2Y31A

Simocyclinone c4 bound form of tetr-like repressor simr
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
b'PVSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 92
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y31A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y31A02
2HXOA 4M3GA 1F43A 2WUIA 1YRNB 3O8GA 4UUTA 3JREA 1MBFA 2M9HA 3HGYA 5EZHA 4JNNA 2M8GX 2WB1N 3GTOJ 4QIWN 2JJ7A 3S1QJ 1ZGWA 4AC0A 2MG4A 3JRHA 2K9SA 3HM5A 5IOYA 3S15J 2ZCXA 1TWAJ 4FCYA 2EZKA 2NS8A 3ZQFA 3O60A 1JJ6C 3B81A 2EZIA 1LFUP 1Z0XA 3FKIJ 1P7JA 3TW7A 3UKGA 4A3FJ 1MBKA 2VPRA 1R9TJ 5C4YA 3VVXA 3KKDA 1T56A 4ICHA 2XRLA 1OJLA 2EQRA 4BBRJ 3HGGA 4ME9A 2ZCNA 1Z77A 3ZQIA 3GEUA 4M3FA 2OERA 5FKKA 3PM1A 3HOZJ 2X48A 5M3MJ 2G7LA 3GTMJ 3IH4A 2L7MP 4C3IJ 3JR9A 2R5YB 2COBA 2LR8A 1VNDA 5GP9A 1ZK8A 1MBHA 5K7HA 3SJMA 2ID3A 3RH2A 5CXGA 2VI6A 1IUFA 5HODA 3HTJA 2DA2A 3BR5A 3RQIA 2CQXA 2GENA 2DA4A 3IV5A 3JRCA 1POGA 2R7ZJ 1B8IB 3KZ9A 1WH5A 5F04A 2O7OA 5FKOA 3JRIA 1HLVA 2FQ4A 5IYDJ 1ETYA 3BQZA 2K9QA 2P81A 3S2HJ 3FRQA 2NVTJ 4UDSA 2DJNA 4W97A 3PPBA 4JX4A 3HOUJ 4B4CA 3G1OA 4CYCA 2MSYA 4A3DJ 2CUEA 2WAQN 3RZDJ 2NP3A 4C2MJ 3D1NI 1ZQ3P 4HNVA 2LKXA 2OPTA 4AYBN 3JRGA 2UXIA 4D7MA 3TEDA 5K7ZA 4UUSA 1JKQC 5C3EJ 1B72B 2D5VA 3QPSA 3BTLA 1ZKGA 2R0QC 2Y9ZA 2IEKA 2DA3A 5EF6A 1GDTA 4FE4A 2YVHA 4GCLA 5H9TA 2NVXJ 5EEAA 1RESA 1RKTA 3JRAA 4NELA 4IHXA 3ANPA 3A02A 1HDPA 1JJ8C 1LE8A 3SFIA 4IHVA 2NS7A 2REKA 2WV1A 3ZQLA 1JKOC 2DA6A 1IDZA 2DMQA 1HF0A 5FLMJ 2FBQA 1FIPA 3P9TA 2FD5A 3NARA 2YUSA 1G2HA 3BCGA 3VOXA 5E3OA 5J1YA 2VUMJ 3GTGJ 4A3IJ 5FKMA 2YVEA 4LOCA 3VW0A 4FISA 3AQSA 2G0EA 5FGLA 2G7GA 4JX5A 1ETVA 3V78A 4D5CA 4YZEA 5K58A 2Y31A 2LP0A 1AKHA 3VW1A 4D5FA 4DYCA 2EH3A 3BRUA 1U78A 1TWHJ 1H8AC 1H89C 5EZGA 2ZCMA 5FJ8J 4BKXA 2O8KA 5IYCJ 2RAEA 2Y9YA 4A3CJ 1I3QJ 1JKPC 2DG8A 4XRMA 1SANA 1SFOJ 3TW6A 5EFYA 2ZB9A 2KT0A 3HOWJ 5AQCA 5F0FA 3ZQCA 5BNGA 2JA6J 2JA8J 4M3DA 2QKOA 2R93J 2XGDA 1APLC 2FJ1A 2QTQA 3OIOA 1IJWC 2E1OA 2NP5A 4IHWA 2E2HJ 3T6NA 5C4JJ 3FIWA 4QSHA 3VIBA 2DA1A 1LFBA 4I76A 1AHDP 3A03A 1WI3A 2XPWA 2F07A 5CW8A 4A69C 5FMPA 5IYBJ 5J3LA 2DA7A 3S16J 1OCTC 3VW2A 1MH4A 3GBGA 1U9OA 4DW6A 3BG5A 9ANTA 2NVYJ 3CQZJ 2CU7A 2E2IJ 3MNLA 5FKLA 2H1KA 3G7RA 2FX0A 1E3OC 1BA5A 4JP0A 1ZTRA 1VF9A 3BG9A 4W1UA 4M6VA 4A93J 4BY7J 2UXHA 5F27A 3HOXJ 5HAWA 2JMWA 3JRBA 4AF5A 3HE0A 2HOAA 3LOCA 1Q1VA 4J19A 4HKUA 2HYJA 3BNIA 4A3BJ 3VOKA 4MK6A 2N8GA 3H0GJ 3S14J 2GBYA 4MFDA 3RD3A 1MSEC 3HOYJ 5EGOA 3BTCA 2JA5J 3RKQA 2LD5A 2XGEA 2ZOYA 3BR6A 1JT6A 1X2NA 2X6OA 3GTLJ 4X1EA 3IUVA 5M5YJ 4JX6A 1UI6A 5DAJA 1CQTA 1MBJA 2E2JJ 5CXIA 2AO9A 2IAIA 1BL0A 3PO3J 4DZJA 4G12A 1PUFA 3S1MJ 3JRDA 5JLWA 2PMZN 3COLA 2PBXA 3NAUA 4C3HJ 3WHBA 3JRFA 1U8BA 4GFLA 1XC5A 3TP3A 3I4NJ 3C2BA 1GVDA 2CRGA 5IOZA 3A01A 2V57A 2Q24A 2LFBA 3DEWA 5E3LA 3MVPA 4D7NA 3LSPA 4A3MJ 2HQ5A 3IH2A 5EDNA 4I6ZA 1W0UA 3LSGA 3EUPA 3S1NJ 3B6CA 2LVSA 2TCTA 2NOGA 2E19A 3OSFA 3BR1A 3VUQA 1Y1VJ 4L5EA 1JGGA 3G1LA 3V6GA 4CYCB 2HKUA 3BJBA 4L62A 1FEXA 2RHAA 1MH3A 3GTJJ 1IG7A 4XK4A 5FHPA 1X58A 2R5ZA 1ENHA 5JLXA 4FE7A 3K7AJ 1FTZA 2M2EA 3SDGA 4FTHA 1NTCA 4Y52J 3KNWA 2ME6A 2QF7A 1JUSA 2DMTA 2UXOA 3HDDA 1ITYA 2IBDA 1VI0A 2LK2A 1ETKA 4CGRA 4JL3A 5F0CA 2PZ9A 1ETOA 2GFNA 1FTTA 4PXIA 1QVTA 2DMPA 3C07A 1UMQA 3GTKJ 3VP5A 5EG0A 1LE8B 3LJLA 2M34A 1MBGA 3CWRA 3GTQJ 3NRGA 1I50J 2WGBA 2VKEA 2JWTA 3QKXA 1TWFJ 1IC8A 2ECBA 1ETQA 1RETA 1UI5A 3S2DJ 2D6YA 2NX4A 3MN2A 1XG1A 1HDDC 4DYQA 2LLKA 3F0CA 1FJLA 3GTPJ 2ID6A 3BR0A 1EF4A 4ABZA 4JKZA 5DTDA 5C44J 5EYRA 4BBSJ 3QBMA 4RDUA 3M3YJ 4QTRA 1JTYA 3EGQA 4JYKA 2IU5A 3VVYA 4GCKA 3CCYA 1QRYA 2QWTA 2QOPA 5M5WJ 1AKHB 1VFCA 2W48A 3HBLA 3HKZN 2L9RA 2UXUA 1YRNA 5IP9J 4KWAA 1JKRC 3Q0VA 1HCRA 4XICA 3CDLA 1JUMA 3BQYA 2TRTA 1IRZA 2YS9A 3OSGA 2G3BA 2RASA 3LNQA 1RPWA 3LSRA 5K7FA 2HOSA 2DN0A 2MGQA 1BJZA 2HI3A 3H3VK 3S17J 2ME0A 3HEFA 2Y0SN 4MIMA 2EBIA 4NDLA 5D19A 1K83J 2L7ZA 4X6AJ 2NVQJ 2LY9A 1RR7A 4V2FA 3RZOJ 3E7QA 2XPVA 4DZPA 4MLOA 2XPUA 3ANGA 4AUXA 1WH7A 5D1RA 2EZLA 2YU9J 3HTAA 4NN1A 3NNRA 3NXCA 5IPAA 2DA5A 2XGCA 2GM4A 3IH3A 2OF7A 4ACIA 1A5JA 3W6VA 1NK2P 2HDDA 3I4MJ 3NI7A 2ECCA 1IV6A 1F36A 4A3GJ 4MXMA 3Q3SA 5D18A 3ON4A 1RKWA 2R5YA 4GCTA 3QPLA 4EEFG 4BXXJ 1DU0A 2K9NA 1JT0A 1W0TA 3VVZA 2KDZA 2L7FP 1FIAA 3TP0A 1GV2A 1ORKA 3BR2A 2DTZA 3BHQA 2XSDC 2R92J 4RBOA 4B3AA 1D5YA 2CUFA 1TC3C 1SGMA 1TWGJ 1B8IA 1GT0C 1XS9A 5FKNA 3NPIA 5F1JA 5EGOB 2HXIA 5GPCA 2O9LA 4DYRA 1JTXA 1DU6A 3MKLA 1QVUA 2Y2ZA 4M3EA 3HTHA 4A3LJ 3PO2J 1O4XA 3JSJA 4A3EJ 5FLVA 3FK6A 5J1UA 5IP6A 1UHSA 2ZOZA 2CJJA 1JUPA 1PUFB 1MNMC 3Q0UA 3LWJA 4Y7NJ 2LTPA 1ETXA 2VKVA 1ZR2A 2DG7A 1B72A 1NK3P 2Y30A 1IGNA 3DCFA 2I10A 2MW8A 1X2MA 5F0HA 1A6IA 3BTJA 2XB0X 3BG3A 1MSFC 3A01B 3CRJA 3S1RJ 3KKCA 1P7IA 4MO7A 4GFBA 2ELKA 4UUSB 1ZR4A 3GZIA 3ZQGA 1IDYA 2DMNA 1TWCJ 4BY1J 1QPIA 5DS9A 1OCPA 5HBUA 2GLOA 2HOTA 4GFKA 5M3FJ 3BTIA 1GUUA 3DPJA 5HSZA 2AHQA 2G7SA 1S7EA 3ON2A 1T33A 5E3NA 1ETWA 4IHYA 2HYTA 1U9NA 3CJDA 2O7TA 2R5ZB 4A3JJ 2JK3A 3LHQA 5IP7J 2JN6A 3B6AA 2W53A 1WPKA 3E7LA 4A3KJ 3HIMA 4C3JJ 4V2GA 2QIBA 2L0KA 2GUHA 4S0HB 3M4OJ 2CQQA 3HB9A 1GV5A 2OI8A 2B63J 3O8HA 5F08A 2DMUA 2M0CA 4XRSG 2JA7J 1HOMA 1UG2A 4AC6A 3F1BA 1I6HJ 1Y1WJ 3OOUA 1MBEA 5EG0B 3BT9A 1WGXA 3LSJA 4XIDA 2QCOA 3G1MA 1K61A 1H88C 3PASA 3FK7A 2XDNA 4MFEA 1WCMJ 1BW5A 5M5XJ 2XB5A 3FISA 3HOVJ 3ZQHA 2H8RA 3G56A 3ZOBA 1BW6A 3WHCA 4M3BA 5J1RA 2X9DA 3HTIA 2K40A 3QQAA 5GPAA 3VPRA 3L1PA 3AQTA 3S5RA 3CMYA 1OFCX 2UXPA 3Q0WA 4IEJA 5C4XJ 1AU7A 3BR3A 4XRSA 4B1RA 2EZHA 3K2AA 5E3MA
chains in the Genus database with same CATH superfamily
4EM0B 1W36D 3HSFA 2DOFA 3H5RA 3KYDB 1VQOI 4M3GA 2BW3A 1YIJI 3F9KA 1XDSA 1F43A 3HIFA 3DBRB 5EZHA 2M1BA 5LD2C 2Z99A 3VTIA 1R4NB 4ZC3A 3CF5F 4XLAA 3KZIC 2JJ7A 4F91B 2MG4A 3CCRI 3VB2A 1HSTA 4RAYA 3HM5A 4V19K 2L5QA 2E1NA 2CMPA 5GAEJ 3O6BB 2EZKA 1GXPA 2EZIA 2OAZA 3VYSB 1Z0XA 5ED4A 4LG0B 1T98A 3F23A 3KKDA 4HBLA 3FHZA 2H09A 3FBNB 4RGRA 2E34A 5D5WB 4HV6A 3HGGA 1TT0A 3ZQIA 3GLXA 4FX4A 1HSJA 3OYIA 4M3FA 1I3AA 3S93A 1SVOA 3MZYA 1F4KA 1YOVB 2R5YB 4UVCA 4PJMA 2BV6A 2HZTA 5JHUA 3NQOA 1ZK8A 1MBHA 3FM5A 3LSIA 2JA2A 2ID3A 4F55A 1YJNI 2DBBA 1U0JA 3VSKA 3HTJA 2DA2A 3IKVA 2CQXA 2DA4A 1K78B 3JRCA 2NRAC 2R7ZJ 5J4YA 4UB6C 5ILUA 1TL8A 2IGOA 5L3FA 3RPUA 5D8KB 1HLVA 3FBIB 1MZBA 3BQZA 5TJJA 2P81A 3T1BA 2HNHA 2NVTJ 4UDSA 2KP6A 3N97A 2DJNA 2ZMEB 2D2WA 3HOUJ 4RA2A 2ZXWH 3G1OA 3SYTA 4XL9A 4CYCA 2QSHX 4ZZDA 4A3DJ 2WAQN 2QYOA 1USSA 2NS0A 5FFXA 1R5HA 2UXIA 1QZZA 4D7MA 3NS4A 4Y17A 1JKQC 3IAS2 1FSEA 1BOBA 3AG4H 4Y15A 2YVXA 4X0GA 2Y9ZA 3MKWB 3FXMA 2DA3A 3LA3A 1LEAA 4FE4A 5H9TA 2RQPA 3CC4I 2NVXJ 1XB4A 1YLFA 2X1EA 1J75A 1PVEA 2GQQA 4G7HF 2F48A 4G6QA 1XSXA 2XAQA 3A02A 2K3FA 2OUMA 4PJLA 4FHTA 1UJ8A 4Y4RA 4G9YA 2NS7A 1UHMA 3DTEA 1H9TA 5KCMA 4KT6A 4BH9A 1ZG5A 1ON1A 1HF0A 5FLMJ 2K27A 3R0AA 5D6EA 1XMKA 4U7DA 3VOXA 1YW8A 1BI1A 4WIBA 4A3IJ 1EKEA 3H9JA 4IQ4A 2B0LA 2M5WA 4LOCA 4FISA 3AQSA 2G0EA 2HFHA 3QU6A 4JX5A 3P9IA 3V78A 4YZEA 1B1BA 2Y31A 2JTVA 2M3AA 1J09A 3LA2A 4R8HA 3V8JA 4DYCA 5DEQA 1YO5C 1U78A 1TWHJ 4WXCA 4RM2A 1H89C 2BEOA 5ICCA 3RJPA 3L00A 2NOJB 2RAEA 2GIZA 4LB6B 4LLNA 1LVAA 2EFNA 2GIVA 3FKJA 4XKCA 1DUXC 2STTA 2WA0A 5FB2A 1CF7B 5H6RA 1OLTA 2DK8A 4KMFA 3B73A 5JR3A 4HRIA 1GXQA 2L2OA 2M7BA 3I59B 3TW6A 4U7BA 3R61A 1LDKB 1SFOJ 2LG4A 5EFYA 3VDXA 5F0FA 4QWQA 1FLIA 1FMVA 1QGPA 3WGHA 3OIOA 3MMYB 1EH7A 2E1OA 3REOA 3Q5FA 2E2HJ 3AG2H 3LL7A 2LH9A 2NP5A 4IOCF 2FOKA 3GUDA 1B9MA 4M9ZA 4I76A 1WJBA 2EIMH 2BY3A 2XPWA 2F07A 2I8DA 4Z2YA 1TQMA 5J3LA 1FPQA 2CH0A 4RAFA 3S16J 3PFYA 2ZY9A 3VW2A 2PMUA 2FNPA 4DW6A 3BG5A 2IPQX 1DP7P 4LG0A 2L01A 2OA4A 1I6XA 4YFNF 4B48A 2FX0A 2GOMA 5FROA 1W7PD 1YYVA 1VF9A 1U5TB 3BG9A 1YW9A 4A93J 4BY7J 2YU3A 5F27A 4I01A 2OD5A 4M6YA 5ICEA 4LFUA 1MMAA 3JAMK 4HKUA 3CDIA 2HYJA 2ZKZA 3L09A 3M1EA 2P8TA 4MK6A 3H0GJ 2Q1ZB 5F64A 1M1EB 4XNFA 4L5JA 4MHGA 4QPOA 5HNHA 4ZYEA 4KMUX 3WE3A 3BCBA 3RKQA 2UXNA 2XGEA 2LD5A 3G73A 3E6DA 4U0VA 2MD5A 3FZVA 3ZP5A 2E2JJ 5IT3A 4I7HA 2IAIA 3PO3J 3O3KA 2COMA 3KZYA 2CFXA 4D9JA 4IZZA 2CFOA 3COLA 1U8BA 2XKOA 4HF1A 4NQWB 3WTUC 3HG9A 2H6BA 3KCCA 3CCQI 4KISA 4L9VA 3L2QA 5HLIA 5DM6F 2KLOA 3L2RA 3MVPA 3W3CA 1OCZH 1SD7A 3IH2A 1RUOA 3PPBA 2OCEA 3B6CA 2IW5A 2E19A 1D8JA 3BR1A 4XOTA 3R0JA 1SC7A 2MABA 5HLGA 3V6GA 1V55H 4CHUA 3A0BC 3KX2A 5HS7A 4EATA 2PJRA 2Y75A 2YSRA 3ABUA 3GTJJ 4Y13A 3BPXA 3BJ6A 5JLXA 4FE7A 2M2EA 5JHFA 4FTHA 4Y52J 3EQLF 3JAMZ 1IN4A 1OYWA 1IN5A 2DI3A 3KNWA 1JUSA 1ITYA 3I53A 2IBDA 1VI0A 4Q4ZF 4IL6C 2QSGX 1SAXA 3FXKA 1FTTA 4DVYP 1QVTA 3C07A 3BZ6A 5EG0A 1LE8B 2A2FX 3DBLB 1LDJA 1X1BA 4CZCA 5DCMB 1OR7A 2JWTA 1YE9A 2LOOA 3K4LA 2HPMA 1ETQA 3GFJA 1RETA 4B43A 2YR2A 4HX4A 4MQ9F 3E0JB 4DYQA 4KUMA 3RTRA 5AONA 2ID6A 1SFKA 2QQBA 2Q2EB 5DTDA 1BN5A 2A6HF 4CCMA 5C44J 4RDUA 3M3YJ 3EGQA 4GCKA 1MGTA 2PJPA 1DQUA 2QOPA 2MA3A 1W7PA 1AKHB 4ZDLA 3S1NJ 3CC7I 2W48A 2L9RA 5IP9J 2ZXIA 4XICA 5HNFA 4HLYA 2LBFA 2VOOA 6PAXA 3OSGA 2G3BA 1Z67A 1H9GA 1IXSB 2QZ8A 3A4CA 3LNQA 4OIOF 1OPCA 1P4WA 1V4RA 2M4KA 1HKQA 3DTKA 4F52A 3U1DA 2MGQA 2HOSA 2ZJ2A 3H3VK 3S17J 3ZMDA 2OJED 3HEFA 2Y0SN 2OU2A 2EBIA 4MIMA 4NDLA 5D19A 3HUGA 4HF0A 1RR7A 2C6YA 2HS5A 2ISYA 3MD2A 4LJZF 1Z7LA 3RPQA 2V26A 2XPVA 2KJCA 4IRGA 2IA0A 1IO2A 2XPUA 4AUXA 1RUNA 3J7YJ 3HTAA 5D5VB 5E17F 5L3DA 3DKYA 5FRMA 2OF7A 3BZKA 1NK2P 3L2CA 3I4MJ 3OY9A 4PDKA 2GA2A 4FT8A 3Q3SA 5D18A 4L0ZB 2UV1A 3FF5A 4XR6A 5F6FA 3QPLA 4EEFG 5JVGF 2OQRA 1DU0A 2K9NA 4XQFA 2BE5F 2L7FP 1ORKA 4XLNF 2YX4A 4BE0A 2HU9A 2WAFA 1U3EM 1SD5A 2BYVE 3B02A 3BHQA 2MYSA 4RBOA 2WWYA 4EJUA 4EMSA 2CUFA 1TC3C 3GYHX 2L9NA 2WV0A 2R7VA 2E71A 4P9FA 5F1JA 5EGOB 4I0AA 1ZGJA 1J5YA 3MKLA 1R4MB 5CVJA 3RI4A 5BS6A 4A3LJ 4PJ0C 4P5OA 1IUYA 4ANJA 2L9SA 2W4SA 