3DPJA

The crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
194
structure length
194
Chain Sequence
SNAMVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQMLADWQGTGDSPRARIASFIDLMIMNRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEAGCTTEAPALAMHLLARSQGAATLAQSFHDEGFLRSEVADMHRWLDNTLPMTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator, TetR family
publication title The crystal structure of a TetR transcription regulator from Silicibacter pomeroyi DSS
rcsb
source organism Silicibacter pomeroyi
molecule tags Dna binding protein
total genus 69
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dpjA00
2IEKA 3G1MA 5F27A 2TCTA 1RKWA 4B3AA 5FHPA 3MVPA 2G7SA 3CCYA 5IOYA 2RHAA 4M3FA 5IOZA 2HKUA 3VOXA 3CWRA 4UDSA 3MNLA 2ZCMA 1VI0A 3BTJA 4ABZA 2REKA 4JYKA 5HAWA 2Q24A 5EFYA 3VOKA 2ZB9A 4M3GA 4JKZA 4M3EA 4NELA 5F08A 2DG8A 1QPIA 2HQ5A 2IU5A 3HTJA 2G7GA 2WV1A 3FIWA 5FKOA 3G7RA 4AF5A 1UI6A 4YZEA 4L62A 3O8GA 1RKTA 2VKVA 3VW2A 3F1BA 2XDNA 3B81A 4JL3A 3C07A 3QPSA 1ORKA 3CJDA 3HGYA 3DCFA 5IP6A 2ID6A 5F0HA 5D18A 3JSJA 4XK4A 5HBUA 2X6OA 5GP9A 3BT9A 3V6GA 2ZOZA 3QQAA 4HKUA 1Z0XA 5F0CA 3EUPA 1QVUA 3IH3A 4D5FA 3KKCA 5F1JA 3BR3A 1U9NA 2NS7A 5J3LA 3BQYA 2PBXA 2NP3A 3Q3SA 3B6AA 3DPJA 4AC6A 2FX0A 3CDLA 3Q0UA 1T56A 3HTHA 1RPWA 3VW0A 3GZIA 1ZKGA 4ICHA 2QCOA 2QWTA 2GFNA 4W97A 2UXUA 3BR5A 4M3DA 3ANPA 2GBYA 3VUQA 5CXIA 3DEWA 2ID3A 3BJBA 5EZHA 4B1RA 5CXGA 3IH4A 2NX4A 3LSRA 2IAIA 2VKEA 4V2FA 2W53A 2F07A 5F04A 3HE0A 3IUVA 1BJZA 2JK3A 3LOCA 4NN1A 3O8HA 3KKDA 3VW1A 3VVXA 2NS8A 3HTIA 2XRLA 2DG7A 2Y2ZA 3KNWA 3NNRA 2QTQA 4ME9A 2Y31A 3LSJA 5FMPA 3LJLA 5J1RA 3VVYA 3VP5A 2FQ4A 2HXIA 2DTZA 3HIMA 3PM1A 2RASA 2OPTA 3KZ9A 1UI5A 3ZQGA 4GFKA 3BTLA 2X9DA 3SFIA 1JUMA 3BR1A 3BNIA 3C2BA 2XPUA 2YVHA 5FKNA 3TP3A 3FK7A 2ZCNA 3PASA 2QIBA 1JUPA 5FKMA 3Q0WA 2G0EA 3P9TA 5K58A 3BRUA 4I76A 1T33A 3BR6A 2D6YA 2OF7A 4X1EA 3ZQHA 1QVTA 3Q0VA 3VIBA 2XB5A 2RAEA 5HSZA 4G12A 5C4YA 2GUHA 4AC0A 5D1RA 3NPIA 5D19A 3WHBA 3BR0A 4MXMA 4GFLA 3E7QA 3ZQIA 2VPRA 4D7MA 2ZOYA 2XGEA 3QPLA 3BHQA 3NRGA 3BCGA 3ON2A 2IBDA 3RD3A 3COLA 3ON4A 2JJ7A 2EH3A 1JTYA 5GPCA 4GCLA 3FRQA 5J1UA 5K7HA 3RH2A 3FK6A 2ZCXA 4W1UA 5IPAA 1SGMA 1JUSA 3T6NA 3HGGA 3SDGA 4CGRA 5CW8A 4V2GA 2QOPA 3O60A 3CRJA 