2Y31A

Simocyclinone c4 bound form of tetr-like repressor simr
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
242
Chain Sequence
PVSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
molecule keywords PUTATIVE REPRESSOR SIMREG2
total genus 92
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y31A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y31A02
2R5YA 4FE7A 4XRMA 2ECCA 3GEUA 3CRJA 2DG7A 1FTZA 1OCTC 2G0EA 2XB5A 1XS9A 3JSJA 5JLWA 2Y9YA 1JTYA 2K9NA 5K58A 1FEXA 2WAQN 2M34A 5IYCJ 5HODA 4UUSB 3I4NJ 3V6GA 4V2GA 4DYQA 3PASA 1LE8B 1VNDA 1GV2A 3G7RA 1S7EA 2ID3A 1XG1A 5EF6A 3BQZA 2D6YA 1IDYA 1AKHB 3COLA 1O4XA 1ZR4A 2X6OA 5J1YA 1OFCX 2R5ZA 1JT6A 2MG4A 2I10A 5JLXA 4AYBN 1ETYA 3C2BA 1APLC 3HOYJ 2FQ4A 3BR5A 3TW7A 1JKRC 2HOAA 2ID6A 5F08A 4JP0A 5C44J 1X58A 3SJMA 4XRSA 2REKA 1MBEA 1K83J 3QPSA 5K7FA 4BBSJ 3CJDA 3EGQA 5FKKA 2VKVA 3F0CA 5M5YJ 1FIPA 4A3FJ 2WGBA 1WI3A 3S5RA 4Y7NJ 5E3NA 1JTXA 4C3IJ 3HDDA 1VFCA 2UXHA 2L7ZA 4XK4A 2O9LA 3PO3J 5EZGA 1GVDA 2O7OA 1BJZA 2DMNA 2Y31A 5C4YA 2TCTA 3LSRA 4LOCA 5F0CA 1U8BA 3HOXJ 4GCKA 5IP6A 2D5VA 2X9DA 5HAWA 1H88C 2LFBA 2E2JJ 1UI6A 2QIBA 4MIMA 2WV1A 5F1JA 3PPBA 1JUSA 2NX4A 2IU5A 1ZR2A 1IJWC 3BCGA 1RESA 2M9HA 3S15J 2NVXJ 3LWJA 3ZQLA 3ANPA 3BTCA 3S17J 1QRYA 4GFLA 4MFEA 2ZOZA 4A3MJ 1TWFJ 4DZPA 2LY9A 3JRCA 3HGGA 4BXXJ 2ZOYA 2NP5A 1U9OA 2HDDA 4S0HB 1DU6A 3O8HA 1PUFA 3CMYA 2DA4A 3M4OJ 4Y52J 2NVQJ 4XRSG 2DA1A 4X1EA 5IYBJ 2QCOA 1AHDP 4JX4A 4XIDA 4RBOA 2HYJA 5EGOB 3LSGA 3ZQGA 1E3OC 1MNMC 2PMZN 1WCMJ 5IOZA 1POGA 2Q24A 4GFKA 3GTJJ 9ANTA 2UXUA 2DA6A 2L0KA 2CJJA 3VVYA 2EZIA 3HB9A 2E2IJ 4A3IJ 3HIMA 3MKLA 5FMPA 3VOXA 2JA5J 3W6VA 2RASA 3G1MA 2Y9ZA 3BR1A 1CQTA 2Y0SN 2DA2A 3FK6A 3BTIA 4B1RA 3QPLA 3TP0A 3MN2A 3QKXA 2X48A 3LOCA 2R7ZJ 2EBIA 1WH7A 2EZLA 3S1QJ 2NOGA 3ON2A 2DMUA 5E3OA 3KZ9A 1WH5A 1MBKA 4DYRA 3ANGA 3HOZJ 2NVYJ 5D1RA 2ZCNA 4AC0A 3GTQJ 3HEFA 5J1UA 2G7LA 2YUSA 2N8GA 1RETA 3CDLA 4BY1J 2YS9A 1A5JA 2L7FP 4IHWA 4QSHA 3L1PA 2JA6J 2E1OA 3BTLA 1RKTA 1UG2A 1Y1VJ 1JT0A 1A6IA 1QPIA 2E19A 4UUSA 4GFBA 1NTCA 2H1KA 1OCPA 3QBMA 4CGRA 3VP5A 1XC5A 3GTMJ 4HKUA 2CRGA 4A3CJ 1HDDC 2B63J 3F1BA 4ICHA 1QVTA 1ENHA 1OJLA 2HXOA 3BNIA 3BG5A 1TC3C 2VKEA 4IHXA 2CUEA 1Z77A 2FX0A 2IEKA 1IGNA 2V57A 2UXPA 2XRLA 4NDLA 5M3MJ 2JMWA 1YRNA 3SDGA 4A3JJ 3IV5A 1HF0A 3HGYA 2K9QA 1JKPC 1UMQA 3GTKJ 3HE0A 2DJNA 2R0QC 3S14J 5J1RA 2GLOA 3ZQHA 4M3BA 2XGCA 2VPRA 4I6ZA 3KKCA 2L7MP 2JA8J 3VW2A 5HBUA 5K7ZA 3OSFA 1D5YA 1B72B 5EZHA 5IP9J 3WHCA 4EEFG 3HOWJ 3ZQIA 4QIWN 5E3MA 4DW6A 1IG7A 1IDZA 3LHQA 3Q3SA 2AHQA 3MVPA 4C3HJ 3G1LA 2ZCXA 5DS9A 2LTPA 4UDSA 3DCFA 2W48A 4A69C 4AF5A 1SFOJ 1PUFB 3T6NA 1LE8A 4B3AA 5IOYA 5BNGA 1WGXA 5FLMJ 5FGLA 4YZEA 3OSGA 5EGOA 1G2HA 1Y1WJ 2PBXA 3JR9A 4JYKA 3JRBA 2O7TA 4A3EJ 3K7AJ 5HSZA 3BHQA 1AU7A 1ETQA 3RD3A 2L9RA 5C3EJ 3ZQFA 1ORKA 4ABZA 4DZJA 3UKGA 3PM1A 1JJ8C 2HKUA 4MK6A 1JUMA 2ME0A 2O8KA 4ACIA 5CXGA 3HTAA 3P9TA 1WPKA 5DTDA 2TRTA 2R5YB 1JKQC 4A3LJ 4RDUA 3JRHA 3I4MJ 2QF7A 3VUQA 3ZQCA 5F04A 1GT0C 3FK7A 1FTTA 2AO9A 1X2NA 4W97A 2M8GX 5IP7J 4UUTA 2YU9J 4NN1A 2YVHA 4C2MJ 1B8IA 1MBJA 3LJLA 1JGGA 3TEDA 3M3YJ 2DG8A 3BR6A 1Z0XA 2H8RA 1MSFC 2M0CA 2FBQA 3CCYA 3BG3A 2KDZA 4M3GA 2HOTA 4FTHA 2DTZA 2WB1N 4D5CA 2R93J 4FCYA 1UHSA 1FIAA 2R5ZB 3JRIA 3VVXA 3VW0A 3VW1A 3GTOJ 3B81A 4X6AJ 1MBFA 2JK3A 1ETVA 2GUHA 3BR2A 2DA5A 2K9SA 1QVUA 3MNLA 3BT9A 1RKWA 2CUFA 3CQZJ 3GTLJ 2MGQA 4KWAA 1JJ6C 2DMQA 3BG9A 3SFIA 2EZHA 3H0GJ 5M3FJ 2HXIA 5GPAA 5EDNA 1ETXA 3FKIJ 3A03A 3E7LA 1NK3P 1BL0A 1NK2P 1IC8A 3ON4A 2QOPA 2NVTJ 4MLOA 2ECBA 2OI8A 5EYRA 2JA7J 5E3LA 5GPCA 5M5XJ 1LFBA 1TWGJ 2M2EA 2FJ1A 4BY7J 5FKNA 1B8IB 5DAJA 2LLKA 2HOSA 5M5WJ 4J19A 3TP3A 1ZKGA 2G3BA 5EFYA 2ZCMA 3B6AA 2R92J 2WUIA 3NI7A 2Y30A 2LR8A 1MH3A 2ZB9A 4A3BJ 1MBGA 2GENA 3IH2A 3LSJA 3HBLA 3AQTA 3KNWA 2LKXA 2HI3A 2JWTA 3NARA 2XPVA 1H8AC 3NAUA 2GFNA 4IHVA 3G56A 1T33A 1I3QJ 2COBA 1K61A 1ZTRA 2OPTA 2XPWA 4C3JJ 1JKOC 2NS8A 4JX5A 2ME6A 3VPRA 5C4JJ 3HOVJ 1HOMA 2QKOA 1HLVA 1ETKA 3NRGA 1Q1VA 2IBDA 1GV5A 2W53A 3RH2A 4L62A 4G12A 2MSYA 3IH4A 2EQRA 1TWAJ 3JREA 1LFUP 5H9TA 1MSEC 2LVSA 2E2HJ 1TWHJ 4M3FA 3HTIA 4D7NA 4BBRJ 5CW8A 1RR7A 3FIWA 1P7JA 2LK2A 3BJBA 3D1NI 3S2HJ 2F07A 5F0HA 2CU7A 2NP3A 2NS7A 1SGMA 1EF4A 3RKQA 2QWTA 1JUPA 2EH3A 1ETOA 2DMTA 3S1RJ 4FISA 4MFDA 5EG0A 3JRGA 2ELKA 5EG0B 3BRUA 4IEJA 2VUMJ 3ZOBA 5IYDJ 3LNQA 4M3EA 1W0TA 5J3LA 1R9TJ 3BR3A 4M6VA 3QQAA 1BW6A 4M3DA 1HCRA 1VF9A 2IAIA 3GTGJ 2LD5A 2CQQA 1ZK8A 1DU0A 3GTPJ 3A02A 3PO2J 2GM4A 3GBGA 3VIBA 1ZGWA 2OERA 1TWCJ 1BW5A 4V2FA 5GP9A 3FRQA 2XPUA 4A3GJ 5CXIA 3NNRA 1IUFA 2JJ7A 3HTHA 3DPJA 2QTQA 1W0UA 4JKZA 4JL3A 2GBYA 1UI5A 1ITYA 3HKZN 5FKMA 2PZ9A 2HQ5A 2LP0A 3TW6A 3S16J 3RZOJ 2Y2ZA 4CYCA 3JRFA 2XSDC 3HOUJ 5FHPA 4FE4A 5F0FA 3Q0UA 3NPIA 4NELA 3FISA 4AUXA 3NXCA 2FD5A 2DA3A 1BA5A 3A01A 2EZKA 3EUPA 5D19A 1U78A 4QTRA 2RHAA 4JX6A 2XGDA 1I50J 4W1UA 3BR0A 4CYCB 1F43A 3O60A 3C07A 4XICA 1P7IA 2G7SA 1MH4A 1IRZA 2MW8A 5EEAA 3A01B 5AQCA 1X2MA 1F36A 3BTJA 1ZQ3P 1IV6A 2YVEA 3OOUA 2DN0A 2JN6A 1GUUA 5FKLA 1GDTA 2XDNA 3Q0VA 4L5EA 2UXOA 1MBHA 3V78A 3OIOA 5FLVA 4I76A 4MO7A 4MXMA 4GCTA 1B72A 4D7MA 3RQIA 3LSPA 5D18A 4PXIA 1RPWA 3DEWA 4BKXA 4JNNA 3RZDJ 2P81A 4HNVA 4GCLA 5IPAA 1FJLA 4A93J 3GZIA 4ME9A 1I6HJ 3VOKA 2VI6A 1VI0A 5F27A 5K7HA 3K2AA 1ETWA 3O8GA 3BQYA 3HM5A 2OF7A 3B6CA 3WHBA 1H89C 1T56A 3S1MJ 4B4CA 1AKHA 1HDPA 2HYTA 2KT0A 2G7GA 3AQSA 3JRAA 2UXIA 4AC6A 2CQXA 3G1OA 3VVZA 4DYCA 3Q0WA 4A3DJ 1SANA 2DMPA 3H3VK 2K40A 2XB0X 2XGEA 5C4XJ 3S2DJ 3IUVA 5FJ8J 4D5FA 2RAEA 3KKDA 3S1NJ 1YRNB 1U9NA 4A3KJ 4IHYA 5FKOA 3CWRA 3HTJA 3IH3A 2DA7A 3JRDA 3E7QA
chains in the Genus database with same CATH superfamily
3E6DA 3GEUA 5CPRB 3WTVC 1FTZA 2OZ6A 2LYCA 3DTEA 5CQEA 1XS9A 3MKYB 3JSJA 4ZYAA 4K2EA 2HFHA 1N78A 2WAQN 3T1BA 1LDDA 3WTUC 4V2GA 5TISC 2FEZA 1VNDA 2KRFA 3CCEI 1S7EA 2ID3A 1XG1A 2ZXWH 5HVQC 1FPQA 2CV1A 1PUEE 3PSIA 3COLA 4II2A 2X6OA 1JT6A 3KE2A 4P55A 5JLXA 3FHNA 3I71A 2M4KA 1APLC 5IT9Z 2FQ4A 4L5JA 3KZYA 3RTRA 4JP0A 2GA2A 3D5RC 3ECOA 4XRSA 3QPSA 4RGRA 1OISA 5J40A 3EGQA 5D8KB 3F0CA 1SAXA 3JTHA 4BHCA 1WI3A 4Y7NJ 2HKOA 2W82A 3NWTA 4OD5A 1Y0UA 3HUGA 4KJZA 2UXHA 2L7ZA 3PO3J 5EZGA 3FZVA 3R6SA 1VQ7I 2BYVE 2WC2A 3VFZA 2FA5A 2QENA 2QKMB 4A0ZA 1DPRA 4CICA 4KUMA 1IUYA 3HC7A 4LOCA 2O8XA 3HOXJ 3F3XA 5LHIA 2R7FA 2X9DA 1TNTA 1H88C 2AS5F 1E17A 2QIBA 2WV1A 4UB6C 1ZH5A 2DAOA 3DPTA 5E20A 2H8WA 2H09A 4HRIA 3EYYA 3LWJA 1D0XA 1GVJA 5ICCA 3PIOF 4R1HA 3AG3H 3A0BC 5AIQA 4AU7A 3GLXA 4LIVA 3U9GA 4E7JA 2HDDA 1DQUA 4I2OA 3O8HA 4CUGA 2L4AA 3GWZA 1X4OA 1PUFA 5IT9K 1YW7A 1MW7A 2IW5A 4X1EA 2NOJB 3K9TA 5IYBJ 4JX4A 4UNOA 2HYJA 3QYBA 4WF2A 4I7HA 4BU2A 1YJNI 2OZUA 3OYEA 5ILVA 2QQAA 2E36A 4GO1A 3ZR8X 5L3DA 3DBRB 4MTEA 2L0KA 3T0YA 3AKZA 2FF4A 2QSHX 3E5XA 2LRDA 2E2IJ 4AM3A 3VVYA 3MKLA 1E3HA 2DOAA 2EILH 1JI8A 1W7PB 3VOXA 2HYGD 3E6MA 1X1DA 2EINH 2RASA 3KIOA 2F4IA 3HRSA 2Y9ZA 3BR1A 2DA2A 2Y0SN 1J5YA 2PBIA 1KU2A 3BTIA 5K1YA 3ASOH 2X48A 5BPIA 1BBYA 2VN2A 1TTYA 3S1QJ 2LKSA 1QZEA 4WCGA 1K7AA 4ZH4F 3TL4X 1D1BA 3QAHA 2GZWA 1WH5A 1MBKA 2V26A 4HF2A 5HNHA 1RUOA 1U2WA 4DBQA 1LFPA 5LEJA 4FETA 4AC0A 2V1NA 2N8GA 1RETA 4XONA 1Z1DA 2I8DA 3V7CA 4ZDLA 2L7FP 4IHWA 4ZZDA 4QSHA 2EFQA 4DBRA 4RAYA 2JA6J 2ZNYA 1JT0A 1TW3A 3MFKA 4FHTA 4EM0B 1QPIA 5LGUA 5FO5A 3I5UA 3PQJA 2L02A 2EFWA 4KYWA 3GFIA 4CGRA 3VP5A 1BI0A 4HKUA 1J9IA 2W4SA 2CRGA 2UXXA 1OJLA 1IN7A 3I58A 2UUZA 1TC3C 4CZZA 1XGOA 1IGNA 4YFNF 2R7UA 4LB5A 2W7NA 4L18B 2F5EA 1YRNA 2Z16A 2ZBKA 3FMSA 3SDGA 1SFXA 1R4MB 5ICFA 4YFKF 3EYIA 3S14J 3VYUB 4U0VA 3HJEA 5J1RA 2GLOA 1G4DA 3DV8A 3KP6A 3ZQHA 4KMUX 1SVOA 3U1DA 2Z5UA 3WG9A 4BXFA 1R71A 3WGHA 5HLTA 4NUBA 5HBUA 3LQRA 1XDSA 3K4LA 4QIWN 1R00A 4AIDA 1IDZA 5B1AH 3ABLH 3IAS2 1MNEA 2HZTA 3G1LA 2VKDA 1AA7A 2LTPA 2VQHA 4B09A 3WTXC 4KITB 2W48A 1PUFB 3T6NA 2L4MA 1S9HA 2F5FA 4IHTA 1IV8A 2KDOA 3RCOA 2GXGA 5EJCA 4YZEA 3OSGA 2XIGA 3KPHA 3R60A 3GFLA 3JR9A 3MD2A 3JRBA 3EPZA 4A3EJ 3T5XA 2PN6A 5HSZA 1TP4A 1AU7A 3RD3A 2WAFA 3FXOA 2A5YB 2ESNA 2K85A 1FOXA 3FBIB 3RIRA 2BY3A 1K4TA 3PM1A 2VE9A 2HKUA 1V5EA 4L9NA 4ACIA 1ZRCA 3LSMA 3DBHB 3DPUA 1WPKA 1VQ9I 3IRQA 5DTDA 3L2QA 2L3DA 1ZRFA 1F1ZA 5KAFC 3JRHA 3I4MJ 3DTKA 1XSXA 2QF7A 3BZ6A 3H1CA 1E3PA 2X4HA 3S15J 4I0AA 2DOEA 2VBZA 1G8XA 4LG3A 5B5EC 4CCKA 2O5RA 1NG7A 3BLYA 1JE8A 2R7VA 1XCVA 1T98A 2A3SA 3E6CC 1R5HA 1V55H 4CHUA 1FYLA 2F4OB 4L5IA 1MSFC 1K78B 4HBLA 4XORA 3ZRGA 1VTNC 1SVLA 2FBQA 2EB7A 3K4NA 4HAMA 3BG3A 4LGWA 2KDZA 3CCJI 1F4KA 2HQAA 2V9VA 3JRIA 3VVXA 4A12A 1MMDA 4RB3C 2LREA 4X0GA 2M7AA 1S7AA 1Z6TA 1G59A 1WJAA 2NNYA 3E6BA 2UV1A 1QVUA 2DO7A 1XMXA 1JHHA 3MNLA 3K8PC 3BY6A 5B1BH 4PJMA 2VT3A 2MGQA 1R5ID 1XD7A 3TO7A 2DMQA 2E35A 2EZHA 2HXIA 5GPAA 5EDNA 3A03A 2XAQA 2M5WA 4ENKA 2ZC2A 1NK2P 2A6TA 3LQQA 5D5VB 1Y0NA 1R1TA 3ON4A 3FF5A 5FD6A 1YS7A 3ABUA 1Y6IA 2IPQX 1R7JA 3EDPA 2QA4I 2JZYA 1P2FA 5JVGF 1U6GA 2M2EA 2FJ1A 3BCAA 4BY7J 1I27A 5KK1A 4ZZLA 3CF5F 1QA6A 5M5WJ 1ZELA 5H6RA 3B6AA 2E1MC 2YX7A 1ZAOA 1Z3YA 3GCMA 3NI7A 1MJAA 3GFMA 2LR8A 2ZB9A 3L7WA 4B44A 4EQQA 2QQ8A 2KP6A 1XGMA 3HBLA 3NWSA 2YX4A 1TZLA 3NQOA 5L3GA 3HOTA 2LKXA 4HQMA 1A04A 2XPVA 4KN4X 2CQKA 3NAUA 4IHVA 2OPTA 2XPWA 4KA4A 1ZGAA 2NS8A 2ME6A 3LA3A 3ABMH 3HOVJ 3EETA 2P4WA 3NRGA 1KGSA 2W53A 1H9GA 3VYSB 2HR3A 2EQRA 2L7KA 2Q2EB 1U8RA 1Z6RA 1TWHJ 1DPUA 4HX7A 1RR7A 2VJIA 4DJAA 3BJBA 1YE9A 1HW1A 2K5CA 3A4CA 2XGXA 2DQRA 1XMAA 4WXCA 2NS7A 3CCQI 1JUPA 1O7LA 2HGCA 3KLOA 3WODF 3BROA 2RNJA 1YIJI 2DMTA 3PFYA 1FT9A 3S1RJ 3CMAI 5EG0A 3BRUA 4KMFA 4XLFA 1OR7C 1P6RA 2ZXHA 5IYDJ 1W0TA 3CCLI 3BR3A 2MC4A 2OCEA 3FWEA 2XAJA 1O7FA 4PDKA 3A02A 1HKSA 4XLHA 2GM4A 3VIBA 3LA7A 2XHKA 4MHGA 4OOIA 4CCJA 1K78A 2XAFA 5LRRA 3KP2A 5GAHJ 3T8RA 2GXAA 2AQFA 3NNRA 1IUFA 5FLXZ 4JKZA 