3LWJA

Crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
193
structure length
193
Chain Sequence
b'QNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNETLSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Transcription regulator
total genus 77
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3lwjA00
3BTIA 3RD3A 2X6OA 2QKOA 2DTZA 2WV1A 3Q3SA 3BR5A 3PPBA 3COLA 2OERA 4MO7A 4UDSA 3TP3A 4GCKA 4I6ZA 4D7MA 3BT9A 5FGLA 2VPRA 3QBMA 5K7FA 3KZ9A 2GUHA 5FKNA 2QIBA 4MK6A 3G1MA 3PASA 3ON2A 3O8GA 3BJBA 2FX0A 5DAJA 3ZQFA 3EUPA 2WUIA 2VKEA 3O60A 3BR3A 2DG8A 5F04A 5GPCA 3HE0A 3CRJA 2PZ9A 3T6NA 4CGRA 2HYTA 5AQCA 2YVHA 3KNWA 4HKUA 2IBDA 5EZHA 5GP9A 4XK4A 5FMPA 3WHBA 3BCGA 3C07A 3GZIA 1A6IA 4D7NA 3WHCA 3HGGA 5EZGA 1BJZA 2ZCNA 4X1EA 1T56A 2FD5A 3KKCA 2XRLA 2XPUA 4MXMA 4L62A 5EFYA 3VW0A 5FKOA 3FIWA 4G12A 2G3BA 2UXUA 3P9TA 1JUSA 3DCFA 3LSJA 3BQYA 3IH2A 3VOKA 4AC0A 3O8HA 2UXPA 2XPVA 4ABZA 2G0EA 2HXOA 4AUXA 3QPLA 3B81A 3JSJA 1U9OA 3ZQHA 2VKVA 3AQTA 3VUQA 3HTAA 2HKUA 2OI8A 3BR1A 4AF5A 3Q0VA 4JL3A 2Y2ZA 1RKTA 2G7SA 3G56A 5J1YA 4JKZA 3F0CA 4W1UA 5CXGA 3F1BA 2XGDA 3C2BA 1JTYA 2X9DA 5HBUA 2JJ7A 3BTLA 3NXCA 3S5RA 2Y31A 5J1UA 2XDNA 5F0FA 4KWAA 1ZK8A 3G1OA 3MNLA 3Q0WA 4D5CA 2Q24A 5K7ZA 2HXIA 4ICHA 3VPRA 2GENA 3VW1A 2QCOA 2ZB9A 2ZCXA 5IOYA 2NS8A 3FK7A 3VW2A 3BTJA 2QTQA 2XGCA 5F08A 5EYRA 5C4YA 2WGBA 4GFKA 2REKA 4M3DA 3DPJA 3TP0A 3EGQA 2F07A 4PXIA 2IAIA 3CJDA 1RPWA 3Q0UA 3VIBA 4B1RA 2GBYA 2W53A 2FQ4A 3IH4A 2QOPA 3NNRA 5K7HA 3BR6A 2NS7A 3E7QA 3NI7A 1JT0A 1JT6A 2PBXA 3KKDA 2NP3A 2UXIA 3HTIA 5J3LA 1JUMA 2ID3A 3BNIA 2YVEA 4W97A 3AQSA 5K58A 5F0HA 3G1LA 3ON4A 2G7GA 2OF7A 3VP5A 4YZEA 5FKKA 3LHQA 3DEWA 1JTXA 3QQAA 1QVUA 2XPWA 3VVYA 3RH2A 5D19A 4ACIA 3VOXA 2NP5A 1UI6A 5GPAA 4M3FA 3PM1A 3CWRA 2QWTA 5CW8A 2TRTA 3ZQGA 3HGYA 3V78A 2FBQA 3NRGA 2RHAA 3ZQIA 3G7RA 5D18A 3BR2A 3IUVA 2TCTA 2RAEA 2XGEA 5F27A 5CXIA 4M3BA 3FK6A 2FJ1A 2ZOZA 3LSPA 3LJLA 4JNNA 2GFNA 3B6AA 3HIMA 5IP6A 3FRQA 3SFIA 2IU5A 5F0CA 3BTCA 3B6CA 4GCLA 2HYJA 2ZOYA 4GFLA 2XB5A 5FKLA 2RASA 5F1JA 2G7LA 3ZQLA 3MVPA 1Z0XA 2ZCMA 3ANPA 4V2FA 2D6YA 4NN1A 3LSRA 4AC6A 5J1RA 3NPIA 1Z77A 3GEUA 3ANGA 2Y30A 5HSZA 5IOZA 5HAWA 2IEKA 2HQ5A 2UXHA 5IPAA 2UXOA 2EH3A 1SGMA 4DW6A 1UI5A 5FKMA 3VVXA 2O7OA 1ZKGA 1ORKA 3QPSA 2DG7A 3V6GA 2V57A 2O7TA 4GCTA 2NX4A 4I76A 3SDGA 3VVZA 3CCYA 3CDLA 4M3EA 3QKXA 2JK3A 3BHQA 4M3GA 1RKWA 5FHPA 3IH3A 3BR0A 1U9NA 5H9TA 3LWJA 2OPTA 3BRUA 3HTJA 1QPIA 1QVTA 5D1RA 4JYKA 3HTHA 4D5FA 1JUPA 4B3AA 3LOCA 4NELA 2ID6A 4ME9A 1T33A 3BQZA 1VI0A 4V2GA 2I10A
