3BQZA

Crystal structure of the complex of malachite green bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bqzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bqzA02
1W0UA 4D5FA 3LNQA 4XICA 2K40A 5K7ZA 1VF9A 1UHSA 1PUFB 5IOZA 2HDDA 1R9TJ 5M3FJ 3BCGA 1A6IA 2W53A 1X2NA 2ELKA 3HEFA 3D1NI 5FGLA 2HQ5A 1AHDP 3H3VK 1WH5A 2XSDC 4A3DJ 2CUEA 3DPJA 2DA4A 2ECBA 5EGOA 1GT0C 3ZQHA 5C44J 3VOKA 5EYRA 1ETYA 1H89C 3FISA 3IV5A 3C2BA 1IGNA 4LOCA 3TEDA 3BR0A 1HLVA 3G1OA 3ZOBA 2DN0A 4FE4A 4QIWN 5EDNA 1GDTA 3CJDA 3VVZA 3VOXA 5EG0B 2K9SA 4NELA 3JR9A 4GFLA 2XPUA 1FIPA 2DMPA 1WCMJ 3TW6A 3M4OJ 2R93J 2XDNA 3GZIA 1HDPA 5F27A 1AU7A 1NK2P 2PMZN 1Z77A 1F36A 3ZQLA 2EZLA 1ETOA 2LK2A 1LFBA 2DA3A 2NP5A 1QVUA 5FKKA 3KKCA 5J1UA 3O8GA 2WB1N 3HOXJ 3BJBA 3CWRA 2G0EA 3JRIA 3HIMA 2LFBA 3O8HA 5J1RA 5DS9A 3JRCA 3RKQA 4C3HJ 5GPCA 4DYQA 2NS8A 2UXOA 2GLOA 1ORKA 5F1JA 3BR6A 3CQZJ 3KKDA 3VVXA 1Q1VA 1QPIA 5BNGA 1GV5A 1MH3A 2EH3A 3JSJA 2DG7A 3LSGA 5IYBJ 3JREA 2R7ZJ 1RKWA 2KDZA 3ON2A 3COLA 1IUFA 5M5WJ 1ETVA 1X58A 2EZHA 1VFCA 5D1RA 2JN6A 2DMUA 2Y0SN 2DTZA 2LKXA 1RPWA 2HOTA 1XG1A 1MBKA 3JRDA 3S1NJ 1JKPC 4BXXJ 3SFIA 1OJLA 2M2EA 5C4JJ 4D7MA 3HKZN 2VI6A 2B63J 1ZQ3P 4L5EA 2L7FP 4A69C 1MH4A 1ETKA 4A3LJ 5K7FA 4ICHA 2CRGA 2DA2A 1B72A 4XK4A 1JJ6C 1U8BA 1OCTC 3PM1A 4S0HB 4MO7A 1WH7A 3BR2A 1H88C 2E19A 2M34A 1JJ8C 3BQZA 3FK6A 2N8GA 1ETQA 3HM5A 3S2HJ 3VW1A 2COBA 4J19A 4DYCA 2R5ZA 2CU7A 4A93J 4IHXA 3G1LA 3A02A 4MFDA 5M5YJ 2D6YA 2P81A 4A3KJ 5EFYA 5CXIA 1TWFJ 3LSJA 1UI5A 2L9RA 3VPRA 2G3BA 4DZPA 4UUTA 2UXUA 2DA6A 1WPKA 2M0CA 1MSEC 1GVDA 1JUMA 2YUSA 3A03A 3K7AJ 1GUUA 4M3BA 2O7OA 3GTGJ 3LHQA 2JA5J 2HI3A 3S1QJ 1MBJA 3GTKJ 4AC6A 1TWCJ 2EZIA 1G2HA 2XRLA 5F08A 3UKGA 2W48A 4A3EJ 2V57A 2X6OA 3L1PA 2R92J 4HKUA 3WHBA 4M3DA 5FJ8J 1T56A 4A3CJ 2E1OA 1IRZA 3BG9A 3GTMJ 2REKA 2ECCA 3E7LA 3ZQGA 2MG4A 1RESA 5E3NA 2HOSA 4IEJA 4B3AA 3IUVA 2FX0A 2TCTA 4JX5A 2ZOZA 4IHYA 3TW7A 3ZQFA 2XGCA 4DW6A 5DAJA 1SANA 3AQSA 1MBGA 3S1RJ 1VI0A 1EF4A 3TP3A 3B6CA 4G12A 3FK7A 4XRSG 3FRQA 3B81A 1IDYA 4JX4A 1A5JA 1Y1WJ 3S2DJ 1Y1VJ 1WGXA 4CYCA 5E3OA 4MIMA 2QWTA 5IPAA 2K9NA 2DMNA 5HBUA 3HOYJ 4A3JJ 1JUPA 5GP9A 3QPLA 4ABZA 2IBDA 2EBIA 2VPRA 4QTRA 3LSPA 3F0CA 4FCYA 1ZTRA 3CMYA 3JRGA 5FHPA 3IH2A 2OERA 4I76A 2XGDA 4KWAA 4D5CA 3G56A 2ZCNA 3M3YJ 3A01A 2NS7A 1ENHA 3TP0A 4UDSA 4AUXA 4GFKA 3B6AA 3DCFA 4C3JJ 4DYRA 1ZK8A 2PZ9A 3BTIA 1CQTA 5F0CA 2DA7A 2L7ZA 5IYCJ 3CCYA 1B72B 3H0GJ 2VKEA 4IHWA 4MLOA 3BTJA 3DEWA 3NARA 2K9QA 5IOYA 2XGEA 3NI7A 4MXMA 3BR3A 2QTQA 3VIBA 5J1YA 1IDZA 4C3IJ 2R5ZB 1O4XA 2R0QC 4BY1J 1FTZA 2YU9J 2M8GX 4CGRA 2YVEA 2R5YB 1OCPA 1BW5A 3HOVJ 4AYBN 5FMPA 3FKIJ 1U9OA 2VKVA 2NP3A 1ETWA 3NPIA 1P7IA 1ZGWA 2H8RA 2G7LA 5AQCA 2RHAA 2HKUA 2L0KA 1XC5A 4A3FJ 2HXOA 2GENA 2ZCMA 2QCOA 2ME6A 2AO9A 1MBFA 5JLXA 2LY9A 3BRUA 5H9TA 3BHQA 1P7JA 1IG7A 4Y52J 2XB5A 3EGQA 2DJNA 4GFBA 4A3GJ 2LD5A 2MW8A 2GUHA 4IHVA 2ZCXA 3HBLA 4PXIA 5M3MJ 1JKQC 4JKZA 3MN2A 5FLMJ 3V6GA 2OI8A 3Q0WA 3QQAA 3PPBA 4V2GA 3S5RA 3HDDA 2JA7J 2UXPA 5HODA 2RAEA 2X9DA 2UXIA 5J3LA 2QF7A 3OIOA 1UMQA 2R5YA 3RZDJ 1ETXA 2ZB9A 3AQTA 4B1RA 2Y9YA 2IEKA 1GV2A 1UG2A 2XPWA 4MFEA 2Y9ZA 3BNIA 3S1MJ 2PBXA 1X2MA 4BBRJ 3LWJA 2I10A 1ZR4A 4CYCB 4A3IJ 3S17J 5F0HA 3S14J 3HE0A 2HYTA 1MBHA 3HTIA 2FQ4A 2TRTA 4BY7J 1DU0A 2DA5A 3W6VA 3VW2A 3BG3A 4GCKA 3GTLJ 5F0FA 2ME0A 4Y7NJ 4JL3A 2CQXA 3A01B 2NVTJ 4D7NA 2EZKA 3RQIA 2FBQA 4V2FA 1BJZA 1DU6A 1BW6A 3GEUA 2CQQA 2LP0A 3WHCA 3NAUA 4M3FA 4BBSJ 1LFUP 2F07A 3QBMA 1OFCX 1JT0A 3MKLA 4JX6A 1H8AC 1U9NA 1HOMA 4A3MJ 2DMQA 2VUMJ 2NOGA 2XB0X 2MSYA 1JUSA 5IP9J 3KNWA 2DG8A 2AHQA 3JRBA 1E3OC 4RDUA 4GCTA 3BTCA 5FKLA 2CUFA 3LJLA 2LLKA 1F43A 1I50J 1TWGJ 3K2AA 1FIAA 4AC0A 4HNVA 4W97A 3MNLA 4X6AJ 3RZOJ 2YVHA 1VNDA 2FJ1A 2NVYJ 4ACIA 4GCLA 3NXCA 1RETA 3IH3A 1HCRA 3VVYA 3F1BA 4UUSA 4C2MJ 5JLWA 3BT9A 1JKRC 3BQYA 2HOAA 1SGMA 1XS9A 1JKOC 3LSRA 5EF6A 5EEAA 2JMWA 1MBEA 4RBOA 1LE8B 3PO2J 5DTDA 1JGGA 4I6ZA 2M9HA 4W1UA 4NN1A 1IC8A 4JNNA 3NRGA 1SFOJ 4QSHA 2JA8J 1WI3A 4YZEA 1D5YA 2HXIA 1AKHB 2Q24A 4ME9A 4BKXA 5EZGA 1K61A 1Z0XA 1UI6A 3BG5A 1B8IA 1I6HJ 3VP5A 3OSGA 4XIDA 1I3QJ 3Q3SA 4DZJA 3OOUA 1NK3P 2UXHA 4XRMA 4AF5A 3KZ9A 3I4NJ 3ANGA 3I4MJ 1K83J 1TWHJ 1ZKGA 1YRNB 3G1MA 3CRJA 3GTJJ 2GBYA 5FKOA 1PUFA 3O60A 2G7SA 1MSFC 2JA6J 3MVPA 1IJWC 3HOUJ 3ANPA 5FKMA 5CW8A 3QKXA 1BL0A 2NVXJ 5IP6A 3HOZJ 3BTLA 3NNRA 3ON4A 2O8KA 5F04A 2IAIA 3ZQCA 2NVQJ 1LE8A 1RR7A 4X1EA 2GM4A 3RH2A 2JWTA 4L62A 2FD5A 1FEXA 3VW0A 3IH4A 4FE7A 5FKNA 4NDLA 3PO3J 3EUPA 1QVTA 1FTTA 5C3EJ 3GBGA 3C07A 5K58A 1ZR2A 1HF0A 3V78A 5K7HA 5EG0A 3HGGA 1AKHA 2DA1A 1T33A 1TWAJ 3LOCA 2OPTA 4M6VA 5CXGA 3S15J 5IYDJ 4A3BJ 2Y31A 3Q0VA 3JRAA 1U78A 3CDLA 5E3LA 1NTCA 2L7MP 2LR8A 1ITYA 2O7TA 1POGA 3T6NA 5HSZA 3GTQJ 2QKOA 2WGBA 3RD3A 1QRYA 1TC3C 2EQRA 2RASA 1YRNA 1RKTA 3BR5A 4M3GA 2QIBA 2ID3A 1JT6A 2CJJA 2E2JJ 2QOPA 5C4XJ 3JRHA 2Y2ZA 5IP7J 5HAWA 2DMTA 2MGQA 2E2IJ 3BR1A 3JRFA 1W0TA 1JTYA 2IU5A 3FIWA 1APLC 3HTHA 3HTJA 3HB9A 2H1KA 4FTHA 3HOWJ 1HDDC 2NX4A 2WV1A 4JP0A 5FLVA 2WUIA 2KT0A 9ANTA 3Q0UA 1MNMC 2YS9A 4FISA 5M5XJ 5D19A 4M3EA 3OSFA 2HYJA 4EEFG 2XPVA 3QPSA 3E7QA 2LVSA 3PASA 5C4YA 3S16J 4UUSB 3VUQA 3HGYA 5GPAA 3SJMA 3SDGA 5EGOB 3GTPJ 4B4CA 2JJ7A 4JYKA 4XRSA 3GTOJ 5D18A 2G7GA 4MK6A 3G7RA 3P9TA 2LTPA 3HTAA 2Y30A 1IV6A 2ZOYA 2JK3A 2WAQN 5EZHA 1BA5A 2O9LA 2OF7A 1S7EA 5E3MA 1B8IB 2ID6A 2X48A 3ZQIA 1FJLA 2GFNA 2D5VA 2E2HJ 1JTXA
chains in the Genus database with same CATH superfamily
3H9JA 3KIOA 1PYVA 1I1GA 5DM7F 5K7ZA 4ZYAA 4AIJA 3OS1A 1EKEA 1EV7A 4BQQA 5M3FJ 1QQIA 1A6IA 2PEXA 5FGLA 2LKPA 5H20A 1OPCA 2XSDC 4KIGA 3DPJA 3QU6A 5EGOA 1REPC 4IPAA 4MGRA 3S3NA 3MQ0A 2DFEA 3VOKA 3IWFA 1H89C 1ZARA 1JHFA 3AG3H 3IV5A 1IGNA 4LOCA 4RGUA 3HOSA 3TEDA 2DXIA 3CJDA 2F5FA 3VVZA 5LHIA 4AU7A 4U0VA 1VZ0A 3NEUA 3TQNA 1LQ1A 4BQAA 3P9CA 4XKBA 3JR9A 4M74A 3FMQA 2XPUA 3R6SA 3TW6A 3M4OJ 2YVXA 2M4GA 4K2EA 2XDNA 5ICGA 2JUCA 3BJOA 5F27A 1AU7A 1NK2P 1R36A 2EZLA 1IXRC 2WAEA 3K4LA 3QAHA 4BJTA 2NP5A 5FKKA 1W7PB 3KKCA 3CTAA 1BM9A 2WB1N 4RGXA 3U2RA 3DBHB 2VIXA 2LFBA 4LK0F 3JRCA 1YS7A 4ZYHA 2H6CA 2VB6A 4ZZLA 4F52A 4HX8A 2MD0A 3KZYA 2RQPA 5JI6A 5A2QK 2EIMH 3ZCOA 3BR6A 4RB1A 2OC6A 1Q1VA 4WF2A 2QENA 1QPIA 1WJFA 4M6YA 3FXKA 1DPUA 1ON2A 1RI7A 4BL0B 3JSJA 5IYBJ 1O3RA 4RB3C 3ZN1A 3COLA 3I53A 2V26A 3I58A 1S8NA 4XLEA 2LH9A 2R7DA 1IUFA 5M5WJ 2W4SA 2ZJPF 2R7QA 3G4SI 1ONVA 1RPWA 3BOQA 4QPQA 4IZZA 2M2EA 1W7PA 3RPUA 4Z6YA 3FWEA 4L5EA 5BQTA 3HTSB 1MH4A 2BW3A 1ETKA 4KUMA 5D6FA 5L3CA 1LUJB 3P5JA 2XAGA 4ICHA 2JA2A 4BQNA 1H9GA 4XK4A 1JJ6C 4XKWA 3W2WA 2YX7A 2ZMEA 4UVBA 2X6YA 2ZXWH 2E60A 2B3WA 3BR2A 4RM2A 2BZTA 1JJ8C 2K9MA 1Z3XA 1VQ4I 1ETQA 4BE1A 3S2HJ 3HXLA 2COBA 1Y0NA 2R5ZA 1N77A 1KONA 1IN7A 1N78A 1YITI 3DPLC 1FP2A 2CU7A 1SD4A 4II3A 1EH7A 1MIJA 5DV5A 1U5TB 5M5YJ 4A3KJ 3H36A 1IN8A 3IKVA 3KETA 1XGOA 3FXQA 3VPRA 1UI5A 2G3BA 2Z3YA 2M0CA 2PMZA 2AXLA 2D1VA 4F3QA 4M3BA 1J7KA 3V8LA 1UCRA 2ZXIA 3K2ZA 4XLFA 4AC6A 2XRLA 4KITB 3Q5FA 3T8RA 3L1PA 1U8RA 1CF7B 1DGWY 3RCOA 4LG0A 5JHFA 4HKUA 3BG9A 3GTMJ 3L9FA 2RC4A 1WVRA 4BGDA 3WGGA 4IEJA 4B3AA 4J00A 1HSJA 1V5GA 2X1CA 3RQ4A 1MDMB 5K1YA 3OYNA 1VQ8I 1V54H 4S05A 2F5CA 4KA4A 2PMUA 1U5TA 3ERMA 2WAFA 4IL6C 4RAFA 4DW6A 1S72I 2DJIA 3H5AA 2Z9OA 2BY3A 2ZMEC 4KN4X 4XRSG 4G12A 1GHCA 1CGPA 2HEOA 4JX4A 3HHHA 2KRHA 2VODA 2QZ8A 4YG2F 1WGXA 4CYCA 3EUHC 1VQKI 3HOYJ 3WU2C 3HKZA 3N05A 4DBQA 4ABZA 5D8KB 4HF2A 2EBIA 2VPRA 4QTRA 3LSPA 3LAJA 1ZTRA 3E1SA 3JRGA 2L2OA 4I76A 2Z33A 3DF8A 2XGDA 4KWAA 5B3SH 3N97A 4R1HA 5HS9A 2BY2A 3I4PA 3H35A 5A2QZ 5CPRB 1DP7P 2QYOA 3BTIA 4Z2YA 2G7HA 4XM3A 5F0CA 5ED4A 2L7ZA 1MMNA 3SEZA 3F3XA 2XASA 2YX4A 1B72B 3BP8A 4N9IA 3DPTA 2F5DA 4JOMA 1VQPI 3DEWA 2FNAA 1R49A 4MXMA 4WWCA 3TOBA 1B1BA 1R4MB 5E17F 1F4KA 3A0HC 4IHSA 2LKSA 1P9QC 4HQEA 4KFCA 2HWVA 4CGRA 2R5YB 3DQVC 5FRMA 2W57A 3G73A 3BJ6A 2NP3A 2FA5A 2OCEA 3PNYA 2XAFA 2H8RA 4FX4A 4NC6A 3DP7A 4II2A 1XC5A 2HXOA 1R1VA 3J80K 2ME6A 4U7DA 4UHTA 1MBFA 3WG9A 1FNNA 1ZRFA 2PFVA 2VC0A 1ZYRF 3OYMA 3CLQA 2Z99A 2VONA 1P4AA 1D0YA 2KQRA 1FT9A 2W24A 4DIQA 2DJNA 4OIQF 2JVHA 4A3GJ 1T0FA 3U9GA 3IRRA 5LD2C 4L9TA 2ZCXA 1X1BA 5M3MJ 2PJRA 1OCOH 2DT6A 2H94A 3QQAA 4IRGA 3S5RA 2UXPA 2H27A 2A3SA 1KQ0A 1LEAA 2X9DA 2XAUA 1TLHB 3OL4A 3LL7A 2IS1A 3ZN0A 3OOPA 1UMQA 2R5YA 1E3HA 1YJNI 3VOEA 2Y9ZA 4C2TA 1UG2A 1O3QA 2IGMA 1W4MA 1FBQA 2NNYA 4BBRJ 3OYJA 5F0HA 5AONA 3E5UA 2KZGA 5CVVA 1WI9A 3HPGA 4MTDA 4BEHB 3QYEA 4M9ZA 1FZPB 4H4KC 3HTIA 4L0ZB 4GDFA 2FQ4A 2TRTA 4BY7J 1DU0A 1A31A 1ERDA 1T38A 2CQ7A 1MJ9A 4EGYA 1W1WE 3CJTB 3VYTB 5F0FA 2ME0A 3CESA 5AIQA 5BOXA 1RR8C 5FLXK 4D7NA 4HDVA 2FBQA 1BJZA 1YOVB 4HV6A 1OR7A 2Q2EB 1YIOA 2IGOA 1W36C 1DU6A 3GEUA 4AM3A 1T0FC 4KICA 3QBMA 3DTEA 2HZTA 4JX6A 1A35A 2VQCA 3GUDA 2LSOA 3IP4B 1X3UA 3WTVC 1JUSA 5B66C 1X3ZB 2A05A 4P1WA 2HDCA 2M1BA 3BTCA 2CUFA 4BEHA 1F43A 1I50J 3KP4A 3F6OA 2JZYA 1SFUA 4W97A 1XDSA 3HRTA 1X19A 2FJ1A 2XUBA 3CDIA 3QU3A 1HCRA 3VVYA 3OWTA 4C2MJ 1KQ8A 3BT9A 4OIPF 3P9KA 1EA3A 3PO2J 5EEAA 2MC3A 3FM3A 5DTDA 1JGGA 3D5SC 1W7PD 4UNOA 3RPUD 4NN1A 3ULQB 1IC8A 2H1LA 1B4AA 4JNNA 3NRGA 4QSHA 4F7ZA 3F21A 1WI3A 1DGRM 1D5YA 3TO6A 4BKXA 4OU0A 1KU2A 3FF5A 3O6BB 4XKVA 3BG5A 1UI6A 1P92A 2I5UA 1FOKA 4LGWA 3VP5A 4XIDA 3ERED 4G94A 1OR7C 1SFEA 2A68F 3I4NJ 4Y33A 4PK4A 5J6XA 3I4MJ 3I5UA 3GTJJ 4XLPF 3IL2A 3CC7I 2IW5A 5GADJ 4RB2C 3O60A 2GA2A 1X1AA 2ZFUA 3JSPA 3FDYA 2GZWA 5CW8A 5CVRA 5CVJA 3D0SA 2H8WA 4PSXA 2LF7A 3K1PA 3NNRA 2O8KA 1QNTA 4Y17A 3MCZA 2FU4A 4L62A 4G9YA 2MD5A 1MMDA 2L9SA 3J7ZI 1FTTA 5GAGJ 5C3EJ 4G7OF 1HF0A 5J4YA 4EJUA 4YEJA 4Q5SF 1TWAJ 4M6VA 3L09A 5H6RA 5CXGA 3VSLA 5IYDJ 1TT0A 3Q0VA 1DQUA 2O7TA 3T6NA 1XCBA 2I8DA 1YW7A 2WY7Q 4HBLA 3DLLF 3RD3A 2EQRA 2QOPA 3GYHX 2OZUA 