3LWJA

Crystal structure of putative tetr-family transcriptional regulator (yp_752756.1) from syntrophomonas wolfei str. goettingen at 2.07 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
193
structure length
193
Chain Sequence
QNKERRQKILTCSLDLFIEKGYYNTSIRDIIALSEVGTGTFYNYFVDKEDILKNLLEDFAKQIISSISEYYLVEKDLYERFIETKRLTMEVFAQNETLSEIYSRVAGSSAPIDQCLKQFEDRLLEFYSRNIEYGIKKGVFKNVPVSPIAHSILAIEKFSLYKWVVLKAITKEEMIEMVLSFHKTLAVGLLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative TetR-family transcriptional regulator
publication title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution
rcsb
source organism Syntrophomonas wolfei subsp. wolfei
total genus 77
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3lwjA00
1RPWA 4V2FA 2X6OA 3V78A 4AUXA 3FRQA 3P9TA 5FKNA 5K7FA 3BHQA 2PZ9A 5GP9A 3CDLA 3BR0A 3O8GA 3COLA 2WUIA 3QBMA 2G7LA 4ABZA 2OPTA 5C4YA 2NP3A 3BR1A 3G1MA 5HBUA 4GFKA 1SGMA 2HYJA 5K7ZA 4M3FA 3ZQHA 3NI7A 5H9TA 2FJ1A 3LSRA 3KKCA 2DTZA 3IUVA 3FIWA 3EGQA 5CW8A 2REKA 2X9DA 2XGEA 3BR5A 3IH3A 4ME9A 3ANGA 2OERA 5IPAA 2EH3A 3PASA 4AF5A 4NN1A 3HTIA 2YVEA 3QPSA 5IOYA 3B6CA 2FBQA 3VVZA 1U9OA 2UXOA 3SDGA 1UI6A 3PPBA 4W1UA 5K58A 3HGYA 3Q0WA 5CXGA 2WV1A 2DG7A 3NRGA 3NNRA 3BRUA 3ON2A 3KNWA 2G7SA 2FX0A 4PXIA 1JUSA 1JUPA 2HXIA 1ZKGA 3VW1A 3F0CA 3BJBA 4L62A 4CGRA 4KWAA 5DAJA 4JL3A 5IP6A 3IH4A 4X1EA 4D5CA 2HXOA 2V57A 5F0CA 3ANPA 4GCTA 2HKUA 3CJDA 1JUMA 3C07A 2G3BA 3Q0VA 4ACIA 1JTYA 5FGLA 1ORKA 1U9NA 3C2BA 2OF7A 4DW6A 2QKOA 2D6YA 3AQSA 2GBYA 5J1RA 3BQZA 3B6AA 4JNNA 5D18A 3KKDA 3GZIA 1JT0A 3LOCA 3E7QA 2QTQA 5F27A 3ZQIA 3IH2A 2Y30A 4NELA 3HGGA 5J1UA 2XGDA 3DPJA 4AC0A 2RASA 3LHQA 3NPIA 5F1JA 2VPRA 4MXMA 2HQ5A 2XB5A 5D19A 3GEUA 3FK7A 2G0EA 2QWTA 3F1BA 5GPCA 2NS8A 5GPAA 5F0FA 4W97A 3BTLA 1VI0A 1QPIA 3LJLA 3HTJA 3NXCA 3EUPA 3LWJA 2QCOA 1Z77A 2XDNA 5FKOA 3QPLA 3BNIA 3O60A 3HTAA 4JYKA 3G56A 3SFIA 2YVHA 2TRTA 3HE0A 3V6GA 3RD3A 2GUHA 3DEWA 5F0HA 3WHCA 2NP5A 2ZCMA 2UXIA 3VOKA 3BTCA 2ZCXA 4I6ZA 2ZCNA 5EYRA 3VVXA 4GCLA 1RKTA 3AQTA 3BQYA 4B3AA 2QIBA 2QOPA 3S5RA 4UDSA 3RH2A 2HYTA 2WGBA 2UXUA 5EZGA 2XGCA 5F04A 4D7NA 2IBDA 2XPWA 5FKKA 4V2GA 2UXPA 3Q3SA 4GFLA 4G12A 3PM1A 2IU5A 3G7RA 3TP3A 3CWRA 5IOZA 2IEKA 3ZQGA 3VP5A 4GCKA 2NS7A 3BCGA 4D7MA 3DCFA 3JSJA 