3NRGA

Crystal structure of a tetr family transcriptional regulator (caur_2714) from chloroflexus aurantiacus j-10-fl at 2.56 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GMPTETFFNLPEEKRSRLIDVLLDEFAQNDYDSVSINRITERAGIAKGSFYQYFADKKDCYLYLIQLGIEQKTAFLRQTPPASTTDMFAYLRWLLDVGIQFQFHNPRLAQIAYKALYDDVPLPAETMQVIRHGSFAYFKQLVEQGIADGSLVPDLDADTAAFVLNVVFTELGNHLIERFAVNPAELLREGGIVLLQPAMRRVIEQVIDILERGMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TetR family transcriptional regulator (Caur_2714) from CHLOROFLEXUS AURANTIACUS J-10-FL at 2.56 A resolution
rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription
molecule keywords TetR family transcriptional regulator
total genus 79
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nrgA00
2ZOYA 1SGMA 2XGEA 3NRGA 2IEKA 2DG7A 2VKVA 5HSZA 2I10A 2GBYA 1RKTA 3GEUA 5CW8A 2EH3A 5CXGA 1Z0XA 3MVPA 4JYKA 5J1RA 2XPUA 2RHAA 5F0HA 2NX4A 4YZEA 2G7LA 5K7FA 4V2FA 5GPCA 2NP5A 3ZQLA 2DTZA 3HGGA 3O8GA 3ANPA 5H9TA 2WUIA 3KKCA 2QIBA 3T6NA 5EZHA 2FX0A 2O7TA 3BTLA 2OERA 1UI5A 4D5CA 5FKMA 5HBUA 2IBDA 2XB5A 3S5RA 1JUSA 5FMPA 3ON2A 2G0EA 3JSJA 2JJ7A 5CXIA 5FKLA 5D19A 3FK7A 3LWJA 2WGBA 3IUVA 3G1LA 4M3GA 3LHQA 3SDGA 4M3FA 2ZCXA 2HYTA 2NS7A 3FIWA 3TP3A 1UI6A 3BHQA 3F0CA 3F1BA 3PM1A 3VPRA 2RAEA 2OI8A 3QBMA 4AF5A 1JUPA 3B81A 3DCFA 4GCKA 1T33A 2FD5A 1QVTA 3IH2A 2Q24A 5DAJA 2Y31A 2UXOA 4ICHA 3HTAA 2D6YA 4GFKA 3IH3A 3KKDA 1BJZA 2GFNA 3BR6A 2YVEA 3VVZA 2REKA 2Y30A 4KWAA 1RPWA 4JL3A 3P9TA 3VW2A 5EZGA 3WHCA 3O60A 2HYJA 3IH4A 5FKOA 3BRUA 3C2BA 1Z77A 3G1MA 3VUQA 2GUHA 2FQ4A 4GFLA 4MK6A 2O7OA 5J1YA 5IPAA 3VW0A 2OPTA 5IOZA 2NS8A 2XGDA 3CRJA 1ZK8A 2JK3A 5F1JA 4I76A 3BR2A 2TCTA 2RASA 3AQTA 3DPJA 2ZB9A 3RH2A 5F0CA 5AQCA 5FGLA 3TP0A 4B1RA 4X1EA 3RD3A 4MO7A 3VOXA 2G7SA 4DW6A 4AUXA 4JKZA 3COLA 2VKEA 3G56A 3LJLA 3CJDA 3Q3SA 3Q0UA 3QPLA 4PXIA 3NXCA 2X6OA 3VP5A 4D5FA 3QPSA 3FK6A 2V57A 5F08A 2QKOA 2HQ5A 1JUMA 3SFIA 4D7MA 3HTHA 3V6GA 4W1UA 2FBQA 3HTJA 3KNWA 5J3LA 4ACIA 4MXMA 3QKXA 2ZCMA 2IU5A 3Q0WA 3BR0A 2PBXA 3BCGA 2YVHA 4ABZA 5K7ZA 3G7RA 5EYRA 2XGCA 3C07A 5D1RA 3BTIA 1JTXA 2XPVA 4B3AA 1T56A 4G12A 4CGRA 3EUPA 3VOKA 1QVUA 4L62A 4XK4A 1JT0A 3BNIA 2ID3A 2QTQA 3PPBA 1ZKGA 5EFYA 2UXHA 2XDNA 5FKNA 3EGQA 1U9NA 2G3BA 2DG8A 1JTYA 3VIBA 3NI7A 