3LWJA

Crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
193
structure length
193
Chain Sequence
b'QNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNETLSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Transcription regulator
total genus 77
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3lwjA00
2YVHA 4JYKA 4M3EA 4MXMA 5F0CA 5J1YA 5EZHA 4V2FA 3V6GA 3VVXA 5AQCA 1JTXA 3ZQIA 2FBQA 3HIMA 3HTJA 3HGYA 2UXPA 2DTZA 3G1OA 5K7ZA 2HQ5A 2TRTA 3HTIA 3KNWA 2EH3A 3BJBA 2NP3A 2UXUA 2ZOZA 2QCOA 3B6CA 3BQYA 3RD3A 5EZGA 3HTHA 4L62A 2OPTA 2Q24A 2XPWA 2HXIA 2TCTA 3VOXA 1QPIA 2IAIA 2UXOA 5FGLA 3G7RA 2ZCNA 4M3BA 1RKWA 5F1JA 2QIBA 5HBUA 4I6ZA 1JT0A 3O8GA 4V2GA 3BR0A 3EGQA 1SGMA 4AC0A 3WHBA 3MNLA 4X1EA 3BTIA 1RPWA 1JT6A 4D5CA 3IUVA 1T33A 3C07A 3PM1A 3FRQA 4I76A 3IH4A 3FK7A 4GFKA 3C2BA 3HE0A 2PBXA 5K7HA 3G1LA 3WHCA 3S5RA 4NELA 1U9NA 3E7QA 1JUMA 5C4YA 4AC6A 3GZIA 2V57A 3G56A 4XK4A 3JSJA 1UI6A 2QOPA 4GFLA 5J1RA 2XGCA 2FJ1A 2RASA 2NP5A 4D7NA 3ON4A 4JKZA 3BTLA 2VKEA 3CDLA 4M3FA 3ON2A 3IH2A 3P9TA 5D18A 2ZOYA 4ACIA 3KZ9A 2OI8A 2JK3A 2RAEA 3DEWA 3BHQA 3LSJA 2G7SA 4M3GA 3VIBA 1ZK8A 2ZB9A 2X6OA 1VI0A 5FKMA 2Y30A 3O60A 3Q0WA 4ICHA 5F0FA 2ZCMA 3KKDA 4AUXA 4B3AA 5FKLA 4PXIA 2W53A 5FKKA 2GBYA 3RH2A 3CCYA 3ZQLA 3DPJA 2XPUA 3ZQGA 4GCTA 4NN1A 3VOKA 2DG8A 4UDSA 2X9DA 4GCLA 2VKVA 3FK6A 2G3BA 1JUSA 5FKOA 1QVUA 1QVTA 4MO7A 2FD5A 2WV1A 5FMPA 2HXOA 2IEKA 3BR5A 3BR1A 5DAJA 3NXCA 3F1BA 1ZKGA 3QQAA 3LWJA 2JJ7A 2QTQA 3VVZA 3KKCA 2IBDA 3LJLA 5F04A 3QPSA 1BJZA 3NPIA 4W97A 2FX0A 5K58A 1ORKA 3CWRA 3NI7A 5EFYA 3T6NA 2HYTA 2RHAA 3TP0A 2WGBA 5J1UA 4MK6A 3B81A 5GPAA 2NS8A 3AQTA 3VUQA 2GENA 2ID3A 3EUPA 2O7TA 3LOCA 3VW2A 3IH3A 2DG7A 4JNNA 3ANPA 2D6YA 5GP9A 5K7FA 3VP5A 4JL3A 3B6AA 2I10A 2UXIA 5J3LA 4KWAA 5CW8A 3NNRA 2GFNA 2Y31A 3SDGA 4ABZA 4W1UA 4B1RA 2XGDA 2NS7A 3LSRA 4CGRA 4D5FA 4D7MA 5EYRA 5H9TA 5HSZA 2PZ9A 3ZQHA 5F27A 3BR2A 3QBMA 3BNIA 4G12A 3ANGA 3HTAA 5F08A 5D1RA 3O8HA 1JTYA 3HGGA 2XB5A 1A6IA 2G0EA 2ID6A 3BTCA 2OERA 2REKA 1Z77A 2HKUA 3CJDA 4GCKA 5D19A 4HKUA 5IPAA 1JUPA 3PASA 3V78A 3LHQA 5IOYA 1UI5A 3QKXA 3BT9A 2UXHA 3LSPA 5HAWA 3FIWA 3VW1A 2FQ4A 3BRUA 2IU5A 3BQZA 3Q0VA 2NX4A 3GEUA 5IP6A 2QWTA 2VPRA 3QPLA 3DCFA 5IOZA 2XRLA 3F0CA 3BTJA 3ZQFA 3TP3A 4DW6A 3PPBA 3G1MA 1RKTA 3BR3A 2G7LA 5CXGA 5FKNA 2G7GA 2ZCXA 3BR6A 2Y2ZA 4YZEA 3VW0A 2YVEA 4AF5A 2O7OA 2OF7A 4ME9A 2XDNA 2XPVA 2F07A 5FHPA 2GUHA 2HYJA 3VPRA 2QKOA 3Q3SA 1T56A 3BCGA 3AQSA 3COLA 1U9OA 3SFIA 1Z0XA 3Q0UA 3MVPA 3NRGA 5F0HA 2XGEA 3CRJA 4M3DA 3VVYA 5CXIA 2WUIA 5GPCA
