4X1EA

Crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
199
structure length
199
Chain Sequence
RAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIAASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand binding specificity of RutR, a member of the TetR family of transcription regulators in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o6:h1
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator RutR
total genus 75
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x1eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4x1eA02
3IH4A 1T56A 2LVSA 4LOCA 2Y30A 4HNVA 2ID3A 4XK4A 4FISA 4IHYA 1IG7A 2HOAA 4BXXJ 1MBHA 4C3IJ 1AKHB 2K9SA 3LSPA 5FLMJ 1HOMA 1GVDA 5C4YA 5JLXA 5FKOA 2Y0SN 1W0UA 1JTYA 2EZLA 1WCMJ 2WGBA 2MG4A 1Z77A 4MXMA 2ZOYA 5IOYA 1VNDA 1RKTA 5EDNA 2YVHA 1ORKA 3BNIA 4JP0A 2GLOA 3D1NI 4JL3A 4L62A 2VI6A 2TCTA 3A02A 3ZQLA 2E2JJ 1ETYA 2X9DA 2R5YB 3ANPA 2E2IJ 5M5WJ 1HCRA 4Y52J 2D5VA 2L0KA 3GTGJ 3CWRA 1APLC 1PUFB 1B8IB 2L7MP 1Y1WJ 5EZHA 4CYCA 4JKZA 3HOVJ 2GBYA 2JA8J 1RESA 5HSZA 5EEAA 4CYCB 2EZIA 4B1RA 1VF9A 2WUIA 3M3YJ 4NELA 2WAQN 4AYBN 1IV6A 4GFLA 4XICA 2YS9A 3GTJJ 2DA2A 2XDNA 3JRHA 4KWAA 4RDUA 1X2NA 1ZK8A 3GTPJ 2LK2A 1XS9A 2G7LA 3EUPA 3W6VA 3SDGA 5E3OA 2DMPA 2UXPA 3ZQCA 5J1YA 3B81A 2Y9YA 3HGYA 5C44J 1JUSA 1XG1A 3RH2A 2Q24A 1JKPC 4EEFG 5M5YJ 5EGOA 2D6YA 5BNGA 1FJLA 3BTJA 2PBXA 2VKEA 2XGCA 4MK6A 4XIDA 3O8GA 2E19A 1NK3P 4M3FA 3VUQA 1OCPA 2R7ZJ 3NNRA 4C2MJ 3TP3A 5IYDJ 1HF0A 3BRUA 5D19A 1EF4A 2R92J 4M6VA 4DYRA 3IUVA 2Y31A 1WH7A 1A6IA 5J1RA 1OJLA 2HDDA 5IP7J 4A3CJ 2DA4A 1U78A 3BQYA 1MBGA 5EZGA 4IHXA 3H3VK 5F0FA 1OCTC 2DTZA 2OPTA 1ENHA 3G7RA 2LY9A 2WV1A 3CMYA 4A3BJ 3LWJA 1HLVA 3S17J 4A3EJ 1GV5A 1LE8A 3JRAA 2M9HA 3GBGA 2LLKA 2G3BA 1YRNB 2GENA 3K2AA 3LHQA 1QVUA 2IEKA 2ZB9A 3BT9A 2KDZA 2ID6A 1CQTA 3G1LA 1ZR4A 3GTQJ 1SANA 2EBIA 1TWAJ 1D5YA 3NRGA 2FQ4A 1JT6A 3HTAA 4X1EA 3O60A 4D5CA 3HOXJ 5IPAA 2ZCXA 2NP5A 5K7ZA 2NS8A 1LFBA 4MLOA 3RKQA 5J1UA 5F04A 2V57A 3JRIA 3S1QJ 2DA5A 2W48A 3OOUA 9ANTA 2HKUA 3VW0A 3QPLA 1TC3C 3A01B 2I10A 1JKOC 2ZOZA 1A5JA 4AUXA 2FD5A 3MNLA 5CW8A 3IH3A 1JJ6C 4FTHA 4D7MA 2EH3A 3ZQFA 1GDTA 2RASA 5JLWA 2QTQA 3GEUA 5HBUA 3BHQA 5FKNA 1JJ8C 2O8KA 1WGXA 5DTDA 3M4OJ 3VVYA 4DYCA 2ELKA 4Y7NJ 2N8GA 3IH2A 2CQQA 4MIMA 2IBDA 4GFBA 2NVYJ 3H0GJ 5F0HA 2UXUA 1IDYA 3GTLJ 1IC8A 2HQ5A 4A93J 3VOXA 1BJZA 5C4JJ 4UUTA 3ANGA 1TWHJ 3NPIA 4QIWN 4G12A 1IGNA 3TEDA 2XGDA 4B3AA 2OERA 3VPRA 1BW5A 2LD5A 3QPSA 2H8RA 2JK3A 4UDSA 1IUFA 1ZKGA 2JJ7A 4W1UA 1K61A 5AQCA 1Z0XA 3JREA 3HKZN 1R9TJ 2ME6A 2DN0A 2LKXA 4B4CA 2G0EA 1H89C 4A3JJ 3E7QA 3LSGA 3MVPA 3ZQHA 2NVQJ 3KNWA 3JRGA 1F43A 5FHPA 3VW1A 2JWTA 2ME0A 3VIBA 1IRZA 2L7ZA 4C3HJ 3HOYJ 1Q1VA 3NARA 5GP9A 5E3MA 2JA7J 1WH5A 2IU5A 3JSJA 1FIPA 1GT0C 1U9OA 3NAUA 3JRBA 1H88C 4D7NA 3HE0A 2R0QC 3OSGA 3S1RJ 3BTCA 4I76A 3JRDA 4V2GA 2XPVA 3S14J 4AF5A 3PM1A 2HI3A 4XRMA 4A3DJ 3NXCA 3MN2A 1NK2P 1HDPA 3LSJA 2RAEA 5F1JA 1JGGA 1UHSA 1AKHA 2HYTA 4JNNA 3PASA 1UI6A 2M34A 1JKQC 4A3IJ 1JKRC 2H1KA 3S16J 2O7TA 3JRCA 4MFDA 3PO2J 3CDLA 4HKUA 1ETXA 2E1OA 3V6GA 2R5ZB 1Y1VJ 3DCFA 2AO9A 3AQTA 2CUFA 2DA1A 5EGOB 3ZQGA 1JT0A 3TP0A 3S2HJ 3QKXA 1BW6A 3BG3A 3LOCA 4A3LJ 2NS7A 1FTTA 4GCKA 1UG2A 3L1PA 4BBSJ 3GTKJ 2DG7A 2MW8A 1B72B 3V78A 3BTIA 2DA7A 4XRSA 3G1MA 2YVEA 5E3NA 2UXOA 4QSHA 4BKXA 2DA6A 1YRNA 1ZTRA 2FX0A 5F08A 2FBQA 2LR8A 3BR3A 1RPWA 3HOUJ 2LFBA 4J19A 2WB1N 2DA3A 2MSYA 3Q0UA 1FTZA 3BR5A 3SFIA 5H9TA 2LTPA 1O4XA 3VW2A 3PPBA 2O7OA 2GM4A 2XPWA 3A03A 1ZGWA 2DMNA 1MH4A 1UMQA 2DMQA 3HEFA 3HBLA 1IJWC 2REKA 2COBA 2XB0X 3BR6A 5EFYA 4CGRA 5M5XJ 2L9RA 3TW6A 1U9NA 1H8AC 3ON4A 4D5FA 4NN1A 5IOZA 1VI0A 1IDZA 2VPRA 1E3OC 4AC6A 1UI5A 4FE7A 2NX4A 3OSFA 2PMZN 1QVTA 3JRFA 4M3GA 2DJNA 1RKWA 5IYBJ 3RZDJ 2K9NA 3BCGA 5FKKA 3FKIJ 2R5ZA 3VOKA 1RR7A 1F36A 3O8HA 2O9LA 4DZPA 5EG0B 3S1NJ 3DPJA 1WI3A 2K9QA 4S0HB 1PUFA 2AHQA 1BL0A 5FLVA 5M3MJ 5EG0A 2YUSA 1MNMC 5HAWA 3FISA 2ECCA 1AHDP 3HTIA 3GTMJ 1U8BA 1MSFC 5FKLA 1AU7A 2DG8A 1OFCX 1SGMA 4GCTA 5K7HA 3WHCA 1XC5A 4JX4A 5D18A 1SFOJ 1B72A 4FE4A 3F1BA 3BTLA 3LNQA 1NTCA 1MBJA 3HOZJ 3HOWJ 2DMUA 1ETOA 4X6AJ 3B6AA 2CUEA 2P81A 4RBOA 4YZEA 4I6ZA 2EQRA 2NOGA 3FIWA 4ABZA 2FJ1A 3VP5A 1ZR2A 2ZCMA 1POGA 2HXOA 4ICHA 2R93J 2QKOA 2UXIA 5FKMA 3BR0A 2G7GA 3HTHA 4A3MJ 3PO3J 1VFCA 4M3DA 3RD3A 3K7AJ 3B6CA 5K7FA 2B63J 3FRQA 5IYCJ 4A3KJ 5M3FJ 5F27A 3G56A 2DMTA 4XRSG 3FK7A 4GCLA 2LP0A 4ACIA 3HM5A 4BY1J 1S7EA 4A3GJ 2NVXJ 1I50J 3P9TA 1JUMA 1TWCJ 5K58A 1P7JA 4L5EA 1MH3A 3BJBA 2HOSA 5C4XJ 2QF7A 5CXIA 1DU6A 1MBKA 4MO7A 2NP3A 2JMWA 2GFNA 2CRGA 1GUUA 3OIOA 3WHBA 1RETA 3QQAA 1BA5A 2W53A 4IHVA 3KKDA 1MBFA 3F0CA 3JR9A 3NI7A 5CXGA 2QCOA 5DAJA 5FMPA 3EGQA 5D1RA 4M3BA 2XRLA 3S15J 4W97A 4QTRA 1HDDC 2QWTA 2HOTA 3AQSA 3IV5A 3ZQIA 5IP9J 4UUSA 3CQZJ 3LSRA 2JA6J 2VKVA 3Q3SA 2OF7A 2ZCNA 3C2BA 3Q0WA 3BG5A 2Y9ZA 2XSDC 2IAIA 1QPIA 2KT0A 3VVZA 1ETVA 3ON2A 2M8GX 4JX5A 4NDLA 3CJDA 5EYRA 1DU0A 3A01A 5IP6A 1TWFJ 1ETWA 3BR1A 1GV2A 1ETQA 2UXHA 2JN6A 1QRYA 1MSEC 2F07A 3KKCA 3Q0VA 5E3LA 2HXIA 3I4MJ 5EF6A 4JX6A 4ME9A 3I4NJ 3FK6A 1X58A 3GTOJ 4DW6A 2PZ9A 1ITYA 5HODA 2TRTA 3COLA 4GFKA 1WPKA 2K40A 3RQIA 3G1OA 1I6HJ 2VUMJ 3ZOBA 2CQXA 3GZIA 3CRJA 3HIMA 2X6OA 3BR2A 2XPUA 2NVTJ 3S1MJ 5F0CA 2L7FP 3VVXA 1ETKA 4A69C 2X48A 5FJ8J 2G7SA 2CJJA 3BQZA 4IEJA 2XB5A 4AC0A 3E7LA 4FCYA 1MBEA 1LE8B 4IHWA 2E2HJ 1TWGJ 4M3EA 1B8IA 2CU7A 1W0TA 1T33A 3C07A 1JUPA 1G2HA 4BY7J 1X2MA 1ZQ3P 2OI8A 2QIBA 4A3FJ 4MFEA 4V2FA 4BBRJ 1FIAA 2QOPA 2RHAA 4DYQA 2JA5J 2GUHA 1I3QJ 5DS9A 3HB9A 2R5YA 4DZJA 3BG9A 3MKLA 2YU9J 3HTJA 3QBMA 2M0CA 3T6NA 4PXIA 1P7IA 2EZHA 3DEWA 3S2DJ 5FGLA 4C3JJ 3HGGA 5J3LA 2M2EA 1K83J 3SJMA 2HYJA 5GPAA 2Y2ZA 1JTXA 3LJLA 3KZ9A 1FEXA 3TW7A 1LFUP 4JYKA 2MGQA 3CCYA 3UKGA 3RZOJ 3S5RA 5C3EJ 2XGEA 2EZKA 2ECBA 4UUSB 3HDDA 5GPCA
chains in the Genus database with same CATH superfamily
1D8KA 2KRHA 2HQAA 3WE2A 2JVGA 4ZYDA 1YJ9I 1FSHA 4LMYA 2Y30A 4XK4A 1P4WA 1T98A 5HNFA 1OKRA 2M3AA 2BHZA 1MBHA 4C30A 3BPXA 4I09A 2K9SA 1Y0NA 2MC4A 1U6GA 2P4WA 2Q2EB 1U5TA 1IUYA 1HOMA 4QPOA 3DTIA 1R71A 5FKOA 2Y0SN 3Q9VA 3WTXC 1W0UA 3RQ4A 2EZLA 1WCMJ 3GFMA 1EH8A 2MG4A 1HW2A 5ICFA 2ZOYA 1G6NA 1ORKA 2YSRA 2VXZA 4JP0A 3FXMA 3D1NI 2GLOA 1Z3YA 4FETA 4JK1X 4L62A 2TCTA 3ZQLA 2E2JJ 2X9DA 5AIPA 2X6WA 3RCOA 3PQJA 3OYNA 5M5WJ 1HCRA 2D5VA 2L0KA 3P9CA 1TBXA 1Y1WJ 5EZHA 1UG0A 1ZAOA 2VL8A 5HS7A 4DOZA 2VONA 2NYXA 3CF5F 4IO9F 3OYHA 2GBYA 2G7UA 2JA8J 1RESA 1K6YA 4CYCB 3WTYC 2KL4A 2O03A 3TO6A 4G94A 2DLLA 4NELA 4AYBN 1O3SA 1OCCH 4XICA 3CLOA 2XDNA 1R00A 4KUMA 5J4YA 1NH3A 3NRVA 2BV6A 1XS9A 2KPMA 5E3OA 2VQGA 2DMPA 5A2QK 3WTVC 3PNYA 1ZG3A 4ZZDA 5J1YA 2Y9YA 2O0YA 2XF5A 3HGYA 4UVAA 5C44J 3RH2A 1UAAA 1U5TB 5BNGA 1KU7A 1ZLKA 1T38A 4RAGA 2MH9A 2D45A 3BTJA 2PBXA 2JA2A 4YIIA 4IQJA 1YX3A 2E19A 3EYYA 5IT9Z 2HTJA 5E20A 4M3FA 4Q47A 4L9NA 3QODA 2DU9A 2P5VA 4P96A 4XLPF 3QYFA 4AU7A 2FNAA 3L2QA 5D19A 2L54A 4S04A 3IUVA 1I5ZA 1OJLA 4N4NB 2HDDA 2DA4A 4OWRB 3P5JA 5FD6A 2QUFA 1SFUA 2PG4A 2R7TA 4IHXA 5F0FA 2LBFA 1OCTC 1LVKA 1Z1DA 2L5QA 4IJAA 5CQGA 1BC8C 4M73A 1FOXA 3SDBA 1JE8A 3E6CC 3CMYA 2L4AA 4HNTA 3SXYA 4ZZLA 1N77A 3RJPA 2ZFWA 5H2FC 1FOWA 2Z99A 3T8RA 4CYDA 1BI3A 2M9HA 4HDUA 3K2AA 3AG4H 2RQPA 2DAOA 3BT9A 2KDZA 1AA7A 3F72A 2BXYA 2PEXA 2YVXA 4ETSA 1ZR4A 3DU5A 3AKZA 1X1PA 2IT0A 1SANA 2FQ4A 4G7ZF 1G3SA 1YQAA 2VLAA 2FA5A 1ULYA 3ESWB 1P92A 3ZQQA 3GVAA 4XBFA 2NS8A 1LFBA 2VB6A 5F04A 5K5QA 3JRIA 3S1QJ 4HW0A 2BEOA 1U2WA 4NB5A 3IKVA 2V6EA 3WU1B 1I1SA 1TC3C 2DCEA 4GYGA 4BUPA 1A36A 4F92B 2ZOZA 2L7KA 3MQ0A 4BS9A 5CW8A 1I27A 2EFPA 3IH3A 3J80Z 4XKCA 2DT6A 5HNHA 5D4SA 1FC3A 2EH3A 1GDTA 4RA2A 2EIJH 2HWVA 2W7NA 2IXSA 1SFKA 2QTQA 4BQOA 4F93B 4Z2YA 5DUIA 1E0EA 3KEOA 1IXCA 1XMXA 3EDPA 3BROA 2O8KA 5DTDA 3M4OJ 3VVYA 2XGXA 4Y7NJ 4D0PA 2XHKA 4ENMA 3QP5A 3IH2A 1IXSB 2IGNA 2DOEA 4BXUA 2IBDA 1T8IA 2FBKA 3L2CA 4JBAA 2MLGA 3S2WA 1KQ9A 3GTLJ 2HQ5A 4EQQA 2K9MA 1KZHA 3ZMUA 2B9SA 2JQ7A 3GLXA 5C4JJ 2C6YA 3VYUB 1TWHJ 1FYLA 1VQ9I 3ULQB 4ASNA 5CVVA 3VPRA 2WAEA 1KU9A 3JSOA 1BM9A 2H94A 3HSFA 2LKPA 5JFRA 4FX0A 1IUFA 2JJ7A 4LFUA 2FJI1 1R9TJ 2Z1DA 3ERED 2XSJC 3TL4X 4E4HA 1H89C 3ABKH 2QQBA 3LA7A 2F5VA 1G8XA 4II3A 3M8JA 2DXIA 3KNWA 3VW1A 1FBSA 1X1AA 3OYAA 2JRMA 2ME0A 3S93A 3J7ZI 4C3HJ 1Z3XA 4E7IA 1IW7F 1LKXA 4Q4ZF 1WH5A 3OIPA 2JA7J 4B47A 4EJTA 2DI3A 2IU5A 4BJ5C 3FXQA 3JRBA 1R36A 3G4SI 1B9NA 2IRFG 2CGPA 3S1RJ 4NC7A 1HXDA 2XPVA 2QM3A 1YFHA 1R22A 3PM1A 2XV4S 2X85A 2HI3A 3NXCA 3C1DA 4G6QA 1QA6A 1NK2P 3I54A 1HDPA 2Y0SA 3LA3A 3LSKA 1JGGA 2Y69H 2FF4A 1K79A 3I55I 1K78A 4OD4A 2HS5A 1X3WB 2M34A 4IZZA 4A3IJ 3S16J 1FMWA 1WJEA 2HGCA 2FMLA 4CA0A 4CO8A 4HNUA 3QPTA 2GA2A 1UFMA 2DTRA 2YX7A 4BE0A 2WC2A 3NWSA 2BXZA 3CDLA 3F8NA 1MD0A 4ZTJA 2QSHX 2R5ZB 1Y1VJ 2RREA 4HQMA 3MCZA 1ZH5A 3V7RA 1TTYA 2HU9A 2VKDA 2JRTA 1BW6A 1BC7C 5B5EC 4GCKA 1R1TA 4BQAA 3CCSI 3IHUA 2MW8A 3KX2A 2CV1A 3BTIA 2DA7A 3BOQA 4ZJZA 2BW3B 1GVJA 2RNGA 5FFZA 2GOMA 1EH7A 1ZTRA 3C2GA 2EV0A 2R7DA 4YRVA 2VC0A 2LR8A 3AFHA 4LLNA 2LH9A 3KYCB 2MSYA 4P9FA 3QP6A 2L01A 1F5TA 5J8FA 3HRTA 5ICGA 4HYEA 5F6FA 4PCQA 3KLOA 3KYDB 2XPWA 1MJ9A 2FUG2 1UMQA 3HEFA 1KONA 2K02A 4P1WA 3QPHA 2REKA 2XB0X 4U9NA 5EFYA 3CDHA 1BOAA 2L9RA 2LOOA 3TW6A 2V1UA 4I99C 3NS4A 3ON4A 1IDZA 1UI5A 4FE7A 2M4KA 3H3ZA 1B9MA 2WBMA 3U21A 4Z6YA 3A0HC 3HIFA 3KETA 2HDCA 3LFUA 5IYBJ 5D6FA 1IRFA 4L0YB 2WWYA 2MD0A 2K9LA 3C7JA 2KRCA 3K6GA 4GGGA 3CMMA 3CCUI 2D1VA 3DPJA 3K2ZA 2K9QA 3I9V2 2AHQA 1BL0A 2R3SA 5EG0A 4Y17A 3DWLE 3N05A 2KJCA 3OV8A 3FX3A 2IS2A 1VQ7I 1R1VA 1MSFC 1FSEA 2OQGA 3H35A 3D5SC 3UR3C 5ERIA 4M9XA 5H6RA 2KIQA 4PJNA 4EGZA 2PJRA 5D18A 2GQQA 1J5YA 1P2FA 4FE4A 5FRNA 3F1BA 2O3FA 3BTLA 4A2UA 1UHWA 3KP2A 1QQIA 3CC4I 2EIMH 1NG7A 4UB6C 2OCEA 4G7OF 2CUEA 2F6CA 4HOBA 3J80K 2IA2A 