1JUPA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jupA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jupA02
2E2JJ 1WCMJ 2LLKA 1UMQA 2NVYJ 1ITYA 3BTJA 4G12A 3QPSA 3HIMA 2EZIA 4GFBA 1APLC 2XPWA 5FGLA 3F0CA 1HF0A 3DPJA 3B6CA 1TWFJ 1PUFA 2HXIA 2YUSA 3LNQA 4HKUA 1JTXA 5JLWA 2Y31A 3CQZJ 1FTTA 2XSDC 3PO2J 2GENA 1ETYA 2REKA 2HI3A 5K7HA 4NDLA 1B72A 1YRNB 4QSHA 2JWTA 5K7FA 3BG5A 1NK3P 4B3AA 4Y52J 5CXGA 3O8GA 5EEAA 3HOYJ 3G1LA 4D5CA 3M4OJ 4GCKA 1I3QJ 4A3MJ 2N8GA 5C3EJ 1H89C 2QWTA 2DA1A 1MBGA 1MBKA 2VI6A 3PASA 3GTPJ 1Z77A 3G1OA 1IC8A 2GFNA 2WGBA 2DG7A 2M2EA 5EZGA 5CW8A 2G7LA 2G7GA 4XIDA 1XG1A 2JJ7A 2B63J 1A5JA 5C4YA 2NOGA 1TWCJ 3FK7A 1ORKA 4DYCA 1ZR4A 1BW5A 2W53A 3G1MA 3T6NA 2DMUA 2XPUA 2ZCNA 3FKIJ 3M3YJ 4UDSA 3JRHA 3L1PA 3HE0A 2NVXJ 2MSYA 2WV1A 3ZQCA 3IH4A 4DYRA 4MLOA 1HOMA 1JKRC 5F0CA 4FCYA 1R9TJ 2NP3A 2TCTA 5FKOA 3NARA 2HOSA 2X6OA 5IPAA 5D19A 3JRCA 4A3GJ 3VUQA 3O8HA 1SANA 2DMQA 1A6IA 5C44J 1SFOJ 2QTQA 1VNDA 4A93J 3VVZA 3WHCA 5E3LA 3TP3A 4DW6A 1NTCA 2O8KA 1HDPA 5J1YA 3S15J 3QPLA 2W48A 1H88C 4JYKA 3GTKJ 9ANTA 1JKQC 2HDDA 3VPRA 1U8BA 2F07A 4QIWN 3CDLA 2HYJA 1MBHA 4V2GA 3JREA 4FE4A 1WPKA 1MH3A 5IYCJ 4GFLA 2IEKA 5IP7J 3TW6A 5M5WJ 4IEJA 1IDZA 1JTYA 3FIWA 4W97A 3RKQA 2CJJA 3LWJA 2PBXA 3ANPA 2MGQA 5HBUA 3HKZN 2NVTJ 2LVSA 5M3MJ 4ACIA 1T33A 1ETXA 3UKGA 1IRZA 4L62A 1VF9A 4NELA 4AF5A 1TWHJ 3QBMA 2DA5A 2DMTA 3JRBA 3VW1A 1AHDP 2XB5A 3HDDA 5GPAA 3NRGA 1ETQA 3BG9A 4FTHA 2WAQN 3D1NI 3JRIA 4BY7J 3HGYA 1JKPC 1QRYA 2P81A 3HM5A 5H9TA 2CQQA 1QVTA 5C4XJ 3IH3A 3GEUA 3EUPA 4D7MA 4XRSG 4GFKA 4XK4A 3PPBA 2Y9ZA 3LSRA 2JK3A 5D18A 2R5YB 3ON2A 1MBJA 1LE8B 3W6VA 2ZCXA 4ICHA 2GBYA 3HB9A 3CMYA 4M3BA 2XGCA 4RBOA 2HXOA 1S7EA 2O7TA 4XICA 2DG8A 1SGMA 3MKLA 1HDDC 2E2IJ 1XS9A 3P9TA 2CUEA 1RESA 2L7ZA 2HOTA 3MVPA 2Y2ZA 2XB0X 4KWAA 4A3JJ 5FKKA 4EEFG 4I76A 2ID6A 1U9OA 2Y0SN 3VIBA 1WH5A 4MO7A 4IHWA 1HCRA 5IOZA 1U9NA 3ZOBA 5EGOA 3NAUA 2RAEA 3S5RA 5J1RA 3B81A 2EH3A 5DTDA 2DA7A 4QTRA 4ABZA 2DN0A 3LSGA 1AKHB 3G7RA 2WB1N 5DAJA 5F08A 2M34A 4JP0A 2K9SA 2JA8J 4HNVA 2R5ZA 1IJWC 3CCYA 2EQRA 3ZQIA 4UUTA 4CYCB 5EZHA 2E1OA 3COLA 4XRMA 2LK2A 2L7FP 2R93J 2EBIA 3TEDA 3ZQGA 2HKUA 5EG0A 4JKZA 1IDYA 2EZLA 3BR5A 5FKMA 3VP5A 4MIMA 2DMPA 1ZTRA 4YZEA 1Y1VJ 2OI8A 4X1EA 3BTIA 3DEWA 5M5XJ 1NK2P 2LY9A 2E19A 2Q24A 4DYQA 3NI7A 2DA4A 2QF7A 3LSPA 3HTIA 5F1JA 3RD3A 1GVDA 3FISA 1PUFB 5EYRA 2R7ZJ 2UXIA 3CWRA 3BR1A 3KKDA 5D1RA 2YVEA 2TRTA 2YVHA 2G7SA 2DA3A 1JT0A 1B72B 2DA6A 3HOWJ 1IG7A 1I50J 3A01A 4M3GA 1POGA 1WGXA 1FIAA 5IYDJ 2O9LA 1K83J 2ZOYA 2NX4A 1OCPA 2ECCA 2R92J 3OOUA 5FLVA 2ZB9A 3IV5A 3GTMJ 5IP6A 3S1MJ 1GUUA 5IP9J 4UUSA 2XPVA 1IV6A 1JUMA 3OSGA 4B1RA 1BA5A 4MFEA 2LTPA 5HODA 4X6AJ 4M3DA 4BBRJ 3Q3SA 3RZDJ 3VVXA 4A3KJ 2CQXA 3S17J 1JUSA 3F1BA 4AC0A 1ETVA 4C3IJ 2UXHA 3HOVJ 3SDGA 2GLOA 2EZKA 2K9QA 2G0EA 5J3LA 1U78A 1B8IA 1Q1VA 1W0UA 4AYBN 4A69C 4AC6A 3JRDA 3JSJA 2NS7A 5IOYA 2ME0A 2IAIA 3B6AA 2D5VA 2RHAA 1OFCX 1HLVA 4PXIA 4A3CJ 4GCLA 3HGGA 2YS9A 4RDUA 1MH4A 3S2HJ 3ZQFA 5EFYA 1BL0A 3BR0A 1GT0C 1DU0A 2NP5A 2QIBA 4M3FA 4M6VA 2MG4A 4MFDA 5K58A 3ZQLA 3CJDA 5E3MA 4MK6A 3HOXJ 2PMZN 3BR2A 5EDNA 2QOPA 4C3JJ 4C2MJ 3C07A 2QCOA 2M9HA 1T56A 4BXXJ 4A3DJ 1F43A 5FMPA 2X9DA 2I10A 2H1KA 2GUHA 3BT9A 1TWGJ 5E3NA 4FE7A 1UG2A 1JGGA 2XDNA 4DZJA 1YRNA 2DMNA 2JA6J 4A3EJ 1CQTA 4IHYA 3K2AA 1ZKGA 2HQ5A 1ZR2A 3RZOJ 3PM1A 5F0HA 3S1QJ 3KKCA 3LSJA 4A3BJ 3IUVA 2GM4A 3E7QA 3O60A 5FLMJ 3BHQA 4L5EA 3KZ9A 4JNNA 1FEXA 4JL3A 1GV2A 2CRGA 4BY1J 4B4CA 3ANGA 2DTZA 2K40A 3H0GJ 4JX4A 1D5YA 1XC5A 2FD5A 3I4MJ 3KNWA 1JT6A 3A03A 4A3IJ 1E3OC 3V6GA 4BKXA 3BQZA 3NNRA 2VUMJ 2QKOA 4LOCA 1H8AC 3BCGA 2OERA 5AQCA 5GPCA 3HTJA 1O4XA 4D5FA 2FBQA 3C2BA 4S0HB 3ZQHA 1RETA 4Y7NJ 2XGDA 3SJMA 2ELKA 1QPIA 1TC3C 4AUXA 3AQSA 1LFUP 3GTGJ 3SFIA 3A02A 4BBSJ 2ZCMA 2FJ1A 1VFCA 2NVQJ 2RASA 3BRUA 2R0QC 1JJ8C 1P7IA 1ZQ3P 2O7OA 1G2HA 1ETWA 3LOCA 3I4NJ 5F04A 2LR8A 1Y1WJ 3S1NJ 2JA7J 1GV5A 3DCFA 3G56A 1X2MA 3S1RJ 3CRJA 3VOXA 2VPRA 4CGRA 1Z0XA 3E7LA 2Y30A 3Q0WA 5CXIA 3HOUJ 3AQTA 4M3EA 3QQAA 2EZHA 2FQ4A 3BG3A 2JMWA 2D6YA 1MSEC 1UI5A 3ON4A 2ID3A 4W1UA 1MBFA 3BJBA 2FX0A 1IUFA 5EGOB 4MXMA 3JRAA 4XRSA 1VI0A 2H8RA 2JA5J 2CUFA 1WI3A 3HTHA 2R5ZB 2MW8A 2UXUA 3LJLA 1RR7A 1K61A 4C3HJ 3VW0A 3H3VK 2ZOZA 4ME9A 1LFBA 5M5YJ 5EG0B 2JN6A 4J19A 2G3BA 2UXPA 1I6HJ 5FHPA 1OJLA 3HOZJ 1W0TA 3WHBA 2UXOA 5GP9A 3NPIA 1AU7A 3FK6A 4A3FJ 1FIPA 2WUIA 5K7ZA 3BQYA 2ME6A 5DS9A 4IHXA 4A3LJ 2L9RA 1UHSA 1TWAJ 1EF4A 3BR6A 3S16J 3VW2A 3OIOA 2DJNA 3GTLJ 1F36A 3IH2A 1ZGWA 3EGQA 2HOAA 1RPWA 3Q0UA 4GCTA 3TP0A 2HYTA 1P7JA 5HSZA 1JUPA 5FKNA 5JLXA 3MN2A 1GDTA 3GTQJ 3PO3J 3GTJJ 1ETKA 4I6ZA 2VKVA 4JX5A 3MNLA 5HAWA 1BW6A 3BR3A 4IHVA 3A01B 2KT0A 3K7AJ 5F0FA 2R5YA 1FTZA 1LE8A 2L0KA 2XGEA 3QKXA 2LKXA 2VKEA 2KDZA 4D7NA 4DZPA 2AO9A 1MSFC 3HBLA 3BTCA 2X48A 3OSFA 1ZK8A 2M8GX 4UUSB 1BJZA 3GBGA 3JR9A 1DU6A 3FRQA 3S2DJ 2ECBA 5C4JJ 1QVUA 2Y9YA 1IGNA 5FJ8J 2V57A 2L7MP 3GTOJ 1RKTA 5E3OA 2OF7A 2DA2A 2IBDA 3RH2A 5M3FJ 2PZ9A 2COBA 2LP0A 2NS8A 4NN1A 2AHQA 2IU5A 3BNIA 3RQIA 2XRLA 2LD5A 4JX6A 2LFBA 3V78A 2OPTA 3S14J 3LHQA 3BTLA 3GZIA 1ETOA 1WH7A 3HEFA 1X2NA 5IYBJ 5EF6A 1B8IB 2K9NA 1AKHA 1OCTC 1MNMC 1FJLA 1UI6A 1JJ6C 2M0CA 1JKOC 3Q0VA 4V2FA 5FKLA 2YU9J 3JRGA 1RKWA 4FISA 4CYCA 3JRFA 1X58A 3VOKA 5BNGA 2E2HJ 3HTAA 3TW7A 2CU7A 5J1UA 1ENHA 3NXCA 3VVYA 1MBEA 5F27A
chains in the Genus database with same CATH superfamily
3DP7A 2E2JJ 3DKWA 3K0LA 2LLKA 3O6BB 1O3QA 1MMDA 1YS6A 1P6RA 1LKXA 2EZIA 2QKMB 2DXIA 5IT3A 5FGLA 4PFPA 1HF0A 1PUFA 5GAHJ 2HXIA 4HKUA 1FTTA 1EKEA 2JVHA 2ZNZA 1B72A 2I5UA 1BI3A 1D0YA 4OAZA 2BHYA 3HTUA 4QSHA 4KMFA 5CXGA 2Z33A 1RNLA 3ASNH 4UVCA 3O8GA 4A0YA 3CD6I 3HOYJ 4D5CA 2F5FA 2M4GA 3FX3A 4LGWA 2EFOA 1LEAA 2XUBA 4BJ5C 3PASA 3ZCOA 4MNUA 2FUG2 3IL2A 2M2EA 5IY5H 1D8KA 3NS4A 4R8HA 2IP2A 4BE0A 1FMWA 2VQHA 5L3EA 4ZZLA 2K5CA 3FK7A 4U9LA 3EUHA 3HZJA 3T6NA 1OPCA 2VPLA 3T0YA 4XRFA 1VQ4I 4DNCA 2ZCNA 3FKIJ 2HOEA 1U3EM 4UDSA 3NEUA 4GYGA 4DQ2A 1TL8A 2VODA 2B1EA 5EJCA 4C2MA 4XMYA 2MSYA 4RB1A 2NVXJ 1KU7A 3MKZA 3BG6A 1R00A 3MZYA 1JKRC 4FCYA 2NP3A 2TCTA 4HG2A 1B9MA 2TDXA 5IPAA 2WAFA 4Q4ZF 3VUQA 2KIFA 3O8HA 2QTQA 1A6IA 1Y0NA 3P5JA 3LSHA 4A93J 3VVZA 2FBHA 3WHCA 4LD5A 4DW6A 1OKRA 4KIGA 1S7OA 1HDPA 2PN6A 5J1YA 1SAUA 2HR3A 2A3SA 2W48A 1WJEA 4II3A 1H0MA 4CH7A 1S72I 2E5NA 2OV7A 3M1EA 3VPRA 1XN7A 4EM1A 4YELA 3WU2C 4KT6A 4WCGA 3JREA 3VWBA 1WPKA 5IYCJ 5E8GA 4GFLA 2IEKA 1ZARA 2ZMEC 2VASA 4XLFA 3D5SC 3G6EI 3ABLH 5GAGJ 2PBXA 1S5LC 1W7PA 5HBUA 2JPBA 3T1BA 4XSZF 3VODA 1T33A 1IRZA 2GA2A 3KEOA 2VJ5A 1TWHJ 1DGWY 2EINH 3QP5A 4E7JA 3QBMA 3LQRA 3JRBA 2P6SA 3A2KA 2ZO4A 1K78A 1AHDP 1R4NB 5DD4A 5GPAA 6PAXA 3IHUA 2BVMA 2O0YA 3VSLA 3L2CA 2R7QA 3HGYA 3L2WA 2DYRH 4ZYHA 2P81A 1JKPC 1R6RA 3GYHX 2W82A 1QVTA 1I5ZA 5ICEA 4D7MA 2IGOA 2GOXB 5FROA 5AONA 4XRSG 3GMEA 2Y9ZA 3ON2A 2JUGA 2FF4A 2HQAA 4BAYA 4XKCA 1NG7A 1N78A 1ZREA 2XGCA 3H9GA 4RGUA 4RBOA 4WXCA 3CC2I 5F1RA 3J80K 4XICA 2OC6A 1YI2I 1XX5A 3PSFA 3U9GA 3LA3A 3TDZC 3G2BA 3K4CA 3VYRB 2BY3A 2GIVA 3WE2A 1IN5A 1K6OA 5K1YA 2EV5A 2Y2ZA 4A3JJ 5FKKA 3SEZA 4EEFG 1N77A 2F4OB 4CICA 4HNTA 3T8TA 4DJAA 2Y0SN 4P96A 5L3CA 5CVRA 2OU2A 4MO7A 4L5IA 1Y8RB 2VOPA 1A35A 2IT0A 2XHKA 3V4GA 1TBXA 4EQQA 5EGOA 4G7ZF 2H27A 1MD0A 3S5RA 2UZKA 2CV2A 5DTDA 5J4YA 3KCCA 1LNWA 1X1AA 4HAMA 4BQQA 4ABZA 3L2QA 3G7RA 2RQQA 4IOAF 2W24A 2K9SA 4JP0A 3ZQQA 4EJVA 1IF1A 2JA8J 3M07A 3A0BC 4IL6C 3OYIA 2EQRA 2M30A 3K4MA 1OISA 1NH3A 3COLA 3U1DA 2DFIA 4CHUA 2R93J 5AIPA 1ACIA 2HKUA 4XLPF 3ZMVA 4I98B 2L9VA 3BR5A 1KQ9A 2M0MA 4HLXA 4CSWA 4L0ZB 1EV7A 2IGNA 2MYSA 4CGZA 1FY7A 2BHZA 3FXMA 3VYSB 4KICA 2XKOA 4B43A 2P5LC 3BTIA 4KN4X 1NK2P 2GIZA 1O3TA 1VTNC 4DYQA 3S2DJ 2QF7A 3LSPA 2Z5UA 4HOBA 3F8BA 4CA0A 2DFFA 1PUFB 1BIBA 3RSNA 3KKDA 4HV5A 3K4NA 3I0TA 1B72B 2HKOA 2B0LA 2Y48A 1FYLA 4BS9A 2GQQA 3OYDA 2Z1DA 4PDKA 3K1MA 4BJ6C 5H20A 4OIQF 2IRFG 2VJ4A 3MEXA 2ZOYA 2DK5A 1D5VA 2EIKH 1OCPA 5HVQC 2R92J 3OOUA 3IV5A 2CUZA 5FD5A 1EJ9A 3GTMJ 3OYHA 1GUUA 3I3LA 1UG0A 4RGXA 1LVKA 1XPXA 2KZVA 4HX8A 3OSGA 4B1RA 1MIJA 4NHJA 2VQCA 2JPCA 4B09A 2V79A 4GO1A 1FPQA 4M3DA 4BBRJ 1PDNC 3VVXA 4QPOA 4A3KJ 1GLNA 1E3PA 4EATA 4IQJA 3S17J 3F1BA 5ICFA 1ETVA 2UXHA 3WTUC 2FXAA 1WJBA 3H35A 3ZGKA 1IN4A 2G9WA 2LDUA 4OMZA 1Q1VA 3JRDA 2NS7A 3JW4A 2AQFA 3TKYA 1U2WA 2D5VA 1IRGA 1OFCX 1Q1HA 2M87A 2R7XA 1HLVA 2HKXA 4RMNA 3H0DA 4Y15A 5JFRA 1BL0A 1GT0C 4L18B 1WFXA 1YOVB 3LFKA 2P5VA 3CJDA 1WVRA 1Z91A 4AM3A 1G6NA 2QM3A 2VBYA 4CDGA 4YIFA 2CW8A 5EDNA 2QOPA 4A3DJ 3HSRA 3HPHA 4ZZDA 1YJWI 2XDVA 1V5EA 2VJIA 1HKQA 2I10A 5BMZA 1B9NA 1H9TA 3W3CA 1T38A 1X4PA 5JVTA 1TWGJ 3ZMUA 4DZJA 2ELHA 3RI4A 1ZKGA 1QU3A 1DGRM 3DLLF 2LF8A 4HDUA 4YFNF 1IRFA 3LSJA 1W7PB 2GM4A 3IUVA 3MD2A 3FXQA 1FEXA 4JL3A 2CRGA 3Q9SA 4B4CA 3ANGA 3H0GJ 3SZPA 3A03A 2K27A 4IOCF 4A3IJ 1E3OC 1Z3XA 1K78B 4U88A 4BHPA 2XASA 1ZRCA 2V1XA 3BCGA 2OERA 5GPCA 1ZHFA 3I54A 1I6XA 2FBQA 3IKTA 2DODA 1IW7F 3KP7A 2E36A 4BXFA 3AQSA 2EWNA 2E7WA 5KAFC 2HFHA 2DYSH 3GTGJ 2HVSA 4IRIA 1TQMA 1YX3A 3AG1H 4U7BA 1VFCA 4KFCA 2R0QC 2IVMA 2WC2A 5DM7F 3MZHA 4XN0A 1G2HA 1I27A 2VC1A 3LOCA 3GX4X 1X3WB 3VB2A 3S1NJ 1XGNA 1GV5A 1D1BA 1UCRA 3PNTA 1XGSA 2UV1A 3DCFA 3G56A 1BOAA 2L7KA 3S1RJ 2VPRA 3CUOA 4CGRA 3Q0WA 2Y30A 1G3YA 3MQ0A 1BI1A 5CQGA 2R7FA 1JI8A 2WY8Q 2JMWA 2LC2A 1IO2A 4XBFA 1A36A 5FLXK 1YX5A 2P0WA 2ZSHB 3HIFA 5HS9A 5HNFA 4I01A 5EGOB 5D4SA 4XRSA 1KONA 1K7AA 1W7PD 3JTGA 2XAFA 1ZG1A 3B73A 3K4JA 4UY8I 1W1WE 3E5QA 2UXNA 1T39A 2W00A 2ETHA 3H9JA 2MW8A 2GXBA 2UXUA 3LJLA 1K61A 4IVNA 3ROUA 1Z1DA 3MKYB 2XAGA 5LRSA 4E4HA 2UXPA 2R3SA 1OJLA 1IN8A 2KJCA 3F6OA 1AU7A 2VC0A 2WUIA 5K7ZA 2ME6A 4IHXA 2L9RA 1UHSA 1J0RA 2V1DA 1TNSA 1F5TA 1ONVA 3FXRA 3S16J 4U9NA 3GTLJ 