3LWJA

Crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
193
structure length
193
Chain Sequence
QNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNETLSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Transcription regulator
molecule keywords Putative TetR-family transcriptional regulator
total genus 77
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3lwjA00
5IPAA 2HXIA 3LOCA 3O8HA 1JTXA 2XPUA 2ZCNA 5K58A 4M3BA 3CRJA 2HXOA 1A6IA 1T56A 2PZ9A 2UXHA 3BTIA 3HE0A 3VW1A 5FKNA 3HTAA 2ZOYA 3E7QA 3GZIA 1RKTA 5HSZA 2IU5A 2ZCXA 5C4YA 5FKOA 2NS7A 4X1EA 3G7RA 2OF7A 2XGCA 5CXIA 4DW6A 1ZKGA 1U9OA 1QPIA 1JT6A 2HYTA 2IEKA 3HGGA 2DG7A 4MO7A 3RD3A 2UXIA 2TCTA 3B81A 5FKLA 5CXGA 4AC6A 2GFNA 2XRLA 1Z0XA 3BR1A 2XB5A 4AC0A 3ANPA 5F08A 2FQ4A 3QPLA 3Q0UA 3Q0WA 2Y30A 3DEWA 5F04A 3TP0A 2HKUA 4JL3A 1RPWA 2ID3A 3FK7A 5EZHA 2GUHA 2RAEA 2XGDA 4XK4A 5EYRA 3VW0A 3VVZA 4JNNA 3BR5A 1QVTA 3BR6A 4L62A 2HYJA 2QCOA 1VI0A 2G7GA 2IAIA 3QKXA 2ZCMA 4NELA 2GBYA 4GCLA 2I10A 2W53A 5IOYA 2Q24A 1QVUA 4ABZA 2RASA 1ZK8A 4CGRA 2F07A 2UXOA 2FJ1A 3F1BA 3TP3A 3VUQA 3ON4A 2FBQA 3FRQA 5K7ZA 3BJBA 3B6AA 3DPJA 3G1LA 4V2FA 3HTJA 1SGMA 4M3EA 3BQZA 4MK6A 3MVPA 3MNLA 5IOZA 3IH3A 2G7SA 4HKUA 3B6CA 3PPBA 2V57A 1JUSA 3ZQGA 3PM1A 2DTZA 3BHQA 3IUVA 3LSJA 3VIBA 2NP5A 2PBXA 2VKVA 1Z77A 2XDNA 2WUIA 2NX4A 4I76A 3SFIA 3O8GA 4MXMA 3NXCA 3LHQA 4AF5A 4JYKA 1T33A 3JSJA 3DCFA 4G12A 2ID6A 2OI8A 4NN1A 2NS8A 5FMPA 2YVEA 1JTYA 4D7MA 2OERA 3VPRA 4M3FA 1BJZA 4M3DA 2G3BA 5HAWA 3AQSA 3ZQFA 4KWAA 4AUXA 5D19A 1U9NA 3ZQLA 5DAJA 3KKDA 2Y2ZA 3G1OA 5J3LA 2FD5A 2XPWA 3BQYA 4B1RA 4M3GA 3V6GA 1UI5A 3RH2A 3P9TA 3PASA 2Y31A 3S5RA 3NRGA 3Q0VA 2ZB9A 3G56A 3LWJA 2UXPA 3CWRA 4I6ZA 2ZOZA 3CDLA 4GCKA 3BTJA 5GP9A 3HIMA 3HGYA 2G7LA 2NP3A 2DG8A 3KZ9A 3QPSA 3ANGA 4D5CA 4V2GA 5F27A 2X6OA 3COLA 5D1RA 2WGBA 3NPIA 3QBMA 3SDGA 3LSRA 3WHCA 3ON2A 1RKWA 2TRTA 3Q3SA 3C07A 2FX0A 5H9TA 5FKMA 2X9DA 4ICHA 2QIBA 3BR3A 3FIWA 3LSPA 3BCGA 5CW8A 3KNWA 3IH2A 3VP5A 3F0CA 3T6NA 5F0FA 2RHAA 2IBDA 1JT0A 5J1RA 2UXUA 3WHBA 2VKEA 5K7FA 4W97A 2WV1A 4D5FA 3HTHA 2O7TA 2XGEA 4ACIA 2YVHA 5GPAA 5EZGA 5K7HA 2QKOA 2QWTA 3VVYA 5F0CA 2JJ7A 5HBUA 4GFLA 3BR2A 1UI6A 1ORKA 2OPTA 4D7NA 4ME9A 3EUPA 2D6YA 3GEUA 