3NRGA

Crystal structure of a tetr family transcriptional regulator (caur_2714) from chloroflexus aurantiacus j-10-fl at 2.56 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GMPTETFFNLPEEKRSRLIDVLLDEFAQNDYDSVSINRITERAGIAKGSFYQYFADKKDCYLYLIQLGIEQKTAFLRQTPPASTTDMFAYLRWLLDVGIQFQFHNPRLAQIAYKALYDDVPLPAETMQVIRHGSFAYFKQLVEQGIADGSLVPDLDADTAAFVLNVVFTELGNHLIERFAVNPAELLREGGIVLLQPAMRRVIEQVIDILERGMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family transcriptional regulator
publication title Crystal structure of a TetR family transcriptional regulator (Caur_2714) from CHLOROFLEXUS AURANTIACUS J-10-FL at 2.56 A resolution
rcsb
source organism Chloroflexus aurantiacus
molecule tags Transcription
total genus 79
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nrgA00
2OPTA 4GFKA 4AUXA 4ME9A 4G12A 5IP6A 5FGLA 3COLA 3V6GA 3VW0A 5CW8A 3ZQFA 3HGGA 3Q0UA 2IBDA 3BTJA 4I6ZA 3B6AA 3BR5A 3LHQA 3LWJA 2OI8A 4XK4A 3ZQGA 1RPWA 2XGEA 5C4YA 2EH3A 2TRTA 3HGYA 3V78A 2HQ5A 1QVTA 4W97A 2NP3A 5EZHA 3G1LA 3PM1A 2DG8A 3VVZA 3IH4A 5F04A 3ZQHA 3VOXA 2ID3A 1UI6A 2Y2ZA 3O60A 1Z77A 4V2GA 2X9DA 2RASA 3BQZA 2O7OA 3GEUA 3NXCA 4D7NA 4B3AA 4D7MA 1Z0XA 4JL3A 3BQYA 2JJ7A 2TCTA 5J1YA 1JUSA 2DTZA 5GP9A 3FIWA 1JT6A 4D5CA 3WHCA 2JK3A 1VI0A 5J1RA 3ON2A 3BCGA 3VVXA 3NRGA 3FK6A 2ZCXA 3Q0WA 3MNLA 4GCTA 2G7SA 3AQTA 3MVPA 3EUPA 1QVUA 2G7LA 2D6YA 5FKOA 4M3DA 2UXUA 3HE0A 3BR6A 5F1JA 2FX0A 4ICHA 3BR0A 3KKCA 4UDSA 4AC6A 5F0CA 3SDGA 3HTHA 1ZKGA 3T6NA 2ZOYA 5D18A 2G7GA 3LOCA 3VPRA 4M3GA 2GFNA 4JYKA 5DAJA 2NS7A 3GZIA 4MK6A 4ABZA 3QPLA 3CWRA 3ANGA 4JKZA 5HAWA 5AQCA 1T33A 2QTQA 3VUQA 2RHAA 4NELA 3PASA 4AF5A 3BHQA 2NX4A 4MO7A 1ZK8A 3E7QA 2RAEA 5H9TA 2UXPA 2QIBA 2UXOA 5EFYA 5CXIA 3B6CA 3Q3SA 3CJDA 2NS8A 3B81A 4AC0A 4B1RA 3QBMA 1RKWA 2HYJA 1A6IA 2REKA 1U9OA 4D5FA 3SFIA 3F0CA 3LSPA 3PPBA 4X1EA 4GCLA 2XRLA 3G56A 2QOPA 3DPJA 4NN1A 2FBQA 2UXIA 3KNWA 3IUVA 3BR1A 4HKUA 4L62A 1RKTA 3HTIA 4JNNA 3DEWA 1ORKA 3BNIA 3KKDA 3ZQLA 3G1MA 5FKNA 5IOZA 5FKLA 2IAIA 3IH3A 2WV1A 2VPRA 2GUHA 3BTCA 2ZCMA 2IEKA 2QKOA 3S5RA 2XB5A 2IU5A 4CGRA 3VW1A 3IH2A 3BR2A 3VVYA 2HXIA 1SGMA 5F0HA 2PZ9A 3TP0A 3C07A 4M3BA 3VOKA 3LSJA 1QPIA 3ON4A 4M3EA 3HTJA 3NI7A 2YVEA 3CDLA 2PBXA 3P9TA 3QQAA 4YZEA 2HKUA 2VKEA 5CXGA 2I10A 3ZQIA 