4HKUA 3G1OA 1QPIA 4GCLA 5GP9A 2PZ9A 5K7HA 5GPAA 4JNNA 3VW1A 2ID6A 3KZ9A 4W97A 4M3BA 3E7QA 4I6ZA 3BJBA 2TRTA 2QCOA 2F07A 5D18A 3BR3A 3ZQGA 3GZIA 3BTJA 2Y2ZA 3BT9A 2HXOA 3NPIA 3DEWA 3ANGA 3BR5A 3V78A 3B6AA 3CDLA 2UXUA 2FJ1A 5F27A 4AC6A 2QOPA 1JT6A 3Q0VA 3ZQFA 3HE0A 3QQAA 2QWTA 2W53A 2ZOZA 2XRLA 4NELA 5F0FA 3MNLA 3ON4A 1A6IA 1U9OA 3O8HA 3ZQIA 3HGYA 4ME9A 4M3EA 3LSJA 3BQYA 3NNRA 2XPWA 4D7NA 3CCYA 2WV1A 2G7GA 5IP6A 5FHPA 2GENA 2UXIA 3BTCA 2UXPA 2OF7A 3AQSA 2HXIA 3B6CA 4GCTA 5HAWA 3FRQA 3BQZA 3BR1A 3PASA 1VI0A 4NN1A 2HKUA 5K58A 3HTIA 3LOCA 3VVYA 3HIMA 2ZCNA 2X9DA 1RKWA 5FKKA 5IOYA 2VPRA 4V2GA 4AC0A 5C4YA 3WHBA 3CWRA 3LSPA 2NP3A 2IAIA 3ZQHA 4UDSA 1ORKA 3VVXA 5J1UA 3LSRA 5F04A 4M3DA
chains in the Genus database with same CATH superfamily
4OD5A 2ZOYA 1SGMA 2XGEA 3NRGA 2IEKA 2DG7A 3K8PC 2VKVA 5HSZA 2I10A 2GBYA 4U9LA 1RKTA 3GEUA 5CW8A 2EH3A 2FJI1 5CXGA 1Z0XA 3MVPA 4JYKA 5J1RA 2XPUA 2RHAA 5F0HA 2NX4A 4YZEA 2G7LA 5K7FA 4V2FA 5GPCA 2NP5A 2R7WA 3ZQLA 2DTZA 3HGGA 3O8GA 3ANPA 5H9TA 2WUIA 3KKCA 2QIBA 3T6NA 5EZHA 2FX0A 2O7TA 3BTLA 2OERA 1UI5A 4D5CA 5FKMA 5HBUA 4U9NA 2IBDA 2YVXA 2XB5A 3S5RA 1JUSA 5FMPA 3ON2A 2G0EA 3JSJA 2JJ7A 5CXIA 5FKLA 5D19A 2R7VA 3FK7A 3LWJA 2WGBA 3IUVA 3G1LA 4M3GA 3LHQA 3SDGA 4M3FA 2ZCXA 4OD4A 2HYTA 2NS7A 3FIWA 3TP3A 1UI6A 3BHQA 3F0CA 3F1BA 3PM1A 3VPRA 2RAEA 2OI8A 3QBMA 4AF5A 1JUPA 3B81A 3DCFA 4GCKA 3VTIA 1T33A 2FD5A 1QVTA 3IH2A 2Q24A 5DAJA 2Y31A 2UXOA 4ICHA 3HTAA 2D6YA 4GFKA 3IH3A 3KKDA 1BJZA 2GFNA 3BR6A 2YVEA 3VVZA 2REKA 2Y30A 4KWAA 1RPWA 3DU5A 3NS4A 2R7OA 4JL3A 3P9TA 3VW2A 5EZGA 3WHCA 3O60A 2HYJA 3IH4A 5FKOA 3BRUA 3C2BA 2B3WA 1Z77A 3G1MA 3VUQA 2GUHA 2FQ4A 4GFLA 4MK6A 2O7OA 5J1YA 5IPAA 3VW0A 3DU6A 2OPTA 5IOZA 2NS8A 2XGDA 3CRJA 1ZK8A 2JK3A 5F1JA 4I76A 3BR2A 2TCTA 2A2FX 2RASA 3AQTA 3DPJA 2ZB9A 3RH2A 5F0CA 5AQCA 5FGLA 3TP0A 4B1RA 2R7UA 4X1EA 3RD3A 4MO7A 4IRVA 3VOXA 2G7SA 4DW6A 4AUXA 4JKZA 3COLA 2B1EA 2VKEA 3G56A 3LJLA 3CJDA 3Q3SA 3Q0UA 3QPLA 4PXIA 3NXCA 2X6OA 3VP5A 2R7XA 4D5FA 3QPSA 3FK6A 2V57A 5F08A 2QKOA 2HQ5A 3FHNA 2PFVA 1JUMA 3SFIA 4D7MA 3HTHA 2R7RA 3V6GA 4W1UA 2FBQA 3HTJA 3KNWA 5J3LA 4ACIA 4MXMA 3QKXA 2ZCMA 2IU5A 3Q0WA 3BR0A 2PBXA 3BCGA 2YVHA 4ABZA 5K7ZA 3G7RA 5CQGA 3SWHA 5EYRA 2XGCA 3C07A 5D1RA 3BTIA 1JTXA 2XPVA 4B3AA 1T56A 