2Y30A 3G1LA 5FGLA 2UXIA 3VPRA 2V57A 2HYJA 2GENA 4GCKA 3ANGA 5K7FA 4I6ZA 3GEUA 3HTAA 4KWAA 1Z77A 4D7NA 2O7OA 1ZK8A 4JNNA 3QBMA 2OI8A 2HYTA 4GCTA 3S5RA 2FD5A 3IH2A 5J1YA 3LSPA 1U9OA 3V78A 3BTIA 3BTCA 1JT0A 4DW6A 2G3BA 1JTXA 2G7LA 2YVEA 3QKXA 2HXOA 3VVZA 5F0FA 4AUXA 4MO7A 5DAJA 2FBQA 3PPBA 3ZQFA 2OERA 3ZQLA 2XGDA 4D5CA 3AQSA 2FJ1A 3TP0A 3AQTA 5EYRA 3G56A 2TRTA 1JT6A 2O7TA 3NI7A 3LHQA 5H9TA 5EZGA 2PZ9A 3G1OA 5FKKA 3WHCA 5AQCA 3BQZA 5GPAA 5FKLA 4ACIA 4M3BA 2WUIA 3BR2A 2XGCA 2XPVA 2UXOA 2UXPA 2NP5A 4MK6A 3F0CA 4PXIA 2QKOA 3B6CA 2WGBA 5K7ZA 1A6IA 3EGQA 2XPWA 3LWJA 2I10A 3NXCA 2UXHA
chains in the Genus database with same CATH superfamily
2IEKA 3G1MA 5F27A 2R7QA 2TCTA 1RKWA 4B3AA 5FHPA 3MVPA 2G7SA 2R7WA 3CCYA 5IOYA 2RHAA 4M3FA 5IOZA 2HKUA 3VOXA 5CQGA 3CWRA 4UDSA 3MNLA 3K8PC 2ZCMA 1VI0A 4U9LA 3BTJA 4C2MA 4ABZA 4IRVA 2REKA 4JYKA 5HAWA 2Q24A 5EFYA 3VOKA 2ZB9A 4M3GA 4JKZA 4M3EA 4NELA 5F08A 2DG8A 1QPIA 2HQ5A 2IU5A 3HTJA 2G7GA 2WV1A 3FIWA 5FKOA 3G7RA 4AF5A 1UI6A 4YZEA 4L62A 3O8GA 1RKTA 2VKVA 3VW2A 3F1BA 2XDNA 3B81A 4JL3A 3C07A 3QPSA 1ORKA 3CJDA 3HGYA 2R7VA 3DCFA 5IP6A 4OD5A 2ID6A 5F0HA 5D18A 3JSJA 4XK4A 5HBUA 2X6OA 5GP9A 3BT9A 3V6GA 2R7SA 2ZOZA 3QQAA 4HKUA 1Z0XA 5F0CA 3EUPA 1QVUA 3IH3A 4D5FA 3KKCA 5F1JA 3BR3A 1U9NA 2A2FX 2NS7A 5J3LA 3BQYA 2PBXA 2NP3A 3Q3SA 3B6AA 3DPJA 4AC6A 2FX0A 2B1EA 3CDLA 3Q0UA 1T56A 3HTHA 1RPWA 3VW0A 3GZIA 1ZKGA 4ICHA 2QCOA 2QWTA 2GFNA 4W97A 2UXUA 3BR5A 4M3DA 3ANPA 2R7UA 2GBYA 3VUQA 5CXIA 3DEWA 2ID3A 3BJBA 5EZHA 4B1RA 5CXGA 3IH4A 2NX4A 3LSRA 2IAIA 2VKEA 4V2FA 2W53A 2F07A 5F04A 3HE0A 3IUVA 1BJZA 2JK3A 3LOCA 4NN1A 3O8HA 3KKDA 3VW1A 3VVXA 2NS8A 3HTIA 2XRLA 2DG7A 2Y2ZA 3KNWA 3NNRA 2QTQA 4ME9A 2Y31A 3LSJA 5FMPA 3LJLA 5J1RA 3VVYA 3VP5A 2FQ4A 2HXIA 2DTZA 3HIMA 3PM1A 2RASA 2OPTA 3DU6A 3KZ9A 2B3WA 1UI5A 3ZQGA 4GFKA 3BTLA 2X9DA 3SFIA 1JUMA 3BR1A 3BNIA 3C2BA 2XPUA 2YVHA 5FKNA 3TP3A 3FK7A 2ZCNA 3PASA 2QIBA 1JUPA 5FKMA 2ZY9A 3Q0WA 2G0EA 2R7RA 3P9TA 5K58A 3BRUA 4I76A 1T33A 3BR6A 3KYLA 2D6YA 2OF7A 4X1EA 3ZQHA 1QVTA 3Q0VA 3VIBA 2XB5A 2RAEA 5HSZA 4G12A 5C4YA 2GUHA 4AC0A 5D1RA 3NPIA 5D19A 3WHBA 3BR0A 4MXMA 4GFLA 3E7QA 3ZQIA 2VPRA 4D7MA 2ZOYA 4DVYP 2XGEA 3QPLA 3BHQA 3NRGA 3BCGA 3ON2A 2IBDA 3RD3A 3COLA 3ON4A 2JJ7A 2EH3A 1JTYA 4U9NA 