3NRGA

Crystal structure of a tetr family transcriptional regulator (caur_2714) from chloroflexus aurantiacus j-10-fl at 2.56 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
b'GMPTETFFNLPEEKRSRLIDVLLDEFAQNDYDSVSINRITERAGIAKGSFYQYFADKKDCYLYLIQLGIEQKTAFLRQTPPASTTDMFAYLRWLLDVGIQFQFHNPRLAQIAYKALYDDVPLPAETMQVIRHGSFAYFKQLVEQGIADGSLVPDLDADTAAFVLNVVFTELGNHLIERFAVNPAELLREGGIVLLQPAMRRVIEQVIDILERGMRRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family transcriptional regulator
publication title Crystal structure of a TetR family transcriptional regulator (Caur_2714) from CHLOROFLEXUS AURANTIACUS J-10-FL at 2.56 A resolution
rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription
total genus 79
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nrgA00
2QCOA 2Y2ZA 1SGMA 3O8GA 4B1RA 5CXGA 2FJ1A 3KNWA 4KWAA 1QPIA 3WHCA 3FIWA 2UXHA 3BRUA 4L62A 3HTIA 2XGCA 2HXOA 3VVYA 5J1UA 4AC0A 5FKLA 3Q3SA 2XGEA 3LSJA 3Q0WA 2IU5A 2FD5A 3V78A 1Z0XA 2XPVA 4V2FA 2NX4A 2O7TA 2GBYA 3BTLA 3WHBA 1QVTA 2JK3A 3Q0UA 3KKCA 2NS7A 3RD3A 2ZCXA 1QVUA 4M3GA 5GPCA 3BR1A 4MXMA 3CJDA 3VW1A 2QWTA 3FK6A 3V6GA 3F1BA 2FQ4A 3IUVA 2QTQA 3SFIA 2DG8A 2ID6A 4GCLA 3VPRA 1ZK8A 3VUQA 5FMPA 3SDGA 2XPWA 2IEKA 4M3BA 3KZ9A 4JKZA 2VKVA 3IH2A 2HKUA 2W53A 5D18A 4W97A 2ZB9A 2G7GA 5K7HA 3HIMA 2TRTA 3MNLA 4D7NA 2EH3A 3ANPA 2ZCMA 3NPIA 2G0EA 4ME9A 3GZIA 3ON2A 3G1MA 3VOKA 5FHPA 5IPAA 3LWJA 2DG7A 3O60A 5F04A 3G56A 3IH4A 4ABZA 4MO7A 2Y31A 3TP0A 3C07A 5AQCA 1RPWA 2UXIA 2XPUA 3AQTA 5C4YA 3BR6A 5FKOA 3HGGA 1JUSA 5K7ZA 2OERA 3P9TA 5IP6A 3RH2A 3PM1A 1U9NA 4AUXA 3LOCA 3E7QA 4JNNA 3VW2A 3BHQA 2Q24A 1T33A 3DCFA 2UXUA 2DTZA 2GUHA 2RHAA 5F0HA 3VVXA 2O7OA 3BQYA 5F1JA 3QQAA 1BJZA 5FKMA 5HAWA 4ACIA 4AC6A 4M3DA 1RKWA 1U9OA 4W1UA 1UI6A 2G3BA 2NP3A 3COLA 2RAEA 5FKKA 3HE0A 2PBXA 2UXOA 2RASA 3F0CA 2OI8A 2IAIA 4JL3A 5CXIA 2G7LA 4NN1A 3G1OA 1JTYA 4PXIA 4I6ZA 3NRGA 1Z77A 3C2BA 3NXCA 2FX0A 4GFKA 3VIBA 2NS8A 1JT0A 4V2GA 3IH3A 2V57A 2WUIA 2QOPA 5F0FA 2PZ9A 2G7SA 3BCGA 4NELA 1A6IA 2I10A 3B6CA 4G12A 2X9DA 3LSRA 3BTCA 5F0CA 4I76A 4D5FA 3KKDA 3HGYA 3JSJA 4HKUA 3QPLA 2F07A 3ON4A 3FK7A 3T6NA 2HYTA 3BR5A 3BR2A 5D19A 3B6AA 1JUMA 1T56A 2OPTA 3LHQA 3BJBA 5F08A 2ZOZA 1RKTA 2XDNA 3O8HA 3NNRA 2ID3A 3G7RA 4MK6A 3QPSA 5H9TA 5F27A 