4X1EA

Crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
199
structure length
199
Chain Sequence
b'RAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIAASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
molecule tags Transcription
source organism Escherichia coli o6:h1
publication title Ligand binding specificity of RutR, a member of the TetR family of transcription regulators in Escherichia coli.
pubmed doi rcsb
total genus 75
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x1eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4x1eA02
2Y31A 1XG1A 1P7IA 2G7SA 3G1MA 1NTCA 2HI3A 4AF5A 3FK7A 4JL3A 5M5XJ 2Y30A 3GTMJ 1ITYA 1ENHA 1RETA 2DMUA 2EZHA 1TWHJ 1IRZA 3OSGA 4FTHA 1FJLA 4UUSB 2DA3A 1Z77A 4A3LJ 5IYDJ 2ZOYA 5K58A 3HKZN 5FHPA 2GENA 1MSEC 4MXMA 2JN6A 3K7AJ 1O4XA 2NX4A 3SFIA 1H89C 3BJBA 3P9TA 2ZCNA 4UUSA 5E3LA 1EF4A 1CQTA 2HYTA 5GPAA 4BXXJ 1PUFB 4JNNA 2JJ7A 4M3EA 1U9NA 3EGQA 4XRSA 5F08A 3M3YJ 5IP9J 2L0KA 3RZOJ 1JT6A 3S1NJ 1JT0A 4BY1J 1MBKA 4A69C 3MVPA 1MH3A 4MIMA 2QIBA 2R0QC 1R9TJ 3FK6A 2K9NA 3HOZJ 3TEDA 4PXIA 5C3EJ 3LSGA 3S15J 2ME6A 3EUPA 1RKTA 2YUSA 2Y9ZA 3LJLA 2MGQA 5FLVA 2L7FP 3HB9A 4NELA 2M2EA 2VPRA 3NARA 1F43A 3HBLA 3CRJA 1ZK8A 4KWAA 2NVQJ 2M34A 1JJ6C 5EG0B 1MBGA 1RR7A 5DTDA 2LR8A 1MH4A 1WI3A 2CRGA 2Y0SN 3NXCA 2IBDA 2GM4A 4ME9A 3HGYA 2ID3A 3VW1A 3GTPJ 1U9OA 3HDDA 3PASA 4ACIA 5E3OA 5D18A 3VW0A 1MSFC 1ZR2A 3GZIA 3BR0A 4B3AA 1QRYA 4IHWA 2ZOZA 3HGGA 2TRTA 3CWRA 3HE0A 2LVSA 1S7EA 2UXHA 2E19A 1W0TA 4EEFG 3NRGA 2DMTA 2ME0A 4C3HJ 4D5CA 1U8BA 1HDDC 5DAJA 4W97A 1SANA 2DMQA 3TW7A 2KT0A 4IEJA 3RZDJ 4DYRA 1I6HJ 1SGMA 3A02A 2EBIA 3DEWA 4XRSG 2RHAA 3TP0A 1UHSA 2QCOA 2LLKA 1K61A 1GVDA 3G7RA 4V2FA 2LY9A 4RBOA 3SDGA 4MFDA 2XGDA 2E2IJ 3UKGA 2R5ZA 3NAUA 1IDZA 3S1RJ 2DJNA 2IU5A 2Q24A 3BNIA 3S2HJ 1AHDP 3BQYA 2VKEA 4A3KJ 1JTXA 3BHQA 3VVYA 2L9RA 2ID6A 2ECBA 3VVXA 2VI6A 2PBXA 3VP5A 3JR9A 2K40A 3LSJA 3MKLA 3VVZA 1I3QJ 1VNDA 2EZIA 2LK2A 5IOZA 1JGGA 2Y2ZA 1IGNA 5CXGA 3KKDA 3HTIA 1SFOJ 2JA6J 2K9SA 2HQ5A 4AYBN 4X6AJ 1JKQC 4AC6A 3OOUA 5D1RA 1VI0A 2CQXA 2WV1A 3OIOA 1H88C 2HXIA 3NI7A 2MSYA 1U78A 1D5YA 3PPBA 3DCFA 3LWJA 1TWAJ 4ABZA 3S14J 2L7MP 2QKOA 1WH5A 2NS8A 2UXIA 4RDUA 3RKQA 1NK3P 5J1UA 4CGRA 3AQTA 2XPVA 1BW5A 2G0EA 3BR2A 4FE7A 3WHCA 5IYBJ 2QOPA 4HNVA 4GFBA 3LSRA 2Y9YA 2NP5A 3BG9A 3FKIJ 4MFEA 5F27A 3JRCA 3IH3A 1WGXA 3ZQLA 4IHYA 3BTCA 2NP3A 3PO3J 3DPJA 5FKLA 3B6AA 3JRDA 3HTJA 3WHBA 2PZ9A 3S5RA 1YRNB 5EYRA 5IP7J 4MK6A 5C4YA 1ETQA 1UMQA 3RD3A 1QVUA 3HTHA 2YU9J 2F07A 2O7TA 4G12A 2R5YB 3BCGA 4A3GJ 1OCPA 2OERA 4DYQA 2AO9A 1JUMA 5BNGA 2H1KA 3HOXJ 3BTJA 5C4XJ 2X9DA 1OJLA 1FEXA 2GFNA 3RQIA 5J1YA 3JRHA 5M5WJ 2ZB9A 3VOXA 2ELKA 3Q0UA 3QPLA 5EZHA 2QTQA 5FKMA 1F36A 1VF9A 2LD5A 2QF7A 3HTAA 2O9LA 3MNLA 5F0HA 4BBSJ 1PUFA 4GFLA 4X1EA 5IP6A 2DA6A 4A3BJ 2MW8A 4JYKA 4A3CJ 1MBHA 3S16J 4FISA 3QKXA 2XRLA 3ZQCA 2XDNA 2M8GX 3NPIA 3BTIA 4DZJA 4A3JJ 4GCLA 1TC3C 1UG2A 1MBFA 1T56A 1RPWA 4MLOA 2UXOA 2EZKA 1A5JA 3A01B 5K7FA 5HBUA 2FQ4A 1T33A 3O60A 2P81A 3QQAA 3JREA 4NN1A 1AU7A 1LE8B 1MBJA 3JRAA 1OFCX 2W53A 2YVHA 2WGBA 4M3DA 3HOUJ 3H3VK 2XB0X 1LFBA 3GBGA 2AHQA 3PO2J 4M3BA 4CYCA 2D5VA 5E3MA 2LFBA 2D6YA 3JRIA 1LE8A 3I4MJ 1A6IA 5CW8A 4XICA 2XGEA 1AKHB 4HKUA 1GT0C 2HKUA 2OPTA 2M9HA 3LNQA 5M3FJ 4XRMA 5EGOA 3SJMA 1IUFA 3Q0VA 5K7HA 2HOSA 2B63J 4JKZA 4Y52J 2HYJA 5HODA 5EGOB 1ETYA 2KDZA 2DA2A 1X2MA 2EQRA 2FD5A 1MNMC 5IPAA 4A3FJ 3F1BA 2DA5A 3QBMA 2CJJA 1ORKA 1ZR4A 1ETWA 4A3DJ 3I4NJ 4D5FA 3BG5A 1Y1VJ 2WUIA 4B1RA 3Q3SA 2IEKA 1W0UA 3BT9A 2I10A 4I76A 5FGLA 2O7OA 4YZEA 1IC8A 2JA5J 3GEUA 5JLXA 1FIAA 2NVYJ 3C2BA 1ZKGA 4C3JJ 4D7MA 4I6ZA 3JRGA 2RAEA 4XIDA 1I50J 5C4JJ 1Z0XA 4L62A 5F0FA 1XC5A 1ZQ3P 2ECCA 1FTZA 2DA4A 2M0CA 5FLMJ 3ZOBA 3VIBA 4V2GA 2O8KA 2WAQN 3D1NI 3MN2A 2XB5A 5M3MJ 3A03A 1YRNA 4B4CA 1GV5A 2ZCXA 3V6GA 3IUVA 2X48A 3A01A 2CUFA 3TW6A 4J19A 3CJDA 9ANTA 4AUXA 5F1JA 2CQQA 5C44J 5J1RA 5HAWA 3G56A 2R7ZJ 5F04A 2OF7A 4D7NA 5EEAA 2DA7A 4UDSA 1IJWC 3BR1A 1MBEA 1X2NA 3B6CA 1BL0A 1JJ8C 5J3LA 3CCYA 4JX4A 3LSPA 1Y1WJ 3FRQA 3O8HA 2FJ1A 2IAIA 1FIPA 3BR5A 3TP3A 2L7ZA 3CMYA 3H0GJ 3G1LA 4M3FA 1B8IA 3VOKA 2XPUA 2G7GA 1TWGJ 1TWCJ 3HOVJ 1OCTC 1RESA 4ICHA 3IH4A 4DW6A 2NVTJ 1E3OC 1APLC 1X58A 3QPSA 2FBQA 4BY7J 4BKXA 2DMNA 1QPIA 2PMZN 3HEFA 3F0CA 1BA5A 2YVEA 1POGA 2DN0A 1DU6A 4GFKA 2HOAA 3LOCA 4QSHA 3ON4A 3GTKJ 4XK4A 4UUTA 3T6NA 1LFUP 3BTLA 1WPKA 2NS7A 3CQZJ 1ETXA 1WCMJ 4BBRJ 3KNWA 3AQSA 2GUHA 3JRBA 4A93J 4DYCA 5FKKA 2UXUA 3B81A 2E2JJ 4A3IJ 2W48A 1H8AC 5FKOA 2XPWA 3ZQFA 4JX5A 2REKA 3S2DJ 2G3BA 3COLA 2NVXJ 5GP9A 5JLWA 1P7JA 1QVTA 3NNRA 3E7LA 2R93J 1GDTA 1B8IB 1UI5A 5H9TA 2DG7A 3VW2A 5EDNA 5GPCA 5M5YJ 1GV2A 2DG8A 5AQCA 5FJ8J 3V78A 4FE4A 4IHVA 2JMWA 5EF6A 1HF0A 3S1MJ 1XS9A 1AKHA 3BRUA 4C3IJ 2COBA 1IV6A 3KZ9A 1TWFJ 2CUEA 5DS9A 2K9QA 3ZQGA 2MG4A 5FKNA 3M4OJ 2DA1A 3BR6A 1ETOA 3BQZA 1HCRA 2X6OA 2XGCA 3BG3A 4JP0A 2E2HJ 3S17J 3ZQHA 2LP0A 1HLVA 4S0HB 1Q1VA 1JUSA 1BW6A 3K2AA 1RKWA 3JSJA 5HSZA 3FIWA 3HM5A 1UI6A 3Q0WA 1VFCA 1NK2P 2DTZA 1JKOC 2LTPA 1JKPC 1HDPA 5EG0A 1WH7A 5EFYA 4A3EJ 5F0CA 4CYCB 2WB1N 1JKRC 1DU0A 2R92J 2JA7J 3GTGJ 2CU7A 4QIWN 2NOGA 2UXPA 1B72B 2ZCMA 4IHXA 4FCYA 2H8RA 2R5YA 5IYCJ 5IOYA 4DZPA 3VPRA 3E7QA 5E3NA 2XSDC 1ETKA 5FMPA 4M6VA 1HOMA 5K7ZA 2HDDA 2VUMJ 3L1PA 4MO7A 1JUPA 1G2HA 2R5ZB 4GCKA 2RASA 2EZLA 2HXOA 3JRFA 2V57A 2DMPA 2TCTA 3ANPA 3HIMA 2G7LA 4AC0A 3PM1A 2GLOA 4C2MJ 3ANGA 4LOCA 2EH3A 2HOTA 4Y7NJ 1IG7A 2GBYA 3IH2A 2YS9A 5CXIA 1IDYA 4NDLA 3RH2A 1ETVA 2N8GA 3VUQA 1JTYA 3ZQIA 4JX6A 1ZTRA 4L5EA 3C07A 3W6VA 2JA8J 3G1OA 3CDLA 4A3MJ 3KKCA 3FISA 2FX0A 4QTRA 3GTQJ 4M3GA 1B72A 1BJZA 2OI8A 3GTJJ 3IV5A 3LHQA 1GUUA 3GTOJ 3S1QJ 4W1UA 2E1OA 3O8GA 3HOWJ 3ON2A 3GTLJ 4GCTA 3OSFA 2JK3A 5EZGA 2LKXA 1K83J 1FTTA 3BR3A 2JWTA 3HOYJ 5D19A 2VKVA 1ZGWA 2QWTA
chains in the Genus database with same CATH superfamily
1ZAOA 1BR4A 2FMLA 3QYFA 1XDUA 1BC8C 5JHFA 4CICA 4XONA 1IF1A 1VQKI 3FKJA 3GTMJ 1EJ9A 1RETA 3M1CA 4II3A 4LK1F 1ERDA 1QHGA 1IRZA 1YS7A 4FTHA 4XN3A 1MJBA 2VODA 1QZZA 4GDFA 5DUIA 1T95A 2RN7A 4DBRA 1Z77A 4A3LJ 3VODA 2E36A 1S29A 3HKZN 4LG0A 4OMYA 1QO0D 2AQEA 4LD5A 1S7AA 2OA4A 3GXOA 1L3LA 2NX4A 2Z33A 4BQQA 4UUSA 4J00A 3FXJA 3RDIA 1G3TA 1MDMA 2FQ3A 2XIGA 4LLNA 3K2ZA 3PFYA 2CV2A 5E17F 1WZ2A 4JNNA 2VBYA 4XKWA 4M3EA 3N4MA 1PVEA 2L0KA 1LJ9A 4M71A 1JT6A 1XSXA 3UR3C 1JT0A 1CGPA 4HQMA 1V55H 3W2AA 3MVPA 4TV7A 1U6GA 2CQNA 3SYTA 3LSGA 3CC4I 2ME6A 1TNTA 2KPMA 3SXYA 3BCAA 2DW4A 2V26A 3H5NA 3OYBA 2WTEA 1RZ4A 3LJLA 1LKXA 5FLVA 3I0TA 4RAZA 3DTIA 1F43A 4KN7X 3VSLA 4C2TA 2E5ZA 4KWAA 1N75A 3FXKA 2NVQJ 3R6SA 1IXCA 2IW5A 3KE2A 3F23A 1YG2A 2Y0SA 1JJ6C 3PQJA 4OIOF 2LR8A 1MH4A 2CRGA 3NXCA 2Y0SN 1BOAA 2A6HF 1YFHA 4ME9A 3HGYA 1AWCA 3GTPJ 1U9OA 3HDDA 2DAOA 3S3OA 2OCEA 3OYJA 1P2FA 2ZOZA 1W4MA 4AVZA 4D9JA 2UXHA 2O6GE 3E3VA 3QPHA 2E19A 1RC9A 1W0TA 1S5LC 3HPGA 3VYTB 2ME0A 3ABUA 1HDDC 2ZC2A 3CMEI 4E7KA 2DMQA 4XKVA 3RZDJ 4DYRA 2QQ9A 1FY7A 1WFXA 3MQ0A 3A02A 2QSHX 1UHSA 1WQ2A 4AWXB 1Z7UA 2LLKA 2DDAA 4RBOA 3MEXA 3SDGA 1QA6A 1H0MA 3UKGA 1I3AA 2Z5UA 3WG7H 2DJNA 4XM3A 2VQLA 4LG3A 3BQYA 1ZREA 2VKEA 4UNOA 1DGWY 3IUOA 2WAFA 3KYDB 2VPLA 3AL0B 2ECBA 2ID6A 4WK8F 2GA2A 3PQKA 5L3DA 1ZRCA 2PBXA 4KFCA 3CD6I 3LSJA 3VVZA 1JGGA 2EZIA 5IY5H 2Y2ZA 5IT9Z 3K1MA 4IVNA 3TO6A 2P0WA 2LC2A 5D5WB 1KU2A 4MEYF 4X6AJ 4RGSA 2PFBA 1X3UA 2DCEA 2COMA 3NS4A 5D1RA 1S3JA 1VI0A 1USTA 3VEPA 2IA2A 3DEEA 4CHUA 1H88C 1PJRA 5DYMA 2HXIA 2QQ8A 3CZ6A 1KQ9A 1D5YA 2DODA 4HG2A 5DDGA 4HOBA 3OY9A 1J09A 1R23A 1XGOA 2M7BA 2Q1ZB 3DLAA 4B44A 4ABZA 3CP2A 1FX7A 2UUZA 3KFWX 4RDUA 4XBFA 4D1QA 2HPMA 2UXIA 4FQGA 1X4PA 2EFNA 1W5CC 3RQ4A 1JXSA 1FSEA 2F5CA 4RB1A 3WHCA 4FX4A 4HNVA 3HL2A 4GFBA 2KISA 3JRCA 1R4MB 1WGXA 1Z7LA 2GWRA 2VIXA 3BP8A 3IH3A 3BTCA 2QSFX 5DUKA 3ZN1A 5J6XA 3L2UA 2XAUA 3G6EI 4U9LA 1YJNI 2PQ8A 4E7SA 2HEOA 5H2FC 4UV8A 5EYRA 5IP7J 2B9SA 1X1CA 2FBHA 1UMQA 4NC6A 4A0XA 1WKMA 1VQMI 1FBQA 3TDUC 2HFHA 4G12A 3BCGA 1T0FA 3HTUA 1OCPA 3KEOA 3LWFA 3Q9SA 4XSZF 5HNFA 4YRVA 5CKTA 2EV0A 2O3FA 2AO9A 4FETA 5BNGA 1R71A 2GXGA 3HOXJ 3BTJA 5FLXZ 3BWGA 5C4XJ 4O6JA 2DPUA 3AKZA 2V1UA 2W25A 2GFNA 2F5FA 3GZNB 1MDMB 1F4KA 1ZRDA 3LA2A 2E60A 2JPCA 2ZSHB 3Q0UA 4NC8A 2P8TA 1SVOA 5FKMA 1VF9A 1L0OC 1FT9A 4HZFA 3WE2A 3AFHA 3F8BA 2O9LA 4I09A 2QUFA 4BBSJ 4HAMA 4YIIA 4X1EA 3I58A 4KMFA 1OQYA 3CUQB 3ZCOA 4HDUA 3S16J 4UHTA 4RB0A 3QKXA 2XRLA 3ZQCA 5GAGJ 3OYEA 4A3JJ 3U9GA 4GCLA 1TC3C 4BACA 4Q5SF 3FHNA 1T56A 1HKSA 3WGIA 4NBQA 3V8JA 3M1EA 4KICA 1K6YA 3V42A 3J7YJ 2PMUA 5E18F 1O3QA 3ZMDA 1SVMA 3BZCA 4NN1A 1AU7A 2FSWA 2ISYA 3I4PA 2WAEA 4WCGA 2Y48A 2YVHA 3TO7A 4M3DA 4MTEA 2YPRA 2XB0X 2IT0A 2AHQA 2MD5A 3COAC 4HRIA 4ON0A 3MKYB 4NC7A 2E7WA 2D6YA 2LFBA 3JRIA 1LE8A 1DPUA 1SC7A 2EV5A 4HX4A 3CF2A 4IJAA 3K70C 1ULYA 3V4GA 1GT0C 3C3WA 2JA2A 2OPTA 4XRMA 5EGOA 3I9V2 2GQQA 5FFZA 4Q47A 2ZJRF 4CSWA 1RI7A 4OD4A 4RM2A 3IAS2 2F5VA 3LSTA 5K5QA 5GTIC 1ETYA 2XKPA 4I0BA 2DA2A 2KDZA 3E97A 1NG7A 2BE5F 1I1SA 3I5UA 1SD4A 5IPAA 3FM5A 4E4HA 2ELHA 4BE2A 1XCVA 2QQBA 5DD4A 4D5FA 3H9QA 1I39A 4A0YA 3Q3SA 3U1KA 1V3FA 1V5FA 1FZPB 1WHUA 2EV6A 1JGSA 5JLXA 5LHGA 4C3JJ 2K3FA 3HRTA 3JRGA 2D1VA 1HA8A 2BXZA 3H9JA 3PJRA 2E1NA 1R5ID 1MNDA 3R4KA 1FTZA 2M0CA 3E6CC 2R7VA 4O3MA 2ESNA 4V2GA 1TW3A 3CLOA 2KJCA 3D1NI 3MN2A 2XB5A 4RB3C 3A03A 1J75A 4CCJA 2RGVA 1GV5A 3OL4A 3D5RC 4NNJA 2CUFA 3M9AA 3TW6A 4J19A 4X0GA 5J40A 9ANTA 1QGPA 1G59A 3I59B 5HAWA 4IRVA 4C9YA 1VTNC 1WRJA 3PFIA 2M5WA 4DVYP 2XRNA 3A0HC 2OZUA 2LH9A 3F8FA 2L3DA 4N9HA 3F9KA 4UVAA 1SFUA 2V6CA 2CGPA 4Z2YA 1YW8A 2DXIA 2L7ZA 4M9SA 3HJEA 3EQLF 2XPUA 3BG6A 4LGWA 3PIOF 2G7GA 2HDWA 3GLXA 4RMNA 1OCTC 1XGMA 4OIQF 1MMGA 3HOVJ 2K9MA 1RESA 1S72I 3OMYA 4PJJA 3ZQ7A 2R3SA 5J8CA 5K5RA 1E3OC 1D0ZA 3C2GA 4BY7J 2DMNA 