3DPJA

The crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
194
structure length
194
Chain Sequence
SNAMVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQMLADWQGTGDSPRARIASFIDLMIMNRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEAGCTTEAPALAMHLLARSQGAATLAQSFHDEGFLRSEVADMHRWLDNTLPMTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcription regulator, TetR family
publication title The crystal structure of a TetR transcription regulator from Silicibacter pomeroyi DSS
rcsb
source organism Silicibacter pomeroyi
total genus 69
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dpjA00
5K7FA 2XGCA 3CWRA 3HIMA 3C2BA 3NXCA 5FKLA 2DTZA 3VOXA 3BR3A 1JUPA 2XB5A 3ZQFA 2F07A 3BNIA 4AC0A 3CDLA 3PM1A 4GCLA 5F27A 2NS8A 2HXIA 2ZOYA 5HSZA 4KWAA 3VIBA 2FJ1A 4M3DA 2XGDA 3TP3A 3IH4A 2UXIA 2TCTA 3O60A 2IEKA 3BJBA 4JKZA 3FIWA 3BCGA 3B81A 5F1JA 2HYJA 2G7LA 1U9OA 5F0HA 5F04A 3CJDA 4JNNA 3VW1A 5IPAA 3G1MA 2DG8A 2G7SA 4CGRA 3ZQLA 4D5CA 2PZ9A 1Z77A 2XGEA 1ZK8A 3G1OA 5FHPA 3SDGA 2XPWA 2NS7A 2Y31A 2FD5A 2O7TA 2QWTA 3EGQA 3QBMA 3DCFA 3KKCA 4AC6A 4L62A 2FBQA 4M3FA 2UXUA 3PPBA 2YVEA 5EZGA 2W53A 4JL3A 5J1UA 1JTYA 2IU5A 3BR6A 3RD3A 2NX4A 1QPIA 4D7NA 2VPRA 2OI8A 3Q0WA 5F0FA 5C4YA 4MXMA 5AQCA 5FKKA 1UI5A 1T56A 4GCKA 3BT9A 3CCYA 3LJLA 3WHBA 2QIBA 4X1EA 1JUMA 2RAEA 4M3GA 2QOPA 1JUSA 2G7GA 5K7HA 4V2GA 5F08A 2RASA 3TP0A 3T6NA 3VVZA 3B6AA 2PBXA 4XK4A 3VOKA 2G0EA 3LSRA 4ME9A 1UI6A 3RH2A 3O8GA 2UXHA 3ANPA 1JT0A 2QKOA 2GFNA 3KZ9A 4W97A 3ZQIA 3LWJA 2Q24A 3VW0A 3QPLA 4HKUA 4JYKA 4V2FA 3MVPA 3VVXA 3QPSA 1BJZA 4ABZA 3BTCA 3DEWA 3ZQGA 3FRQA 3COLA 3NPIA 4G12A 1RPWA 1Z0XA 3HTAA 2O7OA 2ZCXA 5K7ZA 3G56A 3PASA 2XDNA 3FK6A 5GPCA 2UXOA 4I76A 3BR5A 5CW8A 4I6ZA 4M3BA 3IH3A 3Q0VA 2ZOZA 3BTLA 3BR2A 2X6OA 3Q3SA 1JT6A 3GZIA 5FKNA 4M3EA 3FK7A 4MK6A 5DAJA 3ON2A 3HTIA 4DW6A 5GP9A 5J1YA 3NRGA 4YZEA 2ID3A 2OPTA 4UDSA 2VKVA 2IAIA 3P9TA 2WGBA 2D6YA 3G1LA 5EYRA 3LOCA 3ON4A 5J1RA 5D18A 2ZB9A 5FKOA 2OF7A 2ZCMA 3LSPA 2GENA 4NN1A 3V78A 2I10A 1ZKGA 3HTHA 2WV1A 3LSJA 5H9TA 4D7MA 1JTXA 3BTJA 3BR1A 2YVHA 3AQSA 3VPRA 1U9NA 3NI7A 5D1RA 1RKTA 3F0CA 3WHCA 3DPJA 3GEUA 3QKXA 3LHQA 2REKA 3HGGA 2XRLA 5HBUA 3BRUA 5HAWA 2HKUA 2OERA 3ANGA 2ZCNA 1A6IA 3BQZA 2ID6A 3BTIA 3KNWA 5CXGA 