4LG3A 4KN7X 1UHSA 2IGMA 2R7DA 2CJJA 1PUFB 3Q0UA 2HPIA 1P4XA 3FXRA 3TQNA 5GTHC 2W7NA 2VKVA 2DG7A 4WCGA 2NYXA 3SHFA 1X1PA 3V8LA 1KU3A 1WI9A 5F0HA 3HOSA 2L02A 1A6IA 4BXFA 5K1YA 5E1WA 4KDPA 3CRJA 2EIKH 3FXOA 2BY0A 2ELKA 2QBYA 4UUSB 1RNLA 3BP8A 3KP7A 3MAJA 1DGRM 5JFRA 1QPIA 2VPLA 4BNCA 1XGSA 2Z5UA 4B3XA 5M3FJ 3WTXC 4LD5A 1GUUA 3CMAI 1T0FC 1XX5A 4H4KC 5HSZA 4YFKF 2ZSIB 2AHQA 2XSJC 3ON2A 5E3NA 4IHSA 2HYTA 2ISZA 2O7TA 3LHQA 5IP7J 4E7IA 5FRNA 1IZ1A 3E7LA 4A3KJ 2R7SA 4OINF 2Y0MA 5L3GA 4YFXF 5JVTA 2CWEA 1ODDA 4S0HB 1SVMA 4IJAA 3HB9A 2OI8A 1LFPA 2CQKA 2IT0A 3O8HA 2F5DA 4XRSG 4DBQA 1HOMA 1BBYA 1KYZA 3MZHA 1I6HJ 4KA4A 2PMZA 1UG0A 5TRDA 4U0YA 2B7EA 4HQMA 2QCOA 3G1MA 1H88C 1X19A 1T38A 3IWFA 5B5EC 1G6NA 2R7FA 1G8XA 2LC2A 2XRNA 5M5XJ 3BC8A 4YG2F 1QA6A 3ZPLA 1RI7A 3FISA 1TNSA 3VSLA 3ZQHA 3ZOBA 3FHNA 4I09A 2MBFA 2V9KA 1BW6A 1X4OA 3C2GA 3F3XA 4M3BA 3WHCA 2HQNA 3PQJA 2D1VA 3HTIA 1XSVA 2P6SA 2JT1A 2WC2A 3SZTA 1VQPI 3Q0WA 4F93B 2JSPA 2RN7A 4A0ZA 2K5CA 3DP7A 2CUJA 1R5ID 2EZHA 1N75A 5E3MA 3K0LA 1VQMI 1SEUA 2LMDA 1RR8C 3QP6A 3V8KA 2AS5F 3W2WA 1QZYA 2M8GX 2WB1N 1I1GA 2A6TA 2XASA 4II2A 3BWGA 5F1RA 3GTOJ 2DQLA 1JHHA 3S1QJ 4IRVA 4ZJZA 3JRHA 4HF2A 2ZXHA 3N05A 2FUG2 2ZCXA 1MNDA 1TWAJ 2DK5A 3HRMA 3ZCOA 1YITI 5KVRA 3T8RA 3ZQFA 2DFEA 1JJ6C 2MC4A 3B81A 1T95A 3E5QA 1PJRA 3QP5A 1R9TJ 1MBKA 2OZ6A 2VPRA 5C4YA 4AIDA 3CMMA 2BHZA 3BDDA 3CUQA 2KPMA 4ICHA 4DBRA 5IT9K 1Z91A 4EJWA 3JTHA 2HKXA 1OJLA 2W85A 4A6EA 1S3JA 1HKSA 1Y56A 3E5XA 4B8XA 4BBRJ 1PP7U 4YIRX 1Z77A 3AL0C 3LFUA 4RLQA 2K86A 3GWZA 2DJIA 1HKTA 2FBIA 1HW1A 5ERIA 3F8BA 2F2EA 2X48A 1WHUA 3ASOH 3OIPA 3GTMJ 4A2UA 3IH4A 2L7MP 4C3IJ 2COBA 2LR8A 4JBAA 1BM9A 2HVSA 3OS0A 5K7HA 3ZMZA 3RH2A 5E8GA 2EV5A 2VI6A 1IUFA 2MH2A 5CVIA 5HODA 2YX7A 3K1MA 1X1DA 3KPHA 4PUSA 1LNWA 3H0DA 3OYEA 1YS6A 3G4SI 2GENA 3WTSC 2VBWA 1WH5A 3QODA 4CCJA 5F04A 2O7OA 5FKOA 3FMSA 5IYDJ 2DXIA 4BACA 3DPUA 4IXAA 1UAAA 3SZGA 2VQCA 1WVRA 1TNTA 5ICFA 1LB2A 3FXLA 2NP3A 2FXAA 4C2MJ 5LHGA 1ZQ3P 4HNVA 5LHIA 1IN7A 2DYRH 3JRGA 3ESWB 3BPVA 3HYIA 4HSTA 4UUSA 1B72B 3BTLA 2DOEA 2IEKA 4XLEA 4ENJA 3HRTA 3P7NA 2QQAA 3MZ8A 3KYCB 1O3SA 5IT9Z 5L3CA 4DJAA 1ERDA 1RKTA 2DT5A 1BC8C 4P1WA 4NNJA 3ANPA 2KIUA 1HDPA 3DKWA 3LAPA 4PK4A 2R7XA 3PIOF 4IHVA 3WTZA 4QLCU 2KIMA 2LYCA 2G9WA 1JKOC 1IDZA 2DMQA 4II3A 4G6DA 1SFUA 2VB6A 2HKOA 1D0ZA 3NWTA 4MGRA 3TOBA 3OYDA 3GZNB 2FBQA 1U2WA 1OYIA 2JUGA 2UZKA 3I9V2 5J1YA 3EUHC 4QPQA 3GMEA 2YVEA 1G3TA 2L4AA 2QKMB 3K8PC 5K5QA 2R7QA 4OOIA 2FNAA 2E7WA 2MLKA 4D5CA 5K58A 2LP0A 2FBHA 3V7SA 3KEYA 2V9VA 1ZH5A 2FMYA 4KIFA 1H8AC 5BMZA 5EZGA 2ZCMA 3RYRA 4U9LA 4EV0A 4ZH4F 3LA7A 4LMYA 2FQ3A 1MDMB 4XLCA 3V7RA 2BXZA 2DFIA 4E7SA 2GA1A 2Z2SB 4F7ZA 5LEKA 3IRRA 3TKYA 1QPMA 2QQ8A 1PDNC 2Q0OA 2ZB9A 2KT0A 5FGMA 2QSFX 3AFHA 1VQNI 4MEYF 3WE2A 3CLOA 2RGVA 3LMMA 1APLC 2FJ1A 1B4AA 4NUBA 4XSXF 5TISC 2ETHA 2Z16A 1Z9CA 2KIQA 5C4JJ 3T6NA 2LDUA 1XGNA 3T8TA 3F72A 2BGCA 1R22A 1XMXA 4H0EA 4AWXB 5CW8A 5FMPA 5IYBJ 4EGZA 1W1WE 1MH4A 3GBGA 1FP1D 4PCQA 1W5TA 2P7CB 2AQEA 1D1CA 5FKLA 1U8RA 3G7RA 1E3OC 4C2MA 2KJBA 3C2HA 2HVQA 4BL0B 2XUBA 2UXHA 3K70C 5HAWA 3TO6A 1OMIA 3GCMA 3KLNA 4AVPA 2LF7A 4GGGA 4PSXA 3FM3A 1Q1VA 5JI6A 3SEQA 4A3BJ 3VOKA 1XDUA 3IUOA 3S14J 3CP8A 4MFDA 4ASNA 4XLHA 3E6CC 1ZHFA 3BTCA 1V5FA 3IHUA 2JA5J 1QNTA 3GFMA 2GWRA 3RSNA 2IGKA 2CV0A 4L9NA 1KU9A 1F1ZA 4X1EA 2EJRA 5DAJA 4JX6A 1NG7A 1Q1HA 4BEHA 3I56I 2AO9A 1ZAOA 4A0YA 1KYWA 4DZJA 4G12A 1S29A 3JRDA 5JLWA 2O61A 1USTA 1TW3A 1X3UA 3FX3A 3KP3A 5E20A 3WHBA 3JRFA 1YJ9I 4UVBA 5KAIC 4BXUA 3TP3A 2A68F 3X2QH 3K4KA 2CRGA 3A01A 2CW0F 2Q24A 2F6CA 4UV8A 5IY5H 2VT3A 3OYMA 3CMEI 1AA7A 2HTJA 3DEWA 3DV8A 4Q48A 2EILH 2HQ5A 1W0UA 2KZGA 3LSGA 2VQGA 3BOQA 3ML6A 2CW8A 2VE9A 4U88A 1JGGA 5KHDA 3ONQA 3MFKA 4L62A 1YI2I 3ZGKA 1FEXA 2GZWA 2LSOA 1IG7A 5FFZA 2Z9OA 1ENHA 4WK8F 2WBMA 1FTZA 3SDGA 5J8FA 1XPXA 4N9IA 2X1CA 1A04A 3LSHA 4WXDA 2DMTA 3HDDA 2Z33A 1WZ2A 4A5MA 2LK2A 3CF2A 3FMRA 4E4HA 3ZMUA 1L0OC 1ETOA 4OMZA 2KFDA 3WTVC 3A2KA 2JPCA 2GFNA 1WRJA 2PZ9A 1EV7A 1WWXA 3HXLA 4CCKA 3VP5A 3U1KA 2DW4A 1MBGA 4HX7A 4FX0A 3NRGA 2XVCA 2WGBA 1QU3A 4L5IA 3WODF 1V54H 4S05A 1G59A 2EWNA 3F22A 2KRCA 3S2DJ 3F8MA 5CLSA 1O3RA 1OR7C 1RC9A 3D5SC 4PSWA 4YIFA 4XLPF 4G7ZF 1FYMA 2LLKA 3F0CA 3QU3A 2QUFA 1AWCA 3GTPJ 3BR0A 1EF4A 3C3WA 3ZRGA 1C0WA 4ZDOA 4QTRA 5J8CA 4GCVA 1QRYA 1V5GA 2QWTA 2M30A 1X1AA 5D5UB 4YIIA 5HS8A 2VBXA 2ZC2A 4XN3A 1JKRC 5H2FC 3M8EA 5DV5A 1JUMA 3K4NA 2YS9A 2Z3YA 1ZRDA 3DTIA 2QWWA 4HOBA 2STWA 4OIPF 2R4GA 3DU5A 2MH9A 3WG7H 1ACIA 1FOXA 2HI3A 2HDWA 1RZ4A 2HVRA 4RB0A 3RIRA 4G94A 4X6AJ 2LY9A 1FBQA 2ZSHB 4MLOA 3T0YA 1S8NA 3ZN1A 1AOYA 1Y8RB 5D1RA 5GTIC 2IVMA 3NXCA 5IPAA 4XSZF 2GM4A 3W6VA 2HDDA 2V1DA 2ECCA 3GXOA 2A5WA 4ETSA 3M8FA 4MXMA 2QKLB 3H9QA 2R5YA 3VYRB 3CESA 1I27A 4BXXJ 1N78A 5LRSA 3R60A 4L9JA 2EFPA 2KDZA 1GV2A 1XGOA 1R23A 2XSDC 2R7WA 2PLYA 2UWMA 4B3AA 1D5YA 1DGWY 2PN6A 4B09A 1K78A 1YX5A 1B6AA 5DD4A 2F5EA 3ABKH 1X3WB 1GT0C 2ZJPF 2H1LA 2O9LA 4DYRA 4CDGA 2R7RA 1QVUA 2M45A 4WF2A 3RQ4A 2ZMEA 5LHHA 1BR1A 5L3EA 3D0SA 3KYLA 5FLVA 3FK6A 1DPUA 4M72A 2ZOZA 1JUPA 1BJAA 1MNMC 3A1YA 4Y7NJ 3VEPA 1ETXA 1ZR2A 1S9HA 2JPBA 5LEJA 3DCFA 3V4GA 2I10A 5DUKA 1R58A 1IGNA 3KP4A 1OKRA 1X2MA 3CJTB 3M8JA 2XB0X 2P7VB 2H27A 1UZCA 5LFAA 1MSFC 3KKCA 3K1NA 4ESFA 1F5TA 3DBHB 3QOPA 1JI8A 1A31A 3I71A 1SVLA 3RDIA 1ZLKA 3ZQGA 3KZZA 2F5CA 4RGXA 1TWCJ 4ZYAA 4AIKA 4BY1J 1I1SA 3OMYA 4R1HA 3QYEA 4OMYA 4N9HA 3WTWC 2GLOA 2HOEA 3RKWA 1OQYA 2VBYA 3NEUA 4EJVA 4HX8A 2QEXI 3S2WA 4C2TA 3I64A 4YRVA 1ETWA 4IHYA 1U9NA 1QZEA 2R5ZB 3I4PA 4GXOA 1YFHA 3AG3H 1WPKA 2JRMA 2D45A 2VL8A 1Y0NA 3DPTA 2QIBA 5HS9A 2CQQA 1GV5A 4BYYA 4EQQA 2LREA 3EPZA 2JA7J 4GYGA 3DU6A 1MMSA 3F1BA 3QRFF 5FLXK 1JE8A 1HW2A 2XF6A 3RCOA 3CJNA 4CICA 4U0WA 4IX7A 1D8KA 2K9MA 1HC8A 1WGXA 4RS8A 1CF7A 3C7JA 1FSHA 1FBUA 1YIOA 2XDNA 1ZARA 1WCMJ 4MFEA 2E36A 2E35A 3PUBA 3I59A 3HTUA 2H8RA 4AYBA 3HOVJ 2MLGA 2ZNYA 4E6KG 3ERMA 2X9DA 1KQ0A 1E3PA 2K40A 1K79A 3S5RA 3CMYA 4C30A 1IN6A 2L7KA 3PNTA 1CGPA 5LGTA 1Y1WJ 1MKMA 3JSJA 4HZFA 1G3YA 2K7LA 5LGUA 1YRNB 2WUIA 3HGYA 1FBSA 2VJJA 4ENKA 1WKMA 1PYVA 4JQFA 2IXSA 3DWLE 3CCJI 2EIJH 2M87A 5TGTA 2OCCH 2W82A 1U5TA 5EEGA 2K9SA 3QYFA 2CUZA 4FCYA 3VODA 5HLTA 3RKYA 5D4SA 3DPLC 1MMGA 2DDAA 1EH8A 3TW7A 4A3FJ 1XGMA 4CGRA 4FASD 4ZTJA 3PL8A 5J6XA 3ROUA 4KITB 4UB8C 3TDUC 1VQLI 4N4NB 3ASNH 1K4SA 2W1OA 4UY8I 1TQPA 4ENNA 5FLXZ 4D1QA 2KHMA 3OOPA 3WTTC 1P6RA 1W4MA 2K4BA 5M3MJ 2MC3A 2G7LA 1UCRA 3JR9A 3RKXA 2KMUA 1VNDA 4AIJA 4CCNA 5GP9A 4XORA 1RIOH 3ZQQA 4AM3A 4DNCA 1EA3A 1HQCA 5CXGA 2Y69H 2DT6A 1P9QC 4NQWA 3I0TA 2KISA 3RQIA 3H35A 1XTAA 1Z3XA 3IV5A 1POGA 1FOYA 3OYFA 1B8IB 3KZ9A 3E1SA 3ISPA 3R6SA 3VFZA 3L2WA 3QPTA 1ETYA 4E7JA 1QBJA 1IRGA 1S5LC 1WJ5A 3S2HJ 3FRQA 2VC1A 3WTYC 2VKHA 3K4BA 2EPFA 2G7UA 4FETA 1NHAA 2XAGA 4I98B 5ILSA 3H5NA 1A6QA 5K5RA 3ECOA 2M0MA 2LKXA 1W5SA 2OPTA 4AYBN 2BY1A 5HDNA 1YTYA 5K7ZA 4N0BA 3HRSA 5BQTA 4LLGF 4OD4A 2DAOA 2KQRA 5H20A 3MKYB 5EF6A 1GDTA 1T6SA 4GCLA 1ZLJA 3JSOA 1RESA 1SFXA 1VQ8I 2DYSH 4BJ5C 3JRAA 4IHXA 3D5LA 4ITVA 1OCRH 1JJ8C 1LE8A 3SFIA 2LY2A 1K6OA 4Y3OA 1UFMA 4CZZA 2B3WA 2WV1A 5DCMA 2REKA 5CYVA 4E7KA 2W24A 2JZYA 2DODA 1BIAA 1JHFA 1FIPA 3BCGA 1G2HA 3GTGJ 1TW2A 1XMAA 2HWVA 2FEZA 2XAFA 3VW0A 2V9PA 2Q2EA 2MD0A 4E70A 4BS9A 2G7GA 1HXDA 4BU2A 1ETVA 4EVIA 2CO5A 1FYLA 2ZO4A 1AKHA 3ZR8X 2OQGA 4D5FA 3VW1A 1Z21A 4UV9A 2EH3A 3BRUA 5FJ8J 2O8KA 5IYCJ 3CCMI 1FMWA 2Y9YA 2IS4A 4A3CJ 3KETA 1X1CA 1I3QJ 2BZTA 2DG8A 2OZUA 3BG6A 3JCUC 1B59A 2FA5A 3FXUA 3TBIA 2EA2A 2NVUB 4CSWA 4RB3C 2K02A 1KA8A 3CJQB 2E1MC 2VIXA 5BNGA 1OISA 2JA8J 2R7UA 2QKOA 2IJLA 3G2BA 2XGDA 3EDPA 3ZN0A 4IHWA 1VTNC 3FIWA 4L18B 3CTAA 1LFBA 2W25A 3PSIA 1K7AA 4P96A 1R6RA 1AHDP 5J4VA 1L3LA 3F8NA 1WI3A 3K4JA 1P2FA 2F4MB 3BCAA 1T39A 2XHKA 1KONA 2BW3B 2DA7A 4A12A 1OCTC 1JXSA 2DTRA 4XN0A 9ANTA 1R1TA 2CU7A 2E2IJ 3P9CA 1N25A 3MNLA 2P0WA 2LKPA 1BA5A 3LQQA 4JP0A 2NAZA 2ZBKA 4M6VA 2ZJQF 2H94A 3HOXJ 4GO1A 2JMWA 4KIGA 1S7AA 1WFXA 3JRBA 4AF5A 4OU0A 3LOCA 2ZNZA 3KLOA 4XRFA 4J19A 2PFVA 1R1VA 3BNIA 3BG7A 1J7KA 4CH7A 4B44A 3SFZA 5D8LB 2GXAA 4E7HA 2GBYA 2VQHA 3AL0B 3RD3A 4ZDPA 3I3LA 4WXHA 4BQNA 5EGOA 2V6CA 3S8PA 3S3MA 2FF4A 3FDYA 2X6OA 1X2NA 2BBYA 3OYJA 2OTLI 4BAYA 5CPRB 1MBJA 1IAWA 3OYHA 1BI0A 3CD6I 1PUFA 1FNNA 3W2AA 4M9SA 4NC7A 2PMZN 3MWMA 1LUJB 4ENMA 3NAUA 4C3HJ 4GFLA 1XC5A 4BJ6C 4WWCA 1ON2A 3I4NJ 3L7WA 4C9YA 2QA4I 2EV6A 2BOLA 3C2BA 5B1BH 2PG4A 2LFBA 2KRFA 4JK1X 5J40A 2DPUA 3GX4X 4LIVA 2VJ5A 2L4MA 4I6ZA 3EUPA 1S6LA 4BHPA 3D5RC 4DGWB 3J7AY 2NOGA 3OSFA 4KNYA 2JUCA 1Y1VJ 2EV0A 4L5EA 2DDBA 5AIPA 3GFIA 4PGGA 3DKXA 4CYCB 3ZMTA 3AAFA 3CCLI 4GYIA 2BHYA 1O7FA 1MH3A 1MMNA 2P4WA 4OAYA 4XK4A 4AVZA 3J81K 5FHPA 2X0LA 3WU1B 1KQ8A 3F8CA 1D5VA 1NTCA 2Q8KA 5J47A 3KP2A 1TBXA 2XIGA 1SD6A 4I02A 2ME6A 2QF7A 4IKFA 1Z05A 3K10A 4OWRB 1UELB 5F0CA 4BUPA 2EFQA 3E6MA 5EEHA 1NH3A 4PXIA 3ELKA 1G3SA 1KGSA 2DMPA 3CP2A 3GW2A 3RPUD 2Y48A 1PP8F 3GTKJ 3H9GA 3K2ZA 2X1DA 3ECHA 3LJLA 4HNTA 1I50J 4IVNA 1W36C 4R79A 3H1CA 2E5NA 2L54A 1TWFJ 4XKBA 3S32A 3ZQ7A 4EGYA 2NNYA 1IC8A 4MEXF 2ECBA 2EINH 1UI5A 4M74A 2D6YA 1XG1A 1ZGAA 1QQIA 1REPC 1FJLA 1QHHD 1FOWA 2HZDA 1E3HA 5EYRA 4CCOA 2A07F 4NB5A 4J00A 4UUVA 4JYKA 2IU5A 4O6JA 2LY1A 3CCYA 3K6GA 1G3WA 2ZFWA 2P5KA 1QHGA 2GOXB 5M5WJ 3I5UA 3IAM2 1Z6TA 1R7JA 3HBLA 4F3QA 5HOOA 2UXUA 3OWTA 3GFLA 3ABMH 4CO8A 4KWAA 1D1AA 3Q0VA 2JVHA 1PUEE 2EB7A 4S04A 1R71A 2TRTA 3ABTA 1IRZA 2RASA 1YX3A 1ZG3A 3SXYA 3J81Z 3LSRA 2VN2A 3CJRB 5K7FA 2DN0A 4MTDA 2IS1A 2DLLA 1BJZA 1G4DA 2ME0A 3J7ZI 1ZN2A 4XKWA 2GAUA 3H36A 2PEXA 2L7ZA 3HJEA 2FMLA 4RLFA 5E1XA 2NVQJ 5HVQC 3FWEA 2VJ4A 3GEZA 4V2FA 3RZOJ 3OL3A 4DZPA 2CGPA 3ANGA 4CXFA 1WH7A 2WY8Q 3IP4B 4HW0A 3O2PE 2YU9J 1BIBA 