3DPJA

The crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
194
structure length
194
Chain Sequence
SNAMVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQMLADWQGTGDSPRARIASFIDLMIMNRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEAGCTTEAPALAMHLLARSQGAATLAQSFHDEGFLRSEVADMHRWLDNTLPMTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator, TetR family
publication title The crystal structure of a TetR transcription regulator from Silicibacter pomeroyi DSS
rcsb
source organism Silicibacter pomeroyi
molecule tags Dna binding protein
total genus 69
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dpjA00
4B1RA 3LWJA 2NP5A 5J3LA 3VVZA 3CDLA 3RH2A 2UXOA 3BT9A 3KKCA 3Q0WA 1ZKGA 4I76A 3MNLA 4ME9A 5F04A 2RASA 3GZIA 2G0EA 3IH3A 5F27A 4V2GA 4MK6A 3RD3A 4ICHA 4JNNA 4JYKA 2JK3A 5K58A 3VVYA 3HTIA 2XPWA 4M3BA 3QQAA 4M3EA 3VUQA 3VVXA 4KWAA 3VW2A 3VOKA 4GFKA 4W97A 2VPRA 5F0FA 2XGEA 2HKUA 3BNIA 4DW6A 3EUPA 3KKDA 2JJ7A 1UI6A 3LHQA 3PM1A 1Z0XA 2QKOA 5GPAA 3ZQLA 1RKTA 3TP0A 3QPLA 3DEWA 3Q0UA 2OPTA 2O7OA 3ON2A 2HYTA 2D6YA 3B81A 2V57A 3IUVA 3BR6A 2FD5A 3HIMA 2RHAA 2I10A 2FJ1A 3LOCA 4X1EA 2QIBA 3HTHA 5K7HA 2ID6A 5FKOA 5AQCA 2FBQA 3HTAA 3BTIA 2ZOYA 2WV1A 4D7MA 3E7QA 4W1UA 3ZQIA 1UI5A 4JKZA 5F0CA 2IBDA 4NELA 3ZQFA 3G56A 2XGDA 1T56A 1SGMA 3V78A 2X9DA 3BQZA 3O8GA 5EZHA 1ORKA 3KNWA 5H9TA 3TP3A 4I6ZA 1JTXA 1Z77A 2G7GA 1JT0A 1JTYA 5FGLA 3ZQHA 3BTCA 4V2FA 5EZGA 2HXIA 5CW8A 1RKWA 1JUPA 3ANGA 2HYJA 3DPJA 3Q0VA 2NP3A 2NS7A 5IP6A 3PPBA 3G1LA 4JL3A 3KZ9A 3O8HA 2ID3A 3JSJA 1QVTA 4NN1A 2Q24A 2VKEA 2XDNA 4ACIA 2ZCMA 4AC6A 3BQYA 1U9NA 2FQ4A 2Y30A 4L62A 3VW1A 2NS8A 2OERA 5K7FA 3BR1A 5EYRA 4UDSA 2WUIA 4XK4A 4GCKA 2OI8A 2UXIA 2XPVA 2UXHA 3HTJA 3VP5A 5HSZA 3NRGA 3NI7A 3LSRA 2IU5A 1QVUA 2UXPA 5FMPA 3BR3A 2WGBA 2HQ5A 1QPIA 2NX4A 5EFYA 1ZK8A 2G7SA 3AQSA 2TCTA 4YZEA 5GP9A 3LJLA 2DG7A 3ANPA 3AQTA 3C2BA 4D5FA 3Q3SA 5FKNA 4GCLA 5FKKA 2X6OA 3ON4A 3HGGA 5F08A 3B6CA 3P9TA 3BJBA 2QWTA 2QTQA 2W53A 2DG8A 2GBYA 1JUMA 3SDGA 2PBXA 5D1RA 5IOYA 3QKXA 2GUHA 5FKMA 2ZOZA 5F1JA 3BR2A 5IPAA 2VKVA 3VPRA 3G1MA 5C4YA 2GENA 3LSPA 2Y2ZA 3FIWA 2GFNA 2OF7A 3BTLA 4G12A 2FX0A 3HGYA 5F0HA 2DTZA 3IH2A 2HXOA 3NXCA 2ZB9A 5D18A 3DCFA 3F1BA 1JUSA 2QCOA 3BHQA 3CCYA 3SFIA 5IOZA 3O60A 