chains in the Genus database with same CATH superfamily
2YVHA 4JYKA 3DU5A 4M3EA 4MXMA 5F0CA 5J1YA 5EZHA 4V2FA 2R7QA 3V6GA 3VVXA 5AQCA 1JTXA 3ZQIA 2FBQA 3HIMA 3HTJA 3HGYA 2UXPA 2DTZA 4U9NA 3G1OA 5K7ZA 2HQ5A 2TRTA 3HTIA 3KNWA 2EH3A 3BJBA 2NP3A 2R7XA 2UXUA 2ZOZA 2QCOA 3B6CA 3BQYA 4U9LA 3RD3A 5EZGA 3HTHA 4L62A 2OPTA 2Q24A 2XPWA 2HXIA 3KYLA 2TCTA 3VOXA 1QPIA 2IAIA 2UXOA 5FGLA 3G7RA 2ZCNA 4M3BA 1RKWA 5F1JA 2QIBA 5HBUA 4I6ZA 1JT0A 3O8GA 4V2GA 3BR0A 2R7TA 3EGQA 2B1EA 1SGMA 4AC0A 3WHBA 3MNLA 4X1EA 3BTIA 1RPWA 1JT6A 4D5CA 3IUVA 1T33A 3C07A 3PM1A 3FRQA 4I76A 3IH4A 2R7UA 3FK7A 4GFKA 3C2BA 3HE0A 2PBXA 5K7HA 3G1LA 3WHCA 3S5RA 4NELA 1U9NA 3E7QA 1JUMA 5C4YA 4AC6A 2R7VA 3GZIA 2V57A 3G56A 4XK4A 3JSJA 1UI6A 2QOPA 4GFLA 5J1RA 2XGCA 2FJ1A 2RASA 2NP5A 4D7NA 3ON4A 4JKZA 3BTLA 2VKEA 3CDLA 4M3FA 3ON2A 3IH2A 3P9TA 5D18A 2ZOYA 4ACIA 3KZ9A 2OI8A 2PFVA 2JK3A 2RAEA 3DEWA 3BHQA 3LSJA 2G7SA 4M3GA 4C2MA 3VIBA 1ZK8A 2ZB9A 2X6OA 1VI0A 5FKMA 2Y30A 3O60A 3Q0WA 4ICHA 5F0FA 2ZCMA 3KKDA 4AUXA 4B3AA 5FKLA 4PXIA 2W53A 5FKKA 2GBYA 3RH2A 3CCYA 3ZQLA 3DPJA 2XPUA 3ZQGA 2ZY9A 4GCTA 4NN1A 3VOKA 2DG8A 4UDSA 2X9DA 4GCLA 2VKVA 3FK6A 2G3BA 1JUSA 5FKOA 1QVUA 1QVTA 4OD5A 4MO7A 2FD5A 2WV1A 5FMPA 2HXOA 2IEKA 3BR5A 3BR1A 5DAJA 3NXCA 3F1BA 1ZKGA 3QQAA 3LWJA 2JJ7A 2QTQA 3VVZA 3KKCA 2IBDA 3LJLA 5F04A 3QPSA 1BJZA 3NPIA 4W97A 2FX0A 5K58A 1ORKA 3CWRA 3NI7A 5EFYA 3T6NA 2HYTA 2RHAA 3TP0A 2WGBA 5J1UA 4MK6A 3B81A 3DU6A 5GPAA 2NS8A 3AQTA 2YVXA 3VUQA 2GENA 2R7RA 2ID3A 3EUPA 2O7TA 3LOCA 3VW2A 3IH3A 2DG7A 4JNNA 3ANPA 3VTIA 2D6YA 5GP9A 5K7FA 3VP5A 4JL3A 3B6AA 2I10A 2UXIA 5J3LA 4KWAA 5CW8A 3NNRA 2GFNA 2Y31A 3SDGA 4ABZA 4W1UA 4B1RA 2XGDA 2NS7A 3LSRA 4CGRA 4D5FA 4D7MA 5EYRA 5H9TA 4IRVA 3K8PC 5HSZA 2PZ9A 3ZQHA 5F27A 3BR2A 3QBMA 3NS4A 2A2FX 3BNIA 4G12A 3ANGA 3SWHA 3HTAA 5F08A 5D1RA 3O8HA 1JTYA 2B3WA 4OD4A 3HGGA 2R7OA 2XB5A 1A6IA 2G0EA 2ID6A 3BTCA 2OERA 