3LWJA

Crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
193
structure length
193
Chain Sequence
QNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNETLSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
molecule tags Transcription regulator
total genus 77
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3lwjA00
1ZKGA 3FRQA 3VP5A 2X6OA 4D7NA 4M3EA 2RHAA 3ANGA 3LWJA 4ACIA 3E7QA 3IUVA 5FKMA 2HKUA 1QPIA 1U9OA 5F04A 2GUHA 3LHQA 2G3BA 5D18A 2TRTA 2YVEA 2XGDA 3Q0UA 3BR0A 2Y2ZA 3HGGA 2QWTA 3SDGA 3FIWA 2XGEA 3B6AA 3BR5A 5EFYA 2XRLA 1UI5A 5F0CA 3KNWA 4W1UA 4V2FA 3BR2A 3MVPA 2QTQA 3NXCA 5F1JA 2JJ7A 3G1LA 2WGBA 2DTZA 2XPUA 3T6NA 3DCFA 2ID3A 4XK4A 2HYJA 4GCLA 5EYRA 2V57A 2UXUA 4M3FA 4M3BA 1U9NA 3G1OA 2UXIA 3IH4A 3IH2A 2JK3A 3QBMA 3TP3A 1SGMA 3AQTA 3PPBA 2Y30A 2REKA 3BR3A 3VW0A 2FBQA 5HAWA 3LSRA 3BJBA 4D5CA 2XDNA 2FJ1A 1ORKA 3HE0A 1JUSA 5K7ZA 2G7GA 3FK6A 3O60A 5GP9A 3CDLA 3MNLA 1Z0XA 2UXHA 4M3DA 2IBDA 5CXGA 3F1BA 3HGYA 2XGCA 5K7HA 2HQ5A 3V6GA 2XPVA 2ZOZA 4JNNA 2NX4A 1T33A 2XB5A 5J1RA 2ZB9A 4YZEA 3BR6A 3ZQGA 4I76A 3LSJA 2FQ4A 3G7RA 3F0CA 2HXIA 3ON2A 3VW2A 5D1RA 3VVYA 3GEUA 5FMPA 1ZK8A 3Q0WA 3ANPA 5F0FA 1JTYA 4V2GA 2RAEA 3KZ9A 2QIBA 5FKKA 3P9TA 3KKCA 3B81A 2ZOYA 4CGRA 2WUIA 3QPSA 4D7MA 2QOPA 3BQZA 4JL3A 2IEKA 2YVHA 5CW8A 4AUXA 3BRUA 3VIBA 2Y31A 4AC6A 4JKZA 2GENA 3DPJA 2OERA 5F08A 2VKEA 4AF5A 5GPCA 3CRJA 3AQSA 1RPWA 2XPWA 2VKVA 1JTXA 2TCTA 2G7LA 3HTIA 2PZ9A 3COLA 5FGLA 2ZCMA 1JT0A 2F07A 3GZIA 4B1RA 1RKWA 4ABZA 4W97A 3BTIA 4MK6A 4UDSA 5C4YA 2NS7A 1A6IA 1JT6A 4G12A 3BNIA 2EH3A 3Q0VA 1JUMA 3EUPA 3HTHA 3PM1A 5IP6A 5IPAA 3BR1A 3ZQIA 4X1EA 3BTCA 3KKDA 2G7SA 3FK7A 3QPLA 3JSJA 1QVUA 5CXIA 3VW1A 3ZQLA 2OI8A 3HIMA 3NNRA 5K7FA 3NI7A 3PASA 2O7OA 3BT9A 3VOXA 3BQYA 3EGQA 5IOZA 2W53A 3C07A 4NN1A 3B6CA 1T56A 1UI6A 1QVTA 5J1YA 3IH3A 3HTAA 3QKXA 5FKOA 2NP3A 3ZQHA 2Q24A 3G56A 3VOKA 2GFNA 1BJZA 3BCGA 2X9DA 3LOCA 5D19A 2WV1A 3NRGA 4I6ZA 1RKTA 3VVXA 2HYTA 4GCTA 4PXIA 5F27A 3BTLA 5J1UA 5DAJA 2QKOA 4AC0A 2VPRA 3S5RA 3LSPA 4L62A 5HBUA 2DG8A 5EZGA 2DG7A 3RH2A 4HKUA 3ON4A 2HXOA 3Q3SA 3CCYA 4GFKA 3WHCA 3VPRA 2FX0A 2ZCXA 2OPTA 4NELA 2UXOA 1VI0A 3HTJA 2ZCNA 3CJDA 4GCKA 4MXMA 3BHQA 2GBYA 4ICHA 5FKLA 3RD3A 1JUPA 