1O3SA 1POGA 3LOCA 2GXAA 2L9SA 1WSUA 4EATA 4UUTA 3T6NA 2HQRA 3P9KA 3BTLA 4UVBA 4RA2A 4BBRJ 3CMAI 1HQCA 5DD8A 2D1HA 3KNWA 1XN7A 3V7RA 5ILUA 4DYCA 3CUQC 1J9IA 3B81A 5DCFA 1H8AC 3E5UA 5FKOA 4ANJA 4YELA 3S2DJ 2EA2A 1YX3A 3HPHA 1UAAA 1I5ZA 2X1CA 5GP9A 5J8FA 4D0PA 2F6CA 3NNRA 2QKLB 5JFRA 3BOQA 5E8IA 5TISC 3VW2A 2BHZA 2F4MB 3DBRB 3R0AA 5GPCA 3Q5FA 1VQ4I 2DG8A 4YFNF 1S7OA 1XCBA 4OWRB 5FJ8J 2V7FA 4IHVA 1IZ1A 4C2MA 2VQHA 1R4NB 3CLQA 3BRUA 3R61A 1BM9A 1R1VA 3HYIA 4RAFA 1MW7A 4GYGA 3E5XA 2XGCA 4LG0B 3S17J 3ZQHA 2M30A 4S0HB 1JUSA 4HSTA 5E1XA 3JSJA 2UWMA 1PP7U 3HM5A 1D1CA 1T08B 2W4SA 5BOXA 4OAZA 3WODF 1T6SA 4KN4X 1JKOC 2JRMA 4I0AA 4E7HA 1DDNA 1DUXC 4WIBA 2ZXJA 1FOYA 2VKDA 2XASA 2JA7J 3S93A 1B72B 2IGMA 1U0JA 5JI6A 2H8RA 3DQVC 3GMEA 2H1LA 3VPRA 2R4GA 1CF7A 5FMPA 4IO9F 1HOMA 5K7ZA 3RSNA 2L9NA 2HDDA 5CVVA 4MO7A 3C18A 3T8RA 4L18B 4HNTA 4ZH4F 2G7LA 3HRUA 4M72A 2A6TA 4BAYA 4HQEA 3ANGA 1OYWA 1BBYA 2HTJA 1IAWA 1IN6A 2ZSIB 1FYMA 2VC0A 4FHTA 5EJCA 3T0YA 5L3CA 3IH2A 1ZGAA 3H92A 4BQAA 4NDLA 1OMIA 1ETVA 2M1BA 4GO1A 1JTYA 4JX6A 1T39A 1UFMA 3J81K 1A6QA 1X3WB 1SAXA 2LBFA 2NXNB 2QVOA 2EPFA 2HVSA 1GHCA 2JA8J 4IRHA 4BS9A 3KKCA 2VT2A 3FISA 2V4JC 1ON2A 1BJZA 1QPMA 2XSJC 3RIRA 4KDPA 5JHUA 4IRGA 3RTRA 2E71A 1ZHFA 4F7ZA 2ZMEA 3TO9A 3OSFA 4B43A 2JK3A 4GYIA 5EZGA 4XL9A 1K83J 3CTAA 3CJTB 1HW1A 2VKVA 3V8KA 1YTYA 5F64A 2V9PA 1XG1A 2Y31A 2IPQX 3G1MA 3GYHX 2ETHA 1W36D 1KQ8A 1J59A 4Y3OA 4AF5A 4FASD 4C2UA 5M5XJ 4E7LA 4IKFA 4RGRA 1WJEA 2A68F 3OSGA 2CWEA 1FJLA 1FYKA 4P55A 2DBBA 3R0JA 5LEJA 3SHFA 1STZA 5FHPA 1MSEC 2W82A 4MXMA 2FE3A 3SFIA 1LDDA 3BJBA 3E6BA 2FU4A 1PYVA 2OJED 2VXDA 3LFKA 2VBWA 2XAHA 1ONVA 4IQJA 4MHGA 2DT5A 2HYTA 2PMHA 1B1BA 4R1HA 4OIRF 3E5QA 3H36A 2ZFUA 3IC7A 4IOCF 4OINF 1LB2A 4NQWA 1YI2I 2OU2A 3DU5A 3VYUB 1MBKA 4A69C 1MH3A 2R0QC 3HOZJ 3TEDA 5C3EJ 3I3LA 3HG9A 3KCCA 1JHFA 1SFEA 2CUJA 2ZMEB 1RKTA 3D5SC 2Y9ZA 3OR2C 4RGUA 3U21A 2L7FP 4XLFA 3B02A 3HB9A 4MQ9F 2P6TA 2M2EA 2YSRA 1W5SA 3CDIA 3M7GA 1OPCA 3QU6A 4EGYA 1VQ7I 1MBGA 2QQAA 4R79A 3RI4A 2QLZA 2X85A 2M3AA 4I01A 1XSDA 3OYCA 2IBDA 2ID3A 2VN2A 3KLOA 2M87A 3KEYA 5D5XB 3GZIA 1AA7A 2NYXA 5E20A 4B3AA 2WY8Q 4G94A 1O7LA 2STTA 2KL4A 4IZZA 3HE0A 2P5KA 2LVSA 4WX9A 2LF7A 4BH9A 2EWNA 4G6DA 3EDPA 2DPDA 2A07F 3NRGA 3GLLA 1U8BA 4XN0A 4LFUA 2R7UA 2A69F 1X1AA 1KZHA 1LNWA 2RREA 1T0FC 4BUPA 1REPC 3AL0C 2LKPA 2WC2A 3CESA 2EBIA 2Z16A 2RHAA 2Y0MA 2QCOA 3O2PE 2OV7A 1K61A 5KK1A 3ZMVA 1M1EB 1HXDA 2HYFA 4PK4A 4ZTFA 2DI3A 3LFUA 4N4NB 4BJ6C 3F8CA 1IDZA 3RKWA 3S2HJ 1KONA 1AHDP 3BJOA 2P7VB 1JTXA 1TLHB 5HDKA 1G8XA 4AIKA 3BHQA 4PJNA 2L9RA 2A6EF 3ZR8X 3VVXA 4N9IA 5FRNA 3VP5A 4AM3A 5B5EC 1I3QJ 1R22A 5IOZA 3BZ6A 3FF5A 4K2EA 4L5JA 5ICGA 1HW5A 4II2A 1IRFA 5ICFA 4B3XA 3CCUI 3BG7A 2DOFA 1JKQC 4AC6A 3OOUA 2FMYA 2V79A 4IPAA 5KVRA 2WV1A 4F55A 3K70D 3NI7A 1XD7A 3KP3A 4HYEA 4B8XA 3LWJA 3CF5F 2ZXWH 3I59A 1TWAJ 2BVLA 1G3WA 1YW7A 2W00A 3S14J 2B0LA 2L7MP 2QKOA 1WH5A 2DOAA 2BEOA 2IA0A 3RKQA 2KFDA 1KGSA 3CCQI 1V54H 1BW5A 4FE7A 5CPRB 2XF5A 5IYBJ 4XQFA 3DLLF 2NOJB 3K4JA 3SFZA 3I55I 3G73A 3BPVA 2DFEA 2QBYA 5F27A 4EM2A 3DPLC 3ZQLA 2NP3A 1Y39A 3DPJA 1D1BA 4OMZA 2B7EA 2EFWA 4CCMA 3S5RA 3J7ZI 1SMTA 1YRNB 1FWZA 1ETQA 4LIVA 3RD3A 1QVUA 2A5WA 3HTHA 2YU9J 3JSOA 1FOWA 4EMSA 3RKXA 5J4VA 1O57A 3DKXA 4DYQA 2EIMH 4XKBA 1JUMA 2H1KA 1YOVB 2P7CB 2X9DA 2PEXA 1FEXA 1UB9A 3GFJA 4BEHB 3FXUA 4XLEA 1ZELA 1WJBA 3F8MA 5J1YA 3JRHA 1ZLKA 2ZB9A 3VOXA 5D8LB 2E1MC 2ELKA 1O3TA 4U9NA 5GTHC 5EZHA 2AQFA 4I98B 4KT5C 2QTQA 3ONQA 1QU3A 1HBXG 3AAFA 2LD5A 4KUMA 2QF7A 3RCOA 1B59A 3T8TA 3ESWB 3IKTA 4LB5A 5F0HA 2JTVA 4GFLA 5IP6A 3FHZA 2DA6A 2HS5A 4WXCA 1FBSA 2WADA 4JYKA 1K7AA 1PUEE 1OR7C 3FXMA 5LGUA 1IW7F 4AIJA 1BN5A 2VOOA 5L3GA 2BW3A 3BCBA 2KQRA 3IRQA 4FT8A 3EUKL 3CO7C 1T8IA 2CYYA 2F4OB 4WXHA 4DZJA 2VXZA 3S3NA 1TT5B 1RPWA 1IN8A 4MLOA 3MKZA 1EA3A 2PJRB 2UXOA 2CQKA 3PSFA 3WU2C 3H5RA 3E0JB 3A2KA 3K1NA 5HBUA 2Q2EA 2JVHA 3EUHC 2P81A 2W24A 3LL7A 3P7NA 2PI0A 2VLAA 1OFCX 4IHTA 2W53A 2GXBA 2WGBA 4EGZA 1Z9CA 4XLCA 3GBGA 2XROA 1IN5A 5J4YA 5E3MA 4CYCA 2W7NA 5TGTA 5B1BH 2DK5A 2TDXA 3M8EA 1X19A 2CH0A 4A5NA 4KNYA 2BHYA 3HUGB 4XICA 4HKUA 2HKUA 5B1AH 4A6EA 1E3HA 5M3FJ 3K10A 1LVKA 3Q0VA 3RYRA 4BYYA 5K7HA 1FP2A 2DU9A 1DPRA 3AG3H 2HOSA 2KRHA 1OKRA 2HYJA 4Y15A 2HZTA 3L7WA 2PBIA 2EQRA 3IRRA 1B6AA 4KT6A 2DA5A 3QBMA 4E7JA 1Y6IA 1ORKA 2EILH 4A3DJ 3BJ6A 4MTDA 2WUIA 3QOPA 1D5VA 3O3KA 1FYLA 4I76A 2ZBKA 1P4XA 3DP7A 3KP6A 2RC4A 3IP4B 1IC8A 2HVRA 5BQTA 3GEUA 2MLGA 1YITI 5LGNA 2CW0F 4H4KC 1LPQA 2KIUA 3TBIA 1ZKGA 2VE8A 3ASNH 3EPZA 3P5JA 1FOXA 4HX8A 2RAEA 3NWSA 5D6EA 1J0RA 5F0FA 4BHBA 1A04A 2ECCA 3OYGA 3CCRI 4AYBA 2DA4A 2P5VA 1YQAA 3KYCB 2O8KA 4FX0A 4NUBA 5M3MJ 4LB6B 3V8LA 2VBZA 2P4WA 3LQQA 3CCVI 3IUVA 2IGNA 4QWQA 1R00A 2L54A 2K4BA 1IO2A 5DEQA 3GEZA 4AUXA 1BIAA 4F93B 2OC6A 5CQEA 5C44J 5J1RA 2DK8A 2R7ZJ 3HSEA 2OF7A 4BQOA 2EJRA 5EEAA 1MJ9A 3MCZA 1EKEA 1ZRFA 4UDSA 3BR1A 3B6CA 1X2NA 3IWZA 1JJ8C 2DTRA 2E35A 2MFZA 1BJAA 2FJ1A 2IAIA 3BR5A 3CMYA 1FMVA 3G1LA 3H0GJ 2STWA 3VOKA 2RVCA 5JVGF 1VZ0A 1WJDA 3WTVC 2HWVA 4GRIA 3CUOA 2VKHA 3ZPLA 4DW6A 4IQ4A 4XOPA 2OD5A 3J7AO 3DWLE 1XDSA 2LRDA 5DM6F 3CCEI 3JTGA 1APLC 3K0LA 3V7CA 3QPSA 3L2WA 1OLTA 1BA5A 3F0CA 1MMNA 2NRAC 2DN0A 3TQNA 1DU6A 1Y0NA 2RNGA 4QSHA 2PFVA 4HW0A 4XK4A 2E5NA 5HOOA 5D5UB 1WCMJ 1MZBA 4PCQA 4CGZA 3H3ZA 3VFZA 3A0BC 4OIPF 3L09A 3F22A 3JRBA 4PSXA 3OYNA 5GAEJ 1W5TA 2HQNA 3RJPA 4J01A 1O3RA 2ESHA 2KDOA 3HC7A 2UXUA 4DGWB 2W48A 3LQRA 4E70A 1TL8A 3ZQFA 1LVAA 4RS8A 4MGRA 2NVXJ 5JLWA 4EQQA 2EINH 2HU9A 2R93J 5H9TA 4XLPF 5KHDA 1HSJA 2K5CA 1GVJA 1GV2A 4PFOA 2W57A 5AQCA 4BHCA 3CUQA 4P1WA 4XSXF 2RQQA 2V1XA 2V9KA 2VE9A 1HF0A 3S1MJ 4KA4A 1R5GA 2IGOA 4C3IJ 3T5XA 1VQPI 3MWMA 3WGHA 5FB2A 2LY1A 2MG4A 3PNTA 3BR6A 3G3ZA 3H0DA 4XLHA 4PJLA 2OUMA 3KYLA 1HCRA 3BG3A 1FBUA 1W7PB 4JP0A 2ZXIA 3LA3A 1HLVA 5K1YA 1Q1VA 3ASOH 3M8FA 3VYSB 1Z91A 3K2AA 2IRFG 4E7ZA 3DPTA 3H9GA 4AU7A 3CJNA 4ENNA 1NK2P 2DTZA 2JPBA 1HDPA 1WH7A 2R7OA 3WU1B 3KLNA 4A3EJ 5F0CA 1YLFA 1DU0A 2R92J 3WTXC 1YJWI 3CMMA 2NOGA 2OQRA 3RPUA 4B48A 1ZN2A 2PX9A 1TP4A 3WU0A 4DZPA 1MMAA 5KAFC 1MNEA 2XSDC 1ETKA 3I54A 2VJ5A 3DV8A 4QPOA 2VUMJ 3L1PA 3EETA 2R5ZB 3DTEA 2V6EA 3SQNA 5CW8A 1Y0UA 2HXOA 2V57A 3ANPA 1ZH5A 5JR3A 2HVQA 2Q8KA 4L9JA 4HX7A 4ZJZA 2GLOA 4C2MJ 4CCNA 2A5YB 1D3YA 2EH3A 1TW2A 2K7LA 4BHPA 2HOTA 4NHJA 5CVJA 2GOXB 1IG7A 1BOBA 2GBYA 4F52A 2IS6A 1V5GA 3RH2A 1R36A 1U5TA 2DT7B 2F2EA 5FGMA 3FX3A 1G3SA 3W6VA 3I56I 2GAUA 3L00A 5TJJA 4A3MJ 4QTRA 3GTQJ 3SWHA 1B72A 5BPDA 4WF2A 3GTOJ 3ON2A 3GTLJ 3RPQA 1NG6A 1XPXA 4UVCA 1Z05A 2R7WA 1R1UA 2JWTA 3OYLA 1YW9A 3ABMH 1BR1A 4Q48A 1P7IA 2G7SA 3K8PC 2HI3A 4JL3A 4A0ZA 4ESFA 2Y30A 1ZG1A 4KIGA 2K4JA 2LKSA 3FXQA 3DFGA 3S2WA 3HTSB 2YVXA 4L5IA 4EJUA 2DMUA 2KLOA 4LLLA 1FC3A 2HTSA 2ZMEC 4XKCA 4I02A 2LG4A 3GUDA 3RYPA 3KZZA 3L2CA 1FSHA 2IS4A 1A31A 1SFKA 4UUSB 3GVAA 2GENA 2JN6A 2LBFB 3HIFA 5D4RA 4BGDA 3P9TA 1GXQA 2ZCNA 3ECOA 5E3LA 1EF4A 2C6YA 1CQTA 2X1EA 2NAZA 2OTJI 1J5YA 3S3MA 1PUFB 4BXXJ 5L3EA 2KHMA 2FA5A 1KU9A 4IX7A 3KP7A 4I99C 3EGQA 4XRSA 1PP8F 5AIPA 4RAYA 3M3YJ 4A6DA 3WE3A 3RZOJ 3S1NJ 1SAUA 3DU6A 1FNNA 2F4IA 5H20A 3T1BA 2LNBA 1X1PA 3CCLI 2QIBA 4DJAA 1MJAA 2UXXA 5E8GA 3S15J 3CO6C 2WB1A 3LSKA 1OR7A 3FZVA 3EUPA 2YUSA 5K5OA 2ZY9A 2KRFA 2CS3A 3REOA 2MGQA 4S05A 2VPRA 3NARA 4MQVA 1R1TA 3HBLA 3H1CA 2LREA 2YR2A 3L2VA 1ZK8A 5HDGA 4RM3A 2M34A 3AG2H 1BI1A 3NEUA 3DF8A 3W2VA 1VQ9I 2JZYA 5E1ZB 3N05A 2KMUA 5DTDA 1WI3A 3MMYB 1Z21A 2KIQA 3PL8A 3VW1A 5LRRA 3I71A 4ACIA 2BY2A 1JHHA 4QLCU 1EH6A 3ZMZA 3IL2A 1ZR2A 4JK1X 1MSFC 3CJQB 2MC3A 4Y13A 3SEZA 1QRYA 4IHWA 4ETSA 3ERED 3CWRA 3BJAA 5HLGA 2NNYA 3FMRA 1S7EA 3OIQA 4IRIA 3K4MA 1G4DA 4L0ZB 2DMTA 4HF1A 5DAJA 4W97A 2O8XA 3ZMSA 3TW7A 2KT0A 5LLQA 1ZLJA 1I6HJ 1B9MA 4KISA 4XRSG 1SGMA 3DEWA 2G7UA 3TP0A 1EV7A 2EB7A 2OAZA 2O61A 1QNTA 2E34A 2Z1DA 2LY9A 4V2FA 3G7RA 4MFDA 1WJCA 2XGDA 2E2IJ 2CFOA 2R5ZA 3NAUA 3F8NA 5FLXK 5L3FA 2R7QA 2M45A 2Q24A 1Z3YA 2X51A 1SMYF 3TGNA 2WWYA 5ICEA 3ML6A 5CYVA 1GLNA 2CSOA 4ZYGA 3IAM2 4CO8A 4CH7A 2VQGA 5CXGA 3ZMTA 3NWTA 3CJRB 3HTIA 1SFOJ 2HQ5A 4AYBN 3E1SA 2CFXA 2BY0A 1P6RA 2MH9A 5HDNA 4M9ZA 4BNCA 5AONA 2VOPA 2AS5F 3OIOA 4HSRA 5DCMB 1E0EA 3PPBA 3DCFA 4NB5A 4G6QA 1UJ8A 1ZARA 4CYDA 3TKYA 1D8KA 2IVMA 2NS8A 2IXSA 2LY2A 2FEZA 5J1UA 4B47A 2K27A 2XPVA 1QHHD 3C2HA 2ZNZA 4G9YA 1B4AA 3BG9A 3WTWC 5IT3A 1VQ5I 2K3PA 4MFEA 3KIOA 2W85A 3NQOA 4CCKA 4IHYA 2QGUA 2QA4I 5FKLA 3B6AA 4HPQA 3HTJA 3WHBA 4KIBA 2PG4A 2PZ9A 1HW2A 5H6QA 4M74A 4MK6A 1RRJA 5C4YA 2ZO4A 4G8XA 4XLNF 1J2XA 1YYVA 1W7PD 5D5VB 2R5YB 4U0YA 2JUCA 4A3GJ 2CMPA 4DQ2A 4BU2A 2OERA 1T2KA 1XGSA 2K02A 3FWEA 2VASA 2RDPA 3VTIA 3LAPA 3RQIA 3IKVA 1SD5A 3ABKH 4CA0A 3G2BA 3QPLA 1K4SA 2H09A 3WG9A 3CC7I 1TQPA 4UB8C 4HBLA 2DFHA 3HTAA 3MNLA 3P9CA 3WTTC 4I2OA 5LD2C 1YS6A 1VQOI 3FM3A 4A3BJ 1LUJB 1R49A 3L9FA 3OYFA 4P96A 4ESBA 2MLKA 4FISA 2ACJA 3NPIA 2M8GX 4RGXA 1IN4A 2BOLA 2EIJH 1UG2A 2X6WA 3MD2A 1MBFA 4Q4ZF 2BYVE 4GGGA 1NHAA 2P6SA 1VQ8I 2EZKA 1LEAA 4U0VA 2E1CA 3GW2A 2VJJA 3OS1A 2FQ4A 3R60A 4EVIA 1T33A 2PJPA 3I53A 3JREA 1GXPA 1EH8A 1MBJA 3JRAA 4IF4A 2OCCH 3HOUJ 2DO7A 2UXNA 3ERMA 2XDVA 3DKWA 4XMYA 1XMXA 1QBJA 4KITB 2XUBA 3V7SA 1FOKA 1BIBA 4PZJA 4F3QA 3I4MJ 1Y8RB 1WVRA 3W6JB 4G7HF 1A6IA 1SD7A 4BDYA 2XGEA 2IJLA 1OCCH 2L5QA 2M9HA 2HR3A 4ITVA 3LNQA 3SJMA 4YIFA 1IUFA 2RV8A 3FBNB 3HSFA 4ASNA 2B63J 4ZZLA 4HV6A 2BW3B 3OV8A 4L9NA 4AIDA 4HDVA 4JKZA 4Y52J 3QYBA 5HODA 5EGOB 3HKZA 1X2MA 2ELJA 2FD5A 2VT3A 2ZJPF 1KU3A 1MNMC 2M0MA 2V1DA 1P9QC 4HA8A 1ZR4A 1ETWA 1JI8A 3I4NJ 2R7FA 4ZDOA 1Y1VJ 4I7HA 3D0SA 2LMDA 1W0UA 1UCRA 3VSKA 4YZEA 3KZIC 5FFXA 2XAFA 1R58A 2VB6A 2HKOA 2RNJA 3AG4H 3KP5A 3JW4A 1JE8A 4HNUA 2R7TA 3BLYA 1C0WA 5HLIA 4XIDA 1S9HA 3FBIB 4L62A 1ZQ3P 1ZG5A 