2REKA 5CQGA 1Z77A 2HKUA 3CJDA 4GCKA 5D19A 4HKUA 5IPAA 1JUPA 3PASA 3V78A 3LHQA 5IOYA 1UI5A 3QKXA 3BT9A 2UXHA 3LSPA 5HAWA 3FIWA 3VW1A 2FQ4A 3BRUA 2IU5A 3BQZA 3Q0VA 2NX4A 3GEUA 5IP6A 2QWTA 2R7WA 2VPRA 3QPLA 3DCFA 5IOZA 2XRLA 3F0CA 3BTJA 3FHNA 3ZQFA 3TP3A 4DW6A 2FJI1 3PPBA 3G1MA 1RKTA 3BR3A 2G7LA 5CXGA 5FKNA 4WIBA 2G7GA 2ZCXA 3BR6A 2Y2ZA 4YZEA 3VW0A 2YVEA 4AF5A 2O7OA 2OF7A 4ME9A 2R7SA 2XDNA 2XPVA 2F07A 5FHPA 2GUHA 2HYJA 3VPRA 2QKOA 3Q3SA 1T56A 3BCGA 3AQSA 3COLA 1U9OA 3SFIA 1Z0XA 3Q0UA 3MVPA 3NRGA 4DVYP 5F0HA 2XGEA 3CRJA 4M3DA 3VVYA 5CXIA 2WUIA 5GPCA
chains in the Genus database with same CATH topology
2YVHA 4JYKA 4M3EA 4MXMA 5F0CA 5J1YA 5EZHA 4V2FA 3V6GA 3VVXA 5AQCA 1JTXA 3ZQIA 2FBQA 3HIMA 3HTJA 3HGYA 2UXPA 2DTZA 3G1OA 5K7ZA 2HQ5A 2TRTA 3HTIA 3KNWA 2EH3A 3BJBA 2NP3A 2UXUA 2ZOZA 2QCOA 3B6CA 3BQYA 3RD3A 5EZGA 3HTHA 4L62A 2OPTA 2Q24A 2XPWA 2HXIA 2TCTA 3VOXA 1QPIA 2IAIA 2UXOA 5FGLA 3G7RA 2ZCNA 4M3BA 1RKWA 5F1JA 2QIBA 5HBUA 4I6ZA 1JT0A 3O8GA 4V2GA 3BR0A 3EGQA 1SGMA 4AC0A 3WHBA 3MNLA 4X1EA 3BTIA 1RPWA 1JT6A 4D5CA 3IUVA 1T33A 3C07A 3PM1A 3FRQA 4I76A 3IH4A 3FK7A 4GFKA 3C2BA 3HE0A 2PBXA 5K7HA 3G1LA 3WHCA 3S5RA 4NELA 1U9NA 3E7QA 1JUMA 5C4YA 4AC6A 3GZIA 2V57A 3G56A 4XK4A 3JSJA 1UI6A 2QOPA 4GFLA 5J1RA 2XGCA 2FJ1A 2RASA 2NP5A 4D7NA 3ON4A 4JKZA 3BTLA 2VKEA 3CDLA 4M3FA 3ON2A 3IH2A 3P9TA 5D18A 2ZOYA 4ACIA 3KZ9A 2OI8A 2JK3A 2RAEA 3DEWA 3BHQA 3LSJA 2G7SA 4M3GA 3VIBA 1ZK8A 2ZB9A 2X6OA 1VI0A 5FKMA 2Y30A 3O60A 3Q0WA 4ICHA 5F0FA 2ZCMA 3KKDA 4AUXA 4B3AA 5FKLA 4PXIA 2W53A 5FKKA 2GBYA 3RH2A 3CCYA 3ZQLA 3DPJA 2XPUA 3ZQGA 4GCTA 4NN1A 3VOKA 2DG8A 4UDSA 2X9DA 4GCLA 2VKVA 3FK6A 2G3BA 1JUSA 5FKOA 1QVUA 1QVTA 4MO7A 2FD5A 2WV1A 5FMPA 2HXOA 2IEKA 3BR5A 3BR1A 5DAJA 3NXCA 3F1BA 1ZKGA 3QQAA 3LWJA 2JJ7A 2QTQA 3VVZA 3KKCA 2IBDA 3LJLA 5F04A 3QPSA 1BJZA 3NPIA 4W97A 2FX0A 5K58A 1ORKA 3CWRA 3NI7A 5EFYA 3T6NA 2HYTA 2RHAA 3TP0A 2WGBA 5J1UA 4MK6A 3B81A 5GPAA 2NS8A 3AQTA 3VUQA 2GENA 2ID3A 3EUPA 2O7TA 3LOCA 3VW2A 3IH3A 2DG7A 4JNNA 3ANPA 2D6YA 5GP9A 5K7FA 3VP5A 4JL3A 3B6AA 2I10A 2UXIA 5J3LA 4KWAA 5CW8A 3NNRA 2GFNA 2Y31A 3SDGA 4ABZA 4W1UA 4B1RA 2XGDA 2NS7A 3LSRA 4CGRA 4D5FA 4D7MA 5EYRA 5H9TA 5HSZA 2PZ9A 3ZQHA 5F27A 3BR2A 3QBMA 3BNIA 