3BQZA

Crystal structure of the complex of malachite green bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3bqzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bqzA02
3DEWA 5E3NA 3A01A 4D5CA 4BY7J 1HDDC 1QVTA 2E19A 2I10A 3BTJA 3LWJA 2JA8J 5D18A 3BR0A 3ZQIA 5M3FJ 1Z77A 3CWRA 3Q0WA 1PUFB 5M5WJ 1I6HJ 3LOCA 3FRQA 3D1NI 4M3BA 3FIWA 1LE8B 2NS8A 2REKA 4S0HB 4A3KJ 3HOWJ 3BR3A 1ZK8A 2EZIA 2D6YA 2ZOYA 3CJDA 4XRSA 1FEXA 3HGYA 3F0CA 2VPRA 4A3IJ 3PASA 2HXOA 2DG7A 5E3OA 4G12A 3QKXA 3VW1A 2Y2ZA 5J1UA 1UG2A 4X1EA 1WPKA 1IGNA 1I3QJ 3G1MA 3ZQLA 2G7SA 1GUUA 1MBGA 2L7FP 2NOGA 2HI3A 1JKRC 2YVEA 5J1RA 1QRYA 1ETYA 2GLOA 2VUMJ 2AHQA 5CW8A 1APLC 2E2HJ 2OPTA 2DMQA 4GCKA 2QTQA 1K83J 4MFEA 4C2MJ 4UDSA 2GBYA 4I76A 3BTLA 1VFCA 1H88C 3JRBA 4M3GA 1T56A 4JKZA 3VOXA 3C2BA 2X48A 3IH4A 4BXXJ 2GUHA 3S5RA 1HCRA 2P81A 2RAEA 1JUPA 5FKNA 2HOSA 1EF4A 3JRIA 3C07A 1H8AC 2QKOA 1RR7A 3CMYA 3PM1A 4A3EJ 2WV1A 2LP0A 1XS9A 2R0QC 1FJLA 1GV5A 1JJ6C 1VNDA 2JMWA 4UUSA 3ZQCA 2NX4A 1MH3A 2DA2A 4ACIA 3O60A 5C3EJ 2JWTA 3OSFA 1HF0A 3FK7A 3HTIA 5F0FA 5EG0B 3ON2A 3SDGA 3S14J 2DMTA 4LOCA 2R5YA 3BCGA 3EGQA 2ID3A 1NK3P 5C4YA 2XGEA 2IU5A 1X58A 2XSDC 5IYDJ 3BRUA 3JSJA 2EZKA 1D5YA 5IOZA 4QTRA 3BQZA 1RETA 4I6ZA 3VP5A 1VI0A 5EGOB 3HEFA 3VPRA 2DTZA 2R5ZA 4C3IJ 1ORKA 1F43A 2CUEA 4M3DA 2W48A 2D5VA 5F1JA 4XRMA 3RH2A 5EZHA 4IHWA 4L5EA 2O7OA 1UHSA 4M6VA 3OSGA 2TCTA 2QCOA 2B63J 2LTPA 3RQIA 3M3YJ 4BY1J 1JTXA 5IP9J 1RKTA 3COLA 2HKUA 3B6CA 3O8GA 5IOYA 1PUFA 2FBQA 1WCMJ 1X2MA 4A3DJ 3NNRA 4D7NA 5FMPA 1MSEC 3NAUA 1LE8A 1H89C 2EZHA 3TW7A 4NELA 1WGXA 3LSPA 1FIPA 3NXCA 3IUVA 1BW5A 5F0CA 1BJZA 1OCTC 2M2EA 4GFBA 1JUSA 3Q0UA 5JLWA 5EZGA 1FTTA 1ETWA 5F27A 4XICA 3KNWA 3MNLA 2M9HA 1MBEA 4BBRJ 4DW6A 3EUPA 1XG1A 3GTJJ 2YVHA 2NVQJ 1MH4A 2UXIA 2K40A 2E2JJ 1R9TJ 3HIMA 1RPWA 2L7ZA 1IC8A 2G7LA 3BG9A 2CU7A 5EEAA 3TP3A 4M3EA 1FTZA 2WGBA 2ZCMA 2UXPA 2JA6J 2Q24A 3VW2A 4EEFG 1MBJA 3ZQHA 5F04A 1JKQC 2HXIA 1IDZA 4HKUA 3QBMA 5GP9A 3HKZN 1NTCA 2WUIA 2XGDA 2Y9ZA 3HE0A 2KT0A 4NDLA 3S2HJ 2MSYA 4XRSG 3VW0A 3HOZJ 5FKMA 3BNIA 3GTGJ 4JX5A 2FX0A 3CQZJ 4DYQA 1DU0A 4DYRA 1LFBA 1YRNA 2IEKA 3RZOJ 3BG5A 1XC5A 4YZEA 3TEDA 1B8IB 3BG3A 2IBDA 1G2HA 1OJLA 1F36A 2NVYJ 5M5XJ 4XIDA 1B72B 1MBKA 3HOVJ 2LY9A 5K7HA 4XK4A 5J3LA 1LFUP 3MN2A 2FJ1A 5AQCA 4IEJA 2L7MP 2O8KA 3BT9A 5J1YA 2GFNA 2NS7A 4FE4A 2AO9A 2CJJA 3FK6A 1AKHB 3I4MJ 3JR9A 3BR6A 2X6OA 2NP3A 3GEUA 1TWGJ 2DMPA 4W97A 3ZQGA 1SGMA 3PO3J 1QVUA 2ID6A 4GCTA 2DA3A 4QSHA 3Q0VA 3JREA 1ZGWA 5EDNA 2N8GA 4A3MJ 3E7QA 4JL3A 3VVXA 3BTIA 5HODA 5EGOA 3OIOA 3B81A 5FJ8J 1IJWC 2CRGA 2TRTA 3KKCA 3S1MJ 2DN0A 1WI3A 3JRGA 3I4NJ 5HSZA 2DA5A 4FTHA 4AF5A 1ETXA 1JGGA 2VKVA 3V6GA 1GV2A 1Y1WJ 1JTYA 2RASA 5K7FA 3M4OJ 2JJ7A 2RHAA 4ICHA 3VOKA 2UXOA 2CQXA 4JX6A 2UXUA 4GCLA 5FGLA 3GBGA 2NVXJ 4UUTA 5K58A 3NRGA 4A3BJ 2LLKA 4MO7A 4CYCA 1WH5A 2IAIA 2XB5A 3ANPA 2ELKA 3K2AA 1ZTRA 3E7LA 1TWAJ 4BKXA 3JRCA 2L0KA 2ZCNA 1ITYA 3IV5A 1RESA 2G3BA 1Y1VJ 3DCFA 5EYRA 5BNGA 1POGA 1X2NA 3VVYA 1MBHA 2M0CA 2DA7A 3KKDA 4AC6A 5EF6A 2HDDA 1TWHJ 3MKLA 2Y31A 1QPIA 3GTKJ 3JRDA 1JKPC 3G1OA 3UKGA 4MFDA 3WHBA 1IDYA 1U78A 5EFYA 2FD5A 4V2FA 3B6AA 1GT0C 1T33A 4L62A 5JLXA 2WB1N 4D5FA 1ETQA 1K61A 3HTJA 2YS9A 3LHQA 4IHVA 5GPAA 2EQRA 3W6VA 3SJMA 3NPIA 3JRHA 4A3LJ 1SANA 2L9RA 3GTOJ 4Y52J 5DAJA 4RBOA 1B8IA 1ETOA 5GPCA 5DS9A 5HBUA 2DA6A 5IP7J 1B72A 1BA5A 2W53A 2GENA 1JJ8C 2JN6A 2VKEA 3G1LA 3ZQFA 1JUMA 4D7MA 5F0HA 3VIBA 5FLVA 4CGRA 3LNQA 4JNNA 2MG4A 1UI5A 1AHDP 1AKHA 1BL0A 1NK2P 2LFBA 3S1NJ 3IH3A 3GZIA 2H1KA 2XB0X 5FHPA 3HOYJ 4B1RA 2EBIA 1BW6A 2ME6A 3JRFA 2H8RA 2Y9YA 4AYBN 2R5YB 5FKOA 2OI8A 4DZPA 3QPLA 3A03A 3RZDJ 3HB9A 3S1QJ 1MBFA 2ZOZA 2JA7J 1IG7A 2QWTA 3NI7A 2XRLA 2Y0SN 4BBSJ 3HBLA 5IYCJ 3HDDA 3S15J 3F1BA 3S1RJ 1TWFJ 2LK2A 4AC0A 4ME9A 1P7JA 2YUSA 2PMZN 4NN1A 4Y7NJ 5D19A 2ZCXA 5D1RA 2HYJA 1O4XA 3S16J 1TWCJ 3IH2A 1P7IA 2XPWA 2K9QA 1A5JA 2JK3A 2YU9J 2Y30A 4FE7A 4PXIA 2JA5J 4GFLA 3HM5A 4MXMA 3BJBA 2CUFA 2MW8A 4M3FA 4HNVA 1FIAA 5EG0A 3L1PA 4DZJA 1ZKGA 2LR8A 4DYCA 1ZR4A 4J19A 1MNMC 3HGGA 1W0UA 2EZLA 5M5YJ 1ETKA 3GTLJ 2NP5A 4B4CA 3QQAA 3VUQA 4FISA 1SFOJ 2QIBA 4A3JJ 2G0EA 5IP6A 3VVZA 5DTDA 3V78A 2DMNA 3G7RA 2HQ5A 3A02A 1UMQA 4MLOA 1HLVA 2ECCA 3GTPJ 3TP0A 4AUXA 3S17J 3MVPA 1HOMA 1ETVA 1OCPA 3WHCA 3HTAA 1DU6A 5FKLA 5FKKA 2PZ9A 1RKWA 2OERA 3OOUA 2K9SA 3RKQA 2KDZA 2NVTJ 5H9TA 3A01B 2ECBA 3ON4A 4B3AA 3KZ9A 2M34A 1JT6A 2V57A 1I50J 3AQSA 2XGCA 1JT0A 9ANTA 4A69C 3BR1A 3TW6A 2MGQA 5FLMJ 2R92J 2G7GA 3HTHA 5K7ZA 1A6IA 5C4XJ 1YRNB 2XPVA 1Q1VA 2FQ4A 4A3FJ 2DA4A 2DA1A 1WH7A 3AQTA 4V2GA 2LD5A 1U9OA 1JKOC 2DMUA 2ME0A 2R7ZJ 3FISA 1ENHA 3P9TA 4KWAA 4JP0A 3T6NA 5HAWA 3HOUJ 1U9NA 2HYTA 2GM4A 3PO2J 1Z0XA 5CXIA 2EH3A 1ZR2A 3DPJA 4ABZA 4GFKA 5E3MA 2WAQN 4X6AJ 3LSJA 2R93J 3S2DJ 1AU7A 3GTMJ 3RD3A 2O7TA 1E3OC 1W0TA 1S7EA 3BQYA 3SFIA 2X9DA 3H0GJ 4RDUA 1GDTA 1IRZA 2COBA 4MK6A 3H3VK 3Q3SA 3GTQJ 1UI6A 2K9NA 3G56A 2HOTA 4QIWN 2M8GX 5CXGA 4A93J 2ZB9A 4JYKA 3LJLA 1CQTA 2E2IJ 1GVDA 3CDLA 3QPSA 2DJNA 1TC3C 4IHXA 4A3CJ 2LVSA 2PBXA 2HOAA 4MIMA 1OFCX 1IUFA 4C3HJ 1IV6A 3ANGA 4UUSB 3BR2A 3BR5A 5F08A 2F07A 4IHYA 3NARA 5M3MJ 4CYCB 2LKXA 3O8HA 3JRAA 1U8BA 4C3JJ 3ZOBA 3PPBA 3BHQA 4JX4A 5IPAA 5C4JJ 2CQQA 2QF7A 3LSRA 5C44J 1VF9A 2VI6A 4FCYA 2OF7A 3BTCA 5IYBJ 3LSGA 2XDNA 1HDPA 1MSFC 4W1UA 3CCYA 2E1OA 2XPUA 2DG8A 2R5ZB 4A3GJ 3CRJA 2QOPA 3FKIJ 5E3LA 3K7AJ 1ZQ3P 2O9LA 3HOXJ 2UXHA
chains in the Genus database with same CATH superfamily
4HX8A 1T6SA 5E3NA 2X1DA 3I3LA 4RMNA 2LY1A 3OS0A 2CWEA 1L0OC 1FX7A 3FXOA 3R0JA 4IF4A 2BY3A 2CGPA 2KHMA 4NBQA 3H5RA 3ONQA 3FRQA 1G59A 4ZYAA 3DBHB 3CCJI 1LE8B 3DKXA 3WU1B 3FHZA 3GFIA 3HOWJ 1T98A 2JTVA 2EZIA 4NQWB 2D6YA 1K78B 2VPRA 4KMUX 3CCVI 2DG7A 5E3OA 4E6KG 1RRJA 1D1CA 3B02A 1X4PA 1EKEA 3K2ZA 4G8XA 1O3QA 1I3QJ 3HXLA 3ZQLA 1IGNA 5TRDA 4R79A 2HI3A 2NRAC 2EINH 1ETYA 3H3ZA 2VUMJ 5CW8A 5BS6A 1MNDA 1PJRA 1APLC 2MYSA 3QYBA 3IL2A 2X1EA 2BBYA 4MFEA 2XRNA 2EFNA 1I6XA 4OMYA 4JK1X 1FLIA 3K4NA 1VFCA 1PDNC 1RI7A 4M3GA 4JKZA 1IXSB 3DXJF 1NHAA 3ZMDA 3H3UA 3K10A 2XC7A 2LY2A 2RN7A 2L4MA 2RAEA 3ZXSA 4EM0B 1JUPA 5FKNA 1P4AA 3ABUA 1ZELA 1R1UA 1OCCH 2KJCA 4NB5A 2WV1A 5CVUA 4FASD 3VDXA 1KU7A 1FJLA 3W2VA 1GV5A 1J5YA 3BPXA 2A05A 3ZQCA 2R7TA 2DA2A 1ON1A 3CCQI 3O60A 5C3EJ 4OIOF 1XMXA 2JWTA 2WADA 3CCEI 1ZRDA 3ON2A 1FMWA 1F4KA 2R7DA 3EGQA 3VYRB 2EFWA 4A0XA 1X58A 2R7FA 5LBQA 5IYDJ 1G3YA 3O2PE 2R7OA 1R36A 5EGOB 2DTZA 1RUNA 3TO9A 2CV2A 5F6FA 1F43A 1KYZA 4M3DA 3MD2A 2D5VA 2LBFB 3WTUC 2OTJI 1YI2I 3LQQA 4IO9F 1IRFA 3HZJA 3OSGA 1FWZA 2RV8A 2C6YA 1OQYA 3L2RA 3RQIA 3M3YJ 4AWXB 2XKOA 4DBRA 1UZCA 1CF7B 2DAOA 1WCMJ 1X2MA 3TOBA 3BDDA 4C30A 3NAUA 1H89C 3F3XA 2EZHA 3TW7A 3CMEI 4NELA 3LSPA 1ZRCA 3W3CA 5F0CA 2ZJRF 3G4SI 2A2FX 2M2EA 5LRRA 3OY9A 3MNLA 1ETWA 4XICA 3OIQA 2M9HA 4DW6A 3GTJJ 3L09A 4HF0A 3BPVA 3CMAI 2UXIA 2CV0A 3HHGA 4PJJA 5DCMB 3V7CA 2VC0A 2CU7A 2WGBA 2KJBA 2JA6J 2Q24A 4EEFG 4IJAA 4ENJA 3HHHA 4HKUA 3A4CA 4B8XA 1G3WA 4MNUA 2YPRA 2WUIA 2KT0A 4UUVA 3S2HJ 3CF2A 1TQIA 3Q9VA 4XRSG 4CZZA 3JAMZ 3HOZJ 3OOPA 2L02A 3GTGJ 4H4KC 3CQZJ 3WU2C 4DYRA 1YRNA 3RZOJ 4YZEA 3TEDA 4NUBA 2KQRA 2IBDA 4XIDA 1XB4A 3HOTA 5K7HA 2DBBA 4XL9A 3WG7H 3EYYA 3NEUA 3SFZA 4V19K 4UVBA 2DT5A 4E7JA 2DOEA 5AQCA 2ZY9A 4IEJA 2V1NA 4PZJA 1WZ2A 1UJ8A 1B1BA 4DJAA 4FE4A 2XAUA 4HDVA 2KMUA 1TWGJ 2K4BA 3ZQGA 1SD7A 3CP8A 1YLFA 4Y3OA 3IWZA 3RYRA 3NRVA 4BJ5C 2DW4A 3CDHA 1S5LC 5J8CA 1OR7C 4WK8F 1O7LA 4G6TB 1ZGWA 2N8GA 2BHZA 5D8LB 1WFXA 4A3MJ 2HNHA 3HPHA 1OCZH 3R61A 3DPTA 3PIPF 3IAM2 5IT3A 3B81A 3I4NJ 4BE0A 1OCOH 2XIGA 1ETXA 1JGGA 2M1BA 2DU9A 1DQUA 3BCBA 2B3WA 3U1DA 2CUJA 2GIVA 1KU3A 1NG6A 3ZMZA 5D5WB 2HPIA 3CC2I 4UV8A 2JJ7A 4BE2A 3ZQQA 3CUQA 2Y48A 2RREA 3L9FA 4M73A 4ICHA 3VOKA 2UXOA 2CQXA 2IXSA 4GCLA 2E1NA 2NVXJ 4YFKF 5FLXK 5K58A 4OIRF 1R22A 1WH5A 3JTHA 4F93B 1YO5C 1G6NA 3ZCOA 2ELKA 2MLKA 1ZTRA 3E7LA 1V4RA 3I54A 4BKXA 4L0ZB 3ZGKA 4LJZF 4IPAA 3RIRA 2ZCNA 1RESA 3KP3A 4E7HA 3KCCA 2R7RA 2TDXA 1POGA 2M0CA 4BDYA 3KKDA 4XKWA 5DM7F 1XSDA 1D3YA 5EF6A 5E20A 1TWHJ 4G7HF 4YIFA 2E34A 3G3ZA 3UKGA 1D0YA 1IDYA 3HRMA 3LSKA 1U78A 2IP2A 2OU2A 4V2FA 3BJ6A 5E8GA 5KVRA 1GT0C 3BROA 2BY1A 1YW8A 5HDGA 1MGTA 3HSEA 1ETQA 2ZFUA 1R58A 4PFPA 4U7BA 3LA2A 2VE9A 3ZMSA 1LNWA 2RKHA 2PEXA 2PMUA 3PUBA 3W6VA 2P5VA 4A3LJ 5DAJA 2L9RA 4Y52J 1HW2A 4FX0A 1D8JA 2ZKZA 5JFRA 3H36A 3RJPA 4HV6A 3AL0B 3FXJA 3RKWA 2K86A 3ZQFA 3BG7A 2V9VA 1I5ZA 4D7MA 3VIBA 2VBZA 2W7NA 4JNNA 4HV5A 1QZEA 4ETSA 3SYTA 2F2EA 1AHDP 1BL0A 3GZ5A 2LFBA 5JHUA 3IH3A 3GZIA 3P9KA 2H1KA 1I1GA 2UXXA 3ULQB 2V4JC 1XMKA 2BZTA 4KIGA 4D1QA 1G4DA 2JUGA 2Y9YA 5FKOA 3BJAA 1PYVA 3RPUD 3KLOA 4DZPA 1Z6RA 1PVEA 4KJZA 3IHUA 2FNPA 2O8XA 2RQQA 3HB9A 3PNVA 2HDCA 3K4CA 1N77A 5H2FC 2LNBA 3DTIA 1B9MA 1IG7A 2QWTA 5GTHC 4BBSJ 3ASOH 4BL0B 2F5CA 1S72I 2B7EA 3F1BA 1V5FA 3DEEA 3E5QA 3KZZA 4LIVA 4AC0A 2CQKA 2YUSA 4KT6A 3QAHA 1R00A 2F4OB 4XLCA 4PGHA 2MD5A 1E0EA 4Y7NJ 5LFAA 2HYJA 2YVXA 3PNYA 2GIZA 2E71A 2LOOA 3CJNA 1ZH5A 2W82A 4II2A 4UNOA 5GAHJ 3FKJA 2JA5J 4PJNA 4GFLA 4EGYA 1HQCA 4IRGA 2MW8A 4M3FA 2CFXA 2P5LC 3DLLF 2EIMH 3L1PA 2ELHA 2LR8A 2GAUA 2HFHA 5F1RA 1VQ6I 2COMA 5CYVA 4PSWA 4BEHB 3HJEA 4LLGF 2EZLA 3LFKA 5E1XA 4B44A 4LITA 4FETA 2VL8A 3VUQA 2D45A 3R0AA 4LIUA 3I56I 1BIBA 2VODA 5BOXA 5IP6A 3ERMA 5IT9K 3JSPA 2HQ5A 3VTIA 1Z9CA 2ECCA 4BJ6C 3S17J 3MVPA 1SVMA 3PSFA 5L3CA 4E7ZA 3PQKA 3HC7A 5FKKA 2KLOA 1S7OA 2NVTJ 3A0HC 2BVMA 5CQGA 1ZGAA 3A01B 2ECBA 4D9JA 3JTGA 1BBYA 3KZ9A 2M34A 4MQVA 3GZ6A 3A0BC 4KN7X 2HQAA 3OS1A 2HQRA 3HTHA 2HWVA 3FMQA 1K4TA 5ED4A 1YRNB 2G9WA 2X6XA 3EUAA 4BJTA 3IKVA 3DKYA 4P96A 1WH7A 3S93A 4V2GA 3OL4A 1L3LA 1JKOC 4FQGA 2QKMB 1WJAA 2QSHX 1SVOA 1DPRA 1ENHA 4JP0A 3T6NA 3L2UA 3MZHA 2HYTA 