4G12A 4CGRA 3EUPA 3VOKA 1QVUA 4L62A 4XK4A 1JT0A 3BNIA 2ID3A 2QTQA 3PPBA 1ZKGA 5EFYA 2UXHA 2XDNA 5FKNA 3EGQA 1U9NA 2G3BA 2DG8A 1JTYA 3VIBA 3NI7A 4HKUA 3G1OA 2R7TA 1QPIA 4GCLA 5GP9A 2PZ9A 4WIBA 5GPAA 5K7HA 4JNNA 3VW1A 2ID6A 4DVYP 3KZ9A 4W97A 4M3BA 3E7QA 2ZY9A 4I6ZA 3BJBA 2TRTA 2QCOA 2F07A 5D18A 3BR3A 3ZQGA 3GZIA 3BTJA 2Y2ZA 3BT9A 2HXOA 3NPIA 3DEWA 3ANGA 3BR5A 3V78A 3B6AA 3CDLA 2UXUA 2FJ1A 5F27A 4AC6A 2QOPA 1JT6A 3Q0VA 3ZQFA 3HE0A 3KYLA 3QQAA 2QWTA 2W53A 2ZOZA 2XRLA 4NELA 5F0FA 3MNLA 3ON4A 1A6IA 1U9OA 3O8HA 3ZQIA 3HGYA 4ME9A 4M3EA 3LSJA 3BQYA 3NNRA 2XPWA 4D7NA 3CCYA 2WV1A 2G7GA 5IP6A 5FHPA 2GENA 2UXIA 3BTCA 2UXPA 2OF7A 3AQSA 2HXIA 3B6CA 4GCTA 5HAWA 3FRQA 3BQZA 3BR1A 3PASA 1VI0A 2R7QA 4NN1A 2R7SA 2HKUA 5K58A 3HTIA 3LOCA 3VVYA 3HIMA 2ZCNA 2X9DA 1RKWA 5FKKA 5IOYA 2VPRA 4V2GA 4AC0A 5C4YA 3WHBA 3CWRA 3LSPA 2NP3A 2IAIA 3ZQHA 4C2MA 4UDSA 1ORKA 3VVXA 5J1UA 3LSRA 5F04A 4M3DA
chains in the Genus database with same CATH topology
2ZOYA 1SGMA 2XGEA 3NRGA 2IEKA 2DG7A 2VKVA 5HSZA 2I10A 2GBYA 1RKTA 3GEUA 5CW8A 2EH3A 5CXGA 1Z0XA 3MVPA 4JYKA 5J1RA 2XPUA 2RHAA 5F0HA 2NX4A 4YZEA 2G7LA 5K7FA 4V2FA 5GPCA 2NP5A 3ZQLA 2DTZA 3HGGA 3O8GA 3ANPA 5H9TA 2WUIA 3KKCA 2QIBA 3T6NA 5EZHA 2FX0A 2O7TA 3BTLA 2OERA 1UI5A 4D5CA 5FKMA 5HBUA 2IBDA 2XB5A 3S5RA 1JUSA 5FMPA 3ON2A 2G0EA 3JSJA 2JJ7A 5CXIA 5FKLA 5D19A 3FK7A 3LWJA 2WGBA 3IUVA 3G1LA 4M3GA 3LHQA 3SDGA 4M3FA 2ZCXA 2HYTA 2NS7A 3FIWA 3TP3A 1UI6A 3BHQA 3F0CA 3F1BA 3PM1A 3VPRA 2RAEA 2OI8A 3QBMA 4AF5A 1JUPA 3B81A 3DCFA 4GCKA 1T33A 2FD5A 1QVTA 3IH2A 2Q24A 5DAJA 2Y31A 2UXOA 4ICHA 3HTAA 2D6YA 4GFKA 3IH3A 3KKDA 1BJZA 2GFNA 3BR6A 2YVEA 3VVZA 2REKA 2Y30A 4KWAA 1RPWA 4JL3A 3P9TA 3VW2A 5EZGA 3WHCA 3O60A 2HYJA 3IH4A 5FKOA 3BRUA 3C2BA 1Z77A 3G1MA 3VUQA 2GUHA 2FQ4A 4GFLA 4MK6A 2O7OA 5J1YA 5IPAA 3VW0A 2OPTA 5IOZA 2NS8A 2XGDA 3CRJA 1ZK8A 2JK3A 5F1JA 4I76A 3BR2A 2TCTA 2RASA 3AQTA 3DPJA 2ZB9A 3RH2A 5F0CA 5AQCA 5FGLA 3TP0A 4B1RA 4X1EA 3RD3A 4MO7A 3VOXA 2G7SA 4DW6A 4AUXA 4JKZA 3COLA 2VKEA 3G56A 3LJLA 3CJDA 3Q3SA 3Q0UA 3QPLA 4PXIA 3NXCA 2X6OA 3VP5A 4D5FA 3QPSA 3FK6A 2V57A 5F08A 2QKOA 2HQ5A 1JUMA 3SFIA 4D7MA 3HTHA 3V6GA 4W1UA 2FBQA 3HTJA 3KNWA 5J3LA 4ACIA 4MXMA 3QKXA 2ZCMA 2IU5A 3Q0WA 3BR0A 2PBXA 3BCGA 2YVHA 4ABZA 5K7ZA 3G7RA 5EYRA 2XGCA 3C07A 