3O8HA 3C2BA 2O7TA 4MO7A 1Z77A 2ID6A 3NPIA 2QCOA 5J3LA 4KWAA 2D6YA 2IU5A 5GPAA 2PBXA 2G0EA 3LJLA 3BTJA 3G1MA 3DEWA 2FD5A 4DW6A 5AQCA 4JYKA 4GFLA 3VUQA 2NP5A 5FKNA 5F0HA 5EZHA 4ME9A 2OF7A 3ZQFA 5H9TA 3VVZA 5K58A 3CWRA 5HSZA 2RASA 5FHPA 3V78A 4M3GA 2NS8A 2IAIA 3SFIA 2I10A 3TP0A 4D5FA 4B3AA 3QQAA 2UXPA 3WHBA 5IOYA 3O8GA
chains in the Genus database with same CATH superfamily
1ZKGA 3FRQA 3VP5A 2X6OA 4D7NA 4DVYP 4M3EA 2RHAA 3ANGA 3LWJA 4ACIA 3E7QA 3IUVA 5FKMA 2HKUA 1QPIA 1U9OA 5F04A 2GUHA 3LHQA 2G3BA 5D18A 3KYLA 2TRTA 2YVEA 2XGDA 3Q0UA 3BR0A 2Y2ZA 3HGGA 2QWTA 3SDGA 3FIWA 2XGEA 3B6AA 3BR5A 5EFYA 2XRLA 1UI5A 5F0CA 2R7WA 3KNWA 4W1UA 4V2FA 3BR2A 3MVPA 2QTQA 3NXCA 2R7UA 5F1JA 2JJ7A 3G1LA 2R7VA 2WGBA 2DTZA 2XPUA 3T6NA 3DCFA 2ID3A 4XK4A 2HYJA 4GCLA 5EYRA 2V57A 3NS4A 2UXUA 4M3FA 4M3BA 1U9NA 3G1OA 2UXIA 3IH4A 3IH2A 2JK3A 3QBMA 3TP3A 3FHNA 4U9LA 1SGMA 3AQTA 3PPBA 2Y30A 2REKA 3BR3A 3VW0A 2FBQA 5HAWA 3LSRA 3BJBA 4D5CA 2FJI1 2XDNA 2FJ1A 1ORKA 3HE0A 1JUSA 5K7ZA 2G7GA 3FK6A 3O60A 5GP9A 3CDLA 3MNLA 1Z0XA 2UXHA 4M3DA 2IBDA 5CXGA 3F1BA 3HGYA 2XGCA 5K7HA 2HQ5A 3V6GA 2XPVA 2ZOZA 4JNNA 2NX4A 1T33A 2XB5A 5J1RA 2ZB9A 4YZEA 3BR6A 3ZQGA 4I76A 3LSJA 4U9NA 2FQ4A 3G7RA 3F0CA 2HXIA 3ON2A 3K8PC 3VW2A 5D1RA 3VVYA 3GEUA 5FMPA 4WIBA 1ZK8A 3Q0WA 3ANPA 5F0FA 1JTYA 4V2GA 2B3WA 2RAEA 3KZ9A 2QIBA 5FKKA 5CQGA 3P9TA 3KKCA 3B81A 2ZOYA 2R7QA 4CGRA 2WUIA 3QPSA 3VTIA 4D7MA 2QOPA 3BQZA 4JL3A 2IEKA 2YVHA 5CW8A 4AUXA 3BRUA 3VIBA 2Y31A 4AC6A 4JKZA 2GENA 3DPJA 2OERA 5F08A 2VKEA 4AF5A 3DU6A 5GPCA 3CRJA 3AQSA 1RPWA 2XPWA 2VKVA 1JTXA 2TCTA 2G7LA 3HTIA 2PZ9A 3COLA 5FGLA 2ZCMA 1JT0A 2F07A 3GZIA 4B1RA 1RKWA 4ABZA 4W97A 3BTIA 4MK6A 4UDSA 2PFVA 5C4YA 2NS7A 1A6IA 1JT6A 4G12A 3BNIA 2EH3A 3Q0VA 1JUMA 3EUPA 3HTHA 3PM1A 5IP6A 5IPAA 3BR1A 2YVXA 3ZQIA 4X1EA 3BTCA 3KKDA 2G7SA 4OD5A 3FK7A 3QPLA 3JSJA 4OD4A 2B1EA 1QVUA 5CXIA 3VW1A 3ZQLA 2OI8A 3HIMA 3NNRA 5K7FA 3NI7A 3PASA 2O7OA 3BT9A 3VOXA 3BQYA 3EGQA 2R7OA 5IOZA 2W53A 3C07A 4NN1A 3B6CA 1T56A 1UI6A 2A2FX 1QVTA 5J1YA 3IH3A 3HTAA 2R7SA 3QKXA 5FKOA 2NP3A 3ZQHA 2Q24A 3G56A 3VOKA 2GFNA 1BJZA 3BCGA 2X9DA 3LOCA 5D19A 2WV1A 3NRGA 4I6ZA 4IRVA 2R7XA 1RKTA 3VVXA 2HYTA 4GCTA 4PXIA 5F27A 2R7RA 3BTLA 5J1UA 5DAJA 