2Y31A

Simocyclinone c4 bound form of tetr-like repressor simr
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
PVSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 92
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y31A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y31A02
3GTOJ 3JRIA 1G2HA 3IUVA 4DW6A 5D18A 1JUPA 1JJ8C 3FRQA 3BTCA 2NS7A 1LE8A 2JMWA 2V57A 2NX4A 1WH5A 5IP7J 5FGLA 4L5EA 3HOWJ 1TWGJ 2K9NA 3RZDJ 3GTPJ 2FX0A 3CCYA 1K61A 5HAWA 5M3MJ 2Y31A 2E2IJ 2VI6A 2D5VA 1DU6A 3LOCA 1BJZA 2JA8J 5GPAA 1VNDA 5EGOB 4GCKA 2KT0A 2EZLA 2QKOA 3A02A 5F0CA 4A3DJ 5IP6A 2L7ZA 3HM5A 4UUTA 3VW2A 3GTGJ 5EG0A 3S1MJ 5AQCA 2DMTA 3PM1A 2Y30A 1UMQA 2LD5A 2WGBA 1OCTC 2X9DA 3GTLJ 2YS9A 2TCTA 3CQZJ 3JRDA 1PUFB 3BNIA 4BXXJ 2O9LA 1AHDP 5J1UA 4A3EJ 2ZOZA 1WPKA 2G3BA 2OI8A 4JP0A 2UXUA 4G12A 3AQSA 1QVTA 3PO3J 2MGQA 2O7TA 2YVEA 4L62A 2PBXA 2ZCMA 2QF7A 1ZGWA 3QBMA 2IEKA 3LSJA 3Q0VA 1LE8B 2JA5J 3O60A 3V6GA 4DYCA 2NVXJ 4C2MJ 2QIBA 4IHWA 1ZTRA 2NP5A 4IEJA 2QWTA 1O4XA 3BG9A 4EEFG 5GPCA 1HCRA 1FEXA 2X48A 4JKZA 3VVYA 4MO7A 4BBRJ 4UUSB 2LFBA 2DG7A 2HOAA 4CYCA 2XDNA 2GM4A 5C4YA 3COLA 1LFUP 1JUSA 2ELKA 2XPWA 2G7LA 3H3VK 3G56A 3RD3A 1RKTA 1QRYA 3RH2A 4A3BJ 1APLC 2FD5A 1OFCX 3MNLA 2HOSA 1D5YA 3VPRA 5K7ZA 3B6CA 3LJLA 2E19A 2D6YA 2XSDC 4XRMA 3UKGA 1F36A 4A69C 3HTAA 2QCOA 2XPVA 2K9QA 3FKIJ 3G1MA 4NELA 1JKQC 2HQ5A 2P81A 1IUFA 3EGQA 5HBUA 1H89C 3S2DJ 2N8GA 4LOCA 1U78A 5FLMJ 4A3GJ 3S15J 3S17J 2X6OA 1IG7A 3KNWA 1EF4A 4JX5A 5C4JJ 1GT0C 3I4NJ 2WB1N 4Y52J 4ICHA 2ECBA 1F43A 2REKA 2WUIA 2LR8A 2E2HJ 3V78A 2ECCA 3KZ9A 4MLOA 1TWHJ 4IHXA 1A5JA 5EGOA 4C3JJ 3CWRA 2GFNA 1MBHA 2XGEA 3JSJA 2GLOA 2IU5A 4A3KJ 1WCMJ 2ME6A 3Q0UA 2DMQA 4IHVA 4JX6A 1BW5A 4MFDA 3S5RA 4B4CA 3VIBA 1W0TA 2Y0SN 5M5XJ 1JTXA 2Y2ZA 3I4MJ 3O8GA 1FTZA 1IV6A 2DTZA 3TEDA 4RDUA 1B8IA 3LWJA 1MBFA 3BTLA 3BR6A 1JKOC 2GENA 1JTYA 3GTKJ 4ACIA 2Y9YA 2OPTA 3ZOBA 1ZKGA 1BA5A 5CW8A 2VUMJ 1QVUA 4GFBA 2NVTJ 2ID6A 3TP3A 3EUPA 3DPJA 3A03A 2AHQA 2DA1A 1XS9A 5IOYA 1B72A 2HDDA 2RASA 3VP5A 3BJBA 2VPRA 1RR7A 1ETWA 1WH7A 4PXIA 2HI3A 2EBIA 5E3LA 1TWAJ 5FKOA 4A3LJ 1Y1VJ 1GV2A 3ZQHA 4A3IJ 4A3MJ 1RPWA 4UUSA 5DTDA 2FQ4A 4FCYA 5EFYA 4M6VA 1GUUA 1ORKA 4AC0A 2RAEA 1HLVA 2NP3A 2DA6A 3BCGA 1X2NA 5F08A 1ZR4A 1SGMA 1ITYA 2EZKA 3ZQCA 5FJ8J 1NK2P 3HOVJ 3ZQFA 3GEUA 2E2JJ 3MVPA 4C3HJ 3M4OJ 4V2FA 1JUMA 2CU7A 1B8IB 1MH3A 1WI3A 4MXMA 3SFIA 1X2MA 3DEWA 4BY1J 1XC5A 3JRFA 2HYTA 4XRSG 3HIMA 3D1NI 3B6AA 1H88C 3FK6A 2MW8A 1AU7A 4UDSA 3HTHA 5EF6A 1T56A 3NPIA 3NAUA 4MFEA 2R7ZJ 5DAJA 4FE4A 2DMPA 1RKWA 1B72B 1ETQA 3NNRA 1A6IA 3BR1A 3NRGA 3JRCA 5FHPA 2YU9J 1HOMA 5J1RA 5FLVA 1VI0A 5F27A 2E1OA 2UXOA 2M8GX 5HSZA 1ETVA 3LSRA 4B1RA 5EYRA 5IYDJ 3OSGA 3QKXA 3S1NJ 2OERA 1U9OA 2M0CA 2DJNA 2WV1A 2L0KA 3VVXA 2XRLA 3HOXJ 2HXIA 2XPUA 3PASA 1JT0A 2ZCNA 1GVDA 3FK7A 2KDZA 5F1JA 2CQXA 1HDDC 3G1OA 2L9RA 4Y7NJ 1ZR2A 3HOUJ 3HKZN 4M3EA 5E3NA 5FMPA 1JT6A 2COBA 2JK3A 2G7SA 3S2HJ 1AKHB 2OF7A 5CXGA 5F0FA 2AO9A 3BR3A 3K7AJ 2LK2A 3KKDA 2DG8A 3PO2J 3BR0A 5IYCJ 4M3DA 3BQZA 2ZOYA 4NDLA 4MIMA 3S1RJ 1I6HJ 3JREA 1IRZA 2UXPA 2K9SA 2UXIA 1GV5A 3HOYJ 1ENHA 4IHYA 3CJDA 3P9TA 3JRHA 3JRAA 3FISA 3HE0A 1Q1VA 1OCPA 2IAIA 2K40A 4D5CA 1QPIA 1ETYA 3LHQA 2R93J 4YZEA 3GBGA 1RESA 5FKNA 1MSFC 2Q24A 1SFOJ 2O8KA 4MK6A 2XGDA 3B81A 2MSYA 5FKLA 2FBQA 5J1YA 3MN2A 5E3OA 5K58A 2ID3A 4HKUA 2DA3A 3OOUA 3VOKA 3WHBA 1MBJA 2PZ9A 3K2AA 4M3FA 3NXCA 1IDYA 5C44J 3A01A 5EDNA 1ETXA 2H1KA 1CQTA 3Q0WA 2NVQJ 1JJ6C 1IDZA 4KWAA 2PMZN 1TC3C 3GZIA 2EH3A 4QIWN 3O8HA 1NK3P 4I76A 4HNVA 4QTRA 3T6NA 1UG2A 3IV5A 2LLKA 2WAQN 1UI6A 3NI7A 3HTJA 4DYQA 3HTIA 1S7EA 2M34A 3GTQJ 2NOGA 3HGGA 4B3AA 5JLWA 4W1UA 1NTCA 4XRSA 1MNMC 2ZB9A 2DA7A 3CDLA 5IPAA 1GDTA 3G7RA 3BQYA 4V2GA 4BY7J 2CUFA 3TW6A 1U8BA 3HDDA 2I10A 5HODA 3HGYA 3QPLA 4GFKA 3DCFA 1Z77A 1IC8A 1ZK8A 5IOZA 3LSPA 2F07A 1P7IA 4M3BA 2EZHA 2LTPA 1MBKA 1Y1WJ 3IH4A 1MBGA 1RETA 4DZJA 5JLXA 2CJJA 3HB9A 1MSEC 3ANPA 2DMNA 3GTJJ 3CMYA 4XICA 1XG1A 2HYJA 3C2BA 3HEFA 3LNQA 1X58A 3RKQA 3S16J 3VW0A 2JJ7A 2JN6A 1FIPA 4AUXA 3ON4A 3A01B 2R5ZB 3AQTA 3F1BA 4ABZA 1HF0A 4BKXA 3WHCA 4W97A 3FIWA 5F0HA 2LP0A 4A3CJ 4RBOA 1TWFJ 1AKHA 4NN1A 3ZQLA 2DN0A 2VKVA 2G0EA 1BL0A 1I50J 3S1QJ 2DA4A 4XK4A 1IJWC 2L7FP 3KKCA 1FTTA 4D7NA 2G7GA 4AC6A 4A3FJ 3CRJA 2R5YA 2XGCA 2XB0X 3ON2A 3TP0A 3BTJA 2EZIA 1E3OC 1K83J 2XB5A 1LFBA 1POGA 2IBDA 3G1LA 1FJLA 3BHQA 2QTQA 1P7JA 4ME9A 2NVYJ 2M9HA 2HKUA 1TWCJ 1YRNB 5C4XJ 3BRUA 1R9TJ 4D5FA 3ZQGA 3PPBA 4X6AJ 2CRGA 3IH2A 4JL3A 5H9TA 1IGNA 3VW1A 3JRGA 2FJ1A 2MG4A 2LKXA 5IP9J 3HBLA 3RQIA 3SJMA 4QSHA 2UXHA 4XIDA 2DMUA 2GUHA 5CXIA 3BTIA 2GBYA 2JWTA 4M3GA 3L1PA 1VF9A 3E7LA 2YVHA 1I3QJ 2LVSA 5F04A 4C3IJ 4FTHA 1DU0A 5D19A 1VFCA 3MKLA 1U9NA 1JGGA 4BBSJ 5EG0B 1JKRC 2NS8A 5E3MA 1FIAA 1MBEA 2R5YB 5C3EJ 4I6ZA 3W6VA 1MH4A 2ME0A 2VKEA 4AYBN 2DA5A 2EQRA 2R0QC 2JA6J 2W48A 2O7OA 2TRTA 3C07A 1T33A 2Y9ZA 3BR5A 4S0HB 5EZHA 4GFLA 2R92J 5D1RA 4JX4A 5M5YJ 4A3JJ 1ETKA 2L7MP 2RHAA 5M5WJ 5EZGA 2CUEA 3E7QA 4A93J 4AF5A 2B63J 2LY9A 5GP9A 4GCTA 2JA7J 5DS9A 4J19A 3S14J 5IYBJ 5J3LA 1UHSA 3QQAA 3GTMJ 5K7HA 3SDGA 1Z0XA 9ANTA 2QOPA 3QPSA 3VUQA 1HDPA 4JNNA 3F0CA 3H0GJ 3BR2A 2R5ZA 5FKMA 4DYRA 3TW7A 4CYCB 3JRBA 1ETOA 2YUSA 3VVZA 4GCLA 1JKPC 5K7FA 1W0UA 4D7MA 2HXOA 2M2EA 3VOXA 1H8AC 5BNGA 1BW6A 5FKKA 5EEAA 2H8RA 3BG5A 3BG3A 2W53A 3RZOJ 2ZCXA 3OIOA 3ANGA 1PUFA 3ZQIA 1ZQ3P 1UI5A 4CGRA 3NARA 4FE7A 2DA2A 3JR9A 4DZPA 3Q3SA 5M3FJ 2HOTA 3M3YJ 3HOZJ 3IH3A 3LSGA 1SANA 4JYKA 4X1EA 4FISA 2CQQA 3BT9A 1OJLA 1YRNA 3OSFA 1WGXA
chains in the Genus database with same CATH superfamily
2DFHA 2OQRA 1W5SA 4MTDA 1G2HA 3K10A 1JJ8C 3BTCA 2NS7A 2V57A 4EJUA 1HBXG 3BJ6A 1WH5A 2EA4A 5J8CA 1YO5C 4L5EA 3HOWJ 3WG7H 1SD5A 3GTPJ 2CG4A 2FX0A 3CCYA 2H6CA 3LL7A 1B59A 1O7LA 1G4DA 3KFWX 3ZMTA 4Y33A 2PX9A 1S5LC 2AXTC 3V8LA 4BL0B 5IP6A 3EYYA 2IS1A 1YQAA 2YVXA 1SMYF 4Q47A 2P8TA 4U0VA 4UUTA 2ZO4A 3RKWA 5EG0A 2Y0SA 3HOTA 5K5QA 2JQ7A 2VL8A 2WGBA 4LB5A 2EK5A 1OCTC 1WJDA 2KRCA 3DXJF 4NBQA 2E1MC 2TCTA 2ZFUA 4BXXJ 2EV5A 1JHHA 2WWYA 1AHDP 2Z1DA 1VQ9I 3AL0C 3IUOA 2V1UA 2M5WA 2BZTA 4JP0A 4OWRB 4OINF 3ULQB 1QVTA 1Z91A 2MBFA 3IRRA 1E17A 3AQSA 3FM5A 3U1KA 2PBXA 2ZCMA 1D3YA 4XBFA 1KQ9A 3QBMA 4PJNA 4BQNA 2K3FA 3NRVA 2IEKA 3LSJA 3Q0VA 5H2FC 3O60A 2L9SA 4H4KC 1SFEA 4RLFA 4ESFA 5A2QZ 2XKOA 2NVXJ 2QIBA 6PAXA 4DVYP 4GO1A 2NP5A 2QWTA 4BAYA 1T6SA 2ZNYA 2HPIA 5DV5A 2QSHX 2X48A 4MO7A 4BBRJ 2HOAA 4CYCA 2EINH 4D0PA 2GM4A 4ZDPA 1XGNA 4A6EA 4C9YA 3CC2I 3WGHA 1D0YA 2XPWA 4U0YA 3L7WA 1Y56A 3RH2A 4YRVA 3EDPA 1APLC 1XGOA 5L3BA 2FD5A 2K9LA 3MNLA 2HOSA 5K7ZA 2FQ3A 2LF7A 3LJLA 4U9LA 4A69C 3HZJA 5HNFA 3HTAA 1OQYA 3FKIJ 4IF4A 4CCJA 1ZHFA 4FQGA 4ENNA 5FGMA 1X4OA 4R8HA 2Z2SB 4II2A 1JKQC 4NELA 3E5UA 5CVRA 1D1CA 1E3PA 1X3ZB 2DJIA 2P81A 1IXSB 2CQNA 1PP8F 1LJ9A 5HBUA 2OQGA 2N8GA 4LOCA 4CXFA 3I59B 1YOVB 1D5VA 2CH0A 3L2WA 4XLEA 1MJAA 4JX5A 3I4NJ 2QQAA 3A0BC 2WB1N 3BPXA 4Y52J 3WU2C 2LSOA 2LR8A 1TQIA 1UELB 4XSZF 3OIQA 4AIJA 4IHXA 1R23A 3CWRA 1WJEA 2GFNA 1MBHA 1FWZA 2DQLA 4PJMA 4CZCA 4IRHA 1WCMJ 3NWSA 3SQNA 1W36D 1WQ2A 2ME6A 4F55A 2X1EA 4UV8A 3PJRA 3T1BA 5ED4A 1R1TA 3HKZA 4A5NA 3G4SI 2ZJRF 1IXRC 1B8IA 3BTLA 3BR6A 1JKOC 3NQOA 3AKZA 4KN7X 4ACIA 2A68F 2LBFA 4FT8A 1ZKGA 1K78A 1OCRH 5CW8A 1J9IA 1FOXA 2ID6A 4B43A 5D5UB 1TL8A 3EUPA 1X1AA 2AHQA 4BE2A 2OTLI 2DA1A 2DDAA 3R61A 5HS9A 1FBQA 3OS0A 1VQKI 3K4MA 1WH7A 4WIBA 2L9VA 1GV2A 3ZQHA 4A3IJ 3ERED 4A3MJ 1CF7A 1A36A 3KIOA 5DTDA 1T95A 3W2WA 2KRFA 3VYRB 2A3SA 2NP3A 2RAEA 4ON0A 2DA6A 2F4OB 3HSEA 1OCZH 1ZR4A 3ZQCA 1FOKA 1NK2P 3HOVJ 1IXCA 3OYEA 4C3HJ 1WKMA 3WTWC 2P0WA 2P7CB 4P1WA 4WXDA 1VQLI 4IXAA 1MH3A 3A4CA 3SFIA 2RGVA 3OWTA 5FRMA 2V6CA 5KAIC 3QPTA 3JRFA 2IS4A 2HYTA 2DT6A 3D1NI 4EM2A 2P6TA 3OL3A 2OD5A 3OL4A 1X1PA 2WAQA 1Z3XA 2R7SA 3FK6A 3K1MA 5CQEA 3GWZA 4CHUA 3HTHA 3L2VA 3V8JA 5EF6A 1T56A 3NAUA 4MFEA 1X3WB 2L2OA 4FE4A 2YX7A 4HNUA 3SEZA 1R7JA 1A6IA 1U5TC 4O3MA 5FFZA 1R22A 4GRIA 4ZYGA 2YU9J 3AG1H 5J1RA 4XOTA 5DDGA 4HNTA 2OU2A 4RAGA 4RGSA 4PFOA 2M8GX 2RC4A 2RQPA 3LSRA 2BY3A 4RB2C 3OSGA 3QKXA 3S1NJ 3ESWB 2ESNA 2OERA 2IVMA 1R58A 3R0AA 2DJNA 1Z05A 3HOXJ 2HGCA 2WBMA 2H09A 4NC8A 5DM7F 2A07F 3SZPA 2GWRA 2IPQX 4LIVA 5F1JA 3VYTB 2RV8A 3JCUC 4ZYAA 5FMPA 4M3EA 2HEOA 1FYLA 2XKPA 4CCMA 4EVIA 1ACIA 4RLQA 1JT6A 2JK3A 1FSHA 2G7SA 2X1CA 2PFVA 1O3TA 1AKHB 2HFHA 4G6TB 3FMRA 4IQ4A 5JR3A 1UCRA 4M6XA 4DBQA 4IOCF 3GMEA 1X4PA 3ZQQA 4Q4ZF 2B3WA 2ZFWA 3BR0A 4NUBA 3FMSA 5TGTA 3GF2A 4HQMA 4NDLA 3EQLF 1IRZA 1J09A 2CMPA 2K9SA 2UXIA 4XORA 5LEKA 3CJDA 3P9TA 4ZC3A 2COMA 3FF5A 4II3A 1B1BA 3HE0A 2CS3A 3G6EI 1Q1VA 2IAIA 3CP2A 4PK4A 1QPIA 2VE9A 2HU9A 3VB2A 5EEHA 4NC7A 1V5FA 1OYIA 5ICGA 4KUMA 3GBGA 5FKNA 2BOLA 4E6KG 2Q24A 2EIJH 3KE2A 4FX4A 1R1UA 3B81A 4EATA 2JUGA 2GXAA 3D5LA 1UG0A 3CJRB 1HQCA 3CDIA 3GFLA 3BWGA 3CUQB 3KYLA 1R49A 4HKUA 2DA3A 4XMYA 2F6CA 2KZVA 2XASA 3NXCA 1RC9A 4HX8A 4I02A 5C44J 2MD5A 1IDZA 3TDUC 5DD4A 2HQAA 2ZKZA 3KLOA 2EH3A 4OIOF 4AIDA 4AD9A 1KA8A 4E7JA 1UG2A 4KMUX 3P5JA 1SMTA 1UI6A 1UJ8A 3OYIA 1GHCA 1SVLA 3FXKA 5F1RA 3RSNA 2EV6A 1S7EA 3CUOA 2M34A 3PUFA 2VONA 2LOOA 3EETA 4W1UA 4CCOA 1G59A 4UHTA 2DYRH 2CFOA 3DTEA 1GDTA 1MKMA 3BQYA 1YS6A 1BR4A 2O5RA 2CUFA 2QQ9A 2VQLA 2JRTA 1VQ6I 2UWMA 5DCMB 1O3QA 3WGGA 1AA7A 1BIAA 5IOZA 3LSPA 2R7RA 1P7IA 2ZMEB 2LTPA 1Y1WJ 4I09A 4WK8F 4UXNA 4BJTA 2KHMA 4EM1A 2D2WA 2F2EA 1MSEC 5CPRB 1X1DA 2HYJA 2L01A 1BM9A 3LNQA 4ZYHA 1X58A 3K1PA 4IQJA 5EEGA 3W2AA 1FIPA 4AUXA 3ON4A 2Z33A 3A01B 1WWXA 3ZXSA 2UZKA 3HOSA 4Y3OA 2VBYA 3R0JA 1NHAA 2CV2A 4RBOA 4RAYA 3I3LA 1AKHA 1MJBA 3ZQLA 2OCCH 1I50J 2DA4A 1IJWC 2F4MB 3RQ4A 2G7GA 1SD6A 3NEUA 3H9QA 4UV9A 2R5YA 1U5TA 1V5EA 3HUGB 2EIMH 2LNBA 3HYIA 2EZIA 1E3OC 1HSTA 1FMVA 4N4NB 3KP6A 