4X1EA

Crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
199
structure length
199
Chain Sequence
b'RAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIAASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
publication title Ligand binding specificity of RutR, a member of the TetR family of transcription regulators in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o6:h1
molecule tags Transcription
total genus 75
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x1eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4x1eA02
3C07A 1XG1A 3FIWA 2KDZA 3GTLJ 5IYBJ 1BJZA 3G1LA 2M2EA 1PUFA 4M3BA 3I4MJ 4V2FA 2G7SA 2G7LA 2ME6A 2K9SA 3BR3A 3BCGA 1X2MA 2GFNA 5K7ZA 2X48A 3BNIA 3G56A 4A3IJ 3HOXJ 2CUEA 3GTMJ 2PZ9A 4FTHA 3LJLA 2NP3A 1HF0A 2LK2A 3Q0VA 4UUTA 2XSDC 1IDZA 2RHAA 1SANA 3OOUA 3A02A 4RBOA 3ANGA 3CRJA 4MFEA 3NI7A 2ECBA 4GFKA 3ZQLA 4XRMA 2EZHA 4MK6A 3BR1A 1MBJA 1UI6A 5E3NA 5FKMA 1POGA 2PBXA 2YUSA 3MKLA 3HDDA 3IH4A 2DA5A 1ZK8A 3S2DJ 2NVQJ 2MSYA 1A6IA 2DA3A 2IU5A 4BY7J 2EZKA 2R92J 3H0GJ 5FKKA 3M4OJ 5EG0B 4ACIA 5FKOA 4UUSA 3RH2A 3VIBA 1GT0C 2XGEA 3G7RA 1ORKA 2E2HJ 3T6NA 1WH7A 2AO9A 4GCTA 3BHQA 5CW8A 3PASA 1P7JA 1U9OA 1PUFB 2DA1A 3TEDA 2EZLA 5C4JJ 5J3LA 2QKOA 4FCYA 1ZR4A 1VF9A 2FBQA 2O7TA 3O8GA 2CRGA 5JLWA 1DU0A 3LSPA 5K7HA 4EEFG 4JNNA 4DZPA 1O4XA 1JJ8C 3VP5A 3B6AA 4Y52J 3ON2A 2Q24A 5EEAA 3G1MA 5FJ8J 3RD3A 2YS9A 3OSFA 2VKEA 5DS9A 2K9NA 2R7ZJ 2UXHA 5FLVA 5FKNA 3ZQHA 1BW6A 1R9TJ 5D1RA 4XRSG 4IEJA 5H9TA 2NOGA 2UXUA 1GV2A 2AHQA 4ABZA 1SFOJ 2E2IJ 3HM5A 2LY9A 2NVXJ 4UDSA 2QCOA 4M6VA 2YVHA 2XB0X 3HOWJ 1E3OC 2Y9ZA 4A93J 4X6AJ 1ETXA 4UUSB 3CDLA 2WUIA 3JRFA 2M34A 4BBRJ 3S1MJ 3LHQA 2HOAA 2H1KA 2VUMJ 1IC8A 2N8GA 3K7AJ 1XS9A 4HNVA 3SDGA 1TWAJ 2NS8A 3TP3A 1F43A 5M5WJ 1NK3P 5EZHA 1S7EA 1MBKA 1UMQA 2YVEA 1G2HA 3L1PA 4M3EA 3VW2A 4W1UA 3BR2A 3HE0A 5HAWA 1HLVA 2XB5A 3BG3A 2XDNA 4JYKA 3JRCA 3PM1A 4YZEA 4I6ZA 1DU6A 2L7MP 1NTCA 1XC5A 3GTJJ 1ZQ3P 1F36A 5EF6A 2HYTA 1Z77A 3UKGA 2JN6A 3ZQGA 2CJJA 1EF4A 3VPRA 2E2JJ 1OCTC 1X58A 4A3LJ 3K2AA 1U9NA 3FISA 1VFCA 2MG4A 3DCFA 3FK6A 3BTJA 2JA6J 3NARA 3D1NI 2I10A 3ZQCA 1GV5A 1MBEA 5IPAA 3CCYA 1VNDA 3JRDA 1VI0A 3KKCA 4B3AA 3C2BA 3IH3A 3ZQFA 3BR0A 3HEFA 3MN2A 4A3CJ 2P81A 1SGMA 5IOYA 1JKRC 3Q0WA 1BL0A 1JJ6C 1WGXA 2NS7A 4XICA 5C4XJ 4JP0A 1FTZA 1AKHA 3OSGA 1ETKA 2ME0A 3HB9A 1OJLA 1IG7A 3FRQA 3BR6A 1WI3A 2M8GX 3FKIJ 2XPWA 2COBA 2WV1A 3B6CA 5F0CA 3JRGA 2O8KA 5E3MA 1TWGJ 2NX4A 2B63J 3GEUA 1NK2P 2RAEA 5HSZA 1I3QJ 3HOUJ 5J1YA 4M3GA 3GBGA 2LP0A 5EDNA 5GP9A 3RZDJ 3CQZJ 1IRZA 5EGOB 2DA2A 1WPKA 4GCKA 5CXIA 5J1RA 4HKUA 4AUXA 2R93J 3HTJA 2NVYJ 4CYCA 2QWTA 4A3GJ 2VI6A 1ETQA 3Q3SA 1K83J 3S17J 2DA6A 5IP6A 4FISA 1FJLA 4Y7NJ 2WGBA 2LFBA 3WHCA 2L0KA 3HBLA 4AYBN 4X1EA 5C4YA 2CU7A 1Z0XA 3BRUA 4J19A 1I6HJ 2ID6A 3EGQA 1QPIA 4A3MJ 2OI8A 3PO2J 1AKHB 3PO3J 3LOCA 3KNWA 3BG9A 2R5YA 2ZOYA 4ME9A 4JL3A 4C2MJ 4A3BJ 1LE8B 2JK3A 1MH3A 2G0EA 3BTLA 3FK7A 1D5YA 1MH4A 2VPRA 5DTDA 1ETWA 1JTXA 2ID3A 3TP0A 3EUPA 3S5RA 2NP5A 5CXGA 2JA5J 2DA7A 1MBFA 2DN0A 4MLOA 1QVTA 2O7OA 2NVTJ 2DMUA 2Y31A 1B72A 3RZOJ 3NPIA 2XGDA 1UHSA 1P7IA 4JX5A 3HGGA 4CYCB 2ZCNA 2GENA 1AHDP 3HKZN 2R0QC 2JJ7A 2HDDA 3HOZJ 4IHYA 4A3FJ 1GVDA 5AQCA 3TW7A 4V2GA 5IP9J 4D7MA 1LFUP 4A3DJ 1JKOC 4NN1A 3BQYA 1JTYA 1TWCJ 2F07A 1T56A 2QTQA 3LWJA 4S0HB 2FJ1A 4XK4A 4JX4A 2JWTA 5FHPA 1JUPA 3VVYA 2X9DA 5EYRA 1T33A 5GPCA 3GTQJ 1FTTA 5BNGA 1RKWA 4MXMA 2HQ5A 5M3MJ 5C3EJ 2L9RA 2R5YB 2ZCXA 2CQQA 4BBSJ 1IV6A 3LSJA 5F04A 2RASA 3COLA 3I4NJ 1JUSA 2V57A 3VOKA 4D7NA 2UXOA 3CJDA 2EH3A 1TWHJ 5IYDJ 2XPVA 3BR5A 4QSHA 3JRHA 1U8BA 3NAUA 5E3OA 1Q1VA 1B72B 1IGNA 1MSEC 2LTPA 4D5CA 3P9TA 3E7LA 2GBYA 3HTAA 3DPJA 4CGRA 3CMYA 1ZKGA 2XRLA 1RPWA 1GDTA 3HGYA 4DYQA 1JT0A 4DW6A 5EGOA 4XRSA 2CQXA 3TW6A 2L7ZA 1JKPC 1H8AC 2DG8A 3MVPA 1UI5A 3HTHA 1YRNA 2H8RA 4RDUA 2IBDA 4L5EA 1I50J 5F08A 3RKQA 2ZOZA 2DMQA 2FD5A 5F0FA 3E7QA 3PPBA 4BY1J 2DTZA 5EZGA 2X6OA 9ANTA 2G3BA 2UXPA 1OFCX 1JGGA 2DJNA 5D19A 2XPUA 3GTKJ 2PMZN 2OPTA 1ZTRA 5DAJA 3S1QJ 4NELA 4L62A 5J1UA 5FLMJ 3GZIA 3ON4A 3IH2A 4NDLA 2WB1N 5M5YJ 3A01B 3BTIA 2O9LA 3HOYJ 1RETA 3ANPA 1LE8A 2Y9YA 5K58A 5D18A 2W48A 1HDDC 3AQSA 2Y2ZA 2QIBA 1JUMA 1ITYA 3VVZA 4DYRA 2Y0SN 1JT6A 1UG2A 3VOXA 2K9QA 3QPLA 2M9HA 1H89C 2QF7A 1IUFA 4G12A 3JRIA 1OCPA 1HOMA 2HI3A 3F1BA 4AF5A 4IHWA 1YRNB 3HIMA 2G7GA 1JKQC 3CWRA 1QRYA 3JRBA 3VW1A 2JA7J 2TCTA 3BG5A 3F0CA 1APLC 2WAQN 3V78A 2CUFA 2GUHA 1FIPA 5GPAA 2Y30A 2E1OA 3RQIA 4IHXA 2HYJA 3JSJA 4QTRA 1TC3C 2QOPA 4FE4A 1ENHA 3NNRA 1Y1VJ 1WH5A 2OF7A 2DA4A 2D5VA 4JX6A 3QQAA 3NRGA 1W0UA 5FKLA 3GTGJ 2JMWA 3S16J 3JRAA 1U78A 3MNLA 1IDYA 1ETVA 1MBGA 2IAIA 2LVSA 2LLKA 4MFDA 3QKXA 1FIAA 5EFYA 4ICHA 1W0TA 3BTCA 2XGCA 4M3FA 1MBHA 3OIOA 4LOCA 4GCLA 1ETYA 2JA8J 4FE7A 2VKVA 3BJBA 2LD5A 3VW0A 1X2NA 2DMNA 2EBIA 2L7FP 3LSRA 5FMPA 4A69C 4AC0A 3Q0UA 3W6VA 4AC6A 3SFIA 3WHBA 1HCRA 1B8IA 1RKTA 1K61A 4JKZA 4C3JJ 2D6YA 5HBUA 3ZQIA 3O60A 4MIMA 3GTPJ 3A03A 5K7FA 3S15J 5F1JA 2HOTA 1A5JA 1WCMJ 4DYCA 2HXOA 1BW5A 2EZIA 4DZJA 1CQTA 2ZCMA 1GUUA 1MSFC 3S2HJ 3JR9A 4M3DA 2TRTA 2HXIA 4I76A 5M3FJ 4A3KJ 1MNMC 3S1NJ 2DMPA 1RESA 3G1OA 3HOVJ 3AQTA 2FX0A 3SJMA 3H3VK 2LKXA 4C3HJ 3JREA 4BKXA 3A01A 1ZGWA 5F27A 3BQZA 5IOZA 4MO7A 5C44J 1QVUA 5E3LA 3KKDA 2LR8A 2UXIA 3GTOJ 1H88C 2OERA 3VVXA 4B1RA 2MW8A 4C3IJ 2ECCA 2ELKA 3B81A 5F0HA 1B8IB 2R5ZA 2KT0A 2K40A 2HOSA 1RR7A 5IYCJ 4KWAA 4GFLA 3S1RJ 4PXIA 2EQRA 3IUVA 2HKUA 4W97A 2ZB9A 3M3YJ 2REKA 1AU7A 2DMTA 3DEWA 2FQ4A 4D5FA 5JLXA 5FGLA 3BT9A 3VUQA 3LNQA 3ZOBA 2W53A 5HODA 2IEKA 3HTIA 4QIWN 5M5XJ 3QBMA 3NXCA 1Y1WJ 1FEXA 5IP7J 1LFBA 1HDPA 2GLOA 3KZ9A 3QPSA 1BA5A 3O8HA 2YU9J 4GFBA 2MGQA 3V6GA 2M0CA 2GM4A 3S14J 4XIDA 2E19A 3IV5A 4IHVA 2DG7A 4B4CA 5EG0A 2R5ZB 4A3EJ 4A3JJ 1ZR2A 1ETOA 1IJWC 1TWFJ 3LSGA 4BXXJ
chains in the Genus database with same CATH superfamily
3C07A 3OYNA 3FIWA 2KDZA 3HOSA 3GTLJ 4KT6A 3JSOA 4IQJA 1T6SA 2K3FA 3C2GA 1PYVA 3G1LA 4HNTA 4ZDOA 4M3BA 4V2FA 1YYVA 1WQ2A 2BHYA 2ISZA 2ZJPF 1LEAA 2FF4A 1R4MB 2CUEA 2IPQX 3H0DA 3S3OA 2OQGA 3ABTA 2X4HA 4UUTA 4S05A 2RHAA 1SANA 4GYGA 4RBOA 2R7RA 1Z1DA 4GFKA 3TQNA 4XRMA 2IA0A 2X0LA 1YO5C 3BR1A 3K1MA 3WTYC 1UI6A 5J8FA 2NNNA 1BC8C 3RKYA 3IH4A 4HLYA 3LAPA 1A6IA 1QZEA 2QZ8A 2BVLA 1YG2A 2WADA 4BY7J 2EZKA 2R92J 3V42A 2DPDA 2B7EA 5FD6A 5FKOA 3VIBA 3E6BA 1U8RA 2CUZA 1GT0C 2XGEA 3J7ZI 3G7RA 2E2HJ 3CCUI 4JQFA 2IGKA 3ABMH 4A0YA 1A35A 2X6WA 3PASA 1WJBA 1D3YA 3KCCA 4EGZA 1DP3A 1OKRA 5C4JJ 4XRFA 3CCVI 5J3LA 3EQLF 4G9YA 2QKOA 2JT1A 1MJBA 2O7TA 4AYBA 1O3TA 1J9IA 3LSPA 2XROA 3HXLA 2IS4A 1JJ8C 1SAUA 3DF8A 1YI2I 1AOYA 1TNSA 2DFHA 5HOOA 3OS2A 2CV2A 4Y3OA 2L54A 2CO5A 3ZQHA 1R9TJ 4XRSG 4A5NA 1IXRC 3H1CA 2DDAA 1PUEE 4RAYA 2NOGA 2OCCH 4IF4A 1GV2A 2UXUA 4I98B 1E3HA 4DBRA 4GCVA 2E2IJ 3J80K 1FMWA 4XLPF 2I5UA 2NVXJ 4HF1A 2X1CA 2XUBA 1SAXA 4A93J 2LYCA 3KYLA 3BWGA 4ASNA 3WTWC 2WUIA 2M34A 1B59A 2A05A 1UB9A 2UXXA 3C1DA 2EINH 1VQLI 1G3TA 1T0FA 3FXKA 3KP6A 3QU6A 3SDGA 1TWAJ 2NS8A 5B5EC 3S3MA 3M07A 4E70A 4BQNA 3L2VA 5M5WJ 3GW2A 1G59A 1MBKA 2QVOA 1UMQA 3KIOA 3L1PA 1LJ9A 1I39A 4XLFA 2XRNA 2YR2A 4CCKA 5HAWA 4AVPA 2RKHA 3JRCA 3PM1A 4YZEA 2HR3A 3J80Z 4I6ZA 2HWVA 4BNCA 2DDBA 3GTJJ 4HSRA 1G3SA 1F36A 2HYTA 2RV8A 1Z77A 4PJNA 2JN6A 3UKGA 4BAYA 3ASOH 1ZELA 2DYRH 1VQNI 4PFPA 3QODA 3VPRA 1EF4A 1SD4A 2Z3YA 1X58A 2DOAA 3GX4X 1R5ID 5CVJA 3TGNA 5DV5A 3VODA 4EM1A 2A5YB 4RB3C 1X19A 3NARA 3D1NI 2I10A 5B66C 4L9TA 1AWCA 1VNDA 2AXLA 1FNNA 1BBYA 3TO6A 3JRDA 2CQKA 5L3BA 4UHTA 4ANJA 3ZQFA 4F7ZA 2KPMA 3HEFA 1WSUA 4A3CJ 2IP2A 1RUNA 4ZZDA 1WGXA 4JP0A 2D45A 1ETKA 1S6LA 1H0MA 2H6CA 5D5VB 1T8IA 4D9JA 3N4MA 5KAFC 3DEEA 2COBA 4XL9A 1EA3A 4Y4RA 1K6YA 1TWGJ 4J00A 1W7PD 1D1CA 1NK2P 2RAEA 3CCQI 3GEUA 1I3QJ 4BEHA 1ZG3A 5J1YA 4ENKA 4KISA 3BJOA 5D5UB 4E7KA 4GCKA 3OR2C 4RB2C 1NHAA 4HKUA 2KMUA 2QWTA 1ETQA 4ZJZA 2ESNA 4FISA 4I09A 1W7PA 2JUGA 2Z99A 3FBNB 2WGBA 2ELHA 2LFBA 3FF5A 2V1DA 3HTSB 1KZHA 5C4YA 3I64A 1W36C 1VQ5I 4OD5A 1G6NA 1G3WA 2DK5A 3EDPA 4YELA 5B1BH 3V7CA 2EV0A 2PQ8A 3EGQA 1QPIA 3GEZA 4A3MJ 3IWZA 4U7DA 1M1EB 1RC9A 4E7IA 2DFIA 1DQUA 3LOCA 3BG9A 5D6FA 1J75A 3FXOA 4ME9A 4JL3A 4OU0A 4FHTA 1MH3A 1IZ1A 2VBXA 3BTLA 5EJCA 2M3AA 1R6RA 3FK7A 1FPQA 4P1WA 1XX5A 3WE2A 1HXDA 2L2OA 5DTDA 5CPRB 1J59A 1JTXA 2VB6A 3EUPA 2G9WA 2P7VB 2KKOA 3E5QA 3I54A 2DA7A 2DN0A 4MLOA 2KFDA 2O7OA 1B6AA 1XCVA 3F8MA 1E3PA 2GA1A 3HKZN 3GFMA 2JJ7A 1O3QA 2VJIA 5AQCA 1W7PB 3TW7A 3CMEI 4A3DJ 2M7AA 2ZBKA 2HKOA 5EEHA 2DXIA 4RGXA 2P4WA 3BQYA 3REOA 5LGNA 1OR7A 1T08B 3OYKA 2JSPA 4S0HB 1ONVA 1FYLA 4R8HA 5FRNA 5GPCA 3RSNA 4BXFA 5L3GA 1FTTA 2XAGA 5C3EJ 5M3MJ 3S32A 6PAXA 2L9RA 1YOVB 2NNYA 1YS6A 2P5VA 5FD5A 4LFUA 2CQQA 3E6CC 4IRVA 4RB0A 1IF1A 3A0BC 4UVBA 2L9NA 2O3FA 3WTUC 1VQOI 2WBMA 4XONA 5J4VA 3I4NJ 4D7NA 2RN7A 2E1CA 2MABA 2BGCA 3B73A 3CJDA 2BY0A 1ZG1A 5IYDJ 1MMSA 3JRHA 3I4PA 2EIKH 4BQOA 1XDUA 3I55I 3P9TA 3GCMA 2LTPA 4D5CA 2MBFA 3WGIA 5EEGA 4AM3A 2RDPA 1VQ8I 1D8JA 4Q5SF 1FX7A 4G6DA 3DPJA 4CGRA 2XRLA 1BR2A 1IW7F 1QQIA 4ZDPA 3TW6A 2L7ZA 3BPXA 1QO0D 1GHCA 2DG8A 2ESHA 1UI5A 2UWMA 3HTHA 5KHDA 3BJAA 4DNCA 4IJAA 2IBDA 3KETA 4XORA 5F08A 3RKQA 1ON2A 4OINF 2Z9OA 1UHWA 3E7QA 2EV6A 4RAFA 4L18B 5EZGA 2D1VA 4FT8A 2VQLA 2YPRA 3GTKJ 1OCZH 2PMZN 4XKWA 4ZYGA 2OPTA 4RS8A 3S1QJ 3QPHA 2FA5A 2Y69H 2QM3A 3WODF 5FLMJ 1LNWA 4GGGA 3ON4A 2CW8A 3CUQA 4D1QA 5M5YJ 3A01B 1RETA 3ANPA 3KLNA 5H6RA 1IXCA 1O7FA 5J6XA 3OYLA 3BLYA 1MKMA 4G7OF 4P55A 1BJAA 1CF7A 1ITYA 1SD6A 1JT6A 2BE5F 3OY9A 2VOOA 2HQRA 1P92A 5TJJA 1H89C 2VT3A 4KA4A 2A61A 2VJJA 4HPQA 4AF5A 1S72I 3CESA 4IHWA 2ZSIB 2X1EA 1JHHA 2G7GA 3ZP5A 3JRBA 2JA7J 3BG5A 4YFKF 3CF5F 2CWEA 2WAQN 4HV6A 3CMAI 2CUFA 4XNFA 1I1SA 2XVCA 4BHPA 2E1OA 2BBYA 2HYJA 2P7CB 5K1YA 2FRHA 4FE4A 1UZCA 1JE8A 4L0YB 