3I53A 4ESBA 3OYLA 1UI5A 2EIMH 2C6YA 5FKMA 2X0LA 3H5NA 1W5CC 4OMYA 2LP0A 4U87A 3S16J 3JW4A 4CYCA 2GIVA 3H3UA 1G3YA 2B9SA 3W2WA 3EQLF 2L9SA 2P5KA 5E17F 5IT3A 1BA5A 3EUPA 4A6EA 4CA0A 3K1NA 4W1UA 1FWZA 2ZFUA 5HS7A 3ZQ7A 1HSJA 2EFOA 4FASD 2FBKA 2Q0OA 1V4RA 1WVRA 1UFMA 3ZPLA 1W5SA 3QP5A 2ZKZA 2G7SA 1MH4A 2UXNA 2MW8A 4P1WA 1U3EM 1X2MA 3J80Z 2L9NA 3BTJA 1QHHD 2JVGA 3OOUA 4CXFA 2BZTA 3ELKA 2XRNA 3E5QA 5B3SH 2JN6A 2LMDA 2ZCWA 1GDTA 3H9GA 1HC8A 2XDNA 4XSXF 3Q0VA 4BJTA 4F3QA 5H2FC 1K6OA 3OIOA 3SFZA 4GCTA 1B72A 3OYCA 4S04A 1BR2A 2ELJA 5D18A 1Q1HA 5E1WA 1S72I 2IGMA 3DEWA 5DD8A 4HNVA 2ACJA 4F52A 1O3QA 1BR4A 3ZMZA 2QQ9A 2K02A 1YTYA 3HKZA 2NVUB 1I6HJ 2VI6A 2M1BA 2AQEA 5JHUA 3HM5A 5FLXK 4WIBA 2HDCA 4JQFA 1H89C 4BHPA 3KEOA 3EUKL 2HYTA 4IZZA 2KT0A 4JBAA 2ZY9A 2ISYA 2EJRA 3VVZA 3GX4X 1VZ0A 2XUBA 4A3DJ 2P6TA 2W85A 3RKWA 2XB0X 2XGEA 3D5SC 5C4XJ 5FB2A 5FJ8J 2X85A 3F6OA 3ERED 1U9NA 3L00A 4IO9F 2RQPA 1IRGA 1RUNA 1LVAA 1TQMA 3CWRA 4OMZA 2VQCA 1OMIA 4I98B 4IOAF 2GIZA 3TO6A 2VKHA 2R5YA 1Y39A 1D0YA 3SZPA 2O6GE 4II3A 1OCTC 3Q9VA 2XB5A 3OYJA 4GYIA 2K9NA 2XF7A 1DDNA 1FEXA 4ZC3A 1N25A 2WB1A 2VXZA 3I4NJ 1LE8B 2R7XA 2R7DA 1GV2A 1IRFA 2LY1A 4G6DA 4XN3A 4CYDA 1TQPA 4HSRA 1W36D 1IDYA 1YITI 1AKHB 1ZRDA 1NH3A 1KYWA 5DM7F 1OFCX 3CCSI 4L0ZB 2MG4A 4IF4A 5GTIC 3SEZA 3C18A 2HOAA 4Y4RA 1K6YA 5C44J 1IN8A 2R7WA 2REKA 1O3TA 4BBSJ 5K7FA 5CVVA 2VKVA 3G2BA 4M9SA 5FKKA 1FIPA 5M5YJ 3KP5A 2WGBA 3PL8A 4BDYA 3S5RA 3FKJA 2DODA 4C30A 1B4AA 4M6YA 2VOPA 1JTXA 1T8IA 2NRAC 2IA1A 3HDDA 1VFCA 1CF7B 4XK4A 3WGGA 2RDPA 1GVDA 2QZ8A 2QBYB 4ON0A 3CJNA 2E1MB 2HVRA 3CJRB 5F0CA 2CG4A 4QPQA 3AG2H 4RM3A 5IP6A 5HAWA 1MMGA 1Z05A 1UI6A 3WE2A 4MIMA 2MYSA 1FMVA 5F1JA 4KNYA 4IHSA 4G8XA 3I59A 1WJEA 3BCGA 4ITVA 1YX3A 1RESA 2M9HA 2A05A 1G6NA 2QYOA 4PGHA 3PUFA 1R6RA 1KZHA 2JRTA 4HX4A 3V7SA 3ZQLA 3ZCOA 1U5TB 1LDJA 4MFEA 3JCUC 4BEHA 2IJLA 4NQWB 1T38A 2LY9A 2B3WA 4E7HA 2ZOYA 2BY2A 4PFPA 4D9JA 3N05A 3OMYA 3KZZA 3IAM2 4OIQF 4FT8A 1UZCA 4XNFA 1MGTA 3F8MA 3WTTC 4XRSG 1BC7C 3DEUA 1AHDP 3MKZA 4XIDA 5DCFA 3ZQGA 5JVTA 1MNMC 3K4CA 1WCMJ 4C2TA 2K27A 2Q24A 1WQ2A 3CF2A 2DI3A 2VC1A 2UXUA 2DA6A 2GAUA 3HB9A 2NS0A 1OCCH 1VQ8I 5FMPA 3W6VA 2Z99A 5K5QA 1T2KA 4OAYA 2FU4A 3FK6A 4PJ0C 4EM1A 3RPUD 3DF8A 2QUFA 3QKXA 2MC3A 2R7ZJ 2KIUA 3NEUA 4GCVA 4LK0F 4C9YA 1O57A 2KISA 1ULYA 3QU6A 2Q2EA 2LG4A 4XOTA 4IKFA 1KU3A 3KZ9A 3HXLA 4DYRA 4IQJA 2FUG2 3CUQC 1HW2A 5D1RA 3CO6C 2EK5A 4XBFA 3GTQJ 5J1UA 2NYXA 4J00A 4ZTFA 2W1OA 4LFUA 2HKXA 2VQGA 2HTJA 3Q9SA 3LSHA 4PJNA 3VB2A 1NG6A 2X51A 2E1OA 1HSTA 4BE0A 1IO2A 1RKTA 1UG2A 1WJDA 4KT6A 1A6IA 4IPAA 4ESJA 2STWA 4UUVA 2E19A 4LIUA 2XROA 1OCPA 3ZN1A 1D8KA 1ZLJA 1XC5A 3COAC 2IGNA 3GTMJ 1BI1A 1USTA 1P4XA 3G4SI 2DK8A 5FD5A 1HDDC 3F1BA 4ICHA 3KEQA 3GEZA 4XR6A 2HXOA 4ZYDA 2V9PA 1U5TC 1QGPA 4F7ZA 1YHQI 2IEKA 1VQMI 1HW5A 2R7SA 2UXPA 4NDLA 3GYHX 3RYRA 2KKOA 1UB9A 1FBSA 3HTUA 2BHZA 3I3LA 2DJNA 1RI7A 3K1MA 5DYMA 3HE0A 1YO5C 4NBQA 4EM2A 4M3BA 3A2KA 4NHJA 4I6ZA 2L7MP 4YELA 2JA8J 3VW2A 2H94A 4RS8A 1FNNA 4B3XA 1D5YA 1B72B 5EZHA 1Y56A 2HU9A 3BC8A 3HOWJ 5E1XA 3UR3C 4DW6A 4R79A 3LHQA 1SVMA 1SFUA 5J4VA 2X6XA 5DS9A 4G6TB 1VQPI 2X6YA 3DCFA 2B7EA 2OQRA 3ERMA 2DK5A 3P5JA 1SD7A 1LE8A 3BJ6A 3K0LA 5BNGA 1STZA 1WGXA 1YYVA 4XOPA 5FLMJ 2M8EA 3TOAA 5EGOA 1USSA 4BAYA 2PLYA 1D5VA 2PJPA 2O7TA 5FFZA 2L9VA 3CP8A 2E1CA 3J7AO 2KPMA 3B02A 4U9NA 2OC6A 3DP7A 3Q5FA 1XB4A 2EV6A 1JUMA 1S7OA 2Y69H 4B48A 3QRFF 2O8KA 3EUAA 2EWNA 3L2WA 3CUQB 5CXGA 1YLFA 1YX5A 3S3NA 3L2UA 4H0EA 2R5YB 3LL7A 3OYGA 4RDUA 5ILUA 2OV7A 1F5TA 2F48A 1NHAA 4LMYA 3ZP5A 3D5LA 3ZQCA 1GT0C 1WFXA 2E7XA 4S05A 1FTTA 1FP2A 3S2WA 4BDZA 3HIFA 1EH6A 2DBBA 2HPIA 3KZIC 2YU9J 2BVMA 3FX3A 2A2FX 4RB2C 3O3KA 1Z91A 2O03A 1MBJA 1JGGA 4D1QA 1FBUA 1AOYA 2XAHA 4GYGA 2BXZA 4LLNA 3CCYA 1YG2A 3IKTA 1OCOH 1UJ8A 1LKXA 3ZMSA 4YIRX 2OJED 2EPFA 2HOTA 4C2MA 2DTZA 2WB1N 3CP2A 5D5UB 4FCYA 4WWCA 1UHSA 3LAJA 2W57A 2R5ZB 1DP7P 1WHUA 3L2RA 1K4SA 4MNUA 1J7KA 3VW0A 1EA3A 2Q1ZB 2STTA 1ON2A 4E7SA 4BACA 2CUFA 4DOZA 5LFAA 4KWAA 2M4GA 3V8JA 3H0GJ 5M3FJ 1ETXA 2G7HA 4WXHA 5DV5A 3I54A 2KIMA 3CD6I 1BL0A 5JHFA 4BE2A 2FOKA 2QOPA 1S6LA 1X19A 1B9NA 1W36C 2ECBA 1HA8A 4ANJA 5EYRA 2YR2A 2VT2A 5A2QK 1TWGJ 4BQOA 3JSOA 1HKTA 3DLAA 2IXSA 1O3RA 2O61A 4Q4ZF 1S8NA 3K4KA 2DTRA 3E0JB 1U5TA 2HOSA 1ZKGA 3J80K 4BHBA 3VOEA 2IS4A 3WTWC 1B9MA 3HOSA 3AAFA 4A0XA 2K4BA 2MBFA 2Y30A 1MH3A 3K1PA 5E8GA 1MBGA 4BUPA 2GENA 4XMYA 2IA0A 3IH2A 3R4KA 1PJRA 1FOWA 1ZLKA 5KNLA 3HPGA 5DUIA 1RZ4A 5F1RA 3SQNA 1B59A 1BIAA 3O2PE 4XLPF 3HHHA 2JWTA 3E3VA 3TGNA 4BQQA 3NARA 3FXUA 1T33A 2ZJQF 2HTSA 2VL8A 5L3BA 4N0BA 1VQ5I 1HOMA 2QKOA 3CDHA 2PQ8A 1Q1VA 2IBDA 2PFBA 1TT0A 4G12A 2MSYA 2VBWA 3JREA 3LFUA 1FZPB 4KFCA 2YVXA 1Y8QB 5KCMA 2MH2A 1ON1A 2KRCA 5DDGA 3HTIA 4BBRJ 3FIWA 1ZGJA 1P7JA 3KYDB 2E1NA 3OR2C 3S2HJ 2F07A 3M8JA 3I56I 3T8TA 2NP3A 3J81K 1A35A 2IS6A 2RN7A 3R0JA 1EH7A 2QWTA 1VQKI 4U7DA 3FM5A 1ETOA 2D1VA 3WU1B 4PUSA 3K70C 2OCCH 1B1BA 3JRGA 2ELKA 4IXAA 3S32A 5EG0B 3OYDA 4IEJA 4UVBA 1R9TJ 1HCRA 4M3DA 1OKRA 2PMUA 1IN5A 3GTGJ 4L0YB 1XSDA 4LITA 2LD5A 2CQQA 4ETSA 3GTPJ 3PO2J 3GBGA 2HZDA 1IN4A 3ABTA 1L3LA 3PQKA 4EGZA 4E4HA 1BW5A 3KYLA 4EJWA 2GA1A 4A3GJ 2KJCA 1SD4A 3HTHA 1T08B 3VWBA 2F6CA 3MAJA 2ZJPF 3IHUA 2GBYA 1W0UA 5D6EA 4JL3A 4EJOA 2J5OA 1R49A 5D5WB 2HQRA 3HKZN 2PZ9A 1X1CA 3OYKA 2FNPA 2DLLA 1QU3A 1D1AA 2XSDC 3CMMA 3SZTA 3V4GA 3NPIA 4NELA 1R5GA 2A5WA 4AUXA 2KHMA 4YEJA 2FD5A 2PI0A 2EZKA 5GADJ 2RHAA 4QTRA 3GZ5A 4JX6A 1TBXA 2H6CA 4BL0B 3BR0A 5DCMB 5CVUA 4KT5C 3LSKA 2Y48A 3S3OA 4CO8A 3CLOA 3P9CA 2DDAA 2OBPA 1F36A 2Y75A 2A61A 5CQGA 2FBHA 3BPVA 3DEEA 1R36A 4YRVA 2A6EF 3HSRA 1X3ZB 1JHFA 2ZMEB 5FKLA 2VXDA 4L5EA 4YIIA 3V78A 2KRHA 4UVCA 4XLNF 4MXMA 1WI9A 1BJAA 2K7LA 3RQIA 3LSPA 1ZG1A 4PXIA 2JSCA 3RZDJ 2VJ4A 3W6KB 3OS0A 2FBIA 5IPAA 3H9JA 4A93J 1P92A 4IX7A 1VI0A 1Z21A 1KYZA 2DYRH 2M45A 2PG4A 4XM3A 2D2WA 3B6CA 4HF0A 1U0JA 2Z1DA 5HLGA 1MMSA 2V6CA 6PAXA 1T56A 2M0MA 4RM2A 2IA2A 1EV7A 3EUHC 3JRAA 4AC6A 4IOCF 4DYCA 4U7BA 4HG2A 2VE8A 1KONA 3IUVA 4D5FA 2QVOA 3KKDA 2JPBA 4ENMA 1YRNB 2NAZA 2DYSH 4G6QA 2MLGA 4DVYP 5D8LB 2MLKA 2FE3A 2R3SA 3AL0B 4EVIA 4FE7A 3AFHA 4XRMA 2ECCA 3CESA 1BC8C 2Z9OA 4IJAA 4H4KC 4DQ2A 4N9HA 1TNSA 2LF7A 5JLWA 1JTYA 2K3PA 2GQQA 4CSWA 5IYCJ 1WZ2A 5HODA 4UUSB 3V6GA 1R23A 2FMYA 4YFXF 2MABA 3G7RA 4UB8C 3BQZA 4DNCA 2D6YA 3VYTB 3QYFA 3LAPA 4LG0B 1O4XA 1ZR4A 2Z2SB 4XN0A 2KMUA 2VASA 3CC4I 3FDYA 3FHZA 2M3AA 1VQLI 3HOYJ 1YI2I 3BR5A 1JKRC 5F08A 3SJMA 1MBEA 1K83J 1WKMA 1FYMA 3FXRA 1YIOA 3HYIA 4L9VA 1ZG5A 2V1DA 1D8JA 2LH9A 2QWWA 3TMOA 5ICEA 1E0EA 3S8PA 5E18F 4Y3OA 2FNAA 5FRMA 1R22A 2O9LA 3ZXSA 5HLIA 3KFWX 1BJZA 2MFZA 3PJRA 2DFHA 5C4YA 3O6BB 2F2EA 4HV6A 1OCZH 4LG0A 1M1EB 5H6QA 2A07F 2ZJ2A 4MQ9F 4P5OA 4E7IA 2LFBA 3IWZA 1S5LC 3PPBA 1IW7F 1JUSA 2V6EA 1ODDA 2IU5A 1D3YA 3PNVA 5F64A 1IJWC 2CGPA 3AL0C 4BE1A 2NVXJ 1N75A 2YU3A 1IRXA 2VJ5A 3ANPA 2M30A 1QRYA 1DUXC 4GFLA 2VODA 2LKPA 3DKXA 1J09A 4ZTJA 4DZPA 4ZYGA 4RGSA 3OYMA 3JRCA 1I5ZA 3MMYB 4M71A 2COMA 1BI2A 4S0HB 2ZXIA 3MZHA 2CUZA 4M9ZA 2RKHA 3J7AY 1QO0D 4EJVA 3M4OJ 1OLTA 1PDNC 1LEAA 2NVQJ 1S29A 2XF5A 1IAWA 4OAZA 2DA1A 1TW2A 2QCOA 4U9LA 4RBOA 3LSGA 4AIJA 4EATA 1E3OC 3J7ZI 4KICA 2PMZN 1ERDA 5IOZA 1GLNA 2ZO4A 3W2VA 2XF6A 1T0FA 1KQ8A 9ANTA 4TV7A 3KP7A 4OIRF 2CJJA 2UZKA 1FSHA 3HIMA 4A3IJ 3IUOA 4NC7A 5D4RA 1ZREA 2P0WA 2JA5J 5J4YA 4B8XA 3G1MA 3TDUC 1OCRH 3GUDA 3QPHA 5JFRA 2LY2A 2QKLB 4PZJA 1YOVB 4B1RA 3QPLA 3TP0A 3L2CA 1OYIA 1F9NA 2IS2A 3LOCA 1KQ9A 1WH7A 2DT6A 3RJPA 3ON2A 3K70D 2YSRA 3RYPA 2DMUA 5BPDA 5E3OA 1UELB 2JQ7A 3HOZJ 4IL6C 2NVYJ 2KIQA 2LOOA 2ZCNA 2G7LA 1IZ1A 3N4MA 4RGXA 5TGTA 4GGGA 4NQWA 2MH9A 4NNJA 1ZARA 2X6WA 4NB5A 3PNTA 3JTGA 2DU9A 3VYRB 3BTLA 3CZ6A 3QOPA 1Y1VJ 2QEXI 3JSPA 1BI3A 1W4MA 1LB2A 3WGIA 2H6BA 4ZJZA 4GFBA 2H1KA 3CJQB 2WADA 2CUJA 4A0YA 3N97A 1DGRM 3PSFA 3CDIA 4RGUA 2VPLA 3OL4A 2VLAA 2B63J 1J75A 4A3CJ 1ENHA 2PMHA 5DEQA 3ZMTA 1XX5A 4LLGF 1QBJA 3OYAA 3BG5A 2IP2A 1D1CA 2CS3A 3CUQA 4XL9A 2HYFA 3RPUA 2FX0A 1FLIA 1FX7A 2AXTC 2ELHA 5M3MJ 3ZMUA 1P9QC 4NC6A 4A3JJ 1HF0A 2KJBA 3HGYA 4XSZF 1JKPC 1UMQA 3GTKJ 2TDXA 3JAMK 2R0QC 3BZKA 3H0DA 2XKPA 4MGRA 3OS1A 2VPRA 3RI4A 3KKCA 4PGGA 4UV8A 3P7NA 2QBYA 3B73A 3GXOA 5K7ZA 3OSFA 2Z3YA 1QZZA 3H3ZA 1FP1D 5IP9J 3WHCA 4G7HF 2WA0A 4EEFG 2A68F 3FMQA 5E3MA 4QWQA 3OS2A 4IQ4A 3Q3SA 1IG7A 2JSPA 4C3HJ 2ZCXA 2HDWA 4UDSA 3ZN0A 4N4NB 2L54A 4Z6YA 1A31A 2R7RA 4UXNA 4AF5A 2FMLA 2HEOA 4B3AA 4FQGA 5IOYA 5FROA 2X1DA 1IF1A 2G9WA 1J0RA 4U0WA 1G2HA 4Y15A 1YFHA 3DWLE 3ZMVA 4IRGA 2ESHA 3OYHA 2H27A 1W5TA 4V19K 3KP3A 3BHQA 2EFPA 2JRMA 2L9RA 4CCOA 5C3EJ 3KP4A 3ZQFA 1ORKA 4ABZA 1AWCA 3UKGA 3ABKH 2W25A 1JJ8C 1W7PA 1Z9CA 2CH0A 2XVCA 3P9TA 1LDKB 3HZJA 4EJUA 1DP3A 2KQRA 2E5NA 5CVIA 3CCVI 3H92A 4IRVA 3BWGA 2EV5A 2JT1A 3BP8A 5L3FA 5F04A 1T0FC 2HNHA 5IP7J 4NN1A 4UUTA 5DM6F 2DOFA 1IXRC 1H0MA 4D0PA 2YVHA 4HLYA 2ADUA 1B8IA 3LJLA 4BH9A 5LRSA 3BR6A 2BGCA 1Z0XA 3TKYA 5JR3A 3K6GA 1OR7A 2HS5A 2XAUA 4EJTA 3IKVA 3V7RA 3BPXA 4M3GA 2IRFG 3M1EA 3IWFA 4D5CA 1V5FA 4M73A 4HOBA 2WAQA 1FIAA 2ZMEA 1WJFA 5AONA 1XGNA 3VW1A 3GTOJ 1JGSA 5BS6A 1GXPA 3IL2A 3AG4H 3B81A 4X6AJ 1MBFA 1X1AA 1ETVA 4LD5A 4PCQA 2DA5A 3AG1H 2FOWA 1XGSA 3GTLJ 2OA4A 2F5VA 4OIPF 2M7BA 1JJ6C 2CFXA 4N4OB 4PJLA 3SDBA 2BV6A 3SFIA 2IT0A 1OPCA 4P9FA 4E6KG 3FKIJ 1PP7U 3K4BA 3L09A 3WTSC 3E7LA 2E7WA 3G6EI 1NK3P 1IC8A 1VQNI 5LGTA 2NVTJ 1SFKA 4MLOA 2FQ3A 1PYVA 1X3UA 1QPMA 2LSOA 2JA7J 5E3LA 5GPCA 5M5XJ 2DT5A 5CKTA 2DDBA 2OAZA 3CO7C 4J19A 5BMZA 2K9MA 3TP3A 5EFYA 2ZCMA 5E8IA 4CCLA 2R92J 3DBLB 3TOBA 2P7VB 2P5LC 1REPC 2JA2A 4A3BJ 4BQNA 4MQVA 2L5QA 3LSJA 2RGVA 2QM3A 1XCBA 2VJJA 1KA8A 5DCMA 4J01A 3KNWA 4E7LA 2R7QA 3FXJA 2V1UA 3WG7H 2HI3A 3F8BA 3F21A 2QGUA 2DW4A 1PVEA 