4AIKA 4I2OA 4DOZA 1POGA 3LSIA 2H94A 2CFXA 4Y13A 1LB2A 2E71A 4XLPF 3O3KA 1ERDA 1B4AA 2PG4A 1TWCJ 2DI3A 1E2XA 4EJOA 3BCBA 3BRUA 1TNSA 3MZ8A 1YYVA 3DQVC 4BNCA 4X6AJ 3OY9A 3RKXA 2HYGD 2IGMA 2F5VA 3K1NA 1OYWA 1EKEA 3SJMA 4QSHA 1QBJA 4XIDA 5BPDA 2GXBA 2QKMB 3BTIA 2BVLA 5DM6F 1W5CC 1VF9A 2W00A 5A2QK 3ZRGA 5F04A 1DU0A 1VFCA 1FSEA 2DDBA 4S05A 4G7OF 1JKRC 1FIAA 3VTIA 4BJ6C 5LGUA 2O03A 2R0QC 3GZ5A 2EB7A 2O7OA 2IXSA 2X51A 5KCMA 2B1EA 3C07A 4U9NA 3BR5A 2A5WA 1NG7A 1QU3A 3BJAA 3IRQA 1MGTA 4JX4A 3FMQA 1ETKA 5CJ9A 4CH7A 3CCJI 5EZGA 3E7QA 2FE3A 2K9MA 5HDGA 4AF5A 5DCMA 5GP9A 1LUJB 2JA7J 1G8XA 3LQQA 3KZZA 3TBIA 3WODF 4KIFA 3WE2A 3VODA 2KDOA 2L02A 1MDMB 2ZMEA 3C7JA 2GXGA 1UHSA 1DGRM 3QQAA 4OIRF 3GTMJ 1Z0XA 5B1AH 1UB9A 2FBKA 2R7FA 3BC8A 4KITB 1L0OC 1FNNA 1RZ4A 2KKOA 2VT2A 1S6LA 1HC8A 3TW7A 3OS2A 1I39A 1XGMA 2A6TA 3HC7A 1HW2A 5AIQA 5K7FA 4BXFA 3ZPLA 3Q9VA 2HDWA 5JVGF 1WI9A 2IP2A 1S7AA 2K4BA 4H0EA 5FKKA 2V1XA 2F5FA 2STWA 3BG5A 2R4GA 2R7TA 2DPUA 3R60A 3RZOJ 3HUGA 2VJIA 1D0ZA 5BS6A 2QM3A 4OD5A 3NARA 3JR9A 4DZPA 3Q3SA 2HOTA 3AFHA 2R7VA 1P92A 2LDUA 4RB1A 3WTTC 4GCVA 4FISA 4UVBA 4FASD 3JRIA 2HVQA 2XSJC 3IC7A 2JMWA 1Y6IA 2WB1A 2NX4A 1TW3A 5FGLA 2K9NA 4DBRA 2EWNA 1ZG1A 5LD2C 2XAGA 2DQRA 2VI6A 1V4RA 1DU6A 3LOCA 1BJZA 3DKYA 1EH7A 2F4IA 1O3RA 3ZR8X 2QKOA 3A02A 2ZY9A 4KIGA 4B48A 3HM5A 4DIQA 4M73A 2JSPA 4NQWB 2V4JC 3S1MJ 5J40A 3PSFA 1S3JA 2Y30A 2LD5A 2V7FA 1BC7C 2CUZA 2X9DA 3OMYA 3GTLJ 3OYNA 3R6SA 3JRDA 1BI1A 4OAYA 3W6KB 2V1NA 4PCQA 1G3YA 3ZMDA 2G3BA 2V26A 3H3UA 1LEAA 2PLYA 4G12A 1RR8C 4L62A 3I4PA 4GYIA 4GGGA 1IW7F 2K7LA 1MDMA 4HV5A 2NVUB 5CQGA 2VKDA 1T0FC 5J47A 2NOJB 4DYCA 3RTRA 3DPTA 2L7KA 2CGPA 3F8NA 3DTKA 1O4XA 1N77A 1YX3A 3BG9A 1O7FA 2FEZA 5GPCA 1HCRA 1ZAOA 1FEXA 1BIBA 1Q1HA 3Q9SA 3VVYA 4XKCA 3GXOA 4KJZA 4PJLA 2FU4A 2GOMA 5E20A 4L9TA 4KA4A 3COLA 3OYAA 3GFJA 1HXDA 1LFUP 2HNHA 1EH8A 2Z16A 3S93A 2FMLA 1VZ0A 2Q8KA 1RIOH 2D1VA 4G9YA 4A3BJ 1OFCX 4PGGA 3CLQA 3VPRA 1MNEA 3CTAA 3CCRI 4A5MA 2XSDC 4XRMA 2KP6A 2KIMA 1F36A 2IGOA 3O2PE 4MQ9F 1BN5A 2QCOA 2XPVA 3MD2A 1S29A 4LD5A 5DUKA 3WTSC 3ABMH 3F21A 4ZDOA 4WXCA 2CW8A 5FLXZ 3K4KA 3QWLA 1XN7A 3K4LA 1DDNA 2LY1A 1T39A 5CVUA 3SEQA 3EGQA 4QWQA 4EJTA 1FBSA 5D8LB 1U78A 4A3GJ 1QNTA 2XAJA 3S17J 3COAC 1D1BA 2QYOA 1IG7A 3PFIA 2XGXA 2DBBA 5C4JJ 1GT0C 4ICHA 3D5RC 4BQOA 1RUOA 2ECBA 1QZEA 1LDKB 4LMYA 2CV1A 4P9FA 2ZXWH 4MLOA 1Z7UA 2GOXB 1BI3A 2XGEA 2STTA 1D1AA 3JSJA 4F7ZA 2IU5A 3WTXC 4IZZA 1BOBA 3LMMA 4EM0B 3Q0UA 2DMQA 1MZBA 4JX6A 5BOXA 3S5RA 2CQKA 3C1DA 5HS7A 1JTXA 2Y2ZA 4HSRA 3O8GA 1FTZA 3JSOA 1IV6A 2DTZA 3P7NA 3RJPA 3TEDA 4RDUA 5L3EA 1MBFA 4Q48A 3F8CA 2P5KA 1ODDA 2XVCA 2AQEA 1JTYA 4HBLA 2Y9YA 3KP4A 4E7ZA 5BMZA 1MMSA 4BE1A 1REPC 3VWBA 3H3ZA 1UAAA 4ZTJA 1EH6A 4A0YA 2NVTJ 4G6QA 2HKOA 3VEPA 1Y8QB 3KYDB 4M71A 2RN7A 2VQCA 3A03A 5H20A 4J01A 2PQ8A 1XS9A 1B72A 2HDDA 2XAUA 1YW8A 3OS1A 1FBUA 4PXIA 5E3LA 5FKOA 2FOKA 3PIPF 3V8KA 1T8IA 4XNFA 2FQ4A 2PEXA 3MKYB 4L0ZB 3CESA 1HLVA 5GTHC 3QYFA 2O61A 3KZIC 2XROA 4YIFA 1LVKA 1SGMA 3A2KA 5FJ8J 3FXUA 3HRSA 5LEJA 1YIOA 2J5PA 1VTNC 2E2JJ 3GEUA 4XN0A 2V6EA 1F5TA 1ZRCA 4V2FA 1BI2A 2LRDA 4BDZA 5E1ZB 1B8IB 2HTJA 1WI3A 4RAZA 4ZZLA 2Q2EB 2LBFB 4LGWA 4ASNA 5J4VA 4YEJA 4R79A 4XRSG 1K78B 4IO9F 3B6AA 1GXQA 1N75A 2BY1A 1T0FA 3HHHA 1L3LA 1H88C 2MW8A 1AU7A 4UDSA 1YG2A 2EFPA 5D5XB 1RKWA 2EILH 3CCMI 3QOPA 5D4SA 2WAEA 2FBIA 3H0DA 5FHPA 3CZ6A 1QQIA 1JHFA 1HW5A 3M8FA 1CF7B 2EFOA 4CGZA 5L3FA 2E1OA 4YIIA 2QVOA 2GZWA 4B1RA 1DUXC 1YI2I 5D8KB 2E1MB 3DPUA 2CW0F 2HTSA 3GFMA 3VVXA 2ISZA 3MAJA 3AL0B 2IGKA 4PSWA 2XPUA 1QHHD 1W1WE 4PDKA 1GVDA 4HF1A 4RAFA 3PL8A 1LDDA 1FX7A 4Y7NJ 1ZGJA 3BLYA 3K69A 2VLAA 3KLNA 2OCEA 1B6AA 5LHHA 3S2HJ 1SVMA 5CXGA 1USTA 5KNLA 4MHGA 5E17F 1FY7A 2LK2A 4NHJA 2DG8A 1DPRA 3PO2J 2IT0A 4M3DA 2E34A 5K5OA 2GAUA 2KRHA 3S1RJ 2QZ8A 3JREA 1GV5A 2RQQA 4CCLA 3HOYJ 4FETA 3ZN1A 4L0YB 4FHTA 4E7LA 5LRSA 3QP6A 3JRAA 3H5AA 3FISA 1OCPA 2CV0A 1F9NA 4X0GA 3LFUA 2A6HF 3ASNH 1ETYA 3K4CA 1VQ4I 1F1ZA 5LRRA 4HEA2 1MSFC 4L18B 4MK6A 2XGDA 2FBQA 3ELKA 2KIQA 2M7BA 2CO5A 3MN2A 2L54A 2KL4A 3ZQ7A 2ID3A 1X3UA 3OOUA 2F48A 4BYYA 2ETHA 1MBJA 1XGSA 2FSWA 4D1QA 5HOOA 3NS4A 3K2AA 1IDYA 1XX5A 2I5UA 3AG3H 3BP8A 3GCMA 1UHWA 2Q2EA 4XKBA 3AG2H 1ZH5A 2IA2A 1TC3C 2V9PA 1MMAA 3M07A 5L3CA 1HKQA 1NK3P 4I76A 3ASOH 3T6NA 3CMEI 1DGWY 5HNHA 3H5NA 3LSHA 3CF5F 3HTIA 4YFKF 5D5WB 5JLWA 4AM3A 4QPOA 2HQRA 2W82A 4I7HA 4XRSA 2CUJA 2DA7A 3ML6A 3G7RA 3GO5A 1C0WA 3TW6A 4LITA 5FO5A 3HDDA 2JRMA 2MC4A 3HGYA 3H1CA 5LGNA 1I27A 5E18F 1ZK8A 4KT6A 1MW7A 3KETA 4IRIA 3IH4A 2DXIA 1RETA 1ULYA 2CJJA 2UXXA 3ANPA 2VXDA 4U88A 4XICA 1XG1A 4PZJA 1D0XA 1Z1DA 1ZG3A 2QEXI 3S16J 3DEUA 3GLLA 1YITI 1MJ9A 2HYFA 3M1EA 3TOBA 1IN6A 4Y4RA 4W97A 3HG9A 2VKVA 2G0EA 3SZGA 1R5GA 4XK4A 3WU1B 2IA0A 5CVVA 4XLNF 2BW3B 2H6BA 2MD0A 2XB0X 2Z99A 4AU7A 1ON1A 5D4RA 2ADUA 2DYSH 4EGZA 1A6QA 1K83J 2XB5A 2X6XA 2W84A 5HVQC 4I99C 3J80Z 2KIUA 2IBDA 3BHQA 4BS9A 2QTQA 1XPXA 1U2WA 1TBXA 2NVYJ 2M9HA 4N4OB 1D8JA 3RYPA 2KFDA 4U0WA 3BY6A 3RIRA 2HKUA 1H9GA 4XN3A 4LJZF 5D6FA 2L4MA 1BBYA 4YG2F 3KEQA 2OA4A 3ZQGA 3K4JA 4O5VA 1JE8A 3IH2A 1G3TA 4GDFA 5CKTA 4IRGA 2C6YA 1MMNA 1J5YA 1YTYA 1V54H 3RQIA 4AWXB 2W1OA 4XR6A 5B3SH 2UXHA 3WE3A 3CJNA 3I53A 2GUHA 4LG0A 3HSRA 4RB3C 3K0LA 3H5RA 3TO7A 1YIJI 4YELA 2VOPA 1QGPA 2DCEA 3I55I 3E0JB 2YVHA 2DU9A 1V3FA 1SAUA 2LVSA 4C3IJ 3HL2A 5E79C 2F5CA 4FTHA 5K5RA 1ZN2A 4ENJA 1U9NA 2VXZA 3QU3A 1K79A 1EA3A 3SYTA 2R5YB 1MBEA 3PQJA 3PNTA 1U5TB 5C3EJ 3WTVC 3JTGA 1MH4A 4AYBN 2EJRA 2VKEA 4I6ZA 1A35A 1SD4A 5HLGA 2AXLA 2M3AA 2M8EA 4CCKA 4ZH4F 2JA6J 2TRTA 4E7SA 5EZHA 3DLLF 3FXQA 5ICEA 4A3JJ 1E0EA 2L7MP 5M5WJ 2CUEA 2X1DA 2B63J 3E6MA 4GCTA 1BR1A 4UVAA 3H9JA 1EJ9A 1B9MA 2YU3A 3P9IA 4MEXF 3ZGKA 1ZYRF 2XUBA 3C2HA 3K70C 1QPMA 2A05A 3WTYC 1LVAA 2R7XA 5FLXK 3CC4I 3FXMA 4D9JA 3H0GJ 3HHGA 3DTIA 2VJJA 2QLZA 3AAFA 4HRIA 1WZ2A 1ETOA 2YUSA 1OPCA 4YFXF 1PP7U 3GLXA 2PJRA 1W0UA 1TLHB 2BVMA 2HXOA 5FB2A 2M2EA 4HSTA 2NS0A 2XAFA 4B3XA 1JI8A 1H8AC 3DBLB 2PJPA 2R3SA 2BW3A 5BNGA 3IWFA 4G94A 5BQTA 1SC7A 4IX7A 1PUFA 3ZQIA 4CGRA 2XAQA 5JVTA 5M3FJ 5FRNA 2LY2A 4E7IA 4QLCU 3IH3A 2NNNA 3KP5A 1YS7A 5CYVA 1JGSA 3FHNA 4G6DA 5H6QA 4BACA 5FFXA 5IT3A 3OSFA 1Y0NA 2E1NA 5TISC 1WGXA 3LAJA 3IUVA 4JQFA 3WGIA 5BPIA 2MLGA 1JUPA 2IGNA 3FRQA 5FD6A 1LE8A 3VSLA 3M8JA 2OAZA 1Z6TA 3GZ6A 3RZDJ 3FDYA 1WFXA 4WF2A 5M3MJ 3F22A 2ISYA 3CMAI 2P6SA 2ZSIB 3ABKH 3OYJA 2IRFG 1LNWA 4GCKA 3C18A 2R7QA 3M1CA 5F0CA 4A3DJ 1TP4A 4B47A 3OYBA 1P2FA 1UZCA 2X6YA 3VW2A 4IHSA 5AQCA 5E1WA 1ZG5A 3BPVA 2DMTA 3KP2A 3OOPA 2VASA 4CUGA 2YS9A 1Z21A 3CQZJ 2FF4A 2K5CA 5DUIA 3ABTA 3CD6I 2O9LA 2HZTA 1USSA 3T5XA 2D45A 4KNYA 1I6XA 1WPKA 3E6DA 4XSXF 3U21A 4E7KA 1VQOI 3DBHB 2WC2A 2UXUA 2VQHA 3PO3J 1PJRA 2MGQA 3CF2A 4XLAA 2O7TA 3TQNA 1H0MA 2QF7A 3F3XA 1QHGA 1ZGWA 3GUDA 1QZYA 5H6RA 1MMDA 4PFPA 3V6GA 2HS5A 2B0LA 3VYSB 1ZTRA 4IEJA 3F8MA 2K02A 4JKZA 2JT1A 2LFBA 2DG7A 1R4NB 3VFZA 3ISPA 3DLAA 1IZ1A 1KYWA 4F91B 2ELKA 3PUBA 3KCCA 4XKWA 1R71A 3H3VK 3G56A 3FXJA 1RKTA 2VODA 3K8PC 1FLIA 1D5YA 4Q5SF 3B6CA 1EV7A 3UR3C 2BV6A 5J6XA 3I64A 2K9QA 3G1MA 4OAZA 5E8IA 3PFYA 3BOQA 4BHCA 5ILUA 2HQ5A 1VQPI 3EUKL 4WCGA 4ZDLA 1W5TA 4BDYA 1IO2A 1IUFA 1H89C 3S2DJ 3JW4A 3CCSI 3KYCB 4GXOA 3S15J 4MQVA 3OV8A 3KNWA 4BQQA 5ILSA 3I0TA 3AG4H 5DEQA 1GXPA 4B09A 5LLQA 1FYMA 3REOA 2P5LC 3KZ9A 1TWHJ 4U87A 3KEYA 1S8NA 4C3JJ 1RRJA 1UHMA 3EPZA 4NC6A 1XMAA 3FXRA 2JZYA 2M45A 1I5ZA 3E5XA 3HRUA 2Y0MA 4AIHA 1MIJA 3BG7A 1ZRDA 4KIBA 4B4CA 2QSGX 3OYFA 3ZN0A 5M5XJ 5KVRA 2FMYA 3I4MJ 4ZYDA 4LFUA 4C30A 2BY2A 1R00A 1G3WA 1J2XA 3C3WA 2GENA 3CP8A 2PMUA 2OZ6A 3KX2A 3GTKJ 3K2ZA 2OPTA 3ZOBA 2WADA 2FOWA 2X85A 4RGUA 5F64A 1BA5A 4OD4A 1P9QC 3HTUA 1QVUA 5IT9K 4BE0A 4U7DA 3LQRA 5FD5A 1IN4A 1S7OA 2BE5F 2VKHA 2EA2A 1FZPB 3IKVA 5IOYA 2RASA 1RI7A 2DK8A 4F3QA 4F52A 2XDVA 1QA6A 3BJBA 3VP5A 2QKLB 1RR7A 1ETWA 1YX5A 2EBIA 3I71A 4HF0A 4BUPA 4C2UA 3ECHA 2M0MA 2L9NA 1X19A 2W57A 1YW9A 3LFKA 4M72A 4RGXA 1XSDA 1DQUA 1N25A 1J0RA 1ORKA 4AC0A 3BCGA 5HLTA 1X2NA 4PJ0C 4KMFA 1ITYA 2QENA 3S3NA 2LKPA 3ZQFA 4EV0A 4E7HA 4HF2A 3M4OJ 3M8EA 3I56I 1DP3A 2YX4A 1OCOH 3F6VA 1JUMA 1KU7A 4P96A 3IHUA 3RPUD 4MXMA 5B66C 4XQFA 3DEWA 4IVNA 1XC5A 3RYRA 4V19K 4RMNA 4BHPA 3TOAA 4F92B 2JPBA 2ZNZA 3VOEA 2DMPA 4I01A 1B72B 3MWMA 2FNPA 2MC3A 3FWEA 3NRGA 3JRCA 2LKSA 5LGTA 4JOMA 2HKXA 2PBIA 4OIQF 1XCVA 2ZJ2A 5FLVA 2LG4A 4WXHA 3QP5A 2UXOA 5HSZA 3OYGA 5IYDJ 5EYRA 2KJBA 5JHFA 4MNUA 1K6YA 1U8RA 3W2VA 3J80K 1U9OA 2WV1A 2MH2A 2XRLA 3MQ0A 1QZZA 3Q5FA 2E36A 2HXIA 3PASA 3GYHX 3CJQB 3JSPA 3FK7A 3W6JB 2KDZA 2R7UA 2WY8Q 3G1OA 3FBIB 4L9JA 3SHFA 3OYKA 1ZR2A 1HDDC 1UFMA 2DT7B 2Y75A 5E3NA 3MZHA 3F9KA 5TJJA 2W25A 2COBA 2Z9OA 1ZLKA 3BZKA 2OF7A 2KISA 5F0FA 2MYSA 2AO9A 3BR3A 3L2CA 3K7AJ 3V42A 2HPMA 5GAGJ 3KKDA 2DODA 3V7SA 1R6RA 2WAFA 3ABUA 2MH9A 2YR2A 2XHKA 5IYCJ 5TRDA 3BQZA 1WJFA 3HXLA 2ZOYA 4MIMA 2NAZA 2QQ8A 4HA8A 4IHYA 1U0JA 2CWEA 4CDGA 5KHDA 2XC7A 3QYBA 2JSCA 3T8TA 5J8FA 3R4KA 3F23A 2QBYA 4UB6C 4HDUA 4B8XA 2ELJA 1X1BA 4D5CA 1LQ1A 2R93J 3MKWB 3ROUA 1X1CA 4IJAA 4KYWA 4YZEA 4CICA 1XMXA 2Q1ZB 3PNVA 3HPHA 1MMGA 2O8KA 5FKLA 5J1YA 2IW5A 2XF6A 3RKYA 5JI6A 5E3OA 1QO0D 3VOKA 3WHBA 2XF7A 5KK1A 5ERIA 5GAEJ 1R36A 4N9HA 2F5EA 1YFHA 3KEOA 1DPUA 4C2MA 3WG9A 3FHZA 1WJ5A 5EDNA 3DFGA 1GLNA 1ETXA 2A69F 2MLKA 3G2BA 3HPGA 3Q0WA 1CQTA 4XOPA 4BXUA 1TT0A 4LIUA 4KWAA 3CO6C 3M9AA 3GZIA 2E5NA 2XF5A 3O8HA 3QODA 3HTSB 4AYBA 4LLLA 3LAPA 4JBAA 3I9V2 1IF1A 1Z3YA 3BZ6A 1OMIA 1W7PA 2VB6A 3NWTA 3NI7A 4A0ZA 2EIKH 2NOGA 4HYEA 4HLYA 1OR7C 2PMHA 4CA0A 2ZB9A 2E35A 4ZYEA 2EPFA 1VQMI 5EJCA 3CDLA 3LWFA 3G3ZA 2ZJPF 4HOBA 4V2GA 1XMKA 2GIZA 2I8DA 2OUMA 4BY7J 1KZHA 3TO9A 2I10A 3U1DA 1HW1A 4GFKA 2W24A 4KFCA 2F07A 4M3BA 