3BQZA

Crystal structure of the complex of malachite green bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 77
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bqzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bqzA02
3BR2A 1MSFC 2MW8A 3HGGA 4XIDA 3O60A 3OOUA 4A3MJ 2E2IJ 3VVZA 1DU6A 2R5YA 1E3OC 2FQ4A 1RPWA 2REKA 2E2JJ 3QPLA 1Q1VA 3S15J 2CRGA 1A6IA 2R0QC 2QKOA 1MBHA 1AKHA 3GEUA 2ZCNA 3BRUA 1S7EA 2HI3A 2W53A 1IJWC 2AHQA 5J3LA 1HCRA 4A3BJ 1VF9A 2ID6A 3O8HA 5DS9A 3G1MA 1HDDC 4L62A 2XPWA 2WB1N 2DA6A 3BR0A 1U9NA 2ME0A 4GFLA 1ETWA 5FLMJ 5CXGA 3DEWA 2IBDA 2VKEA 3JRAA 2NVQJ 2DA7A 4JX6A 3E7LA 5EDNA 1AKHB 1A5JA 3JRBA 3CDLA 3AQSA 3F0CA 4G12A 3A01A 3S5RA 2XPUA 2M9HA 1MBFA 5GPAA 1MBEA 4FE4A 3TP3A 3ZQHA 2WAQN 2DMTA 4M3EA 1DU0A 2EZIA 4DZPA 2HXIA 1WH5A 3Q0UA 1JKPC 5HODA 3JRHA 2PMZN 2D6YA 3WHBA 1K61A 2LTPA 3NI7A 4JNNA 3LSGA 3PPBA 5EG0B 3JRDA 2HXOA 4JX4A 4M3GA 1X58A 4EEFG 3GTOJ 3PO2J 1RETA 1W0TA 2V57A 1U8BA 4C2MJ 1GV2A 3Q3SA 2ZCMA 4UUSA 4GCTA 3BNIA 4W1UA 5HBUA 2LP0A 3S16J 4B4CA 2NP5A 2ZCXA 3Q0WA 2NS8A 3ZQGA 3LWJA 1XG1A 2K9QA 2VI6A 1ETKA 2NS7A 3AQTA 2XPVA 3VW1A 2D5VA 5HAWA 1JJ8C 4UDSA 1ZR4A 3S1MJ 2JA7J 1F43A 1U9OA 4JX5A 3G1OA 3MKLA 1ZTRA 3PO3J 4BKXA 1JKQC 1B72A 2TCTA 2IU5A 3LOCA 2GBYA 1ETQA 3MVPA 5E3OA 4ICHA 2DN0A 2XGCA 1GT0C 3KKDA 5M3FJ 1B8IB 1T56A 2X9DA 2GENA 2IEKA 2MGQA 2HDDA 2OF7A 3JR9A 4BBRJ 1QVUA 3QKXA 3NAUA 3T6NA 3M3YJ 2DMQA 2R5ZA 4JL3A 2NVYJ 1RR7A 1IC8A 2G3BA 3MN2A 2I10A 3HDDA 5FKNA 2VKVA 3LNQA 3VIBA 3HTJA 2HOTA 2HYJA 3G56A 3SJMA 2O7TA 1TWGJ 4A69C 5FMPA 1JT6A 3I4NJ 2Y0SN 5IOZA 3JRCA 3IV5A 3ZQFA 3G7RA 4FISA 2ELKA 4A93J 3BQZA 2JWTA 1GV5A 5FKLA 1LE8B 1POGA 3NXCA 2LLKA 3RZOJ 2NVTJ 3RH2A 5FKMA 4CYCB 2GFNA 4V2GA 3TW6A 2M34A 2QWTA 4MFDA 4AYBN 3BR3A 2FBQA 1XS9A 4W97A 5JLWA 4IHWA 2G7LA 3ANGA 3BQYA 4MFEA 2JN6A 2Y30A 3CQZJ 3PASA 4GFBA 3VW0A 5EZGA 1H88C 1JGGA 4I76A 1WCMJ 1IDYA 1K83J 2EZKA 1ETOA 2XGDA 5IP7J 2Q24A 1NK3P 2B63J 1UI5A 1VFCA 5IOYA 3HKZN 2CQXA 2DA2A 3RZDJ 3NNRA 2YVEA 3GTPJ 1B72B 2DG8A 2F07A 3GTGJ 1TWAJ 4DZJA 1UG2A 5F08A 4DW6A 2Y31A 3QPSA 1B8IA 4GCKA 3O8GA 5FJ8J 2E2HJ 3VOXA 1Z0XA 3HB9A 1ZR2A 5F27A 4IHXA 4NDLA 3H3VK 2R93J 5EF6A 5DAJA 1ENHA 3ZOBA 1PUFB 1Y1VJ 4M3DA 2EQRA 3A01B 5F0HA 3VP5A 4QTRA 1H89C 4KWAA 3RQIA 1IGNA 1RESA 3HGYA 4JYKA 1ZQ3P 3HOWJ 4LOCA 5C3EJ 3B6CA 2UXPA 5GP9A 5CW8A 3VW2A 1QVTA 2VUMJ 2KT0A 5J1YA 1Z77A 5F0FA 5E3MA 4XICA 1TWHJ 2XSDC 3BHQA 4D7NA 5AQCA 1AU7A 3GTKJ 3IH4A 1VI0A 2XDNA 4CGRA 4IEJA 3HM5A 2O9LA 1BA5A 2ZOYA 2NVXJ 2G7SA 4HNVA 1O4XA 1FIAA 3FK7A 1APLC 2OI8A 1ETXA 1JUMA 1ZGWA 2OERA 2NX4A 3BTLA 5EG0A 4D5FA 1YRNB 3GTJJ 4D5CA 2FD5A 1JKOC 1IV6A 1ZKGA 1JKRC 1ETVA 4ME9A 3HIMA 3S1RJ 1GDTA 2M0CA 4JP0A 2AO9A 1T33A 1JTYA 3SDGA 3IH2A 3TW7A 3LSPA 4PXIA 4QIWN 2K9NA 1R9TJ 1ITYA 5D18A 3BG3A 4A3FJ 3F1BA 3S1QJ 2QF7A 2LKXA 1FEXA 3VVYA 3RKQA 4XK4A 3Q0VA 3A02A 1QRYA 2R7ZJ 3S1NJ 2O7OA 2LK2A 4IHVA 4AUXA 2UXOA 2JJ7A 4A3EJ 4D7MA 2NOGA 3BCGA 3A03A 2CUFA 1QPIA 3W6VA 2IAIA 3JREA 3HTAA 1X2MA 1G2HA 4GFKA 3MNLA 1WH7A 1EF4A 1MH3A 1X2NA 4FTHA 2DTZA 3S14J 3E7QA 1RKTA 3V6GA 2FJ1A 2Y2ZA 2EH3A 1ZK8A 1OFCX 4BY7J 2R92J 4C3JJ 2QTQA 2QIBA 1F36A 2K40A 4ABZA 2DA3A 1YRNA 3HEFA 1OJLA 2DA5A 5M5YJ 2GLOA 5GPCA 1UI6A 1H8AC 1WI3A 1BW6A 2DMPA 3JRGA 1UMQA 4XRSA 2KDZA 4A3JJ 3C07A 3FRQA 4MK6A 1RKWA 3FIWA 1BJZA 5K7FA 3HOYJ 2YS9A 3IH3A 2X6OA 1AHDP 2LY9A 1OCTC 1WGXA 4MXMA 1SFOJ 3TEDA 2EBIA 5IP6A 3LSRA 1GVDA 3VPRA 3JRFA 2WGBA 2YU9J 3KZ9A 3QBMA 3HOXJ 3ZQLA 2XB0X 2QCOA 5EYRA 3NRGA 3S2HJ 3SFIA 2R5ZB 4I6ZA 3P9TA 3B6AA 4CYCA 3L1PA 2CQQA 3VUQA 3BTCA 2YUSA 2LD5A 4FCYA 5FKOA 5K7HA 3GTMJ 3NPIA 5FKKA 2G0EA 2HQ5A 2JA5J 2UXUA 5C4YA 4FE7A 3EUPA 1D5YA 2L9RA 4V2FA 1IUFA 5DTDA 3D1NI 2FX0A 3DCFA 2H1KA 5F04A 1JTXA 2H8RA 2VPRA 3HOVJ 1MNMC 4AF5A 1MBKA 4B1RA 1MH4A 4M3FA 3CCYA 1ETYA 2ME6A 2JMWA 3BT9A 5HSZA 3K2AA 5D1RA 5C4JJ 2MSYA 1TWFJ 2UXIA 4ACIA 1XC5A 1P7JA 3PM1A 1U78A 3BR5A 5IYDJ 4RDUA 3KKCA 4A3CJ 1Y1WJ 3DPJA 1BW5A 2O8KA 4A3DJ 4BBSJ 2JK3A 2M8GX 2QOPA 1HDPA 1GUUA 1MBJA 3FKIJ 2Y9ZA 5K58A 5EFYA 5IP9J 2HOSA 3ZQIA 2DMNA 3TP0A 4DYCA 1LFUP 2W48A 1NK2P 4DYRA 1HOMA 2GUHA 1JUSA 3S2DJ 2L7FP 4C3IJ 2ECBA 2OPTA 2L7MP 5JLXA 2ZB9A 2DA4A 3BG5A 1LE8A 1TC3C 5FHPA 4UUSB 1PUFA 3K7AJ 2DMUA 2PZ9A 4X6AJ 1FTZA 2LVSA 3UKGA 1I50J 1BL0A 4A3KJ 2X48A 1WPKA 5K7ZA 3C2BA 3COLA 4YZEA 3BR6A 5D19A 3ON4A 1SANA 2HOAA 4A3GJ 2WUIA 2M2EA 2XRLA 3CJDA 4BXXJ 2LR8A 4L5EA 1UHSA 3CWRA 4AC6A 2XGEA 4QSHA 2RHAA 2HKUA 3HBLA 5F1JA 5M3MJ 2DA1A 3GBGA 1HF0A 2LFBA 3JRIA 3GZIA 3ON2A 3BJBA 5FGLA 4S0HB 4A3IJ 3S17J 3JSJA 4IHYA 2Y9YA 2E19A 2P81A 2CJJA 2TRTA 3BR1A 4Y52J 1OCPA 1NTCA 3VOKA 3OIOA 2ECCA 1CQTA 4XRSG 5EEAA 4B3AA 3NARA 9ANTA 2L0KA 2JA6J 3HOZJ 3ZQCA 1IRZA 2NP3A 4RBOA 2ID3A 3IUVA 2WV1A 5E3NA 1I6HJ 2EZLA 5J1RA 5EZHA 4JKZA 5C4XJ 4MLOA 3B81A 3CMYA 4J19A 4C3HJ 3HOUJ 1JJ6C 3M4OJ 3CRJA 3HTIA 5J1UA 5BNGA 2HYTA 2ZOZA 1FJLA 4X1EA 3H0GJ 4Y7NJ 3G1LA 3EGQA 2DJNA 2R5YB 4UUTA 4HKUA 1MSEC 1JT0A 5CXIA 4MO7A 2N8GA 3FK6A 5M5WJ 2K9SA 3RD3A 3BG9A 4AC0A 3GTLJ 5H9TA 2CUEA 2PBXA 2UXHA 5EGOA 4MIMA 5IYBJ 4NN1A 4GCLA 3VVXA 2COBA 2RAEA 3I4MJ 3LHQA 3HE0A 3BTIA 1W0UA 1IG7A 5C44J 4XRMA 4M3BA 2JA8J 3BTJA 4DYQA 1FIPA 3LJLA 4NELA 5E3LA 2XB5A 2CU7A 5IPAA 2GM4A 4A3LJ 2L7ZA 3GTQJ 3HTHA 5FLVA 3V78A 3ANPA 2RASA 3QQAA 1LFBA 1FTTA 2EZHA 3WHCA 1P7IA 3OSGA 1HLVA 3FISA 4BY1J 5F0CA 1TWCJ 1ORKA 3LSJA 1MBGA 5IYCJ 2DG7A 1I3QJ 2E1OA 5M5XJ 2MG4A 4M6VA 2YVHA 3KNWA 1VNDA 5EGOB 1JUPA 3OSFA 1SGMA 2G7GA 1IDZA
chains in the Genus database with same CATH superfamily
4BDZA 3LSMA 1ZGAA 2P4WA 1YOVB 4M9XA 3SWHA 3O60A 1VQ8I 2E5ZA 4B3XA 1Y6IA 3FF5A 1DU6A 3GZ5A 2R5YA 1E3OC 1RUNA 3QPLA 1Q1VA 3GEUA 1V3FA 4BE1A 1S7EA 2IVMA 3E5XA 4U9LA 4YEJA 5J3LA 3H3UA 3HSEA 2KIMA 2ID6A 2P0WA 2Z2SB 3G1MA 4FASD 2XPWA 3W3CA 2ME0A 2LG4A 5FGMA 3SDBA 3J81Z 1X1PA 4JX6A 5J8FA 1UB9A 1TQMA 1AKHB 1SFXA 1A5JA 4G12A 3S5RA 1XCVA 2FRHA 4HRIA 3TBIA 5GPAA 4FE4A 4LLNA 1XGSA 4I99C 1DU0A 4XSZF 5H6RA 3ASNH 2LBFA 4TV7A 1NH3A 2KMUA 4NQWA 2EA2A 2A6HF 2KQRA 3H1CA 5HODA 3JRHA 1QBJA 1K4TA 3FMQA 2PI0A 1YS6A 1SMYF 4ETSA 4NHJA 1MNEA 5L3BA 4GYGA 2RREA 3NI7A 2GXBA 3LSGA 2QQ9A 4B47A 1S72I 2DFFA 4JX4A 4EEFG 3RQ4A 2V57A 4NQWB 4HV6A 4DBQA 3Q3SA 3HTSB 4HA8A 2Y75A 1S5LC 3KLNA 2PLYA 2WAFA 4I7HA 1O3TA 3Q5FA 4GCVA 2ZMEA 2XPVA 2D5VA 2HQNA 3CJQB 4UDSA 2LNBA 1ZR4A 4PSXA 5DEQA 1HW1A 2V1XA 2ZMEC 1D5VA 1F43A 2KP6A 3S93A 3JSPA 3G1OA 3MKLA 4XLCA 2VLAA 3ZMZA 2IS6A 1B72A 4L0ZB 3PQKA 2UXNA 3SXYA 3WODF 5E3OA 1ETQA 4ICHA 2ZSHB 2XGCA 1GT0C 3KKDA 3FXKA 2CQKA 4I09A 4PGHA 1JI8A 1I1GA 1ZHFA 4IRGA 2MGQA 4HNUA 3PFIA 3V8JA 3CCRI 3IAM2 2XF7A 2NRAC 2V1DA 4ENMA 3NAUA 3VYRB 2V6CA 4JL3A 1LDJA 2NVYJ 1Z6RA 2ZXJA 1RR7A 1IW7F 1P4AA 3LA2A 3TL4X 1IC8A 3BJAA 1TTYA 1SD6A 3CDIA 5BQTA 4RLQA 3HTJA 1R4NB 3QAHA 1ZN2A 3M8JA 3I59A 2ELKA 4E7SA 3P9IA 3BQZA 1J59A 1GV5A 5FKLA 4A0ZA 1BN5A 3K1NA 4GXOA 1O3RA 4XLFA 3RZOJ 4XBFA 1WJDA 5FKMA 2XF6A 1U5TB 4HX7A 5FROA 1B6AA 3DP7A 1D0YA 1R5ID 4W97A 3BQYA 2CSOA 3L09A 3LQQA 4KN7X 4P1WA 4MHGA 5DM7F 3ZCOA 5LGNA 2FJI1 1H88C 1R00A 2E1CA 3FMRA 4A0YA 4UNOA 2ZFWA 2XGDA 1D8KA 2XKPA 3QYEA 5IOYA 2HTSA 3MFKA 3L2VA 1PDNC 3CLOA 2CQXA 2DA2A 3OIQA 3GTPJ 1MMNA 4DZJA 3CO7C 2QZ8A 2QENA 3MEXA 2ZY9A 2E7WA 1OKRA 2MH2A 1B8IA 4GCKA 3F8MA 1E17A 2E2HJ 3VOXA 1Z0XA 3DBRB 3F9KA 3HB9A 3K4LA 2W1OA 3J80K 2ELHA 3F8FA 1X3ZB 4XM3A 1J2XA 4C30A 4ZYDA 3OYMA 5K5OA 3JSOA 3H3VK 1B9MA 2Q2EB 3WE3A 2WC2A 3VODA 2DT7B 2QSGX 2QVOA 1ODDA 1FPQA 2P5VA 3VP5A 4QTRA 1IGNA 1XGOA 3WGGA 2BXZA 5LHHA 1E0EA 3VW2A 2ZBKA 3DPUA 5GP9A 1LNWA 3ZP5A 4IKFA 2VUMJ 3EQLF 2LC2A 3A0HC 3LA7A 5F0FA 5E3MA 4HEA2 2DYRH 3ZGKA 3CDHA 3IH4A 2BYVE 3CC2I 4CGRA 1MJAA 1R1UA 2O9LA 3FXLA 2ISYA 2G7SA 4HNVA 3WTZA 1FIAA 1ETXA 1JUMA 4XMYA 1XMAA 3BTLA 1TW3A 1OR7C 1TZLA 1OYIA 3DLAA 4F3QA 3WGIA 1KU3A 4L9NA 5FRNA 2FD5A 1IV6A 3W2VA 1VQ9I 3S2WA 3HIMA 4JP0A 4WK8F 1JTYA 1MMGA 4AWXB 5KHDA 1ITYA 3F1BA 2LKXA 1FEXA 2XASA 2QBYA 3SQNA 2BY0A 5HNFA 3JAMZ 1QRYA 3KP5A 2OTLI 4IHVA 4RGUA 4AUXA 4D7MA 3EYYA 1HXDA 1E3HA 3BCGA 3JREA 3CCQI 2W00A 2NNYA 4FQGA 1MH3A 1RKTA 2D1VA 3V6GA 1E2XA 1S9HA 4YELA 4ENJA 2EH3A 1ZK8A 1CGPA 4AU7A 3VEPA 3WG9A 2KISA 2QTQA 2QIBA 3EDPA 1S8NA 2OQGA 3ECOA 3M1CA 4L9JA 4PSWA 3KLOA 2I8DA 3ZR8X 3LSHA 4LLGF 3D5SC 1VZ0A 3W2WA 2PMZA 3JRGA 1WVRA 4EJVA 3TGNA 4MK6A 2HYFA 1BJZA 4LJZF 2YS9A 1ACIA 1J7KA 3QODA 3IH3A 3L2UA 4O3MA 4RB1A 2JUGA 2EA4A 2JVHA 5J4VA 2DLLA 2FUG2 3V4GA 3TEDA 4WX9A 5IP6A 2O61A 3VPRA 2WGBA 3I59B 3S3MA 1N25A 3ZQLA 1LEBA 2EIKH 3ABLH 3NRGA 1QGPA 3E5QA 2H6BA 3B6AA 2CQQA 2K5CA 5A2QK 2YUSA 3LAPA 2LD5A 3GTMJ 3RPUA 1WJ5A 5B3SH 4IZZA 2G0EA 2GA2A 3B73A 3PFYA 2PQ8A 2VPLA 2HQ5A 2L7KA 3ZMSA 5LD2C 4I2OA 2AS5F 4HV5A 1R5HA 4HNTA 1D5YA 5LGUA 2L9RA 4ZYEA 3E0JB 3M8FA 4PZJA 4OWRB 2A07F 2FX0A 3DCFA 2BE5F 5F04A 2O3FA 1MNMC 3K70C 3E6DA 2PFVA 1MH4A 1JGSA 4AVZA 1ZREA 2V6EA 4RAFA 4BEHA 1IUYA 5BS6A 2JMWA 3W6JB 4PJMA 3K2AA 4E7KA 5D1RA 1N75A 1P4WA 1D1AA 3A4CA 1XC5A 1P7JA 3K8PC 2QQAA 3BR5A 3J81K 3IRQA 1K6OA 1BW5A 5IT3A 4BBSJ 1F1ZA 2M8GX 2PJRB 2OCEA 1ZH5A 1HDPA 4U7BA 2Y9ZA 1V4RA 3R61A 5IP9J 2HOSA 4UB8C 3ZQIA 1XGNA 2GUHA 2W48A 1W36D 4BXFA 2KZGA 3BC8A 4M73A 5D5WB 4HLXA 4KA4A 3S2DJ 2XGXA 3K4KA 1LE8A 1OCCH 2XRNA 2VKHA 3RKXA 3RPQA 4UUSB 2K3PA 3K7AJ 4CDGA 2VASA 5D8KB 1LB2A 2LVSA 3UKGA 3KX2A 4N0BA 1ZRFA 1BL0A 3I55I 5DUKA 4A3KJ 5K7ZA 4BE0A 3COLA 2FOKA 4EJWA 3T8RA 2M2EA 3CJDA 5KAIC 4BXXJ 2LR8A 2OBPA 4AC6A 3OOPA 3OV8A 2IXSA 3FXOA 5JVGF 1UELB 3ZN1A 1MMAA 3HBLA 3VYTB 4CCLA 2E5NA 3CUOA 2D45A 4XR6A 1HF0A 1OCZH 3JRIA 2VJ4A 3C3WA 3ON2A 4P55A 4A3IJ 4HYEA 1KONA 2OUMA 2V9KA 2TRTA 3GYHX 2HWVA 1DUXC 4Y52J 1O7LA 3EUHC 1OYWA 3W6KB 2F5VA 3VOKA 4Q47A 1V5FA 2W4SA 1MJBA 3GZIA 4HSTA 5H20A 4WXCA 4LITA 1SFEA 1XCBA 4RBOA 4KIGA 