2QKOA 4AC0A 2VPRA 3S5RA 3LSPA 4L62A 5HBUA 2DG8A 5EZGA 2DG7A 3RH2A 4HKUA 3ON4A 2HXOA 3Q3SA 3CCYA 4GFKA 3WHCA 3VPRA 2FX0A 2ZCXA 2OPTA 4NELA 2UXOA 1VI0A 3HTJA 2ZCNA 4C2MA 3CJDA 4GCKA 4MXMA 3BHQA 2GBYA 4ICHA 5FKLA 3RD3A 1JUPA 3O8HA 3C2BA 3SWHA 2O7TA 4MO7A 1Z77A 2ID6A 3NPIA 2QCOA 5J3LA 4KWAA 2D6YA 2IU5A 5GPAA 2PBXA 2G0EA 3LJLA 3BTJA 3G1MA 3DEWA 2FD5A 4DW6A 5AQCA 4JYKA 4GFLA 3VUQA 2NP5A 5FKNA 5F0HA 2ZY9A 5EZHA 4ME9A 2OF7A 3ZQFA 5H9TA 3VVZA 5K58A 2R7TA 3CWRA 5HSZA 2RASA 5FHPA 3V78A 4M3GA 2NS8A 2IAIA 3SFIA 3DU5A 2I10A 3TP0A 4D5FA 4B3AA 3QQAA 2UXPA 3WHBA 5IOYA 3O8GA
chains in the Genus database with same CATH topology
1ZKGA 3FRQA 3VP5A 2X6OA 4D7NA 4M3EA 2RHAA 3ANGA 3LWJA 4ACIA 3E7QA 3IUVA 5FKMA 2HKUA 1QPIA 1U9OA 5F04A 2GUHA 3LHQA 2G3BA 5D18A 2TRTA 2YVEA 2XGDA 3Q0UA 3BR0A 2Y2ZA 3HGGA 2QWTA 3SDGA 3FIWA 2XGEA 3B6AA 3BR5A 5EFYA 2XRLA 1UI5A 5F0CA 3KNWA 4W1UA 4V2FA 3BR2A 3MVPA 2QTQA 3NXCA 5F1JA 2JJ7A 3G1LA 2WGBA 2DTZA 2XPUA 3T6NA 3DCFA 2ID3A 4XK4A 2HYJA 4GCLA 5EYRA 2V57A 2UXUA 4M3FA 4M3BA 1U9NA 3G1OA 2UXIA 3IH4A 3IH2A 2JK3A 3QBMA 3TP3A 1SGMA 3AQTA 3PPBA 2Y30A 2REKA 3BR3A 3VW0A 2FBQA 5HAWA 3LSRA 3BJBA 4D5CA 2XDNA 2FJ1A 1ORKA 3HE0A 1JUSA 5K7ZA 2G7GA 3FK6A 3O60A 5GP9A 3CDLA 3MNLA 1Z0XA 2UXHA 4M3DA 2IBDA 5CXGA 3F1BA 3HGYA 2XGCA 5K7HA 2HQ5A 3V6GA 2XPVA 2ZOZA 4JNNA 2NX4A 1T33A 2XB5A 5J1RA 2ZB9A 4YZEA 3BR6A 3ZQGA 4I76A 3LSJA 2FQ4A 3G7RA 3F0CA 2HXIA 3ON2A 3VW2A 5D1RA 3VVYA 3GEUA 5FMPA 1ZK8A 3Q0WA 3ANPA 5F0FA 1JTYA 4V2GA 2RAEA 3KZ9A 2QIBA 5FKKA 3P9TA 3KKCA 3B81A 2ZOYA 4CGRA 2WUIA 3QPSA 4D7MA 2QOPA 3BQZA 4JL3A 2IEKA 2YVHA 5CW8A 4AUXA 3BRUA 3VIBA 2Y31A 4AC6A 4JKZA 2GENA 3DPJA 2OERA 5F08A 2VKEA 4AF5A 5GPCA 3CRJA 3AQSA 1RPWA 2XPWA 2VKVA 1JTXA 2TCTA 2G7LA 3HTIA 2PZ9A 3COLA 5FGLA 2ZCMA 1JT0A 2F07A 3GZIA 4B1RA 1RKWA 4ABZA 4W97A 3BTIA 4MK6A 4UDSA 5C4YA 2NS7A 1A6IA 1JT6A 4G12A 3BNIA 2EH3A 3Q0VA 1JUMA 3EUPA 3HTHA 3PM1A 5IP6A 5IPAA 3BR1A 3ZQIA 4X1EA 3BTCA 3KKDA 2G7SA 3FK7A 3QPLA 3JSJA 1QVUA 5CXIA 3VW1A 3ZQLA 2OI8A 3HIMA 3NNRA 5K7FA 3NI7A 3PASA 2O7OA 3BT9A 3VOXA 3BQYA 3EGQA 5IOZA 2W53A 3C07A 4NN1A 3B6CA 1T56A 1UI6A 1QVTA 5J1YA 3IH3A 3HTAA 3QKXA 5FKOA 2NP3A 3ZQHA 2Q24A 3G56A 3VOKA 2GFNA 1BJZA 3BCGA 2X9DA 3LOCA 5D19A 