5FLMJ 5D8KB 4YEJA 1MKMA 1YRNA 4B4CA 2ZCXA 2X48A 3D5LA 3A01A 2HGCA 3CJDA 2Q2EB 3BPXA 2JVGA 2R7XA 4F92B 1TNSA 3G56A 1U5TC 1Z3XA 2BGCA 2I5UA 4WWCA 1Z1DA 1MBEA 1BL0A 3MZ8A 1S8NA 3LSPA 4BL0B 2XF7A 4XNFA 4U88A 2L7KA 1Y1WJ 3FRQA 3DEUA 4S04A 1Z6TA 1FIPA 1VQ6I 4M3FA 2L4MA 2IP2A 2F5EA 3RKYA 2A3SA 2WBMA 5H6RA 3VWBA 5BS6A 4ZC3A 4UUVA 1TQMA 2NVTJ 2EK5A 1X58A 4AIHA 4UB6C 2FBQA 4BKXA 4UY8I 2BZTA 2PMZN 4HF0A 1QQIA 2PMZA 5BPIA 3SZPA 4ENMA 2WAQA 2JRTA 4KYWA 3Q9VA 5FROA 1WPKA 2NS7A 1ETXA 3HRSA 2B1EA 3LSMA 4BXUA 3HZJA 3QYEA 3KEQA 4PJ0C 4A12A 2FF4A 1DP7P 5LEKA 4H0EA 3OL3A 2R7DA 2CUZA 4DBQA 1XGNA 2Q0OA 4PGGA 2XPWA 4JX5A 2CO5A 2REKA 3COLA 1MD0A 2H27A 2L01A 2MD0A 1QVTA 4OAYA 1ACIA 1B8IB 3IHUA 1TT0A 1UI5A 1T98A 3ULQB 4YG2F 4G7OF 1RR8C 2M4KA 3GF2A 2LSOA 4L0YB 1WWXA 2OQGA 4PDKA 3V78A 1K78A 2MC4A 4KMUX 2XV4S 2JMWA 5B3SH 1V5EA 1AKHA 2COBA 2VJ4A 1IV6A 3KZ9A 1W1WE 2DQLA 1LDJA 3C1DA 1XSVA 2ADUA 5FKNA 2DA1A 1ETOA 3BQZA 2X6OA 2XAGA 4LJZF 2E2HJ 4GCVA 5GADJ 4EJVA 1BW6A 1LDKB 1RKWA 5HSZA 3JAMZ 1D0XA 2DDBA 1VFCA 2M8EA 2EIKH 2LTPA 4B09A 1JKPC 4ZYAA 3FMSA 5DM7F 1MMSA 2ZFWA 1V4RA 3OYKA 5FO5A 2WB1N 5A2QK 4CYCB 2QEXI 3GTGJ 3TMOA 1T38A 2CU7A 2W1OA 4QIWN 2UXPA 2ZCMA 1EH7A 4CZZA 5ILSA 4EV0A 4IHSA 2R5YA 4N0BA 3QU3A 4F91B 5IOYA 4BE1A 3KX2A 1XMKA 5CLSA 5E3NA 1K4TA 4M6VA 2HKXA 4EJTA 2M4GA 2XAQA 3CCSI 2X1DA 1JUPA 2OTLI 1G2HA 2L2OA 2EZLA 2G7HA 2EA4A 2FJI1 3OYIA 1RUOA 3HIMA 4HLXA 4ZDLA 3K9TA 3E6MA 3OYAA 3JCUC 2AXTC 4RLFA 4DOZA 3EYYA 3WTUC 2R7RA 1U8RA 3F21A 2CV1A 3C7JA 2GIZA 1N78A 2LYCA 1U3EM 2X4HA 3KPHA 2GOMA 4YFKF 2Y75A 3PUBA 2YS9A 3E6DA 5LFAA 5CXIA 2HNHA 1DP3A 3KETA 2HPIA 4HV5A 3SZGA 1ZTRA 3MAJA 4ZYEA 4IXAA 4M9XA 1USSA 3GFLA 3C07A 3HSRA 1IXRC 5LRSA 2FX0A 1X1BA 4M3GA 1VQLI 3GTJJ 3IV5A 2BBYA 2XGXA 2D2WA 2E1OA 3ZQQA 1A36A 5FD5A 1P4WA 4L9TA 5FD6A 2JQ7A 2DJIA 3H5AA 3PSIA 2WV0A 5ED4A 2LKXA 3OS0A 1FTTA 3ZP5A 3BR3A 2ZXHA 3HOYJ 5D19A 1ZGWA 3BC8A 2VBXA 5HVQC 1NTCA 3LA7A 4RLQA 4CXFA 3FK7A 1N25A 1ITYA 1ENHA 3J80K 5CVUA 1U2WA 1WJFA 3WGGA 2EZHA 4BXFA 1TWHJ 1ZYRF 4P9UA 1BI3A 3CCJI 2IS1A 4WXDA 1SD6A 5LGTA 1Q1HA 2YU3A 4JBAA 3CP8A 5DV5A 1BC7C 1AOYA 3S32A 2DA3A 3K4NA 5IYDJ 2X0LA 5IT9K 2WA0A 2XC7A 1KQ0A 2ZOYA 5K58A 5ILVA 3K7AJ 4XORA 5E1WA 1O4XA 1H89C 5ICCA 1QZEA 2G9WA 1IUYA 6PAXA 1W36C 4P9FA 3KP4A 2LDUA 5GPAA 3GFMA 2CG4A 4M73A 2JJ7A 4ZYHA 5DCMA 1U9NA 3ECHA 5HNHA 5F08A 3K4BA 5IP9J 3EUHA 4M6XA 2BY3A 4BY1J 4MIMA 1R9TJ 3FK6A 2K9NA 4MEXF 4PXIA 2DQRA 3I64A 1UHMA 5HLHA 3TL4X 1NH3A 4A2UA 3FXRA 2IA1A 5ERIA 2RQPA 3ZXSA 4NELA 5D4SA 2QSGX 2QZ8A 3ABTA 3CRJA 5CVIA 5EEHA 1KYZA 4IL6C 3W6KB 2CW8A 2DFIA 5EG0B 3TOBA 1RR7A 2KIMA 3L2QA 3G4SI 3JTHA 1HKQA 3F72A 2GM4A 5D6FA 5B66C 3PASA 2JUGA 5E3OA 5D18A 3VW0A 3BR0A 4O5VA 1RUNA 1Y56A 3OIPA 1E2XA 2ZJQF 3HGGA 2TRTA 1WJAA 2P5LC 4MNUA 2A2FX 1Y8QB 2L02A 5KCMA 2PN6A 3PUFA 4EEFG 2CV0A 1D1AA 4BE0A 4BEHA 2FOKA 4C3HJ 4D5CA 1SANA 3GWZA 4IEJA 4JOMA 3HHHA 2VL8A 3QRFF 1BI0A 3MZHA 1MMDA 1GVDA 2FOWA 4YIRX 3LSIA 1LQ1A 4RB2C 2IGKA 4BQNA 3S1RJ 2IU5A 4AD9A 2XHKA 3BNIA 3UNGC 2PLYA 2K86A 2DLLA 4A3KJ 3N97A 3VVYA 4ESJA 2VJIA 1P92A 3HOSA 2UZKA 4LLGF 2VI6A 3JR9A 1FMWA 2K40A 3BROA 3HRMA 3MKLA 1VNDA 2LK2A 3JAMK 5HS7A 1HKTA 1IGNA 3KKDA 1OYIA 2DFFA 2ISZA 2LF8A 2JA6J 3EUAA 2O03A 2K9SA 1UELB 3X2QH 2L9VA 1Z6RA 2NNNA 4C30A 4PFPA 5CJ9A 1K6OA 4V19K 2CQXA 2E1MB 3OYMA 1FLIA 3CDHA 4NQWB 1KU7A 3MZYA 2MSYA 1U78A 3ZN0A 1QZYA 2AXLA 3OR1C 3GZ5A 4CCOA 3K1PA 3FMQA 2X6YA 1NK3P 3KP2A 1FPQA 2DOEA 3AQTA 4CGRA 2G0EA 2XVCA 3BR2A 2QOPA 2GIVA 1CF7B 1VQNI 1N77A 2MBFA 2FUG2 3LSRA 2Y9YA 3HHGA 2NP5A 3FKIJ 4G7ZF 4LIUA 4BJTA 2KZGA 4ENJA 2W84A 2Z9OA 1IRGA 2HOEA 3PO3J 1R6RA 3SDBA 3JRDA 3GCMA 3ZRGA 3P9IA 3K6GA 5E79C 4Y17A 1LEBA 3K69A 3J80Z 5BMZA 4U87A 3ISPA 3GX4X 4EM0B 3WTZA 3ZGKA 4RAGA 2WY7Q 3ZMUA 2F07A 2O7TA 2BVMA 3OYDA 2Z99A 1IV8A 3TDZC 2I8DA 2XKOA 2MA3A 5GAHJ 1F1ZA 2QBYB 2FRHA 1OJLA 2F48A 2NS0A 3W2WA 3G71I 4N4OB 2VQCA 3FXOA 3GO5A 5M5WJ 3U1DA 2PJRA 3VDXA 5HS8A 4JQFA 1F36A 1G6NA 4BJ5C 4U7BA 2K9LA 2QKMB 4QPQA 2IS2A 2QWWA 2YX7A 2O0YA 1PUFA 4HF2A 5HS9A 3MFKA 2MW8A 4OD5A 1K78B 2LOOA 4A3CJ 1MBHA 4ZTJA 1ZG3A 2XDNA 3K4LA 3SEQA 3BTIA 3ROUA 5A2QZ 2R7SA 1SFXA 2K85A 2HYGD 2D45A 1R5HA 3QODA 4CDGA 1A5JA 2ZKZA 3A01B 2H8WA 5K7FA 3W3CA 3VB2A 3JSPA 4PGHA 4Y33A 3O60A 1BI2A 3QQAA 1S6LA 2F5DA 1LE8B 1TZLA 1I27A 1X1DA 4L9VA 1P4AA 4DNCA 2H94A 3HXLA 3H3VK 1OCOH 4OOIA 1LFBA 2OZ6A 3PO2J 4M3BA 3DBLB 2KJBA 1YE9A 1W7PA 3PIPF 1H9TA 2D5VA 1F5TA 5TRDA 2GA1A 4LMYA 2HDCA 5CVRA 1YX5A 5JVTA 1AKHB 4KJZA 1WI9A 1RIOH 2H6BA 1UHWA 4CUGA 1SEUA 2BXYA 2QYOA 4Z6YA 2M7AA 3IWFA 1J7KA 1Z67A 2OBPA 4G6TB 2DYSH 2H6CA 4EM1A 2QENA 3WTYC 2ZCWA 5F6FA 4A3FJ 3F1BA 3MKWB 2CJJA 1UZCA 2Y69H 1SVLA 3BG5A 5KAIC 2FBIA 4B1RA 1YIOA 2V9VA 3PNVA 2IEKA 3BT9A 2I10A 5FGLA 2FNPA 2O7OA 2V1NA 2JA5J 4ZZDA 1HSTA 1F9NA 2VONA 1I1GA 1FIAA 2NVYJ 3C2BA 2VC1A 4D7MA 2X6XA 4I6ZA 5C4JJ 1I50J 3J81Z 3U2RA 3GZ6A 1D0YA 1Z0XA 1XC5A 4Y4RA 1TBXA 1I6XA 3ZOBA 3VIBA 3AG1H 2WAQN 3LAJA 2FNAA 1UG0A 1E17A 3PNYA 3V6GA 1G3YA 2B3WA 2QM3A 2KKOA 3SZTA 2CQ7A 2KZVA 3OWTA 3H35A 2MH2A 2CQQA 5F1JA 3BDDA 4CCLA 1YIJI 5F04A 4D7NA 5KNLA 2DA7A 2EFQA 1IJWC 3A4CA 1ODDA 3CCYA 3DXJF 4JX4A 4PUSA 5J3LA 3TOAA 3O8HA 2Z2SB 3TP3A 1H9GA 1B8IA 1MGTA 1TQIA 3QP5A 4P5OA 4XOTA 2KP6A 3QWLA 1TWGJ 1TWCJ 3F3XA 3O6BB 3GFIA 3DPUA 1X4OA 4AVPA 4ICHA 3IH4A 1KYWA 5AIQA 1R7JA 3CCMI 2DT6A 2CW7A 1A35A 1QPIA 1KA8A 3HEFA 2YVEA 3KZYA 4GFKA 2HOAA 3ON4A 2JT1A 3GTKJ 2L4AA 3HUGA 3QOEA 1LFUP 4XRFA 3CQZJ 2HZDA 4E7IA 2RKHA 3CC2I 2KIFA 2XF6A 4ZDPA 3AQSA 2GUHA 4A93J 3FDYA 5FKKA 2Z3YA 4E6KG 4KIFA 3VYRB 1OCRH 3RPUD 1OISA 3M07A 4LITA 1IN7A 2E2JJ 4A3IJ 1O7FA 2G3BA 5EEGA 3A1YA 1OCZH 3BY6A 3FXLA 5LBQA 3OS2A 1D8JA 2FBKA 1P7JA 4M6YA 1PDNC 4EJWA 3E7LA 4OU0A 1GDTA 2DG7A 5J47A 5EDNA 2GZWA 5M5YJ 4PSWA 2MYSA 5FRMA 2A61A 1ON1A 1DGRM 4FE4A 2FXAA 5EF6A 2BY1A 1K79A 1XS9A 4YFXF 1TWFJ 2CUEA 2J5PA 3F6VA 2K9QA 3ZQGA 5DS9A 2MABA 3QPTA 4GXOA 3M4OJ 3J7AY 1E3PA 3OOPA 3F6OA 1DQUA 4ZYDA 1IRXA 2JSPA 2JSCA 3QP6A 4UV9A 1XTAA 1XX5A 2LP0A 3WTSC 1YO5C 2ICWG 3DBHB 3FIWA 4BDZA 1UI6A 3Q0WA 3H3UA 1ZGJA 2EFOA 2EFPA 5LHHA 5EG0A 3L2RA 1B9NA 5EFYA 1XMAA 4UXNA 5CQGA 3S8PA 1JKRC 4A5MA 3EYIA 2J5OA 1BR2A 3ELKA 4IHXA 1LFPA 4FCYA 2A05A 3ABLH 5IYCJ 4CZCA 2DYRH 4U7DA 2YX4A 3E7QA 4EJOA 2KRCA 3HOTA 2E7XA 3VOEA 1FP1D 4PJMA 4LK0F 3BZKA 2HQAA 4GCKA 2RASA 1OYYA 3JRFA 3M8JA 4HLYA 2DMPA 2TCTA 1WJ5A 4AC0A 1TTYA 3PM1A 1YHQI 2XAJA 4LOCA 3NRVA 4ENKA 3LMMA 3B73A 3K4KA 4R8HA 4Y7NJ 3DTKA 1U5TB 4XR6A 3K4CA 3LSHA 5LHIA 5F1RA 1IDYA 3OYHA 2N8GA 4U0WA 3VUQA 3ZQIA 3DKYA 4L5EA 4HEA2 1X3ZB 2O5RA 2ZNYA 1YJ9I 1RNLA 2ZJ2A 4DIQA 3QAHA 3G1OA 3CDLA 1HC8A 1XB4A 2NVUB 1MIJA 1IXSB 2OI8A 3LHQA 1GUUA 3S1QJ 4W1UA 3O8GA 4IOAF 3HOWJ 4GCTA 2BV6A 2UV1A 5L3BA 4XLAA 5HLTA 2QWTA
chains in the Genus database with same CATH topology
2Y31A 1XG1A 1P7IA 2G7SA 3G1MA 1NTCA 2HI3A 4AF5A 3FK7A 4JL3A 5M5XJ 2Y30A 3GTMJ 1ITYA 1ENHA 1RETA 2DMUA 2EZHA 1TWHJ 1IRZA 3OSGA 4FTHA 1FJLA 4UUSB 2DA3A 1Z77A 4A3LJ 5IYDJ 2ZOYA 5K58A 3HKZN 5FHPA 2GENA 1MSEC 4MXMA 2JN6A 3K7AJ 1O4XA 2NX4A 3SFIA 1H89C 3BJBA 3P9TA 2ZCNA 4UUSA 5E3LA 1EF4A 1CQTA 2HYTA 5GPAA 4BXXJ 1PUFB 4JNNA 2JJ7A 4M3EA 1U9NA 3EGQA 4XRSA 5F08A 3M3YJ 5IP9J 2L0KA 3RZOJ 1JT6A 3S1NJ 1JT0A 4BY1J 1MBKA 4A69C 3MVPA 1MH3A 4MIMA 2QIBA 2R0QC 1R9TJ 3FK6A 2K9NA 3HOZJ 3TEDA 4PXIA 5C3EJ 3LSGA 3S15J 2ME6A 3EUPA 1RKTA 2YUSA 2Y9ZA 3LJLA 2MGQA 5FLVA 2L7FP 3HB9A 4NELA 2M2EA 2VPRA 3NARA 1F43A 3HBLA 3CRJA 1ZK8A 4KWAA 2NVQJ 2M34A 1JJ6C 5EG0B 1MBGA 1RR7A 5DTDA 2LR8A 1MH4A 1WI3A 2CRGA 2Y0SN 3NXCA 2IBDA 2GM4A 4ME9A 3HGYA 2ID3A 3VW1A 3GTPJ 1U9OA 3HDDA 3PASA 4ACIA 5E3OA 5D18A 3VW0A 1MSFC 1ZR2A 3GZIA 3BR0A 4B3AA 1QRYA 4IHWA 2ZOZA 3HGGA 2TRTA 3CWRA 3HE0A 2LVSA 1S7EA 2UXHA 2E19A 1W0TA 4EEFG 3NRGA 2DMTA 2ME0A 4C3HJ 4D5CA 1U8BA 1HDDC 5DAJA 4W97A 1SANA 2DMQA 3TW7A 2KT0A 4IEJA 3RZDJ 4DYRA 1I6HJ 1SGMA 3A02A 2EBIA 3DEWA 4XRSG 2RHAA 3TP0A 1UHSA 2QCOA 2LLKA 1K61A 1GVDA 3G7RA 4V2FA 2LY9A 4RBOA 3SDGA 4MFDA 2XGDA 2E2IJ 3UKGA 2R5ZA 3NAUA 1IDZA 3S1RJ 2DJNA 2IU5A 2Q24A 3BNIA 3S2HJ 1AHDP 3BQYA 2VKEA 4A3KJ 1JTXA 3BHQA 3VVYA 2L9RA 2ID6A 2ECBA 3VVXA 2VI6A 2PBXA 3VP5A 3JR9A 2K40A 3LSJA 3MKLA 3VVZA 1I3QJ 1VNDA 2EZIA 2LK2A 5IOZA 1JGGA 2Y2ZA 1IGNA 5CXGA 3KKDA 3HTIA 1SFOJ 2JA6J 2K9SA 2HQ5A 4AYBN 4X6AJ 1JKQC 4AC6A 3OOUA 5D1RA 1VI0A 2CQXA 2WV1A 3OIOA 1H88C 2HXIA 3NI7A 2MSYA 1U78A 1D5YA 3PPBA 3DCFA 3LWJA 1TWAJ 4ABZA 3S14J 2L7MP 2QKOA 1WH5A 2NS8A 2UXIA 4RDUA 3RKQA 1NK3P 5J1UA 4CGRA 3AQTA 2XPVA 1BW5A 2G0EA 3BR2A 4FE7A 3WHCA 5IYBJ 2QOPA 4HNVA 4GFBA 3LSRA 2Y9YA 2NP5A 3BG9A 3FKIJ 4MFEA 5F27A 3JRCA 3IH3A 1WGXA 3ZQLA 4IHYA 3BTCA 2NP3A 3PO3J 3DPJA 5FKLA 3B6AA 3JRDA 3HTJA 3WHBA 2PZ9A 3S5RA 1YRNB 5EYRA 5IP7J 4MK6A 5C4YA 1ETQA 1UMQA 3RD3A 1QVUA 3HTHA 2YU9J 2F07A 2O7TA 4G12A 2R5YB 3BCGA 4A3GJ 1OCPA 2OERA 4DYQA 2AO9A 1JUMA 5BNGA 2H1KA 3HOXJ 3BTJA 5C4XJ 2X9DA 1OJLA 1FEXA 2GFNA 3RQIA 5J1YA 3JRHA 5M5WJ 2ZB9A 3VOXA 2ELKA 3Q0UA 3QPLA 5EZHA 2QTQA 5FKMA 1F36A 1VF9A 2LD5A 2QF7A 3HTAA 2O9LA 3MNLA 5F0HA 4BBSJ 1PUFA 4GFLA 4X1EA 5IP6A 2DA6A 4A3BJ 2MW8A 4JYKA 4A3CJ 1MBHA 3S16J 4FISA 3QKXA 2XRLA 3ZQCA 2XDNA 2M8GX 3NPIA 3BTIA 4DZJA 4A3JJ 4GCLA 1TC3C 1UG2A 1MBFA 1T56A 1RPWA 4MLOA 2UXOA 2EZKA 1A5JA 3A01B 5K7FA 5HBUA 2FQ4A 1T33A 3O60A 2P81A 3QQAA 3JREA 4NN1A 1AU7A 1LE8B 1MBJA 3JRAA 1OFCX 2W53A 2YVHA 2WGBA 4M3DA 3HOUJ 3H3VK 2XB0X 1LFBA 3GBGA 2AHQA 3PO2J 4M3BA 4CYCA 2D5VA 5E3MA 2LFBA 2D6YA 3JRIA 1LE8A 3I4MJ 1A6IA 5CW8A 4XICA 2XGEA 1AKHB 4HKUA 1GT0C 2HKUA 2OPTA 2M9HA 3LNQA 5M3FJ 4XRMA 5EGOA 3SJMA 1IUFA 3Q0VA 5K7HA 2HOSA 2B63J 4JKZA 4Y52J 2HYJA 5HODA 5EGOB 1ETYA 2KDZA 2DA2A 1X2MA 2EQRA 2FD5A 1MNMC 5IPAA 4A3FJ 3F1BA 2DA5A 3QBMA 2CJJA 1ORKA 1ZR4A 1ETWA 4A3DJ 3I4NJ 4D5FA 3BG5A 1Y1VJ 2WUIA 