3DPJA

The crystal structure of a tetr transcription regulator from silicibacter pomeroyi dss
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
194
structure length
194
Chain Sequence
b'SNAMVQAQTRDQIVAAADELFYRQGFAQTSFVDISAAVGISRGNFYYHFKTKDEILAEVIRLRLARTAQMLADWQGTGDSPRARIASFIDLMIMNRAKITRYGCPVGSLCTELSKLDHAAQGQANGLFTLFRDWLQRQFAEAGCTTEAPALAMHLLARSQGAATLAQSFHDEGFLRSEVADMHRWLDNTLPMTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription regulator, TetR family
molecule tags Dna binding protein
source organism Silicibacter pomeroyi
publication title The crystal structure of a TetR transcription regulator from Silicibacter pomeroyi DSS
rcsb
total genus 69
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3dpjA00
3O60A 2OERA 2F07A 5H9TA 2DG7A 2VPRA 2FX0A 2RASA 2DG8A 2WV1A 3VOKA 3E7QA 3PM1A 3GZIA 4MK6A 3VW0A 2FBQA 3ANPA 2Y31A 5IP6A 2RAEA 3RD3A 3Q3SA 2ZCNA 2QIBA 3ZQHA 1QPIA 4I76A 4I6ZA 5DAJA 5HAWA 3ZQGA 2IBDA 4AC0A 3B81A 2QTQA 2IU5A 5IPAA 2HKUA 2GENA 3EGQA 2QOPA 2XGCA 3LSPA 3LSRA 1UI6A 1ZK8A 2JK3A 3WHCA 2XPWA 2GFNA 4PXIA 3BTIA 3B6AA 4MXMA 3AQTA 3VVYA 4HKUA 4NELA 5D1RA 4M3EA 5EYRA 3V78A 2XB5A 5F0FA 1RKWA 2ZOZA 2Y30A 1JTXA 3G1MA 4ME9A 3VP5A 3BQYA 3ON2A 4D5FA 3KNWA 3P9TA 2RHAA 1JUSA 1QVUA 3FK7A 3C07A 1JUMA 3SFIA 3NI7A 2IAIA 2W53A 4D5CA 5K7ZA 2XDNA 3VOXA 5CXIA 5J1UA 2NS8A 3LWJA 3BRUA 4V2FA 5D18A 5IOZA 3NXCA 2XGDA 1RKTA 3QKXA 4GFLA 1U9NA 3NRGA 2X6OA 2VKVA 1Z77A 2HXIA 2XPUA 2HQ5A 3MVPA 5FKOA 4D7NA 4M3FA 5GP9A 3LOCA 3HTJA 2HYTA 3BHQA 5IOYA 5FKKA 4JKZA 5D19A 3BR2A 2REKA 3HE0A 2YVHA 2DTZA 4XK4A 2G7LA 3BTCA 2I10A 4X1EA 1Z0XA 3QQAA 3ANGA 5CW8A 2JJ7A 2WUIA 3EUPA 2G0EA 5GPAA 3NPIA 2VKEA 3VVXA 3PASA 2O7OA 5K7HA 5EFYA 1BJZA 3HIMA 2NX4A 3ON4A 2TRTA 2D6YA 3SDGA 1JTYA 3AQSA 2UXPA 3HTIA 1ZKGA 3BR3A 3O8GA 2G7SA 2OPTA 5CXGA 1RPWA 2OF7A 1SGMA 2PZ9A 2UXUA 3FRQA 2XGEA 3ZQIA 3QPLA 2OI8A 2ZB9A 4GCKA 2HXOA 2UXHA 2NS7A 5FKMA 2EH3A 3DEWA 1UI5A 3BR6A 3ZQLA 2IEKA 5EZGA 3IH2A 3VW1A 1JT0A 4JL3A 2ZCXA 3KKCA 3G1LA 5F0HA 5J3LA 2YVEA 4UDSA 4M3GA 1ORKA 3O8HA 5F08A 2Y2ZA 3COLA 2QWTA 3F0CA 4MO7A 4JYKA 3VIBA 3IH4A 5J1RA 2QKOA 4JNNA 3F1BA 3DCFA 4KWAA 3NNRA 5FGLA 3BR1A 5HSZA 2PBXA 2X9DA 2V57A 5K58A 4YZEA 5GPCA 3G1OA 3G7RA 2TCTA 2FJ1A 3BTLA 3WHBA 3BCGA 2FQ4A 5F04A 3GEUA 