3NRGA

Crystal structure of a tetr family transcriptional regulator (caur_2714) from chloroflexus aurantiacus j-10-fl at 2.56 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GMPTETFFNLPEEKRSRLIDVLLDEFAQNDYDSVSINRITERAGIAKGSFYQYFADKKDCYLYLIQLGIEQKTAFLRQTPPASTTDMFAYLRWLLDVGIQFQFHNPRLAQIAYKALYDDVPLPAETMQVIRHGSFAYFKQLVEQGIADGSLVPDLDADTAAFVLNVVFTELGNHLIERFAVNPAELLREGGIVLLQPAMRRVIEQVIDILERGMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family transcriptional regulator
publication title Crystal structure of a TetR family transcriptional regulator (Caur_2714) from CHLOROFLEXUS AURANTIACUS J-10-FL at 2.56 A resolution
rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription
total genus 79
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nrgA00
2VKVA 3KKDA 3Q3SA 1QVTA 2REKA 3TP0A 3SDGA 3NXCA 2JK3A 3HTIA 2ZB9A 3P9TA 3QBMA 5J1UA 3O8GA 3V78A 3B81A 4B1RA 4JL3A 4UDSA 4L62A 2OPTA 4NELA 3HE0A 3BR6A 2NP3A 4W97A 2WUIA 3BCGA 3IH2A 3PPBA 2Y2ZA 2PBXA 5IP6A 3CDLA 1Z0XA 5GPAA 2NP5A 3MNLA 5EFYA 4V2FA 2IBDA 1JT6A 5J1RA 2X6OA 4JKZA 4YZEA 3CRJA 4B3AA 4M3DA 4M3BA 3WHBA 2YVHA 2QWTA 3RH2A 2XGCA 4AUXA 4D7MA 2Y30A 1U9OA 5HBUA 2TCTA 3HTAA 3IH4A 4JNNA 3ZQLA 3VW1A 3BTLA 4DW6A 1QVUA 1ZKGA 2ID3A 4M3FA 3BQYA 3DCFA 3ZQHA 5IOYA 1RPWA 3AQSA 2QIBA 4GCTA 5F04A 5EZHA 2JJ7A 2RAEA 4GCLA 2GBYA 4KWAA 2XPVA 5K7ZA 5HAWA 5FKLA 3DPJA 1A6IA 2PZ9A 4XK4A 5J3LA 3GZIA 5IPAA 3JSJA 4JYKA 5K7HA 5FMPA 1JUMA 2G7SA 2DG7A 4D7NA 1JTXA 2XPUA 1JUSA 2XDNA 3BNIA 3NRGA 2HXIA 4GFKA 3LJLA 5FKNA 3PM1A 3VOKA 5FGLA 4M3EA 5D19A 3QKXA 1ZK8A 3E7QA 4GFLA 3LOCA 2GFNA 3VVZA 3BR3A 3LSJA 1U9NA 5D1RA 3BQZA 4PXIA 5HSZA 2NS7A 4HKUA 3MVPA 4D5CA 3QPLA 3NPIA 4V2GA 3BHQA 5F0FA 3FK7A 2V57A 4CGRA 4I76A 3BR5A 2D6YA 3TP3A 2FJ1A 3Q0VA 2FD5A 2UXUA 2WV1A 5DAJA 4ICHA 4X1EA 3IH3A 3C2BA 2VKEA 3DEWA 5J1YA 2OERA 3BTCA 3IUVA 3B6AA 2XB5A 3V6GA 5IOZA 3BTIA 3F0CA 5GP9A 2YVEA 2Q24A 4ACIA 3VPRA 5FHPA 5AQCA 3FRQA 1BJZA 5C4YA 3KNWA 3QQAA 2ZOZA 5H9TA 5CW8A 3KZ9A 5GPCA 2ID6A 5F08A 3CJDA 1UI5A 3HTJA 3EUPA 3G56A 3BT9A 5F0HA 2I10A 4I6ZA 5FKMA 3AQTA 2QKOA 3NNRA 4ME9A 5FKKA 3G1MA 2HYJA 3O8HA 3EGQA 4MO7A 1JTYA 4W1UA 2G7GA 3CWRA 2O7TA 3HIMA 2HQ5A 1JT0A 2OF7A 3VVYA 3HTHA 3Q0UA 3VW0A 3S5RA 5D18A 2ZOYA 3B6CA 5EYRA 2DTZA 1ORKA 1QPIA 