4U9LA

Structure of a membrane protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
LVYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 70
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9lA00
4U9NA 4WIBA 4U9LA 2ZY9A 2YVXA
chains in the Genus database with same CATH superfamily
2VKEA 5IOYA 4M3GA 2RAEA 3WHCA 2HQ5A 3BCGA 5FHPA 4AF5A 3Q0VA 2GBYA 2QCOA 4JNNA 3LWJA 2EH3A 4AC6A 1VI0A 3BT9A 3LSJA 1JT6A 2X9DA 5GPCA 3KNWA 2G3BA 1RKTA 2ZOZA 3DCFA 2ZCNA 5F0CA 3ZQIA 3QPLA 3O8GA 4D5CA 3ANPA 2XPUA 1JTYA 2ZB9A 4D7NA 2UXUA 1QVUA 3BR0A 3LHQA 2GENA 4OD5A 1JTXA 4YZEA 5J1RA 5EFYA 2R7VA 3QPSA 5D19A 2O7TA 4GFLA 2UXHA 2DG7A 2XGDA 3VUQA 4AC0A 5J1UA 2PZ9A 5D18A 4IRVA 4WIBA 1RKWA 2Y30A 4GFKA 3VOKA 3AQSA 4M3EA 5HBUA 2R7QA 2VKVA 5FKLA 4UDSA 3GEUA 3ON2A 3IUVA 4U9NA 2XGEA 1JUSA 3F0CA 2IEKA 3K8PC 3NPIA 4X1EA 1UI5A 3AQTA 5F04A 3BR2A 2NS7A 3ON4A 3G1OA 3FK6A 5CW8A 4GCKA 3O8HA 2FJ1A 2GFNA 3BJBA 2R7TA 5FMPA 3Q0UA 3BQYA 3G1LA 3Q0WA 3VOXA 3KZ9A 2I10A 3KKCA 2FBQA 3VW1A 2QIBA 2XB5A 3NRGA 2HXIA 3G1MA 3B6CA 3ZQLA 3DU6A 2NS8A 4JKZA 3VTIA 5EZHA 2XRLA 3LOCA 3FK7A 4JL3A 3BTJA 2TCTA 2RHAA 1JT0A 3CWRA 2D6YA 3BR6A 2UXPA 3HGYA 3CDLA 2QWTA 3DEWA 3VVXA 5K7HA 3TP3A 2X6OA 3PM1A 5CXIA 3FRQA 2HXOA 3LJLA 3KYLA 4XK4A 2YVEA 4MO7A 3HTAA 2XGCA 2FD5A 3IH4A 2R7XA 2PFVA 3P9TA 2HYTA 2IBDA 3VVYA 2UXOA 2QOPA 3BTIA 3CJDA 2R7UA 3QQAA 4GCLA 5FKOA 2XDNA 3B81A 3VW0A 2NX4A 2OPTA 3CRJA 3BR1A 3VVZA 2HYJA 4L62A 2RASA 3C2BA 3LSRA 2FX0A 3KKDA 5H9TA 3QKXA 4MXMA 2G7GA 2A2FX 3SFIA 3HE0A 5K7FA 3G56A 2JK3A 3RD3A 5GPAA 2F07A 3FHNA 2XPWA 5FKKA 4I76A 2REKA 3MVPA 2WV1A 2FQ4A 4PXIA 1BJZA 2ZCXA 3QBMA 5FKNA 3BTLA 4D7MA 5F08A 1SGMA 3HTJA 3GZIA 5HSZA 5J1YA 4ACIA 1ZK8A 1RPWA 3HGGA 4ABZA 3VIBA 4W1UA 4M3DA 2W53A 2YVHA 3VP5A 2VPRA 2IU5A 3NXCA 3VPRA 3BR3A 5IPAA 2XPVA 5C4YA 5K58A 3O60A 3S5RA 4ME9A 3EGQA 2O7OA 5CXGA 4V2FA 2R7RA 2JJ7A 1Z0XA 4M3BA 3SWHA 5F1JA 1A6IA 5F27A 2IAIA 2QTQA 4DW6A 2NP5A 4JYKA 3BR5A 3NNRA 3HTHA 2TRTA 4KWAA 3IH2A 5EZGA 2UXIA 5FKMA 1Z77A 1JUMA 2R7OA 2DG8A 4I6ZA 2FJI1 2WUIA 3G7RA 3B6AA 5HAWA 1T33A 2ID6A 1UI6A 2B1EA 2G0EA 4W97A 2ZY9A 3NS4A 3PASA 5CQGA 5DAJA 5K7ZA 3HIMA 4U9LA 4D5FA 2OERA 1JUPA 3V78A 1QVTA 3RH2A 2B3WA 2G7LA 3ZQFA 2DTZA 3DU5A 2Y2ZA 2OF7A 1QPIA 3NI7A 3BQZA 