3B6AA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with actinorhodin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
213
Chain Sequence
b'MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActR protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 70
structure length 213
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6aA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6aA02
2EZHA 1U9NA 2H1KA 1TWCJ 1RKTA 4UUTA 4CYCA 3D1NI 4UDSA 2ECCA 4L62A 4JKZA 3FIWA 3G1OA 3NAUA 4ACIA 3O60A 3GZIA 3W6VA 3BG3A 2Y30A 4RBOA 4XRMA 1GVDA 1SANA 2YS9A 2CQQA 2XB0X 3ON4A 5J1RA 2R5YB 5EFYA 3HTJA 2JA6J 4M3BA 1U9OA 5E3MA 4ABZA 4JL3A 4C3HJ 3BT9A 2HXOA 4NDLA 4XICA 2OF7A 1YRNA 1UI6A 1MBEA 3HGYA 2Y9ZA 2XRLA 3VIBA 4B3AA 2NVXJ 1HF0A 2LKXA 3BCGA 3BJBA 4A3MJ 3WHBA 4M3GA 1PUFB 2H8RA 1QRYA 2Y0SN 1SGMA 3RH2A 2JMWA 3GTJJ 1NTCA 3I4MJ 5HAWA 3S1RJ 3ZQLA 4NELA 3PPBA 5H9TA 2IBDA 4JX5A 1R9TJ 5C3EJ 2XPUA 5F0CA 5CXIA 3KKCA 3M3YJ 3FK6A 3C2BA 3VVXA 2ECBA 2F07A 5E3NA 4J19A 2E19A 1UI5A 1IRZA 1E3OC 5IPAA 1B72A 1MH4A 4GCLA 2ZOZA 4DZPA 3O8HA 1BW6A 3HGGA 1I6HJ 4Y52J 4HKUA 2UXOA 2QOPA 3H3VK 4DW6A 3B81A 2HYTA 2L0KA 1ZK8A 2XPWA 2O9LA 5DS9A 2LK2A 3BR0A 4DYCA 3JRDA 3JRIA 4A3LJ 2DMNA 4JX4A 2NVTJ 1UHSA 2HDDA 1XC5A 1ORKA 3BQZA 1JGGA 4XK4A 2DMQA 3CMYA 2DG8A 5F27A 5DAJA 2YVEA 2QIBA 3BG9A 3DCFA 4A3CJ 3TP0A 5BNGA 2YUSA 2CUEA 4LOCA 3IH3A 1MSEC 2NX4A 2EZIA 3L1PA 4A3DJ 4UUSB 3F1BA 1BW5A 3KKDA 1IDZA 2E1OA 4EEFG 4A3EJ 3BNIA 2NP3A 3PM1A 2DG7A 4MFEA 2CUFA 3MNLA 1ETXA 3H0GJ 1IUFA 2JN6A 1AKHB 2XSDC 3OSFA 4M3FA 3RZDJ 1EF4A 3MN2A 3BTIA 2XGCA 1B8IA 3S17J 3BTJA 5EDNA 1LE8A 5C44J 5E3OA 2FQ4A 1GDTA 5EEAA 3E7QA 2FD5A 2O7OA 3RZOJ 4A93J 2HYJA 1AHDP 4A3FJ 1GUUA 1VNDA 3A02A 2ZCMA 3FISA 1FIAA 5EGOB 4I76A 4FE4A 3PO2J 4DYQA 2L7ZA 3BR3A 2ZOYA 4JYKA 3GTQJ 2Q24A 4GFBA 2ME0A 1ZR4A 4GFKA 5C4YA 1UMQA 4ICHA 2NS8A 2V57A 1ETWA 4XIDA 1FJLA 3ANGA 3TW6A 2JA7J 1A6IA 2IAIA 5EG0A 1FTTA 3CQZJ 4FISA 3LOCA 1ETYA 2FBQA 1MBKA 1JUMA 5F04A 3TEDA 2JK3A 5FHPA 2I10A 3ZQIA 5GPCA 2GENA 2TRTA 3MKLA 3ZQCA 3EGQA 1I3QJ 2M0CA 2G0EA 2ID6A 5IOZA 1Q1VA 3PO3J 4C2MJ 3BTCA 3SJMA 1U8BA 2YU9J 2DA1A 2R5YA 4CGRA 3SFIA 2R93J 3QPSA 3VW2A 3DPJA 2WUIA 1TWGJ 4Y7NJ 3GTMJ 1T56A 2DA4A 3Q0WA 1JT6A 2NS7A 5M3FJ 1FTZA 4AC6A 2DTZA 1HLVA 4C3JJ 3VOXA 2DMUA 3V6GA 1SFOJ 2WAQN 4G12A 1JKQC 1F36A 2NVQJ 5CW8A 3DEWA 5M3MJ 3A03A 3S5RA 2COBA 3HEFA 3AQSA 2DN0A 1VFCA 2P81A 5HBUA 2K9QA 4L5EA 1VI0A 4A3GJ 2QKOA 5HSZA 3KZ9A 2M34A 1JTYA 1ZGWA 1W0TA 1MSFC 2ZCNA 3NI7A 5EZGA 2GM4A 5AQCA 4C3IJ 4QSHA 1OCTC 4AF5A 3K2AA 2Y31A 2L7MP 5FKLA 1WPKA 3CCYA 3GBGA 4MFDA 1TWHJ 2Y9YA 3JREA 1POGA 4FTHA 5FLVA 5J1UA 1BL0A 2ZCXA 5EZHA 5M5XJ 5F0HA 1JUSA 4XRSA 2OI8A 4A3JJ 3HB9A 1WI3A 1IG7A 4D5CA 4JP0A 3GTPJ 3S1MJ 4I6ZA 3CWRA 3EUPA 2KDZA 2QF7A 4DYRA 4QIWN 3UKGA 2VUMJ 2QTQA 3JSJA 5FKNA 3TP3A 3RQIA 1NK2P 2RASA 1H8AC 3LSGA 4MO7A 3JRGA 3G7RA 1ZR2A 2EZKA 3HOVJ 2NP5A 1GT0C 3VVYA 5IP6A 4GCKA 3GTOJ 2PZ9A 2LLKA 3ZOBA 5FGLA 1LFBA 1LFUP 1APLC 3LHQA 2X48A 1QPIA 3V78A 4W1UA 4MLOA 2ME6A 1JJ8C 5K7ZA 2R7ZJ 3CRJA 2KT0A 1FEXA 3FRQA 3ZQFA 4B1RA 2AO9A 2D5VA 3RKQA 3BR1A 1JTXA 1RR7A 1X2MA 2DMPA 3IH4A 3JR9A 3JRAA 1XS9A 1AKHA 4ME9A 4D7NA 1RETA 3HOWJ 4AC0A 2RAEA 2LFBA 2LVSA 2VKVA 1IV6A 1ZQ3P 3NNRA 3A01A 2DMTA 1O4XA 1I50J 2UXPA 3G1MA 5IYBJ 3HOXJ 2L7FP 2R5ZB 5EGOA 1JKOC 2HI3A 1Z0XA 5IYDJ 4MK6A 2TCTA 1P7JA 1X58A 3C07A 1JJ6C 3GTKJ 2OERA 3Q3SA 3PASA 2JJ7A 3GTLJ 4MXMA 5D1RA 4M6VA 1MBGA 3BR5A 2ID3A 2PMZN 2DA7A 3RD3A 5C4XJ 5EF6A 3F0CA 5FLMJ 2FX0A 3MVPA 3ANPA 4PXIA 3BRUA 3B6AA 3VW1A 2EH3A 1IC8A 3QKXA 5GP9A 2XGDA 3HOUJ 2GFNA 1ETOA 1GV5A 4B4CA 2YVHA 1H88C 5CXGA 2HOAA 2K9SA 2CU7A 5K7FA 2XPVA 1BA5A 