3BQZA

Crystal structure of the complex of malachite green bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 77
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bqzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bqzA02
2DMQA 2W48A 1VI0A 1DU6A 1ETXA 4DYRA 1U78A 1X58A 4JKZA 4JP0A 2M34A 4A3IJ 2MG4A 5JLWA 4ME9A 2NS7A 2QIBA 3A01A 1ZGWA 4MIMA 4BY1J 3BR3A 1GV2A 2V57A 5F08A 1I3QJ 4AC0A 3VUQA 2VI6A 2JMWA 4JNNA 2VPRA 3CWRA 2HOSA 4GFLA 1B72A 1QVUA 3BHQA 1AKHB 2Y30A 3BR2A 3ZQFA 4UUTA 4D7MA 3PM1A 5JLXA 1GV5A 2G7GA 5J1UA 2NX4A 1JGGA 2DA5A 2XPWA 3S14J 3NRGA 1BJZA 4GFKA 1FIAA 5IP9J 3SJMA 2H1KA 2FBQA 4FE4A 3M3YJ 5F1JA 3S2DJ 2UXIA 3LSGA 1MBGA 3A03A 2HOTA 2DMPA 5F0FA 4HKUA 3JRIA 2UXHA 4M3GA 2R5YB 3QBMA 1I50J 1JUPA 5E3OA 2LR8A 2XSDC 1PUFA 5FKNA 5C4JJ 4W1UA 3HOZJ 4XIDA 3NARA 1K83J 3HGYA 3S1NJ 2REKA 1E3OC 2L9RA 2CQXA 2WV1A 2FD5A 2Y31A 5FKMA 2NVTJ 2ZOZA 2LD5A 2XDNA 3ON4A 2G0EA 1FEXA 4KWAA 3BQYA 2E1OA 5M5XJ 3BR6A 3JRAA 3BRUA 2HKUA 5CXIA 4QIWN 3GBGA 5EYRA 5E3MA 3L1PA 3HTIA 5K7ZA 3A02A 2NP3A 4M3BA 3TW6A 5M3FJ 3ZQCA 2ME0A 2XGEA 4MLOA 3JREA 5FGLA 4RDUA 3G1LA 4AC6A 3P9TA 5H9TA 1QPIA 2GLOA 3CDLA 4GFBA 1MH3A 2H8RA 4GCLA 3HOVJ 3GZIA 3T6NA 4EEFG 2DA3A 2ID6A 2KDZA 3RZDJ 3W6VA 3S1QJ 3KKCA 3HEFA 5FLMJ 3HE0A 3KKDA 2EBIA 3O60A 2DG7A 2EZHA 2NOGA 2Y9YA 5FMPA 3D1NI 5J1RA 1WI3A 2NVQJ 1JUSA 4FCYA 1BW5A 1TWCJ 4G12A 5GPCA 3PO3J 3K7AJ 4BBRJ 2FJ1A 2XB5A 2JA6J 3E7QA 1JUMA 3Q0UA 3ZQLA 3S5RA 1P7JA 4JYKA 3G56A 2AO9A 3BG3A 3O8GA 1JT6A 3ZQGA 3BNIA 2OI8A 5CW8A 4GCTA 2DA1A 1A6IA 2DTZA 2Y0SN 3RH2A 3ZQIA 3PPBA 3VOKA 3S2HJ 2QOPA 4QTRA 2CUFA 2JA7J 1IC8A 3BT9A 3IV5A 5EG0A 4X1EA 5GPAA 2GFNA 3H3VK 2E2HJ 4UUSA 3RKQA 3DCFA 1Z77A 2K9SA 3S17J 3HM5A 5IOZA 3SDGA 3IUVA 2M0CA 3O8HA 2QWTA 3IH2A 4FE7A 1CQTA 5M3MJ 2X6OA 5BNGA 1ZR2A 2O7TA 2VUMJ 1X2MA 2OPTA 5F27A 3TP0A 2EQRA 1ETQA 1MH4A 1UG2A 4DZPA 1MSFC 4A3KJ 2QF7A 2LLKA 4IHWA 3DPJA 1JJ6C 2RHAA 1FIPA 2LY9A 2Q24A 5D19A 4BKXA 3E7LA 4ICHA 5K7HA 2IU5A 2CRGA 1SFOJ 4L62A 1ETOA 1LFUP 1U9NA 2ID3A 3VPRA 1EF4A 2FX0A 1BA5A 2IEKA 1H89C 1MBEA 5GP9A 5C4XJ 3GTLJ 2DA4A 2NS8A 2LKXA 3BR0A 2I10A 2M2EA 4B3AA 4XRMA 1ORKA 4NDLA 3JRDA 4UDSA 1ZTRA 2HXOA 2NVYJ 1VFCA 4NELA 2LK2A 2DA2A 3HKZN 4IHYA 1VF9A 2EZLA 4V2FA 3BTJA 2R5ZA 4I76A 9ANTA 1Y1VJ 4D5CA 5F0HA 5IP7J 4MXMA 3JRCA 1NK3P 1ZR4A 1ZQ3P 3V6GA 2L7FP 1UHSA 3NXCA 1WGXA 2ECCA 1MBKA 5EZGA 3HOXJ 1JT0A 3GEUA 5AQCA 2JK3A 3BTCA 4XRSA 3JRBA 5D18A 4GCKA 3LNQA 3CJDA 1OCPA 3OOUA 5IYDJ 5IP6A 2QCOA 1XC5A 4M3EA 4A3MJ 4C3JJ 3OSGA 2HQ5A 5C44J 4ABZA 4A3LJ 4AF5A 2GUHA 3Q0WA 1ETWA 2WUIA 4AUXA 2WGBA 4Y52J 2E19A 1POGA 2Y2ZA 3HTJA 3MVPA 1HOMA 2DA6A 3EGQA 5EZHA 3VW2A 2K9QA 5FKKA 4DYQA 4A3CJ 2RAEA 2XGDA 2XPUA 1F36A 2MGQA 2R5ZB 3F1BA 1ITYA 3Q3SA 5C4YA 2GBYA 3BTIA 2ELKA 3B6CA 5EG0B 1B72B 4M3FA 3BR1A 2IBDA 2XB0X 3VVYA 2DMNA 2P81A 3JRGA 1IV6A 3GTGJ 1T56A 3VOXA 2R93J 4X6AJ 4M3DA 2O8KA 3I4MJ 1WCMJ 1OFCX 2B63J 3KNWA 4L5EA 1APLC 3LSPA 1G2HA 2D6YA 5J3LA 2R0QC 4J19A 5K58A 1H8AC 1Y1WJ 2TCTA 2ME6A 2LTPA 1QRYA 1H88C 2QKOA 5IPAA 3PASA 2DN0A 2YU9J 4DZJA 1GVDA 5EEAA 3KZ9A 2GM4A 1TWHJ 2EH3A 5EDNA 1IDYA 2VKVA 2WAQN 2NP5A 2ECBA 3GTKJ 4LOCA 2ZCNA 1AU7A 4RBOA 2XGCA 3BTLA 2O9LA 3G7RA 1RESA 4XICA 2MSYA 2ZB9A 5F04A 4BY7J 5DAJA 3OSFA 2EZIA 3SFIA 1HCRA 3VW0A 3AQSA 3FK6A 5FJ8J 4UUSB 2UXPA 1LFBA 3F0CA 2ZCMA 3K2AA 3HB9A 3OIOA 3LOCA 2VKEA 5E3NA 2NVXJ 2RASA 2OF7A 3Q0VA 5C3EJ 3LSRA 4PXIA 2JWTA 1JKPC 1D5YA 2XRLA 2HYJA 5D1RA 3HTHA 1MSEC 4C2MJ 3ANPA 3ANGA 1FTTA 1JTXA 3BCGA 1HDPA 2KT0A 1IGNA 1MNMC 3AQTA 4JX4A 3HDDA 1VNDA 4AYBN 1IJWC 2D5VA 3NNRA 2K40A 1NK2P 3B81A 2TRTA 3G1OA 2JN6A 4JL3A 5IYBJ 2M8GX 3S1MJ 1JKOC 2OERA 1B8IB 1O4XA 3B6AA 3G1MA 2E2JJ 4A3JJ 3GTQJ 2PBXA 3ON2A 1GT0C 3IH3A 4C3IJ 2GENA 5EFYA 4BXXJ 3PO2J 1HDDC 1RETA 4A3EJ 3TW7A 1PUFB 1ENHA 1WPKA 5IYCJ 1RKTA 3QKXA 3HGGA 3HOUJ 3HBLA 1IDZA 2DMTA 4ACIA 5FHPA 3HTAA 5FKLA 1AHDP 1BW6A 3MN2A 3BG5A 2ZCXA 5HODA 2QTQA 3QPLA 3LJLA 2YVEA 1Q1VA 4MO7A 3NI7A 2UXUA 4A3GJ 4IHXA 4BBSJ 4IEJA 3DEWA 3JR9A 4FTHA 1RKWA 3M4OJ 1MBHA 2HXIA 4A3DJ 1OJLA 1AKHA 1LE8A 1WH7A 2R7ZJ 2PZ9A 1SANA 4I6ZA 4CGRA 2L0KA 4CYCB 1P7IA 2Y9ZA 1WH5A 1GDTA 4A93J 1JJ8C 4A69C 3BR5A 3RZOJ 1UI5A 1DU0A 1K61A 1MBFA 4JX6A 1A5JA 1GUUA 1I6HJ 4IHVA 3VP5A 2M9HA 1UMQA 3ZQHA 2ZOYA 2G3BA 3VVXA 3QPSA 3S16J 3CMYA 2AHQA 2K9NA 2R5YA 2CQQA 2LP0A 2DMUA 3RQIA 5EGOA 3NAUA 5J1YA 3C07A 3I4NJ 1ETVA 1F43A 1HF0A 2O7OA 1JKRC 2PMZN 2JA8J 1X2NA 1IUFA 3BQZA 2MW8A 4XK4A 5HAWA 2HI3A 2N8GA 1MBJA 3H0GJ 2HYTA 3FRQA 3NPIA 4MK6A 4XRSG 3GTPJ 1IRZA 3JSJA 1SGMA 4CYCA 5E3LA 4FISA 1QVTA 3GTJJ 3GTOJ 3A01B 2HOAA 1LE8B 5DS9A 1HLVA 1YRNA 2R92J 1ETKA 2YVHA 2JA5J 3MKLA 2COBA 1RR7A 3TEDA 5FLVA 3FISA 3JRFA 3HOWJ 1OCTC 1R9TJ 2WB1N 4DW6A 4DYCA 1U9OA 3VVZA 3IH4A 4JX5A 3HIMA 2LFBA 4C3HJ 4MFEA 1ZK8A 5EGOB 1TWGJ 3CQZJ 5M5YJ 1TC3C 5CXGA 5M5WJ 2LVSA 1Z0XA 1BL0A 3V78A 3BJBA 3HOYJ 3CRJA 4QSHA 3UKGA 2X48A 1XS9A 1S7EA 2G7SA 1TWAJ 3CCYA 3VIBA 1RPWA 1IG7A 3JRHA 1B8IA 4V2GA 1XG1A 5IOYA 5F0CA 3LSJA 4D7NA 5HSZA 3EUPA 3FKIJ 2DJNA 3TP3A 1ETYA 3WHCA 2CUEA 1T33A 2XPVA 3S1RJ 1W0TA 1YRNB 2G7LA 1ZKGA 2YS9A 2UXOA 4B1RA 3BG9A 4D5FA 3MNLA 3C2BA 3RD3A 2L7ZA 2L7MP 4M6VA 3LHQA 4HNVA 4YZEA 1FTZA 3FIWA 2FQ4A 1FJLA 4B4CA 2EZKA 3VW1A 2W53A 3LWJA 3GTMJ 2CJJA 1NTCA 1W0UA 5EF6A 4NN1A 3FK7A 3QQAA 1TWFJ 5HBUA 2E2IJ 5K7FA 2CU7A 4MFDA 2F07A 3WHBA 2HDDA 4A3FJ 3S15J 3COLA 3ZOBA 4S0HB 2DG8A 2YUSA 4W97A 5DTDA 1U8BA 1JTYA 4Y7NJ 2JJ7A 1JKQC 4A3BJ 2IAIA 2X9DA 2DA7A 1UI6A 5FKOA
chains in the Genus database with same CATH superfamily
2DMQA 3HTSB 4RAFA 1DU6A 2EA4A 4M6YA 2GWRA 3F8CA 3VYRB 5A2QK 3E97A 4DYRA 1X58A 4RS8A 4JP0A 2M34A 4A3IJ 2MG4A 3PL8A 2HZTA 3P7NA 2RVCA 4MIMA 4BQQA 1J9IA 2UWMA 3OR2C 2H27A 2CGPA 2OUMA 3ZCOA 5F08A 2VI6A 1O3SA 1E0EA 3CWRA 2KRCA 2VODA 2OCEA 1OR7C 4UUTA 5JLXA 2IA2A 2XKOA 3EUHC 3SEQA 3TO7A 4HQMA 2DA5A 3OOPA 3S14J 3W3CA 1IRGA 4IL6C 2OA4A 4CZCA 4L9TA 3O2PE 1U6GA 3NRGA 5TJJA 1LUJB 5CVUA 1P4XA 3L2UA 1XB4A 4KN4X 4RGUA 2V6EA 1MBGA 4G6QA 3A03A 3EQLF 1ZGAA 5BS6A 2L9VA 3JRIA 4M3GA 4XONA 4AU7A 3F23A 2XSDC 2VB6A 3FXUA 5DV5A 3NARA 1K83J 3CP2A 2BOLA 1J5YA 5BPDA 1Z3XA 3V7CA 2Y31A 5FKMA 1UB9A 1Z6TA 1Y0NA 1RC9A 3CF2A 2E1OA 5M5XJ 1T0FC 1FOWA 4KMFA 5J8CA 2NAZA 3OYCA 3GBGA 5E3MA 2PJRA 5DCMB 2NP3A 4M3BA 4ZYEA 3J7AY 3ZQCA 1O7FA 3SDBA 1FX7A 4PK4A 3ECOA 2BVMA 3MZYA 1X3UA 3WTTC 5L3DA 4NUBA 4XLFA 3VOEA 3K0LA 3U2RA 2DQRA 4EEFG 4N4OB 3S1QJ 2PMZA 3HEFA 3HE0A 3DV8A 3O60A 2NOGA 2Y9YA 1WSUA 4PFOA 3EUHA 3D1NI 1G4DA 3TOAA 3IWFA 1JUSA 1R1UA 2RN7A 4FCYA 3VYUB 1O3QA 3K7AJ 5ILUA 2XB5A 3A2KA 3AG3H 3Q0UA 2KIMA 1J0RA 3ZQLA 3S5RA 3H5AA 3G56A 2IP2A 2K9MA 2AO9A 3BG3A 2DK5A 2OI8A 4E6KG 3HYIA 3K4LA 1YS6A 5CW8A 4ON0A 1A6IA 2D2WA 3ZQIA 3PPBA 4BE0A 2CQKA 2VC1A 3ZQQA 5HS7A 3IKTA 1IC8A 5DYMA 3BT9A 4ZDPA 3IV5A 3LA7A 4F93B 3AL0C 3BJAA 4E7LA 2AXTC 4YIRX 3J7YJ 2E2HJ 3H3VK 3DCFA 2RV8A 4KIBA 2BW3A 3BZ6A 5IOZA 3CCEI 3SDGA 4KISA 2QWTA 1I27A 1CQTA 3W6JB 3I3LA 1ZR2A 2OPTA 4BAYA 2EQRA 2M30A 2A3SA 3FXRA 3ZXSA 1MSFC 2IGOA 2LLKA 1JHFA 3ULQB 2HEOA 2RHAA 2LKSA 3BY6A 2CH0A 4BKXA 3E7LA 4QLCU 1USTA 2CRGA 5CVRA 2QQAA 4YEJA 1JI8A 4KIGA 4HF0A 2FX0A 5GP9A 3MKYB 3BJOA 3DFGA 2NS8A 3L2QA 2LKXA 1QZEA 2FJI1 3OYFA 4NDLA 2NVYJ 1T8IA 3GFJA 4IQJA 3WE3A 3S32A 4IHYA 1BI2A 1QBJA 2EZLA 4EJUA 4BHCA 1R1VA 3BTJA 2R5ZA 4WK8F 4Y4RA 3CF5F 4Y33A 4PSWA 3FMQA 3OYIA 3KLOA 4KUMA 3QP6A 2GOMA 3GLXA 1ZR4A 3OL4A 1VQ8I 2BEOA 2L7FP 3HUGB 2NNYA 3FXLA 1K78B 1SFKA 1B1BA 1SEUA 1FWZA 3GEUA 2JK3A 4Z2YA 4I98B 3I59B 3K70D 4BQNA 1OCPA 1UFMA 3OOUA 1R7JA 2CW0F 4M3EA 4LLNA 3OSGA 5KNLA 4A3LJ 4AF5A 1X1DA 2OU2A 4Y52J 1V3FA 2E19A 5A2QZ 2F6CA 1JXSA 3HTJA 1E3PA 3EGQA 5EZHA 2K9QA 1I1SA 4C30A 3H1CA 3DTIA 3T5XA 1XDSA 4MQ9F 3LAPA 3F1BA 1ITYA 2C6YA 4P1WA 4KYWA 3EUAA 1TBXA 3PUFA 3C2GA 1NHAA 1D3YA 1O57A 4ZTJA 3S3NA 2EWNA 2J5OA 2XB0X 3VFZA 3QYBA 2ZXJA 3PNYA 3GXOA 4XLCA 5LFAA 2VONA 3L7WA 1RRJA 2GXGA 3J81K 2O8KA 1WCMJ 2Q2EA 4L5EA 1G2HA 1LEAA 4R8HA 2CQNA 1LJ9A 4HX4A 2BBYA 3TO6A 3CMAI 4J19A 1H8AC 2HVRA 2VQCA 1R4MB 1U0JA 1G6NA 2AQFA 2QKOA 2FSWA 4IOCF 1USSA 4QPOA 3PASA 2YU9J 3ZMSA 1KYZA 3DQVC 2F4IA 5EEAA 2GM4A 2DTRA 4BE1A 2FNPA 5EDNA 1IDYA 2NOJB 1SVLA 2KZGA 2Q0OA 1FLIA 2M8EA 1W5SA 3WTUC 2VKDA 2VT3A 4U7BA 3OMYA 2XAFA 3G7RA 4XICA 1YG2A 2MSYA 5F04A 3U1DA 1K7AA 3PIPF 3SFIA 1HCRA 3KYDB 4BL0B 3GO5A 3FK6A 3EDPA 2UXPA 2K86A 2Y0MA 1RNLA 1OQYA 2DO7A 5IT9Z 4N9HA 4WIBA 3L2VA 3QOEA 5E3NA 2ZXIA 1FPQA 2LOOA 2O5RA 5C3EJ 3R60A 2XRLA 2HYJA 1UELB 2K3FA 2VBWA 4C2MJ 4IVNA 1YQAA 2RNJA 4HV6A 4AYBN 3OYBA 2VXZA 3F21A 3S1MJ 4E70A 1UCRA 3K9TA 2K9LA 5DM6F 3RI4A 1I39A 1R4NB 3G1MA 2L02A 2E2JJ 2X1EA 2P4WA 3RSNA 2KHMA 1GT0C 2WBMA 2ZO4A 2GENA 5EFYA 2CS3A 2DJIA 5D5WB 3OYAA 3DEEA 4IRHA 3CLQA 1ENHA 1WPKA 1RKTA 2F48A 2RQQA 3RKXA 1OCOH 1D0XA 3IC7A 4NNJA 1IDZA 3EYYA 2DMTA 2HKXA 4ACIA 4BDZA 2BV6A 1XX5A 2ZCXA 3TMOA 3HHGA 1ZLKA 3LWFA 2PFVA 2YVEA 3RTRA 3LJLA 4P96A 1S7AA 3BG7A 2UXUA 4B43A 3KP3A 1W5TA 4IEJA 3JR9A 4FTHA 1RKWA 1MBHA 2K27A 2HXIA 1MDMA 1RUOA 2PZ9A 2VKHA 4I6ZA 5CJ9A 3O6BB 4I02A 4CA0A 3RZOJ 4EJOA 2RNGA 4II3A 2ELJA 2FBIA 3WU1B 3LQQA 1YW8A 3TDZC 2CG4A 1A5JA 3B02A 1I6HJ 4IHVA 1EJ9A 2O03A 1N75A 2M9HA 4KFCA 3G3ZA 4IO9F 4PSXA 2K9NA 3BROA 4UB8C 2GA2A 3NAUA 4HV5A 2B0LA 2V26A 1QZZA 1LDDA 4MEXF 4GDFA 3CCQI 1F43A 1HF0A 2WB1A 2EPFA 3RKWA 1BBYA 4EQQA 2ZFWA 2CMPA 3P9CA 3JAMK 3VEPA 1U2WA 4UV8A 1K6YA 4DBQA 1J7KA 2BYVE 2L7KA 2VXDA 3DKXA 3QODA 4XQFA 1BC8C 3LQRA 1IAWA 1TW2A 1QA6A 2WC2A 2XUBA 3ESWB 3ZMUA 1GVJA 3KEOA 2VASA 4XRSG 3HIFA 1J09A 2ZY9A 2WA0A 2W1OA 5BQTA 1SGMA 2M87A 2OZUA 3JSPA 1WJAA 2EV6A 1QVTA 3AG2H 5LGNA 2X1CA 1D1BA 5DS9A 2G9WA 1HLVA 2DW4A 3OS0A 3DPTA 2OC6A 2YVHA 1ZG5A 1IO2A 4IHTA 1QGPA 4WXDA 3H9GA 3IAM2 3ZMTA 5FLVA 2VQHA 5HNHA 5EJCA 