1JUPA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jupA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jupA02
1JT6A 3CRJA 5K7ZA 2HOSA 3CDLA 2O8KA 4RBOA 4M3GA 4BY7J 3ANGA 4W97A 2DA7A 2OPTA 4M3BA 4JP0A 2HOTA 3ON4A 4M3DA 2DMTA 4DYRA 3Q3SA 1S7EA 1F36A 2DMQA 4JYKA 5K7HA 1GV2A 1ETYA 1JUMA 1QVTA 1A6IA 2W48A 2R5YA 2FX0A 1X2MA 3HOYJ 3V6GA 5EGOB 4AYBN 4FE7A 3HE0A 1Z0XA 2GENA 4HKUA 4GCLA 1HLVA 3Q0WA 3NI7A 5E3OA 1GDTA 4ICHA 5D18A 2IBDA 5J1UA 5HBUA 4X1EA 3QBMA 2DA4A 3FKIJ 3JSJA 1NK3P 3A03A 4M6VA 3PASA 1BJZA 2LTPA 4BXXJ 3B81A 3BHQA 1B8IA 4XRMA 1MBEA 2JN6A 2Y9ZA 4FISA 5J1RA 4CYCA 3LNQA 3UKGA 1AKHB 5F1JA 1IDZA 2NVTJ 3LSRA 3FIWA 2M9HA 3WHCA 2LR8A 4A3GJ 3HBLA 4KWAA 3MNLA 3HOZJ 3Q0VA 3H3VK 1IDYA 1I6HJ 2GFNA 3NRGA 3VOKA 1F43A 4A3MJ 2E2HJ 1RPWA 2R5ZB 1ORKA 1P7JA 1BL0A 2NVXJ 5FHPA 4GCTA 5FKMA 3JRIA 3SJMA 3BR0A 3MKLA 3E7LA 1FJLA 2EH3A 1XS9A 3S1NJ 3EUPA 4M3FA 4A3IJ 2JA5J 3FK6A 2G7LA 2UXPA 1RR7A 3S2HJ 1APLC 2Q24A 2Y0SN 1Y1WJ 5FGLA 2LKXA 2JA6J 4LOCA 4JX4A 3BR2A 3CMYA 3S1QJ 1FTZA 2WUIA 2DA3A 3K2AA 1QPIA 3HTIA 3GZIA 1YRNB 2ZOZA 5K7FA 2G7GA 3PO2J 3PPBA 1MBKA 2IU5A 1A5JA 3HGGA 1ENHA 1I50J 1LFUP 2VPRA 2UXIA 4MK6A 2AHQA 3EGQA 2WGBA 4CGRA 5IOYA 4S0HB 3K7AJ 3L1PA 4UDSA 3MVPA 1FIPA 2XB5A 5D19A 4BBRJ 4J19A 4GFBA 5EZHA 2HKUA 2ID6A 2FD5A 1AU7A 2Y30A 1K61A 4M3EA 4AF5A 3NARA 4UUSB 3S15J 2NOGA 2VI6A 5IP9J 2O7TA 5FMPA 1POGA 2CRGA 4NN1A 3SFIA 5IOZA 3HB9A 2W53A 2DTZA 2G3BA 5M5WJ 2XGEA 4ABZA 1JKRC 1JUPA 1WPKA 3LSGA 2O7OA 5FLMJ 5C44J 1DU6A 1IJWC 2XPVA 2VUMJ 1HF0A 4XIDA 3DPJA 4GFLA 2D5VA 1Z77A 3G1MA 1MBJA 2UXHA 3BR6A 3VPRA 3CJDA 3LSJA 1MH3A 2TRTA 1H88C 3A02A 1ETOA 1HOMA 1ETXA 5FKOA 4XRSG 4DYQA 3HOWJ 3O8GA 1UI6A 2EZHA 3TEDA 2D6YA 3VIBA 4MO7A 2L7FP 5D1RA 2FQ4A 4FCYA 4BBSJ 1UHSA 4C3HJ 1SGMA 4ACIA 1IC8A 3GTKJ 3BTIA 3QPLA 5DTDA 3B6AA 3VVZA 3KKDA 1ZKGA 3VOXA 3CWRA 2GLOA 1LE8B 3LHQA 5HSZA 1Y1VJ 2R92J 2P81A 1JUSA 4DYCA 3E7QA 5F0HA 4CYCB 2X9DA 1VFCA 1ZGWA 2KT0A 1JTXA 1D5YA 2ZOYA 2MGQA 1QRYA 2ELKA 2XGCA 4PXIA 3DEWA 4Y7NJ 2RHAA 2LLKA 3TW7A 5F08A 2DA2A 2XRLA 3BR1A 5C4JJ 2HI3A 2CUEA 2XPWA 4D5CA 1JJ8C 1E3OC 4XRSA 3SDGA 3JR9A 2PBXA 3LSPA 2XGDA 3O8HA 1RKTA 2Y9YA 3S16J 2JJ7A 2M34A 3KZ9A 4D5FA 5E3NA 2UXOA 4W1UA 1FIAA 1GT0C 2E1OA 2QKOA 2G7SA 3PM1A 1B72B 3M3YJ 1H8AC 2R7ZJ 4JX5A 3ZQCA 2VKEA 5EEAA 2LVSA 2LFBA 3GTQJ 1TWAJ 2HXIA 2QCOA 3ZQGA 2DG8A 2NVYJ 3IH4A 3VVXA 4I76A 4NDLA 4IHVA 1PUFA 1IRZA 1U9OA 2AO9A 1GUUA 3RZDJ 1ETQA 1X2NA 4A3EJ 1WH7A 3I4MJ 4A3CJ 1W0TA 4L5EA 1IGNA 4JKZA 1SANA 3BG3A 3JRGA 2E2IJ 5EGOA 1TWFJ 3JRBA 2B63J 2DMNA 2O9LA 3S1MJ 2M8GX 3JRDA 4JL3A 3NAUA 5C4YA 2R0QC 3HGYA 1MSEC 3NPIA 2IEKA 1IV6A 2E19A 5FKNA 1QVUA 3JRHA 3G7RA 3TP0A 1I3QJ 2ZCXA 4MFEA 1MH4A 5E3MA 4AUXA 5EFYA 2DMPA 2L7MP 1UMQA 2EBIA 3BG5A 1AKHA 3VW1A 2JWTA 5IYCJ 3G1LA 2I10A 2ZCMA 2H8RA 4QIWN 3IH2A 3JRAA 5BNGA 3LJLA 2LK2A 2ID3A 4IEJA 2HDDA 1JKQC 1JJ6C 2R5ZA 5FLVA 5FJ8J 4V2GA 3KKCA 1XG1A 2K40A 3HOUJ 3I4NJ 3HEFA 2K9QA 3G56A 3GTJJ 3S14J 2JA8J 3VUQA 3BCGA 5H9TA 5J3LA 1JT0A 5K58A 4XICA 1U8BA 3GEUA 2GUHA 1JGGA 1WGXA 2E2JJ 2ZCNA 3P9TA 2KDZA 3CQZJ 3BQZA 5FKLA 1ZR4A 1RESA 9ANTA 3HOVJ 2HXOA 4AC6A 3S5RA 2ECCA 3BJBA 2NS8A 1WCMJ 1YRNA 4A93J 3F0CA 3T6NA 3ZQFA 1R9TJ 3C07A 4GFKA 1ETWA 3RQIA 4B3AA 2ECBA 5EDNA 4EEFG 1O4XA 2JA7J 4UUTA 5E3LA 2R5YB 4D7MA 2LP0A 3A01A 2NVQJ 2WV1A 2QIBA 4ME9A 1EF4A 4JX6A 1BA5A 2RASA 2K9NA 3IV5A 2OERA 2HOAA 3BG9A 1HDPA 2V57A 3RH2A 4B1RA 1MBGA 2H1KA 3FK7A 4IHWA 3ANPA 4BY1J 1FTTA 5EG0A 4V2FA 3ZQLA 4MLOA 4MXMA 1GV5A 4UUSA 1WH5A 1B8IB 2QOPA 2QTQA 3IUVA 1ZR2A 5FKKA 1RETA 2FJ1A 1XC5A 3HTAA 2YS9A 2XSDC 3WHBA 5EZGA 4A3BJ 2CU7A 4A69C 2M2EA 5JLXA 3AQTA 4FE4A 2UXUA 3QKXA 2ZB9A 1TC3C 1OCPA 2DA5A 5F04A 1OFCX 2WB1N 3D1NI 3GTLJ 1MBHA 2MG4A 4RDUA 4A3LJ 1OCTC 5EF6A 1PUFB 2CQXA 1NTCA 2XB0X 2XPUA 3ZOBA 1WI3A 4NELA 1T33A 3LWJA 1DU0A 4C3IJ 3OSFA 2M0CA 5M5YJ 3V78A 5CW8A 2YVHA 1T56A 5GP9A 2COBA 2OF7A 3JREA 1IG7A 1ETVA 4YZEA 1Q1VA 2DMUA 3LOCA 5IYBJ 4IHYA 3VW0A 3OOUA 5F0CA 2DA1A 1H89C 3TP3A 5C4XJ 1SFOJ 2L9RA 3VW2A 2GBYA 3VVYA 2Y2ZA 1ITYA 2PZ9A 1LE8A 3W6VA 2ME6A 4I6ZA 3TW6A 3S17J 3BTJA 4A3DJ 3IH3A 4D7NA 2GM4A 5GPCA 4QSHA 4IHXA 2G0EA 2L7ZA 5HAWA 4A3FJ 2RAEA 2HYTA 4HNVA 4C3JJ 1JKPC 2K9SA 1HCRA 3O60A 3HM5A 3HOXJ 2L0KA 1ZTRA 3HTJA 4XK4A 2X6OA 5J1YA 1ZK8A 5M3FJ 3M4OJ 5CXGA 3KNWA 1MBFA 1FEXA 4L62A 2FBQA 4X6AJ 3OSGA 4QTRA 2LY9A 1VI0A 2X48A 1TWHJ 1NK2P 5M3MJ 1UI5A 3VP5A 3HTHA 3H0GJ 2XDNA 1CQTA 2MW8A 3ON2A 2YU9J 3BRUA 1HDDC 1LFBA 1VNDA 5DS9A 4DZJA 3BNIA 1B72A 3OIOA 2IAIA 2DN0A 5HODA 2JK3A 2QWTA 3B6CA 2YVEA 1VF9A 4A3KJ 3PO3J 2REKA 3JRFA 4DW6A 2EZLA 1JTYA 2CUFA 3NXCA 3FISA 3G1OA 3QPSA 2PMZN 3DCFA 5JLWA 3AQSA 3HKZN 2DJNA 2JMWA 3RZOJ 1BW5A 3HIMA 3ZQHA 2OI8A 3NNRA 3A01B 1UG2A 5CXIA 2R93J 2EZIA 3CCYA 3MN2A 5M5XJ 4MFDA 2EZKA 2CJJA 1ETKA 2TCTA 1IUFA 4DZPA 5IP6A 1OJLA 5IP7J 3F1BA 3GTPJ 3RKQA 3BR3A 3S1RJ 1BW6A 3HDDA 1U9NA 3COLA 4AC0A 5EG0B 2NP3A 4B4CA 4BKXA 2NX4A 4GCKA 3BT9A 4C2MJ 3S2DJ 1MSFC 2LD5A 4JNNA 5AQCA 1ZQ3P 3ZQIA 4FTHA 3GTMJ 2MSYA 4MIMA 3JRCA 1P7IA 5IYDJ 1TWCJ 3Q0UA 1MNMC 1U78A 2Y31A 2F07A 2HYJA 1GVDA 3GTOJ 3QQAA 3FRQA 5EYRA 3BQYA 2VKVA 2HQ5A 3BR5A 4A3JJ 1W0UA 5F0FA 3RD3A 4Y52J 5C3EJ 3BTLA 2WAQN 5DAJA 1TWGJ 2DA6A 2QF7A 3C2BA 2N8GA 3BTCA 1K83J 1JKOC 1X58A 2CQQA 4G12A 2NP5A 5IPAA 3GBGA 2ME0A 5F27A 3GTGJ 2YUSA 1AHDP 2DG7A 2EQRA 5GPAA 2NS7A 1RKWA 1G2HA
chains in the Genus database with same CATH superfamily
5J8CA 3E6DA 2AS5F 1YIOA 3CLQA 5K7ZA 3DLAA 2R7QA 2V1UA 4BY7J 2GXBA 2DA7A 4MGRA 1OQYA 3QPTA 5LBQA 4EJVA 3OWTA 4L5IA 4NUBA 2F5DA 2CV1A 3D5RC 4RAGA 3J81Z 3F8FA 2CQ7A 5HDNA 2YX4A 4HV5A 2Y0MA 3K10A 1F36A 3KP3A 4KNYA 1Q1HA 3R4KA 2DI3A 1G3SA 3EUHC 1AA7A 2HVSA 1GV2A 1QO0D 1ETYA 1QVTA 2R5YA 5HLTA 1G3WA 2FX0A 3HOYJ 2DPDA 1Z3YA 5EGOB 2HTJA 2FOWA 4FE7A 3TDZC 3HE0A 1LUJB 5FRMA 4GCLA 3Q0WA 1YQAA 4IRHA 5E3OA 2F5CA 5GAGJ 3KETA 1KU2A 1V54H 4XBFA 5HBUA 1N77A 3DEEA 1OISA 4KT5C 4OWRB 3QBMA 1YS7A 2IA1A 2R7UA 4XRMA 5L3DA 3ZMUA 2OAZA 3LA7A 2G9WA 1IXCA 2ESHA 3H1CA 5F1JA 4A12A 4LITA 1MMGA 3LSRA 4UUVA 2M9HA 3WHCA 5L3BA 2D45A 1FP1D 2DU9A 1IN5A 4EM2A 4P55A 1IDYA 3N97A 2GFNA 2QVOA 3VYSB 1RPWA 5D5UB 4KITB 1BL0A 1YJ9I 2WAEA 2NVXJ 5FHPA 5BPDA 3BR0A 2DFHA 4ETSA 4EMSA 3E7LA 4ZTJA 2A6TA 4QWQA 2MYSA 5J4YA 3S1NJ 3EUPA 4A3IJ 2UXPA 1G6NA 3TMOA 2PFBA 5HNHA 1APLC 3FWEA 3BY6A 5EEHA 5FGLA 1U5TC 3NEUA 2JA6J 4WXCA 3L2WA 1SFKA 2K86A 4LOCA 2XHKA 3IUOA 1UZCA 4RAYA 1T38A 1Y8RB 3TOAA 4BHPA 2WUIA 1KONA 4Z2YA 3K2AA 3QP6A 1YRNB 5K7FA 2ZOZA 2F48A 3PO2J 2B1EA 2G7GA 3PPBA 3I64A 1A5JA 1XPXA 4L9VA 1X4OA 1SD6A 2DQRA 5HDKA 1I50J 3CF5F 4MK6A 4WWCA 2GWRA 4CGRA 4O3MA 1KYZA 4S0HB 5FFXA 1LVKA 3MVPA 1WJBA 3SZTA 3L2VA 2AQFA 3CO7C 3G3ZA 1G3YA 3VYTB 2HKUA 4LJZF 2ID6A 2QSFX 4X0GA 1XMAA 2VQGA 3ZN0A 1K61A 4E6KG 2RNJA 1MKMA 3PNTA 3M1EA 1OCCH 3HOTA 2BGCA 4YFNF 2JA2A 1POGA 3CP2A 4NN1A 3EQLF 3K4LA 3SFIA 3HB9A 2ZMEA 2G3BA 1ZRDA 4HW0A 2QM3A 1IJWC 2XPVA 2DPUA 1HF0A 4XIDA 4L9TA 1DQUA 2BXZA 1SFUA 5ILVA 3G1MA 1MBJA 4MQVA 3CJDA 2VJJA 1X3UA 1D0YA 4ENMA 3HRUA 2TRTA 4A5MA 3A02A 1ETOA 3RJPA 1H88C 3K1MA 3KEYA 3O8GA 2KIFA 2O0YA 2RVCA 4MO7A 1VQLI 2FQ4A 5D1RA 2VE8A 2WY7Q 1QGPA 3KZYA 2NS0A 4C3HJ 1X1CA 3QODA 3GTKJ 5DTDA 4DBQA 4BU2A 1I3AA 2XAUA 3VOXA 3OL3A 3CWRA 5BOXA 3KFWX 3H5NA 1LE8B 2X6YA 3T5XA 3LHQA 1D1BA 4HDVA 2FUG2 4RB3C 3LQQA 1JUSA 3CMAI 2E7XA 5CVVA 2X9DA 1VFCA 1ZGWA 1JTXA 2MGQA 2XGCA 1F9NA 2PJPA 4LG3A 3RSNA 3DEWA 4UVCA 3OYCA 4Y7NJ 2RHAA 4ZYHA 1Z9CA 2BHZA 4BJTA 2BVLA 3OS2A 2UV1A 3S3NA 2KIQA 4M72A 4Y33A 3IHUA 4IO9F 3JR9A 2R7TA 4OD5A 3O8HA 1RKTA 4HF2A 2XVCA 2EK5A 1TLHB 3ABTA 1YHQI 3D0SA 1R22A 2E1OA 3PM1A 4S04A 4P5OA 4JX5A 1YFHA 2VKEA 2H09A 2HVQA 2DK5A 4NB5A 3HZJA 2HXIA 2ZNYA 1EV7A 1TTYA 3JAMK 2DG8A 2I8DA 4IHVA 1USSA 1GUUA 3RZDJ 1ETQA 2NVUB 2KISA 3FMSA 3CLOA 4O6JA 2XF5A 1FBQA 4JKZA 2GIVA 2IPQX 3JRGA 3F72A 3JRBA 3W2AA 1TL8A 2GIZA 1ZGJA 2L2OA 3S1MJ 1V5EA 1F4KA 1OCOH 2MD5A 4HG2A 3BZ6A 2R7XA 3NAUA 2WWYA 3LSIA 3I58A 4FHTA 4CA0A 3NPIA 1QVUA 3U9GA 3G7RA 3G73A 2QKMB 3BCBA 3DU6A 2OTLI 5EFYA 3C3WA 1UMQA 2EBIA 4BS9A 1AKHA 4PJMA 3VW1A 5CYVA 3LA3A 5CJ9A 2D2WA 1IRXA 4WF2A 3OS0A 3CCQI 2ETHA 5KHDA 5JHUA 4HLYA 1HW2A 2LK2A 2ID3A 4IEJA 1YYVA 3O3KA 5H6RA 2DFIA 1JKQC 1JJ6C 5FLVA 2JZYA 4V2GA 4AIDA 1XG1A 2K40A 3GF2A 1SFEA 3G56A 1RC9A 3OYHA 4OAYA 5H9TA 1LDKB 3OYEA 1JT0A 4ZC3A 1U8BA 1HKTA 1W7PA 2F4IA 1S7OA 2E2JJ 2BE5F 2BY0A 4R8HA 3WTYC 2A68F 2ZCNA 1RI7A 3QWLA 2IT0A 2HKOA 1EH8A 3ZMDA 3JSOA 4AC6A 3ROUA 1XMKA 3S2WA 1GXPA 3S5RA 2Z1DA 3BJBA 1S6LA 4ZDOA 2L5QA 3C07A 2VE9A 2IP2A 3CUQA 5F64A 4B3AA 2R7DA 3DTIA 2ECBA 4EEFG 4PUSA 5E3LA 1T98A 2M30A 4K2EA 3MKWB 2LC2A 1DGRM 2QIBA 1HKQA 3MZHA 3H35A 5L3GA 2QA4I 4GDFA 3HKZA 1H9TA 4A0XA 3CCVI 5KAFC 2V57A 2ZY9A 2H1KA 5E17F 5FROA 2HYGD 1R1VA 2EFQA 3NWTA 4PSXA 5EG0A 1GV5A 3P9KA 4UUSA 2QTQA 3IUVA 1X1PA 4MQ9F 1OCRH 1RETA 2XAQA 4A0YA 3OL4A 3HTAA 3KIOA 2ZCWA 4HZFA 3TO9A 5BQTA 2QBYB 4A3BJ 2IS6A 2CU7A 4RGRA 1IXSB 2E35A 1BBYA 4KIGA 3ULQB 1QHHD 3MD2A 3H9GA 1TC3C 2KDOA 4XLHA 1ON1A 2MG4A 4IQ4A 3PNYA 1KQ0A 3K4JA 2YPRA 1G8XA 3DKXA 4OIOF 4NELA 1WI3A 4I02A 3RQ4A 2ISZA 1R7JA 3J7ZI 2ELHA 1REPC 3LWJA 3WGHA 2P5VA 2DW4A 3GO5A 5M5YJ 3V78A 4M71A 3JREA 1ETVA 5IYBJ 1N25A 4HX7A 3VW0A 2ZXHA 2IGOA 2IGKA 2NRAC 1ZN2A 2PMHA 1SFOJ 1LVAA 2ZJ2A 3UR3C 1V4RA 4KT6A 2Y2ZA 4WXDA 3LAJA 1ITYA 1UG0A 4CCNA 1QNTA 3WE3A 4IXAA 1TQMA 3I9V2 3WE2A 3BTJA 3ZP5A 1FOWA 3ABKH 3SEQA 2VQHA 2L7ZA 5HAWA 3I4PA 4BQOA 4IL6C 1JKPC 4KUMA 4OIRF 2B0LA 4M6YA 3HM5A 2GXAA 3HTJA 4F93B 1W36D 3KNWA 2GZWA 3WU0A 3L9FA 3OS1A 1IRGA 3W6JB 1VI0A 1YX3A 1PDNC 5A2QZ 3DPTA 1DDNA 1WJCA 2XDNA 5HS9A 1K7AA 1IUYA 2K4BA 3K69A 4QPQA 4C9YA 1K78B 1YS6A 5DS9A 2HZTA 3E3VA 4HBLA 2YVXA 2IAIA 2JK3A 2QWTA 1WVRA 1VF9A 3DTKA 4B43A 