1T56A 3IH3A 4AUXA 4ICHA 2QCOA 2XRLA 2ID6A 3VVZA 2UXOA 5J1YA 2WGBA 2GBYA 5EZHA 4M3DA 3G56A 3JSJA 4V2GA 4G12A 3CCYA 3DPJA 5FHPA 3LJLA 3CJDA 4W97A 3HTAA 4ABZA 3FIWA 2HYJA 3B6CA 3LHQA 3V6GA 2UXIA 2G3BA 2ID3A 3FK6A 3Q0UA 3KKDA 3KZ9A 3PPBA 2FD5A 5FKLA 3MNLA 5AQCA 3TP3A 4ACIA 2O7TA 3Q0VA 3RH2A 3LSJA 4B1RA 4NN1A 3IUVA 3HTHA 3T6NA 3ZQFA 3BR5A 4B3AA 4CGRA 2ZOYA 1JT6A 2Q24A 5F0CA 3HGGA 4M3BA 3QPSA 5K7FA 3BQZA 3TP0A 3BNIA 3VPRA 3BJBA 2ZCMA 3BTJA 4GFKA 3CWRA 3Q0WA 5HBUA 4GCTA 2GUHA 4AF5A 3S5RA 4GCLA 2G7GA 3BR0A 4L62A 5FMPA 2XPVA 4DW6A 2NP3A 4AC6A 3BT9A 3CRJA 3VUQA 1JUPA 3CDLA 5F27A 4D7MA 5C4YA 4W1UA 1A6IA 5F1JA 1QVTA 2NP5A 3VW2A 1U9OA 1VI0A 3C2BA 3QBMA 3HGYA 5FKNA 1T33A
chains in the Genus database with same CATH superfamily
3O60A 2OERA 2F07A 5H9TA 2DG7A 2VPRA 2FX0A 2RASA 2DG8A 2WV1A 3VOKA 3E7QA 3PM1A 3GZIA 4MK6A 3VW0A 2FBQA 3ANPA 2Y31A 5IP6A 2RAEA 3RD3A 3Q3SA 2ZCNA 2QIBA 3ZQHA 1QPIA 4I76A 4I6ZA 5DAJA 5HAWA 3ZQGA 2IBDA 4AC0A 3B81A 2QTQA 2IU5A 5IPAA 2HKUA 2ZY9A 3SWHA 2GENA 3EGQA 2QOPA 2XGCA 3LSPA 3KYLA 3LSRA 1UI6A 1ZK8A 2JK3A 3K8PC 3WHCA 2XPWA 2GFNA 4PXIA 3BTIA 3B6AA 4MXMA 3AQTA 3VVYA 4HKUA 4NELA 4U9LA 5D1RA 4M3EA 5EYRA 3V78A 2XB5A 5F0FA 1RKWA 2ZOZA 2Y30A 1JTXA 3G1MA 4ME9A 3VP5A 3BQYA 3ON2A 4D5FA 3KNWA 3P9TA 3FHNA 2RHAA 1JUSA 1QVUA 3FK7A 3C07A 1JUMA 4OD5A 3SFIA 3NI7A 2IAIA 2W53A 4D5CA 2XDNA 5K7ZA 3VOXA 5CXIA 2R7OA 5J1UA 2NS8A 3LWJA 3BRUA 4V2FA 5D18A 5IOZA 3NXCA 2XGDA 1RKTA 3QKXA 4GFLA 1U9NA 3NRGA 2X6OA 2VKVA 1Z77A 2HXIA 2XPUA 2HQ5A 3VTIA 3MVPA 5FKOA 4D7NA 4M3FA 5GP9A 3LOCA 3HTJA 2HYTA 3BHQA 5IOYA 5FKKA 4JKZA 5D19A 3DU5A 5CQGA 3BR2A 2REKA 3HE0A 2YVHA 2YVXA 2DTZA 4XK4A 2G7LA 3BTCA 2I10A 4X1EA 1Z0XA 3QQAA 3ANGA 5CW8A 2JJ7A 2B3WA 2WUIA 3EUPA 2G0EA 5GPAA 3NPIA 2B1EA 2VKEA 3VVXA 3PASA 2O7OA 5K7HA 2R7SA 5EFYA 1BJZA 3HIMA 2NX4A 3ON4A 2TRTA 2D6YA 3SDGA 1JTYA 3AQSA 2UXPA 3HTIA 1ZKGA 3BR3A 3O8GA 2G7SA 2OPTA 5CXGA 1RPWA 2OF7A 2R7VA 1SGMA 2PZ9A 2UXUA 3FRQA 2XGEA 3ZQIA 3QPLA 2OI8A 2ZB9A 4GCKA 2HXOA 2UXHA 2NS7A 5FKMA 4WIBA 2EH3A 3DEWA 2PFVA 1UI5A 3BR6A 3ZQLA 2IEKA 5EZGA 2R7XA 3IH2A 3VW1A 1JT0A 4JL3A 2ZCXA 3KKCA 3G1LA 5F0HA 5J3LA 2YVEA 4UDSA 4M3GA 1ORKA 3O8HA 5F08A 2Y2ZA 3COLA 2QWTA 3F0CA 4MO7A 4JYKA 3VIBA 3IH4A 5J1RA 2R7QA 2QKOA 4JNNA 3F1BA 3DCFA 4KWAA 3NNRA 