1JUPA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jupA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jupA02
3V78A 1TWGJ 4GFBA 3OSGA 1AKHA 3RQIA 3M3YJ 3HM5A 3G1MA 5EYRA 1T33A 3IV5A 2QWTA 5IYDJ 2DMPA 2K9NA 4ICHA 3NAUA 4XRMA 1JJ6C 4CYCB 3HOYJ 3VUQA 3FK7A 5F0FA 1RKWA 1TWHJ 3RZDJ 1U8BA 3GTLJ 2NVXJ 1S7EA 3IH4A 5M5WJ 3S1MJ 3VW2A 5HODA 5M5XJ 4HNVA 4A3EJ 2NS8A 1AU7A 1WPKA 2HXIA 2Y9YA 4C3HJ 3DEWA 1P7IA 1FEXA 5F0CA 5HBUA 1JTYA 3S1QJ 5FMPA 3JREA 1AHDP 3CCYA 3I4NJ 2JJ7A 1IJWC 1XC5A 5IP7J 4UUTA 2DMUA 2Y2ZA 3CWRA 4HKUA 1ZKGA 2PZ9A 4UUSA 5K7FA 3OSFA 1W0UA 2UXOA 4DYCA 3KZ9A 1PUFA 1VI0A 3H3VK 5EGOA 4DYRA 4AUXA 2V57A 1RKTA 1GDTA 2E2IJ 5GPAA 2X6OA 3BTCA 1F43A 1ETKA 2MGQA 3ANPA 1ZR4A 4ACIA 2G7LA 2HDDA 3HKZN 2HXOA 2ID6A 1RETA 1JKOC 1ETOA 4XRSA 3GTPJ 2RHAA 1SGMA 4M6VA 5J1RA 2O8KA 4MFEA 4KWAA 1LFBA 5CW8A 2YUSA 2PBXA 3GZIA 2ZOZA 4B1RA 3NRGA 4M3BA 2Q24A 3NXCA 2NS7A 1TC3C 5E3MA 1JKQC 4FTHA 4MK6A 1SANA 4D5FA 2L9RA 5EEAA 2ZOYA 2L7MP 3BCGA 4IHXA 4C2MJ 5M5YJ 1LE8A 4A3MJ 5FLVA 3BTIA 3RD3A 1JKPC 1EF4A 3AQTA 3LSGA 2X48A 2L0KA 4X6AJ 2GENA 2VPRA 1YRNA 3PASA 1APLC 2HI3A 3DCFA 4JYKA 4ME9A 2XRLA 1F36A 3MN2A 3QPLA 2O9LA 4M3EA 4DW6A 2JA7J 1ZR2A 2EZIA 4A3KJ 1T56A 2LLKA 2XGCA 1OCTC 4CGRA 2DMTA 1TWCJ 2IAIA 4NELA 1MH3A 2K9QA 4B4CA 4J19A 2FJ1A 1IRZA 1ETVA 3PPBA 4BBRJ 4FISA 3IH3A 4NN1A 3G1LA 5FKLA 2IEKA 3BJBA 3LWJA 2IBDA 1SFOJ 3BR3A 1UMQA 3S2HJ 5HSZA 2WB1N 3KNWA 4FCYA 1QRYA 3ON2A 3SDGA 2M8GX 2UXPA 5IYCJ 4BY1J 2JN6A 3VVYA 3BR1A 4IHYA 1FTZA 2ZCMA 3S2DJ 2EQRA 3ZQCA 5F08A 1JJ8C 2Y0SN 3CJDA 1O4XA 1LFUP 5EZGA 2XDNA 2NVYJ 2R5YA 5C4XJ 4A3IJ 1WH5A 3CQZJ 1K61A 4QTRA 1RESA 3O8GA 5EF6A 2R5ZA 2Y31A 3SJMA 2LD5A 3W6VA 3EUPA 3G56A 4YZEA 2DN0A 4BXXJ 1NK2P 5DTDA 1OJLA 2CU7A 4A3FJ 2REKA 4V2GA 5IYBJ 3JRFA 3VP5A 2XGDA 2JK3A 2DTZA 3KKDA 3VOXA 2B63J 2FBQA 2O7TA 1IG7A 3HOVJ 5K7HA 3S17J 3FKIJ 2GM4A 2M34A 2LP0A 2E2HJ 4GCLA 5IP9J 2WGBA 4MXMA 5M3FJ 2CQQA 4W97A 3BQZA 2NX4A 2CUFA 2JA5J 4D5CA 1HF0A 2G3BA 1IV6A 4IEJA 1NTCA 9ANTA 2UXIA 2UXHA 5GP9A 4XK4A 5K7ZA 1ZK8A 2JA6J 2EZKA 2XB0X 3JRHA 2R0QC 2CRGA 1A5JA 3FRQA 1GVDA 1AKHB 3PO2J 2EBIA 2OF7A 3JRGA 1HLVA 3C07A 1HCRA 1E3OC 1FIPA 2LVSA 3GBGA 4GFKA 4JP0A 3EGQA 3TEDA 5IP6A 1B72A 5CXGA 1FIAA 3LNQA 5EDNA 2LTPA 3NI7A 1GUUA 2M2EA 4D7NA 1MBKA 2O7OA 2XGEA 1JKRC 3S1NJ 2I10A 5IOZA 4I76A 3JRBA 5HAWA 3B81A 3FISA 3LOCA 1NK3P 2DA5A 2DG7A 1UI6A 4DZPA 1JUPA 3BTJA 3VW0A 2VI6A 4IHWA 3JRIA 4Y52J 2HOSA 1JT0A 1Q1VA 1JT6A 5IOYA 2XB5A 3HTHA 2CUEA 3M4OJ 5E3NA 2XSDC 3ZQHA 2D5VA 3HTAA 1CQTA 4A3DJ 3GEUA 2DA6A 1UG2A 2JMWA 1MSFC 3Q3SA 2P81A 3HBLA 5EGOB 3P9TA 2NVTJ 2COBA 1WCMJ 2QF7A 1GV5A 4AC0A 3ZOBA 3K2AA 2R92J 3JSJA 2M9HA 3S1RJ 4RBOA 3RZOJ 5FHPA 1ZTRA 3FIWA 4DYQA 1I6HJ 1U9OA 2MG4A 3GTOJ 1XS9A 5C4YA 2F07A 5IPAA 3E7LA 1UHSA 2QTQA 2NOGA 4JNNA 3LHQA 2DA3A 4XRSG 2YS9A 4JL3A 1HDDC 1UI5A 3UKGA 4GFLA 2LK2A 4I6ZA 2AHQA 3GTMJ 4A93J 4BY7J 3LSRA 2L7FP 3ZQLA 5EFYA 4C3JJ 2R93J 5FLMJ 1H88C 3F0CA 4L62A 2RAEA 2DA2A 3BG3A 3O60A 2EZLA 3LSJA 2VKEA 1JUMA 3L1PA 5GPCA 1ORKA 3G7RA 2EZHA 2MW8A 3V6GA 2DMQA 1OFCX 4EEFG 3RKQA 2QOPA 5F0HA 1DU6A 4M3DA 1D5YA 3ON4A 2LR8A 1ZGWA 2ECCA 1B8IB 3O8HA 1R9TJ 3LJLA 5D18A 2H1KA 4PXIA 2HQ5A 1X2NA 2VKVA 4GCTA 4B3AA 1ETYA 1JTXA 1MBHA 4JX5A 2GBYA 3FK6A 3HIMA 3RH2A 1MH4A 5C44J 2VUMJ 1ITYA 1X2MA 3VVZA 2FQ4A 3CRJA 1HOMA 2XPUA 4NDLA 2PMZN 1X58A 4CYCA 2DA7A 2H8RA 1U78A 5CXIA 2YVHA 3HOZJ 3IUVA 2TRTA 1QPIA 2YU9J 1W0TA 5EG0B 1MBFA 4A3BJ 3E7QA 1A6IA 5FJ8J 5C4JJ 2GLOA 3HOUJ 2R7ZJ 3A01B 4S0HB 3ZQGA 2ID3A 3GTQJ 5DAJA 1K83J 3Q0VA 1I50J 1BA5A 3BNIA 2E2JJ 1WH7A 2X9DA 1H8AC 1U9NA 2DG8A 3KKCA 3D1NI 1VNDA 1MNMC 1QVTA 2HYTA 3MNLA 3HOWJ 4A3CJ 3JRAA 3ANGA 1MBGA 4A3JJ 5E3LA 5F27A 4BKXA 2R5YB 2CJJA 1MBJA 1IUFA 1BW5A 4RDUA 2R5ZB 1TWFJ 1IGNA 1FJLA 3A03A 3HDDA 1HDPA 3BR6A 3QPSA 2JWTA 3K7AJ 2DJNA 3GTKJ 2L7ZA 1GV2A 3HGGA 5F1JA 1GT0C 3HGYA 4Y7NJ 2K40A 5J3LA 3PO3J 3DPJA 1MSEC 1ZQ3P 4IHVA 1Y1VJ 4DZJA 3LSPA 1G2HA 3QQAA 3MKLA 2N8GA 2XPVA 3JRCA 2ZCXA 1FTTA 2W53A 5F04A 4AC6A 1POGA 1RR7A 3OOUA 2FD5A 3BG9A 3I4MJ 3BR5A 2WV1A 4MLOA 5C3EJ 3BHQA 2LKXA 1P7JA 1Z0XA 3BR0A 2OERA 1ETWA 3JR9A 4QSHA 3TP0A 1WGXA 2G0EA 5E3OA 3WHBA 3BQYA 5J1UA 2KT0A 3SFIA 5JLWA 3S16J 2KDZA 4JX4A 4UUSB 2FX0A 1DU0A 4LOCA 1PUFB 3VW1A 3BR2A 2JA8J 2EH3A 2NP5A 2HOAA 3TW6A 1TWAJ 3WHCA 2GFNA 1JGGA 3VPRA 3CMYA 3G1OA 1B72B 3S14J 3S5RA 1JUSA 4C3IJ 4W1UA 4UDSA 3BT9A 5D1RA 1OCPA 3Q0WA 3VIBA 1BW6A 3A02A 1IDYA 2MSYA 3HOXJ 1VFCA 1BJZA 3ZQIA 4GCKA 2QKOA 1IC8A 1Z77A 3BG5A 1H89C 5H9TA 2ME6A 2IU5A 2UXUA 2D6YA 4L5EA 5J1YA 2LY9A 5FKOA 2QIBA 3NPIA 3TW7A 5K58A 3NARA 3B6CA 3MVPA 4G12A 2G7GA 2ELKA 3F1BA 3HTIA 2CQXA 1B8IA 3T6NA 3HTJA 2G7SA 2TCTA 2HYJA 3PM1A 2Y9ZA 3S15J 4A3LJ 1ENHA 5AQCA 5BNGA 3BTLA 2DMNA 1LE8B 3GTJJ 3OIOA 2W48A 3Q0UA 4AYBN 3QBMA 4JX6A 1YRNB 2XPWA 2ECBA 5FKMA 1QVUA 4FE7A 4JKZA 2ME0A 2DA1A 2M0CA 2DA4A 1ETXA 5DS9A 2K9SA 4M3FA 3TP3A 5EG0A 3BRUA 3HE0A 2Y30A 5JLXA 3NNRA 4A3GJ 1WI3A 1RPWA 2WUIA 3B6AA 2AO9A 5FKKA 2OI8A 2YVEA 4V2FA 3A01A 1XG1A 2GUHA 5FGLA 2NVQJ 3VVXA 4MO7A 2LFBA 3HB9A 4A69C 4XICA 1ETQA 4D7MA 2E1OA 2HOTA 1I3QJ 2ZB9A 2HKUA 2WAQN 3VOKA 3CDLA 3JRDA 3GTGJ 4MFDA 3H0GJ 5EZHA 4X1EA 4AF5A 2NP3A 2E19A 3QKXA 2OPTA 3C2BA 5D19A 4ABZA 1Y1WJ 3IH2A 4BBSJ 2RASA 2ZCNA 3ZQFA 3HEFA 5M3MJ 1IDZA 1MBEA 1BL0A 1VF9A 5FKNA 3AQSA 4MIMA 2QCOA 4FE4A 3COLA 4XIDA 4M3GA 4QIWN
chains in the Genus database with same CATH superfamily
2OZ6A 5FD5A 2NRAC 4A0ZA 2V6EA 2JTVA 4C2MA 2JUCA 5LGNA 2HDWA 3T8RA 3L2CA 2ZY9A 1VQLI 2FMYA 3PIOF 2QQBA 3CTAA 2PFBA 1RKWA 4ZYHA 5CYVA 5HODA 5HLGA 2EFOA 1Z9CA 4XN3A 4A3EJ 5L3DA 1R71A 3DEWA 3FDYA 1P7IA 5HLHA 4NBQA 3QP6A 5FD6A 3H1CA 2TDXA 1JTYA 1LB2A 4WX9A 3JREA 3BROA 1AHDP 1ULYA 3F72A 2HTSA 4ASNA 3VWBA 3IUOA 3CWRA 2KP6A 2XVCA 1Z05A 3FXUA 5LGTA 4UUSA 2PZ9A 2M4GA 2YPRA 2XKPA 3QYEA 1W0UA 1BI2A 2QGUA 3F8CA 5L3CA 1PUFA 2DI3A 2R7QA 1JHHA 1RKTA 3ZN0A 1YE9A 2EFNA 3BTCA 4A5MA 2CW0F 2E34A 3OR2C 3RCOA 1QA6A 4IZZA 4ACIA 1T95A 4XLHA 1ZRFA 1QHHD 1MMDA 2GZWA 1RETA 1JKOC 1JXSA 3OYMA 2PFVA 5AIQA 3GTPJ 2RHAA 4HRIA 5J1RA 2CFXA 3SXYA 3QU6A 4DNCA 3HRMA 1YO5C 4ZZDA 4RGSA 2PBXA 3GZIA 4HX8A 3UR3C 4P9FA 2HQRA 3SEZA 2P0WA 3AG4H 3VYRB 1XCVA 4KITB 4G6TB 4FTHA 2DXIA 1TNTA 2XAJA 3TO9A 2D45A 4D5FA 5EEAA 4RAZA 3BCGA 1XGNA 3AL0B 2LRDA 3H5RA 1NH3A 3GUDA 2EILH 2H94A 1UJ8A 3ABTA 3E5UA 2V6CA 2Y69H 1JKPC 2VKDA 2L0KA 3CD6I 1YRNA 2JVHA 3H0DA 3CUOA 2HFHA 2VC1A 3M1CA 4ME9A 4YELA 2AS5F 2RDPA 2O9LA 2JA7J 1T56A 1XPXA 4EGZA 1OCTC 4CGRA 4HV6A 5L3BA 2K9QA 4E7LA 1IRZA 2FJ1A 3BDDA 1ETVA 4FISA 4ITVA 3WTUC 2E35A 4EATA 5J8FA 1LDDA 2B1EA 1O7FA 1IN8A 3FF5A 4XKBA 5FFZA 5LLQA 2CSOA 2V9VA 4XRFA 2HEOA 3S2HJ 4A6DA 3DPLC 2WB1N 3KNWA 3H36A 3F6VA 1VQNI 1QRYA 2XHKA 2VQLA 2EV5A 2UWMA 3O6BB 3OYLA 3LAJA 5IYCJ 3KP4A 4BY1J 3F8NA 4I7HA 2IVMA 4CCJA 2ZCWA 2VN2A 3VVYA 1SAXA 4NHJA 2ZCMA 4CUGA 1MMGA 3S2DJ 1VZ0A 2WA0A 2W1OA 3ZQCA 1JJ8C 2Y0SN 2ZXHA 2KRFA 2BHZA 2Z5UA 1LFUP 4PUSA 5EZGA 2V1XA 3QYFA 4AD9A 3GMEA 4A3IJ 3LAPA 1K61A 4OIPF 2LD5A 4AIKA 1SMYF 3OOPA 4YZEA 1X3ZB 5ILVA 1NK2P 5DTDA 4BDYA 4ZC3A 3JRFA 3VP5A 2XGDA 2JK3A 1FX7A 1WJFA 5TISC 3VOXA 1HW1A 1FPQA 3PFYA 1T2KA 1FSEA 3NWSA 2JT1A 1HKQA 4FASD 1TQPA 2GIZA 2LP0A 2M34A 4E7SA 4GCLA 3D5LA 3WU1B 2O0YA 1QNTA 4WXHA 5IP9J 4L9JA 2EFQA 5LHIA 1K7AA 4BUPA 1EJ9A 4MXMA 2QSGX 3JCUC 2L5QA 2BVMA 4IO9F 1IF1A 2CQQA 2E1MB 4W97A 4UNOA 3L7WA 1MMNA 2NX4A 3WTXC 2JA5J 1R22A 4S05A 2X1EA 2CV1A 3HKZA 1IV6A 4E6KG 2JVGA 2UXIA 3H3ZA 2P7VB 1XMAA 3BPVA 4CXFA 4IOCF 1T0FA 1ZK8A 2JA6J 1PDNC 5D6FA 1A5JA 4IOAF 2CRGA 3FRQA 1U5TB 2FXAA 1B6AA 1BR2A 2ZJPF 3ROUA 4CCOA 3KP7A 5K5QA 5CXGA 5BQTA 1OCRH 1GUUA 3SFZA 4I09A 4L18B 1MBKA 2XGEA 2VJ4A 5D4SA 1J9IA 4I76A 3JRBA 4KICA 2DG7A 5HOOA 1ZRCA 4IRGA 2LYCA 2IS6A 4BQAA 3K69A 4IHSA 3VW0A 5CVIA 3ZMVA 1BM9A 2XF5A 2IGKA 4U87A 2QBYA 3G71I 1XGMA 1X3WB 5B5EC 3BZKA 3H92A 5E20A 3OYBA 3HIFA 3ZQHA 4YFXF 5GAHJ 2R7WA 1XTAA 3FXJA 5E8IA 3ZP5A 4A3DJ 1UG2A 3DPTA 1K6YA 3HZJA 2P81A 3GLXA 3HBLA 3QPTA 3RPUA 2NVTJ 2COBA 2DT7B 1MJBA 5LRSA 1GV5A 5DD4A 5EEHA 3CC4I 4ZDLA 4HPQA 3CCLI 4OAZA 1ZTRA 1DPUA 4UY8I 3FIWA 4DYQA 1G6NA 2W24A 1I6HJ 3GTOJ 1DDNA 5C4YA 2F07A 3AFHA 3K9TA 4CICA 2QTQA 3TQNA 2EV6A 2DA3A 4C9YA 5ERIA 3LWFA 2JRTA 2PJRA 3FXMA 4ZZLA 2EINH 3UKGA 2AHQA 4NC7A 4C3JJ 3K0LA 3F0CA 3PJRA 4L62A 4E7JA 2L9NA 2LG4A 2VKEA 2ZNZA 1QZZA 5D6EA 1ORKA 3RDIA 2EZHA 3C3WA 3DTEA 1WFXA 1CF7B 1OFCX 2QOPA 5F0HA 2LR8A 5A2QK 1B8IB 3GLLA 1OR7C 1RR8C 2A3SA 1MD0A 1D1CA 4B48A 2IGNA 3R60A 2VKVA 1G3SA 1R4MB 2DCEA 4B3AA 2Q2EB 1JTXA 4JX5A 5HDGA 4DIQA 1MH4A 5KK1A 1Z6RA 2FQ4A 2Z9OA 3L2WA 2DFIA 3DXJF 1TP4A 1O3SA 1RI7A 1XX5A 2MH2A 2K9LA 4NDLA 1PYVA 2QWWA 1BR4A 3CP8A 4CSWA 4XN0A 1U78A 2YVHA 3HOZJ 3R4KA 3COAC 5IT9K 5EG0B 2GIVA 1YFHA 4FX0A 3E0JB 1V5FA 3Q0VA 1I50J 1KYWA 2FJI1 4QLCU 5BPIA 1U9NA 1VNDA 2FA5A 3OWTA 1PP8F 2QM3A 2VIXA 3F21A 3RKYA 4XQFA 1PUEE 3JRAA 5DYMA 2KZGA 3TOBA 4BKXA 4XSZF 2R5YB 3CC7I 3KEOA 3JSPA 1IUFA 4B43A 4U88A 2R5ZB 2KDOA 4HDUA 2ZSHB 5DUKA 3WU0A 4OMYA 1OPCA 1Y0UA 3BR6A 4Y4RA 2H1LA 2JWTA 3K7AJ 3OYGA 2CS3A 4U7BA 5DCFA 3FHNA 1GV2A 1J5YA 3LSKA 1MSEC 1ZQ3P 1R49A 2IT0A 1Y1VJ 3LL7A 4DZJA 4IHVA 3QQAA 4AWXB 3MKLA 2XPVA 2M0MA 1FTTA 3OYAA 5F04A 1E17A 2MC3A 3FZVA 3OIQA 3OOUA 3KE2A 3BC8A 3K10A 3UNGC 3ASNH 4UV8A 3L2VA 5LEJA 2WV1A 2P5LC 1P7JA 2YX4A 5CLSA 4QPQA 2DODA 1Q1HA 3TP0A 3NWTA 1WGXA 5E3OA 2ELJA 3ML6A 3D0SA 5JLWA 3S16J 2QSFX 4BQOA 4JX4A 4UUSB 3P5JA 4BJTA 1PUFB 2Z16A 1XD7A 2EH3A 2HOAA 3TL4X 4CA0A 3RTRA 3G1OA 2DW4A 1JUSA 4W1UA 4M6YA 2RQPA 5D1RA 2L9VA 3Q0WA 3HOTA 1KQ0A 2P5VA 3LMMA 3U1KA 4GCKA 2DYRH 4UB6C 3BG5A 2FMLA 2JPBA 5D4RA 2HPMA 4L5EA 2M7AA 5J1YA 2QIBA 5K58A 2HKXA 2STWA 1YW9A 1X19A 3V8JA 3WG9A 3GZNB 4XONA 1R5HA 2ICWG 2F5CA 2O8XA 