2TRTA 3FK6A 4M3FA 2EH3A 2XRLA 3VIBA 3LSJA 3WHBA 4AF5A 3BR5A 3WHCA 2ZCNA 3COLA 1A6IA 4M3GA 5J1YA 5FHPA 4GFLA 3T6NA 2O7TA 2G7LA 2XGCA 1U9OA 3HE0A 3QPSA 5J1RA 4MO7A 4PXIA 3PASA 3BRUA 3S5RA 5FKLA 2REKA 5HAWA 2IAIA 3GEUA 1BJZA 2YVEA 2Y31A 5CXIA 5DAJA 2UXUA 3G1OA 3B6AA 3F0CA 3C07A 3CJDA 3VOXA 4D5CA 3BTJA 4M3DA 2XB5A 3V6GA 2G3BA 2YVHA 3IH4A 5J1UA 2PZ9A 1JT6A 3BCGA 4MXMA 3CRJA 4AUXA 4GCTA 3EGQA 2ZCXA 3FK7A 3QBMA 4D7NA 2IEKA 4CGRA 3MVPA 4B3AA 3NPIA 5D19A 3FRQA 3NNRA 5HBUA 3VW0A 5CXGA 4HKUA 4ABZA 3G7RA 1T33A 5GPCA 1RPWA 2F07A 2XPUA 5K7ZA 1VI0A 3BR0A 3CWRA 4AC0A 2RAEA 2QOPA 3ZQGA
chains in the Genus database with same CATH superfamily
4B1RA 3LWJA 2NP5A 5J3LA 3VVZA 3CDLA 3RH2A 2UXOA 3BT9A 3KKCA 3Q0WA 1ZKGA 2R7UA 4I76A 3MNLA 4ME9A 5F04A 3NS4A 2ZY9A 2RASA 2A2FX 3GZIA 2G0EA 3IH3A 5F27A 4V2GA 4MK6A 3RD3A 4ICHA 4JNNA 4JYKA 2JK3A 5K58A 3VVYA 3HTIA 2XPWA 4M3BA 3QQAA 4M3EA 3VUQA 3VVXA 2R7WA 4KWAA 3VW2A 3VOKA 2B3WA 4GFKA 4W97A 2VPRA 5F0FA 2XGEA 2HKUA 3BNIA 4DW6A 3EUPA 3KKDA 2JJ7A 1UI6A 3LHQA 3KYLA 3PM1A 1Z0XA 2QKOA 5GPAA 3ZQLA 1RKTA 3TP0A 3QPLA 3DEWA 3Q0UA 2OPTA 2FJI1 2O7OA 3ON2A 2HYTA 2D6YA 3B81A 2V57A 3IUVA 3BR6A 2FD5A 3HIMA 2RHAA 2I10A 2FJ1A 3LOCA 4X1EA 2QIBA 3HTHA 5K7HA 4C2MA 2ID6A 5FKOA 5AQCA 2FBQA 3HTAA 3BTIA 2ZOYA 2WV1A 4D7MA 3E7QA 4W1UA 3ZQIA 1UI5A 4JKZA 5F0CA 2IBDA 4NELA 3ZQFA 3G56A 2XGDA 1T56A 1SGMA 3V78A 2X9DA 3BQZA 3O8GA 5EZHA 1ORKA 3KNWA 5H9TA 3TP3A 4I6ZA 1JTXA 1Z77A 2G7GA 4OD5A 1JT0A 4IRVA 1JTYA 5FGLA 3ZQHA 3K8PC 3BTCA 4DVYP 4V2FA 5EZGA 2HXIA 5CW8A 1RKWA 1JUPA 3ANGA 2HYJA 3DPJA 3Q0VA 2NP3A 2NS7A 5IP6A 3PPBA 3G1LA 4JL3A 3KZ9A 3O8HA 2ID3A 3JSJA 1QVTA 4NN1A 2Q24A 2VKEA 3DU6A 2XDNA 4ACIA 2ZCMA 4AC6A 3BQYA 1U9NA 2FQ4A 2Y30A 4L62A 3VW1A 3VTIA 2NS8A 2OERA 5K7FA 3BR1A 5EYRA 4UDSA 2WUIA 4XK4A 4GCKA 2OI8A 2UXIA 2XPVA 2UXHA 3HTJA 3VP5A 2R7RA 5HSZA 3NRGA 3NI7A 3LSRA 2IU5A 1QVUA 2UXPA 5FMPA 3BR3A 2WGBA 2HQ5A 1QPIA 3SWHA 2NX4A 5EFYA 1ZK8A 2G7SA 3AQSA 2TCTA 4YZEA 5GP9A 3LJLA 2DG7A 3ANPA 3AQTA 3C2BA 4D5FA 3Q3SA 5FKNA 4GCLA 5FKKA 2X6OA 3ON4A 3HGGA 3DU5A 5F08A 3B6CA 3P9TA 3BJBA 2QWTA 2QTQA 2R7QA 2W53A 2DG8A 2GBYA 1JUMA 3SDGA 2PBXA 5D1RA 5IOYA 2R7XA 3QKXA 2GUHA 5FKMA 2ZOZA 5F1JA 3BR2A 5IPAA 2VKVA 3VPRA 3G1MA 5C4YA 2GENA 3LSPA 2R7TA 2R7OA 