3NRGA

Crystal structure of a tetr family transcriptional regulator (caur_2714) from chloroflexus aurantiacus j-10-fl at 2.56 a resolution
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
GMPTETFFNLPEEKRSRLIDVLLDEFAQNDYDSVSINRITERAGIAKGSFYQYFADKKDCYLYLIQLGIEQKTAFLRQTPPASTTDMFAYLRWLLDVGIQFQFHNPRLAQIAYKALYDDVPLPAETMQVIRHGSFAYFKQLVEQGIADGSLVPDLDADTAAFVLNVVFTELGNHLIERFAVNPAELLREGGIVLLQPAMRRVIEQVIDILERGMRRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TetR family transcriptional regulator
publication title Crystal structure of a TetR family transcriptional regulator (Caur_2714) from CHLOROFLEXUS AURANTIACUS J-10-FL at 2.56 A resolution
rcsb
source organism Chloroflexus aurantiacus
total genus 79
structure length 217
sequence length 217
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nrgA00
2WV1A 2HYJA 3VPRA 3VIBA 5EYRA 3ZQHA 3LSRA 4I76A 4B3AA 3TP0A 3VW0A 3VOKA 3KZ9A 5D18A 3Q0WA 3BR1A 4JNNA 1JT6A 5EZGA 4JL3A 4G12A 3LSJA 2UXPA 5J1YA 2TCTA 2ZCMA 1U9NA 3HGGA 2ZB9A 4AF5A 2UXOA 3Q0UA 4AC6A 2RHAA 1A6IA 3Q0VA 5K7HA 5D19A 3T6NA 4PXIA 3BQZA 3NNRA 4GFKA 4I6ZA 4M3EA 2DG7A 3ON2A 2QOPA 4V2GA 3BT9A 3VUQA 3E7QA 1T56A 2OI8A 1QVUA 4UDSA 3NRGA 5J1UA 5HBUA 3SDGA 3LSPA 3GEUA 4ME9A 4MO7A 2FD5A 2HXIA 3BCGA 5IP6A 2NS8A 3NPIA 4B1RA 4M3GA 3BR5A 3FK6A 2HQ5A 5EZHA 5C4YA 2XPUA 3IH4A 2VPRA 3DPJA 5FHPA 2REKA 5J1RA 2XPVA 2QTQA 5K58A 3O8GA 5FKNA 1QVTA 2VKEA 3CWRA 1RKWA 3IH3A 3BTIA 2Q24A 2GUHA 3F0CA 3ZQIA 3B6CA 2UXIA 3F1BA 2GFNA 3G1MA 5IOYA 3FRQA 3QPSA 5F27A 3S5RA 3LOCA 3BTCA 2ZOZA 4NELA 3ANPA 2RASA 3EUPA 4JKZA 5FKLA 3G1LA 2ID3A 3QKXA 2QCOA 3BQYA 2YVEA 5GP9A 5FMPA 4JYKA 5IOZA 4MK6A 1ZKGA 5FGLA 4M3FA 1JUPA 4M3DA 3IH2A 2HXOA 3BR3A 5K7ZA 2G3BA 4GCTA 2FX0A 3MVPA 1JUMA 2X9DA 3AQTA 3BTJA 5K7FA 4D7NA 3Q3SA 5J3LA 3HTHA 3PM1A 2ID6A 2ZCXA 3AQSA 4L62A 4D5FA 2TRTA 2NP3A 2HYTA 5FKMA 2NS7A 2JJ7A 2XGDA 1RPWA 4V2FA 3V78A 2XB5A 5F1JA 1RKTA 5CW8A 5GPCA 2G7SA 3QPLA 3JSJA 5D1RA 3ZQGA 5IPAA 1ORKA 3PASA 4W1UA 2JK3A 3VW2A 2Y30A 3VW1A 3RD3A 4DW6A 3G56A 3VVXA 2IEKA 1JUSA 3DCFA 2I10A 3VOXA 5CXGA 5FKKA 3HTAA 2HKUA 3CDLA 2D6YA 3C2BA 5FKOA 3O60A 4HKUA 4D5CA 3B6AA 2O7TA 3PPBA 5F0HA 5HSZA 1BJZA 3NI7A 1JTXA 3G1OA 3DEWA 3FIWA 4CGRA 2IU5A 3KNWA 2G7LA 1UI6A 1Z0XA 3COLA 3LWJA 3LJLA 2NX4A 3GZIA 5HAWA 