3BHQA

Crystal structure of a putative tetr-family transcriptional regulator (mlr_4833) from mesorhizobium loti maff303099 at 1.54 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
202
structure length
202
Chain Sequence
ETRSARKDREIIQAATAAFISKGYDGTSMEEIATKAGASKQTVYKHFTDKETLFGEVVLSTASQVNDIIESVTTLLSEAIFMEGGLQQLARRLIAVLMDEELLKLRRLIIANADRMPQLGRAWYEKGFERMLASTASCFQKLTNRGLIQTGDPYLAASHLFGMLLWIPMNEAMFTGSNRRSKAELERHADASVEAFLAVYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of TetR-family transcriptional regulator (NP_105615.1) from Mesorhizobium loti at 1.54 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Transcription
total genus 84
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14246 TetR_C_7 AefR-like transcriptional repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bhqA00
1ZK8A 3BTCA 4G12A 3F1BA 3G7RA 4YZEA 4MXMA 5F0FA 1VI0A 1QVTA 3HE0A 3G1LA 3G1OA 4NELA 2HYTA 2VKEA 3BTIA 3ZQGA 2PBXA 4PXIA 3FK7A 3LHQA 2XGEA 2O7OA 2HKUA 3GEUA 4JNNA 3NI7A 1T56A 2QWTA 5F1JA 1JUMA 2UXUA 5GPCA 2WGBA 2ID3A 4X1EA 5IPAA 2WUIA 2NS8A 5D19A 3BR3A 2F07A 3RD3A 5EZHA 3S5RA 2HYJA 3EUPA 5K58A 3RH2A 1UI5A 3BHQA 4D7MA 4JYKA 3QKXA 3ZQHA 2JJ7A 3WHBA 3IH3A 3LSJA 3TP3A 3LJLA 5D18A 3IH4A 2X9DA 4AC6A 3VW1A 3P9TA 3AQSA 4M3DA 5CW8A 2EH3A 2FJ1A 2ID6A 3VP5A 4KWAA 1QPIA 1U9NA 5F08A 5K7HA 1JTYA 2RHAA 5EZGA 3QBMA 3CWRA 5CXIA 3EGQA 4GCLA 5J1RA 2G7LA 3NRGA 2FBQA 5C4YA 1RKTA 2RAEA 3F0CA 5F04A 2OPTA 2QKOA 5K7FA 3BTLA 3VVZA 2XB5A 4W1UA 2Y2ZA 3O8GA 3VVYA 3VPRA 3NNRA 4B3AA 2OERA 2PZ9A 2QTQA 4DW6A 4I76A 3KZ9A 5EFYA 3FK6A 3HTHA 3PASA 2IAIA 3LSRA 3GZIA 4NN1A 4GFLA 2UXHA 4M3FA 2GFNA 2IU5A 1JUPA 2UXPA 3VVXA 3NPIA 2GBYA 2YVHA 1ZKGA 3TP0A 3CDLA 3ON4A 3MVPA 2XPWA 3ANPA 2O7TA 2VKVA 2Y31A 3VW2A 3LWJA 1JTXA 5FMPA 2X6OA 3BR2A 4B1RA 5CXGA 2UXOA 3BR6A 4AF5A 2VPRA 2DTZA 4MO7A 4V2FA 3IUVA 5EYRA 3COLA 3PPBA 3QPLA 3VIBA 2TRTA 2ZCNA 3ZQFA 3SFIA 3KNWA 2NX4A 4L62A 3BT9A 5FKKA 3BR0A 2FX0A 2IBDA 5DAJA 2D6YA 3VUQA 5IOYA 3SDGA 3LOCA 1BJZA 2I10A 3KKCA 5IOZA 5HAWA 4XK4A 4W97A 3VW0A 3CRJA 4M3EA 3BQYA 3DEWA 3O60A 4ABZA 2OF7A 3C2BA 3B6CA 3PM1A 1UI6A 5FKMA 3HTIA 5J3LA 4V2GA 3Q0UA 4GCKA 4HKUA 3HTJA 4MK6A 4I6ZA 4M3GA 3O8HA 4ACIA 2UXIA 2WV1A 2QCOA 3T6NA 2NP5A 3MNLA 3BJBA 3BTJA 3Q0VA 2DG7A 3HTAA 5FKOA 