4U9LA

Structure of a membrane protein
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
179
structure length
179
Chain Sequence
LVYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Metal transport
total genus 70
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9lA00
4U9LA 2ZY9A 4WIBA 2YVXA 4U9NA
chains in the Genus database with same CATH superfamily
4D5FA 1A6IA 1T56A 3NNRA 5FHPA 4U9LA 2VPRA 2PZ9A 3BR6A 2NS8A 4UDSA 3COLA 3DPJA 4AC6A 2Q24A 3HTJA 3HGYA 5AQCA 5FKOA 3G1OA 2ZCMA 4IRVA 1UI6A 5GPAA 4M3BA 2I10A 2UXIA 3ZQGA 4I76A 2WV1A 3DU5A 2YVEA 5J1UA 2FJI1 2GFNA 2ZCXA 3VP5A 5GP9A 3O60A 3KKCA 5D18A 2QTQA 4C2MA 2R7UA 3O8GA 5F1JA 2VKEA 4JYKA 2FJ1A 4AC0A 3E7QA 3IUVA 2YVXA 5D19A 2RASA 4AUXA 3KYLA 2REKA 2XGCA 2A2FX 4ACIA 2R7OA 3AQTA 3TP3A 3QQAA 3VOKA 3BTIA 5CW8A 5HBUA 3G7RA 3QBMA 3IH4A 4W1UA 4NN1A 2JJ7A 4GFLA 3C07A 2HXOA 4ME9A 3LSPA 4M3EA 3WHBA 3BTJA 2G7GA 2G7LA 4X1EA 3Q0UA 4GCLA 3IH3A 2D6YA 3Q0VA 3T6NA 1JTYA 1JUMA 2B1EA 2OPTA 2WGBA 3BNIA 3NRGA 3Q0WA 5CQGA 4GCTA 2B3WA 4GCKA 2OF7A 3DEWA 5EFYA 4JKZA 2DG7A 2Y31A 3CWRA 2G0EA 3SDGA 2XRLA 3CJDA 3Q3SA 5F0HA 5F04A 2JK3A 3GEUA 3SWHA 2R7WA 2VKVA 3PPBA 2O7OA 4OD4A 5F27A 3QKXA 3BQZA 5K7FA 2O7TA 3IH2A 5IOZA 5IOYA 3LJLA 2QKOA 2TRTA 2ZOYA 5K7HA 2ID3A 2NS7A 2DTZA 2IU5A 4YZEA 1U9NA 1JT0A 5D1RA 5K58A 1QVTA 2R7QA 1RKTA 4DW6A 2XPUA 2QCOA 5C4YA 4HKUA 4W97A 2XB5A 3BR1A 4NELA 2UXUA 3VVXA 1JTXA 3BJBA 4V2GA 4D5CA 2R7XA 3DCFA 3BHQA 2R7VA 3VTIA 3BTLA 4AF5A 4M3DA 2NP5A 2XGEA 1JT6A 3NI7A 2HQ5A 3BCGA 3HGGA 4MK6A 2X9DA 3VVYA 1QPIA 3VIBA 3ON2A 2PFVA 1SGMA 3BR0A 3O8HA 3BT9A 3FHNA 4WIBA 5HSZA 3HE0A 3HTHA 3BR5A 2UXPA 3AQSA 5IPAA 5H9TA 3ZQLA 4MO7A 3EUPA 3EGQA 3HTIA 3ZQIA 3ZQFA 2ZB9A 3MVPA 3P9TA 4GFKA 3LSRA 2GENA 4ICHA 3FK7A 4U9NA 3F1BA 3ANPA 4ABZA 3BTCA 3BQYA 1QVUA 2Y30A 3G1LA 5K7ZA 3FK6A 5FKKA 3S5RA 2HXIA 4B3AA 3VUQA 2ZY9A 2RAEA 1Z0XA 4JL3A 4JNNA 5DAJA 2ZOZA 4B1RA 3DU6A 3BR2A 3FIWA 3B6AA 1U9OA 3RD3A 2IBDA 3VPRA 1RKWA 3V78A 2WUIA 3SFIA 4D7NA 5J3LA 2FD5A 5F0FA 2XDNA 3VW0A 2FX0A 2RHAA 2DG8A 2R7RA 2Y2ZA 2QOPA 3V6GA 2UXHA 3KKDA 3PASA 4PXIA 3LWJA 4DVYP 3C2BA 3FRQA 2UXOA 3VVZA 3ZQHA 5CXIA 2XPVA 2QWTA 3MNLA 4XK4A 2XGDA 3BRUA 3HIMA 2X6OA 2V57A 3CDLA 3QPLA 3NPIA 2R7SA 5FKNA 3BR3A 4V2FA 3VW1A 4G12A 2NP3A 3KZ9A 1RPWA 5GPCA 