3BHQA

Crystal structure of a putative tetr-family transcriptional regulator (mlr_4833) from mesorhizobium loti maff303099 at 1.54 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
202
Chain Sequence
ETRSARKDREIIQAATAAFISKGYDGTSMEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQVNDIIESVTTLLSEAIFMEGGLQQLARRLIAVLMDEELLKLRRLIIANADRMPQLGRAWYEKGFERMLASTASCFQKLTNRGLIQTGDPYLAASHLFGMLLWIPMNEAMFTGSNRRSKAELERHADASVEAFLAVYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator
publication title Crystal structure of TetR-family transcriptional regulator (NP_105615.1) from Mesorhizobium loti at 1.54 A resolution
rcsb
source organism Mesorhizobium loti
total genus 84
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bhqA00
5GPCA 3BTLA 1ORKA 3EUPA 2VKEA 4KWAA 4M3BA 5K7FA 5F0FA 4M3DA 3CCYA 3LWJA 2NP5A 3SFIA 2NX4A 5FHPA 4GCKA 2G7GA 2QCOA 3BRUA 2I10A 4GFKA 4JYKA 3O8HA 2IAIA 4YZEA 2GUHA 2RAEA 5FKMA 2HYJA 2F07A 3BJBA 2QTQA 3VOXA 5J1YA 3GZIA 2X6OA 4B3AA 1QVTA 3KKCA 4D7NA 4NN1A 3VUQA 2G0EA 3V6GA 2IBDA 3RH2A 5FKNA 2WGBA 2XPVA 2REKA 5F0HA 2ZCMA 5C4YA 5FGLA 1BJZA 3B6CA 3FK6A 3VW0A 2NS7A 3BR2A 1Z77A 2TRTA 4D5CA 5IP6A 3AQSA 2JK3A 3MNLA 2UXOA 5CXIA 3BR5A 3S5RA 4M3GA 5D18A 3BR3A 2O7OA 3B81A 3MVPA 5EYRA 2YVHA 1JTXA 3BT9A 2FBQA 2W53A 3ZQGA 3VOKA 3BTCA 3PPBA 3LSPA 2NS8A 3FK7A 5J3LA 3FRQA 2Y30A 2XDNA 2HXOA 1VI0A 3HIMA 2IU5A 2HXIA 4HKUA 2RASA 3VPRA 4DW6A 4XK4A 3HGGA 2GBYA 4D5FA 2Q24A 4GFLA 4JL3A 3VVYA 2O7TA 2TCTA 4AUXA 5H9TA 2Y2ZA 5HSZA 2FX0A 3LSRA 2EH3A 3PASA 2YVEA 3WHBA 3BNIA 4AF5A 2RHAA 2ID3A 3ON2A 4L62A 2GFNA 5F27A 5D1RA 5K7ZA 2ZOZA 3LSJA 4CGRA 3C2BA 3QPSA 3CJDA 5GPAA 2HKUA 5FKOA 3IH3A 4W97A 1U9OA 3NPIA 1T56A 3RD3A 2FJ1A 3BR1A 3WHCA 5GP9A 4NELA 5EZGA 3KNWA 2ZCXA 2NP3A 3IH4A 2DTZA 5IOZA 5FMPA 4W1UA 3E7QA 1A6IA 3AQTA 2D6YA 2Y31A 1T33A 3ANGA 5EFYA 3ZQFA 2DG7A 2WV1A 5IPAA 3VW2A 3GEUA 3P9TA 2X9DA 5HAWA 2V57A 3HGYA 3VW1A 3DCFA 3G1MA 2OPTA 5F04A 3HTAA 4JKZA 3BQZA 2IEKA 2QOPA 3ON4A 1RPWA 3BTIA 5HBUA 3LOCA 4M3EA 2UXHA 4ACIA 1QVUA 2UXIA 3O60A 1ZKGA 3V78A 5F1JA 3QBMA 5AQCA 4X1EA 2XGEA 2HQ5A 3ZQIA 4M3FA 4ABZA 4V2GA 2UXUA 3F1BA 3T6NA 3G1LA 4I6ZA 1JUPA 2XPWA 3BQYA 3C07A 3QPLA 1RKWA 2WUIA 2ZCNA 4MXMA 3G56A 3NRGA 2XPUA 4GCTA 4MK6A 4UDSA 3IUVA 3NNRA 2OF7A 3HTJA 