2Y2ZA 3FIWA 2GFNA 2OF7A 3BTLA 4G12A 2FX0A 3HGYA 5F0HA 2DTZA 3IH2A 2HXOA 3NXCA 2ZB9A 2PFVA 5D18A 3DCFA 3F1BA 1JUSA 2QCOA 3BHQA 3CCYA 3SFIA 5IOZA 3O60A 2TRTA 3FK6A 2R7SA 4M3FA 2EH3A 2XRLA 3VIBA 3LSJA 3WHBA 4AF5A 3BR5A 3WHCA 2ZCNA 4U9LA 3COLA 1A6IA 4M3GA 5J1YA 5FHPA 4GFLA 3T6NA 2O7TA 2G7LA 2XGCA 1U9OA 3HE0A 3QPSA 5J1RA 4MO7A 4PXIA 3PASA 2R7VA 3BRUA 4WIBA 3S5RA 5FKLA 2REKA 5HAWA 2IAIA 3GEUA 1BJZA 2YVEA 2Y31A 5CXIA 3FHNA 5DAJA 2UXUA 3G1OA 3B6AA 3F0CA 3C07A 3CJDA 3VOXA 4D5CA 3BTJA 4M3DA 2XB5A 3V6GA 2G3BA 2YVHA 3IH4A 5J1UA 2PZ9A 1JT6A 3BCGA 4MXMA 3CRJA 4AUXA 4OD4A 4GCTA 3EGQA 2ZCXA 3FK7A 3QBMA 4D7NA 2IEKA 4CGRA 3MVPA 2YVXA 4B3AA 3NPIA 5D19A 3FRQA 3NNRA 5HBUA 3VW0A 5CXGA 4HKUA 4ABZA 3G7RA 1T33A 5GPCA 1RPWA 2F07A 4U9NA 2XPUA 5K7ZA 1VI0A 3BR0A 2B1EA 3CWRA 4AC0A 2RAEA 2QOPA 5CQGA 3ZQGA
chains in the Genus database with same CATH topology
4B1RA 3LWJA 2NP5A 5J3LA 3VVZA 3CDLA 3RH2A 2UXOA 3BT9A 3KKCA 3Q0WA 1ZKGA 4I76A 3MNLA 4ME9A 5F04A 2RASA 3GZIA 2G0EA 3IH3A 5F27A 4V2GA 4MK6A 3RD3A 4ICHA 4JNNA 4JYKA 2JK3A 5K58A 3VVYA 3HTIA 2XPWA 4M3BA 3QQAA 4M3EA 3VUQA 3VVXA 4KWAA 3VW2A 3VOKA 4GFKA 4W97A 2VPRA 5F0FA 2XGEA 2HKUA 3BNIA 4DW6A 3EUPA 3KKDA 2JJ7A 1UI6A 3LHQA 3PM1A 1Z0XA 2QKOA 5GPAA 3ZQLA 1RKTA 3TP0A 3QPLA 3DEWA 3Q0UA 2OPTA 2O7OA 3ON2A 2HYTA 2D6YA 3B81A 2V57A 3IUVA 3BR6A 2FD5A 3HIMA 2RHAA 2I10A 2FJ1A 3LOCA 4X1EA 2QIBA 3HTHA 5K7HA 2ID6A 5FKOA 5AQCA 2FBQA 3HTAA 3BTIA 2ZOYA 2WV1A 4D7MA 3E7QA 4W1UA 3ZQIA 1UI5A 4JKZA 5F0CA 2IBDA 4NELA 3ZQFA 3G56A 2XGDA 1T56A 1SGMA 3V78A 2X9DA 3BQZA 3O8GA 5EZHA 1ORKA 3KNWA 5H9TA 3TP3A 4I6ZA 1JTXA 1Z77A 2G7GA 1JT0A 1JTYA 5FGLA 3ZQHA 3BTCA 4V2FA 5EZGA 2HXIA 5CW8A 1RKWA 1JUPA 3ANGA 2HYJA 3DPJA 3Q0VA 2NP3A 2NS7A 5IP6A 3PPBA 3G1LA 4JL3A 3KZ9A 3O8HA 2ID3A 3JSJA 1QVTA 4NN1A 2Q24A 2VKEA 2XDNA 4ACIA 2ZCMA 4AC6A 3BQYA 1U9NA 2FQ4A 2Y30A 4L62A 3VW1A 2NS8A 2OERA 5K7FA 3BR1A 5EYRA 4UDSA 2WUIA 4XK4A 4GCKA 2OI8A 2UXIA 2XPVA 2UXHA 3HTJA 3VP5A 5HSZA 3NRGA 3NI7A 3LSRA 2IU5A 1QVUA 2UXPA 5FMPA 3BR3A 2WGBA 2HQ5A 1QPIA 2NX4A 5EFYA 1ZK8A 2G7SA 3AQSA 2TCTA 4YZEA 5GP9A 3LJLA 2DG7A 3ANPA 3AQTA 3C2BA 4D5FA 3Q3SA 5FKNA 4GCLA 5FKKA 2X6OA 3ON4A 3HGGA 5F08A 3B6CA 3P9TA 3BJBA 2QWTA 2QTQA 2W53A 2DG8A 2GBYA 1JUMA 3SDGA 2PBXA 5D1RA 5IOYA 3QKXA 