2L9SA 2NOGA 3FIWA 2FJ1A 2KKOA 2V1DA 5LHHA 2I5UA 3TQNA 4C2TA 2UXIA 2IGKA 3BR0A 2IJLA 4HSRA 2M5WA 3GW2A 2EINH 1IAWA 2UXXA 3B6CA 3RD3A 4A0XA 4GRIA 5LRRA 1SVOA 4A3KJ 4YFKF 4LD5A 2DJIA 2A05A 1RI7A 4XRSG 3FK7A 4ACIA 3FDYA 4MHGA 4A3GJ 3GZNB 3TBIA 2E1NA 1HA8A 1JUMA 2BE5F 2LNBA 1VQ8I 2MH2A 4EJVA 4EM0B 1P7JA 2LF8A 3HOSA 1XPXA 1WZ2A 5KK1A 1PYVA 1MH3A 1Y6IA 2F2EA 2HOSA 5CPRB 1DU6A 2X0LA 4MO7A 1PUEE 1LFPA 3CCEI 1DGRM 2HFHA 1ON1A 2EJRA 2KIFA 4PJLA 3R61A 5CVJA 4IHVA 1MBFA 1FT9A 3F0CA 3JR9A 3NI7A 2X6YA 2LY2A 2IS6A 1SC7A 2P6TA 4NUBA 1WQ2A 1FX7A 5FMPA 4M3BA 5D6EA 1ZRFA 3S15J 4QTRA 4KN4X 2BGCA 4BACA 3LWFA 1UELB 3ZQIA 1HW5A 4UUSA 3WU2C 1OR7A 3LSRA 2VKVA 3GMEA 2ZCNA 4XSXF 4RM2A 3MZHA 1ONVA 3C2BA 2VBYA 3Q0WA 4BE1A 2TDXA 4ZDOA 1QPIA 3ON2A 4JX5A 3CJDA 5EYRA 1SMYF 1GV2A 1ETQA 4WF2A 1DP7P 2B0LA 4M6XA 1E3PA 3Q0VA 1T0FC 3PUBA 5E3LA 3I4MJ 4JX6A 5EJCA 1HSTA 5CVUA 2PZ9A 2CQ7A 5D5UB 3N97A 5L3CA 1WPKA 2EWNA 2K40A 2VBWA 3KP3A 3U2RA 4MEXF 2VUMJ 3GZIA 4XR6A 1EKEA 1XGNA 3LAPA 2L3DA 3BR2A 3LL7A 3HIMA 2WAQA 4CICA 3WTTC 2BZTA 2DDBA 3GXOA 2G7SA 5J4VA 1K7AA 3LMMA 2XB5A 5H6QA 2E2HJ 2KP6A 3B73A 2R7XA 3MMYB 1F1ZA 1R7JA 2CU7A 3BCAA 5DCMA 1T33A 2IGMA 3LSTA 5E1XA 1JUPA 1X2MA 2EV5A 2OI8A 4Q5SF 4A3FJ 2RHAA 3N4MA 3V4GA 1J7KA 1HQCA 3PNVA 4B44A 1LVAA 4DZJA 2WADA 3CCVI 3QBMA 5CKTA 2HQNA 1ZARA 3T6NA 5FGLA 4F7ZA 3S2DJ 5DD8A 3HGGA 4C3JJ 4Y13A 3J7YJ 2HYJA 3L2RA 2Y2ZA 2QQ8A 1JTXA 5L3FA 1RR8C 3ECOA 3ECHA 1X1DA 5ILUA 5FGMA 1YS7A 3R6SA 2MGQA 3A1YA 2K7LA 4UUSB 3HDDA 3IH4A 1T56A 3B02A 2LVSA 1SD7A 4ZC3A 3PUFA 3QOEA 4HNVA 2ID3A 3FMSA 3DP7A 4RB0A 5DCFA 3T8TA 1IG7A 1D5VA 2VT2A 3OS0A 2HOAA 2K27A 1H0MA 2G7HA 4BXXJ 4HV5A 3LSPA 5FLMJ 5CVRA 1VQKI 5JLXA 3BLYA 3I56I 1W7PD 1Z77A 2XF7A 3V8JA 4MXMA 1YW8A 1VNDA 5IOYA 1RKTA 2YVHA 3H92A 1XGSA 1YOVB 1VQPI 4UV9A 2V26A 1ETYA 1K4SA 2E2IJ 4Y52J 3CWRA 4DJAA 2PMZA 1APLC 4E7SA 2L7MP 4TV7A 1NHAA 1HSJA 3C18A 3HOVJ 5EEAA 4EMSA 2EZIA 1VF9A 4NBQA 3GO5A 1KU2A 3ZMTA 2P7CB 2YS9A 1XD7A 3K70D 4GDFA 2DA2A 4IQ4A 3VYTB 3IC7A 1QHHD 4KWAA 3KZYA 1J75A 4UHTA 2LK2A 4B3XA 3EUPA 1C0WA 2PJPA 4ZDPA 3WGGA 3CDIA 2GXAA 3OYCA 1JKPC 5EGOA 1HC8A 2V6CA 3WTZA 5TRDA 4KIBA 3RYPA 2VKEA 2XGCA 3BG7A 4KITB 3J81Z 3A0BC 3E3VA 3O8GA 4YIFA 2ELJA 2VKHA 1HKSA 4CCNA 3NNRA 2FOWA 2XVCA 3K10A 3EUKL 1HF0A 3BRUA 2M4GA 1WSUA 3ONQA 5ED4A 4X0GA 1EF4A 4M6VA 3IWZA 1RIOH 2JTVA 1WWXA 4AVZA 2QEXI 1U78A 3LFKA 1MBGA 5EZGA 5LEJA 3U1DA 2VC1A 5KAFC 4OD5A 2YR2A 3EUAA 1J09A 1ZELA 1YIJI 1ENHA 3QAHA 5J8CA 4KYWA 5CQEA 4IOCF 4IVNA 2UXNA 4A5MA 2O5RA 4XN3A 2M0MA 3I4PA 2F4MB 1R4NB 3K8PC 3WODF 2E35A 2KZGA 2D1HA 2LLKA 2E1MC 1XCVA 2W84A 2P8TA 3O2PE 1YRNB 2G3BA 3LHQA 4LJZF 2FSWA 2ID6A 3LAJA 1TNTA 1LUJB 4XM3A 4UUVA 2V1NA 1D5YA 3KEYA 4PGGA 4EJUA 3BZCA 2ZCXA 4IKFA 2NP5A 1MW7A 4AYBA 2PQ8A 3VB2A 1OCZH 2F48A 2ZFUA 4HX8A 2W48A 3F22A 5E8IA 5GADJ 2PN6A 3VW0A 2KZVA 2A6EF 5FD5A 4WXHA 3HHHA 1GXQA 3FBNB 4XMYA 4F3QA 4AUXA 1KGSA 1JGSA 2VBZA 1JJ6C 4FTHA 3ABUA 4OAYA 2PI0A 1W1WE 4HX7A 3KP6A 4GYIA 2W82A 2RASA 5JLWA 3GEUA 5JHUA 3HOTA 4L9JA 4ESBA 5FLXK 4L5JA 4LIUA 5FKNA 1JJ8C 3GLLA 1WGXA 1G3WA 2ZMEA 4NHJA 2ELKA 2RQQA 1WJBA 1BI1A 3H0GJ 3WGHA 1KQ0A 2DFIA 2HKOA 3PNTA 3VOXA 3EUHA 2CFOA 4LK1F 4PJ0C 4UUTA 3WTUC 4IRVA 2XKPA 4QIWN 3F21A 1J2XA 4G12A 3SWHA 1X3ZB 3H5NA 1SEUA 5BQTA 3TEDA 2XGDA 3CD6I 2FE3A 2OERA 4CCJA 5B1AH 3K0LA 4OMYA 5AIQA 3M7GA 2JK3A 4LLLA 5HS8A 4P55A 4W1UA 5HLGA 1YI2I 4NC6A 5GAHJ 2BVLA 2LKXA 5E79C 5JI6A 2JZYA 4E7ZA 2KDOA 2EA2A 4H4KC 1I6XA 1YE9A 3OY9A 4J00A 4R79A 1O3RA 3MVPA 1IN6A 3ZQHA 1MMGA 3OYIA 5F64A 3VIBA 1IRZA 1Q1VA 3E0JB 3NARA 5GTIC 5H20A 3JSJA 2CV2A 1JI8A 1B6AA 2CH0A 1TQIA 1FPQA 4U0VA 2XAQA 3CMAI 4I76A 2LBFB 3J7AY 3DEUA 3K4JA 5LBQA 2E7XA 4HDVA 2A2FX 3KP7A 2IA0A 2RAEA 5F1JA 1TL8A 3JCUC 1YHQI 3RYRA 1Z6RA 1TT5B 2ZMEC 2LKSA 4ESJA 1YITI 4JNNA 1JKRC 4I01A 2RN7A 4A5NA 3OYKA 4BL0B 4HZFA 2BVMA 2UV1A 4HKUA 2D2WA 2VQLA 5HS9A 3AQTA 2OZ6A 3ZQGA 3TOBA 1UCRA 3HUGB 3TP0A 3QKXA 1XGMA 4LITA 1MIJA 4HBLA 1FTTA 4RB3C 4HX4A 2BY0A 1O57A 4LK0F 3L1PA 4BBSJ 3A2KA 1B72B 3V78A 2V9VA 1XMAA 2J5PA 3G1MA 4RAZA 5BPIA 2Q1ZB 4ANJA 1Y39A 2ZSIB 5E3NA 1TLHB 2GZWA 2DFFA 2CW0F 2BY3A 5B3SH 5ICEA 4BKXA 1YRNA 2FX0A 3M8EA 2FBQA 2R7VA 1X3UA 3BR3A 1H9TA 2LFBA 4J19A 1A04A 4CCOA 4KIFA 5LHGA 3Q0UA 4OIPF 2PMUA 3W3CA 3BR5A 3SFIA 3G6EI 3ASOH 1Z21A 3RPUA 3EYIA 3ZXSA 1MJBA 1MH4A 1W7PB 2DMQA 1O7LA 1WJFA 1IJWC 3DXJF 2COBA 1DQUA 4HA8A 1V5GA 4E7JA 3OYBA 4CGRA 3KZIC 3I71A 1U9NA 4XSZF 1H8AC 4NN1A 2GIVA 1VI0A 4XONA 4KT5C 3VEPA 2VPRA 3DTEA 2QSFX 1TW2A 4CZZA 4LLGF 4OIOF 4UB8C 5K5RA 1KYWA 1QVTA 2FBHA 2K4JA 3JRFA 4E7LA 3JW4A 4M3GA 3HUGA 1V4RA 2ZKZA 2DPUA 4XLEA 3GUDA 1YX5A 3M1EA 2K9NA 1F9NA 3BCGA 2UZKA 3VOKA 1RR7A 1F36A 2O9LA 3CZ6A 4DZPA 1BN5A 2EK5A 4M6YA 1WI3A 2CWEA 2M45A 4S0HB 4BGDA 3KCCA 4RMNA 2YUSA 4RB2C 1MNMC 5HAWA 3FISA 1GXPA 1AHDP 2RDPA 4KMFA 3CMEI 3HTIA 5CJ9A 4EGYA 5FKLA 2E1MB 3M9AA 1AU7A 1D1CA 1SGMA 1ACIA 1BR2A 1XC5A 4JX4A 2M7AA 1S8NA 2PLYA 2DDAA 2WV0A 3F8CA 2V9KA 3LNQA 1NTCA 1QNTA 4MQ9F 3JAMZ 3HOZJ 2OC6A 3HOWJ 1VQOI 1J9IA 3B6AA 1W7PA 2P81A 4RBOA 4I6ZA 3OMYA 2M87A 3E6BA 3FBIB 3E5XA 1POGA 1YTYA 1QGPA 2OUMA 2HQRA 4B48A 3K7AJ 1W5CC 5K7FA 2B63J 2IP2A 3FRQA 5M3FJ 5F27A 2NRAC 2DMTA 2LP0A 3U1KA 4WIBA 1KU3A 5FO5A 2VASA 3KP5A 1R5GA 2O8XA 1I50J 2FMYA 3QWLA 1R5HA 3EETA 3P9TA 1TWCJ 2DK8A 2XAHA 3K4NA 1V55H 5K58A 1ZRDA 1XMKA 2Y0MA 5L3BA 3CCRI 5C4XJ 4WXCA 2EA4A 1TZLA 2ESHA 1ZGJA 2CFXA 4Y3OA 2CRGA 2XC7A 2H09A 1TT0A 1HW1A 2DYSH 1RUOA 1B4AA 1RETA 2R7UA 1JXSA 3L9FA 3RI4A 3FM3A 2QCOA 5HDNA 3D5LA 5D1RA 3SYTA 2XRLA 2QWTA 1KA8A 4W97A 4IOAF 1MMAA 3HYIA 3VYRB 3V7SA 2W00A 3CQZJ 3ZR8X 2VPLA 1MNEA 5EEGA 3Q3SA 3BJ6A 2ZJ2A 1DPRA 5FLXZ 2FQ3A 1YS6A 2XSDC 1OYYA 3E6DA 2OA4A 3P7NA 4HF1A 2M8GX 4NDLA 3DPUA 3FMQA 4KFCA 3A01A 1ETWA 2UXHA 2JN6A 3DF8A 4N9IA 3KEQA 3OS2A 1G3TA 3FXJA 3I4NJ 4JOMA 3ZRGA 5HODA 5LRSA 1ITYA 1WRJA 4U0WA 3RQIA 2FBIA 1I6HJ 1PP7U 3ZOBA 2F5CA 4B8XA 3CRJA 4WCGA 2X6OA 2XPUA 1U5TC 1WKMA 5IT3A 3CUOA 5BS6A 1KQ8A 4A0ZA 3BQZA 1S29A 3DKYA 3HRMA 4IEJA 5B1BH 3SZPA 3E7LA 1J0RA 4IHWA 3ZMSA 2AQEA 3HRUA 2L9NA 3WGIA 1IF1A 5TJJA 3HPHA 4EVIA 1G2HA 2HZDA 3KZZA 2K86A 2MLKA 2VIXA 4N9HA 1Y0UA 1P9QC 2JA5J 2GUHA 4M9ZA 2OJED 2R5YA 3MKLA 3SEQA 3CP8A 3HTJA 2VJJA 3T0YA 2DW4A 2EZHA 2M2EA 1K83J 1OYIA 2NS0A 5GPAA 1PVEA 2KIUA 5FRMA 1OLTA 1FEXA 3NQOA 3CCYA 3S5RA 3CUQC 2XGEA 3ABMH 4QPQA 5D4RA 5TGTA 1ZN2A 2OV7A 5KNLA 3F23A 3OYDA 1DDNA 4UVBA 4RGXA 4DVYP 3KIOA 4LOCA 2F4IA 5EEHA 1X4OA 3OR2C 2A6TA 2P7VB 4FISA 4NQWA 4IHYA 2LRDA 4FHTA 4YELA 1AKHB 3P9IA 1CF7A 2VJ5A 2GA1A 1IXRC 2KFDA 3GCMA 2ESNA 1JTYA 2HTSA 3QYEA 1JHFA 2FU4A 3H5RA 4U9LA 1LQ1A 1VQLI 1D1AA 2R5YB 4L18B 3G73A 3ANPA 2Q0OA 2QZ8A 4MQVA 3GTGJ 2JT1A 5CYVA 2KRFA 4G9YA 2K4BA 4A0YA 1YLFA 1Z7LA 1IO2A 3PSIA 1PUFB 1QZZA 3W6JB 4CCMA 2LDUA 3QOPA 3G2BA 1W5SA 3ABLH 2HPMA 3VOEA 4IL6C 2QENA 1BJAA 2FOKA 4KIGA 4ZYHA 2WUIA 3FXOA 4CCLA 2WAQN 3DPTA 2F5DA 3L00A 3IKTA 4Q48A 3GTJJ 3DFGA 3DKXA 4IRHA 2OU2A 3JRHA 4RDUA 1X2NA 3GTPJ 3IAM2 1A31A 2G7LA 3H3UA 2PFBA 3W6VA 4ON0A 4U88A 2UXPA 3ZMVA 4DQ2A 2VJ4A 3B81A 2PJRB 1JUSA 2Q24A 5DM6F 4ITVA 2WA0A 4U0YA 1ZRCA 3HSRA 2Q8KA 5M5YJ 3S3NA 3LSMA 1FJLA 4EM1A 2W4SA 1YO5C 3RPUD 2A07F 3R4KA 2ELHA 2GAUA 3CCQI 3IRQA 3DLLF 1SMTA 1NK3P 3VUQA 2R7ZJ 1I39A 3H9GA 1FYMA 3TP3A 5LGUA 4PDKA 4DYRA 2H6CA 1MNDA 2XAFA 1R23A 1WH7A 1A6IA 3ML6A 4RB1A 1CGPA 3CTAA 4BDZA 4A3CJ 3TOAA 4XOTA 2HYFA 3PL8A 3K69A 1S5LC 4D9JA 4RLFA 5GTHC 4FASD 3PIPF 1D0ZA 2WY8Q 2M8EA 1ZHFA 3OYLA 4KNYA 2OPTA 3QYBA 2XUBA 1MDMB 3VWBA 4AIDA 3G7RA 3WE3A 2LY9A 1D0YA 2R7WA 3ZGKA 4O5VA 2FRHA 1G4DA 4A3BJ 2W24A 1D8JA 3LWJA 5D8KB 1QZYA 4A3EJ 4L9VA 1GV5A 1LE8A 3JRAA 1ZREA 3DBRB 3GBGA 4BHPA 4FT8A 2HPIA 5E8GA 1K4TA 3F9KA 3CJNA 3T1BA 1EV7A 2IEKA 4C9YA 2JVHA 2Z2SB 1Y8QB 4XL9A 2LREA 4YFXF 3G1LA 5JVGF 4XOPA 4BH9A 1TWAJ 1W5TA 3L2VA 5IT9K 2JUCA 3NRGA 1JT6A 1IN8A 3HTAA 4X1EA 4Y4RA 1T2KA 4D5CA 3GFLA 3HOXJ 2MA3A 1IZ1A 1MZBA 5K7ZA 1L3LA 3F8FA 3RKQA 3ZQ7A 4XKBA 4PGHA 1YJWI 1U3EM 1YW7A 2V57A 3HC7A 3BG6A 4GXOA 9ANTA 1S3JA 4R8HA 1JKOC 1QHGA 2OBPA 2X4HA 2E5ZA 1VQ4I 4HLXA 1GLNA 2QVOA 3MWMA 4LG0A 4PJJA 1OMIA 4D7MA 1ZYRF 3LQQA 2K85A 3VDXA 3FWEA 2L2OA 3I59A 1LJ9A 3IUOA 5HBUA 2NOJB 3BHQA 1D0XA 2IS4A 1G59A 1YIOA 1WVRA 3TO7A 4HF0A 4HV6A 2QKLB 2XRNA 4NC8A 4FX4A 4E7KA 4IHSA 2RC4A 3VYSB 5F0HA 4GFBA 3AAFA 1IDYA 3E97A 3F6VA 3IAS2 2EPFA 1IC8A 3HXLA 1BJZA 3ANGA 2DOFA 3QU3A 3NPIA 1R58A 2CO5A 1FY7A 3JSPA 2EFWA 1IGNA 3KP4A 1R5ID 1PDNC 1STZA 2QA4I 3HSEA 2OAZA 4B3AA 4I98B 3OWTA 2JSPA 2UWMA 2LD5A 1S7OA 3RPQA 3QPSA 4LG0B 3OL4A 5DV5A 4B43A 1S6LA 2COMA 2K3PA 3CUQA 2V1XA 4EJOA 4U7BA 4ENKA 2O61A 4UDSA 2A68F 5BPDA 1Z0XA 5AQCA 3JREA 3K4CA 2ME6A 1WJDA 3GX4X 3PSFA 1QPMA 2XROA 3BPVA 2CW8A 3TO9A 5D5VB 4II2A 4ZTFA 3LSIA 3LSGA 5K1YA 5LEKA 3JRGA 5FHPA 3W2VA 5LD2C 2L7ZA 2Z33A 3HOYJ 3TKYA 1N75A 5GP9A 5E3MA 2LYCA 4O6JA 1YJNI 1XTAA 2BBYA 1R4MB 2YU3A 2NAZA 1U9OA 1H88C 3HE0A 3OSGA 5HDGA 3AG2H 3FXRA 5HLHA 1XDUA 4V2GA 3JRDA 2HVQA 1SAXA 4RM3A 2LSOA 3S14J 4AF5A 2OTJI 4HLYA 3MN2A 4G8XA 3OYGA 4E7HA 2MD5A 1R6RA 2X1CA 3IRRA 3Q9SA 2KISA 1AKHA 3L09A 2QGUA 3I59B 5IY5H 3PASA 4OU0A 1UI6A 2R4GA 1JKQC 2L9VA 4I02A 2XAGA 4ZYEA 4P9UA 2BYVE 4BHBA 4GO1A 1MMSA 3JRCA 2QWWA 2DBBA 2ZXWH 3MZYA 3CP2A 4L0ZB 2XF6A 3I64A 1WJCA 3DCFA 5LFAA 1IRXA 2Z3YA 5EGOB 1DPUA 5L3DA 3RKWA 4AVPA 2NVUB 3FXLA 5J40A 3BG3A 2OZUA 4A3LJ 2NS7A 3FF5A 3WG9A 3BZKA 1UG2A 4AIJA 3MZ8A 1FYKA 3F6OA 5IOZA 1XGOA 2YVEA 2EFOA 1RNLA 3M8FA 3RDIA 4BHCA 2R7SA 2X1DA 3ELKA 2DA6A 3BZ6A 4OINF 5F08A 2ZY9A 1FOKA 1MMDA 3HOUJ 3PIOF 3D0SA 2WB1N 5CVIA 5FFXA 2MFZA 1T39A 3VTIA 5GAEJ 4KT6A 5JVTA 2LTPA 1O4XA 3PPBA 4WWCA 1ZGWA 2KLOA 1OPCA 1B1BA 2CUZA 5DUKA 1RUNA 4K2EA 5E17F 5M5XJ 3HTUA 4XLCA 4D5FA 4XLFA 2NX4A 1IN4A 2GWRA 2DYRH 2DJNA 5BMZA 3W2WA 