4X1EA

Crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
199
structure length
199
Chain Sequence
RAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIAASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
publication title Ligand binding specificity of RutR, a member of the TetR family of transcription regulators in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o6:h1
molecule tags Transcription
total genus 75
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4x1eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4x1eA02
5IYDJ 2LTPA 5M5XJ 3MKLA 1DU6A 4GFLA 3NXCA 1RR7A 4M3GA 1U9NA 1I3QJ 2O7TA 1YRNB 2QOPA 3BG3A 3LSRA 2FD5A 3BTJA 5EFYA 2V57A 2WB1N 1VI0A 2E1OA 3TP0A 3V6GA 5F0HA 1CQTA 2DMUA 4JP0A 2ME6A 4DYQA 1AKHA 3NI7A 1MH4A 2LFBA 1X58A 3TP3A 3HOXJ 2DMQA 2MGQA 2HYJA 3VIBA 3KZ9A 1MBEA 1JT0A 1Y1VJ 4BY1J 3PO2J 1ETKA 1VNDA 2TCTA 2OPTA 3AQSA 4BY7J 2LD5A 4ABZA 1NK3P 3ZQGA 5J3LA 3FISA 5IP7J 2R5YB 3ZQCA 3BTIA 4GCLA 1TWFJ 3DCFA 2HDDA 4A3CJ 2PMZN 2TRTA 5EZGA 1JUPA 2GM4A 2JWTA 2YS9A 1BJZA 4I76A 4D7MA 1XS9A 3JR9A 3CMYA 5IPAA 1MBGA 4A3MJ 2DTZA 1SGMA 3LWJA 3GTPJ 1QPIA 2EZKA 2Y30A 1WCMJ 2AHQA 2LK2A 4RDUA 1IDYA 3BTLA 3B6AA 1VFCA 1WH7A 1TWAJ 5J1YA 3RQIA 1FTTA 2UXHA 2IEKA 5FKMA 2EBIA 3HTHA 4ME9A 1ETYA 1ETXA 1JUMA 2DN0A 3VVYA 1P7IA 2UXIA 4ACIA 1T33A 3BR3A 3FKIJ 4L62A 2NP5A 1IRZA 3BCGA 1Z77A 2I10A 4MO7A 1MNMC 5JLXA 4M6VA 1QRYA 1ENHA 4M3DA 5J1UA 5E3NA 1YRNA 2JJ7A 5FKNA 3S1NJ 2Y2ZA 4C2MJ 4MIMA 4BXXJ 4S0HB 2OF7A 2G7SA 4CGRA 2DA4A 5CXGA 2Y0SN 4IHWA 3W6VA 2EZHA 4C3HJ 5K7FA 1X2NA 3HB9A 4D5CA 5CW8A 2JMWA 2ELKA 2M34A 3FK6A 1B8IB 3PO3J 3BHQA 3CDLA 2AO9A 3I4NJ 1JTXA 3JRDA 2R5YA 2ME0A 3GTGJ 1ZTRA 5IOYA 1AKHB 2JN6A 4B3AA 5F27A 2JK3A 3TW6A 3GTMJ 3HTJA 4KWAA 5K58A 3VUQA 4A3DJ 1ZKGA 1AU7A 2JA5J 2P81A 1T56A 1LFUP 3CJDA 3BTCA 1Y1WJ 3EGQA 1OCPA 5IP6A 2O8KA 2L7FP 3GTJJ 2VUMJ 3JRAA 4HKUA 1BL0A 4QSHA 2D6YA 2WAQN 1TWCJ 3LNQA 1JKRC 1IG7A 1RPWA 2PZ9A 2D5VA 1OFCX 4B4CA 3P9TA 1P7JA 4AC6A 3WHBA 1JKPC 4W1UA 1BA5A 3VPRA 1NK2P 3BR5A 2K9SA 2XPUA 3HGYA 4C3JJ 4UUSB 3GTQJ 2DG7A 4AUXA 3K7AJ 3FK7A 3VW0A 4V2GA 2IAIA 1G2HA 2COBA 2EQRA 3VP5A 4L5EA 4Y7NJ 2R0QC 3OSGA 2HI3A 5FLVA 3M3YJ 4PXIA 2E19A 2KDZA 1FIAA 4V2FA 3SFIA 4A3FJ 1E3OC 1IGNA 3S15J 2QWTA 1ETOA 2YU9J 1SFOJ 1IV6A 2G3BA 2DG8A 2HKUA 2CJJA 2W53A 4DZJA 2REKA 4FTHA 2G0EA 1Q1VA 2XGDA 1HF0A 2E2JJ 4MLOA 1RETA 1B8IA 3Q0VA 2MSYA 1LE8A 3M4OJ 3KKDA 3LJLA 3QKXA 3VVZA 5FKKA 2MW8A 4JL3A 4D7NA 1XG1A 5K7HA 3JRCA 3RZOJ 1HCRA 1U9OA 1BW5A 2CUFA 2UXUA 1F43A 1H88C 3BRUA 2GUHA 3COLA 3HTIA 5C4YA 2K9QA 2GLOA 3BT9A 5IYBJ 3S1RJ 3HOZJ 5DAJA 2CUEA 2HXOA 4AYBN 4HNVA 3O8HA 3ANPA 2HOTA 3LSJA 3NNRA 3S5RA 1MBJA 2HXIA 1UMQA 5EF6A 3L1PA 2VI6A 3IH3A 3KKCA 3QQAA 3H3VK 3TEDA 4A3EJ 2ZOZA 3SDGA 1RKTA 2QCOA 4J19A 5C4XJ 2E2IJ 3HIMA 3ZQLA 1HOMA 3GEUA 1MBHA 5FKOA 1GV5A 3CWRA 4UUSA 4RBOA 1JJ6C 1JT6A 1GV2A 5F08A 2N8GA 2NS8A 3BG9A 4A3BJ 3ZOBA 1ZR4A 2L0KA 3HE0A 4JX5A 3T6NA 4A3IJ 1APLC 1B72A 3G1OA 3JRHA 5E3OA 4AC0A 5JLWA 3D1NI 2RASA 4MXMA 2CU7A 1ETVA 4UUTA 2EZLA 4B1RA 5M5WJ 1ETWA 2ZCNA 2B63J 2HQ5A 3NARA 2VKVA 2YVHA 4BBRJ 5HBUA 3A03A 1W0TA 2XPWA 1AHDP 4XK4A 3RD3A 3QPSA 4FISA 3NAUA 3TW7A 4A69C 1FJLA 3EUPA 1MH3A 2NX4A 5GPAA 5GPCA 3HTAA 1UG2A 1LE8B 3S16J 2GBYA 2ZB9A 5D1RA 3DPJA 4A3LJ 1WPKA 2UXPA 3ZQFA 1ETQA 1MSFC 4A93J 5M3FJ 2JA6J 1ITYA 5EG0A 1U78A 3BR0A 5DS9A 5F1JA 2NVTJ 3H0GJ 4XRSG 2ZOYA 4DW6A 3Q0WA 5BNGA 2XGCA 3NRGA 5D18A 3LSPA 3FIWA 3FRQA 3GBGA 1ZQ3P 2R5ZA 5FGLA 4FCYA 3LHQA 1DU0A 1U8BA 2X48A 3BR2A 2Y9ZA 2E2HJ 4M3FA 1WGXA 3BG5A 1JJ8C 1JKOC 2DA3A 3VW1A 1HDPA 1IUFA 2DA6A 1XC5A 4NELA 1TWGJ 2CQQA 2ID6A 2JA7J 2JA8J 5AQCA 2XDNA 2NVQJ 5EZHA 3UKGA 5EGOA 2IBDA 3A01B 2H8RA 2O9LA 3HEFA 2VKEA 4DYCA 2HOSA 4FE4A 2NVYJ 4NN1A 3HBLA 3GZIA 1JKQC 3G7RA 5EYRA 1NTCA 2EH3A 4JX4A 1B72B 3RH2A 1WI3A 5C4JJ 4QIWN 1OJLA 2ID3A 2KT0A 2M2EA 4DZPA 1S7EA 2O7OA 5E3LA 2FX0A 1X2MA 3Q0UA 2NOGA 2OI8A 4X6AJ 3IV5A 3DEWA 3VOXA 4GCTA 5EDNA 1UI5A 5M5YJ 5FKLA 2PBXA 3B6CA 3CCYA 1GVDA 1UI6A 3F0CA 2WV1A 5E3MA 2F07A 4FE7A 1JUSA 2DJNA 3Q3SA 3ZQIA 3BR1A 3QPLA 1F36A 3OSFA 2DMPA 3B81A 4IHVA 2K9NA 3OIOA 3NPIA 5H9TA 4C3IJ 2MG4A 4AF5A 1I50J 4XRMA 3V78A 4JYKA 4YZEA 2DMTA 2Y9YA 2XB0X 5K7ZA 2EZIA 5IOZA 2ECBA 1ZK8A 1OCTC 2XSDC 2K40A 4NDLA 4EEFG 4M3EA 3RKQA 3BNIA 3C07A 5D19A 2HOAA 4JNNA 3JRGA 5EG0B 4JKZA 5F04A 1Z0XA 3MN2A 4QTRA 1RKWA 1MBKA 2ECCA 4G12A 2CQXA 2LR8A 2LVSA 3VOKA 3A01A 3JREA 1SANA 2DA2A 2R5ZB 3KNWA 4LOCA 3QBMA 5C3EJ 5DTDA 1R9TJ 3ON4A 3IH4A 3S17J 3AQTA 3JRBA 4W97A 5FMPA 5HODA 4MK6A 1H89C 2W48A 9ANTA 1QVTA 3ZQHA 4XRSA 1ORKA 3O8GA 3BQZA 3WHCA 5EGOB 1I6HJ 1UHSA 5CXIA 1TWHJ 5IYCJ 1W0UA 1A6IA 2VPRA 3PPBA 3I4MJ 3HDDA 1IC8A 4UDSA 2DMNA 5J1RA 1EF4A 4CYCA 1FIPA 2G7LA 3C2BA 3JRFA 2CRGA 2ZCMA 3E7QA 3G56A 1K83J 2LP0A 3MVPA 3S1MJ 3G1LA 1IDZA 1PUFA 4XIDA 2FJ1A 2XB5A 3LOCA 4BKXA 1IJWC 2Y31A 3OOUA 2M9HA 4A3KJ 3MNLA 1FEXA 4GFBA 1MSEC 3F1BA 3HKZN 3IUVA 2RHAA 2FBQA 3VVXA 2DA7A 1HDDC 2R92J 1JGGA 1FTZA 2Q24A 5FLMJ 2LKXA 1O4XA 2LY9A 4BBSJ 3LSGA 3SJMA 1LFBA 4MFDA 1H8AC 1GDTA 4Y52J 1VF9A 4GCKA 2ZCXA 3GTOJ 4M3BA 4IHYA 3RZDJ 2FQ4A 2OERA 3VW2A 4GFKA 4X1EA 5HSZA 5GP9A 2NS7A 2LLKA 5C44J 2QTQA 3PASA 5FHPA 2YUSA 3HOUJ 3HOVJ 2QIBA 5IP9J 2M0CA 5HAWA 5M3MJ 1GT0C 1RESA 5F0CA 4A3JJ 4MFEA 3K2AA 2DA1A 1TC3C 1QVUA 2GFNA 4DYRA 1GUUA 3A02A 4XICA 2QF7A 3JRIA 2GENA 2QKOA 3HM5A 2XGEA 1ZR2A 2M8GX 2WUIA 3ON2A 2NVXJ 2L7ZA 3IH2A 3BJBA 1HLVA 1JTYA 2DA5A 2X6OA 4JX6A 3O60A 2G7GA 3E7LA 2HYTA 5FJ8J 2L7MP 2L9RA 3JSJA 5F0FA 1D5YA 4I6ZA 2R93J 4ICHA 4D5FA 3G1MA 2UXOA 3CRJA 4CYCB 3BR6A 3HOYJ 3PM1A 1BW6A 2XPVA 4IEJA 3GTKJ 3CQZJ 1ZGWA 1PUFB 2RAEA 1POGA 3S2DJ 3HOWJ 1WH5A 3GTLJ 3S2HJ 2XRLA 2X9DA 4IHXA 3S1QJ 3S14J 5EEAA 2NP3A 2H1KA 2YVEA 3ANGA 3BQYA 4A3GJ 2WGBA 1A5JA 3HGGA 1K61A 1MBFA 2IU5A 2R7ZJ
chains in the Genus database with same CATH superfamily
2LTPA 1RZ4A 2KFDA 5J40A 4RGUA 1BIAA 3ZCOA 5LRRA 4GFLA 2CSOA 2B0LA 2LF8A 3MQ0A 3IAM2 1RR7A 3PFYA 4M6XA 1YRNB 2K4BA 3V8KA 3WGIA 4IRVA 2WB1N 2E1OA 4F7ZA 2ZMEA 3V6GA 2KISA 2UUZA 3WTZA 2ME6A 3KEQA 3CMAI 2DBBA 1Z1DA 3HOXJ 3FXRA 4P5OA 1N25A 2QEXI 1SEUA 4CO8A 1JT0A 1HC8A 5D4RA 1YHQI 2OPTA 2HYGD 3CCRI 5CQGA 5J3LA 1Y8QB 2R5YB 4PGHA 4HYEA 2DYSH 4A3CJ 2GOMA 2PMZN 5EZGA 2IJLA 3CCJI 2JWTA 2YS9A 3H5AA 1TT5B 1JGSA 5D5VB 3H9GA 4XORA 1ZELA 4KN4X 5ICFA 1SGMA 2DTZA 1R00A 3LWJA 3GTPJ 2M87A 1Y0UA 2LK2A 2R7FA 3MD2A 3CF5F 2M3AA 3J7AO 2RKHA 4BEHA 2GIVA 2E1MB 4D0PA 1FTTA 4CZZA 4CA0A 3V4GA 1G59A 1J9IA 2RQPA 2MYSA 2P5LC 4YG2F 2DFIA 3VVYA 1P7IA 1R7JA 1J75A 3QP5A 2YX4A 2NP5A 3GW2A 2I8DA 1Z77A 2I10A 2K9MA 4HOBA 4XKWA 5HS9A 3LFUA 1W36D 5L3FA 1MW7A 1P2FA 2I5UA 2EWNA 2MBFA 2JJ7A 5FKNA 2YPRA 2R7WA 3S1NJ 2KQRA 2FJI1 4S0HB 4ZZDA 3WTUC 4CGRA 5CXGA 3KP4A 4F91B 4C3HJ 4WWCA 2R3SA 1K6OA 3IWZA 1X3UA 4JK1X 2M7AA 2WADA 3HB9A 1SAUA 2Z3YA 5CW8A 2ELKA 3HL2A 3KCCA 3CDLA 2PJRA 1O3SA 2PEXA 3ASNH 1ZTRA 5F27A 3HTJA 3LAJA 5FLXK 3M1CA 2HZDA 5K58A 2L4MA 2CH0A 4A3DJ 1YS7A 3S3MA 4C2TA 4Y4RA 1EV7A 1SD7A 2GWRA 4Z6YA 1FY7A 1ZRDA 4FQGA 4XLCA 1VQNI 4PGGA 4BHBA 1Y1WJ 3IL2A 3OOPA 1OYWA 3GTJJ 2VLAA 5CQEA 3CUQA 2EINH 2VBWA 3CESA 2V9VA 2CQNA 3LNQA 1ZG1A 2PZ9A 4NC8A 3OS0A 4B4CA 3LSTA 2EA2A 1BI0A 1W7PD 1JKPC 1GLNA 3AL0B 4UVCA 1HW5A 2LYCA 2XF5A 4E7HA 2CGPA 3BR5A 4XLPF 2XPUA 2EIMH 4KUMA 3E1SA 3OMYA 2D1VA 4HF0A 4BEHB 3HTSB 3VW0A 2IAIA 3NQOA 4L5EA 1VQ7I 5FLVA 2NYXA 1FIAA 4V2FA 2F6CA 3SFIA 1E3OC 1N77A 1OCOH 3S15J 2QWTA 1ETOA 3HYIA 1SAXA 2ISYA 1IV6A 2KZGA 2Q0OA 3KIOA 4RS8A 1FP1D 2DG8A 2HKUA 3E6BA 1J09A 3FWEA 2REKA 3RTRA 2G0EA 1DPUA 1Q1VA 4PJJA 1HF0A 2E2JJ 1YYVA 1YTYA 1RETA 2BY3A 3D5LA 5ICEA 2HR3A 2MSYA 3VVZA 3L2RA 1UHWA 4LJZF 5K7HA 2V7FA 1VQLI 5B5EC 4LK1F 5GADJ 1BW5A 2R7OA 4PDKA 2L9VA 4II3A 1B1BA 2GUHA 2VE8A 4A5NA 1K4TA 2GLOA 4GO1A 5DAJA 3G73A 2VJ4A 4AYBN 1XSXA 3L2VA 2V9KA 4B43A 2E35A 1MBJA 2EV0A 2HXIA 2F4MB 3WG7H 1VQPI 1VQ8I 3FX3A 3K8PC 2NVUB 1UMQA 3IH3A 2HEOA 2EK5A 1OKRA 2MC3A 1P4WA 3OV8A 1RKTA 2ZOZA 4XKVA 2DLLA 1BI1A 2PMZA 2DFEA 4N0BA 4M72A 1KA8A 2E34A 1S7OA 3GEUA 1QHHD 3KEYA 5FKOA 5E1XA 3K2ZA 5J8CA 2NNNA 1GV5A 2LDUA 5ILVA 3CWRA 4RBOA 3K4KA 3AG1H 3H36A 2LOOA 3CUQB 5DV5A 5F08A 2Q8KA 2O5RA 1ZR4A 3HE0A 4CCLA 1APLC 1B72A 4I7HA 4WX9A 1R1VA 5E3OA 2O61A 3F6VA 3D1NI 1XB4A 2ZSHB 1WJ5A 2RASA 3CCLI 2CU7A 1EH8A 2M4GA 1ETVA 3ASOH 2V1XA 4RMNA 2ZXIA 3GFJA 2XKPA 2KIMA 3KLOA 3KE2A 3TOAA 2B63J 4KMFA 4RM3A 3VDXA 1KU9A 2MH2A 1LJ9A 2RQQA 1S5LC 5DUKA 2FA5A 3RKWA 3AKZA 1UJ8A 2HFHA 3OY9A 1Y39A 2NX4A 3HSRA 3HTAA 2MLGA 1V55H 3H3ZA 5DM7F 5ED4A 3DPJA 2PBIA 3V42A 1VZ0A 3WTSC 1O3RA 2QVOA 1F1ZA 2VJJA 3QP6A 4DJAA 1H9GA 2YSRA 5DD8A 5EG0A 5M3FJ 1T8IA 5KVRA 2CFOA 4ESBA 2X1DA 3E5QA 3Q0WA 3BJOA 1TNSA 2XGCA 4MGRA 4LLLA 3LSPA 2KRCA 3ZPLA 4KDPA 4XMYA 3FRQA 2R5ZA 1SC7A 1AA7A 4FCYA 3LHQA 3BR2A 5FFXA 2E2HJ 2IA2A 3ZXSA 3V7CA 1JKOC 3TDUC 2ELJA 4IZZA 3CUOA 4EV0A 2DA6A 4BU2A 1OQYA 2JA7J 3C18A 2A2FX 3ULQB 2NVQJ 4XRFA 3UKGA 4BDYA 2FOWA 5BOXA 4Z2YA 1X4PA 2G7HA 4ASNA 4RAGA 2FXAA 2EH3A 3QU3A 4O6JA 3EPZA 1B72B 3RH2A 1XN7A 3PNTA 1WI3A 3LSKA 3RYPA 3V8JA 1KQ0A 5H20A 2KT0A 2ID3A 4ZTJA 3E97A 3ZMZA 1S7EA 5FRMA 3CUQC 3TBIA 1X2MA 4A0YA 2NOGA 4ZC3A 3PJRA 1P9QC 4YFXF 1P4XA 4ZH4F 2M1BA 5ICGA 3BJ6A 4GYGA 3IV5A 1J7KA 2ZFWA 4GCTA 1R23A 2DW4A 1X1PA 5M5YJ 2PBXA 3HOSA 1D8KA 2WV1A 3LSHA 1D0XA 1BBYA 1B6AA 3RI4A 2CO5A 2XAUA 2PX9A 3F8FA 4IHVA 2K9NA 5H9TA 4FASD 1E3HA 2MG4A 2E36A 3HSEA 3WU2C 1I50J 4XRMA 3OYIA 4IL6C 1R5GA 3OWTA 1KQ8A 1GVJA 2K40A 4NDLA 2IA0A 3CMEI 5E1ZB 1VQ9I 2DO7A 3JRGA 2L02A 4AM3A 5EG0B 4JKZA 3M9AA 5F04A 3N4MA 1Z0XA 2O03A 3CF2A 1RUNA 1SVMA 1O3QA 2H8WA 2YVXA 3HUGA 2CMPA 4G12A 1DDNA 3VOKA 1MDMA 3A01A 3JREA 3FXOA 2A05A 2R5ZB 3BROA 2ICWG 2OQRA 4GCVA 4B09A 1TBXA 4LOCA 2OCEA 2LY1A 3IH4A 3JRBA 5HODA 4M9ZA 4GXOA 1FSEA 