3CWRA 2VPRA 2FD5A 3PM1A 3BR0A 2XGDA 3BTJA 4G12A 2XGCA 3Q0UA 3LJLA 1JUSA 5F0CA 4B1RA 2G7LA 4I76A 3ANPA 3CDLA 3VIBA 1UI5A 3Q3SA 3IH2A 4AC6A 2ZOYA 1U9NA 3VVXA 3LHQA 3COLA 2PZ9A 3NXCA 3TP0A 3G1OA 5DAJA 3B6AA 4ME9A 3BCGA 4GCLA 1Z0XA 1RKTA 3Q0VA 2VKVA 3ZQHA 3QQAA 5F08A 2G7SA 4PXIA 1JT6A 1JTYA 3HTIA 1ZK8A 2DG8A 4D7MA 5J1UA 2ZB9A 3TP3A 5K58A 2G3BA 1QPIA 3DPJA 3ZQLA 3CRJA 4JNNA 2UXPA 1UI6A 2OI8A 1JUMA 2HYTA 5EZHA 2OERA 3SDGA 1SGMA 3G7RA 3KKDA 3VP5A 3F0CA 3KZ9A 2FQ4A 3EGQA 3BHQA 2QIBA 4AC0A 3HTHA 3JSJA 5CW8A 3O8GA 3HE0A 2JJ7A 5J1RA 3QKXA 5FKKA 2ID6A 2QKOA 5CXGA 3Q0WA 2XRLA 2PBXA 3DEWA 5IOYA 2XB5A 3BR6A 3VVZA 5D19A 2QWTA 3NI7A 1JT0A 5K7HA 3FIWA 4V2FA 2GENA 4ICHA 4MO7A 5FKLA
chains in the Genus database with same CATH superfamily
5GPCA 3BTLA 1ORKA 3EUPA 2VKEA 4KWAA 4M3BA 5K7FA 5F0FA 4M3DA 3CCYA 3LWJA 2NP5A 3SFIA 2NX4A 5FHPA 4GCKA 2G7GA 2QCOA 3BRUA 2I10A 4GFKA 4JYKA 3O8HA 2IAIA 4YZEA 2GUHA 2RAEA 5FKMA 2HYJA 2F07A 3BJBA 2QTQA 3VOXA 5J1YA 3GZIA 2X6OA 4B3AA 1QVTA 3KKCA 4D7NA 4NN1A 3VUQA 2G0EA 3V6GA 2IBDA 3RH2A 5FKNA 4U9NA 2WGBA 2XPVA 2REKA 5F0HA 2ZCMA 2R7OA 2R7WA 5C4YA 5FGLA 1BJZA 3B6CA 3FK6A 3VW0A 2NS7A 3BR2A 1Z77A 2TRTA 4D5CA 5IP6A 3AQSA 2JK3A 3MNLA 2UXOA 5CXIA 3BR5A 3S5RA 4M3GA 5D18A 2A2FX 3BR3A 2O7OA 3B81A 3MVPA 5EYRA 2YVHA 1JTXA 3BT9A 2FBQA 2W53A 3ZQGA 3VOKA 3BTCA 4OD4A 3PPBA 2B1EA 3LSPA 2NS8A 3FK7A 5J3LA 3FRQA 2Y30A 2XDNA 2HXOA 1VI0A 3HIMA 2IU5A 2HXIA 4HKUA 2RASA 3VPRA 4DW6A 4WIBA 4XK4A 3HGGA 2GBYA 4D5FA 4IRVA 2Q24A 4GFLA 4JL3A 3VVYA 2O7TA 2TCTA 4AUXA 5H9TA 2Y2ZA 5HSZA 2FX0A 3LSRA 2EH3A 3PASA 2YVEA 3WHBA 3BNIA 4AF5A 2RHAA 2ID3A 3ON2A 4L62A 2GFNA 5F27A 5D1RA 4OD5A 5K7ZA 2ZOZA 3LSJA 3DU6A 4CGRA 3VTIA 2PFVA 3C2BA 4U9LA 3QPSA 3CJDA 5GPAA 2HKUA 5FKOA 3IH3A 4W97A 1U9OA 3NPIA 1T56A 3RD3A 2FJ1A 3BR1A 3WHCA 5GP9A 4NELA 5EZGA 3KNWA 2ZCXA 2NP3A 3IH4A 2DTZA 5IOZA 5FMPA 4W1UA 3E7QA 1A6IA 3AQTA 2D6YA 2Y31A 1T33A 3ANGA 5EFYA 3ZQFA 2DG7A 2WV1A 5IPAA 3VW2A 3GEUA 3P9TA 2X9DA 5HAWA 2V57A 3HGYA 3VW1A 3DCFA 3G1MA 2OPTA 5F04A 3HTAA 5CQGA 4JKZA 3BQZA 2IEKA 2QOPA 3ON4A 1RPWA 3BTIA 5HBUA 3LOCA 4M3EA 2UXHA 4ACIA 1QVUA 2UXIA 3O60A 1ZKGA 3V78A 5F1JA 3QBMA 5AQCA 4X1EA 2XGEA 2HQ5A 3ZQIA 4M3FA 4ABZA 4V2GA 2UXUA 3F1BA 3T6NA 3G1LA 4I6ZA 1JUPA 2XPWA 3DU5A 3BQYA 3C07A 3QPLA 