2GUHA 5FKMA 2ZOZA 5F1JA 3BR2A 5IPAA 2VKVA 3VPRA 3G1MA 5C4YA 2GENA 3LSPA 2Y2ZA 3FIWA 2GFNA 2OF7A 3BTLA 4G12A 2FX0A 3HGYA 5F0HA 2DTZA 3IH2A 2HXOA 3NXCA 2ZB9A 5D18A 3DCFA 3F1BA 1JUSA 2QCOA 3BHQA 3CCYA 3SFIA 5IOZA 3O60A 2TRTA 3FK6A 4M3FA 2EH3A 2XRLA 3VIBA 3LSJA 3WHBA 4AF5A 3BR5A 3WHCA 2ZCNA 3COLA 1A6IA 4M3GA 5J1YA 5FHPA 4GFLA 3T6NA 2O7TA 2G7LA 2XGCA 1U9OA 3HE0A 3QPSA 5J1RA 4MO7A 4PXIA 3PASA 3BRUA 3S5RA 5FKLA 2REKA 5HAWA 2IAIA 3GEUA 1BJZA 2YVEA 2Y31A 5CXIA 5DAJA 2UXUA 3G1OA 3B6AA 3F0CA 3C07A 3CJDA 3VOXA 4D5CA 3BTJA 4M3DA 2XB5A 3V6GA 2G3BA 2YVHA 3IH4A 5J1UA 2PZ9A 1JT6A 3BCGA 4MXMA 3CRJA 4AUXA 4GCTA 3EGQA 2ZCXA 3FK7A 3QBMA 4D7NA 2IEKA 4CGRA 3MVPA 4B3AA 3NPIA 5D19A 3FRQA 3NNRA 5HBUA 3VW0A 5CXGA 4HKUA 4ABZA 3G7RA 1T33A 5GPCA 1RPWA 2F07A 2XPUA 5K7ZA 1VI0A 3BR0A 3CWRA 4AC0A 2RAEA 2QOPA 3ZQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1R A;  3LWJ A;  2NP5 A;  5J3L A;  3VVZ A;  3CDL A;  3RH2 A;  2UXO A;  3BT9 A;  3KKC A;  3Q0W A;  1ZKG A;  4I76 A;  3MNL A;  4ME9 A;  5F04 A;  2RAS A;  3GZI A;  2G0E A;  3IH3 A;  5F27 A;  4V2G A;  4MK6 A;  3RD3 A;  4ICH A;  4JNN A;  4JYK A;  2JK3 A;  5K58 A;  3VVY A;  3HTI A;  2XPW A;  4M3B A;  3QQA A;  4M3E A;  3VUQ A;  3VVX A;  4KWA A;  3VW2 A;  3VOK A;  4GFK A;  4W97 A;  2VPR A;  5F0F A;  2XGE A;  2HKU A;  3BNI A;  4DW6 A;  3EUP A;  3KKD A;  2JJ7 A;  1UI6 A;  3LHQ A;  3PM1 A;  1Z0X A;  2QKO A;  5GPA A;  3ZQL A;  1RKT A;  3TP0 A;  3QPL A;  3DEW A;  3Q0U A;  2OPT A;  2O7O A;  3ON2 A;  2HYT A;  2D6Y A;  3B81 A;  2V57 A;  3IUV A;  3BR6 A;  2FD5 A;  3HIM A;  2RHA A;  2I10 A;  2FJ1 A;  3LOC A;  4X1E A;  2QIB A;  3HTH A;  5K7H A;  2ID6 A;  5FKO A;  5AQC A;  2FBQ A;  3HTA A;  3BTI A;  2ZOY A;  2WV1 A;  4D7M A;  3E7Q A;  4W1U A;  3ZQI A;  1UI5 A;  4JKZ A;  5F0C A;  2IBD A;  4NEL A;  3ZQF A;  3G56 A;  2XGD A;  1T56 A;  1SGM A;  3V78 A;  2X9D A;  3BQZ A;  3O8G A;  5EZH A;  1ORK A;  3KNW A;  5H9T A;  3TP3 A;  4I6Z A;  1JTX A;  1Z77 A;  2G7G A;  1JT0 A;  1JTY A;  5FGL A;  3ZQH A;  3BTC A;  4V2F A;  5EZG A;  2HXI A;  5CW8 A;  1RKW A;  1JUP A;  3ANG A;  2HYJ A;  3DPJ A;  3Q0V A;  2NP3 A;  2NS7 A;  5IP6 A;  3PPB A;  3G1L A;  4JL3 A;  3KZ9 A;  3O8H A;  2ID3 A;  3JSJ A;  1QVT A;  4NN1 A;  2Q24 A;  2VKE A;  2XDN