2V57A 5K58A 2G3BA 3AQTA 3SFIA 2NP5A 2XPUA 4GFLA 5D19A 4GCTA 2Y2ZA 1VI0A 2GUHA 2TRTA 3BHQA 3IUVA 3O8HA 4AF5A 4AUXA 3BQYA 3VUQA 2GBYA 2IBDA 4W1UA 2X9DA 2WUIA 4B1RA 4PXIA 2NP3A 4B3AA 3CRJA 3IH2A 2HXOA 2QCOA 4MO7A 1SGMA 3HTJA 5EZHA 3S5RA 3VW2A 2JK3A 5J3LA 3C07A 3ZQHA 2QTQA 1ORKA 5GPAA 3V6GA 2HYTA 3E7QA 2FX0A 3NNRA 5FMPA 4ACIA 1QVTA 2XPVA 3QQAA 3G7RA 4D5FA 3F1BA 2HQ5A 3BR0A 2DG7A 1RKWA 2Y30A 3MNLA 3VP5A 5IOZA 2JJ7A 1QVUA 5F0CA 2UXPA 5FGLA 4NELA 3JSJA 5IP6A 2VKEA 3KKDA 3EUPA 5EFYA 4GFKA 2RHAA 3HGYA 3HE0A 2EH3A 2FQ4A 5CXIA 5FKMA 4ICHA 3Q0UA 3VVYA 1T33A 3B6CA 5IOYA
chains in the Genus database with same CATH superfamily
5K7FA 2XGCA 3CWRA 3HIMA 3C2BA 3NXCA 5FKLA 2DTZA 3VOXA 3BR3A 2R7TA 1JUPA 2XB5A 3ZQFA 2FJI1 2F07A 3BNIA 4AC0A 3CDLA 3PM1A 4GCLA 5F27A 2NS8A 2HXIA 2ZOYA 5HSZA 4KWAA 3VIBA 2FJ1A 4M3DA 2R7VA 2XGDA 3TP3A 3IH4A 2UXIA 2TCTA 3O60A 2IEKA 3BJBA 4JKZA 3FIWA 3BCGA 3B81A 5F1JA 2HYJA 2G7LA 1U9OA 5F0HA 5F04A 3CJDA 4JNNA 3VW1A 5IPAA 3G1MA 2DG8A 2G7SA 4CGRA 3ZQLA 4D5CA 2PZ9A 1Z77A 2XGEA 1ZK8A 3G1OA 5FHPA 3SDGA 2XPWA 2NS7A 2Y31A 2FD5A 3SWHA 2R7WA 2O7TA 2QWTA 3EGQA 2YVXA 3QBMA 3DCFA 4DVYP 3KKCA 4AC6A 4L62A 2FBQA 3DU5A 2UXUA 4M3FA 3PPBA 2YVEA 5EZGA 2W53A 4JL3A 5J1UA 1JTYA 2IU5A 3BR6A 3RD3A 2NX4A 1QPIA 4D7NA 2VPRA 2OI8A 3Q0WA 2ZY9A 5F0FA 5C4YA 4MXMA 5AQCA 5FKKA 1UI5A 4C2MA 1T56A 4GCKA 3BT9A 3CCYA 3LJLA 3WHBA 2QIBA 4X1EA 1JUMA 2RAEA 4M3GA 2QOPA 1JUSA 2G7GA 5K7HA 4V2GA 5F08A 2RASA 3TP0A 3T6NA 3K8PC 3VVZA 3B6AA 2PBXA 4XK4A 3VOKA 2G0EA 2A2FX 3LSRA 4ME9A 1UI6A 3RH2A 3O8GA 2UXHA 3ANPA 1JT0A 2QKOA 2GFNA 3KZ9A 4W97A 3LWJA 3ZQIA 2Q24A 3VW0A 3QPLA 3FHNA 4HKUA 4JYKA 4V2FA 3MVPA 3VVXA 3QPSA 1BJZA 4ABZA 3BTCA 3DEWA 3ZQGA 3FRQA 3COLA 3NPIA 4G12A 1RPWA 2R7RA 1Z0XA 3HTAA 2O7OA 2ZCXA 5K7ZA 3G56A 2R7QA 3PASA 2XDNA 3FK6A 5GPCA 2UXOA 4I76A 3BR5A 5CW8A 4OD4A 4I6ZA 4M3BA 3IH3A 3Q0VA 2ZOZA 3BTLA 3BR2A 2X6OA 3Q3SA 1JT6A 3GZIA 5FKNA 4M3EA 3FK7A 4MK6A 5DAJA 3ON2A 3HTIA 4DW6A 5GP9A 5J1YA 3NRGA 4YZEA 2ID3A 2OPTA 4UDSA 2VKVA 2IAIA 3P9TA 2WGBA 2D6YA 3G1LA 5EYRA 3LOCA 3ON4A 5J1RA 5D18A 2ZB9A 5FKOA 2OF7A 2ZCMA 3LSPA 3KYLA 2GENA 4NN1A 3V78A 2I10A 4U9LA 2R7XA 1ZKGA 3HTHA 2WV1A 3LSJA 5H9TA 4D7MA 4U9NA 1JTXA 3BTJA 3BR1A 2YVHA 3AQSA 3VPRA 1U9NA 3NI7A 5D1RA 1RKTA 3F0CA 