2MLGA 2E2JJ 3JRHA 5EEGA 2VE9A 2DPUA 4HF1A 2A61A 3BR1A 1W0TA 1JTYA 4BAYA 5LGNA 3CCUI 4I09A 3FMSA 5J8FA 2O03A 2R7SA 1H0MA 3HB9A 2H1KA 2ELHA 2NX4A 2DOEA 3IHUA 3QPHA 1FMVA 3AG1H 2PG4A 1HW1A 3I59B 3Q0UA 5B1AH 5EJCA 1MNMC 2RNGA 4FQGA 5FLXZ 5ILSA 2XF6A 4D1QA 3LSIA 2XPVA 4YELA 3ZMDA 5HLHA 2ZJRF 1B6AA 4F91B 3I56I 3DEUA 2L3DA 3CCSI 2ZSHB 3I9V2 2PBIA 2KMUA 3CO6C 4OMZA 3SDGA 3GTPJ 5D5VB 5D18A 4XL9A 4MK6A 2QQ8A 4A0XA 3AFHA 4BJ5C 2V9KA 2LTPA 5B5EC 2R7TA 3HTAA 2CG4A 2STWA 3K1NA 2P5KA 2Y30A 1Z3YA 4XOPA 3X2QH 2IP2A 2O9LA 1MGTA 1Y56A 1L3LA 1NG7A 1UHMA 2X48A 2YU3A 1FJLA 3GFJA 3BZKA 2CW8A 3V7RA 4O5VA 2R7VA 1W0UA 4D5FA 4HNTA 3LNQA 1OLTA 4E7KA 2DBBA 3IKTA 3QP5A 3EUKL 3F22A 1BOBA 5JR3A 2EA4A 5IOZA 2HDDA 1MMGA 1RUNA 1X2NA 2ELKA 2H6BA 5TJJA 1BIAA 2LG4A 3D1NI 1AHDP 3BPVA 3H3VK 2X6WA 2CUEA 2Y0SA 2DA4A 2ECBA 1GT0C 1X1CA 4Y15A 3RPQA 1VQLI 5C44J 1ETYA 2ZC2A 5DD8A 5HS7A 2A2FX 1EJ9A 1BN5A 5H2FC 5HVQC 5GAEJ 3BR0A 5ICEA 3G1OA 3PIOF 4QIWN 4FE4A 5EDNA 1HLVA 2UXNA 4ZTJA 1FYMA 1W5TA 1W36D 1PJRA 1K7AA 4GFLA 2DMPA 2X6XA 3GZIA 1YX3A 1Z77A 3GWZA 1WJAA 4HPQA 5J4VA 1LFBA 4M71A 1KYWA 2XF5A 1XX5A 3HSFA 3JW4A 5LGTA 2IVMA 2EFQA 5D4RA 3ASOH 2A6EF 4NC8A 3HOXJ 3BJBA 2G0EA 3JRIA 3O8HA 5DS9A 2M0MA 4C3HJ 4QPOA 3OYLA 1LB2A 3H3ZA 4A12A 6PAXA 3KEYA 4XSZF 1S7AA 4DVYP 2X51A 4HF0A 1Y6IA 3HUGB 1MW7A 4BYYA 3CQZJ 4G7HF 1R23A 5J8CA 3I71A 3S3MA 1WJEA 4XLCA 2EK5A 4ANJA 3LSGA 3ONQA 2R7ZJ 4Q4ZF 1R6RA 1Z91A 3ON2A 1IAWA 3ESWB 3V8KA 1VFCA 2EZHA 2XF7A 1PP8F 4LMYA 2Y0SN 2QBYB 1R7JA 1OYWA 3V42A 4CSWA 3JRDA 4HNUA 3L2CA 3FBNB 4XLAA 2XHKA 2A07F 2VI6A 1BR4A 2OD5A 2DDBA 3BG7A 2L7FP 3ZMZA 3CP8A 4A3LJ 5CQEA 2R4GA 2CRGA 3CCVI 4UY8I 4WXHA 3RTRA 1YG2A 3PM1A 4M73A 4S0HB 2STTA 4MO7A 2KDOA 4GCVA 1H88C 1J0RA 3HUGA 1W5SA 2N8GA 5K5OA 4V19K 2LREA 1FY7A 4DYCA 3K8PC 3B02A 1KZHA 3K70C 4IHXA 3G1LA 4JBAA 2LY1A 3BROA 3ZXSA 2W25A 1BR2A 4UUTA 1IO2A 2DA6A 1SFKA 1S5LC 1I6XA 4CDGA 4Y4RA 2K4BA 4IQ4A 1MSEC 3K7AJ 1JUMA 3AG4H 1U2WA 2C6YA 1O3SA 2CH0A 3G2BA 2OQRA 2GAUA 2WB1A 3OIQA 1TWCJ 4B43A 1UFMA 1BI2A 1GXQA 1K6YA 2W48A 3UKGA 2EV0A 5L3FA 5KCMA 2DYSH 2F5VA 4EM0B 2KKOA 4MNUA 5FJ8J 3JAMK 3OYHA 4XSXF 1IRZA 3M8JA 2ECCA 2AS5F 3O3KA 2MG4A 4KIBA 1DPRA 2GXGA 2ZOZA 4E7JA 3ECOA 1IW7F 3TOAA 2X0LA 3WTZA 4PJNA 1J59A 1SANA 1MBGA 2FMYA 2KISA 2GOXB 5CVUA 3B81A 1IDYA 2HOEA 2VOPA 1XGMA 1D8JA 2DFIA 2OZ6A 1Y1VJ 1J9IA 3HTUA 1USSA 2L4AA 4GO1A 3KE2A 4MIMA 5E3OA 4ENJA 3EUAA 3HSEA 4HOBA 2Q8KA 1JUPA 3DPUA 2JPBA 2V9VA 3VYSB 2YSRA 4NC7A 1TW3A 1XGSA 4XBFA 4OD4A 3OYFA 1FYKA 3GZNB 2KZVA 3BPXA 4UXNA 3G71I 3CCMI 3CMYA 4FCYA 5FRNA 2WWYA 2OERA 1FBUA 3KYCB 2WBMA 4D0PA 2X1DA 1FP1D 3G56A 1YW9A 3D5RC 1WJ5A 3TP0A 3A01A 3M3YJ 1N25A 1R71A 2O61A 4GFKA 2MH9A 3DCFA 4KMFA 1P6RA 4HX4A 3SQNA 2PZ9A 4EJTA 4IJAA 2RV8A 2DA7A 2W7NA 2EPFA 2BW3B 3QYFA 2E1MC 4M9SA 2CMPA 3CCYA 4Q47A 3DV8A 5E79C 2VKEA 3TL4X 4HA8A 2ZMEB 3NI7A 2IA0A 4IRIA 2CQNA 2QTQA 3DKWA 2XROA 3VIBA 3M8EA 2CW7A 2R5ZB 1FTZA 4BY1J 3W3CA 1QHGA 5D6EA 1XMXA 2PLYA 1KU3A 2DFHA 4AIKA 2GXAA 3HOVJ 4WK8F 1SD7A 1WJBA 1U9OA 1RUOA 2KFDA 1WFXA 1P7IA 4E7ZA 2V1NA 3OL3A 2ZJQF 2F48A 5AQCA 2RHAA 1HXDA 1R5GA 4HX7A 2QCOA 1ACIA 1PP7U 3FXUA 2LY9A 3OYKA 2VN2A 3WU1B 3KEQA 2VKHA 3BRUA 4PFOA 1IXCA 4IOAF 3HC7A 4YRVA 2ESHA 1P4WA 2KL4A 1LDDA 2ZXHA 4UB6C 5FROA 2KIFA 1VQ7I 2L9VA 4IHVA 3HBLA 5FGMA 4LG0B 3OR2C 1G3SA 1Y39A 1WSUA 1KYZA 2DYRH 5FLMJ 2QSHX 2OI8A 5HLGA 3AL0B 4V2GA 1G3WA 2JA7J 4XORA 3EUHA 3R4KA 4XN0A 3KPHA 2QQAA 3OIOA 4PUSA 1SFXA 4C2UA 3W2VA 3RZDJ 1ETXA 1MD0A 2VBZA 3KP3A 1R5HA 2ELJA 2P8TA 1S7OA 3BG6A 4ZDLA 4CGZA 2CW0F 1ZR4A 1LVAA 4CYCB 4A3IJ 4KISA 1T98A 3GEZA 3JAMZ 2V6CA 3HE0A 4HZFA 1A04A 4CCJA 4HV5A 5D5WB 3T5XA 1K4TA 2X85A 4C9YA 3JTGA 3REOA 1W5CC 4JQFA 4GCKA 1XTAA 4P96A 5LHGA 3GTLJ 4E6KG 4BACA 2CQXA 2GIVA 3OYDA 2E34A 3CJQB 2NVTJ 4FHTA 3PNVA 4P55A 3C2GA 2NVUB 2Y75A 4ZYGA 1BW6A 2W84A 2CQQA 3LAPA 3NWTA 2R7UA 4M3FA 2F07A 1OFCX 2HVRA 2JSPA 4NBQA 1H8AC 1U9NA 3AKZA 1SD5A 2XB0X 4E7IA 2M8EA 3CP2A 2D45A 3M07A 1X1PA 1K79A 5IP9J 3KNWA 2DG8A 4OIRF 3HPHA 1ZGAA 3U21A 4GCTA 2L54A 3S3OA 3LJLA 3COAC 1FIAA 4LD5A 4BH9A 1OISA 2F4MB 3GZ5A 3ZQ7A 3RZOJ 1VNDA 2PMHA 3KEOA 5FD6A 1ZLJA 4ACIA 1H9TA 3CCQI 1NHAA 3I54A 3IH3A 5HDKA 4IOCF 1UB9A 4UUSA 4QWQA 1JKRC 2HOAA 1HKSA 5CYVA 2HU9A 1JKOC 1FOYA 1OCCH 1MBEA 4RBOA 1SVMA 4HW0A 2HS5A 1SMYF 1SAXA 4W1UA 1ZG5A 2OTLI 1X3WB 3OIPA 4U88A 5BPDA 2B9SA 1AKHB 2K85A 5EZGA 3AL0C 4CA0A 3PQKA 1V5EA 1ZH5A 1I6HJ 2K9LA 3EPZA 1XMAA 3GCMA 4DQ2A 5LFAA 2PJRB 3Q3SA 2DFFA 2ZFWA 4DZJA 1YHQI 1ZLKA 4XRMA 1LFPA 3FBIB 3KZ9A 3L2UA 2EFOA 4YIFA 3OYCA 2DTRA 1K83J 5DYMA 2W00A 3F8MA 5F1RA 2W1OA 1YRNB 2EFWA 3GMEA 4BUPA 1PUFA 2VT3A 3GFMA 4YIIA 4PSWA 2JA6J 2CYYA 3MVPA 2HYFA 4KDPA 1FC3A 4LB5A 3ANPA 3FM5A 5BPIA 2GXBA 1I27A 1BL0A 3QKXA 2LF8A 3ABMH 3HOZJ 3BTLA 3DU6A 4HSTA 3E6DA 4XMYA 4I0BA 2IAIA 3ZQCA 1DP3A 4B48A 4X1EA 2GM4A 3RH2A 2JWTA 3ZRGA 1VQ5I 3VW0A 3L2RA 4FE7A 5FKNA 3F8BA 1MNEA 1IRFA 2F6CA 3F9KA 3ZMTA 1Z7LA 3GBGA 4WX9A 1ZR2A 2K02A 4M72A 5EG0A 1AKHA 1YS6A 3CF2A 2HYGD 4KIFA 4A3BJ 4ZH4F 3M9AA 3CDLA 1B59A 1X4PA 1I39A 1E3PA 1J5YA 1POGA 2JRMA 3GTQJ 3HRUA 2DODA 1QRYA 1UHWA 2RASA 1XDUA 3H9GA 1YRNA 2HKOA 2ID3A 2P5VA 1YJ9I 2XRNA 3KZIC 3M7GA 5C4XJ 2FJI1 2Y2ZA 5IP7J 2FSWA 2Z2SB 4GGGA 2BYVE 2F4IA 2MGQA 1XB4A 3S8PA 3ABTA 3K1MA 2OTJI 2B7EA 2M3AA 1BI0A 3CC4I 1SD6A 2O5RA 2Y69H 3TDUC 2ACJA 3R61A 3HOWJ 4AIHA 4U0YA 3WTTC 2P7CB 3CC2I 5FLVA 2OU2A 2QQBA 2WUIA 2DCEA 3BY6A 2XC7A 5HNHA 4FISA 5D19A 2MLKA 4M3EA 1I3AA 2HYJA 3QPSA 2HR3A 4B44A 5DEQA 2LNBA 3A0BC 5FB2A 5C4YA 3GLXA 3LFKA 3QODA 5D4SA 3J7AY 3PSFA 2KP6A 3KYDB 4PZJA 2DK8A 1TZLA 4LLLA 3BZ6A 5J47A 1XMKA 4JYKA 4B4CA 3GTOJ 3QYBA 3AG2H 2PFBA 1ZG3A 4L18B 3DTIA 3FXOA 3HRMA 2V1UA 4DGWB 1IV6A 2ZKZA 1ULYA 5E3MA 3E0JB 2QLZA 2PJPA 3HRSA 1LNWA 1HA8A 4CCKA 2GFNA 2VJJA 5DCMA 2EFPA 2HKXA 2QWWA 2Z5UA 3CCRI 3H92A 2K40A 2XDVA 2DLLA 1T2KA 1LKXA 1YO5C 3VB2A 1OMIA 2QM3A 3ML6A 5ERIA 1AOYA 5HDGA 2CFOA 1SEUA 3BCGA 4CZZA 1I5ZA 3HEFA 2W53A 4IHTA 1YQAA 2WY8Q 1WH5A 4N9HA 4A3DJ 1Y0UA 3BDDA 3ZMSA 3KX2A 4PCQA 5EYRA 2RDPA 3FISA 4EMSA 3WG7H 2Z1DA 1GDTA 5DAJA 4MQ9F 5GTHC 3ZOBA 1B9NA 1KU7A 1SC7A 3CO7C 4PJMA 4BXUA 3H9QA 4G7ZF 4ENNA 1RC9A 2A5WA 2MBFA 2DOFA 1WCMJ 5TRDA 2R93J 2ZJ2A 4H0EA 2JVGA 4BXFA 1RNLA 1F36A 1ETOA 3GF2A 4O6JA 3MKWB 1QVUA 1QZYA 2MYSA 2DI3A 5E1XA 5L3EA 1TNTA 5J1UA 3ELKA 2VE8A 5ICCA 3RKQA 2MH2A 2WV0A 5GPCA 1AWCA 4AVZA 4G6DA 2UXXA 3R0JA 2GLOA 4FETA 3PIPF 2GIZA 4BQOA 1ORKA 1YJWI 3NRVA 3KFWX 2JPCA 4CICA 3CCJI 3KKDA 3W6JB 5BNGA 1R1UA 1GV5A 2RVCA 1MH3A 2DG7A 3JREA 4MEXF 3ABLH 3ISPA 5LRSA 3VTIA 4ZDPA 2Y0MA 3GW2A 2FXAA 4NQWB 3WTWC 1ETVA 3G6EI 4N4NB 4RA2A 2DMUA 2DTZA 1ZRCA 2JQ7A 4LG3A 4A0ZA 3WTUC 3N4MA 3K6GA 2HOTA 1XG1A 3S1NJ 1TNSA 4WXDA 1JKPC 2BEOA 3J81K 3DBLB 1J75A 2IT0A 4RMNA 1S29A 2XSJC 3ZGKA 1ZQ3P 1D1AA 1BC8C 5K7FA 3PL8A 3ROUA 5L3BA 2VBWA 1Y8QB 2OJED 1B9MA 4KNYA 4NB5A 1KU9A 3JSOA 1WZ2A 3LWFA 1XGNA 2WTEA 4N0BA 2M34A 3BQZA 3FK6A 3VW1A 2NS0A 2IS4A 2EV6A 4PDKA 2XKPA 1LDJA 4MFDA 2PI0A 5EFYA 4NQWA 5CXIA 1R00A 2IA1A 1GVJA 1BBYA 4XLNF 4DZPA 4A2UA 1HKQA 1WPKA 3FZVA 4TV7A 3PQJA 2YUSA 3WTSC 2XKOA 4A5NA 2ZY9A 1V3FA 2O7OA 2ZO4A 1AA7A 2QSFX 3MFKA 1JHHA 1GXPA 2JA5J 3CUQA 2HI3A 2UZKA 2CV1A 1E0EA 1SMTA 4ZC3A 2QKLB 4A0YA 2E1NA 3WU0A 5F08A 1G2HA 2V57A 2CV0A 4Q48A 5HS8A 3WHBA 3GXOA 4M3DA 1T56A 1JGSA 2E1OA 4A3CJ 1FLIA 4UB8C 1UAAA 2REKA 3E5XA 4YFNF 3VWBA 4MTEA 3ZQGA 1RESA 3ZQQA 2HOSA 3A2KA 2FX0A 2TCTA 4JX5A 4CYDA 1UELB 4ON0A 3ZQFA 4I02A 2XGCA 2EWNA 2M45A 1U3EM 2IXSA 3S1RJ 1EF4A 3TP3A 3FK7A 4XQFA 3K4BA 1T08B 1TQIA 4DOZA 2ESNA 5LEKA 5TISC 3V7SA 4BDZA 2QWTA 1MKMA 5IPAA 2K9NA 3E97A 2HGCA 2HNHA 1WKMA 4UVCA 4CO8A 5GP9A 2ZBKA 1XD7A 2VKDA 3TMOA 2CWEA 3F0CA 1Z05A 2EIKH 3I64A 2XV4S 3DU5A 2V1XA 3ZP5A 2ZCNA 3CUQC 1ENHA 4UDSA 3RKWA 4AUXA 2EIJH 3B6AA 4C3JJ 1Z9CA 2VOOA 3U1KA 4DYRA 4OIOF 1ZK8A 5JVTA 2HFHA 3WE2A 3FXMA 3LFUA 3WE3A 1CQTA 4F55A 2L4MA 4E7SA 1EH6A 5IYCJ 3H0GJ 4HQMA 2X1EA 3FXLA 4MLOA 3NS4A 3DBRB 3BTJA 3NARA 5IOYA 2BXZA 3TGNA 1Z6RA 3GZ6A 5KNLA 3BR3A 3OR1C 3MKZA 2CUZA 4IVNA 3GX4X 4B09A 5LLQA 3U1DA 5J1YA 1HSTA 1MJAA 3W2AA 1OKRA 3J81Z 5B1BH 2WADA 2M8GX 2JT1A 5CLSA 5IT9K 1BW5A 3K4MA 3L7WA 3FKIJ 3SZTA 2NYXA 2VKVA 2QA4I 1ETWA 3OYGA 3NPIA 2G7LA 4R8HA 5HLTA 2MC4A 3CF5F 3WODF 2HKUA 1U6GA 4EQQA 4A3FJ 1KGSA 2GENA 2ZCMA 2WC2A 2R7RA 5H6QA 1IRXA 1TTYA 2AO9A 3I55I 5GTIC 2L7KA 3BHQA 2O0YA 1P7JA 1IG7A 4Y52J 4RAGA 4IF4A 3EGQA 3L00A 4HAMA 4JK1X 3RJPA 3KZZA 3J7YJ 2O8XA 2MW8A 4RLFA 5F64A 5KAIC 4B8XA 2VPLA 2BBYA 4PXIA 1QA6A 2E1MB 3MN2A 5GAHJ 1PDNC 3Q0WA 1L0OC 4AWXB 1QO0D 2G9WA 3M1EA 2RAEA 2VT2A 2P5LC 1XSDA 3JCUC 2LBFA 3PSIA 2PX9A 2R7OA 1IZ1A 5AIPA 4UUVA 2Q0OA 2FMLA 1FWZA 2Y9YA 4KMUX 5E20A 2EINH 4GRIA 3FXJA 1VQOI 4GYGA 3S1MJ 2PBXA 1ZAOA 4ESFA 4MQVA 2B1EA 2WA0A 3KP7A 4FT8A 3CZ6A 3SYTA 3S17J 1SVLA 3CUOA 1MMSA 3L2QA 2HYTA 1FX7A 3LA7A 3LSKA 2E36A 3VDXA 1C0WA 4BNCA 1P2FA 1VTNC 2HQRA 2LMDA 2DA5A 5FFXA 2ICWG 2F4OB 2MFZA 4I98B 3VW2A 2KRFA 4C2MA 1WJCA 2BXYA 4Y7NJ 3A1YA 4BHCA 3A01B 1E17A 3IC7A 4CCOA 2RGVA 1FSHA 2EZKA 4ZZDA 1O3TA 3FHZA 4NHJA 2E71A 2LP0A 3BCAA 4L9JA 3T1BA 5DD4A 3WHCA 1XCVA 4BBSJ 1FMWA 2M7AA 4FASD 2ZSIB 4KYWA 3E6BA 2DMQA 3F6VA 3QWLA 2VUMJ 2NOGA 2UWMA 1MMAA 2FE3A 2OUMA 3EDPA 3LSHA 2ZXJA 2AHQA 1E3OC 4UV9A 3T0YA 3DKXA 5FKLA 2LLKA 2P0WA 1QZZA 4CUGA 3E5QA 4LJZF 3GFLA 3K2AA 3S32A 4AC0A 4HNVA 1K6OA 3QRFF 3MAJA 3MNLA 4X6AJ 2YVHA 3E6CC 2F5EA 2MABA 3NXCA 1RETA 3C3WA 3F1BA 3DEEA 5FFZA 2FEZA 3EQLF 1SGMA 3NWSA 1LE8B 4I01A 3RSNA 2NRAC 2Q1ZB 4I6ZA 4HRIA 2CFXA 1Q1HA 4BU2A 4YFKF 4B47A 4YZEA 2EA2A 2HXIA 2Q24A 4ME9A 1Z0XA 5CKTA 5IT9Z 1B8IA 1VQNI 2A5YB 3OSGA 3OY9A 1SAUA 2B0LA 1I3QJ 2GA1A 2O6GE 2UXHA 4AF5A 4IRHA 3HG9A 3ANGA 2KPMA 4MEYF 3CCLI 