1QVTA 3DWLE 1MNDA 2E1CA 3O8GA 4Y13A 2EILH 3G4SI 2K9LA 1I6HJ 5CXIA 1FNNA 1TWHJ 2DOFA 3M07A 2VE9A 1N75A 4O5VA 1W0UA 2VPLA 1S29A 1LNWA 3K1PA 4UDSA 2F5DA 3LQRA 3JRFA 4KNYA 3M1EA 1USSA 2LP0A 2W1OA 2XAQA 3U1KA 4EJWA 4IQ4A 1IDZA 1PUFA 4XIDA 2FJ1A 2K27A 3LOCA 5CLSA 2Y31A 1TT0A 4BQNA 4HLYA 4EJOA 3DEUA 3K69A 3MNLA 2EJRA 1MD0A 2KIFA 4I0BA 5CYVA 3SEZA 1G4DA 5AIPA 3IP4B 2DA7A 2DFFA 2M7BA 3FF5A 5JR3A 2E5ZA 2Q24A 1ONVA 2JA2A 5KAIC 4BQQA 3K4JA 3SJMA 1FBSA 1S8NA 1FT9A 1GDTA 3GTOJ 1YIOA 3RZDJ 3Q9VA 1T0FA 5HSZA 2R7DA 3G71I 2NS7A 3ABTA 3VSLA 3OYAA 2W25A 3OL3A 4HV6A 1KONA 2ZJQF 5IP9J 3NRVA 1A04A 3K10A 5GAEJ 5M3MJ 3PQJA 4X0GA 1QGPA 3F9KA 1JHFA 1QO0D 3DBLB 3ESWB 4IO9F 1ZAOA 5F0CA 4A3JJ 4MFEA 1X1DA 2ELHA 2ESHA 5J6XA 4QWQA 2V79A 1TC3C 1D0ZA 4G7HF 2OCCH 3JRIA 1GUUA 1MDMB 2QF7A 1DPRA 3ZMTA 3UR3C 2RV8A 3Q5FA 2L7ZA 3IH2A 4EM1A 2A07F 1VQ5I 5HOOA 3T1BA 1FWZA 4EVIA 4JX6A 4CCJA 4LB5A 2PJPA 3K70C 4HRIA 4OINF 3BCAA 5FJ8J 2RN7A 3JSJA 5LRSA 5FO5A 2P6SA 5F0FA 4I6ZA 1MKMA 3PNYA 2V6CA 4A5MA 3WTXC 5A2QK 4HX4A 3DU5A 3G1MA 3DV8A 2PFVA 1G3TA 2NXNB 5JFRA 3BR6A 2H27A 2XPVA 1VQOI 5HS8A 3GTKJ 1PUFB 1POGA 1FMVA 2P7CB 2K86A 3RPUD 1WH5A 4RGSA 4EM2A 2OTJI 2X6XA 3S14J 2NP3A 3LSIA 3BQYA 4ZDPA 2OD5A 1X19A 4RM2A 1K61A 1MBFA 3CCUI 2R7ZJ 2RNGA 5KK1A 2OC6A 2XASA 3E3VA 3NXCA 4B47A 3D0SA 1MIJA 1IN4A 4M3GA 1I3QJ 3K4BA 4UXNA 4RAFA 3BG3A 3W2AA 2CG4A 4YIRX 5EFYA 1XX5A 1VI0A 1BR4A 2VBXA 1CQTA 2HDWA 4JP0A 3DTKA 2BGCA 2EB7A 2LY2A 1E3PA 2ZCWA 4PK4A 2HYJA 1Y1VJ 2K02A 2GAUA 2XC7A 1J2XA 1VNDA 1WJBA 2TCTA 3CC4I 3FISA 5IP7J 3ZQCA 3CLOA 2E5NA 1TWFJ 2QSGX 2TRTA 4ZYHA 5HLGA 3HDDA 3ZMUA 3O3KA 3I55I 4ENJA 4JQFA 4Q5SF 3VYRB 3BZCA 5DYMA 3RCOA 5KNLA 3CMYA 3OYEA 2JVGA 2KRHA 2F5FA 1XPXA 5D5UB 1QPIA 1D1AA 2AHQA 4PJLA 3KP5A 3V7SA 3A2KA 5BPDA 1LUJB 4RDUA 1VFCA 2RREA 3GX4X 1LFPA 3N97A 2VQHA 3FMQA 1QBJA 3F8CA 2VOPA 2KJCA 3U9GA 1ETXA 1EKEA 4N4NB 3S2WA 2UXIA 1IO2A 4WK8F 3IUOA 3OYGA 1T33A 3GLLA 4OAZA 2Z9OA 1B9NA 4L62A 3CO7C 4YFKF 1K79A 4NUBA 4MO7A 1ZRCA 1OPCA 4L9NA 4M71A 1QRYA 3KX2A 2ACJA 2HNHA 2ESNA 2VBYA 1OCRH 1YRNA 3ZMDA 3FZVA 2A5WA 4KMUX 4XONA 3KP6A 4BXXJ 3CP2A 2VXDA 2DA4A 2HU9A 3FMRA 1MJBA 2EZHA 4U0YA 3JW4A 3VEPA 2D1HA 2OJED 4D5CA 2O8XA 3ABKH 3J80K 3FK6A 3L2QA 1B8IB 4P9UA 3PO3J 2AO9A 1X3ZB 2R5YA 3DKXA 3DPLC 3TO9A 2WV0A 3QYBA 4HQEA 2ZC2A 4KWAA 1WQ2A 3ZN1A 1T38A 3P9CA 2L3DA 2MABA 3V7RA 1YITI 3CJDA 2FEZA 4HNTA 5FD6A 3EGQA 5IP6A 2O8KA 5CKTA 2VUMJ 1U8RA 2XSJC 1W5TA 2DQLA 2DODA 2F5EA 1JKRC 1IG7A 4RB3C 4RAYA 1OFCX 1QZYA 3NEUA 3ZRGA 1P7JA 3OYJA 2D5VA 1FOYA 1UCRA 2FUG2 3HTUA 4A6DA 2L7KA 3GVAA 2X85A 1BA5A 2K9SA 3HGYA 4DQ2A 4UUSB 4HX8A 2IRFG 3K7AJ 4HW0A 1R5HA 2DJIA 3VP5A 4LG0A 4Y7NJ 1S3JA 4LB6B 1KYZA 1PP8F 2V1DA 3FXUA 1IGNA 3K1NA 4BH9A 5E8IA 4B8XA 3GO5A 5B1AH 3S3NA 2EIJH 2G3BA 3CMMA 3BOQA 4AIHA 4MEXF 4HEA2 4DZJA 2Y69H 1VQMI 1IRXA 3LA3A 1TQMA 5BS6A 1I39A 3O2PE 4BJ6C 1LE8A 4M73A 1REPC 1X3WB 4OIOF 3JRCA 2HZTA 3RZOJ 2KIUA 3F23A 3DLAA 1HCRA 3H5NA 2CUFA 1D8JA 1F43A 3VOEA 2W00A 3BRUA 3HTIA 4G94A 3BT9A 3S1RJ 3HOZJ 2CUEA 4HNVA 3JSPA 4EGYA 2FSWA 3O8HA 2QLZA 3LSJA 3ZMVA 2K5CA 1BIBA 3GLXA 4EJTA 2DDBA 3H35A 3F72A 3QQAA 4LGWA 3OYDA 3TO6A 3ELKA 2QCOA 3RKYA 2J5PA 1WZ2A 2E2IJ 1J59A 2V9PA 1Z21A 3MCZA 1MBHA 3MKWB 2KP6A 3DU6A 1FYKA 3GFIA 3MZ8A 2CUJA 1HXDA 2Z99A 2XDVA 3JSOA 1V54H 4A0XA 2NS8A 4A3BJ 2ZO4A 5DDGA 3TQNA 3MKYB 2L0KA 2OU2A 2XF7A 4JX5A 4A3IJ 1W36C 3WGGA 5ICCA 3GZNB 1LB2A 4L0ZB 2BVLA 3IRRA 2UZKA 2MH9A 5JLWA 4MXMA 1SVLA 2LRDA 2W24A 2HPIA 3O6BB 1EH6A 3BWGA 4EJVA 5M5WJ 1XTAA 4I0AA 2O6GE 3DXJF 1ZGAA 1ETWA 1FZPB 4LG0B 2ZJPF 4OMYA 1ON2A 1SFUA 2VKVA 5L3EA 1TNTA 2YVHA 1OCZH 5HBUA 1IN8A 1U3EM 2KHMA 2XPWA 2QENA 4I01A 1JHHA 1AHDP 3EUHC 2V4JC 2P5KA 4FISA 1UELB 4IRHA 3NAUA 4A69C 3EUPA 3I9V2 1MH3A 3K1MA 3QPTA 1FYLA 5GPAA 1FYMA 1IXCA 3A4CA 2DOAA 1LE8B 1O7FA 3G3ZA 2GBYA 2ZB9A 4XOTA 4A3LJ 4OIQF 2UXPA 5L3DA 3A0HC 3VODA 2OV7A 1S9HA 1JI8A 4HA8A 4A93J 1SVOA 4M9SA 2JA6J 1ITYA 3FHNA 1U78A 1HKTA 5DS9A 5F1JA 2NVTJ 2KMUA 3H0GJ 2ZOYA 1BJAA 4DW6A 5BNGA 3MZHA 2VB6A 1ZN2A 2QBYA 1T95A 2X6WA 4L9VA 4IQJA 2XAGA 2VODA 3GBGA 1BC7C 3VB2A 5FGLA 3ISPA 4NNJA 1DU0A 5K5RA 5HNFA 2VJ5A 1WVRA 3OIQA 4RB0A 1YW8A 4R1HA 1WGXA 3BG5A 5ILSA 2DA3A 3CD6I 4HLXA 5J4YA 1XC5A 1ODDA 2CQQA 1MJAA 2QA4I 2CV2A 1WJDA 3VYSB 2XDNA 5EZHA 5HLTA 3QOEA 5EGOA 2IBDA 2QQ9A 4F55A 4D1QA 3OYCA 3FBIB 4IHTA 4CCOA 3HEFA 3CDIA 4MQ9F 4DYCA 4G7OF 4FE4A 1E2XA 3GMEA 2LF7A 3QU6A 1KZHA 2NVYJ 4NN1A 4R8HA 3G7RA 4I98B 4HQMA 5EYRA 5LHHA 4JX4A 1XGOA 4U7BA 3VTIA 4NC7A 4XQFA 4ON0A 5JI6A 5TISC 1TW3A 2DOEA 2GQQA 2BBYA 4Q47A 2R7TA 5GAGJ 5J47A 2LKPA 1HBXG 1LDDA 4U88A 3E6MA 3I64A 3VOXA 4F52A 1Z7UA 5FKLA 3B6CA 1GVDA 1UI6A 1XGNA 3FMSA 4BL0B 3BR1A 2WB1A 3B81A 2F4OB 3C2GA 3OIOA 3NPIA 1V5GA 1FOXA 2VASA 3SFZA 2BXZA 4G8XA 2DMTA 3COAC 3NS4A 2GXGA 2JTVA 2XSDC 3BNIA 2OTLI 3C07A 5D19A 2M45A 4KIFA 2ZNYA 1FOWA 1TTYA 2HOAA 3R60A 3WODF 3LWFA 3MN2A 4L5JA 3VFZA 1Z67A 1YIJI 4IKFA 1MBKA 2QBYB 2ECCA 2M30A 2CQXA 5IY5H 1SANA 3PL8A 5FLXZ 3KNWA 3A1YA 5C3EJ 1XSDA 4QPOA 5DTDA 1R9TJ 3PUBA 3HPHA 3AQTA 4HX7A 4ITVA 2X6YA 1R58A 1I27A 4E7ZA 1R49A 4KYWA 2W48A 5TRDA 9ANTA 2CQ7A 4IOCF 1KU3A 1ORKA 4KICA 2BHYA 1ZH5A 1K78A 4LLNA 3BQZA 4DBRA 5EGOB 1UHSA 4CICA 3WU0A 1OYYA 2FF4A 4YIFA 3AAFA 1EA3A 2VPRA 1GXQA 1YX3A 3DP7A 4BJ5C 2ZXJA 2GIZA 4UVAA 3MEXA 2MA3A 2NRAC 5JVGF 4A12A 1EF4A 4CYCA 5B66C 3C2BA 4PJNA 3G56A 2HVQA 3I59B 3MVPA 1PJRA 2W57A 2WC2A 3G1LA 1H9TA 3H0DA 2ZBKA 2XB5A 4BKXA 1IRFA 3OOUA 4BXUA 4A3KJ 3EYYA 3IWFA 2K3FA 4HV5A 4GFBA 2JRMA 4L0YB 2KKOA 3F1BA 3IUVA 4YELA 2FBQA 2QSHX 2FBKA 2VQLA 1HKSA 3MWMA 4S04A 1OLTA 2EPFA 3CC7I 2EFPA 3K4NA 5FLMJ 3DPUA 3KP7A 3LSGA 2UWMA 1LFBA 2DT6A 1T08B 4MFDA 4Y3OA 4PCQA 5D5XB 1XDSA 3IRQA 2W7NA 4Y52J 3EQLF 2MD5A 2IGKA 2FMYA 4IHYA 3VW2A 2COMA 4ENNA 4HDVA 5FHPA 2QTQA 2BY2A 2DCEA 2LMDA 4AD9A 2BW3A 3FDYA 5H6QA 5HAWA 4N9IA 3CTAA 3HHHA 4KIBA 3K2AA 1FOKA 5CVUA 2DA1A 1YE9A 1I5ZA 2GFNA 2GENA 4XICA 1JE8A 4HAMA 3H3UA 2LSOA 3HM5A 2DPUA 2KIQA 3FKJA 2VJIA 1A31A 2WUIA 3ON2A 3GCMA 5CVIA 2M4KA 1X1AA 2AQEA 2IS2A 3BJBA 1TLHB 2DA5A 3K6GA 4BHCA 4F92B 1S72I 3O60A 5CVRA 1E0EA 1MMDA 2P0WA 2HKOA 3E7LA 1K78B 3PUFA 2L9RA 4U0WA 1KU7A 1I1GA 2AS5F 4AWXB 2R93J 3U2RA 2F48A 1T98A 1O57A 1R22A 2MFZA 3WTTC 4CYCB 2VL8A 2CW7A 1BW6A 3FXLA 4IEJA 2XKOA 4FT8A 4PFOA 2NAZA 5FRNA 2ZKZA 3CQZJ 3J81Z 2RAEA 1IAWA 2BVMA 3KP2A 1OR7C 4IRIA 3OYNA 1Y56A 4XBFA 3S1QJ 2FOKA 3K9TA 5EEAA 2H1KA 3CCEI 1A5JA 4UHTA 4MTEA 4EJUA 2IU5A 5IYDJ 4J00A 3GFMA 1L0OC 2EIKH 2QSFX 3TKYA 3OS2A 3I71A 5IT9K 1DU6A 3I3LA 2XRNA 4QPQA 3LFKA 4AYBA 4HF1A 2O7TA 2QOPA 3LSRA 3C1DA 1BM9A 2QWWA 3BTJA 4P55A 2V57A 4BAYA 2UV1A 1D3YA 4U9LA 2DMUA 4DYQA 1AKHA 3NI7A 5LFAA 1MH4A 2LFBA 1P4AA 6PAXA 1DUXC 5E17F 1UZCA 4PUSA 2MGQA 1UFMA 4HSTA 2ZNZA 3KZ9A 1WFXA 4BY1J 2BW3B 1ETKA 1PVEA 2IA1A 3SHFA 2RGVA 3MAJA 3RYRA 2E1NA 1NK3P 2JZYA 2M5WA 1F9NA 1WJAA 2A6HF 3BTIA 3DCFA 3CCSI 2HDDA 4GCLA 2GM4A 2GA2A 2M0MA 3LSMA 2BZTA 3JR9A 2F5VA 2IW5A 4MEYF 3JTHA 2CS3A 4E6KG 1UG0A 1IDYA 2MC4A 3BTLA 4S05A 3GFLA 1YJWI 1TWAJ 1G8XA 3B73A 3T0YA 5FKMA 2EBIA 3HTHA 2DPDA 1ETYA 2DN0A 3GYHX 4N4OB 5DM6F 2PLYA 2OZUA 3ONQA 4EM0B 3BR3A 1WJEA 2XUBA 1LEBA 1D0YA 1UHMA 3BCGA 3SDBA 4ANJA 3CO6C 1ZGJA 5JHFA 3KYLA 1ZG3A 4YRVA 3CCVI 1MNMC 1YQAA 4M6VA 5JLXA 2DK5A 4ZZLA 2QKMB 1RUOA 5J1UA 3ZP5A 3P7NA 4JBAA 1LQ1A 1MMAA 5L3BA 1VQKI 2JSPA 2Y2ZA 2HGCA 4MIMA 1MZBA 5FROA 2OF7A 2P4WA 2CQKA 2Y0SN 4IHWA 2L5QA 3IKTA 3F3XA 3J7YJ 3VWBA 5K7FA 2K85A 2CV0A 1X2NA 3IC7A 1QU3A 2JPBA 1XD7A 1SD4A 3LQQA 2BOLA 1WSUA 3BJAA 2JMWA 5FB2A 1JTXA 1IN5A 2ME0A 2Y48A 1TQIA 3GTGJ 5IOYA 3JAMK 1AKHB 4KN7X 1WJCA 1ZG5A 3TW6A 2D45A 1EJ9A 1C0WA 3B02A 4UUVA 2JA5J 2P81A 5FFZA 3EETA 1T56A 4A0ZA 3ZGKA 1OCPA 4KJZA 2L7FP 3CP8A 1XMKA 2OZ6A 3JRAA 2OAZA 2XGXA 4TV7A 4HKUA 4QSHA 3L2WA 3WTVC 1TWCJ 4A6EA 2IVMA 1RPWA 3SZTA 3ERMA 4AC6A 3ZR8X 3D5SC 3F22A 1I6XA 2BHZA 4M6YA 3VPRA 3OYHA 3OYBA 3GTQJ 1ZYRF 3U1DA 3ZMSA 2FNAA 4ZJZA 3FK7A 2QQAA 2CW0F 3KPHA 4V2GA 2COBA 5EEGA 2FBHA 1YI2I 4OU0A 2R0QC 1VQ6I 3ABMH 2KZVA 4A3FJ 4XOPA 4GDFA 1GHCA 3M8EA 1Y0NA 1SFOJ 1IF1A 1T2KA 4KIGA 1G3YA 4NHJA 1Y8RB 2CJJA 2W53A 4FTHA 2ZFUA 2L9NA 2XGDA 3L7WA 2HPMA 1DP7P 2DU9A 2R7RA 4E4HA 3FXQA 1XSVA 2WAEA 3Q0VA 1B8IA 4HSRA 3M4OJ 3LJLA 1NG7A 1O3TA 3BZ6A 1TP4A 2MW8A 5FKKA 4D7NA 5LHIA 4CCMA 2PMUA 1IV8A 1RNLA 4P9FA 2CV1A 4XSXF 4RA2A 2RDPA 3HPGA 1U5TB 2UXUA 3CJTB 3P9KA 4IJAA 1X1BA 4C9YA 2K9QA 4RB1A 1R6RA 3HOTA 1I1SA 2FQ3A 2HXOA 3GEZA 3HC7A 3L2UA 3ABUA 2DT7B 3KZZA 5K1YA 4L9TA 2HOTA 3ANPA 4RGXA 4HBLA 3S5RA 5D8KB 4XLFA 5BPIA 1R1TA 1X4OA 4BS9A 3L1PA 3EYIA 2HTSA 3TEDA 2VQCA 2AXLA 4A3EJ 3SDGA 2HVSA 4MHGA 1HSTA 2EA4A 3HIMA 3ZQLA 5DEQA 4OWRB 1HOMA 3H1CA 4XM3A 4UUSA 4BXFA 4FETA 2V26A 1JT6A 3BCBA 3EUHA 3W6JB 3ZOBA 1FPQA 1XDUA 4LG3A 3ML6A 4DIQA 3JRHA 4AC0A 3KZYA 2ETHA 2LBFA 4UUTA 2EZLA 5EJCA 5LEKA 2LH9A 4UV9A 1LEAA 4KITB 1UB9A 4GGGA 1U2WA 3S8PA 3NWSA 4OD5A 1TL8A 1IN7A 2VC0A 3HRSA 5A2QZ 3SZPA 2K7LA 3NARA 2QUFA 1Z9CA 2B3WA 2E71A 1W7PA 1U6GA 1YS6A 5HLIA 4BBRJ 2Z16A 3KLNA 3ZN0A 1W0TA 3GZ6A 1PDNC 3HHGA 4YFNF 1W5SA 4XK4A 3QPSA 3PSFA 1H0MA 2XAFA 2R7UA 1FJLA 5E1WA 2Y0SA 2Z33A 4E70A 3WE3A 5ERIA 3OS1A 1ETQA 3I58A 1MSFC 2IPQX 5LBQA 3BR0A 2MLKA 3TGNA 4XRSG 2CW8A 3P9IA 5KHDA 3NRGA 4IXAA 4Q48A 5LGNA 1ZQ3P 3HRMA 4G7ZF 2X48A 4LITA 2Y9ZA 1U8BA 2XIGA 4XKCA 3TOBA 1HW1A 1U5TC 5HLHA 1JJ8C 1AOYA 2BE5F 1IUFA 4BQAA 2IS1A 4NELA 2JA8J 5AQCA 2XV4S 2O9LA 2WAFA 4PFPA 1MMGA 2K4JA 3RQ4A 2HOSA 2Z5UA 3GF2A 1HKQA 3CJNA 2VXZA 2BYVE 3GZIA 1SMYF 4XLAA 1NTCA 3TO7A 1VTNC 2FRHA 4QIWN 3H9JA 4EQQA 3CC2I 3J7AY 2PN6A 2O7OA 1W1WE 2Q1ZB 4XLNF 3KYCB 2LBFB 2DTRA 2FX0A 2JQ7A 2R7QA 3LA7A 3EDPA 3Q0UA 2EFQA 3R4KA 4X6AJ 2F4IA 2LG4A 1BOAA 2ADUA 1B4AA 3DEWA 4B44A 4CCNA 5JHUA 5EDNA 1UI5A 3SXYA 1LVAA 1W7PB 2XHKA 