3WHCA 3DPJA 3GEUA 3QKXA 3LHQA 2REKA 3HGGA 2XRLA 5HBUA 3BRUA 5HAWA 2HKUA 2OERA 3ANGA 2ZCNA 1A6IA 3BQZA 2ID6A 3BTIA 2R7OA 3KNWA 5CXGA 2V57A 5K58A 2R7SA 2G3BA 3AQTA 3SFIA 2NP5A 2XPUA 4GFLA 4OD5A 5D19A 4GCTA 2Y2ZA 1VI0A 2GUHA 2TRTA 3BHQA 3IUVA 3O8HA 4AF5A 4AUXA 3BQYA 3VUQA 2GBYA 2IBDA 4W1UA 2X9DA 2WUIA 4WIBA 4B1RA 4PXIA 2NP3A 4B3AA 3CRJA 3IH2A 2B3WA 2HXOA 2QCOA 4MO7A 1SGMA 3HTJA 5EZHA 3S5RA 3VW2A 2JK3A 5J3LA 3C07A 3DU6A 3ZQHA 2QTQA 1ORKA 5GPAA 3V6GA 2HYTA 3E7QA 2FX0A 3NNRA 5FMPA 4ACIA 1QVTA 2XPVA 3QQAA 3G7RA 4D5FA 3F1BA 2HQ5A 3BR0A 2DG7A 2R7UA 1RKWA 2PFVA 2Y30A 3MNLA 3VP5A 5IOZA 2JJ7A 4IRVA 1QVUA 3VTIA 5F0CA 2UXPA 5FGLA 4NELA 5CQGA 3JSJA 5IP6A 2VKEA 3NS4A 3KKDA 3EUPA 2B1EA 5EFYA 4GFKA 2RHAA 3HGYA 3HE0A 2EH3A 2FQ4A 5CXIA 5FKMA 4ICHA 3Q0UA 3VVYA 1T33A 3B6CA 5IOYA
chains in the Genus database with same CATH topology
5K7FA 2XGCA 3CWRA 3HIMA 3C2BA 3NXCA 5FKLA 2DTZA 3VOXA 3BR3A 1JUPA 2XB5A 3ZQFA 2F07A 3BNIA 4AC0A 3CDLA 3PM1A 4GCLA 5F27A 2NS8A 2HXIA 2ZOYA 5HSZA 4KWAA 3VIBA 2FJ1A 4M3DA 2XGDA 3TP3A 3IH4A 2UXIA 2TCTA 3O60A 2IEKA 3BJBA 4JKZA 3FIWA 3BCGA 3B81A 5F1JA 2HYJA 2G7LA 1U9OA 5F0HA 5F04A 3CJDA 4JNNA 3VW1A 5IPAA 3G1MA 2DG8A 2G7SA 4CGRA 3ZQLA 4D5CA 2PZ9A 1Z77A 2XGEA 1ZK8A 3G1OA 5FHPA 3SDGA 2XPWA 2NS7A 2Y31A 2FD5A 2O7TA 2QWTA 3EGQA 3QBMA 3DCFA 3KKCA 4AC6A 4L62A 2FBQA 4M3FA 2UXUA 3PPBA 2YVEA 5EZGA 2W53A 4JL3A 5J1UA 1JTYA 2IU5A 3BR6A 3RD3A 2NX4A 1QPIA 4D7NA 2VPRA 2OI8A 3Q0WA 5F0FA 5C4YA 4MXMA 5AQCA 5FKKA 1UI5A 1T56A 4GCKA 3BT9A 3CCYA 3LJLA 3WHBA 2QIBA 4X1EA 1JUMA 2RAEA 4M3GA 2QOPA 1JUSA 2G7GA 5K7HA 4V2GA 5F08A 2RASA 3TP0A 3T6NA 3VVZA 3B6AA 2PBXA 4XK4A 3VOKA 2G0EA 3LSRA 4ME9A 1UI6A 3RH2A 3O8GA 2UXHA 3ANPA 1JT0A 2QKOA 2GFNA 3KZ9A 4W97A 3ZQIA 3LWJA 2Q24A 3VW0A 3QPLA 4HKUA 4JYKA 4V2FA 3MVPA 3VVXA 3QPSA 1BJZA 4ABZA 3BTCA 3DEWA 3ZQGA 3FRQA 3COLA 3NPIA 4G12A 1RPWA 1Z0XA 3HTAA 2O7OA 2ZCXA 5K7ZA 3G56A 3PASA 2XDNA 3FK6A 5GPCA 2UXOA 4I76A 3BR5A 5CW8A 4I6ZA 4M3BA 3IH3A 3Q0VA 2ZOZA 3BTLA 3BR2A 2X6OA 3Q3SA 1JT6A 3GZIA 5FKNA 4M3EA 3FK7A 4MK6A 5DAJA 3ON2A 3HTIA 4DW6A 5GP9A 5J1YA 3NRGA 4YZEA 2ID3A 2OPTA 4UDSA 2VKVA 2IAIA 3P9TA 2WGBA 2D6YA 3G1LA 5EYRA 3LOCA 3ON4A 5J1RA 5D18A 2ZB9A 5FKOA 2OF7A 2ZCMA 3LSPA 2GENA 4NN1A 3V78A 2I10A 1ZKGA 3HTHA 2WV1A 