3O8HA 2FD5A 1T33A 2ID6A 5D1RA 3B81A 2Y31A 2XPUA 4XK4A 1A6IA 5FKLA 3WHBA 4B1RA 5FMPA 3QKXA 3TP0A 2I10A 2VKEA 4MK6A 2O7OA 3BR6A 4HKUA 2TCTA 3VW0A 5HSZA 3G1LA 2XPVA 4M3DA 2W53A 4M3BA 1BJZA 3CRJA 3QQAA 3VPRA 3BTJA 2O7TA 2ZOYA 4ICHA 4AC6A 3T6NA 2GFNA 3BR3A 3BT9A 3Q0UA 3VW2A 5FKMA 5FHPA 2JK3A 2Y2ZA 1JT6A 3VUQA 5J3LA 1ZK8A 5J1YA 3ON4A 2FQ4A 2PBXA 5HAWA 4I76A 1T56A 2RAEA 2ZOZA 2ID3A 2OI8A 2XRLA 2F07A 1QVTA 3HIMA 2UXHA 1UI5A 3KZ9A 5CXIA 3MVPA 2Q24A 2RHAA 2VKVA 4M3GA 2GENA 2JJ7A 1JTXA 1Z0XA 3ZQFA 2G7GA 5EZHA 3LSPA 3BTIA 3VIBA 3VVYA 5F08A 1RKWA 2IAIA 3VOXA 4D5FA 3HTHA 4MO7A 1QVUA 2NX4A 3G1OA 5AQCA 5K7HA 4M3EA 3ZQLA 3CCYA 5EFYA 2ZB9A 4YZEA 3MNLA 3FK6A 3BR2A 4JKZA 2DG8A 3LSJA
chains in the Genus database with same CATH superfamily
1RPWA 4V2FA 2X6OA 3V78A 4AUXA 3FRQA 4C2MA 3P9TA 5FKNA 5K7FA 3BHQA 2PZ9A 5GP9A 3CDLA 3BR0A 3O8GA 3COLA 2WUIA 3QBMA 2G7LA 4ABZA 2OPTA 5C4YA 2NP3A 3BR1A 3G1MA 5HBUA 4GFKA 4OD4A 1SGMA 2HYJA 5K7ZA 4M3FA 3ZQHA 3NI7A 5H9TA 2FJ1A 4OD5A 3LSRA 3KKCA 2DTZA 3IUVA 3FIWA 3EGQA 5CW8A 2REKA 2X9DA 2XGEA 3BR5A 3IH3A 4ME9A 3ANGA 3VTIA 2OERA 2R7VA 5IPAA 2EH3A 3PASA 4AF5A 4NN1A 3HTIA 2YVEA 3QPSA 5IOYA 3K8PC 3B6CA 2FBQA 3VVZA 1U9OA 2UXOA 3SDGA 1UI6A 3PPBA 4W1UA 5K58A 3HGYA 3Q0WA 5CXGA 2WV1A 2DG7A 3NRGA 3NNRA 4U9LA 3BRUA 3ON2A 3KNWA 2G7SA 2FX0A 4PXIA 1JUSA 1JUPA 2YVXA 4U9NA 2HXIA 1ZKGA 3VW1A 3F0CA 3BJBA 4L62A 4CGRA 2R7XA 4KWAA 5DAJA 4JL3A 5IP6A 3IH4A 4X1EA 4D5CA 2HXOA 2V57A 5F0CA 3ANPA 4GCTA 2HKUA 3CJDA 1JUMA 3C07A 4IRVA 2G3BA 3Q0VA 2R7OA 4ACIA 1JTYA 5FGLA 1ORKA 1U9NA 3SWHA 3C2BA 2OF7A 4DW6A 2QKOA 2D6YA 3AQSA 2GBYA 5J1RA 3BQZA 3B6AA 4JNNA 5D18A 3KKDA 4WIBA 3GZIA 1JT0A 2ZY9A 3LOCA 3E7QA 2QTQA 5F27A 3ZQIA 3IH2A 2Y30A 4NELA 3HGGA 5J1UA 2XGDA 3DPJA 4AC0A 2RASA 3LHQA 3NPIA 5F1JA 2VPRA 3NS4A 4MXMA 5D19A 2HQ5A 2XB5A 3GEUA 3FK7A 2B1EA 2G0EA 2QWTA 3F1BA 5GPCA 2NS8A 5GPAA 5F0FA 4W97A 3BTLA 1VI0A 1QPIA 2R7UA 3LJLA 3HTJA 3NXCA 3EUPA 3LWJA 2QCOA 1Z77A 2XDNA 5FKOA 3QPLA 3BNIA 2R7RA 3KYLA 3O60A 3HTAA 4JYKA 3G56A 3SFIA 2YVHA 2R7TA 2TRTA 3HE0A 3V6GA 3RD3A 2GUHA 3DEWA 5F0HA 3WHCA 2NP5A 2ZCMA 2UXIA 3VOKA 3BTCA 2ZCXA 4I6ZA 2ZCNA 5EYRA 3VVXA 4GCLA 1RKTA 3AQTA 3BQYA 4B3AA 2QIBA 2QOPA 3S5RA 4UDSA 3RH2A 2HYTA 2WGBA 3DU6A 2UXUA 5EZGA 2XGCA 2R7WA 5F04A 4D7NA 2IBDA 