3BQZA

Crystal structure of the complex of malachite green bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bqzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bqzA02
3PO2J 2ME6A 1IG7A 4GFLA 3DEWA 4BY1J 2HQ5A 4GCLA 1MBHA 2ZCNA 2D6YA 1QRYA 3Q0WA 1TC3C 4MXMA 1APLC 1NK2P 2G3BA 2XPVA 1XG1A 5BNGA 1MH4A 4B3AA 4MFEA 1ETWA 1BA5A 4A3IJ 3BR6A 4NELA 1ZKGA 3HEFA 2ZCMA 1OCPA 3JR9A 3OSFA 2E2JJ 2VPRA 3JRIA 3Q3SA 4UUTA 3GBGA 5CXIA 3QQAA 4V2FA 3Q0VA 5F08A 4RBOA 3SJMA 1IC8A 1MH3A 2VI6A 3BTIA 2LFBA 2Y2ZA 2EZLA 2EQRA 3VW0A 2LLKA 2NVYJ 3BG5A 4XIDA 3GTJJ 3KKDA 2LVSA 2Y31A 4DZPA 1HF0A 1FJLA 2XGCA 2O9LA 3S2HJ 1MBFA 1MSFC 2G7GA 3KNWA 3F0CA 1WCMJ 5F04A 1B8IB 3DPJA 2GENA 1MBKA 2ID6A 3K2AA 4D5CA 1DU0A 1U9OA 4FE7A 1ZR2A 4XRMA 2OERA 3FISA 2D5VA 1GT0C 3QPSA 1ENHA 1ETVA 2K9NA 2N8GA 1ITYA 2CQXA 3BR1A 2XRLA 4W97A 2GM4A 3PO3J 1RKTA 3P9TA 5FKNA 3ANPA 1XC5A 5D1RA 1UG2A 2KDZA 1NTCA 5FKOA 2Y0SN 1SGMA 2GFNA 1IUFA 5DTDA 3S16J 5EZGA 5DS9A 2MGQA 2ELKA 3CWRA 4FE4A 3ZQFA 1QVUA 2UXIA 4L5EA 2XDNA 1AHDP 3IH4A 2Y30A 1AKHB 1ZQ3P 3VVZA 2UXPA 4D7MA 3S5RA 1P7IA 2M9HA 2ZB9A 2I10A 2YVHA 3BR5A 3VPRA 4MLOA 3A02A 5EZHA 1ZK8A 1DU6A 2JWTA 3VUQA 3GTMJ 2GLOA 1X2MA 2EH3A 3NI7A 4L62A 1WH5A 3WHBA 4Y7NJ 2MSYA 3LWJA 2FQ4A 3EGQA 1ZR4A 2V57A 3GTLJ 3QKXA 5EF6A 2M0CA 3NXCA 4DW6A 1Y1WJ 2H1KA 2JA5J 5E3LA 4A3JJ 1YRNB 4V2GA 4G12A 2FBQA 2TRTA 3GZIA 5GP9A 3BR3A 3ZQGA 3HKZN 1HLVA 5FKLA 4XICA 4CGRA 2DMNA 3CMYA 1VI0A 1HDDC 3HE0A 1GVDA 3IH3A 2AO9A 4NN1A 3EUPA 3LSPA 3HGGA 3GTPJ 2G7LA 2DTZA 2R0QC 4CYCB 3JRAA 2B63J 2ZOYA 1D5YA 4AUXA 2E2HJ 5E3NA 3K7AJ 5C3EJ 1LE8A 5IYCJ 2LKXA 2R5ZA 3BRUA 2E19A 3MKLA 2LY9A 3JRGA 2O7OA 3VVXA 1WPKA 1Z77A 3WHCA 5IP9J 2HOSA 2CJJA 1IJWC 5M3FJ 3HTIA 2R5YA 2GBYA 2L0KA 4FTHA 4JP0A 2JA8J 2X6OA 3I4NJ 3BCGA 3FIWA 1ORKA 2WAQN 4C2MJ 2ME0A 5F0CA 5EGOB 2M34A 2QWTA 3NARA 5F0FA 1CQTA 3S2DJ 2PBXA 5E3OA 3ZQHA 2WB1N 1B72A 2R7ZJ 3COLA 2JK3A 3TP0A 3OOUA 1U78A 2Y9ZA 4GCKA 4QIWN 4QTRA 4XRSG 2CU7A 2LP0A 4B1RA 2JA6J 1JT0A 1H89C 2JN6A 4LOCA 1JKQC 2NS7A 3HTAA 1XS9A 1Y1VJ 2HDDA 1UI6A 1TWGJ 3F1BA 4QSHA 4DYRA 1BL0A 5CXGA 2ID3A 3PM1A 4BBRJ 2QOPA 1IDZA 3FRQA 1JT6A 4XRSA 2YVEA 4A69C 4M3EA 4D7NA 1RPWA 1W0UA 3PPBA 5FLMJ 3VP5A 1WGXA 4ACIA 3RZDJ 3VW2A 1FTZA 2K9QA 3GTQJ 3BR2A 2XB0X 3TEDA 4A3KJ 3W6VA 2W53A 4A3DJ 1B8IA 2Q24A 1TWAJ 3CRJA 5K7ZA 3VW1A 5C4XJ 4NDLA 1HCRA 1UMQA 1X58A 3L1PA 1UI5A 3HTJA 5HSZA 2LD5A 2DA5A 3UKGA 1BW6A 3GTKJ 1RESA 4AYBN 5M5WJ 3S14J 4A3EJ 2CUEA 3MNLA 2XB5A 5F0HA 3LSJA 2YS9A 4A3LJ 3BJBA 3QPLA 3RZOJ 1JUSA 1X2NA 2CQQA 1ETKA 2ECCA 2IEKA 1QPIA 4UUSA 3JRDA 3HOVJ 5GPAA 1JJ6C 2IAIA 1JUPA 2G0EA 3HIMA 2WV1A 5D18A 1JJ8C 2HKUA 2EZHA 2P81A 3TP3A 1AKHA 2UXOA 1JTYA 2X9DA 5IP7J 3HOXJ 5J1RA 2NVTJ 2DG7A 2HYJA 2OF7A 2NVXJ 2XPUA 1PUFB 1GUUA 3IH2A 1SFOJ 2YUSA 2DMPA 5JLXA 1ETXA 1VF9A 5FKMA 5EEAA 5EG0B 3S15J 1JGGA 4AC6A 3V6GA 4A93J 3A01B 3CJDA 1JKRC 4JX5A 1G2HA 4M3FA 5K7FA 4I6ZA 1JKPC 2M2EA 3BT9A 1AU7A 1MSEC 2LR8A 1BJZA 2LK2A 4UDSA 1RR7A 3GTGJ 2XGEA 4FISA 1U8BA 3JRBA 3S17J 2JJ7A 1YRNA 3CDLA 4JYKA 3HB9A 3QBMA 2X48A 3E7LA 2CRGA 4EEFG 2AHQA 2RHAA 5HODA 5FHPA 1GDTA 5M5XJ 2ZOZA 3JSJA 4HNVA 1R9TJ 3GEUA 2YU9J 9ANTA 2HYTA 5F1JA 4D5FA 5IPAA 2XSDC 2L7MP 2HI3A 4CYCA 3BQZA 3VVYA 3G1LA 5EDNA 3ANGA 4IHWA 3JRCA 3HOZJ 5EYRA 3LJLA 1U9NA 5E3MA 3ZQLA 2H8RA 2NP3A 3ON2A 1FIAA 4JX4A 3NPIA 4FCYA 2R93J 3IV5A 3C07A 4YZEA 2MW8A 1I6HJ 5FMPA 1WH7A 4W1UA 2R92J 1A5JA 5C44J 1JKOC 2FX0A 4RDUA 4A3CJ 1FEXA 4GFKA 1GV2A 5IOYA 3VOKA 3ZQCA 2DA4A 3BG3A 3JRFA 1K83J 3O8GA 5EGOA 3A03A 2WUIA 1IRZA 1HDPA 4I76A 4S0HB 2NP5A 4JL3A 1UHSA 2PMZN 3AQSA 3RH2A 2DA3A 5FJ8J 3HOWJ 2E2IJ 1MBGA 1OFCX 3G56A 4MK6A 3B6CA 3FK7A 1QVTA 4IEJA 1FTTA 2K9SA 3OIOA 1ZTRA 4A3MJ 4PXIA 2IBDA 3TW7A 2HXIA 1TWFJ 5GPCA 5FLVA 3O60A 3BTLA 3FK6A 2EZKA 5DAJA 1RKWA 3E7QA 3H0GJ 4J19A 4A3BJ 4M3GA 2ZCXA 4A3FJ 2NVQJ 3KZ9A 5J1YA 3SDGA 1ETOA 4Y52J 3ZOBA 3BTJA 5IP6A 2XGDA 2VKEA 4DYQA 1I50J 2M8GX 2JA7J 4ICHA 3S1RJ 4AC0A 5EFYA 4M6VA 2E1OA 1K61A 1ETQA 2JMWA 4B4CA 2COBA 2DMTA 1MNMC 3V78A 3DCFA 4C3IJ 2F07A 2IU5A 3T6NA 4IHYA 3FKIJ 1OCTC 3D1NI 4GFBA 3MVPA 3RD3A 3VIBA 1LFBA 1F43A 3Q0UA 3G1OA 2GUHA 2L7FP 2DN0A 1H88C 1T56A 4C3JJ 1SANA 2O8KA 3S1NJ 2WGBA 3VOXA 3BHQA 3LHQA 1JUMA 2HOAA 1TWHJ 3JRHA 1WI3A 1GV5A 2OPTA 1W0TA 2RAEA 4A3GJ 1F36A 3ON4A 3S1QJ 1BW5A 1JTXA 2VKVA 3BTCA 5IYDJ 2DA7A 1POGA 4BY7J 4UUSB 4KWAA 2DMQA 2FJ1A 2NX4A 2L9RA 1OJLA 2QTQA 4BKXA 1PUFA 2UXHA 3GTOJ 3G7RA 1VNDA 1EF4A 5J3LA 3BG9A 5EG0A 1IGNA 4GCTA 3HDDA 4M3DA 3A01A 1TWCJ 3RKQA 2TCTA 2DMUA 4IHVA 3JREA 2PZ9A 5IOZA 1S7EA 3HOYJ 2XPWA 4C3HJ 3C2BA 4ME9A 5H9TA 1RETA 5D19A 2KT0A 3HTHA 2FD5A 3RQIA 1LFUP 5HBUA 4JX6A 4ABZA 2Y9YA 3G1MA 3HM5A 3BR0A 5M3MJ 2DG8A 4JNNA 1HOMA 5K58A 2DJNA 5IYBJ 3LNQA 5J1UA 4AF5A 1I3QJ 1E3OC 4MFDA 4DZJA 2EBIA 2QKOA 5FKKA 2DA6A 3S1MJ 1T33A 2LTPA 3LSRA 1Q1VA 4MO7A 1IV6A 3I4MJ 2QIBA 5C4JJ 5F27A 5C4YA 1MBJA 2L7ZA 1ETYA 2EZIA 3LSGA 1ZGWA 2DA2A 2ECBA 3NAUA 3OSGA 4HKUA 2CUFA 1O4XA 4BBSJ 1P7JA 2QF7A 3SFIA 4BXXJ 3IUVA 3HBLA 3CQZJ 5HAWA 4X1EA 4X6AJ 3B6AA 2REKA 3AQTA 1NK3P 2O7TA 3PASA 1A6IA 5CW8A 1FIPA 2W48A 1LE8B 2MG4A 2R5ZB 2DA1A 1IDYA 4M3BA 3M4OJ 5K7HA 1H8AC 3MN2A 2UXUA 5FGLA 2NS8A 3LOCA 3H3VK 5AQCA 2QCOA 3NNRA 3KKCA 3O8HA 4MIMA 3BNIA 2R5YB 3TW6A 5M5YJ 3HGYA 3ZQIA 3M3YJ 3BQYA 2VUMJ 4IHXA 4DYCA 5JLWA 4JKZA 2HXOA 3HOUJ 2K40A 2OI8A 1VFCA 2G7SA 2RASA 4XK4A 1MBEA 3NRGA 1B72B 2NOGA 1Z0XA 3B81A 2HOTA 3CCYA
chains in the Genus database with same CATH superfamily
4GO1A 2HDWA 2KZGA 3GUDA 3FZVA 4AIDA 3F21A 2HQ5A 2OJED 4XKCA 4AD9A 4CCNA 4GCLA 2D6YA 4CCKA 4HLYA 1RNLA 1DUXC 3ERED 4LB6B 1NK2P 4A5NA 4DBRA 2YR2A 4LG0B 1TL8A 1ETWA 4M6YA 3HYIA 1X1AA 2M7BA 4Z6YA 1LKXA 4A3IJ 4NELA 3J7ZI 2E2JJ 3JRIA 3Q3SA 2BHZA 2ZNYA 2A5WA 2K7LA 2V9PA 2A07F 4B47A 3DU6A 3SJMA 1MH3A 2W24A 4BHBA 3FXRA 3VB2A 2VODA 4PZJA 3VW0A 2H1LA 2DT6A 2LLKA 4XIDA 3GTJJ 4CGZA 2LVSA 1OCCH 2KISA 2Q2EA 5CLSA 2HOEA 3K4MA 3ZN0A 1Y6IA 2R7TA 1TQPA 1A35A 4HRIA 1U9OA 2D5VA 1GT0C 4E7KA 3BR1A 2XRLA 4EM2A 2GM4A 3PO3J 4NNJA 1RKTA 1EJ9A 2PJRB 3P9TA 5J8FA 1XSVA 1AOYA 4RGSA 2R7DA 3R60A 2IA1A 5J6XA 2DCEA 2E1MC 4EJTA 3CMAI 4IX7A 3RCOA 2O61A 2UXIA 3OL3A 2XAFA 1AHDP 3TOBA 5CQGA 4XM3A 2J5PA 1ZQ3P 2FOWA 2BY1A 3S5RA 2DFFA 2M9HA 1Z6TA 3OIPA 4G8XA 1R5HA 2BY2A 4MLOA 2BV6A 3A02A 5EZHA 1SD5A 1ZK8A 3MCZA 1PP7U 2KP6A 3GTMJ 2EH3A 4Y7NJ 2MSYA 3B02A 1TNSA 2FMYA 2M0CA 4NC6A 1Z1DA 3AG2H 5CKTA 3BWGA 4BAYA 4PFPA 4DW6A 2R7UA 2DQLA 4MEYF 1KGSA 1XCBA 4HV6A 4GDFA 2LOOA 3FXOA 2H27A 2HEOA 3F8BA 2VQLA 5GP9A 3H5NA 5AIQA 4OINF 3ZQGA 4NC7A 5FKLA 2UZKA 3ABKH 3HSFA 4GYGA 2ZKZA 4Y33A 2X4HA 2DMNA 2JSPA 2M8EA 3HRTA 3KZIC 2GXGA 3IH3A 2VBZA 3R61A 3CCUI 2Z9OA 4L9NA 2E35A 5BS6A 3HGGA 4BQQA 3IRRA 4ITVA 2G7LA 1T95A 1FBSA 3JRAA 2B63J 2ZOYA 2A6TA 3ASNH 3WTVC 3KLNA 4AUXA 2AQEA 4ZTJA 5BPDA 3TGNA 3OL4A 3T8TA 1LE8A 4M71A 3HIFA 3COAC 3R0AA 5E1ZB 2O7OA 2W25A 4YIFA 2K27A 1IN4A 3PFYA 1BI0A 5TGTA 3DPUA 4AVZA 2R5YA 2ZJQF 4XORA 4FTHA 3OYFA 4JP0A 4IRIA 2QZ8A 2Q1ZB 3FIWA 1PDNC 2EV0A 2A61A 3BJOA 3WG7H 3W2WA 3ERMA 4C2MJ 3CUQA 5GAGJ 5EGOB 2VE8A 2JVHA 2E36A 3JAMK 4FT8A 4IOCF 5E3OA 1W5TA 3ZQHA 2WB1N 2I8DA 1XMXA 3COLA 1PYVA 2CO5A 2JK3A 3OOUA 1VQPI 1U78A 3GLXA 1KU7A 4GCKA 3CDIA 3M07A 1MMDA 3H35A 1OCOH 3HRSA 3IRQA 2BY0A 4B1RA 4CXFA 1D3YA 4F52A 1JKQC 1WI9A 3LFKA 3X2QH 1XS9A 1VQ5I 2K4BA 1GXPA 1TWGJ 1YQAA 3GLLA 3AL0B 1L0OC 1VQNI 4QSHA 4LB5A 4I98B 4O6JA 2ELHA 4DYRA 3SFZA 1D0YA 2FOKA 3PM1A 5KAIC 1BOAA 3K10A 4HF2A 1JT6A 2O3FA 3EYYA 1W0UA 1ACIA 5FLMJ 2IGNA 1WGXA 1Y56A 2HGCA 3EDPA 3PSFA 4IL6C 4R1HA 4ACIA 3KEQA 3BZKA 3BR2A 1R36A 1DPRA 3K1PA 1QA6A 1X19A 3GZ5A 3OYAA 2DK8A 2M7AA 1HCRA 1UMQA 3K8PC 2CUJA 5H20A 3FKJA 5B3SH 2YPRA 1BW6A 3SDBA 3GTKJ 1MKMA 4XSXF 2L2OA 4UVCA 4A3EJ 3S14J 3LSJA 3BJBA 1YO5C 2V26A 4KIBA 3QPLA 4XLCA 2CQQA 1ETKA 3CC4I 4ETSA 4MNUA 4HSTA 3ZGKA 3JRDA 2OZ6A 4O5VA 3V4GA 1JJ6C 2PEXA 3U2RA 4B43A 2WV1A 2IGKA 2FBIA 5D18A 1ZAOA 4ZYDA 2L9VA 3TP3A 1AKHA 3RJPA 5LEJA 1D8KA 1UFMA 2GXBA 1JTYA 2NVTJ 1XSXA 1SFEA 5J1RA 3OYCA 2IS6A 2DG7A 2OF7A 2NVXJ 4IOAF 1Y8RB 5IT9Z 3KYCB 1WJAA 2KRHA 4A0YA 2WAQA 5FLXZ 3OYNA 2DMPA 4I7HA 5JLXA 5GAEJ 2FF4A 4OAZA 4CZZA 3WTYC 1ETXA 2V6EA 3V6GA 1QHGA 3S15J 3A0HC 3BCAA 4AC6A 4A93J 3A01B 4EGYA 4OMYA 1W5CC 3HSEA 4E6KG 4JX5A 1G2HA 5K7FA 1R71A 2HWVA 2BOLA 5LD2C 1ZRDA 5LHHA 2HU9A 2L9SA 3T1BA 2XGEA 4OOIA 1U8BA 3JRBA 3S17J 4WF2A 2K3PA 3CDLA 3DTKA 1P2FA 4BQOA 1WZ2A 2M30A 4EMSA 2G7UA 3PUBA 1JHHA 5AIPA 4EEFG 1SVMA 2ZY9A 2HVQA 4YFKF 2M5WA 2OAZA 3G3ZA 5HS9A 4B09A 5FHPA 3E0JB 1H0MA 3F8NA 2DO7A 3JTHA 3JSJA 1EH8A 4HNVA 4ENJA 3VYSB 3GEUA 3IL2A 4D5FA 1DP7P 3ZMZA 4RAFA 4LGWA 3C2HA 3FM3A 3L2WA 4KIGA 2XDVA 5E3MA 3ZQLA 2QQ8A 1SFUA 5J47A 1J59A 2OUMA 3NPIA 2JUGA 2P7VB 2EFQA 2QSHX 4U0VA 2MW8A 2HPIA 2QQBA 1WH7A 3LMMA 3D5RC 1JKOC 2BZTA 3VYTB 5H6RA 4N9HA 2A68F 2MYSA 2P4WA 3LA2A 2DPUA 2W1OA 2Z99A 1HW5A 1YIJI 1GV2A 4X0GA 5IOYA 3VOKA 2DOEA 2A5YB 2VC1A 2X51A 3BP8A 2KRCA 3O8GA 5D8LB 4L18B 3A03A 2WUIA 4EVIA 4S0HB 2R7SA 2NP5A 3RH2A 1B9MA 3ROUA 3MQ0A 3CJRB 1MBGA 3OR1C 3QYEA 3MKYB 4OD5A 1OFCX 2OC6A 4L5JA 4MK6A 2ZMEA 3E5QA 2MLGA 1TQMA 3S2WA 5L3GA 3TW7A 2PFBA 1D1BA 5DUIA 3BTLA 2HKXA 3WE2A 2CH0A 4HAMA 1B6AA 1UHWA 4UB8C 1LVAA 4DQ2A 4UVBA 1R5ID 2D2WA 5DYMA 2VL8A 3KZ9A 1BBYA 1OYIA 3ZOBA 1QZYA 4S04A 4F3QA 3LAJA 3C2GA 2VKEA 3BZCA 1SEUA 2VASA 1MMGA 1Z7UA 5ILVA 1BN5A 4BXUA 5AONA 5EFYA 1ZLJA 1MZBA 1KU9A 3TO6A 2IXSA 2VJ5A 4KMUX 1MNMC 4XLNF 2F07A 4HX8A 2IU5A 3KYLA 1HC8A 3K4LA 1X1CA 3WTXC 3VYRB 4GFBA 3MVPA 2DDAA 2ADUA 2P5VA 3RD3A 1XDUA 4FX0A 4II3A 2EFWA 3G1OA 4A12A 2KQRA 2DN0A 4E7LA 1T56A 2O8KA 3ZP5A 3LWFA 2KIFA 3LHQA 1VQ7I 1RUNA 3OS2A 4E7IA 3F8MA 2OV7A 3JRHA 2E1NA 2RAEA 3V42A 4E7ZA 1MDMB 1JTXA 1R1UA 3BTCA 2JRTA 2RQQA 2GA2A 