3LSJA 5H9TA 4D7MA 1JTXA 3BTJA 3BR1A 2YVHA 3AQSA 3VPRA 1U9NA 3NI7A 5D1RA 1RKTA 3F0CA 3WHCA 3DPJA 3GEUA 3QKXA 3LHQA 2REKA 3HGGA 2XRLA 5HBUA 3BRUA 5HAWA 2HKUA 2OERA 3ANGA 2ZCNA 1A6IA 3BQZA 2ID6A 3BTIA 3KNWA 5CXGA 2V57A 5K58A 2G3BA 3AQTA 3SFIA 2NP5A 2XPUA 4GFLA 5D19A 4GCTA 2Y2ZA 1VI0A 2GUHA 2TRTA 3BHQA 3IUVA 3O8HA 4AF5A 4AUXA 3BQYA 3VUQA 2GBYA 2IBDA 4W1UA 2X9DA 2WUIA 4B1RA 4PXIA 2NP3A 4B3AA 3CRJA 3IH2A 2HXOA 2QCOA 4MO7A 1SGMA 3HTJA 5EZHA 3S5RA 3VW2A 2JK3A 5J3LA 3C07A 3ZQHA 2QTQA 1ORKA 5GPAA 3V6GA 2HYTA 3E7QA 2FX0A 3NNRA 5FMPA 4ACIA 1QVTA 2XPVA 3QQAA 3G7RA 4D5FA 3F1BA 2HQ5A 3BR0A 2DG7A 1RKWA 2Y30A 3MNLA 3VP5A 5IOZA 2JJ7A 1QVUA 5F0CA 2UXPA 5FGLA 4NELA 3JSJA 5IP6A 2VKEA 3KKDA 3EUPA 5EFYA 4GFKA 2RHAA 3HGYA 3HE0A 2EH3A 2FQ4A 5CXIA 5FKMA 4ICHA 3Q0UA 3VVYA 1T33A 3B6CA 5IOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7F A;  2XGC A;  3CWR A;  3HIM A;  3C2B A;  3NXC A;  5FKL A;  2DTZ A;  3VOX A;  3BR3 A;  1JUP A;  2XB5 A;  3ZQF A;  2F07 A;  3BNI A;  4AC0 A;  3CDL A;  3PM1 A;  4GCL A;  5F27 A;  2NS8 A;  2HXI A;  2ZOY A;  5HSZ A;  4KWA A;  3VIB A;  2FJ1 A;  4M3D A;  2XGD A;  3TP3 A;  3IH4 A;  2UXI A;  2TCT A;  3O60 A;  2IEK A;  3BJB A;  4JKZ A;  3FIW A;  3BCG A;  3B81 A;  5F1J A;  2HYJ A;  2G7L A;  1U9O A;  5F0H A;  5F04 A;  3CJD A;  4JNN A;  3VW1 A;  5IPA A;  3G1M A;  2DG8 A;  2G7S A;  4CGR A;  3ZQL A;  4D5C A;  2PZ9 A;  1Z77 A;  2XGE A;  1ZK8 A;  3G1O A;  5FHP A;  3SDG A;  2XPW A;  2NS7 A;  2Y31 A;  2FD5 A;  2O7T A;  2QWT A;  3EGQ A;  3QBM A;  3DCF A;  3KKC A;  4AC6 A;  4L62 A;  2FBQ A;  4M3F A;  2UXU A;  3PPB A;  2YVE A;  5EZG A;  2W53 A;  4JL3 A;  5J1U A;  1JTY A;  2IU5 A;  3BR6 A;  3RD3 A;  2NX4 A;  1QPI A;  4D7N A;  2VPR A;  2OI8 A;  3Q0W A;  5F0F A;  5C4Y A;  4MXM A;  5AQC A;  5FKK A;  1UI5 A;  1T56 A;  4GCK A;  3BT9 A;  3CCY A;  3LJL A;  3WHB A;  2QIB A;  4X1E A;  1JUM A;  2RAE A;  4M3G A;  2QOP A;  1JUS A;  2G7G A;  5K7H A;  4V2G A;  5F08 A;  2RAS A;  3TP0 A;  3T6N A;  3VVZ A;  3B6A A;  2PBX A;  4XK4 A;  3VOK A;  2G0E A;  3LSR A;  4ME9 A;  1UI6 A;  3RH2 A;  3O8G A;  2UXH A;  3ANP A;  1JT0 A;  2QKO A;  2GFN A;  3KZ9 A;  4W97 A;  3ZQI A;  3LWJ A;  2Q24 A;  3VW0 A;  3QPL A;  4HKU A;  4JYK A;  4V2F A;  3MVP A;  3VVX