2GBYA 4KWAA 4W1UA 5HSZA 4ACIA 4M3FA 5EYRA 2UXHA 3BT9A 3VW2A 1JUMA 3O8HA 3HTAA 2FD5A 2W53A 3ANPA 2ZOZA 2OF7A 3BR3A 1T56A 3WHBA 3HIMA 5HBUA 5J3LA 2OERA 3QKXA 2Q24A 1JT0A 3LSRA 2Y31A 4I76A 3BTIA 1JTYA 2HXOA 5K7HA 4V2FA 3DCFA 1BJZA 5F08A 2FQ4A 2WUIA 3NNRA 4GFLA 2G0EA 3G1OA 3F1BA 2QCOA 5FKKA 2GENA 2F07A 3O8GA 5GPCA 5IOYA 5K7ZA 5FMPA 3JSJA 4GCKA 2ZB9A 2G3BA 3CCYA 2XPVA 2O7TA 2WGBA 1JTXA 3RH2A 3KZ9A 5IPAA 2XGCA 2QWTA 5FKMA 5D1RA 2ZCNA 2XGDA 3NPIA 5D19A 2YVHA 2Y30A 3LJLA 3CRJA 3Q0VA 5F0FA 5EZGA 5FHPA 2XPUA 3EGQA 3VP5A 3G7RA 2XPWA 3C2BA 3BJBA 3QPSA 4DW6A 2ID6A 1UI5A 2NP5A 3BRUA 3RD3A 4PXIA 2V57A 3VIBA 3TP3A 5K58A 2X6OA 3BTLA 2DG7A 5K7FA 2HYTA 4MXMA 2XDNA 3FK7A 5GPAA 5F27A 3FRQA 2FJ1A 3AQSA 1U9NA 2VKVA 1JUPA 5J1UA
chains in the Genus database with same CATH superfamily
2OPTA 4GFKA 4AUXA 4ME9A 4G12A 5IP6A 5FGLA 3COLA 3V6GA 3VW0A 5CW8A 2B1EA 3ZQFA 3HGGA 3Q0UA 2IBDA 3BTJA 4I6ZA 3B6AA 3BR5A 3LHQA 3LWJA 2OI8A 4XK4A 4WIBA 3ZQGA 1RPWA 2XGEA 5C4YA 2EH3A 3NS4A 2TRTA 3HGYA 3V78A 2HQ5A 2A2FX 1QVTA 4W97A 2ZY9A 2NP3A 5EZHA 3G1LA 3PM1A 2DG8A 3VVZA 3IH4A 5F04A 3ZQHA 3VOXA 2ID3A 1UI6A 2Y2ZA 3O60A 1Z77A 4V2GA 2X9DA 2RASA 3BQZA 2O7OA 3GEUA 3NXCA 4D7NA 4B3AA 4D7MA 1Z0XA 4JL3A 3BQYA 2JJ7A 2TCTA 5J1YA 1JUSA 2DTZA 2PFVA 5GP9A 3FIWA 1JT6A 4D5CA 3WHCA 2JK3A 1VI0A 5J1RA 3ON2A 5CQGA 3BCGA 2R7VA 3VVXA 2B3WA 3NRGA 3FK6A 2ZCXA 3Q0WA 3MNLA 4GCTA 2G7SA 3AQTA 3MVPA 3EUPA 1QVUA 2G7LA 2D6YA 2R7RA 5FKOA 4M3DA 2UXUA 3HE0A 3BR6A 5F1JA 2FX0A 4ICHA 3BR0A 3K8PC 3KKCA 4UDSA 4AC6A 5F0CA 3SDGA 3HTHA 1ZKGA 3T6NA 2ZOYA 5D18A 2G7GA 3LOCA 3VPRA 4M3GA 2GFNA 3DU6A 4JYKA 5DAJA 3SWHA 2NS7A 3GZIA 4MK6A 4ABZA 3QPLA 4U9LA 3CWRA 3ANGA 4JKZA 5HAWA 5AQCA 1T33A 2QTQA 3VUQA 2RHAA 4NELA 3PASA 4AF5A 3BHQA 2NX4A 4MO7A 1ZK8A 3E7QA 2RAEA 5H9TA 2UXPA 2QIBA 2UXOA 5EFYA 5CXIA 3B6CA 3Q3SA 3CJDA 2NS8A 3B81A 4AC0A 4B1RA 3QBMA 1RKWA 2HYJA 1A6IA 2REKA 1U9OA 4D5FA 3SFIA 3F0CA 3LSPA 3PPBA 3DU5A 4X1EA 2R7XA 4GCLA 2XRLA 3G56A 3KYLA 2QOPA 3DPJA 4NN1A 2FBQA 2UXIA 3KNWA 2YVXA 2R7QA 3IUVA 3BR1A 4HKUA 4L62A 1RKTA 3HTIA 4JNNA 3DEWA 4OD4A 1ORKA 3BNIA 3KKDA 3ZQLA 2R7TA 3G1MA 5FKNA 5IOZA 5FKLA 2IAIA 3IH3A 2WV1A 2VPRA 2GUHA 3BTCA 2ZCMA 2IEKA 2QKOA 3S5RA 2XB5A 2IU5A 4CGRA 2FJI1 3VW1A 3IH2A 3BR2A 3VVYA 2HXIA 1SGMA 5F0HA 2PZ9A 3TP0A 