4Z6YA 1Y0NA 1I6HJ 5B5EC 3WTXC 2EWNA 5C4XJ 3KYCB 4MLOA 4ZZLA 2IA2A 4XKWA 5GAGJ 3HTIA 3CRJA 2HKXA 2LY2A 2V9VA 5J1UA 5BNGA 1W7PB 2MH9A 2ZOZA 4NUBA 1GXQA 5BPIA 2W25A 2KIUA 2VOPA 3GUDA 4GYIA 2R5YB 4UUTA 2YSRA 4HKUA 5CVRA 4C2MA 2KPMA 2JVGA 5CXIA 2N8GA 4EM2A 3BCBA 2BBYA 4LGWA 1W5TA 2GWRA 2K9SA 4AC0A 5FD6A 5CVJA 3DTIA 5H9TA 2PBXA 2DCEA 3BG7A 4E4HA 4MIMA 1W36C 2OZUA 2LOOA 3M9AA 3L9FA 4CCOA 3VVXA 3EUHA 4IX7A 3T0YA 4ZH4F 2RAEA 4UHTA 5HS9A 4ZDOA 2HDWA 3BTIA 2FMYA 1D0ZA 3NQOA 2HU9A 2ZJPF 2XSJC 4DYQA 2BVLA 3PNTA 4IQJA 2L4AA 3LJLA 5E3LA 1TNSA 2XB5A 3DFGA 3GMEA 4G7ZF 4Y3OA 2L7ZA 3H35A 4MEYF 2DI3A 2VJJA 2V26A 3QQAA 4G9YA 2VT3A 3WHCA 1X1CA 4RAGA 4YFNF 1P7IA 2VQCA 1HLVA 4A0XA 5KCMA 3RYPA 3BZ6A 2IA0A 1MBGA 2KJCA 5IYCJ 1U5TA 3CCJI 1UCRA 4KISA 1E3PA 3KNWA 1BI3A 4F91B 1ZGJA 1O7FA 5EGOB 5EEGA 1SGMA 2E1MB 3BR2A 3RDIA 3C2GA 2YVXA 4HZFA 2MW8A 4ZTJA 2C6YA 2VC1A 1PVEA 3HGGA 3TO9A 4ITVA 4BGDA 1FBSA 2P6SA 2KRFA 4KITB 3SZGA 2CV2A 4ZYGA 1A6IA 2QKOA 2M4KA 1AKHA 2L9VA 4CHUA 5HLHA 4UVBA 3RIRA 2HI3A 3WE2A 5D5XB 1IJWC 2W53A 3E6BA 2IJLA 5CJ9A 3Q9VA 1VF9A 3QWLA 4IOCF 3O8HA 4ZTFA 1HDDC 4OIRF 4CGZA 1I3AA 2WB1N 4XKVA 2DA6A 3BR0A 1HC8A 2RGVA 4WCGA 2X1EA 3JRAA 3Q9SA 2ZC2A 2NVQJ 2DA7A 2EV0A 1MDMA 1Y8RB 3K6GA 3E7LA 3HJEA 4II3A 4KUMA 5ICEA 5EDNA 3OYJA 3JRBA 3CDLA 4IRIA 4PJNA 2QWWA 4NB5A 3E6CC 4OINF 4A5MA 4U0WA 4AM3A 1MBEA 2XIGA 3ZQHA 1QNTA 2WAQN 1YS7A 1P92A 4HBLA 3N97A 2EZIA 4DZPA 4LIUA 3F23A 1I27A 3QYFA 3HRMA 1FLIA 1V55H 3OYKA 1O3SA 3SYTA 1WH5A 3Q0UA 3L00A 3EUKL 1JKPC 1R1VA 4LG3A 2D6YA 3WHBA 2BXYA 3DF8A 4B09A 3PL8A 3HHHA 5EG0B 3OL4A 3PO2J 1X58A 4MTDA 2K02A 3GWZA 2A6TA 2XKOA 3HHGA 3GZNB 3CJTB 3R60A 2KRCA 4NC8A 1U6GA 1MGTA 3BOQA 4FX0A 1UJ8A 2ZCMA 3RKYA 4W1UA 3SEZA 3ASOH 3S16J 2HGCA 3R0AA 2K9LA 2NP5A 2K9QA 3FKJA 1ETKA 2NS7A 4BL0B 2IPQX 3K0LA 2DT6A 2DFEA 2WA0A 2JA7J 1ZRCA 3OYHA 2B7EA 1HW5A 3OS1A 1Z1DA 3PO3J 1T95A 1TBXA 3SZPA 2TCTA 4F7ZA 1G3WA 3FXJA 3LOCA 1IZ1A 3ML6A 4UXNA 2L4MA 3RSNA 2J5OA 4BHCA 3CCEI 5J47A 3CCMI 1FYKA 5JR3A 2CQ7A 4HW0A 5K5RA 3FX3A 4DOZA 2OF7A 4BE2A 3FZVA 3SEQA 3T6NA 1Y56A 3A1YA 3V42A 3OYEA 1MNDA 2R5ZA 3PJRA 1D1CA 2RQQA 4FX4A 4O5VA 3CF5F 4IXAA 2KIQA 2Q1ZB 5FKNA 3LNQA 2Z3YA 1KA8A 2HOTA 3I4PA 3G56A 4BEHB 4I0BA 3SJMA 1TWGJ 2XAQA 3MQ0A 3I4NJ 5IOZA 2CFOA 3K1PA 2EV5A 3ZQFA 3BP8A 2CGPA 3G7RA 5F64A 1BOBA 2JWTA 1LE8B 2X0LA 5DD8A 1POGA 5KVRA 2JPCA 4M9ZA 1ZG3A 4BQOA 3RH2A 1UFMA 3TW6A 2M34A 2QWTA 5LRSA 2OCCH 2G7LA 3ANGA 2Y30A 3PASA 4CA0A 4KMFA 3IRRA 1TP4A 4ZJZA 1WCMJ 1IDYA 1VQMI 2EZKA 3V8KA 4AYBA 2BOLA 3PSIA 2NS0A 5BPDA 3HKZN 4PCQA 4U9NA 3HPHA 2ELJA 3FWEA 2YVEA 3NNRA 1YTYA 3ZXSA 2UV1A 3CUQB 5JHFA 1IN6A 3VFZA 4DW6A 2FU4A 1OQYA 3OYIA 2HKOA 1U2WA 3F8BA 3VB2A 1X3UA 3N05A 4RS8A 3JAMK 1OLTA 4HG2A 2L54A 1ZR2A 5F27A 2XROA 2A68F 2CG4A 3VWBA 3D0SA 1HKSA 3SFZA 3BPXA 3DV8A 4EATA 2LYCA 4C9YA 2ESNA 5LEJA 2R93J 5DYMA 1ENHA 2VJIA 1PUFB 3FXUA 4M3DA 1T08B 4LK1F 5AIQA 2EQRA 4UVCA 3EETA 1ON2A 5LFAA 5LHIA 2QEXI 2DQLA 4KWAA 1G4DA 2V9PA 1RESA 1UG0A 4LOCA 4P96A 5C3EJ 2UXPA 3NWTA 1L3LA 2KT0A 4OMZA 5J1YA 4BACA 1G6NA 4XICA 2XSDC 3BHQA 5AQCA 2EPFA 1R36A 3LFKA 4XNFA 1MMSA 1AU7A 3GTKJ 2QUFA 1S6LA 1H9TA 1VI0A 2GA1A 1BOAA 1JXSA 4C2UA 2RNJA 5D6FA 2ZOYA 4XOPA 1O4XA 2OI8A 2A6EF 3VSLA 2OERA 5EG0A 3RTRA 4D5FA 2UWMA 1BI0A 4KDPA 3VTIA 3HSRA 3AL0B 1FWZA 3HUGB 4BXUA 4ME9A 2JUCA 1ETVA 3J7YJ 3IWZA 2QYOA 2VT2A 4IHSA 4MQVA 1F4KA 5F6FA 5HDKA 3LSPA 5JFRA 4XOTA 3TW7A 1J09A 5A2QZ 4PXIA 5D18A 3AKZA 2XC7A 2O03A 1WJBA 2QF7A 2R7FA 2P5KA 1B4AA 5H2FC 2LK2A 1ZYRF 2JJ7A 4ZDPA 2NOGA 5H6QA 1C0WA 2CUFA 3PUFA 4GGGA 2IAIA 3K4CA 4YFXF 4A2UA 3BWGA 1WH7A 1WJAA 3OS0A 3E7QA 2DTZA 2XF5A 4EM0B 2Y2ZA 4BY7J 2R92J 2HVQA 3IHUA 2K40A 2L9SA 3DXJF 4IPAA 4ABZA 4NNJA 3RI4A 3TDUC 3LAJA 1YRNA 2FEZA 3BY6A 2DA5A 1UHMA 5M5YJ 2Y48A 3KEQA 2GLOA 5D5UB 3WTTC 1WI3A 2DMPA 1X4OA 4XRSA 3RPUD 2DW4A 3DKXA 1RKWA 3FIWA 5K7FA 2WY7Q 2CWEA 2P6TA 3KYLA 2X6OA 1OCTC 2QSFX 1SFOJ 4ZYHA 2RN7A 3P9CA 1VQLI 1VQ5I 3JRFA 3PNYA 5B1BH 3CC4I 2X85A 3E1SA 2QCOA 1KYZA 3HRUA 1OISA 2R5ZB 1G8XA 2QGUA 3P9TA 4CYCA 2WB1A 3L1PA 1P9QC 4D0PA 3BTCA 2QA4I 2HYGD 5FLXZ 5FKKA 1ZG1A 5LLQA 4LG0A 1FP2A 1SVLA 4XONA 1YYVA 4CICA 5C4YA 3EUPA 1MMDA 3PNVA 4V2FA 2X1DA 4EJUA 3D1NI 2CV1A 2H94A 4IQ4A 4KFCA 2E7XA 4QPOA 2H8RA 4OOIA 4YRVA 1MDMB 4HDVA 4M3FA 1IV8A 2ESHA 1ETYA 2DPUA 1W5SA 3BT9A 1Z91A 3MCZA 3F8CA 5DUIA 3FBNB 2UXIA 2L9NA 4CH7A 4P9UA 2OC6A 4RAYA 3PM1A 3A0BC 4CZCA 1T0FC 3HC7A 1PJRA 2OZ6A 3TO7A 2EV6A 4NBQA 1U78A 1MIJA 4RDUA 4A3CJ 3DPJA 2O8KA 2LY1A 3ZMDA 3MKYB 2JK3A 3G3ZA 2QOPA 4P9FA 3W2AA 1ONVA 5K58A 3U1DA 1R6RA 3OYDA 4U88A 3UNGC 2DMNA 1NK2P 2Z33A 4DYRA 3I3LA 1HOMA 1JUSA 2L7FP 4RGRA 4C3IJ 1V5EA 1FYLA 2MD5A 2ZB9A 2DA4A 3BCAA 1W5CC 2ZJRF 5TGTA 3G4SI 4BJTA 3CLQA 2DMUA 1PUFA 2PZ9A 2M3AA 4M71A 1YI2I 4JOMA 4MGRA 2X48A 1WPKA 3DPLC 2M1BA 4WXDA 5AIPA 1FMVA 3ZRGA 3BPVA 2XRLA 2MC4A 4CCMA 3HZJA 1MZBA 1U0JA 4L5EA 1UHSA 5ILSA 3OYNA 3CWRA 2A5YB 1BJAA 2X1CA 3WG7H 3TOBA 1Z21A 3T5XA 1RNLA 3MZHA 1Z05A 4G6TB 4HSRA 4HF1A 4WF2A 3S17J 1XSXA 2P81A 2FNPA 4BDYA 3WTYC 3GEZA 2ECCA 2X6WA 3HUGA 1CQTA 2VN2A 2FBKA 3GLXA 3CMMA 5EEAA 3K2ZA 2NP3A 3ZQCA 3QP5A 1WZ2A 2FBHA 2ID3A 2J5PA 2WV1A 3OY9A 2F4IA 4U7DA 3B81A 3CMYA 2Q0OA 1PP7U 3GCMA 3RKWA 1ZAOA 3EUAA 2A61A 2X6YA 3F6VA 4WXHA 2HYTA 5EEHA 1FJLA 2OJED 2STWA 1QHHD 4HPQA 4F55A 1JT0A 5DV5A 3FK6A 5M5WJ 3ISPA 4M72A 3BZKA 1X1DA 5FD5A 5EGOA 1FT9A 4NN1A 3HTUA 3FXQA 4DVYP 2QLZA 3R4KA 3FXRA 3KE2A 4CCKA 3CCUI 2X51A 2M5WA 2YPRA 4M3BA 2JA8J 2PMUA 2AXLA 2RQPA 2CMPA 2F48A 2FE3A 1FIPA 4NELA 2DXIA 4UB6C 2KFDA 1QHGA 2K4JA 1XDUA 5FLVA 3V78A 1XMKA 2ISZA 3ANPA 2LF7A 1LFBA 2LDUA 4Q48A 2EZHA 5GTHC 1AA7A 1DGWY 4G6DA 3K10A 2ZJ2A 3FISA 1HKTA 3G71I 1ZLJA 2DU9A 1XN7A 3H5AA 3HIFA 2MG4A 1XMXA 3ECHA 2YVHA 2CUJA 1B59A 2WADA 1IF1A 4ZC3A 4YIIA 2DPDA 4EMSA 2K86A 4YFKF 2RNGA 2G7GA 1WKMA 4AIDA 2MYSA 1BR2A 1USSA 3DU6A 1MSFC 2FSWA 2BV6A 2VODA 2VB6A 2JRMA 3K70D 1RIOH 2IW5A 2GOXB 1X1AA 4Q4ZF 4A3MJ 3VVZA 2WV0A 1HBXG 1YW9A 2FQ4A 3TOAA 5LHGA 1RPWA 2E2JJ 3SZTA 2FXAA 3PSFA 1A31A 2ZCNA 4AIJA 3BRUA 2BZTA 2BY3A 4LMYA 3ABKH 2R7VA 5E18F 1HCRA 1I6XA 5IT9Z 2IRFG 3TDZC 1K4SA 4EJOA 4N9IA 1ETWA 2XHKA 4GFLA 2L2OA 2CFXA 3I0TA 2VKEA 2FNAA 1SVOA 4HQEA 3M8EA 2G7UA 4XN3A 2G7HA 1Y0UA 1F9NA 3AQSA 4ANJA 1LKXA 2V79A 3MZ8A 3WU1B 3LFUA 4S05A 4L9TA 3L2CA 1MBFA 1AOYA 4A12A 1YJWI 2DMTA 4M3EA 1FBUA 1VTNC 3QRFF 2IS4A 1SEUA 1LFPA 1NG7A 3DPTA 3HYIA 2FQ3A 4RLFA 1F5TA 4ON0A 1K7AA 1QU3A 2JT1A 4IHTA 1TL8A 4E70A 2PMZN 2M4GA 2VBWA 2LTPA 4DNCA 1DGRM 2W24A 3G2BA 3O3KA 4JNNA 3AL0C 1EH7A 3PPBA 3R0JA 4M3GA 3GTOJ 3GFJA 2PEXA 3QPTA 1WQ2A 1TQPA 1W0TA 2MFZA 2W57A 4C2MJ 4Y13A 1GV2A 3FXMA 3RJPA 2Z1DA 3FMSA 3S3OA 2OAZA 4GCTA 3QU3A 3BNIA 2LP0A 4B4CA 2FBIA 3Q0WA 3LWJA 3ZQGA 2XAFA 3COAC 2DFHA 1KU2A 3VW1A 4K2EA 2K7LA 4JK1X 4RGXA 3CMEI 3P7NA 3BJ6A 5GAEJ 1U9OA 1UZCA 1V54H 4JX5A 4ESFA 1YG2A 1ZTRA 4M9SA 4BKXA 4OD4A 4KN4X 2CUZA 2IU5A 3OS2A 3KZZA 2GBYA 1MJ9A 2JZYA 3VDXA 2JSCA 1K79A 3RYRA 1LVKA 1SD7A 5M3FJ 1B8IB 5BMZA 5CVUA 1WRJA 3OYBA 2B9SA 2H8WA 1KU9A 2UZKA 3OYLA 4BBRJ 1KGSA 4IF4A 4G7HF 1QVUA 3I56I 3QKXA 2PFBA 3M3YJ 4G6QA 1BIBA 2MABA 5D5VB 5FFZA 3DBHB 2V4JC 4XRFA 1DP7P 1AWCA 3HDDA 2I10A 4XL9A 3L2WA 3H36A 4L5JA 3VIBA 2A69F 2HYJA 2O7TA 3U2RA 5FMPA 1G3SA 3LQRA 2R4GA 3H9GA 3CJNA 2HZTA 3TMOA 1D0XA 2P5LC 3NXCA 2H1LA 5E1XA 3OYCA 1DPUA 2QSHX 3C1DA 2P7CB 4CYCB 2GFNA 4V2GA 1O3QA 4MFDA 4AYBN 3BR3A 3V7CA 2O5RA 4J01A 1XS9A 2IGOA 2JN6A 4GFBA 5EZGA 1JGGA 1XSDA 4KICA 4I76A 3ZMVA 5GADJ 5KAFC 3PIPF 1RUOA 1K83J 2RDPA 2DOAA 2VL8A 2Q24A 4XLEA 1NK3P 3U1KA 3HSFA 2R7TA 2B63J 1VFCA 4XLAA 5TRDA 2NXNB 3RZDJ 2LSOA 1B72B 3IC7A 2F07A 3QOEA 3GTGJ 1TWAJ 3L2RA 3IWFA 1ZG5A 1WJFA 5FJ8J 3H92A 2Z9OA 3CUQC 1TNTA 2HTJA 2IA1A 5ICGA 4NDLA 3C2HA 4EV0A 2IP2A 2PG4A 4BS9A 4A6DA 2ICWG 2NVUB 5DAJA 4DQ2A 5F1RA 2IGKA 3F3XA 1VQPI 5E17F 3MKZA 4LK0F 1MD0A 3GX4X 4F93B 4BQQA 1H89C 2B0LA 4QWQA 5L3CA 2QBYB 3HGYA 3K4JA 4JYKA 1ZQ3P 1H0MA 1EV7A 5HS8A 1QVTA 3ERMA 1NG6A 1Y8QB 5DCMB 2V7FA 1Z77A 2UXXA 4D7NA 4OD5A 2EK5A 2DO7A 3CD6I 2H27A 1R7JA 1P2FA 2CS3A 2EFNA 3O6BB 2XDNA 3HM5A 1T6SA 1BA5A 4PK4A 4MTEA 3FK7A 1APLC 5E79C 2DJIA 1ZGWA 4Y33A 4BNCA 1YRNB 2FA5A 3GTJJ 1U3EM 3IP4B 3TO6A 4D5CA 2Y0MA 1SMTA 1D8JA 1JKOC 2GZWA 1ZKGA 3H5NA 1JKRC 3HRTA 4F52A 2GOMA 3S1RJ 3N4MA 2DDAA 2M0CA 3TQNA 1STZA 1REPC 2XUBA 4ZYAA 1VQ4I 2AO9A 3OWTA 5FLXK 3SDGA 2MBFA 3JCUC 2K9NA 4QLCU 3TKYA 1Z3YA 3BG3A 1R9TJ 3C7JA 1T39A 3VVYA 3CF2A 1MKMA 2XAUA 4PFOA 3RKQA 3Q0VA 3ZMUA 2GQQA 3OL3A 2R7ZJ 1YO5C 3S1NJ 1BR4A 2UXOA 3D5RC 1CF7B 4XLPF 1QPIA 3I9V2 3A2KA 1X1BA 1X2MA 1EKEA 4L0YB 1G2HA 1BBYA 3HPGA 1MW7A 1KQ9A 1RC9A 5TISC 1EF4A 2HQAA 4FTHA 4PGGA 5D6EA 3OYFA 1OR7A 3S14J 4FETA 4L9VA 1SD5A 1R58A 4C3JJ 5D4SA 3KIOA 4LG0B 1F36A 3ESWB 3VYSB 1V5GA 1D3YA 3ONQA 1FYMA 4C2TA 4E7JA 5GPCA 1L0OC 1LQ1A 4QPQA 1UI6A 4FHTA 4XN0A 1EH6A 1UMQA 4A3JJ 3C07A 1SFUA 3HOYJ 4I02A 2DFIA 4CCNA 1UAAA 2Q8KA 3CP8A 1AHDP 2LY9A 1ERDA 1IRFA 1LEAA 2F4MB 3IUOA 4MXMA 3DQVC 2DK5A 3J7ZI 4WIBA 2ZKZA 2R7SA 4YIRX 1Q1HA 1BIAA 1GVDA 1ULYA 4MEXF 3H0DA 2YU9J 3KZ9A 3KP4A 3QBMA 2F6CA 2XB0X 3DEUA 3M07A 3LSKA 3S2HJ 3SFIA 4I6ZA 1LPQA 4KT6A 3LSIA 5GTIC 5D8LB 3VUQA 5J4YA 1FNNA 4Y15A 3IKTA 4I01A 3OIPA 2CYYA 2PJRA 1OMIA 2ZMEB 1Z3XA 3QYBA 3FDYA 1YITI 4FE7A 3LMMA 2BHZA 1A04A 1K78B 3F6OA 4PJLA 2MLGA 1IUFA 2PMHA 5DTDA 3I58A 2BY2A 1JHHA 1U8RA 2QQBA 2H1KA 2W82A 3CZ6A 5DD4A 1T2KA 2VPRA 1OCRH 2R7XA 2HFHA 1T0FA 4NC7A 2XV4S 3EPZA 2ME6A 1BC8C 1R1TA 2E1MC 2H6CA 5HSZA 2LRDA 2L01A 1J9IA 3RCOA 1K78A 2MSYA 2F4OB 2D1HA 2VONA 2BY1A 5JI6A 3OR2C 1YX5A 3V7SA 3GW2A 2VQLA 2X4HA 1Y1WJ 2ZXHA 2K85A 4A3DJ 1P6RA 1W4MA 2EFPA 1GUUA 2KJBA 3KP6A 2XDVA 3GFIA 3FKIJ 3K9TA 1OPCA 1I5ZA 3HOSA 3VYUB 1LFUP 1BI2A 1LUJB 