4B1RA 3Q3SA 2IEKA 1W0UA 3BT9A 2I10A 4I76A 5FGLA 2O7OA 4YZEA 1IC8A 2JA5J 3GEUA 5JLXA 1FIAA 2NVYJ 3C2BA 1ZKGA 4C3JJ 4D7MA 4I6ZA 3JRGA 2RAEA 4XIDA 1I50J 5C4JJ 1Z0XA 4L62A 5F0FA 1XC5A 1ZQ3P 2ECCA 1FTZA 2DA4A 2M0CA 5FLMJ 3ZOBA 3VIBA 4V2GA 2O8KA 2WAQN 3D1NI 3MN2A 2XB5A 5M3MJ 3A03A 1YRNA 4B4CA 1GV5A 2ZCXA 3V6GA 3IUVA 2X48A 3A01A 2CUFA 3TW6A 4J19A 3CJDA 9ANTA 4AUXA 5F1JA 2CQQA 5C44J 5J1RA 5HAWA 3G56A 2R7ZJ 5F04A 2OF7A 4D7NA 5EEAA 2DA7A 4UDSA 1IJWC 3BR1A 1MBEA 1X2NA 3B6CA 1BL0A 1JJ8C 5J3LA 3CCYA 4JX4A 3LSPA 1Y1WJ 3FRQA 3O8HA 2FJ1A 2IAIA 1FIPA 3BR5A 3TP3A 2L7ZA 3CMYA 3H0GJ 3G1LA 4M3FA 1B8IA 3VOKA 2XPUA 2G7GA 1TWGJ 1TWCJ 3HOVJ 1OCTC 1RESA 4ICHA 3IH4A 4DW6A 2NVTJ 1E3OC 1APLC 1X58A 3QPSA 2FBQA 4BY7J 4BKXA 2DMNA 1QPIA 2PMZN 3HEFA 3F0CA 1BA5A 2YVEA 1POGA 2DN0A 1DU6A 4GFKA 2HOAA 3LOCA 4QSHA 3ON4A 3GTKJ 4XK4A 4UUTA 3T6NA 1LFUP 3BTLA 1WPKA 2NS7A 3CQZJ 1ETXA 1WCMJ 4BBRJ 3KNWA 3AQSA 2GUHA 3JRBA 4A93J 4DYCA 5FKKA 2UXUA 3B81A 2E2JJ 4A3IJ 2W48A 1H8AC 5FKOA 2XPWA 3ZQFA 4JX5A 2REKA 3S2DJ 2G3BA 3COLA 2NVXJ 5GP9A 5JLWA 1P7JA 1QVTA 3NNRA 3E7LA 2R93J 1GDTA 1B8IB 1UI5A 5H9TA 2DG7A 3VW2A 5EDNA 5GPCA 5M5YJ 1GV2A 2DG8A 5AQCA 5FJ8J 3V78A 4FE4A 4IHVA 2JMWA 5EF6A 1HF0A 3S1MJ 1XS9A 1AKHA 3BRUA 4C3IJ 2COBA 1IV6A 3KZ9A 1TWFJ 2CUEA 5DS9A 2K9QA 3ZQGA 2MG4A 5FKNA 3M4OJ 2DA1A 3BR6A 1ETOA 3BQZA 1HCRA 2X6OA 2XGCA 3BG3A 4JP0A 2E2HJ 3S17J 3ZQHA 2LP0A 1HLVA 4S0HB 1Q1VA 1JUSA 1BW6A 3K2AA 1RKWA 3JSJA 5HSZA 3FIWA 3HM5A 1UI6A 3Q0WA 1VFCA 1NK2P 2DTZA 1JKOC 2LTPA 1JKPC 1HDPA 5EG0A 1WH7A 5EFYA 4A3EJ 5F0CA 4CYCB 2WB1N 1JKRC 1DU0A 2R92J 2JA7J 3GTGJ 2CU7A 4QIWN 2NOGA 2UXPA 1B72B 2ZCMA 4IHXA 4FCYA 2H8RA 2R5YA 5IYCJ 5IOYA 4DZPA 3VPRA 3E7QA 5E3NA 2XSDC 1ETKA 5FMPA 4M6VA 1HOMA 5K7ZA 2HDDA 2VUMJ 3L1PA 4MO7A 1JUPA 1G2HA 2R5ZB 4GCKA 2RASA 2EZLA 2HXOA 3JRFA 2V57A 2DMPA 2TCTA 3ANPA 3HIMA 2G7LA 4AC0A 3PM1A 2GLOA 4C2MJ 3ANGA 4LOCA 2EH3A 2HOTA 4Y7NJ 1IG7A 2GBYA 3IH2A 2YS9A 5CXIA 1IDYA 4NDLA 3RH2A 1ETVA 2N8GA 3VUQA 1JTYA 3ZQIA 4JX6A 1ZTRA 4L5EA 3C07A 3W6VA 2JA8J 3G1OA 3CDLA 4A3MJ 3KKCA 3FISA 2FX0A 4QTRA 3GTQJ 4M3GA 1B72A 1BJZA 2OI8A 3GTJJ 3IV5A 3LHQA 1GUUA 3GTOJ 3S1QJ 4W1UA 2E1OA 3O8GA 3HOWJ 3ON2A 3GTLJ 4GCTA 3OSFA 2JK3A 5EZGA 2LKXA 1K83J 1FTTA 3BR3A 2JWTA 3HOYJ 5D19A 2VKVA 1ZGWA 2QWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y31 A;  1XG1 A;  1P7I A;  2G7S A;  3G1M A;  1NTC A;  2HI3 A;  4AF5 A;  3FK7 A;  4JL3 A;  5M5X J;  2Y30 A;  3GTM J;  1ITY A;  1ENH A;  1RET A;  2DMU A;  2EZH A;  1TWH J;  1IRZ A;  3OSG A;  4FTH A;  1FJL A;  4UUS B;  2DA3 A;  1Z77 A;  4A3L J;  5IYD J;  2ZOY A;  5K58 A;  3HKZ N;  5FHP A;  2GEN A;  1MSE C;  4MXM A;  2JN6 A;  3K7A J;  1O4X A;  2NX4 A;  3SFI A;  1H89 C;  3BJB A;  3P9T A;  2ZCN A;  4UUS A;  5E3L A;  1EF4 A;  1CQT A;  2HYT A;  5GPA A;  4BXX J;  1PUF B;  4JNN A;  2JJ7 A;  4M3E A;  1U9N A;  3EGQ A;  4XRS A;  5F08 A;  3M3Y J;  5IP9 J;  2L0K A;  3RZO J;  1JT6 A;  3S1N J;  1JT0 A;  4BY1 J;  1MBK A;  4A69 C;  3MVP A;  1MH3 A;  4MIM A;  2QIB A;  2R0Q C;  1R9T J;  3FK6 A;  2K9N A;  3HOZ J;  3TED A;  4PXI A;  5C3E J;  3LSG A;  3S15 J;  2ME6 A;  3EUP A;  1RKT A;  2YUS A;  2Y9Z A;  3LJL A;  2MGQ A;  5FLV A;  2L7F P;  3HB9 A;  4NEL A;  2M2E A;  2VPR A;  3NAR A;  1F43 A;  3HBL A;  3CRJ A;  1ZK8 A;  4KWA A;  2NVQ J;  2M34 A;  1JJ6 C;  5EG0 B;  1MBG A;  1RR7 A;  5DTD A;  2LR8 A;  1MH4 A;  1WI3 A;  2CRG A;  2Y0S N;  3NXC A;  2IBD A;  2GM4 A;  4ME9 A;  3HGY A;  2ID3 A;  3VW1 A;  3GTP J;  1U9O A;  3HDD A;  3PAS A;  4ACI A;  5E3O A;  5D18 A;  3VW0 A;  1MSF C;  1ZR2 A;  3GZI A;  3BR0 A;  4B3A A;  1QRY A;  4IHW A;  2ZOZ A;  3HGG A;  2TRT A;  3CWR A;  3HE0 A;  2LVS A;  1S7E A;  2UXH A;  2E19 A;  1W0T A;  4EEF G;  3NRG A;  2DMT A;  2ME0 A;  4C3H J;  4D5C A;  1U8B A;  1HDD C;  5DAJ A;  4W97 A;  1SAN A;  2DMQ A;  3TW7 A;  2KT0 A;  4IEJ A;  3RZD J;  4DYR A;  1I6H J;  1SGM A;  3A02 A;  2EBI A;  3DEW A;  4XRS G;  2RHA A;  3TP0 A;  1UHS A;  2QCO A;  2LLK A;  1K61 A;  1GVD A;  3G7R A;  4V2F A;  2LY9 A;  4RBO A;  3SDG A;  4MFD A;  2XGD A;  2E2I J;  3UKG A;  2R5Z A;  3NAU A;  1IDZ A;  3S1R J;  2DJN A;  2IU5 A;  2Q24 A;  3BNI A;  3S2H J;  1AHD P;  3BQY A;  2VKE A;  4A3K J;  1JTX A;  3BHQ A;  3VVY A;  2L9R A;  2ID6 A;  2ECB A;  3VVX A;  2VI6 A;  2PBX A;  3VP5 A;  3JR9 A;  2K40 A;  3LSJ A;  3MKL A;  3VVZ A;  1I3Q J;  1VND A;  2EZI A;  2LK2 A;  5IOZ A;  1JGG A;  2Y2Z A;  1IGN A;  5CXG A;  3KKD A;  3HTI A;  1SFO J;  2JA6 J;  2K9S A;  2HQ5 A;  4AYB N;  4X6A J;  1JKQ C;  4AC6 A;  3OOU A;  5D1R A;  1VI0 A;  2CQX A;  2WV1 A;  3OIO A;  1H88 C;  2HXI A;  3NI7 A;  2MSY A;  1U78 A;  1D5Y A;  3PPB A;  3DCF A;  3LWJ A;  1TWA J;  4ABZ A;  3S14 J;  2L7M P;  2QKO A;  1WH5 A;  2NS8 A;  2UXI A;  4RDU A;  3RKQ A;  1NK3 P;  5J1U A;  4CGR A;  3AQT A;  2XPV A;  1BW5 A;  2G0E A;  3BR2 A;  4FE7 A;  3WHC A;  5IYB J;  2QOP A;  4HNV A;  4GFB A;  3LSR A;  2Y9Y A;  2NP5 A;  3BG9 A;  3FKI J;  4MFE A;  5F27 A;  3JRC A;  3IH3 A;  1WGX A;  3ZQL A;  4IHY A;  3BTC A;  2NP3 A;  3PO3 J;  3DPJ A;  5FKL A;  3B6A A;  3JRD A;  3HTJ A;  3WHB A;  2PZ9 A;  3S5R A;  1YRN B;  5EYR A;  5IP7 J;  4MK6 A;  5C4Y A;  1ETQ A;  1UMQ A;  3RD3 A;  1QVU A;  3HTH A;  2YU9 J;  2F07 A;  2O7T A;  4G12 A;  2R5Y B;  3BCG A;  4A3G J;  1OCP A;  2OER A;  4DYQ A;  2AO9 A;  1JUM A;  5BNG A;  2H1K A;  3HOX J;  3BTJ A;  5C4X J;  2X9D A;  1OJL A;  1FEX A;  2GFN A;  3RQI A;  5J1Y A;  3JRH A;  5M5W J;  2ZB9 A;  3VOX A;  2ELK A;  3Q0U A;  3QPL A;  5EZH A;  2QTQ A;  5FKM A;  1F36 A;  1VF9 A;  2LD5 A;  2QF7 A;  3HTA A;  2O9L A;  3MNL A;  5F0H A;  4BBS J;  1PUF A;  4GFL A;  4X1E A;  5IP6 A;  2DA6 A;  4A3B J;  2MW8 A;  4JYK A;  4A3C J;  1MBH A;  3S16 J;  4FIS A;  3QKX A;  2XRL A;  3ZQC A;  2XDN A;  2M8G X;  3NPI A;  3BTI A;  4DZJ A;  4A3J J;  4GCL A;  1TC3 C;  1UG2 A;  1MBF A;  1T56 A;  1RPW A;  4MLO A;  2UXO A;  2EZK A;  1A5J A;  3A01 B;  5K7F A;  5HBU A;  2FQ4 A;  1T33 A;  3O60 A;  2P81 A;  3QQA A;  3JRE A;  4NN1 A;  1AU7 A;  1LE8 B;  1MBJ A;  3JRA A;  1OFC X;  2W53 A;  2YVH A;  2WGB A;  4M3D A;  3HOU J;  3H3V K;  2XB0 X;  1LFB A;  3GBG A;  2AHQ A;  3PO2 J;  4M3B A;  4CYC A;  2D5V A;  5E3M A;  2LFB A;  2D6Y A;  3JRI A;  1LE8 A;  3I4M J;  1A6I A;  5CW8 A;  4XIC A;  2XGE A;  1AKH B;  4HKU A;  1GT0 C;  2HKU A;  2OPT A;  2M9H A;  3LNQ A;  5M3F J;  4XRM A;  5EGO A;  3SJM A;  1IUF A;  3Q0V A;  5K7H A;  2HOS A;  2B63 J;  4JKZ A;  4Y52 J;  2HYJ A;  5HOD A;  5EGO B;  1ETY A;  2KDZ A;  2DA2 A;  1X2M A;  2EQR A;  2FD5 A;  1MNM C;  5IPA A;  4A3F J;  3F1B A;  2DA5 A;  3QBM A;  2CJJ A;  1ORK A;  1ZR4 A;  1ETW A;  4A3D J;  3I4N J;  4D5F A;  3BG5 A;  1Y1V J;  2WUI A;  4B1R A;  3Q3S A;  2IEK A;  1W0U A;  3BT9 A;  2I10 A;  4I76 A;  5FGL A;  2O7O A;  4YZE A;  1IC8 A;  2JA5 J;  3GEU A;  5JLX A;  1FIA A;  2NVY J;  3C2B A;  1ZKG A;  4C3J J;  4D7M A;  4I6Z A;  3JRG A;  2RAE A;  4XID A;  1I50 J;  5C4J J;  1Z0X A;  4L62 A;  5F0F A;  1XC5 A;  1ZQ3 P;  2ECC A;  1FTZ A;  2DA4 A;  2M0C A;  5FLM J;  3ZOB A;  3VIB A;  4V2G A;  2O8K A;  2WAQ N;  3D1N I;  3MN2 A;  2XB5 A;  5M3M J;  3A03 A;  1YRN A;  4B4C A;  1GV5 A;  2ZCX A;  3V6G A;  3IUV A;  2X48 A;  3A01 A;  2CUF A;  3TW6 A;  4J19 A;  3CJD A;  9ANT A;  4AUX A;  5F1J A;  2CQQ A;  5C44 J;  5J1R A;  5HAW A;  3G56 A;  2R7Z J;  5F04 A;  2OF7 A;  4D7N A;  5EEA A;  2DA7 A;  4UDS A;  1IJW C;  3BR1 A;  1MBE A;  1X2N A;  3B6C A;  1BL0 A;  1JJ8 C;  5J3L A;  3CCY A;  4JX4 A;  3LSP A;  1Y1W J;  3FRQ A;  3O8H A;  2FJ1 A;  2IAI A;  1FIP A;  3BR5 A;  3TP3 A;  2L7Z A;  3CMY A;  3H0G J;  3G1L A;  4M3F A;  1B8I A;  3VOK A;  2XPU A;  2G7G A;  1TWG J;  1TWC J;  3HOV J;  1OCT C;  1RES A;  4ICH A;  3IH4 A;  4DW6 A;  2NVT J;  1E3O C;  1APL C;  1X58 A;  3QPS A;  2FBQ A;  4BY7 J;  4BKX A;  2DMN A;  1QPI A;  2PMZ N;  3HEF A;  3F0C A;  1BA5 A;  2YVE A;  1POG A;  2DN0 A;  1DU6 A;  4GFK A;  2HOA A;  3LOC A;  4QSH A;  3ON4 A;  3GTK J;  4XK4 A;  4UUT A;  3T6N A;  1LFU P;  3BTL A;  1WPK A;  2NS7 A;  3CQZ J;  1ETX A;  1WCM J;  4BBR J;  3KNW A;  3AQS A;  2GUH A;  3JRB A;  4A93 J;  4DYC A;  5FKK A;  2UXU A;  3B81 A;  2E2J J;  4A3I J;  2W48 A;  1H8A C;  5FKO A;  2XPW A;  3ZQF A;  4JX5 A;  2REK A;  3S2D J;  2G3B A;  3COL A;  2NVX J;  5GP9 A;  5JLW A;  1P7J A;  1QVT A;  3NNR A;  3E7L A;  2R93 J;  1GDT A;  1B8I B;  1UI5 A;  5H9T A;  2DG7 A;  3VW2 A;  5EDN A;  5GPC A;  5M5Y J;  1GV2 A;  2DG8 A;  5AQC A;  5FJ8 J;  3V78 A;  4FE4 A;  4IHV A;  2JMW A;  5EF6 A;  1HF0 A;  3S1M J;  1XS9 A;  1AKH A;  3BRU A;  4C3I J;  2COB A;  1IV6 A;  3KZ9 A;  1TWF J;  2CUE A;  5DS9 A;  2K9Q A;  3ZQG A;  2MG4 A;  5FKN A;  3M4O J;  2DA1 A;  3BR6 A;  1ETO A;  3BQZ A;  1HCR A;  2X6O A;  2XGC A;  3BG3 A;  4JP0 A;  2E2H J;  3S17 J;  3ZQH A;  2LP0 A;  1HLV A;  4S0H B;  1Q1V A;  1JUS A;  1BW6 A;  3K2A A;  1RKW A;  3JSJ A;  5HSZ A;  3FIW A;  3HM5 A;  1UI6 A;  3Q0W A;  1VFC A;  1NK2 P;  2DTZ A;  1JKO C;  2LTP A;  1JKP C;  1HDP A;  5EG0 A;  1WH7 A;  5EFY A;  4A3E J;  5F0C A;  4CYC B;  2WB1 N;  1JKR C;  1DU0 A;  2R92 J;  2JA7 J;  3GTG J;  2CU7 A;  4QIW N;  2NOG A;  2UXP A;  1B72 B;  2ZCM A;  4IHX A;  4FCY A;  2H8R A;  2R5Y A;  5IYC J;  5IOY A;  4DZP A;  3VPR A;  3E7Q A;  5E3N A;  2XSD C;  1ETK A;  5FMP A;  4M6V A;  1HOM A;  5K7Z A;  2HDD A;  2VUM J;  3L1P A;  4MO7 A;  1JUP A;  1G2H A;  2R5Z B;  4GCK A;  2RAS A;  2EZL A;  2HXO A;  3JRF A;  2V57 A;  2DMP A;  2TCT A;  3ANP A;  3HIM A;  2G7L A;  4AC0 A;  3PM1 A;  2GLO A;  4C2M J;  3ANG A;  4LOC A;  2EH3 A;  2HOT A;  4Y7N J;  1IG7 A;  2GBY A;  3IH2 A;  2YS9 A;  5CXI A;  1IDY A;  4NDL A;  3RH2 A;  1ETV A;  2N8G A;  3VUQ A;  1JTY A;  3ZQI A;  4JX6 A;  1ZTR A;  4L5E A;  3C07 A;  3W6V A;  2JA8 J;  3G1O A;  3CDL A;  4A3M J;  3KKC A;  3FIS A;  2FX0 A;  4QTR A;  3GTQ J;  4M3G A;  1B72 A;  1BJZ A;  2OI8 A;  3GTJ J;  3IV5 A;  3LHQ A;  1GUU A;  3GTO J;  3S1Q J;  4W1U A;  2E1O A;  3O8G A;  3HOW J;  3ON2 A;  3GTL J;  4GCT A;  3OSF A;  2JK3 A;  5EZG A;  2LKX A;  1K83 J;  1FTT A;  3BR3 A;  2JWT A;  3HOY J;  5D19 A;  2VKV A;  1ZGW A;  2QWT A; 