2VKVA 4G7HF 2DAOA 1POGA 4UUSB 3MEXA 2KMUA 2L9RA 4CYDA 3AAFA 1QO0D 3L2RA 1PUFA 2TDXA 2MLKA 4CZCA 3ASOH 1NH3A 3K70C 3Q9VA 3I71A 3CP8A 3S93A 1LDDA 4M3DA 4G6QA 4IHVA 1ON1A 1V54H 2RGVA 5IT9K 5IOZA 1Z7LA 3MZ8A 4LG3A 5FFZA 3N97A 1S7EA 3HOYJ 2XPWA 3ABLH 4LMYA 5FLXK 4F91B 3PFIA 4ME9A 2H94A 3E6DA 4BJTA 5B5EC 1O3TA 3RQIA 4L5IA 1SVOA 3UR3C 1FYKA 3K4NA 4JX6A 4JK1X 1S8NA 5FD5A 5M3MJ 3BR0A 2RREA 3C3WA 2DG8A 2F4OB 3HUGA 3CCQI 4P5OA 4IKFA 3TBIA 4JNNA 1ZYRF 3V8JA 2VOOA 5J1UA 3FBNB 3KP3A 4I09A 1KQ8A 2EBIA 3AL0C 4XLHA 2DA6A 3S1MJ 3LSRA 2HZDA 2VC0A 4MTEA 3W2AA 1B4AA 3RPUA 3DLAA 4DIQA 1ZGWA 3I59B 1RIOH 3I56I 3QYBA 1FMWA 1W5SA 2QLZA 4IPAA 3K4KA 1QQIA 2KFDA 3U21A 2MA3A 5E8IA 3CQZJ 1FOKA 5HAWA 2RDPA 3EQLF 5K5RA 3J7AO 3P9IA 4AYBA 2DOAA 3AQTA 1DGWY 2X1DA 3K2ZA 1SMYF 4UV9A 2MG4A 3VFZA 5LFAA 1H8AC 1BI2A 1R4NB 2UXUA 1EA3A 1R58A 1P6RA 1Z3XA 2NS8A 3A4CA 3LOCA 5J4YA 2VIXA 3J81K 3H3VK 3LSMA 4HV5A 4C2MA 5M5YJ 3ZQIA 5K5QA 3OYBA 3BQYA 2VUMJ 1BI1A 4IHXA 1SC7A 5KHDA 4JKZA 2HXOA 1OLTA 1B1BA 2L54A 3CESA 5H2FC 1VFCA 5E17F 1U3EM 1J09A 2MBFA 3PNVA 1IRGA 2MC3A 2QSFX 2EFOA 1IXSB 3CCMI 3JSOA 3B81A 1XMKA 3EUHA 4IZZA 3PO2J 1ZGJA 3WODF 1K78A 4BJ5C 2ME6A 1IG7A 1IF1A 2ZC2A 2QQ9A 1X1DA 1XGOA 3CO7C 4BY1J 1MBHA 2ZCNA 1HKTA 5CVUA 1QRYA 3Q0WA 3ZMDA 1TC3C 1BM9A 1D8JA 4XQFA 3RKXA 1XG1A 1NG7A 3IAS2 2QBYB 1R49A 3BJ6A 4ZYEA 2M0MA 3HEFA 1R1VA 4UV8A 1OCPA 3L2QA 3CMEI 1TW3A 3OSFA 1T2KA 2ZCMA 3GBGA 3DBRB 1OCZH 2PBIA 3Q0VA 2VXZA 4V2FA 3W2VA 2DFEA 2R7OA 3V7RA 1MD0A 3BTIA 3DEUA 4RB0A 2EQRA 3KP2A 1PUEE 4DZPA 1FJLA 2P6SA 4FETA 4BH9A 5TRDA 3S2HJ 3BPXA 1WFXA 2G7GA 3O3KA 1WCMJ 2L5QA 5L3DA 3L2VA 2HZTA 1B8IB 2VBWA 1DU0A 2LY1A 5BPIA 4XRMA 4OAYA 1OCRH 3QPSA 4W97A 2GOMA 2IGMA 2RVCA 3MZYA 5FKNA 4ZDLA 2KDOA 1Y8QB 2L02A 1UG2A 1NTCA 1AA7A 2PLYA 4BE0A 4WWCA 2GFNA 1IUFA 5DTDA 2Z2SB 4R8HA 5EZGA 3S16J 2LBFB 1ONVA 3ELKA 2ELKA 4FE4A 1FYLA 3GZNB 3ZQFA 4HQEA 2DYRH 5IY5H 3J7YJ 1IRXA 3H9GA 2XDNA 4D9JA 3VVZA 2E71A 2UXPA 2YVHA 2I10A 2X6YA 2E5ZA 2WBMA 2JWTA 2PMZA 3VUQA 1X2MA 2OTLI 3NI7A 2KIMA 4L62A 4YG2F 3GO5A 3CUOA 2WY7Q 4N4NB 3IKTA 2FQ4A 1VQ8I 3PJRA 3F6OA 2W00A 4LJZF 3NXCA 1YW8A 4YFXF 1HQCA 1QZZA 3LA3A 1Y1WJ 2OA4A 2JA5J 5E3LA 4EGZA 1YRNB 4KNYA 2QVOA 4V2GA 3ZCOA 2RN7A 3E1SA 4G12A 3GZIA 5CVRA 5D5VB 5D6FA 3HOTA 1F9NA 4CGRA 2HTJA 2WADA 4KN4X 3TO7A 3CMYA 1HDDC 1VI0A 1LJ9A 1GVDA 3FM5A 1LQ1A 3F8FA 2AO9A 3EUPA 3R4KA 3LSPA 2DW4A 2DTZA 4CYCB 2QWWA 3CF2A 3FMQA 2GZWA 3I54A 1S9HA 1OYYA 3DLLF 1MIJA 1E3HA 4XMYA 2NNYA 3LSIA 5TISC 5IYCJ 2ZJ2A 2KPMA 2JA2A 2E19A 3MKLA 1OPCA 2LY9A 5LEKA 3PNYA 3VVXA 1WPKA 1YIOA 1SD7A 1Z77A 5IP9J 3LAPA 2CJJA 2CSOA 2HR3A 3G71I 2P0WA 1A04A 2V6CA 5M3FJ 3OWTA 2QQAA 3E3VA 3F6VA 2X6OA 3I4NJ 1ORKA 2Y0SA 3EYIA 2D45A 3H92A 5F0CA 4B48A 2JPCA 2QWTA 3DQVC 3K4JA 4HNTA 3OYMA 1HXDA 5HLTA 3S2DJ 3ABMH 4IRHA 1B72A 3E6BA 2PI0A 2R7ZJ 4Y15A 3CJQB 5DUKA 3CC7I 3ZRGA 2KHMA 2VPLA 2R7RA 2BBYA 1OMIA 4QTRA 2CU7A 1R22A 2JA6J 2KIUA 5E1XA 3LFUA 1UAAA 3HTAA 4LG0A 1EH7A 4L9TA 4OIQF 4PUSA 3ZQ7A 1FBUA 1SFKA 1IDZA 2JVGA 3GXOA 5CVJA 2FMLA 3VP5A 5DCMB 4LLGF 4KDPA 4BGDA 1BC7C 3KEOA 1WJEA 1TP4A 1VZ0A 5B66C 4A3KJ 5B1BH 3GFIA 2W53A 4Y3OA 4YEJA 2XF5A 2NOJB 2Q2EB 3L1PA 3HTJA 1UI5A 4KT5C 3FXKA 1Z21A 1WHUA 2DK5A 5ICEA 3KZYA 4H0EA 1RESA 4AYBN 2PJRA 4ON0A 1FOXA 1L3LA 4ESJA 4U88A 3HXLA 3QP6A 2H6BA 1QPIA 2COMA 3S3MA 5FO5A 3I58A 4GYIA 4ANJA 3SQNA 3LA7A 1WJCA 3OS0A 4J00A 2DODA 4HBLA 1QBJA 4DVYP 5HLHA 2L4MA 2F5CA 2CWEA 2BEOA 2P7CB 4KITB 5LHIA 4HA8A 3N4MA 1E2XA 1VQ4I 1W7PD 5FROA 1GUUA 3IH2A 2CFXA 5FKMA 2V1UA 3G73A 2ZBKA 1FNNA 2STWA 3KE2A 3E6CC 3EUHC 2Z5UA 1JKRC 1IRFA 3GZ6A 3VEPA 5L3CA 4IVNA 1AU7A 3M8FA 1BJZA 1UG0A 2LK2A 4MHGA 5BOXA 1CF7A 4UDSA 1RR7A 3GTGJ 3JSPA 3K70D 4XSZF 3SWHA 4KICA 4PSWA 4BXFA 3ECOA 3DWLE 3QPTA 4HQMA 2CRGA 5GTIC 2P5KA 3H1CA 1XD7A 2DU9A 5DEQA 2RHAA 1T08B 5ILUA 2W82A 3RQ4A 5E1WA 3FXQA 1U5TB 4HX4A 4LD5A 1GDTA 4BEHB 1O3SA 1VQ6I 4L0YB 2ZOZA 2XROA 1R9TJ 4UUVA 2GAUA 5BMZA 1W7PA 3FX3A 5F1JA 5IPAA 5EDNA 3NWTA 4TV7A 1ZRCA 4A0ZA 4XKBA 1YTYA 2BW3A 1T38A 4ESBA 3HOZJ 5EYRA 5LGTA 1U9NA 2KLOA 2NP3A 2BY3A 4I02A 3G2BA 2P6TA 5E18F 4BACA 2R93J 4Y13A 1WJDA 3SEZA 4WCGA 2VQCA 4I2OA 1XX5A 1A5JA 1YS7A 2FX0A 2F5VA 1FEXA 1IZ1A 3PQKA 1X3UA 3V7SA 3BG3A 5EGOA 4EQQA 2JPBA 2EJRA 4PJNA 2OQGA 1HDPA 1U0JA 3WE3A 3ZN1A 1K6YA 3EPZA 4JL3A 2E60A 2DBBA 2PMZN 3I3LA 3AQSA 5FJ8J 3HOWJ 3CUQB 2E34A 1R1TA 3QODA 3B6CA 2EFNA 2GIZA 3ISPA 3K4CA 4G6TB 4IEJA 2OZUA 3KX2A 4Q5SF 2QUFA 2JRMA 3S8PA 2OTJI 2XHKA 1TWFJ 1DGRM 5F1RA 5DD8A 4IJAA 3O60A 1HSJA 3FK6A 3MKZA 1RKWA 3E7QA 1T0FA 2LREA 2ELJA 3CMMA 3H0GJ 2ZJPF 4A3BJ 2XF7A 4M3GA 5LHGA 2XC7A 1RI7A 3K1NA 3BTJA 5IP6A 4PK4A 4WXHA 2CV0A 1KZHA 1O3QA 1ZREA 1I50J 2LKPA 4WIBA 4ICHA 2VE9A 3Q5FA 3HTUA 4M6VA 1ETQA 2P8TA 2JMWA 2COBA 3DCFA 4IHYA 2LSOA 3CCVI 3HL2A 3T0YA 4M6XA 1OCTC 4CCLA 4KISA 3D1NI 2IS4A 2ACJA 4ZZLA 5HOOA 3NWSA 3CCSI 2GUHA 2L7FP 4PJ0C 1HSTA 4E70A 2EPFA 5L3BA 3S1NJ 4RM2A 3BHQA 4LK0F 2VJJA 2EILH 3G4SI 3F8CA 5IYDJ 3K0LA 2DA7A 2GXAA 2BVLA 2FJI1 3CF5F 2FJ1A 1Q1HA 3PIOF 4BYYA 4BKXA 2AXLA 4QWQA 3G7RA 1VNDA 1K7AA 1EF4A 3L2UA 2PFVA 1BJAA 2WA0A 3HDDA 3RKWA 3A01A 1TWCJ 5D8KB 2PZ9A 3MWMA 3QWLA 4C3HJ 3C2BA 1I3AA 3ML6A 1RETA 3DPTA 2Z16A 1MNDA 1LEBA 2FD5A 1N25A 3N05A 4CH7A 5TJJA 3IKVA 4ABZA 2Y9YA 4PGGA 4FX4A 2AXTC 3O2PE 2XAJA 4L9JA 3QRFF 2UWMA 4Y4RA 4OD4A 1YX3A 2DJNA 3VDXA 1XGNA 1TW2A 4F93B 4AF5A 1I3QJ 2F5DA 2RKHA 2ZSIB 2JUCA 1IW7F 3SZGA 1Q1VA 2XUBA 4XOTA 1O3RA 4NBQA 5C4YA 4II2A 6PAXA 3CCEI 2LNBA 2L7ZA 4EJOA 4XLAA 4HKUA 2CUFA 2ZXHA 4BBSJ 1I39A 4BXXJ 4X6AJ 2VJIA 2EA2A 2VJ4A 3GW2A 4ENNA 1UZCA 3I9V2 2UXXA 3DP7A 2R5ZB 3I4PA 4HG2A 3OYKA 5FGLA 3QP5A 2VB6A 2GWRA 3BG7A 4PCQA 1RRJA 4LLNA 3NNRA 1T8IA 3KKCA 4MIMA 4YELA 1MJAA 2A3SA 3RDIA 5CYVA 4DYCA 1K6OA 2XAGA 3E5XA 4NC8A 5JI6A 5LGNA 4WX9A 2OI8A 3TKYA 4HX7A 4XK4A 4A0XA 3WG9A 1RUOA 1R4MB 2EIJH 2CW8A 4HSRA 2MH2A 2Z1DA 1A6QA 4CSWA 3T5XA 5BQTA 4CHUA 3IUVA 3JW4A 1S3JA 3F72A 4GFLA 3ABUA 2XIGA 2NAZA 2QGUA 2I5UA 5KAFC 4MXMA 4FASD 2W4SA 3P9KA 1MH4A 3H9JA 3CC2I 1TNTA 3KLOA 3VODA 2ZMEB 4E7HA 2O0YA 1M1EB 3VYUB 1BA5A 3ZPLA 1ZKGA 5LRSA 5ICGA 3JR9A 2RNGA 3TDZC 4IF4A 3E6MA 4G9YA 1SVLA 4FHTA 4RBOA 1IC8A 2YU3A 4NHJA 2LFBA 1Z3YA 2EZLA 2ISYA 4D1QA 2IJLA 2JSCA 2NVYJ 2XVCA 2BHYA 2BXZA 2Y31A 2FQ3A 4UY8I 1ZRFA 4OIOF 5CVVA 3KNWA 1WSUA 3F0CA 3QPHA 3DU5A 3KP7A 5HNFA 1MBKA 4LITA 4D5CA 2LC2A 2X6WA 5HVQC 2VBYA 2OERA 1U5TC 2N8GA 1P4WA 3WU0A 2GOXB 4XLEA 2NRAC 1QU3A 3J80Z 2OCEA 3IWZA 1XSDA 4XLPF 3ANPA 1XC5A 2FBKA 2KDZA 1I5ZA 5FKOA 1G3SA 2PX9A 2CQ7A 3ECHA 4EJVA 5HDKA 3CWRA 1IN6A 3RPUD 4A6DA 2ZJRF 3R0JA 1QVUA 2QKLB 2WC2A 2K3FA 1YJNI 2DPDA 4RM3A 3HJEA 2XF6A 2R7QA 5A2QZ 1LPQA 4N9IA 1DPUA 4D7MA 1P7IA 2NYXA 4N0BA 4E7SA 4BU2A 4A6EA 3FMRA 3DFGA 1DU6A 1JGSA 1FSEA 2HTSA 2F5FA 3BC8A 3WHBA 3LWJA 1V5EA 3EGQA 3U9GA 2DLLA 1ZR4A 2V57A 3GTLJ 4PSXA 1K4TA 3MMYB 5EF6A 5E20A 4CCOA 3DV8A 1C0WA 2A6EF 3HHHA 3AKZA 2IGOA 3NRVA 4KA4A 2H1KA 3HTSB 3CD6I 3I5UA 4HF1A 2MFZA 1ZG3A 1MMAA 1T0FC 1OYWA 3SZPA 3BR3A 3FXLA 5DDGA 1RR8C 4YRVA 2NVUB 4EV0A 3K6GA 1TZLA 5ILSA 2ZO4A 3CDHA 3I59A 4A5MA 1U6GA 2A69F 3FXUA 2Z33A 1LUJB 3ZQQA 3FDYA 5E79C 3QOPA 2ZSHB 2K86A 5HDGA 3K7AJ 1X1BA 5C3EJ 1YJ9I 1J2XA 1SMTA 1KU3A 1DQUA 3GYHX 1XDSA 2LKXA 4UNOA 2E1MB 4M74A 1FLIA 5H6QA 2EA4A 2L9NA 2WWYA 1ZGAA 1ZLKA 2GQQA 3H5RA 3HTIA 2GBYA 2L0KA 3LSHA 2FA5A 1S6LA 2VKHA 1GXQA 2WAQN 2DDBA 3WTWC 3TMOA 1XMAA 3RIRA 4RB2C 3F23A 2M34A 3RKYA 1ZG5A 2M1BA 1CQTA 2PMUA 4HW0A 2OCCH 3OV8A 3SHFA 4U9NA 2VKDA 3TP0A 4LLLA 2V1NA 1I1GA 2XASA 2XKOA 4QIWN 1JT0A 4C2TA 1H89C 2JN6A 1SD6A 2NS7A 1K78B 2RV8A 1UJ8A 1Y1VJ 1XTAA 1ZARA 2RC4A 4XKVA 3KETA 4MQVA 4P96A 4BBRJ 2QOPA 3FRQA 4XRSA 2ICWG 5J8CA 1BR2A 2IP2A 5HS7A 4A69C 4M3EA 4ZDPA 4D7NA 3PPBA 3U1DA 4XBFA 3M9AA 4V19K 4Q4ZF 3GF2A 1FTZA 1FT9A 5GAHJ 2VT3A 3TEDA 3NS4A 1QHHD 4A3DJ 1J7KA 1B8IA 2Q24A 3CRJA 5K7ZA 3CJNA 4NDLA 4ZC3A 1IN8A 2DA5A 3OMYA 4C30A 3UKGA 1TBXA 5M5WJ 4ZZDA 1KQ0A 2YX7A 2CUEA 2K5CA 2K9LA 3PL8A 3K1MA 3AG4H 5F0HA 1WJFA 1EV7A 2YS9A 4A3LJ 3TDUC 3F9KA 1YITI 3DBHB 3RZOJ 1JUSA 1X2NA 2ECCA 2IEKA 3EETA 2STTA 2LBFA 1VQMI 4G7ZF 4L0ZB 1JUPA 1T98A 1YOVB 2EV5A 2G0EA 2ZCWA 3ZR8X 3F22A 4G7OF 3HIMA 1USSA 1JJ8C 2HKUA 4NQWB 4KT6A 2EV6A 2P81A 4OMZA 4K2EA 2UXOA 5IP7J 1N77A 3QOEA 2XPUA 3OYIA 3L9FA 5HLGA 1K4SA 2IVMA 2ZXIA 4XN3A 1SFOJ 1REPC 2L4AA 4HZFA 1VQ9I 2YUSA 2WV0A 1Z6RA 4HDVA 3M7GA 3QU3A 1VF9A 5EG0B 3CZ6A 4EJWA 3OYGA 1S5LC 3LSKA 1UHMA 2WB1A 4LK1F 3DBLB 1P92A 2F5EA 2LH9A 4ZYHA 1FPQA 4IXAA 3I0TA 4AM3A 1FP1D 3V7CA 1P4XA 2E7XA 3TOAA 4I6ZA 3PUFA 3ZMVA 3BT9A 2FRHA 3K4BA 1MSEC 2LR8A 2ZNZA 4EM1A 5JHUA 4FISA 5JHFA 1YRNA 2FXAA 4H4KC 2H8WA 3QBMA 2X48A 1WJBA 4YIRX 1F4KA 3W6JB 2A2FX 3D0SA 1IAWA 3C18A 1V55H 2PJPA 4KUMA 5LGUA 1FYMA 2EK5A 2HYTA 2L7MP 3HRMA 4CYCA 2F48A 3G1LA 3K69A 3MZHA 1HKSA 4IHWA 3REOA 3OYLA 3C7JA 4HLXA 3EUAA 4NUBA 3OS1A 4UVAA 3JRCA 2O6GE 3VWBA 3NEUA 1X3WB 2GIVA 2V1DA 1FIAA 2R7WA 2W7NA 3WU2C 2B7EA 3IV5A 4DBQA 3C07A 4YZEA 4GGGA 1D5VA 1Y0NA 2EWNA 4MQ9F 2KKOA 1I6HJ 2JQ7A 5FMPA 5C44J 2J5OA 4P55A 3LQQA 3ZMTA 4U7DA 4RDUA 1N75A 3RYRA 2R4GA 1SFXA 2XAHA 3HPGA 3JRFA 3GWZA 3JAMZ 2CUZA 3KYDB 4KN7X 4BE2A 2CFOA 4I76A 4MGRA 5JVTA 4M72A 3VSLA 1BR1A 1UHSA 2O8XA 2DA3A 3PIPF 4GCVA 2E2IJ 1OQYA 3ZMSA 2LRDA 4OIPF 2R7VA 2B0LA 1XCVA 1QVTA 4BQNA 2K9SA 1STZA 3DXJF 3IHUA 2CW0F 1YE9A 3KFWX 4PXIA 3J7AY 1G6NA 2HXIA 4L9VA 5GPCA 2ZFUA 2AS5F 5FLVA 4RLQA 4DNCA 1A36A 2EZKA 5DAJA 4B8XA 1K79A 2VXDA 1BOBA 3IUOA 4J19A 2O5RA 1ZG1A 3DKWA 2ZCXA 4I0AA 4A3FJ 2JT1A 2IRFG 5J1YA 3P5JA 2ZFWA 2VQHA 3SDGA 4Y52J 5DCMA 1HW1A 2BXYA 1WJ5A 2XGDA 1KQ9A 1FZPB 4IHSA 3HKZA 2M8GX 2Y0MA 3AG1H 4AC0A 5B1AH 3IAM2 3WTTC 3S1RJ 1TT0A 2M87A 2E1OA 2IS2A 3OY9A 4B4CA 1LFPA 3BCBA 5DM7F 