5GPCA 3SWHA 4GCLA 3FRQA 5J1UA 5K7HA 3RH2A 3FK6A 2ZCXA 2R7OA 4W1UA 5IPAA 2R7TA 1SGMA 1JUSA 3T6NA 3HGGA 3SDGA 4CGRA 5CW8A 4V2GA 2QOPA 3O60A 3CRJA 2Y30A 3G1LA 2YVXA 5FGLA 2UXIA 3VPRA 2V57A 4WIBA 2HYJA 2GENA 4GCKA 3ANGA 5K7FA 4I6ZA 3GEUA 3HTAA 4KWAA 1Z77A 4D7NA 2O7OA 1ZK8A 4JNNA 3QBMA 2OI8A 2HYTA 4GCTA 3S5RA 2FD5A 3FHNA 3IH2A 2PFVA 5J1YA 3LSPA 1U9OA 3V78A 3BTIA 3BTCA 1JT0A 4DW6A 2G3BA 1JTXA 2G7LA 2YVEA 3QKXA 2HXOA 3VVZA 5F0FA 4AUXA 4MO7A 5DAJA 2FBQA 3PPBA 3ZQFA 2OERA 3ZQLA 2XGDA 4D5CA 3AQSA 2FJ1A 3TP0A 3AQTA 5EYRA 3G56A 2TRTA 1JT6A 2O7TA 3NI7A 3LHQA 5H9TA 2FJI1 4OD4A 5EZGA 2PZ9A 3G1OA 5FKKA 3WHCA 5AQCA 3BQZA 5GPAA 3VTIA 5FKLA 3NS4A 4ACIA 4M3BA 2R7XA 2WUIA 3BR2A 2XGCA 2XPVA 2UXOA 2UXPA 2NP5A 4MK6A 3F0CA 4PXIA 2QKOA 3B6CA 2WGBA 5K7ZA 1A6IA 3EGQA 2XPWA 3LWJA 2I10A 3DU5A 3NXCA 2UXHA
chains in the Genus database with same CATH topology
2IEKA 3G1MA 5F27A 2TCTA 1RKWA 4B3AA 5FHPA 3MVPA 2G7SA 3CCYA 5IOYA 2RHAA 4M3FA 5IOZA 2HKUA 3VOXA 3CWRA 4UDSA 3MNLA 2ZCMA 1VI0A 3BTJA 4ABZA 2REKA 4JYKA 5HAWA 2Q24A 5EFYA 3VOKA 2ZB9A 4M3GA 4JKZA 4M3EA 4NELA 5F08A 2DG8A 1QPIA 2HQ5A 2IU5A 3HTJA 2G7GA 2WV1A 3FIWA 5FKOA 3G7RA 4AF5A 1UI6A 4YZEA 4L62A 3O8GA 1RKTA 2VKVA 3VW2A 3F1BA 2XDNA 3B81A 4JL3A 3C07A 3QPSA 1ORKA 3CJDA 3HGYA 3DCFA 5IP6A 2ID6A 5F0HA 5D18A 3JSJA 4XK4A 5HBUA 2X6OA 5GP9A 3BT9A 3V6GA 2ZOZA 3QQAA 4HKUA 1Z0XA 5F0CA 3EUPA 1QVUA 3IH3A 4D5FA 3KKCA 5F1JA 3BR3A 1U9NA 2NS7A 5J3LA 3BQYA 2PBXA 2NP3A 3Q3SA 3B6AA 3DPJA 4AC6A 2FX0A 3CDLA 3Q0UA 1T56A 3HTHA 1RPWA 3VW0A 3GZIA 1ZKGA 4ICHA 2QCOA 2QWTA 2GFNA 4W97A 2UXUA 3BR5A 4M3DA 3ANPA 2GBYA 3VUQA 5CXIA 3DEWA 2ID3A 3BJBA 5EZHA 4B1RA 5CXGA 3IH4A 2NX4A 3LSRA 2IAIA 2VKEA 4V2FA 2W53A 2F07A 5F04A 3HE0A 3IUVA 1BJZA 2JK3A 3LOCA 4NN1A 3O8HA 3KKDA 3VW1A 3VVXA 2NS8A 3HTIA 2XRLA 2DG7A 2Y2ZA 3KNWA 3NNRA 2QTQA 4ME9A 2Y31A 3LSJA 5FMPA 3LJLA 5J1RA 3VVYA 3VP5A 2FQ4A 2HXIA 2DTZA 3HIMA 3PM1A 2RASA 2OPTA 3KZ9A 1UI5A 3ZQGA 4GFKA 3BTLA 2X9DA 3SFIA 1JUMA 3BR1A 3BNIA 3C2BA 2XPUA 2YVHA 5FKNA 3TP3A 3FK7A 2ZCNA 3PASA 2QIBA 1JUPA 5FKMA 3Q0WA 2G0EA 3P9TA 5K58A 3BRUA 4I76A 1T33A 3BR6A 2D6YA 2OF7A 4X1EA 3ZQHA 1QVTA 3Q0VA 3VIBA 2XB5A 2RAEA 5HSZA 4G12A 5C4YA 2GUHA 4AC0A 5D1RA 3NPIA 5D19A 3WHBA 3BR0A 4MXMA 4GFLA 3E7QA 3ZQIA 2VPRA 4D7MA 