3V8LA 1H8AC 1VQ6I 3OIQA 2LC2A 2COBA 4HQEA 1K61A 4KIGA 4YG2F 1R58A 4C3JJ 3VPRA 1QZYA 1ZG3A 1HLVA 1ETKA 3L2VA 1GV5A 4PSXA 3VODA 1G3TA 3FM3A 3RKXA 1LFUP 1TWAJ 5H9TA 2DFFA 2GXBA 4M3FA 4D7NA 2CSOA 5CW8A 3LFKA 1OYWA 4ZYHA 1JXSA 2LK2A 1L0OC 3D1NI 4LB6B 1OQYA 3CCRI 5F0HA 4HLXA 2XAGA 1HQCA 2WY8Q 1SGMA 1EF4A 3RKQA 2W00A 3OL3A 1RNLA 4FX0A 4AVPA 4UHTA 2BHYA 4MFDA 3WTZA 3K4JA 2VUMJ 1MIJA 3ZOBA 5HNFA 4M3EA 1A36A 1BW6A 4O5VA 3X2QH 1VF9A 2IAIA 3RDIA 4AVZA 3D0SA 4AYBA 1RRJA 1DU0A 1E2XA 3F6VA 1TWCJ 3S3MA 3P9KA 1Z7UA 4DIQA 4XLEA 2LBFA 2JJ7A 4UVAA 3OYNA 4A5MA 4PJJA 2P6SA 2CW7A 3CMEI 4CH7A 2NXNB 1BIBA 3RZOJ 2Y2ZA 1IXCA 5FHPA 3E97A 4FE4A 5F0FA 1XTAA 4M72A 1MJ9A 2PX9A 3FISA 4ZYEA 4BGDA 3NXCA 3CTAA 2KFDA 2DA3A 4I99C 1IXSB 3PIPF 1T39A 2IGKA 1EH8A 2XGDA 1I50J 2VBXA 3RQ4A 5ED4A 3GVAA 4P96A 4OD4A 1F43A 2W84A 3O60A 3C07A 3I55I 3VDXA 4XICA 1P7IA 4KDPA 1SMTA 2VB6A 3A0HC 3A01B 2CV0A 2VQLA 3GF2A 2YVEA 3GZNB 3HSFA 2CYYA 2WTEA 2R7TA 1SEUA 4AWXB 4JOMA 3I59B 2IVMA 4IRIA 2CWEA 3LSIA 1LNWA 5EEHA 3WU0A 2ZSIB 4CCNA 2UXOA 5FLVA 1WJBA 4I76A 2JVHA 4MO7A 5H20A 2I5UA 2V4JC 3ECHA 4Z2YA 5J8CA 5ICGA 1RPWA 3LWFA 4JNNA 2CO5A 1FY7A 2KLOA 4E7ZA 2B1EA 3GZIA 2OTLI 3VOKA 3F23A 5F27A 2KL4A 5K7HA 3IRRA 3C7JA 1ETWA 2AXLA 2OF7A 3WHBA 2WAEA 1X4PA 4BJ5C 4B43A 3S1MJ 1AKHA 1HDPA 3HG9A 3C1DA 2PFVA 1VQOI 2UXIA 1QHGA 2LDUA 5D5XB 3P9IA 1H9TA 3M8EA 3AQSA 3M1CA 1XDUA 4EMSA 5FFXA 4CGZA 2DMPA 4EV0A 2K40A 2QQBA 3MZ8A 3GO5A 3H36A 2Q8KA 2BOLA 5HLHA 1MDMB 3S1NJ 4HSTA 4DGWB 4BXUA 4RA2A 4IHYA 5FKOA 1LJ9A 2CV2A 3HTJA 2XKOA 3IH3A 4M74A 3U21A 3RPQA 4A5NA 2QSFX 3E7QA 2VBYA 2V9KA 1MMAA 1A6QA 3KEYA 2DQLA 3JAMZ 2ISZA 2DG7A 3CRJA 1ZN2A 2EV0A 2H1LA 3OR1C 2G0EA 2BY1A 4ZDPA 2Y9YA 3MQ0A 3BJOA 5K58A 1R1UA 3SXYA 4WXDA 4HDUA 3DU5A 3V8KA 1ACIA 2ETHA 2M34A 1MMNA 3ZQQA 2G7UA 3PASA 4DYQA 3SEQA 3CCUI 5EF6A 5DUKA 1K79A 1MZBA 3C3WA 4I01A 4NC8A 3GW2A 5DD4A 5J1YA 2R5ZA 2JTVA 2CMPA 2I10A 4AYBN 1ETYA 3C2BA 5CVJA 3G71I 1J2XA 2XV4S 3S17J 3TW7A 2ID6A 1X58A 3WE3A 3DQVC 1ONVA 1RIOH 3CJDA 2OQGA 4A3FJ 3W3CA 3BZCA 2QSGX 2M87A 5E3NA 3OOPA 5ERIA 2K9LA 4C3IJ 1QNTA 1V5GA 1YW8A 5E79C 1WJ5A 1YS6A 1T6SA 2O7OA 1Z67A 2DMNA 2Y31A 4PSWA 4U88A 5HDNA 5LLQA 3ISPA 4E70A 4EGYA 2ZFWA 2TCTA 3LSRA 2RNGA 1U8BA 4GCKA 1WRJA 2D5VA 3ONQA 5FRNA 1BR1A 3M8FA 4YIFA 2OD5A 4QPOA 2PEXA 4RAFA 2E2JJ 3G73A 1TT5B 2DCEA 1WJCA 1R4NB 1J59A 4I02A 2NX4A 1ZR2A 1HKQA 1I39A 5EEGA 3LMMA 3QPTA 3BTCA 2DT7B 1S3JA 2P5VA 3F72A 3H5AA 3HSEA 5KHDA 1TWFJ 3IP4B 4A3MJ 1B6AA 3I4PA 2ZOZA 3V42A 4OIOF 3OWTA 3HGGA 1X1BA 3MEXA 2YPRA 4BXXJ 2NP5A 1U9OA 3QOEA 4HNUA 4XLCA 1DU6A 3TDZC 5J47A 3OYBA 3MKWB 4BQAA 3CMYA 3BDDA 1YW9A 2B0LA 2DA4A 2K3FA 4AIHA 4CZCA 4Y52J 1TL8A 5HDGA 4RB0A 3ML6A 1X3WB 1HBXG 3DPLC 1P4WA 5EGOB 5TRDA 3K4MA 1Y8RB 2BY0A 2WBMA 4KN7X 1POGA 4GFKA 2JUCA 3HUGB 5F6FA 5LHGA 4RB1A 3GTJJ 3VEPA 3HL2A 2EZIA 5HS9A 3MZYA 3H9QA 3ROUA 3TBIA 4F93B 2E60A 5LEKA 1XSVA 3F8NA 3W6JB 2ZMEC 1CQTA 4L9TA 1W7PD 2Y0SA 2MA3A 3MN2A 2V7FA 4A2UA 1YJ9I 2EBIA 2EZLA 4G9YA 5BOXA 2NOGA 1UAAA 2D45A 1Z7LA 2E71A 4F55A 2QLZA 3ANGA 4MEYF 4ZDOA 3HEFA 5L3EA 1O3SA 2YUSA 2LF8A 4BY1J 3CDLA 3DLLF 2YS9A 1A5JA 2ZSHB 2ICWG 2F5CA 4A6DA 5CVRA 2EA2A 4M6XA 3DKWA 1WWXA 3L1PA 1V3FA 1BOBA 3C2GA 2KZGA 4BYYA 3LSTA 2EA4A 4AIKA 3R0AA 4BS9A 4UUSA 1NTCA 3W2AA 2BW3B 2D1HA 4OU0A 1YQAA 2HQNA 3KCCA 3QBMA 3M07A 1I6XA 4U0YA 2WY7Q 4JK1X 1QVTA 3FBNB 4XKBA 5ILSA 4HYEA 2WV0A 3BNIA 1MD0A 2VKEA 2CUEA 4IHXA 3G3ZA 1Z77A 1XPXA 4LLLA 2V57A 3RSNA 3GLLA 5CLSA 2XRLA 2JMWA 1PP8F 1MNDA 3IV5A 2K9QA 2VC0A 3SYTA 5HDKA 1IN6A 4HF1A 2F4MB 3H35A 4XRFA 5CJ9A 2XGCA 1SC7A 2VOOA 2X1CA 3NRVA 2BW3A 5E1ZB 2J5PA 3MCZA 2BBYA 5GAEJ 3CUOA 3ASNH 2JUGA 4F91B 3PUBA 3ZMDA 3ZQIA 5LD2C 3BOQA 2AHQA 3MVPA 2RC4A 4C2UA 3KETA 1SMYF 2L2OA 4OWRB 4Y17A 1FSEA 2KIFA 4UY8I 3H5RA 1LQ1A 2CW0F 4A69C 1SFOJ 2K4JA 1G3SA 3WU2C 2XDVA 5FGLA 3F9KA 5GAGJ 1I1GA 4N9IA 1Y1WJ 2PBXA 5B66C 4JYKA 2L01A 3K7AJ 4L9JA 1ETQA 2EIJH 3DU6A 2ZXJA 4CDGA 4HV5A 4G94A 3E5UA 4DZJA 4MK6A 4HA8A 1FC3A 3F8FA 2ME0A 3HRUA 4QLCU 3K10A 1QQIA 3HTAA 2ZJRF 1ZHFA 2V1XA 3GZ6A 3GFJA 2TRTA 4IVNA 4HPQA 1JKQC 3BCBA 4A3LJ 1LVKA 4R8HA 3VSKA 3VUQA 2W24A 2EFNA 2OU2A 3FK7A 5A2QZ 1RC9A 1X2NA 2VIXA 2AO9A 4LJZF 4W97A 2M8GX 2CFOA 3F8CA 1FBQA 2DPDA 3CCMI 2MD5A 4C2MJ 5KVRA 4MEXF 4XLAA 3TEDA 3U2RA 3M3YJ 2DG8A 1CGPA 2UWMA 2H8RA 3CC7I 2M0CA 4XKWA 4GRIA 4GXOA 1T95A 2KZVA 1SD5A 4LK1F 3OYFA 3EUHA 4FTHA 2GOMA 2XC7A 3QYEA 2R93J 4FX4A 4HX8A 3SHFA 3HTSB 3OY9A 2IS1A 1V54H 1KQ0A 3OV8A 3E1SA 2JK3A 2GUHA 4OINF 3F22A 3BR2A 1TLHB 1MJBA 3I0TA 2K9SA 4KIBA 4Y33A 5L3CA 1VQ4I 3SWHA 3BT9A 4RAZA 1RKWA 3CQZJ 3BJAA 1R1VA 5K5OA 3BG9A 3ULQB 3ESWB 3HRMA 1BM9A 2PJRB 2IGOA 4ENNA 1BOAA 3K69A 3QWLA 4I09A 4HZFA 2PMZA 2OI8A 5GTHC 3DKYA 2FXAA 4O3MA 3DFGA 3HHGA 4Q47A 1LFBA 5DAJA 1B8IB 5FKNA 2LLKA 3WTYC 1SAUA 2G3BA 1YJWI 4ENJA 3KYCB 2XASA 3QP6A 2WUIA 2Y0MA 2FSWA 3BG7A 1LUJB 2BXYA 3A1YA 1I1SA 3PFIA 2DFIA 4RAGA 5LHHA 3AQTA 3TO9A 4BEHB 4AD9A 1UCRA 4BNCA 4G7OF 3DTIA 2HWVA 2GFNA 3G56A 1I3QJ 1ZTRA 4HDVA 1JKOC 4JX5A 5C4JJ 1MDMA 4Q5SF 2BE5F 2HVSA 2BEOA 4ASNA 4RLQA 2GWRA 3RH2A 2CW8A 2HPMA 4L62A 1LPQA 3IH4A 4RLFA 3HRTA 3QODA 2Z33A 4BJ6C 1XMKA 1MSEC 4WK8F 3LA2A 2LVSA 2E2HJ 2R4GA 3SZGA 5KAIC 5AIPA 5TJJA 2RQQA 2LNBA 2CU7A 4Q48A 2RV8A 1WSUA 1KU9A 2MD0A 3TQNA 2EH3A 2V79A 4GDFA 3DXJF 1HXDA 2NNNA 3L9FA 4FISA 2E5ZA 5JI6A 1EKEA 4HW0A 5LGNA 1FOKA 2P7CB 3LNQA 1GXQA 4RMNA 5J3LA 4M6VA 3QQAA 4E7KA 1G3WA 4XQFA 1N77A 1GHCA 1XN7A 3J7YJ 3R61A 3FMRA 4Y13A 3CC2I 1ZK8A 2X1EA 1C0WA 4HEA2 1ZGWA 3K2ZA 2OERA 4P9UA 4V2FA 5GP9A 1W1WE 1DGWY 2XPUA 3BG6A 4PFOA 3FRQA 5CXIA 1UHWA 2LBFB 5LBQA 3DPJA 2GOXB 2QTQA 3M7GA 3KLNA 5D4SA 1Z3XA 2A6HF 1ITYA 4XKCA 3IC7A 2HQ5A 2HVQA 3FXMA 3TW6A 2K86A 2OTJI 2P8TA 2OUMA 2DJIA 2A69F 1OYYA 3KX2A 1MKMA 3JRFA 3HOUJ 1LEBA 3Q0UA 2DXIA 4G7ZF 2VONA 2R7OA 3ZGKA 1FYKA 3PNYA 3A01A 1UHMA 5D19A 5J8FA 1U78A 1P4AA 2DFEA 3U1KA 4CYCB 2ZNZA 2PJRA 4I0BA 2E34A 5D6FA 2RVCA 2F5DA 5BQTA 1ZYRF 5HOOA 1IRZA 5EEAA 3J81Z 5AQCA 3CJTB 1X1PA 2EIKH 1ZQ3P 1IV6A 5IY5H 1FOYA 2DN0A 1GUUA 4KIFA 3GMEA 3OIPA 3VTIA 1D0ZA 1MBHA 2XSJC 3FXKA 1TQIA 4M9XA 1EJ9A 3UNGC 1KU7A 3I9V2 4D7MA 4BKXA 4ESFA 2P81A 4GCLA 1FJLA 1UG0A 2O3FA 4ME9A 2RREA 3QU3A 3REOA 2DPUA 1CF7A 3K2AA 2BVLA 5K5RA 3O8GA 1SFEA 3BQYA 2FRHA 3C2HA 4XKVA 5J6XA 2JPCA 4B4CA 4KISA 3NS4A 3MWMA 3VSLA 3CLQA 1RR8C 2G7GA 1FMWA 2CQXA 3G1OA 4PK4A 3RKYA 1SD6A 3M9AA 3Q0WA 4O6JA 5HS8A 1SANA 5CYVA 3H3VK 3I64A 5FGMA 1BN5A 3S2DJ 3FXQA 3HPHA 2RAEA 4F92B 4HNTA 3OYIA 2FJI1 2CQNA 3FXLA 3S93A 2HOEA 4CCMA 4A3KJ 1I3AA 2O0YA 2WWYA 4B47A 2DA7A 4MTDA 4WX9A 3JRDA 4UV9A 4IRHA 2CQ7A
chains in the Genus database with same CATH topology
2R5YA 4FE7A 4XRMA 2ECCA 3GEUA 3CRJA 2DG7A 1FTZA 1OCTC 2G0EA 2XB5A 1XS9A 3JSJA 5JLWA 2Y9YA 1JTYA 2K9NA 5K58A 1FEXA 2WAQN 2M34A 5IYCJ 5HODA 4UUSB 3I4NJ 3V6GA 4V2GA 4DYQA 3PASA 1LE8B 1VNDA 1GV2A 3G7RA 1S7EA 2ID3A 1XG1A 5EF6A 3BQZA 2D6YA 1IDYA 1AKHB 3COLA 1O4XA 1ZR4A 2X6OA 5J1YA 1OFCX 2R5ZA 1JT6A 2MG4A 2I10A 5JLXA 4AYBN 1ETYA 3C2BA 1APLC 3HOYJ 2FQ4A 3BR5A 3TW7A 1JKRC 2HOAA 2ID6A 5F08A 4JP0A 5C44J 1X58A 3SJMA 4XRSA 2REKA 1MBEA 1K83J 3QPSA 5K7FA 4BBSJ 3CJDA 3EGQA 5FKKA 2VKVA 3F0CA 5M5YJ 1FIPA 4A3FJ 2WGBA 1WI3A 3S5RA 4Y7NJ 5E3NA 1JTXA 4C3IJ 3HDDA 1VFCA 2UXHA 2L7ZA 4XK4A 2O9LA 3PO3J 5EZGA 1GVDA 2O7OA 1BJZA 2DMNA 2Y31A 5C4YA 2TCTA 3LSRA 4LOCA 5F0CA 1U8BA 3HOXJ 4GCKA 5IP6A 2D5VA 2X9DA 5HAWA 1H88C 2LFBA 2E2JJ 1UI6A 2QIBA 4MIMA 2WV1A 5F1JA 3PPBA 1JUSA 2NX4A 2IU5A 1ZR2A 1IJWC 3BCGA 1RESA 2M9HA 3S15J 2NVXJ 3LWJA 3ZQLA 3ANPA 3BTCA 3S17J 1QRYA 4GFLA 4MFEA 2ZOZA 4A3MJ 1TWFJ 4DZPA 2LY9A 3JRCA 3HGGA 4BXXJ 2ZOYA 2NP5A 1U9OA 2HDDA 4S0HB 1DU6A 3O8HA 1PUFA 3CMYA 2DA4A 3M4OJ 4Y52J 2NVQJ 4XRSG 2DA1A 4X1EA 5IYBJ 2QCOA 1AHDP 4JX4A 4XIDA 4RBOA 2HYJA 5EGOB 3LSGA 3ZQGA 1E3OC 1MNMC 2PMZN 1WCMJ 5IOZA 1POGA 2Q24A 4GFKA 3GTJJ 9ANTA 2UXUA 2DA6A 2L0KA 2CJJA 3VVYA 2EZIA 3HB9A 2E2IJ 4A3IJ 3HIMA 3MKLA 5FMPA 3VOXA 2JA5J 3W6VA 2RASA 3G1MA 2Y9ZA 3BR1A 1CQTA 2Y0SN 2DA2A 3FK6A 3BTIA 4B1RA 3QPLA 3TP0A 3MN2A 3QKXA 2X48A 3LOCA 2R7ZJ 2EBIA 1WH7A 2EZLA 3S1QJ 2NOGA 3ON2A 2DMUA 5E3OA 3KZ9A 1WH5A 1MBKA 4DYRA 3ANGA 3HOZJ 2NVYJ 5D1RA 2ZCNA 4AC0A 3GTQJ 3HEFA 5J1UA 2G7LA 2YUSA 2N8GA 1RETA 3CDLA 4BY1J 2YS9A 1A5JA 2L7FP 4IHWA 4QSHA 3L1PA 2JA6J 2E1OA 3BTLA 1RKTA 1UG2A 1Y1VJ 1JT0A 1A6IA 1QPIA 2E19A 4UUSA 4GFBA 1NTCA 2H1KA 1OCPA 3QBMA 4CGRA 3VP5A 1XC5A 3GTMJ 4HKUA 2CRGA 4A3CJ 1HDDC 2B63J 3F1BA 4ICHA 1QVTA 1ENHA 1OJLA 2HXOA 3BNIA 3BG5A 1TC3C 2VKEA 4IHXA 2CUEA 1Z77A 2FX0A 2IEKA 1IGNA 2V57A 2UXPA 2XRLA 4NDLA 5M3MJ 2JMWA 1YRNA 3SDGA 4A3JJ 3IV5A 1HF0A 3HGYA 2K9QA 1JKPC 1UMQA 3GTKJ 3HE0A 2DJNA 2R0QC 3S14J 5J1RA 2GLOA 3ZQHA 4M3BA 2XGCA 2VPRA 4I6ZA 3KKCA 2L7MP 2JA8J 3VW2A 5HBUA 5K7ZA 3OSFA 1D5YA 1B72B 5EZHA 5IP9J 3WHCA 4EEFG 3HOWJ 3ZQIA 4QIWN 5E3MA 4DW6A 1IG7A 1IDZA 3LHQA 3Q3SA 2AHQA 3MVPA 4C3HJ 3G1LA 2ZCXA 5DS9A 2LTPA 4UDSA 3DCFA 2W48A 4A69C 4AF5A 1SFOJ 1PUFB 3T6NA 1LE8A 4B3AA 5IOYA 5BNGA 1WGXA 5FLMJ 5FGLA 4YZEA 3OSGA 5EGOA 1G2HA 1Y1WJ 2PBXA 3JR9A 4JYKA 3JRBA 2O7TA 4A3EJ 3K7AJ 5HSZA 3BHQA 1AU7A 1ETQA 3RD3A 2L9RA 5C3EJ 3ZQFA 1ORKA 4ABZA 4DZJA 3UKGA 3PM1A 1JJ8C 2HKUA 4MK6A 1JUMA 2ME0A 2O8KA 4ACIA 5CXGA 3HTAA 3P9TA 1WPKA 5DTDA 2TRTA 2R5YB 1JKQC 4A3LJ 4RDUA 3JRHA 3I4MJ 2QF7A 3VUQA 3ZQCA 5F04A 1GT0C 3FK7A 1FTTA 2AO9A 1X2NA 4W97A 2M8GX 5IP7J 4UUTA 2YU9J 4NN1A 2YVHA 4C2MJ 1B8IA 1MBJA 3LJLA 1JGGA 3TEDA 3M3YJ 2DG8A 3BR6A 1Z0XA 2H8RA 1MSFC 2M0CA 2FBQA 3CCYA 3BG3A 2KDZA 4M3GA 2HOTA 4FTHA 2DTZA 2WB1N 4D5CA 2R93J 4FCYA 1UHSA 1FIAA 2R5ZB 3JRIA 3VVXA 3VW0A 3VW1A 3GTOJ 3B81A 4X6AJ 1MBFA 2JK3A 1ETVA 2GUHA 3BR2A 2DA5A 2K9SA 1QVUA 3MNLA 3BT9A 1RKWA 2CUFA 3CQZJ 3GTLJ 2MGQA 4KWAA 1JJ6C 2DMQA 3BG9A 3SFIA 2EZHA 