#chains in the Genus database with same CATH topology
 1ZAO A;  1BR4 A;  2FML A;  3QYF A;  1XDU A;  1BC8 C;  5JHF A;  4CIC A;  4XON A;  1IF1 A;  1VQK I;  3FKJ A;  3GTM J;  1EJ9 A;  1RET A;  3M1C A;  4II3 A;  4LK1 F;  1ERD A;  1QHG A;  1IRZ A;  1YS7 A;  4FTH A;  4XN3 A;  1MJB A;  2VOD A;  1QZZ A;  4GDF A;  5DUI A;  1T95 A;  2RN7 A;  4DBR A;  1Z77 A;  4A3L J;  3VOD A;  2E36 A;  1S29 A;  3HKZ N;  4LG0 A;  4OMY A;  1QO0 D;  2AQE A;  4LD5 A;  1S7A A;  2OA4 A;  3GXO A;  1L3L A;  2NX4 A;  2Z33 A;  4BQQ A;  4UUS A;  4J00 A;  3FXJ A;  3RDI A;  1G3T A;  1MDM A;  2FQ3 A;  2XIG A;  4LLN A;  3K2Z A;  3PFY A;  2CV2 A;  5E17 F;  1WZ2 A;  4JNN A;  2VBY A;  4XKW A;  4M3E A;  3N4M A;  1PVE A;  2L0K A;  1LJ9 A;  4M71 A;  1JT6 A;  1XSX A;  3UR3 C;  1JT0 A;  1CGP A;  4HQM A;  1V55 H;  3W2A A;  3MVP A;  4TV7 A;  1U6G A;  2CQN A;  3SYT A;  3LSG A;  3CC4 I;  2ME6 A;  1TNT A;  2KPM A;  3SXY A;  3BCA A;  2DW4 A;  2V26 A;  3H5N A;  3OYB A;  2WTE A;  1RZ4 A;  3LJL A;  1LKX A;  5FLV A;  3I0T A;  4RAZ A;  3DTI A;  1F43 A;  4KN7 X;  3VSL A;  4C2T A;  2E5Z A;  4KWA A;  1N75 A;  3FXK A;  2NVQ J;  3R6S A;  1IXC A;  2IW5 A;  3KE2 A;  3F23 A;  1YG2 A;  2Y0S A;  1JJ6 C;  3PQJ A;  4OIO F;  2LR8 A;  1MH4 A;  2CRG A;  3NXC A;  2Y0S N;  1BOA A;  2A6H F;  1YFH A;  4ME9 A;  3HGY A;  1AWC A;  3GTP J;  1U9O A;  3HDD A;  2DAO A;  3S3O A;  2OCE A;  3OYJ A;  1P2F A;  2ZOZ A;  1W4M A;  4AVZ A;  4D9J A;  2UXH A;  2O6G E;  3E3V A;  3QPH A;  2E19 A;  1RC9 A;  1W0T A;  1S5L C;  3HPG A;  3VYT B;  2ME0 A;  3ABU A;  1HDD C;  2ZC2 A;  3CME I;  4E7K A;  2DMQ A;  4XKV A;  3RZD J;  4DYR A;  2QQ9 A;  1FY7 A;  1WFX A;  3MQ0 A;  3A02 A;  2QSH X;  1UHS A;  1WQ2 A;  4AWX B;  1Z7U A;  2LLK A;  2DDA A;  4RBO A;  3MEX A;  3SDG A;  1QA6 A;  1H0M A;  3UKG A;  1I3A A;  2Z5U A;  3WG7 H;  2DJN A;  4XM3 A;  2VQL A;  4LG3 A;  3BQY A;  1ZRE A;  2VKE A;  4UNO A;  1DGW Y;  3IUO A;  2WAF A;  3KYD B;  2VPL A;  3AL0 B;  2ECB A;  2ID6 A;  4WK8 F;  2GA2 A;  3PQK A;  5L3D A;  1ZRC A;  2PBX A;  4KFC A;  3CD6 I;  3LSJ A;  3VVZ A;  1JGG A;  2EZI A;  5IY5 H;  2Y2Z A;  5IT9 Z;  3K1M A;  4IVN A;  3TO6 A;  2P0W A;  2LC2 A;  5D5W B;  1KU2 A;  4MEY F;  4X6A J;  4RGS A;  2PFB A;  1X3U A;  2DCE A;  2COM A;  3NS4 A;  5D1R A;  1S3J A;  1VI0 A;  1UST A;  3VEP A;  2IA2 A;  3DEE A;  4CHU A;  1H88 C;  1PJR A;  5DYM A;  2HXI A;  2QQ8 A;  3CZ6 A;  1KQ9 A;  1D5Y A;  2DOD A;  4HG2 A;  5DDG A;  4HOB A;  3OY9 A;  1J09 A;  1R23 A;  1XGO A;  2M7B A;  2Q1Z B;  3DLA A;  4B44 A;  4ABZ A;  3CP2 A;  1FX7 A;  2UUZ A;  3KFW X;  4RDU A;  4XBF A;  4D1Q A;  2HPM A;  2UXI A;  4FQG A;  1X4P A;  2EFN A;  1W5C C;  3RQ4 A;  1JXS A;  1FSE A;  2F5C A;  4RB1 A;  3WHC A;  4FX4 A;  4HNV A;  3HL2 A;  4GFB A;  2KIS A;  3JRC A;  1R4M B;  1WGX A;  1Z7L A;  2GWR A;  2VIX A;  3BP8 A;  3IH3 A;  3BTC A;  2QSF X;  5DUK A;  3ZN1 A;  5J6X A;  3L2U A;  2XAU A;  3G6E I;  4U9L A;  1YJN I;  2PQ8 A;  4E7S A;  2HEO A;  5H2F C;  4UV8 A;  5EYR A;  5IP7 J;  2B9S A;  1X1C A;  2FBH A;  1UMQ A;  4NC6 A;  4A0X A;  1WKM A;  1VQM I;  1FBQ A;  3TDU C;  2HFH A;  4G12 A;  3BCG A;  1T0F A;  3HTU A;  1OCP A;  3KEO A;  3LWF A;  3Q9S A;  4XSZ F;  5HNF A;  4YRV A;  5CKT A;  2EV0 A;  2O3F A;  2AO9 A;  4FET A;  5BNG A;  1R71 A;  2GXG A;  3HOX J;  3BTJ A;  5FLX Z;  3BWG A;  5C4X J;  4O6J A;  2DPU A;  3AKZ A;  2V1U A;  2W25 A;  2GFN A;  2F5F A;  3GZN B;  1MDM B;  1F4K A;  1ZRD A;  3LA2 A;  2E60 A;  2JPC A;  2ZSH B;  3Q0U A;  4NC8 A;  2P8T A;  1SVO A;  5FKM A;  1VF9 A;  1L0O C;  1FT9 A;  4HZF A;  3WE2 A;  3AFH A;  3F8B A;  2O9L A;  4I09 A;  2QUF A;  4BBS J;  4HAM A;  4YII A;  4X1E A;  3I58 A;  4KMF A;  1OQY A;  3CUQ B;  3ZCO A;  4HDU A;  3S16 J;  4UHT A;  4RB0 A;  3QKX A;  2XRL A;  3ZQC A;  5GAG J;  3OYE A;  4A3J J;  3U9G A;  4GCL A;  1TC3 C;  4BAC A;  4Q5S F;  3FHN A;  1T56 A;  1HKS A;  3WGI A;  4NBQ A;  3V8J A;  3M1E A;  4KIC A;  1K6Y A;  3V42 A;  3J7Y J;  2PMU A;  5E18 F;  1O3Q A;  3ZMD A;  1SVM A;  3BZC A;  4NN1 A;  1AU7 A;  2FSW A;  2ISY A;  3I4P A;  2WAE A;  4WCG A;  2Y48 A;  2YVH A;  3TO7 A;  4M3D A;  4MTE A;  2YPR A;  2XB0 X;  2IT0 A;  2AHQ A;  2MD5 A;  3COA C;  4HRI A;  4ON0 A;  3MKY B;  4NC7 A;  2E7W A;  2D6Y A;  2LFB A;  3JRI A;  1LE8 A;  1DPU A;  1SC7 A;  2EV5 A;  4HX4 A;  3CF2 A;  4IJA A;  3K70 C;  1ULY A;  3V4G A;  1GT0 C;  3C3W A;  2JA2 A;  2OPT A;  4XRM A;  5EGO A;  3I9V 2;  2GQQ A;  5FFZ A;  4Q47 A;  2ZJR F;  4CSW A;  1RI7 A;  4OD4 A;  4RM2 A;  3IAS 2;  2F5V A;  3LST A;  5K5Q A;  5GTI C;  1ETY A;  2XKP A;  4I0B A;  2DA2 A;  2KDZ A;  3E97 A;  1NG7 A;  2BE5 F;  1I1S A;  3I5U A;  1SD4 A;  5IPA A;  3FM5 A;  4E4H A;  2ELH A;  4BE2 A;  1XCV A;  2QQB A;  5DD4 A;  4D5F A;  3H9Q A;  1I39 A;  4A0Y A;  3Q3S A;  3U1K A;  1V3F A;  1V5F A;  1FZP B;  1WHU A;  2EV6 A;  1JGS A;  5JLX A;  5LHG A;  4C3J J;  2K3F A;  3HRT A;  3JRG A;  2D1V A;  1HA8 A;  2BXZ A;  3H9J A;  3PJR A;  2E1N A;  1R5I D;  1MND A;  3R4K A;  1FTZ A;  2M0C A;  3E6C C;  2R7V A;  4O3M A;  2ESN A;  4V2G A;  1TW3 A;  3CLO A;  2KJC A;  3D1N I;  3MN2 A;  2XB5 A;  4RB3 C;  3A03 A;  1J75 A;  4CCJ A;  2RGV A;  1GV5 A;  3OL4 A;  3D5R C;  4NNJ A;  2CUF A;  3M9A A;  3TW6 A;  4J19 A;  4X0G A;  5J40 A;  9ANT A;  1QGP A;  1G59 A;  3I59 B;  5HAW A;  4IRV A;  4C9Y A;  1VTN C;  1WRJ A;  3PFI A;  2M5W A;  4DVY P;  2XRN A;  3A0H C;  2OZU A;  2LH9 A;  3F8F A;  2L3D A;  4N9H A;  3F9K A;  4UVA A;  1SFU A;  2V6C A;  2CGP A;  4Z2Y A;  1YW8 A;  2DXI A;  2L7Z A;  4M9S A;  3HJE A;  3EQL F;  2XPU A;  3BG6 A;  4LGW A;  3PIO F;  2G7G A;  2HDW A;  3GLX A;  4RMN A;  1OCT C;  1XGM A;  4OIQ F;  1MMG A;  3HOV J;  2K9M A;  1RES A;  1S72 I;  3OMY A;  4PJJ A;  3ZQ7 A;  2R3S A;  5J8C A;  5K5R A;  1E3O C;  1D0Z A;  3C2G A;  4BY7 J;  2DMN A;  1O3S A;  1POG A;  3LOC A;  2GXA A;  2L9S A;  1WSU A;  4EAT A;  4UUT A;  3T6N A;  2HQR A;  3P9K A;  3BTL A;  4UVB A;  4RA2 A;  4BBR J;  3CMA I;  1HQC A;  5DD8 A;  2D1H A;  3KNW A;  1XN7 A;  3V7R A;  5ILU A;  4DYC A;  3CUQ C;  1J9I A;  3B81 A;  5DCF A;  1H8A C;  3E5U A;  5FKO A;  4ANJ A;  4YEL A;  3S2D J;  2EA2 A;  1YX3 A;  3HPH A;  1UAA A;  1I5Z A;  2X1C A;  5GP9 A;  5J8F A;  4D0P A;  2F6C A;  3NNR A;  2QKL B;  5JFR A;  3BOQ A;  5E8I A;  5TIS C;  3VW2 A;  2BHZ A;  2F4M B;  3DBR B;  3R0A A;  5GPC A;  3Q5F A;  1VQ4 I;  2DG8 A;  4YFN F;  1S7O A;  1XCB A;  4OWR B;  5FJ8 J;  2V7F A;  4IHV A;  1IZ1 A;  4C2M A;  2VQH A;  1R4N B;  3CLQ A;  3BRU A;  3R61 A;  1BM9 A;  1R1V A;  3HYI A;  4RAF A;  1MW7 A;  4GYG A;  3E5X A;  2XGC A;  4LG0 B;  3S17 J;  3ZQH A;  2M30 A;  4S0H B;  1JUS A;  4HST A;  5E1X A;  3JSJ A;  2UWM A;  1PP7 U;  3HM5 A;  1D1C A;  1T08 B;  2W4S A;  5BOX A;  4OAZ A;  3WOD F;  1T6S A;  4KN4 X;  1JKO C;  2JRM A;  4I0A A;  4E7H A;  1DDN A;  1DUX C;  4WIB A;  2ZXJ A;  1FOY A;  2VKD A;  2XAS A;  2JA7 J;  3S93 A;  1B72 B;  2IGM A;  1U0J A;  5JI6 A;  2H8R A;  3DQV C;  3GME A;  2H1L A;  3VPR A;  2R4G A;  1CF7 A;  5FMP A;  4IO9 F;  1HOM A;  5K7Z A;  3RSN A;  2L9N A;  2HDD A;  5CVV A;  4MO7 A;  3C18 A;  3T8R A;  4L18 B;  4HNT A;  4ZH4 F;  2G7L A;  3HRU A;  4M72 A;  2A6T A;  4BAY A;  4HQE A;  3ANG A;  1OYW A;  1BBY A;  2HTJ A;  1IAW A;  1IN6 A;  2ZSI B;  1FYM A;  2VC0 A;  4FHT A;  5EJC A;  3T0Y A;  5L3C A;  3IH2 A;  1ZGA A;  3H92 A;  4BQA A;  4NDL A;  1OMI A;  1ETV A;  2M1B A;  4GO1 A;  1JTY A;  4JX6 A;  1T39 A;  1UFM A;  3J81 K;  1A6Q A;  1X3W B;  1SAX A;  2LBF A;  2NXN B;  2QVO A;  2EPF A;  2HVS A;  1GHC A;  2JA8 J;  4IRH A;  4BS9 A;  3KKC A;  2VT2 A;  3FIS A;  2V4J C;  1ON2 A;  1BJZ A;  1QPM A;  2XSJ C;  3RIR A;  4KDP A;  5JHU A;  4IRG A;  3RTR A;  2E71 A;  1ZHF A;  4F7Z A;  2ZME A;  3TO9 A;  3OSF A;  4B43 A;  2JK3 A;  4GYI A;  5EZG A;  4XL9 A;  1K83 J;  3CTA A;  3CJT B;  1HW1 A;  2VKV A;  3V8K A;  1YTY A;  5F64 A;  2V9P A;  1XG1 A;  2Y31 A;  2IPQ X;  3G1M A;  3GYH X;  2ETH A;  1W36 D;  1KQ8 A;  1J59 A;  4Y3O A;  4AF5 A;  4FAS D;  4C2U A;  5M5X J;  4E7L A;  4IKF A;  4RGR A;  1WJE A;  2A68 F;  3OSG A;  2CWE A;  1FJL A;  1FYK A;  4P55 A;  2DBB A;  3R0J A;  5LEJ A;  3SHF A;  1STZ A;  5FHP A;  1MSE C;  2W82 A;  4MXM A;  2FE3 A;  3SFI A;  1LDD A;  3BJB A;  3E6B A;  2FU4 A;  1PYV A;  2OJE D;  2VXD A;  3LFK A;  2VBW A;  2XAH A;  1ONV A;  4IQJ A;  4MHG A;  2DT5 A;  2HYT A;  2PMH A;  1B1B A;  4R1H A;  4OIR F;  3E5Q A;  3H36 A;  2ZFU A;  3IC7 A;  4IOC F;  4OIN F;  1LB2 A;  4NQW A;  1YI2 I;  2OU2 A;  3DU5 A;  3VYU B;  1MBK A;  4A69 C;  1MH3 A;  2R0Q C;  3HOZ J;  3TED A;  5C3E J;  3I3L A;  3HG9 A;  3KCC A;  1JHF A;  1SFE A;  2CUJ A;  2ZME B;  1RKT A;  3D5S C;  2Y9Z A;  3OR2 C;  4RGU A;  3U21 A;  2L7F P;  4XLF A;  3B02 A;  3HB9 A;  4MQ9 F;  2P6T A;  2M2E A;  2YSR A;  1W5S A;  3CDI A;  3M7G A;  1OPC A;  3QU6 A;  4EGY A;  1VQ7 I;  1MBG A;  2QQA A;  4R79 A;  3RI4 A;  2QLZ A;  2X85 A;  2M3A A;  4I01 A;  1XSD A;  3OYC A;  2IBD A;  2ID3 A;  2VN2 A;  3KLO A;  2M87 A;  3KEY A;  5D5X B;  3GZI A;  1AA7 A;  2NYX A;  5E20 A;  4B3A A;  2WY8 Q;  4G94 A;  1O7L A;  2STT A;  2KL4 A;  4IZZ A;  3HE0 A;  2P5K A;  2LVS A;  4WX9 A;  2LF7 A;  4BH9 A;  2EWN A;  4G6D A;  3EDP A;  2DPD A;  2A07 F;  3NRG A;  3GLL A;  1U8B A;  4XN0 A;  4LFU A;  