3DU6A 5FGLA 3BR1A 5HSZA 2PBXA 2X9DA 2V57A 2R7WA 5K58A 4YZEA 5GPCA 2R7UA 3G1OA 3G7RA 2R7RA 2TCTA 2FJ1A 3BTLA 3WHBA 3BCGA 2FQ4A 5F04A 3GEUA 1T56A 3IH3A 4AUXA 4ICHA 4U9NA 2QCOA 2XRLA 2ID6A 2R7TA 3VVZA 2UXOA 2WGBA 5J1YA 2GBYA 5EZHA 4M3DA 3G56A 3JSJA 4V2GA 4G12A 3CCYA 3DPJA 5FHPA 3LJLA 3CJDA 4W97A 3HTAA 4ABZA 3FIWA 2HYJA 3B6CA 3LHQA 3V6GA 4DVYP 2UXIA 2G3BA 2ID3A 3FK6A 3Q0UA 3KKDA 3KZ9A 3PPBA 2FD5A 5FKLA 3MNLA 5AQCA 3TP3A 4ACIA 2O7TA 3Q0VA 3RH2A 3LSJA 4B1RA 4NN1A 2FJI1 3IUVA 3HTHA 3T6NA 3ZQFA 3BR5A 4IRVA 4B3AA 4CGRA 2ZOYA 1JT6A 2Q24A 5F0CA 3HGGA 4M3BA 2A2FX 3QPSA 5K7FA 3BQZA 3NS4A 3TP0A 3BNIA 3VPRA 3BJBA 2ZCMA 3BTJA 4GFKA 3CWRA 3Q0WA 5HBUA 4GCTA 2GUHA 4AF5A 3S5RA 4GCLA 2G7GA 3BR0A 4L62A 5FMPA 2XPVA 4DW6A 2NP3A 4AC6A 4OD4A 3BT9A 3CRJA 3VUQA 1JUPA 4C2MA 3CDLA 5F27A 4D7MA 5C4YA 4W1UA 1A6IA 5F1JA 1QVTA 2NP5A 3VW2A 1U9OA 1VI0A 3C2BA 3QBMA 3HGYA 5FKNA 1T33A
chains in the Genus database with same CATH topology
3O60A 2OERA 2F07A 5H9TA 2DG7A 2VPRA 2FX0A 2RASA 2DG8A 2WV1A 3VOKA 3E7QA 3PM1A 3GZIA 4MK6A 3VW0A 2FBQA 3ANPA 2Y31A 5IP6A 2RAEA 3RD3A 3Q3SA 2ZCNA 2QIBA 3ZQHA 1QPIA 4I76A 4I6ZA 5DAJA 5HAWA 3ZQGA 2IBDA 4AC0A 3B81A 2QTQA 2IU5A 5IPAA 2HKUA 2GENA 3EGQA 2QOPA 2XGCA 3LSPA 3LSRA 1UI6A 1ZK8A 2JK3A 3WHCA 2XPWA 2GFNA 4PXIA 3BTIA 3B6AA 4MXMA 3AQTA 3VVYA 4HKUA 4NELA 5D1RA 4M3EA 5EYRA 3V78A 2XB5A 5F0FA 1RKWA 2ZOZA 2Y30A 1JTXA 3G1MA 4ME9A 3VP5A 3BQYA 3ON2A 4D5FA 3KNWA 3P9TA 2RHAA 1JUSA 1QVUA 3FK7A 3C07A 1JUMA 3SFIA 3NI7A 2IAIA 2W53A 4D5CA 5K7ZA 2XDNA 3VOXA 5CXIA 5J1UA 2NS8A 3LWJA 3BRUA 4V2FA 5D18A 5IOZA 3NXCA 2XGDA 1RKTA 3QKXA 4GFLA 1U9NA 3NRGA 2X6OA 2VKVA 1Z77A 2HXIA 2XPUA 2HQ5A 3MVPA 5FKOA 4D7NA 4M3FA 5GP9A 3LOCA 3HTJA 2HYTA 3BHQA 5IOYA 5FKKA 4JKZA 5D19A 3BR2A 2REKA 3HE0A 2YVHA 2DTZA 4XK4A 2G7LA 3BTCA 2I10A 4X1EA 1Z0XA 3QQAA 3ANGA 5CW8A 2JJ7A 2WUIA 3EUPA 2G0EA 5GPAA 3NPIA 2VKEA 3VVXA 3PASA 2O7OA 5K7HA 5EFYA 1BJZA 3HIMA 2NX4A 3ON4A 2TRTA 2D6YA 3SDGA 1JTYA 3AQSA 2UXPA 3HTIA 1ZKGA 3BR3A 3O8GA 2G7SA 2OPTA 5CXGA 1RPWA 2OF7A 1SGMA 2PZ9A 2UXUA 3FRQA 2XGEA 3ZQIA 3QPLA 2OI8A 2ZB9A 4GCKA 2HXOA 2UXHA 2NS7A 5FKMA 2EH3A 3DEWA 1UI5A 3BR6A 3ZQLA 2IEKA 5EZGA 3IH2A 3VW1A 1JT0A 4JL3A 2ZCXA 3KKCA 3G1LA 5F0HA 5J3LA 2YVEA 4UDSA 4M3GA 1ORKA 3O8HA 5F08A 2Y2ZA 3COLA 2QWTA 