3DPJA

The crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
194
structure length
194
Chain Sequence
SNAMVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQMLADWQGTGDSPRARIASFIDLMIMNRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEAGCTTEAPALAMHLLARSQGAATLAQSFHDEGFLRSEVADMHRWLDNTLPMTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a TetR transcription regulator from Silicibacter pomeroyi DSS
rcsb
source organism Silicibacter pomeroyi
molecule tags Dna binding protein
molecule keywords Transcription regulator, TetR family
total genus 69
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dpjA00
2UXHA 5EYRA 3ZQHA 2XGCA 1SGMA 4D5FA 1VI0A 3CRJA 3KZ9A 3CWRA 5GPCA 1UI6A 3DEWA 4V2GA 3LOCA 3HTIA 2JK3A 2UXOA 3O8HA 2ZCXA 2QKOA 3AQSA 1QPIA 1JTYA 3O60A 4M3BA 3TP3A 2ZCNA 4G12A 1T33A 3CDLA 2FD5A 5EZGA 2FBQA 4D7MA 5J1RA 3LWJA 4GFKA 4PXIA 3IUVA 2TRTA 2HKUA 2QWTA 3V78A 4CGRA 5FGLA 3HIMA 3C07A 3QBMA 5HBUA 2DG8A 3NI7A 4I76A 4M3FA 3EGQA 4W97A 5F1JA 2PBXA 2XPUA 2TCTA 3ZQLA 3QQAA 3ON2A 2VKEA 3BR1A 2ZB9A 5GPAA 2HXOA 3E7QA 2RASA 3BR5A 3QPSA 2RHAA 2IAIA 3ANPA 3PM1A 5HAWA 3GZIA 2HYTA 1RKTA 1BJZA 4V2FA 5F0HA 1JUPA 3Q0WA 5IOZA 2FJ1A 2O7TA 4ABZA 3COLA 2QTQA 2XDNA 1JUMA 2XB5A 3BTLA 3VOXA 2OERA 3MNLA 1ORKA 3BR0A 5EFYA 2HXIA 2NP3A 5J3LA 4M3GA 2DTZA 3IH3A 3VPRA 1QVUA 3Q0VA 4AC0A 3VUQA 3SDGA 4GFLA 1RKWA 2XGDA 3VVYA 4AC6A 3VW0A 4ME9A 5K58A 4KWAA 3VP5A 2Q24A 3BTJA 2FQ4A 3CJDA 1T56A 2NP5A 5FKMA 2WGBA 2I10A 5D18A 2F07A 4DW6A 3Q3SA 3FK6A 3QKXA 3BRUA 4XK4A 3HGGA 3NXCA 3VOKA 5EZHA 4D7NA 2IBDA 5CW8A 3VVZA 3G7RA 3BTCA 3FIWA 5F27A 5K7HA 4I6ZA 4JL3A 5CXIA 3WHCA 3DCFA 3AQTA 5FKLA 5IPAA 2ZCMA 3ZQIA 2DG7A 3T6NA 3LSJA 3BR3A 5C4YA 1U9OA 5IOYA 3LJLA 5H9TA 2NX4A 2XPVA 2VKVA 4AF5A 5K7ZA 2HQ5A 1ZKGA 3ANGA 2G3BA 5D19A 5DAJA 5F08A 4AUXA 3RH2A 2OPTA 3NNRA 2G7LA 2QCOA 1A6IA 5FKKA 3KKDA 3BJBA 3F1BA 2ID6A 3CCYA 3IH2A 2PZ9A 3EUPA 3ZQGA 5FKNA 4YZEA 2D6YA 5F0FA 1RPWA 5FMPA 2XRLA 3B6CA 2G0EA 3B81A 2O7OA 3VW2A 2GUHA 1Z0XA 3LSRA 2GFNA 1JTXA 3MVPA 3F0CA 2VPRA 3QPLA 3HTHA 4GCTA 1QVTA 2Y30A 3S5RA 4MO7A 3IH4A 5D1RA 2IU5A 4W1UA 2EH3A 4ICHA 4JNNA 3NRGA 2V57A 2NS8A 4MXMA 4M3DA 5J1UA 4JKZA 2UXIA 3HTAA 5CXGA 2X9DA 4UDSA 3B6AA 3PPBA 3KNWA 2Y31A 2RAEA 3HGYA 2XPWA 2UXUA 