3F1BA 3VVXA 3ZQFA 3C07A 1T56A 2G0EA 2X9DA 3Q0WA 3RD3A 4AC0A 2NS8A 3KKCA 5F0CA 2EH3A 3PASA 2IEKA 1SGMA 4GCKA 3G1LA 3LSPA 2QOPA 2ZCXA 2GENA 2ZCMA 3BJBA 3ON2A 3ZQIA 3LSRA 2FX0A 1JUPA 2FBQA 5F1JA 2QCOA 2TRTA 2O7OA 3QPSA 2RHAA 2UXOA 3VP5A 2UXPA 2OI8A 3CCYA 5CXGA 2W53A 2UXIA 5K7FA 2XRLA 3G1OA 4MK6A 5CXIA 2IAIA 2QTQA 2VPRA 3HGYA 2XGEA 5FKOA 1UI6A 2WGBA 2XGDA 2G7LA 3ANGA 3VW2A 4ABZA 2IU5A 3ZQGA 2XPWA 1RKTA 4MXMA 4AC6A 2GUHA 3VIBA 2RASA 5F27A 2HKUA 3T6NA 3G7RA 4AF5A 3BRUA 2DG8A 2ZCNA 3FIWA 1Z77A 3BTJA 5EZGA 4G12A 2G3BA 3GEUA 3NI7A 3WHCA 4D5FA 3ANPA 4NN1A 2NX4A 3SFIA 2HXOA 5K58A 3LHQA 2FQ4A 3O60A 2F07A 3COLA 3VUQA 4M3GA 3BR2A 3ON4A 1T33A 2Y31A 3FK6A 1RKWA 3HGGA 3LWJA 1VI0A 2UXHA 3BR0A 3VOXA 3BR1A 2HYTA
chains in the Genus database with same CATH superfamily
2VKVA 3KKDA 3Q3SA 1QVTA 2REKA 3TP0A 3SDGA 3NXCA 2JK3A 3HTIA 2ZB9A 3P9TA 3QBMA 5J1UA 3O8GA 3V78A 3B81A 4B1RA 4JL3A 4UDSA 4L62A 2OPTA 4NELA 3HE0A 3BR6A 2NP3A 4W97A 2WUIA 3BCGA 3IH2A 3PPBA 2Y2ZA 2PBXA 3K8PC 5IP6A 3CDLA 1Z0XA 5GPAA 2NP5A 3MNLA 5EFYA 4V2FA 2IBDA 1JT6A 5J1RA 2X6OA 4JKZA 4YZEA 3CRJA 4B3AA 4M3DA 4M3BA 3WHBA 2YVHA 3SWHA 2QWTA 4U9NA 3RH2A 2XGCA 4AUXA 4D7MA 2Y30A 1U9OA 5HBUA 2TCTA 3HTAA 3IH4A 4JNNA 3ZQLA 3VW1A 3BTLA 4DW6A 1QVUA 1ZKGA 2ID3A 4M3FA 3BQYA 4WIBA 3DCFA 3ZQHA 5IOYA 1RPWA 4IRVA 3AQSA 2QIBA 4GCTA 5F04A 3KYLA 5EZHA 2JJ7A 2RAEA 3VTIA 4GCLA 2GBYA 4KWAA 2PFVA 2B3WA 2XPVA 5K7ZA 5HAWA 5FKLA 3DPJA 1A6IA 2ZY9A 2PZ9A 2R7WA 4XK4A 5J3LA 3GZIA 5IPAA 2R7XA 3JSJA 4JYKA 5K7HA 5FMPA 1JUMA 2G7SA 2DG7A 4D7NA 1JTXA 2XPUA 1JUSA 2XDNA 3BNIA 2FJI1 3NRGA 2HXIA 4GFKA 3LJLA 5FKNA 3DU5A 3PM1A 3VOKA 5FGLA 4M3EA 5D19A 3QKXA 1ZK8A 3E7QA 4GFLA 3LOCA 2GFNA 3VVZA 3BR3A 3LSJA 1U9NA 5D1RA 3BQZA 4PXIA 5HSZA 2NS7A 4HKUA 3MVPA 4D5CA 3QPLA 3NPIA 4V2GA 2R7QA 3BHQA 5F0FA 3FK7A 2V57A 4CGRA 4I76A 3BR5A 2D6YA 3TP3A 2FJ1A 3Q0VA 2FD5A 2UXUA 2WV1A 5DAJA 4ICHA 4X1EA 3IH3A 3C2BA 2VKEA 3DEWA 3FHNA 5J1YA 2OERA 3BTCA 3IUVA 3B6AA 2XB5A 3V6GA 5IOZA 3BTIA 3F0CA 5GP9A 2YVEA 2Q24A 4ACIA 3VPRA 5FHPA 4C2MA 5AQCA 3FRQA 1BJZA 3NS4A 5C4YA 3KNWA 3QQAA 2ZOZA 5H9TA 5CW8A 3KZ9A 5GPCA 2ID6A 5F08A 3CJDA 1UI5A 3HTJA 3EUPA 3G56A 3BT9A 5F0HA 2I10A 4I6ZA 5FKMA 3AQTA 2QKOA 3NNRA 4ME9A 5FKKA 3G1MA 2HYJA 3O8HA 3EGQA 4MO7A 2R7SA 2R7OA 1JTYA 4W1UA 2G7GA 