3HZJA 5J6XA 3RZDJ 2A5YB 5LLQA 4ENJA 5FKKA 3FKIJ 3DEEA 3Q5FA 3FKJA 3DQVC 3O8HA 4M9SA 3MD2A 3R0AA 4CDGA 5FLVA 2KIMA 3FM5A 4CSWA 4XLNF 5DM7F 4DNCA 2L4MA 4ZH4F 1U8BA 3CC7I 1O3QA 3CJQB 3BJAA 2QBYA 2HNHA 5K7HA 4J01A 4M74A 3WHCA 3MKYB 1RZ4A 3JAMK 3HRSA 4BAYA 2W57A 2STWA 2OD5A 2NXNB 4ENNA 2K5CA 2DMUA 2LMDA 4DIQA 3CO6C 2MBFA 1ETOA 3KYLA 3OYFA 4BYYA 3E1SA 1K6OA 4ABZA 1PP8F 3VP5A 1ZR2A 2ZCMA 1RRJA 2HXOA 3AL0C 5F1RA 1EJ9A 2QKOA 3TDUC 5FKMA 3HTHA 2KJBA 4XKVA 5K5OA 4M3DA 2ZCWA 4PFOA 3OYJA 2V4JC 3ABTA 4MTDA 2LC2A 3FMRA 5IYCJ 3ZN1A 1FZPB 2KHMA 2GXGA 2ZO4A 4D1QA 3J81K 2Z9OA 1ON2A 3DLAA 3LSHA 3O6BB 4BY1J 3E5QA 1S7EA 3CCMI 2E1CA 2CMPA 2NVXJ 3T5XA 2Y48A 3BWGA 2QKMB 1X1CA 3K1PA 2VXDA 4L5EA 2B3WA 4BJ6C 4DBQA 2RVCA 3BJBA 5CXIA 2GFNA 1WFXA 5LHIA 2NNNA 4ZDLA 2A3SA 5TISC 3BCBA 1J59A 1BA5A 3J7AO 2W53A 5KVRA 2E5NA 2XDVA 4PUSA 3KKDA 3S8PA 4BNCA 3U9GA 1LPQA 5DAJA 2VODA 3S3MA 3K4KA 3EGQA 1ZGAA 3C3WA 3S3OA 1HDDC 3AQSA 2X1EA 2HOTA 3PFIA 3IV5A 2P5LC 5D8LB 1BOBA 1QZEA 4P5OA 4HSTA 1QU3A 2CYYA 2HOEA 3TGNA 3G71I 5HDKA 1AWCA 2Y9ZA 1SVMA 1Z7UA 2IAIA 2VE9A 1IV8A 3L2UA 1BIBA 3I53A 1ETVA 4U87A 2DPDA 1BR1A 1TWFJ 3BR1A 3GZ5A 2A5WA 3DV8A 1QRYA 2W1OA 2JSCA 1MSEC 3ROUA 3ZN0A 4HPQA 2F07A 3SHFA 1MMNA 3H5AA 4NQWB 1LEBA 3CC2I 4AIKA 2HVSA 1QBJA 4UVCA 4ME9A 3FK6A 4DW6A 3COLA 1MJAA 4GCVA 4CZCA 2A61A 2BOLA 2NVTJ 2XKOA 1S7AA 3S1MJ 4L9TA 5DYMA 2L7FP 3VVXA 2H27A 1ETKA 5FJ8J 2X48A 2E34A 2EFQA 4AC0A 4FCYA 1MBEA 5KHDA 1LE8B 4OAZA 3P9KA 1TWGJ 1TQMA 1W0TA 1VQ5I 1OISA 3A4CA 4LB6B 3C07A 4BY7J 2QOPA 2QIBA 4V2FA 3CCLI 2HDWA 3ZMZA 3BDDA 1I3QJ 3F8MA 4F55A 2NNYA 2OCCH 4EM2A 2ZBKA 2J5OA 2YU9J 2X51A 3H9QA 2M0CA 1DUXC 2V79A 1XCBA 4PXIA 3O3KA 4G6TB 4OMZA 3JTGA 4E6KG 1X1BA 4BEHA 2EILH 3H0DA 3TW7A 5J47A 4UY8I 3KFWX 4JYKA 3UKGA 3SZTA 2EZKA 2ECBA 2XAUA 4Y15A 2QSGX 5ICCA 2HKXA 3H9JA 1OCRH 2BY2A 1MGTA 2ZJPF 2DT7B 4I7HA 1SVLA 1M1EB 4BQQA 3V7CA 1HBXG 4C3IJ 4O3MA 1G3YA 2V7FA 2VJIA 1FWZA 2VOPA 1GVDA 5C4YA 4A6EA 4IX7A 2XIGA 4XNFA 2WGBA 2EFNA 1FOYA 5EDNA 1BBYA 3BNIA 4JL3A 1VTNC 1FP1D 2R7RA 3HG9A 1P6RA 4DGWB 2VI6A 3A02A 4FQGA 3CLQA 3K1MA 1V54H 1UJ8A 1DP3A 2PBIA 3M1CA 4G6DA 2MC3A 3WTSC 2M30A 3EPZA 2VOOA 3CJRB 1VQMI 4HRIA 3OS1A 1SD5A 1B8IB 1IN7A 4CYCA 4JKZA 3KLNA 3RIRA 2V9PA 4IHTA 1DGWY 5HSZA 2EB7A 3D5RC 5FB2A 4CH7A 4B1RA 3M3YJ 2CQKA 1V5EA 1IRGA 1IV6A 3VODA 3ZP5A 1YW9A 2DODA 4XRFA 4GFLA 3OL3A 2HVRA 4KISA 4MEYF 2GXBA 3HTSB 3TMOA 2BW3A 3ISPA 3WTWC 4KA4A 1ZK8A 2WY7Q 5A2QZ 2DT5A 2I8DA 3ZPLA 1SAUA 2VQCA 3SDGA 1YYVA 2AS5F 3ZQCA 1LNWA 1BI2A 1FBUA 1XG1A 2ZC2A 3IP4B 4EEFG 2D6YA 2DO7A 2BHYA 1Z9CA 2FNPA 3DTKA 1BR4A 1P4AA 2K3FA 2KMUA 3LQRA 1YG2A 3H1CA 2PX9A 4MK6A 2IVMA 4XIDA 1FMVA 5DCMB 5HLIA 1A6QA 3K70C 3HJEA 3K4LA 3FZVA 1OCPA 3E5UA 4C2MJ 1QO0D 5IYDJ 3DBHB 4HEA2 3KPHA 3OYMA 2ACJA 2R92J 3K4BA 2CS3A 3RKXA 1A35A 2Y31A 5J1RA 4CCKA 5IP7J 4I0BA 2HZTA 3BQYA 2XASA 4RGUA 3H3VK 4BXFA 5GAGJ 1X4PA 2DTZA 3EUHC 1Z91A 3WG7H 1IN5A 2CG4A 2WV1A 4OIQF 2LF7A 3MEXA 3UNGC 3IL2A 1HLVA 3S17J 5LGNA 2DFEA 2DQLA 2FXAA 3PQKA 1R1UA 1Q1HA 2ZSHB 3OIQA 2ZXHA 5GPCA 3FHZA 3L7WA 4R1HA 2GENA 2X6XA 1QVUA 1XSVA 4NNJA 4XKWA 2ZB9A 5DDGA 4Y33A 2LG4A 4IPAA 1REPC 4MNUA 3HL2A 1CQTA 3GTQJ 1UZCA 2EBIA 1HKTA 4LB5A 4RLQA 3O60A 3COAC 5IPAA 3F8BA 4RGRA 2ZJQF 4AWXB 4HQEA 1LB2A 2ZXIA 4MLOA 4MGRA 5J1UA 4WX9A 5KAIC 2DA5A 1U0JA 3OOUA 4PFPA 3RSNA 2HKUA 3I0TA 3QPLA 3A01B 2I10A 1WJ5A 3K9TA 1A5JA 2FD5A 3MNLA 1PJRA 4CGZA 2DQRA 1W36D 3ZQFA 1E2XA 2HYGD 3I5UA 1V5FA 5HLTA 3W2AA 3R60A 4HF2A 2F5FA 2ZNYA 4CXFA 3GZ6A 1VZ0A 3GYHX 4RAYA 4DYCA 2N8GA 3PJRA 4YEJA 2CQQA 3SFZA 1HKQA 4MIMA 2NVYJ 4RAFA 2CQNA 2UXUA 2H6BA 4AIHA 4A93J 1E3HA 4ZYGA 4XLHA 4BE2A 1ERDA 1BW5A 2YPRA 5HVQC 2F4OB 2H8RA 3X2QH 2KQRA 4AM3A 4IXAA 1ZKGA 1K61A 1L0OC 3HKZN 2DN0A 4YIRX 4B4CA 1BIAA 3FHNA 1N25A 4RGSA 2G0EA 5D5XB 2Z16A 1SD4A 4WK8F 4G7HF 2JPBA 1NG6A 2AXTC 4A3JJ 4F91B 2E36A 3I3LA 3DKWA 2RNJA 3W6KB 3E7QA 3JTHA 2NVQJ 1F43A 1Z05A 2JWTA 3VFZA 1ZG5A 4UXNA 4RS8A 3MKZA 1TP4A 1EA3A 5ILSA 2A6HF 1USSA 5B66C 2QLZA 1FIPA 2IW5A 1WI9A 3NAUA 1GT0C 1XB4A 4D7NA 4UV8A 2MABA 2R7OA 2R0QC 1W36C 4KDPA 3BTCA 4KMUX 3KE2A 4YG2F 1VQ6I 3CUQB 1SFEA 4XRMA 1XSDA 4A3DJ 2Y75A 3H36A 2P5KA 2CW7A 3TDZC 3RKYA 3LSJA 1R49A 3AG1H 3OR1C 1F4KA 1UHSA 4IRIA 4L5IA 3REOA 2HYTA 3K1NA 1Z67A 4KJZA 2H1LA 4PK4A 2H1KA 3L2WA 2O7TA 2P0WA 2AQFA 2EIKH 4MFDA 4BJTA 1XX5A 3EQLF 3PO2J 2A69F 2MYSA 1ETXA 2E1OA 5LGTA 3V6GA 3HHGA 1OCOH 2AO9A 4UNOA 3F3XA 4M71A 2QBYB 2CUFA 2DA1A 5E1ZB 4EJWA 1E17A 3BJOA 3SEZA 1JT0A 2STTA 2G9WA 2M1BA 3CF2A 3IWFA 3S2HJ 3LOCA 4XN0A 4IRGA 3GTKJ 1T95A 4F52A 2DG7A 5L3GA 1TW3A 3G3ZA 4XRSA 4OIRF 3CJTB 3BP8A 1LDKB 1RC9A 1XN7A 1AOYA 1OYWA 2UXOA 4QSHA 5JR3A 5KCMA 1ZG1A 4B09A 2IPQX 3BY6A 4AD9A 4XORA 1RPWA 3PFYA 1LDJA 1LDDA 2DA3A 4MTEA 2B1EA 3E6MA 1P4XA 4YFNF 1FTZA 4XLAA 5H9TA 1Z6TA 3VW2A 2O7OA 2GM4A 2ADUA 3V42A 4H0EA 3A03A 1MDMA 2DMNA 4JQFA 3GFIA 2ZXJA 4I2OA 1TQPA 1SD6A 5CLSA 1UB9A 3HBLA 2QYOA 3BR6A 2CV0A 3NEUA 3ERMA 1W4MA 4AC6A 1E3OC 2OQRA 4A12A 3OSFA 2PMZN 1VQNI 2Z5UA 2RKHA 1RKWA 3SQNA 1CF7B 1T0FA 2E7WA 3MFKA 1TNSA 2R5ZA 5FROA 2ZJRF 2CSOA 5EG0B 3S1NJ 3OYEA 1SFXA 3CO7C 1PUFA 1T6SA 5M3MJ 1KYZA 2VN2A 2ECCA 2ETHA 2VT3A 3GTMJ 2VQHA 2DOAA 2DG8A 1OFCX 4GCTA 1O3TA 1OQYA 1SFOJ 1N78A 1B72A 2XAJA 2E60A 1FNNA 1MBJA 2QQ9A 1JHHA 3AL0B 4QWQA 2CUJA 2GIZA 4X6AJ 1I3AA 2AXLA 2Q2EA 2O6GE 5DEQA 4YZEA 2EQRA 2ICWG 4EATA 2BY1A 3DPLC 3VSKA 4U7DA 3CCJI 5L3EA 4WXDA 1XDSA 4ICHA 2R93J 4BDYA 2G7GA 2HR3A 4A3MJ 2E71A 2R7FA 4PSXA 1VFCA 3WU0A 3HKZA 3PO3J 2IA1A 4KN7X 1WHUA 3GFJA 1FBQA 5BOXA 3G56A 6PAXA 2PFVA 1LEAA 4GCLA 3FXKA 3HM5A 3K4MA 2H8WA 2ISYA 2PMHA 2IS1A 1I1GA 3LA2A 5E1WA 2ZNZA 4LG3A 3MKWB 3GEZA 3SZGA 1USTA 1U8RA 2JUGA 3GF2A 3OOPA 5ILVA 2QF7A 1D1BA 2M7BA 1MBKA 3ZMDA 2NP3A 1X19A 1V3FA 2JMWA 2VBXA 1GUUA 3OIOA 4M72A 3WHBA 3QQAA 2DFHA 1WJAA 4S05A 2W85A 5CXGA 5E18F 1XSXA 4QLCU 1S72I 4XQFA 5HOOA 3BC8A 2LY1A 3C2HA 3NWTA 3QRFF 2B7EA 5IP9J 2UUZA 4ESFA 4LGWA 2JA6J 2OF7A 2W25A 4BEHB 3GWZA 4N0BA 4PZJA 3BG5A 2FEZA 2EV6A 4N4OB 2KT0A 3VVZA 3R0JA 1DU0A 5IP6A 4E70A 4A6DA 4HAMA 3FXUA 1BI0A 4CHUA 3KKCA 1D3YA 2HEOA 1O7FA 2HXIA 5EF6A 4BU2A 4EV0A 1Y8RB 1X58A 3GTOJ 4GFKA 2QQAA 4ZYAA 4OOIA 2TRTA 1FP2A 5D5WB 5AONA 2ZMEB 3G1OA 2ISZA 2R7QA 4BQNA 2CQXA 3DU6A 3QU6A 1FLIA 4IF4A 4KICA 5F0CA 2F5EA 4HG2A 4I0AA 4A69C 3V8LA 2CJJA 5DD4A 2RV8A 1B59A 1OR7C 4C2UA 4M3EA 2WB1A 4CUGA 3RTRA 1B8IA 1ODDA 4V19K 4C2MA 1ZQ3P 2RGVA 3DBLB 3MAJA 2P6SA 2JPCA 1FIAA 2DK5A 4LIVA 4MFEA 4BBRJ 4DYQA 4PSWA 2OTLI 5DS9A 1K78B 3HB9A 3BG9A 1S9HA 2YX4A 3V8KA 3HPGA 1ZLJA 1GHCA 1Y56A 1P7IA 1T08B 3DEWA 5JHFA 3S32A 3ZCOA 2VE8A 3M07A 5J3LA 3SJMA 3LJLA 3AG3H 2GOXB 2L02A 4DBRA 1UHMA 3KZ9A 2WAFA 1H9GA 3ASNH 3I58A 3VSLA 4PJMA 1LFUP 3RZOJ 5C3EJ 2IGOA 2WTEA 3CESA 1EH6A 1MKMA
chains in the Genus database with same CATH topology
3IH4A 1T56A 2LVSA 4LOCA 2Y30A 4HNVA 2ID3A 4XK4A 4FISA 4IHYA 1IG7A 2HOAA 4BXXJ 1MBHA 4C3IJ 1AKHB 2K9SA 3LSPA 5FLMJ 1HOMA 1GVDA 5C4YA 5JLXA 5FKOA 2Y0SN 1W0UA 1JTYA 2EZLA 1WCMJ 2WGBA 2MG4A 1Z77A 4MXMA 2ZOYA 5IOYA 1VNDA 1RKTA 5EDNA 2YVHA 1ORKA 3BNIA 4JP0A 2GLOA 3D1NI 4JL3A 4L62A 2VI6A 2TCTA 3A02A 3ZQLA 2E2JJ 1ETYA 2X9DA 2R5YB 3ANPA 2E2IJ 5M5WJ 1HCRA 4Y52J 2D5VA 2L0KA 3GTGJ 3CWRA 1APLC 1PUFB 1B8IB 2L7MP 1Y1WJ 5EZHA 4CYCA 4JKZA 3HOVJ 2GBYA 2JA8J 1RESA 5HSZA 5EEAA 4CYCB 2EZIA 4B1RA 1VF9A 2WUIA 3M3YJ 4NELA 2WAQN 4AYBN 1IV6A 4GFLA 4XICA 2YS9A 3GTJJ 2DA2A 2XDNA 3JRHA 4KWAA 4RDUA 1X2NA 1ZK8A 3GTPJ 2LK2A 1XS9A 2G7LA 3EUPA 3W6VA 3SDGA 5E3OA 2DMPA 2UXPA 3ZQCA 5J1YA 3B81A 2Y9YA 3HGYA 5C44J 1JUSA 1XG1A 3RH2A 2Q24A 1JKPC 4EEFG 5M5YJ 5EGOA 2D6YA 5BNGA 1FJLA 3BTJA 2PBXA 2VKEA 2XGCA 4MK6A 4XIDA 3O8GA 2E19A 1NK3P 4M3FA 3VUQA 1OCPA 2R7ZJ 3NNRA 4C2MJ 3TP3A 5IYDJ 1HF0A 3BRUA 5D19A 1EF4A 2R92J 4M6VA 4DYRA 3IUVA 2Y31A 1WH7A 1A6IA 5J1RA 1OJLA 2HDDA 5IP7J 4A3CJ 2DA4A 1U78A 3BQYA 1MBGA 5EZGA 4IHXA 3H3VK 5F0FA 1OCTC 2DTZA 2OPTA 1ENHA 3G7RA 2LY9A 2WV1A 3CMYA 4A3BJ 3LWJA 1HLVA 3S17J 4A3EJ 1GV5A 1LE8A 3JRAA 2M9HA 3GBGA 2LLKA 2G3BA 1YRNB 2GENA 3K2AA 3LHQA 1QVUA 2IEKA 2ZB9A 3BT9A 2KDZA 2ID6A 1CQTA 3G1LA 1ZR4A 3GTQJ 1SANA 2EBIA 1TWAJ 1D5YA 3NRGA 2FQ4A 1JT6A 3HTAA 4X1EA 3O60A 4D5CA 3HOXJ 5IPAA 2ZCXA 2NP5A 5K7ZA 2NS8A 1LFBA 4MLOA 3RKQA 5J1UA 5F04A 2V57A 3JRIA 3S1QJ 2DA5A 2W48A 3OOUA 9ANTA 2HKUA 3VW0A 3QPLA 1TC3C 3A01B 2I10A 1JKOC 2ZOZA 1A5JA 4AUXA 2FD5A 3MNLA 5CW8A 3IH3A 1JJ6C 4FTHA 4D7MA 2EH3A 3ZQFA 1GDTA 2RASA 5JLWA 2QTQA 3GEUA 5HBUA 3BHQA 5FKNA 1JJ8C 2O8KA 1WGXA 5DTDA 3M4OJ 3VVYA 4DYCA 2ELKA 4Y7NJ 2N8GA 3IH2A 2CQQA 4MIMA 2IBDA 4GFBA 2NVYJ 3H0GJ 5F0HA 2UXUA 1IDYA 3GTLJ 1IC8A 2HQ5A 4A93J 3VOXA 1BJZA 5C4JJ 4UUTA 3ANGA 1TWHJ 3NPIA 4QIWN 4G12A 1IGNA 3TEDA 2XGDA 4B3AA 2OERA 3VPRA 1BW5A 2LD5A 3QPSA 2H8RA 2JK3A 4UDSA 1IUFA 1ZKGA 2JJ7A 4W1UA 1K61A 5AQCA 1Z0XA 3JREA 3HKZN 1R9TJ 2ME6A 2DN0A 2LKXA 4B4CA 2G0EA 1H89C 4A3JJ 3E7QA 3LSGA 3MVPA 3ZQHA 2NVQJ 3KNWA 3JRGA 1F43A 5FHPA 3VW1A 2JWTA 2ME0A 3VIBA 1IRZA 2L7ZA 4C3HJ 3HOYJ 1Q1VA 3NARA 5GP9A 5E3MA 2JA7J 1WH5A 2IU5A 3JSJA 1FIPA 1GT0C 1U9OA 3NAUA 3JRBA 1H88C 4D7NA 3HE0A 2R0QC 3OSGA 3S1RJ 3BTCA 4I76A 3JRDA 4V2GA 2XPVA 3S14J 4AF5A 3PM1A 2HI3A 4XRMA 4A3DJ 3NXCA 3MN2A 1NK2P 1HDPA 3LSJA 2RAEA 5F1JA 1JGGA 1UHSA 1AKHA 2HYTA 4JNNA 3PASA 1UI6A 2M34A 1JKQC 4A3IJ 1JKRC 2H1KA 3S16J 2O7TA 3JRCA 4MFDA 3PO2J 3CDLA 4HKUA 1ETXA 2E1OA 3V6GA 2R5ZB 1Y1VJ 3DCFA 2AO9A 3AQTA 2CUFA 2DA1A 5EGOB 3ZQGA 1JT0A 3TP0A 3S2HJ 3QKXA 1BW6A 3BG3A 3LOCA 4A3LJ 2NS7A 1FTTA 4GCKA 1UG2A 3L1PA 4BBSJ 3GTKJ 2DG7A 2MW8A 1B72B 3V78A 3BTIA 2DA7A 4XRSA 3G1MA 2YVEA 5E3NA 2UXOA 4QSHA 4BKXA 2DA6A 1YRNA 1ZTRA 2FX0A 5F08A 2FBQA 2LR8A 3BR3A 1RPWA 3HOUJ 2LFBA 4J19A 2WB1N 2DA3A 2MSYA 3Q0UA 1FTZA 3BR5A 3SFIA 5H9TA 2LTPA 1O4XA 3VW2A 3PPBA 2O7OA 2GM4A 2XPWA 3A03A 