A;  4ACI A;  2ZCM A;  4AC6 A;  3BQY A;  1U9N A;  2FQ4 A;  2Y30 A;  4L62 A;  3VW1 A;  2NS8 A;  2OER A;  5K7F A;  3BR1 A;  5EYR A;  4UDS A;  2WUI A;  4XK4 A;  4GCK A;  2OI8 A;  2UXI A;  2XPV A;  2UXH A;  3HTJ A;  3VP5 A;  5HSZ A;  3NRG A;  3NI7 A;  3LSR A;  2IU5 A;  1QVU A;  2UXP A;  5FMP A;  3BR3 A;  2WGB A;  2HQ5 A;  1QPI A;  2NX4 A;  5EFY A;  1ZK8 A;  2G7S A;  3AQS A;  2TCT A;  4YZE A;  5GP9 A;  3LJL A;  2DG7 A;  3ANP A;  3AQT A;  3C2B A;  4D5F A;  3Q3S A;  5FKN A;  4GCL A;  5FKK A;  2X6O A;  3ON4 A;  3HGG A;  5F08 A;  3B6C A;  3P9T A;  3BJB A;  2QWT A;  2QTQ A;  2W53 A;  2DG8 A;  2GBY A;  1JUM A;  3SDG A;  2PBX A;  5D1R A;  5IOY A;  3QKX A;  2GUH A;  5FKM A;  2ZOZ A;  5F1J A;  3BR2 A;  5IPA A;  2VKV A;  3VPR A;  3G1M A;  5C4Y A;  2GEN A;  3LSP A;  2Y2Z A;  3FIW A;  2GFN A;  2OF7 A;  3BTL A;  4G12 A;  2FX0 A;  3HGY A;  5F0H A;  2DTZ A;  3IH2 A;  2HXO A;  3NXC A;  2ZB9 A;  5D18 A;  3DCF A;  3F1B A;  1JUS A;  2QCO A;  3BHQ A;  3CCY A;  3SFI A;  5IOZ A;  3O60 A;  2TRT A;  3FK6 A;  4M3F A;  2EH3 A;  2XRL A;  3VIB A;  3LSJ A;  3WHB A;  4AF5 A;  3BR5 A;  3WHC A;  2ZCN A;  3COL A;  1A6I A;  4M3G A;  5J1Y A;  5FHP A;  4GFL A;  3T6N A;  2O7T A;  2G7L A;  2XGC A;  1U9O A;  3HE0 A;  3QPS A;  5J1R A;  4MO7 A;  4PXI A;  3PAS A;  3BRU A;  3S5R A;  5FKL A;  2REK A;  5HAW A;  2IAI A;  3GEU A;  1BJZ A;  2YVE A;  2Y31 A;  5CXI A;  5DAJ A;  2UXU A;  3G1O A;  3B6A A;  3F0C A;  3C07 A;  3CJD A;  3VOX A;  4D5C A;  3BTJ A;  4M3D A;  2XB5 A;  3V6G A;  2G3B A;  2YVH A;  3IH4 A;  5J1U A;  2PZ9 A;  1JT6 A;  3BCG A;  4MXM A;  3CRJ A;  4AUX A;  4GCT A;  3EGQ A;  2ZCX A;  3FK7 A;  3QBM A;  4D7N A;  2IEK A;  4CGR A;  3MVP A;  4B3A A;  3NPI A;  5D19 A;  3FRQ A;  3NNR A;  5HBU A;  3VW0 A;  5CXG A;  4HKU A;  4ABZ A;  3G7R A;  1T33 A;  5GPC A;  1RPW A;  2F07 A;  2XPU A;  5K7Z A;  1VI0 A;  3BR0 A;  3CWR A;  4AC0 A;  2RAE A;  2QOP A;  3ZQG A; 
#chains in the Genus database with same CATH topology