2EZHA 4B44A 1MBKA 4ZJZA 4WX9A 2M4KA 1K7AA 3HB9A 3TGNA 1VQ5I 3GTJJ 3CMYA 2DFEA 3HEFA 2JJ7A 2JN6A 1FMWA 3SWHA 4XL9A 3AQTA 5K1YA 4M9SA 1HF0A 4XRFA 5F0HA 4A3CJ 1ON2A 2PI0A 1K4TA 2QUFA 4NN1A 1AOYA 3H35A 2KIFA 2DN0A 3RPUA 2JVHA 1BL0A 2QA4I 3S1QJ 3CRJA 3OYDA 2R7OA 2WA0A 2DW4A 3CCUI 3TP0A 4CYDA 2EV0A 4J00A 4OMYA 1LFBA 4LK0F 1BOAA 3E3VA 4KN4X 3S32A 1HA8A 3T0YA 3F8FA 2H1LA 1P7JA 4ME9A 2BBYA 4RA2A 4OIPF 2RDPA 3J81Z 1ONVA 2IJLA 3E97A 4ETSA 5L3GA 2VBZA 4D5FA 2LMDA 3PPBA 4I0BA 2CRGA 3JAMK 1MNDA 3K6GA 5AONA 2Y48A 3OYHA 2FJ1A 4OU0A 3MKZA 2PFBA 3KPHA 2AS5F 5IP9J 3HBLA 4EJVA 2DTRA 4AVPA 2M7AA 2JWTA 4M3GA 3E7LA 4U7BA 4HDVA 4G7ZF 2E60A 3GZNB 1YHQI 2HR3A 3N05A 3BCAA 3V4GA 3L2RA 1KU2A 2TDXA 2ZCWA 2W7NA 4EQQA 3ZP5A 1IUYA 3FBNB 1ZLJA 2NS8A 4PGHA 3L9FA 3W6VA 2ME0A 1MD0A 3GEZA 2EFQA 3HSFA 1XSVA 2DA5A 2WTEA 4EMSA 2W48A 3RCOA 4YIRX 4N0BA 4S0HB 4DGWB 1R5ID 2CW7A 2GIVA 4BU2A 4CSWA 2LH9A 2ELHA 3UNGC 3V7RA 2R92J 2RHAA 1IN8A 2M1BA 2LY9A 5DS9A 4J19A 3S14J 2Z5UA 5IYBJ 5J3LA 1KQ0A 1P4XA 3TL4X 2IS6A 3SDGA 1ZARA 9ANTA 3EUHC 3QPSA 1WJAA 2UUZA 3VUQA 5LHIA 2E5ZA 2VOOA 4E70A 3EYIA 3U9GA 2ICWG 1ZELA 4XLCA 3IP4B 4JNNA 3F0CA 2H27A 4LG0B 5IT9Z 4RB0A 1OCCH 2DOEA 4LB6B 5FKMA 1J59A 3IAS2 4A6DA 3JRBA 3OYCA 2K4JA 3VVZA 5DYMA 2DT5A 1JKPC 4D7MA 1LFPA 1YJ9I 3VOXA 3N97A 2ZC2A 1OLTA 1OYYA 3O6BB 3VDXA 2XV4S 3A0HC 1BW6A 5ICCA 3LA7A 2QQBA 2W53A 1OR7A 2HVRA 3OIOA 4KT5C 3ANGA 1A04A 1UI5A 2LYCA 3L2UA 4FE7A 2DA2A 2DOAA 2WV0A 4UY8I 1PDNC 2KZGA 2BXYA 1W36C 3M3YJ 4S04A 1IRXA 4L5JA 2J5OA 1SANA 3FX3A 3L2QA 1FC3A 4M9ZA 1H9TA 3GFIA 3E6CC 1IN7A 2CQQA 3BT9A 1OJLA 2X0LA 4UB8C 2JTVA 4QPQA 2DO7A 3WHCA 3GTOJ 4DW6A 5D18A 2PN6A 1TQMA 5CLSA 2BHZA 3FZVA 2DFIA 2BHYA 2V9VA 2OV7A 5IP7J 3DP7A 3GW2A 2VT3A 3C2GA 1TWGJ 4XLFA 1K61A 5HAWA 2Y31A 4HPQA 2E2IJ 1LEBA 1N78A 2D5VA 4OMZA 2JA8J 5GPAA 1VNDA 5EGOB 1FYKA 4P5OA 2KT0A 2EZLA 2OTJI 3PQKA 2PJRB 2B9SA 2ACJA 1CGPA 1TTYA 2P4WA 2L7ZA 2YSRA 2VBWA 2DK5A 2Q0OA 3HRMA 3GTGJ 3OR1C 1WSUA 1I1SA 1Y0UA 2CQ7A 3PM1A 1UMQA 2MFZA 2R7DA 2ZJQF 1TNTA 3MCZA 5J4YA 3DEEA 3GX4X 1PUFB 3A1YA 3BNIA 2O3FA 1FP1D 5J1UA 4A3EJ 2LC2A 2ZOZA 3BZCA 1HKTA 2E7XA 2PMZA 3QYEA 2RKHA 1WVRA 2OI8A 3FKJA 1XDSA 2YVEA 3IWZA 3DWLE 3P9CA 4TV7A 5HLHA 1HSJA 3IL2A 3J7AY 4ZZDA 4IOAF 1LE8B 4BGDA 3I59A 5KAFC 2JA5J 3L09A 4C2MJ 2ZSHB 4IHWA 2QWWA 2A2FX 1K4SA 1IN5A 3K4NA 2NYXA 1JXSA 4EEFG 3L00A 1OISA 4XM3A 4UUSB 3D0SA 2XDNA 5C4YA 3HRTA 1PVEA 1XDUA 2QSFX 4IKFA 1JUSA 1IRFA 3ZMSA 3JTHA 2G7LA 4LLNA 3RD3A 1QRYA 2HZDA 1A31A 1ZREA 2E1CA 2GA2A 5D5VB 1WHUA 3SXYA 5FROA 4HX4A 4CO8A 5HS8A 2E19A 2IA1A 2D6YA 3CUQC 3UKGA 4G8XA 4RGRA 2ZXHA 1T38A 1K6OA 1SD7A 3K70D 2KQRA 3QOEA 4AVZA 2JA2A 4BJ5C 1P4AA 3EUHA 3KP3A 3S3OA 5FLMJ 2K27A 2NXNB 1KU3A 2X6OA 1EF4A 2KLOA 4OOIA 1I1GA 1F43A 2REKA 2WUIA 4KICA 1OKRA 2E2HJ 3CCLI 3V78A 1YJNI 2ECCA 1A5JA 5EGOA 2VBXA 4ENMA 4A2UA 4EGYA 4LLGF 3MFKA 1KONA 4I0AA 3J7AO 2GLOA 4A3KJ 1SVOA 2X6WA 2R7WA 2FRHA 2O8XA 1T2KA 1BW5A 1G6NA 2ZXJA 3CCVI 4IHVA 4MFDA 3BROA 4RS8A 3OYMA 3OIPA 3VIBA 2ZMEC 2Y0SN 2FA5A 1W0TA 3K4BA 1SFXA 4IRVA 4ZTFA 3DPLC 3LWJA 2A6EF 2DFFA 1XSXA 3I58A 4ESBA 1BI0A 2KPMA 3ERMA 4KDPA 2K3PA 2BXZA 4CZZA 1TQPA 4L9NA 3CC7I 4HG2A 5ILVA 1U3EM 5D6EA 1YJWI 2VUMJ 4GFBA 2G9WA 1LDJA 4Z6YA 1SAXA 3TP3A 2M4GA 2ZXIA 4R1HA 2RREA 3DPJA 1IRGA 3ONQA 4MEYF 4HQEA 1TT5B 2VPRA 2FUG2 4RM2A 3VSKA 1DP7P 2HI3A 1YE9A 1TWAJ 1E3HA 4A3LJ 1Y1VJ 2L5QA 2P7VB 3LSTA 1RPWA 4UUSA 2FXAA 3CMMA 4FCYA 5EFYA 3LA2A 4M6VA 4BHBA 3MZYA 1GUUA 1VQ8I 1KYZA 4WWCA 5F08A 4XLHA 2EZKA 3KZYA 3MVPA 1FPQA 3VYUB 2QGUA 3IKTA 2CU7A 3I5UA 3ZCOA 3BJOA 5E1XA 4CCNA 2EFNA 3ZMZA 2AQFA 3JAMZ 4G7HF 1TW2A 1X2MA 2P5VA 4BY1J 3V7CA 3BG6A 1R1VA 3HIMA 2G7HA 3FM3A 1J7KA 1Z6RA 3LA3A 4PSXA 1R5HA 1XD7A 3NPIA 5DAJA 4Y17A 2R7ZJ 1FT9A 1ETQA 3G71I 3NNRA 2HOEA 5HDKA 1IAWA 3BR1A 1SEUA 3U2RA 3H36A 5GADJ 1HOMA 2Z3YA 2GA1A 1VI0A 1Z7LA 5F27A 3CCEI 1BJAA 2MABA 3D5SC 1ETVA 2BEOA 5AIPA 3WU0A 4RM3A 4BEHB 1XTAA 1KGSA 5ICFA 4A0XA 3W3CA 2M0CA 3KP7A 1SFKA 2L0KA 5LHGA 3J7YJ 3CUQA 1S72I 4DJAA 3J81K 4JK1X 2DAOA 1JT0A 2ZCNA 3F8BA 2VPLA 2CQXA 2L9RA 3S2WA 1P6RA 3CLOA 5F6FA 3HKZN 3HOUJ 4MTEA 5DCFA 4L5IA 3TMOA 3K9TA 1T08B 3B02A 2W4SA 4DQ2A 1T98A 4PUSA 4O6JA 4BQAA 1KU9A 1O57A 4HV6A 2K85A 3M7GA 3E1SA 3OYLA 2YPRA 1WRJA 1Y39A 1GVJA 1I6HJ 2MA3A 3GVAA 2UXPA 4ENKA 4MGRA 4C2TA 2W85A 1ENHA 1G3SA 1V5GA 2XAHA 3BDDA 4UUVA 1BR2A 3JRHA 1WJBA 1PUEE 1Y8RB 3MEXA 4IL6C 1XB4A 1PYVA 2K40A 3PSIA 4Z2YA 3T8RA 2WY7Q 3LHQA 4I98B 2O6GE 1RESA 1SFOJ 2MSYA 4ANJA 1ZRFA 2XIGA 4YFNF 5K58A 3P9KA 4LG3A 2JPCA 5JFRA 1R4MB 4HX7A 3ZMVA 2UXNA 2PZ9A 2OJED 3LSKA 4M3FA 3ABLH 3A01A 1D8KA 2H1KA 3DV8A 4UVCA 2NVQJ 3IAM2 1NH3A 2VIXA 1JJ6C 2GQQA 2PMZN 1W7PD 4QIWN 4HNVA 1ZGAA 3ECOA 4QTRA 1SFUA 3IV5A 1NG6A 2LLKA 2WAQN 4K2EA 4L9VA 2LREA 3HJEA 3QU6A 4IHTA 3HTJA 2VN2A 3PNYA 4DYQA 2XRNA 3GTQJ 2RNGA 1P4WA 3HGGA 4B3AA 1NTCA 1MNMC 1S9HA 5IPAA 4FX0A 2QBYB 2L4AA 2V1DA 4NB5A 1V55H 2G7UA 2H8WA 3DU6A 1U8BA 5HODA 3F72A 3TKYA 3QPLA 3DCFA 1Z77A 4BEHA 1IC8A 2OZUA 3N4MA 5B5EC 2LF8A 2DPDA 4A12A 1J75A 1HKSA 1MBGA 4DZJA 5JLXA 1BC8C 2DMNA 4DNCA 1YLFA 3C2BA 3LSMA 1LKXA 3DF8A 4HLXA 4P9UA 3OR2C 3RKQA 3VW0A 3CDHA 2M87A 4LK1F 2DOFA 3S3MA 2R5ZB 3F1BA 2BY0A 3ZMUA 4ABZA 4N9IA 3TDZC 2RNJA 4BKXA 5IY5H 2HWVA 3FIWA 2LP0A 2UV1A 3EUAA 1TWFJ 2F5DA 2BGCA 3PIOF 2L7FP 3H92A 4P55A 4IPAA 3KKCA 1FTTA 4D7NA 4AC6A 4A3FJ 2XGCA 1W7PB 2IS2A 3ON2A 5HLIA 2X4HA 3BTJA 5JHUA 2RVCA 4HAMA 2O0YA 2JUCA 4EJWA 4HZFA 4ESJA 2VC0A 2VC1A 1I3AA 3RDIA 1VQ7I 3G1LA 2CSOA 1FJLA 5E8GA 4XKVA 1W4MA 3CJTB 2OC6A 1YRNB 5C4XJ 2D1HA 2NNYA 1R9TJ 2EFWA 3MMYB 3CCQI 3H9GA 2DLLA 3S8PA 4JL3A 5H9TA 1Z9CA 1IGNA 3VW1A 3JRGA 2CYYA 1WJCA 2MG4A 3WTUC 2FNAA 2LKXA 5HDNA 1FOWA 1RNLA 4M74A 2FBHA 3FXLA 2DMUA 3HIFA 2B7EA 5CXIA 1XCBA 2GBYA 3L1PA 2OBPA 4PJJA 1IV8A 3QRFF 3E6BA 2FJI1 3F6OA 2KJCA 1O3SA 1LPQA 5B1BH 2V79A 3I54A 3DBRB 1I3QJ 5D19A 2VJ4A 2ZBKA 4Y15A 3MKLA 3QAHA 5CVJA 1JGGA 4BBSJ 5EG0B 5L3DA 1YW7A 1VQNI 3J7ZI 1M1EB 5E3MA 3DKXA 3DU5A 3SZTA 3FXOA 1FP2A 5LBQA 1KQ8A 2EQRA 3B73A 1U6GA 2E7WA 5CVIA 1T33A 1FOYA 2Y9ZA 3X2QH 4GFLA 2HDCA 4E4HA 5D1RA 3E5QA 5M5YJ 2K86A 4M9XA 4A93J 1F4KA 3DKWA 4HW0A 2A5YB 1RUNA 2HQNA 5K7HA 2V9KA 3CO7C 2QOPA 2VE8A 4ITVA 2KMUA 5DD8A 5GTIC 1HDPA 1B9NA 3BR2A 5GAHJ 2R5ZA 1STZA 4DYRA 4CYCB 4BH9A 3G73A 3WTZA 4GCLA 3RI4A 5LFAA 1AWCA 4XONA 2ESHA 3TO6A 2BYVE 4NQWA 3QPHA 4M6YA 5EEAA 2H8RA 3BG3A 2ZCXA 2A61A 4UNOA 2VJ5A 2L3DA 2HVSA 1TZLA 1ZQ3P 4NNJA 2NRAC 2M30A 3SFZA 3RPQA 4KISA 3HOZJ 2JVGA 4GYGA 3LSGA 2Y69H 3SDBA 4JYKA 4X1EA 4F93B 1YRNA 2VQGA 1Z67A
chains in the Genus database with same CATH topology
3GTOJ 3JRIA 1G2HA 3IUVA 4DW6A 5D18A 1JUPA 1JJ8C 3FRQA 3BTCA 2NS7A 1LE8A 2JMWA 2V57A 2NX4A 1WH5A 5IP7J 5FGLA 4L5EA 3HOWJ 1TWGJ 2K9NA 3RZDJ 3GTPJ 2FX0A 3CCYA 1K61A 5HAWA 5M3MJ 2Y31A 2E2IJ 2VI6A 2D5VA 1DU6A 3LOCA 1BJZA 2JA8J 5GPAA 1VNDA 5EGOB 4GCKA 2KT0A 2EZLA 2QKOA 3A02A 5F0CA 4A3DJ 5IP6A 2L7ZA 3HM5A 4UUTA 3VW2A 3GTGJ 5EG0A 3S1MJ 5AQCA 2DMTA 3PM1A 2Y30A 1UMQA 2LD5A 2WGBA 1OCTC 2X9DA 3GTLJ 2YS9A 2TCTA 3CQZJ 3JRDA 1PUFB 3BNIA 4BXXJ 2O9LA 1AHDP 5J1UA 4A3EJ 2ZOZA 1WPKA 2G3BA 2OI8A 4JP0A 2UXUA 4G12A 3AQSA 1QVTA 3PO3J 2MGQA 2O7TA 2YVEA 4L62A 2PBXA 2ZCMA 2QF7A 1ZGWA 3QBMA 2IEKA 3LSJA 3Q0VA 1LE8B 2JA5J 3O60A 3V6GA 4DYCA 2NVXJ 4C2MJ 2QIBA 4IHWA 1ZTRA 2NP5A 4IEJA 2QWTA 1O4XA 3BG9A 4EEFG 5GPCA 1HCRA 1FEXA 2X48A 4JKZA 3VVYA 4MO7A 4BBRJ 4UUSB 2LFBA 2DG7A 2HOAA 4CYCA 2XDNA 2GM4A 5C4YA 3COLA 1LFUP 1JUSA 2ELKA 2XPWA 2G7LA 3H3VK 3G56A 3RD3A 1RKTA 1QRYA 3RH2A 4A3BJ 1APLC 2FD5A 1OFCX 3MNLA 2HOSA 1D5YA 3VPRA 5K7ZA 3B6CA 3LJLA 2E19A 2D6YA 2XSDC 4XRMA 3UKGA 1F36A 4A69C 3HTAA 2QCOA 2XPVA 2K9QA 3FKIJ 3G1MA 4NELA 1JKQC 2HQ5A 2P81A 1IUFA 3EGQA 5HBUA 1H89C 3S2DJ 2N8GA 4LOCA 1U78A 5FLMJ 4A3GJ 3S15J 3S17J 2X6OA 1IG7A 3KNWA 1EF4A 4JX5A 5C4JJ 1GT0C 3I4NJ 2WB1N 4Y52J 4ICHA 2ECBA 1F43A 2REKA 2WUIA 2LR8A 2E2HJ 3V78A 2ECCA 3KZ9A 4MLOA 1TWHJ 4IHXA 1A5JA 5EGOA 4C3JJ 3CWRA 2GFNA 1MBHA 2XGEA 3JSJA 2GLOA 2IU5A 4A3KJ 1WCMJ 2ME6A 3Q0UA 2DMQA 4IHVA 4JX6A 1BW5A 4MFDA 3S5RA 4B4CA 3VIBA 1W0TA 2Y0SN 5M5XJ 1JTXA 2Y2ZA 3I4MJ 3O8GA 1FTZA 1IV6A 2DTZA 3TEDA 4RDUA 1B8IA 3LWJA 1MBFA 3BTLA 3BR6A 1JKOC 2GENA 1JTYA 3GTKJ 4ACIA 2Y9YA 2OPTA 3ZOBA 1ZKGA 1BA5A 5CW8A 2VUMJ 1QVUA 4GFBA 2NVTJ 2ID6A 3TP3A 3EUPA 3DPJA 3A03A 2AHQA 2DA1A 1XS9A 5IOYA 1B72A 2HDDA 2RASA 3VP5A 3BJBA 2VPRA 1RR7A 1ETWA 1WH7A 4PXIA 2HI3A 2EBIA 5E3LA 1TWAJ 5FKOA 4A3LJ 1Y1VJ 1GV2A 3ZQHA 4A3IJ 4A3MJ 1RPWA 4UUSA 5DTDA 2FQ4A 4FCYA 5EFYA 4M6VA 1GUUA 1ORKA 4AC0A 2RAEA 1HLVA 2NP3A 2DA6A 3BCGA 1X2NA 5F08A 1ZR4A 1SGMA 1ITYA 2EZKA 3ZQCA 5FJ8J 1NK2P 3HOVJ 3ZQFA 3GEUA 2E2JJ 3MVPA 4C3HJ 3M4OJ 4V2FA 1JUMA 2CU7A 1B8IB 1MH3A 1WI3A 4MXMA 3SFIA 1X2MA 3DEWA 4BY1J 1XC5A 3JRFA 2HYTA 4XRSG 3HIMA 3D1NI 3B6AA 1H88C 3FK6A 2MW8A 1AU7A 4UDSA 3HTHA 5EF6A 1T56A 3NPIA 3NAUA 4MFEA 2R7ZJ 5DAJA 4FE4A 2DMPA 1RKWA 1B72B 1ETQA 3NNRA 1A6IA 3BR1A 3NRGA 3JRCA 5FHPA 2YU9J 1HOMA 5J1RA 5FLVA 1VI0A 5F27A 2E1OA 2UXOA 2M8GX 5HSZA 1ETVA 3LSRA 4B1RA 5EYRA 5IYDJ 3OSGA 3QKXA 3S1NJ 2OERA 1U9OA 2M0CA 2DJNA 2WV1A 2L0KA 3VVXA 2XRLA 3HOXJ 2HXIA 2XPUA 3PASA 1JT0A 2ZCNA 1GVDA 3FK7A 2KDZA 5F1JA 2CQXA 1HDDC 3G1OA 2L9RA 4Y7NJ 1ZR2A 3HOUJ 3HKZN 4M3EA 5E3NA 5FMPA 1JT6A 2COBA 2JK3A 2G7SA 3S2HJ 1AKHB 2OF7A 5CXGA 5F0FA 2AO9A 3BR3A 3K7AJ 2LK2A 3KKDA 2DG8A 3PO2J 3BR0A 5IYCJ 4M3DA 3BQZA 2ZOYA 4NDLA 4MIMA 3S1RJ 1I6HJ 3JREA 1IRZA 2UXPA 2K9SA 2UXIA 1GV5A 3HOYJ 1ENHA 4IHYA 3CJDA 3P9TA 3JRHA 3JRAA 3FISA 3HE0A 1Q1VA 1OCPA 2IAIA 2K40A 4D5CA 1QPIA 1ETYA 3LHQA 2R93J 4YZEA 3GBGA 1RESA 5FKNA 1MSFC 2Q24A 1SFOJ 2O8KA 4MK6A 2XGDA 3B81A 2MSYA 5FKLA 2FBQA 5J1YA 3MN2A 5E3OA 5K58A 2ID3A 4HKUA 2DA3A 3OOUA 3VOKA 3WHBA 1MBJA 2PZ9A 3K2AA 4M3FA 3NXCA 