3C07A 4M3BA 3VOKA 3LSJA 1QPIA 3ON4A 4M3EA 3HTJA 3NI7A 2YVEA 3CDLA 2R7SA 2PBXA 3P9TA 3QQAA 4YZEA 2HKUA 2VKEA 5CXGA 2I10A 3ZQIA 2GBYA 4KWAA 4W1UA 5HSZA 4ACIA 4M3FA 5EYRA 2UXHA 3BT9A 3VW2A 1JUMA 3O8HA 3HTAA 2FD5A 2W53A 3ANPA 2ZOZA 2OF7A 3BR3A 4IRVA 3FHNA 1T56A 3WHBA 3HIMA 5HBUA 5J3LA 2OERA 3QKXA 2Q24A 1JT0A 3LSRA 2Y31A 4I76A 3BTIA 1JTYA 2HXOA 5K7HA 4V2FA 3DCFA 1BJZA 5F08A 2FQ4A 2WUIA 3NNRA 4GFLA 2G0EA 2R7OA 3G1OA 3F1BA 2QCOA 5FKKA 2GENA 2F07A 3O8GA 5GPCA 5IOYA 5K7ZA 5FMPA 3JSJA 4GCKA 2R7WA 2ZB9A 2G3BA 3CCYA 2XPVA 2O7TA 2WGBA 1JTXA 3RH2A 3KZ9A 5IPAA 2XGCA 2QWTA 4DVYP 5FKMA 5D1RA 2ZCNA 4C2MA 2XGDA 3NPIA 3VTIA 5D19A 2YVHA 2Y30A 3LJLA 4U9NA 3CRJA 3Q0VA 5F0FA 5EZGA 5FHPA 2XPUA 3EGQA 3VP5A 3G7RA 2XPWA 3C2BA 3BJBA 3QPSA 4DW6A 2ID6A 1UI5A 2NP5A 3BRUA 3RD3A 4PXIA 2V57A 3VIBA 3TP3A 5K58A 2X6OA 3BTLA 2DG7A 5K7FA 2HYTA 4MXMA 2XDNA 3FK7A 5GPAA 5F27A 3FRQA 2R7UA 2FJ1A 3AQSA 4OD5A 1U9NA 2VKVA 1JUPA 5J1UA
chains in the Genus database with same CATH topology
2OPTA 4GFKA 4AUXA 4ME9A 4G12A 5IP6A 5FGLA 3COLA 3V6GA 3VW0A 5CW8A 3ZQFA 3HGGA 3Q0UA 2IBDA 3BTJA 4I6ZA 3B6AA 3BR5A 3LHQA 3LWJA 2OI8A 4XK4A 3ZQGA 1RPWA 2XGEA 5C4YA 2EH3A 2TRTA 3HGYA 3V78A 2HQ5A 1QVTA 4W97A 2NP3A 5EZHA 3G1LA 3PM1A 2DG8A 3VVZA 3IH4A 5F04A 3ZQHA 3VOXA 2ID3A 1UI6A 2Y2ZA 3O60A 1Z77A 4V2GA 2X9DA 2RASA 3BQZA 2O7OA 3GEUA 3NXCA 4D7NA 4B3AA 4D7MA 1Z0XA 4JL3A 3BQYA 2JJ7A 2TCTA 5J1YA 1JUSA 2DTZA 5GP9A 3FIWA 1JT6A 4D5CA 3WHCA 2JK3A 1VI0A 5J1RA 3ON2A 3BCGA 3VVXA 3NRGA 3FK6A 2ZCXA 3Q0WA 3MNLA 4GCTA 2G7SA 3AQTA 3MVPA 3EUPA 1QVUA 2G7LA 2D6YA 5FKOA 4M3DA 2UXUA 3HE0A 3BR6A 5F1JA 2FX0A 4ICHA 3BR0A 3KKCA 4UDSA 4AC6A 5F0CA 3SDGA 3HTHA 1ZKGA 3T6NA 2ZOYA 5D18A 2G7GA 3LOCA 3VPRA 4M3GA 2GFNA 4JYKA 5DAJA 2NS7A 3GZIA 4MK6A 4ABZA 3QPLA 3CWRA 3ANGA 4JKZA 5HAWA 5AQCA 1T33A 2QTQA 3VUQA 2RHAA 4NELA 3PASA 4AF5A 3BHQA 2NX4A 4MO7A 1ZK8A 3E7QA 2RAEA 5H9TA 2UXPA 2QIBA 2UXOA 5EFYA 5CXIA 3B6CA 3Q3SA 3CJDA 2NS8A 3B81A 4AC0A 4B1RA 3QBMA 1RKWA 2HYJA 1A6IA 2REKA 1U9OA 4D5FA 3SFIA 3F0CA 3LSPA 3PPBA 4X1EA 4GCLA 2XRLA 3G56A 2QOPA 3DPJA 4NN1A 2FBQA 2UXIA 3KNWA 3IUVA 3BR1A 4HKUA 4L62A 1RKTA 3HTIA 4JNNA 3DEWA 1ORKA 3BNIA 3KKDA 3ZQLA 3G1MA 5FKNA 5IOZA 5FKLA 2IAIA 3IH3A 2WV1A 2VPRA 2GUHA 3BTCA 2ZCMA 2IEKA 2QKOA 3S5RA 2XB5A 2IU5A 4CGRA 