3BR2A 2JJ7A 3G56A 3BTIA 2HYJA 3ZQFA 4NELA 2NS7A 1JT6A 3HTJA 4B1RA 3BQZA 3C2BA 3VW1A 3BR6A 3HE0A 5IP6A 2FX0A 3Q0UA 2ID3A 3RD3A 1JUSA 4GCKA 2QIBA 2YVEA 3LHQA 1ZK8A 3FK7A 3G1OA 2G7GA 2OF7A 2IEKA 3VIBA 2GENA 3TP0A 2Y2ZA 3GEUA 2QOPA 5F0CA 2XGEA 3FRQA 1Z77A 4M3EA 2WV1A 5GP9A 3WHBA 3BNIA 2REKA 2UXPA 4L62A 1JT0A 4NN1A 2GBYA 5K7FA 2ZOZA 3BHQA 3BQYA 3BCGA 3PASA 2X6OA 4GCLA 5HSZA 3ON4A 4JYKA 2YVHA 3NPIA 4ACIA 5AQCA 5F04A 4X1EA 2WUIA 4HKUA 2OI8A 3P9TA 3G1MA 2G7SA 4D5CA 3LSPA 3VVXA 3DPJA 5FKOA 3KKCA 3SFIA 3O8GA 3V6GA 4B3AA 5FHPA 2W53A 1U9NA 4MK6A 1UI5A 3BT9A 3G1LA 2ZOYA 5J1YA 3JSJA
chains in the Genus database with same CATH superfamily
2UXHA 5EYRA 3ZQHA 2XGCA 1SGMA 2R7SA 4D5FA 1VI0A 3CRJA 2R7OA 3KZ9A 3CWRA 5GPCA 1UI6A 3DEWA 4V2GA 3SWHA 3LOCA 3HTIA 2R7TA 2JK3A 2UXOA 3O8HA 2ZCXA 2QKOA 3DU6A 3AQSA 4WIBA 1QPIA 1JTYA 3O60A 4M3BA 3TP3A 2ZCNA 4G12A 1T33A 3CDLA 2FD5A 5EZGA 2FBQA 4D7MA 5J1RA 3LWJA 4GFKA 4PXIA 3IUVA 2TRTA 3NS4A 2HKUA 2QWTA 3V78A 4CGRA 3DU5A 5FGLA 3HIMA 3C07A 3QBMA 5HBUA 2DG8A 2PFVA 3NI7A 4I76A 4M3FA 3EGQA 4OD5A 4W97A 5F1JA 2PBXA 2XPUA 2TCTA 3ZQLA 3QQAA 3ON2A 2VKEA 3BR1A 3VTIA 2ZB9A 5GPAA 2HXOA 3E7QA 2RASA 3BR5A 3QPSA 2RHAA 2IAIA 3ANPA 3PM1A 2B3WA 5HAWA 3GZIA 2HYTA 1RKTA 1BJZA 4V2FA 5F0HA 1JUPA 3Q0WA 5IOZA 2FJ1A 2O7TA 4ABZA 3COLA 2QTQA 2XDNA 1JUMA 2XB5A 3BTLA 3VOXA 2OERA 3K8PC 3MNLA 1ORKA 3BR0A 5EFYA 2HXIA 2R7WA 2NP3A 5J3LA 4M3GA 2DTZA 3IH3A 4U9LA 3VPRA 1QVUA 3Q0VA 4AC0A 3VUQA 3SDGA 4GFLA 1RKWA 2XGDA 3VVYA 4AC6A 3VW0A 4ME9A 5K58A 4KWAA 3VP5A 2Q24A 3KYLA 3BTJA 2FQ4A 3CJDA 1T56A 2NP5A 5FKMA 5CQGA 2WGBA 2I10A 5D18A 2F07A 4DW6A 3Q3SA 3FK6A 3QKXA 3BRUA 4XK4A 3HGGA 3NXCA 3VOKA 5EZHA 4D7NA 2IBDA 4IRVA 5CW8A 3VVZA 3G7RA 3BTCA 3FIWA 5F27A 5K7HA 4I6ZA 4JL3A 5CXIA 3WHCA 3DCFA 3AQTA 5FKLA 5IPAA 2ZCMA 3ZQIA 2DG7A 3T6NA 3LSJA 3BR3A 5C4YA 1U9OA 5IOYA 3LJLA 5H9TA 2R7XA 2NX4A 2XPVA 2VKVA 4AF5A 5K7ZA 2HQ5A 3FHNA 1ZKGA 3ANGA 2A2FX 2G3BA 5D19A 5DAJA 4C2MA 5F08A 4AUXA 3RH2A 2OPTA 3NNRA 2G7LA 2QCOA 1A6IA 5FKKA 3KKDA 3BJBA 3F1BA 2ID6A 3CCYA 3IH2A 2PZ9A 3EUPA 3ZQGA 5FKNA 4YZEA 2D6YA 5F0FA 1RPWA 5FMPA 2XRLA 3B6CA 2G0EA 3B81A 2O7OA 3VW2A 2R7UA 2GUHA 1Z0XA 3LSRA 2GFNA 4DVYP 1JTXA 3MVPA 3F0CA 2B1EA 2VPRA 3QPLA 3HTHA 4GCTA 1QVTA 2Y30A 3S5RA 4MO7A 3IH4A 