1IDYA 5C44J 3A01A 5EDNA 1ETXA 2H1KA 1CQTA 3Q0WA 2NVQJ 1JJ6C 1IDZA 4KWAA 2PMZN 1TC3C 3GZIA 2EH3A 4QIWN 3O8HA 1NK3P 4I76A 4HNVA 4QTRA 3T6NA 1UG2A 3IV5A 2LLKA 2WAQN 1UI6A 3NI7A 3HTJA 4DYQA 3HTIA 1S7EA 2M34A 3GTQJ 2NOGA 3HGGA 4B3AA 5JLWA 4W1UA 1NTCA 4XRSA 1MNMC 2ZB9A 2DA7A 3CDLA 5IPAA 1GDTA 3G7RA 3BQYA 4V2GA 4BY7J 2CUFA 3TW6A 1U8BA 3HDDA 2I10A 5HODA 3HGYA 3QPLA 4GFKA 3DCFA 1Z77A 1IC8A 1ZK8A 5IOZA 3LSPA 2F07A 1P7IA 4M3BA 2EZHA 2LTPA 1MBKA 1Y1WJ 3IH4A 1MBGA 1RETA 4DZJA 5JLXA 2CJJA 3HB9A 1MSEC 3ANPA 2DMNA 3GTJJ 3CMYA 4XICA 1XG1A 2HYJA 3C2BA 3HEFA 3LNQA 1X58A 3RKQA 3S16J 3VW0A 2JJ7A 2JN6A 1FIPA 4AUXA 3ON4A 3A01B 2R5ZB 3AQTA 3F1BA 4ABZA 1HF0A 4BKXA 3WHCA 4W97A 3FIWA 5F0HA 2LP0A 4A3CJ 4RBOA 1TWFJ 1AKHA 4NN1A 3ZQLA 2DN0A 2VKVA 2G0EA 1BL0A 1I50J 3S1QJ 2DA4A 4XK4A 1IJWC 2L7FP 3KKCA 1FTTA 4D7NA 2G7GA 4AC6A 4A3FJ 3CRJA 2R5YA 2XGCA 2XB0X 3ON2A 3TP0A 3BTJA 2EZIA 1E3OC 1K83J 2XB5A 1LFBA 1POGA 2IBDA 3G1LA 1FJLA 3BHQA 2QTQA 1P7JA 4ME9A 2NVYJ 2M9HA 2HKUA 1TWCJ 1YRNB 5C4XJ 3BRUA 1R9TJ 4D5FA 3ZQGA 3PPBA 4X6AJ 2CRGA 3IH2A 4JL3A 5H9TA 1IGNA 3VW1A 3JRGA 2FJ1A 2MG4A 2LKXA 5IP9J 3HBLA 3RQIA 3SJMA 4QSHA 2UXHA 4XIDA 2DMUA 2GUHA 5CXIA 3BTIA 2GBYA 2JWTA 4M3GA 3L1PA 1VF9A 3E7LA 2YVHA 1I3QJ 2LVSA 5F04A 4C3IJ 4FTHA 1DU0A 5D19A 1VFCA 3MKLA 1U9NA 1JGGA 4BBSJ 5EG0B 1JKRC 2NS8A 5E3MA 1FIAA 1MBEA 2R5YB 5C3EJ 4I6ZA 3W6VA 1MH4A 2ME0A 2VKEA 4AYBN 2DA5A 2EQRA 2R0QC 2JA6J 2W48A 2O7OA 2TRTA 3C07A 1T33A 2Y9ZA 3BR5A 4S0HB 5EZHA 4GFLA 2R92J 5D1RA 4JX4A 5M5YJ 4A3JJ 1ETKA 2L7MP 2RHAA 5M5WJ 5EZGA 2CUEA 3E7QA 4A93J 4AF5A 2B63J 2LY9A 5GP9A 4GCTA 2JA7J 5DS9A 4J19A 3S14J 5IYBJ 5J3LA 1UHSA 3QQAA 3GTMJ 5K7HA 3SDGA 1Z0XA 9ANTA 2QOPA 3QPSA 3VUQA 1HDPA 4JNNA 3F0CA 3H0GJ 3BR2A 2R5ZA 5FKMA 4DYRA 3TW7A 4CYCB 3JRBA 1ETOA 2YUSA 3VVZA 4GCLA 1JKPC 5K7FA 1W0UA 4D7MA 2HXOA 2M2EA 3VOXA 1H8AC 5BNGA 1BW6A 5FKKA 5EEAA 2H8RA 3BG5A 3BG3A 2W53A 3RZOJ 2ZCXA 3OIOA 3ANGA 1PUFA 3ZQIA 1ZQ3P 1UI5A 4CGRA 3NARA 4FE7A 2DA2A 3JR9A 4DZPA 3Q3SA 5M3FJ 2HOTA 3M3YJ 3HOZJ 3IH3A 3LSGA 1SANA 4JYKA 4X1EA 4FISA 2CQQA 3BT9A 1OJLA 1YRNA 3OSFA 1WGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO J;  3JRI A;  1G2H A;  3IUV A;  4DW6 A;  5D18 A;  1JUP A;  1JJ8 C;  3FRQ A;  3BTC A;  2NS7 A;  1LE8 A;  2JMW A;  2V57 A;  2NX4 A;  1WH5 A;  5IP7 J;  5FGL A;  4L5E A;  3HOW J;  1TWG J;  2K9N A;  3RZD J;  3GTP J;  2FX0 A;  3CCY A;  1K61 A;  5HAW A;  5M3M J;  2Y31 A;  2E2I J;  2VI6 A;  2D5V A;  1DU6 A;  3LOC A;  1BJZ A;  2JA8 J;  5GPA A;  1VND A;  5EGO B;  4GCK A;  2KT0 A;  2EZL A;  2QKO A;  3A02 A;  5F0C A;  4A3D J;  5IP6 A;  2L7Z A;  3HM5 A;  4UUT A;  3VW2 A;  3GTG J;  5EG0 A;  3S1M J;  5AQC A;  2DMT A;  3PM1 A;  2Y30 A;  1UMQ A;  2LD5 A;  2WGB A;  1OCT C;  2X9D A;  3GTL J;  2YS9 A;  2TCT A;  3CQZ J;  3JRD A;  1PUF B;  3BNI A;  4BXX J;  2O9L A;  1AHD P;  5J1U A;  4A3E J;  2ZOZ A;  1WPK A;  2G3B A;  2OI8 A;  4JP0 A;  2UXU A;  4G12 A;  3AQS A;  1QVT A;  3PO3 J;  2MGQ A;  2O7T A;  2YVE A;  4L62 A;  2PBX A;  2ZCM A;  2QF7 A;  1ZGW A;  3QBM A;  2IEK A;  3LSJ A;  3Q0V A;  1LE8 B;  2JA5 J;  3O60 A;  3V6G A;  4DYC A;  2NVX J;  4C2M J;  2QIB A;  4IHW A;  1ZTR A;  2NP5 A;  4IEJ A;  2QWT A;  1O4X A;  3BG9 A;  4EEF G;  5GPC A;  1HCR A;  1FEX A;  2X48 A;  4JKZ A;  3VVY A;  4MO7 A;  4BBR J;  4UUS B;  2LFB A;  2DG7 A;  2HOA A;  4CYC A;  2XDN A;  2GM4 A;  5C4Y A;  3COL A;  1LFU P;  1JUS A;  2ELK A;  2XPW A;  2G7L A;  3H3V K;  3G56 A;  3RD3 A;  1RKT A;  1QRY A;  3RH2 A;  4A3B J;  1APL C;  2FD5 A;  1OFC X;  3MNL A;  2HOS A;  1D5Y A;  3VPR A;  5K7Z A;  3B6C A;  3LJL A;  2E19 A;  2D6Y A;  2XSD C;  4XRM A;  3UKG A;  1F36 A;  4A69 C;  3HTA A;  2QCO A;  2XPV A;  2K9Q A;  3FKI J;  3G1M A;  4NEL A;  1JKQ C;  2HQ5 A;  2P81 A;  1IUF A;  3EGQ A;  5HBU A;  1H89 C;  3S2D J;  2N8G A;  4LOC A;  1U78 A;  5FLM J;  4A3G J;  3S15 J;  3S17 J;  2X6O A;  1IG7 A;  3KNW A;  1EF4 A;  4JX5 A;  5C4J J;  1GT0 C;  3I4N J;  2WB1 N;  4Y52 J;  4ICH A;  2ECB A;  1F43 A;  2REK A;  2WUI A;  2LR8 A;  2E2H J;  3V78 A;  2ECC A;  3KZ9 A;  4MLO A;  1TWH J;  4IHX A;  1A5J A;  5EGO A;  4C3J J;  3CWR A;  2GFN A;  1MBH A;  2XGE A;  3JSJ A;  2GLO A;  2IU5 A;  4A3K J;  1WCM J;  2ME6 A;  3Q0U A;  2DMQ A;  4IHV A;  4JX6 A;  1BW5 A;  4MFD A;  3S5R A;  4B4C A;  3VIB A;  1W0T A;  2Y0S N;  5M5X J;  1JTX A;  2Y2Z A;  3I4M J;  3O8G A;  1FTZ A;  1IV6 A;  2DTZ A;  3TED A;  4RDU A;  1B8I A;  3LWJ A;  1MBF A;  3BTL A;  3BR6 A;  1JKO C;  2GEN A;  1JTY A;  3GTK J;  4ACI A;  2Y9Y A;  2OPT A;  3ZOB A;  1ZKG A;  1BA5 A;  5CW8 A;  2VUM J;  1QVU A;  4GFB A;  2NVT J;  2ID6 A;  3TP3 A;  3EUP A;  3DPJ A;  3A03 A;  2AHQ A;  2DA1 A;  1XS9 A;  5IOY A;  1B72 A;  2HDD A;  2RAS A;  3VP5 A;  3BJB A;  2VPR A;  1RR7 A;  1ETW A;  1WH7 A;  4PXI A;  2HI3 A;  2EBI A;  5E3L A;  1TWA J;  5FKO A;  4A3L J;  1Y1V J;  1GV2 A;  3ZQH A;  4A3I J;  4A3M J;  1RPW A;  4UUS A;  5DTD A;  2FQ4 A;  4FCY A;  5EFY A;  4M6V A;  1GUU A;  1ORK A;  4AC0 A;  2RAE A;  1HLV A;  2NP3 A;  2DA6 A;  3BCG A;  1X2N A;  5F08 A;  1ZR4 A;  1SGM A;  1ITY A;  2EZK A;  3ZQC A;  5FJ8 J;  1NK2 P;  3HOV J;  3ZQF A;  3GEU A;  2E2J J;  3MVP A;  4C3H J;  3M4O J;  4V2F A;  1JUM A;  2CU7 A;  1B8I B;  1MH3 A;  1WI3 A;  4MXM A;  3SFI A;  1X2M A;  3DEW A;  4BY1 J;  1XC5 A;  3JRF A;  2HYT A;  4XRS G;  3HIM A;  3D1N I;  3B6A A;  1H88 C;  3FK6 A;  2MW8 A;  1AU7 A;  4UDS A;  3HTH A;  5EF6 A;  1T56 A;  3NPI A;  3NAU A;  4MFE A;  2R7Z J;  5DAJ A;  4FE4 A;  2DMP A;  1RKW A;  1B72 B;  1ETQ A;  3NNR A;  1A6I A;  3BR1 A;  3NRG A;  3JRC A;  5FHP A;  2YU9 J;  1HOM A;  5J1R A;  5FLV A;  1VI0 A;  5F27 A;  2E1O A;  2UXO A;  2M8G X;  5HSZ A;  1ETV A;  3LSR A;  4B1R A;  5EYR A;  5IYD J;  3OSG A;  3QKX A;  3S1N J;  2OER A;  1U9O A;  2M0C A;  2DJN A;  2WV1 A;  2L0K A;  3VVX A;  2XRL A;  3HOX J;  2HXI A;  2XPU A;  3PAS A;  1JT0 A;  2ZCN A;  1GVD A;  3FK7 A;  2KDZ A;  5F1J A;  2CQX A;  1HDD C;  3G1O A;  2L9R A;  4Y7N J;  1ZR2 A;  3HOU J;  3HKZ N;  4M3E A;  5E3N A;  5FMP A;  1JT6 A;  2COB A;  2JK3 A;  2G7S A;  3S2H J;  1AKH B;  2OF7 A;  5CXG A;  5F0F A;  2AO9 A;  3BR3 A;  3K7A J;  2LK2 A;  3KKD A;  2DG8 A;  3PO2 J;  3BR0 A;  5IYC J;  4M3D A;  3BQZ A;  2ZOY A;  4NDL A;  4MIM A;  3S1R J;  1I6H J;  3JRE A;  1IRZ A;  2UXP A;  2K9S A;  2UXI A;  1GV5 A;  3HOY J;  1ENH A;  4IHY A;  3CJD A;  3P9T A;  3JRH A;  3JRA A;  3FIS A;  3HE0 A;  1Q1V A;  1OCP A;  2IAI A;  2K40 A;  4D5C A;  1QPI A;  1ETY A;  3LHQ A;  2R93 J;  4YZE A;  3GBG A;  1RES A;  5FKN A;  1MSF C;  2Q24 A;  1SFO J;  2O8K A;  4MK6 A;  2XGD A;  3B81 A;  2MSY A;  5FKL A;  2FBQ A;  5J1Y A;  3MN2 A;  5E3O A;  5K58 A;  2ID3 A;  4HKU A;  2DA3 A;  3OOU A;  3VOK A;  3WHB A;  1MBJ A;  2PZ9 A;  3K2A A;  4M3F A;  3NXC A;  1IDY A;  5C44 J;  3A01 A;  5EDN A;  1ETX A;  2H1K A;  1CQT A;  3Q0W A;  2NVQ J;  1JJ6 C;  1IDZ A;  4KWA A;  2PMZ N;  1TC3 C;  3GZI A;  2EH3 A;  4QIW N;  3O8H A;  1NK3 P;  4I76 A;  4HNV A;  4QTR A;  3T6N A;  1UG2 A;  3IV5 A;  2LLK A;  2WAQ N;  1UI6 A;  3NI7 A;  3HTJ A;  4DYQ A;  3HTI A;  1S7E A;  2M34 A;  3GTQ J;  2NOG A;  3HGG A;  4B3A A;  5JLW A;  4W1U A;  1NTC A;  4XRS A;  1MNM C;  2ZB9 A;  2DA7 A;  3CDL A;  5IPA A;  1GDT A;  3G7R A;  3BQY A;  4V2G A;  4BY7 J;  2CUF A;  3TW6 A;  1U8B A;  3HDD A;  2I10 A;  5HOD A;  3HGY A;  3QPL A;  4GFK A;  3DCF A;  1Z77 A;  1IC8 A;  1ZK8 A;  5IOZ A;  3LSP A;  2F07 A;  1P7I A;  4M3B A;  2EZH A;  2LTP A;  1MBK A;  1Y1W J;  3IH4 A;  1MBG A;  1RET A;  4DZJ A;  5JLX A;  2CJJ A;  3HB9 A;  1MSE C;  3ANP A;  2DMN A;  3GTJ J;  3CMY A;  4XIC A;  1XG1 A;  2HYJ A;  3C2B A;  3HEF A;  3LNQ A;  1X58 A;  3RKQ A;  3S16 J;  3VW0 A;  2JJ7 A;  2JN6 A;  1FIP A;  4AUX A;  3ON4 A;  3A01 B;  2R5Z B;  3AQT A;  3F1B A;  4ABZ A;  1HF0 A;  4BKX A;  3WHC A;  4W97 A;  3FIW A;  5F0H A;  2LP0 A;  4A3C J;  4RBO A;  1TWF J;  1AKH A;  4NN1 A;  3ZQL A;  2DN0 A;  2VKV A;  2G0E A;  1BL0 A;  1I50 J;  3S1Q J;  2DA4 A;  4XK4 A;  1IJW C;  2L7F P;  3KKC A;  1FTT A;  4D7N A;  2G7G A;  4AC6 A;  4A3F J;  3CRJ A;  2R5Y A;  2XGC A;  2XB0 X;  3ON2 A;  3TP0 A;  3BTJ A;  2EZI A;  1E3O C;  1K83 J;  2XB5 A;  1LFB A;  1POG A;  2IBD A;  3G1L A;  1FJL A;  3BHQ A;  2QTQ A;  1P7J A;  4ME9 A;  2NVY J;  2M9H A;  2HKU A;  1TWC J;  1YRN B;  5C4X J;  3BRU A;  1R9T J;  4D5F A;  3ZQG A;  3PPB A;  4X6A J;  2CRG A;  3IH2 A;  4JL3 A;  5H9T A;  1IGN A;  3VW1 A;  3JRG A;  2FJ1 A;  2MG4 A;  2LKX A;  5IP9 J;  3HBL A;  3RQI A;  3SJM A;  4QSH A;  2UXH A;  4XID A;  2DMU A;  2GUH A;  5CXI A;  3BTI A;  2GBY A;  2JWT A;  4M3G A;  3L1P A;  1VF9 A;  3E7L A;  2YVH A;  1I3Q J;  2LVS A;  5F04 A;  4C3I J;  4FTH A;  1DU0 A;  5D19 A;  1VFC A;  3MKL A;  1U9N A;  1JGG A;  4BBS J;  5EG0 B;  1JKR C;  2NS8 A;  5E3M A;  1FIA A;  1MBE A;  2R5Y B;  5C3E J;  4I6Z A;  3W6V A;  1MH4 A;  2ME0 A;  2VKE A;  4AYB N;  2DA5 A;  2EQR A;  2R0Q C;  2JA6 J;  2W48 A;  2O7O A;  2TRT A;  3C07 A;  1T33 A;  2Y9Z A;  3BR5 A;  4S0H B;  5EZH A;  4GFL A;  2R92 J;  5D1R A;  4JX4 A;  5M5Y J;  4A3J J;  1ETK A;  2L7M P;  2RHA A;  5M5W J;  5EZG A;  2CUE A;  3E7Q A;  4A93 J;  4AF5 A;  2B63 J;  2LY9 A;  5GP9 A;  4GCT A;  2JA7 J;  5DS9 A;  4J19 A;  3S14 J;  5IYB J;  5J3L A;  1UHS A;  3QQA A;  3GTM J;  5K7H A;  3SDG A;  1Z0X A;  9ANT A;  2QOP A;  3QPS A;  3VUQ A;  1HDP A;  4JNN A;  3F0C A;  3H0G J;  3BR2 A;  2R5Z A;  5FKM A;  4DYR A;  3TW7 A;  4CYC B;  3JRB A;  1ETO A;  2YUS A;  3VVZ A;  4GCL A;  1JKP C;  5K7F A;  1W0U A;  4D7M A;  2HXO A;  2M2E A;  3VOX A;  1H8A C;  5BNG A;  1BW6 A;  5FKK A;  5EEA A;  2H8R A;  3BG5 A;  3BG3 A;  2W53 A;  3RZO J;  2ZCX A;  3OIO A;  3ANG A;  1PUF A;  3ZQI A;  1ZQ3 P;  1UI5 A;  4CGR A;  3NAR A;  4FE7 A;  2DA2 A;  3JR9 A;  4DZP A;  3Q3S A;  5M3F J;  2HOT A;  3M3Y J;  3HOZ J;  3IH3 A;  3LSG A;  1SAN A;  4JYK A;  4X1E A;  4FIS A;  2CQQ A;  3BT9 A;  1OJL A;  1YRN A;  3OSF A;  1WGX A; 