2WV1A 3NRGA 4I6ZA 1RKTA 3VVXA 2HYTA 4GCTA 4PXIA 5F27A 3BTLA 5J1UA 5DAJA 2QKOA 4AC0A 2VPRA 3S5RA 3LSPA 4L62A 5HBUA 2DG8A 5EZGA 2DG7A 3RH2A 4HKUA 3ON4A 2HXOA 3Q3SA 3CCYA 4GFKA 3WHCA 3VPRA 2FX0A 2ZCXA 2OPTA 4NELA 2UXOA 1VI0A 3HTJA 2ZCNA 3CJDA 4GCKA 4MXMA 3BHQA 2GBYA 4ICHA 5FKLA 3RD3A 1JUPA 3O8HA 3C2BA 2O7TA 4MO7A 1Z77A 2ID6A 3NPIA 2QCOA 5J3LA 4KWAA 2D6YA 2IU5A 5GPAA 2PBXA 2G0EA 3LJLA 3BTJA 3G1MA 3DEWA 2FD5A 4DW6A 5AQCA 4JYKA 4GFLA 3VUQA 2NP5A 5FKNA 5F0HA 5EZHA 4ME9A 2OF7A 3ZQFA 5H9TA 3VVZA 5K58A 3CWRA 5HSZA 2RASA 5FHPA 3V78A 4M3GA 2NS8A 2IAIA 3SFIA 2I10A 3TP0A 4D5FA 4B3AA 3QQAA 2UXPA 3WHBA 5IOYA 3O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKG A;  3FRQ A;  3VP5 A;  2X6O A;  4D7N A;  4M3E A;  2RHA A;  3ANG A;  3LWJ A;  4ACI A;  3E7Q A;  3IUV A;  5FKM A;  2HKU A;  1QPI A;  1U9O A;  5F04 A;  2GUH A;  3LHQ A;  2G3B A;  5D18 A;  2TRT A;  2YVE A;  2XGD A;  3Q0U A;  3BR0 A;  2Y2Z A;  3HGG A;  2QWT A;  3SDG A;  3FIW A;  2XGE A;  3B6A A;  3BR5 A;  5EFY A;  2XRL A;  1UI5 A;  5F0C A;  3KNW A;  4W1U A;  4V2F A;  3BR2 A;  3MVP A;  2QTQ A;  3NXC A;  5F1J A;  2JJ7 A;  3G1L A;  2WGB A;  2DTZ A;  2XPU A;  3T6N A;  3DCF A;  2ID3 A;  4XK4 A;  2HYJ A;  4GCL A;  5EYR A;  2V57 A;  2UXU A;  4M3F A;  4M3B A;  1U9N A;  3G1O A;  2UXI A;  3IH4 A;  3IH2 A;  2JK3 A;  3QBM A;  3TP3 A;  1SGM A;  3AQT A;  3PPB A;  2Y30 A;  2REK A;  3BR3 A;  3VW0 A;  2FBQ A;  5HAW A;  3LSR A;  3BJB A;  4D5C A;  2XDN A;  2FJ1 A;  1ORK A;  3HE0 A;  1JUS A;  5K7Z A;  2G7G A;  3FK6 A;  3O60 A;  5GP9 A;  3CDL A;  3MNL A;  1Z0X A;  2UXH A;  4M3D A;  2IBD A;  5CXG A;  3F1B A;  3HGY A;  2XGC A;  5K7H A;  2HQ5 A;  3V6G A;  2XPV A;  2ZOZ A;  4JNN A;  2NX4 A;  1T33 A;  2XB5 A;  5J1R A;  2ZB9 A;  4YZE A;  3BR6 A;  3ZQG A;  4I76 A;  3LSJ A;  2FQ4 A;  3G7R A;  3F0C A;  2HXI A;  3ON2 A;  3VW2 A;  5D1R A;  3VVY A;  3GEU A;  5FMP A;  1ZK8 A;  3Q0W A;  3ANP A;  5F0F A;  1JTY A;  4V2G A;  2RAE A;  3KZ9 A;  2QIB A;  5FKK A;  3P9T A;  3KKC A;  3B81 A;  2ZOY A;  4CGR A;  2WUI A;  3QPS A;  4D7M A;  2QOP A;  3BQZ A;  4JL3 A;  2IEK A;  2YVH A;  5CW8 A;  4AUX A;  3BRU A;  3VIB A;  2Y31 A;  4AC6 A;  4JKZ A;  2GEN A;  3DPJ A;  2OER A;  5F08 A;  2VKE