2EFPA 1ENHA 4GXOA 1WH5A 3ESWB 2MC3A 3CUQB 4LLGF 2GQQA 2IS2A 3S16J 4HW0A 2JMWA 3I56I 4IZZA 5BS6A 4KN7X 3LMMA 4K2EA 4E7HA 3VYSB 2JVGA 2D1HA 2HGCA 5EFYA 4U0VA 1XGOA 3BTCA 5E1WA 1HSTA 1MD0A 2XGCA 4M3FA 2NOJB 2B1EA 1A6QA 2JA8J 4FE7A 3WU0A 3PNVA 2PLYA 3BJBA 1S8NA 4A6DA 1LDDA 2EBIA 2L7FP 2LD5A 2ELJA 1KQ9A 2R4GA 4AC0A 2BVMA 4AC6A 1JHFA 2DOEA 1VQMI 1HCRA 1V55H 5H20A 1LDJA 1LDKB 4TV7A 3CCJI 4P9UA 1XN7A 2QA4I 1ZAOA 4LLLA 3QAHA 1A5JA 2V7FA 2HXOA 3EYYA 2B0LA 2QWWA 4XMYA 2BW3A 2IGOA 2KZVA 5E18F 3L09A 2IRFG 3TO9A 5JHFA 3JR9A 4M3DA 4F91B 1U3EM 3ZMVA 4I76A 4UB6C 3WE3A 1IO2A 2DMPA 3AG3H 1RESA 4OIQF 1USTA 1BI1A 1REPC 4G7HF 2L7KA 1TT0A 4BKXA 4KIFA 5J4YA 1ZGWA 4UY8I 1XGMA 4MO7A 1TQIA 5HLHA 3DLAA 1XB4A 4YFNF 2DYSH 3QWLA 4A12A 1MMGA 2PG4A 2DPUA 1MNEA 2B3WA 4B1RA 4IRHA 5JR3A 4ENNA 2VN2A 3B81A 2R5ZA 5DYMA 1X3ZB 2PMHA 4GFLA 2K27A 1EH8A 3CC4I 3HOTA 4HF2A 3PNTA 2XAQA 4AIHA 2NS0A 2ZB9A 3M3YJ 1MJAA 3HHGA 3QYEA 2BW3B 3CF2A 2YVXA 2R7UA 2V1XA 3FMSA 1Y8RB 3MKWB 3GFLA 3X2QH 4D5FA 4BE0A 4PK4A 3RI4A 1TLHB 3QRFF 2O5RA 5BPDA 1R58A 3R6SA 4CUGA 2RC4A 4IRGA 3MZHA 3ZRGA 1HBXG 2IGMA 3G73A 4M9XA 4QIWN 1KU2A 3QBMA 2HYGD 5IP7J 2EFQA 3QPSA 2GXBA 4XN0A 2KDOA 1DPUA 3R4KA 3O8HA 2H8WA 2F5EA 2F6CA 2OA4A 1KA8A 3HPHA 3S14J 3FKJA 1MMDA 2DAOA 4XN3A 4XIDA 4BQAA 2VE9A 2R5ZB 4A3JJ 3DXJF 1P4AA 3HSRA 5ILUA 1XG1A 1Z67A 2TDXA 2QQ9A 2L9SA 4PJJA 4A0ZA 5DCMA 2O61A 2M87A 3GXOA 1KU9A 3I4MJ 4CCOA 3EYIA 3DKWA 2ME6A 2K9SA 3V8LA 2R7QA 1D1AA 1FC3A 3PFIA 3OYIA 4R79A 3FX3A 2QSHX 1HF0A 2XSDC 1IDZA 3FXRA 5LLQA 3I3LA 3CRJA 5FGMA 4MFEA 1STZA 5F6FA 5GADJ 1F4KA 3LSHA 2EZHA 4WCGA 1YW8A 3Q9VA 3V8JA 2MYSA 2VXDA 1MBJA 2P5LC 5E3NA 1J09A 5FKMA 3N05A 2PBXA 1X1DA 4B43A 1SC7A 1ZK8A 3JAMK 2DI3A 2MSYA 4NBQA 1QHGA 2DA3A 1E2XA 3M4OJ 3H0GJ 2CFOA 3K69A 1P4XA 2JPBA 2V9KA 4BYYA 4ACIA 3MWMA 1FOYA 3GZ5A 2QGUA 4WX9A 1QA6A 4CSWA 5LFAA 3BHQA 1SVLA 5DCMB 3MEXA 4IQ4A 2ZJQF 4RAZA 3TEDA 3PUFA 3F8NA 1YX5A 2PBIA 1VF9A 1FP2A 3FXMA 3O8GA 2KIFA 4UNOA 3ZMUA 5K7HA 1AA7A 4I0BA 2UUZA 3OYHA 4Y52J 2IA2A 1QPMA 2Q24A 2G7HA 4L0ZB 5FJ8J 1XMAA 2PFBA 3JAMZ 5LRSA 3GLLA 2K9NA 3D5SC 5DS9A 2UXHA 3K2ZA 2JPCA 5FKNA 1BW6A 1VQ7I 4IEJA 5H9TA 4FQGA 1X1CA 5HLGA 2PJPA 4HQEA 3CDHA 4KMFA 2HFHA 5CJ9A 3KEOA 4UDSA 2P8TA 4PDKA 5F1RA 1E3OC 5FFXA 5DM7F 2IW5A 4X0GA 4X6AJ 2YX7A 3E5UA 1VQ9I 2P6TA 2ZKZA 3QP5A 4IOCF 3LHQA 2LF8A 2HOAA 2H1KA 3V4GA 4WXCA 1IC8A 2FUG2 1XS9A 3K7AJ 4IHTA 3KX2A 1RI7A 2EPFA 3W3CA 2EIJH 3E3VA 3OL3A 5EZHA 5TRDA 3G4SI 5HDKA 3TOAA 3COAC 2YVEA 4ENJA 4M3EA 2ZXIA 3M9AA 3BC8A 4V19K 1WZ2A 2XB5A 2ZY9A 3I5UA 1B4AA 2XDNA 4JYKA 1KQ0A 1TW3A 4B8XA 3J7AO 1SVOA 3HRUA 1EH6A 2VT2A 3ECHA 1K6OA 3VSLA 5EF6A 1T2KA 3U21A 2RGVA 3ZQGA 3GO5A 5CQEA 3CDIA 1OCTC 2QEXI 2W57A 2HKXA 4CXFA 1MMNA 3DCFA 3IAM2 2RREA 4XSXF 3H5AA 3VSKA 4BUPA 4FX0A 4XKCA 3ZQCA 1GV5A 5IPAA 2H1LA 2Q0OA 3CCYA 4XM3A 4G94A 1XSXA 2KQRA 3KKCA 2VC0A 3C2BA 4ON0A 1P9QC 3GF2A 4RM3A 3ZMZA 4B3XA 1G4DA 3MN2A 1C0WA 2P81A 1LVKA 1O3SA 1ZLJA 4G6TB 4IL6C 2DO7A 3VFZA 1YJ9I 1FTZA 3AG1H 2ME0A 3AL0C 4P96A 2OU2A 1OJLA 3JTGA 4AWXB 1Y6IA 1WI3A 3FRQA 3KLOA 3K4KA 4QLCU 3F8BA 5IY5H 3HC7A 4PGHA 3TL4X 3DP7A 1W5CC 1HC8A 4E7JA 5F0CA 3LSTA 3JRGA 2O8KA 5E3MA 2NX4A 2EFOA 1IN6A 2BY2A 3ZGKA 1LFPA 1H9GA 3OMYA 3RZDJ 3LWFA 1IRZA 5EGOB 2D2WA 2KRFA 4ZTFA 5J1RA 4AUXA 4LB6B 1R7JA 2PN6A 1FOWA 1W1WE 2ZMEA 4CYCA 1UG0A 2FOKA 4IX7A 1PP8F 2M30A 3S17J 2DA6A 4MNUA 3F23A 4Y7NJ 3GMEA 3WHCA 2DCEA 4CCLA 4DJAA 3HBLA 3GLXA 4AYBN 3MFKA 1OCCH 1TT5B 2CU7A 5L3CA 2Y0SA 4E4HA 3BRUA 4J19A 1LPQA 1XSVA 2DODA 4FETA 5DCFA 5D6EA 1OCOH 4EV0A 3PO3J 4LG3A 5CKTA 2ZOYA 2W1OA 2H94A 1YHQI 1WWXA 3K70C 2DQLA 1JGSA 3HTUA 4DQ2A 2HDCA 4M72A 3ABLH 3RYRA 5D8LB 4ZYHA 1D5YA 4KYWA 3BOQA 3VYRB 1ETWA 3TP0A 1PJRA 4HX8A 1OYIA 4HF0A 1T38A 2NP5A 3BDDA 1MBFA 4HDUA 1FOKA 5KVRA 2Y31A 3RZOJ 2XGDA 1P7IA 4BACA 4CYCB 2ZMEB 1Y8QB 2E35A 4N9IA 1AHDP 1ZGJA 4RGSA 4ZTJA 4D7MA 1L0OC 4HDVA 2F07A 1T56A 4YIIA 2L4MA 3LWJA 3OV8A 2BEOA 1UCRA 4JX4A 2JWTA 4XK4A 2W84A 3CLQA 4IO9F 1RR8C 4MXMA 2HQ5A 1BC7C 4PFOA 4BBSJ 1QZZA 1F9NA 3SZGA 2E1MC 3TDUC 3LSJA 5BQTA 4PSXA 2RASA 4A6EA 4ZZLA 1JUSA 2V57A 4MTEA 2FMYA 3H35A 2UXOA 2V9PA 4C30A 3BR5A 2P0WA 5HS8A 4QSHA 1FMVA 3IL2A 3HRMA 3NAUA 1IGNA 3E97A 4HNUA 3HIFA 1TP4A 1Z7UA 3DLLF 3HTAA 4YIFA 2XF5A 2R7SA 3CP8A 3WTTC 1RPWA 2HPMA 4ESBA 4GO1A 1JT0A 2VODA 4DW6A 3OYFA 3W6JB 3W2WA 4EVIA 1Q1HA 2B9SA 1H8AC 5LGUA 5AIQA 1WJAA 1R00A 3F8CA 4F55A 3PFYA 2K86A 4BQQA 5CYVA 4FASD 2UZKA 1FLIA 5AIPA 5DD4A 2FU4A 1KYZA 4JBAA 4UB8C 3S2WA 5HNHA 2QENA 4BY1J 1DGRM 5D19A 1TW2A 5FROA 2EK5A 2KZGA 2OCEA 2JSCA 5KAIC 1WJEA 2CMPA 4L62A 1SMYF 3BCAA 3JCUC 3CMMA 4NDLA 4ZYEA 1YE9A 1YIOA 3IUOA 3VYUB 5H6QA 4WXHA 4AIKA 2W48A 2MH2A 4B09A 4I01A 2QIBA 3J81K 2W24A 1UHMA 5JI6A 2EFNA 2DLLA 2V1NA 4Y15A 2VIXA 1R23A 3FM3A 1D0ZA 1BI2A 3A4CA 2HI3A 3F1BA 1MNDA 2M4KA 3IWFA 2JA2A 1JKQC 1X1PA 2L9VA 4II3A 3GFJA 4BL0B 2TCTA 3F0CA 1F1ZA 1YX3A 3OR1C 4BJTA 2CQ7A 2JRMA 2R7OA 3TOBA 3Q9SA 2GUHA 3RPQA 2Y30A 3KE2A 5CLSA 5E8IA 3RQIA 2WV0A 4HX7A 3K4CA 4LD5A 1TC3C 3RCOA 5KNLA 3U1DA 2L01A 3QU3A 4PUSA 5D4RA 2DTRA 5DUKA 2D5VA 3HYIA 3J81Z 2IGNA 2XV4S 5FKLA 3IHUA 4KICA 3JRAA 4H4KC 1IDYA 1R1VA 1MBGA 1ETVA 3ERMA 3ROUA 1P6RA 1VTNC 3CC7I 4KFCA 3ZMSA 4L9NA 2Z2SB 4N4NB 1PVEA 4ICHA 2FXAA 4U87A 3L2QA 5ICGA 4GCLA 1ETYA 1SVMA 2VKVA 2AXTC 2GXGA 2BZTA 1X2NA 4C9YA 1A04A 1X1AA 1YTYA 3H9GA 3R0AA 4N0BA 1Y0NA 4CZZA 1ZG5A 4O6JA 1LQ1A 3HRSA 4C2UA 1K61A 3TDZC 3BZCA 5HBUA 2D6YA 1IN7A 3O60A 4MIMA 4CH7A 3GTPJ 2DU9A 2M5WA 4F3QA 2ZJRF 1Z6TA 4XBFA 4DYCA 1IAWA 2BY1A 3H9JA 1BOBA 1KYWA 5BPIA 1RUOA 1K4SA 2OZUA 1JXSA 3TKYA 3AAFA 3S2HJ 2CH0A 4NB5A 1SFUA 5E1XA 5M3FJ 1Z3YA 3SFZA 3B02A 4GRIA 3G1OA 2JQ7A 4BS9A 3AQTA 2FX0A 3L2WA 2DT7B 1J7KA 2XAHA 4HZFA 4CO8A 3H3VK 3A01A 3UNGC 5F27A 1QHHD 3E5XA 5IOZA 4U0WA 1QVUA 1ZH5A 3KKDA 2LR8A 2H09A 1K4TA 2VC1A 4NQWA 2OERA 3T1BA 3H5NA 3BROA 3C3WA 3VVXA 1U5TC 2FSWA 1S9HA 2MLGA 2HYFA 2MLKA 3L2UA 2KT0A 3LQQA 2K40A 3VB2A 2HOSA 3S1RJ 5J47A 4PXIA 4M6YA 1WJCA 3BZKA 3OYAA 3CJRB 4W97A 2FJI1 2REKA 4AIDA 3J7AY 3O3KA 2DMTA 3DEWA 4XKBA 2FQ4A 5JLXA 2E34A 3SDBA 5FGLA 3BT9A 4HYEA 3VUQA 5DM6F 3ZXSA 5E1ZB 5E20A 1G3YA 3R61A 4KMUX 3WGHA 2IEKA 4XKVA 3HTIA 5M5XJ 2LMDA 5K5OA 2OTJI 2HQAA 1FEXA 1LFBA 2KRHA 1TTYA 2QQ8A 3KZ9A 4C2TA 2V6CA 3LA3A 3E6MA 4NQWB 3M8JA 3MZYA 4RLQA 1ODDA 1GXQA 4B48A 1ACIA 2VQCA 2E19A 2NYXA 4A3EJ 3I58A 3DKXA 1TWFJ 2Y0MA 3M8FA 5FO5A 4BXXJ 2QKLB 3ASNH 1BJZA 4KIBA 1PUFA 3OIQA 3LSKA 1R1UA 4KJZA 4BHCA 1MJ9A 2G7SA 2G7LA 1FWZA 1X2MA 2GFNA 5K7ZA 2X48A 2XF7A 4YFXF 3BNIA 4A3IJ 3G56A 3G71I 3GTMJ 3CCSI 1EV7A 4F52A 3LJLA 3FXQA 2OTLI 2JUCA 2GXAA 2LK2A 3ZMTA 5HLTA 2WTEA 3MKZA 1ON1A 3OOUA 3A02A 2KJBA 3W2VA 3ANGA 3K1NA 2ECBA 3ZQLA 4OMZA 2ISYA 4BH9A 3OIPA 5B1AH 4MK6A 2M0MA 3VOEA 2LH9A 2DA5A 3H92A 4EMSA 2NVQJ 2LBFB 2QYOA 3OYMA 5D4SA 3C7JA 2LKPA 5GAEJ 2ZFWA 2IU5A 5FKKA 1QNTA 4M9SA 4UUSA 1A36A 1ZRFA 3LAJA 3V8KA 1T95A 4XOPA 1ORKA 1Z91A 2K3PA 3RYPA 1HKSA 3IRQA 1W36D 5ICEA 2GWRA 1U9OA 1PUFB 2DA1A 4EJVA 2EZLA 4FCYA 2FBQA 1X1BA 3IKVA 5DEQA 1Z7LA 4J01A 1DU0A 4L5JA 4L9VA 4JNNA 2ICWG 3VP5A 4A0XA 5LHIA 3OS1A 3OOPA 3C18A 1OCRH 3G1MA 5EEAA 1L3LA 2QUFA 3KZYA 2LNBA 3OSFA 2VKEA 3DPUA 2R7ZJ 5FLVA 1YFHA 2IS1A 4PCQA 4FX4A 1YW9A 1XMKA 3M1EA 2AHQA 4G7ZF 2JRTA 2M4GA 1SFOJ 5HLIA 3K8PC 3T8RA 2LY9A 2QCOA 2Z1DA 4O3MA 2BYVE 4F92B 1MW7A 2Y9ZA 5DDGA 1DUXC 4UUSB 3P7NA 3JRFA 2FE3A 4M73A 1XD7A 2LC2A 3DBLB 3SEQA 2VUMJ 2GIZA 1ZRDA 2N8GA 1QGPA 3FMQA 1YITI 3TP3A 3L2CA 3QYFA 4WF2A 1NK3P 2IT0A 3VW2A 2JZYA 5D5XB 3BG3A 2IS6A 5B3SH 3HSEA 2LY2A 2GA2A 2L7MP 3K1PA 4JOMA 2HDWA 1ZQ3P 3L00A 3I71A 2Q2EA 3N97A 2V4JC 3KP4A 3WU2C 1XMXA 4A3LJ 3K2AA 1WJ5A 3FISA 3CJQB 3RKXA 3ZMDA 3ZQ7A 2JA6J 3GWZA 3EETA 5GTHC 1W4MA 4BJ6C 2LY1A 4RGRA 3DTEA 3CD6I 2WY8Q 3BPVA 5DD8A 4GDFA 3AFHA 3MCZA 2W25A 3OWTA 2KJCA 1SGMA 3RIRA 2HS5A 5IOYA 3OYEA 4DVYP 3Q0WA 1U5TA 4G8XA 1JJ6C 2NS7A 3AKZA 2A07F 5C4XJ 1AKHA 3HB9A 1KGSA 4M9ZA 4RA2A 4NHJA 3WTXC 2K5CA 1OQYA 5GAHJ 4UV9A 4Q48A 3VTIA 3WTVC 5ILSA 2X6YA 4PGGA 3CO7C 2ZJ2A 2X1DA 3HOUJ 2Q2EB 3GBGA 2LP0A 5EDNA 1OPCA 1OYWA 4ESFA 2VL8A 2DA2A 5CXIA 3HTJA 2WB1A 2Y75A 5HNFA 3NQOA 1K83J 3HL2A 5IP6A 4KUMA 5FB2A 1ZARA 4LGWA 2QLZA 2E36A 2XHKA 3KP2A 4X1EA 2F4MB 2W82A 3CJTB 1HSJA 4XLNF 1Z0XA 3KYCB 1UAAA 1I6HJ 1WVRA 2L3DA 3SYTA 1RZ4A 1V3FA 1U5TB 2XF6A 3S93A 2OI8A 4UV8A 1AKHB 1HA8A 3KEQA 2MD0A 3KNWA 2DFFA 2HVSA 2GZWA 2JK3A 4ZYDA 1LE8B 2J5OA 2G0EA 1JI8A 1KQ8A 2VPRA 3F6VA 1ZLKA 1WFXA 2KHMA 3S5RA 3CLOA 2JA5J 2NAZA 2FQ3A 3ELKA 3LFUA 3DPTA 2NVTJ 3NPIA 2EIMH 3FM5A 1UHSA 3HGGA 1T0FC 1Z05A 4OAZA 3G3ZA 2GENA 2ZSHB 3DU5A 2R0QC 1Z9CA 4DOZA 4IHYA 1GVDA 4EJTA 2LDUA 3GYHX 5IP9J 2HZDA 5ILVA 4NN1A 2OV7A 1TWCJ 2QTQA 4U0YA 2PMUA 5LHGA 5FHPA 1JUPA 3DU6A 2DT6A 1YW7A 2X9DA 5EYRA 1T39A 3GTQJ 4MHGA 1RKWA 3CO6C 1HKTA 3LL7A 2DJIA 1IRXA 3P9IA 1XCBA 4ZH4F 4HEA2 5D5WB 4CDGA 2R7WA 2Z16A 4MTDA 4RMNA 2CG4A 1D0XA 1Z21A 3PNYA 5LGTA 3L9FA 3F8FA 2XPVA 1LEBA 1OMIA 5HS9A 5ICFA 3H5RA 2V6EA 1U8BA 3MD2A 4N4OB 4HRIA 1B9MA 5E3OA 2BXZA 4G6QA 3TO7A 2QBYB 3E7LA 5CQGA 2GBYA 1UELB 1OYYA 2IA1A 2XGXA 3F6OA 1NG7A 4I0AA 2BHZA 3HGYA 3T5XA 4DYQA 5H2FC 3ONQA 3R0JA 1X4OA 4EJOA 3HJEA 2CQXA 5EGOA 3QPTA 4NC7A 1V4RA 5IT9K 3O2PE 1Y0UA 1XSDA 2VOPA 1YRNA 2H8RA 2MC4A 4RDUA 3KZIC 1F5TA 1I50J 3KPHA 2DMQA 2FD5A 1V54H 3UR3C 4U88A 1TZLA 3OYCA 2IXSA 3M1CA 2UXPA 2DJNA 1FBQA 4ITVA 4II2A 2NVUB 1ZTRA 3E0JB 3F72A 4H0EA 1O3RA 3R60A 4U9LA 5DAJA 5K5QA 3I9V2 1B9NA 3GZIA 4ESJA 4BDYA 2K4BA 3IH2A 3OL4A 3HSFA 3HOYJ 2CQNA 2FBHA 5JHUA 1K78B 1FYKA 3DBRB 3TBIA 5K58A 2XAUA 1D8KA 1BI0A 3G6EI 1RRJA 1HDDC 4CGZA 3AQSA 2K9MA 4OIPF 1JUMA 3VVZA 3JSPA 1VQPI 2Y0SN 5IT9Z 1UG2A 2K9QA 2XKPA 1DGWY 3QPLA 2M9HA 3BCBA 4P5OA 2QF7A 2V1UA 1IUFA 3JRIA 2R7DA 3PQKA 1SEUA 1YRNB 3CWRA 2IVMA 1RIOH 