2ZOYA 2XGEA 3QPLA 3BHQA 3NRGA 3BCGA 3ON2A 2IBDA 3RD3A 3COLA 3ON4A 2JJ7A 2EH3A 1JTYA 5GPCA 4GCLA 3FRQA 5J1UA 5K7HA 3RH2A 3FK6A 2ZCXA 4W1UA 5IPAA 1SGMA 1JUSA 3T6NA 3HGGA 3SDGA 4CGRA 5CW8A 4V2GA 2QOPA 3O60A 3CRJA 2Y30A 3G1LA 5FGLA 2UXIA 3VPRA 2V57A 2HYJA 2GENA 4GCKA 3ANGA 5K7FA 4I6ZA 3GEUA 3HTAA 4KWAA 1Z77A 4D7NA 2O7OA 1ZK8A 4JNNA 3QBMA 2OI8A 2HYTA 4GCTA 3S5RA 2FD5A 3IH2A 5J1YA 3LSPA 1U9OA 3V78A 3BTIA 3BTCA 1JT0A 4DW6A 2G3BA 1JTXA 2G7LA 2YVEA 3QKXA 2HXOA 3VVZA 5F0FA 4AUXA 4MO7A 5DAJA 2FBQA 3PPBA 3ZQFA 2OERA 3ZQLA 2XGDA 4D5CA 3AQSA 2FJ1A 3TP0A 3AQTA 5EYRA 3G56A 2TRTA 1JT6A 2O7TA 3NI7A 3LHQA 5H9TA 5EZGA 2PZ9A 3G1OA 5FKKA 3WHCA 5AQCA 3BQZA 5GPAA 5FKLA 4ACIA 4M3BA 2WUIA 3BR2A 2XGCA 2XPVA 2UXOA 2UXPA 2NP5A 4MK6A 3F0CA 4PXIA 2QKOA 3B6CA 2WGBA 5K7ZA 1A6IA 3EGQA 2XPWA 3LWJA 2I10A 3NXCA 2UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEK A;  3G1M A;  5F27 A;  2TCT A;  1RKW A;  4B3A A;  5FHP A;  3MVP A;  2G7S A;  3CCY A;  5IOY A;  2RHA A;  4M3F A;  5IOZ A;  2HKU A;  3VOX A;  3CWR A;  4UDS A;  3MNL A;  2ZCM A;  1VI0 A;  3BTJ A;  4ABZ A;  2REK A;  4JYK A;  5HAW A;  2Q24 A;  5EFY A;  3VOK A;  2ZB9 A;  4M3G A;  4JKZ A;  4M3E A;  4NEL A;  5F08 A;  2DG8 A;  1QPI A;  2HQ5 A;  2IU5 A;  3HTJ A;  2G7G A;  2WV1 A;  3FIW A;  5FKO A;  3G7R A;  4AF5 A;  1UI6 A;  4YZE A;  4L62 A;  3O8G A;  1RKT A;  2VKV A;  3VW2 A;  3F1B A;  2XDN A;  3B81 A;  4JL3 A;  3C07 A;  3QPS A;  1ORK A;  3CJD A;  3HGY A;  3DCF A;  5IP6 A;  2ID6 A;  5F0H A;  5D18 A;  3JSJ A;  4XK4 A;  5HBU A;  2X6O A;  5GP9 A;  3BT9 A;  3V6G A;  2ZOZ A;  3QQA A;  4HKU A;  1Z0X A;  5F0C A;  3EUP A;  1QVU A;  3IH3 A;  4D5F A;  3KKC A;  5F1J A;  3BR3 A;  1U9N A;  2NS7 A;  5J3L A;  3BQY A;  2PBX A;  2NP3 A;  3Q3S A;  3B6A A;  3DPJ A;  4AC6 A;  2FX0 A;  3CDL A;  3Q0U A;  1T56 A;  3HTH A;  1RPW A;  3VW0 A;  3GZI A;  1ZKG A;  4ICH A;  2QCO A;  2QWT A;  2GFN A;  4W97 A;  2UXU A;  3BR5 A;  4M3D A;  3ANP A;  2GBY A;  3VUQ A;  5CXI A;  3DEW A;  2ID3 A;  3BJB A;  5EZH A;  4B1R A;  5CXG A;  3IH4 A;  2NX4 A;  3LSR A;  2IAI A;  2VKE A;  4V2F A;  2W53 A;  2F07 A;  5F04 A;  3HE0 A;  3IUV A;  1BJZ A;  2JK3 A;  3LOC A;  4NN1 A;  3O8H A;  3KKD A;  3VW1 A;  3VVX A;  2NS8 A;  3HTI A;  2XRL A;  2DG7 A;  2Y2Z