3VSKA 2QKMB 3HYIA 3IRRA 3T6NA 3J80Z 3V4GA 2RREA 3KZZA 2PMZA 2QEXI 2M5WA 3LSMA 2Z33A 5BNGA 3OIPA 4A6EA 2HYGD 3GTJJ 2ZMEA 4F3QA 1W5SA 2ZXIA 4AM3A 4RGRA 1YRNB 2CQNA 4KYWA 1OYWA 2F5VA 1JHFA 2ME0A 1ETXA 5LEKA 2UV1A 3TP3A 2LY2A 4BGDA 3PUFA 1K78A 1OKRA 3TO7A 3BWGA 1IN7A 3DTKA 1XDUA 5FLXZ 1FMWA 2ESHA 3VB2A 2LFBA 2JUGA 2E1OA 1VTNC 1KONA 4YG2F 1K6OA 2LOOA 1ZRDA 3VOKA 2XAFA 2QVOA 4D0PA 3WTVC 4AF5A 4OD4A 1HQCA 3BPXA 3QKXA 3L2QA 1O3RA 2K02A 3F8MA 4HF0A 5K5RA 2XV4S 4Y17A 1MBEA 1IXRC 1VF9A 5FKNA 3WE2A 4L0ZB 4IRVA 3COLA 2HR3A 2F4OB 1W4MA 4LB5A 1YTYA 3OSGA 1SVMA 3RQIA 2MYSA 5FGMA 3OYFA 3FMSA 3GVAA 3M3YJ 4YRVA 1T33A 3G2BA 2GXBA 2QWTA 2BY0A 2P4WA 5IYDJ 2DMPA 3V7SA 1FP1D 3LFUA 4GRIA 4FX4A 2B3WA 4L5JA 3HOYJ 3VUQA 3K2ZA 5J8CA 5F0FA 4IF4A 5CVRA 1S7EA 3IH4A 4G94A 1BOAA 1AU7A 1WPKA 4FHTA 2MLKA 3CP2A 3U9GA 1FEXA 5F0CA 4IX7A 3L9FA 3L00A 3CCYA 4FQGA 2W84A 1IJWC 3QOPA 1N78A 4RM3A 1TW2A 4LG3A 4BXUA 4WWCA 4HKUA 5D5VB 5F6FA 3IL2A 3OSFA 1XMKA 1SMTA 2B0LA 3OYJA 3U2RA 2XF6A 4DYCA 4EGYA 5FRMA 1VI0A 2X1CA 4AUXA 1I5ZA 3FHZA 2V57A 2DTRA 2HS5A 2V79A 4GXOA 5HLIA 2R3SA 1F43A 2MGQA 3MZYA 2QLZA 2R7FA 3MQ0A 1X1AA 2HXOA 2MLGA 2CV0A 1ETOA 2HPIA 2W57A 2O8KA 1T8IA 3RJPA 3R0AA 1LFBA 5CW8A 3PQJA 2FBKA 3CCEI 2ZOZA 3S3OA 5CVJA 3B73A 4E70A 5E18F 4HNUA 4MQ9F 1R00A 3K4KA 4L0YB 3HTSB 2NS7A 1TC3C 5E3MA 4PCQA 1JKQC 3BY6A 1S6LA 2XROA 3IP4B 4AYBA 1X1DA 3RYPA 4M72A 1SANA 4MHGA 2FOKA 3EUKL 3ERED 5EJCA 5KHDA 1FSHA 2QBYB 2I8DA 1CF7A 4C2MJ 5M5YJ 1YS6A 1WRJA 4GYIA 1SFKA 3HRUA 1ZN2A 1UFMA 3K4BA 4JOMA 2R7VA 3RD3A 2X0LA 3LSGA 2DQRA 4X6AJ 2G9WA 3ZMZA 4YIFA 1EH8A 1J59A 2HI3A 2G7HA 3LQRA 4P55A 1MW7A 3DCFA 2F4IA 3J7AO 4AIDA 1KQ8A 3HHHA 1FBSA 3QPLA 2Q2EA 3SEQA 1ZR2A 3F22A 4R1HA 2EZIA 4HLYA 3X2QH 3PNTA 1QZYA 3BG6A 4FETA 3GYHX 2VE9A 4A3KJ 3P7NA 3OYNA 1FC3A 3MKZA 2L54A 2V1UA 2DMTA 1MDMB 2IAIA 3SZPA 2VLAA 3H9JA 1EV7A 4NELA 3GFMA 3H3UA 3PSIA 3BJOA 4WIBA 4NN1A 3G1LA 5FKLA 2IEKA 3LWJA 4Z2YA 1SFOJ 2VXDA 3BR3A 1UMQA 4ESFA 1Y6IA 1WJBA 4HEA2 3W6KB 1IXSB 3CO7C 3ON2A 2CG4A 2M8GX 4BHCA 5HS8A 2W4SA 3AG1H 3S2WA 3TKYA 2Q8KA 4IHYA 1U6GA 1LDJA 3EUHA 4JK1X 2PI0A 1VQOI 2FBHA 1O4XA 1ZGJA 2BVLA 3K1MA 4JQFA 4MNUA 5E17F 3E6DA 2NVYJ 2VXZA 3MFKA 2R5YA 2OCEA 2Q0OA 2L02A 2HNHA 2EK5A 1WH5A 2OQRA 1ZLJA 4I0AA 3VFZA 5FB2A 3IRQA 3MKYB 3ISPA 1D0YA 2R5ZA 5FRNA 3ERMA 5IT3A 5DUIA 2DN0A 2K3PA 2DPDA 1MMSA 1OMIA 1OYYA 1KZHA 1OJLA 4A3FJ 3CCUI 4DQ2A 3I55I 1FBUA 1R4NB 4HSTA 2VBZA 2DO7A 2O5RA 2B63J 2ZFWA 1OCCH 4DBRA 2O03A 3O2PE 2RV8A 4IRIA 2H6BA 3S17J 3FKIJ 2O7TA 2PBIA 1UHMA 3F6OA 3LA3A 5F1RA 3LFKA 2WGBA 1WJCA 1FOWA 2VOPA 4G6DA 1D8JA 5BS6A 4XL9A 2CUFA 3WG7H 1HF0A 2PEXA 2G3BA 2GXAA 3REOA 2CUJA 1LEBA 3KPHA 2HZTA 2CYYA 3EETA 1KA8A 2KRHA 3MWMA 2VL8A 9ANTA 3RPUD 4DGWB 2D1HA 1W1WE 2R7OA 4XKVA 3M8FA 2FEZA 1BJAA 4CDGA 1Z7UA 2EA4A 2EZKA 1MJAA 3OYIA 2OTJI 2M87A 2E71A 1KU9A 2EBIA 3DQVC 3DV8A 1IW7F 1F9NA 3C07A 3QOEA 3VODA 3HL2A 3BCAA 2E1MC 2WC2A 4GFKA 3TEDA 1FIAA 4U9NA 5EDNA 3NI7A 1IO2A 3ZPLA 3GFIA 1YJNI 2PQ8A 2W25A 1JKRC 1Y8RB 3M7GA 3G4SI 3B81A 1XN7A 3LSTA 3SHFA 3FISA 5FFXA 4HV5A 2V7FA 3BTJA 4EM0B 3OS0A 2VI6A 1U5TC 1JT0A 2HQNA 3I54A 2CFOA 4XLEA 1JT6A 2KL4A 4HG2A 3WTSC 4UV9A 1LJ9A 2XASA 2CUEA 1SD7A 5E3NA 1VQKI 3FKJA 4G7HF 3V42A 2M4KA 4U0VA 1BIBA 3DKXA 4Q47A 3W2WA 1CQTA 2C6YA 5CQEA 2VBYA 2HVRA 2K4BA 2WAEA 1DGWY 3M1EA 2HZDA 1K4TA 5EGOB 1P4XA 1MIJA 3P9TA 1WCMJ 3IC7A 2VONA 4MTEA 3T5XA 4AC0A 4NC8A 3HG9A 2R92J 2M9HA 3S1RJ 5D8LB 4RBOA 5FHPA 1HA8A 3DLLF 1UAAA 2EFWA 2HDCA 1UHSA 4JNNA 1J2XA 4EMSA 2MC4A 1FOKA 3LHQA 4RB1A 4XRSG 4JL3A 3TOAA 2H6CA 4XLCA 1UI5A 2XUBA 4GFLA 3DTIA 1ZLKA 3GTMJ 3A0HC 1T98A 4N9IA 3F3XA 4F92B 2JRMA 4PSWA 1N75A 2L7FP 3W6JB 4X0GA 1FT9A 2MFZA 2O61A 4A0XA 2DA2A 3BG3A 3O60A 2DK5A 3VYUB 1S3JA 2FBIA 5GPCA 4CHUA 3J81K 2DMQA 3R61A 1DU6A 2KMUA 4RMNA 1R1UA 3O8HA 4XOTA 1R9TJ 5D18A 5F64A 1D3YA 5GTHC 3CJQB 1G8XA 2EIJH 2HQ5A 1X2NA 3MKWB 3GX4X 1RNLA 3KLNA 5CVVA 1MBHA 2AQFA 2GBYA 3SYTA 1QU3A 3HIMA 2ZMEB 2ZSIB 1REPC 1P2FA 1AWCA 1HOMA 2X51A 4LITA 2EIKH 3DF8A 4LFUA 1A6QA 1X58A 1FZPB 1JGSA 4N4NB 2J5OA 4LLNA 3E7QA 1MBFA 1J75A 1TT5B 4A3BJ 4QWQA 1K78B 1A6IA 2VODA 3HOUJ 5C4JJ 2LDUA 3E6CC 1BN5A 3GTQJ 5L3GA 5DAJA 3IWZA 4KMUX 3G6EI 1BA5A 1T38A 1F1ZA 2BXZA 3PSFA 3HJEA 4EJUA 5LD2C 1H8AC 3T0YA 1GVJA 2DFFA 2OV7A 2VT2A 4KIGA 1NHAA 2P6TA 4D9JA 1YIOA 5H20A 2ZJQF 3WGGA 4HDVA 4E7ZA 1ERDA 2EFPA 4II3A 4ENKA 2K3FA 2W85A 2ISZA 3F8BA 3FM5A 3GWZA 2VB6A 4RDUA 2RVCA 4KIBA 1E0EA 5D5WB 5GADJ 3QPSA 1GXQA 3BG7A 3GTKJ 4PJLA 2YSRA 1GT0C 3K8PC 2OCCH 3CF5F 4C2TA 3PO3J 3ZGKA 4PFPA 3LSPA 3KZYA 3LSHA 2KIQA 2W53A 4AC6A 1RR7A 2LNBA 1V55H 1ZELA 1HXDA 3CCVI 3W2VA 2JA2A 4MLOA 1K79A 2LREA 3BHQA 4PJNA 4F93B 3BR0A 2OERA 1ETWA 4QSHA 1YITI 3QPHA 1SD5A 3WHBA 1FYKA 3BQYA 2FE3A 2M30A 2JPCA 1F5TA 1W7PA 5DCMA 3O3KA 1O3TA 1DU0A 3P9IA 2Z3YA 2Z1DA 4LOCA 3WE3A 5TGTA 4G9YA 2JA8J 1HBXG 1ZREA 1USSA 1TWAJ 3WHCA 1B72B 2HVSA 4C3IJ 4C30A 3HPHA 3RIRA 1OCPA 1RIOH 1MDMA 3VIBA 1IDYA 2MSYA 2X6XA 3ZQIA 2QKOA 2AXTC 3M07A 4LIUA 4OMZA 5B66C 2FU4A 1UG0A 4Y15A 3NARA 3CMMA 1VQ4I 2R7RA 3FXOA 3KP6A 2G7GA 4PGHA 3GZ6A 2P5KA 1V5EA 1Z67A 4LMYA 1WWXA 1TLHB 2BY2A 3C2GA 2IGOA 3BZ6A 4M71A 3W3CA 2A05A 1W36D 2ZXWH 4HX7A 5JI6A 2TCTA 5HNFA 5K1YA 1J09A 1YX3A 1SD4A 3PM1A 3IAS2 3S15J 4KUMA 1IXCA 2YR2A 3BTLA 4AIJA 1FP2A 3RKWA 3C2HA 2DMNA 4EQQA 1RZ4A 2IP2A 2BZTA 2DFHA 2VBWA 2XPWA 2ECBA 3SQNA 5FKMA 1QVUA 5ICFA 2EB7A 4ZJZA 4JKZA 4CCKA 4F52A 4KIFA 3KP5A 4PJMA 2K9SA 1FOYA 5J40A 4A2UA 1LPQA 1PJRA 2ESNA 3BRUA 3HE0A 5JLXA 2KISA 3I9V2 3NNRA 1X4PA 4A3GJ 2WUIA 3B6AA 2ZO4A 3H5NA 4V2FA 1IN4A 3FM3A 2GUHA 4BEHA 2CW7A 2V9PA 3F8FA 4P9UA 3HB9A 1PP7U 4UXNA 2LH9A 3SZTA 4BE0A 4RA2A 5H6QA 1SFXA 1VQ5I 2HOTA 1I6XA 1TW3A 5DDGA 3A4CA 1QQIA 3ABUA 3GTGJ 4MFDA 5EZHA 4UUVA 4HF1A 2OAZA 3QYBA 2NP3A 3M8EA 2COMA 2OPTA 3C2BA 4OU0A 2KKOA 2FOWA 4BBSJ 4EM2A 5L3FA 3I3LA 1Y0NA 2OJED 3GZ5A 4XLAA 4XIDA 2X6WA 2EV0A 5LHGA 4GFBA 1XSVA 5EEGA 3DBHB 3I56I 4LG0A 3AAFA 1QGPA 3G1MA 3IV5A 1TQMA 3GEZA 2K9NA 2A69F 3NAUA 4XRMA 2IS1A 1JJ6C 1KGSA 2DU9A 3FBNB 3FK7A 1TWHJ 3RZDJ 4L5IA 3GTLJ 1H0MA 3VW2A 4BH9A 3OYHA 2B7EA 3KZIC 2HXIA 2Y9YA 3KX2A 4RB0A 4YFKF 4E7KA 2CGPA 2STTA 4LK0F 5FMPA 3S1QJ 2OZUA 1KYZA 2CQKA 1SVLA 2JJ7A 1G4DA 3KEQA 5ICGA 4BAYA 1X3UA 2DMUA 3DPUA 1MJ9A 1ZKGA 1R7JA 4ZYEA 4A5NA 3BLYA 3QRFF 3WTYC 2M3AA 1A04A 5EGOA 1Y56A 1KU2A 4DYRA 4G7OF 3CJTB 1GDTA 4YIIA 1E3PA 1ZG3A 4A12A 4MGRA 3ANPA 1ZR4A 2A5YB 5GAEJ 2HDDA 3HKZN 2ID6A 1M1EB 1MNEA 3E1SA 4GCVA 1SGMA 4M6VA 1XCBA 3R6SA 4RM2A 4ESBA 5B3SH 3JSOA 4KT5C 1BI3A 2QSHX 1ODDA 4HNTA 2XAUA 4WXDA 4OIOF 2H09A 4M3BA 3NXCA 1T0FC 1TBXA 1N25A 1D1AA 1IV8A 1ZH5A 1TL8A 2HU9A 3Q5FA 2K5CA 4PDKA 2RQQA 1IRGA 3FXLA 3VOEA 1Z21A 3ZCOA 1V54H 3DFGA 2I5UA 3JAMZ 3OY9A 1XGSA 4Y3OA 5E1WA 3OS2A 4IHXA 1LE8A 2CV2A 4A3MJ 3BTIA 3A0BC 1EF4A 1QO0D 3AQTA 2BW3A 2VPRA 1APLC 4CZCA 5IY5H 2ELHA 2OD5A 4AVPA 4JYKA 2DT5A 2XRLA 5FROA 3MN2A 2G7UA 3NS4A 4ZYGA 1YI2I 4DW6A 1ONVA 3L2RA 4ESJA 4ZYDA 1BI0A 2WAQA 4P5OA 2BE5F 1YS7A 3CCQI 4BQNA 1MH3A 1VQPI 4F91B 4J19A 3PPBA 5JHFA 4IQ4A 3IH3A 4MEXF 1WJDA 3TDUC 3BJBA 1WQ2A 4IHTA 2BY3A 2FUG2 3FXKA 4P1WA 2ZXJA 5HSZA 4BXFA 4F55A 1FYLA 2R4GA 2F5DA 3SDGA 2R7XA 3EYYA 1V5GA 1ZAOA 2UXNA 5DEQA 5HS9A 4OWRB 2JN6A 3BR1A 2Y48A 1SEUA 1F4KA 5F08A 4UB8C 3CJDA 3QP5A 3ELKA 2VC0A 3I71A 2FF4A 1R6RA 1KU3A 3CQZJ 3M9AA 1FMVA 4QTRA 1RESA 5EF6A 3W6VA 3G56A 4YIRX 4LJZF 2WWYA 1S5LC 3EUPA 3DBRB 4PK4A 4DBQA 4V2GA 1STZA 2DYSH 4HQMA 2A6EF 3A1YA 4E7IA 3KKDA 2DFEA 2KJCA 1W5CC 2UUZA 1BR1A 3CLOA 3CUQC 3HOVJ 2W00A 3VDXA 2GM4A 1R23A 4AIHA 5LHHA 1GHCA 5A2QZ 4ZTJA 4F7ZA 2M8EA 4EJOA 5E1XA 3RI4A 5M3FJ 1D0ZA 2BHYA 1SAUA 3BQZA 3SDBA 1SC7A 2FRHA 1GLNA 2EJRA 1I3AA 2KQRA 1BI1A 2CWEA 4D5CA 4N4OB 3KFWX 2QA4I 3OL3A 4ENMA 4BJ6C 2QUFA 1NTCA 3U21A 2UXHA 2L3DA 1OCOH 2O6GE 2NYXA 4XK4A 2WBMA 1D5VA 2ETHA 2HOEA 2R0QC 3BOQA 4Y33A 3FBIB 4O6JA 2JQ7A 1AKHB 3PO2J 4RGXA 1RRJA 3JRGA 5IT9Z 1E3OC 1FIPA 4IXAA 4BU2A 2F5EA 3GBGA 3EGQA 5IP6A 1B72A 2LTPA 4Q4ZF 2M2EA 1FY7A 2JSPA 2O7OA 2PMHA 3OL4A 3P9KA 3S1NJ 2I10A 3RKXA 2QYOA 2VOOA 1Z3XA 3HRSA 5HLTA 2VJ5A 5LRRA 2H27A 1UI6A 1JUPA 4Y52J 3JRIA 1YW7A 3OYDA 3B02A 3BJAA 4XKWA 3F23A 1ON2A 1YG2A 1Q1VA 4PJ0C 4AU7A 1D8KA 2XF7A 4EJWA 1S72I 4B8XA 2XB5A 4BACA 2LSOA 2XSDC 2WY7Q 3HSRA 2DA6A 5CQGA 1XB4A 3S3MA 3VTIA 2EA2A 4LLLA 2WADA 5J47A 2X4HA 3OYKA 3S32A 1Z3YA 3MAJA 2OA4A 4KISA 3K2AA 1IUYA 1W7PB 3GFLA 5DCMB 2PJPA 5CVUA 2NAZA 1U9OA 5AONA 2WB1A 4KDPA 3T1BA 4KMFA 1I1SA 2DDAA 2NOGA 2M45A 2OU2A 2YS9A 3C1DA 5E8GA 3SWHA 2DK8A 3WGHA 3BJ6A 1B1BA 4UVBA 5J4YA 3AL0C 4I6ZA 2IPQX 4IPAA 4BY7J 2Y0SA 3LSRA 5EFYA 2R93J 1WI9A 5BOXA 1I27A 2EZLA 1DUXC 5B1BH 1JUMA 4Q48A 4BJ5C 3L1PA 2QZ8A 2AXLA 2NNYA 2QENA 1HKSA 3G7RA 5D5XB 4U0WA 3I4PA 2MW8A 3V6GA 3W2AA 4S04A 4GYGA 5HNHA 1D5YA 3ON4A 4ZTFA 2ECCA 1G3WA 1ZGWA 4HA8A 1ZG1A 2IS2A 1BC8C 3LJLA 2A68F 2H1KA 4PXIA 1X1CA 2W82A 5D5UB 1QZEA 4HW0A 2L7KA 1YX5A 4GCTA 1VQ7I 1ETYA 2RGVA 5KAFC 3FK6A 5C44J 1X2MA 2IA2A 4G6QA 1X1BA 3CRJA 4XBFA 1G3TA 3ZMSA 2PMZN 2P8TA 2DOEA 2DA7A 4KJZA 4M9ZA 3J7ZI 3L09A 2VQCA 1X4OA 1HSTA 2P7CB 1O57A 5H6RA 2R7ZJ 4BDZA 1YW8A 4BHPA 5HDNA 3ZQGA 4BEHB 2PMUA 2LY1A 4RGUA 3WU2C 2Q1ZB 2F48A 3BNIA 1ZARA 2FSWA 3H9GA 4MEYF 1QVTA 3QWLA 1OCZH 4N0BA 4A3CJ 3ZN1A 3CCMI 1W7PD 3CCRI 2IXSA 3ANGA 4A3JJ 3FMRA 5E3LA 5F27A 3I5UA 5JHUA 1KQ9A 2NOJB 3DEUA 4L9TA 1D1BA 5ICEA 3ULQB 1MBJA 3KYCB 4LD5A 1BW5A 4CYDA 1IGNA 3A03A 3GO5A 1HDPA 2GOMA 3EUAA 1O7LA 3GF2A 1XGOA 5TRDA 3ASOH 2GAUA 2GWRA 4LG0B 3U1DA 2L7ZA 1O3QA 2DAOA 3KCCA 3OMYA 4M73A 1Z6TA 5F1JA 4Y7NJ 2K40A 5J3LA 1W36C 5TJJA 3DP7A 1DGRM 2E36A 3OYEA 1L0OC 2NXNB 3JRCA 2N8GA 1MZBA 4TV7A 4C2UA 1USTA 1B59A 1POGA 5CPRB 2WV0A 2FD5A 3I4MJ 1HW5A 4ETSA 2LKXA 