A;  4AF5 A;  5GPC A;  3CRJ A;  3AQS A;  1RPW A;  2XPW A;  2VKV A;  1JTX A;  2TCT A;  2G7L A;  3HTI A;  2PZ9 A;  3COL A;  5FGL A;  2ZCM A;  1JT0 A;  2F07 A;  3GZI A;  4B1R A;  1RKW A;  4ABZ A;  4W97 A;  3BTI A;  4MK6 A;  4UDS A;  5C4Y A;  2NS7 A;  1A6I A;  1JT6 A;  4G12 A;  3BNI A;  2EH3 A;  3Q0V A;  1JUM A;  3EUP A;  3HTH A;  3PM1 A;  5IP6 A;  5IPA A;  3BR1 A;  3ZQI A;  4X1E A;  3BTC A;  3KKD A;  2G7S A;  3FK7 A;  3QPL A;  3JSJ A;  1QVU A;  5CXI A;  3VW1 A;  3ZQL A;  2OI8 A;  3HIM A;  3NNR A;  5K7F A;  3NI7 A;  3PAS A;  2O7O A;  3BT9 A;  3VOX A;  3BQY A;  3EGQ A;  5IOZ A;  2W53 A;  3C07 A;  4NN1 A;  3B6C A;  1T56 A;  1UI6 A;  1QVT A;  5J1Y A;  3IH3 A;  3HTA A;  3QKX A;  5FKO A;  2NP3 A;  3ZQH A;  2Q24 A;  3G56 A;  3VOK A;  2GFN A;  1BJZ A;  3BCG A;  2X9D A;  3LOC A;  5D19 A;  2WV1 A;  3NRG A;  4I6Z A;  1RKT A;  3VVX A;  2HYT A;  4GCT A;  4PXI A;  5F27 A;  3BTL A;  5J1U A;  5DAJ A;  2QKO A;  4AC0 A;  2VPR A;  3S5R A;  3LSP A;  4L62 A;  5HBU A;  2DG8 A;  5EZG A;  2DG7 A;  3RH2 A;  4HKU A;  3ON4 A;  2HXO A;  3Q3S A;  3CCY A;  4GFK A;  3WHC A;  3VPR A;  2FX0 A;  2ZCX A;  2OPT A;  4NEL A;  2UXO A;  1VI0 A;  3HTJ A;  2ZCN A;  3CJD A;  4GCK A;  4MXM A;  3BHQ A;  2GBY A;  4ICH A;  5FKL A;  3RD3 A;  1JUP A;  3O8H A;  3C2B A;  2O7T A;  4MO7 A;  1Z77 A;  2ID6 A;  3NPI A;  2QCO A;  5J3L A;  4KWA A;  2D6Y A;  2IU5 A;  5GPA A;  2PBX A;  2G0E A;  3LJL A;  3BTJ A;  3G1M A;  3DEW A;  2FD5 A;  4DW6 A;  5AQC A;  4JYK A;  4GFL A;  3VUQ A;  2NP5 A;  5FKN A;  5F0H A;  5EZH A;  4ME9 A;  2OF7 A;  3ZQF A;  5H9T A;  3VVZ A;  5K58 A;  3CWR A;  5HSZ A;  2RAS A;  5FHP A;  3V78 A;  4M3G A;  2NS8 A;  2IAI A;  3SFI A;  2I10 A;  3TP0 A;  4D5F A;  4B3A A;  3QQA A;  2UXP A;  3WHB A;  5IOY A;  3O8G A; 
#chains in the Genus database with same CATH topology
 1ZKG A;  3FRQ A;  3VP5 A;  2X6O A;  4D7N A;  4DVY P;  4M3E A;  2RHA A;  3ANG A;  3LWJ A;  4ACI A;  3E7Q A;  3IUV A;  5FKM A;  2HKU A;  1QPI A;  1U9O A;  5F04 A;  2GUH A;  3LHQ A;  2G3B A;  5D18 A;  3KYL A;  2TRT A;  2YVE A;  2XGD A;  3Q0U A;  3BR0 A;  2Y2Z A;  3HGG A;  2QWT A;  3SDG A;  3FIW A;  2XGE A;  3B6A A;  3BR5 A;  5EFY A;  2XRL A;  1UI5 A;  5F0C A;  2R7W A;  