3PO3J 2HDWA 2QUFA 2ZMEC 5ICEA 3G1OA 5JLWA 2PMZN 3CUQB 2Z9OA 2EV5A 4KIFA 2DJNA 3I71A 1D0XA 5ERIA 2OI8A 2QQ8A 2PEXA 1P4AA 4BAYA 2DOEA 3MN2A 3GFIA 2DXIA 1C0WA 1HA8A 2GAUA 3F9KA 2Z2SB 3BDDA 3T1BA 3GTPJ 3L00A 4OOIA 2Q1ZB 4M9XA 2JUCA 5EG0B 3CD6I 3MEXA 1P92A 4BKXA 3WTUC 2B9SA 2QZ8A 4M9SA 1MSFC 1ACIA 5AQCA 2L4AA 1VQ4I 2MSYA 2Z16A 4HX8A 4IRGA 5D5WB 3HIFA 1OLTA 2Q0OA 1GVDA 2BY1A 3FRQA 3BLYA 4CCKA 3CC2I 2OD5A 4A3JJ 3RD3A 5F0FA 1G59A 1ODDA 1EH7A 2YX7A 5HS7A 3K70C 1E3PA 3A0BC 1S72I 2N8GA 4E7JA 1T08B 2ZJRF 2ACJA 1K83J 1JKOC 4G12A 2M8EA 1XGOA 3GBGA 1MMSA 2BEOA 3CDHA 1IV8A 1R00A 1U0JA 2CV2A 4EJWA 1RRJA 5LD2C 2NS7A 4XONA 2F4OB 3KZIC 1JT6A 3M07A 2CG4A 2VLAA 1NG6A 2VBWA 1Z67A 4IPAA 4IHTA 2OPTA 1OYYA 1Y56A 2X6XA 2JRTA 2E60A 4AIJA 4U7DA 2L7KA 1HW5A 4DBRA 1R71A 1TT0A 1BOAA 4OINF 5BPIA 2K3FA 2QYOA 4JK1X 4JYKA 4TV7A 4FX4A 2KJBA 4L5JA 2A07F 1FNNA 2KQRA 5CKTA 1MW7A 1MD0A 4AYBN 3PIPF 1Z0XA 2GENA 4HKUA 1BJAA 2AXLA 2MLKA 4XM3A 5D18A 5J40A 2EV0A 3H3UA 4QLCU 4QPOA 3SFZA 2VC0A 3JSJA 3A03A 1MMDA 3BHQA 4BXXJ 1B8IA 1I6XA 1P4WA 5FLXK 2F4MB 1B59A 3LNQA 1HW1A 3UKGA 5B66C 1I5ZA 2DBBA 3FIWA 5AIPA 4M73A 3X2QH 4KWAA 2CFXA 3MNLA 3OY9A 3HOZJ 2JVGA 3Q0VA 5LEJA 5LEKA 4UXNA 1I6HJ 1U5TB 1PYVA 2E2HJ 1MMNA 1WQ2A 5E8IA 1DP7P 4HQMA 2RC4A 3WODF 5HDGA 1FPQA 1XD7A 4CO8A 3QU6A 4BH9A 4EQQA 2J5PA 3LSHA 2Q24A 3AL0C 4PFPA 3RKYA 3VB2A 3JTHA 4G9YA 1RR8C 1DGWY 3F6OA 1IN6A 5LGNA 1YJWI 3CMYA 4UB6C 3GWZA 1FTZA 2DA3A 3ECHA 2A6EF 2XAGA 1UJ8A 4Q48A 4ESFA 3HGGA 2R4GA 1QBJA 2VB6A 2AHQA 3M8JA 3PQJA 2WGBA 1IAWA 2L9VA 3K7AJ 5FD6A 2TDXA 5DD4A 3RPUA 1FIPA 2XB5A 3DEUA 1RZ4A 4RS8A 3WU1B 4J19A 2HTSA 1IN4A 2FD5A 3CUQC 4GXOA 4M3EA 1ON2A 1TW2A 3S15J 4RB1A 5CVRA 5IP9J 3OYMA 2J5OA 2JT1A 5IOZA 4BUPA 3K4BA 2R3SA 2HS5A 3MKYB 1JKRC 1JUPA 4OIQF 1HQCA 3RPUD 2EWNA 2O7OA 2EA2A 5FLMJ 5C44J 1DU6A 3DPJA 2DFFA 4LGWA 1ZLKA 2D5VA 3VPRA 1MNEA 1SVMA 2LH9A 4EM0B 3D5LA 4PDKA 2Q2EB 1FBSA 4RLQA 1ETXA 5FKOA 3T8RA 5BS6A 1GHCA 3G2BA 3HOWJ 5LGTA 3SEZA 3FXLA 3KP4A 2D6YA 4L9JA 3WTVC 4FCYA 4CCLA 1EKEA 1Z6TA 2CMPA 1UHSA 3CC4I 4P9FA 1IC8A 3BTIA 5GTIC 2IXSA 3KKDA 1ZKGA 5D5VB 1MDMB 2GLOA 1WKMA 5HSZA 3CCRI 1Y1VJ 1IF1A 2FF4A 2O03A 1SFXA 4ZYEA 1E2XA 2O3FA 2DTRA 2JUGA 3C2GA 5E79C 2X6WA 2ZOYA 2EILH 1QRYA 2ISYA 2OV7A 1W36C 3VYUB 4PXIA 4DIQA 2G7HA 5LLQA 3OYAA 4E7KA 4NC6A 4G7ZF 1CF7A 5KK1A 4PJLA 2LLKA 3GFMA 2RQQA 5CVIA 3TW7A 2DA2A 5GADJ 2X1EA 1RIOH 2XF6A 3BR1A 3SZPA 2XPWA 2ZFWA 1FSHA 2QENA 1K6YA 3IC7A 1FP2A 3KLOA 3ERMA 1X1BA 4Q5SF 2DQLA 3ZPLA 2XGDA 4G6TB 3SHFA 2Y9YA 3DKYA 2JJ7A 2DYRH 5E1WA 1FT9A 1XGMA 4HSRA 4UNOA 5J47A 1FC3A 4N9HA 5L3EA 2CGPA 5JHFA 2M7AA 3ML6A 4AU7A 2LYCA 2Y75A 3C18A 2R7ZJ 4XL9A 3ZQCA 5JVTA 1LB2A 1TWAJ 3GZ6A 1J59A 2KP6A 3OR1C 2KRHA 3EPZA 3HUGB 4I76A 3GCMA 1R4MB 1PP7U 4HRIA 1V55H 3FHNA 2PBIA 4I0AA 3W2VA 1VTNC 3I4MJ 3ISPA 3HYIA 4FX0A 3IP4B 1HSTA 5GAEJ 3R61A 2WB1A 2DOFA 3VEPA 1Y39A 1IGNA 2HQRA 1Y0NA 4YFKF 1IXRC 4XOTA 4EGZA 4NC8A 3QOPA 3AG3H 3QP5A 2MD0A 3OYBA 4PSWA 1IZ1A 1I39A 3E5UA 2O9LA 5B1BH 3JAMZ 1WJDA 2M8GX 3J7AY 2LMDA 5C4YA 2FNAA 3V42A 4XLPF 2R0QC 3OYIA 3F3XA 2IEKA 5FB2A 1WRJA 1IV6A 3JRHA 3U1DA 4AUXA 4J01A 3MZYA 3GUDA 1K4SA 1J9IA 3MMYB 2DYSH 3H5AA 2P5KA 2L02A 3HSFA 1MGTA 3ZMTA 1MJ9A 2H1LA 2ZCMA 4QIWN 1U8RA 3JRAA 3CZ6A 3LJLA 2D1VA 1OYWA 3PQKA 2R5ZA 4E7LA 5D6EA 3I4NJ 3I55I 3O2PE 3D5SC 3L2RA 4EM1A 5E1ZB 2OQRA 4G94A 1QPMA 2JA8J 3Q5FA 5J3LA 2E5ZA 4FETA 3LWFA 2DDAA 4XICA 2GUHA 4G7HF 3GEUA 3KZZA 2Q8KA 1KU3A 3IRRA 5FKLA 1ZR4A 1U6GA 1HKSA 2W84A 3M8EA 9ANTA 1A36A 2ECCA 4BGDA 2NS8A 1FY7A 2VKDA 3T6NA 4KN4X 3ZQFA 3ELKA 2PX9A 3RQIA 2JSCA 5EDNA 2JA7J 1LDDA 2R5YB 4KMFA 2LY2A 4XKBA 2WV1A 2CH0A 2P6TA 1BIAA 4N4OB 1EF4A 4JX6A 2KJCA 1BA5A 3K4NA 3ZN1A 3BG9A 1Z1DA 1OKRA 4L0YB 1JGSA 2K9MA 3RH2A 4B1RA 3ANPA 2LF7A 1FTTA 1TT5B 5EEGA 3LAPA 3QYEA 1OMIA 4RGSA 1WH5A 4U88A 2LOOA 3CCUI 1E17A 1ZR2A 4DGWB 5KVRA 1W5TA 3F8BA 1XC5A 1BM9A 2PMUA 3GW2A 1H0MA 2YS9A 4LG0A 3WHBA 1O57A 4IHSA 4AIKA 4A69C 4Y13A 4FE4A 2UXUA 3QKXA 1K79A 2ZB9A 4NQWA 4XN3A 5F04A 3TO6A 3GTLJ 1MBHA 2W82A 2IS2A 2YR2A 1BI2A 1T6SA 1LEAA 2D1HA 3ZOBA 2CW8A 3K70D 1FMWA 4BE0A 2NXNB 3MFKA 1TQIA 4B44A 3BJ6A 5DUIA 3OSFA 1T56A 3ECOA 2COBA 5GP9A 5ILSA 4YZEA 4XKWA 3SZGA 1UFMA 4AIHA 2H94A 4DOZA 2XSJC 2X4HA 3OOUA 2FXAA 3M8FA 4RM2A 5C4XJ 3DBHB 5KAIC 2PJRA 3VWBA 2DO7A 2RKHA 1ZG5A 3R0JA 2LKPA 2UXXA 3K0LA 3WG7H 1GLNA 2CFOA 4KISA 2PZ9A 2ME6A 4I6ZA 3SWHA 1WJ5A 3K4CA 4YG2F 3HHHA 2CUZA 1L3LA 3WTWC 3JW4A 4Q47A 2IGNA 5HLGA 4QSHA 4A6DA 1J2XA 4IHXA 3ERED 2ZNZA 1YITI 3S93A 2RAEA 4CSWA 3VFZA 2CW7A 2HKXA 4C3JJ 3F23A 2HYTA 2K9SA 4OD4A 1XGSA 2H6BA 5HNFA 2DOAA 4B3XA 2L0KA 3RDIA 1H9GA 2A61A 1ZTRA 3I59A 4BHBA 2X6OA 1ZK8A 3M4OJ 2G7UA 2FBQA 2COMA 3E5XA 2H6CA 1UB9A 3V8LA 3BCAA 2X48A 1TWHJ 1D1CA 3CESA 5M3MJ 2RREA 1MMAA 2ZMEB 4XKVA 2MC3A 3I3LA 4AD9A 1LFBA 1SVLA 1VNDA 4B09A 3DFGA 1WFXA 3BZCA 2E5NA 1B72A 1X3ZB 1X19A 2ADUA 2FMLA 1Y6IA 4I2OA 2DT7B 3RI4A 2EFNA 1ZGAA 1JTYA 3FISA 3H5RA 3KP2A 3DCFA 3P9CA 4OAZA 2Y48A 3G71I 3NNRA 2JMWA 2QGUA 3RZOJ 3ZQHA 4DQ2A 5FD5A 5CVJA 4LIUA 3GFLA 4LLNA 5DCFA 4PK4A 2ICWG 2HPMA 2A6HF 4RM3A 1ETKA 4DZPA 2MH9A 2XRNA 4F92B 2X1CA 2XUBA 2ZC2A 2FMYA 1J7KA 1U9NA 2NAZA 1PJRA 4MNUA 2W1OA 5DM7F 1HBXG 4BDZA 1R5HA 3FXMA 2IVMA 3BT9A 1VQMI 2DFEA 3CJTB 4WCGA 4ENJA 1B9NA 2LD5A 1ZQ3P 3F8CA 2FSWA 3GTMJ 2OCEA 4PJNA 4MIMA 3GZ5A 4EGYA 2DT5A 1TWCJ 3FMQA 4LG0B 1QU3A 4EJUA 1MNMC 1NG7A 5J8FA 2F07A 1J5YA 3PFYA 1W7PD 3QQAA 3IKTA 2VKVA 2W57A 4IF4A 1QZYA 3BR5A 4IX7A 1O3SA 1S9HA 2VBYA 2QSGX 3BTLA 2WAQN 3VTIA 3B02A 3C2BA 2NNNA 4ESBA 1VQNI 1X58A 3M7GA 2A3SA 4ESJA 3JSPA 3FXJA 4CZZA 1S7AA 5F6FA 4LLGF 1AHDP 1QZZA 3SQNA 2E1CA 3ZMZA 2V1NA 2EQRA 2IW5A 3QAHA 5AONA 2A2FX 1G2HA 2RN7A 4J00A 4CH7A 4N9IA 3QYFA 4Y15A 2OUMA 2HOSA 3L09A 4C2UA 2C6YA 2O8KA 2XROA 3FM5A 4RBOA 4M3GA 1XCVA 1WWXA 4W97A 4D9JA 2GOMA 5F1RA 1TBXA 4M3BA 1XCBA 5J4VA 4JP0A 5EJCA 2HOTA 4U87A 2E71A 5H2FC 2GA2A 3CF2A 2RNGA 4M3DA 2DMTA 5D5XB 2JVHA 2BW3A 4YIFA 2DMQA 4LIVA 4YEJA 3J7YJ 3HRSA 3COAC 1D3YA 4ZZDA 1VQOI 1JUMA 2VJIA 4GCVA 2W48A 3V6GA 4EATA 2EJRA 2VT3A 3I59B 2QQ9A 3NI7A 4CGZA 1GDTA 4ICHA 3F8MA 2IBDA 5J1UA 3OYDA 3ABLH 3HG9A 4D0PA 5CPRB 2DA4A 1NK3P 4R79A 2XIGA 2GOXB 4ITVA 3PASA 3LQRA 3B81A 4GYIA 3OIPA 1JE8A 1MBEA 2JN6A 2Y9ZA 3FM3A 4FISA 5LFAA 5J1RA 4CYCA 2LG4A 3NS4A 3QPHA 5CQGA 1P4XA 1Z05A 5DCMA 1Z21A 1AKHB 3ZR8X 2B3WA 1XMXA 5IY5H 1WSUA 2LR8A 3EUHA 4L9NA 4A3GJ 3HBLA 4MHGA 3WU2C 3AL0B 3BROA 5D8KB 2KKOA 3H3VK 2L4MA 1ORKA 2AXTC 1B1BA 1JHFA 4N4NB 1LFPA 4MTDA 3JRIA 2STWA 4P9UA 1FJLA 4Y17A 2XAFA 1KZHA 1XS9A 5FLXZ 2HPIA 3P9IA 2LSOA 2JA5J 3CDIA 3FK6A 3TKYA 2ZJPF 2G7LA 3S2HJ 2M0MA 1W7PB 2Y0SN 2R7WA 5E1XA 1Y1WJ 1SEUA 1BR4A 4RLFA 3FHZA 3A2KA 3VSLA 4IOCF 2OTJI 2F6CA 3RKXA 3BR2A 3S1QJ 2WAFA 1D8KA 2FBHA 3WGGA 4LK1F 1MJBA 1MBKA 2IU5A 3OOPA 4ANJA 2CYYA 4M9ZA 2UXIA 2VPRA 1ZARA 2O61A 1BR2A 2EIKH 1ZH5A 5IOYA 4HDUA 2P8TA 4A6EA 4UDSA 1NH3A 3ASNH 4IQJA 1STZA 2V4JC 1USTA 2LKSA 1LNWA 1S29A 4HPQA 1AU7A 3TO7A 1YIJI 2Y30A 4P1WA 3NARA 4UUSB 2IA0A 2FEZA 3MKZA 2VI6A 2M7BA 3FXQA 3V7SA 2PG4A 2CRGA 2HYFA 1K6OA 1FYLA 2O7TA 1W4MA 4HNTA 2DTZA 2MA3A 3DTEA 1XDUA 4ABZA 4S05A 2EIMH 1WPKA 2BV6A 2E36A 2KIMA 2LY1A 2QKLB 4CCMA 2LBFA 2H8WA 5D4SA 3I0TA 2V9VA 2XAJA 1Z3XA 2ZO4A 3K9TA 3RKWA 3TGNA 2UXHA 5K5QA 1MH3A 2OCCH 1SMYF 4EJTA 1T95A 4DYQA 3WTSC 1SAUA 1IN8A 1UI6A 3QU3A 2EZHA 3BJAA 4RB0A 1D1AA 3VIBA 1XSVA 2FE3A 2F5FA 3PL8A 3PFIA 2W7NA 3DU5A 3H0DA 3T8TA 1TP4A 2MBFA 3IKVA 1R4NB 1SGMA 4ACIA 2DJIA 1VQ7I 1R58A 1MZBA 3QPLA 1UAAA 3B6AA 2WADA 2CQKA 3RYRA 2KL4A 3VVZA 4BE1A 5FRNA 3PSIA 1K4TA 3HC7A 2GQQA 4PJJA 2P81A 2M87A 3E7QA 2RV8A 5F0HA 4CYCB 3S32A 3CRJA 3A4CA 1D5YA 2V7FA 4HSTA 5F08A 2PFVA 2ESNA 1O7FA 1WJFA 4U0VA 1E3OC 1RUOA 2KMUA 2OC6A 5BMZA 4G6QA 1LJ9A 4MEXF 3I5UA 2UWMA 2XDVA 1D0ZA 3ZGKA 4U7BA 1QA6A 1NHAA 4LK0F 3PIOF 3TL4X 4G6DA 3I54A 1ZREA 4YFXF 3V4GA 2EA4A 2M34A 3KZ9A 5E3NA 2UXOA 3FXUA 4W1UA 4F3QA 3F8NA 2QKOA 2FRHA 3V8KA 2VQLA 2G7SA 3M3YJ 4XORA 2LVSA 4BQAA 1EA3A 1PVEA 2YU3A 3GLLA 2QCOA 3ZQGA 5ICGA 1FOXA 2Z5UA 3IH4A 3VVXA 4Y4RA 4E7SA 4NDLA 1IRZA 3OMYA 1PUFA 2K27A 5L3CA 1YTYA 4XRFA 3ZXSA 4A3EJ 2L9NA 4KMUX 4AWXB 4CYDA 4A3CJ 4L5EA 2A69F 3BC8A 1R23A 1SANA 2L54A 2E2IJ 5EGOA 1TWFJ 3R0AA 3H92A 3A1YA 2V6EA 2CQNA 3I53A 2DMNA 3R6SA 2ZXIA 4MTEA 4CDGA 3FMRA 3NQOA 2K9LA 4DVYP 4P96A 5LHGA 4HX4A 2CO5A 3HGYA 2OQGA 3K8PC 5FKNA 5H6QA 2HQNA 4MFEA 4CCOA 4NNJA 5E3MA 1T0FA 2DMPA 2L7MP 1VQPI 3BG5A 4UB8C 2LBFB 3TQNA 2JWTA 3LMMA 2I10A 3LSKA 2P5LC 4HNUA 3DWLE 2VJ4A 5BNGA 3FZVA 3Q9VA 4I09A 3KKCA 1DP3A 3HOUJ 1YG2A 2K9QA 4GRIA 2FNPA 3GTJJ 4HEA2 1VQ6I 3S14J 2JQ7A 2FBIA 3CCMI 2WA0A 2V1XA 5FGMA 2Z33A 1FYMA 2VOOA 1JGGA 1F1ZA 2EPFA 3BQZA 3CQZJ 2VXDA 1ZG3A 3J80K 2HXOA 5DD8A 2BOLA 1XDSA 3AG1H 2M4GA 1YRNA 4A93J 1LKXA 3F0CA 1R5GA 1X1DA 2JPCA 3EYYA 1YE9A 1R9TJ 5IT9K 3OYNA 4GFKA 2CW0F 4CZCA 3Q9SA 2FBKA 1HXDA 2ZFUA 4UUTA 1ZYRF 4ENKA 1W1WE 4D7MA 2LP0A 3A01A 3BP8A 3S3MA 4HF0A 3DBLB 2OZ6A 2XV4S 4C2TA 3GVAA 4EV0A 2PMZA 3R60A 2OERA 2HOAA 4E7IA 2OJED 1HDPA 4WXHA 3ABUA 5ICCA 5AIQA 2CWEA 1P6RA 1MBGA 1UELB 4GO1A 4CXFA 2P7VB 5KCMA 2KLOA 1YX5A 3FX3A 3FXKA 4MLOA 4MXMA 1E3HA 1B8IB 2M45A 3F22A 2QOPA 4ZYGA 5FKKA 5D6FA 3FBIB 2FJ1A 1Z6RA 2IA2A 3EUKL 4WK8F 3SXYA 3CO6C 2B7EA 3LA2A 4F7ZA 1ONVA 5EZGA 3IAM2 5TJJA 2M2EA 2VBXA 4HOBA 1T8IA 5JVGF 4F55A 1FOKA 3QRFF 2DA5A 2R7RA 2KRCA 1SVOA 4JOMA 1OCTC 1W5CC 4BE2A 4KA4A 1PUFB 2CQXA 2QWWA 2FU4A 1F5TA 4DNCA 1OYIA 3VYRB 1X1AA 2FOKA 5J6XA 1DU0A 4C3IJ 4XSXF 1BI1A 3H36A 4LFUA 3HXLA 4H4KC 4KIBA 5CW8A 4JL3A 2OF7A 3P5JA 2XGXA 1XGNA 4AVZA 2DMUA 2HNHA 4E4HA 4LLLA 2XC7A 2WY8Q 1H89C 2O8XA 4NBQA 2P6SA 3W2WA 5B5EC 1S5LC 3DPUA 2L9RA 3VW2A 3U1KA 2GBYA 3VVYA 1XN7A 3MWMA 1FX7A 2OA4A 