2YU3A 2CO5A 4CO8A 2G0EA 2L01A 3S3NA 1BOBA 1T08B 5CKTA 5J1UA 4RB2C 1SFUA 2BBYA 4I99C 2KT0A 4EJVA 1TZLA 5DM6F 2KDZA 4KNYA 6PAXA 5HDKA 3VW1A 3E97A 3PQKA 2NP5A 1ZYRF 5GTIC 3FWEA 2F6CA 2GFNA 1JGGA 2Z99A 3D5RC 2KJBA 2XAHA 4UDSA 1IRFA 3BT9A 2LC2A 1OR7A 3E6BA 4I02A 1QPMA 4Z6YA 3PIPF 3HUGB 1VFCA 3HOXJ 1HW2A 2GA2A 4LB6B 4XLPF 1AA7A 1BJZA 2PN6A 1IC8A 1Z77A 1LQ1A 1H89C 3JTGA 4WF2A 1N77A 3AG3H 2D6YA 1IN6A 2UXUA 4B3XA 3NPIA 2ZJRF 2EIMH 5JR3A 2YX7A 5BPDA 3B6CA 4PFOA 2E60A 3IWFA 4G12A 4IVNA 3F1BA 3J7YJ 4RLFA 2VKHA 3HTIA 2CQXA 4I0BA 3HTJA 2G7SA 2IA0A 3HTUA 2Y9ZA 1W5TA 3CZ6A 2RNGA 1A35A 1T6SA 3L2UA 3I58A 1A31A 1YLFA 4IRHA 1LE8B 2VT3A 2D2WA 3GXOA 2W48A 2E5ZA 4ZH4F 4AYBN 4HOBA 4WK8F 2BW3B 1FOXA 2E1NA 1DPRA 1PVEA 3CLQA 4M9SA 5H2FC 3WODF 4I2OA 2DA4A 5DS9A 4M3FA 2W7NA 3KEYA 2LBFB 1UELB 3RSNA 3I64A 2E1CA 1FWZA 1LKXA 1WI3A 1RPWA 1NG7A 3K1PA 4HBLA 2AO9A 4II2A 2P6SA 2OI8A 2YVEA 3A01A 2HYFA 1ON1A 1R5ID 3RQ4A 2NNNA 2GOXB 4NC6A 3ZQQA 4MO7A 4XICA 1TQIA 4D7MA 3H35A 4OIRF 4OD5A 5HS7A 3CMAI 2DJIA 4U0YA 3NRVA 2JSCA 3HSFA 1Z91A 1HSJA 3CDLA 3KLOA 2Y0MA 5ED4A 3I59A 4NQWA 3CO6C 4CGZA 5D19A 3LSIA 1ZHFA 3IH2A 1S7OA 2RASA 2UXXA 3ZQFA 5JFRA 3AKZA 5M3MJ 1IDZA 1TT0A 2L2OA 3AQSA 2VQHA 2XRNA 3K4CA 4MIMA 5FO5A 4M3GA 3OYCA 3V78A 1TWGJ 2H8WA 4XLFA 1AKHA 4B09A 2IJLA 4OINF 4HAMA 2V1DA 3HM5A 3M8JA 4IJAA 5EYRA 1YOVB 2V1NA 3K6GA 1VQ9I 4ICHA 3CJNA 2M7BA 4CYCB 1H9TA 1U8BA 3ZXSA 1MKMA 3DKYA 2NVXJ 2DOFA 1MNDA 3KETA 3RYRA 5M5WJ 5M5XJ 3S1MJ 4HNVA 1UB9A 2NS8A 3CCSI 4IQJA 4C3HJ 1B9MA 1Z7LA 3EUHC 1MGTA 5HBUA 3V8KA 3DEEA 3I4NJ 1XC5A 5IP7J 2CW8A 3CDIA 4UUTA 3EYIA 5L3EA 4GDFA 1ACIA 2Y2ZA 1HC8A 4IKFA 5K7FA 3K70D 2KFDA 4NB5A 2UXOA 1HKTA 3KZ9A 4PGGA 2X6YA 3H3VK 2EPFA 3JAMK 4ENJA 2VPLA 4XOPA 2IRFG 2E2IJ 5GPAA 2X6OA 2VQGA 2X85A 3V7CA 1UCRA 3J80K 2HKOA 2LKPA 1K4SA 4EV0A 1ETKA 1VQMI 1KU7A 3ZRGA 3OS1A 1RUNA 1WJ5A 1WJAA 2G7LA 4UVAA 1J7KA 4XRSA 3GCMA 1P4WA 4KT6A 4MFEA 5CJ9A 4KWAA 1S8NA 1TNSA 2YUSA 3DKWA 3T8TA 2BXYA 2HWVA 2OBPA 4B1RA 4XM3A 5B1AH 3FX3A 3NRGA 3CDHA 3HOSA 1RUOA 2Q24A 4BE2A 1XMXA 3VYSB 4Y13A 4R79A 3I0TA 1YYVA 3VEPA 3ONQA 4H0EA 3TGNA 5K5OA 4MK6A 4AVZA 2L9RA 2ZOYA 2BYVE 2L7MP 2D1VA 4OAYA 1LVAA 5FLXK 4EM1A 3EQLF 3N05A 5FLVA 3QU3A 5DV5A 4G7ZF 2X48A 1IRXA 1YJWI 2GENA 2NVUB 3PASA 3WTZA 2A5WA 2KIUA 2AQEA 4M74A 2L9SA 2KLOA 1UZCA 2XGXA 2OUMA 3C7JA 4NNJA 5JVGF 1F36A 1AOYA 4LK1F 2EWNA 2R7TA 3IKTA 4M3EA 5JVTA 5LFAA 2LLKA 2XGCA 3V8LA 1MMAA 4DVYP 1TWCJ 2A6HF 1DP7P 1UHWA 1SFEA 4B4CA 1YJ9I 1FYMA 1VQ6I 4BBRJ 3ABMH 1B4AA 1EKEA 2FQ3A 3D5SC 2GQQA 4BYYA 2DT6A 1CGPA 2IBDA 2KPMA 1ZG5A 1G3YA 1WJEA 4EVIA 3CUQA 5KNLA 3WTWC 4KFCA 2LKSA 4FCYA 2UXPA 3CMEI 3CCJI 2Y75A 4LIVA 4CCMA 2XDVA 4G8XA 3ZQ7A 3DU5A 1FTZA 4B44A 1LNWA 2PX9A 3RPQA 2EQRA 3HXLA 4FT8A 4PZJA 2ISYA 3WGIA 2XDNA 3AG2H 5C4XJ 2ZFUA 2LMDA 3O8GA 3H5AA 2DQLA 2Y31A 3SJMA 4BXXJ 2RNJA 3GFJA 4N9HA 1OISA 2CU7A 2HVQA 2NS0A 2OQGA 2REKA 5IYBJ 4Q5SF 4L9VA 2BGCA 2DTZA 4EJTA 2Z2SB 2A07F 1BIAA 3ZR8X 3J81Z 2FBQA 3V7RA 1IG7A 3MEXA 5K7HA 4LGWA 2E7XA 1I39A 2E2HJ 4PSXA 5KCMA 3I53A 3EDPA 2ADUA 2RKHA 1V3FA 2BOLA 2GA1A 3NQOA 1NG6A 4HYEA 5BMZA 2XAGA 3CJRB 4WCGA 3KIOA 1LEAA 2MABA 3NEUA 4IEJA 3VYTB 5GP9A 5KAIC 2B9SA 5K7ZA 1OYIA 3G3ZA 2XB0X 4O5VA 3JRHA 2K86A 1GVDA 2JZYA 1I1GA 1G59A 3FXQA 2IA1A 3ABKH 2ZJ2A 1OQYA 3ZMUA 2OF7A 1HLVA 1C0WA 1HCRA 4WXCA 3PL8A 2LVSA 4JP0A 1V4RA 2E5NA 3BZCA 2CMPA 4M6XA 4XR6A 3LNQA 3MZ8A 5ICCA 2RN7A 4D7NA 4U9LA 1JE8A 4UHTA 3H9QA 3HUGA 5IOZA 5HAWA 2BV6A 2KHMA 1RC9A 3LOCA 2DA5A 3MMYB 1NK3P 2MD5A 4DZPA 4IHWA 4GGGA 2KZVA 2HOSA 4I98B 3CF2A 3GW2A 4NUBA 2K85A 3S93A 5IOYA 4KN7X 2K9MA 3E3VA 4ZDPA 3BCBA 3HTHA 3BP8A 3TDZC 3M4OJ 2ZC2A 1S7AA 2D5VA 3HTAA 1Y8QB 2WTEA 2ACJA 3GEUA 1P4AA 3E5XA 2JMWA 1MSFC 2XKOA 3Q3SA 4XNFA 2QF7A 5DD8A 3HC7A 2RC4A 2X1DA 2CH0A 2DBBA 3ZOBA 5GAGJ 1FLIA 3JSJA 3RZOJ 1R1TA 1E2XA 2KIFA 2LF7A 4HF2A 2MG4A 1XS9A 4RAFA 3K4JA 4HSRA 3S8PA 5IPAA 3E7LA 2LBFA 2ZBKA 1U3EM 5E1ZB 1H9GA 3ECOA 4ENNA 1XDSA 1HDDC 1TTYA 4V19K 4RAGA 2LF8A 1U0JA 2LK2A 3N4MA 4IL6C 1FBQA 4A93J 1SVOA 3FMQA 3PFIA 3ZQLA 5FLMJ 1H88C 3K1NA 2K27A 3Q9SA 1EH7A 2HGCA 2RAEA 4XSXF 2DDBA 3LSJA 3PNVA 2OTLI 3DLAA 4XKCA 4ZYAA 1IN5A 3HHGA 3DWLE 3Q9VA 3LA2A 4ON0A 4EEFG 3RKQA 4HX4A 2V26A 4M3DA 3HSEA 1BC7C 1S29A 4E4HA 1Y39A 1U2WA 1EA3A 3RH2A 2IW5A 3F9KA 1WVRA 4HLXA 2VUMJ 1ITYA 2MD0A 3VVZA 3IAM2 3HRTA 2ZKZA 2XPUA 1T39A 3LQQA 3PUBA 2A2FX 4CYCA 1WZ2A 2K7LA 2H8RA 5CXIA 1LDKB 2WY8Q 3IUVA 2TRTA 4BE1A 1QPIA 1W0TA 1GXPA 2YU9J 3TO6A 3OV8A 2HTJA 5FJ8J 2GLOA 4RAYA 5J6XA 2VASA 2MH9A 3OR1C 3A01B 3C18A 4S0HB 4XORA 3IHUA 2XIGA 2ID3A 2A61A 4D1QA 2UZKA 4DOZA 1K83J 3G73A 2E2JJ 1WH7A 2XC7A 1JI8A 2X9DA 2FNAA 4JBAA 2DG8A 3ECHA 3D1NI 3KKCA 1MNMC 2HYTA 1WKMA 4OIQF 3JTHA 2IS4A 3MNLA 3HOWJ 3E5QA 1SD6A 5E79C 3I59B 1P9QC 1U5TA 2R7DA 4NQWB 2YVXA 3TMOA 2R7SA 2PG4A 1MBGA 1P92A 3CC2I 3K4MA 3ZMTA 4CCLA 3DBLB 1S9HA 1WSUA 1B9NA 2K4JA 2CJJA 4ZDOA 1TWFJ 1FJLA 1L3LA 4BHBA 3HDDA 2WAFA 4BS9A 2VBXA 3MD2A 2GXGA 4GO1A 4E7HA 1Z1DA 2DJNA 2VJJA 2KRCA 4QPOA 3HGGA 3TBIA 5J4VA 1LUJB 1E3HA 1YQAA 4MTDA 3HGYA 3IKVA 3DPJA 1P6RA 4KA4A 4RLQA 1G2HA 4DJAA 3ZMDA 1BBYA 2O3FA 2ZCXA 5LGUA 2BEOA 1LVKA 3BG9A 4CH7A 3BR5A 3FXRA 3QAHA 4CCNA 2QQAA 5C3EJ 2E7WA 2IGMA 3EPZA 4U7DA 1Z0XA 1WHUA 1XSDA 3JR9A 1OLTA 4J01A 4HQEA 4M9XA 3JW4A 3SFIA 3QODA 5ILSA 4L9NA 2FX0A 1R5GA 2V4JC 3R0JA 1EH6A 3BR2A 1ZGAA 3MCZA 1QHGA 2MBFA 3TW6A 4K2EA 4CZZA 2DOAA 3VPRA 3CMYA 3S14J 3S5RA 1YIJI 1R58A 2M1BA 2VJIA 4BL0B 4XLNF 4RS8A 3PNYA 3K4LA 1U8RA 1BW6A 3A02A 1A36A 2XSJC 3KYDB 2KIMA 3ESWB 4YFNF 4ANJA 5H9TA 2ME6A 2R7UA 2FNPA 2IU5A 4UVCA 2QQ8A 3VSLA 2LY9A 4R8HA 5FKOA 3TW7A 4BNCA 3A2KA 3DU6A 3KP3A 3MVPA 2PLYA 2L4AA 5D8KB 2ELKA 5AIPA 4BQQA 1DP3A 4XMYA 4O3MA 4RB3C 2MA3A 1B8IA 3LA7A 2OC6A 1LFPA 3P9CA 2HYJA 1YHQI 3SZGA 1X1PA 4PJJA 2F4MB 1R1VA 4A3LJ 1J0RA 1ENHA 5AQCA 2F2EA 3ABLH 1FNNA 2CQ7A 2J5PA 3OIOA 3Q0UA 4YEJA 1DQUA 3QBMA 4JX6A 4H4KC 1VQ8I 3MZHA 4FE7A 4KN4X 4P96A 2XAQA 4A0YA 2BY1A 2DA1A 2M0CA 3CESA 2HQAA 3KP2A 2CUZA 1IZ1A 2QKLB 1D0XA 3KYLA 5EG0A 1QBJA 2A6TA 2DLLA 2Y30A 1IAWA 2PJRB 4I01A 5FKKA 4OOIA 5DM7F 5ILUA 3N97A 5LBQA 1XG1A 2QQ9A 3J7AY 5FGLA 1XSXA 2NVQJ 3VVXA 3K4NA 4A69C 2V9KA 3K70C 1ETQA 4J00A 5KVRA 1I3QJ 4MQVA 2ZB9A 2HKUA 4LLGF 2WAQN 3JRDA 2F5FA 3H0GJ 3WTTC 4X1EA 2E19A 3CUQB 2ZNYA 3E6MA 2ZMEC 4ABZA 1Y1WJ 2ZCNA 1R36A 3HEFA 2L4MA 4HZFA 5HVQC 1BL0A 4B47A 3HPGA 2QCOA 2VE8A 4FE4A 4QIWN 2DPUA
chains in the Genus database with same CATH topology
3V78A 1TWGJ 4GFBA 3OSGA 1AKHA 3RQIA 3M3YJ 3HM5A 3G1MA 5EYRA 1T33A 3IV5A 2QWTA 5IYDJ 2DMPA 2K9NA 4ICHA 3NAUA 4XRMA 1JJ6C 4CYCB 3HOYJ 3VUQA 3FK7A 5F0FA 1RKWA 1TWHJ 3RZDJ 1U8BA 3GTLJ 2NVXJ 1S7EA 3IH4A 5M5WJ 3S1MJ 3VW2A 5HODA 5M5XJ 4HNVA 4A3EJ 2NS8A 1AU7A 1WPKA 2HXIA 2Y9YA 4C3HJ 3DEWA 1P7IA 1FEXA 5F0CA 5HBUA 1JTYA 3S1QJ 5FMPA 3JREA 1AHDP 3CCYA 3I4NJ 2JJ7A 1IJWC 1XC5A 5IP7J 4UUTA 2DMUA 2Y2ZA 3CWRA 4HKUA 1ZKGA 2PZ9A 4UUSA 5K7FA 3OSFA 1W0UA 2UXOA 4DYCA 3KZ9A 1PUFA 1VI0A 3H3VK 5EGOA 4DYRA 4AUXA 2V57A 1RKTA 1GDTA 2E2IJ 5GPAA 2X6OA 3BTCA 1F43A 1ETKA 2MGQA 3ANPA 1ZR4A 4ACIA 2G7LA 2HDDA 3HKZN 2HXOA 2ID6A 1RETA 1JKOC 1ETOA 4XRSA 3GTPJ 2RHAA 1SGMA 4M6VA 5J1RA 2O8KA 4MFEA 4KWAA 1LFBA 5CW8A 2YUSA 2PBXA 3GZIA 2ZOZA 4B1RA 3NRGA 4M3BA 2Q24A 3NXCA 2NS7A 1TC3C 5E3MA 1JKQC 4FTHA 4MK6A 1SANA 4D5FA 2L9RA 5EEAA 2ZOYA 2L7MP 3BCGA 4IHXA 4C2MJ 5M5YJ 1LE8A 4A3MJ 5FLVA 3BTIA 3RD3A 1JKPC 1EF4A 3AQTA 3LSGA 2X48A 2L0KA 4X6AJ 2GENA 2VPRA 1YRNA 3PASA 1APLC 2HI3A 3DCFA 4JYKA 4ME9A 2XRLA 1F36A 3MN2A 3QPLA 2O9LA 4M3EA 4DW6A 2JA7J 1ZR2A 2EZIA 4A3KJ 1T56A 2LLKA 2XGCA 1OCTC 4CGRA 2DMTA 1TWCJ 2IAIA 4NELA 1MH3A 2K9QA 4B4CA 4J19A 2FJ1A 1IRZA 1ETVA 3PPBA 4BBRJ 4FISA 3IH3A 4NN1A 3G1LA 5FKLA 2IEKA 3BJBA 3LWJA 2IBDA 1SFOJ 3BR3A 1UMQA 3S2HJ 5HSZA 2WB1N 3KNWA 4FCYA 1QRYA 3ON2A 3SDGA 2M8GX 2UXPA 5IYCJ 4BY1J 2JN6A 3VVYA 3BR1A 4IHYA 1FTZA 2ZCMA 3S2DJ 2EQRA 3ZQCA 5F08A 1JJ8C 2Y0SN 3CJDA 1O4XA 1LFUP 5EZGA 2XDNA 2NVYJ 2R5YA 5C4XJ 4A3IJ 1WH5A 3CQZJ 1K61A 4QTRA 1RESA 3O8GA 5EF6A 2R5ZA 2Y31A 3SJMA 2LD5A 3W6VA 3EUPA 3G56A 4YZEA 2DN0A 4BXXJ 1NK2P 5DTDA 1OJLA 2CU7A 4A3FJ 2REKA 4V2GA 5IYBJ 3JRFA 3VP5A 2XGDA 2JK3A 2DTZA 3KKDA 3VOXA 2B63J 2FBQA 2O7TA 1IG7A 3HOVJ 5K7HA 3S17J 3FKIJ 2GM4A 2M34A 2LP0A 2E2HJ 4GCLA 5IP9J 2WGBA 4MXMA 5M3FJ 2CQQA 4W97A 3BQZA 2NX4A 2CUFA 2JA5J 4D5CA 1HF0A 2G3BA 1IV6A 4IEJA 1NTCA 9ANTA 2UXIA 2UXHA 5GP9A 4XK4A 5K7ZA 1ZK8A 2JA6J 2EZKA 2XB0X 3JRHA 2R0QC 2CRGA 1A5JA 3FRQA 1GVDA 1AKHB 3PO2J 2EBIA 2OF7A 3JRGA 1HLVA 3C07A 1HCRA 1E3OC 1FIPA 2LVSA 3GBGA 4GFKA 4JP0A 3EGQA 3TEDA 5IP6A 1B72A 5CXGA 1FIAA 3LNQA 5EDNA 2LTPA 3NI7A 1GUUA 2M2EA 4D7NA 1MBKA 2O7OA 2XGEA 1JKRC 3S1NJ 2I10A 5IOZA 4I76A 3JRBA 5HAWA 3B81A 3FISA 3LOCA 1NK3P 2DA5A 2DG7A 1UI6A 4DZPA 1JUPA 3BTJA 3VW0A 2VI6A 4IHWA 3JRIA 4Y52J 2HOSA 1JT0A 1Q1VA 1JT6A 5IOYA 2XB5A 3HTHA 2CUEA 3M4OJ 5E3NA 2XSDC 3ZQHA 2D5VA 3HTAA 1CQTA 4A3DJ 3GEUA 2DA6A 1UG2A 2JMWA 1MSFC 3Q3SA 2P81A 3HBLA 5EGOB 3P9TA 2NVTJ 2COBA 1WCMJ 2QF7A 1GV5A 4AC0A 3ZOBA 3K2AA 2R92J 3JSJA 2M9HA 3S1RJ 4RBOA 3RZOJ 5FHPA 1ZTRA 3FIWA 4DYQA 1I6HJ 1U9OA 2MG4A 3GTOJ 1XS9A 5C4YA 2F07A 5IPAA 3E7LA 1UHSA 2QTQA 2NOGA 4JNNA 3LHQA 2DA3A 4XRSG 2YS9A 4JL3A 1HDDC 1UI5A 3UKGA 4GFLA 2LK2A 4I6ZA 2AHQA 3GTMJ 4A93J 4BY7J 3LSRA 2L7FP 3ZQLA 5EFYA 4C3JJ 2R93J 5FLMJ 1H88C 3F0CA 4L62A 2RAEA 2DA2A 3BG3A 3O60A 2EZLA 3LSJA 2VKEA 1JUMA 3L1PA 5GPCA 1ORKA 3G7RA 2EZHA 2MW8A 3V6GA 2DMQA 1OFCX 4EEFG 3RKQA 2QOPA 5F0HA 1DU6A 4M3DA 1D5YA 3ON4A 2LR8A 1ZGWA 2ECCA 1B8IB 3O8HA 1R9TJ 3LJLA 5D18A 2H1KA 4PXIA 2HQ5A 1X2NA 2VKVA 4GCTA 4B3AA 1ETYA 1JTXA 1MBHA 4JX5A 2GBYA 3FK6A 3HIMA 3RH2A 1MH4A 5C44J 2VUMJ 1ITYA 1X2MA 3VVZA 2FQ4A 3CRJA 1HOMA 2XPUA 4NDLA 2PMZN 