3H0GJ 5M3FJ 2HXIA 5GPAA 5EDNA 1ETXA 3FKIJ 3A03A 3E7LA 1NK3P 1BL0A 1NK2P 1IC8A 3ON4A 2QOPA 2NVTJ 4MLOA 2ECBA 2OI8A 5EYRA 2JA7J 5E3LA 5GPCA 5M5XJ 1LFBA 1TWGJ 2M2EA 2FJ1A 4BY7J 5FKNA 1B8IB 5DAJA 2LLKA 2HOSA 5M5WJ 4J19A 3TP3A 1ZKGA 2G3BA 5EFYA 2ZCMA 3B6AA 2R92J 2WUIA 3NI7A 2Y30A 2LR8A 1MH3A 2ZB9A 4A3BJ 1MBGA 2GENA 3IH2A 3LSJA 3HBLA 3AQTA 3KNWA 2LKXA 2HI3A 2JWTA 3NARA 2XPVA 1H8AC 3NAUA 2GFNA 4IHVA 3G56A 1T33A 1I3QJ 2COBA 1K61A 1ZTRA 2OPTA 2XPWA 4C3JJ 1JKOC 2NS8A 4JX5A 2ME6A 3VPRA 5C4JJ 3HOVJ 1HOMA 2QKOA 1HLVA 1ETKA 3NRGA 1Q1VA 2IBDA 1GV5A 2W53A 3RH2A 4L62A 4G12A 2MSYA 3IH4A 2EQRA 1TWAJ 3JREA 1LFUP 5H9TA 1MSEC 2LVSA 2E2HJ 1TWHJ 4M3FA 3HTIA 4D7NA 4BBRJ 5CW8A 1RR7A 3FIWA 1P7JA 2LK2A 3BJBA 3D1NI 3S2HJ 2F07A 5F0HA 2CU7A 2NP3A 2NS7A 1SGMA 1EF4A 3RKQA 2QWTA 1JUPA 2EH3A 1ETOA 2DMTA 3S1RJ 4FISA 4MFDA 5EG0A 3JRGA 2ELKA 5EG0B 3BRUA 4IEJA 2VUMJ 3ZOBA 5IYDJ 3LNQA 4M3EA 1W0TA 5J3LA 1R9TJ 3BR3A 4M6VA 3QQAA 1BW6A 4M3DA 1HCRA 1VF9A 2IAIA 3GTGJ 2LD5A 2CQQA 1ZK8A 1DU0A 3GTPJ 3A02A 3PO2J 2GM4A 3GBGA 3VIBA 1ZGWA 2OERA 1TWCJ 1BW5A 4V2FA 5GP9A 3FRQA 2XPUA 4A3GJ 5CXIA 3NNRA 1IUFA 2JJ7A 3HTHA 3DPJA 2QTQA 1W0UA 4JKZA 4JL3A 2GBYA 1UI5A 1ITYA 3HKZN 5FKMA 2PZ9A 2HQ5A 2LP0A 3TW6A 3S16J 3RZOJ 2Y2ZA 4CYCA 3JRFA 2XSDC 3HOUJ 5FHPA 4FE4A 5F0FA 3Q0UA 3NPIA 4NELA 3FISA 4AUXA 3NXCA 2FD5A 2DA3A 1BA5A 3A01A 2EZKA 3EUPA 5D19A 1U78A 4QTRA 2RHAA 4JX6A 2XGDA 1I50J 4W1UA 3BR0A 4CYCB 1F43A 3O60A 3C07A 4XICA 1P7IA 2G7SA 1MH4A 1IRZA 2MW8A 5EEAA 3A01B 5AQCA 1X2MA 1F36A 3BTJA 1ZQ3P 1IV6A 2YVEA 3OOUA 2DN0A 2JN6A 1GUUA 5FKLA 1GDTA 2XDNA 3Q0VA 4L5EA 2UXOA 1MBHA 3V78A 3OIOA 5FLVA 4I76A 4MO7A 4MXMA 4GCTA 1B72A 4D7MA 3RQIA 3LSPA 5D18A 4PXIA 1RPWA 3DEWA 4BKXA 4JNNA 3RZDJ 2P81A 4HNVA 4GCLA 5IPAA 1FJLA 4A93J 3GZIA 4ME9A 1I6HJ 3VOKA 2VI6A 1VI0A 5F27A 5K7HA 3K2AA 1ETWA 3O8GA 3BQYA 3HM5A 2OF7A 3B6CA 3WHBA 1H89C 1T56A 3S1MJ 4B4CA 1AKHA 1HDPA 2HYTA 2KT0A 2G7GA 3AQSA 3JRAA 2UXIA 4AC6A 2CQXA 3G1OA 3VVZA 4DYCA 3Q0WA 4A3DJ 1SANA 2DMPA 3H3VK 2K40A 2XB0X 2XGEA 5C4XJ 3S2DJ 3IUVA 5FJ8J 4D5FA 2RAEA 3KKDA 3S1NJ 1YRNB 1U9NA 4A3KJ 4IHYA 5FKOA 3CWRA 3HTJA 3IH3A 2DA7A 3JRDA 3E7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Y A;  4FE7 A;  4XRM A;  2ECC A;  3GEU A;  3CRJ A;  2DG7 A;  1FTZ A;  1OCT C;  2G0E A;  2XB5 A;  1XS9 A;  3JSJ A;  5JLW A;  2Y9Y A;  1JTY A;  2K9N A;  5K58 A;  1FEX A;  2WAQ N;  2M34 A;  5IYC J;  5HOD A;  4UUS B;  3I4N J;  3V6G A;  4V2G A;  4DYQ A;  3PAS A;  1LE8 B;  1VND A;  1GV2 A;  3G7R A;  1S7E A;  2ID3 A;  1XG1 A;  5EF6 A;  3BQZ A;  2D6Y A;  1IDY A;  1AKH B;  3COL A;  1O4X A;  1ZR4 A;  2X6O A;  5J1Y A;  1OFC X;  2R5Z A;  1JT6 A;  2MG4 A;  2I10 A;  5JLX A;  4AYB N;  1ETY A;  3C2B A;  1APL C;  3HOY J;  2FQ4 A;  3BR5 A;  3TW7 A;  1JKR C;  2HOA A;  2ID6 A;  5F08 A;  4JP0 A;  5C44 J;  1X58 A;  3SJM A;  4XRS A;  2REK A;  1MBE A;  1K83 J;  3QPS A;  5K7F A;  4BBS J;  3CJD A;  3EGQ A;  5FKK A;  2VKV A;  3F0C A;  5M5Y J;  1FIP A;  4A3F J;  2WGB A;  1WI3 A;  3S5R A;  4Y7N J;  5E3N A;  1JTX A;  4C3I J;  3HDD A;  1VFC A;  2UXH A;  2L7Z A;  4XK4 A;  2O9L A;  3PO3 J;  5EZG A;  1GVD A;  2O7O A;  1BJZ A;  2DMN A;  2Y31 A;  5C4Y A;  2TCT A;  3LSR A;  4LOC A;  5F0C A;  1U8B A;  3HOX J;  4GCK A;  5IP6 A;  2D5V A;  2X9D A;  5HAW A;  1H88 C;  2LFB A;  2E2J J;  1UI6 A;  2QIB A;  4MIM A;  2WV1 A;  5F1J A;  3PPB A;  1JUS A;  2NX4 A;  2IU5 A;  1ZR2 A;  1IJW C;  3BCG A;  1RES A;  2M9H A;  3S15 J;  2NVX J;  3LWJ A;  3ZQL A;  3ANP A;  3BTC A;  3S17 J;  1QRY A;  4GFL A;  4MFE A;  2ZOZ A;  4A3M J;  1TWF J;  4DZP A;  2LY9 A;  3JRC A;  3HGG A;  4BXX J;  2ZOY A;  2NP5 A;  1U9O A;  2HDD A;  4S0H B;  1DU6 A;  3O8H A;  1PUF A;  3CMY A;  2DA4 A;  3M4O J;  4Y52 J;  2NVQ J;  4XRS G;  2DA1 A;  4X1E A;  5IYB J;  2QCO A;  1AHD P;  4JX4 A;  4XID A;  4RBO A;  2HYJ A;  5EGO B;  3LSG A;  3ZQG A;  1E3O C;  1MNM C;  2PMZ N;  1WCM J;  5IOZ A;  1POG A;  2Q24 A;  4GFK A;  3GTJ J;  9ANT A;  2UXU A;  2DA6 A;  2L0K A;  2CJJ A;  3VVY A;  2EZI A;  3HB9 A;  2E2I J;  4A3I J;  3HIM A;  3MKL A;  5FMP A;  3VOX A;  2JA5 J;  3W6V A;  2RAS A;  3G1M A;  2Y9Z A;  3BR1 A;  1CQT A;  2Y0S N;  2DA2 A;  3FK6 A;  3BTI A;  4B1R A;  3QPL A;  3TP0 A;  3MN2 A;  3QKX A;  2X48 A;  3LOC A;  2R7Z J;  2EBI A;  1WH7 A;  2EZL A;  3S1Q J;  2NOG A;  3ON2 A;  2DMU A;  5E3O A;  3KZ9 A;  1WH5 A;  1MBK A;  4DYR A;  3ANG A;  3HOZ J;  2NVY J;  5D1R A;  2ZCN A;  4AC0 A;  3GTQ J;  3HEF A;  5J1U A;  2G7L A;  2YUS A;  2N8G A;  1RET A;  3CDL A;  4BY1 J;  2YS9 A;  1A5J A;  2L7F P;  4IHW A;  4QSH A;  3L1P A;  2JA6 J;  2E1O A;  3BTL A;  1RKT A;  1UG2 A;  1Y1V J;  1JT0 A;  1A6I A;  1QPI A;  2E19 A;  4UUS A;  4GFB A;  1NTC A;  2H1K A;  1OCP A;  3QBM A;  4CGR A;  3VP5 A;  1XC5 A;  3GTM J;  4HKU A;  2CRG A;  4A3C J;  1HDD C;  2B63 J;  3F1B A;  4ICH A;  1QVT A;  1ENH A;  1OJL A;  2HXO A;  3BNI A;  3BG5 A;  1TC3 C;  2VKE A;  4IHX A;  2CUE A;  1Z77 A;  2FX0 A;  2IEK A;  1IGN A;  2V57 A;  2UXP A;  2XRL A;  4NDL A;  5M3M J;  2JMW A;  1YRN A;  3SDG A;  4A3J J;  3IV5 A;  1HF0 A;  3HGY A;  2K9Q A;  1JKP C;  1UMQ A;  3GTK J;  3HE0 A;  2DJN A;  2R0Q C;  3S14 J;  5J1R A;  2GLO A;  3ZQH A;  4M3B A;  2XGC A;  2VPR A;  4I6Z A;  3KKC A;  2L7M P;  2JA8 J;  3VW2 A;  5HBU A;  5K7Z A;  3OSF A;  1D5Y A;  1B72 B;  5EZH A;  5IP9 J;  3WHC A;  4EEF G;  3HOW J;  3ZQI A;  4QIW N;  5E3M A;  4DW6 A;  1IG7 A;  1IDZ A;  3LHQ A;  3Q3S A;  2AHQ A;  3MVP A;  4C3H J;  3G1L A;  2ZCX A;  5DS9 A;  2LTP A;  4UDS A;  3DCF A;  2W48 A;  4A69 C;  4AF5 A;  1SFO J;  1PUF B;  3T6N A;  1LE8 A;  4B3A A;  5IOY A;  5BNG A;  1WGX A;  5FLM J;  5FGL A;  4YZE A;  3OSG A;  5EGO A;  1G2H A;  1Y1W J;  2PBX A;  3JR9 A;  4JYK A;  3JRB A;  2O7T A;  4A3E J;  3K7A J;  5HSZ A;  3BHQ A;  1AU7 A;  1ETQ A;  3RD3 A;  2L9R A;  5C3E J;  3ZQF A;  1ORK A;  4ABZ A;  4DZJ A;  3UKG A;  3PM1 A;  1JJ8 C;  2HKU A;  4MK6 A;  1JUM A;  2ME0 A;  2O8K A;  4ACI A;  5CXG A;  3HTA A;  3P9T A;  1WPK A;  5DTD A;  2TRT A;  2R5Y B;  1JKQ C;  4A3L J;  4RDU A;  3JRH A;  3I4M J;  2QF7 A;  3VUQ A;  3ZQC A;  5F04 A;  1GT0 C;  3FK7 A;  1FTT A;  2AO9 A;  1X2N A;  4W97 A;  2M8G X;  5IP7 J;  4UUT A;  2YU9 J;  4NN1 A;  2YVH A;  4C2M J;  1B8I A;  1MBJ A;  3LJL A;  1JGG A;  3TED A;  3M3Y J;  2DG8 A;  3BR6 A;  1Z0X A;  2H8R A;  1MSF C;  2M0C A;  2FBQ A;  3CCY A;  3BG3 A;  2KDZ A;  4M3G A;  2HOT A;  4FTH A;  2DTZ A;  2WB1 N;  4D5C A;  2R93 J;  4FCY A;  1UHS A;  1FIA A;  2R5Z B;  3JRI A;  3VVX A;  3VW0 A;  3VW1 A;  3GTO J;  3B81 A;  4X6A J;  1MBF A;  2JK3 A;  1ETV A;  2GUH A;  3BR2 A;  2DA5 A;  2K9S A;  1QVU A;  3MNL A;  3BT9 A;  1RKW A;  2CUF A;  3CQZ J;  3GTL J;  2MGQ A;  4KWA A;  1JJ6 C;  2DMQ A;  3BG9 A;  3SFI A;  2EZH A;  3H0G J;  5M3F J;  2HXI A;  5GPA A;  5EDN A;  1ETX A;  3FKI J;  3A03 A;  3E7L A;  1NK3 P;  1BL0 A;  1NK2 P;  1IC8 A;  3ON4 A;  2QOP A;  2NVT J;  4MLO A;  2ECB A;  2OI8 A;  5EYR A;  2JA7 J;  5E3L A;  5GPC A;  5M5X J;  1LFB A;  1TWG J;  2M2E A;  2FJ1 A;  4BY7 J;  5FKN A;  1B8I B;  5DAJ A;  2LLK A;  2HOS A;  5M5W J;  4J19 A;  3TP3 A;  1ZKG A;  2G3B A;  5EFY A;  2ZCM A;  3B6A A;  2R92 J;  2WUI A;  3NI7 A;  2Y30 A;  2LR8 A;  1MH3 A;  2ZB9 A;  4A3B J;  1MBG A;  2GEN A;  3IH2 A;  3LSJ A;  3HBL A;  3AQT A;  3KNW A;  2LKX A;  2HI3 A;  2JWT A;  3NAR A;  2XPV A;  1H8A C;  3NAU A;  2GFN A;  4IHV A;  3G56 A;  1T33 A;  1I3Q J;  2COB A;  1K61 A;  1ZTR A;  2OPT A;  2XPW A;  4C3J J;  1JKO C;  2NS8 A;  4JX5 A;  2ME6 A;  3VPR A;  5C4J J;  3HOV J;  1HOM A;  2QKO A;  1HLV A;  1ETK A;  3NRG A;  1Q1V A;  2IBD A;  1GV5 A;  2W53 A;  3RH2 A;  4L62 A;  4G12 A;  2MSY A;  3IH4 A;  2EQR A;  1TWA J;  3JRE A;  1LFU P;  5H9T A;  1MSE C;  2LVS A;  2E2H J;  1TWH J;  4M3F A;  3HTI A;  4D7N A;  4BBR J;  5CW8 A;  1RR7 A;  3FIW A;  1P7J A;  2LK2 A;  3BJB A;  3D1N I;  3S2H J;  2F07 A;  5F0H A;  2CU7 A;  2NP3 A;  2NS7 A;  1SGM A;  1EF4 A;  3RKQ A;  2QWT A;  1JUP A;  2EH3 A;  1ETO A;  2DMT A;  3S1R J;  4FIS A;  4MFD A;  5EG0 A;  3JRG A;  2ELK A;  5EG0 B;  3BRU A;  4IEJ A;  2VUM J;  3ZOB A;  5IYD J;  3LNQ A;  4M3E A;  1W0T A;  5J3L A;  1R9T J;  3BR3 A;  4M6V A;  3QQA A;  1BW6 A;  4M3D A;  1HCR A;  1VF9 A;  2IAI A;  3GTG J;  2LD5 A;  2CQQ A;  1ZK8 A;  1DU0 A;  3GTP J;  3A02 A;  3PO2 J;  2GM4 A;  3GBG A;  3VIB A;  1ZGW A;  2OER A;  1TWC J;  1BW5 A;  4V2F A;  5GP9 A;  3FRQ A;  2XPU A;  4A3G J;  5CXI A;  3NNR A;  1IUF A;  2JJ7 A;  3HTH A;  3DPJ A;  2QTQ A;  1W0U A;  4JKZ A;  4JL3 A;  2GBY A;  1UI5 A;  1ITY A;  3HKZ N;  5FKM A;  2PZ9 A;  2HQ5 A;  2LP0 A;  3TW6 A;  3S16 J;  3RZO J;  2Y2Z A;  4CYC A;  3JRF A;  2XSD C;  3HOU J;  5FHP A;  4FE4 A;  5F0F A;  3Q0U A;  3NPI A;  4NEL A;  3FIS A;  4AUX A;  3NXC A;  2FD5 A;  2DA3 A;  1BA5 A;  3A01 A;  2EZK A;  3EUP A;  5D19 A;  1U78 A;  4QTR A;  2RHA A;  4JX6 A;  2XGD A;  1I50 J;  4W1U A;  3BR0 A;  4CYC B;  1F43 A;  3O60 A;  3C07 A;  4XIC A;  1P7I A;  2G7S A;  1MH4 A;  1IRZ A;  2MW8 A;  5EEA A;  3A01 B;  5AQC A;  1X2M A;  1F36 A;  3BTJ A;  1ZQ3 P;  1IV6 A;  2YVE A;  3OOU A;  2DN0 A;  2JN6 A;  1GUU A;  5FKL A;  1GDT A;  2XDN A;  3Q0V A;  4L5E A;  2UXO A;  1MBH A;  3V78 A;  3OIO A;  5FLV A;  4I76 A;  4MO7 A;  4MXM A;  4GCT A;  1B72 A;  4D7M A;  3RQI A;  3LSP A;  5D18 A;  4PXI A;  1RPW A;  3DEW A;  4BKX A;  4JNN A;  3RZD J;  2P81 A;  4HNV A;  4GCL A;  5IPA A;  1FJL A;  4A93 J;  3GZI A;  4ME9 A;  1I6H J;  3VOK A;  2VI6 A;  1VI0 A;  5F27 A;  5K7H A;  3K2A A;  1ETW A;  3O8G A;  3BQY A;  3HM5 A;  2OF7 A;  3B6C A;  3WHB A;  1H89 C;  1T56 A;  3S1M J;  4B4C A;  1AKH A;  1HDP A;  2HYT A;  2KT0 A;  2G7G A;  3AQS A;  3JRA A;  2UXI A;  4AC6 A;  2CQX A;  3G1O A;  3VVZ A;  4DYC A;  3Q0W A;  4A3D J;  1SAN A;  2DMP A;  3H3V K;  2K40 A;  2XB0 X;  2XGE A;  5C4X J;  3S2D J;  3IUV A;  5FJ8 J;  4D5F A;  2RAE A;  3KKD A;  3S1N J;  1YRN B;  1U9N A;  4A3K J;  4IHY A;  5FKO A;  3CWR A;  3HTJ A;  3IH3 A;  2DA7 A;  3JRD A;  3E7Q A; 