5D1RA 3BTIA 1JTXA 2XPVA 4B3AA 1T56A 4G12A 4CGRA 3EUPA 3VOKA 1QVUA 4L62A 4XK4A 1JT0A 3BNIA 2ID3A 2QTQA 3PPBA 1ZKGA 5EFYA 2UXHA 2XDNA 5FKNA 3EGQA 1U9NA 2G3BA 2DG8A 1JTYA 3VIBA 3NI7A 4HKUA 3G1OA 1QPIA 4GCLA 5GP9A 2PZ9A 5K7HA 5GPAA 4JNNA 3VW1A 2ID6A 3KZ9A 4W97A 4M3BA 3E7QA 4I6ZA 3BJBA 2TRTA 2QCOA 2F07A 5D18A 3BR3A 3ZQGA 3GZIA 3BTJA 2Y2ZA 3BT9A 2HXOA 3NPIA 3DEWA 3ANGA 3BR5A 3V78A 3B6AA 3CDLA 2UXUA 2FJ1A 5F27A 4AC6A 2QOPA 1JT6A 3Q0VA 3ZQFA 3HE0A 3QQAA 2QWTA 2W53A 2ZOZA 2XRLA 4NELA 5F0FA 3MNLA 3ON4A 1A6IA 1U9OA 3O8HA 3ZQIA 3HGYA 4ME9A 4M3EA 3LSJA 3BQYA 3NNRA 2XPWA 4D7NA 3CCYA 2WV1A 2G7GA 5IP6A 5FHPA 2GENA 2UXIA 3BTCA 2UXPA 2OF7A 3AQSA 2HXIA 3B6CA 4GCTA 5HAWA 3FRQA 3BQZA 3BR1A 3PASA 1VI0A 4NN1A 2HKUA 5K58A 3HTIA 3LOCA 3VVYA 3HIMA 2ZCNA 2X9DA 1RKWA 5FKKA 5IOYA 2VPRA 4V2GA 4AC0A 5C4YA 3WHBA 3CWRA 3LSPA 2NP3A 2IAIA 3ZQHA 4UDSA 1ORKA 3VVXA 5J1UA 3LSRA 5F04A 4M3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOY A;  1SGM A;  2XGE A;  3NRG A;  2IEK A;  2DG7 A;  2VKV A;  5HSZ A;  2I10 A;  2GBY A;  1RKT A;  3GEU A;  5CW8 A;  2EH3 A;  5CXG A;  1Z0X A;  3MVP A;  4JYK A;  5J1R A;  2XPU A;  2RHA A;  5F0H A;  2NX4 A;  4YZE A;  2G7L A;  5K7F A;  4V2F A;  5GPC A;  2NP5 A;  3ZQL A;  2DTZ A;  3HGG A;  3O8G A;  3ANP A;  5H9T A;  2WUI A;  3KKC A;  2QIB A;  3T6N A;  5EZH A;  2FX0 A;  2O7T A;  3BTL A;  2OER A;  1UI5 A;  4D5C A;  5FKM A;  5HBU A;  2IBD A;  2XB5 A;  3S5R A;  1JUS A;  5FMP A;  3ON2 A;  2G0E A;  3JSJ A;  2JJ7 A;  5CXI A;  5FKL A;  5D19 A;  3FK7 A;  3LWJ A;  2WGB A;  3IUV A;  3G1L A;  4M3G A;  3LHQ A;  3SDG A;  4M3F A;  2ZCX A;  2HYT A;  2NS7 A;  3FIW A;  3TP3 A;  1UI6 A;  3BHQ A;  3F0C A;  3F1B A;  3PM1 A;  3VPR A;  2RAE A;  2OI8 A;  3QBM A;  4AF5 A;  1JUP A;  3B81 A;  3DCF A;  4GCK A;  1T33 A;  2FD5 A;  1QVT A;  3IH2 A;  2Q24 A;  5DAJ A;  2Y31 A;  2UXO A;  4ICH A;  3HTA A;  2D6Y A;  4GFK A;  3IH3 A;  3KKD A;  1BJZ A;  2GFN A;  3BR6 A;  2YVE A;  3VVZ A;  2REK A;  2Y30 A;  4KWA A;  1RPW A;  4JL3 A;  3P9T A;  3VW2 A;  5EZG A;  3WHC A;  3O60 A;  2HYJ A;  3IH4 A;  5FKO A;  3BRU A;  3C2B A;  1Z77 A;  3G1M A;  3VUQ A;  2GUH A;  2FQ4 A;  4GFL A;  4MK6 A;  2O7O A;  5J1Y A;  5IPA A;  3VW0 A;  2OPT A;  5IOZ A;  2NS8 A;  2XGD A;  3CRJ A;  1ZK8 A;  2JK3 