5LGTA 4U87A 4FE7A 5DUIA 2DJNA 3ZQIA 4Q4ZF 3A0BC 2YU3A 3F6OA 2HVRA 3BDDA 4ESFA 4C3IJ 3TMOA 2OQGA 2DT5A 2IGOA 2B7EA 4JYKA 2EFNA 3H92A 2VQGA 2EZIA 3U21A 5IOZA 4I2OA 2H94A 1OCTC 3RKQA 1V5EA 4BUPA 2XVCA 2XF6A 4JNNA 4OOIA 3OR1C 4IHSA 2H6CA 3J80Z 1OMIA 4I02A 2IXSA 1RRJA 4QTRA 1V4RA 2L54A 2DA2A 1IXRC 3BG7A 2Q2EB 1IRGA 1KYWA 4U0VA 4E7LA 1IZ1A 4CHUA 3ON4A 1BN5A 3EUAA 4E7KA 4W97A 1A6QA 2OA4A 3KYDB 4PSWA 3J7ZI 1TW2A 4MK6A 3BPXA 3MMYB 1FBUA 2A6EF 4GYIA 1ULYA 3D5RC 2NNYA 2X1EA 4OIRF 4BE2A 2YX7A 4ENKA 3WHCA 3OYKA 1F4KA 2IT0A 1P92A 3IHUA 2HDCA 3WG9A 1ZLJA 2IP2A 2HQNA 3I4MJ 2EV6A 5GTIC 4Y15A 2DMNA 3QWLA 2Y75A 2BEOA 2G7LA 3E7QA 2CRGA 2ZCMA 1DGRM 3LMMA 1OYIA 1IJWC 3T5XA 2X4HA 4BACA 3QODA 3WTYC 5KCMA 4M9XA 3DF8A 1Z7LA 4E7JA 2STTA 1E17A 3AG4H 1FEXA 5CVJA 3R61A 4HNUA 2VT2A 3HKZN 3BP8A 3VVXA 2A6TA 1HDDC 3CCMI 2LREA 3DKWA 1A36A 3DTIA 4KA4A 1JGGA 1FTZA 4CUGA 3DTEA 4AIJA 2LKXA 3K4LA 4BBSJ 4E7IA 3BC8A 1H8AC 2AQFA 2VT3A 2AXTC 5HDKA 1J0RA 2JSCA 4M3BA 3ECHA 3HRUA 4OIPF 2FQ4A 2E7XA 3FXMA 1B59A 3G2BA 4CSWA 1G3WA 2LLKA 5C44J 4J01A 3PASA 4IPAA 4LLGF 1Z05A 3HOUJ 4WXHA 3HRTA 2PFBA 3W3CA 1W5CC 4XN3A 2M0CA 1QA6A 3HG9A 1RESA 3IAS2 3E0JB 4C2UA 2ZMEB 2VOOA 1YO5C 2WY8Q 3GZ5A 3LA2A 1USTA 1JXSA 3CDHA 1QVUA 5K5OA 4IOAF 3GXOA 2QKOA 2B9SA 1WKMA 1ZR2A 1OR7A 2NVXJ 4IRGA 3KETA 3QPHA 2IGMA 2ZXHA 3DBRB 3PSIA 4CZCA 4HDUA 2L01A 4KFCA 3KZIC 2IS6A 1JTYA 4GRIA 4CGZA 2DQRA 2VC1A 3I59A 2G7GA 4UY8I 4R79A 1YW7A 4EMSA 2HYTA 3OL4A 2HKXA 2L7MP 2P8TA 2QKLB 1D5YA 2D2WA 3ERED 3PQKA 4ICHA 5F1RA 1AWCA 2A69F 5GTHC 2W82A 1FSHA 3DBHB 5LHGA 3CCQI 5K5QA 5D6EA 3FM3A 3S2DJ 3HOWJ 2R7XA 3GTLJ 4IHXA 5DD4A 2PG4A 3QRFF 1QQIA 3ANGA 4A3GJ 3QYFA 3HGGA 4CYDA 1CGPA 2F5CA 1STZA 5ILUA 1PYVA 1LPQA 2GXAA 5M5XJ 4YEJA 2LKSA 3MKLA 2E1MC 3DFGA 1K6YA 4WF2A 2WTEA 5FGMA 2VONA 1U9NA 1HSJA 3L00A 2FD5A 3KP3A 1QZEA 3CLQA 1R4MB 2W85A 2FU4A 3TP0A 5F0HA 5HDGA 1B9MA 2RNJA 3FXKA 1X58A 3TP3A 3F8MA 2DMQA 3VIBA 3BLYA 1MBEA 5HDNA 3OYMA 3PO2J 1ZARA 1XMAA 1NHAA 3JTGA 3AQSA 3L09A 4BY7J 2LD5A 2FE3A 4ABZA 3ZQGA 4LFUA 2PJRB 1XCVA 4E7SA 3T8TA 2CYYA 1Z6RA 3HIFA 4P96A 1XCBA 1ZRFA 5B3SH 1JUPA 2X51A 3K0LA 4I76A 1BJZA 5E8GA 4D7MA 2IS4A 3VYTB 1XS9A 4H0EA 3UNGC 3KFWX 2OUMA 5IPAA 2BY0A 4CH7A 1MBGA 4UNOA 4A3MJ 2EFOA 2EZKA 2Y30A 1WCMJ 4C2MA 1P6RA 2ZMEC 2GOXB 4O3MA 4ZYAA 2A3SA 3B6AA 1WH7A 2GZWA 4KT5C 1PUEE 3L2CA 5J1YA 3RQIA 5JVTA 2UXHA 3GWZA 3E6DA 2IEKA 4L5IA 4UV8A 2KLOA 3HZJA 3K4MA 4ME9A 4HF2A 1JUMA 3FM5A 4OMZA 3ECOA 4DVYP 3RDIA 2F2EA 4ACIA 1I3AA 3IKVA 4DGWB 3FKIJ 2M8EA 1IRZA 2DAOA 3J81K 3I0TA 3R6SA 2DFHA 3HKZA 1IN6A 3N05A 1IUYA 4M3DA 1ENHA 2ZXWH 2KDOA 3M8FA 3VYUB 5E3NA 3AL0C 4FX4A 3PNVA 2PI0A 4C2MJ 2VIXA 2JVHA 4U9NA 2G7SA 4PSXA 1UAAA 3W6VA 1R1UA 2JUCA 1S6LA 1YJ9I 3RPUA 2WA0A 3FBNB 2MD0A 4UB6C 1YG2A 2M34A 3ZQ7A 3BHQA 2H1LA 2EFWA 3DLLF 3I4NJ 1YX5A 3JRDA 4WXDA 4BNCA 4NB5A 2JN6A 3P5JA 4B3AA 2JK3A 4BE0A 3GTMJ 3R0AA 3VUQA 1ZKGA 4G6TB 4ZYDA 2GXBA 1AU7A 1BOBA 4ZDLA 1RR8C 2WY7Q 2C6YA 4Y33A 1LFUP 1BC8C 3FXJA 3BTCA 1FLIA 4CDGA 1ZHFA 2H09A 3M8JA 1BL0A 5LGUA 2D6YA 2WAQN 3C2HA 5J4VA 1VQ4I 3V8LA 3F21A 3W6KB 1FBQA 2FNPA 1DQUA 3P9TA 2O3FA 1V5FA 2TDXA 3WHBA 4W1UA 2QM3A 5KAFC 3CJQB 1NK2P 3G6EI 5D5WB 4ENMA 2J5OA 2K3PA 5D4SA 4C3JJ 1MJ9A 4II2A 5GAHJ 2DG7A 4AUXA 3I54A 2RC4A 1T39A 1W4MA 3REOA 2EQRA 1G2HA 4I99C 3RIRA 3OSGA 2HI3A 4KT6A 2HOEA 3I4PA 2E19A 2XAJA 3M3YJ 4PXIA 1NG6A 2KDZA 5HNHA 1HQCA 5AONA 2LC2A 3MZYA 3LAPA 2XAHA 2YU9J 2JPCA 5J8FA 1ACIA 1LVKA 2DDAA 4EGZA 2BV6A 2DYRH 4XLHA 1L3LA 3RJPA 2E60A 4XLEA 1XGMA 2V1NA 3OR2C 3TDZC 4MLOA 1KQ9A 4PJ0C 3K4CA 3KKDA 4MNUA 3QKXA 4JL3A 2VKDA 1XG1A 5D8LB 1U9OA 1TQPA 3DQVC 2NS0A 1ERDA 1H88C 1SMTA 1MGTA 3COLA 5C4YA 2L4AA 1BR1A 3WGHA 5IYBJ 4OD4A 1K4SA 2HQAA 1Q1HA 2V1UA 3NNRA 1GXPA 2W84A 4IVNA 5EF6A 1MMSA 2VI6A 2Z2SB 3KKCA 3H3VK 1R5ID 4BE1A 5CVVA 4J19A 5C4XJ 1FC3A 2KJBA 2WBMA 2HYFA 2WWYA 1WJFA 5H6RA 5HVQC 2Y0MA 3I53A 4ZYGA 1JJ6C 4I09A 1WWXA 1GV2A 2N8GA 3BG9A 2VN2A 5DCMA 4LK0F 3T6NA 1G6NA 1Z6TA 3G1OA 5HS7A 4AVZA 3H5RA 1D1CA 3E5XA 4XN0A 1M1EB 1SFKA 1CF7A 2NOJB 2PMHA 4LD5A 3W2VA 4B1RA 1HW2A 1OISA 1YLFA 2ZCNA 1QHGA 2HQ5A 5H2FC 4RB2C 2G7UA 3BZKA 3CJRB 3F8BA 3A03A 2DI3A 4PZJA 4CXFA 1U5TA 1BR2A 1XGSA 1Y6IA 4NC6A 3RD3A 1HA8A 3HJEA 2P7VB 5BMZA 2FBIA 4IF4A 3ZQQA 3TW7A 1DP3A 4A2UA 1MNEA 2JT1A 2HS5A 4BGDA 4XR6A 2GA1A 5GPCA 1UG2A 3E6CC 3JCUC 4P1WA 3HSFA 3S16J 3E5UA 5D1RA 2R7VA 1WPKA 5IT9Z 4FHTA 1V3FA 4DNCA 3ZQFA 3PFIA 1SFXA 3QAHA 1R4NB 4DOZA 3C7JA 4L9JA 3SQNA 4BDZA 2A5YB 2XROA 1O7LA 2ZSIB 2QQBA 5LEJA 5D18A 3AFHA 3FIWA 2H6BA 3ABLH 1QPMA 4IX7A 4ZDOA 5E79C 2LNBA 4D9JA 1EH7A 4M3FA 3PIPF 1ON1A 1NH3A 4AVPA 1LDJA 3VW1A 1FMWA 1HDPA 2JUGA 2A61A 1TWGJ 2ID6A 2WAQA 3DKYA 1S7AA 3HUGB 3A01B 2H8RA 2ISZA 4ESJA 4NBQA 3KEOA 3NWTA 2VKEA 2JRTA 4K2EA 4BJTA 3BPVA 3HBLA 1JKQC 1YW9A 5DCMB 4LIUA 5L3CA 5BQTA 3GUDA 4FX0A 5C4JJ 1OJLA 2M2EA 4UB8C 2KPMA 5LLQA 4V19K 1IXSB 4DZPA 2G9WA 5E3LA 1Z91A 2HQRA 4AU7A 1CF7B 2OI8A 4G6DA 2KRFA 2VKHA 1OCCH 4Y17A 2QQ8A 2EV5A 5TJJA 5CJ9A 3MKZA 1MMNA 3K70D 1F5TA 3CCYA 1QZZA 3F0CA 5E3MA 2F07A 1KGSA 3RSNA 1T6SA 1JUSA 4QLCU 1R71A 3Q3SA 4XNFA 3QPLA 4EATA 1F36A 3OSFA 2DMPA 3I5UA 2YR2A 1SD6A 2E7WA 4H4KC 3H9QA 4AF5A 1ZLKA 3V78A 4YZEA 1QNTA 4RGRA 2Y9YA 4HZFA 2XB0X 5K7ZA 2HWVA 1SD5A 1ZK8A 2ECBA 4HG2A 3DPTA 4EEFG 2PQ8A 1YOVB 3Q9SA 2FMLA 4M3EA 2QGUA 4ETSA 4KISA 1RIOH 4JOMA 3OYLA 1BI2A 1DGWY 2OBPA 2VBZA 3T8RA 4XKBA 3WU1B 1RC9A 1RKWA 5LD2C 2DXIA 2X0LA 3CZ6A 2LVSA 2LR8A 4PJMA 3ROUA 4LIVA 5F64A 5FD5A 3JAMZ 4F93B 5EEHA 3L9FA 3QBMA 3S17J 3OYFA 1ZREA 1A35A 5FMPA 4NQWA 3C3WA 3SYTA 1H89C 1XMXA 5E20A 1RI7A 3WE2A 2DK8A 2Z1DA 3ZQHA 4XRSA 3LL7A 4HPQA 3W2WA 1BI3A 3S3OA 4LMYA 4MTDA 5IYCJ 4M74A 4UVBA 5L3GA 1A6IA 1X1CA 5B1BH 3PPBA 4F3QA 5CPRB 1D5VA 4BYYA 1IC8A 3SZGA 3I56I 5J1RA 1FIPA 1K83J 3S1MJ 2P5VA 3VSKA 4WXCA 2KL4A 1D1BA 2M9HA 3RPQA 1LDKB 4DBQA 4G6QA 4B48A 4ZYEA 1MSEC 2CWEA 3F8NA 2RHAA 3DEEA 3RKXA 1J5YA 2QYOA 4OAYA 3WTWC 4ZTFA 1FX7A 5E18F 2R92J 3QYEA 5D6FA 1Z3XA 2BY1A 3SEQA 3HXLA 2ZJRF 2A68F 1O4XA 2LY9A 2CFXA 1YFHA 3BY6A 2ZJ2A 1VF9A 4GCKA 1WRJA 3M7GA 2ZCXA 1Z3YA 1TZLA 2OERA 5DCFA 4GFKA 4X1EA 3AG2H 5GP9A 3S32A 2CUZA 3R0JA 5IT3A 3EUKL 1SFEA 2HTJA 2Q2EA 2YUSA 2RVCA 3HOVJ 2QIBA 1KU2A 3AG3H 1GT0C 2P6TA 2V6EA 4BHPA 4XL9A 2X1CA 4C30A 5TGTA 4B3XA 1K7AA 2L9SA 1WHUA 3A02A 4DYRA 1N78A 1G3SA 4N9HA 2XGEA 2QZ8A 2L2OA 1U0JA 2M8GX 4AIKA 2W4SA 3QOPA 1IW7F 2UXNA 3FHZA 4NQWB 4XSZF 1HLVA 3PIOF 2X6OA 2IGNA 4BQOA 4U7DA 1T0FC 5F6FA 1YJNI 3S93A 2ZY9A 2R4GA 4CCKA 2BXYA 1FP2A 1PP7U 1LKXA 5AIQA 4AIDA 3MFKA 4RLFA 4RAZA 4YIIA 4L18B 2R7SA 4G9YA 4D5FA 3SWHA 4WIBA 2STWA 3BG6A 2UXOA 3CRJA 3X2QH 3HOYJ 3PM1A 1ZGWA 4RLQA 1R36A 2UXXA 1WI9A 4WCGA 3OIPA 2B1EA 4MQVA 3S2HJ 2XRLA 3TL4X 2O0YA 2X9DA 2YVEA 2WGBA
chains in the Genus database with same CATH topology
5IYDJ 2LTPA 5M5XJ 3MKLA 1DU6A 4GFLA 3NXCA 1RR7A 4M3GA 1U9NA 1I3QJ 2O7TA 1YRNB 2QOPA 3BG3A 3LSRA 2FD5A 3BTJA 5EFYA 2V57A 2WB1N 1VI0A 2E1OA 3TP0A 3V6GA 5F0HA 1CQTA 2DMUA 4JP0A 2ME6A 4DYQA 1AKHA 3NI7A 1MH4A 2LFBA 1X58A 3TP3A 3HOXJ 2DMQA 2MGQA 2HYJA 3VIBA 3KZ9A 1MBEA 1JT0A 1Y1VJ 4BY1J 3PO2J 1ETKA 1VNDA 2TCTA 2OPTA 3AQSA 4BY7J 2LD5A 4ABZA 1NK3P 3ZQGA 5J3LA 3FISA 5IP7J 2R5YB 3ZQCA 3BTIA 4GCLA 1TWFJ 3DCFA 2HDDA 4A3CJ 2PMZN 2TRTA 5EZGA 1JUPA 2GM4A 2JWTA 2YS9A 1BJZA 4I76A 4D7MA 1XS9A 3JR9A 3CMYA 5IPAA 1MBGA 4A3MJ 2DTZA 1SGMA 3LWJA 3GTPJ 1QPIA 2EZKA 2Y30A 1WCMJ 2AHQA 2LK2A 4RDUA 1IDYA 3BTLA 3B6AA 1VFCA 1WH7A 1TWAJ 5J1YA 3RQIA 1FTTA 2UXHA 2IEKA 5FKMA 2EBIA 3HTHA 4ME9A 1ETYA 1ETXA 1JUMA 2DN0A 3VVYA 1P7IA 2UXIA 4ACIA 1T33A 3BR3A 3FKIJ 4L62A 2NP5A 1IRZA 3BCGA 1Z77A 2I10A 4MO7A 1MNMC 5JLXA 4M6VA 1QRYA 1ENHA 4M3DA 5J1UA 5E3NA 1YRNA 2JJ7A 5FKNA 3S1NJ 2Y2ZA 4C2MJ 4MIMA 4BXXJ 4S0HB 2OF7A 2G7SA 4CGRA 2DA4A 5CXGA 2Y0SN 4IHWA 3W6VA 2EZHA 4C3HJ 5K7FA 1X2NA 3HB9A 4D5CA 5CW8A 2JMWA 2ELKA 2M34A 3FK6A 1B8IB 3PO3J 3BHQA 3CDLA 2AO9A 3I4NJ 1JTXA 3JRDA 2R5YA 2ME0A 3GTGJ 1ZTRA 5IOYA 1AKHB 2JN6A 4B3AA 5F27A 2JK3A 3TW6A 3GTMJ 3HTJA 4KWAA 5K58A 3VUQA 4A3DJ 1ZKGA 1AU7A 2JA5J 2P81A 1T56A 1LFUP 3CJDA 3BTCA 1Y1WJ 3EGQA 1OCPA 5IP6A 2O8KA 2L7FP 3GTJJ 2VUMJ 3JRAA 4HKUA 1BL0A 4QSHA 2D6YA 2WAQN 1TWCJ 3LNQA 1JKRC 1IG7A 1RPWA 2PZ9A 2D5VA 1OFCX 4B4CA 3P9TA 1P7JA 4AC6A 3WHBA 1JKPC 4W1UA 1BA5A 3VPRA 1NK2P 3BR5A 2K9SA 2XPUA 3HGYA 4C3JJ 4UUSB 3GTQJ 2DG7A 4AUXA 3K7AJ 3FK7A 3VW0A 4V2GA 2IAIA 1G2HA 2COBA 2EQRA 3VP5A 4L5EA 4Y7NJ 2R0QC 3OSGA 2HI3A 5FLVA 3M3YJ 4PXIA 2E19A 2KDZA 1FIAA 4V2FA 3SFIA 4A3FJ 1E3OC 1IGNA 3S15J 2QWTA 1ETOA 2YU9J 1SFOJ 1IV6A 2G3BA 2DG8A 2HKUA 2CJJA 2W53A 4DZJA 2REKA 4FTHA 2G0EA 1Q1VA 2XGDA 1HF0A 2E2JJ 4MLOA 1RETA 1B8IA 3Q0VA 2MSYA 1LE8A 3M4OJ 3KKDA 3LJLA 3QKXA 3VVZA 5FKKA 2MW8A 4JL3A 4D7NA 1XG1A 5K7HA 3JRCA 3RZOJ 1HCRA 1U9OA 1BW5A 2CUFA 2UXUA 1F43A 1H88C 3BRUA 2GUHA 3COLA 3HTIA 5C4YA 2K9QA 2GLOA 3BT9A 5IYBJ 3S1RJ 3HOZJ 5DAJA 2CUEA 2HXOA 4AYBN 4HNVA 3O8HA 3ANPA 2HOTA 3LSJA 3NNRA 3S5RA 1MBJA 2HXIA 1UMQA 5EF6A 3L1PA 2VI6A 3IH3A 3KKCA 3QQAA 3H3VK 3TEDA 4A3EJ 2ZOZA 3SDGA 1RKTA 2QCOA 4J19A 5C4XJ 2E2IJ 3HIMA 3ZQLA 1HOMA 3GEUA 1MBHA 5FKOA 1GV5A 3CWRA 4UUSA 4RBOA 1JJ6C 1JT6A 1GV2A 5F08A 2N8GA 2NS8A 3BG9A 4A3BJ 3ZOBA 1ZR4A 2L0KA 3HE0A 4JX5A 3T6NA 4A3IJ 1APLC 1B72A 3G1OA 3JRHA 5E3OA 4AC0A 5JLWA 3D1NI 2RASA 4MXMA 2CU7A 1ETVA 4UUTA 2EZLA 4B1RA 5M5WJ 1ETWA 2ZCNA 2B63J 2HQ5A 3NARA 2VKVA 2YVHA 4BBRJ 5HBUA 3A03A 1W0TA 2XPWA 1AHDP 4XK4A 3RD3A 3QPSA 4FISA 3NAUA 3TW7A 4A69C 1FJLA 3EUPA 1MH3A 2NX4A 5GPAA 5GPCA 3HTAA 1UG2A 1LE8B 3S16J 2GBYA 2ZB9A 5D1RA 3DPJA 4A3LJ 1WPKA 2UXPA 3ZQFA 1ETQA 1MSFC 4A93J 5M3FJ 2JA6J 1ITYA 5EG0A 1U78A 3BR0A 5DS9A 5F1JA 2NVTJ 3H0GJ 4XRSG 2ZOYA 4DW6A 3Q0WA 5BNGA 2XGCA 3NRGA 5D18A 3LSPA 3FIWA 3FRQA 3GBGA 1ZQ3P 2R5ZA 5FGLA 4FCYA 3LHQA 1DU0A 1U8BA 