3WHCA 2GBYA 5F08A 3BRUA 3ZQFA 3HIMA 1JT0A 3BR0A 3SFIA 3ON4A 2XDNA 5EFYA 4GCLA 2G0EA 2QIBA 2WUIA 3P9TA 2ZOYA 2XGEA 2WGBA 3CRJA 2FBQA 2IBDA 1SGMA 2DG8A 2UXHA 2PZ9A 3IUVA 2UXUA 3BHQA 4GFLA 3HTJA 3ANGA 2VKVA 1U9OA 2W53A 4KWAA 3CCYA 2YVHA 1JTYA 4AC0A 3HGYA 4ICHA 4ABZA 4W97A 4GCKA 2IAIA 3BR6A 3LHQA 4XK4A 4MXMA 3KKCA 1T33A 3ZQLA 4X1EA 3BJBA 3WHBA 1Z77A 3NXCA 4AUXA 2G7GA 2OERA 2DTZA 2GENA 3MNLA 1VI0A 3O8HA 3BR2A 3HE0A 3BTLA 2XGCA 3BNIA 4ACIA 3B81A 3VVYA 1QPIA 3TP3A 3VP5A 3G7RA 2F07A 2XRLA 3V6GA 3C07A 1ZK8A 2FQ4A 2X6OA 5AQCA 5F0CA 2RAEA 2OPTA 3RH2A 5F04A 2QWTA 2OF7A 3KKDA 2Y2ZA 5CXIA 1UI5A 5GPAA 3CJDA 2Y31A 5F0FA 3EGQA 3HTIA 2EH3A 2QKOA 4NN1A 2V57A 5H9TA 3QBMA 4D7MA 3FK7A 2O7OA 4M3BA 2ZCNA 3VVZA 2PBXA 4YZEA 5DAJA 3QQAA 2FJ1A 2XPWA 2NP5A
chains in the Genus database with same CATH superfamily
2WV1A 2HYJA 3VPRA 3VIBA 5EYRA 3ZQHA 3LSRA 4I76A 4B3AA 3TP0A 3VW0A 3VOKA 3KZ9A 5D18A 3Q0WA 3BR1A 4JNNA 1JT6A 5EZGA 4JL3A 4G12A 3LSJA 2UXPA 5J1YA 2TCTA 2ZCMA 1U9NA 3HGGA 2ZB9A 4AF5A 2UXOA 4WIBA 3Q0UA 4AC6A 2RHAA 1A6IA 3Q0VA 5K7HA 5D19A 3T6NA 4PXIA 3BQZA 3NNRA 4GFKA 4I6ZA 4M3EA 3DU6A 2DG7A 4U9LA 3ON2A 2QOPA 4V2GA 3BT9A 3VUQA 3E7QA 1T56A 2R7RA 2OI8A 1QVUA 4UDSA 3NRGA 5J1UA 5HBUA 3SDGA 3LSPA 3GEUA 4ME9A 4MO7A 2FD5A 2HXIA 3BCGA 5IP6A 2NS8A 3NPIA 3SWHA 4B1RA 3K8PC 4M3GA 2YVXA 2A2FX 3BR5A 3FK6A 2HQ5A 5EZHA 5C4YA 2R7OA 2XPUA 2FJI1 2B1EA 3IH4A 2VPRA 3DPJA 5FHPA 2REKA 5J1RA 2XPVA 2QTQA 5K58A 5CQGA 3O8GA 5FKNA 1QVTA 2VKEA 3CWRA 1RKWA 3IH3A 3BTIA 2Q24A 2GUHA 3F0CA 3ZQIA 2R7VA 3B6CA 2UXIA 3F1BA 2GFNA 3G1MA 5IOYA 3FRQA 3QPSA 5F27A 3S5RA 3LOCA 3BTCA 2ZOZA 4NELA 3ANPA 2RASA 3EUPA 4JKZA 5FKLA 3G1LA 2ID3A 3QKXA 2QCOA 3BQYA 2B3WA 2YVEA 5GP9A 5FMPA 4JYKA 5IOZA 4MK6A 1ZKGA 5FGLA 4M3FA 1JUPA 4M3DA 3IH2A 2HXOA 3BR3A 5K7ZA 2G3BA 2R7TA 2R7WA 4GCTA 2FX0A 3MVPA 1JUMA 2X9DA 3AQTA 3BTJA 5K7FA 4D7NA 3Q3SA 5J3LA 3HTHA 3PM1A 2ID6A 2ZCXA 3AQSA 4L62A 4D5FA 3FHNA 2TRTA 2NP3A 2HYTA 5FKMA 2NS7A 2PFVA 2JJ7A 2XGDA 1RPWA 4V2FA 2XB5A 3V78A 5F1JA 1RKTA 5CW8A 5GPCA 2G7SA 3QPLA 3JSJA 5D1RA 3ZQGA 5IPAA 4U9NA 1ORKA 3PASA 4W1UA 2JK3A 3VW2A 2Y30A 3VW1A 3RD3A 4DW6A 3G56A 3VVXA 2IEKA 1JUSA 3DCFA 2I10A 3VOXA 5CXGA 5FKKA 3HTAA 2HKUA 3CDLA 2D6YA 3C2BA 5FKOA 3O60A 4HKUA 4D5CA 3B6AA 2O7TA 3PPBA 5F0HA 5HSZA 1BJZA 