3T0YA 4O5VA 2GAUA 2DQRA 2M1BA 1APLC 2KLOA 2R7FA 3V78A 3D0SA 4EM2A 1FIPA 2LRDA 4KNYA 3DFGA 2OZ6A 1A31A 3JSJA 3EUHC 2QOPA 3F3XA 3I59A 1HW1A 2W7NA 2FBKA 4NUBA 2OF7A 2DA4A 4ZC3A 1W0UA 3CZ6A 2R7VA 1U78A 3MNLA 4UVAA 2VQGA 5K5RA 1XGSA 4Y33A 2EA4A 2P6SA 1OR7C 3CCEI 4MFDA 2LG4A 2ZNZA 3LQRA 2ZCWA 3G2BA 2L5QA 1WJFA 1MBHA 4LOCA 2VPLA 2YX4A 1R5GA 3JW4A 2Z33A 3VW0A 2DMNA 3LSRA 5FMPA 2XC7A 3I0TA 5JVGF 3Q0UA 1PP7U 3PUBA 4MGRA 3SFIA 5DUIA 3DWLE 1W5SA 4JK1X 3WHBA 2O6GE 1B8IA 1RKTA 1BOAA 1LB2A 4JKZA 2V9VA 3ZQIA 2A6HF 2KIMA 3A03A 2E5ZA 4UVCA 2R7TA 5J40A 1BW5A 2EZIA 3I59B 3KP7A 1CQTA 2ZCMA 2O03A 1I6XA 5E8GA 3SEZA 2GOMA 3U1KA 2TRTA 2DFEA 3EPZA 2HXIA 4XLEA 4A3KJ 2W85A 3S1NJ 4BDZA 3WU1B 3FWEA 2DW4A 2FNAA 4C3HJ 3JREA 4PZJA 3P9KA 4QWQA 2RNGA 3OYGA 1Y39A 3GZNB 4KT5C 1YS7A 4LG0A 3WTSC 3WG7H 3ZN0A 4HQMA 2UXIA 3FHZA 4AVZA 3MKYB 2E71A 5TGTA 5ED4A 2FOWA 1X3WB 2R7XA 5CVUA 5CVRA 4ETSA 3VEPA 2FMLA 4I99C 2ECCA 2ELKA 3DTKA 3I53A 4HA8A 5F0HA 3CUQC 1B8IB 1YJNI 1YQAA 2AQEA 2XKOA 4Y17A 3IP4B 4CICA 2HKUA 1OISA 5CVVA 3WTZA 4AD9A 5GAGJ 4CA0A 4XQFA 4I2OA 2WAFA 1ERDA 3AG2H 2QQAA 4CHUA 3CJNA 4XLAA 2Y48A 4UUVA 2EV5A 2W4SA 4M71A 2MA3A 4KIGA 2O8XA 1IN8A 2HTSA 2BOLA 4LIVA 5L3FA 2KL4A 3ZOBA 5LEKA 4HV5A 2FEZA 3QOEA 1ZREA 1IRFA 3U9GA 4LG0B 1EKEA 3LA7A 4E7SA 3LFKA 1BA5A 4GFBA 1R22A 3FZVA 4LMYA 3RKWA 2MGQA 2PX9A 3V6GA 2M0CA 2HOEA 2VBWA 3KP5A 2IJLA 1TQMA 2KIUA 4IHVA 1S7AA 1WI9A 4WXDA 2DG7A 1O57A 3MQ0A 5EG0A 1KU7A 1DPRA 1R1TA 2XSJC 1ZR2A 1IJWC 3LSGA 2FBIA 5JFRA 4A5MA 5IYBJ 3SZPA 2PJRA 4EM0B 1HW5A 2M2EA 2YSRA 1ZN2A 3IAS2 3BR3A 3BCGA 2HNHA 2LOOA 3HUGA 3HOXJ 2PZ9A 1SD5A 1FYMA 5A2QK 4FTHA 1E17A 2RNJA 2NP3A 3Q0VA 4S04A 1Y56A 1SFXA 1ZGAA 3K0LA 2WWYA 1V5GA 4NC6A 3NI7A 1BR1A 4XSZF 1K79A 1MMAA 2STTA 1FSHA 2VBZA 4M74A 5LBQA 2EILH 1SD7A 2STWA 1POGA 2YUSA 3MKLA 3HDDA 1YJWI 2WA0A 4ZDLA 3VYTB 3S2DJ 2VKHA 1KONA 3W6KB 3A1YA 4HG2A 1S29A 2XASA 5EG0B 3RH2A 2VBYA 5CVIA 1WH7A 1MDMA 3T6NA 2AO9A 4EGYA 4GCTA 2PJRB 5CW8A 1T98A 5A2QZ 1YLFA 2ZC2A 1P7JA 1V5FA 3J7YJ 2YU3A 2KRCA 4HAMA 1ZR4A 1FT9A 2A6TA 1PDNC 3K4BA 2BXYA 4F93B 2V79A 3HUGB 2CRGA 5JLWA 5JVTA 2FNPA 4KDPA 3OYBA 2NRAC 4LIUA 4RLFA 4EEFG 3IC7A 3K70D 2X85A 2CW0F 4BEHB 4DZPA 1O4XA 1QZYA 3B6AA 3ML6A 2QSGX 3ON2A 4OIRF 3RD3A 2YS9A 3K4MA 3EUHA 3K10A 1ZRCA 5D1RA 2HZTA 4MEYF 1FSEA 3LSMA 3D5LA 4OWRB 3AL0B 4PJMA 4IHSA 3JTHA 3NWTA 5HS7A 4ABZA 4PJ0C 1YIJI 4YRVA 1H9TA 2LKSA 2CYYA 3HM5A 2HVRA 4PJLA 2YVHA 2XAJA 4M6VA 2XB0X 3GZ6A 3HOWJ 2A3SA 2CFXA 1ETXA 2CW7A 3FHNA 2JTVA 3CDLA 5AONA 2E60A 2K9LA 3FXUA 4DBQA 3W2AA 4A2UA 3WG9A 4BBRJ 3S1MJ 1MDMB 2M8EA 1ZHFA 3S8PA 3DBHB 3HKZA 4WK8F 1I27A 3FDYA 4HNVA 3ZR8X 4CYDA 1TBXA 5ERIA 1F43A 1QBJA 4BXUA 2PI0A 1FY7A 1S7EA 1D0YA 3BG6A 2VE8A 4NC8A 1G2HA 1U6GA 3H36A 1S3JA 2NXNB 3BR2A 4W1UA 5D8KB 3HE0A 3ULQB 1HLVA 3E6DA 3QOPA 4KITB 1DU6A 1NTCA 1UFMA 3PL8A 1XC5A 2ZNYA 3DEUA 2F4IA 3HHHA 2ZXHA 4RB1A 1LUJB 4IRIA 2W00A 3ABKH 5LEJA 1X3UA 2OJED 1GLNA 2CJJA 1U0JA 2E2JJ 3EUKL 4QPQA 3RTRA 1U9NA 1VFCA 2MG4A 3FK6A 2COMA 3BTJA 1MIJA 3RDIA 4BJ5C 4DIQA 3L2RA 1MBEA 3BJ6A 2LBFA 3BP8A 1VI0A 4B3AA 3IH3A 5HVQC 2CSOA 3BR0A 1V5EA 2ACJA 1JKRC 2ETHA 1BL0A 1N25A 4M6XA 4XICA 4Q47A 3OYDA 3OSGA 3ZN1A 5LRRA 1IG7A 3BR6A 3CCMI 2M8GX 3FKIJ 2XPWA 3GFIA 3HPGA 1DP7P 1U2WA 2OUMA 1TL8A 2PFVA 2PEXA 2WV1A 4CCMA 3B6CA 4OOIA 1TQPA 3ERED 3BG7A 2OQRA 2HPIA 2VKDA 2B63J 5HSZA 4KN4X 2PMZA 4M3GA 4IXAA 1Z3XA 5GP9A 2M7BA 4Z2YA 3F22A 3CQZJ 4ENMA 4OD4A 2ZFUA 2E1MB 5E17F 1IN5A 1MGTA 1WPKA 5L3DA 4BGDA 1NH3A 1P4WA 1IRGA 2R93J 2NVYJ 1N75A 2MD5A 4XLHA 2F2EA 2VI6A 4A3GJ 3Q3SA 1FJLA 2E5NA 2L0KA 3K4JA 5J8CA 3SWHA 3M8EA 1FOXA 1FZPB 3H3UA 4OAYA 3DKYA 4UXNA 5BOXA 2ID6A 1NG6A 2HQNA 3DTIA 2ZXJA 3PO2J 2DBBA 4LITA 1X4PA 2R5YA 1HKQA 3K4NA 2QKMB 4C2MJ 4A3BJ 3RJPA 3H9QA 3K4LA 2C6YA 3KZZA 2WAQA 1MH4A 5ICCA 4MEXF 3P9CA 1CF7B 2ID3A 5L3EA 3OS0A 4C2MA 4AU7A 1GVJA 5CXGA 2X51A 5HDGA 2EB7A 1QVTA 1KU3A 2DMUA 1B72A 1J0RA 4Q4ZF 4JX5A 3BY6A 2ZCNA 1LVAA 2HDDA 3HOZJ 4WIBA 5HDNA 2E7XA 4A3FJ 1DDNA 4WWCA 4XLCA 3E1SA 3VDXA 4V2GA 1EJ9A 2CV1A 2RVCA 1LFUP 1QU3A 1JKOC 4E7ZA 3NS4A 1JTYA 3FXLA 3M7GA 3PQJA 2UXNA 2F4OB 2H6BA 2FJ1A 2GOXB 2KP6A 3D5RC 1IXSB 4IVNA 3RQ4A 3KYDB 4EATA 3VVYA 1T33A 1EH7A 2VLAA 2BY3A 5BNGA 3LA2A 3O6BB 2R5YB 2WAEA 3MAJA 4IKFA 3CP2A 2ZCXA 4L9JA 1IV6A 2EWNA 4HOBA 5F04A 2A2FX 3SZTA 3COLA 2EA2A 2K02A 2CS3A 2OBPA 2XDVA 3VOKA 2VJ4A 2Q1ZB 5TISC 3ZQQA 2EH3A 1TWHJ 5F64A 1E0EA 4HBLA 1I3AA 3K9TA 1J2XA 4RAGA 1XPXA 1Q1VA 1B72B 1MSEC 1ULYA 1VQ4I 2I8DA 1OLTA 1SMTA 2WY7Q 2X6XA 3CCLI 3RPUD 4BE1A 3K6GA 3CMYA 1ZKGA 1GXPA 3WGGA 1GDTA 1W5TA 1CGPA 5BMZA 2ADUA 4XRSA 1XGNA 3GVAA 1JKPC 2F48A 1D1BA 1G8XA 1LKXA 3MVPA 1ZYRF 4LB5A 1SFEA 1XTAA 4OMYA 4MQVA 2JVHA 3DV8A 4L5EA 2L4AA 2ZOZA 4RM2A 5F0FA 2GIVA 2OD5A 3RPUA 3PPBA 1O7LA 3HG9A 2DTZA 4LK1F 3MMYB 2X6OA 3CTAA 2VQHA 9ANTA 2G3BA 1I5ZA 1OFCX 1JGGA 1FBSA 2MFZA 2XPUA 4E7LA 3IRRA 4NELA 3SHFA 2ZMEC 5J1UA 2G7UA 2BV6A 2ZXWH 2F5DA 2K4JA 2QSFX 2HU9A 2K85A 2WB1N 3SQNA 3BTIA 2H27A 2O9LA 4CCJA 5KCMA 2RQQA 3ZPLA 1LE8A 2Y9YA 1K7AA 5FLXK 5D18A 4LJZF 2XIGA 3ABUA 2Y2ZA 4DYRA 3VOXA 2LF7A 3VWBA 4EJWA 4G12A 1HOMA 1OCPA 1BR4A 4BU2A 2F5VA 3A0HC 3HIMA 2DT5A 3DPLC 1QRYA 3VW1A 4XOTA 2OAZA 2F5CA 3F9KA 2E7WA 3FBIB 3NEUA 2CGPA 1IUYA 2MH9A 1J5YA 3F21A 3KEYA 2KIQA 3Q5FA 3PIPF 5GPAA 4IHXA 4QTRA 1USSA 3KP3A 2Z5UA 4B47A 2KISA 5FLXZ 3QP6A 3DQVC 3ISPA 3NNRA 1Y1VJ 4ZYAA 2CUJA 4JX6A 3QQAA 4IOAF 3NRGA 3GTGJ 3GUDA 3SXYA 5IT3A 2WC2A 3ZCOA 1WJDA 4L5IA 3QYBA 2IAIA 4N9HA 4EJUA 2DOFA 4OIOF 2LVSA 2A5WA 2LLKA 3FXJA 3QKXA 2AQFA 1R4NB 4U9NA 1FIAA 2A69F 3V7RA 2M45A 1W0TA 3IKTA 2HTJA 3OIOA 5GTIC 1Z6RA 4E6KG 2QQBA 3ECOA 1S5LC 3CUOA 1FBUA 2QBYA 1BI3A 4LLNA 5FFZA 4BHBA 4A69C 2CV0A 3PIOF 4YG2F 3W6VA 2RQPA 1VQ6I 4CZCA 1SFKA 4YIRX 2P5KA 4C3JJ 4RGUA 2VONA 1BIBA 2LSOA 3PSFA 5F1JA 5K7FA 3S15J 4HSTA 2HOTA 2Q8KA 1WCMJ 2A68F 3LSIA 3AG4H 4D0PA 3C2HA 4DZJA 4Z6YA 1R5HA 3MZ8A 1UJ8A 4BE2A 2A6EF 2LREA 1WKMA 3OYJA 2J5PA 1GUUA 1MSFC 1TNTA 4YEJA 3A2KA 2HVQA 1D5VA 3FMRA 2E1NA 1MNMC 2DK8A 2F5FA 2XAFA 1N78A 1MZBA 3HOVJ 3SJMA 4I7HA 3CC2I 2LKXA 1RNLA 1WRJA 4QPOA 3V7SA 1K78A 3BQZA 3NRVA 4R1HA 5C44J 2VASA 4AIJA 5E3LA 3S3NA 1R49A 3GTOJ 1H88C 1I1GA 3H3ZA 4MQ9F 1HW2A 4Y13A 1WHUA 2ZO4A 4CCNA 2VJ5A 1BIAA 2MW8A 4C3IJ 2K7LA 3P5JA 4HX4A 3EUAA 3U2RA 4XR6A 2VXZA 4B44A 2R3SA 1RR7A 5IYCJ 4KWAA 3NWSA 1P2FA 2EQRA 1IN4A 5FRMA 3IUVA 5E79C 2L02A 3BZ6A 4PSWA 2EJRA 1XDSA 3T8TA 1AU7A 4IPAA 3KFWX 4EQQA 2AS5F 3L7WA 4P9FA 4DGWB 1R36A 3HZJA 1BM9A 4GYIA 3LNQA 1VQKI 1FP1D 5LHHA 1R71A 2O0YA 4HLXA 2HEOA 2W53A 3HRTA 5HODA 4LK0F 1HQCA 3PSIA 1BN5A 2V26A 3PJRA 4U7BA 3NXCA 5KK1A 1Y1WJ 2GLOA 1HDPA 2OC6A 4NNJA 3TMOA 1VZ0A 3CCRI 2YU9J 1S7OA 2GM4A 1IV8A 1B1BA 3IV5A 2UV1A 4B4CA 5LD2C 2EFWA 1N77A 4I02A 1ETOA
chains in the Genus database with same CATH topology
3C07A 1XG1A 3FIWA 2KDZA 3GTLJ 5IYBJ 1BJZA 3G1LA 2M2EA 1PUFA 4M3BA 3I4MJ 4V2FA 2G7SA 2G7LA 2ME6A 2K9SA 3BR3A 3BCGA 1X2MA 2GFNA 5K7ZA 2X48A 3BNIA 3G56A 4A3IJ 3HOXJ 2CUEA 3GTMJ 2PZ9A 4FTHA 3LJLA 2NP3A 1HF0A 2LK2A 3Q0VA 4UUTA 2XSDC 1IDZA 2RHAA 1SANA 3OOUA 3A02A 4RBOA 3ANGA 3CRJA 4MFEA 3NI7A 2ECBA 4GFKA 3ZQLA 4XRMA 2EZHA 4MK6A 3BR1A 1MBJA 1UI6A 5E3NA 5FKMA 1POGA 2PBXA 2YUSA 3MKLA 3HDDA 3IH4A 2DA5A 1ZK8A 3S2DJ 2NVQJ 2MSYA 1A6IA 2DA3A 2IU5A 4BY7J 2EZKA 2R92J 3H0GJ 5FKKA 3M4OJ 5EG0B 4ACIA 5FKOA 4UUSA 3RH2A 3VIBA 1GT0C 2XGEA 3G7RA 1ORKA 2E2HJ 3T6NA 1WH7A 2AO9A 4GCTA 3BHQA 5CW8A 3PASA 1P7JA 1U9OA 1PUFB 2DA1A 3TEDA 2EZLA 5C4JJ 5J3LA 2QKOA 4FCYA 1ZR4A 1VF9A 2FBQA 2O7TA 3O8GA 2CRGA 5JLWA 1DU0A 3LSPA 5K7HA 4EEFG 4JNNA 4DZPA 1O4XA 1JJ8C 3VP5A 3B6AA 4Y52J 3ON2A 2Q24A 5EEAA 3G1MA 5FJ8J 3RD3A 2YS9A 3OSFA 2VKEA 5DS9A 2K9NA 2R7ZJ 2UXHA 5FLVA 5FKNA 3ZQHA 1BW6A 1R9TJ 5D1RA 4XRSG 4IEJA 5H9TA 2NOGA 2UXUA 1GV2A 2AHQA 4ABZA 1SFOJ 2E2IJ 3HM5A 2LY9A 2NVXJ 4UDSA 2QCOA 4M6VA 2YVHA 2XB0X 3HOWJ 1E3OC 2Y9ZA 4A93J 4X6AJ 1ETXA 4UUSB 3CDLA 2WUIA 3JRFA 2M34A 4BBRJ 3S1MJ 3LHQA 2HOAA 2H1KA 2VUMJ 1IC8A 2N8GA 3K7AJ 1XS9A 4HNVA 3SDGA 1TWAJ 2NS8A 3TP3A 1F43A 5M5WJ 1NK3P 5EZHA 1S7EA 1MBKA 1UMQA 2YVEA 1G2HA 3L1PA 4M3EA 3VW2A 4W1UA 3BR2A 3HE0A 5HAWA 1HLVA 2XB5A 3BG3A 2XDNA 4JYKA 3JRCA 3PM1A 4YZEA 4I6ZA 1DU6A 2L7MP 1NTCA 1XC5A 3GTJJ 1ZQ3P 1F36A 5EF6A 2HYTA 1Z77A 3UKGA 2JN6A 3ZQGA 2CJJA 1EF4A 3VPRA 2E2JJ 1OCTC 1X58A 4A3LJ 3K2AA 1U9NA 3FISA 1VFCA 2MG4A 3DCFA 3FK6A 3BTJA 2JA6J 3NARA 3D1NI 2I10A 3ZQCA 1GV5A 1MBEA 5IPAA 3CCYA 1VNDA 3JRDA 1VI0A 3KKCA 4B3AA 3C2BA 3IH3A 3ZQFA 3BR0A 3HEFA 3MN2A 4A3CJ 2P81A 1SGMA 5IOYA 1JKRC 3Q0WA 1BL0A 1JJ6C 1WGXA 2NS7A 4XICA 5C4XJ 4JP0A 1FTZA 1AKHA 3OSGA 1ETKA 2ME0A 3HB9A 1OJLA 1IG7A 3FRQA 3BR6A 1WI3A 2M8GX 3FKIJ 2XPWA 2COBA 2WV1A 3B6CA 5F0CA 3JRGA 2O8KA 5E3MA 1TWGJ 2NX4A 2B63J 3GEUA 1NK2P 2RAEA 5HSZA 1I3QJ 3HOUJ 5J1YA 4M3GA 3GBGA 2LP0A 5EDNA 5GP9A 3RZDJ 3CQZJ 1IRZA 5EGOB 2DA2A 1WPKA 4GCKA 5CXIA 5J1RA 4HKUA 4AUXA 2R93J 3HTJA 2NVYJ 4CYCA 2QWTA 4A3GJ 2VI6A 1ETQA 3Q3SA 1K83J 3S17J 2DA6A 5IP6A 4FISA 1FJLA 4Y7NJ 2WGBA 2LFBA 3WHCA 2L0KA 3HBLA 4AYBN 4X1EA 5C4YA 2CU7A 1Z0XA 3BRUA 4J19A 1I6HJ 2ID6A 3EGQA 1QPIA 4A3MJ 2OI8A 3PO2J 1AKHB 3PO3J 3LOCA 3KNWA 3BG9A 2R5YA 2ZOYA 4ME9A 4JL3A 4C2MJ 4A3BJ 1LE8B 2JK3A 1MH3A 2G0EA 3BTLA 3FK7A 1D5YA 1MH4A 2VPRA 5DTDA 1ETWA 1JTXA 2ID3A 3TP0A 3EUPA 3S5RA 2NP5A 5CXGA 2JA5J 2DA7A 1MBFA 2DN0A 4MLOA 1QVTA 2O7OA 2NVTJ 2DMUA 2Y31A 1B72A 3RZOJ 3NPIA 2XGDA 1UHSA 1P7IA 4JX5A 3HGGA 4CYCB 2ZCNA 2GENA 1AHDP 3HKZN 2R0QC 2JJ7A 2HDDA 3HOZJ 4IHYA 4A3FJ 1GVDA 5AQCA 3TW7A 4V2GA 5IP9J 4D7MA 1LFUP 4A3DJ 1JKOC 4NN1A 3BQYA 1JTYA 1TWCJ 2F07A 1T56A 2QTQA 3LWJA 4S0HB 2FJ1A 4XK4A 4JX4A 2JWTA 5FHPA 1JUPA 3VVYA 2X9DA 5EYRA 1T33A 5GPCA 3GTQJ 1FTTA 5BNGA 1RKWA 4MXMA 2HQ5A 5M3MJ 5C3EJ 2L9RA 2R5YB 2ZCXA 2CQQA 4BBSJ 1IV6A 3LSJA 5F04A 2RASA 3COLA 