3CWRA 2O7TA 3HIMA 2HQ5A 1JT0A 2OF7A 3VVYA 3HTHA 3Q0UA 3VW0A 2B1EA 3S5RA 5D18A 2ZOYA 2R7VA 3B6CA 2A2FX 5EYRA 2DTZA 1ORKA 1QPIA 3F1BA 3VVXA 3ZQFA 3C07A 1T56A 2G0EA 2X9DA 3Q0WA 3RD3A 4AC0A 4OD4A 2NS8A 3KKCA 5F0CA 2EH3A 3PASA 2IEKA 1SGMA 4GCKA 3G1LA 3LSPA 2QOPA 2ZCXA 2R7TA 2GENA 2ZCMA 3BJBA 3ON2A 4DVYP 3ZQIA 3LSRA 2FX0A 1JUPA 2YVXA 2FBQA 5F1JA 2QCOA 2TRTA 2O7OA 3QPSA 2RHAA 2UXOA 3VP5A 2UXPA 2OI8A 3CCYA 5CXGA 2W53A 5CQGA 2UXIA 2R7RA 5K7FA 2XRLA 3G1OA 4MK6A 5CXIA 2IAIA 2QTQA 2VPRA 3HGYA 2XGEA 5FKOA 2R7UA 4U9LA 1UI6A 2WGBA 2XGDA 2G7LA 3ANGA 3VW2A 4ABZA 2IU5A 3ZQGA 2XPWA 1RKTA 4MXMA 4AC6A 2GUHA 3VIBA 4OD5A 2RASA 5F27A 2HKUA 3T6NA 3G7RA 4AF5A 3BRUA 2DG8A 2ZCNA 3FIWA 3DU6A 1Z77A 3BTJA 5EZGA 4G12A 2G3BA 3GEUA 3NI7A 3WHCA 4D5FA 3ANPA 4NN1A 2NX4A 3SFIA 2HXOA 5K58A 3LHQA 2FQ4A 3O60A 2F07A 3COLA 3VUQA 4M3GA 3BR2A 3ON4A 1T33A 2Y31A 3FK6A 1RKWA 3HGGA 3LWJA 1VI0A 2UXHA 3BR0A 3VOXA 3BR1A 2HYTA
chains in the Genus database with same CATH topology
2VKVA 3KKDA 3Q3SA 1QVTA 2REKA 3TP0A 3SDGA 3NXCA 2JK3A 3HTIA 2ZB9A 3P9TA 3QBMA 5J1UA 3O8GA 3V78A 3B81A 4B1RA 4JL3A 4UDSA 4L62A 2OPTA 4NELA 3HE0A 3BR6A 2NP3A 4W97A 2WUIA 3BCGA 3IH2A 3PPBA 2Y2ZA 2PBXA 5IP6A 3CDLA 1Z0XA 5GPAA 2NP5A 3MNLA 5EFYA 4V2FA 2IBDA 1JT6A 5J1RA 2X6OA 4JKZA 4YZEA 3CRJA 4B3AA 4M3DA 4M3BA 3WHBA 2YVHA 2QWTA 3RH2A 2XGCA 4AUXA 4D7MA 2Y30A 1U9OA 5HBUA 2TCTA 3HTAA 3IH4A 4JNNA 3ZQLA 3VW1A 3BTLA 4DW6A 1QVUA 1ZKGA 2ID3A 4M3FA 3BQYA 3DCFA 3ZQHA 5IOYA 1RPWA 3AQSA 2QIBA 4GCTA 5F04A 5EZHA 2JJ7A 2RAEA 4GCLA 2GBYA 4KWAA 2XPVA 5K7ZA 5HAWA 5FKLA 3DPJA 1A6IA 2PZ9A 4XK4A 5J3LA 3GZIA 5IPAA 3JSJA 4JYKA 5K7HA 5FMPA 1JUMA 2G7SA 2DG7A 4D7NA 1JTXA 2XPUA 1JUSA 2XDNA 3BNIA 3NRGA 2HXIA 4GFKA 3LJLA 5FKNA 3PM1A 3VOKA 5FGLA 4M3EA 5D19A 3QKXA 1ZK8A 3E7QA 4GFLA 3LOCA 2GFNA 3VVZA 3BR3A 3LSJA 1U9NA 5D1RA 3BQZA 4PXIA 5HSZA 2NS7A 4HKUA 3MVPA 4D5CA 3QPLA 3NPIA 4V2GA 3BHQA 5F0FA 3FK7A 2V57A 4CGRA 4I76A 3BR5A 2D6YA 3TP3A 2FJ1A 3Q0VA 2FD5A 2UXUA 2WV1A 5DAJA 4ICHA 4X1EA 3IH3A 3C2BA 2VKEA 3DEWA 5J1YA 2OERA 3BTCA 3IUVA 3B6AA 2XB5A 3V6GA 5IOZA 3BTIA 3F0CA 5GP9A 2YVEA 2Q24A 4ACIA 3VPRA 5FHPA 5AQCA 3FRQA 1BJZA 5C4YA 3KNWA 3QQAA 2ZOZA 5H9TA 5CW8A 3KZ9A 5GPCA 2ID6A 5F08A 3CJDA 1UI5A 3HTJA 3EUPA 3G56A 3BT9A 5F0HA 2I10A 4I6ZA 5FKMA 3AQTA 2QKOA 