3QQAA 1QVUA 2Q24A 3FRQA 3CCYA 4D5FA 2XPVA 5F0HA 4GFKA 1SGMA 2G3BA 2ZOZA 2ZCXA 5H9TA 2G7SA 1JT0A 5FKNA 5F0CA 3BQZA 1RPWA 5K7ZA 3V78A 2G0EA 2HXIA 2NP3A 2XGDA 3VOXA 2FD5A 4AUXA 2GENA 2W53A 3DPJA 2ZOYA 3Q3SA 3BR1A 2FQ4A 3BRUA 5HSZA 3Q0WA 5FKLA 3QPSA 4JL3A 5AQCA 3FIWA 2DG8A 5HBUA 2JK3A 3B6AA 5GP9A 2QIBA 3V6GA 5GPAA 5D1RA 4CGRA 2XPUA 4M3BA 3BCGA 4JKZA 2GUHA 2XGCA 3KKDA 5J1UA 2IEKA 1ORKA 4ME9A 2ZB9A 3IH2A 1U9OA 3HGGA 2HXOA 2QOPA 3DCFA 3ZQLA 3ZQIA 4ICHA 4AC0A 5FGLA 3ANGA 3HGYA 3G56A 1T33A 4GCTA 3E7QA 2OI8A 3AQTA 1Z77A 4D5CA 1A6IA 3VOKA 2V57A 3JSJA 3ON2A 3BR5A 2ZCMA 3B81A 3WHCA 5F27A 2G7GA 4D7NA 3NXCA 3CJDA 2XDNA 2Y30A 3C07A 2NS7A 2HQ5A 1Z0XA 3LSPA 2REKA 3HIMA 5IP6A 2YVEA 2RASA 1RKWA 4UDSA 2TCTA 5J1YA 1JT6A 3G1MA 2XRLA 5FHPA 3BNIA 1JUSA
chains in the Genus database with same CATH superfamily
1ZK8A 4IRVA 3BTCA 4G12A 3F1BA 3G7RA 4YZEA 4MXMA 5F0FA 1VI0A 1QVTA 3HE0A 3G1LA 3G1OA 4NELA 2HYTA 2VKEA 3BTIA 3ZQGA 2PBXA 4PXIA 3FK7A 3LHQA 2XGEA 2O7OA 2HKUA 3GEUA 4U9LA 4JNNA 3NI7A 1T56A 2QWTA 5F1JA 2B3WA 1JUMA 2R7RA 2UXUA 5GPCA 2WGBA 2ID3A 4X1EA 5IPAA 2WUIA 2NS8A 5D19A 3BR3A 2F07A 4U9NA 3RD3A 5EZHA 2R7TA 3DU5A 3S5RA 2HYJA 3EUPA 5K58A 3RH2A 1UI5A 3BHQA 4D7MA 4JYKA 3QKXA 3ZQHA 2JJ7A 3WHBA 3IH3A 2YVXA 3LSJA 3TP3A 3LJLA 4OD4A 5D18A 3IH4A 2X9DA 4AC6A 3VW1A 3P9TA 3AQSA 5CQGA 4M3DA 5CW8A 2EH3A 2FJ1A 2ID6A 3VP5A 2R7UA 4KWAA 1QPIA 1U9NA 5F08A 5K7HA 1JTYA 2RHAA 5EZGA 3QBMA 3CWRA 5CXIA 3EGQA 4GCLA 5J1RA 3K8PC 2G7LA 3NRGA 2FBQA 5C4YA 1RKTA 2RAEA 3F0CA 5F04A 2OPTA 2QKOA 5K7FA 3BTLA 3VVZA 2A2FX 2XB5A 4W1UA 2Y2ZA 3O8GA 3VVYA 3VPRA 3NNRA 4B3AA 2OERA 2R7XA 2PZ9A 2QTQA 4DW6A 4I76A 3KZ9A 5EFYA 3VTIA 3FK6A 3HTHA 3PASA 2IAIA 3LSRA 3GZIA 4NN1A 4GFLA 2UXHA 2R7OA 4M3FA 2GFNA 2IU5A 1JUPA 2UXPA 3VVXA 3NPIA 2GBYA 2YVHA 1ZKGA 3TP0A 3CDLA 3ON4A 3MVPA 2XPWA 3ANPA 2O7TA 2VKVA 2Y31A 3VW2A 3LWJA 1JTXA 5FMPA 2X6OA 3BR2A 4B1RA 5CXGA 2UXOA 3BR6A 4AF5A 2VPRA 2DTZA 2R7QA 4MO7A 4V2FA 3IUVA 5EYRA 3COLA 3PPBA 3QPLA 3VIBA 2TRTA 2ZCNA 3ZQFA 3SFIA 3KNWA 2NX4A 4L62A 3BT9A 5FKKA 3BR0A 2FX0A 2IBDA 5DAJA 2D6YA 3VUQA 5IOYA 3SDGA 3KYLA 3LOCA 4OD5A 1BJZA 2I10A 3KKCA 5IOZA 5HAWA 4XK4A 4W97A 3VW0A 3CRJA 4M3EA 3BQYA 3DEWA 3O60A 4ABZA 2OF7A 3C2BA 3B6CA 3PM1A 1UI6A 5FKMA 3NS4A 3HTIA 4C2MA 5J3LA 4V2GA 3Q0UA 4GCKA 4HKUA 