A;  3KNW A;  3NNR A;  2QTQ A;  4ME9 A;  2Y31 A;  3LSJ A;  5FMP A;  3LJL A;  5J1R A;  3VVY A;  3VP5 A;  2FQ4 A;  2HXI A;  2DTZ A;  3HIM A;  3PM1 A;  2RAS A;  2OPT A;  3KZ9 A;  1UI5 A;  3ZQG A;  4GFK A;  3BTL A;  2X9D A;  3SFI A;  1JUM A;  3BR1 A;  3BNI A;  3C2B A;  2XPU A;  2YVH A;  5FKN A;  3TP3 A;  3FK7 A;  2ZCN A;  3PAS A;  2QIB A;  1JUP A;  5FKM A;  3Q0W A;  2G0E A;  3P9T A;  5K58 A;  3BRU A;  4I76 A;  1T33 A;  3BR6 A;  2D6Y A;  2OF7 A;  4X1E A;  3ZQH A;  1QVT A;  3Q0V A;  3VIB A;  2XB5 A;  2RAE A;  5HSZ A;  4G12 A;  5C4Y A;  2GUH A;  4AC0 A;  5D1R A;  3NPI A;  5D19 A;  3WHB A;  3BR0 A;  4MXM A;  4GFL A;  3E7Q A;  3ZQI A;  2VPR A;  4D7M A;  2ZOY A;  2XGE A;  3QPL A;  3BHQ A;  3NRG A;  3BCG A;  3ON2 A;  2IBD A;  3RD3 A;  3COL A;  3ON4 A;  2JJ7 A;  2EH3 A;  1JTY A;  5GPC A;  4GCL A;  3FRQ A;  5J1U A;  5K7H A;  3RH2 A;  3FK6 A;  2ZCX A;  4W1U A;  5IPA A;  1SGM A;  1JUS A;  3T6N A;  3HGG A;  3SDG A;  4CGR A;  5CW8 A;  4V2G A;  2QOP A;  3O60 A;  3CRJ A;  2Y30 A;  3G1L A;  5FGL A;  2UXI A;  3VPR A;  2V57 A;  2HYJ A;  2GEN A;  4GCK A;  3ANG A;  5K7F A;  4I6Z A;  3GEU A;  3HTA A;  4KWA A;  1Z77 A;  4D7N A;  2O7O A;  1ZK8 A;  4JNN A;  3QBM A;  2OI8 A;  2HYT A;  4GCT A;  3S5R A;  2FD5 A;  3IH2 A;  5J1Y A;  3LSP A;  1U9O A;  3V78 A;  3BTI A;  3BTC A;  1JT0 A;  4DW6 A;  2G3B A;  1JTX A;  2G7L A;  2YVE A;  3QKX A;  2HXO A;  3VVZ A;  5F0F A;  4AUX A;  4MO7 A;  5DAJ A;  2FBQ A;  3PPB A;  3ZQF A;  2OER A;  3ZQL A;  2XGD A;  4D5C A;  3AQS A;  2FJ1 A;  3TP0 A;  3AQT A;  5EYR A;  3G56 A;  2TRT A;  1JT6 A;  2O7T A;  3NI7 A;  3LHQ A;  5H9T A;  5EZG A;  2PZ9 A;  3G1O A;  5FKK A;  3WHC A;  5AQC A;  3BQZ A;  5GPA A;  5FKL A;  4ACI A;  4M3B A;  2WUI A;  3BR2 A;  2XGC A;  2XPV A;  2UXO A;  2UXP A;  2NP5 A;  4MK6 A;  3F0C A;  4PXI A;  2QKO A;  3B6C A;  2WGB A;  5K7Z A;  1A6I A;  3EGQ A;  2XPW A;  3LWJ A;  2I10 A;  3NXC A;  2UXH A; 
#chains in the Genus database with same CATH topology