3K69A 1TWHJ 2HVSA 1FBSA 3GO5A 1STZA 2GBYA 1Z6TA 1ZN2A 2G7SA 1WWXA 4IRVA 3HHGA 1IJWC 3ABUA 3HOUJ 3VSKA 4DJAA 5FKMA 1WRJA 2FBIA 4NNJA 3J7AO 1VQ6I 3EYIA 4CCLA 1WHUA 5IP6A 4PJ0C 3SWHA 1K4SA 3ON4A 2BVMA 5F04A 3VEPA 1LE8A 4ZDOA 1IF1A 3HIFA 4Y3OA 1FEXA 3IH4A 4HG2A 4NDLA 3EUPA 4L5IA 3C07A 3TBIA 2V6EA 4X0GA 3HGGA 3AAFA 5CJ9A 2WAQA 1ON1A 4BE0A 2OPTA 1D1BA 2AXTC 1TP4A 3S15J 2FQ3A 3JRAA 1U78A 2HTSA 2BGCA 4I0AA 5E3LA 3CMEI 4IQJA 1ITYA 2DT7B 2HQAA 5HSZA 2KHMA 2ETHA 3QP6A 2WGBA 2K3FA 3KP6A 1RKTA 4M3GA 2QIBA 3WTXC 2W82A 5LBQA 3H0DA 2BHYA 1YI2I 4P5OA 2DMTA 2M5WA 4WXCA 4S04A 2K86A 4RLQA 2E1CA 3MZ8A 1UZCA 1K78B 4FTHA 3K10A 2EFNA 1HDDC 4OOIA 2EB7A 2QVOA 3PJRA 4JP0A 2RQQA 1XSVA 2YS9A 4A6EA 5M5XJ 3OS0A 2MA3A 1LJ9A 2XAJA 1YW8A 3H3UA 3PASA 2COMA 2KIUA 5LGUA 2VQLA 2FNPA 3S16J 3P7NA 4UUSB 3VUQA 5CQGA 1LPQA 5DUIA 3FHNA 5E1ZB 3SJMA 3I0TA 1G8XA 2E7WA 4XRSA 1YYVA 4QLCU 3VYRB 2M7BA 3P9TA 4RB0A 2V1DA 4XLHA 4RM3A 3CJNA 3K9TA 2WAQN 3QPTA 1YLFA 3GFIA 3K70D 5EZHA 3KYLA 1K78A 3F8NA 1S7EA 1BC7C 3O2PE 1V55H 4ENMA 2ID6A 3BLYA 2RKHA 3E6MA 4DBRA 2VC1A 2D5VA 2BHZA 2W85A 1QPMA 1JTXA 1X1DA 3BCBA 5CVIA 3K4JA 3EYYA 3OMYA 1F5TA 4XICA 3OS2A 1VF9A 1UHSA 1FOWA 2PN6A 1PUFB 1A6QA 4OAZA 2DPDA 2VBXA 3MEXA 2KJBA 1R9TJ 2LDUA 1XPXA 3ZPLA 5HNFA 4BS9A 3CMAI 2P6SA 1MZBA 2HQ5A 2RREA 3M1CA 3OYIA 3HZJA 1HKTA 1UJ8A 1MJBA 2VL8A 4PFPA 3ZQHA 4PJLA 4KJZA 3MWMA 3C2BA 3HOTA 1I1SA 4WCGA 2DN0A 4IO9F 2NAZA 1G4DA 3VOXA 5J40A 2DT5A 2K9SA 5EG0B 4NELA 1TL8A 4AIDA 4OAYA 1FPQA 2OQGA 4GYIA 4OD5A 2LY2A 3T8TA 1O7LA 1FIPA 1CF7A 1S6LA 3L2VA 4KN7X 3F72A 5L3GA 1HDPA 2P4WA 2IS2A 2KIQA 1D1CA 2PMZN 3IAM2 3ZQLA 1MDMA 2LK2A 2DA3A 1HBXG 2HPMA 4HLYA 2KIMA 4AVPA 2IJLA 3O8GA 2XGXA 2DU9A 3CWRA 3HYIA 1TQPA 4PGHA 1LEBA 5J1RA 3PNTA 3HIMA 2K4JA 3H1CA 2DQRA 4DYQA 2NS8A 2LC2A 2YPRA 3EETA 5LRRA 3OYBA 2UXOA 2V79A 4BJ6C 5F1JA 2JSCA 2BVLA 1U5TC 3V7CA 4ETSA 1Z1DA 2IPQX 3VVXA 4C30A 3LQQA 2EH3A 2OV7A 1RKWA 2KDZA 4RAYA 2RN7A 4P9UA 2K7LA 3BJAA 1X58A 3K0LA 5D1RA 2JN6A 4E7HA 2LKXA 3CCEI 1MBKA 4BXXJ 3SFIA 1OJLA 3WGHA 5C4JJ 5ILVA 2HZDA 4D7MA 5JHUA 1U0JA 5DDGA 3HKZN 1S3JA 3DWLE 3LSMA 2B63J 4RGSA 2HDWA 2LRDA 4A69C 3C2HA 1Z7UA 4ASNA 2RNJA 2QQ9A 4ZTFA 2DA2A 2FF4A 3S93A 3SZPA 3W6KB 1ZGJA 1B72A 1U8BA 5HDNA 4CCMA 1OCTC 1X4OA 2CO5A 3SFZA 4EVIA 1WH7A 2OBPA 1VQMI 2E19A 5DCMB 3TDZC 3HM5A 5KVRA 1YFHA 4J19A 4I7HA 1BOAA 5DUKA 3PFYA 2VJ5A 1OCRH 4A93J 1IN5A 3A02A 1EH8A 2D6YA 2P81A 3DFGA 1XN7A 1TWFJ 3LSJA 4EJVA 2NXNB 2L9RA 1FOXA 1NH3A 1LDKB 2UXUA 3WGIA 1BIBA 1GVDA 3A03A 1GUUA 4IXAA 2CGPA 1T8IA 3GTGJ 3LHQA 2D1HA 5LEJA 3D5LA 1O7FA 1RZ4A 2BY1A 3S1QJ 1MBJA 3GTKJ 4U9NA 4ZYDA 2EZIA 3ECHA 3FMRA 5K5RA 4A3EJ 2FBKA 2OCCH 2R3SA 2X6OA 4R79A 3L2WA 2V9PA 2R92J 5E8GA 4IKFA 2A69F 1KQ9A 4YIRX 3E7LA 5L3DA 4XNFA 2P7VB 5E3NA 3E3VA 3IUVA 4IHYA 5DCFA 3TW7A 3F23A 1P4XA 3AQSA 4XR6A 2EILH 1D8KA 1VI0A 1ZELA 2DDAA 2E7XA 3B6CA 4M6XA 3FRQA 1R5ID 2ZNZA 4AYBA 4CXFA 4LITA 1A5JA 2BE5F 2ISZA 1Y1WJ 3S2DJ 5JVGF 1ZRDA 3LSTA 4U9LA 3BC8A 4XN3A 3TO7A 2VJ4A 1S9HA 1T39A 3HL2A 2FRHA 3PUBA 4YFXF 4LB6B 2DMNA 3ABKH 2E5ZA 1Y8RB 3MZHA 5HBUA 5E18F 4A3JJ 2ZCWA 3A4CA 4N4OB 4EGZA 1V4RA 2M87A 1WQ2A 4Y13A 3QPLA 1R1TA 3K4KA 2F2EA 2M30A 4L5JA 2IBDA 4OWRB 3MD2A 4CZCA 4O3MA 2IS6A 4E70A 3IH2A 5FHPA 2VQGA 2K27A 2V4JC 3NQOA 4U0WA 4A6DA 2IA2A 4D5CA 2NS7A 2XIGA 1YIJI 1OQYA 2Q2EA 4UVAA 5E1WA 3V8JA 5FD5A 4P9FA 2VASA 4HSRA 5HLIA 1YE9A 3S2WA 4LK1F 3ZR8X 4FX0A 4RAZA 4L9VA 4E4HA 4EV0A 1IRGA 2CUJA 4IHWA 4ESBA 2K9QA 2J5OA 2XGEA 4F93B 2E5NA 2JUGA 4U87A 3QOPA 1QBJA 1VQ9I 1HW2A 3PUFA 3KCCA 3GLLA 2JRTA 2R7WA 3MZYA 4C3IJ 3TKYA 1O4XA 1IDZA 2R0QC 5EEHA 2YU9J 3J80Z 4U7BA 4IX7A 1NG6A 2OA4A 2YVEA 3FKJA 1JXSA 1OCPA 5FMPA 3BWGA 4AYBN 1FYLA 2PQ8A 4G6QA 1ZGWA 2CS3A 4AD9A 1HQCA 1USTA 4XKCA 3V4GA 2J5PA 2Y48A 4EATA 5KAFC 2QGUA 2L0KA 3K4NA 5ILUA 1GLNA 3HSRA 5F6FA 5JLXA 2LYCA 1BI1A 3LMMA 1IV8A 5H9TA 3CUQB 4CHUA 1OYIA 2XB5A 3QOEA 2TDXA 2P6TA 1TBXA 3FXRA 4GFBA 1WJDA 2LD5A 3RKYA 4XRFA 2GUHA 4HLXA 3IRQA 1JKQC 1HC8A 4JKZA 4BDYA 3V6GA 3PPBA 1QGPA 1JE8A 1OYYA 3HDDA 2CSOA 5HODA 2UXIA 5J3LA 3Q9VA 2EJRA 2VBYA 2QF7A 4ZJZA 2QEXI 4EJOA 3K4CA 3C7JA 2ZB9A 3LQRA 3AQTA 3TO9A 4B1RA 2VLAA 2IEKA 1GV2A 1E2XA 2XPWA 3DXJF 2OAZA 4MFEA 3BNIA 3SEQA 1X2MA 4WIBA 2R7FA 2I10A 3LWJA 4HDUA 1DDNA 1Z67A 3RI4A 2O3FA 4D9JA 4OMYA 3VYUB 3S14J 2L01A 2XAHA 1N75A 1MBHA 2HQNA 4EJWA 4ESJA 2H09A 3CLOA 3FX3A 2A6TA 3H5NA 4ZYEA 2JTVA 2VQHA 3CJRB 2DO7A 3W6VA 2M4KA 5D5UB 1F9NA 3BG3A 1TQMA 2DOAA 3SZGA 4XOTA 3RIRA 1MNDA 3M8FA 3OYEA 2QSGX 3CMMA 3PFIA 1HW5A 4ENKA 4JL3A 3BZCA 1R4NB 1Z21A 3CDHA 3RQIA 4V2FA 3OV8A 4LIVA 3CD6I 3KP2A 3RKXA 3NAUA 4BHBA 1LFUP 1T95A 4HEA2 3SXYA 5IT3A 1JT0A 3MKLA 5DM6F 4L0YB 3VFZA 3DTKA 4A3MJ 1HOMA 1J2XA 2FOWA 3LA3A 3IWZA 2FOKA 4M9XA 2AQEA 4OINF 1T6SA 2MSYA 2DK5A 1D5VA 2KJCA 2Z16A 4LFUA 3SDBA 3I59A 1V5FA 2KRCA 3KP5A 1R22A 4RDUA 3JRBA 2UV1A 5K5QA 2A6HF 2IRFG 1TWGJ 5JFRA 1DUXC 2BY0A 2QKMB 3DKYA 5IY5H 2NVYJ 1D0ZA 3UNGC 1QZEA 4GCLA 1FSEA 1ZG1A 1O57A 3IUOA 4LLGF 4I2OA 2AQFA 2R7XA 5JLWA 1J09A 3WTYC 4J01A 3BQYA 1XS9A 3R0AA 5EF6A 3LSRA 2JMWA 2E35A 2DQLA 3MMYB 2GOMA 2M9HA 2L5QA 4HYEA 1SFOJ 3H5RA 1G3YA 2JA8J 3C1DA 2X4HA 2EV5A 1BR1A 1K61A 5LHHA 2BOLA 3RYRA 1BI3A 2GQQA 1PVEA 3B73A 1G6NA 1OCZH 4UV8A 1IN6A 3OOUA 1NK3P 2QUFA 4BHPA 3UR3C 1ZKGA 3Q9SA 5HOOA 2XVCA 3G1MA 2K5CA 1IUYA 4KT6A 3CRJA 4MHGA 1RIOH 5FKOA 1D3YA 2LBFB 1MSFC 1JI8A 2VJIA 1YTYA 2VXDA 2NVXJ 2GWRA 1IXSB 1UG0A 4BE2A 3ZMUA 2CQKA 4DNCA 2L9NA 2NVQJ 1RR7A 3VODA 1G59A 2CV2A 4G6TB 1LVKA 2FD5A 4CH7A 3IAS2 1SVOA 3KLNA 3PO3J 1QVTA 2LOOA 5K58A 3V78A 3KLOA 3OYAA 2FUG2 5K7HA 2HTJA 2ADUA 4L9NA 2DA1A 1T33A 3LOCA 1QHHD 4XONA 3R60A 4CCNA 1YX5A 4GXOA 3RDIA 4A5MA 2K3PA 3F8FA 2Y31A 1ODDA 2NOJB 2IGKA 4F92B 2IGNA 2L7MP 2LR8A 1NTCA 2HPIA 5ICFA 2QKOA 1ZREA 3F8CA 4EM2A 1TC3C 2XAQA 3BR5A 4LLNA 1RRJA 1JT6A 2CJJA 1QU3A 1IN4A 5HAWA 1TT5B 3GVAA 2E2IJ 4ITVA 3JRFA 1R58A 2HVQA 2L02A 2UUZA 2YR2A 2IU5A 3FIWA 1APLC 3HTHA 2NNNA 3HTJA 1M1EB 4RS8A 4PGGA 3I3LA 2VXZA 3DLAA 2ZNYA 3C18A 1A36A 2WV1A 5KHDA 1TW2A 2KT0A 1F1ZA 1KA8A 1XSXA 5TGTA 9ANTA 2KLOA 5BMZA 1G3TA 5D8LB 3OSFA 4EEFG 1D0XA 4I99C 5E8IA 2LVSA 3E7QA 5KK1A 3JTHA 4PJJA 2DAOA 5BS6A 3G3ZA 1BJAA 3P9IA 2QBYA 4B3XA 3HGYA 5GPAA 3ASNH 5FO5A 5EGOB 2BV6A 2G7UA 2JJ7A 4G8XA 3LA2A 2G7GA 4NUBA 2V7FA 3G7RA 4RGRA 4LIUA 3HJEA 4E7LA 5D5XB 4EM1A 1PUEE 3RYPA 2ZOYA 2JK3A 3SHFA 2DW4A 3MKYB 1BA5A 2OF7A 1B8IB 2ISYA 1ZHFA 4KT5C 3ZQIA 3ZMVA 2E2HJ 2FBHA 2D2WA
chains in the Genus database with same CATH topology
1W0UA 4D5FA 3LNQA 4XICA 2K40A 5K7ZA 1VF9A 1UHSA 1PUFB 5IOZA 2HDDA 1R9TJ 5M3FJ 3BCGA 1A6IA 2W53A 1X2NA 2ELKA 3HEFA 3D1NI 5FGLA 2HQ5A 1AHDP 3H3VK 1WH5A 2XSDC 4A3DJ 2CUEA 3DPJA 2DA4A 2ECBA 5EGOA 1GT0C 3ZQHA 5C44J 3VOKA 5EYRA 1ETYA 1H89C 3FISA 3IV5A 3C2BA 1IGNA 4LOCA 3TEDA 3BR0A 1HLVA 3G1OA 3ZOBA 2DN0A 4FE4A 4QIWN 5EDNA 1GDTA 3CJDA 3VVZA 3VOXA 5EG0B 2K9SA 4NELA 3JR9A 4GFLA 2XPUA 1FIPA 2DMPA 1WCMJ 3TW6A 3M4OJ 2R93J 2XDNA 3GZIA 1HDPA 5F27A 1AU7A 1NK2P 2PMZN 1Z77A 1F36A 3ZQLA 2EZLA 1ETOA 2LK2A 1LFBA 2DA3A 2NP5A 1QVUA 5FKKA 3KKCA 5J1UA 3O8GA 2WB1N 3HOXJ 3BJBA 3CWRA 2G0EA 3JRIA 3HIMA 2LFBA 3O8HA 5J1RA 5DS9A 3JRCA 3RKQA 4C3HJ 5GPCA 4DYQA 2NS8A 2UXOA 2GLOA 1ORKA 5F1JA 3BR6A 3CQZJ 3KKDA 3VVXA 1Q1VA 1QPIA 5BNGA 1GV5A 1MH3A 2EH3A 3JSJA 2DG7A 3LSGA 5IYBJ 3JREA 2R7ZJ 1RKWA 2KDZA 3ON2A 3COLA 1IUFA 5M5WJ 1ETVA 1X58A 2EZHA 1VFCA 5D1RA 2JN6A 2DMUA 2Y0SN 2DTZA 2LKXA 1RPWA 2HOTA 1XG1A 1MBKA 3JRDA 3S1NJ 1JKPC 4BXXJ 3SFIA 1OJLA 2M2EA 5C4JJ 4D7MA 3HKZN 2VI6A 2B63J 1ZQ3P 4L5EA 2L7FP 4A69C 1MH4A 1ETKA 4A3LJ 5K7FA 4ICHA 2CRGA 2DA2A 1B72A 4XK4A 1JJ6C 1U8BA 1OCTC 3PM1A 4S0HB 4MO7A 1WH7A 3BR2A 1H88C 2E19A 2M34A 1JJ8C 3BQZA 3FK6A 2N8GA 1ETQA 3HM5A 3S2HJ 3VW1A 2COBA 4J19A 4DYCA 2R5ZA 2CU7A 4A93J 4IHXA 3G1LA 3A02A 4MFDA 5M5YJ 2D6YA 2P81A 4A3KJ 5EFYA 5CXIA 1TWFJ 3LSJA 1UI5A 2L9RA 3VPRA 2G3BA 4DZPA 4UUTA 2UXUA 2DA6A 1WPKA 2M0CA 1MSEC 1GVDA 1JUMA 2YUSA 3A03A 3K7AJ 1GUUA 4M3BA 2O7OA 3GTGJ 3LHQA 2JA5J 2HI3A 3S1QJ 1MBJA 3GTKJ 4AC6A 1TWCJ 2EZIA 1G2HA 2XRLA 5F08A 3UKGA 2W48A 4A3EJ 2V57A 2X6OA 3L1PA 2R92J 4HKUA 3WHBA 4M3DA 5FJ8J 1T56A 4A3CJ 2E1OA 1IRZA 3BG9A 3GTMJ 2REKA 2ECCA 3E7LA 3ZQGA 2MG4A 1RESA 5E3NA 2HOSA 4IEJA 4B3AA 3IUVA 2FX0A 2TCTA 4JX5A 2ZOZA 4IHYA 3TW7A 3ZQFA 2XGCA 4DW6A 5DAJA 1SANA 3AQSA 1MBGA 3S1RJ 1VI0A 1EF4A 3TP3A 3B6CA 4G12A 3FK7A 4XRSG 3FRQA 3B81A 1IDYA 4JX4A 1A5JA 1Y1WJ 3S2DJ 1Y1VJ 1WGXA 4CYCA 5E3OA 4MIMA 2QWTA 5IPAA 2K9NA 2DMNA 5HBUA 3HOYJ 4A3JJ 1JUPA 5GP9A 3QPLA 4ABZA 2IBDA 2EBIA 2VPRA 4QTRA 3LSPA 3F0CA 4FCYA 1ZTRA 3CMYA 3JRGA 5FHPA 3IH2A 2OERA 4I76A 2XGDA 4KWAA 4D5CA 3G56A 2ZCNA 3M3YJ 3A01A 2NS7A 1ENHA 3TP0A 4UDSA 4AUXA 4GFKA 3B6AA 3DCFA 4C3JJ 4DYRA 1ZK8A 2PZ9A 3BTIA 1CQTA 5F0CA 2DA7A 2L7ZA 5IYCJ 3CCYA 1B72B 3H0GJ 2VKEA 4IHWA 4MLOA 3BTJA 3DEWA 3NARA 2K9QA 5IOYA 2XGEA 3NI7A 4MXMA 3BR3A 2QTQA 3VIBA 5J1YA 1IDZA 4C3IJ 2R5ZB 1O4XA 2R0QC 4BY1J 1FTZA 2YU9J 2M8GX 4CGRA 2YVEA 2R5YB 1OCPA 1BW5A 3HOVJ 4AYBN 5FMPA 3FKIJ 1U9OA 2VKVA 2NP3A 1ETWA 3NPIA 1P7IA 1ZGWA 2H8RA 2G7LA 5AQCA 2RHAA 2HKUA 2L0KA 1XC5A 4A3FJ 2HXOA 2GENA 2ZCMA 2QCOA 2ME6A 2AO9A 1MBFA 5JLXA 2LY9A 3BRUA 5H9TA 3BHQA 1P7JA 1IG7A 4Y52J 2XB5A 3EGQA 2DJNA 4GFBA 4A3GJ 2LD5A 2MW8A 2GUHA 4IHVA 2ZCXA 3HBLA 4PXIA 5M3MJ 1JKQC 4JKZA 3MN2A 5FLMJ 3V6GA 2OI8A 3Q0WA 3QQAA 3PPBA 4V2GA 3S5RA 3HDDA 2JA7J 2UXPA 5HODA 2RAEA 2X9DA 2UXIA 5J3LA 2QF7A 3OIOA 1UMQA 2R5YA 3RZDJ 1ETXA 2ZB9A 3AQTA 4B1RA 2Y9YA 2IEKA 1GV2A 1UG2A 2XPWA 4MFEA 2Y9ZA 3BNIA 3S1MJ 2PBXA 1X2MA 4BBRJ 3LWJA 2I10A 1ZR4A 4CYCB 4A3IJ 3S17J 5F0HA 3S14J 3HE0A 2HYTA 1MBHA 3HTIA 2FQ4A 2TRTA 4BY7J 1DU0A 2DA5A 3W6VA 3VW2A 3BG3A 4GCKA 3GTLJ 5F0FA 2ME0A 4Y7NJ 4JL3A 2CQXA 3A01B 