3F0CA 4MO7A 4JYKA 3VIBA 3IH4A 5J1RA 2QKOA 4JNNA 3F1BA 3DCFA 4KWAA 3NNRA 5FGLA 3BR1A 5HSZA 2PBXA 2X9DA 2V57A 5K58A 4YZEA 5GPCA 3G1OA 3G7RA 2TCTA 2FJ1A 3BTLA 3WHBA 3BCGA 2FQ4A 5F04A 3GEUA 1T56A 3IH3A 4AUXA 4ICHA 2QCOA 2XRLA 2ID6A 3VVZA 2UXOA 5J1YA 2WGBA 2GBYA 5EZHA 4M3DA 3G56A 3JSJA 4V2GA 4G12A 3CCYA 3DPJA 5FHPA 3LJLA 3CJDA 4W97A 3HTAA 4ABZA 3FIWA 2HYJA 3B6CA 3LHQA 3V6GA 2UXIA 2G3BA 2ID3A 3FK6A 3Q0UA 3KKDA 3KZ9A 3PPBA 2FD5A 5FKLA 3MNLA 5AQCA 3TP3A 4ACIA 2O7TA 3Q0VA 3RH2A 3LSJA 4B1RA 4NN1A 3IUVA 3HTHA 3T6NA 3ZQFA 3BR5A 4B3AA 4CGRA 2ZOYA 1JT6A 2Q24A 5F0CA 3HGGA 4M3BA 3QPSA 5K7FA 3BQZA 3TP0A 3BNIA 3VPRA 3BJBA 2ZCMA 3BTJA 4GFKA 3CWRA 3Q0WA 5HBUA 4GCTA 2GUHA 4AF5A 3S5RA 4GCLA 2G7GA 3BR0A 4L62A 5FMPA 2XPVA 4DW6A 2NP3A 4AC6A 3BT9A 3CRJA 3VUQA 1JUPA 3CDLA 5F27A 4D7MA 5C4YA 4W1UA 1A6IA 5F1JA 1QVTA 2NP5A 3VW2A 1U9OA 1VI0A 3C2BA 3QBMA 3HGYA 5FKNA 1T33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O60 A;  2OER A;  2F07 A;  5H9T A;  2DG7 A;  2VPR A;  2FX0 A;  2RAS A;  2DG8 A;  2WV1 A;  3VOK A;  3E7Q A;  3PM1 A;  3GZI A;  4MK6 A;  3VW0 A;  2FBQ A;  3ANP A;  2Y31 A;  5IP6 A;  2RAE A;  3RD3 A;  3Q3S A;  2ZCN A;  2QIB A;  3ZQH A;  1QPI A;  4I76 A;  4I6Z A;  5DAJ A;  5HAW A;  3ZQG A;  2IBD A;  4AC0 A;  3B81 A;  2QTQ A;  2IU5 A;  5IPA A;  2HKU A;  2GEN A;  3EGQ A;  2QOP A;  2XGC A;  3LSP A;  3LSR A;  1UI6 A;  1ZK8 A;  2JK3 A;  3WHC A;  2XPW A;  2GFN A;  4PXI A;  3BTI A;  3B6A A;  4MXM A;  3AQT A;  3VVY A;  4HKU A;  4NEL A;  5D1R A;  4M3E A;  5EYR A;  3V78 A;  2XB5 A;  5F0F A;  1RKW A;  2ZOZ A;  2Y30 A;  1JTX A;  3G1M A;  4ME9 A;  3VP5 A;  3BQY A;  3ON2 A;  4D5F A;  3KNW A;  3P9T A;  2RHA A;  1JUS A;  1QVU A;  3FK7 A;  3C07 A;  1JUM A;  3SFI A;  3NI7 A;  2IAI A;  2W53 A;  4D5C A;  5K7Z A;  2XDN A;  3VOX A;  5CXI A;  5J1U A;  2NS8 A;  3LWJ A;  3BRU A;  4V2F A;  5D18 A;  5IOZ A;  3NXC A;  2XGD A;  1RKT A;  3QKX A;  4GFL A;  1U9N A;  3NRG A;  2X6O A;  2VKV A;  1Z77 A;  2HXI A;  2XPU A;  2HQ5 A;  3MVP A;  5FKO A;  4D7N A;  4M3F A;  5GP9 A;  3LOC A;  3HTJ A;  2HYT A;  3BHQ A;  5IOY A;  5FKK A;  4JKZ A;  5D19 A;  3BR2 A;  2REK A;  3HE0 A;  2YVH A;  2DTZ A;  4XK4 A;  2G7L A;  3BTC A;  2I10 A;  4X1E A;  1Z0X A;  3QQA A;  3ANG A;  5CW8 A;  2JJ7 A;  2WUI A;  