5D1RA 2IU5A 4W1UA 2EH3A 4ICHA 4JNNA 2R7VA 3NRGA 2V57A 2NS8A 4MXMA 4M3DA 5J1UA 4JKZA 2UXIA 3HTAA 5CXGA 2X9DA 4UDSA 3B6AA 3PPBA 3KNWA 2Y31A 2RAEA 3HGYA 2XPWA 2UXUA 3BR2A 2JJ7A 3G56A 3BTIA 2HYJA 3ZQFA 4NELA 2NS7A 1JT6A 3HTJA 4B1RA 3BQZA 3C2BA 3VW1A 3BR6A 3HE0A 5IP6A 2FX0A 3Q0UA 2R7RA 2ID3A 3RD3A 1JUSA 4GCKA 2QIBA 2YVEA 3LHQA 1ZK8A 2YVXA 3FK7A 3G1OA 2G7GA 2OF7A 2IEKA 3VIBA 2GENA 3TP0A 2Y2ZA 3GEUA 2FJI1 2QOPA 5F0CA 2XGEA 3FRQA 1Z77A 4M3EA 2WV1A 5GP9A 3WHBA 3BNIA 2REKA 2UXPA 4L62A 1JT0A 4NN1A 2GBYA 5K7FA 2ZOZA 3BHQA 3BQYA 3BCGA 3PASA 2X6OA 4GCLA 5HSZA 3ON4A 4JYKA 4U9NA 2YVHA 4OD4A 3NPIA 4ACIA 5AQCA 5F04A 4X1EA 2WUIA 4HKUA 2OI8A 2R7QA 3P9TA 3G1MA 2G7SA 4D5CA 3LSPA 3VVXA 3DPJA 5FKOA 3KKCA 3SFIA 3O8GA 3V6GA 4B3AA 5FHPA 2W53A 1U9NA 4MK6A 1UI5A 2ZY9A 3BT9A 3G1LA 2ZOYA 5J1YA 3JSJA
chains in the Genus database with same CATH topology
2UXHA 5EYRA 3ZQHA 2XGCA 1SGMA 4D5FA 1VI0A 3CRJA 3KZ9A 3CWRA 5GPCA 1UI6A 3DEWA 4V2GA 3LOCA 3HTIA 2JK3A 2UXOA 3O8HA 2ZCXA 2QKOA 3AQSA 1QPIA 1JTYA 3O60A 4M3BA 3TP3A 2ZCNA 4G12A 1T33A 3CDLA 2FD5A 5EZGA 2FBQA 4D7MA 5J1RA 3LWJA 4GFKA 4PXIA 3IUVA 2TRTA 2HKUA 2QWTA 3V78A 4CGRA 5FGLA 3HIMA 3C07A 3QBMA 5HBUA 2DG8A 3NI7A 4I76A 4M3FA 3EGQA 4W97A 5F1JA 2PBXA 2XPUA 2TCTA 3ZQLA 3QQAA 3ON2A 2VKEA 3BR1A 2ZB9A 5GPAA 2HXOA 3E7QA 2RASA 3BR5A 3QPSA 2RHAA 2IAIA 3ANPA 3PM1A 5HAWA 3GZIA 2HYTA 1RKTA 1BJZA 4V2FA 5F0HA 1JUPA 3Q0WA 5IOZA 2FJ1A 2O7TA 4ABZA 3COLA 2QTQA 2XDNA 1JUMA 2XB5A 3BTLA 3VOXA 2OERA 3MNLA 1ORKA 3BR0A 5EFYA 2HXIA 2NP3A 5J3LA 4M3GA 2DTZA 3IH3A 3VPRA 1QVUA 3Q0VA 4AC0A 3VUQA 3SDGA 4GFLA 1RKWA 2XGDA 3VVYA 4AC6A 3VW0A 4ME9A 5K58A 4KWAA 3VP5A 2Q24A 3BTJA 2FQ4A 3CJDA 1T56A 2NP5A 5FKMA 2WGBA 2I10A 5D18A 2F07A 4DW6A 3Q3SA 3FK6A 3QKXA 3BRUA 4XK4A 3HGGA 3NXCA 3VOKA 5EZHA 4D7NA 2IBDA 5CW8A 3VVZA 3G7RA 3BTCA 3FIWA 5F27A 5K7HA 4I6ZA 4JL3A 5CXIA 3WHCA 3DCFA 3AQTA 5FKLA 5IPAA 2ZCMA 3ZQIA 2DG7A 3T6NA 3LSJA 3BR3A 5C4YA 1U9OA 5IOYA 3LJLA 5H9TA 2NX4A 2XPVA 2VKVA 4AF5A 5K7ZA 2HQ5A 1ZKGA 3ANGA 2G3BA 5D19A 5DAJA 5F08A 4AUXA 3RH2A 2OPTA 3NNRA 2G7LA 2QCOA 1A6IA 5FKKA 3KKDA 3BJBA 3F1BA 2ID6A 3CCYA 3IH2A 2PZ9A 3EUPA 3ZQGA 5FKNA 4YZEA 2D6YA 5F0FA 1RPWA 5FMPA 2XRLA 3B6CA 2G0EA 3B81A 2O7OA 3VW2A 2GUHA 1Z0XA 3LSRA 2GFNA 1JTXA 3MVPA 3F0CA 