4G12A 3ANGA 3HTAA 5F08A 5D1RA 3O8HA 1JTYA 3HGGA 2XB5A 1A6IA 2G0EA 2ID6A 3BTCA 2OERA 2REKA 1Z77A 2HKUA 3CJDA 4GCKA 5D19A 4HKUA 5IPAA 1JUPA 3PASA 3V78A 3LHQA 5IOYA 1UI5A 3QKXA 3BT9A 2UXHA 3LSPA 5HAWA 3FIWA 3VW1A 2FQ4A 3BRUA 2IU5A 3BQZA 3Q0VA 2NX4A 3GEUA 5IP6A 2QWTA 2VPRA 3QPLA 3DCFA 5IOZA 2XRLA 3F0CA 3BTJA 3ZQFA 3TP3A 4DW6A 3PPBA 3G1MA 1RKTA 3BR3A 2G7LA 5CXGA 5FKNA 2G7GA 2ZCXA 3BR6A 2Y2ZA 4YZEA 3VW0A 2YVEA 4AF5A 2O7OA 2OF7A 4ME9A 2XDNA 2XPVA 2F07A 5FHPA 2GUHA 2HYJA 3VPRA 2QKOA 3Q3SA 1T56A 3BCGA 3AQSA 3COLA 1U9OA 3SFIA 1Z0XA 3Q0UA 3MVPA 3NRGA 5F0HA 2XGEA 3CRJA 4M3DA 3VVYA 5CXIA 2WUIA 5GPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVH A;  4JYK A;  4M3E A;  4MXM A;  5F0C A;  5J1Y A;  5EZH A;  4V2F A;  3V6G A;  3VVX A;  5AQC A;  1JTX A;  3ZQI A;  2FBQ A;  3HIM A;  3HTJ A;  3HGY A;  2UXP A;  2DTZ A;  3G1O A;  5K7Z A;  2HQ5 A;  2TRT A;  3HTI A;  3KNW A;  2EH3 A;  3BJB A;  2NP3 A;  2UXU A;  2ZOZ A;  2QCO A;  3B6C A;  3BQY A;  3RD3 A;  5EZG A;  3HTH A;  4L62 A;  2OPT A;  2Q24 A;  2XPW A;  2HXI A;  2TCT A;  3VOX A;  1QPI A;  2IAI A;  2UXO A;  5FGL A;  3G7R A;  2ZCN A;  4M3B A;  1RKW A;  5F1J A;  2QIB A;  5HBU A;  4I6Z A;  1JT0 A;  3O8G A;  4V2G A;  3BR0 A;  3EGQ A;  1SGM A;  4AC0 A;  3WHB A;  3MNL A;  4X1E A;  3BTI A;  1RPW A;  1JT6 A;  4D5C A;  3IUV A;  1T33 A;  3C07 A;  3PM1 A;  3FRQ A;  4I76 A;  3IH4 A;  3FK7 A;  4GFK A;  3C2B A;  3HE0 A;  2PBX A;  5K7H A;  3G1L A;  3WHC A;  3S5R A;  4NEL A;  1U9N A;  3E7Q A;  1JUM A;  5C4Y A;  4AC6 A;  3GZI A;  2V57 A;  3G56 A;  4XK4 A;  3JSJ A;  1UI6 A;  2QOP A;  4GFL A;  5J1R A;  2XGC A;  2FJ1 A;  2RAS A;  2NP5 A;  4D7N A;  3ON4 A;  4JKZ A;  3BTL A;  2VKE A;  3CDL A;  4M3F A;  3ON2 A;  3IH2 A;  3P9T A;  5D18 A;  2ZOY A;  4ACI A;  3KZ9 A;  2OI8 A;  2JK3 A;  2RAE A;  3DEW A;  3BHQ A;  3LSJ A;  2G7S A;  4M3G A;  3VIB A;  1ZK8 A;  2ZB9 A;  2X6O A;  1VI0 A;  5FKM A;  2Y30 A;  3O60 A;  3Q0W A;  4ICH A;  5F0F A;  2ZCM A;  3KKD A;  4AUX A;  4B3A A;  5FKL A;  4PXI A;  2W53 A;  5FKK A;  2GBY A;  3RH2 A;  3CCY A;  3ZQL A;  3DPJ A;  2XPU A;  3ZQG A;  4GCT A;  4NN1 A;  3VOK A;  2DG8 A;  4UDS A;  2X9D A;  4GCL A;  2VKV A;  3FK6 A;  2G3B A;  1JUS A;  5FKO