#chains in the Genus database with same CATH topology
 3E6D A;  3GEU A;  5CPR B;  3WTV C;  1FTZ A;  2OZ6 A;  2LYC A;  3DTE A;  5CQE A;  1XS9 A;  3MKY B;  3JSJ A;  4ZYA A;  4K2E A;  2HFH A;  1N78 A;  2WAQ N;  3T1B A;  1LDD A;  3WTU C;  4V2G A;  5TIS C;  2FEZ A;  1VND A;  2KRF A;  3CCE I;  1S7E A;  2ID3 A;  1XG1 A;  2ZXW H;  5HVQ C;  1FPQ A;  2CV1 A;  1PUE E;  3PSI A;  3COL A;  4II2 A;  2X6O A;  1JT6 A;  3KE2 A;  4P55 A;  5JLX A;  3FHN A;  3I71 A;  2M4K A;  1APL C;  5IT9 Z;  2FQ4 A;  4L5J A;  3KZY A;  3RTR A;  4JP0 A;  2GA2 A;  3D5R C;  3ECO A;  4XRS A;  3QPS A;  4RGR A;  1OIS A;  5J40 A;  3EGQ A;  5D8K B;  3F0C A;  1SAX A;  3JTH A;  4BHC A;  1WI3 A;  4Y7N J;  2HKO A;  2W82 A;  3NWT A;  4OD5 A;  1Y0U A;  3HUG A;  4KJZ A;  2UXH A;  2L7Z A;  3PO3 J;  5EZG A;  3FZV A;  3R6S A;  1VQ7 I;  2BYV E;  2WC2 A;  3VFZ A;  2FA5 A;  2QEN A;  2QKM B;  4A0Z A;  1DPR A;  4CIC A;  4KUM A;  1IUY A;  3HC7 A;  4LOC A;  2O8X A;  3HOX J;  3F3X A;  5LHI A;  2R7F A;  2X9D A;  1TNT A;  1H88 C;  2AS5 F;  1E17 A;  2QIB A;  2WV1 A;  4UB6 C;  1ZH5 A;  2DAO A;  3DPT A;  5E20 A;  2H8W A;  2H09 A;  4HRI A;  3EYY A;  3LWJ A;  1D0X A;  1GVJ A;  5ICC A;  3PIO F;  4R1H A;  3AG3 H;  3A0B C;  5AIQ A;  4AU7 A;  3GLX A;  4LIV A;  3U9G A;  4E7J A;  2HDD A;  1DQU A;  4I2O A;  3O8H A;  4CUG A;  2L4A A;  3GWZ A;  1X4O A;  1PUF A;  5IT9 K;  1YW7 A;  1MW7 A;  2IW5 A;  4X1E A;  2NOJ B;  3K9T A;  5IYB J;  4JX4 A;  4UNO A;  2HYJ A;  3QYB A;  4WF2 A;  4I7H A;  4BU2 A;  1YJN I;  2OZU A;  3OYE A;  5ILV A;  2QQA A;  2E36 A;  4GO1 A;  3ZR8 X;  5L3D A;  3DBR B;  4MTE A;  2L0K A;  3T0Y A;  3AKZ A;  2FF4 A;  2QSH X;  3E5X A;  2LRD A;  2E2I J;  4AM3 A;  3VVY A;  3MKL A;  1E3H A;  2DOA A;  2EIL H;  1JI8 A;  1W7P B;  3VOX A;  2HYG D;  3E6M A;  1X1D A;  2EIN H;  2RAS A;  3KIO A;  2F4I A;  3HRS A;  2Y9Z A;  3BR1 A;  2DA2 A;  2Y0S N;  1J5Y A;  2PBI A;  1KU2 A;  3BTI A;  5K1Y A;  3ASO H;  2X48 A;  5BPI A;  1BBY A;  2VN2 A;  1TTY A;  3S1Q J;  2LKS A;  1QZE A;  4WCG A;  1K7A A;  4ZH4 F;  3TL4 X;  1D1B A;  3QAH A;  2GZW A;  1WH5 A;  1MBK A;  2V26 A;  4HF2 A;  5HNH A;  1RUO A;  1U2W A;  4DBQ A;  1LFP A;  5LEJ A;  4FET A;  4AC0 A;  2V1N A;  2N8G A;  1RET A;  4XON A;  1Z1D A;  2I8D A;  3V7C A;  4ZDL A;  2L7F P;  4IHW A;  4ZZD A;  4QSH A;  2EFQ A;  4DBR A;  4RAY A;  2JA6 J;  2ZNY A;  1JT0 A;  1TW3 A;  3MFK A;  4FHT A;  4EM0 B;  1QPI A;  5LGU A;  5FO5 A;  3I5U A;  3PQJ A;  2L02 A;  2EFW A;  4KYW A;  3GFI A;  4CGR A;  3VP5 A;  1BI0 A;  4HKU A;  1J9I A;  2W4S A;  2CRG A;  2UXX A;  1OJL A;  1IN7 A;  3I58 A;  2UUZ A;  1TC3 C;  4CZZ A;  1XGO A;  1IGN A;  4YFN F;  2R7U A;  4LB5 A;  2W7N A;  4L18 B;  2F5E A;  1YRN A;  2Z16 A;  2ZBK A;  3FMS A;  3SDG A;  1SFX A;  1R4M B;  5ICF A;  4YFK F;  3EYI A;  3S14 J;  3VYU B;  4U0V A;  3HJE A;  5J1R A;  2GLO A;  1G4D A;  3DV8 A;  3KP6 A;  3ZQH A;  4KMU X;  1SVO A;  3U1D A;  2Z5U A;  3WG9 A;  4BXF A;  1R71 A;  3WGH A;  5HLT A;  4NUB A;  5HBU A;  3LQR A;  1XDS A;  3K4L A;  4QIW N;  1R00 A;  4AID A;  1IDZ A;  5B1A H;  3ABL H;  3IAS 2;  1MNE A;  2HZT A;  3G1L A;  2VKD A;  1AA7 A;  2LTP A;  2VQH A;  4B09 A;  3WTX C;  4KIT B;  2W48 A;  1PUF B;  3T6N A;  2L4M A;  1S9H A;  2F5F A;  4IHT A;  1IV8 A;  2KDO A;  3RCO A;  2GXG A;  5EJC A;  4YZE A;  3OSG A;  2XIG A;  3KPH A;  3R60 A;  3GFL A;  3JR9 A;  3MD2 A;  3JRB A;  3EPZ A;  4A3E J;  3T5X A;  2PN6 A;  5HSZ A;  1TP4 A;  1AU7 A;  3RD3 A;  2WAF A;  3FXO A;  2A5Y B;  2ESN A;  2K85 A;  1FOX A;  3FBI B;  3RIR A;  2BY3 A;  1K4T A;  3PM1 A;  2VE9 A;  2HKU A;  1V5E A;  4L9N A;  4ACI A;  1ZRC A;  3LSM A;  3DBH B;  3DPU A;  1WPK A;  1VQ9 I;  3IRQ A;  5DTD A;  3L2Q A;  2L3D A;  1ZRF A;  1F1Z A;  5KAF C;  3JRH A;  3I4M J;  3DTK A;  1XSX A;  2QF7 A;  3BZ6 A;  3H1C A;  1E3P A;  2X4H A;  3S15 J;  4I0A A;  2DOE A;  2VBZ A;  1G8X A;  4LG3 A;  5B5E C;  4CCK A;  2O5R A;  1NG7 A;  3BLY A;  1JE8 A;  2R7V A;  1XCV A;  1T98 A;  2A3S A;  3E6C C;  1R5H A;  1V55 H;  4CHU A;  1FYL A;  2F4O B;  4L5I A;  1MSF C;  1K78 B;  4HBL A;  4XOR A;  3ZRG A;  1VTN C;  1SVL A;  2FBQ A;  2EB7 A;  3K4N A;  4HAM A;  3BG3 A;  4LGW A;  2KDZ A;  3CCJ I;  1F4K A;  2HQA A;  2V9V A;  3JRI A;  3VVX A;  4A12 A;  1MMD A;  4RB3 C;  2LRE A;  4X0G A;  2M7A A;  1S7A A;  1Z6T A;  1G59 A;  1WJA A;  2NNY A;  3E6B A;  2UV1 A;  1QVU A;  2DO7 A;  1XMX A;  1JHH A;  3MNL A;  3K8P C;  3BY6 A;  5B1B H;  4PJM A;  2VT3 A;  2MGQ A;  1R5I D;  1XD7 A;  3TO7 A;  2DMQ A;  2E35 A;  2EZH A;  2HXI A;  5GPA A;  5EDN A;  3A03 A;  2XAQ A;  2M5W A;  4ENK A;  2ZC2 A;  1NK2 P;  2A6T A;  3LQQ A;  5D5V B;  1Y0N A;  1R1T A;  3ON4 A;  3FF5 A;  5FD6 A;  1YS7 A;  3ABU A;  1Y6I A;  2IPQ X;  1R7J A;  3EDP A;  2QA4 I;  2JZY A;  1P2F A;  5JVG F;  1U6G A;  2M2E A;  2FJ1 A;  3BCA A;  4BY7 J;  1I27 A;  5KK1 A;  4ZZL A;  3CF5 F;  1QA6 A;  5M5W J;  1ZEL A;  5H6R A;  3B6A A;  2E1M C;  2YX7 A;  1ZAO A;  1Z3Y A;  3GCM A;  3NI7 A;  1MJA A;  3GFM A;  2LR8 A;  2ZB9 A;  3L7W A;  4B44 A;  4EQQ A;  2QQ8 A;  2KP6 A;  1XGM A;  3HBL A;  3NWS A;  2YX4 A;  1TZL A;  3NQO A;  5L3G A;  3HOT A;  2LKX A;  4HQM A;  1A04 A;  2XPV A;  4KN4 X;  2CQK A;  3NAU A;  4IHV A;  2OPT A;  2XPW A;  4KA4 A;  1ZGA A;  2NS8 A;  2ME6 A;  3LA3 A;  3ABM H;  3HOV J;  3EET A;  2P4W A;  3NRG A;  1KGS A;  2W53 A;  1H9G A;  3VYS B;  2HR3 A;  2EQR A;  2L7K A;  2Q2E B;  1U8R A;  1Z6R A;  1TWH J;  1DPU A;  4HX7 A;  1RR7 A;  2VJI A;  4DJA A;  3BJB A;  1YE9 A;  1HW1 A;  2K5C A;  3A4C A;  2XGX A;  2DQR A;  1XMA A;  4WXC A;  2NS7 A;  3CCQ I;  1JUP A;  1O7L A;  2HGC A;  3KLO A;  3WOD F;  3BRO A;  2RNJ A;  1YIJ I;  2DMT A;  3PFY A;  1FT9 A;  3S1R J;  3CMA I;  5EG0 A;  3BRU A;  4KMF A;  4XLF A;  1OR7 C;  1P6R A;  2ZXH A;  5IYD J;  1W0T A;  3CCL I;  3BR3 A;  2MC4 A;  2OCE A;  3FWE A;  2XAJ A;  1O7F A;  4PDK A;  3A02 A;  1HKS A;  4XLH A;  2GM4 A;  3VIB A;  3LA7 A;  2XHK A;  4MHG A;  4OOI A;  4CCJ A;  1K78 A;  2XAF A;  5LRR A;  3KP2 A;  5GAH J;  3T8R A;  2GXA A;  2AQF A;  3NNR A;  1IUF A;  5FLX Z;  4JKZ A;  3I53 A;  4ESB A;  3OYL A;  1UI5 A;  2EIM H;  2C6Y A;  5FKM A;  2X0L A;  3H5N A;  1W5C C;  4OMY A;  2LP0 A;  4U87 A;  3S16 J;  3JW4 A;  4CYC A;  2GIV A;  3H3U A;  1G3Y A;  2B9S A;  3W2W A;  3EQL F;  2L9S A;  2P5K A;  5E17 F;  5IT3 A;  1BA5 A;  3EUP A;  4A6E A;  4CA0 A;  3K1N A;  4W1U A;  1FWZ A;  2ZFU A;  5HS7 A;  3ZQ7 A;  1HSJ A;  2EFO A;  4FAS D;  2FBK A;  2Q0O A;  1V4R A;  1WVR A;  1UFM A;  3ZPL A;  1W5S A;  3QP5 A;  2ZKZ A;  2G7S A;  1MH4 A;  2UXN A;  2MW8 A;  4P1W A;  1U3E M;  1X2M A;  3J80 Z;  2L9N A;  3BTJ A;  1QHH D;  2JVG A;  3OOU A;  4CXF A;  2BZT A;  3ELK A;  2XRN A;  3E5Q A;  5B3S H;  2JN6 A;  2LMD A;  2ZCW A;  1GDT A;  3H9G A;  1HC8 A;  2XDN A;  4XSX F;  3Q0V A;  4BJT A;  4F3Q A;  5H2F C;  1K6O A;  3OIO A;  3SFZ A;  4GCT A;  1B72 A;  3OYC A;  4S04 A;  1BR2 A;  2ELJ A;  5D18 A;  1Q1H A;  5E1W A;  1S72 I;  2IGM A;  3DEW A;  5DD8 A;  4HNV A;  2ACJ A;  4F52 A;  1O3Q A;  1BR4 A;  3ZMZ A;  2QQ9 A;  2K02 A;  1YTY A;  3HKZ A;  2NVU B;  1I6H J;  2VI6 A;  2M1B A;  2AQE A;  5JHU A;  3HM5 A;  5FLX K;  4WIB A;  2HDC A;  4JQF A;  1H89 C;  4BHP A;  3KEO A;  3EUK L;  2HYT A;  4IZZ A;  2KT0 A;  4JBA A;  2ZY9 A;  2ISY A;  2EJR A;  3VVZ A;  3GX4 X;  1VZ0 A;  2XUB A;  4A3D J;  2P6T A;  2W85 A;  3RKW A;  2XB0 X;  2XGE A;  3D5S C;  5C4X J;  5FB2 A;  5FJ8 J;  2X85 A;  3F6O A;  3ERE D;  1U9N A;  3L00 A;  4IO9 F;  2RQP A;  1IRG A;  1RUN A;  1LVA A;  1TQM A;  3CWR A;  4OMZ A;  2VQC A;  1OMI A;  4I98 B;  4IOA F;  2GIZ A;  3TO6 A;  2VKH A;  2R5Y A;  1Y39 A;  1D0Y A;  3SZP A;  2O6G E;  4II3 A;  1OCT C;  3Q9V A;  2XB5 A;  3OYJ A;  4GYI A;  2K9N A;  2XF7 A;  1DDN A;  1FEX A;  4ZC3 A;  1N25 A;  2WB1 A;  2VXZ A;  3I4N J;  1LE8 B;  2R7X A;  2R7D A;  1GV2 A;  1IRF A;  2LY1 A;  4G6D A;  4XN3 A;  4CYD A;  1TQP A;  4HSR A;  1W36 D;  1IDY A;  1YIT I;  1AKH B;  1ZRD A;  1NH3 A;  1KYW A;  5DM7 F;  1OFC X;  3CCS I;  4L0Z B;  2MG4 A;  4IF4 A;  5GTI C;  3SEZ A;  3C18 A;  2HOA A;  4Y4R A;  1K6Y A;  5C44 J;  1IN8 A;  2R7W A;  2REK A;  1O3T A;  4BBS J;  5K7F A;  5CVV A;  2VKV A;  3G2B A;  4M9S A;  5FKK A;  1FIP A;  5M5Y J;  3KP5 A;  2WGB A;  3PL8 A;  4BDY A;  3S5R A;  3FKJ A;  2DOD A;  4C30 A;  1B4A A;  4M6Y A;  2VOP A;  1JTX A;  1T8I A;  2NRA C;  2IA1 A;  3HDD A;  1VFC A;  1CF7 B;  4XK4 A;  3WGG A;  2RDP A;  1GVD A;  2QZ8 A;  2QBY B;  4ON0 A;  3CJN A;  2E1M B;  2HVR A;  3CJR B;  5F0C A;  2CG4 A;  4QPQ A;  3AG2 H;  4RM3 A;  5IP6 A;  5HAW A;  1MMG A;  1Z05 A;  1UI6 A;  3WE2 A;  4MIM A;  2MYS A;  1FMV A;  5F1J A;  4KNY A;  4IHS A;  4G8X A;  3I59 A;  1WJE A;  3BCG A;  4ITV A;  1YX3 A;  1RES A;  2M9H A;  2A05 A;  1G6N A;  2QYO A;  4PGH A;  3PUF A;  1R6R A;  1KZH A;  2JRT A;  4HX4 A;  3V7S A;  3ZQL A;  3ZCO A;  1U5T B;  1LDJ A;  4MFE A;  3JCU C;  4BEH A;  2IJL A;  4NQW B;  1T38 A;  2LY9 A;  2B3W A;  4E7H A;  2ZOY A;  2BY2 A;  4PFP A;  4D9J A;  3N05 A;  3OMY A;  3KZZ A;  3IAM 2;  4OIQ F;  4FT8 A;  1UZC A;  4XNF A;  1MGT A;  3F8M A;  3WTT C;  4XRS G;  1BC7 C;  3DEU A;  1AHD P;  3MKZ A;  4XID A;  5DCF A;  3ZQG A;  5JVT A;  1MNM C;  3K4C A;  1WCM J;  4C2T A;  2K27 A;  2Q24 A;  1WQ2 A;  3CF2 A;  2DI3 A;  2VC1 A;  2UXU A;  2DA6 A;  2GAU A;  3HB9 A;  2NS0 A;  1OCC H;  