4X1EA

Crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
199
structure length
199
Chain Sequence
RAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIAASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator RutR
publication title Ligand binding specificity of RutR, a member of the TetR family of transcription regulators in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o6:h1
total genus 75
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x1eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4x1eA02
4CYCA 1IV6A 3B6CA 1BW5A 1U8BA 1ITYA 1XG1A 3G1OA 3BT9A 1SGMA 1UMQA 2DA6A 1IG7A 4A3BJ 3S14J 2UXUA 4A3CJ 3HOUJ 2M0CA 3CRJA 3ZQGA 4BKXA 1CQTA 2O8KA 1UHSA 2GM4A 3A01A 3OOUA 1ETOA 3HM5A 1BJZA 2JWTA 1G2HA 1AKHA 1LFBA 2FJ1A 5EYRA 1MNMC 3IH4A 1B8IA 2YVHA 1P7IA 2G3BA 2R93J 1RETA 5FGLA 2DG7A 4XRMA 5HODA 2WAQN 2XPUA 1MBKA 3WHBA 1IJWC 2YU9J 4CGRA 3ANGA 2E2JJ 3GTJJ 2EZKA 4M3DA 3HOZJ 4MO7A 1Y1WJ 3QKXA 3LHQA 2H8RA 2P81A 1HDPA 5FMPA 2Y31A 3RH2A 5CXGA 2ID3A 3GTGJ 5F0CA 2ECCA 3NXCA 2QTQA 2KT0A 4JL3A 4DYQA 1JKQC 1VNDA 3E7LA 3BNIA 3H0GJ 2PZ9A 3HIMA 3O60A 5M3MJ 1IDYA 2DMPA 4M3BA 2X9DA 4FTHA 1D5YA 5J1RA 2MSYA 1RESA 2R5ZB 1ZK8A 1O4XA 3KNWA 5M5YJ 1ZKGA 3G1MA 4XK4A 3F0CA 4NELA 2WGBA 1OFCX 3LOCA 2RAEA 2CUEA 2DA7A 1I3QJ 4D7NA 2NS8A 4UUTA 3LSJA 3SFIA 4XRSA 2XPWA 2Y0SN 2EZHA 2YUSA 5C3EJ 3IV5A 1JJ8C 1T56A 5E3OA 5J3LA 5C4JJ 4B4CA 4UDSA 2AHQA 2YS9A 4MFEA 1ZTRA 2WB1N 4A3GJ 3BRUA 2HQ5A 1TWGJ 2GFNA 2QOPA 4MK6A 2L7FP 4GCKA 5C44J 1QPIA 1ZR2A 1AU7A 4FCYA 2UXPA 1RKTA 2REKA 1P7JA 2NVXJ 3HTHA 4A3LJ 1JTYA 3VOXA 3HTIA 4IHXA 4RDUA 1RPWA 3RD3A 4M3EA 3BTJA 3JRCA 2NVQJ 3P9TA 4JX4A 5GPAA 5IYCJ 3VVZA 2G7SA 2IU5A 3BG3A 5C4XJ 1Y1VJ 3D1NI 1WGXA 1MSFC 4JNNA 2OF7A 3SDGA 3VVYA 3BQZA 2XRLA 1GVDA 1IGNA 4AC0A 5DTDA 1MSEC 2JA8J 4DYRA 3LJLA 5H9TA 1FJLA 3PASA 3C07A 1WI3A 3NRGA 2L0KA 2R5ZA 1K83J 2DA4A 4LOCA 1HDDC 2ZCNA 4V2GA 2PBXA 5D1RA 4XIDA 5IYDJ 2DA5A 1Z0XA 5J1UA 1Z77A 4X6AJ 2COBA 2O9LA 3VVXA 1WH7A 1IRZA 3HTJA 5HBUA 3GTKJ 2E19A 1WH5A 1XC5A 3ZOBA 2B63J 2DA3A 1OJLA 4KWAA 4GFKA 5FKMA 3BR6A 3HTAA 3BTCA 5FHPA 4W97A 5EGOB 3BCGA 2HDDA 4M6VA 1MH3A 3AQSA 1JT6A 1WCMJ 2WUIA 1GV2A 3OIOA 2K9NA 2MW8A 1APLC 2FD5A 2QCOA 2ZCMA 3ZQHA 5D19A 3JRGA 1DU0A 3QPLA 2D6YA 4B1RA 3HOWJ 3C2BA 5HSZA 3WHCA 2E1OA 2HOSA 2TRTA 4XRSG 2LLKA 1ETQA 3NARA 3M4OJ 3ZQIA 4XICA 1ENHA 5FLMJ 1JGGA 4BBSJ 5EZGA 1OCPA 3VW2A 5F1JA 5M3FJ 3BJBA 2ME6A 2EZIA 1S7EA 1LE8B 5FKOA 3B81A 2DMNA 5FJ8J 4GCLA 3G7RA 2IEKA 4EEFG 3HGYA 2UXIA 2FBQA 4DYCA 2WV1A 1VF9A 2G7GA 2IBDA 1ETWA 2ECBA 4X1EA 2JK3A 2HKUA 2LFBA 4L5EA 3M3YJ 1A5JA 4Y52J 2R92J 3GZIA 5JLWA 3BR2A 5E3LA 3LNQA 2HXOA 2AO9A 3LSRA 3GTOJ 3G56A 2OPTA 1HLVA 3VUQA 2FQ4A 4NDLA 1JUPA 2N8GA 3KKDA 3I4NJ 5EFYA 3SJMA 1I50J 1TWHJ 3S15J 4FE4A 2HOAA 4BBRJ 2OI8A 1HF0A 2XGCA 3COLA 1TC3C 2VKEA 3DEWA 4D5CA 1H88C 2O7TA 1UG2A 2CU7A 3BQYA 2HI3A 2EH3A 4B3AA 2VI6A 1NK3P 3W6VA 4A3MJ 4NN1A 2UXOA 5EF6A 3CDLA 3S16J 3JRFA 3S2HJ 5GP9A 5EGOA 4BXXJ 2LTPA 5IPAA 2EBIA 5F0FA 1FIAA 2LK2A 3PPBA 2XPVA 3BR1A 2XB5A 2MGQA 3Q0WA 2ZCXA 3HDDA 3VPRA 1MBFA 2LD5A 1POGA 4DZJA 1K61A 3I4MJ 1FIPA 2NP5A 5F04A 2CRGA 3S5RA 1A6IA 2RASA 2LY9A 1U78A 2O7OA 4QIWN 1QRYA 1TWAJ 3ZQFA 5CW8A 5J1YA 3PO2J 3FKIJ 3TW6A 2R5YB 1LE8A 2ID6A 1H8AC 1R9TJ 3O8GA 4A3IJ 4AUXA 2NVYJ 1JJ6C 4HNVA 2QKOA 2GENA 4DZPA 2PMZN 4I76A 4A3KJ 5K7HA 3IUVA 5FKLA 3BTIA 3QBMA 4JX6A 1ETYA 1F36A 3OSGA 3JRAA 4A3DJ 3JR9A 4QTRA 4YZEA 2DN0A 1X2MA 3O8HA 3V6GA 3BR5A 2HYTA 3CJDA 5DAJA 3H3VK 3KZ9A 2M34A 1ETVA 1XS9A 3ON2A 4FISA 4W1UA 2Y9ZA 2HXIA 1ZGWA 5IOZA 1GT0C 3NI7A 3HOVJ 4HKUA 2IAIA 2K9SA 1LFUP 2XDNA 5K58A 2DJNA 5IP7J 4IHVA 1MH4A 2ZB9A 3RKQA 2F07A 2ZOYA 5C4YA 5E3MA 1W0TA 4DW6A 1T33A 1H89C 5IYBJ 3MNLA 2TCTA 2NS7A 4AC6A 1TWFJ 2JA7J 1BA5A 2NOGA 4AYBN 1BL0A 2LP0A 1ORKA 3JREA 2JA6J 3CWRA 3GTMJ 1JTXA 2D5VA 2XSDC 2M9HA 3HOYJ 5HAWA 4MFDA 1U9NA 3BTLA 3NAUA 1ETXA 4MLOA 1EF4A 3ZQCA 5DS9A 1YRNA 4V2FA 3VP5A 2ELKA 3ON4A 3S1NJ 1IUFA 4I6ZA 2LR8A 2EZLA 3LWJA 3FK6A 1MBGA 4A69C 3TP3A 3KKCA 1U9OA 2R5YA 4IEJA 4A3JJ 4JP0A 1TWCJ 1MBJA 3TP0A 3FIWA 3HBLA 5F27A 3TEDA 1UI5A 4Y7NJ 2LKXA 1VFCA 4GFLA 3EGQA 2DMUA 1WPKA 2M2EA 3FISA 1IDZA 2K9QA 3MN2A 2R0QC 4MXMA 1MBEA 2GUHA 3G1LA 3Q3SA 1PUFB 5M5XJ 2NVTJ 1B72B 5M5WJ 2XGEA 2CUFA 2QF7A 2H1KA 3IH2A 3FK7A 1NTCA 1F43A 3F1BA 5IP9J 4FE7A 3UKGA 2JJ7A 3JSJA 2K40A 5D18A 2VUMJ 4S0HB 3JRIA 4GFBA 4ACIA 1GV5A 5F08A 3GTLJ 2W48A 2HYJA 1JT0A 2JA5J 3FRQA 2NP3A 3BR0A 2M8GX 5EDNA 1QVUA 4C3HJ 4M3GA 2DG8A 1UI6A 4M3FA 3JRDA 2L7MP 3T6NA 2MG4A 1JKRC 3GBGA 2DMQA 1X58A 3QQAA 2L9RA 4PXIA 1VI0A 4UUSB 1E3OC 1IC8A 3GTQJ 2X48A 3DCFA 3BR3A 3Q0VA 4MIMA 3OSFA 3BHQA 3CQZJ 1X2NA 2ME0A 3LSPA 3TW7A 4BY7J 3PO3J 5CXIA 2Y9YA 4IHWA 3HKZN 5FKNA 3VW1A 3K2AA 3NNRA 5IP6A 4BY1J 2X6OA 1YRNB 1HCRA 2GLOA 2FX0A 3MVPA 1ZQ3P 3VOKA 3GEUA 5EG0B 3AQTA 2QWTA 1SANA 3QPSA 2DA2A 3JRHA 1JUSA 4G12A 3GTPJ 3CMYA 3EUPA 3BG9A 2VKVA 3IH3A 4D7MA 3RZDJ 1MBHA 1OCTC 4A93J 3PM1A 3E7QA 4D5FA 1PUFA 2Y2ZA 2G0EA 1B72A 3VIBA 3L1PA 4CYCB 2XGDA 4A3FJ 3MKLA 1JUMA 5AQCA 5K7FA 2YVEA 4J19A 3HB9A 1AHDP 3BG5A 3V78A 2CQXA 3S17J 3S1QJ 1I6HJ 2G7LA 2W53A 3A02A 2CJJA 4IHYA 2DMTA 5IOYA 2EQRA 3K7AJ 3VW0A 3A01B 1GDTA 3B6AA 4RBOA 2HOTA 2R7ZJ 1BW6A 3Q0UA 5EZHA 2QIBA 1AKHB 5EEAA 2E2IJ 3RQIA 2XB0X 2ZOZA 1B8IB 2VPRA 2Q24A 3JRBA 2OERA 3ANPA 3HGGA 4C3JJ 1JKOC 2UXHA 5K7ZA 5E3NA 4JYKA 2Y30A 3HOXJ 4JKZA 3S2DJ 3S1MJ 4UUSA 1RR7A 2I10A 3HEFA 2JN6A 5GPCA 3DPJA 3NPIA 1ZR4A 5BNGA 3HE0A 5JLXA 3CCYA 5FLVA 2L7ZA 1FTTA 1QVTA 2DA1A 4A3EJ 3ZQLA 9ANTA 4L62A 2DTZA 4C2MJ 2GBYA 1W0UA 2KDZA 4QSHA 1NK2P 5F0HA 5EG0A 1DU6A 1GUUA 2RHAA 3A03A 1JKPC 1HOMA 1RKWA 2V57A 1FTZA 2E2HJ 3RZOJ 2LVSA 3LSGA 3S1RJ 2JMWA 4ABZA 5FKKA 4GCTA 4C3IJ 4AF5A 1Q1VA 2CQQA 4JX5A 4ICHA 2NX4A 1SFOJ 4ME9A 1ETKA 1FEXA
chains in the Genus database with same CATH superfamily
2DQRA 4CICA 2Q0OA 5E79C 1U8BA 3G1OA 2KRFA 4RGSA 3WTUC 5BQTA 2OZUA 5D5UB 2LC2A 4HDUA 2M0CA 4M9XA 2R7RA 2HWVA 3LWFA 3R61A 1UHSA 4XSXF 2HZDA 4KUMA 3A01A 3EYYA 2QQ8A 3GO5A 2D1HA 2JWTA 2P8TA 2E1MB 3H5RA 5DD8A 4IQJA 3IH4A 3LFUA 3WE2A 2XROA 5LRSA 3WTTC 1N78A 2DG7A 5ICEA 2WAQN 3SZGA 5HODA 1MBKA 3WHBA 2CQNA 3U1DA 1ZLJA 1OYIA 3K1MA 3HOZJ 1Z1DA 3QKXA 1REPC 1BM9A 3LHQA 2DFEA 3Q9SA 2E34A 1YOVB 4BDZA 5FMPA 1LVKA 3RH2A 2V9VA 5FLXK 2DOFA 3OYGA 1PP8F 2KRCA 2KT0A 3E7LA 1IN5A 3DF8A 3H0DA 3BOQA 5KVRA 1HKTA 3DLLF 3DV8A 2X9DA 4IF4A 4M3BA 2NVUB 1D5YA 1RESA 3S3MA 3KNWA 5M5YJ 2X6WA 3AL0B 1ZKGA 1J7KA 4XK4A 3S3NA 4ZYHA 1OKRA 3V8LA 1OFCX 4M71A 2D1VA 1OR7A 1FT9A 2NS8A 2XPWA 2X4HA 2YUSA 3TBIA 3HXLA 4ETSA 3O2PE 5GAHJ 2TDXA 1U0JA 1WWXA 4GDFA 2V1XA 1IZ1A 2GQQA 2XF7A 3FDYA 4UDSA 4OAZA 2R7WA 4C30A 4EM0B 4MFEA 1UHWA 2KHMA 4HF2A 3OYFA 3A4CA 2GXGA 3ABMH 2HVRA 4A3GJ 1W7PB 1X3UA 2CQKA 3KP6A 2JSCA 4GCKA 5A2QZ 5C44J 2A69F 5IT9Z 1AU7A 3PFIA 4U7DA 2UXPA 5H6RA 1XGNA 1RKTA 2REKA 1P7JA 4KDPA 4RDUA 2QYOA 1GXPA 1W5CC 3BTJA 4M3EA 1Y0UA 3BPVA 3JRCA 2H27A 4JX4A 3P9TA 1CF7A 5GPAA 1I1SA 4RAGA 2RNGA 1FPQA 3KZYA 4ESJA 1X1DA 4G6DA 1U5TC 5C4XJ 1RIOH 2CYYA 3E3VA 3FXLA 4M6YA 3HL2A 1G59A 4IHSA 4C2UA 4Y17A 4AC0A 1ONVA 4UV8A 5LEJA 1MSEC 5H9TA 3LJLA 2Z1DA 1FJLA 2KQRA 2K4JA 5DV5A 4CCOA 3NRGA 2R5ZA 1K83J 2DA4A 5ICCA 5LBQA 3HTSB 1I39A 4XBFA 3CCVI 1VQ7I 5HLTA 5CVIA 4N9IA 2KDOA 2O9LA 1O57A 1GXQA 2GIZA 2L9NA 3HTJA 1HA8A 3IUOA 1XC5A 4Y33A 2R7TA 1LJ9A 3A0BC 1DUXC 2EILH 3OR1C 2DA3A 2NS0A 3HSFA 2R7FA 2QUFA 2CW0F 3DU6A 1JT6A 1WCMJ 1W4MA 3RJPA 2WUIA 3VTIA 4UNOA 1XMXA 2HTJA 2QCOA 4BNCA 2W00A 2DLLA 4GRIA 4AIDA 1TP4A 3QPLA 4B1RA 3HOWJ 3WHCA 1IAWA 2VC0A 5HLIA 1TLHB 3FXRA 4A0YA 1UB9A 2IVMA 2LLKA 2QEXI 3DU5A 5EZGA 4XONA 2O0YA 4U87A 4XKBA 3SFZA 1LE8B 2V26A 3IKTA 3DTKA 1S5LC 2DMNA 3HOSA 1IN7A 2ZJQF 3WGIA 5GAGJ 1MIJA 2R7SA 1B1BA 2G7GA 3A1YA 1ETWA 3K6GA 6PAXA 2ECBA 2JK3A 1X1AA 3B02A 2VQHA 1A5JA 2PN6A 2HQAA 2FNAA 3FF5A 3S32A 1DPUA 2ZXWH 2HXOA 4BEHB 2K3FA 1SC7A 2ZJPF 2FQ4A 1JUPA 2N8GA 1YI2I 2JTVA 4EMSA 3MKWB 3S15J 1BI1A 2LH9A 4HA8A 4LK1F 2HOAA 4E4HA 2GAUA 1HF0A 2E5ZA 1TC3C 2EV6A 2VKEA 3E5XA 5ICFA 4ZZDA 1H88C 1Q1HA 1USTA 1UG2A 2KIFA 3BQYA 5E17F 4B3AA 2VI6A 3DBLB 4NN1A 1R5GA 4EVIA 3BY6A 5GP9A 2FA5A 3VEPA 1K7AA 3OYJA 1KU9A 2H94A 3NWTA 1R1UA 4NQWA 1FMWA 2XPVA 4I98B 3RKXA 1J0RA 2ZCXA 1CGPA 1Z05A 1IN6A 4AWXB 4U0WA 4H4KC 3ZMVA 1POGA 4DZJA 3PQKA 3PUBA 5F04A 2CRGA 4GGGA 5CJ9A 3LQRA 2CO5A 2RASA 1W7PD 5CW8A 1K79A 2ID6A 3ABUA 4PCQA 2IGMA 4S04A 4NC6A 1OYYA 2HGCA 1X1BA 3EDPA 3O8GA 3CF5F 2QKOA 3OYLA 2NYXA 4CZZA 3FBNB 4D1QA 1FOXA 2A5YB 2ZMEA 3DKXA 2RKHA 3BWGA 1PJRA 2IS4A 3JR9A 5LLQA 1R36A 5E1ZB 4HF0A 4CZCA 3V7SA 3H3VK 2M34A 3ON2A 1GT0C 1KU7A 3MZYA 4CO8A 3H5AA 5BPDA 3T8RA 1LFUP 2XDNA 1XTAA 4RB1A 1ZLKA 3DWLE 5IP7J 3E5UA 3CJTB 4XORA 2ZOYA 4Q48A 1EV7A 1XB4A 1TNSA 1DQUA 5F6FA 3CJQB 4EJTA 4AC6A 3NS4A 4BU2A 1H9TA 3QYFA 1T39A 1S29A 2QZ8A 2LP0A 3E6BA 4YIIA 2L3DA 3GTMJ 2D5VA 2M9HA 5CLSA 3M1CA 2FMYA 3BTLA 1WJCA 3LFKA 3NAUA 1KONA 3OYBA 3E6DA 2LF7A 3RYPA 2EA2A 4PSWA 3CDHA 4D0PA 2YX4A 4NUBA 4XOPA 3T5XA 3S1NJ 2IS1A 2OCCH 1UHMA 4L18B 4F92B 5LGNA 1F4KA 4PJLA 3KP3A 3N4MA 3F8BA 3FIWA 3QU6A 3I58A 1Z67A 5F27A 5B66C 4CCNA 3TGNA 1VFCA 5LHHA 3P9IA 2DMUA 1TTYA 1WPKA 2M2EA 2VBXA 2VBZA 2R0QC 2K85A 1WJBA 5HS9A 5M5XJ 3QAHA 3VYTB 1QBJA 1B72B 5M5WJ 4S05A 2M7AA 3BP8A 1TW3A 2DI3A 3IC7A 1T2KA 2H1KA 3F6VA 1ZG1A 3FK7A 2DO7A 2MH9A 5L3BA 1MMSA 2FBIA 3E1SA 2JJ7A 3F8CA 2K40A 3AG2H 2PQ8A 3DPLC 4F93B 2DT7B 2HPMA 3T1BA 2F5FA 2BV6A 4P5OA 3GTLJ 1JXSA 3SXYA 3TO9A 2BVLA 2NP3A 5CKTA 2KISA 2JRMA 4M3FA 3QPHA 1G3WA 3FXQA 4KA4A 3TDZC 3LA7A 1JKRC 2L9RA 1HSTA 4QLCU 1KA8A 4LLGF 4BJ5C 2HPIA 2LG4A 1LDKB 3OSFA 4MIMA 3CCSI 3L2VA 2GA1A 3BJOA 2FUG2 3I4PA 1YJNI 3HKZN 3MMYB 4IRIA 3OYKA 2P7CB 3VW1A 2EFPA 4BY1J 1T38A 1IXRC 1ZQ3P 4JQFA 3H9GA 5CQGA 3RSNA 3VOKA 5KAFC 