4IF4A 5KAFC 3HOWJ 1OCTC 1MMDA 1R9TJ 4DW6A 4DYCA 1I5ZA 2LSOA 3KLNA 3IH4A 3HIMA 2LFBA 3R6SA 3CQZJ 2WWYA 5M5YJ 3PSFA 2JPBA 2VE9A 5CXGA 5M5WJ 3IHUA 5GADJ 1XMAA 4E7IA 5FFXA 4BJTA 1X1PA 1XSDA 4EM2A 2QVOA 3BJBA 3CRJA 5E20A 4PGHA 3CD6I 2HDCA 4UVCA 1MGTA 3FXKA 1TNTA 1TWAJ 3CCYA 3TL4X 1FOXA 1WJCA 3H0DA 2DODA 1RPWA 2H94A 4V19K 3JRHA 1G3WA 2V4JC 3AL0B 1XG1A 2M7BA 2WY8Q 4CGZA 2W7NA 2DJNA 1ETYA 4CO8A 4C9YA 4RB2C 1T33A 2XPVA 3I9V2 1YRNB 2H09A 2ACJA 5H6RA 3BCBA 3PFIA 3DBHB 3MNLA 3B73A 2KMUA 2L7ZA 2A68F 4M6VA 4EMSA 4PDKA 2R7VA 3LHQA 2CSOA 2V1XA 2W53A 3GTMJ 4NN1A 2DOAA 4BEHB 3BC8A 3ABTA 2JUGA 1TWFJ 4UVAA 3KX2A 5E1ZB 5K7FA 2CU7A 2JVGA 3F8MA 4I2OA 2G7HA 2NVUB 3WHBA 4A3FJ 3GYHX 2JZYA 3BWGA 3S15J 1DPUA 1G3SA 2LF8A 2YUSA 2PG4A 3FDYA 3C3WA 1IXCA 1FSHA 3BG6A 1U5TA 1U8BA 1JTYA 2ZXWH 3GMEA 3S3OA 1NG7A 1UI6A 1Y0UA 2W48A 1VI0A 1AOYA 1PYVA 1SVOA 2X51A 2CW7A 4JKZA 4OMZA 1R5ID 2F2EA 3GWZA 5JLWA 3IWZA 4Y17A 2NS7A 2EINH 2TDXA 3A01A 3KPHA 1O3TA 1YLFA 1YJ9I 2W00A 4AC0A 4LLGF 3FXOA 2HU9A 1B72A 3F8BA 3QU6A 4DGWB 4D7MA 3PM1A 1GV5A 4MHGA 1JGGA 4IXAA 4EVIA 5BPIA 1BJZA 4GFKA 4CICA 1FP2A 5IP9J 2E60A 1FY7A 1FOYA 3L09A 2H1KA 4X0GA 2PI0A 5F1JA 3S2DJ 2IS6A 3V8LA 3KZYA 2NXNB 2IPQX 1U5TC 3I54A 3M1EA 3LFKA 4MEYF 4EJWA 2V1DA 3GFMA 4HKUA 5L3FA 3OYKA 2R5YB 3QBMA 5CLSA 1Q1HA 1I50J 1JUPA 2XSJC 3D5RC 5B3SH 2YX4A 1PUFA 2P5VA 4RLFA 3HGYA 3S1NJ 4F7ZA 4YELA 2B1EA 2REKA 1DGRM 2JUCA 3TDUC 2CQXA 1XMKA 4A12A 3MKZA 1D1AA 2V9VA 2XDNA 5ICEA 4H4KC 4KWAA 4WWCA 5DDGA 4NC6A 3JRAA 2VT2A 3MEXA 2HKUA 1BC7C 3RYPA 1ULYA 2EFPA 2ZSIB 3TW6A 3P9KA 2ME0A 4M71A 4HLYA 4LG0B 1P9QC 2XGEA 5FGLA 3U1KA 4AC6A 4NQWA 1HBXG 1XGNA 4ENJA 2GLOA 3CDLA 3ML6A 4GFBA 4GCLA 1XSVA 3R61A 4EGZA 3HOVJ 4IQ4A 2HZDA 2M45A 3GZIA 5F64A 1H0MA 3T6NA 2VBZA 3W6VA 1X1BA 3VODA 4AVPA 4DOZA 1KU3A 3I4PA 5ILVA 2EBIA 2YSRA 5D4SA 2EZHA 2DG7A 2XKPA 1REPC 1WI3A 2NVQJ 5L3CA 4G12A 4M9SA 1QNTA 3UR3C 4RB1A 4HNTA 3HOTA 1R23A 2KQRA 1IUYA 3E7QA 1YE9A 1JUMA 2H1LA 2YR2A 3E5QA 4GXOA 4JYKA 4KIFA 4ZYAA 5FLXZ 3O8GA 4L5IA 1JT6A 1OISA 3SFZA 2F5FA 3E0JB 4ZYDA 1Z1DA 2GA1A 3ERED 3F72A 2DA1A 3RH2A 5E18F 2BHZA 2CUFA 2CO5A 3WE2A 4MTEA 2BY3A 4A5MA 2JA7J 1Z05A 3V8KA 2R7DA 3CESA 1ERDA 5GPAA 2GFNA 5EEHA 4UUSA 3RKQA 1ZLJA 1Y8QB 1YYVA 4AIDA 2K9SA 2CUJA 2KPMA 3IUVA 2M0CA 4HPQA 5LGUA 3IH2A 2KDOA 1R00A 2X6OA 3VSLA 5M3MJ 2PEXA 2E71A 4IRIA 2GIZA 1X2MA 4OIOF 4A0YA 1TL8A 3RKYA 1X4OA 1MH4A 5H2FC 5J47A 4O6JA 3AAFA 1FMWA 4U0VA 2DYSH 2XC7A 3ABMH 4A3KJ 1JJ6C 3REOA 2Q24A 2GAUA 3OIPA 2PFBA 1YITI 2M4GA 2L9SA 4F3QA 2IU5A 4HNUA 4RA2A 2OV7A 1KYWA 3KYCB 1HKSA 3F3XA 4LJZF 1H89C 2M3AA 1A04A 2ESHA 3DU5A 5C4XJ 2DA4A 4LG0A 4Q5SF 4ZH4F 2IA1A 2I10A 2L01A 3OYNA 4LMYA 4BQAA 1VFCA 1DUXC 4XOTA 4RGRA 5ED4A 1FNNA 3QP5A 3OS2A 5JI6A 2A5YB 3ZQ7A 1Y1VJ 1B9MA 5F0HA 4NHJA 4E4HA 1TNSA 1ZQ3P 1P4AA 1Z3YA 4HSRA 1WGXA 2XF5A 2P6TA 1Y8RB 1JT0A 2A6EF 2DOEA 4RB3C 5AQCA 2KIUA 4B09A 4XRSA 5D18A 4GCKA 2E5NA 5KK1A 3CJDA 2CFOA 2HQAA 1KGSA 2VIXA 1FOKA 2UV1A 4C3JJ 3M7GA 5C44J 2BY0A 1R5HA 1ETWA 3Q0WA 1KONA 2X6WA 2E1MC 3KP2A 4KICA 3HRMA 4AUXA 5IT3A 1WJEA 2LDUA 1Y39A 4IHSA 3MVPA 4WCGA 3I5UA 3K1MA 1MKMA 1KZHA 5FKKA 1SAXA 2RAEA 2XGDA 4KT6A 3GUDA 1FZPB 2PLYA 2P0WA 3DLAA 2PJRB 3N05A 5L3GA 1DDNA 3WU2C 4M73A 1XSXA 3BTIA 1SFUA 3PQJA 2JA2A 5HOOA 5EG0B 1B72B 2IBDA 2CQ7A 3VVYA 1WFXA 4ZJZA 1IV6A 2Y75A 3R0AA 4PJJA 2R93J 3I4MJ 4IJAA 5K5RA 2BXYA 4LITA 3OYGA 2B63J 3KNWA 2E5ZA 2UXXA 1APLC 2VJ5A 5J3LA 4CSWA 1DP7P 2E7XA 1TP4A 3N97A 1Y1WJ 5AIPA 1IXSB 1QRYA 5FLXK 1DGWY 1I6XA 1MW7A 1ZG1A 5FFZA 2DN0A 3LA2A 4I09A 4PJNA 2KJCA 2XAHA 2O6GE 2VKVA 2FNAA 4XORA 2ECBA 1B9NA 4LOCA 4RBOA 5FROA 1R58A 2QUFA 2ZB9A 4BY7J 5DAJA 5FD5A 2EZIA 4XKBA 4E7HA 2MFZA 3VW0A 5K1YA 5FJ8J 3NEUA 4UUSB 2B3WA 4Y13A 1FMVA 4ETSA 2W4SA 3HSRA 3K2AA 3HB9A 3OIOA 2VKEA 3CTAA 3T0YA 3W6KB 1WWXA 5J4VA 1HA8A 2RASA 1IRXA 2OF7A 3F6VA 3QWLA 5CQGA 1SFXA 2H8WA 2QSGX 4JQFA 3M07A 2R7UA 2ICWG 2KT0A 1IGNA 2L3DA 2XAQA 3H35A 4OD5A 4M72A 1WI9A 4XR6A 3HJEA 2FBKA 2TRTA 4L0ZB 5J40A 5L3BA 2KRFA 4I0BA 3B6AA 4U9NA 4A3JJ 4D0PA 1PP8F 4NB5A 2DFEA 1B4AA 1E2XA 4OIRF 2AXLA 2CW8A 4S05A 2GOXB 1NH3A 4FQGA 2EB7A 2JPCA 3V42A 4KA4A 3ASOH 1EH6A 3E6MA 3PSIA 2RC4A 3ZMZA 3HBLA 3ZN1A 5HLGA 4U0WA 4U9LA 3HRSA 2QKMB 1Z67A 1IN5A 1V5EA 4PJLA 3BG5A 4KITB 3VYTB 2HFHA 4ESBA 1QQIA 3FMRA 4QWQA 3RQ4A 1Q1VA 4MO7A 4ZYHA 3NI7A 4CH7A 2K7LA 1K6OA 2ESNA 3FM3A 2XRNA 1SD4A 2V9PA 3DEWA 1FBUA 5J8FA 5D6EA 3PNVA 2XIGA 1AKHA 2D45A 3A0HC 1SANA 4CGRA 2L0KA 4B48A 2Y9ZA 5E1XA 4HW0A 2DPUA 3BR5A 1YOVB 4P55A 1BI3A 4LIUA 2HGCA 1GUUA 3KCCA 5TRDA 4S04A 2LY2A 2E34A 1UMQA 3CUOA 3ZQHA 4ESJA 4A5NA 4UV9A 3KEYA 3QPSA 3S16J 1PVEA 2AHQA 2R5YA 4D1QA 3K1PA 3ABUA 4P9FA 5J1YA 3H92A 5HDGA 4B8XA 1YJWI 1VQ6I 2COMA 1YFHA 3CJNA 1BM9A 4ZZDA 2LH9A 2VJ4A 2VBXA 2JA8J 4EV0A 3BQZA 3H3UA 2MW8A 4XK4A 5HAWA 4CCMA 2N8GA 3K8PC 1SD7A 3H0GJ 2EA2A 4FX0A 4Q48A 4MK6A 3DPUA 2HOEA 4LK1F 3JSJA 1UHWA 4FISA 5TISC 4UY8I 3QYEA 3GTOJ 2ELHA 3CCVI 3C18A 3A01B 1G59A 2MA3A 1YIJI 4B44A 4ZTFA 1ETKA 4MQVA 5JFRA 1MDMB 2BXZA 2YPRA 4EM1A 2COBA 1RR7A 1KQ9A 1U9OA 5E79C 1MMSA 2KJBA 4CUGA 4CYDA 4C3HJ 4MFEA 5EGOB 4I7HA 1ZN2A 5GAHJ 4KJZA 4YFNF 3O3KA 1G3TA 4HA8A 4HRIA 3T8RA 3LAJA 2FRHA 3HOYJ 3UKGA 2X48A 2MD5A 4CCOA 4BEHA 2G7SA 2FF4A 3LSMA 3SYTA 1WJDA 5DD8A 2HKOA 4BH9A 1HSTA 1BI1A 3NQOA 3BZKA 3HXLA 1YS7A 5DUIA 2DU9A 3PFYA 4V2GA 3AG1H 5IOYA 1T2KA 1IRFA 4G7HF 1EA3A 2K4BA 2KP6A 4D7NA 4XSZF 4XLEA 5F1RA 2VQGA 3TP3A 2MABA 2CUEA 1ZELA 1R49A 1ZHFA 1D5VA 3L2CA 2Z33A 2UXOA 2A61A 4HSTA 4B1RA 3L2RA 3RCOA 4HDUA 4OMYA 3RD3A 4YZEA 1FTZA 3X2QH 4AVZA 3GX4X 3K69A 1U8RA 2FQ4A 1FJLA 1OKRA 4HYEA 3LWJA 2KRHA 4XKWA 1RUNA 1IXRC 1Z7LA 3FK7A 1B59A 5HBUA 2HYGD 2VL8A 2E2IJ 4R79A 4FETA 1ZG3A 3GFIA 3FKJA 2JSPA 1BIBA 2V7FA 4EJTA 2QQ8A 3CMEI 3I64A 3LA3A 3EYIA 1H9TA 1FC3A 3WGHA 3H5NA 3Q9VA 3WG7H 3LL7A 1BOAA 1T6SA 2JJ7A 3ABLH 4Q47A 2PMUA 2DA7A 3H3ZA 4Q4ZF 2V6CA 2HPIA 4EJVA 1MD0A 3CCMI 3S8PA 1ETXA 3D5SC 4N0BA 1WVRA 3KIOA 1ODDA 2UXNA 5LHHA 4YIFA 1GV2A 2MYSA 4PFPA 3CCSI 2R4GA 1I3QJ 3VUQA 4BU2A 1LDKB 2JMWA 3V8JA 2MLGA 2ZXHA 2VPRA 2Y0SA 4GFLA 1LDJA 1QVUA 1AKHB 3ZR8X 5LRRA 1X1AA 2EILH 4P5OA 4YG2F 2M1BA 5J1UA 1KU7A 1F5TA 2Z5UA 2ISZA 3JTHA 1FIAA 2CUZA 3KP4A 2XV4S 2IXSA 3MWMA 3D0SA 1KQ0A 2UXIA 3LSGA 1OCRH 2FQ3A 3SWHA 3MQ0A 2DMPA 5F0FA 3M8JA 3AFHA 1CF7B 2FMYA 4KNYA 4CCLA 3DLLF 2LR8A 4W1UA 2P5KA 2IW5A 4BS9A 1XTAA 2BY2A 1KU9A 1L3LA 3HOZJ 4UUVA 2RKHA 1E3OC 2L9RA 3JSOA 5HS9A 4MTDA 1RZ4A 4N4NB 1X3ZB 4PCQA 2WV1A 2FD5A 2ZNZA 3K10A 2NVTJ 2ZOZA 2LD5A 3K70C 2XAJA 3ON4A 2G0EA 1FEXA 3BQYA 4LG3A 2BZTA 4E7ZA 1Y6IA 3BRUA 4PUSA 5CXIA 2EFQA 3BP8A 5K7ZA 2BHYA 1L0OC 1J2XA 2AQEA 4ESFA 2FA5A 2RDPA 4BACA 4JOMA 4MLOA 2EFWA 3G1LA 5DUKA 2QENA 1QPIA 2MC4A 1MH3A 2OQRA 3K4JA 3ONQA 1SAUA 3MKWB 1TTYA 4RMNA 3K4MA 2DA3A 2ID6A 2Q8KA 3QAHA 3RZDJ 5CVJA 3KKCA 3CMMA 1IN8A 4CCNA 4HAMA 1ZGJA 2V9KA 4DVYP 4A6EA 1BIAA 5FMPA 2MH2A 3TQNA 5K5QA 4BXFA 5FB2A 2HPMA 2RGVA 3QU3A 3CJTB 3HPHA 1BW5A 2A07F 2G7UA 1H9GA 5GPCA 3PO3J 5D6FA 1W7PB 1QO0D 3S2WA 2XDVA 1BR2A 1NG6A 4YFKF 4WX9A 2HVQA 2HQNA 5EEGA 3ELKA 1IN6A 1KA8A 3OIQA 3WTWC 1VQLI 4GCTA 2Y0SN 1HC8A 3VOKA 3S2HJ 1LNWA 4L9JA 1BJAA 2DFFA 3L00A 3DTEA 2VOOA 5EG0A 2DT5A 4X1EA 1OR7A 4J01A 1T39A 2VOPA 2B7EA 1HXDA 3C7JA 1Z77A 3LSTA 5ERIA 1XPXA 2K3PA 3O8HA 3OYEA 3GW2A 1FP1D 4YFXF 5CVIA 5BNGA 1MMGA 5F27A 3TP0A 2WAQA 1ETQA 1UG2A 3I53A 3CCUI 2IS1A 1E17A 1X1CA 1ON2A 3V7SA 2A69F 2QF7A 4IHWA 3DPJA 2LNBA 5D19A 4I01A 4JBAA 1UG0A 4OOIA 4D9JA 1SVMA 4L62A 1ETOA 1STZA 3EPZA 1LFUP 1S3JA 1WZ2A 1LEBA 2Q2EB 4XNFA 3SEZA 5LHGA 1BA5A 3KP7A 3NS4A 3H5RA 1TQPA 3FF5A 3H9QA 3BR0A 2W82A 1ORKA 3JRDA 4O5VA 3CP8A 2HXOA 3BLYA 3RYRA 3M8FA 2LK2A 2DA2A 2HR3A 3HKZN 5KCMA 1Z21A 5HDKA 4I76A 2PQ8A 1EH7A 4UB6C 2OAZA 2X4HA 2W84A 1FYMA 1VZ0A 3DP7A 1SD6A 3KZZA 4MXMA 1NK3P 3OYHA 2ZC2A 3WGIA 3V6GA 1TQMA 2KL4A 3NXCA 2M4KA 2PBIA 3K4BA 5K5OA 2A2FX 1WJFA 5EZGA 3HOXJ 4I0AA 2DOFA 3BTCA 2NRAC 2L9NA 3T1BA 3OWTA 5DM7F 3WTSC 3LSHA 1A6QA 3JRBA 2QZ8A 3LNQA 2STTA 4RM3A 3M8EA 3J80Z 2QCOA 1OCZH 4G6DA 5KVRA 5ICCA 2HQ5A 4ABZA 3I59A 1V54H 2GUHA 5ICFA 2WGBA 5HLTA 2E36A 5J6XA 2Y2ZA 5B1AH 1K78A 3ZMDA 3QPTA 1HOMA 1YO5C 2DA6A 2YU3A 4A3CJ 1IN7A 3SXYA 4BQOA 2GQQA 2MGQA 2MBFA 4AYBA 2R5ZB 2DLLA 3MZ8A 2GBYA 2ELKA 2DCEA 1XCVA 2ZSHB 3B6CA 1LQ1A 3DU6A 3IKVA 1S5LC 4M3FA 3BR1A 3NWTA 2D1VA 1GXQA 2F5CA 2DMNA 5KHDA 2P81A 2JRMA 2KIFA 2GXAA 1XD7A 4M3DA 1T98A 4HOBA 4XRFA 1B6AA 1N78A 3LSPA 1V4RA 1DPRA 2D6YA 4L5JA 2MH9A 1H88C 3IUOA 1PUEE 5IPAA 4BJ6C 4C2UA 2EH3A 1JHHA 4C2TA 2B9SA 3F9KA 2NP5A 3GTKJ 2BY1A 2IVMA 1F1ZA 2WY7Q 2Z2SB 1RESA 4F52A 2PN6A 4LB5A 1ZARA 2OJED 5JVTA 3AQSA 2BW3B 2MD0A 1A31A 2HS5A 5LEJA 1S29A 2LBFA 5B1BH 3CO6C 3WTYC 3G2BA 1XCBA 4N9IA 3GZ6A 4DIQA 1EV7A 4RGXA 4M6XA 2V79A 4NQWB 2NVXJ 3NWSA 1VQ7I 2XF6A 3LSRA 2LRDA 2JWTA 3DEUA 1W1WE 1JKPC 2CV2A 2QEXI 5B5EC 4YIIA 4L0YB 1OMIA 1FTTA 1JTXA 3K4KA 1HDPA 2ISYA 1MNMC 3AQTA 4JX4A 3K6GA 1VNDA 2D5VA 1PDNC 2XHKA 2K40A 1D0YA 4KN7X 1NK2P 4OU0A 3B81A 1M1EB 2OCCH 3G1OA 2DBBA 1TW3A 5IYBJ 3MZHA 4F92B 5BMZA 4RAZA 1JKOC 3KFWX 2OERA 3EUKL 3HZJA 1B8IB 1MJ9A 1OYIA 3GTQJ 1C0WA 4O3MA 3ON2A 3IH3A 2PMHA 5HLHA 4I99C 1V5GA 2J5PA 4BXXJ 3PO2J 4YRVA 1HDDC 3CC4I 3AG4H 1IW7F 1VQOI 1PUFB 5IYCJ 3QKXA 3HGGA 1LVKA 2KFDA 2P5LC 4GRIA 4OWRB 3Q9SA 5L3EA 3BZCA 2STWA 1VQPI 3HTAA 5FKLA 1AHDP 3NRVA 1BW6A 3MN2A 1LVAA 1XGOA 5KAIC 5HS8A 1YW7A 2EFOA 5D8KB 3WG9A 3M9AA 4IHXA 4A3GJ 6PAXA 3IRQA 4OIQF 1UJ8A 4A3DJ 3ZP5A 2WAFA 1IF1A 3KETA 2Z3YA 4TV7A 1TZLA 3LSIA 2Q1ZB 4CYCB 2JVHA 1SD5A 1WH5A 1GDTA 2VN2A 3HSFA 5GTIC 4A93J 2WADA 1RR8C 3HHHA 1DU0A 2NS0A 2H6BA 2VLAA 1K61A 3ERMA 1MIJA 1Z7UA 3VP5A 2W57A 1GXPA 4BXUA 2LKPA 1ACIA 1D1CA 3F6OA 3GZ5A 2DFIA 2CQQA 2LP0A 1P6RA 4DQ2A 