3NI7A 1JTXA 3G1OA 3DEWA 3FIWA 4CGRA 2IU5A 3KNWA 2G7LA 3VTIA 1UI6A 3KYLA 1Z0XA 3COLA 3LWJA 3LJLA 2NX4A 3GZIA 5HAWA 3WHCA 2GBYA 5F08A 3BRUA 3ZQFA 2R7UA 3HIMA 1JT0A 3BR0A 3SFIA 3ON4A 2XDNA 5EFYA 4GCLA 2G0EA 2QIBA 2WUIA 3P9TA 2ZOYA 4OD4A 2XGEA 2WGBA 3CRJA 4C2MA 2FBQA 2IBDA 1SGMA 2DG8A 2UXHA 2PZ9A 3IUVA 2UXUA 3BHQA 4GFLA 3HTJA 3ANGA 2VKVA 1U9OA 2W53A 4KWAA 3CCYA 2YVHA 1JTYA 4AC0A 3HGYA 4ICHA 4ABZA 4W97A 4GCKA 4OD5A 2IAIA 3BR6A 3LHQA 4XK4A 4MXMA 3KKCA 1T33A 3ZQLA 4X1EA 3BJBA 3WHBA 1Z77A 3NXCA 4AUXA 2G7GA 2OERA 3NS4A 4IRVA 2DTZA 2R7XA 2GENA 3MNLA 2R7QA 1VI0A 3O8HA 3BR2A 3HE0A 3BTLA 2XGCA 2ZY9A 3BNIA 4ACIA 3B81A 3VVYA 1QPIA 3TP3A 3VP5A 3G7RA 2F07A 2XRLA 3V6GA 3C07A 1ZK8A 2FQ4A 2X6OA 5AQCA 5F0CA 2RAEA 3DU5A 2OPTA 3RH2A 5F04A 2QWTA 2OF7A 3KKDA 2Y2ZA 5CXIA 2R7SA 1UI5A 5GPAA 3CJDA 2Y31A 5F0FA 3EGQA 3HTIA 2EH3A 2QKOA 4NN1A 2V57A 5H9TA 3QBMA 4D7MA 3FK7A 2O7OA 4M3BA 2ZCNA 3VVZA 4DVYP 2PBXA 4YZEA 5DAJA 3QQAA 2FJ1A 2XPWA 2NP5A
chains in the Genus database with same CATH topology
2WV1A 2HYJA 3VPRA 3VIBA 5EYRA 3ZQHA 3LSRA 4I76A 4B3AA 3TP0A 3VW0A 3VOKA 3KZ9A 5D18A 3Q0WA 3BR1A 4JNNA 1JT6A 5EZGA 4JL3A 4G12A 3LSJA 2UXPA 5J1YA 2TCTA 2ZCMA 1U9NA 3HGGA 2ZB9A 4AF5A 2UXOA 3Q0UA 4AC6A 2RHAA 1A6IA 3Q0VA 5K7HA 5D19A 3T6NA 4PXIA 3BQZA 3NNRA 4GFKA 4I6ZA 4M3EA 2DG7A 3ON2A 2QOPA 4V2GA 3BT9A 3VUQA 3E7QA 1T56A 2OI8A 1QVUA 4UDSA 3NRGA 5J1UA 5HBUA 3SDGA 3LSPA 3GEUA 4ME9A 4MO7A 2FD5A 2HXIA 3BCGA 5IP6A 2NS8A 3NPIA 4B1RA 4M3GA 3BR5A 3FK6A 2HQ5A 5EZHA 5C4YA 2XPUA 3IH4A 2VPRA 3DPJA 5FHPA 2REKA 5J1RA 2XPVA 2QTQA 5K58A 3O8GA 5FKNA 1QVTA 2VKEA 3CWRA 1RKWA 3IH3A 3BTIA 2Q24A 2GUHA 3F0CA 3ZQIA 3B6CA 2UXIA 3F1BA 2GFNA 3G1MA 5IOYA 3FRQA 3QPSA 5F27A 3S5RA 3LOCA 3BTCA 2ZOZA 4NELA 3ANPA 2RASA 3EUPA 4JKZA 5FKLA 3G1LA 2ID3A 3QKXA 2QCOA 3BQYA 2YVEA 5GP9A 5FMPA 4JYKA 5IOZA 4MK6A 1ZKGA 5FGLA 4M3FA 1JUPA 4M3DA 3IH2A 2HXOA 3BR3A 5K7ZA 2G3BA 4GCTA 2FX0A 3MVPA 1JUMA 2X9DA 3AQTA 3BTJA 5K7FA 4D7NA 3Q3SA 5J3LA 3HTHA 3PM1A 2ID6A 2ZCXA 3AQSA 4L62A 4D5FA 2TRTA 2NP3A 2HYTA 5FKMA 2NS7A 2JJ7A 2XGDA 1RPWA 4V2FA 3V78A 2XB5A 5F1JA 1RKTA 5CW8A 5GPCA 2G7SA 3QPLA 3JSJA 5D1RA 3ZQGA 5IPAA 1ORKA 3PASA 4W1UA 2JK3A 3VW2A 2Y30A 3VW1A 3RD3A 4DW6A 3G56A 3VVXA 2IEKA 1JUSA 3DCFA 2I10A 3VOXA 5CXGA 5FKKA 3HTAA 2HKUA 3CDLA 2D6YA 