2DODA 2QWTA 3CJNA 3FX3A 1EH8A 1JUSA 2L4MA 2VJ5A 4G12A 4I0AA 3CMYA 2X1EA 4XKVA 4OINF 2C6YA 4R79A 3EUPA 3BG9A 1D8JA 3RZDJ 2VC1A 1MBHA 3QYBA 2HZTA 3PM1A 3F22A 2VKDA 1PUFA 2DAOA 2CS3A 3GFLA 2MABA 1B9MA 2M4KA 3GWZA 3VIBA 3KP2A 2FOWA 1R7JA 2FRHA 3MKLA 1H0MA 2O8XA 3R60A 4CDGA 4ANJA 3ABTA 5D8KB 4B47A 4EM2A 3BG5A 1R22A 1DDNA 1V5EA 3PIOF 3S17J 3S1QJ 1I6HJ 2W53A 3V7RA 4IHYA 2DMTA 2W4SA 2EQRA 4KYWA 3A01B 2HOTA 2R7ZJ 3GLLA 1QNTA 1XD7A 2EWNA 1QA6A 2BW3B 1A04A 2XB0X 4RGRA 3RQIA 2X6XA 2Q24A 4UVCA 3AKZA 2GOXB 4C3JJ 4E7KA 3ZMDA 1JKOC 2QBYA 5B3SH 1P4XA 2GOMA 4I99C 3S2DJ 3OS2A 3S93A 4UUSA 4WK8F 4EGZA 2I10A 5LRRA 1RUNA 2M30A 5JVTA 5A2QK 1ZR4A 3DPJA 1IUYA 3NPIA 1ZRCA 3W2WA 5IT9K 1U6GA 1JI8A 3HE0A 3IWFA 5FLVA 3CCJI 4AIKA 1FTTA 4XLFA 1V4RA 1X1CA 2W7NA 2WBMA 4II3A 3J81Z 3OS1A 3CCRI 2L02A 2VT3A 5J6XA 5D5VB 3ZQLA 4KITB 2M3AA 4KISA 3EUKL 1NK2P 4IJAA 4QPOA 1ZREA 2DFIA 1ON1A 1XX5A 2GZWA 4HX7A 3JAMZ 3ESWB 1IRGA 4ABZA 3HPGA 5K5RA 1KYWA 3JTGA 2RVCA 4C3IJ 4AF5A 4GCTA 4A6DA 2PFBA 4UVBA 2BXYA 2LOOA 2W25A 1LEAA 1U5TA 4HV5A 3DP7A 2A6EF 1FEXA 2E35A 1IV6A 3B6CA 1NHAA 2HVSA 5DM6F 1V5GA 1XG1A 2CMPA 3K70D 1ZRFA 4FASD 2KPMA 3S14J 4A3CJ 1W5SA 3IL2A 3CRJA 5HDNA 5JVGF 3DKWA 2DJIA 2XAQA 4Y15A 4YFKF 1AKHA 1K78A 3QOEA 2OTJI 3G2BA 2HVQA 1BC7C 2XAUA 2GWRA 1RETA 3CC4I 2G3BA 4UB8C 2XPUA 2ZXJA 3GX4X 3V7CA 4BGDA 2A07F 4CGRA 5K1YA 3L2UA 4HF1A 1CF7B 3GTJJ 4IOAF 3K69A 3R0AA 4E7JA 4M3DA 4MO7A 3HC7A 3CP2A 3RYRA 3H5NA 1HDPA 2Y31A 2FOKA 2P4WA 2W1OA 1L0OC 2ECCA 2UZKA 3NXCA 1BI0A 1X4PA 3O60A 1QO0D 1IDYA 5E1XA 1TQMA 1V54H 2IW5A 5DCMA 4FTHA 1K4SA 3SHFA 4YEJA 5J1RA 3FXKA 2RQQA 1TBXA 4Y4RA 3D5RC 2ZFWA 4LG3A 4XM3A 2R5ZB 1O4XA 1FYMA 1P9QC 3G1MA 1FOYA 3F0CA 3EQLF 2VONA 5F1RA 2A6TA 4NELA 1N77A 4A2UA 3RPQA 2VE9A 1YO5C 1I3QJ 3K4KA 1KQ0A 2XSJC 2BE5F 2EZHA 1JJ8C 2VLAA 5E3OA 1IW7F 4GXOA 1SD7A 2CWEA 1YW9A 2XV4S 3HRMA 3FBIB 3QP5A 4IXAA 5CVUA 5C4JJ 2FBKA 4B4CA 1IXCA 5LHGA 4NC8A 4PGHA 2BY3A 4HLYA 2GIVA 4IVNA 2EB7A 1ZTRA 1HXDA 5HS7A 2HQ5A 3KZZA 1BOAA 1YX5A 1TZLA 1TWGJ 4BQAA 2QOPA 1TT0A 4ESBA 3BJAA 2YSRA 3ML6A 2ZC2A 1VTNC 1AWCA 3VB2A 1X1PA 4LB5A 2X1CA 3L2RA 3GFIA 4P1WA 4IOCF 2A68F 1FWZA 2A5WA 2UXNA 3MQ0A 2CH0A 4IHXA 3TOBA 1WHUA 1RPWA 2NVQJ 3K4NA 2KIMA 2HOEA 2YVXA 3VVZA 1ZELA 4PFOA 2IU5A 3HSRA 3MZ8A 1Y1VJ 1WGXA 1MSFC 2G7HA 4CH7A 2DPUA 5D5WB 3OYEA 3DTIA 4PK4A 4XLAA 5B1AH 3VVYA 2NNNA 1IGNA 5DTDA 2JRTA 3RPUA 2JA8J 2WWYA 1ON2A 4KIGA 3FXUA 1IO2A 4LMYA 3HYIA 4U7BA 2WAEA 4PJMA 2XAHA 1AOYA 5AIQA 4LOCA 2VQGA 4XIDA 3ZMZA 1G3YA 2VASA 5J1UA 2KJCA 3VVXA 4A5NA 3MWMA 1WH7A 3GTKJ 3RQ4A 2E19A 3U2RA 1ZN2A 3VODA 4XQFA 2L2OA 4GFKA 4KWAA 3PIPF 3BPXA 5FKMA 4O6JA 5FHPA 5TRDA 1VQNI 4R1HA 2HDDA 4XN0A 4F52A 2IS2A 2RC4A 3EETA 2QQBA 2W57A 2WB1A 5ILUA 4NQWB 5HDKA 3J7AY 2BXZA 2EA4A 1E2XA 4OMYA 2VXDA 1ZH5A 1WRJA 1FOWA 1TQIA 2J5OA 5ED4A 1B9NA 5HSZA 2E1OA 1MMDA 1RZ4A 2TRTA 1FBQA 4U88A 4XRSG 3NARA 3J7ZI 3ZPLA 1MD0A 1ENHA 3LSHA 1S3JA 1JGGA 2NXNB 4BBSJ 1OCPA 3KFWX 5M3FJ 2ME6A 2EZIA 5HLGA 2MA3A 1Y6IA 2K27A 4FQGA 2CV2A 1U2WA 4EV0A 3MD2A 4NC7A 5L3GA 2KFDA 4OD5A 1KYZA 4CUGA 3GLXA 2RNJA 1DP7P 4P9FA 2JA2A 1R1TA 2LSOA 5DUIA 5E8IA 1VQ8I 1F5TA 3CMAI 2ZMEB 4X1EA 3FMQA 4L5EA 4HBLA 2R92J 3PUFA 2QSHX 5E3LA 2AO9A 3LSRA 2HYGD 3G56A 1HLVA 4BAYA 2IGOA 2MH2A 4L9JA 4EQQA 1Z6RA 1QHHD 1YE9A 2FBHA 5EFYA 4LLNA 4FE4A 3CC2I 3SDBA 2OI8A 2G7UA 4ZJZA 2XGCA 3COLA 2FU4A 3DEWA 4EJWA 3IKVA 1MMAA 4G7OF 2EH3A 5HVQC 4A3MJ 2PLYA 3PNYA 2BHZA 1MZBA 3OY9A 3CDLA 2R7DA 2KLOA 1RI7A 4XN3A 2LTPA 5IPAA 2CW8A 5F0FA 2RREA 3E5QA 5J4YA 2HNHA 3S3OA 2QSGX 1KU2A 2A3SA 3SEZA 3W6KB 2XB5A 1MGTA 1R49A 1R58A 3X2QH 3W2AA 2MD5A 2Z2SB 4AM3A 4XRFA 1JHHA 3PL8A 3RKWA 3E97A 2O7OA 5E18F 1TT5B 5J1YA 3PO2J 1L3LA 3TW6A 4ENKA 3KYDB 1X4OA 4BQNA 4A3IJ 5LEKA 1YLFA 2NVYJ 5HNFA 4A5MA 1BIBA 3KP4A 4OU0A 2ELJA 2PMZN 3JW4A 4I76A 4NNJA 5K7HA 3IUVA 4KICA 2R7VA 2XAFA 4HOBA 1D5VA 2HQNA 3QOPA 4F7ZA 1F36A 3OSGA 4A3DJ 3BDDA 4XSZF 4YZEA 1X2MA 2NOJB 4MHGA 2HYTA 2A61A 3CMEI 4L0YB 1XS9A 3I64A 4XNFA 2Y9ZA 1ZGWA 2HXIA 1I6XA 4M9ZA 2OV7A 3HOVJ 4HNUA 1Y56A 1S8NA 1YG2A 3G73A 5K58A 2DOEA 3RKQA 2XF5A 5B1BH 4B44A 5E3MA 2EFQA 4DW6A 1W0TA 3UNGC 1H89C 2OTLI 3HHHA 4Y3OA 1GHCA 2Z99A 1H9GA 4HX4A 2TCTA 2V9PA 2X6YA 4O3MA 4IQ4A 4UB6C 5L3EA 2IS6A 5DUKA 4AD9A 4N0BA 2AQFA 2H6BA 1W36C 3ZXSA 1OCOH 3M8EA 3IP4B 4ENNA 1V3FA 1ORKA 1MMGA 1UFMA 3CWRA 2XSDC 3N05A 2V7FA 5FFXA 4MFDA 1ZG3A 3KE2A 1YFHA 2OC6A 1Z7LA 1X3WB 2CW7A 1EF4A 1O7LA 1YRNA 1JHFA 1FC3A 2AQEA 1T08B 2BY1A 3LQQA 4CXFA 5CQEA 1SMTA 3WTVC 2J5PA 1O3TA 3LWJA 2BOLA 2IP2A 1XPXA 2E36A 2JUCA 3TP3A 2KJBA 3M7GA 2Y75A 1XCVA 1U9OA 2UUZA 3RIRA 4IEJA 1MBJA 3HIFA 3V4GA 1UI5A 4Y7NJ 2Z9OA 2LKXA 4GFLA 2B0LA 3J81K 5D4SA 2ESHA 1YHQI 4II2A 1SEUA 4Y13A 1QGPA 4LG0A 2KKOA 3MN2A 3IRRA 5AIPA 4MXMA 2V79A 1TL8A 3G1LA 1PUFB 2VL8A 2NVTJ 1Z91A 4PJJA 2VKHA 3WU1B 1HKQA 1S72I 2V6CA 2HQRA 1I5ZA 2XGEA 2CUFA 2QF7A 3BG7A 3P9KA 3IH2A 3VYRB 3JAMK 2JVGA 2NNYA 1O7FA 1P92A 5IP9J 4G7HF 3JSJA 5D18A 2L4AA 4A12A 4GFBA 2LBFA 2L5QA 4ZC3A 5F08A 4X0GA 3G4SI 1YS6A 3V8KA 2HYJA 4DOZA 3GZNB 2HS5A 5ILSA 4ZTJA 1N25A 3BR0A 5EDNA 4C3HJ 2FJI1 3HRSA 3JTHA 3COAC 2MG4A 3KZIC 1WJ5A 2QBYB 1SFEA 1GLNA 4IX7A 1BI3A 4UUSB 1IC8A 1I3AA 3GTQJ 3JSOA 4EJVA 1VQOI 5BMZA 3BR3A 3Q0VA 2YU3A 3ELKA 4ZDOA 3RDIA 2ME0A 1G6NA 2F5EA 2XHKA 3KP7A 5AONA 3ERED 5FKNA 2YX7A 3NNRA 4KNYA 1HCRA 2GLOA 3CC7I 3AQTA 3IAS2 2IRFG 5LFAA 3DEUA 3LL7A 4E7ZA 4EGYA 3REOA 3FXMA 4B09A 4HSRA 3ZP5A 5LHIA 2VKVA 4D7MA 2EJRA 4D5FA 3WTWC 1P4AA 4ZYAA 4LLLA 3W2VA 4Q47A 4BE1A 1U5TB 2E5NA 3L1PA 2O3FA 2XGDA 1XSDA 5AQCA 5K7FA 4DJAA 2ZO4A 4LD5A 2YVEA 1Z21A 2Q1ZB 2VT2A 4OIQF 2W85A 4KMUX 2ESNA 1EH7A 3CUOA 2G7LA 5D4RA 4BACA 2KZVA 3I9V2 3JSPA 2QKMB 3F9KA 3K7AJ 4ZZLA 5DM7F 1BW6A 1AKHB 5FFZA 1K78B 1K6YA 2ZOZA 4OD4A 4MQ9F 5GADJ 4HQMA 3CCUI 2O6GE 2ZJRF 4N9HA 3I53A 4JKZA 4JYKA 5KCMA 4LJZF 3ISPA 1F1ZA 1RR7A 4UY8I 3W3CA 2XIGA 2Z3YA 1LQ1A 4XKCA 3SWHA 2QM3A 1R1VA 1QVTA 3C1DA 1UELB 2MC4A 5J40A 2E71A 3CD6I 4L62A 1LFPA 4E6KG 5EJCA 4QSHA 1SFUA 5EG0A 3KYLA 5DCMB 1VQ6I 3K1PA 4BS9A 1VQLI 4JBAA 1G3SA 1FTZA 1N75A 2VODA 1OPCA 1S7AA 3QYEA 1BJAA 2E2HJ 1NH3A 3RZOJ 1FP2A 2VN2A 1FX7A 2O03A 1FSEA 5L3DA 2ZCWA 3CP8A 4AVZA 3WTSC 1B6AA 4I02A 1IRXA 3DPTA 1QZEA 2M45A 3B73A 4PJ0C 5TISC 4JX5A 2K02A 2BGCA 3HTUA 2F5DA 3S2WA 1SGMA 1ITYA 1B59A 1UCRA 3BT9A 4RGUA 1UMQA 2DA6A 2F4MB 5IY5H 2H6CA 4ENMA 3GZ6A 1R6RA 1Z3XA 3HOUJ 3HRTA 4BKXA 5D6EA 2O8KA 3QRFF 2GM4A 3OOUA 4BHCA 3HM5A 5K5QA 1VQMI 1ZYRF 3EYIA 1G2HA 1HKSA 2F4IA 3UR3C 2FJ1A 1GVJA 5EYRA 2WC2A 1B8IA 2YVHA 1P7IA 2X1DA 3OIQA 5FGLA 4PSXA 2PI0A 1D0XA 3E6CC 1FNNA 2CFOA 3TDUC 2MLGA 1SVMA 2EZKA 2FE3A 4G6TB 3C3WA 1Y1WJ 4PFPA 2CG4A 2XUBA 4LFUA 4H0EA 2H8RA 2X51A 3L2CA 3CLQA 5CXGA 4IRGA 2ID3A 4LIVA 4L5JA 5F0CA 5CVJA 5J47A 2QTQA 1HQCA 1LVAA 2K9LA 1JKQC 2DDAA 1VZ0A 3H0GJ 3ERMA 4OAYA 4CHUA 4E7IA 2PZ9A 5M3MJ 5GTHC 4DIQA 2FNPA 3HZJA 4KT5C 2P5KA 2COMA 1Y8QB 2MYSA 1ZK8A 4FX4A 2VJ4A 5DD4A 4MGRA 4MTEA 4FETA 1D1BA 1MW7A 3K4CA 1ZRDA 4O5VA 3IWZA 3LOCA 5FRMA 1Z9CA 4HDVA 2PG4A 5D8LB 3LAPA 4UUTA 1FZPB 5C3EJ 1T56A 4E7HA 1I27A 5J3LA 2I5UA 2ZXIA 2JVHA 1KQ8A 1IRFA 4HEA2 3RI4A 1VQPI 2QLZA 2F4OB 1XDUA 2YPRA 3ZRGA 2YS9A 3PQJA 3T0YA 3KYCB 4R8HA 1BBYA 1XMAA 2DK8A 1R5ID 3O3KA 3BRUA 3QODA 4MK6A 2L7FP 2VQCA 1P4WA 4OMZA 4BXUA 1QPIA 3D5SC 1ZR2A 1T95A 4YELA 1SVLA 2VIXA 2WY8Q 3HTHA 2NVXJ 2DW4A 4J00A 1JTYA 3VOXA 2WAQA 2OCEA 1EA3A 3RD3A 4D9JA 4BYYA 2VPLA 1J5YA 5IYCJ 4IKFA 3F8FA 4U0YA 2STTA 3VWBA 3BG3A 2LKSA 3MKYB 4Z2YA 3D1NI 2UXOA 4OOIA 1R4MB 3SZPA 2EINH 4P55A 2OF7A 3SDGA 3BQZA 2EPFA 2NAZA 2GXAA 3L09A 1VQ9I 2W24A 2HDWA 3ZQ7A 3E6MA 3PASA 1R23A 3C07A 1WI3A 4CCJA 4ZYEA 2VE8A 3K4MA 4V2GA 4RAFA 4CYDA 3ROUA 2DA5A 2MLKA 1Z77A 4X6AJ 3ZMSA 2HFHA 1IRZA 1X19A 5HBUA 3ZN1A 2V1NA 1FYKA 3ECHA 3U21A 1WJEA 3ZOBA 2B63J 2PBIA 1X3ZB 4UUVA 1YJWI 4YFNF 1OJLA 1D1CA 1JGSA 3BR6A 3HTAA 3BTCA 3OYNA 4RB2C 5BOXA 4W97A 5F64A 3BCGA 3ASOH 3K4BA 1MH3A 2UV1A 3AQSA 3VYUB 2DCEA 3I71A 2JPBA 2MW8A 4BXFA 3KPHA 4G6QA 5D19A 4RS8A 3L2QA 4JK1X 2D6YA 3C2BA 2HOSA 1W1WE 4UV9A 2LY1A 2ZSIB 3M4OJ 4XICA 2P5LC 1D3YA 1SMYF 1FSHA 3DBHB 3BJBA 3M9AA 2B3WA 2OUMA 4ZYDA 5FKOA 2OJED 2L9VA 3WTZA 2IJLA 4L9TA 3LMMA 2LREA 4JOMA 2A05A 1ERDA 4WXHA 2BHYA 2E1CA 4I01A 3ONQA 1SFKA 1VF9A 3V8JA 3CCEI 1TW2A 2JT1A 2HKUA 3M3YJ 3GFJA 2PEXA 2CSOA 2QQ9A 3BR2A 3LA2A 5JLWA 3GZIA 2B9SA 3GTOJ 2KL4A 2OPTA 4BE2A 3VUQA 1FY7A 3DTEA 2VB6A 4XLCA 2E1MC 4I7HA 3NQOA 3I4NJ 3CTAA 3SJMA 1I50J 1HW1A 3RPUD 4L9NA 3GF2A 4ASNA 4UVAA 3G71I 2P6SA 2HYFA 4D5CA 4BQOA 2V1DA 1ULYA 3RTRA 2O7TA 3KIOA 5CVRA 2W82A 1NG7A 2L01A 4WF2A 3TOAA 5DYMA 2XGXA 3S16J 2H09A 2XKPA 5EGOA 4BXXJ 4M74A 2DT6A 2LK2A 3BLYA 3P9CA 1AA7A 2QSFX 2GXBA 2FF4A 3BR1A 2FMLA 1OCCH 2MGQA 2E7XA 2LYCA 3ZMTA 3HDDA 3VPRA 1MBFA 2VJIA 2LD5A 2PX9A 3KCCA 1FIPA 4OWRB 2ZFUA 1PP7U 3GVAA 2CV0A 1A6IA 2WAFA 3GYHX 1EH6A 2Z5UA 4BHBA 1TWAJ 1G3TA 4M72A 3ZQFA 1WJFA 3BZKA 3ZMUA 3H9JA 5KHDA 1J59A 4DNCA 4UXNA 3C2HA 1R9TJ 4HYEA 2QGUA 4MNUA 1BR2A 2RQPA 1SD6A 3BCBA 1JJ6C 2BY2A 2HR3A 3OR2C 3K9TA 4LG0B 4A3KJ 2WV0A 4JX6A 1WI9A 3OYMA 1YITI 1VQKI 1ETYA 4G9YA 3GEZA 3JRAA 1WZ2A 3PFYA 4QTRA 3V6GA 3CJDA 3I56I 2YR2A 4FISA 4W1UA 5IOZA 3LA3A 2VOPA 3NI7A 3R6SA 2IAIA 4HKUA 3ABLH 4A0ZA 3OIPA 1A31A 4IHTA 2XC7A 4YRVA 4KMFA 5CYVA 4F55A 2ZB9A 2F07A 3U1KA 2LBFB 1YIOA 1RUOA 1SAUA 2PMUA 1I1GA 5IYBJ 4LIUA 1MJAA 2JA7J 4HQEA 2HKXA 3TO6A 4E7SA 1BA5A 4AYBN 2Q2EA 1BL0A 3TKYA 1WKMA 3IAM2 1ODDA 3K2ZA 2M4GA 2OBPA 2JA6J 3JREA 2XVCA 3WGHA 2ZSHB 1MJBA 3HOYJ 4ZYGA 3T8TA 1U9NA 2KRHA 1ETXA 4MLOA 2K5CA 4V2FA 2AS5F 3VP5A 1OYWA 3CESA 1IUFA 5H20A 4G8XA 4I6ZA 2LR8A 4A69C 2DXIA 3KKCA 1T98A 2ETHA 2R5YA 2DT5A 1UG0A 1D1AA 3HBLA 1XGMA 3E0JB 1D0YA 3NEUA 3R4KA 2PJRA 5CPRB 3HHGA 1IDZA 1M1EB 1YW8A 2K9QA 4WX9A 4WWCA 2GUHA 3Q3SA 