3WU0A 3V7RA 2ECBA 5JLXA 2L7MP 3E5UA 3BG5A 3U21A 3WTSC 1TC3C 3F21A 4BHPA 4X6AJ 3KZIC 3E97A 4HDUA 1FMWA 5GAHJ 4UVAA 2DOFA 2ACJA 3ZMTA 3BR6A 2I5UA 2VQGA 4X0GA 2QQ8A 3ZN0A 2HOAA 2WUIA 3V8LA 4JQFA 2Y69H 1RR8C 2LMDA 4H4KC 3PQJA 2R7RA 5L3EA 1X4PA 4ENNA 2H09A 3BROA 4QSHA 2RHAA 2ZXWH 4G7OF 2HKUA 1R5GA 5F1JA 5L3FA 2DA1A 5M3MJ 2XAJA 2LFBA 3NEUA 2DTRA 4HF2A 2FMLA 5ERIA 4ASNA 3JSJA 2WAQA 2Y9YA 4UV9A 2E19A 2CJJA 2EILH 3CJRB 2BVMA 1J0RA 1FC3A 4DBRA 3D5LA 3OIOA 1RRJA 4DGWB 4B3AA 3NARA 4D1QA 2L0KA 4N4OB 3GZ6A 2JA6J 1IRZA 2R7UA 2E1NA 4IOAF 1BC7C 2Q2EA 4PUSA 2EFOA 3H5RA 1G3TA 4LIVA 3BDDA 4CO8A 5E3NA 1B9NA 2EZLA 5J1RA 5EZHA 4JKZA 2NYXA 4OU0A 4J19A 3HOUJ 3M4OJ 2DYSH 2M30A 3NRVA 1FX7A 1IRXA 1SAXA 3KEYA 3MAJA 2VBXA 4X1EA 2P7VB 3K4BA 4JBAA 3G1LA 3EGQA 2DJNA 4BH9A 1VQ7I 4R8HA 2VE9A 2DBBA 5B1AH 1FOKA 3DBLB 1YW8A 3BG9A 1SC7A 3H3ZA 4BJ6C 1FY7A 2JTVA 5IYBJ 3QU6A 2VJ5A 2CW8A 3ROUA 5HDNA 2COBA 4U0YA 1JE8A 3LHQA 1BM9A 2Z16A 3HE0A 1W0UA 5FFXA 3KFWX 2ZNYA 4ZDLA 4XRMA 1IN5A 1IXRC 4E7ZA 4S04A 3LL7A 4BUPA 3AG2H 2A5WA 2CU7A 5L3GA 4Y17A 3DKYA 1XSVA 5FB2A 4OAYA 3GTQJ 5HLTA 4WWCA 1S29A 2RASA 5DM6F 2E36A 1FTTA 1R49A 4BY1J 2GAUA 2KKOA 1ORKA 4E7LA 2MA3A 2ZCWA 4E7HA 2CW7A 2WBMA 4OMYA 2HZDA 1HKQA 2A3SA 1I3QJ 1X3WB 2E1OA 2KHMA 2TDXA 4A6EA 3HG9A 4M6VA 5HOOA 4ZZDA 5EJCA 3WTWC 2PJPA 3O2PE 1VNDA 1JUPA 2GIZA 4N9HA 3KKCA 3WTUC 3HXLA 2HEOA 3K69A 1U5TC 2EIMH 2O8XA 4XIDA 3OOUA 4LFUA 5HLIA 2E2IJ 4RA2A 1WWXA 1Z7UA 1KU7A 4I0AA 3MMYB 2JQ7A 2REKA 3S15J 2CRGA 2EINH 2R0QC 3MKWB 1MBHA 1WFXA 3S32A 3HOTA 5CVIA 1WJEA 1GLNA 4BJ5C 2K3FA 2AHQA 1A6QA 3JTHA 3ERED 1FP1D 5DS9A 4A3BJ 4L62A 3E3VA 3B02A 3REOA 1U9NA 1FSEA 5CLSA 5AONA 4PJJA 5FLMJ 5CXGA 3DEWA 4HX8A 2IBDA 3BG6A 2EIJH 4PFPA 4Q5SF 2RV8A 1OYYA 2LKSA 1VQ6I 4AIHA 5JVTA 3F0CA 3A01A 3I71A 4AIKA 1N78A 4P5OA 1QO0D 2XPUA 2M9HA 3KETA 1EJ9A 1YE9A 2E60A 1HQCA 3TP3A 4CCJA 3L2QA 1LDKB 3F22A 5E1ZB 3G6EI 2W7NA 1JHFA 5E1WA 2HXIA 5KK1A 3T1BA 2XAGA 5K5QA 1Z6TA 3HL2A 2BGCA 5CVVA 1KQ8A 1IDZA 4RMNA 2L3DA 4KIBA 2CV0A 1K61A 3DTEA 2B1EA 1J5YA 1XD7A 2PBIA 5LEKA 2HXOA 2QKMB 3JRDA 4ENKA 2R7DA 1VQOI 1YIJI 2WAEA 4E6KG 1RETA 2RKHA 2WWYA 1IXCA 5IY5H 2HDCA 2JPBA 1U8BA 4XQFA 2VC0A 3ZQQA 1IXSB 4UUSA 1WHUA 3HKZA 2LKPA 4U0VA 5HBUA 4KMUX 4RM3A 2ZCXA 2NS8A 2OTJI 2NOJB 1XG1A 2A05A 2VI6A 3KYDB 3AQTA 4M6XA 5HAWA 2F5EA 5LRRA 1JJ8C 1IN8A 3S1MJ 3I54A 1XDSA 2KIFA 3KPHA 4EM1A 1YJNI 2GXGA 1JKQC 5TJJA 2OA4A 1YX3A 1G59A 2M45A 3AG3H 3GFLA 3MVPA 4IRHA 2DN0A 4RM2A 3ZQ7A 1T56A 2X9DA 2YX7A 4OAZA 2GENA 1P4XA 1QZYA 2IEKA 2HDDA 2OQRA 2BW3B 2R7QA 3BZCA 3JR9A 3JW4A 4CUGA 2DMQA 5E20A 1ZRDA 2D2WA 3IAS2 1W7PD 1KYWA 4I98B 3CUQA 4B44A 2G3BA 3MN2A 3J80Z 4RB0A 2VKVA 2M7AA 4EQQA 3KP3A 1PYVA 4RB2C 5CPRB 4A69C 2AQEA 1JT6A 2E35A 2Y0SN 2M7BA 5B66C 3JRCA 3IV5A 2HNHA 4FISA 2BHYA 4A93J 2HPIA 2QKLB 1XTAA 2CQNA 2LLKA 2VKDA 4LB6B 2NVTJ 3QP6A 2V1UA 2DQRA 1TQIA 4UV8A 4XSXF 4XLHA 3M7GA 4PJ0C 5HNHA 2FF4A 4BQAA 4OIOF 2FBQA 5JLWA 4DJAA 1TW2A 4RB3C 4IHWA 4MFEA 3CQZJ 3VW0A 4M74A 3GXOA 3K4NA 3PUBA 2ZNZA 2DDBA 4XKCA 4IO9F 1ETOA 5IP7J 4RAZA 1XX5A 1Y39A 3EYIA 5DCMA 1UI5A 3E6MA 4H0EA 4IJAA 3X2QH 1TT5B 1FSHA 2HS5A 1O57A 4U87A 2DG8A 4CZZA 5HS7A 1R23A 3IL2A 1UG2A 5F08A 2Y31A 1ZARA 4B48A 2VXZA 5FO5A 2K27A 3QPSA 1I39A 4MQ9F 2HVRA 3O8GA 2UUZA 2DK8A 4DIQA 4BQNA 5ILVA 1OCOH 2ADUA 4IHXA 3CO6C 3I53A 5CQGA 5EF6A 4N4NB 1WSUA 3U9GA 3ZOBA 1Y1VJ 2R3SA 2Z5UA 2IGMA 1IO2A 1EA3A 3H9JA 2Y0SA 3A01B 4LB5A 5F0HA 3K1MA 2KL4A 5JHUA 2F5CA 3RQIA 4LD5A 2IT0A 3HOWJ 5E8GA 3SHFA 3B6CA 2LH9A 2DAOA 2QM3A 5CW8A 1BR1A 2MD0A 3LA3A 1TWHJ 1CF7A 3BJOA 1ZELA 3GFMA 2ZO4A 2JA2A 5LGTA 5ED4A 4BAYA 3GO5A 2OU2A 2AQFA 4IEJA 4EGYA 1X19A 2IS2A 4IVNA 1KQ0A 4BU2A 2NVXJ 3FHZA 3T8TA 2L02A 4G8XA 2EJRA 3GVAA 2JRTA 1LJ9A 2DODA 1DPRA 4HF0A 2NAZA 3AG1H 3P5JA 1IRGA 2NX4A 4HLYA 2FOWA 4M6YA 1IN7A 4HOBA 3WTVC 3J7AY 5J40A 1RI7A 1SAUA 4ESBA 1A35A 2GXAA 2E34A 5L3DA 3R6SA 1GDTA 4YIFA 4II2A 1T33A 5HDGA 1R71A 2YU3A 4EJTA 3IH2A 3AFHA 4QIWN 1J75A 1IAWA 2W85A 4A3FJ 3S1QJ 2ETHA 4EGZA 3PIOF 3UR3C 4XK4A 1QA6A 3A02A 1FBQA 4E7IA 5ICFA 2O7OA 1R22A 2HQRA 1XGMA 5BOXA 2DT5A 3CESA 3KP2A 4A3EJ 2HOEA 1XB4A 1YIOA 3A03A 2XVCA 5J8CA 1QZZA 3W6VA 3HTAA 2XAHA 4GFKA 3MNLA 2ZXIA 5E8IA 1X2NA 1YQAA 4AD9A 2FJ1A 1Z67A 1B1BA 1OFCX 3ABUA 4F92B 3KZYA 1FOXA 5CQEA 2K4BA 5DDGA 2KRHA 3MD2A 2DA3A 3BLYA 3HEFA 1OJLA 2WY8Q 6PAXA 1H8AC 4A5NA 1BW6A 2KDZA 3CCLI 3FRQA 2VIXA 3NS4A 2CO5A 5ICCA 1DDNA 1TT0A 2M0MA 2HPMA 4GDFA 4PDKA 2YX4A 5J6XA 2EB7A 3S8PA 3OMYA 1ON1A 2HVSA 1WGXA 4FT8A 5DCFA 3F72A 3ABTA 2EBIA 2KLOA 4G94A 3LSRA 5FRMA 1XPXA 3JTGA 3HOXJ 3DLLF 3FHNA 5EYRA 3AG4H 2L5QA 3F8NA 1QPMA 2OV7A 2YR2A 3H9QA 5HVQC 4FCYA 2F5DA 5FKOA 5K7HA 4O6JA 3NPIA 1HSJA 4Y4RA 3QOPA 4XLNF 2JA5J 5IT9K 2UXUA 3DKWA 2O6GE 1UHWA 4IL6C 3DU5A 1GXPA 3S3NA 1LVAA 1H9GA 2AXTC 1D1BA 1W1WE 2PX9A 1JTXA 3HOVJ 4AF5A 3DTKA 1MBKA 4R1HA 4B1RA 3CCYA 4CSWA 2PN6A 1YW7A 3CP2A 2R7OA 2IGNA 4UY8I 4NC6A 1DP3A 3L7WA 2LREA 5C4JJ 1TWFJ 3ZPLA 2KDOA 3FM5A 1Z9CA 2OD5A 4ACIA 3LSTA 3CCSI 1K6YA 3CMAI 4CXFA 1IN4A 5IYDJ 3KP7A 2F2EA 2VBYA 3NWSA 2O0YA 2MLKA 1MBJA 3WGHA 3DWLE 2VOOA 3MWMA 1QZEA 2JSPA 2A2FX 5EFYA 2WTEA 4RGSA 3TP0A 4DYCA 3K4MA 1KZHA 4KT5C 2X6XA 2K9MA 2OPTA 3GLLA 3KCCA 5FHPA 1T98A 1WJCA 3MZYA 1T8IA 2ZSIB 1FTZA 4B43A 1LDDA 4L5IA 2Z99A 1I50J 4GO1A 4MNUA 1GVJA 3C2BA 4YZEA 2KZVA 1FOWA 3M1EA 4B8XA 2VBZA 3GF2A 2MC3A 1FZPB 2VXDA 1QQIA 2STTA 1WI9A 2R7WA 4V19K 3ON4A 1SANA 4A3GJ 5D19A 4HX4A 3AAFA 5KNLA 1YJ9I 2F5FA 3I5UA 2LBFB 3WU2C 2XGEA 1I1SA 1HA8A 3LWFA 3GBGA 3VOEA 2DOEA 4ESJA 3BJBA 5FGLA 4S0HB 2E71A 3FBIB 4IHYA 3OYGA 1N77A 2V1NA 2BEOA 2VQHA 2VE8A 5HLGA 3BR1A 4IRVA 1YLFA 1OCPA 5LBQA 1NTCA 1M1EB 2B3WA 1R4MB 2CH0A 1HW2A 3G73A 5CKTA 1SD4A 2NNNA 5CYVA 4XRSG 9ANTA 3HOZJ 5D4RA 3C18A 4R79A 3IUVA 3IKVA 4KNYA 3I64A 3J7AO 1BI1A 2COMA 2LF8A 4C3HJ 1JJ6C 1ZLKA 3OYAA 4AVPA 4Z2YA 2CW0F 1EH8A 1SFKA 1VQNI 3CCVI 4D9JA 4HAMA 3ABMH 2G9WA 3H0GJ 4Y7NJ 5K1YA 2P8TA 3DEEA 2ZFUA 3CC7I 3P9KA 1A36A 1S7AA 1MSEC 4MO7A 1SVMA 1FOYA 2ZJQF 3VSKA 4OIQF 3RD3A 3OR1C 1DQUA 3GTLJ 2CUEA 4J00A 2HR3A 2UXHA 3KEOA 4GCLA 1Z7LA 2BW3A 3ELKA 1S7OA 1W7PA 4HQMA 3I4MJ 4XKBA 1IG7A 3HRSA 5C44J 3QPHA 2RVCA 3BTJA 1S3JA 3ULQB 4L18B 5IPAA 1YHQI 2GM4A 2EFQA 1GHCA 1G3YA 4A3LJ 4BYYA 4BHBA 3FM3A 4KJZA 3HTHA 2EFWA 4KIFA 4LLLA 1VQKI 3CTAA 4OIPF 3OSGA 5ILUA 2W84A 1TWCJ 1HSTA 5F0CA 3LSJA 1T38A 2RC4A 4GRIA 4YG2F 4UUVA 1RZ4A 4XORA 2DG7A 4EVIA 5M5XJ 2M87A 1PP8F 4KYWA 2M8EA 1YFHA 1USTA 1NHAA 3OSFA 2GIVA 1PUEE 1TLHB 2IS1A 4CYDA
chains in the Genus database with same CATH topology
3BR2A 1MSFC 2MW8A 3HGGA 4XIDA 3O60A 3OOUA 4A3MJ 2E2IJ 3VVZA 1DU6A 2R5YA 1E3OC 2FQ4A 1RPWA 2REKA 2E2JJ 3QPLA 1Q1VA 3S15J 2CRGA 1A6IA 2R0QC 2QKOA 1MBHA 1AKHA 3GEUA 2ZCNA 3BRUA 1S7EA 2HI3A 2W53A 1IJWC 2AHQA 5J3LA 1HCRA 4A3BJ 1VF9A 2ID6A 3O8HA 5DS9A 3G1MA 1HDDC 4L62A 2XPWA 2WB1N 2DA6A 3BR0A 1U9NA 2ME0A 4GFLA 1ETWA 5FLMJ 5CXGA 3DEWA 2IBDA 2VKEA 3JRAA 2NVQJ 2DA7A 4JX6A 3E7LA 5EDNA 1AKHB 1A5JA 3JRBA 3CDLA 3AQSA 3F0CA 4G12A 3A01A 3S5RA 2XPUA 2M9HA 1MBFA 5GPAA 1MBEA 4FE4A 3TP3A 3ZQHA 2WAQN 2DMTA 4M3EA 1DU0A 2EZIA 4DZPA 2HXIA 1WH5A 3Q0UA 1JKPC 5HODA 3JRHA 2PMZN 2D6YA 3WHBA 1K61A 2LTPA 3NI7A 4JNNA 3LSGA 3PPBA 5EG0B 3JRDA 2HXOA 4JX4A 4M3GA 1X58A 4EEFG 3GTOJ 3PO2J 1RETA 1W0TA 2V57A 1U8BA 4C2MJ 1GV2A 3Q3SA 2ZCMA 4UUSA 4GCTA 3BNIA 4W1UA 5HBUA 2LP0A 3S16J 4B4CA 2NP5A 2ZCXA 3Q0WA 2NS8A 3ZQGA 3LWJA 1XG1A 2K9QA 2VI6A 1ETKA 2NS7A 3AQTA 2XPVA 3VW1A 2D5VA 5HAWA 1JJ8C 4UDSA 1ZR4A 3S1MJ 2JA7J 1F43A 1U9OA 4JX5A 3G1OA 3MKLA 1ZTRA 3PO3J 4BKXA 1JKQC 1B72A 2TCTA 2IU5A 3LOCA 2GBYA 1ETQA 3MVPA 5E3OA 4ICHA 2DN0A 2XGCA 1GT0C 3KKDA 5M3FJ 1B8IB 1T56A 2X9DA 2GENA 2IEKA 2MGQA 2HDDA 2OF7A 3JR9A 4BBRJ 1QVUA 3QKXA 3NAUA 3T6NA 3M3YJ 2DMQA 2R5ZA 4JL3A 2NVYJ 1RR7A 1IC8A 2G3BA 3MN2A 2I10A 3HDDA 5FKNA 2VKVA 3LNQA 3VIBA 3HTJA 2HOTA 2HYJA 3G56A 3SJMA 2O7TA 1TWGJ 4A69C 5FMPA 1JT6A 3I4NJ 2Y0SN 5IOZA 3JRCA 3IV5A 3ZQFA 3G7RA 4FISA 2ELKA 4A93J 3BQZA 2JWTA 1GV5A 5FKLA 1LE8B 1POGA 3NXCA 2LLKA 3RZOJ 2NVTJ 3RH2A 5FKMA 4CYCB 2GFNA 4V2GA 3TW6A 2M34A 2QWTA 4MFDA 4AYBN 3BR3A 2FBQA 1XS9A 4W97A 5JLWA 4IHWA 2G7LA 3ANGA 3BQYA 4MFEA 2JN6A 2Y30A 3CQZJ 3PASA 4GFBA 3VW0A 5EZGA 1H88C 1JGGA 4I76A 1WCMJ 1IDYA 1K83J 2EZKA 1ETOA 2XGDA 5IP7J 2Q24A 1NK3P 2B63J 1UI5A 1VFCA 5IOYA 3HKZN 2CQXA 2DA2A 3RZDJ 3NNRA 2YVEA 3GTPJ 1B72B 2DG8A 2F07A 3GTGJ 1TWAJ 4DZJA 1UG2A 5F08A 4DW6A 2Y31A 3QPSA 1B8IA 4GCKA 3O8GA 5FJ8J 2E2HJ 3VOXA 1Z0XA 3HB9A 1ZR2A 5F27A 4IHXA 4NDLA 3H3VK 2R93J 5EF6A 5DAJA 1ENHA 3ZOBA 1PUFB 1Y1VJ 4M3DA 2EQRA 3A01B 5F0HA 3VP5A 4QTRA 1H89C 4KWAA 3RQIA 1IGNA 1RESA 3HGYA 4JYKA 1ZQ3P 3HOWJ 4LOCA 5C3EJ 3B6CA 2UXPA 5GP9A 5CW8A 3VW2A 1QVTA 2VUMJ 2KT0A 5J1YA 1Z77A 5F0FA 5E3MA 4XICA 1TWHJ 2XSDC 3BHQA 4D7NA 5AQCA 1AU7A 3GTKJ 3IH4A 1VI0A 2XDNA 4CGRA 4IEJA 3HM5A 2O9LA 1BA5A 2ZOYA 2NVXJ 2G7SA 4HNVA 1O4XA 1FIAA 3FK7A 1APLC 2OI8A 1ETXA 1JUMA 1ZGWA 2OERA 2NX4A 3BTLA 5EG0A 4D5FA 1YRNB 3GTJJ 4D5CA 2FD5A 1JKOC 1IV6A 1ZKGA 1JKRC 1ETVA 4ME9A 3HIMA 3S1RJ 1GDTA 2M0CA 4JP0A 2AO9A 1T33A 1JTYA 3SDGA 3IH2A 3TW7A 3LSPA 4PXIA 4QIWN 2K9NA 1R9TJ 1ITYA 5D18A 3BG3A 4A3FJ 3F1BA 3S1QJ 2QF7A 2LKXA 1FEXA 3VVYA 3RKQA 4XK4A 3Q0VA 3A02A 1QRYA 2R7ZJ 3S1NJ 2O7OA 2LK2A 4IHVA 4AUXA 2UXOA 2JJ7A 4A3EJ 4D7MA 2NOGA 3BCGA 3A03A 2CUFA 1QPIA 3W6VA 2IAIA 3JREA 3HTAA 1X2MA 1G2HA 4GFKA 3MNLA 1WH7A 1EF4A 1MH3A 1X2NA 4FTHA 2DTZA 3S14J 3E7QA 1RKTA 3V6GA 2FJ1A 2Y2ZA 2EH3A 1ZK8A 1OFCX 4BY7J 2R92J 4C3JJ 2QTQA 2QIBA 1F36A 2K40A 4ABZA 2DA3A 1YRNA 3HEFA 1OJLA 2DA5A 5M5YJ 2GLOA 5GPCA 1UI6A 1H8AC 1WI3A 1BW6A 2DMPA 3JRGA 1UMQA 4XRSA 2KDZA 4A3JJ 3C07A 3FRQA 4MK6A 1RKWA 3FIWA 1BJZA 5K7FA 3HOYJ 2YS9A 3IH3A 2X6OA 1AHDP 2LY9A 1OCTC 1WGXA 4MXMA 1SFOJ 