3BQZA

Crystal structure of the complex of malachite green bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
total genus 77
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bqzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bqzA02
3I4NJ 4NDLA 3GTJJ 3C2BA 1WGXA 2DA3A 2FD5A 1IG7A 3RH2A 2L0KA 1B72B 2DMUA 2ZOZA 2RHAA 3ZQHA 4FE7A 2DN0A 2AO9A 1UI5A 3BTJA 1CQTA 3M4OJ 3P9TA 1AHDP 1IUFA 3VIBA 3CCYA 2ZCMA 4DYCA 3CDLA 1YRNB 1ETQA 5E3LA 1K61A 2REKA 2R5YB 3HOZJ 2YVHA 1ITYA 5IP9J 2DJNA 1B8IA 3HEFA 2JA6J 3G56A 3HOWJ 5FHPA 3AQTA 4IHWA 3ZQIA 2CU7A 2M0CA 3HOUJ 5EGOB 5HSZA 2LR8A 4AC6A 3ZOBA 2QIBA 1JT0A 1Q1VA 2MSYA 3V78A 4JX6A 3IH3A 1OCTC 2E19A 2Y31A 1P7IA 2PZ9A 4MFDA 2QOPA 1ETXA 4PXIA 2LD5A 1BA5A 3EGQA 9ANTA 2G7SA 1B8IB 1UMQA 1IJWC 4A3GJ 3K2AA 3JRFA 2DA1A 2DMQA 3CQZJ 3BR5A 3DEWA 5F04A 5DS9A 1T56A 2XRLA 3JRIA 4UDSA 2NVXJ 3VOKA 1HF0A 1LFBA 3LOCA 2XPUA 4BBRJ 4B1RA 3HTHA 5IYBJ 3KKDA 2HDDA 3NRGA 1JTYA 2ZCNA 2ELKA 4I76A 1XS9A 3B81A 5EFYA 2O7TA 2GLOA 5EG0B 3OSFA 2UXIA 2LVSA 5C4YA 3C07A 2EZLA 2X9DA 4L5EA 3O60A 4XIDA 1HCRA 4M6VA 3S1RJ 2XSDC 1TWCJ 4S0HB 1K83J 1SGMA 2MW8A 3CWRA 2OERA 1ZK8A 2WB1N 5EEAA 1BL0A 4ACIA 3PO3J 2PMZN 3ZQGA 3HB9A 4A3CJ 4DW6A 2KDZA 4A69C 3V6GA 4AF5A 2JMWA 1F43A 2R5ZA 2UXPA 4CGRA 1FTTA 1H88C 2CQXA 5M3MJ 1NTCA 3NXCA 4ICHA 2JWTA 2HI3A 3SJMA 2NVTJ 1IDZA 2HKUA 3KKCA 2DMNA 3HTJA 4LOCA 1SANA 3QPSA 4DZJA 4DYQA 1VNDA 1HDDC 2HOSA 2CJJA 2GENA 1JJ6C 1RPWA 2Y2ZA 3GTKJ 1XG1A 1QRYA 5K7FA 1SFOJ 4JL3A 4M3GA 5F08A 4FTHA 4JNNA 4L62A 3BRUA 3LJLA 2TCTA 3VPRA 3A02A 3T6NA 3BHQA 2JJ7A 1MBKA 4D5FA 4YZEA 5FMPA 2M34A 2XGCA 4C3HJ 1QPIA 4A3BJ 1MBHA 3LWJA 3S14J 2OI8A 4UUTA 4RBOA 1LE8B 4GCTA 2X6OA 3JRHA 2RASA 2DA4A 4RDUA 3FK7A 5M5YJ 2YVEA 2ZCXA 3S16J 3HBLA 2UXOA 4MLOA 4EEFG 3LSRA 1TWHJ 1DU0A 1GV5A 2G0EA 5FGLA 1U78A 2M2EA 1QVUA 3VOXA 2K40A 2GFNA 2Y0SN 5J1RA 1U8BA 2O9LA 1ORKA 5HBUA 3OSGA 2O8KA 5K7HA 1YRNA 3RZDJ 3BR0A 3JREA 3DCFA 3FK6A 1ETWA 2R5YA 1TWAJ 2F07A 2GM4A 4A3KJ 5K7ZA 5IP6A 1ZGWA 1OFCX 2KT0A 5IPAA 2LP0A 4IHVA 3WHCA 1MH3A 2N8GA 3HOYJ 1Y1VJ 5EGOA 3TP0A 3ZQLA 5FKLA 3E7LA 3G1MA 3K7AJ 2JA5J 5D19A 2ME0A 1ETOA 2CRGA 5F0FA 5D18A 5J1UA 2K9SA 1NK3P 3FKIJ 5M5WJ 2MG4A 1JGGA 5C44J 3S17J 1O4XA 5EZHA 5EF6A 4XRSA 3FRQA 2I10A 5EG0A 3S1QJ 1JT6A 5IP7J 1POGA 3G1OA 1UHSA 1H89C 1E3OC 2YU9J 3HOVJ 4BXXJ 1MNMC 4DZPA 2WV1A 4M3EA 3TEDA 4X6AJ 2DG7A 1IC8A 2CUEA 4UUSB 2DG8A 1DU6A 3G7RA 4JKZA 2E2IJ 2OF7A 3PM1A 2WAQN 1JUSA 1IGNA 5DAJA 4MXMA 3GTPJ 5IYDJ 5FLMJ 3PO2J 3O8HA 3JR9A 3GZIA 4NELA 5EDNA 1I6HJ 4DYRA 5IYCJ 3BJBA 3NI7A 1WH5A 2XGDA 4JX4A 3NAUA 1FEXA 3LSGA 2YUSA 4G12A 2XPWA 2QF7A 3KZ9A 5JLXA 4A3JJ 5HODA 1RR7A 5FLVA 3LHQA 1W0UA 2HOTA 2EZHA 4A3MJ 2NS8A 2CQQA 5M3FJ 2NP5A 5IOYA 2COBA 4W97A 3GTQJ 2OPTA 1WH7A 3DPJA 3VW1A 4MIMA 1FIAA 1F36A 3VVXA 3TP3A 1ENHA 2LLKA 4FCYA 1PUFB 3BCGA 3HTIA 1NK2P 2H1KA 2LK2A 5F27A 1X2NA 2WGBA 2L7MP 3JSJA 2DA2A 2W48A 2M9HA 1MBJA 2FJ1A 1UG2A 2MGQA 2YS9A 3QQAA 4JX5A 4V2GA 4J19A 1LE8A 2GBYA 3JRGA 4BKXA 3MKLA 5IOZA 2ID3A 5D1RA 2HYJA 5EZGA 3A01B 4A93J 3MNLA 3Q0UA 3S1NJ 2IEKA 3IUVA 1MH4A 3JRCA 2R93J 4A3IJ 1S7EA 2NOGA 4Y52J 2VUMJ 3TW7A 2L7ZA 1WPKA 3MN2A 3TW6A 2JA8J 1G2HA 4MO7A 4HNVA 5HAWA 3Q0WA 3HOXJ 2PBXA 3GTGJ 1QVTA 4HKUA 3HE0A 3CMYA 3BTIA 1RESA 4GCLA 3HM5A 3OOUA 3RQIA 4BY7J 2RAEA 3BR1A 4FISA 3BG3A 4D5CA 4XRMA 2EBIA 1ZKGA 3SDGA 2EH3A 4B4CA 4Y7NJ 4JP0A 2EZKA 5E3NA 2UXUA 2TRTA 1AKHA 5FKMA 3S15J 2ID6A 2IAIA 4XK4A 3BTLA 2O7OA 4CYCB 1JKOC 5CW8A 1GV2A 4IHXA 1X2MA 2K9NA 2XB0X 2Y9YA 3BG9A 2QTQA 5J3LA 2DA6A 4QSHA 3ZQCA 1OJLA 5C3EJ 2DMPA 3RKQA 2G7GA 3F1BA 1FIPA 1AKHB 1ZQ3P 2P81A 4IEJA 1LFUP 4BBSJ 3S2DJ 1BJZA 5CXGA 1JKQC 3HGYA 3VW0A 2ZB9A 2D6YA 3IH4A 3JRBA 3W6VA 1ZR4A 3COLA 3CJDA 1MBEA 3S2HJ 3QPLA 2XPVA 2NVYJ 3FISA 2AHQA 2Q24A 2M8GX 2D5VA 3GTMJ 3LNQA 3ANPA 4JYKA 3O8GA 1OCPA 1TWFJ 4QTRA 1VFCA 2WUIA 1HOMA 2VPRA 3HKZN 1Z0XA 1U9NA 1Z77A 1ZR2A 4M3DA 2Y30A 3HGGA 2LTPA 2L7FP 1GT0C 2NX4A 4AC0A 5J1YA 1IV6A 1APLC 4ABZA 3F0CA 1ETVA 5M5XJ 1GVDA 1W0TA 4D7MA 2K9QA 3BR6A 4C3JJ 4A3FJ 1I3QJ 4UUSA 3Q3SA 2NS7A 2DTZA 3HDDA 1ETKA 1VF9A 1UI6A 2G7LA 1JUPA 2H8RA 1A6IA 2FQ4A 4AYBN 2FX0A 5EYRA 5JLWA 2Y9ZA 2GUHA 2HXOA 3I4MJ 5GPAA 2DA7A 2JN6A 1R9TJ 2E2JJ 3IH2A 5FKOA 3GTLJ 3BTCA 3B6CA 4M3BA 2FBQA 4NN1A 2ECCA 2HXIA 2DA5A 1HLVA 3GBGA 3UKGA 1BW6A 3GTOJ 4ME9A 1JUMA 1ETYA 3MVPA 3NNRA 1T33A 2JK3A 1U9OA 3SFIA 1EF4A 4M3FA 2NVQJ 1ZTRA 3LSJA 3A03A 3Q0VA 4AUXA 1BW5A 3VVYA 5F0HA 5F0CA 2DMTA 1GDTA 2XDNA 3S5RA 3IV5A 3NARA 2IU5A 3JRDA 2XB5A 1IDYA 3QBMA 3BNIA 1I50J 2NP3A 1PUFA 3WHBA 5F1JA 4B3AA 3LSPA 3PASA 3FIWA 1JKPC 1RKWA 3CRJA 3M3YJ 5FKKA 3H3VK 2LFBA 2G3BA 1X58A 2CUFA 5DTDA 2VKVA 4GCKA 2LKXA 4BY1J 3VVZA 3BT9A 2VKEA 3RD3A 5H9TA 3A01A 4V2FA 4A3EJ 2HOAA 5FJ8J 2W53A 2R0QC 3KNWA 4C3IJ 1JTXA 3NPIA 1D5YA 4QIWN 3BR2A 4D7NA 3BR3A 3HIMA 5E3MA 5CXIA 3QKXA 3AQSA 4A3DJ 2B63J 4XICA 1MSFC 3BQYA 3ZQFA 2ZOYA 1Y1WJ 5FKNA 2VI6A 2QCOA 5GP9A 2L9RA 2LY9A 5GPCA 1GUUA 3B6AA 3VW2A 4GFBA 3VP5A 4A3LJ 5C4XJ 1VI0A 5AQCA 3JRAA 5BNGA 2EZIA 1H8AC 2ECBA 2X48A 3ON4A 2ME6A 2R5ZB 1IRZA 3S1MJ 2E2HJ 1AU7A 2HQ5A 1WI3A 4CYCA 4IHYA 3BQZA 4XRSG 1RETA 1FTZA 2V57A 2JA7J 3ON2A 1RKTA 2HYTA 3PPBA 1TWGJ 3VUQA 3BG5A 2XGEA 1JKRC 2R7ZJ 4MK6A 4MFEA 3D1NI 4C2MJ 5K58A 3H0GJ 3GEUA 4I6ZA 4W1UA 4FE4A 2E1OA 3G1LA 1A5JA 2UXHA 1JJ8C 1XC5A 3ANGA 4X1EA 2QWTA 1HDPA 4GFKA 3OIOA 1MBFA 4GFLA 1FJLA 2EQRA 3E7QA 5C4JJ 1TC3C 3EUPA 3HTAA 2QKOA 1B72A 3L1PA 1WCMJ 3RZOJ 2IBDA 5E3OA 4KWAA 2R92J 1MSEC 1MBGA 1P7JA
chains in the Genus database with same CATH superfamily
4ASNA 1KYWA 3CUQB 3OYNA 1IG7A 2V1DA 2DU9A 3RH2A 2ZOZA 2EFWA 2VOPA 2YVXA 3KP6A 3KEQA 1RI7A 1Y6IA 2FOWA 1VTNC 3M9AA 3GLXA 4RGXA 5DUKA 2ACJA 4DYCA 2ZCMA 1QNTA 3CDLA 3F72A 1YRNB 3J7ZI 3TBIA 2NYXA 1K61A 5GADJ 4EJUA 3TDUC 3WTSC 2R5YB 1EJ9A 1VQNI 3HEFA 2JA6J 2LOOA 1ZH5A 5FHPA 5HOOA 1J9IA 3DPUA 4D1QA 4OINF 5HSZA 3DFGA 1T8IA 2PN6A 4QPQA 4AC6A 1JT0A 5FO5A 4BGDA 1LVKA 2NXNB 2XVCA 4JX6A 2PZ9A 4MFDA 2I5UA 3DBRB 1BA5A 4JK1X 4AIDA 1I39A 1BR2A 1XGOA 3HPHA 4A3GJ 1OISA 2AXLA 3GFMA 1A35A 5FRNA 2DA1A 3UNGC 3BR5A 1SVMA 5F04A 1F5TA 2NVXJ 5B5EC 1HF0A 3IRQA 1LFBA 3LOCA 2KIFA 3HTHA 4CYDA 3NRGA 1VQ5I 2BXYA 2PJRA 1R1TA 2ELKA 1Q1HA 4ANJA 4IHSA 4HRIA 3FMSA 3HHGA 1S7OA 3SDBA 1XSXA 2CS3A 3D5LA 1HW5A 2RN7A 1REPC 3CC4I 1HCRA 3ZMZA 1TWCJ 1K83J 2MYSA 1JGSA 2MW8A 1ZK8A 2KJCA 2WB1N 3KZIC 1BL0A 1VQKI 5DV5A 4ACIA 3PO3J 2I8DA 2PMZN 3HB9A 4ZYAA 4DW6A 2O5RA 4UB6C 4NHJA 1F43A 4EM0B 3J7AO 4ZH4F 2Z99A 3KP4A 2CQXA 1R36A 5D8KB 3NXCA 4ICHA 2EV6A 2XF5A 3ZN1A 3JW4A 1XMAA 3CD6I 2WY7Q 4ZDOA 1K6YA 4TV7A 5CVJA 2Y2ZA 4H0EA 1XG1A 2KIMA 5HLTA 1SFOJ 4M3GA 3QPTA 3OYDA 4F52A 5D6FA 2M4KA 4B47A 3BRUA 3PUFA 2TCTA 3I0TA 1ERDA 2DFIA 4ENJA 3LJLA 5F1RA 3T6NA 1NG7A 2JTVA 1IXRC 2IS1A 4PGGA 2DQRA 3RI4A 2RNJA 1QPIA 4A3BJ 3BROA 3D5RC 2E5ZA 2F4MB 2LRDA 1W7PD 1YE9A 4XKCA 4G7HF 3K8PC 2WB1A 1NH3A 4GCTA 5H6RA 2X6OA 3TOBA 2DA4A 2QSHX 2COMA 2KRHA 3CMAI 1USTA 4PJMA 2P6TA 2OD5A 5M5YJ 2YVEA 2ZCXA 3S16J 4BACA 2HWVA 3HBLA 3ML6A 4ENKA 3OIQA 4MLOA 4EEFG 1A6QA 2EV5A 3M1EA 3LSRA 3RPQA 2G0EA 1RIOH 4G6QA 3K4LA 2QBYA 2M2EA 1QVUA 1G59A 1OYYA 2NOJB 2QUFA 3K69A 3SEQA 2O9LA 1ORKA 2LKPA 2DT7B 2O8KA 4I98B 1W5TA 3DBLB 4HX7A 3FK6A 1TWAJ 1IN6A 4KJZA 2MA3A 4LFUA 4IX7A 2GM4A 3S3MA 4RMNA 1U5TA 3LFKA 2ZY9A 1X4OA 1DGRM 1LFPA 1Y1VJ 4RAYA 5EGOA 3TP0A 4KA4A 4RB2C 5E17F 3ASOH 5FKLA 3LWFA 3G1MA 4F3QA 2ME0A 2LNBA 3TO9A 3TOAA 2ZMEA 1HW1A 2OZ6A 3VYRB 1OR7A 4ESBA 5F0FA 4HLYA 4XKWA 5J1UA 2ESNA 2K3PA 1UB9A 3PNVA 3ESWB 3GWZA 3ROUA 2F5DA 2P7VB 5EF6A 2ZBKA 3I9V2 1T08B 2B3WA 2I10A 1E3HA 5EG0A 3SZTA 1JT6A 3VSKA 3JAMZ 4DZPA 2W1OA 2PEXA 3SZGA 3TEDA 3BOQA 3JTHA 3WU2C 2VPLA 3IRRA 3ELKA 4UUSB 3RSNA 2FBIA 4P5OA 1DU6A 4JKZA 1BC7C 2LMDA 3ECOA 3E3VA 1QZZA 2JPCA 2OF7A 1JUSA 2WAQN 3PM1A 1IGNA 5IYDJ 3HUGA 3GZIA 3K4JA 2VASA 4DYRA 5IYCJ 4HPQA 2OCEA 2CV0A 3BJBA 2KLOA 1WH5A 3ZMUA 4F93B 5E18F 1PDNC 4PJJA 2V9PA 4EM1A 5D8LB 2QF7A 2VQLA 4G12A 1R4MB 2XAQA 3HRTA 3F8CA 2JUGA 1RR7A 2XAHA 3I59A 5FLVA 1FY7A 1E0EA 3EPZA 2EZHA 1WJCA 3CLOA 5ICCA 5HDNA 2HOTA 2NS8A 2CQQA 1TW2A 5KNLA 4D0PA 1MZBA 1WH7A 3DPJA 1FIAA 1F36A 1USSA 3VVXA 2RVCA 2O3FA 1BC8C 2KPMA 2LLKA 4LG0B 3HTIA 2VT3A 3DWLE 1FBQA 4M72A 1ON1A 3ERED 1CGPA 2WGBA 4KMFA 1G3TA 1N77A 2M9HA 1D0XA 1UG2A 3QQAA 5K5QA 1MDMA 1XGSA 3IUOA 3FX3A 1AOYA 1MMGA 2ID3A 4UVBA 5EZGA 4HDVA 1A31A 3Q0UA 3S1NJ 1KONA 1MH4A 3V8LA 3WGGA 4U0YA 4IF4A 1H0MA 1JI8A 4RB1A 1SVOA 4E7KA 2X1DA 4O5VA 3TW7A 4XOPA 3TW6A 4RA2A 3DU5A 4EJOA 4MO7A 1HXDA 4HNVA 3ZMDA 3FHNA 4BNCA 3NQOA 2PBXA 2E71A 4WXHA 4KMUX 5H20A 3CO7C 3KX2A 3IKVA 4M9XA 3BTIA 2ZXWH 2A05A 3FF5A 4BY7J 3BR1A 4FISA 2EK5A 1D1AA 3BG3A 4BJ6C 2HTSA 3W3CA 1B59A 3HSRA 1P2FA 1ZKGA 2EB7A 3QU6A 3LA3A 2TRTA 1AKHA 1XSDA 5FKMA 5LEJA 3KYLA 1ZLKA 2UUZA 3CESA 4IXAA 2XKPA 4IO9F 1XX5A 4HV5A 4IHXA 1R71A 2K4JA 2OAZA 2FQ3A 3I4PA 2EFQA 2QTQA 2DI3A 5HDKA 3IWFA 4QSHA 1FLIA 3K1NA 5DM6F 2ELJA 1OJLA 2DMPA 1IRFA 2CW8A 4BUPA 2E1MC 2Y48A 2P81A 3OYHA 4AU7A 1LFUP 3S2DJ 1DPRA 3AG3H 4CCKA 3VW0A 1SVLA 4FX0A 4A5MA 3QPLA 3ABMH 3FISA 4CO8A 2Q24A 1TW3A 4N4OB 4JYKA 3O8GA 3KIOA 4UHTA 1HOMA 3LAPA 1LQ1A 4OIPF 3GUDA 3HKZN 1GT0C 2R7SA 4CHUA 3HGGA 1SD5A 1IV6A 2A6HF 5DEQA 2VC1A 2D1HA 4AIHA 4D7MA 2K9QA 3B02A 4C3JJ 1X1DA 1V5GA 2QKLB 3V8JA 2A3SA 2X1EA 5ILUA 1R7JA 3GEZA 1HQCA 4ESJA 2TDXA 5E8GA 2H8RA 2FX0A 3F23A 2HZDA 3E0JB 1D3YA 4XBFA 3K4CA 4I99C 5LGNA 4KFCA 2NS0A 2UXNA 2E2JJ 1P92A 5FKOA 3CJRB 5L3BA 5LGUA 2PFBA 1JHFA 4BDZA 4OMZA 1XPXA 2DA5A 1FT9A 3GBGA 1SFKA 3UKGA 4PDKA 5E1ZB 3KEOA 3MVPA 5EEHA 1U9OA 4M3FA 3F8NA 4FETA 2NVQJ 3BC8A 1XB4A 5LD2C 2W82A 1V55H 3HKZA 5F0HA 2Z33A 1KU7A 3IL2A 5D4SA 2DMTA 1GDTA 1QPMA 3S5RA 2DT5A 1OLTA 2OCCH 2LG4A 3JTGA 3BNIA 1I50J 2NP3A 3I64A 2CMPA 