1ZGWA 2DMNA 1MH4A 1UMQA 2DMQA 3HEFA 3HBLA 1IJWC 2REKA 2COBA 2XB0X 3BR6A 5EFYA 4CGRA 5M5XJ 2L9RA 3TW6A 1U9NA 1H8AC 3ON4A 4D5FA 4NN1A 5IOZA 1VI0A 1IDZA 2VPRA 1E3OC 4AC6A 1UI5A 4FE7A 2NX4A 3OSFA 2PMZN 1QVTA 3JRFA 4M3GA 2DJNA 1RKWA 5IYBJ 3RZDJ 2K9NA 3BCGA 5FKKA 3FKIJ 2R5ZA 3VOKA 1RR7A 1F36A 3O8HA 2O9LA 4DZPA 5EG0B 3S1NJ 3DPJA 1WI3A 2K9QA 4S0HB 1PUFA 2AHQA 1BL0A 5FLVA 5M3MJ 5EG0A 2YUSA 1MNMC 5HAWA 3FISA 2ECCA 1AHDP 3HTIA 3GTMJ 1U8BA 1MSFC 5FKLA 1AU7A 2DG8A 1OFCX 1SGMA 4GCTA 5K7HA 3WHCA 1XC5A 4JX4A 5D18A 1SFOJ 1B72A 4FE4A 3F1BA 3BTLA 3LNQA 1NTCA 1MBJA 3HOZJ 3HOWJ 2DMUA 1ETOA 4X6AJ 3B6AA 2CUEA 2P81A 4RBOA 4YZEA 4I6ZA 2EQRA 2NOGA 3FIWA 4ABZA 2FJ1A 3VP5A 1ZR2A 2ZCMA 1POGA 2HXOA 4ICHA 2R93J 2QKOA 2UXIA 5FKMA 3BR0A 2G7GA 3HTHA 4A3MJ 3PO3J 1VFCA 4M3DA 3RD3A 3K7AJ 3B6CA 5K7FA 2B63J 3FRQA 5IYCJ 4A3KJ 5M3FJ 5F27A 3G56A 2DMTA 4XRSG 3FK7A 4GCLA 2LP0A 4ACIA 3HM5A 4BY1J 1S7EA 4A3GJ 2NVXJ 1I50J 3P9TA 1JUMA 1TWCJ 5K58A 1P7JA 4L5EA 1MH3A 3BJBA 2HOSA 5C4XJ 2QF7A 5CXIA 1DU6A 1MBKA 4MO7A 2NP3A 2JMWA 2GFNA 2CRGA 1GUUA 3OIOA 3WHBA 1RETA 3QQAA 1BA5A 2W53A 4IHVA 3KKDA 1MBFA 3F0CA 3JR9A 3NI7A 5CXGA 2QCOA 5DAJA 5FMPA 3EGQA 5D1RA 4M3BA 2XRLA 3S15J 4W97A 4QTRA 1HDDC 2QWTA 2HOTA 3AQSA 3IV5A 3ZQIA 5IP9J 4UUSA 3CQZJ 3LSRA 2JA6J 2VKVA 3Q3SA 2OF7A 2ZCNA 3C2BA 3Q0WA 3BG5A 2Y9ZA 2XSDC 2IAIA 1QPIA 2KT0A 3VVZA 1ETVA 3ON2A 2M8GX 4JX5A 4NDLA 3CJDA 5EYRA 1DU0A 3A01A 5IP6A 1TWFJ 1ETWA 3BR1A 1GV2A 1ETQA 2UXHA 2JN6A 1QRYA 1MSEC 2F07A 3KKCA 3Q0VA 5E3LA 2HXIA 3I4MJ 5EF6A 4JX6A 4ME9A 3I4NJ 3FK6A 1X58A 3GTOJ 4DW6A 2PZ9A 1ITYA 5HODA 2TRTA 3COLA 4GFKA 1WPKA 2K40A 3RQIA 3G1OA 1I6HJ 2VUMJ 3ZOBA 2CQXA 3GZIA 3CRJA 3HIMA 2X6OA 3BR2A 2XPUA 2NVTJ 3S1MJ 5F0CA 2L7FP 3VVXA 1ETKA 4A69C 2X48A 5FJ8J 2G7SA 2CJJA 3BQZA 4IEJA 2XB5A 4AC0A 3E7LA 4FCYA 1MBEA 1LE8B 4IHWA 2E2HJ 1TWGJ 4M3EA 1B8IA 2CU7A 1W0TA 1T33A 3C07A 1JUPA 1G2HA 4BY7J 1X2MA 1ZQ3P 2OI8A 2QIBA 4A3FJ 4MFEA 4V2FA 4BBRJ 1FIAA 2QOPA 2RHAA 4DYQA 2JA5J 2GUHA 1I3QJ 5DS9A 3HB9A 2R5YA 4DZJA 3BG9A 3MKLA 2YU9J 3HTJA 3QBMA 2M0CA 3T6NA 4PXIA 1P7IA 2EZHA 3DEWA 3S2DJ 5FGLA 4C3JJ 3HGGA 5J3LA 2M2EA 1K83J 3SJMA 2HYJA 5GPAA 2Y2ZA 1JTXA 3LJLA 3KZ9A 1FEXA 3TW7A 1LFUP 4JYKA 2MGQA 3CCYA 3UKGA 3RZOJ 3S5RA 5C3EJ 2XGEA 2EZKA 2ECBA 4UUSB 3HDDA 5GPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH4 A;  1T56 A;  2LVS A;  4LOC A;  2Y30 A;  4HNV A;  2ID3 A;  4XK4 A;  4FIS A;  4IHY A;  1IG7 A;  2HOA A;  4BXX J;  1MBH A;  4C3I J;  1AKH B;  2K9S A;  3LSP A;  5FLM J;  1HOM A;  1GVD A;  5C4Y A;  5JLX A;  5FKO A;  2Y0S N;  1W0U A;  1JTY A;  2EZL A;  1WCM J;  2WGB A;  2MG4 A;  1Z77 A;  4MXM A;  2ZOY A;  5IOY A;  1VND A;  1RKT A;  5EDN A;  2YVH A;  1ORK A;  3BNI A;  4JP0 A;  2GLO A;  3D1N I;  4JL3 A;  4L62 A;  2VI6 A;  2TCT A;  3A02 A;  3ZQL A;  2E2J J;  1ETY A;  2X9D A;  2R5Y B;  3ANP A;  2E2I J;  5M5W J;  1HCR A;  4Y52 J;  2D5V A;  2L0K A;  3GTG J;  3CWR A;  1APL C;  1PUF B;  1B8I B;  2L7M P;  1Y1W J;  5EZH A;  4CYC A;  4JKZ A;  3HOV J;  2GBY A;  2JA8 J;  1RES A;  5HSZ A;  5EEA A;  4CYC B;  2EZI A;  4B1R A;  1VF9 A;  2WUI A;  3M3Y J;  4NEL A;  2WAQ N;  4AYB N;  1IV6 A;  4GFL A;  4XIC A;  2YS9 A;  3GTJ J;  2DA2 A;  2XDN A;  3JRH A;  4KWA A;  4RDU A;  1X2N A;  1ZK8 A;  3GTP J;  2LK2 A;  1XS9 A;  2G7L A;  3EUP A;  3W6V A;  3SDG A;  5E3O A;  2DMP A;  2UXP A;  3ZQC A;  5J1Y A;  3B81 A;  2Y9Y A;  3HGY A;  5C44 J;  1JUS A;  1XG1 A;  3RH2 A;  2Q24 A;  1JKP C;  4EEF G;  5M5Y J;  5EGO A;  2D6Y A;  5BNG A;  1FJL A;  3BTJ A;  2PBX A;  2VKE A;  2XGC A;  4MK6 A;  4XID A;  3O8G A;  2E19 A;  1NK3 P;  4M3F A;  3VUQ A;  1OCP A;  2R7Z J;  3NNR A;  4C2M J;  3TP3 A;  5IYD J;  1HF0 A;  3BRU A;  5D19 A;  1EF4 A;  2R92 J;  4M6V A;  4DYR A;  3IUV A;  2Y31 A;  1WH7 A;  1A6I A;  5J1R A;  1OJL A;  2HDD A;  5IP7 J;  4A3C J;  2DA4 A;  1U78 A;  3BQY A;  1MBG A;  5EZG A;  4IHX A;  3H3V K;  5F0F A;  1OCT C;  2DTZ A;  2OPT A;  1ENH A;  3G7R A;  2LY9 A;  2WV1 A;  3CMY A;  4A3B J;  3LWJ A;  1HLV A;  3S17 J;  4A3E J;  1GV5 A;  1LE8 A;  3JRA A;  2M9H A;  3GBG A;  2LLK A;  2G3B A;  1YRN B;  2GEN A;  3K2A A;  3LHQ A;  1QVU A;  2IEK A;  2ZB9 A;  3BT9 A;  2KDZ A;  2ID6 A;  1CQT A;  3G1L A;  1ZR4 A;  3GTQ J;  1SAN A;  2EBI A;  1TWA J;  1D5Y A;  3NRG A;  2FQ4 A;  1JT6 A;  3HTA A;  4X1E A;  3O60 A;  4D5C A;  3HOX J;  5IPA A;  2ZCX A;  2NP5 A;  5K7Z A;  2NS8 A;  1LFB A;  4MLO A;  3RKQ A;  5J1U A;  5F04 A;  2V57 A;  3JRI A;  3S1Q J;  2DA5 A;  2W48 A;  3OOU A;  9ANT A;  2HKU A;  3VW0 A;  3QPL A;  1TC3 C;  3A01 B;  2I10 A;  1JKO C;  2ZOZ A;  1A5J A;  4AUX A;  2FD5 A;  3MNL A;  5CW8 A;  3IH3 A;  1JJ6 C;  4FTH A;  4D7M A;  2EH3 A;  3ZQF A;  1GDT A;  2RAS A;  5JLW A;  2QTQ A;  3GEU A;  5HBU A;  3BHQ A;  5FKN A;  1JJ8 C;  2O8K A;  1WGX A;  5DTD A;  3M4O J;  3VVY A;  4DYC A;  2ELK A;  4Y7N J;  2N8G A;  3IH2 A;  2CQQ A;  4MIM A;  2IBD A;  4GFB A;  2NVY J;  3H0G J;  5F0H A;  2UXU A;  1IDY A;  3GTL J;  1IC8 A;  2HQ5 A;  4A93 J;  3VOX A;  1BJZ A;  5C4J J;  4UUT A;  3ANG A;  1TWH J;  3NPI A;  4QIW N;  4G12 A;  1IGN A;  3TED A;  2XGD A;  4B3A A;  2OER A;  3VPR A;  1BW5 A;  2LD5 A;  3QPS A;  2H8R A;  2JK3 A;  4UDS A;  1IUF A;  1ZKG A;  2JJ7 A;  4W1U A;  1K61 A;  5AQC A;  1Z0X A;  3JRE A;  3HKZ N;  1R9T J;  2ME6 A;  2DN0 A;  2LKX A;  4B4C A;  2G0E A;  1H89 C;  4A3J J;  3E7Q A;  3LSG A;  3MVP A;  3ZQH A;  2NVQ J;  3KNW A;  3JRG A;  1F43 A;  5FHP A;  3VW1 A;  2JWT A;  2ME0 A;  3VIB A;  1IRZ A;  2L7Z A;  4C3H J;  3HOY J;  1Q1V A;  3NAR A;  5GP9 A;  5E3M A;  2JA7 J;  1WH5 A;  2IU5 A;  3JSJ A;  1FIP A;  1GT0 C;  1U9O A;  3NAU A;  3JRB A;  1H88 C;  4D7N A;  3HE0 A;  2R0Q C;  3OSG A;  3S1R J;  3BTC A;  4I76 A;  3JRD A;  4V2G A;  2XPV A;  3S14 J;  4AF5 A;  3PM1 A;  2HI3 A;  4XRM A;  4A3D J;  3NXC A;  3MN2 A;  1NK2 P;  1HDP A;  3LSJ A;  2RAE A;  5F1J A;  1JGG A;  1UHS A;  1AKH A;  2HYT A;  4JNN A;  3PAS A;  1UI6 A;  2M34 A;  1JKQ C;  4A3I J;  1JKR C;  2H1K A;  3S16 J;  2O7T A;  3JRC A;  4MFD A;  3PO2 J;  3CDL A;  4HKU A;  1ETX A;  2E1O A;  3V6G A;  2R5Z B;  1Y1V J;  3DCF A;  2AO9 A;  3AQT A;  2CUF A;  2DA1 A;  5EGO B;  3ZQG A;  1JT0 A;  3TP0 A;  3S2H J;  3QKX A;  1BW6 A;  3BG3 A;  3LOC A;  4A3L J;  2NS7 A;  1FTT A;  4GCK A;  1UG2 A;  3L1P A;  4BBS J;  3GTK J;  2DG7 A;  2MW8 A;  1B72 B;  3V78 A;  3BTI A;  2DA7 A;  4XRS A;  3G1M A;  2YVE A;  5E3N A;  2UXO A;  4QSH A;  4BKX A;  2DA6 A;  1YRN A;  1ZTR A;  2FX0 A;  5F08 A;  2FBQ A;  2LR8 A;  3BR3 A;  1RPW A;  3HOU J;  2LFB A;  4J19 A;  2WB1 N;  2DA3 A;  2MSY A;  3Q0U A;  1FTZ A;  3BR5 A;  3SFI A;  5H9T A;  2LTP A;  1O4X A;  3VW2 A;  3PPB A;  2O7O A;  2GM4 A;  2XPW A;  3A03 A;  1ZGW A;  2DMN A;  1MH4 A;  1UMQ A;  2DMQ A;  3HEF A;  3HBL A;  1IJW C;  2REK A;  2COB A;  2XB0 X;  3BR6 A;  5EFY A;  4CGR A;  5M5X J;  2L9R A;  3TW6 A;  1U9N A;  1H8A C;  3ON4 A;  4D5F A;  4NN1 A;  5IOZ A;  1VI0 A;  1IDZ A;  2VPR A;  1E3O C;  4AC6 A;  1UI5 A;  4FE7 A;  2NX4 A;  3OSF A;  2PMZ N;  1QVT A;  3JRF A;  4M3G A;  2DJN A;  1RKW A;  5IYB J;  3RZD J;  2K9N A;  3BCG A;  5FKK A;  3FKI J;  2R5Z A;  3VOK A;  1RR7 A;  1F36 A;  3O8H A;  2O9L A;  4DZP A;  5EG0 B;  3S1N J;  3DPJ A;  1WI3 A;  2K9Q A;  4S0H B;  1PUF A;  2AHQ A;  1BL0 A;  5FLV A;  5M3M J;  5EG0 A;  2YUS A;  1MNM C;  5HAW A;  3FIS A;  2ECC A;  1AHD P;  3HTI A;  3GTM J;  1U8B A;  1MSF C;  5FKL A;  1AU7 A;  2DG8 A;  1OFC X;  1SGM A;  4GCT A;  5K7H A;  3WHC A;  1XC5 A;  4JX4 A;  5D18 A;  1SFO J;  1B72 A;  4FE4 A;  3F1B A;  3BTL A;  3LNQ A;  1NTC A;  1MBJ A;  3HOZ J;  3HOW J;  2DMU A;  1ETO A;  4X6A J;  3B6A A;  2CUE A;  2P81 A;  4RBO A;  4YZE A;  4I6Z A;  2EQR A;  2NOG A;  3FIW A;  4ABZ A;  2FJ1 A;  3VP5 A;  1ZR2 A;  2ZCM A;  1POG A;  2HXO A;  4ICH A;  2R93 J;  2QKO A;  2UXI A;  5FKM A;  3BR0 A;  2G7G A;  3HTH A;  4A3M J;  3PO3 J;  1VFC A;  4M3D A;  3RD3 A;  3K7A J;  3B6C A;  5K7F A;  2B63 J;  3FRQ A;  5IYC J;  4A3K J;  5M3F J;  5F27 A;  3G56 A;  2DMT A;  4XRS G;  3FK7 A;  4GCL A;  2LP0 A;  4ACI A;  3HM5 A;  4BY1 J;  1S7E A;  4A3G J;  2NVX J;  1I50 J;  3P9T A;  1JUM A;  1TWC J;  5K58 A;  1P7J A;  4L5E A;  1MH3 A;  3BJB A;  2HOS A;  5C4X J;  2QF7 A;  5CXI A;  1DU6 A;  1MBK A;  4MO7 A;  2NP3 A;  2JMW A;  2GFN A;  2CRG A;  1GUU A;  3OIO A;  3WHB A;  1RET A;  3QQA A;  1BA5 A;  2W53 A;  4IHV A;  3KKD A;  1MBF A;  3F0C A;  3JR9 A;  3NI7 A;  5CXG A;  2QCO A;  5DAJ A;  5FMP A;  3EGQ A;  5D1R A;  4M3B A;  2XRL A;  3S15 J;  4W97 A;  4QTR A;  1HDD C;  2QWT A;  2HOT A;  3AQS A;  3IV5 A;  3ZQI A;  5IP9 J;  4UUS A;  3CQZ J;  3LSR A;  2JA6 J;  2VKV A;  3Q3S A;  2OF7 A;  2ZCN A;  3C2B A;  3Q0W A;  3BG5 A;  2Y9Z A;  2XSD C;  2IAI A;  1QPI A;  2KT0 A;  3VVZ A;  1ETV A;  3ON2 A;  2M8G X;  4JX5 A;  4NDL A;  3CJD A;  5EYR A;  1DU0 A;  3A01 A;  5IP6 A;  1TWF J;  1ETW A;  3BR1 A;  1GV2 A;  1ETQ A;  2UXH A;  2JN6 A;  1QRY A;  1MSE C;  2F07 A;  3KKC A;  3Q0V A;  5E3L A;  2HXI A;  3I4M J;  5EF6 A;  4JX6 A;  4ME9 A;  3I4N J;  3FK6 A;  1X58 A;  3GTO J;  4DW6 A;  2PZ9 A;  1ITY A;  5HOD A;  2TRT A;  3COL A;  4GFK A;  1WPK A;  2K40 A;  3RQI A;  3G1O A;  1I6H J;  2VUM J;  3ZOB A;  2CQX A;  3GZI A;  3CRJ A;  3HIM A;  2X6O A;  3BR2 A;  2XPU A;  2NVT J;  3S1M J;  5F0C A;  2L7F P;  3VVX A;  1ETK A;  4A69 C;  2X48 A;  5FJ8 J;  2G7S A;  2CJJ A;  3BQZ A;  4IEJ A;  2XB5 A;  4AC0 A;  3E7L A;  4FCY A;  1MBE A;  1LE8 B;  4IHW A;  2E2H J;  1TWG J;  4M3E A;  1B8I A;  2CU7 A;  1W0T A;  1T33 A;  3C07 A;  1JUP A;  1G2H A;  4BY7 J;  1X2M A;  1ZQ3 P;  2OI8 A;  2QIB A;  4A3F J;  4MFE A;  4V2F A;  4BBR J;  1FIA A;  2QOP A;  2RHA A;  4DYQ A;  2JA5 J;  2GUH A;  1I3Q J;  5DS9 A;  3HB9 A;  2R5Y A;  4DZJ A;  3BG9 A;  3MKL A;  2YU9 J;  3HTJ A;  3QBM A;  2M0C A;  3T6N A;  4PXI A;  1P7I A;  2EZH A;  3DEW A;  3S2D J;  5FGL A;  4C3J J;  3HGG A;  5J3L A;  2M2E A;  1K83 J;  3SJM A;  2HYJ A;  5GPA A;  2Y2Z A;  1JTX A;  3LJL A;  3KZ9 A;  1FEX A;  3TW7 A;  1LFU P;  4JYK A;  2MGQ A;  3CCY A;  3UKG A;  3RZO J;  3S5R A;  5C3E J;  2XGE A;  2EZK A;  2ECB A;  4UUS B;  3HDD A;  5GPC A; 