A;  3QPS A;  1BJZ A;  4ABZ A;  3BTC A;  3DEW A;  3ZQG A;  3FRQ A;  3COL A;  3NPI A;  4G12 A;  1RPW A;  1Z0X A;  3HTA A;  2O7O A;  2ZCX A;  5K7Z A;  3G56 A;  3PAS A;  2XDN A;  3FK6 A;  5GPC A;  2UXO A;  4I76 A;  3BR5 A;  5CW8 A;  4I6Z A;  4M3B A;  3IH3 A;  3Q0V A;  2ZOZ A;  3BTL A;  3BR2 A;  2X6O A;  3Q3S A;  1JT6 A;  3GZI A;  5FKN A;  4M3E A;  3FK7 A;  4MK6 A;  5DAJ A;  3ON2 A;  3HTI A;  4DW6 A;  5GP9 A;  5J1Y A;  3NRG A;  4YZE A;  2ID3 A;  2OPT A;  4UDS A;  2VKV A;  2IAI A;  3P9T A;  2WGB A;  2D6Y A;  3G1L A;  5EYR A;  3LOC A;  3ON4 A;  5J1R A;  5D18 A;  2ZB9 A;  5FKO A;  2OF7 A;  2ZCM A;  3LSP A;  2GEN A;  4NN1 A;  3V78 A;  2I10 A;  1ZKG A;  3HTH A;  2WV1 A;  3LSJ A;  5H9T A;  4D7M A;  1JTX A;  3BTJ A;  3BR1 A;  2YVH A;  3AQS A;  3VPR A;  1U9N A;  3NI7 A;  5D1R A;  1RKT A;  3F0C A;  3WHC A;  3DPJ A;  3GEU A;  3QKX A;  3LHQ A;  2REK A;  3HGG A;  2XRL A;  5HBU A;  3BRU A;  5HAW A;  2HKU A;  2OER A;  3ANG A;  2ZCN A;  1A6I A;  3BQZ A;  2ID6 A;  3BTI A;  3KNW A;  5CXG A;  2V57 A;  5K58 A;  2G3B A;  3AQT A;  3SFI A;  2NP5 A;  2XPU A;  4GFL A;  5D19 A;  4GCT A;  2Y2Z A;  1VI0 A;  2GUH A;  2TRT A;  3BHQ A;  3IUV A;  3O8H A;  4AF5 A;  4AUX A;  3BQY A;  3VUQ A;  2GBY A;  2IBD A;  4W1U A;  2X9D A;  2WUI A;  4B1R A;  4PXI A;  2NP3 A;  4B3A A;  3CRJ A;  3IH2 A;  2HXO A;  2QCO A;  4MO7 A;  1SGM A;  3HTJ A;  5EZH A;  3S5R A;  3VW2 A;  2JK3 A;  5J3L A;  3C07 A;  3ZQH A;  2QTQ A;  1ORK A;  5GPA A;  3V6G A;  2HYT A;  3E7Q A;  2FX0 A;  3NNR A;  5FMP A;  4ACI A;  1QVT A;  2XPV A;  3QQA A;  3G7R A;  4D5F A;  3F1B A;  2HQ5 A;  3BR0 A;  2DG7 A;  1RKW A;  2Y30 A;  3MNL A;  3VP5 A;  5IOZ A;  2JJ7 A;  1QVU A;  5F0C A;  2UXP A;  5FGL A;  4NEL A;  3JSJ A;  5IP6 A;  2VKE A;  3KKD A;  3EUP A;  5EFY A;  4GFK A;  2RHA A;  3HGY A;  3HE0 A;  2EH3 A;  2FQ4 A;  5CXI A;  5FKM A;  4ICH A;  3Q0U A;  3VVY A;  1T33 A;  3B6C A;  5IOY A; 
#chains in the Genus database with same CATH topology