4WX9A 4F91B 2HS5A 3DLAA 2GAUA 4AIHA 3HG9A 1GXQA 2VT3A 4EJTA 3LA7A 2HYTA 5HSZA 2LY1A 2XRNA 5JLXA 1GDTA 4ESJA 3AL0C 3MNLA 1ETKA 1JGSA 4JX5A 3AAFA 4IO9F 1YTYA 3K1NA 5HAWA 3K9TA 1YS7A 3BR3A 1A6QA 3KZIC 5JHUA 2R5YA 1FTZA 2L0KA 2CSOA 1NHAA 2XGEA 5LRRA 3QKXA 3CCLI 2LKXA 1SFXA 1YYVA 5GAEJ 1SVOA 4HF1A 1MSFC 1XDSA 2L4MA 4ZYAA 3HBLA 5HOOA 4BQAA 3Q9VA 2M8GX 3L9FA 3GBGA 3L00A 2DOEA 5LGTA 2JA2A 4XKBA 2PEXA 3FXJA 1QZZA 3HC7A 3E6DA 3BNIA 3RQIA 3HTSB 2LD5A 1MJ9A 4JX6A 1UJ8A 2OPTA 4H0EA 3BTLA 1ETOA 3CZ6A 2X1DA 5EF6A 4OIRF 2OUMA 4XKWA 2K9NA 3FMSA 1MGTA 4EM0B 3ECHA 1MDMA 1MMAA 4CXFA 3JSPA 1SVLA 4EM2A 1IAWA 1IV8A 4JQFA 4V2FA 2YU9J 4MEYF 2K4JA 3JRGA 5LBQA 3E0JB 1Y39A 2EIMH 2CU7A 1ENHA 4AWXB 3I56I 3NXCA 5F27A 4NB5A 1OR7C 4Y13A 1D1CA 3CF5F 1XCVA 4XM3A 1UMQA 2JRTA 3WTTC 5E8IA 2NVYJ 1ITYA 2E7XA 3J80Z 3T8RA 1FYMA 1FOKA 4FT8A 1DDNA 3HIMA 5LLQA 1TT0A 2VE8A 3QPHA 5FRNA 3F0CA 4M71A 2KRFA 1TWFJ 1HQCA 1J09A 2YUSA 3AG4H 1K4SA 3LNQA 2IJLA 3C2HA 3DKXA 3CQZJ 2GENA 1TLHB 3FXOA 1TNTA 3F3XA 2REKA 5K7HA 4NDLA 3U2RA 2JWTA 2K02A 3BG5A 4B3AA 1DPUA 1T0FC 4Y33A 4GCKA 4A3MJ 2AS5F 2KFDA 1OMIA 1MBGA 1MBKA 2VBWA 3FF5A 2FA5A 1Z77A 2F4MB 1X1CA 1VQ9I 2LRDA 3GFIA 1KQ8A 2GFNA 5CW8A 2G7LA 3OYEA 3P7NA 4XIDA 4PFOA 4AIDA 4DBRA 3O2PE 2KMUA 3ABKH 4CZZA 1LVAA 1UB9A 1ORKA 4BEHA 4DYCA 2DCEA 3K6GA 4YFKF 2A2FX 2X6WA 2XPUA 4ENJA 3IKVA 3FM3A 5BPDA 2HNHA 2D45A 4KUMA 4IHTA 3F9KA 5FFXA 2OTJI 3HE0A 4KIBA 3H36A 1F4KA 2WV1A 4Y3OA 4XORA 3ERED 3ZQCA 4DYRA 4AD9A 4MLOA 4LITA 1T08B 4G7OF 2IS2A 3HRMA 3JRCA 2ZXIA 3K10A 4A3GJ 1KU9A 2OQRA 5C44J 1SFOJ 1HBXG 1VNDA 3F8FA 4EJOA 3K69A 2VB6A 3E5UA 1XDUA 1G3WA 2XVCA 3K4LA 3CO6C 3GTKJ 4NC7A 1JKQC 5D5UB 4E7KA 1U8BA 4QIWN 3RPUD 2ZMEA 2ISZA 3WU0A 2KISA 1FSHA 4ASNA 4ZYEA 1YW8A 1LPQA 4FE4A 4LLLA 1R5GA 4ZDPA 1YHQI 3GWZA 2EFWA 2ZXHA 3U21A 1UZCA 5IP7J 3DXJF 2EK5A 4Y4RA 1L3LA 4IEJA 2J5OA 4W97A 3ELKA 3QYEA 4B44A 3BP8A 4FQGA 2PJRA 1BI0A 2MGQA 2XAHA 4XR6A 4ETSA 2LVSA 5M3MJ 3OYLA 1ETXA 3DPLC 1X1BA 4KJZA 3KYCB 4NELA 2D1VA 2LOOA 4ANJA 1D0ZA 2DA5A 4LG3A 2DMTA 1ZLKA 4C30A 1TZLA 2VBXA 3NRGA 3P9IA 4RB0A 3REOA 2WAQN 1UELB 3D1NI 3R6SA 3ULQB 2LNBA 4RA2A 1UAAA 3I9V2 1QRYA 3CMAI 1FOYA 4G6TB 5H9TA 2CQQA 2L54A 3GEUA 3EUPA 1U5TC 3GZNB 2JSCA 2R7WA 4A2UA 5LFAA 3QWLA 2HEOA 3LSRA 3BPXA 2R5YB 3W6VA 5FRMA 4ICHA 2GBYA 3E97A 1JHFA 1MZBA 4MTEA 2FBIA 5B5EC 2O7TA 1GHCA 4G94A 5B3SH 3CCRI 4YIIA 3V7SA 2E2IJ 2GXAA 3COAC 2Y0MA 1RESA 2X1CA 4BU2A 3K70C 3MVPA 4FETA 4V19K 3BPVA 3ML6A 3IAS2 3WG7H 2M5WA 2ZFUA 2XV4S 2DOFA 1BIAA 1UFMA 4EJWA 1WH5A 1HCRA 2KKOA 5IOZA 4U0YA 1SC7A 2PFBA 3NAUA 1IXSB 5J1RA 2DA7A 5L3DA 5ILUA 2EILH 3IAM2 2DN0A 3LSGA 4RB2C 2WB1N 2M34A 2H8WA 4M72A 1MDMB 1I39A 3KE2A 3RYPA 3ZQIA 3DTEA 3VYUB 3DV8A 4P9UA 3CC4I 2QQBA 4HX7A 2L7FP 3TEDA 5EG0A 2FEZA 1FOWA 4KISA 1D3YA 3J7YJ 4E7LA 4PK4A 3DPUA 1G8XA 2O5RA 4X1EA 3DEWA 3IUOA 4B47A 5M5XJ 3IRRA 2QA4I 1FP2A 2LY9A 2FNPA 2RN7A 3BDDA 4RLQA 3K2ZA 2EA2A 3NI7A 3TBIA 3HTIA 3ABUA 1XD7A 2NNNA 3EUAA 2UXIA 3CWRA 4BE1A 3KZYA 3TO7A 3BR1A 4JBAA 3KYDB 5ICGA 2G7SA 4Q47A 2Z99A 1YW7A 1D1AA 1FZPB 2DA6A 3H3UA 1W5CC 3V7CA 3BLYA 1IG7A 1I50J 3A01A 2M8EA 1POGA 1D8JA 3I55I 5IYDJ 4GDFA 2LBFA 2QGUA 2NX4A 2ECCA 4XOPA 2PMZA 3S1MJ 2FOKA 4AU7A 1R22A 1IV6A 2ZJQF 3ZPLA 2EB7A 1IRXA 2LTPA 4HF0A 3EUKL 3HRSA 2A07F 3E6BA 4BEHB 3EYIA 1XTAA 3SFZA 2VLAA 3QRFF 1HW5A 5H6QA 2H09A 4IHSA 4AC0A 2LF7A 4Q48A 5F64A 3SDGA 2KHMA 4HA8A 3I59A 5EEGA 2EZKA 2K9QA 4P9FA 2G0EA 5CYVA 4IF4A 2ZXWH 3F6VA 4CO8A 3PIPF 1U78A 4IRVA 2QSFX 1W0UA 2L01A 1RZ4A 4A69C 4AYBN 1FOXA 3JSJA 1ZN2A 2BE5F 2IAIA 1I1SA 4UUVA 2RHAA 1T8IA 2Z16A 4PXIA 2Y0SA 5IT9K 2OZ6A 3HGGA 3OL4A 4RDUA 3BJOA 3ZN1A 3S2HJ 1KGSA 3H5NA 3ZQFA 4C9YA 3BR0A 3OYMA 3S3NA 4IX7A 3TL4X 5AIQA 2XROA 1LQ1A 3ZQLA 4KYWA 1EA3A 5E3MA 2EFQA 5K58A 3CP2A 3HOXJ 1LB2A 2PMZN 2OZUA 3DBLB 2UWMA 1S9HA 2RDPA 2CUJA 4C2MJ 2ZMEB 2NNYA 1KYZA 4BXXJ 2JQ7A 1X3ZB 4RGSA 1VQ6I 1W5SA 2GUHA 1OLTA 3LQQA 3F8MA 4FE7A 1JGGA 1YRNA 3L7WA 3FXUA 4A3EJ 1P9QC 2JA6J 3EDPA 2NVUB 4ZH4F 3JAMK 3RZOJ 3PM1A 3JTHA 1YFHA 4MEXF 4BJTA 1VQNI 2PJRB 3I4PA 4A3BJ 1HA8A 5F6FA 4A6DA 2F5EA 1AOYA 5FLMJ 2BXZA 4L5EA 5L3GA 1KQ0A 4JNNA 5B1AH 4OWRB 1GV2A 5LGUA 4KA4A 2NXNB 1XC5A 3KNWA 3PFIA 3KP6A 4L5JA 2V6EA 3V6GA 2X51A 4OD5A 3BQZA 2VKHA 4LOCA 1H8AC 2A61A 2OAZA 2OJED 3TOBA 3DKYA 4D5FA 4HSRA 3SXYA 3HYIA 4BL0B 1ZG5A 3M8JA 4Y7NJ 2MFZA 2VJJA 2DI3A 2ELKA 4BE2A 3CUQA 4NNJA 4MQ9F 5JVGF 1ULYA 4L9JA 1JJ8C 3QYFA 4HF2A 1P7IA 3KP3A 5E79C 5A2QK 4LLGF 4LLNA 4EGYA 4B48A 1ETWA 2V4JC 4BYYA 2QQAA 5HS7A 1YW9A 2LR8A 4RLFA 1Y1WJ 2JA7J 3TGNA 2HTJA 2DOAA 3IWFA 1WWXA 5CLSA 5E20A 3VOXA 4E7HA 3QODA 3E7LA 2KZGA 5HS8A 4M3EA 3QQAA 3M9AA 5HDGA 2FE3A 2E1CA 2AQEA 2DLLA 3OOPA 3ON4A 2XIGA 3MAJA 4P5OA 1IUFA 4MXMA 1FWZA 2HZDA 4DOZA 4CYDA 1RIOH 2H8RA 1R5HA 1WI3A 3CJQB 1TP4A 3QU3A 1WRJA 1E17A 3WGHA 1RR7A 3CJRB 4C3HJ 3ZQ7A 3H3VK 4Y17A 4ME9A 1VQPI 4QWQA 3J7AY 2HWVA 5CKTA 5M5YJ 4C2UA 1LDDA 4LIUA 5EG0B 4XKVA 2XAUA 2B3WA 3OS0A 3HOZJ 3WHBA 4RB3C 2W25A 2KIMA 2DU9A 4R1HA 3WTWC 3FK6A 3L09A 3HRTA 4A3FJ 1FBQA 2C6YA 4I0AA 4M6YA 3SDBA 1FT9A 1ZAOA 3OIPA 1IN6A 1TWAJ 1EF4A 2DT6A 3SYTA 2DJNA 1F9NA 3AG3H 3IH2A 2ZJPF 4F92B 2QEXI 2DPDA 1I3AA 2ZBKA 4A5MA 4L0YB 2R7VA 4GCTA 3GLLA 3NWTA 3TP0A 1JUPA 1R36A 4I6ZA 1G3TA 2VKVA 3R0JA 2L9NA 5E1XA 4ON0A 4IHVA 3A01B 1FC3A 1MW7A 1ON1A 1XGMA 2MH9A 1U8RA 3CMEI 5CVVA 2E34A 2LY2A 3N05A 4F93B 2LBFB 5ILVA 4DZPA 3T5XA 1YLFA 4PUSA 1R4MB 3F72A 5HLIA 3S8PA 3L2UA 1XB4A 3FMQA 2FSWA 3JR9A 2X6XA 3OS1A 5DCFA 5FJ8J 3SZGA 4B8XA 3M8EA 2V57A 3TOAA 2K4BA 1BR1A 2OF7A 1P2FA 1XSVA 2IBDA 5E17F 5M3FJ 2PZ9A 3RH2A 2LP0A 1QNTA 4RAGA 2FOWA 3TDUC 3EQLF 4NN1A 2L9SA 4O3MA 2IU5A 4EJUA 2JSPA 3CJNA 2XRLA 5FO5A 3I59B 3V78A 4UVBA 3RPUA 4Z2YA 1MKMA 3CCVI 3LHQA 2YX4A 3HEFA 1X2NA 2QBYA 2M7AA 4L9NA 4DVYP 1OYYA 3SHFA 1PP8F 1JJ6C 2XKPA 2M0CA 4CCMA 4XONA 3ZXSA 2OCEA 2W1OA 5FKLA 4CYCA 4QPQA 3JRFA 1X58A 3TW7A 3GFJA 2CW7A 5J1UA 4YEJA 1RUNA 4N4NB 3QP6A 5HDNA 3VVYA 4ZTJA 2NAZA 2NRAC 3PJRA 4HZFA 3WTVC 2DT7B 1OYIA 2PQ8A 3KX2A 3BTJA 2W84A 4G12A 4UV8A 3RPQA 5HLTA 1ZELA 3HHHA 1Z7UA 3QPSA 4GFBA 5BQTA 4CCLA 3DPJA 2H6BA 3GO5A 4PSWA 4A5NA 2VE9A 1T0FA 1JTXA 5J4VA 3PO2J 4XSXF 1ETYA 1YRNB 2QQ9A 2LYCA 2CFXA 5HDKA 5EEAA 3G1LA 4K2EA 1E0EA 1XSDA 2H6CA 5C3EJ 2DA1A 2A5YB 2VI6A 3QYBA 3RIRA 1DUXC 3GTPJ 4HQMA 1YJNI 1IC8A 4F7ZA 2DG7A 4AVPA 4ENNA 5EZGA 5H6RA 2ZJRF 3KYLA 4PGHA 4ENKA 2JJ7A 2X6YA 2B63J 3KFWX 2VKDA 2XSJC 4XN3A 1J9IA 1BW5A 2W53A 3G1MA 3CO7C 1OCRH 2QUFA 3BZCA 3CUQB 3M3YJ 2EJRA 3WTXC 3HOSA 3JRHA 2WADA 3BZ6A 1B59A 4II2A 5CQEA 1TW3A 2ESNA 3LMMA 4CCNA 1V5GA 1J75A 3HKZA 2FU4A 2X4HA 1HOMA 3SQNA 5F0CA 3CC7I 4WF2A 2QWWA 4BACA 2X6OA 4OMYA 3CJTB 4PJJA 3SEQA 1SANA 2DMQA 2DJIA 3HOTA 1SAXA 3R60A 1PP7U 3ISPA 2V6CA 1NTCA 3KLNA 4HPQA 3TP3A 3J81K 2O8KA 1KU3A 4P55A 2IS1A 4KT5C 1H88C 4JYKA 2DDBA 3NWSA 5ICCA 2HDDA 1N25A 3GFLA 2K9MA 3CDLA 2HYJA 4PJMA 3R0AA 4DGWB 4ENMA 4KIFA 4V2GA 2G7HA 2VQLA 2HYFA 3ERMA 5J8FA 3CLQA 1X4OA 4YIRX 2DFEA 5M5WJ 3DEUA 2VOOA 5DUIA 3DBHB 3HUGA 2P5KA 3RKQA 2CJJA 3LWJA 1OCCH 4ESBA 4HNUA 4RGRA 1W4MA 1PUEE 4LIVA 4XLCA 1DPRA 3F8NA 5KHDA 1SFEA 3HKZN 2NVTJ 2K9LA 2YX7A 4XL9A 1QO0D 4ACIA 3RKYA 4BDZA 2XF7A 2A6TA 3UKGA 2PBIA 2WAEA 1VF9A 2UXXA 4AF5A 4JK1X 3GEZA 5IT9Z 5JI6A 5D5XB 3L2RA 4I0BA 3HDDA 3BG9A 4FTHA 2FJI1 1U5TA 2ADUA 2LREA 3TO6A 2F5CA 3JRIA 3CCJI 1CGPA 2ESHA 2ZJ2A 1V4RA 2KPMA 5C4XJ 1YIJI 1T98A 5FD6A 4E7IA 3H5AA 1K6YA 3KP2A 4GFKA 4XK4A 3PPBA 3DFGA 1E3HA 1O57A 2JK3A 4L9TA 1O3SA 2IA0A 4IRHA 3HB9A 1YITI 2HXOA 3F21A 1F1ZA 1SD5A 3LSTA 4PCQA 3CCSI 3S3OA 2DG8A 2MD0A 1ZGAA 4XNFA 4O6JA 2ZCWA 3S2WA 1HDDC 2W85A 1XS9A 3P9TA 2KIUA 2HOTA 2L7ZA 5CPRB 3JAMZ 3W2VA 3GW2A 2XB0X 1W36C 4KWAA 3HL2A 4WXDA 5KAIC 4HQEA 3OIQA 4I76A 3CCMI 1U9OA 5K5RA 3VIBA 4IQ4A 2VONA 4IHWA 3OYKA 1HKSA 1RR8C 5D5VB 3GCMA 4UVAA 4AIKA 1KA8A 4OIOF 3D5RC 1HC8A 3Q5FA 4GYIA 1RI7A 3LL7A 2RAEA 2UUZA 2X0LA 3B81A 1R23A 2EH3A 1DP3A 5BS6A 3MMYB 2B7EA 2QBYB 2F4IA 3ESWB 4UV9A 5DAJA 5F08A 4BUPA 5H2FC 1R1VA 4HNVA 2R5ZA 3PQKA 3CCYA 1G3SA 4UUTA 3VEPA 4CYCB 2PMHA 2Q8KA 1PJRA 2LK2A 1RRJA 2GA1A 2O6GE 3HPGA 4QLCU 1IDYA 2EZLA 5L3BA 3ABMH 1FSEA 2ZNYA 4NQWA 1RC9A 2WBMA 5A2QZ 4CCJA 3RYRA 1WKMA 4YZEA 2OI8A 1EH6A 2E19A 2VXDA 1IUYA 1BC7C 2JT1A 4PSXA 2RNJA 1C0WA 2OCCH 5F1JA 3RD3A 1GVDA 1G4DA 5DV5A 5EYRA 2EA4A 1XCBA 1BC8C 2YVEA 3LA2A 1SVMA 2YVHA 2DA3A 1TT5B 1JT0A 2HVRA 2W4SA 3HOWJ 3C18A 5LEKA 2ZXJA 5TISC 2O8XA 2EFPA 2CQKA 2XF6A 3FHNA 4M3GA 5HNHA 1WGXA 1FIAA 2M7BA 3RCOA 2WAQA 4UNOA 2O9LA 2IGMA 4FASD 2X1EA 2K85A 1USTA 2KRCA 5BPIA 5LHIA 2M1BA 2HVQA 1IXCA 2XPVA 3C2GA 2HQRA 1BA5A 2F2EA 2VT2A 5HLHA 1IN7A 3CTAA 3Q3SA 4Z6YA 1FNNA 2FBKA 2CQXA 3D0SA 2XF5A 1JUSA 2ZKZA 2QLZA 3VFZA 2WV0A 3MFKA 3EYYA 2GLOA 3ZN0A 1SD6A 4N9IA 4BHCA 5K5OA 1M1EB 4CUGA 1B8IA 2E1MB 3C7JA 2Q2EA 1HSTA 3PQJA 2RV8A 2ME0A 3A0HC 4YFXF 3M7GA 1XMAA 2VBZA 3BG7A 2CS3A 2B9SA 4GCLA 2K3PA 3OYBA 3K1PA 1Z67A 2GOMA 4KITB 1MH4A 1P92A 2K86A 1DU0A 2YU3A 3BCAA 4MHGA 4M6VA 2WB1A 3X2QH 2O03A 4MK6A 4DBQA 5LD2C 3BR2A 4GGGA 3WG9A 4L9VA 3C07A 4C3JJ 2QCOA 2A68F 1T56A 1F43A 4Q5SF 3ZMDA 3BJ6A 2M45A 2FRHA 3L2VA 5FMPA 2X9DA 3BT9A 5J8CA 5E3NA 2STTA 3LWFA 4NC8A 3HUGB 2HTSA 3K2AA 1CF7A 2HQ5A 1Y0UA 2MABA 3ASOH 5JR3A 1VQMI 3QAHA 1ZR2A 3S1QJ 3KKCA 1Z21A 1WI9A 3E7QA 2HDCA 2HPMA 3O60A 5GADJ 3V8JA 3KZ9A 2QSGX 4BY1J 2EV0A 2YSRA 2K40A 2R7RA 1VQOI 2FD5A 3EPZA 4E70A 2LMDA 4HBLA 3BWGA 4BKXA 3NNRA 1BR4A 2VUMJ 4EV0A 2V1UA 1FP1D 5DD8A 3OYFA 1U5TB 1YE9A 2AXLA 2ISYA 1O4XA 3OY9A 3C2BA 1S8NA 4OD4A 1JHHA 4RAFA 2XGDA 1TC3C 1LFUP 3I5UA 1Z9CA 3A02A 3BRUA 2RASA 3NRVA 1REPC 1Y6IA 2JUCA 2D1HA 2OD5A 4M73A 2NS0A 5F04A 2J5PA 4D9JA 3ZMZA 3DPTA 4UXNA 5FGMA 5TRDA 2IXSA 2LG4A 4BNCA 3F22A 5E18F 1GVJA 