3VWBA 4NC8A 5JR3A 3RQIA 1U5TB 3IRRA 1OYWA 5HDNA 3ZPLA 3LSKA 2IS4A 2E35A 1ETVA 3HL2A 1D8KA 2H6CA 3P9IA 1ON1A 2A6HF 3K4NA 2HDWA 2DYRH 4XM3A 4EM0B 3CC7I 1WQ2A 3DXJF 1IUFA 2RQPA 5DEQA 4F55A 2Z16A 2EIMH 4XKCA 3GCMA 3I58A 1MBJA 2FOWA 2OBPA 3I71A 3IP4B 2R7TA 3NPIA 3BOQA 4IOAF 3J80K 3GTPJ 1Z9CA 2BGCA 4U88A 1V5FA 3CCRI 2VPLA 1ONVA 4PJ0C 5FGMA 1YRNA 3ECHA 4RAYA 1LE8B 1HW1A 2F5EA 2HTSA 3MKLA 1YW9A 2MLKA 4E7JA 3VYSB 3K1NA 3TKYA 3KP5A 3JRFA 3QPHA 3G73A 2FU4A 2R7RA 4XBFA 3OY9A 3ASNH 2ETHA 4JX5A 2O3FA 5D5UB 2R7XA 3C2HA 1MJBA 4UNOA 1TWGJ 2O0YA 3IL2A 5E8IA 1WHUA 2LVSA 3E3VA 3WGGA 2R7WA 1N25A 3S3MA 1G3YA 2QYOA 1Z0XA 3V78A 3U9GA 3FBNB 4QSHA 4ZC3A 4AIHA 4HF2A 1S7EA 3MAJA 3ROUA 3WODF 1HKTA 2LREA 3VIBA 1YHQI 3K4CA 4M9ZA 4HEA2 4A0ZA 1LKXA 1TLHB 4XSXF 4RM2A 3QOPA 4LB6B 5F0CA 4BGDA 3KE2A 5GAEJ 4P9UA 2HYFA 2E7WA 3EUPA 1P92A 3WHCA 3CZ6A 4GGGA 4PGGA 4G9YA 2XGXA 4EGYA 2G7LA 2YS9A 1YIOA 3BG9A 5H6QA 4D5FA 5AONA 3C2BA 2L7MP 4GYGA 2QLZA 3FIWA 1G8XA 3D5LA 4U0YA 3CUQC 1S72I 1U3EM 3DKWA 1S7OA 2EZKA 2KIQA 3VW1A 2CJJA 1NTCA 3CC2I 4A0XA 4CXFA 2W85A 3FWEA 2QBYA 3QQAA 5HLIA 4KMUX 4MFDA 2CYYA 1R6RA 4HG2A 4UVBA 2HDDA 2OTJI 2MC3A 2IRFG 3COLA 1SC7A 3PJRA 3ZOBA 1DP3A 5E17F 2DT7B 2DG8A 3V4GA 3I56I 2DPDA 5DTDA 4ENKA 4Y7NJ 4GYIA 3G71I 1D0ZA 4A3BJ 4XMYA 2IAIA 1HW5A 2X9DA 3A0BC 5D5VB 2X6YA 3W2WA 3BJ6A 2VJIA 4XLNF 3RPUD 1QZYA 3VSKA 3GEZA 4BE2A 4Z6YA 1U78A 1R36A 4IPAA 2VC0A 1HKQA 3WTXC 3HKZA 3OR1C 4ME9A 2QIBA 2IGMA 3HC7A 3HPGA 1ZGWA 1F4KA 2QQ9A 3ZMVA 3HG9A 4ZYGA 4BY1J 3BR3A 2V57A 3KEQA 2ZNYA 1IZ1A 4ZZLA 3C1DA 1GHCA 2HQRA 4JNNA 2IGKA 3K2ZA 2HOSA 3FXQA 2O8XA 2ZJRF 3BHQA 2Y30A 3BR2A 2LBFB 3ZQFA 2NX4A 2G7GA 2LC2A 2XPWA 4ZDOA 3QRFF 3DKYA 4BHPA 3SZTA 3SJMA 4ZDLA 2FBHA 1I1GA 3ABKH 2FBQA 4XLHA 4XLPF 3BCAA 4FE4A 3CDHA 5CPRB 3M3YJ 2IS2A 3TBIA 4M74A 1P2FA 1FT9A 3CO7C 3CCJI 1T08B 2HOTA 4JK1X 2D1HA 5D5XB 1R71A 2UXHA 1ZYRF 2ADUA 5LD2C 1FYKA 4WF2A 3E6DA 4FT8A 2R7SA 3HTUA 4HQEA 5E3OA 3V7RA 3U21A 5FKNA 5C4JJ 2QA4I 4LFUA 4WXHA 2M0MA 4XIDA 1ZH5A 3T8TA 3DWLE 4IZZA 1SMYF 1MNEA 1K4TA 2A05A 4LD5A 3PQKA 4MNUA 4G7ZF 1XDUA 2RREA 3SZGA 3CUQA 1LPQA 2YVXA 1E3HA 5E8GA 1FBSA 3KZIC 3BR6A 1X3WB 4UHTA 1VQMI 4QIWN 5EYRA 3L1PA 3HTIA 3A02A 4HDVA 3WTZA 4FASD 5M3FJ 1J75A 4M9XA 1AA7A 3R0JA 1A36A 3JREA 3MCZA 4RDUA 3R4KA 2E1NA 1OYYA 4HZFA 3P9TA 5CYVA 5H9TA 3H9JA 2H8RA 2FMLA 1HSJA 4FHTA 2E1CA 1QU3A 2QQBA 1N77A 2KDZA 3GVAA 4L9VA 5ICGA 1OLTA 5FLMJ 3KKDA 3FHNA 1BI0A 5AIQA 3TOBA 5J1RA 5ILSA 2PX9A 4B3XA 2LYCA 3GLLA 3DTKA 2FOKA 1TWCJ 4HX8A 3J7ZI 4BBRJ 2FJ1A 2JA6J 3OS1A 1P7JA 3HRUA 5DD4A 3CCLI 4II2A 4HBLA 3BNIA 3ZQGA 4AM3A 4L9NA 5CVVA 5E1WA 2GZWA 2OTLI 2Z9OA 4F91B 4HF1A 2DTZA 2W25A 2P7CB 1Z91A 4ITVA 3CJQB 5LHIA 2QOPA 1BN5A 1EKEA 4QTRA 1HW2A 5LRSA 1K4SA 1XGSA 2XROA 3FZVA 4OINF 4G94A 2AS5F 3ISPA 2JSCA 3LFUA 3S17J 3HM5A 2CV1A 4DJAA 2JRTA 2LF7A 4FE7A 1Z6RA 2EFNA 2O7TA 2VUMJ 4EATA 1O7LA 1BR4A 5CKTA 3CJRB 1TT5B 2K5CA 4DZPA 4L18B 2CFXA 2X85A 2PJPA 3MMYB 1W36C 2CV0A 4Y15A 2KKOA 4E7KA 1R1TA 2QWWA 4NBQA 1FIPA 2LY9A 2K02A 4ICHA 4LIVA 5K7HA 3ZGKA 1SFOJ 4A2UA 1U9NA 2ID3A 3DBRB 3VPRA 1TT0A 4OAZA 5IY5H 2Y48A 1FYLA 1EF4A 1K79A 1SMTA 4E7SA 5D4RA 3DBLB 2IEKA 4RGSA 1MBEA 3L9FA 3OYDA 4AIJA 1TQIA 3MD2A 3GTLJ 3HUGA 3KYLA 3VTIA 3OYMA 1YJNI 2M2EA 4B3AA 4XRMA 3W2VA 2WAEA 4UDSA 1ZTRA 5GAGJ 4IRVA 4NELA 5DCFA 3W2AA 3COAC 2L4MA 1VF9A 4KDPA 2X1DA 4V2FA 3SHFA 2VJJA 2ZJPF 1VQNI 9ANTA 4D5CA 4BDYA 5IP7J 4AIKA 3JRCA 2DK8A 1W7PA 2ZJQF 2ZKZA 4R1HA 1UHSA 2XASA 2XF7A 2ECCA 1UHMA 1LFPA 1MBKA 5FRNA 3FX3A 3S93A 1UZCA 3CDIA 5IYDJ 5IP6A 2OZ6A 1XC5A 1XN7A 4A3MJ 3FXMA 4HX7A 2P8TA 2JQ7A 2GIVA 2FEZA 2IA0A 3HOSA 2X6XA 2WUIA 4DNCA 1OCCH 1POGA 4LK0F 4CCKA 3FM5A 1VQKI 2EV5A 2K4JA 4Y3OA 3VW2A 2ZBKA 4DYQA 2QSFX 2XPUA 1F36A 2L2OA 3Q3SA 1FBQA 5C4YA 5LGTA 4RB0A 2JT1A 4IX7A 3SZPA 1YI2I 2DFHA 2F5DA 3HRTA 3RPQA 3JRGA 1WKMA 3GTGJ 1PP7U 1T56A 1UAAA 3VOXA 1S8NA 4X6AJ 2Z1DA 1BOBA 1OFCX 3GF2A 2HTJA 2K85A 2DDAA 2OQGA 5B66C 5J4YA 4CDGA 1SFEA 2VBYA 2R0QC 5K58A 4XN3A 2P6SA 2TCTA 2ME6A 4XN0A 2LTPA 2BE5F 1ZAOA 3CLOA 4A6DA 3JAMZ 3WTVC 2EIKH 3WU0A 1CF7A 1W7PD 4BNCA 2I8DA 5JHFA 4DZJA 1GVDA 2V1UA 3KZ9A 2IGNA 1TWHJ 2WAQN 1P4WA 1VQ5I 1J59A 2ZCNA 1AU7A 1I3AA 2XGCA 3BTLA 2DI3A 3N4MA 2O9LA 3P5JA 5LLQA 3OSFA 1V55H 3KP6A 2M5WA 4U87A 1O3RA 2QKLB 2ZMEC 1BR1A 1LFBA 1MMAA 3IAS2 4LGWA 3F0CA 1X19A 1EH8A 3VB2A 2GXBA 2ZCMA 3LOCA 1PJRA 4IRGA 4CHUA 2NNNA 5IT9K 3HSEA 1YTYA 4PXIA 2DQLA 3Q0VA 1D5YA 2A6TA 5D1RA 2M7AA 3UNGC 3HTHA 1MSEC 3RJPA 1A35A 3ANPA 5DCMA 3ANGA 3BCGA 3FMSA 3HDDA 3NNRA 4KT5C 1IJWC 4XKVA 2JN6A 3FXJA 3TO9A 1W4MA 2Z99A 2M8GX 4CCJA 4JL3A 2VE8A 3J7AO 4H0EA 1O4XA 1RIOH 2QGUA 2PBXA 2QM3A 4GCVA 4G7OF 3Q5FA 3F22A 2EK5A 2WV0A 4C3IJ 4K2EA 5JHUA 1WJ5A 2F4MB 1RETA 5FO5A 4A3EJ 2VQLA 3TW7A 4AD9A 2KLOA 4FX4A 3VDXA 3E1SA 3HOUJ 1S6LA 2FE3A 2Y69H 2V1NA 5F6FA 2DDBA 3EETA 5FD6A 1MZBA 2YX7A 5FHPA 3LMMA 2F5VA 1IN4A 1QPMA 1RI7A 2LY1A 5HODA 2QTQA 3QPLA 1Y56A 3A4CA 3G4SI 3JTGA 5D8LB 4BBSJ 2R7FA 4ANJA 1VQ9I 3M4OJ 4C2MA 4LLLA 1OJLA 4WXCA 1LE8A 1WH7A 2R7ZJ 3JW4A 3E5XA 3RIRA 4ENMA 1P7IA 3CUQB 2EIJH 2NYXA 1JJ8C 4A69C 1UI5A 4CZZA 4BUPA 4BHBA 1MBFA 4JX6A 4XL9A 1T38A 1VQ4I 3BDDA 5FRMA 2ZOYA 1MJAA 2G3BA 3PNTA 3VVXA 2UZKA 3CMYA 4AWXB 1YX3A 2DMUA 3QYFA 4BYYA 4QPQA 5EGOA 2HWVA 3C07A 3F8FA 2BVLA 3I4NJ 4UXNA 2E1MB 2IJLA 1S9HA 2ZJ2A 3ZN0A 2LG4A 2KISA 1WJBA 2O7OA 2X0LA 1JKRC 2PMZN 1QHHD 1X2NA 3SQNA 2HI3A 3E5UA 1HQCA 2FUG2 4RLQA 2HYTA 3DF8A 3FRQA 2ZMEB 3PUBA 5JVGF 4GO1A 1IRZA 3J81Z 5TGTA 1VTNC 3GFLA 4CYCA 1W5CC 5E3LA 2FXAA 5LEKA 5HNFA 1JE8A 4B47A 3GTJJ 1R5GA 1OPCA 2LMDA 2A5WA 1X4PA 2HOAA 2R92J 2I5UA 1ZREA 2JA5J 3M1CA 1LB2A 4DBRA 4XOPA 1WRJA 3TEDA 1IV8A 3FISA 2DXIA 5H20A 3BPVA 2WB1N 2F4OB 1ZRDA 2WTEA 2L4AA 3VVZA 1FSEA 2QSHX 1ZK8A 2CWEA 4OD4A 4MGRA 4BJ5C 1AWCA 1TC3C 3OYLA 4PZJA 3GZNB 5BOXA 1BL0A 3H36A 2W24A 2DAOA 1W36D 1YX5A 4G6TB 4G8XA 3ZRGA 4PJMA 3OV8A 1XS9A 2QBYB 2IT0A 1XMXA 2L54A 1MNDA 3OYJA 1IG7A 3F8NA 1T0FA 1B8IA 1ZRCA 2L5QA 1KU2A 3I55I 4ENNA 3RPUA 3AKZA 4ASNA 2KZVA 3LSJA 2HNHA 3MFKA 4J00A 5HSZA 2JTVA 3FKIJ 3JCUC 3FBIB 4OAYA 2XAGA 3BPXA 3S1RJ 3TGNA 1W0TA 4U7DA 2P7VB 1ZKGA 2EV0A 1T95A 1R22A 3RDIA 2XVCA 1KQ8A 3E6CC 3FHZA 4HNVA 2ZFUA 1ZRFA 2OD5A 3DPLC 3I0TA 4OIPF 4B4CA 3A1YA 1MMNA 2ZMEA 3G6EI 1QHGA 1W0UA 5EF6A 1D8JA 3PIOF 1CGPA 3OL3A 2ZCWA 5GTHC 1JGSA 2F07A 2XAUA 1GLNA 4HLXA 4NC7A 1DQUA 2EJRA 2R3SA 4S0HB 4IKFA 5HVQC 2O61A 4W97A 3L2WA 1XGMA 2UUZA 1JKQC 4XLAA 1F9NA 3E6BA 5LBQA 4RAGA 2R7QA 5CQEA 2HVSA 2DT6A 2R7OA 5FKOA
chains in the Genus database with same CATH topology
2DMQA 2W48A 1VI0A 1DU6A 1ETXA 4DYRA 1U78A 1X58A 4JKZA 4JP0A 2M34A 4A3IJ 2MG4A 5JLWA 4ME9A 2NS7A 2QIBA 3A01A 1ZGWA 4MIMA 4BY1J 3BR3A 1GV2A 2V57A 5F08A 1I3QJ 4AC0A 3VUQA 2VI6A 2JMWA 4JNNA 2VPRA 3CWRA 2HOSA 4GFLA 1B72A 1QVUA 3BHQA 1AKHB 2Y30A 3BR2A 3ZQFA 4UUTA 4D7MA 3PM1A 5JLXA 1GV5A 2G7GA 5J1UA 2NX4A 1JGGA 2DA5A 2XPWA 3S14J 3NRGA 1BJZA 4GFKA 1FIAA 5IP9J 3SJMA 2H1KA 2FBQA 4FE4A 3M3YJ 5F1JA 3S2DJ 2UXIA 3LSGA 1MBGA 3A03A 2HOTA 2DMPA 5F0FA 4HKUA 3JRIA 2UXHA 4M3GA 2R5YB 3QBMA 1I50J 1JUPA 5E3OA 2LR8A 2XSDC 1PUFA 5FKNA 5C4JJ 4W1UA 3HOZJ 4XIDA 3NARA 1K83J 3HGYA 3S1NJ 2REKA 1E3OC 2L9RA 2CQXA 2WV1A 2FD5A 2Y31A 5FKMA 2NVTJ 2ZOZA 2LD5A 2XDNA 3ON4A 2G0EA 1FEXA 4KWAA 3BQYA 2E1OA 5M5XJ 3BR6A 3JRAA 3BRUA 2HKUA 5CXIA 4QIWN 3GBGA 5EYRA 5E3MA 3L1PA 3HTIA 5K7ZA 3A02A 2NP3A 4M3BA 3TW6A 5M3FJ 3ZQCA 2ME0A 2XGEA 4MLOA 3JREA 5FGLA 4RDUA 3G1LA 4AC6A 3P9TA 5H9TA 1QPIA 2GLOA 3CDLA 4GFBA 1MH3A 2H8RA 4GCLA 3HOVJ 3GZIA 3T6NA 4EEFG 2DA3A 2ID6A 2KDZA 3RZDJ 3W6VA 3S1QJ 3KKCA 3HEFA 5FLMJ 3HE0A 3KKDA 2EBIA 3O60A 2DG7A 2EZHA 2NOGA 2Y9YA 5FMPA 3D1NI 5J1RA 1WI3A 2NVQJ 1JUSA 4FCYA 1BW5A 1TWCJ 4G12A 5GPCA 3PO3J 3K7AJ 4BBRJ 2FJ1A 2XB5A 2JA6J 3E7QA 1JUMA 3Q0UA 3ZQLA 3S5RA 1P7JA 4JYKA 3G56A 2AO9A 3BG3A 3O8GA 1JT6A 3ZQGA 3BNIA 2OI8A 5CW8A 4GCTA 2DA1A 1A6IA 2DTZA 2Y0SN 3RH2A 3ZQIA 3PPBA 3VOKA 3S2HJ 2QOPA 4QTRA 2CUFA 2JA7J 1IC8A 3BT9A 3IV5A 5EG0A 4X1EA 5GPAA 2GFNA 3H3VK 2E2HJ 4UUSA 3RKQA 3DCFA 1Z77A 2K9SA 3S17J 3HM5A 5IOZA 3SDGA 3IUVA 2M0CA 3O8HA 2QWTA 3IH2A 4FE7A 1CQTA 5M3MJ 2X6OA 5BNGA 1ZR2A 2O7TA 2VUMJ 1X2MA 2OPTA 5F27A 3TP0A 2EQRA 1ETQA 1MH4A 1UG2A 4DZPA 1MSFC 4A3KJ 2QF7A 2LLKA 4IHWA 3DPJA 1JJ6C 2RHAA 1FIPA 2LY9A 2Q24A 5D19A 4BKXA 3E7LA 4ICHA 5K7HA 2IU5A 2CRGA 1SFOJ 4L62A 1ETOA 1LFUP 1U9NA 2ID3A 3VPRA 1EF4A 2FX0A 1BA5A 2IEKA 1H89C 1MBEA 5GP9A 5C4XJ 3GTLJ 2DA4A 2NS8A 2LKXA 3BR0A 2I10A 2M2EA 4B3AA 4XRMA 1ORKA 4NDLA 3JRDA 4UDSA 1ZTRA 2HXOA 2NVYJ 1VFCA 4NELA 2LK2A 2DA2A 3HKZN 4IHYA 1VF9A 2EZLA 4V2FA 3BTJA 2R5ZA 4I76A 9ANTA 1Y1VJ 4D5CA 5F0HA 5IP7J 4MXMA 3JRCA 1NK3P 1ZR4A 1ZQ3P 3V6GA 2L7FP 1UHSA 3NXCA 1WGXA 2ECCA 1MBKA 5EZGA 3HOXJ 1JT0A 3GEUA 5AQCA 2JK3A 3BTCA 4XRSA 3JRBA 5D18A 4GCKA 3LNQA 3CJDA 1OCPA 3OOUA 5IYDJ 5IP6A 2QCOA 1XC5A 4M3EA 4A3MJ 4C3JJ 3OSGA 2HQ5A 5C44J 4ABZA 4A3LJ 4AF5A 2GUHA 3Q0WA 1ETWA 2WUIA 4AUXA 2WGBA 4Y52J 2E19A 1POGA 2Y2ZA 3HTJA 3MVPA 1HOMA 2DA6A 3EGQA 5EZHA 3VW2A 2K9QA 5FKKA 4DYQA 4A3CJ 2RAEA 2XGDA 2XPUA 1F36A 2MGQA 2R5ZB 3F1BA 1ITYA 3Q3SA 5C4YA 2GBYA 3BTIA 2ELKA 3B6CA 5EG0B 1B72B 4M3FA 3BR1A 2IBDA 2XB0X 3VVYA 2DMNA 2P81A 3JRGA 1IV6A 3GTGJ 1T56A 3VOXA 2R93J 4X6AJ 4M3DA 2O8KA 3I4MJ 1WCMJ 1OFCX 2B63J 3KNWA 4L5EA 1APLC 3LSPA 1G2HA 2D6YA 5J3LA 2R0QC 4J19A 5K58A 1H8AC 1Y1WJ 2TCTA 2ME6A 2LTPA 1QRYA 1H88C 2QKOA 5IPAA 3PASA 2DN0A 2YU9J 4DZJA 1GVDA 5EEAA 3KZ9A 2GM4A 1TWHJ 2EH3A 5EDNA 1IDYA 2VKVA 2WAQN 2NP5A 2ECBA 3GTKJ 4LOCA 2ZCNA 1AU7A 4RBOA 2XGCA 3BTLA 2O9LA 3G7RA 1RESA 4XICA 2MSYA 2ZB9A 5F04A 4BY7J 5DAJA 3OSFA 2EZIA 3SFIA 1HCRA 3VW0A 3AQSA 3FK6A 5FJ8J 4UUSB 2UXPA 1LFBA 3F0CA 2ZCMA 3K2AA 3HB9A 3OIOA 3LOCA 2VKEA 5E3NA 2NVXJ 2RASA 2OF7A 3Q0VA 