3NRGA 2IEKA 1HCRA 2W48A 3O8GA 4A3BJ 2K40A 2DA2A 3VOKA 1ETKA 2OPTA 5FKKA 2CRGA 5IP7J 2Y2ZA 4A69C 2LTPA 1QVTA 2E2IJ 2CQXA 5IOYA 2QWTA 2JA5J 1DU0A 2EZLA 3K7AJ 3OOUA 3TW7A 4M3EA 4MIMA 3HBLA 2B63J 2MSYA 3G56A 3NPIA 4IHXA 3GTGJ 4GCTA 2HOTA 3VUQA 3OIOA 3HTHA 2O7TA 3S1NJ 2M8GX 3ZQHA 5EG0B 2VKEA 1PUFA 1BJZA 2N8GA 5M5YJ 1MBHA 2UXUA 3BTLA 3M4OJ 4BBRJ 4BXXJ 1ETQA 3B6CA 4FCYA 1ZKGA 3CDLA 3LJLA 3BG5A 1H89C 9ANTA 4BY7J 4CYCB 3VW0A 3JRFA 3E7LA 2HQ5A 2VI6A 1RPWA 1Z77A 1ETVA 3S1QJ 5F08A 3HM5A 3WHCA 2XDNA 1CQTA 2QCOA 3Q0VA 1MH3A 4QTRA 2M9HA 4BKXA 1HDPA 5IP9J 4D7MA 2RHAA 1A5JA 3FK7A 2VPRA 2REKA 1YRNB 1F43A 1ZTRA 2R0QC 5FJ8J 2ZB9A 1WH7A 5JLWA 2LD5A 4BBSJ 2MGQA 1AU7A 3LSPA 4RDUA 4X6AJ 2XGEA 3HOYJ 3VVZA 2WGBA 4IHYA 3BR6A 3HKZN 2GLOA 3HOZJ 2JWTA 5D18A 5D19A 2GBYA 4AUXA 3P9TA 2UXHA 3LWJA 1DU6A 1X2NA 1OCPA 3BR2A 5F0FA 3VPRA 3IV5A 4S0HB 2E2HJ 2MW8A 1U78A 1S7EA 5M5WJ 4W97A 2G7GA 4D5FA 4NN1A 4X1EA 4UUSA 3GEUA 3G1LA 1TC3C 3ON2A 4M3DA 2WB1N 2NOGA 1T33A 2HKUA 2DA6A 1B72B 4V2FA 3NARA 2EBIA 2W53A 1W0UA 2M2EA 2FJ1A 2MG4A 3SDGA 4IEJA 2UXIA 1ENHA 3S2DJ 4JX6A 1WCMJ 2R5ZA 3ZQGA 5FKMA 1XG1A 1NK3P 3S16J 5F1JA 2CJJA 3KNWA 3JRHA 1JKPC 3HTAA 2G7LA 3IH2A 3BQYA 3QQAA 1TWAJ 2DA5A 3T6NA 1GV2A 5J1YA 5C4JJ 1QVUA 3LNQA 5GPAA 1RESA 1D5YA 2K9NA 2L9RA 2LY9A 2R92J 2O8KA 2D6YA 3HIMA 4GFLA 2ELKA 2X9DA 4YZEA 4IHVA 4IHWA 3LSRA 2E2JJ 3I4NJ 1TWFJ 2GUHA 1OFCX 2PBXA 1WGXA 3BHQA 1MBJA 1Y1WJ 3FKIJ 2DJNA 5IYCJ 4DZJA 1K61A 1P7IA 2HXIA 1ITYA 5J3LA 1IGNA 4JNNA 3S15J 3JRCA 2XB5A 1JKRC 1G2HA 3CJDA 5K7HA 3HDDA 2JA8J 3HE0A 4V2GA 1UG2A 4A3KJ 4AYBN 3A01B 1B8IB 1LE8B 1IDYA 4KWAA 2DA3A 3QBMA 1MBFA 2EQRA 5FKOA 5DTDA 4XRSG 3AQTA 5E3LA 4FE7A 1HOMA 2WV1A 3OSGA 2AHQA 2LR8A 3IUVA 5HODA 3S14J 3Q0UA 2G3BA 1VF9A 1MNMC 3HTIA 1WH5A 1RKWA 5FMPA 1FIPA 1K83J 1IJWC 2NVYJ 2IU5A 1Y1VJ 4BY1J 1OJLA 1HDDC 2X6OA 2LP0A 5JLXA 3S2HJ 3JRBA 3VP5A 1JUPA 2G7SA 5K58A 5EYRA 1JT0A 3LSJA 3NXCA 4A3IJ 3QPLA 3COLA 4HNVA 2HOSA
chains in the Genus database with same CATH superfamily
2OCCH 1WJCA 3EETA 1XTAA 3ZMDA 2ZNYA 3HC7A 4L62A 4IKFA 4UDSA 2GWRA 3H3UA 3ZXSA 3DKWA 4M72A 2IS2A 2BV6A 3G1OA 3O60A 1R4MB 3W6VA 2A69F 3SZGA 1D0ZA 2Y30A 3VWBA 3VTIA 3PFYA 4CCNA 4PK4A 1Q1HA 2HR3A 4RB2C 2Z9OA 4LFUA 1D1AA 3W6JB 4XKWA 5J1RA 4A0ZA 1E3HA 5DD8A 2MYSA 5EEHA 5TGTA 4JL3A 1B4AA 1DPRA 2DLLA 1UI6A 4DQ2A 3E5UA 1U3EM 5BMZA 3VIBA 4U0WA 4B3AA 4U7DA 1LDKB 2JUCA 2LKXA 3KP7A 1J9IA 1LVKA 5D6EA 5D6FA 3VSLA 2H8RA 3ZMUA 3RH2A 1WJDA 5AONA 2MBFA 3S1RJ 5H9TA 3PPBA 2IBDA 1Z3XA 4F52A 1R9TJ 1IZ1A 2XPUA 1BR2A 2QQ9A 5CXIA 3DP7A 1XPXA 3M3YJ 3C2BA 3VVXA 2V26A 1X4PA 2V1DA 1OCOH 4LIUA 3AFHA 1J5YA 3FBNB 3KX2A 3GCMA 4XM3A 4F7ZA 2X4HA 5IPAA 4HDUA 1K78A 2ZOZA 4DZPA 1ERDA 3HGGA 1FSEA 3SEZA 1BBYA 1TQMA 1QZEA 3C2HA 3KLNA 1PDNC 3B81A 2O9LA 3FX3A 5LFAA 1YIOA 1B6AA 2ETHA 2X0LA 2DMNA 3V4GA 3DPTA 2PLYA 5JFRA 1ULYA 2CH0A 3HOSA 3Q5FA 5KHDA 3BQZA 4HF2A 2XASA 3NQOA 2CSOA 4XK4A 2DMQA 1MDMA 2YVEA 2QSGX 1ZYRF 2OJED 2DOFA 4G7ZF 4Y3OA 5BOXA 2M3AA 5E8IA 3IH3A 1VQNI 1J2XA 3L1PA 4UVBA 4LK0F 1BIAA 3IC7A 5E79C 1UG0A 4A3EJ 3MZYA 1FYMA 2KIQA 4MFEA 4A6DA 2H94A 3G73A 1ETXA 3H0GJ 1FBUA 2RGVA 3F6OA 3K10A 3OIQA 4BAYA 1AKHB 3MN2A 3BTIA 3PSIA 2EV6A 2XGCA 3RKYA 3W2VA 3ZMVA 3CCEI 2FQ4A 3BZCA 3PSFA 1BM9A 2JPCA 3FMRA 2K86A 1T98A 2FD5A 1SC7A 3RZOJ 2VQLA 1MMDA 4XLEA 2L01A 1GUUA 1FOYA 1VNDA 4DBRA 3RI4A 3H35A 1G3YA 1FIAA 4I76A 2R7WA 2YVXA 2P8TA 5K5OA 1I3AA 2L7ZA 2RC4A 3BR3A 1R22A 5LGUA 5JVTA 2EV0A 3KZZA 2ME0A 3J80Z 5C4YA 4XR6A 2VODA 1YS7A 2ZSIB 1MNEA 1ZREA 4NHJA 2DODA 2GA2A 2JA7J 3ELKA 2M1BA 2ZJQF 2MC4A 2TDXA 2JK3A 5FHPA 4GCVA 3ZQIA 5GPCA 3K4NA 2TRTA 1G3SA 1KU9A 3MKLA 3EGQA 3SZPA 3R61A 2G0EA 