3KNW A;  4W1U A;  4V2F A;  3BR2 A;  3MVP A;  2QTQ A;  3NXC A;  2R7U A;  5F1J A;  2JJ7 A;  3G1L A;  2R7V A;  2WGB A;  2DTZ A;  2XPU A;  3T6N A;  3DCF A;  2ID3 A;  4XK4 A;  2HYJ A;  4GCL A;  5EYR A;  2V57 A;  3NS4 A;  2UXU A;  4M3F A;  4M3B A;  1U9N A;  3G1O A;  2UXI A;  3IH4 A;  3IH2 A;  2JK3 A;  3QBM A;  3TP3 A;  3FHN A;  4U9L A;  1SGM A;  3AQT A;  3PPB A;  2Y30 A;  2REK A;  3BR3 A;  3VW0 A;  2FBQ A;  5HAW A;  3LSR A;  3BJB A;  4D5C A;  2FJI 1;  2XDN A;  2FJ1 A;  1ORK A;  3HE0 A;  1JUS A;  5K7Z A;  2G7G A;  3FK6 A;  3O60 A;  5GP9 A;  3CDL A;  3MNL A;  1Z0X A;  2UXH A;  4M3D A;  2IBD A;  5CXG A;  3F1B A;  3HGY A;  2XGC A;  5K7H A;  2HQ5 A;  3V6G A;  2XPV A;  2ZOZ A;  4JNN A;  2NX4 A;  1T33 A;  2XB5 A;  5J1R A;  2ZB9 A;  4YZE A;  3BR6 A;  3ZQG A;  4I76 A;  3LSJ A;  4U9N A;  2FQ4 A;  3G7R A;  3F0C A;  2HXI A;  3ON2 A;  3K8P C;  3VW2 A;  5D1R A;  3VVY A;  3GEU A;  5FMP A;  4WIB A;  1ZK8 A;  3Q0W A;  3ANP A;  5F0F A;  1JTY A;  4V2G A;  2B3W A;  2RAE A;  3KZ9 A;  2QIB A;  5FKK A;  5CQG A;  3P9T A;  3KKC A;  3B81 A;  2ZOY A;  2R7Q A;  4CGR A;  2WUI A;  3QPS A;  3VTI A;  4D7M A;  2QOP A;  3BQZ A;  4JL3 A;  2IEK A;  2YVH A;  5CW8 A;  4AUX A;  3BRU A;  3VIB A;  2Y31 A;  4AC6 A;  4JKZ A;  2GEN A;  3DPJ A;  2OER A;  5F08 A;  2VKE A;  4AF5 A;  3DU6 A;  5GPC A;  3CRJ A;  3AQS A;  1RPW A;  2XPW A;  2VKV A;  1JTX A;  2TCT A;  2G7L A;  3HTI A;  2PZ9 A;  3COL A;  5FGL A;  2ZCM A;  1JT0 A;  2F07 A;  3GZI A;  4B1R A;  1RKW A;  4ABZ A;  4W97 A;  3BTI A;  4MK6 A;  4UDS A;  2PFV A;  5C4Y A;  2NS7 A;  1A6I A;  1JT6 A;  4G12 A;  3BNI A;  2EH3 A;  3Q0V A;  1JUM A;  3EUP A;  3HTH A;  3PM1 A;  5IP6 A;  5IPA A;  3BR1 A;  2YVX A;  3ZQI A;  4X1E A;  3BTC A;  3KKD A;  2G7S A;  4OD5 A;  3FK7 A;  3QPL A;  3JSJ A;  4OD4 A;  2B1E A;  1QVU A;  5CXI A;  3VW1 A;  3ZQL A;  2OI8 A;  3HIM A;  3NNR A;  5K7F A;  3NI7 A;  3PAS A;  2O7O A;  3BT9 A;  3VOX A;  3BQY A;  3EGQ A;  2R7O A;  5IOZ A;  2W53 A;  3C07 A;  4NN1 A;  3B6C A;  1T56 A;  1UI6 A;  2A2F X;  1QVT A;  5J1Y A;  3IH3 A;  3HTA A;  2R7S A;  3QKX A;  5FKO A;  2NP3 A;  3ZQH A;  2Q24 A;  3G56 A;  3VOK A;  2GFN A;  1BJZ A;  3BCG A;  2X9D A;  3LOC A;  5D19 A;  2WV1 A;  