1RKWA 2WUIA 2ZCNA 4MXMA 3G56A 3NRGA 2XPUA 4GCTA 4MK6A 4UDSA 3IUVA 3NNRA 2OF7A 3HTJA 3CWRA 2VPRA 2FD5A 3PM1A 3BR0A 2XGDA 3BTJA 4G12A 2XGCA 3Q0UA 3LJLA 1JUSA 5F0CA 4B1RA 2R7RA 2G7LA 4I76A 3ANPA 3CDLA 3VIBA 1UI5A 3Q3SA 3IH2A 4AC6A 2ZOYA 1U9NA 2R7SA 2R7QA 3VVXA 3LHQA 4DVYP 2ZY9A 3COLA 2PZ9A 3NXCA 3TP0A 3NS4A 3G1OA 5DAJA 3B6AA 4ME9A 3BCGA 4C2MA 4GCLA 1Z0XA 1RKTA 3Q0VA 2VKVA 3ZQHA 3QQAA 5F08A 2G7SA 4PXIA 1JT6A 1JTYA 3HTIA 1ZK8A 2DG8A 4D7MA 5J1UA 2ZB9A 3TP3A 5K58A 2G3BA 2FJI1 1QPIA 3DPJA 3ZQLA 3CRJA 4JNNA 2B3WA 2R7VA 3KYLA 2UXPA 1UI6A 3SWHA 2OI8A 1JUMA 2HYTA 5EZHA 2OERA 3SDGA 1SGMA 3G7RA 3KKDA 3VP5A 2R7TA 2YVXA 3F0CA 3KZ9A 2R7UA 2FQ4A 3EGQA 3BHQA 2QIBA 4AC0A 3HTHA 3JSJA 5CW8A 3O8GA 3HE0A 2JJ7A 5J1RA 3QKXA 5FKKA 2ID6A 2QKOA 5CXGA 3Q0WA 2XRLA 2PBXA 3DEWA 2R7XA 5IOYA 2XB5A 3BR6A 3VVZA 5D19A 2QWTA 3K8PC 3NI7A 1JT0A 5K7HA 3FIWA 3FHNA 4V2FA 2GENA 4ICHA 4MO7A 5FKLA
chains in the Genus database with same CATH topology
5GPCA 3BTLA 1ORKA 3EUPA 2VKEA 4KWAA 4M3BA 5K7FA 5F0FA 4M3DA 3CCYA 3LWJA 2NP5A 3SFIA 2NX4A 5FHPA 4GCKA 2G7GA 2QCOA 3BRUA 2I10A 4GFKA 4JYKA 3O8HA 2IAIA 4YZEA 2GUHA 2RAEA 5FKMA 2HYJA 2F07A 3BJBA 2QTQA 3VOXA 5J1YA 3GZIA 2X6OA 4B3AA 1QVTA 3KKCA 4D7NA 4NN1A 3VUQA 2G0EA 3V6GA 2IBDA 3RH2A 5FKNA 2WGBA 2XPVA 2REKA 5F0HA 2ZCMA 5C4YA 5FGLA 1BJZA 3B6CA 3FK6A 3VW0A 2NS7A 3BR2A 1Z77A 2TRTA 4D5CA 5IP6A 3AQSA 2JK3A 3MNLA 2UXOA 5CXIA 3BR5A 3S5RA 4M3GA 5D18A 3BR3A 2O7OA 3B81A 3MVPA 5EYRA 2YVHA 1JTXA 3BT9A 2FBQA 2W53A 3ZQGA 3VOKA 3BTCA 3PPBA 3LSPA 2NS8A 3FK7A 5J3LA 3FRQA 2Y30A 2XDNA 2HXOA 1VI0A 3HIMA 2IU5A 2HXIA 4HKUA 2RASA 3VPRA 4DW6A 4XK4A 3HGGA 2GBYA 4D5FA 2Q24A 4GFLA 4JL3A 3VVYA 2O7TA 2TCTA 4AUXA 5H9TA 2Y2ZA 5HSZA 2FX0A 3LSRA 2EH3A 3PASA 2YVEA 3WHBA 3BNIA 4AF5A 2RHAA 2ID3A 3ON2A 4L62A 2GFNA 5F27A 5D1RA 5K7ZA 2ZOZA 3LSJA 4CGRA 3C2BA 3QPSA 3CJDA 5GPAA 2HKUA 5FKOA 3IH3A 4W97A 1U9OA 3NPIA 1T56A 3RD3A 2FJ1A 3BR1A 3WHCA 5GP9A 4NELA 5EZGA 3KNWA 2ZCXA 2NP3A 3IH4A 2DTZA 5IOZA 5FMPA 4W1UA 3E7QA 1A6IA 3AQTA 2D6YA 2Y31A 1T33A 3ANGA 5EFYA 3ZQFA 2DG7A 2WV1A 5IPAA 3VW2A 3GEUA 3P9TA 2X9DA 5HAWA 2V57A 3HGYA 3VW1A 3DCFA 3G1MA 2OPTA 5F04A 3HTAA 4JKZA 3BQZA 2IEKA 2QOPA 3ON4A 1RPWA 3BTIA 5HBUA 3LOCA 4M3EA 2UXHA 4ACIA 1QVUA 2UXIA 3O60A 1ZKGA 3V78A 5F1JA 3QBMA 5AQCA 