chains in the Genus database with same CATH superfamily
3BTIA 3RD3A 2X6OA 2QKOA 2DTZA 2WV1A 3Q3SA 3BR5A 3PPBA 3COLA 2OERA 4MO7A 4UDSA 3TP3A 4GCKA 2R7XA 4I6ZA 4D7MA 3BT9A 5FGLA 2VPRA 3QBMA 5K7FA 3KZ9A 2GUHA 5FKNA 2QIBA 2ZY9A 4MK6A 3G1MA 3VTIA 3PASA 3ON2A 3O8GA 3BJBA 2FX0A 5DAJA 3ZQFA 3EUPA 2WUIA 2VKEA 3O60A 3BR3A 4U9NA 2DG8A 4WIBA 5F04A 5GPCA 3HE0A 3CRJA 2PZ9A 3T6NA 4CGRA 2HYTA 3FHNA 2R7SA 5AQCA 2YVHA 3KNWA 4HKUA 2IBDA 5EZHA 5GP9A 4XK4A 5FMPA 3WHBA 3BCGA 3C07A 3GZIA 1A6IA 4D7NA 3WHCA 3HGGA 3DU6A 5EZGA 1BJZA 2ZCNA 4X1EA 1T56A 2FD5A 3KKCA 2XRLA 2XPUA 4MXMA 4L62A 5EFYA 3VW0A 3SWHA 2B3WA 5FKOA 3FIWA 4G12A 2G3BA 2UXUA 3P9TA 1JUSA 3DCFA 3LSJA 3K8PC 3BQYA 3IH2A 3VOKA 4AC0A 3O8HA 2UXPA 2XPVA 4ABZA 2G0EA 2HXOA 4AUXA 3QPLA 3B81A 3JSJA 1U9OA 3ZQHA 2VKVA 3AQTA 3DU5A 3VUQA 3HTAA 2HKUA 2OI8A 3BR1A 4AF5A 3Q0VA 4JL3A 2Y2ZA 1RKTA 2G7SA 3G56A 5J1YA 4JKZA 3F0CA 4W1UA 5CXGA 3F1BA 2XGDA 3C2BA 2R7OA 1JTYA 2X9DA 5HBUA 2JJ7A 3BTLA 3NXCA 3S5RA 2Y31A 5J1UA 2XDNA 5F0FA 4KWAA 1ZK8A 3G1OA 3MNLA 3Q0WA 4D5CA 2R7RA 2Q24A 5K7ZA 2HXIA 4ICHA 3VPRA 2GENA 3VW1A 2QCOA 2ZB9A 2ZCXA 5IOYA 2NS8A 3FK7A 3VW2A 3BTJA 2QTQA 2XGCA 5F08A 5EYRA 5C4YA 2WGBA 4U9LA 2A2FX 2FJI1 4GFKA 2REKA 4M3DA 3DPJA 3TP0A 3EGQA 2F07A 4PXIA 2IAIA 3CJDA 1RPWA 3Q0UA 3VIBA 4B1RA 2GBYA 2W53A 2FQ4A 3IH4A 2QOPA 3NNRA 5K7HA 3BR6A 2NS7A 3E7QA 3NI7A 2R7TA 1JT0A 1JT6A 2PBXA 3KKDA 2R7UA 2R7WA 2NP3A 2UXIA 3HTIA 5J3LA 1JUMA 2ID3A 3BNIA 2YVEA 4W97A 3AQSA 5K58A 5F0HA 3G1LA 3ON4A 2G7GA 2OF7A 3VP5A 4YZEA 5FKKA 3LHQA 3DEWA 1JTXA 3QQAA 1QVUA 2XPWA 3VVYA 3RH2A 5D19A 2R7VA 4ACIA 3VOXA 2NP5A 1UI6A 5GPAA 4M3FA 3PM1A 3CWRA 2QWTA 5CW8A 2TRTA 3ZQGA 3HGYA 4IRVA 3V78A 2FBQA 3NRGA 2RHAA 3ZQIA 3G7RA 5D18A 4OD5A 3BR2A 3IUVA 2TCTA 2RAEA 2XGEA 5F27A 5CXIA 4M3BA 3FK6A 2FJ1A 2ZOZA 2R7QA 3LSPA 3NS4A 3LJLA 4JNNA 2GFNA 3B6AA 3HIMA 5IP6A 3FRQA 3SFIA 2PFVA 2IU5A 5F0CA 2YVXA 3BTCA 3B6CA 