2W4SA 1YJWI 3M3YJ 3H5AA 5FKKA 3E6CC 2QM3A 3FXQA 2A61A 3CP2A 2A2FX 4GCKA 1OCRH 1QBJA 4LMYA 3GYHX 1VQ9I 3BT9A 1WJEA 2PJRB 3AL0B 3OYLA 1XTAA 1Z6TA 4ZC3A 5FJ8J 1BI3A 2RQPA 2R0QC 2O6GE 1JTXA 1YW9A 3NPIA 2XKOA 4U0VA 3HIMA 2GZWA 2QVOA 4A6EA 5D6EA 3GFLA 1Z67A 2DJIA 4ENNA 3M7GA 2L3DA 3DQVC 5B1AH 5HLHA 4XICA 3KFWX 2B63J 2QSGX 4II2A 3ZQFA 3E1SA 3BY6A 2CW0F 3C2HA 3WU1B 1Y1WJ 2OTJI 2VI6A 5GP9A 2L9RA 4DVYP 4HLXA 5H2FC 3HTSB 1AWCA 3B6AA 4GFBA 1TT5B 2HS5A 4PFOA 3VP5A 4A3LJ 3JRAA 2G9WA 2EZIA 1H8AC 2ECBA 2X48A 5ICGA 1MKMA 4QLCU 3F21A 5IT9Z 5CPRB 2E2HJ 1AU7A 4E7ZA 2CUZA 4XRSG 4YFNF 2PG4A 3K1MA 4F92B 5GAHJ 2IGOA 3H36A 4EATA 2HYTA 3VUQA 2DTRA 1JKRC 4MK6A 1YHQI 4XR6A 1OYIA 4C2MJ 4HNTA 4WF2A 4W1UA 4I6ZA 2E1OA 1A5JA 1N75A 2DW4A 2LREA 2Y69H 3BDDA 1Y39A 4ETSA 3ANGA 3OV8A 3MWMA 4HG2A 3J81K 2D2WA 4GFKA 4FHTA 3OIOA 1OKRA 2R7DA 3D0SA 2Y0MA 2VBWA 3ZCOA 3CCUI 2YPRA 1MMAA 1Z05A 3QODA 2EWNA 1VQPI 1LEAA 2FEZA 2IBDA 1P6RA 3W2WA 4NNJA 4YRVA 2E1NA 3DLLF 3GTJJ 3C2BA 3DTIA 3TMOA 1WGXA 2DA3A 2A5YB 2FD5A 3CCVI 1B72B 2DMUA 3FM3A 4LIUA 3ZQHA 3E5UA 3FXRA 2AO9A 4MEYF 2B1EA 2R3SA 1CQTA 1LB2A 4XM3A 2QBYB 2R7XA 2M1BA 3H35A 4XRFA 2AQFA 3OYBA 2WAEA 3CCYA 3LSTA 3LHQA 1J0RA 4IOCF 1Y8RB 2GXBA 1UG0A 3P5JA 1OCZH 3RQ4A 5E3LA 2CYYA 2RDPA 4XN0A 3HOZJ 2YVHA 3BJOA 2DJNA 3GLLA 4C30A 1N78A 2FUG2 1U5TB 2Y75A 4BHPA 3AQTA 2FMYA 3ZQIA 2M0CA 5ICEA 5EGOB 4UXNA 2LR8A 2QIBA 2O0YA 4KIFA 2MSYA 3V78A 3IH3A 1Z21A 2E19A 1P4XA 4LGWA 2LD5A 3F8BA 5FLXK 3OYIA 2G7SA 1B8IB 2MC4A 1X1PA 2ZMEB 3CC2I 4AWXB 2F48A 2G7UA 2WAFA 4IQ4A 5FB2A 4KT5C 2CV2A 1KQ0A 1UFMA 2K7LA 2RNGA 2XPUA 3FBNB 3EQLF 4B1RA 3FXKA 3KKDA 2HDDA 2RKHA 2OA4A 4IVNA 1SD7A 1B1BA 2FU4A 2ZJ2A 4A6DA 4EGZA 4I76A 3V7RA 2VQHA 5CVUA 3PQJA 5EG0B 4LIVA 4MEXF 1P9QC 1ZRFA 2LVSA 1BBYA 3AAFA 1AA7A 3C07A 1UHMA 3CUQC 5JHFA 4XLHA 2ICWG 3MKZA 1C0WA 1JXSA 2X0LA 4XIDA 4M6VA 2A6TA 3ABTA 3S1RJ 5KAIC 3VYSB 2XSDC 1DP7P 4M73A 1XDUA 2XSJC 2ZNYA 3M8FA 4DBQA 3G4SI 2ETHA 2OERA 5EEAA 3LFUA 4UV9A 2HQNA 3ZQGA 2KDZA 2HOEA 2VOOA 3HUGB 2MH2A 1D1CA 2R5ZA 4CGRA 4KUMA 4F55A 1XD7A 2F5FA 1TQPA 2IS6A 2K27A 2JSPA 3U9GA 3DKYA 1QO0D 3WE3A 3A4CA 1IDZA 4A0ZA 3FZVA 2DMNA 2EFPA 3J7YJ 2HOSA 1SANA 3QPSA 3ZRGA 1ONVA 1VNDA 4DZJA 4XORA 3I59B 4ZZDA 1HDDC 2FF4A 3U2RA 1RPWA 2QQ8A 3H1CA 3K70C 1FP2A 2CFXA 4FTHA 1FOKA 2XF6A 1J75A 2KMUA 2HDCA 4JNNA 4BE0A 3K70D 1SD4A 1HA8A 2EA4A 4D5FA 1MBKA 5FMPA 1ZAOA 4ENMA 2D45A 2XGCA 3IAS2 4Q4ZF 3QYFA 1YX5A 3S14J 2OI8A 1L0OC 1Z3XA 1MDMB 2PI0A 3CCMI 2FBHA 1YIJI 1GXPA 3MKYB 1WRJA 1KZHA 3ECHA 1G6NA 4I09A 1TWHJ 3Q9SA 4RAZA 3OYCA 1IN7A 1GV5A 5D5WB 4AVZA 4FX4A 2IPQX 3VOXA 2DFHA 1U8BA 2CG4A 2BW3A 3ZN0A 4EM2A 3CCEI 4N9HA 1JHHA 2FJI1 1WKMA 3RZDJ 2LF7A 2CUJA 3MMYB 3DCFA 2V6EA 2F07A 4OWRB 3H9GA 4XL9A 4P55A 3LL7A 2R4GA 5IPAA 3RJPA 4IHVA 2KKOA 3V7SA 3WHCA 1MH3A 3FWEA 2N8GA 3G73A 4S04A 4A12A 4Q5SF 3S8PA 1Y0NA 4AM3A 4HOBA 3T1BA 4NBQA 5FFZA 1BM9A 2YSRA 4HSRA 4I0BA 2KL4A 3ZXSA 2XV4S 3MZ8A 3LSIA 2CRGA 5LHHA 2DYRH 2DAOA 2QQ9A 3I71A 1NK3P 3FXUA 2AQEA 1DGWY 4GYGA 3I53A 1TL8A 4U7BA 1JGGA 3EUKL 5C44J 2XGXA 2M87A 4WIBA 4NQWA 4UV8A 2L5QA 3A0BC 3L2QA 3OY9A 4IJAA 4CCLA 2UZKA 1B6AA 3FRQA 2ESHA 2DPUA 3S1QJ 5IP7J 1POGA 3G1OA 1E3OC 2KIQA 5J8CA 2BOLA 2OJED 2W00A 1BI1A 2F2EA 4PJ0C 3LSMA 3E97A 1MNMC 3MD2A 4Y33A 5CVIA 2H94A 3OOPA 3BJ6A 4OIRF 3B73A 4C2MA 1MMNA 3CF5F 1YTYA 5JI6A 3EDPA 1A36A 2E2IJ 3FXLA 3ASNH 2LSOA 1O7LA 3GMEA 3W6JB 3JR9A 2EIKH 1MW7A 3AFHA 1VQ8I 2GXAA 2X4HA 1Z9CA 2K85A 3P7NA 5CVRA 1TQIA 1YG2A 2XAUA 4GCVA 3GZNB 5LHIA 5E20A 3R0AA 4BXFA 1P4AA 2XASA 5JLXA 4RGUA 3E5XA 3RKYA 3C18A 4YFKF 5M3FJ 3ZQQA 2COBA 4W97A 3GTQJ 4DBRA 4AYBA 1KU3A 3WG7H 3VW1A 4MIMA 2DDBA 2HKOA 3TP3A 3OYMA 2HQAA 3BCGA 3L09A 4KDPA 5F27A 4WWCA 1X2NA 5DYMA 2XC7A 2XHKA 1YW7A 4LJZF 2VQCA 4CGZA 4NUBA 3JSJA 1QHGA 2CSOA 4JX5A 2YS9A 3ZQ7A 4ZZLA 2HVQA 1KQ9A 3D5SC 3R0JA 3JRGA 5L3CA 4BDYA 1HKQA 4A93J 3MNLA 3IUVA 2E7WA 2IEKA 4A3IJ 3OS1A 4HDUA 1PVEA 4EJWA 2ISZA 4Y52J 2VUMJ 3MN2A 2HGCA 5HAWA 4DIQA 1OCCH 4BAYA 4RLFA 2FNPA 1F4KA 4HKUA 3HE0A 2VBYA 2KFDA 3HM5A 3VFZA 1LDKB 4D5CA 4XRMA 3T5XA 1F9NA 2IT0A 2PLYA 2IJLA 1T2KA 1L3LA 2UXUA 1X1AA 4MTDA 2ID6A 2M5WA 5KVRA 4XK4A 1UELB 5KCMA 4KN7X 4MQ9F 3ZR8X 3LQQA 3R60A 3VB2A 1RNLA 1X2MA 4IRIA 4IZZA 2Y9YA 5BMZA 2E7XA 1MJBA 3KPHA 5C3EJ 4UY8I 4O6JA 3TDZC 2VKHA 3GZ6A 4M9ZA 4U0WA 2ZJPF 4CCOA 4IEJA 3HGYA 1G8XA 4BL0B 2ZB9A 4PGHA 1MMDA 4I0AA 3COLA 1ZR4A 3S2HJ 1K78A 2QENA 5GTIC 3GTMJ 4F7ZA 1VFCA 3OYGA 2WUIA 1I27A 4EMSA 1ZR2A 1Z0XA 1U9NA 3P9CA 5J1YA 1APLC 2VXDA 3F0CA 4ABZA 1GVDA 2M7BA 3H0DA 4BE2A 2MLGA 3WTVC 5ICFA 4MHGA 1FOXA 4A3FJ 2H1LA 5J4VA 2F5CA 5A2QK 3GFJA 2XIGA 3CMMA 3ZMSA 3K4BA 2DTZA 1ETKA 4JBAA 2LY1A 1VF9A 1PUEE 3HSFA 4XKBA 1UI6A 1JUPA 1R49A 2Y9ZA 1W5CC 2FQ4A 5TGTA 2ZJQF 3FBIB 3HRUA 5GPAA 3QPHA 4HEA2 3L2UA 2ISYA 4ZYDA 3BTCA 3B6CA 2FBQA 1NG6A 4YG2F 2G7HA 5BS6A 2A5WA 5D5XB 1X1BA 1XN7A 3WU0A 2LBFA 3VDXA 1PP7U 4PJLA 2W57A 1W4MA 4KYWA 1EF4A 1VQOI 2UXXA 5TJJA 5GAEJ 3F6VA 4ZYGA 4AUXA 3W2VA 1D8KA 3LSHA 1ZYRF 2XDNA 5J8FA 1OCOH 3QP6A 2VC0A 1YS7A 3NARA 1U2WA 2XB5A 2XF7A 4Z6YA 3JRDA 3E5QA 3WHBA 2F6CA 4B3AA 2W7NA 2JRMA 3FIWA 1S5LC 2BHZA 1U8RA 4BQNA 2IS4A 3H3VK 3AG2H 2LFBA 4EJTA 3NS4A 5DTDA 2VKVA 1IZ1A 4L18B 2W24A 3SQNA 2HPMA 1EKEA 3VVZA 2VKEA 4HW0A 4BQQA 3A01A 4L5IA 4A3EJ 1O3QA 2GA1A 4B48A 3CDIA 2W85A 2O61A 2CW7A 4C3IJ 4HF2A 2KP6A 1R5HA 4QIWN 3FXJA 2IA1A 2JT1A 5CXIA 3QKXA 1G4DA 4B44A 2QQAA 3AQSA 4A3DJ 4OD4A 4Y4RA 3OYAA 2IA2A 2EFNA 5F6FA 3I3LA 2IGNA 2QCOA 4ZTJA 2ELHA 2IW5A 3T8RA 4HNUA 3OR2C 4V19K 1H9GA 2FA5A 2FMLA 2KISA 2CV1A 5C4XJ 1VI0A 4EGYA 3KZYA 2K9LA 4LG3A 2OTLI 2ZC2A 3QOPA 4XN3A 3RYRA 4UNOA 3ON4A 1ZGJA 2ME6A 2V1NA 5AIPA 4CCJA 2R5ZB 1IRZA 2ZKZA 4IHYA 1IUYA 4YELA 5D4RA 3IC7A 1RR8C 2JVGA 1FTZA 2KRFA 4U9LA 3LA7A 4X0GA 1LPQA 1U0JA 2DPDA 2V57A 1RKTA 1TWGJ 3IAM2 2OQRA 1OMIA 2XGEA 2X1CA 3DF8A 3FKJA 4MTEA 3OR1C 2DO7A 1KQ8A 4M6YA 3GEUA 1J5YA 2UXHA 1N25A 1XC5A 3H3ZA 4N9IA 2DT6A 3TGNA 5LRSA 4KIGA 1MBFA 4IL6C 2EQRA 5ILVA 3IKTA 1OYWA 2A68F 4E7SA 4CA0A 2JPBA 4M74A 3L1PA 2HQRA 1TLHB 1EA3A 4UVCA 3AL0C 3WTXC 2R92J 1T6SA 1MBGA 3CJTB 2X85A 1BN5A 2DK8A 4NDLA 4ESFA 2JRTA 5HNFA 4OMYA 1YLFA 4OAYA 2ZFUA 3QU3A 3I56I 5BOXA 3BZKA 1TQMA 3PSIA 1MJ9A 2RHAA 2IGKA 1UAAA 4FE7A 2PX9A 3G6EI 4DJAA 4NC7A 3GZ5A 3M4OJ 4GO1A 2BY2A 1IUFA 5LHGA 4L0ZB 5DM7F 2BW3B 3K10A 2M45A 1ETQA 1TTYA 4C2TA 2REKA 1RC9A 2QZ8A 5IP9J 1FMWA 3ZMTA 3G56A 3HOWJ 4BH9A 4IHWA 3K4MA 5IT3A 2E36A 4DNCA 3HOUJ 4HA8A 5B66C 3CCSI 1EV7A 3TO7A 3ZOBA 1YFHA 2LKSA 1Q1VA 3HC7A 4GYIA 2M3AA 1MIJA 1P7IA 4FASD 3EGQA 1B9MA 1LUJB 4CXFA 1G3WA 4XLCA 1IJWC 5GAGJ 2Y0SA 3WG9A 2F4OB 2HZTA 3ONQA 3CQZJ 3U21A 5ERIA 3E6BA 1T56A 1XGNA 4RB3C 3I5UA 3OYKA 2R7QA 4UDSA 3VOKA 2CH0A 2R7VA 5IYBJ 2PMHA 2PQ8A 1JTYA 4NQWB 2WY8Q 4WXDA 2GIVA 2VQGA 1XS9A 1CF7A 4ZYEA 3B81A 1WWXA 5L3DA 2HEOA 2O7TA 1XMKA 5EFYA 5LEKA 5C4YA 2M0MA 4KN4X 2Q8KA 3DTEA 3RKWA 4JOMA 3CCJI 2X9DA 4BHCA 4L5EA 2RC4A 4FT8A 2FXAA 2GOMA 3PNTA 4G9YA 4LLNA 4BHBA 1R22A 2JA2A 2KRCA 3PFYA 3TO6A 1SGMA 5HNHA 3RIRA 1TNSA 4A3CJ 5FFXA 4A69C 1D5VA 2JMWA 4CUGA 2UXPA 3P9KA 3H3UA 4YIIA 1VQMI 2HPIA 1H88C 3CP8A 1EH6A 1YIOA 5M3MJ 1NTCA 4G7ZF 2HR3A 2LF8A 2XAGA 1UHWA 1U5TC 2A6EF 2JWTA 4WX9A 4XMYA 3SJMA 2VODA 3KKCA 3AG1H 5ILSA 4RS8A 1TNTA 4DYQA 3JSOA 4HSTA 1LJ9A 2GENA 3J7AY 4B8XA 3GTKJ 5K7FA 4JL3A 1D0YA 1X3ZB 5F08A 4IRGA 1O3SA 1BR4A 1VQ6I 3VYTB 1A04A 3A02A 4IPAA 1OR7C 2DQLA 2EPFA 2JJ7A 3HRSA 3M8EA 3P9IA 1W5SA 3MQ0A 4B3XA 4HQMA 3LWJA 5IT9K 4G6TB 3HHHA 2QGUA 3EYIA 4RBOA 3WTZA 3MCZA 2RASA 2IRFG 4RDUA 1J2XA 4A0YA 1STZA 1LNWA 2IA0A 3HSEA 1YJ9I 1S3JA 1K6OA 1NHAA 4BU2A 3K4NA 3S3OA 1BOAA 2WV0A 1DU0A 5FGLA 2JZYA 3KCCA 4IRVA 2V4JC 2BVMA 2K40A 1ODDA 2EILH 4JQFA 3X2QH 2H27A 5J1RA 2BY3A 3M07A 4J01A 5K7HA 4XLEA 2RV8A 3BR0A 3K4KA 4E70A 2NNNA 1ETWA 2XDVA 1ULYA 5CQGA 3DKWA 2CFOA 1JE8A 1I1SA 3L2CA 3H5RA 4CSWA 2LP0A 3HZJA 4HX4A 2NVUB 3J80K 3BPXA 5LFAA 3HOYJ 1M1EB 3ZQLA 1BI0A 3F6OA 3H5NA 1O7FA 1YO5C 2ZSIB 4XQFA 3UR3C 2JA5J 5D19A 2F5EA 4XLFA 3OWTA 5J47A 1W36C 4BEHA 2CGPA 2V9KA 2E34A 1YW8A 1W36D 1W7PA 2K9SA 5CLSA 1R23A 3BJAA 1S9HA 3FKIJ 1QGPA 4P1WA 5IY5H 2V1UA 2MG4A 1FYLA 1K78B 3OS0A 3S17J 1O4XA 5EZHA 3RTRA 3H9QA 4BS9A 2CQKA 4XRSA 1ZG5A 3CCLI 3W2AA 2CQ7A 2KZVA 4IOAF 3BG6A 3RYPA 1T0FC 3KYDB 3MZHA 1H89C 1HKTA 1ZG1A 1P4WA 4NC6A 3CMEI 2P5LC 3E6MA 4X6AJ 1IC8A 2L54A 2CUEA 5DCMA 4RLQA 2HFHA 2OU2A 1FSHA 1BR1A 2BGCA 2KJBA 4L62A 3WE2A 3A0HC 3WTTC 2M7AA 4L9VA 1X19A 5DAJA 4MXMA 2BHYA 5JFRA 1X4PA 3E6DA 5FLMJ 3PO2J 2WWYA 4LLLA 4G7OF 4NELA 1YYVA 1R5ID 2M8EA 2DFEA 2EV0A 5EDNA 4L9NA 3R4KA 5E1XA 4U87A 1ZN2A 1TBXA 2LBFB 3SYTA 3KP3A 4MNUA 3V42A 2QA4I 1FEXA 1O57A 2K86A 2YUSA 3LSGA 4MQVA 2MABA 2Z5UA 4L5JA 1IW7F 4PSXA 1Z7LA 2OZUA 4A3MJ 5IOYA 4YEJA 1KU2A 3CO6C 4AD9A 3OYEA 4CCNA 2BY0A 3AG4H 1XMXA 4GGGA 1RUOA 2MBFA 4FCYA 5K1YA 3GF2A 3IHUA 1NK2P 4N0BA 2H1KA 2MD0A 1SAXA 2CWEA 1T98A 2L7MP 1X3UA 2W48A 4XLPF 2MGQA 1MBJA 2FJ1A 2VE9A 1YJNI 1LE8A 2GBYA 2VJ5A 4BKXA 2HKXA 3NEUA 5D1RA 4I01A 4OAZA 2HYJA 3TKYA 3A01B 5F64A 2R7FA 1ACIA 1S7EA 3F8FA 1Z6RA 2BE5F 1D8JA 2HTJA 1G2HA 2YX7A 4ZDLA 3DV8A 2F4IA 3HOXJ 1RUNA 4WXCA 3GTGJ 2LYCA 1DUXC 2V1XA 2ZCWA 4ITVA 4LK1F 1RESA 3RQIA 5L3FA 2X6WA 3L2VA 1R6RA 4KIBA 4E7HA 2RAEA 5CKTA 3HJEA 1WVRA 2GAUA 5HDGA 2EBIA 5B3SH 4L9JA 3SDGA 2EH3A 4B4CA 2EZKA 4BQOA 1Z7UA 2L4AA 1FOYA 2BY1A 3S15J 2M30A 2OQGA 2IAIA 4P96A 2O7OA 4LITA 4BJ5C 3U1DA 2L02A 2XB0X 3L2WA 3CCRI 5J3LA 2DA6A 4YIFA 3ZQCA 1KU9A 4BJTA 1BIBA 3R61A 3RKQA 1R00A 2MFZA 5HS9A 4J00A 1HSJA 4HF0A 3BPVA 2BXZA 3V8KA 1AKHB 4A0XA 5DUIA 1ZQ3P 1ON2A 4BBSJ 3G2BA 3GO5A 4QWQA 2JVHA 3MAJA 4I02A 2D6YA 3DBHB 3JRBA 3W6VA 5H6QA 1SEUA 3VTIA 1MBEA 2OBPA 2ZJRF 2XPVA 1Z1DA 2NVYJ 2AHQA 1Y8QB 2M8GX 2A07F 