 2IEK A;  3G1M A;  5F27 A;  2R7Q A;  2TCT A;  1RKW A;  4B3A A;  5FHP A;  3MVP A;  2G7S A;  2R7W A;  3CCY A;  5IOY A;  2RHA A;  4M3F A;  5IOZ A;  2HKU A;  3VOX A;  5CQG A;  3CWR A;  4UDS A;  3MNL A;  3K8P C;  2ZCM A;  1VI0 A;  4U9L A;  3BTJ A;  4C2M A;  4ABZ A;  4IRV A;  2REK A;  4JYK A;  5HAW A;  2Q24 A;  5EFY A;  3VOK A;  2ZB9 A;  4M3G A;  4JKZ A;  4M3E A;  4NEL A;  5F08 A;  2DG8 A;  1QPI A;  2HQ5 A;  2IU5 A;  3HTJ A;  2G7G A;  2WV1 A;  3FIW A;  5FKO A;  3G7R A;  4AF5 A;  1UI6 A;  4YZE A;  4L62 A;  3O8G A;  1RKT A;  2VKV A;  3VW2 A;  3F1B A;  2XDN A;  3B81 A;  4JL3 A;  3C07 A;  3QPS A;  1ORK A;  3CJD A;  3HGY A;  2R7V A;  3DCF A;  5IP6 A;  4OD5 A;  2ID6 A;  5F0H A;  5D18 A;  3JSJ A;  4XK4 A;  5HBU A;  2X6O A;  5GP9 A;  3BT9 A;  3V6G A;  2R7S A;  2ZOZ A;  3QQA A;  4HKU A;  1Z0X A;  5F0C A;  3EUP A;  1QVU A;  3IH3 A;  4D5F A;  3KKC A;  5F1J A;  3BR3 A;  1U9N A;  2A2F X;  2NS7 A;  5J3L A;  3BQY A;  2PBX A;  2NP3 A;  3Q3S A;  3B6A A;  3DPJ A;  4AC6 A;  2FX0 A;  2B1E A;  3CDL A;  3Q0U A;  1T56 A;  3HTH A;  1RPW A;  3VW0 A;  3GZI A;  1ZKG A;  4ICH A;  2QCO A;  2QWT A;  2GFN A;  4W97 A;  2UXU A;  3BR5 A;  4M3D A;  3ANP A;  2R7U A;  2GBY A;  3VUQ A;  5CXI A;  3DEW A;  2ID3 A;  3BJB A;  5EZH A;  4B1R A;  5CXG A;  3IH4 A;  2NX4 A;  3LSR A;  2IAI A;  2VKE A;  4V2F A;  2W53 A;  2F07 A;  5F04 A;  3HE0 A;  3IUV A;  1BJZ A;  2JK3 A;  3LOC A;  4NN1 A;  3O8H A;  3KKD A;  3VW1 A;  3VVX A;  2NS8 A;  3HTI A;  2XRL A;  2DG7 A;  2Y2Z A;  3KNW A;  3NNR A;  2QTQ A;  4ME9 A;  2Y31 A;  3LSJ A;  5FMP A;  3LJL A;  5J1R A;  3VVY A;  3VP5 A;  2FQ4 A;  2HXI A;  2DTZ A;  3HIM A;  3PM1 A;  2RAS A;  2OPT A;  3DU6 A;  3KZ9 A;  2B3W A;  1UI5 A;  3ZQG A;  4GFK A;  3BTL A;  2X9D A;  3SFI A;  1JUM A;  3BR1 A;  3BNI A;  3C2B A;  2XPU A;  2YVH A;  5FKN A;  3TP3 A;  3FK7 A;  2ZCN A;  3PAS A;  2QIB A;  1JUP A;  5FKM A;  2ZY9 A;  3Q0W A;  2G0E A;  2R7R A;  3P9T A;  5K58 A;  3BRU A;  4I76 A;  1T33 A;  3BR6 A;  3KYL A;  2D6Y A;  2OF7 A;  4X1E A;  3ZQH A;  1QVT A;  3Q0V A;  3VIB A;  2XB5 A;  2RAE A;  5HSZ A;  4G12 A;  5C4Y A;  2GUH A;  4AC0 A;  5D1R A;  3NPI A;  5D19 A;  3WHB A;  3BR0 A;  4MXM A;  4GFL A;  3E7Q A;  3ZQI A;  2VPR A;  4D7M A;  2ZOY A;  4DVY P;  2XGE A;  3QPL A;  3BHQ A;  3NRG A;  3BCG A;  3ON2 A;  2IBD A;  3RD3 A;  3COL A;  3ON4 A;  2JJ7 A;  2EH3 A;  1JTY A;  4U9N A;  5GPC A;  3SWH A;  4GCL A;  3FRQ A;  5J1U A;  5K7H A;  3RH2 A;  3FK6 A;  2ZCX A;  2R7O A;  4W1U A;  5IPA A;  2R7T A;  1SGM A;  1JUS A;  