3TEDA 2EBIA 5IP6A 3LSRA 1GVDA 3VPRA 3JRFA 2WGBA 2YU9J 3KZ9A 3QBMA 3HOXJ 3ZQLA 2XB0X 2QCOA 5EYRA 3NRGA 3S2HJ 3SFIA 2R5ZB 4I6ZA 3P9TA 3B6AA 4CYCA 3L1PA 2CQQA 3VUQA 3BTCA 2YUSA 2LD5A 4FCYA 5FKOA 5K7HA 3GTMJ 3NPIA 5FKKA 2G0EA 2HQ5A 2JA5J 2UXUA 5C4YA 4FE7A 3EUPA 1D5YA 2L9RA 4V2FA 1IUFA 5DTDA 3D1NI 2FX0A 3DCFA 2H1KA 5F04A 1JTXA 2H8RA 2VPRA 3HOVJ 1MNMC 4AF5A 1MBKA 4B1RA 1MH4A 4M3FA 3CCYA 1ETYA 2ME6A 2JMWA 3BT9A 5HSZA 3K2AA 5D1RA 5C4JJ 2MSYA 1TWFJ 2UXIA 4ACIA 1XC5A 1P7JA 3PM1A 1U78A 3BR5A 5IYDJ 4RDUA 3KKCA 4A3CJ 1Y1WJ 3DPJA 1BW5A 2O8KA 4A3DJ 4BBSJ 2JK3A 2M8GX 2QOPA 1HDPA 1GUUA 1MBJA 3FKIJ 2Y9ZA 5K58A 5EFYA 5IP9J 2HOSA 3ZQIA 2DMNA 3TP0A 4DYCA 1LFUP 2W48A 1NK2P 4DYRA 1HOMA 2GUHA 1JUSA 3S2DJ 2L7FP 4C3IJ 2ECBA 2OPTA 2L7MP 5JLXA 2ZB9A 2DA4A 3BG5A 1LE8A 1TC3C 5FHPA 4UUSB 1PUFA 3K7AJ 2DMUA 2PZ9A 4X6AJ 1FTZA 2LVSA 3UKGA 1I50J 1BL0A 4A3KJ 2X48A 1WPKA 5K7ZA 3C2BA 3COLA 4YZEA 3BR6A 5D19A 3ON4A 1SANA 2HOAA 4A3GJ 2WUIA 2M2EA 2XRLA 3CJDA 4BXXJ 2LR8A 4L5EA 1UHSA 3CWRA 4AC6A 2XGEA 4QSHA 2RHAA 2HKUA 3HBLA 5F1JA 5M3MJ 2DA1A 3GBGA 1HF0A 2LFBA 3JRIA 3GZIA 3ON2A 3BJBA 5FGLA 4S0HB 4A3IJ 3S17J 3JSJA 4IHYA 2Y9YA 2E19A 2P81A 2CJJA 2TRTA 3BR1A 4Y52J 1OCPA 1NTCA 3VOKA 3OIOA 2ECCA 1CQTA 4XRSG 5EEAA 4B3AA 3NARA 9ANTA 2L0KA 2JA6J 3HOZJ 3ZQCA 1IRZA 2NP3A 4RBOA 2ID3A 3IUVA 2WV1A 5E3NA 1I6HJ 2EZLA 5J1RA 5EZHA 4JKZA 5C4XJ 4MLOA 3B81A 3CMYA 4J19A 4C3HJ 3HOUJ 1JJ6C 3M4OJ 3CRJA 3HTIA 5J1UA 5BNGA 2HYTA 2ZOZA 1FJLA 4X1EA 3H0GJ 4Y7NJ 3G1LA 3EGQA 2DJNA 2R5YB 4UUTA 4HKUA 1MSEC 1JT0A 5CXIA 4MO7A 2N8GA 3FK6A 5M5WJ 2K9SA 3RD3A 3BG9A 4AC0A 3GTLJ 5H9TA 2CUEA 2PBXA 2UXHA 5EGOA 4MIMA 5IYBJ 4NN1A 4GCLA 3VVXA 2COBA 2RAEA 3I4MJ 3LHQA 3HE0A 3BTIA 1W0UA 1IG7A 5C44J 4XRMA 4M3BA 2JA8J 3BTJA 4DYQA 1FIPA 3LJLA 4NELA 5E3LA 2XB5A 2CU7A 5IPAA 2GM4A 4A3LJ 2L7ZA 3GTQJ 3HTHA 5FLVA 3V78A 3ANPA 2RASA 3QQAA 1LFBA 1FTTA 2EZHA 3WHCA 1P7IA 3OSGA 1HLVA 3FISA 4BY1J 5F0CA 1TWCJ 1ORKA 3LSJA 1MBGA 5IYCJ 2DG7A 1I3QJ 2E1OA 5M5XJ 2MG4A 4M6VA 2YVHA 3KNWA 1VNDA 5EGOB 1JUPA 3OSFA 1SGMA 2G7GA 1IDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR2 A;  1MSF C;  2MW8 A;  3HGG A;  4XID A;  3O60 A;  3OOU A;  4A3M J;  2E2I J;  3VVZ A;  1DU6 A;  2R5Y A;  1E3O C;  2FQ4 A;  1RPW A;  2REK A;  2E2J J;  3QPL A;  1Q1V A;  3S15 J;  2CRG A;  1A6I A;  2R0Q C;  2QKO A;  1MBH A;  1AKH A;  3GEU A;  2ZCN A;  3BRU A;  1S7E A;  2HI3 A;  2W53 A;  1IJW C;  2AHQ A;  5J3L A;  1HCR A;  4A3B J;  1VF9 A;  2ID6 A;  3O8H A;  5DS9 A;  3G1M A;  1HDD C;  4L62 A;  2XPW A;  2WB1 N;  2DA6 A;  3BR0 A;  1U9N A;  2ME0 A;  4GFL A;  1ETW A;  5FLM J;  5CXG A;  3DEW A;  2IBD A;  2VKE A;  3JRA A;  2NVQ J;  2DA7 A;  4JX6 A;  3E7L A;  5EDN A;  1AKH B;  1A5J A;  3JRB A;  3CDL A;  3AQS A;  3F0C A;  4G12 A;  3A01 A;  3S5R A;  2XPU A;  2M9H A;  1MBF A;  5GPA A;  1MBE A;  4FE4 A;  3TP3 A;  3ZQH A;  2WAQ N;  2DMT A;  4M3E A;  1DU0 A;  2EZI A;  4DZP A;  2HXI A;  1WH5 A;  3Q0U A;  1JKP C;  5HOD A;  3JRH A;  2PMZ N;  2D6Y A;  3WHB A;  1K61 A;  2LTP A;  3NI7 A;  4JNN A;  3LSG A;  3PPB A;  5EG0 B;  3JRD A;  2HXO A;  4JX4 A;  4M3G A;  1X58 A;  4EEF G;  3GTO J;  3PO2 J;  1RET A;  1W0T A;  2V57 A;  1U8B A;  4C2M J;  1GV2 A;  3Q3S A;  2ZCM A;  4UUS A;  4GCT A;  3BNI A;  4W1U A;  5HBU A;  2LP0 A;  3S16 J;  4B4C A;  2NP5 A;  2ZCX A;  3Q0W A;  2NS8 A;  3ZQG A;  3LWJ A;  1XG1 A;  2K9Q A;  2VI6 A;  1ETK A;  2NS7 A;  3AQT A;  2XPV A;  3VW1 A;  2D5V A;  5HAW A;  1JJ8 C;  4UDS A;  1ZR4 A;  3S1M J;  2JA7 J;  1F43 A;  1U9O A;  4JX5 A;  3G1O A;  3MKL A;  1ZTR A;  3PO3 J;  4BKX A;  1JKQ C;  1B72 A;  2TCT A;  2IU5 A;  3LOC A;  2GBY A;  1ETQ A;  3MVP A;  5E3O A;  4ICH A;  2DN0 A;  2XGC A;  1GT0 C;  3KKD A;  5M3F J;  1B8I B;  1T56 A;  2X9D A;  2GEN A;  2IEK A;  2MGQ A;  2HDD A;  2OF7 A;  3JR9 A;  4BBR J;  1QVU A;  3QKX A;  3NAU A;  3T6N A;  3M3Y J;  2DMQ A;  2R5Z A;  4JL3 A;  2NVY J;  1RR7 A;  1IC8 A;  2G3B A;  3MN2 A;  2I10 A;  3HDD A;  5FKN A;  2VKV A;  3LNQ A;  3VIB A;  3HTJ A;  2HOT A;  2HYJ A;  3G56 A;  3SJM A;  2O7T A;  1TWG J;  4A69 C;  5FMP A;  1JT6 A;  3I4N J;  2Y0S N;  5IOZ A;  3JRC A;  3IV5 A;  3ZQF A;  3G7R A;  4FIS A;  2ELK A;  4A93 J;  3BQZ A;  2JWT A;  1GV5 A;  5FKL A;  1LE8 B;  1POG A;  3NXC A;  2LLK A;  3RZO J;  2NVT J;  3RH2 A;  5FKM A;  4CYC B;  2GFN A;  4V2G A;  3TW6 A;  2M34 A;  2QWT A;  4MFD A;  4AYB N;  3BR3 A;  2FBQ A;  1XS9 A;  4W97 A;  5JLW A;  4IHW A;  2G7L A;  3ANG A;  3BQY A;  4MFE A;  2JN6 A;  2Y30 A;  3CQZ J;  3PAS A;  4GFB A;  3VW0 A;  5EZG A;  1H88 C;  1JGG A;  4I76 A;  1WCM J;  1IDY A;  1K83 J;  2EZK A;  1ETO A;  2XGD A;  5IP7 J;  2Q24 A;  1NK3 P;  2B63 J;  1UI5 A;  1VFC A;  5IOY A;  3HKZ N;  2CQX A;  2DA2 A;  3RZD J;  3NNR A;  2YVE A;  3GTP J;  1B72 B;  2DG8 A;  2F07 A;  3GTG J;  1TWA J;  4DZJ A;  1UG2 A;  5F08 A;  4DW6 A;  2Y31 A;  3QPS A;  1B8I A;  4GCK A;  3O8G A;  5FJ8 J;  2E2H J;  3VOX A;  1Z0X A;  3HB9 A;  1ZR2 A;  5F27 A;  4IHX A;  4NDL A;  3H3V K;  2R93 J;  5EF6 A;  5DAJ A;  1ENH A;  3ZOB A;  1PUF B;  1Y1V J;  4M3D A;  2EQR A;  3A01 B;  5F0H A;  3VP5 A;  4QTR A;  1H89 C;  4KWA A;  3RQI A;  1IGN A;  1RES A;  3HGY A;  4JYK A;  1ZQ3 P;  3HOW J;  4LOC A;  5C3E J;  3B6C A;  2UXP A;  5GP9 A;  5CW8 A;  3VW2 A;  1QVT A;  2VUM J;  2KT0 A;  5J1Y A;  1Z77 A;  5F0F A;  5E3M A;  4XIC A;  1TWH J;  2XSD C;  3BHQ A;  4D7N A;  5AQC A;  1AU7 A;  3GTK J;  3IH4 A;  1VI0 A;  2XDN A;  4CGR A;  4IEJ A;  3HM5 A;  2O9L A;  1BA5 A;  2ZOY A;  2NVX J;  2G7S A;  4HNV A;  1O4X A;  1FIA A;  3FK7 A;  1APL C;  2OI8 A;  1ETX A;  1JUM A;  1ZGW A;  2OER A;  2NX4 A;  3BTL A;  5EG0 A;  4D5F A;  1YRN B;  3GTJ J;  4D5C A;  2FD5 A;  1JKO C;  1IV6 A;  1ZKG A;  1JKR C;  1ETV A;  4ME9 A;  3HIM A;  3S1R J;  1GDT A;  2M0C A;  4JP0 A;  2AO9 A;  1T33 A;  1JTY A;  3SDG A;  3IH2 A;  3TW7 A;  3LSP A;  4PXI A;  4QIW N;  2K9N A;  1R9T J;  1ITY A;  5D18 A;  3BG3 A;  4A3F J;  3F1B A;  3S1Q J;  2QF7 A;  2LKX A;  1FEX A;  3VVY A;  3RKQ A;  4XK4 A;  3Q0V A;  3A02 A;  1QRY A;  2R7Z J;  3S1N J;  2O7O A;  2LK2 A;  4IHV A;  4AUX A;  2UXO A;  2JJ7 A;  4A3E J;  4D7M A;  2NOG A;  3BCG A;  3A03 A;  2CUF A;  1QPI A;  3W6V A;  2IAI A;  3JRE A;  3HTA A;  1X2M A;  1G2H A;  4GFK A;  3MNL A;  1WH7 A;  1EF4 A;  1MH3 A;  1X2N A;  4FTH A;  2DTZ A;  3S14 J;  3E7Q A;  1RKT A;  3V6G A;  2FJ1 A;  2Y2Z A;  2EH3 A;  1ZK8 A;  1OFC X;  4BY7 J;  2R92 J;  4C3J J;  2QTQ A;  2QIB A;  1F36 A;  2K40 A;  4ABZ A;  2DA3 A;  1YRN A;  3HEF A;  1OJL A;  2DA5 A;  5M5Y J;  2GLO A;  5GPC A;  1UI6 A;  1H8A C;  1WI3 A;  1BW6 A;  2DMP A;  3JRG A;  1UMQ A;  4XRS A;  2KDZ A;  4A3J J;  3C07 A;  3FRQ A;  4MK6 A;  1RKW A;  3FIW A;  1BJZ A;  5K7F A;  3HOY J;  2YS9 A;  3IH3 A;  2X6O A;  1AHD P;  2LY9 A;  1OCT C;  1WGX A;  4MXM A;  1SFO J;  3TED A;  2EBI A;  5IP6 A;  3LSR A;  1GVD A;  3VPR A;  3JRF A;  2WGB A;  2YU9 J;  3KZ9 A;  3QBM A;  3HOX J;  3ZQL A;  2XB0 X;  2QCO A;  5EYR A;  3NRG A;  3S2H J;  3SFI A;  2R5Z B;  4I6Z A;  3P9T A;  3B6A A;  4CYC A;  3L1P A;  2CQQ A;  3VUQ A;  3BTC A;  2YUS A;  2LD5 A;  4FCY A;  5FKO A;  5K7H A;  3GTM J;  3NPI A;  5FKK A;  2G0E A;  2HQ5 A;  2JA5 J;  2UXU A;  5C4Y A;  4FE7 A;  3EUP A;  1D5Y A;  2L9R A;  4V2F A;  1IUF A;  5DTD A;  3D1N I;  2FX0 A;  3DCF A;  2H1K A;  5F04 A;  1JTX A;  2H8R A;  2VPR A;  3HOV J;  1MNM C;  4AF5 A;  1MBK A;  4B1R A;  1MH4 A;  4M3F A;  3CCY A;  1ETY A;  2ME6 A;  2JMW A;  3BT9 A;  5HSZ A;  3K2A A;  5D1R A;  5C4J J;  2MSY A;  1TWF J;  2UXI A;  4ACI A;  1XC5 A;  1P7J A;  3PM1 A;  1U78 A;  3BR5 A;  5IYD J;  4RDU A;  3KKC A;  4A3C J;  1Y1W J;  3DPJ A;  1BW5 A;  2O8K A;  4A3D J;  4BBS J;  2JK3 A;  2M8G X;  2QOP A;  1HDP A;  1GUU A;  1MBJ A;  3FKI J;  2Y9Z A;  5K58 A;  5EFY A;  5IP9 J;  2HOS A;  3ZQI A;  2DMN A;  3TP0 A;  4DYC A;  1LFU P;  2W48 A;  1NK2 P;  4DYR A;  1HOM A;  2GUH A;  1JUS A;  3S2D J;  2L7F P;  4C3I J;  2ECB A;  2OPT A;  2L7M P;  5JLX A;  2ZB9 A;  2DA4 A;  3BG5 A;  1LE8 A;  1TC3 C;  5FHP A;  4UUS B;  1PUF A;  3K7A J;  2DMU A;  2PZ9 A;  4X6A J;  1FTZ A;  2LVS A;  3UKG A;  1I50 J;  1BL0 A;  4A3K J;  2X48 A;  1WPK A;  5K7Z A;  3C2B A;  3COL A;  4YZE A;  3BR6 A;  5D19 A;  3ON4 A;  1SAN A;  2HOA A;  4A3G J;  2WUI A;  2M2E A;  2XRL A;  3CJD A;  4BXX J;  2LR8 A;  4L5E A;  1UHS A;  3CWR A;  4AC6 A;  2XGE A;  4QSH A;  2RHA A;  2HKU A;  3HBL A;  5F1J A;  5M3M J;  2DA1 A;  3GBG A;  1HF0 A;  2LFB A;  3JRI A;  3GZI A;  3ON2 A;  3BJB A;  5FGL A;  4S0H B;  4A3I J;  3S17 J;  3JSJ A;  4IHY A;  2Y9Y A;  2E19 A;  2P81 A;  2CJJ A;  2TRT A;  3BR1 A;  4Y52 J;  1OCP A;  1NTC A;  3VOK A;  3OIO A;  2ECC A;  1CQT A;  4XRS G;  5EEA A;  4B3A A;  3NAR A;  9ANT A;  2L0K A;  2JA6 J;  3HOZ J;  3ZQC A;  1IRZ A;  2NP3 A;  4RBO A;  2ID3 A;  3IUV A;  2WV1 A;  5E3N A;  1I6H J;  2EZL A;  5J1R A;  5EZH A;  4JKZ A;  5C4X J;  4MLO A;  3B81 A;  3CMY A;  4J19 A;  4C3H J;  3HOU J;  1JJ6 C;  3M4O J;  3CRJ A;  3HTI A;  5J1U A;  5BNG A;  2HYT A;  2ZOZ A;  1FJL A;  4X1E A;  3H0G J;  4Y7N J;  3G1L A;  3EGQ A;  2DJN A;  2R5Y B;  4UUT A;  4HKU A;  1MSE C;  1JT0 A;  5CXI A;  4MO7 A;  2N8G A;  3FK6 A;  5M5W J;  2K9S A;  3RD3 A;  3BG9 A;  4AC0 A;  3GTL J;  5H9T A;  2CUE A;  2PBX A;  2UXH A;  5EGO A;  4MIM A;  5IYB J;  4NN1 A;  4GCL A;  3VVX A;  2COB A;  2RAE A;  3I4M J;  3LHQ A;  3HE0 A;  3BTI A;  1W0U A;  1IG7 A;  5C44 J;  4XRM A;  4M3B A;  2JA8 J;  3BTJ A;  4DYQ A;  1FIP A;  3LJL A;  4NEL A;  5E3L A;  2XB5 A;  2CU7 A;  5IPA A;  2GM4 A;  4A3L J;  2L7Z A;  3GTQ J;  3HTH A;  5FLV A;  3V78 A;  3ANP A;  2RAS A;  3QQA A;  1LFB A;  1FTT A;  2EZH A;  3WHC A;  1P7I A;  3OSG A;  1HLV A;  3FIS A;  4BY1 J;  5F0C A;  1TWC J;  1ORK A;  3LSJ A;  1MBG A;  5IYC J;  2DG7 A;  1I3Q J;  2E1O A;  5M5X J;  2MG4 A;  4M6V A;  2YVH A;  3KNW A;  1VND A;  5EGO B;  1JUP A;  3OSF A;  1SGM A;  2G7G A;  1IDZ A; 
#chains in the Genus database with same CATH topology
 4BDZ A;  3LSM A;  1ZGA A;  2P4W A;  1YOV B;  4M9X A;  3SWH A;  3O60 A;  1VQ8 I;  2E5Z A;  4B3X A;  1Y6I A;  3FF5 A;  1DU6 A;  3GZ5 A;  2R5Y A;  1E3O C;  1RUN A;  3QPL A;  1Q1V A;  3GEU A;  1V3F A;  4BE1 A;  1S7E A;  2IVM A;  3E5X A;  4U9L A;  4YEJ A;  5J3L A;  3H3U A;  3HSE A;  2KIM A;  2ID6 A;  2P0W A;  2Z2S B;  3G1M A;  4FAS D;  2XPW A;  3W3C A;  2ME0 A;  2LG4 A;  5FGM A;  3SDB A;  3J81 Z;  1X1P A;  4JX6 A;  5J8F A;  1UB9 A;  1TQM A;  1AKH B;  1SFX A;  1A5J A;  4G12 A;  3S5R A;  1XCV A;  2FRH A;  4HRI A;  3TBI A;  5GPA A;  4FE4 A;  4LLN A;  1XGS A;  4I99 C;  1DU0 A;  4XSZ F;  5H6R A;  3ASN H;  2LBF A;  4TV7 A;  1NH3 A;  2KMU A;  4NQW A;  2EA2 A;  2A6H F;  2KQR A;  3H1C A;  5HOD A;  3JRH A;  1QBJ A;  1K4T A;  3FMQ A;  2PI0 A;  1YS6 A;  1SMY F;  4ETS A;  4NHJ A;  1MNE A;  5L3B A;  4GYG A;  2RRE A;  3NI7 A;  2GXB A;  3LSG A;  2QQ9 A;  4B47 A;  1S72 I;  2DFF A;  4JX4 A;  4EEF G;  3RQ4 A;  2V57 A;  4NQW B;  4HV6 A;  4DBQ A;  3Q3S A;  3HTS B;  4HA8 A;  2Y75 A;  1S5L C;  3KLN A;  2PLY A;  2WAF A;  4I7H A;  1O3T A;  3Q5F A;  4GCV A;  2ZME A;  2XPV A;  2D5V A;  2HQN A;  3CJQ B;  4UDS A;  2LNB A;  1ZR4 A;  4PSX A;  5DEQ A;  1HW1 A;  2V1X A;  2ZME C;  1D5V A;  1F43 A;  2KP6 A;  3S93 A;  3JSP A;  3G1O A;  3MKL A;  4XLC A;  2VLA A;  3ZMZ A;  2IS6 A;  1B72 A;  4L0Z B;  3PQK A;  2UXN A;  3SXY A;  3WOD F;  5E3O A;  1ETQ A;  4ICH A;  2ZSH B;  2XGC A;  1GT0 C;  3KKD A;  3FXK A;  2CQK A;  4I09 A;  4PGH A;  1JI8 A;  1I1G A;  1ZHF A;  4IRG A;  2MGQ A;  4HNU A;  3PFI A;  3V8J A;  3CCR I;  3IAM 2;  2XF7 A;  2NRA C;  2V1D A;  4ENM A;  3NAU A;  3VYR B;  2V6C A;  4JL3 A;  1LDJ A;  2NVY J;  1Z6R A;  2ZXJ A;  1RR7 A;  1IW7 F;  1P4A A;  3LA2 A;  3TL4 X;  1IC8 A;  3BJA A;  1TTY A;  1SD6 A;  3CDI A;  5BQT A;  4RLQ A;  3HTJ A;  1R4N B;  3QAH A;  1ZN2 A;  3M8J A;  3I59 A;  2ELK A;  4E7S A;  3P9I A;  3BQZ A;  1J59 A;  1GV5 A;  5FKL A;  4A0Z A;  1BN5 A;  3K1N A;  4GXO A;  1O3R A;  4XLF A;  3RZO J;  4XBF A;  1WJD A;  5FKM A;  2XF6 A;  1U5T B;  4HX7 A;  5FRO A;  1B6A A;  3DP7 A;  1D0Y A;  1R5I D;  4W97 A;  3BQY A;  2CSO A;  3L09 A;  3LQQ A;  4KN7 X;  4P1W A;  4MHG A;  5DM7 F;  3ZCO A;  5LGN A;  2FJI 1;  1H88 C;  1R00 A;  2E1C A;  3FMR A;  4A0Y A;  4UNO A;  2ZFW A;  2XGD A;  1D8K A;  2XKP A;  3QYE A;  5IOY A;  2HTS A;  3MFK A;  3L2V A;  1PDN C;  3CLO A;  2CQX A;  2DA2 A;  3OIQ A;  3GTP J;  1MMN A;  4DZJ A;  3CO7 C;  2QZ8 A;  2QEN A;  3MEX A;  2ZY9 A;  2E7W A;  1OKR A;  2MH2 A;  1B8I A;  4GCK A;  3F8M A;  1E17 A;  2E2H J;  3VOX A;  1Z0X A;  3DBR B;  3F9K A;  3HB9 A;  3K4L A;  2W1O A;  3J80 K;  2ELH A;  3F8F A;  1X3Z B;  4XM3 A;  1J2X A;  4C30 A;  4ZYD A;  3OYM A;  5K5O A;  3JSO A;  3H3V K;  1B9M A;  2Q2E B;  3WE3 A;  2WC2 A;  3VOD A;  2DT7 B;  2QSG X;  2QVO A;  1ODD A;  1FPQ A;  2P5V A;  3VP5 A;  4QTR A;  1IGN A;  1XGO A;  3WGG A;  2BXZ A;  5LHH A;  1E0E A;  3VW2 A;  2ZBK A;  3DPU A;  5GP9 A;  1LNW A;  3ZP5 A;  4IKF A;  2VUM J;  3EQL F;  2LC2 A;  3A0H C;  3LA7 A;  5F0F A;  5E3M A;  4HEA 2;  2DYR H;  3ZGK A;  3CDH A;  3IH4 A;  2BYV E;  3CC2 I;  4CGR A;  1MJA A;  1R1U A;  2O9L A;  3FXL A;  2ISY A;  2G7S A;  4HNV A;  3WTZ A;  1FIA A;  1ETX A;  1JUM A;  4XMY A;  1XMA A;  3BTL A;  1TW3 A;  1OR7 C;  1TZL A;  1OYI A;  3DLA A;  4F3Q A;  3WGI A;  1KU3 A;  4L9N A;  5FRN A;  2FD5 A;  1IV6 A;  3W2V A;  1VQ9 I;  3S2W A;  3HIM A;  4JP0 A;  4WK8 F;  1JTY A;  1MMG A;  4AWX B;  5KHD A;  1ITY A;  3F1B A;  2LKX A;  1FEX A;  2XAS A;  2QBY A;  3SQN A;  2BY0 A;  5HNF A;  3JAM Z;  1QRY A;  3KP5 A;  2OTL I;  4IHV A;  4RGU A;  4AUX A;  4D7M A;  3EYY A;  1HXD A;  1E3H A;  3BCG A;  3JRE A;  3CCQ I;  2W00 A;  2NNY A;  4FQG A;  1MH3 A;  1RKT A;  2D1V A;  3V6G A;  1E2X A;  1S9H A;  4YEL A;  4ENJ A;  2EH3 A;  1ZK8 A;  1CGP A;  4AU7 A;  3VEP A;  3WG9 A;  2KIS A;  2QTQ A;  2QIB A;  3EDP A;  1S8N A;  2OQG A;  3ECO A;  3M1C A;  4L9J A;  4PSW A;  3KLO A;  2I8D A;  3ZR8 X;  3LSH A;  4LLG F;  3D5S C;  1VZ0 A;  3W2W A;  2PMZ A;  3JRG A;  1WVR A;  4EJV A;  3TGN A;  4MK6 A;  2HYF A;  1BJZ A;  4LJZ F;  2YS9 A;  1ACI A;  1J7K A;  3QOD A;  3IH3 A;  3L2U A;  4O3M A;  4RB1 A;  2JUG A;  2EA4 A;  2JVH A;  5J4V A;  2DLL A;  2FUG 2;  3V4G A;  3TED A;  4WX9 A;  5IP6 A;  2O61 A;  3VPR A;  2WGB A;  3I59 B;  3S3M A;  1N25 A;  3ZQL A;  1LEB A;  2EIK H;  3ABL H;  3NRG A;  1QGP A;  3E5Q A;  2H6B A;  3B6A A;  2CQQ A;  2K5C A;  5A2Q K;  2YUS A;  3LAP A;  2LD5 A;  3GTM J;  3RPU A;  1WJ5 A;  5B3S H;  4IZZ A;  2G0E A;  2GA2 A;  3B73 A;  3PFY A;  2PQ8 A;  2VPL A;  2HQ5 A;  2L7K A;  3ZMS A;  5LD2 C;  4I2O A;  2AS5 F;  4HV5 A;  1R5H A;  4HNT A;  1D5Y A;  5LGU A;  2L9R A;  4ZYE A;  3E0J B;  3M8F A;  4PZJ A;  4OWR B;  2A07 F;  2FX0 A;  3DCF A;  2BE5 F;  5F04 A;  2O3F A;  1MNM C;  3K70 C;  3E6D A;  2PFV A;  1MH4 A;  1JGS A;  4AVZ A;  1ZRE A;  2V6E A;  4RAF A;  4BEH A;  1IUY A;  5BS6 A;  2JMW A;  3W6J B;  4PJM A;  3K2A A;  4E7K A;  5D1R A;  1N75 A;  1P4W A;  1D1A A;  3A4C A;  1XC5 A;  1P7J A;  3K8P C;  2QQA A;  3BR5 A;  3J81 K;  3IRQ A;  1K6O A;  1BW5 A;  5IT3 A;  4BBS J;  1F1Z A;  2M8G X;  2PJR B;  2OCE A;  1ZH5 A;  1HDP A;  4U7B A;  2Y9Z A;  1V4R A;  3R61 A;  5IP9 J;  2HOS A;  4UB8 C;  3ZQI A;  1XGN A;  2GUH A;  2W48 A;  1W36 D;  4BXF A;  2KZG A;  3BC8 A;  4M73 A;  5D5W B;  4HLX A;  4KA4 A;  3S2D J;  2XGX A;  3K4K A;  1LE8 A;  1OCC H;  2XRN A;  2VKH A;  3RKX A;  3RPQ A;  4UUS B;  2K3P A;  3K7A J;  4CDG A;  2VAS A;  5D8K B;  1LB2 A;  2LVS A;  3UKG A;  3KX2 A;  4N0B A;  1ZRF A;  1BL0 A;  3I55 I;  5DUK A;  4A3K J;  5K7Z A;  4BE0 A;  3COL A;  2FOK A;  4EJW A;  3T8R A;  2M2E A;  3CJD A;  5KAI C;  4BXX J;  2LR8 A;  2OBP A;  4AC6 A;  3OOP A;  3OV8 A;  2IXS A;  3FXO A;  5JVG F;  1UEL B;  3ZN1 A;  1MMA A;  3HBL A;  3VYT B;  4CCL A;  2E5N A;  3CUO A;  2D45 A;  4XR6 A;  1HF0 A;  1OCZ H;  3JRI A;  2VJ4 A;  3C3W A;  3ON2 A;  4P55 A;  4A3I J;  4HYE A;  1KON A;  2OUM A;  2V9K A;  2TRT A;  3GYH X;  2HWV A;  1DUX C;  4Y52 J;  1O7L A;  3EUH C;  1OYW A;  3W6K B;  2F5V A;  3VOK A;  4Q47 A;  1V5F A;  2W4S A;  1MJB A;  3GZI A;  4HST A;  5H20 A;  4WXC A;  4LIT A;  1SFE A;  1XCB A;  4RBO A;  4KIG A;  4Z6Y A;  1Y0N A;  1I6H J;  5B5E C;  3WTX C;  2EWN A;  5C4X J;  3KYC B;  4MLO A;  4ZZL A;  2IA2 A;  4XKW A;  5GAG J;  3HTI A;  3CRJ A;  2HKX A;  2LY2 A;  2V9V A;  5J1U A;  5BNG A;  1W7P B;  2MH9 A;  2ZOZ A;  4NUB A;  1GXQ A;  5BPI A;  2W25 A;  2KIU A;  2VOP A;  3GUD A;  4GYI A;  2R5Y B;  4UUT A;  2YSR A;  4HKU A;  5CVR A;  4C2M A;  2KPM A;  2JVG A;  5CXI A;  2N8G A;  4EM2 A;  3BCB A;  2BBY A;  4LGW A;  1W5T A;  2GWR A;  2K9S A;  4AC0 A;  5FD6 A;  5CVJ A;  3DTI A;  5H9T A;  2PBX A;  2DCE A;  3BG7 A;  4E4H A;  4MIM A;  1W36 C;  2OZU A;  2LOO A;  3M9A A;  3L9F A;  4CCO A;  3VVX A;  3EUH A;  4IX7 A;  3T0Y A;  4ZH4 F;  2RAE A;  4UHT A;  5HS9 A;  4ZDO A;  2HDW A;  3BTI A;  2FMY A;  1D0Z A;  3NQO A;  2HU9 A;  2ZJP F;  2XSJ C;  4DYQ A;  2BVL A;  3PNT A;  4IQJ A;  2L4A A;  3LJL A;  5E3L A;  1TNS A;  2XB5 A;  3DFG A;  3GME A;  4G7Z F;  4Y3O A;  2L7Z A;  3H35 A;  4MEY F;  2DI3 A;  2VJJ A;  2V26 A;  3QQA A;  4G9Y A;  2VT3 A;  3WHC A;  1X1C A;  4RAG A;  4YFN F;  1P7I A;  2VQC A;  1HLV A;  4A0X A;  5KCM A;  3RYP A;  3BZ6 A;  2IA0 A;  1MBG A;  2KJC A;  5IYC J;  1U5T A;  3CCJ I;  1UCR A;  4KIS A;  1E3P A;  3KNW A;  1BI3 A;  4F91 B;  1ZGJ A;  1O7F A;  5EGO B;  5EEG A;  1SGM A;  2E1M B;  3BR2 A;  3RDI A;  3C2G A;  2YVX A;  4HZF A;  2MW8 A;  4ZTJ A;  2C6Y A;  2VC1 A;  1PVE A;  3HGG A;  3TO9 A;  4ITV A;  4BGD A;  1FBS A;  2P6S A;  2KRF A;  4KIT B;  3SZG A;  2CV2 A;  4ZYG A;  1A6I A;  2QKO A;  2M4K A;  1AKH A;  2L9V A;  4CHU A;  5HLH A;  4UVB A;  3RIR A;  2HI3 A;  3WE2 A;  5D5X B;  1IJW C;  2W53 A;  3E6B A;  2IJL A;  5CJ9 A;  3Q9V A;  1VF9 A;  3QWL A;  4IOC F;  3O8H A;  4ZTF A;  1HDD C;  4OIR F;  4CGZ A;  1I3A A;  2WB1 N;  4XKV A;  2DA6 A;  3BR0 A;  1HC8 A;  2RGV A;  4WCG A;  2X1E A;  3JRA A;  3Q9S A;  2ZC2 A;  2NVQ J;  2DA7 A;  2EV0 A;  1MDM A;  1Y8R B;  3K6G A;  3E7L A;  3HJE A;  4II3 A;  4KUM A;  5ICE A;  5EDN A;  3OYJ A;  3JRB A;  3CDL A;  4IRI A;  4PJN A;  2QWW A;  4NB5 A;  3E6C C;  4OIN F;  4A5M A;  4U0W A;  4AM3 A;  1MBE A;  2XIG A;  3ZQH A;  1QNT A;  2WAQ N;  1YS7 A;  1P92 A;  4HBL A;  3N97 A;  2EZI A;  4DZP A;  4LIU A;  3F23 A;  1I27 A;  3QYF A;  3HRM A;  1FLI A;  1V55 H;  3OYK A;  1O3S A;  3SYT A;  1WH5 A;  3Q0U A;  3L00 A;  3EUK L;  1JKP C;  1R1V A;  4LG3 A;  2D6Y A;  3WHB A;  2BXY A;  3DF8 A;  4B09 A;  3PL8 A;  3HHH A;  5EG0 B;  3OL4 A;  3PO2 J;  1X58 A;  4MTD A;  2K02 A;  3GWZ A;  2A6T A;  2XKO A;  3HHG A;  3GZN B;  3CJT B;  3R60 A;  2KRC A;  4NC8 A;  1U6G A;  1MGT A;  3BOQ A;  4FX0 A;  1UJ8 A;  2ZCM A;  3RKY A;  4W1U A;  3SEZ A;  3ASO H;  3S16 J;  2HGC A;  3R0A A;  2K9L A;  2NP5 A;  2K9Q A;  3FKJ A;  1ETK A;  2NS7 A;  4BL0 B;  2IPQ X;  3K0L A;  2DT6 A;  2DFE A;  2WA0 A;  2JA7 J;  1ZRC A;  3OYH A;  2B7E A;  1HW5 A;  3OS1 A;  1Z1D A;  3PO3 J;  1T95 A;  1TBX A;  3SZP A;  2TCT A;  4F7Z A;  1G3W A;  3FXJ A;  3LOC A;  1IZ1 A;  3ML6 A;  4UXN A;  2L4M A;  3RSN A;  2J5O A;  4BHC A;  3CCE I;  5J47 A;  3CCM I;  1FYK A;  5JR3 A;  2CQ7 A;  4HW0 A;  5K5R A;  3FX3 A;  4DOZ A;  2OF7 A;  4BE2 A;  3FZV A;  3SEQ A;  3T6N