3I4NJ 1JUSA 2V57A 3VOKA 4D7NA 2UXOA 3CJDA 2EH3A 1TWHJ 5IYDJ 2XPVA 3BR5A 4QSHA 3JRHA 1U8BA 3NAUA 5E3OA 1Q1VA 1B72B 1IGNA 1MSEC 2LTPA 4D5CA 3P9TA 3E7LA 2GBYA 3HTAA 3DPJA 4CGRA 3CMYA 1ZKGA 2XRLA 1RPWA 1GDTA 3HGYA 4DYQA 1JT0A 4DW6A 5EGOA 4XRSA 2CQXA 3TW6A 2L7ZA 1JKPC 1H8AC 2DG8A 3MVPA 1UI5A 3HTHA 1YRNA 2H8RA 4RDUA 2IBDA 4L5EA 1I50J 5F08A 3RKQA 2ZOZA 2DMQA 2FD5A 5F0FA 3E7QA 3PPBA 4BY1J 2DTZA 5EZGA 2X6OA 9ANTA 2G3BA 2UXPA 1OFCX 1JGGA 2DJNA 5D19A 2XPUA 3GTKJ 2PMZN 2OPTA 1ZTRA 5DAJA 3S1QJ 4NELA 4L62A 5J1UA 5FLMJ 3GZIA 3ON4A 3IH2A 4NDLA 2WB1N 5M5YJ 3A01B 3BTIA 2O9LA 3HOYJ 1RETA 3ANPA 1LE8A 2Y9YA 5K58A 5D18A 2W48A 1HDDC 3AQSA 2Y2ZA 2QIBA 1JUMA 1ITYA 3VVZA 4DYRA 2Y0SN 1JT6A 1UG2A 3VOXA 2K9QA 3QPLA 2M9HA 1H89C 2QF7A 1IUFA 4G12A 3JRIA 1OCPA 1HOMA 2HI3A 3F1BA 4AF5A 4IHWA 1YRNB 3HIMA 2G7GA 1JKQC 3CWRA 1QRYA 3JRBA 3VW1A 2JA7J 2TCTA 3BG5A 3F0CA 1APLC 2WAQN 3V78A 2CUFA 2GUHA 1FIPA 5GPAA 2Y30A 2E1OA 3RQIA 4IHXA 2HYJA 3JSJA 4QTRA 1TC3C 2QOPA 4FE4A 1ENHA 3NNRA 1Y1VJ 1WH5A 2OF7A 2DA4A 2D5VA 4JX6A 3QQAA 3NRGA 1W0UA 5FKLA 3GTGJ 2JMWA 3S16J 3JRAA 1U78A 3MNLA 1IDYA 1ETVA 1MBGA 2IAIA 2LVSA 2LLKA 4MFDA 3QKXA 1FIAA 5EFYA 4ICHA 1W0TA 3BTCA 2XGCA 4M3FA 1MBHA 3OIOA 4LOCA 4GCLA 1ETYA 2JA8J 4FE7A 2VKVA 3BJBA 2LD5A 3VW0A 1X2NA 2DMNA 2EBIA 2L7FP 3LSRA 5FMPA 4A69C 4AC0A 3Q0UA 3W6VA 4AC6A 3SFIA 3WHBA 1HCRA 1B8IA 1RKTA 1K61A 4JKZA 4C3JJ 2D6YA 5HBUA 3ZQIA 3O60A 4MIMA 3GTPJ 3A03A 5K7FA 3S15J 5F1JA 2HOTA 1A5JA 1WCMJ 4DYCA 2HXOA 1BW5A 2EZIA 4DZJA 1CQTA 2ZCMA 1GUUA 1MSFC 3S2HJ 3JR9A 4M3DA 2TRTA 2HXIA 4I76A 5M3FJ 4A3KJ 1MNMC 3S1NJ 2DMPA 1RESA 3G1OA 3HOVJ 3AQTA 2FX0A 3SJMA 3H3VK 2LKXA 4C3HJ 3JREA 4BKXA 3A01A 1ZGWA 5F27A 3BQZA 5IOZA 4MO7A 5C44J 1QVUA 5E3LA 3KKDA 2LR8A 2UXIA 3GTOJ 1H88C 2OERA 3VVXA 4B1RA 2MW8A 4C3IJ 2ECCA 2ELKA 3B81A 5F0HA 1B8IB 2R5ZA 2KT0A 2K40A 2HOSA 1RR7A 5IYCJ 4KWAA 4GFLA 3S1RJ 4PXIA 2EQRA 3IUVA 2HKUA 4W97A 2ZB9A 3M3YJ 2REKA 1AU7A 2DMTA 3DEWA 2FQ4A 4D5FA 5JLXA 5FGLA 3BT9A 3VUQA 3LNQA 3ZOBA 2W53A 5HODA 2IEKA 3HTIA 4QIWN 5M5XJ 3QBMA 3NXCA 1Y1WJ 1FEXA 5IP7J 1LFBA 1HDPA 2GLOA 3KZ9A 3QPSA 1BA5A 3O8HA 2YU9J 4GFBA 2MGQA 3V6GA 2M0CA 2GM4A 3S14J 4XIDA 2E19A 3IV5A 4IHVA 2DG7A 4B4CA 5EG0A 2R5ZB 4A3EJ 4A3JJ 1ZR2A 1ETOA 1IJWC 1TWFJ 3LSGA 4BXXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C07 A;  1XG1 A;  3FIW A;  2KDZ A;  3GTL J;  5IYB J;  1BJZ A;  3G1L A;  2M2E A;  1PUF A;  4M3B A;  3I4M J;  4V2F A;  2G7S A;  2G7L A;  2ME6 A;  2K9S A;  3BR3 A;  3BCG A;  1X2M A;  2GFN A;  5K7Z A;  2X48 A;  3BNI A;  3G56 A;  4A3I J;  3HOX J;  2CUE A;  3GTM J;  2PZ9 A;  4FTH A;  3LJL A;  2NP3 A;  1HF0 A;  2LK2 A;  3Q0V A;  4UUT A;  2XSD C;  1IDZ A;  2RHA A;  1SAN A;  3OOU A;  3A02 A;  4RBO A;  3ANG A;  3CRJ A;  4MFE A;  3NI7 A;  2ECB A;  4GFK A;  3ZQL A;  4XRM A;  2EZH A;  4MK6 A;  3BR1 A;  1MBJ A;  1UI6 A;  5E3N A;  5FKM A;  1POG A;  2PBX A;  2YUS A;  3MKL A;  3HDD A;  3IH4 A;  2DA5 A;  1ZK8 A;  3S2D J;  2NVQ J;  2MSY A;  1A6I A;  2DA3 A;  2IU5 A;  4BY7 J;  2EZK A;  2R92 J;  3H0G J;  5FKK A;  3M4O J;  5EG0 B;  4ACI A;  5FKO A;  4UUS A;  3RH2 A;  3VIB A;  1GT0 C;  2XGE A;  3G7R A;  1ORK A;  2E2H J;  3T6N A;  1WH7 A;  2AO9 A;  4GCT A;  3BHQ A;  5CW8 A;  3PAS A;  1P7J A;  1U9O A;  1PUF B;  2DA1 A;  3TED A;  2EZL A;  5C4J J;  5J3L A;  2QKO A;  4FCY A;  1ZR4 A;  1VF9 A;  2FBQ A;  2O7T A;  3O8G A;  2CRG A;  5JLW A;  1DU0 A;  3LSP A;  5K7H A;  4EEF G;  4JNN A;  4DZP A;  1O4X A;  1JJ8 C;  3VP5 A;  3B6A A;  4Y52 J;  3ON2 A;  2Q24 A;  5EEA A;  3G1M A;  5FJ8 J;  3RD3 A;  2YS9 A;  3OSF A;  2VKE A;  5DS9 A;  2K9N A;  2R7Z J;  2UXH A;  5FLV A;  5FKN A;  3ZQH A;  1BW6 A;  1R9T J;  5D1R A;  4XRS G;  4IEJ A;  5H9T A;  2NOG A;  2UXU A;  1GV2 A;  2AHQ A;  4ABZ A;  1SFO J;  2E2I J;  3HM5 A;  2LY9 A;  2NVX J;  4UDS A;  2QCO A;  4M6V A;  2YVH A;  2XB0 X;  3HOW J;  1E3O C;  2Y9Z A;  4A93 J;  4X6A J;  1ETX A;  4UUS B;  3CDL A;  2WUI A;  3JRF A;  2M34 A;  4BBR J;  3S1M J;  3LHQ A;  2HOA A;  2H1K A;  2VUM J;  1IC8 A;  2N8G A;  3K7A J;  1XS9 A;  4HNV A;  3SDG A;  1TWA J;  2NS8 A;  3TP3 A;  1F43 A;  5M5W J;  1NK3 P;  5EZH A;  1S7E A;  1MBK A;  1UMQ A;  2YVE A;  1G2H A;  3L1P A;  4M3E A;  3VW2 A;  4W1U A;  3BR2 A;  3HE0 A;  5HAW A;  1HLV A;  2XB5 A;  3BG3 A;  2XDN A;  4JYK A;  3JRC A;  3PM1 A;  4YZE A;  4I6Z A;  1DU6 A;  2L7M P;  1NTC A;  1XC5 A;  3GTJ J;  1ZQ3 P;  1F36 A;  5EF6 A;  2HYT A;  1Z77 A;  3UKG A;  2JN6 A;  3ZQG A;  2CJJ A;  1EF4 A;  3VPR A;  2E2J J;  1OCT C;  1X58 A;  4A3L J;  3K2A A;  1U9N A;  3FIS A;  1VFC A;  2MG4 A;  3DCF A;  3FK6 A;  3BTJ A;  2JA6 J;  3NAR A;  3D1N I;  2I10 A;  3ZQC A;  1GV5 A;  1MBE A;  5IPA A;  3CCY A;  1VND A;  3JRD A;  1VI0 A;  3KKC A;  4B3A A;  3C2B A;  3IH3 A;  3ZQF A;  3BR0 A;  3HEF A;  3MN2 A;  4A3C J;  2P81 A;  1SGM A;  5IOY A;  1JKR C;  3Q0W A;  1BL0 A;  1JJ6 C;  1WGX A;  2NS7 A;  4XIC A;  5C4X J;  4JP0 A;  1FTZ A;  1AKH A;  3OSG A;  1ETK A;  2ME0 A;  3HB9 A;  1OJL A;  1IG7 A;  3FRQ A;  3BR6 A;  1WI3 A;  2M8G X;  3FKI J;  2XPW A;  2COB A;  2WV1 A;  3B6C A;  5F0C A;  3JRG A;  2O8K A;  5E3M A;  1TWG J;  2NX4 A;  2B63 J;  3GEU A;  1NK2 P;  2RAE A;  5HSZ A;  1I3Q J;  3HOU J;  5J1Y A;  4M3G A;  3GBG A;  2LP0 A;  5EDN A;  5GP9 A;  3RZD J;  3CQZ J;  1IRZ A;  5EGO B;  2DA2 A;  1WPK A;  4GCK A;  5CXI A;  5J1R A;  4HKU A;  4AUX A;  2R93 J;  3HTJ A;  2NVY J;  4CYC A;  2QWT A;  4A3G J;  2VI6 A;  1ETQ A;  3Q3S A;  1K83 J;  3S17 J;  2DA6 A;  5IP6 A;  4FIS A;  1FJL A;  4Y7N J;  2WGB A;  2LFB A;  3WHC A;  2L0K A;  3HBL A;  4AYB N;  4X1E A;  5C4Y A;  2CU7 A;  1Z0X A;  3BRU A;  4J19 A;  1I6H J;  2ID6 A;  3EGQ A;  1QPI A;  4A3M J;  2OI8 A;  3PO2 J;  1AKH B;  3PO3 J;  3LOC A;  3KNW A;  3BG9 A;  2R5Y A;  2ZOY A;  4ME9 A;  4JL3 A;  4C2M J;  4A3B J;  1LE8 B;  2JK3 A;  1MH3 A;  2G0E A;  3BTL A;  3FK7 A;  1D5Y A;  1MH4 A;  2VPR A;  5DTD A;  1ETW A;  1JTX A;  2ID3 A;  3TP0 A;  3EUP A;  3S5R A;  2NP5 A;  5CXG A;  2JA5 J;  2DA7 A;  1MBF A;  2DN0 A;  4MLO A;  1QVT A;  2O7O A;  2NVT J;  2DMU A;  2Y31 A;  1B72 A;  3RZO J;  3NPI A;  2XGD A;  1UHS A;  1P7I A;  4JX5 A;  3HGG A;  4CYC B;  2ZCN A;  2GEN A;  1AHD P;  3HKZ N;  2R0Q C;  2JJ7 A;  2HDD A;  3HOZ J;  4IHY A;  4A3F J;  1GVD A;  5AQC A;  3TW7 A;  4V2G A;  5IP9 J;  4D7M A;  1LFU P;  4A3D J;  1JKO C;  4NN1 A;  3BQY A;  1JTY A;  1TWC J;  2F07 A;  1T56 A;  2QTQ A;  3LWJ A;  4S0H B;  2FJ1 A;  4XK4 A;  4JX4 A;  2JWT A;  5FHP A;  1JUP A;  3VVY A;  2X9D A;  5EYR A;  1T33 A;  5GPC A;  3GTQ J;  1FTT A;  5BNG A;  1RKW A;  4MXM A;  2HQ5 A;  5M3M J;  5C3E J;  2L9R A;  2R5Y B;  2ZCX A;  2CQQ A;  4BBS J;  1IV6 A;  3LSJ A;  5F04 A;  2RAS A;  3COL A;  3I4N J;  1JUS A;  2V57 A;  3VOK A;  4D7N A;  2UXO A;  3CJD A;  2EH3 A;  1TWH J;  5IYD J;  2XPV A;  3BR5 A;  4QSH A;  3JRH A;  1U8B A;  3NAU A;  5E3O A;  1Q1V A;  1B72 B;  1IGN A;  1MSE C;  2LTP A;  4D5C A;  3P9T A;  3E7L A;  2GBY A;  3HTA A;  3DPJ A;  4CGR A;  3CMY A;  1ZKG A;  2XRL A;  1RPW A;  1GDT A;  3HGY A;  4DYQ A;  1JT0 A;  4DW6 A;  5EGO A;  4XRS A;  2CQX A;  3TW6 A;  2L7Z A;  1JKP C;  1H8A C;  2DG8 A;  3MVP A;  1UI5 A;  3HTH A;  1YRN A;  2H8R A;  4RDU A;  2IBD A;  4L5E A;  1I50 J;  5F08 A;  3RKQ A;  2ZOZ A;  2DMQ A;  2FD5 A;  5F0F A;  3E7Q A;  3PPB A;  4BY1 J;  2DTZ A;  5EZG A;  2X6O A;  9ANT A;  2G3B A;  2UXP A;  1OFC X;  1JGG A;  2DJN A;  5D19 A;  2XPU A;  3GTK J;  2PMZ N;  2OPT A;  1ZTR A;  5DAJ A;  3S1Q J;  4NEL A;  4L62 A;  5J1U A;  5FLM J;  3GZI A;  3ON4 A;  3IH2 A;  4NDL A;  2WB1 N;  5M5Y J;  3A01 B;  3BTI A;  2O9L A;  3HOY J;  1RET A;  3ANP A;  1LE8 A;  2Y9Y A;  5K58 A;  5D18 A;  2W48 A;  1HDD C;  3AQS A;  2Y2Z A;  2QIB A;  1JUM A;  1ITY A;  3VVZ A;  4DYR A;  2Y0S N;  1JT6 A;  1UG2 A;  3VOX A;  2K9Q A;  3QPL A;  2M9H A;  1H89 C;  2QF7 A;  1IUF A;  4G12 A;  3JRI A;  1OCP A;  1HOM A;  2HI3 A;  3F1B A;  4AF5 A;  4IHW A;  1YRN B;  3HIM A;  2G7G A;  1JKQ C;  3CWR A;  1QRY A;  3JRB A;  3VW1 A;  2JA7 J;  2TCT A;  3BG5 A;  3F0C A;  1APL C;  2WAQ N;  3V78 A;  2CUF A;  2GUH A;  1FIP A;  5GPA A;  2Y30 A;  2E1O A;  3RQI A;  4IHX A;  2HYJ A;  3JSJ A;  4QTR A;  1TC3 C;  2QOP A;  4FE4 A;  1ENH A;  3NNR A;  1Y1V J;  1WH5 A;  2OF7 A;  2DA4 A;  2D5V A;  4JX6 A;  3QQA A;  3NRG A;  1W0U A;  5FKL A;  3GTG J;  2JMW A;  3S16 J;  3JRA A;  1U78 A;  3MNL A;  1IDY A;  1ETV A;  1MBG A;  2IAI A;  2LVS A;  2LLK A;  4MFD A;  3QKX A;  1FIA A;  5EFY A;  4ICH A;  1W0T A;  3BTC A;  2XGC A;  4M3F A;  1MBH A;  3OIO A;  4LOC A;  4GCL A;  1ETY A;  2JA8 J;  4FE7 A;  2VKV A;  3BJB A;  2LD5 A;  3VW0 A;  1X2N A;  2DMN A;  2EBI A;  2L7F P;  3LSR A;  5FMP A;  4A69 C;  4AC0 A;  3Q0U A;  3W6V A;  4AC6 A;  3SFI A;  3WHB A;  1HCR A;  1B8I A;  1RKT A;  1K61 A;  4JKZ A;  4C3J J;  2D6Y A;  5HBU A;  3ZQI A;  3O60 A;  4MIM A;  3GTP J;  3A03 A;  5K7F A;  3S15 J;  5F1J A;  2HOT A;  1A5J A;  1WCM J;  4DYC A;  2HXO A;  1BW5 A;  2EZI A;  4DZJ A;  1CQT A;  2ZCM A;  1GUU A;  1MSF C;  3S2H J;  3JR9 A;  4M3D A;  2TRT A;  2HXI A;  4I76 A;  5M3F J;  4A3K J;  1MNM C;  3S1N J;  2DMP A;  1RES A;  3G1O A;  3HOV J;  3AQT A;  2FX0 A;  3SJM A;  3H3V K;  2LKX A;  4C3H J;  3JRE A;  4BKX A;  3A01 A;  1ZGW A;  5F27 A;  3BQZ A;  5IOZ A;  4MO7 A;  5C44 J;  1QVU A;  5E3L A;  3KKD A;  2LR8 A;  2UXI A;  3GTO J;  1H88 C;  2OER A;  3VVX A;  4B1R A;  2MW8 A;  4C3I J;  2ECC A;  2ELK A;  3B81 A;  5F0H A;  1B8I B;  2R5Z A;  2KT0 A;  2K40 A;  2HOS A;  1RR7 A;  5IYC J;  4KWA A;  4GFL A;  3S1R J;  4PXI A;  2EQR A;  3IUV A;  2HKU A;  4W97 A;  2ZB9 A;  3M3Y J;  2REK A;  1AU7 A;  2DMT A;  3DEW A;  2FQ4 A;  4D5F A;  5JLX A;  5FGL A;  3BT9 A;  3VUQ A;  3LNQ A;  3ZOB A;  2W53 A;  5HOD A;  2IEK A;  3HTI A;  4QIW N;  5M5X J;  3QBM A;  3NXC A;  1Y1W J;  1FEX A;  5IP7 J;  1LFB A;  1HDP A;  2GLO A;  3KZ9 A;  3QPS A;  1BA5 A;  3O8H A;  2YU9 J;  4GFB A;  2MGQ A;  3V6G A;  2M0C A;  2GM4 A;  3S14 J;  4XID A;  2E19 A;  3IV5 A;  4IHV A;  2DG7 A;  4B4C A;  5EG0 A;  2R5Z B;  4A3E J;  4A3J J;  1ZR2 A;  1ETO A;  1IJW C;  1TWF J;  3LSG A;  4BXX J; 