2XPWA 5FKKA 4V2GA 2UXPA 3Q3SA 4GFLA 4G12A 3PM1A 2IU5A 3G7RA 3TP3A 3CWRA 5IOZA 2IEKA 3ZQGA 3DU5A 3VP5A 4GCKA 2NS7A 3BCGA 4D7MA 3DCFA 2A2FX 2B3WA 2R7QA 3JSJA 3O8HA 2FD5A 1T33A 2ID6A 5D1RA 3B81A 2Y31A 2XPUA 4XK4A 1A6IA 5FKLA 3WHBA 4B1RA 5FMPA 3QKXA 3TP0A 2I10A 2VKEA 4MK6A 2O7OA 3BR6A 4HKUA 2TCTA 3VW0A 5HSZA 3G1LA 2XPVA 4M3DA 2W53A 4M3BA 1BJZA 3CRJA 3QQAA 3VPRA 5CQGA 3BTJA 2O7TA 2ZOYA 4ICHA 4AC6A 3T6NA 2GFNA 3BR3A 3BT9A 3Q0UA 3VW2A 5FKMA 5FHPA 2JK3A 2Y2ZA 1JT6A 3VUQA 5J3LA 1ZK8A 5J1YA 4DVYP 3ON4A 3FHNA 2R7SA 2FQ4A 2PBXA 5HAWA 4I76A 1T56A 2RAEA 2ZOZA 2ID3A 2OI8A 2XRLA 2F07A 1QVTA 3HIMA 2UXHA 1UI5A 3KZ9A 5CXIA 3MVPA 2Q24A 2RHAA 2VKVA 4M3GA 2GENA 2JJ7A 1JTXA 1Z0XA 3ZQFA 2PFVA 2G7GA 5EZHA 2FJI1 3LSPA 3BTIA 3VIBA 3VVYA 5F08A 1RKWA 2IAIA 3VOXA 4D5FA 3HTHA 4MO7A 1QVUA 2NX4A 3G1OA 5AQCA 5K7HA 4M3EA 3ZQLA 3CCYA 5EFYA 2ZB9A 4YZEA 3MNLA 3FK6A 3BR2A 4JKZA 2DG8A 3LSJA
chains in the Genus database with same CATH topology
1RPWA 4V2FA 2X6OA 3V78A 4AUXA 3FRQA 3P9TA 5FKNA 5K7FA 3BHQA 2PZ9A 5GP9A 3CDLA 3BR0A 3O8GA 3COLA 2WUIA 3QBMA 2G7LA 4ABZA 2OPTA 5C4YA 2NP3A 3BR1A 3G1MA 5HBUA 4GFKA 1SGMA 2HYJA 5K7ZA 4M3FA 3ZQHA 3NI7A 5H9TA 2FJ1A 3LSRA 3KKCA 2DTZA 3IUVA 3FIWA 3EGQA 5CW8A 2REKA 2X9DA 2XGEA 3BR5A 3IH3A 4ME9A 3ANGA 2OERA 5IPAA 2EH3A 3PASA 4AF5A 4NN1A 3HTIA 2YVEA 3QPSA 5IOYA 3B6CA 2FBQA 3VVZA 1U9OA 2UXOA 3SDGA 1UI6A 3PPBA 4W1UA 5K58A 3HGYA 3Q0WA 5CXGA 2WV1A 2DG7A 3NRGA 3NNRA 3BRUA 3ON2A 3KNWA 2G7SA 2FX0A 4PXIA 1JUSA 1JUPA 2HXIA 1ZKGA 3VW1A 3F0CA 3BJBA 4L62A 4CGRA 4KWAA 5DAJA 4JL3A 5IP6A 3IH4A 4X1EA 4D5CA 2HXOA 2V57A 5F0CA 3ANPA 4GCTA 2HKUA 3CJDA 1JUMA 3C07A 2G3BA 3Q0VA 4ACIA 1JTYA 5FGLA 1ORKA 1U9NA 3C2BA 2OF7A 4DW6A 2QKOA 2D6YA 3AQSA 2GBYA 5J1RA 3BQZA 3B6AA 4JNNA 5D18A 3KKDA 3GZIA 1JT0A 3LOCA 3E7QA 2QTQA 5F27A 3ZQIA 3IH2A 2Y30A 4NELA 3HGGA 5J1UA 2XGDA 3DPJA 4AC0A 2RASA 3LHQA 3NPIA 5F1JA 2VPRA 4MXMA 2HQ5A 2XB5A 5D19A 3GEUA 3FK7A 2G0EA 2QWTA 3F1BA 5GPCA 2NS8A 5GPAA 5F0FA 4W97A 3BTLA 1VI0A 1QPIA 3LJLA 3HTJA 3NXCA 3EUPA 3LWJA 2QCOA 1Z77A 2XDNA 5FKOA 3QPLA 3BNIA 3O60A 3HTAA 4JYKA 3G56A 3SFIA 2YVHA 2TRTA 3HE0A 3V6GA 3RD3A 2GUHA 3DEWA 5F0HA 3WHCA 2NP5A 2ZCMA 2UXIA 3VOKA 3BTCA 2ZCXA 4I6ZA 2ZCNA 5EYRA 3VVXA 4GCLA 1RKTA 3AQTA 3BQYA 4B3AA 2QIBA 2QOPA 3S5RA 4UDSA 3RH2A 