5FD6A 1QHHD 1IN8A 1R5GA 2HYGD 4ENMA 4IOCF 4X6AJ 3KP4A 2ZJPF 3OYLA 3W2WA 4B09A 3GTMJ 1R5ID 4I0AA 1E3OC 5L3BA 3SFIA 3COAC 2X9DA 2MABA 2OQGA 4OOIA 5JI6A 4RDUA 3BP8A 2I5UA 2ZMEB 2CW7A 3EUKL 2WAEA 3H3VK 2K9NA 5B1BH 1ZGJA 3OYIA 2HOTA 2DDBA 3NWSA 2M8GX 2QQ8A 2V7FA 2K7LA 4A93J 1AOYA 1X1PA 5HS9A 3LJLA 3HSFA 2OZUA 3MWMA 4KICA 3L2QA 2KIUA 4KDPA 2LVSA 2PBXA 2HOAA 2HS5A 1T0FC 2EWNA 2VC1A 1OKRA 2VKHA 3GCMA 1VQ7I 2GXGA 4PFOA 3I5UA 4C3HJ 1IV6A 5CQEA 3ANGA 6PAXA 3BR2A 4WWCA 5ICEA 1U8BA 3ISPA 4XR6A 5IPAA 3M8JA 3OYCA 3ECHA 1EH8A 3MKZA 2MA3A 4L9VA 2XKPA 3HSRA 4OWRB 2OF7A 5HNFA 3CUOA 2XDNA 3SEQA 1MSFC 2JRMA 3CCYA 2E1OA 3R6SA 5D4RA 2DG8A 4NNJA 2R5ZB 2DFIA 2IS6A 1X3ZB 3KP5A 2O9LA 2EJRA 2NVUB 2UXHA 1HW5A 3VYSB 4ZTJA 3TGNA 2EK5A 4HG2A 2FEZA 3RKXA 4D5CA 4BY7J 3KYCB 2I10A 3KYDB 1LPQA 3BR0A 5M3FJ 3Q0WA 2OTLI 1MDMB 1PUFB 4PJLA 5FRNA 1B9NA 2ZXIA 3FIWA 4H0EA 2NS8A 3F22A 1XDSA 1TLHB 4M6YA 1J0RA 3BR3A 5KAFC 3CJDA 4BUPA 1FEXA 3ESWB 3F0CA 3OMYA 4Y4RA 2M4KA 1QNTA 2BXZA 2RGVA 4LD5A 3QKXA 1V55H 3VW1A 5D6EA 5J1UA 1UG2A 4X1EA 4ZC3A 1H9GA 2FA5A 4MTEA 2A6HF 2DODA 2UWMA 1X1BA 2K27A 1SD5A 4I02A 2LKSA 2L7FP 2JSCA 1JKRC 4KYWA 2EFOA 4ESJA 1KGSA 3GFLA 4XMYA 3H9JA 3K4JA 2IW5A 3AFHA 2AHQA 2E7WA 3BZCA 3F9KA 1VQ5I 2K9MA 4PJ0C 4BNCA 5KNLA 2F5VA 5GAGJ 2QTQA 1K83J 3NQOA 4KT5C 4LG0B 3DEUA 1EA3A 1YS7A 1VZ0A 3K0LA 2O0YA 3ZQ7A 3E0JB 1T56A 3VOXA 5LRSA 3S3NA 1J2XA 1Y6IA 2V6CA 2IA0A 4BXXJ 2GUHA 1Y0NA 2HGCA 3QPTA 4R1HA 2JVGA 3V7SA 3QPHA 3BC8A 1RR7A 2VQLA 3OR2C 3CMYA 2IPQX 2LP0A 2P6TA 4B47A 1BOAA 1E17A 2HVSA 4JQFA 1VNDA 2JMWA 3OWTA 5FD5A 3T8TA 5DDGA 1SMYF 2NX4A 1OISA 3AL0C 2VOPA 2I8DA 4XOPA 3CLQA 4II3A 1YJ9I 5F0FA 3OYMA 4BH9A 2KIMA 3SDGA 2R7VA 3M07A 2JUCA 3S32A 2ID3A 3JSOA 1S3JA 2DK5A 4RB1A 2XAGA 2OD5A 4RA2A 5L3FA 4OIQF 3BRUA 1WHUA 2EZKA 3WGGA 1D5YA 5HDKA 5IOZA 1VI0A 3DLAA 3EETA 2PX9A 1IF1A 4NC6A 2CUEA 4EMSA 2W48A 2H27A 4XRMA 3RH2A 2KIQA 2ISZA 5EZHA 4IHWA 4L5EA 2IA2A 4EVIA 3K69A 3K1MA 3BZKA 1U2WA 4YRVA 2VJJA 1GHCA 3GX4X 2FOWA 3GLXA 1O3SA 5D5UB 4S04A 4BY1J 1SD4A 1KQ9A 3WTVC 1JTXA 3RYPA 2HKUA 1ZYRF 3CLOA 3BLYA 5ILUA 5FMPA 4D7NA 3JW4A 2A07F 2J5OA 4IL6C 3F21A 1EH7A 3HG9A 1LB2A 3L7WA 4AM3A 1RUOA 2STWA 4GFBA 2G7UA 4ENNA 3FDYA 1EJ9A 5JLWA 3C7JA 1KYWA 3CO6C 1MBEA 2QA4I 3EUPA 2CS3A 3P9CA 2K40A 5DD4A 1UB9A 3Q9SA 4M6XA 1R9TJ 2L7ZA 1IC8A 4L5IA 3BG9A 5KHDA 5EEAA 2LMDA 3TP3A 2ZCMA 3MZ8A 4FT8A 4RGSA 2QQBA 4K2EA 1MBJA 1Y56A 5F04A 4CO8A 1IDZA 4DGWB 3QBMA 1NTCA 3HPGA 1IZ1A 4KN4X 3GLLA 4B43A 3GVAA 4NDLA 2NXNB 4MTDA 3VW0A 1TQMA 2K85A 3IUOA 3CZ6A 2O6GE 3GEZA 1BI0A 2EIJH 3KZIC 1A6QA 3LSTA 4YFXF 1SFXA 3HRTA 5E17F 1BI1A 2DFEA 1BN5A 1UFMA 3BG5A 4F55A 3I64A 1Y8QB 1F36A 5M5XJ 1YIOA 1B72B 1IO2A 4X0GA 3V8KA 1F5TA 2CW8A 2L7MP 3OYHA 2F5EA 1NG7A 5J1YA 2GFNA 1CGPA 2JVHA 1WJEA 2Q1ZB 4HQMA 3JR9A 1AKHB 3BR6A 3I4MJ 3KETA 3CCMI 3E1SA 3PO3J 3S2WA 5J4VA 4LMYA 1FYLA 2LRDA 2DA3A 1OLTA 4QSHA 4WCGA 3JREA 3MMYB 3TQNA 3DWLE 2GXBA 3M9AA 4M71A 3VVXA 2BXYA 3BTIA 5HODA 1WSUA 2ZCWA 1R49A 1IJWC 1BM9A 2TRTA 2Q2EA 2DN0A 1H9TA 2YR2A 2DA5A 3KFWX 3F72A 2EV0A 4ZH4F 2CG4A 5BMZA 1GV2A 1R23A 2HR3A 3I71A 1BR2A 2ZJQF 3AG1H 3FMRA 5EEHA 4ZDOA 5FFXA 2NOJB 2ZMEC 2RHAA 4DVYP 4Y33A 5JVTA 4EV0A 4RAZA 4GRIA 4P9FA 1LFPA 4LB5A 3KX2A 4F92B 3GZNB 1IXCA 2L0KA 2H94A 1ITYA 3K6GA 1Y1VJ 4XLEA 5BNGA 3VEPA 1W7PA 1N78A 5B1AH 2WTEA 5CJ9A 2QGUA 5K5OA 4AC6A 2V79A 1YQAA 2WC2A 4LG3A 2FBHA 3C2GA 2DOFA 4AIKA 3F8CA 3G1OA 4BDZA 4MFDA 2NNYA 3WHBA 1USSA 5HVQC 2R4GA 1N75A 1B59A 1D1BA 4YEJA 5TGTA 1PP7U 2FD5A 1T39A 5B5EC 1OCRH 2MBFA 2WB1N 2MLGA 2MC3A 2FUG2 3C3WA 2AXTC 4EJWA 1R7JA 3HTJA 1XN7A 2YS9A 2LKPA 2EQRA 3TDUC 3SJMA 2R7SA 1IW7F 3NPIA 2W85A 4P55A 3JRHA 5LHIA 1SANA 3GTOJ 3OS2A 4FX4A 4RBOA 3H1CA 1B8IA 1ETOA 4O5VA 5DS9A 1U3EM 1ACIA 5HBUA 3BZ6A 2DA6A 5IP7J 1Z3XA 3HUGA 4E7IA 2GENA 1JJ8C 2JN6A 4IRVA 2HPMA 2M7BA 4BU2A 2OV7A 2LF7A 3WTYC 2MH9A 4UXNA 2E36A 4CGRA 2L54A 2WAFA 4WF2A 3UR3C 3ZN1A 5E79C 1NK2P 2PMHA 2XB0X 2VONA 2H1LA 2EBIA 1BW6A 3M1EA 2R7WA 5DV5A 3JRFA 4AYBN 2OI8A 3DPLC 5CPRB 4J01A 1KU9A 3L00A 3A03A 4BHPA 4C2MA 2DK8A 1MBFA 1SAUA 2JA7J 2QQAA 1I39A 3HBLA 5IYCJ 3S15J 3HL2A 3S1RJ 1TWFJ 2KP6A 3K1NA 4ME9A 4RAFA 2H6BA 3FZVA 2PMZN 5HS7A 4IX7A 1YOVB 1JGSA 4NN1A 3JAMK 1QU3A 4I01A 1TWCJ 1WJCA 2M8EA 2W57A 3GUDA 3V7RA 2UXNA 2YU9J 2Y30A 1MJBA 3DP7A 3DFGA 2A5WA 5D4SA 3HM5A 2CUFA 4HNVA 4DOZA 3IP4B 1FIAA 4YG2F 5EG0A 4TV7A 4DYCA 1ZKGA 1R6RA 4ZJZA 3WTXC 3HYIA 5LHHA 3K4MA 1MNMC 3HGGA 1W0UA 5M5YJ 1GXQA 2W84A 2XV4S 4MGRA 3WE3A 4B4CA 3VYUB 3FXMA 3KE2A 4A3JJ 4BXUA 3VVZA 5DTDA 3G7RA 4Q4ZF 3A02A 4MLOA 4U88A 2VPLA 1HLVA 3GTPJ 5E1ZB 1DU6A 1HKSA 3NS4A 1FP1D 4XKVA 1HSTA 2HKXA 3NWTA 1RKWA 2PZ9A 4CCMA 3J7ZI 3U9GA 1ZN2A 5J4YA 4HZFA 3ON4A 5DUKA 3K1PA 5HOOA 1G3TA 2DFHA 4ITVA 2DTRA 3WTWC 4BE1A 4CH7A 2KRHA 4RLFA 3F23A 4OD4A 1REPC 2ZBKA 1ZARA 2MGQA 3H9GA 5ILSA 5FLMJ 5JHFA 4U0WA 5E1WA 2EFPA 1IN7A 2EILH 1A6IA 2HVRA 1VTNC 2XPVA 1Q1HA 4YIIA 4ZZLA 4MEXF 1H0MA 1Q1VA 2FQ4A 2QENA 4A3FJ 4HRIA 2E1CA 1IRGA 3F8NA 2FQ3A 3M8FA 4HQEA 4G7ZF 2DMUA 2ME0A 1VQMI 2R7ZJ 3FISA 2P4WA 3AKZA 4I09A 3GWZA 5GAEJ 1R5HA 2UUZA 4XLPF 1QA6A 5HAWA 4CCKA 4OINF 2IA1A 4XSZF 1IAWA 2GM4A 4M9ZA 3PO2J 1Z0XA 1V5GA 2FRHA 1D1AA 3PIOF 3MKWB 1YTYA 2WB1A 2EH3A 1X3WB 1J75A 5E3MA 1ZHFA 1FY7A 1WJFA 2FNAA 3EUHA 5CKTA 1P4XA 5CVVA 3WODF 3ZMTA 4A6DA 2O7TA 1YIJI 1K79A 3IRRA 2X85A 1W0TA 1MMNA 3MQ0A 3BQYA 3DU6A 3HIFA 4BQOA 1S9HA 3H0GJ 2Q2EB 3ZR8X 2RQPA 3IC7A 3Q3SA 1R71A 1UI6A 3T0YA 3G56A 2K3FA 4AVPA 2GA2A 5CXGA 1JE8A 4UV9A 4JYKA 4KIBA 1R4NB 2YX4A 1XSVA 2DJNA 2M45A 4IHXA 4RGXA 1W5TA 2EPFA 3OYBA 3BR5A 5F08A 2A61A 4PJMA 3OL3A 4AYBA 4CDGA 3H9QA 3JRAA 4ON0A 4C3JJ 2VE8A 4UVCA 4HSTA 1N25A 1XCBA 2CQQA 3ZRGA 4BXFA 4JOMA 1HKQA 3DBLB 1SC7A 3PQJA 5DUIA 2VI6A 4LFUA 4AD9A 2X51A 4MHGA 3V8JA 1HDPA 1FOKA 4W1UA 2XAHA 4AIJA 4A3GJ 2PMZA 3CRJA 2H8WA 3U2RA 4G6QA 5E3LA 4CUGA 2CO5A 3HOXJ 5J6XA 2DPUA 3C1DA 1BR4A 2VQHA 2K5CA 4CCOA 3LFUA 4IXAA 2HEOA 2GXAA 2A68F 3H0DA 2MD0A 2F4MB 2QKLB 3LWJA 2MFZA 3LSHA 5D18A 1ZAOA 4E7LA 1OYIA 1OPCA 4XN0A 3PJRA 4R8HA 4CZCA 2WY7Q 3PL8A 3HTSB 1ZREA 4IHTA 1ERDA 4NC8A 2ZOYA 4XRSA 1FPQA 3HGYA 1Z7LA 4A3IJ 3PASA 4U7DA 4G12A 1TW3A 2JPBA 1OR7A 3HOSA 5AONA 1WPKA 3SWHA 3G1MA 1MBGA 5TISC 1K6OA 2LG4A 3TDZC 3N4MA 2YVEA 1X19A 2UV1A 3QP6A 4N9IA 3FXRA 2GZWA 4HNUA 2E2HJ 4IRIA 2OPTA 3D5SC 2DMQA 3KIOA 3CJRB 4YELA 4GCKA 2KZVA 3E6BA 2BVLA 4C2MJ 4UDSA 2GBYA 2L4AA 2IT0A 1DDNA 4I76A 2M30A 2FSWA 3BTLA 4BS9A 1FOWA 3M8EA 3C2BA 2KRFA 2F48A 3RI4A 2A3SA 3IH4A 1Y0UA 3S5RA 1HCRA 1HXDA 3GXOA 1R1VA 2P81A 1DP3A 1EF4A 4XN3A 2DT7B 3C07A 2XUBA 3E6CC 5ILVA 3CESA 4RB0A 4A3EJ 1XS9A 3KLNA 1WI9A 5EEGA 4WXDA 1JJ6C 2L3DA 4XOTA 2VB6A 4UUSA 3CCUI 4ACIA 3IKTA 5TJJA 1DGWY 4CA0A 5EG0B 1T95A 4HOBA 1S7AA 3S14J 4LOCA 4F3QA 2R5YA 2DDAA 1T38A 5C4YA 2QEXI 4CHUA 1XGOA 2L2OA 4RAGA 2ZNYA 4N4NB 4ZYHA 2XSDC 1WJDA 2DO7A 2WWYA 3JSJA 4U87A 1BR1A 4QTRA 3BQZA 1RETA 3QWLA 3OYGA 3N97A 4KISA 3VP5A 3VPRA 4QWQA 4A2UA 1MD0A 2LC2A 1ORKA 4C3IJ 2VBXA 2GOMA 4EATA 1J7KA 3FF5A 5F1JA 3QU3A 4RLQA 3CJTB 1VQOI 2O7OA 1UHSA 2ESHA 4GXOA 4GDFA 2IGMA 5HLHA 3CUQB 2LTPA 2IS2A 2ISYA 2H09A 1HC8A 3H92A 2IS4A 4A3DJ 3NNRA 4BGDA 1MSEC 4C2TA 1LE8A 3B73A 2V26A 4U0VA 1FIPA 3I53A 3K4BA 3IUVA 1WJ5A 4NQWA 1IRXA 1BW5A 4XSXF 1BJZA 1OCTC 1P4WA 2Z33A 3WG9A 4N9HA 3EDPA 1JUSA 4OIPF 3OR1C 5EJCA 3FXKA 1FTTA 5F27A 1QQIA 3AG4H 4BBRJ 2W1OA 3K70D 3ABKH 2V1XA 1MH4A 1UHMA 4BQNA 2E2JJ 1ONVA 2IGOA 2OCEA 4YFNF 3HIMA 1RPWA 3KZYA 2G7LA 2DQLA 1EH6A 3K8PC 4XLAA 4KUMA 3F6VA 1Z21A 1UAAA 4CCLA 4UY8I 1IN6A 1I3AA 3ZQHA 4HDUA 2O61A 1JKQC 2HXIA 1RR8C 2FBKA 1F1ZA 1KA8A 2ZSIB 2XGDA 2Y9ZA 3HE0A 1KONA 4UHTA 3VOEA 1TNSA 2MSYA 1QHGA 2L9SA 5FKMA 3TO6A 1RC9A 4AIHA 4D0PA 2FX0A 3FM3A 3TBIA 4ENKA 3CC7I 2OUMA 1LFBA 2F4IA 2K4JA 4ZDLA 2GWRA 2CW0F 1G2HA 1OJLA 1WWXA 2NVYJ 3HOVJ 3I58A 1MBKA 2BYVE 2LY9A 4EJOA 4RB2C 4XK4A 1D8KA 1GXPA 3MN2A 5KCMA 5D8KB 2XDVA 4OU0A 1ZLJA 4L18B 2DFFA 3WU0A 3BT9A 4MEYF 3CF5F 1YITI 2AO9A 2R3SA 1QZZA 1FYKA 2CJJA 4G7OF 2X6OA 5LEKA 3GEUA 4RS8A 3BJOA 4PDKA 1FNNA 1SGMA 4L9JA 1QVUA 2Z9OA 1XGMA 1YG2A 2ZC2A 4GCTA 4DQ2A 2O3FA 5K5RA 5EDNA 1GVJA 3H35A 1P2FA 4NC7A 5EGOA 1S29A 1UCRA 2IGNA 5FJ8J 2CRGA 3S3OA 4XQFA 1P92A 3KKCA 1WI3A 1W1WE 5KAIC 3JRGA 5HSZA 4ANJA 3A2KA 2VKVA 2VKDA 2F5DA 1Y1WJ 1U5TA 4ESFA 1JTYA 1A35A 4RM3A 3PSIA 2NAZA 5K7FA 3M4OJ 2XROA 2IVMA 1F9NA 1TL8A 2FE3A 4XNFA 1BJAA 4F52A 2PJRA 2FJI1 4E4HA 2HVQA 3F8FA 4A3BJ 4CYCA 2IGKA 2IAIA 3GW2A 3RQ4A 3ANPA 4HYEA 2OCCH 2JSPA 3ZN0A 1WVRA 3JRCA 2P7CB 3QOPA 3IV5A 1X1AA 3DCFA 4HX7A 1LEAA 1MBHA 5LGTA 2DA7A 2QLZA 2V1UA 2O03A 3ABLH 2Z5UA 4KA4A 2HDDA 1YJNI 1G3SA 2LREA 2Y31A 1QPIA 5DCMA 3GTKJ 3JRDA 1TZLA 5DCFA 1JKPC 2LSOA 2PG4A 2DYSH 4CYDA 2VBWA 5EFYA 3B6AA 3GFJA 4RGRA 3ZMVA 2DQRA 1LDJA 3KPHA 4HA8A 5JLXA 4XBFA 2PQ8A 2HZTA 4D5FA 2QYOA 2VBYA 3T5XA 5LD2C 3JCUC 2VXZA 2ZXWH 4E7SA 5BQTA 1TT0A 5GPAA 3LHQA 4LK1F 1K7AA 2Y75A 3FXQA 2ZJ2A 1HA8A 1T0FA 4EJVA 5GPCA 3IAS2 1XPXA 3WTSC 1BA5A 1XX5A 2X6YA 5KK1A 1QO0D 1TNTA 2QZ8A 2RDPA 3G1LA 3X2QH 4BQQA 4PCQA 4LK0F 4L0YB 3E5UA 2MG4A 3K70C 5H6QA 3S1NJ 2K9LA 2Y0MA 1W36D 3RPUA 1YX5A 2VJIA 4IQ4A 3L2CA 2KISA 4WX9A 1OMIA 3F6OA 1Y8RB 5FROA 1ON2A 3SXYA 1SFUA 2E1MB 3MAJA 1FYMA 3DQVC 2H8RA 4XKCA 2R5YB 4HLXA 5FRMA 3I55I 3FMSA 2HDWA 3QPLA 4P9UA 2QM3A 3RZDJ 3S1QJ 2RNJA 3MZYA 1Z3YA 4O3MA 4KITB 3DU5A 4EGZA 2Y0SN 3HDDA 1YHQI 1W4MA 2F6CA 5ICFA 1V54H 1WKMA 1FBQA 3ABMH 2L5QA 2EV5A 2ZCXA 2M5WA 3S16J 1O4XA 2V9PA 4PK4A 5D1RA 3IH2A 1P7IA 4FHTA 2XPWA 4BHCA 2K9QA 1A5JA 2ICWG 2JK3A 3H5AA 1W5CC 4FE7A 1X1CA 5LLQA 3SZGA 2JQ7A 2PLYA 4MXMA 2EA4A 4M9XA 5HLGA 2ZSHB 4DZJA 4LB6B 3O3KA 1ZR4A 2Q0OA 1E3PA 2A69F 1MJAA 2L9NA 3COLA 1ETKA 2NP5A 3K4LA 3Q5FA 3OYJA 1T2KA 4EQQA 2QIBA 2XAJA 