2NVTJ 4D7NA 2EZKA 3RQIA 2FBQA 4V2FA 1BJZA 1DU6A 1BW6A 3GEUA 2CQQA 2LP0A 3WHCA 3NAUA 4M3FA 4BBSJ 1LFUP 2F07A 3QBMA 1OFCX 1JT0A 3MKLA 4JX6A 1H8AC 1U9NA 1HOMA 4A3MJ 2DMQA 2VUMJ 2NOGA 2XB0X 2MSYA 1JUSA 5IP9J 3KNWA 2DG8A 2AHQA 3JRBA 1E3OC 4RDUA 4GCTA 3BTCA 5FKLA 2CUFA 3LJLA 2LLKA 1F43A 1I50J 1TWGJ 3K2AA 1FIAA 4AC0A 4HNVA 4W97A 3MNLA 4X6AJ 3RZOJ 2YVHA 1VNDA 2FJ1A 2NVYJ 4ACIA 4GCLA 3NXCA 1RETA 3IH3A 1HCRA 3VVYA 3F1BA 4UUSA 4C2MJ 5JLWA 3BT9A 1JKRC 3BQYA 2HOAA 1SGMA 1XS9A 1JKOC 3LSRA 5EF6A 5EEAA 2JMWA 1MBEA 4RBOA 1LE8B 3PO2J 5DTDA 1JGGA 4I6ZA 2M9HA 4W1UA 4NN1A 1IC8A 4JNNA 3NRGA 1SFOJ 4QSHA 2JA8J 1WI3A 4YZEA 1D5YA 2HXIA 1AKHB 2Q24A 4ME9A 4BKXA 5EZGA 1K61A 1Z0XA 1UI6A 3BG5A 1B8IA 1I6HJ 3VP5A 3OSGA 4XIDA 1I3QJ 3Q3SA 4DZJA 3OOUA 1NK3P 2UXHA 4XRMA 4AF5A 3KZ9A 3I4NJ 3ANGA 3I4MJ 1K83J 1TWHJ 1ZKGA 1YRNB 3G1MA 3CRJA 3GTJJ 2GBYA 5FKOA 1PUFA 3O60A 2G7SA 1MSFC 2JA6J 3MVPA 1IJWC 3HOUJ 3ANPA 5FKMA 5CW8A 3QKXA 1BL0A 2NVXJ 5IP6A 3HOZJ 3BTLA 3NNRA 3ON4A 2O8KA 5F04A 2IAIA 3ZQCA 2NVQJ 1LE8A 1RR7A 4X1EA 2GM4A 3RH2A 2JWTA 4L62A 2FD5A 1FEXA 3VW0A 3IH4A 4FE7A 5FKNA 4NDLA 3PO3J 3EUPA 1QVTA 1FTTA 5C3EJ 3GBGA 3C07A 5K58A 1ZR2A 1HF0A 3V78A 5K7HA 5EG0A 3HGGA 1AKHA 2DA1A 1T33A 1TWAJ 3LOCA 2OPTA 4M6VA 5CXGA 3S15J 5IYDJ 4A3BJ 2Y31A 3Q0VA 3JRAA 1U78A 3CDLA 5E3LA 1NTCA 2L7MP 2LR8A 1ITYA 2O7TA 1POGA 3T6NA 5HSZA 3GTQJ 2QKOA 2WGBA 3RD3A 1QRYA 1TC3C 2EQRA 2RASA 1YRNA 1RKTA 3BR5A 4M3GA 2QIBA 2ID3A 1JT6A 2CJJA 2E2JJ 2QOPA 5C4XJ 3JRHA 2Y2ZA 5IP7J 5HAWA 2DMTA 2MGQA 2E2IJ 3BR1A 3JRFA 1W0TA 1JTYA 2IU5A 3FIWA 1APLC 3HTHA 3HTJA 3HB9A 2H1KA 4FTHA 3HOWJ 1HDDC 2NX4A 2WV1A 4JP0A 5FLVA 2WUIA 2KT0A 9ANTA 3Q0UA 1MNMC 2YS9A 4FISA 5M5XJ 5D19A 4M3EA 3OSFA 2HYJA 4EEFG 2XPVA 3QPSA 3E7QA 2LVSA 3PASA 5C4YA 3S16J 4UUSB 3VUQA 3HGYA 5GPAA 3SJMA 3SDGA 5EGOB 3GTPJ 4B4CA 2JJ7A 4JYKA 4XRSA 3GTOJ 5D18A 2G7GA 4MK6A 3G7RA 3P9TA 2LTPA 3HTAA 2Y30A 1IV6A 2ZOYA 2JK3A 2WAQN 5EZHA 1BA5A 2O9LA 2OF7A 1S7EA 5E3MA 1B8IB 2ID6A 2X48A 3ZQIA 1FJLA 2GFNA 2D5VA 2E2HJ 1JTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0U A;  4D5F A;  3LNQ A;  4XIC A;  2K40 A;  5K7Z A;  1VF9 A;  1UHS A;  1PUF B;  5IOZ A;  2HDD A;  1R9T J;  5M3F J;  3BCG A;  1A6I A;  2W53 A;  1X2N A;  2ELK A;  3HEF A;  3D1N I;  5FGL A;  2HQ5 A;  1AHD P;  3H3V K;  1WH5 A;  2XSD C;  4A3D J;  2CUE A;  3DPJ A;  2DA4 A;  2ECB A;  5EGO A;  1GT0 C;  3ZQH A;  5C44 J;  3VOK A;  5EYR A;  1ETY A;  1H89 C;  3FIS A;  3IV5 A;  3C2B A;  1IGN A;  4LOC A;  3TED A;  3BR0 A;  1HLV A;  3G1O A;  3ZOB A;  2DN0 A;  4FE4 A;  4QIW N;  5EDN A;  1GDT A;  3CJD A;  3VVZ A;  3VOX A;  5EG0 B;  2K9S A;  4NEL A;  3JR9 A;  4GFL A;  2XPU A;  1FIP A;  2DMP A;  1WCM J;  3TW6 A;  3M4O J;  2R93 J;  2XDN A;  3GZI A;  1HDP A;  5F27 A;  1AU7 A;  1NK2 P;  2PMZ N;  1Z77 A;  1F36 A;  3ZQL A;  2EZL A;  1ETO A;  2LK2 A;  1LFB A;  2DA3 A;  2NP5 A;  1QVU A;  5FKK A;  3KKC A;  5J1U A;  3O8G A;  2WB1 N;  3HOX J;  3BJB A;  3CWR A;  2G0E A;  3JRI A;  3HIM A;  2LFB A;  3O8H A;  5J1R A;  5DS9 A;  3JRC A;  3RKQ A;  4C3H J;  5GPC A;  4DYQ A;  2NS8 A;  2UXO A;  2GLO A;  1ORK A;  5F1J A;  3BR6 A;  3CQZ J;  3KKD A;  3VVX A;  1Q1V A;  1QPI A;  5BNG A;  1GV5 A;  1MH3 A;  2EH3 A;  3JSJ A;  2DG7 A;  3LSG A;  5IYB J;  3JRE A;  2R7Z J;  1RKW A;  2KDZ A;  3ON2 A;  3COL A;  1IUF A;  5M5W J;  1ETV A;  1X58 A;  2EZH A;  1VFC A;  5D1R A;  2JN6 A;  2DMU A;  2Y0S N;  2DTZ A;  2LKX A;  1RPW A;  2HOT A;  1XG1 A;  1MBK A;  3JRD A;  3S1N J;  1JKP C;  4BXX J;  3SFI A;  1OJL A;  2M2E A;  5C4J J;  4D7M A;  3HKZ N;  2VI6 A;  2B63 J;  1ZQ3 P;  4L5E A;  2L7F P;  4A69 C;  1MH4 A;  1ETK A;  4A3L J;  5K7F A;  4ICH A;  2CRG A;  2DA2 A;  1B72 A;  4XK4 A;  1JJ6 C;  1U8B A;  1OCT C;  3PM1 A;  4S0H B;  4MO7 A;  1WH7 A;  3BR2 A;  1H88 C;  2E19 A;  2M34 A;  1JJ8 C;  3BQZ A;  3FK6 A;  2N8G A;  1ETQ A;  3HM5 A;  3S2H J;  3VW1 A;  2COB A;  4J19 A;  4DYC A;  2R5Z A;  2CU7 A;  4A93 J;  4IHX A;  3G1L A;  3A02 A;  4MFD A;  5M5Y J;  2D6Y A;  2P81 A;  4A3K J;  5EFY A;  5CXI A;  1TWF J;  3LSJ A;  1UI5 A;  2L9R A;  3VPR A;  2G3B A;  4DZP A;  4UUT A;  2UXU A;  2DA6 A;  1WPK A;  2M0C A;  1MSE C;  1GVD A;  1JUM A;  2YUS A;  3A03 A;  3K7A J;  1GUU A;  4M3B A;  2O7O A;  3GTG J;  3LHQ A;  2JA5 J;  2HI3 A;  3S1Q J;  1MBJ A;  3GTK J;  4AC6 A;  1TWC J;  2EZI A;  1G2H A;  2XRL A;  5F08 A;  3UKG A;  2W48 A;  4A3E J;  2V57 A;  2X6O A;  3L1P A;  2R92 J;  4HKU A;  3WHB A;  4M3D A;  5FJ8 J;  1T56 A;  4A3C J;  2E1O A;  1IRZ A;  3BG9 A;  3GTM J;  2REK A;  2ECC A;  3E7L A;  3ZQG A;  2MG4 A;  1RES A;  5E3N A;  2HOS A;  4IEJ A;  4B3A A;  3IUV A;  2FX0 A;  2TCT A;  4JX5 A;  2ZOZ A;  4IHY A;  3TW7 A;  3ZQF A;  2XGC A;  4DW6 A;  5DAJ A;  1SAN A;  3AQS A;  1MBG A;  3S1R J;  1VI0 A;  1EF4 A;  3TP3 A;  3B6C A;  4G12 A;  3FK7 A;  4XRS G;  3FRQ A;  3B81 A;  1IDY A;  4JX4 A;  1A5J A;  1Y1W J;  3S2D J;  1Y1V J;  1WGX A;  4CYC A;  5E3O A;  4MIM A;  2QWT A;  5IPA A;  2K9N A;  2DMN A;  5HBU A;  3HOY J;  4A3J J;  1JUP A;  5GP9 A;  3QPL A;  4ABZ A;  2IBD A;  2EBI A;  2VPR A;  4QTR A;  3LSP A;  3F0C A;  4FCY A;  1ZTR A;  3CMY A;  3JRG A;  5FHP A;  3IH2 A;  2OER A;  4I76 A;  2XGD A;  4KWA A;  4D5C A;  3G56 A;  2ZCN A;  3M3Y J;  3A01 A;  2NS7 A;  1ENH A;  3TP0 A;  4UDS A;  4AUX A;  4GFK A;  3B6A A;  3DCF A;  4C3J J;  4DYR A;  1ZK8 A;  2PZ9 A;  3BTI A;  1CQT A;  5F0C A;  2DA7 A;  2L7Z A;  5IYC J;  3CCY A;  1B72 B;  3H0G J;  2VKE A;  4IHW A;  4MLO A;  3BTJ A;  3DEW A;  3NAR A;  2K9Q A;  5IOY A;  2XGE A;  3NI7 A;  4MXM A;  3BR3 A;  2QTQ A;  3VIB A;  5J1Y A;  1IDZ A;  4C3I J;  2R5Z B;  1O4X A;  2R0Q C;  4BY1 J;  1FTZ A;  2YU9 J;  2M8G X;  4CGR A;  2YVE A;  2R5Y B;  1OCP A;  1BW5 A;  3HOV J;  4AYB N;  5FMP A;  3FKI J;  1U9O A;  2VKV A;  2NP3 A;  1ETW A;  3NPI A;  1P7I A;  1ZGW A;  2H8R A;  2G7L A;  5AQC A;  2RHA A;  2HKU A;  2L0K A;  1XC5 A;  4A3F J;  2HXO A;  2GEN A;  2ZCM A;  2QCO A;  2ME6 A;  2AO9 A;  1MBF A;  5JLX A;  2LY9 A;  3BRU A;  5H9T A;  3BHQ A;  1P7J A;  1IG7 A;  4Y52 J;  2XB5 A;  3EGQ A;  2DJN A;  4GFB A;  4A3G J;  2LD5 A;  2MW8 A;  2GUH A;  4IHV A;  2ZCX A;  3HBL A;  4PXI A;  5M3M J;  1JKQ C;  4JKZ A;  3MN2 A;  5FLM J;  3V6G A;  2OI8 A;  3Q0W A;  3QQA A;  3PPB A;  4V2G A;  3S5R A;  3HDD A;  2JA7 J;  2UXP A;  5HOD A;  2RAE A;  2X9D A;  2UXI A;  5J3L A;  2QF7 A;  3OIO A;  1UMQ A;  2R5Y A;  3RZD J;  1ETX A;  2ZB9 A;  3AQT A;  4B1R A;  2Y9Y A;  2IEK A;  1GV2 A;  1UG2 A;  2XPW A;  4MFE A;  2Y9Z A;  3BNI A;  3S1M J;  2PBX A;  1X2M A;  4BBR J;  3LWJ A;  2I10 A;  1ZR4 A;  4CYC B;  4A3I J;  3S17 J;  5F0H A;  3S14 J;  3HE0 A;  2HYT A;  1MBH A;  3HTI A;  2FQ4 A;  2TRT A;  4BY7 J;  1DU0 A;  2DA5 A;  3W6V A;  3VW2 A;  3BG3 A;  4GCK A;  3GTL J;  5F0F A;  2ME0 A;  4Y7N J;  4JL3 A;  2CQX A;  3A01 B;  2NVT J;  4D7N A;  2EZK A;  3RQI A;  2FBQ A;  4V2F A;  1BJZ A;  1DU6 A;  1BW6 A;  3GEU A;  2CQQ A;  2LP0 A;  3WHC A;  3NAU A;  4M3F A;  4BBS J;  1LFU P;  2F07 A;  3QBM A;  1OFC X;  1JT0 A;  3MKL A;  4JX6 A;  1H8A C;  1U9N A;  1HOM A;  4A3M J;  2DMQ A;  2VUM J;  2NOG A;  2XB0 X;  2MSY A;  1JUS A;  5IP9 J;  3KNW A;  2DG8 A;  2AHQ A;  3JRB A;  1E3O C;  4RDU A;  4GCT A;  3BTC A;  5FKL A;  2CUF A;  3LJL A;  2LLK A;  1F43 A;  1I50 J;  1TWG J;  3K2A A;  1FIA A;  4AC0 A;  4HNV A;  4W97 A;  3MNL A;  4X6A J;  3RZO J;  2YVH A;  1VND A;  2FJ1 A;  2NVY J;  4ACI A;  4GCL A;  3NXC A;  1RET A;  3IH3 A;  1HCR A;  3VVY A;  3F1B A;  4UUS A;  4C2M J;  5JLW A;  3BT9 A;  1JKR C;  3BQY A;  2HOA A;  1SGM A;  1XS9 A;  1JKO C;  3LSR A;  5EF6 A;  5EEA A;  2JMW A;  1MBE A;  4RBO A;  1LE8 B;  3PO2 J;  5DTD A;  1JGG A;  4I6Z A;  2M9H A;  4W1U A;  4NN1 A;  1IC8 A;  4JNN A;  3NRG A;  1SFO J;  4QSH A;  2JA8 J;  1WI3 A;  4YZE A;  1D5Y A;  2HXI A;  1AKH B;  2Q24 A;  4ME9 A;  4BKX A;  5EZG A;  1K61 A;  1Z0X A;  1UI6 A;  3BG5 A;  1B8I A;  1I6H J;  3VP5 A;  3OSG A;  4XID A;  1I3Q J;  3Q3S A;  4DZJ A;  3OOU A;  1NK3 P;  2UXH A;  4XRM A;  4AF5 A;  3KZ9 A;  3I4N J;  3ANG A;  3I4M J;  1K83 J;  1TWH J;  1ZKG A;  1YRN B;  3G1M A;  3CRJ A;  3GTJ J;  2GBY A;  5FKO A;  1PUF A;  3O60 A;  2G7S A;  1MSF C;  2JA6 J;  3MVP A;  1IJW C;  3HOU J;  3ANP A;  5FKM A;  5CW8 A;  3QKX A;  1BL0 A;  2NVX J;  5IP6 A;  3HOZ J;  3BTL A;  3NNR A;  3ON4 A;  2O8K A;  5F04 A;  2IAI A;  3ZQC A;  2NVQ J;  1LE8 A;  1RR7 A;  4X1E A;  2GM4 A;  3RH2 A;  2JWT A;  4L62 A;  2FD5 A;  1FEX A;  3VW0 A;  3IH4 A;  4FE7 A;  5FKN A;  4NDL A;  3PO3 J;  3EUP A;  1QVT A;  1FTT A;  5C3E J;  3GBG A;  3C07 A;  5K58 A;  1ZR2 A;  1HF0 A;  3V78 A;  5K7H A;  5EG0 A;  3HGG A;  1AKH A;  2DA1 A;  1T33 A;  1TWA J;  3LOC A;  2OPT A;  4M6V A;  5CXG A;  3S15 J;  5IYD J;  4A3B J;  2Y31 A;  3Q0V A;  3JRA A;  1U78 A;  3CDL A;  5E3L A;  1NTC A;  2L7M P;  2LR8 A;  1ITY A;  2O7T A;  1POG A;  3T6N A;  5HSZ A;  3GTQ J;  2QKO A;  2WGB A;  3RD3 A;  1QRY A;  1TC3 C;  2EQR A;  2RAS A;  1YRN A;  1RKT A;  3BR5 A;  4M3G A;  2QIB A;  2ID3 A;  1JT6 A;  2CJJ A;  2E2J J;  2QOP A;  5C4X J;  3JRH A;  2Y2Z A;  5IP7 J;  5HAW A;  2DMT A;  2MGQ A;  2E2I J;  3BR1 A;  3JRF A;  1W0T A;  1JTY A;  2IU5 A;  3FIW A;  1APL C;  3HTH A;  3HTJ A;  3HB9 A;  2H1K A;  4FTH A;  3HOW J;  1HDD C;  2NX4 A;  2WV1 A;  4JP0 A;  5FLV A;  2WUI A;  2KT0 A;  9ANT A;  3Q0U A;  1MNM C;  2YS9 A;  4FIS A;  5M5X J;  5D19 A;  4M3E A;  3OSF A;  2HYJ A;  4EEF G;  2XPV A;  3QPS A;  3E7Q A;  2LVS A;  3PAS A;  5C4Y A;  3S16 J;  4UUS B;  3VUQ A;  3HGY A;  5GPA A;  3SJM A;  3SDG A;  5EGO B;  3GTP J;  4B4C A;  2JJ7 A;  4JYK A;  4XRS A;  3GTO J;  5D18 A;  2G7G A;  4MK6 A;  3G7R A;  3P9T A;  2LTP A;  3HTA A;  2Y30 A;  1IV6 A;  2ZOY A;  2JK3 A;  2WAQ N;  5EZH A;  1BA5 A;  2O9L A;  2OF7 A;  1S7E A;  5E3M A;  1B8I B;  2ID6 A;  2X48 A;  3ZQI A;  1FJL A;  2GFN A;  2D5V A;  2E2H J;  1JTX A; 