2ZNZA 3TL4X 1E2XA 2D5VA 3LNQA 4BQAA 4QTRA 1OCPA 2RGVA 4E7LA 4C9YA 3CCQI 4PCQA 5D5UB 2VPRA 1Z77A 2VONA 2NX4A 4M3DA 2LTPA 2L7FP 3PUBA 3T0YA 1BJAA 1ETVA 5M5XJ 3RKXA 3SHFA 2J5PA 2PJPA 5DD4A 4Z2YA 4IQJA 1I3QJ 4LLGF 5TRDA 2F5VA 3HDDA 1WI9A 2Q2EA 4KT6A 4UB8C 4AVPA 1LVAA 2G7LA 4AYBN 5EYRA 1KA8A 2YR2A 3I4MJ 1V54H 2K3FA 3S2WA 4U7DA 3GTLJ 1FBUA 2L9NA 4NN1A 3BLYA 1K7AA 4C2UA 1IV8A 1HLVA 3EYYA 3K1PA 3EUHC 1B9NA 2MLKA 5J4YA 1SC7A 1IF1A 2CQNA 4M9SA 2MH9A 4ME9A 1QQIA 4RAGA 1FZPB 3NNRA 1S6LA 1T33A 2GA2A 3HYIA 3MFKA 3FDYA 3Q0VA 1BW5A 2VN2A 5F0CA 1RRJA 3HL2A 1K79A 4HQEA 2JSCA 3IV5A 2GXGA 3F22A 6PAXA 2FSWA 3V7CA 1PUFA 3O6BB 4Q48A 2R7WA 1JKPC 1RKWA 2DOEA 2XRNA 1ZARA 2VIXA 1X58A 3KEYA 2CUFA 3LAJA 1MNDA 2BEOA 4D9JA 2LKXA 1O3TA 4BY1J 5H9TA 3RD3A 3QYBA 2QLZA 2DLLA 4HAMA 2HOAA 1CF7B 2XROA 1LEBA 4NB5A 1XCBA 2LY2A 3QYEA 1ZLJA 1D5YA 5HVQC 5FD5A 3T8TA 4E6KG 5E3MA 2EA2A 4RB0A 5CVVA 2BZTA 3KZZA 1MSFC 1TP4A 2DOFA 2P8TA 4CH7A 5HLIA 2D1VA 2L4MA 3VODA 2ZOYA 3RPUD 4YFXF 3MZYA 2RREA 5GPCA 1GUUA 2GOXB 1V4RA 3GCMA 1MD0A 3G71I 3OL3A 5BNGA 3QRFF 3COAC 1G3YA 1VQ4I 4DQ2A 2HQ5A 1WI3A 2H6BA 4CYCA 2KHMA 1RETA 1MNEA 2E35A 4HV6A 2WBMA 2HVRA 3F3XA 3L9FA 3O2PE 3PPBA 3BG5A 2R7ZJ 5BQTA 4MFEA 1ZG3A 2CO5A 3L2RA 3D1NI 5K58A 4HZFA 5HS7A 5LBQA 3G1LA 1IXCA 1JJ8C 2ZXHA 3ABUA 3VOEA 1Z3YA 2LDUA 1S7AA 3BWGA 3I58A 2PMZA 3RDIA 4YIRX 2QWTA 2ADUA 1R58A 4KNYA 3GXOA 2V79A 3E7QA 3NWSA 4GFLA 2UV1A 5C4JJ 3HTAA 2NAZA 2EJRA 1PJRA 2QKOA 4O3MA 1B72A 4HYEA 3ISPA 2VJJA 4LK0F 2OUMA 2KQRA 3ZP5A 4A2UA 4HF1A 2K9MA 4KWAA 1U6GA 4U9NA 3M8JA 2ZFWA 2B7EA 2V26A 1FYKA 3I4NJ 1FNNA 3DXJF 2DODA 2L0KA 4OIOF 5JVGF 2DN0A 1IRXA 1SD6A 3L7WA 3CTAA 1UI5A 3BTJA 4F91B 3P9TA 1VQLI 1AHDP 1HSTA 1VZ0A 3OMYA 3VSLA 4ZTFA 3VIBA 4WCGA 2VT2A 2Z1DA 5K5RA 1V3FA 2K02A 4NC8A 3DU6A 1QHHD 2VXZA 5A2QZ 3L00A 1W1WE 1ITYA 4GDFA 1SFUA 2GWRA 1B8IA 2VJIA 1V5EA 2R7OA 2XAFA 2CU7A 1KGSA 5BPDA 5EEGA 1ZREA 5HS8A 3EUAA 1FWZA 1T95A 2PBIA 1OCTC 3BZ6A 2Y31A 4PXIA 2QOPA 1ETXA 3DPLC 3LA2A 3EETA 1VQ7I 3OYJA 9ANTA 1WJAA 2DCEA 3PNYA 1UMQA 3JAMK 4BEHB 2KIUA 3ZPLA 3K2AA 2E60A 3JRFA 2DMQA 1W7PB 3OS2A 3DEWA 5DS9A 1O3RA 2L9VA 2KZGA 2XRLA 3JRIA 3Q9VA 4BBRJ 3ABKH 2ZXIA 1UZCA 2ZCNA 1WJFA 1KYZA 1SFXA 1FYMA 2L01A 3CUOA 2GLOA 3OSFA 2UXIA 5KK1A 4AIKA 3ZGKA 3QOEA 4R1HA 3ZMVA 3JCUC 1XGMA 4U88A 2EZLA 2BYVE 2FRHA 5EJCA 3O60A 4HBLA 2AXTC 3CJQB 5DCMB 3ERMA 3V4GA 2UWMA 2P5KA 4CCMA 3KP2A 4E4HA 4N4NB 4I2OA 2R7RA 4XLNF 2P4WA 4S0HB 4XSXF 1HW2A 2XAJA 3CWRA 1ZRDA 1YQAA 2H6CA 1LDJA 2PMUA 2QWWA 3FXMA 3MEXA 1IRGA 3WGIA 3SZPA 3V6GA 4AF5A 2DBBA 3REOA 3JSPA 3PFIA 3PIPF 1FTTA 5KHDA 1MGTA 2BBYA 3GFIA 2E1CA 3DP7A 5L3GA 2C6YA 1D1BA 1WHUA 2HI3A 2NVTJ 4M6XA 2P7CB 1IN8A 3C1DA 3K6GA 2H09A 1QZYA 2HKUA 3IP4B 4I7HA 3DEUA 3HTJA 4LOCA 1WZ2A 1SFEA 2RQQA 1WFXA 2CJJA 1JJ6C 3AKZA 1MMSA 1QRYA 3KLOA 2WAQA 4LD5A 3F8MA 1Z91A 1T0FA 3VPRA 2LH9A 2WTEA 3BHQA 4YZEA 3FXOA 2DFFA 1K4SA 2M34A 2KDOA 4C3HJ 1DPUA 1FX7A 1MBHA 2Q1ZB 2O8XA 4UUTA 3OYFA 4S05A 1LE8B 2AS5F 1WQ2A 2P5VA 2QEXI 2V6CA 3JRHA 5FGMA 3FK7A 3FM5A 4PK4A 4Q47A 2QKMB 3CUQA 4GRIA 2QYOA 4RM3A 2L9SA 2UXOA 4OU0A 1U3EM 1TT0A 1U78A 3BP8A 1FSEA 3BCBA 5B1BH 2VB6A 5KAFC 2GFNA 2Y0SN 4XKVA 4EQQA 5HBUA 3OSGA 3KLNA 5CQEA 1SMTA 3SXYA 5DDGA 1YRNA 3LMMA 2V7FA 3JREA 4QPOA 2R5YA 4LB5A 4A3KJ 5K7ZA 5IP6A 1ZGWA 1OFCX 2KT0A 5L3EA 3HTUA 4M71A 2Z9OA 2NRAC 2IXSA 2GQQA 3HPGA 2FOKA 3E7LA 5LLQA 4OOIA 3K7AJ 3SEZA 5LGTA 4Y13A 3I55I 1ETOA 4PJNA 3DKXA 4HX8A 2EIMH 2EINH 4A5NA 5D18A 3K2ZA 2Z16A 3DLAA 2FBKA 4K2EA 4PZJA 2M4GA 5M5WJ 3HIFA 3C2GA 3WTUC 3S3NA 2V9VA 4XONA 4EVIA 4DGWB 1FPQA 2DDAA 1X1CA 2H8WA 1WSUA 3QWLA 4G6DA 3HOVJ 1UHSA 2YU9J 4BXXJ 2WV1A 4M3EA 2X6YA 1PP8F 5JR3A 2DG7A 1Y0UA 2DG8A 3G7RA 2Q2EB 3ABLH 4ZDPA 5D5VB 3DEEA 5FROA 1XDSA 4RGRA 3A2KA 3HXLA 4DOZA 3GTPJ 1X3WB 3G3ZA 4XSZF 3O8HA 3H9JA 4MGRA 3HRMA 4PUSA 1FBSA 4ZYHA 1I6HJ 4ON0A 3DTKA 1J7KA 3NI7A 2XGDA 3Q5FA 4JX4A 3NAUA 3A1YA 2VLAA 4R79A 1YI2I 5JVTA 2P0WA 1DQUA 2XPWA 3SFZA 3KZ9A 1GLNA 4A3JJ 1Y56A 1R4NB 5HODA 1G3SA 1W0UA 1FP1D 2NP5A 3QAHA 4Y15A 2E1MB 2OPTA 2VBXA 2O03A 3GW2A 3RCOA 1E17A 1IXSB 4AIJA 2IVMA 1PYVA 1S29A 3FMRA 1ENHA 3N05A 1ZELA 5TISC 1PUFB 2LK2A 2GIZA 2W84A 2WADA 2P6SA 3BG7A 1SMYF 4RGSA 2DA2A 3OL4A 5LRRA 4V2GA 3CJNA 4J19A 2BV6A 2W25A 1GXQA 4P9FA 2ZO4A 5AIQA 4B09A 2HNHA 2ZMEC 3MKLA 5IOZA 5K5OA 2YX4A 3K9TA 2MC3A 1IO2A 4E7JA 2STWA 3C3WA 2EFOA 1H9TA 3JRCA 2R93J 3KP5A 1GVJA 1I3AA 5E1WA 1R1VA 2JUCA 3GVAA 3CZ6A 3PL8A 4OIQF 2NOGA 5DCFA 2L7ZA 1WPKA 5ED4A 2JA8J 1WJDA 3EUHA 4PFPA 1GHCA 3BCAA 3Q0WA 3MKWB 1QVTA 3NRVA 3CMYA 1FOWA 4XLAA 5GTHC 4GCLA 3OOUA 4KITB 3J81Z 3SWHA 2HU9A 3S93A 5BPIA 3CC7I 2R7UA 4Y7NJ 1DP3A 1I6XA 4JP0A 3BZCA 5E3NA 2J5OA 2VJ4A 1K4TA 1JKOC 3BTLA 5CW8A 4CYCB 1YS6A 3N97A 1GV2A 2WA0A 3WGHA 3FMQA 2JQ7A 3LQRA 2K9NA 3BG9A 2DOAA 4II3A 4FQGA 3GX4X 1IN5A 3PQKA 2HVSA 2Q0OA 2G7GA 3F1BA 1FIPA 1BIAA 1QZEA 4E7IA 1BJZA 5CXGA 1ZHFA 1JKQC 3I54A 4RM2A 4OD5A 2OV7A 3IH4A 2K4BA 3J80Z 3CJDA 5J6XA 4IKFA 1RZ4A 1T38A 2R7TA 3ANPA 1TWFJ 4RAFA 4LB6B 3RPUA 2VBZA 2VL8A 2Y30A 1OPCA 2VE8A 4AC0A 1W0TA 1EH8A 2IGMA 3BR6A 4GXOA 4CZCA 3C7JA 4UUSA 3Q3SA 2NS7A 5AONA 3OIPA 2BVLA 1ZRCA 2Z3YA 2X51A 3KP7A 3NWTA 5FLXZ 2FE3A 2WC2A 1A6IA 4WK8F 3ULQB 5JLWA 3FHZA 5FRMA 3HG9A 2GUHA 2HXOA 5HLGA 2DA7A 2JN6A 3HOSA 1R9TJ 4CZZA 3IH2A 1J59A 1WJ5A 4M3BA 5E79C 3F9KA 2VKDA 3H92A 4CICA 2ECCA 1BOBA 1YOVB 2HXIA 4KISA 2L7KA 1ZGAA 1BW6A 2DYSH 4UVAA 3QP5A 2IP2A 3IWZA 4XNFA 3GTOJ 3CLQA 5DD8A 1JUMA 1ETYA 2JK3A 2YU3A 2ZXJA 3SFIA 3W6KB 2B9SA 3PIOF 1OQYA 1ZTRA 3LSJA 2FNAA 3A03A 2X6XA 2ZSHB 3VVYA 2E5NA 2QQBA 1S72I 1T39A 3CDHA 5CJ9A 3WODF 2DK5A 4EV0A 3CF2A 1D0ZA 1EH7A 2DXIA 3KYCB 3QBMA 2IU5A 4G94A 1IDYA 1WJBA 3S32A 4LG0A 5F1JA 2Z2SB 3LSPA 3PASA 5CYVA 1V5FA 2OC6A 1MJAA 3CRJA 1FMVA 2QSFX 4BE1A 2MD5A 4CDGA 1DDNA 5E8IA 2B0LA 2G3BA 1XCVA 5J40A 2XUBA 1IAWA 1LKXA 4R8HA 4BXUA 1IN4A 4V2FA 1HBXG 5FD6A 2W53A 1TZLA 3KNWA 1S8NA 4PSWA 3BR2A 4D7NA 3BR3A 4G8XA 3KETA 3VWBA 3LSKA 4B43A 3VYUB 1B4AA 3BQYA 3R6SA 1BI2A 2HDWA 1YX3A 2LC2A 5FKNA 2HYFA 1I1GA 2LY9A 3HOTA 3N4MA 3WTWC 3VW2A 4IRHA 4KICA 4BYYA 4P9UA 1LDDA 5AQCA 1UCRA 3M1CA 2NNYA 2STTA 3TQNA 4UUVA 4L0YB 3O3KA 3S1MJ 2PFVA 3K0LA 3BQZA 3WTYC 2L2OA 3DPTA 2A69F 5JHUA 3VEPA 1XSVA 2JA7J 1HC8A 3ON2A 2EIJH 1HKSA 2IS2A 4ZJZA 3H0GJ 4IHTA 1QU3A 4FE4A 1I5ZA 4X1EA 4EJVA 3PSFA 1HDPA 1SAUA 3U1KA 3PJRA 1FJLA 1TC3C 1E3PA 3KE2A 3EUPA 4Y17A 1R1UA 1FC3A 2HYGD 4L9TA 1WCMJ 3RZOJ 1QA6A 1UJ8A 1R5GA 5E3OA 2K5CA 1YITI 1MSEC 4XOTA 1F1ZA 4H4KC 1J09A 4Y3OA 1P7JA
chains in the Genus database with same CATH topology
3I4NJ 4NDLA 3GTJJ 3C2BA 1WGXA 2DA3A 2FD5A 1IG7A 3RH2A 2L0KA 1B72B 2DMUA 2ZOZA 2RHAA 3ZQHA 4FE7A 2DN0A 2AO9A 1UI5A 3BTJA 1CQTA 3M4OJ 3P9TA 1AHDP 1IUFA 3VIBA 3CCYA 2ZCMA 4DYCA 3CDLA 1YRNB 1ETQA 5E3LA 1K61A 2REKA 2R5YB 3HOZJ 2YVHA 1ITYA 5IP9J 2DJNA 1B8IA 3HEFA 2JA6J 3G56A 3HOWJ 5FHPA 3AQTA 4IHWA 3ZQIA 2CU7A 2M0CA 3HOUJ 5EGOB 5HSZA 2LR8A 4AC6A 3ZOBA 2QIBA 1JT0A 1Q1VA 2MSYA 3V78A 4JX6A 3IH3A 1OCTC 2E19A 2Y31A 1P7IA 2PZ9A 4MFDA 2QOPA 1ETXA 4PXIA 2LD5A 1BA5A 3EGQA 9ANTA 2G7SA 1B8IB 1UMQA 1IJWC 4A3GJ 3K2AA 3JRFA 2DA1A 2DMQA 3CQZJ 3BR5A 3DEWA 5F04A 5DS9A 1T56A 2XRLA 3JRIA 4UDSA 2NVXJ 3VOKA 1HF0A 1LFBA 3LOCA 2XPUA 4BBRJ 4B1RA 3HTHA 5IYBJ 3KKDA 2HDDA 3NRGA 1JTYA 2ZCNA 2ELKA 4I76A 1XS9A 3B81A 5EFYA 2O7TA 2GLOA 5EG0B 3OSFA 2UXIA 2LVSA 5C4YA 3C07A 2EZLA 2X9DA 4L5EA 3O60A 4XIDA 1HCRA 4M6VA 3S1RJ 2XSDC 1TWCJ 4S0HB 1K83J 1SGMA 2MW8A 3CWRA 2OERA 1ZK8A 2WB1N 5EEAA 1BL0A 4ACIA 3PO3J 2PMZN 3ZQGA 3HB9A 4A3CJ 4DW6A 2KDZA 4A69C 3V6GA 4AF5A 2JMWA 1F43A 2R5ZA 2UXPA 4CGRA 1FTTA 1H88C 2CQXA 5M3MJ 1NTCA 3NXCA 4ICHA 2JWTA 2HI3A 3SJMA 2NVTJ 1IDZA 2HKUA 3KKCA 2DMNA 3HTJA 4LOCA 1SANA 3QPSA 4DZJA 4DYQA 1VNDA 1HDDC 2HOSA 2CJJA 2GENA 1JJ6C 1RPWA 2Y2ZA 3GTKJ 1XG1A 1QRYA 5K7FA 1SFOJ 4JL3A 4M3GA 5F08A 4FTHA 4JNNA 4L62A 3BRUA 3LJLA 2TCTA 3VPRA 3A02A 3T6NA 3BHQA 2JJ7A 1MBKA 4D5FA 4YZEA 5FMPA 2M34A 2XGCA 4C3HJ 1QPIA 4A3BJ 1MBHA 3LWJA 3S14J 2OI8A 4UUTA 4RBOA 1LE8B 4GCTA 2X6OA 3JRHA 2RASA 2DA4A 4RDUA 3FK7A 5M5YJ 2YVEA 2ZCXA 3S16J 3HBLA 2UXOA 4MLOA 4EEFG 3LSRA 1TWHJ 1DU0A 1GV5A 2G0EA 5FGLA 1U78A 2M2EA 1QVUA 3VOXA 2K40A 2GFNA 2Y0SN 5J1RA 1U8BA 2O9LA 1ORKA 5HBUA 3OSGA 2O8KA 5K7HA 1YRNA 3RZDJ 3BR0A 3JREA 3DCFA 3FK6A 1ETWA 2R5YA 1TWAJ 2F07A 2GM4A 4A3KJ 5K7ZA 5IP6A 1ZGWA 1OFCX 2KT0A 5IPAA 2LP0A 4IHVA 3WHCA 1MH3A 2N8GA 3HOYJ 1Y1VJ 5EGOA 3TP0A 3ZQLA 5FKLA 3E7LA 3G1MA 3K7AJ 2JA5J 5D19A 2ME0A 1ETOA 2CRGA 5F0FA 5D18A 5J1UA 2K9SA 1NK3P 3FKIJ 5M5WJ 2MG4A 1JGGA 5C44J 3S17J 1O4XA 5EZHA 5EF6A 4XRSA 3FRQA 2I10A 5EG0A 3S1QJ 1JT6A 5IP7J 1POGA 3G1OA 1UHSA 1H89C 1E3OC 2YU9J 3HOVJ 4BXXJ 1MNMC 4DZPA 2WV1A 4M3EA 3TEDA 4X6AJ 2DG7A 1IC8A 2CUEA 4UUSB 2DG8A 1DU6A 3G7RA 4JKZA 2E2IJ 2OF7A 3PM1A 2WAQN 1JUSA 1IGNA 5DAJA 4MXMA 3GTPJ 5IYDJ 5FLMJ 3PO2J 3O8HA 3JR9A 3GZIA 4NELA 5EDNA 1I6HJ 4DYRA 5IYCJ 3BJBA 3NI7A 1WH5A 2XGDA 4JX4A 3NAUA 1FEXA 3LSGA 2YUSA 4G12A 2XPWA 2QF7A 3KZ9A 5JLXA 4A3JJ 5HODA 1RR7A 5FLVA 3LHQA 1W0UA 2HOTA 2EZHA 4A3MJ 2NS8A 2CQQA 5M3FJ 2NP5A 5IOYA 2COBA 4W97A 3GTQJ 2OPTA 1WH7A 3DPJA 3VW1A 4MIMA 1FIAA 1F36A 3VVXA 3TP3A 1ENHA 2LLKA 4FCYA 1PUFB 3BCGA 3HTIA 1NK2P 2H1KA 2LK2A 5F27A 1X2NA 2WGBA 2L7MP 3JSJA 2DA2A 2W48A 2M9HA 1MBJA 2FJ1A 1UG2A 2MGQA 2YS9A 3QQAA 4JX5A 4V2GA 4J19A 1LE8A 2GBYA 3JRGA 4BKXA 3MKLA 5IOZA 2ID3A 5D1RA 2HYJA 5EZGA 3A01B 4A93J 3MNLA 3Q0UA 3S1NJ 2IEKA 3IUVA 1MH4A 3JRCA 2R93J 4A3IJ 1S7EA 2NOGA 4Y52J 2VUMJ 3TW7A 2L7ZA 1WPKA 3MN2A 3TW6A 2JA8J 1G2HA 4MO7A 4HNVA 5HAWA 3Q0WA 3HOXJ 2PBXA 3GTGJ 1QVTA 4HKUA 3HE0A 3CMYA 3BTIA 1RESA 4GCLA 3HM5A 3OOUA 3RQIA 4BY7J 2RAEA 3BR1A 4FISA 3BG3A 4D5CA 4XRMA 2EBIA 1ZKGA 3SDGA 2EH3A 4B4CA 4Y7NJ 4JP0A 2EZKA 5E3NA 2UXUA 