1X58A 4CYCA 2DA7A 2H8RA 1U78A 5CXIA 2YVHA 3HOZJ 3IUVA 2TRTA 1QPIA 2YU9J 1W0TA 5EG0B 1MBFA 4A3BJ 3E7QA 1A6IA 5FJ8J 5C4JJ 2GLOA 3HOUJ 2R7ZJ 3A01B 4S0HB 3ZQGA 2ID3A 3GTQJ 5DAJA 1K83J 3Q0VA 1I50J 1BA5A 3BNIA 2E2JJ 1WH7A 2X9DA 1H8AC 1U9NA 2DG8A 3KKCA 3D1NI 1VNDA 1MNMC 1QVTA 2HYTA 3MNLA 3HOWJ 4A3CJ 3JRAA 3ANGA 1MBGA 4A3JJ 5E3LA 5F27A 4BKXA 2R5YB 2CJJA 1MBJA 1IUFA 1BW5A 4RDUA 2R5ZB 1TWFJ 1IGNA 1FJLA 3A03A 3HDDA 1HDPA 3BR6A 3QPSA 2JWTA 3K7AJ 2DJNA 3GTKJ 2L7ZA 1GV2A 3HGGA 5F1JA 1GT0C 3HGYA 4Y7NJ 2K40A 5J3LA 3PO3J 3DPJA 1MSEC 1ZQ3P 4IHVA 1Y1VJ 4DZJA 3LSPA 1G2HA 3QQAA 3MKLA 2N8GA 2XPVA 3JRCA 2ZCXA 1FTTA 2W53A 5F04A 4AC6A 1POGA 1RR7A 3OOUA 2FD5A 3BG9A 3I4MJ 3BR5A 2WV1A 4MLOA 5C3EJ 3BHQA 2LKXA 1P7JA 1Z0XA 3BR0A 2OERA 1ETWA 3JR9A 4QSHA 3TP0A 1WGXA 2G0EA 5E3OA 3WHBA 3BQYA 5J1UA 2KT0A 3SFIA 5JLWA 3S16J 2KDZA 4JX4A 4UUSB 2FX0A 1DU0A 4LOCA 1PUFB 3VW1A 3BR2A 2JA8J 2EH3A 2NP5A 2HOAA 3TW6A 1TWAJ 3WHCA 2GFNA 1JGGA 3VPRA 3CMYA 3G1OA 1B72B 3S14J 3S5RA 1JUSA 4C3IJ 4W1UA 4UDSA 3BT9A 5D1RA 1OCPA 3Q0WA 3VIBA 1BW6A 3A02A 1IDYA 2MSYA 3HOXJ 1VFCA 1BJZA 3ZQIA 4GCKA 2QKOA 1IC8A 1Z77A 3BG5A 1H89C 5H9TA 2ME6A 2IU5A 2UXUA 2D6YA 4L5EA 5J1YA 2LY9A 5FKOA 2QIBA 3NPIA 3TW7A 5K58A 3NARA 3B6CA 3MVPA 4G12A 2G7GA 2ELKA 3F1BA 3HTIA 2CQXA 1B8IA 3T6NA 3HTJA 2G7SA 2TCTA 2HYJA 3PM1A 2Y9ZA 3S15J 4A3LJ 1ENHA 5AQCA 5BNGA 3BTLA 2DMNA 1LE8B 3GTJJ 3OIOA 2W48A 3Q0UA 4AYBN 3QBMA 4JX6A 1YRNB 2XPWA 2ECBA 5FKMA 1QVUA 4FE7A 4JKZA 2ME0A 2DA1A 2M0CA 2DA4A 1ETXA 5DS9A 2K9SA 4M3FA 3TP3A 5EG0A 3BRUA 3HE0A 2Y30A 5JLXA 3NNRA 4A3GJ 1WI3A 1RPWA 2WUIA 3B6AA 2AO9A 5FKKA 2OI8A 2YVEA 4V2FA 3A01A 1XG1A 2GUHA 5FGLA 2NVQJ 3VVXA 4MO7A 2LFBA 3HB9A 4A69C 4XICA 1ETQA 4D7MA 2E1OA 2HOTA 1I3QJ 2ZB9A 2HKUA 2WAQN 3VOKA 3CDLA 3JRDA 3GTGJ 4MFDA 3H0GJ 5EZHA 4X1EA 4AF5A 2NP3A 2E19A 3QKXA 2OPTA 3C2BA 5D19A 4ABZA 1Y1WJ 3IH2A 4BBSJ 2RASA 2ZCNA 3ZQFA 3HEFA 5M3MJ 1IDZA 1MBEA 1BL0A 1VF9A 5FKNA 3AQSA 4MIMA 2QCOA 4FE4A 3COLA 4XIDA 4M3GA 4QIWN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V78 A;  1TWG J;  4GFB A;  3OSG A;  1AKH A;  3RQI A;  3M3Y J;  3HM5 A;  3G1M A;  5EYR A;  1T33 A;  3IV5 A;  2QWT A;  5IYD J;  2DMP A;  2K9N A;  4ICH A;  3NAU A;  4XRM A;  1JJ6 C;  4CYC B;  3HOY J;  3VUQ A;  3FK7 A;  5F0F A;  1RKW A;  1TWH J;  3RZD J;  1U8B A;  3GTL J;  2NVX J;  1S7E A;  3IH4 A;  5M5W J;  3S1M J;  3VW2 A;  5HOD A;  5M5X J;  4HNV A;  4A3E J;  2NS8 A;  1AU7 A;  1WPK A;  2HXI A;  2Y9Y A;  4C3H J;  3DEW A;  1P7I A;  1FEX A;  5F0C A;  5HBU A;  1JTY A;  3S1Q J;  5FMP A;  3JRE A;  1AHD P;  3CCY A;  3I4N J;  2JJ7 A;  1IJW C;  1XC5 A;  5IP7 J;  4UUT A;  2DMU A;  2Y2Z A;  3CWR A;  4HKU A;  1ZKG A;  2PZ9 A;  4UUS A;  5K7F A;  3OSF A;  1W0U A;  2UXO A;  4DYC A;  3KZ9 A;  1PUF A;  1VI0 A;  3H3V K;  5EGO A;  4DYR A;  4AUX A;  2V57 A;  1RKT A;  1GDT A;  2E2I J;  5GPA A;  2X6O A;  3BTC A;  1F43 A;  1ETK A;  2MGQ A;  3ANP A;  1ZR4 A;  4ACI A;  2G7L A;  2HDD A;  3HKZ N;  2HXO A;  2ID6 A;  1RET A;  1JKO C;  1ETO A;  4XRS A;  3GTP J;  2RHA A;  1SGM A;  4M6V A;  5J1R A;  2O8K A;  4MFE A;  4KWA A;  1LFB A;  5CW8 A;  2YUS A;  2PBX A;  3GZI A;  2ZOZ A;  4B1R A;  3NRG A;  4M3B A;  2Q24 A;  3NXC A;  2NS7 A;  1TC3 C;  5E3M A;  1JKQ C;  4FTH A;  4MK6 A;  1SAN A;  4D5F A;  2L9R A;  5EEA A;  2ZOY A;  2L7M P;  3BCG A;  4IHX A;  4C2M J;  5M5Y J;  1LE8 A;  4A3M J;  5FLV A;  3BTI A;  3RD3 A;  1JKP C;  1EF4 A;  3AQT A;  3LSG A;  2X48 A;  2L0K A;  4X6A J;  2GEN A;  2VPR A;  1YRN A;  3PAS A;  1APL C;  2HI3 A;  3DCF A;  4JYK A;  4ME9 A;  2XRL A;  1F36 A;  3MN2 A;  3QPL A;  2O9L A;  4M3E A;  4DW6 A;  2JA7 J;  1ZR2 A;  2EZI A;  4A3K J;  1T56 A;  2LLK A;  2XGC A;  1OCT C;  4CGR A;  2DMT A;  1TWC J;  2IAI A;  4NEL A;  1MH3 A;  2K9Q A;  4B4C A;  4J19 A;  2FJ1 A;  1IRZ A;  1ETV A;  3PPB A;  4BBR J;  4FIS A;  3IH3 A;  4NN1 A;  3G1L A;  5FKL A;  2IEK A;  3BJB A;  3LWJ A;  2IBD A;  1SFO J;  3BR3 A;  1UMQ A;  3S2H J;  5HSZ A;  2WB1 N;  3KNW A;  4FCY A;  1QRY A;  3ON2 A;  3SDG A;  2M8G X;  2UXP A;  5IYC J;  4BY1 J;  2JN6 A;  3VVY A;  3BR1 A;  4IHY A;  1FTZ A;  2ZCM A;  3S2D J;  2EQR A;  3ZQC A;  5F08 A;  1JJ8 C;  2Y0S N;  3CJD A;  1O4X A;  1LFU P;  5EZG A;  2XDN A;  2NVY J;  2R5Y A;  5C4X J;  4A3I J;  1WH5 A;  3CQZ J;  1K61 A;  4QTR A;  1RES A;  3O8G A;  5EF6 A;  2R5Z A;  2Y31 A;  3SJM A;  2LD5 A;  3W6V A;  3EUP A;  3G56 A;  4YZE A;  2DN0 A;  4BXX J;  1NK2 P;  5DTD A;  1OJL A;  2CU7 A;  4A3F J;  2REK A;  4V2G A;  5IYB J;  3JRF A;  3VP5 A;  2XGD A;  2JK3 A;  2DTZ A;  3KKD A;  3VOX A;  2B63 J;  2FBQ A;  2O7T A;  1IG7 A;  3HOV J;  5K7H A;  3S17 J;  3FKI J;  2GM4 A;  2M34 A;  2LP0 A;  2E2H J;  4GCL A;  5IP9 J;  2WGB A;  4MXM A;  5M3F J;  2CQQ A;  4W97 A;  3BQZ A;  2NX4 A;  2CUF A;  2JA5 J;  4D5C A;  1HF0 A;  2G3B A;  1IV6 A;  4IEJ A;  1NTC A;  9ANT A;  2UXI A;  2UXH A;  5GP9 A;  4XK4 A;  5K7Z A;  1ZK8 A;  2JA6 J;  2EZK A;  2XB0 X;  3JRH A;  2R0Q C;  2CRG A;  1A5J A;  3FRQ A;  1GVD A;  1AKH B;  3PO2 J;  2EBI A;  2OF7 A;  3JRG A;  1HLV A;  3C07 A;  1HCR A;  1E3O C;  1FIP A;  2LVS A;  3GBG A;  4GFK A;  4JP0 A;  3EGQ A;  3TED A;  5IP6 A;  1B72 A;  5CXG A;  1FIA A;  3LNQ A;  5EDN A;  2LTP A;  3NI7 A;  1GUU A;  2M2E A;  4D7N A;  1MBK A;  2O7O A;  2XGE A;  1JKR C;  3S1N J;  2I10 A;  5IOZ A;  4I76 A;  3JRB A;  5HAW A;  3B81 A;  3FIS A;  3LOC A;  1NK3 P;  2DA5 A;  2DG7 A;  1UI6 A;  4DZP A;  1JUP A;  3BTJ A;  3VW0 A;  2VI6 A;  4IHW A;  3JRI A;  4Y52 J;  2HOS A;  1JT0 A;  1Q1V A;  1JT6 A;  5IOY A;  2XB5 A;  3HTH A;  2CUE A;  3M4O J;  5E3N A;  2XSD C;  3ZQH A;  2D5V A;  3HTA A;  1CQT A;  4A3D J;  3GEU A;  2DA6 A;  1UG2 A;  2JMW A;  1MSF C;  3Q3S A;  2P81 A;  3HBL A;  5EGO B;  3P9T A;  2NVT J;  2COB A;  1WCM J;  2QF7 A;  1GV5 A;  4AC0 A;  3ZOB A;  3K2A A;  2R92 J;  3JSJ A;  2M9H A;  3S1R J;  4RBO A;  3RZO J;  5FHP A;  1ZTR A;  3FIW A;  4DYQ A;  1I6H J;  1U9O A;  2MG4 A;  3GTO J;  1XS9 A;  5C4Y A;  2F07 A;  5IPA A;  3E7L A;  1UHS A;  2QTQ A;  2NOG A;  4JNN A;  3LHQ A;  2DA3 A;  4XRS G;  2YS9 A;  4JL3 A;  1HDD C;  1UI5 A;  3UKG A;  4GFL A;  2LK2 A;  4I6Z A;  2AHQ A;  3GTM J;  4A93 J;  4BY7 J;  3LSR A;  2L7F P;  3ZQL A;  5EFY A;  4C3J J;  2R93 J;  5FLM J;  1H88 C;  3F0C A;  4L62 A;  2RAE A;  2DA2 A;  3BG3 A;  3O60 A;  2EZL A;  3LSJ A;  2VKE A;  1JUM A;  3L1P A;  5GPC A;  1ORK A;  3G7R A;  2EZH A;  2MW8 A;  3V6G A;  2DMQ A;  1OFC X;  4EEF G;  3RKQ A;  2QOP A;  5F0H A;  1DU6 A;  4M3D A;  1D5Y A;  3ON4 A;  2LR8 A;  1ZGW A;  2ECC A;  1B8I B;  3O8H A;  1R9T J;  3LJL A;  5D18 A;  2H1K A;  4PXI A;  2HQ5 A;  1X2N A;  2VKV A;  4GCT A;  4B3A A;  1ETY A;  1JTX A;  1MBH A;  4JX5 A;  2GBY A;  3FK6 A;  3HIM A;  3RH2 A;  1MH4 A;  5C44 J;  2VUM J;  1ITY A;  1X2M A;  3VVZ A;  2FQ4 A;  3CRJ A;  1HOM A;  2XPU A;  4NDL A;  2PMZ N;  1X58 A;  4CYC A;  2DA7 A;  2H8R A;  1U78 A;  5CXI A;  2YVH A;  3HOZ J;  3IUV A;  2TRT A;  1QPI A;  2YU9 J;  1W0T A;  5EG0 B;  1MBF A;  4A3B J;  3E7Q A;  1A6I A;  5FJ8 J;  5C4J J;  2GLO A;  3HOU J;  2R7Z J;  3A01 B;  4S0H B;  3ZQG A;  2ID3 A;  3GTQ J;  5DAJ A;  1K83 J;  3Q0V A;  1I50 J;  1BA5 A;  3BNI A;  2E2J J;  1WH7 A;  2X9D A;  1H8A C;  1U9N A;  2DG8 A;  3KKC A;  3D1N I;  1VND A;  1MNM C;  1QVT A;  2HYT A;  3MNL A;  3HOW J;  4A3C J;  3JRA A;  3ANG A;  1MBG A;  4A3J J;  5E3L A;  5F27 A;  4BKX A;  2R5Y B;  2CJJ A;  1MBJ A;  1IUF A;  1BW5 A;  4RDU A;  2R5Z B;  1TWF J;  1IGN A;  1FJL A;  3A03 A;  3HDD A;  1HDP A;  3BR6 A;  3QPS A;  2JWT A;  3K7A J;  2DJN A;  3GTK J;  2L7Z A;  1GV2 A;  3HGG A;  5F1J A;  1GT0 C;  3HGY A;  4Y7N J;  2K40 A;  5J3L A;  3PO3 J;  3DPJ A;  1MSE C;  1ZQ3 P;  4IHV A;  1Y1V J;  4DZJ A;  3LSP A;  1G2H A;  3QQA A;  3MKL A;  2N8G A;  2XPV A;  3JRC A;  2ZCX A;  1FTT A;  2W53 A;  5F04 A;  4AC6 A;  1POG A;  1RR7 A;  3OOU A;  2FD5 A;  3BG9 A;  3I4M J;  3BR5 A;  2WV1 A;  4MLO A;  5C3E J;  3BHQ A;  2LKX A;  1P7J A;  1Z0X A;  3BR0 A;  2OER A;  1ETW A;  3JR9 A;  4QSH A;  3TP0 A;  1WGX A;  2G0E A;  5E3O A;  3WHB A;  3BQY A;  5J1U A;  2KT0 A;  3SFI A;  5JLW A;  3S16 J;  2KDZ A;  4JX4 A;  4UUS B;  2FX0 A;  1DU0 A;  4LOC A;  1PUF B;  3VW1 A;  3BR2 A;  2JA8 J;  2EH3 A;  2NP5 A;  2HOA A;  3TW6 A;  1TWA J;  3WHC A;  2GFN A;  1JGG A;  3VPR A;  3CMY A;  3G1O A;  1B72 B;  3S14 J;  3S5R A;  1JUS A;  4C3I J;  4W1U A;  4UDS A;  3BT9 A;  5D1R A;  1OCP A;  3Q0W A;  3VIB A;  1BW6 A;  3A02 A;  1IDY A;  2MSY A;  3HOX J;  1VFC A;  1BJZ A;  3ZQI A;  4GCK A;  2QKO A;  1IC8 A;  1Z77 A;  3BG5 A;  1H89 C;  5H9T A;  2ME6 A;  2IU5 A;  2UXU A;  2D6Y A;  4L5E A;  5J1Y A;  2LY9 A;  5FKO A;  2QIB A;  3NPI A;  3TW7 A;  5K58 A;  3NAR A;  3B6C A;  3MVP A;  4G12 A;  2G7G A;  2ELK A;  3F1B A;  3HTI A;  2CQX A;  1B8I A;  3T6N A;  3HTJ A;  2G7S A;  2TCT A;  2HYJ A;  3PM1 A;  2Y9Z A;  3S15 J;  4A3L J;  1ENH A;  5AQC A;  5BNG A;  3BTL A;  2DMN A;  1LE8 B;  3GTJ J;  3OIO A;  2W48 A;  3Q0U A;  4AYB N;  3QBM A;  4JX6 A;  1YRN B;  2XPW A;  2ECB A;  5FKM A;  1QVU A;  4FE7 A;  4JKZ A;  2ME0 A;  2DA1 A;  2M0C A;  2DA4 A;  1ETX A;  5DS9 A;  2K9S A;  4M3F A;  3TP3 A;  5EG0 A;  3BRU A;  3HE0 A;  2Y30 A;  5JLX A;  3NNR A;  4A3G J;  1WI3 A;  1RPW A;  2WUI A;  3B6A A;  2AO9 A;  5FKK A;  2OI8 A;  2YVE A;  4V2F A;  3A01 A;  1XG1 A;  2GUH A;  5FGL A;  2NVQ J;  3VVX A;  4MO7 A;  2LFB A;  3HB9 A;  4A69 C;  4XIC A;  1ETQ A;  4D7M A;  2E1O A;  2HOT A;  1I3Q J;  2ZB9 A;  2HKU A;  2WAQ N;  3VOK A;  3CDL A;  3JRD A;  3GTG J;  4MFD A;  3H0G J;  5EZH A;  4X1E A;  4AF5 A;  2NP3 A;  2E19 A;  3QKX A;  2OPT A;  3C2B A;  5D19 A;  4ABZ A;  1Y1W J;  3IH2 A;  4BBS J;  2RAS A;  2ZCN A;  3ZQF A;  3HEF A;  5M3M J;  1IDZ A;  1MBE A;  1BL0 A;  1VF9 A;  5FKN A;  3AQS A;  4MIM A;  2QCO A;  4FE4 A;  3COL A;  4XID A;  4M3G A;  4QIW N; 