4GCLA 2HYJA 2ZOYA 4OD4A 4GFLA 2XB5A 5FKLA 2RASA 5F1JA 4C2MA 2G7LA 3ZQLA 3KYLA 3MVPA 1Z0XA 2ZCMA 3ANPA 4V2FA 2D6YA 4NN1A 3LSRA 4AC6A 5J1RA 3NPIA 1Z77A 3GEUA 3ANGA 2Y30A 5HSZA 5IOZA 5HAWA 2IEKA 2HQ5A 2UXHA 5IPAA 2UXOA 2EH3A 1SGMA 4DW6A 1UI5A 5FKMA 3VVXA 2O7OA 1ZKGA 1ORKA 3QPSA 2DG7A 3V6GA 2V57A 2O7TA 4DVYP 4GCTA 2NX4A 4I76A 3SDGA 3VVZA 3CCYA 3CDLA 4M3EA 3QKXA 5CQGA 2JK3A 3BHQA 4M3GA 1RKWA 5FHPA 3IH3A 3BR0A 1U9NA 2B1EA 5H9TA 3LWJA 2OPTA 3BRUA 3HTJA 1QPIA 1QVTA 5D1RA 4JYKA 3HTHA 4D5FA 1JUPA 4B3AA 3LOCA 4NELA 2ID6A 4ME9A 1T33A 3BQZA 1VI0A 4V2GA 2I10A
chains in the Genus database with same CATH topology
3BTIA 3RD3A 2X6OA 2QKOA 2DTZA 2WV1A 3Q3SA 3BR5A 3PPBA 3COLA 2OERA 4MO7A 4UDSA 3TP3A 4GCKA 4I6ZA 4D7MA 3BT9A 5FGLA 2VPRA 3QBMA 5K7FA 3KZ9A 2GUHA 5FKNA 2QIBA 4MK6A 3G1MA 3PASA 3ON2A 3O8GA 3BJBA 2FX0A 5DAJA 3ZQFA 3EUPA 2WUIA 2VKEA 3O60A 3BR3A 2DG8A 5F04A 5GPCA 3HE0A 3CRJA 2PZ9A 3T6NA 4CGRA 2HYTA 5AQCA 2YVHA 3KNWA 4HKUA 2IBDA 5EZHA 5GP9A 4XK4A 5FMPA 3WHBA 3BCGA 3C07A 3GZIA 1A6IA 4D7NA 3WHCA 3HGGA 5EZGA 1BJZA 2ZCNA 4X1EA 1T56A 2FD5A 3KKCA 2XRLA 2XPUA 4MXMA 4L62A 5EFYA 3VW0A 5FKOA 3FIWA 4G12A 2G3BA 2UXUA 3P9TA 1JUSA 3DCFA 3LSJA 3BQYA 3IH2A 3VOKA 4AC0A 3O8HA 2UXPA 2XPVA 4ABZA 2G0EA 2HXOA 4AUXA 3QPLA 3B81A 3JSJA 1U9OA 3ZQHA 2VKVA 3AQTA 3VUQA 3HTAA 2HKUA 2OI8A 3BR1A 4AF5A 3Q0VA 4JL3A 2Y2ZA 1RKTA 2G7SA 3G56A 5J1YA 4JKZA 3F0CA 4W1UA 5CXGA 3F1BA 2XGDA 3C2BA 1JTYA 2X9DA 5HBUA 2JJ7A 3BTLA 3NXCA 3S5RA 2Y31A 5J1UA 2XDNA 5F0FA 4KWAA 1ZK8A 3G1OA 3MNLA 3Q0WA 4D5CA 2Q24A 5K7ZA 2HXIA 4ICHA 3VPRA 2GENA 3VW1A 2QCOA 2ZB9A 2ZCXA 5IOYA 2NS8A 3FK7A 3VW2A 3BTJA 2QTQA 2XGCA 5F08A 5EYRA 5C4YA 2WGBA 4GFKA 2REKA 4M3DA 3DPJA 3TP0A 3EGQA 2F07A 4PXIA 2IAIA 3CJDA 1RPWA 3Q0UA 3VIBA 4B1RA 2GBYA 2W53A 2FQ4A 3IH4A 2QOPA 3NNRA 5K7HA 3BR6A 2NS7A 3E7QA 3NI7A 1JT0A 1JT6A 2PBXA 3KKDA 2NP3A 2UXIA 3HTIA 5J3LA 1JUMA 2ID3A 3BNIA 2YVEA 4W97A 3AQSA 5K58A 5F0HA 3G1LA 3ON4A 2G7GA 2OF7A 3VP5A 4YZEA 5FKKA 3LHQA 3DEWA 1JTXA 3QQAA 1QVUA 2XPWA 3VVYA 3RH2A 5D19A 4ACIA 3VOXA 2NP5A 1UI6A 5GPAA 4M3FA 3PM1A 3CWRA 2QWTA 5CW8A 2TRTA 3ZQGA 3HGYA 3V78A 2FBQA 3NRGA 2RHAA 3ZQIA 3G7RA 5D18A 3BR2A 3IUVA 2TCTA 2RAEA 2XGEA 5F27A 5CXIA 4M3BA 3FK6A 2FJ1A 2ZOZA 