2QSFX 1Z7UA 2DMNA 3H5NA 4Y17A 4CCNA 3TP0A 4AUXA 1HKTA 3HTAA 4B48A 2HU9A 3QOEA 2OERA 3R4KA 2NS0A 4OAZA 5HS8A 2JT1A 3RKQA 2AXLA 5H9TA 2CSOA 2VIXA 1HSJA 4B3AA 4L9NA 1JT6A 4EM2A 2Z1DA 1A04A 4M72A 3LA7A 3AQSA 9ANTA 3ASNH 4CXFA 3IRQA 1HBXG 2R92J 2G7GA 3CUQC 1EV7A 3SZPA 2PI0A 1IN5A 3HTUA 4ZYGA 1LQ1A 4QPQA 3I59A 3AQTA 2LD5A 1U9OA 4RB3C 3BG6A 2CH0A 2R7QA 2OQRA 4F91B 1G8XA 2L01A 3P5JA 2L9VA 2KPMA 3BCAA 1XMAA 4P1WA 5D6FA 2B1EA 1U9NA 5HNHA 1DP7P 3TL4X 2X1CA 5CXIA 4GFKA 5JVGF 1V3FA 2P5KA 1U0JA 2WAQN 1QPMA 2R93J 1BC7C 3S2DJ 3RD3A 4QPOA 4HBLA 2RNGA 5L3DA 1S7EA 1VQKI 4IHSA 2XF5A 4XORA 1GDTA 4KNYA 2CMPA 1USTA 2COBA 3GTQJ 4MK6A 3U1KA 3EUHC 3BY6A 4QIWN 1U5TB 2V9KA 3KP6A 3G6EI 3ZPLA 4PUSA 2ZB9A 4HLYA 1CQTA 1JI8A 2E2IJ 1QZYA 3G73A 1GVDA 2YX7A 5IY5H 1JXSA 1JHHA 3GF2A 4MIMA 3L2WA 2PJRB 1IUFA 1OFCX 1E2XA 1UHWA 1XSXA 2LDUA 4Z6YA 2FF4A 1MMSA 3K9TA 3WTZA 4IHYA 3OYEA 5M3MJ 1FOXA 4CYCB 3ZP5A 1W36C 2BOLA 3ZOBA 4BEHA 1VQ4I 4KMFA 3BHQA 4JX4A 4I98B 4GCVA 5HLTA 5E8IA 4O6JA 1VF9A 1U8RA 1YE9A 2XGXA 3AAFA 5DEQA 1ULYA 3I0TA 4FCYA 4OAYA 2Y0SA 1VQNI 3MKYB 1Y39A 4AVZA 4KIFA 3FXUA 2QOPA 3FM5A 3FKIJ 3W6KB 3K7AJ 4IKFA 2XF6A 2WBMA 1LDDA 3LSIA 3DEWA 3A1YA 1ZG3A 3FX3A 2K02A 3A01A 1MJ9A 3E5XA 1QVTA 1T8IA 1HDDC 1MMGA 2E19A 5JR3A 3BTJA 2JA8J 2PJPA 4EJUA 3CWRA 4N0BA 3ZQIA 1Z77A 4F7ZA 2FXAA 3MFKA 1FZPB 3TKYA 1ZLKA 2QBYA 1P9QC 1YYVA 5M5WJ 1I6HJ 3LOCA 3D1NI 4M3BA 4RAYA 5B3SH 5DM6F 2REKA 4S0HB 4A3KJ 3G71I 1ZK8A 2KZGA 1I1SA 1K4SA 1BC8C 3E97A 1R1TA 4ZDPA 3CCSI 1Z91A 2HXOA 2Z99A 1STZA 2Y2ZA 4A5NA 1MZBA 4E7KA 4CSWA 3KEYA 2BEOA 2HKOA 2KRCA 4I99C 5CVRA 1VQ8I 3G2BA 4I7HA 2G7SA 1GUUA 4Y13A 2NOGA 2XASA 3SHFA 1TW2A 5J1RA 1QRYA 4HNTA 2GLOA 2EB7A 3CJQB 1LDKB 4BQAA 1RIOH 2QQ9A 2OZ6A 3FXLA 1MMAA 1DUXC 4B3XA 2VQCA 3KP2A 3T8RA 5BPDA 1H88C 1VQPI 3JRBA 2ZMEA 2KFDA 3LQRA 2CQNA 3QYFA 3QYEA 1SFEA 2QWWA 2W00A 5FLXZ 5BPIA 2K3PA 2X48A 3GMEA 5LEJA 2NYXA 3S8PA 3I9V2 2HOSA 2E60A 3JRIA 1TBXA 1H8AC 2QKOA 4DBQA 3PM1A 3VFZA 4A0YA 1O3RA 2R0QC 4LLNA 1O3TA 4GYIA 4IRHA 1MNEA 3J7AY 2XSJC 1MH3A 5L3EA 4Q47A 3OSFA 2ACJA 3FK7A 1IXRC 1HF0A 3HTIA 1LVKA 5DD8A 4C9YA 1AA7A 1TP4A 2DMTA 2PFBA 2WAQA 4XKBA 4LLLA 3V42A 3J81Z 3BCGA 1NK3P 4OD5A 2XGEA 2VT2A 2IU5A 3OIPA 1MMDA 3UNGC 3S3MA 4A12A 2E35A 3LMMA 4I6ZA 3F8BA 3HEFA 2E1MC 2HZDA 2R5ZA 2ADUA 3DPUA 5GADJ 5CVIA 1T08B 3PNTA 3LSMA 2DT6A 1XCVA 2M0MA 5H20A 1DGRM 3J81K 1I27A 2GOXB 3R60A 1MIJA 2QUFA 1X4OA 1SAXA 4N4OB 4E70A 4M6VA 2KIFA 1MKMA 2TCTA 2QCOA 3ABTA 2D1HA 2V1DA 2M87A 5ICGA 2B63J 2F5FA 1IN4A 2VXDA 1A31A 2VQGA 4GGGA 1OYWA 3REOA 4BYYA 5IP9J 1RKTA 1MDMA 4RGUA 3B6CA 3O8GA 3RPQA 3U21A 5IOYA 1BOBA 1PUFA 4C2UA 2FBQA 5LGUA 5E18F 2R7UA 1XD7A 3L2VA 4CGZA 1WGXA 2E7XA 3NXCA 2ZXJA 3RKYA 1S8NA 1Z1DA 2VOOA 1O57A 3Q0UA 4S05A 2Y69H 1BIAA 1JHFA 3I59B 4G6DA 5EZGA 3KNWA 4M74A 2Z2SB 1X1DA 1W7PB 1KZHA 1XG1A 4HEA2 2YVHA 2NVQJ 2DLLA 2R7XA 2FOKA 4LGWA 2M4GA 4Z2YA 2LF8A 3CO7C 1BI2A 2DXIA 1U6GA 4HF2A 2EIKH 1FTZA 4M3EA 2UXPA 1GLNA 3VW2A 4DNCA 2HOEA 2OAZA 2WY8Q 5GP9A 1YX3A 3C18A 3HKZN 3SEZA 3WGHA 4HPQA 3P9IA 4JBAA 1KQ0A 3CDIA 2BY2A 4Q48A 4LG0A 2OJED 3BNIA 1S6LA 1VQ9I 3IWFA 4JX5A 4WXCA 4DYQA 1XDUA 1DU0A 2ZO4A 3EPZA 1E3HA 2IEKA 4AIDA 1XC5A 2STTA 3E3VA 2JZYA 3BG3A 1B8IB 4XLHA 1LVAA 1YW9A 2BY0A 3HUGB 5J3LA 3VSLA 2HQNA 2P7VB 1LFUP 2XF7A 2ESNA 2FJ1A 3PFYA 4L5JA 2VJ4A 2DI3A 1B6AA 2O8KA 3AG2H 1XGNA 1YS6A 3P7NA 1LEBA 1FOYA 1LUJB 2NS7A 1LJ9A 3LAJA 3FK6A 5F64A 2NP3A 1C0WA 2DMPA 5IT9Z 4W97A 1FBUA 2BGCA 3PUFA 2BE5F 2ID6A 5FB2A 1Z6TA 3Q0VA 3RCOA 2VT3A 4EM1A 3CD6I 3O6BB 4WIBA 3ELKA 5AIQA 3E7QA 4JL3A 3DBRB 1J9IA 3OIOA 3D0SA 1PUEE 4A0ZA 3S1MJ 2XVCA 3LA3A 4FTHA 4AF5A 2LYCA 3OYKA 3DF8A 1NH3A 3V6GA 5A2QZ 3CP2A 2RASA 1BI3A 4MQ9F 1IV8A 4GO1A 5HDNA 4CCJA 3WTTC 3I4PA 2VN2A 4JX6A 2UXUA 5FGLA 3CMMA 3GBGA 2EFQA 1U5TC 2BW3A 3GFMA 2BV6A 4UUTA 2QBYB 4M9SA 4CICA 2LLKA 5A2QK 4MO7A 3NRGA 3SQNA 1FC3A 2XB5A 2JA2A 3DTKA 4HF1A 2VJ5A 3K2AA 4Y15A 1TWAJ 2YU3A 2A6EF 2DYRH 5HLIA 2CV1A 1D5VA 2E5ZA 3HRUA 3D5RC 2G3BA 4U9NA 5EYRA 3KYLA 4XRFA 3VVYA 1X2NA 2CUZA 2ZFWA 2WV0A 3T1BA 1WRJA 3HRSA 2GQQA 3SZTA 2O5RA 4ZTFA 3MKLA 2PN6A 3V8LA 4J00A 3OYDA 5ERIA 3BOQA 1W7PD 5CLSA 5AIPA 2Z16A 1M1EB 2MC4A 1T33A 3CCRI 4L62A 2HYFA 3V4GA 3KP7A 1MW7A 4P5OA 1K61A 1O7FA 3RTRA 4DIQA 4WXHA 4IHVA 4XLNF 4OMZA 1WJBA 2KL4A 1YJWI 4PGGA 2D1VA 1UG0A 1K78A 1UELB 1VQLI 4IQJA 1B72A 2W53A 4HW0A 4UVAA 3VODA 4A6EA 5J47A 1TT5B 2VKEA 4PSXA 3AG3H 3OYFA 1JUMA 2IJLA 5F0HA 5FLVA 3RDIA 3LNQA 1UI5A 2KKOA 3MEXA 1AKHA 1WQ2A 5FGMA 2B0LA 1RZ4A 5L3GA 5FHPA 2G7HA 4B1RA 3HOYJ 2E5NA 2PBIA 3TMOA 3HKZA 3ERED 2RC4A 5FO5A 2ME6A 5J40A 4NHJA 3QU6A 4YIRX 2M3AA 2Z3YA 2OA4A 3F8MA 5LHGA 2PFVA 4XONA 2ZOZA 1B4AA 3C2HA 3MCZA 2QSGX 3NI7A 2XRLA 3LL7A 2JRTA 3M1CA 1HW1A 4U9LA 3DKWA 2LK2A 3SDBA 1P7JA 4HX4A 3QODA 5FFZA 5D19A 2DCEA 2X4HA 4EJTA 2DOAA 2OC6A 1KQ8A 2CQ7A 4ZZDA 1W5SA 1FSEA 3K4KA 2IS1A 4ZYEA 5J8FA 2ELJA 3GYHX 4PXIA 1ZRFA 3VWBA 2L7KA 3BJBA 2Q8KA 4ASNA 1FBSA 1YFHA 5B66C 4J19A 2H6CA 2FBIA 5GTIC 2GA1A 2AQFA 1LKXA 2NNNA 5K1YA 3GTLJ 3E6DA 3QQAA 1KU2A 4FISA 1SFOJ 4XM3A 2FMLA 3DTEA 4QLCU 1XTAA 2G0EA 3V78A 1UMQA 3OYAA 4IZZA 3CTAA 2LBFA 3FBNB 4UB8C 4XLFA 3LAPA 1SVLA 1HOMA 1IUYA 1ETVA 1OCPA 3WHCA 2IRFG 1FP2A 1DPUA 2AQEA 5FKLA 1SMTA 2XAQA 2LH9A 3OOUA 2K9SA 2KDZA 2HTSA 2FMYA 3KEOA 1FSHA 4I2OA 2ZNZA 2A5YB 2EA2A 4L9TA 1CF7A 2V57A 5D5VB 4GYGA 1I50J 1SEUA 2AS5F 2XGCA 1JT0A 4A69C 3BR1A 2A6TA 1P6RA 3TW6A 5LGNA 1K6YA 2WA0A 5K7ZA 5CVJA 4G94A 1QBJA 3ECOA 3EYIA 1X3UA 4U0YA 2DPDA 5C4XJ 3ZMUA 5ICCA 2ETHA 2P0WA 3VB2A 3VYTB 4ESBA 4I0BA 2DA4A 2DA1A 3FHNA 3GO5A 3BWGA 3OV8A 4HAMA 3QRFF 2JPCA 3TOAA 3LWFA 2VLAA 3P9TA 4KWAA 2EV6A 4RM2A 4IVNA 4IOAF 1AWCA 3FBIB 5K5QA 2X6WA 3WE2A 2UZKA 3HOUJ 1ZG1A 3J80Z 3W6JB 4UB6C 1J59A 3D5LA 3J7AO 1QGPA 3W2AA 1ZG5A 2FU4A 1ZR2A 1R4MB 3E6MA 4ABZA 4BAYA 2XHKA 3DPJA 1PP8F 2DJIA 3LSJA 1ODDA 4Q5SF 2OBPA 1AU7A 3ML6A 5D5XB 3N05A 3DV8A 1Z67A 2W25A 4A5MA 2W24A 1FMVA 3J80K 2BHYA 3CC4I 1IRZA 3FWEA 5DYMA 1OYYA 2D2WA 1TTYA 2VASA 1V5EA 2MH2A 4ZYDA 3CDLA 4BACA 3QPSA 1TC3C 2J5PA 4A3CJ 3PFIA 4KFCA 1SD6A 2B9SA 3M7GA 3KEQA 4G9YA 3WGIA 2BW3B 4UUSB 2F07A 1XGSA 3NARA 3OYNA 2LKXA 3O8HA 4HSRA 3PPBA 2RVCA 5H6RA 2ZXHA 3RSNA 2XAFA 5C4JJ 2QF7A 3LSRA 1TQPA 2X0LA 2CYYA 2V6EA 2YSRA 2CFOA 5C44J 3QP5A 1D0ZA 2KDOA 4BHBA 1Z05A 2HTJA 1J09A 1D0XA 3ROUA 3EQLF 1SFKA 3BTCA 3LSGA 5IYBJ 2QVOA 2M7AA 1FT9A 1A36A 2W4SA 2XPUA 4AU7A 3VSKA 1YW7A 2P6SA 2P8TA 3TO7A 1RNLA 1ZQ3P 3J7YJ 3CCLI
chains in the Genus database with same CATH topology
3DEWA 5E3NA 3A01A 4D5CA 4BY7J 1HDDC 1QVTA 2E19A 2I10A 3BTJA 3LWJA 2JA8J 5D18A 3BR0A 3ZQIA 5M3FJ 1Z77A 3CWRA 3Q0WA 1PUFB 5M5WJ 1I6HJ 3LOCA 3FRQA 3D1NI 4M3BA 3FIWA 1LE8B 2NS8A 2REKA 4S0HB 4A3KJ 3HOWJ 3BR3A 1ZK8A 2EZIA 2D6YA 2ZOYA 3CJDA 4XRSA 1FEXA 3HGYA 3F0CA 2VPRA 4A3IJ 3PASA 2HXOA 2DG7A 5E3OA 4G12A 3QKXA 3VW1A 2Y2ZA 5J1UA 1UG2A 4X1EA 1WPKA 1IGNA 1I3QJ 3G1MA 3ZQLA 2G7SA 1GUUA 1MBGA 2L7FP 2NOGA 2HI3A 1JKRC 2YVEA 5J1RA 1QRYA 1ETYA 2GLOA 2VUMJ 2AHQA 5CW8A 1APLC 2E2HJ 2OPTA 2DMQA 4GCKA 2QTQA 1K83J 4MFEA 4C2MJ 4UDSA 2GBYA 4I76A 3BTLA 1VFCA 1H88C 3JRBA 4M3GA 1T56A 4JKZA 3VOXA 3C2BA 2X48A 3IH4A 4BXXJ 2GUHA 3S5RA 1HCRA 2P81A 2RAEA 1JUPA 5FKNA 2HOSA 1EF4A 3JRIA 3C07A 1H8AC 2QKOA 1RR7A 3CMYA 3PM1A 4A3EJ 2WV1A 2LP0A 1XS9A 2R0QC 1FJLA 1GV5A 1JJ6C 1VNDA 2JMWA 4UUSA 3ZQCA 2NX4A 1MH3A 2DA2A 4ACIA 3O60A 5C3EJ 2JWTA 3OSFA 1HF0A 3FK7A 3HTIA 5F0FA 5EG0B 3ON2A 3SDGA 3S14J 2DMTA 4LOCA 2R5YA 3BCGA 3EGQA 2ID3A 1NK3P 5C4YA 2XGEA 2IU5A 1X58A 2XSDC 5IYDJ 3BRUA 3JSJA 2EZKA 1D5YA 5IOZA 4QTRA 3BQZA 1RETA 4I6ZA 3VP5A 1VI0A 5EGOB 3HEFA 3VPRA 2DTZA 2R5ZA 4C3IJ 1ORKA 1F43A 2CUEA 4M3DA 2W48A 2D5VA 5F1JA 4XRMA 3RH2A 5EZHA 4IHWA 4L5EA 2O7OA 1UHSA 4M6VA 3OSGA 2TCTA 2QCOA 2B63J 2LTPA 3RQIA 3M3YJ 4BY1J 1JTXA 5IP9J 1RKTA 3COLA 2HKUA 3B6CA 3O8GA 5IOYA 1PUFA 2FBQA 1WCMJ 1X2MA 4A3DJ 3NNRA 4D7NA 5FMPA 1MSEC 3NAUA 1LE8A 1H89C 2EZHA 3TW7A 4NELA 1WGXA 3LSPA 1FIPA 3NXCA 3IUVA 1BW5A 5F0CA 1BJZA 1OCTC 2M2EA 4GFBA 1JUSA 3Q0UA 5JLWA 5EZGA 1FTTA 1ETWA 5F27A 4XICA 3KNWA 3MNLA 2M9HA 1MBEA 4BBRJ 4DW6A 3EUPA 1XG1A 3GTJJ 2YVHA 2NVQJ 1MH4A 2UXIA 2K40A 2E2JJ 1R9TJ 3HIMA 1RPWA 2L7ZA 1IC8A 2G7LA 3BG9A 2CU7A 5EEAA 3TP3A 4M3EA 1FTZA 2WGBA 2ZCMA 2UXPA 2JA6J 2Q24A 3VW2A 4EEFG 1MBJA 3ZQHA 5F04A 1JKQC 2HXIA 1IDZA 4HKUA 3QBMA 5GP9A 3HKZN 1NTCA 2WUIA 2XGDA 2Y9ZA 3HE0A 2KT0A 4NDLA 3S2HJ 2MSYA 4XRSG 3VW0A 3HOZJ 5FKMA 3BNIA 3GTGJ 4JX5A 2FX0A 3CQZJ 4DYQA 1DU0A 4DYRA 1LFBA 1YRNA 2IEKA 3RZOJ 3BG5A 1XC5A 4YZEA 3TEDA 1B8IB 3BG3A 2IBDA 1G2HA 1OJLA 1F36A 2NVYJ 5M5XJ 4XIDA 1B72B 1MBKA 3HOVJ 2LY9A 5K7HA 4XK4A 5J3LA 1LFUP 3MN2A 2FJ1A 5AQCA 4IEJA 2L7MP 2O8KA 3BT9A 5J1YA 2GFNA 2NS7A 4FE4A 2AO9A 2CJJA 3FK6A 1AKHB 3I4MJ 3JR9A 3BR6A 2X6OA 2NP3A 3GEUA 1TWGJ 2DMPA 4W97A 3ZQGA 1SGMA 3PO3J 1QVUA 2ID6A 4GCTA 2DA3A 4QSHA 3Q0VA 3JREA 1ZGWA 5EDNA 2N8GA 4A3MJ 3E7QA 4JL3A 3VVXA 3BTIA 5HODA 5EGOA 3OIOA 3B81A 5FJ8J 1IJWC 2CRGA 2TRTA 3KKCA 3S1MJ 2DN0A 1WI3A 3JRGA 3I4NJ 5HSZA 2DA5A 4FTHA 4AF5A 1ETXA 1JGGA 2VKVA 3V6GA 1GV2A 1Y1WJ 1JTYA 2RASA 5K7FA 3M4OJ 2JJ7A 2RHAA 4ICHA 3VOKA 2UXOA 2CQXA 4JX6A 2UXUA 4GCLA 5FGLA 3GBGA 2NVXJ 4UUTA 5K58A 3NRGA 4A3BJ 2LLKA 4MO7A 4CYCA 1WH5A 2IAIA 2XB5A 3ANPA 2ELKA 3K2AA 1ZTRA 3E7LA 1TWAJ 4BKXA 3JRCA 2L0KA 2ZCNA 1ITYA 3IV5A 1RESA 2G3BA 1Y1VJ 3DCFA 5EYRA 5BNGA 1POGA 1X2NA 3VVYA 1MBHA 2M0CA 2DA7A 3KKDA 4AC6A 5EF6A 2HDDA 1TWHJ 3MKLA 2Y31A 1QPIA 3GTKJ 3JRDA 1JKPC 3G1OA 3UKGA 4MFDA 3WHBA 1IDYA 1U78A 5EFYA 2FD5A 4V2FA 3B6AA 1GT0C 1T33A 4L62A 5JLXA 2WB1N 4D5FA 1ETQA 1K61A 3HTJA 2YS9A 3LHQA 4IHVA 5GPAA 2EQRA 3W6VA 3SJMA 3NPIA 3JRHA 4A3LJ 1SANA 2L9RA 3GTOJ 4Y52J 5DAJA 4RBOA 1B8IA 1ETOA 5GPCA 5DS9A 5HBUA 2DA6A 5IP7J 1B72A 