2R7U A;  2A69 F;  1X1A A;  1KZH A;  1LNW A;  2RRE A;  1T0F C;  4BUP A;  1REP C;  3AL0 C;  2LKP A;  2WC2 A;  3CES A;  2EBI A;  2Z16 A;  2RHA A;  2Y0M A;  2QCO A;  3O2P E;  2OV7 A;  1K61 A;  5KK1 A;  3ZMV A;  1M1E B;  1HXD A;  2HYF A;  4PK4 A;  4ZTF A;  2DI3 A;  3LFU A;  4N4N B;  4BJ6 C;  3F8C A;  1IDZ A;  3RKW A;  3S2H J;  1KON A;  1AHD P;  3BJO A;  2P7V B;  1JTX A;  1TLH B;  5HDK A;  1G8X A;  4AIK A;  3BHQ A;  4PJN A;  2L9R A;  2A6E F;  3ZR8 X;  3VVX A;  4N9I A;  5FRN A;  3VP5 A;  4AM3 A;  5B5E C;  1I3Q J;  1R22 A;  5IOZ A;  3BZ6 A;  3FF5 A;  4K2E A;  4L5J A;  5ICG A;  1HW5 A;  4II2 A;  1IRF A;  5ICF A;  4B3X A;  3CCU I;  3BG7 A;  2DOF A;  1JKQ C;  4AC6 A;  3OOU A;  2FMY A;  2V79 A;  4IPA A;  5KVR A;  2WV1 A;  4F55 A;  3K70 D;  3NI7 A;  1XD7 A;  3KP3 A;  4HYE A;  4B8X A;  3LWJ A;  3CF5 F;  2ZXW H;  3I59 A;  1TWA J;  2BVL A;  1G3W A;  1YW7 A;  2W00 A;  3S14 J;  2B0L A;  2L7M P;  2QKO A;  1WH5 A;  2DOA A;  2BEO A;  2IA0 A;  3RKQ A;  2KFD A;  1KGS A;  3CCQ I;  1V54 H;  1BW5 A;  4FE7 A;  5CPR B;  2XF5 A;  5IYB J;  4XQF A;  3DLL F;  2NOJ B;  3K4J A;  3SFZ A;  3I55 I;  3G73 A;  3BPV A;  2DFE A;  2QBY A;  5F27 A;  4EM2 A;  3DPL C;  3ZQL A;  2NP3 A;  1Y39 A;  3DPJ A;  1D1B A;  4OMZ A;  2B7E A;  2EFW A;  4CCM A;  3S5R A;  3J7Z I;  1SMT A;  1YRN B;  1FWZ A;  1ETQ A;  4LIV A;  3RD3 A;  1QVU A;  2A5W A;  3HTH A;  2YU9 J;  3JSO A;  1FOW A;  4EMS A;  3RKX A;  5J4V A;  1O57 A;  3DKX A;  4DYQ A;  2EIM H;  4XKB A;  1JUM A;  2H1K A;  1YOV B;  2P7C B;  2X9D A;  2PEX A;  1FEX A;  1UB9 A;  3GFJ A;  4BEH B;  3FXU A;  4XLE A;  1ZEL A;  1WJB A;  3F8M A;  5J1Y A;  3JRH A;  1ZLK A;  2ZB9 A;  3VOX A;  5D8L B;  2E1M C;  2ELK A;  1O3T A;  4U9N A;  5GTH C;  5EZH A;  2AQF A;  4I98 B;  4KT5 C;  2QTQ A;  3ONQ A;  1QU3 A;  1HBX G;  3AAF A;  2LD5 A;  4KUM A;  2QF7 A;  3RCO A;  1B59 A;  3T8T A;  3ESW B;  3IKT A;  4LB5 A;  5F0H A;  2JTV A;  4GFL A;  5IP6 A;  3FHZ A;  2DA6 A;  2HS5 A;  4WXC A;  1FBS A;  2WAD A;  4JYK A;  1K7A A;  1PUE E;  1OR7 C;  3FXM A;  5LGU A;  1IW7 F;  4AIJ A;  1BN5 A;  2VOO A;  5L3G A;  2BW3 A;  3BCB A;  2KQR A;  3IRQ A;  4FT8 A;  3EUK L;  3CO7 C;  1T8I A;  2CYY A;  2F4O B;  4WXH A;  4DZJ A;  2VXZ A;  3S3N A;  1TT5 B;  1RPW A;  1IN8 A;  4MLO A;  3MKZ A;  1EA3 A;  2PJR B;  2UXO A;  2CQK A;  3PSF A;  3WU2 C;  3H5R A;  3E0J B;  3A2K A;  3K1N A;  5HBU A;  2Q2E A;  2JVH A;  3EUH C;  2P81 A;  2W24 A;  3LL7 A;  3P7N A;  2PI0 A;  2VLA A;  1OFC X;  4IHT A;  2W53 A;  2GXB A;  2WGB A;  4EGZ A;  1Z9C A;  4XLC A;  3GBG A;  2XRO A;  1IN5 A;  5J4Y A;  5E3M A;  4CYC A;  2W7N A;  5TGT A;  5B1B H;  2DK5 A;  2TDX A;  3M8E A;  1X19 A;  2CH0 A;  4A5N A;  4KNY A;  2BHY A;  3HUG B;  4XIC A;  4HKU A;  2HKU A;  5B1A H;  4A6E A;  1E3H A;  5M3F J;  3K10 A;  1LVK A;  3Q0V A;  3RYR A;  4BYY A;  5K7H A;  1FP2 A;  2DU9 A;  1DPR A;  3AG3 H;  2HOS A;  2KRH A;  1OKR A;  2HYJ A;  4Y15 A;  2HZT A;  3L7W A;  2PBI A;  2EQR A;  3IRR A;  1B6A A;  4KT6 A;  2DA5 A;  3QBM A;  4E7J A;  1Y6I A;  1ORK A;  2EIL H;  4A3D J;  3BJ6 A;  4MTD A;  2WUI A;  3QOP A;  1D5V A;  3O3K A;  1FYL A;  4I76 A;  2ZBK A;  1P4X A;  3DP7 A;  3KP6 A;  2RC4 A;  3IP4 B;  1IC8 A;  2HVR A;  5BQT A;  3GEU A;  2MLG A;  1YIT I;  5LGN A;  2CW0 F;  4H4K C;  1LPQ A;  2KIU A;  3TBI A;  1ZKG A;  2VE8 A;  3ASN H;  3EPZ A;  3P5J A;  1FOX A;  4HX8 A;  2RAE A;  3NWS A;  5D6E A;  1J0R A;  5F0F A;  4BHB A;  1A04 A;  2ECC A;  3OYG A;  3CCR I;  4AYB A;  2DA4 A;  2P5V A;  1YQA A;  3KYC B;  2O8K A;  4FX0 A;  4NUB A;  5M3M J;  4LB6 B;  3V8L A;  2VBZ A;  2P4W A;  3LQQ A;  3CCV I;  3IUV A;  2IGN A;  4QWQ A;  1R00 A;  2L54 A;  2K4B A;  1IO2 A;  5DEQ A;  3GEZ A;  4AUX A;  1BIA A;  4F93 B;  2OC6 A;  5CQE A;  5C44 J;  5J1R A;  2DK8 A;  2R7Z J;  3HSE A;  2OF7 A;  4BQO A;  2EJR A;  5EEA A;  1MJ9 A;  3MCZ A;  1EKE A;  1ZRF A;  4UDS A;  3BR1 A;  3B6C A;  1X2N A;  3IWZ A;  1JJ8 C;  2DTR A;  2E35 A;  2MFZ A;  1BJA A;  2FJ1 A;  2IAI A;  3BR5 A;  3CMY A;  1FMV A;  3G1L A;  3H0G J;  2STW A;  3VOK A;  2RVC A;  5JVG F;  1VZ0 A;  1WJD A;  3WTV C;  2HWV A;  4GRI A;  3CUO A;  2VKH A;  3ZPL A;  4DW6 A;  4IQ4 A;  4XOP A;  2OD5 A;  3J7A O;  3DWL E;  1XDS A;  2LRD A;  5DM6 F;  3CCE I;  3JTG A;  1APL C;  3K0L A;  3V7C A;  3QPS A;  3L2W A;  1OLT A;  1BA5 A;  3F0C A;  1MMN A;  2NRA C;  2DN0 A;  3TQN A;  1DU6 A;  1Y0N A;  2RNG A;  4QSH A;  2PFV A;  4HW0 A;  4XK4 A;  2E5N A;  5HOO A;  5D5U B;  1WCM J;  1MZB A;  4PCQ A;  4CGZ A;  3H3Z A;  3VFZ A;  3A0B C;  4OIP F;  3L09 A;  3F22 A;  3JRB A;  4PSX A;  3OYN A;  5GAE J;  1W5T A;  2HQN A;  3RJP A;  4J01 A;  1O3R A;  2ESH A;  2KDO A;  3HC7 A;  2UXU A;  4DGW B;  2W48 A;  3LQR A;  4E70 A;  1TL8 A;  3ZQF A;  1LVA A;  4RS8 A;  4MGR A;  2NVX J;  5JLW A;  4EQQ A;  2EIN H;  2HU9 A;  2R93 J;  5H9T A;  4XLP F;  5KHD A;  1HSJ A;  2K5C A;  1GVJ A;  1GV2 A;  4PFO A;  2W57 A;  5AQC A;  4BHC A;  3CUQ A;  4P1W A;  4XSX F;  2RQQ A;  2V1X A;  2V9K A;  2VE9 A;  1HF0 A;  3S1M J;  4KA4 A;  1R5G A;  2IGO A;  4C3I J;  3T5X A;  1VQP I;  3MWM A;  3WGH A;  5FB2 A;  2LY1 A;  2MG4 A;  3PNT A;  3BR6 A;  3G3Z A;  3H0D A;  4XLH A;  4PJL A;  2OUM A;  3KYL A;  1HCR A;  3BG3 A;  1FBU A;  1W7P B;  4JP0 A;  2ZXI A;  3LA3 A;  1HLV A;  5K1Y A;  1Q1V A;  3ASO H;  3M8F A;  3VYS B;  1Z91 A;  3K2A A;  2IRF G;  4E7Z A;  3DPT A;  3H9G A;  4AU7 A;  3CJN A;  4ENN A;  1NK2 P;  2DTZ A;  2JPB A;  1HDP A;  1WH7 A;  2R7O A;  3WU1 B;  3KLN A;  4A3E J;  5F0C A;  1YLF A;  1DU0 A;  2R92 J;  3WTX C;  1YJW I;  3CMM A;  2NOG A;  2OQR A;  3RPU A;  4B48 A;  1ZN2 A;  2PX9 A;  1TP4 A;  3WU0 A;  4DZP A;  1MMA A;  5KAF C;  1MNE A;  2XSD C;  1ETK A;  3I54 A;  2VJ5 A;  3DV8 A;  4QPO A;  2VUM J;  3L1P A;  3EET A;  2R5Z B;  3DTE A;  2V6E A;  3SQN A;  5CW8 A;  1Y0U A;  2HXO A;  2V57 A;  3ANP A;  1ZH5 A;  5JR3 A;  2HVQ A;  2Q8K A;  4L9J A;  4HX7 A;  4ZJZ A;  2GLO A;  4C2M J;  4CCN A;  2A5Y B;  1D3Y A;  2EH3 A;  1TW2 A;  2K7L A;  4BHP A;  2HOT A;  4NHJ A;  5CVJ A;  2GOX B;  1IG7 A;  1BOB A;  2GBY A;  4F52 A;  2IS6 A;  1V5G A;  3RH2 A;  1R36 A;  1U5T A;  2DT7 B;  2F2E A;  5FGM A;  3FX3 A;  1G3S A;  3W6V A;  3I56 I;  2GAU A;  3L00 A;  5TJJ A;  4A3M J;  4QTR A;  3GTQ J;  3SWH A;  1B72 A;  5BPD A;  4WF2 A;  3GTO J;  3ON2 A;  3GTL J;  3RPQ A;  1NG6 A;  1XPX A;  4UVC A;  1Z05 A;  2R7W A;  1R1U A;  2JWT A;  3OYL A;  1YW9 A;  3ABM H;  1BR1 A;  4Q48 A;  1P7I A;  2G7S A;  3K8P C;  2HI3 A;  4JL3 A;  4A0Z A;  4ESF A;  2Y30 A;  1ZG1 A;  4KIG A;  2K4J A;  2LKS A;  3FXQ A;  3DFG A;  3S2W A;  3HTS B;  2YVX A;  4L5I A;  4EJU A;  2DMU A;  2KLO A;  4LLL A;  1FC3 A;  2HTS A;  2ZME C;  4XKC A;  4I02 A;  2LG4 A;  3GUD A;  3RYP A;  3KZZ A;  3L2C A;  1FSH A;  2IS4 A;  1A31 A;  1SFK A;  4UUS B;  3GVA A;  2GEN A;  2JN6 A;  2LBF B;  3HIF A;  5D4R A;  4BGD A;  3P9T A;  1GXQ A;  2ZCN A;  3ECO A;  5E3L A;  1EF4 A;  2C6Y A;  1CQT A;  2X1E A;  2NAZ A;  2OTJ I;  1J5Y A;  3S3M A;  1PUF B;  4BXX J;  5L3E A;  2KHM A;  2FA5 A;  1KU9 A;  4IX7 A;  3KP7 A;  4I99 C;  3EGQ A;  4XRS A;  1PP8 F;  5AIP A;  4RAY A;  3M3Y J;  4A6D A;  3WE3 A;  3RZO J;  3S1N J;  1SAU A;  3DU6 A;  1FNN A;  2F4I A;  5H20 A;  3T1B A;  2LNB A;  1X1P A;  3CCL I;  2QIB A;  4DJA A;  1MJA A;  2UXX A;  5E8G A;  3S15 J;  3CO6 C;  2WB1 A;  3LSK A;  1OR7 A;  3FZV A;  3EUP A;  2YUS A;  5K5O A;  2ZY9 A;  2KRF A;  2CS3 A;  3REO A;  2MGQ A;  4S05 A;  2VPR A;  3NAR A;  4MQV A;  1R1T A;  3HBL A;  3H1C A;  2LRE A;  2YR2 A;  3L2V A;  1ZK8 A;  5HDG A;  4RM3 A;  2M34 A;  3AG2 H;  1BI1 A;  3NEU A;  3DF8 A;  3W2V A;  1VQ9 I;  2JZY A;  5E1Z B;  3N05 A;  2KMU A;  5DTD A;  1WI3 A;  3MMY B;  1Z21 A;  2KIQ A;  3PL8 A;  3VW1 A;  5LRR A;  3I71 A;  4ACI A;  2BY2 A;  1JHH A;  4QLC U;  1EH6 A;  3ZMZ A;  3IL2 A;  1ZR2 A;  4JK1 X;  1MSF C;  3CJQ B;  2MC3 A;  4Y13 A;  3SEZ A;  1QRY A;  4IHW A;  4ETS A;  3ERE D;  3CWR A;  3BJA A;  5HLG A;  2NNY A;  3FMR A;  1S7E A;  3OIQ A;  4IRI A;  3K4M A;  1G4D A;  4L0Z B;  2DMT A;  4HF1 A;  5DAJ A;  4W97 A;  2O8X A;  3ZMS A;  3TW7 A;  2KT0 A;  5LLQ A;  1ZLJ A;  1I6H J;  1B9M A;  4KIS A;  4XRS G;  1SGM A;  3DEW A;  2G7U A;  3TP0 A;  1EV7 A;  2EB7 A;  2OAZ A;  2O61 A;  1QNT A;  2E34 A;  2Z1D A;  2LY9 A;  4V2F A;  3G7R A;  4MFD A;  1WJC A;  2XGD A;  2E2I J;  2CFO A;  2R5Z A;  3NAU A;  3F8N A;  5FLX K;  5L3F A;  2R7Q A;  2M45 A;  2Q24 A;  1Z3Y A;  2X51 A;  1SMY F;  3TGN A;  2WWY A;  5ICE A;  3ML6 A;  5CYV A;  1GLN A;  2CSO A;  4ZYG A;  3IAM 2;  4CO8 A;  4CH7 A;  2VQG A;  5CXG A;  3ZMT A;  3NWT A;  3CJR B;  3HTI A;  1SFO J;  2HQ5 A;  4AYB N;  3E1S A;  2CFX A;  2BY0 A;  1P6R A;  2MH9 A;  5HDN A;  4M9Z A;  4BNC A;  5AON A;  2VOP A;  2AS5 F;  3OIO A;  4HSR A;  5DCM B;  1E0E A;  3PPB A;  3DCF A;  4NB5 A;  4G6Q A;  1UJ8 A;  1ZAR A;  4CYD A;  3TKY A;  1D8K A;  2IVM A;  2NS8 A;  2IXS A;  2LY2 A;  2FEZ A;  5J1U A;  4B47 A;  2K27 A;  2XPV A;  1QHH D;  3C2H A;  2ZNZ A;  4G9Y A;  1B4A A;  3BG9 A;  3WTW C;  5IT3 A;  1VQ5 I;  2K3P A;  4MFE A;  3KIO A;  2W85 A;  3NQO A;  4CCK A;  4IHY A;  2QGU A;  2QA4 I;  5FKL A;  3B6A A;  4HPQ A;  3HTJ A;  3WHB A;  4KIB A;  2PG4 A;  2PZ9 A;  1HW2 A;  5H6Q A;  4M74 A;  4MK6 A;  1RRJ A;  5C4Y A;  2ZO4 A;  4G8X A;  4XLN F;  1J2X A;  1YYV A;  1W7P D;  5D5V B;  2R5Y B;  4U0Y A;  2JUC A;  4A3G J;  2CMP A;  4DQ2 A;  4BU2 A;  2OER A;  1T2K A;  1XGS A;  2K02 A;  3FWE A;  2VAS A;  2RDP A;  3VTI A;  3LAP A;  3RQI A;  3IKV A;  1SD5 A;  3ABK H;  4CA0 A;  3G2B A;  3QPL A;  1K4S A;  2H09 A;  3WG9 A;  3CC7 I;  1TQP A;  4UB8 C;  4HBL A;  2DFH A;  3HTA A;  3MNL A;  3P9C A;  3WTT C;  4I2O A;  5LD2 C;  1YS6 A;  