3LSPA 3LJLA 4JNNA 2GFNA 3B6AA 3HIMA 5IP6A 3FRQA 3SFIA 2IU5A 5F0CA 3BTCA 3B6CA 4GCLA 2HYJA 2ZOYA 4GFLA 2XB5A 5FKLA 2RASA 5F1JA 2G7LA 3ZQLA 3MVPA 1Z0XA 2ZCMA 3ANPA 4V2FA 2D6YA 4NN1A 3LSRA 4AC6A 5J1RA 3NPIA 1Z77A 3GEUA 3ANGA 2Y30A 5HSZA 5IOZA 5HAWA 2IEKA 2HQ5A 2UXHA 5IPAA 2UXOA 2EH3A 1SGMA 4DW6A 1UI5A 5FKMA 3VVXA 2O7OA 1ZKGA 1ORKA 3QPSA 2DG7A 3V6GA 2V57A 2O7TA 4GCTA 2NX4A 4I76A 3SDGA 3VVZA 3CCYA 3CDLA 4M3EA 3QKXA 2JK3A 3BHQA 4M3GA 1RKWA 5FHPA 3IH3A 3BR0A 1U9NA 5H9TA 3LWJA 2OPTA 3BRUA 3HTJA 1QPIA 1QVTA 5D1RA 4JYKA 3HTHA 4D5FA 1JUPA 4B3AA 3LOCA 4NELA 2ID6A 4ME9A 1T33A 3BQZA 1VI0A 4V2GA 2I10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTI A;  3RD3 A;  2X6O A;  2QKO A;  2DTZ A;  2WV1 A;  3Q3S A;  3BR5 A;  3PPB A;  3COL A;  2OER A;  4MO7 A;  4UDS A;  3TP3 A;  4GCK A;  4I6Z A;  4D7M A;  3BT9 A;  5FGL A;  2VPR A;  3QBM A;  5K7F A;  3KZ9 A;  2GUH A;  5FKN A;  2QIB A;  4MK6 A;  3G1M A;  3PAS A;  3ON2 A;  3O8G A;  3BJB A;  2FX0 A;  5DAJ A;  3ZQF A;  3EUP A;  2WUI A;  2VKE A;  3O60 A;  3BR3 A;  2DG8 A;  5F04 A;  5GPC A;  3HE0 A;  3CRJ A;  2PZ9 A;  3T6N A;  4CGR A;  2HYT A;  5AQC A;  2YVH A;  3KNW A;  4HKU A;  2IBD A;  5EZH A;  5GP9 A;  4XK4 A;  5FMP A;  3WHB A;  3BCG A;  3C07 A;  3GZI A;  1A6I A;  4D7N A;  3WHC A;  3HGG A;  5EZG A;  1BJZ A;  2ZCN A;  4X1E A;  1T56 A;  2FD5 A;  3KKC A;  2XRL A;  2XPU A;  4MXM A;  4L62 A;  5EFY A;  3VW0 A;  5FKO A;  3FIW A;  4G12 A;  2G3B A;  2UXU A;  3P9T A;  1JUS A;  3DCF A;  3LSJ A;  3BQY A;  3IH2 A;  3VOK A;  4AC0 A;  3O8H A;  2UXP A;  2XPV A;  4ABZ A;  2G0E A;  2HXO A;  4AUX A;  3QPL A;  3B81 A;  3JSJ A;  1U9O A;  3ZQH A;  2VKV A;  3AQT A;  3VUQ A;  3HTA A;  2HKU A;  2OI8 A;  3BR1 A;  4AF5 A;  3Q0V A;  4JL3 A;  2Y2Z A;  1RKT A;  2G7S A;  3G56 A;  5J1Y A;  4JKZ A;  3F0C A;  4W1U A;  5CXG A;  3F1B A;  2XGD A;  3C2B A;  1JTY A;  2X9D A;  5HBU A;  2JJ7 A;  3BTL A;  3NXC A;  3S5R A;  2Y31 A;  5J1U A;  2XDN A;  5F0F A;  4KWA A;  1ZK8 A;  3G1O A;  3MNL A;  3Q0W A;  4D5C A;  2Q24 A;  5K7Z A;  2HXI A;  4ICH A;  3VPR A;  2GEN A;  3VW1 A;  2QCO A;  2ZB9 A;  2ZCX A;  5IOY A;  2NS8 A;  3FK7 A;  3VW2 A;  3BTJ A;  2QTQ A;  2XGC A;  5F08 A;  5EYR A;  5C4Y A;  2WGB