4X1EA 2XGEA 2HQ5A 3ZQIA 4M3FA 4ABZA 4V2GA 2UXUA 3F1BA 3T6NA 3G1LA 4I6ZA 1JUPA 2XPWA 3BQYA 3C07A 3QPLA 1RKWA 2WUIA 2ZCNA 4MXMA 3G56A 3NRGA 2XPUA 4GCTA 4MK6A 4UDSA 3IUVA 3NNRA 2OF7A 3HTJA 3CWRA 2VPRA 2FD5A 3PM1A 3BR0A 2XGDA 3BTJA 4G12A 2XGCA 3Q0UA 3LJLA 1JUSA 5F0CA 4B1RA 2G7LA 4I76A 3ANPA 3CDLA 3VIBA 1UI5A 3Q3SA 3IH2A 4AC6A 2ZOYA 1U9NA 3VVXA 3LHQA 3COLA 2PZ9A 3NXCA 3TP0A 3G1OA 5DAJA 3B6AA 4ME9A 3BCGA 4GCLA 1Z0XA 1RKTA 3Q0VA 2VKVA 3ZQHA 3QQAA 5F08A 2G7SA 4PXIA 1JT6A 1JTYA 3HTIA 1ZK8A 2DG8A 4D7MA 5J1UA 2ZB9A 3TP3A 5K58A 2G3BA 1QPIA 3DPJA 3ZQLA 3CRJA 4JNNA 2UXPA 1UI6A 2OI8A 1JUMA 2HYTA 5EZHA 2OERA 3SDGA 1SGMA 3G7RA 3KKDA 3VP5A 3F0CA 3KZ9A 2FQ4A 3EGQA 3BHQA 2QIBA 4AC0A 3HTHA 3JSJA 5CW8A 3O8GA 3HE0A 2JJ7A 5J1RA 3QKXA 5FKKA 2ID6A 2QKOA 5CXGA 3Q0WA 2XRLA 2PBXA 3DEWA 5IOYA 2XB5A 3BR6A 3VVZA 5D19A 2QWTA 3NI7A 1JT0A 5K7HA 3FIWA 4V2FA 2GENA 4ICHA 4MO7A 5FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPC A;  3BTL A;  1ORK A;  3EUP A;  2VKE A;  4KWA A;  4M3B A;  5K7F A;  5F0F A;  4M3D A;  3CCY A;  3LWJ A;  2NP5 A;  3SFI A;  2NX4 A;  5FHP A;  4GCK A;  2G7G A;  2QCO A;  3BRU A;  2I10 A;  4GFK A;  4JYK A;  3O8H A;  2IAI A;  4YZE A;  2GUH A;  2RAE A;  5FKM A;  2HYJ A;  2F07 A;  3BJB A;  2QTQ A;  3VOX A;  5J1Y A;  3GZI A;  2X6O A;  4B3A A;  1QVT A;  3KKC A;  4D7N A;  4NN1 A;  3VUQ A;  2G0E A;  3V6G A;  2IBD A;  3RH2 A;  5FKN A;  2WGB A;  2XPV A;  2REK A;  5F0H A;  2ZCM A;  5C4Y A;  5FGL A;  1BJZ A;  3B6C A;  3FK6 A;  3VW0 A;  2NS7 A;  3BR2 A;  1Z77 A;  2TRT A;  4D5C A;  5IP6 A;  3AQS A;  2JK3 A;  3MNL A;  2UXO A;  5CXI A;  3BR5 A;  3S5R A;  4M3G A;  5D18 A;  3BR3 A;  2O7O A;  3B81 A;  3MVP A;  5EYR A;  2YVH A;  1JTX A;  3BT9 A;  2FBQ A;  2W53 A;  3ZQG A;  3VOK A;  3BTC A;  3PPB A;  3LSP A;  2NS8 A;  3FK7 A;  5J3L A;  3FRQ A;  2Y30 A;  2XDN A;  2HXO A;  1VI0 A;  3HIM A;  2IU5 A;  2HXI A;  4HKU A;  2RAS A;  3VPR A;  4DW6 A;  4XK4 A;  3HGG A;  2GBY A;  4D5F A;  2Q24 A;  4GFL A;  4JL3 A;  3VVY A;  2O7T A;  2TCT A;  4AUX A;  5H9T A;  2Y2Z A;  5HSZ A;  2FX0 A;  3LSR A;  2EH3 A;  3PAS A;  2YVE A;  3WHB A;  3BNI A;  4AF5 A;  2RHA A;  2ID3 A;  3ON2 A;  4L62 A;  2GFN A;  5F27 A;  5D1R A;  5K7Z A;  2ZOZ A;  3LSJ A;  4CGR A;  3C2B A;  3QPS A;  3CJD A;  5GPA