1D1AA 5LLQA 3FKIJ 4Q48A 2QSGX 3VIBA 1LFBA 5LBQA 1VQKI 1GVJA 3HPHA 3Q0UA 1R7JA 2HVSA 1H88C 5D5UB 4ZH4F 2W84A 1IO2A 4PDKA 3BROA 1JUMA 2HOAA 3B73A 3DTEA 3A0BC 1R6RA 3FWEA 2HQAA 4A3GJ 2FUG2 5EEHA 1BW5A 2FBHA 4ENKA 3VSKA 1P4AA 2DMQA 2NX4A 1X3ZB 4RGRA 2HPMA 4B3XA 2IPQX 1HA8A 4J01A 3FHZA 1WQ2A 2V1XA 4BUPA 5J3LA 2PG4A 1QNTA 1O7FA 1IGNA 4AWXB 4AVPA 4EM0B 4GCTA 2TCTA 4BHCA 3KPHA 3KP5A 4LFUA 1WKMA 1FY7A 4RB3C 1IXCA 3BY6A 2KT0A 4PJJA 3HTHA 4U9LA 5KK1A 2ESHA 4FQGA 5HBUA 3A2KA 2L01A 3HM5A 4BS9A 1TQIA 2MD5A 4LIVA 4OWRB 2NNNA 4RGXA 1MGTA 1W36C 5LRRA 3HHGA 1CF7B 3CP2A 5IYBJ 5K58A 1E3OC 4YIIA 1U5TA 4BEHA 3ULQB 3RSNA 5JR3A 3HRUA 5D4RA 3OYEA 1S7AA 3LSGA 3OYDA 3C1DA 2DA2A 2ECBA 3NAUA 3E5UA 3S3NA 1B9NA 1FMVA 2E5NA 2QF7A 3P9CA 3SFIA 4XOPA 1W7PB 3KCCA 3GX4X 4X1EA 3M8JA 3B6AA 2DQRA 3PASA 1NK3P 1USTA 1A6IA 1FIPA 1LE8B 2CMPA 2BW3B 3ONQA 4P1WA 1OR7C 2DA1A 4M3BA 3M4OJ 5DM6F 5AQCA 3KZZA 2QCOA 2E1CA 2DFHA 3BNIA 2R5YB 4B44A 3TW6A 2R3SA 3M3YJ 5D5XB 5JLWA 3OIQA 2IT0A 3HOUJ 2HKOA 2K40A 2V79A 4HOBA 4OU0A 2G7SA 1X1PA 1QPMA 2RASA 2FU4A 1MBEA 3NRGA 2NOGA 1Z0XA 1G3YA 2Y75A 4ZTFA 3JTGA 1BIAA 3CCYA 4RGUA 1IUYA 3BLYA 2CG4A 2Y48A 1H9TA 1W4MA 5FGMA 3DEWA 2CV1A 3A1YA 3DKXA 1PVEA 1MJ9A 1ERDA 2F6CA 2NS0A 3L2CA 1APLC 1SAXA 2XV4S 4HNUA 2G3BA 2XPVA 2UXNA 5BNGA 4B3AA 4MFEA 4JOMA 4PGHA 2M4KA 3BR6A 5J4VA 1J75A 2VPRA 1XPXA 5CXIA 2NXNB 4G94A 4UUTA 2DYSH 2BVMA 3QQAA 4CCJA 4ESFA 5F08A 1YI2I 2VI6A 3ABTA 3MD2A 4LIUA 4KIFA 3H5AA 1KYZA 3GFMA 2Y2ZA 4G6DA 3BG5A 4IO9F 3KKDA 4DGWB 1HF0A 2CQNA 1HBXG 2F4MB 1XN7A 2XGCA 2RNJA 2O9LA 1MBFA 4GRIA 1MSFC 5F04A 2ZXWH 2KZVA 3DPJA 1QZEA 2GENA 3IWFA 2ID6A 2LY2A 3K2AA 3KIOA 1ZR2A 4FE7A 2PBXA 3FISA 2DI3A 5KVRA 1ENHA 1ETVA 2K9NA 5ED4A 2L7KA 4WK8F 2CQXA 1JE8A 1ITYA 2X85A 2CV2A 3BDDA 3NQOA 3FBIB 5DV5A 5D1RA 4RAGA 4IRGA 4F7ZA 2Y0SN 1NHAA 1SGMA 2PN6A 3GFLA 3H9QA 5DS9A 3SEQA 2ETHA 2LYCA 2MGQA 2X0LA 3D5LA 3QAHA 4XNFA 1ZH5A 2LMDA 1FOWA 1FC3A 4L5EA 4RAZA 3IH4A 2Y30A 1AKHB 4YFNF 1W1WE 1KA8A 2ZB9A 3WGIA 3HSRA 1BI3A 4ENMA 3BR5A 1YW9A 4JBAA 3VPRA 2DT5A 2VLAA 2DOFA 4IHTA 1ZHFA 4RS8A 3GVAA 2EINH 2GLOA 4ASNA 1WH5A 2CYYA 3CTAA 5EJCA 1BIBA 4DJAA 1FX7A 3D5SC 2HS5A 2DT7B 3I53A 2HQRA 2AQFA 1Z9CA 2CQKA 1QGPA 3QKXA 4KFCA 3W3CA 2V9VA 1P9QC 2KIQA 4U7BA 3KEYA 4CDGA 1V4RA 3ZXSA 3RTRA 2X1EA 1R5GA 1R00A 2C6YA 4A3JJ 1IXRC 5L3EA 3BZ6A 1V3FA 2FBQA 2TRTA 1DDNA 1YG2A 2HQNA 2WTEA 3L7WA 2KJCA 3HKZN 1JXSA 4MTDA 1HLVA 4XICA 2EIMH 3CLQA 3IC7A 3BPVA 2FSWA 4C9YA 1MMSA 5FD6A 3HE0A 2D1VA 4M9SA 4QLCU 1KYWA 3H3UA 4I99C 4NN1A 5FB2A 1OISA 2HDCA 3GTPJ 2K9MA 2R0QC 3G6EI 3KP4A 2MH9A 4EATA 1D5YA 2E2HJ 4M73A 5E3NA 1PJRA 2VN2A 2DJIA 1PP8F 4XR6A 3V8KA 2LG4A 4BHPA 2L3DA 3WTUC 1J0RA 1G59A 2R5ZA 3I55I 2QA4I 2BGCA 1I27A 4XKWA 3BRUA 3JRGA 2EFPA 2YX4A 2QENA 3Q9SA 4NB5A 3WHCA 3J81Z 2HOSA 4M9XA 3CO6C 1IJWC 1MJBA 2B1EA 2RQPA 3FHNA 2A6HF 2JA8J 3L09A 3RI4A 4PJMA 1IN7A 3BCGA 3DF8A 5JFRA 1ODDA 4XLFA 2ME0A 4P9FA 4CICA 2QEXI 3NARA 5F0FA 1XB4A 4I01A 3HG9A 3OYHA 1X4OA 2Y9ZA 5ERIA 3TQNA 3L00A 2R7FA 2KL4A 2Z3YA 2FNAA 4XRSG 2LP0A 3H3ZA 1R23A 4RMNA 4LOCA 3WTSC 3WGHA 1TTYA 2HDDA 4D0PA 1E3PA 2LF8A 1UI6A 3WGGA 2E7WA 3F1BA 2X1CA 1V5FA 1BL0A 5CXGA 2ID3A 3LQRA 4BDZA 1O57A 2ESNA 1Z91A 4P9UA 1LVKA 5IT3A 1LDKB 4A2UA 2BYVE 2YVEA 2LKSA 2V9KA 1RPWA 1H9GA 1EH6A 4R79A 3VTIA 3RZDJ 3VW2A 1XGMA 2K9QA 4HF0A 3GTQJ 1AWCA 4IQJA 2XB0X 2W57A 4Y17A 5DCFA 4IQ4A 1FP2A 4OIRF 3W6VA 3OOPA 2PMHA 4ZYGA 1YJWI 3CCLI 1TWAJ 3SXYA 4M9ZA 3VW1A 5C4XJ 2XKPA 1X58A 1G3TA 5HSZA 5K1YA 2LD5A 2GA1A 5L3FA 4KMFA 1DP3A 2OBPA 4BQAA 4O3MA 5E8GA 3MNLA 2XB5A 1MDMA 3AG3H 2B3WA 2LDUA 2O03A 5K5OA 3GEZA 3CCRI 1YHQI 4UUSA 2CGPA 2IW5A 1N78A 2OU2A 3LL7A 3HOVJ 2UV1A 5GPAA 4E4HA 2IAIA 2B9SA 5HLIA 4CCMA 3MKWB 2EZHA 2WAEA 4KJZA 3V8LA 2H6CA 1MW7A 5D4SA 2X9DA 5GTHC 3HOXJ 1FBQA 2HYJA 1MNEA 3I64A 1E0EA 1F5TA 1PUFB 4UHTA 3BJAA 2CS3A 1X4PA 2H09A 4QPQA 4EJUA 2ZXJA 1NG6A 3AFHA 5EEAA 1KONA 2Q0OA 1JGGA 1YX5A 3CUQC 3CJDA 1YS6A 2VONA 1F1ZA 4IRVA 2F4IA 1V5GA 4M3FA 4BL0B 1JKPC 3P7NA 4HEA2 3DEEA 2K85A 2M2EA 4U0WA 4WXCA 5CJ9A 5CPRB 1YFHA 3JCUC 3LSTA 2HFHA 2JJ7A 4N4OB 5J40A 1VQOI 3FF5A 4JYKA 3HB9A 3HUGB 3T8RA 1FWZA 1SAUA 3E7LA 3OYJA 2AHQA 2Y69H 2X6XA 1B59A 3DTIA 5HODA 3ZMUA 1Y0UA 3HZJA 5M5XJ 1ULYA 3HC7A 4HDUA 1LB2A 2G9WA 2DXIA 2YU9J 9ANTA 4BNCA 2IA0A 5FRNA 2XSDC 1D1CA 2HI3A 4HYEA 4UB6C 3BQZA 4Z2YA 1SD4A 3ANGA 3VVYA 1W36D 3VOEA 5HNHA 5ICFA 3R6SA 1G3WA 1G8XA 3LJLA 3H0DA 3K9TA 2H8RA 3KP6A 3W6KB 2FNPA 3ON2A 4JX4A 4FCYA 4KYWA 2QKMB 4I0BA 2FEZA 4U87A 3ESWB 2OQRA 2M3AA 1J5YA 2JTVA 2HVRA 2MD0A 4W1UA 5EEGA 2R92J 3O6BB 3RPQA 1E17A 1G4DA 3QYFA 4XL9A 1T39A 3WTZA 5ICCA 1J9IA 4GFKA 4A3CJ 2YVXA 2CW7A 3U1KA 3ZQCA 3CCJI 3M1EA 2DA4A 1K83J 1RZ4A 3BOQA 4WXDA 3HOSA 1IRZA 1D0XA 2K4JA 4C2UA 4ZJZA 3M8EA 3M1CA 3PQJA 1ON2A 4AIKA 4AIJA 2IA2A 1IV8A 2G7HA 3DPLC 3G56A 2XRNA 3FK7A 1VTNC 1CGPA 1FTTA 2QBYA 3OIOA 3OR2C 1OKRA 1ZTRA 3CLOA 4A3MJ 1GHCA 2IBDA 1LEAA 2VT2A 4MEXF 3GFJA 2WAFA 5DD4A 5KCMA 2QM3A 1WRJA 3CJTB 4CO8A 3FXJA 4QPOA 5FFXA 5KNLA 2NVQJ 1TT5B 2EB7A 1ETOA 4BJ6C 1BC8C 3WU1B 4DYQA 2JA7J 3FXMA 5JVGF 3GCMA 4RLFA 4RB1A 1K61A 1S7OA 2XGXA 4PJLA 2DMTA 3V78A 1OR7A 4C3IJ 1U8RA 1LDJA 3T6NA 1FOYA 4PFOA 2HYGD 1JHFA 2W85A 1WWXA 4U0YA 1LNWA 4CA0A 3TO9A 1F43A 2M45A 2ISZA 4C3JJ 1SANA 2WGBA 3VOXA 2KRFA 3J80K 1WVRA 2F2EA 2DTRA 2M4GA 1TWHJ 1XGSA 5HS8A 1YLFA 1WI3A 4XONA 1GV5A 2OPTA 4XRFA 1W0TA 2YSRA 1VQLI 1F36A 1HW2A 4F92B 3ON4A 3S1QJ 4NQWA 4BDYA 1HKQA 1D0ZA 3S3OA 4BY7J 4KWAA 2XSJC 2JZYA 2K02A 5A2QK 2IS1A 1OJLA 2QTQA 4JQFA 2UXHA 2A05A 3PNTA 1EKEA 3DKYA 1KU2A 3GTOJ 1BR4A 5F6FA 3BG9A 5EG0A 1MMNA 3RKQA 2EIKH 2XAQA 2DMUA 3JREA 2HYFA 5HDNA 5FRMA 2MC4A 4E7JA 1RC9A 4ZYAA 2V7FA 1T6SA 1GLNA 2PQ8A 4XN0A 1O7LA 2V4JC 1Z67A 3SZTA 1U2WA 5D19A 3EUKL 4Q47A 5H9TA 2HNHA 1S29A 1LFUP 3SYTA 1YW7A 3UNGC 4UXNA 4BE1A 4RAYA 3G1MA 5D6EA 1A31A 4DOZA 1TLHB 2ZMEC 4GXOA 2P5LC 1ZN2A 3FMSA 1HOMA 1Z05A 1Y39A 2FE3A 3LNQA 1FSHA 2LF7A 2R7XA 1UCRA 2WY8Q 4MFDA 4DZJA 2QKOA 5FKKA 3RYPA 1T33A 2LTPA 2BE5F 4MO7A 1IV6A 3I4MJ 2QIBA 1ZELA 5C4JJ 5F27A 2VOPA 2DFIA 3TL4X 1I6XA 1IN5A 1MBJA 1ETYA 2EZIA 1JI8A 3PSIA 3OSGA 3QU6A 1O4XA 1P7JA 2Q8KA 2OD5A 3HBLA 1I1SA 2UUZA 2REKA 2O7TA 3MFKA 5CW8A 2W48A 1UB9A 3MAJA 1YYVA 1IDYA 4ZDOA 5K7HA 3MN2A 3H36A 5D5WB 3F3XA 4RA2A 5CVIA 4F55A 2KJBA 4S05A 2QYOA 3O8HA 4AU7A 4CUGA 3E97A 3HGYA 2MABA 2VBXA 3GMEA 3BG6A 3S32A 2D1HA 1UELB 4HPQA 4AIHA 2XAUA 1B72B 2VQGA 1S72I 3IP4B 5CQEA 2HOTA 5GADJ 5F64A
chains in the Genus database with same CATH topology
3PO2J 2ME6A 1IG7A 4GFLA 3DEWA 4BY1J 2HQ5A 4GCLA 1MBHA 2ZCNA 2D6YA 1QRYA 3Q0WA 1TC3C 4MXMA 1APLC 1NK2P 2G3BA 2XPVA 1XG1A 5BNGA 1MH4A 4B3AA 4MFEA 1ETWA 1BA5A 4A3IJ 3BR6A 4NELA 1ZKGA 3HEFA 2ZCMA 1OCPA 3JR9A 3OSFA 2E2JJ 2VPRA 3JRIA 3Q3SA 4UUTA 3GBGA 5CXIA 3QQAA 4V2FA 3Q0VA 5F08A 4RBOA 3SJMA 1IC8A 1MH3A 2VI6A 3BTIA 2LFBA 2Y2ZA 2EZLA 2EQRA 3VW0A 2LLKA 2NVYJ 3BG5A 4XIDA 3GTJJ 3KKDA 2LVSA 2Y31A 4DZPA 1HF0A 1FJLA 2XGCA 2O9LA 3S2HJ 1MBFA 1MSFC 2G7GA 3KNWA 3F0CA 1WCMJ 5F04A 1B8IB 3DPJA 2GENA 1MBKA 2ID6A 3K2AA 4D5CA 1DU0A 1U9OA 4FE7A 1ZR2A 4XRMA 2OERA 3FISA 2D5VA 1GT0C 3QPSA 1ENHA 1ETVA 2K9NA 2N8GA 1ITYA 2CQXA 3BR1A 2XRLA 4W97A 2GM4A 3PO3J 1RKTA 3P9TA 5FKNA 3ANPA 1XC5A 5D1RA 1UG2A 2KDZA 1NTCA 5FKOA 2Y0SN 1SGMA 2GFNA 1IUFA 5DTDA 3S16J 5EZGA 5DS9A 2MGQA 2ELKA 3CWRA 4FE4A 3ZQFA 1QVUA 2UXIA 4L5EA 2XDNA 1AHDP 3IH4A 2Y30A 1AKHB 1ZQ3P 3VVZA 2UXPA 4D7MA 3S5RA 1P7IA 2M9HA 2ZB9A 2I10A 2YVHA 3BR5A 3VPRA 4MLOA 3A02A 5EZHA 1ZK8A 1DU6A 2JWTA 3VUQA 3GTMJ 2GLOA 1X2MA 2EH3A 3NI7A 4L62A 1WH5A 3WHBA 4Y7NJ 2MSYA 3LWJA 2FQ4A 3EGQA 1ZR4A 2V57A 3GTLJ 3QKXA 5EF6A 2M0CA 3NXCA 4DW6A 1Y1WJ 2H1KA 2JA5J 5E3LA 4A3JJ 1YRNB 4V2GA 4G12A 2FBQA 2TRTA 3GZIA 5GP9A 3BR3A 3ZQGA 3HKZN 1HLVA 5FKLA 4XICA 4CGRA 2DMNA 3CMYA 1VI0A 1HDDC 3HE0A 1GVDA 3IH3A 2AO9A 4NN1A 3EUPA 3LSPA 3HGGA 3GTPJ 2G7LA 2DTZA 2R0QC 4CYCB 3JRAA 2B63J 2ZOYA 1D5YA 4AUXA 2E2HJ 5E3NA 3K7AJ 5C3EJ 1LE8A 5IYCJ 2LKXA 2R5ZA 3BRUA 2E19A 3MKLA 2LY9A 3JRGA 2O7OA 3VVXA 1WPKA 1Z77A 3WHCA 5IP9J 2HOSA 2CJJA 1IJWC 5M3FJ 3HTIA 2R5YA 2GBYA 2L0KA 4FTHA 4JP0A 2JA8J 2X6OA 3I4NJ 3BCGA 3FIWA 1ORKA 2WAQN 4C2MJ 2ME0A 5F0CA 5EGOB 2M34A 2QWTA 3NARA 5F0FA 1CQTA 3S2DJ 2PBXA 5E3OA 3ZQHA 2WB1N 1B72A 2R7ZJ 3COLA 2JK3A 3TP0A 3OOUA 1U78A 2Y9ZA 4GCKA 4QIWN 4QTRA 4XRSG 2CU7A 2LP0A 4B1RA 2JA6J 1JT0A 1H89C 2JN6A 4LOCA 1JKQC 2NS7A 3HTAA 1XS9A 1Y1VJ 2HDDA 1UI6A 1TWGJ 3F1BA 4QSHA 4DYRA 1BL0A 5CXGA 2ID3A 3PM1A 4BBRJ 2QOPA 1IDZA 3FRQA 1JT6A 4XRSA 2YVEA 4A69C 4M3EA 4D7NA 1RPWA 1W0UA 3PPBA 5FLMJ 3VP5A 1WGXA 4ACIA 3RZDJ 3VW2A 1FTZA 2K9QA 3GTQJ 3BR2A 2XB0X 3TEDA 4A3KJ 3W6VA 2W53A 4A3DJ 1B8IA 2Q24A 1TWAJ 3CRJA 5K7ZA 3VW1A 5C4XJ 4NDLA 1HCRA 1UMQA 1X58A 3L1PA 1UI5A 3HTJA 5HSZA 2LD5A 2DA5A 3UKGA 1BW6A 3GTKJ 1RESA 4AYBN 5M5WJ 3S14J 4A3EJ 2CUEA 3MNLA 2XB5A 5F0HA 3LSJA 2YS9A 4A3LJ 3BJBA 3QPLA 3RZOJ 1JUSA 1X2NA 2CQQA 1ETKA 2ECCA 2IEKA 1QPIA 4UUSA 3JRDA 3HOVJ 5GPAA 1JJ6C 2IAIA 1JUPA 2G0EA 3HIMA 2WV1A 5D18A 1JJ8C 2HKUA 2EZHA 2P81A 3TP3A 1AKHA 2UXOA 1JTYA 2X9DA 5IP7J 3HOXJ 5J1RA 2NVTJ 2DG7A 2HYJA 2OF7A 2NVXJ 2XPUA 1PUFB 1GUUA 3IH2A 1SFOJ 2YUSA 2DMPA 5JLXA 1ETXA 1VF9A 5FKMA 5EEAA 5EG0B 3S15J 1JGGA 4AC6A 3V6GA 4A93J 3A01B 3CJDA 1JKRC 4JX5A 1G2HA 4M3FA 5K7FA 4I6ZA 1JKPC 2M2EA 3BT9A 1AU7A 1MSEC 2LR8A 1BJZA 2LK2A 4UDSA 1RR7A 3GTGJ 2XGEA 4FISA 1U8BA 3JRBA 3S17J 2JJ7A 1YRNA 3CDLA 4JYKA 3HB9A 3QBMA 2X48A 3E7LA 2CRGA 4EEFG 2AHQA 2RHAA 5HODA 5FHPA 1GDTA 5M5XJ 2ZOZA 3JSJA 4HNVA 1R9TJ 3GEUA 2YU9J 9ANTA 2HYTA 5F1JA 4D5FA 5IPAA 2XSDC 2L7MP 2HI3A 4CYCA 3BQZA 3VVYA 3G1LA 5EDNA 3ANGA 4IHWA 3JRCA 3HOZJ 5EYRA 3LJLA 1U9NA 5E3MA 3ZQLA 2H8RA 2NP3A 3ON2A 1FIAA 4JX4A 3NPIA 4FCYA 2R93J 3IV5A 3C07A 4YZEA 