2X48A 3BR2A 2Y9ZA 2E2HJ 4M3FA 1WGXA 3BG5A 1JJ8C 1JKOC 2DA3A 3VW1A 1HDPA 1IUFA 2DA6A 1XC5A 4NELA 1TWGJ 2CQQA 2ID6A 2JA7J 2JA8J 5AQCA 2XDNA 2NVQJ 5EZHA 3UKGA 5EGOA 2IBDA 3A01B 2H8RA 2O9LA 3HEFA 2VKEA 4DYCA 2HOSA 4FE4A 2NVYJ 4NN1A 3HBLA 3GZIA 1JKQC 3G7RA 5EYRA 1NTCA 2EH3A 4JX4A 1B72B 3RH2A 1WI3A 5C4JJ 4QIWN 1OJLA 2ID3A 2KT0A 2M2EA 4DZPA 1S7EA 2O7OA 5E3LA 2FX0A 1X2MA 3Q0UA 2NOGA 2OI8A 4X6AJ 3IV5A 3DEWA 3VOXA 4GCTA 5EDNA 1UI5A 5M5YJ 5FKLA 2PBXA 3B6CA 3CCYA 1GVDA 1UI6A 3F0CA 2WV1A 5E3MA 2F07A 4FE7A 1JUSA 2DJNA 3Q3SA 3ZQIA 3BR1A 3QPLA 1F36A 3OSFA 2DMPA 3B81A 4IHVA 2K9NA 3OIOA 3NPIA 5H9TA 4C3IJ 2MG4A 4AF5A 1I50J 4XRMA 3V78A 4JYKA 4YZEA 2DMTA 2Y9YA 2XB0X 5K7ZA 2EZIA 5IOZA 2ECBA 1ZK8A 1OCTC 2XSDC 2K40A 4NDLA 4EEFG 4M3EA 3RKQA 3BNIA 3C07A 5D19A 2HOAA 4JNNA 3JRGA 5EG0B 4JKZA 5F04A 1Z0XA 3MN2A 4QTRA 1RKWA 1MBKA 2ECCA 4G12A 2CQXA 2LR8A 2LVSA 3VOKA 3A01A 3JREA 1SANA 2DA2A 2R5ZB 3KNWA 4LOCA 3QBMA 5C3EJ 5DTDA 1R9TJ 3ON4A 3IH4A 3S17J 3AQTA 3JRBA 4W97A 5FMPA 5HODA 4MK6A 1H89C 2W48A 9ANTA 1QVTA 3ZQHA 4XRSA 1ORKA 3O8GA 3BQZA 3WHCA 5EGOB 1I6HJ 1UHSA 5CXIA 1TWHJ 5IYCJ 1W0UA 1A6IA 2VPRA 3PPBA 3I4MJ 3HDDA 1IC8A 4UDSA 2DMNA 5J1RA 1EF4A 4CYCA 1FIPA 2G7LA 3C2BA 3JRFA 2CRGA 2ZCMA 3E7QA 3G56A 1K83J 2LP0A 3MVPA 3S1MJ 3G1LA 1IDZA 1PUFA 4XIDA 2FJ1A 2XB5A 3LOCA 4BKXA 1IJWC 2Y31A 3OOUA 2M9HA 4A3KJ 3MNLA 1FEXA 4GFBA 1MSEC 3F1BA 3HKZN 3IUVA 2RHAA 2FBQA 3VVXA 2DA7A 1HDDC 2R92J 1JGGA 1FTZA 2Q24A 5FLMJ 2LKXA 1O4XA 2LY9A 4BBSJ 3LSGA 3SJMA 1LFBA 4MFDA 1H8AC 1GDTA 4Y52J 1VF9A 4GCKA 2ZCXA 3GTOJ 4M3BA 4IHYA 3RZDJ 2FQ4A 2OERA 3VW2A 4GFKA 4X1EA 5HSZA 5GP9A 2NS7A 2LLKA 5C44J 2QTQA 3PASA 5FHPA 2YUSA 3HOUJ 3HOVJ 2QIBA 5IP9J 2M0CA 5HAWA 5M3MJ 1GT0C 1RESA 5F0CA 4A3JJ 4MFEA 3K2AA 2DA1A 1TC3C 1QVUA 2GFNA 4DYRA 1GUUA 3A02A 4XICA 2QF7A 3JRIA 2GENA 2QKOA 3HM5A 2XGEA 1ZR2A 2M8GX 2WUIA 3ON2A 2NVXJ 2L7ZA 3IH2A 3BJBA 1HLVA 1JTYA 2DA5A 2X6OA 4JX6A 3O60A 2G7GA 3E7LA 2HYTA 5FJ8J 2L7MP 2L9RA 3JSJA 5F0FA 1D5YA 4I6ZA 2R93J 4ICHA 4D5FA 3G1MA 2UXOA 3CRJA 4CYCB 3BR6A 3HOYJ 3PM1A 1BW6A 2XPVA 4IEJA 3GTKJ 3CQZJ 1ZGWA 1PUFB 2RAEA 1POGA 3S2DJ 3HOWJ 1WH5A 3GTLJ 3S2HJ 2XRLA 2X9DA 4IHXA 3S1QJ 3S14J 5EEAA 2NP3A 2H1KA 2YVEA 3ANGA 3BQYA 4A3GJ 2WGBA 1A5JA 3HGGA 1K61A 1MBFA 2IU5A 2R7ZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD J;  2LTP A;  5M5X J;  3MKL A;  1DU6 A;  4GFL A;  3NXC A;  1RR7 A;  4M3G A;  1U9N A;  1I3Q J;  2O7T A;  1YRN B;  2QOP A;  3BG3 A;  3LSR A;  2FD5 A;  3BTJ A;  5EFY A;  2V57 A;  2WB1 N;  1VI0 A;  2E1O A;  3TP0 A;  3V6G A;  5F0H A;  1CQT A;  2DMU A;  4JP0 A;  2ME6 A;  4DYQ A;  1AKH A;  3NI7 A;  1MH4 A;  2LFB A;  1X58 A;  3TP3 A;  3HOX J;  2DMQ A;  2MGQ A;  2HYJ A;  3VIB A;  3KZ9 A;  1MBE A;  1JT0 A;  1Y1V J;  4BY1 J;  3PO2 J;  1ETK A;  1VND A;  2TCT A;  2OPT A;  3AQS A;  4BY7 J;  2LD5 A;  4ABZ A;  1NK3 P;  3ZQG A;  5J3L A;  3FIS A;  5IP7 J;  2R5Y B;  3ZQC A;  3BTI A;  4GCL A;  1TWF J;  3DCF A;  2HDD A;  4A3C J;  2PMZ N;  2TRT A;  5EZG A;  1JUP A;  2GM4 A;  2JWT A;  2YS9 A;  1BJZ A;  4I76 A;  4D7M A;  1XS9 A;  3JR9 A;  3CMY A;  5IPA A;  1MBG A;  4A3M J;  2DTZ A;  1SGM A;  3LWJ A;  3GTP J;  1QPI A;  2EZK A;  2Y30 A;  1WCM J;  2AHQ A;  2LK2 A;  4RDU A;  1IDY A;  3BTL A;  3B6A A;  1VFC A;  1WH7 A;  1TWA J;  5J1Y A;  3RQI A;  1FTT A;  2UXH A;  2IEK A;  5FKM A;  2EBI A;  3HTH A;  4ME9 A;  1ETY A;  1ETX A;  1JUM A;  2DN0 A;  3VVY A;  1P7I A;  2UXI A;  4ACI A;  1T33 A;  3BR3 A;  3FKI J;  4L62 A;  2NP5 A;  1IRZ A;  3BCG A;  1Z77 A;  2I10 A;  4MO7 A;  1MNM C;  5JLX A;  4M6V A;  1QRY A;  1ENH A;  4M3D A;  5J1U A;  5E3N A;  1YRN A;  2JJ7 A;  5FKN A;  3S1N J;  2Y2Z A;  4C2M J;  4MIM A;  4BXX J;  4S0H B;  2OF7 A;  2G7S A;  4CGR A;  2DA4 A;  5CXG A;  2Y0S N;  4IHW A;  3W6V A;  2EZH A;  4C3H J;  5K7F A;  1X2N A;  3HB9 A;  4D5C A;  5CW8 A;  2JMW A;  2ELK A;  2M34 A;  3FK6 A;  1B8I B;  3PO3 J;  3BHQ A;  3CDL A;  2AO9 A;  3I4N J;  1JTX A;  3JRD A;  2R5Y A;  2ME0 A;  3GTG J;  1ZTR A;  5IOY A;  1AKH B;  2JN6 A;  4B3A A;  5F27 A;  2JK3 A;  3TW6 A;  3GTM J;  3HTJ A;  4KWA A;  5K58 A;  3VUQ A;  4A3D J;  1ZKG A;  1AU7 A;  2JA5 J;  2P81 A;  1T56 A;  1LFU P;  3CJD A;  3BTC A;  1Y1W J;  3EGQ A;  1OCP A;  5IP6 A;  2O8K A;  2L7F P;  3GTJ J;  2VUM J;  3JRA A;  4HKU A;  1BL0 A;  4QSH A;  2D6Y A;  2WAQ N;  1TWC J;  3LNQ A;  1JKR C;  1IG7 A;  1RPW A;  2PZ9 A;  2D5V A;  1OFC X;  4B4C A;  3P9T A;  1P7J A;  4AC6 A;  3WHB A;  1JKP C;  4W1U A;  1BA5 A;  3VPR A;  1NK2 P;  3BR5 A;  2K9S A;  2XPU A;  3HGY A;  4C3J J;  4UUS B;  3GTQ J;  2DG7 A;  4AUX A;  3K7A J;  3FK7 A;  3VW0 A;  4V2G A;  2IAI A;  1G2H A;  2COB A;  2EQR A;  3VP5 A;  4L5E A;  4Y7N J;  2R0Q C;  3OSG A;  2HI3 A;  5FLV A;  3M3Y J;  4PXI A;  2E19 A;  2KDZ A;  1FIA A;  4V2F A;  3SFI A;  4A3F J;  1E3O C;  1IGN A;  3S15 J;  2QWT A;  1ETO A;  2YU9 J;  1SFO J;  1IV6 A;  2G3B A;  2DG8 A;  2HKU A;  2CJJ A;  2W53 A;  4DZJ A;  2REK A;  4FTH A;  2G0E A;  1Q1V A;  2XGD A;  1HF0 A;  2E2J J;  4MLO A;  1RET A;  1B8I A;  3Q0V A;  2MSY A;  1LE8 A;  3M4O J;  3KKD A;  3LJL A;  3QKX A;  3VVZ A;  5FKK A;  2MW8 A;  4JL3 A;  4D7N A;  1XG1 A;  5K7H A;  3JRC A;  3RZO J;  1HCR A;  1U9O A;  1BW5 A;  2CUF A;  2UXU A;  1F43 A;  1H88 C;  3BRU A;  2GUH A;  3COL A;  3HTI A;  5C4Y A;  2K9Q A;  2GLO A;  3BT9 A;  5IYB J;  3S1R J;  3HOZ J;  5DAJ A;  2CUE A;  2HXO A;  4AYB N;  4HNV A;  3O8H A;  3ANP A;  2HOT A;  3LSJ A;  3NNR A;  3S5R A;  1MBJ A;  2HXI A;  1UMQ A;  5EF6 A;  3L1P A;  2VI6 A;  3IH3 A;  3KKC A;  3QQA A;  3H3V K;  3TED A;  4A3E J;  2ZOZ A;  3SDG A;  1RKT A;  2QCO A;  4J19 A;  5C4X J;  2E2I J;  3HIM A;  3ZQL A;  1HOM A;  3GEU A;  1MBH A;  5FKO A;  1GV5 A;  3CWR A;  4UUS A;  4RBO A;  1JJ6 C;  1JT6 A;  1GV2 A;  5F08 A;  2N8G A;  2NS8 A;  3BG9 A;  4A3B J;  3ZOB A;  1ZR4 A;  2L0K A;  3HE0 A;  4JX5 A;  3T6N A;  4A3I J;  1APL C;  1B72 A;  3G1O A;  3JRH A;  5E3O A;  4AC0 A;  5JLW A;  3D1N I;  2RAS A;  4MXM A;  2CU7 A;  1ETV A;  4UUT A;  2EZL A;  4B1R A;  5M5W J;  1ETW A;  2ZCN A;  2B63 J;  2HQ5 A;  3NAR A;  2VKV A;  2YVH A;  4BBR J;  5HBU A;  3A03 A;  1W0T A;  2XPW A;  1AHD P;  4XK4 A;  3RD3 A;  3QPS A;  4FIS A;  3NAU A;  3TW7 A;  4A69 C;  1FJL A;  3EUP A;  1MH3 A;  2NX4 A;  5GPA A;  5GPC A;  3HTA A;  1UG2 A;  1LE8 B;  3S16 J;  2GBY A;  2ZB9 A;  5D1R A;  3DPJ A;  4A3L J;  1WPK A;  2UXP A;  3ZQF A;  1ETQ A;  1MSF C;  4A93 J;  5M3F J;  2JA6 J;  1ITY A;  5EG0 A;  1U78 A;  3BR0 A;  5DS9 A;  5F1J A;  2NVT J;  3H0G J;  4XRS G;  2ZOY A;  4DW6 A;  3Q0W A;  5BNG A;  2XGC A;  3NRG A;  5D18 A;  3LSP A;  3FIW A;  3FRQ A;  3GBG A;  1ZQ3 P;  2R5Z A;  5FGL A;  4FCY A;  3LHQ A;  1DU0 A;  1U8B A;  2X48 A;  3BR2 A;  2Y9Z A;  2E2H J;  4M3F A;  1WGX A;  3BG5 A;  1JJ8 C;  1JKO C;  2DA3 A;  3VW1 A;  1HDP A;  1IUF A;  2DA6 A;  1XC5 A;  4NEL A;  1TWG J;  2CQQ A;  2ID6 A;  2JA7 J;  2JA8 J;  5AQC A;  2XDN A;  2NVQ J;  5EZH A;  3UKG A;  5EGO A;  2IBD A;  3A01 B;  2H8R A;  2O9L A;  3HEF A;  2VKE A;  4DYC A;  2HOS A;  4FE4 A;  2NVY J;  4NN1 A;  3HBL A;  3GZI A;  1JKQ C;  3G7R A;  5EYR A;  1NTC A;  2EH3 A;  4JX4 A;  1B72 B;  3RH2 A;  1WI3 A;  5C4J J;  4QIW N;  1OJL A;  2ID3 A;  2KT0 A;  2M2E A;  4DZP A;  1S7E A;  2O7O A;  5E3L A;  2FX0 A;  1X2M A;  3Q0U A;  2NOG A;  2OI8 A;  4X6A J;  3IV5 A;  3DEW A;  3VOX A;  4GCT A;  5EDN A;  1UI5 A;  5M5Y J;  5FKL A;  2PBX A;  3B6C A;  3CCY A;  1GVD A;  1UI6 A;  3F0C A;  2WV1 A;  5E3M A;  2F07 A;  4FE7 A;  1JUS A;  2DJN A;  3Q3S A;  3ZQI A;  3BR1 A;  3QPL A;  1F36 A;  3OSF A;  2DMP A;  3B81 A;  4IHV A;  2K9N A;  3OIO A;  3NPI A;  5H9T A;  4C3I J;  2MG4 A;  4AF5 A;  1I50 J;  4XRM A;  3V78 A;  4JYK A;  4YZE A;  2DMT A;  2Y9Y A;  2XB0 X;  5K7Z A;  2EZI A;  5IOZ A;  2ECB A;  1ZK8 A;  1OCT C;  2XSD C;  2K40 A;  4NDL A;  4EEF G;  4M3E A;  3RKQ A;  3BNI A;  3C07 A;  5D19 A;  2HOA A;  4JNN A;  3JRG A;  5EG0 B;  4JKZ A;  5F04 A;  1Z0X A;  3MN2 A;  4QTR A;  1RKW A;  1MBK A;  2ECC A;  4G12 A;  2CQX A;  2LR8 A;  2LVS A;  3VOK A;  3A01 A;  3JRE A;  1SAN A;  2DA2 A;  2R5Z B;  3KNW A;  4LOC A;  3QBM A;  5C3E J;  5DTD A;  1R9T J;  3ON4 A;  3IH4 A;  3S17 J;  3AQT A;  3JRB A;  4W97 A;  5FMP A;  5HOD A;  4MK6 A;  1H89 C;  2W48 A;  9ANT A;  1QVT A;  3ZQH A;  4XRS A;  1ORK A;  3O8G A;  3BQZ A;  3WHC A;  5EGO B;  1I6H J;  1UHS A;  5CXI A;  1TWH J;  5IYC J;  1W0U A;  1A6I A;  2VPR A;  3PPB A;  3I4M J;  3HDD A;  1IC8 A;  4UDS A;  2DMN A;  5J1R A;  1EF4 A;  4CYC A;  1FIP A;  2G7L A;  3C2B A;  3JRF A;  2CRG A;  2ZCM A;  3E7Q A;  3G56 A;  1K83 J;  2LP0 A;  3MVP A;  3S1M J;  3G1L A;  1IDZ A;  1PUF A;  4XID A;  2FJ1 A;  2XB5 A;  3LOC A;  4BKX A;  1IJW C;  2Y31 A;  3OOU A;  2M9H A;  4A3K J;  3MNL A;  1FEX A;  4GFB A;  1MSE C;  3F1B A;  3HKZ N;  3IUV A;  2RHA A;  2FBQ A;  3VVX A;  2DA7 A;  1HDD C;  2R92 J;  1JGG A;  1FTZ A;  2Q24 A;  5FLM J;  2LKX A;  1O4X A;  2LY9 A;  4BBS J;  3LSG A;  3SJM A;  1LFB A;  4MFD A;  1H8A C;  1GDT A;  4Y52 J;  1VF9 A;  4GCK A;  2ZCX A;  3GTO J;  4M3B A;  4IHY A;  3RZD J;  2FQ4 A;  2OER A;  3VW2 A;  4GFK A;  4X1E A;  5HSZ A;  5GP9 A;  2NS7 A;  2LLK A;  5C44 J;  2QTQ A;  3PAS A;  5FHP A;  2YUS A;  3HOU J;  3HOV J;  2QIB A;  5IP9 J;  2M0C A;  5HAW A;  5M3M J;  1GT0 C;  1RES A;  5F0C A;  4A3J J;  4MFE A;  3K2A A;  2DA1 A;  1TC3 C;  1QVU A;  2GFN A;  4DYR A;  1GUU A;  3A02 A;  4XIC A;  2QF7 A;  3JRI A;  2GEN A;  2QKO A;  3HM5 A;  2XGE A;  1ZR2 A;  2M8G X;  2WUI A;  3ON2 A;  2NVX J;  2L7Z A;  3IH2 A;  3BJB A;  1HLV A;  1JTY A;  2DA5 A;  2X6O A;  4JX6 A;  3O60 A;  2G7G A;  3E7L A;  2HYT A;  5FJ8 J;  2L7M P;  2L9R A;  3JSJ A;  5F0F A;  1D5Y A;  4I6Z A;  2R93 J;  4ICH A;  4D5F A;  3G1M A;  2UXO A;  3CRJ A;  4CYC B;  3BR6 A;  3HOY J;  3PM1 A;  1BW6 A;  2XPV A;  4IEJ A;  3GTK J;  3CQZ J;  1ZGW A;  1PUF B;  2RAE A;  1POG A;  3S2D J;  3HOW J;  1WH5 A;  3GTL J;  3S2H J;  2XRL A;  2X9D A;  4IHX A;  3S1Q J;  3S14 J;  5EEA A;  2NP3 A;  2H1K A;  2YVE A;  3ANG A;  3BQY A;  4A3G J;  2WGB A;  1A5J A;  3HGG A;  1K61 A;  1MBF A;  2IU5 A;  2R7Z J; 