3NRG A;  4I6Z A;  4IRV A;  2R7X A;  1RKT A;  3VVX A;  2HYT A;  4GCT A;  4PXI A;  5F27 A;  2R7R A;  3BTL A;  5J1U A;  5DAJ A;  2QKO A;  4AC0 A;  2VPR A;  3S5R A;  3LSP A;  4L62 A;  5HBU A;  2DG8 A;  5EZG A;  2DG7 A;  3RH2 A;  4HKU A;  3ON4 A;  2HXO A;  3Q3S A;  3CCY A;  4GFK A;  3WHC A;  3VPR A;  2FX0 A;  2ZCX A;  2OPT A;  4NEL A;  2UXO A;  1VI0 A;  3HTJ A;  2ZCN A;  4C2M A;  3CJD A;  4GCK A;  4MXM A;  3BHQ A;  2GBY A;  4ICH A;  5FKL A;  3RD3 A;  1JUP A;  3O8H A;  3C2B A;  3SWH A;  2O7T A;  4MO7 A;  1Z77 A;  2ID6 A;  3NPI A;  2QCO A;  5J3L A;  4KWA A;  2D6Y A;  2IU5 A;  5GPA A;  2PBX A;  2G0E A;  3LJL A;  3BTJ A;  3G1M A;  3DEW A;  2FD5 A;  4DW6 A;  5AQC A;  4JYK A;  4GFL A;  3VUQ A;  2NP5 A;  5FKN A;  5F0H A;  2ZY9 A;  5EZH A;  4ME9 A;  2OF7 A;  3ZQF A;  5H9T A;  3VVZ A;  5K58 A;  2R7T A;  3CWR A;  5HSZ A;  2RAS A;  5FHP A;  3V78 A;  4M3G A;  2NS8 A;  2IAI A;  3SFI A;  3DU5 A;  2I10 A;  3TP0 A;  4D5F A;  4B3A A;  3QQA A;  2UXP A;  3WHB A;  5IOY A;  3O8G A; 
#chains in the Genus database with same CATH homology
 1ZKG A;  3FRQ A;  3VP5 A;  2X6O A;  4D7N A;  4M3E A;  2RHA A;  3ANG A;  3LWJ A;  4ACI A;  3E7Q A;  3IUV A;  5FKM A;  2HKU A;  1QPI A;  1U9O A;  5F04 A;  2GUH A;  3LHQ A;  2G3B A;  5D18 A;  2TRT A;  2YVE A;  2XGD A;  3Q0U A;  3BR0 A;  2Y2Z A;  3HGG A;  2QWT A;  3SDG A;  3FIW A;  2XGE A;  3B6A A;  3BR5 A;  5EFY A;  2XRL A;  1UI5 A;  5F0C A;  3KNW A;  4W1U A;  4V2F A;  3BR2 A;  3MVP A;  2QTQ A;  3NXC A;  5F1J A;  2JJ7 A;  3G1L A;  2WGB A;  2DTZ A;  2XPU A;  3T6N A;  3DCF A;  2ID3 A;  4XK4 A;  2HYJ A;  4GCL A;  5EYR A;  2V57 A;  2UXU A;  4M3F A;  4M3B A;  1U9N A;  3G1O A;  2UXI A;  3IH4 A;  3IH2 A;  2JK3 A;  3QBM A;  3TP3 A;  1SGM A;  3AQT A;  3PPB A;  2Y30 A;  2REK A;  3BR3 A;  3VW0 A;  2FBQ A;  5HAW A;  3LSR A;  3BJB A;  4D5C A;  2XDN A;  2FJ1 A;  1ORK A;  3HE0 A;  1JUS A;  5K7Z A;  2G7G A;  3FK6 A;  3O60 A;  5GP9 A;  3CDL A;  3MNL A;  1Z0X A;  2UXH A;  4M3D A;  2IBD A;  5CXG A;  3F1B A;  3HGY A;  2XGC A;  5K7H A;  2HQ5 A;  3V6G A;  2XPV A;  2ZOZ A;  4JNN A;  2NX4 A;  1T33 A;  2XB5 A;  5J1R A;  2ZB9 A;  4YZE A;  3BR6 A;  3ZQG A;  4I76 A;  3LSJ A;  2FQ4 A;  3G7R A;  3F0C A;  