2TRTA 1AKHA 5FKMA 3S15J 2ID6A 2IAIA 4XK4A 3BTLA 2O7OA 4CYCB 1JKOC 5CW8A 1GV2A 4IHXA 1X2MA 2K9NA 2XB0X 2Y9YA 3BG9A 2QTQA 5J3LA 2DA6A 4QSHA 3ZQCA 1OJLA 5C3EJ 2DMPA 3RKQA 2G7GA 3F1BA 1FIPA 1AKHB 1ZQ3P 2P81A 4IEJA 1LFUP 4BBSJ 3S2DJ 1BJZA 5CXGA 1JKQC 3HGYA 3VW0A 2ZB9A 2D6YA 3IH4A 3JRBA 3W6VA 1ZR4A 3COLA 3CJDA 1MBEA 3S2HJ 3QPLA 2XPVA 2NVYJ 3FISA 2AHQA 2Q24A 2M8GX 2D5VA 3GTMJ 3LNQA 3ANPA 4JYKA 3O8GA 1OCPA 1TWFJ 4QTRA 1VFCA 2WUIA 1HOMA 2VPRA 3HKZN 1Z0XA 1U9NA 1Z77A 1ZR2A 4M3DA 2Y30A 3HGGA 2LTPA 2L7FP 1GT0C 2NX4A 4AC0A 5J1YA 1IV6A 1APLC 4ABZA 3F0CA 1ETVA 5M5XJ 1GVDA 1W0TA 4D7MA 2K9QA 3BR6A 4C3JJ 4A3FJ 1I3QJ 4UUSA 3Q3SA 2NS7A 2DTZA 3HDDA 1ETKA 1VF9A 1UI6A 2G7LA 1JUPA 2H8RA 1A6IA 2FQ4A 4AYBN 2FX0A 5EYRA 5JLWA 2Y9ZA 2GUHA 2HXOA 3I4MJ 5GPAA 2DA7A 2JN6A 1R9TJ 2E2JJ 3IH2A 5FKOA 3GTLJ 3BTCA 3B6CA 4M3BA 2FBQA 4NN1A 2ECCA 2HXIA 2DA5A 1HLVA 3GBGA 3UKGA 1BW6A 3GTOJ 4ME9A 1JUMA 1ETYA 3MVPA 3NNRA 1T33A 2JK3A 1U9OA 3SFIA 1EF4A 4M3FA 2NVQJ 1ZTRA 3LSJA 3A03A 3Q0VA 4AUXA 1BW5A 3VVYA 5F0HA 5F0CA 2DMTA 1GDTA 2XDNA 3S5RA 3IV5A 3NARA 2IU5A 3JRDA 2XB5A 1IDYA 3QBMA 3BNIA 1I50J 2NP3A 1PUFA 3WHBA 5F1JA 4B3AA 3LSPA 3PASA 3FIWA 1JKPC 1RKWA 3CRJA 3M3YJ 5FKKA 3H3VK 2LFBA 2G3BA 1X58A 2CUFA 5DTDA 2VKVA 4GCKA 2LKXA 4BY1J 3VVZA 3BT9A 2VKEA 3RD3A 5H9TA 3A01A 4V2FA 4A3EJ 2HOAA 5FJ8J 2W53A 2R0QC 3KNWA 4C3IJ 1JTXA 3NPIA 1D5YA 4QIWN 3BR2A 4D7NA 3BR3A 3HIMA 5E3MA 5CXIA 3QKXA 3AQSA 4A3DJ 2B63J 4XICA 1MSFC 3BQYA 3ZQFA 2ZOYA 1Y1WJ 5FKNA 2VI6A 2QCOA 5GP9A 2L9RA 2LY9A 5GPCA 1GUUA 3B6AA 3VW2A 4GFBA 3VP5A 4A3LJ 5C4XJ 1VI0A 5AQCA 3JRAA 5BNGA 2EZIA 1H8AC 2ECBA 2X48A 3ON4A 2ME6A 2R5ZB 1IRZA 3S1MJ 2E2HJ 1AU7A 2HQ5A 1WI3A 4CYCA 4IHYA 3BQZA 4XRSG 1RETA 1FTZA 2V57A 2JA7J 3ON2A 1RKTA 2HYTA 3PPBA 1TWGJ 3VUQA 3BG5A 2XGEA 1JKRC 2R7ZJ 4MK6A 4MFEA 3D1NI 4C2MJ 5K58A 3H0GJ 3GEUA 4I6ZA 4W1UA 4FE4A 2E1OA 3G1LA 1A5JA 2UXHA 1JJ8C 1XC5A 3ANGA 4X1EA 2QWTA 1HDPA 4GFKA 3OIOA 1MBFA 4GFLA 1FJLA 2EQRA 3E7QA 5C4JJ 1TC3C 3EUPA 3HTAA 2QKOA 1B72A 3L1PA 1WCMJ 3RZOJ 2IBDA 5E3OA 4KWAA 2R92J 1MSEC 1MBGA 1P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N J;  4NDL A;  3GTJ J;  3C2B A;  1WGX A;  2DA3 A;  2FD5 A;  1IG7 A;  3RH2 A;  2L0K A;  1B72 B;  2DMU A;  2ZOZ A;  2RHA A;  3ZQH A;  4FE7 A;  2DN0 A;  2AO9 A;  1UI5 A;  3BTJ A;  1CQT A;  3M4O J;  3P9T A;  1AHD P;  1IUF A;  3VIB A;  3CCY A;  2ZCM A;  4DYC A;  3CDL A;  1YRN B;  1ETQ A;  5E3L A;  1K61 A;  2REK A;  2R5Y B;  3HOZ J;  2YVH A;  1ITY A;  5IP9 J;  2DJN A;  1B8I A;  3HEF A;  2JA6 J;  3G56 A;  3HOW J;  5FHP A;  3AQT A;  4IHW A;  3ZQI A;  2CU7 A;  2M0C A;  3HOU J;  5EGO B;  5HSZ A;  2LR8 A;  4AC6 A;  3ZOB A;  2QIB A;  1JT0 A;  1Q1V A;  2MSY A;  3V78 A;  4JX6 A;  3IH3 A;  1OCT C;  2E19 A;  2Y31 A;  1P7I A;  2PZ9 A;  4MFD A;  2QOP A;  1ETX A;  4PXI A;  2LD5 A;  1BA5 A;  3EGQ A;  9ANT A;  2G7S A;  1B8I B;  1UMQ A;  1IJW C;  4A3G J;  3K2A A;  3JRF A;  2DA1 A;  2DMQ A;  3CQZ J;  3BR5 A;  3DEW A;  5F04 A;  5DS9 A;  1T56 A;  2XRL A;  3JRI A;  4UDS A;  2NVX J;  3VOK A;  1HF0 A;  1LFB A;  3LOC A;  2XPU A;  4BBR J;  4B1R A;  3HTH A;  5IYB J;  3KKD A;  2HDD A;  3NRG A;  1JTY A;  2ZCN A;  2ELK A;  4I76 A;  1XS9 A;  3B81 A;  5EFY A;  2O7T A;  2GLO A;  5EG0 B;  3OSF A;  2UXI A;  2LVS A;  5C4Y A;  3C07 A;  2EZL A;  2X9D A;  4L5E A;  3O60 A;  4XID A;  1HCR A;  4M6V A;  3S1R J;  2XSD C;  1TWC J;  4S0H B;  1K83 J;  1SGM A;  2MW8 A;  3CWR A;  2OER A;  1ZK8 A;  2WB1 N;  5EEA A;  1BL0 A;  4ACI A;  3PO3 J;  2PMZ N;  3ZQG A;  3HB9 A;  4A3C J;  4DW6 A;  2KDZ A;  4A69 C;  3V6G A;  4AF5 A;  2JMW A;  1F43 A;  2R5Z A;  2UXP A;  4CGR A;  1FTT A;  1H88 C;  2CQX A;  5M3M J;  1NTC A;  3NXC A;  4ICH A;  2JWT A;  2HI3 A;  3SJM A;  2NVT J;  1IDZ A;  2HKU A;  3KKC A;  2DMN A;  3HTJ A;  4LOC A;  1SAN A;  3QPS A;  4DZJ A;  4DYQ A;  1VND A;  1HDD C;  2HOS A;  2CJJ A;  2GEN A;  1JJ6 C;  1RPW A;  2Y2Z A;  3GTK J;  1XG1 A;  1QRY A;  5K7F A;  1SFO J;  4JL3 A;  4M3G A;  5F08 A;  4FTH A;  4JNN A;  4L62 A;  3BRU A;  3LJL A;  2TCT A;  3VPR A;  3A02 A;  3T6N A;  3BHQ A;  2JJ7 A;  1MBK A;  4D5F A;  4YZE A;  5FMP A;  2M34 A;  2XGC A;  4C3H J;  1QPI A;  4A3B J;  1MBH A;  3LWJ A;  3S14 J;  2OI8 A;  4UUT A;  4RBO A;  1LE8 B;  4GCT A;  2X6O A;  3JRH A;  2RAS A;  2DA4 A;  4RDU A;  3FK7 A;  5M5Y J;  2YVE A;  2ZCX A;  3S16 J;  3HBL A;  2UXO A;  4MLO A;  4EEF G;  3LSR A;  1TWH J;  1DU0 A;  1GV5 A;  2G0E A;  5FGL A;  1U78 A;  2M2E A;  1QVU A;  3VOX A;  2K40 A;  2GFN A;  2Y0S N;  5J1R A;  1U8B A;  2O9L A;  1ORK A;  5HBU A;  3OSG A;  2O8K A;  5K7H A;  1YRN A;  3RZD J;  3BR0 A;  3JRE A;  3DCF A;  3FK6 A;  1ETW A;  2R5Y A;  1TWA J;  2F07 A;  2GM4 A;  4A3K J;  5K7Z A;  5IP6 A;  1ZGW A;  1OFC X;  2KT0 A;  5IPA A;  2LP0 A;  4IHV A;  3WHC A;  1MH3 A;  2N8G A;  3HOY J;  1Y1V J;  5EGO A;  3TP0 A;  3ZQL A;  5FKL A;  3E7L A;  3G1M A;  3K7A J;  2JA5 J;  5D19 A;  2ME0 A;  1ETO A;  2CRG A;  5F0F A;  5D18 A;  5J1U A;  2K9S A;  1NK3 P;  3FKI J;  5M5W J;  2MG4 A;  1JGG A;  5C44 J;  3S17 J;  1O4X A;  5EZH A;  5EF6 A;  4XRS A;  3FRQ A;  2I10 A;  5EG0 A;  3S1Q J;  1JT6 A;  5IP7 J;  1POG A;  3G1O A;  1UHS A;  1H89 C;  1E3O C;  2YU9 J;  3HOV J;  4BXX J;  1MNM C;  4DZP A;  2WV1 A;  4M3E A;  3TED A;  4X6A J;  2DG7 A;  1IC8 A;  2CUE A;  4UUS B;  2DG8 A;  1DU6 A;  3G7R A;  4JKZ A;  2E2I J;  2OF7 A;  3PM1 A;  2WAQ N;  1JUS A;  1IGN A;  5DAJ A;  4MXM A;  3GTP J;  5IYD J;  5FLM J;  3PO2 J;  3O8H A;  3JR9 A;  3GZI A;  4NEL A;  5EDN A;  1I6H J;  4DYR A;  5IYC J;  3BJB A;  3NI7 A;  1WH5 A;  2XGD A;  4JX4 A;  3NAU A;  1FEX A;  3LSG A;  2YUS A;  4G12 A;  2XPW A;  2QF7 A;  3KZ9 A;  5JLX A;  4A3J J;  5HOD A;  1RR7 A;  5FLV A;  3LHQ A;  1W0U A;  2HOT A;  2EZH A;  4A3M J;  2NS8 A;  2CQQ A;  5M3F J;  2NP5 A;  5IOY A;  2COB A;  4W97 A;  3GTQ J;  2OPT A;  1WH7 A;  3DPJ A;  3VW1 A;  4MIM A;  1FIA A;  1F36 A;  3VVX A;  3TP3 A;  1ENH A;  2LLK A;  4FCY A;  1PUF B;  3BCG A;  3HTI A;  1NK2 P;  2H1K A;  2LK2 A;  5F27 A;  1X2N A;  2WGB A;  2L7M P;  3JSJ A;  2DA2 A;  2W48 A;  2M9H A;  1MBJ A;  2FJ1 A;  1UG2 A;  2MGQ A;  2YS9 A;  3QQA A;  4JX5 A;  4V2G A;  4J19 A;  1LE8 A;  2GBY A;  3JRG A;  4BKX A;  3MKL A;  5IOZ A;  2ID3 A;  5D1R A;  2HYJ A;  5EZG A;  3A01 B;  4A93 J;  3MNL A;  3Q0U A;  3S1N J;  2IEK A;  3IUV A;  1MH4 A;  3JRC A;  2R93 J;  4A3I J;  1S7E A;  2NOG A;  4Y52 J;  2VUM J;  3TW7 A;  2L7Z A;  1WPK A;  3MN2 A;  3TW6 A;  2JA8 J;  1G2H A;  4MO7 A;  4HNV A;  5HAW A;  3Q0W A;  3HOX J;  2PBX A;  3GTG J;  1QVT A;  4HKU A;  3HE0 A;  3CMY A;  3BTI A;  1RES A;  4GCL A;  3HM5 A;  3OOU A;  3RQI A;  4BY7 J;  2RAE A;  3BR1 A;  4FIS A;  3BG3 A;  4D5C A;  4XRM A;  2EBI A;  1ZKG A;  3SDG A;  2EH3 A;  4B4C A;  4Y7N J;  4JP0 A;  2EZK A;  5E3N A;  2UXU A;  2TRT A;  1AKH A;  5FKM A;  3S15 J;  2ID6 A;  2IAI A;  4XK4 A;  3BTL A;  2O7O A;  4CYC B;  1JKO C;  5CW8 A;  1GV2 A;  4IHX A;  1X2M A;  2K9N A;  2XB0 X;  2Y9Y A;  3BG9 A;  2QTQ A;  5J3L A;  2DA6 A;  4QSH A;  3ZQC A;  1OJL A;  5C3E J;  2DMP A;  3RKQ A;  2G7G A;  3F1B A;  1FIP A;  1AKH B;  1ZQ3 P;  2P81 A;  4IEJ A;  1LFU P;  4BBS J;  3S2D J;  1BJZ A;  5CXG A;  1JKQ C;  3HGY A;  3VW0 A;  2ZB9 A;  2D6Y A;  3IH4 A;  3JRB A;  3W6V A;  1ZR4 A;  3COL A;  3CJD A;  1MBE A;  3S2H J;  3QPL A;  2XPV A;  2NVY J;  3FIS A;  2AHQ A;  2Q24 A;  2M8G X;  2D5V A;  3GTM J;  3LNQ A;  3ANP A;  4JYK A;  3O8G A;  1OCP A;  1TWF J;  4QTR A;  1VFC A;  2WUI A;  1HOM A;  2VPR A;  3HKZ N;  1Z0X A;  1U9N A;  1Z77 A;  1ZR2 A;  4M3D A;  2Y30 A;  3HGG A;  2LTP A;  2L7F P;  1GT0 C;  2NX4 A;  4AC0 A;  5J1Y A;  1IV6 A;  1APL C;  4ABZ A;  3F0C A;  1ETV A;  5M5X J;  1GVD A;  1W0T A;  4D7M A;  2K9Q A;  3BR6 A;  4C3J J;  4A3F J;  1I3Q J;  4UUS A;  3Q3S A;  2NS7 A;  2DTZ A;  3HDD A;  1ETK A;  1VF9 A;  1UI6 A;  2G7L A;  1JUP A;  2H8R A;  1A6I A;  2FQ4 A;  4AYB N;  2FX0 A;  5EYR A;  5JLW A;  2Y9Z A;  2GUH A;  2HXO A;  3I4M J;  5GPA A;  2DA7 A;  2JN6 A;  1R9T J;  2E2J J;  3IH2 A;  5FKO A;  3GTL J;  3BTC A;  3B6C A;  4M3B A;  2FBQ A;  4NN1 A;  2ECC A;  2HXI A;  2DA5 A;  1HLV A;  3GBG A;  3UKG A;  1BW6 A;  3GTO J;  4ME9 A;  1JUM A;  1ETY A;  3MVP A;  3NNR A;  1T33 A;  2JK3 A;  1U9O A;  3SFI A;  1EF4 A;  4M3F A;  2NVQ J;  1ZTR A;  3LSJ A;  3A03 A;  3Q0V A;  4AUX A;  1BW5 A;  3VVY A;  5F0H A;  5F0C A;  2DMT A;  1GDT A;  2XDN A;  3S5R A;  3IV5 A;  3NAR A;  2IU5 A;  3JRD A;  2XB5 A;  1IDY A;  3QBM A;  3BNI A;  1I50 J;  2NP3 A;  1PUF A;  3WHB A;  5F1J A;  4B3A A;  3LSP A;  3PAS A;  3FIW A;  1JKP C;  1RKW A;  3CRJ A;  3M3Y J;  5FKK A;  3H3V K;  2LFB A;  2G3B A;  1X58 A;  2CUF A;  5DTD A;  2VKV A;  4GCK A;  2LKX A;  4BY1 J;  3VVZ A;  3BT9 A;  2VKE A;  3RD3 A;  5H9T A;  3A01 A;  4V2F A;  4A3E J;  2HOA A;  5FJ8 J;  2W53 A;  2R0Q C;  3KNW A;  4C3I J;  1JTX A;  3NPI A;  1D5Y A;  4QIW N;  3BR2 A;  4D7N A;  3BR3 A;  3HIM A;  5E3M A;  5CXI A;  3QKX A;  3AQS A;  4A3D J;  2B63 J;  4XIC A;  1MSF C;  3BQY A;  3ZQF A;  2ZOY A;  1Y1W J;  5FKN A;  2VI6 A;  2QCO A;  5GP9 A;  2L9R A;  2LY9 A;  5GPC A;  1GUU A;  3B6A A;  3VW2 A;  4GFB A;  3VP5 A;  4A3L J;  5C4X J;  1VI0 A;  5AQC A;  3JRA A;  5BNG A;  2EZI A;  1H8A C;  2ECB A;  2X48 A;  3ON4 A;  2ME6 A;  2R5Z B;  1IRZ A;  3S1M J;  2E2H J;  1AU7 A;  2HQ5 A;  1WI3 A;  4CYC A;  4IHY A;  3BQZ A;  4XRS G;  1RET A;  1FTZ A;  2V57 A;  2JA7 J;  3ON2 A;  1RKT A;  2HYT A;  3PPB A;  1TWG J;  3VUQ A;  3BG5 A;  2XGE A;  1JKR C;  2R7Z J;  4MK6 A;  4MFE A;  3D1N I;  4C2M J;  5K58 A;  3H0G J;  3GEU A;  4I6Z A;  4W1U A;  4FE4 A;  2E1O A;  3G1L A;  1A5J A;  2UXH A;  1JJ8 C;  1XC5 A;  3ANG A;  4X1E A;  2QWT A;  1HDP A;  4GFK A;  3OIO A;  1MBF A;  4GFL A;  1FJL A;  2EQR A;  3E7Q A;  5C4J J;  1TC3 C;  3EUP A;  3HTA A;  2QKO A;  1B72 A;  3L1P A;  1WCM J;  3RZO J;  2IBD A;  5E3O A;  4KWA A;  2R92 J;  1MSE C;  1MBG A;  1P7J A; 