1X2MA 5B66C 3G4SI 2WWYA 3HOUJ 4ZTFA 1XMXA 2LSOA 2ZFWA 4AYBA 3CMMA 3J7ZI 2EZHA 2ACJA 2FQ4A 3BG3A 2XC7A 2A6EF 4WK8F 2D6YA 3IC7A 2GWRA 1WSUA 2F48A 2FMLA 2CGPA 2ID3A 4W1UA 3I71A 3BJBA 4F52A 1SD4A 2CH0A 3FZVA 5FLXZ 4A12A 1B1BA 4A6EA 3HJEA 4J01A 1KU2A 2CUFA 4RS8A 4G7HF 1HW2A 3VOEA 2R5ZB 2P7CB 4E7SA 3LAPA 3S93A 4BDYA 3WGIA 3H3ZA 1S6LA 3H9QA 4KDPA 3V8LA 1LFBA 3DTKA 4OIPF 1O3RA 2RC4A 4J19A 1I6HJ 4F55A 4NQWB 2HYGD 2R7OA 1W0TA 3NPIA 1T2KA 3DWLE 3WTSC 2WTEA 1WJ5A 1U6GA 4UB8C 3KETA 1X1DA 4A3LJ 5DS9A 2MC4A 3BR6A 4IPAA 3OIOA 1F36A 3JSOA 4GCVA 2G7UA 1ZGWA 3DF8A 1RPWA 1LEBA 1MMNA 3J81Z 3E3VA 3RJPA 1USSA 2XAQA 2E35A 2E71A 3MN2A 1WJAA 3K70D 3PO3J 1QA6A 2CYYA 2DTRA 2OBPA 2R7UA 2KLOA 2KT0A 1OCOH 3K7AJ 2Y75A 1LE8A 3GUDA 4CZCA 3N97A 2VKEA 5DEQA 2V9VA 1IZ1A 4E6KG 3P9KA 2AO9A 4WWCA 3DU6A 2KQRA 3CCEI 3BTCA 5GTHC 3RDIA 3OSFA 1GXPA 2IPQX 1QZYA 2A6HF 4LK0F 4G9YA 3IWZA 3GF2A 2ECBA 4O5VA 1QVUA 2Q0OA 4HYEA 3SZTA 3OYCA 1IGNA 2DW4A 2L7MP 3GTOJ 1RKTA 5E3OA 2DA2A 3DU5A 5DCMA 5GTIC 2IA1A 1B4AA 2QSHX 3VTIA 4KNYA 1AWCA 4H4KC 3MCZA 3MKWB 3K4KA 2AXTC 3DBRB 2KP6A 2L02A 2RQPA 2LFBA 2W57A 3GXOA 3KLOA 3S14J 2O61A 1B8IB 2DQRA 2Q2EB 1AKHA 1OCTC 1HW1A 4M9ZA 1QQIA 2BW3A 3LSKA 1R71A 2KDOA 2DQLA 3PL8A 5D5WB 4FISA 3H92A 3PNYA 3VOKA 5BNGA 2BEOA 3HTAA 3CESA 1YIOA 4M6XA 2VQGA 3VDXA 2CG4A 5FFZA 2KRHA 2F6CA 2F5VA 3RKWA 4PZJA 1WCMJ 3A1YA 3KEQA 3E5XA 3M8FA 3WU1B 2VXZA 3PSIA 1HXDA 4MTDA 1APLC 2XPWA 1ZRFA 2PFVA 3PUFA 1HKTA 3FDYA 1S3JA 2PLYA 3B6CA 1BJAA 3F23A 2GZWA 5JLWA 2Y31A 2XGXA 1K79A 3AG2H 2XSDC 2BY0A 2HI3A 3P9CA 3ZMTA 4XLEA 4OAYA 4IRGA 4ZC3A 2A69F 5D4RA 5K7FA 2M3AA 5CVUA 1CF7B 1NK3P 1VQLI 4Y52J 4LK1F 4PGGA 3D5LA 3WTZA 2PI0A 3M4OJ 2OA4A 1O7LA 2F5DA 1I3QJ 2PMUA 4E7ZA 2N8GA 3KPHA 1H89C 2QWTA 2EV6A 3TO9A 2WA0A 2E1NA 2RVCA 3KP4A 3G1OA 5DUKA 1R1TA 1TTYA 4BGDA 1JXSA 1KZHA 2WGBA 2R7SA 2EFNA 2BOLA 4XQFA 2P6TA 2G7GA 3N4MA 4OOIA 2CQ7A 1XG1A 1A5JA 1FYKA 2ICWG 4C2TA 3MZ8A 5C4YA 2NOGA 1TWCJ 3I58A 2V26A 1ZR4A 1FBUA 3W6JB 3QU6A 2IS4A 2DMUA 1Y8QB 5KVRA 1Z3YA 2VN2A 3G71I 4FHTA 3JCUC 4MGRA 5KK1A 2RREA 3EUHC 2D2WA 5D8LB 3L1PA 2BVLA 1ZGJA 1FMVA 3LFUA 3IH4A 3F8CA 4S04A 1WQ2A 1R9TJ 3OL3A 5DYMA 2P4WA 3NARA 5FKOA 4IZZA 2HOSA 5D19A 3E6MA 4X0GA 2M4KA 2IW5A 4EMSA 5J47A 1V5FA 1BOBA 2R7DA 5E3LA 3B02A 3S15J 3QPLA 2HPIA 3ZR8X 9ANTA 1WJDA 4U7DA 3J7AO 4YG2F 2DAOA 3OS2A 2K7LA 2MD5A 3I64A 2F07A 3BJAA 3UR3C 1MBHA 2K3FA 2JVGA 3PNVA 1H9GA 1Y56A 1LDKB 3K4BA 4RM3A 3FKJA 1WJFA 1MH3A 1BN5A 1YJ9I 1B6AA 1KYWA 1ZYRF 2Z9OA 3TW6A 1IDZA 4BQOA 4ZYGA 1JTYA 3FIWA 3ZP5A 1RUOA 5KCMA 2NYXA 3OYGA 2EPFA 3G73A 2OQGA 3ANPA 3I53A 3KZZA 5TGTA 2O3FA 1ERDA 5CVJA 4AVZA 1FX7A 4MQVA 5D8KB 3OMYA 5BOXA 4L62A 1T6SA 1ON2A 5J40A 2EIJH 1EH8A 1Z6RA 4FX4A 3BOQA 3VW1A 5E1WA 2XB5A 4PJ0C 1E2XA 1ETQA 2PX9A 3RTRA 2R7TA 1J5YA 1R7JA 4BY7J 3HSFA 3V8KA 3HM5A 4A0XA 1SMYF 1Z05A 1A04A 1YO5C 3IH3A 2KL4A 3BROA 1J7KA 2ZSIB 4AIJA 5B1BH 3KP5A 2CV1A 3IRQA 1TW2A 3GLXA 3TMOA 1OR7A 3SWHA 1QHGA 4RAYA 5D18A 1MBJA 4KN7X 1LE8B 2ZCXA 3OR2C 5LHGA 3CMYA 4M3BA 4HSTA 4HEA2 1S7EA 1MJAA 2H94A 5K5QA 3EETA 1X3UA 4D1QA 4XLAA 5TJJA 1SGMA 1UHMA 3MKLA 1ZG3A 3BY6A 2XAJA 2CUEA 4A0ZA 4U87A 4UB6C 4LG0A 5DDGA 2Z3YA 2MH2A 2DK8A 5DCMB 1X19A 2ID6A 4OINF 3RKXA 2GXGA 4HX4A 3HHGA 3CF2A 1EH7A 1LUJB 2BY1A 3CCQI 1Z6TA 1U9NA 3ZOBA 1P4WA 3GZ5A 2RGVA 3HSEA 1STZA 4BXUA 4ESFA 4QTRA 1AKHB 3FM5A 4S05A 2BW3B 4M9SA 5KNLA 4BHBA 3C1DA 1IJWC 1DP7P 1BM9A 3FXLA 4LMYA 1SEUA 4IKFA 5EZHA 2E1OA 2IS6A 2QKLB 4XRMA 3AFHA 2EBIA 3CUQC 3ZQGA 4JKZA 3R4KA 4GXOA 5FKMA 3VP5A 3HXLA 3TQNA 1SFUA 4MIMA 2DMPA 2BV6A 1ZTRA 4NBQA 2YVXA 1Y1VJ 5JHFA 3S32A 2Q24A 5J6XA 2CWEA 4YRVA 1OYWA 5ERIA 2DA4A 3BZKA 3U1KA 5HLGA 4RM2A 3C3WA 3CDIA 2NOJB 1QZEA 4CCOA 1DQUA 2CW0F 3FISA 2R7ZJ 1T95A 3GVAA 2R4GA 4EVIA 3WGGA 4ITVA 4B3XA 5D1RA 1J2XA 2DFHA 2TRTA 3E1SA 1MNDA 2HZTA 3OYAA 1TQPA 3IP4B 3CCUI 1WJCA 2E5ZA 4HV6A 3AKZA 4CCKA 1VQ5I 2A05A 5CJ9A 2FQ3A 2QQ8A 3G3ZA 3W6KB 3R61A 4I02A 1S29A 1P4AA 2YR2A 1K83J 2BZTA 1SFKA 4ZJZA 1XSXA 1K4TA 5FLVA 1J59A 2ZB9A 3MWMA 2HDWA 5IP6A 3A4CA 2CV0A 2MLKA 1MMGA 3HRUA 3E6CC 5IP9J 4UUSA 1JUMA 2YPRA 5FB2A 3RQ4A 1I1GA 2Y69H 4MFEA 1ZRDA 4P1WA 5HODA 4X6AJ 3RZDJ 1FBSA 4ZDOA 4I7HA 1AA7A 1D0XA 1SMTA 2HGCA 4C3IJ 2QZ8A 4LB6B 2W7NA 3HOVJ 3LAJA 3ECOA 2STWA 1NG6A 5J3LA 1V54H 2DPUA 2PJPA 2ZY9A 2VL8A 3OV8A 3FBNB 4AC6A 3BC8A 3ONQA 5IOYA 1VQ7I 3B6AA 4I2OA 1FLIA 4M74A 3DEEA 2Q1ZB 3VSKA 4A3CJ 3S3MA 4LFUA 2YS9A 2JTVA 3BCBA 3WE3A 1R5ID 5EFYA 4GRIA 2NP5A 3M1CA 4UHTA 2QIBA 2BY2A 4M3FA 4D0PA 3AL0B 2I8DA 2MG4A 4MFDA 1BI2A 4XLHA 4PJLA 5CVIA 4RAZA 3H1CA 2DT5A 2M9HA 3ZRGA 1VZ0A 2CQNA 2MLGA 1XGOA 4G6DA 1QPMA 1HSJA 2H1KA 2ELJA 1UG2A 4J00A 2A5WA 2XDNA 3LSIA 1Z7LA 2DMNA 2L4AA 4IHYA 4R79A 1CQTA 1P4XA 4M9XA 5F0HA 2OTLI 2BBYA 1MMSA 4WIBA 4TV7A 3BHQA 4N9HA 2LKSA 1YQAA 5LHHA 2DTZA 1PVEA 4JX4A 2MA3A 1D5YA 3I4MJ 1N75A 1JT6A 2JRMA 3V7RA 4F3QA 3CLOA 2QKOA 5AQCA 1MJBA 3HTJA 2WY7Q 2MC3A 2CFOA 2IA2A 1SD7A 4G6QA 4S0HB 3ZQHA 1RETA 4FX0A 3SJMA 1R49A 1QPIA 4AUXA 2KIQA 3SFIA 3OR1C 4BBSJ 2ZCMA 2FJ1A 2NVQJ 4WXHA 1WZ2A 1LDJA 1ZQ3P 2V1NA 2O7OA 1TQIA 3I4NJ 2LKPA 4BH9A 1ZLJA 3CP8A 2KJBA 3QOEA 4U0WA 2E60A 5E1ZB 2VIXA 3K8PC 4JOMA 4NUBA 3CRJA 1Z0XA 3FMRA 4LG0B 2RNGA 4BQNA 5CXIA 5EEHA 3AQTA 1G59A 4XOTA 2H1LA 4HLYA 2ZC2A 1VQKI 3NQOA 1MSEC 1UI5A 2P8TA 1LFPA 1MBFA 2FX0A 5LGNA 1W5TA 1YG2A 3JRAA 1QBJA 1VI0A 3DTIA 1QGPA 2JA5J 5DM6F 2PG4A 5L3FA 4N0BA 3KIOA 1VQ8I 3O3KA 3OYNA 3HTHA 3VYTB 3ZMSA 3VW0A 4DIQA 1XMKA 2ZOZA 3CDHA 3GFMA 1V3FA 1A31A 2P7VB 2CO5A 2JN6A 2G3BA 4HW0A 5FHPA 3FXKA 2FNAA 1UHWA 3GZ6A 2UXOA 5GP9A 4LB5A 2E1MC 3FWEA 2DDAA 1MNEA 1FIPA 3OWTA 3BQYA 2V9PA 3OYJA 1OCZH 2JZYA 2LH9A 1LJ9A 4N4OB 5D6FA 1WHUA 3VW2A 4IJAA 2BGCA 1ZH5A 3W2AA 3EGQA 1R1UA 2HOAA 2V9KA 3Q0UA 4IXAA 2MBFA 5ILSA 1BBYA 1P7JA 3KEYA 3LSMA 2QVOA 5FKNA 1OQYA 3V42A 4EGZA 3GTQJ 1W36D 5ED4A 3GTJJ 4ZYDA 4PJNA 1BW6A 2V7FA 3QOPA 4U0VA 5F0FA 1ODDA 1QHHD 5D6EA 1U0JA 2KDZA 3FHZA 2BXYA 4D7NA 1L0OC 1O7FA 2X48A 3FBIB 1ZK8A 3PUBA 4UUSB 2Z2SB 4ZDLA 1BJZA 1DU6A 3FRQA 4OU0A 5C4JJ 2Y9YA 3PFYA 5LEJA 4LJZF 1R58A 4I09A 2BYVE 3PIOF 2RKHA 3WTYC 2COBA 2NS8A 2QYOA 2AHQA 4HDVA 2DO7A 2HU9A 2FMYA 1X1PA 2L2OA 4G8XA 3GZIA 1WH7A 3WODF 3DQVC 5IYBJ 2L3DA 4KMUX 2COMA 1JE8A 1MNMC 1FJLA 1UI6A 3ABTA 1JKOC 2IGKA 2CMPA 2DBBA 1V55H 2QENA 3Q0VA 3QPTA 1IXRC 4HRIA 1RKWA 2HQNA 1S7AA 2L5QA 3UNGC 3W2WA 2X85A 3H5RA 1PYVA 2E2HJ 4XLNF 4I99C 4NC6A 1MBEA 1BR2A
chains in the Genus database with same CATH topology
2E2JJ 1WCMJ 2LLKA 1UMQA 2NVYJ 1ITYA 3BTJA 4G12A 3QPSA 3HIMA 2EZIA 4GFBA 1APLC 2XPWA 5FGLA 3F0CA 1HF0A 3DPJA 3B6CA 1TWFJ 1PUFA 2HXIA 2YUSA 3LNQA 4HKUA 1JTXA 5JLWA 2Y31A 3CQZJ 1FTTA 2XSDC 3PO2J 2GENA 1ETYA 2REKA 2HI3A 5K7HA 4NDLA 1B72A 1YRNB 4QSHA 2JWTA 5K7FA 3BG5A 1NK3P 4B3AA 4Y52J 5CXGA 3O8GA 5EEAA 3HOYJ 3G1LA 4D5CA 3M4OJ 4GCKA 1I3QJ 4A3MJ 2N8GA 5C3EJ 1H89C 2QWTA 2DA1A 1MBGA 1MBKA 2VI6A 3PASA 3GTPJ 1Z77A 3G1OA 1IC8A 2GFNA 2WGBA 2DG7A 2M2EA 5EZGA 5CW8A 2G7LA 2G7GA 4XIDA 1XG1A 2JJ7A 2B63J 1A5JA 5C4YA 2NOGA 1TWCJ 3FK7A 1ORKA 4DYCA 1ZR4A 1BW5A 2W53A 3G1MA 3T6NA 2DMUA 2XPUA 2ZCNA 3FKIJ 3M3YJ 4UDSA 3JRHA 3L1PA 3HE0A 2NVXJ 2MSYA 2WV1A 3ZQCA 3IH4A 4DYRA 4MLOA 1HOMA 1JKRC 5F0CA 4FCYA 1R9TJ 2NP3A 2TCTA 5FKOA 3NARA 2HOSA 2X6OA 5IPAA 5D19A 3JRCA 4A3GJ 3VUQA 3O8HA 1SANA 2DMQA 1A6IA 5C44J 1SFOJ 2QTQA 1VNDA 4A93J 3VVZA 3WHCA 5E3LA 3TP3A 4DW6A 1NTCA 2O8KA 1HDPA 5J1YA 3S15J 3QPLA 2W48A 1H88C 4JYKA 3GTKJ 9ANTA 1JKQC 2HDDA 3VPRA 1U8BA 2F07A 4QIWN 3CDLA 2HYJA 1MBHA 4V2GA 3JREA 4FE4A 1WPKA 1MH3A 5IYCJ 4GFLA 2IEKA 5IP7J 3TW6A 5M5WJ 4IEJA 1IDZA 1JTYA 3FIWA 4W97A 3RKQA 2CJJA 3LWJA 2PBXA 3ANPA 2MGQA 5HBUA 3HKZN 2NVTJ 2LVSA 5M3MJ 4ACIA 1T33A 1ETXA 3UKGA 1IRZA 4L62A 1VF9A 4NELA 4AF5A 1TWHJ 3QBMA 2DA5A 2DMTA 3JRBA 3VW1A 1AHDP 2XB5A 3HDDA 5GPAA 3NRGA 1ETQA 3BG9A 4FTHA 2WAQN 3D1NI 3JRIA 4BY7J 3HGYA 1JKPC 1QRYA 2P81A 3HM5A 5H9TA 2CQQA 1QVTA 5C4XJ 3IH3A 3GEUA 3EUPA 4D7MA 4XRSG 4GFKA 4XK4A 3PPBA 2Y9ZA 3LSRA 2JK3A 5D18A 2R5YB 3ON2A 1MBJA 1LE8B 3W6VA 2ZCXA 4ICHA 2GBYA 3HB9A 3CMYA 4M3BA 2XGCA 4RBOA 2HXOA 1S7EA 2O7TA 4XICA 2DG8A 1SGMA 3MKLA 1HDDC 2E2IJ 1XS9A 3P9TA 2CUEA 1RESA 2L7ZA 2HOTA 3MVPA 2Y2ZA 2XB0X 4KWAA 4A3JJ 5FKKA 4EEFG 4I76A 2ID6A 1U9OA 2Y0SN 3VIBA 1WH5A 4MO7A 4IHWA 1HCRA 5IOZA 1U9NA 3ZOBA 5EGOA 3NAUA 2RAEA 3S5RA 5J1RA 3B81A 2EH3A 5DTDA 2DA7A 4QTRA 4ABZA 2DN0A 3LSGA 1AKHB 3G7RA 2WB1N 5DAJA 5F08A 2M34A 4JP0A 2K9SA 2JA8J 4HNVA 2R5ZA 1IJWC 3CCYA 2EQRA 3ZQIA 4UUTA 4CYCB 5EZHA 2E1OA 3COLA 4XRMA 2LK2A 2L7FP 2R93J 2EBIA 3TEDA 3ZQGA 2HKUA 5EG0A 4JKZA 1IDYA 2EZLA 3BR5A 5FKMA 3VP5A 4MIMA 2DMPA 1ZTRA 4YZEA 1Y1VJ 2OI8A 4X1EA 3BTIA 3DEWA 5M5XJ 1NK2P 2LY9A 2E19A 2Q24A 4DYQA 3NI7A 2DA4A 2QF7A 3LSPA 3HTIA 5F1JA 3RD3A 1GVDA 3FISA 1PUFB 5EYRA 2R7ZJ 2UXIA 3CWRA 3BR1A 3KKDA 5D1RA 2YVEA 2TRTA 2YVHA 2G7SA 2DA3A 1JT0A 1B72B 2DA6A 3HOWJ 1IG7A 1I50J 3A01A 4M3GA 1POGA 1WGXA 1FIAA 5IYDJ 2O9LA 1K83J 2ZOYA 2NX4A 1OCPA 2ECCA 2R92J 3OOUA 5FLVA 2ZB9A 3IV5A 3GTMJ 5IP6A 3S1MJ 1GUUA 5IP9J 4UUSA 2XPVA 1IV6A 1JUMA 3OSGA 4B1RA 1BA5A 4MFEA 2LTPA 5HODA 4X6AJ 4M3DA 4BBRJ 3Q3SA 3RZDJ 3VVXA 4A3KJ 2CQXA 3S17J 1JUSA 3F1BA 4AC0A 1ETVA 4C3IJ 2UXHA 3HOVJ 3SDGA 2GLOA 2EZKA 2K9QA 2G0EA 5J3LA 1U78A 1B8IA 1Q1VA 1W0UA 4AYBN 4A69C 4AC6A 3JRDA 3JSJA 2NS7A 5IOYA 2ME0A 2IAIA 3B6AA 2D5VA 2RHAA 1OFCX 1HLVA 4PXIA 4A3CJ 4GCLA 3HGGA 2YS9A 4RDUA 1MH4A 3S2HJ 3ZQFA 5EFYA 1BL0A 3BR0A 1GT0C 1DU0A 2NP5A 2QIBA 4M3FA 4M6VA 2MG4A 4MFDA 5K58A 3ZQLA 3CJDA 5E3MA 4MK6A 3HOXJ 2PMZN 3BR2A 5EDNA 2QOPA 4C3JJ 4C2MJ 3C07A 2QCOA 2M9HA 1T56A 4BXXJ 4A3DJ 1F43A 5FMPA 2X9DA 2I10A 2H1KA 2GUHA 3BT9A 1TWGJ 5E3NA 4FE7A 1UG2A 1JGGA 2XDNA 4DZJA 1YRNA 2DMNA 2JA6J 4A3EJ 1CQTA 4IHYA 3K2AA 1ZKGA 