#chains in the Genus database with same CATH topology
 3C07 A;  3OYN A;  3FIW A;  2KDZ A;  3HOS A;  3GTL J;  4KT6 A;  3JSO A;  4IQJ A;  1T6S A;  2K3F A;  3C2G A;  1PYV A;  3G1L A;  4HNT A;  4ZDO A;  4M3B A;  4V2F A;  1YYV A;  1WQ2 A;  2BHY A;  2ISZ A;  2ZJP F;  1LEA A;  2FF4 A;  1R4M B;  2CUE A;  2IPQ X;  3H0D A;  3S3O A;  2OQG A;  3ABT A;  2X4H A;  4UUT A;  4S05 A;  2RHA A;  1SAN A;  4GYG A;  4RBO A;  2R7R A;  1Z1D A;  4GFK A;  3TQN A;  4XRM A;  2IA0 A;  2X0L A;  1YO5 C;  3BR1 A;  3K1M A;  3WTY C;  1UI6 A;  5J8F A;  2NNN A;  1BC8 C;  3RKY A;  3IH4 A;  4HLY A;  3LAP A;  1A6I A;  1QZE A;  2QZ8 A;  2BVL A;  1YG2 A;  2WAD A;  4BY7 J;  2EZK A;  2R92 J;  3V42 A;  2DPD A;  2B7E A;  5FD6 A;  5FKO A;  3VIB A;  3E6B A;  1U8R A;  2CUZ A;  1GT0 C;  2XGE A;  3J7Z I;  3G7R A;  2E2H J;  3CCU I;  4JQF A;  2IGK A;  3ABM H;  4A0Y A;  1A35 A;  2X6W A;  3PAS A;  1WJB A;  1D3Y A;  3KCC A;  4EGZ A;  1DP3 A;  1OKR A;  5C4J J;  4XRF A;  3CCV I;  5J3L A;  3EQL F;  4G9Y A;  2QKO A;  2JT1 A;  1MJB A;  2O7T A;  4AYB A;  1O3T A;  1J9I A;  3LSP A;  2XRO A;  3HXL A;  2IS4 A;  1JJ8 C;  1SAU A;  3DF8 A;  1YI2 I;  1AOY A;  1TNS A;  2DFH A;  5HOO A;  3OS2 A;  2CV2 A;  4Y3O A;  2L54 A;  2CO5 A;  3ZQH A;  1R9T J;  4XRS G;  4A5N A;  1IXR C;  3H1C A;  2DDA A;  1PUE E;  4RAY A;  2NOG A;  2OCC H;  4IF4 A;  1GV2 A;  2UXU A;  4I98 B;  1E3H A;  4DBR A;  4GCV A;  2E2I J;  3J80 K;  1FMW A;  4XLP F;  2I5U A;  2NVX J;  4HF1 A;  2X1C A;  2XUB A;  1SAX A;  4A93 J;  2LYC A;  3KYL A;  3BWG A;  4ASN A;  3WTW C;  2WUI A;  2M34 A;  1B59 A;  2A05 A;  1UB9 A;  2UXX A;  3C1D A;  2EIN H;  1VQL I;  1G3T A;  1T0F A;  3FXK A;  3KP6 A;  3QU6 A;  3SDG A;  1TWA J;  2NS8 A;  5B5E C;  3S3M A;  3M07 A;  4E70 A;  4BQN A;  3L2V A;  5M5W J;  3GW2 A;  1G59 A;  1MBK A;  2QVO A;  1UMQ A;  3KIO A;  3L1P A;  1LJ9 A;  1I39 A;  4XLF A;  2XRN A;  2YR2 A;  4CCK A;  5HAW A;  4AVP A;  2RKH A;  3JRC A;  3PM1 A;  4YZE A;  2HR3 A;  3J80 Z;  4I6Z A;  2HWV A;  4BNC A;  2DDB A;  3GTJ J;  4HSR A;  1G3S A;  1F36 A;  2HYT A;  2RV8 A;  1Z77 A;  4PJN A;  2JN6 A;  3UKG A;  4BAY A;  3ASO H;  1ZEL A;  2DYR H;  1VQN I;  4PFP A;  3QOD A;  3VPR A;  1EF4 A;  1SD4 A;  2Z3Y A;  1X58 A;  2DOA A;  3GX4 X;  1R5I D;  5CVJ A;  3TGN A;  5DV5 A;  3VOD A;  4EM1 A;  2A5Y B;  4RB3 C;  1X19 A;  3NAR A;  3D1N I;  2I10 A;  5B66 C;  4L9T A;  1AWC A;  1VND A;  2AXL A;  1FNN A;  1BBY A;  3TO6 A;  3JRD A;  2CQK A;  5L3B A;  4UHT A;  4ANJ A;  3ZQF A;  4F7Z A;  2KPM A;  3HEF A;  1WSU A;  4A3C J;  2IP2 A;  1RUN A;  4ZZD A;  1WGX A;  4JP0 A;  2D45 A;  1ETK A;  1S6L A;  1H0M A;  2H6C A;  5D5V B;  1T8I A;  4D9J A;  3N4M A;  5KAF C;  3DEE A;  2COB A;  4XL9 A;  1EA3 A;  4Y4R A;  1K6Y A;  1TWG J;  4J00 A;  1W7P D;  1D1C A;  1NK2 P;  2RAE A;  3CCQ I;  3GEU A;  1I3Q J;  4BEH A;  1ZG3 A;  5J1Y A;  4ENK A;  4KIS A;  3BJO A;  5D5U B;  4E7K A;  4GCK A;  3OR2 C;  4RB2 C;  1NHA A;  4HKU A;  2KMU A;  2QWT A;  1ETQ A;  4ZJZ A;  2ESN A;  4FIS A;  4I09 A;  1W7P A;  2JUG A;  2Z99 A;  3FBN B;  2WGB A;  2ELH A;  2LFB A;  3FF5 A;  2V1D A;  3HTS B;  1KZH A;  5C4Y A;  3I64 A;  1W36 C;  1VQ5 I;  4OD5 A;  1G6N A;  1G3W A;  2DK5 A;  3EDP A;  4YEL A;  5B1B H;  3V7C A;  2EV0 A;  2PQ8 A;  3EGQ A;  1QPI A;  3GEZ A;  4A3M J;  3IWZ A;  4U7D A;  1M1E B;  1RC9 A;  4E7I A;  2DFI A;  1DQU A;  3LOC A;  3BG9 A;  5D6F A;  1J75 A;  3FXO A;  4ME9 A;  4JL3 A;  4OU0 A;  4FHT A;  1MH3 A;  1IZ1 A;  2VBX A;  3BTL A;  5EJC A;  2M3A A;  1R6R A;  3FK7 A;  1FPQ A;  4P1W A;  1XX5 A;  3WE2 A;  1HXD A;  2L2O A;  5DTD A;  5CPR B;  1J59 A;  1JTX A;  2VB6 A;  3EUP A;  2G9W A;  2P7V B;  2KKO A;  3E5Q A;  3I54 A;  2DA7 A;  2DN0 A;  4MLO A;  2KFD A;  2O7O A;  1B6A A;  1XCV A;  3F8M A;  1E3P A;  2GA1 A;  3HKZ N;  3GFM A;  2JJ7 A;  1O3Q A;  2VJI A;  5AQC A;  1W7P B;  3TW7 A;  3CME I;  4A3D J;  2M7A A;  2ZBK A;  2HKO A;  5EEH A;  2DXI A;  4RGX A;  2P4W A;  3BQY A;  3REO A;  5LGN A;  1OR7 A;  1T08 B;  3OYK A;  2JSP A;  4S0H B;  1ONV A;  1FYL A;  4R8H A;  5FRN A;  5GPC A;  3RSN A;  4BXF A;  5L3G A;  1FTT A;  2XAG A;  5C3E J;  5M3M J;  3S32 A;  6PAX A;  2L9R A;  1YOV B;  2NNY A;  1YS6 A;  2P5V A;  5FD5 A;  4LFU A;  2CQQ A;  3E6C C;  4IRV A;  4RB0 A;  1IF1 A;  3A0B C;  4UVB A;  2L9N A;  2O3F A;  3WTU C;  1VQO I;  2WBM A;  4XON A;  5J4V A;  3I4N J;  4D7N A;  2RN7 A;  2E1C A;  2MAB A;  2BGC A;  3B73 A;  3CJD A;  2BY0 A;  1ZG1 A;  5IYD J;  1MMS A;  3JRH A;  3I4P A;  2EIK H;  4BQO A;  1XDU A;  3I55 I;  3P9T A;  3GCM A;  2LTP A;  4D5C A;  2MBF A;  3WGI A;  5EEG A;  4AM3 A;  2RDP A;  1VQ8 I;  1D8J A;  4Q5S F;  1FX7 A;  4G6D A;  3DPJ A;  4CGR A;  2XRL A;  1BR2 A;  1IW7 F;  1QQI A;  4ZDP A;  3TW6 A;  2L7Z A;  3BPX A;  1QO0 D;  1GHC A;  2DG8 A;  2ESH A;  1UI5 A;  2UWM A;  3HTH A;  5KHD A;  3BJA A;  4DNC A;  4IJA A;  2IBD A;  3KET A;  4XOR A;  5F08 A;  3RKQ A;  1ON2 A;  4OIN F;  2Z9O A;  1UHW A;  3E7Q A;  2EV6 A;  4RAF A;  4L18 B;  5EZG A;  2D1V A;  4FT8 A;  2VQL A;  2YPR A;  3GTK J;  1OCZ H;  2PMZ N;  4XKW A;  4ZYG A;  2OPT A;  4RS8 A;  3S1Q J;  3QPH A;  2FA5 A;  2Y69 H;  2QM3 A;  3WOD F;  5FLM J;  1LNW A;  4GGG A;  3ON4 A;  2CW8 A;  3CUQ A;  4D1Q A;  5M5Y J;  3A01 B;  1RET A;  3ANP A;  3KLN A;  5H6R A;  1IXC A;  1O7F A;  5J6X A;  3OYL A;  3BLY A;  1MKM A;  4G7O F;  4P55 A;  1BJA A;  1CF7 A;  1ITY A;  1SD6 A;  1JT6 A;  2BE5 F;  3OY9 A;  2VOO A;  2HQR A;  1P92 A;  5TJJ A;  1H89 C;  2VT3 A;  4KA4 A;  2A61 A;  2VJJ A;  4HPQ A;  4AF5 A;  1S72 I;  3CES A;  4IHW A;  2ZSI B;  2X1E A;  1JHH A;  2G7G A;  3ZP5 A;  3JRB A;  2JA7 J;  3BG5 A;  4YFK F;  3CF5 F;  2CWE A;  2WAQ N;  4HV6 A;  3CMA I;  2CUF A;  4XNF A;  1I1S A;  2XVC A;  4BHP A;  2E1O A;  2BBY A;  2HYJ A;  2P7C B;  5K1Y A;  2FRH A;  4FE4 A;  1UZC A;  1JE8 A;  4L0Y B;  2EFP A;  1ENH A;  4GXO A;  1WH5 A;  3ESW B;  2MC3 A;  3CUQ B;  4LLG F;  2GQQ A;  2IS2 A;  3S16 J;  4HW0 A;  2JMW A;  3I56 I;  4IZZ A;  5BS6 A;  4KN7 X;  3LMM A;  4K2E A;  4E7H A;  3VYS B;  2JVG A;  2D1H A;  2HGC A;  5EFY A;  4U0V A;  1XGO A;  3BTC A;  5E1W A;  1HST A;  1MD0 A;  2XGC A;  4M3F A;  2NOJ B;  2B1E A;  1A6Q A;  2JA8 J;  4FE7 A;  3WU0 A;  3PNV A;  2PLY A;  3BJB A;  1S8N A;  4A6D A;  1LDD A;  2EBI A;  2L7F P;  2LD5 A;  2ELJ A;  1KQ9 A;  2R4G A;  4AC0 A;  2BVM A;  4AC6 A;  1JHF A;  2DOE A;  1VQM I;  1HCR A;  1V55 H;  5H20 A;  1LDJ A;  1LDK B;  4TV7 A;  3CCJ I;  4P9U A;  1XN7 A;  2QA4 I;  1ZAO A;  4LLL A;  3QAH A;  1A5J A;  2V7F A;  2HXO A;  3EYY A;  2B0L A;  2QWW A;  4XMY A;  2BW3 A;  2IGO A;  2KZV A;  5E18 F;  3L09 A;  2IRF G;  3TO9 A;  5JHF A;  3JR9 A;  4M3D A;  4F91 B;  1U3E M;  3ZMV A;  4I76 A;  4UB6 C;  3WE3 A;  1IO2 A;  2DMP A;  3AG3 H;  1RES A;  4OIQ F;  1UST A;  1BI1 A;  1REP C;  4G7H F;  2L7K A;  1TT0 A;  4BKX A;  4KIF A;  5J4Y A;  1ZGW A;  4UY8 I;  1XGM A;  4MO7 A;  1TQI A;  5HLH A;  3DLA A;  1XB4 A;  4YFN F;  2DYS H;  3QWL A;  4A12 A;  1MMG A;  2PG4 A;  2DPU A;  1MNE A;  2B3W A;  4B1R A;  4IRH A;  5JR3 A;  4ENN A;  2VN2 A;  3B81 A;  2R5Z A;  5DYM A;  1X3Z B;  2PMH A;  4GFL A;  2K27 A;  1EH8 A;  3CC4 I;  3HOT A;  4HF2 A;  3PNT A;  2XAQ A;  4AIH A;  2NS0 A;  2ZB9 A;  3M3Y J;  1MJA A;  3HHG A;  3QYE A;  2BW3 B;  3CF2 A;  2YVX A;  2R7U A;  2V1X A;  3FMS A;  1Y8R B;  3MKW B;  3GFL A;  3X2Q H;  4D5F A;  4BE0 A;  4PK4 A;  3RI4 A;  1TLH B;  3QRF F;  2O5R A;  5BPD A;  1R58 A;  3R6S A;  4CUG A;  2RC4 A;  4IRG A;  3MZH A;  3ZRG A;  1HBX G;  2IGM A;  3G73 A;  4M9X A;  4QIW N;  1KU2 A;  3QBM A;  2HYG D;  5IP7 J;  2EFQ A;  3QPS A;  2GXB A;  4XN0 A;  2KDO A;  1DPU A;  3R4K A;  3O8H A;  2H8W A;  2F5E A;  2F6C A;  2OA4 A;  1KA8 A;  3HPH A;  3S14 J;  3FKJ A;  1MMD A;  2DAO A;  4XN3 A;  4XID A;  4BQA A;  2VE9 A;  2R5Z B;  4A3J J;  3DXJ F;  1P4A A;  3HSR A;  5ILU A;  1XG1 A;  1Z67 A;  2TDX A;  2QQ9 A;  2L9S A;  4PJJ A;  4A0Z A;  5DCM A;  2O61 A;  2M87 A;  3GXO A;  1KU9 A;  3I4M J;  4CCO A;  3EYI A;  3DKW A;  2ME6 A;  2K9S A;  3V8L A;  2R7Q A;  1D1A A;  1FC3 A;  3PFI A;  3OYI A;  4R79 A;  3FX3 A;  2QSH X;  1HF0 A;  2XSD C;  1IDZ A;  3FXR A;  5LLQ A;  3I3L A;  3CRJ A;  5FGM A;  4MFE A;  1STZ A;  5F6F A;  5GAD J;  1F4K A;  3LSH A;  2EZH A;  4WCG A;  1YW8 A;  3Q9V A;  3V8J A;  2MYS A;  2VXD A;  1MBJ A;  2P5L C;  5E3N A;  1J09 A;  5FKM A;  3N05 A;  2PBX A;  1X1D A;  4B43 A;  1SC7 A;  1ZK8 A;  3JAM K;  2DI3 A;  2MSY A;  4NBQ A;  1QHG A;  2DA3 A;  1E2X A;  3M4O J;  3H0G J;  2CFO A;  3K69 A;  1P4X A;  2JPB A;  2V9K A;  4BYY A;  4ACI A;  3MWM A;  1FOY A;  3GZ5 A;  2QGU A;  4WX9 A;  1QA6 A;  4CSW A;  5LFA A;  3BHQ A;  1SVL A;  5DCM B;  3MEX A;  4IQ4 A;  2ZJQ F;  4RAZ A;  3TED A;  3PUF A;  3F8N A;  1YX5 A;  2PBI A;  1VF9 A;  1FP2 A;  3FXM A;  3O8G A;  2KIF A;  4UNO A;  3ZMU A;  5K7H A;  1AA7 A;  4I0B A;  2UUZ A;  3OYH A;  4Y52 J;  2IA2 A;  1QPM A;  2Q24 A;  2G7H A;  4L0Z B;  5FJ8 J;  1XMA A;  2PFB A;  3JAM Z;  5LRS A;  3GLL A;  2K9N A;  3D5S C;  5DS9 A;  2UXH A;  3K2Z A;  2JPC A;  5FKN A;  1BW6 A;  1VQ7 I;  4IEJ A;  5H9T A;  4FQG A;  1X1C A;  5HLG A;  2PJP A;  4HQE A;  3CDH A;  4KMF A;  2HFH A;  5CJ9 A;  3KEO A;  4UDS A;  2P8T A;  4PDK A;  5F1R A;  1E3O C;  5FFX A;  5DM7 F;  2IW5 A;  4X0G A;  4X6A