4NN1A 3KEOA 2K9LA 3LAJA 3IH3A 4N4OB 5LLQA 2J5PA 5D5XB 4HYEA 3U9GA 3DEUA 4A3GJ 1ZRCA 2PMHA 4A0XA 4G6TB 5LGNA 2I5UA 2XV4S 2RNGA 3OYKA 5KK1A 1JT0A 3BROA 1XD7A 4Q5SF 1FIAA 3CDHA 4ZYDA 2AQFA 3WGGA 3BR2A 3E3VA 2A05A 3HPGA 2R92J 1ZYRF 4HDVA 3C18A 1TWGJ 2V4JC 4D0PA 1XS9A 2AXLA 3K4MA 5FKNA 3NPIA 2ZCWA 3F8FA 4GDFA 2HXIA 2CV1A 1JTXA 3CCEI 2Y2ZA 4M3EA 5KNLA 3M9AA 2BY2A 3HTHA 4M9XA 3PO2J 1O4XA 4IO9F 2IS6A 3K70D 2HEOA 5J1UA 2ZMEC 2NXNB 2LTPA 4OAZA 1B72A 4BDYA 1NK3P 2D1HA 2MW8A 4NC8A 4IQJA 3OYLA 3LSTA 2X6WA 3BY6A 3BG3A 2KKOA 1YS7A 1VQ9I 3S1RJ 2KZVA 1P7IA 3S3OA 4NBQA 3QPHA 4GFBA 3G6EI 1Z7UA 3F6VA 1ZR4A 3GZIA 1LEBA 3KIOA 2H6CA 5DS9A 1OCPA 2EFOA 5H6QA 2ACJA 5GAGJ 5HBUA 2HOTA 4GFKA 2WTEA 3HZJA 2M8EA 3E97A 3W6KB 3DPJA 3DXJF 4Y33A 1R49A 2G7SA 1SMYF 2PJRB 3S3NA 1Y39A 1XCVA 4A3JJ 4KYWA 2JN6A 3B6AA 1I39A 2W53A 1A36A 2A5YB 1R36A 2H8WA 5E1ZB 2XC7A 4C3JJ 4V2GA 2L9VA 2GUHA 4NC6A 1EJ9A 3M4OJ 3BZCA 3EUHA 5F08A 5CVVA 2CQNA 2M0CA 1UG2A 2F4IA 1O7LA 3HC7A 3JSPA 2CV2A 5DYMA 3OOUA 3MEXA 5EG0B 1WQ2A 2E1CA 1MDMA 1VQKI 3M7GA 3CLQA 3LSJA 5BOXA 2XAHA 2CG4A 5B3SH 3CCVI 1BI2A 1K61A 1IXCA 3PASA 1D0YA 3FK7A 3ULQB 4LB5A 4RGUA 2K4JA 1BW5A 1D0XA 3KEQA 2ZFUA 5DM7F 1R1UA 2RQQA 2RC4A 5J1RA 1XN7A 1WJEA 3TDZC 3OR2C 2E60A 1HBXG 4M6XA 3OYAA 1OFCX 2UXPA 3OIQA 3K4CA 3PNYA 3BR3A 4I0BA 1W7PB 4YELA 4ZZLA 5A2QK 2HXOA 1W5CC 1TTYA 2KL4A 2KDOA 3KP5A 3G3ZA 4M73A 3O8GA 4UUTA 3JREA 1MBFA 2M9HA 5DDGA 4JNNA 3VYUB 4BDZA 3I55I 2LBFB 2ELHA 2EK5A 4QIWN 1S72I 4G7OF 4XLFA 1ZGWA 4AC0A 4BQQA 4ESJA 4UXNA 2VC0A 2JSCA 5IOYA 3S15J 4J01A 1O57A 4BHCA 4HQEA 2VKDA 1FWZA 2NS8A 3O60A 3G71I 4IOAF 1U5TC 2IP2A 1LFUP 3FKIJ 3NWSA 1P7JA 4G8XA 4CUGA 3PUFA 3JTGA 2ZJRF 3HOTA 3UKGA 2V1UA 3VVXA 3HUGB 1T56A 2OBPA 2XRLA 2DCEA 3HPHA 3UR3C 4PFOA 2VT2A 1ONVA 4BGDA 4FQGA 3EUKL 2EQRA 2F4OB 2V6EA 2DO7A 3TGNA 3COAC 4ME9A 4LITA 3TL4X 2ZCNA 4E7ZA 4Z6YA 3GEUA 3WG9A 2OERA 2RV8A 2HYGD 5FKKA 3PM1A 3HOZJ 1D3YA 2KIFA 4RB2C 4O3MA 2LKSA 2ADUA 3GZ6A 2LF8A 2W84A 4I99C 3ERED 3SJMA 2FRHA 5FD6A 4F92B 1K6YA 5KAFC 3KP6A 4HLXA 1LJ9A 3MCZA 3BR5A 3DFGA 3QYBA 1FYKA 4B47A 5E18F 2WAEA 3HTSB 1DPRA 4L9TA 1FC3A 3JRIA 2FQ4A 3DQVC 2K9QA 5A2QZ 1VQ5I 2VONA 1FX7A 1MJBA 4W97A 4JX4A 2Y0SA 1U6GA 1LKXA 3Q9SA 4B4CA 2QVOA 3TOAA 4BJTA 2MSYA 3HL2A 4KJZA 3HHGA 3OV8A 1P4AA 2CUEA 2J5OA 4HG2A 3RZDJ 5ILVA 2DQRA 3D1NI 1TZLA 3H3UA 1LQ1A 2L3DA 3TEDA 2D5VA 2F5FA 4LK0F 5C3EJ 3AKZA 1IW7F 2XROA 3QPSA 1FOKA 3EYIA 1ZKGA 2F5VA 2R0QC 3BLYA 2X51A 1GHCA 2YVHA 5E79C 1Y6IA 1OCCH 2UUZA 2HQAA 2B9SA 5EEAA 2EFWA 2AXTC 2JVGA 1YQAA 4NELA 3F21A 2QBYB 1GVJA 5AIQA 3SDBA 1FT9A 1KU2A 2O5RA 1Y8QB 3ZQLA 3F6OA 4IPAA 2W57A 2DA6A 3C1DA 5BPIA 3QOEA 4XM3A 1RRJA 4ON0A 2P6TA 3ZMSA 2XAJA 1GLNA 3P9TA 2FD5A 2YUSA 3NARA 3PQKA 4EM1A 1ZELA 3IKTA 5E3OA 1YJWI 2VUMJ 3DLAA 2ESNA 2OV7A 1OYYA 4U9NA 5FKMA 2CSOA 1TLHB 2VOPA 1UB9A 2V79A 5FGLA 1I5ZA 2FOWA 2OC6A 1O3TA 4EM2A 4ESBA 4BQAA 2HTSA 4Q47A 2RNJA 1VQ4I 4HV5A 3OS2A 3OYNA 2VBZA 3L2VA 4CGZA 2PBIA 3E5UA 2O6GE 2DOAA 3PNVA 3L2UA 2JRTA 1R00A 4BKXA 5BPDA 5DUIA 4UHTA 3A0HC 5EJCA 3MQ0A 1LDDA 2M7AA 1JKPC 3SQNA 3MKZA 3H3ZA 4P55A 4IHTA 4XRMA 4PJNA 4HEA2 3DF8A 1SANA 2CYYA 1J59A 3CO6C 3HOWJ 2ZXJA 2W00A 5AQCA 1TQIA 2GXGA 4CCLA 3ZQCA 2JA6J 3UNGC 4M3DA 1OCOH 3TO9A 4LK1F 2R93J 1VZ0A 2QTQA 1IJWC 3AG1H 1LPQA 1WJCA 4IRIA 4PZJA 4QSHA 3VIBA 2DA1A 4RM3A 3WU2C 3A03A 2WY7Q 3H5AA 3LQRA 4A69C 1DP3A 3WGIA 4I2OA 4MNUA 5D6FA 3OYBA 1U9OA 5L3BA 3CQZJ 2NVYJ 2H1KA 2M4GA 1STZA 4WX9A 3J7AO 1ZTRA 3CUQC 2PFBA 4W1UA 3VOEA 3GZ5A 1T8IA 3SWHA 2BVLA 4MQVA 1WJFA 2VQLA 3PJRA 3BJAA 2RKHA 2LRDA 4GRIA 3HE0A 1Z6RA 2HOAA 2CQ7A 5E8IA 1VQ6I 3R4KA 3PFIA 2X4HA 5CKTA 3CUQB 2N8GA 2FBKA 2X85A 3ZXSA 1BC7C 4PJJA 1MSEC 1YW7A 4XMYA 3HOYJ 2FJI1 4M71A 3HKZA 3OR1C 1FY7A 2ZOYA 3BR6A 4ZYHA 1JT6A 1J9IA 3IUVA 3GTLJ 2VASA 4RAZA 4XBFA 1EH6A 2YPRA 5M5YJ 1CQTA 1UI6A 1IRFA 4HNUA 4HDUA 2R7OA 3EYYA 5CXIA 1MW7A 1O3QA 1BL0A 2A61A 3S1MJ 5DCFA 2PI0A 5DD8A 1ZREA 3I54A 2PBXA 3P9KA 2WADA 5LBQA 2WB1A 1GVDA 2K85A 5IOZA 2V57A 1SMTA 3OYCA 2K3PA 4L0YB 5E3LA 2V1NA 4D7NA 4XKVA 3LSPA 4A3MJ 2R7TA 5EDNA 5CQEA 2RREA 3CZ6A 2LVSA 2TCTA 3K9TA 4U87A 3TO7A 4BHBA 5B66C 5HDGA 3VUQA 2XF7A 2FSWA 4EJTA 3G1LA 5HDKA 1A35A 3T5XA 3K1PA 4CA0A 4C2UA 2HKUA 1IV8A 3BJBA 5B1AH 2O3FA 2NNNA 2RHAA 3N4MA 4BQOA 1MNEA 1X58A 2R5ZA 3FMQA 1IN8A 1X3ZB 3K7AJ 4JOMA 2RDPA 1Z1DA 2LNBA 3SEZA 3CO7C 2UXOA 2A69F 1BI3A 2HR3A 1XCBA 1E2XA 4HPQA 1ETKA 3GVAA 3ZMVA 4JL3A 2XF5A 4XONA 4AD9A 1UMQA 4MTEA 4CYDA 1YG2A 3U2RA 4KICA 1R5GA 4RMNA 3IC7A 2M34A 2E7XA 2HGCA 3CWRA 3GTQJ 1ZG1A 2XAUA 4NHJA 2VKEA 4BE1A 4UVAA 4IF4A 3QKXA 4PGHA 4ZTFA 2B1EA 2IRFG 3LSKA 1H0MA 3CC2I 2NX4A 3MN2A 1Y0UA 1HDDC 2VXDA 3RYPA 3GO5A 4LLLA 2O8XA 4ZYGA 3OL4A 1IRXA 1MJ9A 1T08B 3J80K 2KRHA 4ABZA 2JQ7A 3QBMA 4JKZA 2G7HA 4BBSJ 2XDVA 1JTYA 3VVYA 3VYTB 1P92A 3IRQA 3M07A 1VFCA 1HW5A 3IL2A 1FZPB 3Q9VA 3HKZN 5GAHJ 1YRNA 2Z1DA 2BXYA 3NRVA 4PFPA 1NG6A 2MFZA 2QLZA 1BR4A 1KU7A 1HCRA 3CDLA 3FXQA 3BQYA 2A3SA 2PQ8A 5HLHA 1LVKA 2P5LC 2E1MB 1RPWA 3WU0A 2QQ9A 1TT5B 2DFFA 3V7CA 4E7LA 2EA4A 1WSUA 1K83J 1XSDA 4DOZA 1T2KA 1Z3YA 1UHWA 3IWZA 3E7QA 2VE8A 3HRUA 4TV7A 2XGXA 2EZLA 3NNRA 3M1CA 2DA5A 2X6XA 2XGCA 4ACIA 1A5JA 3NI7A 1MD0A 1IV6A 1F36A 3JW4A 3ON4A 1RKWA 2HQRA 4UNOA 4GCTA 3K69A 1SD4A 1J0RA 1D1BA 1V3FA 1V5EA 1W0TA 3VVZA 3DEEA 3I58A 3TP0A 4AU7A 5GADJ 2VLAA 2DTZA 3J80Z 3GLLA 2IGNA 1BR2A 1SGMA 1MJAA 2E5ZA 3EUAA 1B8IA 4KFCA 2CS3A 2GXBA 5CVUA 2O0YA 1KQ9A 2IA1A 2VODA 2O03A 5GPCA 3VWBA 3W6JB 1DU6A 4YEJA 2QGUA 1WJDA 3E6BA 2BVMA 2TDXA 4LIUA 5ICGA 3P5JA 3W2VA 4BEHB 5FD5A 4A3EJ 3L9FA 3LWFA 3OYGA 2R3SA 4RAGA 5IP6A 2ESHA 1YHQI 3TMOA 3LWJA 1X4PA 2IA2A 4A5NA 3QAHA 2ELJA 1N77A 2Y30A 1KZHA 5LRRA 4HAMA 3BTJA 4KT5C 3H92A 3HHHA 1MIJA 2V7FA 1ZRFA 5D4RA 3A01B 3PIPF 4MO7A 2DT7B 3QWLA 4KIBA 1HA8A 2XKPA 5CVRA 1IDYA 2DMNA 1T0FA 3CUOA 4DQ2A 1VQ7I 3FXJA 4OIRF 3GF2A 3DLLF 3HSRA 4RGSA 3BTIA 4O5VA 4XOPA 2P5VA 2IS2A 2FU4A 1IXRC 3V42A 1S7EA 4IRHA 1T33A 1QO0D 1TP4A 3KE2A 3KFWX 3CJDA 2JK3A 4KN4X 3ABLH 4LGWA 5K5OA 2PX9A 2QENA 3HIMA 1S7OA 2VJIA 4OIQF 1FP2A 2L0KA 1WJAA 1BOAA 2B63J 1DDNA 2HDCA 3CCSI 2DMUA 1J2XA 1IF1A 2OTJI 3LFKA 1JGSA 4AC6A 2UXXA 2A6EF 3BJOA 2DU9A 4BE2A 2DFHA 3LSMA 5CJ9A 1MBEA 3U21A 4HA8A 3BT9A 1B9NA 4K2EA 4XIDA 4HSRA 4EJOA 2VXZA 2WAQA 3EETA 2QM3A 1F9NA 2CW7A 2XB5A 3G56A 2FE3A 1MMDA 2HYFA 2ICWG 3OS1A 2DPDA 2RVCA 3HSEA 5FO5A 2V1XA 4A6DA 1E0EA 4AIHA 1ULYA 1E17A 2X6YA 1SFEA 3QQAA 5CQGA 5GPAA 3VPRA 1SAUA 3L1PA 3SZPA 3PSFA 4DIQA 1K4TA 3AQTA 4RB1A 4IEJA 3CCUI 5C4XJ 4P9UA 1AU7A 4XRSA 4B1RA 4OD5A 3K2AA
chains in the Genus database with same CATH topology
2HXOA 4M3GA 1F43A 2WUIA 1YRNB 3O8GA 4UUTA 3JREA 1MBFA 2M9HA 3HGYA 5EZHA 4JNNA 2M8GX 2WB1N 3GTOJ 4QIWN 2JJ7A 3S1QJ 1ZGWA 4AC0A 2MG4A 3JRHA 2K9SA 3HM5A 5IOYA 3S15J 2ZCXA 1TWAJ 4FCYA 2EZKA 2NS8A 3ZQFA 3O60A 1JJ6C 3B81A 2EZIA 1LFUP 1Z0XA 3FKIJ 1P7JA 3TW7A 3UKGA 4A3FJ 1MBKA 2VPRA 1R9TJ 5C4YA 3VVXA 3KKDA 1T56A 4ICHA 2XRLA 1OJLA 2EQRA 4BBRJ 3HGGA 4ME9A 2ZCNA 1Z77A 3ZQIA 3GEUA 4M3FA 2OERA 5FKKA 3PM1A 3HOZJ 2X48A 5M3MJ 2G7LA 3GTMJ 3IH4A 2L7MP 4C3IJ 3JR9A 2R5YB 2COBA 2LR8A 1VNDA 5GP9A 1ZK8A 1MBHA 5K7HA 3SJMA 2ID3A 3RH2A 5CXGA 2VI6A 1IUFA 5HODA 3HTJA 2DA2A 3BR5A 3RQIA 2CQXA 2GENA 2DA4A 3IV5A 3JRCA 1POGA 2R7ZJ 1B8IB 3KZ9A 1WH5A 5F04A 2O7OA 5FKOA 3JRIA 1HLVA 2FQ4A 5IYDJ 1ETYA 3BQZA 2K9QA 2P81A 3S2HJ 3FRQA 2NVTJ 4UDSA 2DJNA 4W97A 3PPBA 4JX4A 3HOUJ 4B4CA 3G1OA 4CYCA 2MSYA 4A3DJ 2CUEA 2WAQN 3RZDJ 2NP3A 4C2MJ 3D1NI 1ZQ3P 4HNVA 2LKXA 2OPTA 4AYBN 3JRGA 2UXIA 4D7MA 3TEDA 5K7ZA 4UUSA 1JKQC 5C3EJ 1B72B 2D5VA 3QPSA 3BTLA 1ZKGA 2R0QC 2Y9ZA 2IEKA 2DA3A 5EF6A 1GDTA 4FE4A 2YVHA 4GCLA 5H9TA 2NVXJ 5EEAA 1RESA 1RKTA 3JRAA 4NELA 4IHXA 3ANPA 3A02A 1HDPA 1JJ8C 1LE8A 3SFIA 4IHVA 2NS7A 2REKA 2WV1A 3ZQLA 1JKOC 2DA6A 1IDZA 2DMQA 1HF0A 5FLMJ 2FBQA 1FIPA 3P9TA 2FD5A 3NARA 2YUSA 1G2HA 3BCGA 3VOXA 5E3OA 5J1YA 2VUMJ 3GTGJ 4A3IJ 5FKMA 2YVEA 4LOCA 3VW0A 4FISA 3AQSA 2G0EA 5FGLA 2G7GA 4JX5A 1ETVA 3V78A 4D5CA 4YZEA 5K58A 2Y31A 2LP0A 1AKHA 3VW1A 4D5FA 4DYCA 2EH3A 3BRUA 1U78A 1TWHJ 1H8AC 1H89C 5EZGA 2ZCMA 5FJ8J 4BKXA 2O8KA 5IYCJ 2RAEA 2Y9YA 4A3CJ 1I3QJ 1JKPC 2DG8A 4XRMA 1SANA 1SFOJ 3TW6A 5EFYA 2ZB9A 2KT0A 3HOWJ 5AQCA 5F0FA 3ZQCA 5BNGA 2JA6J 2JA8J 4M3DA 2QKOA 2R93J 2XGDA 1APLC 2FJ1A 2QTQA 3OIOA 1IJWC 2E1OA 2NP5A 4IHWA 2E2HJ 3T6NA 5C4JJ 3FIWA 4QSHA 3VIBA 2DA1A 1LFBA 4I76A 1AHDP 3A03A 1WI3A 2XPWA 2F07A 5CW8A 4A69C 5FMPA 5IYBJ 5J3LA 2DA7A 3S16J 1OCTC 3VW2A 1MH4A 3GBGA 1U9OA 4DW6A 3BG5A 9ANTA 2NVYJ 3CQZJ 2CU7A 2E2IJ 3MNLA 5FKLA 2H1KA 3G7RA 2FX0A 1E3OC 1BA5A 4JP0A 1ZTRA 1VF9A 3BG9A 4W1UA 4M6VA 4A93J 4BY7J 2UXHA 5F27A 3HOXJ 5HAWA 2JMWA 3JRBA 4AF5A 3HE0A 2HOAA 3LOCA 1Q1VA 4J19A 4HKUA 2HYJA 3BNIA 4A3BJ 3VOKA 4MK6A 2N8GA 3H0GJ 3S14J 2GBYA 4MFDA 3RD3A 1MSEC 3HOYJ 5EGOA 3BTCA 2JA5J 3RKQA 2LD5A 2XGEA 2ZOYA 3BR6A 1JT6A 1X2NA 2X6OA 3GTLJ 4X1EA 3IUVA 5M5YJ 4JX6A 1UI6A 5DAJA 1CQTA 1MBJA 2E2JJ 5CXIA 2AO9A 2IAIA 1BL0A 3PO3J 4DZJA 4G12A 1PUFA 3S1MJ 3JRDA 5JLWA 2PMZN 3COLA 2PBXA 3NAUA 4C3HJ 3WHBA 3JRFA 1U8BA 4GFLA 1XC5A 3TP3A 3I4NJ 3C2BA 1GVDA 2CRGA 5IOZA 3A01A 2V57A 2Q24A 2LFBA 3DEWA 5E3LA 3MVPA 4D7NA 3LSPA 4A3MJ 2HQ5A 3IH2A 5EDNA 4I6ZA 1W0UA 3LSGA 3EUPA 3S1NJ 3B6CA 2LVSA 2TCTA 2NOGA 2E19A 3OSFA 3BR1A 3VUQA 1Y1VJ 4L5EA 1JGGA 3G1LA 3V6GA 4CYCB 2HKUA 3BJBA 4L62A 1FEXA 2RHAA 1MH3A 3GTJJ 1IG7A 4XK4A 5FHPA 1X58A 2R5ZA 1ENHA 5JLXA 4FE7A 3K7AJ 1FTZA 2M2EA 3SDGA 4FTHA 1NTCA 4Y52J 3KNWA 2ME6A 2QF7A 1JUSA 2DMTA 2UXOA 3HDDA 1ITYA 2IBDA 1VI0A 2LK2A 1ETKA 4CGRA 4JL3A 5F0CA 2PZ9A 1ETOA 2GFNA 1FTTA 4PXIA 1QVTA 2DMPA 3C07A 1UMQA 3GTKJ 3VP5A 5EG0A 1LE8B 3LJLA 2M34A 1MBGA 3CWRA 3GTQJ 3NRGA 1I50J 2WGBA 2VKEA 2JWTA 3QKXA 1TWFJ 1IC8A 2ECBA 1ETQA 1RETA 1UI5A 