A;  5F1J A;  4I76 A;  3BR2 A;  2TCT A;  2RAS A;  3AQT A;  3DPJ A;  2ZB9 A;  3RH2 A;  5F0C A;  5AQC A;  5FGL A;  3TP0 A;  4B1R A;  4X1E A;  3RD3 A;  4MO7 A;  3VOX A;  2G7S A;  4DW6 A;  4AUX A;  4JKZ A;  3COL A;  2VKE A;  3G56 A;  3LJL A;  3CJD A;  3Q3S A;  3Q0U A;  3QPL A;  4PXI A;  3NXC A;  2X6O A;  3VP5 A;  4D5F A;  3QPS A;  3FK6 A;  2V57 A;  5F08 A;  2QKO A;  2HQ5 A;  1JUM A;  3SFI A;  4D7M A;  3HTH A;  3V6G A;  4W1U A;  2FBQ A;  3HTJ A;  3KNW A;  5J3L A;  4ACI A;  4MXM A;  3QKX A;  2ZCM A;  2IU5 A;  3Q0W A;  3BR0 A;  2PBX A;  3BCG A;  2YVH A;  4ABZ A;  5K7Z A;  3G7R A;  5EYR A;  2XGC A;  3C07 A;  5D1R A;  3BTI A;  1JTX A;  2XPV A;  4B3A A;  1T56 A;  4G12 A;  4CGR A;  3EUP A;  3VOK A;  1QVU A;  4L62 A;  4XK4 A;  1JT0 A;  3BNI A;  2ID3 A;  2QTQ A;  3PPB A;  1ZKG A;  5EFY A;  2UXH A;  2XDN A;  5FKN A;  3EGQ A;  1U9N A;  2G3B A;  2DG8 A;  1JTY A;  3VIB A;  3NI7 A;  4HKU A;  3G1O A;  1QPI A;  4GCL A;  5GP9 A;  2PZ9 A;  5K7H A;  5GPA A;  4JNN A;  3VW1 A;  2ID6 A;  3KZ9 A;  4W97 A;  4M3B A;  3E7Q A;  4I6Z A;  3BJB A;  2TRT A;  2QCO A;  2F07 A;  5D18 A;  3BR3 A;  3ZQG A;  3GZI A;  3BTJ A;  2Y2Z A;  3BT9 A;  2HXO A;  3NPI A;  3DEW A;  3ANG A;  3BR5 A;  3V78 A;  3B6A A;  3CDL A;  2UXU A;  2FJ1 A;  5F27 A;  4AC6 A;  2QOP A;  1JT6 A;  3Q0V A;  3ZQF A;  3HE0 A;  3QQA A;  2QWT A;  2W53 A;  2ZOZ A;  2XRL A;  4NEL A;  5F0F A;  3MNL A;  3ON4 A;  1A6I A;  1U9O A;  3O8H A;  3ZQI A;  3HGY A;  4ME9 A;  4M3E A;  3LSJ A;  3BQY A;  3NNR A;  2XPW A;  4D7N A;  3CCY A;  2WV1 A;  2G7G A;  5IP6 A;  5FHP A;  2GEN A;  2UXI A;  3BTC A;  2UXP A;  2OF7 A;  3AQS A;  2HXI A;  3B6C A;  4GCT A;  5HAW A;  3FRQ A;  3BQZ A;  3BR1 A;  3PAS A;  1VI0 A;  4NN1 A;  2HKU A;  5K58 A;  3HTI A;  3LOC A;  3VVY A;  3HIM A;  2ZCN A;  2X9D A;  1RKW A;  5FKK A;  5IOY A;  2VPR A;  4V2G A;  4AC0 A;  5C4Y A;  3WHB A;  3CWR A;  3LSP A;  2NP3 A;  2IAI A;  3ZQH A;  4UDS A;  1ORK A;  3VVX A;  5J1U A;  3LSR A;  5F04 A;  4M3D A; 
#chains in the Genus database with same CATH topology