#chains in the Genus database with same CATH topology
 4ASN A;  1KYW A;  3CUQ B;  3OYN A;  1IG7 A;  2V1D A;  2DU9 A;  3RH2 A;  2ZOZ A;  2EFW A;  2VOP A;  2YVX A;  3KP6 A;  3KEQ A;  1RI7 A;  1Y6I A;  2FOW A;  1VTN C;  3M9A A;  3GLX A;  4RGX A;  5DUK A;  2ACJ A;  4DYC A;  2ZCM A;  1QNT A;  3CDL A;  3F72 A;  1YRN B;  3J7Z I;  3TBI A;  2NYX A;  1K61 A;  5GAD J;  4EJU A;  3TDU C;  3WTS C;  2R5Y B;  1EJ9 A;  1VQN I;  3HEF A;  2JA6 J;  2LOO A;  1ZH5 A;  5FHP A;  5HOO A;  1J9I A;  3DPU A;  4D1Q A;  4OIN F;  5HSZ A;  3DFG A;  1T8I A;  2PN6 A;  4QPQ A;  4AC6 A;  1JT0 A;  5FO5 A;  4BGD A;  1LVK A;  2NXN B;  2XVC A;  4JX6 A;  2PZ9 A;  4MFD A;  2I5U A;  3DBR B;  1BA5 A;  4JK1 X;  4AID A;  1I39 A;  1BR2 A;  1XGO A;  3HPH A;  4A3G J;  1OIS A;  2AXL A;  3GFM A;  1A35 A;  5FRN A;  2DA1 A;  3UNG C;  3BR5 A;  1SVM A;  5F04 A;  1F5T A;  2NVX J;  5B5E C;  1HF0 A;  3IRQ A;  1LFB A;  3LOC A;  2KIF A;  3HTH A;  4CYD A;  3NRG A;  1VQ5 I;  2BXY A;  2PJR A;  1R1T A;  2ELK A;  1Q1H A;  4ANJ A;  4IHS A;  4HRI A;  3FMS A;  3HHG A;  1S7O A;  3SDB A;  1XSX A;  2CS3 A;  3D5L A;  1HW5 A;  2RN7 A;  1REP C;  3CC4 I;  1HCR A;  3ZMZ A;  1TWC J;  1K83 J;  2MYS A;  1JGS A;  2MW8 A;  1ZK8 A;  2KJC A;  2WB1 N;  3KZI C;  1BL0 A;  1VQK I;  5DV5 A;  4ACI A;  3PO3 J;  2I8D A;  2PMZ N;  3HB9 A;  4ZYA A;  4DW6 A;  2O5R A;  4UB6 C;  4NHJ A;  1F43 A;  4EM0 B;  3J7A O;  4ZH4 F;  2Z99 A;  3KP4 A;  2CQX A;  1R36 A;  5D8K B;  3NXC A;  4ICH A;  2EV6 A;  2XF5 A;  3ZN1 A;  3JW4 A;  1XMA A;  3CD6 I;  2WY7 Q;  4ZDO A;  1K6Y A;  4TV7 A;  5CVJ A;  2Y2Z A;  4H0E A;  1XG1 A;  2KIM A;  5HLT A;  1SFO J;  4M3G A;  3QPT A;  3OYD A;  4F52 A;  5D6F A;  2M4K A;  4B47 A;  3BRU A;  3PUF A;  2TCT A;  3I0T A;  1ERD A;  2DFI A;  4ENJ A;  3LJL A;  5F1R A;  3T6N A;  1NG7 A;  2JTV A;  1IXR C;  2IS1 A;  4PGG A;  2DQR A;  3RI4 A;  2RNJ A;  1QPI A;  4A3B J;  3BRO A;  3D5R C;  2E5Z A;  2F4M B;  2LRD A;  1W7P D;  1YE9 A;  4XKC A;  4G7H F;  3K8P C;  2WB1 A;  1NH3 A;  4GCT A;  5H6R A;  2X6O A;  3TOB A;  2DA4 A;  2QSH X;  2COM A;  2KRH A;  3CMA I;  1UST A;  4PJM A;  2P6T A;  2OD5 A;  5M5Y J;  2YVE A;  2ZCX A;  3S16 J;  4BAC A;  2HWV A;  3HBL A;  3ML6 A;  4ENK A;  3OIQ A;  4MLO A;  4EEF G;  1A6Q A;  2EV5 A;  3M1E A;  3LSR A;  3RPQ A;  2G0E A;  1RIO H;  4G6Q A;  3K4L A;  2QBY A;  2M2E A;  1QVU A;  1G59 A;  1OYY A;  2NOJ B;  2QUF A;  3K69 A;  3SEQ A;  2O9L A;  1ORK A;  2LKP A;  2DT7 B;  2O8K A;  4I98 B;  1W5T A;  3DBL B;  4HX7 A;  3FK6 A;  1TWA J;  1IN6 A;  4KJZ A;  2MA3 A;  4LFU A;  4IX7 A;  2GM4 A;  3S3M A;  4RMN A;  1U5T A;  3LFK A;  2ZY9 A;  1X4O A;  1DGR M;  1LFP A;  1Y1V J;  4RAY A;  5EGO A;  3TP0 A;  4KA4 A;  4RB2 C;  5E17 F;  3ASO H;  5FKL A;  3LWF A;  3G1M A;  4F3Q A;  2ME0 A;  2LNB A;  3TO9 A;  3TOA A;  2ZME A;  1HW1 A;  2OZ6 A;  3VYR B;  1OR7 A;  4ESB A;  5F0F A;  4HLY A;  4XKW A;  5J1U A;  2ESN A;  2K3P A;  1UB9 A;  3PNV A;  3ESW B;  3GWZ A;  3ROU A;  2F5D A;  2P7V B;  5EF6 A;  2ZBK A;  3I9V 2;  1T08 B;  2B3W A;  2I10 A;  1E3H A;  5EG0 A;  3SZT A;  1JT6 A;  3VSK A;  3JAM Z;  4DZP A;  2W1O A;  2PEX A;  3SZG A;  3TED A;  3BOQ A;  3JTH A;  3WU2 C;  2VPL A;  3IRR A;  3ELK A;  4UUS B;  3RSN A;  2FBI A;  4P5O A;  1DU6 A;  4JKZ A;  1BC7 C;  2LMD A;  3ECO A;  3E3V A;  1QZZ A;  2JPC A;  2OF7 A;  1JUS A;  2WAQ N;  3PM1 A;  1IGN A;  5IYD J;  3HUG A;  3GZI A;  3K4J A;  2VAS A;  4DYR A;  5IYC J;  4HPQ A;  2OCE A;  2CV0 A;  3BJB A;  2KLO A;  1WH5 A;  3ZMU A;  4F93 B;  5E18 F;  1PDN C;  4PJJ A;  2V9P A;  4EM1 A;  5D8L B;  2QF7 A;  2VQL A;  4G12 A;  1R4M B;  2XAQ A;  3HRT A;  3F8C A;  2JUG A;  1RR7 A;  2XAH A;  3I59 A;  5FLV A;  1FY7 A;  1E0E A;  3EPZ A;  2EZH A;  1WJC A;  3CLO A;  5ICC A;  5HDN A;  2HOT A;  2NS8 A;  2CQQ A;  1TW2 A;  5KNL A;  4D0P A;  1MZB A;  1WH7 A;  3DPJ A;  1FIA A;  1F36 A;  1USS A;  3VVX A;  2RVC A;  2O3F A;  1BC8 C;  2KPM A;  2LLK A;  4LG0 B;  3HTI A;  2VT3 A;  3DWL E;  1FBQ A;  4M72 A;  1ON1 A;  3ERE D;  1CGP A;  2WGB A;  4KMF A;  1G3T A;  1N77 A;  2M9H A;  1D0X A;  1UG2 A;  3QQA A;  5K5Q A;  1MDM A;  1XGS A;  3IUO A;  3FX3 A;  1AOY A;  1MMG A;  2ID3 A;  4UVB A;  5EZG A;  4HDV A;  1A31 A;  3Q0U A;  3S1N J;  1KON A;  1MH4 A;  3V8L A;  3WGG A;  4U0Y A;  4IF4 A;  1H0M A;  1JI8 A;  4RB1 A;  1SVO A;  4E7K A;  2X1D A;  4O5V A;  3TW7 A;  4XOP A;  3TW6 A;  4RA2 A;  3DU5 A;  4EJO A;  4MO7 A;  1HXD A;  4HNV A;  3ZMD A;  3FHN A;  4BNC A;  3NQO A;  2PBX A;  2E71 A;  4WXH A;  4KMU X;  5H20 A;  3CO7 C;  3KX2 A;  3IKV A;  4M9X A;  3BTI A;  2ZXW H;  2A05 A;  3FF5 A;  4BY7 J;  3BR1 A;  4FIS A;  2EK5 A;  1D1A A;  3BG3 A;  4BJ6 C;  2HTS A;  3W3C A;  1B59 A;  3HSR A;  1P2F A;  1ZKG A;  2EB7 A;  3QU6 A;  3LA3 A;  2TRT A;  1AKH A;  1XSD A;  5FKM A;  5LEJ A;  3KYL A;  1ZLK A;  2UUZ A;  3CES A;  4IXA A;  2XKP A;  4IO9 F;  1XX5 A;  4HV5 A;  4IHX A;  1R71 A;  2K4J A;  2OAZ A;  2FQ3 A;  3I4P A;  2EFQ A;  2QTQ A;  2DI3 A;  5HDK A;  3IWF A;  4QSH A;  1FLI A;  3K1N A;  5DM6 F;  2ELJ A;  1OJL A;  2DMP A;  1IRF A;  2CW8 A;  4BUP A;  2E1M C;  2Y48 A;  2P81 A;  3OYH A;  4AU7 A;  1LFU P;  3S2D J;  1DPR A;  3AG3 H;  4CCK A;  3VW0 A;  1SVL A;  4FX0 A;  4A5M A;  3QPL A;  3ABM H;  3FIS A;  4CO8 A;  2Q24 A;  1TW3 A;  4N4O B;  4JYK A;  3O8G A;  3KIO A;  4UHT A;  1HOM A;  3LAP A;  1LQ1 A;  4OIP F;  3GUD A;  3HKZ N;  1GT0 C;  2R7S A;  4CHU A;  3HGG A;  1SD5 A;  1IV6 A;  2A6H F;  5DEQ A;  2VC1 A;  2D1H A;  4AIH A;  4D7M A;  2K9Q A;  3B02 A;  4C3J J;  1X1D A;  1V5G A;  2QKL B;  3V8J A;  2A3S A;  2X1E A;  5ILU A;  1R7J A;  3GEZ A;  1HQC A;  4ESJ A;  2TDX A;  5E8G A;  2H8R A;  2FX0 A;  3F23 A;  2HZD A;  3E0J B;  1D3Y A;  4XBF A;  3K4C A;  4I99 C;  5LGN A;  4KFC A;  2NS0 A;  2UXN A;  2E2J J;  1P92 A;  5FKO A;  3CJR B;  5L3B A;  5LGU A;  2PFB A;  1JHF A;  4BDZ A;  4OMZ A;  1XPX A;  2DA5 A;  1FT9 A;  3GBG A;  1SFK A;  3UKG A;  4PDK A;  5E1Z B;  3KEO A;  3MVP A;  5EEH A;  1U9O A;  4M3F A;  3F8N A;  4FET A;  2NVQ J;  3BC8 A;  1XB4 A;  5LD2 C;  2W82 A;  1V55 H;  3HKZ A;  5F0H A;  2Z33 A;  1KU7 A;  3IL2 A;  5D4S A;  2DMT A;  1GDT A;  1QPM A;  3S5R A;  2DT5 A;  1OLT A;  2OCC H;  2LG4 A;  3JTG A;  3BNI A;  1I50 J;  2NP3 A;  3I64 A;  2CMP A;  2W4S A;  1YJW I;  3M3Y J;  3H5A A;  5FKK A;  3E6C C;  2QM3 A;  3FXQ A;  2A61 A;  3CP2 A;  2A2F X;  4GCK A;  1OCR H;  1QBJ A;  4LMY A;  3GYH X;  1VQ9 I;  3BT9 A;  1WJE A;  2PJR B;  3AL0 B;  3OYL A;  1XTA A;  1Z6T A;  4ZC3 A;  5FJ8 J;  1BI3 A;  2RQP A;  2R0Q C;  2O6G E;  1JTX A;  1YW9 A;  3NPI A;  2XKO A;  4U0V A;  3HIM A;  2GZW A;  2QVO A;  4A6E A;  5D6E A;  3GFL A;  1Z67 A;  2DJI A;  4ENN A;  3M7G A;  2L3D A;  3DQV C;  5B1A H;  5HLH A;  4XIC A;  3KFW X;  2B63 J;  2QSG X;  4II2 A;  3ZQF A;  3E1S A;  3BY6 A;  2CW0 F;  3C2H A;  3WU1 B;  1Y1W J;  2OTJ I;  2VI6 A;  5GP9 A;  2L9R A;  4DVY P;  4HLX A;  5H2F C;  3HTS B;  1AWC A;  3B6A A;  4GFB A;  1TT5 B;  2HS5 A;  4PFO A;  3VP5 A;  4A3L J;  3JRA A;  2G9W A;  2EZI A;  1H8A C;  2ECB A;  2X48 A;  5ICG A;  1MKM A;  4QLC U;  3F21 A;  5IT9 Z;  5CPR B;  2E2H J;  1AU7 A;  4E7Z A;  2CUZ A;  4XRS G;  4YFN F;  2PG4 A;  3K1M A;  4F92 B;  5GAH J;  2IGO A;  3H36 A;  4EAT A;  2HYT A;  3VUQ A;  2DTR A;  1JKR C;  4MK6 A;  1YHQ I;  4XR6 A;  1OYI A;  4C2M J;  4HNT A;  4WF2 A;  4W1U A;  4I6Z A;  2E1O A;  1A5J A;  1N75 A;  2DW4 A;  2LRE A;  2Y69 H;  3BDD A;  1Y39 A;  4ETS A;  3ANG A;  3OV8 A;  3MWM A;  4HG2 A;  3J81 K;  2D2W A;  4GFK A;  4FHT A;  3OIO A;  1OKR A;  2R7D A;  3D0S A;  2Y0M A;  2VBW A;  3ZCO A;  3CCU I;  2YPR A;  1MMA A;  1Z05 A;  3QOD A;  2EWN A;  1VQP I;  1LEA A;  2FEZ A;  2IBD A;  1P6R A;  3W2W A;  4NNJ A;  4YRV A;  2E1N A;  3DLL F;  3GTJ J;  3C2B A;  3DTI A;  3TMO A;  1WGX A;  2DA3 A;  2A5Y B;  2FD5 A;  3CCV I;  1B72 B;  2DMU A;  3FM3 A;  4LIU A;  3ZQH A;  3E5U A;  3FXR A;  2AO9 A;  4MEY F;  2B1E A;  2R3S A;  1CQT A;  1LB2 A;  4XM3 A;  2QBY B;  2R7X A;  2M1B A;  3H35 A;  4XRF A;  2AQF A;  3OYB A;  2WAE A;  3CCY A;  3LST A;  3LHQ A;  1J0R A;  4IOC F;  1Y8R B;  2GXB A;  1UG0 A;  3P5J A;  1OCZ H;  3RQ4 A;  5E3L A;  2CYY A;  2RDP A;  4XN0 A;  3HOZ J;  2YVH A;  3BJO A;  2DJN A;  3GLL A;  4C30 A;  1N78 A;  2FUG 2;  1U5T B;  2Y75 A;  4BHP A;  3AQT A;  2FMY A;  3ZQI A;  2M0C A;  5ICE A;  5EGO B;  4UXN A;  2LR8 A;  2QIB A;  2O0Y A;  4KIF A;  2MSY A;  3V78 A;  3IH3 A;  1Z21 A;  2E19 A;  1P4X A;  4LGW A;  2LD5 A;  3F8B A;  5FLX K;  3OYI A;  2G7S A;  1B8I B;  2MC4 A;  1X1P A;  2ZME B;  3CC2 I;  4AWX B;  2F48 A;  2G7U A;  2WAF A;  4IQ4 A;  5FB2 A;  4KT5 C;  2CV2 A;  1KQ0 A;  1UFM A;  2K7L A;  2RNG A;  2XPU A;  3FBN B;  3EQL F;  4B1R A;  3FXK A;  3KKD A;  2HDD A;  2RKH A;  2OA4 A;  4IVN A;  1SD7 A;  1B1B A;  2FU4 A;  2ZJ2 A;  4A6D A;  4EGZ A;  4I76 A;  3V7R A;  2VQH A;  5CVU A;  3PQJ A;  5EG0 B;  4LIV A;  4MEX F;  1P9Q C;  1ZRF A;  2LVS A;  1BBY A;  3AAF A;  1AA7 A;  3C07 A;  1UHM A;  3CUQ C;  5JHF A;  4XLH A;  2ICW G;  3MKZ A;  1C0W A;  1JXS A;  2X0L A;  4XID A;  4M6V A;  2A6T A;  3ABT A;  3S1R J;  5KAI C;  3VYS B;  2XSD C;  1DP7 P;  4M73 A;  1XDU A;  2XSJ C;  2ZNY A;  3M8F A;  4DBQ A;  3G4S I;  2ETH A;  2OER A;  5EEA A;  3LFU A;  4UV9 A;  2HQN A;  3ZQG A;  2KDZ A;  2HOE A;  2VOO A;  3HUG B;  2MH2 A;  1D1C A;  2R5Z A;  4CGR A;  4KUM A;  4F55 A;  1XD7 A;  2F5F A;  1TQP A;  