#chains in the Genus database with same CATH topology
 1D8K A;  2KRH A;  2HQA A;  3WE2 A;  2JVG A;  4ZYD A;  1YJ9 I;  1FSH A;  4LMY A;  2Y30 A;  4XK4 A;  1P4W A;  1T98 A;  5HNF A;  1OKR A;  2M3A A;  2BHZ A;  1MBH A;  4C30 A;  3BPX A;  4I09 A;  2K9S A;  1Y0N A;  2MC4 A;  1U6G A;  2P4W A;  2Q2E B;  1U5T A;  1IUY A;  1HOM A;  4QPO A;  3DTI A;  1R71 A;  5FKO A;  2Y0S N;  3Q9V A;  3WTX C;  1W0U A;  3RQ4 A;  2EZL A;  1WCM J;  3GFM A;  1EH8 A;  2MG4 A;  1HW2 A;  5ICF A;  2ZOY A;  1G6N A;  1ORK A;  2YSR A;  2VXZ A;  4JP0 A;  3FXM A;  3D1N I;  2GLO A;  1Z3Y A;  4FET A;  4JK1 X;  4L62 A;  2TCT A;  3ZQL A;  2E2J J;  2X9D A;  5AIP A;  2X6W A;  3RCO A;  3PQJ A;  3OYN A;  5M5W J;  1HCR A;  2D5V A;  2L0K A;  3P9C A;  1TBX A;  1Y1W J;  5EZH A;  1UG0 A;  1ZAO A;  2VL8 A;  5HS7 A;  4DOZ A;  2VON A;  2NYX A;  3CF5 F;  4IO9 F;  3OYH A;  2GBY A;  2G7U A;  2JA8 J;  1RES A;  1K6Y A;  4CYC B;  3WTY C;  2KL4 A;  2O03 A;  3TO6 A;  4G94 A;  2DLL A;  4NEL A;  4AYB N;  1O3S A;  1OCC H;  4XIC A;  3CLO A;  2XDN A;  1R00 A;  4KUM A;  5J4Y A;  1NH3 A;  3NRV A;  2BV6 A;  1XS9 A;  2KPM A;  5E3O A;  2VQG A;  2DMP A;  5A2Q K;  3WTV C;  3PNY A;  1ZG3 A;  4ZZD A;  5J1Y A;  2Y9Y A;  2O0Y A;  2XF5 A;  3HGY A;  4UVA A;  5C44 J;  3RH2 A;  1UAA A;  1U5T B;  5BNG A;  1KU7 A;  1ZLK A;  1T38 A;  4RAG A;  2MH9 A;  2D45 A;  3BTJ A;  2PBX A;  2JA2 A;  4YII A;  4IQJ A;  1YX3 A;  2E19 A;  3EYY A;  5IT9 Z;  2HTJ A;  5E20 A;  4M3F A;  4Q47 A;  4L9N A;  3QOD A;  2DU9 A;  2P5V A;  4P96 A;  4XLP F;  3QYF A;  4AU7 A;  2FNA A;  3L2Q A;  5D19 A;  2L54 A;  4S04 A;  3IUV A;  1I5Z A;  1OJL A;  4N4N B;  2HDD A;  2DA4 A;  4OWR B;  3P5J A;  5FD6 A;  2QUF A;  1SFU A;  2PG4 A;  2R7T A;  4IHX A;  5F0F A;  2LBF A;  1OCT C;  1LVK A;  1Z1D A;  2L5Q A;  4IJA A;  5CQG A;  1BC8 C;  4M73 A;  1FOX A;  3SDB A;  1JE8 A;  3E6C C;  3CMY A;  2L4A A;  4HNT A;  3SXY A;  4ZZL A;  1N77 A;  3RJP A;  2ZFW A;  5H2F C;  1FOW A;  2Z99 A;  3T8R A;  4CYD A;  1BI3 A;  2M9H A;  4HDU A;  3K2A A;  3AG4 H;  2RQP A;  2DAO A;  3BT9 A;  2KDZ A;  1AA7 A;  3F72 A;  2BXY A;  2PEX A;  2YVX A;  4ETS A;  1ZR4 A;  3DU5 A;  3AKZ A;  1X1P A;  2IT0 A;  1SAN A;  2FQ4 A;  4G7Z F;  1G3S A;  1YQA A;  2VLA A;  2FA5 A;  1ULY A;  3ESW B;  1P92 A;  3ZQQ A;  3GVA A;  4XBF A;  2NS8 A;  1LFB A;  2VB6 A;  5F04 A;  5K5Q A;  3JRI A;  3S1Q J;  4HW0 A;  2BEO A;  1U2W A;  4NB5 A;  3IKV A;  2V6E A;  3WU1 B;  1I1S A;  1TC3 C;  2DCE A;  4GYG A;  4BUP A;  1A36 A;  4F92 B;  2ZOZ A;  2L7K A;  3MQ0 A;  4BS9 A;  5CW8 A;  1I27 A;  2EFP A;  3IH3 A;  3J80 Z;  4XKC A;  2DT6 A;  5HNH A;  5D4S A;  1FC3 A;  2EH3 A;  1GDT A;  4RA2 A;  2EIJ H;  2HWV A;  2W7N A;  2IXS A;  1SFK A;  2QTQ A;  4BQO A;  4F93 B;  4Z2Y A;  5DUI A;  1E0E A;  3KEO A;  1IXC A;  1XMX A;  3EDP A;  3BRO A;  2O8K A;  5DTD A;  3M4O J;  3VVY A;  2XGX A;  4Y7N J;  4D0P A;  2XHK A;  4ENM A;  3QP5 A;  3IH2 A;  1IXS B;  2IGN A;  2DOE A;  4BXU A;  2IBD A;  1T8I A;  2FBK A;  3L2C A;  4JBA A;  2MLG A;  3S2W A;  1KQ9 A;  3GTL J;  2HQ5 A;  4EQQ A;  2K9M A;  1KZH A;  3ZMU A;  2B9S A;  2JQ7 A;  3GLX A;  5C4J J;  2C6Y A;  3VYU B;  1TWH J;  1FYL A;  1VQ9 I;  3ULQ B;  4ASN A;  5CVV A;  3VPR A;  2WAE A;  1KU9 A;  3JSO A;  1BM9 A;  2H94 A;  3HSF A;  2LKP A;  5JFR A;  4FX0 A;  1IUF A;  2JJ7 A;  4LFU A;  2FJI 1;  1R9T J;  2Z1D A;  3ERE D;  2XSJ C;  3TL4 X;  4E4H A;  1H89 C;  3ABK H;  2QQB A;  3LA7 A;  2F5V A;  1G8X A;  4II3 A;  3M8J A;  2DXI A;  3KNW A;  3VW1 A;  1FBS A;  1X1A A;  3OYA A;  2JRM A;  2ME0 A;  3S93 A;  3J7Z I;  4C3H J;  1Z3X A;  4E7I A;  1IW7 F;  1LKX A;  4Q4Z F;  1WH5 A;  3OIP A;  2JA7 J;  4B47 A;  4EJT A;  2DI3 A;  2IU5 A;  4BJ5 C;  3FXQ A;  3JRB A;  1R36 A;  3G4S I;  1B9N A;  2IRF G;  2CGP A;  3S1R J;  4NC7 A;  1HXD A;  2XPV A;  2QM3 A;  1YFH A;  1R22 A;  3PM1 A;  2XV4 S;  2X85 A;  2HI3 A;  3NXC A;  3C1D A;  4G6Q A;  1QA6 A;  1NK2 P;  3I54 A;  1HDP A;  2Y0S A;  3LA3 A;  3LSK A;  1JGG A;  2Y69 H;  2FF4 A;  1K79 A;  3I55 I;  1K78 A;  4OD4 A;  2HS5 A;  1X3W B;  2M34 A;  4IZZ A;  4A3I J;  3S16 J;  1FMW A;  1WJE A;  2HGC A;  2FML A;  4CA0 A;  4CO8 A;  4HNU A;  3QPT A;  2GA2 A;  1UFM A;  2DTR A;  2YX7 A;  4BE0 A;  2WC2 A;  3NWS A;  2BXZ A;  3CDL A;  3F8N A;  1MD0 A;  4ZTJ A;  2QSH X;  2R5Z B;  1Y1V J;  2RRE A;  4HQM A;  3MCZ A;  1ZH5 A;  3V7R A;  1TTY A;  2HU9 A;  2VKD A;  2JRT A;  1BW6 A;  1BC7 C;  5B5E C;  4GCK A;  1R1T A;  4BQA A;  3CCS I;  3IHU A;  2MW8 A;  3KX2 A;  2CV1 A;  3BTI A;  2DA7 A;  3BOQ A;  4ZJZ A;  2BW3 B;  1GVJ A;  2RNG A;  5FFZ A;  2GOM A;  1EH7 A;  1ZTR A;  3C2G A;  2EV0 A;  2R7D A;  4YRV A;  2VC0 A;  2LR8 A;  3AFH A;  4LLN A;  2LH9 A;  3KYC B;  2MSY A;  4P9F A;  3QP6 A;  2L01 A;  1F5T A;  5J8F A;  3HRT A;  5ICG A;  4HYE A;  5F6F A;  4PCQ A;  3KLO A;  3KYD B;  2XPW A;  1MJ9 A;  2FUG 2;  1UMQ A;  3HEF A;  1KON A;  2K02 A;  4P1W A;  3QPH A;  2REK A;  2XB0 X;  4U9N A;  5EFY A;  3CDH A;  1BOA A;  2L9R A;  2LOO A;  3TW6 A;  2V1U A;  4I99 C;  3NS4 A;  3ON4 A;  1IDZ A;  1UI5 A;  4FE7 A;  2M4K A;  3H3Z A;  1B9M A;  2WBM A;  3U21 A;  4Z6Y A;  3A0H C;  3HIF A;  3KET A;  2HDC A;  3LFU A;  5IYB J;  5D6F A;  1IRF A;  4L0Y B;  2WWY A;  2MD0 A;  2K9L A;  3C7J A;  2KRC A;  3K6G A;  4GGG A;  3CMM A;  3CCU I;  2D1V A;  3DPJ A;  3K2Z A;  2K9Q A;  3I9V 2;  2AHQ A;  1BL0 A;  2R3S A;  5EG0 A;  4Y17 A;  3DWL E;  3N05 A;  2KJC A;  3OV8 A;  3FX3 A;  2IS2 A;  1VQ7 I;  1R1V A;  1MSF C;  1FSE A;  2OQG A;  3H35 A;  3D5S C;  3UR3 C;  5ERI A;  4M9X A;  5H6R A;  2KIQ A;  4PJN A;  4EGZ A;  2PJR A;  5D18 A;  2GQQ A;  1J5Y A;  1P2F A;  4FE4 A;  5FRN A;  3F1B A;  2O3F A;  3BTL A;  4A2U A;  1UHW A;  3KP2 A;  1QQI A;  3CC4 I;  2EIM H;  1NG7 A;  4UB6 C;  2OCE A;  4G7O F;  2CUE A;  2F6C A;  4HOB A;  3J80 K;  2IA2 A;  2L9S A;  2NOG A;  3FIW A;  2FJ1 A;  2KKO A;  2V1D A;  5LHH A;  2I5U A;  3TQN A;  4C2T A;  2UXI A;  2IGK A;  3BR0 A;  2IJL A;  4HSR A;  2M5W A;  3GW2 A;  2EIN H;  1IAW A;  2UXX A;  3B6C A;  3RD3 A;  4A0X A;  4GRI A;  5LRR A;  1SVO A;  4A3K J;  4YFK F;  4LD5 A;  2DJI A;  2A05 A;  1RI7 A;  4XRS G;  3FK7 A;  4ACI A;  3FDY A;  4MHG A;  4A3G J;  3GZN B;  3TBI A;  2E1N A;  1HA8 A;  1JUM A;  2BE5 F;  2LNB A;  1VQ8 I;  2MH2 A;  4EJV A;  4EM0 B;  1P7J A;  2LF8 A;  3HOS A;  1XPX A;  1WZ2 A;  5KK1 A;  1PYV A;  1MH3 A;  1Y6I A;  2F2E A;  2HOS A;  5CPR B;  1DU6 A;  2X0L A;  4MO7 A;  1PUE E;  1LFP A;  3CCE I;  1DGR M;  2HFH A;  1ON1 A;  2EJR A;  2KIF A;  4PJL A;  3R61 A;  5CVJ A;  4IHV A;  1MBF A;  1FT9 A;  3F0C A;  3JR9 A;  3NI7 A;  2X6Y A;  2LY2 A;  2IS6 A;  1SC7 A;  2P6T A;  4NUB A;  1WQ2 A;  1FX7 A;  5FMP A;  4M3B A;  5D6E A;  1ZRF A;  3S15 J;  4QTR A;  4KN4 X;  2BGC A;  4BAC A;  3LWF A;  1UEL B;  3ZQI A;  1HW5 A;  4UUS A;  3WU2 C;  1OR7 A;  3LSR A;  2VKV A;  3GME A;  2ZCN A;  4XSX F;  4RM2 A;  3MZH A;  1ONV A;  3C2B A;  2VBY A;  3Q0W A;  4BE1 A;  2TDX A;  4ZDO A;  1QPI A;  3ON2 A;  4JX5 A;  3CJD A;  5EYR A;  1SMY F;  1GV2 A;  1ETQ A;  4WF2 A;  1DP7 P;  2B0L A;  4M6X A;  1E3P A;  3Q0V A;  1T0F C;  3PUB A;  5E3L A;  3I4M J;  4JX6 A;  5EJC A;  1HST A;  5CVU A;  2PZ9 A;  2CQ7 A;  5D5U B;  3N97 A;  5L3C A;  1WPK A;  2EWN A;  2K40 A;  2VBW A;  3KP3 A;  3U2R A;  4MEX F;  2VUM J;  3GZI A;  4XR6 A;  1EKE A;  1XGN A;  3LAP A;  2L3D A;  3BR2 A;  3LL7 A;  3HIM A;  2WAQ A;  4CIC A;  3WTT C;  2BZT A;  2DDB A;  3GXO A;  2G7S A;  5J4V A;  1K7A A;  3LMM A;  2XB5 A;  5H6Q A;  2E2H J;  2KP6 A;  3B73 A;  2R7X A;  3MMY B;  1F1Z A;  1R7J A;  2CU7 A;  3BCA A;  5DCM A;  1T33 A;  2IGM A;  3LST A;  5E1X A;  1JUP A;  1X2M A;  2EV5 A;  2OI8 A;  4Q5S F;  4A3F J;  2RHA A;  3N4M A;  3V4G A;  1J7K A;  1HQC A;  3PNV A;  4B44 A;  1LVA A;  4DZJ A;  2WAD A;  3CCV I;  3QBM A;  5CKT A;  2HQN A;  1ZAR A;  3T6N A;  5FGL A;  4F7Z A;  3S2D J;  5DD8 A;  3HGG A;  4C3J J;  4Y13 A;  3J7Y J;  2HYJ A;  3L2R A;  2Y2Z A;  2QQ8 A;  1JTX A;  5L3F A;  1RR8 C;  3ECO A;  3ECH A;  1X1D A;  5ILU A;  5FGM A;  1YS7 A;  3R6S A;  2MGQ A;  3A1Y A;  2K7L A;  4UUS B;  3HDD A;  3IH4 A;  1T56 A;  3B02 A;  2LVS A;  1SD7 A;  4ZC3 A;  3PUF A;  3QOE A;  4HNV A;  2ID3 A;  3FMS A;  3DP7 A;  4RB0 A;  5DCF A;  3T8T A;  1IG7 A;  1D5V A;  2VT2 A;  3OS0 A;  2HOA A;  2K27 A;  1H0M A;  2G7H A;  4BXX J;  4HV5 A;  3LSP A;  5FLM J;  5CVR A;  1VQK I;  5JLX A;  3BLY A;  3I56 I;  1W7P D;  1Z77 A;  2XF7 A;  3V8J A;  4MXM A;  1YW8 A;  1VND A;  5IOY A;  1RKT A;  2YVH A;  3H92 A;  1XGS A;  1YOV B;  1VQP I;  4UV9 A;  2V26 A;  1ETY A;  1K4S A;  2E2I J;  4Y52 J;  3CWR A;  4DJA A;  2PMZ A;  1APL C;  4E7S A;  2L7M P;  4TV7 A;  1NHA A;  1HSJ A;  3C18 A;  3HOV J;  5EEA A;  4EMS A;  2EZI A;  1VF9 A;  4NBQ A;  3GO5 A;  1KU2 A;  3ZMT A;  2P7C B;  2YS9 A;  1XD7 A;  3K70 D;  4GDF A;  2DA2 A;  4IQ4 A;  3VYT B;  3IC7 A;  1QHH D;  4KWA A;  3KZY A;  1J75 A;  4UHT A;  2LK2 A;  4B3X A;  3EUP A;  1C0W A;  2PJP A;  4ZDP A;  3WGG A;  3CDI A;  2GXA A;  3OYC A;  1JKP C;  5EGO A;  1HC8 A;  2V6C A;  3WTZ A;  5TRD A;  4KIB A;  3RYP A;  2VKE A;  2XGC A;  3BG7 A;  4KIT B;  3J81 Z;  3A0B C;  3E3V A;  3O8G A;  4YIF A;  2ELJ A;  2VKH A;  1HKS A;  4CCN A;  3NNR A;  2FOW A;  2XVC A;  3K10 A;  3EUK L;  1HF0 A;  3BRU A;  