3S2DJ 2D6YA 2NX4A 3MN2A 1XG1A 1HDDC 4DYQA 2LLKA 3F0CA 1FJLA 3GTPJ 2ID6A 3BR0A 1EF4A 4ABZA 4JKZA 5DTDA 5C44J 5EYRA 4BBSJ 3QBMA 4RDUA 3M3YJ 4QTRA 1JTYA 3EGQA 4JYKA 2IU5A 3VVYA 4GCKA 3CCYA 1QRYA 2QWTA 2QOPA 5M5WJ 1AKHB 1VFCA 2W48A 3HBLA 3HKZN 2L9RA 2UXUA 1YRNA 5IP9J 4KWAA 1JKRC 3Q0VA 1HCRA 4XICA 3CDLA 1JUMA 3BQYA 2TRTA 1IRZA 2YS9A 3OSGA 2G3BA 2RASA 3LNQA 1RPWA 3LSRA 5K7FA 2HOSA 2DN0A 2MGQA 1BJZA 2HI3A 3H3VK 3S17J 2ME0A 3HEFA 2Y0SN 4MIMA 2EBIA 4NDLA 5D19A 1K83J 2L7ZA 4X6AJ 2NVQJ 2LY9A 1RR7A 4V2FA 3RZOJ 3E7QA 2XPVA 4DZPA 4MLOA 2XPUA 3ANGA 4AUXA 1WH7A 5D1RA 2EZLA 2YU9J 3HTAA 4NN1A 3NNRA 3NXCA 5IPAA 2DA5A 2XGCA 2GM4A 3IH3A 2OF7A 4ACIA 1A5JA 3W6VA 1NK2P 2HDDA 3I4MJ 3NI7A 2ECCA 1IV6A 1F36A 4A3GJ 4MXMA 3Q3SA 5D18A 3ON4A 1RKWA 2R5YA 4GCTA 3QPLA 4EEFG 4BXXJ 1DU0A 2K9NA 1JT0A 1W0TA 3VVZA 2KDZA 2L7FP 1FIAA 3TP0A 1GV2A 1ORKA 3BR2A 2DTZA 3BHQA 2XSDC 2R92J 4RBOA 4B3AA 1D5YA 2CUFA 1TC3C 1SGMA 1TWGJ 1B8IA 1GT0C 1XS9A 5FKNA 3NPIA 5F1JA 5EGOB 2HXIA 5GPCA 2O9LA 4DYRA 1JTXA 1DU6A 3MKLA 1QVUA 2Y2ZA 4M3EA 3HTHA 4A3LJ 3PO2J 1O4XA 3JSJA 4A3EJ 5FLVA 3FK6A 5J1UA 5IP6A 1UHSA 2ZOZA 2CJJA 1JUPA 1PUFB 1MNMC 3Q0UA 3LWJA 4Y7NJ 2LTPA 1ETXA 2VKVA 1ZR2A 2DG7A 1B72A 1NK3P 2Y30A 1IGNA 3DCFA 2I10A 2MW8A 1X2MA 5F0HA 1A6IA 3BTJA 2XB0X 3BG3A 1MSFC 3A01B 3CRJA 3S1RJ 3KKCA 1P7IA 4MO7A 4GFBA 2ELKA 4UUSB 1ZR4A 3GZIA 3ZQGA 1IDYA 2DMNA 1TWCJ 4BY1J 1QPIA 5DS9A 1OCPA 5HBUA 2GLOA 2HOTA 4GFKA 5M3FJ 3BTIA 1GUUA 3DPJA 5HSZA 2AHQA 2G7SA 1S7EA 3ON2A 1T33A 5E3NA 1ETWA 4IHYA 2HYTA 1U9NA 3CJDA 2O7TA 2R5ZB 4A3JJ 2JK3A 3LHQA 5IP7J 2JN6A 3B6AA 2W53A 1WPKA 3E7LA 4A3KJ 3HIMA 4C3JJ 4V2GA 2QIBA 2L0KA 2GUHA 4S0HB 3M4OJ 2CQQA 3HB9A 1GV5A 2OI8A 2B63J 3O8HA 5F08A 2DMUA 2M0CA 4XRSG 2JA7J 1HOMA 1UG2A 4AC6A 3F1BA 1I6HJ 1Y1WJ 3OOUA 1MBEA 5EG0B 3BT9A 1WGXA 3LSJA 4XIDA 2QCOA 3G1MA 1K61A 1H88C 3PASA 3FK7A 2XDNA 4MFEA 1WCMJ 1BW5A 5M5XJ 2XB5A 3FISA 3HOVJ 3ZQHA 2H8RA 3G56A 3ZOBA 1BW6A 3WHCA 4M3BA 5J1RA 2X9DA 3HTIA 2K40A 3QQAA 5GPAA 3VPRA 3L1PA 3AQTA 3S5RA 3CMYA 1OFCX 2UXPA 3Q0WA 4IEJA 5C4XJ 1AU7A 3BR3A 4XRSA 4B1RA 2EZHA 3K2AA 5E3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXO A;  4M3G A;  1F43 A;  2WUI A;  1YRN B;  3O8G A;  4UUT A;  3JRE A;  1MBF A;  2M9H A;  3HGY A;  5EZH A;  4JNN A;  2M8G X;  2WB1 N;  3GTO J;  4QIW N;  2JJ7 A;  3S1Q J;  1ZGW A;  4AC0 A;  2MG4 A;  3JRH A;  2K9S A;  3HM5 A;  5IOY A;  3S15 J;  2ZCX A;  1TWA J;  4FCY A;  2EZK A;  2NS8 A;  3ZQF A;  3O60 A;  1JJ6 C;  3B81 A;  2EZI A;  1LFU P;  1Z0X A;  3FKI J;  1P7J A;  3TW7 A;  3UKG A;  4A3F J;  1MBK A;  2VPR A;  1R9T J;  5C4Y A;  3VVX A;  3KKD A;  1T56 A;  4ICH A;  2XRL A;  1OJL A;  2EQR A;  4BBR J;  3HGG A;  4ME9 A;  2ZCN A;  1Z77 A;  3ZQI A;  3GEU A;  4M3F A;  2OER A;  5FKK A;  3PM1 A;  3HOZ J;  2X48 A;  5M3M J;  2G7L A;  3GTM J;  3IH4 A;  2L7M P;  4C3I J;  3JR9 A;  2R5Y B;  2COB A;  2LR8 A;  1VND A;  5GP9 A;  1ZK8 A;  1MBH A;  5K7H A;  3SJM A;  2ID3 A;  3RH2 A;  5CXG A;  2VI6 A;  1IUF A;  5HOD A;  3HTJ A;  2DA2 A;  3BR5 A;  3RQI A;  2CQX A;  2GEN A;  2DA4 A;  3IV5 A;  3JRC A;  1POG A;  2R7Z J;  1B8I B;  3KZ9 A;  1WH5 A;  5F04 A;  2O7O A;  5FKO A;  3JRI A;  1HLV A;  2FQ4 A;  5IYD J;  1ETY A;  3BQZ A;  2K9Q A;  2P81 A;  3S2H J;  3FRQ A;  2NVT J;  4UDS A;  2DJN A;  4W97 A;  3PPB A;  4JX4 A;  3HOU J;  4B4C A;  3G1O A;  4CYC A;  2MSY A;  4A3D J;  2CUE A;  2WAQ N;  3RZD J;  2NP3 A;  4C2M J;  3D1N I;  1ZQ3 P;  4HNV A;  2LKX A;  2OPT A;  4AYB N;  3JRG A;  2UXI A;  4D7M A;  3TED A;  5K7Z A;  4UUS A;  1JKQ C;  5C3E J;  1B72 B;  2D5V A;  3QPS A;  3BTL A;  1ZKG A;  2R0Q C;  2Y9Z A;  2IEK A;  2DA3 A;  5EF6 A;  1GDT A;  4FE4 A;  2YVH A;  4GCL A;  5H9T A;  2NVX J;  5EEA A;  1RES A;  1RKT A;  3JRA A;  4NEL A;  4IHX A;  3ANP A;  3A02 A;  1HDP A;  1JJ8 C;  1LE8 A;  3SFI A;  4IHV A;  2NS7 A;  2REK A;  2WV1 A;  3ZQL A;  1JKO C;  2DA6 A;  1IDZ A;  2DMQ A;  1HF0 A;  5FLM J;  2FBQ A;  1FIP A;  3P9T A;  2FD5 A;  3NAR A;  2YUS A;  1G2H A;  3BCG A;  3VOX A;  5E3O A;  5J1Y A;  2VUM J;  3GTG J;  4A3I J;  5FKM A;  2YVE A;  4LOC A;  3VW0 A;  4FIS A;  3AQS A;  2G0E A;  5FGL A;  2G7G A;  4JX5 A;  1ETV A;  3V78 A;  4D5C A;  4YZE A;  5K58 A;  2Y31 A;  2LP0 A;  1AKH A;  3VW1 A;  4D5F A;  4DYC A;  2EH3 A;  3BRU A;  1U78 A;  1TWH J;  1H8A C;  1H89 C;  5EZG A;  2ZCM A;  5FJ8 J;  4BKX A;  2O8K A;  5IYC J;  2RAE A;  2Y9Y A;  4A3C J;  1I3Q J;  1JKP C;  2DG8 A;  4XRM A;  1SAN A;  1SFO J;  3TW6 A;  5EFY A;  2ZB9 A;  2KT0 A;  3HOW J;  5AQC A;  5F0F A;  3ZQC A;  5BNG A;  2JA6 J;  2JA8 J;  4M3D A;  2QKO A;  2R93 J;  2XGD A;  1APL C;  2FJ1 A;  2QTQ A;  3OIO A;  1IJW C;  2E1O A;  2NP5 A;  4IHW A;  2E2H J;  3T6N A;  5C4J J;  3FIW A;  4QSH A;  3VIB A;  2DA1 A;  1LFB A;  4I76 A;  1AHD P;  3A03 A;  1WI3 A;  2XPW A;  2F07 A;  5CW8 A;  4A69 C;  5FMP A;  5IYB J;  5J3L A;  2DA7 A;  3S16 J;  1OCT C;  3VW2 A;  1MH4 A;  3GBG A;  1U9O A;  4DW6 A;  3BG5 A;  9ANT A;  2NVY J;  3CQZ J;  2CU7 A;  2E2I J;  3MNL A;  5FKL A;  2H1K A;  3G7R A;  2FX0 A;  1E3O C;  1BA5 A;  4JP0 A;  1ZTR A;  1VF9 A;  3BG9 A;  4W1U A;  4M6V A;  4A93 J;  4BY7 J;  2UXH A;  5F27 A;  3HOX J;  5HAW A;  2JMW A;  3JRB A;  4AF5 A;  3HE0 A;  2HOA A;  3LOC A;  1Q1V A;  4J19 A;  4HKU A;  2HYJ A;  3BNI A;  4A3B J;  3VOK A;  4MK6 A;  2N8G A;  3H0G J;  3S14 J;  2GBY A;  4MFD A;  3RD3 A;  1MSE C;  3HOY J;  5EGO A;  3BTC A;  2JA5 J;  3RKQ A;  2LD5 A;  2XGE A;  2ZOY A;  3BR6 A;  1JT6 A;  1X2N A;  2X6O A;  3GTL J;  4X1E A;  3IUV A;  5M5Y J;  4JX6 A;  1UI6 A;  5DAJ A;  1CQT A;  1MBJ A;  2E2J J;  5CXI A;  2AO9 A;  2IAI A;  1BL0 A;  3PO3 J;  4DZJ A;  4G12 A;  1PUF A;  3S1M J;  3JRD A;  5JLW A;  2PMZ N;  3COL A;  2PBX A;  3NAU A;  4C3H J;  3WHB A;  3JRF A;  1U8B A;  4GFL A;  1XC5 A;  3TP3 A;  3I4N J;  3C2B A;  1GVD A;  2CRG A;  5IOZ A;  3A01 A;  2V57 A;  2Q24 A;  2LFB A;  3DEW A;  5E3L A;  3MVP A;  4D7N A;  3LSP A;  4A3M J;  2HQ5 A;  3IH2 A;  5EDN A;  4I6Z A;  1W0U A;  3LSG A;  3EUP A;  3S1N J;  3B6C A;  2LVS A;  2TCT A;  2NOG A;  2E19 A;  3OSF A;  3BR1 A;  3VUQ A;  1Y1V J;  4L5E A;  1JGG A;  3G1L A;  3V6G A;  4CYC B;  2HKU A;  3BJB A;  4L62 A;  1FEX A;  2RHA A;  1MH3 A;  3GTJ J;  1IG7 A;  4XK4 A;  5FHP A;  1X58 A;  2R5Z A;  1ENH A;  5JLX A;  4FE7 A;  3K7A J;  1FTZ A;  2M2E A;  3SDG A;  4FTH A;  1NTC A;  4Y52 J;  3KNW A;  2ME6 A;  2QF7 A;  1JUS A;  2DMT A;  2UXO A;  3HDD A;  1ITY A;  2IBD A;  1VI0 A;  2LK2 A;  1ETK A;  4CGR A;  4JL3 A;  5F0C A;  2PZ9 A;  1ETO A;  2GFN A;  1FTT A;  4PXI A;  1QVT A;  2DMP A;  3C07 A;  1UMQ A;  3GTK J;  3VP5 A;  5EG0 A;  1LE8 B;  3LJL A;  2M34 A;  1MBG A;  3CWR A;  3GTQ J;  3NRG A;  1I50 J;  2WGB A;  2VKE A;  2JWT A;  3QKX A;  1TWF J;  1IC8 A;  2ECB A;  1ETQ A;  1RET A;  1UI5 A;  3S2D J;  2D6Y A;  2NX4 A;  3MN2 A;  1XG1 A;  1HDD C;  4DYQ A;  2LLK A;  3F0C A;  1FJL A;  3GTP J;  2ID6 A;  3BR0 A;  1EF4 A;  4ABZ A;  4JKZ A;  5DTD A;  5C44 J;  5EYR A;  4BBS J;  3QBM A;  4RDU A;  3M3Y J;  4QTR A;  1JTY A;  3EGQ A;  4JYK A;  2IU5 A;  3VVY A;  4GCK A;  3CCY A;  1QRY A;  2QWT A;  2QOP A;  5M5W J;  1AKH B;  1VFC A;  2W48 A;  3HBL A;  3HKZ N;  2L9R A;  2UXU A;  1YRN A;  5IP9 J;  4KWA A;  1JKR C;  3Q0V A;  1HCR A;  4XIC A;  3CDL A;  1JUM A;  3BQY A;  2TRT A;  1IRZ A;  2YS9 A;  3OSG A;  2G3B A;  2RAS A;  3LNQ A;  1RPW A;  3LSR A;  5K7F A;  2HOS A;  2DN0 A;  2MGQ A;  1BJZ A;  2HI3 A;  3H3V K;  3S17 J;  2ME0 A;  3HEF A;  2Y0S N;  4MIM A;  2EBI A;  4NDL A;  5D19 A;  1K83 J;  2L7Z A;  4X6A J;  2NVQ J;  2LY9 A;  1RR7 A;  4V2F A;  3RZO J;  3E7Q A;  2XPV A;  4DZP A;  4MLO A;  2XPU A;  3ANG A;  4AUX A;  1WH7 A;  5D1R A;  2EZL A;  2YU9 J;  3HTA A;  4NN1 A;  3NNR A;  3NXC A;  5IPA A;  2DA5 A;  2XGC A;  2GM4 A;  3IH3 A;  2OF7 A;  4ACI A;  1A5J A;  3W6V A;  1NK2 P;  2HDD A;  3I4M J;  3NI7 A;  2ECC A;  1IV6 A;  1F36 A;  4A3G J;  4MXM A;  3Q3S A;  5D18 A;  3ON4 A;  1RKW A;  2R5Y A;  4GCT A;  3QPL A;  4EEF G;  4BXX J;  1DU0 A;  2K9N A;  1JT0 A;  1W0T A;  3VVZ A;  2KDZ A;  2L7F P;  1FIA A;  3TP0 A;  1GV2 A;  1ORK A;  3BR2 A;  2DTZ A;  3BHQ A;  2XSD C;  2R92 J;  4RBO A;  4B3A A;  1D5Y A;  2CUF A;  1TC3 C;  1SGM A;  1TWG J;  1B8I A;  1GT0 C;  1XS9 A;  5FKN A;  3NPI A;  5F1J A;  5EGO B;  2HXI A;  5GPC A;  2O9L A;  4DYR A;  1JTX A;  1DU6 A;  3MKL A;  1QVU A;  2Y2Z A;  4M3E A;  3HTH A;  4A3L J;  3PO2 J;  1O4X A;  3JSJ A;  4A3E J;  5FLV A;  3FK6 A;  5J1U A;  5IP6 A;  1UHS A;  2ZOZ A;  2CJJ A;  1JUP A;  1PUF B;  1MNM C;  3Q0U A;  3LWJ A;  4Y7N J;  2LTP A;  1ETX A;  2VKV A;  1ZR2 A;  2DG7 A;  1B72 A;  1NK3 P;  2Y30 A;  1IGN A;  3DCF A;  2I10 A;  2MW8 A;  1X2M A;  5F0H A;  1A6I A;  3BTJ A;  2XB0 X;  3BG3 A;  1MSF C;  3A01 B;  3CRJ A;  3S1R J;  3KKC A;  1P7I A;  4MO7 A;  4GFB A;  2ELK A;  4UUS B;  1ZR4 A;  3GZI A;  3ZQG A;  1IDY A;  2DMN A;  1TWC J;  4BY1 J;  1QPI A;  5DS9 A;  1OCP A;  5HBU A;  2GLO A;  2HOT A;  4GFK A;  5M3F J;  3BTI A;  1GUU A;  3DPJ A;  5HSZ A;  2AHQ A;  2G7S A;  1S7E A;  3ON2 A;  1T33 A;  5E3N A;  1ETW A;  4IHY A;  2HYT A;  1U9N A;  3CJD A;  2O7T A;  2R5Z B;  4A3J J;  2JK3 A;  3LHQ A;  5IP7 J;  2JN6 A;  3B6A A;  2W53 A;  1WPK A;  3E7L A;  4A3K J;  3HIM A;  4C3J J;  4V2G A;  2QIB A;  2L0K A;  2GUH A;  4S0H B;  3M4O J;  2CQQ A;  3HB9 A;  1GV5 A;  2OI8 A;  2B63 J;  3O8H A;  5F08 A;  2DMU A;  2M0C A;  4XRS G;  2JA7 J;  1HOM A;  1UG2 A;  4AC6 A;  3F1B A;  1I6H J;  1Y1W J;  3OOU A;  1MBE A;  5EG0 B;  3BT9 A;  1WGX A;  3LSJ A;  4XID A;  2QCO A;  3G1M A;  1K61 A;  1H88 C;  3PAS A;  3FK7 A;  2XDN A;  4MFE A;  1WCM J;  1BW5 A;  5M5X J;  2XB5 A;  3FIS A;  3HOV J;  3ZQH A;  2H8R A;  3G56 A;  3ZOB A;  1BW6 A;  3WHC A;  4M3B A;  5J1R A;  2X9D A;  3HTI A;  2K40 A;  3QQA A;  5GPA A;  3VPR A;  3L1P A;  3AQT A;  3S5R A;  3CMY A;  1OFC X;  2UXP A;  3Q0W A;  4IEJ A;  5C4X J;  1AU7 A;  3BR3 A;  4XRS A;  4B1R A;  2EZH A;  3K2A A;  5E3M A; 