#chains in the Genus database with same CATH topology
 2LTP A;  1RZ4 A;  2KFD A;  5J40 A;  4RGU A;  1BIA A;  3ZCO A;  5LRR A;  4GFL A;  2CSO A;  2B0L A;  2LF8 A;  3MQ0 A;  3IAM 2;  1RR7 A;  3PFY A;  4M6X A;  1YRN B;  2K4B A;  3V8K A;  3WGI A;  4IRV A;  2WB1 N;  2E1O A;  4F7Z A;  2ZME A;  3V6G A;  2KIS A;  2UUZ A;  3WTZ A;  2ME6 A;  3KEQ A;  3CMA I;  2DBB A;  1Z1D A;  3HOX J;  3FXR A;  4P5O A;  1N25 A;  2QEX I;  1SEU A;  4CO8 A;  1JT0 A;  1HC8 A;  5D4R A;  1YHQ I;  2OPT A;  2HYG D;  3CCR I;  5CQG A;  5J3L A;  1Y8Q B;  2R5Y B;  4PGH A;  4HYE A;  2DYS H;  4A3C J;  2GOM A;  2PMZ N;  5EZG A;  2IJL A;  3CCJ I;  2JWT A;  2YS9 A;  3H5A A;  1TT5 B;  1JGS A;  5D5V B;  3H9G A;  4XOR A;  1ZEL A;  4KN4 X;  5ICF A;  1SGM A;  2DTZ A;  1R00 A;  3LWJ A;  3GTP J;  2M87 A;  1Y0U A;  2LK2 A;  2R7F A;  3MD2 A;  3CF5 F;  2M3A A;  3J7A O;  2RKH A;  4BEH A;  2GIV A;  2E1M B;  4D0P A;  1FTT A;  4CZZ A;  4CA0 A;  3V4G A;  1G59 A;  1J9I A;  2RQP A;  2MYS A;  2P5L C;  4YG2 F;  2DFI A;  3VVY A;  1P7I A;  1R7J A;  1J75 A;  3QP5 A;  2YX4 A;  2NP5 A;  3GW2 A;  2I8D A;  1Z77 A;  2I10 A;  2K9M A;  4HOB A;  4XKW A;  5HS9 A;  3LFU A;  1W36 D;  5L3F A;  1MW7 A;  1P2F A;  2I5U A;  2EWN A;  2MBF A;  2JJ7 A;  5FKN A;  2YPR A;  2R7W A;  3S1N J;  2KQR A;  2FJI 1;  4S0H B;  4ZZD A;  3WTU C;  4CGR A;  5CXG A;  3KP4 A;  4F91 B;  4C3H J;  4WWC A;  2R3S A;  1K6O A;  3IWZ A;  1X3U A;  4JK1 X;  2M7A A;  2WAD A;  3HB9 A;  1SAU A;  2Z3Y A;  5CW8 A;  2ELK A;  3HL2 A;  3KCC A;  3CDL A;  2PJR A;  1O3S A;  2PEX A;  3ASN H;  1ZTR A;  5F27 A;  3HTJ A;  3LAJ A;  5FLX K;  3M1C A;  2HZD A;  5K58 A;  2L4M A;  2CH0 A;  4A3D J;  1YS7 A;  3S3M A;  4C2T A;  4Y4R A;  1EV7 A;  1SD7 A;  2GWR A;  4Z6Y A;  1FY7 A;  1ZRD A;  4FQG A;  4XLC A;  1VQN I;  4PGG A;  4BHB A;  1Y1W J;  3IL2 A;  3OOP A;  1OYW A;  3GTJ J;  2VLA A;  5CQE A;  3CUQ A;  2EIN H;  2VBW A;  3CES A;  2V9V A;  2CQN A;  3LNQ A;  1ZG1 A;  2PZ9 A;  4NC8 A;  3OS0 A;  4B4C A;  3LST A;  2EA2 A;  1BI0 A;  1W7P D;  1JKP C;  1GLN A;  3AL0 B;  4UVC A;  1HW5 A;  2LYC A;  2XF5 A;  4E7H A;  2CGP A;  3BR5 A;  4XLP F;  2XPU A;  2EIM H;  4KUM A;  3E1S A;  3OMY A;  2D1V A;  4HF0 A;  4BEH B;  3HTS B;  3VW0 A;  2IAI A;  3NQO A;  4L5E A;  1VQ7 I;  5FLV A;  2NYX A;  1FIA A;  4V2F A;  2F6C A;  3SFI A;  1E3O C;  1N77 A;  1OCO H;  3S15 J;  2QWT A;  1ETO A;  3HYI A;  1SAX A;  2ISY A;  1IV6 A;  2KZG A;  2Q0O A;  3KIO A;  4RS8 A;  1FP1 D;  2DG8 A;  2HKU A;  3E6B A;  1J09 A;  3FWE A;  2REK A;  3RTR A;  2G0E A;  1DPU A;  1Q1V A;  4PJJ A;  1HF0 A;  2E2J J;  1YYV A;  1YTY A;  1RET A;  2BY3 A;  3D5L A;  5ICE A;  2HR3 A;  2MSY A;  3VVZ A;  3L2R A;  1UHW A;  4LJZ F;  5K7H A;  2V7F A;  1VQL I;  5B5E C;  4LK1 F;  5GAD J;  1BW5 A;  2R7O A;  4PDK A;  2L9V A;  4II3 A;  1B1B A;  2GUH A;  2VE8 A;  4A5N A;  1K4T A;  2GLO A;  4GO1 A;  5DAJ A;  3G73 A;  2VJ4 A;  4AYB N;  1XSX A;  3L2V A;  2V9K A;  4B43 A;  2E35 A;  1MBJ A;  2EV0 A;  2HXI A;  2F4M B;  3WG7 H;  1VQP I;  1VQ8 I;  3FX3 A;  3K8P C;  2NVU B;  1UMQ A;  3IH3 A;  2HEO A;  2EK5 A;  1OKR A;  2MC3 A;  1P4W A;  3OV8 A;  1RKT A;  2ZOZ A;  4XKV A;  2DLL A;  1BI1 A;  2PMZ A;  2DFE A;  4N0B A;  4M72 A;  1KA8 A;  2E34 A;  1S7O A;  3GEU A;  1QHH D;  3KEY A;  5FKO A;  5E1X A;  3K2Z A;  5J8C A;  2NNN A;  1GV5 A;  2LDU A;  5ILV A;  3CWR A;  4RBO A;  3K4K A;  3AG1 H;  3H36 A;  2LOO A;  3CUQ B;  5DV5 A;  5F08 A;  2Q8K A;  2O5R A;  1ZR4 A;  3HE0 A;  4CCL A;  1APL C;  1B72 A;  4I7H A;  4WX9 A;  1R1V A;  5E3O A;  2O61 A;  3F6V A;  3D1N I;  1XB4 A;  2ZSH B;  1WJ5 A;  2RAS A;  3CCL I;  2CU7 A;  1EH8 A;  2M4G A;  1ETV A;  3ASO H;  2V1X A;  4RMN A;  2ZXI A;  3GFJ A;  2XKP A;  2KIM A;  3KLO A;  3KE2 A;  3TOA A;  2B63 J;  4KMF A;  4RM3 A;  3VDX A;  1KU9 A;  2MH2 A;  1LJ9 A;  2RQQ A;  1S5L C;  5DUK A;  2FA5 A;  3RKW A;  3AKZ A;  1UJ8 A;  2HFH A;  3OY9 A;  1Y39 A;  2NX4 A;  3HSR A;  3HTA A;  2MLG A;  1V55 H;  3H3Z A;  5DM7 F;  5ED4 A;  3DPJ A;  2PBI A;  3V42 A;  1VZ0 A;  3WTS C;  1O3R A;  2QVO A;  1F1Z A;  2VJJ A;  3QP6 A;  4DJA A;  1H9G A;  2YSR A;  5DD8 A;  5EG0 A;  5M3F J;  1T8I A;  5KVR A;  2CFO A;  4ESB A;  2X1D A;  3E5Q A;  3Q0W A;  3BJO A;  1TNS A;  2XGC A;  4MGR A;  4LLL A;  3LSP A;  2KRC A;  3ZPL A;  4KDP A;  4XMY A;  3FRQ A;  2R5Z A;  1SC7 A;  1AA7 A;  4FCY A;  3LHQ A;  3BR2 A;  5FFX A;  2E2H J;  2IA2 A;  3ZXS A;  3V7C A;  1JKO C;  3TDU C;  2ELJ A;  4IZZ A;  3CUO A;  4EV0 A;  2DA6 A;  4BU2 A;  1OQY A;  2JA7 J;  3C18 A;  2A2F X;  3ULQ B;  2NVQ J;  4XRF A;  3UKG A;  4BDY A;  2FOW A;  5BOX A;  4Z2Y A;  1X4P A;  2G7H A;  4ASN A;  4RAG A;  2FXA A;  2EH3 A;  3QU3 A;  4O6J A;  3EPZ A;  1B72 B;  3RH2 A;  1XN7 A;  3PNT A;  1WI3 A;  3LSK A;  3RYP A;  3V8J A;  1KQ0 A;  5H20 A;  2KT0 A;  2ID3 A;  4ZTJ A;  3E97 A;  3ZMZ A;  1S7E A;  5FRM A;  3CUQ C;  3TBI A;  1X2M A;  4A0Y A;  2NOG A;  4ZC3 A;  3PJR A;  1P9Q C;  4YFX F;  1P4X A;  4ZH4 F;  2M1B A;  5ICG A;  3BJ6 A;  4GYG A;  3IV5 A;  1J7K A;  2ZFW A;  4GCT A;  1R23 A;  2DW4 A;  1X1P A;  5M5Y J;  2PBX A;  3HOS A;  1D8K A;  2WV1 A;  3LSH A;  1D0X A;  1BBY A;  1B6A A;  3RI4 A;  2CO5 A;  2XAU A;  2PX9 A;  3F8F A;  4IHV A;  2K9N A;  5H9T A;  4FAS D;  1E3H A;  2MG4 A;  2E36 A;  3HSE A;  3WU2 C;  1I50 J;  4XRM A;  3OYI A;  4IL6 C;  1R5G A;  3OWT A;  1KQ8 A;  1GVJ A;  2K40 A;  4NDL A;  2IA0 A;  3CME I;  5E1Z B;  1VQ9 I;  2DO7 A;  3JRG A;  2L02 A;  4AM3 A;  5EG0 B;  4JKZ A;  3M9A A;  5F04 A;  3N4M A;  1Z0X A;  2O03 A;  3CF2 A;  1RUN A;  1SVM A;  1O3Q A;  2H8W A;  2YVX A;  3HUG A;  2CMP A;  4G12 A;  1DDN A;  3VOK A;  1MDM A;  3A01 A;  3JRE A;  3FXO A;  2A05 A;  2R5Z B;  3BRO A;  2ICW G;  2OQR A;  4GCV A;  4B09 A;  1TBX A;  4LOC A;  2OCE A;  2LY1 A;  3IH4 A;  3JRB A;  5HOD A;  4M9Z A;  4GXO A;  1FSE A;  1QVT A;  3DWL E;  1MND A;  2E1C A;  3O8G A;  4Y13 A;  2EIL H;  3G4S I;  2K9L A;  1I6H J;  5CXI A;  1FNN A;  1TWH J;  2DOF A;  3M07 A;  2VE9 A;  1N75 A;  4O5V A;  1W0U A;  2VPL A;  1S29 A;  1LNW A;  3K1P A;  4UDS A;  2F5D A;  3LQR A;  3JRF A;  4KNY A;  3M1E A;  1USS A;  2LP0 A;  2W1O A;  2XAQ A;  3U1K A;  4EJW A;  4IQ4 A;  1IDZ A;  1PUF A;  4XID A;  2FJ1 A;  2K27 A;  3LOC A;  5CLS A;  2Y31 A;  1TT0 A;  4BQN A;  4HLY A;  4EJO A;  3DEU A;  3K69 A;  3MNL A;  2EJR A;  1MD0 A;  2KIF A;  4I0B A;  5CYV A;  3SEZ A;  1G4D A;  5AIP A;  3IP4 B;  2DA7 A;  2DFF A;  2M7B A;  3FF5 A;  5JR3 A;  2E5Z A;  2Q24 A;  1ONV A;  2JA2 A;  5KAI C;  4BQQ A;  3K4J A;  3SJM A;  1FBS A;  1S8N A;  1FT9 A;  1GDT A;  3GTO J;  1YIO A;  3RZD J;  3Q9V A;  1T0F A;  5HSZ A;  2R7D A;  3G71 I;  2NS7 A;  3ABT A;  3VSL A;  3OYA A;  2W25 A;  3OL3 A;  4HV6 A;  1KON A;  2ZJQ F;  5IP9 J;  3NRV A;  1A04 A;  3K10 A;  5GAE J;  5M3M J;  3PQJ A;  4X0G A;  1QGP A;  3F9K A;  1JHF A;  1QO0 D;  3DBL B;  3ESW B;  4IO9 F;  1ZAO A;  5F0C A;  4A3J J;  4MFE A;  1X1D A;  2ELH A;  2ESH A;  5J6X A;  4QWQ A;  2V79 A;  1TC3 C;  1D0Z A;  4G7H F;  2OCC H;  3JRI A;  1GUU A;  1MDM B;  2QF7 A;  1DPR A;  3ZMT A;  3UR3 C;  2RV8 A;  3Q5F A;  2L7Z A;  3IH2 A;  4EM1 A;  2A07 F;  1VQ5 I;  5HOO A;  3T1B A;  1FWZ A;  4EVI A;  4JX6 A;  4CCJ A;  4LB5 A;  2PJP A;  3K70 C;  4HRI A;  4OIN F;  3BCA A;  5FJ8 J;  2RN7 A;  3JSJ A;  5LRS A;  5FO5 A;  2P6S A;  5F0F A;  4I6Z A;  1MKM A;  3PNY A;  2V6C A;  4A5M A;  3WTX C;  5A2Q K;  4HX4 A;  3DU5 A;  3G1M A;  3DV8 A;  2PFV A;  1G3T A;  2NXN B;  5JFR A;  3BR6 A;  2H27 A;  2XPV A;  1VQO I;  5HS8 A;  3GTK J;  1PUF B;  1POG A;  1FMV A;  2P7C B;  2K86 A;  3RPU D;  1WH5 A;  4RGS A;  4EM2 A;  2OTJ I;  2X6X A;  3S14 J;  2NP3 A;  3LSI A;  3BQY A;  4ZDP A;  2OD5 A;  1X19 A;  4RM2 A;  1K61 A;  1MBF A;  3CCU I;  2R7Z J;  2RNG A;  5KK1 A;  2OC6 A;  2XAS A;  3E3V A;  3NXC A;  4B47 A;  3D0S A;  1MIJ A;  1IN4 A;  4M3G A;  1I3Q J;  3K4B A;  4UXN A;  4RAF A;  3BG3 A;  3W2A A;  2CG4 A;  4YIR X;  5EFY A;  1XX5 A;  1VI0 A;  1BR4 A;  2VBX A;  1CQT A;  2HDW A;  4JP0 A;  3DTK A;  2BGC A;  2EB7 A;  2LY2 A;  1E3P A;  2ZCW A;  4PK4 A;  2HYJ A;  1Y1V J;  2K02 A;  2GAU A;  2XC7 A;  1J2X A;  1VND A;  1WJB A;  2TCT A;  3CC4 I;  3FIS A;  5IP7 J;  3ZQC A;  3CLO A;  2E5N A;  1TWF J;  2QSG X;  2TRT A;  4ZYH A;  5HLG A;  3HDD A;  3ZMU A;  3O3K A;  3I55 I;  4ENJ A;  4JQF A;  4Q5S F;  3VYR B;  3BZC A;  5DYM A;  3RCO A;  5KNL A;  3CMY A;  3OYE A;  2JVG A;  2KRH A;  2F5F A;  1XPX A;  5D5U B;  1QPI A;  1D1A A;  2AHQ A;  4PJL A;  3KP5 A;  3V7S A;  3A2K A;  5BPD A;  1LUJ B;  4RDU A;  1VFC A;  2RRE A;  3GX4 X;  1LFP A;  3N97 A;  2VQH A;  3FMQ A;  1QBJ A;  3F8C A;  2VOP A;  2KJC A;  3U9G A;  1ETX A;  1EKE A;  4N4N B;  3S2W A;  2UXI A;  1IO2 A;  4WK8 F;  3IUO A;  3OYG A;  1T33 A;  3GLL A;  4OAZ A;  2Z9O A;  1B9N A;  4L62 A;  3CO7 C;  4YFK F;  1K79 A;  4NUB A;  4MO7 A;  1ZRC A;  1OPC A;  4L9N A;  4M71 A;  1QRY A;  3KX2 A;  2ACJ A;  2HNH A;  2ESN A;  2VBY A;  1OCR H;  1YRN A;  3ZMD A;  3FZV A;  2A5W A;  4KMU X;  4XON A;  3KP6 A;  4BXX J;  3CP2 A;  2VXD A;  2DA4 A;  2HU9 A;  3FMR A;  1MJB A;  2EZH A;  4U0Y A;  3JW4 A;  3VEP A;  2D1H A;  2OJE D;  4D5C A;  2O8X A;  3ABK H;  3J80 K;  3FK6 A;  3L2Q A;  1B8I B;  4P9U A;  3PO3 J;  2AO9 A;  1X3Z B;  2R5Y A;  3DKX A;  3DPL C;  3TO9 