1BA5A 2W53A 2GENA 1JJ8C 2JN6A 2VKEA 3G1LA 3ZQFA 1JUMA 4D7MA 5F0HA 3VIBA 5FLVA 4CGRA 3LNQA 4JNNA 2MG4A 1UI5A 1AHDP 1AKHA 1BL0A 1NK2P 2LFBA 3S1NJ 3IH3A 3GZIA 2H1KA 2XB0X 5FHPA 3HOYJ 4B1RA 2EBIA 1BW6A 2ME6A 3JRFA 2H8RA 2Y9YA 4AYBN 2R5YB 5FKOA 2OI8A 4DZPA 3QPLA 3A03A 3RZDJ 3HB9A 3S1QJ 1MBFA 2ZOZA 2JA7J 1IG7A 2QWTA 3NI7A 2XRLA 2Y0SN 4BBSJ 3HBLA 5IYCJ 3HDDA 3S15J 3F1BA 3S1RJ 1TWFJ 2LK2A 4AC0A 4ME9A 1P7JA 2YUSA 2PMZN 4NN1A 4Y7NJ 5D19A 2ZCXA 5D1RA 2HYJA 1O4XA 3S16J 1TWCJ 3IH2A 1P7IA 2XPWA 2K9QA 1A5JA 2JK3A 2YU9J 2Y30A 4FE7A 4PXIA 2JA5J 4GFLA 3HM5A 4MXMA 3BJBA 2CUFA 2MW8A 4M3FA 4HNVA 1FIAA 5EG0A 3L1PA 4DZJA 1ZKGA 2LR8A 4DYCA 1ZR4A 4J19A 1MNMC 3HGGA 1W0UA 2EZLA 5M5YJ 1ETKA 3GTLJ 2NP5A 4B4CA 3QQAA 3VUQA 4FISA 1SFOJ 2QIBA 4A3JJ 2G0EA 5IP6A 3VVZA 5DTDA 3V78A 2DMNA 3G7RA 2HQ5A 3A02A 1UMQA 4MLOA 1HLVA 2ECCA 3GTPJ 3TP0A 4AUXA 3S17J 3MVPA 1HOMA 1ETVA 1OCPA 3WHCA 3HTAA 1DU6A 5FKLA 5FKKA 2PZ9A 1RKWA 2OERA 3OOUA 2K9SA 3RKQA 2KDZA 2NVTJ 5H9TA 3A01B 2ECBA 3ON4A 4B3AA 3KZ9A 2M34A 1JT6A 2V57A 1I50J 3AQSA 2XGCA 1JT0A 9ANTA 4A69C 3BR1A 3TW6A 2MGQA 5FLMJ 2R92J 2G7GA 3HTHA 5K7ZA 1A6IA 5C4XJ 1YRNB 2XPVA 1Q1VA 2FQ4A 4A3FJ 2DA4A 2DA1A 1WH7A 3AQTA 4V2GA 2LD5A 1U9OA 1JKOC 2DMUA 2ME0A 2R7ZJ 3FISA 1ENHA 3P9TA 4KWAA 4JP0A 3T6NA 5HAWA 3HOUJ 1U9NA 2HYTA 2GM4A 3PO2J 1Z0XA 5CXIA 2EH3A 1ZR2A 3DPJA 4ABZA 4GFKA 5E3MA 2WAQN 4X6AJ 3LSJA 2R93J 3S2DJ 1AU7A 3GTMJ 3RD3A 2O7TA 1E3OC 1W0TA 1S7EA 3BQYA 3SFIA 2X9DA 3H0GJ 4RDUA 1GDTA 1IRZA 2COBA 4MK6A 3H3VK 3Q3SA 3GTQJ 1UI6A 2K9NA 3G56A 2HOTA 4QIWN 2M8GX 5CXGA 4A93J 2ZB9A 4JYKA 3LJLA 1CQTA 2E2IJ 1GVDA 3CDLA 3QPSA 2DJNA 1TC3C 4IHXA 4A3CJ 2LVSA 2PBXA 2HOAA 4MIMA 1OFCX 1IUFA 4C3HJ 1IV6A 3ANGA 4UUSB 3BR2A 3BR5A 5F08A 2F07A 4IHYA 3NARA 5M3MJ 4CYCB 2LKXA 3O8HA 3JRAA 1U8BA 4C3JJ 3ZOBA 3PPBA 3BHQA 4JX4A 5IPAA 5C4JJ 2CQQA 2QF7A 3LSRA 5C44J 1VF9A 2VI6A 4FCYA 2OF7A 3BTCA 5IYBJ 3LSGA 2XDNA 1HDPA 1MSFC 4W1UA 3CCYA 2E1OA 2XPUA 2DG8A 2R5ZB 4A3GJ 3CRJA 2QOPA 3FKIJ 5E3LA 3K7AJ 1ZQ3P 2O9LA 3HOXJ 2UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEW A;  5E3N A;  3A01 A;  4D5C A;  4BY7 J;  1HDD C;  1QVT A;  2E19 A;  2I10 A;  3BTJ A;  3LWJ A;  2JA8 J;  5D18 A;  3BR0 A;  3ZQI A;  5M3F J;  1Z77 A;  3CWR A;  3Q0W A;  1PUF B;  5M5W J;  1I6H J;  3LOC A;  3FRQ A;  3D1N I;  4M3B A;  3FIW A;  1LE8 B;  2NS8 A;  2REK A;  4S0H B;  4A3K J;  3HOW J;  3BR3 A;  1ZK8 A;  2EZI A;  2D6Y A;  2ZOY A;  3CJD A;  4XRS A;  1FEX A;  3HGY A;  3F0C A;  2VPR A;  4A3I J;  3PAS A;  2HXO A;  2DG7 A;  5E3O A;  4G12 A;  3QKX A;  3VW1 A;  2Y2Z A;  5J1U A;  1UG2 A;  4X1E A;  1WPK A;  1IGN A;  1I3Q J;  3G1M A;  3ZQL A;  2G7S A;  1GUU A;  1MBG A;  2L7F P;  2NOG A;  2HI3 A;  1JKR C;  2YVE A;  5J1R A;  1QRY A;  1ETY A;  2GLO A;  2VUM J;  2AHQ A;  5CW8 A;  1APL C;  2E2H J;  2OPT A;  2DMQ A;  4GCK A;  2QTQ A;  1K83 J;  4MFE A;  4C2M J;  4UDS A;  2GBY A;  4I76 A;  3BTL A;  1VFC A;  1H88 C;  3JRB A;  4M3G A;  1T56 A;  4JKZ A;  3VOX A;  3C2B A;  2X48 A;  3IH4 A;  4BXX J;  2GUH A;  3S5R A;  1HCR A;  2P81 A;  2RAE A;  1JUP A;  5FKN A;  2HOS A;  1EF4 A;  3JRI A;  3C07 A;  1H8A C;  2QKO A;  1RR7 A;  3CMY A;  3PM1 A;  4A3E J;  2WV1 A;  2LP0 A;  1XS9 A;  2R0Q C;  1FJL A;  1GV5 A;  1JJ6 C;  1VND A;  2JMW A;  4UUS A;  3ZQC A;  2NX4 A;  1MH3 A;  2DA2 A;  4ACI A;  3O60 A;  5C3E J;  2JWT A;  3OSF A;  1HF0 A;  3FK7 A;  3HTI A;  5F0F A;  5EG0 B;  3ON2 A;  3SDG A;  3S14 J;  2DMT A;  4LOC A;  2R5Y A;  3BCG A;  3EGQ A;  2ID3 A;  1NK3 P;  5C4Y A;  2XGE A;  2IU5 A;  1X58 A;  2XSD C;  5IYD J;  3BRU A;  3JSJ A;  2EZK A;  1D5Y A;  5IOZ A;  4QTR A;  3BQZ A;  1RET A;  4I6Z A;  3VP5 A;  1VI0 A;  5EGO B;  3HEF A;  3VPR A;  2DTZ A;  2R5Z A;  4C3I J;  1ORK A;  1F43 A;  2CUE A;  4M3D A;  2W48 A;  2D5V A;  5F1J A;  4XRM A;  3RH2 A;  5EZH A;  4IHW A;  4L5E A;  2O7O A;  1UHS A;  4M6V A;  3OSG A;  2TCT A;  2QCO A;  2B63 J;  2LTP A;  3RQI A;  3M3Y J;  4BY1 J;  1JTX A;  5IP9 J;  1RKT A;  3COL A;  2HKU A;  3B6C A;  3O8G A;  5IOY A;  1PUF A;  2FBQ A;  1WCM J;  1X2M A;  4A3D J;  3NNR A;  4D7N A;  5FMP A;  1MSE C;  3NAU A;  1LE8 A;  1H89 C;  2EZH A;  3TW7 A;  4NEL A;  1WGX A;  3LSP A;  1FIP A;  3NXC A;  3IUV A;  1BW5 A;  5F0C A;  1BJZ A;  1OCT C;  2M2E A;  4GFB A;  1JUS A;  3Q0U A;  5JLW A;  5EZG A;  1FTT A;  1ETW A;  5F27 A;  4XIC A;  3KNW A;  3MNL A;  2M9H A;  1MBE A;  4BBR J;  4DW6 A;  3EUP A;  1XG1 A;  3GTJ J;  2YVH A;  2NVQ J;  1MH4 A;  2UXI A;  2K40 A;  2E2J J;  1R9T J;  3HIM A;  1RPW A;  2L7Z A;  1IC8 A;  2G7L A;  3BG9 A;  2CU7 A;  5EEA A;  3TP3 A;  4M3E A;  1FTZ A;  2WGB A;  2ZCM A;  2UXP A;  2JA6 J;  2Q24 A;  3VW2 A;  4EEF G;  1MBJ A;  3ZQH A;  5F04 A;  1JKQ C;  2HXI A;  1IDZ A;  4HKU A;  3QBM A;  5GP9 A;  3HKZ N;  1NTC A;  2WUI A;  2XGD A;  2Y9Z A;  3HE0 A;  2KT0 A;  4NDL A;  3S2H J;  2MSY A;  4XRS G;  3VW0 A;  3HOZ J;  5FKM A;  3BNI A;  3GTG J;  4JX5 A;  2FX0 A;  3CQZ J;  4DYQ A;  1DU0 A;  4DYR A;  1LFB A;  1YRN A;  2IEK A;  3RZO J;  3BG5 A;  1XC5 A;  4YZE A;  3TED A;  1B8I B;  3BG3 A;  2IBD A;  1G2H A;  1OJL A;  1F36 A;  2NVY J;  5M5X J;  4XID A;  1B72 B;  1MBK A;  3HOV J;  2LY9 A;  5K7H A;  4XK4 A;  5J3L A;  1LFU P;  3MN2 A;  2FJ1 A;  5AQC A;  4IEJ A;  2L7M P;  2O8K A;  3BT9 A;  5J1Y A;  2GFN A;  2NS7 A;  4FE4 A;  2AO9 A;  2CJJ A;  3FK6 A;  1AKH B;  3I4M J;  3JR9 A;  3BR6 A;  2X6O A;  2NP3 A;  3GEU A;  1TWG J;  2DMP A;  4W97 A;  3ZQG A;  1SGM A;  3PO3 J;  1QVU A;  2ID6 A;  4GCT A;  2DA3 A;  4QSH A;  3Q0V A;  3JRE A;  1ZGW A;  5EDN A;  2N8G A;  4A3M J;  3E7Q A;  4JL3 A;  3VVX A;  3BTI A;  5HOD A;  5EGO A;  3OIO A;  3B81 A;  5FJ8 J;  1IJW C;  2CRG A;  2TRT A;  3KKC A;  3S1M J;  2DN0 A;  1WI3 A;  3JRG A;  3I4N J;  5HSZ A;  2DA5 A;  4FTH A;  4AF5 A;  1ETX A;  1JGG A;  2VKV A;  3V6G A;  1GV2 A;  1Y1W J;  1JTY A;  2RAS A;  5K7F A;  3M4O J;  2JJ7 A;  2RHA A;  4ICH A;  3VOK A;  2UXO A;  2CQX A;  4JX6 A;  2UXU A;  4GCL A;  5FGL A;  3GBG A;  2NVX J;  4UUT A;  5K58 A;  3NRG A;  4A3B J;  2LLK A;  4MO7 A;  4CYC A;  1WH5 A;  2IAI A;  2XB5 A;  3ANP A;  2ELK A;  3K2A A;  1ZTR A;  3E7L A;  1TWA J;  4BKX A;  3JRC A;  2L0K A;  2ZCN A;  1ITY A;  3IV5 A;  1RES A;  2G3B A;  1Y1V J;  3DCF A;  5EYR A;  5BNG A;  1POG A;  1X2N A;  3VVY A;  1MBH A;  2M0C A;  2DA7 A;  3KKD A;  4AC6 A;  5EF6 A;  2HDD A;  1TWH J;  3MKL A;  2Y31 A;  1QPI A;  3GTK J;  3JRD A;  1JKP C;  3G1O A;  3UKG A;  4MFD A;  3WHB A;  1IDY A;  1U78 A;  5EFY A;  2FD5 A;  4V2F A;  3B6A A;  1GT0 C;  1T33 A;  4L62 A;  5JLX A;  2WB1 N;  4D5F A;  1ETQ A;  1K61 A;  3HTJ A;  2YS9 A;  3LHQ A;  4IHV A;  5GPA A;  2EQR A;  3W6V A;  3SJM A;  3NPI A;  3JRH A;  4A3L J;  1SAN A;  2L9R A;  3GTO J;  4Y52 J;  5DAJ A;  4RBO A;  1B8I A;  1ETO A;  5GPC A;  5DS9 A;  5HBU A;  2DA6 A;  5IP7 J;  1B72 A;  1BA5 A;  2W53 A;  2GEN A;  1JJ8 C;  2JN6 A;  2VKE A;  3G1L A;  3ZQF A;  1JUM A;  4D7M A;  5F0H A;  3VIB A;  5FLV A;  4CGR A;  3LNQ A;  4JNN A;  2MG4 A;  1UI5 A;  1AHD P;  1AKH A;  1BL0 A;  1NK2 P;  2LFB A;  3S1N J;  3IH3 A;  3GZI A;  2H1K A;  2XB0 X;  5FHP A;  3HOY J;  4B1R A;  2EBI A;  1BW6 A;  2ME6 A;  3JRF A;  2H8R A;  2Y9Y A;  4AYB N;  2R5Y B;  5FKO A;  2OI8 A;  4DZP A;  3QPL A;  3A03 A;  3RZD J;  3HB9 A;  3S1Q J;  1MBF A;  2ZOZ A;  2JA7 J;  1IG7 A;  2QWT A;  3NI7 A;  2XRL A;  2Y0S N;  4BBS J;  3HBL A;  5IYC J;  3HDD A;  3S15 J;  3F1B A;  3S1R J;  1TWF J;  2LK2 A;  4AC0 A;  4ME9 A;  1P7J A;  2YUS A;  2PMZ N;  4NN1 A;  4Y7N J;  5D19 A;  2ZCX A;  5D1R A;  2HYJ A;  1O4X A;  3S16 J;  1TWC J;  3IH2 A;  1P7I A;  2XPW A;  2K9Q A;  1A5J A;  2JK3 A;  2YU9 J;  2Y30 A;  4FE7 A;  4PXI A;  2JA5 J;  4GFL A;  3HM5 A;  4MXM A;  3BJB A;  2CUF A;  2MW8 A;  4M3F A;  4HNV A;  1FIA A;  5EG0 A;  3L1P A;  4DZJ A;  1ZKG A;  2LR8 A;  4DYC A;  1ZR4 A;  4J19 A;  1MNM C;  3HGG A;  1W0U A;  2EZL A;  5M5Y J;  1ETK A;  3GTL J;  2NP5 A;  4B4C A;  3QQA A;  3VUQ A;  4FIS A;  1SFO J;  2QIB A;  4A3J J;  2G0E A;  5IP6 A;  3VVZ A;  5DTD A;  3V78 A;  2DMN A;  3G7R A;  2HQ5 A;  3A02 A;  1UMQ A;  4MLO A;  1HLV A;  2ECC A;  3GTP J;  3TP0 A;  4AUX A;  3S17 J;  3MVP A;  1HOM A;  1ETV A;  1OCP A;  3WHC A;  3HTA A;  1DU6 A;  5FKL A;  5FKK A;  2PZ9 A;  1RKW A;  2OER A;  3OOU A;  2K9S A;  3RKQ A;  2KDZ A;  2NVT J;  5H9T A;  3A01 B;  2ECB A;  3ON4 A;  4B3A A;  3KZ9 A;  2M34 A;  1JT6 A;  2V57 A;  1I50 J;  3AQS A;  2XGC A;  1JT0 A;  9ANT A;  4A69 C;  3BR1 A;  3TW6 A;  2MGQ A;  5FLM J;  2R92 J;  2G7G A;  3HTH A;  5K7Z A;  1A6I A;  5C4X J;  1YRN B;  2XPV A;  1Q1V A;  2FQ4 A;  4A3F J;  2DA4 A;  2DA1 A;  1WH7 A;  3AQT A;  4V2G A;  2LD5 A;  1U9O A;  1JKO C;  2DMU A;  2ME0 A;  2R7Z J;  3FIS A;  1ENH A;  3P9T A;  4KWA A;  4JP0 A;  3T6N A;  5HAW A;  3HOU J;  1U9N A;  2HYT A;  2GM4 A;  3PO2 J;  1Z0X A;  5CXI A;  2EH3 A;  1ZR2 A;  3DPJ A;  4ABZ A;  4GFK A;  5E3M A;  2WAQ N;  4X6A J;  3LSJ A;  2R93 J;  3S2D J;  1AU7 A;  3GTM J;  3RD3 A;  2O7T A;  1E3O C;  1W0T A;  1S7E A;  3BQY A;  3SFI A;  2X9D A;  3H0G J;  4RDU A;  1GDT A;  1IRZ A;  2COB A;  4MK6 A;  3H3V K;  3Q3S A;  3GTQ J;  1UI6 A;  2K9N A;  3G56 A;  2HOT A;  4QIW N;  2M8G X;  5CXG A;  4A93 J;  2ZB9 A;  4JYK A;  3LJL A;  1CQT A;  2E2I J;  1GVD A;  3CDL A;  3QPS A;  2DJN A;  1TC3 C;  4IHX A;  4A3C J;  2LVS A;  2PBX A;  2HOA A;  4MIM A;  1OFC X;  1IUF A;  4C3H J;  1IV6 A;  3ANG A;  4UUS B;  3BR2 A;  3BR5 A;  5F08 A;  2F07 A;  4IHY A;  3NAR A;  5M3M J;  4CYC B;  2LKX A;  3O8H A;  3JRA A;  1U8B A;  4C3J J;  3ZOB A;  3PPB A;  3BHQ A;  4JX4 A;  5IPA A;  5C4J J;  2CQQ A;  2QF7 A;  3LSR A;  5C44 J;  1VF9 A;  2VI6 A;  4FCY A;  2OF7 A;  3BTC A;  5IYB J;  3LSG A;  2XDN A;  1HDP A;  1MSF C;  4W1U A;  3CCY A;  2E1O A;  2XPU A;  2DG8 A;  2R5Z B;  4A3G J;  3CRJ A;  2QOP A;  3FKI J;  5E3L A;  3K7A J;  1ZQ3 P;  2O9L A;  3HOX J;  2UXH A; 