 5K7F A;  2XGC A;  3CWR A;  3HIM A;  3C2B A;  3NXC A;  5FKL A;  2DTZ A;  3VOX A;  3BR3 A;  2R7T A;  1JUP A;  2XB5 A;  3ZQF A;  2FJI 1;  2F07 A;  3BNI A;  4AC0 A;  3CDL A;  3PM1 A;  4GCL A;  5F27 A;  2NS8 A;  2HXI A;  2ZOY A;  5HSZ A;  4KWA A;  3VIB A;  2FJ1 A;  4M3D A;  2R7V A;  2XGD A;  3TP3 A;  3IH4 A;  2UXI A;  2TCT A;  3O60 A;  2IEK A;  3BJB A;  4JKZ A;  3FIW A;  3BCG A;  3B81 A;  5F1J A;  2HYJ A;  2G7L A;  1U9O A;  5F0H A;  5F04 A;  3CJD A;  4JNN A;  3VW1 A;  5IPA A;  3G1M A;  2DG8 A;  2G7S A;  4CGR A;  3ZQL A;  4D5C A;  2PZ9 A;  1Z77 A;  2XGE A;  1ZK8 A;  3G1O A;  5FHP A;  3SDG A;  2XPW A;  2NS7 A;  2Y31 A;  2FD5 A;  3SWH A;  2R7W A;  2O7T A;  2QWT A;  3EGQ A;  2YVX A;  3QBM A;  3DCF A;  4DVY P;  3KKC A;  4AC6 A;  4L62 A;  2FBQ A;  3DU5 A;  2UXU A;  4M3F A;  3PPB A;  2YVE A;  5EZG A;  2W53 A;  4JL3 A;  5J1U A;  1JTY A;  2IU5 A;  3BR6 A;  3RD3 A;  2NX4 A;  1QPI A;  4D7N A;  2VPR A;  2OI8 A;  3Q0W A;  2ZY9 A;  5F0F A;  5C4Y A;  4MXM A;  5AQC A;  5FKK A;  1UI5 A;  4C2M A;  1T56 A;  4GCK A;  3BT9 A;  3CCY A;  3LJL A;  3WHB A;  2QIB A;  4X1E A;  1JUM A;  2RAE A;  4M3G A;  2QOP A;  1JUS A;  2G7G A;  5K7H A;  4V2G A;  5F08 A;  2RAS A;  3TP0 A;  3T6N A;  3K8P C;  3VVZ A;  3B6A A;  2PBX A;  4XK4 A;  3VOK A;  2G0E A;  2A2F X;  3LSR A;  4ME9 A;  1UI6 A;  3RH2 A;  3O8G A;  2UXH A;  3ANP A;  1JT0 A;  2QKO A;  2GFN A;  3KZ9 A;  4W97 A;  3LWJ A;  3ZQI A;  2Q24 A;  3VW0 A;  3QPL A;  3FHN A;  4HKU A;  4JYK A;  4V2F A;  3MVP A;  3VVX A;  3QPS A;  1BJZ A;  4ABZ A;  3BTC A;  3DEW A;  3ZQG A;  3FRQ A;  3COL A;  3NPI A;  4G12 A;  1RPW A;  2R7R A;  1Z0X A;  3HTA A;  2O7O A;  2ZCX A;  5K7Z A;  3G56 A;  2R7Q A;  3PAS A;  2XDN A;  3FK6 A;  5GPC A;  2UXO A;  4I76 A;  3BR5 A;  5CW8 A;  4OD4 A;  4I6Z A;  4M3B A;  3IH3 A;  3Q0V A;  2ZOZ A;  3BTL A;  3BR2 A;  2X6O A;  3Q3S A;  1JT6 A;  3GZI A;  5FKN A;  4M3E A;  3FK7 A;  4MK6 A;  5DAJ A;  3ON2 A;  3HTI A;  4DW6 A;  5GP9 A;  5J1Y A;  3NRG A;  4YZE A;  2ID3 A;  2OPT A;  4UDS A;  2VKV A;  2IAI A;  3P9T A;  2WGB A;  2D6Y A;  3G1L A;  5EYR A;  3LOC A;  3ON4 A;  5J1R A;  5D18 A;  2ZB9 A;  5FKO A;  2OF7 A;  2ZCM A;  3LSP A;  3KYL A;  2GEN A;  4NN1 A;  3V78 A;  2I10 A;  4U9L A;  2R7X A;  1ZKG A;  3HTH A;  2WV1 A;  3LSJ A;  5H9T A;  4D7M A;  4U9N A;  1JTX A;  3BTJ A;  3BR1 A;  2YVH A;  3AQS A;  3VPR A;  1U9N A;  3NI7 A;  5D1R A;  1RKT A;  3F0C A;  3WHC A;  3DPJ A;  3GEU A;  3QKX A;  3LHQ A;  2REK A;  3HGG A;  2XRL A;  5HBU A;  3BRU A;  5HAW A;  2HKU A;  2OER