#chains in the Genus database with same CATH topology
 4EM0 B;  1W36 D;  3HSF A;  2DOF A;  3H5R A;  3KYD B;  1VQO I;  4M3G A;  2BW3 A;  1YIJ I;  3F9K A;  1XDS A;  1F43 A;  3HIF A;  3DBR B;  5EZH A;  2M1B A;  5LD2 C;  2Z99 A;  3VTI A;  1R4N B;  4ZC3 A;  3CF5 F;  4XLA A;  3KZI C;  2JJ7 A;  4F91 B;  2MG4 A;  3CCR I;  3VB2 A;  1HST A;  4RAY A;  3HM5 A;  4V19 K;  2L5Q A;  2E1N A;  2CMP A;  5GAE J;  3O6B B;  2EZK A;  1GXP A;  2EZI A;  2OAZ A;  3VYS B;  1Z0X A;  5ED4 A;  4LG0 B;  1T98 A;  3F23 A;  3KKD A;  4HBL A;  3FHZ A;  2H09 A;  3FBN B;  4RGR A;  2E34 A;  5D5W B;  4HV6 A;  3HGG A;  1TT0 A;  3ZQI A;  3GLX A;  4FX4 A;  1HSJ A;  3OYI A;  4M3F A;  1I3A A;  3S93 A;  1SVO A;  3MZY A;  1F4K A;  1YOV B;  2R5Y B;  4UVC A;  4PJM A;  2BV6 A;  2HZT A;  5JHU A;  3NQO A;  1ZK8 A;  1MBH A;  3FM5 A;  3LSI A;  2JA2 A;  2ID3 A;  4F55 A;  1YJN I;  2DBB A;  1U0J A;  3VSK A;  3HTJ A;  2DA2 A;  3IKV A;  2CQX A;  2DA4 A;  1K78 B;  3JRC A;  2NRA C;  2R7Z J;  5J4Y A;  4UB6 C;  5ILU A;  1TL8 A;  2IGO A;  5L3F A;  3RPU A;  5D8K B;  1HLV A;  3FBI B;  1MZB A;  3BQZ A;  5TJJ A;  2P81 A;  3T1B A;  2HNH A;  2NVT J;  4UDS A;  2KP6 A;  3N97 A;  2DJN A;  2ZME B;  2D2W A;  3HOU J;  4RA2 A;  2ZXW H;  3G1O A;  3SYT A;  4XL9 A;  4CYC A;  2QSH X;  4ZZD A;  4A3D J;  2WAQ N;  2QYO A;  1USS A;  2NS0 A;  5FFX A;  1R5H A;  2UXI A;  1QZZ A;  4D7M A;  3NS4 A;  4Y17 A;  1JKQ C;  3IAS 2;  1FSE A;  1BOB A;  3AG4 H;  4Y15 A;  2YVX A;  4X0G A;  2Y9Z A;  3MKW B;  3FXM A;  2DA3 A;  3LA3 A;  1LEA A;  4FE4 A;  5H9T A;  2RQP A;  3CC4 I;  2NVX J;  1XB4 A;  1YLF A;  2X1E A;  1J75 A;  1PVE A;  2GQQ A;  4G7H F;  2F48 A;  4G6Q A;  1XSX A;  2XAQ A;  3A02 A;  2K3F A;  2OUM A;  4PJL A;  4FHT A;  1UJ8 A;  4Y4R A;  4G9Y A;  2NS7 A;  1UHM A;  3DTE A;  1H9T A;  5KCM A;  4KT6 A;  4BH9 A;  1ZG5 A;  1ON1 A;  1HF0 A;  5FLM J;  2K27 A;  3R0A A;  5D6E A;  1XMK A;  4U7D A;  3VOX A;  1YW8 A;  1BI1 A;  4WIB A;  4A3I J;  1EKE A;  3H9J A;  4IQ4 A;  2B0L A;  2M5W A;  4LOC A;  4FIS A;  3AQS A;  2G0E A;  2HFH A;  3QU6 A;  4JX5 A;  3P9I A;  3V78 A;  4YZE A;  1B1B A;  2Y31 A;  2JTV A;  2M3A A;  1J09 A;  3LA2 A;  4R8H A;  3V8J A;  4DYC A;  5DEQ A;  1YO5 C;  1U78 A;  1TWH J;  4WXC A;  4RM2 A;  1H89 C;  2BEO A;  5ICC A;  3RJP A;  3L00 A;  2NOJ B;  2RAE A;  2GIZ A;  4LB6 B;  4LLN A;  1LVA A;  2EFN A;  2GIV A;  3FKJ A;  4XKC A;  1DUX C;  2STT A;  2WA0 A;  5FB2 A;  1CF7 B;  5H6R A;  1OLT A;  2DK8 A;  4KMF A;  3B73 A;  5JR3 A;  4HRI A;  1GXQ A;  2L2O A;  2M7B A;  3I59 B;  3TW6 A;  4U7B A;  3R61 A;  1LDK B;  1SFO J;  2LG4 A;  5EFY A;  3VDX A;  5F0F A;  4QWQ A;  1FLI A;  1FMV A;  1QGP A;  3WGH A;  3OIO A;  3MMY B;  1EH7 A;  2E1O A;  3REO A;  3Q5F A;  2E2H J;  3AG2 H;  3LL7 A;  2LH9 A;  2NP5 A;  4IOC F;  2FOK A;  3GUD A;  1B9M A;  4M9Z A;  4I76 A;  1WJB A;  2EIM H;  2BY3 A;  2XPW A;  2F07 A;  2I8D A;  4Z2Y A;  1TQM A;  5J3L A;  1FPQ A;  2CH0 A;  4RAF A;  3S16 J;  3PFY A;  2ZY9 A;  3VW2 A;  2PMU A;  2FNP A;  4DW6 A;  3BG5 A;  2IPQ X;  1DP7 P;  4LG0 A;  2L01 A;  2OA4 A;  1I6X A;  4YFN F;  4B48 A;  2FX0 A;  2GOM A;  5FRO A;  1W7P D;  1YYV A;  1VF9 A;  1U5T B;  3BG9 A;  1YW9 A;  4A93 J;  4BY7 J;  2YU3 A;  5F27 A;  4I01 A;  2OD5 A;  4M6Y A;  5ICE A;  4LFU A;  1MMA A;  3JAM K;  4HKU A;  3CDI A;  2HYJ A;  2ZKZ A;  3L09 A;  3M1E A;  2P8T A;  4MK6 A;  3H0G J;  2Q1Z B;  5F64 A;  1M1E B;  4XNF A;  4L5J A;  4MHG A;  4QPO A;  5HNH A;  4ZYE A;  4KMU X;  3WE3 A;  3BCB A;  3RKQ A;  2UXN A;  2XGE A;  2LD5 A;  3G73 A;  3E6D A;  4U0V A;  2MD5 A;  3FZV A;  3ZP5 A;  2E2J J;  5IT3 A;  4I7H A;  2IAI A;  3PO3 J;  3O3K A;  2COM A;  3KZY A;  2CFX A;  4D9J A;  4IZZ A;  2CFO A;  3COL A;  1U8B A;  2XKO A;  4HF1 A;  4NQW B;  3WTU C;  3HG9 A;  2H6B A;  3KCC A;  3CCQ I;  4KIS A;  4L9V A;  3L2Q A;  5HLI A;  5DM6 F;  2KLO A;  3L2R A;  3MVP A;  3W3C A;  1OCZ H;  1SD7 A;  3IH2 A;  1RUO A;  3PPB A;  2OCE A;  3B6C A;  2IW5 A;  2E19 A;  1D8J A;  3BR1 A;  4XOT A;  3R0J A;  1SC7 A;  2MAB A;  5HLG A;  3V6G A;  1V55 H;  4CHU A;  3A0B C;  3KX2 A;  5HS7 A;  4EAT A;  2PJR A;  2Y75 A;  2YSR A;  3ABU A;  3GTJ J;  4Y13 A;  3BPX A;  3BJ6 A;  5JLX A;  4FE7 A;  2M2E A;  5JHF A;  4FTH A;  4Y52 J;  3EQL F;  3JAM Z;  1IN4 A;  1OYW A;  1IN5 A;  2DI3 A;  3KNW A;  1JUS A;  1ITY A;  3I53 A;  2IBD A;  1VI0 A;  4Q4Z F;  4IL6 C;  2QSG X;  1SAX A;  3FXK A;  1FTT A;  4DVY P;  1QVT A;  3C07 A;  3BZ6 A;  5EG0 A;  1LE8 B;  2A2F X;  3DBL B;  1LDJ A;  1X1B A;  4CZC A;  5DCM B;  1OR7 A;  2JWT A;  1YE9 A;  2LOO A;  3K4L A;  2HPM A;  1ETQ A;  3GFJ A;  1RET A;  4B43 A;  2YR2 A;  4HX4 A;  4MQ9 F;  3E0J B;  4DYQ A;  4KUM A;  3RTR A;  5AON A;  2ID6 A;  1SFK A;  2QQB A;  2Q2E B;  5DTD A;  1BN5 A;  2A6H F;  4CCM A;  5C44 J;  4RDU A;  3M3Y J;  3EGQ A;  4GCK A;  1MGT A;  2PJP A;  1DQU A;  2QOP A;  2MA3 A;  1W7P A;  1AKH B;  4ZDL A;  3S1N J;  3CC7 I;  2W48 A;  2L9R A;  5IP9 J;  2ZXI A;  4XIC A;  5HNF A;  4HLY A;  2LBF A;  2VOO A;  6PAX A;  3OSG A;  2G3B A;  1Z67 A;  1H9G A;  1IXS B;  2QZ8 A;  3A4C A;  3LNQ A;  4OIO F;  1OPC A;  1P4W A;  1V4R A;  2M4K A;  1HKQ A;  3DTK A;  4F52 A;  3U1D A;  2MGQ A;  2HOS A;  2ZJ2 A;  3H3V K;  3S17 J;  3ZMD A;  2OJE D;  3HEF A;  2Y0S N;  2OU2 A;  2EBI A;  4MIM A;  4NDL A;  5D19 A;  3HUG A;  4HF0 A;  1RR7 A;  2C6Y A;  2HS5 A;  2ISY A;  3MD2 A;  4LJZ F;  1Z7L A;  3RPQ A;  2V26 A;  2XPV A;  2KJC A;  4IRG A;  2IA0 A;  1IO2 A;  2XPU A;  4AUX A;  1RUN A;  3J7Y J;  3HTA A;  5D5V B;  5E17 F;  5L3D A;  3DKY A;  5FRM A;  2OF7 A;  3BZK A;  1NK2 P;  3L2C A;  3I4M J;  3OY9 A;  4PDK A;  2GA2 A;  4FT8 A;  3Q3S A;  5D18 A;  4L0Z B;  2UV1 A;  3FF5 A;  4XR6 A;  5F6F A;  3QPL A;  4EEF G;  5JVG F;  2OQR A;  1DU0 A;  2K9N A;  4XQF A;  2BE5 F;  2L7F P;  1ORK A;  4XLN F;  2YX4 A;  4BE0 A;  2HU9 A;  2WAF A;  1U3E M;  1SD5 A;  2BYV E;  3B02 A;  3BHQ A;  2MYS A;  4RBO A;  2WWY A;  4EJU A;  4EMS A;  2CUF A;  1TC3 C;  3GYH X;  2L9N A;  2WV0 A;  2R7V A;  2E71 A;  4P9F A;  5F1J A;  5EGO B;  4I0A A;  1ZGJ A;  1J5Y A;  3MKL A;  1R4M B;  5CVJ A;  3RI4 A;  5BS6 A;  4A3L J;  4PJ0 C;  4P5O A;  1IUY A;  4ANJ A;  2L9S A;  2W4S A;  4LG3 A;  4KN7 X;  1UHS A;  2IGM A;  2R7D A;  2CJJ A;  1PUF B;  3Q0U A;  2HPI A;  1P4X A;  3FXR A;  3TQN A;  5GTH C;  2W7N A;  2VKV A;  2DG7 A;  4WCG A;  2NYX A;  3SHF A;  1X1P A;  3V8L A;  1KU3 A;  1WI9 A;  5F0H A;  3HOS A;  2L02 A;  1A6I A;  4BXF A;  5K1Y A;  5E1W A;  4KDP A;  3CRJ A;  2EIK H;  3FXO A;  2BY0 A;  2ELK A;  2QBY A;  4UUS B;  1RNL A;  3BP8 A;  3KP7 A;  3MAJ A;  1DGR M;  5JFR A;  1QPI A;  2VPL A;  4BNC A;  1XGS A;  2Z5U A;  4B3X A;  5M3F J;  3WTX C;  4LD5 A;  1GUU A;  3CMA I;  1T0F C;  1XX5 A;  4H4K C;  5HSZ A;  4YFK F;  2ZSI B;  2AHQ A;  2XSJ C;  3ON2 A;  5E3N A;  4IHS A;  2HYT A;  2ISZ A;  2O7T A;  3LHQ A;  5IP7 J;  4E7I A;  5FRN A;  1IZ1 A;  3E7L A;  4A3K J;  2R7S A;  4OIN F;  2Y0M A;  5L3G A;  4YFX F;  5JVT A;  2CWE A;  1ODD A;  4S0H B;  1SVM A;  4IJA A;  3HB9 A;  2OI8 A;  1LFP A;  2CQK A;  2IT0 A;  3O8H A;  2F5D A;  4XRS G;  4DBQ A;  1HOM A;  1BBY A;  1KYZ A;  3MZH A;  1I6H J;  4KA4 A;  2PMZ A;  1UG0 A;  5TRD A;  4U0Y A;  2B7E A;  4HQM A;  2QCO A;  3G1M A;  1H88 C;  1X19 A;  1T38 A;  3IWF A;  5B5E C;  1G6N A;  2R7F A;  1G8X A;  2LC2 A;  2XRN A;  5M5X J;  3BC8 A;  4YG2 F;  1QA6 A;  3ZPL A;  1RI7 A;  3FIS A;  1TNS A;  3VSL A;  3ZQH A;  3ZOB A;  3FHN A;  4I09 A;  2MBF A;  2V9K A;  1BW6 A;  1X4O A;  3C2G A;  3F3X A;  4M3B A;  3WHC A;  2HQN A;  3PQJ A;  2D1V A;  3HTI A;  1XSV A;  2P6S A;  2JT1 A;  2WC2 A;  3SZT A;  1VQP I;  3Q0W A;  4F93 B;  2JSP A;  2RN7 A;  4A0Z A;  2K5C A;  3DP7 A;  2CUJ A;  1R5I D;  2EZH A;  1N75 A;  5E3M A;  3K0L A;  1VQM I;  1SEU A;  2LMD A;  1RR8 C;  3QP6 A;  3V8K A;  2AS5 F;  3W2W A;  1QZY A;  2M8G X;  2WB1 N;  1I1G A;  2A6T A;  2XAS A;  4II2 A;  3BWG A;  5F1R A;  3GTO J;  2DQL A;  1JHH A;  3S1Q J;  4IRV A;  4ZJZ A;  3JRH A;  4HF2 A;  2ZXH A;  3N05 A;  2FUG 2;  2ZCX A;  1MND A;  1TWA J;  2DK5 A;  3HRM A;  3ZCO A;  1YIT I;  5KVR A;  3T8R A;  3ZQF A;  2DFE A;  1JJ6 C;  2MC4 A;  3B81 A;  1T95 A;  3E5Q A;  1PJR A;  3QP5 A;  1R9T J;  1MBK A;  2OZ6 A;  2VPR A;  5C4Y A;  4AID A;  3CMM A;  2BHZ A;  3BDD A;  3CUQ A;  2KPM A;  4ICH A;  4DBR A;  5IT9 K;  1Z91 A;  4EJW A;  3JTH A;  2HKX A;  1OJL A;  2W85 A;  4A6E A;  1S3J A;  1HKS A;  1Y56 A;  3E5X A;  4B8X A;  4BBR J;  1PP7 U;  4YIR X;  1Z77 A;  3AL0 C;  3LFU A;  4RLQ A;  2K86 A;  3GWZ A;  2DJI A;  1HKT A;  2FBI A;  1HW1 A;  5ERI A;  3F8B A;  2F2E A;  2X48 A;  1WHU A;  3ASO H;  3OIP A;  3GTM J;  4A2U A;  3IH4 A;  2L7M P;  4C3I J;  2COB A;  2LR8 A;  4JBA A;  1BM9 A;  2HVS A;  3OS0 A;  5K7H A;  3ZMZ A;  3RH2 A;  5E8G A;  2EV5 A;  2VI6 A;  1IUF A;  2MH2 A;  5CVI A;  5HOD A;  2YX7 A;  3K1M A;  1X1D A;  3KPH A;  4PUS A;  1LNW A;  3H0D A;  3OYE A;  1YS6 A;  3G4S I;  2GEN A;  3WTS C;  2VBW A;  1WH5 A;  3QOD A;  4CCJ A;  5F04 A;  2O7O A;  5FKO A;  3FMS A;  5IYD J;  2DXI A;  4BAC A;  3DPU A;  4IXA A;  1UAA A;  3SZG A;  2VQC A;  1WVR A;  1TNT A;  5ICF A;  1LB2 A;  3FXL A;  2NP3 A;  2FXA A;  4C2M J;  5LHG A;  1ZQ3 P;  4HNV A;  5LHI A;  1IN7 A;  2DYR H;  3JRG A;  3ESW B;  3BPV A;  3HYI A;  4HST A;  4UUS A;  1B72 B;  3BTL A;  2DOE A;  2IEK A;  4XLE A;  4ENJ A;  3HRT A;  3P7N A;  2QQA A;  