5IOZA 1ZH5A 5D8KB 1RI7A 1WFXA 3OYKA 4IXAA 1U8BA 1LPQA 4Q47A 3OR2C 4EM0B 4OOIA 3EYYA 2DA1A 3KYLA 4U7BA 3CCLI 2VT2A 2KJBA 4L0YB 4KIFA 1LDDA 3CUQB 4Y7NJ 3WGGA 1DDNA 1ZN2A 3GTMJ 3Q0WA 2DPDA 4IHSA 3QAHA 4U9LA 1FTZA 4C3JJ 1WSUA 2M4KA 2WAQN 2PN6A 3GF2A 1F36A 2V6CA 4A2UA 2NVQJ 3DEWA 5M3MJ 2IJLA 3PFIA 2BXZA 1XD7A 2COBA 3HEFA 3T8RA 5F6FA 4DGWB 4HX4A 1ZARA 2LH9A 4OIPF 3FHNA 2WC2A 3S8PA 4CSWA 3KZ9A 4ZZLA 1ZGWA 2A6TA 3DBHB 1Y0NA 4B3XA 4RGUA 1MW7A 3OYEA 2OA4A 3E97A 3AG3H 2ZJPF 1WWXA 2ZBKA 4P9UA 1V5FA 3H1CA 4D9JA 5D5XB 4MFDA 1TWHJ 2Y9YA 3IP4B 3JREA 3CC4I 2IP2A 2PG4A 5ICFA 4XL9A 2A3SA 1B9NA 2BY0A 3OYNA 4I6ZA 4EM2A 2XROA 3ASNH 4QIWN 1R5GA 2GIVA 5FKNA 3TP3A 3ABMH 4MO7A 3JRGA 3WG7H 1R49A 1LEAA 3N4MA 2DJIA 2LKPA 3HHHA 5HLIA 3HOVJ 2NP5A 4QLCU 1GT0C 1YX5A 3GTOJ 2LLKA 3DTKA 5FGLA 2BVLA 2GQQA 1APLC 3LHQA 1V54H 2ME6A 2ZXWH 2KT0A 4N9IA 3ZQFA 2D5VA 2FU4A 4OAYA 3TMOA 1JGSA 1JTXA 1S5LC 3L00A 4BJ6C 1AKHA 3JR9A 4L0ZB 2R7UA 4BE2A 4MQ9F 4C9YA 2G7HA 1HW5A 1O7FA 2ZSHB 4RS8A 3A01A 1O4XA 2RNGA 3C3WA 4KYWA 3QP6A 2NAZA 4HA8A 3G1MA 5IYBJ 2DT6A 4HLYA 2L7FP 2X1CA 4CA0A 1W36D 3IHUA 1JKOC 1MD0A 3D5LA 1Z0XA 3J7AO 3KLOA 4I7HA 3QYBA 1U8RA 2RV8A 2TCTA 2AXTC 2FBIA 5LLQA 4JOMA 3RDIA 4MGRA 4L9VA 2WY8Q 3GTLJ 3EQLF 3BLYA 4MXMA 1MBGA 3BR5A 5HS9A 3LA3A 5C4XJ 3GW2A 3M8FA 3UNGC 2M4GA 5EF6A 1FOWA 5HLGA 3GMEA 3CCUI 2FF4A 4HX8A 2V7FA 2ISZA 4PXIA 5TRDA 2HVQA 1IC8A 2L3DA 1W7PD 3QKXA 4ZTFA 1ZRCA 2BYVE 2B0LA 1W4MA 2YX4A 4B4CA 2YVHA 2K9SA 2BBYA 4M71A 5K7FA 2A68F 3O8GA 4S04A 1LB2A 3ECHA 1OR7A 2KRFA 3FXMA 1DP3A 2CRGA 2OCEA 2VJIA 3U1DA 2PX9A 1R1TA 1Z6TA 2LTPA 2IS4A 2CQXA 5LRRA 3MKWB 2GXGA 3CUQA 2YU3A 1SVLA 3F9KA 3GUDA 2HZTA 4MIMA 1YG2A 1R36A 3OYAA 2OQGA 3G56A 1OYIA 1IF1A 3VSKA 3GTGJ 2GXBA 4GCTA 1Z1DA 5K1YA 4IRGA 3SEQA 3K1PA 5KNLA 2STWA 3I58A 4EM1A 2DO7A 4E7IA 3ZQHA 1SD4A 4MQVA 1PUFA 1BJZA 2NNNA 1XSVA 3P9IA 2EPFA 4WCGA 2UXUA 3M4OJ 4QPOA 5CJ9A 3WTSC 1GVJA 2FOWA 3JTGA 1BI3A 2DOEA 1H89C 1DUXC 2PJPA 1LNWA 3C2GA 4CYCB 1ZRFA 2V9VA 1RPWA 2XAQA 3HM5A 3WHCA 4UB6C 1Z67A 3BG7A 2QM3A 4O5VA 3HL2A 1HSTA 1CQTA 5CKTA 4KISA 3J81K 2A6HF 1AOYA 3MKYB 3AAFA 1UFMA 4UVAA 2JT1A 5H6QA 2M9HA 4BKXA 1IW7F 3TQNA 1HQCA 3OIPA 4EJUA 3ZMTA 4HG2A 2REKA 1YRNB 1MMGA 1WHUA 1ZTRA 3R0AA 2BOLA 2KPMA 2UZKA 2M30A 2LD5A 3LSPA 2ZO4A 2E5ZA 2I5UA 2L9VA 2CW7A 3BR6A 4BH9A 4RMNA 4UV8A 2GBYA 3KEQA 2K9MA 1X2NA 1OCPA 4FX0A 2VN2A 4XN0A 5GAGJ 1BOAA 4KT6A 1K7AA 3IV5A 3CCRI 1G3TA 5IY5H 1S7OA 2DXIA 1IN4A 2LG4A 3ZMZA 3PJRA 4X1EA 4UUSA 3G1LA 2QQBA 2HTJA 1T33A 4NC7A 2F4MB 3DLAA 1K4TA 4PCQA 2QBYB 5LEKA 1W0UA 1IXSB 3TO7A 2XF6A 3PUFA 1J75A 2MG4A 3F21A 1G4DA 2QLZA 2V9KA 3HRSA 5DDGA 1USSA 3S2DJ 4CYDA 3I71A 1HKQA 5FKMA 3LAPA 4FASD 1VQ5I 3PNTA 2KZGA 2ZNZA 4CHUA 3HTAA 3BQYA 2EA2A 2FSWA 4U88A 1GV2A 3JAMZ 1QVUA 2HDWA 3OYBA 2R92J 3HIMA 2X9DA 1VQKI 4WX9A 3ERED 2STTA 5HS8A 1U6GA 2PBXA 2GA1A 1MBJA 2F5VA 1YE9A 4ESJA 5ED4A 1R7JA 1SFKA 1YW7A 3LL7A 2B9SA 4ENMA 4CH7A 1W7PB 4ZZDA 3JRCA 1VQPI 3LFKA 1JKRC 3DV8A 1G2HA 4WF2A 5K7HA 3HDDA 4V2GA 2DFHA 1KU2A 1YW8A 3A2KA 2D45A 4L18B 1P4XA 1LE8B 5E1ZB 3PQJA 4ZC3A 4I01A 3QBMA 2EQRA 4NC6A 3BPXA 5DTDA 3KP4A 4J01A 3AQTA 5E3LA 2KZVA 3IL2A 4N9HA 2VPLA 2VBXA 1EV7A 3MD2A 2VBYA 3K8PC 3FXJA 2QA4I 4EVIA 1IJWC 2F5CA 1P2FA 3I5UA 1ON2A 2ZFWA 3IRQA 4BY1J 3I54A 1HDDC 3Q9VA 4CCJA 5ERIA 3S2HJ 5JLXA 3KCCA 2G7SA 3WTYC 1Z7UA 2G9WA 4A3IJ 4BACA 3COLA 4HNVA 5B5EC 3VYTB 3CC7I 1YFHA 1U9NA 1YO5C 2H1KA 2L5QA 2LKSA 1RKTA 4CYCA 3D1NI 2ECCA 3CUQC 2LRDA 4A12A 4XSZF 1ZLKA 3U2RA 2E7WA 3GZIA 4M9ZA 3BG3A 4WK8F 1EKEA 4DJAA 5J47A 3MZHA 4LLGF 3CMAI 2KRCA 2E36A 3ON4A 4M3BA 2A07F 5E3MA 3ZR8X 2JUGA 4C3HJ 1YRNA 1U5TB 1MBEA 2FBKA 2ISYA 1TNSA 2Y9ZA 2HYFA 