J;  2YX7 A;  3E5U A;  1VQ9 I;  2P6T A;  2ZKZ A;  3QP5 A;  4IOC F;  3LHQ A;  2LF8 A;  2HOA A;  2H1K A;  3V4G A;  4WXC A;  1IC8 A;  2FUG 2;  1XS9 A;  3K7A J;  4IHT A;  3KX2 A;  1RI7 A;  2EPF A;  3W3C A;  2EIJ H;  3E3V A;  3OL3 A;  5EZH A;  5TRD A;  3G4S I;  5HDK A;  3TOA A;  3COA C;  2YVE A;  4ENJ A;  4M3E A;  2ZXI A;  3M9A A;  3BC8 A;  4V19 K;  1WZ2 A;  2XB5 A;  2ZY9 A;  3I5U A;  1B4A A;  2XDN A;  4JYK A;  1KQ0 A;  1TW3 A;  4B8X A;  3J7A O;  1SVO A;  3HRU A;  1EH6 A;  2VT2 A;  3ECH A;  1K6O A;  3VSL A;  5EF6 A;  1T2K A;  3U21 A;  2RGV A;  3ZQG A;  3GO5 A;  5CQE A;  3CDI A;  1OCT C;  2QEX I;  2W57 A;  2HKX A;  4CXF A;  1MMN A;  3DCF A;  3IAM 2;  2RRE A;  4XSX F;  3H5A A;  3VSK A;  4BUP A;  4FX0 A;  4XKC A;  3ZQC A;  1GV5 A;  5IPA A;  2H1L A;  2Q0O A;  3CCY A;  4XM3 A;  4G94 A;  1XSX A;  2KQR A;  3KKC A;  2VC0 A;  3C2B A;  4ON0 A;  1P9Q C;  3GF2 A;  4RM3 A;  3ZMZ A;  4B3X A;  1G4D A;  3MN2 A;  1C0W A;  2P81 A;  1LVK A;  1O3S A;  1ZLJ A;  4G6T B;  4IL6 C;  2DO7 A;  3VFZ A;  1YJ9 I;  1FTZ A;  3AG1 H;  2ME0 A;  3AL0 C;  4P96 A;  2OU2 A;  1OJL A;  3JTG A;  4AWX B;  1Y6I A;  1WI3 A;  3FRQ A;  3KLO A;  3K4K A;  4QLC U;  3F8B A;  5IY5 H;  3HC7 A;  4PGH A;  3TL4 X;  3DP7 A;  1W5C C;  1HC8 A;  4E7J A;  5F0C A;  3LST A;  3JRG A;  2O8K A;  5E3M A;  2NX4 A;  2EFO A;  1IN6 A;  2BY2 A;  3ZGK A;  1LFP A;  1H9G A;  3OMY A;  3RZD J;  3LWF A;  1IRZ A;  5EGO B;  2D2W A;  2KRF A;  4ZTF A;  5J1R A;  4AUX A;  4LB6 B;  1R7J A;  2PN6 A;  1FOW A;  1W1W E;  2ZME A;  4CYC A;  1UG0 A;  2FOK A;  4IX7 A;  1PP8 F;  2M30 A;  3S17 J;  2DA6 A;  4MNU A;  3F23 A;  4Y7N J;  3GME A;  3WHC A;  2DCE A;  4CCL A;  4DJA A;  3HBL A;  3GLX A;  4AYB N;  3MFK A;  1OCC H;  1TT5 B;  2CU7 A;  5L3C A;  2Y0S A;  4E4H A;  3BRU A;  4J19 A;  1LPQ A;  1XSV A;  2DOD A;  4FET A;  5DCF A;  5D6E A;  1OCO H;  4EV0 A;  3PO3 J;  4LG3 A;  5CKT A;  2ZOY A;  2W1O A;  2H94 A;  1YHQ I;  1WWX A;  3K70 C;  2DQL A;  1JGS A;  3HTU A;  4DQ2 A;  2HDC A;  4M72 A;  3ABL H;  3RYR A;  5D8L B;  4ZYH A;  1D5Y A;  4KYW A;  3BOQ A;  3VYR B;  1ETW A;  3TP0 A;  1PJR A;  4HX8 A;  1OYI A;  4HF0 A;  1T38 A;  2NP5 A;  3BDD A;  1MBF A;  4HDU A;  1FOK A;  5KVR A;  2Y31 A;  3RZO J;  2XGD A;  1P7I A;  4BAC A;  4CYC B;  2ZME B;  1Y8Q B;  2E35 A;  4N9I A;  1AHD P;  1ZGJ A;  4RGS A;  4ZTJ A;  4D7M A;  1L0O C;  4HDV A;  2F07 A;  1T56 A;  4YII A;  2L4M A;  3LWJ A;  3OV8 A;  2BEO A;  1UCR A;  4JX4 A;  2JWT A;  4XK4 A;  2W84 A;  3CLQ A;  4IO9 F;  1RR8 C;  4MXM A;  2HQ5 A;  1BC7 C;  4PFO A;  4BBS J;  1QZZ A;  1F9N A;  3SZG A;  2E1M C;  3TDU C;  3LSJ A;  5BQT A;  4PSX A;  2RAS A;  4A6E A;  4ZZL A;  1JUS A;  2V57 A;  4MTE A;  2FMY A;  3H35 A;  2UXO A;  2V9P A;  4C30 A;  3BR5 A;  2P0W A;  5HS8 A;  4QSH A;  1FMV A;  3IL2 A;  3HRM A;  3NAU A;  1IGN A;  3E97 A;  4HNU A;  3HIF A;  1TP4 A;  1Z7U A;  3DLL F;  3HTA A;  4YIF A;  2XF5 A;  2R7S A;  3CP8 A;  3WTT C;  1RPW A;  2HPM A;  4ESB A;  4GO1 A;  1JT0 A;  2VOD A;  4DW6 A;  3OYF A;  3W6J B;  3W2W A;  4EVI A;  1Q1H A;  2B9S A;  1H8A C;  5LGU A;  5AIQ A;  1WJA A;  1R00 A;  3F8C A;  4F55 A;  3PFY A;  2K86 A;  4BQQ A;  5CYV A;  4FAS D;  2UZK A;  1FLI A;  5AIP A;  5DD4 A;  2FU4 A;  1KYZ A;  4JBA A;  4UB8 C;  3S2W A;  5HNH A;  2QEN A;  4BY1 J;  1DGR M;  5D19 A;  1TW2 A;  5FRO A;  2EK5 A;  2KZG A;  2OCE A;  2JSC A;  5KAI C;  1WJE A;  2CMP A;  4L62 A;  1SMY F;  3BCA A;  3JCU C;  3CMM A;  4NDL A;  4ZYE A;  1YE9 A;  1YIO A;  3IUO A;  3VYU B;  5H6Q A;  4WXH A;  4AIK A;  2W48 A;  2MH2 A;  4B09 A;  4I01 A;  2QIB A;  3J81 K;  2W24 A;  1UHM A;  5JI6 A;  2EFN A;  2DLL A;  2V1N A;  4Y15 A;  2VIX A;  1R23 A;  3FM3 A;  1D0Z A;  1BI2 A;  3A4C A;  2HI3 A;  3F1B A;  1MND A;  2M4K A;  3IWF A;  2JA2 A;  1JKQ C;  1X1P A;  2L9V A;  4II3 A;  3GFJ A;  4BL0 B;  2TCT A;  3F0C A;  1F1Z A;  1YX3 A;  3OR1 C;  4BJT A;  2CQ7 A;  2JRM A;  2R7O A;  3TOB A;  3Q9S A;  2GUH A;  3RPQ A;  2Y30 A;  3KE2 A;  5CLS A;  5E8I A;  3RQI A;  2WV0 A;  4HX7 A;  3K4C A;  4LD5 A;  1TC3 C;  3RCO A;  5KNL A;  3U1D A;  2L01 A;  3QU3 A;  4PUS A;  5D4R A;  2DTR A;  5DUK A;  2D5V A;  3HYI A;  3J81 Z;  2IGN A;  2XV4 S;  5FKL A;  3IHU A;  4KIC A;  3JRA A;  4H4K C;  1IDY A;  1R1V A;  1MBG A;  1ETV A;  3ERM A;  3ROU A;  1P6R A;  1VTN C;  3CC7 I;  4KFC A;  3ZMS A;  4L9N A;  2Z2S B;  4N4N B;  1PVE A;  4ICH A;  2FXA A;  4U87 A;  3L2Q A;  5ICG A;  4GCL A;  1ETY A;  1SVM A;  2VKV A;  2AXT C;  2GXG A;  2BZT A;  1X2N A;  4C9Y A;  1A04 A;  1X1A A;  1YTY A;  3H9G A;  3R0A A;  4N0B A;  1Y0N A;  4CZZ A;  1ZG5 A;  4O6J A;  1LQ1 A;  3HRS A;  4C2U A;  1K61 A;  3TDZ C;  3BZC A;  5HBU A;  2D6Y A;  1IN7 A;  3O60 A;  4MIM A;  4CH7 A;  3GTP J;  2DU9 A;  2M5W A;  4F3Q A;  2ZJR F;  1Z6T A;  4XBF A;  4DYC A;  1IAW A;  2BY1 A;  3H9J A;  1BOB A;  1KYW A;  5BPI A;  1RUO A;  1K4S A;  2OZU A;  1JXS A;  3TKY A;  3AAF A;  3S2H J;  2CH0 A;  4NB5 A;  1SFU A;  5E1X A;  5M3F J;  1Z3Y A;  3SFZ A;  3B02 A;  4GRI A;  3G1O A;  2JQ7 A;  4BS9 A;  3AQT A;  2FX0 A;  3L2W A;  2DT7 B;  1J7K A;  2XAH A;  4HZF A;  4CO8 A;  3H3V K;  3A01 A;  3UNG C;  5F27 A;  1QHH D;  3E5X A;  5IOZ A;  4U0W A;  1QVU A;  1ZH5 A;  3KKD A;  2LR8 A;  2H09 A;  1K4T A;  2VC1 A;  4NQW A;  2OER A;  3T1B A;  3H5N A;  3BRO A;  3C3W A;  3VVX A;  1U5T C;  2FSW A;  1S9H A;  2MLG A;  2HYF A;  2MLK A;  3L2U A;  2KT0 A;  3LQQ A;  2K40 A;  3VB2 A;  2HOS A;  3S1R J;  5J47 A;  4PXI A;  4M6Y A;  1WJC A;  3BZK A;  3OYA A;  3CJR B;  4W97 A;  2FJI 1;  2REK A;  4AID A;  3J7A Y;  3O3K A;  2DMT A;  3DEW A;  4XKB A;  2FQ4 A;  5JLX A;  2E34 A;  3SDB A;  5FGL A;  3BT9 A;  4HYE A;  3VUQ A;  5DM6 F;  3ZXS A;  5E1Z B;  5E20 A;  1G3Y A;  3R61 A;  4KMU X;  3WGH A;  2IEK A;  4XKV A;  3HTI A;  5M5X J;  2LMD A;  5K5O A;  2OTJ I;  2HQA A;  1FEX A;  1LFB A;  2KRH A;  1TTY A;  2QQ8 A;  3KZ9 A;  4C2T A;  2V6C A;  3LA3 A;  3E6M A;  4NQW B;  3M8J A;  3MZY A;  4RLQ A;  1ODD A;  1GXQ A;  4B48 A;  1ACI A;  2VQC A;  2E19 A;  2NYX A;  4A3E J;  3I58 A;  3DKX A;  1TWF J;  2Y0M A;  3M8F A;  5FO5 A;  4BXX J;  2QKL B;  3ASN H;  1BJZ A;  4KIB A;  1PUF A;  3OIQ A;  3LSK A;  1R1U A;  4KJZ A;  4BHC A;  1MJ9 A;  2G7S A;  2G7L A;  1FWZ A;  1X2M A;  2GFN A;  5K7Z A;  2X48 A;  2XF7 A;  4YFX F;  3BNI A;  4A3I J;  3G56 A;  3G71 I;  3GTM J;  3CCS I;  1EV7 A;  4F52 A;  3LJL A;  3FXQ A;  2OTL I;  2JUC A;  2GXA A;  2LK2 A;  3ZMT A;  5HLT A;  2WTE A;  3MKZ A;  1ON1 A;  3OOU A;  3A02 A;  2KJB A;  3W2V A;  3ANG A;  3K1N A;  2ECB A;  3ZQL A;  4OMZ A;  2ISY A;  4BH9 A;  3OIP A;  5B1A H;  4MK6 A;  2M0M A;  3VOE A;  2LH9 A;  2DA5 A;  3H92 A;  4EMS A;  2NVQ J;  2LBF B;  2QYO A;  3OYM A;  5D4S A;  3C7J A;  2LKP A;  5GAE J;  2ZFW A;  2IU5 A;  5FKK A;  1QNT A;  4M9S A;  4UUS A;  1A36 A;  1ZRF A;  3LAJ A;  3V8K A;  1T95 A;  4XOP A;  1ORK A;  1Z91 A;  2K3P A;  3RYP A;  1HKS A;  3IRQ A;  1W36 D;  5ICE A;  2GWR A;  1U9O A;  1PUF B;  2DA1 A;  4EJV A;  2EZL A;  4FCY A;  2FBQ A;  1X1B A;  3IKV A;  5DEQ A;  1Z7L A;  4J01 A;  1DU0 A;  4L5J A;  4L9V A;  4JNN A;  2ICW G;  3VP5 A;  4A0X A;  5LHI A;  3OS1 A;  3OOP A;  3C18 A;  1OCR H;  3G1M A;  5EEA A;  1L3L A;  2QUF A;  3KZY A;  2LNB A;  3OSF A;  2VKE A;  3DPU A;  2R7Z J;  5FLV A;  1YFH A;  2IS1 A;  4PCQ A;  4FX4 A;  1YW9 A;  1XMK A;  3M1E A;  2AHQ A;  4G7Z F;  2JRT A;  2M4G A;  1SFO J;  5HLI A;  3K8P C;  3T8R A;  2LY9 A;  2QCO A;  2Z1D A;  4O3M A;  2BYV E;  4F92 B;  1MW7 A;  2Y9Z A;  5DDG A;  1DUX C;  4UUS B;  3P7N A;  3JRF A;  2FE3 A;  4M73 A;  1XD7 A;  2LC2 A;  3DBL B;  3SEQ A;  2VUM J;  2GIZ A;  1ZRD A;  2N8G A;  1QGP A;  3FMQ A;  1YIT I;  3TP3 A;  3L2C A;  3QYF A;  4WF2 A;  1NK3 P;  2IT0 A;  3VW2 A;  2JZY A;  5D5X B;  3BG3 A;  2IS6 A;  5B3S H;  3HSE A;  2LY2 A;  2GA2 A;  2L7M P;  3K1P A;  4JOM A;  2HDW A;  1ZQ3 P;  3L00 A;  3I71 A;  2Q2E A;  3N97 A;  2V4J C;  3KP4 A;  3WU2 C;  1XMX A;  4A3L J;  3K2A A;  1WJ5 A;  3FIS A;  3CJQ B;  3RKX A;  3ZMD A;  3ZQ7 A;  2JA6 J;  3GWZ A;  3EET A;  5GTH C;  1W4M A;  4BJ6 C;  2LY1 A;  4RGR A;  3DTE A;  3CD6 I;  2WY8 Q;  3BPV A;  5DD8 A;  4GDF A;  3AFH A;  3MCZ A;  2W25 A;  3OWT A;  2KJC A;  1SGM A;  3RIR A;  2HS5 A;  5IOY A;  3OYE A;  4DVY P;  3Q0W A;  1U5T A;  4G8X A;  1JJ6 C;  2NS7 A;  3AKZ A;  2A07 F;  5C4X J;  1AKH A;  3HB9 A;  1KGS A;  4M9Z A;  4RA2 A;  4NHJ A;  3WTX C;  2K5C A;  1OQY A;  5GAH J;  4UV9 A;  4Q48 A;  3VTI A;  3WTV C;  5ILS A;  2X6Y A;  4PGG A;  3CO7 C;  2ZJ2 A;  2X1D A;  3HOU J;  2Q2E B;  3GBG A;  2LP0 A;  5EDN A;  1OPC A;  1OYW A;  4ESF A;  2VL8 A;  2DA2 A;  5CXI A;  3HTJ A;  2WB1 A;  2Y75 A;  5HNF A;  3NQO A;  1K83 J;  3HL2 A;  5IP6 A;  4KUM A;  5FB2 A;  1ZAR A;  4LGW A;  2QLZ A;  2E36 A;  2XHK A;  3KP2 A;  4X1E A;  2F4M B;  2W82 A;  3CJT B;  1HSJ A;  4XLN F;  1Z0X A;  3KYC B;  1UAA A;  1I6H J;  1WVR A;  2L3D A;  3SYT A;  1RZ4 A;  1V3F A;  1U5T B;  2XF6 A;  3S93 A;  2OI8 A;  4UV8 A;  1AKH B;  1HA8 A;  3KEQ A;  2MD0 A;  3KNW A;  2DFF A;  2HVS A;  2GZW A;  2JK3 A;  4ZYD A;  1LE8 B;  2J5O A;  2G0E A;  1JI8 A;  1KQ8 A;  2VPR A;  3F6V A;  1ZLK A;  1WFX A;  2KHM A;  3S5R A;  3CLO A;  2JA5 J;  2NAZ A;  2FQ3 A;  3ELK A;  3LFU A;  3DPT A;  2NVT J;  3NPI A;  2EIM H;  3FM5 A;  1UHS A;  3HGG A;  1T0F C;  1Z05 A;  4OAZ A;  3G3Z A;  2GEN A;  2ZSH B;  3DU5 A;  2R0Q C;  1Z9C A;  4DOZ A;  4IHY A;  1GVD A;  4EJT A;  2LDU A;  3GYH X;  5IP9 J;  2HZD A;  5ILV A;  4NN1 A;  2OV7 A;  1TWC J;  2QTQ A;  4U0Y A;  2PMU A;  5LHG A;  5FHP A;  1JUP A;  3DU6 A;  2DT6 A;  1YW7 A;  2X9D A;  5EYR A;  1T39 A;  3GTQ J;  4MHG A;  1RKW A;  3CO6 C;  1HKT A;  3LL7 A;  2DJI A;  1IRX A;  3P9I