2VPRA 3QPLA 3HTHA 4GCTA 1QVTA 2Y30A 3S5RA 4MO7A 3IH4A 5D1RA 2IU5A 4W1UA 2EH3A 4ICHA 4JNNA 3NRGA 2V57A 2NS8A 4MXMA 4M3DA 5J1UA 4JKZA 2UXIA 3HTAA 5CXGA 2X9DA 4UDSA 3B6AA 3PPBA 3KNWA 2Y31A 2RAEA 3HGYA 2XPWA 2UXUA 3BR2A 2JJ7A 3G56A 3BTIA 2HYJA 3ZQFA 4NELA 2NS7A 1JT6A 3HTJA 4B1RA 3BQZA 3C2BA 3VW1A 3BR6A 3HE0A 5IP6A 2FX0A 3Q0UA 2ID3A 3RD3A 1JUSA 4GCKA 2QIBA 2YVEA 3LHQA 1ZK8A 3FK7A 3G1OA 2G7GA 2OF7A 2IEKA 3VIBA 2GENA 3TP0A 2Y2ZA 3GEUA 2QOPA 5F0CA 2XGEA 3FRQA 1Z77A 4M3EA 2WV1A 5GP9A 3WHBA 3BNIA 2REKA 2UXPA 4L62A 1JT0A 4NN1A 2GBYA 5K7FA 2ZOZA 3BHQA 3BQYA 3BCGA 3PASA 2X6OA 4GCLA 5HSZA 3ON4A 4JYKA 2YVHA 3NPIA 4ACIA 5AQCA 5F04A 4X1EA 2WUIA 4HKUA 2OI8A 3P9TA 3G1MA 2G7SA 4D5CA 3LSPA 3VVXA 3DPJA 5FKOA 3KKCA 3SFIA 3O8GA 3V6GA 4B3AA 5FHPA 2W53A 1U9NA 4MK6A 1UI5A 3BT9A 3G1LA 2ZOYA 5J1YA 3JSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXH A;  5EYR A;  3ZQH A;  2XGC A;  1SGM A;  4D5F A;  1VI0 A;  3CRJ A;  3KZ9 A;  3CWR A;  5GPC A;  1UI6 A;  3DEW A;  4V2G A;  3LOC A;  3HTI A;  2JK3 A;  2UXO A;  3O8H A;  2ZCX A;  2QKO A;  3AQS A;  1QPI A;  1JTY A;  3O60 A;  4M3B A;  3TP3 A;  2ZCN A;  4G12 A;  1T33 A;  3CDL A;  2FD5 A;  5EZG A;  2FBQ A;  4D7M A;  5J1R A;  3LWJ A;  4GFK A;  4PXI A;  3IUV A;  2TRT A;  2HKU A;  2QWT A;  3V78 A;  4CGR A;  5FGL A;  3HIM A;  3C07 A;  3QBM A;  5HBU A;  2DG8 A;  3NI7 A;  4I76 A;  4M3F A;  3EGQ A;  4W97 A;  5F1J A;  2PBX A;  2XPU A;  2TCT A;  3ZQL A;  3QQA A;  3ON2 A;  2VKE A;  3BR1 A;  2ZB9 A;  5GPA A;  2HXO A;  3E7Q A;  2RAS A;  3BR5 A;  3QPS A;  2RHA A;  2IAI A;  3ANP A;  3PM1 A;  5HAW A;  3GZI A;  2HYT A;  1RKT A;  1BJZ A;  4V2F A;  5F0H A;  1JUP A;  3Q0W A;  5IOZ A;  2FJ1 A;  2O7T A;  4ABZ A;  3COL A;  2QTQ A;  2XDN A;  1JUM A;  2XB5 A;  3BTL A;  3VOX A;  2OER A;  3MNL A;  1ORK A;  3BR0 A;  5EFY A;  2HXI A;  2NP3 A;  5J3L A;  4M3G A;  2DTZ A;  3IH3 A;  3VPR A;  1QVU A;  3Q0V A;  4AC0 A;  3VUQ A;  3SDG A;  4GFL A;  1RKW A;  2XGD A;  3VVY A;  4AC6 A;  3VW0 A;  4ME9 A;  5K58 A;  4KWA A;  3VP5 A;  2Q24 A;  3BTJ A;  2FQ4 A;  3CJD A;  1T56 A;  2NP5 A;  5FKM A;  2WGB A;  2I10 A;  5D18 A;  2F07 A;  4DW6 A;  3Q3S A;  3FK6 A;  3QKX A;  3BRU A;  4XK4 A;  3HGG A;  3NXC A;  3VOK A;  5EZH A;  4D7N A;  2IBD A;  5CW8 