3EUP A;  2G0E A;  5GPA A;  3NPI A;  2VKE A;  3VVX A;  3PAS A;  2O7O A;  5K7H A;  5EFY A;  1BJZ A;  3HIM A;  2NX4 A;  3ON4 A;  2TRT A;  2D6Y A;  3SDG A;  1JTY A;  3AQS A;  2UXP A;  3HTI A;  1ZKG A;  3BR3 A;  3O8G A;  2G7S A;  2OPT A;  5CXG A;  1RPW A;  2OF7 A;  1SGM A;  2PZ9 A;  2UXU A;  3FRQ A;  2XGE A;  3ZQI A;  3QPL A;  2OI8 A;  2ZB9 A;  4GCK A;  2HXO A;  2UXH A;  2NS7 A;  5FKM A;  2EH3 A;  3DEW A;  1UI5 A;  3BR6 A;  3ZQL A;  2IEK A;  5EZG A;  3IH2 A;  3VW1 A;  1JT0 A;  4JL3 A;  2ZCX A;  3KKC A;  3G1L A;  5F0H A;  5J3L A;  2YVE A;  4UDS A;  4M3G A;  1ORK A;  3O8H A;  5F08 A;  2Y2Z A;  3COL A;  2QWT A;  3F0C A;  4MO7 A;  4JYK A;  3VIB A;  3IH4 A;  5J1R A;  2QKO A;  4JNN A;  3F1B A;  3DCF A;  4KWA A;  3NNR A;  5FGL A;  3BR1 A;  5HSZ A;  2PBX A;  2X9D A;  2V57 A;  5K58 A;  4YZE A;  5GPC A;  3G1O A;  3G7R A;  2TCT A;  2FJ1 A;  3BTL A;  3WHB A;  3BCG A;  2FQ4 A;  5F04 A;  3GEU A;  1T56 A;  3IH3 A;  4AUX A;  4ICH A;  2QCO A;  2XRL A;  2ID6 A;  3VVZ A;  2UXO A;  5J1Y A;  2WGB A;  2GBY A;  5EZH A;  4M3D A;  3G56 A;  3JSJ A;  4V2G A;  4G12 A;  3CCY A;  3DPJ A;  5FHP A;  3LJL A;  3CJD A;  4W97 A;  3HTA A;  4ABZ A;  3FIW A;  2HYJ A;  3B6C A;  3LHQ A;  3V6G A;  2UXI A;  2G3B A;  2ID3 A;  3FK6 A;  3Q0U A;  3KKD A;  3KZ9 A;  3PPB A;  2FD5 A;  5FKL A;  3MNL A;  5AQC A;  3TP3 A;  4ACI A;  2O7T A;  3Q0V A;  3RH2 A;  3LSJ A;  4B1R A;  4NN1 A;  3IUV A;  3HTH A;  3T6N A;  3ZQF A;  3BR5 A;  4B3A A;  4CGR A;  2ZOY A;  1JT6 A;  2Q24 A;  5F0C A;  3HGG A;  4M3B A;  3QPS A;  5K7F A;  3BQZ A;  3TP0 A;  3BNI A;  3VPR A;  3BJB A;  2ZCM A;  3BTJ A;  4GFK A;  3CWR A;  3Q0W A;  5HBU A;  4GCT A;  2GUH A;  4AF5 A;  3S5R A;  4GCL A;  2G7G A;  3BR0 A;  4L62 A;  5FMP A;  2XPV A;  4DW6 A;  2NP3 A;  4AC6 A;  3BT9 A;  3CRJ A;  3VUQ A;  1JUP A;  3CDL A;  5F27 A;  4D7M A;  5C4Y A;  4W1U A;  1A6I A;  5F1J A;  1QVT A;  2NP5 A;  3VW2 A;  1U9O A;  1VI0 A;  3C2B A;  3QBM A;  3HGY A;  5FKN A;  1T33 A; 
#chains in the Genus database with same CATH topology