3T6N A;  3HGG A;  3SDG A;  4CGR A;  5CW8 A;  4V2G A;  2QOP A;  3O60 A;  3CRJ A;  2Y30 A;  3G1L A;  2YVX A;  5FGL A;  2UXI A;  3VPR A;  2V57 A;  4WIB A;  2HYJ A;  2GEN A;  4GCK A;  3ANG A;  5K7F A;  4I6Z A;  3GEU A;  3HTA A;  4KWA A;  1Z77 A;  4D7N A;  2O7O A;  1ZK8 A;  4JNN A;  3QBM A;  2OI8 A;  2HYT A;  4GCT A;  3S5R A;  2FD5 A;  3FHN A;  3IH2 A;  2PFV A;  5J1Y A;  3LSP A;  1U9O A;  3V78 A;  3BTI A;  3BTC A;  1JT0 A;  4DW6 A;  2G3B A;  1JTX A;  2G7L A;  2YVE A;  3QKX A;  2HXO A;  3VVZ A;  5F0F A;  4AUX A;  4MO7 A;  5DAJ A;  2FBQ A;  3PPB A;  3ZQF A;  2OER A;  3ZQL A;  2XGD A;  4D5C A;  3AQS A;  2FJ1 A;  3TP0 A;  3AQT A;  5EYR A;  3G56 A;  2TRT A;  1JT6 A;  2O7T A;  3NI7 A;  3LHQ A;  5H9T A;  2FJI 1;  4OD4 A;  5EZG A;  2PZ9 A;  3G1O A;  5FKK A;  3WHC A;  5AQC A;  3BQZ A;  5GPA A;  3VTI A;  5FKL A;  3NS4 A;  4ACI A;  4M3B A;  2R7X A;  2WUI A;  3BR2 A;  2XGC A;  2XPV A;  2UXO A;  2UXP A;  2NP5 A;  4MK6 A;  3F0C A;  4PXI A;  2QKO A;  3B6C A;  2WGB A;  5K7Z A;  1A6I A;  3EGQ A;  2XPW A;  3LWJ A;  2I10 A;  3DU5 A;  3NXC A;  2UXH A; 
#chains in the Genus database with same CATH homology
 2IEK A;  3G1M A;  5F27 A;  2TCT A;  1RKW A;  4B3A A;  5FHP A;  3MVP A;  2G7S A;  3CCY A;  5IOY A;  2RHA A;  4M3F A;  5IOZ A;  2HKU A;  3VOX A;  3CWR A;  4UDS A;  3MNL A;  2ZCM A;  1VI0 A;  3BTJ A;  4ABZ A;  2REK A;  4JYK A;  5HAW A;  2Q24 A;  5EFY A;  3VOK A;  2ZB9 A;  4M3G A;  4JKZ A;  4M3E A;  4NEL A;  5F08 A;  2DG8 A;  1QPI A;  2HQ5 A;  2IU5 A;  3HTJ A;  2G7G A;  2WV1 A;  3FIW A;  5FKO A;  3G7R A;  4AF5 A;  1UI6 A;  4YZE A;  4L62 A;  3O8G A;  1RKT A;  2VKV A;  3VW2 A;  3F1B A;  2XDN A;  3B81 A;  4JL3 A;  3C07 A;  3QPS A;  1ORK A;  3CJD A;  3HGY A;  3DCF A;  5IP6 A;  2ID6 A;  5F0H A;  5D18 A;  3JSJ A;  4XK4 A;  5HBU A;  2X6O A;  5GP9 A;  3BT9 A;  3V6G A;  2ZOZ A;  3QQA A;  4HKU A;  1Z0X A;  5F0C A;  3EUP A;  1QVU A;  3IH3 A;  4D5F A;  3KKC A;  5F1J A;  3BR3 A;  1U9N A;  2NS7 A;  5J3L A;  3BQY A;  2PBX A;  2NP3 A;  3Q3S A;  3B6A A;  3DPJ A;  4AC6 A;  2FX0 A;  3CDL A;  3Q0U A;  1T56 A;  3HTH A;  1RPW A;  3VW0 A;  3GZI A;  1ZKG A;  4ICH A;  2QCO A;  2QWT A;  2GFN A;  4W97 A;  2UXU A;  3BR5 A;  4M3D A;  3ANP A;  2GBY A;  3VUQ A;  5CXI A;  