2IS6 A;  2K27 A;  2JSP A;  3U9G A;  3DKY A;  1QO0 D;  3WE3 A;  3A4C A;  1IDZ A;  4A0Z A;  3FZV A;  2DMN A;  2EFP A;  3J7Y J;  2HOS A;  1SAN A;  3QPS A;  3ZRG A;  1ONV A;  1VND A;  4DZJ A;  4XOR A;  3I59 B;  4ZZD A;  1HDD C;  2FF4 A;  3U2R A;  1RPW A;  2QQ8 A;  3H1C A;  3K70 C;  1FP2 A;  2CFX A;  4FTH A;  1FOK A;  2XF6 A;  1J75 A;  2KMU A;  2HDC A;  4JNN A;  4BE0 A;  3K70 D;  1SD4 A;  1HA8 A;  2EA4 A;  4D5F A;  1MBK A;  5FMP A;  1ZAO A;  4ENM A;  2D45 A;  2XGC A;  3IAS 2;  4Q4Z F;  3QYF A;  1YX5 A;  3S14 J;  2OI8 A;  1L0O C;  1Z3X A;  1MDM B;  2PI0 A;  3CCM I;  2FBH A;  1YIJ I;  1GXP A;  3MKY B;  1WRJ A;  1KZH A;  3ECH A;  1G6N A;  4I09 A;  1TWH J;  3Q9S A;  4RAZ A;  3OYC A;  1IN7 A;  1GV5 A;  5D5W B;  4AVZ A;  4FX4 A;  2IPQ X;  3VOX A;  2DFH A;  1U8B A;  2CG4 A;  2BW3 A;  3ZN0 A;  4EM2 A;  3CCE I;  4N9H A;  1JHH A;  2FJI 1;  1WKM A;  3RZD J;  2LF7 A;  2CUJ A;  3MMY B;  3DCF A;  2V6E A;  2F07 A;  4OWR B;  3H9G A;  4XL9 A;  4P55 A;  3LL7 A;  2R4G A;  5IPA A;  3RJP A;  4IHV A;  2KKO A;  3V7S A;  3WHC A;  1MH3 A;  3FWE A;  2N8G A;  3G73 A;  4S04 A;  4A12 A;  4Q5S F;  3S8P A;  1Y0N A;  4AM3 A;  4HOB A;  3T1B A;  4NBQ A;  5FFZ A;  1BM9 A;  2YSR A;  4HSR A;  4I0B A;  2KL4 A;  3ZXS A;  2XV4 S;  3MZ8 A;  3LSI A;  2CRG A;  5LHH A;  2DYR H;  2DAO A;  2QQ9 A;  3I71 A;  1NK3 P;  3FXU A;  2AQE A;  1DGW Y;  4GYG A;  3I53 A;  1TL8 A;  4U7B A;  1JGG A;  3EUK L;  5C44 J;  2XGX A;  2M87 A;  4WIB A;  4NQW A;  4UV8 A;  2L5Q A;  3A0B C;  3L2Q A;  3OY9 A;  4IJA A;  4CCL A;  2UZK A;  1B6A A;  3FRQ A;  2ESH A;  2DPU A;  3S1Q J;  5IP7 J;  1POG A;  3G1O A;  1E3O C;  2KIQ A;  5J8C A;  2BOL A;  2OJE D;  2W00 A;  1BI1 A;  2F2E A;  4PJ0 C;  3LSM A;  3E97 A;  1MNM C;  3MD2 A;  4Y33 A;  5CVI A;  2H94 A;  3OOP A;  3BJ6 A;  4OIR F;  3B73 A;  4C2M A;  1MMN A;  3CF5 F;  1YTY A;  5JI6 A;  3EDP A;  1A36 A;  2E2I J;  3FXL A;  3ASN H;  2LSO A;  1O7L A;  3GME A;  3W6J B;  3JR9 A;  2EIK H;  1MW7 A;  3AFH A;  1VQ8 I;  2GXA A;  2X4H A;  1Z9C A;  2K85 A;  3P7N A;  5CVR A;  1TQI A;  1YG2 A;  2XAU A;  4GCV A;  3GZN B;  5LHI A;  5E20 A;  3R0A A;  4BXF A;  1P4A A;  2XAS A;  5JLX A;  4RGU A;  3E5X A;  3RKY A;  3C18 A;  4YFK F;  5M3F J;  3ZQQ A;  2COB A;  4W97 A;  3GTQ J;  4DBR A;  4AYB A;  1KU3 A;  3WG7 H;  3VW1 A;  4MIM A;  2DDB A;  2HKO A;  3TP3 A;  3OYM A;  2HQA A;  3BCG A;  3L09 A;  4KDP A;  5F27 A;  4WWC A;  1X2N A;  5DYM A;  2XC7 A;  2XHK A;  1YW7 A;  4LJZ F;  2VQC A;  4CGZ A;  4NUB A;  3JSJ A;  1QHG A;  2CSO A;  4JX5 A;  2YS9 A;  3ZQ7 A;  4ZZL A;  2HVQ A;  1KQ9 A;  3D5S C;  3R0J A;  3JRG A;  5L3C A;  4BDY A;  1HKQ A;  4A93 J;  3MNL A;  3IUV A;  2E7W A;  2IEK A;  4A3I J;  3OS1 A;  4HDU A;  1PVE A;  4EJW A;  2ISZ A;  4Y52 J;  2VUM J;  3MN2 A;  2HGC A;  5HAW A;  4DIQ A;  1OCC H;  4BAY A;  4RLF A;  2FNP A;  1F4K A;  4HKU A;  3HE0 A;  2VBY A;  2KFD A;  3HM5 A;  3VFZ A;  1LDK B;  4D5C A;  4XRM A;  3T5X A;  1F9N A;  2IT0 A;  2PLY A;  2IJL A;  1T2K A;  1L3L A;  2UXU A;  1X1A A;  4MTD A;  2ID6 A;  2M5W A;  5KVR A;  4XK4 A;  1UEL B;  5KCM A;  4KN7 X;  4MQ9 F;  3ZR8 X;  3LQQ A;  3R60 A;  3VB2 A;  1RNL A;  1X2M A;  4IRI A;  4IZZ A;  2Y9Y A;  5BMZ A;  2E7X A;  1MJB A;  3KPH A;  5C3E J;  4UY8 I;  4O6J A;  3TDZ C;  2VKH A;  3GZ6 A;  4M9Z A;  4U0W A;  2ZJP F;  4CCO A;  4IEJ A;  3HGY A;  1G8X A;  4BL0 B;  2ZB9 A;  4PGH A;  1MMD A;  4I0A A;  3COL A;  1ZR4 A;  3S2H J;  1K78 A;  2QEN A;  5GTI C;  3GTM J;  4F7Z A;  1VFC A;  3OYG A;  2WUI A;  1I27 A;  4EMS A;  1ZR2 A;  1Z0X A;  1U9N A;  3P9C A;  5J1Y A;  1APL C;  2VXD A;  3F0C A;  4ABZ A;  1GVD A;  2M7B A;  3H0D A;  4BE2 A;  2MLG A;  3WTV C;  5ICF A;  4MHG A;  1FOX A;  4A3F J;  2H1L A;  5J4V A;  2F5C A;  5A2Q K;  3GFJ A;  2XIG A;  3CMM A;  3ZMS A;  3K4B A;  2DTZ A;  1ETK A;  4JBA A;  2LY1 A;  1VF9 A;  1PUE E;  3HSF A;  4XKB A;  1UI6 A;  1JUP A;  1R49 A;  2Y9Z A;  1W5C C;  2FQ4 A;  5TGT A;  2ZJQ F;  3FBI B;  3HRU A;  5GPA A;  3QPH A;  4HEA 2;  3L2U A;  2ISY A;  4ZYD A;  3BTC A;  3B6C A;  2FBQ A;  1NG6 A;  4YG2 F;  2G7H A;  5BS6 A;  2A5W A;  5D5X B;  1X1B A;  1XN7 A;  3WU0 A;  2LBF A;  3VDX A;  1PP7 U;  4PJL A;  2W57 A;  1W4M A;  4KYW A;  1EF4 A;  1VQO I;  2UXX A;  5TJJ A;  5GAE J;  3F6V A;  4ZYG A;  4AUX A;  3W2V A;  1D8K A;  3LSH A;  1ZYR F;  2XDN A;  5J8F A;  1OCO H;  3QP6 A;  2VC0 A;  1YS7 A;  3NAR A;  1U2W A;  2XB5 A;  2XF7 A;  4Z6Y A;  3JRD A;  3E5Q A;  3WHB A;  2F6C A;  4B3A A;  2W7N A;  2JRM A;  3FIW A;  1S5L C;  2BHZ A;  1U8R A;  4BQN A;  2IS4 A;  3H3V K;  3AG2 H;  2LFB A;  4EJT A;  3NS4 A;  5DTD A;  2VKV A;  1IZ1 A;  4L18 B;  2W24 A;  3SQN A;  2HPM A;  1EKE A;  3VVZ A;  2VKE A;  4HW0 A;  4BQQ A;  3A01 A;  4L5I A;  4A3E J;  1O3Q A;  2GA1 A;  4B48 A;  3CDI A;  2W85 A;  2O61 A;  2CW7 A;  4C3I J;  4HF2 A;  2KP6 A;  1R5H A;  4QIW N;  3FXJ A;  2IA1 A;  2JT1 A;  5CXI A;  3QKX A;  1G4D A;  4B44 A;  2QQA A;  3AQS A;  4A3D J;  4OD4 A;  4Y4R A;  3OYA A;  2IA2 A;  2EFN A;  5F6F A;  3I3L A;  2IGN A;  2QCO A;  4ZTJ A;  2ELH A;  2IW5 A;  3T8R A;  4HNU A;  3OR2 C;  4V19 K;  1H9G A;  2FA5 A;  2FML A;  2KIS A;  2CV1 A;  5C4X J;  1VI0 A;  4EGY A;  3KZY A;  2K9L A;  4LG3 A;  2OTL I;  2ZC2 A;  3QOP A;  4XN3 A;  3RYR A;  4UNO A;  3ON4 A;  1ZGJ A;  2ME6 A;  2V1N A;  5AIP A;  4CCJ A;  2R5Z B;  1IRZ A;  2ZKZ A;  4IHY A;  1IUY A;  4YEL A;  5D4R A;  3IC7 A;  1RR8 C;  2JVG A;  1FTZ A;  2KRF A;  4U9L A;  3LA7 A;  4X0G A;  1LPQ A;  1U0J A;  2DPD A;  2V57 A;  1RKT A;  1TWG J;  3IAM 2;  2OQR A;  1OMI A;  2XGE A;  2X1C A;  3DF8 A;  3FKJ A;  4MTE A;  3OR1 C;  2DO7 A;  1KQ8 A;  4M6Y A;  3GEU A;  1J5Y A;  2UXH A;  1N25 A;  1XC5 A;  3H3Z A;  4N9I A;  2DT6 A;  3TGN A;  5LRS A;  4KIG A;  1MBF A;  4IL6 C;  2EQR A;  5ILV A;  3IKT A;  1OYW A;  2A68 F;  4E7S A;  4CA0 A;  2JPB A;  4M74 A;  3L1P A;  2HQR A;  1TLH B;  1EA3 A;  4UVC A;  3AL0 C;  3WTX C;  2R92 J;  1T6S A;  1MBG A;  3CJT B;  2X85 A;  1BN5 A;  2DK8 A;  4NDL A;  4ESF A;  2JRT A;  5HNF A;  4OMY A;  1YLF A;  4OAY A;  2ZFU A;  3QU3 A;  3I56 I;  5BOX A;  3BZK A;  1TQM A;  3PSI A;  1MJ9 A;  2RHA A;  2IGK A;  1UAA A;  4FE7 A;  2PX9 A;  3G6E I;  4DJA A;  4NC7 A;  3GZ5 A;  3M4O J;  4GO1 A;  2BY2 A;  1IUF A;  5LHG A;  4L0Z B;  5DM7 F;  2BW3 B;  3K10 A;  2M45 A;  1ETQ A;  1TTY A;  4C2T A;  2REK A;  1RC9 A;  2QZ8 A;  5IP9 J;  1FMW A;  3ZMT A;  3G56 A;  3HOW J;  4BH9 A;  4IHW A;  3K4M A;  5IT3 A;  2E36 A;  4DNC A;  3HOU J;  4HA8 A;  5B66 C;  3CCS I;  1EV7 A;  3TO7 A;  3ZOB A;  1YFH A;  2LKS A;  1Q1V A;  3HC7 A;  4GYI A;  2M3A A;  1MIJ A;  1P7I A;  4FAS D;  3EGQ A;  1B9M A;  1LUJ B;  4CXF A;  1G3W A;  4XLC A;  1IJW C;  5GAG J;  2Y0S A;  3WG9 A;  2F4O B;  2HZT A;  3ONQ A;  3CQZ J;  3U21 A;  5ERI A;  3E6B A;  1T56 A;  1XGN A;  4RB3 C;  3I5U A;  3OYK A;  2R7Q A;  4UDS A;  3VOK A;  2CH0 A;  2R7V A;  5IYB J;  2PMH A;  2PQ8 A;  1JTY A;  4NQW B;  2WY8 Q;  4WXD A;  2GIV A;  2VQG A;  1XS9 A;  1CF7 A;  4ZYE A;  3B81 A;  1WWX A;  5L3D A;  2HEO A;  2O7T A;  1XMK A;  5EFY A;  5LEK A;  5C4Y A;  2M0M A;  4KN4 X;  2Q8K A;  3DTE A;  3RKW A;  4JOM A;  3CCJ I;  2X9D A;  4BHC A;  4L5E A;  2RC4 A;  4FT8 A;  2FXA A;  2GOM A;  3PNT A;  4G9Y A;  4LLN A;  4BHB A;  1R22 A;  2JA2 A;  2KRC A;  3PFY A;  3TO6 A;  1SGM A;  5HNH A;  3RIR A;  1TNS A;  4A3C J;  5FFX A;  4A69 C;  1D5V A;  2JMW A;  4CUG A;  2UXP A;  3P9K A;  3H3U A;  4YII A;  1VQM I;  2HPI A;  1H88 C;  3CP8 A;  1EH6 A;  1YIO A;  5M3M J;  1NTC A;  4G7Z F;  2HR3 A;  2LF8 A;  2XAG A;  1UHW A;  1U5T C;  2A6E F;  2JWT A;  4WX9 A;  4XMY A;  3SJM A;  2VOD A;  3KKC A;  3AG1 H;  5ILS A;  4RS8 A;  1TNT A;  4DYQ A;  3JSO A;  4HST A;  1LJ9 A;  2GEN A;  3J7A Y;  4B8X A;  3GTK J;  5K7F A;  4JL3 A;  1D0Y A;  1X3Z B;  5F08 A;  4IRG A;  1O3S A;  1BR4 A;  1VQ6 I;  3VYT B;  1A04 A;  3A02 A;  4IPA A;  1OR7 C;  2DQL A;  2EPF A;  2JJ7 A;  3HRS A;  3M8E A;  3P9I A;  1W5S A;  3MQ0 A;  4B3X A;  4HQM A;  3LWJ A;  5IT9 K;  4G6T B;  3HHH A;  2QGU A;  3EYI A;  4RBO A;  3WTZ A;  3MCZ A;  2RAS A;  2IRF G;  4RDU A;  1J2X A;  4A0Y A;  1STZ A;  1LNW A;  2IA0 A;  3HSE A;  1YJ9 I;  1S3J A;  1K6O A;  1NHA A;  4BU2 A;  3K4N A;  3S3O A;  1BOA A;  2WV0 A;  1DU0 A;  5FGL A;  2JZY A;  3KCC A;  4IRV A;  2V4J C;  2BVM A;  2K40 A;  1ODD A;  2EIL H;  4JQF A;  3X2Q H;  2H27 A;  5J1R A;  2BY3 A;  3M07 A;  4J01 A;  5K7H A;  4XLE A;  2RV8 A;  3BR0 A;  3K4K A;  4E70 A;  2NNN A;  1ETW A;  2XDV A;  1ULY A;  5CQG A;  3DKW A;  2CFO A;  1JE8 A;  1I1S A;  3L2C A;  3H5R A;  4CSW A;  2LP0 A;  3HZJ A;  4HX4 A;  2NVU B;  3J80 K;  3BPX A;  5LFA A;  3HOY J;  1M1E B;  3ZQL A;  1BI0 A;  3F6O A;  3H5N A;  1O7F A;  1YO5 C;  2ZSI B;  4XQF A;  3UR3 C;  2JA5 J;  5D19 A;  2F5E A;  4XLF A;  3OWT A;  5J47 A;  1W36 C;  4BEH A;  2CGP A;  2V9K A;  2E34 A;  1YW8 A;  1W36 D;  1W7P A;  2K9S A;  5CLS A;  1R23 A;  3BJA A;  1S9H A;  3FKI J;  1QGP A;  4P1W A;  5IY5 H;  2V1U A;  2MG4 A;  1FYL A;  1K78 B;  3OS0 A;  3S17 J;  1O4X A;  5EZH A;  3RTR A;  3H9Q A;  4BS9 A;  2CQK A;  4XRS A;  1ZG5 A;  3CCL I;  3W2A A;  2CQ7 A;  2KZV A;  4IOA F;  3BG6 A;  3RYP A;  1T0F C;  3KYD B;  3MZH A;  1H89 C;  1HKT A;  1ZG1 A;  1P4W A;  4NC6 A;  3CME I;  2P5L C;  3E6M A;  4X6A J;  1IC8 A;  2L54 A;  2CUE A;  5DCM A;  4RLQ A;  2HFH A;  2OU2 A;  1FSH A;  1BR1 A;  2BGC A;  2KJB A;  4L62 A;  3WE2 A;  3A0H C;  3WTT C;  2M7A A;  4L9V A;  1X19 A;  5DAJ A;  4MXM A;  2BHY A;  5JFR A;  1X4P A;  3E6D A;  5FLM J;  3PO2 J;  2WWY A;  4LLL A;  4G7O F;  4NEL A;  1YYV A;  1R5I D;  2M8E A;  2DFE A;  2EV0 A;  5EDN A;  4L9N A;  3R4K A;  5E1X A;  