2JK3A 3KKCA 4UDSA 2REKA 3LJLA 2QTQA 5F0HA 3BT9A 3O60A 3VW2A 3FK6A 5J1YA 3CJDA 5J1UA 3NNRA 2EH3A 2GENA 3VVXA 3AQTA 5EFYA 4GCTA 2XPVA 4B3AA 3CCYA 4PXIA 5GPCA 5FHPA 3VOKA 1JUMA 2QOPA 3ZQIA 5AQCA 3BR0A 4W1UA 2HQ5A 4JKZA 3NI7A 2G0EA 3BRUA 3G1MA 2O7OA 3BTCA 3ZQHA 3VOXA 4YZEA 1JUPA 3HTIA 3BNIA 5IP6A 3BTLA 5D18A 3V78A 3IH4A 2VPRA 3QQAA 5FKKA 3C2BA 5FGLA 3EGQA 4GFKA 5F1JA
chains in the Genus database with same CATH superfamily
5IPAA 2HXIA 2A2FX 3LOCA 3O8HA 1JTXA 2XPUA 2ZCNA 5K58A 4WIBA 4M3BA 3CRJA 2HXOA 1A6IA 1T56A 2PZ9A 2UXHA 3BTIA 3HE0A 3VW1A 5FKNA 3HTAA 2ZOYA 3E7QA 3GZIA 1RKTA 5HSZA 2IU5A 2ZCXA 5C4YA 5FKOA 2NS7A 4X1EA 3VTIA 3G7RA 2OF7A 2XGCA 5CXIA 4DW6A 1ZKGA 1U9OA 1QPIA 2R7VA 1JT6A 2HYTA 2IEKA 3HGGA 2DG7A 4MO7A 3RD3A 2B1EA 2UXIA 2TCTA 3B81A 5FKLA 5CXGA 4AC6A 2GFNA 2XRLA 1Z0XA 3BR1A 2XB5A 4AC0A 3ANPA 5F08A 2FQ4A 3QPLA 3Q0UA 3Q0WA 3DU5A 2Y30A 3DEWA 5F04A 3TP0A 2HKUA 4JL3A 2R7TA 1RPWA 2ID3A 3FK7A 5EZHA 2R7WA 2GUHA 2RAEA 2XGDA 4XK4A 5EYRA 3VW0A 3SWHA 3VVZA 4JNNA 3BR5A 1QVTA 3BR6A 4L62A 2HYJA 2QCOA 1VI0A 2G7GA 2IAIA 3QKXA 2ZCMA 3FHNA 4NELA 2GBYA 4GCLA 2I10A 2W53A 5IOYA 2Q24A 1QVUA 4ABZA 2RASA 1ZK8A 4CGRA 2F07A 2R7RA 2UXOA 2FJ1A 3F1BA 3TP3A 3VUQA 3ON4A 2FBQA 3FRQA 5K7ZA 3BJBA 3B6AA 3DPJA 3G1LA 4V2FA 3HTJA 1SGMA 4M3EA 3BQZA 4MK6A 3MVPA 3MNLA 5IOZA 3IH3A 2G7SA 4HKUA 3B6CA 3PPBA 2V57A 1JUSA 3ZQGA 3PM1A 2DTZA 3BHQA 3IUVA 3LSJA 3VIBA 2NP5A 2PBXA 2VKVA 1Z77A 2XDNA 2WUIA 2NX4A 4I76A 3SFIA 3O8GA 4OD4A 4MXMA 3NXCA 3LHQA 4AF5A 4JYKA 1T33A 3JSJA 3DCFA 4G12A 2ID6A 2OI8A 4NN1A 2NS8A 5FMPA 2YVEA 1JTYA 4D7MA 2OERA 4OD5A 3VPRA 4U9LA 4M3FA 1BJZA 4M3DA 2G3BA 5HAWA 3AQSA 3ZQFA 4KWAA 4AUXA 5D19A 1U9NA 3ZQLA 5DAJA 3KKDA 2Y2ZA 3G1OA 5J3LA 2FD5A 2R7SA 2XPWA 3BQYA 4B1RA 4M3GA 3K8PC 3V6GA 1UI5A 3RH2A 3P9TA 3PASA 2Y31A 3S5RA 3NRGA 3DU6A 3Q0VA 2ZB9A 3G56A 3LWJA 2UXPA 3CWRA 4I6ZA 2ZOZA 3CDLA 4GCKA 3BTJA 5GP9A 3HIMA 3HGYA 2G7LA 2NP3A 2DG8A 3KZ9A 3QPSA 3ANGA 4D5CA 4V2GA 5F27A 2X6OA 3COLA 3NS4A 5D1RA 2WGBA 3NPIA 3QBMA 3SDGA 3LSRA 4C2MA 3WHCA 4IRVA 3ON2A 1RKWA 2TRTA 3Q3SA 3C07A 2FX0A 5H9TA 5FKMA 2X9DA 4ICHA 2QIBA 3BR3A 3FIWA 2R7QA 3LSPA 3BCGA 5CW8A 3KNWA 3IH2A 3VP5A 3F0CA 3T6NA 5F0FA 2RHAA 2R7OA 2IBDA 1JT0A 5J1RA 2UXUA 3WHBA 2VKEA 