5C3EJ 3LSRA 4PXIA 2JWTA 1JKPC 1D5YA 2XRLA 2HYJA 5D1RA 3HTHA 1MSEC 4C2MJ 3ANPA 3ANGA 1FTTA 1JTXA 3BCGA 1HDPA 2KT0A 1IGNA 1MNMC 3AQTA 4JX4A 3HDDA 1VNDA 4AYBN 1IJWC 2D5VA 3NNRA 2K40A 1NK2P 3B81A 2TRTA 3G1OA 2JN6A 4JL3A 5IYBJ 2M8GX 3S1MJ 1JKOC 2OERA 1B8IB 1O4XA 3B6AA 3G1MA 2E2JJ 4A3JJ 3GTQJ 2PBXA 3ON2A 1GT0C 3IH3A 4C3IJ 2GENA 5EFYA 4BXXJ 3PO2J 1HDDC 1RETA 4A3EJ 3TW7A 1PUFB 1ENHA 1WPKA 5IYCJ 1RKTA 3QKXA 3HGGA 3HOUJ 3HBLA 1IDZA 2DMTA 4ACIA 5FHPA 3HTAA 5FKLA 1AHDP 1BW6A 3MN2A 3BG5A 2ZCXA 5HODA 2QTQA 3QPLA 3LJLA 2YVEA 1Q1VA 4MO7A 3NI7A 2UXUA 4A3GJ 4IHXA 4BBSJ 4IEJA 3DEWA 3JR9A 4FTHA 1RKWA 3M4OJ 1MBHA 2HXIA 4A3DJ 1OJLA 1AKHA 1LE8A 1WH7A 2R7ZJ 2PZ9A 1SANA 4I6ZA 4CGRA 2L0KA 4CYCB 1P7IA 2Y9ZA 1WH5A 1GDTA 4A93J 1JJ8C 4A69C 3BR5A 3RZOJ 1UI5A 1DU0A 1K61A 1MBFA 4JX6A 1A5JA 1GUUA 1I6HJ 4IHVA 3VP5A 2M9HA 1UMQA 3ZQHA 2ZOYA 2G3BA 3VVXA 3QPSA 3S16J 3CMYA 2AHQA 2K9NA 2R5YA 2CQQA 2LP0A 2DMUA 3RQIA 5EGOA 3NAUA 5J1YA 3C07A 3I4NJ 1ETVA 1F43A 1HF0A 2O7OA 1JKRC 2PMZN 2JA8J 1X2NA 1IUFA 3BQZA 2MW8A 4XK4A 5HAWA 2HI3A 2N8GA 1MBJA 3H0GJ 2HYTA 3FRQA 3NPIA 4MK6A 4XRSG 3GTPJ 1IRZA 3JSJA 1SGMA 4CYCA 5E3LA 4FISA 1QVTA 3GTJJ 3GTOJ 3A01B 2HOAA 1LE8B 5DS9A 1HLVA 1YRNA 2R92J 1ETKA 2YVHA 2JA5J 3MKLA 2COBA 1RR7A 3TEDA 5FLVA 3FISA 3JRFA 3HOWJ 1OCTC 1R9TJ 2WB1N 4DW6A 4DYCA 1U9OA 3VVZA 3IH4A 4JX5A 3HIMA 2LFBA 4C3HJ 4MFEA 1ZK8A 5EGOB 1TWGJ 3CQZJ 5M5YJ 1TC3C 5CXGA 5M5WJ 2LVSA 1Z0XA 1BL0A 3V78A 3BJBA 3HOYJ 3CRJA 4QSHA 3UKGA 2X48A 1XS9A 1S7EA 2G7SA 1TWAJ 3CCYA 3VIBA 1RPWA 1IG7A 3JRHA 1B8IA 4V2GA 1XG1A 5IOYA 5F0CA 3LSJA 4D7NA 5HSZA 3EUPA 3FKIJ 2DJNA 3TP3A 1ETYA 3WHCA 2CUEA 1T33A 2XPVA 3S1RJ 1W0TA 1YRNB 2G7LA 1ZKGA 2YS9A 2UXOA 4B1RA 3BG9A 4D5FA 3MNLA 3C2BA 3RD3A 2L7ZA 2L7MP 4M6VA 3LHQA 4HNVA 4YZEA 1FTZA 3FIWA 2FQ4A 1FJLA 4B4CA 2EZKA 3VW1A 2W53A 3LWJA 3GTMJ 2CJJA 1NTCA 1W0UA 5EF6A 4NN1A 3FK7A 3QQAA 1TWFJ 5HBUA 2E2IJ 5K7FA 2CU7A 4MFDA 2F07A 3WHBA 2HDDA 4A3FJ 3S15J 3COLA 3ZOBA 4S0HB 2DG8A 2YUSA 4W97A 5DTDA 1U8BA 1JTYA 4Y7NJ 2JJ7A 1JKQC 4A3BJ 2IAIA 2X9DA 2DA7A 1UI6A 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMQ A;  2W48 A;  1VI0 A;  1DU6 A;  1ETX A;  4DYR A;  1U78 A;  1X58 A;  4JKZ A;  4JP0 A;  2M34 A;  4A3I J;  2MG4 A;  5JLW A;  4ME9 A;  2NS7 A;  2QIB A;  3A01 A;  1ZGW A;  4MIM A;  4BY1 J;  3BR3 A;  1GV2 A;  2V57 A;  5F08 A;  1I3Q J;  4AC0 A;  3VUQ A;  2VI6 A;  2JMW A;  4JNN A;  2VPR A;  3CWR A;  2HOS A;  4GFL A;  1B72 A;  1QVU A;  3BHQ A;  1AKH B;  2Y30 A;  3BR2 A;  3ZQF A;  4UUT A;  4D7M A;  3PM1 A;  5JLX A;  1GV5 A;  2G7G A;  5J1U A;  2NX4 A;  1JGG A;  2DA5 A;  2XPW A;  3S14 J;  3NRG A;  1BJZ A;  4GFK A;  1FIA A;  5IP9 J;  3SJM A;  2H1K A;  2FBQ A;  4FE4 A;  3M3Y J;  5F1J A;  3S2D J;  2UXI A;  3LSG A;  1MBG A;  3A03 A;  2HOT A;  2DMP A;  5F0F A;  4HKU A;  3JRI A;  2UXH A;  4M3G A;  2R5Y B;  3QBM A;  1I50 J;  1JUP A;  5E3O A;  2LR8 A;  2XSD C;  1PUF A;  5FKN A;  5C4J J;  4W1U A;  3HOZ J;  4XID A;  3NAR A;  1K83 J;  3HGY A;  3S1N J;  2REK A;  1E3O C;  2L9R A;  2CQX A;  2WV1 A;  2FD5 A;  2Y31 A;  5FKM A;  2NVT J;  2ZOZ A;  2LD5 A;  2XDN A;  3ON4 A;  2G0E A;  1FEX A;  4KWA A;  3BQY A;  2E1O A;  5M5X J;  3BR6 A;  3JRA A;  3BRU A;  2HKU A;  5CXI A;  4QIW N;  3GBG A;  5EYR A;  5E3M A;  3L1P A;  3HTI A;  5K7Z A;  3A02 A;  2NP3 A;  4M3B A;  3TW6 A;  5M3F J;  3ZQC A;  2ME0 A;  2XGE A;  4MLO A;  3JRE A;  5FGL A;  4RDU A;  3G1L A;  4AC6 A;  3P9T A;  5H9T A;  1QPI A;  2GLO A;  3CDL A;  4GFB A;  1MH3 A;  2H8R A;  4GCL A;  3HOV J;  3GZI A;  3T6N A;  4EEF G;  2DA3 A;  2ID6 A;  2KDZ A;  3RZD J;  3W6V A;  3S1Q J;  3KKC A;  3HEF A;  5FLM J;  3HE0 A;  3KKD A;  2EBI A;  3O60 A;  2DG7 A;  2EZH A;  2NOG A;  2Y9Y A;  5FMP A;  3D1N I;  5J1R A;  1WI3 A;  2NVQ J;  1JUS A;  4FCY A;  1BW5 A;  1TWC J;  4G12 A;  5GPC A;  3PO3 J;  3K7A J;  4BBR J;  2FJ1 A;  2XB5 A;  2JA6 J;  3E7Q A;  1JUM A;  3Q0U A;  3ZQL A;  3S5R A;  1P7J A;  4JYK A;  3G56 A;  2AO9 A;  3BG3 A;  3O8G A;  1JT6 A;  3ZQG A;  3BNI A;  2OI8 A;  5CW8 A;  4GCT A;  2DA1 A;  1A6I A;  2DTZ A;  2Y0S N;  3RH2 A;  3ZQI A;  3PPB A;  3VOK A;  3S2H J;  2QOP A;  4QTR A;  2CUF A;  2JA7 J;  1IC8 A;  3BT9 A;  3IV5 A;  5EG0 A;  4X1E A;  5GPA A;  2GFN A;  3H3V K;  2E2H J;  4UUS A;  3RKQ A;  3DCF A;  1Z77 A;  2K9S A;  3S17 J;  3HM5 A;  5IOZ A;  3SDG A;  3IUV A;  2M0C A;  3O8H A;  2QWT A;  3IH2 A;  4FE7 A;  1CQT A;  5M3M J;  2X6O A;  5BNG A;  1ZR2 A;  2O7T A;  2VUM J;  1X2M A;  2OPT A;  5F27 A;  3TP0 A;  2EQR A;  1ETQ A;  1MH4 A;  1UG2 A;  4DZP A;  1MSF C;  4A3K J;  2QF7 A;  2LLK A;  4IHW A;  3DPJ A;  1JJ6 C;  2RHA A;  1FIP A;  2LY9 A;  2Q24 A;  5D19 A;  4BKX A;  3E7L A;  4ICH A;  5K7H A;  2IU5 A;  2CRG A;  1SFO J;  4L62 A;  1ETO A;  1LFU P;  1U9N A;  2ID3 A;  3VPR A;  1EF4 A;  2FX0 A;  1BA5 A;  2IEK A;  1H89 C;  1MBE A;  5GP9 A;  5C4X J;  3GTL J;  2DA4 A;  2NS8 A;  2LKX A;  3BR0 A;  2I10 A;  2M2E A;  4B3A A;  4XRM A;  1ORK A;  4NDL A;  3JRD A;  4UDS A;  1ZTR A;  2HXO A;  2NVY J;  1VFC A;  4NEL A;  2LK2 A;  2DA2 A;  3HKZ N;  4IHY A;  1VF9 A;  2EZL A;  4V2F A;  3BTJ A;  2R5Z A;  4I76 A;  9ANT A;  1Y1V J;  4D5C A;  5F0H A;  5IP7 J;  4MXM A;  3JRC A;  1NK3 P;  1ZR4 A;  1ZQ3 P;  3V6G A;  2L7F P;  1UHS A;  3NXC A;  1WGX A;  2ECC A;  1MBK A;  5EZG A;  3HOX J;  1JT0 A;  3GEU A;  5AQC A;  2JK3 A;  3BTC A;  4XRS A;  3JRB A;  5D18 A;  4GCK A;  3LNQ A;  3CJD A;  1OCP A;  3OOU A;  5IYD J;  5IP6 A;  2QCO A;  1XC5 A;  4M3E A;  4A3M J;  4C3J J;  3OSG A;  2HQ5 A;  5C44 J;  4ABZ A;  4A3L J;  4AF5 A;  2GUH A;  3Q0W A;  1ETW A;  2WUI A;  4AUX A;  2WGB A;  4Y52 J;  2E19 A;  1POG A;  2Y2Z A;  3HTJ A;  3MVP A;  1HOM A;  2DA6 A;  3EGQ A;  5EZH A;  3VW2 A;  2K9Q A;  5FKK A;  4DYQ A;  4A3C J;  2RAE A;  2XGD A;  2XPU A;  1F36 A;  2MGQ A;  2R5Z B;  3F1B A;  1ITY A;  3Q3S A;  5C4Y A;  2GBY A;  3BTI A;  2ELK A;  3B6C A;  5EG0 B;  1B72 B;  4M3F A;  3BR1 A;  2IBD A;  2XB0 X;  3VVY A;  2DMN A;  2P81 A;  3JRG A;  1IV6 A;  3GTG J;  1T56 A;  3VOX A;  2R93 J;  4X6A J;  4M3D A;  2O8K A;  3I4M J;  1WCM J;  1OFC X;  2B63 J;  3KNW A;  4L5E A;  1APL C;  3LSP A;  1G2H A;  2D6Y A;  5J3L A;  2R0Q C;  4J19 A;  5K58 A;  1H8A C;  1Y1W J;  2TCT A;  2ME6 A;  2LTP A;  1QRY A;  1H88 C;  2QKO A;  5IPA A;  3PAS A;  2DN0 A;  2YU9 J;  4DZJ A;  1GVD A;  5EEA A;  3KZ9 A;  2GM4 A;  1TWH J;  2EH3 A;  5EDN A;  1IDY A;  2VKV A;  2WAQ N;  2NP5 A;  2ECB A;  3GTK J;  4LOC A;  2ZCN A;  1AU7 A;  4RBO A;  2XGC A;  3BTL A;  2O9L A;  3G7R A;  1RES A;  4XIC A;  2MSY A;  2ZB9 A;  5F04 A;  4BY7 J;  5DAJ A;  3OSF A;  2EZI A;  3SFI A;  1HCR A;  3VW0 A;  3AQS A;  3FK6 A;  5FJ8 J;  4UUS B;  2UXP A;  1LFB A;  3F0C A;  2ZCM A;  3K2A A;  3HB9 A;  3OIO A;  3LOC A;  2VKE A;  5E3N A;  2NVX J;  2RAS A;  2OF7 A;  3Q0V A;  5C3E J;  3LSR A;  4PXI A;  2JWT A;  1JKP C;  1D5Y A;  2XRL A;  2HYJ A;  5D1R A;  3HTH A;  1MSE C;  4C2M J;  3ANP A;  3ANG A;  1FTT A;  1JTX A;  3BCG A;  1HDP A;  2KT0 A;  1IGN A;  1MNM C;  3AQT A;  4JX4 A;  3HDD A;  1VND A;  4AYB N;  1IJW C;  2D5V A;  3NNR A;  2K40 A;  1NK2 P;  3B81 A;  2TRT A;  3G1O A;  2JN6 A;  4JL3 A;  5IYB J;  2M8G X;  3S1M J;  1JKO C;  2OER A;  1B8I B;  1O4X A;  3B6A A;  3G1M A;  2E2J J;  4A3J J;  3GTQ J;  2PBX A;  3ON2 A;  1GT0 C;  3IH3 A;  4C3I J;  2GEN A;  5EFY A;  4BXX J;  3PO2 J;  1HDD C;  1RET A;  4A3E J;  3TW7 A;  1PUF B;  1ENH A;  1WPK A;  5IYC J;  1RKT A;  3QKX A;  3HGG A;  3HOU J;  3HBL A;  1IDZ A;  2DMT A;  4ACI A;  5FHP A;  3HTA A;  5FKL A;  1AHD P;  1BW6 A;  3MN2 A;  3BG5 A;  2ZCX A;  5HOD A;  2QTQ A;  3QPL A;  3LJL A;  2YVE A;  1Q1V A;  4MO7 A;  3NI7 A;  2UXU A;  4A3G J;  4IHX A;  4BBS J;  4IEJ A;  3DEW A;  3JR9 A;  4FTH A;  1RKW A;  3M4O J;  1MBH A;  2HXI A;  4A3D J;  1OJL A;  1AKH A;  1LE8 A;  1WH7 A;  2R7Z J;  2PZ9 A;  1SAN A;  4I6Z A;  4CGR A;  2L0K A;  4CYC B;  1P7I A;  2Y9Z A;  1WH5 A;  1GDT A;  4A93 J;  1JJ8 C;  4A69 C;  3BR5 A;  3RZO J;  1UI5 A;  1DU0 A;  1K61 A;  1MBF A;  4JX6 A;  1A5J A;  1GUU A;  1I6H J;  4IHV A;  3VP5 A;  2M9H A;  1UMQ A;  3ZQH A;  2ZOY A;  2G3B A;  3VVX A;  3QPS A;  3S16 J;  3CMY A;  2AHQ A;  2K9N A;  2R5Y A;  2CQQ A;  2LP0 A;  2DMU A;  3RQI A;  5EGO A;  3NAU A;  5J1Y A;  3C07 A;  3I4N J;  1ETV A;  1F43 A;  1HF0 A;  2O7O A;  1JKR C;  2PMZ N;  2JA8 J;  1X2N A;  1IUF A;  3BQZ A;  2MW8 A;  4XK4 A;  5HAW A;  2HI3 A;  2N8G A;  1MBJ A;  3H0G J;  2HYT A;  3FRQ A;  3NPI A;  4MK6 A;  4XRS G;  3GTP J;  1IRZ A;  3JSJ A;  1SGM A;  4CYC A;  5E3L A;  4FIS A;  1QVT A;  3GTJ J;  3GTO J;  3A01 B;  2HOA A;  1LE8 B;  5DS9 A;  1HLV A;  1YRN A;  2R92 J;  1ETK A;  2YVH A;  2JA5 J;  3MKL A;  2COB A;  1RR7 A;  3TED A;  5FLV A;  3FIS A;  3JRF A;  3HOW J;  1OCT C;  1R9T J;  2WB1 N;  4DW6 A;  4DYC A;  1U9O A;  3VVZ A;  3IH4 A;  4JX5 A;  3HIM A;  2LFB A;  4C3H J;  4MFE A;  1ZK8 A;  5EGO B;  1TWG J;  3CQZ J;  5M5Y J;  1TC3 C;  5CXG A;  5M5W J;  2LVS A;  1Z0X A;  1BL0 A;  3V78 A;  3BJB A;  3HOY J;  3CRJ A;  4QSH A;  3UKG A;  2X48 A;  1XS9 A;  1S7E A;  2G7S A;  1TWA J;  3CCY A;  3VIB A;  1RPW A;  1IG7 A;  3JRH A;  1B8I A;  4V2G A;  1XG1 A;  5IOY A;  5F0C A;  3LSJ A;  4D7N A;  5HSZ A;  3EUP A;  3FKI J;  2DJN A;  3TP3 A;  1ETY A;  3WHC A;  2CUE A;  1T33 A;  2XPV A;  3S1R J;  1W0T A;  1YRN B;  2G7L A;  1ZKG A;  2YS9 A;  2UXO A;  4B1R A;  3BG9 A;  4D5F A;  3MNL A;  3C2B A;  3RD3 A;  2L7Z A;  2L7M P;  4M6V A;  3LHQ A;  4HNV A;  4YZE A;  1FTZ A;  3FIW A;  2FQ4 A;  1FJL A;  4B4C A;  2EZK A;  3VW1 A;  2W53 A;  3LWJ A;  3GTM J;  2CJJ A;  1NTC A;  1W0U A;  5EF6 A;  4NN1 A;  3FK7 A;  3QQA A;  1TWF J;  5HBU A;  2E2I J;  5K7F A;  2CU7 A;  4MFD A;  2F07 A;  3WHB A;  2HDD A;  4A3F J;  3S15 J;  3COL A;  3ZOB A;  4S0H B;  2DG8 A;  2YUS A;  4W97 A;  5DTD A;  1U8B A;  1JTY A;  4Y7N J;  2JJ7 A;  1JKQ C;  4A3B J;  2IAI A;  2X9D A;  2DA7 A;  1UI6 A;  5FKO A; 