3HTJA 4MK6A 4I6ZA 4M3GA 3O8HA 4ACIA 2UXIA 2WV1A 2QCOA 3T6NA 2NP5A 2R7VA 3MNLA 3BJBA 3BTJA 3Q0VA 2DG7A 3HTAA 5FKOA 3QQAA 1QVUA 2Q24A 3FRQA 3CCYA 4D5FA 2XPVA 5F0HA 4GFKA 1SGMA 2G3BA 2ZOZA 2ZCXA 5H9TA 2G7SA 3DU6A 1JT0A 5FKNA 5F0CA 3BQZA 1RPWA 5K7ZA 2R7SA 3V78A 2G0EA 2HXIA 2NP3A 2XGDA 3VOXA 2FD5A 4AUXA 2GENA 2W53A 3DPJA 2ZOYA 3Q3SA 3BR1A 2FQ4A 3BRUA 5HSZA 3Q0WA 5FKLA 3QPSA 4JL3A 5AQCA 3FIWA 2DG8A 5HBUA 2JK3A 3B6AA 5GP9A 2QIBA 3V6GA 5GPAA 5D1RA 4CGRA 2XPUA 4M3BA 2B1EA 3BCGA 4JKZA 2GUHA 2XGCA 3KKDA 5J1UA 2IEKA 1ORKA 4ME9A 3FHNA 2ZB9A 2ZY9A 3IH2A 1U9OA 3HGGA 2HXOA 2QOPA 3DCFA 3ZQLA 3ZQIA 4ICHA 4DVYP 4AC0A 2PFVA 2FJI1 5FGLA 3ANGA 3HGYA 3G56A 1T33A 4GCTA 3E7QA 2OI8A 3AQTA 1Z77A 4D5CA 1A6IA 3VOKA 2V57A 3JSJA 3ON2A 3SWHA 3BR5A 2ZCMA 3B81A 3WHCA 5F27A 2G7GA 4D7NA 3NXCA 3CJDA 4WIBA 2R7WA 2XDNA 2Y30A 3C07A 2NS7A 2HQ5A 1Z0XA 3LSPA 2REKA 3HIMA 5IP6A 2YVEA 2RASA 1RKWA 4UDSA 2TCTA 5J1YA 1JT6A 3G1MA 2XRLA 5FHPA 3BNIA 1JUSA
chains in the Genus database with same CATH topology
1ZK8A 3BTCA 4G12A 3F1BA 3G7RA 4YZEA 4MXMA 5F0FA 1VI0A 1QVTA 3HE0A 3G1LA 3G1OA 4NELA 2HYTA 2VKEA 3BTIA 3ZQGA 2PBXA 4PXIA 3FK7A 3LHQA 2XGEA 2O7OA 2HKUA 3GEUA 4JNNA 3NI7A 1T56A 2QWTA 5F1JA 1JUMA 2UXUA 5GPCA 2WGBA 2ID3A 4X1EA 5IPAA 2WUIA 2NS8A 5D19A 3BR3A 2F07A 3RD3A 5EZHA 3S5RA 2HYJA 3EUPA 5K58A 3RH2A 1UI5A 3BHQA 4D7MA 4JYKA 3QKXA 3ZQHA 2JJ7A 3WHBA 3IH3A 3LSJA 3TP3A 3LJLA 5D18A 3IH4A 2X9DA 4AC6A 3VW1A 3P9TA 3AQSA 4M3DA 5CW8A 2EH3A 2FJ1A 2ID6A 3VP5A 4KWAA 1QPIA 1U9NA 5F08A 5K7HA 1JTYA 2RHAA 5EZGA 3QBMA 3CWRA 5CXIA 3EGQA 4GCLA 5J1RA 2G7LA 3NRGA 2FBQA 5C4YA 1RKTA 2RAEA 3F0CA 5F04A 2OPTA 2QKOA 5K7FA 3BTLA 3VVZA 2XB5A 4W1UA 2Y2ZA 3O8GA 3VVYA 3VPRA 3NNRA 4B3AA 2OERA 2PZ9A 2QTQA 4DW6A 4I76A 3KZ9A 5EFYA 3FK6A 3HTHA 3PASA 2IAIA 3LSRA 3GZIA 4NN1A 4GFLA 2UXHA 4M3FA 2GFNA 2IU5A 1JUPA 2UXPA 3VVXA 3NPIA 2GBYA 2YVHA 1ZKGA 3TP0A 3CDLA 3ON4A 3MVPA 2XPWA 3ANPA 2O7TA 2VKVA 2Y31A 3VW2A 3LWJA 1JTXA 5FMPA 2X6OA 3BR2A 4B1RA 5CXGA 2UXOA 3BR6A 4AF5A 2VPRA 2DTZA 4MO7A 4V2FA 3IUVA 5EYRA 3COLA 3PPBA 3QPLA 3VIBA 2TRTA 2ZCNA 3ZQFA 3SFIA 3KNWA 2NX4A 4L62A 3BT9A 5FKKA 3BR0A 2FX0A 2IBDA 5DAJA 2D6YA 3VUQA 5IOYA 3SDGA 3LOCA 1BJZA 2I10A 3KKCA 5IOZA 5HAWA 4XK4A 4W97A 3VW0A 3CRJA 4M3EA 3BQYA 3DEWA 3O60A 4ABZA 2OF7A 3C2BA 