2HYTA 2WGBA 2UXUA 5EZGA 2XGCA 5F04A 4D7NA 2IBDA 2XPWA 5FKKA 4V2GA 2UXPA 3Q3SA 4GFLA 4G12A 3PM1A 2IU5A 3G7RA 3TP3A 3CWRA 5IOZA 2IEKA 3ZQGA 3VP5A 4GCKA 2NS7A 3BCGA 4D7MA 3DCFA 3JSJA 3O8HA 2FD5A 1T33A 2ID6A 5D1RA 3B81A 2Y31A 2XPUA 4XK4A 1A6IA 5FKLA 3WHBA 4B1RA 5FMPA 3QKXA 3TP0A 2I10A 2VKEA 4MK6A 2O7OA 3BR6A 4HKUA 2TCTA 3VW0A 5HSZA 3G1LA 2XPVA 4M3DA 2W53A 4M3BA 1BJZA 3CRJA 3QQAA 3VPRA 3BTJA 2O7TA 2ZOYA 4ICHA 4AC6A 3T6NA 2GFNA 3BR3A 3BT9A 3Q0UA 3VW2A 5FKMA 5FHPA 2JK3A 2Y2ZA 1JT6A 3VUQA 5J3LA 1ZK8A 5J1YA 3ON4A 2FQ4A 2PBXA 5HAWA 4I76A 1T56A 2RAEA 2ZOZA 2ID3A 2OI8A 2XRLA 2F07A 1QVTA 3HIMA 2UXHA 1UI5A 3KZ9A 5CXIA 3MVPA 2Q24A 2RHAA 2VKVA 4M3GA 2GENA 2JJ7A 1JTXA 1Z0XA 3ZQFA 2G7GA 5EZHA 3LSPA 3BTIA 3VIBA 3VVYA 5F08A 1RKWA 2IAIA 3VOXA 4D5FA 3HTHA 4MO7A 1QVUA 2NX4A 3G1OA 5AQCA 5K7HA 4M3EA 3ZQLA 3CCYA 5EFYA 2ZB9A 4YZEA 3MNLA 3FK6A 3BR2A 4JKZA 2DG8A 3LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPW A;  4V2F A;  2X6O A;  3V78 A;  4AUX A;  3FRQ A;  3P9T A;  5FKN A;  5K7F A;  3BHQ A;  2PZ9 A;  5GP9 A;  3CDL A;  3BR0 A;  3O8G A;  3COL A;  2WUI A;  3QBM A;  2G7L A;  4ABZ A;  2OPT A;  5C4Y A;  2NP3 A;  3BR1 A;  3G1M A;  5HBU A;  4GFK A;  1SGM A;  2HYJ A;  5K7Z A;  4M3F A;  3ZQH A;  3NI7 A;  5H9T A;  2FJ1 A;  3LSR A;  3KKC A;  2DTZ A;  3IUV A;  3FIW A;  3EGQ A;  5CW8 A;  2REK A;  2X9D A;  2XGE A;  3BR5 A;  3IH3 A;  4ME9 A;  3ANG A;  2OER A;  5IPA A;  2EH3 A;  3PAS A;  4AF5 A;  4NN1 A;  3HTI A;  2YVE A;  3QPS A;  5IOY A;  3B6C A;  2FBQ A;  3VVZ A;  1U9O A;  2UXO A;  3SDG A;  1UI6 A;  3PPB A;  4W1U A;  5K58 A;  3HGY A;  3Q0W A;  5CXG A;  2WV1 A;  2DG7 A;  3NRG A;  3NNR A;  3BRU A;  3ON2 A;  3KNW A;  2G7S A;  2FX0 A;  4PXI A;  1JUS A;  1JUP A;  2HXI A;  1ZKG A;  3VW1 A;  3F0C A;  3BJB A;  4L62 A;  4CGR A;  4KWA A;  5DAJ A;  4JL3 A;  5IP6 A;  3IH4 A;  4X1E A;  4D5C A;  2HXO A;  2V57 A;  5F0C A;  3ANP A;  4GCT A;  2HKU A;  3CJD A;  1JUM A;  3C07 A;  2G3B A;  3Q0V A;  4ACI A;  1JTY A;  5FGL A;  1ORK A;  1U9N A;  3C2B A;  2OF7 A;  4DW6 A;  2QKO A;  2D6Y A;  3AQS A;  2GBY A;  5J1R A;  3BQZ A;  3B6A A;  4JNN A;  5D18 A;  3KKD A;  3GZI A;  1JT0 A;  3LOC A;  3E7Q A;  2QTQ A;  5F27 A;  3ZQI A;  3IH2 A;  2Y30 A;  4NEL A;  3HGG A;  5J1U A;  2XGD A;  3DPJ A;  4AC0 A;  2RAS A;  3LHQ A;  3NPI A;  5F1J A;  2VPR A;  4MXM A;  2HQ5 A;  2XB5 A;  5D19 A;  3GEU A;  3FK7 A;  2G0E A;  2QWT A;  3F1B A;  5GPC A;  2NS8 A;  5GPA A;  5F0F A;  4W97 A;  3BTL A;  1VI0 A;  1QPI A;  3LJL A;  3HTJ A;  3NXC A;  3EUP A;  3LWJ A;  2QCO A;  1Z77 A;  2XDN A;  5FKO A;  3QPL A;  3BNI A;  3O60 A;  3HTA A;  4JYK A;  3G56 A;  3SFI A;  2YVH A;  2TRT A;  3HE0 A;  3V6G A;  3RD3 A;  2GUH A;  3DEW A;  5F0H A;  3WHC A;  2NP5 A;  2ZCM A;  2UXI A;  3VOK A;  3BTC A;  2ZCX A;  4I6Z A;  2ZCN A;  5EYR A;  3VVX A;  4GCL A;  1RKT A;  3AQT A;  3BQY A;  4B3A A;  2QIB A;  2QOP A;  3S5R A;  4UDS A;  3RH2 A;  2HYT A;  2WGB A;  2UXU A;  5EZG A;  2XGC A;  5F04 A;  4D7N A;  2IBD A;  2XPW A;  5FKK A;  4V2G A;  2UXP A;  3Q3S A;  4GFL A;  4G12 A;  3PM1 A;  2IU5 A;  3G7R A;  3TP3 A;  3CWR A;  5IOZ A;  2IEK A;  3ZQG A;  3VP5 A;  4GCK A;  2NS7 A;  3BCG A;  4D7M A;  3DCF A;  3JSJ A;  3O8H A;  2FD5 A;  1T33 A;  2ID6 A;  5D1R A;  3B81 A;  2Y31 A;  2XPU A;  4XK4 A;  1A6I A;  5FKL A;  3WHB A;  4B1R A;  5FMP A;  3QKX A;  3TP0 A;  2I10 A;  2VKE A;  4MK6 A;  2O7O A;  3BR6 A;  4HKU A;  2TCT A;  3VW0 A;  5HSZ A;  3G1L A;  2XPV A;  4M3D A;  2W53 A;  4M3B A;  1BJZ A;  3CRJ A;  3QQA A;  3VPR A;  3BTJ A;  2O7T A;  2ZOY A;  4ICH A;  4AC6 A;  3T6N A;  2GFN A;  3BR3 A;  3BT9 A;  3Q0U A;  3VW2 A;  5FKM A;  5FHP A;  2JK3 A;  2Y2Z A;  1JT6 A;  3VUQ A;  5J3L A;  1ZK8 A;  5J1Y A;  3ON4 A;  2FQ4 A;  2PBX A;  5HAW A;  4I76 A;  1T56 A;  2RAE A;  2ZOZ A;  2ID3 A;  2OI8 A;  2XRL A;  2F07 A;  1QVT A;  3HIM A;  2UXH A;  1UI5 A;  3KZ9 A;  5CXI A;  3MVP A;  2Q24 A;  2RHA A;  2VKV A;  4M3G A;  2GEN A;  2JJ7 A;  1JTX A;  1Z0X A;  3ZQF A;  2G7G A;  5EZH A;  3LSP A;  3BTI A;  3VIB A;  3VVY A;  5F08 A;  1RKW A;  2IAI A;  3VOX A;  4D5F A;  3HTH A;  4MO7 A;  1QVU A;  2NX4 A;  3G1O A;  5AQC A;  5K7H A;  4M3E A;  3ZQL A;  3CCY A;  5EFY A;  2ZB9 A;  4YZE A;  3MNL A;  3FK6 A;  3BR2 A;  4JKZ A;  2DG8 A;  3LSJ A; 
#chains in the Genus database with same CATH topology