4DVYP 5K7FA 4W97A 2WV1A 4D5FA 3HTHA 2O7TA 2XGEA 4ACIA 2YVHA 5GPAA 2YVXA 5EZGA 5K7HA 2QKOA 3KYLA 2QWTA 3VVYA 5F0CA 2JJ7A 5HBUA 4GFLA 3BR2A 1UI6A 1ORKA 2OPTA 4U9NA 4D7NA 4ME9A 3EUPA 2D6YA 3GEUA 2JK3A 3KKCA 4UDSA 2R7UA 2REKA 3LJLA 2QTQA 5F0HA 3BT9A 3O60A 3VW2A 3FK6A 5J1YA 3CJDA 5J1UA 3NNRA 2EH3A 2GENA 3VVXA 3AQTA 5EFYA 4GCTA 2XPVA 4B3AA 3CCYA 4PXIA 5GPCA 5FHPA 3VOKA 1JUMA 2QOPA 3ZQIA 5AQCA 3BR0A 4W1UA 2HQ5A 4JKZA 3NI7A 2G0EA 2ZY9A 3BRUA 3G1MA 2O7OA 3BTCA 3ZQHA 3VOXA 4YZEA 2B3WA 1JUPA 3HTIA 3BNIA 5IP6A 3BTLA 2FJI1 5D18A 2R7XA 2PFVA 3V78A 3IH4A 2VPRA 3QQAA 5FKKA 3C2BA 5CQGA 5FGLA 3EGQA 4GFKA 5F1JA
chains in the Genus database with same CATH topology
5IPAA 2HXIA 3LOCA 3O8HA 1JTXA 2XPUA 2ZCNA 5K58A 4M3BA 3CRJA 2HXOA 1A6IA 1T56A 2PZ9A 2UXHA 3BTIA 3HE0A 3VW1A 5FKNA 3HTAA 2ZOYA 3E7QA 3GZIA 1RKTA 5HSZA 2IU5A 2ZCXA 5C4YA 5FKOA 2NS7A 4X1EA 3G7RA 2OF7A 2XGCA 5CXIA 4DW6A 1ZKGA 1U9OA 1QPIA 1JT6A 2HYTA 2IEKA 3HGGA 2DG7A 4MO7A 3RD3A 2UXIA 2TCTA 3B81A 5FKLA 5CXGA 4AC6A 2GFNA 2XRLA 1Z0XA 3BR1A 2XB5A 4AC0A 3ANPA 5F08A 2FQ4A 3QPLA 3Q0UA 3Q0WA 2Y30A 3DEWA 5F04A 3TP0A 2HKUA 4JL3A 1RPWA 2ID3A 3FK7A 5EZHA 2GUHA 2RAEA 2XGDA 4XK4A 5EYRA 3VW0A 3VVZA 4JNNA 3BR5A 1QVTA 3BR6A 4L62A 2HYJA 2QCOA 1VI0A 2G7GA 2IAIA 3QKXA 2ZCMA 4NELA 2GBYA 4GCLA 2I10A 2W53A 5IOYA 2Q24A 1QVUA 4ABZA 2RASA 1ZK8A 4CGRA 2F07A 2UXOA 2FJ1A 3F1BA 3TP3A 3VUQA 3ON4A 2FBQA 3FRQA 5K7ZA 3BJBA 3B6AA 3DPJA 3G1LA 4V2FA 3HTJA 1SGMA 4M3EA 3BQZA 4MK6A 3MVPA 3MNLA 5IOZA 3IH3A 2G7SA 4HKUA 3B6CA 3PPBA 2V57A 1JUSA 3ZQGA 3PM1A 2DTZA 3BHQA 3IUVA 3LSJA 3VIBA 2NP5A 2PBXA 2VKVA 1Z77A 2XDNA 2WUIA 2NX4A 4I76A 3SFIA 3O8GA 4MXMA 3NXCA 3LHQA 4AF5A 4JYKA 1T33A 3JSJA 3DCFA 4G12A 2ID6A 2OI8A 4NN1A 2NS8A 5FMPA 2YVEA 1JTYA 4D7MA 2OERA 3VPRA 4M3FA 1BJZA 4M3DA 2G3BA 5HAWA 3AQSA 3ZQFA 4KWAA 4AUXA 5D19A 1U9NA 3ZQLA 5DAJA 3KKDA 2Y2ZA 3G1OA 5J3LA 2FD5A 2XPWA 3BQYA 4B1RA 4M3GA 3V6GA 1UI5A 3RH2A 3P9TA 3PASA 2Y31A 3S5RA 3NRGA 3Q0VA 2ZB9A 3G56A 3LWJA 2UXPA 3CWRA 4I6ZA 2ZOZA 3CDLA 4GCKA 3BTJA 5GP9A 3HIMA 3HGYA 2G7LA 2NP3A 2DG8A 3KZ9A 3QPSA 3ANGA 4D5CA 4V2GA 5F27A 2X6OA 3COLA 5D1RA 2WGBA 3NPIA 3QBMA 3SDGA 3LSRA 3WHCA 3ON2A 1RKWA 2TRTA 3Q3SA 3C07A 2FX0A 5H9TA 5FKMA 2X9DA 4ICHA 2QIBA 3BR3A 