3NNRA 4ME9A 5FKKA 3G1MA 2HYJA 3O8HA 3EGQA 4MO7A 1JTYA 4W1UA 2G7GA 3CWRA 2O7TA 3HIMA 2HQ5A 1JT0A 2OF7A 3VVYA 3HTHA 3Q0UA 3VW0A 3S5RA 5D18A 2ZOYA 3B6CA 5EYRA 2DTZA 1ORKA 1QPIA 3F1BA 3VVXA 3ZQFA 3C07A 1T56A 2G0EA 2X9DA 3Q0WA 3RD3A 4AC0A 2NS8A 3KKCA 5F0CA 2EH3A 3PASA 2IEKA 1SGMA 4GCKA 3G1LA 3LSPA 2QOPA 2ZCXA 2GENA 2ZCMA 3BJBA 3ON2A 3ZQIA 3LSRA 2FX0A 1JUPA 2FBQA 5F1JA 2QCOA 2TRTA 2O7OA 3QPSA 2RHAA 2UXOA 3VP5A 2UXPA 2OI8A 3CCYA 5CXGA 2W53A 2UXIA 5K7FA 2XRLA 3G1OA 4MK6A 5CXIA 2IAIA 2QTQA 2VPRA 3HGYA 2XGEA 5FKOA 1UI6A 2WGBA 2XGDA 2G7LA 3ANGA 3VW2A 4ABZA 2IU5A 3ZQGA 2XPWA 1RKTA 4MXMA 4AC6A 2GUHA 3VIBA 2RASA 5F27A 2HKUA 3T6NA 3G7RA 4AF5A 3BRUA 2DG8A 2ZCNA 3FIWA 1Z77A 3BTJA 5EZGA 4G12A 2G3BA 3GEUA 3NI7A 3WHCA 4D5FA 3ANPA 4NN1A 2NX4A 3SFIA 2HXOA 5K58A 3LHQA 2FQ4A 3O60A 2F07A 3COLA 3VUQA 4M3GA 3BR2A 3ON4A 1T33A 2Y31A 3FK6A 1RKWA 3HGGA 3LWJA 1VI0A 2UXHA 3BR0A 3VOXA 3BR1A 2HYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKV A;  3KKD A;  3Q3S A;  1QVT A;  2REK A;  3TP0 A;  3SDG A;  3NXC A;  2JK3 A;  3HTI A;  2ZB9 A;  3P9T A;  3QBM A;  5J1U A;  3O8G A;  3V78 A;  3B81 A;  4B1R A;  4JL3 A;  4UDS A;  4L62 A;  2OPT A;  4NEL A;  3HE0 A;  3BR6 A;  2NP3 A;  4W97 A;  2WUI A;  3BCG A;  3IH2 A;  3PPB A;  2Y2Z A;  2PBX A;  5IP6 A;  3CDL A;  1Z0X A;  5GPA A;  2NP5 A;  3MNL A;  5EFY A;  4V2F A;  2IBD A;  1JT6 A;  5J1R A;  2X6O A;  4JKZ A;  4YZE A;  3CRJ A;  4B3A A;  4M3D A;  4M3B A;  3WHB A;  2YVH A;  2QWT A;  3RH2 A;  2XGC A;  4AUX A;  4D7M A;  2Y30 A;  1U9O A;  5HBU A;  2TCT A;  3HTA A;  3IH4 A;  4JNN A;  3ZQL A;  3VW1 A;  3BTL A;  4DW6 A;  1QVU A;  1ZKG A;  2ID3 A;  4M3F A;  3BQY A;  3DCF A;  3ZQH A;  5IOY A;  1RPW A;  3AQS A;  2QIB A;  4GCT A;  5F04 A;  5EZH A;  2JJ7 A;  2RAE A;  4GCL A;  2GBY A;  4KWA A;  2XPV A;  5K7Z A;  5HAW A;  5FKL A;  3DPJ A;  1A6I A;  2PZ9 A;  4XK4 A;  5J3L A;  3GZI A;  5IPA A;  3JSJ A;  4JYK A;  5K7H A;  5FMP A;  1JUM A;  2G7S A;  2DG7 A;  4D7N A;  1JTX A;  2XPU A;  1JUS A;  2XDN A;  3BNI A;  3NRG A;  2HXI A;  4GFK A;  3LJL A;  5FKN A;  3PM1 A;  3VOK A;  5FGL A;  4M3E A;  5D19 A;  3QKX A;  1ZK8 A;  3E7Q A;  4GFL A;  3LOC A;  2GFN A;  3VVZ A;  3BR3 A;  3LSJ A;  1U9N A;  5D1R A;  3BQZ A;  4PXI A;  5HSZ A;  2NS7 A;  4HKU A;  3MVP