3LWJA

Crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
193
structure length
193
Chain Sequence
QNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNETLSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Transcription regulator
molecule keywords Putative TetR-family transcriptional regulator
total genus 77
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3lwjA00
3PASA 3DCFA 5K7FA 5FKLA 3O60A 3O8GA 2O7OA 2UXOA 2GBYA 1JUPA 4M3DA 3WHCA 1Z77A 4L62A 4AUXA 2RHAA 3CJDA 2ID6A 3KKCA 2IBDA 3BTCA 2G0EA 2UXIA 2FBQA 2ZCMA 4ICHA 5EZHA 2RASA 5HBUA 3VVYA 3WHBA 1QVUA 3LSRA 3KKDA 5HSZA 2ZOZA 2O7TA 3PPBA 4PXIA 2XB5A 4JKZA 2HXIA 3ANPA 2PBXA 2TCTA 4M3FA 2FQ4A 1QPIA 5F08A 2XGCA 3G1MA 3VVZA 2FD5A 4AC6A 2FX0A 3G1OA 5EFYA 4D7MA 1JT6A 2ZB9A 3BJBA 2QKOA 5IOYA 2UXUA 2VKEA 3DEWA 3EGQA 2ID3A 3Q3SA 1JUSA 3P9TA 1JTYA 3BQYA 4GFLA 2W53A 3VW0A 3SFIA 1JUMA 2I10A 5F04A 5EYRA 5CXIA 1ZKGA 3FRQA 1BJZA 2XDNA 2UXHA 5F0FA 5DAJA 2Y30A 3BR2A 3ZQLA 5FMPA 2VKVA 3NXCA 5CW8A 5F0CA 1UI5A 3NI7A 3HTHA 3GZIA 2X6OA 2NP5A 5F1JA 5AQCA 4UDSA 3RH2A 3LOCA 5GP9A 4B3AA 2HXOA 5F0HA 2XGDA 1ZK8A 3O8HA 1ORKA 1VI0A 2HYTA 3F1BA 1RPWA 3TP0A 3Q0UA 3BTJA 2NS8A 2WV1A 3LJLA 5IPAA 2WGBA 5D19A 2RAEA 3DPJA 2QIBA 3LSPA 3C07A 4JL3A 4W1UA 3HTIA 2XPVA 3CDLA 4NELA 4GCTA 2OF7A 4I6ZA 3ZQIA 2DTZA 4W97A 3IH3A 2HQ5A 2Q24A 2IEKA 3F0CA 5K7ZA 2YVEA 5D1RA 3MVPA 1SGMA 3QBMA 2WUIA 3HTAA 4B1RA 5FHPA 1T33A 3ANGA 3VW2A 2OERA 4MO7A 3NPIA 3G1LA 5IOZA 5C4YA 3BTLA 3G7RA 2F07A 5J1RA 5HAWA 2DG8A 3BRUA 2Y31A 2QTQA 4KWAA 3AQTA 2XPWA 5J3LA 2GFNA 4D7NA 5FKKA 2HYJA 2VPRA 3V78A 3BQZA 1T56A 2XGEA 3BTIA 3FK7A 3NNRA 5FKNA 2OPTA 3QPLA 2Y2ZA 3GEUA 3BR6A 5GPAA 2HKUA 2XPUA 3QKXA 4I76A 2YVHA 3HGGA 5F27A 1RKWA 3VPRA 1U9OA 2TRTA 2G3BA 3VW1A 3B81A 4D5CA 2GENA 4GCLA 3BR1A 4MK6A 3C2BA 2NX4A 3CRJA 2QCOA 4GCKA 4D5FA 3Q0WA 5D18A 3E7QA 2ZCNA 1QVTA 3LHQA 3ON4A 1UI6A 3VUQA 2NP3A 3IH2A 3RD3A 3LWJA 3BHQA 4AF5A 3B6AA 4G12A 3BR0A 2NS7A 5IP6A 3EUPA 3ZQFA 3V6GA 3VOXA 3T6NA 2GUHA 4ME9A 3COLA 3MNLA 2IAIA 1JT0A 4X1EA 2IU5A 3FK6A 4M3BA 2JJ7A 2EH3A 3QQAA 2PZ9A 2QOPA 5FKOA 2ZCXA 2UXPA 1JTXA 3AQSA 3JSJA 2JK3A 4JYKA 4M3EA 2ZOYA 3CWRA 4ABZA 2FJ1A 3BCGA 5K7HA 3B6CA 3KZ9A 5CXGA 4AC0A 5FKMA 4YZEA 2V57A 4CGRA 