A;  3ANG A;  2ZCN A;  1A6I A;  3BQZ A;  2ID6 A;  3BTI A;  2R7O A;  3KNW A;  5CXG A;  2V57 A;  5K58 A;  2R7S A;  2G3B A;  3AQT A;  3SFI A;  2NP5 A;  2XPU A;  4GFL A;  4OD5 A;  5D19 A;  4GCT A;  2Y2Z A;  1VI0 A;  2GUH A;  2TRT A;  3BHQ A;  3IUV A;  3O8H A;  4AF5 A;  4AUX A;  3BQY A;  3VUQ A;  2GBY A;  2IBD A;  4W1U A;  2X9D A;  2WUI A;  4WIB A;  4B1R A;  4PXI A;  2NP3 A;  4B3A A;  3CRJ A;  3IH2 A;  2B3W A;  2HXO A;  2QCO A;  4MO7 A;  1SGM A;  3HTJ A;  5EZH A;  3S5R A;  3VW2 A;  2JK3 A;  5J3L A;  3C07 A;  3DU6 A;  3ZQH A;  2QTQ A;  1ORK A;  5GPA A;  3V6G A;  2HYT A;  3E7Q A;  2FX0 A;  3NNR A;  5FMP A;  4ACI A;  1QVT A;  2XPV A;  3QQA A;  3G7R A;  4D5F A;  3F1B A;  2HQ5 A;  3BR0 A;  2DG7 A;  2R7U A;  1RKW A;  2PFV A;  2Y30 A;  3MNL A;  3VP5 A;  5IOZ A;  2JJ7 A;  4IRV A;  1QVU A;  3VTI A;  5F0C A;  2UXP A;  5FGL A;  4NEL A;  5CQG A;  3JSJ A;  5IP6 A;  2VKE A;  3NS4 A;  3KKD A;  3EUP A;  2B1E A;  5EFY A;  4GFK A;  2RHA A;  3HGY A;  3HE0 A;  2EH3 A;  2FQ4 A;  5CXI A;  5FKM A;  4ICH A;  3Q0U A;  3VVY A;  1T33 A;  3B6C A;  5IOY A; 
#chains in the Genus database with same CATH homology
 5K7F A;  2XGC A;  3CWR A;  3HIM A;  3C2B A;  3NXC A;  5FKL A;  2DTZ A;  3VOX A;  3BR3 A;  1JUP A;  2XB5 A;  3ZQF A;  2F07 A;  3BNI A;  4AC0 A;  3CDL A;  3PM1 A;  4GCL A;  5F27 A;  2NS8 A;  2HXI A;  2ZOY A;  5HSZ A;  4KWA A;  3VIB A;  2FJ1 A;  4M3D A;  2XGD A;  3TP3 A;  3IH4 A;  2UXI A;  2TCT A;  3O60 A;  2IEK A;  3BJB A;  4JKZ A;  3FIW A;  3BCG A;  3B81 A;  5F1J A;  2HYJ A;  2G7L A;  1U9O A;  5F0H A;  5F04 A;  3CJD A;  4JNN A;  3VW1 A;  5IPA A;  3G1M A;  2DG8 A;  2G7S A;  4CGR A;  3ZQL A;  4D5C A;  2PZ9 A;  1Z77 A;  2XGE A;  1ZK8 A;  3G1O A;  5FHP A;  3SDG A;  2XPW A;  2NS7 A;  2Y31 A;  2FD5 A;  2O7T A;  2QWT A;  3EGQ A;  3QBM A;  3DCF A;  3KKC A;  4AC6 A;  4L62 A;  2FBQ A;  4M3F A;  2UXU A;  3PPB A;  2YVE A;  5EZG A;  2W53 A;  4JL3 A;  5J1U A;  1JTY A;  2IU5 A;  3BR6 A;  3RD3 A;  2NX4 A;  1QPI A;  4D7N A;  2VPR A;  2OI8 A;  3Q0W A;  5F0F A;  5C4Y A;  4MXM A;  5AQC A;  5FKK A;  1UI5 A;  1T56 A;  4GCK A;  3BT9 A;  3CCY A;  3LJL A;  3WHB A;  2QIB A;  4X1E A;  1JUM A;  2RAE A;  4M3G A;  2QOP A;  1JUS A;  2G7G A;  5K7H A;  4V2G A;  5F08 A;  2RAS