A;  1QVU A;  1QVT A;  4MO7 A;  2FD5 A;  2WV1 A;  5FMP A;  2HXO A;  2IEK A;  3BR5 A;  3BR1 A;  5DAJ A;  3NXC A;  3F1B A;  1ZKG A;  3QQA A;  3LWJ A;  2JJ7 A;  2QTQ A;  3VVZ A;  3KKC A;  2IBD A;  3LJL A;  5F04 A;  3QPS A;  1BJZ A;  3NPI A;  4W97 A;  2FX0 A;  5K58 A;  1ORK A;  3CWR A;  3NI7 A;  5EFY A;  3T6N A;  2HYT A;  2RHA A;  3TP0 A;  2WGB A;  5J1U A;  4MK6 A;  3B81 A;  5GPA A;  2NS8 A;  3AQT A;  3VUQ A;  2GEN A;  2ID3 A;  3EUP A;  2O7T A;  3LOC A;  3VW2 A;  3IH3 A;  2DG7 A;  4JNN A;  3ANP A;  2D6Y A;  5GP9 A;  5K7F A;  3VP5 A;  4JL3 A;  3B6A A;  2I10 A;  2UXI A;  5J3L A;  4KWA A;  5CW8 A;  3NNR A;  2GFN A;  2Y31 A;  3SDG A;  4ABZ A;  4W1U A;  4B1R A;  2XGD A;  2NS7 A;  3LSR A;  4CGR A;  4D5F A;  4D7M A;  5EYR A;  5H9T A;  5HSZ A;  2PZ9 A;  3ZQH A;  5F27 A;  3BR2 A;  3QBM A;  3BNI A;  4G12 A;  3ANG A;  3HTA A;  5F08 A;  5D1R A;  3O8H A;  1JTY A;  3HGG A;  2XB5 A;  1A6I A;  2G0E A;  2ID6 A;  3BTC A;  2OER A;  2REK A;  1Z77 A;  2HKU A;  3CJD A;  4GCK A;  5D19 A;  4HKU A;  5IPA A;  1JUP A;  3PAS A;  3V78 A;  3LHQ A;  5IOY A;  1UI5 A;  3QKX A;  3BT9 A;  2UXH A;  3LSP A;  5HAW A;  3FIW A;  3VW1 A;  2FQ4 A;  3BRU A;  2IU5 A;  3BQZ A;  3Q0V A;  2NX4 A;  3GEU A;  5IP6 A;  2QWT A;  2VPR A;  3QPL A;  3DCF A;  5IOZ A;  2XRL A;  3F0C A;  3BTJ A;  3ZQF A;  3TP3 A;  4DW6 A;  3PPB A;  3G1M A;  1RKT A;  3BR3 A;  2G7L A;  5CXG A;  5FKN A;  2G7G A;  2ZCX A;  3BR6 A;  2Y2Z A;  4YZE A;  3VW0 A;  2YVE A;  4AF5 A;  2O7O A;  2OF7 A;  4ME9 A;  2XDN A;  2XPV A;  2F07 A;  5FHP A;  2GUH A;  2HYJ A;  3VPR A;  2QKO A;  3Q3S A;  1T56 A;  3BCG A;  3AQS A;  3COL A;  1U9O A;  3SFI A;  1Z0X A;  3Q0U A;  3MVP A;  3NRG A;  5F0H A;  2XGE A;  3CRJ A;  4M3D A;  3VVY A;  5CXI A;  2WUI A;  5GPC A; 
#chains in the Genus database with same CATH topology
 2YVH A;  4JYK A;  3DU5 A;  4M3E A;  4MXM A;  5F0C A;  5J1Y A;  5EZH A;  4V2F A;  2R7Q A;  3V6G A;  3VVX A;  5AQC A;  1JTX A;  3ZQI A;  2FBQ A;  3HIM A;  3HTJ A;  3HGY A;  2UXP A;  2DTZ A;  4U9N A;  3G1O A;  5K7Z A;  2HQ5 A;  2TRT A;  3HTI A;  3KNW A;  2EH3 A;  3BJB A;  2NP3 A;  2R7X A;  2UXU A;  2ZOZ A;  2QCO A;  3B6C A;  3BQY A;  4U9L A;  3RD3 A;  5EZG A;  3HTH A;  4L62 