2DLLA 2WBMA 5K5RA 3O6BB 1LE8A 2CS3A 3A0HC 2ZSHB 4E70A 3TW6A 2JSPA 1TQPA 1O7LA 3S17J 4OU0A 4A3DJ 2GM4A 3G4SI 2G0EA 2BBYA 2HVRA 1ZLJA 4UHTA 3KE2A 4B47A 4HNVA 1GXQA 5ICFA 3FKJA 1YW8A 4HA8A 2V9KA 2P0WA 4XMYA 3F21A 2EB7A 4GYGA 3QYBA 5M3FJ 4ZDPA 3WG9A 2HZDA 5CXGA 1MBFA 1OPCA 4L62A 1KA8A 4U0WA 2HEOA 2KRFA 2LY9A 3E97A 5ILUA 1UI5A 3HOSA 3VP5A 4AYBA 3ZRGA 3HTHA 1MJAA 3H0GJ 1U3EM 2ELJA 3ON2A 2MW8A 4NC7A 4PCQA 2YU9J 4HAMA 1HDDC 5E8GA 4ZDLA 1YO5C 5DM6F 3EETA 1OCZH 3BNIA 2KPMA 3OIOA 4UVBA 3FDYA 1FWZA 3E1SA 1V5FA 2YVEA 4AVPA 4A3KJ 3J7AO 3JRFA 4DW6A 2EZLA 3U2RA 1LPQA 3HKZN 3WGIA 1BW5A 1R36A 5JFRA 3DKWA 5D8LB 2PQ8A 3HIMA 2KFDA 2UUZA 1UG2A 3A01B 4R1HA 2R93J 1ZRCA 2EZIA 3WTTC 2VODA 2EZKA 2CJJA 3GLXA 2FQ3A 5IP6A 1OJLA 3BG6A 4E7HA 5D4RA 1ZELA 3CCJI 1L0OC 3BR3A 1BW6A 3HDDA 4AC0A 4A0ZA 3IAS2 4B4CA 2NX4A 3MZ8A 1FSEA 5DUKA 4F52A 4C2MJ 3B73A 1VQ9I 2LNBA 1TNTA 2DAOA 4JNNA 4WIBA 4FTHA 1S3JA 4GGGA 3JRCA 2KHMA 3HTSB 3BPVA 4M74A 1U78A 2Y31A 1CF7B 2HYJA 3GTOJ 2HOEA 3BQYA 2K02A 3L2UA 1W0UA 2LDUA 3LL7A 4XQFA 1X3WB 4Z6YA 4Y52J 2X85A 2XASA 3NWSA 3VSKA 2DA6A 2QF7A 3J81K 2CQQA 1WJEA 2NP5A 1EJ9A 2M3AA 2Z3YA 3LFUA 3GTGJ 2DG7A 2VIXA 5GPAA 3I56I 2PI0A 5K58A 1O3QA 3IL2A 1ZG1A 2IGMA 3H3ZA 3C2HA 3CDLA 3ANGA 2Y69H 4IZZA 1D8JA 1LDJA 4G7OF 2V6CA 2KIUA 4E7ZA 4ZJZA 1ZRFA 2BZTA 2DT6A 2X1DA 1WHUA 3CTAA 4ZTFA 3ON4A 2EINH 3KYCB 4DYRA 3Q3SA 1S7EA 1B9MA 5K7HA 2PLYA 4BJ6C 3HJEA 4BNCA 1A6IA 1I1GA 1TZLA 1X2MA 1MNDA 1XSXA 2AQEA 5E20A 3V8JA 3OYLA 3W6KB 4CHUA 4BACA 1HLVA 3KYDB 3OR2C 5B1AH 4X1EA 2P7CB 1T39A 2MLGA 2RGVA 1BI0A 1V5GA 3FKIJ 3W3CA 3OYGA 5ED4A 4I99C 4M6VA 1N75A 1BJZA 2LTPA 3KEQA 3GZNB 4FQGA 3CCLI 2QQBA 2MFZA 3OIQA 5K5OA 2X51A 1SD4A 3E0JB 3AFHA 3U21A 3GX4X 4PFOA 1TW3A 1V3FA 2QBYA 1IDZA 2K85A 2NVTJ 1A04A 2P4WA 4U0YA 2FJI1 1TNSA 1X4PA 3CCSI 2HR3A 3ESWB 3EUAA 3NRGA 3VOKA 1F43A 4A3MJ 4G8XA 2R5ZB 4OIPF 1P7JA 4GCTA 1FBUA 4FT8A 5FKMA 1DPUA 3SJMA 3MKLA 1OR7A 1T0FC 1KU9A 4HQEA 2EH3A 2DK8A 4IJAA 4M3FA 2WC2A 3QOEA 1RR7A 1A6QA 3H9QA 2K3PA 3K2ZA 2LKXA 3M9AA 5HS8A 6PAXA 3FXRA 4LMYA 4RGUA 4JX4A 4I01A 4XN0A 1HC8A 1KYWA 1QPIA 3HTIA 3GZIA 3ZQ7A 1JHHA 3HRTA 3PUFA 1I1SA 1GVJA 4DJAA 1ENHA 4XNFA 2STTA 3MAJA 1LFUP 3EGQA 2VN2A 4BJ5C 3L1PA 4L0ZB 4B48A 2V79A 5DV5A 5D19A 4XLCA 4BBRJ 2IJLA 2BVMA 3L2QA 4GFBA 5EZHA 2ZBKA 4II3A 3ABMH 3CJRB 2LF8A 5LHIA 1FMVA 3LSMA 3C1DA 3IWZA 3KX2A 3WTXC 4AM3A 4AF5A 4UV8A 2NOGA 2JTVA 2E1MB 4A5NA 5FMPA 1O3RA 2ZJQF 4RB2C 3AKZA 2W53A 3BJOA 3N05A 2R7FA 5M5WJ 2XGEA 2A05A 3F6VA 1K78A 1Z7LA 3LSGA 2VUMJ 4NQWB 4XLEA 3KPHA 4EJOA 4GFLA 1UCRA 3E5QA 4JBAA 1Z77A 3GEZA 3SDBA 3K1PA 3BR6A 3C7JA 3FBNB 3KP7A 3LSJA 5DEQA 3HL2A 2H27A 4HLXA 4KFCA 1VZ0A 1JI8A 2QSHX 4XR6A 3SYTA 1HOMA 3E6CC 4BEHA 4XRSG 3CP8A 4B8XA 3TEDA 2HFHA 2NNYA 2L7FP 3PJRA 2EFOA 1U2WA 1BN5A 4XLFA 4F91B 4BBSJ 4IKFA 3CMEI 4ZZLA 2PJRB 4KYWA 1VQ8I 4I0BA 2VOPA 1R49A 2EFWA 2ZXWH 2NYXA 2Z99A 4HV6A 2IS1A 2R92J 3PUBA 2UXNA 1Z7UA 3GYHX 2HDCA 4XOPA 4DYCA 1HSJA 1SAXA 1R1TA 4L18B 4V19K 2M5WA 2KT0A 2ELKA 2DCEA 2DODA 2XKPA 2RQPA 3IRQA 4A2UA 3FXOA 3T0YA 3E6MA 2XRLA 3ZCOA 5C4JJ 2HI3A 3ASOH 2CUEA 1SD5A 2A5WA 5JR3A 4D5CA 4Q4ZF 1JJ8C 5CQEA 5LRSA 4FASD 3NRVA 1WI9A 1YI2I 2KZGA 4XRSA 3SDGA 2PBXA 2IS4A 3LSPA 1IO2A 4O5VA 2VC1A 3CJQB 3VODA 5B3SH 5CVUA 4UY8I 4CCJA 4XLAA 1DUXC 1RUNA 3S16J 2BHYA 2M4KA 3BG7A 4D5FA 1GT0C 1FIAA 2HU9A 1LQ1A 1AOYA 4YIIA 1B72B 3GXOA 1DPRA 5GAHJ 1H8AC 3BWGA 4PZJA 4UVAA 4RAFA 5TGTA 5EEAA 3DV8A 2F5EA 2LFBA 2VKHA 3GTQJ 1WJAA 2QQAA 3KYLA 2NVYJ 1BC8C 2V26A 5DYMA 3PNVA 2M1BA 1U9OA 2AO9A 2NOJB 2LRDA 2FA5A 1X2NA 2K5CA 3KEOA 1WH7A 5HVQC 4ON0A 2MC4A 2EV6A 1W0TA 5KNLA 3S8PA 2VBZA 1FOYA 1FYKA 1XSDA 2HGCA 3BG3A 3REOA 2K7LA 2B63J 3AAFA 1YLFA 3HSRA 5TISC 1KQ8A 3JRDA 2VXZA 3V7CA 4BXFA 4N0BA 1Y8QB 3LSTA 1MSEC 4U9LA 2E19A 3TP0A 1I3QJ 2ZCXA 3BZKA 4PGGA 2XKOA 1MH4A 4XKCA 3RTRA 3RPQA 1LEBA 3OV8A 5JI6A 3AG2H 2O6GE 2X0LA 2R7VA 1ERDA 4RAZA 3G1LA 3WTZA 5IYCJ 1IW7F 1BR1A 2H8RA 1ULYA 3DLLF 3GMEA 3IH2A 1U5TA 2HDDA 5FJ8J 4C30A 4BEHB 3IWFA 4RGXA 2LREA 3HEFA 3VDXA 2W25A 1J09A 4YELA 3TDUC 1FLIA 1S8NA 1Z91A 1BC7C 3VUQA 3L7WA 5HLHA 3BCGA 2VL8A 1AWCA 2JPBA 2GXGA 4ZYDA 2L01A 1YJNI 4ZH4F 1WGXA 3P9TA 2KDZA 4WX9A 1BI3A 2R7OA 1A31A 2MH2A 2CV0A 4I98B 1BOBA 1SD7A 1RESA 2E1MC 2L9SA 3HOVJ 3ZMSA 1WCMJ 3OYJA 3L2CA 3TBIA 2BW3B 3BPXA 5LGUA 1ETWA 4MEYF 2DDBA 4BL0B 1O4XA 3CMMA 1E0EA 1MIJA 1Y0UA 2NVQJ 3RIRA 1IRFA 4YIRX 3KLNA 1WZ2A 4ME9A 2RASA 2K9NA 3IV5A 1P2FA 3TOBA 3HRMA 1O3TA 4BQNA 3FK7A 3K4MA 3J80Z 4IHWA 3ZQQA 4BY1J 4V2FA 4XSZF 3ZQLA 4ZYAA 2V1DA 3E6BA 3FF5A 4EVIA 5IT9Z 1R6RA 1VQ5I 3KP5A 4YRVA 1XB4A 2OBPA 1G3TA 2XSDC 5DCMB 4RMNA 5K1YA 3K6GA 4KJZA 4PGHA 3VOEA 1XTAA 3RYPA 5JLXA 3AQTA 2BY2A 1QHGA 1OCPA 5IT3A 3HSEA 1OFCX 2WB1N 3D1NI 1KU7A 4RDUA 4A3LJ 4KICA 2PN6A 3UNGC 4NHJA 5EF6A 2IRFG 1NTCA 2XAHA 2XB0X 2XPUA 3BOQA 2V9PA 1KGSA 4CUGA 2Q2EA 1T33A 5E18F 3ZMVA 2CSOA 1G4DA 1FZPB 2ZSIB 2M0CA 1SC7A 3HHGA 4D1QA 2YVHA 1IG7A 2WAQA 1KQ9A 1Q1VA 3LOCA 2QEXI 2BYVE 4IHYA 5F0CA 2ZXJA 2UZKA 3CCEI 2DA1A 4IRVA 3TP3A 2QLZA 3JTGA 2VONA 3LFKA 2VQCA 3EDPA 2I5UA 2OZUA 1OR7C 2W4SA 3HPGA 4RA2A 3DQVC 1BIBA 2WV0A 1MDMA 4UV9A 1QZEA 2E34A 3MCZA 3W6VA 4JQFA 2ZKZA 3KP6A 4OMYA 1JXSA 1N78A 1YOVB 2MABA 3IH3A 3M1CA 4D7NA 4HF1A 4U9NA 1J0RA 5GPCA 5A2QK 1T2KA 2HWVA 2BXYA 4A3FJ 3DP7A 3RCOA 1SMTA 2GA1A 4BYYA 5FO5A 5LRRA 1HCRA 3O60A 5DDGA 4BHCA 3HOXJ 4LB6B 2OU2A 5LHHA 3MQ0A 1I27A 4CICA 4Y3OA 4XK4A 2W24A 4HYEA 5J1YA 2CUJA 4IOAF 1FEXA 4X6AJ 3OSGA 3DPLC 1CGPA 4QTRA 4C2MA 2F5VA 2W85A 4M6XA 2A5YB 4ENNA 1NK2P 5H20A 3OYKA 4OMZA 3AG4H 1B6AA 2O5RA 3P7NA 1CQTA 1A35A 5GTHC 3BRUA 4LB5A 2RDPA 1PUEE 1YW7A 3CJNA 2VT2A 3CC7I 2L3DA 4I7HA 2R7SA 4DZJA 2JRMA 3DXJF 2DN0A 5HODA 1R5ID 3GFJA 3ONQA 3B6CA 2VJ5A 3K1NA 2VASA 4IRIA 2REKA 2YSRA 4ASNA 2BY3A 2CUFA 4BDYA 3EYIA 3NXCA 2KZVA 3AQSA 3HUGA 3QPSA 5HLIA 4BXUA 2F2EA 2VPLA 3V7RA 1B4AA 5CXIA 3CCYA 1P9QC 2E1NA 3HPHA 5M5XJ 4MFDA 3G6EI 2TCTA 4IVNA 1IN7A 1IUFA 1M1EB 3HTUA 1UHWA 4XLNF 2WTEA 5IP7J 5L3FA 3F1BA 1UHMA 4BQQA 3RKQA 3DF8A 3S1RJ 3COLA 1R1UA 4LD5A 2NP3A 1QQIA 2EIJH 4GCKA 3S3OA 1ZAOA 1W5SA 3S2DJ 2Y0SA 1D5VA 2HQAA 3ZQIA 1PP8F 1P7IA 3KCCA 3N4MA 1RNLA 1VQKI 5IYDJ 3Q0UA 4KDPA 4KN7X 1YW9A 3PSFA 1EH6A 3OYFA 5EYRA 2E7WA 2W00A 2HQ5A 3K4KA 1J75A 5C3EJ 3CUOA 5DAJA 1TWGJ 1XX5A 3H9JA 3BTCA 2EFPA 4H0EA 5FFZA 5HOOA 5IPAA 2K4JA 2ME0A 5F27A 2YUSA 5TRDA 2XF7A 3DBRB 3JCUC 1ZHFA 4PJ0C 1RKWA 5CLSA 4II2A
chains in the Genus database with same CATH topology
1JT6A 3CRJA 5K7ZA 2HOSA 3CDLA 2O8KA 4RBOA 4M3GA 4BY7J 3ANGA 4W97A 2DA7A 2OPTA 4M3BA 4JP0A 2HOTA 3ON4A 4M3DA 2DMTA 4DYRA 3Q3SA 1S7EA 1F36A 2DMQA 4JYKA 5K7HA 1GV2A 1ETYA 1JUMA 1QVTA 1A6IA 2W48A 2R5YA 2FX0A 1X2MA 3HOYJ 3V6GA 5EGOB 4AYBN 4FE7A 3HE0A 1Z0XA 2GENA 4HKUA 4GCLA 1HLVA 3Q0WA 3NI7A 5E3OA 1GDTA 4ICHA 5D18A 2IBDA 5J1UA 5HBUA 4X1EA 3QBMA 2DA4A 3FKIJ 3JSJA 1NK3P 3A03A 4M6VA 3PASA 1BJZA 2LTPA 4BXXJ 3B81A 3BHQA 1B8IA 4XRMA 1MBEA 2JN6A 2Y9ZA 4FISA 5J1RA 4CYCA 3LNQA 3UKGA 1AKHB 5F1JA 1IDZA 2NVTJ 3LSRA 3FIWA 2M9HA 3WHCA 2LR8A 4A3GJ 3HBLA 4KWAA 3MNLA 3HOZJ 3Q0VA 3H3VK 1IDYA 1I6HJ 2GFNA 3NRGA 3VOKA 1F43A 4A3MJ 2E2HJ 1RPWA 2R5ZB 1ORKA 1P7JA 1BL0A 2NVXJ 5FHPA 4GCTA 5FKMA 3JRIA 3SJMA 3BR0A 3MKLA 3E7LA 1FJLA 2EH3A 1XS9A 3S1NJ 3EUPA 4M3FA 4A3IJ 2JA5J 3FK6A 2G7LA 2UXPA 1RR7A 3S2HJ 1APLC 2Q24A 2Y0SN 1Y1WJ 5FGLA 2LKXA 2JA6J 4LOCA 4JX4A 3BR2A 3CMYA 3S1QJ 1FTZA 2WUIA 2DA3A 3K2AA 1QPIA 3HTIA 3GZIA 1YRNB 2ZOZA 5K7FA 2G7GA 3PO2J 3PPBA 1MBKA 2IU5A 1A5JA 3HGGA 1ENHA 1I50J 1LFUP 2VPRA 2UXIA 4MK6A 2AHQA 3EGQA 2WGBA 4CGRA 5IOYA 4S0HB 3K7AJ 3L1PA 4UDSA 3MVPA 1FIPA 2XB5A 5D19A 4BBRJ 4J19A 4GFBA 5EZHA 2HKUA 2ID6A 2FD5A 1AU7A 2Y30A 1K61A 4M3EA 4AF5A 3NARA 4UUSB 3S15J 2NOGA 2VI6A 5IP9J 2O7TA 5FMPA 1POGA 2CRGA 4NN1A 3SFIA 5IOZA 3HB9A 2W53A 2DTZA 2G3BA 5M5WJ 2XGEA 4ABZA 1JKRC 1JUPA 1WPKA 3LSGA 2O7OA 5FLMJ 5C44J 1DU6A 1IJWC 2XPVA 2VUMJ 1HF0A 4XIDA 3DPJA 4GFLA 2D5VA 1Z77A 3G1MA 1MBJA 2UXHA 3BR6A 3VPRA 3CJDA 3LSJA 1MH3A 2TRTA 1H88C 3A02A 1ETOA 1HOMA 1ETXA 5FKOA 4XRSG 4DYQA 3HOWJ 3O8GA 1UI6A 2EZHA 3TEDA 2D6YA 3VIBA 4MO7A 2L7FP 5D1RA 2FQ4A 4FCYA 4BBSJ 1UHSA 4C3HJ 1SGMA 4ACIA 1IC8A 3GTKJ 3BTIA 3QPLA 5DTDA 3B6AA 3VVZA 3KKDA 1ZKGA 3VOXA 3CWRA 2GLOA 1LE8B 3LHQA 5HSZA 1Y1VJ 2R92J 2P81A 1JUSA 4DYCA 3E7QA 5F0HA 4CYCB 2X9DA 1VFCA 1ZGWA 2KT0A 1JTXA 1D5YA 2ZOYA 2MGQA 1QRYA 2ELKA 2XGCA 4PXIA 3DEWA 4Y7NJ 2RHAA 2LLKA 3TW7A 5F08A 2DA2A 2XRLA 3BR1A 5C4JJ 2HI3A 2CUEA 2XPWA 4D5CA 1JJ8C 1E3OC 4XRSA 3SDGA 3JR9A 2PBXA 3LSPA 2XGDA 3O8HA 1RKTA 2Y9YA 3S16J 2JJ7A 2M34A 3KZ9A 4D5FA 5E3NA 2UXOA 4W1UA 1FIAA 1GT0C 2E1OA 2QKOA 2G7SA 3PM1A 1B72B 3M3YJ 1H8AC 2R7ZJ 4JX5A 3ZQCA 2VKEA 5EEAA 2LVSA 2LFBA 3GTQJ 1TWAJ 2HXIA 2QCOA 3ZQGA 2DG8A 2NVYJ 3IH4A 3VVXA 4I76A 4NDLA 4IHVA 1PUFA 1IRZA 1U9OA 2AO9A 1GUUA 3RZDJ 1ETQA 1X2NA 4A3EJ 1WH7A 3I4MJ 4A3CJ 1W0TA 4L5EA 1IGNA 4JKZA 1SANA 3BG3A 3JRGA 2E2IJ 5EGOA 1TWFJ 3JRBA 2B63J 2DMNA 2O9LA 3S1MJ 2M8GX 3JRDA 4JL3A 3NAUA 5C4YA 2R0QC 3HGYA 1MSEC 3NPIA 2IEKA 1IV6A 2E19A 5FKNA 1QVUA 3JRHA 3G7RA 3TP0A 1I3QJ 2ZCXA 4MFEA 1MH4A 5E3MA 4AUXA 5EFYA 2DMPA 2L7MP 1UMQA 2EBIA 3BG5A 1AKHA 3VW1A 2JWTA 5IYCJ 3G1LA 2I10A 2ZCMA 2H8RA 4QIWN 3IH2A 3JRAA 5BNGA 3LJLA 2LK2A 2ID3A 4IEJA 2HDDA 1JKQC 1JJ6C 2R5ZA 5FLVA 5FJ8J 4V2GA 3KKCA 1XG1A 2K40A 3HOUJ 3I4NJ 3HEFA 2K9QA 3G56A 3GTJJ 3S14J 2JA8J 3VUQA 3BCGA 5H9TA 5J3LA 1JT0A 5K58A 4XICA 1U8BA 3GEUA 2GUHA 1JGGA 1WGXA 2E2JJ 2ZCNA 3P9TA 2KDZA 3CQZJ 3BQZA 5FKLA 1ZR4A 1RESA 9ANTA 3HOVJ 2HXOA 4AC6A 3S5RA 2ECCA 3BJBA 2NS8A 1WCMJ 1YRNA 4A93J 3F0CA 3T6NA 3ZQFA 1R9TJ 3C07A 4GFKA 1ETWA 3RQIA 4B3AA 2ECBA 5EDNA 4EEFG 1O4XA 2JA7J 4UUTA 5E3LA 2R5YB 4D7MA 2LP0A 3A01A 2NVQJ 2WV1A 2QIBA 4ME9A 1EF4A 4JX6A 