 1RPW A;  4V2F A;  2X6O A;  3V78 A;  4AUX A;  3FRQ A;  4C2M A;  3P9T A;  5FKN A;  5K7F A;  3BHQ A;  2PZ9 A;  5GP9 A;  3CDL A;  3BR0 A;  3O8G A;  3COL A;  2WUI A;  3QBM A;  2G7L A;  4ABZ A;  2OPT A;  5C4Y A;  2NP3 A;  3BR1 A;  3G1M A;  5HBU A;  4GFK A;  4OD4 A;  1SGM A;  2HYJ A;  5K7Z A;  4M3F A;  3ZQH A;  3NI7 A;  5H9T A;  2FJ1 A;  4OD5 A;  3LSR A;  3KKC A;  2DTZ A;  3IUV A;  3FIW A;  3EGQ A;  5CW8 A;  2REK A;  2X9D A;  2XGE A;  3BR5 A;  3IH3 A;  4ME9 A;  3ANG A;  3VTI A;  2OER A;  2R7V A;  5IPA A;  2EH3 A;  3PAS A;  4AF5 A;  4NN1 A;  3HTI A;  2YVE A;  3QPS A;  5IOY A;  3K8P C;  3B6C A;  2FBQ A;  3VVZ A;  1U9O A;  2UXO A;  3SDG A;  1UI6 A;  3PPB A;  4W1U A;  5K58 A;  3HGY A;  3Q0W A;  5CXG A;  2WV1 A;  2DG7 A;  3NRG A;  3NNR A;  4U9L A;  3BRU A;  3ON2 A;  3KNW A;  2G7S A;  2FX0 A;  4PXI A;  1JUS A;  1JUP A;  2YVX A;  4U9N A;  2HXI A;  1ZKG A;  3VW1 A;  3F0C A;  3BJB A;  4L62 A;  4CGR A;  2R7X A;  4KWA A;  5DAJ A;  4JL3 A;  5IP6 A;  3IH4 A;  4X1E A;  4D5C A;  2HXO A;  2V57 A;  5F0C A;  3ANP A;  4GCT A;  2HKU A;  3CJD A;  1JUM A;  3C07 A;  4IRV A;  2G3B A;  3Q0V A;  2R7O A;  4ACI A;  1JTY A;  5FGL A;  1ORK A;  1U9N A;  3SWH A;  3C2B A;  2OF7 A;  4DW6 A;  2QKO A;  2D6Y A;  3AQS A;  2GBY A;  5J1R A;  3BQZ A;  3B6A A;  4JNN A;  5D18 A;  3KKD A;  4WIB A;  3GZI A;  1JT0 A;  2ZY9 A;  3LOC A;  3E7Q A;  2QTQ A;  5F27 A;  3ZQI A;  3IH2 A;  2Y30 A;  4NEL A;  3HGG A;  5J1U A;  2XGD A;  3DPJ A;  4AC0 A;  2RAS A;  3LHQ A;  3NPI A;  5F1J A;  2VPR A;  3NS4 A;  4MXM A;  5D19 A;  2HQ5 A;  2XB5 A;  3GEU A;  3FK7 A;  2B1E A;  2G0E A;  2QWT A;  3F1B A;  5GPC A;  2NS8 A;  5GPA A;  5F0F A;  4W97 A;  3BTL A;  1VI0 A;  1QPI A;  2R7U A;  3LJL A;  3HTJ A;  3NXC A;  3EUP A;  3LWJ A;  2QCO A;  1Z77 A;  2XDN A;  5FKO A;  3QPL A;  3BNI A;  2R7R A;  3KYL A;  3O60 A;  3HTA A;  4JYK A;  3G56 A;  3SFI A;  2YVH A;  2R7T A;  2TRT A;  3HE0 A;  3V6G A;  3RD3 A;  2GUH A;  3DEW A;  5F0H A;  3WHC A;  2NP5 A;  2ZCM A;  2UXI A;  3VOK A;  3BTC A;  2ZCX A;  4I6Z A;  2ZCN A;  5EYR A;  3VVX A;  4GCL A;  1RKT A;  3AQT A;  3BQY A;  4B3A A;  2QIB A;  2QOP A;  3S5R A;  4UDS A;  3RH2 A;  2HYT A;  2WGB A;  3DU6 A;  2UXU A;  5EZG A;  2XGC A;  2R7W A;  5F04 A;  4D7N A;  2IBD A;  2XPW A;  5FKK A;  4V2G A;  2UXP A;  3Q3S A;  4GFL A;  4G12 A;  3PM1 A;  2IU5 A;  3G7R A;  3TP3 A;  3CWR A;  5IOZ A;  2IEK A;  3ZQG A;  3DU5 A;  3VP5 A;  4GCK A;  2NS7 A;  3BCG A;  4D7M A;  3DCF A;  2A2F X;  2B3W A;  2R7Q A;  