 4B1R A;  3LWJ A;  2NP5 A;  5J3L A;  3VVZ A;  3CDL A;  3RH2 A;  2UXO A;  3BT9 A;  3KKC A;  3Q0W A;  1ZKG A;  2R7U A;  4I76 A;  3MNL A;  4ME9 A;  5F04 A;  3NS4 A;  2ZY9 A;  2RAS A;  2A2F X;  3GZI A;  2G0E A;  3IH3 A;  5F27 A;  4V2G A;  4MK6 A;  3RD3 A;  4ICH A;  4JNN A;  4JYK A;  2JK3 A;  5K58 A;  3VVY A;  3HTI A;  2XPW A;  4M3B A;  3QQA A;  4M3E A;  3VUQ A;  3VVX A;  2R7W A;  4KWA A;  3VW2 A;  3VOK A;  2B3W A;  4GFK A;  4W97 A;  2VPR A;  5F0F A;  2XGE A;  2HKU A;  3BNI A;  4DW6 A;  3EUP A;  3KKD A;  2JJ7 A;  1UI6 A;  3LHQ A;  3KYL A;  3PM1 A;  1Z0X A;  2QKO A;  5GPA A;  3ZQL A;  1RKT A;  3TP0 A;  3QPL A;  3DEW A;  3Q0U A;  2OPT A;  2FJI 1;  2O7O A;  3ON2 A;  2HYT A;  2D6Y A;  3B81 A;  2V57 A;  3IUV A;  3BR6 A;  2FD5 A;  3HIM A;  2RHA A;  2I10 A;  2FJ1 A;  3LOC A;  4X1E A;  2QIB A;  3HTH A;  5K7H A;  4C2M A;  2ID6 A;  5FKO A;  5AQC A;  2FBQ A;  3HTA A;  3BTI A;  2ZOY A;  2WV1 A;  4D7M A;  3E7Q A;  4W1U A;  3ZQI A;  1UI5 A;  4JKZ A;  5F0C A;  2IBD A;  4NEL A;  3ZQF A;  3G56 A;  2XGD A;  1T56 A;  1SGM A;  3V78 A;  2X9D A;  3BQZ A;  3O8G A;  5EZH A;  1ORK A;  3KNW A;  5H9T A;  3TP3 A;  4I6Z A;  1JTX A;  1Z77 A;  2G7G A;  4OD5 A;  1JT0 A;  4IRV A;  1JTY A;  5FGL A;  3ZQH A;  3K8P C;  3BTC A;  4DVY P;  4V2F A;  5EZG A;  2HXI A;  5CW8 A;  1RKW A;  1JUP A;  3ANG A;  2HYJ A;  3DPJ A;  3Q0V A;  2NP3 A;  2NS7 A;  5IP6 A;  3PPB A;  3G1L A;  4JL3 A;  3KZ9 A;  3O8H A;  2ID3 A;  3JSJ A;  1QVT A;  4NN1 A;  2Q24 A;  2VKE A;  3DU6 A;  2XDN A;  4ACI A;  2ZCM A;  4AC6 A;  3BQY A;  1U9N A;  2FQ4 A;  2Y30 A;  4L62 A;  3VW1 A;  3VTI A;  2NS8 A;  2OER A;  5K7F A;  3BR1 A;  5EYR A;  4UDS A;  2WUI A;  4XK4 A;  4GCK A;  2OI8 A;  2UXI A;  2XPV A;  2UXH A;  3HTJ A;  3VP5 A;  2R7R A;  5HSZ A;  3NRG A;  3NI7 A;  3LSR A;  2IU5 A;  1QVU A;  2UXP A;  5FMP A;  3BR3 A;  2WGB A;  2HQ5 A;  1QPI A;  3SWH A;  2NX4 A;  5EFY A;  1ZK8 A;  2G7S A;  3AQS A;  2TCT A;  4YZE A;  5GP9 A;  3LJL A;  2DG7 A;  3ANP A;  3AQT A;  3C2B A;  4D5F A;  3Q3S A;  5FKN A;  4GCL A;  5FKK A;  2X6O A;  3ON4 A;  3HGG A;  3DU5 A;  5F08 A;  3B6C A;  3P9T A;  3BJB A;  2QWT A;  2QTQ A;  2R7Q A;  2W53 A;  2DG8 A;  2GBY A;  1JUM A;  3SDG A;  2PBX A;  5D1R A;  5IOY A;  2R7X A;  3QKX A;  2GUH A;  5FKM A;  2ZOZ A;  5F1J A;  3BR2 A;  5IPA A;  2VKV A;  3VPR A;  3G1M A;  5C4Y A;  2GEN A;  3LSP A;  2R7T A;  2R7O A;  2Y2Z A;  3FIW A;  2GFN A;  2OF7 A;  3BTL A;  4G12 A;  2FX0 A;  3HGY A;  5F0H A;  2DTZ A;  3IH2 A;  2HXO A;  3NXC A;  2ZB9 A;  2PFV A;  