3B6CA 3PM1A 1UI6A 5FKMA 3HTIA 5J3LA 4V2GA 3Q0UA 4GCKA 4HKUA 3HTJA 4MK6A 4I6ZA 4M3GA 3O8HA 4ACIA 2UXIA 2WV1A 2QCOA 3T6NA 2NP5A 3MNLA 3BJBA 3BTJA 3Q0VA 2DG7A 3HTAA 5FKOA 3QQAA 1QVUA 2Q24A 3FRQA 3CCYA 4D5FA 2XPVA 5F0HA 4GFKA 1SGMA 2G3BA 2ZOZA 2ZCXA 5H9TA 2G7SA 1JT0A 5FKNA 5F0CA 3BQZA 1RPWA 5K7ZA 3V78A 2G0EA 2HXIA 2NP3A 2XGDA 3VOXA 2FD5A 4AUXA 2GENA 2W53A 3DPJA 2ZOYA 3Q3SA 3BR1A 2FQ4A 3BRUA 5HSZA 3Q0WA 5FKLA 3QPSA 4JL3A 5AQCA 3FIWA 2DG8A 5HBUA 2JK3A 3B6AA 5GP9A 2QIBA 3V6GA 5GPAA 5D1RA 4CGRA 2XPUA 4M3BA 3BCGA 4JKZA 2GUHA 2XGCA 3KKDA 5J1UA 2IEKA 1ORKA 4ME9A 2ZB9A 3IH2A 1U9OA 3HGGA 2HXOA 2QOPA 3DCFA 3ZQLA 3ZQIA 4ICHA 4AC0A 5FGLA 3ANGA 3HGYA 3G56A 1T33A 4GCTA 3E7QA 2OI8A 3AQTA 1Z77A 4D5CA 1A6IA 3VOKA 2V57A 3JSJA 3ON2A 3BR5A 2ZCMA 3B81A 3WHCA 5F27A 2G7GA 4D7NA 3NXCA 3CJDA 2XDNA 2Y30A 3C07A 2NS7A 2HQ5A 1Z0XA 3LSPA 2REKA 3HIMA 5IP6A 2YVEA 2RASA 1RKWA 4UDSA 2TCTA 5J1YA 1JT6A 3G1MA 2XRLA 5FHPA 3BNIA 1JUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK8 A;  3BTC A;  4G12 A;  3F1B A;  3G7R A;  4YZE A;  4MXM A;  5F0F A;  1VI0 A;  1QVT A;  3HE0 A;  3G1L A;  3G1O A;  4NEL A;  2HYT A;  2VKE A;  3BTI A;  3ZQG A;  2PBX A;  4PXI A;  3FK7 A;  3LHQ A;  2XGE A;  2O7O A;  2HKU A;  3GEU A;  4JNN A;  3NI7 A;  1T56 A;  2QWT A;  5F1J A;  1JUM A;  2UXU A;  5GPC A;  2WGB A;  2ID3 A;  4X1E A;  5IPA A;  2WUI A;  2NS8 A;  5D19 A;  3BR3 A;  2F07 A;  3RD3 A;  5EZH A;  3S5R A;  2HYJ A;  3EUP A;  5K58 A;  3RH2 A;  1UI5 A;  3BHQ A;  4D7M A;  4JYK A;  3QKX A;  3ZQH A;  2JJ7 A;  3WHB A;  3IH3 A;  3LSJ A;  3TP3 A;  3LJL A;  5D18 A;  3IH4 A;  2X9D A;  4AC6 A;  3VW1 A;  3P9T A;  3AQS A;  4M3D A;  5CW8 A;  2EH3 A;  2FJ1 A;  2ID6 A;  3VP5 A;  4KWA A;  1QPI A;  1U9N A;  5F08 A;  5K7H A;  1JTY A;  2RHA A;  5EZG A;  3QBM A;  3CWR A;  5CXI A;  3EGQ A;  4GCL A;  5J1R A;  2G7L A;  3NRG A;  2FBQ A;  5C4Y A;  1RKT A;  2RAE A;  3F0C A;  5F04 A;  2OPT A;  2QKO A;  5K7F A;  3BTL A;  3VVZ A;  2XB5 A;  4W1U A;  2Y2Z A;  3O8G A;  3VVY A;  3VPR A;  3NNR A;  4B3A A;  2OER A;  2PZ9 A;  2QTQ A;  4DW6 A;  4I76 A;  3KZ9 A;  5EFY A;  3FK6 A;  3HTH A;  3PAS A;  2IAI A;  3LSR A;  3GZI A;  4NN1 A;  4GFL A;  2UXH A;  4M3F A;  2GFN A;  2IU5 A;  1JUP A;  2UXP A;  3VVX A;  3NPI A;  2GBY A;  2YVH A;  1ZKG A;  