A;  2OPT A;  2Q24 A;  2XPW A;  2HXI A;  3KYL A;  2TCT A;  3VOX A;  1QPI A;  2IAI A;  2UXO A;  5FGL A;  3G7R A;  2ZCN A;  4M3B A;  1RKW A;  5F1J A;  2QIB A;  5HBU A;  4I6Z A;  1JT0 A;  3O8G A;  4V2G A;  3BR0 A;  2R7T A;  3EGQ A;  2B1E A;  1SGM A;  4AC0 A;  3WHB A;  3MNL A;  4X1E A;  3BTI A;  1RPW A;  1JT6 A;  4D5C A;  3IUV A;  1T33 A;  3C07 A;  3PM1 A;  3FRQ A;  4I76 A;  3IH4 A;  2R7U A;  3FK7 A;  4GFK A;  3C2B A;  3HE0 A;  2PBX A;  5K7H A;  3G1L A;  3WHC A;  3S5R A;  4NEL A;  1U9N A;  3E7Q A;  1JUM A;  5C4Y A;  4AC6 A;  2R7V A;  3GZI A;  2V57 A;  3G56 A;  4XK4 A;  3JSJ A;  1UI6 A;  2QOP A;  4GFL A;  5J1R A;  2XGC A;  2FJ1 A;  2RAS A;  2NP5 A;  4D7N A;  3ON4 A;  4JKZ A;  3BTL A;  2VKE A;  3CDL A;  4M3F A;  3ON2 A;  3IH2 A;  3P9T A;  5D18 A;  2ZOY A;  4ACI A;  3KZ9 A;  2OI8 A;  2PFV A;  2JK3 A;  2RAE A;  3DEW A;  3BHQ A;  3LSJ A;  2G7S A;  4M3G A;  4C2M A;  3VIB A;  1ZK8 A;  2ZB9 A;  2X6O A;  1VI0 A;  5FKM A;  2Y30 A;  3O60 A;  3Q0W A;  4ICH A;  5F0F A;  2ZCM A;  3KKD A;  4AUX A;  4B3A A;  5FKL A;  4PXI A;  2W53 A;  5FKK A;  2GBY A;  3RH2 A;  3CCY A;  3ZQL A;  3DPJ A;  2XPU A;  3ZQG A;  2ZY9 A;  4GCT A;  4NN1 A;  3VOK A;  2DG8 A;  4UDS A;  2X9D A;  4GCL A;  2VKV A;  3FK6 A;  2G3B A;  1JUS A;  5FKO A;  1QVU A;  1QVT A;  4OD5 A;  4MO7 A;  2FD5 A;  2WV1 A;  5FMP A;  2HXO A;  2IEK A;  3BR5 A;  3BR1 A;  5DAJ A;  3NXC A;  3F1B A;  1ZKG A;  3QQA A;  3LWJ A;  2JJ7 A;  2QTQ A;  3VVZ A;  3KKC A;  2IBD A;  3LJL A;  5F04 A;  3QPS A;  1BJZ A;  3NPI A;  4W97 A;  2FX0 A;  5K58 A;  1ORK A;  3CWR A;  3NI7 A;  5EFY A;  3T6N A;  2HYT A;  2RHA A;  3TP0 A;  2WGB A;  5J1U A;  4MK6 A;  3B81 A;  3DU6 A;  5GPA A;  2NS8 A;  3AQT A;  2YVX A;  3VUQ A;  2GEN A;  2R7R A;  2ID3 A;  3EUP A;  2O7T A;  3LOC A;  3VW2 A;  3IH3 A;  2DG7 A;  4JNN A;  3ANP A;  3VTI A;  2D6Y A;  5GP9 A;  5K7F A;  3VP5 A;  4JL3 A;  3B6A A;  2I10 A;  2UXI A;  5J3L A;  4KWA A;  5CW8 A;  3NNR A;  2GFN A;  2Y31 A;  3SDG A;  4ABZ A;  4W1U A;  4B1R A;  2XGD A;  2NS7 A;  3LSR A;  4CGR A;  4D5F A;  4D7M A;  5EYR A;  5H9T A;  4IRV A;  3K8P C;  5HSZ A;  2PZ9 A;  3ZQH A;  5F27 A;  3BR2 A;  3QBM A;  3NS4 A;  2A2F X;  3BNI A;  4G12 A;  3ANG A;  3SWH