3MZ8 A;  3KYC B;  1O3S A;  5IT9 Z;  5L3C A;  4DJA A;  1ERD A;  1RKT A;  2DT5 A;  1BC8 C;  4P1W A;  4NNJ A;  3ANP A;  2KIU A;  1HDP A;  3DKW A;  3LAP A;  4PK4 A;  2R7X A;  3PIO F;  4IHV A;  3WTZ A;  4QLC U;  2KIM A;  2LYC A;  2G9W A;  1JKO C;  1IDZ A;  2DMQ A;  4II3 A;  4G6D A;  1SFU A;  2VB6 A;  2HKO A;  1D0Z A;  3NWT A;  4MGR A;  3TOB A;  3OYD A;  3GZN B;  2FBQ A;  1U2W A;  1OYI A;  2JUG A;  2UZK A;  3I9V 2;  5J1Y A;  3EUH C;  4QPQ A;  3GME A;  2YVE A;  1G3T A;  2L4A A;  2QKM B;  3K8P C;  5K5Q A;  2R7Q A;  4OOI A;  2FNA A;  2E7W A;  2MLK A;  4D5C A;  5K58 A;  2LP0 A;  2FBH A;  3V7S A;  3KEY A;  2V9V A;  1ZH5 A;  2FMY A;  4KIF A;  1H8A C;  5BMZ A;  5EZG A;  2ZCM A;  3RYR A;  4U9L A;  4EV0 A;  4ZH4 F;  3LA7 A;  4LMY A;  2FQ3 A;  1MDM B;  4XLC A;  3V7R A;  2BXZ A;  2DFI A;  4E7S A;  2GA1 A;  2Z2S B;  4F7Z A;  5LEK A;  3IRR A;  3TKY A;  1QPM A;  2QQ8 A;  1PDN C;  2Q0O A;  2ZB9 A;  2KT0 A;  5FGM A;  2QSF X;  3AFH A;  1VQN I;  4MEY F;  3WE2 A;  3CLO A;  2RGV A;  3LMM A;  1APL C;  2FJ1 A;  1B4A A;  4NUB A;  4XSX F;  5TIS C;  2ETH A;  2Z16 A;  1Z9C A;  2KIQ A;  5C4J J;  3T6N A;  2LDU A;  1XGN A;  3T8T A;  3F72 A;  2BGC A;  1R22 A;  1XMX A;  4H0E A;  4AWX B;  5CW8 A;  5FMP A;  5IYB J;  4EGZ A;  1W1W E;  1MH4 A;  3GBG A;  1FP1 D;  4PCQ A;  1W5T A;  2P7C B;  2AQE A;  1D1C A;  5FKL A;  1U8R A;  3G7R A;  1E3O C;  4C2M A;  2KJB A;  3C2H A;  2HVQ A;  4BL0 B;  2XUB A;  2UXH A;  3K70 C;  5HAW A;  3TO6 A;  1OMI A;  3GCM A;  3KLN A;  4AVP A;  2LF7 A;  4GGG A;  4PSX A;  3FM3 A;  1Q1V A;  5JI6 A;  3SEQ A;  4A3B J;  3VOK A;  1XDU A;  3IUO A;  3S14 J;  3CP8 A;  4MFD A;  4ASN A;  4XLH A;  3E6C C;  1ZHF A;  3BTC A;  1V5F A;  3IHU A;  2JA5 J;  1QNT A;  3GFM A;  2GWR A;  3RSN A;  2IGK A;  2CV0 A;  4L9N A;  1KU9 A;  1F1Z A;  4X1E A;  2EJR A;  5DAJ A;  4JX6 A;  1NG7 A;  1Q1H A;  4BEH A;  3I56 I;  2AO9 A;  1ZAO A;  4A0Y A;  1KYW A;  4DZJ A;  4G12 A;  1S29 A;  3JRD A;  5JLW A;  2O61 A;  1UST A;  1TW3 A;  1X3U A;  3FX3 A;  3KP3 A;  5E20 A;  3WHB A;  3JRF A;  1YJ9 I;  4UVB A;  5KAI C;  4BXU A;  3TP3 A;  2A68 F;  3X2Q H;  3K4K A;  2CRG A;  3A01 A;  2CW0 F;  2Q24 A;  2F6C A;  4UV8 A;  5IY5 H;  2VT3 A;  3OYM A;  3CME I;  1AA7 A;  2HTJ A;  3DEW A;  3DV8 A;  4Q48 A;  2EIL H;  2HQ5 A;  1W0U A;  2KZG A;  3LSG A;  2VQG A;  3BOQ A;  3ML6 A;  2CW8 A;  2VE9 A;  4U88 A;  1JGG A;  5KHD A;  3ONQ A;  3MFK A;  4L62 A;  1YI2 I;  3ZGK A;  1FEX A;  2GZW A;  2LSO A;  1IG7 A;  5FFZ A;  2Z9O A;  1ENH A;  4WK8 F;  2WBM A;  1FTZ A;  3SDG A;  5J8F A;  1XPX A;  4N9I A;  2X1C A;  1A04 A;  3LSH A;  4WXD A;  2DMT A;  3HDD A;  2Z33 A;  1WZ2 A;  4A5M A;  2LK2 A;  3CF2 A;  3FMR A;  4E4H A;  3ZMU A;  1L0O C;  1ETO A;  4OMZ A;  2KFD A;  3WTV C;  3A2K A;  2JPC A;  2GFN A;  1WRJ A;  2PZ9 A;  1EV7 A;  1WWX A;  3HXL A;  4CCK A;  3VP5 A;  3U1K A;  2DW4 A;  1MBG A;  4HX7 A;  4FX0 A;  3NRG A;  2XVC A;  2WGB A;  1QU3 A;  4L5I A;  3WOD F;  1V54 H;  4S05 A;  1G59 A;  2EWN A;  3F22 A;  2KRC A;  3S2D J;  3F8M A;  5CLS A;  1O3R A;  1OR7 C;  1RC9 A;  3D5S C;  4PSW A;  4YIF A;  4XLP F;  4G7Z F;  1FYM A;  2LLK A;  3F0C A;  3QU3 A;  2QUF A;  1AWC A;  3GTP J;  3BR0 A;  1EF4 A;  3C3W A;  3ZRG A;  1C0W A;  4ZDO A;  4QTR A;  5J8C A;  4GCV A;  1QRY A;  1V5G A;  2QWT A;  2M30 A;  1X1A A;  5D5U B;  4YII A;  5HS8 A;  2VBX A;  2ZC2 A;  4XN3 A;  1JKR C;  5H2F C;  3M8E A;  5DV5 A;  1JUM A;  3K4N A;  2YS9 A;  2Z3Y A;  1ZRD A;  3DTI A;  2QWW A;  4HOB A;  2STW A;  4OIP F;  2R4G A;  3DU5 A;  2MH9 A;  3WG7 H;  1ACI A;  1FOX A;  2HI3 A;  2HDW A;  1RZ4 A;  2HVR A;  4RB0 A;  3RIR A;  4G94 A;  4X6A J;  2LY9 A;  1FBQ A;  2ZSH B;  4MLO A;  3T0Y A;  1S8N A;  3ZN1 A;  1AOY A;  1Y8R B;  5D1R A;  5GTI C;  2IVM A;  3NXC A;  5IPA A;  4XSZ F;  2GM4 A;  3W6V A;  2HDD A;  2V1D A;  2ECC A;  3GXO A;  2A5W A;  4ETS A;  3M8F A;  4MXM A;  2QKL B;  3H9Q A;  2R5Y A;  3VYR B;  3CES A;  1I27 A;  4BXX J;  1N78 A;  5LRS A;  3R60 A;  4L9J A;  2EFP A;  2KDZ A;  1GV2 A;  1XGO A;  1R23 A;  2XSD C;  2R7W A;  2PLY A;  2UWM A;  4B3A A;  1D5Y A;  1DGW Y;  2PN6 A;  4B09 A;  1K78 A;  1YX5 A;  1B6A A;  5DD4 A;  2F5E A;  3ABK H;  1X3W B;  1GT0 C;  2ZJP F;  2H1L A;  2O9L A;  4DYR A;  4CDG A;  2R7R A;  1QVU A;  2M45 A;  4WF2 A;  3RQ4 A;  2ZME A;  5LHH A;  1BR1 A;  5L3E A;  3D0S A;  3KYL A;  5FLV A;  3FK6 A;  1DPU A;  4M72 A;  2ZOZ A;  1JUP A;  1BJA A;  1MNM C;  3A1Y A;  4Y7N J;  3VEP A;  1ETX A;  1ZR2 A;  1S9H A;  2JPB A;  5LEJ A;  3DCF A;  3V4G A;  2I10 A;  5DUK A;  1R58 A;  1IGN A;  3KP4 A;  1OKR A;  1X2M A;  3CJT B;  3M8J A;  2XB0 X;  2P7V B;  2H27 A;  1UZC A;  5LFA A;  1MSF C;  3KKC A;  3K1N A;  4ESF A;  1F5T A;  3DBH B;  3QOP A;  1JI8 A;  1A31 A;  3I71 A;  1SVL A;  3RDI A;  1ZLK A;  3ZQG A;  3KZZ A;  2F5C A;  4RGX A;  1TWC J;  4ZYA A;  4AIK A;  4BY1 J;  1I1S A;  3OMY A;  4R1H A;  3QYE A;  4OMY A;  4N9H A;  3WTW C;  2GLO A;  2HOE A;  3RKW A;  1OQY A;  2VBY A;  3NEU A;  4EJV A;  4HX8 A;  2QEX I;  3S2W A;  4C2T A;  3I64 A;  4YRV A;  1ETW A;  4IHY A;  1U9N A;  1QZE A;  2R5Z B;  3I4P A;  4GXO A;  1YFH A;  3AG3 H;  1WPK A;  2JRM A;  2D45 A;  2VL8 A;  1Y0N A;  3DPT A;  2QIB A;  5HS9 A;  2CQQ A;  1GV5 A;  4BYY A;  4EQQ A;  2LRE A;  3EPZ A;  2JA7 J;  4GYG A;  3DU6 A;  1MMS A;  3F1B A;  3QRF F;  5FLX K;  1JE8 A;  1HW2 A;  2XF6 A;  3RCO A;  3CJN A;  4CIC A;  4U0W A;  4IX7 A;  1D8K A;  2K9M A;  1HC8 A;  1WGX A;  4RS8 A;  1CF7 A;  3C7J A;  1FSH A;  1FBU A;  1YIO A;  2XDN A;  1ZAR A;  1WCM J;  4MFE A;  2E36 A;  2E35 A;  3PUB A;  3I59 A;  3HTU A;  2H8R A;  4AYB A;  3HOV J;  2MLG A;  2ZNY A;  4E6K G;  3ERM A;  2X9D A;  1KQ0 A;  1E3P A;  2K40 A;  1K79 A;  3S5R A;  3CMY A;  4C30 A;  1IN6 A;  2L7K A;  3PNT A;  1CGP A;  5LGT A;  1Y1W J;  1MKM A;  3JSJ A;  4HZF A;  1G3Y A;  2K7L A;  5LGU A;  1YRN B;  2WUI A;  3HGY A;  1FBS A;  2VJJ A;  4ENK A;  1WKM A;  1PYV A;  4JQF A;  2IXS A;  3DWL E;  3CCJ I;  2EIJ H;  2M87 A;  5TGT A;  2OCC H;  2W82 A;  1U5T A;  5EEG A;  2K9S A;  3QYF A;  2CUZ A;  4FCY A;  3VOD A;  5HLT A;  3RKY A;  5D4S A;  3DPL C;  1MMG A;  2DDA A;  1EH8 A;  3TW7 A;  4A3F J;  1XGM A;  4CGR A;  4FAS D;  4ZTJ A;  3PL8 A;  5J6X A;  3ROU A;  4KIT B;  4UB8 C;  3TDU C;  1VQL I;  4N4N B;  3ASN H;  1K4S A;  2W1O A;  4UY8 I;  1TQP A;  4ENN A;  5FLX Z;  4D1Q A;  2KHM A;  3OOP A;  3WTT C;  1P6R A;  1W4M A;  2K4B A;  5M3M J;  2MC3 A;  2G7L A;  1UCR A;  3JR9 A;  3RKX A;  2KMU A;  1VND A;  4AIJ A;  4CCN A;  5GP9 A;  4XOR A;  1RIO H;  3ZQQ A;  4AM3 A;  4DNC A;  1EA3 A;  1HQC A;  5CXG A;  2Y69 H;  2DT6 A;  1P9Q C;  4NQW A;  3I0T A;  2KIS A;  3RQI A;  3H35 A;  1XTA A;  1Z3X A;  3IV5 A;  1POG A;  1FOY A;  3OYF A;  1B8I B;  3KZ9 A;  3E1S A;  3ISP A;  3R6S A;  3VFZ A;  3L2W A;  3QPT A;  1ETY A;  4E7J A;  1QBJ A;  1IRG A;  1S5L C;  1WJ5 A;  3S2H J;  3FRQ A;  2VC1 A;  3WTY C;  2VKH A;  3K4B A;  2EPF A;  2G7U A;  4FET A;  1NHA A;  2XAG A;  4I98 B;  5ILS A;  3H5N A;  1A6Q A;  5K5R A;  3ECO A;  2M0M A;  2LKX A;  1W5S A;  2OPT A;  4AYB N;  2BY1 A;  5HDN A;  1YTY A;  5K7Z A;  4N0B A;  3HRS A;  5BQT A;  4LLG F;  4OD4 A;  2DAO A;  2KQR A;  5H20 A;  3MKY B;  5EF6 A;  1GDT A;  1T6S A;  4GCL A;  1ZLJ A;  3JSO A;  1RES A;  1SFX A;  1VQ8 I;  2DYS H;  4BJ5 C;  3JRA A;  4IHX A;  3D5L A;  4ITV A;  1OCR H;  1JJ8 C;  1LE8 A;  3SFI A;  2LY2 A;  1K6O A;  4Y3O A;  1UFM A;  4CZZ A;  2B3W A;  2WV1 A;  5DCM A;  2REK A;  5CYV A;  4E7K A;  2W24 A;  2JZY A;  2DOD A;  1BIA A;  1JHF A;  1FIP A;  3BCG A;  1G2H A;  3GTG J;  1TW2 A;  1XMA A;  2HWV A;  2FEZ A;  2XAF A;  3VW0 A;  2V9P A;  2Q2E A;  2MD0 A;  4E70 A;  4BS9 A;  2G7G A;  1HXD A;  4BU2 A;  1ETV A;  4EVI A;  2CO5 A;  1FYL A;  2ZO4 A;  1AKH A;  3ZR8 X;  2OQG A;  4D5F A;  3VW1 A;  1Z21 A;  4UV9 A;  2EH3 A;  3BRU A;  5FJ8 J;  2O8K A;  5IYC J;  3CCM I;  1FMW A;  2Y9Y A;  2IS4 A;  4A3C J;  3KET A;  1X1C A;  1I3Q J;  2BZT A;  2DG8 A;  2OZU A;  3BG6 A;  3JCU C;  1B59 A;  2FA5 A;  3FXU A;  3TBI A;  2EA2 A;  2NVU B;  4CSW A;  4RB3 C;  2K02 A;  1KA8 A;  3CJQ B;  2E1M C;  2VIX A;  5BNG A;  1OIS A;  2JA8 J;  2R7U A;  2QKO A;  2IJL A;  3G2B A;  2XGD A;  3EDP A;  3ZN0 A;  4IHW A;  1VTN C;  3FIW A;  4L18 B;  3CTA A;  1LFB A;  2W25 A;  3PSI A;  1K7A A;  4P96 A;  1R6R A;  1AHD P;  5J4V A;  1L3L A;  3F8N A;  1WI3 A;  3K4J A;  1P2F A;  2F4M B;  3BCA A;  1T39 A;  2XHK A;  1KON A;  2BW3 B;  2DA7 A;  4A12 A;  1OCT C;  1JXS A;  2DTR A;  4XN0 A;  9ANT A;  1R1T A;  2CU7 A;  2E2I J;  3P9C A;  1N25 A;  3MNL A;  2P0W A;  2LKP A;  1BA5 A;  3LQQ A;  4JP0 A;  2NAZ A;  2ZBK A;  4M6V A;  2ZJQ F;  2H94 A;  3HOX J;  4GO1 A;  2JMW A;  4KIG A;  1S7A A;  1WFX A;  3JRB A;  4AF5 A;  4OU0 A;  3LOC A;  2ZNZ A;  3KLO A;  4XRF A;  4J19 A;  2PFV A;  1R1V A;  3BNI A;  3BG7 A;  1J7K A;  4CH7 A;  4B44 A;  3SFZ A;  5D8L B;  2GXA A;  4E7H A;  2GBY A;  2VQH A;  3AL0 B;  3RD3 A;  4ZDP A;  3I3L A;  4WXH A;  4BQN A;  5EGO A;  2V6C A;  3S8P A;  3S3M A;  2FF4 A;  3FDY A;  2X6O A;  1X2N A;  2BBY A;  3OYJ A;  2OTL I;  4BAY A;  5CPR B;  1MBJ A;  1IAW A;  3OYH A;  1BI0 A;  3CD6 I;  1PUF A;  1FNN A;  3W2A A;  4M9S A;  4NC7 A;  2PMZ N;  3MWM A;  1LUJ B;  4ENM A;  3NAU A;  4C3H J;  4GFL A;  1XC5 A;  4BJ6 C;  4WWC A;  1ON2 A;  3I4N J;  3L7W A;  4C9Y A;  2QA4 I;  2EV6 A;  2BOL A;  3C2B A;  5B1B H;  2PG4 A;  2LFB A;  2KRF A;  4JK1 X;  5J40 A;  2DPU A;  3GX4 X;  4LIV A;  2VJ5 A;  2L4M A;  4I6Z A;  3EUP A;  1S6L A;  4BHP A;  3D5R C;  4DGW B;  3J7A Y;  2NOG A;  3OSF A;  4KNY A;  2JUC A;  1Y1V J;  2EV0 A;  4L5E A;  2DDB A;  5AIP A;  3GFI A;  4PGG A;  3DKX A;  4CYC