3TP0 A;  3CDL A;  3ON4 A;  3MVP A;  2XPW A;  3ANP A;  2O7T A;  2VKV A;  2Y31 A;  3VW2 A;  3LWJ A;  1JTX A;  5FMP A;  2X6O A;  3BR2 A;  4B1R A;  5CXG A;  2UXO A;  3BR6 A;  4AF5 A;  2VPR A;  2DTZ A;  4MO7 A;  4V2F A;  3IUV A;  5EYR A;  3COL A;  3PPB A;  3QPL A;  3VIB A;  2TRT A;  2ZCN A;  3ZQF A;  3SFI A;  3KNW A;  2NX4 A;  4L62 A;  3BT9 A;  5FKK A;  3BR0 A;  2FX0 A;  2IBD A;  5DAJ A;  2D6Y A;  3VUQ A;  5IOY A;  3SDG A;  3LOC A;  1BJZ A;  2I10 A;  3KKC A;  5IOZ A;  5HAW A;  4XK4 A;  4W97 A;  3VW0 A;  3CRJ A;  4M3E A;  3BQY A;  3DEW A;  3O60 A;  4ABZ A;  2OF7 A;  3C2B A;  3B6C A;  3PM1 A;  1UI6 A;  5FKM A;  3HTI A;  5J3L A;  4V2G A;  3Q0U A;  4GCK A;  4HKU A;  3HTJ A;  4MK6 A;  4I6Z A;  4M3G A;  3O8H A;  4ACI A;  2UXI A;  2WV1 A;  2QCO A;  3T6N A;  2NP5 A;  3MNL A;  3BJB A;  3BTJ A;  3Q0V A;  2DG7 A;  3HTA A;  5FKO A;  3QQA A;  1QVU A;  2Q24 A;  3FRQ A;  3CCY A;  4D5F A;  2XPV A;  5F0H A;  4GFK A;  1SGM A;  2G3B A;  2ZOZ A;  2ZCX A;  5H9T A;  2G7S A;  1JT0 A;  5FKN A;  5F0C A;  3BQZ A;  1RPW A;  5K7Z A;  3V78 A;  2G0E A;  2HXI A;  2NP3 A;  2XGD A;  3VOX A;  2FD5 A;  4AUX A;  2GEN A;  2W53 A;  3DPJ A;  2ZOY A;  3Q3S A;  3BR1 A;  2FQ4 A;  3BRU A;  5HSZ A;  3Q0W A;  5FKL A;  3QPS A;  4JL3 A;  5AQC A;  3FIW A;  2DG8 A;  5HBU A;  2JK3 A;  3B6A A;  5GP9 A;  2QIB A;  3V6G A;  5GPA A;  5D1R A;  4CGR A;  2XPU A;  4M3B A;  3BCG A;  4JKZ A;  2GUH A;  2XGC A;  3KKD A;  5J1U A;  2IEK A;  1ORK A;  4ME9 A;  2ZB9 A;  3IH2 A;  1U9O A;  3HGG A;  2HXO A;  2QOP A;  3DCF A;  3ZQL A;  3ZQI A;  4ICH A;  4AC0 A;  5FGL A;  3ANG A;  3HGY A;  3G56 A;  1T33 A;  4GCT A;  3E7Q A;  2OI8 A;  3AQT A;  1Z77 A;  4D5C A;  1A6I A;  3VOK A;  2V57 A;  3JSJ A;  3ON2 A;  3BR5 A;  2ZCM A;  3B81 A;  3WHC A;  5F27 A;  2G7G A;  4D7N A;  3NXC A;  3CJD A;  2XDN A;  2Y30 A;  3C07 A;  2NS7 A;  2HQ5 A;  1Z0X A;  3LSP A;  2REK A;  3HIM A;  5IP6 A;  2YVE A;  2RAS A;  1RKW A;  4UDS A;  2TCT A;  5J1Y A;  1JT6 A;  3G1M A;  2XRL A;  5FHP A;  3BNI A;  1JUS A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  4IRV A;  3BTC A;  4G12 A;  3F1B A;  3G7R A;  4YZE A;  4MXM A;  5F0F A;  1VI0 A;  1QVT A;  3HE0 A;  3G1L A;  3G1O A;  4NEL A;  2HYT A;  2VKE A;  3BTI A;  3ZQG A;  2PBX A;  4PXI A;  3FK7 