3FIWA 3LSPA 3BCGA 5CW8A 3KNWA 3IH2A 3VP5A 3F0CA 3T6NA 5F0FA 2RHAA 2IBDA 1JT0A 5J1RA 2UXUA 3WHBA 2VKEA 5K7FA 4W97A 2WV1A 4D5FA 3HTHA 2O7TA 2XGEA 4ACIA 2YVHA 5GPAA 5EZGA 5K7HA 2QKOA 2QWTA 3VVYA 5F0CA 2JJ7A 5HBUA 4GFLA 3BR2A 1UI6A 1ORKA 2OPTA 4D7NA 4ME9A 3EUPA 2D6YA 3GEUA 2JK3A 3KKCA 4UDSA 2REKA 3LJLA 2QTQA 5F0HA 3BT9A 3O60A 3VW2A 3FK6A 5J1YA 3CJDA 5J1UA 3NNRA 2EH3A 2GENA 3VVXA 3AQTA 5EFYA 4GCTA 2XPVA 4B3AA 3CCYA 4PXIA 5GPCA 5FHPA 3VOKA 1JUMA 2QOPA 3ZQIA 5AQCA 3BR0A 4W1UA 2HQ5A 4JKZA 3NI7A 2G0EA 3BRUA 3G1MA 2O7OA 3BTCA 3ZQHA 3VOXA 4YZEA 1JUPA 3HTIA 3BNIA 5IP6A 3BTLA 5D18A 3V78A 3IH4A 2VPRA 3QQAA 5FKKA 3C2BA 5FGLA 3EGQA 4GFKA 5F1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IPA A;  2HXI A;  3LOC A;  3O8H A;  1JTX A;  2XPU A;  2ZCN A;  5K58 A;  4M3B A;  3CRJ A;  2HXO A;  1A6I A;  1T56 A;  2PZ9 A;  2UXH A;  3BTI A;  3HE0 A;  3VW1 A;  5FKN A;  3HTA A;  2ZOY A;  3E7Q A;  3GZI A;  1RKT A;  5HSZ A;  2IU5 A;  2ZCX A;  5C4Y A;  5FKO A;  2NS7 A;  4X1E A;  3G7R A;  2OF7 A;  2XGC A;  5CXI A;  4DW6 A;  1ZKG A;  1U9O A;  1QPI A;  1JT6 A;  2HYT A;  2IEK A;  3HGG A;  2DG7 A;  4MO7 A;  3RD3 A;  2UXI A;  2TCT A;  3B81 A;  5FKL A;  5CXG A;  4AC6 A;  2GFN A;  2XRL A;  1Z0X A;  3BR1 A;  2XB5 A;  4AC0 A;  3ANP A;  5F08 A;  2FQ4 A;  3QPL A;  3Q0U A;  3Q0W A;  2Y30 A;  3DEW A;  5F04 A;  3TP0 A;  2HKU A;  4JL3 A;  1RPW A;  2ID3 A;  3FK7 A;  5EZH A;  2GUH A;  2RAE A;  2XGD A;  4XK4 A;  5EYR A;  3VW0 A;  3VVZ A;  4JNN A;  3BR5 A;  1QVT A;  3BR6 A;  4L62 A;  2HYJ A;  2QCO A;  1VI0 A;  2G7G A;  2IAI A;  3QKX A;  2ZCM A;  4NEL A;  2GBY A;  4GCL A;  2I10 A;  2W53 A;  5IOY A;  2Q24 A;  1QVU A;  4ABZ A;  2RAS A;  1ZK8 A;  4CGR A;  2F07 A;  2UXO A;  2FJ1 A;  3F1B A;  3TP3 A;  3VUQ A;  3ON4 A;  2FBQ A;  3FRQ A;  5K7Z A;  3BJB A;  3B6A A;  3DPJ A;  3G1L A;  4V2F A;  3HTJ A;  1SGM A;  4M3E A;  3BQZ A;  4MK6 A;  3MVP A;  3MNL A;  5IOZ A;  3IH3 A;  2G7S A;  4HKU A;  3B6C A;  3PPB A;  2V57 A;  1JUS A;  3ZQG A;  3PM1 A;  2DTZ A;  3BHQ A;  3IUV A;  3LSJ A;  3VIB A;  2NP5 A;  2PBX A;  2VKV A;  1Z77 A;  2XDN A;  2WUI A;  2NX4 A;  4I76 A;  3SFI A;  3O8G A;  4MXM A;  3NXC A;  3LHQ A;  4AF5 A;  4JYK A;  1T33 A;  3JSJ A;  3DCF A;  