1BA5A 2RASA 2K9NA 3IV5A 2OERA 2HOAA 3BG9A 1HDPA 2V57A 3RH2A 4B1RA 1MBGA 2H1KA 3FK7A 4IHWA 3ANPA 4BY1J 1FTTA 5EG0A 4V2FA 3ZQLA 4MLOA 4MXMA 1GV5A 4UUSA 1WH5A 1B8IB 2QOPA 2QTQA 3IUVA 1ZR2A 5FKKA 1RETA 2FJ1A 1XC5A 3HTAA 2YS9A 2XSDC 3WHBA 5EZGA 4A3BJ 2CU7A 4A69C 2M2EA 5JLXA 3AQTA 4FE4A 2UXUA 3QKXA 2ZB9A 1TC3C 1OCPA 2DA5A 5F04A 1OFCX 2WB1N 3D1NI 3GTLJ 1MBHA 2MG4A 4RDUA 4A3LJ 1OCTC 5EF6A 1PUFB 2CQXA 1NTCA 2XB0X 2XPUA 3ZOBA 1WI3A 4NELA 1T33A 3LWJA 1DU0A 4C3IJ 3OSFA 2M0CA 5M5YJ 3V78A 5CW8A 2YVHA 1T56A 5GP9A 2COBA 2OF7A 3JREA 1IG7A 1ETVA 4YZEA 1Q1VA 2DMUA 3LOCA 5IYBJ 4IHYA 3VW0A 3OOUA 5F0CA 2DA1A 1H89C 3TP3A 5C4XJ 1SFOJ 2L9RA 3VW2A 2GBYA 3VVYA 2Y2ZA 1ITYA 2PZ9A 1LE8A 3W6VA 2ME6A 4I6ZA 3TW6A 3S17J 3BTJA 4A3DJ 3IH3A 4D7NA 2GM4A 5GPCA 4QSHA 4IHXA 2G0EA 2L7ZA 5HAWA 4A3FJ 2RAEA 2HYTA 4HNVA 4C3JJ 1JKPC 2K9SA 1HCRA 3O60A 3HM5A 3HOXJ 2L0KA 1ZTRA 3HTJA 4XK4A 2X6OA 5J1YA 1ZK8A 5M3FJ 3M4OJ 5CXGA 3KNWA 1MBFA 1FEXA 4L62A 2FBQA 4X6AJ 3OSGA 4QTRA 2LY9A 1VI0A 2X48A 1TWHJ 1NK2P 5M3MJ 1UI5A 3VP5A 3HTHA 3H0GJ 2XDNA 1CQTA 2MW8A 3ON2A 2YU9J 3BRUA 1HDDC 1LFBA 1VNDA 5DS9A 4DZJA 3BNIA 1B72A 3OIOA 2IAIA 2DN0A 5HODA 2JK3A 2QWTA 3B6CA 2YVEA 1VF9A 4A3KJ 3PO3J 2REKA 3JRFA 4DW6A 2EZLA 1JTYA 2CUFA 3NXCA 3FISA 3G1OA 3QPSA 2PMZN 3DCFA 5JLWA 3AQSA 3HKZN 2DJNA 2JMWA 3RZOJ 1BW5A 3HIMA 3ZQHA 2OI8A 3NNRA 3A01B 1UG2A 5CXIA 2R93J 2EZIA 3CCYA 3MN2A 5M5XJ 4MFDA 2EZKA 2CJJA 1ETKA 2TCTA 1IUFA 4DZPA 5IP6A 1OJLA 5IP7J 3F1BA 3GTPJ 3RKQA 3BR3A 3S1RJ 1BW6A 3HDDA 1U9NA 3COLA 4AC0A 5EG0B 2NP3A 4B4CA 4BKXA 2NX4A 4GCKA 3BT9A 4C2MJ 3S2DJ 1MSFC 2LD5A 4JNNA 5AQCA 1ZQ3P 3ZQIA 4FTHA 3GTMJ 2MSYA 4MIMA 3JRCA 1P7IA 5IYDJ 1TWCJ 3Q0UA 1MNMC 1U78A 2Y31A 2F07A 2HYJA 1GVDA 3GTOJ 3QQAA 3FRQA 5EYRA 3BQYA 2VKVA 2HQ5A 3BR5A 4A3JJ 1W0UA 5F0FA 3RD3A 4Y52J 5C3EJ 3BTLA 2WAQN 5DAJA 1TWGJ 2DA6A 2QF7A 3C2BA 2N8GA 3BTCA 1K83J 1JKOC 1X58A 2CQQA 4G12A 2NP5A 5IPAA 3GBGA 2ME0A 5F27A 3GTGJ 2YUSA 1AHDP 2DG7A 2EQRA 5GPAA 2NS7A 1RKWA 1G2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT6 A;  3CRJ A;  5K7Z A;  2HOS A;  3CDL A;  2O8K A;  4RBO A;  4M3G A;  4BY7 J;  3ANG A;  4W97 A;  2DA7 A;  2OPT A;  4M3B A;  4JP0 A;  2HOT A;  3ON4 A;  4M3D A;  2DMT A;  4DYR A;  3Q3S A;  1S7E A;  1F36 A;  2DMQ A;  4JYK A;  5K7H A;  1GV2 A;  1ETY A;  1JUM A;  1QVT A;  1A6I A;  2W48 A;  2R5Y A;  2FX0 A;  1X2M A;  3HOY J;  3V6G A;  5EGO B;  4AYB N;  4FE7 A;  3HE0 A;  1Z0X A;  2GEN A;  4HKU A;  4GCL A;  1HLV A;  3Q0W A;  3NI7 A;  5E3O A;  1GDT A;  4ICH A;  5D18 A;  2IBD A;  5J1U A;  5HBU A;  4X1E A;  3QBM A;  2DA4 A;  3FKI J;  3JSJ A;  1NK3 P;  3A03 A;  4M6V A;  3PAS A;  1BJZ A;  2LTP A;  4BXX J;  3B81 A;  3BHQ A;  1B8I A;  4XRM A;  1MBE A;  2JN6 A;  2Y9Z A;  4FIS A;  5J1R A;  4CYC A;  3LNQ A;  3UKG A;  1AKH B;  5F1J A;  1IDZ A;  2NVT J;  3LSR A;  3FIW A;  2M9H A;  3WHC A;  2LR8 A;  4A3G J;  3HBL A;  4KWA A;  3MNL A;  3HOZ J;  3Q0V A;  3H3V K;  1IDY A;  1I6H J;  2GFN A;  3NRG A;  3VOK A;  1F43 A;  4A3M J;  2E2H J;  1RPW A;  2R5Z B;  1ORK A;  1P7J A;  1BL0 A;  2NVX J;  5FHP A;  4GCT A;  5FKM A;  3JRI A;  3SJM A;  3BR0 A;  3MKL A;  3E7L A;  1FJL A;  2EH3 A;  1XS9 A;  3S1N J;  3EUP A;  4M3F A;  4A3I J;  2JA5 J;  3FK6 A;  2G7L A;  2UXP A;  1RR7 A;  3S2H J;  1APL C;  2Q24 A;  2Y0S N;  1Y1W J;  5FGL A;  2LKX A;  2JA6 J;  4LOC A;  4JX4 A;  3BR2 A;  3CMY A;  3S1Q J;  1FTZ A;  2WUI A;  2DA3 A;  3K2A A;  1QPI A;  3HTI A;  3GZI A;  1YRN B;  2ZOZ A;  5K7F A;  2G7G A;  3PO2 J;  3PPB A;  1MBK A;  2IU5 A;  1A5J A;  3HGG A;  1ENH A;  1I50 J;  1LFU P;  2VPR A;  2UXI A;  4MK6 A;  2AHQ A;  3EGQ A;  2WGB A;  4CGR A;  5IOY A;  4S0H B;  3K7A J;  3L1P A;  4UDS A;  3MVP A;  1FIP A;  2XB5 A;  5D19 A;  4BBR J;  4J19 A;  4GFB A;  5EZH A;  2HKU A;  2ID6 A;  2FD5 A;  1AU7 A;  2Y30 A;  1K61 A;  4M3E A;  4AF5 A;  3NAR A;  4UUS B;  3S15 J;  2NOG A;  2VI6 A;  5IP9 J;  2O7T A;  5FMP A;  1POG A;  2CRG A;  4NN1 A;  3SFI A;  5IOZ A;  3HB9 A;  2W53 A;  2DTZ A;  2G3B A;  5M5W J;  2XGE A;  4ABZ A;  1JKR C;  1JUP A;  1WPK A;  3LSG A;  2O7O A;  5FLM J;  5C44 J;  1DU6 A;  1IJW C;  2XPV A;  2VUM J;  1HF0 A;  4XID A;  3DPJ A;  4GFL A;  2D5V A;  1Z77 A;  3G1M A;  1MBJ A;  2UXH A;  3BR6 A;  3VPR A;  3CJD A;  3LSJ A;  1MH3 A;  2TRT A;  1H88 C;  3A02 A;  1ETO A;  1HOM A;  1ETX A;  5FKO A;  4XRS G;  4DYQ A;  3HOW J;  3O8G A;  1UI6 A;  2EZH A;  3TED A;  2D6Y A;  3VIB A;  4MO7 A;  2L7F P;  5D1R A;  2FQ4 A;  4FCY A;  4BBS J;  1UHS A;  4C3H J;  1SGM A;  4ACI A;  1IC8 A;  3GTK J;  3BTI A;  3QPL A;  5DTD A;  3B6A A;  3VVZ A;  3KKD A;  1ZKG A;  3VOX A;  3CWR A;  2GLO A;  1LE8 B;  3LHQ A;  5HSZ A;  1Y1V J;  2R92 J;  2P81 A;  1JUS A;  4DYC A;  3E7Q A;  5F0H A;  4CYC B;  2X9D A;  1VFC A;  1ZGW A;  2KT0 A;  1JTX A;  1D5Y A;  2ZOY A;  2MGQ A;  1QRY A;  2ELK A;  2XGC A;  4PXI A;  3DEW A;  4Y7N J;  2RHA A;  2LLK A;  3TW7 A;  5F08 A;  2DA2 A;  2XRL A;  3BR1 A;  5C4J J;  2HI3 A;  2CUE A;  2XPW A;  4D5C A;  1JJ8 C;  1E3O C;  4XRS A;  3SDG A;  3JR9 A;  2PBX A;  3LSP A;  2XGD A;  3O8H A;  1RKT A;  2Y9Y A;  3S16 J;  2JJ7 A;  2M34 A;  3KZ9 A;  4D5F A;  5E3N A;  2UXO A;  4W1U A;  1FIA A;  1GT0 C;  2E1O A;  2QKO A;  2G7S A;  3PM1 A;  1B72 B;  3M3Y J;  1H8A C;  2R7Z J;  4JX5 A;  3ZQC A;  2VKE A;  5EEA A;  2LVS A;  2LFB A;  3GTQ J;  1TWA J;  2HXI A;  2QCO A;  3ZQG A;  2DG8 A;  2NVY J;  3IH4 A;  3VVX A;  4I76 A;  4NDL A;  4IHV A;  1PUF A;  1IRZ A;  1U9O A;  2AO9 A;  1GUU A;  3RZD J;  1ETQ A;  1X2N A;  4A3E J;  1WH7 A;  3I4M J;  4A3C J;  1W0T A;  4L5E A;  1IGN A;  4JKZ A;  1SAN A;  3BG3 A;  3JRG A;  2E2I J;  5EGO A;  1TWF J;  3JRB A;  2B63 J;  2DMN A;  2O9L A;  3S1M J;  2M8G X;  3JRD A;  4JL3 A;  3NAU A;  5C4Y A;  2R0Q C;  3HGY A;  1MSE C;  3NPI A;  2IEK A;  1IV6 A;  2E19 A;  5FKN A;  1QVU A;  3JRH A;  3G7R A;  3TP0 A;  1I3Q J;  2ZCX A;  4MFE A;  1MH4 A;  5E3M A;  4AUX A;  5EFY A;  2DMP A;  2L7M P;  1UMQ A;  2EBI A;  3BG5 A;  1AKH A;  3VW1 A;  2JWT A;  5IYC J;  3G1L A;  2I10 A;  2ZCM A;  2H8R A;  4QIW N;  3IH2 A;  3JRA A;  5BNG A;  3LJL A;  2LK2 A;  2ID3 A;  4IEJ A;  2HDD A;  1JKQ C;  1JJ6 C;  2R5Z A;  5FLV A;  5FJ8 J;  4V2G A;  3KKC A;  1XG1 A;  2K40 A;  3HOU J;  3I4N J;  3HEF A;  2K9Q A;  3G56 A;  3GTJ J;  3S14 J;  2JA8 J;  3VUQ A;  3BCG A;  5H9T A;  5J3L A;  1JT0 A;  5K58 A;  4XIC A;  1U8B A;  3GEU A;  2GUH A;  1JGG A;  1WGX A;  2E2J J;  2ZCN A;  3P9T A;  2KDZ A;  3CQZ J;  3BQZ A;  5FKL A;  1ZR4 A;  1RES A;  9ANT A;  3HOV J;  2HXO A;  4AC6 A;  3S5R A;  2ECC A;  3BJB A;  2NS8 A;  1WCM J;  1YRN A;  4A93 J;  3F0C A;  3T6N A;  3ZQF A;  1R9T J;  3C07 A;  4GFK A;  1ETW A;  3RQI A;  4B3A A;  2ECB A;  5EDN A;  4EEF G;  1O4X A;  2JA7 J;  4UUT A;  5E3L A;  2R5Y B;  4D7M A;  2LP0 A;  3A01 A;  2NVQ J;  2WV1 A;  2QIB A;  4ME9 A;  1EF4 A;  4JX6 A;  1BA5 A;  2RAS A;  2K9N A;  3IV5 A;  2OER A;  2HOA A;  3BG9 A;  1HDP A;  2V57 A;  3RH2 A;  4B1R A;  1MBG A;  2H1K A;  3FK7 A;  4IHW A;  3ANP A;  4BY1 J;  1FTT A;  5EG0 A;  4V2F A;  3ZQL A;  4MLO A;  4MXM A;  1GV5 A;  4UUS A;  1WH5 A;  1B8I B;  2QOP A;  2QTQ A;  3IUV A;  1ZR2 A;  5FKK A;  1RET A;  2FJ1 A;  1XC5 A;  3HTA A;  2YS9 A;  2XSD C;  3WHB A;  5EZG A;  4A3B J;  2CU7 A;  4A69 C;  2M2E A;  5JLX A;  3AQT A;  4FE4 A;  2UXU A;  3QKX A;  2ZB9 A;  1TC3 C;  1OCP A;  2DA5 A;  5F04 A;  1OFC X;  2WB1 N;  3D1N I;  3GTL J;  1MBH A;  2MG4 A;  4RDU A;  4A3L J;  1OCT C;  5EF6 A;  1PUF B;  2CQX A;  1NTC A;  2XB0 X;  2XPU A;  3ZOB A;  1WI3 A;  4NEL A;  1T33 A;  3LWJ A;  1DU0 A;  4C3I J;  3OSF A;  2M0C A;  5M5Y J;  3V78 A;  5CW8 A;  2YVH A;  1T56 A;  5GP9 A;  2COB A;  2OF7 A;  3JRE A;  1IG7 A;  1ETV A;  4YZE A;  1Q1V A;  2DMU A;  3LOC A;  5IYB J;  4IHY A;  3VW0 A;  3OOU A;  5F0C A;  2DA1 A;  1H89 C;  3TP3 A;  5C4X J;  1SFO J;  2L9R A;  3VW2 A;  2GBY A;  3VVY A;  2Y2Z A;  1ITY A;  2PZ9 A;  1LE8 A;  3W6V A;  2ME6 A;  4I6Z A;  3TW6 A;  3S17 J;  3BTJ A;  4A3D J;  3IH3 A;  4D7N A;  2GM4 A;  5GPC A;  4QSH A;  4IHX A;  2G0E A;  2L7Z A;  5HAW A;  4A3F J;  2RAE A;  2HYT A;  4HNV A;  4C3J J;  1JKP C;  2K9S A;  1HCR A;  3O60 A;  3HM5 A;  3HOX J;  2L0K A;  1ZTR A;  3HTJ A;  4XK4 A;  2X6O A;  5J1Y A;  1ZK8 A;  5M3F J;  3M4O J;  5CXG A;  3KNW A;  1MBF A;  1FEX A;  4L62 A;  2FBQ A;  4X6A J;  3OSG A;  4QTR A;  2LY9 A;  1VI0 A;  2X48 A;  1TWH J;  1NK2 P;  5M3M J;  1UI5 A;  3VP5 A;  3HTH A;  3H0G J;  2XDN A;  1CQT A;  2MW8 A;  3ON2 A;  2YU9 J;  3BRU A;  1HDD C;  1LFB A;  1VND A;  5DS9 A;  4DZJ A;  3BNI A;  1B72 A;  3OIO A;  2IAI A;  2DN0 A;  5HOD A;  2JK3 A;  2QWT A;  3B6C A;  2YVE A;  1VF9 A;  4A3K J;  3PO3 J;  2REK A;  3JRF A;  4DW6 A;  2EZL A;  1JTY A;  2CUF A;  3NXC A;  3FIS A;  3G1O A;  3QPS A;  2PMZ N;  3DCF A;  5JLW A;  3AQS A;  3HKZ N;  2DJN A;  2JMW A;  3RZO J;  1BW5 A;  3HIM A;  3ZQH A;  2OI8 A;  3NNR A;  3A01 B;  1UG2 A;  5CXI A;  2R93 J;  2EZI A;  3CCY A;  3MN2 A;  5M5X J;  4MFD A;  2EZK A;  2CJJ A;  1ETK A;  2TCT A;  1IUF A;  4DZP A;  5IP6 A;  1OJL A;  5IP7 J;  3F1B A;  3GTP J;  3RKQ A;  3BR3 A;  3S1R J;  1BW6 A;  3HDD A;  1U9N A;  3COL A;  4AC0 A;  5EG0 B;  2NP3 A;  4B4C A;  4BKX A;  2NX4 A;  4GCK A;  3BT9 A;  4C2M J;  3S2D J;  1MSF C;  2LD5 A;  4JNN A;  5AQC A;  1ZQ3 P;  3ZQI A;  4FTH A;  3GTM J;  2MSY A;  4MIM A;  3JRC A;  1P7I A;  5IYD J;  1TWC J;  3Q0U A;  1MNM C;  1U78 A;  2Y31 A;  2F07 A;  2HYJ A;  1GVD A;  3GTO J;  3QQA A;  3FRQ A;  5EYR A;  3BQY A;  2VKV A;  2HQ5 A;  3BR5 A;  4A3J J;  1W0U A;  5F0F A;  3RD3 A;  4Y52 J;  5C3E J;  3BTL A;  2WAQ N;  5DAJ A;  1TWG J;  2DA6 A;  2QF7 A;  3C2B A;  2N8G A;  3BTC A;  1K83 J;  1JKO C;  1X58 A;  2CQQ A;  4G12 A;  2NP5 A;  5IPA A;  3GBG A;  2ME0 A;  5F27 A;  3GTG J;  2YUS A;  1AHD P;  2DG7 A;  2EQR A;  5GPA A;  2NS7 A;  1RKW A;  1G2H A; 