A;  3TP0 A;  3T6N A;  3VVZ A;  3B6A A;  2PBX A;  4XK4 A;  3VOK A;  2G0E A;  3LSR A;  4ME9 A;  1UI6 A;  3RH2 A;  3O8G A;  2UXH A;  3ANP A;  1JT0 A;  2QKO A;  2GFN A;  3KZ9 A;  4W97 A;  3ZQI A;  3LWJ A;  2Q24 A;  3VW0 A;  3QPL A;  4HKU A;  4JYK A;  4V2F A;  3MVP A;  3VVX A;  3QPS A;  1BJZ A;  4ABZ A;  3BTC A;  3DEW A;  3ZQG A;  3FRQ A;  3COL A;  3NPI A;  4G12 A;  1RPW A;  1Z0X A;  3HTA A;  2O7O A;  2ZCX A;  5K7Z A;  3G56 A;  3PAS A;  2XDN A;  3FK6 A;  5GPC A;  2UXO A;  4I76 A;  3BR5 A;  5CW8 A;  4I6Z A;  4M3B A;  3IH3 A;  3Q0V A;  2ZOZ A;  3BTL A;  3BR2 A;  2X6O A;  3Q3S A;  1JT6 A;  3GZI A;  5FKN A;  4M3E A;  3FK7 A;  4MK6 A;  5DAJ A;  3ON2 A;  3HTI A;  4DW6 A;  5GP9 A;  5J1Y A;  3NRG A;  4YZE A;  2ID3 A;  2OPT A;  4UDS A;  2VKV A;  2IAI A;  3P9T A;  2WGB A;  2D6Y A;  3G1L A;  5EYR A;  3LOC A;  3ON4 A;  5J1R A;  5D18 A;  2ZB9 A;  5FKO A;  2OF7 A;  2ZCM A;  3LSP A;  2GEN A;  4NN1 A;  3V78 A;  2I10 A;  1ZKG A;  3HTH A;  2WV1 A;  3LSJ A;  5H9T A;  4D7M A;  1JTX A;  3BTJ A;  3BR1 A;  2YVH A;  3AQS A;  3VPR A;  1U9N A;  3NI7 A;  5D1R A;  1RKT A;  3F0C A;  3WHC A;  3DPJ A;  3GEU A;  3QKX A;  3LHQ A;  2REK A;  3HGG A;  2XRL A;  5HBU A;  3BRU A;  5HAW A;  2HKU A;  2OER A;  3ANG A;  2ZCN A;  1A6I A;  3BQZ A;  2ID6 A;  3BTI A;  3KNW A;  5CXG A;  2V57 A;  5K58 A;  2G3B A;  3AQT A;  3SFI A;  2NP5 A;  2XPU A;  4GFL A;  5D19 A;  4GCT A;  2Y2Z A;  1VI0 A;  2GUH A;  2TRT A;  3BHQ A;  3IUV A;  3O8H A;  4AF5 A;  4AUX A;  3BQY A;  3VUQ A;  2GBY A;  2IBD A;  4W1U A;  2X9D A;  2WUI A;  4B1R A;  4PXI A;  2NP3 A;  4B3A A;  3CRJ A;  3IH2 A;  2HXO A;  2QCO A;  4MO7 A;  1SGM A;  3HTJ A;  5EZH A;  3S5R A;  3VW2 A;  2JK3 A;  5J3L A;  3C07 A;  3ZQH A;  2QTQ A;  1ORK A;  5GPA A;  3V6G A;  2HYT A;  3E7Q A;  2FX0 A;  3NNR A;  5FMP A;  4ACI A;  1QVT A;  2XPV A;  3QQA A;  3G7R A;  4D5F A;  3F1B A;  2HQ5 A;  3BR0 A;  2DG7 A;  1RKW A;  2Y30 A;  3MNL A;  3VP5 A;  5IOZ A;  2JJ7 A;  1QVU A;  5F0C A;  2UXP A;  5FGL A;  4NEL A;  3JSJ A;  5IP6 A;  2VKE A;  3KKD A;  3EUP A;  5EFY A;  4GFK A;  2RHA A;  3HGY A;  3HE0 A;  2EH3 A;  2FQ4 A;  5CXI A;  5FKM A;  4ICH A;  3Q0U A;  3VVY A;  1T33 A;  3B6C A;  5IOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...