#chains in the Genus database with same CATH topology
 2DFH A;  2OQR A;  1W5S A;  4MTD A;  1G2H A;  3K10 A;  1JJ8 C;  3BTC A;  2NS7 A;  2V57 A;  4EJU A;  1HBX G;  3BJ6 A;  1WH5 A;  2EA4 A;  5J8C A;  1YO5 C;  4L5E A;  3HOW J;  3WG7 H;  1SD5 A;  3GTP J;  2CG4 A;  2FX0 A;  3CCY A;  2H6C A;  3LL7 A;  1B59 A;  1O7L A;  1G4D A;  3KFW X;  3ZMT A;  4Y33 A;  2PX9 A;  1S5L C;  2AXT C;  3V8L A;  4BL0 B;  5IP6 A;  3EYY A;  2IS1 A;  1YQA A;  2YVX A;  1SMY F;  4Q47 A;  2P8T A;  4U0V A;  4UUT A;  2ZO4 A;  3RKW A;  5EG0 A;  2Y0S A;  3HOT A;  5K5Q A;  2JQ7 A;  2VL8 A;  2WGB A;  4LB5 A;  2EK5 A;  1OCT C;  1WJD A;  2KRC A;  3DXJ F;  4NBQ A;  2E1M C;  2TCT A;  2ZFU A;  4BXX J;  2EV5 A;  1JHH A;  2WWY A;  1AHD P;  2Z1D A;  1VQ9 I;  3AL0 C;  3IUO A;  2V1U A;  2M5W A;  2BZT A;  4JP0 A;  4OWR B;  4OIN F;  3ULQ B;  1QVT A;  1Z91 A;  2MBF A;  3IRR A;  1E17 A;  3AQS A;  3FM5 A;  3U1K A;  2PBX A;  2ZCM A;  1D3Y A;  4XBF A;  1KQ9 A;  3QBM A;  4PJN A;  4BQN A;  2K3F A;  3NRV A;  2IEK A;  3LSJ A;  3Q0V A;  5H2F C;  3O60 A;  2L9S A;  4H4K C;  1SFE A;  4RLF A;  4ESF A;  5A2Q Z;  2XKO A;  2NVX J;  2QIB A;  6PAX A;  4DVY P;  4GO1 A;  2NP5 A;  2QWT A;  4BAY A;  1T6S A;  2ZNY A;  2HPI A;  5DV5 A;  2QSH X;  2X48 A;  4MO7 A;  4BBR J;  2HOA A;  4CYC A;  2EIN H;  4D0P A;  2GM4 A;  4ZDP A;  1XGN A;  4A6E A;  4C9Y A;  3CC2 I;  3WGH A;  1D0Y A;  2XPW A;  4U0Y A;  3L7W A;  1Y56 A;  3RH2 A;  4YRV A;  3EDP A;  1APL C;  1XGO A;  5L3B A;  2FD5 A;  2K9L A;  3MNL A;  2HOS A;  5K7Z A;  2FQ3 A;  2LF7 A;  3LJL A;  4U9L A;  4A69 C;  3HZJ A;  5HNF A;  3HTA A;  1OQY A;  3FKI J;  4IF4 A;  4CCJ A;  1ZHF A;  4FQG A;  4ENN A;  5FGM A;  1X4O A;  4R8H A;  2Z2S B;  4II2 A;  1JKQ C;  4NEL A;  3E5U A;  5CVR A;  1D1C A;  1E3P A;  1X3Z B;  2DJI A;  2P81 A;  1IXS B;  2CQN A;  1PP8 F;  1LJ9 A;  5HBU A;  2OQG A;  2N8G A;  4LOC A;  4CXF A;  3I59 B;  1YOV B;  1D5V A;  2CH0 A;  3L2W A;  4XLE A;  1MJA A;  4JX5 A;  3I4N J;  2QQA A;  3A0B C;  2WB1 N;  3BPX A;  4Y52 J;  3WU2 C;  2LSO A;  2LR8 A;  1TQI A;  1UEL B;  4XSZ F;  3OIQ A;  4AIJ A;  4IHX A;  1R23 A;  3CWR A;  1WJE A;  2GFN A;  1MBH A;  1FWZ A;  2DQL A;  4PJM A;  4CZC A;  4IRH A;  1WCM J;  3NWS A;  3SQN A;  1W36 D;  1WQ2 A;  2ME6 A;  4F55 A;  2X1E A;  4UV8 A;  3PJR A;  3T1B A;  5ED4 A;  1R1T A;  3HKZ A;  4A5N A;  3G4S I;  2ZJR F;  1IXR C;  1B8I A;  3BTL A;  3BR6 A;  1JKO C;  3NQO A;  3AKZ A;  4KN7 X;  4ACI A;  2A68 F;  2LBF A;  4FT8 A;  1ZKG A;  1K78 A;  1OCR H;  5CW8 A;  1J9I A;  1FOX A;  2ID6 A;  4B43 A;  5D5U B;  1TL8 A;  3EUP A;  1X1A A;  2AHQ A;  4BE2 A;  2OTL I;  2DA1 A;  2DDA A;  3R61 A;  5HS9 A;  1FBQ A;  3OS0 A;  1VQK I;  3K4M A;  1WH7 A;  4WIB A;  2L9V A;  1GV2 A;  3ZQH A;  4A3I J;  3ERE D;  4A3M J;  1CF7 A;  1A36 A;  3KIO A;  5DTD A;  1T95 A;  3W2W A;  2KRF A;  3VYR B;  2A3S A;  2NP3 A;  2RAE A;  4ON0 A;  2DA6 A;  2F4O B;  3HSE A;  1OCZ H;  1ZR4 A;  3ZQC A;  1FOK A;  1NK2 P;  3HOV J;  1IXC A;  3OYE A;  4C3H J;  1WKM A;  3WTW C;  2P0W A;  2P7C B;  4P1W A;  4WXD A;  1VQL I;  4IXA A;  1MH3 A;  3A4C A;  3SFI A;  2RGV A;  3OWT A;  5FRM A;  2V6C A;  5KAI C;  3QPT A;  3JRF A;  2IS4 A;  2HYT A;  2DT6 A;  3D1N I;  4EM2 A;  2P6T A;  3OL3 A;  2OD5 A;  3OL4 A;  1X1P A;  2WAQ A;  1Z3X A;  2R7S A;  3FK6 A;  3K1M A;  5CQE A;  3GWZ A;  4CHU A;  3HTH A;  3L2V A;  3V8J A;  5EF6 A;  1T56 A;  3NAU A;  4MFE A;  1X3W B;  2L2O A;  4FE4 A;  2YX7 A;  4HNU A;  3SEZ A;  1R7J A;  1A6I A;  1U5T C;  4O3M A;  5FFZ A;  1R22 A;  4GRI A;  4ZYG A;  2YU9 J;  3AG1 H;  5J1R A;  4XOT A;  5DDG A;  4HNT A;  2OU2 A;  4RAG A;  4RGS A;  4PFO A;  2M8G X;  2RC4 A;  2RQP A;  3LSR A;  2BY3 A;  4RB2 C;  3OSG A;  3QKX A;  3S1N J;  3ESW B;  2ESN A;  2OER A;  2IVM A;  1R58 A;  3R0A A;  2DJN A;  1Z05 A;  3HOX J;  2HGC A;  2WBM A;  2H09 A;  4NC8 A;  5DM7 F;  2A07 F;  3SZP A;  2GWR A;  2IPQ X;  4LIV A;  5F1J A;  3VYT B;  2RV8 A;  3JCU C;  4ZYA A;  5FMP A;  4M3E A;  2HEO A;  1FYL A;  2XKP A;  4CCM A;  4EVI A;  1ACI A;  4RLQ A;  1JT6 A;  2JK3 A;  1FSH A;  2G7S A;  2X1C A;  2PFV A;  1O3T A;  1AKH B;  2HFH A;  4G6T B;  3FMR A;  4IQ4 A;  5JR3 A;  1UCR A;  4M6X A;  4DBQ A;  4IOC F;  3GME A;  1X4P A;  3ZQQ A;  4Q4Z F;  2B3W A;  2ZFW A;  3BR0 A;  4NUB A;  3FMS A;  5TGT A;  3GF2 A;  4HQM A;  4NDL A;  3EQL F;  1IRZ A;  1J09 A;  2CMP A;  2K9S A;  2UXI A;  4XOR A;  5LEK A;  3CJD A;  3P9T A;  4ZC3 A;  2COM A;  3FF5 A;  4II3 A;  1B1B A;  3HE0 A;  2CS3 A;  3G6E I;  1Q1V A;  2IAI A;  3CP2 A;  4PK4 A;  1QPI A;  2VE9 A;  2HU9 A;  3VB2 A;  5EEH A;  4NC7 A;  1V5F A;  1OYI A;  5ICG A;  4KUM A;  3GBG A;  5FKN A;  2BOL A;  4E6K G;  2Q24 A;  2EIJ H;  3KE2 A;  4FX4 A;  1R1U A;  3B81 A;  4EAT A;  2JUG A;  2GXA A;  3D5L A;  1UG0 A;  3CJR B;  1HQC A;  3CDI A;  3GFL A;  3BWG A;  3CUQ B;  3KYL A;  1R49 A;  4HKU A;  2DA3 A;  4XMY A;  2F6C A;  2KZV A;  2XAS A;  3NXC A;  1RC9 A;  4HX8 A;  4I02 A;  5C44 J;  2MD5 A;  1IDZ A;  3TDU C;  5DD4 A;  2HQA A;  2ZKZ A;  3KLO A;  2EH3 A;  4OIO F;  4AID A;  4AD9 A;  1KA8 A;  4E7J A;  1UG2 A;  4KMU X;  3P5J A;  1SMT A;  1UI6 A;  1UJ8 A;  3OYI A;  1GHC A;  1SVL A;  3FXK A;  5F1R A;  3RSN A;  2EV6 A;  1S7E A;  3CUO A;  2M34 A;  3PUF A;  2VON A;  2LOO A;  3EET A;  4W1U A;  4CCO A;  1G59 A;  4UHT A;  2DYR H;  2CFO A;  3DTE A;  1GDT A;  1MKM A;  3BQY A;  1YS6 A;  1BR4 A;  2O5R A;  2CUF A;  2QQ9 A;  2VQL A;  2JRT A;  1VQ6 I;  2UWM A;  5DCM B;  1O3Q A;  3WGG A;  1AA7 A;  1BIA A;  5IOZ A;  3LSP A;  2R7R A;  1P7I A;  2ZME B;  2LTP A;  1Y1W J;  4I09 A;  4WK8 F;  4UXN A;  4BJT A;  2KHM A;  4EM1 A;  2D2W A;  2F2E A;  1MSE C;  5CPR B;  1X1D A;  2HYJ A;  2L01 A;  1BM9 A;  3LNQ A;  4ZYH A;  1X58 A;  3K1P A;  4IQJ A;  5EEG A;  3W2A A;  1FIP A;  4AUX A;  3ON4 A;  2Z33 A;  3A01 B;  1WWX A;  3ZXS A;  2UZK A;  3HOS A;  4Y3O A;  2VBY A;  3R0J A;  1NHA A;  2CV2 A;  4RBO A;  4RAY A;  3I3L A;  1AKH A;  1MJB A;  3ZQL A;  2OCC H;  1I50 J;  2DA4 A;  1IJW C;  2F4M B;  3RQ4 A;  2G7G A;  1SD6 A;  3NEU A;  3H9Q A;  4UV9 A;  2R5Y A;  1U5T A;  1V5E A;  3HUG B;  2EIM H;  2LNB A;  3HYI A;  2EZI A;  1E3O C;  1HST A;  1FMV A;  4N4N B;  3KP6 A;  4AIK A;  4I2O A;  4DOZ A;  1POG A;  3LSI A;  2H94 A;  2CFX A;  4Y13 A;  1LB2 A;  2E71 A;  4XLP F;  3O3K A;  1ERD A;  1B4A A;  2PG4 A;  1TWC J;  2DI3 A;  1E2X A;  4EJO A;  3BCB A;  3BRU A;  1TNS A;  3MZ8 A;  1YYV A;  3DQV C;  4BNC A;  4X6A J;  3OY9 A;  3RKX A;  2HYG D;  2IGM A;  2F5V A;  3K1N A;  1OYW A;  1EKE A;  3SJM A;  4QSH A;  1QBJ A;  4XID A;  5BPD A;  2GXB A;  2QKM B;  3BTI A;  2BVL A;  5DM6 F;  1W5C C;  1VF9 A;  2W00 A;  5A2Q K;  3ZRG A;  5F04 A;  1DU0 A;  1VFC A;  1FSE A;  2DDB A;  4S05 A;  4G7O F;  1JKR C;  1FIA A;  3VTI A;  4BJ6 C;  5LGU A;  2O03 A;  2R0Q C;  3GZ5 A;  2EB7 A;  2O7O A;  2IXS A;  2X51 A;  5KCM A;  2B1E A;  3C07 A;  4U9N A;  3BR5 A;  2A5W A;  1NG7 A;  1QU3 A;  3BJA A;  3IRQ A;  1MGT A;  4JX4 A;  3FMQ A;  1ETK A;  5CJ9 A;  4CH7 A;  3CCJ I;  5EZG A;  3E7Q A;  2FE3 A;  2K9M A;  5HDG A;  4AF5 A;  5DCM A;  5GP9 A;  1LUJ B;  2JA7 J;  1G8X A;  3LQQ A;  3KZZ A;  3TBI A;  3WOD F;  4KIF A;  3WE2 A;  3VOD A;  2KDO A;  2L02 A;  1MDM B;  2ZME A;  3C7J A;  2GXG A;  1UHS A;  1DGR M;  3QQA A;  4OIR F;  3GTM J;  1Z0X A;  5B1A H;  1UB9 A;  2FBK A;  2R7F A;  3BC8 A;  4KIT B;  1L0O C;  1FNN A;  1RZ4 A;  2KKO A;  2VT2 A;  1S6L A;  1HC8 A;  3TW7 A;  3OS2 A;  1I39 A;  1XGM A;  2A6T A;  3HC7 A;  1HW2 A;  5AIQ A;  5K7F A;  4BXF A;  3ZPL A;  3Q9V A;  2HDW A;  5JVG F;  1WI9 A;  2IP2 A;  1S7A A;  2K4B A;  4H0E A;  5FKK A;  2V1X A;  2F5F A;  2STW A;  3BG5 A;  2R4G A;  2R7T A;  2DPU A;  3R60 A;  3RZO J;  3HUG A;  2VJI A;  1D0Z A;  5BS6 A;  2QM3 A;  4OD5 A;  3NAR A;  3JR9 A;  4DZP A;  3Q3S A;  2HOT A;  3AFH A;  2R7V A;  1P92 A;  2LDU A;  4RB1 A;  3WTT C;  4GCV A;  4FIS A;  4UVB A;  4FAS D;  3JRI A;  2HVQ A;  2XSJ C;  3IC7 A;  2JMW A;  1Y6I A;  2WB1 A;  2NX4 A;  1TW3 A;  5FGL A;  2K9N A;  4DBR A;  2EWN A;  1ZG1 A;  5LD2 C;  2XAG A;  2DQR A;  2VI6 A;  1V4R A;  1DU6 A;  3LOC A;  1BJZ A;  3DKY A;  1EH7 A;  2F4I A;  1O3R A;  3ZR8 X;  2QKO A;  3A02 A;  2ZY9 A;  4KIG A;  4B48 A;  3HM5 A;  4DIQ A;  4M73 A;  2JSP A;  4NQW B;  2V4J C;  3S1M J;  5J40 A;  3PSF A;  1S3J A;  2Y30 A;  2LD5 A;  2V7F A;  1BC7 C;  2CUZ A;  2X9D A;  3OMY A;  3GTL J;  3OYN A;  3R6S A;  3JRD A;  1BI1 A;  4OAY A;  3W6K B;  2V1N A;  4PCQ A;  1G3Y A;  3ZMD A;  2G3B A;  2V26 A;  3H3U A;  1LEA A;  2PLY A;  4G12 A;  1RR8 C;  4L62 A;  3I4P A;  4GYI A;  4GGG A;  1IW7 F;  2K7L A;  1MDM A;  4HV5 A;  2NVU B;  5CQG A;  2VKD A;  1T0F C;  5J47 A;  2NOJ B;  4DYC A;  3RTR A;  3DPT A;  2L7K A;  2CGP A;  3F8N A;  3DTK A;  1O4X A;  1N77 A;  1YX3 A;  3BG9 A;  1O7F A;  2FEZ A;  5GPC A;  1HCR A;  1ZAO A;  1FEX A;  1BIB A;  1Q1H A;  3Q9S A;  3VVY A;  4XKC A;  3GXO A;  4KJZ A;  4PJL A;  2FU4 A;  2GOM A;  5E20 A;  4L9T A;  4KA4 A;  3COL A;  3OYA A;  3GFJ A;  1HXD A;  1LFU P;  2HNH A;  1EH8 A;  2Z16 A;  3S93 A;  2FML A;  1VZ0 A;  2Q8K A;  1RIO H;  2D1V A;  4G9Y A;  4A3B J;  1OFC X;  4PGG A;  3CLQ A;  3VPR A;  1MNE A;  3CTA A;  3CCR I;  4A5M A;  2XSD C;  4XRM A;  2KP6 A;  2KIM A;  1F36 A;  2IGO A;  3O2P E;  4MQ9 F;  1BN5 A;  2QCO A;  2XPV A;  3MD2 A;  1S29 A;  4LD5 A;  5DUK A;  3WTS C;  3ABM H;  3F21 A;  4ZDO A;  4WXC A;  