3VP5A 2QWTA 4DW6A 3IH4A 5K58A 2G7LA 4HKUA 3HE0A 3HGYA 4XK4A 1U9NA 3IUVA 3SDGA 3HIMA 3BR5A 2X9DA 3QPSA 5EZGA 3NRGA 2DG7A 2REKA 3VOKA 3FIWA 4ACIA 3BR3A 3ZQHA 3S5RA 3PM1A 5GPCA 5J1YA 4GFKA 3CCYA 4NN1A 3LSJA 4MXMA 3VIBA 2G7SA 1RKTA 4V2GA 5FGLA 5J1UA 3ON2A 4JNNA 3KNWA 3BT9A 4V2FA 3TP3A 1Z0XA 2XRLA 5H9TA 4M3GA 2OI8A 1A6IA 3Q0VA 3VVXA 2D6YA 3HTJA 3G56A 2G7GA 3BNIA 3ZQGA
chains in the Genus database with same CATH superfamily
3PASA 2ZY9A 3DCFA 5K7FA 5FKLA 3O60A 3O8GA 2O7OA 2UXOA 2GBYA 1JUPA 4M3DA 3WHCA 3KYLA 1Z77A 4L62A 4AUXA 2RHAA 3CJDA 2ID6A 3KKCA 2IBDA 3BTCA 4DVYP 2G0EA 2UXIA 2FBQA 2ZCMA 4ICHA 5EZHA 2RASA 5HBUA 3VVYA 3WHBA 1QVUA 3LSRA 3KKDA 5HSZA 2ZOZA 2O7TA 3PPBA 4PXIA 2XB5A 4JKZA 2HXIA 3ANPA 2PBXA 2TCTA 4M3FA 3K8PC 2FQ4A 1QPIA 2R7TA 5F08A 2XGCA 3G1MA 3VVZA 2FD5A 4AC6A 2FX0A 3G1OA 2B1EA 5EFYA 4D7MA 5CQGA 1JT6A 2ZB9A 3BJBA 2QKOA 5IOYA 2UXUA 2VKEA 4U9NA 3DEWA 3EGQA 2ID3A 3Q3SA 1JUSA 2R7QA 3VTIA 3P9TA 1JTYA 3BQYA 4GFLA 2W53A 3VW0A 3SFIA 1JUMA 2I10A 5F04A 5EYRA 5CXIA 1ZKGA 3FRQA 1BJZA 2XDNA 2UXHA 5F0FA 5DAJA 2Y30A 2YVXA 3BR2A 3ZQLA 5FMPA 2VKVA 3NXCA 5CW8A 5F0CA 1UI5A 3NI7A 3HTHA 2R7SA 3GZIA 4WIBA 2B3WA 2X6OA 2NP5A 5F1JA 5AQCA 4UDSA 3RH2A 3LOCA 2R7OA 5GP9A 4B3AA 2HXOA 5F0HA 2XGDA 1ZK8A 3O8HA 1ORKA 1VI0A 2HYTA 3F1BA 1RPWA 2R7WA 3TP0A 3NS4A 3Q0UA 3BTJA 2NS8A 2WV1A 3LJLA 5IPAA 2WGBA 5D19A 2RAEA 3DPJA 2QIBA 3LSPA 3C07A 4JL3A 4W1UA 3HTIA 2XPVA 3CDLA 4NELA 4GCTA 2OF7A 4I6ZA 2FJI1 3ZQIA 2DTZA 4W97A 3IH3A 2HQ5A 2Q24A 2IEKA 3F0CA 5K7ZA 4IRVA 2YVEA 4C2MA 5D1RA 3MVPA 1SGMA 3QBMA 2WUIA 3HTAA 4B1RA 5FHPA 1T33A 3ANGA 3VW2A 2OERA 4MO7A 3NPIA 3G1LA 5IOZA 5C4YA 3BTLA 3G7RA 2PFVA 2F07A 5J1RA 5HAWA 2DG8A 3BRUA 2Y31A 2QTQA 4KWAA 3AQTA 2XPWA 5J3LA 3SWHA 2GFNA 4D7NA 5FKKA 2R7RA 2A2FX 2HYJA 2VPRA 3V78A 3BQZA 1T56A 2XGEA 3BTIA 3DU6A 3DU5A 3FK7A 3NNRA 5FKNA 2OPTA 3QPLA 2Y2ZA 3GEUA 3BR6A 5GPAA 2HKUA 2XPUA 3QKXA 4I76A 2YVHA 2R7UA 3HGGA 5F27A 1RKWA 3VPRA 1U9OA 2TRTA 2G3BA 3VW1A 3B81A 4D5CA 2GENA 4GCLA 3BR1A 4MK6A 3C2BA 2NX4A 3CRJA 2QCOA 4GCKA 4D5FA 3Q0WA 5D18A 3E7QA 2ZCNA 1QVTA 3LHQA 3ON4A 1UI6A 3VUQA 2NP3A 3FHNA 3IH2A 3RD3A 3LWJA 3BHQA 4AF5A 3B6AA 2R7VA 4G12A 3BR0A 4OD4A 2R7XA 2NS7A 5IP6A 3EUPA 3ZQFA 3V6GA 3VOXA 3T6NA 2GUHA 