2HXI A;  3ON2 A;  3VW2 A;  5D1R A;  3VVY A;  3GEU A;  5FMP A;  1ZK8 A;  3Q0W A;  3ANP A;  5F0F A;  1JTY A;  4V2G A;  2RAE A;  3KZ9 A;  2QIB A;  5FKK A;  3P9T A;  3KKC A;  3B81 A;  2ZOY A;  4CGR A;  2WUI A;  3QPS A;  4D7M A;  2QOP A;  3BQZ A;  4JL3 A;  2IEK A;  2YVH A;  5CW8 A;  4AUX A;  3BRU A;  3VIB A;  2Y31 A;  4AC6 A;  4JKZ A;  2GEN A;  3DPJ A;  2OER A;  5F08 A;  2VKE A;  4AF5 A;  5GPC A;  3CRJ A;  3AQS A;  1RPW A;  2XPW A;  2VKV A;  1JTX A;  2TCT A;  2G7L A;  3HTI A;  2PZ9 A;  3COL A;  5FGL A;  2ZCM A;  1JT0 A;  2F07 A;  3GZI A;  4B1R A;  1RKW A;  4ABZ A;  4W97 A;  3BTI A;  4MK6 A;  4UDS A;  5C4Y A;  2NS7 A;  1A6I A;  1JT6 A;  4G12 A;  3BNI A;  2EH3 A;  3Q0V A;  1JUM A;  3EUP A;  3HTH A;  3PM1 A;  5IP6 A;  5IPA A;  3BR1 A;  3ZQI A;  4X1E A;  3BTC A;  3KKD A;  2G7S A;  3FK7 A;  3QPL A;  3JSJ A;  1QVU A;  5CXI A;  3VW1 A;  3ZQL A;  2OI8 A;  3HIM A;  3NNR A;  5K7F A;  3NI7 A;  3PAS A;  2O7O A;  3BT9 A;  3VOX A;  3BQY A;  3EGQ A;  5IOZ A;  2W53 A;  3C07 A;  4NN1 A;  3B6C A;  1T56 A;  1UI6 A;  1QVT A;  5J1Y A;  3IH3 A;  3HTA A;  3QKX A;  5FKO A;  2NP3 A;  3ZQH A;  2Q24 A;  3G56 A;  3VOK A;  2GFN A;  1BJZ A;  3BCG A;  2X9D A;  3LOC A;  5D19 A;  2WV1 A;  3NRG A;  4I6Z A;  1RKT A;  3VVX A;  2HYT A;  4GCT A;  4PXI A;  5F27 A;  3BTL A;  5J1U A;  5DAJ A;  2QKO A;  4AC0 A;  2VPR A;  3S5R A;  3LSP A;  4L62 A;  5HBU A;  2DG8 A;  5EZG A;  2DG7 A;  3RH2 A;  4HKU A;  3ON4 A;  2HXO A;  3Q3S A;  3CCY A;  4GFK A;  3WHC A;  3VPR A;  2FX0 A;  2ZCX A;  2OPT A;  4NEL A;  2UXO A;  1VI0 A;  3HTJ A;  2ZCN A;  3CJD A;  4GCK A;  4MXM A;  3BHQ A;  2GBY A;  4ICH A;  5FKL A;  3RD3 A;  1JUP A;  3O8H A;  3C2B A;  2O7T A;  4MO7 A;  1Z77 A;  2ID6 A;  3NPI A;  2QCO A;  5J3L A;  4KWA A;  2D6Y A;  2IU5 A;  5GPA A;  2PBX A;  2G0E A;  3LJL A;  3BTJ A;  3G1M A;  3DEW A;  2FD5 A;  4DW6 A;  5AQC A;  4JYK A;  4GFL A;  3VUQ A;  2NP5 A;  5FKN A;  5F0H A;  5EZH A;  4ME9 A;  2OF7 A;  3ZQF A;  5H9T A;  3VVZ A;  5K58 A;  3CWR A;  5HSZ A;  2RAS A;  5FHP A;  3V78 A;  4M3G A;  2NS8 A;  2IAI A;  3SFI A;  2I10 A;  3TP0 A;  4D5F A;  4B3A A;  3QQA A;  2UXP A;  3WHB A;  5IOY A;  3O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...