1VQO I;  3FM3 A;  4A3B J;  1LUJ B;  1R49 A;  3L9F A;  3OYF A;  4P96 A;  4ESB A;  2MLK A;  4FIS A;  2ACJ A;  3NPI A;  2M8G X;  4RGX A;  1IN4 A;  2BOL A;  2EIJ H;  1UG2 A;  2X6W A;  3MD2 A;  1MBF A;  4Q4Z F;  2BYV E;  4GGG A;  1NHA A;  2P6S A;  1VQ8 I;  2EZK A;  1LEA A;  4U0V A;  2E1C A;  3GW2 A;  2VJJ A;  3OS1 A;  2FQ4 A;  3R60 A;  4EVI A;  1T33 A;  2PJP A;  3I53 A;  3JRE A;  1GXP A;  1EH8 A;  1MBJ A;  3JRA A;  4IF4 A;  2OCC H;  3HOU J;  2DO7 A;  2UXN A;  3ERM A;  2XDV A;  3DKW A;  4XMY A;  1XMX A;  1QBJ A;  4KIT B;  2XUB A;  3V7S A;  1FOK A;  1BIB A;  4PZJ A;  4F3Q A;  3I4M J;  1Y8R B;  1WVR A;  3W6J B;  4G7H F;  1A6I A;  1SD7 A;  4BDY A;  2XGE A;  2IJL A;  1OCC H;  2L5Q A;  2M9H A;  2HR3 A;  4ITV A;  3LNQ A;  3SJM A;  4YIF A;  1IUF A;  2RV8 A;  3FBN B;  3HSF A;  4ASN A;  2B63 J;  4ZZL A;  4HV6 A;  2BW3 B;  3OV8 A;  4L9N A;  4AID A;  4HDV A;  4JKZ A;  4Y52 J;  3QYB A;  5HOD A;  5EGO B;  3HKZ A;  1X2M A;  2ELJ A;  2FD5 A;  2VT3 A;  2ZJP F;  1KU3 A;  1MNM C;  2M0M A;  2V1D A;  1P9Q C;  4HA8 A;  1ZR4 A;  1ETW A;  1JI8 A;  3I4N J;  2R7F A;  4ZDO A;  1Y1V J;  4I7H A;  3D0S A;  2LMD A;  1W0U A;  1UCR A;  3VSK A;  4YZE A;  3KZI C;  5FFX A;  2XAF A;  1R58 A;  2VB6 A;  2HKO A;  2RNJ A;  3AG4 H;  3KP5 A;  3JW4 A;  1JE8 A;  4HNU A;  2R7T A;  3BLY A;  1C0W A;  5HLI A;  4XID A;  1S9H A;  3FBI B;  4L62 A;  1ZQ3 P;  1ZG5 A;  5FLM J;  5D8K B;  4YEJ A;  1MKM A;  1YRN A;  4B4C A;  2ZCX A;  2X48 A;  3D5L A;  3A01 A;  2HGC A;  3CJD A;  2Q2E B;  3BPX A;  2JVG A;  2R7X A;  4F92 B;  1TNS A;  3G56 A;  1U5T C;  1Z3X A;  2BGC A;  2I5U A;  4WWC A;  1Z1D A;  1MBE A;  1BL0 A;  3MZ8 A;  1S8N A;  3LSP A;  4BL0 B;  2XF7 A;  4XNF A;  4U88 A;  2L7K A;  1Y1W J;  3FRQ A;  3DEU A;  4S04 A;  1Z6T A;  1FIP A;  1VQ6 I;  4M3F A;  2L4M A;  2IP2 A;  2F5E A;  3RKY A;  2A3S A;  2WBM A;  5H6R A;  3VWB A;  5BS6 A;  4ZC3 A;  4UUV A;  1TQM A;  2NVT J;  2EK5 A;  1X58 A;  4AIH A;  4UB6 C;  2FBQ A;  4BKX A;  4UY8 I;  2BZT A;  2PMZ N;  4HF0 A;  1QQI A;  2PMZ A;  5BPI A;  3SZP A;  4ENM A;  2WAQ A;  2JRT A;  4KYW A;  3Q9V A;  5FRO A;  1WPK A;  2NS7 A;  1ETX A;  3HRS A;  2B1E A;  3LSM A;  4BXU A;  3HZJ A;  3QYE A;  3KEQ A;  4PJ0 C;  4A12 A;  2FF4 A;  1DP7 P;  5LEK A;  4H0E A;  3OL3 A;  2R7D A;  2CUZ A;  4DBQ A;  1XGN A;  2Q0O A;  4PGG A;  2XPW A;  4JX5 A;  2CO5 A;  2REK A;  3COL A;  1MD0 A;  2H27 A;  2L01 A;  2MD0 A;  1QVT A;  4OAY A;  1ACI A;  1B8I B;  3IHU A;  1TT0 A;  1UI5 A;  1T98 A;  3ULQ B;  4YG2 F;  4G7O F;  1RR8 C;  2M4K A;  3GF2 A;  2LSO A;  4L0Y B;  1WWX A;  2OQG A;  4PDK A;  3V78 A;  1K78 A;  2MC4 A;  4KMU X;  2XV4 S;  2JMW A;  5B3S H;  1V5E A;  1AKH A;  2COB A;  2VJ4 A;  1IV6 A;  3KZ9 A;  1W1W E;  2DQL A;  1LDJ A;  3C1D A;  1XSV A;  2ADU A;  5FKN A;  2DA1 A;  1ETO A;  3BQZ A;  2X6O A;  2XAG A;  4LJZ F;  2E2H J;  4GCV A;  5GAD J;  4EJV A;  1BW6 A;  1LDK B;  1RKW A;  5HSZ A;  3JAM Z;  1D0X A;  2DDB A;  1VFC A;  2M8E A;  2EIK H;  2LTP A;  4B09 A;  1JKP C;  4ZYA A;  3FMS A;  5DM7 F;  1MMS A;  2ZFW A;  1V4R A;  3OYK A;  5FO5 A;  2WB1 N;  5A2Q K;  4CYC B;  2QEX I;  3GTG J;  3TMO A;  1T38 A;  2CU7 A;  2W1O A;  4QIW N;  2UXP A;  2ZCM A;  1EH7 A;  4CZZ A;  5ILS A;  4EV0 A;  4IHS A;  2R5Y A;  4N0B A;  3QU3 A;  4F91 B;  5IOY A;  4BE1 A;  3KX2 A;  1XMK A;  5CLS A;  5E3N A;  1K4T A;  4M6V A;  2HKX A;  4EJT A;  2M4G A;  2XAQ A;  3CCS I;  2X1D A;  1JUP A;  2OTL I;  1G2H A;  2L2O A;  2EZL A;  2G7H A;  2EA4 A;  2FJI 1;  3OYI A;  1RUO A;  3HIM A;  4HLX A;  4ZDL A;  3K9T A;  3E6M A;  3OYA A;  3JCU C;  2AXT C;  4RLF A;  4DOZ A;  3EYY A;  3WTU C;  2R7R A;  1U8R A;  3F21 A;  2CV1 A;  3C7J A;  2GIZ A;  1N78 A;  2LYC A;  1U3E M;  2X4H A;  3KPH A;  2GOM A;  4YFK F;  2Y75 A;  3PUB A;  2YS9 A;  3E6D A;  5LFA A;  5CXI A;  2HNH A;  1DP3 A;  3KET A;  2HPI A;  4HV5 A;  3SZG A;  1ZTR A;  3MAJ A;  4ZYE A;  4IXA A;  4M9X A;  1USS A;  3GFL A;  3C07 A;  3HSR A;  1IXR C;  5LRS A;  2FX0 A;  1X1B A;  4M3G A;  1VQL I;  3GTJ J;  3IV5 A;  2BBY A;  2XGX A;  2D2W A;  2E1O A;  3ZQQ A;  1A36 A;  5FD5 A;  1P4W A;  4L9T A;  5FD6 A;  2JQ7 A;  2DJI A;  3H5A A;  3PSI A;  2WV0 A;  5ED4 A;  2LKX A;  3OS0 A;  1FTT A;  3ZP5 A;  3BR3 A;  2ZXH A;  3HOY J;  5D19 A;  1ZGW A;  3BC8 A;  2VBX A;  5HVQ C;  1NTC A;  3LA7 A;  4RLQ A;  4CXF A;  3FK7 A;  1N25 A;  1ITY A;  1ENH A;  3J80 K;  5CVU A;  1U2W A;  1WJF A;  3WGG A;  2EZH A;  4BXF A;  1TWH J;  1ZYR F;  4P9U A;  1BI3 A;  3CCJ I;  2IS1 A;  4WXD A;  1SD6 A;  5LGT A;  1Q1H A;  2YU3 A;  4JBA A;  3CP8 A;  5DV5 A;  1BC7 C;  1AOY A;  3S32 A;  2DA3 A;  3K4N A;  5IYD J;  2X0L A;  5IT9 K;  2WA0 A;  2XC7 A;  1KQ0 A;  2ZOY A;  5K58 A;  5ILV A;  3K7A J;  4XOR A;  5E1W A;  1O4X A;  1H89 C;  5ICC A;  1QZE A;  2G9W A;  1IUY A;  6PAX A;  1W36 C;  4P9F A;  3KP4 A;  2LDU A;  5GPA A;  3GFM A;  2CG4 A;  4M73 A;  2JJ7 A;  4ZYH A;  5DCM A;  1U9N A;  3ECH A;  5HNH A;  5F08 A;  3K4B A;  5IP9 J;  3EUH A;  4M6X A;  2BY3 A;  4BY1 J;  4MIM A;  1R9T J;  3FK6 A;  2K9N A;  4MEX F;  4PXI A;  2DQR A;  3I64 A;  1UHM A;  5HLH A;  3TL4 X;  1NH3 A;  4A2U A;  3FXR A;  2IA1 A;  5ERI A;  2RQP A;  3ZXS A;  4NEL A;  5D4S A;  2QSG X;  2QZ8 A;  3ABT A;  3CRJ A;  5CVI A;  5EEH A;  1KYZ A;  4IL6 C;  3W6K B;  2CW8 A;  2DFI A;  5EG0 B;  3TOB A;  1RR7 A;  2KIM A;  3L2Q A;  3G4S I;  3JTH A;  1HKQ A;  3F72 A;  2GM4 A;  5D6F A;  5B66 C;  3PAS A;  2JUG A;  5E3O A;  5D18 A;  3VW0 A;  3BR0 A;  4O5V A;  1RUN A;  1Y56 A;  3OIP A;  1E2X A;  2ZJQ F;  3HGG A;  2TRT A;  1WJA A;  2P5L C;  4MNU A;  2A2F X;  1Y8Q B;  2L02 A;  5KCM A;  2PN6 A;  3PUF A;  4EEF G;  2CV0 A;  1D1A A;  4BE0 A;  4BEH A;  2FOK A;  4C3H J;  4D5C A;  1SAN A;  3GWZ A;  4IEJ A;  4JOM A;  3HHH A;  2VL8 A;  3QRF F;  1BI0 A;  3MZH A;  1MMD A;  1GVD A;  2FOW A;  4YIR X;  3LSI A;  1LQ1 A;  4RB2 C;  2IGK A;  4BQN A;  3S1R J;  2IU5 A;  4AD9 A;  2XHK A;  3BNI A;  3UNG C;  2PLY A;  2K86 A;  2DLL A;  4A3K J;  3N97 A;  3VVY A;  4ESJ A;  2VJI A;  1P92 A;  3HOS A;  2UZK A;  4LLG F;  2VI6 A;  3JR9 A;  1FMW A;  2K40 A;  3BRO A;  3HRM A;  3MKL A;  1VND A;  2LK2 A;  3JAM K;  5HS7 A;  1HKT A;  1IGN A;  3KKD A;  1OYI A;  2DFF A;  2ISZ A;  2LF8 A;  2JA6 J;  3EUA A;  2O03 A;  2K9S A;  1UEL B;  3X2Q H;  2L9V A;  1Z6R A;  2NNN A;  4C30 A;  4PFP A;  5CJ9 A;  1K6O A;  4V19 K;  2CQX A;  2E1M B;  3OYM A;  1FLI A;  3CDH A;  4NQW B;  1KU7 A;  3MZY A;  2MSY A;  1U78 A;  3ZN0 A;  1QZY A;  2AXL A;  3OR1 C;  3GZ5 A;  4CCO A;  3K1P A;  3FMQ A;  2X6Y A;  1NK3 P;  3KP2 A;  1FPQ A;  2DOE A;  3AQT A;  4CGR A;  2G0E A;  2XVC A;  3BR2 A;  2QOP A;  2GIV A;  1CF7 B;  1VQN I;  1N77 A;  2MBF A;  2FUG 2;  3LSR A;  2Y9Y A;  3HHG A;  2NP5 A;  3FKI J;  4G7Z F;  4LIU A;  4BJT A;  2KZG A;  4ENJ A;  2W84 A;  2Z9O A;  1IRG A;  2HOE A;  3PO3 J;  1R6R A;  3SDB A;  3JRD A;  3GCM A;  3ZRG A;  3P9I A;  3K6G A;  5E79 C;  4Y17 A;  1LEB A;  3K69 A;  3J80 Z;  5BMZ A;  4U87 A;  3ISP A;  3GX4 X;  4EM0 B;  3WTZ A;  3ZGK A;  4RAG A;  2WY7 Q;  3ZMU A;  2F07 A;  2O7T A;  2BVM A;  3OYD A;  2Z99 A;  1IV8 A;  3TDZ C;  2I8D A;  2XKO A;  2MA3 A;  5GAH J;  1F1Z A;  2QBY B;  2FRH A;  1OJL A;  2F48 A;  2NS0 A;  3W2W A;  3G71 I;  4N4O B;  2VQC A;  3FXO A;  3GO5 A;  5M5W J;  3U1D A;  2PJR A;  3VDX A;  5HS8 A;  4JQF A;  1F36 A;  1G6N A;  4BJ5 C;  4U7B A;  2K9L A;  2QKM B;  4QPQ A;  2IS2 A;  2QWW A;  2YX7 A;  2O0Y A;  1PUF A;  4HF2 A;  5HS9 A;  3MFK A;  2MW8 A;  4OD5 A;  1K78 B;  2LOO A;  4A3C J;  1MBH A;  4ZTJ A;  1ZG3 A;  2XDN A;  3K4L A;  3SEQ A;  3BTI A;  3ROU A;  5A2Q Z;  2R7S A;  1SFX A;  2K85 A;  2HYG D;  2D45 A;  1R5H A;  3QOD A;  4CDG A;  1A5J A;  2ZKZ A;  3A01 B;  2H8W A;  5K7F A;  3W3C A;  3VB2 A;  3JSP A;  4PGH A;  4Y33 A;  3O60 A;  1BI2 A;  3QQA A;  1S6L A;  2F5D A;  1LE8 B;  1TZL A;  1I27 A;  1X1D A;  4L9V A;  1P4A A;  4DNC A;  2H94 A;  3HXL A;  3H3V K;  1OCO H;  4OOI A;  1LFB A;  2OZ6 A;  3PO2 J;  4M3B A;  3DBL B;  2KJB A;  1YE9 A;  1W7P A;  3PIP F;  1H9T A;  2D5V A;  1F5T A;  5TRD A;  2GA1 A;  4LMY A;  2HDC A;  5CVR A;  1YX5 A;  5JVT A;  1AKH B;  4KJZ A;  1WI9 A;  1RIO H;  2H6B A;  1UHW A;  4CUG A;  1SEU A;  2BXY A;  2QYO A;  4Z6Y A;  2M7A A;  3IWF A;  1J7K A;  1Z67 A;  2OBP A;  4G6T B;  2DYS H;  2H6C A;  4EM1 A;  2QEN A;  3WTY C;  2ZCW A;  5F6F A;  4A3F J;  3F1B A;  3MKW B;  2CJJ A;  1UZC A;  2Y69 H;  1SVL A;  3BG5 A;  5KAI C;  2FBI A;  4B1R A;  1YIO A;  2V9V A;  3PNV A;  2IEK A;  3BT9 A;  2I10 A;  5FGL A;  2FNP A;  2O7O A;  2V1N A;  2JA5 J;  4ZZD A;  1HST A;  1F9N A;  2VON A;  1I1G A;  1FIA A;  2NVY J;  3C2B A;  2VC1 A;  4D7M A;  2X6X A;  4I6Z A;  5C4J J;  1I50 J;  3J81 Z;  3U2R A;  3GZ6 A;  1D0Y A;  1Z0X A;  1XC5 A;  4Y4R A;  1TBX A;  1I6X A;  3ZOB A;  3VIB A;  3AG1 H;  2WAQ N;  3LAJ A;  2FNA A;  1UG0 A;  1E17 A;  3PNY A;  3V6G A;  1G3Y A;  2B3W A;  2QM3 A;  2KKO A;  3SZT A;  2CQ7 A;  2KZV A;  3OWT A;  3H35 A;  2MH2 A;  2CQQ A;  5F1J A;  3BDD A;  4CCL A;  1YIJ I;  5F04 A;  4D7N A;  5KNL A;  2DA7 A;  2EFQ A;  1IJW C;  3A4C A;  1ODD A;  3CCY A;  3DXJ F;  4JX4 A;  4PUS A;  5J3L A;  3TOA A;  3O8H A;  2Z2S B;  3TP3 A;  1H9G A;  1B8I A;  1MGT A;  1TQI A;  3QP5 A;  4P5O A;  4XOT A;  2KP6 A;  3QWL A;  1TWG J;  1TWC J;  3F3X A;  3O6B B;  3GFI A;  3DPU A;  1X4O A;  4AVP A;  4ICH A;  3IH4 A;  1KYW A;  5AIQ A;  1R7J A;  3CCM I;  2DT6 A;  2CW7 A;  1A35 A;  1QPI A;  1KA8 A;  3HEF A;  2YVE A;  3KZY A;  4GFK A;  2HOA A;  3ON4 A;  2JT1 A;  3GTK J;  2L4A A;  3HUG A;  3QOE A;  1LFU P;  4XRF A;  3CQZ J;  2HZD A;  4E7I A;  2RKH A;  3CC2 I;  2KIF A;  2XF6 A;  4ZDP A;  3AQS A;  2GUH A;  4A93 J;  3FDY A;  5FKK A;  2Z3Y