4U87 A;  1ZN2 A;  1TBX A;  2LBF B;  3SYT A;  3KP3 A;  4MNU A;  3V42 A;  2QA4 I;  1FEX A;  1O57 A;  2K86 A;  2YUS A;  3LSG A;  4MQV A;  2MAB A;  2Z5U A;  4L5J A;  1IW7 F;  4PSX A;  1Z7L A;  2OZU A;  4A3M J;  5IOY A;  4YEJ A;  1KU2 A;  3CO6 C;  4AD9 A;  3OYE A;  4CCN A;  2BY0 A;  3AG4 H;  1XMX A;  4GGG A;  1RUO A;  2MBF A;  4FCY A;  5K1Y A;  3GF2 A;  3IHU A;  1NK2 P;  4N0B A;  2H1K A;  2MD0 A;  1SAX A;  2CWE A;  1T98 A;  2L7M P;  1X3U A;  2W48 A;  4XLP F;  2MGQ A;  1MBJ A;  2FJ1 A;  2VE9 A;  1YJN I;  1LE8 A;  2GBY A;  2VJ5 A;  4BKX A;  2HKX A;  3NEU A;  5D1R A;  4I01 A;  4OAZ A;  2HYJ A;  3TKY A;  3A01 B;  5F64 A;  2R7F A;  1ACI A;  1S7E A;  3F8F A;  1Z6R A;  2BE5 F;  1D8J A;  2HTJ A;  1G2H A;  2YX7 A;  4ZDL A;  3DV8 A;  2F4I A;  3HOX J;  1RUN A;  4WXC A;  3GTG J;  2LYC A;  1DUX C;  2V1X A;  2ZCW A;  4ITV A;  4LK1 F;  1RES A;  3RQI A;  5L3F A;  2X6W A;  3L2V A;  1R6R A;  4KIB A;  4E7H A;  2RAE A;  5CKT A;  3HJE A;  1WVR A;  2GAU A;  5HDG A;  2EBI A;  5B3S H;  4L9J A;  3SDG A;  2EH3 A;  4B4C A;  2EZK A;  4BQO A;  1Z7U A;  2L4A A;  1FOY A;  2BY1 A;  3S15 J;  2M30 A;  2OQG A;  2IAI A;  4P96 A;  2O7O A;  4LIT A;  4BJ5 C;  3U1D A;  2L02 A;  2XB0 X;  3L2W A;  3CCR I;  5J3L A;  2DA6 A;  4YIF A;  3ZQC A;  1KU9 A;  4BJT A;  1BIB A;  3R61 A;  3RKQ A;  1R00 A;  2MFZ A;  5HS9 A;  4J00 A;  1HSJ A;  4HF0 A;  3BPV A;  2BXZ A;  3V8K A;  1AKH B;  4A0X A;  5DUI A;  1ZQ3 P;  1ON2 A;  4BBS J;  3G2B A;  3GO5 A;  4QWQ A;  2JVH A;  3MAJ A;  4I02 A;  2D6Y A;  3DBH B;  3JRB A;  3W6V A;  5H6Q A;  1SEU A;  3VTI A;  1MBE A;  2OBP A;  2ZJR F;  2XPV A;  1Z1D A;  2NVY J;  2AHQ A;  1Y8Q B;  2M8G X;  2A07 F;  2ZNZ A;  3TL4 X;  1E2X A;  2D5V A;  3LNQ A;  4BQA A;  4QTR A;  1OCP A;  2RGV A;  4E7L A;  4C9Y A;  3CCQ I;  4PCQ A;  5D5U B;  2VPR A;  1Z77 A;  2VON A;  2NX4 A;  4M3D A;  2LTP A;  2L7F P;  3PUB A;  3T0Y A;  1BJA A;  1ETV A;  5M5X J;  3RKX A;  3SHF A;  2J5P A;  2PJP A;  5DD4 A;  4Z2Y A;  4IQJ A;  1I3Q J;  4LLG F;  5TRD A;  2F5V A;  3HDD A;  1WI9 A;  2Q2E A;  4KT6 A;  4UB8 C;  4AVP A;  1LVA A;  2G7L A;  4AYB N;  5EYR A;  1KA8 A;  2YR2 A;  3I4M J;  1V54 H;  2K3F A;  3S2W A;  4U7D A;  3GTL J;  1FBU A;  2L9N A;  4NN1 A;  3BLY A;  1K7A A;  4C2U A;  1IV8 A;  1HLV A;  3EYY A;  3K1P A;  3EUH C;  1B9N A;  2MLK A;  5J4Y A;  1SC7 A;  1IF1 A;  2CQN A;  4M9S A;  2MH9 A;  4ME9 A;  1QQI A;  4RAG A;  1FZP B;  3NNR A;  1S6L A;  1T33 A;  2GA2 A;  3HYI A;  3MFK A;  3FDY A;  3Q0V A;  1BW5 A;  2VN2 A;  5F0C A;  1RRJ A;  3HL2 A;  1K79 A;  4HQE A;  2JSC A;  3IV5 A;  2GXG A;  3F22 A;  6PAX A;  2FSW A;  3V7C A;  1PUF A;  3O6B B;  4Q48 A;  2R7W A;  1JKP C;  1RKW A;  2DOE A;  2XRN A;  1ZAR A;  2VIX A;  1X58 A;  3KEY A;  2CUF A;  3LAJ A;  1MND A;  2BEO A;  4D9J A;  2LKX A;  1O3T A;  4BY1 J;  5H9T A;  3RD3 A;  3QYB A;  2QLZ A;  2DLL A;  4HAM A;  2HOA A;  1CF7 B;  2XRO A;  1LEB A;  4NB5 A;  1XCB A;  2LY2 A;  3QYE A;  1ZLJ A;  1D5Y A;  5HVQ C;  5FD5 A;  3T8T A;  4E6K G;  5E3M A;  2EA2 A;  4RB0 A;  5CVV A;  2BZT A;  3KZZ A;  1MSF C;  1TP4 A;  2DOF A;  2P8T A;  4CH7 A;  5HLI A;  2D1V A;  2L4M A;  3VOD A;  2ZOY A;  3RPU D;  4YFX F;  3MZY A;  2RRE A;  5GPC A;  1GUU A;  2GOX B;  1V4R A;  3GCM A;  1MD0 A;  3G71 I;  3OL3 A;  5BNG A;  3QRF F;  3COA C;  1G3Y A;  1VQ4 I;  4DQ2 A;  2HQ5 A;  1WI3 A;  2H6B A;  4CYC A;  2KHM A;  1RET A;  1MNE A;  2E35 A;  4HV6 A;  2WBM A;  2HVR A;  3F3X A;  3L9F A;  3O2P E;  3PPB A;  3BG5 A;  2R7Z J;  5BQT A;  4MFE A;  1ZG3 A;  2CO5 A;  3L2R A;  3D1N I;  5K58 A;  4HZF A;  5HS7 A;  5LBQ A;  3G1L A;  1IXC A;  1JJ8 C;  2ZXH A;  3ABU A;  3VOE A;  1Z3Y A;  2LDU A;  1S7A A;  3BWG A;  3I58 A;  2PMZ A;  3RDI A;  4YIR X;  2QWT A;  2ADU A;  1R58 A;  4KNY A;  3GXO A;  2V79 A;  3E7Q A;  3NWS A;  4GFL A;  2UV1 A;  5C4J J;  3HTA A;  2NAZ A;  2EJR A;  1PJR A;  2QKO A;  4O3M A;  1B72 A;  4HYE A;  3ISP A;  2VJJ A;  4LK0 F;  2OUM A;  2KQR A;  3ZP5 A;  4A2U A;  4HF1 A;  2K9M A;  4KWA A;  1U6G A;  4U9N A;  3M8J A;  2ZFW A;  2B7E A;  2V26 A;  1FYK A;  3I4N J;  1FNN A;  3DXJ F;  2DOD A;  2L0K A;  4OIO F;  5JVG F;  2DN0 A;  1IRX A;  1SD6 A;  3L7W A;  3CTA A;  1UI5 A;  3BTJ A;  4F91 B;  3P9T A;  1VQL I;  1AHD P;  1HST A;  1VZ0 A;  3OMY A;  3VSL A;  4ZTF A;  3VIB A;  4WCG A;  2VT2 A;  2Z1D A;  5K5R A;  1V3F A;  2K02 A;  4NC8 A;  3DU6 A;  1QHH D;  2VXZ A;  5A2Q Z;  3L00 A;  1W1W E;  1ITY A;  4GDF A;  1SFU A;  2GWR A;  1B8I A;  2VJI A;  1V5E A;  2R7O A;  2XAF A;  2CU7 A;  1KGS A;  5BPD A;  5EEG A;  1ZRE A;  5HS8 A;  3EUA A;  1FWZ A;  1T95 A;  2PBI A;  1OCT C;  3BZ6 A;  2Y31 A;  4PXI A;  2QOP A;  1ETX A;  3DPL C;  3LA2 A;  3EET A;  1VQ7 I;  3OYJ A;  9ANT A;  1WJA A;  2DCE A;  3PNY A;  1UMQ A;  3JAM K;  4BEH B;  2KIU A;  3ZPL A;  3K2A A;  2E60 A;  3JRF A;  2DMQ A;  1W7P B;  3OS2 A;  3DEW A;  5DS9 A;  1O3R A;  2L9V A;  2KZG A;  2XRL A;  3JRI A;  3Q9V A;  4BBR J;  3ABK H;  2ZXI A;  1UZC A;  2ZCN A;  1WJF A;  1KYZ A;  1SFX A;  1FYM A;  2L01 A;  3CUO A;  2GLO A;  3OSF A;  2UXI A;  5KK1 A;  4AIK A;  3ZGK A;  3QOE A;  4R1H A;  3ZMV A;  3JCU C;  1XGM A;  4U88 A;  2EZL A;  2BYV E;  2FRH A;  5EJC A;  3O60 A;  4HBL A;  2AXT C;  3CJQ B;  5DCM B;  3ERM A;  3V4G A;  2UWM A;  2P5K A;  4CCM A;  3KP2 A;  4E4H A;  4N4N B;  4I2O A;  2R7R A;  4XLN F;  2P4W A;  4S0H B;  4XSX F;  1HW2 A;  2XAJ A;  3CWR A;  1ZRD A;  1YQA A;  2H6C A;  1LDJ A;  2PMU A;  2QWW A;  3FXM A;  3MEX A;  1IRG A;  3WGI A;  3SZP A;  3V6G A;  4AF5 A;  2DBB A;  3REO A;  3JSP A;  3PFI A;  3PIP F;  1FTT A;  5KHD A;  1MGT A;  2BBY A;  3GFI A;  2E1C A;  3DP7 A;  5L3G A;  2C6Y A;  1D1B A;  1WHU A;  2HI3 A;  2NVT J;  4M6X A;  2P7C B;  1IN8 A;  3C1D A;  3K6G A;  2H09 A;  1QZY A;  2HKU A;  3IP4 B;  4I7H A;  3DEU A;  3HTJ A;  4LOC A;  1WZ2 A;  1SFE A;  2RQQ A;  1WFX A;  2CJJ A;  1JJ6 C;  3AKZ A;  1MMS A;  1QRY A;  3KLO A;  2WAQ A;  4LD5 A;  3F8M A;  1Z91 A;  1T0F A;  3VPR A;  2LH9 A;  2WTE A;  3BHQ A;  4YZE A;  3FXO A;  2DFF A;  1K4S A;  2M34 A;  2KDO A;  4C3H J;  1DPU A;  1FX7 A;  1MBH A;  2Q1Z B;  2O8X A;  4UUT A;  3OYF A;  4S05 A;  1LE8 B;  2AS5 F;  1WQ2 A;  2P5V A;  2QEX I;  2V6C A;  3JRH A;  5FGM A;  3FK7 A;  3FM5 A;  4PK4 A;  4Q47 A;  2QKM B;  3CUQ A;  4GRI A;  2QYO A;  4RM3 A;  2L9S A;  2UXO A;  4OU0 A;  1U3E M;  1TT0 A;  1U78 A;  3BP8 A;  1FSE A;  3BCB A;  5B1B H;  2VB6 A;  5KAF C;  2GFN A;  2Y0S N;  4XKV A;  4EQQ A;  5HBU A;  3OSG A;  3KLN A;  5CQE A;  1SMT A;  3SXY A;  5DDG A;  1YRN A;  3LMM A;  2V7F A;  3JRE A;  4QPO A;  2R5Y A;  4LB5 A;  4A3K J;  5K7Z A;  5IP6 A;  1ZGW A;  1OFC X;  2KT0 A;  5L3E A;  3HTU A;  4M71 A;  2Z9O A;  2NRA C;  2IXS A;  2GQQ A;  3HPG A;  2FOK A;  3E7L A;  5LLQ A;  4OOI A;  3K7A J;  3SEZ A;  5LGT A;  4Y13 A;  3I55 I;  1ETO A;  4PJN A;  3DKX A;  4HX8 A;  2EIM H;  2EIN H;  4A5N A;  5D18 A;  3K2Z A;  2Z16 A;  3DLA A;  2FBK A;  4K2E A;  4PZJ A;  2M4G A;  5M5W J;  3HIF A;  3C2G A;  3WTU C;  3S3N A;  2V9V A;  4XON A;  4EVI A;  4DGW B;  1FPQ A;  2DDA A;  1X1C A;  2H8W A;  1WSU A;  3QWL A;  4G6D A;  3HOV J;  1UHS A;  2YU9 J;  4BXX J;  2WV1 A;  4M3E A;  2X6Y A;  1PP8 F;  5JR3 A;  2DG7 A;  1Y0U A;  2DG8 A;  3G7R A;  2Q2E B;  3ABL H;  4ZDP A;  5D5V B;  3DEE A;  5FRO A;  1XDS A;  4RGR A;  3A2K A;  3HXL A;  4DOZ A;  3GTP J;  1X3W B;  3G3Z A;  4XSZ F;  3O8H A;  3H9J A;  4MGR A;  3HRM A;  4PUS A;  1FBS A;  4ZYH A;  1I6H J;  4ON0 A;  3DTK A;  1J7K A;  3NI7 A;  2XGD A;  3Q5F A;  4JX4 A;  3NAU A;  3A1Y A;  2VLA A;  4R79 A;  1YI2 I;  5JVT A;  2P0W A;  1DQU A;  2XPW A;  3SFZ A;  3KZ9 A;  1GLN A;  4A3J J;  1Y56 A;  1R4N B;  5HOD A;  1G3S A;  1W0U A;  1FP1 D;  2NP5 A;  3QAH A;  4Y15 A;  2E1M B;  2OPT A;  2VBX A;  2O03 A;  3GW2 A;  3RCO A;  1E17 A;  1IXS B;  4AIJ A;  2IVM A;  1PYV A;  1S29 A;  3FMR A;  1ENH A;  3N05 A;  1ZEL A;  5TIS C;  1PUF B;  2LK2 A;  2GIZ A;  2W84 A;  2WAD A;  2P6S A;  3BG7 A;  1SMY F;  4RGS A;  2DA2 A;  3OL4 A;  5LRR A;  4V2G A;  3CJN A;  4J19 A;  2BV6 A;  2W25 A;  1GXQ A;  4P9F A;  2ZO4 A;  5AIQ A;  4B09 A;  2HNH A;  2ZME C;  3MKL A;  5IOZ A;  5K5O A;  2YX4 A;  3K9T A;  2MC3 A;  1IO2 A;  4E7J A;  2STW A;  3C3W A;  2EFO A;  1H9T A;  3JRC A;  2R93 J;  3KP5 A;  1GVJ A;  1I3A A;  5E1W A;  1R1V A;  2JUC A;  3GVA A;  3CZ6 A;  3PL8 A;  4OIQ F;  2NOG A;  5DCF A;  2L7Z A;  1WPK A;  5ED4 A;  2JA8 J;  1WJD A;  3EUH A;  4PFP A;  1GHC A;  3BCA A;  3Q0W A;  3MKW B;  1QVT A;  3NRV A;  3CMY A;  1FOW A;  4XLA A;  5GTH C;  4GCL A;  3OOU A;  4KIT B;  3J81 Z;  3SWH A;  2HU9 A;  3S93 A;  5BPI A;  3CC7 I;  2R7U A;  4Y7N J;  1DP3 A;  1I6X A;  4JP0 A;  3BZC A;  5E3N A;  2J5O A;  2VJ4 A;  1K4T A;  1JKO C;  3BTL A;  5CW8 A;  4CYC B;  1YS6 A;  3N97 A;  1GV2 A;  2WA0 A;  3WGH A;  3FMQ A;  2JQ7 A;  3LQR A;  2K9N A;  3BG9 A;  2DOA A;  4II3 A;  4FQG A;  3GX4 X;  1IN5 A;  3PQK A;  2HVS A;  2Q0O A;  2G7G A;  3F1B A;  1FIP A;  1BIA A;  1QZE A;  4E7I A;  1BJZ A;  5CXG A;  1ZHF A;  1JKQ C;  3I54 A;  4RM2 A;  4OD5 A;  2OV7 A;  3IH4 A;  2K4B A;  3J80 Z;  3CJD A;  5J6X A;  4IKF A;  1RZ4 A;  1T38 A;  2R7T A;  3ANP A;  1TWF J;  4RAF A;  4LB6 B;  3RPU A;  2VBZ A;  2VL8 A;  2Y30 A;  1OPC A;  2VE8 A;  4AC0 A;  1W0T A;  1EH8 A;  2IGM A;  3BR6 A;  4GXO A;  4CZC A;  3C7J A;  4UUS A;  3Q3S A;  2NS7 A;  5AON A;  3OIP A;  2BVL A;  1ZRC A;  2Z3Y A;  2X51 A;  3KP7 A;  3NWT A;  5FLX Z;  2FE3 A;  2WC2 A;  1A6I A;  4WK8 F;  3ULQ B;  5JLW A;  3FHZ A;  5FRM A;  3HG9 A;  2GUH A;  2HXO A;  5HLG A;  2DA7 A;  2JN6 A;  3HOS A;  1R9T J;  4CZZ A;  3IH2 A;  1J59 A;  1WJ5 A;  4M3B A;  5E79 C;  3F9K A;  2VKD