A;  3LHQ A;  2XGE A;  2O7O A;  2HKU A;  3GEU A;  4U9L A;  4JNN A;  3NI7 A;  1T56 A;  2QWT A;  5F1J A;  2B3W A;  1JUM A;  2R7R A;  2UXU A;  5GPC A;  2WGB A;  2ID3 A;  4X1E A;  5IPA A;  2WUI A;  2NS8 A;  5D19 A;  3BR3 A;  2F07 A;  4U9N A;  3RD3 A;  5EZH A;  2R7T A;  3DU5 A;  3S5R A;  2HYJ A;  3EUP A;  5K58 A;  3RH2 A;  1UI5 A;  3BHQ A;  4D7M A;  4JYK A;  3QKX A;  3ZQH A;  2JJ7 A;  3WHB A;  3IH3 A;  2YVX A;  3LSJ A;  3TP3 A;  3LJL A;  4OD4 A;  5D18 A;  3IH4 A;  2X9D A;  4AC6 A;  3VW1 A;  3P9T A;  3AQS A;  5CQG A;  4M3D A;  5CW8 A;  2EH3 A;  2FJ1 A;  2ID6 A;  3VP5 A;  2R7U A;  4KWA A;  1QPI A;  1U9N A;  5F08 A;  5K7H A;  1JTY A;  2RHA A;  5EZG A;  3QBM A;  3CWR A;  5CXI A;  3EGQ A;  4GCL A;  5J1R A;  3K8P C;  2G7L A;  3NRG A;  2FBQ A;  5C4Y A;  1RKT A;  2RAE A;  3F0C A;  5F04 A;  2OPT A;  2QKO A;  5K7F A;  3BTL A;  3VVZ A;  2A2F X;  2XB5 A;  4W1U A;  2Y2Z A;  3O8G A;  3VVY A;  3VPR A;  3NNR A;  4B3A A;  2OER A;  2R7X A;  2PZ9 A;  2QTQ A;  4DW6 A;  4I76 A;  3KZ9 A;  5EFY A;  3VTI A;  3FK6 A;  3HTH A;  3PAS A;  2IAI A;  3LSR A;  3GZI A;  4NN1 A;  4GFL A;  2UXH A;  2R7O A;  4M3F A;  2GFN A;  2IU5 A;  1JUP A;  2UXP A;  3VVX A;  3NPI A;  2GBY A;  2YVH A;  1ZKG A;  3TP0 A;  3CDL A;  3ON4 A;  3MVP A;  2XPW A;  3ANP A;  2O7T A;  2VKV A;  2Y31 A;  3VW2 A;  3LWJ A;  1JTX A;  5FMP A;  2X6O A;  3BR2 A;  4B1R A;  5CXG A;  2UXO A;  3BR6 A;  4AF5 A;  2VPR A;  2DTZ A;  2R7Q A;  4MO7 A;  4V2F A;  3IUV A;  5EYR A;  3COL A;  3PPB A;  3QPL A;  3VIB A;  2TRT A;  2ZCN A;  3ZQF A;  3SFI A;  3KNW A;  2NX4 A;  4L62 A;  3BT9 A;  5FKK A;  3BR0 A;  2FX0 A;  2IBD A;  5DAJ A;  2D6Y A;  3VUQ A;  5IOY A;  3SDG A;  3KYL A;  3LOC A;  4OD5 A;  1BJZ A;  2I10 A;  3KKC A;  5IOZ A;  5HAW A;  4XK4 A;  4W97 A;  3VW0 A;  3CRJ A;  4M3E A;  3BQY A;  3DEW A;  3O60 A;  4ABZ A;  2OF7 A;  3C2B A;  3B6C A;  3PM1 A;  1UI6 A;  5FKM A;  3NS4 A;  3HTI A;  4C2M A;  5J3L A;  4V2G A;  3Q0U A;  4GCK A;  4HKU A;  3HTJ A;  4MK6 A;  4I6Z A;  4M3G A;  3O8H A;  4ACI A;  2UXI A;  2WV1 A;  2QCO A;  3T6N A;  2NP5 A;  2R7V A;  3MNL A;  3BJB A;  3BTJ A;  3Q0V A;  2DG7 A;  3HTA A;  5FKO A;  3QQA A;  1QVU A;  2Q24 A;  3FRQ A;  3CCY A;  4D5F A;  2XPV A;  5F0H A;  4GFK A;  1SGM A;  2G3B A;  2ZOZ A;  2ZCX A;  5H9T