3C2BA 5FKOA 3O60A 4HKUA 4D5CA 3B6AA 2O7TA 3PPBA 5F0HA 5HSZA 1BJZA 3NI7A 1JTXA 3G1OA 3DEWA 3FIWA 4CGRA 2IU5A 3KNWA 2G7LA 1UI6A 1Z0XA 3COLA 3LWJA 3LJLA 2NX4A 3GZIA 5HAWA 3WHCA 2GBYA 5F08A 3BRUA 3ZQFA 3HIMA 1JT0A 3BR0A 3SFIA 3ON4A 2XDNA 5EFYA 4GCLA 2G0EA 2QIBA 2WUIA 3P9TA 2ZOYA 2XGEA 2WGBA 3CRJA 2FBQA 2IBDA 1SGMA 2DG8A 2UXHA 2PZ9A 3IUVA 2UXUA 3BHQA 4GFLA 3HTJA 3ANGA 2VKVA 1U9OA 2W53A 4KWAA 3CCYA 2YVHA 1JTYA 4AC0A 3HGYA 4ICHA 4ABZA 4W97A 4GCKA 2IAIA 3BR6A 3LHQA 4XK4A 4MXMA 3KKCA 1T33A 3ZQLA 4X1EA 3BJBA 3WHBA 1Z77A 3NXCA 4AUXA 2G7GA 2OERA 2DTZA 2GENA 3MNLA 1VI0A 3O8HA 3BR2A 3HE0A 3BTLA 2XGCA 3BNIA 4ACIA 3B81A 3VVYA 1QPIA 3TP3A 3VP5A 3G7RA 2F07A 2XRLA 3V6GA 3C07A 1ZK8A 2FQ4A 2X6OA 5AQCA 5F0CA 2RAEA 2OPTA 3RH2A 5F04A 2QWTA 2OF7A 3KKDA 2Y2ZA 5CXIA 1UI5A 5GPAA 3CJDA 2Y31A 5F0FA 3EGQA 3HTIA 2EH3A 2QKOA 4NN1A 2V57A 5H9TA 3QBMA 4D7MA 3FK7A 2O7OA 4M3BA 2ZCNA 3VVZA 2PBXA 4YZEA 5DAJA 3QQAA 2FJ1A 2XPWA 2NP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WV1 A;  2HYJ A;  3VPR A;  3VIB A;  5EYR A;  3ZQH A;  3LSR A;  4I76 A;  4B3A A;  3TP0 A;  3VW0 A;  3VOK A;  3KZ9 A;  5D18 A;  3Q0W A;  3BR1 A;  4JNN A;  1JT6 A;  5EZG A;  4JL3 A;  4G12 A;  3LSJ A;  2UXP A;  5J1Y A;  2TCT A;  2ZCM A;  1U9N A;  3HGG A;  2ZB9 A;  4AF5 A;  2UXO A;  3Q0U A;  4AC6 A;  2RHA A;  1A6I A;  3Q0V A;  5K7H A;  5D19 A;  3T6N A;  4PXI A;  3BQZ A;  3NNR A;  4GFK A;  4I6Z A;  4M3E A;  2DG7 A;  3ON2 A;  2QOP A;  4V2G A;  3BT9 A;  3VUQ A;  3E7Q A;  1T56 A;  2OI8 A;  1QVU A;  4UDS A;  3NRG A;  5J1U A;  5HBU A;  3SDG A;  3LSP A;  3GEU A;  4ME9 A;  4MO7 A;  2FD5 A;  2HXI A;  3BCG A;  5IP6 A;  2NS8 A;  3NPI A;  4B1R A;  4M3G A;  3BR5 A;  3FK6 A;  2HQ5 A;  5EZH A;  5C4Y A;  2XPU A;  3IH4 A;  2VPR A;  3DPJ A;  5FHP A;  2REK A;  5J1R A;  2XPV A;  2QTQ A;  5K58 A;  3O8G A;  5FKN A;  1QVT A;  2VKE A;  3CWR A;  1RKW A;  3IH3 A;  3BTI A;  2Q24 A;  2GUH A;  3F0C A;  3ZQI A;  3B6C A;  2UXI A;  3F1B A;  2GFN A;  3G1M A;  5IOY A;  3FRQ A;  3QPS A;  5F27 A;  3S5R A;  3LOC A;  3BTC A;  2ZOZ A;  4NEL A;  3ANP A;  2RAS A;  3EUP A;  4JKZ A;  5FKL A;  3G1L A;  2ID3 A;  3QKX A;  2QCO A;  3BQY A;  2YVE A;  5GP9 A;  5FMP A;  4JYK A;  5IOZ A;  4MK6 A;  1ZKG A;  5FGL A;  4M3F A;  1JUP A;  4M3D A;  3IH2 A;  2HXO A;  