1LPQA 3DPUA 1G8XA 3G3ZA 2O5RA 1MDMA 5EEHA 5KNLA 4BDYA 1T8IA 3L9FA 1MNEA 3HG9A 4ZDLA 3FKJA 3KP5A 1NTCA 1XMKA 1F43A 3F1BA 3G6EI 4I09A 1UZCA 5D6FA 3J80Z 2M0MA 2QQAA 2BBYA 2PFVA 2BW3A 2VUMJ 3L7WA 4S0HB 5L3FA 4Q4ZF 4ACIA 4WCGA 3OYDA 1GV5A 1XGSA 5H2FC 2EIJH 2W48A 2JA5J 1EKEA 4BH9A 1PYVA 1QVUA 1MNDA 3WTXC 3WE3A 1UI6A 2ISZA 2L7MP 3GBGA 1Y0NA 4KJZA 2ZJ2A 2Y69H 1VI0A 4MQVA 2IGKA 3I55I 1E3OC 2X48A 3DCFA 1IV8A 4M73A 3LSPA 5E1WA 4BY7J 3TW7A 3PO3J 2E60A 2V4JC 4QWQA 5IP6A 2E7WA 3OYAA 4Q5SF 5TJJA 1E17A 3FXJA 3GEUA 5EG0B 4XLNF 1SANA 2EFNA 4B48A 3I54A 2DA2A 2DDBA 1BR4A 1BN5A 1A35A 4A6EA 3FHZA 1O3RA 3BZ6A 1C0WA 1OCRH 5KAIC 1EJ9A 2CFXA 2VQLA 2AXTC 2DBBA 2XAJA 2M1BA 1OCTC 1IN8A 4YIRX 3IHUA 4XKWA 3CCMI 2VJJA 1LKXA 2DFFA 4IO9F 4A3FJ 2P0WA 1OISA 1BI2A 3HB9A 3F8MA 3FMRA 2CQXA 4XR6A 4P96A 2CJJA 4XMYA 3VW0A 5FD5A 1GDTA 1HBXG 3SZTA 4OIOF 2P5VA 1VQ5I 1E3PA 2EFOA 2KZGA 1XSVA 2E2IJ 4RMNA 3H3UA 3H92A 2CUZA 1BIAA 2PMHA 2VPRA 1B8IB 3MAJA 4IRHA 1IXSB 3HUGA 3OOPA 3L2WA 3KEQA 4ZH4F 5E3NA 2Y30A 3HOXJ 1LNWA 3GFMA 4A0XA 1QU3A 3CO6C 1BR1A 2HDCA 3TMOA 4MEXF 5JLXA 1Z7UA 2KIQA 1G4DA 2DU9A 2L7ZA 2JSPA 4M9SA 3HKZA 2EIKH 3KETA 4LITA 1ACIA 3I0TA 2XASA 3I59A 2DTZA 4C2MJ 1W0UA 2KDZA 5F0HA 2EV5A 4L5IA 4KIBA 1GUUA 3LSTA 1YS7A 3A03A 3CO7C 1JKPC 1HOMA 1RKWA 2V57A 1D8KA 1UAAA 1MKMA 5HOOA 3EUHC 3CUQA 3LSGA 3OMYA 3S1RJ 5FKKA 1STZA 3J7YJ 1LDDA 4CCLA 3O6BB 1D0ZA 1QQIA 1Q1VA 2M8EA 2MC3A 2QA4I 1SFOJ 1WJAA 4ME9A 4XLHA 1ETKA 4CYCA 2Q8KA 1J75A 2OU2A 1BOBA 1BW5A 2CUJA 4G7ZF 4A3BJ 1IG7A 3DQVC 4HAMA 1TNTA 4XOTA 2UXUA 2CQ7A 3VFZA 5HS8A 3ZQGA 3H36A 1CQTA 4UHTA 4KN7X 1ETOA 2B7EA 2XDVA 1BJZA 3AG3H 1QHGA 1LB2A 5TGTA 1LFBA 2RDPA 2M7BA 1DPRA 3MEXA 3WU0A 3ZQQA 1O3SA 1MNMC 3A2KA 3F8NA 2DK5A 2R93J 1KZHA 5E20A 4XRMA 3K70C 2LRDA 1IJWC 2YU9J 2X0LA 3CZ6A 3RKYA 3ANGA 2E2JJ 3LAJA 2W84A 4B8XA 5EEGA 1Y8RB 1LDJA 2I8DA 4HRIA 2O61A 2P81A 3OYCA 3TL4X 4U0VA 1OLTA 4EM1A 1FOKA 1S6LA 2OZ6A 3GTGJ 4KT6A 3CDIA 5ILVA 1YTYA 2LMDA 1FYLA 4JL3A 4DYQA 5FRNA 1VNDA 4CCMA 3BNIA 2ZNYA 3HIMA 1T6SA 3FMSA 2A6HF 1KU3A 2DMPA 1B4AA 3F21A 5BPIA 2DOAA 2MSYA 2K86A 3PNVA 2WADA 3MCZA 3AG1H 3K4LA 2ELHA 1U8RA 2L9SA 4BJTA 5GTIC 3WODF 1T0FA 4RLFA 2WGBA 1W5TA 2RAEA 3VSKA 2CUEA 2DA7A 3K0LA 4D7NA 3SFIA 2P6TA 3LSJA 3LSIA 4ZDPA 2Y0SN 4XRSA 3IV5A 2EFWA 2BVMA 5JI6A 3N97A 2OQGA 4BL0B 2AHQA 2M87A 3C18A 5BS6A 1WFXA 4HX8A 2WB1N 4EJUA 2R4GA 2LDUA 1Z3YA 3QP6A 3FZVA 3CCLI 2GFNA 1HSJA 4AIHA 4PJNA 3OL4A 1SD5A 2ACJA 4FCYA 1F9NA 2R7XA 4A3LJ 4C2TA 3AG4H 4M6XA 1LEBA 3HTIA 1BC8C 3HSEA 2WTEA 1QPMA 2LY2A 4NBQA 1RNLA 2G7SA 4NB5A 3BCAA 2E1NA 4HLXA 1HC8A 3DEEA 2ISYA 1ZHFA 3H1CA 4OIRF 4JNNA 2MFZA 2QENA 2UWMA 2RN7A 2XRLA 3K1NA 1GVDA 5HLHA 4PZJA 1FP1D 5J4VA 2XAGA 3I3LA 3R0JA 4IL6C 4DYRA 5K5OA 2XKOA 4HZFA 2OD5A 2L0KA 3IRQA 2NRAC 1HDDC 2ZCNA 2PBXA 5D1RA 1OQYA 5IYDJ 2EK5A 4DBRA 1Z0XA 3F6OA 3H3ZA 2COBA 3ASNH 2ZBKA 1J09A 1WH5A 2ZKZA 3ZN0A 2IA1A 5FGMA 3ECOA 3OWTA 2R7OA 2R7UA 3ZGKA 4LK0F 2D45A 2K9MA 2R3SA 4GYIA 5EGOB 3FM3A 1PUEE 4M6VA 3WGGA 2DYSH 4U9NA 2DQLA 3C7JA 3U9GA 1K4TA 2IT0A 1GV2A 3CMMA 3OIOA 2K9NA 2AXLA 4RA2A 2FD5A 1APLC 3S8PA 2ZCMA 3KLOA 1W7PA 4CA0A 3ZQHA 3WTYC 3JRGA 1DU0A 3CF2A 5JHUA 1SAXA 1NG6A 3VSLA 2CV1A 2XF6A 3TO7A 1XSXA 2EV0A 3M8FA 1ETQA 5FLXZ 3ZQIA 3F23A 5FLMJ 1RC9A 4V19K 2HU9A 3VW2A 4FT8A 5F1JA 1S7EA 1V5FA 3BROA 4CGZA 1DGRM 1OR7C 3Q5FA 3B81A 5FJ8J 4GCLA 4GO1A 5FO5A 3G7RA 2IEKA 4DVYP 4EEFG 3HGYA 5E8GA 4AIJA 2UXIA 2FBQA 4DYCA 4HW0A 2H1LA 2WV1A 3FHNA 5FB2A 2IBDA 3K4JA 2F5VA 4AU7A 2K7LA 2LFBA 1USSA 2P7VB 4Y52J 2LF8A 4BHPA 1V55H 3LNQA 4KN4X 1WQ2A 1R00A 2QKLB 3F3XA 3P7NA 4YFXF 1R4NB 2VXZA 4NDLA 1MMNA 2HKOA 3CLOA 4MEYF 2B1EA 4XLEA 3KKDA 2V9KA 4C2MA 1TWHJ 1J9IA 2VBWA 4FX0A 4HPQA 4BBRJ 1WVRA 2QVOA 2R7QA 3LSMA 4AYBA 2CU7A 2H8WA 3DFGA 2HI3A 1NK3P 3W6VA 5LGUA 4CCKA 1J2XA 2RGVA 5EF6A 3OV8A 3OS0A 3HRUA 3JRFA 2Q2EB 3HOTA 3S2HJ 3WU2C 3J80K 1HW2A 3GXOA 3M07A 2EBIA 4TV7A 1FIAA 3K8PC 5DEQA 4K2EA 3PPBA 3NWSA 4IRVA 4BUPA 2CGPA 2VBYA 5FD6A 4FHTA 2IA0A 5JFRA 3Q0WA 4RAYA 2XRNA 5LGTA 4I2OA 3PSFA 1R5HA 1K61A 4ON0A 3I4MJ 1LUJB 4HNTA 2UXXA 5FROA 4XL9A 2NP5A 2BZTA 2A2FX 2V6EA 3S5RA 2V1UA 2LY9A 1U78A 1DGWY 4QIWN 1QRYA 3DXJF 1OMIA 3PSIA 4YIFA 3FKIJ 2R5YB 1LE8A 1H8AC 2L7KA 4DQ2A 3ABKH 3CUQC 4WXDA 4BE0A 2PJRB 4AUXA 4BQQA 5DDGA 4HNVA 1OCZH 5B5EC 4IPAA 2GENA 4DZPA 1YJ9I 1YW7A 2DPDA 5FKLA 3BTIA 1E3HA 1Y39A 5HDGA 3QBMA 4J01A 3DLAA 1MDMB 4I0BA 1ZGJA 3PNTA 1P6RA 2DN0A 1DP3A 3O8HA 1U3EM 3BR5A 1W36D 3ULQB 5DAJA 4BEHA 3KZ9A 2F5CA 1ETVA 3MKZA 4WXCA 4B3XA 3VOEA 4Z6YA 3FM5A 2M5WA 3F72A 1ZGAA 2K9SA 2RV8A 4GYGA 2DJNA 4QPQA 1RR8C 4IHVA 1MH4A 3TQNA 5C4YA 2HEOA 1T33A 3OL3A 4RGXA 4XLPF 4U9LA 4RAZA 3MNLA 1YYVA 2NS7A 1TWFJ 2HTSA 3SYTA 3FWEA 3BC8A 2NOGA 3DBRB 2Y0MA 4AVPA 4IZZA 4N4OB 1O3QA 5CVVA 3FXOA 1JTXA 2Z33A 1FLIA 3A0HC 5HAWA 4P9UA 3BG6A 3C2GA 1YQAA 2WA0A 5LD2C 3MZHA 3NRVA 2ZY9A 3CJRB 4RLQA 3ZQCA 3QPTA 1FBSA 5DS9A 2ELKA 2FXAA 3CCQI 4KIFA 2LNBA 4HG2A 3ON4A 4N4NB 1TQPA 3V42A 1WJDA 2EZLA 4OIPF 2ZNZA 4B43A 3FK6A 2VOOA 2ADUA 1MBGA 5IT3A 2EIMH 2STWA 1E0EA 1Z6TA 3OYHA 1A6QA 5JHFA 3WG7H 4A3JJ 4HV6A 4JP0A 1TWCJ 3TP0A 3TEDA 1T0FC 1K6OA 3GMEA 1QZZA 4E7LA 1KQ9A 4RB3C 3VYSB 2PMZA 3QU3A 3EGQA 1SVOA 3FISA 2OA4A 1MBEA 3AFHA 3D0SA 2K3PA 1XCBA 2OAZA 1YX3A 5ICGA 4RM3A 3KX2A 4ENJA 2IGNA 2BEOA 5KK1A 3D5LA 1A36A 4GCVA 5L3CA 4ESFA 5H6QA 1R71A 1PDNC 3UKGA 2LKPA 4FE7A 2IXSA 2GA2A 3GW2A 3JRIA 1QZYA 2Y48A 4L0ZB 3J7AO 3AAFA 2F2EA 4F3QA 5DCFA 1JT0A 3FRQA 3SEQA 3MFKA 1ZARA 1SD4A 3EUHA 3SQNA 2M8GX 3GCMA 2DG8A 3QWLA 2JUGA 3BZCA 4M3GA 1SFXA 4BJ6C 2Z16A 3HUGB 3KLNA 2JPCA 3JRDA 3T6NA 5JR3A 2DMQA 1X58A 3Q9VA 3QQAA 4PXIA 1RRJA 1IN4A 2ZMEC 2DTRA 4ITVA 3BHQA 3CQZJ 1X2NA 2IA2A 5ERIA 1JE8A 5CXIA 2Y9YA 1XGOA 1XDSA 1WSUA 4IHWA 2D2WA 2KMUA 3I59B 3K2AA 4HSTA 3GUDA 2X6OA 1YRNB 4KFCA 3M8JA 2FX0A 1KGSA 3MVPA 2X85A 2L54A 4PUSA 3VDXA 1PVEA 1ZG5A 3QPSA 4L9VA 4CSWA 1XN7A 3JRHA 3AL0C 2QWWA 1P2FA 2BY0A 3GTPJ 4MTDA 4PGGA 3ZR8X 3CUQB 5GAEJ 3IH3A 2G9WA 2F48A 3BJ6A 3ZCOA 4RB0A 4A93J 3E7QA 3H9QA 2Y2ZA 4LB6B 3RCOA 2DYRH 2G0EA 4PDKA 1B72A 2MBFA 4CYCB 1YIJI 1JUMA 1MJ9A 2PJPA 2ICWG 1FMVA 4J19A 1AHDP 1IF1A 4EJOA 3V78A 4E70A 2IPQX 1HW5A 3A02A 3L00A 2ZXHA 4YG2F 5IOYA 2JZYA 5J8CA 2KIUA 3B6AA 4RBOA 5D5XB 4C9YA 3Q0UA 5EZHA 2QIBA 3DKYA 5EEAA 3KEYA 4EATA 1ZAOA 3LSKA 3JRBA 2OERA 3ANPA 3HGGA 2FSWA 2UXHA 5K7ZA 3S1MJ 3HEFA 3JCUC 2JN6A 4DBQA 5GPCA 2DFHA 5BNGA 2K4BA 4DGWB 3CCYA 3EUAA 2DA1A 1S9HA 4LGWA 5HNHA 4A3EJ 4RM2A 3P5JA 9ANTA 2OQRA 1VQ4I 2WY7Q 2GBYA 3K10A 3HJEA 1DU6A 2F6CA 2RHAA 2FQ3A 3H35A 3W6JB 2LVSA 3M1EA 2Y0SA 1S7OA 3GZ5A 2JMWA 3EPZA 4F91B 4G94A 4WIBA 2MD0A 5J8FA 2BYVE 2JQ7A 3PJRA 3HPHA 2CQQA 2FEZA 3KEOA 1UJ8A 3I5UA 4ICHA 4NHJA 2KP6A 2NX4A 4ZTFA 3OYIA 3WG9A 1FBUA
chains in the Genus database with same CATH topology
4CYCA 1IV6A 3B6CA 1BW5A 1U8BA 1ITYA 1XG1A 3G1OA 3BT9A 1SGMA 1UMQA 2DA6A 1IG7A 4A3BJ 3S14J 2UXUA 4A3CJ 3HOUJ 2M0CA 3CRJA 3ZQGA 4BKXA 1CQTA 2O8KA 1UHSA 2GM4A 3A01A 3OOUA 1ETOA 3HM5A 1BJZA 2JWTA 1G2HA 1AKHA 1LFBA 2FJ1A 5EYRA 1MNMC 3IH4A 1B8IA 2YVHA 1P7IA 2G3BA 2R93J 1RETA 5FGLA 2DG7A 4XRMA 5HODA 2WAQN 2XPUA 1MBKA 3WHBA 1IJWC 2YU9J 4CGRA 3ANGA 2E2JJ 3GTJJ 2EZKA 4M3DA 3HOZJ 4MO7A 1Y1WJ 3QKXA 3LHQA 2H8RA 2P81A 1HDPA 5FMPA 2Y31A 3RH2A 5CXGA 2ID3A 3GTGJ 5F0CA 2ECCA 3NXCA 2QTQA 2KT0A 4JL3A 4DYQA 1JKQC 1VNDA 3E7LA 3BNIA 3H0GJ 2PZ9A 3HIMA 3O60A 5M3MJ 1IDYA 2DMPA 4M3BA 2X9DA 4FTHA 1D5YA 5J1RA 2MSYA 1RESA 2R5ZB 1ZK8A 1O4XA 3KNWA 5M5YJ 1ZKGA 3G1MA 4XK4A 3F0CA 4NELA 2WGBA 1OFCX 3LOCA 2RAEA 2CUEA 2DA7A 1I3QJ 4D7NA 2NS8A 4UUTA 3LSJA 3SFIA 4XRSA 2XPWA 2Y0SN 2EZHA 2YUSA 5C3EJ 3IV5A 1JJ8C 1T56A 5E3OA 5J3LA 5C4JJ 4B4CA 4UDSA 2AHQA 2YS9A 4MFEA 1ZTRA 2WB1N 4A3GJ 3BRUA 2HQ5A 1TWGJ 2GFNA 2QOPA 4MK6A 2L7FP 4GCKA 5C44J 1QPIA 1ZR2A 1AU7A 4FCYA 2UXPA 1RKTA 2REKA 1P7JA 2NVXJ 3HTHA 4A3LJ 1JTYA 3VOXA 3HTIA 4IHXA 4RDUA 1RPWA 3RD3A 4M3EA 3BTJA 3JRCA 2NVQJ 3P9TA 4JX4A 5GPAA 5IYCJ 3VVZA 2G7SA 2IU5A 3BG3A 5C4XJ 1Y1VJ 3D1NI 1WGXA 1MSFC 4JNNA 2OF7A 3SDGA 3VVYA 3BQZA 2XRLA 1GVDA 1IGNA 4AC0A 5DTDA 1MSEC 2JA8J 4DYRA 3LJLA 5H9TA 1FJLA 3PASA 3C07A 1WI3A 3NRGA 2L0KA 2R5ZA 1K83J 2DA4A 4LOCA 1HDDC 2ZCNA 4V2GA 2PBXA 5D1RA 4XIDA 5IYDJ 2DA5A 1Z0XA 5J1UA 1Z77A 4X6AJ 2COBA 2O9LA 3VVXA 1WH7A 1IRZA 3HTJA 5HBUA 3GTKJ 2E19A 1WH5A 1XC5A 3ZOBA 2B63J 2DA3A 1OJLA 4KWAA 4GFKA 5FKMA 3BR6A 3HTAA 3BTCA 5FHPA 4W97A 5EGOB 3BCGA 2HDDA 4M6VA 1MH3A 3AQSA 1JT6A 1WCMJ 2WUIA 1GV2A 3OIOA 2K9NA 2MW8A 1APLC 2FD5A 2QCOA 2ZCMA 3ZQHA 5D19A 3JRGA 1DU0A 3QPLA 2D6YA 4B1RA 3HOWJ 3C2BA 5HSZA 3WHCA 2E1OA 2HOSA 2TRTA 4XRSG 2LLKA 1ETQA 3NARA 3M4OJ 3ZQIA 4XICA 1ENHA 5FLMJ 1JGGA 4BBSJ 5EZGA 1OCPA 3VW2A 5F1JA 5M3FJ 3BJBA 2ME6A 2EZIA 1S7EA 1LE8B 5FKOA 3B81A 2DMNA 5FJ8J 4GCLA 3G7RA 2IEKA 4EEFG 3HGYA 2UXIA 2FBQA 4DYCA 2WV1A 1VF9A 2G7GA 2IBDA 1ETWA 2ECBA 4X1EA 2JK3A 2HKUA 2LFBA 4L5EA 3M3YJ 1A5JA 4Y52J 2R92J 3GZIA 5JLWA 3BR2A 5E3LA 3LNQA 2HXOA 2AO9A 3LSRA 3GTOJ 3G56A 2OPTA 1HLVA 3VUQA 2FQ4A 4NDLA 1JUPA 2N8GA 3KKDA 3I4NJ 5EFYA 3SJMA 1I50J 1TWHJ 3S15J 4FE4A 2HOAA 4BBRJ 2OI8A 1HF0A 2XGCA 3COLA 1TC3C 2VKEA 3DEWA 4D5CA 1H88C 2O7TA 1UG2A 2CU7A 3BQYA 2HI3A 2EH3A 4B3AA 2VI6A 1NK3P 3W6VA 4A3MJ 4NN1A 2UXOA 5EF6A 3CDLA 3S16J 3JRFA 3S2HJ 5GP9A 5EGOA 4BXXJ 2LTPA 5IPAA 2EBIA 5F0FA 1FIAA 2LK2A 3PPBA 2XPVA 3BR1A 2XB5A 2MGQA 3Q0WA 2ZCXA 3HDDA 3VPRA 1MBFA 2LD5A 1POGA 4DZJA 1K61A 3I4MJ 1FIPA 2NP5A 5F04A 2CRGA 3S5RA 1A6IA 2RASA 2LY9A 1U78A 2O7OA 4QIWN 1QRYA 1TWAJ 3ZQFA 5CW8A 5J1YA 3PO2J 3FKIJ 3TW6A 2R5YB 1LE8A 2ID6A 1H8AC 1R9TJ 3O8GA 4A3IJ 4AUXA 2NVYJ 1JJ6C 4HNVA 2QKOA 2GENA 4DZPA 2PMZN 4I76A 4A3KJ 5K7HA 3IUVA 5FKLA 3BTIA 3QBMA 4JX6A 1ETYA 1F36A 3OSGA 3JRAA 4A3DJ 3JR9A 4QTRA 4YZEA 2DN0A 1X2MA 3O8HA 3V6GA 3BR5A 2HYTA 3CJDA 5DAJA 3H3VK 3KZ9A 