A;  4E6K G;  4KIF A;  3VYR B;  1OCR H;  3RPU D;  1OIS A;  3M07 A;  4LIT A;  1IN7 A;  2E2J J;  4A3I J;  1O7F A;  2G3B A;  5EEG A;  3A1Y A;  1OCZ H;  3BY6 A;  3FXL A;  5LBQ A;  3OS2 A;  1D8J A;  2FBK A;  1P7J A;  4M6Y A;  1PDN C;  4EJW A;  3E7L A;  4OU0 A;  1GDT A;  2DG7 A;  5J47 A;  5EDN A;  2GZW A;  5M5Y J;  4PSW A;  2MYS A;  5FRM A;  2A61 A;  1ON1 A;  1DGR M;  4FE4 A;  2FXA A;  5EF6 A;  2BY1 A;  1K79 A;  1XS9 A;  4YFX F;  1TWF J;  2CUE A;  2J5P A;  3F6V A;  2K9Q A;  3ZQG A;  5DS9 A;  2MAB A;  3QPT A;  4GXO A;  3M4O J;  3J7A Y;  1E3P A;  3OOP A;  3F6O A;  1DQU A;  4ZYD A;  1IRX A;  2JSP A;  2JSC A;  3QP6 A;  4UV9 A;  1XTA A;  1XX5 A;  2LP0 A;  3WTS C;  1YO5 C;  2ICW G;  3DBH B;  3FIW A;  4BDZ A;  1UI6 A;  3Q0W A;  3H3U A;  1ZGJ A;  2EFO A;  2EFP A;  5LHH A;  5EG0 A;  3L2R A;  1B9N A;  5EFY A;  1XMA A;  4UXN A;  5CQG A;  3S8P A;  1JKR C;  4A5M A;  3EYI A;  2J5O A;  1BR2 A;  3ELK A;  4IHX A;  1LFP A;  4FCY A;  2A05 A;  3ABL H;  5IYC J;  4CZC A;  2DYR H;  4U7D A;  2YX4 A;  3E7Q A;  4EJO A;  2KRC A;  3HOT A;  2E7X A;  3VOE A;  1FP1 D;  4PJM A;  4LK0 F;  3BZK A;  2HQA A;  4GCK A;  2RAS A;  1OYY A;  3JRF A;  3M8J A;  4HLY A;  2DMP A;  2TCT A;  1WJ5 A;  4AC0 A;  1TTY A;  3PM1 A;  1YHQ I;  2XAJ A;  4LOC A;  3NRV A;  4ENK A;  3LMM A;  3B73 A;  3K4K A;  4R8H A;  4Y7N J;  3DTK A;  1U5T B;  4XR6 A;  3K4C A;  3LSH A;  5LHI A;  5F1R A;  1IDY A;  3OYH A;  2N8G A;  4U0W A;  3VUQ A;  3ZQI A;  3DKY A;  4L5E A;  4HEA 2;  1X3Z B;  2O5R A;  2ZNY A;  1YJ9 I;  1RNL A;  2ZJ2 A;  4DIQ A;  3QAH A;  3G1O A;  3CDL A;  1HC8 A;  1XB4 A;  2NVU B;  1MIJ A;  1IXS B;  2OI8 A;  3LHQ A;  1GUU A;  3S1Q J;  4W1U A;  3O8G A;  4IOA F;  3HOW J;  4GCT A;  2BV6 A;  2UV1 A;  5L3B A;  4XLA A;  5HLT A;  2QWT A; 
#chains in the Genus database with same CATH homology
 2Y31 A;  1XG1 A;  1P7I A;  2G7S A;  3G1M A;  1NTC A;  2HI3 A;  4AF5 A;  3FK7 A;  4JL3 A;  5M5X J;  2Y30 A;  3GTM J;  1ITY A;  1ENH A;  1RET A;  2DMU A;  2EZH A;  1TWH J;  1IRZ A;  3OSG A;  4FTH A;  1FJL A;  4UUS B;  2DA3 A;  1Z77 A;  4A3L J;  5IYD J;  2ZOY A;  5K58 A;  3HKZ N;  5FHP A;  2GEN A;  1MSE C;  4MXM A;  2JN6 A;  3K7A J;  1O4X A;  2NX4 A;  3SFI A;  1H89 C;  3BJB A;  3P9T A;  2ZCN A;  4UUS A;  5E3L A;  1EF4 A;  1CQT A;  2HYT A;  5GPA A;  4BXX J;  1PUF B;  4JNN A;  2JJ7 A;  4M3E A;  1U9N A;  3EGQ A;  4XRS A;  5F08 A;  3M3Y J;  5IP9 J;  2L0K A;  3RZO J;  1JT6 A;  3S1N J;  1JT0 A;  4BY1 J;  1MBK A;  4A69 C;  3MVP A;  1MH3 A;  4MIM A;  2QIB A;  2R0Q C;  1R9T J;  3FK6 A;  2K9N A;  3HOZ J;  3TED A;  4PXI A;  5C3E J;  3LSG A;  3S15 J;  2ME6 A;  3EUP A;  1RKT A;  2YUS A;  2Y9Z A;  3LJL A;  2MGQ A;  5FLV A;  2L7F P;  3HB9 A;  4NEL A;  2M2E A;  2VPR A;  3NAR A;  1F43 A;  3HBL A;  3CRJ A;  1ZK8 A;  4KWA A;  2NVQ J;  2M34 A;  1JJ6 C;  5EG0 B;  1MBG A;  1RR7 A;  5DTD A;  2LR8 A;  1MH4 A;  1WI3 A;  2CRG A;  2Y0S N;  3NXC A;  2IBD A;  2GM4 A;  4ME9 A;  3HGY A;  2ID3 A;  3VW1 A;  3GTP J;  1U9O A;  3HDD A;  3PAS A;  4ACI A;  5E3O A;  5D18 A;  3VW0 A;  1MSF C;  1ZR2 A;  3GZI A;  3BR0 A;  4B3A A;  1QRY A;  4IHW A;  2ZOZ A;  3HGG A;  2TRT A;  3CWR A;  3HE0 A;  2LVS A;  1S7E A;  2UXH A;  2E19 A;  1W0T A;  4EEF G;  3NRG A;  2DMT A;  2ME0 A;  4C3H J;  4D5C A;  1U8B A;  1HDD C;  5DAJ A;  4W97 A;  1SAN A;  2DMQ A;  3TW7 A;  2KT0 A;  4IEJ A;  3RZD J;  4DYR A;  1I6H J;  1SGM A;  3A02 A;  2EBI A;  3DEW A;  4XRS G;  2RHA A;  3TP0 A;  1UHS A;  2QCO A;  2LLK A;  1K61 A;  1GVD A;  3G7R A;  4V2F A;  2LY9 A;  4RBO A;  3SDG A;  4MFD A;  2XGD A;  2E2I J;  3UKG A;  2R5Z A;  3NAU A;  1IDZ A;  3S1R J;  2DJN A;  2IU5 A;  2Q24 A;  3BNI A;  3S2H J;  1AHD P;  3BQY A;  2VKE A;  4A3K J;  1JTX A;  3BHQ A;  3VVY A;  2L9R A;  2ID6 A;  2ECB A;  3VVX A;  2VI6 A;  2PBX A;  3VP5 A;  3JR9 A;  2K40 A;  3LSJ A;  3MKL A;  3VVZ A;  1I3Q J;  1VND A;  2EZI A;  2LK2 A;  5IOZ A;  1JGG A;  2Y2Z A;  1IGN A;  5CXG A;  3KKD A;  3HTI A;  1SFO J;  2JA6 J;  2K9S A;  2HQ5 A;  4AYB N;  4X6A J;  1JKQ C;  4AC6 A;  3OOU A;  5D1R A;  1VI0 A;  2CQX A;  2WV1 A;  3OIO A;  1H88 C;  2HXI A;  3NI7 A;  2MSY A;  1U78 A;  1D5Y A;  3PPB A;  3DCF A;  3LWJ A;  1TWA J;  4ABZ A;  3S14 J;  2L7M P;  2QKO A;  1WH5 A;  2NS8 A;  2UXI A;  4RDU A;  3RKQ A;  1NK3 P;  5J1U A;  4CGR A;  3AQT A;  2XPV A;  1BW5 A;  2G0E A;  3BR2 A;  4FE7 A;  3WHC A;  5IYB J;  2QOP A;  4HNV A;  4GFB A;  3LSR A;  2Y9Y A;  2NP5 A;  3BG9 A;  3FKI J;  4MFE A;  5F27 A;  3JRC A;  3IH3 A;  1WGX A;  3ZQL A;  4IHY A;  3BTC A;  2NP3 A;  3PO3 J;  3DPJ A;  5FKL A;  3B6A A;  3JRD A;  3HTJ A;  3WHB A;  2PZ9 A;  3S5R A;  1YRN B;  5EYR A;  5IP7 J;  4MK6 A;  5C4Y A;  1ETQ A;  1UMQ A;  3RD3 A;  1QVU A;  3HTH A;  2YU9 J;  2F07 A;  2O7T A;  4G12 A;  2R5Y B;  3BCG A;  4A3G J;  1OCP A;  2OER A;  4DYQ A;  2AO9 A;  1JUM A;  5BNG A;  2H1K A;  3HOX J;  3BTJ A;  5C4X J;  2X9D A;  1OJL A;  1FEX A;  2GFN A;  3RQI A;  5J1Y A;  3JRH A;  5M5W J;  2ZB9 A;  3VOX A;  2ELK A;  3Q0U A;  3QPL A;  5EZH A;  2QTQ A;  5FKM A;  1F36 A;  1VF9 A;  2LD5 A;  2QF7 A;  3HTA A;  2O9L A;  3MNL A;  5F0H A;  4BBS J;  1PUF A;  4GFL A;  4X1E A;  5IP6 A;  2DA6 A;  4A3B J;  2MW8 A;  4JYK A;  4A3C J;  1MBH A;  3S16 J;  4FIS A;  3QKX A;  2XRL A;  3ZQC A;  2XDN A;  2M8G X;  3NPI A;  3BTI A;  4DZJ A;  4A3J J;  4GCL A;  1TC3 C;  1UG2 A;  1MBF A;  1T56 A;  1RPW A;  4MLO A;  2UXO A;  2EZK A;  1A5J A;  3A01 B;  5K7F A;  5HBU A;  2FQ4 A;  1T33 A;  3O60 A;  2P81 A;  3QQA A;  3JRE A;  4NN1 A;  1AU7 A;  1LE8 B;  1MBJ A;  3JRA A;  1OFC X;  2W53 A;  2YVH A;  2WGB A;  4M3D A;  3HOU J;  3H3V K;  2XB0 X;  1LFB A;  3GBG A;  2AHQ A;  3PO2 J;  4M3B A;  4CYC A;  2D5V A;  5E3M A;  2LFB A;  2D6Y A;  3JRI A;  1LE8 A;  3I4M J;  1A6I A;  5CW8 A;  4XIC A;  2XGE A;  1AKH B;  4HKU A;  1GT0 C;  2HKU A;  2OPT A;  2M9H A;  3LNQ A;  5M3F J;  4XRM A;  5EGO A;  3SJM A;  1IUF A;  3Q0V A;  5K7H A;  2HOS A;  2B63 J;  4JKZ A;  4Y52 J;  2HYJ A;  5HOD A;  5EGO B;  1ETY A;  2KDZ A;  2DA2 A;  1X2M A;  2EQR A;  2FD5 A;  1MNM C;  5IPA A;  4A3F J;  3F1B A;  2DA5 A;  3QBM A;  2CJJ A;  1ORK A;  1ZR4 A;  1ETW A;  4A3D J;  3I4N J;  4D5F A;  3BG5 A;  1Y1V J;  2WUI A;  4B1R A;  3Q3S A;  2IEK A;  1W0U A;  3BT9 A;  2I10 A;  4I76 A;  5FGL A;  2O7O A;  4YZE A;  1IC8 A;  2JA5 J;  3GEU A;  5JLX A;  1FIA A;  2NVY J;  3C2B A;  1ZKG A;  4C3J J;  4D7M A;  4I6Z A;  3JRG A;  2RAE A;  4XID A;  1I50 J;  5C4J J;  1Z0X A;  4L62 A;  5F0F A;  1XC5 A;  1ZQ3 P;  2ECC A;  1FTZ A;  2DA4 A;  2M0C A;  5FLM J;  3ZOB A;  3VIB A;  4V2G A;  2O8K A;  2WAQ N;  3D1N I;  3MN2 A;  2XB5 A;  5M3M J;  3A03 A;  1YRN A;  4B4C A;  1GV5 A;  2ZCX A;  3V6G A;  3IUV A;  2X48 A;  3A01 A;  2CUF A;  3TW6 A;  4J19 A;  3CJD A;  9ANT A;  4AUX A;  5F1J A;  2CQQ A;  5C44 J;  5J1R A;  5HAW A;  3G56 A;  2R7Z J;  5F04 A;  2OF7 A;  4D7N A;  5EEA A;  2DA7 A;  4UDS A;  1IJW C;  3BR1 A;  1MBE A;  1X2N A;  3B6C A;  1BL0 A;  1JJ8 C;  5J3L A;  3CCY A;  4JX4 A;  3LSP A;  1Y1W J;  3FRQ A;  3O8H A;  2FJ1 A;  2IAI A;  1FIP A;  3BR5 A;  3TP3 A;  2L7Z A;  3CMY A;  3H0G J;  3G1L A;  4M3F A;  1B8I A;  3VOK A;  2XPU A;  2G7G A;  1TWG J;  1TWC J;  3HOV J;  1OCT C;  1RES A;  4ICH A;  3IH4 A;  4DW6 A;  2NVT J;  1E3O C;  1APL C;  1X58 A;  3QPS A;  2FBQ A;  4BY7 J;  4BKX A;  2DMN A;  1QPI A;  2PMZ N;  3HEF A;  3F0C A;  1BA5 A;  2YVE A;  1POG A;  2DN0 A;  1DU6 A;  4GFK A;  2HOA A;  3LOC A;  4QSH A;  3ON4 A;  3GTK J;  4XK4 A;  4UUT A;  3T6N A;  1LFU P;  3BTL A;  1WPK A;  2NS7 A;  3CQZ J;  1ETX A;  1WCM J;  4BBR J;  3KNW A;  3AQS A;  2GUH A;  3JRB A;  4A93 J;  4DYC A;  5FKK A;  2UXU A;  3B81 A;  2E2J J;  4A3I J;  2W48 A;  1H8A C;  5FKO A;  2XPW A;  3ZQF A;  4JX5 A;  2REK A;  3S2D J;  2G3B A;  3COL A;  2NVX J;  5GP9 A;  5JLW A;  1P7J A;  1QVT A;  3NNR A;  3E7L A;  2R93 J;  1GDT A;  1B8I B;  1UI5 A;  5H9T A;  2DG7 A;  3VW2 A;  5EDN A;  5GPC A;  5M5Y J;  1GV2 A;  2DG8 A;  5AQC A;  5FJ8 J;  3V78 A;  4FE4 A;  4IHV A;  2JMW A;  5EF6 A;  1HF0 A;  3S1M J;  1XS9 A;  1AKH A;  3BRU A;  4C3I J;  2COB A;  1IV6 A;  3KZ9 A;  1TWF J;  2CUE A;  5DS9 A;  2K9Q A;  3ZQG A;  2MG4 A;  5FKN A;  3M4O J;  2DA1 A;  3BR6 A;  1ETO A;  3BQZ A;  1HCR A;  2X6O A;  2XGC A;  3BG3 A;  4JP0 A;  2E2H J;  3S17 J;  3ZQH A;  2LP0 A;  1HLV A;  4S0H B;  1Q1V A;  1JUS A;  1BW6 A;  3K2A A;  1RKW A;  3JSJ A;  5HSZ A;  3FIW A;  3HM5 A;  1UI6 A;  3Q0W A;  1VFC A;  1NK2 P;  2DTZ A;  1JKO C;  2LTP A;  1JKP C;  1HDP A;  5EG0 A;  1WH7 A;  5EFY A;  4A3E J;  5F0C A;  4CYC B;  2WB1 N;  1JKR C;  1DU0 A;  2R92 J;  2JA7 J;  3GTG J;  2CU7 A;  4QIW N;  2NOG A;  2UXP A;  1B72 B;  2ZCM A;  4IHX A;  4FCY A;  2H8R A;  2R5Y A;  5IYC J;  5IOY A;  4DZP A;  3VPR A;  3E7Q A;  5E3N A;  2XSD C;  1ETK A;  5FMP A;  4M6V A;  1HOM A;  5K7Z A;  2HDD A;  2VUM J;  3L1P A;  4MO7 A;  1JUP A;  1G2H A;  2R5Z B;  4GCK A;  2RAS A;  2EZL A;  2HXO A;  3JRF A;  2V57 A;  2DMP A;  2TCT A;  3ANP A;  3HIM A;  2G7L A;  4AC0 A;  3PM1 A;  2GLO A;  4C2M J;  3ANG A;  4LOC A;  2EH3 A;  2HOT A;  4Y7N J;  1IG7 A;  2GBY A;  3IH2 A;  2YS9 A;  5CXI A;  1IDY A;  4NDL A;  3RH2 A;  1ETV A;  2N8G A;  3VUQ A;  1JTY A;  3ZQI A;  4JX6 A;  1ZTR A;  4L5E A;  3C07 A;  3W6V A;  2JA8 J;  3G1O A;  3CDL A;  4A3M J;  3KKC A;  3FIS A;  2FX0 A;  4QTR A;  3GTQ J;  4M3G A;  1B72 A;  1BJZ A;  2OI8 A;  3GTJ J;  3IV5 A;  3LHQ A;  1GUU A;  3GTO J;  3S1Q J;  4W1U A;  2E1O A;  3O8G A;  3HOW J;  3ON2 A;  3GTL J;  4GCT A;  3OSF A;  2JK3 A;  5EZG A;  2LKX A;  1K83 J;  1FTT A;  3BR3 A;  2JWT A;  3HOY J;  5D19 A;  2VKV A;  1ZGW A;  2QWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...