3BR3 A;  5K7Z A;  2G3B A;  4GCT A;  2FX0 A;  3MVP A;  1JUM A;  2X9D A;  3AQT A;  3BTJ A;  5K7F A;  4D7N A;  3Q3S A;  5J3L A;  3HTH A;  3PM1 A;  2ID6 A;  2ZCX A;  3AQS A;  4L62 A;  4D5F A;  2TRT A;  2NP3 A;  2HYT A;  5FKM A;  2NS7 A;  2JJ7 A;  2XGD A;  1RPW A;  4V2F A;  3V78 A;  2XB5 A;  5F1J A;  1RKT A;  5CW8 A;  5GPC A;  2G7S A;  3QPL A;  3JSJ A;  5D1R A;  3ZQG A;  5IPA A;  1ORK A;  3PAS A;  4W1U A;  2JK3 A;  3VW2 A;  2Y30 A;  3VW1 A;  3RD3 A;  4DW6 A;  3G56 A;  3VVX A;  2IEK A;  1JUS A;  3DCF A;  2I10 A;  3VOX A;  5CXG A;  5FKK A;  3HTA A;  2HKU A;  3CDL A;  2D6Y A;  3C2B A;  5FKO A;  3O60 A;  4HKU A;  4D5C A;  3B6A A;  2O7T A;  3PPB A;  5F0H A;  5HSZ A;  1BJZ A;  3NI7 A;  1JTX A;  3G1O A;  3DEW A;  3FIW A;  4CGR A;  2IU5 A;  3KNW A;  2G7L A;  1UI6 A;  1Z0X A;  3COL A;  3LWJ A;  3LJL A;  2NX4 A;  3GZI A;  5HAW A;  3WHC A;  2GBY A;  5F08 A;  3BRU A;  3ZQF A;  3HIM A;  1JT0 A;  3BR0 A;  3SFI A;  3ON4 A;  2XDN A;  5EFY A;  4GCL A;  2G0E A;  2QIB A;  2WUI A;  3P9T A;  2ZOY A;  2XGE A;  2WGB A;  3CRJ A;  2FBQ A;  2IBD A;  1SGM A;  2DG8 A;  2UXH A;  2PZ9 A;  3IUV A;  2UXU A;  3BHQ A;  4GFL A;  3HTJ A;  3ANG A;  2VKV A;  1U9O A;  2W53 A;  4KWA A;  3CCY A;  2YVH A;  1JTY A;  4AC0 A;  3HGY A;  4ICH A;  4ABZ A;  4W97 A;  4GCK A;  2IAI A;  3BR6 A;  3LHQ A;  4XK4 A;  4MXM A;  3KKC A;  1T33 A;  3ZQL A;  4X1E A;  3BJB A;  3WHB A;  1Z77 A;  3NXC A;  4AUX A;  2G7G A;  2OER A;  2DTZ A;  2GEN A;  3MNL A;  1VI0 A;  3O8H A;  3BR2 A;  3HE0 A;  3BTL A;  2XGC A;  3BNI A;  4ACI A;  3B81 A;  3VVY A;  1QPI A;  3TP3 A;  3VP5 A;  3G7R A;  2F07 A;  2XRL A;  3V6G A;  3C07 A;  1ZK8 A;  2FQ4 A;  2X6O A;  5AQC A;  5F0C A;  2RAE A;  2OPT A;  3RH2 A;  5F04 A;  2QWT A;  2OF7 A;  3KKD A;  2Y2Z A;  5CXI A;  1UI5 A;  5GPA A;  3CJD A;  2Y31 A;  5F0F A;  3EGQ A;  3HTI A;  2EH3 A;  2QKO A;  4NN1 A;  2V57 A;  5H9T A;  3QBM A;  4D7M A;  3FK7 A;  2O7O A;  4M3B A;  2ZCN A;  3VVZ A;  2PBX A;  4YZE A;  5DAJ A;  3QQA A;  2FJ1 A;  2XPW A;  2NP5 A; 
#chains in the Genus database with same CATH topology