3JSJ A;  3O8H A;  2FD5 A;  1T33 A;  2ID6 A;  5D1R A;  3B81 A;  2Y31 A;  2XPU A;  4XK4 A;  1A6I A;  5FKL A;  3WHB A;  4B1R A;  5FMP A;  3QKX A;  3TP0 A;  2I10 A;  2VKE A;  4MK6 A;  2O7O A;  3BR6 A;  4HKU A;  2TCT A;  3VW0 A;  5HSZ A;  3G1L A;  2XPV A;  4M3D A;  2W53 A;  4M3B A;  1BJZ A;  3CRJ A;  3QQA A;  3VPR A;  5CQG A;  3BTJ A;  2O7T A;  2ZOY A;  4ICH A;  4AC6 A;  3T6N A;  2GFN A;  3BR3 A;  3BT9 A;  3Q0U A;  3VW2 A;  5FKM A;  5FHP A;  2JK3 A;  2Y2Z A;  1JT6 A;  3VUQ A;  5J3L A;  1ZK8 A;  5J1Y A;  4DVY P;  3ON4 A;  3FHN A;  2R7S A;  2FQ4 A;  2PBX A;  5HAW A;  4I76 A;  1T56 A;  2RAE A;  2ZOZ A;  2ID3 A;  2OI8 A;  2XRL A;  2F07 A;  1QVT A;  3HIM A;  2UXH A;  1UI5 A;  3KZ9 A;  5CXI A;  3MVP A;  2Q24 A;  2RHA A;  2VKV A;  4M3G A;  2GEN A;  2JJ7 A;  1JTX A;  1Z0X A;  3ZQF A;  2PFV A;  2G7G A;  5EZH A;  2FJI 1;  3LSP A;  3BTI A;  3VIB A;  3VVY A;  5F08 A;  1RKW A;  2IAI A;  3VOX A;  4D5F A;  3HTH A;  4MO7 A;  1QVU A;  2NX4 A;  3G1O A;  5AQC A;  5K7H A;  4M3E A;  3ZQL A;  3CCY A;  5EFY A;  2ZB9 A;  4YZE A;  3MNL A;  3FK6 A;  3BR2 A;  4JKZ A;  2DG8 A;  3LSJ A; 
#chains in the Genus database with same CATH homology
 1RPW A;  4V2F A;  2X6O A;  3V78 A;  4AUX A;  3FRQ A;  3P9T A;  5FKN A;  5K7F A;  3BHQ A;  2PZ9 A;  5GP9 A;  3CDL A;  3BR0 A;  3O8G A;  3COL A;  2WUI A;  3QBM A;  2G7L A;  4ABZ A;  2OPT A;  5C4Y A;  2NP3 A;  3BR1 A;  3G1M A;  5HBU A;  4GFK A;  1SGM A;  2HYJ A;  5K7Z A;  4M3F A;  3ZQH A;  3NI7 A;  5H9T A;  2FJ1 A;  3LSR A;  3KKC A;  2DTZ A;  3IUV A;  3FIW A;  3EGQ A;  5CW8 A;  2REK A;  2X9D A;  2XGE A;  3BR5 A;  3IH3 A;  4ME9 A;  3ANG A;  2OER A;  5IPA A;  2EH3 A;  3PAS A;  4AF5 A;  4NN1 A;  3HTI A;  2YVE A;  3QPS A;  5IOY A;  3B6C A;  2FBQ A;  3VVZ A;  1U9O A;  2UXO A;  3SDG A;  1UI6 A;  3PPB A;  4W1U A;  5K58 A;  3HGY A;  3Q0W A;  5CXG A;  2WV1 A;  2DG7 A;  3NRG A;  3NNR A;  3BRU A;  3ON2 A;  3KNW A;  2G7S A;  2FX0 A;  4PXI A;  1JUS A;  1JUP A;  2HXI A;  1ZKG A;  3VW1 A;  3F0C A;  3BJB A;  4L62 A;  4CGR A;  4KWA A;  5DAJ A;  4JL3 A;  5IP6 A;  3IH4 A;  4X1E A;  4D5C A;  2HXO A;  2V57 A;  5F0C A;  3ANP A;  4GCT A;  2HKU A;  3CJD A;  1JUM A;  3C07 A;  2G3B A;  3Q0V A;  4ACI A;  1JTY A;  5FGL A;  1ORK A;  1U9N A;  3C2B A;  2OF7 