3VW1A 3IH2A 3BR2A 3VVYA 2HXIA 1SGMA 5F0HA 2PZ9A 3TP0A 3C07A 4M3BA 3VOKA 3LSJA 1QPIA 3ON4A 4M3EA 3HTJA 3NI7A 2YVEA 3CDLA 2PBXA 3P9TA 3QQAA 4YZEA 2HKUA 2VKEA 5CXGA 2I10A 3ZQIA 2GBYA 4KWAA 4W1UA 5HSZA 4ACIA 4M3FA 5EYRA 2UXHA 3BT9A 3VW2A 1JUMA 3O8HA 3HTAA 2FD5A 2W53A 3ANPA 2ZOZA 2OF7A 3BR3A 1T56A 3WHBA 3HIMA 5HBUA 5J3LA 2OERA 3QKXA 2Q24A 1JT0A 3LSRA 2Y31A 4I76A 3BTIA 1JTYA 2HXOA 5K7HA 4V2FA 3DCFA 1BJZA 5F08A 2FQ4A 2WUIA 3NNRA 4GFLA 2G0EA 3G1OA 3F1BA 2QCOA 5FKKA 2GENA 2F07A 3O8GA 5GPCA 5IOYA 5K7ZA 5FMPA 3JSJA 4GCKA 2ZB9A 2G3BA 3CCYA 2XPVA 2O7TA 2WGBA 1JTXA 3RH2A 3KZ9A 5IPAA 2XGCA 2QWTA 5FKMA 5D1RA 2ZCNA 2XGDA 3NPIA 5D19A 2YVHA 2Y30A 3LJLA 3CRJA 3Q0VA 5F0FA 5EZGA 5FHPA 2XPUA 3EGQA 3VP5A 3G7RA 2XPWA 3C2BA 3BJBA 3QPSA 4DW6A 2ID6A 1UI5A 2NP5A 3BRUA 3RD3A 4PXIA 2V57A 3VIBA 3TP3A 5K58A 2X6OA 3BTLA 2DG7A 5K7FA 2HYTA 4MXMA 2XDNA 3FK7A 5GPAA 5F27A 3FRQA 2FJ1A 3AQSA 1U9NA 2VKVA 1JUPA 5J1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  4GFK A;  4AUX A;  4ME9 A;  4G12 A;  5IP6 A;  5FGL A;  3COL A;  3V6G A;  3VW0 A;  5CW8 A;  3ZQF A;  3HGG A;  3Q0U A;  2IBD A;  3BTJ A;  4I6Z A;  3B6A A;  3BR5 A;  3LHQ A;  3LWJ A;  2OI8 A;  4XK4 A;  3ZQG A;  1RPW A;  2XGE A;  5C4Y A;  2EH3 A;  2TRT A;  3HGY A;  3V78 A;  2HQ5 A;  1QVT A;  4W97 A;  2NP3 A;  5EZH A;  3G1L A;  3PM1 A;  2DG8 A;  3VVZ A;  3IH4 A;  5F04 A;  3ZQH A;  3VOX A;  2ID3 A;  1UI6 A;  2Y2Z A;  3O60 A;  1Z77 A;  4V2G A;  2X9D A;  2RAS A;  3BQZ A;  2O7O A;  3GEU A;  3NXC A;  4D7N A;  4B3A A;  4D7M A;  1Z0X A;  4JL3 A;  3BQY A;  2JJ7 A;  2TCT A;  5J1Y A;  1JUS A;  2DTZ A;  5GP9 A;  3FIW A;  1JT6 A;  4D5C A;  3WHC A;  2JK3 A;  1VI0 A;  5J1R A;  3ON2 A;  3BCG A;  3VVX A;  3NRG A;  3FK6 A;  2ZCX A;  3Q0W A;  3MNL A;  4GCT A;  2G7S A;  3AQT A;  3MVP A;  3EUP A;  1QVU A;  2G7L A;  2D6Y A;  5FKO A;  4M3D A;  2UXU A;  3HE0 A;  3BR6 A;  5F1J A;  2FX0 A;  4ICH A;  3BR0 A;  3KKC A;  4UDS A;  4AC6 A;  5F0C A;  3SDG A;  3HTH A;  1ZKG A;  3T6N A;  2ZOY A;  5D18 A;  2G7G A;  3LOC A;  3VPR A;  4M3G A;  2GFN A;  4JYK A;  5DAJ A;  2NS7 A;  3GZI A;  4MK6 A;  4ABZ A;  3QPL A;  3CWR A;  3ANG A;  4JKZ A;  5HAW A;  5AQC A;  1T33 A;  2QTQ A;  3VUQ A;  2RHA A;  4NEL A;  3PAS A;  4AF5 A;  3BHQ A;  2NX4 A;  4MO7 A;  1ZK8 A;  