4ME9A 3COLA 3MNLA 2IAIA 1JT0A 4X1EA 2IU5A 3FK6A 4U9LA 4M3BA 2JJ7A 2EH3A 3QQAA 2PZ9A 2QOPA 5FKOA 2ZCXA 2UXPA 1JTXA 3AQSA 3JSJA 2JK3A 4JYKA 4M3EA 2ZOYA 3CWRA 4ABZA 2FJ1A 3BCGA 5K7HA 3B6CA 3KZ9A 5CXGA 4AC0A 5FKMA 4YZEA 2V57A 4CGRA 3VP5A 2QWTA 4DW6A 3IH4A 5K58A 2G7LA 4HKUA 3HE0A 3HGYA 4XK4A 1U9NA 3IUVA 3SDGA 3HIMA 3BR5A 2X9DA 3QPSA 5EZGA 3NRGA 2DG7A 2REKA 4OD5A 3VOKA 3FIWA 4ACIA 3BR3A 3ZQHA 3S5RA 3PM1A 5GPCA 5J1YA 4GFKA 3CCYA 4NN1A 3LSJA 4MXMA 3VIBA 2G7SA 1RKTA 4V2GA 5FGLA 5J1UA 3ON2A 4JNNA 3KNWA 3BT9A 4V2FA 3TP3A 1Z0XA 2XRLA 5H9TA 4M3GA 2OI8A 1A6IA 3Q0VA 3VVXA 2D6YA 3HTJA 3G56A 2G7GA 3BNIA 3ZQGA
chains in the Genus database with same CATH topology
3PASA 3DCFA 5K7FA 5FKLA 3O60A 3O8GA 2O7OA 2UXOA 2GBYA 1JUPA 4M3DA 3WHCA 1Z77A 4L62A 4AUXA 2RHAA 3CJDA 2ID6A 3KKCA 2IBDA 3BTCA 2G0EA 2UXIA 2FBQA 2ZCMA 4ICHA 5EZHA 2RASA 5HBUA 3VVYA 3WHBA 1QVUA 3LSRA 3KKDA 5HSZA 2ZOZA 2O7TA 3PPBA 4PXIA 2XB5A 4JKZA 2HXIA 3ANPA 2PBXA 2TCTA 4M3FA 2FQ4A 1QPIA 5F08A 2XGCA 3G1MA 3VVZA 2FD5A 4AC6A 2FX0A 3G1OA 5EFYA 4D7MA 1JT6A 2ZB9A 3BJBA 2QKOA 5IOYA 2UXUA 2VKEA 3DEWA 3EGQA 2ID3A 3Q3SA 1JUSA 3P9TA 1JTYA 3BQYA 4GFLA 2W53A 3VW0A 3SFIA 1JUMA 2I10A 5F04A 5EYRA 5CXIA 1ZKGA 3FRQA 1BJZA 2XDNA 2UXHA 5F0FA 5DAJA 2Y30A 3BR2A 3ZQLA 5FMPA 2VKVA 3NXCA 5CW8A 5F0CA 1UI5A 3NI7A 3HTHA 3GZIA 2X6OA 2NP5A 5F1JA 5AQCA 4UDSA 3RH2A 3LOCA 5GP9A 4B3AA 2HXOA 5F0HA 2XGDA 1ZK8A 3O8HA 1ORKA 1VI0A 2HYTA 3F1BA 1RPWA 3TP0A 3Q0UA 3BTJA 2NS8A 2WV1A 3LJLA 5IPAA 2WGBA 5D19A 2RAEA 3DPJA 2QIBA 3LSPA 3C07A 4JL3A 4W1UA 3HTIA 2XPVA 3CDLA 4NELA 4GCTA 2OF7A 4I6ZA 3ZQIA 2DTZA 4W97A 3IH3A 2HQ5A 2Q24A 2IEKA 3F0CA 5K7ZA 2YVEA 5D1RA 3MVPA 1SGMA 3QBMA 2WUIA 3HTAA 4B1RA 5FHPA 1T33A 3ANGA 3VW2A 2OERA 4MO7A 3NPIA 3G1LA 5IOZA 5C4YA 3BTLA 3G7RA 2F07A 5J1RA 5HAWA 2DG8A 3BRUA 2Y31A 2QTQA 4KWAA 3AQTA 2XPWA 5J3LA 2GFNA 4D7NA 5FKKA 2HYJA 2VPRA 3V78A 3BQZA 1T56A 2XGEA 3BTIA 3FK7A 3NNRA 5FKNA 2OPTA 3QPLA 2Y2ZA 3GEUA 3BR6A 5GPAA 2HKUA 2XPUA 3QKXA 4I76A 2YVHA 3HGGA 5F27A 1RKWA 3VPRA 1U9OA 2TRTA 2G3BA 3VW1A 3B81A 4D5CA 2GENA 4GCLA 3BR1A 4MK6A 3C2BA 2NX4A 3CRJA 2QCOA 4GCKA 4D5FA 3Q0WA 5D18A 3E7QA 2ZCNA 1QVTA 3LHQA 3ON4A 1UI6A 3VUQA 2NP3A 3IH2A 3RD3A 3LWJA 3BHQA 4AF5A 3B6AA 4G12A 3BR0A 