A;  4GFK A;  2REK A;  4M3D A;  3DPJ A;  3TP0 A;  3EGQ A;  2F07 A;  4PXI A;  2IAI A;  3CJD A;  1RPW A;  3Q0U A;  3VIB A;  4B1R A;  2GBY A;  2W53 A;  2FQ4 A;  3IH4 A;  2QOP A;  3NNR A;  5K7H A;  3BR6 A;  2NS7 A;  3E7Q A;  3NI7 A;  1JT0 A;  1JT6 A;  2PBX A;  3KKD A;  2NP3 A;  2UXI A;  3HTI A;  5J3L A;  1JUM A;  2ID3 A;  3BNI A;  2YVE A;  4W97 A;  3AQS A;  5K58 A;  5F0H A;  3G1L A;  3ON4 A;  2G7G A;  2OF7 A;  3VP5 A;  4YZE A;  5FKK A;  3LHQ A;  3DEW A;  1JTX A;  3QQA A;  1QVU A;  2XPW A;  3VVY A;  3RH2 A;  5D19 A;  4ACI A;  3VOX A;  2NP5 A;  1UI6 A;  5GPA A;  4M3F A;  3PM1 A;  3CWR A;  2QWT A;  5CW8 A;  2TRT A;  3ZQG A;  3HGY A;  3V78 A;  2FBQ A;  3NRG A;  2RHA A;  3ZQI A;  3G7R A;  5D18 A;  3BR2 A;  3IUV A;  2TCT A;  2RAE A;  2XGE A;  5F27 A;  5CXI A;  4M3B A;  3FK6 A;  2FJ1 A;  2ZOZ A;  3LSP A;  3LJL A;  4JNN A;  2GFN A;  3B6A A;  3HIM A;  5IP6 A;  3FRQ A;  3SFI A;  2IU5 A;  5F0C A;  3BTC A;  3B6C A;  4GCL A;  2HYJ A;  2ZOY A;  4GFL A;  2XB5 A;  5FKL A;  2RAS A;  5F1J A;  2G7L A;  3ZQL A;  3MVP A;  1Z0X A;  2ZCM A;  3ANP A;  4V2F A;  2D6Y A;  4NN1 A;  3LSR A;  4AC6 A;  5J1R A;  3NPI A;  1Z77 A;  3GEU A;  3ANG A;  2Y30 A;  5HSZ A;  5IOZ A;  5HAW A;  2IEK A;  2HQ5 A;  2UXH A;  5IPA A;  2UXO A;  2EH3 A;  1SGM A;  4DW6 A;  1UI5 A;  5FKM A;  3VVX A;  2O7O A;  1ZKG A;  1ORK A;  3QPS A;  2DG7 A;  3V6G A;  2V57 A;  2O7T A;  4GCT A;  2NX4 A;  4I76 A;  3SDG A;  3VVZ A;  3CCY A;  3CDL A;  4M3E A;  3QKX A;  2JK3 A;  3BHQ A;  4M3G A;  1RKW A;  5FHP A;  3IH3 A;  3BR0 A;  1U9N A;  5H9T A;  3LWJ A;  2OPT A;  3BRU A;  3HTJ A;  1QPI A;  1QVT A;  5D1R A;  4JYK A;  3HTH A;  4D5F A;  1JUP A;  4B3A A;  3LOC A;  4NEL A;  2ID6 A;  4ME9 A;  1T33 A;  3BQZ A;  1VI0 A;  4V2G A;  2I10 A; 
#chains in the Genus database with same CATH topology
 3BTI A;  3RD3 A;  2X6O A;  2QKO A;  2DTZ A;  2WV1 A;  3Q3S A;  3BR5 A;  3PPB A;  3COL A;  2OER A;  4MO7 A;  4UDS A;  3TP3 A;  4GCK A;  2R7X A;  4I6Z A;  4D7M A;  3BT9 A;  5FGL A;  2VPR A;  3QBM A;  5K7F A;  3KZ9 A;  2GUH A;  5FKN A;  2QIB A;  2ZY9 A;  4MK6 A;  3G1M A;  3VTI A;  3PAS A;  3ON2 A;  3O8G A;  3BJB A;  2FX0 A;  5DAJ A;  3ZQF A;  3EUP A;  2WUI A;  2VKE A;  3O60 