A;  3H92 A;  4CIC A;  2ECC A;  1BOB A;  1YOV B;  2HXI A;  4KIS A;  2L7K A;  1ZGA A;  1BW6 A;  2DYS H;  4UVA A;  3QP5 A;  2IP2 A;  3IWZ A;  4XNF A;  3GTO J;  3CLQ A;  5DD8 A;  1JUM A;  1ETY A;  2JK3 A;  2YU3 A;  2ZXJ A;  3SFI A;  3W6K B;  2B9S A;  3PIO F;  1OQY A;  1ZTR A;  3LSJ A;  2FNA A;  3A03 A;  2X6X A;  2ZSH B;  3VVY A;  2E5N A;  2QQB A;  1S72 I;  1T39 A;  3CDH A;  5CJ9 A;  3WOD F;  2DK5 A;  4EV0 A;  3CF2 A;  1D0Z A;  1EH7 A;  2DXI A;  3KYC B;  3QBM A;  2IU5 A;  4G94 A;  1IDY A;  1WJB A;  3S32 A;  4LG0 A;  5F1J A;  2Z2S B;  3LSP A;  3PAS A;  5CYV A;  1V5F A;  2OC6 A;  1MJA A;  3CRJ A;  1FMV A;  2QSF X;  4BE1 A;  2MD5 A;  4CDG A;  1DDN A;  5E8I A;  2B0L A;  2G3B A;  1XCV A;  5J40 A;  2XUB A;  1IAW A;  1LKX A;  4R8H A;  4BXU A;  1IN4 A;  4V2F A;  1HBX G;  5FD6 A;  2W53 A;  1TZL A;  3KNW A;  1S8N A;  4PSW A;  3BR2 A;  4D7N A;  3BR3 A;  4G8X A;  3KET A;  3VWB A;  3LSK A;  4B43 A;  3VYU B;  1B4A A;  3BQY A;  3R6S A;  1BI2 A;  2HDW A;  1YX3 A;  2LC2 A;  5FKN A;  2HYF A;  1I1G A;  2LY9 A;  3HOT A;  3N4M A;  3WTW C;  3VW2 A;  4IRH A;  4KIC A;  4BYY A;  4P9U A;  1LDD A;  5AQC A;  1UCR A;  3M1C A;  2NNY A;  2STT A;  3TQN A;  4UUV A;  4L0Y B;  3O3K A;  3S1M J;  2PFV A;  3K0L A;  3BQZ A;  3WTY C;  2L2O A;  3DPT A;  2A69 F;  5JHU A;  3VEP A;  1XSV A;  2JA7 J;  1HC8 A;  3ON2 A;  2EIJ H;  1HKS A;  2IS2 A;  4ZJZ A;  3H0G J;  4IHT A;  1QU3 A;  4FE4 A;  1I5Z A;  4X1E A;  4EJV A;  3PSF A;  1HDP A;  1SAU A;  3U1K A;  3PJR A;  1FJL A;  1TC3 C;  1E3P A;  3KE2 A;  3EUP A;  4Y17 A;  1R1U A;  1FC3 A;  2HYG D;  4L9T A;  1WCM J;  3RZO J;  1QA6 A;  1UJ8 A;  1R5G A;  5E3O A;  2K5C A;  1YIT I;  1MSE C;  4XOT A;  1F1Z A;  4H4K C;  1J09 A;  4Y3O A;  1P7J A; 
#chains in the Genus database with same CATH homology
 3I4N J;  4NDL A;  3GTJ J;  3C2B A;  1WGX A;  2DA3 A;  2FD5 A;  1IG7 A;  3RH2 A;  2L0K A;  1B72 B;  2DMU A;  2ZOZ A;  2RHA A;  3ZQH A;  4FE7 A;  2DN0 A;  2AO9 A;  1UI5 A;  3BTJ A;  1CQT A;  3M4O J;  3P9T A;  1AHD P;  1IUF A;  3VIB A;  3CCY A;  2ZCM A;  4DYC A;  3CDL A;  1YRN B;  1ETQ A;  5E3L A;  1K61 A;  2REK A;  2R5Y B;  3HOZ J;  2YVH A;  1ITY A;  5IP9 J;  2DJN A;  1B8I A;  3HEF A;  2JA6 J;  3G56 A;  3HOW J;  5FHP A;  3AQT A;  4IHW A;  3ZQI A;  2CU7 A;  2M0C A;  3HOU J;  5EGO B;  5HSZ A;  2LR8 A;  4AC6 A;  3ZOB A;  2QIB A;  1JT0 A;  1Q1V A;  2MSY A;  3V78 A;  4JX6 A;  3IH3 A;  1OCT C;  2E19 A;  2Y31 A;  1P7I A;  2PZ9 A;  4MFD A;  2QOP A;  1ETX A;  4PXI A;  2LD5 A;  1BA5 A;  3EGQ A;  9ANT A;  2G7S A;  1B8I B;  1UMQ A;  1IJW C;  4A3G J;  3K2A A;  3JRF A;  2DA1 A;  2DMQ A;  3CQZ J;  3BR5 A;  3DEW A;  5F04 A;  5DS9 A;  1T56 A;  2XRL A;  3JRI A;  4UDS A;  2NVX J;  3VOK A;  1HF0 A;  1LFB A;  3LOC A;  2XPU A;  4BBR J;  4B1R A;  3HTH A;  5IYB J;  3KKD A;  2HDD A;  3NRG A;  1JTY A;  2ZCN A;  2ELK A;  4I76 A;  1XS9 A;  3B81 A;  5EFY A;  2O7T A;  2GLO A;  5EG0 B;  3OSF A;  2UXI A;  2LVS A;  5C4Y A;  3C07 A;  2EZL A;  2X9D A;  4L5E A;  3O60 A;  4XID A;  1HCR A;  4M6V A;  3S1R J;  2XSD C;  1TWC J;  4S0H B;  1K83 J;  1SGM A;  2MW8 A;  3CWR A;  2OER A;  1ZK8 A;  2WB1 N;  5EEA A;  1BL0 A;  4ACI A;  3PO3 J;  2PMZ N;  3ZQG A;  3HB9 A;  4A3C J;  4DW6 A;  2KDZ A;  4A69 C;  3V6G A;  4AF5 A;  2JMW A;  1F43 A;  2R5Z A;  2UXP A;  4CGR A;  1FTT A;  1H88 C;  2CQX A;  5M3M J;  1NTC A;  3NXC A;  4ICH A;  2JWT A;  2HI3 A;  3SJM A;  2NVT J;  1IDZ A;  2HKU A;  3KKC A;  2DMN A;  3HTJ A;  4LOC A;  1SAN A;  3QPS A;  4DZJ A;  4DYQ A;  1VND A;  1HDD C;  2HOS A;  2CJJ A;  2GEN A;  1JJ6 C;  1RPW A;  2Y2Z A;  3GTK J;  1XG1 A;  1QRY A;  5K7F A;  1SFO J;  4JL3 A;  4M3G A;  5F08 A;  4FTH A;  4JNN A;  4L62 A;  3BRU A;  3LJL A;  2TCT A;  3VPR A;  3A02 A;  3T6N A;  3BHQ A;  2JJ7 A;  1MBK A;  4D5F A;  4YZE A;  5FMP A;  2M34 A;  2XGC A;  4C3H J;  1QPI A;  4A3B J;  1MBH A;  3LWJ A;  3S14 J;  2OI8 A;  4UUT A;  4RBO A;  1LE8 B;  4GCT A;  2X6O A;  3JRH A;  2RAS A;  2DA4 A;  4RDU A;  3FK7 A;  5M5Y J;  2YVE A;  2ZCX A;  3S16 J;  3HBL A;  2UXO A;  4MLO A;  4EEF G;  3LSR A;  1TWH J;  1DU0 A;  1GV5 A;  2G0E A;  5FGL A;  1U78 A;  2M2E A;  1QVU A;  3VOX A;  2K40 A;  2GFN A;  2Y0S N;  5J1R A;  1U8B A;  2O9L A;  1ORK A;  5HBU A;  3OSG A;  2O8K A;  5K7H A;  1YRN A;  3RZD J;  3BR0 A;  3JRE A;  3DCF A;  3FK6 A;  1ETW A;  2R5Y A;  1TWA J;  2F07 A;  2GM4 A;  4A3K J;  5K7Z A;  5IP6 A;  1ZGW A;  1OFC X;  2KT0 A;  5IPA A;  2LP0 A;  4IHV A;  3WHC A;  1MH3 A;  2N8G A;  3HOY J;  1Y1V J;  5EGO A;  3TP0 A;  3ZQL A;  5FKL A;  3E7L A;  3G1M A;  3K7A J;  2JA5 J;  5D19 A;  2ME0 A;  1ETO A;  2CRG A;  5F0F A;  5D18 A;  5J1U A;  2K9S A;  1NK3 P;  3FKI J;  5M5W J;  2MG4 A;  1JGG A;  5C44 J;  3S17 J;  1O4X A;  5EZH A;  5EF6 A;  4XRS A;  3FRQ A;  2I10 A;  5EG0 A;  3S1Q J;  1JT6 A;  5IP7 J;  1POG A;  3G1O A;  1UHS A;  1H89 C;  1E3O C;  2YU9 J;  3HOV J;  4BXX J;  1MNM C;  4DZP A;  2WV1 A;  4M3E A;  3TED A;  4X6A J;  2DG7 A;  1IC8 A;  2CUE A;  4UUS B;  2DG8 A;  1DU6 A;  3G7R A;  4JKZ A;  2E2I J;  2OF7 A;  3PM1 A;  2WAQ N;  1JUS A;  1IGN A;  5DAJ A;  4MXM A;  3GTP J;  5IYD J;  5FLM J;  3PO2 J;  3O8H A;  3JR9 A;  3GZI A;  4NEL A;  5EDN A;  1I6H J;  4DYR A;  5IYC J;  3BJB A;  3NI7 A;  1WH5 A;  2XGD A;  4JX4 A;  3NAU A;  1FEX A;  3LSG A;  2YUS A;  4G12 A;  2XPW A;  2QF7 A;  3KZ9 A;  5JLX A;  4A3J J;  5HOD A;  1RR7 A;  5FLV A;  3LHQ A;  1W0U A;  2HOT A;  2EZH A;  4A3M J;  2NS8 A;  2CQQ A;  5M3F J;  2NP5 A;  5IOY A;  2COB A;  4W97 A;  3GTQ J;  2OPT A;  1WH7 A;  3DPJ A;  3VW1 A;  4MIM A;  1FIA A;  1F36 A;  3VVX A;  3TP3 A;  1ENH A;  2LLK A;  4FCY A;  1PUF B;  3BCG A;  3HTI A;  1NK2 P;  2H1K A;  2LK2 A;  5F27 A;  1X2N A;  2WGB A;  2L7M P;  3JSJ A;  2DA2 A;  2W48 A;  2M9H A;  1MBJ A;  2FJ1 A;  1UG2 A;  2MGQ A;  2YS9 A;  3QQA A;  4JX5 A;  4V2G A;  4J19 A;  1LE8 A;  2GBY A;  3JRG A;  4BKX A;  3MKL A;  5IOZ A;  2ID3 A;  5D1R A;  2HYJ A;  5EZG A;  3A01 B;  4A93 J;  3MNL A;  3Q0U A;  3S1N J;  2IEK A;  3IUV A;  1MH4 A;  3JRC A;  2R93 J;  4A3I J;  1S7E A;  2NOG A;  4Y52 J;  2VUM J;  3TW7 A;  2L7Z A;  1WPK A;  3MN2 A;  3TW6 A;  2JA8 J;  1G2H A;  4MO7 A;  4HNV A;  5HAW A;  3Q0W A;  3HOX J;  2PBX A;  3GTG J;  1QVT A;  4HKU A;  3HE0 A;  3CMY A;  3BTI A;  1RES A;  4GCL A;  3HM5 A;  3OOU A;  3RQI A;  4BY7 J;  2RAE A;  3BR1 A;  4FIS A;  3BG3 A;  4D5C A;  4XRM A;  2EBI A;  1ZKG A;  3SDG A;  2EH3 A;  4B4C A;  4Y7N J;  4JP0 A;  2EZK A;  5E3N A;  2UXU A;  2TRT A;  1AKH A;  5FKM A;  3S15 J;  2ID6 A;  2IAI A;  4XK4 A;  3BTL A;  2O7O A;  4CYC B;  1JKO C;  5CW8 A;  1GV2 A;  4IHX A;  1X2M A;  2K9N A;  2XB0 X;  2Y9Y A;  3BG9 A;  2QTQ A;  5J3L A;  2DA6 A;  4QSH A;  3ZQC A;  1OJL A;  5C3E J;  2DMP A;  3RKQ A;  2G7G A;  3F1B A;  1FIP A;  1AKH B;  1ZQ3 P;  2P81 A;  4IEJ A;  1LFU P;  4BBS J;  3S2D J;  1BJZ A;  5CXG A;  1JKQ C;  3HGY A;  3VW0 A;  2ZB9 A;  2D6Y A;  3IH4 A;  3JRB A;  3W6V A;  1ZR4 A;  3COL A;  3CJD A;  1MBE A;  3S2H J;  3QPL A;  2XPV A;  2NVY J;  3FIS A;  2AHQ A;  2Q24 A;  2M8G X;  2D5V A;  3GTM J;  3LNQ A;  3ANP A;  4JYK A;  3O8G A;  1OCP A;  1TWF J;  4QTR A;  1VFC A;  2WUI A;  1HOM A;  2VPR A;  3HKZ N;  1Z0X A;  1U9N A;  1Z77 A;  1ZR2 A;  4M3D A;  2Y30 A;  3HGG A;  2LTP A;  2L7F P;  1GT0 C;  2NX4 A;  4AC0 A;  5J1Y A;  1IV6 A;  1APL C;  4ABZ A;  3F0C A;  1ETV A;  5M5X J;  1GVD A;  1W0T A;  4D7M A;  2K9Q A;  3BR6 A;  4C3J J;  4A3F J;  1I3Q J;  4UUS A;  3Q3S A;  2NS7 A;  2DTZ A;  3HDD A;  1ETK A;  1VF9 A;  1UI6 A;  2G7L A;  1JUP A;  2H8R A;  1A6I A;  2FQ4 A;  4AYB N;  2FX0 A;  5EYR A;  5JLW A;  2Y9Z A;  2GUH A;  2HXO A;  3I4M J;  5GPA A;  2DA7 A;  2JN6 A;  1R9T J;  2E2J J;  3IH2 A;  5FKO A;  3GTL J;  3BTC A;  3B6C A;  4M3B A;  2FBQ A;  4NN1 A;  2ECC A;  2HXI A;  2DA5 A;  1HLV A;  3GBG A;  3UKG A;  1BW6 A;  3GTO J;  4ME9 A;  1JUM A;  1ETY A;  3MVP A;  3NNR A;  1T33 A;  2JK3 A;  1U9O A;  3SFI A;  1EF4 A;  4M3F A;  2NVQ J;  1ZTR A;  3LSJ A;  3A03 A;  3Q0V A;  4AUX A;  1BW5 A;  3VVY A;  5F0H A;  5F0C A;  2DMT A;  1GDT A;  2XDN A;  3S5R A;  3IV5 A;  3NAR A;  2IU5 A;  3JRD A;  2XB5 A;  1IDY A;  3QBM A;  3BNI A;  1I50 J;  2NP3 A;  1PUF A;  3WHB A;  5F1J A;  4B3A A;  3LSP A;  3PAS A;  3FIW A;  1JKP C;  1RKW A;  3CRJ A;  3M3Y J;  5FKK A;  3H3V K;  2LFB A;  2G3B A;  1X58 A;  2CUF A;  5DTD A;  2VKV A;  4GCK A;  2LKX A;  4BY1 J;  3VVZ A;  3BT9 A;  2VKE A;  3RD3 A;  5H9T A;  3A01 A;  4V2F A;  4A3E J;  2HOA A;  5FJ8 J;  2W53 A;  2R0Q C;  3KNW A;  4C3I J;  1JTX A;  3NPI A;  1D5Y A;  4QIW N;  3BR2 A;  4D7N A;  3BR3 A;  3HIM A;  5E3M A;  5CXI A;  3QKX A;  3AQS A;  4A3D J;  2B63 J;  4XIC A;  1MSF C;  3BQY A;  3ZQF A;  2ZOY A;  1Y1W J;  5FKN A;  2VI6 A;  2QCO A;  5GP9 A;  2L9R A;  2LY9 A;  5GPC A;  1GUU A;  3B6A A;  3VW2 A;  4GFB A;  3VP5 A;  4A3L J;  5C4X J;  1VI0 A;  5AQC A;  3JRA A;  5BNG A;  2EZI A;  1H8A C;  2ECB A;  2X48 A;  3ON4 A;  2ME6 A;  2R5Z B;  1IRZ A;  3S1M J;  2E2H J;  1AU7 A;  2HQ5 A;  1WI3 A;  4CYC A;  4IHY A;  3BQZ A;  4XRS G;  1RET A;  1FTZ A;  2V57 A;  2JA7 J;  3ON2 A;  1RKT A;  2HYT A;  3PPB A;  1TWG J;  3VUQ A;  3BG5 A;  2XGE A;  1JKR C;  2R7Z J;  4MK6 A;  4MFE A;  3D1N I;  4C2M J;  5K58 A;  3H0G J;  3GEU A;  4I6Z A;  4W1U A;  4FE4 A;  2E1O A;  3G1L A;  1A5J A;  2UXH A;  1JJ8 C;  1XC5 A;  3ANG A;  4X1E A;  2QWT A;  1HDP A;  4GFK A;  3OIO A;  1MBF A;  4GFL A;  1FJL A;  2EQR A;  3E7Q A;  5C4J J;  1TC3 C;  3EUP A;  3HTA A;  2QKO A;  1B72 A;  3L1P A;  1WCM J;  3RZO J;  2IBD A;  5E3O A;  4KWA A;  2R92 J;  1MSE C;  1MBG A;  1P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...