4G12 A;  2ID6 A;  2OI8 A;  4NN1 A;  2NS8 A;  5FMP A;  2YVE A;  1JTY A;  4D7M A;  2OER A;  3VPR A;  4M3F A;  1BJZ A;  4M3D A;  2G3B A;  5HAW A;  3AQS A;  3ZQF A;  4KWA A;  4AUX A;  5D19 A;  1U9N A;  3ZQL A;  5DAJ A;  3KKD A;  2Y2Z A;  3G1O A;  5J3L A;  2FD5 A;  2XPW A;  3BQY A;  4B1R A;  4M3G A;  3V6G A;  1UI5 A;  3RH2 A;  3P9T A;  3PAS A;  2Y31 A;  3S5R A;  3NRG A;  3Q0V A;  2ZB9 A;  3G56 A;  3LWJ A;  2UXP A;  3CWR A;  4I6Z A;  2ZOZ A;  3CDL A;  4GCK A;  3BTJ A;  5GP9 A;  3HIM A;  3HGY A;  2G7L A;  2NP3 A;  2DG8 A;  3KZ9 A;  3QPS A;  3ANG A;  4D5C A;  4V2G A;  5F27 A;  2X6O A;  3COL A;  5D1R A;  2WGB A;  3NPI A;  3QBM A;  3SDG A;  3LSR A;  3WHC A;  3ON2 A;  1RKW A;  2TRT A;  3Q3S A;  3C07 A;  2FX0 A;  5H9T A;  5FKM A;  2X9D A;  4ICH A;  2QIB A;  3BR3 A;  3FIW A;  3LSP A;  3BCG A;  5CW8 A;  3KNW A;  3IH2 A;  3VP5 A;  3F0C A;  3T6N A;  5F0F A;  2RHA A;  2IBD A;  1JT0 A;  5J1R A;  2UXU A;  3WHB A;  2VKE A;  5K7F A;  4W97 A;  2WV1 A;  4D5F A;  3HTH A;  2O7T A;  2XGE A;  4ACI A;  2YVH A;  5GPA A;  5EZG A;  5K7H A;  2QKO A;  2QWT A;  3VVY A;  5F0C A;  2JJ7 A;  5HBU A;  4GFL A;  3BR2 A;  1UI6 A;  1ORK A;  2OPT A;  4D7N A;  4ME9 A;  3EUP A;  2D6Y A;  3GEU A;  2JK3 A;  3KKC A;  4UDS A;  2REK A;  3LJL A;  2QTQ A;  5F0H A;  3BT9 A;  3O60 A;  3VW2 A;  3FK6 A;  5J1Y A;  3CJD A;  5J1U A;  3NNR A;  2EH3 A;  2GEN A;  3VVX A;  3AQT A;  5EFY A;  4GCT A;  2XPV A;  4B3A A;  3CCY A;  4PXI A;  5GPC A;  5FHP A;  3VOK A;  1JUM A;  2QOP A;  3ZQI A;  5AQC A;  3BR0 A;  4W1U A;  2HQ5 A;  4JKZ A;  3NI7 A;  2G0E A;  3BRU A;  3G1M A;  2O7O A;  3BTC A;  3ZQH A;  3VOX A;  4YZE A;  1JUP A;  3HTI A;  3BNI A;  5IP6 A;  3BTL A;  5D18 A;  3V78 A;  3IH4 A;  2VPR A;  3QQA A;  5FKK A;  3C2B A;  5FGL A;  3EGQ A;  4GFK A;  5F1J A; 
#chains in the Genus database with same CATH topology
 5IPA A;  2HXI A;  2A2F X;  3LOC A;  3O8H A;  1JTX A;  2XPU A;  2ZCN A;  5K58 A;  4WIB A;  4M3B A;  3CRJ A;  2HXO A;  1A6I A;  1T56 A;  2PZ9 A;  2UXH A;  3BTI A;  3HE0 A;  3VW1 A;  5FKN A;  3HTA A;  2ZOY A;  3E7Q A;  3GZI A;  1RKT A;  5HSZ A;  2IU5 A;  2ZCX A;  5C4Y A;  5FKO A;  2NS7 A;  4X1E A;  3VTI A;  3G7R A;  2OF7 A;  2XGC A;  5CXI A;  4DW6 A;  