2MW8A 1I6HJ 5FMPA 1WH7A 4W1UA 2R92J 1A5JA 5C44J 1JKOC 2FX0A 4RDUA 4A3CJ 1FEXA 4GFKA 1GV2A 5IOYA 3VOKA 3ZQCA 2DA4A 3BG3A 3JRFA 1K83J 3O8GA 5EGOA 3A03A 2WUIA 1IRZA 1HDPA 4I76A 4S0HB 2NP5A 4JL3A 1UHSA 2PMZN 3AQSA 3RH2A 2DA3A 5FJ8J 3HOWJ 2E2IJ 1MBGA 1OFCX 3G56A 4MK6A 3B6CA 3FK7A 1QVTA 4IEJA 1FTTA 2K9SA 3OIOA 1ZTRA 4A3MJ 4PXIA 2IBDA 3TW7A 2HXIA 1TWFJ 5GPCA 5FLVA 3O60A 3BTLA 3FK6A 2EZKA 5DAJA 1RKWA 3E7QA 3H0GJ 4J19A 4A3BJ 4M3GA 2ZCXA 4A3FJ 2NVQJ 3KZ9A 5J1YA 3SDGA 1ETOA 4Y52J 3ZOBA 3BTJA 5IP6A 2XGDA 2VKEA 4DYQA 1I50J 2M8GX 2JA7J 4ICHA 3S1RJ 4AC0A 5EFYA 4M6VA 2E1OA 1K61A 1ETQA 2JMWA 4B4CA 2COBA 2DMTA 1MNMC 3V78A 3DCFA 4C3IJ 2F07A 2IU5A 3T6NA 4IHYA 3FKIJ 1OCTC 3D1NI 4GFBA 3MVPA 3RD3A 3VIBA 1LFBA 1F43A 3Q0UA 3G1OA 2GUHA 2L7FP 2DN0A 1H88C 1T56A 4C3JJ 1SANA 2O8KA 3S1NJ 2WGBA 3VOXA 3BHQA 3LHQA 1JUMA 2HOAA 1TWHJ 3JRHA 1WI3A 1GV5A 2OPTA 1W0TA 2RAEA 4A3GJ 1F36A 3ON4A 3S1QJ 1BW5A 1JTXA 2VKVA 3BTCA 5IYDJ 2DA7A 1POGA 4BY7J 4UUSB 4KWAA 2DMQA 2FJ1A 2NX4A 2L9RA 1OJLA 2QTQA 4BKXA 1PUFA 2UXHA 3GTOJ 3G7RA 1VNDA 1EF4A 5J3LA 3BG9A 5EG0A 1IGNA 4GCTA 3HDDA 4M3DA 3A01A 1TWCJ 3RKQA 2TCTA 2DMUA 4IHVA 3JREA 2PZ9A 5IOZA 1S7EA 3HOYJ 2XPWA 4C3HJ 3C2BA 4ME9A 5H9TA 1RETA 5D19A 2KT0A 3HTHA 2FD5A 3RQIA 1LFUP 5HBUA 4JX6A 4ABZA 2Y9YA 3G1MA 3HM5A 3BR0A 5M3MJ 2DG8A 4JNNA 1HOMA 5K58A 2DJNA 5IYBJ 3LNQA 5J1UA 4AF5A 1I3QJ 1E3OC 4MFDA 4DZJA 2EBIA 2QKOA 5FKKA 2DA6A 3S1MJ 1T33A 2LTPA 3LSRA 1Q1VA 4MO7A 1IV6A 3I4MJ 2QIBA 5C4JJ 5F27A 5C4YA 1MBJA 2L7ZA 1ETYA 2EZIA 3LSGA 1ZGWA 2DA2A 2ECBA 3NAUA 3OSGA 4HKUA 2CUFA 1O4XA 4BBSJ 1P7JA 2QF7A 3SFIA 4BXXJ 3IUVA 3HBLA 3CQZJ 5HAWA 4X1EA 4X6AJ 3B6AA 2REKA 3AQTA 1NK3P 2O7TA 3PASA 1A6IA 5CW8A 1FIPA 2W48A 1LE8B 2MG4A 2R5ZB 2DA1A 1IDYA 4M3BA 3M4OJ 5K7HA 1H8AC 3MN2A 2UXUA 5FGLA 2NS8A 3LOCA 3H3VK 5AQCA 2QCOA 3NNRA 3KKCA 3O8HA 4MIMA 3BNIA 2R5YB 3TW6A 5M5YJ 3HGYA 3ZQIA 3M3YJ 3BQYA 2VUMJ 4IHXA 4DYCA 5JLWA 4JKZA 2HXOA 3HOUJ 2K40A 2OI8A 1VFCA 2G7SA 2RASA 4XK4A 1MBEA 3NRGA 1B72B 2NOGA 1Z0XA 3B81A 2HOTA 3CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 J;  2ME6 A;  1IG7 A;  4GFL A;  3DEW A;  4BY1 J;  2HQ5 A;  4GCL A;  1MBH A;  2ZCN A;  2D6Y A;  1QRY A;  3Q0W A;  1TC3 C;  4MXM A;  1APL C;  1NK2 P;  2G3B A;  2XPV A;  1XG1 A;  5BNG A;  1MH4 A;  4B3A A;  4MFE A;  1ETW A;  1BA5 A;  4A3I J;  3BR6 A;  4NEL A;  1ZKG A;  3HEF A;  2ZCM A;  1OCP A;  3JR9 A;  3OSF A;  2E2J J;  2VPR A;  3JRI A;  3Q3S A;  4UUT A;  3GBG A;  5CXI A;  3QQA A;  4V2F A;  3Q0V A;  5F08 A;  4RBO A;  3SJM A;  1IC8 A;  1MH3 A;  2VI6 A;  3BTI A;  2LFB A;  2Y2Z A;  2EZL A;  2EQR A;  3VW0 A;  2LLK A;  2NVY J;  3BG5 A;  4XID A;  3GTJ J;  3KKD A;  2LVS A;  2Y31 A;  4DZP A;  1HF0 A;  1FJL A;  2XGC A;  2O9L A;  3S2H J;  1MBF A;  1MSF C;  2G7G A;  3KNW A;  3F0C A;  1WCM J;  5F04 A;  1B8I B;  3DPJ A;  2GEN A;  1MBK A;  2ID6 A;  3K2A A;  4D5C A;  1DU0 A;  1U9O A;  4FE7 A;  1ZR2 A;  4XRM A;  2OER A;  3FIS A;  2D5V A;  1GT0 C;  3QPS A;  1ENH A;  1ETV A;  2K9N A;  2N8G A;  1ITY A;  2CQX A;  3BR1 A;  2XRL A;  4W97 A;  2GM4 A;  3PO3 J;  1RKT A;  3P9T A;  5FKN A;  3ANP A;  1XC5 A;  5D1R A;  1UG2 A;  2KDZ A;  1NTC A;  5FKO A;  2Y0S N;  1SGM A;  2GFN A;  1IUF A;  5DTD A;  3S16 J;  5EZG A;  5DS9 A;  2MGQ A;  2ELK A;  3CWR A;  4FE4 A;  3ZQF A;  1QVU A;  2UXI A;  4L5E A;  2XDN A;  1AHD P;  3IH4 A;  2Y30 A;  1AKH B;  1ZQ3 P;  3VVZ A;  2UXP A;  4D7M A;  3S5R A;  1P7I A;  2M9H A;  2ZB9 A;  2I10 A;  2YVH A;  3BR5 A;  3VPR A;  4MLO A;  3A02 A;  5EZH A;  1ZK8 A;  1DU6 A;  2JWT A;  3VUQ A;  3GTM J;  2GLO A;  1X2M A;  2EH3 A;  3NI7 A;  4L62 A;  1WH5 A;  3WHB A;  4Y7N J;  2MSY A;  3LWJ A;  2FQ4 A;  3EGQ A;  1ZR4 A;  2V57 A;  3GTL J;  3QKX A;  5EF6 A;  2M0C A;  3NXC A;  4DW6 A;  1Y1W J;  2H1K A;  2JA5 J;  5E3L A;  4A3J J;  1YRN B;  4V2G A;  4G12 A;  2FBQ A;  2TRT A;  3GZI A;  5GP9 A;  3BR3 A;  3ZQG A;  3HKZ N;  1HLV A;  5FKL A;  4XIC A;  4CGR A;  2DMN A;  3CMY A;  1VI0 A;  1HDD C;  3HE0 A;  1GVD A;  3IH3 A;  2AO9 A;  4NN1 A;  3EUP A;  3LSP A;  3HGG A;  3GTP J;  2G7L A;  2DTZ A;  2R0Q C;  4CYC B;  3JRA A;  2B63 J;  2ZOY A;  1D5Y A;  4AUX A;  2E2H J;  5E3N A;  3K7A J;  5C3E J;  1LE8 A;  5IYC J;  2LKX A;  2R5Z A;  3BRU A;  2E19 A;  3MKL A;  2LY9 A;  3JRG A;  2O7O A;  3VVX A;  1WPK A;  1Z77 A;  3WHC A;  5IP9 J;  2HOS A;  2CJJ A;  1IJW C;  5M3F J;  3HTI A;  2R5Y A;  2GBY A;  2L0K A;  4FTH A;  4JP0 A;  2JA8 J;  2X6O A;  3I4N J;  3BCG A;  3FIW A;  1ORK A;  2WAQ N;  4C2M J;  2ME0 A;  5F0C A;  5EGO B;  2M34 A;  2QWT A;  3NAR A;  5F0F A;  1CQT A;  3S2D J;  2PBX A;  5E3O A;  3ZQH A;  2WB1 N;  1B72 A;  2R7Z J;  3COL A;  2JK3 A;  3TP0 A;  3OOU A;  1U78 A;  2Y9Z A;  4GCK A;  4QIW N;  4QTR A;  4XRS G;  2CU7 A;  2LP0 A;  4B1R A;  2JA6 J;  1JT0 A;  1H89 C;  2JN6 A;  4LOC A;  1JKQ C;  2NS7 A;  3HTA A;  1XS9 A;  1Y1V J;  2HDD A;  1UI6 A;  1TWG J;  3F1B A;  4QSH A;  4DYR A;  1BL0 A;  5CXG A;  2ID3 A;  3PM1 A;  4BBR J;  2QOP A;  1IDZ A;  3FRQ A;  1JT6 A;  4XRS A;  2YVE A;  4A69 C;  4M3E A;  4D7N A;  1RPW A;  1W0U A;  3PPB A;  5FLM J;  3VP5 A;  1WGX A;  4ACI A;  3RZD J;  3VW2 A;  1FTZ A;  2K9Q A;  3GTQ J;  3BR2 A;  2XB0 X;  3TED A;  4A3K J;  3W6V A;  2W53 A;  4A3D J;  1B8I A;  2Q24 A;  1TWA J;  3CRJ A;  5K7Z A;  3VW1 A;  5C4X J;  4NDL A;  1HCR A;  1UMQ A;  1X58 A;  3L1P A;  1UI5 A;  3HTJ A;  5HSZ A;  2LD5 A;  2DA5 A;  3UKG A;  1BW6 A;  3GTK J;  1RES A;  4AYB N;  5M5W J;  3S14 J;  4A3E J;  2CUE A;  3MNL A;  2XB5 A;  5F0H A;  3LSJ A;  2YS9 A;  4A3L J;  3BJB A;  3QPL A;  3RZO J;  1JUS A;  1X2N A;  2CQQ A;  1ETK A;  2ECC A;  2IEK A;  1QPI A;  4UUS A;  3JRD A;  3HOV J;  5GPA A;  1JJ6 C;  2IAI A;  1JUP A;  2G0E A;  3HIM A;  2WV1 A;  5D18 A;  1JJ8 C;  2HKU A;  2EZH A;  2P81 A;  3TP3 A;  1AKH A;  2UXO A;  1JTY A;  2X9D A;  5IP7 J;  3HOX J;  5J1R A;  2NVT J;  2DG7 A;  2HYJ A;  2OF7 A;  2NVX J;  2XPU A;  1PUF B;  1GUU A;  3IH2 A;  1SFO J;  2YUS A;  2DMP A;  5JLX A;  1ETX A;  1VF9 A;  5FKM A;  5EEA A;  5EG0 B;  3S15 J;  1JGG A;  4AC6 A;  3V6G A;  4A93 J;  3A01 B;  3CJD A;  1JKR C;  4JX5 A;  1G2H A;  4M3F A;  5K7F A;  4I6Z A;  1JKP C;  2M2E A;  3BT9 A;  1AU7 A;  1MSE C;  2LR8 A;  1BJZ A;  2LK2 A;  4UDS A;  1RR7 A;  3GTG J;  2XGE A;  4FIS A;  1U8B A;  3JRB A;  3S17 J;  2JJ7 A;  1YRN A;  3CDL A;  4JYK A;  3HB9 A;  3QBM A;  2X48 A;  3E7L A;  2CRG A;  4EEF G;  2AHQ A;  2RHA A;  5HOD A;  5FHP A;  1GDT A;  5M5X J;  2ZOZ A;  3JSJ A;  4HNV A;  1R9T J;  3GEU A;  2YU9 J;  9ANT A;  2HYT A;  5F1J A;  4D5F A;  5IPA A;  2XSD C;  2L7M P;  2HI3 A;  4CYC A;  3BQZ A;  3VVY A;  3G1L A;  5EDN A;  3ANG A;  4IHW A;  3JRC A;  3HOZ J;  5EYR A;  3LJL A;  1U9N A;  5E3M A;  3ZQL A;  2H8R A;  2NP3 A;  3ON2 A;  1FIA A;  4JX4 A;  3NPI A;  4FCY A;  2R93 J;  3IV5 A;  3C07 A;  4YZE A;  2MW8 A;  1I6H J;  5FMP A;  1WH7 A;  4W1U A;  2R92 J;  1A5J A;  5C44 J;  1JKO C;  2FX0 A;  4RDU A;  4A3C J;  1FEX A;  4GFK A;  1GV2 A;  5IOY A;  3VOK A;  3ZQC A;  2DA4 A;  3BG3 A;  3JRF A;  1K83 J;  3O8G A;  5EGO A;  3A03 A;  2WUI A;  1IRZ A;  1HDP A;  4I76 A;  4S0H B;  2NP5 A;  4JL3 A;  1UHS A;  2PMZ N;  3AQS A;  3RH2 A;  2DA3 A;  5FJ8 J;  3HOW J;  2E2I J;  1MBG A;  1OFC X;  3G56 A;  4MK6 A;  3B6C A;  3FK7 A;  1QVT A;  4IEJ A;  1FTT A;  2K9S A;  3OIO A;  1ZTR A;  4A3M J;  4PXI A;  2IBD A;  3TW7 A;  2HXI A;  1TWF J;  5GPC A;  5FLV A;  3O60 A;  3BTL A;  3FK6 A;  2EZK A;  5DAJ A;  1RKW A;  3E7Q A;  3H0G J;  4J19 A;  4A3B J;  4M3G A;  2ZCX A;  4A3F J;  2NVQ J;  3KZ9 A;  5J1Y A;  3SDG A;  1ETO A;  4Y52 J;  3ZOB A;  3BTJ A;  5IP6 A;  2XGD A;  2VKE A;  4DYQ A;  1I50 J;  2M8G X;  2JA7 J;  4ICH A;  3S1R J;  4AC0 A;  5EFY A;  4M6V A;  2E1O A;  1K61 A;  1ETQ A;  2JMW A;  4B4C A;  2COB A;  2DMT A;  1MNM C;  3V78 A;  3DCF A;  4C3I J;  2F07 A;  2IU5 A;  3T6N A;  4IHY A;  3FKI J;  1OCT C;  3D1N I;  4GFB A;  3MVP A;  3RD3 A;  3VIB A;  1LFB A;  1F43 A;  3Q0U A;  3G1O A;  2GUH A;  2L7F P;  2DN0 A;  1H88 C;  1T56 A;  4C3J J;  1SAN A;  2O8K A;  3S1N J;  2WGB A;  3VOX A;  3BHQ A;  3LHQ A;  1JUM A;  2HOA A;  1TWH J;  3JRH A;  1WI3 A;  1GV5 A;  2OPT A;  1W0T A;  2RAE A;  4A3G J;  1F36 A;  3ON4 A;  3S1Q J;  1BW5 A;  1JTX A;  2VKV A;  3BTC A;  5IYD J;  2DA7 A;  1POG A;  4BY7 J;  4UUS B;  4KWA A;  2DMQ A;  2FJ1 A;  2NX4 A;  2L9R A;  1OJL A;  2QTQ A;  4BKX A;  1PUF A;  2UXH A;  3GTO J;  3G7R A;  1VND A;  1EF4 A;  5J3L A;  3BG9 A;  5EG0 A;  1IGN A;  4GCT A;  3HDD A;  4M3D A;  3A01 A;  1TWC J;  3RKQ A;  2TCT A;  2DMU A;  4IHV A;  3JRE A;  2PZ9 A;  5IOZ A;  1S7E A;  3HOY J;  2XPW A;  4C3H J;  3C2B A;  4ME9 A;  5H9T A;  1RET A;  5D19 A;  2KT0 A;  3HTH A;  2FD5 A;  3RQI A;  1LFU P;  5HBU A;  4JX6 A;  4ABZ A;  2Y9Y A;  3G1M A;  3HM5 A;  3BR0 A;  5M3M J;  2DG8 A;  4JNN A;  1HOM A;  5K58 A;  2DJN A;  5IYB J;  3LNQ A;  5J1U A;  4AF5 A;  1I3Q J;  1E3O C;  4MFD A;  4DZJ A;  2EBI A;  2QKO A;  5FKK A;  2DA6 A;  3S1M J;  1T33 A;  2LTP A;  3LSR A;  1Q1V A;  4MO7 A;  1IV6 A;  3I4M J;  2QIB A;  5C4J J;  5F27 A;  5C4Y A;  1MBJ A;  2L7Z A;  1ETY A;  2EZI A;  3LSG A;  1ZGW A;  2DA2 A;  2ECB A;  3NAU A;  3OSG A;  4HKU A;  2CUF A;  1O4X A;  4BBS J;  1P7J A;  2QF7 A;  3SFI A;  4BXX J;  3IUV A;  3HBL A;  3CQZ J;  5HAW A;  4X1E A;  4X6A J;  3B6A A;  2REK A;  3AQT A;  1NK3 P;  2O7T A;  3PAS A;  1A6I A;  5CW8 A;  1FIP A;  2W48 A;  1LE8 B;  2MG4 A;  2R5Z B;  2DA1 A;  1IDY A;  4M3B A;  3M4O J;  5K7H A;  1H8A C;  3MN2 A;  2UXU A;  5FGL A;  2NS8 A;  3LOC A;  3H3V K;  5AQC A;  2QCO A;  3NNR A;  3KKC A;  3O8H A;  4MIM A;  3BNI A;  2R5Y B;  3TW6 A;  5M5Y J;  3HGY A;  3ZQI A;  3M3Y J;  3BQY A;  2VUM J;  4IHX A;  4DYC A;  5JLW A;  4JKZ A;  2HXO A;  3HOU J;  2K40 A;  2OI8 A;  1VFC A;  2G7S A;  2RAS A;  4XK4 A;  1MBE A;  3NRG A;  1B72 B;  2NOG A;  1Z0X A;  3B81 A;  2HOT A;  3CCY A; 