A;  2WV0 A;  3QYB A;  4HQE A;  2ZC2 A;  4KWA A;  1WQ2 A;  3ZN1 A;  1T38 A;  3P9C A;  2L3D A;  2MAB A;  3V7R A;  1YIT I;  3CJD A;  2FEZ A;  4HNT A;  5FD6 A;  3EGQ A;  5IP6 A;  2O8K A;  5CKT A;  2VUM J;  1U8R A;  2XSJ C;  1W5T A;  2DQL A;  2DOD A;  2F5E A;  1JKR C;  1IG7 A;  4RB3 C;  4RAY A;  1OFC X;  1QZY A;  3NEU A;  3ZRG A;  1P7J A;  3OYJ A;  2D5V A;  1FOY A;  1UCR A;  2FUG 2;  3HTU A;  4A6D A;  2L7K A;  3GVA A;  2X85 A;  1BA5 A;  2K9S A;  3HGY A;  4DQ2 A;  4UUS B;  4HX8 A;  2IRF G;  3K7A J;  4HW0 A;  1R5H A;  2DJI A;  3VP5 A;  4LG0 A;  4Y7N J;  1S3J A;  4LB6 B;  1KYZ A;  1PP8 F;  2V1D A;  3FXU A;  1IGN A;  3K1N A;  4BH9 A;  5E8I A;  4B8X A;  3GO5 A;  5B1A H;  3S3N A;  2EIJ H;  2G3B A;  3CMM A;  3BOQ A;  4AIH A;  4MEX F;  4HEA 2;  4DZJ A;  2Y69 H;  1VQM I;  1IRX A;  3LA3 A;  1TQM A;  5BS6 A;  1I39 A;  3O2P E;  4BJ6 C;  1LE8 A;  4M73 A;  1REP C;  1X3W B;  4OIO F;  3JRC A;  2HZT A;  3RZO J;  2KIU A;  3F23 A;  3DLA A;  1HCR A;  3H5N A;  2CUF A;  1D8J A;  1F43 A;  3VOE A;  2W00 A;  3BRU A;  3HTI A;  4G94 A;  3BT9 A;  3S1R J;  3HOZ J;  2CUE A;  4HNV A;  3JSP A;  4EGY A;  2FSW A;  3O8H A;  2QLZ A;  3LSJ A;  3ZMV A;  2K5C A;  1BIB A;  3GLX A;  4EJT A;  2DDB A;  3H35 A;  3F72 A;  3QQA A;  4LGW A;  3OYD A;  3TO6 A;  3ELK A;  2QCO A;  3RKY A;  2J5P A;  1WZ2 A;  2E2I J;  1J59 A;  2V9P A;  1Z21 A;  3MCZ A;  1MBH A;  3MKW B;  2KP6 A;  3DU6 A;  1FYK A;  3GFI A;  3MZ8 A;  2CUJ A;  1HXD A;  2Z99 A;  2XDV A;  3JSO A;  1V54 H;  4A0X A;  2NS8 A;  4A3B J;  2ZO4 A;  5DDG A;  3TQN A;  3MKY B;  2L0K A;  2OU2 A;  2XF7 A;  4JX5 A;  4A3I J;  1W36 C;  3WGG A;  5ICC A;  3GZN B;  1LB2 A;  4L0Z B;  2BVL A;  3IRR A;  2UZK A;  2MH9 A;  5JLW A;  4MXM A;  1SVL A;  2LRD A;  2W24 A;  2HPI A;  3O6B B;  1EH6 A;  3BWG A;  4EJV A;  5M5W J;  1XTA A;  4I0A A;  2O6G E;  3DXJ F;  1ZGA A;  1ETW A;  1FZP B;  4LG0 B;  2ZJP F;  4OMY A;  1ON2 A;  1SFU A;  2VKV A;  5L3E A;  1TNT A;  2YVH A;  1OCZ H;  5HBU A;  1IN8 A;  1U3E M;  2KHM A;  2XPW A;  2QEN A;  4I01 A;  1JHH A;  1AHD P;  3EUH C;  2V4J C;  2P5K A;  4FIS A;  1UEL B;  4IRH A;  3NAU A;  4A69 C;  3EUP A;  3I9V 2;  1MH3 A;  3K1M A;  3QPT A;  1FYL A;  5GPA A;  1FYM A;  1IXC A;  3A4C A;  2DOA A;  1LE8 B;  1O7F A;  3G3Z A;  2GBY A;  2ZB9 A;  4XOT A;  4A3L J;  4OIQ F;  2UXP A;  5L3D A;  3A0H C;  3VOD A;  2OV7 A;  1S9H A;  1JI8 A;  4HA8 A;  4A93 J;  1SVO A;  4M9S A;  2JA6 J;  1ITY A;  3FHN A;  1U78 A;  1HKT A;  5DS9 A;  5F1J A;  2NVT J;  2KMU A;  3H0G J;  2ZOY A;  1BJA A;  4DW6 A;  5BNG A;  3MZH A;  2VB6 A;  1ZN2 A;  2QBY A;  1T95 A;  2X6W A;  4L9V A;  4IQJ A;  2XAG A;  2VOD A;  3GBG A;  1BC7 C;  3VB2 A;  5FGL A;  3ISP A;  4NNJ A;  1DU0 A;  5K5R A;  5HNF A;  2VJ5 A;  1WVR A;  3OIQ A;  4RB0 A;  1YW8 A;  4R1H A;  1WGX A;  3BG5 A;  5ILS A;  2DA3 A;  3CD6 I;  4HLX A;  5J4Y A;  1XC5 A;  1ODD A;  2CQQ A;  1MJA A;  2QA4 I;  2CV2 A;  1WJD A;  3VYS B;  2XDN A;  5EZH A;  5HLT A;  3QOE A;  5EGO A;  2IBD A;  2QQ9 A;  4F55 A;  4D1Q A;  3OYC A;  3FBI B;  4IHT A;  4CCO A;  3HEF A;  3CDI A;  4MQ9 F;  4DYC A;  4G7O F;  4FE4 A;  1E2X A;  3GME A;  2LF7 A;  3QU6 A;  1KZH A;  2NVY J;  4NN1 A;  4R8H A;  3G7R A;  4I98 B;  4HQM A;  5EYR A;  5LHH A;  4JX4 A;  1XGO A;  4U7B A;  3VTI A;  4NC7 A;  4XQF A;  4ON0 A;  5JI6 A;  5TIS C;  1TW3 A;  2DOE A;  2GQQ A;  2BBY A;  4Q47 A;  2R7T A;  5GAG J;  5J47 A;  2LKP A;  1HBX G;  1LDD A;  4U88 A;  3E6M A;  3I64 A;  3VOX A;  4F52 A;  1Z7U A;  5FKL A;  3B6C A;  1GVD A;  1UI6 A;  1XGN A;  3FMS A;  4BL0 B;  3BR1 A;  2WB1 A;  3B81 A;  2F4O B;  3C2G A;  3OIO A;  3NPI A;  1V5G A;  1FOX A;  2VAS A;  3SFZ A;  2BXZ A;  4G8X A;  2DMT A;  3COA C;  3NS4 A;  2GXG A;  2JTV A;  2XSD C;  3BNI A;  2OTL I;  3C07 A;  5D19 A;  2M45 A;  4KIF A;  2ZNY A;  1FOW A;  1TTY A;  2HOA A;  3R60 A;  3WOD F;  3LWF A;  3MN2 A;  4L5J A;  3VFZ A;  1Z67 A;  1YIJ I;  4IKF A;  1MBK A;  2QBY B;  2ECC A;  2M30 A;  2CQX A;  5IY5 H;  1SAN A;  3PL8 A;  5FLX Z;  3KNW A;  3A1Y A;  5C3E J;  1XSD A;  4QPO A;  5DTD A;  1R9T J;  3PUB A;  3HPH A;  3AQT A;  4HX7 A;  4ITV A;  2X6Y A;  1R58 A;  1I27 A;  4E7Z A;  1R49 A;  4KYW A;  2W48 A;  5TRD A;  9ANT A;  2CQ7 A;  4IOC F;  1KU3 A;  1ORK A;  4KIC A;  2BHY A;  1ZH5 A;  1K78 A;  4LLN A;  3BQZ A;  4DBR A;  5EGO B;  1UHS A;  4CIC A;  3WU0 A;  1OYY A;  2FF4 A;  4YIF A;  3AAF A;  1EA3 A;  2VPR A;  1GXQ A;  1YX3 A;  3DP7 A;  4BJ5 C;  2ZXJ A;  2GIZ A;  4UVA A;  3MEX A;  2MA3 A;  2NRA C;  5JVG F;  4A12 A;  1EF4 A;  4CYC A;  5B66 C;  3C2B A;  4PJN A;  3G56 A;  2HVQ A;  3I59 B;  3MVP A;  1PJR A;  2W57 A;  2WC2 A;  3G1L A;  1H9T A;  3H0D A;  2ZBK A;  2XB5 A;  4BKX A;  1IRF A;  3OOU A;  4BXU A;  4A3K J;  3EYY A;  3IWF A;  2K3F A;  4HV5 A;  4GFB A;  2JRM A;  4L0Y B;  2KKO A;  3F1B A;  3IUV A;  4YEL A;  2FBQ A;  2QSH X;  2FBK A;  2VQL A;  1HKS A;  3MWM A;  4S04 A;  1OLT A;  2EPF A;  3CC7 I;  2EFP A;  3K4N A;  5FLM J;  3DPU A;  3KP7 A;  3LSG A;  2UWM A;  1LFB A;  2DT6 A;  1T08 B;  4MFD A;  4Y3O A;  4PCQ A;  5D5X B;  1XDS A;  3IRQ A;  2W7N A;  4Y52 J;  3EQL F;  2MD5 A;  2IGK A;  2FMY A;  4IHY A;  3VW2 A;  2COM A;  4ENN A;  4HDV A;  5FHP A;  2QTQ A;  2BY2 A;  2DCE A;  2LMD A;  4AD9 A;  2BW3 A;  3FDY A;  5H6Q A;  5HAW A;  4N9I A;  3CTA A;  3HHH A;  4KIB A;  3K2A A;  1FOK A;  5CVU A;  2DA1 A;  1YE9 A;  1I5Z A;  2GFN A;  2GEN A;  4XIC A;  1JE8 A;  4HAM A;  3H3U A;  2LSO A;  3HM5 A;  2DPU A;  2KIQ A;  3FKJ A;  2VJI A;  1A31 A;  2WUI A;  3ON2 A;  3GCM A;  5CVI A;  2M4K A;  1X1A A;  2AQE A;  2IS2 A;  3BJB A;  1TLH B;  2DA5 A;  3K6G A;  4BHC A;  4F92 B;  1S72 I;  3O60 A;  5CVR A;  1E0E A;  1MMD A;  2P0W A;  2HKO A;  3E7L A;  1K78 B;  3PUF A;  2L9R A;  4U0W A;  1KU7 A;  1I1G A;  2AS5 F;  4AWX B;  2R93 J;  3U2R A;  2F48 A;  1T98 A;  1O57 A;  1R22 A;  2MFZ A;  3WTT C;  4CYC B;  2VL8 A;  2CW7 A;  1BW6 A;  3FXL A;  4IEJ A;  2XKO A;  4FT8 A;  4PFO A;  2NAZ A;  5FRN A;  2ZKZ A;  3CQZ J;  3J81 Z;  2RAE A;  1IAW A;  2BVM A;  3KP2 A;  1OR7 C;  4IRI A;  3OYN A;  1Y56 A;  4XBF A;  3S1Q J;  2FOK A;  3K9T A;  5EEA A;  2H1K A;  3CCE I;  1A5J A;  4UHT A;  4MTE A;  4EJU A;  2IU5 A;  5IYD J;  4J00 A;  3GFM A;  1L0O C;  2EIK H;  2QSF X;  3TKY A;  3OS2 A;  3I71 A;  5IT9 K;  1DU6 A;  3I3L A;  2XRN A;  4QPQ A;  3LFK A;  4AYB A;  4HF1 A;  2O7T A;  2QOP A;  3LSR A;  3C1D A;  1BM9 A;  2QWW A;  3BTJ A;  4P55 A;  2V57 A;  4BAY A;  2UV1 A;  1D3Y A;  4U9L A;  2DMU A;  4DYQ A;  1AKH A;  3NI7 A;  5LFA A;  1MH4 A;  2LFB A;  1P4A A;  6PAX A;  1DUX C;  5E17 F;  1UZC A;  4PUS A;  2MGQ A;  1UFM A;  4HST A;  2ZNZ A;  3KZ9 A;  1WFX A;  4BY1 J;  2BW3 B;  1ETK A;  1PVE A;  2IA1 A;  3SHF A;  2RGV A;  3MAJ A;  3RYR A;  2E1N A;  1NK3 P;  2JZY A;  2M5W A;  1F9N A;  1WJA A;  2A6H F;  3BTI A;  3DCF A;  3CCS I;  2HDD A;  4GCL A;  2GM4 A;  2GA2 A;  2M0M A;  3LSM A;  2BZT A;  3JR9 A;  2F5V A;  2IW5 A;  4MEY F;  3JTH A;  2CS3 A;  4E6K G;  1UG0 A;  1IDY A;  2MC4 A;  3BTL A;  4S05 A;  3GFL A;  1YJW I;  1TWA J;  1G8X A;  3B73 A;  3T0Y A;  5FKM A;  2EBI A;  3HTH A;  2DPD A;  1ETY A;  2DN0 A;  3GYH X;  4N4O B;  5DM6 F;  2PLY A;  2OZU A;  3ONQ A;  4EM0 B;  3BR3 A;  1WJE A;  2XUB A;  1LEB A;  1D0Y A;  1UHM A;  3BCG A;  3SDB A;  4ANJ A;  3CO6 C;  1ZGJ A;  5JHF A;  3KYL A;  1ZG3 A;  4YRV A;  3CCV I;  1MNM C;  1YQA A;  4M6V A;  5JLX A;  2DK5 A;  4ZZL A;  2QKM B;  1RUO A;  5J1U A;  3ZP5 A;  3P7N A;  4JBA A;  1LQ1 A;  1MMA A;  5L3B A;  1VQK I;  2JSP A;  2Y2Z A;  2HGC A;  4MIM A;  1MZB A;  5FRO A;  2OF7 A;  2P4W A;  2CQK A;  2Y0S N;  4IHW A;  2L5Q A;  3IKT A;  3F3X A;  3J7Y J;  3VWB A;  5K7F A;  2K85 A;  2CV0 A;  1X2N A;  3IC7 A;  1QU3 A;  2JPB A;  1XD7 A;  1SD4 A;  3LQQ A;  2BOL A;  1WSU A;  3BJA A;  2JMW A;  5FB2 A;  1JTX A;  1IN5 A;  2ME0 A;  2Y48 A;  1TQI A;  3GTG J;  5IOY A;  3JAM K;  1AKH B;  4KN7 X;  1WJC A;  1ZG5 A;  3TW6 A;  2D45 A;  1EJ9 A;  1C0W A;  3B02 A;  4UUV A;  2JA5 J;  2P81 A;  5FFZ A;  3EET A;  1T56 A;  4A0Z A;  3ZGK A;  1OCP A;  4KJZ A;  2L7F P;  3CP8 A;  1XMK A;  2OZ6 A;  3JRA A;  2OAZ A;  2XGX A;  4TV7 A;  4HKU A;  4QSH A;  3L2W A;  3WTV C;  1TWC J;  4A6E A;  2IVM A;  1RPW A;  3SZT A;  3ERM A;  4AC6 A;  3ZR8 X;  3D5S C;  3F22 A;  1I6X A;  2BHZ A;  4M6Y A;  3VPR A;  3OYH A;  3OYB A;  3GTQ J;  1ZYR F;  3U1D A;  3ZMS A;  2FNA A;  4ZJZ A;  3FK7 A;  2QQA A;  2CW0 F;  3KPH A;  4V2G A;  2COB A;  5EEG A;  2FBH A;  1YI2 I;  4OU0 A;  2R0Q C;  1VQ6 I;  3ABM H;  2KZV A;  4A3F J;  4XOP A;  4GDF A;  1GHC A;  3M8E A;  1Y0N A;  1SFO J;  1IF1 A;  1T2K A;  4KIG A;  1G3Y A;  4NHJ A;  1Y8R B;  2CJJ A;  2W53 A;  4FTH A;  2ZFU A;  2L9N A;  2XGD A;  3L7W A;  2HPM A;  1DP7 P;  2DU9 A;  2R7R A;  4E4H A;  3FXQ A;  1XSV A;  2WAE A;  3Q0V A;  1B8I A;  4HSR A;  3M4O J;  3LJL A;  1NG7 A;  1O3T A;  3BZ6 A;  1TP4 A;  2MW8 A;  5FKK A;  4D7N A;  5LHI A;  4CCM A;  2PMU A;  1IV8 A;  1RNL A;  4P9F A;  2CV1 A;  4XSX F;  4RA2 A;  2RDP A;  3HPG A;  1U5T B;  2UXU A;  3CJT B;  3P9K A;  4IJA A;  1X1B A;  4C9Y A;  2K9Q A;  4RB1 A;  1R6R A;  3HOT A;  1I1S A;  2FQ3 A;  2HXO A;  3GEZ A;  3HC7 A;  3L2U A;  3ABU A;  2DT7 B;  3KZZ A;  5K1Y A;  4L9T A;  2HOT A;  3ANP A;  4RGX A;  4HBL A;  3S5R A;  5D8K B;  4XLF A;  5BPI A;  1R1T A;  1X4O A;  4BS9 A;  3L1P A;  3EYI A;  2HTS A;  3TED A;  2VQC A;  2AXL A;  4A3E J;  3SDG A;  2HVS A;  4MHG A;  1HST A;  2EA4 A;  3HIM A;  3ZQL A;  5DEQ A;  4OWR B;  1HOM A;  3H1C A;  4XM3 A;  4UUS A;  4BXF A;  4FET A;  2V26 A;  1JT6 A;  3BCB A;  3EUH A;  3W6J B;  3ZOB A;  1FPQ A;  1XDU A;  4LG3 A;  3ML6 A;  4DIQ A;  3JRH A;  4AC0 A;  3KZY A;  2ETH A;  2LBF A;  4UUT A;  