3CDLA 3VW0A 4D5CA 4CGRA 5HBUA 2OF7A 2XGDA 3NI7A 3BR0A 4M3FA 3BTIA 2REKA 3ZQLA 5GPAA 3VP5A 5K58A 2HYJA 4D7MA 2TCTA 5FGLA 2JJ7A 2WV1A 2IBDA 3VVZA 3PPBA 3TP3A 1UI5A 2GENA 4GCKA 2FBQA 3EGQA 2YVEA 4M3EA 5EFYA 4XK4A 4YZEA 2GFNA 3BQZA 3CRJA 3LSPA 3HTHA 3BNIA 3QKXA 4B3AA 5K7FA 5EYRA 2D6YA 3ZQFA 3HTAA 1JTXA 4UDSA 3ZQIA 2HQ5A 2VPRA 1JT6A 1VI0A 3HTJA 2YVHA 3QBMA 1JUPA 5CW8A 3BT9A 3CWRA 3PASA 5J1YA 2UXPA 3Q0VA 5J1RA 2Y30A 3EUPA 4AF5A 3B81A 3DEWA 3FRQA 3AQSA 3DPJA 2WGBA 5GP9A 5FKNA 3S5RA 2ZCNA 4GCTA 1ORKA 2HXIA 5J3LA 3ANGA 3ZQGA 5HSZA 1ZKGA 5DAJA 2XRLA 2ZOYA 3CCYA 3BR3A 2QIBA 3G1LA 3LJLA 4ICHA 4X1EA 5IOYA 2VKEA 3ZQHA 3VOXA 3GEUA 2XB5A 4GFLA 2X6OA 3BTJA 5EZGA 3MVPA 4JYKA 4DW6A 5IOZA 2QKOA 5EZHA 5D1RA 2NP5A
chains in the Genus database with same CATH superfamily
2QCOA 2Y2ZA 1SGMA 3O8GA 4B1RA 5CXGA 2FJ1A 3KNWA 4KWAA 1QPIA 3WHCA 3FIWA 2UXHA 3BRUA 4L62A 3HTIA 2XGCA 2HXOA 3VVYA 5CQGA 5J1UA 4AC0A 5FKLA 3Q3SA 2XGEA 2R7UA 3LSJA 3Q0WA 2IU5A 2FD5A 3FHNA 3V78A 1Z0XA 2XPVA 4V2FA 2NX4A 2O7TA 2GBYA 3BTLA 3WHBA 1QVTA 2JK3A 2R7WA 3Q0UA 3KKCA 2NS7A 3SWHA 3RD3A 2ZCXA 1QVUA 4M3GA 5GPCA 3BR1A 4MXMA 3CJDA 2R7OA 3VW1A 2QWTA 3FK6A 3V6GA 3F1BA 2FQ4A 3IUVA 2QTQA 3SFIA 2DG8A 2ID6A 4GCLA 3VPRA 1ZK8A 3VUQA 5FMPA 3SDGA 2XPWA 2IEKA 4M3BA 3KZ9A 4JKZA 2VKVA 3IH2A 2HKUA 2W53A 5D18A 4W97A 4C2MA 2ZB9A 2G7GA 5K7HA 3HIMA 2TRTA 3MNLA 4D7NA 2EH3A 3ANPA 3DU5A 2ZCMA 3NPIA 2G0EA 4ME9A 3GZIA 3ON2A 3G1MA 3VOKA 5FHPA 5IPAA 3LWJA 2DG7A 3O60A 5F04A 3G56A 3IH4A 4ABZA 4MO7A 2R7XA 2Y31A 3TP0A 3C07A 5AQCA 1RPWA 2UXIA 2XPUA 3AQTA 5C4YA 3BR6A 5FKOA 3HGGA 1JUSA 5K7ZA 2OERA 3P9TA 5IP6A 3RH2A 3PM1A 1U9NA 4AUXA 3LOCA 3E7QA 4JNNA 3VW2A 3BHQA 2Q24A 1T33A 3DCFA 2UXUA 2DTZA 2GUHA 2RHAA 5F0HA 3VVXA 2O7OA 3BQYA 5F1JA 4OD5A 3QQAA 1BJZA 4U9NA 5FKMA 5HAWA 4ACIA 4AC6A 4M3DA 1RKWA 1U9OA 4W1UA 1UI6A 2G3BA 2NP3A 3COLA 2A2FX 2RAEA 5FKKA 3HE0A 2PBXA 2UXOA 2RASA 3F0CA 2OI8A 2IAIA 4JL3A 5CXIA 4DVYP 2G7LA 4U9LA 4NN1A 3G1OA 1JTYA 2R7RA 4PXIA 4I6ZA 3NRGA 3KYLA 1Z77A 3C2BA 3NXCA 2FX0A 4GFKA 3VIBA 2NS8A 1JT0A 4V2GA 3IH3A 2V57A 3DU6A 2WUIA 2QOPA 5F0FA 2PZ9A 2G7SA 2R7VA 3BCGA 4NELA 1A6IA 2I10A 3B6CA 4G12A 2X9DA 3LSRA 3BTCA 5F0CA 4I76A 4D5FA 3KKDA 3HGYA 3JSJA 4HKUA 3QPLA 2F07A 3K8PC 3NS4A 3ON4A 3FK7A 3T6NA 2HYTA 2PFVA 3BR5A 