#chains in the Genus database with same CATH topology
 4HX8 A;  1T6S A;  5E3N A;  2X1D A;  3I3L A;  4RMN A;  2LY1 A;  3OS0 A;  2CWE A;  1L0O C;  1FX7 A;  3FXO A;  3R0J A;  4IF4 A;  2BY3 A;  2CGP A;  2KHM A;  4NBQ A;  3H5R A;  3ONQ A;  3FRQ A;  1G59 A;  4ZYA A;  3DBH B;  3CCJ I;  1LE8 B;  3DKX A;  3WU1 B;  3FHZ A;  3GFI A;  3HOW J;  1T98 A;  2JTV A;  2EZI A;  4NQW B;  2D6Y A;  1K78 B;  2VPR A;  4KMU X;  3CCV I;  2DG7 A;  5E3O A;  4E6K G;  1RRJ A;  1D1C A;  3B02 A;  1X4P A;  1EKE A;  3K2Z A;  4G8X A;  1O3Q A;  1I3Q J;  3HXL A;  3ZQL A;  1IGN A;  5TRD A;  4R79 A;  2HI3 A;  2NRA C;  2EIN H;  1ETY A;  3H3Z A;  2VUM J;  5CW8 A;  5BS6 A;  1MND A;  1PJR A;  1APL C;  2MYS A;  3QYB A;  3IL2 A;  2X1E A;  2BBY A;  4MFE A;  2XRN A;  2EFN A;  1I6X A;  4OMY A;  4JK1 X;  1FLI A;  3K4N A;  1VFC A;  1PDN C;  1RI7 A;  4M3G A;  4JKZ A;  1IXS B;  3DXJ F;  1NHA A;  3ZMD A;  3H3U A;  3K10 A;  2XC7 A;  2LY2 A;  2RN7 A;  2L4M A;  2RAE A;  3ZXS A;  4EM0 B;  1JUP A;  5FKN A;  1P4A A;  3ABU A;  1ZEL A;  1R1U A;  1OCC H;  2KJC A;  4NB5 A;  2WV1 A;  5CVU A;  4FAS D;  3VDX A;  1KU7 A;  1FJL A;  3W2V A;  1GV5 A;  1J5Y A;  3BPX A;  2A05 A;  3ZQC A;  2R7T A;  2DA2 A;  1ON1 A;  3CCQ I;  3O60 A;  5C3E J;  4OIO F;  1XMX A;  2JWT A;  2WAD A;  3CCE I;  1ZRD A;  3ON2 A;  1FMW A;  1F4K A;  2R7D A;  3EGQ A;  3VYR B;  2EFW A;  4A0X A;  1X58 A;  2R7F A;  5LBQ A;  5IYD J;  1G3Y A;  3O2P E;  2R7O A;  1R36 A;  5EGO B;  2DTZ A;  1RUN A;  3TO9 A;  2CV2 A;  5F6F A;  1F43 A;  1KYZ A;  4M3D A;  3MD2 A;  2D5V A;  2LBF B;  3WTU C;  2OTJ I;  1YI2 I;  3LQQ A;  4IO9 F;  1IRF A;  3HZJ A;  3OSG A;  1FWZ A;  2RV8 A;  2C6Y A;  1OQY A;  3L2R A;  3RQI A;  3M3Y J;  4AWX B;  2XKO A;  4DBR A;  1UZC A;  1CF7 B;  2DAO A;  1WCM J;  1X2M A;  3TOB A;  3BDD A;  4C30 A;  3NAU A;  1H89 C;  3F3X A;  2EZH A;  3TW7 A;  3CME I;  4NEL A;  3LSP A;  1ZRC A;  3W3C A;  5F0C A;  2ZJR F;  3G4S I;  2A2F X;  2M2E A;  5LRR A;  3OY9 A;  3MNL A;  1ETW A;  4XIC A;  3OIQ A;  2M9H A;  4DW6 A;  3GTJ J;  3L09 A;  4HF0 A;  3BPV A;  3CMA I;  2UXI A;  2CV0 A;  3HHG A;  4PJJ A;  5DCM B;  3V7C A;  2VC0 A;  2CU7 A;  2WGB A;  2KJB A;  2JA6 J;  2Q24 A;  4EEF G;  4IJA A;  4ENJ A;  3HHH A;  4HKU A;  3A4C A;  4B8X A;  1G3W A;  4MNU A;  2YPR A;  2WUI A;  2KT0 A;  4UUV A;  3S2H J;  3CF2 A;  1TQI A;  3Q9V A;  4XRS G;  4CZZ A;  3JAM Z;  3HOZ J;  3OOP A;  2L02 A;  3GTG J;  4H4K C;  3CQZ J;  3WU2 C;  4DYR A;  1YRN A;  3RZO J;  4YZE A;  3TED A;  4NUB A;  2KQR A;  2IBD A;  4XID A;  1XB4 A;  3HOT A;  5K7H A;  2DBB A;  4XL9 A;  3WG7 H;  3EYY A;  3NEU A;  3SFZ A;  4V19 K;  4UVB A;  2DT5 A;  4E7J A;  2DOE A;  5AQC A;  2ZY9 A;  4IEJ A;  2V1N A;  4PZJ A;  1WZ2 A;  1UJ8 A;  1B1B A;  4DJA A;  4FE4 A;  2XAU A;  4HDV A;  2KMU A;  1TWG J;  2K4B A;  3ZQG A;  1SD7 A;  3CP8 A;  1YLF A;  4Y3O A;  3IWZ A;  3RYR A;  3NRV A;  4BJ5 C;  2DW4 A;  3CDH A;  1S5L C;  5J8C A;  1OR7 C;  4WK8 F;  1O7L A;  4G6T B;  1ZGW A;  2N8G A;  2BHZ A;  5D8L B;  1WFX A;  4A3M J;  2HNH A;  3HPH A;  1OCZ H;  3R61 A;  3DPT A;  3PIP F;  3IAM 2;  5IT3 A;  3B81 A;  3I4N J;  4BE0 A;  1OCO H;  2XIG A;  1ETX A;  1JGG A;  2M1B A;  2DU9 A;  1DQU A;  3BCB A;  2B3W A;  3U1D A;  2CUJ A;  2GIV A;  1KU3 A;  1NG6 A;  3ZMZ A;  5D5W B;  2HPI A;  3CC2 I;  4UV8 A;  2JJ7 A;  4BE2 A;  3ZQQ A;  3CUQ A;  2Y48 A;  2RRE A;  3L9F A;  4M73 A;  4ICH A;  3VOK A;  2UXO A;  2CQX A;  2IXS A;  4GCL A;  2E1N A;  2NVX J;  4YFK F;  5FLX K;  5K58 A;  4OIR F;  1R22 A;  1WH5 A;  3JTH A;  4F93 B;  1YO5 C;  1G6N A;  3ZCO A;  2ELK A;  2MLK A;  1ZTR A;  3E7L A;  1V4R A;  3I54 A;  4BKX A;  4L0Z B;  3ZGK A;  4LJZ F;  4IPA A;  3RIR A;  2ZCN A;  1RES A;  3KP3 A;  4E7H A;  3KCC A;  2R7R A;  2TDX A;  1POG A;  2M0C A;  4BDY A;  3KKD A;  4XKW A;  5DM7 F;  1XSD A;  1D3Y A;  5EF6 A;  5E20 A;  1TWH J;  4G7H F;  4YIF A;  2E34 A;  3G3Z A;  3UKG A;  1D0Y A;  1IDY A;  3HRM A;  3LSK A;  1U78 A;  2IP2 A;  2OU2 A;  4V2F A;  3BJ6 A;  5E8G A;  5KVR A;  1GT0 C;  3BRO A;  2BY1 A;  1YW8 A;  5HDG A;  1MGT A;  3HSE A;  1ETQ A;  2ZFU A;  1R58 A;  4PFP A;  4U7B A;  3LA2 A;  2VE9 A;  3ZMS A;  1LNW A;  2RKH A;  2PEX A;  2PMU A;  3PUB A;  3W6V A;  2P5V A;  4A3L J;  5DAJ A;  2L9R A;  4Y52 J;  1HW2 A;  4FX0 A;  1D8J A;  2ZKZ A;  5JFR A;  3H36 A;  3RJP A;  4HV6 A;  3AL0 B;  3FXJ A;  3RKW A;  2K86 A;  3ZQF A;  3BG7 A;  2V9V A;  1I5Z A;  4D7M A;  3VIB A;  2VBZ A;  2W7N A;  4JNN A;  4HV5 A;  1QZE A;  4ETS A;  3SYT A;  2F2E A;  1AHD P;  1BL0 A;  3GZ5 A;  2LFB A;  5JHU A;  3IH3 A;  3GZI A;  3P9K A;  2H1K A;  1I1G A;  2UXX A;  3ULQ B;  2V4J C;  1XMK A;  2BZT A;  4KIG A;  4D1Q A;  1G4D A;  2JUG A;  2Y9Y A;  5FKO A;  3BJA A;  1PYV A;  3RPU D;  3KLO A;  4DZP A;  1Z6R A;  1PVE A;  4KJZ A;  3IHU A;  2FNP A;  2O8X A;  2RQQ A;  3HB9 A;  3PNV A;  2HDC A;  3K4C A;  1N77 A;  5H2F C;  2LNB A;  3DTI A;  1B9M A;  1IG7 A;  2QWT A;  5GTH C;  4BBS J;  3ASO H;  4BL0 B;  2F5C A;  1S72 I;  2B7E A;  3F1B A;  1V5F A;  3DEE A;  3E5Q A;  3KZZ A;  4LIV A;  4AC0 A;  2CQK A;  2YUS A;  4KT6 A;  3QAH A;  1R00 A;  2F4O B;  4XLC A;  4PGH A;  2MD5 A;  1E0E A;  4Y7N J;  5LFA A;  2HYJ A;  2YVX A;  3PNY A;  2GIZ A;  2E71 A;  2LOO A;  3CJN A;  1ZH5 A;  2W82 A;  4II2 A;  4UNO A;  5GAH J;  3FKJ A;  2JA5 J;  4PJN A;  4GFL A;  4EGY A;  1HQC A;  4IRG A;  2MW8 A;  4M3F A;  2CFX A;  2P5L C;  3DLL F;  2EIM H;  3L1P A;  2ELH A;  2LR8 A;  2GAU A;  2HFH A;  5F1R A;  1VQ6 I;  2COM A;  5CYV A;  4PSW A;  4BEH B;  3HJE A;  4LLG F;  2EZL A;  3LFK A;  5E1X A;  4B44 A;  4LIT A;  4FET A;  2VL8 A;  3VUQ A;  2D45 A;  3R0A A;  4LIU A;  3I56 I;  1BIB A;  2VOD A;  5BOX A;  5IP6 A;  3ERM A;  5IT9 K;  3JSP A;  2HQ5 A;  3VTI A;  1Z9C A;  2ECC A;  4BJ6 C;  3S17 J;  3MVP A;  1SVM A;  3PSF A;  5L3C A;  4E7Z A;  3PQK A;  3HC7 A;  5FKK A;  2KLO A;  1S7O A;  2NVT J;  3A0H C;  2BVM A;  5CQG A;  1ZGA A;  3A01 B;  2ECB A;  4D9J A;  3JTG A;  1BBY A;  3KZ9 A;  2M34 A;  4MQV A;  3GZ6 A;  3A0B C;  4KN7 X;  2HQA A;  3OS1 A;  2HQR A;  3HTH A;  2HWV A;  3FMQ A;  1K4T A;  5ED4 A;  1YRN B;  2G9W A;  2X6X A;  3EUA A;  4BJT A;  3IKV A;  3DKY A;  4P96 A;  1WH7 A;  3S93 A;  4V2G A;  3OL4 A;  1L3L A;  1JKO C;  4FQG A;  2QKM B;  1WJA A;  2QSH X;  1SVO A;  1DPR A;  1ENH A;  4JP0 A;  3T6N A;  3L2U A;  3MZH A;  2HYT A;  5FD6 A;  1QHH D;  1IN8 A;  1R5G A;  2HYG D;  4ENM A;  4IOC F;  4X6A J;  3KP4 A;  2ZJP F;  3OYL A;  3W2W A;  4B09 A;  3GTM J;  1R5I D;  4I0A A;  1E3O C;  5L3B A;  3SFI A;  3COA C;  2X9D A;  2MAB A;  2OQG A;  4OOI A;  5JI6 A;  4RDU A;  3BP8 A;  2I5U A;  2ZME B;  2CW7 A;  3EUK L;  2WAE A;  3H3V K;  2K9N A;  5B1B H;  1ZGJ A;  3OYI A;  2HOT A;  2DDB A;  3NWS A;  2M8G X;  2QQ8 A;  2V7F A;  2K7L A;  4A93 J;  1AOY A;  1X1P A;  5HS9 A;  3LJL A;  3HSF A;  2OZU A;  3MWM A;  4KIC A;  3L2Q A;  2KIU A;  4KDP A;  2LVS A;  2PBX A;  2HOA A;  2HS5 A;  1T0F C;  2EWN A;  2VC1 A;  1OKR A;  2VKH A;  3GCM A;  1VQ7 I;  2GXG A;  4PFO A;  3I5U A;  4C3H J;  1IV6 A;  5CQE A;  3ANG A;  6PAX A;  3BR2 A;  4WWC A;  5ICE A;  1U8B A;  3ISP A;  4XR6 A;  5IPA A;  3M8J A;  3OYC A;  3ECH A;  1EH8 A;  3MKZ A;  2MA3 A;  4L9V A;  2XKP A;  3HSR A;  4OWR B;  2OF7 A;  5HNF A;  3CUO A;  2XDN A;  3SEQ A;  1MSF C;  2JRM A;  3CCY A;  2E1O A;  3R6S A;  5D4R A;  2DG8 A;  4NNJ A;  2R5Z B;  2DFI A;  2IS6 A;  1X3Z B;  3KP5 A;  2O9L A;  2EJR A;  2NVU B;  2UXH A;  1HW5 A;  3VYS B;  4ZTJ A;  3TGN A;  2EK5 A;  4HG2 A;  2FEZ A;  3RKX A;  4D5C A;  4BY7 J;  3KYC B;  2I10 A;  3KYD B;  1LPQ A;  3BR0 A;  5M3F J;  3Q0W A;  2OTL I;  1MDM B;  1PUF B;  4PJL A;  5FRN A;  1B9N A;  2ZXI A;  3FIW A;  4H0E A;  2NS8 A;  3F22 A;  1XDS A;  1TLH B;  4M6Y A;  1J0R A;  3BR3 A;  5KAF C;  3CJD A;  4BUP A;  1FEX A;  3ESW B;  3F0C A;  3OMY A;  4Y4R A;  2M4K A;  1QNT A;  2BXZ A;  2RGV A;  4LD5 A;  3QKX A;  1V55 H;  3VW1 A;  5D6E A;  5J1U A;  1UG2 A;  4X1E A;  4ZC3 A;  1H9G A;  2FA5 A;  4MTE A;  2A6H F;  2DOD A;  2UWM A;  1X1B A;  2K27 A;  1SD5 A;  4I02 A;  2LKS A;  2L7F P;  2JSC A;  1JKR C;  4KYW A;  2EFO A;  4ESJ A;  1KGS A;  3GFL A;  4XMY A;  3H9J A;  3K4J A;  2IW5 A;  3AFH A;  2AHQ A;  2E7W A;  3BZC A;  3F9K A;  1VQ5 I;  2K9M A;  4PJ0 C;  4BNC A;  5KNL A;  2F5V A;  5GAG J;  2QTQ A;  1K83 J;  3NQO A;  4KT5 C;  4LG0 B;  3DEU A;  1EA3 A;  1YS7 A;  1VZ0 A;  3K0L A;  2O0Y A;  3ZQ7 A;  3E0J B;  1T56 A;  3VOX A;  5LRS A;  3S3N A;  1J2X A;  1Y6I A;  2V6C A;  2IA0 A;  4BXX J;  2GUH A;  1Y0N A;  2HGC A;  3QPT A;  4R1H A;  2JVG A;  3V7S A;  3QPH A;  3BC8 A;  1RR7 A;  2VQL A;  3OR2 C;  3CMY A;  2IPQ X;  2LP0 A;  2P6T A;  4B47 A;  1BOA A;  1E17 A;  2HVS A;  4JQF A;  1VND A;  2JMW A;  3OWT A;  5FD5 A;  3T8T A;  5DDG A;  1SMY F;  2NX4 A;  1OIS A;  3AL0 C;  2VOP A;  2I8D A;  4XOP A;  3CLQ A;  4II3 A;  1YJ9 I;  5F0F A;  3OYM A;  4BH9 A;  2KIM A;  3SDG A;  2R7V A;  3M07 A;  2JUC A;  3S32 A;  2ID3 A;  3JSO A;  1S3J A;  2DK5 A;  4RB1 A;  2XAG A;  2OD5 A;  4RA2 A;  5L3F A;  4OIQ F;  3BRU A;  1WHU A;  2EZK A;  3WGG A;  1D5Y A;  5HDK A;  5IOZ A;  1VI0 A;  3DLA A;  3EET A;  2PX9 A;  1IF1 A;  4NC6 A;  2CUE A;  4EMS A;  2W48 A;  2H27 A;  4XRM A;  3RH2 A;  2KIQ A;  2ISZ A;  5EZH A;  4IHW A;  4L5E A;  2IA2 A;  4EVI A;  3K69 A;  3K1M A;  3BZK A;  1U2W A;  4YRV A;  2VJJ A;  1GHC A;  3GX4 X;  2FOW A;  3GLX A;  1O3S A;  5D5U B;  4S04 A;  4BY1 J;  1SD4 A;  