3RH2A 5EYRA 2OERA 2GBYA 5FGLA 4M3FA 3CCYA 4D7MA 4I6ZA 3ON4A 3PM1A 2R7TA 5J1RA 3QPSA 2G3BA 3CRJA 2F07A 3HTAA 5F0CA 3NS4A 3ANGA 3K8PC 5HAWA 3LHQA 3B81A 5EZGA 2HYTA 1T33A 2TCTA 3F0CA 2XPWA 4KWAA 2GUHA 2YVHA 2W53A 2IAIA 3WHCA 3JSJA 5IP6A 4L62A 2QIBA 2IEKA 3G56A 2FBQA 5CXGA 1Z77A 2ZCNA 4OD5A 4M3GA 3LSJA 1JUSA 3NXCA 3G1MA 5EZHA 2EH3A 2HKUA 5FKLA 2FQ4A 3TP0A 5F08A 2HYJA 2OI8A 2ID6A 5FMPA 3VW2A 1BJZA 3LOCA 1UI5A 1ORKA 3KNWA 1JUPA 5FKMA 5J1YA 3GZIA 3B6CA 3VOXA 4CGRA 4MXMA 1ZKGA 2PBXA 1ZK8A 1VI0A 2G7SA 2NX4A
chains in the Genus database with same CATH topology
4U9LA 2ZY9A 4WIBA 2YVXA 4U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9L A;  2ZY9 A;  4WIB A;  2YVX A;  4U9N A; 
#chains in the Genus database with same CATH topology
 4D5F A;  1A6I A;  1T56 A;  3NNR A;  5FHP A;  4U9L A;  2VPR A;  2PZ9 A;  3BR6 A;  2NS8 A;  4UDS A;  3COL A;  3DPJ A;  4AC6 A;  2Q24 A;  3HTJ A;  3HGY A;  5AQC A;  5FKO A;  3G1O A;  2ZCM A;  4IRV A;  1UI6 A;  5GPA A;  4M3B A;  2I10 A;  2UXI A;  3ZQG A;  4I76 A;  2WV1 A;  3DU5 A;  2YVE A;  5J1U A;  2FJI 1;  2GFN A;  2ZCX A;  3VP5 A;  5GP9 A;  3O60 A;  3KKC A;  5D18 A;  2QTQ A;  4C2M A;  2R7U A;  3O8G A;  5F1J A;  2VKE A;  4JYK A;  2FJ1 A;  4AC0 A;  3E7Q A;  3IUV A;  2YVX A;  5D19 A;  2RAS A;  4AUX A;  3KYL A;  2REK A;  2XGC A;  2A2F X;  4ACI A;  2R7O A;  3AQT A;  3TP3 A;  3QQA A;  3VOK A;  3BTI A;  5CW8 A;  5HBU A;  3G7R A;  3QBM A;  3IH4 A;  4W1U A;  4NN1 A;  2JJ7 A;  4GFL A;  3C07 A;  2HXO A;  4ME9 A;  3LSP A;  4M3E A;  3WHB A;  3BTJ A;  2G7G A;  2G7L A;  4X1E A;  3Q0U A;  4GCL A;  3IH3 A;  2D6Y A;  3Q0V A;  3T6N A;  1JTY A;  1JUM A;  2B1E A;  2OPT A;  2WGB A;  3BNI A;  3NRG A;  3Q0W A;  5CQG A;  4GCT A;  2B3W A;  4GCK A;  2OF7 A;  3DEW A;  5EFY A;  4JKZ A;  2DG7 A;  2Y31 A;  3CWR A;  2G0E A;  3SDG A;  2XRL A;  3CJD A;  3Q3S A;  5F0H A;  5F04 A;  2JK3 A;  3GEU A;  3SWH A;  2R7W A;  2VKV A;  3PPB A;  2O7O A;  4OD4 A;  5F27 A;  3QKX A;  3BQZ A;  5K7F A;  2O7T A;  3IH2 A;  5IOZ A;  5IOY A;  3LJL A;  2QKO A;  2TRT A;  2ZOY A;  5K7H A;  2ID3 A;  2NS7 A;  2DTZ A;  2IU5 A;  4YZE A;  1U9N A;  1JT0 A;  5D1R A;  5K58 A;  1QVT A;  2R7Q A;  1RKT A;  4DW6 A;  2XPU A;  2QCO A;  5C4Y A;  4HKU A;  4W97 A;  2XB5 A;  3BR1 A;  4NEL