3BR2A 5D19A 3B6AA 1JUMA 1T56A 2B1EA 2OPTA 3LHQA 3BJBA 5F08A 2ZOZA 1RKTA 2XDNA 3O8HA 3NNRA 2ID3A 3G7RA 4MK6A 3QPSA 5H9TA 5F27A 3CDLA 3VW0A 4D5CA 4CGRA 5HBUA 2OF7A 2XGDA 3NI7A 4IRVA 3BR0A 4M3FA 3BTIA 2REKA 3ZQLA 5GPAA 2B3WA 3VP5A 5K58A 2HYJA 4D7MA 2TCTA 5FGLA 2JJ7A 2WV1A 2IBDA 3VVZA 2FJI1 3PPBA 3TP3A 1UI5A 2GENA 2R7TA 4GCKA 2FBQA 3EGQA 2YVEA 4M3EA 5EFYA 4XK4A 4YZEA 2GFNA 3BQZA 3CRJA 3LSPA 3VTIA 3HTHA 3BNIA 3QKXA 4B3AA 5K7FA 5EYRA 2D6YA 3ZQFA 3HTAA 1JTXA 4UDSA 3ZQIA 2HQ5A 2VPRA 4WIBA 2YVXA 1JT6A 1VI0A 3HTJA 2YVHA 3QBMA 1JUPA 5CW8A 3BT9A 3CWRA 3PASA 5J1YA 2UXPA 3Q0VA 5J1RA 4OD4A 2Y30A 3EUPA 4AF5A 3B81A 3DEWA 2R7QA 3FRQA 3AQSA 3DPJA 2WGBA 5GP9A 5FKNA 3S5RA 2ZCNA 4GCTA 1ORKA 2ZY9A 2HXIA 5J3LA 3ANGA 3ZQGA 5HSZA 2R7SA 1ZKGA 5DAJA 2XRLA 2ZOYA 3CCYA 3BR3A 2QIBA 3G1LA 3LJLA 4ICHA 4X1EA 5IOYA 2VKEA 3ZQHA 3VOXA 3GEUA 2XB5A 4GFLA 2X6OA 3BTJA 5EZGA 3MVPA 4JYKA 4DW6A 5IOZA 2QKOA 5EZHA 5D1RA 2NP5A
chains in the Genus database with same CATH topology
2QCOA 2Y2ZA 1SGMA 3O8GA 4B1RA 5CXGA 2FJ1A 3KNWA 4KWAA 1QPIA 3WHCA 3FIWA 2UXHA 3BRUA 4L62A 3HTIA 2XGCA 2HXOA 3VVYA 5J1UA 4AC0A 5FKLA 3Q3SA 2XGEA 3LSJA 3Q0WA 2IU5A 2FD5A 3V78A 1Z0XA 2XPVA 4V2FA 2NX4A 2O7TA 2GBYA 3BTLA 3WHBA 1QVTA 2JK3A 3Q0UA 3KKCA 2NS7A 3RD3A 2ZCXA 1QVUA 4M3GA 5GPCA 3BR1A 4MXMA 3CJDA 3VW1A 2QWTA 3FK6A 3V6GA 3F1BA 2FQ4A 3IUVA 2QTQA 3SFIA 2DG8A 2ID6A 4GCLA 3VPRA 1ZK8A 3VUQA 5FMPA 3SDGA 2XPWA 2IEKA 4M3BA 3KZ9A 4JKZA 2VKVA 3IH2A 2HKUA 2W53A 5D18A 4W97A 2ZB9A 2G7GA 5K7HA 3HIMA 2TRTA 3MNLA 4D7NA 2EH3A 3ANPA 2ZCMA 3NPIA 2G0EA 4ME9A 3GZIA 3ON2A 3G1MA 3VOKA 5FHPA 5IPAA 3LWJA 2DG7A 3O60A 5F04A 3G56A 3IH4A 4ABZA 4MO7A 2Y31A 3TP0A 3C07A 5AQCA 1RPWA 2UXIA 2XPUA 3AQTA 5C4YA 3BR6A 5FKOA 3HGGA 1JUSA 5K7ZA 2OERA 3P9TA 5IP6A 3RH2A 3PM1A 1U9NA 4AUXA 3LOCA 3E7QA 4JNNA 3VW2A 3BHQA 2Q24A 1T33A 3DCFA 2UXUA 2DTZA 2GUHA 2RHAA 5F0HA 3VVXA 2O7OA 3BQYA 5F1JA 3QQAA 1BJZA 5FKMA 5HAWA 4ACIA 4AC6A 4M3DA 1RKWA 1U9OA 4W1UA 1UI6A 2G3BA 2NP3A 3COLA 2RAEA 5FKKA 3HE0A 2PBXA 2UXOA 2RASA 3F0CA 2OI8A 2IAIA 4JL3A 5CXIA 2G7LA 4NN1A 3G1OA 1JTYA 4PXIA 4I6ZA 3NRGA 1Z77A 3C2BA 3NXCA 2FX0A 4GFKA 3VIBA 2NS8A 1JT0A 4V2GA 3IH3A 2V57A 2WUIA 2QOPA 5F0FA 2PZ9A 2G7SA 3BCGA 4NELA 1A6IA 2I10A 3B6CA 4G12A 2X9DA 3LSRA 3BTCA 5F0CA 4I76A 4D5FA 3KKDA 