2HQ5A 1ZR2A 3RZOJ 3PM1A 5F0HA 3S1QJ 3KKCA 3LSJA 4A3BJ 3IUVA 2GM4A 3E7QA 3O60A 5FLMJ 3BHQA 4L5EA 3KZ9A 4JNNA 1FEXA 4JL3A 1GV2A 2CRGA 4BY1J 4B4CA 3ANGA 2DTZA 2K40A 3H0GJ 4JX4A 1D5YA 1XC5A 2FD5A 3I4MJ 3KNWA 1JT6A 3A03A 4A3IJ 1E3OC 3V6GA 4BKXA 3BQZA 3NNRA 2VUMJ 2QKOA 4LOCA 1H8AC 3BCGA 2OERA 5AQCA 5GPCA 3HTJA 1O4XA 4D5FA 2FBQA 3C2BA 4S0HB 3ZQHA 1RETA 4Y7NJ 2XGDA 3SJMA 2ELKA 1QPIA 1TC3C 4AUXA 3AQSA 1LFUP 3GTGJ 3SFIA 3A02A 4BBSJ 2ZCMA 2FJ1A 1VFCA 2NVQJ 2RASA 3BRUA 2R0QC 1JJ8C 1P7IA 1ZQ3P 2O7OA 1G2HA 1ETWA 3LOCA 3I4NJ 5F04A 2LR8A 1Y1WJ 3S1NJ 2JA7J 1GV5A 3DCFA 3G56A 1X2MA 3S1RJ 3CRJA 3VOXA 2VPRA 4CGRA 1Z0XA 3E7LA 2Y30A 3Q0WA 5CXIA 3HOUJ 3AQTA 4M3EA 3QQAA 2EZHA 2FQ4A 3BG3A 2JMWA 2D6YA 1MSEC 1UI5A 3ON4A 2ID3A 4W1UA 1MBFA 3BJBA 2FX0A 1IUFA 5EGOB 4MXMA 3JRAA 4XRSA 1VI0A 2H8RA 2JA5J 2CUFA 1WI3A 3HTHA 2R5ZB 2MW8A 2UXUA 3LJLA 1RR7A 1K61A 4C3HJ 3VW0A 3H3VK 2ZOZA 4ME9A 1LFBA 5M5YJ 5EG0B 2JN6A 4J19A 2G3BA 2UXPA 1I6HJ 5FHPA 1OJLA 3HOZJ 1W0TA 3WHBA 2UXOA 5GP9A 3NPIA 1AU7A 3FK6A 4A3FJ 1FIPA 2WUIA 5K7ZA 3BQYA 2ME6A 5DS9A 4IHXA 4A3LJ 2L9RA 1UHSA 1TWAJ 1EF4A 3BR6A 3S16J 3VW2A 3OIOA 2DJNA 3GTLJ 1F36A 3IH2A 1ZGWA 3EGQA 2HOAA 1RPWA 3Q0UA 4GCTA 3TP0A 2HYTA 1P7JA 5HSZA 1JUPA 5FKNA 5JLXA 3MN2A 1GDTA 3GTQJ 3PO3J 3GTJJ 1ETKA 4I6ZA 2VKVA 4JX5A 3MNLA 5HAWA 1BW6A 3BR3A 4IHVA 3A01B 2KT0A 3K7AJ 5F0FA 2R5YA 1FTZA 1LE8A 2L0KA 2XGEA 3QKXA 2LKXA 2VKEA 2KDZA 4D7NA 4DZPA 2AO9A 1MSFC 3HBLA 3BTCA 2X48A 3OSFA 1ZK8A 2M8GX 4UUSB 1BJZA 3GBGA 3JR9A 1DU6A 3FRQA 3S2DJ 2ECBA 5C4JJ 1QVUA 2Y9YA 1IGNA 5FJ8J 2V57A 2L7MP 3GTOJ 1RKTA 5E3OA 2OF7A 2DA2A 2IBDA 3RH2A 5M3FJ 2PZ9A 2COBA 2LP0A 2NS8A 4NN1A 2AHQA 2IU5A 3BNIA 3RQIA 2XRLA 2LD5A 4JX6A 2LFBA 3V78A 2OPTA 3S14J 3LHQA 3BTLA 3GZIA 1ETOA 1WH7A 3HEFA 1X2NA 5IYBJ 5EF6A 1B8IB 2K9NA 1AKHA 1OCTC 1MNMC 1FJLA 1UI6A 1JJ6C 2M0CA 1JKOC 3Q0VA 4V2FA 5FKLA 2YU9J 3JRGA 1RKWA 4FISA 4CYCA 3JRFA 1X58A 3VOKA 5BNGA 2E2HJ 3HTAA 3TW7A 2CU7A 5J1UA 1ENHA 3NXCA 3VVYA 1MBEA 5F27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J J;  1WCM J;  2LLK A;  1UMQ A;  2NVY J;  1ITY A;  3BTJ A;  4G12 A;  3QPS A;  3HIM A;  2EZI A;  4GFB A;  1APL C;  2XPW A;  5FGL A;  3F0C A;  1HF0 A;  3DPJ A;  3B6C A;  1TWF J;  1PUF A;  2HXI A;  2YUS A;  3LNQ A;  4HKU A;  1JTX A;  5JLW A;  2Y31 A;  3CQZ J;  1FTT A;  2XSD C;  3PO2 J;  2GEN A;  1ETY A;  2REK A;  2HI3 A;  5K7H A;  4NDL A;  1B72 A;  1YRN B;  4QSH A;  2JWT A;  5K7F A;  3BG5 A;  1NK3 P;  4B3A A;  4Y52 J;  5CXG A;  3O8G A;  5EEA A;  3HOY J;  3G1L A;  4D5C A;  3M4O J;  4GCK A;  1I3Q J;  4A3M J;  2N8G A;  5C3E J;  1H89 C;  2QWT A;  2DA1 A;  1MBG A;  1MBK A;  2VI6 A;  3PAS A;  3GTP J;  1Z77 A;  3G1O A;  1IC8 A;  2GFN A;  2WGB A;  2DG7 A;  2M2E A;  5EZG A;  5CW8 A;  2G7L A;  2G7G A;  4XID A;  1XG1 A;  2JJ7 A;  2B63 J;  1A5J A;  5C4Y A;  2NOG A;  1TWC J;  3FK7 A;  1ORK A;  4DYC A;  1ZR4 A;  1BW5 A;  2W53 A;  3G1M A;  3T6N A;  2DMU A;  2XPU A;  2ZCN A;  3FKI J;  3M3Y J;  4UDS A;  3JRH A;  3L1P A;  3HE0 A;  2NVX J;  2MSY A;  2WV1 A;  3ZQC A;  3IH4 A;  4DYR A;  4MLO A;  1HOM A;  1JKR C;  5F0C A;  4FCY A;  1R9T J;  2NP3 A;  2TCT A;  5FKO A;  3NAR A;  2HOS A;  2X6O A;  5IPA A;  5D19 A;  3JRC A;  4A3G J;  3VUQ A;  3O8H A;  1SAN A;  2DMQ A;  1A6I A;  5C44 J;  1SFO J;  2QTQ A;  1VND A;  4A93 J;  3VVZ A;  3WHC A;  5E3L A;  3TP3 A;  4DW6 A;  1NTC A;  2O8K A;  1HDP A;  5J1Y A;  3S15 J;  3QPL A;  2W48 A;  1H88 C;  4JYK A;  3GTK J;  9ANT A;  1JKQ C;  2HDD A;  3VPR A;  1U8B A;  2F07 A;  4QIW N;  3CDL A;  2HYJ A;  1MBH A;  4V2G A;  3JRE A;  4FE4 A;  1WPK A;  1MH3 A;  5IYC J;  4GFL A;  2IEK A;  5IP7 J;  3TW6 A;  5M5W J;  4IEJ A;  1IDZ A;  1JTY A;  3FIW A;  4W97 A;  3RKQ A;  2CJJ A;  3LWJ A;  2PBX A;  3ANP A;  2MGQ A;  5HBU A;  3HKZ N;  2NVT J;  2LVS A;  5M3M J;  4ACI A;  1T33 A;  1ETX A;  3UKG A;  1IRZ A;  4L62 A;  1VF9 A;  4NEL A;  4AF5 A;  1TWH J;  3QBM A;  2DA5 A;  2DMT A;  3JRB A;  3VW1 A;  1AHD P;  2XB5 A;  3HDD A;  5GPA A;  3NRG A;  1ETQ A;  3BG9 A;  4FTH A;  2WAQ N;  3D1N I;  3JRI A;  4BY7 J;  3HGY A;  1JKP C;  1QRY A;  2P81 A;  3HM5 A;  5H9T A;  2CQQ A;  1QVT A;  5C4X J;  3IH3 A;  3GEU A;  3EUP A;  4D7M A;  4XRS G;  4GFK A;  4XK4 A;  3PPB A;  2Y9Z A;  3LSR A;  2JK3 A;  5D18 A;  2R5Y B;  3ON2 A;  1MBJ A;  1LE8 B;  3W6V A;  2ZCX A;  4ICH A;  2GBY A;  3HB9 A;  3CMY A;  4M3B A;  2XGC A;  4RBO A;  2HXO A;  1S7E A;  2O7T A;  4XIC A;  2DG8 A;  1SGM A;  3MKL A;  1HDD C;  2E2I J;  1XS9 A;  3P9T A;  2CUE A;  1RES A;  2L7Z A;  2HOT A;  3MVP A;  2Y2Z A;  2XB0 X;  4KWA A;  4A3J J;  5FKK A;  4EEF G;  4I76 A;  2ID6 A;  1U9O A;  2Y0S N;  3VIB A;  1WH5 A;  4MO7 A;  4IHW A;  1HCR A;  5IOZ A;  1U9N A;  3ZOB A;  5EGO A;  3NAU A;  2RAE A;  3S5R A;  5J1R A;  3B81 A;  2EH3 A;  5DTD A;  2DA7 A;  4QTR A;  4ABZ A;  2DN0 A;  3LSG A;  1AKH B;  3G7R A;  2WB1 N;  5DAJ A;  5F08 A;  2M34 A;  4JP0 A;  2K9S A;  2JA8 J;  4HNV A;  2R5Z A;  1IJW C;  3CCY A;  2EQR A;  3ZQI A;  4UUT A;  4CYC B;  5EZH A;  2E1O A;  3COL A;  4XRM A;  2LK2 A;  2L7F P;  2R93 J;  2EBI A;  3TED A;  3ZQG A;  2HKU A;  5EG0 A;  4JKZ A;  1IDY A;  2EZL A;  3BR5 A;  5FKM A;  3VP5 A;  4MIM A;  2DMP A;  1ZTR A;  4YZE A;  1Y1V J;  2OI8 A;  4X1E A;  3BTI A;  3DEW A;  5M5X J;  1NK2 P;  2LY9 A;  2E19 A;  2Q24 A;  4DYQ A;  3NI7 A;  2DA4 A;  2QF7 A;  3LSP A;  3HTI A;  5F1J A;  3RD3 A;  1GVD A;  3FIS A;  1PUF B;  5EYR A;  2R7Z J;  2UXI A;  3CWR A;  3BR1 A;  3KKD A;  5D1R A;  2YVE A;  2TRT A;  2YVH A;  2G7S A;  2DA3 A;  1JT0 A;  1B72 B;  2DA6 A;  3HOW J;  1IG7 A;  1I50 J;  3A01 A;  4M3G A;  1POG A;  1WGX A;  1FIA A;  5IYD J;  2O9L A;  1K83 J;  2ZOY A;  2NX4 A;  1OCP A;  2ECC A;  2R92 J;  3OOU A;  5FLV A;  2ZB9 A;  3IV5 A;  3GTM J;  5IP6 A;  3S1M J;  1GUU A;  5IP9 J;  4UUS A;  2XPV A;  1IV6 A;  1JUM A;  3OSG A;  4B1R A;  1BA5 A;  4MFE A;  2LTP A;  5HOD A;  4X6A J;  4M3D A;  4BBR J;  3Q3S A;  3RZD J;  3VVX A;  4A3K J;  2CQX A;  3S17 J;  1JUS A;  3F1B A;  4AC0 A;  1ETV A;  4C3I J;  2UXH A;  3HOV J;  3SDG A;  2GLO A;  2EZK A;  2K9Q A;  2G0E A;  5J3L A;  1U78 A;  1B8I A;  1Q1V A;  1W0U A;  4AYB N;  4A69 C;  4AC6 A;  3JRD A;  3JSJ A;  2NS7 A;  5IOY A;  2ME0 A;  2IAI A;  3B6A A;  2D5V A;  2RHA A;  1OFC X;  1HLV A;  4PXI A;  4A3C J;  4GCL A;  3HGG A;  2YS9 A;  4RDU A;  1MH4 A;  3S2H J;  3ZQF A;  5EFY A;  1BL0 A;  3BR0 A;  1GT0 C;  1DU0 A;  2NP5 A;  2QIB A;  4M3F A;  4M6V A;  2MG4 A;  4MFD A;  5K58 A;  3ZQL A;  3CJD A;  5E3M A;  4MK6 A;  3HOX J;  2PMZ N;  3BR2 A;  5EDN A;  2QOP A;  4C3J J;  4C2M J;  3C07 A;  2QCO A;  2M9H A;  1T56 A;  4BXX J;  4A3D J;  1F43 A;  5FMP A;  2X9D A;  2I10 A;  2H1K A;  2GUH A;  3BT9 A;  1TWG J;  5E3N A;  4FE7 A;  1UG2 A;  1JGG A;  2XDN A;  4DZJ A;  1YRN A;  2DMN A;  2JA6 J;  4A3E J;  1CQT A;  4IHY A;  3K2A A;  1ZKG A;  2HQ5 A;  1ZR2 A;  3RZO J;  3PM1 A;  5F0H A;  3S1Q J;  3KKC A;  3LSJ A;  4A3B J;  3IUV A;  2GM4 A;  3E7Q A;  3O60 A;  5FLM J;  3BHQ A;  4L5E A;  3KZ9 A;  4JNN A;  1FEX A;  4JL3 A;  1GV2 A;  2CRG A;  4BY1 J;  4B4C A;  3ANG A;  2DTZ A;  2K40 A;  3H0G J;  4JX4 A;  1D5Y A;  1XC5 A;  2FD5 A;  3I4M J;  3KNW A;  1JT6 A;  3A03 A;  4A3I J;  1E3O C;  3V6G A;  4BKX A;  3BQZ A;  3NNR A;  2VUM J;  2QKO A;  4LOC A;  1H8A C;  3BCG A;  2OER A;  5AQC A;  5GPC A;  3HTJ A;  1O4X A;  4D5F A;  2FBQ A;  3C2B A;  4S0H B;  3ZQH A;  1RET A;  4Y7N J;  2XGD A;  3SJM A;  2ELK A;  1QPI A;  1TC3 C;  4AUX A;  3AQS A;  1LFU P;  3GTG J;  3SFI A;  3A02 A;  4BBS J;  2ZCM A;  2FJ1 A;  1VFC A;  2NVQ J;  2RAS A;  3BRU A;  2R0Q C;  1JJ8 C;  1P7I A;  1ZQ3 P;  2O7O A;  1G2H A;  1ETW A;  3LOC A;  3I4N J;  5F04 A;  2LR8 A;  1Y1W J;  3S1N J;  2JA7 J;  1GV5 A;  3DCF A;  3G56 A;  1X2M A;  3S1R J;  3CRJ A;  3VOX A;  2VPR A;  4CGR A;  1Z0X A;  3E7L A;  2Y30 A;  3Q0W A;  5CXI A;  3HOU J;  3AQT A;  4M3E A;  3QQA A;  2EZH A;  2FQ4 A;  3BG3 A;  2JMW A;  2D6Y A;  1MSE C;  1UI5 A;  3ON4 A;  2ID3 A;  4W1U A;  1MBF A;  3BJB A;  2FX0 A;  1IUF A;  5EGO B;  4MXM A;  3JRA A;  4XRS A;  1VI0 A;  2H8R A;  2JA5 J;  2CUF A;  1WI3 A;  3HTH A;  2R5Z B;  2MW8 A;  2UXU A;  3LJL A;  1RR7 A;  1K61 A;  4C3H J;  3VW0 A;  3H3V K;  2ZOZ A;  4ME9 A;  1LFB A;  5M5Y J;  5EG0 B;  2JN6 A;  4J19 A;  2G3B A;  2UXP A;  1I6H J;  5FHP A;  1OJL A;  3HOZ J;  1W0T A;  3WHB A;  2UXO A;  5GP9 A;  3NPI A;  1AU7 A;  3FK6 A;  4A3F J;  1FIP A;  2WUI A;  5K7Z A;  3BQY A;  2ME6 A;  5DS9 A;  4IHX A;  4A3L J;  2L9R A;  1UHS A;  1TWA J;  1EF4 A;  3BR6 A;  3S16 J;  3VW2 A;  3OIO A;  2DJN A;  3GTL J;  1F36 A;  3IH2 A;  1ZGW A;  3EGQ A;  2HOA A;  1RPW A;  3Q0U A;  4GCT A;  3TP0 A;  2HYT A;  1P7J A;  5HSZ A;  1JUP A;  5FKN A;  5JLX A;  3MN2 A;  1GDT A;  3GTQ J;  3PO3 J;  3GTJ J;  1ETK A;  4I6Z A;  2VKV A;  4JX5 A;  3MNL A;  5HAW A;  1BW6 A;  3BR3 A;  4IHV A;  3A01 B;  2KT0 A;  3K7A J;  5F0F A;  2R5Y A;  1FTZ A;  1LE8 A;  2L0K A;  2XGE A;  3QKX A;  2LKX A;  2VKE A;  2KDZ A;  4D7N A;  4DZP A;  2AO9 A;  1MSF C;  3HBL A;  3BTC A;  2X48 A;  3OSF A;  1ZK8 A;  2M8G X;  4UUS B;  1BJZ A;  3GBG A;  3JR9 A;  1DU6 A;  3FRQ A;  3S2D J;  2ECB A;  5C4J J;  1QVU A;  2Y9Y A;  1IGN A;  5FJ8 J;  2V57 A;  2L7M P;  3GTO J;  1RKT A;  5E3O A;  2OF7 A;  2DA2 A;  2IBD A;  3RH2 A;  5M3F J;  2PZ9 A;  2COB A;  2LP0 A;  2NS8 A;  4NN1 A;  2AHQ A;  2IU5 A;  3BNI A;  3RQI A;  2XRL A;  2LD5 A;  4JX6 A;  2LFB A;  3V78 A;  2OPT A;  3S14 J;  3LHQ A;  3BTL A;  3GZI A;  1ETO A;  1WH7 A;  3HEF A;  1X2N A;  5IYB J;  5EF6 A;  1B8I B;  2K9N A;  1AKH A;  1OCT C;  1MNM C;  1FJL A;  1UI6 A;  1JJ6 C;  2M0C A;  1JKO C;  3Q0V A;  4V2F A;  5FKL A;  2YU9 J;  3JRG A;  1RKW A;  4FIS A;  4CYC A;  3JRF A;  1X58 A;  3VOK A;  5BNG A;  2E2H J;  3HTA A;  3TW7 A;  2CU7 A;  5J1U A;  1ENH A;  3NXC A;  3VVY A;  1MBE A;  5F27 A; 