 2WV1 A;  2HYJ A;  3VPR A;  3VIB A;  5EYR A;  3ZQH A;  3LSR A;  4I76 A;  4B3A A;  3TP0 A;  3VW0 A;  3VOK A;  3KZ9 A;  5D18 A;  3Q0W A;  3BR1 A;  4JNN A;  1JT6 A;  5EZG A;  4JL3 A;  4G12 A;  3LSJ A;  2UXP A;  5J1Y A;  2TCT A;  2ZCM A;  1U9N A;  3HGG A;  2ZB9 A;  4AF5 A;  2UXO A;  4WIB A;  3Q0U A;  4AC6 A;  2RHA A;  1A6I A;  3Q0V A;  5K7H A;  5D19 A;  3T6N A;  4PXI A;  3BQZ A;  3NNR A;  4GFK A;  4I6Z A;  4M3E A;  3DU6 A;  2DG7 A;  4U9L A;  3ON2 A;  2QOP A;  4V2G A;  3BT9 A;  3VUQ A;  3E7Q A;  1T56 A;  2R7R A;  2OI8 A;  1QVU A;  4UDS A;  3NRG A;  5J1U A;  5HBU A;  3SDG A;  3LSP A;  3GEU A;  4ME9 A;  4MO7 A;  2FD5 A;  2HXI A;  3BCG A;  5IP6 A;  2NS8 A;  3NPI A;  3SWH A;  4B1R A;  3K8P C;  4M3G A;  2YVX A;  2A2F X;  3BR5 A;  3FK6 A;  2HQ5 A;  5EZH A;  5C4Y A;  2R7O A;  2XPU A;  2FJI 1;  2B1E A;  3IH4 A;  2VPR A;  3DPJ A;  5FHP A;  2REK A;  5J1R A;  2XPV A;  2QTQ A;  5K58 A;  5CQG A;  3O8G A;  5FKN A;  1QVT A;  2VKE A;  3CWR A;  1RKW A;  3IH3 A;  3BTI A;  2Q24 A;  2GUH A;  3F0C A;  3ZQI A;  2R7V A;  3B6C A;  2UXI A;  3F1B A;  2GFN A;  3G1M A;  5IOY A;  3FRQ A;  3QPS A;  5F27 A;  3S5R A;  3LOC A;  3BTC A;  2ZOZ A;  4NEL A;  3ANP A;  2RAS A;  3EUP A;  4JKZ A;  5FKL A;  3G1L A;  2ID3 A;  3QKX A;  2QCO A;  3BQY A;  2B3W A;  2YVE A;  5GP9 A;  5FMP A;  4JYK A;  5IOZ A;  4MK6 A;  1ZKG A;  5FGL A;  4M3F A;  1JUP A;  4M3D A;  3IH2 A;  2HXO A;  3BR3 A;  5K7Z A;  2G3B A;  2R7T A;  2R7W A;  4GCT A;  2FX0 A;  3MVP A;  1JUM A;  2X9D A;  3AQT A;  3BTJ A;  5K7F A;  4D7N A;  3Q3S A;  5J3L A;  3HTH A;  3PM1 A;  2ID6 A;  2ZCX A;  3AQS A;  4L62 A;  4D5F A;  3FHN A;  2TRT A;  2NP3 A;  2HYT A;  5FKM A;  2NS7 A;  2PFV A;  2JJ7 A;  2XGD A;  1RPW A;  4V2F A;  2XB5 A;  3V78 A;  5F1J A;  1RKT A;  5CW8 A;  5GPC A;  2G7S A;  3QPL A;  3JSJ A;  5D1R A;  3ZQG A;  5IPA A;  4U9N A;  1ORK A;  3PAS A;  4W1U A;  2JK3 A;  3VW2 A;  2Y30 A;  3VW1 A;  3RD3 A;  4DW6 A;  3G56 A;  3VVX A;  2IEK A;  1JUS A;  3DCF A;  2I10 A;  3VOX A;  5CXG A;  5FKK A;  3HTA A;  2HKU A;  3CDL A;  2D6Y A;  3C2B A;  5FKO A;  3O60 A;  4HKU A;  4D5C A;  3B6A A;  2O7T A;  3PPB A;  5F0H A;  5HSZ A;  1BJZ A;  3NI7 A;  1JTX A;  3G1O A;  3DEW A;  3FIW A;  4CGR A;  2IU5 A;  3KNW A;  2G7L A;  3VTI A;  1UI6 A;  3KYL A;  1Z0X A;  3COL A;  3LWJ A;  3LJL A;  2NX4 A;  3GZI A;  5HAW A;  3WHC A;  2GBY A;  5F08 A;  3BRU A;  3ZQF A;  2R7U A;  3HIM A;  1JT0 A;  3BR0 A;  3SFI A;  3ON4 A;  2XDN A;  5EFY A;  4GCL