3E7Q A;  2RAE A;  5H9T A;  2UXP A;  2QIB A;  2UXO A;  5EFY A;  5CXI A;  3B6C A;  3Q3S A;  3CJD A;  2NS8 A;  3B81 A;  4AC0 A;  4B1R A;  3QBM A;  1RKW A;  2HYJ A;  1A6I A;  2REK A;  1U9O A;  4D5F A;  3SFI A;  3F0C A;  3LSP A;  3PPB A;  4X1E A;  4GCL A;  2XRL A;  3G56 A;  2QOP A;  3DPJ A;  4NN1 A;  2FBQ A;  2UXI A;  3KNW A;  3IUV A;  3BR1 A;  4HKU A;  4L62 A;  1RKT A;  3HTI A;  4JNN A;  3DEW A;  1ORK A;  3BNI A;  3KKD A;  3ZQL A;  3G1M A;  5FKN A;  5IOZ A;  5FKL A;  2IAI A;  3IH3 A;  2WV1 A;  2VPR A;  2GUH A;  3BTC A;  2ZCM A;  2IEK A;  2QKO A;  3S5R A;  2XB5 A;  2IU5 A;  4CGR A;  3VW1 A;  3IH2 A;  3BR2 A;  3VVY A;  2HXI A;  1SGM A;  5F0H A;  2PZ9 A;  3TP0 A;  3C07 A;  4M3B A;  3VOK A;  3LSJ A;  1QPI A;  3ON4 A;  4M3E A;  3HTJ A;  3NI7 A;  2YVE A;  3CDL A;  2PBX A;  3P9T A;  3QQA A;  4YZE A;  2HKU A;  2VKE A;  5CXG A;  2I10 A;  3ZQI A;  2GBY A;  4KWA A;  4W1U A;  5HSZ A;  4ACI A;  4M3F A;  5EYR A;  2UXH A;  3BT9 A;  3VW2 A;  1JUM A;  3O8H A;  3HTA A;  2FD5 A;  2W53 A;  3ANP A;  2ZOZ A;  2OF7 A;  3BR3 A;  1T56 A;  3WHB A;  3HIM A;  5HBU A;  5J3L A;  2OER A;  3QKX A;  2Q24 A;  1JT0 A;  3LSR A;  2Y31 A;  4I76 A;  3BTI A;  1JTY A;  2HXO A;  5K7H A;  4V2F A;  3DCF A;  1BJZ A;  5F08 A;  2FQ4 A;  2WUI A;  3NNR A;  4GFL A;  2G0E A;  3G1O A;  3F1B A;  2QCO A;  5FKK A;  2GEN A;  2F07 A;  3O8G A;  5GPC A;  5IOY A;  5K7Z A;  5FMP A;  3JSJ A;  4GCK A;  2ZB9 A;  2G3B A;  3CCY A;  2XPV A;  2O7T A;  2WGB A;  1JTX A;  3RH2 A;  3KZ9 A;  5IPA A;  2XGC A;  2QWT A;  5FKM A;  5D1R A;  2ZCN A;  2XGD A;  3NPI A;  5D19 A;  2YVH A;  2Y30 A;  3LJL A;  3CRJ A;  3Q0V A;  5F0F A;  5EZG A;  5FHP A;  2XPU A;  3EGQ A;  3VP5 A;  3G7R A;  2XPW A;  3C2B A;  3BJB A;  3QPS A;  4DW6 A;  2ID6 A;  1UI5 A;  2NP5 A;  3BRU A;  3RD3 A;  4PXI A;  2V57 A;  3VIB A;  3TP3 A;  5K58 A;  2X6O A;  3BTL A;  2DG7 A;  5K7F A;  2HYT A;  4MXM A;  2XDN A;  3FK7 A;  5GPA A;  5F27 A;  3FRQ A;  2FJ1 A;  3AQS A;  1U9N A;  2VKV A;  1JUP A;  5J1U A; 
#chains in the Genus database with same CATH topology