#chains in the Genus database with same CATH topology
 4GO1 A;  2HDW A;  2KZG A;  3GUD A;  3FZV A;  4AID A;  3F21 A;  2HQ5 A;  2OJE D;  4XKC A;  4AD9 A;  4CCN A;  4GCL A;  2D6Y A;  4CCK A;  4HLY A;  1RNL A;  1DUX C;  3ERE D;  4LB6 B;  1NK2 P;  4A5N A;  4DBR A;  2YR2 A;  4LG0 B;  1TL8 A;  1ETW A;  4M6Y A;  3HYI A;  1X1A A;  2M7B A;  4Z6Y A;  1LKX A;  4A3I J;  4NEL A;  3J7Z I;  2E2J J;  3JRI A;  3Q3S A;  2BHZ A;  2ZNY A;  2A5W A;  2K7L A;  2V9P A;  2A07 F;  4B47 A;  3DU6 A;  3SJM A;  1MH3 A;  2W24 A;  4BHB A;  3FXR A;  3VB2 A;  2VOD A;  4PZJ A;  3VW0 A;  2H1L A;  2DT6 A;  2LLK A;  4XID A;  3GTJ J;  4CGZ A;  2LVS A;  1OCC H;  2KIS A;  2Q2E A;  5CLS A;  2HOE A;  3K4M A;  3ZN0 A;  1Y6I A;  2R7T A;  1TQP A;  1A35 A;  4HRI A;  1U9O A;  2D5V A;  1GT0 C;  4E7K A;  3BR1 A;  2XRL A;  4EM2 A;  2GM4 A;  3PO3 J;  4NNJ A;  1RKT A;  1EJ9 A;  2PJR B;  3P9T A;  5J8F A;  1XSV A;  1AOY A;  4RGS A;  2R7D A;  3R60 A;  2IA1 A;  5J6X A;  2DCE A;  2E1M C;  4EJT A;  3CMA I;  4IX7 A;  3RCO A;  2O61 A;  2UXI A;  3OL3 A;  2XAF A;  1AHD P;  3TOB A;  5CQG A;  4XM3 A;  2J5P A;  1ZQ3 P;  2FOW A;  2BY1 A;  3S5R A;  2DFF A;  2M9H A;  1Z6T A;  3OIP A;  4G8X A;  1R5H A;  2BY2 A;  4MLO A;  2BV6 A;  3A02 A;  5EZH A;  1SD5 A;  1ZK8 A;  3MCZ A;  1PP7 U;  2KP6 A;  3GTM J;  2EH3 A;  4Y7N J;  2MSY A;  3B02 A;  1TNS A;  2FMY A;  2M0C A;  4NC6 A;  1Z1D A;  3AG2 H;  5CKT A;  3BWG A;  4BAY A;  4PFP A;  4DW6 A;  2R7U A;  2DQL A;  4MEY F;  1KGS A;  1XCB A;  4HV6 A;  4GDF A;  2LOO A;  3FXO A;  2H27 A;  2HEO A;  3F8B A;  2VQL A;  5GP9 A;  3H5N A;  5AIQ A;  4OIN F;  3ZQG A;  4NC7 A;  5FKL A;  2UZK A;  3ABK H;  3HSF A;  4GYG A;  2ZKZ A;  4Y33 A;  2X4H A;  2DMN A;  2JSP A;  2M8E A;  3HRT A;  3KZI C;  2GXG A;  3IH3 A;  2VBZ A;  3R61 A;  3CCU I;  2Z9O A;  4L9N A;  2E35 A;  5BS6 A;  3HGG A;  4BQQ A;  3IRR A;  4ITV A;  2G7L A;  1T95 A;  1FBS A;  3JRA A;  2B63 J;  2ZOY A;  2A6T A;  3ASN H;  3WTV C;  3KLN A;  4AUX A;  2AQE A;  4ZTJ A;  5BPD A;  3TGN A;  3OL4 A;  3T8T A;  1LE8 A;  4M71 A;  3HIF A;  3COA C;  3R0A A;  5E1Z B;  2O7O A;  2W25 A;  4YIF A;  2K27 A;  1IN4 A;  3PFY A;  1BI0 A;  5TGT A;  3DPU A;  4AVZ A;  2R5Y A;  2ZJQ F;  4XOR A;  4FTH A;  3OYF A;  4JP0 A;  4IRI A;  2QZ8 A;  2Q1Z B;  3FIW A;  1PDN C;  2EV0 A;  2A61 A;  3BJO A;  3WG7 H;  3W2W A;  3ERM A;  4C2M J;  3CUQ A;  5GAG J;  5EGO B;  2VE8 A;  2JVH A;  2E36 A;  3JAM K;  4FT8 A;  4IOC F;  5E3O A;  1W5T A;  3ZQH A;  2WB1 N;  2I8D A;  1XMX A;  3COL A;  1PYV A;  2CO5 A;  2JK3 A;  3OOU A;  1VQP I;  1U78 A;  3GLX A;  1KU7 A;  4GCK A;  3CDI A;  3M07 A;  1MMD A;  3H35 A;  1OCO H;  3HRS A;  3IRQ A;  2BY0 A;  4B1R A;  4CXF A;  1D3Y A;  4F52 A;  1JKQ C;  1WI9 A;  3LFK A;  3X2Q H;  1XS9 A;  1VQ5 I;  2K4B A;  1GXP A;  1TWG J;  1YQA A;  3GLL A;  3AL0 B;  1L0O C;  1VQN I;  4QSH A;  4LB5 A;  4I98 B;  4O6J A;  2ELH A;  4DYR A;  3SFZ A;  1D0Y A;  2FOK A;  3PM1 A;  5KAI C;  1BOA A;  3K10 A;  4HF2 A;  1JT6 A;  2O3F A;  3EYY A;  1W0U A;  1ACI A;  5FLM J;  2IGN A;  1WGX A;  1Y56 A;  2HGC A;  3EDP A;  3PSF A;  4IL6 C;  4R1H A;  4ACI A;  3KEQ A;  3BZK A;  3BR2 A;  1R36 A;  1DPR A;  3K1P A;  1QA6 A;  1X19 A;  3GZ5 A;  3OYA A;  2DK8 A;  2M7A A;  1HCR A;  1UMQ A;  3K8P C;  2CUJ A;  5H20 A;  3FKJ A;  5B3S H;  2YPR A;  1BW6 A;  3SDB A;  3GTK J;  1MKM A;  4XSX F;  2L2O A;  4UVC A;  4A3E J;  3S14 J;  3LSJ A;  3BJB A;  1YO5 C;  2V26 A;  4KIB A;  3QPL A;  4XLC A;  2CQQ A;  1ETK A;  3CC4 I;  4ETS A;  4MNU A;  4HST A;  3ZGK A;  3JRD A;  2OZ6 A;  4O5V A;  3V4G A;  1JJ6 C;  2PEX A;  3U2R A;  4B43 A;  2WV1 A;  2IGK A;  2FBI A;  5D18 A;  1ZAO A;  4ZYD A;  2L9V A;  3TP3 A;  1AKH A;  3RJP A;  5LEJ A;  1D8K A;  1UFM A;  2GXB A;  1JTY A;  2NVT J;  1XSX A;  1SFE A;  5J1R A;  3OYC A;  2IS6 A;  2DG7 A;  2OF7 A;  2NVX J;  4IOA F;  1Y8R B;  5IT9 Z;  3KYC B;  1WJA A;  2KRH A;  4A0Y A;  2WAQ A;  5FLX Z;  3OYN A;  2DMP A;  4I7H A;  5JLX A;  5GAE J;  2FF4 A;  4OAZ A;  4CZZ A;  3WTY C;  1ETX A;  2V6E A;  3V6G A;  1QHG A;  3S15 J;  3A0H C;  3BCA A;  4AC6 A;  4A93 J;  3A01 B;  4EGY A;  4OMY A;  1W5C C;  3HSE A;  4E6K G;  4JX5 A;  1G2H A;  5K7F A;  1R71 A;  2HWV A;  2BOL A;  5LD2 C;  1ZRD A;  5LHH A;  2HU9 A;  2L9S A;  3T1B A;  2XGE A;  4OOI A;  1U8B A;  3JRB A;  3S17 J;  4WF2 A;  2K3P A;  3CDL A;  3DTK A;  1P2F A;  4BQO A;  1WZ2 A;  2M30 A;  4EMS A;  2G7U A;  3PUB A;  1JHH A;  5AIP A;  4EEF G;  1SVM A;  2ZY9 A;  2HVQ A;  4YFK F;  2M5W A;  2OAZ A;  3G3Z A;  5HS9 A;  4B09 A;  5FHP A;  3E0J B;  1H0M A;  3F8N A;  2DO7 A;  3JTH A;  3JSJ A;  1EH8 A;  4HNV A;  4ENJ A;  3VYS B;  3GEU A;  3IL2 A;  4D5F A;  1DP7 P;  3ZMZ A;  4RAF A;  4LGW A;  3C2H A;  3FM3 A;  3L2W A;  4KIG A;  2XDV A;  5E3M A;  3ZQL A;  2QQ8 A;  1SFU A;  5J47 A;  1J59 A;  2OUM A;  3NPI A;  2JUG A;  2P7V B;  2EFQ A;  2QSH X;  4U0V A;  2MW8 A;  2HPI A;  2QQB A;  1WH7 A;  3LMM A;  3D5R C;  1JKO C;  2BZT A;  3VYT B;  5H6R A;  4N9H A;  2A68 F;  2MYS A;  2P4W A;  3LA2 A;  2DPU A;  2W1O A;  2Z99 A;  1HW5 A;  1YIJ I;  1GV2 A;  4X0G A;  5IOY A;  3VOK A;  2DOE A;  2A5Y B;  2VC1 A;  2X51 A;  3BP8 A;  2KRC A;  3O8G A;  5D8L B;  4L18 B;  3A03 A;  2WUI A;  4EVI A;  4S0H B;  2R7S A;  2NP5 A;  3RH2 A;  1B9M A;  3ROU A;  3MQ0 A;  3CJR B;  1MBG A;  3OR1 C;  3QYE A;  3MKY B;  4OD5 A;  1OFC X;  2OC6 A;  4L5J A;  4MK6 A;  2ZME A;  3E5Q A;  2MLG A;  1TQM A;  3S2W A;  5L3G A;  3TW7 A;  2PFB A;  1D1B A;  5DUI A;  3BTL A;  2HKX A;  3WE2 A;  2CH0 A;  4HAM A;  1B6A A;  1UHW A;  4UB8 C;  1LVA A;  4DQ2 A;  4UVB A;  1R5I D;  2D2W A;  5DYM A;  2VL8 A;  3KZ9 A;  1BBY A;  1OYI A;  3ZOB A;  1QZY A;  4S04 A;  4F3Q A;  3LAJ A;  3C2G A;  2VKE A;  3BZC A;  1SEU A;  2VAS A;  1MMG A;  1Z7U A;  5ILV A;  1BN5 A;  4BXU A;  5AON A;  5EFY A;  1ZLJ A;  1MZB A;  1KU9 A;  3TO6 A;  2IXS A;  2VJ5 A;  4KMU X;  1MNM C;  4XLN F;  2F07 A;  4HX8 A;  2IU5 A;  3KYL A;  1HC8 A;  3K4L A;  1X1C A;  3WTX C;  3VYR B;  4GFB A;  3MVP A;  2DDA A;  2ADU A;  2P5V A;  3RD3 A;  1XDU A;  4FX0 A;  4II3 A;  2EFW A;  3G1O A;  4A12 A;  2KQR A;  2DN0 A;  4E7L A;  1T56 A;  2O8K A;  3ZP5 A;  3LWF A;  2KIF A;  3LHQ A;  1VQ7 I;  1RUN A;  3OS2 A;  4E7I A;  3F8M A;  2OV7 A;  3JRH A;  2E1N A;  2RAE A;  3V42 A;  4E7Z A;  1MDM B;  1JTX A;  1R1U A;  3BTC A;  2JRT A;  2RQQ A;  2GA2 A;  2VKV A;  4G7H F;  2DAO A;  1POG A;  4UUS B;  3MEX A;  2KMU A;  2L9R A;  4CYD A;  3AAF A;  1QO0 D;  3L2R A;  1PUF A;  2TDX A;  2MLK A;  4CZC A;  3ASO H;  1NH3 A;  3K70 C;  3Q9V A;  3I71 A;  3CP8 A;  3S93 A;  1LDD A;  4M3D A;  4G6Q A;  4IHV A;  1ON1 A;  1V54 H;  2RGV A;  5IT9 K;  5IOZ A;  1Z7L A;  3MZ8 A;  4LG3 A;  5FFZ A;  3N97 A;  1S7E A;  3HOY J;  2XPW A;  3ABL H;  4LMY A;  5FLX K;  4F91 B;  3PFI A;  4ME9 A;  2H94 A;  3E6D A;  4BJT A;  5B5E C;  1O3T A;  3RQI A;  4L5I A;  1SVO A;  3UR3 C;  1FYK A;  3K4N A;  4JX6 A;  4JK1 X;  1S8N A;  5FD5 A;  5M3M J;  3BR0 A;  2RRE A;  3C3W A;  2DG8 A;  2F4O B;  3HUG A;  3CCQ I;  4P5O A;  4IKF A;  3TBI A;  4JNN A;  1ZYR F;  3V8J A;  2VOO A;  5J1U A;  3FBN B;  3KP3 A;  4I09 A;  1KQ8 A;  2EBI A;  3AL0 C;  4XLH A;  2DA6 A;  3S1M J;  3LSR A;  2HZD A;  2VC0 A;  4MTE A;  3W2A A;  1B4A A;  3RPU A;  3DLA A;  4DIQ A;  1ZGW A;  3I59 B;  1RIO H;  3I56 I;  3QYB A;  1FMW A;  1W5S A;  2QLZ A;  4IPA A;  3K4K A;  1QQI A;  2KFD A;  3U21 A;  2MA3 A;  5E8I A;  3CQZ J;  1FOK A;  5HAW A;  2RDP A;  3EQL F;  5K5R A;  3J7A O;  3P9I A;  4AYB A;  2DOA A;  3AQT A;  1DGW Y;  2X1D A;  3K2Z A;  1SMY F;  4UV9 A;  2MG4 A;  3VFZ A;  5LFA A;  1H8A C;  1BI2 A;  1R4N B;  2UXU A;  1EA3 A;  1R58 A;  1P6R A;  1Z3X A;  2NS8 A;  3A4C A;  3LOC A;  5J4Y A;  2VIX A;  3J81 K;  3H3V K;  3LSM A;  4HV5 A;  4C2M A;  5M5Y J;  3ZQI A;  5K5Q A;  3OYB A;  3BQY A;  2VUM J;  1BI1 A;  4IHX A;  1SC7 A;  5KHD A;  4JKZ A;  2HXO A;  1OLT A;  1B1B A;  2L54 A;  3CES A;  5H2F C;  1VFC A;  5E17 F;  1U3E M;  1J09 A;  2MBF A;  3PNV A;  1IRG A;  2MC3 A;  2QSF X;  2EFO A;  1IXS B;  3CCM I;  3JSO A;  3B81 A;  1XMK A;  3EUH A;  4IZZ A;  3PO2 J;  1ZGJ A;  3WOD F;  1K78 A;  4BJ5 C;  2ME6 A;  1IG7 A;  1IF1 A;  2ZC2 A;  2QQ9 A;  1X1D A;  1XGO A;  3CO7 C;  4BY1 J;  1MBH A;  2ZCN A;  1HKT A;  5CVU A;  1QRY A;  3Q0W A;  3ZMD A;  1TC3 C;  1BM9 A;  1D8J A;  4XQF A;  3RKX A;  1XG1 A;  1NG7 A;  3IAS 2;  2QBY B;  1R49 A;  3BJ6 A;  4ZYE A;  2M0M A;  3HEF A;  1R1V A;  4UV8 A;  1OCP A;  3L2Q A;  3CME I;  1TW3 A;  3OSF A;  1T2K A;  2ZCM A;  3GBG A;  3DBR B;  1OCZ H;  2PBI A;  3Q0V A;  2VXZ A;  4V2F A;  3W2V A;  2DFE A;  2R7O A;  3V7R A;  1MD0 A;  3BTI A;  3DEU A;  4RB0 A;  2EQR A;  3KP2 A;  1PUE E;  4DZP A;  1FJL A;  2P6S A;  4FET A;  4BH9 A;  5TRD A;  3S2H J;  3BPX A;  1WFX A;  2G7G A;  3O3K A;  1WCM J;  2L5Q A;  5L3D A;  3L2V A;  2HZT A;  1B8I B;  2VBW A;  1DU0 A;  2LY1 A;  5BPI A;  4XRM A;  4OAY A;  1OCR H;  3QPS A;  4W97 A;  2GOM A;  2IGM A;  2RVC A;  3MZY A;  5FKN A;  4ZDL A;  2KDO A;  1Y8Q B;  2L02 A;  1UG2 A;  1NTC A;  1AA7 A;  2PLY A;  4BE0 A;  4WWC A;  2GFN A;  1IUF A;  5DTD A;  2Z2S B;  4R8H A;  5EZG A;  3S16 J;  2LBF B;  1ONV A;  3ELK A;  2ELK A;  4FE4 A;  1FYL A;  3GZN B;  3ZQF A;  4HQE A;  2DYR H;  5IY5 H;  3J7Y J;  1IRX A;  3H9G A;  2XDN A;  4D9J A;  3VVZ A;  2E71 A;  2UXP A;  2YVH A;  2I10 A;  2X6Y A;  2E5Z A;  2WBM A;  2JWT A;  2PMZ A;  3VUQ A;  1X2M A;  2OTL I;  3NI7 A;  