2M34A 1ETVA 1XS9A 3ON2A 4FISA 4W1UA 2Y9ZA 2HXIA 1ZGWA 5IOZA 1GT0C 3NI7A 3HOVJ 4HKUA 2IAIA 2K9SA 1LFUP 2XDNA 5K58A 2DJNA 5IP7J 4IHVA 1MH4A 2ZB9A 3RKQA 2F07A 2ZOYA 5C4YA 5E3MA 1W0TA 4DW6A 1T33A 1H89C 5IYBJ 3MNLA 2TCTA 2NS7A 4AC6A 1TWFJ 2JA7J 1BA5A 2NOGA 4AYBN 1BL0A 2LP0A 1ORKA 3JREA 2JA6J 3CWRA 3GTMJ 1JTXA 2D5VA 2XSDC 2M9HA 3HOYJ 5HAWA 4MFDA 1U9NA 3BTLA 3NAUA 1ETXA 4MLOA 1EF4A 3ZQCA 5DS9A 1YRNA 4V2FA 3VP5A 2ELKA 3ON4A 3S1NJ 1IUFA 4I6ZA 2LR8A 2EZLA 3LWJA 3FK6A 1MBGA 4A69C 3TP3A 3KKCA 1U9OA 2R5YA 4IEJA 4A3JJ 4JP0A 1TWCJ 1MBJA 3TP0A 3FIWA 3HBLA 5F27A 3TEDA 1UI5A 4Y7NJ 2LKXA 1VFCA 4GFLA 3EGQA 2DMUA 1WPKA 2M2EA 3FISA 1IDZA 2K9QA 3MN2A 2R0QC 4MXMA 1MBEA 2GUHA 3G1LA 3Q3SA 1PUFB 5M5XJ 2NVTJ 1B72B 5M5WJ 2XGEA 2CUFA 2QF7A 2H1KA 3IH2A 3FK7A 1NTCA 1F43A 3F1BA 5IP9J 4FE7A 3UKGA 2JJ7A 3JSJA 2K40A 5D18A 2VUMJ 4S0HB 3JRIA 4GFBA 4ACIA 1GV5A 5F08A 3GTLJ 2W48A 2HYJA 1JT0A 2JA5J 3FRQA 2NP3A 3BR0A 2M8GX 5EDNA 1QVUA 4C3HJ 4M3GA 2DG8A 1UI6A 4M3FA 3JRDA 2L7MP 3T6NA 2MG4A 1JKRC 3GBGA 2DMQA 1X58A 3QQAA 2L9RA 4PXIA 1VI0A 4UUSB 1E3OC 1IC8A 3GTQJ 2X48A 3DCFA 3BR3A 3Q0VA 4MIMA 3OSFA 3BHQA 3CQZJ 1X2NA 2ME0A 3LSPA 3TW7A 4BY7J 3PO3J 5CXIA 2Y9YA 4IHWA 3HKZN 5FKNA 3VW1A 3K2AA 3NNRA 5IP6A 4BY1J 2X6OA 1YRNB 1HCRA 2GLOA 2FX0A 3MVPA 1ZQ3P 3VOKA 3GEUA 5EG0B 3AQTA 2QWTA 1SANA 3QPSA 2DA2A 3JRHA 1JUSA 4G12A 3GTPJ 3CMYA 3EUPA 3BG9A 2VKVA 3IH3A 4D7MA 3RZDJ 1MBHA 1OCTC 4A93J 3PM1A 3E7QA 4D5FA 1PUFA 2Y2ZA 2G0EA 1B72A 3VIBA 3L1PA 4CYCB 2XGDA 4A3FJ 3MKLA 1JUMA 5AQCA 5K7FA 2YVEA 4J19A 3HB9A 1AHDP 3BG5A 3V78A 2CQXA 3S17J 3S1QJ 1I6HJ 2G7LA 2W53A 3A02A 2CJJA 4IHYA 2DMTA 5IOYA 2EQRA 3K7AJ 3VW0A 3A01B 1GDTA 3B6AA 4RBOA 2HOTA 2R7ZJ 1BW6A 3Q0UA 5EZHA 2QIBA 1AKHB 5EEAA 2E2IJ 3RQIA 2XB0X 2ZOZA 1B8IB 2VPRA 2Q24A 3JRBA 2OERA 3ANPA 3HGGA 4C3JJ 1JKOC 2UXHA 5K7ZA 5E3NA 4JYKA 2Y30A 3HOXJ 4JKZA 3S2DJ 3S1MJ 4UUSA 1RR7A 2I10A 3HEFA 2JN6A 5GPCA 3DPJA 3NPIA 1ZR4A 5BNGA 3HE0A 5JLXA 3CCYA 5FLVA 2L7ZA 1FTTA 1QVTA 2DA1A 4A3EJ 3ZQLA 9ANTA 4L62A 2DTZA 4C2MJ 2GBYA 1W0UA 2KDZA 4QSHA 1NK2P 5F0HA 5EG0A 1DU6A 1GUUA 2RHAA 3A03A 1JKPC 1HOMA 1RKWA 2V57A 1FTZA 2E2HJ 3RZOJ 2LVSA 3LSGA 3S1RJ 2JMWA 4ABZA 5FKKA 4GCTA 4C3IJ 4AF5A 1Q1VA 2CQQA 4JX5A 4ICHA 2NX4A 1SFOJ 4ME9A 1ETKA 1FEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYC A;  1IV6 A;  3B6C A;  1BW5 A;  1U8B A;  1ITY A;  1XG1 A;  3G1O A;  3BT9 A;  1SGM A;  1UMQ A;  2DA6 A;  1IG7 A;  4A3B J;  3S14 J;  2UXU A;  4A3C J;  3HOU J;  2M0C A;  3CRJ A;  3ZQG A;  4BKX A;  1CQT A;  2O8K A;  1UHS A;  2GM4 A;  3A01 A;  3OOU A;  1ETO A;  3HM5 A;  1BJZ A;  2JWT A;  1G2H A;  1AKH A;  1LFB A;  2FJ1 A;  5EYR A;  1MNM C;  3IH4 A;  1B8I A;  2YVH A;  1P7I A;  2G3B A;  2R93 J;  1RET A;  5FGL A;  2DG7 A;  4XRM A;  5HOD A;  2WAQ N;  2XPU A;  1MBK A;  3WHB A;  1IJW C;  2YU9 J;  4CGR A;  3ANG A;  2E2J J;  3GTJ J;  2EZK A;  4M3D A;  3HOZ J;  4MO7 A;  1Y1W J;  3QKX A;  3LHQ A;  2H8R A;  2P81 A;  1HDP A;  5FMP A;  2Y31 A;  3RH2 A;  5CXG A;  2ID3 A;  3GTG J;  5F0C A;  2ECC A;  3NXC A;  2QTQ A;  2KT0 A;  4JL3 A;  4DYQ A;  1JKQ C;  1VND A;  3E7L A;  3BNI A;  3H0G J;  2PZ9 A;  3HIM A;  3O60 A;  5M3M J;  1IDY A;  2DMP A;  4M3B A;  2X9D A;  4FTH A;  1D5Y A;  5J1R A;  2MSY A;  1RES A;  2R5Z B;  1ZK8 A;  1O4X A;  3KNW A;  5M5Y J;  1ZKG A;  3G1M A;  4XK4 A;  3F0C A;  4NEL A;  2WGB A;  1OFC X;  3LOC A;  2RAE A;  2CUE A;  2DA7 A;  1I3Q J;  4D7N A;  2NS8 A;  4UUT A;  3LSJ A;  3SFI A;  4XRS A;  2XPW A;  2Y0S N;  2EZH A;  2YUS A;  5C3E J;  3IV5 A;  1JJ8 C;  1T56 A;  5E3O A;  5J3L A;  5C4J J;  4B4C A;  4UDS A;  2AHQ A;  2YS9 A;  4MFE A;  1ZTR A;  2WB1 N;  4A3G J;  3BRU A;  2HQ5 A;  1TWG J;  2GFN A;  2QOP A;  4MK6 A;  2L7F P;  4GCK A;  5C44 J;  1QPI A;  1ZR2 A;  1AU7 A;  4FCY A;  2UXP A;  1RKT A;  2REK A;  1P7J A;  2NVX J;  3HTH A;  4A3L J;  1JTY A;  3VOX A;  3HTI A;  4IHX A;  4RDU A;  1RPW A;  3RD3 A;  4M3E A;  3BTJ A;  3JRC A;  2NVQ J;  3P9T A;  4JX4 A;  5GPA A;  5IYC J;  3VVZ A;  2G7S A;  2IU5 A;  3BG3 A;  5C4X J;  1Y1V J;  3D1N I;  1WGX A;  1MSF C;  4JNN A;  2OF7 A;  3SDG A;  3VVY A;  3BQZ A;  2XRL A;  1GVD A;  1IGN A;  4AC0 A;  5DTD A;  1MSE C;  2JA8 J;  4DYR A;  3LJL A;  5H9T A;  1FJL A;  3PAS A;  3C07 A;  1WI3 A;  3NRG A;  2L0K A;  2R5Z A;  1K83 J;  2DA4 A;  4LOC A;  1HDD C;  2ZCN A;  4V2G A;  2PBX A;  5D1R A;  4XID A;  5IYD J;  2DA5 A;  1Z0X A;  5J1U A;  1Z77 A;  4X6A J;  2COB A;  2O9L A;  3VVX A;  1WH7 A;  1IRZ A;  3HTJ A;  5HBU A;  3GTK J;  2E19 A;  1WH5 A;  1XC5 A;  3ZOB A;  2B63 J;  2DA3 A;  1OJL A;  4KWA A;  4GFK A;  5FKM A;  3BR6 A;  3HTA A;  3BTC A;  5FHP A;  4W97 A;  5EGO B;  3BCG A;  2HDD A;  4M6V A;  1MH3 A;  3AQS A;  1JT6 A;  1WCM J;  2WUI A;  1GV2 A;  3OIO A;  2K9N A;  2MW8 A;  1APL C;  2FD5 A;  2QCO A;  2ZCM A;  3ZQH A;  5D19 A;  3JRG A;  1DU0 A;  3QPL A;  2D6Y A;  4B1R A;  3HOW J;  3C2B A;  5HSZ A;  3WHC A;  2E1O A;  2HOS A;  2TRT A;  4XRS G;  2LLK A;  1ETQ A;  3NAR A;  3M4O J;  3ZQI A;  4XIC A;  1ENH A;  5FLM J;  1JGG A;  4BBS J;  5EZG A;  1OCP A;  3VW2 A;  5F1J A;  5M3F J;  3BJB A;  2ME6 A;  2EZI A;  1S7E A;  1LE8 B;  5FKO A;  3B81 A;  2DMN A;  5FJ8 J;  4GCL A;  3G7R A;  2IEK A;  4EEF G;  3HGY A;  2UXI A;  2FBQ A;  4DYC A;  2WV1 A;  1VF9 A;  2G7G A;  2IBD A;  1ETW A;  2ECB A;  4X1E A;  2JK3 A;  2HKU A;  2LFB A;  4L5E A;  3M3Y J;  1A5J A;  4Y52 J;  2R92 J;  3GZI A;  5JLW A;  3BR2 A;  5E3L A;  3LNQ A;  2HXO A;  2AO9 A;  3LSR A;  3GTO J;  3G56 A;  2OPT A;  1HLV A;  3VUQ A;  2FQ4 A;  4NDL A;  1JUP A;  2N8G A;  3KKD A;  3I4N J;  5EFY A;  3SJM A;  1I50 J;  1TWH J;  3S15 J;  4FE4 A;  2HOA A;  4BBR J;  2OI8 A;  1HF0 A;  2XGC A;  3COL A;  1TC3 C;  2VKE A;  3DEW A;  4D5C A;  1H88 C;  2O7T A;  1UG2 A;  2CU7 A;  3BQY A;  2HI3 A;  2EH3 A;  4B3A A;  2VI6 A;  1NK3 P;  3W6V A;  4A3M J;  4NN1 A;  2UXO A;  5EF6 A;  3CDL A;  3S16 J;  3JRF A;  3S2H J;  5GP9 A;  5EGO A;  4BXX J;  2LTP A;  5IPA A;  2EBI A;  5F0F A;  1FIA A;  2LK2 A;  3PPB A;  2XPV A;  3BR1 A;  2XB5 A;  2MGQ A;  3Q0W A;  2ZCX A;  3HDD A;  3VPR A;  1MBF A;  2LD5 A;  1POG A;  4DZJ A;  1K61 A;  3I4M J;  1FIP A;  2NP5 A;  5F04 A;  2CRG A;  3S5R A;  1A6I A;  2RAS A;  2LY9 A;  1U78 A;  2O7O A;  4QIW N;  1QRY A;  1TWA J;  3ZQF A;  5CW8 A;  5J1Y A;  3PO2 J;  3FKI J;  3TW6 A;  2R5Y B;  1LE8 A;  2ID6 A;  1H8A C;  1R9T J;  3O8G A;  4A3I J;  4AUX A;  2NVY J;  1JJ6 C;  4HNV A;  2QKO A;  2GEN A;  4DZP A;  2PMZ N;  4I76 A;  4A3K J;  5K7H A;  3IUV A;  5FKL A;  3BTI A;  3QBM A;  4JX6 A;  1ETY A;  1F36 A;  3OSG A;  3JRA A;  4A3D J;  3JR9 A;  4QTR A;  4YZE A;  2DN0 A;  1X2M A;  3O8H A;  3V6G A;  3BR5 A;  2HYT A;  3CJD A;  5DAJ A;  3H3V K;  3KZ9 A;  2M34 A;  1ETV A;  1XS9 A;  3ON2 A;  4FIS A;  4W1U A;  2Y9Z A;  2HXI A;  1ZGW A;  5IOZ A;  1GT0 C;  3NI7 A;  3HOV J;  4HKU A;  2IAI A;  2K9S A;  1LFU P;  2XDN A;  5K58 A;  2DJN A;  5IP7 J;  4IHV A;  1MH4 A;  2ZB9 A;  3RKQ A;  2F07 A;  2ZOY A;  5C4Y A;  5E3M A;  1W0T A;  4DW6 A;  1T33 A;  1H89 C;  5IYB J;  3MNL A;  2TCT A;  2NS7 A;  4AC6 A;  1TWF J;  2JA7 J;  1BA5 A;  2NOG A;  4AYB N;  1BL0 A;  2LP0 A;  1ORK A;  3JRE A;  2JA6 J;  3CWR A;  3GTM J;  1JTX A;  2D5V A;  2XSD C;  2M9H A;  3HOY J;  5HAW A;  4MFD A;  1U9N A;  3BTL A;  3NAU A;  1ETX A;  4MLO A;  1EF4 A;  3ZQC A;  5DS9 A;  1YRN A;  4V2F A;  3VP5 A;  2ELK A;  3ON4 A;  3S1N J;  1IUF A;  4I6Z A;  2LR8 A;  2EZL A;  3LWJ A;  3FK6 A;  1MBG A;  4A69 C;  3TP3 A;  3KKC A;  1U9O A;  2R5Y A;  4IEJ A;  4A3J J;  4JP0 A;  1TWC J;  1MBJ A;  3TP0 A;  3FIW A;  3HBL A;  5F27 A;  3TED A;  1UI5 A;  4Y7N J;  2LKX A;  1VFC A;  4GFL A;  3EGQ A;  2DMU A;  1WPK A;  2M2E A;  3FIS A;  1IDZ A;  2K9Q A;  3MN2 A;  2R0Q C;  4MXM A;  1MBE A;  2GUH A;  3G1L A;  3Q3S A;  1PUF B;  5M5X J;  2NVT J;  1B72 B;  5M5W J;  2XGE A;  2CUF A;  2QF7 A;  2H1K A;  3IH2 A;  3FK7 A;  1NTC A;  1F43 A;  3F1B A;  5IP9 J;  4FE7 A;  3UKG A;  2JJ7 A;  3JSJ A;  2K40 A;  5D18 A;  2VUM J;  4S0H B;  3JRI A;  4GFB A;  4ACI A;  1GV5 A;  5F08 A;  3GTL J;  2W48 A;  2HYJ A;  1JT0 A;  2JA5 J;  3FRQ A;  2NP3 A;  3BR0 A;  2M8G X;  5EDN A;  1QVU A;  4C3H J;  4M3G A;  2DG8 A;  1UI6 A;  4M3F A;  3JRD A;  2L7M P;  3T6N A;  2MG4 A;  1JKR C;  3GBG A;  2DMQ A;  1X58 A;  3QQA A;  2L9R A;  4PXI A;  1VI0 A;  4UUS B;  1E3O C;  1IC8 A;  3GTQ J;  2X48 A;  3DCF A;  3BR3 A;  3Q0V A;  4MIM A;  3OSF A;  3BHQ A;  3CQZ J;  1X2N A;  2ME0 A;  3LSP A;  3TW7 A;  4BY7 J;  3PO3 J;  5CXI A;  2Y9Y A;  4IHW A;  3HKZ N;  5FKN A;  3VW1 A;  3K2A A;  3NNR A;  5IP6 A;  4BY1 J;  2X6O A;  1YRN B;  1HCR A;  2GLO A;  2FX0 A;  3MVP A;  1ZQ3 P;  3VOK A;  3GEU A;  5EG0 B;  3AQT A;  2QWT A;  1SAN A;  3QPS A;  2DA2 A;  3JRH A;  1JUS A;  4G12 A;  3GTP J;  3CMY A;  3EUP A;  3BG9 A;  2VKV A;  3IH3 A;  4D7M A;  3RZD J;  1MBH A;  1OCT C;  4A93 J;  3PM1 A;  3E7Q A;  4D5F A;  1PUF A;  2Y2Z A;  2G0E A;  1B72 A;  3VIB A;  3L1P A;  4CYC B;  2XGD A;  4A3F J;  3MKL A;  1JUM A;  5AQC A;  5K7F A;  2YVE A;  4J19 A;  3HB9 A;  1AHD P;  3BG5 A;  3V78 A;  2CQX A;  3S17 J;  3S1Q J;  1I6H J;  2G7L A;  2W53 A;  3A02 A;  2CJJ A;  4IHY A;  2DMT A;  5IOY A;  2EQR A;  3K7A J;  3VW0 A;  3A01 B;  1GDT A;  3B6A A;  4RBO A;  2HOT A;  2R7Z J;  1BW6 A;  3Q0U A;  5EZH A;  2QIB A;  1AKH B;  5EEA A;  2E2I J;  3RQI A;  2XB0 X;  2ZOZ A;  1B8I B;  2VPR A;  2Q24 A;  3JRB A;  2OER A;  3ANP A;  3HGG A;  4C3J J;  1JKO C;  2UXH A;  5K7Z A;  5E3N A;  4JYK A;  2Y30 A;  3HOX J;  4JKZ A;  3S2D J;  3S1M J;  4UUS A;  1RR7 A;  2I10 A;  3HEF A;  2JN6 A;  5GPC A;  3DPJ A;  3NPI A;  1ZR4 A;  5BNG A;  3HE0 A;  5JLX A;  3CCY A;  5FLV A;  2L7Z A;  1FTT A;  1QVT A;  2DA1 A;  4A3E J;  3ZQL A;  9ANT A;  4L62 A;  2DTZ A;  4C2M J;  2GBY A;  1W0U A;  2KDZ A;  4QSH A;  1NK2 P;  5F0H A;  5EG0 A;  1DU6 A;  1GUU A;  2RHA A;  3A03 A;  1JKP C;  1HOM A;  1RKW A;  2V57 A;  1FTZ A;  2E2H J;  3RZO J;  2LVS A;  3LSG A;  3S1R J;  2JMW A;  4ABZ A;  5FKK A;  4GCT A;  4C3I J;  4AF5 A;  1Q1V A;  2CQQ A;  4JX5 A;  4ICH A;  2NX4 A;  1SFO J;  4ME9 A;  1ETK A;  1FEX A; 