#chains in the Genus database with same CATH topology
 2DMQ A;  3HTS B;  4RAF A;  1DU6 A;  2EA4 A;  4M6Y A;  2GWR A;  3F8C A;  3VYR B;  5A2Q K;  3E97 A;  4DYR A;  1X58 A;  4RS8 A;  4JP0 A;  2M34 A;  4A3I J;  2MG4 A;  3PL8 A;  2HZT A;  3P7N A;  2RVC A;  4MIM A;  4BQQ A;  1J9I A;  2UWM A;  3OR2 C;  2H27 A;  2CGP A;  2OUM A;  3ZCO A;  5F08 A;  2VI6 A;  1O3S A;  1E0E A;  3CWR A;  2KRC A;  2VOD A;  2OCE A;  1OR7 C;  4UUT A;  5JLX A;  2IA2 A;  2XKO A;  3EUH C;  3SEQ A;  3TO7 A;  4HQM A;  2DA5 A;  3OOP A;  3S14 J;  3W3C A;  1IRG A;  4IL6 C;  2OA4 A;  4CZC A;  4L9T A;  3O2P E;  1U6G A;  3NRG A;  5TJJ A;  1LUJ B;  5CVU A;  1P4X A;  3L2U A;  1XB4 A;  4KN4 X;  4RGU A;  2V6E A;  1MBG A;  4G6Q A;  3A03 A;  3EQL F;  1ZGA A;  5BS6 A;  2L9V A;  3JRI A;  4M3G A;  4XON A;  4AU7 A;  3F23 A;  2XSD C;  2VB6 A;  3FXU A;  5DV5 A;  3NAR A;  1K83 J;  3CP2 A;  2BOL A;  1J5Y A;  5BPD A;  1Z3X A;  3V7C A;  2Y31 A;  5FKM A;  1UB9 A;  1Z6T A;  1Y0N A;  1RC9 A;  3CF2 A;  2E1O A;  5M5X J;  1T0F C;  1FOW A;  4KMF A;  5J8C A;  2NAZ A;  3OYC A;  3GBG A;  5E3M A;  2PJR A;  5DCM B;  2NP3 A;  4M3B A;  4ZYE A;  3J7A Y;  3ZQC A;  1O7F A;  3SDB A;  1FX7 A;  4PK4 A;  3ECO A;  2BVM A;  3MZY A;  1X3U A;  3WTT C;  5L3D A;  4NUB A;  4XLF A;  3VOE A;  3K0L A;  3U2R A;  2DQR A;  4EEF G;  4N4O B;  3S1Q J;  2PMZ A;  3HEF A;  3HE0 A;  3DV8 A;  3O60 A;  2NOG A;  2Y9Y A;  1WSU A;  4PFO A;  3EUH A;  3D1N I;  1G4D A;  3TOA A;  3IWF A;  1JUS A;  1R1U A;  2RN7 A;  4FCY A;  3VYU B;  1O3Q A;  3K7A J;  5ILU A;  2XB5 A;  3A2K A;  3AG3 H;  3Q0U A;  2KIM A;  1J0R A;  3ZQL A;  3S5R A;  3H5A A;  3G56 A;  2IP2 A;  2K9M A;  2AO9 A;  3BG3 A;  2DK5 A;  2OI8 A;  4E6K G;  3HYI A;  3K4L A;  1YS6 A;  5CW8 A;  4ON0 A;  1A6I A;  2D2W A;  3ZQI A;  3PPB A;  4BE0 A;  2CQK A;  2VC1 A;  3ZQQ A;  5HS7 A;  3IKT A;  1IC8 A;  5DYM A;  3BT9 A;  4ZDP A;  3IV5 A;  3LA7 A;  4F93 B;  3AL0 C;  3BJA A;  4E7L A;  2AXT C;  4YIR X;  3J7Y J;  2E2H J;  3H3V K;  3DCF A;  2RV8 A;  4KIB A;  2BW3 A;  3BZ6 A;  5IOZ A;  3CCE I;  3SDG A;  4KIS A;  2QWT A;  1I27 A;  1CQT A;  3W6J B;  3I3L A;  1ZR2 A;  2OPT A;  4BAY A;  2EQR A;  2M30 A;  2A3S A;  3FXR A;  3ZXS A;  1MSF C;  2IGO A;  2LLK A;  1JHF A;  3ULQ B;  2HEO A;  2RHA A;  2LKS A;  3BY6 A;  2CH0 A;  4BKX A;  3E7L A;  4QLC U;  1UST A;  2CRG A;  5CVR A;  2QQA A;  4YEJ A;  1JI8 A;  4KIG A;  4HF0 A;  2FX0 A;  5GP9 A;  3MKY B;  3BJO A;  3DFG A;  2NS8 A;  3L2Q A;  2LKX A;  1QZE A;  2FJI 1;  3OYF A;  4NDL A;  2NVY J;  1T8I A;  3GFJ A;  4IQJ A;  3WE3 A;  3S32 A;  4IHY A;  1BI2 A;  1QBJ A;  2EZL A;  4EJU A;  4BHC A;  1R1V A;  3BTJ A;  2R5Z A;  4WK8 F;  4Y4R A;  3CF5 F;  4Y33 A;  4PSW A;  3FMQ A;  3OYI A;  3KLO A;  4KUM A;  3QP6 A;  2GOM A;  3GLX A;  1ZR4 A;  3OL4 A;  1VQ8 I;  2BEO A;  2L7F P;  3HUG B;  2NNY A;  3FXL A;  1K78 B;  1SFK A;  1B1B A;  1SEU A;  1FWZ A;  3GEU A;  2JK3 A;  4Z2Y A;  4I98 B;  3I59 B;  3K70 D;  4BQN A;  1OCP A;  1UFM A;  3OOU A;  1R7J A;  2CW0 F;  4M3E A;  4LLN A;  3OSG A;  5KNL A;  4A3L J;  4AF5 A;  1X1D A;  2OU2 A;  4Y52 J;  1V3F A;  2E19 A;  5A2Q Z;  2F6C A;  1JXS A;  3HTJ A;  1E3P A;  3EGQ A;  5EZH A;  2K9Q A;  1I1S A;  4C30 A;  3H1C A;  3DTI A;  3T5X A;  1XDS A;  4MQ9 F;  3LAP A;  3F1B A;  1ITY A;  2C6Y A;  4P1W A;  4KYW A;  3EUA A;  1TBX A;  3PUF A;  3C2G A;  1NHA A;  1D3Y A;  1O57 A;  4ZTJ A;  3S3N A;  2EWN A;  2J5O A;  2XB0 X;  3VFZ A;  3QYB A;  2ZXJ A;  3PNY A;  3GXO A;  4XLC A;  5LFA A;  2VON A;  3L7W A;  1RRJ A;  2GXG A;  3J81 K;  2O8K A;  1WCM J;  2Q2E A;  4L5E A;  1G2H A;  1LEA A;  4R8H A;  2CQN A;  1LJ9 A;  4HX4 A;  2BBY A;  3TO6 A;  3CMA I;  4J19 A;  1H8A C;  2HVR A;  2VQC A;  1R4M B;  1U0J A;  1G6N A;  2AQF A;  2QKO A;  2FSW A;  4IOC F;  1USS A;  4QPO A;  3PAS A;  2YU9 J;  3ZMS A;  1KYZ A;  3DQV C;  2F4I A;  5EEA A;  2GM4 A;  2DTR A;  4BE1 A;  2FNP A;  5EDN A;  1IDY A;  2NOJ B;  1SVL A;  2KZG A;  2Q0O A;  1FLI A;  2M8E A;  1W5S A;  3WTU C;  2VKD A;  2VT3 A;  4U7B A;  3OMY A;  2XAF A;  3G7R A;  4XIC A;  1YG2 A;  2MSY A;  5F04 A;  3U1D A;  1K7A A;  3PIP F;  3SFI A;  1HCR A;  3KYD B;  4BL0 B;  3GO5 A;  3FK6 A;  3EDP A;  2UXP A;  2K86 A;  2Y0M A;  1RNL A;  1OQY A;  2DO7 A;  5IT9 Z;  4N9H A;  4WIB A;  3L2V A;  3QOE A;  5E3N A;  2ZXI A;  1FPQ A;  2LOO A;  2O5R A;  5C3E J;  3R60 A;  2XRL A;  2HYJ A;  1UEL B;  2K3F A;  2VBW A;  4C2M J;  4IVN A;  1YQA A;  2RNJ A;  4HV6 A;  4AYB N;  3OYB A;  2VXZ A;  3F21 A;  3S1M J;  4E70 A;  1UCR A;  3K9T A;  2K9L A;  5DM6 F;  3RI4 A;  1I39 A;  1R4N B;  3G1M A;  2L02 A;  2E2J J;  2X1E A;  2P4W A;  3RSN A;  2KHM A;  1GT0 C;  2WBM A;  2ZO4 A;  2GEN A;  5EFY A;  2CS3 A;  2DJI A;  5D5W B;  3OYA A;  3DEE A;  4IRH A;  3CLQ A;  1ENH A;  1WPK A;  1RKT A;  2F48 A;  2RQQ A;  3RKX A;  1OCO H;  1D0X A;  3IC7 A;  4NNJ A;  1IDZ A;  3EYY A;  2DMT A;  2HKX A;  4ACI A;  4BDZ A;  2BV6 A;  1XX5 A;  2ZCX A;  3TMO A;  3HHG A;  1ZLK A;  3LWF A;  2PFV A;  2YVE A;  3RTR A;  3LJL A;  4P96 A;  1S7A A;  3BG7 A;  2UXU A;  4B43 A;  3KP3 A;  1W5T A;  4IEJ A;  3JR9 A;  4FTH A;  1RKW A;  1MBH A;  2K27 A;  2HXI A;  1MDM A;  1RUO A;  2PZ9 A;  2VKH A;  4I6Z A;  5CJ9 A;  3O6B B;  4I02 A;  4CA0 A;  3RZO J;  4EJO A;  2RNG A;  4II3 A;  2ELJ A;  2FBI A;  3WU1 B;  3LQQ A;  1YW8 A;  3TDZ C;  2CG4 A;  1A5J A;  3B02 A;  1I6H J;  4IHV A;  1EJ9 A;  2O03 A;  1N75 A;  2M9H A;  4KFC A;  3G3Z A;  4IO9 F;  4PSX A;  2K9N A;  3BRO A;  4UB8 C;  2GA2 A;  3NAU A;  4HV5 A;  2B0L A;  2V26 A;  1QZZ A;  1LDD A;  4MEX F;  4GDF A;  3CCQ I;  1F43 A;  1HF0 A;  2WB1 A;  2EPF A;  3RKW A;  1BBY A;  4EQQ A;  2ZFW A;  2CMP A;  3P9C A;  3JAM K;  3VEP A;  1U2W A;  4UV8 A;  1K6Y A;  4DBQ A;  1J7K A;  2BYV E;  2L7K A;  2VXD A;  3DKX A;  3QOD A;  4XQF A;  1BC8 C;  3LQR A;  1IAW A;  1TW2 A;  1QA6 A;  2WC2 A;  2XUB A;  3ESW B;  3ZMU A;  1GVJ A;  3KEO A;  2VAS A;  4XRS G;  3HIF A;  1J09 A;  2ZY9 A;  2WA0 A;  2W1O A;  5BQT A;  1SGM A;  2M87 A;  2OZU A;  3JSP A;  1WJA A;  2EV6 A;  1QVT A;  3AG2 H;  5LGN A;  2X1C A;  1D1B A;  5DS9 A;  2G9W A;  1HLV A;  2DW4 A;  3OS0 A;  3DPT A;  2OC6 A;  2YVH A;  1ZG5 A;  1IO2 A;  4IHT A;  1QGP A;  4WXD A;  3H9G A;  3IAM 2;  3ZMT A;  5FLV A;  2VQH A;  5HNH A;  5EJC A;  4IF4 A;  5KAF C;  3HOW J;  1OCT C;  1MMD A;  1R9T J;  4DW6 A;  4DYC A;  1I5Z A;  2LSO A;  3KLN A;  3IH4 A;  3HIM A;  2LFB A;  3R6S A;  3CQZ J;  2WWY A;  5M5Y J;  3PSF A;  2JPB A;  2VE9 A;  5CXG A;  5M5W J;  3IHU A;  5GAD J;  1XMA A;  4E7I A;  5FFX A;  4BJT A;  1X1P A;  1XSD A;  4EM2 A;  2QVO A;  3BJB A;  3CRJ A;  5E20 A;  4PGH A;  3CD6 I;  2HDC A;  4UVC A;  1MGT A;  3FXK A;  1TNT A;  1TWA J;  3CCY A;  3TL4 X;  1FOX A;  1WJC A;  3H0D A;  2DOD A;  1RPW A;  2H94 A;  4V19 K;  3JRH A;  1G3W A;  2V4J C;  3AL0 B;  1XG1 A;  2M7B A;  2WY8 Q;  4CGZ A;  2W7N A;  2DJN A;  1ETY A;  4CO8 A;  4C9Y A;  4RB2 C;  1T33 A;  2XPV A;  3I9V 2;  1YRN B;  2H09 A;  2ACJ A;  5H6R A;  3BCB A;  3PFI A;  3DBH B;  3MNL A;  3B73 A;  2KMU A;  2L7Z A;  2A68 F;  4M6V A;  4EMS A;  4PDK A;  2R7V A;  3LHQ A;  2CSO A;  2V1X A;  2W53 A;  3GTM J;  4NN1 A;  2DOA A;  4BEH B;  3BC8 A;  3ABT A;  2JUG A;  1TWF J;  4UVA A;  3KX2 A;  5E1Z B;  5K7F A;  2CU7 A;  2JVG A;  3F8M A;  4I2O A;  2G7H A;  2NVU B;  3WHB A;  4A3F J;  3GYH X;  2JZY A;  3BWG A;  3S15 J;  1DPU A;  1G3S A;  2LF8 A;  2YUS A;  2PG4 A;  3FDY A;  3C3W A;  1IXC A;  1FSH A;  3BG6 A;  1U5T A;  1U8B A;  1JTY A;  2ZXW H;  3GME A;  3S3O A;  1NG7 A;  1UI6 A;  1Y0U A;  2W48 A;  1VI0 A;  1AOY A;  1PYV A;  1SVO A;  2X51 A;  2CW7 A;  4JKZ A;  4OMZ A;  1R5I D;  2F2E A;  3GWZ A;  5JLW A;  3IWZ A;  4Y17 A;  2NS7 A;  2EIN H;  2TDX A;  3A01 A;  3KPH A;  1O3T A;  1YLF A;  1YJ9 I;  2W00 A;  4AC0 A;  4LLG F;  3FXO A;  2HU9 A;  1B72 A;  3F8B A;  3QU6 A;  4DGW B;  4D7M A;  3PM1 A;  1GV5 A;  4MHG A;  1JGG A;  4IXA A;  4EVI A;  5BPI A;  1BJZ A;  4GFK A;  4CIC A;  1FP2 A;  5IP9 J;  2E60 A;  1FY7 A;  1FOY A;  3L09 A;  2H1K A;  4X0G A;  2PI0 A;  5F1J A;  3S2D J;  2IS6 A;  3V8L A;  3KZY A;  2NXN B;  2IPQ X;  1U5T C;  3I54 A;  3M1E A;  3LFK A;  4MEY F;  4EJW A;  2V1D A;  3GFM A;  4HKU A;  5L3F A;  3OYK A;  2R5Y B;  3QBM A;  5CLS A;  1Q1H A;  1I50 J;  1JUP A;  2XSJ C;  3D5R C;  5B3S H;  2YX4 A;  1PUF A;  2P5V A;  4RLF A;  3HGY A;  3S1N J;  4F7Z A;  4YEL A;  2B1E A;  2REK A;  1DGR M;  2JUC A;  3TDU C;  2CQX A;  1XMK A;  4A12 A;  3MKZ A;  1D1A A;  2V9V A;  2XDN A;  5ICE A;  4H4K C;  4KWA A;  4WWC A;  5DDG A;  4NC6 A;  3JRA A;  2VT2 A;  3MEX A;  2HKU A;  1BC7 C;  3RYP A;  1ULY A;  2EFP A;  2ZSI B;  3TW6 A;  3P9K A;  2ME0 A;  4M71 A;  4HLY A;  4LG0 B;  1P9Q C;  2XGE A;  5FGL A;  3U1K A;  4AC6 A;  4NQW A;  1HBX G;  1XGN A;  4ENJ A;  2GLO A;  3CDL A;  3ML6 A;  4GFB A;  4GCL A;  1XSV A;  3R61 A;  4EGZ A;  3HOV J;  4IQ4 A;  2HZD A;  2M45 A;  3GZI A;  5F64 A;  1H0M A;  3T6N A;  2VBZ A;  3W6V A;  1X1B A;  3VOD A;  4AVP A;  4DOZ A;  1KU3 A;  3I4P A;  5ILV A;  2EBI A;  2YSR A;  5D4S A;  2EZH A;  2DG7 A;  2XKP A;  1REP C;  1WI3 A;  2NVQ J;  5L3C A;  4G12 A;  4M9S A;  1QNT A;  3UR3 C;  4RB1 A;  4HNT A;  3HOT A;  1R23 A;  2KQR A;  1IUY A;  3E7Q A;  1YE9 A;  1JUM A;  2H1L A;  2YR2 A;  3E5Q A;  4GXO A;  4JYK A;  4KIF A;  4ZYA A;  5FLX Z;  3O8G A;  4L5I A;  1JT6 A;  1OIS A;  3SFZ A;  2F5F A;  3E0J B;  4ZYD A;  1Z1D A;  2GA1 