4MHGA 3RPUD 2NVXJ 1D5VA 2OZ6A 3BJAA 3J7YJ 3WHBA 4M3GA 3A0HC 2ZMEB 1B59A 1QRYA 2Y0SN 1SGMA 2PMZA 3HSEA 2CFOA 2JMWA 2Z5UA 2XV4S 1NTCA 4P9FA 3L2UA 3KYDB 3I4MJ 5F0CA 1XGSA 2VKDA 3KKCA 2Y69H 4CO8A 5CPRB 4HV6A 5E3NA 4J19A 1IRZA 1MH4A 1WJEA 2QBYA 1BW6A 2ZY9A 1I6HJ 4HKUA 2BE5F 2HPIA 3H3VK 3V8JA 3BJ6A 2XAJA 1SMTA 2HYTA 2FQ3A 4LLNA 2KIMA 3K9TA 4WXDA 3CJTB 4DYCA 4CZCA 3JRDA 3ZPLA 1XMKA 1IN7A 3HZJA 1A36A 1UHSA 2HDDA 2GXAA 1XC5A 1XX5A 2ZJRF 4HRIA 1USTA 3CMYA 5DAJA 3I59A 3BG9A 4IVNA 5BNGA 3GFLA 2YUSA 4CDGA 4H4KC 2K7LA 3CF5F 4LOCA 2XIGA 3LFUA 4NBQA 2NX4A 2EZIA 5LHIA 2K02A 5D5VB 2L9NA 4EEFG 1W7PA 3BNIA 4PSWA 1KGSA 1XN7A 3PM1A 2CUFA 3CP8A 1IUFA 1E17A 4LIVA 3COAC 4IZZA 1YITI 1BOBA 3KP6A 1PP8F 4YIFA 1LE8A 1DGRM 3FF5A 1EH8A 5J6XA 4CZZA 5C44J 2J5OA 1ZG1A 5DEQA 2RQQA 1R5ID 4G9YA 3NWSA 1AHDP 3D5SC 4A3FJ 4XN3A 3A02A 5E18F 2ZCMA 5LRSA 1X1CA 1V55H 2PBIA 4UB8C 2D2WA 2XAGA 3PO2J 3OS0A 3EYIA 1UB9A 3GTQJ 5HS7A 2RN7A 2Z99A 1WI9A 4Y13A 1ZR4A 1FX7A 2FUG2 2KLOA 2OC6A 3ANGA 2R7SA 4HF1A 2X85A 1X3ZB 2HQRA 3FXOA 1A6IA 2IAIA 3DKXA 5EG0A 4FISA 1KU7A 3LOCA 5ICGA 1SVMA 1U2WA 2GOMA 3VOEA 4AD9A 4E70A 5BQTA 4BL0B 3KZIC 1WQ2A 2M0CA 2ZKZA 2OUMA 4IOAF 3CJRB 3QU3A 4RB1A 3PO3J 4E7LA 2F48A 4FT8A 3BTCA 2KMUA 3H9JA 3WODF 2MA3A 2KIUA 4EATA 3SJMA 4B09A 4ETSA 1JXSA 3H5AA 3SFIA 3I56I 3QPSA 5J8CA 5F64A 4I99C 2WUIA 1T56A 1U5TA 3QPHA 4BQAA 4AC6A 1DGWY 3F8BA 1HLVA 2O8XA 1MMSA 2BEOA 1SFOJ 1O3QA 2PI0A 3SWHA 1YYVA 3DKYA 3I55I 2ZMEA 1Z6RA 3A03A 1KQ8A 5D4SA 3I53A 3HSRA 3DBLB 3AQSA 4A6EA 3VYRB 4PJ0C 2H27A 3F3XA 1VI0A 3L9FA 2QKOA 2XRNA 1JTYA 3JCUC 1KYWA 3RTRA 3T8TA 3LQQA 5EZGA 3L7WA 3I64A 1FMWA 2EINH 1F5TA 2JZYA 4P5OA 3Q9SA 4AF5A 1QPMA 3GO5A 2BW3B 2R7TA 3AG2H 5FKLA 4E7HA 4AYBA 4WXHA 3AKZA 5CLSA 2ZCXA 3WGHA 5EZHA 5TISC 2P7CB 1N78A 4R1HA 2VJ4A 2M87A 4IRHA 3TBIA 5LHHA 3W3CA 2CV1A 3F8NA 2B7EA 3V42A 3GTPJ 2V4JC 4Y33A 3DLLF 2HPMA 3CWRA 2KDZA 2QF7A 4DYRA 3CCSI 3SDBA 3MAJA 1MIJA 1H8AC 4B8XA 2XKPA 2KISA 2EFQA 1STZA 4WWCA 1W5CC 5IP6A 2DK5A 3CC2I 2M7AA 1O7LA 4GCKA 5CVRA 3ZOBA 4BHPA 3NWTA 1TW2A 1SD7A 1LFUP 1LKXA 3HXLA 2X48A 5J4VA 3V78A 4MLOA 4E7JA 3KFWX 3K4CA 5K7ZA 2QWWA 1FSHA 3ZQQA 3CRJA 1GLNA 3E1SA 2NVUB 4B1RA 3K6GA 5JHFA 3KEYA 4BDZA 1DP7P 2WA0A 3BR1A 5K5QA 5FO5A 1XS9A 4ME9A 3IH4A 4XSXF 1FP2A 1W36C 1RETA 2WADA 3HRTA 2IGKA 2LNBA 3ROUA 1OISA 2VJ5A 4PGGA 4ASNA 2LFBA 1FYLA 1IV6A 4UNOA 3NNRA 5DUKA 2DMTA 3OR1C 1I50J 4M74A 1KQ9A 2DT7B 4B48A 4LK1F 2ICWG 5CVVA 2DPUA 1S72I 4MNUA 1Y39A 4MK6A 5FD5A 3HPGA 5CQGA 4XKBA 1YW9A 1JJ6C 3C07A 2Q8KA 2OERA 1UCRA 1VQMI 5D1RA 2PMZN 2K3FA 4HAMA 1LUJB 4YIRX 3CUOA 1F9NA 1X1BA 2DA7A 2DQLA 4Q4ZF 2ZXJA 3PIPF 4E7KA 3NRVA 4MTDA 3E6BA 4R79A 3ZQ7A 1UJ8A 2K4JA 4LMYA 5HOOA 4PJMA 2XF5A 3BRUA 3VDXA 4NUBA 5E20A 4B43A 3OL3A 2EH3A 5J40A 4B44A 3VW1A 4N0BA 2CQ7A 5L3CA 2R7DA 1JI8A 1OQYA 1F4KA 1ETOA 4HW0A 4I02A 3V7RA 1R00A 2CV0A 2HOAA 2CU7A 3OY9A 2X6WA 4A0XA 3LSIA 1WJAA 1HCRA 4PFPA 1WJFA 1IRFA 4KN7X 4A3BJ 1EH6A 2NYXA 3VOKA 3FXRA 2Y2ZA 1YHQI 2DAOA 2VASA 4XNFA 4OWRB 2E2IJ 5IOYA 3VYUB 2E34A 2CW0F 2W1OA 3LSMA 3TGNA 2EZLA 3K7AJ 4IF4A 3GFIA 3K4BA 1ZRDA 2DDBA 2HKOA 3ECOA 2Z33A 2R7VA 3NPIA 2MLKA 3TL4X 1KA8A 1Z7LA 4Y15A 1E0EA 3OYLA 3HTHA 1UHWA 3CF2A 1YOVB 3S1NJ 4EJVA 2M8GX 2VKEA 4L9JA 4F92B 2O5RA 3DWLE 4G6DA 3PNYA 5M5YJ 2OV7A 4BQOA 4XKCA 2XAUA 1ETQA 4BXXJ 1ZKGA 3F72A 3ZRGA 4MTEA 4PSXA 2F5FA 3E7LA 2HQ5A 2BW3A 1ETVA 3S1QJ 1JHHA 5F08A 1U5TC 4ENKA 4Q5SF 2XDNA 5A2QK 2HDCA 3TOBA 4EJTA 2LF7A 2QCOA 3Q0VA 3WE2A 3WU0A 2ZMEC 1FNNA 4EGZA 4QTRA 1R4NB 2RDPA 1Y8RB 2ZFUA 4D7MA 2VONA 2RHAA 2VPRA 2VT3A 1RZ4A 1TP4A 2VB6A 3LSKA 2LBFB 1ON1A 2XSJC 4X0GA 4OMZA 1ZG3A 2ZB9A 2L2OA 5JLWA 2O6GE 2GIZA 2BY1A 