2NS7A 5IP6A 3EUPA 3ZQFA 3V6GA 3VOXA 3T6NA 2GUHA 4ME9A 3COLA 3MNLA 2IAIA 1JT0A 4X1EA 2IU5A 3FK6A 4M3BA 2JJ7A 2EH3A 3QQAA 2PZ9A 2QOPA 5FKOA 2ZCXA 2UXPA 1JTXA 3AQSA 3JSJA 2JK3A 4JYKA 4M3EA 2ZOYA 3CWRA 4ABZA 2FJ1A 3BCGA 5K7HA 3B6CA 3KZ9A 5CXGA 4AC0A 5FKMA 4YZEA 2V57A 4CGRA 3VP5A 2QWTA 4DW6A 3IH4A 5K58A 2G7LA 4HKUA 3HE0A 3HGYA 4XK4A 1U9NA 3IUVA 3SDGA 3HIMA 3BR5A 2X9DA 3QPSA 5EZGA 3NRGA 2DG7A 2REKA 3VOKA 3FIWA 4ACIA 3BR3A 3ZQHA 3S5RA 3PM1A 5GPCA 5J1YA 4GFKA 3CCYA 4NN1A 3LSJA 4MXMA 3VIBA 2G7SA 1RKTA 4V2GA 5FGLA 5J1UA 3ON2A 4JNNA 3KNWA 3BT9A 4V2FA 3TP3A 1Z0XA 2XRLA 5H9TA 4M3GA 2OI8A 1A6IA 3Q0VA 3VVXA 2D6YA 3HTJA 3G56A 2G7GA 3BNIA 3ZQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAS A;  3DCF A;  5K7F A;  5FKL A;  3O60 A;  3O8G A;  2O7O A;  2UXO A;  2GBY A;  1JUP A;  4M3D A;  3WHC A;  1Z77 A;  4L62 A;  4AUX A;  2RHA A;  3CJD A;  2ID6 A;  3KKC A;  2IBD A;  3BTC A;  2G0E A;  2UXI A;  2FBQ A;  2ZCM A;  4ICH A;  5EZH A;  2RAS A;  5HBU A;  3VVY A;  3WHB A;  1QVU A;  3LSR A;  3KKD A;  5HSZ A;  2ZOZ A;  2O7T A;  3PPB A;  4PXI A;  2XB5 A;  4JKZ A;  2HXI A;  3ANP A;  2PBX A;  2TCT A;  4M3F A;  2FQ4 A;  1QPI A;  5F08 A;  2XGC A;  3G1M A;  3VVZ A;  2FD5 A;  4AC6 A;  2FX0 A;  3G1O A;  5EFY A;  4D7M A;  1JT6 A;  2ZB9 A;  3BJB A;  2QKO A;  5IOY A;  2UXU A;  2VKE A;  3DEW A;  3EGQ A;  2ID3 A;  3Q3S A;  1JUS A;  3P9T A;  1JTY A;  3BQY A;  4GFL A;  2W53 A;  3VW0 A;  3SFI A;  1JUM A;  2I10 A;  5F04 A;  5EYR A;  5CXI A;  1ZKG A;  3FRQ A;  1BJZ A;  2XDN A;  2UXH A;  5F0F A;  5DAJ A;  2Y30 A;  3BR2 A;  3ZQL A;  5FMP A;  2VKV A;  3NXC A;  5CW8 A;  5F0C A;  1UI5 A;  3NI7 A;  3HTH A;  3GZI A;  2X6O A;  2NP5 A;  5F1J A;  5AQC A;  4UDS A;  3RH2 A;  3LOC A;  5GP9 A;  4B3A A;  2HXO A;  5F0H A;  2XGD A;  1ZK8 A;  3O8H A;  1ORK A;  1VI0 A;  2HYT A;  3F1B A;  1RPW A;  3TP0 A;  3Q0U A;  3BTJ A;  2NS8 A;  2WV1 A;  3LJL A;  5IPA A;  2WGB A;  5D19 A;  2RAE A;  3DPJ A;  2QIB A;  3LSP A;  3C07 A;  4JL3 A;  4W1U A;  3HTI A;  2XPV A;  3CDL A;  4NEL A;  4GCT A;  2OF7 A;  4I6Z A;  3ZQI A;  2DTZ A;  4W97 A;  3IH3 A;  2HQ5 A;  2Q24 A;  2IEK A;  3F0C A;  5K7Z A;  2YVE A;  5D1R A;  3MVP A;  1SGM A;  3QBM A;  2WUI A;  3HTA A;  4B1R A;  