#chains in the Genus database with same CATH topology
 2OZ6 A;  5FD5 A;  2NRA C;  4A0Z A;  2V6E A;  2JTV A;  4C2M A;  2JUC A;  5LGN A;  2HDW A;  3T8R A;  3L2C A;  2ZY9 A;  1VQL I;  2FMY A;  3PIO F;  2QQB A;  3CTA A;  2PFB A;  1RKW A;  4ZYH A;  5CYV A;  5HOD A;  5HLG A;  2EFO A;  1Z9C A;  4XN3 A;  4A3E J;  5L3D A;  1R71 A;  3DEW A;  3FDY A;  1P7I A;  5HLH A;  4NBQ A;  3QP6 A;  5FD6 A;  3H1C A;  2TDX A;  1JTY A;  1LB2 A;  4WX9 A;  3JRE A;  3BRO A;  1AHD P;  1ULY A;  3F72 A;  2HTS A;  4ASN A;  3VWB A;  3IUO A;  3CWR A;  2KP6 A;  2XVC A;  1Z05 A;  3FXU A;  5LGT A;  4UUS A;  2PZ9 A;  2M4G A;  2YPR A;  2XKP A;  3QYE A;  1W0U A;  1BI2 A;  2QGU A;  3F8C A;  5L3C A;  1PUF A;  2DI3 A;  2R7Q A;  1JHH A;  1RKT A;  3ZN0 A;  1YE9 A;  2EFN A;  3BTC A;  4A5M A;  2CW0 F;  2E34 A;  3OR2 C;  3RCO A;  1QA6 A;  4IZZ A;  4ACI A;  1T95 A;  4XLH A;  1ZRF A;  1QHH D;  1MMD A;  2GZW A;  1RET A;  1JKO C;  1JXS A;  3OYM A;  2PFV A;  5AIQ A;  3GTP J;  2RHA A;  4HRI A;  5J1R A;  2CFX A;  3SXY A;  3QU6 A;  4DNC A;  3HRM A;  1YO5 C;  4ZZD A;  4RGS A;  2PBX A;  3GZI A;  4HX8 A;  3UR3 C;  4P9F A;  2HQR A;  3SEZ A;  2P0W A;  3AG4 H;  3VYR B;  1XCV A;  4KIT B;  4G6T B;  4FTH A;  2DXI A;  1TNT A;  2XAJ A;  3TO9 A;  2D45 A;  4D5F A;  5EEA A;  4RAZ A;  3BCG A;  1XGN A;  3AL0 B;  2LRD A;  3H5R A;  1NH3 A;  3GUD A;  2EIL H;  2H94 A;  1UJ8 A;  3ABT A;  3E5U A;  2V6C A;  2Y69 H;  1JKP C;  2VKD A;  2L0K A;  3CD6 I;  1YRN A;  2JVH A;  3H0D A;  3CUO A;  2HFH A;  2VC1 A;  3M1C A;  4ME9 A;  4YEL A;  2AS5 F;  2RDP A;  2O9L A;  2JA7 J;  1T56 A;  1XPX A;  4EGZ A;  1OCT C;  4CGR A;  4HV6 A;  5L3B A;  2K9Q A;  4E7L A;  1IRZ A;  2FJ1 A;  3BDD A;  1ETV A;  4FIS A;  4ITV A;  3WTU C;  2E35 A;  4EAT A;  5J8F A;  1LDD A;  2B1E A;  1O7F A;  1IN8 A;  3FF5 A;  4XKB A;  5FFZ A;  5LLQ A;  2CSO A;  2V9V A;  4XRF A;  2HEO A;  3S2H J;  4A6D A;  3DPL C;  2WB1 N;  3KNW A;  3H36 A;  3F6V A;  1VQN I;  1QRY A;  2XHK A;  2VQL A;  2EV5 A;  2UWM A;  3O6B B;  3OYL A;  3LAJ A;  5IYC J;  3KP4 A;  4BY1 J;  3F8N A;  4I7H A;  2IVM A;  4CCJ A;  2ZCW A;  2VN2 A;  3VVY A;  1SAX A;  4NHJ A;  2ZCM A;  4CUG A;  1MMG A;  3S2D J;  1VZ0 A;  2WA0 A;  2W1O A;  3ZQC A;  1JJ8 C;  2Y0S N;  2ZXH A;  2KRF A;  2BHZ A;  2Z5U A;  1LFU P;  4PUS A;  5EZG A;  2V1X A;  3QYF A;  4AD9 A;  3GME A;  4A3I J;  3LAP A;  1K61 A;  4OIP F;  2LD5 A;  4AIK A;  1SMY F;  3OOP A;  4YZE A;  1X3Z B;  5ILV A;  1NK2 P;  5DTD A;  4BDY A;  4ZC3 A;  3JRF A;  3VP5 A;  2XGD A;  2JK3 A;  1FX7 A;  1WJF A;  5TIS C;  3VOX A;  1HW1 A;  1FPQ A;  3PFY A;  1T2K A;  1FSE A;  3NWS A;  2JT1 A;  1HKQ A;  4FAS D;  1TQP A;  2GIZ A;  2LP0 A;  2M34 A;  4E7S A;  4GCL A;  3D5L A;  3WU1 B;  2O0Y A;  1QNT A;  4WXH A;  5IP9 J;  4L9J A;  2EFQ A;  5LHI A;  1K7A A;  4BUP A;  1EJ9 A;  4MXM A;  2QSG X;  3JCU C;  2L5Q A;  2BVM A;  4IO9 F;  1IF1 A;  2CQQ A;  2E1M B;  4W97 A;  4UNO A;  3L7W A;  1MMN A;  2NX4 A;  3WTX C;  2JA5 J;  1R22 A;  4S05 A;  2X1E A;  2CV1 A;  3HKZ A;  1IV6 A;  4E6K G;  2JVG A;  2UXI A;  3H3Z A;  2P7V B;  1XMA A;  3BPV A;  4CXF A;  4IOC F;  1T0F A;  1ZK8 A;  2JA6 J;  1PDN C;  5D6F A;  1A5J A;  4IOA F;  2CRG A;  3FRQ A;  1U5T B;  2FXA A;  1B6A A;  1BR2 A;  2ZJP F;  3ROU A;  4CCO A;  3KP7 A;  5K5Q A;  5CXG A;  5BQT A;  1OCR H;  1GUU A;  3SFZ A;  4I09 A;  4L18 B;  1MBK A;  2XGE A;  2VJ4 A;  5D4S A;  1J9I A;  4I76 A;  3JRB A;  4KIC A;  2DG7 A;  5HOO A;  1ZRC A;  4IRG A;  2LYC A;  2IS6 A;  4BQA A;  3K69 A;  4IHS A;  3VW0 A;  5CVI A;  3ZMV A;  1BM9 A;  2XF5 A;  2IGK A;  4U87 A;  2QBY A;  3G71 I;  1XGM A;  1X3W B;  5B5E C;  3BZK A;  3H92 A;  5E20 A;  3OYB A;  3HIF A;  3ZQH A;  4YFX F;  5GAH J;  2R7W A;  1XTA A;  3FXJ A;  5E8I A;  3ZP5 A;  4A3D J;  1UG2 A;  3DPT A;  1K6Y A;  3HZJ A;  2P81 A;  3GLX A;  3HBL A;  3QPT A;  3RPU A;  2NVT J;  2COB A;  2DT7 B;  1MJB A;  5LRS A;  1GV5 A;  5DD4 A;  5EEH A;  3CC4 I;  4ZDL A;  4HPQ A;  3CCL I;  4OAZ A;  1ZTR A;  1DPU A;  4UY8 I;  3FIW A;  4DYQ A;  1G6N A;  2W24 A;  1I6H J;  3GTO J;  1DDN A;  5C4Y A;  2F07 A;  3AFH A;  3K9T A;  4CIC A;  2QTQ A;  3TQN A;  2EV6 A;  2DA3 A;  4C9Y A;  5ERI A;  3LWF A;  2JRT A;  2PJR A;  3FXM A;  4ZZL A;  2EIN H;  3UKG A;  2AHQ A;  4NC7 A;  4C3J J;  3K0L A;  3F0C A;  3PJR A;  4L62 A;  4E7J A;  2L9N A;  2LG4 A;  2VKE A;  2ZNZ A;  1QZZ A;  5D6E A;  1ORK A;  3RDI A;  2EZH A;  3C3W A;  3DTE A;  1WFX A;  1CF7 B;  1OFC X;  2QOP A;  5F0H A;  2LR8 A;  5A2Q K;  1B8I B;  3GLL A;  1OR7 C;  1RR8 C;  2A3S A;  1MD0 A;  1D1C A;  4B48 A;  2IGN A;  3R60 A;  2VKV A;  1G3S A;  1R4M B;  2DCE A;  4B3A A;  2Q2E B;  1JTX A;  4JX5 A;  5HDG A;  4DIQ A;  1MH4 A;  5KK1 A;  1Z6R A;  2FQ4 A;  2Z9O A;  3L2W A;  2DFI A;  3DXJ F;  1TP4 A;  1O3S A;  1RI7 A;  1XX5 A;  2MH2 A;  2K9L A;  4NDL A;  1PYV A;  2QWW A;  1BR4 A;  3CP8 A;  4CSW A;  4XN0 A;  1U78 A;  2YVH A;  3HOZ J;  3R4K A;  3COA C;  5IT9 K;  5EG0 B;  2GIV A;  1YFH A;  4FX0 A;  3E0J B;  1V5F A;  3Q0V A;  1I50 J;  1KYW A;  2FJI 1;  4QLC U;  5BPI A;  1U9N A;  1VND A;  2FA5 A;  3OWT A;  1PP8 F;  2QM3 A;  2VIX A;  3F21 A;  3RKY A;  4XQF A;  1PUE E;  3JRA A;  5DYM A;  2KZG A;  3TOB A;  4BKX A;  4XSZ F;  2R5Y B;  3CC7 I;  3KEO A;  3JSP A;  1IUF A;  4B43 A;  4U88 A;  2R5Z B;  2KDO A;  4HDU A;  2ZSH B;  5DUK A;  3WU0 A;  4OMY A;  1OPC A;  1Y0U A;  3BR6 A;  4Y4R A;  2H1L A;  2JWT A;  3K7A J;  3OYG A;  2CS3 A;  4U7B A;  5DCF A;  3FHN A;  1GV2 A;  1J5Y A;  3LSK A;  1MSE C;  1ZQ3 P;  1R49 A;  2IT0 A;  1Y1V J;  3LL7 A;  4DZJ A;  4IHV A;  3QQA A;  4AWX B;  3MKL A;  2XPV A;  2M0M A;  1FTT A;  3OYA A;  5F04 A;  1E17 A;  2MC3 A;  3FZV A;  3OIQ A;  3OOU A;  3KE2 A;  3BC8 A;  3K10 A;  3UNG C;  3ASN H;  4UV8 A;  3L2V A;  5LEJ A;  2WV1 A;  2P5L C;  1P7J A;  2YX4 A;  5CLS A;  4QPQ A;  2DOD A;  1Q1H A;  3TP0 A;  3NWT A;  1WGX A;  5E3O A;  2ELJ A;  3ML6 A;  3D0S A;  5JLW A;  3S16 J;  2QSF X;  4BQO A;  4JX4 A;  4UUS B;  3P5J A;  4BJT A;  1PUF B;  2Z16 A;  1XD7 A;  2EH3 A;  2HOA A;  3TL4 X;  4CA0 A;  3RTR A;  3G1O A;  2DW4 A;  1JUS A;  4W1U A;  4M6Y A;  2RQP A;  5D1R A;  2L9V A;  3Q0W A;  3HOT A;  1KQ0 A;  2P5V A;  3LMM A;  3U1K A;  4GCK A;  2DYR H;  4UB6 C;  3BG5 A;  2FML A;  2JPB A;  5D4R A;  2HPM A;  4L5E A;  2M7A A;  5J1Y A;  2QIB A;  5K58 A;  2HKX A;  2STW A;  1YW9 A;  1X19 A;  3V8J A;  3WG9 A;  3GZN B;  4XON A;  1R5H A;  2ICW G;  2F5C A;  2O8X A;  3VSK A;  2QKM B;  3HYI A;  3IRR A;  3T6N A;  3J80 Z;  3V4G A;  2RRE A;  3KZZ A;  2PMZ A;  2QEX I;  2M5W A;  3LSM A;  2Z33 A;  5BNG A;  3OIP A;  4A6E A;  2HYG D;  3GTJ J;  2ZME A;  4F3Q A;  1W5S A;  2ZXI A;  4AM3 A;  4RGR A;  1YRN B;  2CQN A;  4KYW A;  1OYW A;  2F5V A;  1JHF A;  2ME0 A;  1ETX A;  5LEK A;  2UV1 A;  3TP3 A;  2LY2 A;  4BGD A;  3PUF A;  1K78 A;  1OKR A;  3TO7 A;  3BWG A;  1IN7 A;  3DTK A;  1XDU A;  5FLX Z;  1FMW A;  2ESH A;  3VB2 A;  2LFB A;  2JUG A;  2E1O A;  1VTN C;  1KON A;  4YG2 F;  1K6O A;  2LOO A;  1ZRD A;  3VOK A;  2XAF A;  2QVO A;  4D0P A;  3WTV C;  4AF5 A;  4OD4 A;  1HQC A;  3BPX A;  3QKX A;  3L2Q A;  1O3R A;  2K02 A;  3F8M A;  4HF0 A;  5K5R A;  2XV4 S;  4Y17 A;  1MBE A;  1IXR C;  1VF9 A;  5FKN A;  3WE2 A;  4L0Z B;  4IRV A;  3COL A;  2HR3 A;  2F4O B;  1W4M A;  4LB5 A;  1YTY A;  3OSG A;  1SVM A;  3RQI A;  2MYS A;  5FGM A;  3OYF A;  3FMS A;  3GVA A;  3M3Y J;  4YRV A;  1T33 A;  3G2B A;  2GXB A;  2QWT A;  2BY0 A;  2P4W A;  5IYD J;  2DMP A;  3V7S A;  1FP1 D;  3LFU A;  4GRI A;  4FX4 A;  2B3W A;  4L5J A;  3HOY J;  3VUQ A;  3K2Z A;  5J8C A;  5F0F A;  4IF4 A;  5CVR A;  1S7E A;  3IH4 A;  4G94 A;  1BOA A;  1AU7 A;  1WPK A;  4FHT A;  2MLK A;  3CP2 A;  3U9G A;  1FEX A;  5F0C A;  4IX7 A;  3L9F A;  3L00 A;  3CCY A;  4FQG A;  2W84 A;  1IJW C;  3QOP A;  1N78 A;  4RM3 A;  1TW2 A;  4LG3 A;  4BXU A;  4WWC A;  4HKU A;  5D5V B;  5F6F A;  3IL2 A;  3OSF A;  1XMK A;  1SMT A;  2B0L A;  3OYJ A;  3U2R A;  2XF6 A;  4DYC A;  4EGY A;  5FRM A;  1VI0 A;  2X1C A;  4AUX A;  1I5Z A;  3FHZ A;  2V57 A;  2DTR A;  2HS5 A;  2V79 A;  4GXO A;  5HLI A;  2R3S A;  1F43 A;  2MGQ A;  3MZY A;  2QLZ A;  2R7F A;  3MQ0 A;  1X1A A;  2HXO A;  2MLG A;  2CV0 A;  1ETO A;  2HPI A;  2W57 A;  2O8K A;  1T8I A;  3RJP A;  3R0A A;  1LFB A;  5CW8 A;  3PQJ A;  2FBK A;  3CCE I;  2ZOZ A;  3S3O A;  5CVJ A;  3B73 A;  4E70 A;  5E18 F;  4HNU A;  4MQ9 F;  1R00 A;  3K4K A;  4L0Y B;  3HTS B;  2NS7 A;  1TC3 C;  5E3M A;  4PCQ A;  1JKQ C;  3BY6 A;  1S6L A;  2XRO A;  3IP4 B;  4AYB A;  1X1D A;  3RYP A;  4M72 A;  1SAN A;  4MHG A;  2FOK A;  3EUK L;  3ERE D;  5EJC A;  5KHD A;  1FSH A;  2QBY B;  2I8D A;  1CF7 A;  4C2M J;  5M5Y J;  1YS6 A;  1WRJ A;  4GYI A;  1SFK A;  3HRU A;  1ZN2 A;  1UFM A;  3K4B A;  4JOM A;  2R7V A;  3RD3 A;  2X0L A;  3LSG A;  2DQR A;  4X6A J;  2G9W A;  3ZMZ A;  4YIF A;  1EH8 A;  1J59 A;  2HI3 A;  2G7H A;  3LQR A;  4P55 A;  1MW7 A;  3DCF A;  2F4I A;  3J7A O;  4AID A;  1KQ8 A;  3HHH A;  1FBS A;  3QPL A;  2Q2E A;  3SEQ A;  1ZR2 A;  3F22 A;  4R1H A;  2EZI A;  4HLY A;  3X2Q H;  3PNT A;  1QZY A;  3BG6 A;  4FET A;  3GYH X;  2VE9 A;  4A3K J;  3P7N A;  3OYN A;  1FC3 A;  3MKZ A;  2L54 A;  2V1U A;  2DMT A;  1MDM B;  2IAI A;  3SZP A;  2VLA A;  3H9J A;  1EV7 A;  4NEL A;  3GFM A;  3H3U A;  3PSI A;  3BJO A;  4WIB A;  4NN1 A;  3G1L A;  5FKL A;  2IEK A;  3LWJ A;  4Z2Y A;  1SFO J;  2VXD A;  3BR3 A;  1UMQ A;  4ESF A;  1Y6I A;  1WJB A;  4HEA 2;  3W6K