A;  2G0E A;  2QIB A;  2WUI A;  3P9T A;  2ZOY A;  4OD4 A;  2XGE A;  2WGB A;  3CRJ A;  4C2M A;  2FBQ A;  2IBD A;  1SGM A;  2DG8 A;  2UXH A;  2PZ9 A;  3IUV A;  2UXU A;  3BHQ A;  4GFL A;  3HTJ A;  3ANG A;  2VKV A;  1U9O A;  2W53 A;  4KWA A;  3CCY A;  2YVH A;  1JTY A;  4AC0 A;  3HGY A;  4ICH A;  4ABZ A;  4W97 A;  4GCK A;  4OD5 A;  2IAI A;  3BR6 A;  3LHQ A;  4XK4 A;  4MXM A;  3KKC A;  1T33 A;  3ZQL A;  4X1E A;  3BJB A;  3WHB A;  1Z77 A;  3NXC A;  4AUX A;  2G7G A;  2OER A;  3NS4 A;  4IRV A;  2DTZ A;  2R7X A;  2GEN A;  3MNL A;  2R7Q A;  1VI0 A;  3O8H A;  3BR2 A;  3HE0 A;  3BTL A;  2XGC A;  2ZY9 A;  3BNI A;  4ACI A;  3B81 A;  3VVY A;  1QPI A;  3TP3 A;  3VP5 A;  3G7R A;  2F07 A;  2XRL A;  3V6G A;  3C07 A;  1ZK8 A;  2FQ4 A;  2X6O A;  5AQC A;  5F0C A;  2RAE A;  3DU5 A;  2OPT A;  3RH2 A;  5F04 A;  2QWT A;  2OF7 A;  3KKD A;  2Y2Z A;  5CXI A;  2R7S A;  1UI5 A;  5GPA A;  3CJD A;  2Y31 A;  5F0F A;  3EGQ A;  3HTI A;  2EH3 A;  2QKO A;  4NN1 A;  2V57 A;  5H9T A;  3QBM A;  4D7M A;  3FK7 A;  2O7O A;  4M3B A;  2ZCN A;  3VVZ A;  4DVY P;  2PBX A;  4YZE A;  5DAJ A;  3QQA A;  2FJ1 A;  2XPW A;  2NP5 A; 
#chains in the Genus database with same CATH homology
 2WV1 A;  2HYJ A;  3VPR A;  3VIB A;  5EYR A;  3ZQH A;  3LSR A;  4I76 A;  4B3A A;  3TP0 A;  3VW0 A;  3VOK A;  3KZ9 A;  5D18 A;  3Q0W A;  3BR1 A;  4JNN A;  1JT6 A;  5EZG A;  4JL3 A;  4G12 A;  3LSJ A;  2UXP A;  5J1Y A;  2TCT A;  2ZCM A;  1U9N A;  3HGG A;  2ZB9 A;  4AF5 A;  2UXO A;  3Q0U A;  4AC6 A;  2RHA A;  1A6I A;  3Q0V A;  5K7H A;  5D19 A;  3T6N A;  4PXI A;  3BQZ A;  3NNR A;  4GFK A;  4I6Z A;  4M3E A;  2DG7 A;  3ON2 A;  2QOP A;  4V2G A;  3BT9 A;  3VUQ A;  3E7Q A;  1T56 A;  2OI8 A;  1QVU A;  4UDS A;  3NRG A;  5J1U A;  5HBU A;  3SDG A;  3LSP A;  3GEU A;  4ME9 A;  4MO7 A;  2FD5 A;  2HXI A;  3BCG A;  5IP6 A;  2NS8 A;  3NPI A;  4B1R A;  4M3G A;  3BR5 A;  3FK6 A;  2HQ5 A;  5EZH A;  5C4Y A;  2XPU A;  3IH4 A;  2VPR A;  3DPJ A;  5FHP A;  2REK A;  5J1R A;  2XPV A;  2QTQ A;  5K58 A;  3O8G A;  5FKN A;  1QVT A;  2VKE A;  3CWR A;  1RKW A;  3IH3 A;  3BTI A;  2Q24 A;  2GUH A;  3F0C A;  3ZQI A;  3B6C A;  2UXI A;  3F1B A;  2GFN A;  3G1M A;  5IOY A;  3FRQ A;  3QPS A;  5F27 A;  3S5R A;  3LOC A;  3BTC A;  2ZOZ A;  4NEL A;  3ANP A;  2RAS