1ZKG A;  1U9O A;  1QPI A;  2R7V A;  1JT6 A;  2HYT A;  2IEK A;  3HGG A;  2DG7 A;  4MO7 A;  3RD3 A;  2B1E A;  2UXI A;  2TCT A;  3B81 A;  5FKL A;  5CXG A;  4AC6 A;  2GFN A;  2XRL A;  1Z0X A;  3BR1 A;  2XB5 A;  4AC0 A;  3ANP A;  5F08 A;  2FQ4 A;  3QPL A;  3Q0U A;  3Q0W A;  3DU5 A;  2Y30 A;  3DEW A;  5F04 A;  3TP0 A;  2HKU A;  4JL3 A;  2R7T A;  1RPW A;  2ID3 A;  3FK7 A;  5EZH A;  2R7W A;  2GUH A;  2RAE A;  2XGD A;  4XK4 A;  5EYR A;  3VW0 A;  3SWH A;  3VVZ A;  4JNN A;  3BR5 A;  1QVT A;  3BR6 A;  4L62 A;  2HYJ A;  2QCO A;  1VI0 A;  2G7G A;  2IAI A;  3QKX A;  2ZCM A;  3FHN A;  4NEL A;  2GBY A;  4GCL A;  2I10 A;  2W53 A;  5IOY A;  2Q24 A;  1QVU A;  4ABZ A;  2RAS A;  1ZK8 A;  4CGR A;  2F07 A;  2R7R A;  2UXO A;  2FJ1 A;  3F1B A;  3TP3 A;  3VUQ A;  3ON4 A;  2FBQ A;  3FRQ A;  5K7Z A;  3BJB A;  3B6A A;  3DPJ A;  3G1L A;  4V2F A;  3HTJ A;  1SGM A;  4M3E A;  3BQZ A;  4MK6 A;  3MVP A;  3MNL A;  5IOZ A;  3IH3 A;  2G7S A;  4HKU A;  3B6C A;  3PPB A;  2V57 A;  1JUS A;  3ZQG A;  3PM1 A;  2DTZ A;  3BHQ A;  3IUV A;  3LSJ A;  3VIB A;  2NP5 A;  2PBX A;  2VKV A;  1Z77 A;  2XDN A;  2WUI A;  2NX4 A;  4I76 A;  3SFI A;  3O8G A;  4OD4 A;  4MXM A;  3NXC A;  3LHQ A;  4AF5 A;  4JYK A;  1T33 A;  3JSJ A;  3DCF A;  4G12 A;  2ID6 A;  2OI8 A;  4NN1 A;  2NS8 A;  5FMP A;  2YVE A;  1JTY A;  4D7M A;  2OER A;  4OD5 A;  3VPR A;  4U9L A;  4M3F A;  1BJZ A;  4M3D A;  2G3B A;  5HAW A;  3AQS A;  3ZQF A;  4KWA A;  4AUX A;  5D19 A;  1U9N A;  3ZQL A;  5DAJ A;  3KKD A;  2Y2Z A;  3G1O A;  5J3L A;  2FD5 A;  2R7S A;  2XPW A;  3BQY A;  4B1R A;  4M3G A;  3K8P C;  3V6G A;  1UI5 A;  3RH2 A;  3P9T A;  3PAS A;  2Y31 A;  3S5R A;  3NRG A;  3DU6 A;  3Q0V A;  2ZB9 A;  3G56 A;  3LWJ A;  2UXP A;  3CWR A;  4I6Z A;  2ZOZ A;  3CDL A;  4GCK A;  3BTJ A;  5GP9 A;  3HIM A;  3HGY A;  2G7L A;  2NP3 A;  2DG8 A;  3KZ9 A;  3QPS A;  3ANG A;  4D5C A;  4V2G A;  5F27 A;  2X6O A;  3COL A;  3NS4 A;  5D1R A;  2WGB A;  3NPI A;  3QBM A;  3SDG A;  3LSR A;  4C2M A;  3WHC A;  4IRV A;  3ON2 A;  1RKW A;  2TRT A;  3Q3S A;  3C07 A;  2FX0 A;  5H9T A;  5FKM A;  2X9D A;  4ICH A;  2QIB A;  3BR3 A;  3FIW A;  2R7Q A;  3LSP A;  3BCG A;  5CW8 A;  3KNW A;  3IH2 A;  3VP5 A;  3F0C A;  3T6N