3HGYA 3JSJA 4HKUA 3QPLA 2F07A 3ON4A 3FK7A 3T6NA 2HYTA 3BR5A 3BR2A 5D19A 3B6AA 1JUMA 1T56A 2OPTA 3LHQA 3BJBA 5F08A 2ZOZA 1RKTA 2XDNA 3O8HA 3NNRA 2ID3A 3G7RA 4MK6A 3QPSA 5H9TA 5F27A 3CDLA 3VW0A 4D5CA 4CGRA 5HBUA 2OF7A 2XGDA 3NI7A 3BR0A 4M3FA 3BTIA 2REKA 3ZQLA 5GPAA 3VP5A 5K58A 2HYJA 4D7MA 2TCTA 5FGLA 2JJ7A 2WV1A 2IBDA 3VVZA 3PPBA 3TP3A 1UI5A 2GENA 4GCKA 2FBQA 3EGQA 2YVEA 4M3EA 5EFYA 4XK4A 4YZEA 2GFNA 3BQZA 3CRJA 3LSPA 3HTHA 3BNIA 3QKXA 4B3AA 5K7FA 5EYRA 2D6YA 3ZQFA 3HTAA 1JTXA 4UDSA 3ZQIA 2HQ5A 2VPRA 1JT6A 1VI0A 3HTJA 2YVHA 3QBMA 1JUPA 5CW8A 3BT9A 3CWRA 3PASA 5J1YA 2UXPA 3Q0VA 5J1RA 2Y30A 3EUPA 4AF5A 3B81A 3DEWA 3FRQA 3AQSA 3DPJA 2WGBA 5GP9A 5FKNA 3S5RA 2ZCNA 4GCTA 1ORKA 2HXIA 5J3LA 3ANGA 3ZQGA 5HSZA 1ZKGA 5DAJA 2XRLA 2ZOYA 3CCYA 3BR3A 2QIBA 3G1LA 3LJLA 4ICHA 4X1EA 5IOYA 2VKEA 3ZQHA 3VOXA 3GEUA 2XB5A 4GFLA 2X6OA 3BTJA 5EZGA 3MVPA 4JYKA 4DW6A 5IOZA 2QKOA 5EZHA 5D1RA 2NP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCO A;  2Y2Z A;  1SGM A;  3O8G A;  4B1R A;  5CXG A;  2FJ1 A;  3KNW A;  4KWA A;  1QPI A;  3WHC A;  3FIW A;  2UXH A;  3BRU A;  4L62 A;  3HTI A;  2XGC A;  2HXO A;  3VVY A;  5J1U A;  4AC0 A;  5FKL A;  3Q3S A;  2XGE A;  3LSJ A;  3Q0W A;  2IU5 A;  2FD5 A;  3V78 A;  1Z0X A;  2XPV A;  4V2F A;  2NX4 A;  2O7T A;  2GBY A;  3BTL A;  3WHB A;  1QVT A;  2JK3 A;  3Q0U A;  3KKC A;  2NS7 A;  3RD3 A;  2ZCX A;  1QVU A;  4M3G A;  5GPC A;  3BR1 A;  4MXM A;  3CJD A;  3VW1 A;  2QWT A;  3FK6 A;  3V6G A;  3F1B A;  2FQ4 A;  3IUV A;  2QTQ A;  3SFI A;  2DG8 A;  2ID6 A;  4GCL A;  3VPR A;  1ZK8 A;  3VUQ A;  5FMP A;  3SDG A;  2XPW A;  2IEK A;  4M3B A;  3KZ9 A;  4JKZ A;  2VKV A;  3IH2 A;  2HKU A;  2W53 A;  5D18 A;  4W97 A;  2ZB9 A;  2G7G A;  5K7H A;  3HIM A;  2TRT A;  3MNL A;  4D7N A;  2EH3 A;  3ANP A;  2ZCM A;  3NPI A;  2G0E A;  4ME9 A;  3GZI A;  3ON2 A;  3G1M A;  3VOK A;  5FHP A;  5IPA A;  3LWJ A;  2DG7 A;  3O60 A;  5F04 A;  3G56 A;  3IH4 A;  4ABZ A;  4MO7 A;  2Y31 A;  3TP0 A;  3C07 A;  5AQC A;  1RPW A;  2UXI A;  2XPU A;  3AQT A;  5C4Y A;  3BR6 A;  5FKO A;  3HGG A;  1JUS A;  5K7Z A;  2OER A;  3P9T A;  5IP6 A;  3RH2 A;  3PM1 A;  1U9N A;  4AUX A;  3LOC A;  3E7Q A;  4JNN A;  3VW2 A;  3BHQ A;  2Q24 A;  1T33 A;  3DCF A;  2UXU A;  2DTZ A;  2GUH A;  2RHA A;  5F0H