A;  3VVZ A;  3G7R A;  3BTC A;  3FIW A;  5F27 A;  5K7H A;  4I6Z A;  4JL3 A;  5CXI A;  3WHC A;  3DCF A;  3AQT A;  5FKL A;  5IPA A;  2ZCM A;  3ZQI A;  2DG7 A;  3T6N A;  3LSJ A;  3BR3 A;  5C4Y A;  1U9O A;  5IOY A;  3LJL A;  5H9T A;  2NX4 A;  2XPV A;  2VKV A;  4AF5 A;  5K7Z A;  2HQ5 A;  1ZKG A;  3ANG A;  2G3B A;  5D19 A;  5DAJ A;  5F08 A;  4AUX A;  3RH2 A;  2OPT A;  3NNR A;  2G7L A;  2QCO A;  1A6I A;  5FKK A;  3KKD A;  3BJB A;  3F1B A;  2ID6 A;  3CCY A;  3IH2 A;  2PZ9 A;  3EUP A;  3ZQG A;  5FKN A;  4YZE A;  2D6Y A;  5F0F A;  1RPW A;  5FMP A;  2XRL A;  3B6C A;  2G0E A;  3B81 A;  2O7O A;  3VW2 A;  2GUH A;  1Z0X A;  3LSR A;  2GFN A;  1JTX A;  3MVP A;  3F0C A;  2VPR A;  3QPL A;  3HTH A;  4GCT A;  1QVT A;  2Y30 A;  3S5R A;  4MO7 A;  3IH4 A;  5D1R A;  2IU5 A;  4W1U A;  2EH3 A;  4ICH A;  4JNN A;  3NRG A;  2V57 A;  2NS8 A;  4MXM A;  4M3D A;  5J1U A;  4JKZ A;  2UXI A;  3HTA A;  5CXG A;  2X9D A;  4UDS A;  3B6A A;  3PPB A;  3KNW A;  2Y31 A;  2RAE A;  3HGY A;  2XPW A;  2UXU A;  3BR2 A;  2JJ7 A;  3G56 A;  3BTI A;  2HYJ A;  3ZQF A;  4NEL A;  2NS7 A;  1JT6 A;  3HTJ A;  4B1R A;  3BQZ A;  3C2B A;  3VW1 A;  3BR6 A;  3HE0 A;  5IP6 A;  2FX0 A;  3Q0U A;  2ID3 A;  3RD3 A;  1JUS A;  4GCK A;  2QIB A;  2YVE A;  3LHQ A;  1ZK8 A;  3FK7 A;  3G1O A;  2G7G A;  2OF7 A;  2IEK A;  3VIB A;  2GEN A;  3TP0 A;  2Y2Z A;  3GEU A;  2QOP A;  5F0C A;  2XGE A;  3FRQ A;  1Z77 A;  4M3E A;  2WV1 A;  5GP9 A;  3WHB A;  3BNI A;  2REK A;  2UXP A;  4L62 A;  1JT0 A;  4NN1 A;  2GBY A;  5K7F A;  2ZOZ A;  3BHQ A;  3BQY A;  3BCG A;  3PAS A;  2X6O A;  4GCL A;  5HSZ A;  3ON4 A;  4JYK A;  2YVH A;  3NPI A;  4ACI A;  5AQC A;  5F04 A;  4X1E A;  2WUI A;  4HKU A;  2OI8 A;  3P9T A;  3G1M A;  2G7S A;  4D5C A;  3LSP A;  3VVX A;  3DPJ A;  5FKO A;  3KKC A;  3SFI A;  3O8G A;  3V6G A;  4B3A A;  5FHP A;  2W53 A;  1U9N A;  4MK6 A;  1UI5 A;  3BT9 A;  3G1L A;  2ZOY A;  5J1Y A;  3JSJ A; 
#chains in the Genus database with same CATH topology