#chains in the Genus database with same CATH topology
 3DP7 A;  2E2J J;  3DKW A;  3K0L A;  2LLK A;  3O6B B;  1O3Q A;  1MMD A;  1YS6 A;  1P6R A;  1LKX A;  2EZI A;  2QKM B;  2DXI A;  5IT3 A;  5FGL A;  4PFP A;  1HF0 A;  1PUF A;  5GAH J;  2HXI A;  4HKU A;  1FTT A;  1EKE A;  2JVH A;  2ZNZ A;  1B72 A;  2I5U A;  1BI3 A;  1D0Y A;  4OAZ A;  2BHY A;  3HTU A;  4QSH A;  4KMF A;  5CXG A;  2Z33 A;  1RNL A;  3ASN H;  4UVC A;  3O8G A;  4A0Y A;  3CD6 I;  3HOY J;  4D5C A;  2F5F A;  2M4G A;  3FX3 A;  4LGW A;  2EFO A;  1LEA A;  2XUB A;  4BJ5 C;  3PAS A;  3ZCO A;  4MNU A;  2FUG 2;  3IL2 A;  2M2E A;  5IY5 H;  1D8K A;  3NS4 A;  4R8H A;  2IP2 A;  4BE0 A;  1FMW A;  2VQH A;  5L3E A;  4ZZL A;  2K5C A;  3FK7 A;  4U9L A;  3EUH A;  3HZJ A;  3T6N A;  1OPC A;  2VPL A;  3T0Y A;  4XRF A;  1VQ4 I;  4DNC A;  2ZCN A;  3FKI J;  2HOE A;  1U3E M;  4UDS A;  3NEU A;  4GYG A;  4DQ2 A;  1TL8 A;  2VOD A;  2B1E A;  5EJC A;  4C2M A;  4XMY A;  2MSY A;  4RB1 A;  2NVX J;  1KU7 A;  3MKZ A;  3BG6 A;  1R00 A;  3MZY A;  1JKR C;  4FCY A;  2NP3 A;  2TCT A;  4HG2 A;  1B9M A;  2TDX A;  5IPA A;  2WAF A;  4Q4Z F;  3VUQ A;  2KIF A;  3O8H A;  2QTQ A;  1A6I A;  1Y0N A;  3P5J A;  3LSH A;  4A93 J;  3VVZ A;  2FBH A;  3WHC A;  4LD5 A;  4DW6 A;  1OKR A;  4KIG A;  1S7O A;  1HDP A;  2PN6 A;  5J1Y A;  1SAU A;  2HR3 A;  2A3S A;  2W48 A;  1WJE A;  4II3 A;  1H0M A;  4CH7 A;  1S72 I;  2E5N A;  2OV7 A;  3M1E A;  3VPR A;  1XN7 A;  4EM1 A;  4YEL A;  3WU2 C;  4KT6 A;  4WCG A;  3JRE A;  3VWB A;  1WPK A;  5IYC J;  5E8G A;  4GFL A;  2IEK A;  1ZAR A;  2ZME C;  2VAS A;  4XLF A;  3D5S C;  3G6E I;  3ABL H;  5GAG J;  2PBX A;  1S5L C;  1W7P A;  5HBU A;  2JPB A;  3T1B A;  4XSZ F;  3VOD A;  1T33 A;  1IRZ A;  2GA2 A;  3KEO A;  2VJ5 A;  1TWH J;  1DGW Y;  2EIN H;  3QP5 A;  4E7J A;  3QBM A;  3LQR A;  3JRB A;  2P6S A;  3A2K A;  2ZO4 A;  1K78 A;  1AHD P;  1R4N B;  5DD4 A;  5GPA A;  6PAX A;  3IHU A;  2BVM A;  2O0Y A;  3VSL A;  3L2C A;  2R7Q A;  3HGY A;  3L2W A;  2DYR H;  4ZYH A;  2P81 A;  1JKP C;  1R6R A;  3GYH X;  2W82 A;  1QVT A;  1I5Z A;  5ICE A;  4D7M A;  2IGO A;  2GOX B;  5FRO A;  5AON A;  4XRS G;  3GME A;  2Y9Z A;  3ON2 A;  2JUG A;  2FF4 A;  2HQA A;  4BAY A;  4XKC A;  1NG7 A;  1N78 A;  1ZRE A;  2XGC A;  3H9G A;  4RGU A;  4RBO A;  4WXC A;  3CC2 I;  5F1R A;  3J80 K;  4XIC A;  2OC6 A;  1YI2 I;  1XX5 A;  3PSF A;  3U9G A;  3LA3 A;  3TDZ C;  3G2B A;  3K4C A;  3VYR B;  2BY3 A;  2GIV A;  3WE2 A;  1IN5 A;  1K6O A;  5K1Y A;  2EV5 A;  2Y2Z A;  4A3J J;  5FKK A;  3SEZ A;  4EEF G;  1N77 A;  2F4O B;  4CIC A;  4HNT A;  3T8T A;  4DJA A;  2Y0S N;  4P96 A;  5L3C A;  5CVR A;  2OU2 A;  4MO7 A;  4L5I A;  1Y8R B;  2VOP A;  1A35 A;  2IT0 A;  2XHK A;  3V4G A;  1TBX A;  4EQQ A;  5EGO A;  4G7Z F;  2H27 A;  1MD0 A;  3S5R A;  2UZK A;  2CV2 A;  5DTD A;  5J4Y A;  3KCC A;  1LNW A;  1X1A A;  4HAM A;  4BQQ A;  4ABZ A;  3L2Q A;  3G7R A;  2RQQ A;  4IOA F;  2W24 A;  2K9S A;  4JP0 A;  3ZQQ A;  4EJV A;  1IF1 A;  2JA8 J;  3M07 A;  3A0B C;  4IL6 C;  3OYI A;  2EQR A;  2M30 A;  3K4M A;  1OIS A;  1NH3 A;  3COL A;  3U1D A;  2DFI A;  4CHU A;  2R93 J;  5AIP A;  1ACI A;  2HKU A;  4XLP F;  3ZMV A;  4I98 B;  2L9V A;  3BR5 A;  1KQ9 A;  2M0M A;  4HLX A;  4CSW A;  4L0Z B;  1EV7 A;  2IGN A;  2MYS A;  4CGZ A;  1FY7 A;  2BHZ A;  3FXM A;  3VYS B;  4KIC A;  2XKO A;  4B43 A;  2P5L C;  3BTI A;  4KN4 X;  1NK2 P;  2GIZ A;  1O3T A;  1VTN C;  4DYQ A;  3S2D J;  2QF7 A;  3LSP A;  2Z5U A;  4HOB A;  3F8B A;  4CA0 A;  2DFF A;  1PUF B;  1BIB A;  3RSN A;  3KKD A;  4HV5 A;  3K4N A;  3I0T A;  1B72 B;  2HKO A;  2B0L A;  2Y48 A;  1FYL A;  4BS9 A;  2GQQ A;  3OYD A;  2Z1D A;  4PDK A;  3K1M A;  4BJ6 C;  5H20 A;  4OIQ F;  2IRF G;  2VJ4 A;  3MEX A;  2ZOY A;  2DK5 A;  1D5V A;  2EIK H;  1OCP A;  5HVQ C;  2R92 J;  3OOU A;  3IV5 A;  2CUZ A;  5FD5 A;  1EJ9 A;  3GTM J;  3OYH A;  1GUU A;  3I3L A;  1UG0 A;  4RGX A;  1LVK A;  1XPX A;  2KZV A;  4HX8 A;  3OSG A;  4B1R A;  1MIJ A;  4NHJ A;  2VQC A;  2JPC A;  4B09 A;  2V79 A;  4GO1 A;  1FPQ A;  4M3D A;  4BBR J;  1PDN C;  3VVX A;  4QPO A;  4A3K J;  1GLN A;  1E3P A;  4EAT A;  4IQJ A;  3S17 J;  3F1B A;  5ICF A;  1ETV A;  2UXH A;  3WTU C;  2FXA A;  1WJB A;  3H35 A;  3ZGK A;  1IN4 A;  2G9W A;  2LDU A;  4OMZ A;  1Q1V A;  3JRD A;  2NS7 A;  3JW4 A;  2AQF A;  3TKY A;  1U2W A;  2D5V A;  1IRG A;  1OFC X;  1Q1H A;  2M87 A;  2R7X A;  1HLV A;  2HKX A;  4RMN A;  3H0D A;  4Y15 A;  5JFR A;  1BL0 A;  1GT0 C;  4L18 B;  1WFX A;  1YOV B;  3LFK A;  2P5V A;  3CJD A;  1WVR A;  1Z91 A;  4AM3 A;  1G6N A;  2QM3 A;  2VBY A;  4CDG A;  4YIF A;  2CW8 A;  5EDN A;  2QOP A;  4A3D J;  3HSR A;  3HPH A;  4ZZD A;  1YJW I;  2XDV A;  1V5E A;  2VJI A;  1HKQ A;  2I10 A;  5BMZ A;  1B9N A;  1H9T A;  3W3C A;  1T38 A;  1X4P A;  5JVT A;  1TWG J;  3ZMU A;  4DZJ A;  2ELH A;  3RI4 A;  1ZKG A;  1QU3 A;  1DGR M;  3DLL F;  2LF8 A;  4HDU A;  4YFN F;  1IRF A;  3LSJ A;  1W7P B;  2GM4 A;  3IUV A;  3MD2 A;  3FXQ A;  1FEX A;  4JL3 A;  2CRG A;  3Q9S A;  4B4C A;  3ANG A;  3H0G J;  3SZP A;  3A03 A;  2K27 A;  4IOC F;  4A3I J;  1E3O C;  1Z3X A;  1K78 B;  4U88 A;  4BHP A;  2XAS A;  1ZRC A;  2V1X A;  3BCG A;  2OER A;  5GPC A;  1ZHF A;  3I54 A;  1I6X A;  2FBQ A;  3IKT A;  2DOD A;  1IW7 F;  3KP7 A;  2E36 A;  4BXF A;  3AQS A;  2EWN A;  2E7W A;  5KAF C;  2HFH A;  2DYS H;  3GTG J;  2HVS A;  4IRI A;  1TQM A;  1YX3 A;  3AG1 H;  4U7B A;  1VFC A;  4KFC A;  2R0Q C;  2IVM A;  2WC2 A;  5DM7 F;  3MZH A;  4XN0 A;  1G2H A;  1I27 A;  2VC1 A;  3LOC A;  3GX4 X;  1X3W B;  3VB2 A;  3S1N J;  1XGN A;  1GV5 A;  1D1B A;  1UCR A;  3PNT A;  1XGS A;  2UV1 A;  3DCF A;  3G56 A;  1BOA A;  2L7K A;  3S1R J;  2VPR A;  3CUO A;  4CGR A;  3Q0W A;  2Y30 A;  1G3Y A;  3MQ0 A;  1BI1 A;  5CQG A;  2R7F A;  1JI8 A;  2WY8 Q;  2JMW A;  2LC2 A;  1IO2 A;  4XBF A;  1A36 A;  5FLX K;  1YX5 A;  2P0W A;  2ZSH B;  3HIF A;  5HS9 A;  5HNF A;  4I01 A;  5EGO B;  5D4S A;  4XRS A;  1KON A;  1K7A A;  1W7P D;  3JTG A;  2XAF A;  1ZG1 A;  3B73 A;  3K4J A;  4UY8 I;  1W1W E;  3E5Q A;  2UXN A;  1T39 A;  2W00 A;  2ETH A;  3H9J A;  2MW8 A;  2GXB A;  2UXU A;  3LJL A;  1K61 A;  4IVN A;  3ROU A;  1Z1D A;  3MKY B;  2XAG A;  5LRS A;  4E4H A;  2UXP A;  2R3S A;  1OJL A;  1IN8 A;  2KJC A;  3F6O A;  1AU7 A;  2VC0 A;  2WUI A;  5K7Z A;  2ME6 A;  4IHX A;  2L9R A;  1UHS A;  1J0R A;  2V1D A;  1TNS A;  1F5T A;  1ONV A;  3FXR A;  3S16 J;  4U9N A;  3GTL J;  4WX9 A;  4F91 B;  2HS5 A;  3DLA A;  2GAU A;  4AIH A;  3HG9 A;  1GXQ A;  2VT3 A;  4EJT A;  3LA7 A;  2HYT A;  5HSZ A;  2LY1 A;  2XRN A;  5JLX A;  1GDT A;  4ESJ A;  3AL0 C;  3MNL A;  1ETK A;  1JGS A;  4JX5 A;  3AAF A;  4IO9 F;  1YTY A;  3K1N A;  5HAW A;  3K9T A;  1YS7 A;  3BR3 A;  1A6Q A;  3KZI C;  5JHU A;  2R5Y A;  1FTZ A;  2L0K A;  2CSO A;  1NHA A;  2XGE A;  5LRR A;  3QKX A;  3CCL I;  2LKX A;  1SFX A;  1YYV A;  5GAE J;  1SVO A;  4HF1 A;  1MSF C;  1XDS A;  2L4M A;  4ZYA A;  3HBL A;  5HOO A;  4BQA A;  3Q9V A;  2M8G X;  3L9F A;  3GBG A;  3L00 A;  2DOE A;  5LGT A;  2JA2 A;  4XKB A;  2PEX A;  3FXJ A;  1QZZ A;  3HC7 A;  3E6D A;  3BNI A;  3RQI A;  3HTS B;  2LD5 A;  1MJ9 A;  4JX6 A;  1UJ8 A;  2OPT A;  4H0E A;  3BTL A;  1ETO A;  3CZ6 A;  2X1D A;  5EF6 A;  4OIR F;  2OUM A;  4XKW A;  2K9N A;  3FMS A;  1MGT A;  4EM0 B;  3ECH A;  1MDM A;  1MMA A;  4CXF A;  3JSP A;  1SVL A;  4EM2 A;  1IAW A;  1IV8 A;  4JQF A;  4V2F A;  2YU9 J;  4MEY F;  2K4J A;  3JRG A;  5LBQ A;  3E0J B;  1Y39 A;  2EIM H;  2CU7 A;  1ENH A;  4AWX B;  3I56 I;  3NXC A;  5F27 A;  4NB5 A;  1OR7 C;  4Y13 A;  1D1C A;  3CF5 F;  1XCV A;  4XM3 A;  1UMQ A;  2JRT A;  3WTT C;  5E8I A;  2NVY J;  1ITY A;  2E7X A;  3J80 Z;  3T8R A;  1FYM A;  1FOK A;  4FT8 A;  1DDN A;  3HIM A;  5LLQ A;  1TT0 A;  2VE8 A;  3QPH A;  5FRN A;  3F0C A;  4M71 A;  2KRF A;  1TWF J;  1HQC A;  1J09 A;  2YUS A;  3AG4 H;  1K4S A;  3LNQ A;  2IJL A;  3C2H A;  3DKX A;  3CQZ J;  2GEN A;  1TLH B;  3FXO A;  1TNT A;  3F3X A;  2REK A;  5K7H A;  4NDL A;  3U2R A;  2JWT A;  2K02 A;  3BG5 A;  4B3A A;  1DPU A;  1T0F C;  4Y33 A;  4GCK A;  4A3M J;  2AS5 F;  2KFD A;  1OMI A;  1MBG A;  1MBK A;  2VBW A;  3FF5 A;  2FA5 A;  1Z77 A;  2F4M B;  1X1C A;  1VQ9 I;  2LRD A;  3GFI A;  1KQ8 A;  2GFN A;  5CW8 A;  2G7L A;  3OYE A;  3P7N A;  4XID A;  4PFO A;  4AID A;  4DBR A;  3O2P E;  2KMU A;  3ABK H;  4CZZ A;  1LVA A;  1UB9 A;  1ORK A;  4BEH A;  4DYC A;  2DCE A;  3K6G A;  4YFK F;  2A2F X;  2X6W A;  2XPU A;  4ENJ A;  3IKV A;  3FM3 A;  5BPD A;  2HNH A;  2D45 A;  4KUM A;  4IHT A;  3F9K A;  5FFX A;  2OTJ I;  3HE0 A;  4KIB A;  3H36 A;  1F4K A;  2WV1 A;  4Y3O A;  4XOR A;  3ERE D;  3ZQC A;  4DYR A;  4AD9 A;  4MLO A;  4LIT A;  1T08 B;  4G7O F;  2IS2 A;  3HRM A;  3JRC A;  2ZXI A;  3K10 A;  4A3G J;  1KU9 A;  2OQR A;  5C44 J;  1SFO J;  1HBX G;  1VND A;  3F8F A;  4EJO A;  3K69 A;  2VB6 A;  3E5U A;  1XDU A;  1G3W A;  2XVC A;  3K4L A;  3CO6 C;  3GTK J;  4NC7 A;  1JKQ C;  5D5U B;  4E7K A;  1U8B A;  4QIW N;  3RPU D;  2ZME A;  2ISZ A;  3WU0 A;  2KIS A;  1FSH A;  4ASN A;  4ZYE A;  1YW8 A;  1LPQ A;  4FE4 A;  4LLL A;  1R5G A;  4ZDP A;  1YHQ I;  3GWZ A;  2EFW A;  2ZXH A;  3U21 A;  1UZC A;  5IP7 J;  3DXJ F;  2EK5 A;  4Y4R A;  1L3L A;  4IEJ A;  2J5O A;  4W97 A;  3ELK A;  3QYE A;  4B44 A;  3BP8 A;  4FQG A;  2PJR A;  1BI0 A;  2MGQ A;  2XAH A;  4XR6 A;  4ETS A;  2LVS A;  5M3M J;  3OYL A;  1ETX A;  3DPL C;  1X1B A;  4KJZ A;  3KYC B;  4NEL