 2OPT A;  4GFK A;  4AUX A;  4ME9 A;  4G12 A;  5IP6 A;  5FGL A;  3COL A;  3V6G A;  3VW0 A;  5CW8 A;  2B1E A;  3ZQF A;  3HGG A;  3Q0U A;  2IBD A;  3BTJ A;  4I6Z A;  3B6A A;  3BR5 A;  3LHQ A;  3LWJ A;  2OI8 A;  4XK4 A;  4WIB A;  3ZQG A;  1RPW A;  2XGE A;  5C4Y A;  2EH3 A;  3NS4 A;  2TRT A;  3HGY A;  3V78 A;  2HQ5 A;  2A2F X;  1QVT A;  4W97 A;  2ZY9 A;  2NP3 A;  5EZH A;  3G1L A;  3PM1 A;  2DG8 A;  3VVZ A;  3IH4 A;  5F04 A;  3ZQH A;  3VOX A;  2ID3 A;  1UI6 A;  2Y2Z A;  3O60 A;  1Z77 A;  4V2G A;  2X9D A;  2RAS A;  3BQZ A;  2O7O A;  3GEU A;  3NXC A;  4D7N A;  4B3A A;  4D7M A;  1Z0X A;  4JL3 A;  3BQY A;  2JJ7 A;  2TCT A;  5J1Y A;  1JUS A;  2DTZ A;  2PFV A;  5GP9 A;  3FIW A;  1JT6 A;  4D5C A;  3WHC A;  2JK3 A;  1VI0 A;  5J1R A;  3ON2 A;  5CQG A;  3BCG A;  2R7V A;  3VVX A;  2B3W A;  3NRG A;  3FK6 A;  2ZCX A;  3Q0W A;  3MNL A;  4GCT A;  2G7S A;  3AQT A;  3MVP A;  3EUP A;  1QVU A;  2G7L A;  2D6Y A;  2R7R A;  5FKO A;  4M3D A;  2UXU A;  3HE0 A;  3BR6 A;  5F1J A;  2FX0 A;  4ICH A;  3BR0 A;  3K8P C;  3KKC A;  4UDS A;  4AC6 A;  5F0C A;  3SDG A;  3HTH A;  1ZKG A;  3T6N A;  2ZOY A;  5D18 A;  2G7G A;  3LOC A;  3VPR A;  4M3G A;  2GFN A;  3DU6 A;  4JYK A;  5DAJ A;  3SWH A;  2NS7 A;  3GZI A;  4MK6 A;  4ABZ A;  3QPL A;  4U9L A;  3CWR A;  3ANG A;  4JKZ A;  5HAW A;  5AQC A;  1T33 A;  2QTQ A;  3VUQ A;  2RHA A;  4NEL A;  3PAS A;  4AF5 A;  3BHQ A;  2NX4 A;  4MO7 A;  1ZK8 A;  3E7Q A;  2RAE A;  5H9T A;  2UXP A;  2QIB A;  2UXO A;  5EFY A;  5CXI A;  3B6C A;  3Q3S A;  3CJD A;  2NS8 A;  3B81 A;  4AC0 A;  4B1R A;  3QBM A;  1RKW A;  2HYJ A;  1A6I A;  2REK A;  1U9O A;  4D5F A;  3SFI A;  3F0C A;  3LSP A;  3PPB A;  3DU5 A;  4X1E A;  2R7X A;  4GCL A;  2XRL A;  3G56 A;  3KYL A;  2QOP A;  3DPJ A;  4NN1 A;  2FBQ A;  2UXI A;  3KNW A;  2YVX A;  2R7Q A;  3IUV A;  3BR1 A;  4HKU A;  4L62 A;  1RKT A;  3HTI A;  4JNN A;  3DEW A;  4OD4 A;  1ORK A;  3BNI A;  3KKD A;  3ZQL A;  2R7T A;  3G1M A;  5FKN A;  5IOZ A;  5FKL A;  2IAI A;  3IH3 A;  2WV1 A;  2VPR A;  2GUH A;  3BTC A;  2ZCM A;  2IEK A;  2QKO A;  3S5R A;  2XB5 A;  2IU5 A;  4CGR A;  2FJI 1;  3VW1 A;  3IH2 A;  3BR2 A;  3VVY A;  2HXI A;  1SGM A;  5F0H A;  2PZ9 A;  3TP0 A;  3C07 A;  4M3B A;  3VOK A;  3LSJ A;  1QPI A;  3ON4 A;  4M3E A;  3HTJ A;  3NI7 A;  2YVE A;  3CDL A;  2R7S A;  2PBX A;  3P9T A;  3QQA A;  4YZE A;  2HKU A;  2VKE A;  5CXG A;  2I10 A;  3ZQI A;  2GBY A;  4KWA A;  4W1U A;  5HSZ A;  4ACI A;  4M3F A;  5EYR A;  2UXH A;  3BT9 A;  