A;  2HKU A;  5FKO A;  3IH3 A;  4W97 A;  1U9O A;  3NPI A;  1T56 A;  3RD3 A;  2FJ1 A;  3BR1 A;  3WHC A;  5GP9 A;  4NEL A;  5EZG A;  3KNW A;  2ZCX A;  2NP3 A;  3IH4 A;  2DTZ A;  5IOZ A;  5FMP A;  4W1U A;  3E7Q A;  1A6I A;  3AQT A;  2D6Y A;  2Y31 A;  1T33 A;  3ANG A;  5EFY A;  3ZQF A;  2DG7 A;  2WV1 A;  5IPA A;  3VW2 A;  3GEU A;  3P9T A;  2X9D A;  5HAW A;  2V57 A;  3HGY A;  3VW1 A;  3DCF A;  3G1M A;  2OPT A;  5F04 A;  3HTA A;  4JKZ A;  3BQZ A;  2IEK A;  2QOP A;  3ON4 A;  1RPW A;  3BTI A;  5HBU A;  3LOC A;  4M3E A;  2UXH A;  4ACI A;  1QVU A;  2UXI A;  3O60 A;  1ZKG A;  3V78 A;  5F1J A;  3QBM A;  5AQC A;  4X1E A;  2XGE A;  2HQ5 A;  3ZQI A;  4M3F A;  4ABZ A;  4V2G A;  2UXU A;  3F1B A;  3T6N A;  3G1L A;  4I6Z A;  1JUP A;  2XPW A;  3BQY A;  3C07 A;  3QPL A;  1RKW A;  2WUI A;  2ZCN A;  4MXM A;  3G56 A;  3NRG A;  2XPU A;  4GCT A;  4MK6 A;  4UDS A;  3IUV A;  3NNR A;  2OF7 A;  3HTJ A;  3CWR A;  2VPR A;  2FD5 A;  3PM1 A;  3BR0 A;  2XGD A;  3BTJ A;  4G12 A;  2XGC A;  3Q0U A;  3LJL A;  1JUS A;  5F0C A;  4B1R A;  2G7L A;  4I76 A;  3ANP A;  3CDL A;  3VIB A;  1UI5 A;  3Q3S A;  3IH2 A;  4AC6 A;  2ZOY A;  1U9N A;  3VVX A;  3LHQ A;  3COL A;  2PZ9 A;  3NXC A;  3TP0 A;  3G1O A;  5DAJ A;  3B6A A;  4ME9 A;  3BCG A;  4GCL A;  1Z0X A;  1RKT A;  3Q0V A;  2VKV A;  3ZQH A;  3QQA A;  5F08 A;  2G7S A;  4PXI A;  1JT6 A;  1JTY A;  3HTI A;  1ZK8 A;  2DG8 A;  4D7M A;  5J1U A;  2ZB9 A;  3TP3 A;  5K58 A;  2G3B A;  1QPI A;  3DPJ A;  3ZQL A;  3CRJ A;  4JNN A;  2UXP A;  1UI6 A;  2OI8 A;  1JUM A;  2HYT A;  5EZH A;  2OER A;  3SDG A;  1SGM A;  3G7R A;  3KKD A;  3VP5 A;  3F0C A;  3KZ9 A;  2FQ4 A;  3EGQ A;  3BHQ A;  2QIB A;  4AC0 A;  3HTH A;  3JSJ A;  5CW8 A;  3O8G A;  3HE0 A;  2JJ7 A;  5J1R A;  3QKX A;  5FKK A;  2ID6 A;  2QKO A;  5CXG A;  3Q0W A;  2XRL A;  2PBX A;  3DEW A;  5IOY A;  2XB5 A;  3BR6 A;  3VVZ A;  5D19 A;  2QWT A;  3NI7 A;  1JT0 A;  5K7H A;  3FIW A;  4V2F A;  2GEN A;  4ICH A;  4MO7 A;  5FKL A; 
#chains in the Genus database with same CATH topology