A;  3BR3 A;  4U9N A;  2DG8 A;  4WIB A;  5F04 A;  5GPC A;  3HE0 A;  3CRJ A;  2PZ9 A;  3T6N A;  4CGR A;  2HYT A;  3FHN A;  2R7S A;  5AQC A;  2YVH A;  3KNW A;  4HKU A;  2IBD A;  5EZH A;  5GP9 A;  4XK4 A;  5FMP A;  3WHB A;  3BCG A;  3C07 A;  3GZI A;  1A6I A;  4D7N A;  3WHC A;  3HGG A;  3DU6 A;  5EZG A;  1BJZ A;  2ZCN A;  4X1E A;  1T56 A;  2FD5 A;  3KKC A;  2XRL A;  2XPU A;  4MXM A;  4L62 A;  5EFY A;  3VW0 A;  3SWH A;  2B3W A;  5FKO A;  3FIW A;  4G12 A;  2G3B A;  2UXU A;  3P9T A;  1JUS A;  3DCF A;  3LSJ A;  3K8P C;  3BQY A;  3IH2 A;  3VOK A;  4AC0 A;  3O8H A;  2UXP A;  2XPV A;  4ABZ A;  2G0E A;  2HXO A;  4AUX A;  3QPL A;  3B81 A;  3JSJ A;  1U9O A;  3ZQH A;  2VKV A;  3AQT A;  3DU5 A;  3VUQ A;  3HTA A;  2HKU A;  2OI8 A;  3BR1 A;  4AF5 A;  3Q0V A;  4JL3 A;  2Y2Z A;  1RKT A;  2G7S A;  3G56 A;  5J1Y A;  4JKZ A;  3F0C A;  4W1U A;  5CXG A;  3F1B A;  2XGD A;  3C2B A;  2R7O A;  1JTY A;  2X9D A;  5HBU A;  2JJ7 A;  3BTL A;  3NXC A;  3S5R A;  2Y31 A;  5J1U A;  2XDN A;  5F0F A;  4KWA A;  1ZK8 A;  3G1O A;  3MNL A;  3Q0W A;  4D5C A;  2R7R A;  2Q24 A;  5K7Z A;  2HXI A;  4ICH A;  3VPR A;  2GEN A;  3VW1 A;  2QCO A;  2ZB9 A;  2ZCX A;  5IOY A;  2NS8 A;  3FK7 A;  3VW2 A;  3BTJ A;  2QTQ A;  2XGC A;  5F08 A;  5EYR A;  5C4Y A;  2WGB A;  4U9L A;  2A2F X;  2FJI 1;  4GFK A;  2REK A;  4M3D A;  3DPJ A;  3TP0 A;  3EGQ A;  2F07 A;  4PXI A;  2IAI A;  3CJD A;  1RPW A;  3Q0U A;  3VIB A;  4B1R A;  2GBY A;  2W53 A;  2FQ4 A;  3IH4 A;  2QOP A;  3NNR A;  5K7H A;  3BR6 A;  2NS7 A;  3E7Q A;  3NI7 A;  2R7T A;  1JT0 A;  1JT6 A;  2PBX A;  3KKD A;  2R7U A;  2R7W A;  2NP3 A;  2UXI A;  3HTI A;  5J3L A;  1JUM A;  2ID3 A;  3BNI A;  2YVE A;  4W97 A;  3AQS A;  5K58 A;  5F0H A;  3G1L A;  3ON4 A;  2G7G A;  2OF7 A;  3VP5 A;  4YZE A;  5FKK A;  3LHQ A;  3DEW A;  1JTX A;  3QQA A;  1QVU A;  2XPW A;  3VVY A;  3RH2 A;  5D19 A;  2R7V A;  4ACI A;  3VOX A;  2NP5 A;  1UI6 A;  5GPA A;  4M3F A;  3PM1 A;  3CWR A;  2QWT A;  5CW8 A;  2TRT A;  3ZQG A;  3HGY A;  4IRV A;  3V78 A;  2FBQ A;  3NRG A;  2RHA A;  3ZQI A;  3G7R A;  5D18 A;  4OD5 A;  3BR2 A;  3IUV A;  2TCT A;  2RAE A;  2XGE A;  5F27 A;  5CXI A;  4M3B A;  3FK6 A;  2FJ1 A;  2ZOZ A;  2R7Q A;  3LSP