A;  3VVX A;  2O7O A;  3BQY A;  5F1J A;  3QQA A;  1BJZ A;  5FKM A;  5HAW A;  4ACI A;  4AC6 A;  4M3D A;  1RKW A;  1U9O A;  4W1U A;  1UI6 A;  2G3B A;  2NP3 A;  3COL A;  2RAE A;  5FKK A;  3HE0 A;  2PBX A;  2UXO A;  2RAS A;  3F0C A;  2OI8 A;  2IAI A;  4JL3 A;  5CXI A;  2G7L A;  4NN1 A;  3G1O A;  1JTY A;  4PXI A;  4I6Z A;  3NRG A;  1Z77 A;  3C2B A;  3NXC A;  2FX0 A;  4GFK A;  3VIB A;  2NS8 A;  1JT0 A;  4V2G A;  3IH3 A;  2V57 A;  2WUI A;  2QOP A;  5F0F A;  2PZ9 A;  2G7S A;  3BCG A;  4NEL A;  1A6I A;  2I10 A;  3B6C A;  4G12 A;  2X9D A;  3LSR A;  3BTC A;  5F0C A;  4I76 A;  4D5F A;  3KKD A;  3HGY A;  3JSJ A;  4HKU A;  3QPL A;  2F07 A;  3ON4 A;  3FK7 A;  3T6N A;  2HYT A;  3BR5 A;  3BR2 A;  5D19 A;  3B6A A;  1JUM A;  1T56 A;  2OPT A;  3LHQ A;  3BJB A;  5F08 A;  2ZOZ A;  1RKT A;  2XDN A;  3O8H A;  3NNR A;  2ID3 A;  3G7R A;  4MK6 A;  3QPS A;  5H9T A;  5F27 A;  3CDL A;  3VW0 A;  4D5C A;  4CGR A;  5HBU A;  2OF7 A;  2XGD A;  3NI7 A;  3BR0 A;  4M3F A;  3BTI A;  2REK A;  3ZQL A;  5GPA A;  3VP5 A;  5K58 A;  2HYJ A;  4D7M A;  2TCT A;  5FGL A;  2JJ7 A;  2WV1 A;  2IBD A;  3VVZ A;  3PPB A;  3TP3 A;  1UI5 A;  2GEN A;  4GCK A;  2FBQ A;  3EGQ A;  2YVE A;  4M3E A;  5EFY A;  4XK4 A;  4YZE A;  2GFN A;  3BQZ A;  3CRJ A;  3LSP A;  3HTH A;  3BNI A;  3QKX A;  4B3A A;  5K7F A;  5EYR A;  2D6Y A;  3ZQF A;  3HTA A;  1JTX A;  4UDS A;  3ZQI A;  2HQ5 A;  2VPR A;  1JT6 A;  1VI0 A;  3HTJ A;  2YVH A;  3QBM A;  1JUP A;  5CW8 A;  3BT9 A;  3CWR A;  3PAS A;  5J1Y A;  2UXP A;  3Q0V A;  5J1R A;  2Y30 A;  3EUP A;  4AF5 A;  3B81 A;  3DEW A;  3FRQ A;  3AQS A;  3DPJ A;  2WGB A;  5GP9 A;  5FKN A;  3S5R A;  2ZCN A;  4GCT A;  1ORK A;  2HXI A;  5J3L A;  3ANG A;  3ZQG A;  5HSZ A;  1ZKG A;  5DAJ A;  2XRL A;  2ZOY A;  3CCY A;  3BR3 A;  2QIB A;  3G1L A;  3LJL A;  4ICH A;  4X1E A;  5IOY A;  2VKE A;  3ZQH A;  3VOX A;  3GEU A;  2XB5 A;  4GFL A;  2X6O A;  3BTJ A;  5EZG A;  3MVP A;  4JYK A;  4DW6 A;  5IOZ A;  2QKO A;  5EZH A;  5D1R A;  2NP5 A; 
#chains in the Genus database with same CATH topology