#chains in the Genus database with same CATH topology
 3H9J A;  3KIO A;  1PYV A;  1I1G A;  5DM7 F;  5K7Z A;  4ZYA A;  4AIJ A;  3OS1 A;  1EKE A;  1EV7 A;  4BQQ A;  5M3F J;  1QQI A;  1A6I A;  2PEX A;  5FGL A;  2LKP A;  5H20 A;  1OPC A;  2XSD C;  4KIG A;  3DPJ A;  3QU6 A;  5EGO A;  1REP C;  4IPA A;  4MGR A;  3S3N A;  3MQ0 A;  2DFE A;  3VOK A;  3IWF A;  1H89 C;  1ZAR A;  1JHF A;  3AG3 H;  3IV5 A;  1IGN A;  4LOC A;  4RGU A;  3HOS A;  3TED A;  2DXI A;  3CJD A;  2F5F A;  3VVZ A;  5LHI A;  4AU7 A;  4U0V A;  1VZ0 A;  3NEU A;  3TQN A;  1LQ1 A;  4BQA A;  3P9C A;  4XKB A;  3JR9 A;  4M74 A;  3FMQ A;  2XPU A;  3R6S A;  3TW6 A;  3M4O J;  2YVX A;  2M4G A;  4K2E A;  2XDN A;  5ICG A;  2JUC A;  3BJO A;  5F27 A;  1AU7 A;  1NK2 P;  1R36 A;  2EZL A;  1IXR C;  2WAE A;  3K4L A;  3QAH A;  4BJT A;  2NP5 A;  5FKK A;  1W7P B;  3KKC A;  3CTA A;  1BM9 A;  2WB1 N;  4RGX A;  3U2R A;  3DBH B;  2VIX A;  2LFB A;  4LK0 F;  3JRC A;  1YS7 A;  4ZYH A;  2H6C A;  2VB6 A;  4ZZL A;  4F52 A;  4HX8 A;  2MD0 A;  3KZY A;  2RQP A;  5JI6 A;  5A2Q K;  2EIM H;  3ZCO A;  3BR6 A;  4RB1 A;  2OC6 A;  1Q1V A;  4WF2 A;  2QEN A;  1QPI A;  1WJF A;  4M6Y A;  3FXK A;  1DPU A;  1ON2 A;  1RI7 A;  4BL0 B;  3JSJ A;  5IYB J;  1O3R A;  4RB3 C;  3ZN1 A;  3COL A;  3I53 A;  2V26 A;  3I58 A;  1S8N A;  4XLE A;  2LH9 A;  2R7D A;  1IUF A;  5M5W J;  2W4S A;  2ZJP F;  2R7Q A;  3G4S I;  1ONV A;  1RPW A;  3BOQ A;  4QPQ A;  4IZZ A;  2M2E A;  1W7P A;  3RPU A;  4Z6Y A;  3FWE A;  4L5E A;  5BQT A;  3HTS B;  1MH4 A;  2BW3 A;  1ETK A;  4KUM A;  5D6F A;  5L3C A;  1LUJ B;  3P5J A;  2XAG A;  4ICH A;  2JA2 A;  4BQN A;  1H9G A;  4XK4 A;  1JJ6 C;  4XKW A;  3W2W A;  2YX7 A;  2ZME A;  4UVB A;  2X6Y A;  2ZXW H;  2E60 A;  2B3W A;  3BR2 A;  4RM2 A;  2BZT A;  1JJ8 C;  2K9M A;  1Z3X A;  1VQ4 I;  1ETQ A;  4BE1 A;  3S2H J;  3HXL A;  2COB A;  1Y0N A;  2R5Z A;  1N77 A;  1KON A;  1IN7 A;  1N78 A;  1YIT I;  3DPL C;  1FP2 A;  2CU7 A;  1SD4 A;  4II3 A;  1EH7 A;  1MIJ A;  5DV5 A;  1U5T B;  5M5Y J;  4A3K J;  3H36 A;  1IN8 A;  3IKV A;  3KET A;  1XGO A;  3FXQ A;  3VPR A;  1UI5 A;  2G3B A;  2Z3Y A;  2M0C A;  2PMZ A;  2AXL A;  2D1V A;  4F3Q A;  4M3B A;  1J7K A;  3V8L A;  1UCR A;  2ZXI A;  3K2Z A;  4XLF A;  4AC6 A;  2XRL A;  4KIT B;  3Q5F A;  3T8R A;  3L1P A;  1U8R A;  1CF7 B;  1DGW Y;  3RCO A;  4LG0 A;  5JHF A;  4HKU A;  3BG9 A;  3GTM J;  3L9F A;  2RC4 A;  1WVR A;  4BGD A;  3WGG A;  4IEJ A;  4B3A A;  4J00 A;  1HSJ A;  1V5G A;  2X1C A;  3RQ4 A;  1MDM B;  5K1Y A;  3OYN A;  1VQ8 I;  1V54 H;  4S05 A;  2F5C A;  4KA4 A;  2PMU A;  1U5T A;  3ERM A;  2WAF A;  4IL6 C;  4RAF A;  4DW6 A;  1S72 I;  2DJI A;  3H5A A;  2Z9O A;  2BY3 A;  2ZME C;  4KN4 X;  4XRS G;  4G12 A;  1GHC A;  1CGP A;  2HEO A;  4JX4 A;  3HHH A;  2KRH A;  2VOD A;  2QZ8 A;  4YG2 F;  1WGX A;  4CYC A;  3EUH C;  1VQK I;  3HOY J;  3WU2 C;  3HKZ A;  3N05 A;  4DBQ A;  4ABZ A;  5D8K B;  4HF2 A;  2EBI A;  2VPR A;  4QTR A;  3LSP A;  3LAJ A;  1ZTR A;  3E1S A;  3JRG A;  2L2O A;  4I76 A;  2Z33 A;  3DF8 A;  2XGD A;  4KWA A;  5B3S H;  3N97 A;  4R1H A;  5HS9 A;  2BY2 A;  3I4P A;  3H35 A;  5A2Q Z;  5CPR B;  1DP7 P;  2QYO A;  3BTI A;  4Z2Y A;  2G7H A;  4XM3 A;  5F0C A;  5ED4 A;  2L7Z A;  1MMN A;  3SEZ A;  3F3X A;  2XAS A;  2YX4 A;  1B72 B;  3BP8 A;  4N9I A;  3DPT A;  2F5D A;  4JOM A;  1VQP I;  3DEW A;  2FNA A;  1R49 A;  4MXM A;  4WWC A;  3TOB A;  1B1B A;  1R4M B;  5E17 F;  1F4K A;  3A0H C;  4IHS A;  2LKS A;  1P9Q C;  4HQE A;  4KFC A;  2HWV A;  4CGR A;  2R5Y B;  3DQV C;  5FRM A;  2W57 A;  3G73 A;  3BJ6 A;  2NP3 A;  2FA5 A;  2OCE A;  3PNY A;  2XAF A;  2H8R A;  4FX4 A;  4NC6 A;  3DP7 A;  4II2 A;  1XC5 A;  2HXO A;  1R1V A;  3J80 K;  2ME6 A;  4U7D A;  4UHT A;  1MBF A;  3WG9 A;  1FNN A;  1ZRF A;  2PFV A;  2VC0 A;  1ZYR F;  3OYM A;  3CLQ A;  2Z99 A;  2VON A;  1P4A A;  1D0Y A;  2KQR A;  1FT9 A;  2W24 A;  4DIQ A;  2DJN A;  4OIQ F;  2JVH A;  4A3G J;  1T0F A;  3U9G A;  3IRR A;  5LD2 C;  4L9T A;  2ZCX A;  1X1B A;  5M3M J;  2PJR A;  1OCO H;  2DT6 A;  2H94 A;  3QQA A;  4IRG A;  3S5R A;  2UXP A;  2H27 A;  2A3S A;  1KQ0 A;  1LEA A;  2X9D A;  2XAU A;  1TLH B;  3OL4 A;  3LL7 A;  2IS1 A;  3ZN0 A;  3OOP A;  1UMQ A;  2R5Y A;  1E3H A;  1YJN I;  3VOE A;  2Y9Z A;  4C2T A;  1UG2 A;  1O3Q A;  2IGM A;  1W4M A;  1FBQ A;  2NNY A;  4BBR J;  3OYJ A;  5F0H A;  5AON A;  3E5U A;  2KZG A;  5CVV A;  1WI9 A;  3HPG A;  4MTD A;  4BEH B;  3QYE A;  4M9Z A;  1FZP B;  4H4K C;  3HTI A;  4L0Z B;  4GDF A;  2FQ4 A;  2TRT A;  4BY7 J;  1DU0 A;  1A31 A;  1ERD A;  1T38 A;  2CQ7 A;  1MJ9 A;  4EGY A;  1W1W E;  3CJT B;  3VYT B;  5F0F A;  2ME0 A;  3CES A;  5AIQ A;  5BOX A;  1RR8 C;  5FLX K;  4D7N A;  4HDV A;  2FBQ A;  1BJZ A;  1YOV B;  4HV6 A;  1OR7 A;  2Q2E B;  1YIO A;  2IGO A;  1W36 C;  1DU6 A;  3GEU A;  4AM3 A;  1T0F C;  4KIC A;  3QBM A;  3DTE A;  2HZT A;  4JX6 A;  1A35 A;  2VQC A;  3GUD A;  2LSO A;  3IP4 B;  1X3U A;  3WTV C;  1JUS A;  5B66 C;  1X3Z B;  2A05 A;  4P1W A;  2HDC A;  2M1B A;  3BTC A;  2CUF A;  4BEH A;  1F43 A;  1I50 J;  3KP4 A;  3F6O A;  2JZY A;  1SFU A;  4W97 A;  1XDS A;  3HRT A;  1X19 A;  2FJ1 A;  2XUB A;  3CDI A;  3QU3 A;  1HCR A;  3VVY A;  3OWT A;  4C2M J;  1KQ8 A;  3BT9 A;  4OIP F;  3P9K A;  1EA3 A;  3PO2 J;  5EEA A;  2MC3 A;  3FM3 A;  5DTD A;  1JGG A;  3D5S C;  1W7P D;  4UNO A;  3RPU D;  4NN1 A;  3ULQ B;  1IC8 A;  2H1L A;  1B4A A;  4JNN A;  3NRG A;  4QSH A;  4F7Z A;  3F21 A;  1WI3 A;  1DGR M;  1D5Y A;  3TO6 A;  4BKX A;  4OU0 A;  1KU2 A;  3FF5 A;  3O6B B;  4XKV A;  3BG5 A;  1UI6 A;  1P92 A;  2I5U A;  1FOK A;  4LGW A;  3VP5 A;  4XID A;  3ERE D;  4G94 A;  1OR7 C;  1SFE A;  2A68 F;  3I4N J;  4Y33 A;  4PK4 A;  5J6X A;  3I4M J;  3I5U A;  3GTJ J;  4XLP F;  3IL2 A;  3CC7 I;  2IW5 A;  5GAD J;  4RB2 C;  3O60 A;  2GA2 A;  1X1A A;  2ZFU A;  3JSP A;  3FDY A;  2GZW A;  5CW8 A;  5CVR A;  5CVJ A;  3D0S A;  2H8W A;  4PSX A;  2LF7 A;  3K1P A;  3NNR A;  2O8K A;  1QNT A;  4Y17 A;  3MCZ A;  2FU4 A;  4L62 A;  4G9Y A;  2MD5 A;  1MMD A;  2L9S A;  3J7Z I;  1FTT A;  5GAG J;  5C3E J;  4G7O F;  1HF0 A;  5J4Y A;  4EJU A;  4YEJ A;  4Q5S F;  1TWA J;  4M6V A;  3L09 A;  5H6R A;  5CXG A;  3VSL A;  5IYD J;  1TT0 A;  3Q0V A;  1DQU A;  2O7T A;  3T6N A;  1XCB A;  2I8D A;  1YW7 A;  2WY7 Q;  4HBL A;  3DLL F;  3RD3 A;  2EQR A;  2QOP A;  3GYH X;  2OZU A;  2MLG A;  2E2J J;  3JRH A;  5EEG A;  2VE9 A;  2DPU A;  4HF1 A;  2A61 A;  3BR1 A;  1W0T A;  1JTY A;  4BAY A;  5LGN A;  3CCU I;  4I09 A;  3FMS A;  5J8F A;  2O03 A;  2R7S A;  1H0M A;  3HB9 A;  2H1K A;  2ELH A;  2NX4 A;  2DOE A;  3IHU A;  3QPH A;  1FMV A;  3AG1 H;  2PG4 A;  1HW1 A;  3I59 B;  3Q0U A;  5B1A H;  5EJC A;  1MNM C;  2RNG A;  4FQG A;  5FLX Z;  5ILS A;  2XF6 A;  4D1Q A;  3LSI A;  2XPV A;  4YEL A;  3ZMD A;  5HLH A;  2ZJR F;  1B6A A;  4F91 B;  3I56 I;  3DEU A;  2L3D A;  3CCS I;  2ZSH B;  3I9V 2;  2PBI A;  2KMU A;  3CO6 C;  4OMZ A;  3SDG A;  3GTP J;  5D5V B;  5D18 A;  4XL9 A;  4MK6 A;  2QQ8 A;  4A0X A;  3AFH A;  4BJ5 C;  2V9K A;  2LTP A;  5B5E C;  2R7T A;  3HTA A;  2CG4 A;  2STW A;  3K1N A;  2P5K A;  2Y30 A;  1Z3Y A;  4XOP A;  3X2Q H;  2IP2 A;  2O9L A;  1MGT A;  1Y56 A;  1L3L A;  1NG7 A;  1UHM A;  2X48 A;  2YU3 A;  1FJL A;  3GFJ A;  3BZK A;  2CW8 A;  3V7R A;  4O5V A;  2R7V A;  1W0U A;  4D5F A;  4HNT A;  3LNQ A;  1OLT A;  4E7K A;  2DBB A;  3IKT A;  3QP5 A;  3EUK L;  3F22 A;  1BOB A;  5JR3 A;  2EA4 A;  5IOZ A;  2HDD A;  1MMG A;  1RUN A;  1X2N A;  2ELK A;  2H6B A;  5TJJ A;  1BIA A;  2LG4 A;  3D1N I;  1AHD P;  3BPV A;  3H3V K;  2X6W A;  2CUE A;  2Y0S A;  2DA4 A;  2ECB A;  1GT0 C;  1X1C A;  4Y15 A;  3RPQ A;  1VQL I;  5C44 J;  1ETY A;  2ZC2 A;  5DD8 A;  5HS7 A;  2A2F X;  1EJ9 A;  1BN5 A;  5H2F C;  5HVQ C;  5GAE J;  3BR0 A;  5ICE A;  3G1O A;  3PIO F;  4QIW N;  4FE4 A;  5EDN A;  1HLV A;  2UXN A;  4ZTJ A;  1FYM A;  1W5T A;  1W36 D;  1PJR A;  1K7A A;  4GFL A;  2DMP A;  2X6X A;  3GZI A;  1YX3 A;  1Z77 A;  3GWZ A;  1WJA A;  4HPQ A;  5J4V A;  1LFB A;  4M71 A;  1KYW A;  2XF5 A;  1XX5 A;  3HSF A;  3JW4 A;  5LGT A;  2IVM A;  2EFQ A;  5D4R A;  3ASO H;  2A6E F;  4NC8 A;  3HOX J;  3BJB A;  2G0E A;  3JRI A;  3O8H A;  5DS9 A;  2M0M A;  4C3H J;  4QPO A;  3OYL A;  1LB2 A;  3H3Z A;  4A12 A;  6PAX A;  3KEY A;  4XSZ F;  1S7A A;  4DVY P;  2X51 A;  4HF0 A;  1Y6I A;  3HUG B;  1MW7 A;  4BYY A;  3CQZ J;  4G7H F;  1R23 A;  5J8C A;  3I71 A;  3S3M A;  1WJE A;  4XLC A;  2EK5 A;  4ANJ A;  3LSG A;  3ONQ A;  2R7Z J;  4Q4Z F;  1R6R A;  1Z91 A;  3ON2 A;  1IAW A;  3ESW B;  3V8K A;  1VFC A;  2EZH A;  2XF7 A;  1PP8 F;  4LMY A;  2Y0S N;  2QBY B;  1R7J A;  1OYW A;  3V42 A;  4CSW A;  3JRD A;  4HNU A;  3L2C A;  3FBN B;  4XLA A;  2XHK A;  2A07 F;  2VI6 A;  1BR4 A;  2OD5 A;  2DDB A;  3BG7 A;  2L7F P;  3ZMZ A;  3CP8 A;  4A3L J;  5CQE A;  2R4G A;  2CRG A;  3CCV I;  4UY8 I;  4WXH A;  3RTR A;  1YG2 A;  3PM1 A;  4M73 A;  4S0H B;  2STT A;  4MO7 A;  2KDO A;  4GCV A;  1H88 C;  1J0R A;  3HUG A;  1W5S A;  2N8G A;  5K5O A;  4V19 K;  2LRE A;  1FY7 A;  4DYC A;  3K8P C;  3B02 A;  1KZH A;  3K70 C;  4IHX A;  3G1L A;  4JBA A;  2LY1 A;  3BRO A;  3ZXS A;  2W25 A;  1BR2 A;  4UUT A;  1IO2 A;  2DA6 A;  1SFK A;  1S5L C;  1I6X A;  4CDG A;  4Y4R A;  2K4B A;  4IQ4 A;  1MSE C;  3K7A J;  1JUM A;  3AG4 H;  1U2W A;  2C6Y A;  1O3S A;  2CH0 A;  3G2B A;  2OQR A;  2GAU A;  2WB1 A;  3OIQ A;  1TWC J;  4B43 A;  1UFM A;  