2WGBA 2M5WA 3ASOH 1RR8C 2P7VB 3HKZN 3OYFA 2VOOA 2YR2A 3JAMK 4F91B 2E5NA 2F6CA 5B3SH 1FBSA 5F0FA 4BS9A 1S7AA 4Y17A 4YG2F 5ICCA 4S0HB 5ILVA 2MW8A 1RUNA 2E2HJ 2JQ7A 1S7EA 5M5WJ 2G7GA 2L4AA 3X2QH 4D5FA 2XC7A 4C2MA 1TT5B 3GEUA 2HS5A 2VL8A 1JHFA 1B72B 4V2FA 3EUHA 1U0JA 1X1DA 2W53A 1YI2I 2M2EA 4U87A 3SDGA 2IA2A 3IKVA 5BS6A 3N97A 2J5PA 4TV7A 4XLPF 1TZLA 1XG1A 4PZJA 3WTZA 3S16J 3JRHA 3QRFF 4DOZA 1SD5A 1JKPC 1GHCA 3QQAA 1TWAJ 1W5SA 5J1YA 3OYIA 5EEGA 2BGCA 3ML6A 2LY9A 2D1HA 1LJ9A 3JSPA 1IRGA 1N75A 2E2JJ 3IAM2 1WRJA 4XORA 1E3PA 1QNTA 5GAHJ 2CWEA 2E1CA 3TOAA 3ZCOA 1K61A 1PVEA 3TO6A 4XQFA 3HTUA 1OYYA 1FWZA 3S15J 3WTWC 3LAJA 3KYCB 5IT3A 2QSHX 3KIOA 2HVRA 3HE0A 2P5KA 1FP1D 4AYBN 4IO9F 1ONVA 4KFCA 3QOPA 4I0AA 2ACJA 1MJAA 4RA2A 4YFNF 2KQRA 3DPLC 2L4MA 3L2CA 1T2KA 2A5YB 2RREA 4YRVA 5FKOA 1VQ6I 1NG6A 1FT9A 2W25A 3OSGA 3CDHA 4LJZF 1D8JA 2LR8A 2YSRA 5HODA 1Y8QB 1FZPB 1VF9A 1WH5A 5FMPA 3KE2A 4PDKA 2VIXA 2XKOA 1Y1VJ 1ZG5A 5LGNA 2LF8A 3VYSB 2X6OA 1JUPA 1SEUA 3DU6A 4YFKF 4ZJZA 3V7CA 3LSJA 2P6TA 2E1NA 2HOSA 4ZYEA 4EJOA 4OIRF 2ELJA 1LEBA 1TWCJ 1ODDA 3H5RA 3E0JB 2Q1ZB 4JKZA 1DQUA 2OTJI 2EFPA 2FEZA 2KKOA 3EUKL 3NAUA 4ACIA 1KYZA 3MFKA 4GDFA 2IGNA 3CESA 1ZELA 2IA0A 3ULQB 4XRMA 2DBBA 2FA5A 2HQAA 4R8HA 1BJAA 1D0YA 2CQQA 2YS9A 2XB0X 5EFYA 2R5YB 4BQNA 1P4AA 2NNYA 1U9OA 1R5HA 5BPIA 2VQHA 5CYVA 2CV2A 3BT9A 3KP2A 2HXOA 4NDLA 1HW2A 1YTYA 5D8LB 5LGTA 1EA3A 5FFXA 1VZ0A 1UZCA 1NHAA 4A3MJ 4ZDPA 2OBPA 4LGWA 2X6YA 1MZBA 3GTJJ 2CS3A 1BN5A 4BEHB 2Z3YA 4UVCA 3F23A 1XMAA 5B1AH 2VQGA 4NELA 1LQ1A 3VODA 5C3EJ 5CVUA 2PMUA 5JR3A 3HRMA 2ADUA 3FK6A 1BR4A 3R0JA 2W7NA 4PGHA 2DK8A 3TDZC 4KMFA 1K4SA 2E19A 3U21A 4IX7A 1UI5A 3CMMA 3HG9A 1J09A 1E3OC 2HTSA 2R3SA 3QWLA 1MGTA 1B72A 4GCLA 2W00A 2V79A 5A2QZ 4BQQA 2FOKA 5D4RA 3GFMA 3SXYA 4LG0B 2QOPA 4DW6A 2L0KA 1J7KA 1EH7A 3C18A 5DS9A 5J4YA 1IN5A 1PYVA 2LYCA 4A3LJ 3OOPA 3RKWA 4RB3C 3I0TA 4NQWB 2BHZA 2NVTJ 1FLIA 4O3MA 1D1CA 3E5XA 2DG8A 4KITB 4G6TB 2QIBA 4XLFA 4A3CJ 1A04A 3TP0A 1IRXA 4HF0A 3KZYA 5HDNA 4II2A 1UAAA 1GXQA 2F4IA 2RKHA 1ACIA 3EUHC 3HUGB 3U9GA 3BPVA 4A3DJ 2B1EA 3KKDA 2AXLA 1IDZA 4A5NA 2WY7Q 1YIJI 4XRFA 1VQ9I 3K4MA 3KETA 5CVIA 1MJ9A 2IVMA 1M1EB 4XBFA 2DG7A 2QUFA 1YS6A 3IWZA 2JN6A 3HOTA 3OSFA 4M3FA 3QP5A 2RVCA 3BTJA 5EDNA 5E3OA 1GDTA 4QWQA 5EEAA 2WTEA 3BROA 3E7QA 2F4OB 2O7OA 2DYSH 4A93J 2HYJA 3RYRA 3L2WA 4MEYF 5EGOB 3BJOA 1H9GA 1OLTA 2XGXA 2K9LA 4FE4A 4BXUA 2WBMA 5J8FA 2ZXHA 4AU7A 2KJCA 4UUVA 2V1XA 3EUAA 4IJAA 3OS2A 2ZOYA 2XF7A 3SQNA 4L5JA 1QHHD 4GFBA 4U0YA 1G59A 2RQPA 1UMQA 3IKTA 4ICHA 2V57A 3KEOA 1ETWA 4U0VA 3VEPA 4CICA 2X1DA 2F5DA 4EMSA 3TW6A 1ZGJA 3GFJA 3MEXA 3CQZJ 1ETYA 1JUMA 3TEDA 2E60A 2PFBA 2GENA 2H1LA 3VB2A 1I3QJ 4F55A 2O0YA 2ID6A 2WB1A 1Q1VA 2ELHA 1XDUA 1HKTA 5KAIC 3IUOA 1L3LA 4YELA 2HVSA 2KIFA 4F3QA 2P0WA 2R5YA 5F1RA 1S9HA 2PEXA 4N4OB 4BJTA 2JTVA 4RLQA 3OYMA 4BNCA 2IXSA 4J00A 3DPJA 1SFEA 1TWGJ 3V7SA 1I1GA 3RQ4A 2DA4A 2EIKH 1A6QA 1JT6A 2W85A 3FMQA 2NS7A 4IQJA 2MABA 3VOXA 2VBZA 2DMUA 4LB6B 1JKQC 2M8EA 2K27A 5HLHA 2JSPA 3S5RA 4FETA 2HNHA 2QQ8A 3REOA 4BYYA 1VFCA 2CGPA 2DDAA 5HBUA 2K9QA 1O3RA 3PUBA 4XLCA 1K6OA 1W0TA 4DBQA 3NI7A 2V1NA 4HQEA 4NC8A 3CDIA 5AQCA 3BG6A 1N25A 2F5EA 5DM7F 1OCTC 3K70D 1WKMA 3DPUA 2Y31A 3H5NA 2L7MP 1TQPA 1F1ZA 3ABUA 3OWTA 3T1BA 4FTHA 1POGA 5FLVA 5J1UA 1BL0A 4AVPA 5M5XJ 2OI8A 5F0HA 1JUSA 2LMDA 3MWMA 4I09A 3ONQA 2W57A 3S1MJ 1O57A 1I5ZA 1R6RA 3EUPA 2VUMJ 3UKGA 2QTQA 3BWGA 3CO7C 3G3ZA 2E1MB 1UHMA 4RAYA 3RQIA 1T39A 2RASA 4IPAA 4C2UA 4KJZA 2DI3A 3CJQB 3KP5A 3G7RA 2EJRA 2EZKA 1XDSA 1ZR2A 1HC8A 5HVQC 2BZTA 3VVYA 4O6JA 2PZ9A 5JI6A 4BU2A 4C2TA 3GZNB 2FMYA 1XGMA 2CG4A 2LDUA 3H0DA 2BVMA 4KMUX 