#chains in the Genus database with same CATH topology
 5J8C A;  3E6D A;  2AS5 F;  1YIO A;  3CLQ A;  5K7Z A;  3DLA A;  2R7Q A;  2V1U A;  4BY7 J;  2GXB A;  2DA7 A;  4MGR A;  1OQY A;  3QPT A;  5LBQ A;  4EJV A;  3OWT A;  4L5I A;  4NUB A;  2F5D A;  2CV1 A;  3D5R C;  4RAG A;  3J81 Z;  3F8F A;  2CQ7 A;  5HDN A;  2YX4 A;  4HV5 A;  2Y0M A;  3K10 A;  1F36 A;  3KP3 A;  4KNY A;  1Q1H A;  3R4K A;  2DI3 A;  1G3S A;  3EUH C;  1AA7 A;  2HVS A;  1GV2 A;  1QO0 D;  1ETY A;  1QVT A;  2R5Y A;  5HLT A;  1G3W A;  2FX0 A;  3HOY J;  2DPD A;  1Z3Y A;  5EGO B;  2HTJ A;  2FOW A;  4FE7 A;  3TDZ C;  3HE0 A;  1LUJ B;  5FRM A;  4GCL A;  3Q0W A;  1YQA A;  4IRH A;  5E3O A;  2F5C A;  5GAG J;  3KET A;  1KU2 A;  1V54 H;  4XBF A;  5HBU A;  1N77 A;  3DEE A;  1OIS A;  4KT5 C;  4OWR B;  3QBM A;  1YS7 A;  2IA1 A;  2R7U A;  4XRM A;  5L3D A;  3ZMU A;  2OAZ A;  3LA7 A;  2G9W A;  1IXC A;  2ESH A;  3H1C A;  5F1J A;  4A12 A;  4LIT A;  1MMG A;  3LSR A;  4UUV A;  2M9H A;  3WHC A;  5L3B A;  2D45 A;  1FP1 D;  2DU9 A;  1IN5 A;  4EM2 A;  4P55 A;  1IDY A;  3N97 A;  2GFN A;  2QVO A;  3VYS B;  1RPW A;  5D5U B;  4KIT B;  1BL0 A;  1YJ9 I;  2WAE A;  2NVX J;  5FHP A;  5BPD A;  3BR0 A;  2DFH A;  4ETS A;  4EMS A;  3E7L A;  4ZTJ A;  2A6T A;  4QWQ A;  2MYS A;  5J4Y A;  3S1N J;  3EUP A;  4A3I J;  2UXP A;  1G6N A;  3TMO A;  2PFB A;  5HNH A;  1APL C;  3FWE A;  3BY6 A;  5EEH A;  5FGL A;  1U5T C;  3NEU A;  2JA6 J;  4WXC A;  3L2W A;  1SFK A;  2K86 A;  4LOC A;  2XHK A;  3IUO A;  1UZC A;  4RAY A;  1T38 A;  1Y8R B;  3TOA A;  4BHP A;  2WUI A;  1KON A;  4Z2Y A;  3K2A A;  3QP6 A;  1YRN B;  5K7F A;  2ZOZ A;  2F48 A;  3PO2 J;  2B1E A;  2G7G A;  3PPB A;  3I64 A;  1A5J A;  1XPX A;  4L9V A;  1X4O A;  1SD6 A;  2DQR A;  5HDK A;  1I50 J;  3CF5 F;  4MK6 A;  4WWC A;  2GWR A;  4CGR A;  4O3M A;  1KYZ A;  4S0H B;  5FFX A;  1LVK A;  3MVP A;  1WJB A;  3SZT A;  3L2V A;  2AQF A;  3CO7 C;  3G3Z A;  1G3Y A;  3VYT B;  2HKU A;  4LJZ F;  2ID6 A;  2QSF X;  4X0G A;  1XMA A;  2VQG A;  3ZN0 A;  1K61 A;  4E6K G;  2RNJ A;  1MKM A;  3PNT A;  3M1E A;  1OCC H;  3HOT A;  2BGC A;  4YFN F;  2JA2 A;  1POG A;  3CP2 A;  4NN1 A;  3EQL F;  3K4L A;  3SFI A;  3HB9 A;  2ZME A;  2G3B A;  1ZRD A;  4HW0 A;  2QM3 A;  1IJW C;  2XPV A;  2DPU A;  1HF0 A;  4XID A;  4L9T A;  1DQU A;  2BXZ A;  1SFU A;  5ILV A;  3G1M A;  1MBJ A;  4MQV A;  3CJD A;  2VJJ A;  1X3U A;  1D0Y A;  4ENM A;  3HRU A;  2TRT A;  4A5M A;  3A02 A;  1ETO A;  3RJP A;  1H88 C;  3K1M A;  3KEY A;  3O8G A;  2KIF A;  2O0Y A;  2RVC A;  4MO7 A;  1VQL I;  2FQ4 A;  5D1R A;  2VE8 A;  2WY7 Q;  1QGP A;  3KZY A;  2NS0 A;  4C3H J;  1X1C A;  3QOD A;  3GTK J;  5DTD A;  4DBQ A;  4BU2 A;  1I3A A;  2XAU A;  3VOX A;  3OL3 A;  3CWR A;  5BOX A;  3KFW X;  3H5N A;  1LE8 B;  2X6Y A;  3T5X A;  3LHQ A;  1D1B A;  4HDV A;  2FUG 2;  4RB3 C;  3LQQ A;  1JUS A;  3CMA I;  2E7X A;  5CVV A;  2X9D A;  1VFC A;  1ZGW A;  1JTX A;  2MGQ A;  2XGC A;  1F9N A;  2PJP A;  4LG3 A;  3RSN A;  3DEW A;  4UVC A;  3OYC A;  4Y7N J;  2RHA A;  4ZYH A;  1Z9C A;  2BHZ A;  4BJT A;  2BVL A;  3OS2 A;  2UV1 A;  3S3N A;  2KIQ A;  4M72 A;  4Y33 A;  3IHU A;  4IO9 F;  3JR9 A;  2R7T A;  4OD5 A;  3O8H A;  1RKT A;  4HF2 A;  2XVC A;  2EK5 A;  1TLH B;  3ABT A;  1YHQ I;  3D0S A;  1R22 A;  2E1O A;  3PM1 A;  4S04 A;  4P5O A;  4JX5 A;  1YFH A;  2VKE A;  2H09 A;  2HVQ A;  2DK5 A;  4NB5 A;  3HZJ A;  2HXI A;  2ZNY A;  1EV7 A;  1TTY A;  3JAM K;  2DG8 A;  2I8D A;  4IHV A;  1USS A;  1GUU A;  3RZD J;  1ETQ A;  2NVU B;  2KIS A;  3FMS A;  3CLO A;  4O6J A;  2XF5 A;  1FBQ A;  4JKZ A;  2GIV A;  2IPQ X;  3JRG A;  3F72 A;  3JRB A;  3W2A A;  1TL8 A;  2GIZ A;  1ZGJ A;  2L2O A;  3S1M J;  1V5E A;  1F4K A;  1OCO H;  2MD5 A;  4HG2 A;  3BZ6 A;  2R7X A;  3NAU A;  2WWY A;  3LSI A;  3I58 A;  4FHT A;  4CA0 A;  3NPI A;  1QVU A;  3U9G A;  3G7R A;  3G73 A;  2QKM B;  3BCB A;  3DU6 A;  2OTL I;  5EFY A;  3C3W A;  1UMQ A;  2EBI A;  4BS9 A;  1AKH A;  4PJM A;  3VW1 A;  5CYV A;  3LA3 A;  5CJ9 A;  2D2W A;  1IRX A;  4WF2 A;  3OS0 A;  3CCQ I;  2ETH A;  5KHD A;  5JHU A;  4HLY A;  1HW2 A;  2LK2 A;  2ID3 A;  4IEJ A;  1YYV A;  3O3K A;  5H6R A;  2DFI A;  1JKQ C;  1JJ6 C;  5FLV A;  2JZY A;  4V2G A;  4AID A;  1XG1 A;  2K40 A;  3GF2 A;  1SFE A;  3G56 A;  1RC9 A;  3OYH A;  4OAY A;  5H9T A;  1LDK B;  3OYE A;  1JT0 A;  4ZC3 A;  1U8B A;  1HKT A;  1W7P A;  2F4I A;  1S7O A;  2E2J J;  2BE5 F;  2BY0 A;  4R8H A;  3WTY C;  2A68 F;  2ZCN A;  1RI7 A;  3QWL A;  2IT0 A;  2HKO A;  1EH8 A;  3ZMD A;  3JSO A;  4AC6 A;  3ROU A;  1XMK A;  3S2W A;  1GXP A;  3S5R A;  2Z1D A;  3BJB A;  1S6L A;  4ZDO A;  2L5Q A;  3C07 A;  2VE9 A;  2IP2 A;  3CUQ A;  5F64 A;  4B3A A;  2R7D A;  3DTI A;  2ECB A;  4EEF G;  4PUS A;  5E3L A;  1T98 A;  2M30 A;  4K2E A;  3MKW B;  2LC2 A;  1DGR M;  2QIB A;  1HKQ A;  3MZH A;  3H35 A;  5L3G A;  2QA4 I;  4GDF A;  3HKZ A;  1H9T A;  4A0X A;  3CCV I;  5KAF C;  2V57 A;  2ZY9 A;  2H1K A;  5E17 F;  5FRO A;  2HYG D;  1R1V A;  2EFQ A;  3NWT A;  4PSX A;  5EG0 A;  1GV5 A;  3P9K A;  4UUS A;  2QTQ A;  3IUV A;  1X1P A;  4MQ9 F;  1OCR H;  1RET A;  2XAQ A;  4A0Y A;  3OL4 A;  3HTA A;  3KIO A;  2ZCW A;  4HZF A;  3TO9 A;  5BQT A;  2QBY B;  4A3B J;  2IS6 A;  2CU7 A;  4RGR A;  1IXS B;  2E35 A;  1BBY A;  4KIG A;  3ULQ B;  1QHH D;  3MD2 A;  3H9G A;  1TC3 C;  2KDO A;  4XLH A;  1ON1 A;  2MG4 A;  4IQ4 A;  3PNY A;  1KQ0 A;  3K4J A;  2YPR A;  1G8X A;  3DKX A;  4OIO F;  4NEL A;  1WI3 A;  4I02 A;  3RQ4 A;  2ISZ A;  1R7J A;  3J7Z I;  2ELH A;  1REP C;  3LWJ A;  3WGH A;  2P5V A;  2DW4 A;  3GO5 A;  5M5Y J;  3V78 A;  4M71 A;  3JRE A;  1ETV A;  5IYB J;  1N25 A;  4HX7 A;  3VW0 A;  2ZXH A;  2IGO A;  2IGK A;  2NRA C;  1ZN2 A;  2PMH A;  1SFO J;  1LVA A;  2ZJ2 A;  3UR3 C;  1V4R A;  4KT6 A;  2Y2Z A;  4WXD A;  3LAJ A;  1ITY A;  1UG0 A;  4CCN A;  1QNT A;  3WE3 A;  4IXA A;  1TQM A;  3I9V 2;  3WE2 A;  3BTJ A;  3ZP5 A;  1FOW A;  3ABK H;  3SEQ A;  2VQH A;  2L7Z A;  5HAW A;  3I4P A;  4BQO A;  4IL6 C;  1JKP C;  4KUM A;  4OIR F;  2B0L A;  4M6Y A;  3HM5 A;  2GXA A;  3HTJ A;  4F93 B;  1W36 D;  3KNW A;  2GZW A;  3WU0 A;  3L9F A;  3OS1 A;  1IRG A;  3W6J B;  1VI0 A;  1YX3 A;  1PDN C;  5A2Q Z;  3DPT A;  1DDN A;  1WJC A;  2XDN A;  5HS9 A;  1K7A A;  1IUY A;  2K4B A;  3K69 A;  4QPQ A;  4C9Y A;  1K78 B;  1YS6 A;  5DS9 A;  2HZT A;  3E3V A;  4HBL A;  2YVX A;  2IAI A;  2JK3 A;  2QWT A;  1WVR A;  1VF9 A;  3DTK A;  4B43 A;  3PO3 J;  2HDW A;  2QUF A;  2ZME C;  5ICE A;  3G1O A;  5JLW A;  2PMZ N;  3CUQ B;  2Z9O A;  2EV5 A;  4KIF A;  2DJN A;  3I71 A;  1D0X A;  5ERI A;  2OI8 A;  2QQ8 A;  2PEX A;  1P4A A;  4BAY A;  2DOE A;  3MN2 A;  3GFI A;  2DXI A;  1C0W A;  1HA8 A;  2GAU A;  3F9K A;  2Z2S B;  3BDD A;  3T1B A;  3GTP J;  3L00 A;  4OOI A;  2Q1Z B;  4M9X A;  2JUC A;  5EG0 B;  3CD6 I;  3MEX A;  1P92 A;  4BKX A;  3WTU C;  2B9S A;  2QZ8 A;  4M9S A;  1MSF C;  1ACI A;  5AQC A;  2L4A A;  1VQ4 I;  2MSY A;  2Z16 A;  4HX8 A;  4IRG A;  5D5W B;  3HIF A;  1OLT A;  2Q0O A;  1GVD A;  2BY1 A;  3FRQ A;  3BLY A;  4CCK A;  3CC2 I;  2OD5 A;  4A3J J;  3RD3 A;  5F0F A;  1G59 A;  1ODD A;  1EH7 A;  2YX7 A;  5HS7 A;  3K70 C;  1E3P A;  3A0B C;  1S72 I;  2N8G A;  4E7J A;  1T08 B;  2ZJR F;  2ACJ A;  1K83 J;  1JKO C;  4G12 A;  2M8E A;  1XGO A;  3GBG A;  1MMS A;  2BEO A;  3CDH A;  1IV8 A;  1R00 A;  1U0J A;  2CV2 A;  4EJW A;  1RRJ A;  5LD2 C;  2NS7 A;  4XON A;  2F4O B;  3KZI C;  1JT6 A;  3M07 A;  2CG4 A;  2VLA A;  1NG6 A;  2VBW A;  1Z67 A;  4IPA A;  4IHT A;  2OPT A;  1OYY A;  1Y56 A;  2X6X A;  2JRT A;  2E60 A;  4AIJ A;  4U7D A;  2L7K A;  1HW5 A;  4DBR A;  1R71 A;  1TT0 A;  1BOA A;  4OIN F;  5BPI A;  2K3F A;  2QYO A;  4JK1 X;  4JYK A;  4TV7 A;  4FX4 A;  2KJB A;  4L5J A;  2A07 F;  1FNN A;  2KQR A;  5CKT A;  1MW7 A;  1MD0 A;  4AYB N;  3PIP F;  1Z0X A;  2GEN A;  4HKU A;  1BJA A;  2AXL A;  2MLK A;  4XM3 A;  5D18 A;  5J40 A;  2EV0 A;  3H3U A;  4QLC U;  4QPO A;  3SFZ A;  2VC0 A;  3JSJ A;  3A03 A;  1MMD A;  3BHQ A;  4BXX J;  1B8I A;  1I6X A;  1P4W A;  5FLX K;  2F4M B;  1B59 A;  3LNQ A;  1HW1 A;  3UKG A;  5B66 C;  1I5Z A;  2DBB A;  3FIW A;  5AIP A;  4M73 A;  3X2Q H;  4KWA A;  2CFX A;  3MNL A;  3OY9 A;  3HOZ J;  2JVG A;  3Q0V A;  5LEJ A;  5LEK A;  4UXN A;  1I6H J;  1U5T B;  1PYV A;  2E2H J;  1MMN A;  1WQ2 A;  5E8I A;  1DP7 P;  4HQM A;  2RC4 A;  3WOD F;  5HDG A;  1FPQ A;  1XD7 A;  4CO8 A;  3QU6 A;  4BH9 A;  4EQQ A;  2J5P A;  3LSH A;  2Q24 A;  3AL0 C;  4PFP A;  3RKY A;  3VB2 A;  3JTH A;  4G9Y A;  1RR8 C;  1DGW Y;  3F6O A;  1IN6 A;  5LGN A;  1YJW I;  3CMY A;  4UB6 C;  3GWZ A;  1FTZ A;  2DA3 A;  3ECH A;  2A6E F;  2XAG A;  1UJ8 A;  4Q48 A;  4ESF A;  3HGG A;  2R4G A;  1QBJ A;  2VB6 A;  2AHQ A;  3M8J A;  3PQJ A;  2WGB A;  1IAW A;  2L9V A;  3K7A J;  5FD6 A;  2TDX A;  5DD4 A;  3RPU A;  1FIP A;  2XB5 A;  3DEU A;  1RZ4 A;  4RS8 A;  3WU1 B;  4J19 A;  2HTS A;  1IN4 A;  2FD5 A;  3CUQ C;  4GXO A;  4M3E A;  1ON2 A;  1TW2 A;  3S15 J;  4RB1 A;  5CVR A;  5IP9 J;  3OYM A;  2J5O A;  2JT1 A;  5IOZ A;  4BUP A;  3K4B A;  2R3S A;  2HS5 A;  3MKY B;  1JKR C;  1JUP A;  4OIQ F;  1HQC A;  3RPU D;  2EWN A;  2O7O A;  2EA2 A;  5FLM J;  5C44 J;  1DU6 A;  3DPJ A;  2DFF A;  4LGW A;  1ZLK A;  2D5V A;  3VPR A;  1MNE A;  1SVM A;  2LH9 A;  4EM0 B;  3D5L A;  4PDK A;  2Q2E B;  1FBS A;  4RLQ A;  1ETX A;  5FKO A;  3T8R A;  5BS6 A;  1GHC A;  3G2B A;  3HOW J;  5LGT A;  3SEZ A;  3FXL A;  3KP4 A;  