 5GPC A;  3BTL A;  1ORK A;  3EUP A;  2VKE A;  4KWA A;  4M3B A;  5K7F A;  5F0F A;  4M3D A;  3CCY A;  3LWJ A;  2NP5 A;  3SFI A;  2NX4 A;  5FHP A;  4GCK A;  2G7G A;  2QCO A;  3BRU A;  2I10 A;  4GFK A;  4JYK A;  3O8H A;  2IAI A;  4YZE A;  2GUH A;  2RAE A;  5FKM A;  2HYJ A;  2F07 A;  3BJB A;  2QTQ A;  3VOX A;  5J1Y A;  3GZI A;  2X6O A;  4B3A A;  1QVT A;  3KKC A;  4D7N A;  4NN1 A;  3VUQ A;  2G0E A;  3V6G A;  2IBD A;  3RH2 A;  5FKN A;  4U9N A;  2WGB A;  2XPV A;  2REK A;  5F0H A;  2ZCM A;  2R7O A;  2R7W A;  5C4Y A;  5FGL A;  1BJZ A;  3B6C A;  3FK6 A;  3VW0 A;  2NS7 A;  3BR2 A;  1Z77 A;  2TRT A;  4D5C A;  5IP6 A;  3AQS A;  2JK3 A;  3MNL A;  2UXO A;  5CXI A;  3BR5 A;  3S5R A;  4M3G A;  5D18 A;  2A2F X;  3BR3 A;  2O7O A;  3B81 A;  3MVP A;  5EYR A;  2YVH A;  1JTX A;  3BT9 A;  2FBQ A;  2W53 A;  3ZQG A;  3VOK A;  3BTC A;  4OD4 A;  3PPB A;  2B1E A;  3LSP A;  2NS8 A;  3FK7 A;  5J3L A;  3FRQ A;  2Y30 A;  2XDN A;  2HXO A;  1VI0 A;  3HIM A;  2IU5 A;  2HXI A;  4HKU A;  2RAS A;  3VPR A;  4DW6 A;  4WIB A;  4XK4 A;  3HGG A;  2GBY A;  4D5F A;  4IRV A;  2Q24 A;  4GFL A;  4JL3 A;  3VVY A;  2O7T A;  2TCT A;  4AUX A;  5H9T A;  2Y2Z A;  5HSZ A;  2FX0 A;  3LSR A;  2EH3 A;  3PAS A;  2YVE A;  3WHB A;  3BNI A;  4AF5 A;  2RHA A;  2ID3 A;  3ON2 A;  4L62 A;  2GFN A;  5F27 A;  5D1R A;  4OD5 A;  5K7Z A;  2ZOZ A;  3LSJ A;  3DU6 A;  4CGR A;  3VTI A;  2PFV A;  3C2B A;  4U9L A;  3QPS A;  3CJD A;  5GPA A;  2HKU A;  5FKO A;  3IH3 A;  4W97 A;  1U9O A;  3NPI A;  1T56 A;  3RD3 A;  2FJ1 A;  3BR1 A;  3WHC A;  5GP9 A;  4NEL A;  5EZG A;  3KNW A;  2ZCX A;  2NP3 A;  3IH4 A;  2DTZ A;  5IOZ A;  5FMP A;  4W1U A;  3E7Q A;  1A6I A;  3AQT A;  2D6Y A;  2Y31 A;  1T33 A;  3ANG A;  5EFY A;  3ZQF A;  2DG7 A;  2WV1 A;  5IPA A;  3VW2 A;  3GEU A;  3P9T A;  2X9D A;  5HAW A;  2V57 A;  3HGY A;  3VW1 A;  3DCF A;  3G1M A;  2OPT A;  5F04 A;  3HTA A;  5CQG A;  4JKZ A;  3BQZ A;  2IEK A;  2QOP A;  3ON4 A;  1RPW A;  3BTI A;  5HBU A;  3LOC A;  4M3E A;  2UXH A;  4ACI A;  1QVU A;  2UXI A;  3O60 A;  1ZKG A;  3V78 A;  5F1J A;  3QBM A;  5AQC A;  4X1E A;  2XGE A;  2HQ5 A;  3ZQI A;  4M3F A;  4ABZ A;  4V2G A;  2UXU A;  3F1B A;  3T6N A;  3G1L A;  4I6Z A;  1JUP A;  2XPW A;  3DU5 A;  3BQY A;  3C07 A;  3QPL A;  1RKW A;  2WUI A;  2ZCN A;  4MXM A;  3G56 A;  3NRG A;  2XPU A;  4GCT A;  4MK6 A;  4UDS A;  3IUV A;  3NNR A;  2OF7 A;  3HTJ A;  3CWR A;  2VPR A;  2FD5 A;  3PM1 A;  3BR0 A;  2XGD A;  3BTJ A;  4G12 A;  2XGC A;  3Q0U A;  3LJL A;  