A;  3EUP A;  4JKZ A;  5FKL A;  3G1L A;  2ID3 A;  3QKX A;  2QCO A;  3BQY A;  2YVE A;  5GP9 A;  5FMP A;  4JYK A;  5IOZ A;  4MK6 A;  1ZKG A;  5FGL A;  4M3F A;  1JUP A;  4M3D A;  3IH2 A;  2HXO A;  3BR3 A;  5K7Z A;  2G3B A;  4GCT A;  2FX0 A;  3MVP A;  1JUM A;  2X9D A;  3AQT A;  3BTJ A;  5K7F A;  4D7N A;  3Q3S A;  5J3L A;  3HTH A;  3PM1 A;  2ID6 A;  2ZCX A;  3AQS A;  4L62 A;  4D5F A;  2TRT A;  2NP3 A;  2HYT A;  5FKM A;  2NS7 A;  2JJ7 A;  2XGD A;  1RPW A;  4V2F A;  3V78 A;  2XB5 A;  5F1J A;  1RKT A;  5CW8 A;  5GPC A;  2G7S A;  3QPL A;  3JSJ A;  5D1R A;  3ZQG A;  5IPA A;  1ORK A;  3PAS A;  4W1U A;  2JK3 A;  3VW2 A;  2Y30 A;  3VW1 A;  3RD3 A;  4DW6 A;  3G56 A;  3VVX A;  2IEK A;  1JUS A;  3DCF A;  2I10 A;  3VOX A;  5CXG A;  5FKK A;  3HTA A;  2HKU A;  3CDL A;  2D6Y A;  3C2B A;  5FKO A;  3O60 A;  4HKU A;  4D5C A;  3B6A A;  2O7T A;  3PPB A;  5F0H A;  5HSZ A;  1BJZ A;  3NI7 A;  1JTX A;  3G1O A;  3DEW A;  3FIW A;  4CGR A;  2IU5 A;  3KNW A;  2G7L A;  1UI6 A;  1Z0X A;  3COL A;  3LWJ A;  3LJL A;  2NX4 A;  3GZI A;  5HAW A;  3WHC A;  2GBY A;  5F08 A;  3BRU A;  3ZQF A;  3HIM A;  1JT0 A;  3BR0 A;  3SFI A;  3ON4 A;  2XDN A;  5EFY A;  4GCL A;  2G0E A;  2QIB A;  2WUI A;  3P9T A;  2ZOY A;  2XGE A;  2WGB A;  3CRJ A;  2FBQ A;  2IBD A;  1SGM A;  2DG8 A;  2UXH A;  2PZ9 A;  3IUV A;  2UXU A;  3BHQ A;  4GFL A;  3HTJ A;  3ANG A;  2VKV A;  1U9O A;  2W53 A;  4KWA A;  3CCY A;  2YVH A;  1JTY A;  4AC0 A;  3HGY A;  4ICH A;  4ABZ A;  4W97 A;  4GCK A;  2IAI A;  3BR6 A;  3LHQ A;  4XK4 A;  4MXM A;  3KKC A;  1T33 A;  3ZQL A;  4X1E A;  3BJB A;  3WHB A;  1Z77 A;  3NXC A;  4AUX A;  2G7G A;  2OER A;  2DTZ A;  2GEN A;  3MNL A;  1VI0 A;  3O8H A;  3BR2 A;  3HE0 A;  3BTL A;  2XGC A;  3BNI A;  4ACI A;  3B81 A;  3VVY A;  1QPI A;  3TP3 A;  3VP5 A;  3G7R A;  2F07 A;  2XRL A;  3V6G A;  3C07 A;  1ZK8 A;  2FQ4 A;  2X6O A;  5AQC A;  5F0C A;  2RAE A;  2OPT A;  3RH2 A;  5F04 A;  2QWT A;  2OF7 A;  3KKD A;  2Y2Z A;  5CXI A;  1UI5 A;  5GPA A;  3CJD A;  2Y31 A;  5F0F A;  3EGQ A;  3HTI A;  2EH3 A;  2QKO A;  4NN1 A;  2V57 A;  5H9T A;  3QBM A;  4D7M A;  3FK7 A;  2O7O A;  4M3B A;  2ZCN A;  3VVZ A;  2PBX A;  4YZE A;  5DAJ A;  3QQA A;  2FJ1 A;  2XPW A;  2NP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...