A;  1Y56 A;  3A1Y A;  3V42 A;  3OYE A;  1MND A;  2R5Z A;  3PJR A;  1D1C A;  2RQQ A;  4FX4 A;  4O5V A;  3CF5 F;  4IXA A;  2KIQ A;  2Q1Z B;  5FKN A;  3LNQ A;  2Z3Y A;  1KA8 A;  2HOT A;  3I4P A;  3G56 A;  4BEH B;  4I0B A;  3SJM A;  1TWG J;  2XAQ A;  3MQ0 A;  3I4N J;  5IOZ A;  2CFO A;  3K1P A;  2EV5 A;  3ZQF A;  3BP8 A;  2CGP A;  3G7R A;  5F64 A;  1BOB A;  2JWT A;  1LE8 B;  2X0L A;  5DD8 A;  1POG A;  5KVR A;  2JPC A;  4M9Z A;  1ZG3 A;  4BQO A;  3RH2 A;  1UFM A;  3TW6 A;  2M34 A;  2QWT A;  5LRS A;  2OCC H;  2G7L A;  3ANG A;  2Y30 A;  3PAS A;  4CA0 A;  4KMF A;  3IRR A;  1TP4 A;  4ZJZ A;  1WCM J;  1IDY A;  1VQM I;  2EZK A;  3V8K A;  4AYB A;  2BOL A;  3PSI A;  2NS0 A;  5BPD A;  3HKZ N;  4PCQ A;  4U9N A;  3HPH A;  2ELJ A;  3FWE A;  2YVE A;  3NNR A;  1YTY A;  3ZXS A;  2UV1 A;  3CUQ B;  5JHF A;  1IN6 A;  3VFZ A;  4DW6 A;  2FU4 A;  1OQY A;  3OYI A;  2HKO A;  1U2W A;  3F8B A;  3VB2 A;  1X3U A;  3N05 A;  4RS8 A;  3JAM K;  1OLT A;  4HG2 A;  2L54 A;  1ZR2 A;  5F27 A;  2XRO A;  2A68 F;  2CG4 A;  3VWB A;  3D0S A;  1HKS A;  3SFZ A;  3BPX A;  3DV8 A;  4EAT A;  2LYC A;  4C9Y A;  2ESN A;  5LEJ A;  2R93 J;  5DYM A;  1ENH A;  2VJI A;  1PUF B;  3FXU A;  4M3D A;  1T08 B;  4LK1 F;  5AIQ A;  2EQR A;  4UVC A;  3EET A;  1ON2 A;  5LFA A;  5LHI A;  2QEX I;  2DQL A;  4KWA A;  1G4D A;  2V9P A;  1RES A;  1UG0 A;  4LOC A;  4P96 A;  5C3E J;  2UXP A;  3NWT A;  1L3L A;  2KT0 A;  4OMZ A;  5J1Y A;  4BAC A;  1G6N A;  4XIC A;  2XSD C;  3BHQ A;  5AQC A;  2EPF A;  1R36 A;  3LFK A;  4XNF A;  1MMS A;  1AU7 A;  3GTK J;  2QUF A;  1S6L A;  1H9T A;  1VI0 A;  2GA1 A;  1BOA A;  1JXS A;  4C2U A;  2RNJ A;  5D6F A;  2ZOY A;  4XOP A;  1O4X A;  2OI8 A;  2A6E F;  3VSL A;  2OER A;  5EG0 A;  3RTR A;  4D5F A;  2UWM A;  1BI0 A;  4KDP A;  3VTI A;  3HSR A;  3AL0 B;  1FWZ A;  3HUG B;  4BXU A;  4ME9 A;  2JUC A;  1ETV A;  3J7Y J;  3IWZ A;  2QYO A;  2VT2 A;  4IHS A;  4MQV A;  1F4K A;  5F6F A;  5HDK A;  3LSP A;  5JFR A;  4XOT A;  3TW7 A;  1J09 A;  5A2Q Z;  4PXI A;  5D18 A;  3AKZ A;  2XC7 A;  2O03 A;  1WJB A;  2QF7 A;  2R7F A;  2P5K A;  1B4A A;  5H2F C;  2LK2 A;  1ZYR F;  2JJ7 A;  4ZDP A;  2NOG A;  5H6Q A;  1C0W A;  2CUF A;  3PUF A;  4GGG A;  2IAI A;  3K4C A;  4YFX F;  4A2U A;  3BWG A;  1WH7 A;  1WJA A;  3OS0 A;  3E7Q A;  2DTZ A;  2XF5 A;  4EM0 B;  2Y2Z A;  4BY7 J;  2R92 J;  2HVQ A;  3IHU A;  2K40 A;  2L9S A;  3DXJ F;  4IPA A;  4ABZ A;  4NNJ A;  3RI4 A;  3TDU C;  3LAJ A;  1YRN A;  2FEZ A;  3BY6 A;  2DA5 A;  1UHM A;  5M5Y J;  2Y48 A;  3KEQ A;  2GLO A;  5D5U B;  3WTT C;  1WI3 A;  2DMP A;  1X4O A;  4XRS A;  3RPU D;  2DW4 A;  3DKX A;  1RKW A;  3FIW A;  5K7F A;  2WY7 Q;  2CWE A;  2P6T A;  3KYL A;  2X6O A;  1OCT C;  2QSF X;  1SFO J;  4ZYH A;  2RN7 A;  3P9C A;  1VQL I;  1VQ5 I;  3JRF A;  3PNY A;  5B1B H;  3CC4 I;  2X85 A;  3E1S A;  2QCO A;  1KYZ A;  3HRU A;  1OIS A;  2R5Z B;  1G8X A;  2QGU A;  3P9T A;  4CYC A;  2WB1 A;  3L1P A;  1P9Q C;  4D0P A;  3BTC A;  2QA4 I;  2HYG D;  5FLX Z;  5FKK A;  1ZG1 A;  5LLQ A;  4LG0 A;  1FP2 A;  1SVL A;  4XON A;  1YYV A;  4CIC A;  5C4Y A;  3EUP A;  1MMD A;  3PNV A;  4V2F A;  2X1D A;  4EJU A;  3D1N I;  2CV1 A;  2H94 A;  4IQ4 A;  4KFC A;  2E7X A;  4QPO A;  2H8R A;  4OOI A;  4YRV A;  1MDM B;  4HDV A;  4M3F A;  1IV8 A;  2ESH A;  1ETY A;  2DPU A;  1W5S A;  3BT9 A;  1Z91 A;  3MCZ A;  3F8C A;  5DUI A;  3FBN B;  2UXI A;  2L9N A;  4CH7 A;  4P9U A;  2OC6 A;  4RAY A;  3PM1 A;  3A0B C;  4CZC A;  1T0F C;  3HC7 A;  1PJR A;  2OZ6 A;  3TO7 A;  2EV6 A;  4NBQ A;  1U78 A;  1MIJ A;  4RDU A;  4A3C J;  3DPJ A;  2O8K A;  2LY1 A;  3ZMD A;  3MKY B;  2JK3 A;  3G3Z A;  2QOP A;  4P9F A;  3W2A A;  1ONV A;  5K58 A;  3U1D A;  1R6R A;  3OYD A;  4U88 A;  3UNG C;  2DMN A;  1NK2 P;  2Z33 A;  4DYR A;  3I3L A;  1HOM A;  1JUS A;  2L7F P;  4RGR A;  4C3I J;  1V5E A;  1FYL A;  2MD5 A;  2ZB9 A;  2DA4 A;  3BCA A;  1W5C C;  2ZJR F;  5TGT A;  3G4S I;  4BJT A;  3CLQ A;  2DMU A;  1PUF A;  2PZ9 A;  2M3A A;  4M71 A;  1YI2 I;  4JOM A;  4MGR A;  2X48 A;  1WPK A;  3DPL C;  2M1B A;  4WXD A;  5AIP A;  1FMV A;  3ZRG A;  3BPV A;  2XRL A;  2MC4 A;  4CCM A;  3HZJ A;  1MZB A;  1U0J A;  4L5E A;  1UHS A;  5ILS A;  3OYN A;  3CWR A;  2A5Y B;  1BJA A;  2X1C A;  3WG7 H;  3TOB A;  1Z21 A;  3T5X A;  1RNL A;  3MZH A;  1Z05 A;  4G6T B;  4HSR A;  4HF1 A;  4WF2 A;  3S17 J;  1XSX A;  2P81 A;  2FNP A;  4BDY A;  3WTY C;  3GEZ A;  2ECC A;  2X6W A;  3HUG A;  1CQT A;  2VN2 A;  2FBK A;  3GLX A;  3CMM A;  5EEA A;  3K2Z A;  2NP3 A;  3ZQC A;  3QP5 A;  1WZ2 A;  2FBH A;  2ID3 A;  2J5P A;  2WV1 A;  3OY9 A;  2F4I A;  4U7D A;  3B81 A;  3CMY A;  2Q0O A;  1PP7 U;  3GCM A;  3RKW A;  1ZAO A;  3EUA A;  2A61 A;  2X6Y A;  3F6V A;  4WXH A;  2HYT A;  5EEH A;  1FJL A;  2OJE D;  2STW A;  1QHH D;  4HPQ A;  4F55 A;  1JT0 A;  5DV5 A;  3FK6 A;  5M5W J;  3ISP A;  4M72 A;  3BZK A;  1X1D A;  5FD5 A;  5EGO A;  1FT9 A;  4NN1 A;  3HTU A;  3FXQ A;  4DVY P;  2QLZ A;  3R4K A;  3FXR A;  3KE2 A;  4CCK A;  3CCU I;  2X51 A;  2M5W A;  2YPR A;  4M3B A;  2JA8 J;  2PMU A;  2AXL A;  2RQP A;  2CMP A;  2F48 A;  2FE3 A;  1FIP A;  4NEL A;  2DXI A;  4UB6 C;  2KFD A;  1QHG A;  2K4J A;  1XDU A;  5FLV A;  3V78 A;  1XMK A;  2ISZ A;  3ANP A;  2LF7 A;  1LFB A;  2LDU A;  4Q48 A;  2EZH A;  5GTH C;  1AA7 A;  1DGW Y;  4G6D A;  3K10 A;  2ZJ2 A;  3FIS A;  1HKT A;  3G71 I;  1ZLJ A;  2DU9 A;  1XN7 A;  3H5A A;  3HIF A;  2MG4 A;  1XMX A;  3ECH A;  2YVH A;  2CUJ A;  1B59 A;  2WAD A;  1IF1 A;  4ZC3 A;  4YII A;  2DPD A;  4EMS A;  2K86 A;  4YFK F;  2RNG A;  2G7G A;  1WKM A;  4AID A;  2MYS A;  1BR2 A;  1USS A;  3DU6 A;  1MSF C;  2FSW A;  2BV6 A;  2VOD A;  2VB6 A;  2JRM A;  3K70 D;  1RIO H;  2IW5 A;  2GOX B;  1X1A A;  4Q4Z F;  4A3M J;  3VVZ A;  2WV0 A;  1HBX G;  1YW9 A;  2FQ4 A;  3TOA A;  5LHG A;  1RPW A;  2E2J J;  3SZT A;  2FXA A;  3PSF A;  1A31 A;  2ZCN A;  4AIJ A;  3BRU A;  2BZT A;  2BY3 A;  4LMY A;  3ABK H;  2R7V A;  5E18 F;  1HCR A;  1I6X A;  5IT9 Z;  2IRF G;  3TDZ C;  1K4S A;  4EJO A;  4N9I A;  1ETW A;  2XHK A;  4GFL A;  2L2O A;  2CFX A;  3I0T A;  2VKE A;  2FNA A;  1SVO A;  4HQE A;  3M8E A;  2G7U A;  4XN3 A;  2G7H A;  1Y0U A;  1F9N A;  3AQS A;  4ANJ A;  1LKX A;  2V79 A;  3MZ8 A;  3WU1 B;  3LFU A;  4S05 A;  4L9T A;  3L2C A;  1MBF A;  1AOY A;  4A12 A;  1YJW I;  2DMT A;  4M3E A;  1FBU A;  1VTN C;  3QRF F;  2IS4 A;  1SEU A;  1LFP A;  1NG7 A;  3DPT A;  3HYI A;  2FQ3 A;  4RLF A;  1F5T A;  4ON0 A;  1K7A A;  1QU3 A;  2JT1 A;  4IHT A;  1TL8 A;  4E70 A;  2PMZ N;  2M4G A;  2VBW A;  2LTP A;  4DNC A;  1DGR M;  2W24 A;  3G2B A;  3O3K A;  4JNN A;  3AL0 C;  1EH7 A;  3PPB A;  3R0J A;  4M3G A;  3GTO J;  3GFJ A;  2PEX A;  3QPT A;  1WQ2 A;  1TQP A;  1W0T A;  2MFZ A;  2W57 A;  4C2M J;  4Y13 A;  1GV2 A;  3FXM A;  3RJP A;  2Z1D A;  3FMS A;  3S3O A;  2OAZ A;  4GCT A;  3QU3 A;  3BNI A;  2LP0 A;  4B4C A;  2FBI A;  3Q0W A;  3LWJ A;  3ZQG A;  2XAF A;  3COA C;  2DFH A;  1KU2 A;  3VW1 A;  4K2E A;  2K7L A;  4JK1 X;  4RGX A;  3CME I;  3P7N A;  3BJ6 A;  5GAE J;  1U9O A;  1UZC A;  1V54 H;  4JX5 A;  4ESF A;  1YG2 A;  1ZTR A;  4M9S A;  4BKX A;  4OD4 A;  4KN4 X;  2CUZ A;  2IU5 A;  3OS2 A;  3KZZ A;  2GBY A;  1MJ9 A;  2JZY A;  3VDX A;  2JSC A;  1K79 A;  3RYR A;  1LVK A;  1SD7 A;  5M3F J;  1B8I B;  5BMZ A;  5CVU A;  1WRJ A;  3OYB A;  2B9S A;  2H8W A;  1KU9 A;  2UZK A;  3OYL A;  4BBR J;  1KGS A;  4IF4 A;  4G7H F;  1QVU A;  3I56 I;  3QKX A;  2PFB A;  3M3Y J;  4G6Q A;  1BIB A;  2MAB A;  5D5V B;  5FFZ A;  3DBH B;  2V4J C;  4XRF A;  1DP7 P;  1AWC A;  3HDD A;  2I10 A;  4XL9 A;  3L2W A;  3H36 A;  4L5J A;  3VIB A;  2A69 F;  2HYJ A;  2O7T A;  3U2R A;  5FMP A;  1G3S A;  3LQR A;  2R4G A;  3H9G A;  3CJN A;  2HZT A;  3TMO A;  1D0X A;  2P5L C;  3NXC A;  2H1L A;  5E1X A;  3OYC A;  1DPU A;  2QSH X;  3C1D A;  2P7C B;  4CYC B;  2GFN A;  4V2G A;  1O3Q A;  4MFD A;  4AYB N;  3BR3 A;  3V7C A;  2O5R A;  4J01 A;  1XS9 A;  2IGO A;  2JN6 A;  4GFB A;  5EZG A;  1JGG A;  1XSD A;  4KIC A;  4I76 A;  3ZMV A;  5GAD J;  5KAF C;  3PIP F;  1RUO A;  1K83 J;  2RDP A;  2DOA A;  2VL8 A;  2Q24 A;  4XLE A;  1NK3 P;  3U1K A;  3HSF A;  2R7T A;  2B63 J;  1VFC A;  4XLA A;  5TRD A;  2NXN B;  3RZD J;  2LSO A;  1B72 B;  3IC7 A;  2F07 A;  3QOE A;  3GTG J;  1TWA J;  3L2R A;  3IWF A;  1ZG5 A;  1WJF A;  5FJ8 J;  3H92 A;  2Z9O A;  3CUQ C;  1TNT A;  2HTJ A;  2IA1 A;  5ICG A;  4NDL A;  3C2H A;  4EV0 A;  2IP2 A;  2PG4 A;  4BS9 A;  4A6D A;  2ICW G;  2NVU B;  5DAJ A;  4DQ2 A;  5F1R A;  2IGK A;  3F3X A;  1VQP I;  5E17 F;  3MKZ A;  4LK0 F;  1MD0 A;  3GX4 X;  4F93 B;  4BQQ A;  1H89 C;  2B0L A;  4QWQ A;  5L3C A;  2QBY B;  3HGY A;  3K4J A;  4JYK A;  1ZQ3 P;  1H0M A;  1EV7 A;  5HS8 A;  1QVT A;  3ERM A;  1NG6 A;  1Y8Q B;  5DCM B;  2V7F A;  1Z77 A;  2UXX A;  4D7N A;  4OD5 A;  2EK5 A;  2DO7 A;  3CD6 I;  2H27 A;  1R7J A;  1P2F A;  2CS3 A;  2EFN A;  3O6B B;  2XDN A;  3HM5 A;  1T6S A;  1BA5 A;  4PK4 A;  4MTE A;  3FK7 A;  1APL C;  5E79 C;  2DJI A;  1ZGW A;  4Y33 A;  4BNC A;  1YRN B;  2FA5 A;  3GTJ J;  1U3E M;  3IP4 B;  3TO6 A;  4D5C A;  2Y0M A;  1SMT A;  1D8J A;  1JKO C;  2GZW A;  1ZKG A;  3H5N A;  1JKR C;  3HRT A;  4F52 A;  2GOM A;  3S1R J;  3N4M A;  2DDA A;  2M0C A;  3TQN A;  1STZ A;  1REP C;  2XUB A;  4ZYA A;  1VQ4 I;  2AO9 A;  3OWT A;  5FLX K;  3SDG A;  2MBF A;  3JCU C;  2K9N A;  4QLC U;  3TKY A;  1Z3Y A;  3BG3 A;  1R9T J;  3C7J A;  1T39 A;  3VVY A;  3CF2 A;  1MKM A;  2XAU A;  4PFO A;  3RKQ A;  3Q0V A;  3ZMU A;  2GQQ A;  3OL3 A;  2R7Z J;  1YO5 C;  3S1N J;  1BR4 A;  2UXO A;  3D5R C;  1CF7 B;  4XLP F;  1QPI A;  3I9V 2;  3A2K A;  1X1B A;  1X2M