 3O60 A;  2OER A;  2F07 A;  5H9T A;  2DG7 A;  2VPR A;  2FX0 A;  2RAS A;  2DG8 A;  2WV1 A;  3VOK A;  3E7Q A;  3PM1 A;  3GZI A;  4MK6 A;  3VW0 A;  2FBQ A;  3ANP A;  2Y31 A;  5IP6 A;  2RAE A;  3RD3 A;  3Q3S A;  2ZCN A;  2QIB A;  3ZQH A;  1QPI A;  4I76 A;  4I6Z A;  5DAJ A;  5HAW A;  3ZQG A;  2IBD A;  4AC0 A;  3B81 A;  2QTQ A;  2IU5 A;  5IPA A;  2HKU A;  2ZY9 A;  3SWH A;  2GEN A;  3EGQ A;  2QOP A;  2XGC A;  3LSP A;  3KYL A;  3LSR A;  1UI6 A;  1ZK8 A;  2JK3 A;  3K8P C;  3WHC A;  2XPW A;  2GFN A;  4PXI A;  3BTI A;  3B6A A;  4MXM A;  3AQT A;  3VVY A;  4HKU A;  4NEL A;  4U9L A;  5D1R A;  4M3E A;  5EYR A;  3V78 A;  2XB5 A;  5F0F A;  1RKW A;  2ZOZ A;  2Y30 A;  1JTX A;  3G1M A;  4ME9 A;  3VP5 A;  3BQY A;  3ON2 A;  4D5F A;  3KNW A;  3P9T A;  3FHN A;  2RHA A;  1JUS A;  1QVU A;  3FK7 A;  3C07 A;  1JUM A;  4OD5 A;  3SFI A;  3NI7 A;  2IAI A;  2W53 A;  4D5C A;  2XDN A;  5K7Z A;  3VOX A;  5CXI A;  2R7O A;  5J1U A;  2NS8 A;  3LWJ A;  3BRU A;  4V2F A;  5D18 A;  5IOZ A;  3NXC A;  2XGD A;  1RKT A;  3QKX A;  4GFL A;  1U9N A;  3NRG A;  2X6O A;  2VKV A;  1Z77 A;  2HXI A;  2XPU A;  2HQ5 A;  3VTI A;  3MVP A;  5FKO A;  4D7N A;  4M3F A;  5GP9 A;  3LOC A;  3HTJ A;  2HYT A;  3BHQ A;  5IOY A;  5FKK A;  4JKZ A;  5D19 A;  3DU5 A;  5CQG A;  3BR2 A;  2REK A;  3HE0 A;  2YVH A;  2YVX A;  2DTZ A;  4XK4 A;  2G7L A;  3BTC A;  2I10 A;  4X1E A;  1Z0X A;  3QQA A;  3ANG A;  5CW8 A;  2JJ7 A;  2B3W A;  2WUI A;  3EUP A;  2G0E A;  5GPA A;  3NPI A;  2B1E A;  2VKE A;  3VVX A;  3PAS A;  2O7O A;  5K7H A;  2R7S A;  5EFY A;  1BJZ A;  3HIM A;  2NX4 A;  3ON4 A;  2TRT A;  2D6Y A;  3SDG A;  1JTY A;  3AQS A;  2UXP A;  3HTI A;  1ZKG A;  3BR3 A;  3O8G A;  2G7S A;  2OPT A;  5CXG A;  1RPW A;  2OF7 A;  2R7V A;  1SGM A;  2PZ9 A;  2UXU A;  3FRQ A;  2XGE A;  3ZQI A;  3QPL A;  2OI8 A;  2ZB9 A;  4GCK A;  2HXO A;  2UXH A;  2NS7 A;  5FKM A;  4WIB A;  2EH3 A;  3DEW A;  2PFV A;  1UI5 A;  3BR6 A;  3ZQL A;  2IEK A;  5EZG A;  2R7X A;  3IH2 A;  3VW1 A;  1JT0 A;  4JL3 A;  2ZCX A;  3KKC A;  3G1L A;  5F0H A;  5J3L A;  2YVE A;  4UDS A;  4M3G A;  1ORK A;  3O8H A;  5F08 A;  2Y2Z A;  3COL A;  2QWT A;  3F0C A;  4MO7 A;  4JYK A;  3VIB A;  3IH4 A;  5J1R A;  2R7Q A;  2QKO A;  4JNN A;  3F1B A;  3DCF A;  4KWA A;  3NNR A;  3DU6 A;  5FGL A;  3BR1 A;  5HSZ A;  2PBX A;  2X9D A;  2V57 A;  2R7W A;  5K58 A;  4YZE A;  5GPC A;  2R7U A;  3G1O A;  3G7R A;  2R7R A;  2TCT A;  2FJ1 A;  3BTL A;  3WHB A;  3BCG A;  2FQ4 A;  5F04 A;  3GEU A;  1T56 A;  