1VQ8 I;  5FMP A;  3W6V A;  2Z99 A;  5K5Q A;  1T2K A;  4OAY A;  2FU4 A;  3FK6 A;  4PJ0 C;  4EM1 A;  3RPU D;  3DF8 A;  2QUF A;  3QKX A;  2MC3 A;  2R7Z J;  2KIU A;  3NEU A;  4GCV A;  4LK0 F;  4C9Y A;  1O57 A;  2KIS A;  1ULY A;  3QU6 A;  2Q2E A;  2LG4 A;  4XOT A;  4IKF A;  1KU3 A;  3KZ9 A;  3HXL A;  4DYR A;  4IQJ A;  2FUG 2;  3CUQ C;  1HW2 A;  5D1R A;  3CO6 C;  2EK5 A;  4XBF A;  3GTQ J;  5J1U A;  2NYX A;  4J00 A;  4ZTF A;  2W1O A;  4LFU A;  2HKX A;  2VQG A;  2HTJ A;  3Q9S A;  3LSH A;  4PJN A;  3VB2 A;  1NG6 A;  2X51 A;  2E1O A;  1HST A;  4BE0 A;  1IO2 A;  1RKT A;  1UG2 A;  1WJD A;  4KT6 A;  1A6I A;  4IPA A;  4ESJ A;  2STW A;  4UUV A;  2E19 A;  4LIU A;  2XRO A;  1OCP A;  3ZN1 A;  1D8K A;  1ZLJ A;  1XC5 A;  3COA C;  2IGN A;  3GTM J;  1BI1 A;  1UST A;  1P4X A;  3G4S I;  2DK8 A;  5FD5 A;  1HDD C;  3F1B A;  4ICH A;  3KEQ A;  3GEZ A;  4XR6 A;  2HXO A;  4ZYD A;  2V9P A;  1U5T C;  1QGP A;  4F7Z A;  1YHQ I;  2IEK A;  1VQM I;  1HW5 A;  2R7S A;  2UXP A;  4NDL A;  3GYH X;  3RYR A;  2KKO A;  1UB9 A;  1FBS A;  3HTU A;  2BHZ A;  3I3L A;  2DJN A;  1RI7 A;  3K1M A;  5DYM A;  3HE0 A;  1YO5 C;  4NBQ A;  4EM2 A;  4M3B A;  3A2K A;  4NHJ A;  4I6Z A;  2L7M P;  4YEL A;  2JA8 J;  3VW2 A;  2H94 A;  4RS8 A;  1FNN A;  4B3X A;  1D5Y A;  1B72 B;  5EZH A;  1Y56 A;  2HU9 A;  3BC8 A;  3HOW J;  5E1X A;  3UR3 C;  4DW6 A;  4R79 A;  3LHQ A;  1SVM A;  1SFU A;  5J4V A;  2X6X A;  5DS9 A;  4G6T B;  1VQP I;  2X6Y A;  3DCF A;  2B7E A;  2OQR A;  3ERM A;  2DK5 A;  3P5J A;  1SD7 A;  1LE8 A;  3BJ6 A;  3K0L A;  5BNG A;  1STZ A;  1WGX A;  1YYV A;  4XOP A;  5FLM J;  2M8E A;  3TOA A;  5EGO A;  1USS A;  4BAY A;  2PLY A;  1D5V A;  2PJP A;  2O7T A;  5FFZ A;  2L9V A;  3CP8 A;  2E1C A;  3J7A O;  2KPM A;  3B02 A;  4U9N A;  2OC6 A;  3DP7 A;  3Q5F A;  1XB4 A;  2EV6 A;  1JUM A;  1S7O A;  2Y69 H;  4B48 A;  3QRF F;  2O8K A;  3EUA A;  2EWN A;  3L2W A;  3CUQ B;  5CXG A;  1YLF A;  1YX5 A;  3S3N A;  3L2U A;  4H0E A;  2R5Y B;  3LL7 A;  3OYG A;  4RDU A;  5ILU A;  2OV7 A;  1F5T A;  2F48 A;  1NHA A;  4LMY A;  3ZP5 A;  3D5L A;  3ZQC A;  1GT0 C;  1WFX A;  2E7X A;  4S05 A;  1FTT A;  1FP2 A;  3S2W A;  4BDZ A;  3HIF A;  1EH6 A;  2DBB A;  2HPI A;  3KZI C;  2YU9 J;  2BVM A;  3FX3 A;  2A2F X;  4RB2 C;  3O3K A;  1Z91 A;  2O03 A;  1MBJ A;  1JGG A;  4D1Q A;  1FBU A;  1AOY A;  2XAH A;  4GYG A;  2BXZ A;  4LLN A;  3CCY A;  1YG2 A;  3IKT A;  1OCO H;  1UJ8 A;  1LKX A;  3ZMS A;  4YIR X;  2OJE D;  2EPF A;  2HOT A;  4C2M A;  2DTZ A;  2WB1 N;  3CP2 A;  5D5U B;  4FCY A;  4WWC A;  1UHS A;  3LAJ A;  2W57 A;  2R5Z B;  1DP7 P;  1WHU A;  3L2R A;  1K4S A;  4MNU A;  1J7K A;  3VW0 A;  1EA3 A;  2Q1Z B;  2STT A;  1ON2 A;  4E7S A;  4BAC A;  2CUF A;  4DOZ A;  5LFA A;  4KWA A;  2M4G A;  3V8J A;  3H0G J;  5M3F J;  1ETX A;  2G7H A;  4WXH A;  5DV5 A;  3I54 A;  2KIM A;  3CD6 I;  1BL0 A;  5JHF A;  4BE2 A;  2FOK A;  2QOP A;  1S6L A;  1X19 A;  1B9N A;  1W36 C;  2ECB A;  1HA8 A;  4ANJ A;  5EYR A;  2YR2 A;  2VT2 A;  5A2Q K;  1TWG J;  4BQO A;  3JSO A;  1HKT A;  3DLA A;  2IXS A;  1O3R A;  2O61 A;  4Q4Z F;  1S8N A;  3K4K A;  2DTR A;  3E0J B;  1U5T A;  2HOS A;  1ZKG A;  3J80 K;  4BHB A;  3VOE A;  2IS4 A;  3WTW C;  1B9M A;  3HOS A;  3AAF A;  4A0X A;  2K4B A;  2MBF A;  2Y30 A;  1MH3 A;  3K1P A;  5E8G A;  1MBG A;  4BUP A;  2GEN A;  4XMY A;  2IA0 A;  3IH2 A;  3R4K A;  1PJR A;  1FOW A;  1ZLK A;  5KNL A;  3HPG A;  5DUI A;  1RZ4 A;  5F1R A;  3SQN A;  1B59 A;  1BIA A;  3O2P E;  4XLP F;  3HHH A;  2JWT A;  3E3V A;  3TGN A;  4BQQ A;  3NAR A;  3FXU A;  1T33 A;  2ZJQ F;  2HTS A;  2VL8 A;  5L3B A;  4N0B A;  1VQ5 I;  1HOM A;  2QKO A;  3CDH A;  2PQ8 A;  1Q1V A;  2IBD A;  2PFB A;  1TT0 A;  4G12 A;  2MSY A;  2VBW A;  3JRE A;  3LFU A;  1FZP B;  4KFC A;  2YVX A;  1Y8Q B;  5KCM A;  2MH2 A;  1ON1 A;  2KRC A;  5DDG A;  3HTI A;  4BBR J;  3FIW A;  1ZGJ A;  1P7J A;  3KYD B;  2E1N A;  3OR2 C;  3S2H J;  2F07 A;  3M8J A;  3I56 I;  3T8T A;  2NP3 A;  3J81 K;  1A35 A;  2IS6 A;  2RN7 A;  3R0J A;  1EH7 A;  2QWT A;  1VQK I;  4U7D A;  3FM5 A;  1ETO A;  2D1V A;  3WU1 B;  4PUS A;  3K70 C;  2OCC H;  1B1B A;  3JRG A;  2ELK A;  4IXA A;  3S32 A;  5EG0 B;  3OYD A;  4IEJ A;  4UVB A;  1R9T J;  1HCR A;  4M3D A;  1OKR A;  2PMU A;  1IN5 A;  3GTG J;  4L0Y B;  1XSD A;  4LIT A;  2LD5 A;  2CQQ A;  4ETS A;  3GTP J;  3PO2 J;  3GBG A;  2HZD A;  1IN4 A;  3ABT A;  1L3L A;  3PQK A;  4EGZ A;  4E4H A;  1BW5 A;  3KYL A;  4EJW A;  2GA1 A;  4A3G J;  2KJC A;  1SD4 A;  3HTH A;  1T08 B;  3VWB A;  2F6C A;  3MAJ A;  2ZJP F;  3IHU A;  2GBY A;  1W0U A;  5D6E A;  4JL3 A;  4EJO A;  2J5O A;  1R49 A;  5D5W B;  2HQR A;  3HKZ N;  2PZ9 A;  1X1C A;  3OYK A;  2FNP A;  2DLL A;  1QU3 A;  1D1A A;  2XSD C;  3CMM A;  3SZT A;  3V4G A;  3NPI A;  4NEL A;  1R5G A;  2A5W A;  4AUX A;  2KHM A;  4YEJ A;  2FD5 A;  2PI0 A;  2EZK A;  5GAD J;  2RHA A;  4QTR A;  3GZ5 A;  4JX6 A;  1TBX A;  2H6C A;  4BL0 B;  3BR0 A;  5DCM B;  5CVU A;  4KT5 C;  3LSK A;  2Y48 A;  3S3O A;  4CO8 A;  3CLO A;  3P9C A;  2DDA A;  2OBP A;  1F36 A;  2Y75 A;  2A61 A;  5CQG A;  2FBH A;  3BPV A;  3DEE A;  1R36 A;  4YRV A;  2A6E F;  3HSR A;  1X3Z B;  1JHF A;  2ZME B;  5FKL A;  2VXD A;  4L5E A;  4YII A;  3V78 A;  2KRH A;  4UVC A;  4XLN F;  4MXM A;  1WI9 A;  1BJA A;  2K7L A;  3RQI A;  3LSP A;  1ZG1 A;  4PXI A;  2JSC A;  3RZD J;  2VJ4 A;  3W6K B;  3OS0 A;  2FBI A;  5IPA A;  3H9J A;  4A93 J;  1P92 A;  4IX7 A;  1VI0 A;  1Z21 A;  1KYZ A;  2DYR H;  2M45 A;  2PG4 A;  4XM3 A;  2D2W A;  3B6C A;  4HF0 A;  1U0J A;  2Z1D A;  5HLG A;  1MMS A;  2V6C A;  6PAX A;  1T56 A;  2M0M A;  4RM2 A;  2IA2 A;  1EV7 A;  3EUH C;  3JRA A;  4AC6 A;  4IOC F;  4DYC A;  4U7B A;  4HG2 A;  2VE8 A;  1KON A;  3IUV A;  4D5F A;  2QVO A;  3KKD A;  2JPB A;  4ENM A;  1YRN B;  2NAZ A;  2DYS H;  4G6Q A;  2MLG A;  4DVY P;  5D8L B;  2MLK A;  2FE3 A;  2R3S A;  3AL0 B;  4EVI A;  4FE7 A;  3AFH A;  4XRM A;  2ECC A;  3CES A;  1BC8 C;  2Z9O A;  4IJA A;  4H4K C;  4DQ2 A;  4N9H A;  1TNS A;  2LF7 A;  5JLW A;  1JTY A;  2K3P A;  2GQQ A;  4CSW A;  5IYC J;  1WZ2 A;  5HOD A;  4UUS B;  3V6G A;  1R23 A;  2FMY A;  4YFX F;  2MAB A;  3G7R A;  4UB8 C;  3BQZ A;  4DNC A;  2D6Y A;  3VYT B;  3QYF A;  3LAP A;  4LG0 B;  1O4X A;  1ZR4 A;  2Z2S B;  4XN0 A;  2KMU A;  2VAS A;  3CC4 I;  3FDY A;  3FHZ A;  2M3A A;  1VQL I;  3HOY J;  1YI2 I;  3BR5 A;  1JKR C;  5F08 A;  3SJM A;  1MBE A;  1K83 J;  1WKM A;  1FYM A;  3FXR A;  1YIO A;  3HYI A;  4L9V A;  1ZG5 A;  2V1D A;  1D8J A;  2LH9 A;  2QWW A;  3TMO A;  5ICE A;  1E0E A;  3S8P A;  5E18 F;  4Y3O A;  2FNA A;  5FRM A;  1R22 A;  2O9L A;  3ZXS A;  5HLI A;  3KFW X;  1BJZ A;  2MFZ A;  3PJR A;  2DFH A;  5C4Y A;  3O6B B;  2F2E A;  4HV6 A;  1OCZ H;  4LG0 A;  1M1E B;  5H6Q A;  2A07 F;  2ZJ2 A;  4MQ9 F;  4P5O A;  4E7I A;  2LFB A;  3IWZ A;  1S5L C;  3PPB A;  1IW7 F;  1JUS A;  2V6E A;  1ODD A;  2IU5 A;  1D3Y A;  3PNV A;  5F64 A;  1IJW C;  2CGP A;  3AL0 C;  4BE1 A;  2NVX J;  1N75 A;  2YU3 A;  1IRX A;  2VJ5 A;  3ANP A;  2M30 A;  1QRY A;  1DUX C;  4GFL A;  2VOD A;  2LKP A;  3DKX A;  1J09 A;  4ZTJ A;  4DZP A;  4ZYG A;  4RGS A;  3OYM A;  3JRC A;  1I5Z A;  3MMY B;  4M71 A;  2COM A;  1BI2 A;  4S0H B;  2ZXI A;  3MZH A;  2CUZ A;  4M9Z A;  2RKH A;  3J7A Y;  1QO0 D;  4EJV A;  3M4O J;  1OLT A;  1PDN C;  1LEA A;  2NVQ J;  1S29 A;  2XF5 A;  1IAW A;  4OAZ A;  2DA1 A;  1TW2 A;  2QCO A;  4U9L A;  4RBO A;  3LSG A;  4AIJ A;  4EAT A;  1E3O C;  3J7Z I;  4KIC A;  2PMZ N;  1ERD A;  5IOZ A;  1GLN A;  2ZO4 A;  3W2V A;  2XF6 A;  1T0F A;  1KQ8 A;  9ANT A;  4TV7 A;  3KP7 A;  4OIR F;  2CJJ A;  2UZK A;  1FSH A;  3HIM A;  4A3I J;  3IUO A;  4NC7 A;  5D4R A;  1ZRE A;  2P0W A;  2JA5 J;  5J4Y A;  4B8X A;  3G1M A;  3TDU C;  1OCR H;  3GUD A;  3QPH A;  5JFR A;  2LY2 A;  2QKL B;  4PZJ A;  1YOV B;  4B1R A;  3QPL A;  3TP0 A;  3L2C A;  1OYI A;  1F9N A;  2IS2 A;  3LOC A;  1KQ9 A;  1WH7 A;  2DT6 A;  3RJP A;  3ON2 A;  3K70 D;  2YSR A;  3RYP A;  2DMU A;  5BPD A;  5E3O A;  1UEL B;  2JQ7 A;  3HOZ J;  4IL6 C;  2NVY J;  2KIQ A;  2LOO A;  2ZCN A;  2G7L A;  1IZ1 A;  3N4M A;  4RGX A;  5TGT A;  4GGG A;  4NQW A;  2MH9 A;  4NNJ A;  1ZAR A;  2X6W A;  4NB5 A;  3PNT A;  3JTG A;  2DU9 A;  3VYR B;  3BTL A;  3CZ6 A;  3QOP A;  1Y1V J;  2QEX I;  3JSP A;  1BI3 A;  1W4M A;  1LB2 A;  3WGI A;  2H6B A;  4ZJZ A;  4GFB A;  2H1K A;  3CJQ B;  2WAD A;  2CUJ A;  4A0Y A;  3N97 A;  1DGR M;  3PSF A;  3CDI A;  4RGU A;  2VPL A;  3OL4 A;  2VLA A;  2B63 J;  1J75 A;  4A3C J;  1ENH A;  2PMH A;  5DEQ A;  3ZMT A;  1XX5 A;  4LLG F;  1QBJ A;  3OYA A;  3BG5 A;  2IP2 A;  1D1C A;  2CS3 A;  3CUQ A;  4XL9 A;  2HYF A;  3RPU A;  2FX0 A;  1FLI A;  1FX7 A;  2AXT C;  2ELH A;  5M3M J;  3ZMU A;  1P9Q C;  4NC6 A;  4A3J J;  1HF0 A;  2KJB A;  3HGY A;  4XSZ F;  1JKP C;  1UMQ A;  3GTK J;  2TDX A;  3JAM K;  2R0Q C;  3BZK A;  3H0D A;  2XKP A;  4MGR A;  3OS1 A;  2VPR A;  3RI4 A;  3KKC A;  4PGG A;  4UV8 A;  3P7N A;  2QBY A;  3B73 A;  3GXO A;  5K7Z A;  3OSF A;  2Z3Y A;  1QZZ A;  3H3Z A;  1FP1 D;  5IP9 J;  3WHC A;  4G7H F;  2WA0 A;  4EEF G;  2A68 F;  3FMQ A;  5E3M A;  4QWQ A;  3OS2 A;  4IQ4 A;  3Q3S A;  1IG7 A;  2JSP A;  4C3H J;  2ZCX A;  2HDW A;  4UDS A;  3ZN0 A;  4N4N B;  2L54 A;  4Z6Y A;  1A31 A;  2R7R A;  4UXN A;  4AF5 A;  2FML A;  2HEO A;  4B3A A;  4FQG A;  5IOY A;  5FRO A;  2X1D A;  1IF1 A;  2G9W A;  1J0R A;  4U0W A;  1G2H A;  4Y15 A;  1YFH A;  3DWL E;  3ZMV A;  4IRG A;  2ESH A;  3OYH A;  2H27 A;  1W5T A;  4V19 K;  3KP3 A;  3BHQ A;  2EFP A;  2JRM A;  2L9R A;  4CCO A;  5C3E J;  3KP4 A;  3ZQF A;  1ORK A;  4ABZ A;  1AWC A;  3UKG A;  3ABK H;  2W25 A;  1JJ8 C;  1W7P