B;  1IXS B;  3CO7 C;  3ON2 A;  2CG4 A;  2M8G X;  4BHC A;  5HS8 A;  2W4S A;  3AG1 H;  3S2W A;  3TKY A;  2Q8K A;  4IHY A;  1U6G A;  1LDJ A;  3EUH A;  4JK1 X;  2PI0 A;  1VQO I;  2FBH A;  1O4X A;  1ZGJ A;  2BVL A;  3K1M A;  4JQF A;  4MNU A;  5E17 F;  3E6D A;  2NVY J;  2VXZ A;  3MFK A;  2R5Y A;  2OCE A;  2Q0O A;  2L02 A;  2HNH A;  2EK5 A;  1WH5 A;  2OQR A;  1ZLJ A;  4I0A A;  3VFZ A;  5FB2 A;  3IRQ A;  3MKY B;  3ISP A;  1D0Y A;  2R5Z A;  5FRN A;  3ERM A;  5IT3 A;  5DUI A;  2DN0 A;  2K3P A;  2DPD A;  1MMS A;  1OMI A;  1OYY A;  1KZH A;  1OJL A;  4A3F J;  3CCU I;  4DQ2 A;  3I55 I;  1FBU A;  1R4N B;  4HST A;  2VBZ A;  2DO7 A;  2O5R A;  2B63 J;  2ZFW A;  1OCC H;  4DBR A;  2O03 A;  3O2P E;  2RV8 A;  4IRI A;  2H6B A;  3S17 J;  3FKI J;  2O7T A;  2PBI A;  1UHM A;  3F6O A;  3LA3 A;  5F1R A;  3LFK A;  2WGB A;  1WJC A;  1FOW A;  2VOP A;  4G6D A;  1D8J A;  5BS6 A;  4XL9 A;  2CUF A;  3WG7 H;  1HF0 A;  2PEX A;  2G3B A;  2GXA A;  3REO A;  2CUJ A;  1LEB A;  3KPH A;  2HZT A;  2CYY A;  3EET A;  1KA8 A;  2KRH A;  3MWM A;  2VL8 A;  9ANT A;  3RPU D;  4DGW B;  2D1H A;  1W1W E;  2R7O A;  4XKV A;  3M8F A;  2FEZ A;  1BJA A;  4CDG A;  1Z7U A;  2EA4 A;  2EZK A;  1MJA A;  3OYI A;  2OTJ I;  2M87 A;  2E71 A;  1KU9 A;  2EBI A;  3DQV C;  3DV8 A;  1IW7 F;  1F9N A;  3C07 A;  3QOE A;  3VOD A;  3HL2 A;  3BCA A;  2E1M C;  2WC2 A;  4GFK A;  3TED A;  1FIA A;  4U9N A;  5EDN A;  3NI7 A;  1IO2 A;  3ZPL A;  3GFI A;  1YJN I;  2PQ8 A;  2W25 A;  1JKR C;  1Y8R B;  3M7G A;  3G4S I;  3B81 A;  1XN7 A;  3LST A;  3SHF A;  3FIS A;  5FFX A;  4HV5 A;  2V7F A;  3BTJ A;  4EM0 B;  3OS0 A;  2VI6 A;  1U5T C;  1JT0 A;  2HQN A;  3I54 A;  2CFO A;  4XLE A;  1JT6 A;  2KL4 A;  4HG2 A;  3WTS C;  4UV9 A;  1LJ9 A;  2XAS A;  2CUE A;  1SD7 A;  5E3N A;  1VQK I;  3FKJ A;  4G7H F;  3V42 A;  2M4K A;  4U0V A;  1BIB A;  3DKX A;  4Q47 A;  3W2W A;  1CQT A;  2C6Y A;  5CQE A;  2VBY A;  2HVR A;  2K4B A;  2WAE A;  1DGW Y;  3M1E A;  2HZD A;  1K4T A;  5EGO B;  1P4X A;  1MIJ A;  3P9T A;  1WCM J;  3IC7 A;  2VON A;  4MTE A;  3T5X A;  4AC0 A;  4NC8 A;  3HG9 A;  2R92 J;  2M9H A;  3S1R J;  5D8L B;  4RBO A;  5FHP A;  1HA8 A;  3DLL F;  1UAA A;  2EFW A;  2HDC A;  1UHS A;  4JNN A;  1J2X A;  4EMS A;  2MC4 A;  1FOK A;  3LHQ A;  4RB1 A;  4XRS G;  4JL3 A;  3TOA A;  2H6C A;  4XLC A;  1UI5 A;  2XUB A;  4GFL A;  3DTI A;  1ZLK A;  3GTM J;  3A0H C;  1T98 A;  4N9I A;  3F3X A;  4F92 B;  2JRM A;  4PSW A;  1N75 A;  2L7F P;  3W6J B;  4X0G A;  1FT9 A;  2MFZ A;  2O61 A;  4A0X A;  2DA2 A;  3BG3 A;  3O60 A;  2DK5 A;  3VYU B;  1S3J A;  2FBI A;  5GPC A;  4CHU A;  3J81 K;  2DMQ A;  3R61 A;  1DU6 A;  2KMU A;  4RMN A;  1R1U A;  3O8H A;  4XOT A;  1R9T J;  5D18 A;  5F64 A;  1D3Y A;  5GTH C;  3CJQ B;  1G8X A;  2EIJ H;  2HQ5 A;  1X2N A;  3MKW B;  3GX4 X;  1RNL A;  3KLN A;  5CVV A;  1MBH A;  2AQF A;  2GBY A;  3SYT A;  1QU3 A;  3HIM A;  2ZME B;  2ZSI B;  1REP C;  1P2F A;  1AWC A;  1HOM A;  2X51 A;  4LIT A;  2EIK H;  3DF8 A;  4LFU A;  1A6Q A;  1X58 A;  1FZP B;  1JGS A;  4N4N B;  2J5O A;  4LLN A;  3E7Q A;  1MBF A;  1J75 A;  1TT5 B;  4A3B J;  4QWQ A;  1K78 B;  1A6I A;  2VOD A;  3HOU J;  5C4J J;  2LDU A;  3E6C C;  1BN5 A;  3GTQ J;  5L3G A;  5DAJ A;  3IWZ A;  4KMU X;  3G6E I;  1BA5 A;  1T38 A;  1F1Z A;  2BXZ A;  3PSF A;  3HJE A;  4EJU A;  5LD2 C;  1H8A C;  3T0Y A;  1GVJ A;  2DFF A;  2OV7 A;  2VT2 A;  4KIG A;  1NHA A;  2P6T A;  4D9J A;  1YIO A;  5H20 A;  2ZJQ F;  3WGG A;  4HDV A;  4E7Z A;  1ERD A;  2EFP A;  4II3 A;  4ENK A;  2K3F A;  2W85 A;  2ISZ A;  3F8B A;  3FM5 A;  3GWZ A;  2VB6 A;  4RDU A;  2RVC A;  4KIB A;  1E0E A;  5D5W B;  5GAD J;  3QPS A;  1GXQ A;  3BG7 A;  3GTK J;  4PJL A;  2YSR A;  1GT0 C;  3K8P C;  2OCC H;  3CF5 F;  4C2T A;  3PO3 J;  3ZGK A;  4PFP A;  3LSP A;  3KZY A;  3LSH A;  2KIQ A;  2W53 A;  4AC6 A;  1RR7 A;  2LNB A;  1V55 H;  1ZEL A;  1HXD A;  3CCV I;  3W2V A;  2JA2 A;  4MLO A;  1K79 A;  2LRE A;  3BHQ A;  4PJN A;  4F93 B;  3BR0 A;  2OER A;  1ETW A;  4QSH A;  1YIT I;  3QPH A;  1SD5 A;  3WHB A;  1FYK A;  3BQY A;  2FE3 A;  2M30 A;  2JPC A;  1F5T A;  1W7P A;  5DCM A;  3O3K A;  1O3T A;  1DU0 A;  3P9I A;  2Z3Y A;  2Z1D A;  4LOC A;  3WE3 A;  5TGT A;  4G9Y A;  2JA8 J;  1HBX G;  1ZRE A;  1USS A;  1TWA J;  3WHC A;  1B72 B;  2HVS A;  4C3I J;  4C30 A;  3HPH A;  3RIR A;  1OCP A;  1RIO H;  1MDM A;  3VIB A;  1IDY A;  2MSY A;  2X6X A;  3ZQI A;  2QKO A;  2AXT C;  3M07 A;  4LIU A;  4OMZ A;  5B66 C;  2FU4 A;  1UG0 A;  4Y15 A;  3NAR A;  3CMM A;  1VQ4 I;  2R7R A;  3FXO A;  3KP6 A;  2G7G A;  4PGH A;  3GZ6 A;  2P5K A;  1V5E A;  1Z67 A;  4LMY A;  1WWX A;  1TLH B;  2BY2 A;  3C2G A;  2IGO A;  3BZ6 A;  4M71 A;  3W3C A;  2A05 A;  1W36 D;  2ZXW H;  4HX7 A;  5JI6 A;  2TCT A;  5HNF A;  5K1Y A;  1J09 A;  1YX3 A;  1SD4 A;  3PM1 A;  3IAS 2;  3S15 J;  4KUM A;  1IXC A;  2YR2 A;  3BTL A;  4AIJ A;  1FP2 A;  3RKW A;  3C2H A;  2DMN A;  4EQQ A;  1RZ4 A;  2IP2 A;  2BZT A;  2DFH A;  2VBW A;  2XPW A;  2ECB A;  3SQN A;  5FKM A;  1QVU A;  5ICF A;  2EB7 A;  4ZJZ A;  4JKZ A;  4CCK A;  4F52 A;  4KIF A;  3KP5 A;  4PJM A;  2K9S A;  1FOY A;  5J40 A;  4A2U A;  1LPQ A;  1PJR A;  2ESN A;  3BRU A;  3HE0 A;  5JLX A;  2KIS A;  3I9V 2;  3NNR A;  1X4P A;  4A3G J;  2WUI A;  3B6A A;  2ZO4 A;  3H5N A;  4V2F A;  1IN4 A;  3FM3 A;  2GUH A;  4BEH A;  2CW7 A;  2V9P A;  3F8F A;  4P9U A;  3HB9 A;  1PP7 U;  4UXN A;  2LH9 A;  3SZT A;  4BE0 A;  4RA2 A;  5H6Q A;  1SFX A;  1VQ5 I;  2HOT A;  1I6X A;  1TW3 A;  5DDG A;  3A4C A;  1QQI A;  3ABU A;  3GTG J;  4MFD A;  5EZH A;  4UUV A;  4HF1 A;  2OAZ A;  3QYB A;  2NP3 A;  3M8E A;  2COM A;  2OPT A;  3C2B A;  4OU0 A;  2KKO A;  2FOW A;  4BBS J;  4EM2 A;  5L3F A;  3I3L A;  1Y0N A;  2OJE D;  3GZ5 A;  4XLA A;  4XID A;  2X6W A;  2EV0 A;  5LHG A;  4GFB A;  1XSV A;  5EEG A;  3DBH B;  3I56 I;  4LG0 A;  3AAF A;  1QGP A;  3G1M A;  3IV5 A;  1TQM A;  3GEZ A;  2K9N A;  2A69 F;  3NAU A;  4XRM A;  2IS1 A;  1JJ6 C;  1KGS A;  2DU9 A;  3FBN B;  3FK7 A;  1TWH J;  3RZD J;  4L5I A;  3GTL J;  1H0M A;  3VW2 A;  4BH9 A;  3OYH A;  2B7E A;  3KZI C;  2HXI A;  2Y9Y A;  3KX2 A;  4RB0 A;  4YFK F;  4E7K A;  2CGP A;  2STT A;  4LK0 F;  5FMP A;  3S1Q J;  2OZU A;  1KYZ A;  2CQK A;  1SVL A;  2JJ7 A;  1G4D A;  3KEQ A;  5ICG A;  4BAY A;  1X3U A;  2DMU A;  3DPU A;  1MJ9 A;  1ZKG A;  1R7J A;  4ZYE A;  4A5N A;  3BLY A;  3QRF F;  3WTY C;  2M3A A;  1A04 A;  5EGO A;  1Y56 A;  1KU2 A;  4DYR A;  4G7O F;  3CJT B;  1GDT A;  4YII A;  1E3P A;  1ZG3 A;  4A12 A;  4MGR A;  3ANP A;  1ZR4 A;  2A5Y B;  5GAE J;  2HDD A;  3HKZ N;  2ID6 A;  1M1E B;  1MNE A;  3E1S A;  4GCV A;  1SGM A;  4M6V A;  1XCB A;  3R6S A;  4RM2 A;  4ESB A;  5B3S H;  3JSO A;  4KT5 C;  1BI3 A;  2QSH X;  1ODD A;  4HNT A;  2XAU A;  4WXD A;  4OIO F;  2H09 A;  4M3B A;  3NXC A;  1T0F C;  1TBX A;  1N25 A;  1D1A A;  1IV8 A;  1ZH5 A;  1TL8 A;  2HU9 A;  3Q5F A;  2K5C A;  4PDK A;  2RQQ A;  1IRG A;  3FXL A;  3VOE A;  1Z21 A;  3ZCO A;  1V54 H;  3DFG A;  2I5U A;  3JAM Z;  3OY9 A;  1XGS A;  4Y3O A;  5E1W A;  3OS2 A;  4IHX A;  1LE8 A;  2CV2 A;  4A3M J;  3BTI A;  3A0B C;  1EF4 A;  1QO0 D;  3AQT A;  2BW3 A;  2VPR A;  1APL C;  4CZC A;  5IY5 H;  2ELH A;  2OD5 A;  4AVP A;  4JYK A;  2DT5 A;  2XRL A;  5FRO A;  3MN2 A;  2G7U A;  3NS4 A;  4ZYG A;  1YI2 I;  4DW6 A;  1ONV A;  3L2R A;  4ESJ A;  4ZYD A;  1BI0 A;  2WAQ A;  4P5O A;  2BE5 F;  1YS7 A;  3CCQ I;  4BQN A;  1MH3 A;  1VQP I;  4F91 B;  4J19 A;  3PPB A;  5JHF A;  4IQ4 A;  3IH3 A;  4MEX F;  1WJD A;  3TDU C;  3BJB A;  1WQ2 A;  4IHT A;  2BY3 A;  2FUG 2;  3FXK A;  4P1W A;  2ZXJ A;  5HSZ A;  4BXF A;  4F55 A;  1FYL A;  2R4G A;  2F5D A;  3SDG A;  2R7X A;  3EYY A;  1V5G A;  1ZAO A;  2UXN A;  5DEQ A;  5HS9 A;  4OWR B;  2JN6 A;  3BR1 A;  2Y48 A;  1SEU A;  1F4K A;  5F08 A;  4UB8 C;  3CJD A;  3QP5 A;  3ELK A;  2VC0 A;  3I71 A;  2FF4 A;  1R6R A;  1KU3 A;  3CQZ J;  3M9A A;  1FMV A;  4QTR A;  1RES A;  5EF6 A;  3W6V A;  3G56 A;  4YIR X;  4LJZ F;  2WWY A;  1S5L C;  3EUP A;  3DBR B;  4PK4 A;  4DBQ A;  4V2G A;  1STZ A;  2DYS H;  4HQM A;  2A6E F;  3A1Y A;  4E7I A;  3KKD A;  2DFE A;  2KJC A;  1W5C C;  2UUZ A;  1BR1 A;  3CLO A;  3CUQ C;  3HOV J;  2W00 A;  3VDX A;  2GM4 A;  1R23 A;  4AIH A;  5LHH A;  1GHC A;  5A2Q Z;  4ZTJ A;  4F7Z A;  2M8E A;  4EJO A;  5E1X A;  3RI4 A;  5M3F J;  1D0Z A;  2BHY A;  1SAU A;  3BQZ A;  3SDB A;  1SC7 A;  2FRH A;  1GLN A;  2EJR A;  1I3A A;  2KQR A;  1BI1 A;  2CWE A;  4D5C A;  4N4O B;  3KFW X;  2QA4 I;  3OL3 A;  4ENM A;  4BJ6 C;  2QUF A;  1NTC A;  3U21 A;  2UXH A;  2L3D A;  1OCO H;  2O6G E;  2NYX A;  4XK4 A;  2WBM A;  1D5V A;  2ETH A;  2HOE A;  2R0Q C;  3BOQ A;  4Y33 A;  3FBI B;  4O6J A;  2JQ7 A;  1AKH B;  3PO2 J;  4RGX A;  1RRJ A;  3JRG A;  5IT9 Z;  1E3O C;  1FIP A;  4IXA A;  4BU2 A;  2F5E A;  3GBG A;  3EGQ A;  5IP6 A;  1B72 A;  2LTP A;  4Q4Z F;  2M2E A;  1FY7 A;  2JSP A;  2O7O A;  2PMH A;  3OL4 A;  3P9K A;  3S1N J;  2I10 A;  3RKX A;  2QYO A;  2VOO A;  1Z3X A;  3HRS A;  5HLT A;  2VJ5 A;  5LRR A;  2H27 A;  1UI6 A;  1JUP A;  4Y52 J;  3JRI A;  1YW7 A;  3OYD A;  3B02 A;  3BJA A;  4XKW A;  3F23 A;  1ON2 A;  1YG2 A;  1Q1V A;  4PJ0 C;  4AU7 A;  1D8K A;  2XF7 A;  4EJW A;  1S72 I;  4B8X A;  2XB5 A;  4BAC A;  2LSO A;  2XSD C;  2WY7 Q;  3HSR A;  2DA6 A;  5CQG A;  1XB4 A;  3S3M A;  3VTI A;  2EA2 A;  4LLL A;  2WAD A;  5J47 A;  2X4H A;  3OYK A;  3S32 A;  1Z3Y A;  3MAJ A;  2OA4 A;  4KIS A;  3K2A A;  1IUY A;  1W7P B;  3GFL A;  5DCM B;  2PJP A;  5CVU A;  2NAZ A;  1U9O A;  5AON A;  2WB1 A;  4KDP A;  3T1B A;  4KMF A;  1I1S A;  2DDA A;  2NOG A;  2M45 A;  2OU2 