1BI2 A;  1GXQ A;  1K6Y A;  2W48 A;  3UKG A;  2EV0 A;  5L3F A;  5KCM A;  2DYS H;  2F5V A;  4EM0 B;  2KKO A;  4MNU A;  5FJ8 J;  3JAM K;  3OYH A;  4XSX F;  1IRZ A;  3M8J A;  2ECC A;  2AS5 F;  3O3K A;  2MG4 A;  4KIB A;  1DPR A;  2GXG A;  2ZOZ A;  4E7J A;  3ECO A;  1IW7 F;  3TOA A;  2X0L A;  3WTZ A;  4PJN A;  1J59 A;  1SAN A;  1MBG A;  2FMY A;  2KIS A;  2GOX B;  5CVU A;  3B81 A;  1IDY A;  2HOE A;  2VOP A;  1XGM A;  1D8J A;  2DFI A;  2OZ6 A;  1Y1V J;  1J9I A;  3HTU A;  1USS A;  2L4A A;  4GO1 A;  3KE2 A;  4MIM A;  5E3O A;  4ENJ A;  3EUA A;  3HSE A;  4HOB A;  2Q8K A;  1JUP A;  3DPU A;  2JPB A;  2V9V A;  3VYS B;  2YSR A;  4NC7 A;  1TW3 A;  1XGS A;  4XBF A;  4OD4 A;  3OYF A;  1FYK A;  3GZN B;  2KZV A;  3BPX A;  4UXN A;  3G71 I;  3CCM I;  3CMY A;  4FCY A;  5FRN A;  2WWY A;  2OER A;  1FBU A;  3KYC B;  2WBM A;  4D0P A;  2X1D A;  1FP1 D;  3G56 A;  1YW9 A;  3D5R C;  1WJ5 A;  3TP0 A;  3A01 A;  3M3Y J;  1N25 A;  1R71 A;  2O61 A;  4GFK A;  2MH9 A;  3DCF A;  4KMF A;  1P6R A;  4HX4 A;  3SQN A;  2PZ9 A;  4EJT A;  4IJA A;  2RV8 A;  2DA7 A;  2W7N A;  2EPF A;  2BW3 B;  3QYF A;  2E1M C;  4M9S A;  2CMP A;  3CCY A;  4Q47 A;  3DV8 A;  5E79 C;  2VKE A;  3TL4 X;  4HA8 A;  2ZME B;  3NI7 A;  2IA0 A;  4IRI A;  2CQN A;  2QTQ A;  3DKW A;  2XRO A;  3VIB A;  3M8E A;  2CW7 A;  2R5Z B;  1FTZ A;  4BY1 J;  3W3C A;  1QHG A;  5D6E A;  1XMX A;  2PLY A;  1KU3 A;  2DFH A;  4AIK A;  2GXA A;  3HOV J;  4WK8 F;  1SD7 A;  1WJB A;  1U9O A;  1RUO A;  2KFD A;  1WFX A;  1P7I A;  4E7Z A;  2V1N A;  3OL3 A;  2ZJQ F;  2F48 A;  5AQC A;  2RHA A;  1HXD A;  1R5G A;  4HX7 A;  2QCO A;  1ACI A;  1PP7 U;  3FXU A;  2LY9 A;  3OYK A;  2VN2 A;  3WU1 B;  3KEQ A;  2VKH A;  3BRU A;  4PFO A;  1IXC A;  4IOA F;  3HC7 A;  4YRV A;  2ESH A;  1P4W A;  2KL4 A;  1LDD A;  2ZXH A;  4UB6 C;  5FRO A;  2KIF A;  1VQ7 I;  2L9V A;  4IHV A;  3HBL A;  5FGM A;  4LG0 B;  3OR2 C;  1G3S A;  1Y39 A;  1WSU A;  1KYZ A;  2DYR H;  5FLM J;  2QSH X;  2OI8 A;  5HLG A;  3AL0 B;  4V2G A;  1G3W A;  2JA7 J;  4XOR A;  3EUH A;  3R4K A;  4XN0 A;  3KPH A;  2QQA A;  3OIO A;  4PUS A;  1SFX A;  4C2U A;  3W2V A;  3RZD J;  1ETX A;  1MD0 A;  2VBZ A;  3KP3 A;  1R5H A;  2ELJ A;  2P8T A;  1S7O A;  3BG6 A;  4ZDL A;  4CGZ A;  2CW0 F;  1ZR4 A;  1LVA A;  4CYC B;  4A3I J;  4KIS A;  1T98 A;  3GEZ A;  3JAM Z;  2V6C A;  3HE0 A;  4HZF A;  1A04 A;  4CCJ A;  4HV5 A;  5D5W B;  3T5X A;  1K4T A;  2X85 A;  4C9Y A;  3JTG A;  3REO A;  1W5C C;  4JQF A;  4GCK A;  1XTA A;  4P96 A;  5LHG A;  3GTL J;  4E6K G;  4BAC A;  2CQX A;  2GIV A;  3OYD A;  2E34 A;  3CJQ B;  2NVT J;  4FHT A;  3PNV A;  4P55 A;  3C2G A;  2NVU B;  2Y75 A;  4ZYG A;  1BW6 A;  2W84 A;  2CQQ A;  3LAP A;  3NWT A;  2R7U A;  4M3F A;  2F07 A;  1OFC X;  2HVR A;  2JSP A;  4NBQ A;  1H8A C;  1U9N A;  3AKZ A;  1SD5 A;  2XB0 X;  4E7I A;  2M8E A;  3CP2 A;  2D45 A;  3M07 A;  1X1P A;  1K79 A;  5IP9 J;  3KNW A;  2DG8 A;  4OIR F;  3HPH A;  1ZGA A;  3U21 A;  4GCT A;  2L54 A;  3S3O A;  3LJL A;  3COA C;  1FIA A;  4LD5 A;  4BH9 A;  1OIS A;  2F4M B;  3GZ5 A;  3ZQ7 A;  3RZO J;  1VND A;  2PMH A;  3KEO A;  5FD6 A;  1ZLJ A;  4ACI A;  1H9T A;  3CCQ I;  1NHA A;  3I54 A;  3IH3 A;  5HDK A;  4IOC F;  1UB9 A;  4UUS A;  4QWQ A;  1JKR C;  2HOA A;  1HKS A;  5CYV A;  2HU9 A;  1JKO C;  1FOY A;  1OCC H;  1MBE A;  4RBO A;  1SVM A;  4HW0 A;  2HS5 A;  1SMY F;  1SAX A;  4W1U A;  1ZG5 A;  2OTL I;  1X3W B;  3OIP A;  4U88 A;  5BPD A;  2B9S A;  1AKH B;  2K85 A;  5EZG A;  3AL0 C;  4CA0 A;  3PQK A;  1V5E A;  1ZH5 A;  1I6H J;  2K9L A;  3EPZ A;  1XMA A;  3GCM A;  4DQ2 A;  5LFA A;  2PJR B;  3Q3S A;  2DFF A;  2ZFW A;  4DZJ A;  1YHQ I;  1ZLK A;  4XRM A;  1LFP A;  3FBI B;  3KZ9 A;  3L2U A;  2EFO A;  4YIF A;  3OYC A;  2DTR A;  1K83 J;  5DYM A;  2W00 A;  3F8M A;  5F1R A;  2W1O A;  1YRN B;  2EFW A;  3GME A;  4BUP A;  1PUF A;  2VT3 A;  3GFM A;  4YII A;  4PSW A;  2JA6 J;  2CYY A;  3MVP A;  2HYF A;  4KDP A;  1FC3 A;  4LB5 A;  3ANP A;  3FM5 A;  5BPI A;  2GXB A;  1I27 A;  1BL0 A;  3QKX A;  2LF8 A;  3ABM H;  3HOZ J;  3BTL A;  3DU6 A;  4HST A;  3E6D A;  4XMY A;  4I0B A;  2IAI A;  3ZQC A;  1DP3 A;  4B48 A;  4X1E A;  2GM4 A;  3RH2 A;  2JWT A;  3ZRG A;  1VQ5 I;  3VW0 A;  3L2R A;  4FE7 A;  5FKN A;  3F8B A;  1MNE A;  1IRF A;  2F6C A;  3F9K A;  3ZMT A;  1Z7L A;  3GBG A;  4WX9 A;  1ZR2 A;  2K02 A;  4M72 A;  5EG0 A;  1AKH A;  1YS6 A;  3CF2 A;  2HYG D;  4KIF A;  4A3B J;  4ZH4 F;  3M9A A;  3CDL A;  1B59 A;  1X4P A;  1I39 A;  1E3P A;  1J5Y A;  1POG A;  2JRM A;  3GTQ J;  3HRU A;  2DOD A;  1QRY A;  1UHW A;  2RAS A;  1XDU A;  3H9G A;  1YRN A;  2HKO A;  2ID3 A;  2P5V A;  1YJ9 I;  2XRN A;  3KZI C;  3M7G A;  5C4X J;  2FJI 1;  2Y2Z A;  5IP7 J;  2FSW A;  2Z2S B;  4GGG A;  2BYV E;  2F4I A;  2MGQ A;  1XB4 A;  3S8P A;  3ABT A;  3K1M A;  2OTJ I;  2B7E A;  2M3A A;  1BI0 A;  3CC4 I;  1SD6 A;  2O5R A;  2Y69 H;  3TDU C;  2ACJ A;  3R61 A;  3HOW J;  4AIH A;  4U0Y A;  3WTT C;  2P7C B;  3CC2 I;  5FLV A;  2OU2 A;  2QQB A;  2WUI A;  2DCE A;  3BY6 A;  2XC7 A;  5HNH A;  4FIS A;  5D19 A;  2MLK A;  4M3E A;  1I3A A;  2HYJ A;  3QPS A;  2HR3 A;  4B44 A;  5DEQ A;  2LNB A;  3A0B C;  5FB2 A;  5C4Y A;  3GLX A;  3LFK A;  3QOD A;  5D4S A;  3J7A Y;  3PSF A;  2KP6 A;  3KYD B;  4PZJ A;  2DK8 A;  1TZL A;  4LLL A;  3BZ6 A;  5J47 A;  1XMK A;  4JYK A;  4B4C A;  3GTO J;  3QYB A;  3AG2 H;  2PFB A;  1ZG3 A;  4L18 B;  3DTI A;  3FXO A;  3HRM A;  2V1U A;  4DGW B;  1IV6 A;  2ZKZ A;  1ULY A;  5E3M A;  3E0J B;  2QLZ A;  2PJP A;  3HRS A;  1LNW A;  1HA8 A;  4CCK A;  2GFN A;  2VJJ A;  5DCM A;  2EFP A;  2HKX A;  2QWW A;  2Z5U A;  3CCR I;  3H92 A;  2K40 A;  2XDV A;  2DLL A;  1T2K A;  1LKX A;  1YO5 C;  3VB2 A;  1OMI A;  2QM3 A;  3ML6 A;  5ERI A;  1AOY A;  5HDG A;  2CFO A;  1SEU A;  3BCG A;  4CZZ A;  1I5Z A;  3HEF A;  2W53 A;  4IHT A;  1YQA A;  2WY8 Q;  1WH5 A;  4N9H A;  4A3D J;  1Y0U A;  3BDD A;  3ZMS A;  3KX2 A;  4PCQ A;  5EYR A;  2RDP A;  3FIS A;  4EMS A;  3WG7 H;  2Z1D A;  1GDT A;  5DAJ A;  4MQ9 F;  5GTH C;  3ZOB A;  1B9N A;  1KU7 A;  1SC7 A;  3CO7 C;  4PJM A;  4BXU A;  3H9Q A;  4G7Z F;  4ENN A;  1RC9 A;  2A5W A;  2MBF A;  2DOF A;  1WCM J;  5TRD A;  2R93 J;  2ZJ2 A;  4H0E A;  2JVG A;  4BXF A;  1RNL A;  1F36 A;  1ETO A;  3GF2 A;  4O6J A;  3MKW B;  1QVU A;  1QZY A;  2MYS A;  2DI3 A;  5E1X A;  5L3E A;  1TNT A;  5J1U A;  3ELK A;  2VE8 A;  5ICC A;  3RKQ A;  2MH2 A;  2WV0 A;  5GPC A;  1AWC A;  4AVZ A;  4G6D A;  2UXX A;  3R0J A;  2GLO A;  4FET A;  3PIP F;  2GIZ A;  4BQO A;  1ORK A;  1YJW I;  3NRV A;  3KFW X;  2JPC A;  4CIC A;  3CCJ I;  3KKD A;  3W6J B;  5BNG A;  1R1U A;  1GV5 A;  2RVC A;  1MH3 A;  2DG7 A;  3JRE A;  4MEX F;  3ABL H;  3ISP A;  5LRS A;  3VTI A;  4ZDP A;  2Y0M A;  3GW2 A;  2FXA A;  4NQW B;  3WTW C;  1ETV A;  3G6E I;  4N4N B;  4RA2 A;  2DMU A;  2DTZ A;  1ZRC A;  2JQ7 A;  4LG3 A;  4A0Z A;  3WTU C;  3N4M A;  3K6G A;  2HOT A;  1XG1 A;  3S1N J;  1TNS A;  4WXD A;  1JKP C;  2BEO A;  3J81 K;  3DBL B;  1J75 A;  2IT0 A;  4RMN A;  1S29 A;  2XSJ C;  3ZGK A;  1ZQ3 P;  1D1A A;  1BC8 C;  5K7F A;  3PL8 A;  3ROU A;  5L3B A;  2VBW A;  1Y8Q B;  2OJE D;  1B9M A;  4KNY A;  4NB5 A;  1KU9 A;  3JSO A;  1WZ2 A;  3LWF A;  1XGN A;  2WTE A;  4N0B A;  2M34 A;  3BQZ A;  3FK6 A;  3VW1 A;  2NS0 A;  2IS4 A;  2EV6 A;  4PDK A;  2XKP A;  1LDJ A;  4MFD A;  2PI0 A;  5EFY A;  4NQW A;  5CXI A;  1R00 A;  2IA1 A;  1GVJ A;  1BBY A;  4XLN F;  4DZP A;  4A2U A;  1HKQ A;  1WPK A;  3FZV A;  4TV7 A;  3PQJ A;  2YUS A;  3WTS C;  2XKO A;  4A5N A;  2ZY9 A;  1V3F A;  2O7O A;  2ZO4 A;  1AA7 A;  2QSF X;  3MFK A;  1JHH A;  1GXP A;  2JA5 J;  3CUQ A;  2HI3 A;  2UZK A;  2CV1 A;  1E0E A;  1SMT A;  4ZC3 A;  2QKL B;  4A0Y A;  2E1N A;  3WU0 A;  5F08 A;  1G2H A;  2V57 A;  2CV0 A;  4Q48 A;  5HS8 A;  3WHB A;  3GXO A;  4M3D A;  1T56 A;  1JGS A;  2E1O A;  4A3C J;  1FLI A;  4UB8 C;  1UAA A;  2REK A;  3E5X A;  4YFN F;  3VWB A;  4MTE A;  3ZQG A;  1RES A;  3ZQQ A;  2HOS A;  3A2K A;  2FX0 A;  2TCT A;  4JX5 A;  4CYD A;  1UEL B;  4ON0 A;  3ZQF A;  4I02 A;  2XGC A;  2EWN A;  2M45 A;  1U3E M;  2IXS A;  3S1R J;  1EF4 A;  3TP3 A;  3FK7 A;  4XQF A;  3K4B A;  1T08 B;  1TQI A;  4DOZ A;  2ESN A;  5LEK A;  5TIS C;  3V7S A;  4BDZ A;  2QWT A;  1MKM A;  5IPA A;  2K9N A;  3E97 A;  2HGC A;  2HNH A;  1WKM A;  4UVC A;  4CO8 A;  5GP9 A;  2ZBK A;  1XD7 A;  2VKD A;  3TMO A;  2CWE A;  3F0C A;  1Z05 A;  2EIK H;  3I64 A;  2XV4 S;  3DU5 A;  2V1X A;  3ZP5 A;  2ZCN A;  3CUQ C;  1ENH A;  4UDS A;  3RKW A;  4AUX A;  2EIJ H;  3B6A A;  4C3J J;  1Z9C A;  2VOO A;  3U1K A;  4DYR A;  4OIO F;  1ZK8 A;  5JVT A;  2HFH A;  3WE2 A;  3FXM A;  3LFU A;  3WE3 A;  1CQT A;  4F55 A;  2L4M A;  4E7S A;  1EH6 A;  5IYC J;  3H0G J;  4HQM A;  2X1E A;  3FXL A;  4MLO A;  3NS4 A;  3DBR B;  3BTJ A;  3NAR A;  5IOY A;  2BXZ A;  3TGN A;  1Z6R A;  3GZ6 A;  5KNL A;  3BR3 A;  3OR1 C;  3MKZ A;  2CUZ A;  4IVN A;  3GX4 X;  4B09 A;  5LLQ A;  3U1D A;  5J1Y A;  1HST A;  1MJA A;  3W2A A;  1OKR A;  3J81 Z;  5B1B H;  2WAD A;  2M8G X;  2JT1 A;  5CLS A;  5IT9 K;  1BW5 A;  3K4M A;  3L7W A;  3FKI J;  3SZT A;  2NYX A;  2VKV A;  2QA4 I;  1ETW A;  3OYG A;  3NPI A;  2G7L A;  4R8H A;  5HLT A;  2MC4 A;  3CF5 F;  3WOD F;  2HKU A;  1U6G A;  4EQQ A;  4A3F J;  1KGS A;  2GEN A;  2ZCM A;  2WC2 A;  2R7R A;  5H6Q A;  1IRX A;  1TTY A;  2AO9 A;  3I55 I;  5GTI C;  2L7K A;  3BHQ A;  2O0Y A;  1P7J A;  1IG7 A;  4Y52 J;  4RAG A;  4IF4 A;  3EGQ A;  3L00 A;  4HAM A;  4JK1 X;  3RJP A;  3KZZ A;  3J7Y J;  2O8X A;  2MW8 A;  4RLF A;  5F64 A;  5KAI C;  4B8X A;  2VPL A;  2BBY A;  4PXI A;  1QA6 A;  2E1M B;  3MN2 A;  