A;  2D1V A;  2LOO A;  4ANJ A;  1D0Z A;  2DA5 A;  4LG3 A;  2DMT A;  1ZLK A;  4C30 A;  1TZL A;  2VBX A;  3NRG A;  3P9I A;  4RB0 A;  3REO A;  2WAQ N;  1UEL B;  3D1N I;  3R6S A;  3ULQ B;  2LNB A;  4RA2 A;  1UAA A;  3I9V 2;  1QRY A;  3CMA I;  1FOY A;  4G6T B;  5H9T A;  2CQQ A;  2L54 A;  3GEU A;  3EUP A;  1U5T C;  3GZN B;  2JSC A;  2R7W A;  4A2U A;  5LFA A;  3QWL A;  2HEO A;  3LSR A;  3BPX A;  2R5Y B;  3W6V A;  5FRM A;  4ICH A;  2GBY A;  3E97 A;  1JHF A;  1MZB A;  4MTE A;  2FBI A;  5B5E C;  2O7T A;  1GHC A;  4G94 A;  5B3S H;  3CCR I;  4YII A;  3V7S A;  2E2I J;  2GXA A;  3COA C;  2Y0M A;  1RES A;  2X1C A;  4BU2 A;  3K70 C;  3MVP A;  4FET A;  4V19 K;  3BPV A;  3ML6 A;  3IAS 2;  3WG7 H;  2M5W A;  2ZFU A;  2XV4 S;  2DOF A;  1BIA A;  1UFM A;  4EJW A;  1WH5 A;  1HCR A;  2KKO A;  5IOZ A;  4U0Y A;  1SC7 A;  2PFB A;  3NAU A;  1IXS B;  5J1R A;  2DA7 A;  5L3D A;  5ILU A;  2EIL H;  3IAM 2;  2DN0 A;  3LSG A;  4RB2 C;  2WB1 N;  2M34 A;  2H8W A;  4M72 A;  1MDM B;  1I39 A;  3KE2 A;  3RYP A;  3ZQI A;  3DTE A;  3VYU B;  3DV8 A;  4P9U A;  3CC4 I;  2QQB A;  4HX7 A;  2L7F P;  3TED A;  5EG0 A;  2FEZ A;  1FOW A;  4KIS A;  1D3Y A;  3J7Y J;  4E7L A;  4PK4 A;  3DPU A;  1G8X A;  2O5R A;  4X1E A;  3DEW A;  3IUO A;  4B47 A;  5M5X J;  3IRR A;  2QA4 I;  1FP2 A;  2LY9 A;  2FNP A;  2RN7 A;  3BDD A;  4RLQ A;  3K2Z A;  2EA2 A;  3NI7 A;  3TBI A;  3HTI A;  3ABU A;  1XD7 A;  2NNN A;  3EUA A;  2UXI A;  3CWR A;  4BE1 A;  3KZY A;  3TO7 A;  3BR1 A;  4JBA A;  3KYD B;  5ICG A;  2G7S A;  4Q47 A;  2Z99 A;  1YW7 A;  1D1A A;  1FZP B;  2DA6 A;  3H3U A;  1W5C C;  3V7C A;  3BLY A;  1IG7 A;  1I50 J;  3A01 A;  2M8E A;  1POG A;  1D8J A;  3I55 I;  5IYD J;  4GDF A;  2LBF A;  2QGU A;  2NX4 A;  2ECC A;  4XOP A;  2PMZ A;  3S1M J;  2FOK A;  4AU7 A;  1R22 A;  1IV6 A;  2ZJQ F;  3ZPL A;  2EB7 A;  1IRX A;  2LTP A;  4HF0 A;  3EUK L;  3HRS A;  2A07 F;  3E6B A;  4BEH B;  3EYI A;  1XTA A;  3SFZ A;  2VLA A;  3QRF F;  1HW5 A;  5H6Q A;  2H09 A;  4IHS A;  4AC0 A;  2LF7 A;  4Q48 A;  5F64 A;  3SDG A;  2KHM A;  4HA8 A;  3I59 A;  5EEG A;  2EZK A;  2K9Q A;  4P9F A;  2G0E A;  5CYV A;  4IF4 A;  2ZXW H;  3F6V A;  4CO8 A;  3PIP F;  1U78 A;  4IRV A;  2QSF X;  1W0U A;  2L01 A;  1RZ4 A;  4A69 C;  4AYB N;  1FOX A;  3JSJ A;  1ZN2 A;  2BE5 F;  2IAI A;  1I1S A;  4UUV A;  2RHA A;  1T8I A;  2Z16 A;  4PXI A;  2Y0S A;  5IT9 K;  2OZ6 A;  3HGG A;  3OL4 A;  4RDU A;  3BJO A;  3ZN1 A;  3S2H J;  1KGS A;  3H5N A;  3ZQF A;  4C9Y A;  3BR0 A;  3OYM A;  3S3N A;  4IX7 A;  3TL4 X;  5AIQ A;  2XRO A;  1LQ1 A;  3ZQL A;  4KYW A;  1EA3 A;  5E3M A;  2EFQ A;  5K58 A;  3CP2 A;  3HOX J;  1LB2 A;  2PMZ N;  2OZU A;  3DBL B;  2UWM A;  1S9H A;  2RDP A;  2CUJ A;  4C2M J;  2ZME B;  2NNY A;  1KYZ A;  4BXX J;  2JQ7 A;  1X3Z B;  4RGS A;  1VQ6 I;  1W5S A;  2GUH A;  1OLT A;  3LQQ A;  3F8M A;  4FE7 A;  1JGG A;  1YRN A;  3L7W A;  3FXU A;  4A3E J;  1P9Q C;  2JA6 J;  3EDP A;  2NVU B;  4ZH4 F;  3JAM K;  3RZO J;  3PM1 A;  3JTH A;  1YFH A;  4MEX F;  4BJT A;  1VQN I;  2PJR B;  3I4P A;  4A3B J;  1HA8 A;  5F6F A;  4A6D A;  2F5E A;  1AOY A;  5FLM J;  2BXZ A;  4L5E A;  5L3G A;  1KQ0 A;  4JNN A;  5B1A H;  4OWR B;  1GV2 A;  5LGU A;  4KA4 A;  2NXN B;  1XC5 A;  3KNW A;  3PFI A;  3KP6 A;  4L5J A;  2V6E A;  3V6G A;  2X51 A;  4OD5 A;  3BQZ A;  2VKH A;  4LOC A;  1H8A C;  2A61 A;  2OAZ A;  2OJE D;  3TOB A;  3DKY A;  4D5F A;  4HSR A;  3SXY A;  3HYI A;  4BL0 B;  1ZG5 A;  3M8J A;  4Y7N J;  2MFZ A;  2VJJ A;  2DI3 A;  2ELK A;  4BE2 A;  3CUQ A;  4NNJ A;  4MQ9 F;  5JVG F;  1ULY A;  4L9J A;  1JJ8 C;  3QYF A;  4HF2 A;  1P7I A;  3KP3 A;  5E79 C;  5A2Q K;  4LLG F;  4LLN A;  4EGY A;  4B48 A;  1ETW A;  2V4J C;  4BYY A;  2QQA A;  5HS7 A;  1YW9 A;  2LR8 A;  4RLF A;  1Y1W J;  2JA7 J;  3TGN A;  2HTJ A;  2DOA A;  3IWF A;  1WWX A;  5CLS A;  5E20 A;  3VOX A;  4E7H A;  3QOD A;  3E7L A;  2KZG A;  5HS8 A;  4M3E A;  3QQA A;  3M9A A;  5HDG A;  2FE3 A;  2E1C A;  2AQE A;  2DLL A;  3OOP A;  3ON4 A;  2XIG A;  3MAJ A;  4P5O A;  1IUF A;  4MXM A;  1FWZ A;  2HZD A;  4DOZ A;  4CYD A;  1RIO H;  2H8R A;  1R5H A;  1WI3 A;  3CJQ B;  1TP4 A;  3QU3 A;  1WRJ A;  1E17 A;  3WGH A;  1RR7 A;  3CJR B;  4C3H J;  3ZQ7 A;  3H3V K;  4Y17 A;  4ME9 A;  1VQP I;  4QWQ A;  3J7A Y;  2HWV A;  5CKT A;  5M5Y J;  4C2U A;  1LDD A;  4LIU A;  5EG0 B;  4XKV A;  2XAU A;  2B3W A;  3OS0 A;  3HOZ J;  3WHB A;  4RB3 C;  2W25 A;  2KIM A;  2DU9 A;  4R1H A;  3WTW C;  3FK6 A;  3L09 A;  3HRT A;  4A3F J;  1FBQ A;  2C6Y A;  4I0A A;  4M6Y A;  3SDB A;  1FT9 A;  1ZAO A;  3OIP A;  1IN6 A;  1TWA J;  1EF4 A;  2DT6 A;  3SYT A;  2DJN A;  1F9N A;  3AG3 H;  3IH2 A;  2ZJP F;  4F92 B;  2QEX I;  2DPD A;  1I3A A;  2ZBK A;  4A5M A;  4L0Y B;  2R7V A;  4GCT A;  3GLL A;  3NWT A;  3TP0 A;  1JUP A;  1R36 A;  4I6Z A;  1G3T A;  2VKV A;  3R0J A;  2L9N A;  5E1X A;  4ON0 A;  4IHV A;  3A01 B;  1FC3 A;  1MW7 A;  1ON1 A;  1XGM A;  2MH9 A;  1U8R A;  3CME I;  5CVV A;  2E34 A;  2LY2 A;  3N05 A;  4F93 B;  2LBF B;  5ILV A;  4DZP A;  3T5X A;  1YLF A;  4PUS A;  1R4M B;  3F72 A;  5HLI A;  3S8P A;  3L2U A;  1XB4 A;  3FMQ A;  2FSW A;  3JR9 A;  2X6X A;  3OS1 A;  5DCF A;  5FJ8 J;  3SZG A;  4B8X A;  3M8E A;  2V57 A;  3TOA A;  2K4B A;  1BR1 A;  2OF7 A;  1P2F A;  1XSV A;  2IBD A;  5E17 F;  5M3F J;  2PZ9 A;  3RH2 A;  2LP0 A;  1QNT A;  4RAG A;  2FOW A;  3TDU C;  3EQL F;  4NN1 A;  2L9S A;  4O3M A;  2IU5 A;  4EJU A;  2JSP A;  3CJN A;  2XRL A;  5FO5 A;  3I59 B;  3V78 A;  4UVB A;  3RPU A;  4Z2Y A;  1MKM A;  3CCV I;  3LHQ A;  2YX4 A;  3HEF A;  1X2N A;  2QBY A;  2M7A A;  4L9N A;  4DVY P;  1OYY A;  3SHF A;  1PP8 F;  1JJ6 C;  2XKP A;  2M0C A;  4CCM A;  4XON A;  3ZXS A;  2OCE A;  2W1O A;  5FKL A;  4CYC A;  4QPQ A;  3JRF A;  1X58 A;  3TW7 A;  3GFJ A;  2CW7 A;  5J1U A;  4YEJ A;  1RUN A;  4N4N B;  3QP6 A;  5HDN A;  3VVY A;  4ZTJ A;  2NAZ A;  2NRA C;  3PJR A;  4HZF A;  3WTV C;  2DT7 B;  1OYI A;  2PQ8 A;  3KX2 A;  3BTJ A;  2W84 A;  4G12 A;  4UV8 A;  3RPQ A;  5HLT A;  1ZEL A;  3HHH A;  1Z7U A;  3QPS A;  4GFB A;  5BQT A;  4CCL A;  3DPJ A;  2H6B A;  3GO5 A;  4PSW A;  4A5N A;  2VE9 A;  1T0F A;  1JTX A;  5J4V A;  3PO2 J;  4XSX F;  1ETY A;  1YRN B;  2QQ9 A;  2LYC A;  2CFX A;  5HDK A;  5EEA A;  3G1L A;  4K2E A;  1E0E A;  1XSD A;  2H6C A;  5C3E J;  2DA1 A;  2A5Y B;  2VI6 A;  3QYB A;  3RIR A;  1DUX C;  3GTP J;  4HQM A;  1YJN I;  1IC8 A;  4F7Z A;  2DG7 A;  4AVP A;  4ENN A;  5EZG A;  5H6R A;  2ZJR F;  3KYL A;  4PGH A;  4ENK A;  2JJ7 A;  2X6Y A;  2B63 J;  3KFW X;  2VKD A;  2XSJ C;  4XN3 A;  1J9I A;  1BW5 A;  2W53 A;  3G1M A;  3CO7 C;  1OCR H;  2QUF A;  3BZC A;  3CUQ B;  3M3Y J;  2EJR A;  3WTX C;  3HOS A;  3JRH A;  2WAD A;  3BZ6 A;  1B59 A;  4II2 A;  5CQE A;  1TW3 A;  2ESN A;  3LMM A;  4CCN A;  1V5G A;  1J75 A;  3HKZ A;  2FU4 A;  2X4H A;  1HOM A;  3SQN A;  5F0C A;  3CC7 I;  4WF2 A;  2QWW A;  4BAC A;  2X6O A;  4OMY A;  3CJT B;  4PJJ A;  3SEQ A;  1SAN A;  2DMQ A;  2DJI A;  3HOT A;  1SAX A;  3R60 A;  1PP7 U;  3ISP A;  2V6C A;  1NTC A;  3KLN A;  4HPQ A;  3TP3 A;  3J81 K;  2O8K A;  1KU3 A;  4P55 A;  2IS1 A;  4KT5 C;  1H88 C;  4JYK A;  2DDB A;  3NWS A;  5ICC A;  2HDD A;  1N25 A;  3GFL A;  2K9M A;  3CDL A;  2HYJ A;  4PJM A;  3R0A A;  4DGW B;  4ENM A;  4KIF A;  4V2G A;  2G7H A;  2VQL A;  2HYF A;  3ERM A;  5J8F A;  3CLQ A;  1X4O A;  4YIR X;  2DFE A;  5M5W J;  3DEU A;  2VOO A;  5DUI A;  3DBH B;  3HUG A;  2P5K A;  3RKQ A;  2CJJ A;  3LWJ A;  1OCC H;  4ESB A;  4HNU A;  4RGR A;  1W4M A;  1PUE E;  4LIV A;  4XLC A;  1DPR A;  3F8N A;  5KHD A;  1SFE A;  3HKZ N;  2NVT J;  2K9L A;  2YX7 A;  4XL9 A;  1QO0 D;  4ACI A;  3RKY A;  4BDZ A;  2XF7 A;  2A6T A;  3UKG A;  2PBI A;  2WAE A;  1VF9 A;  2UXX A;  4AF5 A;  4JK1 X;  3GEZ A;  5IT9 Z;  5JI6 A;  5D5X B;  3L2R A;  4I0B A;  3HDD A;  3BG9 A;  4FTH A;  2FJI 1;  1U5T A;  2ADU A;  2LRE A;  3TO6 A;  2F5C A;  3JRI A;  3CCJ I;  1CGP A;  2ESH A;  2ZJ2 A;  1V4R A;  2KPM A;  5C4X J;  1YIJ I;  1T98 A;  5FD6 A;  4E7I A;  3H5A A;  1K6Y A;  3KP2 A;  4GFK A;  4XK4 A;  3PPB A;  3DFG A;  1E3H A;  1O57 A;  2JK3 A;  4L9T A;  1O3S A;  2IA0 A;  4IRH A;  3HB9 A;  1YIT I;  2HXO A;  3F21 A;  1F1Z A;  1SD5 A;  3LST A;  4PCQ A;  3CCS I;  3S3O A;  2DG8 A;  2MD0 A;  1ZGA A;  4XNF A;  4O6J A;  2ZCW A;  3S2W A;  1HDD C;  2W85 A;  1XS9 A;  3P9T A;  2KIU A;  2HOT A;  2L7Z A;  5CPR B;  3JAM Z;  3W2V A;  3GW2 A;  2XB0 X;  1W36 C;  4KWA A;  3HL2 A;  4WXD A;  5KAI C;  4HQE A;  3OIQ A;  4I76 A;  3CCM I;  1U9O A;  5K5R A;  3VIB A;  4IQ4 A;  2VON A;  4IHW A;  3OYK A;  1HKS A;  1RR8 C;  5D5V B;  3GCM A;  4UVA A;  4AIK A;  1KA8 A;  4OIO F;  3D5R C;  1HC8 A;  3Q5F A;  4GYI A;  1RI7 A;  3LL7 A;  2RAE A;  2UUZ A;  2X0L A;  3B81 A;  1R23 A;  2EH3 A;  1DP3 A;  5BS6 A;  3MMY B;  2B7E A;  2QBY B;  2F4I A;  3ESW B;  4UV9 A;  5DAJ A;  5F08 A;  4BUP A;  5H2F C;  1R1V A;  4HNV A;  2R5Z A;  3PQK A;  3CCY A;  1G3S A;  4UUT A;  3VEP A;  4CYC B;  2PMH A;  2Q8K A;  1PJR A;  2LK2 A;  1RRJ A;  2GA1 A;  2O6G E;  3HPG A;  4QLC U;  1IDY A;  2EZL A;  5L3B A;  3ABM H;  1FSE A;  2ZNY A;  4NQW A;  1RC9 A;  2WBM A;  5A2Q Z;  4CCJ A;  3RYR A;  1WKM A;  4YZE A;  2OI8 A;  1EH6 A;  2E19 A;  2VXD A;  1IUY A;  1BC7 C;  2JT1 A;  4PSX A;  2RNJ A;  1C0W A;  2OCC H;  5F1J A;  3RD3 A;  1GVD A;  1G4D A;  5DV5 A;  5EYR A;  2EA4 A;  1XCB A;  1BC8 C;  2YVE A;  3LA2 A;  1SVM A;  2YVH A;  2DA3 A;  1TT5 B;  1JT0 A;  2HVR A;  2W4S A;  3HOW J;  3C18 A;  5LEK A;  2ZXJ A;  5TIS C;  2O8X A;  2EFP A;  2CQK A;  2XF6 A;  3FHN A;  4M3G A;  5HNH A;  1WGX A;  1FIA A;  2M7B A;  3RCO A;  2WAQ A;  4UNO