 4OD5 A;  2ZOY A;  1SGM A;  2XGE A;  3NRG A;  2IEK A;  2DG7 A;  3K8P C;  2VKV A;  5HSZ A;  2I10 A;  2GBY A;  4U9L A;  1RKT A;  3GEU A;  5CW8 A;  2EH3 A;  2FJI 1;  5CXG A;  1Z0X A;  3MVP A;  4JYK A;  5J1R A;  2XPU A;  2RHA A;  5F0H A;  2NX4 A;  4YZE A;  2G7L A;  5K7F A;  4V2F A;  5GPC A;  2NP5 A;  2R7W A;  3ZQL A;  2DTZ A;  3HGG A;  3O8G A;  3ANP A;  5H9T A;  2WUI A;  3KKC A;  2QIB A;  3T6N A;  5EZH A;  2FX0 A;  2O7T A;  3BTL A;  2OER A;  1UI5 A;  4D5C A;  5FKM A;  5HBU A;  4U9N A;  2IBD A;  2YVX A;  2XB5 A;  3S5R A;  1JUS A;  5FMP A;  3ON2 A;  2G0E A;  3JSJ A;  2JJ7 A;  5CXI A;  5FKL A;  5D19 A;  2R7V A;  3FK7 A;  3LWJ A;  2WGB A;  3IUV A;  3G1L A;  4M3G A;  3LHQ A;  3SDG A;  4M3F A;  2ZCX A;  4OD4 A;  2HYT A;  2NS7 A;  3FIW A;  3TP3 A;  1UI6 A;  3BHQ A;  3F0C A;  3F1B A;  3PM1 A;  3VPR A;  2RAE A;  2OI8 A;  3QBM A;  4AF5 A;  1JUP A;  3B81 A;  3DCF A;  4GCK A;  3VTI A;  1T33 A;  2FD5 A;  1QVT A;  3IH2 A;  2Q24 A;  5DAJ A;  2Y31 A;  2UXO A;  4ICH A;  3HTA A;  2D6Y A;  4GFK A;  3IH3 A;  3KKD A;  1BJZ A;  2GFN A;  3BR6 A;  2YVE A;  3VVZ A;  2REK A;  2Y30 A;  4KWA A;  1RPW A;  3DU5 A;  3NS4 A;  2R7O A;  4JL3 A;  3P9T A;  3VW2 A;  5EZG A;  3WHC A;  3O60 A;  2HYJ A;  3IH4 A;  5FKO A;  3BRU A;  3C2B A;  2B3W A;  1Z77 A;  3G1M A;  3VUQ A;  2GUH A;  2FQ4 A;  4GFL A;  4MK6 A;  2O7O A;  5J1Y A;  5IPA A;  3VW0 A;  3DU6 A;  2OPT A;  5IOZ A;  2NS8 A;  2XGD A;  3CRJ A;  1ZK8 A;  2JK3 A;  5F1J A;  4I76 A;  3BR2 A;  2TCT A;  2A2F X;  2RAS A;  3AQT A;  3DPJ A;  2ZB9 A;  3RH2 A;  5F0C A;  5AQC A;  5FGL A;  3TP0 A;  4B1R A;  2R7U A;  4X1E A;  3RD3 A;  4MO7 A;  4IRV A;  3VOX A;  2G7S A;  4DW6 A;  4AUX A;  4JKZ A;  3COL A;  2B1E A;  2VKE A;  3G56 A;  3LJL A;  3CJD A;  3Q3S A;  3Q0U A;  3QPL A;  4PXI A;  3NXC A;  2X6O A;  3VP5 A;  2R7X A;  4D5F A;  3QPS A;  3FK6 A;  2V57 A;  5F08 A;  2QKO A;  2HQ5 A;  3FHN A;  2PFV A;  1JUM A;  3SFI A;  4D7M A;  3HTH A;  2R7R A;  3V6G A;  4W1U A;  2FBQ A;  3HTJ A;  3KNW A;  5J3L A;  4ACI A;  4MXM A;  3QKX A;  2ZCM A;  2IU5 A;  3Q0W A;  3BR0 A;  2PBX A;  3BCG A;  2YVH A;  4ABZ A;  5K7Z A;  3G7R A;  5CQG A;  3SWH A;  5EYR A;  2XGC A;  3C07 A;  5D1R A;  3BTI A;  1JTX A;  2XPV A;  4B3A A;  1T56 A;  4G12 A;  4CGR A;  3EUP A;  3VOK A;  1QVU A;  4L62 A;  4XK4 A;  1JT0 A;  3BNI A;  2ID3 A;  2QTQ A;  3PPB A;  1ZKG A;  5EFY A;  2UXH A;  2XDN A;  5FKN A;  3EGQ A;  1U9N A;  2G3B A;  2DG8 A;  1JTY A;  3VIB A;  3NI7 A;  4HKU A;  3G1O A;  2R7T