2D6Y A;  4L9J A;  3WTV C;  4FCY A;  4CCL A;  1EKE A;  1Z6T A;  2CMP A;  1UHS A;  3CC4 I;  4P9F A;  1IC8 A;  3BTI A;  5GTI C;  2IXS A;  3KKD A;  1ZKG A;  5D5V B;  1MDM B;  2GLO A;  1WKM A;  5HSZ A;  3CCR I;  1Y1V J;  1IF1 A;  2FF4 A;  2O03 A;  1SFX A;  4ZYE A;  1E2X A;  2O3F A;  2DTR A;  2JUG A;  3C2G A;  5E79 C;  2X6W A;  2ZOY A;  2EIL H;  1QRY A;  2ISY A;  2OV7 A;  1W36 C;  3VYU B;  4PXI A;  4DIQ A;  2G7H A;  5LLQ A;  3OYA A;  4E7K A;  4NC6 A;  4G7Z F;  1CF7 A;  5KK1 A;  4PJL A;  2LLK A;  3GFM A;  2RQQ A;  5CVI A;  3TW7 A;  2DA2 A;  5GAD J;  2X1E A;  1RIO H;  2XF6 A;  3BR1 A;  3SZP A;  2XPW A;  2ZFW A;  1FSH A;  2QEN A;  1K6Y A;  3IC7 A;  1FP2 A;  3KLO A;  3ERM A;  1X1B A;  4Q5S F;  2DQL A;  3ZPL A;  2XGD A;  4G6T B;  3SHF A;  2Y9Y A;  3DKY A;  2JJ7 A;  2DYR H;  5E1W A;  1FT9 A;  1XGM A;  4HSR A;  4UNO A;  5J47 A;  1FC3 A;  4N9H A;  5L3E A;  2CGP A;  5JHF A;  2M7A A;  3ML6 A;  4AU7 A;  2LYC A;  2Y75 A;  3C18 A;  2R7Z J;  4XL9 A;  3ZQC A;  5JVT A;  1LB2 A;  1TWA J;  3GZ6 A;  1J59 A;  2KP6 A;  3OR1 C;  2KRH A;  3EPZ A;  3HUG B;  4I76 A;  3GCM A;  1R4M B;  1PP7 U;  4HRI A;  1V55 H;  3FHN A;  2PBI A;  4I0A A;  3W2V A;  1VTN C;  3I4M J;  3ISP A;  3HYI A;  4FX0 A;  3IP4 B;  1HST A;  5GAE J;  3R61 A;  2WB1 A;  2DOF A;  3VEP A;  1Y39 A;  1IGN A;  2HQR A;  1Y0N A;  4YFK F;  1IXR C;  4XOT A;  4EGZ A;  4NC8 A;  3QOP A;  3AG3 H;  3QP5 A;  2MD0 A;  3OYB A;  4PSW A;  1IZ1 A;  1I39 A;  3E5U A;  2O9L A;  5B1B H;  3JAM Z;  1WJD A;  2M8G X;  3J7A Y;  2LMD A;  5C4Y A;  2FNA A;  3V42 A;  4XLP F;  2R0Q C;  3OYI A;  3F3X A;  2IEK A;  5FB2 A;  1WRJ A;  1IV6 A;  3JRH A;  3U1D A;  4AUX A;  4J01 A;  3MZY A;  3GUD A;  1K4S A;  1J9I A;  3MMY B;  2DYS H;  3H5A A;  2P5K A;  2L02 A;  3HSF A;  1MGT A;  3ZMT A;  1MJ9 A;  2H1L A;  2ZCM A;  4QIW N;  1U8R A;  3JRA A;  3CZ6 A;  3LJL A;  2D1V A;  1OYW A;  3PQK A;  2R5Z A;  4E7L A;  5D6E A;  3I4N J;  3I55 I;  3O2P E;  3D5S C;  3L2R A;  4EM1 A;  5E1Z B;  2OQR A;  4G94 A;  1QPM A;  2JA8 J;  3Q5F A;  5J3L A;  2E5Z A;  4FET A;  3LWF A;  2DDA A;  4XIC A;  2GUH A;  4G7H F;  3GEU A;  3KZZ A;  2Q8K A;  1KU3 A;  3IRR A;  5FKL A;  1ZR4 A;  1U6G A;  1HKS A;  2W84 A;  3M8E A;  9ANT A;  1A36 A;  2ECC A;  4BGD A;  2NS8 A;  1FY7 A;  2VKD A;  3T6N A;  4KN4 X;  3ZQF A;  3ELK A;  2PX9 A;  3RQI A;  2JSC A;  5EDN A;  2JA7 J;  1LDD A;  2R5Y B;  4KMF A;  2LY2 A;  4XKB A;  2WV1 A;  2CH0 A;  2P6T A;  1BIA A;  4N4O B;  1EF4 A;  4JX6 A;  2KJC A;  1BA5 A;  3K4N A;  3ZN1 A;  3BG9 A;  1Z1D A;  1OKR A;  4L0Y B;  1JGS A;  2K9M A;  3RH2 A;  4B1R A;  3ANP A;  2LF7 A;  1FTT A;  1TT5 B;  5EEG A;  3LAP A;  3QYE A;  1OMI A;  4RGS A;  1WH5 A;  4U88 A;  2LOO A;  3CCU I;  1E17 A;  1ZR2 A;  4DGW B;  5KVR A;  1W5T A;  3F8B A;  1XC5 A;  1BM9 A;  2PMU A;  3GW2 A;  1H0M A;  2YS9 A;  4LG0 A;  3WHB A;  1O57 A;  4IHS A;  4AIK A;  4A69 C;  4Y13 A;  4FE4 A;  2UXU A;  3QKX A;  1K79 A;  2ZB9 A;  4NQW A;  4XN3 A;  5F04 A;  3TO6 A;  3GTL J;  1MBH A;  2W82 A;  2IS2 A;  2YR2 A;  1BI2 A;  1T6S A;  1LEA A;  2D1H A;  3ZOB A;  2CW8 A;  3K70 D;  1FMW A;  4BE0 A;  2NXN B;  3MFK A;  1TQI A;  4B44 A;  3BJ6 A;  5DUI A;  3OSF A;  1T56 A;  3ECO A;  2COB A;  5GP9 A;  5ILS A;  4YZE A;  4XKW A;  3SZG A;  1UFM A;  4AIH A;  2H94 A;  4DOZ A;  2XSJ C;  2X4H A;  3OOU A;  2FXA A;  3M8F A;  4RM2 A;  5C4X J;  3DBH B;  5KAI C;  2PJR A;  3VWB A;  2DO7 A;  2RKH A;  1ZG5 A;  3R0J A;  2LKP A;  2UXX A;  3K0L A;  3WG7 H;  1GLN A;  2CFO A;  4KIS A;  2PZ9 A;  2ME6 A;  4I6Z A;  3SWH A;  1WJ5 A;  3K4C A;  4YG2 F;  3HHH A;  2CUZ A;  1L3L A;  3WTW C;  3JW4 A;  4Q47 A;  2IGN A;  5HLG A;  4QSH A;  4A6D A;  1J2X A;  4IHX A;  3ERE D;  2ZNZ A;  1YIT I;  3S93 A;  2RAE A;  4CSW A;  3VFZ A;  2CW7 A;  2HKX A;  4C3J J;  3F23 A;  2HYT A;  2K9S A;  4OD4 A;  1XGS A;  2H6B A;  5HNF A;  2DOA A;  4B3X A;  2L0K A;  3RDI A;  1H9G A;  2A61 A;  1ZTR A;  3I59 A;  4BHB A;  2X6O A;  1ZK8 A;  3M4O J;  2G7U A;  2FBQ A;  2COM A;  3E5X A;  2H6C A;  1UB9 A;  3V8L A;  3BCA A;  2X48 A;  1TWH J;  1D1C A;  3CES A;  5M3M J;  2RRE A;  1MMA A;  2ZME B;  4XKV A;  2MC3 A;  3I3L A;  4AD9 A;  1LFB A;  1SVL A;  1VND A;  4B09 A;  3DFG A;  1WFX A;  3BZC A;  2E5N A;  1B72 A;  1X3Z B;  1X19 A;  2ADU A;  2FML A;  1Y6I A;  4I2O A;  2DT7 B;  3RI4 A;  2EFN A;  1ZGA A;  1JTY A;  3FIS A;  3H5R A;  3KP2 A;  3DCF A;  3P9C A;  4OAZ A;  2Y48 A;  3G71 I;  3NNR A;  2JMW A;  2QGU A;  3RZO J;  3ZQH A;  4DQ2 A;  5FD5 A;  5CVJ A;  4LIU A;  3GFL A;  4LLN A;  5DCF A;  4PK4 A;  2ICW G;  2HPM A;  2A6H F;  4RM3 A;  1ETK A;  4DZP A;  2MH9 A;  2XRN A;  4F92 B;  2X1C A;  2XUB A;  2ZC2 A;  2FMY A;  1J7K A;  1U9N A;  2NAZ A;  1PJR A;  4MNU A;  2W1O A;  5DM7 F;  1HBX G;  4BDZ A;  1R5H A;  3FXM A;  2IVM A;  3BT9 A;  1VQM I;  2DFE A;  3CJT B;  4WCG A;  4ENJ A;  1B9N A;  2LD5 A;  1ZQ3 P;  3F8C A;  2FSW A;  3GTM J;  2OCE A;  4PJN A;  4MIM A;  3GZ5 A;  4EGY A;  2DT5 A;  1TWC J;  3FMQ A;  4LG0 B;  1QU3 A;  4EJU A;  1MNM C;  1NG7 A;  5J8F A;  2F07 A;  1J5Y A;  3PFY A;  1W7P D;  3QQA A;  3IKT A;  2VKV A;  2W57 A;  4IF4 A;  1QZY A;  3BR5 A;  4IX7 A;  1O3S A;  1S9H A;  2VBY A;  2QSG X;  3BTL A;  2WAQ N;  3VTI A;  3B02 A;  3C2B A;  2NNN A;  4ESB A;  1VQN I;  1X58 A;  3M7G A;  2A3S A;  4ESJ A;  3JSP A;  3FXJ A;  4CZZ A;  1S7A A;  5F6F A;  4LLG F;  1AHD P;  1QZZ A;  3SQN A;  2E1C A;  3ZMZ A;  2V1N A;  2EQR A;  2IW5 A;  3QAH A;  5AON A;  2A2F X;  1G2H A;  2RN7 A;  4J00 A;  4CH7 A;  4N9I A;  3QYF A;  4Y15 A;  2OUM A;  2HOS A;  3L09 A;  4C2U A;  2C6Y A;  2O8K A;  2XRO A;  3FM5 A;  4RBO A;  4M3G A;  1XCV A;  1WWX A;  4W97 A;  4D9J A;  2GOM A;  5F1R A;  1TBX A;  4M3B A;  1XCB A;  5J4V A;  4JP0 A;  5EJC A;  2HOT A;  4U87 A;  2E71 A;  5H2F C;  2GA2 A;  3CF2 A;  2RNG A;  4M3D A;  2DMT A;  5D5X B;  2JVH A;  2BW3 A;  4YIF A;  2DMQ A;  4LIV A;  4YEJ A;  3J7Y J;  3HRS A;  3COA C;  1D3Y A;  4ZZD A;  1VQO I;  1JUM A;  2VJI A;  4GCV A;  2W48 A;  3V6G A;  4EAT A;  2EJR A;  2VT3 A;  3I59 B;  2QQ9 A;  3NI7 A;  4CGZ A;  1GDT A;  4ICH A;  3F8M A;  2IBD A;  5J1U A;  3OYD A;  3ABL H;  3HG9 A;  4D0P A;  5CPR B;  2DA4 A;  1NK3 P;  4R79 A;  2XIG A;  2GOX B;  4ITV A;  3PAS A;  3LQR A;  3B81 A;  4GYI A;  3OIP A;  1JE8 A;  1MBE A;  2JN6 A;  2Y9Z A;  3FM3 A;  4FIS A;  5LFA A;  5J1R A;  4CYC A;  2LG4 A;  3NS4 A;  3QPH A;  5CQG A;  1P4X A;  1Z05 A;  5DCM A;  1Z21 A;  1AKH B;  3ZR8 X;  2B3W A;  1XMX A;  5IY5 H;  1WSU A;  2LR8 A;  3EUH A;  4L9N A;  4A3G J;  3HBL A;  4MHG A;  3WU2 C;  3AL0 B;  3BRO A;  5D8K B;  2KKO A;  3H3V K;  2L4M A;  1ORK A;  2AXT C;  1B1B A;  1JHF A;  4N4N B;  1LFP A;  4MTD A;  3JRI A;  2STW A;  4P9U A;  1FJL A;  4Y17 A;  2XAF A;  1KZH A;  1XS9 A;  5FLX Z;  2HPI A;  3P9I A;  2LSO A;  2JA5 J;  3CDI A;  3FK6 A;  3TKY A;  2ZJP F;  2G7L A;  3S2H J;  2M0M A;  1W7P B;  2Y0S N;  2R7W A;  5E1X A;  1Y1W J;  1SEU A;  1BR4 A;  4RLF A;  3FHZ A;  3A2K A;  3VSL A;  4IOC F;  2OTJ I;  2F6C A;  3RKX A;  3BR2 A;  3S1Q J;  2WAF A;  1D8K A;  2FBH A;  3WGG A;  4LK1 F;  1MJB A;  1MBK A;  2IU5 A;  3OOP A;  4ANJ A;  2CYY A;  4M9Z A;  2UXI A;  2VPR A;  1ZAR A;  2O61 A;  1BR2 A;  2EIK H;  1ZH5 A;  5IOY A;  4HDU A;  2P8T A;  4A6E A;  4UDS A;  1NH3 A;  3ASN H;  4IQJ A;  1STZ A;  2V4J C;  1UST A;  2LKS A;  1LNW A;  1S29 A;  4HPQ A;  1AU7 A;  3TO7 A;  1YIJ I;  2Y30 A;  4P1W A;  3NAR A;  4UUS B;  2IA0 A;  2FEZ A;  3MKZ A;  2VI6 A;  2M7B A;  3FXQ A;  3V7S A;  2PG4 A;  2CRG A;  2HYF A;  1K6O A;  1FYL A;  2O7T A;  1W4M A;  4HNT A;  2DTZ A;  2MA3 A;  3DTE A;  1XDU A;  4ABZ A;  4S05 A;  2EIM H;  1WPK A;  2BV6 A;  2E36 A;  2KIM A;  2LY1 A;  2QKL B;  4CCM A;  2LBF A;  2H8W A;  5D4S A;  3I0T A;  2V9V A;  2XAJ A;  1Z3X A;  2ZO4 A;  3K9T A;  3RKW A;  3TGN A;  2UXH A;  5K5Q A;  1MH3 A;  2OCC H;  1SMY F;  4EJT A;  1T95 A;  4DYQ A;  3WTS C;  1SAU A;  1IN8 A;  1UI6 A;  3QU3 A;  2EZH A;  3BJA A;  4RB0 A;  1D1A A;  3VIB A;  1XSV A;  2FE3 A;  2F5F A;  3PL8 A;  3PFI A;  2W7N A;  3DU5 A;  3H0D A;  3T8T A;  1TP4 A;  2MBF A;  3IKV A;  1R4N B;  1SGM A;  4ACI A;  2DJI A;  1VQ7 I;  1R58 A;  1MZB A;  3QPL A;  1UAA A;  3B6A A;  2WAD A;  2CQK A;  3RYR A;  2KL4 A;  3VVZ A;  4BE1 A;  5FRN A;  3PSI A;  1K4T A;  3HC7 A;  2GQQ A;  4PJJ A;  2P81 A;  2M87 A;  3E7Q A;  2RV8 A;  5F0H A;  4CYC B;  3S32 A;  3CRJ A;  3A4C A;  1D5Y A;  2V7F A;  4HST A;  5F08 A;  2PFV A;  2ESN A;  1O7F A;  1WJF A;  4U0V A;  1E3O C;  1RUO A;  2KMU A;  2OC6 A;  5BMZ A;  4G6Q A;  1LJ9 A;  4MEX F;  3I5U A;  2UWM A;  2XDV A;  1D0Z A;  3ZGK A;  4U7B A;  1QA6 A;  1NHA A;  4LK0 F;  3PIO F;  3TL4 X;  4G6D A;  3I54 A;  1ZRE A;  4YFX F;  3V4G A;  2EA4 A;  2M34 A;  3KZ9 A;  5E3N A;  2UXO A;  3FXU A;  4W1U A;  4F3Q A;  3F8N A;  2QKO A;  2FRH A;  3V8K A;  2VQL A;  2G7S A;  3M3Y J;  4XOR A;  2LVS A;  4BQA A;  1EA3 A;  1PVE A;  2YU3 A;  3GLL A;  2QCO A;  3ZQG A;  5ICG A;  1FOX A;  2Z5U A;  3IH4 A;  3VVX A;  4Y4R A;  4E7S A;  4NDL A;  1IRZ A;  3OMY A;  1PUF A;  2K27 A;  5L3C A;  1YTY A;  4XRF A;  3ZXS A;  4A3E J;  2L9N A;  4KMU X;  4AWX B;  4CYD A;  4A3C J;  4L5E A;  2A69 F;  3BC8 A;  1R23 A;  1SAN A;  2L54 A;  2E2I J;  5EGO A;  1TWF J;  3R0A A;  3H92 A;  3A1Y A;  2V6E A;  2CQN A;  3I53 A;  2DMN A;  3R6S A;  2ZXI A;  4MTE A;  4CDG A;  3FMR A;  3NQO A;  2K9L A;  4DVY P;  4P96 A;  5LHG A;  4HX4 A;  2CO5 A;  3HGY A;  2OQG A;  3K8P C;  5FKN A;  5H6Q A;  2HQN A;  4MFE A;  4CCO A;  4NNJ A;  5E3M A;  1T0F A;  2DMP A;  2L7M P;  1VQP I;  3BG5 A;  4UB8 C;  2LBF B;  3TQN A;  2JWT A;  3LMM A;  2I10 A;  3LSK A;  2P5L C;  4HNU