A;  2O9L A;  2IGM A;  4FAS D;  2X1E A;  2K85 A;  1UST A;  2KRC A;  5BPI A;  5LHI A;  2M1B A;  2HVQ A;  1IXC A;  2XPV A;  3C2G A;  2HQR A;  1BA5 A;  2F2E A;  2VT2 A;  5HLH A;  1IN7 A;  3CTA A;  3Q3S A;  4Z6Y A;  1FNN A;  2FBK A;  2CQX A;  3D0S A;  2XF5 A;  1JUS A;  2ZKZ A;  2QLZ A;  3VFZ A;  2WV0 A;  3MFK A;  3EYY A;  2GLO A;  3ZN0 A;  1SD6 A;  4N9I A;  4BHC A;  5K5O A;  1M1E B;  4CUG A;  1B8I A;  2E1M B;  3C7J A;  2Q2E A;  1HST A;  3PQJ A;  2RV8 A;  2ME0 A;  3A0H C;  4YFX F;  3M7G A;  1XMA A;  2VBZ A;  3BG7 A;  2CS3 A;  2B9S A;  4GCL A;  2K3P A;  3OYB A;  3K1P A;  1Z67 A;  2GOM A;  4KIT B;  1MH4 A;  1P92 A;  2K86 A;  1DU0 A;  2YU3 A;  3BCA A;  4MHG A;  4M6V A;  2WB1 A;  3X2Q H;  2O03 A;  4MK6 A;  4DBQ A;  5LD2 C;  3BR2 A;  4GGG A;  3WG9 A;  4L9V A;  3C07 A;  4C3J J;  2QCO A;  2A68 F;  1T56 A;  1F43 A;  4Q5S F;  3ZMD A;  3BJ6 A;  2M45 A;  2FRH A;  3L2V A;  5FMP A;  2X9D A;  3BT9 A;  5J8C A;  5E3N A;  2STT A;  3LWF A;  4NC8 A;  3HUG B;  2HTS A;  3K2A A;  1CF7 A;  2HQ5 A;  1Y0U A;  2MAB A;  3ASO H;  5JR3 A;  1VQM I;  3QAH A;  1ZR2 A;  3S1Q J;  3KKC A;  1Z21 A;  1WI9 A;  3E7Q A;  2HDC A;  2HPM A;  3O60 A;  5GAD J;  3V8J A;  3KZ9 A;  2QSG X;  4BY1 J;  2EV0 A;  2YSR A;  2K40 A;  2R7R A;  1VQO I;  2FD5 A;  3EPZ A;  4E70 A;  2LMD A;  4HBL A;  3BWG A;  4BKX A;  3NNR A;  1BR4 A;  2VUM J;  4EV0 A;  2V1U A;  1FP1 D;  5DD8 A;  3OYF A;  1U5T B;  1YE9 A;  2AXL A;  2ISY A;  1O4X A;  3OY9 A;  3C2B A;  1S8N A;  4OD4 A;  1JHH A;  4RAF A;  2XGD A;  1TC3 C;  1LFU P;  3I5U A;  1Z9C A;  3A02 A;  3BRU A;  2RAS A;  3NRV A;  1REP C;  1Y6I A;  2JUC A;  2D1H A;  2OD5 A;  4M73 A;  2NS0 A;  5F04 A;  2J5P A;  4D9J A;  3ZMZ A;  3DPT A;  4UXN A;  5FGM A;  5TRD A;  2IXS A;  2LG4 A;  4BNC A;  3F22 A;  5E18 F;  1GVJ A;  1X2M A;  5B66 C;  3G4S I;  2WWY A;  3HOU J;  4ZTF A;  1XMX A;  2LSO A;  2ZFW A;  4AYB A;  3CMM A;  3J7Z I;  2EZH A;  2ACJ A;  2FQ4 A;  3BG3 A;  2XC7 A;  2A6E F;  4WK8 F;  2D6Y A;  3IC7 A;  2GWR A;  1WSU A;  2F48 A;  2FML A;  2CGP A;  2ID3 A;  4W1U A;  3I71 A;  3BJB A;  4F52 A;  1SD4 A;  2CH0 A;  3FZV A;  5FLX Z;  4A12 A;  1B1B A;  4A6E A;  3HJE A;  4J01 A;  1KU2 A;  2CUF A;  4RS8 A;  4G7H F;  1HW2 A;  3VOE A;  2R5Z B;  2P7C B;  4E7S A;  3LAP A;  3S93 A;  4BDY A;  3WGI A;  3H3Z A;  1S6L A;  3H9Q A;  4KDP A;  3V8L A;  1LFB A;  3DTK A;  4OIP F;  1O3R A;  2RC4 A;  4J19 A;  1I6H J;  4F55 A;  4NQW B;  2HYG D;  2R7O A;  1W0T A;  3NPI A;  1T2K A;  3DWL E;  3WTS C;  2WTE A;  1WJ5 A;  1U6G A;  4UB8 C;  3KET A;  1X1D A;  4A3L J;  5DS9 A;  2MC4 A;  3BR6 A;  4IPA A;  3OIO A;  1F36 A;  3JSO A;  4GCV A;  2G7U A;  1ZGW A;  3DF8 A;  1RPW A;  1LEB A;  1MMN A;  3J81 Z;  3E3V A;  3RJP A;  1USS A;  2XAQ A;  2E35 A;  2E71 A;  3MN2 A;  1WJA A;  3K70 D;  3PO3 J;  1QA6 A;  2CYY A;  2DTR A;  2OBP A;  2R7U A;  2KLO A;  2KT0 A;  1OCO H;  3K7A J;  2Y75 A;  1LE8 A;  3GUD A;  4CZC A;  3N97 A;  2VKE A;  5DEQ A;  2V9V A;  1IZ1 A;  4E6K G;  3P9K A;  2AO9 A;  4WWC A;  3DU6 A;  2KQR A;  3CCE I;  3BTC A;  5GTH C;  3RDI A;  3OSF A;  1GXP A;  2IPQ X;  1QZY A;  2A6H F;  4LK0 F;  4G9Y A;  3IWZ A;  3GF2 A;  2ECB A;  4O5V A;  1QVU A;  2Q0O A;  4HYE A;  3SZT A;  3OYC A;  1IGN A;  2DW4 A;  2L7M P;  3GTO J;  1RKT A;  5E3O A;  2DA2 A;  3DU5 A;  5DCM A;  5GTI C;  2IA1 A;  1B4A A;  2QSH X;  3VTI A;  4KNY A;  1AWC A;  4H4K C;  3MCZ A;  3MKW B;  3K4K A;  2AXT C;  3DBR B;  2KP6 A;  2L02 A;  2RQP A;  2LFB A;  2W57 A;  3GXO A;  3KLO A;  3S14 J;  2O61 A;  1B8I B;  2DQR A;  2Q2E B;  1AKH A;  1OCT C;  1HW1 A;  4M9Z A;  1QQI A;  2BW3 A;  3LSK A;  1R71 A;  2KDO A;  2DQL A;  3PL8 A;  5D5W B;  4FIS A;  3H92 A;  3PNY A;  3VOK A;  5BNG A;  2BEO A;  3HTA A;  3CES A;  1YIO A;  4M6X A;  2VQG A;  3VDX A;  2CG4 A;  5FFZ A;  2KRH A;  2F6C A;  2F5V A;  3RKW A;  4PZJ A;  1WCM J;  3A1Y A;  3KEQ A;  3E5X A;  3M8F A;  3WU1 B;  2VXZ A;  3PSI A;  1HXD A;  4MTD A;  1APL C;  2XPW A;  1ZRF A;  2PFV A;  3PUF A;  1HKT A;  3FDY A;  1S3J A;  2PLY A;  3B6C A;  1BJA A;  3F23 A;  2GZW A;  5JLW A;  2Y31 A;  2XGX A;  1K79 A;  3AG2 H;  2XSD C;  2BY0 A;  2HI3 A;  3P9C A;  3ZMT A;  4XLE A;  4OAY A;  4IRG A;  4ZC3 A;  2A69 F;  5D4R A;  5K7F A;  2M3A A;  5CVU A;  1CF7 B;  1NK3 P;  1VQL I;  4Y52 J;  4LK1 F;  4PGG A;  3D5L A;  3WTZ A;  2PI0 A;  3M4O J;  2OA4 A;  1O7L A;  2F5D A;  1I3Q J;  2PMU A;  4E7Z A;  2N8G A;  3KPH A;  1H89 C;  2QWT A;  2EV6 A;  3TO9 A;  2WA0 A;  2E1N A;  2RVC A;  3KP4 A;  3G1O A;  5DUK A;  1R1T A;  1TTY A;  4BGD A;  1JXS A;  1KZH A;  2WGB A;  2R7S A;  2EFN A;  2BOL A;  4XQF A;  2P6T A;  2G7G A;  3N4M A;  4OOI A;  2CQ7 A;  1XG1 A;  1A5J A;  1FYK A;  2ICW G;  4C2T A;  3MZ8 A;  5C4Y A;  2NOG A;  1TWC J;  3I58 A;  2V26 A;  1ZR4 A;  1FBU A;  3W6J B;  3QU6 A;  2IS4 A;  2DMU A;  1Y8Q B;  5KVR A;  1Z3Y A;  2VN2 A;  3G71 I;  4FHT A;  3JCU C;  4MGR A;  5KK1 A;  2RRE A;  3EUH C;  2D2W A;  5D8L B;  3L1P A;  2BVL A;  1ZGJ A;  1FMV A;  3LFU A;  3IH4 A;  3F8C A;  4S04 A;  1WQ2 A;  1R9T J;  3OL3 A;  5DYM A;  2P4W A;  3NAR A;  5FKO A;  4IZZ A;  2HOS A;  5D19 A;  3E6M A;  4X0G A;  2M4K A;  2IW5 A;  4EMS A;  5J47 A;  1V5F A;  1BOB A;  2R7D A;  5E3L A;  3B02 A;  3S15 J;  3QPL A;  2HPI A;  3ZR8 X;  9ANT A;  1WJD A;  4U7D A;  3J7A O;  4YG2 F;  2DAO A;  3OS2 A;  2K7L A;  2MD5 A;  3I64 A;  2F07 A;  3BJA A;  3UR3 C;  1MBH A;  2K3F A;  2JVG A;  3PNV A;  1H9G A;  1Y56 A;  1LDK B;  3K4B A;  4RM3 A;  3FKJ A;  1WJF A;  1MH3 A;  1BN5 A;  1YJ9 I;  1B6A A;  1KYW A;  1ZYR F;  2Z9O A;  3TW6 A;  1IDZ A;  4BQO A;  4ZYG A;  1JTY A;  3FIW A;  3ZP5 A;  1RUO A;  5KCM A;  2NYX A;  3OYG A;  2EPF A;  3G73 A;  2OQG A;  3ANP A;  3I53 A;  3KZZ A;  5TGT A;  2O3F A;  1ERD A;  5CVJ A;  4AVZ A;  1FX7 A;  4MQV A;  5D8K B;  3OMY A;  5BOX A;  4L62 A;  1T6S A;  1ON2 A;  5J40 A;  2EIJ H;  1EH8 A;  1Z6R A;  4FX4 A;  3BOQ A;  3VW1 A;  5E1W A;  2XB5 A;  4PJ0 C;  1E2X A;  1ETQ A;  2PX9 A;  3RTR A;  2R7T A;  1J5Y A;  1R7J A;  4BY7 J;  3HSF A;  3V8K A;  3HM5 A;  4A0X A;  1SMY F;  1Z05 A;  1A04 A;  1YO5 C;  3IH3 A;  2KL4 A;  3BRO A;  1J7K A;  2ZSI B;  4AIJ A;  5B1B H;  3KP5 A;  2CV1 A;  3IRQ A;  1TW2 A;  3GLX A;  3TMO A;  1OR7 A;  3SWH A;  1QHG A;  4RAY A;  5D18 A;  1MBJ A;  4KN7 X;  1LE8 B;  2ZCX A;  3OR2 C;  5LHG A;  3CMY A;  4M3B A;  4HST A;  4HEA 2;  1S7E A;  1MJA A;  2H94 A;  5K5Q A;  3EET A;  1X3U A;  4D1Q A;  4XLA A;  5TJJ A;  1SGM A;  1UHM A;  3MKL A;  1ZG3 A;  3BY6 A;  2XAJ A;  2CUE A;  4A0Z A;  4U87 A;  4UB6 C;  4LG0 A;  5DDG A;  2Z3Y A;  2MH2 A;  2DK8 A;  5DCM B;  1X19 A;  2ID6 A;  4OIN F;  3RKX A;  2GXG A;  4HX4 A;  3HHG A;  3CF2 A;  1EH7 A;  1LUJ B;  2BY1 A;  3CCQ I;  1Z6T A;  1U9N A;  3ZOB A;  1P4W A;  3GZ5 A;  2RGV A;  3HSE A;  1STZ A;  4BXU A;  4ESF A;  4QTR A;  1AKH B;  3FM5 A;  4S05 A;  2BW3 B;  4M9S A;  5KNL A;  4BHB A;  3C1D A;  1IJW C;  1DP7 P;  1BM9 A;  3FXL A;  4LMY A;  1SEU A;  4IKF A;  5EZH A;  2E1O A;  2IS6 A;  2QKL B;  4XRM A;  3AFH A;  2EBI A;  3CUQ C;  3ZQG A;  4JKZ A;  3R4K A;  4GXO A;  5FKM A;  3VP5 A;  3HXL A;  3TQN A;  1SFU A;  4MIM A;  2DMP A;  2BV6 A;  1ZTR A;  4NBQ A;  2YVX A;  1Y1V J;  5JHF A;  3S32 A;  2Q24 A;  5J6X A;  2CWE A;  4YRV A;  1OYW A;  5ERI A;  2DA4 A;  3BZK A;  3U1K A;  5HLG A;  4RM2 A;  3C3W A;  3CDI A;  2NOJ B;  1QZE A;  4CCO A;  1DQU A;  2CW0 F;  3FIS A;  2R7Z J;  1T95 A;  3GVA A;  2R4G A;  4EVI A;  3WGG A;  4ITV A;  4B3X A;  5D1R A;  1J2X A;  2DFH A;  2TRT A;  3E1S A;  1MND A;  2HZT A;  3OYA A;  1TQP A;  3IP4 B;  3CCU I;  1WJC A;  2E5Z A;  4HV6 A;  3AKZ A;  4CCK A;  1VQ5 I;  2A05 A;  5CJ9 A;  2FQ3 A;  2QQ8 A;  3G3Z A;  3W6K B;  3R61 A;  4I02 A;  1S29 A;  1P4A A;  2YR2 A;  1K83 J;  2BZT A;  1SFK A;  4ZJZ A;  1XSX A;  1K4T A;  5FLV A;  1J59 A;  2ZB9 A;  3MWM A;  2HDW A;  5IP6 A;  3A4C A;  2CV0 A;  2MLK A;  1MMG A;  3HRU A;  3E6C C;  5IP9 J;  4UUS A;  1JUM A;  2YPR A;  5FB2 A;  3RQ4 A;  1I1G A;  2Y69 H;  4MFE A;  1ZRD A;  4P1W A;  5HOD A;  4X6A J;  3RZD J;  1FBS A;  4ZDO A;  4I7H A;  1AA7 A;  1D0X A;  1SMT A;  2HGC A;  4C3I J;  2QZ8 A;  4LB6 B;  2W7N A;  3HOV J;  3LAJ A;  3ECO A;  2STW A;  1NG6 A;  5J3L A;  1V54 H;  2DPU A;  2PJP A;  2ZY9 A;  2VL8 A;  3OV8 A;  3FBN B;  4AC6 A;  3BC8 A;  3ONQ A;  5IOY A;  1VQ7 I;  3B6A A;  4I2O A;  1FLI A;  4M74 A;  3DEE A;  2Q1Z B;  3VSK A;  4A3C J;  3S3M A;  4LFU A;  2YS9 A;  2JTV A;  3BCB A;  3WE3 A;  1R5I D;  5EFY A;  4GRI A;  2NP5 A;  3M1C A;  4UHT A;  2QIB A;  2BY2 A;  4M3F A;  4D0P A;  3AL0 B;  2I8D A;  2MG4 A;  4MFD A;  1BI2 A;  4XLH A;  4PJL A;  5CVI A;  4RAZ A;  3H1C A;  2DT5 A;  2M9H A;  3ZRG A;  1VZ0 A;  2CQN A;  2MLG A;  1XGO A;  4G6D A;  1QPM A;  1HSJ A;  2H1K A;  2ELJ A;  1UG2 A;  4J00 A;  2A5W A;  2XDN A;  3LSI A;  1Z7L A;  2DMN A;  2L4A A;  4IHY A;  4R79 A;  1CQT A;  1P4X A;  4M9X A;  5F0H A;  2OTL I;  2BBY A;  1MMS A;  4WIB A;  4TV7 A;  3BHQ A;  4N9H A;  2LKS A;  1YQA A;  5LHH A;  2DTZ A;  1PVE A;  4JX4 A;  2MA3 A;  1D5Y A;  3I4M J;  1N75 A;  1JT6 A;  2JRM A;  3V7R A;  4F3Q A;  3CLO A;  2QKO A;  5AQC A;  1MJB A;  3HTJ A;  2WY7 Q;  2MC3 A;  2CFO A;  2IA2 A;  1SD7 A;  4G6Q A;  4S0H B;  3ZQH A;  1RET A;  4FX0 A;  3SJM A;  1R49 A;  1QPI A;  4AUX A;  2KIQ A;  3SFI A;  3OR1 C;  4BBS J;  2ZCM A;  2FJ1 A;  2NVQ J;  4WXH A;  1WZ2 A;  1LDJ A;  1ZQ3 P;  2V1N A;  2O7O A;  1TQI A;  3I4N J;  2LKP A;  4BH9 A;  1ZLJ A;  3CP8 A;  2KJB A;  3QOE A;  4U0W A;  2E60 A;  5E1Z B;  2VIX A;  3K8P C;  4JOM A;  4NUB A;  3CRJ A;  1Z0X A;  3FMR A;  4LG0 B;  2RNG A;  4BQN A;  5CXI A;  5EEH A;  3AQT A;  1G59 A;  4XOT