 2QCO A;  2Y2Z A;  1SGM A;  3O8G A;  4B1R A;  5CXG A;  2FJ1 A;  3KNW A;  4KWA A;  1QPI A;  3WHC A;  3FIW A;  2UXH A;  3BRU A;  4L62 A;  3HTI A;  2XGC A;  2HXO A;  3VVY A;  5CQG A;  5J1U A;  4AC0 A;  5FKL A;  3Q3S A;  2XGE A;  2R7U A;  3LSJ A;  3Q0W A;  2IU5 A;  2FD5 A;  3FHN A;  3V78 A;  1Z0X A;  2XPV A;  4V2F A;  2NX4 A;  2O7T A;  2GBY A;  3BTL A;  3WHB A;  1QVT A;  2JK3 A;  2R7W A;  3Q0U A;  3KKC A;  2NS7 A;  3SWH A;  3RD3 A;  2ZCX A;  1QVU A;  4M3G A;  5GPC A;  3BR1 A;  4MXM A;  3CJD A;  2R7O A;  3VW1 A;  2QWT A;  3FK6 A;  3V6G A;  3F1B A;  2FQ4 A;  3IUV A;  2QTQ A;  3SFI A;  2DG8 A;  2ID6 A;  4GCL A;  3VPR A;  1ZK8 A;  3VUQ A;  5FMP A;  3SDG A;  2XPW A;  2IEK A;  4M3B A;  3KZ9 A;  4JKZ A;  2VKV A;  3IH2 A;  2HKU A;  2W53 A;  5D18 A;  4W97 A;  4C2M A;  2ZB9 A;  2G7G A;  5K7H A;  3HIM A;  2TRT A;  3MNL A;  4D7N A;  2EH3 A;  3ANP A;  3DU5 A;  2ZCM A;  3NPI A;  2G0E A;  4ME9 A;  3GZI A;  3ON2 A;  3G1M A;  3VOK A;  5FHP A;  5IPA A;  3LWJ A;  2DG7 A;  3O60 A;  5F04 A;  3G56 A;  3IH4 A;  4ABZ A;  4MO7 A;  2R7X A;  2Y31 A;  3TP0 A;  3C07 A;  5AQC A;  1RPW A;  2UXI A;  2XPU A;  3AQT A;  5C4Y A;  3BR6 A;  5FKO A;  3HGG A;  1JUS A;  5K7Z A;  2OER A;  3P9T A;  5IP6 A;  3RH2 A;  3PM1 A;  1U9N A;  4AUX A;  3LOC A;  3E7Q A;  4JNN A;  3VW2 A;  3BHQ A;  2Q24 A;  1T33 A;  3DCF A;  2UXU A;  2DTZ A;  2GUH A;  2RHA A;  5F0H A;  3VVX A;  2O7O A;  3BQY A;  5F1J A;  4OD5 A;  3QQA A;  1BJZ A;  4U9N A;  5FKM A;  5HAW A;  4ACI A;  4AC6 A;  4M3D A;  1RKW A;  1U9O A;  4W1U A;  1UI6 A;  2G3B A;  2NP3 A;  3COL A;  2A2F X;  2RAE A;  5FKK A;  3HE0 A;  2PBX A;  2UXO A;  2RAS A;  3F0C A;  2OI8 A;  2IAI A;  4JL3 A;  5CXI A;  4DVY P;  2G7L A;  4U9L A;  4NN1 A;  3G1O A;  1JTY A;  2R7R A;  4PXI A;  4I6Z A;  3NRG A;  3KYL A;  1Z77 A;  3C2B A;  3NXC A;  2FX0 A;  4GFK A;  3VIB A;  2NS8 A;  1JT0 A;  4V2G A;  3IH3 A;  2V57 A;  3DU6 A;  2WUI A;  2QOP A;  5F0F A;  2PZ9 A;  2G7S A;  2R7V A;  3BCG A;  4NEL A;  1A6I A;  2I10 A;  3B6C A;  4G12 A;  2X9D A;  3LSR A;  3BTC A;  5F0C A;  4I76 A;  4D5F A;  3KKD A;  3HGY A;  3JSJ A;  4HKU A;  3QPL A;  2F07 A;  3K8P C;  3NS4 A;  3ON4 A;  3FK7 A;  3T6N A;  2HYT A;  2PFV A;  3BR5 A;  3BR2 A;  5D19 A;  3B6A A;  1JUM A;  1T56 A;  2B1E A;  2OPT A;  3LHQ A;  3BJB A;  5F08 A;  2ZOZ A;  1RKT A;  2XDN A;  3O8H A;  3NNR A;  2ID3 A;  3G7R A;  4MK6 A;  3QPS A;  5H9T A;  5F27 A;  3CDL A;  3VW0 A;  4D5C A;  4CGR A;  5HBU A;  2OF7 A;  2XGD A;  3NI7 A;  