A;  2YS9 A;  3C1D A;  5E8G A;  3SWH A;  2DK8 A;  3WGH A;  3BJ6 A;  1B1B A;  4UVB A;  5J4Y A;  3AL0 C;  4I6Z A;  2IPQ X;  4IPA A;  4BY7 J;  2Y0S A;  3LSR A;  5EFY A;  2R93 J;  1WI9 A;  5BOX A;  1I27 A;  2EZL A;  1DUX C;  5B1B H;  1JUM A;  4Q48 A;  4BJ5 C;  3L1P A;  2QZ8 A;  2AXL A;  2NNY A;  2QEN A;  1HKS A;  3G7R A;  5D5X B;  4U0W A;  3I4P A;  2MW8 A;  3V6G A;  3W2A A;  4S04 A;  4GYG A;  5HNH A;  1D5Y A;  3ON4 A;  4ZTF A;  2ECC A;  1G3W A;  1ZGW A;  4HA8 A;  1ZG1 A;  2IS2 A;  1BC8 C;  3LJL A;  2A68 F;  2H1K A;  4PXI A;  1X1C A;  2W82 A;  5D5U B;  1QZE A;  4HW0 A;  2L7K A;  1YX5 A;  4GCT A;  1VQ7 I;  1ETY A;  2RGV A;  5KAF C;  3FK6 A;  5C44 J;  1X2M A;  2IA2 A;  4G6Q A;  1X1B A;  3CRJ A;  4XBF A;  1G3T A;  3ZMS A;  2PMZ N;  2P8T A;  2DOE A;  2DA7 A;  4KJZ A;  4M9Z A;  3J7Z I;  3L09 A;  2VQC A;  1X4O A;  1HST A;  2P7C B;  1O57 A;  5H6R A;  2R7Z J;  4BDZ A;  1YW8 A;  4BHP A;  5HDN A;  3ZQG A;  4BEH B;  2PMU A;  2LY1 A;  4RGU A;  3WU2 C;  2Q1Z B;  2F48 A;  3BNI A;  1ZAR A;  2FSW A;  3H9G A;  4MEY F;  1QVT A;  3QWL A;  1OCZ H;  4N0B A;  4A3C J;  3ZN1 A;  3CCM I;  1W7P D;  3CCR I;  2IXS A;  3ANG A;  4A3J J;  3FMR A;  5E3L A;  5F27 A;  3I5U A;  5JHU A;  1KQ9 A;  2NOJ B;  3DEU A;  4L9T A;  1D1B A;  5ICE A;  3ULQ B;  1MBJ A;  3KYC B;  4LD5 A;  1BW5 A;  4CYD A;  1IGN A;  3A03 A;  3GO5 A;  1HDP A;  2GOM A;  3EUA A;  1O7L A;  3GF2 A;  1XGO A;  5TRD A;  3ASO H;  2GAU A;  2GWR A;  4LG0 B;  3U1D A;  2L7Z A;  1O3Q A;  2DAO A;  3KCC A;  3OMY A;  4M73 A;  1Z6T A;  5F1J A;  4Y7N J;  2K40 A;  5J3L A;  1W36 C;  5TJJ A;  3DP7 A;  1DGR M;  2E36 A;  3OYE A;  1L0O C;  2NXN B;  3JRC A;  2N8G A;  1MZB A;  4TV7 A;  4C2U A;  1UST A;  1B59 A;  1POG A;  5CPR B;  2WV0 A;  2FD5 A;  3I4M J;  1HW5 A;  4ETS A;  2LKX A;  2YU3 A;  2CO5 A;  4CO8 A;  2G0E A;  2L01 A;  3S3N A;  1BOB A;  1T08 B;  5CKT A;  5J1U A;  4RB2 C;  1SFU A;  2BBY A;  4I99 C;  2KT0 A;  4EJV A;  1TZL A;  5DM6 F;  2KDZ A;  4KNY A;  6PAX A;  5HDK A;  3VW1 A;  3E97 A;  3PQK A;  2NP5 A;  1ZYR F;  5GTI C;  3FWE A;  2F6C A;  2GFN A;  1JGG A;  2Z99 A;  3D5R C;  2KJB A;  2XAH A;  4UDS A;  1IRF A;  3BT9 A;  2LC2 A;  1OR7 A;  3E6B A;  4I02 A;  1QPM A;  4Z6Y A;  3PIP F;  3HUG B;  1VFC A;  3HOX J;  1HW2 A;  2GA2 A;  4LB6 B;  4XLP F;  1AA7 A;  1BJZ A;  2PN6 A;  1IC8 A;  1Z77 A;  1LQ1 A;  1H89 C;  3JTG A;  4WF2 A;  1N77 A;  3AG3 H;  2D6Y A;  1IN6 A;  2UXU A;  4B3X A;  3NPI A;  2ZJR F;  2EIM H;  5JR3 A;  2YX7 A;  5BPD A;  3B6C A;  4PFO A;  2E60 A;  3IWF A;  4G12 A;  4IVN A;  3F1B A;  3J7Y J;  4RLF A;  2VKH A;  3HTI A;  2CQX A;  4I0B A;  3HTJ A;  2G7S A;  2IA0 A;  3HTU A;  2Y9Z A;  1W5T A;  3CZ6 A;  2RNG A;  1A35 A;  1T6S A;  3L2U A;  3I58 A;  1A31 A;  1YLF A;  4IRH A;  1LE8 B;  2VT3 A;  2D2W A;  3GXO A;  2W48 A;  2E5Z A;  4ZH4 F;  4AYB N;  4HOB A;  4WK8 F;  2BW3 B;  1FOX A;  2E1N A;  1DPR A;  1PVE A;  3CLQ A;  4M9S A;  5H2F C;  3WOD F;  4I2O A;  2DA4 A;  5DS9 A;  4M3F A;  2W7N A;  3KEY A;  2LBF B;  1UEL B;  3RSN A;  3I64 A;  2E1C A;  1FWZ A;  1LKX A;  1WI3 A;  1RPW A;  1NG7 A;  3K1P A;  4HBL A;  2AO9 A;  4II2 A;  2P6S A;  2OI8 A;  2YVE A;  3A01 A;  2HYF A;  1ON1 A;  1R5I D;  3RQ4 A;  2NNN A;  2GOX B;  4NC6 A;  3ZQQ A;  4MO7 A;  4XIC A;  1TQI A;  4D7M A;  3H35 A;  4OIR F;  4OD5 A;  5HS7 A;  3CMA I;  2DJI A;  4U0Y A;  3NRV A;  2JSC A;  3HSF A;  1Z91 A;  1HSJ A;  3CDL A;  3KLO A;  2Y0M A;  5ED4 A;  3I59 A;  4NQW A;  3CO6 C;  4CGZ A;  5D19 A;  3LSI A;  1ZHF A;  3IH2 A;  1S7O A;  2RAS A;  2UXX A;  3ZQF A;  5JFR A;  3AKZ A;  5M3M J;  1IDZ A;  1TT0 A;  2L2O A;  3AQS A;  2VQH A;  2XRN A;  3K4C A;  4MIM A;  5FO5 A;  4M3G A;  3OYC A;  3V78 A;  1TWG J;  2H8W A;  4XLF A;  1AKH A;  4B09 A;  2IJL A;  4OIN F;  4HAM A;  2V1D A;  3HM5 A;  3M8J A;  4IJA A;  5EYR A;  1YOV B;  2V1N A;  3K6G A;  1VQ9 I;  4ICH A;  3CJN A;  2M7B A;  4CYC B;  1H9T A;  1U8B A;  3ZXS A;  1MKM A;  3DKY A;  2NVX J;  2DOF A;  1MND A;  3KET A;  3RYR A;  5M5W J;  5M5X J;  3S1M J;  4HNV A;  1UB9 A;  2NS8 A;  3CCS I;  4IQJ A;  4C3H J;  1B9M A;  1Z7L A;  3EUH C;  1MGT A;  5HBU A;  3V8K A;  3DEE A;  3I4N J;  1XC5 A;  5IP7 J;  2CW8 A;  3CDI A;  4UUT A;  3EYI A;  5L3E A;  4GDF A;  1ACI A;  2Y2Z A;  1HC8 A;  4IKF A;  5K7F A;  3K70 D;  2KFD A;  4NB5 A;  2UXO A;  1HKT A;  3KZ9 A;  4PGG A;  2X6Y A;  3H3V K;  2EPF A;  3JAM K;  4ENJ A;  2VPL A;  4XOP A;  2IRF G;  2E2I J;  5GPA A;  2X6O A;  2VQG A;  2X85 A;  3V7C A;  1UCR A;  3J80 K;  2HKO A;  2LKP A;  1K4S A;  4EV0 A;  1ETK A;  1VQM I;  1KU7 A;  3ZRG A;  3OS1 A;  1RUN A;  1WJ5 A;  1WJA A;  2G7L A;  4UVA A;  1J7K A;  4XRS A;  3GCM A;  1P4W A;  4KT6 A;  4MFE A;  5CJ9 A;  4KWA A;  1S8N A;  1TNS A;  2YUS A;  3DKW A;  3T8T A;  2BXY A;  2HWV A;  2OBP A;  4B1R A;  4XM3 A;  5B1A H;  3FX3 A;  3NRG A;  3CDH A;  3HOS A;  1RUO A;  2Q24 A;  4BE2 A;  1XMX A;  3VYS B;  4Y13 A;  4R79 A;  3I0T A;  1YYV A;  3VEP A;  3ONQ A;  4H0E A;  3TGN A;  5K5O A;  4MK6 A;  4AVZ A;  2L9R A;  2ZOY A;  2BYV E;  2L7M P;  2D1V A;  4OAY A;  1LVA A;  5FLX K;  4EM1 A;  3EQL F;  3N05 A;  5FLV A;  3QU3 A;  5DV5 A;  4G7Z F;  2X48 A;  1IRX A;  1YJW I;  2GEN A;  2NVU B;  3PAS A;  3WTZ A;  2A5W A;  2KIU A;  2AQE A;  4M74 A;  2L9S A;  2KLO A;  1UZC A;  2XGX A;  2OUM A;  3C7J A;  4NNJ A;  5JVG F;  1F36 A;  1AOY A;  4LK1 F;  2EWN A;  2R7T A;  3IKT A;  4M3E A;  5JVT A;  5LFA A;  2LLK A;  2XGC A;  3V8L A;  1MMA A;  4DVY P;  1TWC J;  2A6H F;  1DP7 P;  1UHW A;  1SFE A;  4B4C A;  1YJ9 I;  1FYM A;  1VQ6 I;  4BBR J;  3ABM H;  1B4A A;  1EKE A;  2FQ3 A;  3D5S C;  2GQQ A;  4BYY A;  2DT6 A;  1CGP A;  2IBD A;  2KPM A;  1ZG5 A;  1G3Y A;  1WJE A;  4EVI A;  3CUQ A;  5KNL A;  3WTW C;  4KFC A;  2LKS A;  4FCY A;  2UXP A;  3CME I;  3CCJ I;  2Y75 A;  4LIV A;  4CCM A;  2XDV A;  4G8X A;  3ZQ7 A;  3DU5 A;  1FTZ A;  4B44 A;  1LNW A;  2PX9 A;  3RPQ A;  2EQR A;  3HXL A;  4FT8 A;  4PZJ A;  2ISY A;  3WGI A;  2XDN A;  3AG2 H;  5C4X J;  2ZFU A;  2LMD A;  3O8G A;  3H5A A;  2DQL A;  2Y31 A;  3SJM A;  4BXX J;  2RNJ A;  3GFJ A;  4N9H A;  1OIS A;  2CU7 A;  2HVQ A;  2NS0 A;  2OQG A;  2REK A;  5IYB J;  4Q5S F;  4L9V A;  2BGC A;  2DTZ A;  4EJT A;  2Z2S B;  2A07 F;  1BIA A;  3ZR8 X;  3J81 Z;  2FBQ A;  3V7R A;  1IG7 A;  3MEX A;  5K7H A;  4LGW A;  2E7X A;  1I39 A;  2E2H J;  4PSX A;  5KCM A;  3I53 A;  3EDP A;  2ADU A;  2RKH A;  1V3F A;  2BOL A;  2GA1 A;  3NQO A;  1NG6 A;  4HYE A;  5BMZ A;  2XAG A;  3CJR B;  4WCG A;  3KIO A;  1LEA A;  2MAB A;  3NEU A;  4IEJ A;  3VYT B;  5GP9 A;  5KAI C;  2B9S A;  5K7Z A;  1OYI A;  3G3Z A;  2XB0 X;  4O5V A;  3JRH A;  2K86 A;  1GVD A;  2JZY A;  1I1G A;  1G59 A;  3FXQ A;  2IA1 A;  3ABK H;  2ZJ2 A;  1OQY A;  3ZMU A;  2OF7 A;  1HLV A;  1C0W A;  1HCR A;  4WXC A;  3PL8 A;  2LVS A;  4JP0 A;  1V4R A;  2E5N A;  3BZC A;  2CMP A;  4M6X A;  4XR6 A;  3LNQ A;  3MZ8 A;  5ICC A;  2RN7 A;  4D7N A;  4U9L A;  1JE8 A;  4UHT A;  3H9Q A;  3HUG A;  5IOZ A;  5HAW A;  2BV6 A;  2KHM A;  1RC9 A;  3LOC A;  2DA5 A;  3MMY B;  1NK3 P;  2MD5 A;  4DZP A;  4IHW A;  4GGG A;  2KZV A;  2HOS A;  4I98 B;  3CF2 A;  3GW2 A;  4NUB A;  2K85 A;  3S93 A;  5IOY A;  4KN7 X;  2K9M A;  3E3V A;  4ZDP A;  3BCB A;  3HTH A;  3BP8 A;  3TDZ C;  3M4O J;  2ZC2 A;  1S7A A;  2D5V A;  3HTA A;  1Y8Q B;  2WTE A;  2ACJ A;  3GEU A;  1P4A A;  3E5X A;  2JMW A;  1MSF C;  2XKO A;  3Q3S A;  4XNF A;  2QF7 A;  5DD8 A;  3HC7 A;  2RC4 A;  2X1D A;  2CH0 A;  2DBB A;  3ZOB A;  5GAG J;  1FLI A;  3JSJ A;  3RZO J;  1R1T A;  1E2X A;  2KIF A;  2LF7 A;  4HF2 A;  2MG4 A;  1XS9 A;  4RAF A;  3K4J A;  4HSR A;  3S8P A;  5IPA A;  3E7L A;  2LBF A;  2ZBK A;  1U3E M;  5E1Z B;  1H9G A;  3ECO A;  4ENN A;  1XDS A;  1HDD C;  1TTY A;  4V19 K;  4RAG A;  2LF8 A;  1U0J A;  2LK2 A;  3N4M A;  4IL6 C;  1FBQ A;  4A93 J;  1SVO A;  3FMQ A;  3PFI A;  3ZQL A;  5FLM J;  1H88 C;  3K1N A;  2K27 A;  3Q9S A;  1EH7 A;  2HGC A;  2RAE A;  4XSX F;  2DDB A;  3LSJ A;  3PNV A;  2OTL I;  3DLA A;  4XKC A;  4ZYA A;  1IN5 A;  3HHG A;  3DWL E;  3Q9V A;  3LA2 A;  4ON0 A;  4EEF G;  3RKQ A;  4HX4 A;  2V26 A;  4M3D A;  3HSE A;  1BC7 C;  1S29 A;  4E4H A;  1Y39 A;  1U2W A;  1EA3 A;  3RH2 A;  2IW5 A;  3F9K A;  1WVR A;  4HLX A;  2VUM J;  1ITY A;  2MD0 A;  3VVZ A;  3IAM 2;  3HRT A;  2ZKZ A;  2XPU A;  1T39 A;  3LQQ A;  3PUB A;  2A2F X;  4CYC A;  1WZ2 A;  2K7L A;  2H8R A;  5CXI A;  1LDK B;  2WY8 Q;  3IUV A;  2TRT A;  4BE1 A;  1QPI A;  1W0T A;  1GXP A;  2YU9 J;  3TO6 A;  3OV8 A;  2HTJ A;  5FJ8 J;  2GLO A;  4RAY A;  5J6X A;  2VAS A;  2MH9 A;  3OR1 C;  3A01 B;  3C18 A;  4S0H B;  4XOR A;  3IHU A;  2XIG A;  2ID3 A;  2A61 A;  4D1Q A;  2UZK A;  4DOZ A;  1K83 J;  3G73 A;  2E2J J;  1WH7 A;  2XC7 A;  1JI8 A;  2X9D A;  2FNA A;  4JBA A;  2DG8 A;  3ECH A;  3D1N I;  3KKC A;  1MNM C;  2HYT A;  1WKM A;  4OIQ F;  3JTH A;  2IS4 A;  3MNL A;  3HOW J;  3E5Q A;  1SD6 A;  5E79 C;  3I59 B;  1P9Q C;  1U5T A;  2R7D A;  4NQW B;  2YVX A;  3TMO A;  2R7S A;  2PG4 A;  1MBG A;  1P92 A;  3CC2 I;  3K4M A;  3ZMT A;  4CCL A;  3DBL B;  1S9H A;  1WSU A;  1B9N A;  2K4J A;  2CJJ A;  4ZDO A;  1TWF J;  1FJL A;  1L3L A;  4BHB A;  3HDD A;  2WAF A;  4BS9 A;  2VBX A;  3MD2 A;  2GXG A;  4GO1 A;  4E7H A;  1Z1D A;  2DJN A;  2VJJ A;  2KRC A;  4QPO A;  3HGG A;  3TBI A;  5J4V A;  1LUJ B;  1E3H A;  1YQA A;  4MTD A;  3HGY A;  3IKV A;  3DPJ A;  1P6R A;  4KA4 A;  4RLQ A;  1G2H A;  4DJA A;  3ZMD A;  1BBY A;  2O3F A;  2ZCX A;  5LGU A;  2BEO A;  1LVK A;  3BG9 A;  4CH7 A;  3BR5 A;  3FXR A;  3QAH A;  4CCN A;  2QQA A;  5C3E J;  2E7W A;  2IGM A;  3EPZ A;  4U7D A;  1Z0X A;  1WHU