A;  2H1L A;  4HLY A;  2ZC2 A;  1VQK I;  3NQO A;  1MSE C;  1UI5 A;  2P8T A;  1LFP A;  1MBF A;  2FX0 A;  5LGN A;  1W5T A;  1YG2 A;  3JRA A;  1QBJ A;  1VI0 A;  3DTI A;  1QGP A;  2JA5 J;  5DM6 F;  2PG4 A;  5L3F A;  4N0B A;  3KIO A;  1VQ8 I;  3O3K A;  3OYN A;  3HTH A;  3VYT B;  3ZMS A;  3VW0 A;  4DIQ A;  1XMK A;  2ZOZ A;  3CDH A;  3GFM A;  1V3F A;  1A31 A;  2P7V B;  2CO5 A;  2JN6 A;  2G3B A;  4HW0 A;  5FHP A;  3FXK A;  2FNA A;  1UHW A;  3GZ6 A;  2UXO A;  5GP9 A;  4LB5 A;  2E1M C;  3FWE A;  2DDA A;  1MNE A;  1FIP A;  3OWT A;  3BQY A;  2V9P A;  3OYJ A;  1OCZ H;  2JZY A;  2LH9 A;  1LJ9 A;  4N4O B;  5D6F A;  1WHU A;  3VW2 A;  4IJA A;  2BGC A;  1ZH5 A;  3W2A A;  3EGQ A;  1R1U A;  2HOA A;  2V9K A;  3Q0U A;  4IXA A;  2MBF A;  5ILS A;  1BBY A;  1P7J A;  3KEY A;  3LSM A;  2QVO A;  5FKN A;  1OQY A;  3V42 A;  4EGZ A;  3GTQ J;  1W36 D;  5ED4 A;  3GTJ J;  4ZYD A;  4PJN A;  1BW6 A;  2V7F A;  3QOP A;  4U0V A;  5F0F A;  1ODD A;  1QHH D;  5D6E A;  1U0J A;  2KDZ A;  3FHZ A;  2BXY A;  4D7N A;  1L0O C;  1O7F A;  2X48 A;  3FBI B;  1ZK8 A;  3PUB A;  4UUS B;  2Z2S B;  4ZDL A;  1BJZ A;  1DU6 A;  3FRQ A;  4OU0 A;  5C4J J;  2Y9Y A;  3PFY A;  5LEJ A;  4LJZ F;  1R58 A;  4I09 A;  2BYV E;  3PIO F;  2RKH A;  3WTY C;  2COB A;  2NS8 A;  2QYO A;  2AHQ A;  4HDV A;  2DO7 A;  2HU9 A;  2FMY A;  1X1P A;  2L2O A;  4G8X A;  3GZI A;  1WH7 A;  3WOD F;  3DQV C;  5IYB J;  2L3D A;  4KMU X;  2COM A;  1JE8 A;  1MNM C;  1FJL A;  1UI6 A;  3ABT A;  1JKO C;  2IGK A;  2CMP A;  2DBB A;  1V55 H;  2QEN A;  3Q0V A;  3QPT A;  1IXR C;  4HRI A;  1RKW A;  2HQN A;  1S7A A;  2L5Q A;  3UNG C;  3W2W A;  2X85 A;  3H5R A;  1PYV A;  2E2H J;  4XLN F;  4I99 C;  4NC6 A;  1MBE A;  1BR2 A; 
#chains in the Genus database with same CATH homology
 2E2J J;  1WCM J;  2LLK A;  1UMQ A;  2NVY J;  1ITY A;  3BTJ A;  4G12 A;  3QPS A;  3HIM A;  2EZI A;  4GFB A;  1APL C;  2XPW A;  5FGL A;  3F0C A;  1HF0 A;  3DPJ A;  3B6C A;  1TWF J;  1PUF A;  2HXI A;  2YUS A;  3LNQ A;  4HKU A;  1JTX A;  5JLW A;  2Y31 A;  3CQZ J;  1FTT A;  2XSD C;  3PO2 J;  2GEN A;  1ETY A;  2REK A;  2HI3 A;  5K7H A;  4NDL A;  1B72 A;  1YRN B;  4QSH A;  2JWT A;  5K7F A;  3BG5 A;  1NK3 P;  4B3A A;  4Y52 J;  5CXG A;  3O8G A;  5EEA A;  3HOY J;  3G1L A;  4D5C A;  3M4O J;  4GCK A;  1I3Q J;  4A3M J;  2N8G A;  5C3E J;  1H89 C;  2QWT A;  2DA1 A;  1MBG A;  1MBK A;  2VI6 A;  3PAS A;  3GTP J;  1Z77 A;  3G1O A;  1IC8 A;  2GFN A;  2WGB A;  2DG7 A;  2M2E A;  5EZG A;  5CW8 A;  2G7L A;  2G7G A;  4XID A;  1XG1 A;  2JJ7 A;  2B63 J;  1A5J A;  5C4Y A;  2NOG A;  1TWC J;  3FK7 A;  1ORK A;  4DYC A;  1ZR4 A;  1BW5 A;  2W53 A;  3G1M A;  3T6N A;  2DMU A;  2XPU A;  2ZCN A;  3FKI J;  3M3Y J;  4UDS A;  3JRH A;  3L1P A;  3HE0 A;  2NVX J;  2MSY A;  2WV1 A;  3ZQC A;  3IH4 A;  4DYR A;  4MLO A;  1HOM A;  1JKR C;  5F0C A;  4FCY A;  1R9T J;  2NP3 A;  2TCT A;  5FKO A;  3NAR A;  2HOS A;  2X6O A;  5IPA A;  5D19 A;  3JRC A;  4A3G J;  3VUQ A;  3O8H A;  1SAN A;  2DMQ A;  1A6I A;  5C44 J;  1SFO J;  2QTQ A;  1VND A;  4A93 J;  3VVZ A;  3WHC A;  5E3L A;  3TP3 A;  4DW6 A;  1NTC A;  2O8K A;  1HDP A;  5J1Y A;  3S15 J;  3QPL A;  2W48 A;  1H88 C;  4JYK A;  3GTK J;  9ANT A;  1JKQ C;  2HDD A;  3VPR A;  1U8B A;  2F07 A;  4QIW N;  3CDL A;  2HYJ A;  1MBH A;  4V2G A;  3JRE A;  4FE4 A;  1WPK A;  1MH3 A;  5IYC J;  4GFL A;  2IEK A;  5IP7 J;  3TW6 A;  5M5W J;  4IEJ A;  1IDZ A;  1JTY A;  3FIW A;  4W97 A;  3RKQ A;  2CJJ A;  3LWJ A;  2PBX A;  3ANP A;  2MGQ A;  5HBU A;  3HKZ N;  2NVT J;  2LVS A;  5M3M J;  4ACI A;  1T33 A;  1ETX A;  3UKG A;  1IRZ A;  4L62 A;  1VF9 A;  4NEL A;  4AF5 A;  1TWH J;  3QBM A;  2DA5 A;  2DMT A;  3JRB A;  3VW1 A;  1AHD P;  2XB5 A;  3HDD A;  5GPA A;  3NRG A;  1ETQ A;  3BG9 A;  4FTH A;  2WAQ N;  3D1N I;  3JRI A;  4BY7 J;  3HGY A;  1JKP C;  1QRY A;  2P81 A;  3HM5 A;  5H9T A;  2CQQ A;  1QVT A;  5C4X J;  3IH3 A;  3GEU A;  3EUP A;  4D7M A;  4XRS G;  4GFK A;  4XK4 A;  3PPB A;  2Y9Z A;  3LSR A;  2JK3 A;  5D18 A;  2R5Y B;  3ON2 A;  1MBJ A;  1LE8 B;  3W6V A;  2ZCX A;  4ICH A;  2GBY A;  3HB9 A;  3CMY A;  4M3B A;  2XGC A;  4RBO A;  2HXO A;  1S7E A;  2O7T A;  4XIC A;  2DG8 A;  1SGM A;  3MKL A;  1HDD C;  2E2I J;  1XS9 A;  3P9T A;  2CUE A;  1RES A;  2L7Z A;  2HOT A;  3MVP A;  2Y2Z A;  2XB0 X;  4KWA A;  4A3J J;  5FKK A;  4EEF G;  4I76 A;  2ID6 A;  1U9O A;  2Y0S N;  3VIB A;  1WH5 A;  4MO7 A;  4IHW A;  1HCR A;  5IOZ A;  1U9N A;  3ZOB A;  5EGO A;  3NAU A;  2RAE A;  3S5R A;  5J1R A;  3B81 A;  2EH3 A;  5DTD A;  2DA7 A;  4QTR A;  4ABZ A;  2DN0 A;  3LSG A;  1AKH B;  3G7R A;  2WB1 N;  5DAJ A;  5F08 A;  2M34 A;  4JP0 A;  2K9S A;  2JA8 J;  4HNV A;  2R5Z A;  1IJW C;  3CCY A;  2EQR A;  3ZQI A;  4UUT A;  4CYC B;  5EZH A;  2E1O A;  3COL A;  4XRM A;  2LK2 A;  2L7F P;  2R93 J;  2EBI A;  3TED A;  3ZQG A;  2HKU A;  5EG0 A;  4JKZ A;  1IDY A;  2EZL A;  3BR5 A;  5FKM A;  3VP5 A;  4MIM A;  2DMP A;  1ZTR A;  4YZE A;  1Y1V J;  2OI8 A;  4X1E A;  3BTI A;  3DEW A;  5M5X J;  1NK2 P;  2LY9 A;  2E19 A;  2Q24 A;  4DYQ A;  3NI7 A;  2DA4 A;  2QF7 A;  3LSP A;  3HTI A;  5F1J A;  3RD3 A;  1GVD A;  3FIS A;  1PUF B;  5EYR A;  2R7Z J;  2UXI A;  3CWR A;  3BR1 A;  3KKD A;  5D1R A;  2YVE A;  2TRT A;  2YVH A;  2G7S A;  2DA3 A;  1JT0 A;  1B72 B;  2DA6 A;  3HOW J;  1IG7 A;  1I50 J;  3A01 A;  4M3G A;  1POG A;  1WGX A;  1FIA A;  5IYD J;  2O9L A;  1K83 J;  2ZOY A;  2NX4 A;  1OCP A;  2ECC A;  2R92 J;  3OOU A;  5FLV A;  2ZB9 A;  3IV5 A;  3GTM J;  5IP6 A;  3S1M J;  1GUU A;  5IP9 J;  4UUS A;  2XPV A;  1IV6 A;  1JUM A;  3OSG A;  4B1R A;  1BA5 A;  4MFE A;  2LTP A;  5HOD A;  4X6A J;  4M3D A;  4BBR J;  3Q3S A;  3RZD J;  3VVX A;  4A3K J;  2CQX A;  3S17 J;  1JUS A;  3F1B A;  4AC0 A;  1ETV A;  4C3I J;  2UXH A;  3HOV J;  3SDG A;  2GLO A;  2EZK A;  2K9Q A;  2G0E A;  5J3L A;  1U78 A;  1B8I A;  1Q1V A;  1W0U A;  4AYB N;  4A69 C;  4AC6 A;  3JRD A;  3JSJ A;  2NS7 A;  5IOY A;  2ME0 A;  2IAI A;  3B6A A;  2D5V A;  2RHA A;  1OFC X;  1HLV A;  4PXI A;  4A3C J;  4GCL A;  3HGG A;  2YS9 A;  4RDU A;  1MH4 A;  3S2H J;  3ZQF A;  5EFY A;  1BL0 A;  3BR0 A;  1GT0 C;  1DU0 A;  2NP5 A;  2QIB A;  4M3F A;  4M6V A;  2MG4 A;  4MFD A;  5K58 A;  3ZQL A;  3CJD A;  5E3M A;  4MK6 A;  3HOX J;  2PMZ N;  3BR2 A;  5EDN A;  2QOP A;  4C3J J;  4C2M J;  3C07 A;  2QCO A;  2M9H A;  1T56 A;  4BXX J;  4A3D J;  1F43 A;  5FMP A;  2X9D A;  2I10 A;  2H1K A;  2GUH A;  3BT9 A;  1TWG J;  5E3N A;  4FE7 A;  1UG2 A;  1JGG A;  2XDN A;  4DZJ A;  1YRN A;  2DMN A;  2JA6 J;  4A3E J;  1CQT A;  4IHY A;  3K2A A;  1ZKG A;  2HQ5 A;  1ZR2 A;  3RZO J;  3PM1 A;  5F0H A;  3S1Q J;  3KKC A;  3LSJ A;  4A3B J;  3IUV A;  2GM4 A;  3E7Q A;  3O60 A;  5FLM J;  3BHQ A;  4L5E A;  3KZ9 A;  4JNN A;  1FEX A;  4JL3 A;  1GV2 A;  2CRG A;  4BY1 J;  4B4C A;  3ANG A;  2DTZ A;  2K40 A;  3H0G J;  4JX4 A;  1D5Y A;  1XC5 A;  2FD5 A;  3I4M J;  3KNW A;  1JT6 A;  3A03 A;  4A3I J;  1E3O C;  3V6G A;  4BKX A;  3BQZ A;  3NNR A;  2VUM J;  2QKO A;  4LOC A;  1H8A C;  3BCG A;  2OER A;  5AQC A;  5GPC A;  3HTJ A;  1O4X A;  4D5F A;  2FBQ A;  3C2B A;  4S0H B;  3ZQH A;  1RET A;  4Y7N J;  2XGD A;  3SJM A;  2ELK A;  1QPI A;  1TC3 C;  4AUX A;  3AQS A;  1LFU P;  3GTG J;  3SFI A;  3A02 A;  4BBS J;  2ZCM A;  2FJ1 A;  1VFC A;  2NVQ J;  2RAS A;  3BRU A;  2R0Q C;  1JJ8 C;  1P7I A;  1ZQ3 P;  2O7O A;  1G2H A;  1ETW A;  3LOC A;  3I4N J;  5F04 A;  2LR8 A;  1Y1W J;  3S1N J;  2JA7 J;  1GV5 A;  3DCF A;  3G56 A;  1X2M A;  3S1R J;  3CRJ A;  3VOX A;  2VPR A;  4CGR A;  1Z0X A;  3E7L A;  2Y30 A;  3Q0W A;  5CXI A;  3HOU J;  3AQT A;  4M3E A;  3QQA A;  2EZH A;  2FQ4 A;  3BG3 A;  2JMW A;  2D6Y A;  1MSE C;  1UI5 A;  3ON4 A;  2ID3 A;  4W1U A;  1MBF A;  3BJB A;  2FX0 A;  1IUF A;  5EGO B;  4MXM A;  3JRA A;  4XRS A;  1VI0 A;  2H8R A;  2JA5 J;  2CUF A;  1WI3 A;  3HTH A;  2R5Z B;  2MW8 A;  2UXU A;  3LJL A;  1RR7 A;  1K61 A;  4C3H J;  3VW0 A;  3H3V K;  2ZOZ A;  4ME9 A;  1LFB A;  5M5Y J;  5EG0 B;  2JN6 A;  4J19 A;  2G3B A;  2UXP A;  1I6H J;  5FHP A;  1OJL A;  3HOZ J;  1W0T A;  3WHB A;  2UXO A;  5GP9 A;  3NPI A;  1AU7 A;  3FK6 A;  4A3F J;  1FIP A;  2WUI A;  5K7Z A;  3BQY A;  2ME6 A;  5DS9 A;  4IHX A;  4A3L J;  2L9R A;  1UHS A;  1TWA J;  1EF4 A;  3BR6 A;  3S16 J;  3VW2 A;  3OIO A;  2DJN A;  3GTL J;  1F36 A;  3IH2 A;  1ZGW A;  3EGQ A;  2HOA A;  1RPW A;  3Q0U A;  4GCT A;  3TP0 A;  2HYT A;  1P7J A;  5HSZ A;  1JUP A;  5FKN A;  5JLX A;  3MN2 A;  1GDT A;  3GTQ J;  3PO3 J;  3GTJ J;  1ETK A;  4I6Z A;  2VKV A;  4JX5 A;  3MNL A;  5HAW A;  1BW6 A;  3BR3 A;  4IHV A;  3A01 B;  2KT0 A;  3K7A J;  5F0F A;  2R5Y A;  1FTZ A;  1LE8 A;  2L0K A;  2XGE A;  3QKX A;  2LKX A;  2VKE A;  2KDZ A;  4D7N A;  4DZP A;  2AO9 A;  1MSF C;  3HBL A;  3BTC A;  2X48 A;  3OSF A;  1ZK8 A;  2M8G X;  4UUS B;  1BJZ A;  3GBG A;  3JR9 A;  1DU6 A;  3FRQ A;  3S2D J;  2ECB A;  5C4J J;  1QVU A;  2Y9Y A;  1IGN A;  5FJ8 J;  2V57 A;  2L7M P;  3GTO J;  1RKT A;  5E3O A;  2OF7 A;  2DA2 A;  2IBD A;  3RH2 A;  5M3F J;  2PZ9 A;  2COB A;  2LP0 A;  2NS8 A;  4NN1 A;  2AHQ A;  2IU5 A;  3BNI A;  3RQI A;  2XRL A;  2LD5 A;  4JX6 A;  2LFB A;  3V78 A;  2OPT A;  3S14 J;  3LHQ A;  3BTL A;  3GZI A;  1ETO A;  1WH7 A;  3HEF A;  1X2N A;  5IYB J;  5EF6 A;  1B8I B;  2K9N A;  1AKH A;  1OCT C;  1MNM C;  1FJL A;  1UI6 A;  1JJ6 C;  2M0C A;  1JKO C;  3Q0V A;  4V2F A;  5FKL A;  2YU9 J;  3JRG A;  1RKW A;  4FIS A;  4CYC A;  3JRF A;  1X58 A;  3VOK A;  5BNG A;  2E2H J;  3HTA A;  3TW7 A;  2CU7 A;  5J1U A;  1ENH A;  3NXC A;  3VVY A;  1MBE A;  5F27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...