4M3FA 5IP6A 3VW2A 2ZOYA 3ZQGA 3V6GA 4V2GA 5AQCA 5IOZA 3CCYA 1U9NA 5F0FA 3F1BA 5J3LA 3E7QA 2G7SA 4G12A 3DPJA 5EYRA 4GCTA 3BTCA 3LSPA 2R7SA 2R7WA 2GUHA 3SDGA 2YVXA 1U9OA 3EUPA 1ORKA 2WGBA 4MK6A 2PBXA 5FGLA 4CGRA 4NELA 2V57A 5GP9A 2Q24A 4HKUA 4DVYP 3MNLA 5D1RA 3PPBA 3JSJA 2HKUA 4OD4A 2QKOA 3COLA 3BRUA 2OI8A 3C07A 3FIWA 4ICHA 3ZQHA 2NP3A 4NN1A 3WHBA 5F0HA 3BHQA 3IH3A 3Q3SA 3BNIA 1ZKGA 1T56A 3TP0A 2Y31A 2ZCMA 4C2MA 4B3AA 3T6NA 4AUXA 4B1RA 3ANGA 2ID3A 3HTIA
chains in the Genus database with same CATH topology
4U9NA 4WIBA 4U9LA 2ZY9A 2YVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9N A;  4WIB A;  4U9L A;  2ZY9 A;  2YVX A; 
#chains in the Genus database with same CATH topology
 2VKE A;  5IOY A;  4M3G A;  2RAE A;  3WHC A;  2HQ5 A;  3BCG A;  5FHP A;  4AF5 A;  3Q0V A;  2GBY A;  2QCO A;  4JNN A;  3LWJ A;  2EH3 A;  4AC6 A;  1VI0 A;  3BT9 A;  3LSJ A;  1JT6 A;  2X9D A;  5GPC A;  3KNW A;  2G3B A;  1RKT A;  2ZOZ A;  3DCF A;  2ZCN A;  5F0C A;  3ZQI A;  3QPL A;  3O8G A;  4D5C A;  3ANP A;  2XPU A;  1JTY A;  2ZB9 A;  4D7N A;  2UXU A;  1QVU A;  3BR0 A;  3LHQ A;  2GEN A;  4OD5 A;  1JTX A;  4YZE A;  5J1R A;  5EFY A;  2R7V A;  3QPS A;  5D19 A;  2O7T A;  4GFL A;  2UXH A;  2DG7 A;  2XGD A;  3VUQ A;  4AC0 A;  5J1U A;  2PZ9 A;  5D18 A;  4IRV A;  4WIB A;  1RKW A;  2Y30 A;  4GFK A;  3VOK A;  3AQS A;  4M3E A;  5HBU A;  2R7Q A;  2VKV A;  5FKL A;  4UDS A;  3GEU A;  3ON2 A;  3IUV A;  4U9N A;  2XGE A;  1JUS A;  3F0C A;  2IEK A;  3K8P C;  3NPI A;  4X1E A;  1UI5 A;  3AQT A;  5F04 A;  3BR2 A;  2NS7 A;  3ON4 A;  3G1O A;  3FK6 A;  5CW8 A;  4GCK A;  3O8H A;  2FJ1 A;  2GFN A;  3BJB A;  2R7T A;  5FMP A;  3Q0U A;  3BQY A;  3G1L A;  3Q0W A;  3VOX A;  3KZ9 A;  2I10 A;  3KKC A;  2FBQ A;  3VW1 A;  2QIB A;  2XB5 A;  3NRG A;  2HXI A;  3G1M A;  3B6C A;  3ZQL A;  3DU6 A;  2NS8 A;  4JKZ A;  3VTI A;  5EZH A;  2XRL A;  3LOC A;  3FK7 A;  4JL3 A;  3BTJ A;  2TCT A;  2RHA A;  1JT0 A;  3CWR A;  2D6Y A;  3BR6 A;  2UXP A;  3HGY A;  3CDL A;  2QWT A;  3DEW A;  3VVX A;  5K7H A;  3TP3 A;  2X6O A;  3PM1 A;  5CXI A;  3FRQ A;  2HXO A;  3LJL A;  3KYL A;  4XK4 A;  2YVE A;  4MO7 A;  3HTA A;  2XGC A;  2FD5 A;  3IH4 A;  2R7X A;  2PFV A;  3P9T A;  2HYT A;  2IBD A;  3VVY A;  2UXO