5GAH J;  1PDN C;  3Q0W A;  1L0O C;  4AWX B;  1QO0 D;  2G9W A;  3M1E A;  2RAE A;  2VT2 A;  2P5L C;  1XSD A;  3JCU C;  2LBF A;  3PSI A;  2PX9 A;  2R7O A;  1IZ1 A;  5AIP A;  4UUV A;  2Q0O A;  2FML A;  1FWZ A;  2Y9Y A;  4KMU X;  5E20 A;  2EIN H;  4GRI A;  3FXJ A;  1VQO I;  4GYG A;  3S1M J;  2PBX A;  1ZAO A;  4ESF A;  4MQV A;  2B1E A;  2WA0 A;  3KP7 A;  4FT8 A;  3CZ6 A;  3SYT A;  3S17 J;  1SVL A;  3CUO A;  1MMS A;  3L2Q A;  2HYT A;  1FX7 A;  3LA7 A;  3LSK A;  2E36 A;  3VDX A;  1C0W A;  4BNC A;  1P2F A;  1VTN C;  2HQR A;  2LMD A;  2DA5 A;  5FFX A;  2ICW G;  2F4O B;  2MFZ A;  4I98 B;  3VW2 A;  2KRF A;  4C2M A;  1WJC A;  2BXY A;  4Y7N J;  3A1Y A;  4BHC A;  3A01 B;  1E17 A;  3IC7 A;  4CCO A;  2RGV A;  1FSH A;  2EZK A;  4ZZD A;  1O3T A;  3FHZ A;  4NHJ A;  2E71 A;  2LP0 A;  3BCA A;  4L9J A;  3T1B A;  5DD4 A;  3WHC A;  1XCV A;  4BBS J;  1FMW A;  2M7A A;  4FAS D;  2ZSI B;  4KYW A;  3E6B A;  2DMQ A;  3F6V A;  3QWL A;  2VUM J;  2NOG A;  2UWM A;  1MMA A;  2FE3 A;  2OUM A;  3EDP A;  3LSH A;  2ZXJ A;  2AHQ A;  1E3O C;  4UV9 A;  3T0Y A;  3DKX A;  5FKL A;  2LLK A;  2P0W A;  1QZZ A;  4CUG A;  3E5Q A;  4LJZ F;  3GFL A;  3K2A A;  3S32 A;  4AC0 A;  4HNV A;  1K6O A;  3QRF F;  3MAJ A;  3MNL A;  4X6A J;  2YVH A;  3E6C C;  2F5E A;  2MAB A;  3NXC A;  1RET A;  3C3W A;  3F1B A;  3DEE A;  5FFZ A;  2FEZ A;  3EQL F;  1SGM A;  3NWS A;  1LE8 B;  4I01 A;  3RSN A;  2NRA C;  2Q1Z B;  4I6Z A;  4HRI A;  2CFX A;  1Q1H A;  4BU2 A;  4YFK F;  4B47 A;  4YZE A;  2EA2 A;  2HXI A;  2Q24 A;  4ME9 A;  1Z0X A;  5CKT A;  5IT9 Z;  1B8I A;  1VQN I;  2A5Y B;  3OSG A;  3OY9 A;  1SAU A;  2B0L A;  1I3Q J;  2GA1 A;  2O6G E;  2UXH A;  4AF5 A;  4IRH A;  3HG9 A;  3ANG A;  2KPM A;  4MEY F;  3CCL I;  3K69 A;  1TWH J;  2HVS A;  1FBS A;  3GO5 A;  1STZ A;  2GBY A;  1Z6T A;  1ZN2 A;  2G7S A;  1WWX A;  4IRV A;  3HHG A;  1IJW C;  3ABU A;  3HOU J;  3VSK A;  4DJA A;  5FKM A;  1WRJ A;  2FBI A;  4NNJ A;  3J7A O;  1VQ6 I;  3EYI A;  4CCL A;  1WHU A;  5IP6 A;  4PJ0 C;  3SWH A;  1K4S A;  3ON4 A;  2BVM A;  5F04 A;  3VEP A;  1LE8 A;  4ZDO A;  1IF1 A;  3HIF A;  4Y3O A;  1FEX A;  3IH4 A;  4HG2 A;  4NDL A;  3EUP A;  4L5I A;  3C07 A;  3TBI A;  2V6E A;  4X0G A;  3HGG A;  3AAF A;  5CJ9 A;  2WAQ A;  1ON1 A;  4BE0 A;  2OPT A;  1D1B A;  2AXT C;  1TP4 A;  3S15 J;  2FQ3 A;  3JRA A;  1U78 A;  2HTS A;  2BGC A;  4I0A A;  5E3L A;  3CME I;  4IQJ A;  1ITY A;  2DT7 B;  2HQA A;  5HSZ A;  2KHM A;  2ETH A;  3QP6 A;  2WGB A;  2K3F A;  3KP6 A;  1RKT A;  4M3G A;  2QIB A;  3WTX C;  2W82 A;  5LBQ A;  3H0D A;  2BHY A;  1YI2 I;  4P5O A;  2DMT A;  2M5W A;  4WXC A;  4S04 A;  2K86 A;  4RLQ A;  2E1C A;  3MZ8 A;  1UZC A;  1K78 B;  4FTH A;  3K10 A;  2EFN A;  1HDD C;  4OOI A;  2EB7 A;  2QVO A;  3PJR A;  4JP0 A;  2RQQ A;  1XSV A;  2YS9 A;  4A6E A;  5M5X J;  3OS0 A;  2MA3 A;  1LJ9 A;  2XAJ A;  1YW8 A;  3H3U A;  3PAS A;  2COM A;  2KIU A;  5LGU A;  2VQL A;  2FNP A;  3S16 J;  3P7N A;  4UUS B;  3VUQ A;  5CQG A;  1LPQ A;  5DUI A;  3FHN A;  5E1Z B;  3SJM A;  3I0T A;  1G8X A;  2E7W A;  4XRS A;  1YYV A;  4QLC U;  3VYR B;  2M7B A;  3P9T A;  4RB0 A;  2V1D A;  4XLH A;  4RM3 A;  3CJN A;  3K9T A;  2WAQ N;  3QPT A;  1YLF A;  3GFI A;  3K70 D;  5EZH A;  3KYL A;  1K78 A;  3F8N A;  1S7E A;  1BC7 C;  3O2P E;  1V55 H;  4ENM A;  2ID6 A;  3BLY A;  2RKH A;  3E6M A;  4DBR A;  2VC1 A;  2D5V A;  2BHZ A;  2W85 A;  1QPM A;  1JTX A;  1X1D A;  3BCB A;  5CVI A;  3K4J A;  3EYY A;  3OMY A;  1F5T A;  4XIC A;  3OS2 A;  1VF9 A;  1UHS A;  1FOW A;  2PN6 A;  1PUF B;  1A6Q A;  4OAZ A;  2DPD A;  2VBX A;  3MEX A;  2KJB A;  1R9T J;  2LDU A;  1XPX A;  3ZPL A;  5HNF A;  4BS9 A;  3CMA I;  2P6S A;  1MZB A;  2HQ5 A;  2RRE A;  3M1C A;  3OYI A;  3HZJ A;  1HKT A;  1UJ8 A;  1MJB A;  2VL8 A;  4PFP A;  3ZQH A;  4PJL A;  4KJZ A;  3MWM A;  3C2B A;  3HOT A;  1I1S A;  4WCG A;  2DN0 A;  4IO9 F;  2NAZ A;  1G4D A;  3VOX A;  5J40 A;  2DT5 A;  2K9S A;  5EG0 B;  4NEL A;  1TL8 A;  4AID A;  4OAY A;  1FPQ A;  2OQG A;  4GYI A;  4OD5 A;  2LY2 A;  3T8T A;  1O7L A;  1FIP A;  1CF7 A;  1S6L A;  3L2V A;  4KN7 X;  3F72 A;  5L3G A;  1HDP A;  2P4W A;  2IS2 A;  2KIQ A;  1D1C A;  2PMZ N;  3IAM 2;  3ZQL A;  1MDM A;  2LK2 A;  2DA3 A;  1HBX G;  2HPM A;  4HLY A;  2KIM A;  4AVP A;  2IJL A;  3O8G A;  2XGX A;  2DU9 A;  3CWR A;  3HYI A;  1TQP A;  4PGH A;  1LEB A;  5J1R A;  3PNT A;  3HIM A;  2K4J A;  3H1C A;  2DQR A;  4DYQ A;  2NS8 A;  2LC2 A;  2YPR A;  3EET A;  5LRR A;  3OYB A;  2UXO A;  2V79 A;  4BJ6 C;  5F1J A;  2JSC A;  2BVL A;  1U5T C;  3V7C A;  4ETS A;  1Z1D A;  2IPQ X;  3VVX A;  4C30 A;  3LQQ A;  2EH3 A;  2OV7 A;  1RKW A;  2KDZ A;  4RAY A;  2RN7 A;  4P9U A;  2K7L A;  3BJA A;  1X58 A;  3K0L A;  5D1R A;  2JN6 A;  4E7H A;  2LKX A;  3CCE I;  1MBK A;  4BXX J;  3SFI A;  1OJL A;  3WGH A;  5C4J J;  5ILV A;  2HZD A;  4D7M A;  5JHU A;  1U0J A;  5DDG A;  3HKZ N;  1S3J A;  3DWL E;  3LSM A;  2B63 J;  4RGS A;  2HDW A;  2LRD A;  4A69 C;  3C2H A;  1Z7U A;  4ASN A;  2RNJ A;  2QQ9 A;  4ZTF A;  2DA2 A;  2FF4 A;  3S93 A;  3SZP A;  3W6K B;  1ZGJ A;  1B72 A;  1U8B A;  5HDN A;  4CCM A;  1OCT C;  1X4O A;  2CO5 A;  3SFZ A;  4EVI A;  1WH7 A;  2OBP A;  1VQM I;  2E19 A;  5DCM B;  3TDZ C;  3HM5 A;  5KVR A;  1YFH A;  4J19 A;  4I7H A;  1BOA A;  5DUK A;  3PFY A;  2VJ5 A;  1OCR H;  4A93 J;  1IN5 A;  3A02 A;  1EH8 A;  2D6Y A;  2P81 A;  3DFG A;  1XN7 A;  1TWF J;  3LSJ A;  4EJV A;  2NXN B;  2L9R A;  1FOX A;  1NH3 A;  1LDK B;  2UXU A;  3WGI A;  1BIB A;  1GVD A;  3A03 A;  1GUU A;  4IXA A;  2CGP A;  1T8I A;  3GTG J;  3LHQ A;  2D1H A;  5LEJ A;  3D5L A;  1O7F A;  1RZ4 A;  2BY1 A;  3S1Q J;  1MBJ A;  3GTK J;  4U9N A;  4ZYD A;  2EZI A;  3ECH A;  3FMR A;  5K5R A;  4A3E J;  2FBK A;  2OCC H;  2R3S A;  2X6O A;  4R79 A;  3L2W A;  2V9P A;  2R92 J;  5E8G A;  4IKF A;  2A69 F;  1KQ9 A;  4YIR X;  3E7L A;  5L3D A;  4XNF A;  2P7V B;  5E3N A;  3E3V A;  3IUV A;  4IHY A;  5DCF A;  3TW7 A;  3F23 A;  1P4X A;  3AQS A;  4XR6 A;  2EIL H;  1D8K A;  1VI0 A;  1ZEL A;  2DDA A;  2E7X A;  3B6C A;  4M6X A;  3FRQ A;  1R5I D;  2ZNZ A;  4AYB A;  4CXF A;  4LIT A;  1A5J A;  2BE5 F;  2ISZ A;  1Y1W J;  3S2D J;  5JVG F;  1ZRD A;  3LST A;  4U9L A;  3BC8 A;  4XN3 A;  3TO7 A;  2VJ4 A;  1S9H A;  1T39 A;  3HL2 A;  2FRH A;  3PUB A;  4YFX F;  4LB6 B;  2DMN A;  3ABK H;  2E5Z A;  1Y8R B;  3MZH A;  5HBU A;  5E18 F;  4A3J J;  2ZCW A;  3A4C A;  4N4O B;  4EGZ A;  1V4R A;  2M87 A;  1WQ2 A;  4Y13 A;  3QPL A;  1R1T A;  3K4K A;  2F2E A;  2M30 A;  4L5J A;  2IBD A;  4OWR B;  3MD2 A;  4CZC A;  4O3M A;  2IS6 A;  4E70 A;  3IH2 A;  5FHP A;  2VQG A;  2K27 A;  2V4J C;  3NQO A;  4U0W A;  4A6D A;  2IA2 A;  4D5C A;  2NS7 A;  2XIG A;  1YIJ I;  1OQY A;  2Q2E A;  4UVA A;  5E1W A;  3V8J A;  5FD5 A;  4P9F A;  2VAS A;  4HSR A;  5HLI A;  1YE9 A;  3S2W A;  4LK1 F;  3ZR8 X;  4FX0 A;  4RAZ A;  4L9V A;  4E4H A;  4EV0 A;  1IRG A;  2CUJ A;  4IHW A;  4ESB A;  2K9Q A;  2J5O A;  2XGE A;  4F93 B;  2E5N A;  2JUG A;  4U87 A;  3QOP A;  1QBJ A;  1VQ9 I;  1HW2 A;  3PUF A;  3KCC A;  3GLL A;  2JRT A;  2R7W A;  3MZY A;  4C3I J;  3TKY A;  1O4X A;  1IDZ A;  2R0Q C;  5EEH A;  2YU9 J;  3J80 Z;  4U7B A;  4IX7 A;  1NG6 A;  2OA4 A;  2YVE A;  3FKJ A;  1JXS A;  1OCP A;  5FMP A;  3BWG A;  4AYB N;  1FYL A;  2PQ8 A;  4G6Q A;  1ZGW A;  2CS3 A;  4AD9 A;  1HQC A;  1UST A;  4XKC A;  3V4G A;  2J5P A;  2Y48 A;  4EAT A;  5KAF C;  2QGU A;  2L0K A;  3K4N A;  5ILU A;  1GLN A;  3HSR A;  5F6F A;  5JLX A;  2LYC A;  1BI1 A;  3LMM A;  1IV8 A;  5H9T A;  3CUQ B;  4CHU A;  1OYI A;  2XB5 A;  3QOE A;  2TDX A;  2P6T A;  1TBX A;  3FXR A;  4GFB A;  1WJD A;  2LD5 A;  3RKY A;  4XRF A;  2GUH A;  4HLX A;  3IRQ A;  1JKQ C;  1HC8 A;  4JKZ A;  4BDY A;  3V6G A;  3PPB A;  1QGP A;  1JE8 A;  1OYY A;  3HDD A;  2CSO A;  5HOD A;  2UXI A;  5J3L A;  3Q9V A;  2EJR A;  2VBY A;  2QF7 A;  4ZJZ A;  2QEX I;  4EJO A;  3K4C A;  3C7J A;  2ZB9 A;  3LQR A;  3AQT A;  3TO9 A;  4B1R A;  2VLA A;  2IEK A;  1GV2 A;  1E2X A;  2XPW A;  3DXJ F;  2OAZ A;  4MFE A;  3BNI A;  3SEQ A;  1X2M A;  4WIB A;  2R7F A;  2I10 A;  3LWJ A;  4HDU A;  1DDN A;  1Z67 A;  3RI4 A;  2O3F A;  4D9J A;  4OMY A;  3VYU B;  3S14 J;  2L01 A;  2XAH A;  1N75 A;  1MBH A;  2HQN A;  4EJW A;  4ESJ A;  2H09 A;  3CLO A;  3FX3 A;  2A6T A;  3H5N A;  4ZYE A;  2JTV A;  2VQH A;  3CJR B;  2DO7 A;  3W6V A;  2M4K A;  5D5U B;  1F9N A;  3BG3 A;  1TQM A;  2DOA A;  3SZG A;  4XOT A;  3RIR A;  1MND A;  3M8F A;  3OYE A;  2QSG X;  3CMM A;  3PFI A;  1HW5 A;  4ENK A;  4JL3 A;  3BZC A;  1R4N B;  1Z21 A;  3CDH A;  3RQI A;  4V2F A;  3OV8 A;  4LIV A;  3CD6 I;  3KP2 A;  3RKX A;  3NAU A;  4BHB A;  1LFU P;  1T95 A;  4HEA 2;  3SXY A;  5IT3 A;  1JT0 A;  3MKL A;  5DM6 F;  4L0Y B;  3VFZ A;  3DTK A;  4A3M J;  1HOM A;  1J2X A;  2FOW A;  3LA3 A;  3IWZ A;  2FOK A;  4M9X A;  2AQE A;  4OIN F;  1T6S A;  2MSY A;  2DK5 A;  1D5V A;  2KJC A;  2Z16 A;  4LFU A;  3SDB A;  3I59 A;  1V5F A;  2KRC A;  3KP5 A;  1R22 A;  4RDU A;  3JRB A;  2UV1 A;  5K5Q A;  2A6H F;  2IRF G;  1TWG J;  5JFR A;  1DUX C;  2BY0 A;  2QKM B;  3DKY A;  5IY5 H;  2NVY J;  1D0Z A;  3UNG C;  1QZE A;  4GCL A;  1FSE A;  1ZG1 A;  1O57 A;  3IUO A;  4LLG F;  4I2O A;  2AQF A;  2R7X A;  5JLW A;  1J09 A;  3WTY C;  4J01 A;  3BQY A;  1XS9 A;  3R0A A;  5EF6 A;  3LSR A;  2JMW A;  2E35 A;  2DQL A;  3MMY B;  2GOM A;  2M9H A;  2L5Q A;  4HYE A;  1SFO J;  3H5R A;  1G3Y A;  2JA8 J;  3C1D A;  2X4H A;  2EV5 A;  1BR1 A;  1K61 A;  5LHH A;  2BOL A;  3RYR A;  1BI3 A;  2GQQ A;  1PVE A;  3B73 A;  1G6N A;  1OCZ H;  4UV8 A;  1IN6 A;  3OOU A;  1NK3 P;  2QUF A;  4BHP A;  3UR3 