#chains in the Genus database with same CATH topology
 2DQR A;  4CIC A;  2Q0O A;  5E79 C;  1U8B A;  3G1O A;  2KRF A;  4RGS A;  3WTU C;  5BQT A;  2OZU A;  5D5U B;  2LC2 A;  4HDU A;  2M0C A;  4M9X A;  2R7R A;  2HWV A;  3LWF A;  3R61 A;  1UHS A;  4XSX F;  2HZD A;  4KUM A;  3A01 A;  3EYY A;  2QQ8 A;  3GO5 A;  2D1H A;  2JWT A;  2P8T A;  2E1M B;  3H5R A;  5DD8 A;  4IQJ A;  3IH4 A;  3LFU A;  3WE2 A;  2XRO A;  5LRS A;  3WTT C;  1N78 A;  2DG7 A;  5ICE A;  2WAQ N;  3SZG A;  5HOD A;  1MBK A;  3WHB A;  2CQN A;  3U1D A;  1ZLJ A;  1OYI A;  3K1M A;  3HOZ J;  1Z1D A;  3QKX A;  1REP C;  1BM9 A;  3LHQ A;  2DFE A;  3Q9S A;  2E34 A;  1YOV B;  4BDZ A;  5FMP A;  1LVK A;  3RH2 A;  2V9V A;  5FLX K;  2DOF A;  3OYG A;  1PP8 F;  2KRC A;  2KT0 A;  3E7L A;  1IN5 A;  3DF8 A;  3H0D A;  3BOQ A;  5KVR A;  1HKT A;  3DLL F;  3DV8 A;  2X9D A;  4IF4 A;  4M3B A;  2NVU B;  1D5Y A;  1RES A;  3S3M A;  3KNW A;  5M5Y J;  2X6W A;  3AL0 B;  1ZKG A;  1J7K A;  4XK4 A;  3S3N A;  4ZYH A;  1OKR A;  3V8L A;  1OFC X;  4M71 A;  2D1V A;  1OR7 A;  1FT9 A;  2NS8 A;  2XPW A;  2X4H A;  2YUS A;  3TBI A;  3HXL A;  4ETS A;  3O2P E;  5GAH J;  2TDX A;  1U0J A;  1WWX A;  4GDF A;  2V1X A;  1IZ1 A;  2GQQ A;  2XF7 A;  3FDY A;  4UDS A;  4OAZ A;  2R7W A;  4C30 A;  4EM0 B;  4MFE A;  1UHW A;  2KHM A;  4HF2 A;  3OYF A;  3A4C A;  2GXG A;  3ABM H;  2HVR A;  4A3G J;  1W7P B;  1X3U A;  2CQK A;  3KP6 A;  2JSC A;  4GCK A;  5A2Q Z;  5C44 J;  2A69 F;  5IT9 Z;  1AU7 A;  3PFI A;  4U7D A;  2UXP A;  5H6R A;  1XGN A;  1RKT A;  2REK A;  1P7J A;  4KDP A;  4RDU A;  2QYO A;  1GXP A;  1W5C C;  3BTJ A;  4M3E A;  1Y0U A;  3BPV A;  3JRC A;  2H27 A;  4JX4 A;  3P9T A;  1CF7 A;  5GPA A;  1I1S A;  4RAG A;  2RNG A;  1FPQ A;  3KZY A;  4ESJ A;  1X1D A;  4G6D A;  1U5T C;  5C4X J;  1RIO H;  2CYY A;  3E3V A;  3FXL A;  4M6Y A;  3HL2 A;  1G59 A;  4IHS A;  4C2U A;  4Y17 A;  4AC0 A;  1ONV A;  4UV8 A;  5LEJ A;  1MSE C;  5H9T A;  3LJL A;  2Z1D A;  1FJL A;  2KQR A;  2K4J A;  5DV5 A;  4CCO A;  3NRG A;  2R5Z A;  1K83 J;  2DA4 A;  5ICC A;  5LBQ A;  3HTS B;  1I39 A;  4XBF A;  3CCV I;  1VQ7 I;  5HLT A;  5CVI A;  4N9I A;  2KDO A;  2O9L A;  1O57 A;  1GXQ A;  2GIZ A;  2L9N A;  3HTJ A;  1HA8 A;  3IUO A;  1XC5 A;  4Y33 A;  2R7T A;  1LJ9 A;  3A0B C;  1DUX C;  2EIL H;  3OR1 C;  2DA3 A;  2NS0 A;  3HSF A;  2R7F A;  2QUF A;  2CW0 F;  3DU6 A;  1JT6 A;  1WCM J;  1W4M A;  3RJP A;  2WUI A;  3VTI A;  4UNO A;  1XMX A;  2HTJ A;  2QCO A;  4BNC A;  2W00 A;  2DLL A;  4GRI A;  4AID A;  1TP4 A;  3QPL A;  4B1R A;  3HOW J;  3WHC A;  1IAW A;  2VC0 A;  5HLI A;  1TLH B;  3FXR A;  4A0Y A;  1UB9 A;  2IVM A;  2LLK A;  2QEX I;  3DU5 A;  5EZG A;  4XON A;  2O0Y A;  4U87 A;  4XKB A;  3SFZ A;  1LE8 B;  2V26 A;  3IKT A;  3DTK A;  1S5L C;  2DMN A;  3HOS A;  1IN7 A;  2ZJQ F;  3WGI A;  5GAG J;  1MIJ A;  2R7S A;  1B1B A;  2G7G A;  3A1Y A;  1ETW A;  3K6G A;  6PAX A;  2ECB A;  2JK3 A;  1X1A A;  3B02 A;  2VQH A;  1A5J A;  2PN6 A;  2HQA A;  2FNA A;  3FF5 A;  3S32 A;  1DPU A;  2ZXW H;  2HXO A;  4BEH B;  2K3F A;  1SC7 A;  2ZJP F;  2FQ4 A;  1JUP A;  2N8G A;  1YI2 I;  2JTV A;  4EMS A;  3MKW B;  3S15 J;  1BI1 A;  2LH9 A;  4HA8 A;  4LK1 F;  2HOA A;  4E4H A;  2GAU A;  1HF0 A;  2E5Z A;  1TC3 C;  2EV6 A;  2VKE A;  3E5X A;  5ICF A;  4ZZD A;  1H88 C;  1Q1H A;  1UST A;  1UG2 A;  2KIF A;  3BQY A;  5E17 F;  4B3A A;  2VI6 A;  3DBL B;  4NN1 A;  1R5G A;  4EVI A;  3BY6 A;  5GP9 A;  2FA5 A;  3VEP A;  1K7A A;  3OYJ A;  1KU9 A;  2H94 A;  3NWT A;  1R1U A;  4NQW A;  1FMW A;  2XPV A;  4I98 B;  3RKX A;  1J0R A;  2ZCX A;  1CGP A;  1Z05 A;  1IN6 A;  4AWX B;  4U0W A;  4H4K C;  3ZMV A;  1POG A;  4DZJ A;  3PQK A;  3PUB A;  5F04 A;  2CRG A;  4GGG A;  5CJ9 A;  3LQR A;  2CO5 A;  2RAS A;  1W7P D;  5CW8 A;  1K79 A;  2ID6 A;  3ABU A;  4PCQ A;  2IGM A;  4S04 A;  4NC6 A;  1OYY A;  2HGC A;  1X1B A;  3EDP A;  3O8G A;  3CF5 F;  2QKO A;  3OYL A;  2NYX A;  4CZZ A;  3FBN B;  4D1Q A;  1FOX A;  2A5Y B;  2ZME A;  3DKX A;  2RKH A;  3BWG A;  1PJR A;  2IS4 A;  3JR9 A;  5LLQ A;  1R36 A;  5E1Z B;  4HF0 A;  4CZC A;  3V7S A;  3H3V K;  2M34 A;  3ON2 A;  1GT0 C;  1KU7 A;  3MZY A;  4CO8 A;  3H5A A;  5BPD A;  3T8R A;  1LFU P;  2XDN A;  1XTA A;  4RB1 A;  1ZLK A;  3DWL E;  5IP7 J;  3E5U A;  3CJT B;  4XOR A;  2ZOY A;  4Q48 A;  1EV7 A;  1XB4 A;  1TNS A;  1DQU A;  5F6F A;  3CJQ B;  4EJT A;  4AC6 A;  3NS4 A;  4BU2 A;  1H9T A;  3QYF A;  1T39 A;  1S29 A;  2QZ8 A;  2LP0 A;  3E6B A;  4YII A;  2L3D A;  3GTM J;  2D5V A;  2M9H A;  5CLS A;  3M1C A;  2FMY A;  3BTL A;  1WJC A;  3LFK A;  3NAU A;  1KON A;  3OYB A;  3E6D A;  2LF7 A;  3RYP A;  2EA2 A;  4PSW A;  3CDH A;  4D0P A;  2YX4 A;  4NUB A;  4XOP A;  3T5X A;  3S1N J;  2IS1 A;  2OCC H;  1UHM A;  4L18 B;  4F92 B;  5LGN A;  1F4K A;  4PJL A;  3KP3 A;  3N4M A;  3F8B A;  3FIW A;  3QU6 A;  3I58 A;  1Z67 A;  5F27 A;  5B66 C;  4CCN A;  3TGN A;  1VFC A;  5LHH A;  3P9I A;  2DMU A;  1TTY A;  1WPK A;  2M2E A;  2VBX A;  2VBZ A;  2R0Q C;  2K85 A;  1WJB A;  5HS9 A;  5M5X J;  3QAH A;  3VYT B;  1QBJ A;  1B72 B;  5M5W J;  4S05 A;  2M7A A;  3BP8 A;  1TW3 A;  2DI3 A;  3IC7 A;  1T2K A;  2H1K A;  3F6V A;  1ZG1 A;  3FK7 A;  2DO7 A;  2MH9 A;  5L3B A;  1MMS A;  2FBI A;  3E1S A;  2JJ7 A;  3F8C A;  2K40 A;  3AG2 H;  2PQ8 A;  3DPL C;  4F93 B;  2DT7 B;  2HPM A;  3T1B A;  2F5F A;  2BV6 A;  4P5O A;  3GTL J;  1JXS A;  3SXY A;  3TO9 A;  2BVL A;  2NP3 A;  5CKT A;  2KIS A;  2JRM A;  4M3F A;  3QPH A;  1G3W A;  3FXQ A;  4KA4 A;  3TDZ C;  3LA7 A;  1JKR C;  2L9R A;  1HST A;  4QLC U;  1KA8 A;  4LLG F;  4BJ5 C;  2HPI A;  2LG4 A;  1LDK B;  3OSF A;  4MIM A;  3CCS I;  3L2V A;  2GA1 A;  3BJO A;  2FUG 2;  3I4P A;  1YJN I;  3HKZ N;  3MMY B;  4IRI A;  3OYK A;  2P7C B;  3VW1 A;  2EFP A;  4BY1 J;  1T38 A;  1IXR C;  1ZQ3 P;  4JQF A;  3H9G A;  5CQG A;  3RSN A;  3VOK A;  5KAF C;  2DOD A;  2QWT A;  3CJN A;  3FX3 A;  1EH8 A;  1JUS A;  2L4M A;  2VJ5 A;  4G12 A;  4I0A A;  3CMY A;  2X1E A;  4XKV A;  4OIN F;  2C6Y A;  4R79 A;  3EUP A;  3BG9 A;  1D8J A;  3RZD J;  2VC1 A;  1MBH A;  3QYB A;  2HZT A;  3PM1 A;  3F22 A;  2VKD A;  1PUF A;  2DAO A;  2CS3 A;  3GFL A;  2MAB A;  1B9M A;  2M4K A;  3GWZ A;  3VIB A;  3KP2 A;  2FOW A;  1R7J A;  2FRH A;  3MKL A;  1H0M A;  2O8X A;  3R60 A;  4CDG A;  4ANJ A;  3ABT A;  5D8K B;  4B47 A;  4EM2 A;  3BG5 A;  1R22 A;  1DDN A;  1V5E A;  3PIO F;  3S17 J;  3S1Q J;  1I6H J;  2W53 A;  3V7R A;  4IHY A;  2DMT A;  2W4S A;  2EQR A;  4KYW A;  3A01 B;  2HOT A;  2R7Z J;  3GLL A;  1QNT A;  1XD7 A;  2EWN A;  1QA6 A;  2BW3 B;  1A04 A;  2XB0 X;  4RGR A;  3RQI A;  2X6X A;  2Q24 A;  4UVC A;  3AKZ A;  2GOX B;  4C3J J;  4E7K A;  3ZMD A;  1JKO C;  2QBY A;  5B3S H;  1P4X A;  2GOM A;  4I99 C;  3S2D J;  3OS2 A;  3S93 A;  4UUS A;  4WK8 F;  4EGZ A;  2I10 A;  5LRR A;  1RUN A;  2M30 A;  5JVT A;  5A2Q K;  1ZR4 A;  3DPJ A;  1IUY A;  3NPI A;  1ZRC A;  3W2W A;  5IT9 K;  1U6G A;  1JI8 A;  3HE0 A;  3IWF A;  5FLV A;  3CCJ I;  4AIK A;  1FTT A;  4XLF A;  1V4R A;  1X1C A;  2W7N A;  2WBM A;  4II3 A;  3J81 Z;  3OS1 A;  3CCR I;  2L02 A;  2VT3 A;  5J6X A;  5D5V B;  3ZQL A;  4KIT B;  2M3A A;  4KIS A;  3EUK L;  1NK2 P;  4IJA A;  4QPO A;  1ZRE A;  2DFI A;  1ON1 A;  1XX5 A;  2GZW A;  4HX7 A;  3JAM Z;  3ESW B;  1IRG A;  4ABZ A;  3HPG A;  5K5R A;  1KYW A;  3JTG A;  2RVC A;  4C3I J;  4AF5 A;  4GCT A;  4A6D A;  2PFB A;  4UVB A;  2BXY A;  2LOO A;  2W25 A;  1LEA A;  1U5T A;  4HV5 A;  3DP7 A;  2A6E F;  1FEX A;  2E35 A;  1IV6 A;  3B6C A;  1NHA A;  2HVS A;  5DM6 F;  1V5G A;  1XG1 A;  2CMP A;  3K70 D;  1ZRF A;  4FAS D;  2KPM A;  3S14 J;  4A3C J;  1W5S A;  3IL2 A;  3CRJ A;  5HDN A;  5JVG F;  3DKW A;  2DJI A;  2XAQ A;  4Y15 A;  4YFK F;  1AKH A;  1K78 A;  3QOE A;  2OTJ I;  3G2B A;  2HVQ A;  1BC7 C;  2XAU A;  2GWR A;  1RET A;  3CC4 I;  2G3B A;  4UB8 C;  2XPU A;  2ZXJ A;  3GX4 X;  3V7C A;  4BGD A;  2A07 F;  4CGR A;  5K1Y A;  3L2U A;  4HF1 A;  1CF7 B;  3GTJ J;  4IOA F;  3K69 A;  3R0A A;  4E7J A;  4M3D A;  4MO7 A;  3HC7 A;  3CP2 A;  3RYR A;  3H5N A;  1HDP A;  2Y31 A;  2FOK A;  2P4W A;  2W1O A;  1L0O C;  2ECC A;  2UZK A;  3NXC A;  1BI0 A;  1X4P A;  3O60 A;  1QO0 D;  1IDY A;  5E1X A;  1TQM A;  1V54 H;  2IW5 A;  5DCM A;  4FTH A;  1K4S A;  3SHF A;  4YEJ A;  5J1R A;  3FXK A;  2RQQ A;  1TBX A;  4Y4R A;  3D5R C;  2ZFW A;  4LG3 A;  4XM3 A;  2R5Z B;  1O4X A;  1FYM A;  1P9Q C;  3G1M A;  1FOY A;  3F0C A;  3EQL F;  2VON A;  5F1R A;  2A6T A;  4NEL A;  1N77 A;  4A2U A;  3RPQ A;  2VE9 A;  1YO5 C;  1I3Q J;  3K4K A;  1KQ0 A;  2XSJ C;  2BE5 F;  2EZH A;  1JJ8 C;  2VLA A;  5E3O A;  1IW7 F;  4GXO A;  1SD7 A;  2CWE A;  1YW9 A;  2XV4 S;  3HRM A;  3FBI B;  3QP5 A;  4IXA A;  5CVU A;  5C4J J;  2FBK A;  4B4C A;  1IXC A;  5LHG A;  4NC8 A;  4PGH A;  2BY3 A;  4HLY A;  2GIV A;  4IVN A;  2EB7 A;  1ZTR A;  1HXD A;  5HS7 A;  2HQ5 A;  3KZZ A;  1BOA A;  1YX5 A;  1TZL A;  1TWG J;  4BQA A;  2QOP A;  1TT0 A;  4ESB A;  3BJA A;  2YSR A;  3ML6 A;  2ZC2 A;  1VTN C;  1AWC A;  3VB2 A;  1X1P A;  4LB5 A;  2X1C A;  3L2R A;  3GFI A;  4P1W A;  4IOC F;  2A68 F;  1FWZ A;  2A5W A;  2UXN A;  3MQ0 A;  2CH0 A;  4IHX A;  3TOB A;  1WHU A;  1RPW A;  2NVQ J;  3K4N A;  2KIM A;  2HOE A;  2YVX A;  3VVZ A;  1ZEL A;  4PFO A;  2IU5 A;  3HSR A;  3MZ8 