1KQ9 A;  3WTV C;  1JTX A;  3RYP A;  2HKU A;  1ZYR F;  3CLO A;  3BLY A;  5ILU A;  5FMP A;  4D7N A;  3JW4 A;  2A07 F;  2J5O A;  4IL6 C;  3F21 A;  1EH7 A;  3HG9 A;  1LB2 A;  3L7W A;  4AM3 A;  1RUO A;  2STW A;  4GFB A;  2G7U A;  4ENN A;  3FDY A;  1EJ9 A;  5JLW A;  3C7J A;  1KYW A;  3CO6 C;  1MBE A;  2QA4 I;  3EUP A;  2CS3 A;  3P9C A;  2K40 A;  5DD4 A;  1UB9 A;  3Q9S A;  4M6X A;  1R9T J;  2L7Z A;  1IC8 A;  4L5I A;  3BG9 A;  5KHD A;  5EEA A;  2LMD A;  3TP3 A;  2ZCM A;  3MZ8 A;  4FT8 A;  4RGS A;  2QQB A;  4K2E A;  1MBJ A;  1Y56 A;  5F04 A;  4CO8 A;  1IDZ A;  4DGW B;  3QBM A;  1NTC A;  3HPG A;  1IZ1 A;  4KN4 X;  3GLL A;  4B43 A;  3GVA A;  4NDL A;  2NXN B;  4MTD A;  3VW0 A;  1TQM A;  2K85 A;  3IUO A;  3CZ6 A;  2O6G E;  3GEZ A;  1BI0 A;  2EIJ H;  3KZI C;  1A6Q A;  3LST A;  4YFX F;  1SFX A;  3HRT A;  5E17 F;  1BI1 A;  2DFE A;  1BN5 A;  1UFM A;  3BG5 A;  4F55 A;  3I64 A;  1Y8Q B;  1F36 A;  5M5X J;  1YIO A;  1B72 B;  1IO2 A;  4X0G A;  3V8K A;  1F5T A;  2CW8 A;  2L7M P;  3OYH A;  2F5E A;  1NG7 A;  5J1Y A;  2GFN A;  1CGP A;  2JVH A;  1WJE A;  2Q1Z B;  4HQM A;  3JR9 A;  1AKH B;  3BR6 A;  3I4M J;  3KET A;  3CCM I;  3E1S A;  3PO3 J;  3S2W A;  5J4V A;  4LMY A;  1FYL A;  2LRD A;  2DA3 A;  1OLT A;  4QSH A;  4WCG A;  3JRE A;  3MMY B;  3TQN A;  3DWL E;  2GXB A;  3M9A A;  4M71 A;  3VVX A;  2BXY A;  3BTI A;  5HOD A;  1WSU A;  2ZCW A;  1R49 A;  1IJW C;  1BM9 A;  2TRT A;  2Q2E A;  2DN0 A;  1H9T A;  2YR2 A;  2DA5 A;  3KFW X;  3F72 A;  2EV0 A;  4ZH4 F;  2CG4 A;  5BMZ A;  1GV2 A;  1R23 A;  2HR3 A;  3I71 A;  1BR2 A;  2ZJQ F;  3AG1 H;  3FMR A;  5EEH A;  4ZDO A;  5FFX A;  2NOJ B;  2ZME C;  2RHA A;  4DVY P;  4Y33 A;  5JVT A;  4EV0 A;  4RAZ A;  4GRI A;  4P9F A;  1LFP A;  4LB5 A;  3KX2 A;  4F92 B;  3GZN B;  1IXC A;  2L0K A;  2H94 A;  1ITY A;  3K6G A;  1Y1V J;  4XLE A;  5BNG A;  3VEP A;  1W7P A;  1N78 A;  5B1A H;  2WTE A;  5CJ9 A;  2QGU A;  5K5O A;  4AC6 A;  2V79 A;  1YQA A;  2WC2 A;  4LG3 A;  2FBH A;  3C2G A;  2DOF A;  4AIK A;  3F8C A;  3G1O A;  4BDZ A;  4MFD A;  2NNY A;  3WHB A;  1USS A;  5HVQ C;  2R4G A;  1N75 A;  1B59 A;  1D1B A;  4YEJ A;  5TGT A;  1PP7 U;  2FD5 A;  1T39 A;  5B5E C;  1OCR H;  2MBF A;  2WB1 N;  2MLG A;  2MC3 A;  2FUG 2;  3C3W A;  2AXT C;  4EJW A;  1R7J A;  3HTJ A;  1XN7 A;  2YS9 A;  2LKP A;  2EQR A;  3TDU C;  3SJM A;  2R7S A;  1IW7 F;  3NPI A;  2W85 A;  4P55 A;  3JRH A;  5LHI A;  1SAN A;  3GTO J;  3OS2 A;  4FX4 A;  4RBO A;  3H1C A;  1B8I A;  1ETO A;  4O5V A;  5DS9 A;  1U3E M;  1ACI A;  5HBU A;  3BZ6 A;  2DA6 A;  5IP7 J;  1Z3X A;  3HUG A;  4E7I A;  2GEN A;  1JJ8 C;  2JN6 A;  4IRV A;  2HPM A;  2M7B A;  4BU2 A;  2OV7 A;  2LF7 A;  3WTY C;  2MH9 A;  4UXN A;  2E36 A;  4CGR A;  2L54 A;  2WAF A;  4WF2 A;  3UR3 C;  3ZN1 A;  5E79 C;  1NK2 P;  2PMH A;  2XB0 X;  2VON A;  2H1L A;  2EBI A;  1BW6 A;  3M1E A;  2R7W A;  5DV5 A;  3JRF A;  4AYB N;  2OI8 A;  3DPL C;  5CPR B;  4J01 A;  1KU9 A;  3L00 A;  3A03 A;  4BHP A;  4C2M A;  2DK8 A;  1MBF A;  1SAU A;  2JA7 J;  2QQA A;  1I39 A;  3HBL A;  5IYC J;  3S15 J;  3HL2 A;  3S1R J;  1TWF J;  2KP6 A;  3K1N A;  4ME9 A;  4RAF A;  2H6B A;  3FZV A;  2PMZ N;  5HS7 A;  4IX7 A;  1YOV B;  1JGS A;  4NN1 A;  3JAM K;  1QU3 A;  4I01 A;  1TWC J;  1WJC A;  2M8E A;  2W57 A;  3GUD A;  3V7R A;  2UXN A;  2YU9 J;  2Y30 A;  1MJB A;  3DP7 A;  3DFG A;  2A5W A;  5D4S A;  3HM5 A;  2CUF A;  4HNV A;  4DOZ A;  3IP4 B;  1FIA A;  4YG2 F;  5EG0 A;  4TV7 A;  4DYC A;  1ZKG A;  1R6R A;  4ZJZ A;  3WTX C;  3HYI A;  5LHH A;  3K4M A;  1MNM C;  3HGG A;  1W0U A;  5M5Y J;  1GXQ A;  2W84 A;  2XV4 S;  4MGR A;  3WE3 A;  4B4C A;  3VYU B;  3FXM A;  3KE2 A;  4A3J J;  4BXU A;  3VVZ A;  5DTD A;  3G7R A;  4Q4Z F;  3A02 A;  4MLO A;  4U88 A;  2VPL A;  1HLV A;  3GTP J;  5E1Z B;  1DU6 A;  1HKS A;  3NS4 A;  1FP1 D;  4XKV A;  1HST A;  2HKX A;  3NWT A;  1RKW A;  2PZ9 A;  4CCM A;  3J7Z I;  3U9G A;  1ZN2 A;  5J4Y A;  4HZF A;  3ON4 A;  5DUK A;  3K1P A;  5HOO A;  1G3T A;  2DFH A;  4ITV A;  2DTR A;  3WTW C;  4BE1 A;  4CH7 A;  2KRH A;  4RLF A;  3F23 A;  4OD4 A;  1REP C;  2ZBK A;  1ZAR A;  2MGQ A;  3H9G A;  5ILS A;  5FLM J;  5JHF A;  4U0W A;  5E1W A;  2EFP A;  1IN7 A;  2EIL H;  1A6I A;  2HVR A;  1VTN C;  2XPV A;  1Q1H A;  4YII A;  4ZZL A;  4MEX F;  1H0M A;  1Q1V A;  2FQ4 A;  2QEN A;  4A3F J;  4HRI A;  2E1C A;  1IRG A;  3F8N A;  2FQ3 A;  3M8F A;  4HQE A;  4G7Z F;  2DMU A;  2ME0 A;  1VQM I;  2R7Z J;  3FIS A;  2P4W A;  3AKZ A;  4I09 A;  3GWZ A;  5GAE J;  1R5H A;  2UUZ A;  4XLP F;  1QA6 A;  5HAW A;  4CCK A;  4OIN F;  2IA1 A;  4XSZ F;  1IAW A;  2GM4 A;  4M9Z A;  3PO2 J;  1Z0X A;  1V5G A;  2FRH A;  1D1A A;  3PIO F;  3MKW B;  1YTY A;  2WB1 A;  2EH3 A;  1X3W B;  1J75 A;  5E3M A;  1ZHF A;  1FY7 A;  1WJF A;  2FNA A;  3EUH A;  5CKT A;  1P4X A;  5CVV A;  3WOD F;  3ZMT A;  4A6D A;  2O7T A;  1YIJ I;  1K79 A;  3IRR A;  2X85 A;  1W0T A;  1MMN A;  3MQ0 A;  3BQY A;  3DU6 A;  3HIF A;  4BQO A;  1S9H A;  3H0G J;  2Q2E B;  3ZR8 X;  2RQP A;  3IC7 A;  3Q3S A;  1R71 A;  1UI6 A;  3T0Y A;  3G56 A;  2K3F A;  4AVP A;  2GA2 A;  5CXG A;  1JE8 A;  4UV9 A;  4JYK A;  4KIB A;  1R4N B;  2YX4 A;  1XSV A;  2DJN A;  2M45 A;  4IHX A;  4RGX A;  1W5T A;  2EPF A;  3OYB A;  3BR5 A;  5F08 A;  2A61 A;  4PJM A;  3OL3 A;  4AYB A;  4CDG A;  3H9Q A;  3JRA A;  4ON0 A;  4C3J J;  2VE8 A;  4UVC A;  4HST A;  1N25 A;  1XCB A;  2CQQ A;  3ZRG A;  4BXF A;  4JOM A;  1HKQ A;  3DBL B;  1SC7 A;  3PQJ A;  5DUI A;  2VI6 A;  4LFU A;  4AD9 A;  2X51 A;  4MHG A;  3V8J A;  1HDP A;  1FOK A;  4W1U A;  2XAH A;  4AIJ A;  4A3G J;  2PMZ A;  3CRJ A;  2H8W A;  3U2R A;  4G6Q A;  5E3L A;  4CUG A;  2CO5 A;  3HOX J;  5J6X A;  2DPU A;  3C1D A;  1BR4 A;  2VQH A;  2K5C A;  4CCO A;  3LFU A;  4IXA A;  2HEO A;  2GXA A;  2A68 F;  3H0D A;  2MD0 A;  2F4M B;  2QKL B;  3LWJ A;  2MFZ A;  3LSH A;  5D18 A;  1ZAO A;  4E7L A;  1OYI A;  1OPC A;  4XN0 A;  3PJR A;  4R8H A;  4CZC A;  2WY7 Q;  3PL8 A;  3HTS B;  1ZRE A;  4IHT A;  1ERD A;  4NC8 A;  2ZOY A;  4XRS A;  1FPQ A;  3HGY A;  1Z7L A;  4A3I J;  3PAS A;  4U7D A;  4G12 A;  1TW3 A;  2JPB A;  1OR7 A;  3HOS A;  5AON A;  1WPK A;  3SWH A;  3G1M A;  1MBG A;  5TIS C;  1K6O A;  2LG4 A;  3TDZ C;  3N4M A;  2YVE A;  1X19 A;  2UV1 A;  3QP6 A;  4N9I A;  3FXR A;  2GZW A;  4HNU A;  2E2H J;  4IRI A;  2OPT A;  3D5S C;  2DMQ A;  3KIO A;  3CJR B;  4YEL A;  4GCK A;  2KZV A;  3E6B A;  2BVL A;  4C2M J;  4UDS A;  2GBY A;  2L4A A;  2IT0 A;  1DDN A;  4I76 A;  2M30 A;  2FSW A;  3BTL A;  4BS9 A;  1FOW A;  3M8E A;  3C2B A;  2KRF A;  2F48 A;  3RI4 A;  2A3S A;  3IH4 A;  1Y0U A;  3S5R A;  1HCR A;  1HXD A;  3GXO A;  1R1V A;  2P81 A;  1DP3 A;  1EF4 A;  4XN3 A;  2DT7 B;  3C07 A;  2XUB A;  3E6C C;  5ILV A;  3CES A;  4RB0 A;  4A3E J;  1XS9 A;  3KLN A;  1WI9 A;  5EEG A;  4WXD A;  1JJ6 C;  2L3D A;  4XOT A;  2VB6 A;  4UUS A;  3CCU I;  4ACI A;  3IKT A;  5TJJ A;  1DGW Y;  4CA0 A;  5EG0 B;  1T95 A;  4HOB A;  1S7A A;  3S14 J;  4LOC A;  4F3Q A;  2R5Y A;  2DDA A;  1T38 A;  5C4Y A;  2QEX I;  4CHU A;  1XGO A;  2L2O A;  4RAG A;  2ZNY A;  4N4N B;  4ZYH A;  2XSD C;  1WJD A;  2DO7 A;  2WWY A;  3JSJ A;  4U87 A;  1BR1 A;  4QTR A;  3BQZ A;  1RET A;  3QWL A;  3OYG A;  3N97 A;  4KIS A;  3VP5 A;  3VPR A;  4QWQ A;  4A2U A;  1MD0 A;  2LC2 A;  1ORK A;  4C3I J;  2VBX A;  2GOM A;  4EAT A;  1J7K A;  3FF5 A;  5F1J A;  3QU3 A;  4RLQ A;  3CJT B;  1VQO I;  2O7O A;  1UHS A;  2ESH A;  4GXO A;  4GDF A;  2IGM A;  5HLH A;  3CUQ B;  2LTP A;  2IS2 A;  2ISY A;  2H09 A;  1HC8 A;  3H92 A;  2IS4 A;  4A3D J;  3NNR A;  4BGD A;  1MSE C;  4C2T A;  1LE8 A;  3B73 A;  2V26 A;  4U0V A;  1FIP A;  3I53 A;  3K4B A;  3IUV A;  1WJ5 A;  4NQW A;  1IRX A;  1BW5 A;  4XSX F;  1BJZ A;  1OCT C;  1P4W A;  2Z33 A;  3WG9 A;  4N9H A;  3EDP A;  1JUS A;  4OIP F;  3OR1 C;  5EJC A;  3FXK A;  1FTT A;  5F27 A;  1QQI A;  3AG4 H;  4BBR J;  2W1O A;  3K70 D;  3ABK H;  2V1X A;  1MH4 A;  1UHM A;  4BQN A;  2E2J J;  1ONV A;  2IGO A;  2OCE A;  4YFN F;  3HIM A;  1RPW A;  3KZY A;  2G7L A;  2DQL A;  1EH6 A;  3K8P C;  4XLA A;  4KUM A;  3F6V A;  1Z21 A;  1UAA A;  4CCL A;  4UY8 I;  1IN6 A;  1I3A A;  3ZQH A;  4HDU A;  2O61 A;  1JKQ C;  2HXI A;  1RR8 C;  2FBK A;  1F1Z A;  1KA8 A;  2ZSI B;  2XGD A;  2Y9Z A;  3HE0 A;  1KON A;  4UHT A;  3VOE A;  1TNS A;  2MSY A;  1QHG A;  2L9S A;  5FKM A;  3TO6 A;  1RC9 A;  4AIH A;  4D0P A;  2FX0 A;  3FM3 A;  3TBI A;  4ENK A;  3CC7 I;  2OUM A;  1LFB A;  2F4I A;  2K4J A;  4ZDL A;  2GWR A;  2CW0 F;  1G2H A;  1OJL A;  1WWX A;  2NVY J;  3HOV J;  3I58 A;  1MBK A;  2BYV E;  2LY9 A;  4EJO A;  4RB2 C;  4XK4 A;  1D8K A;  1GXP A;  3MN2 A;  5KCM A;  5D8K B;  2XDV A;  4OU0 A;  1ZLJ A;  4L18 B;  2DFF A;  3WU0 A;  3BT9 A;  4MEY F;  3CF5 F;  1YIT I;  2AO9 A;  2R3S A;  1QZZ A;  1FYK A;  2CJJ A;  4G7O F;  2X6O A;  5LEK A;  3GEU A;  4RS8 A;  3BJO A;  4PDK A;  1FNN A;  1SGM A;  4L9J A;  1QVU A;  2Z9O A;  1XGM A;  1YG2 A;  2ZC2 A;  4GCT A;  4DQ2 A;  2O3F A;  5K5R A;  5EDN A;  1GVJ A;  3H35 A;  1P2F A;  4NC7 A;  5EGO A;  1S29 A;  1UCR A;  2IGN A;  5FJ8 J;  2CRG A;  3S3O A;  4XQF A;  1P92 A;  3KKC A;  1WI3 A;  1W1W E;  5KAI C;  3JRG A;  5HSZ A;  4ANJ A;  3A2K A;  2VKV A;  2VKD A;  2F5D A;  1Y1W J;  1U5T A;  4ESF A;  1JTY A;  1A35 A;  4RM3 A;  3PSI A;  2NAZ A;  5K7F A;  3M4O J;  2XRO A;  2IVM A;  1F9N A;  1TL8 A;  2FE3 A;  4XNF A;  1BJA A;  4F52 A;  2PJR A;  2FJI 1;  4E4H A;  2HVQ A;  3F8F A;  4A3B J;  4CYC A;  2IGK A;  2IAI A;  3GW2 A;  3RQ4 A;  3ANP A;  4HYE A;  2OCC H;  2JSP A;  3ZN0 A;  1WVR A;  3JRC A;  2P7C B;  3QOP A;  3IV5 A;  1X1A A;  3DCF A;  4HX7 A;  