2KIM A;  4L62 A;  4YG2 F;  3GO5 A;  3CUO A;  2WY7 Q;  4N4N B;  3IKT A;  2FQ4 A;  1VQ8 I;  3PJR A;  3F6O A;  2W00 A;  4LJZ F;  3NXC A;  1YW8 A;  4YFX F;  1HQC A;  1QZZ A;  3LA3 A;  1Y1W J;  2OA4 A;  2JA5 J;  5E3L A;  4EGZ A;  1YRN B;  4KNY A;  2QVO A;  4V2G A;  3ZCO A;  2RN7 A;  3E1S A;  4G12 A;  3GZI A;  5CVR A;  5D5V B;  5D6F A;  3HOT A;  1F9N A;  4CGR A;  2HTJ A;  2WAD A;  4KN4 X;  3TO7 A;  3CMY A;  1HDD C;  1VI0 A;  1LJ9 A;  1GVD A;  3FM5 A;  1LQ1 A;  3F8F A;  2AO9 A;  3EUP A;  3R4K A;  3LSP A;  2DW4 A;  2DTZ A;  4CYC B;  2QWW A;  3CF2 A;  3FMQ A;  2GZW A;  3I54 A;  1S9H A;  1OYY A;  3DLL F;  1MIJ A;  1E3H A;  4XMY A;  2NNY A;  3LSI A;  5TIS C;  5IYC J;  2ZJ2 A;  2KPM A;  2JA2 A;  2E19 A;  3MKL A;  1OPC A;  2LY9 A;  5LEK A;  3PNY A;  3VVX A;  1WPK A;  1YIO A;  1SD7 A;  1Z77 A;  5IP9 J;  3LAP A;  2CJJ A;  2CSO A;  2HR3 A;  3G71 I;  2P0W A;  1A04 A;  2V6C A;  5M3F J;  3OWT A;  2QQA A;  3E3V A;  3F6V A;  2X6O A;  3I4N J;  1ORK A;  2Y0S A;  3EYI A;  2D45 A;  3H92 A;  5F0C A;  4B48 A;  2JPC A;  2QWT A;  3DQV C;  3K4J A;  4HNT A;  3OYM A;  1HXD A;  5HLT A;  3S2D J;  3ABM H;  4IRH A;  1B72 A;  3E6B A;  2PI0 A;  2R7Z J;  4Y15 A;  3CJQ B;  5DUK A;  3CC7 I;  3ZRG A;  2KHM A;  2VPL A;  2R7R A;  2BBY A;  1OMI A;  4QTR A;  2CU7 A;  1R22 A;  2JA6 J;  2KIU A;  5E1X A;  3LFU A;  1UAA A;  3HTA A;  4LG0 A;  1EH7 A;  4L9T A;  4OIQ F;  4PUS A;  3ZQ7 A;  1FBU A;  1SFK A;  1IDZ A;  2JVG A;  3GXO A;  5CVJ A;  2FML A;  3VP5 A;  5DCM B;  4LLG F;  4KDP A;  4BGD A;  1BC7 C;  3KEO A;  1WJE A;  1TP4 A;  1VZ0 A;  5B66 C;  4A3K J;  5B1B H;  3GFI A;  2W53 A;  4Y3O A;  4YEJ A;  2XF5 A;  2NOJ B;  2Q2E B;  3L1P A;  3HTJ A;  1UI5 A;  4KT5 C;  3FXK A;  1Z21 A;  1WHU A;  2DK5 A;  5ICE A;  3KZY A;  4H0E A;  1RES A;  4AYB N;  2PJR A;  4ON0 A;  1FOX A;  1L3L A;  4ESJ A;  4U88 A;  3HXL A;  3QP6 A;  2H6B A;  1QPI A;  2COM A;  3S3M A;  5FO5 A;  3I58 A;  4GYI A;  4ANJ A;  3SQN A;  3LA7 A;  1WJC A;  3OS0 A;  4J00 A;  2DOD A;  4HBL A;  1QBJ A;  4DVY P;  5HLH A;  2L4M A;  2F5C A;  2CWE A;  2BEO A;  2P7C B;  4KIT B;  5LHI A;  4HA8 A;  3N4M A;  1E2X A;  1VQ4 I;  1W7P D;  5FRO A;  1GUU A;  3IH2 A;  2CFX A;  5FKM A;  2V1U A;  3G73 A;  2ZBK A;  1FNN A;  2STW A;  3KE2 A;  3E6C C;  3EUH C;  2Z5U A;  1JKR C;  1IRF A;  3GZ6 A;  3VEP A;  5L3C A;  4IVN A;  1AU7 A;  3M8F A;  1BJZ A;  1UG0 A;  2LK2 A;  4MHG A;  5BOX A;  1CF7 A;  4UDS A;  1RR7 A;  3GTG J;  3JSP A;  3K70 D;  4XSZ F;  3SWH A;  4KIC A;  4PSW A;  4BXF A;  3ECO A;  3DWL E;  3QPT A;  4HQM A;  2CRG A;  5GTI C;  2P5K A;  3H1C A;  1XD7 A;  2DU9 A;  5DEQ A;  2RHA A;  1T08 B;  5ILU A;  2W82 A;  3RQ4 A;  5E1W A;  3FXQ A;  1U5T B;  4HX4 A;  4LD5 A;  1GDT A;  4BEH B;  1O3S A;  1VQ6 I;  4L0Y B;  2ZOZ A;  2XRO A;  1R9T J;  4UUV A;  2GAU A;  5BMZ A;  1W7P A;  3FX3 A;  5F1J A;  5IPA A;  5EDN A;  3NWT A;  4TV7 A;  1ZRC A;  4A0Z A;  4XKB A;  1YTY A;  2BW3 A;  1T38 A;  4ESB A;  3HOZ J;  5EYR A;  5LGT A;  1U9N A;  2KLO A;  2NP3 A;  2BY3 A;  4I02 A;  3G2B A;  2P6T A;  5E18 F;  4BAC A;  2R93 J;  4Y13 A;  1WJD A;  3SEZ A;  4WCG A;  2VQC A;  4I2O A;  1XX5 A;  1A5J A;  1YS7 A;  2FX0 A;  2F5V A;  1FEX A;  1IZ1 A;  3PQK A;  1X3U A;  3V7S A;  3BG3 A;  5EGO A;  4EQQ A;  2JPB A;  2EJR A;  4PJN A;  2OQG A;  1HDP A;  1U0J A;  3WE3 A;  3ZN1 A;  1K6Y A;  3EPZ A;  4JL3 A;  2E60 A;  2DBB A;  2PMZ N;  3I3L A;  3AQS A;  5FJ8 J;  3HOW J;  3CUQ B;  2E34 A;  1R1T A;  3QOD A;  3B6C A;  2EFN A;  2GIZ A;  3ISP A;  3K4C A;  4G6T B;  4IEJ A;  2OZU A;  3KX2 A;  4Q5S F;  2QUF A;  2JRM A;  3S8P A;  2OTJ I;  2XHK A;  1TWF J;  1DGR M;  5F1R A;  5DD8 A;  4IJA A;  3O60 A;  1HSJ A;  3FK6 A;  3MKZ A;  1RKW A;  3E7Q A;  1T0F A;  2LRE A;  2ELJ A;  3CMM A;  3H0G J;  2ZJP F;  4A3B J;  2XF7 A;  4M3G A;  5LHG A;  2XC7 A;  1RI7 A;  3K1N A;  3BTJ A;  5IP6 A;  4PK4 A;  4WXH A;  2CV0 A;  1KZH A;  1O3Q A;  1ZRE A;  1I50 J;  2LKP A;  4WIB A;  4ICH A;  2VE9 A;  3Q5F A;  3HTU A;  4M6V A;  1ETQ A;  2P8T A;  2JMW A;  2COB A;  3DCF A;  4IHY A;  2LSO A;  3CCV I;  3HL2 A;  3T0Y A;  4M6X A;  1OCT C;  4CCL A;  4KIS A;  3D1N I;  2IS4 A;  2ACJ A;  4ZZL A;  5HOO A;  3NWS A;  3CCS I;  2GUH A;  2L7F P;  4PJ0 C;  1HST A;  4E70 A;  2EPF A;  5L3B A;  3S1N J;  4RM2 A;  3BHQ A;  4LK0 F;  2VJJ A;  2EIL H;  3G4S I;  3F8C A;  5IYD J;  3K0L A;  2DA7 A;  2GXA A;  2BVL A;  2FJI 1;  3CF5 F;  2FJ1 A;  1Q1H A;  3PIO F;  4BYY A;  4BKX A;  2AXL A;  4QWQ A;  3G7R A;  1VND A;  1K7A A;  1EF4 A;  3L2U A;  2PFV A;  1BJA A;  2WA0 A;  3HDD A;  3RKW A;  3A01 A;  1TWC J;  5D8K B;  2PZ9 A;  3MWM A;  3QWL A;  4C3H J;  3C2B A;  1I3A A;  3ML6 A;  1RET A;  3DPT A;  2Z16 A;  1MND A;  1LEB A;  2FD5 A;  1N25 A;  3N05 A;  4CH7 A;  5TJJ A;  3IKV A;  4ABZ A;  2Y9Y A;  4PGG A;  4FX4 A;  2AXT C;  3O2P E;  2XAJ A;  4L9J A;  3QRF F;  2UWM A;  4Y4R A;  4OD4 A;  1YX3 A;  2DJN A;  3VDX A;  1XGN A;  1TW2 A;  4F93 B;  4AF5 A;  1I3Q J;  2F5D A;  2RKH A;  2ZSI B;  2JUC A;  1IW7 F;  3SZG A;  1Q1V A;  2XUB A;  4XOT A;  1O3R A;  4NBQ A;  5C4Y A;  4II2 A;  6PAX A;  3CCE I;  2LNB A;  2L7Z A;  4EJO A;  4XLA A;  4HKU A;  2CUF A;  2ZXH A;  4BBS J;  1I39 A;  4BXX J;  4X6A J;  2VJI A;  2EA2 A;  2VJ4 A;  3GW2 A;  4ENN A;  1UZC A;  3I9V 2;  2UXX A;  3DP7 A;  2R5Z B;  3I4P A;  4HG2 A;  3OYK A;  5FGL A;  3QP5 A;  2VB6 A;  2GWR A;  3BG7 A;  4PCQ A;  1RRJ A;  4LLN A;  3NNR A;  1T8I A;  3KKC A;  4MIM A;  4YEL A;  1MJA A;  2A3S A;  3RDI A;  5CYV A;  4DYC A;  1K6O A;  2XAG A;  3E5X A;  4NC8 A;  5JI6 A;  5LGN A;  4WX9 A;  2OI8 A;  3TKY A;  4HX7 A;  4XK4 A;  4A0X A;  3WG9 A;  1RUO A;  1R4M B;  2EIJ H;  2CW8 A;  4HSR A;  2MH2 A;  2Z1D A;  1A6Q A;  4CSW A;  3T5X A;  5BQT A;  4CHU A;  3IUV A;  3JW4 A;  1S3J A;  3F72 A;  4GFL A;  3ABU A;  2XIG A;  2NAZ A;  2QGU A;  2I5U A;  5KAF C;  4MXM A;  4FAS D;  2W4S A;  3P9K A;  1MH4 A;  3H9J A;  3CC2 I;  1TNT A;  3KLO A;  3VOD A;  2ZME B;  4E7H A;  2O0Y A;  1M1E B;  3VYU B;  1BA5 A;  3ZPL A;  1ZKG A;  5LRS A;  5ICG A;  3JR9 A;  2RNG A;  3TDZ C;  4IF4 A;  3E6M A;  4G9Y A;  1SVL A;  4FHT A;  4RBO A;  1IC8 A;  2YU3 A;  4NHJ A;  2LFB A;  1Z3Y A;  2EZL A;  2ISY A;  4D1Q A;  2IJL A;  2JSC A;  2NVY J;  2XVC A;  2BHY A;  2BXZ A;  2Y31 A;  2FQ3 A;  4UY8 I;  1ZRF A;  4OIO F;  5CVV A;  3KNW A;  1WSU A;  3F0C A;  3QPH A;  3DU5 A;  3KP7 A;  5HNF A;  1MBK A;  4LIT A;  4D5C A;  2LC2 A;  2X6W A;  5HVQ C;  2VBY A;  2OER A;  1U5T C;  2N8G A;  1P4W A;  3WU0 A;  2GOX B;  4XLE A;  2NRA C;  1QU3 A;  3J80 Z;  2OCE A;  3IWZ A;  1XSD A;  4XLP F;  3ANP A;  1XC5 A;  2FBK A;  2KDZ A;  1I5Z A;  5FKO A;  1G3S A;  2PX9 A;  2CQ7 A;  3ECH A;  4EJV A;  5HDK A;  3CWR A;  1IN6 A;  3RPU D;  4A6D A;  2ZJR F;  3R0J A;  1QVU A;  2QKL B;  2WC2 A;  2K3F A;  1YJN I;  2DPD A;  4RM3 A;  3HJE A;  2XF6 A;  2R7Q A;  5A2Q Z;  1LPQ A;  4N9I A;  1DPU A;  4D7M A;  1P7I A;  2NYX A;  4N0B A;  4E7S A;  4BU2 A;  4A6E A;  3FMR A;  3DFG A;  1DU6 A;  1JGS A;  1FSE A;  2HTS A;  2F5F A;  3BC8 A;  3WHB A;  3LWJ A;  1V5E A;  3EGQ A;  3U9G A;  2DLL A;  1ZR4 A;  2V57 A;  3GTL J;  4PSX A;  1K4T A;  3MMY B;  5EF6 A;  5E20 A;  4CCO A;  3DV8 A;  1C0W A;  2A6E F;  3HHH A;  3AKZ A;  2IGO A;  3NRV A;  4KA4 A;  2H1K A;  3HTS B;  3CD6 I;  3I5U A;  4HF1 A;  2MFZ A;  1ZG3 A;  1MMA A;  1T0F C;  1OYW A;  3SZP A;  3BR3 A;  3FXL A;  5DDG A;  1RR8 C;  4YRV A;  2NVU B;  4EV0 A;  3K6G A;  1TZL A;  5ILS A;  2ZO4 A;  3CDH A;  3I59 A;  4A5M A;  1U6G A;  2A69 F;  3FXU A;  2Z33 A;  1LUJ B;  3ZQQ A;  3FDY A;  5E79 C;  3QOP A;  2ZSH B;  2K86 A;  5HDG A;  3K7A J;  1X1B A;  5C3E J;  1YJ9 I;  1J2X A;  1SMT A;  1KU3 A;  1DQU A;  3GYH X;  1XDS A;  2LKX A;  4UNO A;  2E1M B;  4M74 A;  1FLI A;  5H6Q A;  2EA4 A;  2L9N A;  2WWY A;  1ZGA A;  1ZLK A;  2GQQ A;  3H5R A;  3HTI A;  2GBY A;  2L0K A;  3LSH A;  2FA5 A;  1S6L A;  2VKH A;  1GXQ A;  2WAQ N;  2DDB A;  3WTW C;  3TMO A;  1XMA A;  3RIR A;  4RB2 C;  3F23 A;  2M34 A;  3RKY A;  1ZG5 A;  2M1B A;  1CQT A;  2PMU A;  4HW0 A;  2OCC H;  3OV8 A;  3SHF A;  4U9N A;  2VKD A;  3TP0 A;  4LLL A;  2V1N A;  1I1G A;  2XAS A;  2XKO A;  4QIW N;  1JT0 A;  4C2T A;  1H89 C;  2JN6 A;  1SD6 A;  2NS7 A;  1K78 B;  2RV8 A;  1UJ8 A;  1Y1V J;  1XTA A;  1ZAR A;  2RC4 A;  4XKV A;  3KET A;  4MQV A;  4P96 A;  4BBR J;  2QOP A;  3FRQ A;  4XRS A;  2ICW G;  5J8C A;  1BR2 A;  2IP2 A;  5HS7 A;  4A69 C;  4M3E A;  4ZDP A;  4D7N A;  3PPB A;  3U1D A;  4XBF A;  3M9A A;  4V19 K;  4Q4Z F;  3GF2 A;  1FTZ A;  1FT9 A;  5GAH J;  2VT3 A;  3TED A;  3NS4 A;  1QHH D;  4A3D J;  1J7K A;  1B8I A;  2Q24 A;  3CRJ A;  5K7Z A;  3CJN A;  4NDL A;  4ZC3 A;  1IN8 A;  2DA5 A;  3OMY A;  4C30 A;  3UKG A;  1TBX A;  5M5W J;  4ZZD A;  1KQ0 A;  2YX7 A;  2CUE A;  2K5C A;  2K9L A;  3PL8 A;  3K1M A;  3AG4 H;  5F0H A;  1WJF A;  1EV7 A;  2YS9 A;  4A3L J;  3TDU C;  3F9K A;  1YIT I;  3DBH B;  3RZO J;  1JUS A;  1X2N A;  2ECC A;  2IEK A;  3EET A;  2STT A;  2LBF A;  1VQM I;  4G7Z F;  4L0Z B;  1JUP A;  1T98 A;  1YOV B;  2EV5 A;  2G0E A;  2ZCW A;  3ZR8 X;  3F22 A;  4G7O F;  3HIM A;  1USS A;  1JJ8 C;  2HKU A;  4NQW B;  4KT6 A;  2EV6 A;  2P81 A;  4OMZ A;  4K2E A;  2UXO A;  5IP7 J;  1N77 A;  3QOE A;  2XPU A;  3OYI A;  3L9F A;  5HLG A;  1K4S A;  2IVM A;  2ZXI A;  4XN3 A;  1SFO J;  1REP C;  2L4A A;  4HZF A;  1VQ9 I;  2YUS A;  2WV0 A;  1Z6R A;  4HDV A;  3M7G A;  3QU3 A;  1VF9 A;  5EG0 B;  3CZ6 A;  4EJW A;  3OYG A;  1S5L C;  3LSK A;  1UHM A;  2WB1 A;  4LK1 F;  3DBL B;  1P92 A;  2F5E A;  2LH9 A;  4ZYH A;  1FPQ A;  4IXA A;  3I0T A;  4AM3 A;  1FP1 D;  3V7C A;  1P4X A;  2E7X A;  3TOA A;  