A;  3ERE D;  3F72 A;  2DA1 A;  3RH2 A;  5E18 F;  2BHZ A;  2CUF A;  2CO5 A;  3WE2 A;  4MTE A;  2BY3 A;  4A5M A;  2JA7 J;  1Z05 A;  3V8K A;  2R7D A;  3CES A;  1ERD A;  5GPA A;  2GFN A;  5EEH A;  4UUS A;  3RKQ A;  1ZLJ A;  1Y8Q B;  1YYV A;  4AID A;  2K9S A;  2CUJ A;  2KPM A;  3IUV A;  2M0C A;  4HPQ A;  5LGU A;  3IH2 A;  2KDO A;  1R00 A;  2X6O A;  3VSL A;  5M3M J;  2PEX A;  2E71 A;  4IRI A;  2GIZ A;  1X2M A;  4OIO F;  4A0Y A;  1TL8 A;  3RKY A;  1X4O A;  1MH4 A;  5H2F C;  5J47 A;  4O6J A;  3AAF A;  1FMW A;  4U0V A;  2DYS H;  2XC7 A;  3ABM H;  4A3K J;  1JJ6 C;  3REO A;  2Q24 A;  2GAU A;  3OIP A;  2PFB A;  1YIT I;  2M4G A;  2L9S A;  4F3Q A;  2IU5 A;  4HNU A;  4RA2 A;  2OV7 A;  1KYW A;  3KYC B;  1HKS A;  3F3X A;  4LJZ F;  1H89 C;  2M3A A;  1A04 A;  2ESH A;  3DU5 A;  5C4X J;  2DA4 A;  4LG0 A;  4Q5S F;  4ZH4 F;  2IA1 A;  2I10 A;  2L01 A;  3OYN A;  4LMY A;  4BQA A;  1VFC A;  1DUX C;  4XOT A;  4RGR A;  5ED4 A;  1FNN A;  3QP5 A;  3OS2 A;  5JI6 A;  2A5Y B;  3ZQ7 A;  1Y1V J;  1B9M A;  5F0H A;  4NHJ A;  4E4H A;  1TNS A;  1ZQ3 P;  1P4A A;  1Z3Y A;  4HSR A;  1WGX A;  2XF5 A;  2P6T A;  1Y8R B;  1JT0 A;  2A6E F;  2DOE A;  4RB3 C;  5AQC A;  2KIU A;  4B09 A;  4XRS A;  5D18 A;  4GCK A;  2E5N A;  5KK1 A;  3CJD A;  2CFO A;  2HQA A;  1KGS A;  2VIX A;  1FOK A;  2UV1 A;  4C3J J;  3M7G A;  5C44 J;  2BY0 A;  1R5H A;  1ETW A;  3Q0W A;  1KON A;  2X6W A;  2E1M C;  3KP2 A;  4KIC A;  3HRM A;  4AUX A;  5IT3 A;  1WJE A;  2LDU A;  1Y39 A;  4IHS A;  3MVP A;  4WCG A;  3I5U A;  3K1M A;  1MKM A;  1KZH A;  5FKK A;  1SAX A;  2RAE A;  2XGD A;  4KT6 A;  3GUD A;  1FZP B;  2PLY A;  2P0W A;  3DLA A;  2PJR B;  3N05 A;  5L3G A;  1DDN A;  3WU2 C;  4M73 A;  1XSX A;  3BTI A;  1SFU A;  3PQJ A;  2JA2 A;  5HOO A;  5EG0 B;  1B72 B;  2IBD A;  2CQ7 A;  3VVY A;  1WFX A;  4ZJZ A;  1IV6 A;  2Y75 A;  3R0A A;  4PJJ A;  2R93 J;  3I4M J;  4IJA A;  5K5R A;  2BXY A;  4LIT A;  3OYG A;  2B63 J;  3KNW A;  2E5Z A;  2UXX A;  1APL C;  2VJ5 A;  5J3L A;  4CSW A;  1DP7 P;  2E7X A;  1TP4 A;  3N97 A;  1Y1W J;  5AIP A;  1IXS B;  1QRY A;  5FLX K;  1DGW Y;  1I6X A;  1MW7 A;  1ZG1 A;  5FFZ A;  2DN0 A;  3LA2 A;  4I09 A;  4PJN A;  2KJC A;  2XAH A;  2O6G E;  2VKV A;  2FNA A;  4XOR A;  2ECB A;  1B9N A;  4LOC A;  4RBO A;  5FRO A;  1R58 A;  2QUF A;  2ZB9 A;  4BY7 J;  5DAJ A;  5FD5 A;  2EZI A;  4XKB A;  4E7H A;  2MFZ A;  3VW0 A;  5K1Y A;  5FJ8 J;  3NEU A;  4UUS B;  2B3W A;  4Y13 A;  1FMV A;  4ETS A;  2W4S A;  3HSR A;  3K2A A;  3HB9 A;  3OIO A;  2VKE A;  3CTA A;  3T0Y A;  3W6K B;  1WWX A;  5J4V A;  1HA8 A;  2RAS A;  1IRX A;  2OF7 A;  3F6V A;  3QWL A;  5CQG A;  1SFX A;  2H8W A;  2QSG X;  4JQF A;  3M07 A;  2R7U A;  2ICW G;  2KT0 A;  1IGN A;  2L3D A;  2XAQ A;  3H35 A;  4OD5 A;  4M72 A;  1WI9 A;  4XR6 A;  3HJE A;  2FBK A;  2TRT A;  4L0Z B;  5J40 A;  5L3B A;  2KRF A;  4I0B A;  3B6A A;  4U9N A;  4A3J J;  4D0P A;  1PP8 F;  4NB5 A;  2DFE A;  1B4A A;  1E2X A;  4OIR F;  2AXL A;  2CW8 A;  4S05 A;  2GOX B;  1NH3 A;  4FQG A;  2EB7 A;  2JPC A;  3V42 A;  4KA4 A;  3ASO H;  1EH6 A;  3E6M A;  3PSI A;  2RC4 A;  3ZMZ A;  3HBL A;  3ZN1 A;  5HLG A;  4U0W A;  4U9L A;  3HRS A;  2QKM B;  1Z67 A;  1IN5 A;  1V5E A;  4PJL A;  3BG5 A;  4KIT B;  3VYT B;  2HFH A;  4ESB A;  1QQI A;  3FMR A;  4QWQ A;  3RQ4 A;  1Q1V A;  4MO7 A;  4ZYH A;  3NI7 A;  4CH7 A;  2K7L A;  1K6O A;  2ESN A;  3FM3 A;  2XRN A;  1SD4 A;  2V9P A;  3DEW A;  1FBU A;  5J8F A;  5D6E A;  3PNV A;  2XIG A;  1AKH A;  2D45 A;  3A0H C;  1SAN A;  4CGR A;  2L0K A;  4B48 A;  2Y9Z A;  5E1X A;  4HW0 A;  2DPU A;  3BR5 A;  1YOV B;  4P55 A;  1BI3 A;  4LIU A;  2HGC A;  1GUU A;  3KCC A;  5TRD A;  4S04 A;  2LY2 A;  2E34 A;  1UMQ A;  3CUO A;  3ZQH A;  4ESJ A;  4A5N A;  4UV9 A;  3KEY A;  3QPS A;  3S16 J;  1PVE A;  2AHQ A;  2R5Y A;  4D1Q A;  3K1P A;  3ABU A;  4P9F A;  5J1Y A;  3H92 A;  5HDG A;  4B8X A;  1YJW I;  1VQ6 I;  2COM A;  1YFH A;  3CJN A;  1BM9 A;  4ZZD A;  2LH9 A;  2VJ4 A;  2VBX A;  2JA8 J;  4EV0 A;  3BQZ A;  3H3U A;  2MW8 A;  4XK4 A;  5HAW A;  4CCM A;  2N8G A;  3K8P C;  1SD7 A;  3H0G J;  2EA2 A;  4FX0 A;  4Q48 A;  4MK6 A;  3DPU A;  2HOE A;  4LK1 F;  3JSJ A;  1UHW A;  4FIS A;  5TIS C;  4UY8 I;  3QYE A;  3GTO J;  2ELH A;  3CCV I;  3C18 A;  3A01 B;  1G59 A;  2MA3 A;  1YIJ I;  4B44 A;  4ZTF A;  1ETK A;  4MQV A;  5JFR A;  1MDM B;  2BXZ A;  2YPR A;  4EM1 A;  2COB A;  1RR7 A;  1KQ9 A;  1U9O A;  5E79 C;  1MMS A;  2KJB A;  4CUG A;  4CYD A;  4C3H J;  4MFE A;  5EGO B;  4I7H A;  1ZN2 A;  5GAH J;  4KJZ A;  4YFN F;  3O3K A;  1G3T A;  4HA8 A;  4HRI A;  3T8R A;  3LAJ A;  2FRH A;  3HOY J;  3UKG A;  2X48 A;  2MD5 A;  4CCO A;  4BEH A;  2G7S A;  2FF4 A;  3LSM A;  3SYT A;  1WJD A;  5DD8 A;  2HKO A;  4BH9 A;  1HST A;  1BI1 A;  3NQO A;  3BZK A;  3HXL A;  1YS7 A;  5DUI A;  2DU9 A;  3PFY A;  4V2G A;  3AG1 H;  5IOY A;  1T2K A;  1IRF A;  4G7H F;  1EA3 A;  2K4B A;  2KP6 A;  4D7N A;  4XSZ F;  4XLE A;  5F1R A;  2VQG A;  3TP3 A;  2MAB A;  2CUE A;  1ZEL A;  1R49 A;  1ZHF A;  1D5V A;  3L2C A;  2Z33 A;  2UXO A;  2A61 A;  4HST A;  4B1R A;  3L2R A;  3RCO A;  4HDU A;  4OMY A;  3RD3 A;  4YZE A;  1FTZ A;  3X2Q H;  4AVZ A;  3GX4 X;  3K69 A;  1U8R A;  2FQ4 A;  1FJL A;  1OKR A;  4HYE A;  3LWJ A;  2KRH A;  4XKW A;  1RUN A;  1IXR C;  1Z7L A;  3FK7 A;  1B59 A;  5HBU A;  2HYG D;  2VL8 A;  2E2I J;  4R79 A;  4FET A;  1ZG3 A;  3GFI A;  3FKJ A;  2JSP A;  1BIB A;  2V7F A;  4EJT A;  2QQ8 A;  3CME I;  3I64 A;  3LA3 A;  3EYI A;  1H9T A;  1FC3 A;  3WGH A;  3H5N A;  3Q9V A;  3WG7 H;  3LL7 A;  1BOA A;  1T6S A;  2JJ7 A;  3ABL H;  4Q47 A;  2PMU A;  2DA7 A;  3H3Z A;  4Q4Z F;  2V6C A;  2HPI A;  4EJV A;  1MD0 A;  3CCM I;  3S8P A;  1ETX A;  3D5S C;  4N0B A;  1WVR A;  3KIO A;  1ODD A;  2UXN A;  5LHH A;  4YIF A;  1GV2 A;  2MYS A;  4PFP A;  3CCS I;  2R4G A;  1I3Q J;  3VUQ A;  4BU2 A;  1LDK B;  2JMW A;  3V8J A;  2MLG A;  2ZXH A;  2VPR A;  2Y0S A;  4GFL A;  1LDJ A;  1QVU A;  1AKH B;  3ZR8 X;  5LRR A;  1X1A A;  2EIL H;  4P5O A;  4YG2 F;  2M1B A;  5J1U A;  1KU7 A;  1F5T A;  2Z5U A;  2ISZ A;  3JTH A;  1FIA A;  2CUZ A;  3KP4 A;  2XV4 S;  2IXS A;  3MWM A;  3D0S A;  1KQ0 A;  2UXI A;  3LSG A;  1OCR H;  2FQ3 A;  3SWH A;  3MQ0 A;  2DMP A;  5F0F A;  3M8J A;  3AFH A;  1CF7 B;  2FMY A;  4KNY A;  4CCL A;  3DLL F;  2LR8 A;  4W1U A;  2P5K A;  2IW5 A;  4BS9 A;  1XTA A;  2BY2 A;  1KU9 A;  1L3L A;  3HOZ J;  4UUV A;  2RKH A;  1E3O C;  2L9R A;  3JSO A;  5HS9 A;  4MTD A;  1RZ4 A;  4N4N B;  1X3Z B;  4PCQ A;  2WV1 A;  2FD5 A;  2ZNZ A;  3K10 A;  2NVT J;  2ZOZ A;  2LD5 A;  3K70 C;  2XAJ A;  3ON4 A;  2G0E A;  1FEX A;  3BQY A;  4LG3 A;  2BZT A;  4E7Z A;  1Y6I A;  3BRU A;  4PUS A;  5CXI A;  2EFQ A;  3BP8 A;  5K7Z A;  2BHY A;  1L0O C;  1J2X A;  2AQE A;  4ESF A;  2FA5 A;  2RDP A;  4BAC A;  4JOM A;  4MLO A;  2EFW A;  3G1L A;  5DUK A;  2QEN A;  1QPI A;  2MC4 A;  1MH3 A;  2OQR A;  3K4J A;  3ONQ A;  1SAU A;  3MKW B;  1TTY A;  4RMN A;  3K4M A;  2DA3 A;  2ID6 A;  2Q8K A;  3QAH A;  3RZD J;  5CVJ A;  3KKC A;  3CMM A;  1IN8 A;  4CCN A;  4HAM A;  1ZGJ A;  2V9K A;  4DVY P;  4A6E A;  1BIA A;  5FMP A;  2MH2 A;  3TQN A;  5K5Q A;  4BXF A;  5FB2 A;  2HPM A;  2RGV A;  3QU3 A;  3CJT B;  3HPH A;  1BW5 A;  2A07 F;  2G7U A;  1H9G A;  5GPC A;  3PO3 J;  5D6F A;  1W7P B;  1QO0 D;  3S2W A;  2XDV A;  1BR2 A;  1NG6 A;  4YFK F;  4WX9 A;  2HVQ A;  2HQN A;  5EEG A;  3ELK A;  1IN6 A;  1KA8 A;  3OIQ A;  3WTW C;  1VQL I;  4GCT A;  2Y0S N;  1HC8 A;  3VOK A;  3S2H J;  1LNW A;  4L9J A;  1BJA A;  2DFF A;  3L00 A;  3DTE A;  2VOO A;  5EG0 A;  2DT5 A;  4X1E A;  1OR7 A;  4J01 A;  1T39 A;  2VOP A;  2B7E A;  1HXD A;  3C7J A;  1Z77 A;  3LST A;  5ERI A;  1XPX A;  2K3P A;  3O8H A;  3OYE A;  3GW2 A;  1FP1 D;  4YFX F;  5CVI A;  5BNG A;  1MMG A;  5F27 A;  3TP0 A;  2WAQ A;  1ETQ A;  1UG2 A;  3I53 A;  3CCU I;  2IS1 A;  1E17 A;  1X1C A;  1ON2 A;  3V7S A;  2A69 F;  2QF7 A;  4IHW A;  3DPJ A;  2LNB A;  5D19 A;  4I01 A;  4JBA A;  1UG0 A;  4OOI A;  4D9J A;  1SVM A;  4L62 A;  1ETO A;  1STZ A;  3EPZ A;  1LFU P;  1S3J A;  1WZ2 A;  1LEB A;  2Q2E B;  4XNF A;  3SEZ A;  5LHG A;  1BA5 A;  3KP7 A;  3NS4 A;  3H5R A;  1TQP A;  3FF5 A;  3H9Q A;  3BR0 A;  2W82 A;  1ORK A;  3JRD A;  4O5V A;  3CP8 A;  2HXO A;  3BLY A;  3RYR A;  3M8F A;  2LK2 A;  2DA2 A;  2HR3 A;  3HKZ N;  5KCM A;  1Z21 A;  5HDK A;  4I76 A;  2PQ8 A;  1EH7 A;  4UB6 C;  2OAZ A;  2X4H A;  2W84 A;  1FYM A;  1VZ0 A;  3DP7 A;  1SD6 A;  3KZZ A;  4MXM A;  1NK3 P;  3OYH A;  2ZC2 A;  3WGI A;  3V6G A;  1TQM A;  2KL4 A;  3NXC A;  2M4K A;  2PBI A;  3K4B A;  5K5O A;  2A2F X;  1WJF A;  5EZG A;  3HOX J;  4I0A A;  2DOF A;  3BTC A;  2NRA C;  2L9N A;  3T1B A;  3OWT A;  5DM7 F;  3WTS C;  3LSH A;  1A6Q A;  3JRB A;  2QZ8 A;  3LNQ A;  2STT A;  4RM3 A;  3M8E A;  3J80 Z;  2QCO A;  1OCZ H;  4G6D A;  5KVR A;  5ICC A;  2HQ5 A;  4ABZ A;  3I59 A;  1V54 H;  2GUH A;  5ICF A;  2WGB A;  5HLT A;  2E36 A;  5J6X A;  2Y2Z A;  5B1A H;  1K78 A;  3ZMD A;  3QPT A;  1HOM A;  1YO5 C;  2DA6 A;  2YU3 A;  4A3C J;  1IN7 A;  3SXY A;  4BQO A;  2GQQ A;  2MGQ A;  2MBF A;  4AYB A;  2R5Z B;  2DLL A;  3MZ8 A;  2GBY A;  2ELK A;  2DCE A;  1XCV A;  2ZSH B;  3B6C A;  1LQ1 A;  3DU6 A;  3IKV A;  1S5L C;  4M3F A;  3BR1 A;  3NWT A;  2D1V A;  1GXQ A;  2F5C A;  2DMN A;  5KHD A;  2P81 A;  2JRM A;  2KIF A;  2GXA A;  1XD7 A;  4M3D A;  1T98 A;  4HOB A;  4XRF A;  1B6A A;  1N78 A;  3LSP A;  1V4R A;  1DPR A;  2D6Y A;  4L5J A;  2MH9 A;  1H88 C;  3IUO A;  1PUE E;  5IPA A;  4BJ6 C;  4C2U A;  2EH3 A;  1JHH A;  4C2T A;  2B9S A;  3F9K A;  2NP5 A;  3GTK J;  2BY1 A;  2IVM A;  1F1Z A;  2WY7 Q;  