A;  1Y1V J;  1WGX A;  1MSF C;  2G7H A;  4CH7 A;  2DPU A;  5D5W B;  3OYE A;  3DTI A;  4PK4 A;  4XLA A;  5B1A H;  3VVY A;  2NNN A;  1IGN A;  5DTD A;  2JRT A;  3RPU A;  2JA8 J;  2WWY A;  1ON2 A;  4KIG A;  3FXU A;  1IO2 A;  4LMY A;  3HYI A;  4U7B A;  2WAE A;  4PJM A;  2XAH A;  1AOY A;  5AIQ A;  4LOC A;  2VQG A;  4XID A;  3ZMZ A;  1G3Y A;  2VAS A;  5J1U A;  2KJC A;  3VVX A;  4A5N A;  3MWM A;  1WH7 A;  3GTK J;  3RQ4 A;  2E19 A;  3U2R A;  1ZN2 A;  3VOD A;  4XQF A;  2L2O A;  4GFK A;  4KWA A;  3PIP F;  3BPX A;  5FKM A;  4O6J A;  5FHP A;  5TRD A;  1VQN I;  4R1H A;  2HDD A;  4XN0 A;  4F52 A;  2IS2 A;  2RC4 A;  3EET A;  2QQB A;  2W57 A;  2WB1 A;  5ILU A;  4NQW B;  5HDK A;  3J7A Y;  2BXZ A;  2EA4 A;  1E2X A;  4OMY A;  2VXD A;  1ZH5 A;  1WRJ A;  1FOW A;  1TQI A;  2J5O A;  5ED4 A;  1B9N A;  5HSZ A;  2E1O A;  1MMD A;  1RZ4 A;  2TRT A;  1FBQ A;  4U88 A;  4XRS G;  3NAR A;  3J7Z I;  3ZPL A;  1MD0 A;  1ENH A;  3LSH A;  1S3J A;  1JGG A;  2NXN B;  4BBS J;  1OCP A;  3KFW X;  5M3F J;  2ME6 A;  2EZI A;  5HLG A;  2MA3 A;  1Y6I A;  2K27 A;  4FQG A;  2CV2 A;  1U2W A;  4EV0 A;  3MD2 A;  4NC7 A;  5L3G A;  2KFD A;  4OD5 A;  1KYZ A;  4CUG A;  3GLX A;  2RNJ A;  1DP7 P;  4P9F A;  2JA2 A;  1R1T A;  2LSO A;  5DUI A;  5E8I A;  1VQ8 I;  1F5T A;  3CMA I;  2ZME B;  4X1E A;  3FMQ A;  4L5E A;  4HBL A;  2R92 J;  3PUF A;  2QSH X;  5E3L A;  2AO9 A;  3LSR A;  2HYG D;  3G56 A;  1HLV A;  4BAY A;  2IGO A;  2MH2 A;  4L9J A;  4EQQ A;  1Z6R A;  1QHH D;  1YE9 A;  2FBH A;  5EFY A;  4LLN A;  4FE4 A;  3CC2 I;  3SDB A;  2OI8 A;  2G7U A;  4ZJZ A;  2XGC A;  3COL A;  2FU4 A;  3DEW A;  4EJW A;  3IKV A;  1MMA A;  4G7O F;  2EH3 A;  5HVQ C;  4A3M J;  2PLY A;  3PNY A;  2BHZ A;  1MZB A;  3OY9 A;  3CDL A;  2R7D A;  2KLO A;  1RI7 A;  4XN3 A;  2LTP A;  5IPA A;  2CW8 A;  5F0F A;  2RRE A;  3E5Q A;  5J4Y A;  2HNH A;  3S3O A;  2QSG X;  1KU2 A;  2A3S A;  3SEZ A;  3W6K B;  2XB5 A;  1MGT A;  1R49 A;  1R58 A;  3X2Q H;  3W2A A;  2MD5 A;  2Z2S B;  4AM3 A;  4XRF A;  1JHH A;  3PL8 A;  3RKW A;  3E97 A;  2O7O A;  5E18 F;  1TT5 B;  5J1Y A;  3PO2 J;  1L3L A;  3TW6 A;  4ENK A;  3KYD B;  1X4O A;  4BQN A;  4A3I J;  5LEK A;  1YLF A;  2NVY J;  5HNF A;  4A5M A;  1BIB A;  3KP4 A;  4OU0 A;  2ELJ A;  2PMZ N;  3JW4 A;  4I76 A;  4NNJ A;  5K7H A;  3IUV A;  4KIC A;  2R7V A;  2XAF A;  4HOB A;  1D5V A;  2HQN A;  3QOP A;  4F7Z A;  1F36 A;  3OSG A;  4A3D J;  3BDD A;  4XSZ F;  4YZE A;  1X2M A;  2NOJ B;  4MHG A;  2HYT A;  2A61 A;  3CME I;  4L0Y B;  1XS9 A;  3I64 A;  4XNF A;  2Y9Z A;  1ZGW A;  2HXI A;  1I6X A;  4M9Z A;  2OV7 A;  3HOV J;  4HNU A;  1Y56 A;  1S8N A;  1YG2 A;  3G73 A;  5K58 A;  2DOE A;  3RKQ A;  2XF5 A;  5B1B H;  4B44 A;  5E3M A;  2EFQ A;  4DW6 A;  1W0T A;  3UNG C;  1H89 C;  2OTL I;  3HHH A;  4Y3O A;  1GHC A;  2Z99 A;  1H9G A;  4HX4 A;  2TCT A;  2V9P A;  2X6Y A;  4O3M A;  4IQ4 A;  4UB6 C;  5L3E A;  2IS6 A;  5DUK A;  4AD9 A;  4N0B A;  2AQF A;  2H6B A;  1W36 C;  3ZXS A;  1OCO H;  3M8E A;  3IP4 B;  4ENN A;  1V3F A;  1ORK A;  1MMG A;  1UFM A;  3CWR A;  2XSD C;  3N05 A;  2V7F A;  5FFX A;  4MFD A;  1ZG3 A;  3KE2 A;  1YFH A;  2OC6 A;  1Z7L A;  1X3W B;  2CW7 A;  1EF4 A;  1O7L A;  1YRN A;  1JHF A;  1FC3 A;  2AQE A;  1T08 B;  2BY1 A;  3LQQ A;  4CXF A;  5CQE A;  1SMT A;  3WTV C;  2J5P A;  1O3T A;  3LWJ A;  2BOL A;  2IP2 A;  1XPX A;  2E36 A;  2JUC A;  3TP3 A;  2KJB A;  3M7G A;  2Y75 A;  1XCV A;  1U9O A;  2UUZ A;  3RIR A;  4IEJ A;  1MBJ A;  3HIF A;  3V4G A;  1UI5 A;  4Y7N J;  2Z9O A;  2LKX A;  4GFL A;  2B0L A;  3J81 K;  5D4S A;  2ESH A;  1YHQ I;  4II2 A;  1SEU A;  4Y13 A;  1QGP A;  4LG0 A;  2KKO A;  3MN2 A;  3IRR A;  5AIP A;  4MXM A;  2V79 A;  1TL8 A;  3G1L A;  1PUF B;  2VL8 A;  2NVT J;  1Z91 A;  4PJJ A;  2VKH A;  3WU1 B;  1HKQ A;  1S72 I;  2V6C A;  2HQR A;  1I5Z A;  2XGE A;  2CUF A;  2QF7 A;  3BG7 A;  3P9K A;  3IH2 A;  3VYR B;  3JAM K;  2JVG A;  2NNY A;  1O7F A;  1P92 A;  5IP9 J;  4G7H F;  3JSJ A;  5D18 A;  2L4A A;  4A12 A;  4GFB A;  2LBF A;  2L5Q A;  4ZC3 A;  5F08 A;  4X0G A;  3G4S I;  1YS6 A;  3V8K A;  2HYJ A;  4DOZ A;  3GZN B;  2HS5 A;  5ILS A;  4ZTJ A;  1N25 A;  3BR0 A;  5EDN A;  4C3H J;  2FJI 1;  3HRS A;  3JTH A;  3COA C;  2MG4 A;  3KZI C;  1WJ5 A;  2QBY B;  1SFE A;  1GLN A;  4IX7 A;  1BI3 A;  4UUS B;  1IC8 A;  1I3A A;  3GTQ J;  3JSO A;  4EJV A;  1VQO I;  5BMZ A;  3BR3 A;  3Q0V A;  2YU3 A;  3ELK A;  4ZDO A;  3RDI A;  2ME0 A;  1G6N A;  2F5E A;  2XHK A;  3KP7 A;  5AON A;  3ERE D;  5FKN A;  2YX7 A;  3NNR A;  4KNY A;  1HCR A;  2GLO A;  3CC7 I;  3AQT A;  3IAS 2;  2IRF G;  5LFA A;  3DEU A;  3LL7 A;  4E7Z A;  4EGY A;  3REO A;  3FXM A;  4B09 A;  4HSR A;  3ZP5 A;  5LHI A;  2VKV A;  4D7M A;  2EJR A;  4D5F A;  3WTW C;  1P4A A;  4ZYA A;  4LLL A;  3W2V A;  4Q47 A;  4BE1 A;  1U5T B;  2E5N A;  3L1P A;  2O3F A;  2XGD A;  1XSD A;  5AQC A;  5K7F A;  4DJA A;  2ZO4 A;  4LD5 A;  2YVE A;  1Z21 A;  2Q1Z B;  2VT2 A;  4OIQ F;  2W85 A;  4KMU X;  2ESN A;  1EH7 A;  3CUO A;  2G7L A;  5D4R A;  4BAC A;  2KZV A;  3I9V 2;  3JSP A;  2QKM B;  3F9K A;  3K7A J;  4ZZL A;  5DM7 F;  1BW6 A;  1AKH B;  5FFZ A;  1K78 B;  1K6Y A;  2ZOZ A;  4OD4 A;  4MQ9 F;  5GAD J;  4HQM A;  3CCU I;  2O6G E;  2ZJR F;  4N9H A;  3I53 A;  4JKZ A;  4JYK A;  5KCM A;  4LJZ F;  3ISP A;  1F1Z A;  1RR7 A;  4UY8 I;  3W3C A;  2XIG A;  2Z3Y A;  1LQ1 A;  4XKC A;  3SWH A;  2QM3 A;  1R1V A;  1QVT A;  3C1D A;  1UEL B;  2MC4 A;  5J40 A;  2E71 A;  3CD6 I;  4L62 A;  1LFP A;  4E6K G;  5EJC A;  4QSH A;  1SFU A;  5EG0 A;  3KYL A;  5DCM B;  1VQ6 I;  3K1P A;  4BS9 A;  1VQL I;  4JBA A;  1G3S A;  1FTZ A;  1N75 A;  2VOD A;  1OPC A;  1S7A A;  3QYE A;  1BJA A;  2E2H J;  1NH3 A;  3RZO J;  1FP2 A;  2VN2 A;  1FX7 A;  2O03 A;  1FSE A;  5L3D A;  2ZCW A;  3CP8 A;  4AVZ A;  3WTS C;  1B6A A;  4I02 A;  1IRX A;  3DPT A;  1QZE A;  2M45 A;  3B73 A;  4PJ0 C;  5TIS C;  4JX5 A;  2K02 A;  2BGC A;  3HTU A;  2F5D A;  3S2W A;  1SGM A;  1ITY A;  1B59 A;  1UCR A;  3BT9 A;  4RGU A;  1UMQ A;  2DA6 A;  2F4M B;  5IY5 H;  2H6C A;  4ENM A;  3GZ6 A;  1R6R A;  1Z3X A;  3HOU J;  3HRT A;  4BKX A;  5D6E A;  2O8K A;  3QRF F;  2GM4 A;  3OOU A;  4BHC A;  3HM5 A;  5K5Q A;  1VQM I;  1ZYR F;  3EYI A;  1G2H A;  1HKS A;  2F4I A;  3UR3 C;  2FJ1 A;  1GVJ A;  5EYR A;  2WC2 A;  1B8I A;  2YVH A;  1P7I A;  2X1D A;  3OIQ A;  5FGL A;  4PSX A;  2PI0 A;  1D0X A;  3E6C C;  1FNN A;  2CFO A;  3TDU C;  2MLG A;  1SVM A;  2EZK A;  2FE3 A;  4G6T B;  3C3W A;  1Y1W J;  4PFP A;  2CG4 A;  2XUB A;  4LFU A;  4H0E A;  2H8R A;  2X51 A;  3L2C A;  3CLQ A;  5CXG A;  4IRG A;  2ID3 A;  4LIV A;  4L5J A;  5F0C A;  5CVJ A;  5J47 A;  2QTQ A;  1HQC A;  1LVA A;  2K9L A;  1JKQ C;  2DDA A;  1VZ0 A;  3H0G J;  3ERM A;  4OAY A;  4CHU A;  4E7I A;  2PZ9 A;  5M3M J;  5GTH C;  4DIQ A;  2FNP A;  3HZJ A;  4KT5 C;  2P5K A;  2COM A;  1Y8Q B;  2MYS A;  1ZK8 A;  4FX4 A;  2VJ4 A;  5DD4 A;  4MGR A;  4MTE A;  4FET A;  1D1B A;  1MW7 A;  3K4C A;  1ZRD A;  4O5V A;  3IWZ A;  3LOC A;  5FRM A;  1Z9C A;  4HDV A;  2PG4 A;  5D8L B;  3LAP A;  4UUT A;  1FZP B;  5C3E J;  1T56 A;  4E7H A;  1I27 A;  5J3L A;  2I5U A;  2ZXI A;  2JVH A;  1KQ8 A;  1IRF A;  4HEA 2;  3RI4 A;  1VQP I;  2QLZ A;  2F4O B;  1XDU A;  2YPR A;  3ZRG A;  2YS9 A;  3PQJ A;  3T0Y A;  3KYC B;  4R8H A;  1BBY A;  1XMA A;  2DK8 A;  1R5I D;  3O3K A;  3BRU A;  3QOD A;  4MK6 A;  2L7F P;  2VQC A;  1P4W A;  4OMZ A;  4BXU A;  1QPI A;  3D5S C;  1ZR2 A;  1T95 A;  4YEL A;  1SVL A;  2VIX A;  2WY8 Q;  3HTH A;  2NVX J;  2DW4 A;  4J00 A;  1JTY A;  3VOX A;  2WAQ A;  2OCE A;  1EA3 A;  3RD3 A;  4D9J A;  4BYY A;  2VPL A;  1J5Y A;  5IYC J;  4IKF A;  3F8F A;  4U0Y A;  2STT A;  3VWB A;  3BG3 A;  2LKS A;  3MKY B;  4Z2Y A;  3D1N I;  2UXO A;  4OOI A;  1R4M B;  3SZP A;  2EIN H;  4P55 A;  2OF7 A;  3SDG A;  3BQZ A;  2EPF A;  2NAZ A;  2GXA A;  3L09 A;  1VQ9 I;  2W24 A;  2HDW A;  3ZQ7 A;  3E6M A;  3PAS A;  1R23 A;  3C07 A;  1WI3 A;  4CCJ A;  4ZYE A;  2VE8 A;  3K4M A;  4V2G A;  4RAF A;  4CYD A;  3ROU A;  2DA5 A;  2MLK A;  1Z77 A;  4X6A J;  3ZMS A;  2HFH A;  1IRZ A;  1X19 A;  5HBU A;  3ZN1 A;  2V1N A;  1FYK A;  3ECH A;  3U21 A;  1WJE A;  3ZOB A;  2B63 J;  2PBI A;  1X3Z B;  4UUV A;  1YJW I;  4YFN F;  1OJL A;  1D1C A;  1JGS A;  3BR6 A;  3HTA A;  3BTC A;  3OYN A;  4RB2 C;  5BOX A;  4W97 A;  5F64 A;  3BCG A;  3ASO H;  3K4B A;  1MH3 A;  2UV1 A;  3AQS A;  3VYU B;  2DCE A;  3I71 A;  2JPB A;  2MW8 A;  4BXF A;  3KPH A;  4G6Q A;  5D19 A;  4RS8 A;  3L2Q A;  4JK1 X;  2D6Y A;  3C2B A;  2HOS A;  1W1W E;  4UV9 A;  2LY1 A;  2ZSI B;  3M4O J;  4XIC A;  2P5L C;  1D3Y A;  1SMY F;  1FSH A;  3DBH B;  3BJB A;  3M9A A;  2B3W A;  2OUM A;  4ZYD A;  5FKO A;  2OJE D;  2L9V A;  3WTZ A;  2IJL A;  4L9T A;  3LMM A;  2LRE A;  4JOM A;  2A05 A;  1ERD A;  4WXH A;  2BHY A;  2E1C A;  4I01 A;  3ONQ A;  1SFK A;  1VF9 A;  3V8J A;  3CCE I;  1TW2 A;  2JT1 A;  2HKU A;  3M3Y J;  3GFJ A;  2PEX A;  2CSO A;  2QQ9 A;  3BR2 A;  3LA2 A;  5JLW A;  3GZI A;  2B9S A;  3GTO J;  2KL4 A;  2OPT A;  4BE2 A;  3VUQ A;  1FY7 A;  3DTE A;  2VB6 A;  4XLC A;  2E1M C;  4I7H A;  3NQO A;  3I4N J;  3CTA A;  3SJM A;  1I50 J;  1HW1 A;  3RPU D;  4L9N A;  3GF2 A;  4ASN A;  4UVA A;  3G71 I;  2P6S A;  2HYF A;  4D5C A;  4BQO A;  2V1D A;  1ULY A;  3RTR A;  2O7T A;  3KIO A;  5CVR A;  2W82 A;  1NG7 A;  2L01 A;  4WF2 A;  3TOA A;  5DYM A;  2XGX A;  3S16 J;  2H09 A;  2XKP A;  5EGO A;  4BXX J;  4M74 A;  2DT6 A;  2LK2 A;  3BLY A;  3P9C A;  1AA7 A;  2QSF X;  2GXB A;  2FF4 A;  3BR1 A;  2FML A;  1OCC H;  2MGQ A;  2E7X A;  2LYC A;  3ZMT A;  3HDD A;  3VPR A;  1MBF A;  2VJI A;  2LD5 A;  2PX9 A;  3KCC A;  1FIP A;  4OWR B;  2ZFU A;  