3IH3 A;  4AUX A;  4ICH A;  4U9N A;  2QCO A;  2XRL A;  2ID6 A;  2R7T A;  3VVZ A;  2UXO A;  2WGB A;  5J1Y A;  2GBY A;  5EZH A;  4M3D A;  3G56 A;  3JSJ A;  4V2G A;  4G12 A;  3CCY A;  3DPJ A;  5FHP A;  3LJL A;  3CJD A;  4W97 A;  3HTA A;  4ABZ A;  3FIW A;  2HYJ A;  3B6C A;  3LHQ A;  3V6G A;  4DVY P;  2UXI A;  2G3B A;  2ID3 A;  3FK6 A;  3Q0U A;  3KKD A;  3KZ9 A;  3PPB A;  2FD5 A;  5FKL A;  3MNL A;  5AQC A;  3TP3 A;  4ACI A;  2O7T A;  3Q0V A;  3RH2 A;  3LSJ A;  4B1R A;  4NN1 A;  2FJI 1;  3IUV A;  3HTH A;  3T6N A;  3ZQF A;  3BR5 A;  4IRV A;  4B3A A;  4CGR A;  2ZOY A;  1JT6 A;  2Q24 A;  5F0C A;  3HGG A;  4M3B A;  2A2F X;  3QPS A;  5K7F A;  3BQZ A;  3NS4 A;  3TP0 A;  3BNI A;  3VPR A;  3BJB A;  2ZCM A;  3BTJ A;  4GFK A;  3CWR A;  3Q0W A;  5HBU A;  4GCT A;  2GUH A;  4AF5 A;  3S5R A;  4GCL A;  2G7G A;  3BR0 A;  4L62 A;  5FMP A;  2XPV A;  4DW6 A;  2NP3 A;  4AC6 A;  4OD4 A;  3BT9 A;  3CRJ A;  3VUQ A;  1JUP A;  4C2M A;  3CDL A;  5F27 A;  4D7M A;  5C4Y A;  4W1U A;  1A6I A;  5F1J A;  1QVT A;  2NP5 A;  3VW2 A;  1U9O A;  1VI0 A;  3C2B A;  3QBM A;  3HGY A;  5FKN A;  1T33 A; 
#chains in the Genus database with same CATH homology
 3O60 A;  2OER A;  2F07 A;  5H9T A;  2DG7 A;  2VPR A;  2FX0 A;  2RAS A;  2DG8 A;  2WV1 A;  3VOK A;  3E7Q A;  3PM1 A;  3GZI A;  4MK6 A;  3VW0 A;  2FBQ A;  3ANP A;  2Y31 A;  5IP6 A;  2RAE A;  3RD3 A;  3Q3S A;  2ZCN A;  2QIB A;  3ZQH A;  1QPI A;  4I76 A;  4I6Z A;  5DAJ A;  5HAW A;  3ZQG A;  2IBD A;  4AC0 A;  3B81 A;  2QTQ A;  2IU5 A;  5IPA A;  2HKU A;  2GEN A;  3EGQ A;  2QOP A;  2XGC A;  3LSP A;  3LSR A;  1UI6 A;  1ZK8 A;  2JK3 A;  3WHC A;  2XPW A;  2GFN A;  4PXI A;  3BTI A;  3B6A A;  4MXM A;  3AQT A;  3VVY A;  4HKU A;  4NEL A;  5D1R A;  4M3E A;  5EYR A;  3V78 A;  2XB5 A;  5F0F A;  1RKW A;  2ZOZ A;  2Y30 A;  1JTX A;  3G1M A;  4ME9 A;  3VP5 A;  3BQY A;  3ON2 A;  4D5F A;  3KNW A;  3P9T A;  2RHA A;  1JUS A;  1QVU A;  3FK7 A;  3C07 A;  1JUM A;  3SFI A;  3NI7 A;  2IAI A;  2W53 A;  4D5C A;  5K7Z A;  2XDN A;  3VOX A;  5CXI A;  5J1U A;  2NS8 A;  3LWJ A;  3BRU A;  4V2F A;  5D18 A;  5IOZ A;  3NXC A;  2XGD A;  1RKT A;  3QKX A;  4GFL A;  1U9N A;  3NRG A;  2X6O A;  2VKV A;  1Z77 A;  2HXI A;  2XPU A;  2HQ5 A;  3MVP A;  5FKO A;  4D7N A;  4M3F A;  