1JUS A;  5F0C A;  4B1R A;  2R7R A;  2G7L A;  4I76 A;  3ANP A;  3CDL A;  3VIB A;  1UI5 A;  3Q3S A;  3IH2 A;  4AC6 A;  2ZOY A;  1U9N A;  2R7S A;  2R7Q A;  3VVX A;  3LHQ A;  4DVY P;  2ZY9 A;  3COL A;  2PZ9 A;  3NXC A;  3TP0 A;  3NS4 A;  3G1O A;  5DAJ A;  3B6A A;  4ME9 A;  3BCG A;  4C2M A;  4GCL A;  1Z0X A;  1RKT A;  3Q0V A;  2VKV A;  3ZQH A;  3QQA A;  5F08 A;  2G7S A;  4PXI A;  1JT6 A;  1JTY A;  3HTI A;  1ZK8 A;  2DG8 A;  4D7M A;  5J1U A;  2ZB9 A;  3TP3 A;  5K58 A;  2G3B A;  2FJI 1;  1QPI A;  3DPJ A;  3ZQL A;  3CRJ A;  4JNN A;  2B3W A;  2R7V A;  3KYL A;  2UXP A;  1UI6 A;  3SWH A;  2OI8 A;  1JUM A;  2HYT A;  5EZH A;  2OER A;  3SDG A;  1SGM A;  3G7R A;  3KKD A;  3VP5 A;  2R7T A;  2YVX A;  3F0C A;  3KZ9 A;  2R7U A;  2FQ4 A;  3EGQ A;  3BHQ A;  2QIB A;  4AC0 A;  3HTH A;  3JSJ A;  5CW8 A;  3O8G A;  3HE0 A;  2JJ7 A;  5J1R A;  3QKX A;  5FKK A;  2ID6 A;  2QKO A;  5CXG A;  3Q0W A;  2XRL A;  2PBX A;  3DEW A;  2R7X A;  5IOY A;  2XB5 A;  3BR6 A;  3VVZ A;  5D19 A;  2QWT A;  3K8P C;  3NI7 A;  1JT0 A;  5K7H A;  3FIW A;  3FHN A;  4V2F A;  2GEN A;  4ICH A;  4MO7 A;  5FKL A; 
#chains in the Genus database with same CATH homology
 5GPC A;  3BTL A;  1ORK A;  3EUP A;  2VKE A;  4KWA A;  4M3B A;  5K7F A;  5F0F A;  4M3D A;  3CCY A;  3LWJ A;  2NP5 A;  3SFI A;  2NX4 A;  5FHP A;  4GCK A;  2G7G A;  2QCO A;  3BRU A;  2I10 A;  4GFK A;  4JYK A;  3O8H A;  2IAI A;  4YZE A;  2GUH A;  2RAE A;  5FKM A;  2HYJ A;  2F07 A;  3BJB A;  2QTQ A;  3VOX A;  5J1Y A;  3GZI A;  2X6O A;  4B3A A;  1QVT A;  3KKC A;  4D7N A;  4NN1 A;  3VUQ A;  2G0E A;  3V6G A;  2IBD A;  3RH2 A;  5FKN A;  2WGB A;  2XPV A;  2REK A;  5F0H A;  2ZCM A;  5C4Y A;  5FGL A;  1BJZ A;  3B6C A;  3FK6 A;  3VW0 A;  2NS7 A;  3BR2 A;  1Z77 A;  2TRT A;  4D5C A;  5IP6 A;  3AQS A;  2JK3 A;  3MNL A;  2UXO A;  5CXI A;  3BR5 A;  3S5R A;  4M3G A;  5D18 A;  3BR3 A;  2O7O A;  3B81 A;  3MVP A;  5EYR A;  2YVH A;  1JTX A;  3BT9 A;  2FBQ A;  2W53 A;  3ZQG A;  3VOK A;  3BTC A;  3PPB A;  3LSP A;  2NS8 A;  3FK7 A;  5J3L A;  3FRQ A;  2Y30 A;  2XDN A;  2HXO A;  1VI0 A;  3HIM A;  2IU5 A;  2HXI A;  4HKU A;  2RAS A;  3VPR A;  4DW6 A;  4XK4 A;  3HGG A;  2GBY A;  4D5F A;  2Q24 A;  4GFL A;  4JL3 A;  3VVY A;  2O7T A;  2TCT A;  4AUX A;  5H9T