5FHP A;  1T33 A;  3ANG A;  3VW2 A;  2OER A;  4MO7 A;  3NPI A;  3G1L A;  5IOZ A;  5C4Y A;  3BTL A;  3G7R A;  2F07 A;  5J1R A;  5HAW A;  2DG8 A;  3BRU A;  2Y31 A;  2QTQ A;  4KWA A;  3AQT A;  2XPW A;  5J3L A;  2GFN A;  4D7N A;  5FKK A;  2HYJ A;  2VPR A;  3V78 A;  3BQZ A;  1T56 A;  2XGE A;  3BTI A;  3FK7 A;  3NNR A;  5FKN A;  2OPT A;  3QPL A;  2Y2Z A;  3GEU A;  3BR6 A;  5GPA A;  2HKU A;  2XPU A;  3QKX A;  4I76 A;  2YVH A;  3HGG A;  5F27 A;  1RKW A;  3VPR A;  1U9O A;  2TRT A;  2G3B A;  3VW1 A;  3B81 A;  4D5C A;  2GEN A;  4GCL A;  3BR1 A;  4MK6 A;  3C2B A;  2NX4 A;  3CRJ A;  2QCO A;  4GCK A;  4D5F A;  3Q0W A;  5D18 A;  3E7Q A;  2ZCN A;  1QVT A;  3LHQ A;  3ON4 A;  1UI6 A;  3VUQ A;  2NP3 A;  3IH2 A;  3RD3 A;  3LWJ A;  3BHQ A;  4AF5 A;  3B6A A;  4G12 A;  3BR0 A;  2NS7 A;  5IP6 A;  3EUP A;  3ZQF A;  3V6G A;  3VOX A;  3T6N A;  2GUH A;  4ME9 A;  3COL A;  3MNL A;  2IAI A;  1JT0 A;  4X1E A;  2IU5 A;  3FK6 A;  4M3B A;  2JJ7 A;  2EH3 A;  3QQA A;  2PZ9 A;  2QOP A;  5FKO A;  2ZCX A;  2UXP A;  1JTX A;  3AQS A;  3JSJ A;  2JK3 A;  4JYK A;  4M3E A;  2ZOY A;  3CWR A;  4ABZ A;  2FJ1 A;  3BCG A;  5K7H A;  3B6C A;  3KZ9 A;  5CXG A;  4AC0 A;  5FKM A;  4YZE A;  2V57 A;  4CGR A;  3VP5 A;  2QWT A;  4DW6 A;  3IH4 A;  5K58 A;  2G7L A;  4HKU A;  3HE0 A;  3HGY A;  4XK4 A;  1U9N A;  3IUV A;  3SDG A;  3HIM A;  3BR5 A;  2X9D A;  3QPS A;  5EZG A;  3NRG A;  2DG7 A;  2REK A;  3VOK A;  3FIW A;  4ACI A;  3BR3 A;  3ZQH A;  3S5R A;  3PM1 A;  5GPC A;  5J1Y A;  4GFK A;  3CCY A;  4NN1 A;  3LSJ A;  4MXM A;  3VIB A;  2G7S A;  1RKT A;  4V2G A;  5FGL A;  5J1U A;  3ON2 A;  4JNN A;  3KNW A;  3BT9 A;  4V2F A;  3TP3 A;  1Z0X A;  2XRL A;  5H9T A;  4M3G A;  2OI8 A;  1A6I A;  3Q0V A;  3VVX A;  2D6Y A;  3HTJ A;  3G56 A;  2G7G A;  3BNI A;  3ZQG A; 
#chains in the Genus database with same CATH topology
 3PAS A;  2ZY9 A;  3DCF A;  5K7F A;  5FKL A;  3O60 A;  3O8G A;  2O7O A;  2UXO A;  2GBY A;  1JUP A;  4M3D A;  3WHC A;  3KYL A;  1Z77 A;  4L62 A;  4AUX A;  2RHA A;  3CJD A;  2ID6 A;  3KKC A;  2IBD A;  3BTC A;  4DVY P;  2G0E A;  2UXI A;  2FBQ A;  2ZCM A;  4ICH A;  5EZH A;  2RAS A;  5HBU A;  3VVY A;  3WHB A;  1QVU A;  3LSR A;  3KKD A;  5HSZ A;  2ZOZ A;  2O7T A;  3PPB A;  4PXI A;  2XB5 A;  4JKZ A;  2HXI A;  3ANP A;  2PBX A;  2TCT A;  4M3F A;  3K8P C;  2FQ4 A;  1QPI A;  2R7T A;  5F08 A;  2XGC A;  3G1M A;  3VVZ A;  2FD5 A;  4AC6 A;  2FX0 A;  3G1O A;  2B1E A;  5EFY A;  4D7M A;  5CQG A;  1JT6 A;  2ZB9 A;  3BJB A;  2QKO A;  5IOY A;  2UXU A;  2VKE A;  4U9N A;  3DEW A;  3EGQ A;  2ID3 A;  3Q3S A;  1JUS A;  2R7Q A;  3VTI A;  3P9T A;  1JTY A;  3BQY A;  4GFL A;  2W53 A;  3VW0 A;  3SFI A;  1JUM A;  2I10 A;  5F04 A;  5EYR A;  5CXI A;  1ZKG A;  3FRQ A;  1BJZ A;  2XDN A;  2UXH A;  5F0F A;  5DAJ A;  2Y30 A;  2YVX A;  3BR2 A;  3ZQL A;  5FMP A;  2VKV A;  3NXC A;  5CW8 A;  5F0C A;  1UI5 A;  3NI7 A;  3HTH A;  2R7S A;  3GZI A;  4WIB A;  2B3W A;  2X6O A;  2NP5 A;  5F1J A;  5AQC A;  4UDS A;  3RH2 A;  3LOC A;  2R7O A;  5GP9 A;  4B3A A;  2HXO A;  5F0H A;  2XGD A;  1ZK8 A;  3O8H A;  1ORK A;  1VI0 A;  2HYT A;  3F1B A;  1RPW A;  2R7W A;  3TP0 A;  3NS4 A;  3Q0U A;  3BTJ A;  2NS8 A;  2WV1 A;  3LJL A;  5IPA A;  2WGB A;  5D19 A;  2RAE A;  3DPJ A;  2QIB A;  3LSP A;  3C07 A;  4JL3 A;  4W1U A;  3HTI A;  2XPV A;  3CDL A;  4NEL A;  4GCT A;  2OF7 A;  4I6Z A;  2FJI 1;  3ZQI A;  2DTZ A;  4W97 A;  3IH3 A;  2HQ5 A;  2Q24 A;  2IEK A;  3F0C A;  5K7Z A;  4IRV A;  2YVE A;  4C2M A;  5D1R A;  3MVP A;  1SGM A;  3QBM A;  2WUI A;  3HTA A;  4B1R A;  5FHP A;  1T33 A;  3ANG A;  3VW2 A;  2OER A;  4MO7 A;  3NPI A;  3G1L A;  5IOZ A;  5C4Y A;  3BTL A;  3G7R A;  2PFV A;  2F07 A;  5J1R A;  5HAW A;  2DG8 A;  3BRU A;  2Y31 A;  2QTQ A;  4KWA A;  3AQT A;  2XPW A;  5J3L A;  3SWH A;  2GFN A;  4D7N A;  5FKK A;  2R7R A;  2A2F X;  2HYJ A;  2VPR A;  3V78 A;  3BQZ A;  1T56 A;  2XGE A;  3BTI A;  3DU6 A;  3DU5 A;  3FK7 A;  3NNR A;  5FKN A;  2OPT A;  3QPL A;  2Y2Z A;  3GEU A;  3BR6 A;  5GPA A;  2HKU A;  2XPU A;  3QKX A;  4I76 A;  2YVH A;  2R7U A;  3HGG A;  5F27 A;  1RKW A;  3VPR A;  1U9O A;  2TRT A;  2G3B A;  3VW1 A;  3B81 A;  4D5C A;  2GEN A;  4GCL A;  3BR1 A;  4MK6 A;  3C2B A;  2NX4 A;  3CRJ A;  2QCO A;  4GCK A;  4D5F A;  3Q0W A;  5D18 A;  3E7Q A;  2ZCN A;  1QVT A;  3LHQ A;  3ON4 A;  1UI6 A;  3VUQ A;  2NP3 A;  3FHN A;  3IH2 A;  3RD3 A;  3LWJ A;  3BHQ A;  4AF5 A;  3B6A A;  2R7V A;  4G12 A;  3BR0 A;  4OD4 