5GP9 A;  3LOC A;  3HTJ A;  2HYT A;  3BHQ A;  5IOY A;  5FKK A;  4JKZ A;  5D19 A;  3BR2 A;  2REK A;  3HE0 A;  2YVH A;  2DTZ A;  4XK4 A;  2G7L A;  3BTC A;  2I10 A;  4X1E A;  1Z0X A;  3QQA A;  3ANG A;  5CW8 A;  2JJ7 A;  2WUI A;  3EUP A;  2G0E A;  5GPA A;  3NPI A;  2VKE A;  3VVX A;  3PAS A;  2O7O A;  5K7H A;  5EFY A;  1BJZ A;  3HIM A;  2NX4 A;  3ON4 A;  2TRT A;  2D6Y A;  3SDG A;  1JTY A;  3AQS A;  2UXP A;  3HTI A;  1ZKG A;  3BR3 A;  3O8G A;  2G7S A;  2OPT A;  5CXG A;  1RPW A;  2OF7 A;  1SGM A;  2PZ9 A;  2UXU A;  3FRQ A;  2XGE A;  3ZQI A;  3QPL A;  2OI8 A;  2ZB9 A;  4GCK A;  2HXO A;  2UXH A;  2NS7 A;  5FKM A;  2EH3 A;  3DEW A;  1UI5 A;  3BR6 A;  3ZQL A;  2IEK A;  5EZG A;  3IH2 A;  3VW1 A;  1JT0 A;  4JL3 A;  2ZCX A;  3KKC A;  3G1L A;  5F0H A;  5J3L A;  2YVE A;  4UDS A;  4M3G A;  1ORK A;  3O8H A;  5F08 A;  2Y2Z A;  3COL A;  2QWT A;  3F0C A;  4MO7 A;  4JYK A;  3VIB A;  3IH4 A;  5J1R A;  2QKO A;  4JNN A;  3F1B A;  3DCF A;  4KWA A;  3NNR A;  5FGL A;  3BR1 A;  5HSZ A;  2PBX A;  2X9D A;  2V57 A;  5K58 A;  4YZE A;  5GPC A;  3G1O A;  3G7R A;  2TCT A;  2FJ1 A;  3BTL A;  3WHB A;  3BCG A;  2FQ4 A;  5F04 A;  3GEU A;  1T56 A;  3IH3 A;  4AUX A;  4ICH A;  2QCO A;  2XRL A;  2ID6 A;  3VVZ A;  2UXO A;  5J1Y A;  2WGB A;  2GBY A;  5EZH A;  4M3D A;  3G56 A;  3JSJ A;  4V2G A;  4G12 A;  3CCY A;  3DPJ A;  5FHP A;  3LJL A;  3CJD A;  4W97 A;  3HTA A;  4ABZ A;  3FIW A;  2HYJ A;  3B6C A;  3LHQ A;  3V6G A;  2UXI A;  2G3B A;  2ID3 A;  3FK6 A;  3Q0U A;  3KKD A;  3KZ9 A;  3PPB A;  2FD5 A;  5FKL A;  3MNL A;  5AQC A;  3TP3 A;  4ACI A;  2O7T A;  3Q0V A;  3RH2 A;  3LSJ A;  4B1R A;  4NN1 A;  3IUV A;  3HTH A;  3T6N A;  3ZQF A;  3BR5 A;  4B3A A;  4CGR A;  2ZOY A;  1JT6 A;  2Q24 A;  5F0C A;  3HGG A;  4M3B A;  3QPS A;  5K7F A;  3BQZ A;  3TP0 A;  3BNI A;  3VPR A;  3BJB A;  2ZCM A;  3BTJ A;  4GFK A;  3CWR A;  3Q0W A;  5HBU A;  4GCT A;  2GUH A;  4AF5 A;  3S5R A;  4GCL A;  2G7G A;  3BR0 A;  4L62 A;  5FMP A;  2XPV A;  4DW6 A;  2NP3 A;  4AC6 A;  3BT9 A;  3CRJ A;  3VUQ A;  1JUP A;  3CDL A;  5F27 A;  4D7M A;  5C4Y A;  4W1U A;  1A6I A;  5F1J A;  1QVT A;  2NP5 A;  3VW2 A;  1U9O A;  1VI0 A;  3C2B A;  3QBM A;  3HGY A;  5FKN A;  1T33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...