A;  4D5C A;  3QPL A;  3NPI A;  4V2G A;  3BHQ A;  5F0F A;  3FK7 A;  2V57 A;  4CGR A;  4I76 A;  3BR5 A;  2D6Y A;  3TP3 A;  2FJ1 A;  3Q0V A;  2FD5 A;  2UXU A;  2WV1 A;  5DAJ A;  4ICH A;  4X1E A;  3IH3 A;  3C2B A;  2VKE A;  3DEW A;  5J1Y A;  2OER A;  3BTC A;  3IUV A;  3B6A A;  2XB5 A;  3V6G A;  5IOZ A;  3BTI A;  3F0C A;  5GP9 A;  2YVE A;  2Q24 A;  4ACI A;  3VPR A;  5FHP A;  5AQC A;  3FRQ A;  1BJZ A;  5C4Y A;  3KNW A;  3QQA A;  2ZOZ A;  5H9T A;  5CW8 A;  3KZ9 A;  5GPC A;  2ID6 A;  5F08 A;  3CJD A;  1UI5 A;  3HTJ A;  3EUP A;  3G56 A;  3BT9 A;  5F0H A;  2I10 A;  4I6Z A;  5FKM A;  3AQT A;  2QKO A;  3NNR A;  4ME9 A;  5FKK A;  3G1M A;  2HYJ A;  3O8H A;  3EGQ A;  4MO7 A;  1JTY A;  4W1U A;  2G7G A;  3CWR A;  2O7T A;  3HIM A;  2HQ5 A;  1JT0 A;  2OF7 A;  3VVY A;  3HTH A;  3Q0U A;  3VW0 A;  3S5R A;  5D18 A;  2ZOY A;  3B6C A;  5EYR A;  2DTZ A;  1ORK A;  1QPI A;  3F1B A;  3VVX A;  3ZQF A;  3C07 A;  1T56 A;  2G0E A;  2X9D A;  3Q0W A;  3RD3 A;  4AC0 A;  2NS8 A;  3KKC A;  5F0C A;  2EH3 A;  3PAS A;  2IEK A;  1SGM A;  4GCK A;  3G1L A;  3LSP A;  2QOP A;  2ZCX A;  2GEN A;  2ZCM A;  3BJB A;  3ON2 A;  3ZQI A;  3LSR A;  2FX0 A;  1JUP A;  2FBQ A;  5F1J A;  2QCO A;  2TRT A;  2O7O A;  3QPS A;  2RHA A;  2UXO A;  3VP5 A;  2UXP A;  2OI8 A;  3CCY A;  5CXG A;  2W53 A;  2UXI A;  5K7F A;  2XRL A;  3G1O A;  4MK6 A;  5CXI A;  2IAI A;  2QTQ A;  2VPR A;  3HGY A;  2XGE A;  5FKO A;  1UI6 A;  2WGB A;  2XGD A;  2G7L A;  3ANG A;  3VW2 A;  4ABZ A;  2IU5 A;  3ZQG A;  2XPW A;  1RKT A;  4MXM A;  4AC6 A;  2GUH A;  3VIB A;  2RAS A;  5F27 A;  2HKU A;  3T6N A;  3G7R A;  4AF5 A;  3BRU A;  2DG8 A;  2ZCN A;  3FIW A;  1Z77 A;  3BTJ A;  5EZG A;  4G12 A;  2G3B A;  3GEU A;  3NI7 A;  3WHC A;  4D5F A;  3ANP A;  4NN1 A;  2NX4 A;  3SFI A;  2HXO A;  5K58 A;  3LHQ A;  2FQ4 A;  3O60 A;  2F07 A;  3COL A;  3VUQ A;  4M3G A;  3BR2 A;  3ON4 A;  1T33 A;  2Y31 A;  3FK6 A;  1RKW A;  3HGG A;  3LWJ A;  1VI0 A;  2UXH A;  3BR0 A;  3VOX A;  3BR1 A;  2HYT A; 
#chains in the Genus database with same CATH topology