3VW2 A;  1JUM A;  3O8H A;  3HTA A;  2FD5 A;  2W53 A;  3ANP A;  2ZOZ A;  2OF7 A;  3BR3 A;  4IRV A;  3FHN A;  1T56 A;  3WHB A;  3HIM A;  5HBU A;  5J3L A;  2OER A;  3QKX A;  2Q24 A;  1JT0 A;  3LSR A;  2Y31 A;  4I76 A;  3BTI A;  1JTY A;  2HXO A;  5K7H A;  4V2F A;  3DCF A;  1BJZ A;  5F08 A;  2FQ4 A;  2WUI A;  3NNR A;  4GFL A;  2G0E A;  2R7O A;  3G1O A;  3F1B A;  2QCO A;  5FKK A;  2GEN A;  2F07 A;  3O8G A;  5GPC A;  5IOY A;  5K7Z A;  5FMP A;  3JSJ A;  4GCK A;  2R7W A;  2ZB9 A;  2G3B A;  3CCY A;  2XPV A;  2O7T A;  2WGB A;  1JTX A;  3RH2 A;  3KZ9 A;  5IPA A;  2XGC A;  2QWT A;  4DVY P;  5FKM A;  5D1R A;  2ZCN A;  4C2M A;  2XGD A;  3NPI A;  3VTI A;  5D19 A;  2YVH A;  2Y30 A;  3LJL A;  4U9N A;  3CRJ A;  3Q0V A;  5F0F A;  5EZG A;  5FHP A;  2XPU A;  3EGQ A;  3VP5 A;  3G7R A;  2XPW A;  3C2B A;  3BJB A;  3QPS A;  4DW6 A;  2ID6 A;  1UI5 A;  2NP5 A;  3BRU A;  3RD3 A;  4PXI A;  2V57 A;  3VIB A;  3TP3 A;  5K58 A;  2X6O A;  3BTL A;  2DG7 A;  5K7F A;  2HYT A;  4MXM A;  2XDN A;  3FK7 A;  5GPA A;  5F27 A;  3FRQ A;  2R7U A;  2FJ1 A;  3AQS A;  4OD5 A;  1U9N A;  2VKV A;  1JUP A;  5J1U A; 
#chains in the Genus database with same CATH homology
 2OPT A;  4GFK A;  4AUX A;  4ME9 A;  4G12 A;  5IP6 A;  5FGL A;  3COL A;  3V6G A;  3VW0 A;  5CW8 A;  3ZQF A;  3HGG A;  3Q0U A;  2IBD A;  3BTJ A;  4I6Z A;  3B6A A;  3BR5 A;  3LHQ A;  3LWJ A;  2OI8 A;  4XK4 A;  3ZQG A;  1RPW A;  2XGE A;  5C4Y A;  2EH3 A;  2TRT A;  3HGY A;  3V78 A;  2HQ5 A;  1QVT A;  4W97 A;  2NP3 A;  5EZH A;  3G1L A;  3PM1 A;  2DG8 A;  3VVZ A;  3IH4 A;  5F04 A;  3ZQH A;  3VOX A;  2ID3 A;  1UI6 A;  2Y2Z A;  3O60 A;  1Z77 A;  4V2G A;  2X9D A;  2RAS A;  3BQZ A;  2O7O A;  3GEU A;  3NXC A;  4D7N A;  4B3A A;  4D7M A;  1Z0X A;  4JL3 A;  3BQY A;  2JJ7 A;  2TCT A;  5J1Y A;  1JUS A;  2DTZ A;  5GP9 A;  3FIW A;  1JT6 A;  4D5C A;  3WHC A;  2JK3 A;  1VI0 A;  5J1R A;  3ON2 A;  3BCG A;  3VVX A;  3NRG A;  3FK6 A;  2ZCX A;  3Q0W A;  3MNL A;  4GCT A;  2G7S A;  3AQT A;  3MVP A;  3EUP A;  1QVU A;  2G7L A;  2D6Y A;  5FKO A;  4M3D A;  2UXU A;  3HE0 A;  3BR6 A;  5F1J A;  2FX0 A;  4ICH A;  3BR0 A;  3KKC A;  4UDS A;  4AC6 A;  5F0C A;  3SDG A;  3HTH A;  1ZKG A;  3T6N A;  2ZOY A;  5D18 A;  2G7G A;  3LOC A;  3VPR A;  4M3G A;  2GFN A;  