1LEA A;  1MBH A;  5LGT A;  2DA7 A;  2QLZ A;  2V1U A;  2O03 A;  3ABL H;  2Z5U A;  4KA4 A;  2HDD A;  1YJN I;  1G3S A;  2LRE A;  2Y31 A;  1QPI A;  5DCM A;  3GTK J;  3JRD A;  1TZL A;  5DCF A;  1JKP C;  2LSO A;  2PG4 A;  2DYS H;  4CYD A;  2VBW A;  5EFY A;  3B6A A;  3GFJ A;  4RGR A;  3ZMV A;  2DQR A;  1LDJ A;  3KPH A;  4HA8 A;  5JLX A;  4XBF A;  2PQ8 A;  2HZT A;  4D5F A;  2QYO A;  2VBY A;  3T5X A;  5LD2 C;  3JCU C;  2VXZ A;  2ZXW H;  4E7S A;  5BQT A;  1TT0 A;  5GPA A;  3LHQ A;  4LK1 F;  1K7A A;  2Y75 A;  3FXQ A;  2ZJ2 A;  1HA8 A;  1T0F A;  4EJV A;  5GPC A;  3IAS 2;  1XPX A;  3WTS C;  1BA5 A;  1XX5 A;  2X6Y A;  5KK1 A;  1QO0 D;  1TNT A;  2QZ8 A;  2RDP A;  3G1L A;  3X2Q H;  4BQQ A;  4PCQ A;  4LK0 F;  4L0Y B;  3E5U A;  2MG4 A;  3K70 C;  5H6Q A;  3S1N J;  2K9L A;  2Y0M A;  1W36 D;  3RPU A;  1YX5 A;  2VJI A;  4IQ4 A;  3L2C A;  2KIS A;  4WX9 A;  1OMI A;  3F6O A;  1Y8R B;  5FRO A;  1ON2 A;  3SXY A;  1SFU A;  2E1M B;  3MAJ A;  1FYM A;  3DQV C;  2H8R A;  4XKC A;  2R5Y B;  4HLX A;  5FRM A;  3I55 I;  3FMS A;  2HDW A;  3QPL A;  4P9U A;  2QM3 A;  3RZD J;  3S1Q J;  2RNJ A;  3MZY A;  1Z3Y A;  4O3M A;  4KIT B;  3DU5 A;  4EGZ A;  2Y0S N;  3HDD A;  1YHQ I;  1W4M A;  2F6C A;  5ICF A;  1V54 H;  1WKM A;  1FBQ A;  3ABM H;  2L5Q A;  2EV5 A;  2ZCX A;  2M5W A;  3S16 J;  1O4X A;  2V9P A;  4PK4 A;  5D1R A;  3IH2 A;  1P7I A;  4FHT A;  2XPW A;  4BHC A;  2K9Q A;  1A5J A;  2ICW G;  2JK3 A;  3H5A A;  1W5C C;  4FE7 A;  1X1C A;  5LLQ A;  3SZG A;  2JQ7 A;  2PLY A;  4MXM A;  2EA4 A;  4M9X A;  5HLG A;  2ZSH B;  4DZJ A;  4LB6 B;  3O3K A;  1ZR4 A;  2Q0O A;  1E3P A;  2A69 F;  1MJA A;  2L9N A;  3COL A;  1ETK A;  2NP5 A;  3K4L A;  3Q5F A;  3OYJ A;  1T2K A;  4EQQ A;  2QIB A;  2XAJ A;  2QSF X;  1Z7U A;  2DMN A;  3H5N A;  4Y17 A;  4CCN A;  3TP0 A;  4AUX A;  1HKT A;  3HTA A;  4B48 A;  2HU9 A;  3QOE A;  2OER A;  3R4K A;  2NS0 A;  4OAZ A;  5HS8 A;  2JT1 A;  3RKQ A;  2AXL A;  5H9T A;  2CSO A;  2VIX A;  1HSJ A;  4B3A A;  4L9N A;  1JT6 A;  4EM2 A;  2Z1D A;  1A04 A;  4M72 A;  3LA7 A;  3AQS A;  9ANT A;  3ASN H;  4CXF A;  3IRQ A;  1HBX G;  2R92 J;  2G7G A;  3CUQ C;  1EV7 A;  3SZP A;  2PI0 A;  1IN5 A;  3HTU A;  4ZYG A;  1LQ1 A;  4QPQ A;  3I59 A;  3AQT A;  2LD5 A;  1U9O A;  4RB3 C;  3BG6 A;  2CH0 A;  2R7Q A;  2OQR A;  4F91 B;  1G8X A;  2L01 A;  3P5J A;  2L9V A;  2KPM A;  3BCA A;  1XMA A;  4P1W A;  5D6F A;  2B1E A;  1U9N A;  5HNH A;  1DP7 P;  3TL4 X;  2X1C A;  5CXI A;  4GFK A;  5JVG F;  1V3F A;  2P5K A;  1U0J A;  2WAQ N;  1QPM A;  2R93 J;  1BC7 C;  3S2D J;  3RD3 A;  4QPO A;  4HBL A;  2RNG A;  5L3D A;  1S7E A;  1VQK I;  4IHS A;  2XF5 A;  4XOR A;  1GDT A;  4KNY A;  2CMP A;  1UST A;  2COB A;  3GTQ J;  4MK6 A;  3U1K A;  3EUH C;  3BY6 A;  4QIW N;  1U5T B;  2V9K A;  3KP6 A;  3G6E I;  3ZPL A;  4PUS A;  2ZB9 A;  4HLY A;  1CQT A;  1JI8 A;  2E2I J;  1QZY A;  3G73 A;  1GVD A;  2YX7 A;  5IY5 H;  1JXS A;  1JHH A;  3GF2 A;  4MIM A;  3L2W A;  2PJR B;  1IUF A;  1OFC X;  1E2X A;  1UHW A;  1XSX A;  2LDU A;  4Z6Y A;  2FF4 A;  1MMS A;  3K9T A;  3WTZ A;  4IHY A;  3OYE A;  5M3M J;  1FOX A;  4CYC B;  3ZP5 A;  1W36 C;  2BOL A;  3ZOB A;  4BEH A;  1VQ4 I;  4KMF A;  3BHQ A;  4JX4 A;  4I98 B;  4GCV A;  5HLT A;  5E8I A;  4O6J A;  1VF9 A;  1U8R A;  1YE9 A;  2XGX A;  3AAF A;  5DEQ A;  1ULY A;  3I0T A;  4FCY A;  4OAY A;  2Y0S A;  1VQN I;  3MKY B;  1Y39 A;  4AVZ A;  4KIF A;  3FXU A;  2QOP A;  3FM5 A;  3FKI J;  3W6K B;  3K7A J;  4IKF A;  2XF6 A;  2WBM A;  1LDD A;  3LSI A;  3DEW A;  3A1Y A;  1ZG3 A;  3FX3 A;  2K02 A;  3A01 A;  1MJ9 A;  3E5X A;  1QVT A;  1T8I A;  1HDD C;  1MMG A;  2E19 A;  5JR3 A;  3BTJ A;  2JA8 J;  2PJP A;  4EJU A;  3CWR A;  4N0B A;  3ZQI A;  1Z77 A;  4F7Z A;  2FXA A;  3MFK A;  1FZP B;  3TKY A;  1ZLK A;  2QBY A;  1P9Q C;  1YYV A;  5M5W J;  1I6H J;  3LOC A;  3D1N I;  4M3B A;  4RAY A;  5B3S H;  5DM6 F;  2REK A;  4S0H B;  4A3K J;  3G71 I;  1ZK8 A;  2KZG A;  1I1S A;  1K4S A;  1BC8 C;  3E97 A;  1R1T A;  4ZDP A;  3CCS I;  1Z91 A;  2HXO A;  2Z99 A;  1STZ A;  2Y2Z A;  4A5N A;  1MZB A;  4E7K A;  4CSW A;  3KEY A;  2BEO A;  2HKO A;  2KRC A;  4I99 C;  5CVR A;  1VQ8 I;  3G2B A;  4I7H A;  2G7S A;  1GUU A;  4Y13 A;  2NOG A;  2XAS A;  3SHF A;  1TW2 A;  5J1R A;  1QRY A;  4HNT A;  2GLO A;  2EB7 A;  3CJQ B;  1LDK B;  4BQA A;  1RIO H;  2QQ9 A;  2OZ6 A;  3FXL A;  1MMA A;  1DUX C;  4B3X A;  2VQC A;  3KP2 A;  3T8R A;  5BPD A;  1H88 C;  1VQP I;  3JRB A;  2ZME A;  2KFD A;  3LQR A;  2CQN A;  3QYF A;  3QYE A;  1SFE A;  2QWW A;  2W00 A;  5FLX Z;  5BPI A;  2K3P A;  2X48 A;  3GME A;  5LEJ A;  2NYX A;  3S8P A;  3I9V 2;  2HOS A;  2E60 A;  3JRI A;  1TBX A;  1H8A C;  2QKO A;  4DBQ A;  3PM1 A;  3VFZ A;  4A0Y A;  1O3R A;  2R0Q C;  4LLN A;  1O3T A;  4GYI A;  4IRH A;  1MNE A;  3J7A Y;  2XSJ C;  1MH3 A;  5L3E A;  4Q47 A;  3OSF A;  2ACJ A;  3FK7 A;  1IXR C;  1HF0 A;  3HTI A;  1LVK A;  5DD8 A;  4C9Y A;  1AA7 A;  1TP4 A;  2DMT A;  2PFB A;  2WAQ A;  4XKB A;  4LLL A;  3V42 A;  3J81 Z;  3BCG A;  1NK3 P;  4OD5 A;  2XGE A;  2VT2 A;  2IU5 A;  3OIP A;  1MMD A;  3UNG C;  3S3M A;  4A12 A;  2E35 A;  3LMM A;  4I6Z A;  3F8B A;  3HEF A;  2E1M C;  2HZD A;  2R5Z A;  2ADU A;  3DPU A;  5GAD J;  5CVI A;  1T08 B;  3PNT A;  3LSM A;  2DT6 A;  1XCV A;  2M0M A;  5H20 A;  1DGR M;  3J81 K;  1I27 A;  2GOX B;  3R60 A;  1MIJ A;  2QUF A;  1X4O A;  1SAX A;  4N4O B;  4E70 A;  4M6V A;  2KIF A;  1MKM A;  2TCT A;  2QCO A;  3ABT A;  2D1H A;  2V1D A;  2M87 A;  5ICG A;  2B63 J;  2F5F A;  1IN4 A;  2VXD A;  1A31 A;  2VQG A;  4GGG A;  1OYW A;  3REO A;  4BYY A;  5IP9 J;  1RKT A;  1MDM A;  4RGU A;  3B6C A;  3O8G A;  3RPQ A;  3U21 A;  5IOY A;  1BOB A;  1PUF A;  4C2U A;  2FBQ A;  5LGU A;  5E18 F;  2R7U A;  1XD7 A;  3L2V A;  4CGZ A;  1WGX A;  2E7X A;  3NXC A;  2ZXJ A;  3RKY A;  1S8N A;  1Z1D A;  2VOO A;  1O57 A;  3Q0U A;  4S05 A;  2Y69 H;  1BIA A;  1JHF A;  3I59 B;  4G6D A;  5EZG A;  3KNW A;  4M74 A;  2Z2S B;  1X1D A;  1W7P B;  1KZH A;  1XG1 A;  4HEA 2;  2YVH A;  2NVQ J;  2DLL A;  2R7X A;  2FOK A;  4LGW A;  2M4G A;  4Z2Y A;  2LF8 A;  3CO7 C;  1BI2 A;  2DXI A;  1U6G A;  4HF2 A;  2EIK H;  1FTZ A;  4M3E A;  2UXP A;  1GLN A;  3VW2 A;  4DNC A;  2HOE A;  2OAZ A;  2WY8 Q;  5GP9 A;  1YX3 A;  3C18 A;  3HKZ N;  3SEZ A;  3WGH A;  4HPQ A;  3P9I A;  4JBA A;  1KQ0 A;  3CDI A;  2BY2 A;  4Q48 A;  4LG0 A;  2OJE D;  3BNI A;  1S6L A;  1VQ9 I;  3IWF A;  4JX5 A;  4WXC A;  4DYQ A;  1XDU A;  1DU0 A;  2ZO4 A;  3EPZ A;  1E3H A;  2IEK A;  4AID A;  1XC5 A;  2STT A;  3E3V A;  2JZY A;  3BG3 A;  1B8I B;  4XLH A;  1LVA A;  1YW9 A;  2BY0 A;  3HUG B;  5J3L A;  3VSL A;  2HQN A;  2P7V B;  1LFU P;  2XF7 A;  2ESN A;  2FJ1 A;  3PFY A;  4L5J A;  2VJ4 A;  2DI3 A;  1B6A A;  2O8K A;  3AG2 H;  1XGN A;  1YS6 A;  3P7N A;  1LEB A;  1FOY A;  1LUJ B;  2NS7 A;  1LJ9 A;  3LAJ A;  3FK6 A;  5F64 A;  2NP3 A;  1C0W A;  2DMP A;  5IT9 Z;  4W97 A;  1FBU A;  2BGC A;  3PUF A;  2BE5 F;  2ID6 A;  5FB2 A;  1Z6T A;  3Q0V A;  3RCO A;  2VT3 A;  4EM1 A;  3CD6 I;  3O6B B;  4WIB A;  3ELK A;  5AIQ A;  3E7Q A;  4JL3 A;  3DBR B;  1J9I A;  3OIO A;  3D0S A;  1PUE E;  4A0Z A;  3S1M J;  2XVC A;  3LA3 A;  4FTH A;  4AF5 A;  2LYC A;  3OYK A;  3DF8 A;  1NH3 A;  3V6G A;  5A2Q Z;  3CP2 A;  2RAS A;  1BI3 A;  4MQ9 F;  1IV8 A;  4GO1 A;  5HDN A;  4CCJ A;  3WTT C;  3I4P A;  2VN2 A;  4JX6 A;  2UXU A;  5FGL A;  3CMM A;  3GBG A;  2EFQ A;  1U5T C;  2BW3 A;  3GFM A;  2BV6 A;  4UUT A;  2QBY B;  4M9S A;  4CIC A;  2LLK A;  5A2Q K;  4MO7 A;  3NRG A;  3SQN A;  1FC3 A;  2XB5 A;  2JA2 A;  3DTK A;  4HF1 A;  2VJ5 A;  3K2A A;  4Y15 A;  1TWA J;  2YU3 A;  2A6E F;  2DYR H;  5HLI A;  2CV1 A;  1D5V A;  2E5Z A;  3HRU A;  3D5R C;  2G3B A;  4U9N A;  5EYR A;  3KYL A;  4XRF A;  3VVY A;  1X2N A;  2CUZ A;  2ZFW A;  2WV0 A;  3T1B A;  1WRJ A;  3HRS A;  2GQQ A;  3SZT A;  2O5R A;  4ZTF A;  3MKL A;  2PN6 A;  3V8L A;  4J00 A;  3OYD A;  5ERI A;  3BOQ A;  1W7P D;  5CLS A;  5AIP A;  2Z16 A;  1M1E B;  2MC4 A;  1T33 A;  3CCR I;  4L62 A;  2HYF A;  3V4G A;  3KP7 A;  1MW7 A;  4P5O A;  1K61 A;  1O7F A;  3RTR A;  4DIQ A;  4WXH A;  4IHV A;  4XLN F;  4OMZ A;  1WJB A;  2KL4 A;  1YJW I;  4PGG A;  2D1V A;  1UG0 A;  1K78 A;  1UEL B;  1VQL I;  4IQJ A;  1B72 A;  2W53 A;  4HW0 A;  4UVA A;  3VOD A;  4A6E A;  5J47 A;  1TT5 B;  2VKE A;  4PSX A;  3AG3 H;  3OYF A;  1JUM A;  2IJL A;  5F0H A;  5FLV A;  3RDI A;  3LNQ A;  1UI5 A;  2KKO A;  3MEX A;  1AKH A;  1WQ2 A;  5FGM A;  2B0L A;  1RZ4 A;  5L3G A;  5FHP A;  2G7H A;  4B1R A;  3HOY J;  2E5N A;  2PBI A;  3TMO A;  3HKZ A;  3ERE D;  2RC4 A;  5FO5 A;  2ME6 A;  5J40 A;  4NHJ A;  3QU6 A;  4YIR X;  2M3A A;  2Z3Y A;  2OA4 A;  3F8M A;  5LHG A;  2PFV A;  4XON A;  2ZOZ A;  1B4A A;  3C2H A;  3MCZ A;  2QSG X;  3NI7 A;  2XRL A;  3LL7 A;  2JRT A;  3M1C A;  1HW1 A;  4U9L A;  3DKW A;  2LK2 A;  3SDB A;  1P7J A;  4HX4 A;  3QOD A;  5FFZ A;  5D19 A;  2DCE A;  2X4H A;  4EJT A;  2DOA A;  2OC6 A;  1KQ8 A;  2CQ7 A;  4ZZD A;  1W5S A;  1FSE A;  3K4K A;  2IS1 A;  4ZYE A;  5J8F A;  2ELJ A;  3GYH X;  4PXI A;  1ZRF A;  3VWB A;  2L7K A;  3BJB A;  2Q8K A;  4ASN A;  1FBS A;  1YFH A;  5B66 C;  4J19 A;  2H6C A;  2FBI A;  5GTI C;  2GA1 A;  2AQF A;  1LKX A;  2NNN A;  5K1Y A;  3GTL J;  3E6D A;  3QQA A;  1KU2 A;  4FIS A;  1SFO J;  4XM3 A;  2FML A;  3DTE A;  4QLC U;  1XTA A;  2G0E A;  3V78 A;  1UMQ A;  3OYA A;  4IZZ A;  3CTA A;  2LBF A;  3FBN B;  4UB8 C;  4XLF A;  3LAP A;  1SVL A;  1HOM A;  1IUY A;  1ETV A;  1OCP A;  3WHC A;  2IRF G;  1FP2 A;  1DPU A;  2AQE A;  5FKL A;  1SMT A;  2XAQ A;  2LH9 A;  3OOU A;  2K9S A;  2KDZ A;  2HTS A;  2FMY