 2VKV A;  3KKD A;  3Q3S A;  1QVT A;  2REK A;  3TP0 A;  3SDG A;  3NXC A;  2JK3 A;  3HTI A;  2ZB9 A;  3P9T A;  3QBM A;  5J1U A;  3O8G A;  3V78 A;  3B81 A;  4B1R A;  4JL3 A;  4UDS A;  4L62 A;  2OPT A;  4NEL A;  3HE0 A;  3BR6 A;  2NP3 A;  4W97 A;  2WUI A;  3BCG A;  3IH2 A;  3PPB A;  2Y2Z A;  2PBX A;  3K8P C;  5IP6 A;  3CDL A;  1Z0X A;  5GPA A;  2NP5 A;  3MNL A;  5EFY A;  4V2F A;  2IBD A;  1JT6 A;  5J1R A;  2X6O A;  4JKZ A;  4YZE A;  3CRJ A;  4B3A A;  4M3D A;  4M3B A;  3WHB A;  2YVH A;  3SWH A;  2QWT A;  4U9N A;  3RH2 A;  2XGC A;  4AUX A;  4D7M A;  2Y30 A;  1U9O A;  5HBU A;  2TCT A;  3HTA A;  3IH4 A;  4JNN A;  3ZQL A;  3VW1 A;  3BTL A;  4DW6 A;  1QVU A;  1ZKG A;  2ID3 A;  4M3F A;  3BQY A;  4WIB A;  3DCF A;  3ZQH A;  5IOY A;  1RPW A;  4IRV A;  3AQS A;  2QIB A;  4GCT A;  5F04 A;  3KYL A;  5EZH A;  2JJ7 A;  2RAE A;  3VTI A;  4GCL A;  2GBY A;  4KWA A;  2PFV A;  2B3W A;  2XPV A;  5K7Z A;  5HAW A;  5FKL A;  3DPJ A;  1A6I A;  2ZY9 A;  2PZ9 A;  2R7W A;  4XK4 A;  5J3L A;  3GZI A;  5IPA A;  2R7X A;  3JSJ A;  4JYK A;  5K7H A;  5FMP A;  1JUM A;  2G7S A;  2DG7 A;  4D7N A;  1JTX A;  2XPU A;  1JUS A;  2XDN A;  3BNI A;  2FJI 1;  3NRG A;  2HXI A;  4GFK A;  3LJL A;  5FKN A;  3DU5 A;  3PM1 A;  3VOK A;  5FGL A;  4M3E A;  5D19 A;  3QKX A;  1ZK8 A;  3E7Q A;  4GFL A;  3LOC A;  2GFN A;  3VVZ A;  3BR3 A;  3LSJ A;  1U9N A;  5D1R A;  3BQZ A;  4PXI A;  5HSZ A;  2NS7 A;  4HKU A;  3MVP A;  4D5C A;  3QPL A;  3NPI A;  4V2G A;  2R7Q A;  3BHQ A;  5F0F A;  3FK7 A;  2V57 A;  4CGR A;  4I76 A;  3BR5 A;  2D6Y A;  3TP3 A;  2FJ1 A;  3Q0V A;  2FD5 A;  2UXU A;  2WV1 A;  5DAJ A;  4ICH A;  4X1E A;  3IH3 A;  3C2B A;  2VKE A;  3DEW A;  3FHN A;  5J1Y A;  2OER A;  3BTC A;  3IUV A;  3B6A A;  2XB5 A;  3V6G A;  5IOZ A;  3BTI A;  3F0C A;  5GP9 A;  2YVE A;  2Q24 A;  4ACI A;  3VPR A;  5FHP A;  4C2M A;  5AQC A;  3FRQ A;  1BJZ A;  3NS4 A;  5C4Y A;  3KNW A;  3QQA A;  2ZOZ A;  5H9T A;  5CW8 A;  3KZ9 A;  5GPC A;  2ID6 A;  5F08 A;  3CJD A;  1UI5 A;  3HTJ A;  3EUP A;  3G56 A;  3BT9 A;  5F0H A;  2I10 A;  4I6Z A;  5FKM A;  3AQT A;  2QKO A;  3NNR A;  4ME9 A;  5FKK A;  3G1M A;  2HYJ A;  3O8H A;  3EGQ A;  4MO7 A;  2R7S A;  2R7O A;  1JTY A;  4W1U A;  2G7G A;  3CWR A;  2O7T A;  3HIM A;  2HQ5 A;  1JT0 A;  2OF7 A;  3VVY A;  3HTH A;  3Q0U A;  3VW0 A;  2B1E A;  3S5R A;  5D18 A;  2ZOY A;  2R7V A;  3B6C A;  2A2F X;  5EYR A;  2DTZ A;  1ORK A;  1QPI A;  3F1B A;  3VVX A;  3ZQF A;  3C07 A;  1T56 A;  2G0E A;  2X9D A;  