A;  2G7S A;  3DU6 A;  1JT0 A;  5FKN A;  5F0C A;  3BQZ A;  1RPW A;  5K7Z A;  2R7S A;  3V78 A;  2G0E A;  2HXI A;  2NP3 A;  2XGD A;  3VOX A;  2FD5 A;  4AUX A;  2GEN A;  2W53 A;  3DPJ A;  2ZOY A;  3Q3S A;  3BR1 A;  2FQ4 A;  3BRU A;  5HSZ A;  3Q0W A;  5FKL A;  3QPS A;  4JL3 A;  5AQC A;  3FIW A;  2DG8 A;  5HBU A;  2JK3 A;  3B6A A;  5GP9 A;  2QIB A;  3V6G A;  5GPA A;  5D1R A;  4CGR A;  2XPU A;  4M3B A;  2B1E A;  3BCG A;  4JKZ A;  2GUH A;  2XGC A;  3KKD A;  5J1U A;  2IEK A;  1ORK A;  4ME9 A;  3FHN A;  2ZB9 A;  2ZY9 A;  3IH2 A;  1U9O A;  3HGG A;  2HXO A;  2QOP A;  3DCF A;  3ZQL A;  3ZQI A;  4ICH A;  4DVY P;  4AC0 A;  2PFV A;  2FJI 1;  5FGL A;  3ANG A;  3HGY A;  3G56 A;  1T33 A;  4GCT A;  3E7Q A;  2OI8 A;  3AQT A;  1Z77 A;  4D5C A;  1A6I A;  3VOK A;  2V57 A;  3JSJ A;  3ON2 A;  3SWH A;  3BR5 A;  2ZCM A;  3B81 A;  3WHC A;  5F27 A;  2G7G A;  4D7N A;  3NXC A;  3CJD A;  4WIB A;  2R7W A;  2XDN A;  2Y30 A;  3C07 A;  2NS7 A;  2HQ5 A;  1Z0X A;  3LSP A;  2REK A;  3HIM A;  5IP6 A;  2YVE A;  2RAS A;  1RKW A;  4UDS A;  2TCT A;  5J1Y A;  1JT6 A;  3G1M A;  2XRL A;  5FHP A;  3BNI A;  1JUS A; 
#chains in the Genus database with same CATH homology
 1ZK8 A;  3BTC A;  4G12 A;  3F1B A;  3G7R A;  4YZE A;  4MXM A;  5F0F A;  1VI0 A;  1QVT A;  3HE0 A;  3G1L A;  3G1O A;  4NEL A;  2HYT A;  2VKE A;  3BTI A;  3ZQG A;  2PBX A;  4PXI A;  3FK7 A;  3LHQ A;  2XGE A;  2O7O A;  2HKU A;  3GEU A;  4JNN A;  3NI7 A;  1T56 A;  2QWT A;  5F1J A;  1JUM A;  2UXU A;  5GPC A;  2WGB A;  2ID3 A;  4X1E A;  5IPA A;  2WUI A;  2NS8 A;  5D19 A;  3BR3 A;  2F07 A;  3RD3 A;  5EZH A;  3S5R A;  2HYJ A;  3EUP A;  5K58 A;  3RH2 A;  1UI5 A;  3BHQ A;  4D7M A;  4JYK A;  3QKX A;  3ZQH A;  2JJ7 A;  3WHB A;  3IH3 A;  3LSJ A;  3TP3 A;  3LJL A;  5D18 A;  3IH4 A;  2X9D A;  4AC6 A;  3VW1 A;  3P9T A;  3AQS A;  4M3D A;  5CW8 A;  2EH3 A;  2FJ1 A;  2ID6 A;  3VP5 A;  4KWA A;  1QPI A;  1U9N A;  5F08 A;  5K7H A;  1JTY A;  2RHA A;  5EZG A;  3QBM A;  3CWR A;  5CXI A;  3EGQ A;  4GCL A;  5J1R A;  2G7L A;  3NRG A;  2FBQ A;  5C4Y A;  1RKT A;  2RAE A;  3F0C A;  5F04 A;  2OPT A;  2QKO A;  5K7F A;  3BTL A;  3VVZ A;  2XB5 A;  4W1U A;  2Y2Z A;  3O8G A;  3VVY A;  3VPR A;  3NNR A;  4B3A A;  2OER A;  2PZ9 A;  2QTQ A;  4DW6 A;  4I76 A;  