2CW8 A;  5FLX Z;  3K4K A;  3QWL A;  1XN7 A;  3K4L A;  1DDN A;  2LY1 A;  1T39 A;  5CVU A;  3SEQ A;  3EGQ A;  4QWQ A;  4EJT A;  1FBS A;  5D8L B;  1U78 A;  4A3G J;  1QNT A;  2XAJ A;  3S17 J;  3COA C;  1D1B A;  2QYO A;  1IG7 A;  3PFI A;  2XGX A;  2DBB A;  5C4J J;  1GT0 C;  4ICH A;  3D5R C;  4BQO A;  1RUO A;  2ECB A;  1QZE A;  1LDK B;  4LMY A;  2CV1 A;  4P9F A;  2ZXW H;  4MLO A;  1Z7U A;  2GOX B;  1BI3 A;  2XGE A;  2STT A;  1D1A A;  3JSJ A;  4F7Z A;  2IU5 A;  3WTX C;  4IZZ A;  1BOB A;  3LMM A;  4EM0 B;  3Q0U A;  2DMQ A;  1MZB A;  4JX6 A;  5BOX A;  3S5R A;  2CQK A;  3C1D A;  5HS7 A;  1JTX A;  2Y2Z A;  4HSR A;  3O8G A;  1FTZ A;  3JSO A;  1IV6 A;  2DTZ A;  3P7N A;  3RJP A;  3TED A;  4RDU A;  5L3E A;  1MBF A;  4Q48 A;  3F8C A;  2P5K A;  1ODD A;  2XVC A;  2AQE A;  1JTY A;  4HBL A;  2Y9Y A;  3KP4 A;  4E7Z A;  5BMZ A;  1MMS A;  4BE1 A;  1REP C;  3VWB A;  3H3Z A;  1UAA A;  4ZTJ A;  1EH6 A;  4A0Y A;  2NVT J;  4G6Q A;  2HKO A;  3VEP A;  1Y8Q B;  3KYD B;  4M71 A;  2RN7 A;  2VQC A;  3A03 A;  5H20 A;  4J01 A;  2PQ8 A;  1XS9 A;  1B72 A;  2HDD A;  2XAU A;  1YW8 A;  3OS1 A;  1FBU A;  4PXI A;  5E3L A;  5FKO A;  2FOK A;  3PIP F;  3V8K A;  1T8I A;  4XNF A;  2FQ4 A;  2PEX A;  3MKY B;  4L0Z B;  3CES A;  1HLV A;  5GTH C;  3QYF A;  2O61 A;  3KZI C;  2XRO A;  4YIF A;  1LVK A;  1SGM A;  3A2K A;  5FJ8 J;  3FXU A;  3HRS A;  5LEJ A;  1YIO A;  2J5P A;  1VTN C;  2E2J J;  3GEU A;  4XN0 A;  2V6E A;  1F5T A;  1ZRC A;  4V2F A;  1BI2 A;  2LRD A;  4BDZ A;  5E1Z B;  1B8I B;  2HTJ A;  1WI3 A;  4RAZ A;  4ZZL A;  2Q2E B;  2LBF B;  4LGW A;  4ASN A;  5J4V A;  4YEJ A;  4R79 A;  4XRS G;  1K78 B;  4IO9 F;  3B6A A;  1GXQ A;  1N75 A;  2BY1 A;  1T0F A;  3HHH A;  1L3L A;  1H88 C;  2MW8 A;  1AU7 A;  4UDS A;  1YG2 A;  2EFP A;  5D5X B;  1RKW A;  2EIL H;  3CCM I;  3QOP A;  5D4S A;  2WAE A;  2FBI A;  3H0D A;  5FHP A;  3CZ6 A;  1QQI A;  1JHF A;  1HW5 A;  3M8F A;  1CF7 B;  2EFO A;  4CGZ A;  5L3F A;  2E1O A;  4YII A;  2QVO A;  2GZW A;  4B1R A;  1DUX C;  1YI2 I;  5D8K B;  2E1M B;  3DPU A;  2CW0 F;  2HTS A;  3GFM A;  3VVX A;  2ISZ A;  3MAJ A;  3AL0 B;  2IGK A;  4PSW A;  2XPU A;  1QHH D;  1W1W E;  4PDK A;  1GVD A;  4HF1 A;  4RAF A;  3PL8 A;  1LDD A;  1FX7 A;  4Y7N J;  1ZGJ A;  3BLY A;  3K69 A;  2VLA A;  3KLN A;  2OCE A;  1B6A A;  5LHH A;  3S2H J;  1SVM A;  5CXG A;  1UST A;  5KNL A;  4MHG A;  5E17 F;  1FY7 A;  2LK2 A;  4NHJ A;  2DG8 A;  1DPR A;  3PO2 J;  2IT0 A;  4M3D A;  2E34 A;  5K5O A;  2GAU A;  2KRH A;  3S1R J;  2QZ8 A;  3JRE A;  1GV5 A;  2RQQ A;  4CCL A;  3HOY J;  4FET A;  3ZN1 A;  4L0Y B;  4FHT A;  4E7L A;  5LRS A;  3QP6 A;  3JRA A;  3H5A A;  3FIS A;  1OCP A;  2CV0 A;  1F9N A;  4X0G A;  3LFU A;  2A6H F;  3ASN H;  1ETY A;  3K4C A;  1VQ4 I;  1F1Z A;  5LRR A;  4HEA 2;  1MSF C;  4L18 B;  4MK6 A;  2XGD A;  2FBQ A;  3ELK A;  2KIQ A;  2M7B A;  2CO5 A;  3MN2 A;  2L54 A;  2KL4 A;  3ZQ7 A;  2ID3 A;  1X3U A;  3OOU A;  2F48 A;  4BYY A;  2ETH A;  1MBJ A;  1XGS A;  2FSW A;  4D1Q A;  5HOO A;  3NS4 A;  3K2A A;  1IDY A;  1XX5 A;  2I5U A;  3AG3 H;  3BP8 A;  3GCM A;  1UHW A;  2Q2E A;  4XKB A;  3AG2 H;  1ZH5 A;  2IA2 A;  1TC3 C;  2V9P A;  1MMA A;  3M07 A;  5L3C A;  1HKQ A;  1NK3 P;  4I76 A;  3ASO H;  3T6N A;  3CME I;  1DGW Y;  5HNH A;  3H5N A;  3LSH A;  3CF5 F;  3HTI A;  4YFK F;  5D5W B;  5JLW A;  4AM3 A;  4QPO A;  2HQR A;  2W82 A;  4I7H A;  4XRS A;  2CUJ A;  2DA7 A;  3ML6 A;  3G7R A;  3GO5 A;  1C0W A;  3TW6 A;  4LIT A;  5FO5 A;  3HDD A;  2JRM A;  2MC4 A;  3HGY A;  3H1C A;  5LGN A;  1I27 A;  5E18 F;  1ZK8 A;  4KT6 A;  1MW7 A;  3KET A;  4IRI A;  3IH4 A;  2DXI A;  1RET A;  1ULY A;  2CJJ A;  2UXX A;  3ANP A;  2VXD A;  4U88 A;  4XIC A;  1XG1 A;  4PZJ A;  1D0X A;  1Z1D A;  1ZG3 A;  2QEX I;  3S16 J;  3DEU A;  3GLL A;  1YIT I;  1MJ9 A;  2HYF A;  3M1E A;  3TOB A;  1IN6 A;  4Y4R A;  4W97 A;  3HG9 A;  2VKV A;  2G0E A;  3SZG A;  1R5G A;  4XK4 A;  3WU1 B;  2IA0 A;  5CVV A;  4XLN F;  2BW3 B;  2H6B A;  2MD0 A;  2XB0 X;  2Z99 A;  4AU7 A;  1ON1 A;  5D4R A;  2ADU A;  2DYS H;  4EGZ A;  1A6Q A;  1K83 J;  2XB5 A;  2X6X A;  2W84 A;  5HVQ C;  4I99 C;  3J80 Z;  2KIU A;  2IBD A;  3BHQ A;  4BS9 A;  2QTQ A;  1XPX A;  1U2W A;  1TBX A;  2NVY J;  2M9H A;  4N4O B;  1D8J A;  3RYP A;  2KFD A;  4U0W A;  3BY6 A;  3RIR A;  2HKU A;  1H9G A;  4XN3 A;  4LJZ F;  5D6F A;  2L4M A;  1BBY A;  4YG2 F;  3KEQ A;  2OA4 A;  3ZQG A;  3K4J A;  4O5V A;  1JE8 A;  3IH2 A;  1G3T A;  4GDF A;  5CKT A;  4IRG A;  2C6Y A;  1MMN A;  1J5Y A;  1YTY A;  1V54 H;  3RQI A;  4AWX B;  2W1O A;  4XR6 A;  5B3S H;  2UXH A;  3WE3 A;  3CJN A;  3I53 A;  2GUH A;  4LG0 A;  3HSR A;  4RB3 C;  3K0L A;  3H5R A;  3TO7 A;  1YIJ I;  4YEL A;  2VOP A;  1QGP A;  2DCE A;  3I55 I;  3E0J B;  2YVH A;  2DU9 A;  1V3F A;  1SAU A;  2LVS A;  4C3I J;  3HL2 A;  5E79 C;  2F5C A;  4FTH A;  5K5R A;  1ZN2 A;  4ENJ A;  1U9N A;  2VXZ A;  3QU3 A;  1K79 A;  1EA3 A;  3SYT A;  2R5Y B;  1MBE A;  3PQJ A;  3PNT A;  1U5T B;  5C3E J;  3WTV C;  3JTG A;  1MH4 A;  4AYB N;  2EJR A;  2VKE A;  4I6Z A;  1A35 A;  1SD4 A;  5HLG A;  2AXL A;  2M3A A;  2M8E A;  4CCK A;  4ZH4 F;  2JA6 J;  2TRT A;  4E7S A;  5EZH A;  3DLL F;  3FXQ A;  5ICE A;  4A3J J;  1E0E A;  2L7M P;  5M5W J;  2CUE A;  2X1D A;  2B63 J;  3E6M A;  4GCT A;  1BR1 A;  4UVA A;  3H9J A;  1EJ9 A;  1B9M A;  2YU3 A;  3P9I A;  4MEX F;  3ZGK A;  1ZYR F;  2XUB A;  3C2H A;  3K70 C;  1QPM A;  2A05 A;  3WTY C;  1LVA A;  2R7X A;  5FLX K;  3CC4 I;  3FXM A;  4D9J A;  3H0G J;  3HHG A;  3DTI A;  2VJJ A;  2QLZ A;  3AAF A;  4HRI A;  1WZ2 A;  1ETO A;  2YUS A;  1OPC A;  4YFX F;  1PP7 U;  3GLX A;  2PJR A;  1W0U A;  1TLH B;  2BVM A;  2HXO A;  5FB2 A;  2M2E A;  4HST A;  2NS0 A;  2XAF A;  4B3X A;  1JI8 A;  1H8A C;  3DBL B;  2PJP A;  2R3S A;  2BW3 A;  5BNG A;  3IWF A;  4G94 A;  5BQT A;  1SC7 A;  4IX7 A;  1PUF A;  3ZQI A;  4CGR A;  2XAQ A;  5JVT A;  5M3F J;  5FRN A;  2LY2 A;  4E7I A;  4QLC U;  3IH3 A;  2NNN A;  3KP5 A;  1YS7 A;  5CYV A;  1JGS A;  3FHN A;  4G6D A;  5H6Q A;  4BAC A;  5FFX A;  5IT3 A;  3OSF A;  1Y0N A;  2E1N A;  5TIS C;  1WGX A;  3LAJ A;  3IUV A;  4JQF A;  3WGI A;  5BPI A;  2MLG A;  1JUP A;  2IGN A;  3FRQ A;  5FD6 A;  1LE8 A;  3VSL A;  3M8J A;  2OAZ A;  1Z6T A;  3GZ6 A;  3RZD J;  3FDY A;  1WFX A;  4WF2 A;  5M3M J;  3F22 A;  2ISY A;  3CMA I;  2P6S A;  2ZSI B;  3ABK H;  3OYJ A;  2IRF G;  1LNW A;  4GCK A;  3C18 A;  2R7Q A;  3M1C A;  5F0C A;  4A3D J;  1TP4 A;  4B47 A;  3OYB A;  1P2F A;  1UZC A;  2X6Y A;  3VW2 A;  4IHS A;  5AQC A;  5E1W A;  1ZG5 A;  3BPV A;  2DMT A;  3KP2 A;  3OOP A;  2VAS A;  4CUG A;  2YS9 A;  1Z21 A;  3CQZ J;  2FF4 A;  2K5C A;  5DUI A;  3ABT A;  3CD6 I;  2O9L A;  2HZT A;  1USS A;  3T5X A;  2D45 A;  4KNY A;  1I6X A;  1WPK A;  3E6D A;  4XSX F;  3U21 A;  4E7K A;  1VQO I;  3DBH B;  2WC2 A;  2UXU A;  2VQH A;  3PO3 J;  1PJR A;  2MGQ A;  3CF2 A;  4XLA A;  2O7T A;  3TQN A;  1H0M A;  2QF7 A;  3F3X A;  1QHG A;  1ZGW A;  3GUD A;  1QZY A;  5H6R A;  1MMD A;  4PFP A;  3V6G A;  2HS5 A;  2B0L A;  3VYS B;  1ZTR A;  4IEJ A;  3F8M A;  2K02 A;  4JKZ A;  2JT1 A;  2LFB A;  2DG7 A;  1R4N B;  3VFZ A;  3ISP A;  3DLA A;  1IZ1 A;  1KYW A;  4F91 B;  2ELK A;  3PUB A;  3KCC A;  4XKW A;  1R71 A;  3H3V K;  3G56 A;  3FXJ A;  1RKT A;  2VOD A;  3K8P C;  1FLI A;  1D5Y A;  4Q5S F;  3B6C A;  1EV7 A;  3UR3 C;  2BV6 A;  5J6X A;  3I64 A;  2K9Q A;  3G1M A;  4OAZ A;  5E8I A;  3PFY A;  3BOQ A;  4BHC A;  5ILU A;  2HQ5 A;  1VQP I;  3EUK L;  4WCG A;  4ZDL A;  1W5T A;  4BDY A;  1IO2 A;  1IUF A;  1H89 C;  3S2D J;  3JW4 A;  3CCS I;  3KYC B;  4GXO A;  3S15 J;  4MQV A;  3OV8 A;  3KNW A;  4BQQ A;  5ILS A;  3I0T A;  3AG4 H;  5DEQ A;  1GXP A;  4B09 A;  5LLQ A;  1FYM A;  3REO A;  2P5L C;  3KZ9 A;  1TWH J;  4U87 A;  3KEY A;  1S8N A;  4C3J J;  1RRJ A;  1UHM A;  3EPZ A;  4NC6 A;  1XMA A;  3FXR A;  2JZY A;  2M45 A;  1I5Z A;  3E5X A;  3HRU A;  2Y0M A;  4AIH A;  1MIJ A;  3BG7 A;  1ZRD A;  4KIB A;  4B4C A;  2QSG X;  3OYF A;  3ZN0 A;  5M5X J;  5KVR A;  2FMY A;  3I4M J;  4ZYD A;  4LFU A;  4C30 A;  2BY2 A;  1R00 A;  1G3W A;  1J2X A;  3C3W A;  2GEN A;  3CP8 A;  2PMU A;  2OZ6 A;  3KX2 A;  3GTK J;  3K2Z A;  2OPT A;  3ZOB A;  2WAD A;  2FOW A;  2X85 A;  4RGU A;  5F64 A;  1BA5 A;  4OD4 A;  1P9Q C;  3HTU A;  1QVU A;  5IT9 K;  4BE0 A;  4U7D A;  3LQR A;  5FD5 A;  1IN4 A;  1S7O A;  2BE5 F;  2VKH A;  2EA2 A;  1FZP B;  3IKV A;  5IOY A;  2RAS A;  1RI7 A;  2DK8 A;  4F3Q A;  4F52 A;  2XDV A;  1QA6 A;  3BJB A;  3VP5 A;  2QKL B;  1RR7 A;  1ETW A;  1YX5 A;  2EBI A;  3I71 A;  4HF0 A;  4BUP A;  4C2U A;  3ECH A;  2M0M A;  2L9N A;  1X19 A;  2W57 A;  1YW9 A;  3LFK A;  4M72 A;  4RGX A;  1XSD A;  1DQU A;  1N25 A;  1J0R A;  1ORK A;  4AC0 A;  3BCG A;  5HLT A;  1X2N A;  4PJ0 C;  4KMF A;  1ITY A;  2QEN A;  3S3N A;  2LKP A;  3ZQF A;  4EV0 A;  4E7H A;  4HF2 A;  3M4O J;  3M8E A;  3I56 I;  1DP3 A;  2YX4 A;  1OCO H;  3F6V A;  1JUM A;  1KU7 A;  4P96 A;  3IHU A;  3RPU D;  4MXM A;  5B66 C;  4XQF A;  3DEW A;  4IVN A;  1XC5 A;  3RYR A;  4V19 K;  4RMN A;  4BHP A;  3TOA A;  4F92 B;  2JPB A;  2ZNZ A;  3VOE A;  2DMP A;  4I01 A;  1B72 B;  3MWM A;  2FNP A;  2MC3 A;  3FWE A;  3NRG A;  3JRC A;  2LKS A;  5LGT A;  4JOM A;  2HKX A;  2PBI A;  4OIQ F;  1XCV A;  2ZJ2 A;  5FLV A;  2LG4 A;  4WXH A;  3QP5 A;  2UXO A;  5HSZ A;  3OYG A;  5IYD J;  5EYR A;  2KJB A;  5JHF A;  4MNU A;  1K6Y A;  1U8R A;  3W2V A;  3J80 K;  1U9O A;  2WV1 A;  2MH2 A;  2XRL A;  3MQ0 A;  1QZZ A;  3Q5F A;  2E36 A;  2HXI A;  3PAS A;  3GYH X;  3CJQ B;  3JSP A;  3FK7 A;  3W6J B;  2KDZ A;  2R7U A;  2WY8 Q;  3G1O A;  3FBI B;  4L9J A;  3SHF A;  3OYK