3Q0W A;  3RD3 A;  4AC0 A;  4OD4 A;  2NS8 A;  3KKC A;  5F0C A;  2EH3 A;  3PAS A;  2IEK A;  1SGM A;  4GCK A;  3G1L A;  3LSP A;  2QOP A;  2ZCX A;  2R7T A;  2GEN A;  2ZCM A;  3BJB A;  3ON2 A;  4DVY P;  3ZQI A;  3LSR A;  2FX0 A;  1JUP A;  2YVX A;  2FBQ A;  5F1J A;  2QCO A;  2TRT A;  2O7O A;  3QPS A;  2RHA A;  2UXO A;  3VP5 A;  2UXP A;  2OI8 A;  3CCY A;  5CXG A;  2W53 A;  5CQG A;  2UXI A;  2R7R A;  5K7F A;  2XRL A;  3G1O A;  4MK6 A;  5CXI A;  2IAI A;  2QTQ A;  2VPR A;  3HGY A;  2XGE A;  5FKO A;  2R7U A;  4U9L A;  1UI6 A;  2WGB A;  2XGD A;  2G7L A;  3ANG A;  3VW2 A;  4ABZ A;  2IU5 A;  3ZQG A;  2XPW A;  1RKT A;  4MXM A;  4AC6 A;  2GUH A;  3VIB A;  4OD5 A;  2RAS A;  5F27 A;  2HKU A;  3T6N A;  3G7R A;  4AF5 A;  3BRU A;  2DG8 A;  2ZCN A;  3FIW A;  3DU6 A;  1Z77 A;  3BTJ A;  5EZG A;  4G12 A;  2G3B A;  3GEU A;  3NI7 A;  3WHC A;  4D5F A;  3ANP A;  4NN1 A;  2NX4 A;  3SFI A;  2HXO A;  5K58 A;  3LHQ A;  2FQ4 A;  3O60 A;  2F07 A;  3COL A;  3VUQ A;  4M3G A;  3BR2 A;  3ON4 A;  1T33 A;  2Y31 A;  3FK6 A;  1RKW A;  3HGG A;  3LWJ A;  1VI0 A;  2UXH A;  3BR0 A;  3VOX A;  3BR1 A;  2HYT A; 
#chains in the Genus database with same CATH homology
 2VKV A;  3KKD A;  3Q3S A;  1QVT A;  2REK A;  3TP0 A;  3SDG A;  3NXC A;  2JK3 A;  3HTI A;  2ZB9 A;  3P9T A;  3QBM A;  5J1U A;  3O8G A;  3V78 A;  3B81 A;  4B1R A;  4JL3 A;  4UDS A;  4L62 A;  2OPT A;  4NEL A;  3HE0 A;  3BR6 A;  2NP3 A;  4W97 A;  2WUI A;  3BCG A;  3IH2 A;  3PPB A;  2Y2Z A;  2PBX A;  5IP6 A;  3CDL A;  1Z0X A;  5GPA A;  2NP5 A;  3MNL A;  5EFY A;  4V2F A;  2IBD A;  1JT6 A;  5J1R A;  2X6O A;  4JKZ A;  4YZE A;  3CRJ A;  4B3A A;  4M3D A;  4M3B A;  3WHB A;  2YVH A;  2QWT A;  3RH2 A;  2XGC A;  4AUX A;  4D7M A;  2Y30 A;  1U9O A;  5HBU A;  2TCT A;  3HTA A;  3IH4 A;  4JNN A;  3ZQL A;  3VW1 A;  3BTL A;  4DW6 A;  1QVU A;  1ZKG A;  2ID3 A;  4M3F A;  3BQY A;  3DCF A;  3ZQH A;  5IOY A;  1RPW A;  3AQS A;  2QIB A;  4GCT A;  5F04 A;  5EZH A;  2JJ7 A;  2RAE A;  4GCL A;  2GBY A;  4KWA A;  2XPV A;  5K7Z A;  5HAW A;  5FKL A;  3DPJ A;  1A6I A;  2PZ9 A;  4XK4 A;  5J3L A;  3GZI A;  5IPA A;  3JSJ A;  4JYK A;  5K7H A;  5FMP A;  1JUM A;  2G7S A;  2DG7 A;  4D7N A;  1JTX A;  2XPU A;  1JUS A;  2XDN A;  3BNI A;  3NRG A;  2HXI A;  4GFK A;  