A;  1Z9C A;  2CH0 A;  2XVC A;  3P9T A;  1LDK B;  3HZJ A;  4EJU A;  1DP3 A;  2KQR A;  2E5N A;  5CVI A;  3CCV I;  3H92 A;  4IRV A;  3BWG A;  2EV5 A;  2JT1 A;  3BP8 A;  5L3F A;  5F04 A;  1T0F C;  2HNH A;  5IP7 J;  4NN1 A;  4UUT A;  5DM6 F;  2DOF A;  1IXR C;  1H0M A;  4D0P A;  2YVH A;  4HLY A;  2ADU A;  1B8I A;  3LJL A;  4BH9 A;  5LRS A;  3BR6 A;  2BGC A;  1Z0X A;  3TKY A;  5JR3 A;  3K6G A;  1OR7 A;  2HS5 A;  2XAU A;  4EJT A;  3IKV A;  3V7R A;  3BPX A;  4M3G A;  2IRF G;  3M1E A;  3IWF A;  4D5C A;  1V5F A;  4M73 A;  4HOB A;  2WAQ A;  1FIA A;  2ZME A;  1WJF A;  5AON A;  1XGN A;  3VW1 A;  3GTO J;  1JGS A;  5BS6 A;  1GXP A;  3IL2 A;  3AG4 H;  3B81 A;  4X6A J;  1MBF A;  1X1A A;  1ETV A;  4LD5 A;  4PCQ A;  2DA5 A;  3AG1 H;  2FOW A;  1XGS A;  3GTL J;  2OA4 A;  2F5V A;  4OIP F;  2M7B A;  1JJ6 C;  2CFX A;  4N4O B;  4PJL A;  3SDB A;  2BV6 A;  3SFI A;  2IT0 A;  1OPC A;  4P9F A;  4E6K G;  3FKI J;  1PP7 U;  3K4B A;  3L09 A;  3WTS C;  3E7L A;  2E7W A;  3G6E I;  1NK3 P;  1IC8 A;  1VQN I;  5LGT A;  2NVT J;  1SFK A;  4MLO A;  2FQ3 A;  1PYV A;  1X3U A;  1QPM A;  2LSO A;  2JA7 J;  5E3L A;  5GPC A;  5M5X J;  2DT5 A;  5CKT A;  2DDB A;  2OAZ A;  3CO7 C;  4J19 A;  5BMZ A;  2K9M A;  3TP3 A;  5EFY A;  2ZCM A;  5E8I A;  4CCL A;  2R92 J;  3DBL B;  3TOB A;  2P7V B;  2P5L C;  1REP C;  2JA2 A;  4A3B J;  4BQN A;  4MQV A;  2L5Q A;  3LSJ A;  2RGV A;  2QM3 A;  1XCB A;  2VJJ A;  1KA8 A;  5DCM A;  4J01 A;  3KNW A;  4E7L A;  2R7Q A;  3FXJ A;  2V1U A;  3WG7 H;  2HI3 A;  3F8B A;  3F21 A;  2QGU A;  2DW4 A;  1PVE A;  3V8L A;  1H8A C;  1VQ6 I;  3OIQ A;  2LC2 A;  2COB A;  4HQE A;  1K61 A;  4KIG A;  4YG2 F;  1R58 A;  4C3J J;  3VPR A;  1QZY A;  1ZG3 A;  1HLV A;  1ETK A;  3L2V A;  1GV5 A;  4PSX A;  3VOD A;  1G3T A;  3FM3 A;  3RKX A;  1LFU P;  1TWA J;  5H9T A;  2DFF A;  2GXB A;  4M3F A;  4D7N A;  2CSO A;  5CW8 A;  3LFK A;  1OYW A;  4ZYH A;  1JXS A;  2LK2 A;  1L0O C;  3D1N I;  4LB6 B;  1OQY A;  3CCR I;  5F0H A;  4HLX A;  2XAG A;  1HQC A;  2WY8 Q;  1SGM A;  1EF4 A;  3RKQ A;  2W00 A;  3OL3 A;  1RNL A;  4FX0 A;  4AVP A;  4UHT A;  2BHY A;  4MFD A;  3WTZ A;  3K4J A;  2VUM J;  1MIJ A;  3ZOB A;  5HNF A;  4M3E A;  1A36 A;  1BW6 A;  4O5V A;  3X2Q H;  1VF9 A;  2IAI A;  3RDI A;  4AVZ A;  3D0S A;  4AYB A;  1RRJ A;  1DU0 A;  1E2X A;  3F6V A;  1TWC J;  3S3M A;  3P9K A;  1Z7U A;  4DIQ A;  4XLE A;  2LBF A;  2JJ7 A;  4UVA A;  3OYN A;  4A5M A;  4PJJ A;  2P6S A;  2CW7 A;  3CME I;  4CH7 A;  2NXN B;  1BIB A;  3RZO J;  2Y2Z A;  1IXC A;  5FHP A;  3E97 A;  4FE4 A;  5F0F A;  1XTA A;  4M72 A;  1MJ9 A;  2PX9 A;  3FIS A;  4ZYE A;  4BGD A;  3NXC A;  3CTA A;  2KFD A;  2DA3 A;  4I99 C;  1IXS B;  3PIP F;  1T39 A;  2IGK A;  1EH8 A;  2XGD A;  1I50 J;  2VBX A;  3RQ4 A;  5ED4 A;  3GVA A;  4P96 A;  4OD4 A;  1F43 A;  2W84 A;  3O60 A;  3C07 A;  3I55 I;  3VDX A;  4XIC A;  1P7I A;  4KDP A;  1SMT A;  2VB6 A;  3A0H C;  3A01 B;  2CV0 A;  2VQL A;  3GF2 A;  2YVE A;  3GZN B;  3HSF A;  2CYY A;  2WTE A;  2R7T A;  1SEU A;  4AWX B;  4JOM A;  3I59 B;  2IVM A;  4IRI A;  2CWE A;  3LSI A;  1LNW A;  5EEH A;  3WU0 A;  2ZSI B;  4CCN A;  2UXO A;  5FLV A;  1WJB A;  4I76 A;  2JVH A;  4MO7 A;  5H20 A;  2I5U A;  2V4J C;  3ECH A;  4Z2Y A;  5J8C A;  5ICG A;  1RPW A;  3LWF A;  4JNN A;  2CO5 A;  1FY7 A;  2KLO A;  4E7Z A;  2B1E A;  3GZI A;  2OTL I;  3VOK A;  3F23 A;  5F27 A;  2KL4 A;  5K7H A;  3IRR A;  3C7J A;  1ETW A;  2AXL A;  2OF7 A;  3WHB A;  2WAE A;  1X4P A;  4BJ5 C;  4B43 A;  3S1M J;  1AKH A;  1HDP A;  3HG9 A;  3C1D A;  2PFV A;  1VQO I;  2UXI A;  1QHG A;  2LDU A;  5D5X B;  3P9I A;  1H9T A;  3M8E A;  3AQS A;  3M1C A;  1XDU A;  4EMS A;  5FFX A;  4CGZ A;  2DMP A;  4EV0 A;  2K40 A;  2QQB A;  3MZ8 A;  3GO5 A;  3H36 A;  2Q8K A;  2BOL A;  5HLH A;  1MDM B;  3S1N J;  4HST A;  4DGW B;  4BXU A;  4RA2 A;  4IHY A;  5FKO A;  1LJ9 A;  2CV2 A;  3HTJ A;  2XKO A;  3IH3 A;  4M74 A;  3U21 A;  3RPQ A;  4A5N A;  2QSF X;  3E7Q A;  2VBY A;  2V9K A;  1MMA A;  1A6Q A;  3KEY A;  2DQL A;  3JAM Z;  2ISZ A;  2DG7 A;  3CRJ A;  1ZN2 A;  2EV0 A;  2H1L A;  3OR1 C;  2G0E A;  2BY1 A;  4ZDP A;  2Y9Y A;  3MQ0 A;  3BJO A;  5K58 A;  1R1U A;  3SXY A;  4WXD A;  4HDU A;  3DU5 A;  3V8K A;  1ACI A;  2ETH A;  2M34 A;  1MMN A;  3ZQQ A;  2G7U A;  3PAS A;  4DYQ A;  3SEQ A;  3CCU I;  5EF6 A;  5DUK A;  1K79 A;  1MZB A;  3C3W A;  4I01 A;  4NC8 A;  3GW2 A;  5DD4 A;  5J1Y A;  2R5Z A;  2JTV A;  2CMP A;  2I10 A;  4AYB N;  1ETY A;  3C2B A;  5CVJ A;  3G71 I;  1J2X A;  2XV4 S;  3S17 J;  3TW7 A;  2ID6 A;  1X58 A;  3WE3 A;  3DQV C;  1ONV A;  1RIO H;  3CJD A;  2OQG A;  4A3F J;  3W3C A;  3BZC A;  2QSG X;  2M87 A;  5E3N A;  3OOP A;  5ERI A;  2K9L A;  4C3I J;  1QNT A;  1V5G A;  1YW8 A;  5E79 C;  1WJ5 A;  1YS6 A;  1T6S A;  2O7O A;  1Z67 A;  2DMN A;  2Y31 A;  4PSW A;  4U88 A;  5HDN A;  5LLQ A;  3ISP A;  4E70 A;  4EGY A;  2ZFW A;  2TCT A;  3LSR A;  2RNG A;  1U8B A;  4GCK A;  1WRJ A;  2D5V A;  3ONQ A;  5FRN A;  1BR1 A;  3M8F A;  4YIF A;  2OD5 A;  4QPO A;  2PEX A;  4RAF A;  2E2J J;  3G73 A;  1TT5 B;  2DCE A;  1WJC A;  1R4N B;  1J59 A;  4I02 A;  2NX4 A;  1ZR2 A;  1HKQ A;  1I39 A;  5EEG A;  3LMM A;  3QPT A;  3BTC A;  2DT7 B;  1S3J A;  2P5V A;  3F72 A;  3H5A A;  3HSE A;  5KHD A;  1TWF J;  3IP4 B;  4A3M J;  1B6A A;  3I4P A;  2ZOZ A;  3V42 A;  4OIO F;  3OWT A;  3HGG A;  1X1B A;  3MEX A;  2YPR A;  4BXX J;  2NP5 A;  1U9O A;  3QOE A;  4HNU A;  4XLC A;  1DU6 A;  3TDZ C;  5J47 A;  3OYB A;  3MKW B;  4BQA A;  3CMY A;  3BDD A;  1YW9 A;  2B0L A;  2DA4 A;  2K3F A;  4AIH A;  4CZC A;  4Y52 J;  1TL8 A;  5HDG A;  4RB0 A;  3ML6 A;  1X3W B;  1HBX G;  3DPL C;  1P4W A;  5EGO B;  5TRD A;  3K4M A;  1Y8R B;  2BY0 A;  2WBM A;  4KN7 X;  1POG A;  4GFK A;  2JUC A;  3HUG B;  5F6F A;  5LHG A;  4RB1 A;  3GTJ J;  3VEP A;  3HL2 A;  2EZI A;  5HS9 A;  3MZY A;  3H9Q A;  3ROU A;  3TBI A;  4F93 B;  2E60 A;  5LEK A;  1XSV A;  3F8N A;  3W6J B;  2ZME C;  1CQT A;  4L9T A;  1W7P D;  2Y0S A;  2MA3 A;  3MN2 A;  2V7F A;  4A2U A;  1YJ9 I;  2EBI A;  2EZL A;  4G9Y A;  5BOX A;  2NOG A;  1UAA A;  2D45 A;  1Z7L A;  2E71 A;  4F55 A;  2QLZ A;  3ANG A;  4MEY F;  4ZDO A;  3HEF A;  5L3E A;  1O3S A;  2YUS A;  2LF8 A;  4BY1 J;  3CDL A;  3DLL F;  2YS9 A;  1A5J A;  2ZSH B;  2ICW G;  2F5C A;  4A6D A;  5CVR A;  2EA2 A;  4M6X A;  3DKW A;  1WWX A;  3L1P A;  1V3F A;  1BOB A;  3C2G A;  2KZG A;  4BYY A;  3LST A;  2EA4 A;  4AIK A;  3R0A A;  4BS9 A;  4UUS A;  1NTC A;  3W2A A;  2BW3 B;  2D1H A;  4OU0 A;  1YQA A;  2HQN A;  3KCC A;  3QBM A;  3M07 A;  1I6X A;  4U0Y A;  2WY7 Q;  4JK1 X;  1QVT A;  3FBN B;  4XKB A;  5ILS A;  4HYE A;  2WV0 A;  3BNI A;  1MD0 A;  2VKE A;  2CUE A;  4IHX A;  3G3Z A;  1Z77 A;  1XPX A;  4LLL A;  2V57 A;  3RSN A;  3GLL A;  5CLS A;  2XRL A;  2JMW A;  1PP8 F;  1MND A;  3IV5 A;  2K9Q A;  2VC0 A;  3SYT A;  5HDK A;  1IN6 A;  4HF1 A;  2F4M B;  3H35 A;  4XRF A;  5CJ9 A;  2XGC A;  1SC7 A;  2VOO A;  2X1C A;  3NRV A;  2BW3 A;  5E1Z B;  2J5P A;  3MCZ A;  2BBY A;  5GAE J;  3CUO A;  3ASN H;  2JUG A;  4F91 B;  3PUB A;  3ZMD A;  3ZQI A;  5LD2 C;  3BOQ A;  2AHQ A;  3MVP A;  2RC4 A;  4C2U A;  3KET A;  1SMY F;  2L2O A;  4OWR B;  4Y17 A;  1FSE A;  2KIF A;  4UY8 I;  3H5R A;  1LQ1 A;  2CW0 F;  4A69 C;  1SFO J;  2K4J A;  1G3S A;  3WU2 C;  2XDV A;  5FGL A;  3F9K A;  5GAG J;  1I1G A;  4N9I A;  1Y1W J;  2PBX A;  5B66 C;  4JYK A;  2L01 A;  3K7A J;  4L9J A;  1ETQ A;  2EIJ H;  3DU6 A;  2ZXJ A;  4CDG A;  4HV5 A;  4G94 A;  3E5U A;  4DZJ A;  4MK6 A;  4HA8 A;  1FC3 A;  3F8F A;  2ME0 A;  3HRU A;  4QLC U;  3K10 A;  1QQI A;  3HTA A;  2ZJR F;  1ZHF A;  2V1X A;  3GZ6 A;  3GFJ A;  2TRT A;  4IVN A;  4HPQ A;  1JKQ C;  3BCB A;  4A3L J;  1LVK A;  4R8H A;  3VSK A;  3VUQ A;  2W24 A;  2EFN A;  2OU2 A;  3FK7 A;  5A2Q Z;  1RC9 A;  1X2N A;  2VIX A;  2AO9 A;  4LJZ F;  4W97 A;  2M8G X;  2CFO A;  3F8C A;  1FBQ A;  2DPD A;  3CCM I;  2MD5 A;  4C2M J;  5KVR A;  4MEX F;  4XLA A;  3TED A;  3U2R A;  3M3Y J;  2DG8 A;  1CGP A;  2UWM A;  2H8R A;  3CC7 I;  2M0C A;  4XKW A;  4GRI A;  4GXO A;  1T95 A;  2KZV A;  1SD5 A;  4LK1 F;  3OYF A;  3EUH A;  4FTH A;  2GOM A;  2XC7 A;  3QYE A;  2R93 J;  4FX4 A;  4HX8 A;  3SHF A;  3HTS B;  3OY9 A;  2IS1 A;  1V54 H;  1KQ0 A;  3OV8 A;  3E1S A;  2JK3 A;  2GUH A;  4OIN F;  3F22 A;  3BR2 A;  1TLH B;  1MJB A;  3I0T A;  2K9S A;  4KIB A;  4Y33 A;  5L3C A;  1VQ4 I;  3SWH A;  3BT9 A;  4RAZ A;  1RKW A;  3CQZ J;  3BJA A;  1R1V A;  5K5O A;  3BG9 A;  3ULQ B;  3ESW B;  3HRM A;  1BM9 A;  2PJR B;  2IGO A;  4ENN A;  1BOA A;  3K69 A;  3QWL A;  4I09 A;  4HZF A;  2PMZ A;  2OI8 A;  5GTH C;  3DKY A;  2FXA A;  4O3M A;  3DFG A;  3HHG A;  4Q47 A;  1LFB A;  5DAJ A;  1B8I B;  5FKN A;  2LLK A;  3WTY C;  1SAU A;  2G3B A;  1YJW I;  4ENJ A;  3KYC B;  2XAS A;  3QP6 A;  2WUI A;  2Y0M A;  2FSW A;  3BG7 A;  1LUJ B;  2BXY A;  3A1Y A;  1I1S A;  3PFI A;  2DFI A;  4RAG A;  5LHH A;  3AQT A;  3TO9 A;  4BEH B;  4AD9 A;  1UCR A;  4BNC A;  4G7O F;  3DTI A;  2HWV A;  2GFN A;  3G56 A;  1I3Q J;  1ZTR A;  4HDV A;  1JKO C;  4JX5 A;  5C4J J;  1MDM A;  4Q5S F;  2BE5 F;  2HVS A;  2BEO A;  4ASN A;  4RLQ A;  2GWR A;  3RH2 A;  2CW8 A;  2HPM A;  4L62 A;  1LPQ A;  3IH4 A;  4RLF A;  3HRT A;  3QOD A;  2Z33 A;  4BJ6 C;  1XMK A;  1MSE C;  4WK8 F;  3LA2 A;  2LVS A;  2E2H J;  2R4G A;  3SZG A;  5KAI C;  5AIP A;  5TJJ A;  2RQQ A;  2LNB A;  2CU7 A;  4Q48 A;  2RV8 A;  1WSU A;  1KU9 A;  2MD0 A;  3TQN A;  2EH3 A;  2V79 A;  4GDF A;  3DXJ F;  1HXD A;  2NNN A;  3L9F A;  4FIS A;  2E5Z A;  5JI6 A;  1EKE A;  4HW0 A;  5LGN A;  1FOK A;  2P7C B;  3LNQ A;  1GXQ A;  4RMN A;  5J3L A;  4M6V A;  3QQA A;  