A;  3NS4 A;  3LJL A;  4JNN A;  2GFN A;  3B6A A;  3HIM A;  5IP6 A;  3FRQ A;  3SFI A;  2PFV A;  2IU5 A;  5F0C A;  2YVX A;  3BTC A;  3B6C A;  4GCL A;  2HYJ A;  2ZOY A;  4OD4 A;  4GFL A;  2XB5 A;  5FKL A;  2RAS A;  5F1J A;  4C2M A;  2G7L A;  3ZQL A;  3KYL A;  3MVP A;  1Z0X A;  2ZCM A;  3ANP A;  4V2F A;  2D6Y A;  4NN1 A;  3LSR A;  4AC6 A;  5J1R A;  3NPI A;  1Z77 A;  3GEU A;  3ANG A;  2Y30 A;  5HSZ A;  5IOZ A;  5HAW A;  2IEK A;  2HQ5 A;  2UXH A;  5IPA A;  2UXO A;  2EH3 A;  1SGM A;  4DW6 A;  1UI5 A;  5FKM A;  3VVX A;  2O7O A;  1ZKG A;  1ORK A;  3QPS A;  2DG7 A;  3V6G A;  2V57 A;  2O7T A;  4DVY P;  4GCT A;  2NX4 A;  4I76 A;  3SDG A;  3VVZ A;  3CCY A;  3CDL A;  4M3E A;  3QKX A;  5CQG A;  2JK3 A;  3BHQ A;  4M3G A;  1RKW A;  5FHP A;  3IH3 A;  3BR0 A;  1U9N A;  2B1E A;  5H9T A;  3LWJ A;  2OPT A;  3BRU A;  3HTJ A;  1QPI A;  1QVT A;  5D1R A;  4JYK A;  3HTH A;  4D5F A;  1JUP A;  4B3A A;  3LOC A;  4NEL A;  2ID6 A;  4ME9 A;  1T33 A;  3BQZ A;  1VI0 A;  4V2G A;  2I10 A; 
#chains in the Genus database with same CATH homology
 3BTI A;  3RD3 A;  2X6O A;  2QKO A;  2DTZ A;  2WV1 A;  3Q3S A;  3BR5 A;  3PPB A;  3COL A;  2OER A;  4MO7 A;  4UDS A;  3TP3 A;  4GCK A;  4I6Z A;  4D7M A;  3BT9 A;  5FGL A;  2VPR A;  3QBM A;  5K7F A;  3KZ9 A;  2GUH A;  5FKN A;  2QIB A;  4MK6 A;  3G1M A;  3PAS A;  3ON2 A;  3O8G A;  3BJB A;  2FX0 A;  5DAJ A;  3ZQF A;  3EUP A;  2WUI A;  2VKE A;  3O60 A;  3BR3 A;  2DG8 A;  5F04 A;  5GPC A;  3HE0 A;  3CRJ A;  2PZ9 A;  3T6N A;  4CGR A;  2HYT A;  5AQC A;  2YVH A;  3KNW A;  4HKU A;  2IBD A;  5EZH A;  5GP9 A;  4XK4 A;  5FMP A;  3WHB A;  3BCG A;  3C07 A;  3GZI A;  1A6I A;  4D7N A;  3WHC A;  3HGG A;  5EZG A;  1BJZ A;  2ZCN A;  4X1E A;  1T56 A;  2FD5 A;  3KKC A;  2XRL A;  2XPU A;  4MXM A;  4L62 A;  5EFY A;  3VW0 A;  5FKO A;  3FIW A;  4G12 A;  2G3B A;  2UXU A;  3P9T A;  1JUS A;  3DCF A;  3LSJ A;  3BQY A;  3IH2 A;  3VOK A;  4AC0 A;  3O8H A;  2UXP A;  2XPV A;  4ABZ A;  2G0E A;  2HXO A;  4AUX A;  3QPL A;  3B81 A;  3JSJ A;  1U9O A;  3ZQH A;  2VKV A;  3AQT A;  3VUQ A;  3HTA A;  2HKU A;  2OI8 A;  3BR1 A;  4AF5 A;  3Q0V A;  4JL3 A;  2Y2Z A;  1RKT A;  2G7S A;  3G56 A;  5J1Y A;  4JKZ A;  3F0C A;  4W1U