 2UXH A;  5EYR A;  3ZQH A;  2XGC A;  1SGM A;  2R7S A;  4D5F A;  1VI0 A;  3CRJ A;  2R7O A;  3KZ9 A;  3CWR A;  5GPC A;  1UI6 A;  3DEW A;  4V2G A;  3SWH A;  3LOC A;  3HTI A;  2R7T A;  2JK3 A;  2UXO A;  3O8H A;  2ZCX A;  2QKO A;  3DU6 A;  3AQS A;  4WIB A;  1QPI A;  1JTY A;  3O60 A;  4M3B A;  3TP3 A;  2ZCN A;  4G12 A;  1T33 A;  3CDL A;  2FD5 A;  5EZG A;  2FBQ A;  4D7M A;  5J1R A;  3LWJ A;  4GFK A;  4PXI A;  3IUV A;  2TRT A;  3NS4 A;  2HKU A;  2QWT A;  3V78 A;  4CGR A;  3DU5 A;  5FGL A;  3HIM A;  3C07 A;  3QBM A;  5HBU A;  2DG8 A;  2PFV A;  3NI7 A;  4I76 A;  4M3F A;  3EGQ A;  4OD5 A;  4W97 A;  5F1J A;  2PBX A;  2XPU A;  2TCT A;  3ZQL A;  3QQA A;  3ON2 A;  2VKE A;  3BR1 A;  3VTI A;  2ZB9 A;  5GPA A;  2HXO A;  3E7Q A;  2RAS A;  3BR5 A;  3QPS A;  2RHA A;  2IAI A;  3ANP A;  3PM1 A;  2B3W A;  5HAW A;  3GZI A;  2HYT A;  1RKT A;  1BJZ A;  4V2F A;  5F0H A;  1JUP A;  3Q0W A;  5IOZ A;  2FJ1 A;  2O7T A;  4ABZ A;  3COL A;  2QTQ A;  2XDN A;  1JUM A;  2XB5 A;  3BTL A;  3VOX A;  2OER A;  3K8P C;  3MNL A;  1ORK A;  3BR0 A;  5EFY A;  2HXI A;  2R7W A;  2NP3 A;  5J3L A;  4M3G A;  2DTZ A;  3IH3 A;  4U9L A;  3VPR A;  1QVU A;  3Q0V A;  4AC0 A;  3VUQ A;  3SDG A;  4GFL A;  1RKW A;  2XGD A;  3VVY A;  4AC6 A;  3VW0 A;  4ME9 A;  5K58 A;  4KWA A;  3VP5 A;  2Q24 A;  3KYL A;  3BTJ A;  2FQ4 A;  3CJD A;  1T56 A;  2NP5 A;  5FKM A;  5CQG A;  2WGB A;  2I10 A;  5D18 A;  2F07 A;  4DW6 A;  3Q3S A;  3FK6 A;  3QKX A;  3BRU A;  4XK4 A;  3HGG A;  3NXC A;  3VOK A;  5EZH A;  4D7N A;  2IBD A;  4IRV A;  5CW8 A;  3VVZ A;  3G7R A;  3BTC A;  3FIW A;  5F27 A;  5K7H A;  4I6Z A;  4JL3 A;  5CXI A;  3WHC A;  3DCF A;  3AQT A;  5FKL A;  5IPA A;  2ZCM A;  3ZQI A;  2DG7 A;  3T6N A;  3LSJ A;  3BR3 A;  5C4Y A;  1U9O A;  5IOY A;  3LJL A;  5H9T A;  2R7X A;  2NX4 A;  2XPV A;  2VKV A;  4AF5 A;  5K7Z A;  2HQ5 A;  3FHN A;  1ZKG A;  3ANG A;  2A2F X;  2G3B A;  5D19 A;  5DAJ A;  4C2M A;  5F08 A;  4AUX A;  3RH2 A;  2OPT A;  3NNR A;  2G7L A;  2QCO A;  1A6I A;  5FKK A;  3KKD A;  3BJB A;  3F1B A;  2ID6 A;  3CCY A;  3IH2 A;  2PZ9 A;  3EUP A;  3ZQG A;  5FKN A;  4YZE A;  2D6Y A;  5F0F A;  1RPW A;  5FMP A;  2XRL A;  3B6C A;  2G0E A;  3B81 A;  2O7O A;  3VW2 A;  2R7U A;  2GUH A;  1Z0X A;  3LSR A;  2GFN A;  4DVY P;  1JTX A;  3MVP A;  3F0C A;  2B1E A;  2VPR A;  3QPL A;  3HTH A;  4GCT A;  1QVT A;  2Y30 A;  3S5R A;  4MO7 A;  3IH4 A;  5D1R A;  2IU5 A;  4W1U A;  2EH3 A;  4ICH A;  4JNN A;  2R7V A;  3NRG A;  2V57 A;  2NS8 A;  4MXM A;  4M3D A;  5J1U A;  4JKZ A;  