A;  3HTA A;  5F08 A;  5D1R A;  3O8H A;  1JTY A;  2B3W A;  4OD4 A;  3HGG A;  2R7O A;  2XB5 A;  1A6I A;  2G0E A;  2ID6 A;  3BTC A;  2OER A;  2REK A;  5CQG A;  1Z77 A;  2HKU A;  3CJD A;  4GCK A;  5D19 A;  4HKU A;  5IPA A;  1JUP A;  3PAS A;  3V78 A;  3LHQ A;  5IOY A;  1UI5 A;  3QKX A;  3BT9 A;  2UXH A;  3LSP A;  5HAW A;  3FIW A;  3VW1 A;  2FQ4 A;  3BRU A;  2IU5 A;  3BQZ A;  3Q0V A;  2NX4 A;  3GEU A;  5IP6 A;  2QWT A;  2R7W A;  2VPR A;  3QPL A;  3DCF A;  5IOZ A;  2XRL A;  3F0C A;  3BTJ A;  3FHN A;  3ZQF A;  3TP3 A;  4DW6 A;  2FJI 1;  3PPB A;  3G1M A;  1RKT A;  3BR3 A;  2G7L A;  5CXG A;  5FKN A;  4WIB A;  2G7G A;  2ZCX A;  3BR6 A;  2Y2Z A;  4YZE A;  3VW0 A;  2YVE A;  4AF5 A;  2O7O A;  2OF7 A;  4ME9 A;  2R7S A;  2XDN A;  2XPV A;  2F07 A;  5FHP A;  2GUH A;  2HYJ A;  3VPR A;  2QKO A;  3Q3S A;  1T56 A;  3BCG A;  3AQS A;  3COL A;  1U9O A;  3SFI A;  1Z0X A;  3Q0U A;  3MVP A;  3NRG A;  4DVY P;  5F0H A;  2XGE A;  3CRJ A;  4M3D A;  3VVY A;  5CXI A;  2WUI A;  5GPC A; 
#chains in the Genus database with same CATH homology
 2YVH A;  4JYK A;  4M3E A;  4MXM A;  5F0C A;  5J1Y A;  5EZH A;  4V2F A;  3V6G A;  3VVX A;  5AQC A;  1JTX A;  3ZQI A;  2FBQ A;  3HIM A;  3HTJ A;  3HGY A;  2UXP A;  2DTZ A;  3G1O A;  5K7Z A;  2HQ5 A;  2TRT A;  3HTI A;  3KNW A;  2EH3 A;  3BJB A;  2NP3 A;  2UXU A;  2ZOZ A;  2QCO A;  3B6C A;  3BQY A;  3RD3 A;  5EZG A;  3HTH A;  4L62 A;  2OPT A;  2Q24 A;  2XPW A;  2HXI A;  2TCT A;  3VOX A;  1QPI A;  2IAI A;  2UXO A;  5FGL A;  3G7R A;  2ZCN A;  4M3B A;  1RKW A;  5F1J A;  2QIB A;  5HBU A;  4I6Z A;  1JT0 A;  3O8G A;  4V2G A;  3BR0 A;  3EGQ A;  1SGM A;  4AC0 A;  3WHB A;  3MNL A;  4X1E A;  3BTI A;  1RPW A;  1JT6 A;  4D5C A;  3IUV A;  1T33 A;  3C07 A;  3PM1 A;  3FRQ A;  4I76 A;  3IH4 A;  3FK7 A;  4GFK A;  3C2B A;  3HE0 A;  2PBX A;  5K7H A;  3G1L A;  3WHC A;  3S5R A;  4NEL A;  1U9N A;  3E7Q A;  1JUM A;  5C4Y A;  4AC6 A;  3GZI A;  2V57 A;  3G56 A;  4XK4 A;  3JSJ A;  1UI6 A;  2QOP A;  4GFL A;  5J1R A;  2XGC A;  2FJ1 A;  2RAS A;  2NP5 A;  4D7N A;  3ON4 A;  4JKZ A;  3BTL A;  2VKE A;  3CDL A;  4M3F A;  3ON2 A;  3IH2 A;  3P9T A;  5D18 A;  2ZOY A;  4ACI A;  3KZ9 A;  2OI8 A;  2JK3 A;  2RAE A;  3DEW