1FC3A 3LWFA 5DYMA 3DTEA 2R7ZJ 3S2WA 1FEXA 3FRQA 4Z6YA 1I39A 2KFDA 1K78B 1VQ8I 1V5EA 4A0YA 2DMPA 1X2MA 3IRRA 3AG1H 4AIDA 2KL4A 5HLTA 2YPRA 1E2XA 2DCEA 2DFFA 4AC0A 2RAEA 1XSXA 1T95A 3RIRA 3SYTA 1ZLJA 1ZQ3P 3HSFA 3P9CA 4HX7A 2UXPA 3LSTA 2QEXI 2QGUA 3FM3A 3QYEA 5HNFA 2R5ZB 1FOXA 5EGOA 4ZYDA 2HI3A 2HQNA 4JQFA 5IYDJ 1C0WA 1RIOH 1X58A 1OYWA 1TNTA 3GTKJ 4XOTA 4IQ4A 2LY2A 3Q3SA 5H20A 5HNHA 3PASA 4P55A 4YIIA 2ID3A 1VTNC 5AIPA 4ZYGA 3HJEA 3A4CA 3RD3A 2H09A 2I8DA 2XAFA 4EGYA 1G3WA 2R7OA 1T6SA 2V9PA 1TT0A 4BE0A 2CFXA 3F0CA 4G7HF 5FLMJ 1HW1A 5E17F 4KA4A 3MVPA 3M8EA 3ANPA 1L0OC 4LLLA 3FKJA 2HKXA 1G6NA 2XGDA 2G7UA 1V5GA 1PUEE 3HOUJ 3BCBA 3L2VA 2EFNA 2GFNA 1R23A 5CXGA 3U1KA 2ZCWA 1BA5A 4UV9A 3NRGA 3BC8A 2EILH 2ZXIA 1TTYA 3E6CC 2DA2A 2OQRA 5FGMA 2VOPA 4LG3A 1ETKA 1ZGAA 2OPTA 4GO1A 2P6SA 5FKKA 4PJLA 5L3FA 4LITA 1DPUA 1QVTA 3BCAA 2X51A 2JA5J 1P92A 1DU0A 5L3EA 3GZ5A 3TW7A 2UUZA 3CLQA 3OYHA 1JE8A 3HBLA 4C30A 2XHKA 1SMYF 4IHXA 4OIQF 1YQAA 3F8FA 5JHUA 2HOTA 3VUQA 2P4WA 3M8JA 4EJWA 4ZDLA 2MFZA 4AIKA 2O7TA 2M45A 1O3TA 4RGRA 2N8GA 2QKMB 2R7QA 2UV1A 3M9AA 5E1XA 2VJJA 2QKLB 4BBRJ 2JVHA 3DFGA 3B6CA 4FCYA 3OYCA 3CDLA 2ZC2A 4F93B 1QBJA 3BG5A 3R60A 2LY1A 4QPQA 9ANTA 1YX3A 2WAFA 3OMYA 5L3BA 4BE1A 3VW0A 3JRFA 2VI6A 4OINF 3FZVA 5IT9K 3GX4X 3FDYA 2QENA 4PJNA 1YJNI 2PQ8A 5EJCA 1X1AA 4XLAA 3DQVC 5DUIA 3RKXA 3J7AY 1MH3A 3LA7A 3DU5A 3GZ6A 1G8XA 1S29A 2CW8A 2D1VA 1A5JA 3B02A 3FK7A 2V1UA 1IN6A 4DVYP 2R0QC 2HU9A 2DFEA 2HOEA 5FJ8J 2MLGA 4BBSJ 2Z2SB 2MC3A 4EV0A 1AU7A 4RDUA 4OMYA 4X6AJ 5K5RA 2XGEA 2Y48A 2Z1DA 2GLOA 3LSHA 2JWTA 3MCZA 4XONA 5D18A 3PQKA 2UXHA 3LWJA 1KU3A 2VXDA 2VKHA 1DU6A 3BR2A 5FLXK 4RM2A 1FOKA 1GXPA 4W97A 2IGOA 1QQIA 3ON2A 3WTXC 4M3DA 2UXNA 2WB1N 2HKUA 3GXOA 5GAEJ 3JSOA 4NB5A 5HDKA 4XMYA 3NARA 2EBIA 1TLHB 2FJ1A 3WTVC 5GTHC 3H36A 2CUJA 4IEJA 3DBRB 3T5XA 4D1QA 2R5ZA 3AL0B 4V19K 3HYIA 4YFXF 3KNWA 1R1VA 2DA5A 2O3FA 1YJ9I 4LB5A 2OZUA 3HRUA 4HQMA 3WE3A 3PL8A 4YZEA 3CP2A 1K79A 4IHWA 3LSRA 2GUHA 1TWFJ 4AIJA 2PFVA 2LOOA 2JPBA 1HSJA 3GWZA 3O3KA 4M9XA 1Y1WJ 5FFZA 3B73A 5IYCJ 2UXXA 3FXKA 4DZJA 1QU3A 2CYYA 1P7IA 2HXIA 4JK1X 2PMHA 2FNPA 4KICA 5J3LA 1WJBA 2XB5A 4KN4X 1X3WB 3BOQA 5FRMA 2MH9A 3TO9A 2VE8A 1J0RA 1UG2A 3I4PA 4ZYAA 3A01B 3K4JA 3DEEA 2K4BA 4ENJA 1B8IB 1V3FA 1IDYA 4RAZA 3HIFA 1MBFA 4ANJA 2VBWA 4XRSG 1MKMA 4RLFA 1EJ9A 1HOMA 1P4WA 1R58A 4N4NB 1P9QC 4Q48A 2ESHA 3MMYB 3S14J 2DW4A 4ESBA 2G3BA 1IV8A 1RKWA 4CCKA 1FIPA 1K83J 3DF8A 4D0PA 2HEOA 2NVYJ 2LREA 5KAFC 1OJLA 3JRBA 3VP5A 2KHMA 3RPUA 5K58A 5EYRA 3H3ZA 3NXCA 1BI2A 1S8NA 2MD0A 1B9MA 3L2RA 2EZHA 3OYDA 3OYJA 4ITVA 1VQLI 4M73A 4UUTA 1ZHFA 3QODA 3K1NA 1TBXA 4BHCA 4CUGA 2KP6A 3ABTA 1D8KA 3F8CA 3FIWA 4KIGA 1NG7A 3F8MA 1Y6IA 2NRAC 2EIMH 1Z91A 4RBOA 1GVDA 2NXNB 1SANA 2FJI1 1LFPA 1QZZA 3NS4A 3HTJA 2JA6J 1XSDA 2YX7A 2Z16A 4ABZA 4CGZA 4HZFA 1V4RA 4GXOA 3ZP5A 4RB0A 4XICA 1LVAA 2BHYA 2F2EA 2OF7A 2HGCA 3HGYA 1RNLA 2XRLA 1AA7A 2QQAA 3OL4A 3LQRA 1HF0A 1Z9CA 3BCGA 3BJBA 3L2QA 4AIHA 2WWYA 1PUFB 4OU0A 5FB2A 2DYRH 3K4LA 3CD6I 4ESFA 2VLAA 4FX4A 2GZWA 4NNJA 2A5WA 2DTRA 3ZQLA 1R71A 5HAWA 4JX5A 3F22A 2OU2A 4EQQA 2Q0OA 2DT5A 4U9NA 3BDDA 1MMAA 2ECBA 3C1DA 2DFIA 3D5RC 1Z05A 2F07A 4S05A 3CZ6A 4MEXF 1TQIA 1LDJA 3W2AA 5IT9Z 2BXYA 4WXCA 1X4OA 4BXFA 5JVGF 2E1MC 4B47A 3O8HA 4RAGA 3RSNA 4Y52J 4CXFA 4II3A 2EV5A 2UXOA 3ESWB 2FE3A 1WVRA 1ZK8A 2XPWA 4G94A 4OAZA 1OCCH 1CF7B 3RCOA 3NEUA 1FBQA 2LK2A 4A5MA 1QA6A 1VQ4I 4HSTA 3BR0A 3H9QA 3JRIA 3CCQI 4JX4A 1RUOA 1D0XA 2P5VA 1ORKA 3K2ZA 2R4GA 2AQFA 1JGGA 3ZMSA 4OD5A 5F27A 1A31A 4M9SA 3DCFA 4HV5A 2CUEA 3MQ0A 1K6YA 1MSEC 4K2EA 2EFWA 4HPQA 5FLXZ 4I0BA 3FM5A 4RGSA 1BIBA 4UUSB 1AWCA 3F1BA 