1PP7 U;  3GVA A;  2CV0 A;  1A6I A;  2WAF A;  3GYH X;  1EH6 A;  2Z5U A;  4BHB A;  1TWA J;  1G3T A;  4M72 A;  3ZQF A;  1WJF A;  3BZK A;  3ZMU A;  3H9J A;  5KHD A;  1J59 A;  4DNC A;  4UXN A;  3C2H A;  1R9T J;  4HYE A;  2QGU A;  4MNU A;  1BR2 A;  2RQP A;  1SD6 A;  3BCB A;  1JJ6 C;  2BY2 A;  2HR3 A;  3OR2 C;  3K9T A;  4LG0 B;  4A3K J;  2WV0 A;  4JX6 A;  1WI9 A;  3OYM A;  1YIT I;  1VQK I;  1ETY A;  4G9Y A;  3GEZ A;  3JRA A;  1WZ2 A;  3PFY A;  4QTR A;  3V6G A;  3CJD A;  3I56 I;  2YR2 A;  4FIS A;  4W1U A;  5IOZ A;  3LA3 A;  2VOP A;  3NI7 A;  3R6S A;  2IAI A;  4HKU A;  3ABL H;  4A0Z A;  3OIP A;  1A31 A;  4IHT A;  2XC7 A;  4YRV A;  4KMF A;  5CYV A;  4F55 A;  2ZB9 A;  2F07 A;  3U1K A;  2LBF B;  1YIO A;  1RUO A;  1SAU A;  2PMU A;  1I1G A;  5IYB J;  4LIU A;  1MJA A;  2JA7 J;  4HQE A;  2HKX A;  3TO6 A;  4E7S A;  1BA5 A;  4AYB N;  2Q2E A;  1BL0 A;  3TKY A;  1WKM A;  3IAM 2;  1ODD A;  3K2Z A;  2M4G A;  2OBP A;  2JA6 J;  3JRE A;  2XVC A;  3WGH A;  2ZSH B;  1MJB A;  3HOY J;  4ZYG A;  3T8T A;  1U9N A;  2KRH A;  1ETX A;  4MLO A;  2K5C A;  4V2F A;  2AS5 F;  3VP5 A;  1OYW A;  3CES A;  1IUF A;  5H20 A;  4G8X A;  4I6Z A;  2LR8 A;  4A69 C;  2DXI A;  3KKC A;  1T98 A;  2ETH A;  2R5Y A;  2DT5 A;  1UG0 A;  1D1A A;  3HBL A;  1XGM A;  3E0J B;  1D0Y A;  3NEU A;  3R4K A;  2PJR A;  5CPR B;  3HHG A;  1IDZ A;  1M1E B;  1YW8 A;  2K9Q A;  4WX9 A;  4WWC A;  2GUH A;  3Q3S A;  1LPQ A;  3DPU A;  1G8X A;  3G3Z A;  2O5R A;  1MDM A;  5EEH A;  5KNL A;  4BDY A;  1T8I A;  3L9F A;  1MNE A;  3HG9 A;  4ZDL A;  3FKJ A;  3KP5 A;  1NTC A;  1XMK A;  1F43 A;  3F1B A;  3G6E I;  4I09 A;  1UZC A;  5D6F A;  3J80 Z;  2M0M A;  2QQA A;  2BBY A;  2PFV A;  2BW3 A;  2VUM J;  3L7W A;  4S0H B;  5L3F A;  4Q4Z F;  4ACI A;  4WCG A;  3OYD A;  1GV5 A;  1XGS A;  5H2F C;  2EIJ H;  2W48 A;  2JA5 J;  1EKE A;  4BH9 A;  1PYV A;  1QVU A;  1MND A;  3WTX C;  3WE3 A;  1UI6 A;  2ISZ A;  2L7M P;  3GBG A;  1Y0N A;  4KJZ A;  2ZJ2 A;  2Y69 H;  1VI0 A;  4MQV A;  2IGK A;  3I55 I;  1E3O C;  2X48 A;  3DCF A;  1IV8 A;  4M73 A;  3LSP A;  5E1W A;  4BY7 J;  3TW7 A;  3PO3 J;  2E60 A;  2V4J C;  4QWQ A;  5IP6 A;  2E7W A;  3OYA A;  4Q5S F;  5TJJ A;  1E17 A;  3FXJ A;  3GEU A;  5EG0 B;  4XLN F;  1SAN A;  2EFN A;  4B48 A;  3I54 A;  2DA2 A;  2DDB A;  1BR4 A;  1BN5 A;  1A35 A;  4A6E A;  3FHZ A;  1O3R A;  3BZ6 A;  1C0W A;  1OCR H;  5KAI C;  1EJ9 A;  2CFX A;  2VQL A;  2AXT C;  2DBB A;  2XAJ A;  2M1B A;  1OCT C;  1IN8 A;  4YIR X;  3IHU A;  4XKW A;  3CCM I;  2VJJ A;  1LKX A;  2DFF A;  4IO9 F;  4A3F J;  2P0W A;  1OIS A;  1BI2 A;  3HB9 A;  3F8M A;  3FMR A;  2CQX A;  4XR6 A;  4P96 A;  2CJJ A;  4XMY A;  3VW0 A;  5FD5 A;  1GDT A;  1HBX G;  3SZT A;  4OIO F;  2P5V A;  1VQ5 I;  1E3P A;  2EFO A;  2KZG A;  1XSV A;  2E2I J;  4RMN A;  3H3U A;  3H92 A;  2CUZ A;  1BIA A;  2PMH A;  2VPR A;  1B8I B;  3MAJ A;  4IRH A;  1IXS B;  3HUG A;  3OOP A;  3L2W A;  3KEQ A;  4ZH4 F;  5E3N A;  2Y30 A;  3HOX J;  1LNW A;  3GFM A;  4A0X A;  1QU3 A;  3CO6 C;  1BR1 A;  2HDC A;  3TMO A;  4MEX F;  5JLX A;  1Z7U A;  2KIQ A;  1G4D A;  2DU9 A;  2L7Z A;  2JSP A;  4M9S A;  3HKZ A;  2EIK H;  3KET A;  4LIT A;  1ACI A;  3I0T A;  2XAS A;  3I59 A;  2DTZ A;  4C2M J;  1W0U A;  2KDZ A;  5F0H A;  2EV5 A;  4L5I A;  4KIB A;  1GUU A;  3LST A;  1YS7 A;  3A03 A;  3CO7 C;  1JKP C;  1HOM A;  1RKW A;  2V57 A;  1D8K A;  1UAA A;  1MKM A;  5HOO A;  3EUH C;  3CUQ A;  3LSG A;  3OMY A;  3S1R J;  5FKK A;  1STZ A;  3J7Y J;  1LDD A;  4CCL A;  3O6B B;  1D0Z A;  1QQI A;  1Q1V A;  2M8E A;  2MC3 A;  2QA4 I;  1SFO J;  1WJA A;  4ME9 A;  4XLH A;  1ETK A;  4CYC A;  2Q8K A;  1J75 A;  2OU2 A;  1BOB A;  1BW5 A;  2CUJ A;  4G7Z F;  4A3B J;  1IG7 A;  3DQV C;  4HAM A;  1TNT A;  4XOT A;  2UXU A;  2CQ7 A;  3VFZ A;  5HS8 A;  3ZQG A;  3H36 A;  1CQT A;  4UHT A;  4KN7 X;  1ETO A;  2B7E A;  2XDV A;  1BJZ A;  3AG3 H;  1QHG A;  1LB2 A;  5TGT A;  1LFB A;  2RDP A;  2M7B A;  1DPR A;  3MEX A;  3WU0 A;  3ZQQ A;  1O3S A;  1MNM C;  3A2K A;  3F8N A;  2DK5 A;  2R93 J;  1KZH A;  5E20 A;  4XRM A;  3K70 C;  2LRD A;  1IJW C;  2YU9 J;  2X0L A;  3CZ6 A;  3RKY A;  3ANG A;  2E2J J;  3LAJ A;  2W84 A;  4B8X A;  5EEG A;  1Y8R B;  1LDJ A;  2I8D A;  4HRI A;  2O61 A;  2P81 A;  3OYC A;  3TL4 X;  4U0V A;  1OLT A;  4EM1 A;  1FOK A;  1S6L A;  2OZ6 A;  3GTG J;  4KT6 A;  3CDI A;  5ILV A;  1YTY A;  2LMD A;  1FYL A;  4JL3 A;  4DYQ A;  5FRN A;  1VND A;  4CCM A;  3BNI A;  2ZNY A;  3HIM A;  1T6S A;  3FMS A;  2A6H F;  1KU3 A;  2DMP A;  1B4A A;  3F21 A;  5BPI A;  2DOA A;  2MSY A;  2K86 A;  3PNV A;  2WAD A;  3MCZ A;  3AG1 H;  3K4L A;  2ELH A;  1U8R A;  2L9S A;  4BJT A;  5GTI C;  3WOD F;  1T0F A;  4RLF A;  2WGB A;  1W5T A;  2RAE A;  3VSK A;  2CUE A;  2DA7 A;  3K0L A;  4D7N A;  3SFI A;  2P6T A;  3LSJ A;  3LSI A;  4ZDP A;  2Y0S N;  4XRS A;  3IV5 A;  2EFW A;  2BVM A;  5JI6 A;  3N97 A;  2OQG A;  4BL0 B;  2AHQ A;  2M87 A;  3C18 A;  5BS6 A;  1WFX A;  4HX8 A;  2WB1 N;  4EJU A;  2R4G A;  2LDU A;  1Z3Y A;  3QP6 A;  3FZV A;  3CCL I;  2GFN A;  1HSJ A;  4AIH A;  4PJN A;  3OL4 A;  1SD5 A;  2ACJ A;  4FCY A;  1F9N A;  2R7X A;  4A3L J;  4C2T A;  3AG4 H;  4M6X A;  1LEB A;  3HTI A;  1BC8 C;  3HSE A;  2WTE A;  1QPM A;  2LY2 A;  4NBQ A;  1RNL A;  2G7S A;  4NB5 A;  3BCA A;  2E1N A;  4HLX A;  1HC8 A;  3DEE A;  2ISY A;  1ZHF A;  3H1C A;  4OIR F;  4JNN A;  2MFZ A;  2QEN A;  2UWM A;  2RN7 A;  2XRL A;  3K1N A;  1GVD A;  5HLH A;  4PZJ A;  1FP1 D;  5J4V A;  2XAG A;  3I3L A;  3R0J A;  4IL6 C;  4DYR A;  5K5O A;  2XKO A;  4HZF A;  2OD5 A;  2L0K A;  3IRQ A;  2NRA C;  1HDD C;  2ZCN A;  2PBX A;  5D1R A;  1OQY A;  5IYD J;  2EK5 A;  4DBR A;  1Z0X A;  3F6O A;  3H3Z A;  2COB A;  3ASN H;  2ZBK A;  1J09 A;  1WH5 A;  2ZKZ A;  3ZN0 A;  2IA1 A;  5FGM A;  3ECO A;  3OWT A;  2R7O A;  2R7U A;  3ZGK A;  4LK0 F;  2D45 A;  2K9M A;  2R3S A;  4GYI A;  5EGO B;  3FM3 A;  1PUE E;  4M6V A;  3WGG A;  2DYS H;  4U9N A;  2DQL A;  3C7J A;  3U9G A;  1K4T A;  2IT0 A;  1GV2 A;  3CMM A;  3OIO A;  2K9N A;  2AXL A;  4RA2 A;  2FD5 A;  1APL C;  3S8P A;  2ZCM A;  3KLO A;  1W7P A;  4CA0 A;  3ZQH A;  3WTY C;  3JRG A;  1DU0 A;  3CF2 A;  5JHU A;  1SAX A;  1NG6 A;  3VSL A;  2CV1 A;  2XF6 A;  3TO7 A;  1XSX A;  2EV0 A;  3M8F A;  1ETQ A;  5FLX Z;  3ZQI A;  3F23 A;  5FLM J;  1RC9 A;  4V19 K;  2HU9 A;  3VW2 A;  4FT8 A;  5F1J A;  1S7E A;  1V5F A;  3BRO A;  4CGZ A;  1DGR M;  1OR7 C;  3Q5F A;  3B81 A;  5FJ8 J;  4GCL A;  4GO1 A;  5FO5 A;  3G7R A;  2IEK A;  4DVY P;  4EEF G;  3HGY A;  5E8G A;  4AIJ A;  2UXI A;  2FBQ A;  4DYC A;  4HW0 A;  2H1L A;  2WV1 A;  3FHN A;  5FB2 A;  2IBD A;  3K4J A;  2F5V A;  4AU7 A;  2K7L A;  2LFB A;  1USS A;  2P7V B;  4Y52 J;  2LF8 A;  4BHP A;  1V55 H;  3LNQ A;  4KN4 X;  1WQ2 A;  1R00 A;  2QKL B;  3F3X A;  3P7N A;  4YFX F;  1R4N B;  2VXZ A;  4NDL A;  1MMN A;  2HKO A;  3CLO A;  4MEY F;  2B1E A;  4XLE A;  3KKD A;  2V9K A;  4C2M A;  1TWH J;  1J9I A;  2VBW A;  4FX0 A;  4HPQ A;  4BBR J;  1WVR A;  2QVO A;  2R7Q A;  3LSM A;  4AYB A;  2CU7 A;  2H8W A;  3DFG A;  2HI3 A;  1NK3 P;  3W6V A;  5LGU A;  4CCK A;  1J2X A;  2RGV A;  5EF6 A;  3OV8 A;  3OS0 A;  3HRU A;  3JRF A;  2Q2E B;  3HOT A;  3S2H J;  3WU2 C;  3J80 K;  1HW2 A;  3GXO A;  3M07 A;  2EBI A;  4TV7 A;  1FIA A;  3K8P C;  5DEQ A;  4K2E A;  3PPB A;  3NWS A;  4IRV A;  4BUP A;  2CGP A;  2VBY A;  5FD6 A;  4FHT A;  2IA0 A;  5JFR A;  3Q0W A;  4RAY A;  2XRN A;  5LGT A;  4I2O A;  3PSF A;  1R5H A;  1K61 A;  4ON0 A;  3I4M J;  1LUJ B;  4HNT A;  2UXX A;  5FRO A;  4XL9 A;  2NP5 A;  2BZT A;  2A2F X;  2V6E A;  3S5R A;  2V1U A;  2LY9 A;  1U78 A;  1DGW Y;  4QIW N;  1QRY A;  3DXJ F;  1OMI A;  3PSI A;  4YIF A;  3FKI J;  2R5Y B;  1LE8 A;  1H8A C;  2L7K A;  4DQ2 A;  3ABK H;  3CUQ C;  4WXD A;  4BE0 A;  2PJR B;  4AUX A;  4BQQ A;  5DDG A;  4HNV A;  1OCZ H;  5B5E C;  4IPA A;  2GEN A;  4DZP A;  1YJ9 I;  1YW7 A;  2DPD A;  5FKL A;  3BTI A;  1E3H A;  1Y39 A;  5HDG A;  3QBM A;  4J01 A;  3DLA A;  1MDM B;  4I0B A;  1ZGJ A;  3PNT A;  1P6R A;  2DN0 A;  1DP3 A;  3O8H A;  1U3E M;  3BR5 A;  1W36 D;  3ULQ B;  5DAJ A;  4BEH A;  3KZ9 A;  2F5C A;  1ETV A;  3MKZ A;  4WXC A;  4B3X A;  3VOE A;  4Z6Y A;  3FM5 A;  2M5W A;  3F72 A;  1ZGA A;  2K9S A;  2RV8 A;  4GYG A;  2DJN A;  4QPQ A;  1RR8 C;  4IHV A;  1MH4 A;  3TQN A;  5C4Y A;  2HEO A;  1T33 A;  3OL3 A;  4RGX A;  4XLP F;  4U9L A;  4RAZ A;  3MNL A;  1YYV A;  2NS7 A;  1TWF J;  2HTS A;  3SYT A;  3FWE A;  3BC8 A;  2NOG A;  3DBR B;  2Y0M A;  4AVP A;  4IZZ A;  4N4O B;  1O3Q A;  5CVV A;  3FXO A;  1JTX A;  2Z33 A;  1FLI A;  3A0H C;  5HAW A;  4P9U A;  3BG6 A;  3C2G A;  1YQA A;  2WA0 A;  5LD2 C;  3MZH A;  3NRV A;  2ZY9 A;  3CJR B;  4RLQ A;  3ZQC A;  3QPT A;  1FBS A;  5DS9 A;  2ELK A;  2FXA A;  3CCQ I;  4KIF A;  2LNB A;  4HG2 A;  3ON4 A;  4N4N B;  1TQP A;  3V42 A;  1WJD A;  2EZL A;  4OIP F;  2ZNZ A;  4B43 A;  3FK6 A;  2VOO A;  2ADU A;  1MBG A;  5IT3 A;  2EIM H;  2STW A;  1E0E A;  1Z6T A;  3OYH A;  1A6Q A;  5JHF A;  3WG7 H;  4A3J J;  4HV6 A;  4JP0 A;  1TWC J;  3TP0 A;  3TED A;  1T0F C;  1K6O A;  3GME A;  1QZZ A;  4E7L A;  1KQ9 A;  4RB3 C;  3VYS B;  2PMZ A;  3QU3 A;  3EGQ A;  1SVO A;  3FIS A;  2OA4 A;  1MBE A;  3AFH A;  3D0S A;  2K3P A;  1XCB A;  2OAZ A;  1YX3 A;  5ICG A;  4RM3 A;  3KX2 A;  4ENJ A;  2IGN A;  2BEO A;  5KK1 A;  3D5L A;  1A36 A;  4GCV A;  5L3C A;  4ESF A;  5H6Q A;  1R71 A;  1PDN C;  3UKG A;  2LKP A;  4FE7 A;  2IXS A;  2GA2 A;  3GW2 A;  3JRI A;  1QZY A;  2Y48 A;  4L0Z B;  3J7A O;  3AAF A;  2F2E A;  4F3Q A;  5DCF A;  1JT0 A;  3FRQ A;  3SEQ A;  3MFK A;  1ZAR A;  1SD4 A;  3EUH A;  3SQN A;  2M8G X;  3GCM A;  2DG8 A;  3QWL A;  2JUG A;  