A;  5F0F A;  2RHA A;  2R7O A;  2IBD A;  1JT0 A;  5J1R A;  2UXU A;  3WHB A;  2VKE A;  4DVY P;  5K7F A;  4W97 A;  2WV1 A;  4D5F A;  3HTH A;  2O7T A;  2XGE A;  4ACI A;  2YVH A;  5GPA A;  2YVX A;  5EZG A;  5K7H A;  2QKO A;  3KYL A;  2QWT A;  3VVY A;  5F0C A;  2JJ7 A;  5HBU A;  4GFL A;  3BR2 A;  1UI6 A;  1ORK A;  2OPT A;  4U9N A;  4D7N A;  4ME9 A;  3EUP A;  2D6Y A;  3GEU A;  2JK3 A;  3KKC A;  4UDS A;  2R7U A;  2REK A;  3LJL A;  2QTQ A;  5F0H A;  3BT9 A;  3O60 A;  3VW2 A;  3FK6 A;  5J1Y A;  3CJD A;  5J1U A;  3NNR A;  2EH3 A;  2GEN A;  3VVX A;  3AQT A;  5EFY A;  4GCT A;  2XPV A;  4B3A A;  3CCY A;  4PXI A;  5GPC A;  5FHP A;  3VOK A;  1JUM A;  2QOP A;  3ZQI A;  5AQC A;  3BR0 A;  4W1U A;  2HQ5 A;  4JKZ A;  3NI7 A;  2G0E A;  2ZY9 A;  3BRU A;  3G1M A;  2O7O A;  3BTC A;  3ZQH A;  3VOX A;  4YZE A;  2B3W A;  1JUP A;  3HTI A;  3BNI A;  5IP6 A;  3BTL A;  2FJI 1;  5D18 A;  2R7X A;  2PFV A;  3V78 A;  3IH4 A;  2VPR A;  3QQA A;  5FKK A;  3C2B A;  5CQG A;  5FGL A;  3EGQ A;  4GFK A;  5F1J A; 
#chains in the Genus database with same CATH homology
 5IPA A;  2HXI A;  3LOC A;  3O8H A;  1JTX A;  2XPU A;  2ZCN A;  5K58 A;  4M3B A;  3CRJ A;  2HXO A;  1A6I A;  1T56 A;  2PZ9 A;  2UXH A;  3BTI A;  3HE0 A;  3VW1 A;  5FKN A;  3HTA A;  2ZOY A;  3E7Q A;  3GZI A;  1RKT A;  5HSZ A;  2IU5 A;  2ZCX A;  5C4Y A;  5FKO A;  2NS7 A;  4X1E A;  3G7R A;  2OF7 A;  2XGC A;  5CXI A;  4DW6 A;  1ZKG A;  1U9O A;  1QPI A;  1JT6 A;  2HYT A;  2IEK A;  3HGG A;  2DG7 A;  4MO7 A;  3RD3 A;  2UXI A;  2TCT A;  3B81 A;  5FKL A;  5CXG A;  4AC6 A;  2GFN A;  2XRL A;  1Z0X A;  3BR1 A;  2XB5 A;  4AC0 A;  3ANP A;  5F08 A;  2FQ4 A;  3QPL A;  3Q0U A;  3Q0W A;  2Y30 A;  3DEW A;  5F04 A;  3TP0 A;  2HKU A;  4JL3 A;  1RPW A;  2ID3 A;  3FK7 A;  5EZH A;  2GUH A;  2RAE A;  2XGD A;  4XK4 A;  5EYR A;  3VW0 A;  3VVZ A;  4JNN A;  3BR5 A;  1QVT A;  3BR6 A;  4L62 A;  2HYJ A;  2QCO A;  1VI0 A;  2G7G A;  2IAI A;  3QKX A;  2ZCM A;  4NEL A;  2GBY A;  4GCL A;  2I10 A;  2W53 A;  5IOY A;  2Q24 A;  1QVU A;  4ABZ A;  2RAS A;  1ZK8 A;  4CGR A;  2F07 A;  2UXO A;  2FJ1 A;  3F1B A;  3TP3 A;  3VUQ A;  3ON4 A;  2FBQ A;  3FRQ A;  5K7Z A;  3BJB A;  3B6A A;  3DPJ A;  3G1L A;  4V2F A;  3HTJ A;  1SGM A;  4M3E A;  3BQZ A;  4MK6 A;  3MVP A;  3MNL A;  5IOZ A;  3IH3 A;  2G7S A;  4HKU A;  3B6C A;  3PPB A;  2V57 A;  1JUS A;  3ZQG A;  3PM1 A;  2DTZ A;  3BHQ A;  3IUV A;  3LSJ A;  3VIB A;  2NP5 A;  2PBX A;  2VKV A;  1Z77 A;  2XDN A;  2WUI A;  2NX4 A;  4I76 A;  3SFI A;  3O8G A;  4MXM A;  3NXC A;  3LHQ A;  4AF5 A;  4JYK A;  1T33 A;  3JSJ A;  3DCF A;  4G12 A;  2ID6 A;  2OI8 A;  4NN1 A;  2NS8 A;  5FMP A;  2YVE A;  1JTY A;  4D7M A;  2OER A;  3VPR A;  4M3F A;  1BJZ A;  4M3D A;  2G3B A;  5HAW A;  3AQS A;  3ZQF A;  4KWA A;  4AUX A;  5D19 A;  1U9N A;  3ZQL A;  5DAJ A;  3KKD A;  2Y2Z A;  3G1O A;  5J3L A;  2FD5 A;  2XPW A;  3BQY A;  4B1R A;  4M3G A;  3V6G A;  1UI5 A;  3RH2 A;  3P9T A;  3PAS A;  2Y31 A;  3S5R A;  3NRG A;  3Q0V A;  2ZB9 A;  3G56 A;  3LWJ A;  2UXP A;  3CWR A;  4I6Z A;  2ZOZ A;  3CDL A;  4GCK A;  3BTJ A;  5GP9 A;  3HIM A;  3HGY A;  2G7L A;  2NP3 A;  2DG8 A;  3KZ9 A;  3QPS A;  3ANG A;  4D5C A;  4V2G A;  5F27 A;  2X6O A;  3COL A;  5D1R A;  2WGB A;  3NPI A;  3QBM A;  3SDG A;  3LSR A;  3WHC A;  3ON2 A;  1RKW A;  2TRT A;  3Q3S A;  3C07 A;  2FX0 A;  5H9T A;  5FKM A;  2X9D A;  4ICH A;  2QIB A;  3BR3 A;  3FIW A;  3LSP A;  3BCG A;  5CW8 A;  3KNW A;  3IH2 A;  3VP5 A;  3F0C A;  3T6N A;  5F0F A;  2RHA A;  2IBD A;  1JT0 A;  5J1R A;  2UXU A;  3WHB A;  2VKE A;  5K7F A;  4W97 A;  2WV1 A;  4D5F A;  3HTH A;  2O7T A;  2XGE A;  4ACI A;  2YVH A;  5GPA A;  5EZG A;  5K7H A;  2QKO A;  2QWT A;  3VVY A;  5F0C A;  2JJ7 A;  5HBU A;  4GFL A;  3BR2 A;  1UI6 A;  1ORK A;  2OPT A;  4D7N A;  4ME9 A;  3EUP A;  2D6Y A;  3GEU A;  2JK3 A;  3KKC A;  4UDS A;  2REK A;  3LJL A;  2QTQ A;  5F0H A;  3BT9 A;  3O60 A;  3VW2 A;  3FK6 A;  5J1Y A;  3CJD A;  5J1U A;  3NNR A;  2EH3 A;  2GEN A;  3VVX A;  3AQT A;  5EFY A;  4GCT A;  2XPV A;  4B3A A;  3CCY A;  4PXI A;  5GPC A;  5FHP A;  3VOK A;  1JUM A;  2QOP A;  3ZQI A;  5AQC A;  3BR0 A;  4W1U A;  2HQ5 A;  4JKZ A;  3NI7 A;  2G0E A;  3BRU A;  3G1M A;  2O7O A;  3BTC A;  3ZQH A;  3VOX A;  4YZE A;  1JUP A;  3HTI A;  3BNI A;  5IP6 A;  3BTL A;  5D18 A;  3V78 A;  3IH4 A;  2VPR A;  3QQA A;  5FKK A;  3C2B A;  5FGL A;  3EGQ A;  4GFK A;  5F1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...