A;  3DWL E;  2VJ4 A;  5BNG A;  3FZV A;  3Q9V A;  4I09 A;  3KKC A;  1DP3 A;  3HOU J;  1YG2 A;  2K9Q A;  4GRI A;  2FNP A;  3GTJ J;  4HEA 2;  1VQ6 I;  3S14 J;  2JQ7 A;  2FBI A;  3CCM I;  2WA0 A;  2V1X A;  5FGM A;  2Z33 A;  1FYM A;  2VOO A;  1JGG A;  1F1Z A;  2EPF A;  3BQZ A;  3CQZ J;  2VXD A;  1ZG3 A;  3J80 K;  2HXO A;  5DD8 A;  2BOL A;  1XDS A;  3AG1 H;  2M4G A;  1YRN A;  4A93 J;  1LKX A;  3F0C A;  1R5G A;  1X1D A;  2JPC A;  3EYY A;  1YE9 A;  1R9T J;  5IT9 K;  3OYN A;  4GFK A;  2CW0 F;  4CZC A;  3Q9S A;  2FBK A;  1HXD A;  2ZFU A;  4UUT A;  1ZYR F;  4ENK A;  1W1W E;  4D7M A;  2LP0 A;  3A01 A;  3BP8 A;  3S3M A;  4HF0 A;  3DBL B;  2OZ6 A;  2XV4 S;  4C2T A;  3GVA A;  4EV0 A;  2PMZ A;  3R60 A;  2OER A;  2HOA A;  4E7I A;  2OJE D;  1HDP A;  4WXH A;  3ABU A;  5ICC A;  5AIQ A;  2CWE A;  1P6R A;  1MBG A;  1UEL B;  4GO1 A;  4CXF A;  2P7V B;  5KCM A;  2KLO A;  1YX5 A;  3FX3 A;  3FXK A;  4MLO A;  4MXM A;  1E3H A;  1B8I B;  2M45 A;  3F22 A;  2QOP A;  4ZYG A;  5FKK A;  5D6F A;  3FBI B;  2FJ1 A;  1Z6R A;  2IA2 A;  3EUK L;  4WK8 F;  3SXY A;  3CO6 C;  2B7E A;  3LA2 A;  4F7Z A;  1ONV A;  5EZG A;  3IAM 2;  5TJJ A;  2M2E A;  2VBX A;  4HOB A;  1T8I A;  5JVG F;  4F55 A;  1FOK A;  3QRF F;  2DA5 A;  2R7R A;  2KRC A;  1SVO A;  4JOM A;  1OCT C;  1W5C C;  4BE2 A;  4KA4 A;  1PUF B;  2CQX A;  2QWW A;  2FU4 A;  1F5T A;  4DNC A;  1OYI A;  3VYR B;  1X1A A;  2FOK A;  5J6X A;  1DU0 A;  4C3I J;  4XSX F;  1BI1 A;  3H36 A;  4LFU A;  3HXL A;  4H4K C;  4KIB A;  5CW8 A;  4JL3 A;  2OF7 A;  3P5J A;  2XGX A;  1XGN A;  4AVZ A;  2DMU A;  2HNH A;  4E4H A;  4LLL A;  2XC7 A;  2WY8 Q;  1H89 C;  2O8X A;  4NBQ A;  2P6S A;  3W2W A;  5B5E C;  1S5L C;  3DPU A;  2L9R A;  3VW2 A;  3U1K A;  2GBY A;  3VVY A;  1XN7 A;  3MWM A;  1FX7 A;  2OA4 A;  2DLL A;  2WBM A;  5K5R A;  3O6B B;  1LE8 A;  2CS3 A;  3A0H C;  2ZSH B;  4E70 A;  3TW6 A;  2JSP A;  1TQP A;  1O7L A;  3S17 J;  4OU0 A;  4A3D J;  2GM4 A;  3G4S I;  2G0E A;  2BBY A;  2HVR A;  1ZLJ A;  4UHT A;  3KE2 A;  4B47 A;  4HNV A;  1GXQ A;  5ICF A;  3FKJ A;  1YW8 A;  4HA8 A;  2V9K A;  2P0W A;  4XMY A;  3F21 A;  2EB7 A;  4GYG A;  3QYB A;  5M3F J;  4ZDP A;  3WG9 A;  2HZD A;  5CXG A;  1MBF A;  1OPC A;  4L62 A;  1KA8 A;  4U0W A;  2HEO A;  2KRF A;  2LY9 A;  3E97 A;  5ILU A;  1UI5 A;  3HOS A;  3VP5 A;  4AYB A;  3ZRG A;  3HTH A;  1MJA A;  3H0G J;  1U3E M;  2ELJ A;  3ON2 A;  2MW8 A;  4NC7 A;  4PCQ A;  2YU9 J;  4HAM A;  1HDD C;  5E8G A;  4ZDL A;  1YO5 C;  5DM6 F;  3EET A;  1OCZ H;  3BNI A;  2KPM A;  3OIO A;  4UVB A;  3FDY A;  1FWZ A;  3E1S A;  1V5F A;  2YVE A;  4AVP A;  4A3K J;  3J7A O;  3JRF A;  4DW6 A;  2EZL A;  3U2R A;  1LPQ A;  3HKZ N;  3WGI A;  1BW5 A;  1R36 A;  5JFR A;  3DKW A;  5D8L B;  2PQ8 A;  3HIM A;  2KFD A;  2UUZ A;  1UG2 A;  3A01 B;  4R1H A;  2R93 J;  1ZRC A;  2EZI A;  3WTT C;  2VOD A;  2EZK A;  2CJJ A;  3GLX A;  2FQ3 A;  5IP6 A;  1OJL A;  3BG6 A;  4E7H A;  5D4R A;  1ZEL A;  3CCJ I;  1L0O C;  3BR3 A;  1BW6 A;  3HDD A;  4AC0 A;  4A0Z A;  3IAS 2;  4B4C A;  2NX4 A;  3MZ8 A;  1FSE A;  5DUK A;  4F52 A;  4C2M J;  3B73 A;  1VQ9 I;  2LNB A;  1TNT A;  2DAO A;  4JNN A;  4WIB A;  4FTH A;  1S3J A;  4GGG A;  3JRC A;  2KHM A;  3HTS B;  3BPV A;  4M74 A;  1U78 A;  2Y31 A;  1CF7 B;  2HYJ A;  3GTO J;  2HOE A;  3BQY A;  2K02 A;  3L2U A;  1W0U A;  2LDU A;  3LL7 A;  4XQF A;  1X3W B;  4Z6Y A;  4Y52 J;  2X85 A;  2XAS A;  3NWS A;  3VSK A;  2DA6 A;  2QF7 A;  3J81 K;  2CQQ A;  1WJE A;  2NP5 A;  1EJ9 A;  2M3A A;  2Z3Y A;  3LFU A;  3GTG J;  2DG7 A;  2VIX A;  5GPA A;  3I56 I;  2PI0 A;  5K58 A;  1O3Q A;  3IL2 A;  1ZG1 A;  2IGM A;  3H3Z A;  3C2H A;  3CDL A;  3ANG A;  2Y69 H;  4IZZ A;  1D8J A;  1LDJ A;  4G7O F;  2V6C A;  2KIU A;  4E7Z A;  4ZJZ A;  1ZRF A;  2BZT A;  2DT6 A;  2X1D A;  1WHU A;  3CTA A;  4ZTF A;  3ON4 A;  2EIN H;  3KYC B;  4DYR A;  3Q3S A;  1S7E A;  1B9M A;  5K7H A;  2PLY A;  4BJ6 C;  3HJE A;  4BNC A;  1A6I A;  1I1G A;  1TZL A;  1X2M A;  1MND A;  1XSX A;  2AQE A;  5E20 A;  3V8J A;  3OYL A;  3W6K B;  4CHU A;  4BAC A;  1HLV A;  3KYD B;  3OR2 C;  5B1A H;  4X1E A;  2P7C B;  1T39 A;  2MLG A;  2RGV A;  1BI0 A;  1V5G A;  3FKI J;  3W3C A;  3OYG A;  5ED4 A;  4I99 C;  4M6V A;  1N75 A;  1BJZ A;  2LTP A;  3KEQ A;  3GZN B;  4FQG A;  3CCL I;  2QQB A;  2MFZ A;  3OIQ A;  5K5O A;  2X51 A;  1SD4 A;  3E0J B;  3AFH A;  3U21 A;  3GX4 X;  4PFO A;  1TW3 A;  1V3F A;  2QBY A;  1IDZ A;  2K85 A;  2NVT J;  1A04 A;  2P4W A;  4U0Y A;  2FJI 1;  1TNS A;  1X4P A;  3CCS I;  2HR3 A;  3ESW B;  3EUA A;  3NRG A;  3VOK A;  1F43 A;  4A3M J;  4G8X A;  2R5Z B;  4OIP F;  1P7J A;  4GCT A;  1FBU A;  4FT8 A;  5FKM A;  1DPU A;  3SJM A;  3MKL A;  1OR7 A;  1T0F C;  1KU9 A;  4HQE A;  2EH3 A;  2DK8 A;  4IJA A;  4M3F A;  2WC2 A;  3QOE A;  1RR7 A;  1A6Q A;  3H9Q A;  2K3P A;  3K2Z A;  2LKX A;  3M9A A;  5HS8 A;  6PAX A;  3FXR A;  4LMY A;  4RGU A;  4JX4 A;  4I01 A;  4XN0 A;  1HC8 A;  1KYW A;  1QPI A;  3HTI A;  3GZI A;  3ZQ7 A;  1JHH A;  3HRT A;  3PUF A;  1I1S A;  1GVJ A;  4DJA A;  1ENH A;  4XNF A;  2STT A;  3MAJ A;  1LFU P;  3EGQ A;  2VN2 A;  4BJ5 C;  3L1P A;  4L0Z B;  4B48 A;  2V79 A;  5DV5 A;  5D19 A;  4XLC A;  4BBR J;  2IJL A;  2BVM A;  3L2Q A;  4GFB A;  5EZH A;  2ZBK A;  4II3 A;  3ABM H;  3CJR B;  2LF8 A;  5LHI A;  1FMV A;  3LSM A;  3C1D A;  3IWZ A;  3KX2 A;  3WTX C;  4AM3 A;  4AF5 A;  4UV8 A;  2NOG A;  2JTV A;  2E1M B;  4A5N A;  5FMP A;  1O3R A;  2ZJQ F;  4RB2 C;  3AKZ A;  2W53 A;  3BJO A;  3N05 A;  2R7F A;  5M5W J;  2XGE A;  2A05 A;  3F6V A;  1K78 A;  1Z7L A;  3LSG A;  2VUM J;  4NQW B;  4XLE A;  3KPH A;  4EJO A;  4GFL A;  1UCR A;  3E5Q A;  4JBA A;  1Z77 A;  3GEZ A;  3SDB A;  3K1P A;  3BR6 A;  3C7J A;  3FBN B;  3KP7 A;  3LSJ A;  5DEQ A;  3HL2 A;  2H27 A;  4HLX A;  4KFC A;  1VZ0 A;  1JI8 A;  2QSH X;  4XR6 A;  3SYT A;  1HOM A;  3E6C C;  4BEH A;  4XRS G;  3CP8 A;  4B8X A;  3TED A;  2HFH A;  2NNY A;  2L7F P;  3PJR A;  2EFO A;  1U2W A;  1BN5 A;  4XLF A;  4F91 B;  4BBS J;  4IKF A;  3CME I;  4ZZL A;  2PJR B;  4KYW A;  1VQ8 I;  4I0B A;  2VOP A;  1R49 A;  2EFW A;  2ZXW H;  2NYX A;  2Z99 A;  4HV6 A;  2IS1 A;  2R92 J;  3PUB A;  2UXN A;  1Z7U A;  3GYH X;  2HDC A;  4XOP A;  4DYC A;  1HSJ A;  1SAX A;  1R1T A;  4L18 B;  4V19 K;  2M5W A;  2KT0 A;  2ELK A;  2DCE A;  2DOD A;  2XKP A;  2RQP A;  3IRQ A;  4A2U A;  3FXO A;  3T0Y A;  3E6M A;  2XRL A;  3ZCO A;  5C4J J;  2HI3 A;  3ASO H;  2CUE A;  1SD5 A;  2A5W A;  5JR3 A;  4D5C A;  4Q4Z F;  1JJ8 C;  5CQE A;  5LRS A;  4FAS D;  3NRV A;  1WI9 A;  1YI2 I;  2KZG A;  4XRS A;  3SDG A;  2PBX A;  2IS4 A;  3LSP A;  1IO2 A;  4O5V A;  2VC1 A;  3CJQ B;  3VOD A;  5B3S H;  5CVU A;  4UY8 I;  4CCJ A;  4XLA A;  1DUX C;  1RUN A;  3S16 J;  2BHY A;  2M4K A;  3BG7 A;  4D5F A;  1GT0 C;  1FIA A;  2HU9 A;  1LQ1 A;  1AOY A;  4YII A;  1B72 B;  3GXO A;  1DPR A;  5GAH J;  1H8A C;  3BWG A;  4PZJ A;  4UVA A;  4RAF A;  5TGT A;  5EEA A;  3DV8 A;  2F5E A;  2LFB A;  2VKH A;  3GTQ J;  1WJA A;  2QQA A;  3KYL A;  2NVY J;  1BC8 C;  2V26 A;  5DYM A;  3PNV A;  2M1B A;  1U9O A;  2AO9 A;  2NOJ B;  2LRD A;  2FA5 A;  1X2N A;  2K5C A;  3KEO A;  1WH7 A;  5HVQ C;  4ON0 A;  2MC4 A;  2EV6 A;  1W0T A;  5KNL A;  3S8P A;  2VBZ A;  1FOY A;  1FYK A;  1XSD A;  2HGC A;  3BG3 A;  3REO A;  2K7L A;  2B63 J;  3AAF A;  1YLF A;  3HSR A;  5TIS C;  1KQ8 A;  3JRD A;  2VXZ A;  3V7C A;  4BXF A;  4N0B A;  1Y8Q B;  3LST A;  1MSE C;  4U9L A;  2E19 A;  3TP0 A;  1I3Q J;  2ZCX A;  3BZK A;  4PGG A;  2XKO A;  1MH4 A;  4XKC A;  3RTR A;  3RPQ A;  1LEB A;  3OV8 A;  5JI6 A;  3AG2 H;  2O6G E;  2X0L A;  2R7V A;  1ERD A;  4RAZ A;  3G1L A;  3WTZ A;  5IYC J;  1IW7 F;  1BR1 A;  2H8R A;  1ULY A;  3DLL F;  3GME A;  3IH2 A;  1U5T A;  2HDD A;  5FJ8 J;  4C30 A;  4BEH B;  3IWF A;  4RGX A;  2LRE A;  3HEF A;  3VDX A;  2W25 A;  1J09 A;  4YEL A;  3TDU C;  1FLI A;  1S8N A;  1Z91 A;  1BC7 C;  3VUQ A;  3L7W A;  5HLH A;  3BCG A;  2VL8 A;  1AWC A;  2JPB A;  2GXG A;  4ZYD A;  2L01 A;  1YJN I;  4ZH4 F;  1WGX A;  3P9T A;  2KDZ A;  4WX9 A;  1BI3 A;  2R7O A;  1A31 A;  2MH2 A;  2CV0 A;  4I98 B;  1BOB A;  1SD7 A;  1RES A;  2E1M C;  2L9S A;  3HOV J;  3ZMS A;  1WCM J;  3OYJ A;  3L2C A;  3TBI A;  2BW3 B;  3BPX A;  5LGU A;  1ETW A;  4MEY F;  2DDB A;  4BL0 B;  1O4X A;  3CMM A;  1E0E A;  1MIJ A;  1Y0U A;  2NVQ J;  3RIR A;  1IRF A;  4YIR X;  3KLN A;  1WZ2 A;  4ME9 A;  2RAS A;  2K9N A;  3IV5 A;  1P2F A;  3TOB A;  3HRM A;  1O3T A;  4BQN A;  3FK7 A;  3K4M A;  3J80 Z;  4IHW A;  3ZQQ A;  4BY1 J;  4V2F A;  4XSZ F;  3ZQL A;  4ZYA A;  2V1D A;  3E6B A;  3FF5 A;  4EVI A;  5IT9 Z;  1R6R A;  1VQ5 I;  3KP5 A;  4YRV A;  1XB4 A;  2OBP A;  1G3T A;  2XSD C;  5DCM B;  4RMN A;  5K1Y A;  3K6G A;  4KJZ A;  4PGH A;  3VOE A;  1XTA A;  3RYP A;  5JLX A;  3AQT A;  2BY2 A;  1QHG A;  1OCP A;  5IT3 A;  3HSE A;  1OFC X;  2WB1 N;  3D1N I;  1KU7 A;  4RDU A;  4A3L J;  4KIC A;  2PN6 A;  3UNG C;  4NHJ A;  5EF6 A;  2IRF G;  1NTC A;  2XAH A;  2XB0 X;  2XPU A;  3BOQ A;  2V9P A;  1KGS A;  4CUG A;  2Q2E A;  1T33 A;  5E18 F;  3ZMV A;  2CSO A;  1G4D A;  1FZP B;  2ZSI B;  2M0C A;  1SC7 A;  3HHG A;  4D1Q A;  2YVH A;  1IG7 A;  2WAQ A;  1KQ9 A;  1Q1V A;  3LOC A;  2QEX I;  2BYV E;  4IHY A;  5F0C A;  2ZXJ A;  2UZK A;  3CCE I;  2DA1 A;  4IRV A;  3TP3 A;  2QLZ A;  3JTG A;  2VON A;  3LFK A;  2VQC A;  3EDP A;  2I5U A;  2OZU A;  1OR7 C;  2W4S A;  3HPG A;  4RA2 A;  3DQV C;  1BIB A;  2WV0 A;  1MDM A;  4UV9 A;  1QZE A;  2E34 A;  3MCZ A;  3W6V A;  4JQF A;  2ZKZ A;  3KP6 A;  4OMY A;  1JXS A;  1N78 A;  1YOV B;  2MAB A;  3IH3 A;  3M1C A;  4D7N A;  4HF1 A;  4U9N