3BZC A;  4M3G A;  1SFX A;  4BJ6 C;  2Z16 A;  3HUG B;  3KLN A;  2JPC A;  3JRD A;  3T6N A;  5JR3 A;  2DMQ A;  1X58 A;  3Q9V A;  3QQA A;  4PXI A;  1RRJ A;  1IN4 A;  2ZME C;  2DTR A;  4ITV A;  3BHQ A;  3CQZ J;  1X2N A;  2IA2 A;  5ERI A;  1JE8 A;  5CXI A;  2Y9Y A;  1XGO A;  1XDS A;  1WSU A;  4IHW A;  2D2W A;  2KMU A;  3I59 B;  3K2A A;  4HST A;  3GUD A;  2X6O A;  1YRN B;  4KFC A;  3M8J A;  2FX0 A;  1KGS A;  3MVP A;  2X85 A;  2L54 A;  4PUS A;  3VDX A;  1PVE A;  1ZG5 A;  3QPS A;  4L9V A;  4CSW A;  1XN7 A;  3JRH A;  3AL0 C;  2QWW A;  1P2F A;  2BY0 A;  3GTP J;  4MTD A;  4PGG A;  3ZR8 X;  3CUQ B;  5GAE J;  3IH3 A;  2G9W A;  2F48 A;  3BJ6 A;  3ZCO A;  4RB0 A;  4A93 J;  3E7Q A;  3H9Q A;  2Y2Z A;  4LB6 B;  3RCO A;  2DYR H;  2G0E A;  4PDK A;  1B72 A;  2MBF A;  4CYC B;  1YIJ I;  1JUM A;  1MJ9 A;  2PJP A;  2ICW G;  1FMV A;  4J19 A;  1AHD P;  1IF1 A;  4EJO A;  3V78 A;  4E70 A;  2IPQ X;  1HW5 A;  3A02 A;  3L00 A;  2ZXH A;  4YG2 F;  5IOY A;  2JZY A;  5J8C A;  2KIU A;  3B6A A;  4RBO A;  5D5X B;  4C9Y A;  3Q0U A;  5EZH A;  2QIB A;  3DKY A;  5EEA A;  3KEY A;  4EAT A;  1ZAO A;  3LSK A;  3JRB A;  2OER A;  3ANP A;  3HGG A;  2FSW A;  2UXH A;  5K7Z A;  3S1M J;  3HEF A;  3JCU C;  2JN6 A;  4DBQ A;  5GPC A;  2DFH A;  5BNG A;  2K4B A;  4DGW B;  3CCY A;  3EUA A;  2DA1 A;  1S9H A;  4LGW A;  5HNH A;  4A3E J;  4RM2 A;  3P5J A;  9ANT A;  2OQR A;  1VQ4 I;  2WY7 Q;  2GBY A;  3K10 A;  3HJE A;  1DU6 A;  2F6C A;  2RHA A;  2FQ3 A;  3H35 A;  3W6J B;  2LVS A;  3M1E A;  2Y0S A;  1S7O A;  3GZ5 A;  2JMW A;  3EPZ A;  4F91 B;  4G94 A;  4WIB A;  2MD0 A;  5J8F A;  2BYV E;  2JQ7 A;  3PJR A;  3HPH A;  2CQQ A;  2FEZ A;  3KEO A;  1UJ8 A;  3I5U A;  4ICH A;  4NHJ A;  2KP6 A;  2NX4 A;  4ZTF A;  3OYI A;  3WG9 A;  1FBU A; 
#chains in the Genus database with same CATH homology
 4CYC A;  1IV6 A;  3B6C A;  1BW5 A;  1U8B A;  1ITY A;  1XG1 A;  3G1O A;  3BT9 A;  1SGM A;  1UMQ A;  2DA6 A;  1IG7 A;  4A3B J;  3S14 J;  2UXU A;  4A3C J;  3HOU J;  2M0C A;  3CRJ A;  3ZQG A;  4BKX A;  1CQT A;  2O8K A;  1UHS A;  2GM4 A;  3A01 A;  3OOU A;  1ETO A;  3HM5 A;  1BJZ A;  2JWT A;  1G2H A;  1AKH A;  1LFB A;  2FJ1 A;  5EYR A;  1MNM C;  3IH4 A;  1B8I A;  2YVH A;  1P7I A;  2G3B A;  2R93 J;  1RET A;  5FGL A;  2DG7 A;  4XRM A;  5HOD A;  2WAQ N;  2XPU A;  1MBK A;  3WHB A;  1IJW C;  2YU9 J;  4CGR A;  3ANG A;  2E2J J;  3GTJ J;  2EZK A;  4M3D A;  3HOZ J;  4MO7 A;  1Y1W J;  3QKX A;  3LHQ A;  2H8R A;  2P81 A;  1HDP A;  5FMP A;  2Y31 A;  3RH2 A;  5CXG A;  2ID3 A;  3GTG J;  5F0C A;  2ECC A;  3NXC A;  2QTQ A;  2KT0 A;  4JL3 A;  4DYQ A;  1JKQ C;  1VND A;  3E7L A;  3BNI A;  3H0G J;  2PZ9 A;  3HIM A;  3O60 A;  5M3M J;  1IDY A;  2DMP A;  4M3B A;  2X9D A;  4FTH A;  1D5Y A;  5J1R A;  2MSY A;  1RES A;  2R5Z B;  1ZK8 A;  1O4X A;  3KNW A;  5M5Y J;  1ZKG A;  3G1M A;  4XK4 A;  3F0C A;  4NEL A;  2WGB A;  1OFC X;  3LOC A;  2RAE A;  2CUE A;  2DA7 A;  1I3Q J;  4D7N A;  2NS8 A;  4UUT A;  3LSJ A;  3SFI A;  4XRS A;  2XPW A;  2Y0S N;  2EZH A;  2YUS A;  5C3E J;  3IV5 A;  1JJ8 C;  1T56 A;  5E3O A;  5J3L A;  5C4J J;  4B4C A;  4UDS A;  2AHQ A;  2YS9 A;  4MFE A;  1ZTR A;  2WB1 N;  4A3G J;  3BRU A;  2HQ5 A;  1TWG J;  2GFN A;  2QOP A;  4MK6 A;  2L7F P;  4GCK A;  5C44 J;  1QPI A;  1ZR2 A;  1AU7 A;  4FCY A;  2UXP A;  1RKT A;  2REK A;  1P7J A;  2NVX J;  3HTH A;  4A3L J;  1JTY A;  3VOX A;  3HTI A;  4IHX A;  4RDU A;  1RPW A;  3RD3 A;  4M3E A;  3BTJ A;  3JRC A;  2NVQ J;  3P9T A;  4JX4 A;  5GPA A;  5IYC J;  3VVZ A;  2G7S A;  2IU5 A;  3BG3 A;  5C4X J;  1Y1V J;  3D1N I;  1WGX A;  1MSF C;  4JNN A;  2OF7 A;  3SDG A;  3VVY A;  3BQZ A;  2XRL A;  1GVD A;  1IGN A;  4AC0 A;  5DTD A;  1MSE C;  2JA8 J;  4DYR A;  3LJL A;  5H9T A;  1FJL A;  3PAS A;  3C07 A;  1WI3 A;  3NRG A;  2L0K A;  2R5Z A;  1K83 J;  2DA4 A;  4LOC A;  1HDD C;  2ZCN A;  4V2G A;  2PBX A;  5D1R A;  4XID A;  5IYD J;  2DA5 A;  1Z0X A;  5J1U A;  1Z77 A;  4X6A J;  2COB A;  2O9L A;  3VVX A;  1WH7 A;  1IRZ A;  3HTJ A;  5HBU A;  3GTK J;  2E19 A;  1WH5 A;  1XC5 A;  3ZOB A;  2B63 J;  2DA3 A;  1OJL A;  4KWA A;  4GFK A;  5FKM A;  3BR6 A;  3HTA A;  3BTC A;  5FHP A;  4W97 A;  5EGO B;  3BCG A;  2HDD A;  4M6V A;  1MH3 A;  3AQS A;  1JT6 A;  1WCM J;  2WUI A;  1GV2 A;  3OIO A;  2K9N A;  2MW8 A;  1APL C;  2FD5 A;  2QCO A;  2ZCM A;  3ZQH A;  5D19 A;  3JRG A;  1DU0 A;  3QPL A;  2D6Y A;  4B1R A;  3HOW J;  3C2B A;  5HSZ A;  3WHC A;  2E1O A;  2HOS A;  2TRT A;  4XRS G;  2LLK A;  1ETQ A;  3NAR A;  3M4O J;  3ZQI A;  4XIC A;  1ENH A;  5FLM J;  1JGG A;  4BBS J;  5EZG A;  1OCP A;  3VW2 A;  5F1J A;  5M3F J;  3BJB A;  2ME6 A;  2EZI A;  1S7E A;  1LE8 B;  5FKO A;  3B81 A;  2DMN A;  5FJ8 J;  4GCL A;  3G7R A;  2IEK A;  4EEF G;  3HGY A;  2UXI A;  2FBQ A;  4DYC A;  2WV1 A;  1VF9 A;  2G7G A;  2IBD A;  1ETW A;  2ECB A;  4X1E A;  2JK3 A;  2HKU A;  2LFB A;  4L5E A;  3M3Y J;  1A5J A;  4Y52 J;  2R92 J;  3GZI A;  5JLW A;  3BR2 A;  5E3L A;  3LNQ A;  2HXO A;  2AO9 A;  3LSR A;  3GTO J;  3G56 A;  2OPT A;  1HLV A;  3VUQ A;  2FQ4 A;  4NDL A;  1JUP A;  2N8G A;  3KKD A;  3I4N J;  5EFY A;  3SJM A;  1I50 J;  1TWH J;  3S15 J;  4FE4 A;  2HOA A;  4BBR J;  2OI8 A;  1HF0 A;  2XGC A;  3COL A;  1TC3 C;  2VKE A;  3DEW A;  4D5C A;  1H88 C;  2O7T A;  1UG2 A;  2CU7 A;  3BQY A;  2HI3 A;  2EH3 A;  4B3A A;  2VI6 A;  1NK3 P;  3W6V A;  4A3M J;  4NN1 A;  2UXO A;  5EF6 A;  3CDL A;  3S16 J;  3JRF A;  3S2H J;  5GP9 A;  5EGO A;  4BXX J;  2LTP A;  5IPA A;  2EBI A;  5F0F A;  1FIA A;  2LK2 A;  3PPB A;  2XPV A;  3BR1 A;  2XB5 A;  2MGQ A;  3Q0W A;  2ZCX A;  3HDD A;  3VPR A;  1MBF A;  2LD5 A;  1POG A;  4DZJ A;  1K61 A;  3I4M J;  1FIP A;  2NP5 A;  5F04 A;  2CRG A;  3S5R A;  1A6I A;  2RAS A;  2LY9 A;  1U78 A;  2O7O A;  4QIW N;  1QRY A;  1TWA J;  3ZQF A;  5CW8 A;  5J1Y A;  3PO2 J;  3FKI J;  3TW6 A;  2R5Y B;  1LE8 A;  2ID6 A;  1H8A C;  1R9T J;  3O8G A;  4A3I J;  4AUX A;  2NVY J;  1JJ6 C;  4HNV A;  2QKO A;  2GEN A;  4DZP A;  2PMZ N;  4I76 A;  4A3K J;  5K7H A;  3IUV A;  5FKL A;  3BTI A;  3QBM A;  4JX6 A;  1ETY A;  1F36 A;  3OSG A;  3JRA A;  4A3D J;  3JR9 A;  4QTR A;  4YZE A;  2DN0 A;  1X2M A;  3O8H A;  3V6G A;  3BR5 A;  2HYT A;  3CJD A;  5DAJ A;  3H3V K;  3KZ9 A;  2M34 A;  1ETV A;  1XS9 A;  3ON2 A;  4FIS A;  4W1U A;  2Y9Z A;  2HXI A;  1ZGW A;  5IOZ A;  1GT0 C;  3NI7 A;  3HOV J;  4HKU A;  2IAI A;  2K9S A;  1LFU P;  2XDN A;  5K58 A;  2DJN A;  5IP7 J;  4IHV A;  1MH4 A;  2ZB9 A;  3RKQ A;  2F07 A;  2ZOY A;  5C4Y A;  5E3M A;  1W0T A;  4DW6 A;  1T33 A;  1H89 C;  5IYB J;  3MNL A;  2TCT A;  2NS7 A;  4AC6 A;  1TWF J;  2JA7 J;  1BA5 A;  2NOG A;  4AYB N;  1BL0 A;  2LP0 A;  1ORK A;  3JRE A;  2JA6 J;  3CWR A;  3GTM J;  1JTX A;  2D5V A;  2XSD C;  2M9H A;  3HOY J;  5HAW A;  4MFD A;  1U9N A;  3BTL A;  3NAU A;  1ETX A;  4MLO A;  1EF4 A;  3ZQC A;  5DS9 A;  1YRN A;  4V2F A;  3VP5 A;  2ELK A;  3ON4 A;  3S1N J;  1IUF A;  4I6Z A;  2LR8 A;  2EZL A;  3LWJ A;  3FK6 A;  1MBG A;  4A69 C;  3TP3 A;  3KKC A;  1U9O A;  2R5Y A;  4IEJ A;  4A3J J;  4JP0 A;  1TWC J;  1MBJ A;  3TP0 A;  3FIW A;  3HBL A;  5F27 A;  3TED A;  1UI5 A;  4Y7N J;  2LKX A;  1VFC A;  4GFL A;  3EGQ A;  2DMU A;  1WPK A;  2M2E A;  3FIS A;  1IDZ A;  2K9Q A;  3MN2 A;  2R0Q C;  4MXM A;  1MBE A;  2GUH A;  3G1L A;  3Q3S A;  1PUF B;  5M5X J;  2NVT J;  1B72 B;  5M5W J;  2XGE A;  2CUF A;  2QF7 A;  2H1K A;  3IH2 A;  3FK7 A;  1NTC A;  1F43 A;  3F1B A;  5IP9 J;  4FE7 A;  3UKG A;  2JJ7 A;  3JSJ A;  2K40 A;  5D18 A;  2VUM J;  4S0H B;  3JRI A;  4GFB A;  4ACI A;  1GV5 A;  5F08 A;  3GTL J;  2W48 A;  2HYJ A;  1JT0 A;  2JA5 J;  3FRQ A;  2NP3 A;  3BR0 A;  2M8G X;  5EDN A;  1QVU A;  4C3H J;  4M3G A;  2DG8 A;  1UI6 A;  4M3F A;  3JRD A;  2L7M P;  3T6N A;  2MG4 A;  1JKR C;  3GBG A;  2DMQ A;  1X58 A;  3QQA A;  2L9R A;  4PXI A;  1VI0 A;  4UUS B;  1E3O C;  1IC8 A;  3GTQ J;  2X48 A;  3DCF A;  3BR3 A;  3Q0V A;  4MIM A;  3OSF A;  3BHQ A;  3CQZ J;  1X2N A;  2ME0 A;  3LSP A;  3TW7 A;  4BY7 J;  3PO3 J;  5CXI A;  2Y9Y A;  4IHW A;  3HKZ N;  5FKN A;  3VW1 A;  3K2A A;  3NNR A;  5IP6 A;  4BY1 J;  2X6O A;  1YRN B;  1HCR A;  2GLO A;  2FX0 A;  3MVP A;  1ZQ3 P;  3VOK A;  3GEU A;  5EG0 B;  3AQT A;  2QWT A;  1SAN A;  3QPS A;  2DA2 A;  3JRH A;  1JUS A;  4G12 A;  3GTP J;  3CMY A;  3EUP A;  3BG9 A;  2VKV A;  3IH3 A;  4D7M A;  3RZD J;  1MBH A;  1OCT C;  4A93 J;  3PM1 A;  3E7Q A;  4D5F A;  1PUF A;  2Y2Z A;  2G0E A;  1B72 A;  3VIB A;  3L1P A;  4CYC B;  2XGD A;  4A3F J;  3MKL A;  1JUM A;  5AQC A;  5K7F A;  2YVE A;  4J19 A;  3HB9 A;  1AHD P;  3BG5 A;  3V78 A;  2CQX A;  3S17 J;  3S1Q J;  1I6H J;  2G7L A;  2W53 A;  3A02 A;  2CJJ A;  4IHY A;  2DMT A;  5IOY A;  2EQR A;  3K7A J;  3VW0 A;  3A01 B;  1GDT A;  3B6A A;  4RBO A;  2HOT A;  2R7Z J;  1BW6 A;  3Q0U A;  5EZH A;  2QIB A;  1AKH B;  5EEA A;  2E2I J;  3RQI A;  2XB0 X;  2ZOZ A;  1B8I B;  2VPR A;  2Q24 A;  3JRB A;  2OER A;  3ANP A;  3HGG A;  4C3J J;  1JKO C;  2UXH A;  5K7Z A;  5E3N A;  4JYK A;  2Y30 A;  3HOX J;  4JKZ A;  3S2D J;  3S1M J;  4UUS A;  1RR7 A;  2I10 A;  3HEF A;  2JN6 A;  5GPC A;  3DPJ A;  3NPI A;  1ZR4 A;  5BNG A;  3HE0 A;  5JLX A;  3CCY A;  5FLV A;  2L7Z A;  1FTT A;  1QVT A;  2DA1 A;  4A3E J;  3ZQL A;  9ANT A;  4L62 A;  2DTZ A;  4C2M J;  2GBY A;  1W0U A;  2KDZ A;  4QSH A;  1NK2 P;  5F0H A;  5EG0 A;  1DU6 A;  1GUU A;  2RHA A;  3A03 A;  1JKP C;  1HOM A;  1RKW A;  2V57 A;  1FTZ A;  2E2H J;  3RZO J;  2LVS A;  3LSG A;  3S1R J;  2JMW A;  4ABZ A;  5FKK A;  4GCT A;  4C3I J;  4AF5 A;  1Q1V A;  2CQQ A;  4JX5 A;  4ICH A;  2NX4 A;  1SFO J;  4ME9 A;  1ETK A;  1FEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...