4IRV A;  3BR0 A;  4M3F A;  3BTI A;  2REK A;  3ZQL A;  5GPA A;  2B3W A;  3VP5 A;  5K58 A;  2HYJ A;  4D7M A;  2TCT A;  5FGL A;  2JJ7 A;  2WV1 A;  2IBD A;  3VVZ A;  2FJI 1;  3PPB A;  3TP3 A;  1UI5 A;  2GEN A;  2R7T A;  4GCK A;  2FBQ A;  3EGQ A;  2YVE A;  4M3E A;  5EFY A;  4XK4 A;  4YZE A;  2GFN A;  3BQZ A;  3CRJ A;  3LSP A;  3VTI A;  3HTH A;  3BNI A;  3QKX A;  4B3A A;  5K7F A;  5EYR A;  2D6Y A;  3ZQF A;  3HTA A;  1JTX A;  4UDS A;  3ZQI A;  2HQ5 A;  2VPR A;  4WIB A;  2YVX A;  1JT6 A;  1VI0 A;  3HTJ A;  2YVH A;  3QBM A;  1JUP A;  5CW8 A;  3BT9 A;  3CWR A;  3PAS A;  5J1Y A;  2UXP A;  3Q0V A;  5J1R A;  4OD4 A;  2Y30 A;  3EUP A;  4AF5 A;  3B81 A;  3DEW A;  2R7Q A;  3FRQ A;  3AQS A;  3DPJ A;  2WGB A;  5GP9 A;  5FKN A;  3S5R A;  2ZCN A;  4GCT A;  1ORK A;  2ZY9 A;  2HXI A;  5J3L A;  3ANG A;  3ZQG A;  5HSZ A;  2R7S A;  1ZKG A;  5DAJ A;  2XRL A;  2ZOY A;  3CCY A;  3BR3 A;  2QIB A;  3G1L A;  3LJL A;  4ICH A;  4X1E A;  5IOY A;  2VKE A;  3ZQH A;  3VOX A;  3GEU A;  2XB5 A;  4GFL A;  2X6O A;  3BTJ A;  5EZG A;  3MVP A;  4JYK A;  4DW6 A;  5IOZ A;  2QKO A;  5EZH A;  5D1R A;  2NP5 A; 
#chains in the Genus database with same CATH homology
 2QCO A;  2Y2Z A;  1SGM A;  3O8G A;  4B1R A;  5CXG A;  2FJ1 A;  3KNW A;  4KWA A;  1QPI A;  3WHC A;  3FIW A;  2UXH A;  3BRU A;  4L62 A;  3HTI A;  2XGC A;  2HXO A;  3VVY A;  5J1U A;  4AC0 A;  5FKL A;  3Q3S A;  2XGE A;  3LSJ A;  3Q0W A;  2IU5 A;  2FD5 A;  3V78 A;  1Z0X A;  2XPV A;  4V2F A;  2NX4 A;  2O7T A;  2GBY A;  3BTL A;  3WHB A;  1QVT A;  2JK3 A;  3Q0U A;  3KKC A;  2NS7 A;  3RD3 A;  2ZCX A;  1QVU A;  4M3G A;  5GPC A;  3BR1 A;  4MXM A;  3CJD A;  3VW1 A;  2QWT A;  3FK6 A;  3V6G A;  3F1B A;  2FQ4 A;  3IUV A;  2QTQ A;  3SFI A;  2DG8 A;  2ID6 A;  4GCL A;  3VPR A;  1ZK8 A;  3VUQ A;  5FMP A;  3SDG A;  2XPW A;  2IEK A;  4M3B A;  3KZ9 A;  4JKZ A;  2VKV A;  3IH2 A;  2HKU A;  2W53 A;  5D18 A;  4W97 A;  2ZB9 A;  2G7G A;  5K7H A;  3HIM A;  2TRT A;  3MNL A;  4D7N A;  2EH3 A;  3ANP A;  2ZCM A;  3NPI A;  2G0E A;  4ME9 A;  3GZI A;  3ON2 A;  3G1M A;  3VOK A;  5FHP A;  5IPA A;  3LWJ A;  2DG7 A;  3O60 A;  5F04 A;  3G56 A;  3IH4 A;  4ABZ A;  4MO7 A;  2Y31 A;  3TP0 A;  3C07 A;  5AQC A;  1RPW A;  2UXI A;  2XPU A;  3AQT A;  5C4Y A;  3BR6 A;  