A;  5CXG A;  3F1B A;  2XGD A;  3C2B A;  1JTY A;  2X9D A;  5HBU A;  2JJ7 A;  3BTL A;  3NXC A;  3S5R A;  2Y31 A;  5J1U A;  2XDN A;  5F0F A;  4KWA A;  1ZK8 A;  3G1O A;  3MNL A;  3Q0W A;  4D5C A;  2Q24 A;  5K7Z A;  2HXI A;  4ICH A;  3VPR A;  2GEN A;  3VW1 A;  2QCO A;  2ZB9 A;  2ZCX A;  5IOY A;  2NS8 A;  3FK7 A;  3VW2 A;  3BTJ A;  2QTQ A;  2XGC A;  5F08 A;  5EYR A;  5C4Y A;  2WGB A;  4GFK A;  2REK A;  4M3D A;  3DPJ A;  3TP0 A;  3EGQ A;  2F07 A;  4PXI A;  2IAI A;  3CJD A;  1RPW A;  3Q0U A;  3VIB A;  4B1R A;  2GBY A;  2W53 A;  2FQ4 A;  3IH4 A;  2QOP A;  3NNR A;  5K7H A;  3BR6 A;  2NS7 A;  3E7Q A;  3NI7 A;  1JT0 A;  1JT6 A;  2PBX A;  3KKD A;  2NP3 A;  2UXI A;  3HTI A;  5J3L A;  1JUM A;  2ID3 A;  3BNI A;  2YVE A;  4W97 A;  3AQS A;  5K58 A;  5F0H A;  3G1L A;  3ON4 A;  2G7G A;  2OF7 A;  3VP5 A;  4YZE A;  5FKK A;  3LHQ A;  3DEW A;  1JTX A;  3QQA A;  1QVU A;  2XPW A;  3VVY A;  3RH2 A;  5D19 A;  4ACI A;  3VOX A;  2NP5 A;  1UI6 A;  5GPA A;  4M3F A;  3PM1 A;  3CWR A;  2QWT A;  5CW8 A;  2TRT A;  3ZQG A;  3HGY A;  3V78 A;  2FBQ A;  3NRG A;  2RHA A;  3ZQI A;  3G7R A;  5D18 A;  3BR2 A;  3IUV A;  2TCT A;  2RAE A;  2XGE A;  5F27 A;  5CXI A;  4M3B A;  3FK6 A;  2FJ1 A;  2ZOZ A;  3LSP A;  3LJL A;  4JNN A;  2GFN A;  3B6A A;  3HIM A;  5IP6 A;  3FRQ A;  3SFI A;  2IU5 A;  5F0C A;  3BTC A;  3B6C A;  4GCL A;  2HYJ A;  2ZOY A;  4GFL A;  2XB5 A;  5FKL A;  2RAS A;  5F1J A;  2G7L A;  3ZQL A;  3MVP A;  1Z0X A;  2ZCM A;  3ANP A;  4V2F A;  2D6Y A;  4NN1 A;  3LSR A;  4AC6 A;  5J1R A;  3NPI A;  1Z77 A;  3GEU A;  3ANG A;  2Y30 A;  5HSZ A;  5IOZ A;  5HAW A;  2IEK A;  2HQ5 A;  2UXH A;  5IPA A;  2UXO A;  2EH3 A;  1SGM A;  4DW6 A;  1UI5 A;  5FKM A;  3VVX A;  2O7O A;  1ZKG A;  1ORK A;  3QPS A;  2DG7 A;  3V6G A;  2V57 A;  2O7T A;  4GCT A;  2NX4 A;  4I76 A;  3SDG A;  3VVZ A;  3CCY A;  3CDL A;  4M3E A;  3QKX A;  2JK3 A;  3BHQ A;  4M3G A;  1RKW A;  5FHP A;  3IH3 A;  3BR0 A;  1U9N A;  5H9T A;  3LWJ A;  2OPT A;  3BRU A;  3HTJ A;  1QPI A;  1QVT A;  5D1R A;  4JYK A;  3HTH A;  4D5F A;  1JUP A;  4B3A A;  3LOC A;  4NEL A;  2ID6 A;  4ME9 A;  1T33 A;  3BQZ A;  1VI0 A;  4V2G A;  2I10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...