A;  4DW6 A;  2QKO A;  2D6Y A;  3AQS A;  2GBY A;  5J1R A;  3BQZ A;  3B6A A;  4JNN A;  5D18 A;  3KKD A;  3GZI A;  1JT0 A;  3LOC A;  3E7Q A;  2QTQ A;  5F27 A;  3ZQI A;  3IH2 A;  2Y30 A;  4NEL A;  3HGG A;  5J1U A;  2XGD A;  3DPJ A;  4AC0 A;  2RAS A;  3LHQ A;  3NPI A;  5F1J A;  2VPR A;  4MXM A;  2HQ5 A;  2XB5 A;  5D19 A;  3GEU A;  3FK7 A;  2G0E A;  2QWT A;  3F1B A;  5GPC A;  2NS8 A;  5GPA A;  5F0F A;  4W97 A;  3BTL A;  1VI0 A;  1QPI A;  3LJL A;  3HTJ A;  3NXC A;  3EUP A;  3LWJ A;  2QCO A;  1Z77 A;  2XDN A;  5FKO A;  3QPL A;  3BNI A;  3O60 A;  3HTA A;  4JYK A;  3G56 A;  3SFI A;  2YVH A;  2TRT A;  3HE0 A;  3V6G A;  3RD3 A;  2GUH A;  3DEW A;  5F0H A;  3WHC A;  2NP5 A;  2ZCM A;  2UXI A;  3VOK A;  3BTC A;  2ZCX A;  4I6Z A;  2ZCN A;  5EYR A;  3VVX A;  4GCL A;  1RKT A;  3AQT A;  3BQY A;  4B3A A;  2QIB A;  2QOP A;  3S5R A;  4UDS A;  3RH2 A;  2HYT A;  2WGB A;  2UXU A;  5EZG A;  2XGC A;  5F04 A;  4D7N A;  2IBD A;  2XPW A;  5FKK A;  4V2G A;  2UXP A;  3Q3S A;  4GFL A;  4G12 A;  3PM1 A;  2IU5 A;  3G7R A;  3TP3 A;  3CWR A;  5IOZ A;  2IEK A;  3ZQG A;  3VP5 A;  4GCK A;  2NS7 A;  3BCG A;  4D7M A;  3DCF A;  3JSJ A;  3O8H A;  2FD5 A;  1T33 A;  2ID6 A;  5D1R A;  3B81 A;  2Y31 A;  2XPU A;  4XK4 A;  1A6I A;  5FKL A;  3WHB A;  4B1R A;  5FMP A;  3QKX A;  3TP0 A;  2I10 A;  2VKE A;  4MK6 A;  2O7O A;  3BR6 A;  4HKU A;  2TCT A;  3VW0 A;  5HSZ A;  3G1L A;  2XPV A;  4M3D A;  2W53 A;  4M3B A;  1BJZ A;  3CRJ A;  3QQA A;  3VPR A;  3BTJ A;  2O7T A;  2ZOY A;  4ICH A;  4AC6 A;  3T6N A;  2GFN A;  3BR3 A;  3BT9 A;  3Q0U A;  3VW2 A;  5FKM A;  5FHP A;  2JK3 A;  2Y2Z A;  1JT6 A;  3VUQ A;  5J3L A;  1ZK8 A;  5J1Y A;  3ON4 A;  2FQ4 A;  2PBX A;  5HAW A;  4I76 A;  1T56 A;  2RAE A;  2ZOZ A;  2ID3 A;  2OI8 A;  2XRL A;  2F07 A;  1QVT A;  3HIM A;  2UXH A;  1UI5 A;  3KZ9 A;  5CXI A;  3MVP A;  2Q24 A;  2RHA A;  2VKV A;  4M3G A;  2GEN A;  2JJ7 A;  1JTX A;  1Z0X A;  3ZQF A;  2G7G A;  5EZH A;  3LSP A;  3BTI A;  3VIB A;  3VVY A;  5F08 A;  1RKW A;  2IAI A;  3VOX A;  4D5F A;  3HTH A;  4MO7 A;  1QVU A;  2NX4 A;  3G1O A;  5AQC A;  5K7H A;  4M3E A;  3ZQL A;  3CCY A;  5EFY A;  2ZB9 A;  4YZE A;  3MNL A;  3FK6 A;  3BR2 A;  4JKZ A;  2DG8 A;  3LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...