A;  3KEO A;  1FSH A;  4I2O A;  2ZNZ A;  2A5Y B;  2EA2 A;  4L9T A;  1CF7 A;  2V57 A;  5D5V B;  4GYG A;  1I50 J;  1SEU A;  2AS5 F;  2XGC A;  1JT0 A;  4A69 C;  3BR1 A;  2A6T A;  1P6R A;  3TW6 A;  5LGN A;  1K6Y A;  2WA0 A;  5K7Z A;  5CVJ A;  4G94 A;  1QBJ A;  3ECO A;  3EYI A;  1X3U A;  4U0Y A;  2DPD A;  5C4X J;  3ZMU A;  5ICC A;  2ETH A;  2P0W A;  3VB2 A;  3VYT B;  4ESB A;  4I0B A;  2DA4 A;  2DA1 A;  3FHN A;  3GO5 A;  3BWG A;  3OV8 A;  4HAM A;  3QRF F;  2JPC A;  3TOA A;  3LWF A;  2VLA A;  3P9T A;  4KWA A;  2EV6 A;  4RM2 A;  4IVN A;  4IOA F;  1AWC A;  3FBI B;  5K5Q A;  2X6W A;  3WE2 A;  2UZK A;  3HOU J;  1ZG1 A;  3J80 Z;  3W6J B;  4UB6 C;  1J59 A;  3D5L A;  3J7A O;  1QGP A;  3W2A A;  1ZG5 A;  2FU4 A;  1ZR2 A;  1R4M B;  3E6M A;  4ABZ A;  4BAY A;  2XHK A;  3DPJ A;  1PP8 F;  2DJI A;  3LSJ A;  1ODD A;  4Q5S F;  2OBP A;  1AU7 A;  3ML6 A;  5D5X B;  3N05 A;  3DV8 A;  1Z67 A;  2W25 A;  4A5M A;  2W24 A;  1FMV A;  3J80 K;  2BHY A;  3CC4 I;  1IRZ A;  3FWE A;  5DYM A;  1OYY A;  2D2W A;  1TTY A;  2VAS A;  1V5E A;  2MH2 A;  4ZYD A;  3CDL A;  4BAC A;  3QPS A;  1TC3 C;  2J5P A;  4A3C J;  3PFI A;  4KFC A;  1SD6 A;  2B9S A;  3M7G A;  3KEQ A;  4G9Y A;  3WGI A;  2BW3 B;  4UUS B;  2F07 A;  1XGS A;  3NAR A;  3OYN A;  2LKX A;  3O8H A;  4HSR A;  3PPB A;  2RVC A;  5H6R A;  2ZXH A;  3RSN A;  2XAF A;  5C4J J;  2QF7 A;  3LSR A;  1TQP A;  2X0L A;  2CYY A;  2V6E A;  2YSR A;  2CFO A;  5C44 J;  3QP5 A;  1D0Z A;  2KDO A;  4BHB A;  1Z05 A;  2HTJ A;  1J09 A;  1D0X A;  3ROU A;  3EQL F;  1SFK A;  3BTC A;  3LSG A;  5IYB J;  2QVO A;  2M7A A;  1FT9 A;  1A36 A;  2W4S A;  2XPU A;  4AU7 A;  3VSK A;  1YW7 A;  2P6S A;  2P8T A;  3TO7 A;  1RNL A;  1ZQ3 P;  3J7Y J;  3CCL I; 
#chains in the Genus database with same CATH homology
 3DEW A;  5E3N A;  3A01 A;  4D5C A;  4BY7 J;  1HDD C;  1QVT A;  2E19 A;  2I10 A;  3BTJ A;  3LWJ A;  2JA8 J;  5D18 A;  3BR0 A;  3ZQI A;  5M3F J;  1Z77 A;  3CWR A;  3Q0W A;  1PUF B;  5M5W J;  1I6H J;  3LOC A;  3FRQ A;  3D1N I;  4M3B A;  3FIW A;  1LE8 B;  2NS8 A;  2REK A;  4S0H B;  4A3K J;  3HOW J;  3BR3 A;  1ZK8 A;  2EZI A;  2D6Y A;  2ZOY A;  3CJD A;  4XRS A;  1FEX A;  3HGY A;  3F0C A;  2VPR A;  4A3I J;  3PAS A;  2HXO A;  2DG7 A;  5E3O A;  4G12 A;  3QKX A;  3VW1 A;  2Y2Z A;  5J1U A;  1UG2 A;  4X1E A;  1WPK A;  1IGN A;  1I3Q J;  3G1M A;  3ZQL A;  2G7S A;  1GUU A;  1MBG A;  2L7F P;  2NOG A;  2HI3 A;  1JKR C;  2YVE A;  5J1R A;  1QRY A;  1ETY A;  2GLO A;  2VUM J;  2AHQ A;  5CW8 A;  1APL C;  2E2H J;  2OPT A;  2DMQ A;  4GCK A;  2QTQ A;  1K83 J;  4MFE A;  4C2M J;  4UDS A;  2GBY A;  4I76 A;  3BTL A;  1VFC A;  1H88 C;  3JRB A;  4M3G A;  1T56 A;  4JKZ A;  3VOX A;  3C2B A;  2X48 A;  3IH4 A;  4BXX J;  2GUH A;  3S5R A;  1HCR A;  2P81 A;  2RAE A;  1JUP A;  5FKN A;  2HOS A;  1EF4 A;  3JRI A;  3C07 A;  1H8A C;  2QKO A;  1RR7 A;  3CMY A;  3PM1 A;  4A3E J;  2WV1 A;  2LP0 A;  1XS9 A;  2R0Q C;  1FJL A;  1GV5 A;  1JJ6 C;  1VND A;  2JMW A;  4UUS A;  3ZQC A;  2NX4 A;  1MH3 A;  2DA2 A;  4ACI A;  3O60 A;  5C3E J;  2JWT A;  3OSF A;  1HF0 A;  3FK7 A;  3HTI A;  5F0F A;  5EG0 B;  3ON2 A;  3SDG A;  3S14 J;  2DMT A;  4LOC A;  2R5Y A;  3BCG A;  3EGQ A;  2ID3 A;  1NK3 P;  5C4Y A;  2XGE A;  2IU5 A;  1X58 A;  2XSD C;  5IYD J;  3BRU A;  3JSJ A;  2EZK A;  1D5Y A;  5IOZ A;  4QTR A;  3BQZ A;  1RET A;  4I6Z A;  3VP5 A;  1VI0 A;  5EGO B;  3HEF A;  3VPR A;  2DTZ A;  2R5Z A;  4C3I J;  1ORK A;  1F43 A;  2CUE A;  4M3D A;  2W48 A;  2D5V A;  5F1J A;  4XRM A;  3RH2 A;  5EZH A;  4IHW A;  4L5E A;  2O7O A;  1UHS A;  4M6V A;  3OSG A;  2TCT A;  2QCO A;  2B63 J;  2LTP A;  3RQI A;  3M3Y J;  4BY1 J;  1JTX A;  5IP9 J;  1RKT A;  3COL A;  2HKU A;  3B6C A;  3O8G A;  5IOY A;  1PUF A;  2FBQ A;  1WCM J;  1X2M A;  4A3D J;  3NNR A;  4D7N A;  5FMP A;  1MSE C;  3NAU A;  1LE8 A;  1H89 C;  2EZH A;  3TW7 A;  4NEL A;  1WGX A;  3LSP A;  1FIP A;  3NXC A;  3IUV A;  1BW5 A;  5F0C A;  1BJZ A;  1OCT C;  2M2E A;  4GFB A;  1JUS A;  3Q0U A;  5JLW A;  5EZG A;  1FTT A;  1ETW A;  5F27 A;  4XIC A;  3KNW A;  3MNL A;  2M9H A;  1MBE A;  4BBR J;  4DW6 A;  3EUP A;  1XG1 A;  3GTJ J;  2YVH A;  2NVQ J;  1MH4 A;  2UXI A;  2K40 A;  2E2J J;  1R9T J;  3HIM A;  1RPW A;  2L7Z A;  1IC8 A;  2G7L A;  3BG9 A;  2CU7 A;  5EEA A;  3TP3 A;  4M3E A;  1FTZ A;  2WGB A;  2ZCM A;  2UXP A;  2JA6 J;  2Q24 A;  3VW2 A;  4EEF G;  1MBJ A;  3ZQH A;  5F04 A;  1JKQ C;  2HXI A;  1IDZ A;  4HKU A;  3QBM A;  5GP9 A;  3HKZ N;  1NTC A;  2WUI A;  2XGD A;  2Y9Z A;  3HE0 A;  2KT0 A;  4NDL A;  3S2H J;  2MSY A;  4XRS G;  3VW0 A;  3HOZ J;  5FKM A;  3BNI A;  3GTG J;  4JX5 A;  2FX0 A;  3CQZ J;  4DYQ A;  1DU0 A;  4DYR A;  1LFB A;  1YRN A;  2IEK A;  3RZO J;  3BG5 A;  1XC5 A;  4YZE A;  3TED A;  1B8I B;  3BG3 A;  2IBD A;  1G2H A;  1OJL A;  1F36 A;  2NVY J;  5M5X J;  4XID A;  1B72 B;  1MBK A;  3HOV J;  2LY9 A;  5K7H A;  4XK4 A;  5J3L A;  1LFU P;  3MN2 A;  2FJ1 A;  5AQC A;  4IEJ A;  2L7M P;  2O8K A;  3BT9 A;  5J1Y A;  2GFN A;  2NS7 A;  4FE4 A;  2AO9 A;  2CJJ A;  3FK6 A;  1AKH B;  3I4M J;  3JR9 A;  3BR6 A;  2X6O A;  2NP3 A;  3GEU A;  1TWG J;  2DMP A;  4W97 A;  3ZQG A;  1SGM A;  3PO3 J;  1QVU A;  2ID6 A;  4GCT A;  2DA3 A;  4QSH A;  3Q0V A;  3JRE A;  1ZGW A;  5EDN A;  2N8G A;  4A3M J;  3E7Q A;  4JL3 A;  3VVX A;  3BTI A;  5HOD A;  5EGO A;  3OIO A;  3B81 A;  5FJ8 J;  1IJW C;  2CRG A;  2TRT A;  3KKC A;  3S1M J;  2DN0 A;  1WI3 A;  3JRG A;  3I4N J;  5HSZ A;  2DA5 A;  4FTH A;  4AF5 A;  1ETX A;  1JGG A;  2VKV A;  3V6G A;  1GV2 A;  1Y1W J;  1JTY A;  2RAS A;  5K7F A;  3M4O J;  2JJ7 A;  2RHA A;  4ICH A;  3VOK A;  2UXO A;  2CQX A;  4JX6 A;  2UXU A;  4GCL A;  5FGL A;  3GBG A;  2NVX J;  4UUT A;  5K58 A;  3NRG A;  4A3B J;  2LLK A;  4MO7 A;  4CYC A;  1WH5 A;  2IAI A;  2XB5 A;  3ANP A;  2ELK A;  3K2A A;  1ZTR A;  3E7L A;  1TWA J;  4BKX A;  3JRC A;  2L0K A;  2ZCN A;  1ITY A;  3IV5 A;  1RES A;  2G3B A;  1Y1V J;  3DCF A;  5EYR A;  5BNG A;  1POG A;  1X2N A;  3VVY A;  1MBH A;  2M0C A;  2DA7 A;  3KKD A;  4AC6 A;  5EF6 A;  2HDD A;  1TWH J;  3MKL A;  2Y31 A;  1QPI A;  3GTK J;  3JRD A;  1JKP C;  3G1O A;  3UKG A;  4MFD A;  3WHB A;  1IDY A;  1U78 A;  5EFY A;  2FD5 A;  4V2F A;  3B6A A;  1GT0 C;  1T33 A;  4L62 A;  5JLX A;  2WB1 N;  4D5F A;  1ETQ A;  1K61 A;  3HTJ A;  2YS9 A;  3LHQ A;  4IHV A;  5GPA A;  2EQR A;  3W6V A;  3SJM A;  3NPI A;  3JRH A;  4A3L J;  1SAN A;  2L9R A;  3GTO J;  4Y52 J;  5DAJ A;  4RBO A;  1B8I A;  1ETO A;  5GPC A;  5DS9 A;  5HBU A;  2DA6 A;  5IP7 J;  1B72 A;  1BA5 A;  2W53 A;  2GEN A;  1JJ8 C;  2JN6 A;  2VKE A;  3G1L A;  3ZQF A;  1JUM A;  4D7M A;  5F0H A;  3VIB A;  5FLV A;  4CGR A;  3LNQ A;  4JNN A;  2MG4 A;  1UI5 A;  1AHD P;  1AKH A;  1BL0 A;  1NK2 P;  2LFB A;  3S1N J;  3IH3 A;  3GZI A;  2H1K A;  2XB0 X;  5FHP A;  3HOY J;  4B1R A;  2EBI A;  1BW6 A;  2ME6 A;  3JRF A;  2H8R A;  2Y9Y A;  4AYB N;  2R5Y B;  5FKO A;  2OI8 A;  4DZP A;  3QPL A;  3A03 A;  3RZD J;  3HB9 A;  3S1Q J;  1MBF A;  2ZOZ A;  2JA7 J;  1IG7 A;  2QWT A;  3NI7 A;  2XRL A;  2Y0S N;  4BBS J;  3HBL A;  5IYC J;  3HDD A;  3S15 J;  3F1B A;  3S1R J;  1TWF J;  2LK2 A;  4AC0 A;  4ME9 A;  1P7J A;  2YUS A;  2PMZ N;  4NN1 A;  4Y7N J;  5D19 A;  2ZCX A;  5D1R A;  2HYJ A;  1O4X A;  3S16 J;  1TWC J;  3IH2 A;  1P7I A;  2XPW A;  2K9Q A;  1A5J A;  2JK3 A;  2YU9 J;  2Y30 A;  4FE7 A;  4PXI A;  2JA5 J;  4GFL A;  3HM5 A;  4MXM A;  3BJB A;  2CUF A;  2MW8 A;  4M3F A;  4HNV A;  1FIA A;  5EG0 A;  3L1P A;  4DZJ A;  1ZKG A;  2LR8 A;  4DYC A;  1ZR4 A;  4J19 A;  1MNM C;  3HGG A;  1W0U A;  2EZL A;  5M5Y J;  1ETK A;  3GTL J;  2NP5 A;  4B4C A;  3QQA A;  3VUQ A;  4FIS A;  1SFO J;  2QIB A;  4A3J J;  2G0E A;  5IP6 A;  3VVZ A;  5DTD A;  3V78 A;  2DMN A;  3G7R A;  2HQ5 A;  3A02 A;  1UMQ A;  4MLO A;  1HLV A;  2ECC A;  3GTP J;  3TP0 A;  4AUX A;  3S17 J;  3MVP A;  1HOM A;  1ETV A;  1OCP A;  3WHC A;  3HTA A;  1DU6 A;  5FKL A;  5FKK A;  2PZ9 A;  1RKW A;  2OER A;  3OOU A;  2K9S A;  3RKQ A;  2KDZ A;  2NVT J;  5H9T A;  3A01 B;  2ECB A;  3ON4 A;  4B3A A;  3KZ9 A;  2M34 A;  1JT6 A;  2V57 A;  1I50 J;  3AQS A;  2XGC A;  1JT0 A;  9ANT A;  4A69 C;  3BR1 A;  3TW6 A;  2MGQ A;  5FLM J;  2R92 J;  2G7G A;  3HTH A;  5K7Z A;  1A6I A;  5C4X J;  1YRN B;  2XPV A;  1Q1V A;  2FQ4 A;  4A3F J;  2DA4 A;  2DA1 A;  1WH7 A;  3AQT A;  4V2G A;  2LD5 A;  1U9O A;  1JKO C;  2DMU A;  2ME0 A;  2R7Z J;  3FIS A;  1ENH A;  3P9T A;  4KWA A;  4JP0 A;  3T6N A;  5HAW A;  3HOU J;  1U9N A;  2HYT A;  2GM4 A;  3PO2 J;  1Z0X A;  5CXI A;  2EH3 A;  1ZR2 A;  3DPJ A;  4ABZ A;  4GFK A;  5E3M A;  2WAQ N;  4X6A J;  3LSJ A;  2R93 J;  3S2D J;  1AU7 A;  3GTM J;  3RD3 A;  2O7T A;  1E3O C;  1W0T A;  1S7E A;  3BQY A;  3SFI A;  2X9D A;  3H0G J;  4RDU A;  1GDT A;  1IRZ A;  2COB A;  4MK6 A;  3H3V K;  3Q3S A;  3GTQ J;  1UI6 A;  2K9N A;  3G56 A;  2HOT A;  4QIW N;  2M8G X;  5CXG A;  4A93 J;  2ZB9 A;  4JYK A;  3LJL A;  1CQT A;  2E2I J;  1GVD A;  3CDL A;  3QPS A;  2DJN A;  1TC3 C;  4IHX A;  4A3C J;  2LVS A;  2PBX A;  2HOA A;  4MIM A;  1OFC X;  1IUF A;  4C3H J;  1IV6 A;  3ANG A;  4UUS B;  3BR2 A;  3BR5 A;  5F08 A;  2F07 A;  4IHY A;  3NAR A;  5M3M J;  4CYC B;  2LKX A;  3O8H A;  3JRA A;  1U8B A;  4C3J J;  3ZOB A;  3PPB A;  3BHQ A;  4JX4 A;  5IPA A;  5C4J J;  2CQQ A;  2QF7 A;  3LSR A;  5C44 J;  1VF9 A;  2VI6 A;  4FCY A;  2OF7 A;  3BTC A;  5IYB J;  3LSG A;  2XDN A;  1HDP A;  1MSF C;  4W1U A;  3CCY A;  2E1O A;  2XPU A;  2DG8 A;  2R5Z B;  4A3G J;  3CRJ A;  2QOP A;  3FKI J;  5E3L A;  3K7A J;  1ZQ3 P;  2O9L A;  3HOX J;  2UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...