A;  2R7X A;  2NS7 A;  5IP6 A;  3EUP A;  3ZQF A;  3V6G A;  3VOX A;  3T6N A;  2GUH A;  4ME9 A;  3COL A;  3MNL A;  2IAI A;  1JT0 A;  4X1E A;  2IU5 A;  3FK6 A;  4U9L A;  4M3B A;  2JJ7 A;  2EH3 A;  3QQA A;  2PZ9 A;  2QOP A;  5FKO A;  2ZCX A;  2UXP A;  1JTX A;  3AQS A;  3JSJ A;  2JK3 A;  4JYK A;  4M3E A;  2ZOY A;  3CWR A;  4ABZ A;  2FJ1 A;  3BCG A;  5K7H A;  3B6C A;  3KZ9 A;  5CXG A;  4AC0 A;  5FKM A;  4YZE A;  2V57 A;  4CGR A;  3VP5 A;  2QWT A;  4DW6 A;  3IH4 A;  5K58 A;  2G7L A;  4HKU A;  3HE0 A;  3HGY A;  4XK4 A;  1U9N A;  3IUV A;  3SDG A;  3HIM A;  3BR5 A;  2X9D A;  3QPS A;  5EZG A;  3NRG A;  2DG7 A;  2REK A;  4OD5 A;  3VOK A;  3FIW A;  4ACI A;  3BR3 A;  3ZQH A;  3S5R A;  3PM1 A;  5GPC A;  5J1Y A;  4GFK A;  3CCY A;  4NN1 A;  3LSJ A;  4MXM A;  3VIB A;  2G7S A;  1RKT A;  4V2G A;  5FGL A;  5J1U A;  3ON2 A;  4JNN A;  3KNW A;  3BT9 A;  4V2F A;  3TP3 A;  1Z0X A;  2XRL A;  5H9T A;  4M3G A;  2OI8 A;  1A6I A;  3Q0V A;  3VVX A;  2D6Y A;  3HTJ A;  3G56 A;  2G7G A;  3BNI A;  3ZQG A; 
#chains in the Genus database with same CATH homology
 3PAS A;  3DCF A;  5K7F A;  5FKL A;  3O60 A;  3O8G A;  2O7O A;  2UXO A;  2GBY A;  1JUP A;  4M3D A;  3WHC A;  1Z77 A;  4L62 A;  4AUX A;  2RHA A;  3CJD A;  2ID6 A;  3KKC A;  2IBD A;  3BTC A;  2G0E A;  2UXI A;  2FBQ A;  2ZCM A;  4ICH A;  5EZH A;  2RAS A;  5HBU A;  3VVY A;  3WHB A;  1QVU A;  3LSR A;  3KKD A;  5HSZ A;  2ZOZ A;  2O7T A;  3PPB A;  4PXI A;  2XB5 A;  4JKZ A;  2HXI A;  3ANP A;  2PBX A;  2TCT A;  4M3F A;  2FQ4 A;  1QPI A;  5F08 A;  2XGC A;  3G1M A;  3VVZ A;  2FD5 A;  4AC6 A;  2FX0 A;  3G1O A;  5EFY A;  4D7M A;  1JT6 A;  2ZB9 A;  3BJB A;  2QKO A;  5IOY A;  2UXU A;  2VKE A;  3DEW A;  3EGQ A;  2ID3 A;  3Q3S A;  1JUS A;  3P9T A;  1JTY A;  3BQY A;  4GFL A;  2W53 A;  3VW0 A;  3SFI A;  1JUM A;  2I10 A;  5F04 A;  5EYR A;  5CXI A;  1ZKG A;  3FRQ A;  1BJZ A;  2XDN A;  2UXH A;  5F0F A;  5DAJ A;  2Y30 A;  3BR2 A;  3ZQL A;  5FMP A;  2VKV A;  3NXC A;  5CW8 A;  5F0C A;  1UI5 A;  3NI7 A;  3HTH A;  3GZI A;  2X6O A;  2NP5 A;  5F1J A;  5AQC A;  4UDS A;  3RH2 A;  3LOC A;  5GP9 A;  4B3A A;  2HXO A;  5F0H A;  2XGD A;  1ZK8 A;  3O8H A;  1ORK A;  1VI0 A;  2HYT A;  3F1B A;  1RPW A;  3TP0 