2M4G A;  1WSU A;  3ONQ A;  5ED4 A;  4X0G A;  1EF4 A;  4M6V A;  3IWZ A;  1RIO H;  2JTV A;  1WWX A;  4AVZ A;  2QEX I;  1U78 A;  3LFK A;  1MBG A;  5EZG A;  5LEJ A;  3U1D A;  2VC1 A;  5KAF C;  4OD5 A;  2YR2 A;  3EUA A;  1J09 A;  1ZEL A;  1YIJ I;  1ENH A;  3QAH A;  5J8C A;  4KYW A;  5CQE A;  4IOC F;  4IVN A;  2UXN A;  4A5M A;  2O5R A;  4XN3 A;  2M0M A;  3I4P A;  2F4M B;  1R4N B;  3K8P C;  3WOD F;  2E35 A;  2KZG A;  2D1H A;  2LLK A;  2E1M C;  1XCV A;  2W84 A;  2P8T A;  3O2P E;  1YRN B;  2G3B A;  3LHQ A;  4LJZ F;  2FSW A;  2ID6 A;  3LAJ A;  1TNT A;  1LUJ B;  4XM3 A;  4UUV A;  2V1N A;  1D5Y A;  3KEY A;  4PGG A;  4EJU A;  3BZC A;  2ZCX A;  4IKF A;  2NP5 A;  1MW7 A;  4AYB A;  2PQ8 A;  3VB2 A;  1OCZ H;  2F48 A;  2ZFU A;  4HX8 A;  2W48 A;  3F22 A;  5E8I A;  5GAD J;  2PN6 A;  3VW0 A;  2KZV A;  2A6E F;  5FD5 A;  4WXH A;  3HHH A;  1GXQ A;  3FBN B;  4XMY A;  4F3Q A;  4AUX A;  1KGS A;  1JGS A;  2VBZ A;  1JJ6 C;  4FTH A;  3ABU A;  4OAY A;  2PI0 A;  1W1W E;  4HX7 A;  3KP6 A;  4GYI A;  2W82 A;  2RAS A;  5JLW A;  3GEU A;  5JHU A;  3HOT A;  4L9J A;  4ESB A;  5FLX K;  4L5J A;  4LIU A;  5FKN A;  1JJ8 C;  3GLL A;  1WGX A;  1G3W A;  2ZME A;  4NHJ A;  2ELK A;  2RQQ A;  1WJB A;  1BI1 A;  3H0G J;  3WGH A;  1KQ0 A;  2DFI A;  2HKO A;  3PNT A;  3VOX A;  3EUH A;  2CFO A;  4LK1 F;  4PJ0 C;  4UUT A;  3WTU C;  4IRV A;  2XKP A;  4QIW N;  3F21 A;  1J2X A;  4G12 A;  3SWH A;  1X3Z B;  3H5N A;  1SEU A;  5BQT A;  3TED A;  2XGD A;  3CD6 I;  2FE3 A;  2OER A;  4CCJ A;  5B1A H;  3K0L A;  4OMY A;  5AIQ A;  3M7G A;  2JK3 A;  4LLL A;  5HS8 A;  4P55 A;  4W1U A;  5HLG A;  1YI2 I;  4NC6 A;  5GAH J;  2BVL A;  2LKX A;  5E79 C;  5JI6 A;  2JZY A;  4E7Z A;  2KDO A;  2EA2 A;  4H4K C;  1I6X A;  1YE9 A;  3OY9 A;  4J00 A;  4R79 A;  1O3R A;  3MVP A;  1IN6 A;  3ZQH A;  1MMG A;  3OYI A;  5F64 A;  3VIB A;  1IRZ A;  1Q1V A;  3E0J B;  3NAR A;  5GTI C;  5H20 A;  3JSJ A;  2CV2 A;  1JI8 A;  1B6A A;  2CH0 A;  1TQI A;  1FPQ A;  4U0V A;  2XAQ A;  3CMA I;  4I76 A;  2LBF B;  3J7A Y;  3DEU A;  3K4J A;  5LBQ A;  2E7X A;  4HDV A;  2A2F X;  3KP7 A;  2IA0 A;  2RAE A;  5F1J A;  1TL8 A;  3JCU C;  1YHQ I;  3RYR A;  1Z6R A;  1TT5 B;  2ZME C;  2LKS A;  4ESJ A;  1YIT I;  4JNN A;  1JKR C;  4I01 A;  2RN7 A;  4A5N A;  3OYK A;  4BL0 B;  4HZF A;  2BVM A;  2UV1 A;  4HKU A;  2D2W A;  2VQL A;  5HS9 A;  3AQT A;  2OZ6 A;  3ZQG A;  3TOB A;  1UCR A;  3HUG B;  3TP0 A;  3QKX A;  1XGM A;  4LIT A;  1MIJ A;  4HBL A;  1FTT A;  4RB3 C;  4HX4 A;  2BY0 A;  1O57 A;  4LK0 F;  3L1P A;  4BBS J;  3A2K A;  1B72 B;  3V78 A;  2V9V A;  1XMA A;  2J5P A;  3G1M A;  4RAZ A;  5BPI A;  2Q1Z B;  4ANJ A;  1Y39 A;  2ZSI B;  5E3N A;  1TLH B;  2GZW A;  2DFF A;  2CW0 F;  2BY3 A;  5B3S H;  5ICE A;  4BKX A;  1YRN A;  2FX0 A;  3M8E A;  2FBQ A;  2R7V A;  1X3U A;  3BR3 A;  1H9T A;  2LFB A;  4J19 A;  1A04 A;  4CCO A;  4KIF A;  5LHG A;  3Q0U A;  4OIP F;  2PMU A;  3W3C A;  3BR5 A;  3SFI A;  3G6E I;  3ASO H;  1Z21 A;  3RPU A;  3EYI A;  3ZXS A;  1MJB A;  1MH4 A;  1W7P B;  2DMQ A;  1O7L A;  1WJF A;  1IJW C;  3DXJ F;  2COB A;  1DQU A;  4HA8 A;  1V5G A;  4E7J A;  3OYB A;  4CGR A;  3KZI C;  3I71 A;  1U9N A;  4XSZ F;  1H8A C;  4NN1 A;  2GIV A;  1VI0 A;  4XON A;  4KT5 C;  3VEP A;  2VPR A;  3DTE A;  2QSF X;  1TW2 A;  4CZZ A;  4LLG F;  4OIO F;  4UB8 C;  5K5R A;  1KYW A;  1QVT A;  2FBH A;  2K4J A;  3JRF A;  4E7L A;  3JW4 A;  4M3G A;  3HUG A;  1V4R A;  2ZKZ A;  2DPU A;  4XLE A;  3GUD A;  1YX5 A;  3M1E A;  2K9N A;  1F9N A;  3BCG A;  2UZK A;  3VOK A;  1RR7 A;  1F36 A;  2O9L A;  3CZ6 A;  4DZP A;  1BN5 A;  2EK5 A;  4M6Y A;  1WI3 A;  2CWE A;  2M45 A;  4S0H B;  4BGD A;  3KCC A;  4RMN A;  2YUS A;  4RB2 C;  1MNM C;  5HAW A;  3FIS A;  1GXP A;  1AHD P;  2RDP A;  4KMF A;  3CME I;  3HTI A;  5CJ9 A;  4EGY A;  5FKL A;  2E1M B;  3M9A A;  1AU7 A;  1D1C A;  1SGM A;  1ACI A;  1BR2 A;  1XC5 A;  4JX4 A;  2M7A A;  1S8N A;  2PLY A;  2DDA A;  2WV0 A;  3F8C A;  2V9K A;  3LNQ A;  1NTC A;  1QNT A;  4MQ9 F;  3JAM Z;  3HOZ J;  2OC6 A;  3HOW J;  1VQO I;  1J9I A;  3B6A A;  1W7P A;  2P81 A;  4RBO A;  4I6Z A;  3OMY A;  2M87 A;  3E6B A;  3FBI B;  3E5X A;  1POG A;  1YTY A;  1QGP A;  2OUM A;  2HQR A;  4B48 A;  3K7A J;  1W5C C;  5K7F A;  2B63 J;  2IP2 A;  3FRQ A;  5M3F J;  5F27 A;  2NRA C;  2DMT A;  2LP0 A;  3U1K A;  4WIB A;  1KU3 A;  5FO5 A;  2VAS A;  3KP5 A;  1R5G A;  2O8X A;  1I50 J;  2FMY A;  3QWL A;  1R5H A;  3EET A;  3P9T A;  1TWC J;  2DK8 A;  2XAH A;  3K4N A;  1V55 H;  5K58 A;  1ZRD A;  1XMK A;  2Y0M A;  5L3B A;  3CCR I;  5C4X J;  4WXC A;  2EA4 A;  1TZL A;  2ESH A;  1ZGJ A;  2CFX A;  4Y3O A;  2CRG A;  2XC7 A;  2H09 A;  1TT0 A;  1HW1 A;  2DYS H;  1RUO A;  1B4A A;  1RET A;  2R7U A;  1JXS A;  3L9F A;  3RI4 A;  3FM3 A;  2QCO A;  5HDN A;  3D5L A;  5D1R A;  3SYT A;  2XRL A;  2QWT A;  1KA8 A;  4W97 A;  4IOA F;  1MMA A;  3HYI A;  3VYR B;  3V7S A;  2W00 A;  3CQZ J;  3ZR8 X;  2VPL A;  1MNE A;  5EEG A;  3Q3S A;  3BJ6 A;  2ZJ2 A;  1DPR A;  5FLX Z;  2FQ3 A;  1YS6 A;  2XSD C;  1OYY A;  3E6D A;  2OA4 A;  3P7N A;  4HF1 A;  2M8G X;  4NDL A;  3DPU A;  3FMQ A;  4KFC A;  3A01 A;  1ETW A;  2UXH A;  2JN6 A;  3DF8 A;  4N9I A;  3KEQ A;  3OS2 A;  1G3T A;  3FXJ A;  3I4N J;  4JOM A;  3ZRG A;  5HOD A;  5LRS A;  1ITY A;  1WRJ A;  4U0W A;  3RQI A;  2FBI A;  1I6H J;  1PP7 U;  3ZOB A;  2F5C A;  4B8X A;  3CRJ A;  4WCG A;  2X6O A;  2XPU A;  1U5T C;  1WKM A;  5IT3 A;  3CUO A;  5BS6 A;  1KQ8 A;  4A0Z A;  3BQZ A;  1S29 A;  3DKY A;  3HRM A;  4IEJ A;  5B1B H;  3SZP A;  3E7L A;  1J0R A;  4IHW A;  3ZMS A;  2AQE A;  3HRU A;  2L9N A;  3WGI A;  1IF1 A;  5TJJ A;  3HPH A;  4EVI A;  1G2H A;  2HZD A;  3KZZ A;  2K86 A;  2MLK A;  2VIX A;  4N9H A;  1Y0U A;  1P9Q C;  2JA5 J;  2GUH A;  4M9Z A;  2OJE D;  2R5Y A;  3MKL A;  3SEQ A;  3CP8 A;  3HTJ A;  2VJJ A;  3T0Y A;  2DW4 A;  2EZH A;  2M2E A;  1K83 J;  1OYI A;  2NS0 A;  5GPA A;  1PVE A;  2KIU A;  5FRM A;  1OLT A;  1FEX A;  3NQO A;  3CCY A;  3S5R A;  3CUQ C;  2XGE A;  3ABM H;  4QPQ A;  5D4R A;  5TGT A;  1ZN2 A;  2OV7 A;  5KNL A;  3F23 A;  3OYD A;  1DDN A;  4UVB A;  4RGX A;  4DVY P;  3KIO A;  4LOC A;  2F4I A;  5EEH A;  1X4O A;  3OR2 C;  2A6T A;  2P7V B;  4FIS A;  4NQW A;  4IHY A;  2LRD A;  4FHT A;  4YEL A;  1AKH B;  3P9I A;  1CF7 A;  2VJ5 A;  2GA1 A;  1IXR C;  2KFD A;  3GCM A;  2ESN A;  1JTY A;  2HTS A;  3QYE A;  1JHF A;  2FU4 A;  3H5R A;  4U9L A;  1LQ1 A;  1VQL I;  1D1A A;  2R5Y B;  4L18 B;  3G73 A;  3ANP A;  2Q0O A;  2QZ8 A;  4MQV A;  3GTG J;  2JT1 A;  5CYV A;  2KRF A;  4G9Y A;  2K4B A;  4A0Y A;  1YLF A;  1Z7L A;  1IO2 A;  3PSI A;  1PUF B;  1QZZ A;  3W6J B;  4CCM A;  2LDU A;  3QOP A;  3G2B A;  1W5S A;  3ABL H;  2HPM A;  3VOE A;  4IL6 C;  2QEN A;  1BJA A;  2FOK A;  4KIG A;  4ZYH A;  2WUI A;  3FXO A;  4CCL A;  2WAQ N;  3DPT A;  2F5D A;  3L00 A;  3IKT A;  4Q48 A;  3GTJ J;  3DFG A;  3DKX A;  4IRH A;  2OU2 A;  3JRH A;  4RDU A;  1X2N A;  3GTP J;  3IAM 2;  1A31 A;  2G7L A;  3H3U A;  2PFB A;  3W6V A;  4ON0 A;  4U88 A;  2UXP A;  3ZMV A;  4DQ2 A;  2VJ4 A;  3B81 A;  2PJR B;  1JUS A;  2Q24 A;  5DM6 F;  4ITV A;  2WA0 A;  4U0Y A;  1ZRC A;  3HSR A;  2Q8K A;  5M5Y J;  3S3N A;  3LSM A;  1FJL A;  4EM1 A;  2W4S A;  1YO5 C;  3RPU D;  2A07 F;  3R4K A;  2ELH A;  2GAU A;  3CCQ I;  3IRQ A;  3DLL F;  1SMT A;  1NK3 P;  3VUQ A;  2R7Z J;  1I39 A;  3H9G A;  1FYM A;  3TP3 A;  5LGU A;  4PDK A;  4DYR A;  2H6C A;  1MND A;  2XAF A;  1R23 A;  1WH7 A;  1A6I A;  3ML6 A;  4RB1 A;  1CGP A;  3CTA A;  4BDZ A;  4A3C J;  3TOA A;  4XOT A;  2HYF A;  3PL8 A;  3K69 A;  1S5L C;  4D9J A;  4RLF A;  5GTH C;  4FAS D;  3PIP F;  1D0Z A;  2WY8 Q;  2M8E A;  1ZHF A;  3OYL A;  4KNY A;  2OPT A;  3QYB A;  2XUB A;  1MDM B;  3VWB A;  4AID A;  3G7R A;  3WE3 A;  2LY9 A;  1D0Y A;  2R7W A;  3ZGK A;  4O5V A;  2FRH A;  1G4D A;  4A3B J;  2W24 A;  1D8J A;  3LWJ A;  5D8K B;  1QZY A;  4A3E J;  4L9V A;  1GV5 A;  1LE8 A;  3JRA A;  1ZRE A;  3DBR B;  3GBG A;  4BHP A;  4FT8 A;  2HPI A;  5E8G A;  1K4T A;  3F9K A;  3CJN A;  3T1B A;  1EV7 A;  2IEK A;  4C9Y A;  2JVH A;  2Z2S B;  1Y8Q B;  4XL9 A;  2LRE A;  4YFX F;  3G1L A;  5JVG F;  4XOP A;  4BH9 A;  1TWA J;  1W5T A;  3L2V A;  5IT9 K;  2JUC A;  3NRG A;  1JT6 A;  1IN8 A;  3HTA A;  4X1E A;  4Y4R A;  1T2K A;  4D5C A;  3GFL A;  3HOX J;  2MA3 A;  1IZ1 A;  1MZB A;  5K7Z A;  1L3L A;  3F8F A;  3RKQ A;  3ZQ7 A;  4XKB A;  4PGH A;  1YJW I;  1U3E M;  1YW7 A;  2V57 A;  3HC7 A;  3BG6 A;  4GXO A;  9ANT A;  1S3J A;  4R8H A;  1JKO C;  1QHG A;  2OBP A;  2X4H A;  2E5Z A;  1VQ4 I;  4HLX A;  1GLN A;  2QVO A;  3MWM A;  4LG0 A;  4PJJ A;  1OMI A;  4D7M A;  1ZYR F;  3LQQ A;  2K85 A;  3VDX A;  3FWE A;  2L2O A;  3I59 A;  1LJ9 A;  3IUO A;  5HBU A;  2NOJ B;  3BHQ A;  1D0X A;  2IS4 A;  1G59 A;  1YIO A;  1WVR A;  3TO7 A;  4HF0 A;  4HV6 A;  2QKL B;  2XRN A;  4NC8 A;  4FX4 A;  4E7K A;  4IHS A;  2RC4 A;  3VYS B;  5F0H A;  4GFB A;  3AAF A;  1IDY A;  3E97 A;  3F6V A;  3IAS 2;  2EPF A;  1IC8 A;  3HXL A;  1BJZ A;  3ANG A;  2DOF A;  3QU3 A;  3NPI A;  1R58 A;  2CO5 A;  1FY7 A;  3JSP A;  2EFW A;  1IGN A;  3KP4 A;  1R5I D;  1PDN C;  1STZ A;  2QA4 I;  3HSE A;  2OAZ A;  4B3A A;  4I98 B;  3OWT A;  2JSP A;  2UWM A;  2LD5 A;  1S7O A;  3RPQ A;  3QPS A;  4LG0 B;  3OL4 A;  5DV5 A;  4B43 A;  1S6L A;  2COM A;  2K3P A;  3CUQ A;  2V1X A;  4EJO A;  4U7B A;  4ENK A;  2O61 A;  4UDS A;  2A68 F;  5BPD A;  1Z0X A;  5AQC A;  3JRE A;  3K4C A;  2ME6 A;  1WJD A;  3GX4 X;  3PSF A;  1QPM A;  2XRO A;  3BPV A;  2CW8 A;  3TO9 A;  5D5V B;  4II2 A;  4ZTF A;  3LSI A;  3LSG A;  5K1Y A;  5LEK A;  3JRG A;  5FHP A;  3W2V A;  5LD2 C;  2L7Z A;  2Z33 A;  3HOY J;  3TKY A;  