4I6Z A;  3PUF A;  3ZMV A;  3BT9 A;  2FRH A;  3K4B A;  1MSE C;  2LR8 A;  2ZNZ A;  4EM1 A;  5JHU A;  4FIS A;  5JHF A;  1YRN A;  2FXA A;  4H4K C;  2H8W A;  3QBM A;  2X48 A;  1WJB A;  4YIR X;  1F4K A;  3W6J B;  2A2F X;  3D0S A;  1IAW A;  3C18 A;  1V55 H;  2PJP A;  4KUM A;  5LGU A;  1FYM A;  2EK5 A;  2HYT A;  2L7M P;  3HRM A;  4CYC A;  2F48 A;  3G1L A;  3K69 A;  3MZH A;  1HKS A;  4IHW A;  3REO A;  3OYL A;  3C7J A;  4HLX A;  3EUA A;  4NUB A;  3OS1 A;  4UVA A;  3JRC A;  2O6G E;  3VWB A;  3NEU A;  1X3W B;  2GIV A;  2V1D A;  1FIA A;  2R7W A;  2W7N A;  3WU2 C;  2B7E A;  3IV5 A;  4DBQ A;  3C07 A;  4YZE A;  4GGG A;  1D5V A;  1Y0N A;  2EWN A;  4MQ9 F;  2KKO A;  1I6H J;  2JQ7 A;  5FMP A;  5C44 J;  2J5O A;  4P55 A;  3LQQ A;  3ZMT A;  4U7D A;  4RDU A;  1N75 A;  3RYR A;  2R4G A;  1SFX A;  2XAH A;  3HPG A;  3JRF A;  3GWZ A;  3JAM Z;  2CUZ A;  3KYD B;  4KN7 X;  4BE2 A;  2CFO A;  4I76 A;  4MGR A;  5JVT A;  4M72 A;  3VSL A;  1BR1 A;  1UHS A;  2O8X A;  2DA3 A;  3PIP F;  4GCV A;  2E2I J;  1OQY A;  3ZMS A;  2LRD A;  4OIP F;  2R7V A;  2B0L A;  1XCV A;  1QVT A;  4BQN A;  2K9S A;  1STZ A;  3DXJ F;  3IHU A;  2CW0 F;  1YE9 A;  3KFW X;  4PXI A;  3J7A Y;  1G6N A;  2HXI A;  4L9V A;  5GPC A;  2ZFU A;  2AS5 F;  5FLV A;  4RLQ A;  4DNC A;  1A36 A;  2EZK A;  5DAJ A;  4B8X A;  1K79 A;  2VXD A;  1BOB A;  3IUO A;  4J19 A;  2O5R A;  1ZG1 A;  3DKW A;  2ZCX A;  4I0A A;  4A3F J;  2JT1 A;  2IRF G;  5J1Y A;  3P5J A;  2ZFW A;  2VQH A;  3SDG A;  4Y52 J;  5DCM A;  1HW1 A;  2BXY A;  1WJ5 A;  2XGD A;  1KQ9 A;  1FZP B;  4IHS A;  3HKZ A;  2M8G X;  2Y0M A;  3AG1 H;  4AC0 A;  5B1A H;  3IAM 2;  3WTT C;  3S1R J;  1TT0 A;  2M87 A;  2E1O A;  2IS2 A;  3OY9 A;  4B4C A;  1LFP A;  3BCB A;  5DM7 F;  1D1A A;  5LLQ A;  3FKI J;  4Q48 A;  2QSG X;  3VIB A;  1LFB A;  5LBQ A;  1VQK I;  1GVJ A;  3HPH A;  3Q0U A;  1R7J A;  2HVS A;  1H88 C;  5D5U B;  4ZH4 F;  2W84 A;  1IO2 A;  4PDK A;  3BRO A;  1JUM A;  2HOA A;  3B73 A;  3DTE A;  3A0B C;  1R6R A;  3FWE A;  2HQA A;  4A3G J;  2FUG 2;  5EEH A;  1BW5 A;  2FBH A;  4ENK A;  3VSK A;  1P4A A;  2DMQ A;  2NX4 A;  1X3Z B;  4RGR A;  2HPM A;  4B3X A;  2IPQ X;  1HA8 A;  4J01 A;  3FHZ A;  1WQ2 A;  2V1X A;  4BUP A;  5J3L A;  2PG4 A;  1QNT A;  1O7F A;  1IGN A;  4AWX B;  4AVP A;  4EM0 B;  4GCT A;  2TCT A;  4BHC A;  3KPH A;  3KP5 A;  4LFU A;  1WKM A;  1FY7 A;  4RB3 C;  1IXC A;  3BY6 A;  2KT0 A;  4PJJ A;  3HTH A;  4U9L A;  5KK1 A;  2ESH A;  4FQG A;  5HBU A;  3A2K A;  2L01 A;  3HM5 A;  4BS9 A;  1TQI A;  2MD5 A;  4LIV A;  4OWR B;  2NNN A;  4RGX A;  1MGT A;  1W36 C;  5LRR A;  3HHG A;  1CF7 B;  3CP2 A;  5IYB J;  5K58 A;  1E3O C;  4YII A;  1U5T A;  4BEH A;  3ULQ B;  3RSN A;  5JR3 A;  3HRU A;  5D4R A;  3OYE A;  1S7A A;  3LSG A;  3OYD A;  3C1D A;  2DA2 A;  2ECB A;  3NAU A;  3E5U A;  3S3N A;  1B9N A;  1FMV A;  2E5N A;  2QF7 A;  3P9C A;  3SFI A;  4XOP A;  1W7P B;  3KCC A;  3GX4 X;  4X1E A;  3M8J A;  3B6A A;  2DQR A;  3PAS A;  1NK3 P;  1UST A;  1A6I A;  1FIP A;  1LE8 B;  2CMP A;  2BW3 B;  3ONQ A;  4P1W A;  1OR7 C;  2DA1 A;  4M3B A;  3M4O J;  5DM6 F;  5AQC A;  3KZZ A;  2QCO A;  2E1C A;  2DFH A;  3BNI A;  2R5Y B;  4B44 A;  3TW6 A;  2R3S A;  3M3Y J;  5D5X B;  5JLW A;  3OIQ A;  2IT0 A;  3HOU J;  2HKO A;  2K40 A;  2V79 A;  4HOB A;  4OU0 A;  2G7S A;  1X1P A;  1QPM A;  2RAS A;  2FU4 A;  1MBE A;  3NRG A;  2NOG A;  1Z0X A;  1G3Y A;  2Y75 A;  4ZTF A;  3JTG A;  1BIA A;  3CCY A;  4RGU A;  1IUY A;  3BLY A;  2CG4 A;  2Y48 A;  1H9T A;  1W4M A;  5FGM A;  3DEW A;  2CV1 A;  3A1Y A;  3DKX A;  1PVE A;  1MJ9 A;  1ERD A;  2F6C A;  2NS0 A;  3L2C A;  1APL C;  1SAX A;  2XV4 S;  4HNU A;  2G3B A;  2XPV A;  2UXN A;  5BNG A;  4B3A A;  4MFE A;  4JOM A;  4PGH A;  2M4K A;  3BR6 A;  5J4V A;  1J75 A;  2VPR A;  1XPX A;  5CXI A;  2NXN B;  4G94 A;  4UUT A;  2DYS H;  2BVM A;  3QQA A;  4CCJ A;  4ESF A;  5F08 A;  1YI2 I;  2VI6 A;  3ABT A;  3MD2 A;  4LIU A;  4KIF A;  3H5A A;  1KYZ A;  3GFM A;  2Y2Z A;  4G6D A;  3BG5 A;  4IO9 F;  3KKD A;  4DGW B;  1HF0 A;  2CQN A;  1HBX G;  2F4M B;  1XN7 A;  2XGC A;  2RNJ A;  2O9L A;  1MBF A;  4GRI A;  1MSF C;  5F04 A;  2ZXW H;  2KZV A;  3DPJ A;  1QZE A;  2GEN A;  3IWF A;  2ID6 A;  2LY2 A;  3K2A A;  3KIO A;  1ZR2 A;  4FE7 A;  2PBX A;  3FIS A;  2DI3 A;  5KVR A;  1ENH A;  1ETV A;  2K9N A;  5ED4 A;  2L7K A;  4WK8 F;  2CQX A;  1JE8 A;  1ITY A;  2X85 A;  2CV2 A;  3BDD A;  3NQO A;  3FBI B;  5DV5 A;  5D1R A;  4RAG A;  4IRG A;  4F7Z A;  2Y0S N;  1NHA A;  1SGM A;  2PN6 A;  3GFL A;  3H9Q A;  5DS9 A;  3SEQ A;  2ETH A;  2LYC A;  2MGQ A;  2X0L A;  3D5L A;  3QAH A;  4XNF A;  1ZH5 A;  2LMD A;  1FOW A;  1FC3 A;  4L5E A;  4RAZ A;  3IH4 A;  2Y30 A;  1AKH B;  4YFN F;  1W1W E;  1KA8 A;  2ZB9 A;  3WGI A;  3HSR A;  1BI3 A;  4ENM A;  3BR5 A;  1YW9 A;  4JBA A;  3VPR A;  2DT5 A;  2VLA A;  2DOF A;  4IHT A;  1ZHF A;  4RS8 A;  3GVA A;  2EIN H;  2GLO A;  4ASN A;  1WH5 A;  2CYY A;  3CTA A;  5EJC A;  1BIB A;  4DJA A;  1FX7 A;  3D5S C;  2HS5 A;  2DT7 B;  3I53 A;  2HQR A;  2AQF A;  1Z9C A;  2CQK A;  1QGP A;  3QKX A;  4KFC A;  3W3C A;  2V9V A;  1P9Q C;  2KIQ A;  4U7B A;  3KEY A;  4CDG A;  1V4R A;  3ZXS A;  3RTR A;  2X1E A;  1R5G A;  1R00 A;  2C6Y A;  4A3J J;  1IXR C;  5L3E A;  3BZ6 A;  1V3F A;  2FBQ A;  2TRT A;  1DDN A;  1YG2 A;  2HQN A;  2WTE A;  3L7W A;  2KJC A;  3HKZ N;  1JXS A;  4MTD A;  1HLV A;  4XIC A;  2EIM H;  3CLQ A;  3IC7 A;  3BPV A;  2FSW A;  4C9Y A;  1MMS A;  5FD6 A;  3HE0 A;  2D1V A;  4M9S A;  4QLC U;  1KYW A;  3H3U A;  4I99 C;  4NN1 A;  5FB2 A;  1OIS A;  2HDC A;  3GTP J;  2K9M A;  2R0Q C;  3G6E I;  3KP4 A;  2MH9 A;  4EAT A;  1D5Y A;  2E2H J;  4M73 A;  5E3N A;  1PJR A;  2VN2 A;  2DJI A;  1PP8 F;  4XR6 A;  3V8K A;  2LG4 A;  4BHP A;  2L3D A;  3WTU C;  1J0R A;  1G59 A;  2R5Z A;  3I55 I;  2QA4 I;  2BGC A;  1I27 A;  4XKW A;  3BRU A;  3JRG A;  2EFP A;  2YX4 A;  2QEN A;  3Q9S A;  4NB5 A;  3WHC A;  3J81 Z;  2HOS A;  4M9X A;  3CO6 C;  1IJW C;  1MJB A;  2B1E A;  2RQP A;  3FHN A;  2A6H F;  2JA8 J;  3L09 A;  3RI4 A;  4PJM A;  1IN7 A;  3BCG A;  3DF8 A;  5JFR A;  1ODD A;  4XLF A;  2ME0 A;  4P9F A;  4CIC A;  2QEX I;  3NAR A;  5F0F A;  1XB4 A;  4I01 A;  3HG9 A;  3OYH A;  1X4O A;  2Y9Z A;  5ERI A;  3TQN A;  3L00 A;  2R7F A;  2KL4 A;  2Z3Y A;  2FNA A;  4XRS G;  2LP0 A;  3H3Z A;  1R23 A;  4RMN A;  4LOC A;  3WTS C;  3WGH A;  1TTY A;  2HDD A;  4D0P A;  1E3P A;  2LF8 A;  1UI6 A;  3WGG A;  2E7W A;  3F1B A;  2X1C A;  1V5F A;  1BL0 A;  5CXG A;  2ID3 A;  3LQR A;  4BDZ A;  1O57 A;  2ESN A;  1Z91 A;  4P9U A;  1LVK A;  5IT3 A;  1LDK B;  4A2U A;  2BYV E;  2YVE A;  2LKS A;  2V9K A;  1RPW A;  1H9G A;  1EH6 A;  4R79 A;  3VTI A;  3RZD J;  3VW2 A;  1XGM A;  2K9Q A;  4HF0 A;  3GTQ J;  1AWC A;  4IQJ A;  2XB0 X;  2W57 A;  4Y17 A;  5DCF A;  4IQ4 A;  1FP2 A;  4OIR F;  3W6V A;  3OOP A;  2PMH A;  4ZYG A;  1YJW I;  3CCL I;  1TWA J;  3SXY A;  4M9Z A;  3VW1 A;  5C4X J;  2XKP A;  1X58 A;  1G3T A;  5HSZ A;  5K1Y A;  2LD5 A;  2GA1 A;  5L3F A;  4KMF A;  1DP3 A;  2OBP A;  4BQA A;  4O3M A;  5E8G A;  3MNL A;  2XB5 A;  1MDM A;  3AG3 H;  2B3W A;  2LDU A;  2O03 A;  5K5O A;  3GEZ A;  3CCR I;  1YHQ I;  4UUS A;  2CGP A;  2IW5 A;  1N78 A;  2OU2 A;  3LL7 A;  3HOV J;  2UV1 A;  5GPA A;  4E4H A;  2IAI A;  2B9S A;  5HLI A;  4CCM A;  3MKW B;  2EZH A;  2WAE A;  4KJZ A;  3V8L A;  2H6C A;  1MW7 A;  5D4S A;  2X9D A;  5GTH C;  3HOX J;  1FBQ A;  2HYJ A;  1MNE A;  3I64 A;  1E0E A;  1F5T A;  1PUF B;  4UHT A;  3BJA A;  2CS3 A;  1X4P A;  2H09 A;  4QPQ A;  4EJU A;  2ZXJ A;  1NG6 A;  3AFH A;  5EEA A;  1KON A;  2Q0O A;  1JGG A;  1YX5 A;  3CUQ C;  3CJD A;  1YS6 A;  2VON A;  1F1Z A;  4IRV A;  2F4I A;  1V5G A;  4M3F A;  4BL0 B;  1JKP C;  3P7N A;  4HEA 2;  3DEE A;  2K85 A;  2M2E A;  4U0W A;  4WXC A;  5CJ9 A;  5CPR B;  1YFH A;  3JCU C;  3LST A;  2HFH A;  2JJ7 A;  4N4O B;  5J40 A;  1VQO I;  3FF5 A;  4JYK A;  3HB9 A;  3HUG B;  3T8R A;  1FWZ A;  1SAU A;  3E7L A;  3OYJ A;  2AHQ A;  2Y69 H;  2X6X A;  1B59 A;  3DTI A;  5HOD A;  3ZMU A;  1Y0U A;  3HZJ A;  5M5X J;  1ULY A;  3HC7 A;  4HDU A;  1LB2 A;  2G9W A;  2DXI A;  2YU9 J;  9ANT A;  4BNC A;  2IA0 A;  5FRN A;  2XSD C;  1D1C A;  2HI3 A;  4HYE A;  4UB6 C;  3BQZ A;  4Z2Y A;  1SD4 A;  3ANG A;  3VVY A;  1W36 D;  3VOE A;  5HNH A;  5ICF A;  3R6S A;  1G3W A;  1G8X A;  3LJL A;  3H0D A;  3K9T A;  2H8R A;  3KP6 A;  3W6K B;  2FNP A;  3ON2 A;  4JX4 A;  4FCY A;  4KYW A;  2QKM B;  4I0B A;  2FEZ A;  4U87 A;  3ESW B;  2OQR A;  2M3A A;  1J5Y A;  2JTV A;  2HVR A;  2MD0 A;  4W1U A;  5EEG A;  2R92 J;  3O6B B;  3RPQ A;  1E17 A;  1G4D A;  3QYF A;  4XL9 A;  1T39 A;  3WTZ A;  5ICC A;  1J9I A;  4GFK A;  4A3C J;  2YVX A;  2CW7 A;  3U1K A;  3ZQC A;  3CCJ I;  3M1E A;  2DA4 A;  1K83 J;  1RZ4 A;  3BOQ A;  4WXD A;  3HOS A;  1IRZ A;  1D0X A;  2K4J A;  4C2U A;  4ZJZ A;  3M8E A;  3M1C A;  3PQJ A;  1ON2 A;  4AIK A;  4AIJ A;  2IA2 A;  1IV8 A;  2G7H A;  3DPL C;  3G56 A;  2XRN A;  3FK7 A;  1VTN C;  1CGP A;  1FTT A;  2QBY A;  3OIO A;  3OR2 C;  1OKR A;  1ZTR A;  3CLO A;  4A3M J;  1GHC A;  2IBD A;  1LEA A;  2VT2 A;  4MEX F;  3GFJ A;  2WAF A;  5DD4 A;  5KCM A;  2QM3 A;  1WRJ A;  3CJT B;  4CO8 A;  3FXJ A;  4QPO A;  5FFX A;  5KNL A;  2NVQ J;  1TT5 B;  2EB7 A;  1ETO A;  4BJ6 C;  1BC8 C;  3WU1 B;  4DYQ A;  2JA7 J;  3FXM A;  5JVG F;  3GCM A;  4RLF A;  4RB1 A;  1K61 A;  1S7O A;  2XGX A;  4PJL A;  2DMT A;  3V78 A;  1OR7 A;  4C3I J;  1U8R A;  1LDJ A;  3T6N A;  1FOY A;  4PFO A;  2HYG D;  1JHF A;  2W85 A;  1WWX A;  4U0Y A;  1LNW A;  4CA0 A;  3TO9 A;  1F43 A;  2M45 A;  2ISZ A;  4C3J J;  1SAN A;  2WGB A;  3VOX