A;  3Q0U A;  3BTJ A;  2NS8 A;  2WV1 A;  3LJL A;  5IPA A;  2WGB A;  5D19 A;  2RAE A;  3DPJ A;  2QIB A;  3LSP A;  3C07 A;  4JL3 A;  4W1U A;  3HTI A;  2XPV A;  3CDL A;  4NEL A;  4GCT A;  2OF7 A;  4I6Z A;  3ZQI A;  2DTZ A;  4W97 A;  3IH3 A;  2HQ5 A;  2Q24 A;  2IEK A;  3F0C A;  5K7Z A;  2YVE A;  5D1R A;  3MVP A;  1SGM A;  3QBM A;  2WUI A;  3HTA A;  4B1R A;  5FHP A;  1T33 A;  3ANG A;  3VW2 A;  2OER A;  4MO7 A;  3NPI A;  3G1L A;  5IOZ A;  5C4Y A;  3BTL A;  3G7R A;  2F07 A;  5J1R A;  5HAW A;  2DG8 A;  3BRU A;  2Y31 A;  2QTQ A;  4KWA A;  3AQT A;  2XPW A;  5J3L A;  2GFN A;  4D7N A;  5FKK A;  2HYJ A;  2VPR A;  3V78 A;  3BQZ A;  1T56 A;  2XGE A;  3BTI A;  3FK7 A;  3NNR A;  5FKN A;  2OPT A;  3QPL A;  2Y2Z A;  3GEU A;  3BR6 A;  5GPA A;  2HKU A;  2XPU A;  3QKX A;  4I76 A;  2YVH A;  3HGG A;  5F27 A;  1RKW A;  3VPR A;  1U9O A;  2TRT A;  2G3B A;  3VW1 A;  3B81 A;  4D5C A;  2GEN A;  4GCL A;  3BR1 A;  4MK6 A;  3C2B A;  2NX4 A;  3CRJ A;  2QCO A;  4GCK A;  4D5F A;  3Q0W A;  5D18 A;  3E7Q A;  2ZCN A;  1QVT A;  3LHQ A;  3ON4 A;  1UI6 A;  3VUQ A;  2NP3 A;  3IH2 A;  3RD3 A;  3LWJ A;  3BHQ A;  4AF5 A;  3B6A A;  4G12 A;  3BR0 A;  2NS7 A;  5IP6 A;  3EUP A;  3ZQF A;  3V6G A;  3VOX A;  3T6N A;  2GUH A;  4ME9 A;  3COL A;  3MNL A;  2IAI A;  1JT0 A;  4X1E A;  2IU5 A;  3FK6 A;  4M3B A;  2JJ7 A;  2EH3 A;  3QQA A;  2PZ9 A;  2QOP A;  5FKO A;  2ZCX A;  2UXP A;  1JTX A;  3AQS A;  3JSJ A;  2JK3 A;  4JYK A;  4M3E A;  2ZOY A;  3CWR A;  4ABZ A;  2FJ1 A;  3BCG A;  5K7H A;  3B6C A;  3KZ9 A;  5CXG A;  4AC0 A;  5FKM A;  4YZE A;  2V57 A;  4CGR A;  3VP5 A;  2QWT A;  4DW6 A;  3IH4 A;  5K58 A;  2G7L A;  4HKU A;  3HE0 A;  3HGY A;  4XK4 A;  1U9N A;  3IUV A;  3SDG A;  3HIM A;  3BR5 A;  2X9D A;  3QPS A;  5EZG A;  3NRG A;  2DG7 A;  2REK A;  3VOK A;  3FIW A;  4ACI A;  3BR3 A;  3ZQH A;  3S5R A;  3PM1 A;  5GPC A;  5J1Y A;  4GFK A;  3CCY A;  4NN1 A;  3LSJ A;  4MXM A;  3VIB A;  2G7S A;  1RKT A;  4V2G A;  5FGL A;  5J1U A;  3ON2 A;  4JNN A;  3KNW A;  3BT9 A;  4V2F A;  3TP3 A;  1Z0X A;  2XRL A;  5H9T A;  4M3G A;  2OI8 A;  1A6I A;  3Q0V A;  3VVX A;  2D6Y A;  3HTJ A;  3G56 A;  2G7G A;  3BNI A;  3ZQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...