1N75 A;  5GP9 A;  5E3M A;  2LYC A;  4O6J A;  1YJN I;  1XTA A;  2BBY A;  1R4M B;  2YU3 A;  2NAZ A;  1U9O A;  1H88 C;  3HE0 A;  3OSG A;  5HDG A;  3AG2 H;  3FXR A;  5HLH A;  1XDU A;  4V2G A;  3JRD A;  2HVQ A;  1SAX A;  4RM3 A;  2LSO A;  3S14 J;  4AF5 A;  2OTJ I;  4HLY A;  3MN2 A;  4G8X A;  3OYG A;  4E7H A;  2MD5 A;  1R6R A;  2X1C A;  3IRR A;  3Q9S A;  2KIS A;  1AKH A;  3L09 A;  2QGU A;  3I59 B;  5IY5 H;  3PAS A;  4OU0 A;  1UI6 A;  2R4G A;  1JKQ C;  2L9V A;  4I02 A;  2XAG A;  4ZYE A;  4P9U A;  2BYV E;  4BHB A;  4GO1 A;  1MMS A;  3JRC A;  2QWW A;  2DBB A;  2ZXW H;  3MZY A;  3CP2 A;  4L0Z B;  2XF6 A;  3I64 A;  1WJC A;  3DCF A;  5LFA A;  1IRX A;  2Z3Y A;  5EGO B;  1DPU A;  5L3D A;  3RKW A;  4AVP A;  2NVU B;  3FXL A;  5J40 A;  3BG3 A;  2OZU A;  4A3L J;  2NS7 A;  3FF5 A;  3WG9 A;  3BZK A;  1UG2 A;  4AIJ A;  3MZ8 A;  1FYK A;  3F6O A;  5IOZ A;  1XGO A;  2YVE A;  2EFO A;  1RNL A;  3M8F A;  3RDI A;  4BHC A;  2R7S A;  2X1D A;  3ELK A;  2DA6 A;  3BZ6 A;  4OIN F;  5F08 A;  2ZY9 A;  1FOK A;  1MMD A;  3HOU J;  3PIO F;  3D0S A;  2WB1 N;  5CVI A;  5FFX A;  2MFZ A;  1T39 A;  3VTI A;  5GAE J;  4KT6 A;  5JVT A;  2LTP A;  1O4X A;  3PPB A;  4WWC A;  1ZGW A;  2KLO A;  1OPC A;  1B1B A;  2CUZ A;  5DUK A;  1RUN A;  4K2E A;  5E17 F;  5M5X J;  3HTU A;  4XLC A;  4D5F A;  4XLF A;  2NX4 A;  1IN4 A;  2GWR A;  2DYR H;  2DJN A;  5BMZ A;  3W2W A;  3HZJ A;  5J6X A;  3RZD J;  2A5Y B;  5LLQ A;  4ENJ A;  5FKK A;  3FKI J;  3DEE A;  3Q5F A;  3FKJ A;  3DQV C;  3O8H A;  4M9S A;  3MD2 A;  3R0A A;  4CDG A;  5FLV A;  2KIM A;  3FM5 A;  4CSW A;  4XLN F;  5DM7 F;  4DNC A;  2L4M A;  4ZH4 F;  1U8B A;  3CC7 I;  1O3Q A;  3CJQ B;  3BJA A;  2QBY A;  2HNH A;  5K7H A;  4J01 A;  4M74 A;  3WHC A;  3MKY B;  1RZ4 A;  3JAM K;  3HRS A;  4BAY A;  2W57 A;  2STW A;  2OD5 A;  2NXN B;  4ENN A;  2K5C A;  2DMU A;  2LMD A;  4DIQ A;  3CO6 C;  2MBF A;  1ETO A;  3KYL A;  3OYF A;  4BYY A;  3E1S A;  1K6O A;  4ABZ A;  1PP8 F;  3VP5 A;  1ZR2 A;  2ZCM A;  1RRJ A;  2HXO A;  3AL0 C;  5F1R A;  1EJ9 A;  2QKO A;  3TDU C;  5FKM A;  3HTH A;  2KJB A;  4XKV A;  5K5O A;  4M3D A;  2ZCW A;  4PFO A;  3OYJ A;  2V4J C;  3ABT A;  4MTD A;  2LC2 A;  3FMR A;  5IYC J;  3ZN1 A;  1FZP B;  2KHM A;  2GXG A;  2ZO4 A;  4D1Q A;  3J81 K;  2Z9O A;  1ON2 A;  3DLA A;  3LSH A;  3O6B B;  4BY1 J;  3E5Q A;  1S7E A;  3CCM I;  2E1C A;  2CMP A;  2NVX J;  3T5X A;  2Y48 A;  3BWG A;  2QKM B;  1X1C A;  3K1P A;  2VXD A;  4L5E A;  2B3W A;  4BJ6 C;  4DBQ A;  2RVC A;  3BJB A;  5CXI A;  2GFN A;  1WFX A;  5LHI A;  2NNN A;  4ZDL A;  2A3S A;  5TIS C;  3BCB A;  1J59 A;  1BA5 A;  3J7A O;  2W53 A;  5KVR A;  2E5N A;  2XDV A;  4PUS A;  3KKD A;  3S8P A;  4BNC A;  3U9G A;  1LPQ A;  5DAJ A;  2VOD A;  3S3M A;  3K4K A;  3EGQ A;  1ZGA A;  3C3W A;  3S3O A;  1HDD C;  3AQS A;  2X1E A;  2HOT A;  3PFI A;  3IV5 A;  2P5L C;  5D8L B;  1BOB A;  1QZE A;  4P5O A;  4HST A;  1QU3 A;  2CYY A;  2HOE A;  3TGN A;  3G71 I;  5HDK A;  1AWC A;  2Y9Z A;  1SVM A;  1Z7U A;  2IAI A;  2VE9 A;  1IV8 A;  3L2U A;  1BIB A;  3I53 A;  1ETV A;  4U87 A;  2DPD A;  1BR1 A;  1TWF J;  3BR1 A;  3GZ5 A;  2A5W A;  3DV8 A;  1QRY A;  2W1O A;  2JSC A;  1MSE C;  3ROU A;  3ZN0 A;  4HPQ A;  2F07 A;  3SHF A;  1MMN A;  3H5A A;  4NQW B;  1LEB A;  3CC2 I;  4AIK A;  2HVS A;  1QBJ A;  4UVC A;  4ME9 A;  3FK6 A;  4DW6 A;  3COL A;  1MJA A;  4GCV A;  4CZC A;  2A61 A;  2BOL A;  2NVT J;  2XKO A;  1S7A A;  3S1M J;  4L9T A;  5DYM A;  2L7F P;  3VVX A;  2H27 A;  1ETK A;  5FJ8 J;  2X48 A;  2E34 A;  2EFQ A;  4AC0 A;  4FCY A;  1MBE A;  5KHD A;  1LE8 B;  4OAZ A;  3P9K A;  1TWG J;  1TQM A;  1W0T A;  1VQ5 I;  1OIS A;  3A4C A;  4LB6 B;  3C07 A;  4BY7 J;  2QOP A;  2QIB A;  4V2F A;  3CCL I;  2HDW A;  3ZMZ A;  3BDD A;  1I3Q J;  3F8M A;  4F55 A;  2NNY A;  2OCC H;  4EM2 A;  2ZBK A;  2J5O A;  2YU9 J;  2X51 A;  3H9Q A;  2M0C A;  1DUX C;  2V79 A;  1XCB A;  4PXI A;  3O3K A;  4G6T B;  4OMZ A;  3JTG A;  4E6K G;  1X1B A;  4BEH A;  2EIL H;  3H0D A;  3TW7 A;  5J47 A;  4UY8 I;  3KFW X;  4JYK A;  3UKG A;  3SZT A;  2EZK A;  2ECB A;  2XAU A;  4Y15 A;  2QSG X;  5ICC A;  2HKX A;  3H9J A;  1OCR H;  2BY2 A;  1MGT A;  2ZJP F;  2DT7 B;  4I7H A;  1SVL A;  1M1E B;  4BQQ A;  3V7C A;  1HBX G;  4C3I J;  4O3M A;  1G3Y A;  2V7F A;  2VJI A;  1FWZ A;  2VOP A;  1GVD A;  5C4Y A;  4A6E A;  4IX7 A;  2XIG A;  4XNF A;  2WGB A;  2EFN A;  1FOY A;  5EDN A;  1BBY A;  3BNI A;  4JL3 A;  1VTN C;  1FP1 D;  2R7R A;  3HG9 A;  1P6R A;  4DGW B;  2VI6 A;  3A02 A;  4FQG A;  3CLQ A;  3K1M A;  1V54 H;  1UJ8 A;  1DP3 A;  2PBI A;  3M1C A;  4G6D A;  2MC3 A;  3WTS C;  2M30 A;  3EPZ A;  2VOO A;  3CJR B;  1VQM I;  4HRI A;  3OS1 A;  1SD5 A;  1B8I B;  1IN7 A;  4CYC A;  4JKZ A;  3KLN A;  3RIR A;  2V9P A;  4IHT A;  1DGW Y;  5HSZ A;  2EB7 A;  3D5R C;  5FB2 A;  4CH7 A;  4B1R A;  3M3Y J;  2CQK A;  1V5E A;  1IRG A;  1IV6 A;  3VOD A;  3ZP5 A;  1YW9 A;  2DOD A;  4XRF A;  4GFL A;  3OL3 A;  2HVR A;  4KIS A;  4MEY F;  2GXB A;  3HTS B;  3TMO A;  2BW3 A;  3ISP A;  3WTW C;  4KA4 A;  1ZK8 A;  2WY7 Q;  5A2Q Z;  2DT5 A;  2I8D A;  3ZPL A;  1SAU A;  2VQC A;  3SDG A;  1YYV A;  2AS5 F;  3ZQC A;  1LNW A;  1BI2 A;  1FBU A;  1XG1 A;  2ZC2 A;  3IP4 B;  4EEF G;  2D6Y A;  2DO7 A;  2BHY A;  1Z9C A;  2FNP A;  3DTK A;  1BR4 A;  1P4A A;  2K3F A;  2KMU A;  3LQR A;  1YG2 A;  3H1C A;  2PX9 A;  4MK6 A;  2IVM A;  4XID A;  1FMV A;  5DCM B;  5HLI A;  1A6Q A;  3K70 C;  3HJE A;  3K4L A;  3FZV A;  1OCP A;  3E5U A;  4C2M J;  1QO0 D;  5IYD J;  3DBH B;  4HEA 2;  3KPH A;  3OYM A;  2ACJ A;  2R92 J;  3K4B A;  2CS3 A;  3RKX A;  1A35 A;  2Y31 A;  5J1R A;  4CCK A;  5IP7 J;  4I0B A;  2HZT A;  3BQY A;  2XAS A;  4RGU A;  3H3V K;  4BXF A;  5GAG J;  1X4P A;  2DTZ A;  3EUH C;  1Z91 A;  3WG7 H;  1IN5 A;  2CG4 A;  2WV1 A;  4OIQ F;  2LF7 A;  3MEX A;  3UNG C;  3IL2 A;  1HLV A;  3S17 J;  5LGN A;  2DFE A;  2DQL A;  2FXA A;  3PQK A;  1R1U A;  1Q1H A;  2ZSH B;  3OIQ A;  2ZXH A;  5GPC A;  3FHZ A;  3L7W A;  4R1H A;  2GEN A;  2X6X A;  1QVU A;  1XSV A;  4NNJ A;  4XKW A;  2ZB9 A;  5DDG A;  4Y33 A;  2LG4 A;  4IPA A;  1REP C;  4MNU A;  3HL2 A;  1CQT A;  3GTQ J;  1UZC A;  2EBI A;  1HKT A;  4LB5 A;  4RLQ A;  3O60 A;  3COA C;  5IPA A;  3F8B A;  4RGR A;  2ZJQ F;  4AWX B;  4HQE A;  1LB2 A;  2ZXI A;  4MLO A;  4MGR A;  5J1U A;  4WX9 A;  5KAI C;  2DA5 A;  1U0J A;  3OOU A;  4PFP A;  3RSN A;  2HKU A;  3I0T A;  3QPL A;  3A01 B;  2I10 A;  1WJ5 A;  3K9T A;  1A5J A;  2FD5 A;  3MNL A;  1PJR A;  4CGZ A;  2DQR A;  1W36 D;  3ZQF A;  1E2X A;  2HYG D;  3I5U A;  1V5F A;  5HLT A;  3W2A A;  3R60 A;  4HF2 A;  2F5F A;  2ZNY A;  4CXF A;  3GZ6 A;  1VZ0 A;  3GYH X;  4RAY A;  4DYC A;  2N8G A;  3PJR A;  4YEJ A;  2CQQ A;  3SFZ A;  1HKQ A;  4MIM A;  2NVY J;  4RAF A;  2CQN A;  2UXU A;  2H6B A;  4AIH A;  4A93 J;  1E3H A;  4ZYG A;  4XLH A;  4BE2 A;  1ERD A;  1BW5 A;  2YPR A;  5HVQ C;  2F4O B;  2H8R A;  3X2Q H;  2KQR A;  4AM3 A;  4IXA A;  1ZKG A;  1K61 A;  1L0O C;  3HKZ N;  2DN0 A;  4YIR X;  4B4C A;  1BIA A;  3FHN A;  1N25 A;  4RGS A;  2G0E A;  5D5X B;  2Z16 A;  1SD4 A;  4WK8 F;  4G7H F;  2JPB A;  1NG6 A;  2AXT C;  4A3J J;  4F91 B;  2E36 A;  3I3L A;  3DKW A;  2RNJ A;  3W6K B;  3E7Q A;  3JTH A;  2NVQ J;  1F43 A;  1Z05 A;  2JWT A;  3VFZ A;  1ZG5 A;  4UXN A;  4RS8 A;  3MKZ A;  1TP4 A;  1EA3 A;  5ILS A;  2A6H F;  1USS A;  5B66 C;  2QLZ A;  1FIP A;  2IW5 A;  1WI9 A;  3NAU A;  1GT0 C;  1XB4 A;  4D7N A;  4UV8 A;  2MAB A;  2R7O A;  2R0Q C;  1W36 C;  4KDP A;  3BTC A;  4KMU X;  3KE2 A;  4YG2 F;  1VQ6 I;  3CUQ B;  1SFE A;  4XRM A;  1XSD A;  4A3D J;  2Y75 A;  3H36 A;  2P5K A;  2CW7 A;  3TDZ C;  3RKY A;  3LSJ A;  1R49 A;  3AG1 H;  3OR1 C;  1F4K A;  1UHS A;  4IRI A;  4L5I A;  3REO A;  2HYT A;  3K1N A;  1Z67 A;  4KJZ A;  2H1L A;  4PK4 A;  2H1K A;  3L2W A;  2O7T A;  2P0W A;  2AQF A;  2EIK H;  4MFD A;  4BJT A;  1XX5 A;  3EQL F;  3PO2 J;  2A69 F;  2MYS A;  1ETX A;  2E1O A;  5LGT A;  3V6G A;  3HHG A;  1OCO H;  2AO9 A;  4UNO A;  3F3X A;  4M71 A;  2QBY B;  2CUF A;  2DA1 A;  5E1Z B;  4EJW A;  1E17 A;  3BJO A;  3SEZ A;  1JT0 A;  2STT A;  2G9W A;  2M1B A;  3CF2 A;  3IWF A;  3S2H J;  3LOC A;  4XN0 A;  4IRG A;  3GTK J;  1T95 A;  4F52 A;  2DG7 A;  5L3G A;  1TW3 A;  3G3Z A;  4XRS A;  4OIR F;  3CJT B;  3BP8 A;  1LDK B;  1RC9 A;  1XN7 A;  1AOY A;  1OYW A;  2UXO A;  4QSH A;  5JR3 A;  5KCM A;  1ZG1 A;  4B09 A;  2IPQ X;  3BY6 A;  4AD9 A;  4XOR A;  1RPW A;  3PFY A;  1LDJ A;  1LDD A;  2DA3 A;  4MTE A;  2B1E A;  3E6M A;  1P4X A;  4YFN F;  1FTZ A;  4XLA A;  5H9T A;  1Z6T A;  3VW2 A;  2O7O A;  2GM4 A;  2ADU A;  3V42 A;  4H0E A;  3A03 A;  1MDM A;  2DMN A;  4JQF A;  3GFI A;  2ZXJ A;  4I2O A;  1TQP A;  1SD6 A;  5CLS A;  1UB9 A;  3HBL A;  2QYO A;  3BR6 A;  2CV0 A;  3NEU A;  3ERM A;  1W4M A;  4AC6 A;  1E3O C;  2OQR A;  4A12 A;  3OSF A;  2PMZ N;  1VQN I;  2Z5U A;  2RKH A;  1RKW A;  3SQN A;  1CF7 B;  1T0F A;  2E7W A;  3MFK A;  1TNS A;  2R5Z A;  5FRO A;  2ZJR F;  2CSO A;  5EG0 B;  3S1N J;  3OYE A;  1SFX A;  3CO7 C;  1PUF A;  1T6S A;  5M3M J;  1KYZ A;  2VN2 A;  2ECC A;  2ETH A;  2VT3 A;  3GTM J;  2VQH A;  2DOA A;  2DG8 A;  1OFC X;  4GCT A;  1O3T A;  1OQY A;  1SFO J;  1N78 A;  1B72 A;  2XAJ A;  2E60 A;  1FNN A;  1MBJ A;  2QQ9 A;  1JHH A;  3AL0 B;  4QWQ A;  2CUJ A;  2GIZ A;  4X6A J;  1I3A A;  2AXL A;  2Q2E A;  2O6G E;  5DEQ A;  4YZE A;  2EQR A;  2ICW G;  4EAT A;  2BY1 A;  3DPL C;  3VSK A;  4U7D A;  3CCJ I;  5L3E A;  4WXD A;  1XDS A;  4ICH A;  2R93 J;  4BDY A;  2G7G A;  2HR3 A;  4A3M J;  2E71 A;  2R7F A;  4PSX A;  1VFC A;  3WU0 A;  3HKZ A;  3PO3 J;  2IA1 A;  4KN7 X;  1WHU A;  3GFJ A;  1FBQ A;  5BOX A;  3G56 A;  6PAX