2UXI A;  3HTA A;  5CXG A;  2X9D A;  4UDS A;  3B6A A;  3PPB A;  3KNW A;  2Y31 A;  2RAE A;  3HGY A;  2XPW A;  2UXU A;  3BR2 A;  2JJ7 A;  3G56 A;  3BTI A;  2HYJ A;  3ZQF A;  4NEL A;  2NS7 A;  1JT6 A;  3HTJ A;  4B1R A;  3BQZ A;  3C2B A;  3VW1 A;  3BR6 A;  3HE0 A;  5IP6 A;  2FX0 A;  3Q0U A;  2R7R A;  2ID3 A;  3RD3 A;  1JUS A;  4GCK A;  2QIB A;  2YVE A;  3LHQ A;  1ZK8 A;  2YVX A;  3FK7 A;  3G1O A;  2G7G A;  2OF7 A;  2IEK A;  3VIB A;  2GEN A;  3TP0 A;  2Y2Z A;  3GEU A;  2FJI 1;  2QOP A;  5F0C A;  2XGE A;  3FRQ A;  1Z77 A;  4M3E A;  2WV1 A;  5GP9 A;  3WHB A;  3BNI A;  2REK A;  2UXP A;  4L62 A;  1JT0 A;  4NN1 A;  2GBY A;  5K7F A;  2ZOZ A;  3BHQ A;  3BQY A;  3BCG A;  3PAS A;  2X6O A;  4GCL A;  5HSZ A;  3ON4 A;  4JYK A;  4U9N A;  2YVH A;  4OD4 A;  3NPI A;  4ACI A;  5AQC A;  5F04 A;  4X1E A;  2WUI A;  4HKU A;  2OI8 A;  2R7Q A;  3P9T A;  3G1M A;  2G7S A;  4D5C A;  3LSP A;  3VVX A;  3DPJ A;  5FKO A;  3KKC A;  3SFI A;  3O8G A;  3V6G A;  4B3A A;  5FHP A;  2W53 A;  1U9N A;  4MK6 A;  1UI5 A;  2ZY9 A;  3BT9 A;  3G1L A;  2ZOY A;  5J1Y A;  3JSJ A; 
#chains in the Genus database with same CATH homology
 2UXH A;  5EYR A;  3ZQH A;  2XGC A;  1SGM A;  4D5F A;  1VI0 A;  3CRJ A;  3KZ9 A;  3CWR A;  5GPC A;  1UI6 A;  3DEW A;  4V2G A;  3LOC A;  3HTI A;  2JK3 A;  2UXO A;  3O8H A;  2ZCX A;  2QKO A;  3AQS A;  1QPI A;  1JTY A;  3O60 A;  4M3B A;  3TP3 A;  2ZCN A;  4G12 A;  1T33 A;  3CDL A;  2FD5 A;  5EZG A;  2FBQ A;  4D7M A;  5J1R A;  3LWJ A;  4GFK A;  4PXI A;  3IUV A;  2TRT A;  2HKU A;  2QWT A;  3V78 A;  4CGR A;  5FGL A;  3HIM A;  3C07 A;  3QBM A;  5HBU A;  2DG8 A;  3NI7 A;  4I76 A;  4M3F A;  3EGQ A;  4W97 A;  5F1J A;  2PBX A;  2XPU A;  2TCT A;  3ZQL A;  3QQA A;  3ON2 A;  2VKE A;  3BR1 A;  2ZB9 A;  5GPA A;  2HXO A;  3E7Q A;  2RAS A;  3BR5 A;  3QPS A;  2RHA A;  2IAI A;  3ANP A;  3PM1 A;  5HAW A;  3GZI A;  2HYT A;  1RKT A;  1BJZ A;  4V2F A;  5F0H A;  1JUP A;  3Q0W A;  5IOZ A;  2FJ1 A;  2O7T A;  4ABZ A;  3COL A;  2QTQ A;  2XDN A;  1JUM A;  2XB5 A;  3BTL A;  3VOX A;  2OER A;  3MNL A;  1ORK A;  3BR0 A;  5EFY A;  2HXI A;  2NP3 A;  5J3L A;  4M3G A;  2DTZ A;  3IH3 A;  3VPR A;  1QVU A;  3Q0V A;  4AC0 A;  3VUQ A;  3SDG A;  4GFL A;  1RKW A;  2XGD A;  3VVY A;  