3DEW A;  2ID3 A;  3BJB A;  5EZH A;  4B1R A;  5CXG A;  3IH4 A;  2NX4 A;  3LSR A;  2IAI A;  2VKE A;  4V2F A;  2W53 A;  2F07 A;  5F04 A;  3HE0 A;  3IUV A;  1BJZ A;  2JK3 A;  3LOC A;  4NN1 A;  3O8H A;  3KKD A;  3VW1 A;  3VVX A;  2NS8 A;  3HTI A;  2XRL A;  2DG7 A;  2Y2Z A;  3KNW A;  3NNR A;  2QTQ A;  4ME9 A;  2Y31 A;  3LSJ A;  5FMP A;  3LJL A;  5J1R A;  3VVY A;  3VP5 A;  2FQ4 A;  2HXI A;  2DTZ A;  3HIM A;  3PM1 A;  2RAS A;  2OPT A;  3KZ9 A;  1UI5 A;  3ZQG A;  4GFK A;  3BTL A;  2X9D A;  3SFI A;  1JUM A;  3BR1 A;  3BNI A;  3C2B A;  2XPU A;  2YVH A;  5FKN A;  3TP3 A;  3FK7 A;  2ZCN A;  3PAS A;  2QIB A;  1JUP A;  5FKM A;  3Q0W A;  2G0E A;  3P9T A;  5K58 A;  3BRU A;  4I76 A;  1T33 A;  3BR6 A;  2D6Y A;  2OF7 A;  4X1E A;  3ZQH A;  1QVT A;  3Q0V A;  3VIB A;  2XB5 A;  2RAE A;  5HSZ A;  4G12 A;  5C4Y A;  2GUH A;  4AC0 A;  5D1R A;  3NPI A;  5D19 A;  3WHB A;  3BR0 A;  4MXM A;  4GFL A;  3E7Q A;  3ZQI A;  2VPR A;  4D7M A;  2ZOY A;  2XGE A;  3QPL A;  3BHQ A;  3NRG A;  3BCG A;  3ON2 A;  2IBD A;  3RD3 A;  3COL A;  3ON4 A;  2JJ7 A;  2EH3 A;  1JTY A;  5GPC A;  4GCL A;  3FRQ A;  5J1U A;  5K7H A;  3RH2 A;  3FK6 A;  2ZCX A;  4W1U A;  5IPA A;  1SGM A;  1JUS A;  3T6N A;  3HGG A;  3SDG A;  4CGR A;  5CW8 A;  4V2G A;  2QOP A;  3O60 A;  3CRJ A;  2Y30 A;  3G1L A;  5FGL A;  2UXI A;  3VPR A;  2V57 A;  2HYJ A;  2GEN A;  4GCK A;  3ANG A;  5K7F A;  4I6Z A;  3GEU A;  3HTA A;  4KWA A;  1Z77 A;  4D7N A;  2O7O A;  1ZK8 A;  4JNN A;  3QBM A;  2OI8 A;  2HYT A;  4GCT A;  3S5R A;  2FD5 A;  3IH2 A;  5J1Y A;  3LSP A;  1U9O A;  3V78 A;  3BTI A;  3BTC A;  1JT0 A;  4DW6 A;  2G3B A;  1JTX A;  2G7L A;  2YVE A;  3QKX A;  2HXO A;  3VVZ A;  5F0F A;  4AUX A;  4MO7 A;  5DAJ A;  2FBQ A;  3PPB A;  3ZQF A;  2OER A;  3ZQL A;  2XGD A;  4D5C A;  3AQS A;  2FJ1 A;  3TP0 A;  3AQT A;  5EYR A;  3G56 A;  2TRT A;  1JT6 A;  2O7T A;  3NI7 A;  3LHQ A;  5H9T A;  5EZG A;  2PZ9 A;  3G1O A;  5FKK A;  3WHC A;  5AQC A;  3BQZ A;  5GPA A;  5FKL A;  4ACI A;  4M3B A;  2WUI A;  3BR2 A;  2XGC A;  2XPV A;  2UXO A;  2UXP A;  2NP5 A;  4MK6 A;  3F0C A;  4PXI A;  2QKO A;  3B6C A;  2WGB A;  5K7Z A;  1A6I A;  3EGQ A;  2XPW A;  3LWJ A;  2I10 A;  3NXC A;  2UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...