3LJL A;  5FKN A;  3PM1 A;  3VOK A;  5FGL A;  4M3E A;  5D19 A;  3QKX A;  1ZK8 A;  3E7Q A;  4GFL A;  3LOC A;  2GFN A;  3VVZ A;  3BR3 A;  3LSJ A;  1U9N A;  5D1R A;  3BQZ A;  4PXI A;  5HSZ A;  2NS7 A;  4HKU A;  3MVP A;  4D5C A;  3QPL A;  3NPI A;  4V2G A;  3BHQ A;  5F0F A;  3FK7 A;  2V57 A;  4CGR A;  4I76 A;  3BR5 A;  2D6Y A;  3TP3 A;  2FJ1 A;  3Q0V A;  2FD5 A;  2UXU A;  2WV1 A;  5DAJ A;  4ICH A;  4X1E A;  3IH3 A;  3C2B A;  2VKE A;  3DEW A;  5J1Y A;  2OER A;  3BTC A;  3IUV A;  3B6A A;  2XB5 A;  3V6G A;  5IOZ A;  3BTI A;  3F0C A;  5GP9 A;  2YVE A;  2Q24 A;  4ACI A;  3VPR A;  5FHP A;  5AQC A;  3FRQ A;  1BJZ A;  5C4Y A;  3KNW A;  3QQA A;  2ZOZ A;  5H9T A;  5CW8 A;  3KZ9 A;  5GPC A;  2ID6 A;  5F08 A;  3CJD A;  1UI5 A;  3HTJ A;  3EUP A;  3G56 A;  3BT9 A;  5F0H A;  2I10 A;  4I6Z A;  5FKM A;  3AQT A;  2QKO A;  3NNR A;  4ME9 A;  5FKK A;  3G1M A;  2HYJ A;  3O8H A;  3EGQ A;  4MO7 A;  1JTY A;  4W1U A;  2G7G A;  3CWR A;  2O7T A;  3HIM A;  2HQ5 A;  1JT0 A;  2OF7 A;  3VVY A;  3HTH A;  3Q0U A;  3VW0 A;  3S5R A;  5D18 A;  2ZOY A;  3B6C A;  5EYR A;  2DTZ A;  1ORK A;  1QPI A;  3F1B A;  3VVX A;  3ZQF A;  3C07 A;  1T56 A;  2G0E A;  2X9D A;  3Q0W A;  3RD3 A;  4AC0 A;  2NS8 A;  3KKC A;  5F0C A;  2EH3 A;  3PAS A;  2IEK A;  1SGM A;  4GCK A;  3G1L A;  3LSP A;  2QOP A;  2ZCX A;  2GEN A;  2ZCM A;  3BJB A;  3ON2 A;  3ZQI A;  3LSR A;  2FX0 A;  1JUP A;  2FBQ A;  5F1J A;  2QCO A;  2TRT A;  2O7O A;  3QPS A;  2RHA A;  2UXO A;  3VP5 A;  2UXP A;  2OI8 A;  3CCY A;  5CXG A;  2W53 A;  2UXI A;  5K7F A;  2XRL A;  3G1O A;  4MK6 A;  5CXI A;  2IAI A;  2QTQ A;  2VPR A;  3HGY A;  2XGE A;  5FKO A;  1UI6 A;  2WGB A;  2XGD A;  2G7L A;  3ANG A;  3VW2 A;  4ABZ A;  2IU5 A;  3ZQG A;  2XPW A;  1RKT A;  4MXM A;  4AC6 A;  2GUH A;  3VIB A;  2RAS A;  5F27 A;  2HKU A;  3T6N A;  3G7R A;  4AF5 A;  3BRU A;  2DG8 A;  2ZCN A;  3FIW A;  1Z77 A;  3BTJ A;  5EZG A;  4G12 A;  2G3B A;  3GEU A;  3NI7 A;  3WHC A;  4D5F A;  3ANP A;  4NN1 A;  2NX4 A;  3SFI A;  2HXO A;  5K58 A;  3LHQ A;  2FQ4 A;  3O60 A;  2F07 A;  3COL A;  3VUQ A;  4M3G A;  3BR2 A;  3ON4 A;  1T33 A;  2Y31 A;  3FK6 A;  1RKW A;  3HGG A;  3LWJ A;  1VI0 A;  2UXH A;  3BR0 A;  3VOX A;  3BR1 A;  2HYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...