C;  1ZKG A;  3Q9S A;  5HOO A;  2XVC A;  3G1M A;  2K5C A;  1IUY A;  4KT6 A;  3CRJ A;  4MHG A;  1RIO H;  5FKO A;  1D3Y A;  2LBF B;  1MSF C;  1JI8 A;  2VJI A;  1YTY A;  2VXD A;  2NVX J;  2GWR A;  1IXS B;  1UG0 A;  4BE2 A;  3ZMU A;  2CQK A;  4DNC A;  2L9N A;  2NVQ J;  1RR7 A;  3VOD A;  1G59 A;  2CV2 A;  4G6T B;  1LVK A;  2FD5 A;  4CH7 A;  3IAS 2;  1SVO A;  3KLN A;  3PO3 J;  1QVT A;  2LOO A;  5K58 A;  3V78 A;  3KLO A;  3OYA A;  2FUG 2;  5K7H A;  2HTJ A;  2ADU A;  4L9N A;  2DA1 A;  1T33 A;  3LOC A;  1QHH D;  4XON A;  3R60 A;  4CCN A;  1YX5 A;  4GXO A;  3RDI A;  4A5M A;  2K3P A;  3F8F A;  2Y31 A;  1ODD A;  2NOJ B;  2IGK A;  4F92 B;  2IGN A;  2L7M P;  2LR8 A;  1NTC A;  2HPI A;  5ICF A;  2QKO A;  1ZRE A;  3F8C A;  4EM2 A;  1TC3 C;  2XAQ A;  3BR5 A;  4LLN A;  1RRJ A;  1JT6 A;  2CJJ A;  1QU3 A;  1IN4 A;  5HAW A;  1TT5 B;  3GVA A;  2E2I J;  4ITV A;  3JRF A;  1R58 A;  2HVQ A;  2L02 A;  2UUZ A;  2YR2 A;  2IU5 A;  3FIW A;  1APL C;  3HTH A;  2NNN A;  3HTJ A;  1M1E B;  4RS8 A;  4PGG A;  3I3L A;  2VXZ A;  3DLA A;  2ZNY A;  3C18 A;  1A36 A;  2WV1 A;  5KHD A;  1TW2 A;  2KT0 A;  1F1Z A;  1KA8 A;  1XSX A;  5TGT A;  9ANT A;  2KLO A;  5BMZ A;  1G3T A;  5D8L B;  3OSF A;  4EEF G;  1D0X A;  4I99 C;  5E8I A;  2LVS A;  3E7Q A;  5KK1 A;  3JTH A;  4PJJ A;  2DAO A;  5BS6 A;  3G3Z A;  1BJA A;  3P9I A;  2QBY A;  4B3X A;  3HGY A;  5GPA A;  3ASN H;  5FO5 A;  5EGO B;  2BV6 A;  2G7U A;  2JJ7 A;  4G8X A;  3LA2 A;  2G7G A;  4NUB A;  2V7F A;  3G7R A;  4RGR A;  4LIU A;  3HJE A;  4E7L A;  5D5X B;  4EM1 A;  1PUE E;  3RYP A;  2ZOY A;  2JK3 A;  3SHF A;  2DW4 A;  3MKY B;  1BA5 A;  2OF7 A;  1B8I B;  2ISY A;  1ZHF A;  4KT5 C;  3ZQI A;  3ZMV A;  2E2H J;  2FBH A;  2D2W A; 
#chains in the Genus database with same CATH homology
 1W0U A;  4D5F A;  3LNQ A;  4XIC A;  2K40 A;  5K7Z A;  1VF9 A;  1UHS A;  1PUF B;  5IOZ A;  2HDD A;  1R9T J;  5M3F J;  3BCG A;  1A6I A;  2W53 A;  1X2N A;  2ELK A;  3HEF A;  3D1N I;  5FGL A;  2HQ5 A;  1AHD P;  3H3V K;  1WH5 A;  2XSD C;  4A3D J;  2CUE A;  3DPJ A;  2DA4 A;  2ECB A;  5EGO A;  1GT0 C;  3ZQH A;  5C44 J;  3VOK A;  5EYR A;  1ETY A;  1H89 C;  3FIS A;  3IV5 A;  3C2B A;  1IGN A;  4LOC A;  3TED A;  3BR0 A;  1HLV A;  3G1O A;  3ZOB A;  2DN0 A;  4FE4 A;  4QIW N;  5EDN A;  1GDT A;  3CJD A;  3VVZ A;  3VOX A;  5EG0 B;  2K9S A;  4NEL A;  3JR9 A;  4GFL A;  2XPU A;  1FIP A;  2DMP A;  1WCM J;  3TW6 A;  3M4O J;  2R93 J;  2XDN A;  3GZI A;  1HDP A;  5F27 A;  1AU7 A;  1NK2 P;  2PMZ N;  1Z77 A;  1F36 A;  3ZQL A;  2EZL A;  1ETO A;  2LK2 A;  1LFB A;  2DA3 A;  2NP5 A;  1QVU A;  5FKK A;  3KKC A;  5J1U A;  3O8G A;  2WB1 N;  3HOX J;  3BJB A;  3CWR A;  2G0E A;  3JRI A;  3HIM A;  2LFB A;  3O8H A;  5J1R A;  5DS9 A;  3JRC A;  3RKQ A;  4C3H J;  5GPC A;  4DYQ A;  2NS8 A;  2UXO A;  2GLO A;  1ORK A;  5F1J A;  3BR6 A;  3CQZ J;  3KKD A;  3VVX A;  1Q1V A;  1QPI A;  5BNG A;  1GV5 A;  1MH3 A;  2EH3 A;  3JSJ A;  2DG7 A;  3LSG A;  5IYB J;  3JRE A;  2R7Z J;  1RKW A;  2KDZ A;  3ON2 A;  3COL A;  1IUF A;  5M5W J;  1ETV A;  1X58 A;  2EZH A;  1VFC A;  5D1R A;  2JN6 A;  2DMU A;  2Y0S N;  2DTZ A;  2LKX A;  1RPW A;  2HOT A;  1XG1 A;  1MBK A;  3JRD A;  3S1N J;  1JKP C;  4BXX J;  3SFI A;  1OJL A;  2M2E A;  5C4J J;  4D7M A;  3HKZ N;  2VI6 A;  2B63 J;  1ZQ3 P;  4L5E A;  2L7F P;  4A69 C;  1MH4 A;  1ETK A;  4A3L J;  5K7F A;  4ICH A;  2CRG A;  2DA2 A;  1B72 A;  4XK4 A;  1JJ6 C;  1U8B A;  1OCT C;  3PM1 A;  4S0H B;  4MO7 A;  1WH7 A;  3BR2 A;  1H88 C;  2E19 A;  2M34 A;  1JJ8 C;  3BQZ A;  3FK6 A;  2N8G A;  1ETQ A;  3HM5 A;  3S2H J;  3VW1 A;  2COB A;  4J19 A;  4DYC A;  2R5Z A;  2CU7 A;  4A93 J;  4IHX A;  3G1L A;  3A02 A;  4MFD A;  5M5Y J;  2D6Y A;  2P81 A;  4A3K J;  5EFY A;  5CXI A;  1TWF J;  3LSJ A;  1UI5 A;  2L9R A;  3VPR A;  2G3B A;  4DZP A;  4UUT A;  2UXU A;  2DA6 A;  1WPK A;  2M0C A;  1MSE C;  1GVD A;  1JUM A;  2YUS A;  3A03 A;  3K7A J;  1GUU A;  4M3B A;  2O7O A;  3GTG J;  3LHQ A;  2JA5 J;  2HI3 A;  3S1Q J;  1MBJ A;  3GTK J;  4AC6 A;  1TWC J;  2EZI A;  1G2H A;  2XRL A;  5F08 A;  3UKG A;  2W48 A;  4A3E J;  2V57 A;  2X6O A;  3L1P A;  2R92 J;  4HKU A;  3WHB A;  4M3D A;  5FJ8 J;  1T56 A;  4A3C J;  2E1O A;  1IRZ A;  3BG9 A;  3GTM J;  2REK A;  2ECC A;  3E7L A;  3ZQG A;  2MG4 A;  1RES A;  5E3N A;  2HOS A;  4IEJ A;  4B3A A;  3IUV A;  2FX0 A;  2TCT A;  4JX5 A;  2ZOZ A;  4IHY A;  3TW7 A;  3ZQF A;  2XGC A;  4DW6 A;  5DAJ A;  1SAN A;  3AQS A;  1MBG A;  3S1R J;  1VI0 A;  1EF4 A;  3TP3 A;  3B6C A;  4G12 A;  3FK7 A;  4XRS G;  3FRQ A;  3B81 A;  1IDY A;  4JX4 A;  1A5J A;  1Y1W J;  3S2D J;  1Y1V J;  1WGX A;  4CYC A;  5E3O A;  4MIM A;  2QWT A;  5IPA A;  2K9N A;  2DMN A;  5HBU A;  3HOY J;  4A3J J;  1JUP A;  5GP9 A;  3QPL A;  4ABZ A;  2IBD A;  2EBI A;  2VPR A;  4QTR A;  3LSP A;  3F0C A;  4FCY A;  1ZTR A;  3CMY A;  3JRG A;  5FHP A;  3IH2 A;  2OER A;  4I76 A;  2XGD A;  4KWA A;  4D5C A;  3G56 A;  2ZCN A;  3M3Y J;  3A01 A;  2NS7 A;  1ENH A;  3TP0 A;  4UDS A;  4AUX A;  4GFK A;  3B6A A;  3DCF A;  4C3J J;  4DYR A;  1ZK8 A;  2PZ9 A;  3BTI A;  1CQT A;  5F0C A;  2DA7 A;  2L7Z A;  5IYC J;  3CCY A;  1B72 B;  3H0G J;  2VKE A;  4IHW A;  4MLO A;  3BTJ A;  3DEW A;  3NAR A;  2K9Q A;  5IOY A;  2XGE A;  3NI7 A;  4MXM A;  3BR3 A;  2QTQ A;  3VIB A;  5J1Y A;  1IDZ A;  4C3I J;  2R5Z B;  1O4X A;  2R0Q C;  4BY1 J;  1FTZ A;  2YU9 J;  2M8G X;  4CGR A;  2YVE A;  2R5Y B;  1OCP A;  1BW5 A;  3HOV J;  4AYB N;  5FMP A;  3FKI J;  1U9O A;  2VKV A;  2NP3 A;  1ETW A;  3NPI A;  1P7I A;  1ZGW A;  2H8R A;  2G7L A;  5AQC A;  2RHA A;  2HKU A;  2L0K A;  1XC5 A;  4A3F J;  2HXO A;  2GEN A;  2ZCM A;  2QCO A;  2ME6 A;  2AO9 A;  1MBF A;  5JLX A;  2LY9 A;  3BRU A;  5H9T A;  3BHQ A;  1P7J A;  1IG7 A;  4Y52 J;  2XB5 A;  3EGQ A;  2DJN A;  4GFB A;  4A3G J;  2LD5 A;  2MW8 A;  2GUH A;  4IHV A;  2ZCX A;  3HBL A;  4PXI A;  5M3M J;  1JKQ C;  4JKZ A;  3MN2 A;  5FLM J;  3V6G A;  2OI8 A;  3Q0W A;  3QQA A;  3PPB A;  4V2G A;  3S5R A;  3HDD A;  2JA7 J;  2UXP A;  5HOD A;  2RAE A;  2X9D A;  2UXI A;  5J3L A;  2QF7 A;  3OIO A;  1UMQ A;  2R5Y A;  3RZD J;  1ETX A;  2ZB9 A;  3AQT A;  4B1R A;  2Y9Y A;  2IEK A;  1GV2 A;  1UG2 A;  2XPW A;  4MFE A;  2Y9Z A;  3BNI A;  3S1M J;  2PBX A;  1X2M A;  4BBR J;  3LWJ A;  2I10 A;  1ZR4 A;  4CYC B;  4A3I J;  3S17 J;  5F0H A;  3S14 J;  3HE0 A;  2HYT A;  1MBH A;  3HTI A;  2FQ4 A;  2TRT A;  4BY7 J;  1DU0 A;  2DA5 A;  3W6V A;  3VW2 A;  3BG3 A;  4GCK A;  3GTL J;  5F0F A;  2ME0 A;  4Y7N J;  4JL3 A;  2CQX A;  3A01 B;  2NVT J;  4D7N A;  2EZK A;  3RQI A;  2FBQ A;  4V2F A;  1BJZ A;  1DU6 A;  1BW6 A;  3GEU A;  2CQQ A;  2LP0 A;  3WHC A;  3NAU A;  4M3F A;  4BBS J;  1LFU P;  2F07 A;  3QBM A;  1OFC X;  1JT0 A;  3MKL A;  4JX6 A;  1H8A C;  1U9N A;  1HOM A;  4A3M J;  2DMQ A;  2VUM J;  2NOG A;  2XB0 X;  2MSY A;  1JUS A;  5IP9 J;  3KNW A;  2DG8 A;  2AHQ A;  3JRB A;  1E3O C;  4RDU A;  4GCT A;  3BTC A;  5FKL A;  2CUF A;  3LJL A;  2LLK A;  1F43 A;  1I50 J;  1TWG J;  3K2A A;  1FIA A;  4AC0 A;  4HNV A;  4W97 A;  3MNL A;  4X6A J;  3RZO J;  2YVH A;  1VND A;  2FJ1 A;  2NVY J;  4ACI A;  4GCL A;  3NXC A;  1RET A;  3IH3 A;  1HCR A;  3VVY A;  3F1B A;  4UUS A;  4C2M J;  5JLW A;  3BT9 A;  1JKR C;  3BQY A;  2HOA A;  1SGM A;  1XS9 A;  1JKO C;  3LSR A;  5EF6 A;  5EEA A;  2JMW A;  1MBE A;  4RBO A;  1LE8 B;  3PO2 J;  5DTD A;  1JGG A;  4I6Z A;  2M9H A;  4W1U A;  4NN1 A;  1IC8 A;  4JNN A;  3NRG A;  1SFO J;  4QSH A;  2JA8 J;  1WI3 A;  4YZE A;  1D5Y A;  2HXI A;  1AKH B;  2Q24 A;  4ME9 A;  4BKX A;  5EZG A;  1K61 A;  1Z0X A;  1UI6 A;  3BG5 A;  1B8I A;  1I6H J;  3VP5 A;  3OSG A;  4XID A;  1I3Q J;  3Q3S A;  4DZJ A;  3OOU A;  1NK3 P;  2UXH A;  4XRM A;  4AF5 A;  3KZ9 A;  3I4N J;  3ANG A;  3I4M J;  1K83 J;  1TWH J;  1ZKG A;  1YRN B;  3G1M A;  3CRJ A;  3GTJ J;  2GBY A;  5FKO A;  1PUF A;  3O60 A;  2G7S A;  1MSF C;  2JA6 J;  3MVP A;  1IJW C;  3HOU J;  3ANP A;  5FKM A;  5CW8 A;  3QKX A;  1BL0 A;  2NVX J;  5IP6 A;  3HOZ J;  3BTL A;  3NNR A;  3ON4 A;  2O8K A;  5F04 A;  2IAI A;  3ZQC A;  2NVQ J;  1LE8 A;  1RR7 A;  4X1E A;  2GM4 A;  3RH2 A;  2JWT A;  4L62 A;  2FD5 A;  1FEX A;  3VW0 A;  3IH4 A;  4FE7 A;  5FKN A;  4NDL A;  3PO3 J;  3EUP A;  1QVT A;  1FTT A;  5C3E J;  3GBG A;  3C07 A;  5K58 A;  1ZR2 A;  1HF0 A;  3V78 A;  5K7H A;  5EG0 A;  3HGG A;  1AKH A;  2DA1 A;  1T33 A;  1TWA J;  3LOC A;  2OPT A;  4M6V A;  5CXG A;  3S15 J;  5IYD J;  4A3B J;  2Y31 A;  3Q0V A;  3JRA A;  1U78 A;  3CDL A;  5E3L A;  1NTC A;  2L7M P;  2LR8 A;  1ITY A;  2O7T A;  1POG A;  3T6N A;  5HSZ A;  3GTQ J;  2QKO A;  2WGB A;  3RD3 A;  1QRY A;  1TC3 C;  2EQR A;  2RAS A;  1YRN A;  1RKT A;  3BR5 A;  4M3G A;  2QIB A;  2ID3 A;  1JT6 A;  2CJJ A;  2E2J J;  2QOP A;  5C4X J;  3JRH A;  2Y2Z A;  5IP7 J;  5HAW A;  2DMT A;  2MGQ A;  2E2I J;  3BR1 A;  3JRF A;  1W0T A;  1JTY A;  2IU5 A;  3FIW A;  1APL C;  3HTH A;  3HTJ A;  3HB9 A;  2H1K A;  4FTH A;  3HOW J;  1HDD C;  2NX4 A;  2WV1 A;  4JP0 A;  5FLV A;  2WUI A;  2KT0 A;  9ANT A;  3Q0U A;  1MNM C;  2YS9 A;  4FIS A;  5M5X J;  5D19 A;  4M3E A;  3OSF A;  2HYJ A;  4EEF G;  2XPV A;  3QPS A;  3E7Q A;  2LVS A;  3PAS A;  5C4Y A;  3S16 J;  4UUS B;  3VUQ A;  3HGY A;  5GPA A;  3SJM A;  3SDG A;  5EGO B;  3GTP J;  4B4C A;  2JJ7 A;  4JYK A;  4XRS A;  3GTO J;  5D18 A;  2G7G A;  4MK6 A;  3G7R A;  3P9T A;  2LTP A;  3HTA A;  2Y30 A;  1IV6 A;  2ZOY A;  2JK3 A;  2WAQ N;  5EZH A;  1BA5 A;  2O9L A;  2OF7 A;  1S7E A;  5E3M A;  1B8I B;  2ID6 A;  2X48 A;  3ZQI A;  1FJL A;  2GFN A;  2D5V A;  2E2H J;  1JTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...