5D18 A;  3DCF A;  3F1B A;  1JUS A;  2QCO A;  3BHQ A;  3CCY A;  3SFI A;  5IOZ A;  3O60 A;  2TRT A;  3FK6 A;  2R7S A;  4M3F A;  2EH3 A;  2XRL A;  3VIB A;  3LSJ A;  3WHB A;  4AF5 A;  3BR5 A;  3WHC A;  2ZCN A;  4U9L A;  3COL A;  1A6I A;  4M3G A;  5J1Y A;  5FHP A;  4GFL A;  3T6N A;  2O7T A;  2G7L A;  2XGC A;  1U9O A;  3HE0 A;  3QPS A;  5J1R A;  4MO7 A;  4PXI A;  3PAS A;  2R7V A;  3BRU A;  4WIB A;  3S5R A;  5FKL A;  2REK A;  5HAW A;  2IAI A;  3GEU A;  1BJZ A;  2YVE A;  2Y31 A;  5CXI A;  3FHN A;  5DAJ A;  2UXU A;  3G1O A;  3B6A A;  3F0C A;  3C07 A;  3CJD A;  3VOX A;  4D5C A;  3BTJ A;  4M3D A;  2XB5 A;  3V6G A;  2G3B A;  2YVH A;  3IH4 A;  5J1U A;  2PZ9 A;  1JT6 A;  3BCG A;  4MXM A;  3CRJ A;  4AUX A;  4OD4 A;  4GCT A;  3EGQ A;  2ZCX A;  3FK7 A;  3QBM A;  4D7N A;  2IEK A;  4CGR A;  3MVP A;  2YVX A;  4B3A A;  3NPI A;  5D19 A;  3FRQ A;  3NNR A;  5HBU A;  3VW0 A;  5CXG A;  4HKU A;  4ABZ A;  3G7R A;  1T33 A;  5GPC A;  1RPW A;  2F07 A;  4U9N A;  2XPU A;  5K7Z A;  1VI0 A;  3BR0 A;  2B1E A;  3CWR A;  4AC0 A;  2RAE A;  2QOP A;  5CQG A;  3ZQG A; 
#chains in the Genus database with same CATH homology
 4B1R A;  3LWJ A;  2NP5 A;  5J3L A;  3VVZ A;  3CDL A;  3RH2 A;  2UXO A;  3BT9 A;  3KKC A;  3Q0W A;  1ZKG A;  4I76 A;  3MNL A;  4ME9 A;  5F04 A;  2RAS A;  3GZI A;  2G0E A;  3IH3 A;  5F27 A;  4V2G A;  4MK6 A;  3RD3 A;  4ICH A;  4JNN A;  4JYK A;  2JK3 A;  5K58 A;  3VVY A;  3HTI A;  2XPW A;  4M3B A;  3QQA A;  4M3E A;  3VUQ A;  3VVX A;  4KWA A;  3VW2 A;  3VOK A;  4GFK A;  4W97 A;  2VPR A;  5F0F A;  2XGE A;  2HKU A;  3BNI A;  4DW6 A;  3EUP A;  3KKD A;  2JJ7 A;  1UI6 A;  3LHQ A;  3PM1 A;  1Z0X A;  2QKO A;  5GPA A;  3ZQL A;  1RKT A;  3TP0 A;  3QPL A;  3DEW A;  3Q0U A;  2OPT A;  2O7O A;  3ON2 A;  2HYT A;  2D6Y A;  3B81 A;  2V57 A;  3IUV A;  3BR6 A;  2FD5 A;  3HIM A;  2RHA A;  2I10 A;  2FJ1 A;  3LOC A;  4X1E A;  2QIB A;  3HTH A;  5K7H A;  2ID6 A;  5FKO A;  5AQC A;  2FBQ A;  3HTA A;  3BTI A;  2ZOY A;  2WV1 A;  4D7M A;  3E7Q A;  4W1U A;  3ZQI A;  1UI5 A;  4JKZ A;  5F0C A;  2IBD A;  4NEL A;  3ZQF A;  3G56 A;  2XGD A;  1T56 A;  1SGM A;  3V78 A;  2X9D A;  3BQZ A;  3O8G A;  5EZH A;  1ORK A;  3KNW A;  5H9T A;  3TP3 A;  4I6Z A;  1JTX A;  1Z77 A;  2G7G A;  