4JYK A;  5DAJ A;  2NS7 A;  3GZI A;  4MK6 A;  4ABZ A;  3QPL A;  3CWR A;  3ANG A;  4JKZ A;  5HAW A;  5AQC A;  1T33 A;  2QTQ A;  3VUQ A;  2RHA A;  4NEL A;  3PAS A;  4AF5 A;  3BHQ A;  2NX4 A;  4MO7 A;  1ZK8 A;  3E7Q A;  2RAE A;  5H9T A;  2UXP A;  2QIB A;  2UXO A;  5EFY A;  5CXI A;  3B6C A;  3Q3S A;  3CJD A;  2NS8 A;  3B81 A;  4AC0 A;  4B1R A;  3QBM A;  1RKW A;  2HYJ A;  1A6I A;  2REK A;  1U9O A;  4D5F A;  3SFI A;  3F0C A;  3LSP A;  3PPB A;  4X1E A;  4GCL A;  2XRL A;  3G56 A;  2QOP A;  3DPJ A;  4NN1 A;  2FBQ A;  2UXI A;  3KNW A;  3IUV A;  3BR1 A;  4HKU A;  4L62 A;  1RKT A;  3HTI A;  4JNN A;  3DEW A;  1ORK A;  3BNI A;  3KKD A;  3ZQL A;  3G1M A;  5FKN A;  5IOZ A;  5FKL A;  2IAI A;  3IH3 A;  2WV1 A;  2VPR A;  2GUH A;  3BTC A;  2ZCM A;  2IEK A;  2QKO A;  3S5R A;  2XB5 A;  2IU5 A;  4CGR A;  3VW1 A;  3IH2 A;  3BR2 A;  3VVY A;  2HXI A;  1SGM A;  5F0H A;  2PZ9 A;  3TP0 A;  3C07 A;  4M3B A;  3VOK A;  3LSJ A;  1QPI A;  3ON4 A;  4M3E A;  3HTJ A;  3NI7 A;  2YVE A;  3CDL A;  2PBX A;  3P9T A;  3QQA A;  4YZE A;  2HKU A;  2VKE A;  5CXG A;  2I10 A;  3ZQI A;  2GBY A;  4KWA A;  4W1U A;  5HSZ A;  4ACI A;  4M3F A;  5EYR A;  2UXH A;  3BT9 A;  3VW2 A;  1JUM A;  3O8H A;  3HTA A;  2FD5 A;  2W53 A;  3ANP A;  2ZOZ A;  2OF7 A;  3BR3 A;  1T56 A;  3WHB A;  3HIM A;  5HBU A;  5J3L A;  2OER A;  3QKX A;  2Q24 A;  1JT0 A;  3LSR A;  2Y31 A;  4I76 A;  3BTI A;  1JTY A;  2HXO A;  5K7H A;  4V2F A;  3DCF A;  1BJZ A;  5F08 A;  2FQ4 A;  2WUI A;  3NNR A;  4GFL A;  2G0E A;  3G1O A;  3F1B A;  2QCO A;  5FKK A;  2GEN A;  2F07 A;  3O8G A;  5GPC A;  5IOY A;  5K7Z A;  5FMP A;  3JSJ A;  4GCK A;  2ZB9 A;  2G3B A;  3CCY A;  2XPV A;  2O7T A;  2WGB A;  1JTX A;  3RH2 A;  3KZ9 A;  5IPA A;  2XGC A;  2QWT A;  5FKM A;  5D1R A;  2ZCN A;  2XGD A;  3NPI A;  5D19 A;  2YVH A;  2Y30 A;  3LJL A;  3CRJ A;  3Q0V A;  5F0F A;  5EZG A;  5FHP A;  2XPU A;  3EGQ A;  3VP5 A;  3G7R A;  2XPW A;  3C2B A;  3BJB A;  3QPS A;  4DW6 A;  2ID6 A;  1UI5 A;  2NP5 A;  3BRU A;  3RD3 A;  4PXI A;  2V57 A;  3VIB A;  3TP3 A;  5K58 A;  2X6O A;  3BTL A;  2DG7 A;  5K7F A;  2HYT A;  4MXM A;  2XDN A;  3FK7 A;  5GPA A;  5F27 A;  3FRQ A;  2FJ1 A;  3AQS A;  1U9N A;  2VKV A;  1JUP A;  5J1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...