A;  1ZR2 A;  1HDD C;  1UFM A;  2DT7 B;  2Y75 A;  5E3N A;  3MZH A;  3F9K A;  5TJJ A;  2W25 A;  2COB A;  2Z9O A;  1ZLK A;  3BZK A;  2OF7 A;  2KIS A;  5F0F A;  2MYS A;  2AO9 A;  3BR3 A;  3L2C A;  3K7A J;  3V42 A;  2HPM A;  5GAG J;  3KKD A;  2DOD A;  3V7S A;  1R6R A;  2WAF A;  3ABU A;  2MH9 A;  2YR2 A;  2XHK A;  5IYC J;  5TRD A;  3BQZ A;  1WJF A;  3HXL A;  2ZOY A;  4MIM A;  2NAZ A;  2QQ8 A;  4HA8 A;  4IHY A;  1U0J A;  2CWE A;  4CDG A;  5KHD A;  2XC7 A;  3QYB A;  2JSC A;  3T8T A;  5J8F A;  3R4K A;  3F23 A;  2QBY A;  4UB6 C;  4HDU A;  4B8X A;  2ELJ A;  1X1B A;  4D5C A;  1LQ1 A;  2R93 J;  3MKW B;  3ROU A;  1X1C A;  4IJA A;  4KYW A;  4YZE A;  4CIC A;  1XMX A;  2Q1Z B;  3PNV A;  3HPH A;  1MMG A;  2O8K A;  5FKL A;  5J1Y A;  2IW5 A;  2XF6 A;  3RKY A;  5JI6 A;  5E3O A;  1QO0 D;  3VOK A;  3WHB A;  2XF7 A;  5KK1 A;  5ERI A;  5GAE J;  1R36 A;  4N9H A;  2F5E A;  1YFH A;  3KEO A;  1DPU A;  4C2M A;  3WG9 A;  3FHZ A;  1WJ5 A;  5EDN A;  3DFG A;  1GLN A;  1ETX A;  2A69 F;  2MLK A;  3G2B A;  3HPG A;  3Q0W A;  1CQT A;  4XOP A;  4BXU A;  1TT0 A;  4LIU A;  4KWA A;  3CO6 C;  3M9A A;  3GZI A;  2E5N A;  2XF5 A;  3O8H A;  3QOD A;  3HTS B;  4AYB A;  4LLL A;  3LAP A;  4JBA A;  3I9V 2;  1IF1 A;  1Z3Y A;  3BZ6 A;  1OMI A;  1W7P A;  2VB6 A;  3NWT A;  3NI7 A;  4A0Z A;  2EIK H;  2NOG A;  4HYE A;  4HLY A;  1OR7 C;  2PMH A;  4CA0 A;  2ZB9 A;  2E35 A;  4ZYE A;  2EPF A;  1VQM I;  5EJC A;  3CDL A;  3LWF A;  3G3Z A;  2ZJP F;  4HOB A;  4V2G A;  1XMK A;  2GIZ A;  2I8D A;  2OUM A;  4BY7 J;  1KZH A;  3TO9 A;  2I10 A;  3U1D A;  1HW1 A;  4GFK A;  2W24 A;  4KFC A;  2F07 A;  4M3B A;  2EZH A;  4B44 A;  1MBK A;  4ZJZ A;  4WX9 A;  2M4K A;  1K7A A;  3HB9 A;  3TGN A;  1VQ5 I;  3GTJ J;  3CMY A;  2DFE A;  3HEF A;  2JJ7 A;  2JN6 A;  1FMW A;  3SWH A;  4XL9 A;  3AQT A;  5K1Y A;  4M9S A;  1HF0 A;  4XRF A;  5F0H A;  4A3C J;  1ON2 A;  2PI0 A;  1K4T A;  2QUF A;  4NN1 A;  1AOY A;  3H35 A;  2KIF A;  2DN0 A;  3RPU A;  2JVH A;  1BL0 A;  2QA4 I;  3S1Q J;  3CRJ A;  3OYD A;  2R7O A;  2WA0 A;  2DW4 A;  3CCU I;  3TP0 A;  4CYD A;  2EV0 A;  4J00 A;  4OMY A;  1LFB A;  4LK0 F;  1BOA A;  3E3V A;  4KN4 X;  3S32 A;  1HA8 A;  3T0Y A;  3F8F A;  2H1L A;  1P7J A;  4ME9 A;  2BBY A;  4RA2 A;  4OIP F;  2RDP A;  3J81 Z;  1ONV A;  2IJL A;  3E97 A;  4ETS A;  5L3G A;  2VBZ A;  4D5F A;  2LMD A;  3PPB A;  4I0B A;  2CRG A;  3JAM K;  1MND A;  3K6G A;  5AON A;  2Y48 A;  3OYH A;  2FJ1 A;  4OU0 A;  3MKZ A;  2PFB A;  3KPH A;  2AS5 F;  5IP9 J;  3HBL A;  4EJV A;  2DTR A;  4AVP A;  2M7A A;  2JWT A;  4M3G A;  3E7L A;  4U7B A;  4HDV A;  4G7Z F;  2E60 A;  3GZN B;  1YHQ I;  2HR3 A;  3N05 A;  3BCA A;  3V4G A;  3L2R A;  1KU2 A;  2TDX A;  2ZCW A;  2W7N A;  4EQQ A;  3ZP5 A;  1IUY A;  3FBN B;  1ZLJ A;  2NS8 A;  4PGH A;  3L9F A;  3W6V A;  2ME0 A;  1MD0 A;  3GEZ A;  2EFQ A;  3HSF A;  1XSV A;  2DA5 A;  2WTE A;  4EMS A;  2W48 A;  3RCO A;  4YIR X;  4N0B A;  4S0H B;  4DGW B;  1R5I D;  2CW7 A;  2GIV A;  4BU2 A;  4CSW A;  2LH9 A;  2ELH A;  3UNG C;  3V7R A;  2R92 J;  2RHA A;  1IN8 A;  2M1B A;  2LY9 A;  5DS9 A;  4J19 A;  3S14 J;  2Z5U A;  5IYB J;  5J3L A;  1KQ0 A;  1P4X A;  3TL4 X;  2IS6 A;  3SDG A;  1ZAR A;  9ANT A;  3EUH C;  3QPS A;  1WJA A;  2UUZ A;  3VUQ A;  5LHI A;  2E5Z A;  2VOO A;  4E70 A;  3EYI A;  3U9G A;  2ICW G;  1ZEL A;  4XLC A;  3IP4 B;  4JNN A;  3F0C A;  2H27 A;  4LG0 B;  5IT9 Z;  4RB0 A;  1OCC H;  2DOE A;  4LB6 B;  5FKM A;  1J59 A;  3IAS 2;  4A6D A;  3JRB A;  3OYC A;  2K4J A;  3VVZ A;  5DYM A;  2DT5 A;  1JKP C;  4D7M A;  1LFP A;  1YJ9 I;  3VOX A;  3N97 A;  2ZC2 A;  1OLT A;  1OYY A;  3O6B B;  3VDX A;  2XV4 S;  3A0H C;  1BW6 A;  5ICC A;  3LA7 A;  2QQB A;  2W53 A;  1OR7 A;  2HVR A;  3OIO A;  4KT5 C;  3ANG A;  1A04 A;  1UI5 A;  2LYC A;  3L2U A;  4FE7 A;  2DA2 A;  2DOA A;  2WV0 A;  4UY8 I;  1PDN C;  2KZG A;  2BXY A;  1W36 C;  3M3Y J;  4S04 A;  1IRX A;  4L5J A;  2J5O A;  1SAN A;  3FX3 A;  3L2Q A;  1FC3 A;  4M9Z A;  1H9T A;  3GFI A;  3E6C C;  1IN7 A;  2CQQ A;  3BT9 A;  1OJL A;  2X0L A;  4UB8 C;  2JTV A;  4QPQ A;  2DO7 A;  3WHC A;  3GTO J;  4DW6 A;  5D18 A;  2PN6 A;  1TQM A;  5CLS A;  2BHZ A;  3FZV A;  2DFI A;  2BHY A;  2V9V A;  2OV7 A;  5IP7 J;  3DP7 A;  3GW2 A;  2VT3 A;  3C2G A;  1TWG J;  4XLF A;  1K61 A;  5HAW A;  2Y31 A;  4HPQ A;  2E2I J;  1LEB A;  1N78 A;  2D5V A;  4OMZ A;  2JA8 J;  5GPA A;  1VND A;  5EGO B;  1FYK A;  4P5O A;  2KT0 A;  2EZL A;  2OTJ I;  3PQK A;  2PJR B;  2B9S A;  2ACJ A;  1CGP A;  1TTY A;  2P4W A;  2L7Z A;  2YSR A;  2VBW A;  2DK5 A;  2Q0O A;  3HRM A;  3GTG J;  3OR1 C;  1WSU A;  1I1S A;  1Y0U A;  2CQ7 A;  3PM1 A;  1UMQ A;  2MFZ A;  2R7D A;  2ZJQ F;  1TNT A;  3MCZ A;  5J4Y A;  3DEE A;  3GX4 X;  1PUF B;  3A1Y A;  3BNI A;  2O3F A;  1FP1 D;  5J1U A;  4A3E J;  2LC2 A;  2ZOZ A;  3BZC A;  1HKT A;  2E7X A;  2PMZ A;  3QYE A;  2RKH A;  1WVR A;  2OI8 A;  3FKJ A;  1XDS A;  2YVE A;  3IWZ A;  3DWL E;  3P9C A;  4TV7 A;  5HLH A;  1HSJ A;  3IL2 A;  3J7A Y;  4ZZD A;  4IOA F;  1LE8 B;  4BGD A;  3I59 A;  5KAF C;  2JA5 J;  3L09 A;  4C2M J;  2ZSH B;  4IHW A;  2QWW A;  2A2F X;  1K4S A;  1IN5 A;  3K4N A;  2NYX A;  1JXS A;  4EEF G;  3L00 A;  1OIS A;  4XM3 A;  4UUS B;  3D0S A;  2XDN A;  5C4Y A;  3HRT A;  1PVE A;  1XDU A;  2QSF X;  4IKF A;  1JUS A;  1IRF A;  3ZMS A;  3JTH A;  2G7L A;  4LLN A;  3RD3 A;  1QRY A;  2HZD A;  1A31 A;  1ZRE A;  2E1C A;  2GA2 A;  5D5V B;  1WHU A;  3SXY A;  5FRO A;  4HX4 A;  4CO8 A;  5HS8 A;  2E19 A;  2IA1 A;  2D6Y A;  3CUQ C;  3UKG A;  4G8X A;  4RGR A;  2ZXH A;  1T38 A;  1K6O A;  1SD7 A;  3K70 D;  2KQR A;  3QOE A;  4AVZ A;  2JA2 A;  4BJ5 C;  1P4A A;  3EUH A;  3KP3 A;  3S3O A;  5FLM J;  2K27 A;  2NXN B;  1KU3 A;  2X6O A;  1EF4 A;  2KLO A;  4OOI A;  1I1G A;  1F43 A;  2REK A;  2WUI A;  4KIC A;  1OKR A;  2E2H J;  3CCL I;  3V78 A;  1YJN I;  2ECC A;  1A5J A;  5EGO A;  2VBX A;  4ENM A;  4A2U A;  4EGY A;  4LLG F;  3MFK A;  1KON A;  4I0A A;  3J7A O;  2GLO A;  4A3K J;  1SVO A;  2X6W A;  2R7W A;  2FRH A;  2O8X A;  1T2K A;  1BW5 A;  1G6N A;  2ZXJ A;  3CCV I;  4IHV A;  4MFD A;  3BRO A;  4RS8 A;  3OYM A;  3OIP A;  3VIB A;  2ZME C;  2Y0S N;  2FA5 A;  1W0T A;  3K4B A;  1SFX A;  4IRV A;  4ZTF A;  3DPL C;  3LWJ A;  2A6E F;  2DFF A;  1XSX A;  3I58 A;  4ESB A;  1BI0 A;  2KPM A;  3ERM A;  4KDP A;  2K3P A;  2BXZ A;  4CZZ A;  1TQP A;  4L9N A;  3CC7 I;  4HG2 A;  5ILV A;  1U3E M;  5D6E A;  1YJW I;  2VUM J;  4GFB A;  2G9W A;  1LDJ A;  4Z6Y A;  1SAX A;  3TP3 A;  2M4G A;  2ZXI A;  4R1H A;  2RRE A;  3DPJ A;  1IRG A;  3ONQ A;  4MEY F;  4HQE A;  1TT5 B;  2VPR A;  2FUG 2;  4RM2 A;  3VSK A;  1DP7 P;  2HI3 A;  1YE9 A;  1TWA J;  1E3H A;  4A3L J;  1Y1V J;  2L5Q A;  2P7V B;  3LST A;  1RPW A;  4UUS A;  2FXA A;  3CMM A;  4FCY A;  5EFY A;  3LA2 A;  4M6V A;  4BHB A;  3MZY A;  1GUU A;  1VQ8 I;  1KYZ A;  4WWC A;  5F08 A;  4XLH A;  2EZK A;  3KZY A;  3MVP A;  1FPQ A;  3VYU B;  2QGU A;  3IKT A;  2CU7 A;  3I5U A;  3ZCO A;  3BJO A;  5E1X A;  4CCN A;  2EFN A;  3ZMZ A;  2AQF A;  3JAM Z;  4G7H F;  1TW2 A;  1X2M A;  2P5V A;  4BY1 J;  3V7C A;  3BG6 A;  1R1V A;  3HIM A;  2G7H A;  3FM3 A;  1J7K A;  1Z6R A;  3LA3 A;  4PSX A;  1R5H A;  1XD7 A;  3NPI A;  5DAJ A;  4Y17 A;  2R7Z J;  1FT9 A;  1ETQ A;  3G71 I;  3NNR A;  2HOE A;  5HDK A;  1IAW A;  3BR1 A;  1SEU A;  3U2R A;  3H36 A;  5GAD J;  1HOM A;  2Z3Y A;  2GA1 A;  1VI0 A;  1Z7L A;  5F27 A;  3CCE I;  1BJA A;  2MAB A;  3D5S C;  1ETV A;  2BEO A;  5AIP A;  3WU0 A;  4RM3 A;  4BEH B;  1XTA A;  1KGS A;  5ICF A;  4A0X A;  3W3C A;  2M0C A;  3KP7 A;  1SFK A;  2L0K A;  5LHG A;  3J7Y J;  3CUQ A;  1S72 I;  4DJA A;  3J81 K;  4JK1 X;  2DAO A;  1JT0 A;  2ZCN A;  3F8B A;  2VPL A;  2CQX A;  2L9R A;  3S2W A;  1P6R A;  3CLO A;  5F6F A;  3HKZ N;  3HOU J;  4MTE A;  5DCF A;  4L5I A;  3TMO A;  3K9T A;  1T08 B;  3B02 A;  2W4S A;  4DQ2 A;  1T98 A;  4PUS A;  4O6J A;  4BQA A;  1KU9 A;  1O57 A;  4HV6 A;  2K85 A;  3M7G A;  3E1S A;  3OYL A;  2YPR A;  1WRJ A;  1Y39 A;  1GVJ A;  1I6H J;  2MA3 A;  3GVA A;  2UXP A;  4ENK A;  4MGR A;  4C2T A;  2W85 A;  1ENH A;  1G3S A;  1V5G A;  2XAH A;  3BDD A;  4UUV A;  1BR2 A;  3JRH A;  1WJB A;  1PUE E;  1Y8R B;  3MEX A;  4IL6 C;  1XB4 A;  1PYV A;  2K40 A;  3PSI A;  4Z2Y A;  3T8R A;  2WY7 Q;  3LHQ A;  4I98 B;  2O6G E;  1RES A;  1SFO J;  2MSY A;  4ANJ A;  1ZRF A;  2XIG A;  4YFN F;  5K58 A;  3P9K A;  4LG3 A;  2JPC A;  5JFR A;  1R4M B;  4HX7 A;  3ZMV A;  2UXN A;  2PZ9 A;  2OJE D;  3LSK A;  4M3F A;  3ABL H;  3A01 A;  1D8K A;  2H1K A;  3DV8 A;  4UVC A;  2NVQ J;  3IAM 2;  1NH3 A;  2VIX A;  1JJ6 C;  2GQQ A;  2PMZ N;  1W7P D;  4QIW N;  4HNV A;  1ZGA A;  3ECO A;  4QTR A;  1SFU A;  3IV5 A;  1NG6 A;  2LLK A;  2WAQ N;  4K2E A;  4L9V A;  2LRE A;  3HJE A;  3QU6 A;  4IHT A;  3HTJ A;  2VN2 A;  3PNY A;  4DYQ A;  2XRN A;  3GTQ J;  2RNG A;  1P4W A;  3HGG A;  4B3A A;  1NTC A;  1MNM C;  1S9H A;  5IPA A;  4FX0 A;  2QBY B;  2L4A A;  2V1D A;  4NB5 A;  1V55 H;  2G7U A;  2H8W A;  3DU6 A;  1U8B A;  5HOD A;  3F72 A;  3TKY A;  3QPL A;  3DCF A;  1Z77 A;  4BEH A;  1IC8 A;  2OZU A;  3N4M A;  5B5E C;  2LF8 A;  2DPD A;  4A12 A;  1J75 A;  1HKS A;  1MBG A;  4DZJ A;  5JLX A;  1BC8 C;  2DMN A;  4DNC A;  1YLF A;  3C2B A;  3LSM A;  1LKX A;  3DF8 A;  4HLX A;  4P9U A;  3OR2 C;  3RKQ A;  3VW0 A;  3CDH A;  2M87 A;  4LK1 F;  2DOF A;  3S3M A;  2R5Z B;  3F1B A;  2BY0 A;  3ZMU A;  4ABZ A;  4N9I A;  3TDZ C;  2RNJ A;  4BKX A;  5IY5 H;  2HWV A;  3FIW A;  2LP0 A;  2UV1 A;  3EUA A;  1TWF J;  2F5D A;  2BGC A;  3PIO F;  2L7F P;  3H92 A;  4P55 A;  4IPA A;  3KKC A;  1FTT A;  4D7N A;  4AC6 A;  4A3F J;  2XGC A;  