A;  1EKE A;  4L0Y B;  1G2H A;  1BBY A;  3HPG A;  1MW7 A;  1KQ9 A;  1RC9 A;  5TIS C;  1EF4 A;  2HQA A;  4FTH A;  4PGG A;  5D6E A;  3OYF A;  1OR7 A;  3S14 J;  4FET A;  4L9V A;  1SD5 A;  1R58 A;  4C3J J;  5D4S A;  3KIO A;  4LG0 B;  1F36 A;  3ESW B;  3VYS B;  1V5G A;  1D3Y A;  3ONQ A;  1FYM A;  4C2T A;  4E7J A;  5GPC A;  1L0O C;  1LQ1 A;  4QPQ A;  1UI6 A;  4FHT A;  4XN0 A;  1EH6 A;  1UMQ A;  4A3J J;  3C07 A;  1SFU A;  3HOY J;  4I02 A;  2DFI A;  4CCN A;  1UAA A;  2Q8K A;  3CP8 A;  1AHD P;  2LY9 A;  1ERD A;  1IRF A;  1LEA A;  2F4M B;  3IUO A;  4MXM A;  3DQV C;  2DK5 A;  3J7Z I;  4WIB A;  2ZKZ A;  2R7S A;  4YIR X;  1Q1H A;  1BIA A;  1GVD A;  1ULY A;  4MEX F;  3H0D A;  2YU9 J;  3KZ9 A;  3KP4 A;  3QBM A;  2F6C A;  2XB0 X;  3DEU A;  3M07 A;  3LSK A;  3S2H J;  3SFI A;  4I6Z A;  1LPQ A;  4KT6 A;  3LSI A;  5GTI C;  5D8L B;  3VUQ A;  5J4Y A;  1FNN A;  4Y15 A;  3IKT A;  4I01 A;  3OIP A;  2CYY A;  2PJR A;  1OMI A;  2ZME B;  1Z3X A;  3QYB A;  3FDY A;  1YIT I;  4FE7 A;  3LMM A;  2BHZ A;  1A04 A;  1K78 B;  3F6O A;  4PJL A;  2MLG A;  1IUF A;  2PMH A;  5DTD A;  3I58 A;  2BY2 A;  1JHH A;  1U8R A;  2QQB A;  2H1K A;  2W82 A;  3CZ6 A;  5DD4 A;  1T2K A;  2VPR A;  1OCR H;  2R7X A;  2HFH A;  1T0F A;  4NC7 A;  2XV4 S;  3EPZ A;  2ME6 A;  1BC8 C;  1R1T A;  2E1M C;  2H6C A;  5HSZ A;  2LRD A;  2L01 A;  1J9I A;  3RCO A;  1K78 A;  2MSY A;  2F4O B;  2D1H A;  2VON A;  2BY1 A;  5JI6 A;  3OR2 C;  1YX5 A;  3V7S A;  3GW2 A;  2VQL A;  2X4H A;  1Y1W J;  2ZXH A;  2K85 A;  4A3D J;  1P6R A;  1W4M A;  2EFP A;  1GUU A;  2KJB A;  3KP6 A;  2XDV A;  3GFI A;  3FKI J;  3K9T A;  1OPC A;  1I5Z A;  3HOS A;  3VYU B;  1LFU P;  1BI2 A;  1LUJ B;  3WU0 A;  3V7R A;  2ECB A;  5JLX A;  2L7M P;  3E5U A;  3BG5 A;  3U21 A;  3WTS C;  1TC3 C;  3F21 A;  4BHP A;  4X6A J;  3KZI C;  3E97 A;  4HDU A;  1FMW A;  5GAH J;  4UVA A;  2DOF A;  2ACJ A;  3ZMT A;  3BR6 A;  2I5U A;  2VQG A;  4X0G A;  2QQ8 A;  3ZN0 A;  2HOA A;  2WUI A;  3V8L A;  4JQF A;  2Y69 H;  1RR8 C;  2LMD A;  4H4K C;  3PQJ A;  2R7R A;  5L3E A;  1X4P A;  4ENN A;  2H09 A;  3BRO A;  4QSH A;  2RHA A;  2ZXW H;  4G7O F;  2HKU A;  1R5G A;  5F1J A;  5L3F A;  2DA1 A;  5M3M J;  2XAJ A;  2LFB A;  3NEU A;  2DTR A;  4HF2 A;  2FML A;  5ERI A;  4ASN A;  3JSJ A;  2WAQ A;  2Y9Y A;  4UV9 A;  2E19 A;  2CJJ A;  2EIL H;  3CJR B;  2BVM A;  1J0R A;  1FC3 A;  4DBR A;  3D5L A;  3OIO A;  1RRJ A;  4DGW B;  4B3A A;  3NAR A;  4D1Q A;  2L0K A;  4N4O B;  3GZ6 A;  2JA6 J;  1IRZ A;  2R7U A;  2E1N A;  4IOA F;  1BC7 C;  2Q2E A;  4PUS A;  2EFO A;  3H5R A;  1G3T A;  4LIV A;  3BDD A;  4CO8 A;  5E3N A;  1B9N A;  2EZL A;  5J1R A;  5EZH A;  4JKZ A;  2NYX A;  4OU0 A;  4J19 A;  3HOU J;  3M4O J;  2DYS H;  2M30 A;  3NRV A;  1FX7 A;  1IRX A;  1SAX A;  3KEY A;  3MAJ A;  2VBX A;  4X1E A;  2P7V B;  3K4B A;  4JBA A;  3G1L A;  3EGQ A;  2DJN A;  4BH9 A;  1VQ7 I;  4R8H A;  2VE9 A;  2DBB A;  5B1A H;  1FOK A;  3DBL B;  1YW8 A;  3BG9 A;  1SC7 A;  3H3Z A;  4BJ6 C;  1FY7 A;  2JTV A;  5IYB J;  3QU6 A;  2VJ5 A;  2CW8 A;  3ROU A;  5HDN A;  2COB A;  4U0Y A;  1JE8 A;  3LHQ A;  1BM9 A;  2Z16 A;  3HE0 A;  1W0U A;  5FFX A;  3KFW X;  2ZNY A;  4ZDL A;  4XRM A;  1IN5 A;  1IXR C;  4E7Z A;  4S04 A;  3LL7 A;  4BUP A;  3AG2 H;  2A5W A;  2CU7 A;  5L3G A;  4Y17 A;  3DKY A;  1XSV A;  5FB2 A;  4OAY A;  3GTQ J;  5HLT A;  4WWC A;  1S29 A;  2RAS A;  5DM6 F;  2E36 A;  1FTT A;  1R49 A;  4BY1 J;  2GAU A;  2KKO A;  1ORK A;  4E7L A;  2MA3 A;  2ZCW A;  4E7H A;  2CW7 A;  2WBM A;  4OMY A;  2HZD A;  1HKQ A;  2A3S A;  1I3Q J;  1X3W B;  2E1O A;  2KHM A;  2TDX A;  4A6E A;  3HG9 A;  4M6V A;  5HOO A;  4ZZD A;  5EJC A;  3WTW C;  2PJP A;  3O2P E;  1VND A;  1JUP A;  2GIZ A;  4N9H A;  3KKC A;  3WTU C;  3HXL A;  2HEO A;  3K69 A;  1U5T C;  2EIM H;  2O8X A;  4XID A;  3OOU A;  4LFU A;  5HLI A;  2E2I J;  4RA2 A;  1WWX A;  1Z7U A;  1KU7 A;  4I0A A;  3MMY B;  2JQ7 A;  2REK A;  3S15 J;  2CRG A;  2EIN H;  2R0Q C;  3MKW B;  1MBH A;  1WFX A;  3S32 A;  3HOT A;  5CVI A;  1WJE A;  1GLN A;  4BJ5 C;  2K3F A;  2AHQ A;  1A6Q A;  3JTH A;  3ERE D;  1FP1 D;  5DS9 A;  4A3B J;  4L62 A;  3E3V A;  3B02 A;  3REO A;  1U9N A;  1FSE A;  5CLS A;  5AON A;  4PJJ A;  5FLM J;  5CXG A;  3DEW A;  4HX8 A;  2IBD A;  3BG6 A;  2EIJ H;  4PFP A;  4Q5S F;  2RV8 A;  1OYY A;  2LKS A;  1VQ6 I;  4AIH A;  5JVT A;  3F0C A;  3A01 A;  3I71 A;  4AIK A;  1N78 A;  4P5O A;  1QO0 D;  2XPU A;  2M9H A;  3KET A;  1EJ9 A;  1YE9 A;  2E60 A;  1HQC A;  3TP3 A;  4CCJ A;  3L2Q A;  1LDK B;  3F22 A;  5E1Z B;  3G6E I;  2W7N A;  1JHF A;  5E1W A;  2HXI A;  5KK1 A;  3T1B A;  2XAG A;  5K5Q A;  1Z6T A;  3HL2 A;  2BGC A;  5CVV A;  1KQ8 A;  1IDZ A;  4RMN A;  2L3D A;  4KIB A;  2CV0 A;  1K61 A;  3DTE A;  2B1E A;  1J5Y A;  1XD7 A;  2PBI A;  5LEK A;  2HXO A;  2QKM B;  3JRD A;  4ENK A;  2R7D A;  1VQO I;  1YIJ I;  2WAE A;  4E6K G;  1RET A;  2RKH A;  2WWY A;  1IXC A;  5IY5 H;  2HDC A;  2JPB A;  1U8B A;  4XQF A;  2VC0 A;  3ZQQ A;  1IXS B;  4UUS A;  1WHU A;  3HKZ A;  2LKP A;  4U0V A;  5HBU A;  4KMU X;  4RM3 A;  2ZCX A;  2NS8 A;  2OTJ I;  2NOJ B;  1XG1 A;  2A05 A;  2VI6 A;  3KYD B;  3AQT A;  4M6X A;  5HAW A;  2F5E A;  5LRR A;  1JJ8 C;  1IN8 A;  3S1M J;  3I54 A;  1XDS A;  2KIF A;  3KPH A;  4EM1 A;  1YJN I;  2GXG A;  1JKQ C;  5TJJ A;  2OA4 A;  1YX3 A;  1G59 A;  2M45 A;  3AG3 H;  3GFL A;  3MVP A;  4IRH A;  2DN0 A;  4RM2 A;  3ZQ7 A;  1T56 A;  2X9D A;  2YX7 A;  4OAZ A;  2GEN A;  1P4X A;  1QZY A;  2IEK A;  2HDD A;  2OQR A;  2BW3 B;  2R7Q A;  3BZC A;  3JR9 A;  3JW4 A;  4CUG A;  2DMQ A;  5E20 A;  1ZRD A;  2D2W A;  3IAS 2;  1W7P D;  1KYW A;  4I98 B;  3CUQ A;  4B44 A;  2G3B A;  3MN2 A;  3J80 Z;  4RB0 A;  2VKV A;  2M7A A;  4EQQ A;  3KP3 A;  1PYV A;  4RB2 C;  5CPR B;  4A69 C;  2AQE A;  1JT6 A;  2E35 A;  2Y0S N;  2M7B A;  5B66 C;  3JRC A;  3IV5 A;  2HNH A;  4FIS A;  2BHY A;  4A93 J;  2HPI A;  2QKL B;  1XTA A;  2CQN A;  2LLK A;  2VKD A;  4LB6 B;  2NVT J;  3QP6 A;  2V1U A;  2DQR A;  1TQI A;  4UV8 A;  4XSX F;  4XLH A;  3M7G A;  4PJ0 C;  5HNH A;  2FF4 A;  4BQA A;  4OIO F;  2FBQ A;  5JLW A;  4DJA A;  1TW2 A;  4RB3 C;  4IHW A;  4MFE A;  3CQZ J;  3VW0 A;  4M74 A;  3GXO A;  3K4N A;  3PUB A;  2ZNZ A;  2DDB A;  4XKC A;  4IO9 F;  1ETO A;  5IP7 J;  4RAZ A;  1XX5 A;  1Y39 A;  3EYI A;  5DCM A;  1UI5 A;  3E6M A;  4H0E A;  4IJA A;  3X2Q H;  1TT5 B;  1FSH A;  2HS5 A;  1O57 A;  4U87 A;  2DG8 A;  4CZZ A;  5HS7 A;  1R23 A;  3IL2 A;  1UG2 A;  5F08 A;  2Y31 A;  1ZAR A;  4B48 A;  2VXZ A;  5FO5 A;  2K27 A;  3QPS A;  1I39 A;  4MQ9 F;  2HVR A;  3O8G A;  2UUZ A;  2DK8 A;  4DIQ A;  4BQN A;  5ILV A;  1OCO H;  2ADU A;  4IHX A;  3CO6 C;  3I53 A;  5CQG A;  5EF6 A;  4N4N B;  1WSU A;  3U9G A;  3ZOB A;  1Y1V J;  2R3S A;  2Z5U A;  2IGM A;  1IO2 A;  1EA3 A;  3H9J A;  2Y0S A;  3A01 B;  4LB5 A;  5F0H A;  3K1M A;  2KL4 A;  5JHU A;  2F5C A;  3RQI A;  4LD5 A;  2IT0 A;  3HOW J;  5E8G A;  3SHF A;  3B6C A;  2LH9 A;  2DAO A;  2QM3 A;  5CW8 A;  1BR1 A;  2MD0 A;  3LA3 A;  1TWH J;  1CF7 A;  3BJO A;  1ZEL A;  3GFM A;  2ZO4 A;  2JA2 A;  5LGT A;  5ED4 A;  4BAY A;  3GO5 A;  2OU2 A;  2AQF A;  4IEJ A;  4EGY A;  1X19 A;  2IS2 A;  4IVN A;  1KQ0 A;  4BU2 A;  2NVX J;  3FHZ A;  3T8T A;  2L02 A;  4G8X A;  2EJR A;  3GVA A;  2JRT A;  1LJ9 A;  2DOD A;  1DPR A;  4HF0 A;  2NAZ A;  3AG1 H;  3P5J A;  1IRG A;  2NX4 A;  4HLY A;  2FOW A;  4M6Y A;  1IN7 A;  4HOB A;  3WTV C;  3J7A Y;  5J40 A;  1RI7 A;  1SAU A;  4ESB A;  1A35 A;  2GXA A;  2E34 A;  5L3D A;  3R6S A;  1GDT A;  4YIF A;  4II2 A;  1T33 A;  5HDG A;  1R71 A;  2YU3 A;  4EJT A;  3IH2 A;  3AFH A;  4QIW N;  1J75 A;  1IAW A;  2W85 A;  4A3F J;  3S1Q J;  2ETH A;  4EGZ A;  3PIO F;  3UR3 C;  4XK4 A;  1QA6 A;  3A02 A;  1FBQ A;  4E7I A;  5ICF A;  2O7O A;  1R22 A;  2HQR A;  1XGM A;  5BOX A;  2DT5 A;  3CES A;  3KP2 A;  4A3E J;  2HOE A;  1XB4 A;  1YIO A;  3A03 A;  2XVC A;  5J8C A;  1QZZ A;  3W6V A;  3HTA A;  2XAH A;  4GFK A;  3MNL A;  2ZXI A;  5E8I A;  1X2N A;  1YQA A;  4AD9 A;  2FJ1 A;  1Z67 A;  1B1B A;  1OFC X;  3ABU A;  4F92 B;  3KZY A;  1FOX A;  5CQE A;  2K4B A;  5DDG A;  2KRH A;  3MD2 A;  2DA3 A;  3BLY A;  3HEF A;  1OJL A;  2WY8 Q;  6PAX A;  1H8A C;  4A5N A;  1BW6 A;  2KDZ A;  3CCL I;  3FRQ A;  2VIX A;  3NS4 A;  2CO5 A;  5ICC A;  1DDN A;  1TT0 A;  2M0M A;  2HPM A;  4GDF A;  4PDK A;  2YX4 A;  5J6X A;  2EB7 A;  3S8P A;  3OMY A;  1ON1 A;  2HVS A;  1WGX A;  4FT8 A;  5DCF A;  3F72 A;  3ABT A;  2EBI A;  2KLO A;  4G94 A;  3LSR A;  5FRM A;  1XPX A;  3JTG A;  3HOX J;  3DLL F;  3FHN A;  5EYR A;  3AG4 H;  2L5Q A;  3F8N A;  1QPM A;  2OV7 A;  2YR2 A;  3H9Q A;  5HVQ C;  4FCY A;  2F5D A;  5FKO A;  5K7H A;  4O6J A;  3NPI A;  1HSJ A;  4Y4R A;  3QOP A;  4XLN F;  2JA5 J;  5IT9 K;  2UXU A;  3DKW A;  2O6G E;  1UHW A;  4IL6 C;  3DU5 A;  1GXP A;  3S3N A;  1LVA A;  1H9G A;  2AXT C;  1D1B A;  1W1W E;  2PX9 A;  1JTX A;  3HOV J;  4AF5 A;  3DTK A;  1MBK A;  4R1H A;  4B1R A;  3CCY A;  4CSW A;  2PN6 A;  1YW7 A;  3CP2 A;  2R7O A;  2IGN A;  4UY8 I;  4NC6 A;  1DP3 A;  3L7W A;  2LRE A;  5C4J J;  1TWF J;  3ZPL A;  2KDO A;  3FM5 A;  1Z9C A;  2OD5 A;  4ACI A;  3LST A;  3CCS I;  1K6Y A;  3CMA I;  4CXF A;  1IN4 A;  5IYD J;  3KP7 A;  2F2E A;  2VBY A;  3NWS A;  2O0Y A;  2MLK A;  1MBJ A;  3WGH A;  3DWL E;  2VOO A;  3MWM A;  1QZE A;  2JSP A;  2A2F X;  5EFY A;  2WTE A;  4RGS A;  3TP0 A;  4DYC A;  3K4M A;  1KZH A;  4KT5 C;  2X6X A;  2K9M A;  2OPT A;  3GLL A;  3KCC A;  5FHP A;  1T98 A;  1WJC A;  3MZY A;  1T8I A;  2ZSI B;  1FTZ A;  4B43 A;  1LDD A;  4L5I A;  2Z99 A;  1I50 J;  4GO1 A;  4MNU A;  1GVJ A;  3C2B A;  4YZE A;  