A;  3BHQ A;  3LSJ A;  2G7S A;  4M3G A;  3VIB A;  1ZK8 A;  2ZB9 A;  2X6O A;  1VI0 A;  5FKM A;  2Y30 A;  3O60 A;  3Q0W A;  4ICH A;  5F0F A;  2ZCM A;  3KKD A;  4AUX A;  4B3A A;  5FKL A;  4PXI A;  2W53 A;  5FKK A;  2GBY A;  3RH2 A;  3CCY A;  3ZQL A;  3DPJ A;  2XPU A;  3ZQG A;  4GCT A;  4NN1 A;  3VOK A;  2DG8 A;  4UDS A;  2X9D A;  4GCL A;  2VKV A;  3FK6 A;  2G3B A;  1JUS A;  5FKO A;  1QVU A;  1QVT A;  4MO7 A;  2FD5 A;  2WV1 A;  5FMP A;  2HXO A;  2IEK A;  3BR5 A;  3BR1 A;  5DAJ A;  3NXC A;  3F1B A;  1ZKG A;  3QQA A;  3LWJ A;  2JJ7 A;  2QTQ A;  3VVZ A;  3KKC A;  2IBD A;  3LJL A;  5F04 A;  3QPS A;  1BJZ A;  3NPI A;  4W97 A;  2FX0 A;  5K58 A;  1ORK A;  3CWR A;  3NI7 A;  5EFY A;  3T6N A;  2HYT A;  2RHA A;  3TP0 A;  2WGB A;  5J1U A;  4MK6 A;  3B81 A;  5GPA A;  2NS8 A;  3AQT A;  3VUQ A;  2GEN A;  2ID3 A;  3EUP A;  2O7T A;  3LOC A;  3VW2 A;  3IH3 A;  2DG7 A;  4JNN A;  3ANP A;  2D6Y A;  5GP9 A;  5K7F A;  3VP5 A;  4JL3 A;  3B6A A;  2I10 A;  2UXI A;  5J3L A;  4KWA A;  5CW8 A;  3NNR A;  2GFN A;  2Y31 A;  3SDG A;  4ABZ A;  4W1U A;  4B1R A;  2XGD A;  2NS7 A;  3LSR A;  4CGR A;  4D5F A;  4D7M A;  5EYR A;  5H9T A;  5HSZ A;  2PZ9 A;  3ZQH A;  5F27 A;  3BR2 A;  3QBM A;  3BNI A;  4G12 A;  3ANG A;  3HTA A;  5F08 A;  5D1R A;  3O8H A;  1JTY A;  3HGG A;  2XB5 A;  1A6I A;  2G0E A;  2ID6 A;  3BTC A;  2OER A;  2REK A;  1Z77 A;  2HKU A;  3CJD A;  4GCK A;  5D19 A;  4HKU A;  5IPA A;  1JUP A;  3PAS A;  3V78 A;  3LHQ A;  5IOY A;  1UI5 A;  3QKX A;  3BT9 A;  2UXH A;  3LSP A;  5HAW A;  3FIW A;  3VW1 A;  2FQ4 A;  3BRU A;  2IU5 A;  3BQZ A;  3Q0V A;  2NX4 A;  3GEU A;  5IP6 A;  2QWT A;  2VPR A;  3QPL A;  3DCF A;  5IOZ A;  2XRL A;  3F0C A;  3BTJ A;  3ZQF A;  3TP3 A;  4DW6 A;  3PPB A;  3G1M A;  1RKT A;  3BR3 A;  2G7L A;  5CXG A;  5FKN A;  2G7G A;  2ZCX A;  3BR6 A;  2Y2Z A;  4YZE A;  3VW0 A;  2YVE A;  4AF5 A;  2O7O A;  2OF7 A;  4ME9 A;  2XDN A;  2XPV A;  2F07 A;  5FHP A;  2GUH A;  2HYJ A;  3VPR A;  2QKO A;  3Q3S A;  1T56 A;  3BCG A;  3AQS A;  3COL A;  1U9O A;  3SFI A;  1Z0X A;  3Q0U A;  3MVP A;  3NRG A;  5F0H A;  2XGE A;  3CRJ A;  4M3D A;  3VVY A;  5CXI A;  2WUI A;  5GPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...