1W7P B;  2IS2 A;  3ON2 A;  5HLI A;  2X4H A;  3BTJ A;  5JHU A;  2RVC A;  4HAM A;  2O0Y A;  2JUC A;  4EJW A;  4HZF A;  4ESJ A;  2VC0 A;  2VC1 A;  1I3A A;  3RDI A;  1VQ7 I;  3G1L A;  2CSO A;  1FJL A;  5E8G A;  4XKV A;  1W4M A;  3CJT B;  2OC6 A;  1YRN B;  5C4X J;  2D1H A;  2NNY A;  1R9T J;  2EFW A;  3MMY B;  3CCQ I;  3H9G A;  2DLL A;  3S8P A;  4JL3 A;  5H9T A;  1Z9C A;  1IGN A;  3VW1 A;  3JRG A;  2CYY A;  1WJC A;  2MG4 A;  3WTU C;  2FNA A;  2LKX A;  5HDN A;  1FOW A;  1RNL A;  4M74 A;  2FBH A;  3FXL A;  2DMU A;  3HIF A;  2B7E A;  5CXI A;  1XCB A;  2GBY A;  3L1P A;  2OBP A;  4PJJ A;  1IV8 A;  3QRF F;  3E6B A;  2FJI 1;  3F6O A;  2KJC A;  1O3S A;  1LPQ A;  5B1B H;  2V79 A;  3I54 A;  3DBR B;  1I3Q J;  5D19 A;  2VJ4 A;  2ZBK A;  4Y15 A;  3MKL A;  3QAH A;  5CVJ A;  1JGG A;  4BBS J;  5EG0 B;  5L3D A;  1YW7 A;  1VQN I;  3J7Z I;  1M1E B;  5E3M A;  3DKX A;  3DU5 A;  3SZT A;  3FXO A;  1FP2 A;  5LBQ A;  1KQ8 A;  2EQR A;  3B73 A;  1U6G A;  2E7W A;  5CVI A;  1T33 A;  1FOY A;  2Y9Z A;  3X2Q H;  4GFL A;  2HDC A;  4E4H A;  5D1R A;  3E5Q A;  5M5Y J;  2K86 A;  4M9X A;  4A93 J;  1F4K A;  3DKW A;  4HW0 A;  2A5Y B;  1RUN A;  2HQN A;  5K7H A;  2V9K A;  3CO7 C;  2QOP A;  2VE8 A;  4ITV A;  2KMU A;  5DD8 A;  5GTI C;  1HDP A;  1B9N A;  3BR2 A;  5GAH J;  2R5Z A;  1STZ A;  4DYR A;  4CYC B;  4BH9 A;  3G73 A;  3WTZ A;  4GCL A;  3RI4 A;  5LFA A;  1AWC A;  4XON A;  2ESH A;  3TO6 A;  2BYV E;  4NQW A;  3QPH A;  4M6Y A;  5EEA A;  2H8R A;  3BG3 A;  2ZCX A;  2A61 A;  4UNO A;  2VJ5 A;  2L3D A;  2HVS A;  1TZL A;  1ZQ3 P;  4NNJ A;  2NRA C;  2M30 A;  3SFZ A;  3RPQ A;  4KIS A;  3HOZ J;  2JVG A;  4GYG A;  3LSG A;  2Y69 H;  3SDB A;  4JYK A;  4X1E A;  4F93 B;  1YRN A;  2VQG A;  1Z67 A; 
#chains in the Genus database with same CATH homology
 3GTO J;  3JRI A;  1G2H A;  3IUV A;  4DW6 A;  5D18 A;  1JUP A;  1JJ8 C;  3FRQ A;  3BTC A;  2NS7 A;  1LE8 A;  2JMW A;  2V57 A;  2NX4 A;  1WH5 A;  5IP7 J;  5FGL A;  4L5E A;  3HOW J;  1TWG J;  2K9N A;  3RZD J;  3GTP J;  2FX0 A;  3CCY A;  1K61 A;  5HAW A;  5M3M J;  2Y31 A;  2E2I J;  2VI6 A;  2D5V A;  1DU6 A;  3LOC A;  1BJZ A;  2JA8 J;  5GPA A;  1VND A;  5EGO B;  4GCK A;  2KT0 A;  2EZL A;  2QKO A;  3A02 A;  5F0C A;  4A3D J;  5IP6 A;  2L7Z A;  3HM5 A;  4UUT A;  3VW2 A;  3GTG J;  5EG0 A;  3S1M J;  5AQC A;  2DMT A;  3PM1 A;  2Y30 A;  1UMQ A;  2LD5 A;  2WGB A;  1OCT C;  2X9D A;  3GTL J;  2YS9 A;  2TCT A;  3CQZ J;  3JRD A;  1PUF B;  3BNI A;  4BXX J;  2O9L A;  1AHD P;  5J1U A;  4A3E J;  2ZOZ A;  1WPK A;  2G3B A;  2OI8 A;  4JP0 A;  2UXU A;  4G12 A;  3AQS A;  1QVT A;  3PO3 J;  2MGQ A;  2O7T A;  2YVE A;  4L62 A;  2PBX A;  2ZCM A;  2QF7 A;  1ZGW A;  3QBM A;  2IEK A;  3LSJ A;  3Q0V A;  1LE8 B;  2JA5 J;  3O60 A;  3V6G A;  4DYC A;  2NVX J;  4C2M J;  2QIB A;  4IHW A;  1ZTR A;  2NP5 A;  4IEJ A;  2QWT A;  1O4X A;  3BG9 A;  4EEF G;  5GPC A;  1HCR A;  1FEX A;  2X48 A;  4JKZ A;  3VVY A;  4MO7 A;  4BBR J;  4UUS B;  2LFB A;  2DG7 A;  2HOA A;  4CYC A;  2XDN A;  2GM4 A;  5C4Y A;  3COL A;  1LFU P;  1JUS A;  2ELK A;  2XPW A;  2G7L A;  3H3V K;  3G56 A;  3RD3 A;  1RKT A;  1QRY A;  3RH2 A;  4A3B J;  1APL C;  2FD5 A;  1OFC X;  3MNL A;  2HOS A;  1D5Y A;  3VPR A;  5K7Z A;  3B6C A;  3LJL A;  2E19 A;  2D6Y A;  2XSD C;  4XRM A;  3UKG A;  1F36 A;  4A69 C;  3HTA A;  2QCO A;  2XPV A;  2K9Q A;  3FKI J;  3G1M A;  4NEL A;  1JKQ C;  2HQ5 A;  2P81 A;  1IUF A;  3EGQ A;  5HBU A;  1H89 C;  3S2D J;  2N8G A;  4LOC A;  1U78 A;  5FLM J;  4A3G J;  3S15 J;  3S17 J;  2X6O A;  1IG7 A;  3KNW A;  1EF4 A;  4JX5 A;  5C4J J;  1GT0 C;  3I4N J;  2WB1 N;  4Y52 J;  4ICH A;  2ECB A;  1F43 A;  2REK A;  2WUI A;  2LR8 A;  2E2H J;  3V78 A;  2ECC A;  3KZ9 A;  4MLO A;  1TWH J;  4IHX A;  1A5J A;  5EGO A;  4C3J J;  3CWR A;  2GFN A;  1MBH A;  2XGE A;  3JSJ A;  2GLO A;  2IU5 A;  4A3K J;  1WCM J;  2ME6 A;  3Q0U A;  2DMQ A;  4IHV A;  4JX6 A;  1BW5 A;  4MFD A;  3S5R A;  4B4C A;  3VIB A;  1W0T A;  2Y0S N;  5M5X J;  1JTX A;  2Y2Z A;  3I4M J;  3O8G A;  1FTZ A;  1IV6 A;  2DTZ A;  3TED A;  4RDU A;  1B8I A;  3LWJ A;  1MBF A;  3BTL A;  3BR6 A;  1JKO C;  2GEN A;  1JTY A;  3GTK J;  4ACI A;  2Y9Y A;  2OPT A;  3ZOB A;  1ZKG A;  1BA5 A;  5CW8 A;  2VUM J;  1QVU A;  4GFB A;  2NVT J;  2ID6 A;  3TP3 A;  3EUP A;  3DPJ A;  3A03 A;  2AHQ A;  2DA1 A;  1XS9 A;  5IOY A;  1B72 A;  2HDD A;  2RAS A;  3VP5 A;  3BJB A;  2VPR A;  1RR7 A;  1ETW A;  1WH7 A;  4PXI A;  2HI3 A;  2EBI A;  5E3L A;  1TWA J;  5FKO A;  4A3L J;  1Y1V J;  1GV2 A;  3ZQH A;  4A3I J;  4A3M J;  1RPW A;  4UUS A;  5DTD A;  2FQ4 A;  4FCY A;  5EFY A;  4M6V A;  1GUU A;  1ORK A;  4AC0 A;  2RAE A;  1HLV A;  2NP3 A;  2DA6 A;  3BCG A;  1X2N A;  5F08 A;  1ZR4 A;  1SGM A;  1ITY A;  2EZK A;  3ZQC A;  5FJ8 J;  1NK2 P;  3HOV J;  3ZQF A;  3GEU A;  2E2J J;  3MVP A;  4C3H J;  3M4O J;  4V2F A;  1JUM A;  2CU7 A;  1B8I B;  1MH3 A;  1WI3 A;  4MXM A;  3SFI A;  1X2M A;  3DEW A;  4BY1 J;  1XC5 A;  3JRF A;  2HYT A;  4XRS G;  3HIM A;  3D1N I;  3B6A A;  1H88 C;  3FK6 A;  2MW8 A;  1AU7 A;  4UDS A;  3HTH A;  5EF6 A;  1T56 A;  3NPI A;  3NAU A;  4MFE A;  2R7Z J;  5DAJ A;  4FE4 A;  2DMP A;  1RKW A;  1B72 B;  1ETQ A;  3NNR A;  1A6I A;  3BR1 A;  3NRG A;  3JRC A;  5FHP A;  2YU9 J;  1HOM A;  5J1R A;  5FLV A;  1VI0 A;  5F27 A;  2E1O A;  2UXO A;  2M8G X;  5HSZ A;  1ETV A;  3LSR A;  4B1R A;  5EYR A;  5IYD J;  3OSG A;  3QKX A;  3S1N J;  2OER A;  1U9O A;  2M0C A;  2DJN A;  2WV1 A;  2L0K A;  3VVX A;  2XRL A;  3HOX J;  2HXI A;  2XPU A;  3PAS A;  1JT0 A;  2ZCN A;  1GVD A;  3FK7 A;  2KDZ A;  5F1J A;  2CQX A;  1HDD C;  3G1O A;  2L9R A;  4Y7N J;  1ZR2 A;  3HOU J;  3HKZ N;  4M3E A;  5E3N A;  5FMP A;  1JT6 A;  2COB A;  2JK3 A;  2G7S A;  3S2H J;  1AKH B;  2OF7 A;  5CXG A;  5F0F A;  2AO9 A;  3BR3 A;  3K7A J;  2LK2 A;  3KKD A;  2DG8 A;  3PO2 J;  3BR0 A;  5IYC J;  4M3D A;  3BQZ A;  2ZOY A;  4NDL A;  4MIM A;  3S1R J;  1I6H J;  3JRE A;  1IRZ A;  2UXP A;  2K9S A;  2UXI A;  1GV5 A;  3HOY J;  1ENH A;  4IHY A;  3CJD A;  3P9T A;  3JRH A;  3JRA A;  3FIS A;  3HE0 A;  1Q1V A;  1OCP A;  2IAI A;  2K40 A;  4D5C A;  1QPI A;  1ETY A;  3LHQ A;  2R93 J;  4YZE A;  3GBG A;  1RES A;  5FKN A;  1MSF C;  2Q24 A;  1SFO J;  2O8K A;  4MK6 A;  2XGD A;  3B81 A;  2MSY A;  5FKL A;  2FBQ A;  5J1Y A;  3MN2 A;  5E3O A;  5K58 A;  2ID3 A;  4HKU A;  2DA3 A;  3OOU A;  3VOK A;  3WHB A;  1MBJ A;  2PZ9 A;  3K2A A;  4M3F A;  3NXC A;  1IDY A;  5C44 J;  3A01 A;  5EDN A;  1ETX A;  2H1K A;  1CQT A;  3Q0W A;  2NVQ J;  1JJ6 C;  1IDZ A;  4KWA A;  2PMZ N;  1TC3 C;  3GZI A;  2EH3 A;  4QIW N;  3O8H A;  1NK3 P;  4I76 A;  4HNV A;  4QTR A;  3T6N A;  1UG2 A;  3IV5 A;  2LLK A;  2WAQ N;  1UI6 A;  3NI7 A;  3HTJ A;  4DYQ A;  3HTI A;  1S7E A;  2M34 A;  3GTQ J;  2NOG A;  3HGG A;  4B3A A;  5JLW A;  4W1U A;  1NTC A;  4XRS A;  1MNM C;  2ZB9 A;  2DA7 A;  3CDL A;  5IPA A;  1GDT A;  3G7R A;  3BQY A;  4V2G A;  4BY7 J;  2CUF A;  3TW6 A;  1U8B A;  3HDD A;  2I10 A;  5HOD A;  3HGY A;  3QPL A;  4GFK A;  3DCF A;  1Z77 A;  1IC8 A;  1ZK8 A;  5IOZ A;  3LSP A;  2F07 A;  1P7I A;  4M3B A;  2EZH A;  2LTP A;  1MBK A;  1Y1W J;  3IH4 A;  1MBG A;  1RET A;  4DZJ A;  5JLX A;  2CJJ A;  3HB9 A;  1MSE C;  3ANP A;  2DMN A;  3GTJ J;  3CMY A;  4XIC A;  1XG1 A;  2HYJ A;  3C2B A;  3HEF A;  3LNQ A;  1X58 A;  3RKQ A;  3S16 J;  3VW0 A;  2JJ7 A;  2JN6 A;  1FIP A;  4AUX A;  3ON4 A;  3A01 B;  2R5Z B;  3AQT A;  3F1B A;  4ABZ A;  1HF0 A;  4BKX A;  3WHC A;  4W97 A;  3FIW A;  5F0H A;  2LP0 A;  4A3C J;  4RBO A;  1TWF J;  1AKH A;  4NN1 A;  3ZQL A;  2DN0 A;  2VKV A;  2G0E A;  1BL0 A;  1I50 J;  3S1Q J;  2DA4 A;  4XK4 A;  1IJW C;  2L7F P;  3KKC A;  1FTT A;  4D7N A;  2G7G A;  4AC6 A;  4A3F J;  3CRJ A;  2R5Y A;  2XGC A;  2XB0 X;  3ON2 A;  3TP0 A;  3BTJ A;  2EZI A;  1E3O C;  1K83 J;  2XB5 A;  1LFB A;  1POG A;  2IBD A;  3G1L A;  1FJL A;  3BHQ A;  2QTQ A;  1P7J A;  4ME9 A;  2NVY J;  2M9H A;  2HKU A;  1TWC J;  1YRN B;  5C4X J;  3BRU A;  1R9T J;  4D5F A;  3ZQG A;  3PPB A;  4X6A J;  2CRG A;  3IH2 A;  4JL3 A;  5H9T A;  1IGN A;  3VW1 A;  3JRG A;  2FJ1 A;  2MG4 A;  2LKX A;  5IP9 J;  3HBL A;  3RQI A;  3SJM A;  4QSH A;  2UXH A;  4XID A;  2DMU A;  2GUH A;  5CXI A;  3BTI A;  2GBY A;  2JWT A;  4M3G A;  3L1P A;  1VF9 A;  3E7L A;  2YVH A;  1I3Q J;  2LVS A;  5F04 A;  4C3I J;  4FTH A;  1DU0 A;  5D19 A;  1VFC A;  3MKL A;  1U9N A;  1JGG A;  4BBS J;  5EG0 B;  1JKR C;  2NS8 A;  5E3M A;  1FIA A;  1MBE A;  2R5Y B;  5C3E J;  4I6Z A;  3W6V A;  1MH4 A;  2ME0 A;  2VKE A;  4AYB N;  2DA5 A;  2EQR A;  2R0Q C;  2JA6 J;  2W48 A;  2O7O A;  2TRT A;  3C07 A;  1T33 A;  2Y9Z A;  3BR5 A;  4S0H B;  5EZH A;  4GFL A;  2R92 J;  5D1R A;  4JX4 A;  5M5Y J;  4A3J J;  1ETK A;  2L7M P;  2RHA A;  5M5W J;  5EZG A;  2CUE A;  3E7Q A;  4A93 J;  4AF5 A;  2B63 J;  2LY9 A;  5GP9 A;  4GCT A;  2JA7 J;  5DS9 A;  4J19 A;  3S14 J;  5IYB J;  5J3L A;  1UHS A;  3QQA A;  3GTM J;  5K7H A;  3SDG A;  1Z0X A;  9ANT A;  2QOP A;  3QPS A;  3VUQ A;  1HDP A;  4JNN A;  3F0C A;  3H0G J;  3BR2 A;  2R5Z A;  5FKM A;  4DYR A;  3TW7 A;  4CYC B;  3JRB A;  1ETO A;  2YUS A;  3VVZ A;  4GCL A;  1JKP C;  5K7F A;  1W0U A;  4D7M A;  2HXO A;  2M2E A;  3VOX A;  1H8A C;  5BNG A;  1BW6 A;  5FKK A;  5EEA A;  2H8R A;  3BG5 A;  3BG3 A;  2W53 A;  3RZO J;  2ZCX A;  3OIO A;  3ANG A;  1PUF A;  3ZQI A;  1ZQ3 P;  1UI5 A;  4CGR A;  3NAR A;  4FE7 A;  2DA2 A;  3JR9 A;  4DZP A;  3Q3S A;  5M3F J;  2HOT A;  3M3Y J;  3HOZ J;  3IH3 A;  3LSG A;  1SAN A;  4JYK A;  4X1E A;  4FIS A;  2CQQ A;  3BT9 A;  1OJL A;  1YRN A;  3OSF A;  1WGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...