A;  1QPI A;  4GCL A;  5GP9 A;  2PZ9 A;  4WIB A;  5GPA A;  5K7H A;  4JNN A;  3VW1 A;  2ID6 A;  4DVY P;  3KZ9 A;  4W97 A;  4M3B A;  3E7Q A;  2ZY9 A;  4I6Z A;  3BJB A;  2TRT A;  2QCO A;  2F07 A;  5D18 A;  3BR3 A;  3ZQG A;  3GZI A;  3BTJ A;  2Y2Z A;  3BT9 A;  2HXO A;  3NPI A;  3DEW A;  3ANG A;  3BR5 A;  3V78 A;  3B6A A;  3CDL A;  2UXU A;  2FJ1 A;  5F27 A;  4AC6 A;  2QOP A;  1JT6 A;  3Q0V A;  3ZQF A;  3HE0 A;  3KYL A;  3QQA A;  2QWT A;  2W53 A;  2ZOZ A;  2XRL A;  4NEL A;  5F0F A;  3MNL A;  3ON4 A;  1A6I A;  1U9O A;  3O8H A;  3ZQI A;  3HGY A;  4ME9 A;  4M3E A;  3LSJ A;  3BQY A;  3NNR A;  2XPW A;  4D7N A;  3CCY A;  2WV1 A;  2G7G A;  5IP6 A;  5FHP A;  2GEN A;  2UXI A;  3BTC A;  2UXP A;  2OF7 A;  3AQS A;  2HXI A;  3B6C A;  4GCT A;  5HAW A;  3FRQ A;  3BQZ A;  3BR1 A;  3PAS A;  1VI0 A;  2R7Q A;  4NN1 A;  2R7S A;  2HKU A;  5K58 A;  3HTI A;  3LOC A;  3VVY A;  3HIM A;  2ZCN A;  2X9D A;  1RKW A;  5FKK A;  5IOY A;  2VPR A;  4V2G A;  4AC0 A;  5C4Y A;  3WHB A;  3CWR A;  3LSP A;  2NP3 A;  2IAI A;  3ZQH A;  4C2M A;  4UDS A;  1ORK A;  3VVX A;  5J1U A;  3LSR A;  5F04 A;  4M3D A; 
#chains in the Genus database with same CATH homology
 2ZOY A;  1SGM A;  2XGE A;  3NRG A;  2IEK A;  2DG7 A;  2VKV A;  5HSZ A;  2I10 A;  2GBY A;  1RKT A;  3GEU A;  5CW8 A;  2EH3 A;  5CXG A;  1Z0X A;  3MVP A;  4JYK A;  5J1R A;  2XPU A;  2RHA A;  5F0H A;  2NX4 A;  4YZE A;  2G7L A;  5K7F A;  4V2F A;  5GPC A;  2NP5 A;  3ZQL A;  2DTZ A;  3HGG A;  3O8G A;  3ANP A;  5H9T A;  2WUI A;  3KKC A;  2QIB A;  3T6N A;  5EZH A;  2FX0 A;  2O7T A;  3BTL A;  2OER A;  1UI5 A;  4D5C A;  5FKM A;  5HBU A;  2IBD A;  2XB5 A;  3S5R A;  1JUS A;  5FMP A;  3ON2 A;  2G0E A;  3JSJ A;  2JJ7 A;  5CXI A;  5FKL A;  5D19 A;  3FK7 A;  3LWJ A;  2WGB A;  3IUV A;  3G1L A;  4M3G A;  3LHQ A;  3SDG A;  4M3F A;  2ZCX A;  2HYT A;  2NS7 A;  3FIW A;  3TP3 A;  1UI6 A;  3BHQ A;  3F0C A;  3F1B A;  3PM1 A;  3VPR A;  2RAE A;  2OI8 A;  3QBM A;  4AF5 A;  1JUP A;  3B81 A;  3DCF A;  4GCK A;  1T33 A;  2FD5 A;  1QVT A;  3IH2 A;  2Q24 A;  5DAJ A;  2Y31 A;  2UXO A;  4ICH A;  3HTA A;  2D6Y A;  4GFK A;  3IH3 A;  3KKD A;  1BJZ A;  2GFN A;  3BR6 A;  2YVE A;  3VVZ A;  2REK A;  2Y30 A;  4KWA A;  1RPW A;  4JL3 A;  3P9T A;  3VW2 A;  5EZG A;  3WHC