A;  2PFV A;  1LEA A;  4GCL A;  3FXK A;  3HM5 A;  3K4M A;  2H8W A;  2ISY A;  2PMH A;  2IS1 A;  1I1G A;  3LA2 A;  5E1W A;  2ZNZ A;  4LG3 A;  3MKW B;  3GEZ A;  3SZG A;  1UST A;  1U8R A;  2JUG A;  3GF2 A;  3OOP A;  5ILV A;  2QF7 A;  1D1B A;  2M7B A;  1MBK A;  3ZMD A;  2NP3 A;  1X19 A;  1V3F A;  2JMW A;  2VBX A;  1GUU A;  3OIO A;  4M72 A;  3WHB A;  3QQA A;  2DFH A;  1WJA A;  4S05 A;  2W85 A;  5CXG A;  5E18 F;  1XSX A;  4QLC U;  1S72 I;  4XQF A;  5HOO A;  3BC8 A;  2LY1 A;  3C2H A;  3NWT A;  3QRF F;  2B7E A;  5IP9 J;  2UUZ A;  4ESF A;  4LGW A;  2JA6 J;  2OF7 A;  2W25 A;  4BEH B;  3GWZ A;  4N0B A;  4PZJ A;  3BG5 A;  2FEZ A;  2EV6 A;  4N4O B;  2KT0 A;  3VVZ A;  3R0J A;  1DU0 A;  5IP6 A;  4E70 A;  4A6D A;  4HAM A;  3FXU A;  1BI0 A;  4CHU A;  3KKC A;  1D3Y A;  2HEO A;  1O7F A;  2HXI A;  5EF6 A;  4BU2 A;  4EV0 A;  1Y8R B;  1X58 A;  3GTO J;  4GFK A;  2QQA A;  4ZYA A;  4OOI A;  2TRT A;  1FP2 A;  5D5W B;  5AON A;  2ZME B;  3G1O A;  2ISZ A;  2R7Q A;  4BQN A;  2CQX A;  3DU6 A;  3QU6 A;  1FLI A;  4IF4 A;  4KIC A;  5F0C A;  2F5E A;  4HG2 A;  4I0A A;  4A69 C;  3V8L A;  2CJJ A;  5DD4 A;  2RV8 A;  1B59 A;  1OR7 C;  4C2U A;  4M3E A;  2WB1 A;  4CUG A;  3RTR A;  1B8I A;  1ODD A;  4V19 K;  4C2M A;  1ZQ3 P;  2RGV A;  3DBL B;  3MAJ A;  2P6S A;  2JPC A;  1FIA A;  2DK5 A;  4LIV A;  4MFE A;  4BBR J;  4DYQ A;  4PSW A;  2OTL I;  5DS9 A;  1K78 B;  3HB9 A;  3BG9 A;  1S9H A;  2YX4 A;  3V8K A;  3HPG A;  1ZLJ A;  1GHC A;  1Y56 A;  1P7I A;  1T08 B;  3DEW A;  5JHF A;  3S32 A;  3ZCO A;  2VE8 A;  3M07 A;  5J3L A;  3SJM A;  3LJL A;  3AG3 H;  2GOX B;  2L02 A;  4DBR A;  1UHM A;  3KZ9 A;  2WAF A;  1H9G A;  3ASN H;  3I58 A;  3VSL A;  4PJM A;  1LFU P;  3RZO J;  5C3E J;  2IGO A;  2WTE A;  3CES A;  1EH6 A;  1MKM A; 
#chains in the Genus database with same CATH homology
 3IH4 A;  1T56 A;  2LVS A;  4LOC A;  2Y30 A;  4HNV A;  2ID3 A;  4XK4 A;  4FIS A;  4IHY A;  1IG7 A;  2HOA A;  4BXX J;  1MBH A;  4C3I J;  1AKH B;  2K9S A;  3LSP A;  5FLM J;  1HOM A;  1GVD A;  5C4Y A;  5JLX A;  5FKO A;  2Y0S N;  1W0U A;  1JTY A;  2EZL A;  1WCM J;  2WGB A;  2MG4 A;  1Z77 A;  4MXM A;  2ZOY A;  5IOY A;  1VND A;  1RKT A;  5EDN A;  2YVH A;  1ORK A;  3BNI A;  4JP0 A;  2GLO A;  3D1N I;  4JL3 A;  4L62 A;  2VI6 A;  2TCT A;  3A02 A;  3ZQL A;  2E2J J;  1ETY A;  2X9D A;  2R5Y B;  3ANP A;  2E2I J;  5M5W J;  1HCR A;  4Y52 J;  2D5V A;  2L0K A;  3GTG J;  3CWR A;  1APL C;  1PUF B;  1B8I B;  2L7M P;  1Y1W J;  5EZH A;  4CYC A;  4JKZ A;  3HOV J;  2GBY A;  2JA8 J;  1RES A;  5HSZ A;  5EEA A;  4CYC B;  2EZI A;  4B1R A;  1VF9 A;  2WUI A;  3M3Y J;  4NEL A;  2WAQ N;  4AYB N;  1IV6 A;  4GFL A;  4XIC A;  2YS9 A;  3GTJ J;  2DA2 A;  2XDN A;  3JRH A;  4KWA A;  4RDU A;  1X2N A;  1ZK8 A;  3GTP J;  2LK2 A;  1XS9 A;  2G7L A;  3EUP A;  3W6V A;  3SDG A;  5E3O A;  2DMP A;  2UXP A;  3ZQC A;  5J1Y A;  3B81 A;  2Y9Y A;  3HGY A;  5C44 J;  1JUS A;  1XG1 A;  3RH2 A;  2Q24 A;  1JKP C;  4EEF G;  5M5Y J;  5EGO A;  2D6Y A;  5BNG A;  1FJL A;  3BTJ A;  2PBX A;  2VKE A;  2XGC A;  4MK6 A;  4XID A;  3O8G A;  2E19 A;  1NK3 P;  4M3F A;  3VUQ A;  1OCP A;  2R7Z J;  3NNR A;  4C2M J;  3TP3 A;  5IYD J;  1HF0 A;  3BRU A;  5D19 A;  1EF4 A;  2R92 J;  4M6V A;  4DYR A;  3IUV A;  2Y31 A;  1WH7 A;  1A6I A;  5J1R A;  1OJL A;  2HDD A;  5IP7 J;  4A3C J;  2DA4 A;  1U78 A;  3BQY A;  1MBG A;  5EZG A;  4IHX A;  3H3V K;  5F0F A;  1OCT C;  2DTZ A;  2OPT A;  1ENH A;  3G7R A;  2LY9 A;  2WV1 A;  3CMY A;  4A3B J;  3LWJ A;  1HLV A;  3S17 J;  4A3E J;  1GV5 A;  1LE8 A;  3JRA A;  2M9H A;  3GBG A;  2LLK A;  2G3B A;  1YRN B;  2GEN A;  3K2A A;  3LHQ A;  1QVU A;  2IEK A;  2ZB9 A;  3BT9 A;  2KDZ A;  2ID6 A;  1CQT A;  3G1L A;  1ZR4 A;  3GTQ J;  1SAN A;  2EBI A;  1TWA J;  1D5Y A;  3NRG A;  2FQ4 A;  1JT6 A;  3HTA A;  4X1E A;  3O60 A;  4D5C A;  3HOX J;  5IPA A;  2ZCX A;  2NP5 A;  5K7Z A;  2NS8 A;  1LFB A;  4MLO A;  3RKQ A;  5J1U A;  5F04 A;  2V57 A;  3JRI A;  3S1Q J;  2DA5 A;  2W48 A;  3OOU A;  9ANT A;  2HKU A;  3VW0 A;  3QPL A;  1TC3 C;  3A01 B;  2I10 A;  1JKO C;  2ZOZ A;  1A5J A;  4AUX A;  2FD5 A;  3MNL A;  5CW8 A;  3IH3 A;  1JJ6 C;  4FTH A;  4D7M A;  2EH3 A;  3ZQF A;  1GDT A;  2RAS A;  5JLW A;  2QTQ A;  3GEU A;  5HBU A;  3BHQ A;  5FKN A;  1JJ8 C;  2O8K A;  1WGX A;  5DTD A;  3M4O J;  3VVY A;  4DYC A;  2ELK A;  4Y7N J;  2N8G A;  3IH2 A;  2CQQ A;  4MIM A;  2IBD A;  4GFB A;  2NVY J;  3H0G J;  5F0H A;  2UXU A;  1IDY A;  3GTL J;  1IC8 A;  2HQ5 A;  4A93 J;  3VOX A;  1BJZ A;  5C4J J;  4UUT A;  3ANG A;  1TWH J;  3NPI A;  4QIW N;  4G12 A;  1IGN A;  3TED A;  2XGD A;  4B3A A;  2OER A;  3VPR A;  1BW5 A;  2LD5 A;  3QPS A;  2H8R A;  2JK3 A;  4UDS A;  1IUF A;  1ZKG A;  2JJ7 A;  4W1U A;  1K61 A;  5AQC A;  1Z0X A;  3JRE A;  3HKZ N;  1R9T J;  2ME6 A;  2DN0 A;  2LKX A;  4B4C A;  2G0E A;  1H89 C;  4A3J J;  3E7Q A;  3LSG A;  3MVP A;  3ZQH A;  2NVQ J;  3KNW A;  3JRG A;  1F43 A;  5FHP A;  3VW1 A;  2JWT A;  2ME0 A;  3VIB A;  1IRZ A;  2L7Z A;  4C3H J;  3HOY J;  1Q1V A;  3NAR A;  5GP9 A;  5E3M A;  2JA7 J;  1WH5 A;  2IU5 A;  3JSJ A;  1FIP A;  1GT0 C;  1U9O A;  3NAU A;  3JRB A;  1H88 C;  4D7N A;  3HE0 A;  2R0Q C;  3OSG A;  3S1R J;  3BTC A;  4I76 A;  3JRD A;  4V2G A;  2XPV A;  3S14 J;  4AF5 A;  3PM1 A;  2HI3 A;  4XRM A;  4A3D J;  3NXC A;  3MN2 A;  1NK2 P;  1HDP A;  3LSJ A;  2RAE A;  5F1J A;  1JGG A;  1UHS A;  1AKH A;  2HYT A;  4JNN A;  3PAS A;  1UI6 A;  2M34 A;  1JKQ C;  4A3I J;  1JKR C;  2H1K A;  3S16 J;  2O7T A;  3JRC A;  4MFD A;  3PO2 J;  3CDL A;  4HKU A;  1ETX A;  2E1O A;  3V6G A;  2R5Z B;  1Y1V J;  3DCF A;  2AO9 A;  3AQT A;  2CUF A;  2DA1 A;  5EGO B;  3ZQG A;  1JT0 A;  3TP0 A;  3S2H J;  3QKX A;  1BW6 A;  3BG3 A;  3LOC A;  4A3L J;  2NS7 A;  1FTT A;  4GCK A;  1UG2 A;  3L1P A;  4BBS J;  3GTK J;  2DG7 A;  2MW8 A;  1B72 B;  3V78 A;  3BTI A;  2DA7 A;  4XRS A;  3G1M A;  2YVE A;  5E3N A;  2UXO A;  4QSH A;  4BKX A;  2DA6 A;  1YRN A;  1ZTR A;  2FX0 A;  5F08 A;  2FBQ A;  2LR8 A;  3BR3 A;  1RPW A;  3HOU J;  2LFB A;  4J19 A;  2WB1 N;  2DA3 A;  2MSY A;  3Q0U A;  1FTZ A;  3BR5 A;  3SFI A;  5H9T A;  2LTP A;  1O4X A;  3VW2 A;  3PPB A;  2O7O A;  2GM4 A;  2XPW A;  3A03 A;  1ZGW A;  2DMN A;  1MH4 A;  1UMQ A;  2DMQ A;  3HEF A;  3HBL A;  1IJW C;  2REK A;  2COB A;  2XB0 X;  3BR6 A;  5EFY A;  4CGR A;  5M5X J;  2L9R A;  3TW6 A;  1U9N A;  1H8A C;  3ON4 A;  4D5F A;  4NN1 A;  5IOZ A;  1VI0 A;  1IDZ A;  2VPR A;  1E3O C;  4AC6 A;  1UI5 A;  4FE7 A;  2NX4 A;  3OSF A;  2PMZ N;  1QVT A;  3JRF A;  4M3G A;  2DJN A;  1RKW A;  5IYB J;  3RZD J;  2K9N A;  3BCG A;  5FKK A;  3FKI J;  2R5Z A;  3VOK A;  1RR7 A;  1F36 A;  3O8H A;  2O9L A;  4DZP A;  5EG0 B;  3S1N J;  3DPJ A;  1WI3 A;  2K9Q A;  4S0H B;  1PUF A;  2AHQ A;  1BL0 A;  5FLV A;  5M3M J;  5EG0 A;  2YUS A;  1MNM C;  5HAW A;  3FIS A;  2ECC A;  1AHD P;  3HTI A;  3GTM J;  1U8B A;  1MSF C;  5FKL A;  1AU7 A;  2DG8 A;  1OFC X;  1SGM A;  4GCT A;  5K7H A;  3WHC A;  1XC5 A;  4JX4 A;  5D18 A;  1SFO J;  1B72 A;  4FE4 A;  3F1B A;  3BTL A;  3LNQ A;  1NTC A;  1MBJ A;  3HOZ J;  3HOW J;  2DMU A;  1ETO A;  4X6A J;  3B6A A;  2CUE A;  2P81 A;  4RBO A;  4YZE A;  4I6Z A;  2EQR A;  2NOG A;  3FIW A;  4ABZ A;  2FJ1 A;  3VP5 A;  1ZR2 A;  2ZCM A;  1POG A;  2HXO A;  4ICH A;  2R93 J;  2QKO A;  2UXI A;  5FKM A;  3BR0 A;  2G7G A;  3HTH A;  4A3M J;  3PO3 J;  1VFC A;  4M3D A;  3RD3 A;  3K7A J;  3B6C A;  5K7F A;  2B63 J;  3FRQ A;  5IYC J;  4A3K J;  5M3F J;  5F27 A;  3G56 A;  2DMT A;  4XRS G;  3FK7 A;  4GCL A;  2LP0 A;  4ACI A;  3HM5 A;  4BY1 J;  1S7E A;  4A3G J;  2NVX J;  1I50 J;  3P9T A;  1JUM A;  1TWC J;  5K58 A;  1P7J A;  4L5E A;  1MH3 A;  3BJB A;  2HOS A;  5C4X J;  2QF7 A;  5CXI A;  1DU6 A;  1MBK A;  4MO7 A;  2NP3 A;  2JMW A;  2GFN A;  2CRG A;  1GUU A;  3OIO A;  3WHB A;  1RET A;  3QQA A;  1BA5 A;  2W53 A;  4IHV A;  3KKD A;  1MBF A;  3F0C A;  3JR9 A;  3NI7 A;  5CXG A;  2QCO A;  5DAJ A;  5FMP A;  3EGQ A;  5D1R A;  4M3B A;  2XRL A;  3S15 J;  4W97 A;  4QTR A;  1HDD C;  2QWT A;  2HOT A;  3AQS A;  3IV5 A;  3ZQI A;  5IP9 J;  4UUS A;  3CQZ J;  3LSR A;  2JA6 J;  2VKV A;  3Q3S A;  2OF7 A;  2ZCN A;  3C2B A;  3Q0W A;  3BG5 A;  2Y9Z A;  2XSD C;  2IAI A;  1QPI A;  2KT0 A;  3VVZ A;  1ETV A;  3ON2 A;  2M8G X;  4JX5 A;  4NDL A;  3CJD A;  5EYR A;  1DU0 A;  3A01 A;  5IP6 A;  1TWF J;  1ETW A;  3BR1 A;  1GV2 A;  1ETQ A;  2UXH A;  2JN6 A;  1QRY A;  1MSE C;  2F07 A;  3KKC A;  3Q0V A;  5E3L A;  2HXI A;  3I4M J;  5EF6 A;  4JX6 A;  4ME9 A;  3I4N J;  3FK6 A;  1X58 A;  3GTO J;  4DW6 A;  2PZ9 A;  1ITY A;  5HOD A;  2TRT A;  3COL A;  4GFK A;  1WPK A;  2K40 A;  3RQI A;  3G1O A;  1I6H J;  2VUM J;  3ZOB A;  2CQX A;  3GZI A;  3CRJ A;  3HIM A;  2X6O A;  3BR2 A;  2XPU A;  2NVT J;  3S1M J;  5F0C A;  2L7F P;  3VVX A;  1ETK A;  4A69 C;  2X48 A;  5FJ8 J;  2G7S A;  2CJJ A;  3BQZ A;  4IEJ A;  2XB5 A;  4AC0 A;  3E7L A;  4FCY A;  1MBE A;  1LE8 B;  4IHW A;  2E2H J;  1TWG J;  4M3E A;  1B8I A;  2CU7 A;  1W0T A;  1T33 A;  3C07 A;  1JUP A;  1G2H A;  4BY7 J;  1X2M A;  1ZQ3 P;  2OI8 A;  2QIB A;  4A3F J;  4MFE A;  4V2F A;  4BBR J;  1FIA A;  2QOP A;  2RHA A;  4DYQ A;  2JA5 J;  2GUH A;  1I3Q J;  5DS9 A;  3HB9 A;  2R5Y A;  4DZJ A;  3BG9 A;  3MKL A;  2YU9 J;  3HTJ A;  3QBM A;  2M0C A;  3T6N A;  4PXI A;  1P7I A;  2EZH A;  3DEW A;  3S2D J;  5FGL A;  4C3J J;  3HGG A;  5J3L A;  2M2E A;  1K83 J;  3SJM A;  2HYJ A;  5GPA A;  2Y2Z A;  1JTX A;  3LJL A;  3KZ9 A;  1FEX A;  3TW7 A;  1LFU P;  4JYK A;  2MGQ A;  3CCY A;  3UKG A;  3RZO J;  3S5R A;  5C3E J;  2XGE A;  2EZK A;  2ECB A;  4UUS B;  3HDD A;  5GPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...