4E7K A;  1G3W A;  4XQF A;  1N77 A;  1GHC A;  1XN7 A;  3J7Y J;  3R61 A;  3FMR A;  4Y13 A;  3CC2 I;  1ZK8 A;  2X1E A;  1C0W A;  4HEA 2;  1ZGW A;  3K2Z A;  2OER A;  4P9U A;  4V2F A;  5GP9 A;  1W1W E;  1DGW Y;  2XPU A;  3BG6 A;  4PFO A;  3FRQ A;  5CXI A;  1UHW A;  2LBF B;  5LBQ A;  3DPJ A;  2GOX B;  2QTQ A;  3M7G A;  3KLN A;  5D4S A;  1Z3X A;  2A6H F;  1ITY A;  4XKC A;  3IC7 A;  2HQ5 A;  2HVQ A;  3FXM A;  3TW6 A;  2K86 A;  2OTJ I;  2P8T A;  2OUM A;  2DJI A;  2A69 F;  1OYY A;  3KX2 A;  1MKM A;  3JRF A;  3HOU J;  1LEB A;  3Q0U A;  2DXI A;  4G7Z F;  2VON A;  2R7O A;  3ZGK A;  1FYK A;  3PNY A;  3A01 A;  1UHM A;  5D19 A;  5J8F A;  1U78 A;  1P4A A;  2DFE A;  3U1K A;  4CYC B;  2ZNZ A;  2PJR A;  4I0B A;  2E34 A;  5D6F A;  2RVC A;  2F5D A;  5BQT A;  1ZYR F;  5HOO A;  1IRZ A;  5EEA A;  3J81 Z;  5AQC A;  3CJT B;  1X1P A;  2EIK H;  1ZQ3 P;  1IV6 A;  5IY5 H;  1FOY A;  2DN0 A;  1GUU A;  4KIF A;  3GME A;  3OIP A;  3VTI A;  1D0Z A;  1MBH A;  2XSJ C;  3FXK A;  1TQI A;  4M9X A;  1EJ9 A;  3UNG C;  1KU7 A;  3I9V 2;  4D7M A;  4BKX A;  4ESF A;  2P81 A;  4GCL A;  1FJL A;  1UG0 A;  2O3F A;  4ME9 A;  2RRE A;  3QU3 A;  3REO A;  2DPU A;  1CF7 A;  3K2A A;  2BVL A;  5K5R A;  3O8G A;  1SFE A;  3BQY A;  2FRH A;  3C2H A;  4XKV A;  5J6X A;  2JPC A;  4B4C A;  4KIS A;  3NS4 A;  3MWM A;  3VSL A;  3CLQ A;  1RR8 C;  2G7G A;  1FMW A;  2CQX A;  3G1O A;  4PK4 A;  3RKY A;  1SD6 A;  3M9A A;  3Q0W A;  4O6J A;  5HS8 A;  1SAN A;  5CYV A;  3H3V K;  3I64 A;  5FGM A;  1BN5 A;  3S2D J;  3FXQ A;  3HPH A;  2RAE A;  4F92 B;  4HNT A;  3OYI A;  2FJI 1;  2CQN A;  3FXL A;  3S93 A;  2HOE A;  4CCM A;  4A3K J;  1I3A A;  2O0Y A;  2WWY A;  4B47 A;  2DA7 A;  4MTD A;  4WX9 A;  3JRD A;  4UV9 A;  4IRH A;  2CQ7 A; 
#chains in the Genus database with same CATH homology
 2R5Y A;  4FE7 A;  4XRM A;  2ECC A;  3GEU A;  3CRJ A;  2DG7 A;  1FTZ A;  1OCT C;  2G0E A;  2XB5 A;  1XS9 A;  3JSJ A;  5JLW A;  2Y9Y A;  1JTY A;  2K9N A;  5K58 A;  1FEX A;  2WAQ N;  2M34 A;  5IYC J;  5HOD A;  4UUS B;  3I4N J;  3V6G A;  4V2G A;  4DYQ A;  3PAS A;  1LE8 B;  1VND A;  1GV2 A;  3G7R A;  1S7E A;  2ID3 A;  1XG1 A;  5EF6 A;  3BQZ A;  2D6Y A;  1IDY A;  1AKH B;  3COL A;  1O4X A;  1ZR4 A;  2X6O A;  5J1Y A;  1OFC X;  2R5Z A;  1JT6 A;  2MG4 A;  2I10 A;  5JLX A;  4AYB N;  1ETY A;  3C2B A;  1APL C;  3HOY J;  2FQ4 A;  3BR5 A;  3TW7 A;  1JKR C;  2HOA A;  2ID6 A;  5F08 A;  4JP0 A;  5C44 J;  1X58 A;  3SJM A;  4XRS A;  2REK A;  1MBE A;  1K83 J;  3QPS A;  5K7F A;  4BBS J;  3CJD A;  3EGQ A;  5FKK A;  2VKV A;  3F0C A;  5M5Y J;  1FIP A;  4A3F J;  2WGB A;  1WI3 A;  3S5R A;  4Y7N J;  5E3N A;  1JTX A;  4C3I J;  3HDD A;  1VFC A;  2UXH A;  2L7Z A;  4XK4 A;  2O9L A;  3PO3 J;  5EZG A;  1GVD A;  2O7O A;  1BJZ A;  2DMN A;  2Y31 A;  5C4Y A;  2TCT A;  3LSR A;  4LOC A;  5F0C A;  1U8B A;  3HOX J;  4GCK A;  5IP6 A;  2D5V A;  2X9D A;  5HAW A;  1H88 C;  2LFB A;  2E2J J;  1UI6 A;  2QIB A;  4MIM A;  2WV1 A;  5F1J A;  3PPB A;  1JUS A;  2NX4 A;  2IU5 A;  1ZR2 A;  1IJW C;  3BCG A;  1RES A;  2M9H A;  3S15 J;  2NVX J;  3LWJ A;  3ZQL A;  3ANP A;  3BTC A;  3S17 J;  1QRY A;  4GFL A;  4MFE A;  2ZOZ A;  4A3M J;  1TWF J;  4DZP A;  2LY9 A;  3JRC A;  3HGG A;  4BXX J;  2ZOY A;  2NP5 A;  1U9O A;  2HDD A;  4S0H B;  1DU6 A;  3O8H A;  1PUF A;  3CMY A;  2DA4 A;  3M4O J;  4Y52 J;  2NVQ J;  4XRS G;  2DA1 A;  4X1E A;  5IYB J;  2QCO A;  1AHD P;  4JX4 A;  4XID A;  4RBO A;  2HYJ A;  5EGO B;  3LSG A;  3ZQG A;  1E3O C;  1MNM C;  2PMZ N;  1WCM J;  5IOZ A;  1POG A;  2Q24 A;  4GFK A;  3GTJ J;  9ANT A;  2UXU A;  2DA6 A;  2L0K A;  2CJJ A;  3VVY A;  2EZI A;  3HB9 A;  2E2I J;  4A3I J;  3HIM A;  3MKL A;  5FMP A;  3VOX A;  2JA5 J;  3W6V A;  2RAS A;  3G1M A;  2Y9Z A;  3BR1 A;  1CQT A;  2Y0S N;  2DA2 A;  3FK6 A;  3BTI A;  4B1R A;  3QPL A;  3TP0 A;  3MN2 A;  3QKX A;  2X48 A;  3LOC A;  2R7Z J;  2EBI A;  1WH7 A;  2EZL A;  3S1Q J;  2NOG A;  3ON2 A;  2DMU A;  5E3O A;  3KZ9 A;  1WH5 A;  1MBK A;  4DYR A;  3ANG A;  3HOZ J;  2NVY J;  5D1R A;  2ZCN A;  4AC0 A;  3GTQ J;  3HEF A;  5J1U A;  2G7L A;  2YUS A;  2N8G A;  1RET A;  3CDL A;  4BY1 J;  2YS9 A;  1A5J A;  2L7F P;  4IHW A;  4QSH A;  3L1P A;  2JA6 J;  2E1O A;  3BTL A;  1RKT A;  1UG2 A;  1Y1V J;  1JT0 A;  1A6I A;  1QPI A;  2E19 A;  4UUS A;  4GFB A;  1NTC A;  2H1K A;  1OCP A;  3QBM A;  4CGR A;  3VP5 A;  1XC5 A;  3GTM J;  4HKU A;  2CRG A;  4A3C J;  1HDD C;  2B63 J;  3F1B A;  4ICH A;  1QVT A;  1ENH A;  1OJL A;  2HXO A;  3BNI A;  3BG5 A;  1TC3 C;  2VKE A;  4IHX A;  2CUE A;  1Z77 A;  2FX0 A;  2IEK A;  1IGN A;  2V57 A;  2UXP A;  2XRL A;  4NDL A;  5M3M J;  2JMW A;  1YRN A;  3SDG A;  4A3J J;  3IV5 A;  1HF0 A;  3HGY A;  2K9Q A;  1JKP C;  1UMQ A;  3GTK J;  3HE0 A;  2DJN A;  2R0Q C;  3S14 J;  5J1R A;  2GLO A;  3ZQH A;  4M3B A;  2XGC A;  2VPR A;  4I6Z A;  3KKC A;  2L7M P;  2JA8 J;  3VW2 A;  5HBU A;  5K7Z A;  3OSF A;  1D5Y A;  1B72 B;  5EZH A;  5IP9 J;  3WHC A;  4EEF G;  3HOW J;  3ZQI A;  4QIW N;  5E3M A;  4DW6 A;  1IG7 A;  1IDZ A;  3LHQ A;  3Q3S A;  2AHQ A;  3MVP A;  4C3H J;  3G1L A;  2ZCX A;  5DS9 A;  2LTP A;  4UDS A;  3DCF A;  2W48 A;  4A69 C;  4AF5 A;  1SFO J;  1PUF B;  3T6N A;  1LE8 A;  4B3A A;  5IOY A;  5BNG A;  1WGX A;  5FLM J;  5FGL A;  4YZE A;  3OSG A;  5EGO A;  1G2H A;  1Y1W J;  2PBX A;  3JR9 A;  4JYK A;  3JRB A;  2O7T A;  4A3E J;  3K7A J;  5HSZ A;  3BHQ A;  1AU7 A;  1ETQ A;  3RD3 A;  2L9R A;  5C3E J;  3ZQF A;  1ORK A;  4ABZ A;  4DZJ A;  3UKG A;  3PM1 A;  1JJ8 C;  2HKU A;  4MK6 A;  1JUM A;  2ME0 A;  2O8K A;  4ACI A;  5CXG A;  3HTA A;  3P9T A;  1WPK A;  5DTD A;  2TRT A;  2R5Y B;  1JKQ C;  4A3L J;  4RDU A;  3JRH A;  3I4M J;  2QF7 A;  3VUQ A;  3ZQC A;  5F04 A;  1GT0 C;  3FK7 A;  1FTT A;  2AO9 A;  1X2N A;  4W97 A;  2M8G X;  5IP7 J;  4UUT A;  2YU9 J;  4NN1 A;  2YVH A;  4C2M J;  1B8I A;  1MBJ A;  3LJL A;  1JGG A;  3TED A;  3M3Y J;  2DG8 A;  3BR6 A;  1Z0X A;  2H8R A;  1MSF C;  2M0C A;  2FBQ A;  3CCY A;  3BG3 A;  2KDZ A;  4M3G A;  2HOT A;  4FTH A;  2DTZ A;  2WB1 N;  4D5C A;  2R93 J;  4FCY A;  1UHS A;  1FIA A;  2R5Z B;  3JRI A;  3VVX A;  3VW0 A;  3VW1 A;  3GTO J;  3B81 A;  4X6A J;  1MBF A;  2JK3 A;  1ETV A;  2GUH A;  3BR2 A;  2DA5 A;  2K9S A;  1QVU A;  3MNL A;  3BT9 A;  1RKW A;  2CUF A;  3CQZ J;  3GTL J;  2MGQ A;  4KWA A;  1JJ6 C;  2DMQ A;  3BG9 A;  3SFI A;  2EZH A;  3H0G J;  5M3F J;  2HXI A;  5GPA A;  5EDN A;  1ETX A;  3FKI J;  3A03 A;  3E7L A;  1NK3 P;  1BL0 A;  1NK2 P;  1IC8 A;  3ON4 A;  2QOP A;  2NVT J;  4MLO A;  2ECB A;  2OI8 A;  5EYR A;  2JA7 J;  5E3L A;  5GPC A;  5M5X J;  1LFB A;  1TWG J;  2M2E A;  2FJ1 A;  4BY7 J;  5FKN A;  1B8I B;  5DAJ A;  2LLK A;  2HOS A;  5M5W J;  4J19 A;  3TP3 A;  1ZKG A;  2G3B A;  5EFY A;  2ZCM A;  3B6A A;  2R92 J;  2WUI A;  3NI7 A;  2Y30 A;  2LR8 A;  1MH3 A;  2ZB9 A;  4A3B J;  1MBG A;  2GEN A;  3IH2 A;  3LSJ A;  3HBL A;  3AQT A;  3KNW A;  2LKX A;  2HI3 A;  2JWT A;  3NAR A;  2XPV A;  1H8A C;  3NAU A;  2GFN A;  4IHV A;  3G56 A;  1T33 A;  1I3Q J;  2COB A;  1K61 A;  1ZTR A;  2OPT A;  2XPW A;  4C3J J;  1JKO C;  2NS8 A;  4JX5 A;  2ME6 A;  3VPR A;  5C4J J;  3HOV J;  1HOM A;  2QKO A;  1HLV A;  1ETK A;  3NRG A;  1Q1V A;  2IBD A;  1GV5 A;  2W53 A;  3RH2 A;  4L62 A;  4G12 A;  2MSY A;  3IH4 A;  2EQR A;  1TWA J;  3JRE A;  1LFU P;  5H9T A;  1MSE C;  2LVS A;  2E2H J;  1TWH J;  4M3F A;  3HTI A;  4D7N A;  4BBR J;  5CW8 A;  1RR7 A;  3FIW A;  1P7J A;  2LK2 A;  3BJB A;  3D1N I;  3S2H J;  2F07 A;  5F0H A;  2CU7 A;  2NP3 A;  2NS7 A;  1SGM A;  1EF4 A;  3RKQ A;  2QWT A;  1JUP A;  2EH3 A;  1ETO A;  2DMT A;  3S1R J;  4FIS A;  4MFD A;  5EG0 A;  3JRG A;  2ELK A;  5EG0 B;  3BRU A;  4IEJ A;  2VUM J;  3ZOB A;  5IYD J;  3LNQ A;  4M3E A;  1W0T A;  5J3L A;  1R9T J;  3BR3 A;  4M6V A;  3QQA A;  1BW6 A;  4M3D A;  1HCR A;  1VF9 A;  2IAI A;  3GTG J;  2LD5 A;  2CQQ A;  1ZK8 A;  1DU0 A;  3GTP J;  3A02 A;  3PO2 J;  2GM4 A;  3GBG A;  3VIB A;  1ZGW A;  2OER A;  1TWC J;  1BW5 A;  4V2F A;  5GP9 A;  3FRQ A;  2XPU A;  4A3G J;  5CXI A;  3NNR A;  1IUF A;  2JJ7 A;  3HTH A;  3DPJ A;  2QTQ A;  1W0U A;  4JKZ A;  4JL3 A;  2GBY A;  1UI5 A;  1ITY A;  3HKZ N;  5FKM A;  2PZ9 A;  2HQ5 A;  2LP0 A;  3TW6 A;  3S16 J;  3RZO J;  2Y2Z A;  4CYC A;  3JRF A;  2XSD C;  3HOU J;  5FHP A;  4FE4 A;  5F0F A;  3Q0U A;  3NPI A;  4NEL A;  3FIS A;  4AUX A;  3NXC A;  2FD5 A;  2DA3 A;  1BA5 A;  3A01 A;  2EZK A;  3EUP A;  5D19 A;  1U78 A;  4QTR A;  2RHA A;  4JX6 A;  2XGD A;  1I50 J;  4W1U A;  3BR0 A;  4CYC B;  1F43 A;  3O60 A;  3C07 A;  4XIC A;  1P7I A;  2G7S A;  1MH4 A;  1IRZ A;  2MW8 A;  5EEA A;  3A01 B;  5AQC A;  1X2M A;  1F36 A;  3BTJ A;  1ZQ3 P;  1IV6 A;  2YVE A;  3OOU A;  2DN0 A;  2JN6 A;  1GUU A;  5FKL A;  1GDT A;  2XDN A;  3Q0V A;  4L5E A;  2UXO A;  1MBH A;  3V78 A;  3OIO A;  5FLV A;  4I76 A;  4MO7 A;  4MXM A;  4GCT A;  1B72 A;  4D7M A;  3RQI A;  3LSP A;  5D18 A;  4PXI A;  1RPW A;  3DEW A;  4BKX A;  4JNN A;  3RZD J;  2P81 A;  4HNV A;  4GCL A;  5IPA A;  1FJL A;  4A93 J;  3GZI A;  4ME9 A;  1I6H J;  3VOK A;  2VI6 A;  1VI0 A;  5F27 A;  5K7H A;  3K2A A;  1ETW A;  3O8G A;  3BQY A;  3HM5 A;  2OF7 A;  3B6C A;  3WHB A;  1H89 C;  1T56 A;  3S1M J;  4B4C A;  1AKH A;  1HDP A;  2HYT A;  2KT0 A;  2G7G A;  3AQS A;  3JRA A;  2UXI A;  4AC6 A;  2CQX A;  3G1O A;  3VVZ A;  4DYC A;  3Q0W A;  4A3D J;  1SAN A;  2DMP A;  3H3V K;  2K40 A;  2XB0 X;  2XGE A;  5C4X J;  3S2D J;  3IUV A;  5FJ8 J;  4D5F A;  2RAE A;  3KKD A;  3S1N J;  1YRN B;  1U9N A;  4A3K J;  4IHY A;  5FKO A;  3CWR A;  3HTJ A;  3IH3 A;  2DA7 A;  3JRD A;  3E7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...