A;  3O60 A;  2HYJ A;  3IH4 A;  5FKO A;  3BRU A;  3C2B A;  1Z77 A;  3G1M A;  3VUQ A;  2GUH A;  2FQ4 A;  4GFL A;  4MK6 A;  2O7O A;  5J1Y A;  5IPA A;  3VW0 A;  2OPT A;  5IOZ A;  2NS8 A;  2XGD A;  3CRJ A;  1ZK8 A;  2JK3 A;  5F1J A;  4I76 A;  3BR2 A;  2TCT A;  2RAS A;  3AQT A;  3DPJ A;  2ZB9 A;  3RH2 A;  5F0C A;  5AQC A;  5FGL A;  3TP0 A;  4B1R A;  4X1E A;  3RD3 A;  4MO7 A;  3VOX A;  2G7S A;  4DW6 A;  4AUX A;  4JKZ A;  3COL A;  2VKE A;  3G56 A;  3LJL A;  3CJD A;  3Q3S A;  3Q0U A;  3QPL A;  4PXI A;  3NXC A;  2X6O A;  3VP5 A;  4D5F A;  3QPS A;  3FK6 A;  2V57 A;  5F08 A;  2QKO A;  2HQ5 A;  1JUM A;  3SFI A;  4D7M A;  3HTH A;  3V6G A;  4W1U A;  2FBQ A;  3HTJ A;  3KNW A;  5J3L A;  4ACI A;  4MXM A;  3QKX A;  2ZCM A;  2IU5 A;  3Q0W A;  3BR0 A;  2PBX A;  3BCG A;  2YVH A;  4ABZ A;  5K7Z A;  3G7R A;  5EYR A;  2XGC A;  3C07 A;  5D1R A;  3BTI A;  1JTX A;  2XPV A;  4B3A A;  1T56 A;  4G12 A;  4CGR A;  3EUP A;  3VOK A;  1QVU A;  4L62 A;  4XK4 A;  1JT0 A;  3BNI A;  2ID3 A;  2QTQ A;  3PPB A;  1ZKG A;  5EFY A;  2UXH A;  2XDN A;  5FKN A;  3EGQ A;  1U9N A;  2G3B A;  2DG8 A;  1JTY A;  3VIB A;  3NI7 A;  4HKU A;  3G1O A;  1QPI A;  4GCL A;  5GP9 A;  2PZ9 A;  5K7H A;  5GPA A;  4JNN A;  3VW1 A;  2ID6 A;  3KZ9 A;  4W97 A;  4M3B A;  3E7Q A;  4I6Z A;  3BJB A;  2TRT A;  2QCO A;  2F07 A;  5D18 A;  3BR3 A;  3ZQG A;  3GZI A;  3BTJ A;  2Y2Z A;  3BT9 A;  2HXO A;  3NPI A;  3DEW A;  3ANG A;  3BR5 A;  3V78 A;  3B6A A;  3CDL A;  2UXU A;  2FJ1 A;  5F27 A;  4AC6 A;  2QOP A;  1JT6 A;  3Q0V A;  3ZQF A;  3HE0 A;  3QQA A;  2QWT A;  2W53 A;  2ZOZ A;  2XRL A;  4NEL A;  5F0F A;  3MNL A;  3ON4 A;  1A6I A;  1U9O A;  3O8H A;  3ZQI A;  3HGY A;  4ME9 A;  4M3E A;  3LSJ A;  3BQY A;  3NNR A;  2XPW A;  4D7N A;  3CCY A;  2WV1 A;  2G7G A;  5IP6 A;  5FHP A;  2GEN A;  2UXI A;  3BTC A;  2UXP A;  2OF7 A;  3AQS A;  2HXI A;  3B6C A;  4GCT A;  5HAW A;  3FRQ A;  3BQZ A;  3BR1 A;  3PAS A;  1VI0 A;  4NN1 A;  2HKU A;  5K58 A;  3HTI A;  3LOC A;  3VVY A;  3HIM A;  2ZCN A;  2X9D A;  1RKW A;  5FKK A;  5IOY A;  2VPR A;  4V2G A;  4AC0 A;  5C4Y A;  3WHB A;  3CWR A;  3LSP A;  2NP3 A;  2IAI A;  3ZQH A;  4UDS A;  1ORK A;  3VVX A;  5J1U A;  3LSR A;  5F04 A;  4M3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...