2EZL A;  5EJC A;  5LEK A;  2LH9 A;  4UV9 A;  1LEA A;  4KIT B;  1UB9 A;  4GGG A;  1U2W A;  3S8P A;  3NWS A;  4OD5 A;  1TL8 A;  1IN7 A;  2VC0 A;  3HRS A;  5A2Q Z;  3SZP A;  2K7L A;  3NAR A;  2QUF A;  1Z9C A;  2B3W A;  2E71 A;  1W7P A;  1U6G A;  1YS6 A;  5HLI A;  4BBR J;  2Z16 A;  3KLN A;  3ZN0 A;  1W0T A;  3GZ6 A;  1PDN C;  3HHG A;  4YFN F;  1W5S A;  4XK4 A;  3QPS A;  3PSF A;  1H0M A;  2XAF A;  2R7U A;  1FJL A;  5E1W A;  2Y0S A;  2Z33 A;  4E70 A;  3WE3 A;  5ERI A;  3OS1 A;  1ETQ A;  3I58 A;  1MSF C;  2IPQ X;  5LBQ A;  3BR0 A;  2MLK A;  3TGN A;  4XRS G;  2CW8 A;  3P9I A;  5KHD A;  3NRG A;  4IXA A;  4Q48 A;  5LGN A;  1ZQ3 P;  3HRM A;  4G7Z F;  2X48 A;  4LIT A;  2Y9Z A;  1U8B A;  2XIG A;  4XKC A;  3TOB A;  1HW1 A;  1U5T C;  5HLH A;  1JJ8 C;  1AOY A;  2BE5 F;  1IUF A;  4BQA A;  2IS1 A;  4NEL A;  2JA8 J;  5AQC A;  2XV4 S;  2O9L A;  2WAF A;  4PFP A;  1MMG A;  2K4J A;  3RQ4 A;  2HOS A;  2Z5U A;  3GF2 A;  1HKQ A;  3CJN A;  2VXZ A;  2BYV E;  3GZI A;  1SMY F;  4XLA A;  1NTC A;  3TO7 A;  1VTN C;  2FRH A;  4QIW N;  3H9J A;  4EQQ A;  3CC2 I;  3J7A Y;  2PN6 A;  2O7O A;  1W1W E;  2Q1Z B;  4XLN F;  3KYC B;  2LBF B;  2DTR A;  2FX0 A;  2JQ7 A;  2R7Q A;  3LA7 A;  3EDP A;  3Q0U A;  2EFQ A;  3R4K A;  4X6A J;  2F4I A;  2LG4 A;  1BOA A;  2ADU A;  1B4A A;  3DEW A;  4B44 A;  4CCN A;  5JHU A;  5EDN A;  1UI5 A;  3SXY A;  1LVA A;  1W7P B;  2XHK A;  5LGT A;  4U87 A;  4FE7 A;  5DUI A;  2DJN A;  3ZQI A;  4Q4Z F;  3A0B C;  2YU3 A;  3F6O A;  2HVR A;  3BDD A;  4ESF A;  4C3I J;  3TMO A;  2OQG A;  2DT5 A;  2IGO A;  2B7E A;  4JYK A;  2EFN A;  3H92 A;  2VQG A;  2EZI A;  3U21 A;  5IOZ A;  4I2O A;  2H94 A;  1OCT C;  3RKQ A;  1V5E A;  4BUP A;  2XVC A;  2XF6 A;  4JNN A;  4OOI A;  3OR1 C;  4IHS A;  2H6C A;  3J80 Z;  1OMI A;  4I02 A;  2IXS A;  1RRJ A;  4QTR A;  1V4R A;  2L54 A;  2DA2 A;  1IXR C;  3BG7 A;  2Q2E B;  1IRG A;  1KYW A;  4U0V A;  4E7L A;  1IZ1 A;  4CHU A;  3ON4 A;  1BN5 A;  3EUA A;  4E7K A;  4W97 A;  1A6Q A;  2OA4 A;  3KYD B;  4PSW A;  3J7Z I;  1TW2 A;  4MK6 A;  3BPX A;  3MMY B;  1FBU A;  2A6E F;  4GYI A;  1ULY A;  3D5R C;  2NNY A;  2X1E A;  4OIR F;  4BE2 A;  2YX7 A;  4ENK A;  3WHC A;  3OYK A;  1F4K A;  2IT0 A;  1P92 A;  3IHU A;  2HDC A;  3WG9 A;  1ZLJ A;  2IP2 A;  2HQN A;  3I4M J;  2EV6 A;  5GTI C;  4Y15 A;  2DMN A;  3QWL A;  2Y75 A;  2BEO A;  2G7L A;  3E7Q A;  2CRG A;  2ZCM A;  1DGR M;  3LMM A;  1OYI A;  1IJW C;  3T5X A;  2X4H A;  4BAC A;  3QOD A;  3WTY C;  5KCM A;  4M9X A;  3DF8 A;  1Z7L A;  4E7J A;  2STT A;  1E17 A;  3AG4 H;  1FEX A;  5CVJ A;  3R61 A;  4HNU A;  2VT2 A;  3HKZ N;  3BP8 A;  3VVX A;  2A6T A;  1HDD C;  3CCM I;  2LRE A;  3DKW A;  1A36 A;  3DTI A;  4KA4 A;  1JGG A;  1FTZ A;  4CUG A;  3DTE A;  4AIJ A;  2LKX A;  3K4L A;  4BBS J;  4E7I A;  3BC8 A;  1H8A C;  2AQF A;  2VT3 A;  2AXT C;  5HDK A;  1J0R A;  2JSC A;  4M3B A;  3ECH A;  3HRU A;  4OIP F;  2FQ4 A;  2E7X A;  3FXM A;  1B59 A;  3G2B A;  4CSW A;  1G3W A;  2LLK A;  5C44 J;  4J01 A;  3PAS A;  4IPA A;  4LLG F;  1Z05 A;  3HOU J;  4WXH A;  3HRT A;  2PFB A;  3W3C A;  1W5C C;  4XN3 A;  2M0C A;  1QA6 A;  3HG9 A;  1RES A;  3IAS 2;  3E0J B;  4C2U A;  2ZME B;  2VOO A;  1YO5 C;  2WY8 Q;  3GZ5 A;  3LA2 A;  1UST A;  1JXS A;  3CDH A;  1QVU A;  5K5O A;  4IOA F;  3GXO A;  2QKO A;  2B9S A;  1WKM A;  1ZR2 A;  1OR7 A;  2NVX J;  4IRG A;  3KET A;  3QPH A;  2IGM A;  2ZXH A;  3DBR B;  3PSI A;  4CZC A;  4HDU A;  2L01 A;  4KFC A;  3KZI C;  2IS6 A;  1JTY A;  4GRI A;  4CGZ A;  2DQR A;  2VC1 A;  3I59 A;  2G7G A;  4UY8 I;  4R79 A;  1YW7 A;  4EMS A;  2HYT A;  3OL4 A;  2HKX A;  2L7M P;  2P8T A;  2QKL B;  1D5Y A;  2D2W A;  3ERE D;  3PQK A;  4ICH A;  5F1R A;  1AWC A;  2A69 F;  5GTH C;  2W82 A;  1FSH A;  3DBH B;  5LHG A;  3CCQ I;  5K5Q A;  5D6E A;  3FM3 A;  3S2D J;  3HOW J;  2R7X A;  3GTL J;  4IHX A;  5DD4 A;  2PG4 A;  3QRF F;  1QQI A;  3ANG A;  4A3G J;  3QYF A;  3HGG A;  4CYD A;  1CGP A;  2F5C A;  1STZ A;  5ILU A;  1PYV A;  1LPQ A;  2GXA A;  5M5X J;  4YEJ A;  2LKS A;  3MKL A;  2E1M C;  3DFG A;  1K6Y A;  4WF2 A;  2WTE A;  5FGM A;  2VON A;  1U9N A;  1HSJ A;  3L00 A;  2FD5 A;  3KP3 A;  1QZE A;  3CLQ A;  1R4M B;  2W85 A;  2FU4 A;  3TP0 A;  5F0H A;  5HDG A;  1B9M A;  2RNJ A;  3FXK A;  1X58 A;  3TP3 A;  3F8M A;  2DMQ A;  3VIB A;  3BLY A;  1MBE A;  5HDN A;  3OYM A;  3PO2 J;  1ZAR A;  1XMA A;  1NHA A;  3JTG A;  3AQS A;  3L09 A;  4BY7 J;  2LD5 A;  2FE3 A;  4ABZ A;  3ZQG A;  4LFU A;  2PJR B;  1XCV A;  4E7S A;  3T8T A;  2CYY A;  1Z6R A;  3HIF A;  4P96 A;  1XCB A;  1ZRF A;  5B3S H;  1JUP A;  2X51 A;  3K0L A;  4I76 A;  1BJZ A;  5E8G A;  4D7M A;  2IS4 A;  3VYT B;  1XS9 A;  4H0E A;  3UNG C;  3KFW X;  2OUM A;  5IPA A;  2BY0 A;  4CH7 A;  1MBG A;  4UNO A;  4A3M J;  2EFO A;  2EZK A;  2Y30 A;  1WCM J;  4C2M A;  1P6R A;  2ZME C;  2GOX B;  4O3M A;  4ZYA A;  2A3S A;  3B6A A;  1WH7 A;  2GZW A;  4KT5 C;  1PUE E;  3L2C A;  5J1Y A;  3RQI A;  5JVT A;  2UXH A;  3GWZ A;  3E6D A;  2IEK A;  4L5I A;  4UV8 A;  2KLO A;  3HZJ A;  3K4M A;  4ME9 A;  4HF2 A;  1JUM A;  3FM5 A;  4OMZ A;  3ECO A;  4DVY P;  3RDI A;  2F2E A;  4ACI A;  1I3A A;  3IKV A;  4DGW B;  3FKI J;  2M8E A;  1IRZ A;  2DAO A;  3J81 K;  3I0T A;  3R6S A;  2DFH A;  3HKZ A;  1IN6 A;  3N05 A;  1IUY A;  4M3D A;  1ENH A;  2ZXW H;  2KDO A;  3M8F A;  3VYU B;  5E3N A;  3AL0 C;  4FX4 A;  3PNV A;  2PI0 A;  4C2M J;  2VIX A;  2JVH A;  4U9N A;  2G7S A;  4PSX A;  1UAA A;  3W6V A;  1R1U A;  2JUC A;  1S6L A;  1YJ9 I;  3RPU A;  2WA0 A;  3FBN B;  2MD0 A;  4UB6 C;  1YG2 A;  2M34 A;  3ZQ7 A;  3BHQ A;  2H1L A;  2EFW A;  3DLL F;  3I4N J;  1YX5 A;  3JRD A;  4WXD A;  4BNC A;  4NB5 A;  2JN6 A;  3P5J A;  4B3A A;  2JK3 A;  4BE0 A;  3GTM J;  3R0A A;  3VUQ A;  1ZKG A;  4G6T B;  4ZYD A;  2GXB A;  1AU7 A;  1BOB A;  4ZDL A;  1RR8 C;  2WY7 Q;  2C6Y A;  4Y33 A;  1LFU P;  1BC8 C;  3FXJ A;  3BTC A;  1FLI A;  4CDG A;  1ZHF A;  2H09 A;  3M8J A;  1BL0 A;  5LGU A;  2D6Y A;  2WAQ N;  3C2H A;  5J4V A;  1VQ4 I;  3V8L A;  3F21 A;  3W6K B;  1FBQ A;  2FNP A;  1DQU A;  3P9T A;  2O3F A;  1V5F A;  2TDX A;  3WHB A;  4W1U A;  2QM3 A;  5KAF C;  3CJQ B;  1NK2 P;  3G6E I;  5D5W B;  4ENM A;  2J5O A;  2K3P A;  5D4S A;  4C3J J;  1MJ9 A;  4II2 A;  5GAH J;  2DG7 A;  4AUX A;  3I54 A;  2RC4 A;  1T39 A;  1W4M A;  3REO A;  2EQR A;  1G2H A;  4I99 C;  3RIR A;  3OSG A;  2HI3 A;  4KT6 A;  2HOE A;  3I4P A;  2E19 A;  2XAJ A;  3M3Y J;  4PXI A;  1NG6 A;  2KDZ A;  5HNH A;  1HQC A;  5AON A;  2LC2 A;  3MZY A;  3LAP A;  2XAH A;  2YU9 J;  2JPC A;  5J8F A;  1ACI A;  1LVK A;  2DDA A;  4EGZ A;  2BV6 A;  2DYR H;  4XLH A;  1L3L A;  3RJP A;  2E60 A;  4XLE A;  1XGM A;  2V1N A;  3OR2 C;  3TDZ C;  4MLO A;  1KQ9 A;  4PJ0 C;  3K4C A;  3KKD A;  4MNU A;  3QKX A;  4JL3 A;  2VKD A;  1XG1 A;  5D8L B;  1U9O A;  1TQP A;  3DQV C;  2NS0 A;  1ERD A;  1H88 C;  1SMT A;  1MGT A;  3COL A;  5C4Y A;  2L4A A;  1BR1 A;  3WGH A;  5IYB J;  4OD4 A;  1K4S A;  2HQA A;  1Q1H A;  2V1U A;  3NNR A;  1GXP A;  2W84 A;  4IVN A;  5EF6 A;  1MMS A;  2VI6 A;  2Z2S B;  3KKC A;  3H3V K;  1R5I D;  4BE1 A;  5CVV A;  4J19 A;  5C4X J;  1FC3 A;  2KJB A;  2WBM A;  2HYF A;  2WWY A;  1WJF A;  5H6R A;  5HVQ C;  2Y0M A;  3I53 A;  4ZYG A;  1JJ6 C;  4I09 A;  1WWX A;  1GV2 A;  2N8G A;  3BG9 A;  2VN2 A;  5DCM A;  4LK0 F;  3T6N A;  1G6N A;  1Z6T A;  3G1O A;  5HS7 A;  4AVZ A;  3H5R A;  1D1C A;  3E5X A;  4XN0 A;  1M1E B;  1SFK A;  1CF7 A;  2NOJ B;  2PMH A;  4LD5 A;  3W2V A;  4B1R A;  1HW2 A;  1OIS A;  1YLF A;  2ZCN A;  1QHG A;  2HQ5 A;  5H2F C;  4RB2 C;  2G7U A;  3BZK A;  3CJR B;  3F8B A;  3A03 A;  2DI3 A;  4PZJ A;  4CXF A;  1U5T A;  1BR2 A;  1XGS A;  1Y6I A;  4NC6 A;  3RD3 A;  1HA8 A;  3HJE A;  2P7V B;  5BMZ A;  2FBI A;  4IF4 A;  3ZQQ A;  3TW7 A;  1DP3 A;  4A2U A;  1MNE A;  2JT1 A;  2HS5 A;  4BGD A;  4XR6 A;  2GA1 A;  5GPC A;  1UG2 A;  3E6C C;  3JCU C;  4P1W A;  3HSF A;  3S16 J;  3E5U A;  5D1R A;  2R7V A;  1WPK A;  5IT9 Z;  4FHT A;  1V3F A;  4DNC A;  3ZQF A;  3PFI A;  1SFX A;  3QAH A;  1R4N B;  4DOZ A;  3C7J A;  4L9J A;  3SQN A;  4BDZ A;  2A5Y B;  2XRO A;  1O7L A;  2ZSI B;  2QQB A;  5LEJ A;  5D18 A;  3AFH A;  3FIW A;  2H6B A;  3ABL H;  1QPM A;  4IX7 A;  4ZDO A;  5E79 C;  2LNB A;  4D9J A;  1EH7 A;  4M3F A;  3PIP F;  1ON1 A;  1NH3 A;  4AVP A;  1LDJ A;  3VW1 A;  1FMW A;  1HDP A;  2JUG A;  2A61 A;  1TWG J;  2ID6 A;  2WAQ A;  3DKY A;  1S7A A;  3HUG B;  3A01 B;  2H8R A;  2ISZ A;  4ESJ A;  4NBQ A;  3KEO A;  3NWT A;  2VKE A;  2JRT A;  4K2E A;  4BJT A;  3BPV A;  3HBL A;  1JKQ C;  1YW9 A;  5DCM B;  4LIU A;  5L3C A;  5BQT A;  3GUD A;  4FX0 A;  5C4J J;  1OJL A;  2M2E A;  4UB8 C;  2KPM A;  5LLQ A;  4V19 K;  1IXS B;  4DZP A;  2G9W A;  5E3L A;  1Z91 A;  2HQR A;  4AU7 A;  1CF7 B;  2OI8 A;  4G6D A;  2KRF A;  2VKH A;  1OCC H;  4Y17 A;  2QQ8 A;  2EV5 A;  5TJJ A;  5CJ9 A;  3MKZ A;  1MMN A;  3K70 D;  1F5T A;  3CCY A;  1QZZ A;  3F0C A;  5E3M A;  2F07 A;  1KGS A;  3RSN A;  1T6S A;  1JUS A;  4QLC U;  1R71 A;  3Q3S A;  4XNF A;  3QPL A;  4EAT A;  1F36 A;  3OSF A;  2DMP A;  3I5U A;  2YR2 A;  1SD6 A;  2E7W A;  4H4K C;  3H9Q A;  4AF5 A;  1ZLK A;  3V78 A;  4YZE A;  1QNT A;  4RGR A;  2Y9Y A;  4HZF A;  2XB0 X;  5K7Z A;  2HWV A;  1SD5 A;  1ZK8 A;  2ECB A;  4HG2 A;  3DPT A;  4EEF G;  2PQ8 A;  1YOV B;  3Q9S A;  2FML A;  4M3E A;  2QGU A;  4ETS A;  4KIS A;  1RIO H;  4JOM A;  3OYL A;  1BI2 A;  1DGW Y;  2OBP A;  2VBZ A;  3T8R A;  4XKB A;  3WU1 B;  1RC9 A;  1RKW A;  5LD2 C;  2DXI A;  2X0L A;  3CZ6 A;  2LVS A;  2LR8 A;  4PJM A;  3ROU A;  4LIV A;  5F64 A;  5FD5 A;  3JAM Z;  4F93 B;  5EEH A;  3L9F A;  3QBM A;  3S17 J;  3OYF A;  1ZRE A;  1A35 A;  