A;  2UXU A;  3VVX A;  1JTX A;  3BJB A;  4V2G A;  4D5C A;  2R7X A;  3DCF A;  3BHQ A;  2R7V A;  3VTI A;  3BTL A;  4AF5 A;  4M3D A;  2NP5 A;  2XGE A;  1JT6 A;  3NI7 A;  2HQ5 A;  3BCG A;  3HGG A;  4MK6 A;  2X9D A;  3VVY A;  1QPI A;  3VIB A;  3ON2 A;  2PFV A;  1SGM A;  3BR0 A;  3O8H A;  3BT9 A;  3FHN A;  4WIB A;  5HSZ A;  3HE0 A;  3HTH A;  3BR5 A;  2UXP A;  3AQS A;  5IPA A;  5H9T A;  3ZQL A;  4MO7 A;  3EUP A;  3EGQ A;  3HTI A;  3ZQI A;  3ZQF A;  2ZB9 A;  3MVP A;  3P9T A;  4GFK A;  3LSR A;  2GEN A;  4ICH A;  3FK7 A;  4U9N A;  3F1B A;  3ANP A;  4ABZ A;  3BTC A;  3BQY A;  1QVU A;  2Y30 A;  3G1L A;  5K7Z A;  3FK6 A;  5FKK A;  3S5R A;  2HXI A;  4B3A A;  3VUQ A;  2ZY9 A;  2RAE A;  1Z0X A;  4JL3 A;  4JNN A;  5DAJ A;  2ZOZ A;  4B1R A;  3DU6 A;  3BR2 A;  3FIW A;  3B6A A;  1U9O A;  3RD3 A;  2IBD A;  3VPR A;  1RKW A;  3V78 A;  2WUI A;  3SFI A;  4D7N A;  5J3L A;  2FD5 A;  5F0F A;  2XDN A;  3VW0 A;  2FX0 A;  2RHA A;  2DG8 A;  2R7R A;  2Y2Z A;  2QOP A;  3V6G A;  2UXH A;  3KKD A;  3PAS A;  4PXI A;  3LWJ A;  4DVY P;  3C2B A;  3FRQ A;  2UXO A;  3VVZ A;  3ZQH A;  5CXI A;  2XPV A;  2QWT A;  3MNL A;  4XK4 A;  2XGD A;  3BRU A;  3HIM A;  2X6O A;  2V57 A;  3CDL A;  3QPL A;  3NPI A;  2R7S A;  5FKN A;  3BR3 A;  4V2F A;  3VW1 A;  4G12 A;  2NP3 A;  3KZ9 A;  1RPW A;  5GPC A;  3RH2 A;  5EYR A;  2OER A;  2GBY A;  5FGL A;  4M3F A;  3CCY A;  4D7M A;  4I6Z A;  3ON4 A;  3PM1 A;  2R7T A;  5J1R A;  3QPS A;  2G3B A;  3CRJ A;  2F07 A;  3HTA A;  5F0C A;  3NS4 A;  3ANG A;  3K8P C;  5HAW A;  3LHQ A;  3B81 A;  5EZG A;  2HYT A;  1T33 A;  2TCT A;  3F0C A;  2XPW A;  4KWA A;  2GUH A;  2YVH A;  2W53 A;  2IAI A;  3WHC A;  3JSJ A;  5IP6 A;  4L62 A;  2QIB A;  2IEK A;  3G56 A;  2FBQ A;  5CXG A;  1Z77 A;  2ZCN A;  4OD5 A;  4M3G A;  3LSJ A;  1JUS A;  3NXC A;  3G1M A;  5EZH A;  2EH3 A;  2HKU A;  5FKL A;  2FQ4 A;  3TP0 A;  5F08 A;  2HYJ A;  2OI8 A;  2ID6 A;  5FMP A;  3VW2 A;  1BJZ A;  3LOC A;  1UI5 A;  1ORK A;  3KNW A;  1JUP A;  5FKM A;  5J1Y A;  3GZI A;  3B6C A;  3VOX A;  4CGR A;  4MXM A;  1ZKG A;  2PBX A;  1ZK8 A;  1VI0 A;  2G7S A;  2NX4 A; 
#chains in the Genus database with same CATH homology
 4U9L A;  2ZY9 A;  4WIB A;  2YVX A;  4U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...