A;  1XCB A;  4ZH4 F;  4HEA 2;  5D5W B;  4CDG A;  2R7W A;  2Z16 A;  4MTD A;  4RMN A;  2CG4 A;  1D0X A;  1Z21 A;  3PNY A;  5LGT A;  3L9F A;  3F8F A;  2XPV A;  1LEB A;  1OMI A;  5HS9 A;  5ICF A;  3H5R A;  2V6E A;  1U8B A;  3MD2 A;  4N4O B;  4HRI A;  1B9M A;  5E3O A;  2BXZ A;  4G6Q A;  3TO7 A;  2QBY B;  3E7L A;  5CQG A;  2GBY A;  1UEL B;  1OYY A;  2IA1 A;  2XGX A;  3F6O A;  1NG7 A;  4I0A A;  2BHZ A;  3HGY A;  3T5X A;  4DYQ A;  5H2F C;  3ONQ A;  3R0J A;  1X4O A;  4EJO A;  3HJE A;  2CQX A;  5EGO A;  3QPT A;  4NC7 A;  1V4R A;  5IT9 K;  3O2P E;  1Y0U A;  1XSD A;  2VOP A;  1YRN A;  2H8R A;  2MC4 A;  4RDU A;  3KZI C;  1F5T A;  1I50 J;  3KPH A;  2DMQ A;  2FD5 A;  1V54 H;  3UR3 C;  4U88 A;  1TZL A;  3OYC A;  2IXS A;  3M1C A;  2UXP A;  2DJN A;  1FBQ A;  4ITV A;  4II2 A;  2NVU B;  1ZTR A;  3E0J B;  3F72 A;  4H0E A;  1O3R A;  3R60 A;  4U9L A;  5DAJ A;  5K5Q A;  3I9V 2;  1B9N A;  3GZI A;  4ESJ A;  4BDY A;  2K4B A;  3IH2 A;  3OL4 A;  3HSF A;  3HOY J;  2CQN A;  2FBH A;  5JHU A;  1K78 B;  1FYK A;  3DBR B;  3TBI A;  5K58 A;  2XAU A;  1D8K A;  1BI0 A;  3G6E I;  1RRJ A;  1HDD C;  4CGZ A;  3AQS A;  2K9M A;  4OIP F;  1JUM A;  3VVZ A;  3JSP A;  1VQP I;  2Y0S N;  5IT9 Z;  1UG2 A;  2K9Q A;  2XKP A;  1DGW Y;  3QPL A;  2M9H A;  3BCB A;  4P5O A;  2QF7 A;  2V1U A;  1IUF A;  3JRI A;  2R7D A;  3PQK A;  1SEU A;  1YRN B;  3CWR A;  2IVM A;  1RIO H;  3T0Y A;  4O5V A;  2GAU A;  2DQR A;  2M1B A;  1APL C;  2KLO A;  2R7F A;  3V78 A;  3D0S A;  4EM2 A;  1FIP A;  2LRD A;  4KNY A;  3DFG A;  2OZ6 A;  1A31 A;  3JSJ A;  3EUH C;  2QOP A;  3F3X A;  3I59 A;  1HW1 A;  2W7N A;  2FBK A;  4NUB A;  2OF7 A;  2DA4 A;  4ZC3 A;  1W0U A;  3CZ6 A;  2R7V A;  1U78 A;  3MNL A;  4UVA A;  2VQG A;  5K5R A;  1XGS A;  4Y33 A;  2EA4 A;  2P6S A;  1OR7 C;  3CCE I;  4MFD A;  2LG4 A;  2ZNZ A;  3LQR A;  2ZCW A;  3G2B A;  2L5Q A;  1WJF A;  1MBH A;  4LOC A;  2VPL A;  2YX4 A;  1R5G A;  3JW4 A;  2Z33 A;  3VW0 A;  2DMN A;  3LSR A;  5FMP A;  2XC7 A;  3I0T A;  5JVG F;  3Q0U A;  1PP7 U;  3PUB A;  4MGR A;  3SFI A;  5DUI A;  3DWL E;  1W5S A;  4JK1 X;  3WHB A;  2O6G E;  1B8I A;  1RKT A;  1BOA A;  1LB2 A;  4JKZ A;  2V9V A;  3ZQI A;  2A6H F;  2KIM A;  3A03 A;  2E5Z A;  4UVC A;  2R7T A;  5J40 A;  1BW5 A;  2EZI A;  3I59 B;  3KP7 A;  1CQT A;  2ZCM A;  2O03 A;  1I6X A;  5E8G A;  3SEZ A;  2GOM A;  3U1K A;  2TRT A;  2DFE A;  3EPZ A;  2HXI A;  4XLE A;  4A3K J;  2W85 A;  3S1N J;  4BDZ A;  3WU1 B;  3FWE A;  2DW4 A;  2FNA A;  4C3H J;  3JRE A;  4PZJ A;  3P9K A;  4QWQ A;  2RNG A;  3OYG A;  1Y39 A;  3GZN B;  4KT5 C;  1YS7 A;  4LG0 A;  3WTS C;  3WG7 H;  3ZN0 A;  4HQM A;  2UXI A;  3FHZ A;  4AVZ A;  3MKY B;  2E71 A;  5TGT A;  5ED4 A;  2FOW A;  1X3W B;  2R7X A;  5CVU A;  5CVR A;  4ETS A;  3VEP A;  2FML A;  4I99 C;  2ECC A;  2ELK A;  3DTK A;  3I53 A;  4HA8 A;  5F0H A;  3CUQ C;  1B8I B;  1YJN I;  1YQA A;  2AQE A;  2XKO A;  4Y17 A;  3IP4 B;  4CIC A;  2HKU A;  1OIS A;  5CVV A;  3WTZ A;  4AD9 A;  5GAG J;  4CA0 A;  4XQF A;  4I2O A;  2WAF A;  1ERD A;  3AG2 H;  2QQA A;  4CHU A;  3CJN A;  4XLA A;  2Y48 A;  4UUV A;  2EV5 A;  2W4S A;  4M71 A;  2MA3 A;  4KIG A;  2O8X A;  1IN8 A;  2HTS A;  2BOL A;  4LIV A;  5L3F A;  2KL4 A;  3ZOB A;  5LEK A;  4HV5 A;  2FEZ A;  3QOE A;  1ZRE A;  1IRF A;  3U9G A;  4LG0 B;  1EKE A;  3LA7 A;  4E7S A;  3LFK A;  1BA5 A;  4GFB A;  1R22 A;  3FZV A;  4LMY A;  3RKW A;  2MGQ A;  2PX9 A;  3V6G A;  2M0C A;  2HOE A;  2VBW A;  3KP5 A;  2IJL A;  1TQM A;  2KIU A;  4IHV A;  1S7A A;  1WI9 A;  4WXD A;  2DG7 A;  1O57 A;  3MQ0 A;  5EG0 A;  1KU7 A;  1DPR A;  1R1T A;  2XSJ C;  1ZR2 A;  1IJW C;  3LSG A;  2FBI A;  5JFR A;  4A5M A;  5IYB J;  3SZP A;  2PJR A;  4EM0 B;  1HW5 A;  2M2E A;  2YSR A;  1ZN2 A;  3IAS 2;  3BR3 A;  3BCG A;  2HNH A;  2LOO A;  3HUG A;  3HOX J;  2PZ9 A;  1SD5 A;  1FYM A;  5A2Q K;  4FTH A;  1E17 A;  2RNJ A;  2NP3 A;  3Q0V A;  4S04 A;  1Y56 A;  1SFX A;  1ZGA A;  3K0L A;  2WWY A;  1V5G A;  4NC6 A;  3NI7 A;  1BR1 A;  4XSZ F;  1K79 A;  1MMA A;  2STT A;  1FSH A;  2VBZ A;  4M74 A;  5LBQ A;  2EIL H;  1SD7 A;  2STW A;  1POG A;  2YUS A;  3MKL A;  3HDD A;  1YJW I;  2WA0 A;  4ZDL A;  3VYT B;  3S2D J;  2VKH A;  1KON A;  3W6K B;  3A1Y A;  4HG2 A;  1S29 A;  2XAS A;  5EG0 B;  3RH2 A;  2VBY A;  5CVI A;  1WH7 A;  1MDM A;  3T6N A;  2AO9 A;  4EGY A;  4GCT A;  2PJR B;  5CW8 A;  1T98 A;  5A2Q Z;  1YLF A;  2ZC2 A;  1P7J A;  1V5F A;  3J7Y J;  2YU3 A;  2KRC A;  4HAM A;  1ZR4 A;  1FT9 A;  2A6T A;  1PDN C;  3K4B A;  2BXY A;  4F93 B;  2V79 A;  3HUG B;  2CRG A;  5JLW A;  5JVT A;  2FNP A;  4KDP A;  3OYB A;  2NRA C;  4LIU A;  4RLF A;  4EEF G;  3IC7 A;  3K70 D;  2X85 A;  2CW0 F;  4BEH B;  4DZP A;  1O4X A;  1QZY A;  3B6A A;  3ML6 A;  2QSG X;  3ON2 A;  4OIR F;  3RD3 A;  2YS9 A;  3K4M A;  3EUH A;  3K10 A;  1ZRC A;  5D1R A;  2HZT A;  4MEY F;  1FSE A;  3LSM A;  3D5L A;  4OWR B;  3AL0 B;  4PJM A;  4IHS A;  3JTH A;  3NWT A;  5HS7 A;  4ABZ A;  4PJ0 C;  1YIJ I;  4YRV A;  1H9T A;  2LKS A;  2CYY A;  3HM5 A;  2HVR A;  4PJL A;  2YVH A;  2XAJ A;  4M6V A;  2XB0 X;  3GZ6 A;  3HOW J;  2A3S A;  2CFX A;  1ETX A;  2CW7 A;  3FHN A;  2JTV A;  3CDL A;  5AON A;  2E60 A;  2K9L A;  3FXU A;  4DBQ A;  3W2A A;  4A2U A;  3WG9 A;  4BBR J;  3S1M J;  1MDM B;  2M8E A;  1ZHF A;  3S8P A;  3DBH B;  3HKZ A;  4WK8 F;  1I27 A;  3FDY A;  4HNV A;  3ZR8 X;  4CYD A;  1TBX A;  5ERI A;  1F43 A;  1QBJ A;  4BXU A;  2PI0 A;  1FY7 A;  1S7E A;  1D0Y A;  3BG6 A;  2VE8 A;  4NC8 A;  1G2H A;  1U6G A;  3H36 A;  1S3J A;  2NXN B;  3BR2 A;  4W1U A;  5D8K B;  3HE0 A;  3ULQ B;  1HLV A;  3E6D A;  3QOP A;  4KIT B;  1DU6 A;  1NTC A;  1UFM A;  3PL8 A;  1XC5 A;  2ZNY A;  3DEU A;  2F4I A;  3HHH A;  2ZXH A;  4RB1 A;  1LUJ B;  4IRI A;  2W00 A;  3ABK H;  5LEJ A;  1X3U A;  2OJE D;  1GLN A;  2CJJ A;  1U0J A;  2E2J J;  3EUK L;  4QPQ A;  3RTR A;  1U9N A;  1VFC A;  2MG4 A;  3FK6 A;  2COM A;  3BTJ A;  1MIJ A;  3RDI A;  4BJ5 C;  4DIQ A;  3L2R A;  1MBE A;  3BJ6 A;  2LBF A;  3BP8 A;  1VI0 A;  4B3A A;  3IH3 A;  5HVQ C;  2CSO A;  3BR0 A;  1V5E A;  2ACJ A;  1JKR C;  2ETH A;  1BL0 A;  1N25 A;  4M6X A;  4XIC A;  4Q47 A;  3OYD A;  3OSG A;  3ZN1 A;  5LRR A;  1IG7 A;  3BR6 A;  3CCM I;  2M8G X;  3FKI J;  2XPW A;  3GFI A;  3HPG A;  1DP7 P;  1U2W A;  2OUM A;  1TL8 A;  2PFV A;  2PEX A;  2WV1 A;  4CCM A;  3B6C A;  4OOI A;  1TQP A;  3ERE D;  3BG7 A;  2OQR A;  2HPI A;  2VKD A;  2B63 J;  5HSZ A;  4KN4 X;  2PMZ A;  4M3G A;  4IXA A;  1Z3X A;  5GP9 A;  2M7B A;  4Z2Y A;  3F22 A;  3CQZ J;  4ENM A;  4OD4 A;  2ZFU A;  2E1M B;  5E17 F;  1IN5 A;  1MGT A;  1WPK A;  5L3D A;  4BGD A;  1NH3 A;  1P4W A;  1IRG A;  2R93 J;  2NVY J;  1N75 A;  2MD5 A;  4XLH A;  2F2E A;  2VI6 A;  4A3G J;  3Q3S A;  1FJL A;  2E5N A;  2L0K A;  3K4J A;  5J8C A;  3SWH A;  3M8E A;  1FOX A;  1FZP B;  3H3U A;  4OAY A;  3DKY A;  4UXN A;  5BOX A;  2ID6 A;  1NG6 A;  2HQN A;  3DTI A;  2ZXJ A;  3PO2 J;  2DBB A;  4LIT A;  1X4P A;  2R5Y A;  1HKQ A;  3K4N A;  2QKM B;  4C2M J;  4A3B J;  3RJP A;  3H9Q A;  3K4L A;  2C6Y A;  3KZZ A;  2WAQ A;  1MH4 A;  5ICC A;  4MEX F;  3P9C A;  1CF7 B;  2ID3 A;  5L3E A;  3OS0 A;  4C2M A;  4AU7 A;  1GVJ A;  5CXG A;  2X51 A;  5HDG A;  2EB7 A;  1QVT A;  1KU3 A;  2DMU A;  1B72 A;  1J0R A;  4Q4Z F;  4JX5 A;  3BY6 A;  2ZCN A;  1LVA A;  2HDD A;  3HOZ J;  4WIB A;  5HDN A;  2E7X A;  4A3F J;  1DDN A;  4WWC A;  4XLC A;  3E1S A;  3VDX A;  4V2G A;  1EJ9 A;  2CV1 A;  2RVC A;  1LFU P;  1QU3 A;  1JKO C;  4E7Z A;  3NS4 A;  1JTY A;  3FXL A;  3M7G A;  3PQJ A;  2UXN A;  2F4O B;  2H6B A;  2FJ1 A;  2GOX B;  2KP6 A;  3D5R C;  1IXS B;  4IVN A;  3RQ4 A;  3KYD B;  4EAT A;  3VVY A;  1T33 A;  1EH7 A;  2VLA A;  2BY3 A;  5BNG A;  3LA2 A;  3O6B B;  2R5Y B;  2WAE A;  3MAJ A;  4IKF A;  3CP2 A;  2ZCX A;  4L9J A;  1IV6 A;  2EWN A;  4HOB A;  5F04 A;  2A2F X;  3SZT A;  3COL A;  2EA2 A;  2K02 A;  2CS3 A;  2OBP A;  2XDV A;  3VOK A;  2VJ4 A;  2Q1Z B;  5TIS C;  3ZQQ A;  2EH3 A;  1TWH J;  5F64 A;  1E0E A;  4HBL A;  1I3A A;  3K9T A;  1J2X A;  4RAG A;  1XPX A;  1Q1V A;  1B72 B;  1MSE C;  1ULY A;  1VQ4 I;  2I8D A;  1OLT A;  1SMT A;  2WY7 Q;  2X6X A;  3CCL I;  3RPU D;  4BE1 A;  3K6G A;  3CMY A;  1ZKG A;  1GXP A;  3WGG A;  1GDT A;  1W5T A;  1CGP A;  5BMZ A;  2ADU A;  4XRS A;  1XGN A;  3GVA A;  1JKP C;  2F48 A;  1D1B A;  1G8X A;  1LKX A;  3MVP A;  1ZYR F;  4LB5 A;  1SFE A;  1XTA A;  4OMY A;  4MQV A;  2JVH A;  3DV8 A;  4L5E A;  2L4A A;  2ZOZ A;  4RM2 A;  5F0F A;  2GIV A;  2OD5 A;  3RPU A;  3PPB A;  1O7L A;  3HG9 A;  2DTZ A;  4LK1 F;  3MMY B;  2X6O A;  3CTA A;  2VQH A;  9ANT A;  2G3B A;  1I5Z A;  1OFC X;  1JGG A;  1FBS A;  2MFZ A;  2XPU A;  4E7L A;  3IRR A;  4NEL A;  3SHF A;  2ZME C;  5J1U A;  2G7U A;  2BV6 A;  2ZXW H;  2F5D A;  2K4J A;  2QSF X;  2HU9 A;  2K85 A;  2WB1 N;  3SQN A;  3BTI A;  2H27 A;  2O9L A;  4CCJ A;  5KCM A;  2RQQ A;  3ZPL A;  1LE8 A;  2Y9Y A;  1K7A A;  5FLX K;  5D18 A;  4LJZ F;  2XIG A;  3ABU A;  2Y2Z A;  4DYR A;  3VOX A;  2LF7 A;  3VWB A;  4EJW A;  4G12 A;  1HOM A;  1OCP A;  1BR4 A;  4BU2 A;  2F5V A;  3A0H C;  3HIM A;  2DT5 A;  3DPL C;  1QRY A;  3VW1 A;  4XOT A;  2OAZ A;  2F5C A;  3F9K A;  2E7W A;  3FBI B;  3NEU A;  2CGP A;  1IUY A;  2MH9 A;  1J5Y A;  3F21 A;  3KEY A;  2KIQ A;  3Q5F A;  3PIP F;  5GPA A;  4IHX A;  4QTR A;  1USS A;  3KP3 A;  2Z5U A;  4B47 A;  2KIS A;  5FLX Z;  3QP6 A;  3DQV C;  3ISP A;  3NNR A;  1Y1V J;  4ZYA A;  2CUJ A;  4JX6 A;  3QQA A;  4IOA F;  3NRG A;  3GTG J;  3GUD A;  3SXY A;  5IT3 A;  2WC2 A;  3ZCO A;  1WJD A;  4L5I A;  3QYB A;  2IAI A;  4N9H A;  4EJU A;  2DOF A;  4OIO F;  2LVS A;  2A5W A;  2LLK A;  3FXJ A;  3QKX A;  2AQF A;  1R4N