A;  2Y2Z A;  5HSZ A;  2FX0 A;  3LSR A;  2EH3 A;  3PAS A;  2YVE A;  3WHB A;  3BNI A;  4AF5 A;  2RHA A;  2ID3 A;  3ON2 A;  4L62 A;  2GFN A;  5F27 A;  5D1R A;  5K7Z A;  2ZOZ A;  3LSJ A;  4CGR A;  3C2B A;  3QPS A;  3CJD A;  5GPA A;  2HKU A;  5FKO A;  3IH3 A;  4W97 A;  1U9O A;  3NPI A;  1T56 A;  3RD3 A;  2FJ1 A;  3BR1 A;  3WHC A;  5GP9 A;  4NEL A;  5EZG A;  3KNW A;  2ZCX A;  2NP3 A;  3IH4 A;  2DTZ A;  5IOZ A;  5FMP A;  4W1U A;  3E7Q A;  1A6I A;  3AQT A;  2D6Y A;  2Y31 A;  1T33 A;  3ANG A;  5EFY A;  3ZQF A;  2DG7 A;  2WV1 A;  5IPA A;  3VW2 A;  3GEU A;  3P9T A;  2X9D A;  5HAW A;  2V57 A;  3HGY A;  3VW1 A;  3DCF A;  3G1M A;  2OPT A;  5F04 A;  3HTA A;  4JKZ A;  3BQZ A;  2IEK A;  2QOP A;  3ON4 A;  1RPW A;  3BTI A;  5HBU A;  3LOC A;  4M3E A;  2UXH A;  4ACI A;  1QVU A;  2UXI A;  3O60 A;  1ZKG A;  3V78 A;  5F1J A;  3QBM A;  5AQC A;  4X1E A;  2XGE A;  2HQ5 A;  3ZQI A;  4M3F A;  4ABZ A;  4V2G A;  2UXU A;  3F1B A;  3T6N A;  3G1L A;  4I6Z A;  1JUP A;  2XPW A;  3BQY A;  3C07 A;  3QPL A;  1RKW A;  2WUI A;  2ZCN A;  4MXM A;  3G56 A;  3NRG A;  2XPU A;  4GCT A;  4MK6 A;  4UDS A;  3IUV A;  3NNR A;  2OF7 A;  3HTJ A;  3CWR A;  2VPR A;  2FD5 A;  3PM1 A;  3BR0 A;  2XGD A;  3BTJ A;  4G12 A;  2XGC A;  3Q0U A;  3LJL A;  1JUS A;  5F0C A;  4B1R A;  2G7L A;  4I76 A;  3ANP A;  3CDL A;  3VIB A;  1UI5 A;  3Q3S A;  3IH2 A;  4AC6 A;  2ZOY A;  1U9N A;  3VVX A;  3LHQ A;  3COL A;  2PZ9 A;  3NXC A;  3TP0 A;  3G1O A;  5DAJ A;  3B6A A;  4ME9 A;  3BCG A;  4GCL A;  1Z0X A;  1RKT A;  3Q0V A;  2VKV A;  3ZQH A;  3QQA A;  5F08 A;  2G7S A;  4PXI A;  1JT6 A;  1JTY A;  3HTI A;  1ZK8 A;  2DG8 A;  4D7M A;  5J1U A;  2ZB9 A;  3TP3 A;  5K58 A;  2G3B A;  1QPI A;  3DPJ A;  3ZQL A;  3CRJ A;  4JNN A;  2UXP A;  1UI6 A;  2OI8 A;  1JUM A;  2HYT A;  5EZH A;  2OER A;  3SDG A;  1SGM A;  3G7R A;  3KKD A;  3VP5 A;  3F0C A;  3KZ9 A;  2FQ4 A;  3EGQ A;  3BHQ A;  2QIB A;  4AC0 A;  3HTH A;  3JSJ A;  5CW8 A;  3O8G A;  3HE0 A;  2JJ7 A;  5J1R A;  3QKX A;  5FKK A;  2ID6 A;  2QKO A;  5CXG A;  3Q0W A;  2XRL A;  2PBX A;  3DEW A;  5IOY A;  2XB5 A;  3BR6 A;  3VVZ A;  5D19 A;  2QWT A;  3NI7 A;  1JT0 A;  5K7H A;  3FIW A;  4V2F A;  2GEN A;  4ICH A;  4MO7 A;  5FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...