B;  3ZMT A;  3AAF A;  3CCL I;  4GYI A;  2BHY A;  1O7F A;  1MH3 A;  1MMN A;  2P4W A;  4OAY A;  4XK4 A;  4AVZ A;  3J81 K;  5FHP A;  2X0L A;  3WU1 B;  1KQ8 A;  3F8C A;  1D5V A;  1NTC A;  2Q8K A;  5J47 A;  3KP2 A;  1TBX A;  2XIG A;  1SD6 A;  4I02 A;  2ME6 A;  2QF7 A;  4IKF A;  1Z05 A;  3K10 A;  4OWR B;  1UEL B;  5F0C A;  4BUP A;  2EFQ A;  3E6M A;  5EEH A;  1NH3 A;  4PXI A;  3ELK A;  1G3S A;  1KGS A;  2DMP A;  3CP2 A;  3GW2 A;  3RPU D;  2Y48 A;  1PP8 F;  3GTK J;  3H9G A;  3K2Z A;  2X1D A;  3ECH A;  3LJL A;  4HNT A;  1I50 J;  4IVN A;  1W36 C;  4R79 A;  3H1C A;  2E5N A;  2L54 A;  1TWF J;  4XKB A;  3S32 A;  3ZQ7 A;  4EGY A;  2NNY A;  1IC8 A;  4MEX F;  2ECB A;  2EIN H;  1UI5 A;  4M74 A;  2D6Y A;  1XG1 A;  1ZGA A;  1QQI A;  1REP C;  1FJL A;  1QHH D;  1FOW A;  2HZD A;  1E3H A;  5EYR A;  4CCO A;  2A07 F;  4NB5 A;  4J00 A;  4UUV A;  4JYK A;  2IU5 A;  4O6J A;  2LY1 A;  3CCY A;  3K6G A;  1G3W A;  2ZFW A;  2P5K A;  1QHG A;  2GOX B;  5M5W J;  3I5U A;  3IAM 2;  1Z6T A;  1R7J A;  3HBL A;  4F3Q A;  5HOO A;  2UXU A;  3OWT A;  3GFL A;  3ABM H;  4CO8 A;  4KWA A;  1D1A A;  3Q0V A;  2JVH A;  1PUE E;  2EB7 A;  4S04 A;  1R71 A;  2TRT A;  3ABT A;  1IRZ A;  2RAS A;  1YX3 A;  1ZG3 A;  3SXY A;  3J81 Z;  3LSR A;  2VN2 A;  3CJR B;  5K7F A;  2DN0 A;  4MTD A;  2IS1 A;  2DLL A;  1BJZ A;  1G4D A;  2ME0 A;  3J7Z I;  1ZN2 A;  4XKW A;  2GAU A;  3H36 A;  2PEX A;  2L7Z A;  3HJE A;  2FML A;  4RLF A;  5E1X A;  2NVQ J;  5HVQ C;  3FWE A;  2VJ4 A;  3GEZ A;  4V2F A;  3RZO J;  3OL3 A;  4DZP A;  2CGP A;  3ANG A;  4CXF A;  1WH7 A;  2WY8 Q;  3IP4 B;  4HW0 A;  3O2P E;  2YU9 J;  1BIB A;  4NN1 A;  3KEO A;  2K9L A;  3LAJ A;  3IH3 A;  4N4O B;  5LLQ A;  2J5P A;  5D5X B;  4HYE A;  3U9G A;  3DEU A;  4A3G J;  1ZRC A;  2PMH A;  4A0X A;  4G6T B;  5LGN A;  2I5U A;  2XV4 S;  2RNG A;  3OYK A;  5KK1 A;  1JT0 A;  3BRO A;  1XD7 A;  4Q5S F;  1FIA A;  3CDH A;  4ZYD A;  2AQF A;  3WGG A;  3BR2 A;  3E3V A;  2A05 A;  3HPG A;  2R92 J;  1ZYR F;  4HDV A;  3C18 A;  1TWG J;  2V4J C;  4D0P A;  1XS9 A;  2AXL A;  3K4M A;  5FKN A;  3NPI A;  2ZCW A;  3F8F A;  4GDF A;  2HXI A;  2CV1 A;  1JTX A;  3CCE I;  2Y2Z A;  4M3E A;  5KNL A;  3M9A A;  2BY2 A;  3HTH A;  4M9X A;  3PO2 J;  1O4X A;  4IO9 F;  2IS6 A;  3K70 D;  2HEO A;  5J1U A;  2ZME C;  2NXN B;  2LTP A;  4OAZ A;  1B72 A;  4BDY A;  1NK3 P;  2D1H A;  2MW8 A;  4NC8 A;  4IQJ A;  3OYL A;  3LST A;  2X6W A;  3BY6 A;  3BG3 A;  2KKO A;  1YS7 A;  1VQ9 I;  3S1R J;  2KZV A;  1P7I A;  3S3O A;  4NBQ A;  3QPH A;  4GFB A;  3G6E I;  1Z7U A;  3F6V A;  1ZR4 A;  3GZI A;  1LEB A;  3KIO A;  2H6C A;  5DS9 A;  1OCP A;  2EFO A;  5H6Q A;  2ACJ A;  5GAG J;  5HBU A;  2HOT A;  4GFK A;  2WTE A;  3HZJ A;  2M8E A;  3E97 A;  3W6K B;  3DPJ A;  3DXJ F;  4Y33 A;  1R49 A;  2G7S A;  1SMY F;  2PJR B;  3S3N A;  1Y39 A;  1XCV A;  4A3J J;  4KYW A;  2JN6 A;  3B6A A;  1I39 A;  2W53 A;  1A36 A;  2A5Y B;  1R36 A;  2H8W A;  5E1Z B;  2XC7 A;  4C3J J;  4V2G A;  2L9V A;  2GUH A;  4NC6 A;  1EJ9 A;  3M4O J;  3BZC A;  3EUH A;  5F08 A;  5CVV A;  2CQN A;  2M0C A;  1UG2 A;  2F4I A;  1O7L A;  3HC7 A;  3JSP A;  2CV2 A;  5DYM A;  3OOU A;  3MEX A;  5EG0 B;  1WQ2 A;  2E1C A;  1MDM A;  1VQK I;  3M7G A;  3CLQ A;  3LSJ A;  5BOX A;  2XAH A;  2CG4 A;  5B3S H;  3CCV I;  1BI2 A;  1K61 A;  1IXC A;  3PAS A;  1D0Y A;  3FK7 A;  3ULQ B;  4LB5 A;  4RGU A;  2K4J A;  1BW5 A;  1D0X A;  3KEQ A;  2ZFU A;  5DM7 F;  1R1U A;  2RQQ A;  2RC4 A;  5J1R A;  1XN7 A;  1WJE A;  3TDZ C;  3OR2 C;  2E60 A;  1HBX G;  4M6X A;  3OYA A;  1OFC X;  2UXP A;  3OIQ A;  3K4C A;  3PNY A;  3BR3 A;  4I0B A;  1W7P B;  4YEL A;  4ZZL A;  5A2Q K;  2HXO A;  1W5C C;  1TTY A;  2KL4 A;  2KDO A;  3KP5 A;  3G3Z A;  4M73 A;  3O8G A;  4UUT A;  3JRE A;  1MBF A;  2M9H A;  5DDG A;  4JNN A;  3VYU B;  4BDZ A;  3I55 I;  2LBF B;  2ELH A;  2EK5 A;  4QIW N;  1S72 I;  4G7O F;  4XLF A;  1ZGW A;  4AC0 A;  4BQQ A;  4ESJ A;  4UXN A;  2VC0 A;  2JSC A;  5IOY A;  3S15 J;  4J01 A;  1O57 A;  4BHC A;  4HQE A;  2VKD A;  1FWZ A;  2NS8 A;  3O60 A;  3G71 I;  4IOA F;  1U5T C;  2IP2 A;  1LFU P;  3FKI J;  3NWS A;  1P7J A;  4G8X A;  4CUG A;  3PUF A;  3JTG A;  2ZJR F;  3HOT A;  3UKG A;  2V1U A;  3VVX A;  3HUG B;  1T56 A;  2OBP A;  2XRL A;  2DCE A;  3HPH A;  3UR3 C;  4PFO A;  2VT2 A;  1ONV A;  4BGD A;  4FQG A;  3EUK L;  2EQR A;  2F4O B;  2V6E A;  2DO7 A;  3TGN A;  3COA C;  4ME9 A;  4LIT A;  3TL4 X;  2ZCN A;  4E7Z A;  4Z6Y A;  3GEU A;  3WG9 A;  2OER A;  2RV8 A;  2HYG D;  5FKK A;  3PM1 A;  3HOZ J;  1D3Y A;  2KIF A;  4RB2 C;  4O3M A;  2LKS A;  2ADU A;  3GZ6 A;  2LF8 A;  2W84 A;  4I99 C;  3ERE D;  3SJM A;  2FRH A;  5FD6 A;  4F92 B;  1K6Y A;  5KAF C;  3KP6 A;  4HLX A;  1LJ9 A;  3MCZ A;  3BR5 A;  3DFG A;  3QYB A;  1FYK A;  4B47 A;  5E18 F;  2WAE A;  3HTS B;  1DPR A;  4L9T A;  1FC3 A;  3JRI A;  2FQ4 A;  3DQV C;  2K9Q A;  5A2Q Z;  1VQ5 I;  2VON A;  1FX7 A;  1MJB A;  4W97 A;  4JX4 A;  2Y0S A;  1U6G A;  1LKX A;  3Q9S A;  4B4C A;  2QVO A;  3TOA A;  4BJT A;  2MSY A;  3HL2 A;  4KJZ A;  3HHG A;  3OV8 A;  1P4A A;  2CUE A;  2J5O A;  4HG2 A;  3RZD J;  5ILV A;  2DQR A;  3D1N I;  1TZL A;  3H3U A;  1LQ1 A;  2L3D A;  3TED A;  2D5V A;  2F5F A;  4LK0 F;  5C3E J;  3AKZ A;  1IW7 F;  2XRO A;  3QPS A;  1FOK A;  3EYI A;  1ZKG A;  2F5V A;  2R0Q C;  3BLY A;  2X51 A;  1GHC A;  2YVH A;  5E79 C;  1Y6I A;  1OCC H;  2UUZ A;  2HQA A;  2B9S A;  5EEA A;  2EFW A;  2AXT C;  2JVG A;  1YQA A;  4NEL A;  3F21 A;  2QBY B;  1GVJ A;  5AIQ A;  3SDB A;  1FT9 A;  1KU2 A;  2O5R A;  1Y8Q B;  3ZQL A;  3F6O A;  4IPA A;  2W57 A;  2DA6 A;  3C1D A;  5BPI A;  3QOE A;  4XM3 A;  1RRJ A;  4ON0 A;  2P6T A;  3ZMS A;  2XAJ A;  1GLN A;  3P9T A;  2FD5 A;  2YUS A;  3NAR A;  3PQK A;  4EM1 A;  1ZEL A;  3IKT A;  5E3O A;  1YJW I;  2VUM J;  3DLA A;  2ESN A;  2OV7 A;  1OYY A;  4U9N A;  5FKM A;  2CSO A;  1TLH B;  2VOP A;  1UB9 A;  2V79 A;  5FGL A;  1I5Z A;  2FOW A;  2OC6 A;  1O3T A;  4EM2 A;  4ESB A;  4BQA A;  2HTS A;  4Q47 A;  2RNJ A;  1VQ4 I;  4HV5 A;  3OS2 A;  3OYN A;  2VBZ A;  3L2V A;  4CGZ A;  2PBI A;  3E5U A;  2O6G E;  2DOA A;  3PNV A;  3L2U A;  2JRT A;  1R00 A;  4BKX A;  5BPD A;  5DUI A;  4UHT A;  3A0H C;  5EJC A;  3MQ0 A;  1LDD A;  2M7A A;  1JKP C;  3SQN A;  3MKZ A;  3H3Z A;  4P55 A;  4IHT A;  4XRM A;  4PJN A;  4HEA 2;  3DF8 A;  1SAN A;  2CYY A;  1J59 A;  3CO6 C;  3HOW J;  2ZXJ A;  2W00 A;  5AQC A;  1TQI A;  2GXG A;  4CCL A;  3ZQC A;  2JA6 J;  3UNG C;  4M3D A;  1OCO H;  3TO9 A;  4LK1 F;  2R93 J;  1VZ0 A;  2QTQ A;  1IJW C;  3AG1 H;  1LPQ A;  1WJC A;  4IRI A;  4PZJ A;  4QSH A;  3VIB A;  2DA1 A;  4RM3 A;  3WU2 C;  3A03 A;  2WY7 Q;  3H5A A;  3LQR A;  4A69 C;  1DP3 A;  3WGI A;  4I2O A;  4MNU A;  5D6F A;  3OYB A;  1U9O A;  5L3B A;  3CQZ J;  2NVY J;  2H1K A;  2M4G A;  1STZ A;  4WX9 A;  3J7A O;  1ZTR A;  3CUQ C;  2PFB A;  4W1U A;  3VOE A;  3GZ5 A;  1T8I A;  3SWH A;  2BVL A;  4MQV A;  1WJF A;  2VQL A;  3PJR A;  3BJA A;  2RKH A;  2LRD A;  4GRI A;  3HE0 A;  1Z6R A;  2HOA A;  2CQ7 A;  5E8I A;  1VQ6 I;  3R4K A;  3PFI A;  2X4H A;  5CKT A;  3CUQ B;  2N8G A;  2FBK A;  2X85 A;  3ZXS A;  1BC7 C;  4PJJ A;  1MSE C;  1YW7 A;  4XMY A;  3HOY J;  2FJI 1;  4M71 A;  3HKZ A;  3OR1 C;  1FY7 A;  2ZOY A;  3BR6 A;  4ZYH A;  1JT6 A;  1J9I A;  3IUV A;  3GTL J;  2VAS A;  4RAZ A;  4XBF A;  1EH6 A;  2YPR A;  5M5Y J;  1CQT A;  1UI6 A;  1IRF A;  4HNU A;  4HDU A;  2R7O A;  3EYY A;  5CXI A;  1MW7 A;  1O3Q A;  1BL0 A;  2A61 A;  3S1M J;  5DCF A;  2PI0 A;  5DD8 A;  1ZRE A;  3I54 A;  2PBX A;  3P9K A;  2WAD A;  5LBQ A;  2WB1 A;  1GVD A;  2K85 A;  5IOZ A;  2V57 A;  1SMT A;  3OYC A;  2K3P A;  4L0Y B;  5E3L A;  2V1N A;  4D7N A;  4XKV A;  3LSP A;  4A3M J;  2R7T A;  5EDN A;  5CQE A;  2RRE A;  3CZ6 A;  2LVS A;  2TCT A;  3K9T A;  4U87 A;  3TO7 A;  4BHB A;  5B66 C;  5HDG A;  3VUQ A;  2XF7 A;  2FSW A;  4EJT A;  3G1L A;  5HDK A;  1A35 A;  3T5X A;  3K1P A;  4CA0 A;  4C2U A;  2HKU A;  1IV8 A;  3BJB A;  5B1A H;  2O3F A;  2NNN A;  2RHA A;  3N4M A;  4BQO A;  1MNE A;  1X58 A;  2R5Z A;  3FMQ A;  1IN8 A;  1X3Z B;  3K7A J;  4JOM A;  2RDP A;  1Z1D A;  2LNB A;  3SEZ A;  3CO7 C;  2UXO A;  2A69 F;  1BI3 A;  2HR3 A;  1XCB A;  1E2X A;  4HPQ A;  1ETK A;  3GVA A;  3ZMV A;  4JL3 A;  2XF5 A;  4XON A;  4AD9 A;  1UMQ A;  4MTE A;  4CYD A;  1YG2 A;  3U2R A;  4KIC A;  1R5G A;  4RMN A;  3IC7 A;  2M34 A;  2E7X A;  2HGC A;  3CWR A;  3GTQ J;  1ZG1 A;  2XAU A;  4NHJ A;  2VKE A;  4BE1 A;  4UVA A;  4IF4 A;  3QKX A;  4PGH A;  4ZTF A;  2B1E A;  2IRF G;  3LSK A;  1H0M A;  3CC2 I;  2NX4 A;  3MN2 A;  1Y0U A;  1HDD C;  2VXD A;  3RYP A;  3GO5 A;  4LLL A;  2O8X A;  4ZYG A;  3OL4 A;  1IRX A;  1MJ9 A;  1T08 B;  3J80 K;  2KRH A;  4ABZ A;  2JQ7 A;  3QBM A;  4JKZ A;  2G7H A;  4BBS J;  2XDV A;  1JTY A;  3VVY A;  3VYT B;  1P92 A;  3IRQ A;  3M07 A;  1VFC A;  1HW5 A;  3IL2 A;  1FZP B;  3Q9V A;  3HKZ N;  5GAH J;  1YRN A;  2Z1D A;  2BXY A;  3NRV A;  4PFP A;  1NG6 A;  2MFZ A;  2QLZ A;  1BR4 A;  1KU7 A;  1HCR A;  3CDL A;  3FXQ A;  3BQY A;  2A3S A;  2PQ8 A;  5HLH A;  1LVK A;  2P5L C;  2E1M B;  1RPW A;  3WU0 A;  2QQ9 A;  1TT5 B;  2DFF A;  3V7C A;  4E7L A;  2EA4 A;  1WSU A;  1K83 J;  1XSD A;  4DOZ A;  1T2K A;  1Z3Y A;  1UHW A;  3IWZ A;  3E7Q A;  2VE8 A;  3HRU A;  4TV7 A;  2XGX A;  2EZL A;  3NNR A;  3M1C A;  2DA5 A;  2X6X A;  2XGC A;  4ACI A;  1A5J A;  3NI7 A;  1MD0 A;  1IV6 A;  1F36 A;  3JW4 A;  3ON4 A;  1RKW A;  2HQR A;  4UNO A;  4GCT A;  3K69 A;  1SD4 A;  1J0R A;  1D1B A;  1V3F A;  1V5E A;  1W0T A;  3VVZ A;  3DEE A;  3I58 A;  3TP0 A;  4AU7 A;  5GAD J;  2VLA A;  2DTZ A;  3J80 Z;  3GLL A;  2IGN A;  1BR2 A;  