A;  1J0R A;  5GPC A;  5A2Q K;  1T2K A;  2HWV A;  2BXY A;  4A3F J;  3DP7 A;  3RCO A;  1SMT A;  2GA1 A;  4BYY A;  5FO5 A;  5LRR A;  1HCR A;  3O60 A;  5DDG A;  4BHC A;  3HOX J;  4LB6 B;  2OU2 A;  5LHH A;  3MQ0 A;  1I27 A;  4CIC A;  4Y3O A;  4XK4 A;  2W24 A;  4HYE A;  5J1Y A;  2CUJ A;  4IOA F;  1FEX A;  4X6A J;  3OSG A;  3DPL C;  1CGP A;  4QTR A;  4C2M A;  2F5V A;  2W85 A;  4M6X A;  2A5Y B;  4ENN A;  1NK2 P;  5H20 A;  3OYK A;  4OMZ A;  3AG4 H;  1B6A A;  2O5R A;  3P7N A;  1CQT A;  1A35 A;  5GTH C;  3BRU A;  4LB5 A;  2RDP A;  1PUE E;  1YW7 A;  3CJN A;  2VT2 A;  3CC7 I;  2L3D A;  4I7H A;  2R7S A;  4DZJ A;  2JRM A;  3DXJ F;  2DN0 A;  5HOD A;  1R5I D;  3GFJ A;  3ONQ A;  3B6C A;  2VJ5 A;  3K1N A;  2VAS A;  4IRI A;  2REK A;  2YSR A;  4ASN A;  2BY3 A;  2CUF A;  4BDY A;  3EYI A;  3NXC A;  2KZV A;  3AQS A;  3HUG A;  3QPS A;  5HLI A;  4BXU A;  2F2E A;  2VPL A;  3V7R A;  1B4A A;  5CXI A;  3CCY A;  1P9Q C;  2E1N A;  3HPH A;  5M5X J;  4MFD A;  3G6E I;  2TCT A;  4IVN A;  1IN7 A;  1IUF A;  1M1E B;  3HTU A;  1UHW A;  4XLN F;  2WTE A;  5IP7 J;  5L3F A;  3F1B A;  1UHM A;  4BQQ A;  3RKQ A;  3DF8 A;  3S1R J;  3COL A;  1R1U A;  4LD5 A;  2NP3 A;  1QQI A;  2EIJ H;  4GCK A;  3S3O A;  1ZAO A;  1W5S A;  3S2D J;  2Y0S A;  1D5V A;  2HQA A;  3ZQI A;  1PP8 F;  1P7I A;  3KCC A;  3N4M A;  1RNL A;  1VQK I;  5IYD J;  3Q0U A;  4KDP A;  4KN7 X;  1YW9 A;  3PSF A;  1EH6 A;  3OYF A;  5EYR A;  2E7W A;  2W00 A;  2HQ5 A;  3K4K A;  1J75 A;  5C3E J;  3CUO A;  5DAJ A;  1TWG J;  1XX5 A;  3H9J A;  3BTC A;  2EFP A;  4H0E A;  5FFZ A;  5HOO A;  5IPA A;  2K4J A;  2ME0 A;  5F27 A;  2YUS A;  5TRD A;  2XF7 A;  3DBR B;  3JCU C;  1ZHF A;  4PJ0 C;  1RKW A;  5CLS A;  4II2 A; 
#chains in the Genus database with same CATH homology
 1JT6 A;  3CRJ A;  5K7Z A;  2HOS A;  3CDL A;  2O8K A;  4RBO A;  4M3G A;  4BY7 J;  3ANG A;  4W97 A;  2DA7 A;  2OPT A;  4M3B A;  4JP0 A;  2HOT A;  3ON4 A;  4M3D A;  2DMT A;  4DYR A;  3Q3S A;  1S7E A;  1F36 A;  2DMQ A;  4JYK A;  5K7H A;  1GV2 A;  1ETY A;  1JUM A;  1QVT A;  1A6I A;  2W48 A;  2R5Y A;  2FX0 A;  1X2M A;  3HOY J;  3V6G A;  5EGO B;  4AYB N;  4FE7 A;  3HE0 A;  1Z0X A;  2GEN A;  4HKU A;  4GCL A;  1HLV A;  3Q0W A;  3NI7 A;  5E3O A;  1GDT A;  4ICH A;  5D18 A;  2IBD A;  5J1U A;  5HBU A;  4X1E A;  3QBM A;  2DA4 A;  3FKI J;  3JSJ A;  1NK3 P;  3A03 A;  4M6V A;  3PAS A;  1BJZ A;  2LTP A;  4BXX J;  3B81 A;  3BHQ A;  1B8I A;  4XRM A;  1MBE A;  2JN6 A;  2Y9Z A;  4FIS A;  5J1R A;  4CYC A;  3LNQ A;  3UKG A;  1AKH B;  5F1J A;  1IDZ A;  2NVT J;  3LSR A;  3FIW A;  2M9H A;  3WHC A;  2LR8 A;  4A3G J;  3HBL A;  4KWA A;  3MNL A;  3HOZ J;  3Q0V A;  3H3V K;  1IDY A;  1I6H J;  2GFN A;  3NRG A;  3VOK A;  1F43 A;  4A3M J;  2E2H J;  1RPW A;  2R5Z B;  1ORK A;  1P7J A;  1BL0 A;  2NVX J;  5FHP A;  4GCT A;  5FKM A;  3JRI A;  3SJM A;  3BR0 A;  3MKL A;  3E7L A;  1FJL A;  2EH3 A;  1XS9 A;  3S1N J;  3EUP A;  4M3F A;  4A3I J;  2JA5 J;  3FK6 A;  2G7L A;  2UXP A;  1RR7 A;  3S2H J;  1APL C;  2Q24 A;  2Y0S N;  1Y1W J;  5FGL A;  2LKX A;  2JA6 J;  4LOC A;  4JX4 A;  3BR2 A;  3CMY A;  3S1Q J;  1FTZ A;  2WUI A;  2DA3 A;  3K2A A;  1QPI A;  3HTI A;  3GZI A;  1YRN B;  2ZOZ A;  5K7F A;  2G7G A;  3PO2 J;  3PPB A;  1MBK A;  2IU5 A;  1A5J A;  3HGG A;  1ENH A;  1I50 J;  1LFU P;  2VPR A;  2UXI A;  4MK6 A;  2AHQ A;  3EGQ A;  2WGB A;  4CGR A;  5IOY A;  4S0H B;  3K7A J;  3L1P A;  4UDS A;  3MVP A;  1FIP A;  2XB5 A;  5D19 A;  4BBR J;  4J19 A;  4GFB A;  5EZH A;  2HKU A;  2ID6 A;  2FD5 A;  1AU7 A;  2Y30 A;  1K61 A;  4M3E A;  4AF5 A;  3NAR A;  4UUS B;  3S15 J;  2NOG A;  2VI6 A;  5IP9 J;  2O7T A;  5FMP A;  1POG A;  2CRG A;  4NN1 A;  3SFI A;  5IOZ A;  3HB9 A;  2W53 A;  2DTZ A;  2G3B A;  5M5W J;  2XGE A;  4ABZ A;  1JKR C;  1JUP A;  1WPK A;  3LSG A;  2O7O A;  5FLM J;  5C44 J;  1DU6 A;  1IJW C;  2XPV A;  2VUM J;  1HF0 A;  4XID A;  3DPJ A;  4GFL A;  2D5V A;  1Z77 A;  3G1M A;  1MBJ A;  2UXH A;  3BR6 A;  3VPR A;  3CJD A;  3LSJ A;  1MH3 A;  2TRT A;  1H88 C;  3A02 A;  1ETO A;  1HOM A;  1ETX A;  5FKO A;  4XRS G;  4DYQ A;  3HOW J;  3O8G A;  1UI6 A;  2EZH A;  3TED A;  2D6Y A;  3VIB A;  4MO7 A;  2L7F P;  5D1R A;  2FQ4 A;  4FCY A;  4BBS J;  1UHS A;  4C3H J;  1SGM A;  4ACI A;  1IC8 A;  3GTK J;  3BTI A;  3QPL A;  5DTD A;  3B6A A;  3VVZ A;  3KKD A;  1ZKG A;  3VOX A;  3CWR A;  2GLO A;  1LE8 B;  3LHQ A;  5HSZ A;  1Y1V J;  2R92 J;  2P81 A;  1JUS A;  4DYC A;  3E7Q A;  5F0H A;  4CYC B;  2X9D A;  1VFC A;  1ZGW A;  2KT0 A;  1JTX A;  1D5Y A;  2ZOY A;  2MGQ A;  1QRY A;  2ELK A;  2XGC A;  4PXI A;  3DEW A;  4Y7N J;  2RHA A;  2LLK A;  3TW7 A;  5F08 A;  2DA2 A;  2XRL A;  3BR1 A;  5C4J J;  2HI3 A;  2CUE A;  2XPW A;  4D5C A;  1JJ8 C;  1E3O C;  4XRS A;  3SDG A;  3JR9 A;  2PBX A;  3LSP A;  2XGD A;  3O8H A;  1RKT A;  2Y9Y A;  3S16 J;  2JJ7 A;  2M34 A;  3KZ9 A;  4D5F A;  5E3N A;  2UXO A;  4W1U A;  1FIA A;  1GT0 C;  2E1O A;  2QKO A;  2G7S A;  3PM1 A;  1B72 B;  3M3Y J;  1H8A C;  2R7Z J;  4JX5 A;  3ZQC A;  2VKE A;  5EEA A;  2LVS A;  2LFB A;  3GTQ J;  1TWA J;  2HXI A;  2QCO A;  3ZQG A;  2DG8 A;  2NVY J;  3IH4 A;  3VVX A;  4I76 A;  4NDL A;  4IHV A;  1PUF A;  1IRZ A;  1U9O A;  2AO9 A;  1GUU A;  3RZD J;  1ETQ A;  1X2N A;  4A3E J;  1WH7 A;  3I4M J;  4A3C J;  1W0T A;  4L5E A;  1IGN A;  4JKZ A;  1SAN A;  3BG3 A;  3JRG A;  2E2I J;  5EGO A;  1TWF J;  3JRB A;  2B63 J;  2DMN A;  2O9L A;  3S1M J;  2M8G X;  3JRD A;  4JL3 A;  3NAU A;  5C4Y A;  2R0Q C;  3HGY A;  1MSE C;  3NPI A;  2IEK A;  1IV6 A;  2E19 A;  5FKN A;  1QVU A;  3JRH A;  3G7R A;  3TP0 A;  1I3Q J;  2ZCX A;  4MFE A;  1MH4 A;  5E3M A;  4AUX A;  5EFY A;  2DMP A;  2L7M P;  1UMQ A;  2EBI A;  3BG5 A;  1AKH A;  3VW1 A;  2JWT A;  5IYC J;  3G1L A;  2I10 A;  2ZCM A;  2H8R A;  4QIW N;  3IH2 A;  3JRA A;  5BNG A;  3LJL A;  2LK2 A;  2ID3 A;  4IEJ A;  2HDD A;  1JKQ C;  1JJ6 C;  2R5Z A;  5FLV A;  5FJ8 J;  4V2G A;  3KKC A;  1XG1 A;  2K40 A;  3HOU J;  3I4N J;  3HEF A;  2K9Q A;  3G56 A;  3GTJ J;  3S14 J;  2JA8 J;  3VUQ A;  3BCG A;  5H9T A;  5J3L A;  1JT0 A;  5K58 A;  4XIC A;  1U8B A;  3GEU A;  2GUH A;  1JGG A;  1WGX A;  2E2J J;  2ZCN A;  3P9T A;  2KDZ A;  3CQZ J;  3BQZ A;  5FKL A;  1ZR4 A;  1RES A;  9ANT A;  3HOV J;  2HXO A;  4AC6 A;  3S5R A;  2ECC A;  3BJB A;  2NS8 A;  1WCM J;  1YRN A;  4A93 J;  3F0C A;  3T6N A;  3ZQF A;  1R9T J;  3C07 A;  4GFK A;  1ETW A;  3RQI A;  4B3A A;  2ECB A;  5EDN A;  4EEF G;  1O4X A;  2JA7 J;  4UUT A;  5E3L A;  2R5Y B;  4D7M A;  2LP0 A;  3A01 A;  2NVQ J;  2WV1 A;  2QIB A;  4ME9 A;  1EF4 A;  4JX6 A;  1BA5 A;  2RAS A;  2K9N A;  3IV5 A;  2OER A;  2HOA A;  3BG9 A;  1HDP A;  2V57 A;  3RH2 A;  4B1R A;  1MBG A;  2H1K A;  3FK7 A;  4IHW A;  3ANP A;  4BY1 J;  1FTT A;  5EG0 A;  4V2F A;  3ZQL A;  4MLO A;  4MXM A;  1GV5 A;  4UUS A;  1WH5 A;  1B8I B;  2QOP A;  2QTQ A;  3IUV A;  1ZR2 A;  5FKK A;  1RET A;  2FJ1 A;  1XC5 A;  3HTA A;  2YS9 A;  2XSD C;  3WHB A;  5EZG A;  4A3B J;  2CU7 A;  4A69 C;  2M2E A;  5JLX A;  3AQT A;  4FE4 A;  2UXU A;  3QKX A;  2ZB9 A;  1TC3 C;  1OCP A;  2DA5 A;  5F04 A;  1OFC X;  2WB1 N;  3D1N I;  3GTL J;  1MBH A;  2MG4 A;  4RDU A;  4A3L J;  1OCT C;  5EF6 A;  1PUF B;  2CQX A;  1NTC A;  2XB0 X;  2XPU A;  3ZOB A;  1WI3 A;  4NEL A;  1T33 A;  3LWJ A;  1DU0 A;  4C3I J;  3OSF A;  2M0C A;  5M5Y J;  3V78 A;  5CW8 A;  2YVH A;  1T56 A;  5GP9 A;  2COB A;  2OF7 A;  3JRE A;  1IG7 A;  1ETV A;  4YZE A;  1Q1V A;  2DMU A;  3LOC A;  5IYB J;  4IHY A;  3VW0 A;  3OOU A;  5F0C A;  2DA1 A;  1H89 C;  3TP3 A;  5C4X J;  1SFO J;  2L9R A;  3VW2 A;  2GBY A;  3VVY A;  2Y2Z A;  1ITY A;  2PZ9 A;  1LE8 A;  3W6V A;  2ME6 A;  4I6Z A;  3TW6 A;  3S17 J;  3BTJ A;  4A3D J;  3IH3 A;  4D7N A;  2GM4 A;  5GPC A;  4QSH A;  4IHX A;  2G0E A;  2L7Z A;  5HAW A;  4A3F J;  2RAE A;  2HYT A;  4HNV A;  4C3J J;  1JKP C;  2K9S A;  1HCR A;  3O60 A;  3HM5 A;  3HOX J;  2L0K A;  1ZTR A;  3HTJ A;  4XK4 A;  2X6O A;  5J1Y A;  1ZK8 A;  5M3F J;  3M4O J;  5CXG A;  3KNW A;  1MBF A;  1FEX A;  4L62 A;  2FBQ A;  4X6A J;  3OSG A;  4QTR A;  2LY9 A;  1VI0 A;  2X48 A;  1TWH J;  1NK2 P;  5M3M J;  1UI5 A;  3VP5 A;  3HTH A;  3H0G J;  2XDN A;  1CQT A;  2MW8 A;  3ON2 A;  2YU9 J;  3BRU A;  1HDD C;  1LFB A;  1VND A;  5DS9 A;  4DZJ A;  3BNI A;  1B72 A;  3OIO A;  2IAI A;  2DN0 A;  5HOD A;  2JK3 A;  2QWT A;  3B6C A;  2YVE A;  1VF9 A;  4A3K J;  3PO3 J;  2REK A;  3JRF A;  4DW6 A;  2EZL A;  1JTY A;  2CUF A;  3NXC A;  3FIS A;  3G1O A;  3QPS A;  2PMZ N;  3DCF A;  5JLW A;  3AQS A;  3HKZ N;  2DJN A;  2JMW A;  3RZO J;  1BW5 A;  3HIM A;  3ZQH A;  2OI8 A;  3NNR A;  3A01 B;  1UG2 A;  5CXI A;  2R93 J;  2EZI A;  3CCY A;  3MN2 A;  5M5X J;  4MFD A;  2EZK A;  2CJJ A;  1ETK A;  2TCT A;  1IUF A;  4DZP A;  5IP6 A;  1OJL A;  5IP7 J;  3F1B A;  3GTP J;  3RKQ A;  3BR3 A;  3S1R J;  1BW6 A;  3HDD A;  1U9N A;  3COL A;  4AC0 A;  5EG0 B;  2NP3 A;  4B4C A;  4BKX A;  2NX4 A;  4GCK A;  3BT9 A;  4C2M J;  3S2D J;  1MSF C;  2LD5 A;  4JNN A;  5AQC A;  1ZQ3 P;  3ZQI A;  4FTH A;  3GTM J;  2MSY A;  4MIM A;  3JRC A;  1P7I A;  5IYD J;  1TWC J;  3Q0U A;  1MNM C;  1U78 A;  2Y31 A;  2F07 A;  2HYJ A;  1GVD A;  3GTO J;  3QQA A;  3FRQ A;  5EYR A;  3BQY A;  2VKV A;  2HQ5 A;  3BR5 A;  4A3J J;  1W0U A;  5F0F A;  3RD3 A;  4Y52 J;  5C3E J;  3BTL A;  2WAQ N;  5DAJ A;  1TWG J;  2DA6 A;  2QF7 A;  3C2B A;  2N8G A;  3BTC A;  1K83 J;  1JKO C;  1X58 A;  2CQQ A;  4G12 A;  2NP5 A;  5IPA A;  3GBG A;  2ME0 A;  5F27 A;  3GTG J;  2YUS A;  1AHD P;  2DG7 A;  2EQR A;  5GPA A;  2NS7 A;  1RKW A;  1G2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...