2Z2S B;  1RES A;  4F52 A;  2PN6 A;  4LB5 A;  1ZAR A;  2OJE D;  5JVT A;  3AQS A;  2BW3 B;  2MD0 A;  1A31 A;  2HS5 A;  5LEJ A;  1S29 A;  2LBF A;  5B1B H;  3CO6 C;  3WTY C;  3G2B A;  1XCB A;  4N9I A;  3GZ6 A;  4DIQ A;  1EV7 A;  4RGX A;  4M6X A;  2V79 A;  4NQW B;  2NVX J;  3NWS A;  1VQ7 I;  2XF6 A;  3LSR A;  2LRD A;  2JWT A;  3DEU A;  1W1W E;  1JKP C;  2CV2 A;  2QEX I;  5B5E C;  4YII A;  4L0Y B;  1OMI A;  1FTT A;  1JTX A;  3K4K A;  1HDP A;  2ISY A;  1MNM C;  3AQT A;  4JX4 A;  3K6G A;  1VND A;  2D5V A;  1PDN C;  2XHK A;  2K40 A;  1D0Y A;  4KN7 X;  1NK2 P;  4OU0 A;  3B81 A;  1M1E B;  2OCC H;  3G1O A;  2DBB A;  1TW3 A;  5IYB J;  3MZH A;  4F92 B;  5BMZ A;  4RAZ A;  1JKO C;  3KFW X;  2OER A;  3EUK L;  3HZJ A;  1B8I B;  1MJ9 A;  1OYI A;  3GTQ J;  1C0W A;  4O3M A;  3ON2 A;  3IH3 A;  2PMH A;  5HLH A;  4I99 C;  1V5G A;  2J5P A;  4BXX J;  3PO2 J;  4YRV A;  1HDD C;  3CC4 I;  3AG4 H;  1IW7 F;  1VQO I;  1PUF B;  5IYC J;  3QKX A;  3HGG A;  1LVK A;  2KFD A;  2P5L C;  4GRI A;  4OWR B;  3Q9S A;  5L3E A;  3BZC A;  2STW A;  1VQP I;  3HTA A;  5FKL A;  1AHD P;  3NRV A;  1BW6 A;  3MN2 A;  1LVA A;  1XGO A;  5KAI C;  5HS8 A;  1YW7 A;  2EFO A;  5D8K B;  3WG9 A;  3M9A A;  4IHX A;  4A3G J;  6PAX A;  3IRQ A;  4OIQ F;  1UJ8 A;  4A3D J;  3ZP5 A;  2WAF A;  1IF1 A;  3KET A;  2Z3Y A;  4TV7 A;  1TZL A;  3LSI A;  2Q1Z B;  4CYC B;  2JVH A;  1SD5 A;  1WH5 A;  1GDT A;  2VN2 A;  3HSF A;  5GTI C;  4A93 J;  2WAD A;  1RR8 C;  3HHH A;  1DU0 A;  2NS0 A;  2H6B A;  2VLA A;  1K61 A;  3ERM A;  1MIJ A;  1Z7U A;  3VP5 A;  2W57 A;  1GXP A;  4BXU A;  2LKP A;  1ACI A;  1D1C A;  3F6O A;  3GZ5 A;  2DFI A;  2CQQ A;  2LP0 A;  1P6R A;  4DQ2 A;  3VWB A;  4NC8 A;  5JR3 A;  3RQI A;  1U5T B;  3IRR A;  1OYW A;  5HDN A;  3ZPL A;  3LSK A;  2IS4 A;  2E35 A;  1ETV A;  3HL2 A;  1D8K A;  2H6C A;  3P9I A;  1ON1 A;  2A6H F;  3K4N A;  2HDW A;  2DYR H;  4XM3 A;  4EM0 B;  3CC7 I;  1WQ2 A;  3DXJ F;  1IUF A;  2RQP A;  5DEQ A;  4F55 A;  2Z16 A;  2EIM H;  4XKC A;  3GCM A;  3I58 A;  1MBJ A;  2FOW A;  2OBP A;  3I71 A;  3IP4 B;  2R7T A;  3NPI A;  3BOQ A;  4IOA F;  3J80 K;  3GTP J;  1Z9C A;  2BGC A;  4U88 A;  1V5F A;  3CCR I;  2VPL A;  1ONV A;  4PJ0 C;  5FGM A;  1YRN A;  3ECH A;  4RAY A;  1LE8 B;  1HW1 A;  2F5E A;  2HTS A;  3MKL A;  1YW9 A;  2MLK A;  4E7J A;  3VYS B;  3K1N A;  3TKY A;  3KP5 A;  3JRF A;  3QPH A;  3G73 A;  2FU4 A;  2R7R A;  4XBF A;  3OY9 A;  3ASN H;  2ETH A;  4JX5 A;  2O3F A;  5D5U B;  2R7X A;  3C2H A;  1MJB A;  4UNO A;  1TWG J;  2O0Y A;  3IL2 A;  5E8I A;  1WHU A;  2LVS A;  3E3V A;  3WGG A;  2R7W A;  1N25 A;  3S3M A;  1G3Y A;  2QYO A;  1Z0X A;  3V78 A;  3U9G A;  3FBN B;  4QSH A;  4ZC3 A;  4AIH A;  4HF2 A;  1S7E A;  3MAJ A;  3ROU A;  3WOD F;  1HKT A;  2LRE A;  3VIB A;  1YHQ I;  3K4C A;  4M9Z A;  4HEA 2;  4A0Z A;  1LKX A;  1TLH B;  4XSX F;  4RM2 A;  3QOP A;  4LB6 B;  5F0C A;  4BGD A;  3KE2 A;  5GAE J;  4P9U A;  2HYF A;  2E7W A;  3EUP A;  1P92 A;  3WHC A;  3CZ6 A;  4GGG A;  4PGG A;  4G9Y A;  2XGX A;  4EGY A;  2G7L A;  2YS9 A;  1YIO A;  3BG9 A;  5H6Q A;  4D5F A;  5AON A;  3C2B A;  2L7M P;  4GYG A;  2QLZ A;  3FIW A;  1G8X A;  3D5L A;  4U0Y A;  3CUQ C;  1S72 I;  1U3E M;  3DKW A;  1S7O A;  2EZK A;  2KIQ A;  3VW1 A;  2CJJ A;  1NTC A;  3CC2 I;  4A0X A;  4CXF A;  2W85 A;  3FWE A;  2QBY A;  3QQA A;  5HLI A;  4KMU X;  4MFD A;  2CYY A;  1R6R A;  4HG2 A;  4UVB A;  2HDD A;  2OTJ I;  2MC3 A;  2IRF G;  3COL A;  1SC7 A;  3PJR A;  3ZOB A;  1DP3 A;  5E17 F;  2DT7 B;  2DG8 A;  3V4G A;  3I56 I;  2DPD A;  5DTD A;  4ENK A;  4Y7N J;  4GYI A;  3G71 I;  1D0Z A;  4A3B J;  4XMY A;  2IAI A;  1HW5 A;  2X9D A;  3A0B C;  5D5V B;  2X6Y A;  3W2W A;  3BJ6 A;  2VJI A;  4XLN F;  3RPU D;  1QZY A;  3VSK A;  3GEZ A;  4BE2 A;  4Z6Y A;  1U78 A;  1R36 A;  4IPA A;  2VC0 A;  1HKQ A;  3WTX C;  3HKZ A;  3OR1 C;  4ME9 A;  2QIB A;  2IGM A;  3HC7 A;  3HPG A;  1ZGW A;  1F4K A;  2QQ9 A;  3ZMV A;  3HG9 A;  4ZYG A;  4BY1 J;  3BR3 A;  2V57 A;  3KEQ A;  2ZNY A;  1IZ1 A;  4ZZL A;  3C1D A;  1GHC A;  2HQR A;  4JNN A;  2IGK A;  3K2Z A;  2HOS A;  3FXQ A;  2O8X A;  2ZJR F;  3BHQ A;  2Y30 A;  3BR2 A;  2LBF B;  3ZQF A;  2NX4 A;  2G7G A;  2LC2 A;  2XPW A;  4ZDO A;  3QRF F;  3DKY A;  4BHP A;  3SZT A;  3SJM A;  4ZDL A;  2FBH A;  1I1G A;  3ABK H;  2FBQ A;  4XLH A;  4XLP F;  3BCA A;  4FE4 A;  3CDH A;  5CPR B;  3M3Y J;  2IS2 A;  3TBI A;  4M74 A;  1P2F A;  1FT9 A;  3CO7 C;  3CCJ I;  1T08 B;  2HOT A;  4JK1 X;  2D1H A;  5D5X B;  1R71 A;  2UXH A;  1ZYR F;  2ADU A;  5LD2 C;  1FYK A;  4WF2 A;  3E6D A;  4FT8 A;  2R7S A;  3HTU A;  4HQE A;  5E3O A;  3V7R A;  3U21 A;  5FKN A;  5C4J J;  2QA4 I;  4LFU A;  4WXH A;  2M0M A;  4XID A;  1ZH5 A;  3T8T A;  3DWL E;  4IZZ A;  1SMY F;  1MNE A;  1K4T A;  2A05 A;  4LD5 A;  3PQK A;  4MNU A;  4G7Z F;  1XDU A;  2RRE A;  3SZG A;  3CUQ A;  1LPQ A;  2YVX A;  1E3H A;  5E8G A;  1FBS A;  3KZI C;  3BR6 A;  1X3W B;  4UHT A;  1VQM I;  4QIW N;  5EYR A;  3L1P A;  3HTI A;  3A02 A;  4HDV A;  3WTZ A;  4FAS D;  5M3F J;  1J75 A;  4M9X A;  1AA7 A;  3R0J A;  1A36 A;  3JRE A;  3MCZ A;  4RDU A;  3R4K A;  2E1N A;  1OYY A;  4HZF A;  3P9T A;  5CYV A;  5H9T A;  3H9J A;  2H8R A;  2FML A;  1HSJ A;  4FHT A;  2E1C A;  1QU3 A;  2QQB A;  1N77 A;  2KDZ A;  3GVA A;  4L9V A;  5ICG A;  1OLT A;  5FLM J;  3KKD A;  3FHN A;  1BI0 A;  5AIQ A;  3TOB A;  5J1R A;  5ILS A;  2PX9 A;  4B3X A;  2LYC A;  3GLL A;  3DTK A;  2FOK A;  1TWC J;  4HX8 A;  3J7Z I;  4BBR J;  2FJ1 A;  2JA6 J;  3OS1 A;  1P7J A;  3HRU A;  5DD4 A;  3CCL I;  4II2 A;  4HBL A;  3BNI A;  3ZQG A;  4AM3 A;  4L9N A;  5CVV A;  5E1W A;  2GZW A;  2OTL I;  2Z9O A;  4F91 B;  4HF1 A;  2DTZ A;  2W25 A;  2P7C B;  1Z91 A;  4ITV A;  3CJQ B;  5LHI A;  2QOP A;  1BN5 A;  1EKE A;  4QTR A;  1HW2 A;  5LRS A;  1K4S A;  1XGS A;  2XRO A;  3FZV A;  4OIN F;  4G94 A;  2AS5 F;  3ISP A;  2JSC A;  3LFU A;  3S17 J;  3HM5 A;  2CV1 A;  4DJA A;  2JRT A;  2LF7 A;  4FE7 A;  1Z6R A;  2EFN A;  2O7T A;  2VUM J;  4EAT A;  1O7L A;  1BR4 A;  5CKT A;  3CJR B;  1TT5 B;  2K5C A;  4DZP A;  4L18 B;  2CFX A;  2X85 A;  2PJP A;  3MMY B;  1W36 C;  2CV0 A;  4Y15 A;  2KKO A;  4E7K A;  1R1T A;  2QWW A;  4NBQ A;  1FIP A;  2LY9 A;  2K02 A;  4ICH A;  4LIV A;  5K7H A;  3ZGK A;  1SFO J;  4A2U A;  1U9N A;  2ID3 A;  3DBR B;  3VPR A;  1TT0 A;  4OAZ A;  5IY5 H;  2Y48 A;  1FYL A;  1EF4 A;  1K79 A;  1SMT A;  4E7S A;  5D4R A;  3DBL B;  2IEK A;  4RGS A;  1MBE A;  3L9F A;  3OYD A;  4AIJ A;  1TQI A;  3MD2 A;  3GTL J;  3HUG A;  3KYL A;  3VTI A;  3OYM A;  1YJN I;  2M2E A;  4B3A A;  4XRM A;  3W2V A;  2WAE A;  4UDS A;  1ZTR A;  5GAG J;  4IRV A;  4NEL A;  5DCF A;  3W2A A;  3COA C;  2L4M A;  1VF9 A;  4KDP A;  2X1D A;  4V2F A;  3SHF A;  2VJJ A;  2ZJP F;  1VQN I;  9ANT A;  4D5C A;  4BDY A;  5IP7 J;  4AIK A;  3JRC A;  2DK8 A;  1W7P A;  2ZJQ F;  2ZKZ A;  4R1H A;  1UHS A;  2XAS A;  2XF7 A;  2ECC A;  1UHM A;  1LFP A;  1MBK A;  5FRN A;  3FX3 A;  3S93 A;  1UZC A;  3CDI A;  5IYD J;  5IP6 A;  2OZ6 A;  1XC5 A;  1XN7 A;  4A3M J;  3FXM A;  4HX7 A;  2P8T A;  2JQ7 A;  2GIV A;  2FEZ A;  2IA0 A;  3HOS A;  2X6X A;  2WUI A;  4DNC A;  1OCC H;  1POG A;  4LK0 F;  4CCK A;  3FM5 A;  1VQK I;  2EV5 A;  2K4J A;  4Y3O A;  3VW2 A;  2ZBK A;  4DYQ A;  2QSF X;  2XPU A;  1F36 A;  2L2O A;  3Q3S A;  1FBQ A;  5C4Y A;  5LGT A;  4RB0 A;  2JT1 A;  4IX7 A;  3SZP A;  1YI2 I;  2DFH A;  2F5D A;  3HRT A;  3RPQ A;  3JRG A;  1WKM A;  3GTG J;  1PP7 U;  1T56 A;  1UAA A;  3VOX A;  1S8N A;  4X6A J;  2Z1D A;  1BOB A;  1OFC X;  3GF2 A;  2HTJ A;  2K85 A;  2DDA A;  2OQG A;  5B66 C;  5J4Y A;  4CDG A;  1SFE A;  2VBY A;  2R0Q C;  5K58 A;  4XN3 A;  2P6S A;  2TCT A;  2ME6 A;  4XN0 A;  2LTP A;  2BE5 F;  1ZAO A;  3CLO A;  4A6D A;  3JAM Z;  3WTV C;  2EIK H;  3WU0 A;  1CF7 A;  1W7P D;  4BNC A;  2I8D A;  5JHF A;  4DZJ A;  1GVD A;  2V1U A;  3KZ9 A;  2IGN A;  1TWH J;  2WAQ N;  1P4W A;  1VQ5 I;  1J59 A;  2ZCN A;  1AU7 A;  1I3A A;  2XGC A;  3BTL A;  2DI3 A;  3N4M A;  2O9L A;  3P5J A;  5LLQ A;  3OSF A;  1V55 H;  3KP6 A;  2M5W A;  4U87 A;  1O3R A;  2QKL B;  2ZME C;  1BR1 A;  1LFB A;  1MMA A;  3IAS 2;  4LGW A;  3F0C A;  1X19 A;  1EH8 A;  3VB2 A;  2GXB A;  2ZCM A;  3LOC A;  1PJR A;  4IRG A;  4CHU A;  2NNN A;  5IT9 K;  3HSE A;  1YTY A;  4PXI A;  2DQL A;  3Q0V A;  1D5Y A;  2A6T A;  5D1R A;  2M7A A;  3UNG C;  3HTH A;  1MSE C;  3RJP A;  1A35 A;  3ANP A;  5DCM A;  3ANG A;  3BCG A;  3FMS A;  3HDD A;  3NNR A;  4KT5 C;  1IJW C;  4XKV A;  2JN6 A;  3FXJ A;  3TO9 A;  1W4M A;  2Z99 A;  2M8G X;  4CCJ A;  4JL3 A;  2VE8 A;  3J7A O;  4H0E A;  1O4X A;  1RIO H;  2QGU A;  2PBX A;  2QM3 A;  4GCV A;  4G7O F;  3Q5F A;  3F22 A;  2EK5 A;  2WV0 A;  4C3I J;  4K2E A;  5JHU A;  1WJ5 A;  2F4M B;  1RET A;  5FO5 A;  4A3E J;  2VQL A;  3TW7 A;  4AD9 A;  2KLO A;  4FX4 A;  3VDX A;  3E1S A;  3HOU J;  1S6L A;  2FE3 A;  2Y69 H;  2V1N A;  5F6F A;  2DDB A;  3EET A;  5FD6 A;  1MZB A;  2YX7 A;  5FHP A;  3LMM A;  2F5V A;  1IN4 A;  1QPM A;  1RI7 A;  2LY1 A;  5HOD A;  2QTQ A;  3QPL A;  1Y56 A;  3A4C A;  3G4S I;  3JTG A;  5D8L B;  4BBS J;  2R7F A;  4ANJ A;  1VQ9 I;  3M4O J;  4C2M A;  4LLL A;  1OJL A;  4WXC A;  1LE8 A;  1WH7 A;  2R7Z J;  3JW4 A;  3E5X A;  3RIR A;  4ENM A;  1P7I A;  3CUQ B;  2EIJ H;  2NYX A;  1JJ8 C;  4A69 C;  1UI5 A;  4CZZ A;  4BUP A;  4BHB A;  1MBF A;  4JX6 A;  4XL9 A;  1T38 A;  1VQ4 I;  3BDD A;  5FRM A;  2ZOY A;  1MJA A;  2G3B A;  3PNT A;  3VVX A;  2UZK A;  3CMY A;  4AWX B;  1YX3 A;  2DMU A;  3QYF A;  4BYY A;  4QPQ A;  5EGO A;  2HWV A;  3C07 A;  3F8F A;  2BVL A;  3I4N J;  4UXN A;  2E1M B;  2IJL A;  1S9H A;  2ZJ2 