1SGM A;  1MJA A;  2E5Z A;  3EUA A;  1B8I A;  4KFC A;  2CS3 A;  2GXB A;  5CVU A;  2O0Y A;  1KQ9 A;  2IA1 A;  2VOD A;  2O03 A;  5GPC A;  3VWB A;  3W6J B;  1DU6 A;  4YEJ A;  2QGU A;  1WJD A;  3E6B A;  2BVM A;  2TDX A;  4LIU A;  5ICG A;  3P5J A;  3W2V A;  4BEH B;  5FD5 A;  4A3E J;  3L9F A;  3LWF A;  3OYG A;  2R3S A;  4RAG A;  5IP6 A;  2ESH A;  1YHQ I;  3TMO A;  3LWJ A;  1X4P A;  2IA2 A;  4A5N A;  3QAH A;  2ELJ A;  1N77 A;  2Y30 A;  1KZH A;  5LRR A;  4HAM A;  3BTJ A;  4KT5 C;  3H92 A;  3HHH A;  1MIJ A;  2V7F A;  1ZRF A;  5D4R A;  3A01 B;  3PIP F;  4MO7 A;  2DT7 B;  3QWL A;  4KIB A;  1HA8 A;  2XKP A;  5CVR A;  1IDY A;  2DMN A;  1T0F A;  3CUO A;  4DQ2 A;  1VQ7 I;  3FXJ A;  4OIR F;  3GF2 A;  3DLL F;  3HSR A;  4RGS A;  3BTI A;  4O5V A;  4XOP A;  2P5V A;  2IS2 A;  2FU4 A;  1IXR C;  3V42 A;  1S7E A;  4IRH A;  1T33 A;  1QO0 D;  1TP4 A;  3KE2 A;  3KFW X;  3CJD A;  2JK3 A;  4KN4 X;  3ABL H;  4LGW A;  5K5O A;  2PX9 A;  2QEN A;  3HIM A;  1S7O A;  2VJI A;  4OIQ F;  1FP2 A;  2L0K A;  1WJA A;  1BOA A;  2B63 J;  1DDN A;  2HDC A;  3CCS I;  2DMU A;  1J2X A;  1IF1 A;  2OTJ I;  3LFK A;  1JGS A;  4AC6 A;  2UXX A;  2A6E F;  3BJO A;  2DU9 A;  4BE2 A;  2DFH A;  3LSM A;  5CJ9 A;  1MBE A;  3U21 A;  4HA8 A;  3BT9 A;  1B9N A;  4K2E A;  4XID A;  4HSR A;  4EJO A;  2VXZ A;  2WAQ A;  3EET A;  2QM3 A;  1F9N A;  2CW7 A;  2XB5 A;  3G56 A;  2FE3 A;  1MMD A;  2HYF A;  2ICW G;  3OS1 A;  2DPD A;  2RVC A;  3HSE A;  5FO5 A;  2V1X A;  4A6D A;  1E0E A;  4AIH A;  1ULY A;  1E17 A;  2X6Y A;  1SFE A;  3QQA A;  5CQG A;  5GPA A;  3VPR A;  1SAU A;  3L1P A;  3SZP A;  3PSF A;  4DIQ A;  1K4T A;  3AQT A;  4RB1 A;  4IEJ A;  3CCU I;  5C4X J;  4P9U A;  1AU7 A;  4XRS A;  4B1R A;  4OD5 A;  3K2A A; 
#chains in the Genus database with same CATH homology
 2HXO A;  4M3G A;  1F43 A;  2WUI A;  1YRN B;  3O8G A;  4UUT A;  3JRE A;  1MBF A;  2M9H A;  3HGY A;  5EZH A;  4JNN A;  2M8G X;  2WB1 N;  3GTO J;  4QIW N;  2JJ7 A;  3S1Q J;  1ZGW A;  4AC0 A;  2MG4 A;  3JRH A;  2K9S A;  3HM5 A;  5IOY A;  3S15 J;  2ZCX A;  1TWA J;  4FCY A;  2EZK A;  2NS8 A;  3ZQF A;  3O60 A;  1JJ6 C;  3B81 A;  2EZI A;  1LFU P;  1Z0X A;  3FKI J;  1P7J A;  3TW7 A;  3UKG A;  4A3F J;  1MBK A;  2VPR A;  1R9T J;  5C4Y A;  3VVX A;  3KKD A;  1T56 A;  4ICH A;  2XRL A;  1OJL A;  2EQR A;  4BBR J;  3HGG A;  4ME9 A;  2ZCN A;  1Z77 A;  3ZQI A;  3GEU A;  4M3F A;  2OER A;  5FKK A;  3PM1 A;  3HOZ J;  2X48 A;  5M3M J;  2G7L A;  3GTM J;  3IH4 A;  2L7M P;  4C3I J;  3JR9 A;  2R5Y B;  2COB A;  2LR8 A;  1VND A;  5GP9 A;  1ZK8 A;  1MBH A;  5K7H A;  3SJM A;  2ID3 A;  3RH2 A;  5CXG A;  2VI6 A;  1IUF A;  5HOD A;  3HTJ A;  2DA2 A;  3BR5 A;  3RQI A;  2CQX A;  2GEN A;  2DA4 A;  3IV5 A;  3JRC A;  1POG A;  2R7Z J;  1B8I B;  3KZ9 A;  1WH5 A;  5F04 A;  2O7O A;  5FKO A;  3JRI A;  1HLV A;  2FQ4 A;  5IYD J;  1ETY A;  3BQZ A;  2K9Q A;  2P81 A;  3S2H J;  3FRQ A;  2NVT J;  4UDS A;  2DJN A;  4W97 A;  3PPB A;  4JX4 A;  3HOU J;  4B4C A;  3G1O A;  4CYC A;  2MSY A;  4A3D J;  2CUE A;  2WAQ N;  3RZD J;  2NP3 A;  4C2M J;  3D1N I;  1ZQ3 P;  4HNV A;  2LKX A;  2OPT A;  4AYB N;  3JRG A;  2UXI A;  4D7M A;  3TED A;  5K7Z A;  4UUS A;  1JKQ C;  5C3E J;  1B72 B;  2D5V A;  3QPS A;  3BTL A;  1ZKG A;  2R0Q C;  2Y9Z A;  2IEK A;  2DA3 A;  5EF6 A;  1GDT A;  4FE4 A;  2YVH A;  4GCL A;  5H9T A;  2NVX J;  5EEA A;  1RES A;  1RKT A;  3JRA A;  4NEL A;  4IHX A;  3ANP A;  3A02 A;  1HDP A;  1JJ8 C;  1LE8 A;  3SFI A;  4IHV A;  2NS7 A;  2REK A;  2WV1 A;  3ZQL A;  1JKO C;  2DA6 A;  1IDZ A;  2DMQ A;  1HF0 A;  5FLM J;  2FBQ A;  1FIP A;  3P9T A;  2FD5 A;  3NAR A;  2YUS A;  1G2H A;  3BCG A;  3VOX A;  5E3O A;  5J1Y A;  2VUM J;  3GTG J;  4A3I J;  5FKM A;  2YVE A;  4LOC A;  3VW0 A;  4FIS A;  3AQS A;  2G0E A;  5FGL A;  2G7G A;  4JX5 A;  1ETV A;  3V78 A;  4D5C A;  4YZE A;  5K58 A;  2Y31 A;  2LP0 A;  1AKH A;  3VW1 A;  4D5F A;  4DYC A;  2EH3 A;  3BRU A;  1U78 A;  1TWH J;  1H8A C;  1H89 C;  5EZG A;  2ZCM A;  5FJ8 J;  4BKX A;  2O8K A;  5IYC J;  2RAE A;  2Y9Y A;  4A3C J;  1I3Q J;  1JKP C;  2DG8 A;  4XRM A;  1SAN A;  1SFO J;  3TW6 A;  5EFY A;  2ZB9 A;  2KT0 A;  3HOW J;  5AQC A;  5F0F A;  3ZQC A;  5BNG A;  2JA6 J;  2JA8 J;  4M3D A;  2QKO A;  2R93 J;  2XGD A;  1APL C;  2FJ1 A;  2QTQ A;  3OIO A;  1IJW C;  2E1O A;  2NP5 A;  4IHW A;  2E2H J;  3T6N A;  5C4J J;  3FIW A;  4QSH A;  3VIB A;  2DA1 A;  1LFB A;  4I76 A;  1AHD P;  3A03 A;  1WI3 A;  2XPW A;  2F07 A;  5CW8 A;  4A69 C;  5FMP A;  5IYB J;  5J3L A;  2DA7 A;  3S16 J;  1OCT C;  3VW2 A;  1MH4 A;  3GBG A;  1U9O A;  4DW6 A;  3BG5 A;  9ANT A;  2NVY J;  3CQZ J;  2CU7 A;  2E2I J;  3MNL A;  5FKL A;  2H1K A;  3G7R A;  2FX0 A;  1E3O C;  1BA5 A;  4JP0 A;  1ZTR A;  1VF9 A;  3BG9 A;  4W1U A;  4M6V A;  4A93 J;  4BY7 J;  2UXH A;  5F27 A;  3HOX J;  5HAW A;  2JMW A;  3JRB A;  4AF5 A;  3HE0 A;  2HOA A;  3LOC A;  1Q1V A;  4J19 A;  4HKU A;  2HYJ A;  3BNI A;  4A3B J;  3VOK A;  4MK6 A;  2N8G A;  3H0G J;  3S14 J;  2GBY A;  4MFD A;  3RD3 A;  1MSE C;  3HOY J;  5EGO A;  3BTC A;  2JA5 J;  3RKQ A;  2LD5 A;  2XGE A;  2ZOY A;  3BR6 A;  1JT6 A;  1X2N A;  2X6O A;  3GTL J;  4X1E A;  3IUV A;  5M5Y J;  4JX6 A;  1UI6 A;  5DAJ A;  1CQT A;  1MBJ A;  2E2J J;  5CXI A;  2AO9 A;  2IAI A;  1BL0 A;  3PO3 J;  4DZJ A;  4G12 A;  1PUF A;  3S1M J;  3JRD A;  5JLW A;  2PMZ N;  3COL A;  2PBX A;  3NAU A;  4C3H J;  3WHB A;  3JRF A;  1U8B A;  4GFL A;  1XC5 A;  3TP3 A;  3I4N J;  3C2B A;  1GVD A;  2CRG A;  5IOZ A;  3A01 A;  2V57 A;  2Q24 A;  2LFB A;  3DEW A;  5E3L A;  3MVP A;  4D7N A;  3LSP A;  4A3M J;  2HQ5 A;  3IH2 A;  5EDN A;  4I6Z A;  1W0U A;  3LSG A;  3EUP A;  3S1N J;  3B6C A;  2LVS A;  2TCT A;  2NOG A;  2E19 A;  3OSF A;  3BR1 A;  3VUQ A;  1Y1V J;  4L5E A;  1JGG A;  3G1L A;  3V6G A;  4CYC B;  2HKU A;  3BJB A;  4L62 A;  1FEX A;  2RHA A;  1MH3 A;  3GTJ J;  1IG7 A;  4XK4 A;  5FHP A;  1X58 A;  2R5Z A;  1ENH A;  5JLX A;  4FE7 A;  3K7A J;  1FTZ A;  2M2E A;  3SDG A;  4FTH A;  1NTC A;  4Y52 J;  3KNW A;  2ME6 A;  2QF7 A;  1JUS A;  2DMT A;  2UXO A;  3HDD A;  1ITY A;  2IBD A;  1VI0 A;  2LK2 A;  1ETK A;  4CGR A;  4JL3 A;  5F0C A;  2PZ9 A;  1ETO A;  2GFN A;  1FTT A;  4PXI A;  1QVT A;  2DMP A;  3C07 A;  1UMQ A;  3GTK J;  3VP5 A;  5EG0 A;  1LE8 B;  3LJL A;  2M34 A;  1MBG A;  3CWR A;  3GTQ J;  3NRG A;  1I50 J;  2WGB A;  2VKE A;  2JWT A;  3QKX A;  1TWF J;  1IC8 A;  2ECB A;  1ETQ A;  1RET A;  1UI5 A;  3S2D J;  2D6Y A;  2NX4 A;  3MN2 A;  1XG1 A;  1HDD C;  4DYQ A;  2LLK A;  3F0C A;  1FJL A;  3GTP J;  2ID6 A;  3BR0 A;  1EF4 A;  4ABZ A;  4JKZ A;  5DTD A;  5C44 J;  5EYR A;  4BBS J;  3QBM A;  4RDU A;  3M3Y J;  4QTR A;  1JTY A;  3EGQ A;  4JYK A;  2IU5 A;  3VVY A;  4GCK A;  3CCY A;  1QRY A;  2QWT A;  2QOP A;  5M5W J;  1AKH B;  1VFC A;  2W48 A;  3HBL A;  3HKZ N;  2L9R A;  2UXU A;  1YRN A;  5IP9 J;  4KWA A;  1JKR C;  3Q0V A;  1HCR A;  4XIC A;  3CDL A;  1JUM A;  3BQY A;  2TRT A;  1IRZ A;  2YS9 A;  3OSG A;  2G3B A;  2RAS A;  3LNQ A;  1RPW A;  3LSR A;  5K7F A;  2HOS A;  2DN0 A;  2MGQ A;  1BJZ A;  2HI3 A;  3H3V K;  3S17 J;  2ME0 A;  3HEF A;  2Y0S N;  4MIM A;  2EBI A;  4NDL A;  5D19 A;  1K83 J;  2L7Z A;  4X6A J;  2NVQ J;  2LY9 A;  1RR7 A;  4V2F A;  3RZO J;  3E7Q A;  2XPV A;  4DZP A;  4MLO A;  2XPU A;  3ANG A;  4AUX A;  1WH7 A;  5D1R A;  2EZL A;  2YU9 J;  3HTA A;  4NN1 A;  3NNR A;  3NXC A;  5IPA A;  2DA5 A;  2XGC A;  2GM4 A;  3IH3 A;  2OF7 A;  4ACI A;  1A5J A;  3W6V A;  1NK2 P;  2HDD A;  3I4M J;  3NI7 A;  2ECC A;  1IV6 A;  1F36 A;  4A3G J;  4MXM A;  3Q3S A;  5D18 A;  3ON4 A;  1RKW A;  2R5Y A;  4GCT A;  3QPL A;  4EEF G;  4BXX J;  1DU0 A;  2K9N A;  1JT0 A;  1W0T A;  3VVZ A;  2KDZ A;  2L7F P;  1FIA A;  3TP0 A;  1GV2 A;  1ORK A;  3BR2 A;  2DTZ A;  3BHQ A;  2XSD C;  2R92 J;  4RBO A;  4B3A A;  1D5Y A;  2CUF A;  1TC3 C;  1SGM A;  1TWG J;  1B8I A;  1GT0 C;  1XS9 A;  5FKN A;  3NPI A;  5F1J A;  5EGO B;  2HXI A;  5GPC A;  2O9L A;  4DYR A;  1JTX A;  1DU6 A;  3MKL A;  1QVU A;  2Y2Z A;  4M3E A;  3HTH A;  4A3L J;  3PO2 J;  1O4X A;  3JSJ A;  4A3E J;  5FLV A;  3FK6 A;  5J1U A;  5IP6 A;  1UHS A;  2ZOZ A;  2CJJ A;  1JUP A;  1PUF B;  1MNM C;  3Q0U A;  3LWJ A;  4Y7N J;  2LTP A;  1ETX A;  2VKV A;  1ZR2 A;  2DG7 A;  1B72 A;  1NK3 P;  2Y30 A;  1IGN A;  3DCF A;  2I10 A;  2MW8 A;  1X2M A;  5F0H A;  1A6I A;  3BTJ A;  2XB0 X;  3BG3 A;  1MSF C;  3A01 B;  3CRJ A;  3S1R J;  3KKC A;  1P7I A;  4MO7 A;  4GFB A;  2ELK A;  4UUS B;  1ZR4 A;  3GZI A;  3ZQG A;  1IDY A;  2DMN A;  1TWC J;  4BY1 J;  1QPI A;  5DS9 A;  1OCP A;  5HBU A;  2GLO A;  2HOT A;  4GFK A;  5M3F J;  3BTI A;  1GUU A;  3DPJ A;  5HSZ A;  2AHQ A;  2G7S A;  1S7E A;  3ON2 A;  1T33 A;  5E3N A;  1ETW A;  4IHY A;  2HYT A;  1U9N A;  3CJD A;  2O7T A;  2R5Z B;  4A3J J;  2JK3 A;  3LHQ A;  5IP7 J;  2JN6 A;  3B6A A;  2W53 A;  1WPK A;  3E7L A;  4A3K J;  3HIM A;  4C3J J;  4V2G A;  2QIB A;  2L0K A;  2GUH A;  4S0H B;  3M4O J;  2CQQ A;  3HB9 A;  1GV5 A;  2OI8 A;  2B63 J;  3O8H A;  5F08 A;  2DMU A;  2M0C A;  4XRS G;  2JA7 J;  1HOM A;  1UG2 A;  4AC6 A;  3F1B A;  1I6H J;  1Y1W J;  3OOU A;  1MBE A;  5EG0 B;  3BT9 A;  1WGX A;  3LSJ A;  4XID A;  2QCO A;  3G1M A;  1K61 A;  1H88 C;  3PAS A;  3FK7 A;  2XDN A;  4MFE A;  1WCM J;  1BW5 A;  5M5X J;  2XB5 A;  3FIS A;  3HOV J;  3ZQH A;  2H8R A;  3G56 A;  3ZOB A;  1BW6 A;  3WHC A;  4M3B A;  5J1R A;  2X9D A;  3HTI A;  2K40 A;  3QQA A;  5GPA A;  3VPR A;  3L1P A;  3AQT A;  3S5R A;  3CMY A;  1OFC X;  2UXP A;  3Q0W A;  4IEJ A;  5C4X J;  1AU7 A;  3BR3 A;  4XRS A;  4B1R A;  2EZH A;  3K2A A;  5E3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...