4AC6 A;  3VW0 A;  4ME9 A;  5K58 A;  4KWA A;  3VP5 A;  2Q24 A;  3BTJ A;  2FQ4 A;  3CJD A;  1T56 A;  2NP5 A;  5FKM A;  2WGB A;  2I10 A;  5D18 A;  2F07 A;  4DW6 A;  3Q3S A;  3FK6 A;  3QKX A;  3BRU A;  4XK4 A;  3HGG A;  3NXC A;  3VOK A;  5EZH A;  4D7N A;  2IBD A;  5CW8 A;  3VVZ A;  3G7R A;  3BTC A;  3FIW A;  5F27 A;  5K7H A;  4I6Z A;  4JL3 A;  5CXI A;  3WHC A;  3DCF A;  3AQT A;  5FKL A;  5IPA A;  2ZCM A;  3ZQI A;  2DG7 A;  3T6N A;  3LSJ A;  3BR3 A;  5C4Y A;  1U9O A;  5IOY A;  3LJL A;  5H9T A;  2NX4 A;  2XPV A;  2VKV A;  4AF5 A;  5K7Z A;  2HQ5 A;  1ZKG A;  3ANG A;  2G3B A;  5D19 A;  5DAJ A;  5F08 A;  4AUX A;  3RH2 A;  2OPT A;  3NNR A;  2G7L A;  2QCO A;  1A6I A;  5FKK A;  3KKD A;  3BJB A;  3F1B A;  2ID6 A;  3CCY A;  3IH2 A;  2PZ9 A;  3EUP A;  3ZQG A;  5FKN A;  4YZE A;  2D6Y A;  5F0F A;  1RPW A;  5FMP A;  2XRL A;  3B6C A;  2G0E A;  3B81 A;  2O7O A;  3VW2 A;  2GUH A;  1Z0X A;  3LSR A;  2GFN A;  1JTX A;  3MVP A;  3F0C A;  2VPR A;  3QPL A;  3HTH A;  4GCT A;  1QVT A;  2Y30 A;  3S5R A;  4MO7 A;  3IH4 A;  5D1R A;  2IU5 A;  4W1U A;  2EH3 A;  4ICH A;  4JNN A;  3NRG A;  2V57 A;  2NS8 A;  4MXM A;  4M3D A;  5J1U A;  4JKZ A;  2UXI A;  3HTA A;  5CXG A;  2X9D A;  4UDS A;  3B6A A;  3PPB A;  3KNW A;  2Y31 A;  2RAE A;  3HGY A;  2XPW A;  2UXU A;  3BR2 A;  2JJ7 A;  3G56 A;  3BTI A;  2HYJ A;  3ZQF A;  4NEL A;  2NS7 A;  1JT6 A;  3HTJ A;  4B1R A;  3BQZ A;  3C2B A;  3VW1 A;  3BR6 A;  3HE0 A;  5IP6 A;  2FX0 A;  3Q0U A;  2ID3 A;  3RD3 A;  1JUS A;  4GCK A;  2QIB A;  2YVE A;  3LHQ A;  1ZK8 A;  3FK7 A;  3G1O A;  2G7G A;  2OF7 A;  2IEK A;  3VIB A;  2GEN A;  3TP0 A;  2Y2Z A;  3GEU A;  2QOP A;  5F0C A;  2XGE A;  3FRQ A;  1Z77 A;  4M3E A;  2WV1 A;  5GP9 A;  3WHB A;  3BNI A;  2REK A;  2UXP A;  4L62 A;  1JT0 A;  4NN1 A;  2GBY A;  5K7F A;  2ZOZ A;  3BHQ A;  3BQY A;  3BCG A;  3PAS A;  2X6O A;  4GCL A;  5HSZ A;  3ON4 A;  4JYK A;  2YVH A;  3NPI A;  4ACI A;  5AQC A;  5F04 A;  4X1E A;  2WUI A;  4HKU A;  2OI8 A;  3P9T A;  3G1M A;  2G7S A;  4D5C A;  3LSP A;  3VVX A;  3DPJ A;  5FKO A;  3KKC A;  3SFI A;  3O8G A;  3V6G A;  4B3A A;  5FHP A;  2W53 A;  1U9N A;  4MK6 A;  1UI5 A;  3BT9 A;  3G1L A;  2ZOY A;  5J1Y A;  3JSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...