5FMP A;  4NQW A;  3C3W A;  3SYT A;  1H89 C;  1XMX A;  5E20 A;  1RI7 A;  3WE2 A;  2DK8 A;  2Z1D A;  3ZQH A;  4XRS A;  3LL7 A;  4HPQ A;  3W2W A;  1BI3 A;  3S3O A;  4LMY A;  4MTD A;  5IYC J;  4M74 A;  4UVB A;  5L3G A;  1A6I A;  1X1C A;  5B1B H;  3PPB A;  4F3Q A;  5CPR B;  1D5V A;  4BYY A;  1IC8 A;  3SZG A;  3I56 I;  5J1R A;  1FIP A;  1K83 J;  3S1M J;  2P5V A;  3VSK A;  4WXC A;  2KL4 A;  1D1B A;  2M9H A;  3RPQ A;  1LDK B;  4DBQ A;  4G6Q A;  4B48 A;  4ZYE A;  1MSE C;  2CWE A;  3F8N A;  2RHA A;  3DEE A;  3RKX A;  1J5Y A;  2QYO A;  4OAY A;  3WTW C;  4ZTF A;  1FX7 A;  5E18 F;  2R92 J;  3QYE A;  5D6F A;  1Z3X A;  2BY1 A;  3SEQ A;  3HXL A;  2ZJR F;  2A68 F;  1O4X A;  2LY9 A;  2CFX A;  1YFH A;  3BY6 A;  2ZJ2 A;  1VF9 A;  4GCK A;  1WRJ A;  3M7G A;  2ZCX A;  1Z3Y A;  1TZL A;  2OER A;  5DCF A;  4GFK A;  4X1E A;  3AG2 H;  5GP9 A;  3S32 A;  2CUZ A;  3R0J A;  5IT3 A;  3EUK L;  1SFE A;  2HTJ A;  2Q2E A;  2YUS A;  2RVC A;  3HOV J;  2QIB A;  1KU2 A;  3AG3 H;  1GT0 C;  2P6T A;  2V6E A;  4BHP A;  4XL9 A;  2X1C A;  4C30 A;  5TGT A;  4B3X A;  1K7A A;  2L9S A;  1WHU A;  3A02 A;  4DYR A;  1N78 A;  1G3S A;  4N9H A;  2XGE A;  2QZ8 A;  2L2O A;  1U0J A;  2M8G X;  4AIK A;  2W4S A;  3QOP A;  1IW7 F;  2UXN A;  3FHZ A;  4NQW B;  4XSZ F;  1HLV A;  3PIO F;  2X6O A;  2IGN A;  4BQO A;  4U7D A;  1T0F C;  5F6F A;  1YJN I;  3S93 A;  2ZY9 A;  2R4G A;  4CCK A;  2BXY A;  1FP2 A;  1PP7 U;  1LKX A;  5AIQ A;  4AID A;  3MFK A;  4RLF A;  4RAZ A;  4YII A;  4L18 B;  2R7S A;  4G9Y A;  4D5F A;  3SWH A;  4WIB A;  2STW A;  3BG6 A;  2UXO A;  3CRJ A;  3X2Q H;  3HOY J;  3PM1 A;  1ZGW A;  4RLQ A;  1R36 A;  2UXX A;  1WI9 A;  4WCG A;  3OIP A;  2B1E A;  4MQV A;  3S2H J;  2XRL A;  3TL4 X;  2O0Y A;  2X9D A;  2YVE A;  2WGB A; 
#chains in the Genus database with same CATH homology
 5IYD J;  2LTP A;  5M5X J;  3MKL A;  1DU6 A;  4GFL A;  3NXC A;  1RR7 A;  4M3G A;  1U9N A;  1I3Q J;  2O7T A;  1YRN B;  2QOP A;  3BG3 A;  3LSR A;  2FD5 A;  3BTJ A;  5EFY A;  2V57 A;  2WB1 N;  1VI0 A;  2E1O A;  3TP0 A;  3V6G A;  5F0H A;  1CQT A;  2DMU A;  4JP0 A;  2ME6 A;  4DYQ A;  1AKH A;  3NI7 A;  1MH4 A;  2LFB A;  1X58 A;  3TP3 A;  3HOX J;  2DMQ A;  2MGQ A;  2HYJ A;  3VIB A;  3KZ9 A;  1MBE A;  1JT0 A;  1Y1V J;  4BY1 J;  3PO2 J;  1ETK A;  1VND A;  2TCT A;  2OPT A;  3AQS A;  4BY7 J;  2LD5 A;  4ABZ A;  1NK3 P;  3ZQG A;  5J3L A;  3FIS A;  5IP7 J;  2R5Y B;  3ZQC A;  3BTI A;  4GCL A;  1TWF J;  3DCF A;  2HDD A;  4A3C J;  2PMZ N;  2TRT A;  5EZG A;  1JUP A;  2GM4 A;  2JWT A;  2YS9 A;  1BJZ A;  4I76 A;  4D7M A;  1XS9 A;  3JR9 A;  3CMY A;  5IPA A;  1MBG A;  4A3M J;  2DTZ A;  1SGM A;  3LWJ A;  3GTP J;  1QPI A;  2EZK A;  2Y30 A;  1WCM J;  2AHQ A;  2LK2 A;  4RDU A;  1IDY A;  3BTL A;  3B6A A;  1VFC A;  1WH7 A;  1TWA J;  5J1Y A;  3RQI A;  1FTT A;  2UXH A;  2IEK A;  5FKM A;  2EBI A;  3HTH A;  4ME9 A;  1ETY A;  1ETX A;  1JUM A;  2DN0 A;  3VVY A;  1P7I A;  2UXI A;  4ACI A;  1T33 A;  3BR3 A;  3FKI J;  4L62 A;  2NP5 A;  1IRZ A;  3BCG A;  1Z77 A;  2I10 A;  4MO7 A;  1MNM C;  5JLX A;  4M6V A;  1QRY A;  1ENH A;  4M3D A;  5J1U A;  5E3N A;  1YRN A;  2JJ7 A;  5FKN A;  3S1N J;  2Y2Z A;  4C2M J;  4MIM A;  4BXX J;  4S0H B;  2OF7 A;  2G7S A;  4CGR A;  2DA4 A;  5CXG A;  2Y0S N;  4IHW A;  3W6V A;  2EZH A;  4C3H J;  5K7F A;  1X2N A;  3HB9 A;  4D5C A;  5CW8 A;  2JMW A;  2ELK A;  2M34 A;  3FK6 A;  1B8I B;  3PO3 J;  3BHQ A;  3CDL A;  2AO9 A;  3I4N J;  1JTX A;  3JRD A;  2R5Y A;  2ME0 A;  3GTG J;  1ZTR A;  5IOY A;  1AKH B;  2JN6 A;  4B3A A;  5F27 A;  2JK3 A;  3TW6 A;  3GTM J;  3HTJ A;  4KWA A;  5K58 A;  3VUQ A;  4A3D J;  1ZKG A;  1AU7 A;  2JA5 J;  2P81 A;  1T56 A;  1LFU P;  3CJD A;  3BTC A;  1Y1W J;  3EGQ A;  1OCP A;  5IP6 A;  2O8K A;  2L7F P;  3GTJ J;  2VUM J;  3JRA A;  4HKU A;  1BL0 A;  4QSH A;  2D6Y A;  2WAQ N;  1TWC J;  3LNQ A;  1JKR C;  1IG7 A;  1RPW A;  2PZ9 A;  2D5V A;  1OFC X;  4B4C A;  3P9T A;  1P7J A;  4AC6 A;  3WHB A;  1JKP C;  4W1U A;  1BA5 A;  3VPR A;  1NK2 P;  3BR5 A;  2K9S A;  2XPU A;  3HGY A;  4C3J J;  4UUS B;  3GTQ J;  2DG7 A;  4AUX A;  3K7A J;  3FK7 A;  3VW0 A;  4V2G A;  2IAI A;  1G2H A;  2COB A;  2EQR A;  3VP5 A;  4L5E A;  4Y7N J;  2R0Q C;  3OSG A;  2HI3 A;  5FLV A;  3M3Y J;  4PXI A;  2E19 A;  2KDZ A;  1FIA A;  4V2F A;  3SFI A;  4A3F J;  1E3O C;  1IGN A;  3S15 J;  2QWT A;  1ETO A;  2YU9 J;  1SFO J;  1IV6 A;  2G3B A;  2DG8 A;  2HKU A;  2CJJ A;  2W53 A;  4DZJ A;  2REK A;  4FTH A;  2G0E A;  1Q1V A;  2XGD A;  1HF0 A;  2E2J J;  4MLO A;  1RET A;  1B8I A;  3Q0V A;  2MSY A;  1LE8 A;  3M4O J;  3KKD A;  3LJL A;  3QKX A;  3VVZ A;  5FKK A;  2MW8 A;  4JL3 A;  4D7N A;  1XG1 A;  5K7H A;  3JRC A;  3RZO J;  1HCR A;  1U9O A;  1BW5 A;  2CUF A;  2UXU A;  1F43 A;  1H88 C;  3BRU A;  2GUH A;  3COL A;  3HTI A;  5C4Y A;  2K9Q A;  2GLO A;  3BT9 A;  5IYB J;  3S1R J;  3HOZ J;  5DAJ A;  2CUE A;  2HXO A;  4AYB N;  4HNV A;  3O8H A;  3ANP A;  2HOT A;  3LSJ A;  3NNR A;  3S5R A;  1MBJ A;  2HXI A;  1UMQ A;  5EF6 A;  3L1P A;  2VI6 A;  3IH3 A;  3KKC A;  3QQA A;  3H3V K;  3TED A;  4A3E J;  2ZOZ A;  3SDG A;  1RKT A;  2QCO A;  4J19 A;  5C4X J;  2E2I J;  3HIM A;  3ZQL A;  1HOM A;  3GEU A;  1MBH A;  5FKO A;  1GV5 A;  3CWR A;  4UUS A;  4RBO A;  1JJ6 C;  1JT6 A;  1GV2 A;  5F08 A;  2N8G A;  2NS8 A;  3BG9 A;  4A3B J;  3ZOB A;  1ZR4 A;  2L0K A;  3HE0 A;  4JX5 A;  3T6N A;  4A3I J;  1APL C;  1B72 A;  3G1O A;  3JRH A;  5E3O A;  4AC0 A;  5JLW A;  3D1N I;  2RAS A;  4MXM A;  2CU7 A;  1ETV A;  4UUT A;  2EZL A;  4B1R A;  5M5W J;  1ETW A;  2ZCN A;  2B63 J;  2HQ5 A;  3NAR A;  2VKV A;  2YVH A;  4BBR J;  5HBU A;  3A03 A;  1W0T A;  2XPW A;  1AHD P;  4XK4 A;  3RD3 A;  3QPS A;  4FIS A;  3NAU A;  3TW7 A;  4A69 C;  1FJL A;  3EUP A;  1MH3 A;  2NX4 A;  5GPA A;  5GPC A;  3HTA A;  1UG2 A;  1LE8 B;  3S16 J;  2GBY A;  2ZB9 A;  5D1R A;  3DPJ A;  4A3L J;  1WPK A;  2UXP A;  3ZQF A;  1ETQ A;  1MSF C;  4A93 J;  5M3F J;  2JA6 J;  1ITY A;  5EG0 A;  1U78 A;  3BR0 A;  5DS9 A;  5F1J A;  2NVT J;  3H0G J;  4XRS G;  2ZOY A;  4DW6 A;  3Q0W A;  5BNG A;  2XGC A;  3NRG A;  5D18 A;  3LSP A;  3FIW A;  3FRQ A;  3GBG A;  1ZQ3 P;  2R5Z A;  5FGL A;  4FCY A;  3LHQ A;  1DU0 A;  1U8B A;  2X48 A;  3BR2 A;  2Y9Z A;  2E2H J;  4M3F A;  1WGX A;  3BG5 A;  1JJ8 C;  1JKO C;  2DA3 A;  3VW1 A;  1HDP A;  1IUF A;  2DA6 A;  1XC5 A;  4NEL A;  1TWG J;  2CQQ A;  2ID6 A;  2JA7 J;  2JA8 J;  5AQC A;  2XDN A;  2NVQ J;  5EZH A;  3UKG A;  5EGO A;  2IBD A;  3A01 B;  2H8R A;  2O9L A;  3HEF A;  2VKE A;  4DYC A;  2HOS A;  4FE4 A;  2NVY J;  4NN1 A;  3HBL A;  3GZI A;  1JKQ C;  3G7R A;  5EYR A;  1NTC A;  2EH3 A;  4JX4 A;  1B72 B;  3RH2 A;  1WI3 A;  5C4J J;  4QIW N;  1OJL A;  2ID3 A;  2KT0 A;  2M2E A;  4DZP A;  1S7E A;  2O7O A;  5E3L A;  2FX0 A;  1X2M A;  3Q0U A;  2NOG A;  2OI8 A;  4X6A J;  3IV5 A;  3DEW A;  3VOX A;  4GCT A;  5EDN A;  1UI5 A;  5M5Y J;  5FKL A;  2PBX A;  3B6C A;  3CCY A;  1GVD A;  1UI6 A;  3F0C A;  2WV1 A;  5E3M A;  2F07 A;  4FE7 A;  1JUS A;  2DJN A;  3Q3S A;  3ZQI A;  3BR1 A;  3QPL A;  1F36 A;  3OSF A;  2DMP A;  3B81 A;  4IHV A;  2K9N A;  3OIO A;  3NPI A;  5H9T A;  4C3I J;  2MG4 A;  4AF5 A;  1I50 J;  4XRM A;  3V78 A;  4JYK A;  4YZE A;  2DMT A;  2Y9Y A;  2XB0 X;  5K7Z A;  2EZI A;  5IOZ A;  2ECB A;  1ZK8 A;  1OCT C;  2XSD C;  2K40 A;  4NDL A;  4EEF G;  4M3E A;  3RKQ A;  3BNI A;  3C07 A;  5D19 A;  2HOA A;  4JNN A;  3JRG A;  5EG0 B;  4JKZ A;  5F04 A;  1Z0X A;  3MN2 A;  4QTR A;  1RKW A;  1MBK A;  2ECC A;  4G12 A;  2CQX A;  2LR8 A;  2LVS A;  3VOK A;  3A01 A;  3JRE A;  1SAN A;  2DA2 A;  2R5Z B;  3KNW A;  4LOC A;  3QBM A;  5C3E J;  5DTD A;  1R9T J;  3ON4 A;  3IH4 A;  3S17 J;  3AQT A;  3JRB A;  4W97 A;  5FMP A;  5HOD A;  4MK6 A;  1H89 C;  2W48 A;  9ANT A;  1QVT A;  3ZQH A;  4XRS A;  1ORK A;  3O8G A;  3BQZ A;  3WHC A;  5EGO B;  1I6H J;  1UHS A;  5CXI A;  1TWH J;  5IYC J;  1W0U A;  1A6I A;  2VPR A;  3PPB A;  3I4M J;  3HDD A;  1IC8 A;  4UDS A;  2DMN A;  5J1R A;  1EF4 A;  4CYC A;  1FIP A;  2G7L A;  3C2B A;  3JRF A;  2CRG A;  2ZCM A;  3E7Q A;  3G56 A;  1K83 J;  2LP0 A;  3MVP A;  3S1M J;  3G1L A;  1IDZ A;  1PUF A;  4XID A;  2FJ1 A;  2XB5 A;  3LOC A;  4BKX A;  1IJW C;  2Y31 A;  3OOU A;  2M9H A;  4A3K J;  3MNL A;  1FEX A;  4GFB A;  1MSE C;  3F1B A;  3HKZ N;  3IUV A;  2RHA A;  2FBQ A;  3VVX A;  2DA7 A;  1HDD C;  2R92 J;  1JGG A;  1FTZ A;  2Q24 A;  5FLM J;  2LKX A;  1O4X A;  2LY9 A;  4BBS J;  3LSG A;  3SJM A;  1LFB A;  4MFD A;  1H8A C;  1GDT A;  4Y52 J;  1VF9 A;  4GCK A;  2ZCX A;  3GTO J;  4M3B A;  4IHY A;  3RZD J;  2FQ4 A;  2OER A;  3VW2 A;  4GFK A;  4X1E A;  5HSZ A;  5GP9 A;  2NS7 A;  2LLK A;  5C44 J;  2QTQ A;  3PAS A;  5FHP A;  2YUS A;  3HOU J;  3HOV J;  2QIB A;  5IP9 J;  2M0C A;  5HAW A;  5M3M J;  1GT0 C;  1RES A;  5F0C A;  4A3J J;  4MFE A;  3K2A A;  2DA1 A;  1TC3 C;  1QVU A;  2GFN A;  4DYR A;  1GUU A;  3A02 A;  4XIC A;  2QF7 A;  3JRI A;  2GEN A;  2QKO A;  3HM5 A;  2XGE A;  1ZR2 A;  2M8G X;  2WUI A;  3ON2 A;  2NVX J;  2L7Z A;  3IH2 A;  3BJB A;  1HLV A;  1JTY A;  2DA5 A;  2X6O A;  4JX6 A;  3O60 A;  2G7G A;  3E7L A;  2HYT A;  5FJ8 J;  2L7M P;  2L9R A;  3JSJ A;  5F0F A;  1D5Y A;  4I6Z A;  2R93 J;  4ICH A;  4D5F A;  3G1M A;  2UXO A;  3CRJ A;  4CYC B;  3BR6 A;  3HOY J;  3PM1 A;  1BW6 A;  2XPV A;  4IEJ A;  3GTK J;  3CQZ J;  1ZGW A;  1PUF B;  2RAE A;  1POG A;  3S2D J;  3HOW J;  1WH5 A;  3GTL J;  3S2H J;  2XRL A;  2X9D A;  4IHX A;  3S1Q J;  3S14 J;  5EEA A;  2NP3 A;  2H1K A;  2YVE A;  3ANG A;  3BQY A;  4A3G J;  2WGB A;  1A5J A;  3HGG A;  1K61 A;  1MBF A;  2IU5 A;  2R7Z J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...