3KZ9 A;  5EFY A;  3FK6 A;  3HTH A;  3PAS A;  2IAI A;  3LSR A;  3GZI A;  4NN1 A;  4GFL A;  2UXH A;  4M3F A;  2GFN A;  2IU5 A;  1JUP A;  2UXP A;  3VVX A;  3NPI A;  2GBY A;  2YVH A;  1ZKG A;  3TP0 A;  3CDL A;  3ON4 A;  3MVP A;  2XPW A;  3ANP A;  2O7T A;  2VKV A;  2Y31 A;  3VW2 A;  3LWJ A;  1JTX A;  5FMP A;  2X6O A;  3BR2 A;  4B1R A;  5CXG A;  2UXO A;  3BR6 A;  4AF5 A;  2VPR A;  2DTZ A;  4MO7 A;  4V2F A;  3IUV A;  5EYR A;  3COL A;  3PPB A;  3QPL A;  3VIB A;  2TRT A;  2ZCN A;  3ZQF A;  3SFI A;  3KNW A;  2NX4 A;  4L62 A;  3BT9 A;  5FKK A;  3BR0 A;  2FX0 A;  2IBD A;  5DAJ A;  2D6Y A;  3VUQ A;  5IOY A;  3SDG A;  3LOC A;  1BJZ A;  2I10 A;  3KKC A;  5IOZ A;  5HAW A;  4XK4 A;  4W97 A;  3VW0 A;  3CRJ A;  4M3E A;  3BQY A;  3DEW A;  3O60 A;  4ABZ A;  2OF7 A;  3C2B A;  3B6C A;  3PM1 A;  1UI6 A;  5FKM A;  3HTI A;  5J3L A;  4V2G A;  3Q0U A;  4GCK A;  4HKU A;  3HTJ A;  4MK6 A;  4I6Z A;  4M3G A;  3O8H A;  4ACI A;  2UXI A;  2WV1 A;  2QCO A;  3T6N A;  2NP5 A;  3MNL A;  3BJB A;  3BTJ A;  3Q0V A;  2DG7 A;  3HTA A;  5FKO A;  3QQA A;  1QVU A;  2Q24 A;  3FRQ A;  3CCY A;  4D5F A;  2XPV A;  5F0H A;  4GFK A;  1SGM A;  2G3B A;  2ZOZ A;  2ZCX A;  5H9T A;  2G7S A;  1JT0 A;  5FKN A;  5F0C A;  3BQZ A;  1RPW A;  5K7Z A;  3V78 A;  2G0E A;  2HXI A;  2NP3 A;  2XGD A;  3VOX A;  2FD5 A;  4AUX A;  2GEN A;  2W53 A;  3DPJ A;  2ZOY A;  3Q3S A;  3BR1 A;  2FQ4 A;  3BRU A;  5HSZ A;  3Q0W A;  5FKL A;  3QPS A;  4JL3 A;  5AQC A;  3FIW A;  2DG8 A;  5HBU A;  2JK3 A;  3B6A A;  5GP9 A;  2QIB A;  3V6G A;  5GPA A;  5D1R A;  4CGR A;  2XPU A;  4M3B A;  3BCG A;  4JKZ A;  2GUH A;  2XGC A;  3KKD A;  5J1U A;  2IEK A;  1ORK A;  4ME9 A;  2ZB9 A;  3IH2 A;  1U9O A;  3HGG A;  2HXO A;  2QOP A;  3DCF A;  3ZQL A;  3ZQI A;  4ICH A;  4AC0 A;  5FGL A;  3ANG A;  3HGY A;  3G56 A;  1T33 A;  4GCT A;  3E7Q A;  2OI8 A;  3AQT A;  1Z77 A;  4D5C A;  1A6I A;  3VOK A;  2V57 A;  3JSJ A;  3ON2 A;  3BR5 A;  2ZCM A;  3B81 A;  3WHC A;  5F27 A;  2G7G A;  4D7N A;  3NXC A;  3CJD A;  2XDN A;  2Y30 A;  3C07 A;  2NS7 A;  2HQ5 A;  1Z0X A;  3LSP A;  2REK A;  3HIM A;  5IP6 A;  2YVE A;  2RAS A;  1RKW A;  4UDS A;  2TCT A;  5J1Y A;  1JT6 A;  3G1M A;  2XRL A;  5FHP A;  3BNI A;  1JUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...