3JW4A 4I2OA 3WTTC 2E1OA 1BW5A 1I1SA 3GLXA 5HDGA 3M7GA 3WGIA 2FXAA 4Z2YA 2EIJH 2NP3A 3ISPA 3P7NA 4LD5A 2ESNA 4BHBA 3MNLA 2RNJA 1W5TA 4BDYA 2FNAA 4RM3A 3BY6A 2XSDC 3RZDJ 2IS1A 2JRMA 2X1EA 6PAXA 1EF4A 3S17J 2L02A 1B8IA 5CVJA 1X19A 2GAUA 3P5JA 1IXRC 3ABKH 3RPQA 3S3NA 1WJ5A 2WAEA 1MJBA 3FISA 1FYKA 1BR1A 3E6MA 1XB4A 1Y56A 4RAFA 4WIBA 2Y0SA 2P5LC 4DYQA 1RRJA 4JYKA 1HKSA 2AQEA 2Q24A 1IUYA 2IW5A 1IXCA 1QGPA 3EPZA 3QOEA 3O6BB 5DV5A 3G4SI 2H6CA 4GFKA 3FWEA 2NS8A 1S6LA 3ERMA 4XIDA 1FJLA 2EK5A 3ZN1A 1FTTA 3EDPA 2FBQA 4IHTA 1MBKA 5F04A 4GGGA 3ZGKA 2I10A 2Y0MA 4GRIA 4XLNF 4L5IA 3RYPA 4HNUA 5DM6F 4UHTA 3ZQCA 5GADJ 2EB7A 2W84A 3H9GA 3O2PE 4CCMA 3CCJI 3L09A 2LC2A 4C2MJ 1MMNA 3WG9A 3MKZA 4ZH4F 2YU9J 4KIBA 3GEZA 1VQOI 4CGRA 2JVGA 1XMXA 4OD4A 4YEJA 2R93J 3VW2A 3N05A 4ZYHA 5M3FJ 3JTHA 2DTZA 1KQ0A 3V6GA 3CO6C 3G71I 4G12A 3J7ZI 3A0BC 2LBFA 2MH2A 3T0YA 5CW8A 2ZJ2A 5LD2C 5KK1A 4BJ5C 3BZ6A 2DN0A 1Z21A 2P81A 3K70C 4HDVA 2QYOA 4L5EA 2IRFG 4A3GJ 5HSZA 2R7FA 1Z3YA 2M34A 3IAS2 1MSFC 2ZCNA 3E6DA 2L54A 2GM4A 3PNVA 2A61A 2CO5A 4C3IJ 3C7JA 4QSHA 2EFOA 3K2AA 2Y75A 5FRNA 5E1WA 1WZ2A 1WPKA 5LBQA 2MD5A 3CCYA 3GBGA 5E8GA 2CQKA 1PP7U 2K5CA 1CF7A 4XRSA 5B66C 1T08B 3RJPA 3S93A 5H6RA 3SFZA 4A3JJ 2R7RA 1R1UA 3HB9A 5KVRA 1WI3A 1IG7A 2FMLA 4D5CA 4JP0A 2O03A 3DEUA 3R6SA 5D5WB 1TW3A 3MZ8A 2CUZA 3JSJA 1S3JA 2VC1A 5FROA 1NK2P 3LSGA 2HFHA 3R4KA 2QVOA 4L9NA 2C6YA 2W24A 1OMIA 1P6RA 4GYGA 2IA1A 1LFBA 3FHZA 3OS1A 1QPIA 4AWXB 1FMVA 3M1EA 2FRHA 3E3VA 4W1UA 1JJ8C 3ABLH 3K69A 1KZHA 2FBHA 2OAZA 2Q2EB 1MNDA 1PJRA 5FD6A 2AO9A 1O3SA 3RKQA 4KT5C 1RR7A 2AS5F 3AL0C 4G8XA 3JRAA 4HNTA 4D7NA 3G2BA 4G6QA 3W2WA 3HOWJ 2W4SA 4BUPA 2W82A 2LVSA 2X6XA 2E71A 2VKVA 1J59A 5LEJA 1B1BA 2WV0A 1QHGA 1D1BA 3HOXJ 3WTUC 4ENNA 1BC7C 4GYIA 2LSOA 1QZYA 2DOAA 3I59B 2V6EA 1P7JA 2M7BA 2JJ7A 2NOJB 3FXQA 4M6YA 5AIQA 4KDPA 4M6VA 1BC8C 3WU1B 2IT0A 2B3WA 3CCVI 2HZDA 2E7XA 1YLFA 1OPCA 4M6XA 4E6KG 3QPTA 5CQEA 3SZTA 4HLXA 3W6KB 2FX0A 4RGXA 3E5QA 3M1CA 2CQNA 3B6AA 5LHGA 2JA2A 2VE9A 5GP9A 3DTIA 2L7KA 3G6EI 1T0FA 4ZTJA 4FQGA 1REPC 1GV5A 3LMMA 4HOBA 4HYEA 1H88C 2UWMA 2XPVA 2A2FX 3HPHA 3CJNA 4KUMA 3HHGA 1N77A 2IEKA 2W48A 1OCZH 2K40A 1TL8A 3D0SA 1SFUA 1D3YA 2E35A 2KRHA 5IP7J 1RC9A 4A69C 2HWVA 1BI0A 2PJRB 4HEA2 2QWTA 2XAHA 5GTIC 4G7OF 3I3LA 4ZDOA 3OOUA 1HA8A 2O61A 3I9V2 4OIOF 4M3EA 3CCMI 2B63J 2MSYA 2K3PA 1FY7A 2IPQX 5DCMB 2L9SA 2VQCA 4E7ZA 3OIOA 4IRVA 3ZN0A 1OR7C 1XGNA 1KONA 5EG0B 1BI1A 2EA4A 2IS6A 1A35A 4L9TA 2R7XA 1MBHA 4H0EA 3OYGA 3BTLA 3K0LA 1X3UA 4BEHA 1X1PA 1SAXA 1T38A 2KDOA 2K85A 3LJLA 1I27A 3BZKA 2OD5A 5ILSA 1OCRH 3QU6A 2XVCA 4BY7J 3A1YA 3TDUC 2VC0A 3GLLA 3IWFA 1Z77A 4P96A 3CMEI 3HTSB 2VXZA 1IAWA 2XUBA 3K1MA 2OTLI 1OKRA 4AM3A 1H9TA 1QO0D 3M07A 2H8WA 3AG4H 2A05A 4E7SA 4IOCF 4CCLA 4LG0A 1HDPA 5IP9J 5ILUA 1F43A 1HXDA 2QZ8A 1SD6A 3GYHX 3FMSA 2A6EF 1WH7A 4NQWA 5DD4A 2HYGD 2MGQA 1FPQA 4E4HA 2BY3A 3S32A 3HOYJ 3VVZA 1IN8A 1SAUA 3CLOA 4DIQA 1SFXA 3VFZA 4IHYA 3HOZJ 2DQRA 3F6VA 3QYFA 4AUXA 5D19A 3P9TA 3V8KA 1W1WE 2Q2EA 3VPRA 2M0MA 3P9KA 1U78A 3HUGA 4NN1A 5L3GA 3J81Z 5B1BH 4BGDA 1TC3C 4PJJA 2NOGA 4UY8I 2DA6A 3FXLA 4I98B 3S3OA 3WU2C 3V8LA 1XCVA 2GOXB 3UR3C 1SVOA 2UXIA 1ENHA 4JX6A 3FXUA 1XCBA 1VQ7I 1WCMJ 4XLHA 3ZQGA 2H6BA 3CTAA 1NK3P 4PFOA 5F1JA 2CJJA 2QSFX 5DCFA 4IRIA 2G7LA 3IH2A 3T6NA 2WAQA 2XDVA 5C4JJ 3LNQA 5GPAA 1RESA 1XGOA 3DXJF 2K9NA 1D5YA 2L9RA 1MDMB 4XOPA 3FBIB 2O8KA 5ICEA 5D5UB 4FHTA 2D6YA 2ELKA 2JRTA 4GFLA 3J80K 4IHVA 3I4NJ 4Y4RA 1OFCX 1Y0UA 3K4KA 1WGXA 5KCMA 3SHFA 3BHQA 3FKIJ 2DJNA 1I6XA 4XKVA 1H0MA 1CGPA 1ITYA 1IGNA 4JNNA 4P1WA 4KNYA 3OV8A 3CJDA 2JA8J 1UELB 4AVZA 5TJJA 1ZAOA 4A3KJ 3KP3A 4KWAA 4DNCA 2DA3A 3LA2A 2PJRA 2DU9A 4IL6C 3PIOF 2EWNA 3BP8A 4FE7A 2CMPA 1NH3A 2NS0A 2BY2A 2WV1A 3S3MA 2AHQA 2COMA 4HBLA 3IUVA 4UXNA 3H92A 3Q0UA 4CCOA 5DCMA 5H2FC 1YJWI 4ON0A 1MNMC 3HTIA 2JSCA 2IU5A 5BPDA 1IO2A 3HKZA 5L3DA 2IGMA 3KPHA 1T0FC 1T8IA 3TKYA 2LP0A 4JBAA 4HSRA 3GVAA 1JT0A 4PUSA 3QPLA 1HBXG