2KZV A;  1FOW A;  3M1E A;  4B8X A;  2VBZ A;  3GF2 A;  2MC3 A;  1FZP B;  2VXD A;  1QQI A;  2STT A;  1WI9 A;  2R7W A;  4V19 K;  3ON4 A;  1SAN A;  4A3G J;  5D19 A;  4HX4 A;  3AAF A;  5KNL A;  1YJ9 I;  2F5F A;  3I5U A;  2LBF B;  3WU2 C;  2XGE A;  1I1S A;  1HA8 A;  3LWF A;  3GBG A;  3VOE A;  2DOE A;  4ESJ A;  3BJB A;  5FGL A;  4S0H B;  2E71 A;  3FBI B;  4IHY A;  3OYG A;  1N77 A;  2V1N A;  2BEO A;  2VQH A;  2VE8 A;  5HLG A;  3BR1 A;  4IRV A;  1YLF A;  1OCP A;  5LBQ A;  1NTC A;  1M1E B;  2B3W A;  1R4M B;  2CH0 A;  1HW2 A;  3G73 A;  5CKT A;  1SD4 A;  2NNN A;  5CYV A;  4XRS G;  9ANT A;  3HOZ J;  5D4R A;  3C18 A;  4R79 A;  3IUV A;  3IKV A;  4KNY A;  3I64 A;  3J7A O;  1BI1 A;  2COM A;  2LF8 A;  4C3H J;  1JJ6 C;  1ZLK A;  3OYA A;  4AVP A;  4Z2Y A;  2CW0 F;  1EH8 A;  1SFK A;  1VQN I;  3CCV I;  4D9J A;  4HAM A;  3ABM H;  2G9W A;  3H0G J;  4Y7N J;  5K1Y A;  2P8T A;  3DEE A;  2ZFU A;  3CC7 I;  3P9K A;  1A36 A;  1S7A A;  1MSE C;  4MO7 A;  1SVM A;  1FOY A;  2ZJQ F;  3VSK A;  4OIQ F;  3RD3 A;  3OR1 C;  1DQU A;  3GTL J;  2CUE A;  4J00 A;  2HR3 A;  2UXH A;  3KEO A;  4GCL A;  1Z7L A;  2BW3 A;  3ELK A;  1S7O A;  1W7P A;  4HQM A;  3I4M J;  4XKB A;  1IG7 A;  3HRS A;  5C44 J;  3QPH A;  2RVC A;  3BTJ A;  1S3J A;  3ULQ B;  4L18 B;  5IPA A;  1YHQ I;  2GM4 A;  2EFQ A;  1GHC A;  1G3Y A;  4A3L J;  4BYY A;  4BHB A;  3FM3 A;  4KJZ A;  3HTH A;  2EFW A;  4KIF A;  4LLL A;  1VQK I;  3CTA A;  4OIP F;  3OSG A;  5ILU A;  2W84 A;  1TWC J;  1HST A;  5F0C A;  3LSJ A;  1T38 A;  2RC4 A;  4GRI A;  4YG2 F;  4UUV A;  1RZ4 A;  4XOR A;  2DG7 A;  4EVI A;  5M5X J;  2M87 A;  1PP8 F;  4KYW A;  2M8E A;  1YFH A;  1UST A;  1NHA A;  3OSF A;  2GIV A;  1PUE E;  1TLH B;  2IS1 A;  4CYD A; 
#chains in the Genus database with same CATH homology
 3BR2 A;  1MSF C;  2MW8 A;  3HGG A;  4XID A;  3O60 A;  3OOU A;  4A3M J;  2E2I J;  3VVZ A;  1DU6 A;  2R5Y A;  1E3O C;  2FQ4 A;  1RPW A;  2REK A;  2E2J J;  3QPL A;  1Q1V A;  3S15 J;  2CRG A;  1A6I A;  2R0Q C;  2QKO A;  1MBH A;  1AKH A;  3GEU A;  2ZCN A;  3BRU A;  1S7E A;  2HI3 A;  2W53 A;  1IJW C;  2AHQ A;  5J3L A;  1HCR A;  4A3B J;  1VF9 A;  2ID6 A;  3O8H A;  5DS9 A;  3G1M A;  1HDD C;  4L62 A;  2XPW A;  2WB1 N;  2DA6 A;  3BR0 A;  1U9N A;  2ME0 A;  4GFL A;  1ETW A;  5FLM J;  5CXG A;  3DEW A;  2IBD A;  2VKE A;  3JRA A;  2NVQ J;  2DA7 A;  4JX6 A;  3E7L A;  5EDN A;  1AKH B;  1A5J A;  3JRB A;  3CDL A;  3AQS A;  3F0C A;  4G12 A;  3A01 A;  3S5R A;  2XPU A;  2M9H A;  1MBF A;  5GPA A;  1MBE A;  4FE4 A;  3TP3 A;  3ZQH A;  2WAQ N;  2DMT A;  4M3E A;  1DU0 A;  2EZI A;  4DZP A;  2HXI A;  1WH5 A;  3Q0U A;  1JKP C;  5HOD A;  3JRH A;  2PMZ N;  2D6Y A;  3WHB A;  1K61 A;  2LTP A;  3NI7 A;  4JNN A;  3LSG A;  3PPB A;  5EG0 B;  3JRD A;  2HXO A;  4JX4 A;  4M3G A;  1X58 A;  4EEF G;  3GTO J;  3PO2 J;  1RET A;  1W0T A;  2V57 A;  1U8B A;  4C2M J;  1GV2 A;  3Q3S A;  2ZCM A;  4UUS A;  4GCT A;  3BNI A;  4W1U A;  5HBU A;  2LP0 A;  3S16 J;  4B4C A;  2NP5 A;  2ZCX A;  3Q0W A;  2NS8 A;  3ZQG A;  3LWJ A;  1XG1 A;  2K9Q A;  2VI6 A;  1ETK A;  2NS7 A;  3AQT A;  2XPV A;  3VW1 A;  2D5V A;  5HAW A;  1JJ8 C;  4UDS A;  1ZR4 A;  3S1M J;  2JA7 J;  1F43 A;  1U9O A;  4JX5 A;  3G1O A;  3MKL A;  1ZTR A;  3PO3 J;  4BKX A;  1JKQ C;  1B72 A;  2TCT A;  2IU5 A;  3LOC A;  2GBY A;  1ETQ A;  3MVP A;  5E3O A;  4ICH A;  2DN0 A;  2XGC A;  1GT0 C;  3KKD A;  5M3F J;  1B8I B;  1T56 A;  2X9D A;  2GEN A;  2IEK A;  2MGQ A;  2HDD A;  2OF7 A;  3JR9 A;  4BBR J;  1QVU A;  3QKX A;  3NAU A;  3T6N A;  3M3Y J;  2DMQ A;  2R5Z A;  4JL3 A;  2NVY J;  1RR7 A;  1IC8 A;  2G3B A;  3MN2 A;  2I10 A;  3HDD A;  5FKN A;  2VKV A;  3LNQ A;  3VIB A;  3HTJ A;  2HOT A;  2HYJ A;  3G56 A;  3SJM A;  2O7T A;  1TWG J;  4A69 C;  5FMP A;  1JT6 A;  3I4N J;  2Y0S N;  5IOZ A;  3JRC A;  3IV5 A;  3ZQF A;  3G7R A;  4FIS A;  2ELK A;  4A93 J;  3BQZ A;  2JWT A;  1GV5 A;  5FKL A;  1LE8 B;  1POG A;  3NXC A;  2LLK A;  3RZO J;  2NVT J;  3RH2 A;  5FKM A;  4CYC B;  2GFN A;  4V2G A;  3TW6 A;  2M34 A;  2QWT A;  4MFD A;  4AYB N;  3BR3 A;  2FBQ A;  1XS9 A;  4W97 A;  5JLW A;  4IHW A;  2G7L A;  3ANG A;  3BQY A;  4MFE A;  2JN6 A;  2Y30 A;  3CQZ J;  3PAS A;  4GFB A;  3VW0 A;  5EZG A;  1H88 C;  1JGG A;  4I76 A;  1WCM J;  1IDY A;  1K83 J;  2EZK A;  1ETO A;  2XGD A;  5IP7 J;  2Q24 A;  1NK3 P;  2B63 J;  1UI5 A;  1VFC A;  5IOY A;  3HKZ N;  2CQX A;  2DA2 A;  3RZD J;  3NNR A;  2YVE A;  3GTP J;  1B72 B;  2DG8 A;  2F07 A;  3GTG J;  1TWA J;  4DZJ A;  1UG2 A;  5F08 A;  4DW6 A;  2Y31 A;  3QPS A;  1B8I A;  4GCK A;  3O8G A;  5FJ8 J;  2E2H J;  3VOX A;  1Z0X A;  3HB9 A;  1ZR2 A;  5F27 A;  4IHX A;  4NDL A;  3H3V K;  2R93 J;  5EF6 A;  5DAJ A;  1ENH A;  3ZOB A;  1PUF B;  1Y1V J;  4M3D A;  2EQR A;  3A01 B;  5F0H A;  3VP5 A;  4QTR A;  1H89 C;  4KWA A;  3RQI A;  1IGN A;  1RES A;  3HGY A;  4JYK A;  1ZQ3 P;  3HOW J;  4LOC A;  5C3E J;  3B6C A;  2UXP A;  5GP9 A;  5CW8 A;  3VW2 A;  1QVT A;  2VUM J;  2KT0 A;  5J1Y A;  1Z77 A;  5F0F A;  5E3M A;  4XIC A;  1TWH J;  2XSD C;  3BHQ A;  4D7N A;  5AQC A;  1AU7 A;  3GTK J;  3IH4 A;  1VI0 A;  2XDN A;  4CGR A;  4IEJ A;  3HM5 A;  2O9L A;  1BA5 A;  2ZOY A;  2NVX J;  2G7S A;  4HNV A;  1O4X A;  1FIA A;  3FK7 A;  1APL C;  2OI8 A;  1ETX A;  1JUM A;  1ZGW A;  2OER A;  2NX4 A;  3BTL A;  5EG0 A;  4D5F A;  1YRN B;  3GTJ J;  4D5C A;  2FD5 A;  1JKO C;  1IV6 A;  1ZKG A;  1JKR C;  1ETV A;  4ME9 A;  3HIM A;  3S1R J;  1GDT A;  2M0C A;  4JP0 A;  2AO9 A;  1T33 A;  1JTY A;  3SDG A;  3IH2 A;  3TW7 A;  3LSP A;  4PXI A;  4QIW N;  2K9N A;  1R9T J;  1ITY A;  5D18 A;  3BG3 A;  4A3F J;  3F1B A;  3S1Q J;  2QF7 A;  2LKX A;  1FEX A;  3VVY A;  3RKQ A;  4XK4 A;  3Q0V A;  3A02 A;  1QRY A;  2R7Z J;  3S1N J;  2O7O A;  2LK2 A;  4IHV A;  4AUX A;  2UXO A;  2JJ7 A;  4A3E J;  4D7M A;  2NOG A;  3BCG A;  3A03 A;  2CUF A;  1QPI A;  3W6V A;  2IAI A;  3JRE A;  3HTA A;  1X2M A;  1G2H A;  4GFK A;  3MNL A;  1WH7 A;  1EF4 A;  1MH3 A;  1X2N A;  4FTH A;  2DTZ A;  3S14 J;  3E7Q A;  1RKT A;  3V6G A;  2FJ1 A;  2Y2Z A;  2EH3 A;  1ZK8 A;  1OFC X;  4BY7 J;  2R92 J;  4C3J J;  2QTQ A;  2QIB A;  1F36 A;  2K40 A;  4ABZ A;  2DA3 A;  1YRN A;  3HEF A;  1OJL A;  2DA5 A;  5M5Y J;  2GLO A;  5GPC A;  1UI6 A;  1H8A C;  1WI3 A;  1BW6 A;  2DMP A;  3JRG A;  1UMQ A;  4XRS A;  2KDZ A;  4A3J J;  3C07 A;  3FRQ A;  4MK6 A;  1RKW A;  3FIW A;  1BJZ A;  5K7F A;  3HOY J;  2YS9 A;  3IH3 A;  2X6O A;  1AHD P;  2LY9 A;  1OCT C;  1WGX A;  4MXM A;  1SFO J;  3TED A;  2EBI A;  5IP6 A;  3LSR A;  1GVD A;  3VPR A;  3JRF A;  2WGB A;  2YU9 J;  3KZ9 A;  3QBM A;  3HOX J;  3ZQL A;  2XB0 X;  2QCO A;  5EYR A;  3NRG A;  3S2H J;  3SFI A;  2R5Z B;  4I6Z A;  3P9T A;  3B6A A;  4CYC A;  3L1P A;  2CQQ A;  3VUQ A;  3BTC A;  2YUS A;  2LD5 A;  4FCY A;  5FKO A;  5K7H A;  3GTM J;  3NPI A;  5FKK A;  2G0E A;  2HQ5 A;  2JA5 J;  2UXU A;  5C4Y A;  4FE7 A;  3EUP A;  1D5Y A;  2L9R A;  4V2F A;  1IUF A;  5DTD A;  3D1N I;  2FX0 A;  3DCF A;  2H1K A;  5F04 A;  1JTX A;  2H8R A;  2VPR A;  3HOV J;  1MNM C;  4AF5 A;  1MBK A;  4B1R A;  1MH4 A;  4M3F A;  3CCY A;  1ETY A;  2ME6 A;  2JMW A;  3BT9 A;  5HSZ A;  3K2A A;  5D1R A;  5C4J J;  2MSY A;  1TWF J;  2UXI A;  4ACI A;  1XC5 A;  1P7J A;  3PM1 A;  1U78 A;  3BR5 A;  5IYD J;  4RDU A;  3KKC A;  4A3C J;  1Y1W J;  3DPJ A;  1BW5 A;  2O8K A;  4A3D J;  4BBS J;  2JK3 A;  2M8G X;  2QOP A;  1HDP A;  1GUU A;  1MBJ A;  3FKI J;  2Y9Z A;  5K58 A;  5EFY A;  5IP9 J;  2HOS A;  3ZQI A;  2DMN A;  3TP0 A;  4DYC A;  1LFU P;  2W48 A;  1NK2 P;  4DYR A;  1HOM A;  2GUH A;  1JUS A;  3S2D J;  2L7F P;  4C3I J;  2ECB A;  2OPT A;  2L7M P;  5JLX A;  2ZB9 A;  2DA4 A;  3BG5 A;  1LE8 A;  1TC3 C;  5FHP A;  4UUS B;  1PUF A;  3K7A J;  2DMU A;  2PZ9 A;  4X6A J;  1FTZ A;  2LVS A;  3UKG A;  1I50 J;  1BL0 A;  4A3K J;  2X48 A;  1WPK A;  5K7Z A;  3C2B A;  3COL A;  4YZE A;  3BR6 A;  5D19 A;  3ON4 A;  1SAN A;  2HOA A;  4A3G J;  2WUI A;  2M2E A;  2XRL A;  3CJD A;  4BXX J;  2LR8 A;  4L5E A;  1UHS A;  3CWR A;  4AC6 A;  2XGE A;  4QSH A;  2RHA A;  2HKU A;  3HBL A;  5F1J A;  5M3M J;  2DA1 A;  3GBG A;  1HF0 A;  2LFB A;  3JRI A;  3GZI A;  3ON2 A;  3BJB A;  5FGL A;  4S0H B;  4A3I J;  3S17 J;  3JSJ A;  4IHY A;  2Y9Y A;  2E19 A;  2P81 A;  2CJJ A;  2TRT A;  3BR1 A;  4Y52 J;  1OCP A;  1NTC A;  3VOK A;  3OIO A;  2ECC A;  1CQT A;  4XRS G;  5EEA A;  4B3A A;  3NAR A;  9ANT A;  2L0K A;  2JA6 J;  3HOZ J;  3ZQC A;  1IRZ A;  2NP3 A;  4RBO A;  2ID3 A;  3IUV A;  2WV1 A;  5E3N A;  1I6H J;  2EZL A;  5J1R A;  5EZH A;  4JKZ A;  5C4X J;  4MLO A;  3B81 A;  3CMY A;  4J19 A;  4C3H J;  3HOU J;  1JJ6 C;  3M4O J;  3CRJ A;  3HTI A;  5J1U A;  5BNG A;  2HYT A;  2ZOZ A;  1FJL A;  4X1E A;  3H0G J;  4Y7N J;  3G1L A;  3EGQ A;  2DJN A;  2R5Y B;  4UUT A;  4HKU A;  1MSE C;  1JT0 A;  5CXI A;  4MO7 A;  2N8G A;  3FK6 A;  5M5W J;  2K9S A;  3RD3 A;  3BG9 A;  4AC0 A;  3GTL J;  5H9T A;  2CUE A;  2PBX A;  2UXH A;  5EGO A;  4MIM A;  5IYB J;  4NN1 A;  4GCL A;  3VVX A;  2COB A;  2RAE A;  3I4M J;  3LHQ A;  3HE0 A;  3BTI A;  1W0U A;  1IG7 A;  5C44 J;  4XRM A;  4M3B A;  2JA8 J;  3BTJ A;  4DYQ A;  1FIP A;  3LJL A;  4NEL A;  5E3L A;  2XB5 A;  2CU7 A;  5IPA A;  2GM4 A;  4A3L J;  2L7Z A;  3GTQ J;  3HTH A;  5FLV A;  3V78 A;  3ANP A;  2RAS A;  3QQA A;  1LFB A;  1FTT A;  2EZH A;  3WHC A;  1P7I A;  3OSG A;  1HLV A;  3FIS A;  4BY1 J;  5F0C A;  1TWC J;  1ORK A;  3LSJ A;  1MBG A;  5IYC J;  2DG7 A;  1I3Q J;  2E1O A;  5M5X J;  2MG4 A;  4M6V A;  2YVH A;  3KNW A;  1VND A;  5EGO B;  1JUP A;  3OSF A;  1SGM A;  2G7G A;  1IDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...