A;  3ZN0 A;  2LG4 A;  2KIS A;  1WJB A;  2O7O A;  2X0L A;  1JKR C;  2PMZ N;  1QHH D;  1X2N A;  3SQN A;  2HI3 A;  3E5U A;  1HQC A;  2FUG 2;  4RLQ A;  2HYT A;  3DF8 A;  3FRQ A;  2ZME B;  3PUB A;  5JVG F;  4GO1 A;  1IRZ A;  3J81 Z;  5TGT A;  1VTN C;  3GFL A;  4CYC A;  1W5C C;  5E3L A;  2FXA A;  5LEK A;  5HNF A;  1JE8 A;  4B47 A;  3GTJ J;  1R5G A;  1OPC A;  2LMD A;  2A5W A;  1X4P A;  2HOA A;  2R92 J;  2I5U A;  1ZRE A;  2JA5 J;  3M1C A;  1LB2 A;  4DBR A;  4XOP A;  1WRJ A;  3TED A;  1IV8 A;  3FIS A;  2DXI A;  5H20 A;  3BPV A;  2WB1 N;  2F4O B;  1ZRD A;  2WTE A;  2L4A A;  3VVZ A;  1FSE A;  2QSH X;  1ZK8 A;  2CWE A;  4OD4 A;  4MGR A;  4BJ5 C;  1AWC A;  1TC3 C;  3OYL A;  4PZJ A;  3GZN B;  5BOX A;  1BL0 A;  3H36 A;  2W24 A;  2DAO A;  1W36 D;  1YX5 A;  4G6T B;  4G8X A;  3ZRG A;  4PJM A;  3OV8 A;  1XS9 A;  2QBY B;  2IT0 A;  1XMX A;  2L54 A;  1MND A;  3OYJ A;  1IG7 A;  3F8N A;  1T0F A;  1B8I A;  1ZRC A;  2L5Q A;  1KU2 A;  3I55 I;  4ENN A;  3RPU A;  3AKZ A;  4ASN A;  2KZV A;  3LSJ A;  2HNH A;  3MFK A;  4J00 A;  5HSZ A;  2JTV A;  3FKI J;  3JCU C;  3FBI B;  4OAY A;  2XAG A;  3BPX A;  3S1R J;  3TGN A;  1W0T A;  4U7D A;  2P7V B;  1ZKG A;  2EV0 A;  1T95 A;  1R22 A;  3RDI A;  2XVC A;  1KQ8 A;  3E6C C;  3FHZ A;  4HNV A;  2ZFU A;  1ZRF A;  2OD5 A;  3DPL C;  3I0T A;  4OIP F;  4B4C A;  3A1Y A;  1MMN A;  2ZME A;  3G6E I;  1QHG A;  1W0U A;  5EF6 A;  1D8J A;  3PIO F;  1CGP A;  3OL3 A;  2ZCW A;  5GTH C;  1JGS A;  2F07 A;  2XAU A;  1GLN A;  4HLX A;  4NC7 A;  1DQU A;  2EJR A;  2R3S A;  4S0H B;  4IKF A;  5HVQ C;  2O61 A;  4W97 A;  3L2W A;  1XGM A;  2UUZ A;  1JKQ C;  4XLA A;  1F9N A;  3E6B A;  5LBQ A;  4RAG A;  2R7Q A;  5CQE A;  2HVS A;  2DT6 A;  2R7O A;  5FKO A; 
#chains in the Genus database with same CATH homology
 2DMQ A;  2W48 A;  1VI0 A;  1DU6 A;  1ETX A;  4DYR A;  1U78 A;  1X58 A;  4JKZ A;  4JP0 A;  2M34 A;  4A3I J;  2MG4 A;  5JLW A;  4ME9 A;  2NS7 A;  2QIB A;  3A01 A;  1ZGW A;  4MIM A;  4BY1 J;  3BR3 A;  1GV2 A;  2V57 A;  5F08 A;  1I3Q J;  4AC0 A;  3VUQ A;  2VI6 A;  2JMW A;  4JNN A;  2VPR A;  3CWR A;  2HOS A;  4GFL A;  1B72 A;  1QVU A;  3BHQ A;  1AKH B;  2Y30 A;  3BR2 A;  3ZQF A;  4UUT A;  4D7M A;  3PM1 A;  5JLX A;  1GV5 A;  2G7G A;  5J1U A;  2NX4 A;  1JGG A;  2DA5 A;  2XPW A;  3S14 J;  3NRG A;  1BJZ A;  4GFK A;  1FIA A;  5IP9 J;  3SJM A;  2H1K A;  2FBQ A;  4FE4 A;  3M3Y J;  5F1J A;  3S2D J;  2UXI A;  3LSG A;  1MBG A;  3A03 A;  2HOT A;  2DMP A;  5F0F A;  4HKU A;  3JRI A;  2UXH A;  4M3G A;  2R5Y B;  3QBM A;  1I50 J;  1JUP A;  5E3O A;  2LR8 A;  2XSD C;  1PUF A;  5FKN A;  5C4J J;  4W1U A;  3HOZ J;  4XID A;  3NAR A;  1K83 J;  3HGY A;  3S1N J;  2REK A;  1E3O C;  2L9R A;  2CQX A;  2WV1 A;  2FD5 A;  2Y31 A;  5FKM A;  2NVT J;  2ZOZ A;  2LD5 A;  2XDN A;  3ON4 A;  2G0E A;  1FEX A;  4KWA A;  3BQY A;  2E1O A;  5M5X J;  3BR6 A;  3JRA A;  3BRU A;  2HKU A;  5CXI A;  4QIW N;  3GBG A;  5EYR A;  5E3M A;  3L1P A;  3HTI A;  5K7Z A;  3A02 A;  2NP3 A;  4M3B A;  3TW6 A;  5M3F J;  3ZQC A;  2ME0 A;  2XGE A;  4MLO A;  3JRE A;  5FGL A;  4RDU A;  3G1L A;  4AC6 A;  3P9T A;  5H9T A;  1QPI A;  2GLO A;  3CDL A;  4GFB A;  1MH3 A;  2H8R A;  4GCL A;  3HOV J;  3GZI A;  3T6N A;  4EEF G;  2DA3 A;  2ID6 A;  2KDZ A;  3RZD J;  3W6V A;  3S1Q J;  3KKC A;  3HEF A;  5FLM J;  3HE0 A;  3KKD A;  2EBI A;  3O60 A;  2DG7 A;  2EZH A;  2NOG A;  2Y9Y A;  5FMP A;  3D1N I;  5J1R A;  1WI3 A;  2NVQ J;  1JUS A;  4FCY A;  1BW5 A;  1TWC J;  4G12 A;  5GPC A;  3PO3 J;  3K7A J;  4BBR J;  2FJ1 A;  2XB5 A;  2JA6 J;  3E7Q A;  1JUM A;  3Q0U A;  3ZQL A;  3S5R A;  1P7J A;  4JYK A;  3G56 A;  2AO9 A;  3BG3 A;  3O8G A;  1JT6 A;  3ZQG A;  3BNI A;  2OI8 A;  5CW8 A;  4GCT A;  2DA1 A;  1A6I A;  2DTZ A;  2Y0S N;  3RH2 A;  3ZQI A;  3PPB A;  3VOK A;  3S2H J;  2QOP A;  4QTR A;  2CUF A;  2JA7 J;  1IC8 A;  3BT9 A;  3IV5 A;  5EG0 A;  4X1E A;  5GPA A;  2GFN A;  3H3V K;  2E2H J;  4UUS A;  3RKQ A;  3DCF A;  1Z77 A;  2K9S A;  3S17 J;  3HM5 A;  5IOZ A;  3SDG A;  3IUV A;  2M0C A;  3O8H A;  2QWT A;  3IH2 A;  4FE7 A;  1CQT A;  5M3M J;  2X6O A;  5BNG A;  1ZR2 A;  2O7T A;  2VUM J;  1X2M A;  2OPT A;  5F27 A;  3TP0 A;  2EQR A;  1ETQ A;  1MH4 A;  1UG2 A;  4DZP A;  1MSF C;  4A3K J;  2QF7 A;  2LLK A;  4IHW A;  3DPJ A;  1JJ6 C;  2RHA A;  1FIP A;  2LY9 A;  2Q24 A;  5D19 A;  4BKX A;  3E7L A;  4ICH A;  5K7H A;  2IU5 A;  2CRG A;  1SFO J;  4L62 A;  1ETO A;  1LFU P;  1U9N A;  2ID3 A;  3VPR A;  1EF4 A;  2FX0 A;  1BA5 A;  2IEK A;  1H89 C;  1MBE A;  5GP9 A;  5C4X J;  3GTL J;  2DA4 A;  2NS8 A;  2LKX A;  3BR0 A;  2I10 A;  2M2E A;  4B3A A;  4XRM A;  1ORK A;  4NDL A;  3JRD A;  4UDS A;  1ZTR A;  2HXO A;  2NVY J;  1VFC A;  4NEL A;  2LK2 A;  2DA2 A;  3HKZ N;  4IHY A;  1VF9 A;  2EZL A;  4V2F A;  3BTJ A;  2R5Z A;  4I76 A;  9ANT A;  1Y1V J;  4D5C A;  5F0H A;  5IP7 J;  4MXM A;  3JRC A;  1NK3 P;  1ZR4 A;  1ZQ3 P;  3V6G A;  2L7F P;  1UHS A;  3NXC A;  1WGX A;  2ECC A;  1MBK A;  5EZG A;  3HOX J;  1JT0 A;  3GEU A;  5AQC A;  2JK3 A;  3BTC A;  4XRS A;  3JRB A;  5D18 A;  4GCK A;  3LNQ A;  3CJD A;  1OCP A;  3OOU A;  5IYD J;  5IP6 A;  2QCO A;  1XC5 A;  4M3E A;  4A3M J;  4C3J J;  3OSG A;  2HQ5 A;  5C44 J;  4ABZ A;  4A3L J;  4AF5 A;  2GUH A;  3Q0W A;  1ETW A;  2WUI A;  4AUX A;  2WGB A;  4Y52 J;  2E19 A;  1POG A;  2Y2Z A;  3HTJ A;  3MVP A;  1HOM A;  2DA6 A;  3EGQ A;  5EZH A;  3VW2 A;  2K9Q A;  5FKK A;  4DYQ A;  4A3C J;  2RAE A;  2XGD A;  2XPU A;  1F36 A;  2MGQ A;  2R5Z B;  3F1B A;  1ITY A;  3Q3S A;  5C4Y A;  2GBY A;  3BTI A;  2ELK A;  3B6C A;  5EG0 B;  1B72 B;  4M3F A;  3BR1 A;  2IBD A;  2XB0 X;  3VVY A;  2DMN A;  2P81 A;  3JRG A;  1IV6 A;  3GTG J;  1T56 A;  3VOX A;  2R93 J;  4X6A J;  4M3D A;  2O8K A;  3I4M J;  1WCM J;  1OFC X;  2B63 J;  3KNW A;  4L5E A;  1APL C;  3LSP A;  1G2H A;  2D6Y A;  5J3L A;  2R0Q C;  4J19 A;  5K58 A;  1H8A C;  1Y1W J;  2TCT A;  2ME6 A;  2LTP A;  1QRY A;  1H88 C;  2QKO A;  5IPA A;  3PAS A;  2DN0 A;  2YU9 J;  4DZJ A;  1GVD A;  5EEA A;  3KZ9 A;  2GM4 A;  1TWH J;  2EH3 A;  5EDN A;  1IDY A;  2VKV A;  2WAQ N;  2NP5 A;  2ECB A;  3GTK J;  4LOC A;  2ZCN A;  1AU7 A;  4RBO A;  2XGC A;  3BTL A;  2O9L A;  3G7R A;  1RES A;  4XIC A;  2MSY A;  2ZB9 A;  5F04 A;  4BY7 J;  5DAJ A;  3OSF A;  2EZI A;  3SFI A;  1HCR A;  3VW0 A;  3AQS A;  3FK6 A;  5FJ8 J;  4UUS B;  2UXP A;  1LFB A;  3F0C A;  2ZCM A;  3K2A A;  3HB9 A;  3OIO A;  3LOC A;  2VKE A;  5E3N A;  2NVX J;  2RAS A;  2OF7 A;  3Q0V A;  5C3E J;  3LSR A;  4PXI A;  2JWT A;  1JKP C;  1D5Y A;  2XRL A;  2HYJ A;  5D1R A;  3HTH A;  1MSE C;  4C2M J;  3ANP A;  3ANG A;  1FTT A;  1JTX A;  3BCG A;  1HDP A;  2KT0 A;  1IGN A;  1MNM C;  3AQT A;  4JX4 A;  3HDD A;  1VND A;  4AYB N;  1IJW C;  2D5V A;  3NNR A;  2K40 A;  1NK2 P;  3B81 A;  2TRT A;  3G1O A;  2JN6 A;  4JL3 A;  5IYB J;  2M8G X;  3S1M J;  1JKO C;  2OER A;  1B8I B;  1O4X A;  3B6A A;  3G1M A;  2E2J J;  4A3J J;  3GTQ J;  2PBX A;  3ON2 A;  1GT0 C;  3IH3 A;  4C3I J;  2GEN A;  5EFY A;  4BXX J;  3PO2 J;  1HDD C;  1RET A;  4A3E J;  3TW7 A;  1PUF B;  1ENH A;  1WPK A;  5IYC J;  1RKT A;  3QKX A;  3HGG A;  3HOU J;  3HBL A;  1IDZ A;  2DMT A;  4ACI A;  5FHP A;  3HTA A;  5FKL A;  1AHD P;  1BW6 A;  3MN2 A;  3BG5 A;  2ZCX A;  5HOD A;  2QTQ A;  3QPL A;  3LJL A;  2YVE A;  1Q1V A;  4MO7 A;  3NI7 A;  2UXU A;  4A3G J;  4IHX A;  4BBS J;  4IEJ A;  3DEW A;  3JR9 A;  4FTH A;  1RKW A;  3M4O J;  1MBH A;  2HXI A;  4A3D J;  1OJL A;  1AKH A;  1LE8 A;  1WH7 A;  2R7Z J;  2PZ9 A;  1SAN A;  4I6Z A;  4CGR A;  2L0K A;  4CYC B;  1P7I A;  2Y9Z A;  1WH5 A;  1GDT A;  4A93 J;  1JJ8 C;  4A69 C;  3BR5 A;  3RZO J;  1UI5 A;  1DU0 A;  1K61 A;  1MBF A;  4JX6 A;  1A5J A;  1GUU A;  1I6H J;  4IHV A;  3VP5 A;  2M9H A;  1UMQ A;  3ZQH A;  2ZOY A;  2G3B A;  3VVX A;  3QPS A;  3S16 J;  3CMY A;  2AHQ A;  2K9N A;  2R5Y A;  2CQQ A;  2LP0 A;  2DMU A;  3RQI A;  5EGO A;  3NAU A;  5J1Y A;  3C07 A;  3I4N J;  1ETV A;  1F43 A;  1HF0 A;  2O7O A;  1JKR C;  2PMZ N;  2JA8 J;  1X2N A;  1IUF A;  3BQZ A;  2MW8 A;  4XK4 A;  5HAW A;  2HI3 A;  2N8G A;  1MBJ A;  3H0G J;  2HYT A;  3FRQ A;  3NPI A;  4MK6 A;  4XRS G;  3GTP J;  1IRZ A;  3JSJ A;  1SGM A;  4CYC A;  5E3L A;  4FIS A;  1QVT A;  3GTJ J;  3GTO J;  3A01 B;  2HOA A;  1LE8 B;  5DS9 A;  1HLV A;  1YRN A;  2R92 J;  1ETK A;  2YVH A;  2JA5 J;  3MKL A;  2COB A;  1RR7 A;  3TED A;  5FLV A;  3FIS A;  3JRF A;  3HOW J;  1OCT C;  1R9T J;  2WB1 N;  4DW6 A;  4DYC A;  1U9O A;  3VVZ A;  3IH4 A;  4JX5 A;  3HIM A;  2LFB A;  4C3H J;  4MFE A;  1ZK8 A;  5EGO B;  1TWG J;  3CQZ J;  5M5Y J;  1TC3 C;  5CXG A;  5M5W J;  2LVS A;  1Z0X A;  1BL0 A;  3V78 A;  3BJB A;  3HOY J;  3CRJ A;  4QSH A;  3UKG A;  2X48 A;  1XS9 A;  1S7E A;  2G7S A;  1TWA J;  3CCY A;  3VIB A;  1RPW A;  1IG7 A;  3JRH A;  1B8I A;  4V2G A;  1XG1 A;  5IOY A;  5F0C A;  3LSJ A;  4D7N A;  5HSZ A;  3EUP A;  3FKI J;  2DJN A;  3TP3 A;  1ETY A;  3WHC A;  2CUE A;  1T33 A;  2XPV A;  3S1R J;  1W0T A;  1YRN B;  2G7L A;  1ZKG A;  2YS9 A;  2UXO A;  4B1R A;  3BG9 A;  4D5F A;  3MNL A;  3C2B A;  3RD3 A;  2L7Z A;  2L7M P;  4M6V A;  3LHQ A;  4HNV A;  4YZE A;  1FTZ A;  3FIW A;  2FQ4 A;  1FJL A;  4B4C A;  2EZK A;  3VW1 A;  2W53 A;  3LWJ A;  3GTM J;  2CJJ A;  1NTC A;  1W0U A;  5EF6 A;  4NN1 A;  3FK7 A;  3QQA A;  1TWF J;  5HBU A;  2E2I J;  5K7F A;  2CU7 A;  4MFD A;  2F07 A;  3WHB A;  2HDD A;  4A3F J;  3S15 J;  3COL A;  3ZOB A;  4S0H B;  2DG8 A;  2YUS A;  4W97 A;  5DTD A;  1U8B A;  1JTY A;  4Y7N J;  2JJ7 A;  1JKQ C;  4A3B J;  2IAI A;  2X9D A;  2DA7 A;  1UI6 A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...