A;  2QOP A;  3BTI A;  3CJD A;  2R7U A;  3QQA A;  4GCL A;  5FKO A;  2XDN A;  3B81 A;  3VW0 A;  2NX4 A;  2OPT A;  3CRJ A;  3BR1 A;  3VVZ A;  2HYJ A;  4L62 A;  2RAS A;  3C2B A;  3LSR A;  2FX0 A;  3KKD A;  5H9T A;  3QKX A;  4MXM A;  2G7G A;  2A2F X;  3SFI A;  3HE0 A;  5K7F A;  3G56 A;  2JK3 A;  3RD3 A;  5GPA A;  2F07 A;  3FHN A;  2XPW A;  5FKK A;  4I76 A;  2REK A;  3MVP A;  2WV1 A;  2FQ4 A;  4PXI A;  1BJZ A;  2ZCX A;  3QBM A;  5FKN A;  3BTL A;  4D7M A;  5F08 A;  1SGM A;  3HTJ A;  3GZI A;  5HSZ A;  5J1Y A;  4ACI A;  1ZK8 A;  1RPW A;  3HGG A;  4ABZ A;  3VIB A;  4W1U A;  4M3D A;  2W53 A;  2YVH A;  3VP5 A;  2VPR A;  2IU5 A;  3NXC A;  3VPR A;  3BR3 A;  5IPA A;  2XPV A;  5C4Y A;  5K58 A;  3O60 A;  3S5R A;  4ME9 A;  3EGQ A;  2O7O A;  5CXG A;  4V2F A;  2R7R A;  2JJ7 A;  1Z0X A;  4M3B A;  3SWH A;  5F1J A;  1A6I A;  5F27 A;  2IAI A;  2QTQ A;  4DW6 A;  2NP5 A;  4JYK A;  3BR5 A;  3NNR A;  3HTH A;  2TRT A;  4KWA A;  3IH2 A;  5EZG A;  2UXI A;  5FKM A;  1Z77 A;  1JUM A;  2R7O A;  2DG8 A;  4I6Z A;  2FJI 1;  2WUI A;  3G7R A;  3B6A A;  5HAW A;  1T33 A;  2ID6 A;  1UI6 A;  2B1E A;  2G0E A;  4W97 A;  2ZY9 A;  3NS4 A;  3PAS A;  5CQG A;  5DAJ A;  5K7Z A;  3HIM A;  4U9L A;  4D5F A;  2OER A;  1JUP A;  3V78 A;  1QVT A;  3RH2 A;  2B3W A;  2G7L A;  3ZQF A;  2DTZ A;  3DU5 A;  2Y2Z A;  2OF7 A;  1QPI A;  3NI7 A;  3BQZ A;  4M3F A;  5IP6 A;  3VW2 A;  2ZOY A;  3ZQG A;  3V6G A;  4V2G A;  5AQC A;  5IOZ A;  3CCY A;  1U9N A;  5F0F A;  3F1B A;  5J3L A;  3E7Q A;  2G7S A;  4G12 A;  3DPJ A;  5EYR A;  4GCT A;  3BTC A;  3LSP A;  2R7S A;  2R7W A;  2GUH A;  3SDG A;  2YVX A;  1U9O A;  3EUP A;  1ORK A;  2WGB A;  4MK6 A;  2PBX A;  5FGL A;  4CGR A;  4NEL A;  2V57 A;  5GP9 A;  2Q24 A;  4HKU A;  4DVY P;  3MNL A;  5D1R A;  3PPB A;  3JSJ A;  2HKU A;  4OD4 A;  2QKO A;  3COL A;  3BRU A;  2OI8 A;  3C07 A;  3FIW A;  4ICH A;  3ZQH A;  2NP3 A;  4NN1 A;  3WHB A;  5F0H A;  3BHQ A;  3IH3 A;  3Q3S A;  3BNI A;  1ZKG A;  1T56 A;  3TP0 A;  2Y31 A;  2ZCM A;  4C2M A;  4B3A A;  3T6N A;  4AUX A;  4B1R A;  3ANG A;  2ID3 A;  3HTI A; 
#chains in the Genus database with same CATH homology
 4U9N A;  4WIB A;  4U9L A;  2ZY9 A;  2YVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...