A;  2KRF A;  3J80 K;  1WVR A;  2F2E A;  2DTR A;  2M4G A;  1TWH J;  1XGS A;  5HS8 A;  1YLF A;  1WI3 A;  4XON A;  1GV5 A;  2OPT A;  4XRF A;  1W0T A;  2YSR A;  1VQL I;  1F36 A;  1HW2 A;  4F92 B;  3ON4 A;  3S1Q J;  4NQW A;  4BDY A;  1HKQ A;  1D0Z A;  3S3O A;  4BY7 J;  4KWA A;  2XSJ C;  2JZY A;  2K02 A;  5A2Q K;  2IS1 A;  1OJL A;  2QTQ A;  4JQF A;  2UXH A;  2A05 A;  3PNT A;  1EKE A;  3DKY A;  1KU2 A;  3GTO J;  1BR4 A;  5F6F A;  3BG9 A;  5EG0 A;  1MMN A;  3RKQ A;  2EIK H;  2XAQ A;  2DMU A;  3JRE A;  2HYF A;  5HDN A;  5FRM A;  2MC4 A;  4E7J A;  1RC9 A;  4ZYA A;  2V7F A;  1T6S A;  1GLN A;  2PQ8 A;  4XN0 A;  1O7L A;  2V4J C;  1Z67 A;  3SZT A;  1U2W A;  5D19 A;  3EUK L;  4Q47 A;  5H9T A;  2HNH A;  1S29 A;  1LFU P;  3SYT A;  1YW7 A;  3UNG C;  4UXN A;  4BE1 A;  4RAY A;  3G1M A;  5D6E A;  1A31 A;  4DOZ A;  1TLH B;  2ZME C;  4GXO A;  2P5L C;  1ZN2 A;  3FMS A;  1HOM A;  1Z05 A;  1Y39 A;  2FE3 A;  3LNQ A;  1FSH A;  2LF7 A;  2R7X A;  1UCR A;  2WY8 Q;  4MFD A;  4DZJ A;  2QKO A;  5FKK A;  3RYP A;  1T33 A;  2LTP A;  2BE5 F;  4MO7 A;  1IV6 A;  3I4M J;  2QIB A;  1ZEL A;  5C4J J;  5F27 A;  2VOP A;  2DFI A;  3TL4 X;  1I6X A;  1IN5 A;  1MBJ A;  1ETY A;  2EZI A;  1JI8 A;  3PSI A;  3OSG A;  3QU6 A;  1O4X A;  1P7J A;  2Q8K A;  2OD5 A;  3HBL A;  1I1S A;  2UUZ A;  2REK A;  2O7T A;  3MFK A;  5CW8 A;  2W48 A;  1UB9 A;  3MAJ A;  1YYV A;  1IDY A;  4ZDO A;  5K7H A;  3MN2 A;  3H36 A;  5D5W B;  3F3X A;  4RA2 A;  5CVI A;  4F55 A;  2KJB A;  4S05 A;  2QYO A;  3O8H A;  4AU7 A;  4CUG A;  3E97 A;  3HGY A;  2MAB A;  2VBX A;  3GME A;  3BG6 A;  3S32 A;  2D1H A;  1UEL B;  4HPQ A;  4AIH A;  2XAU A;  1B72 B;  2VQG A;  1S72 I;  3IP4 B;  5CQE A;  2HOT A;  5GAD J;  5F64 A; 
#chains in the Genus database with same CATH homology
 3PO2 J;  2ME6 A;  1IG7 A;  4GFL A;  3DEW A;  4BY1 J;  2HQ5 A;  4GCL A;  1MBH A;  2ZCN A;  2D6Y A;  1QRY A;  3Q0W A;  1TC3 C;  4MXM A;  1APL C;  1NK2 P;  2G3B A;  2XPV A;  1XG1 A;  5BNG A;  1MH4 A;  4B3A A;  4MFE A;  1ETW A;  1BA5 A;  4A3I J;  3BR6 A;  4NEL A;  1ZKG A;  3HEF A;  2ZCM A;  1OCP A;  3JR9 A;  3OSF A;  2E2J J;  2VPR A;  3JRI A;  3Q3S A;  4UUT A;  3GBG A;  5CXI A;  3QQA A;  4V2F A;  3Q0V A;  5F08 A;  4RBO A;  3SJM A;  1IC8 A;  1MH3 A;  2VI6 A;  3BTI A;  2LFB A;  2Y2Z A;  2EZL A;  2EQR A;  3VW0 A;  2LLK A;  2NVY J;  3BG5 A;  4XID A;  3GTJ J;  3KKD A;  2LVS A;  2Y31 A;  4DZP A;  1HF0 A;  1FJL A;  2XGC A;  2O9L A;  3S2H J;  1MBF A;  1MSF C;  2G7G A;  3KNW A;  3F0C A;  1WCM J;  5F04 A;  1B8I B;  3DPJ A;  2GEN A;  1MBK A;  2ID6 A;  3K2A A;  4D5C A;  1DU0 A;  1U9O A;  4FE7 A;  1ZR2 A;  4XRM A;  2OER A;  3FIS A;  2D5V A;  1GT0 C;  3QPS A;  1ENH A;  1ETV A;  2K9N A;  2N8G A;  1ITY A;  2CQX A;  3BR1 A;  2XRL A;  4W97 A;  2GM4 A;  3PO3 J;  1RKT A;  3P9T A;  5FKN A;  3ANP A;  1XC5 A;  5D1R A;  1UG2 A;  2KDZ A;  1NTC A;  5FKO A;  2Y0S N;  1SGM A;  2GFN A;  1IUF A;  5DTD A;  3S16 J;  5EZG A;  5DS9 A;  2MGQ A;  2ELK A;  3CWR A;  4FE4 A;  3ZQF A;  1QVU A;  2UXI A;  4L5E A;  2XDN A;  1AHD P;  3IH4 A;  2Y30 A;  1AKH B;  1ZQ3 P;  3VVZ A;  2UXP A;  4D7M A;  3S5R A;  1P7I A;  2M9H A;  2ZB9 A;  2I10 A;  2YVH A;  3BR5 A;  3VPR A;  4MLO A;  3A02 A;  5EZH A;  1ZK8 A;  1DU6 A;  2JWT A;  3VUQ A;  3GTM J;  2GLO A;  1X2M A;  2EH3 A;  3NI7 A;  4L62 A;  1WH5 A;  3WHB A;  4Y7N J;  2MSY A;  3LWJ A;  2FQ4 A;  3EGQ A;  1ZR4 A;  2V57 A;  3GTL J;  3QKX A;  5EF6 A;  2M0C A;  3NXC A;  4DW6 A;  1Y1W J;  2H1K A;  2JA5 J;  5E3L A;  4A3J J;  1YRN B;  4V2G A;  4G12 A;  2FBQ A;  2TRT A;  3GZI A;  5GP9 A;  3BR3 A;  3ZQG A;  3HKZ N;  1HLV A;  5FKL A;  4XIC A;  4CGR A;  2DMN A;  3CMY A;  1VI0 A;  1HDD C;  3HE0 A;  1GVD A;  3IH3 A;  2AO9 A;  4NN1 A;  3EUP A;  3LSP A;  3HGG A;  3GTP J;  2G7L A;  2DTZ A;  2R0Q C;  4CYC B;  3JRA A;  2B63 J;  2ZOY A;  1D5Y A;  4AUX A;  2E2H J;  5E3N A;  3K7A J;  5C3E J;  1LE8 A;  5IYC J;  2LKX A;  2R5Z A;  3BRU A;  2E19 A;  3MKL A;  2LY9 A;  3JRG A;  2O7O A;  3VVX A;  1WPK A;  1Z77 A;  3WHC A;  5IP9 J;  2HOS A;  2CJJ A;  1IJW C;  5M3F J;  3HTI A;  2R5Y A;  2GBY A;  2L0K A;  4FTH A;  4JP0 A;  2JA8 J;  2X6O A;  3I4N J;  3BCG A;  3FIW A;  1ORK A;  2WAQ N;  4C2M J;  2ME0 A;  5F0C A;  5EGO B;  2M34 A;  2QWT A;  3NAR A;  5F0F A;  1CQT A;  3S2D J;  2PBX A;  5E3O A;  3ZQH A;  2WB1 N;  1B72 A;  2R7Z J;  3COL A;  2JK3 A;  3TP0 A;  3OOU A;  1U78 A;  2Y9Z A;  4GCK A;  4QIW N;  4QTR A;  4XRS G;  2CU7 A;  2LP0 A;  4B1R A;  2JA6 J;  1JT0 A;  1H89 C;  2JN6 A;  4LOC A;  1JKQ C;  2NS7 A;  3HTA A;  1XS9 A;  1Y1V J;  2HDD A;  1UI6 A;  1TWG J;  3F1B A;  4QSH A;  4DYR A;  1BL0 A;  5CXG A;  2ID3 A;  3PM1 A;  4BBR J;  2QOP A;  1IDZ A;  3FRQ A;  1JT6 A;  4XRS A;  2YVE A;  4A69 C;  4M3E A;  4D7N A;  1RPW A;  1W0U A;  3PPB A;  5FLM J;  3VP5 A;  1WGX A;  4ACI A;  3RZD J;  3VW2 A;  1FTZ A;  2K9Q A;  3GTQ J;  3BR2 A;  2XB0 X;  3TED A;  4A3K J;  3W6V A;  2W53 A;  4A3D J;  1B8I A;  2Q24 A;  1TWA J;  3CRJ A;  5K7Z A;  3VW1 A;  5C4X J;  4NDL A;  1HCR A;  1UMQ A;  1X58 A;  3L1P A;  1UI5 A;  3HTJ A;  5HSZ A;  2LD5 A;  2DA5 A;  3UKG A;  1BW6 A;  3GTK J;  1RES A;  4AYB N;  5M5W J;  3S14 J;  4A3E J;  2CUE A;  3MNL A;  2XB5 A;  5F0H A;  3LSJ A;  2YS9 A;  4A3L J;  3BJB A;  3QPL A;  3RZO J;  1JUS A;  1X2N A;  2CQQ A;  1ETK A;  2ECC A;  2IEK A;  1QPI A;  4UUS A;  3JRD A;  3HOV J;  5GPA A;  1JJ6 C;  2IAI A;  1JUP A;  2G0E A;  3HIM A;  2WV1 A;  5D18 A;  1JJ8 C;  2HKU A;  2EZH A;  2P81 A;  3TP3 A;  1AKH A;  2UXO A;  1JTY A;  2X9D A;  5IP7 J;  3HOX J;  5J1R A;  2NVT J;  2DG7 A;  2HYJ A;  2OF7 A;  2NVX J;  2XPU A;  1PUF B;  1GUU A;  3IH2 A;  1SFO J;  2YUS A;  2DMP A;  5JLX A;  1ETX A;  1VF9 A;  5FKM A;  5EEA A;  5EG0 B;  3S15 J;  1JGG A;  4AC6 A;  3V6G A;  4A93 J;  3A01 B;  3CJD A;  1JKR C;  4JX5 A;  1G2H A;  4M3F A;  5K7F A;  4I6Z A;  1JKP C;  2M2E A;  3BT9 A;  1AU7 A;  1MSE C;  2LR8 A;  1BJZ A;  2LK2 A;  4UDS A;  1RR7 A;  3GTG J;  2XGE A;  4FIS A;  1U8B A;  3JRB A;  3S17 J;  2JJ7 A;  1YRN A;  3CDL A;  4JYK A;  3HB9 A;  3QBM A;  2X48 A;  3E7L A;  2CRG A;  4EEF G;  2AHQ A;  2RHA A;  5HOD A;  5FHP A;  1GDT A;  5M5X J;  2ZOZ A;  3JSJ A;  4HNV A;  1R9T J;  3GEU A;  2YU9 J;  9ANT A;  2HYT A;  5F1J A;  4D5F A;  5IPA A;  2XSD C;  2L7M P;  2HI3 A;  4CYC A;  3BQZ A;  3VVY A;  3G1L A;  5EDN A;  3ANG A;  4IHW A;  3JRC A;  3HOZ J;  5EYR A;  3LJL A;  1U9N A;  5E3M A;  3ZQL A;  2H8R A;  2NP3 A;  3ON2 A;  1FIA A;  4JX4 A;  3NPI A;  4FCY A;  2R93 J;  3IV5 A;  3C07 A;  4YZE A;  2MW8 A;  1I6H J;  5FMP A;  1WH7 A;  4W1U A;  2R92 J;  1A5J A;  5C44 J;  1JKO C;  2FX0 A;  4RDU A;  4A3C J;  1FEX A;  4GFK A;  1GV2 A;  5IOY A;  3VOK A;  3ZQC A;  2DA4 A;  3BG3 A;  3JRF A;  1K83 J;  3O8G A;  5EGO A;  3A03 A;  2WUI A;  1IRZ A;  1HDP A;  4I76 A;  4S0H B;  2NP5 A;  4JL3 A;  1UHS A;  2PMZ N;  3AQS A;  3RH2 A;  2DA3 A;  5FJ8 J;  3HOW J;  2E2I J;  1MBG A;  1OFC X;  3G56 A;  4MK6 A;  3B6C A;  3FK7 A;  1QVT A;  4IEJ A;  1FTT A;  2K9S A;  3OIO A;  1ZTR A;  4A3M J;  4PXI A;  2IBD A;  3TW7 A;  2HXI A;  1TWF J;  5GPC A;  5FLV A;  3O60 A;  3BTL A;  3FK6 A;  2EZK A;  5DAJ A;  1RKW A;  3E7Q A;  3H0G J;  4J19 A;  4A3B J;  4M3G A;  2ZCX A;  4A3F J;  2NVQ J;  3KZ9 A;  5J1Y A;  3SDG A;  1ETO A;  4Y52 J;  3ZOB A;  3BTJ A;  5IP6 A;  2XGD A;  2VKE A;  4DYQ A;  1I50 J;  2M8G X;  2JA7 J;  4ICH A;  3S1R J;  4AC0 A;  5EFY A;  4M6V A;  2E1O A;  1K61 A;  1ETQ A;  2JMW A;  4B4C A;  2COB A;  2DMT A;  1MNM C;  3V78 A;  3DCF A;  4C3I J;  2F07 A;  2IU5 A;  3T6N A;  4IHY A;  3FKI J;  1OCT C;  3D1N I;  4GFB A;  3MVP A;  3RD3 A;  3VIB A;  1LFB A;  1F43 A;  3Q0U A;  3G1O A;  2GUH A;  2L7F P;  2DN0 A;  1H88 C;  1T56 A;  4C3J J;  1SAN A;  2O8K A;  3S1N J;  2WGB A;  3VOX A;  3BHQ A;  3LHQ A;  1JUM A;  2HOA A;  1TWH J;  3JRH A;  1WI3 A;  1GV5 A;  2OPT A;  1W0T A;  2RAE A;  4A3G J;  1F36 A;  3ON4 A;  3S1Q J;  1BW5 A;  1JTX A;  2VKV A;  3BTC A;  5IYD J;  2DA7 A;  1POG A;  4BY7 J;  4UUS B;  4KWA A;  2DMQ A;  2FJ1 A;  2NX4 A;  2L9R A;  1OJL A;  2QTQ A;  4BKX A;  1PUF A;  2UXH A;  3GTO J;  3G7R A;  1VND A;  1EF4 A;  5J3L A;  3BG9 A;  5EG0 A;  1IGN A;  4GCT A;  3HDD A;  4M3D A;  3A01 A;  1TWC J;  3RKQ A;  2TCT A;  2DMU A;  4IHV A;  3JRE A;  2PZ9 A;  5IOZ A;  1S7E A;  3HOY J;  2XPW A;  4C3H J;  3C2B A;  4ME9 A;  5H9T A;  1RET A;  5D19 A;  2KT0 A;  3HTH A;  2FD5 A;  3RQI A;  1LFU P;  5HBU A;  4JX6 A;  4ABZ A;  2Y9Y A;  3G1M A;  3HM5 A;  3BR0 A;  5M3M J;  2DG8 A;  4JNN A;  1HOM A;  5K58 A;  2DJN A;  5IYB J;  3LNQ A;  5J1U A;  4AF5 A;  1I3Q J;  1E3O C;  4MFD A;  4DZJ A;  2EBI A;  2QKO A;  5FKK A;  2DA6 A;  3S1M J;  1T33 A;  2LTP A;  3LSR A;  1Q1V A;  4MO7 A;  1IV6 A;  3I4M J;  2QIB A;  5C4J J;  5F27 A;  5C4Y A;  1MBJ A;  2L7Z A;  1ETY A;  2EZI A;  3LSG A;  1ZGW A;  2DA2 A;  2ECB A;  3NAU A;  3OSG A;  4HKU A;  2CUF A;  1O4X A;  4BBS J;  1P7J A;  2QF7 A;  3SFI A;  4BXX J;  3IUV A;  3HBL A;  3CQZ J;  5HAW A;  4X1E A;  4X6A J;  3B6A A;  2REK A;  3AQT A;  1NK3 P;  2O7T A;  3PAS A;  1A6I A;  5CW8 A;  1FIP A;  2W48 A;  1LE8 B;  2MG4 A;  2R5Z B;  2DA1 A;  1IDY A;  4M3B A;  3M4O J;  5K7H A;  1H8A C;  3MN2 A;  2UXU A;  5FGL A;  2NS8 A;  3LOC A;  3H3V K;  5AQC A;  2QCO A;  3NNR A;  3KKC A;  3O8H A;  4MIM A;  3BNI A;  2R5Y B;  3TW6 A;  5M5Y J;  3HGY A;  3ZQI A;  3M3Y J;  3BQY A;  2VUM J;  4IHX A;  4DYC A;  5JLW A;  4JKZ A;  2HXO A;  3HOU J;  2K40 A;  2OI8 A;  1VFC A;  2G7S A;  2RAS A;  4XK4 A;  1MBE A;  3NRG A;  1B72 B;  2NOG A;  1Z0X A;  3B81 A;  2HOT A;  3CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...