1JT0 A;  1JTY A;  5FGL A;  3ZQH A;  3BTC A;  4V2F A;  5EZG A;  2HXI A;  5CW8 A;  1RKW A;  1JUP A;  3ANG A;  2HYJ A;  3DPJ A;  3Q0V A;  2NP3 A;  2NS7 A;  5IP6 A;  3PPB A;  3G1L A;  4JL3 A;  3KZ9 A;  3O8H A;  2ID3 A;  3JSJ A;  1QVT A;  4NN1 A;  2Q24 A;  2VKE A;  2XDN A;  4ACI A;  2ZCM A;  4AC6 A;  3BQY A;  1U9N A;  2FQ4 A;  2Y30 A;  4L62 A;  3VW1 A;  2NS8 A;  2OER A;  5K7F A;  3BR1 A;  5EYR A;  4UDS A;  2WUI A;  4XK4 A;  4GCK A;  2OI8 A;  2UXI A;  2XPV A;  2UXH A;  3HTJ A;  3VP5 A;  5HSZ A;  3NRG A;  3NI7 A;  3LSR A;  2IU5 A;  1QVU A;  2UXP A;  5FMP A;  3BR3 A;  2WGB A;  2HQ5 A;  1QPI A;  2NX4 A;  5EFY A;  1ZK8 A;  2G7S A;  3AQS A;  2TCT A;  4YZE A;  5GP9 A;  3LJL A;  2DG7 A;  3ANP A;  3AQT A;  3C2B A;  4D5F A;  3Q3S A;  5FKN A;  4GCL A;  5FKK A;  2X6O A;  3ON4 A;  3HGG A;  5F08 A;  3B6C A;  3P9T A;  3BJB A;  2QWT A;  2QTQ A;  2W53 A;  2DG8 A;  2GBY A;  1JUM A;  3SDG A;  2PBX A;  5D1R A;  5IOY A;  3QKX A;  2GUH A;  5FKM A;  2ZOZ A;  5F1J A;  3BR2 A;  5IPA A;  2VKV A;  3VPR A;  3G1M A;  5C4Y A;  2GEN A;  3LSP A;  2Y2Z A;  3FIW A;  2GFN A;  2OF7 A;  3BTL A;  4G12 A;  2FX0 A;  3HGY A;  5F0H A;  2DTZ A;  3IH2 A;  2HXO A;  3NXC A;  2ZB9 A;  5D18 A;  3DCF A;  3F1B A;  1JUS A;  2QCO A;  3BHQ A;  3CCY A;  3SFI A;  5IOZ A;  3O60 A;  2TRT A;  3FK6 A;  4M3F A;  2EH3 A;  2XRL A;  3VIB A;  3LSJ A;  3WHB A;  4AF5 A;  3BR5 A;  3WHC A;  2ZCN A;  3COL A;  1A6I A;  4M3G A;  5J1Y A;  5FHP A;  4GFL A;  3T6N A;  2O7T A;  2G7L A;  2XGC A;  1U9O A;  3HE0 A;  3QPS A;  5J1R A;  4MO7 A;  4PXI A;  3PAS A;  3BRU A;  3S5R A;  5FKL A;  2REK A;  5HAW A;  2IAI A;  3GEU A;  1BJZ A;  2YVE A;  2Y31 A;  5CXI A;  5DAJ A;  2UXU A;  3G1O A;  3B6A A;  3F0C A;  3C07 A;  3CJD A;  3VOX A;  4D5C A;  3BTJ A;  4M3D A;  2XB5 A;  3V6G A;  2G3B A;  2YVH A;  3IH4 A;  5J1U A;  2PZ9 A;  1JT6 A;  3BCG A;  4MXM A;  3CRJ A;  4AUX A;  4GCT A;  3EGQ A;  2ZCX A;  3FK7 A;  3QBM A;  4D7N A;  2IEK A;  4CGR A;  3MVP A;  4B3A A;  3NPI A;  5D19 A;  3FRQ A;  3NNR A;  5HBU A;  3VW0 A;  5CXG A;  4HKU A;  4ABZ A;  3G7R A;  1T33 A;  5GPC A;  1RPW A;  2F07 A;  2XPU A;  5K7Z A;  1VI0 A;  3BR0 A;  3CWR A;  4AC0 A;  2RAE A;  2QOP A;  3ZQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...