A;  1XSD A;  3JR9 A;  1OLT A;  4J01 A;  4HQE A;  4M9X A;  3JW4 A;  3SFI A;  3QOD A;  5ILS A;  4L9N A;  2FX0 A;  1R5G A;  2V4J C;  3R0J A;  1EH6 A;  3BR2 A;  1ZGA A;  3MCZ A;  1QHG A;  2MBF A;  3TW6 A;  4K2E A;  4CZZ A;  2DOA A;  3VPR A;  3CMY A;  3S14 J;  3S5R A;  1YIJ I;  1R58 A;  2M1B A;  2VJI A;  4BL0 B;  4XLN F;  4RS8 A;  3PNY A;  3K4L A;  1U8R A;  1BW6 A;  3A02 A;  1A36 A;  2XSJ C;  3KYD B;  2KIM A;  3ESW B;  4YFN F;  4ANJ A;  5H9T A;  2ME6 A;  2R7U A;  2FNP A;  2IU5 A;  4UVC A;  2QQ8 A;  3VSL A;  2LY9 A;  4R8H A;  5FKO A;  3TW7 A;  4BNC A;  3A2K A;  3DU6 A;  3KP3 A;  3MVP A;  2PLY A;  2L4A A;  5D8K B;  2ELK A;  5AIP A;  4BQQ A;  1DP3 A;  4XMY A;  4O3M A;  4RB3 C;  2MA3 A;  1B8I A;  3LA7 A;  2OC6 A;  1LFP A;  3P9C A;  2HYJ A;  1YHQ I;  3SZG A;  1X1P A;  4PJJ A;  2F4M B;  1R1V A;  4A3L J;  1J0R A;  1ENH A;  5AQC A;  2F2E A;  3ABL H;  1FNN A;  2CQ7 A;  2J5P A;  3OIO A;  3Q0U A;  4YEJ A;  1DQU A;  3QBM A;  4JX6 A;  4H4K C;  1VQ8 I;  3MZH A;  4FE7 A;  4KN4 X;  4P96 A;  2XAQ A;  4A0Y A;  2BY1 A;  2DA1 A;  2M0C A;  3CES A;  2HQA A;  3KP2 A;  2CUZ A;  1IZ1 A;  2QKL B;  1D0X A;  3KYL A;  5EG0 A;  1QBJ A;  2A6T A;  2DLL A;  2Y30 A;  1IAW A;  2PJR B;  4I01 A;  5FKK A;  4OOI A;  5DM7 F;  5ILU A;  3N97 A;  5LBQ A;  1XG1 A;  2QQ9 A;  3J7A Y;  5FGL A;  1XSX A;  2NVQ J;  3VVX A;  3K4N A;  4A69 C;  2V9K A;  3K70 C;  1ETQ A;  4J00 A;  5KVR A;  1I3Q J;  4MQV A;  2ZB9 A;  2HKU A;  4LLG F;  2WAQ N;  3JRD A;  2F5F A;  3H0G J;  3WTT C;  4X1E A;  2E19 A;  3CUQ B;  2ZNY A;  3E6M A;  2ZME C;  4ABZ A;  1Y1W J;  2ZCN A;  1R36 A;  3HEF A;  2L4M A;  4HZF A;  5HVQ C;  1BL0 A;  4B47 A;  3HPG A;  2QCO A;  2VE8 A;  4FE4 A;  4QIW N;  2DPU A; 
#chains in the Genus database with same CATH homology
 3V78 A;  1TWG J;  4GFB A;  3OSG A;  1AKH A;  3RQI A;  3M3Y J;  3HM5 A;  3G1M A;  5EYR A;  1T33 A;  3IV5 A;  2QWT A;  5IYD J;  2DMP A;  2K9N A;  4ICH A;  3NAU A;  4XRM A;  1JJ6 C;  4CYC B;  3HOY J;  3VUQ A;  3FK7 A;  5F0F A;  1RKW A;  1TWH J;  3RZD J;  1U8B A;  3GTL J;  2NVX J;  1S7E A;  3IH4 A;  5M5W J;  3S1M J;  3VW2 A;  5HOD A;  5M5X J;  4HNV A;  4A3E J;  2NS8 A;  1AU7 A;  1WPK A;  2HXI A;  2Y9Y A;  4C3H J;  3DEW A;  1P7I A;  1FEX A;  5F0C A;  5HBU A;  1JTY A;  3S1Q J;  5FMP A;  3JRE A;  1AHD P;  3CCY A;  3I4N J;  2JJ7 A;  1IJW C;  1XC5 A;  5IP7 J;  4UUT A;  2DMU A;  2Y2Z A;  3CWR A;  4HKU A;  1ZKG A;  2PZ9 A;  4UUS A;  5K7F A;  3OSF A;  1W0U A;  2UXO A;  4DYC A;  3KZ9 A;  1PUF A;  1VI0 A;  3H3V K;  5EGO A;  4DYR A;  4AUX A;  2V57 A;  1RKT A;  1GDT A;  2E2I J;  5GPA A;  2X6O A;  3BTC A;  1F43 A;  1ETK A;  2MGQ A;  3ANP A;  1ZR4 A;  4ACI A;  2G7L A;  2HDD A;  3HKZ N;  2HXO A;  2ID6 A;  1RET A;  1JKO C;  1ETO A;  4XRS A;  3GTP J;  2RHA A;  1SGM A;  4M6V A;  5J1R A;  2O8K A;  4MFE A;  4KWA A;  1LFB A;  5CW8 A;  2YUS A;  2PBX A;  3GZI A;  2ZOZ A;  4B1R A;  3NRG A;  4M3B A;  2Q24 A;  3NXC A;  2NS7 A;  1TC3 C;  5E3M A;  1JKQ C;  4FTH A;  4MK6 A;  1SAN A;  4D5F A;  2L9R A;  5EEA A;  2ZOY A;  2L7M P;  3BCG A;  4IHX A;  4C2M J;  5M5Y J;  1LE8 A;  4A3M J;  5FLV A;  3BTI A;  3RD3 A;  1JKP C;  1EF4 A;  3AQT A;  3LSG A;  2X48 A;  2L0K A;  4X6A J;  2GEN A;  2VPR A;  1YRN A;  3PAS A;  1APL C;  2HI3 A;  3DCF A;  4JYK A;  4ME9 A;  2XRL A;  1F36 A;  3MN2 A;  3QPL A;  2O9L A;  4M3E A;  4DW6 A;  2JA7 J;  1ZR2 A;  2EZI A;  4A3K J;  1T56 A;  2LLK A;  2XGC A;  1OCT C;  4CGR A;  2DMT A;  1TWC J;  2IAI A;  4NEL A;  1MH3 A;  2K9Q A;  4B4C A;  4J19 A;  2FJ1 A;  1IRZ A;  1ETV A;  3PPB A;  4BBR J;  4FIS A;  3IH3 A;  4NN1 A;  3G1L A;  5FKL A;  2IEK A;  3BJB A;  3LWJ A;  2IBD A;  1SFO J;  3BR3 A;  1UMQ A;  3S2H J;  5HSZ A;  2WB1 N;  3KNW A;  4FCY A;  1QRY A;  3ON2 A;  3SDG A;  2M8G X;  2UXP A;  5IYC J;  4BY1 J;  2JN6 A;  3VVY A;  3BR1 A;  4IHY A;  1FTZ A;  2ZCM A;  3S2D J;  2EQR A;  3ZQC A;  5F08 A;  1JJ8 C;  2Y0S N;  3CJD A;  1O4X A;  1LFU P;  5EZG A;  2XDN A;  2NVY J;  2R5Y A;  5C4X J;  4A3I J;  1WH5 A;  3CQZ J;  1K61 A;  4QTR A;  1RES A;  3O8G A;  5EF6 A;  2R5Z A;  2Y31 A;  3SJM A;  2LD5 A;  3W6V A;  3EUP A;  3G56 A;  4YZE A;  2DN0 A;  4BXX J;  1NK2 P;  5DTD A;  1OJL A;  2CU7 A;  4A3F J;  2REK A;  4V2G A;  5IYB J;  3JRF A;  3VP5 A;  2XGD A;  2JK3 A;  2DTZ A;  3KKD A;  3VOX A;  2B63 J;  2FBQ A;  2O7T A;  1IG7 A;  3HOV J;  5K7H A;  3S17 J;  3FKI J;  2GM4 A;  2M34 A;  2LP0 A;  2E2H J;  4GCL A;  5IP9 J;  2WGB A;  4MXM A;  5M3F J;  2CQQ A;  4W97 A;  3BQZ A;  2NX4 A;  2CUF A;  2JA5 J;  4D5C A;  1HF0 A;  2G3B A;  1IV6 A;  4IEJ A;  1NTC A;  9ANT A;  2UXI A;  2UXH A;  5GP9 A;  4XK4 A;  5K7Z A;  1ZK8 A;  2JA6 J;  2EZK A;  2XB0 X;  3JRH A;  2R0Q C;  2CRG A;  1A5J A;  3FRQ A;  1GVD A;  1AKH B;  3PO2 J;  2EBI A;  2OF7 A;  3JRG A;  1HLV A;  3C07 A;  1HCR A;  1E3O C;  1FIP A;  2LVS A;  3GBG A;  4GFK A;  4JP0 A;  3EGQ A;  3TED A;  5IP6 A;  1B72 A;  5CXG A;  1FIA A;  3LNQ A;  5EDN A;  2LTP A;  3NI7 A;  1GUU A;  2M2E A;  4D7N A;  1MBK A;  2O7O A;  2XGE A;  1JKR C;  3S1N J;  2I10 A;  5IOZ A;  4I76 A;  3JRB A;  5HAW A;  3B81 A;  3FIS A;  3LOC A;  1NK3 P;  2DA5 A;  2DG7 A;  1UI6 A;  4DZP A;  1JUP A;  3BTJ A;  3VW0 A;  2VI6 A;  4IHW A;  3JRI A;  4Y52 J;  2HOS A;  1JT0 A;  1Q1V A;  1JT6 A;  5IOY A;  2XB5 A;  3HTH A;  2CUE A;  3M4O J;  5E3N A;  2XSD C;  3ZQH A;  2D5V A;  3HTA A;  1CQT A;  4A3D J;  3GEU A;  2DA6 A;  1UG2 A;  2JMW A;  1MSF C;  3Q3S A;  2P81 A;  3HBL A;  5EGO B;  3P9T A;  2NVT J;  2COB A;  1WCM J;  2QF7 A;  1GV5 A;  4AC0 A;  3ZOB A;  3K2A A;  2R92 J;  3JSJ A;  2M9H A;  3S1R J;  4RBO A;  3RZO J;  5FHP A;  1ZTR A;  3FIW A;  4DYQ A;  1I6H J;  1U9O A;  2MG4 A;  3GTO J;  1XS9 A;  5C4Y A;  2F07 A;  5IPA A;  3E7L A;  1UHS A;  2QTQ A;  2NOG A;  4JNN A;  3LHQ A;  2DA3 A;  4XRS G;  2YS9 A;  4JL3 A;  1HDD C;  1UI5 A;  3UKG A;  4GFL A;  2LK2 A;  4I6Z A;  2AHQ A;  3GTM J;  4A93 J;  4BY7 J;  3LSR A;  2L7F P;  3ZQL A;  5EFY A;  4C3J J;  2R93 J;  5FLM J;  1H88 C;  3F0C A;  4L62 A;  2RAE A;  2DA2 A;  3BG3 A;  3O60 A;  2EZL A;  3LSJ A;  2VKE A;  1JUM A;  3L1P A;  5GPC A;  1ORK A;  3G7R A;  2EZH A;  2MW8 A;  3V6G A;  2DMQ A;  1OFC X;  4EEF G;  3RKQ A;  2QOP A;  5F0H A;  1DU6 A;  4M3D A;  1D5Y A;  3ON4 A;  2LR8 A;  1ZGW A;  2ECC A;  1B8I B;  3O8H A;  1R9T J;  3LJL A;  5D18 A;  2H1K A;  4PXI A;  2HQ5 A;  1X2N A;  2VKV A;  4GCT A;  4B3A A;  1ETY A;  1JTX A;  1MBH A;  4JX5 A;  2GBY A;  3FK6 A;  3HIM A;  3RH2 A;  1MH4 A;  5C44 J;  2VUM J;  1ITY A;  1X2M A;  3VVZ A;  2FQ4 A;  3CRJ A;  1HOM A;  2XPU A;  4NDL A;  2PMZ N;  1X58 A;  4CYC A;  2DA7 A;  2H8R A;  1U78 A;  5CXI A;  2YVH A;  3HOZ J;  3IUV A;  2TRT A;  1QPI A;  2YU9 J;  1W0T A;  5EG0 B;  1MBF A;  4A3B J;  3E7Q A;  1A6I A;  5FJ8 J;  5C4J J;  2GLO A;  3HOU J;  2R7Z J;  3A01 B;  4S0H B;  3ZQG A;  2ID3 A;  3GTQ J;  5DAJ A;  1K83 J;  3Q0V A;  1I50 J;  1BA5 A;  3BNI A;  2E2J J;  1WH7 A;  2X9D A;  1H8A C;  1U9N A;  2DG8 A;  3KKC A;  3D1N I;  1VND A;  1MNM C;  1QVT A;  2HYT A;  3MNL A;  3HOW J;  4A3C J;  3JRA A;  3ANG A;  1MBG A;  4A3J J;  5E3L A;  5F27 A;  4BKX A;  2R5Y B;  2CJJ A;  1MBJ A;  1IUF A;  1BW5 A;  4RDU A;  2R5Z B;  1TWF J;  1IGN A;  1FJL A;  3A03 A;  3HDD A;  1HDP A;  3BR6 A;  3QPS A;  2JWT A;  3K7A J;  2DJN A;  3GTK J;  2L7Z A;  1GV2 A;  3HGG A;  5F1J A;  1GT0 C;  3HGY A;  4Y7N J;  2K40 A;  5J3L A;  3PO3 J;  3DPJ A;  1MSE C;  1ZQ3 P;  4IHV A;  1Y1V J;  4DZJ A;  3LSP A;  1G2H A;  3QQA A;  3MKL A;  2N8G A;  2XPV A;  3JRC A;  2ZCX A;  1FTT A;  2W53 A;  5F04 A;  4AC6 A;  1POG A;  1RR7 A;  3OOU A;  2FD5 A;  3BG9 A;  3I4M J;  3BR5 A;  2WV1 A;  4MLO A;  5C3E J;  3BHQ A;  2LKX A;  1P7J A;  1Z0X A;  3BR0 A;  2OER A;  1ETW A;  3JR9 A;  4QSH A;  3TP0 A;  1WGX A;  2G0E A;  5E3O A;  3WHB A;  3BQY A;  5J1U A;  2KT0 A;  3SFI A;  5JLW A;  3S16 J;  2KDZ A;  4JX4 A;  4UUS B;  2FX0 A;  1DU0 A;  4LOC A;  1PUF B;  3VW1 A;  3BR2 A;  2JA8 J;  2EH3 A;  2NP5 A;  2HOA A;  3TW6 A;  1TWA J;  3WHC A;  2GFN A;  1JGG A;  3VPR A;  3CMY A;  3G1O A;  1B72 B;  3S14 J;  3S5R A;  1JUS A;  4C3I J;  4W1U A;  4UDS A;  3BT9 A;  5D1R A;  1OCP A;  3Q0W A;  3VIB A;  1BW6 A;  3A02 A;  1IDY A;  2MSY A;  3HOX J;  1VFC A;  1BJZ A;  3ZQI A;  4GCK A;  2QKO A;  1IC8 A;  1Z77 A;  3BG5 A;  1H89 C;  5H9T A;  2ME6 A;  2IU5 A;  2UXU A;  2D6Y A;  4L5E A;  5J1Y A;  2LY9 A;  5FKO A;  2QIB A;  3NPI A;  3TW7 A;  5K58 A;  3NAR A;  3B6C A;  3MVP A;  4G12 A;  2G7G A;  2ELK A;  3F1B A;  3HTI A;  2CQX A;  1B8I A;  3T6N A;  3HTJ A;  2G7S A;  2TCT A;  2HYJ A;  3PM1 A;  2Y9Z A;  3S15 J;  4A3L J;  1ENH A;  5AQC A;  5BNG A;  3BTL A;  2DMN A;  1LE8 B;  3GTJ J;  3OIO A;  2W48 A;  3Q0U A;  4AYB N;  3QBM A;  4JX6 A;  1YRN B;  2XPW A;  2ECB A;  5FKM A;  1QVU A;  4FE7 A;  4JKZ A;  2ME0 A;  2DA1 A;  2M0C A;  2DA4 A;  1ETX A;  5DS9 A;  2K9S A;  4M3F A;  3TP3 A;  5EG0 A;  3BRU A;  3HE0 A;  2Y30 A;  5JLX A;  3NNR A;  4A3G J;  1WI3 A;  1RPW A;  2WUI A;  3B6A A;  2AO9 A;  5FKK A;  2OI8 A;  2YVE A;  4V2F A;  3A01 A;  1XG1 A;  2GUH A;  5FGL A;  2NVQ J;  3VVX A;  4MO7 A;  2LFB A;  3HB9 A;  4A69 C;  4XIC A;  1ETQ A;  4D7M A;  2E1O A;  2HOT A;  1I3Q J;  2ZB9 A;  2HKU A;  2WAQ N;  3VOK A;  3CDL A;  3JRD A;  3GTG J;  4MFD A;  3H0G J;  5EZH A;  4X1E A;  4AF5 A;  2NP3 A;  2E19 A;  3QKX A;  2OPT A;  3C2B A;  5D19 A;  4ABZ A;  1Y1W J;  3IH2 A;  4BBS J;  2RAS A;  2ZCN A;  3ZQF A;  3HEF A;  5M3M J;  1IDZ A;  1MBE A;  1BL0 A;  1VF9 A;  5FKN A;  3AQS A;  4MIM A;  2QCO A;  4FE4 A;  3COL A;  4XID A;  4M3G A;  4QIW N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...