5FKO A;  3HGG A;  1JUS A;  5K7Z A;  2OER A;  3P9T A;  5IP6 A;  3RH2 A;  3PM1 A;  1U9N A;  4AUX A;  3LOC A;  3E7Q A;  4JNN A;  3VW2 A;  3BHQ A;  2Q24 A;  1T33 A;  3DCF A;  2UXU A;  2DTZ A;  2GUH A;  2RHA A;  5F0H A;  3VVX A;  2O7O A;  3BQY A;  5F1J A;  3QQA A;  1BJZ A;  5FKM A;  5HAW A;  4ACI A;  4AC6 A;  4M3D A;  1RKW A;  1U9O A;  4W1U A;  1UI6 A;  2G3B A;  2NP3 A;  3COL A;  2RAE A;  5FKK A;  3HE0 A;  2PBX A;  2UXO A;  2RAS A;  3F0C A;  2OI8 A;  2IAI A;  4JL3 A;  5CXI A;  2G7L A;  4NN1 A;  3G1O A;  1JTY A;  4PXI A;  4I6Z A;  3NRG A;  1Z77 A;  3C2B A;  3NXC A;  2FX0 A;  4GFK A;  3VIB A;  2NS8 A;  1JT0 A;  4V2G A;  3IH3 A;  2V57 A;  2WUI A;  2QOP A;  5F0F A;  2PZ9 A;  2G7S A;  3BCG A;  4NEL A;  1A6I A;  2I10 A;  3B6C A;  4G12 A;  2X9D A;  3LSR A;  3BTC A;  5F0C A;  4I76 A;  4D5F A;  3KKD A;  3HGY A;  3JSJ A;  4HKU A;  3QPL A;  2F07 A;  3ON4 A;  3FK7 A;  3T6N A;  2HYT A;  3BR5 A;  3BR2 A;  5D19 A;  3B6A A;  1JUM A;  1T56 A;  2OPT A;  3LHQ A;  3BJB A;  5F08 A;  2ZOZ A;  1RKT A;  2XDN A;  3O8H A;  3NNR A;  2ID3 A;  3G7R A;  4MK6 A;  3QPS A;  5H9T A;  5F27 A;  3CDL A;  3VW0 A;  4D5C A;  4CGR A;  5HBU A;  2OF7 A;  2XGD A;  3NI7 A;  3BR0 A;  4M3F A;  3BTI A;  2REK A;  3ZQL A;  5GPA A;  3VP5 A;  5K58 A;  2HYJ A;  4D7M A;  2TCT A;  5FGL A;  2JJ7 A;  2WV1 A;  2IBD A;  3VVZ A;  3PPB A;  3TP3 A;  1UI5 A;  2GEN A;  4GCK A;  2FBQ A;  3EGQ A;  2YVE A;  4M3E A;  5EFY A;  4XK4 A;  4YZE A;  2GFN A;  3BQZ A;  3CRJ A;  3LSP A;  3HTH A;  3BNI A;  3QKX A;  4B3A A;  5K7F A;  5EYR A;  2D6Y A;  3ZQF A;  3HTA A;  1JTX A;  4UDS A;  3ZQI A;  2HQ5 A;  2VPR A;  1JT6 A;  1VI0 A;  3HTJ A;  2YVH A;  3QBM A;  1JUP A;  5CW8 A;  3BT9 A;  3CWR A;  3PAS A;  5J1Y A;  2UXP A;  3Q0V A;  5J1R A;  2Y30 A;  3EUP A;  4AF5 A;  3B81 A;  3DEW A;  3FRQ A;  3AQS A;  3DPJ A;  2WGB A;  5GP9 A;  5FKN A;  3S5R A;  2ZCN A;  4GCT A;  1ORK A;  2HXI A;  5J3L A;  3ANG A;  3ZQG A;  5HSZ A;  1ZKG A;  5DAJ A;  2XRL A;  2ZOY A;  3CCY A;  3BR3 A;  2QIB A;  3G1L A;  3LJL A;  4ICH A;  4X1E A;  5IOY A;  2VKE A;  3ZQH A;  3VOX A;  3GEU A;  2XB5 A;  4GFL A;  2X6O A;  3BTJ A;  5EZG A;  3MVP A;  4JYK A;  4DW6 A;  5IOZ A;  2QKO A;  5EZH A;  5D1R A;  2NP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...