B;  4U9N A;  1FIA A;  2A69 F;  3V7R A;  2M45 A;  1W0T A;  3IKT A;  2HTJ A;  3OIO A;  5GTI C;  1Z6R A;  4E6K G;  2QQB A;  3ECO A;  1S5L C;  3CUO A;  1FBU A;  2QBY A;  1BI3 A;  4LLN A;  5FFZ A;  4BHB A;  4A69 C;  2CV0 A;  3PIO F;  4YG2 F;  3W6V A;  2RQP A;  1VQ6 I;  4CZC A;  1SFK A;  4YIR X;  2P5K A;  4C3J J;  4RGU A;  2VON A;  1BIB A;  2LSO A;  3PSF A;  5F1J A;  5K7F A;  3S15 J;  4HST A;  2HOT A;  2Q8K A;  1WCM J;  2A68 F;  3LSI A;  3AG4 H;  4D0P A;  3C2H A;  4DZJ A;  4Z6Y A;  1R5H A;  3MZ8 A;  1UJ8 A;  4BE2 A;  2A6E F;  2LRE A;  1WKM A;  3OYJ A;  2J5P A;  1GUU A;  1MSF C;  1TNT A;  4YEJ A;  3A2K A;  2HVQ A;  1D5V A;  3FMR A;  2E1N A;  1MNM C;  2DK8 A;  2F5F A;  2XAF A;  1N78 A;  1MZB A;  3HOV J;  3SJM A;  4I7H A;  3CC2 I;  2LKX A;  1RNL A;  1WRJ A;  4QPO A;  3V7S A;  1K78 A;  3BQZ A;  3NRV A;  4R1H A;  5C44 J;  2VAS A;  4AIJ A;  5E3L A;  3S3N A;  1R49 A;  3GTO J;  1H88 C;  1I1G A;  3H3Z A;  4MQ9 F;  1HW2 A;  4Y13 A;  1WHU A;  2ZO4 A;  4CCN A;  2VJ5 A;  1BIA A;  2MW8 A;  4C3I J;  2K7L A;  3P5J A;  4HX4 A;  3EUA A;  3U2R A;  4XR6 A;  2VXZ A;  4B44 A;  2R3S A;  1RR7 A;  5IYC J;  4KWA A;  3NWS A;  1P2F A;  2EQR A;  1IN4 A;  5FRM A;  3IUV A;  5E79 C;  2L02 A;  3BZ6 A;  4PSW A;  2EJR A;  1XDS A;  3T8T A;  1AU7 A;  4IPA A;  3KFW X;  4EQQ A;  2AS5 F;  3L7W A;  4P9F A;  4DGW B;  1R36 A;  3HZJ A;  1BM9 A;  4GYI A;  3LNQ A;  1VQK I;  1FP1 D;  5LHH A;  1R71 A;  2O0Y A;  4HLX A;  2HEO A;  2W53 A;  3HRT A;  5HOD A;  4LK0 F;  1HQC A;  3PSI A;  1BN5 A;  2V26 A;  3PJR A;  4U7B A;  3NXC A;  5KK1 A;  1Y1W J;  2GLO A;  1HDP A;  2OC6 A;  4NNJ A;  3TMO A;  1VZ0 A;  3CCR I;  2YU9 J;  1S7O A;  2GM4 A;  1IV8 A;  1B1B A;  3IV5 A;  2UV1 A;  4B4C A;  5LD2 C;  2EFW A;  1N77 A;  4I02 A;  1ETO A; 
#chains in the Genus database with same CATH homology
 3C07 A;  1XG1 A;  3FIW A;  2KDZ A;  3GTL J;  5IYB J;  1BJZ A;  3G1L A;  2M2E A;  1PUF A;  4M3B A;  3I4M J;  4V2F A;  2G7S A;  2G7L A;  2ME6 A;  2K9S A;  3BR3 A;  3BCG A;  1X2M A;  2GFN A;  5K7Z A;  2X48 A;  3BNI A;  3G56 A;  4A3I J;  3HOX J;  2CUE A;  3GTM J;  2PZ9 A;  4FTH A;  3LJL A;  2NP3 A;  1HF0 A;  2LK2 A;  3Q0V A;  4UUT A;  2XSD C;  1IDZ A;  2RHA A;  1SAN A;  3OOU A;  3A02 A;  4RBO A;  3ANG A;  3CRJ A;  4MFE A;  3NI7 A;  2ECB A;  4GFK A;  3ZQL A;  4XRM A;  2EZH A;  4MK6 A;  3BR1 A;  1MBJ A;  1UI6 A;  5E3N A;  5FKM A;  1POG A;  2PBX A;  2YUS A;  3MKL A;  3HDD A;  3IH4 A;  2DA5 A;  1ZK8 A;  3S2D J;  2NVQ J;  2MSY A;  1A6I A;  2DA3 A;  2IU5 A;  4BY7 J;  2EZK A;  2R92 J;  3H0G J;  5FKK A;  3M4O J;  5EG0 B;  4ACI A;  5FKO A;  4UUS A;  3RH2 A;  3VIB A;  1GT0 C;  2XGE A;  3G7R A;  1ORK A;  2E2H J;  3T6N A;  1WH7 A;  2AO9 A;  4GCT A;  3BHQ A;  5CW8 A;  3PAS A;  1P7J A;  1U9O A;  1PUF B;  2DA1 A;  3TED A;  2EZL A;  5C4J J;  5J3L A;  2QKO A;  4FCY A;  1ZR4 A;  1VF9 A;  2FBQ A;  2O7T A;  3O8G A;  2CRG A;  5JLW A;  1DU0 A;  3LSP A;  5K7H A;  4EEF G;  4JNN A;  4DZP A;  1O4X A;  1JJ8 C;  3VP5 A;  3B6A A;  4Y52 J;  3ON2 A;  2Q24 A;  5EEA A;  3G1M A;  5FJ8 J;  3RD3 A;  2YS9 A;  3OSF A;  2VKE A;  5DS9 A;  2K9N A;  2R7Z J;  2UXH A;  5FLV A;  5FKN A;  3ZQH A;  1BW6 A;  1R9T J;  5D1R A;  4XRS G;  4IEJ A;  5H9T A;  2NOG A;  2UXU A;  1GV2 A;  2AHQ A;  4ABZ A;  1SFO J;  2E2I J;  3HM5 A;  2LY9 A;  2NVX J;  4UDS A;  2QCO A;  4M6V A;  2YVH A;  2XB0 X;  3HOW J;  1E3O C;  2Y9Z A;  4A93 J;  4X6A J;  1ETX A;  4UUS B;  3CDL A;  2WUI A;  3JRF A;  2M34 A;  4BBR J;  3S1M J;  3LHQ A;  2HOA A;  2H1K A;  2VUM J;  1IC8 A;  2N8G A;  3K7A J;  1XS9 A;  4HNV A;  3SDG A;  1TWA J;  2NS8 A;  3TP3 A;  1F43 A;  5M5W J;  1NK3 P;  5EZH A;  1S7E A;  1MBK A;  1UMQ A;  2YVE A;  1G2H A;  3L1P A;  4M3E A;  3VW2 A;  4W1U A;  3BR2 A;  3HE0 A;  5HAW A;  1HLV A;  2XB5 A;  3BG3 A;  2XDN A;  4JYK A;  3JRC A;  3PM1 A;  4YZE A;  4I6Z A;  1DU6 A;  2L7M P;  1NTC A;  1XC5 A;  3GTJ J;  1ZQ3 P;  1F36 A;  5EF6 A;  2HYT A;  1Z77 A;  3UKG A;  2JN6 A;  3ZQG A;  2CJJ A;  1EF4 A;  3VPR A;  2E2J J;  1OCT C;  1X58 A;  4A3L J;  3K2A A;  1U9N A;  3FIS A;  1VFC A;  2MG4 A;  3DCF A;  3FK6 A;  3BTJ A;  2JA6 J;  3NAR A;  3D1N I;  2I10 A;  3ZQC A;  1GV5 A;  1MBE A;  5IPA A;  3CCY A;  1VND A;  3JRD A;  1VI0 A;  3KKC A;  4B3A A;  3C2B A;  3IH3 A;  3ZQF A;  3BR0 A;  3HEF A;  3MN2 A;  4A3C J;  2P81 A;  1SGM A;  5IOY A;  1JKR C;  3Q0W A;  1BL0 A;  1JJ6 C;  1WGX A;  2NS7 A;  4XIC A;  5C4X J;  4JP0 A;  1FTZ A;  1AKH A;  3OSG A;  1ETK A;  2ME0 A;  3HB9 A;  1OJL A;  1IG7 A;  3FRQ A;  3BR6 A;  1WI3 A;  2M8G X;  3FKI J;  2XPW A;  2COB A;  2WV1 A;  3B6C A;  5F0C A;  3JRG A;  2O8K A;  5E3M A;  1TWG J;  2NX4 A;  2B63 J;  3GEU A;  1NK2 P;  2RAE A;  5HSZ A;  1I3Q J;  3HOU J;  5J1Y A;  4M3G A;  3GBG A;  2LP0 A;  5EDN A;  5GP9 A;  3RZD J;  3CQZ J;  1IRZ A;  5EGO B;  2DA2 A;  1WPK A;  4GCK A;  5CXI A;  5J1R A;  4HKU A;  4AUX A;  2R93 J;  3HTJ A;  2NVY J;  4CYC A;  2QWT A;  4A3G J;  2VI6 A;  1ETQ A;  3Q3S A;  1K83 J;  3S17 J;  2DA6 A;  5IP6 A;  4FIS A;  1FJL A;  4Y7N J;  2WGB A;  2LFB A;  3WHC A;  2L0K A;  3HBL A;  4AYB N;  4X1E A;  5C4Y A;  2CU7 A;  1Z0X A;  3BRU A;  4J19 A;  1I6H J;  2ID6 A;  3EGQ A;  1QPI A;  4A3M J;  2OI8 A;  3PO2 J;  1AKH B;  3PO3 J;  3LOC A;  3KNW A;  3BG9 A;  2R5Y A;  2ZOY A;  4ME9 A;  4JL3 A;  4C2M J;  4A3B J;  1LE8 B;  2JK3 A;  1MH3 A;  2G0E A;  3BTL A;  3FK7 A;  1D5Y A;  1MH4 A;  2VPR A;  5DTD A;  1ETW A;  1JTX A;  2ID3 A;  3TP0 A;  3EUP A;  3S5R A;  2NP5 A;  5CXG A;  2JA5 J;  2DA7 A;  1MBF A;  2DN0 A;  4MLO A;  1QVT A;  2O7O A;  2NVT J;  2DMU A;  2Y31 A;  1B72 A;  3RZO J;  3NPI A;  2XGD A;  1UHS A;  1P7I A;  4JX5 A;  3HGG A;  4CYC B;  2ZCN A;  2GEN A;  1AHD P;  3HKZ N;  2R0Q C;  2JJ7 A;  2HDD A;  3HOZ J;  4IHY A;  4A3F J;  1GVD A;  5AQC A;  3TW7 A;  4V2G A;  5IP9 J;  4D7M A;  1LFU P;  4A3D J;  1JKO C;  4NN1 A;  3BQY A;  1JTY A;  1TWC J;  2F07 A;  1T56 A;  2QTQ A;  3LWJ A;  4S0H B;  2FJ1 A;  4XK4 A;  4JX4 A;  2JWT A;  5FHP A;  1JUP A;  3VVY A;  2X9D A;  5EYR A;  1T33 A;  5GPC A;  3GTQ J;  1FTT A;  5BNG A;  1RKW A;  4MXM A;  2HQ5 A;  5M3M J;  5C3E J;  2L9R A;  2R5Y B;  2ZCX A;  2CQQ A;  4BBS J;  1IV6 A;  3LSJ A;  5F04 A;  2RAS A;  3COL A;  3I4N J;  1JUS A;  2V57 A;  3VOK A;  4D7N A;  2UXO A;  3CJD A;  2EH3 A;  1TWH J;  5IYD J;  2XPV A;  3BR5 A;  4QSH A;  3JRH A;  1U8B A;  3NAU A;  5E3O A;  1Q1V A;  1B72 B;  1IGN A;  1MSE C;  2LTP A;  4D5C A;  3P9T A;  3E7L A;  2GBY A;  3HTA A;  3DPJ A;  4CGR A;  3CMY A;  1ZKG A;  2XRL A;  1RPW A;  1GDT A;  3HGY A;  4DYQ A;  1JT0 A;  4DW6 A;  5EGO A;  4XRS A;  2CQX A;  3TW6 A;  2L7Z A;  1JKP C;  1H8A C;  2DG8 A;  3MVP A;  1UI5 A;  3HTH A;  1YRN A;  2H8R A;  4RDU A;  2IBD A;  4L5E A;  1I50 J;  5F08 A;  3RKQ A;  2ZOZ A;  2DMQ A;  2FD5 A;  5F0F A;  3E7Q A;  3PPB A;  4BY1 J;  2DTZ A;  5EZG A;  2X6O A;  9ANT A;  2G3B A;  2UXP A;  1OFC X;  1JGG A;  2DJN A;  5D19 A;  2XPU A;  3GTK J;  2PMZ N;  2OPT A;  1ZTR A;  5DAJ A;  3S1Q J;  4NEL A;  4L62 A;  5J1U A;  5FLM J;  3GZI A;  3ON4 A;  3IH2 A;  4NDL A;  2WB1 N;  5M5Y J;  3A01 B;  3BTI A;  2O9L A;  3HOY J;  1RET A;  3ANP A;  1LE8 A;  2Y9Y A;  5K58 A;  5D18 A;  2W48 A;  1HDD C;  3AQS A;  2Y2Z A;  2QIB A;  1JUM A;  1ITY A;  3VVZ A;  4DYR A;  2Y0S N;  1JT6 A;  1UG2 A;  3VOX A;  2K9Q A;  3QPL A;  2M9H A;  1H89 C;  2QF7 A;  1IUF A;  4G12 A;  3JRI A;  1OCP A;  1HOM A;  2HI3 A;  3F1B A;  4AF5 A;  4IHW A;  1YRN B;  3HIM A;  2G7G A;  1JKQ C;  3CWR A;  1QRY A;  3JRB A;  3VW1 A;  2JA7 J;  2TCT A;  3BG5 A;  3F0C A;  1APL C;  2WAQ N;  3V78 A;  2CUF A;  2GUH A;  1FIP A;  5GPA A;  2Y30 A;  2E1O A;  3RQI A;  4IHX A;  2HYJ A;  3JSJ A;  4QTR A;  1TC3 C;  2QOP A;  4FE4 A;  1ENH A;  3NNR A;  1Y1V J;  1WH5 A;  2OF7 A;  2DA4 A;  2D5V A;  4JX6 A;  3QQA A;  3NRG A;  1W0U A;  5FKL A;  3GTG J;  2JMW A;  3S16 J;  3JRA A;  1U78 A;  3MNL A;  1IDY A;  1ETV A;  1MBG A;  2IAI A;  2LVS A;  2LLK A;  4MFD A;  3QKX A;  1FIA A;  5EFY A;  4ICH A;  1W0T A;  3BTC A;  2XGC A;  4M3F A;  1MBH A;  3OIO A;  4LOC A;  4GCL A;  1ETY A;  2JA8 J;  4FE7 A;  2VKV A;  3BJB A;  2LD5 A;  3VW0 A;  1X2N A;  2DMN A;  2EBI A;  2L7F P;  3LSR A;  5FMP A;  4A69 C;  4AC0 A;  3Q0U A;  3W6V A;  4AC6 A;  3SFI A;  3WHB A;  1HCR A;  1B8I A;  1RKT A;  1K61 A;  4JKZ A;  4C3J J;  2D6Y A;  5HBU A;  3ZQI A;  3O60 A;  4MIM A;  3GTP J;  3A03 A;  5K7F A;  3S15 J;  5F1J A;  2HOT A;  1A5J A;  1WCM J;  4DYC A;  2HXO A;  1BW5 A;  2EZI A;  4DZJ A;  1CQT A;  2ZCM A;  1GUU A;  1MSF C;  3S2H J;  3JR9 A;  4M3D A;  2TRT A;  2HXI A;  4I76 A;  5M3F J;  4A3K J;  1MNM C;  3S1N J;  2DMP A;  1RES A;  3G1O A;  3HOV J;  3AQT A;  2FX0 A;  3SJM A;  3H3V K;  2LKX A;  4C3H J;  3JRE A;  4BKX A;  3A01 A;  1ZGW A;  5F27 A;  3BQZ A;  5IOZ A;  4MO7 A;  5C44 J;  1QVU A;  5E3L A;  3KKD A;  2LR8 A;  2UXI A;  3GTO J;  1H88 C;  2OER A;  3VVX A;  4B1R A;  2MW8 A;  4C3I J;  2ECC A;  2ELK A;  3B81 A;  5F0H A;  1B8I B;  2R5Z A;  2KT0 A;  2K40 A;  2HOS A;  1RR7 A;  5IYC J;  4KWA A;  4GFL A;  3S1R J;  4PXI A;  2EQR A;  3IUV A;  2HKU A;  4W97 A;  2ZB9 A;  3M3Y J;  2REK A;  1AU7 A;  2DMT A;  3DEW A;  2FQ4 A;  4D5F A;  5JLX A;  5FGL A;  3BT9 A;  3VUQ A;  3LNQ A;  3ZOB A;  2W53 A;  5HOD A;  2IEK A;  3HTI A;  4QIW N;  5M5X J;  3QBM A;  3NXC A;  1Y1W J;  1FEX A;  5IP7 J;  1LFB A;  1HDP A;  2GLO A;  3KZ9 A;  3QPS A;  1BA5 A;  3O8H A;  2YU9 J;  4GFB A;  2MGQ A;  3V6G A;  2M0C A;  2GM4 A;  3S14 J;  4XID A;  2E19 A;  3IV5 A;  4IHV A;  2DG7 A;  4B4C A;  5EG0 A;  2R5Z B;  4A3E J;  4A3J J;  1ZR2 A;  1ETO A;  1IJW C;  1TWF J;  3LSG A;  4BXX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...