chains in the Genus database with same CATH topology
2EZHA 1U9NA 2H1KA 1TWCJ 1RKTA 4UUTA 4CYCA 3D1NI 4UDSA 2ECCA 4L62A 4JKZA 3FIWA 3G1OA 3NAUA 4ACIA 3O60A 3GZIA 3W6VA 3BG3A 2Y30A 4RBOA 4XRMA 1GVDA 1SANA 2YS9A 2CQQA 2XB0X 3ON4A 5J1RA 2R5YB 5EFYA 3HTJA 2JA6J 4M3BA 1U9OA 5E3MA 4ABZA 4JL3A 4C3HJ 3BT9A 2HXOA 4NDLA 4XICA 2OF7A 1YRNA 1UI6A 1MBEA 3HGYA 2Y9ZA 2XRLA 3VIBA 4B3AA 2NVXJ 1HF0A 2LKXA 3BCGA 3BJBA 4A3MJ 3WHBA 4M3GA 1PUFB 2H8RA 1QRYA 2Y0SN 1SGMA 3RH2A 2JMWA 3GTJJ 1NTCA 3I4MJ 5HAWA 3S1RJ 3ZQLA 4NELA 3PPBA 5H9TA 2IBDA 4JX5A 1R9TJ 5C3EJ 2XPUA 5F0CA 5CXIA 3KKCA 3M3YJ 3FK6A 3C2BA 3VVXA 2ECBA 2F07A 5E3NA 4J19A 2E19A 1UI5A 1IRZA 1E3OC 5IPAA 1B72A 1MH4A 4GCLA 2ZOZA 4DZPA 3O8HA 1BW6A 3HGGA 1I6HJ 4Y52J 4HKUA 2UXOA 2QOPA 3H3VK 4DW6A 3B81A 2HYTA 2L0KA 1ZK8A 2XPWA 2O9LA 5DS9A 2LK2A 3BR0A 4DYCA 3JRDA 3JRIA 4A3LJ 2DMNA 4JX4A 2NVTJ 1UHSA 2HDDA 1XC5A 1ORKA 3BQZA 1JGGA 4XK4A 2DMQA 3CMYA 2DG8A 5F27A 5DAJA 2YVEA 2QIBA 3BG9A 3DCFA 4A3CJ 3TP0A 5BNGA 2YUSA 2CUEA 4LOCA 3IH3A 1MSEC 2NX4A 2EZIA 3L1PA 4A3DJ 4UUSB 3F1BA 1BW5A 3KKDA 1IDZA 2E1OA 4EEFG 4A3EJ 3BNIA 2NP3A 3PM1A 2DG7A 4MFEA 2CUFA 3MNLA 1ETXA 3H0GJ 1IUFA 2JN6A 1AKHB 2XSDC 3OSFA 4M3FA 3RZDJ 1EF4A 3MN2A 3BTIA 2XGCA 1B8IA 3S17J 3BTJA 5EDNA 1LE8A 5C44J 5E3OA 2FQ4A 1GDTA 5EEAA 3E7QA 2FD5A 2O7OA 3RZOJ 4A93J 2HYJA 1AHDP 4A3FJ 1GUUA 1VNDA 3A02A 2ZCMA 3FISA 1FIAA 5EGOB 4I76A 4FE4A 3PO2J 4DYQA 2L7ZA 3BR3A 2ZOYA 4JYKA 3GTQJ 2Q24A 4GFBA 2ME0A 1ZR4A 4GFKA 5C4YA 1UMQA 4ICHA 2NS8A 2V57A 1ETWA 4XIDA 1FJLA 3ANGA 3TW6A 2JA7J 1A6IA 2IAIA 5EG0A 1FTTA 3CQZJ 4FISA 3LOCA 1ETYA 2FBQA 1MBKA 1JUMA 5F04A 3TEDA 2JK3A 5FHPA 2I10A 3ZQIA 5GPCA 2GENA 2TRTA 3MKLA 3ZQCA 3EGQA 1I3QJ 2M0CA 2G0EA 2ID6A 5IOZA 1Q1VA 3PO3J 4C2MJ 3BTCA 3SJMA 1U8BA 2YU9J 2DA1A 2R5YA 4CGRA 3SFIA 2R93J 3QPSA 3VW2A 3DPJA 2WUIA 1TWGJ 4Y7NJ 3GTMJ 1T56A 2DA4A 3Q0WA 1JT6A 2NS7A 5M3FJ 1FTZA 4AC6A 2DTZA 1HLVA 4C3JJ 3VOXA 2DMUA 3V6GA 1SFOJ 2WAQN 4G12A 1JKQC 1F36A 2NVQJ 5CW8A 3DEWA 5M3MJ 3A03A 3S5RA 2COBA 3HEFA 3AQSA 2DN0A 1VFCA 2P81A 5HBUA 2K9QA 4L5EA 1VI0A 4A3GJ 2QKOA 5HSZA 3KZ9A 2M34A 1JTYA 1ZGWA 1W0TA 1MSFC 2ZCNA 3NI7A 5EZGA 2GM4A 5AQCA 4C3IJ 4QSHA 1OCTC 4AF5A 3K2AA 2Y31A 2L7MP 5FKLA 1WPKA 3CCYA 3GBGA 4MFDA 1TWHJ 2Y9YA 3JREA 1POGA 4FTHA 5FLVA 5J1UA 1BL0A 2ZCXA 5EZHA 5M5XJ 5F0HA 1JUSA 4XRSA 2OI8A 4A3JJ 3HB9A 1WI3A 1IG7A 4D5CA 4JP0A 3GTPJ 3S1MJ 4I6ZA 3CWRA 3EUPA 2KDZA 2QF7A 4DYRA 4QIWN 3UKGA 2VUMJ 2QTQA 3JSJA 5FKNA 3TP3A 3RQIA 1NK2P 2RASA 1H8AC 3LSGA 4MO7A 3JRGA 3G7RA 1ZR2A 2EZKA 3HOVJ 2NP5A 1GT0C 3VVYA 5IP6A 4GCKA 3GTOJ 2PZ9A 2LLKA 3ZOBA 5FGLA 1LFBA 1LFUP 1APLC 3LHQA 2X48A 1QPIA 3V78A 4W1UA 4MLOA 2ME6A 1JJ8C 5K7ZA 2R7ZJ 3CRJA 2KT0A 1FEXA 3FRQA 3ZQFA 4B1RA 2AO9A 2D5VA 3RKQA 3BR1A 1JTXA 1RR7A 1X2MA 2DMPA 3IH4A 3JR9A 3JRAA 1XS9A 1AKHA 4ME9A 4D7NA 1RETA 3HOWJ 4AC0A 2RAEA 2LFBA 2LVSA 2VKVA 1IV6A 1ZQ3P 3NNRA 3A01A 2DMTA 1O4XA 1I50J 2UXPA 3G1MA 5IYBJ 3HOXJ 2L7FP 2R5ZB 5EGOA 1JKOC 2HI3A 1Z0XA 5IYDJ 4MK6A 2TCTA 1P7JA 1X58A 3C07A 1JJ6C 3GTKJ 2OERA 3Q3SA 3PASA 2JJ7A 3GTLJ 4MXMA 5D1RA 4M6VA 1MBGA 3BR5A 2ID3A 2PMZN 2DA7A 3RD3A 5C4XJ 5EF6A 3F0CA 5FLMJ 2FX0A 3MVPA 3ANPA 4PXIA 3BRUA 3B6AA 3VW1A 2EH3A 1IC8A 3QKXA 5GP9A 2XGDA 3HOUJ 2GFNA 1ETOA 1GV5A 4B4CA 2YVHA 1H88C 5CXGA 2HOAA 2K9SA 2CU7A 5K7FA 2XPVA 1BA5A 3NRGA 2IEKA 1HCRA 2W48A 3O8GA 4A3BJ 2K40A 2DA2A 3VOKA 1ETKA 2OPTA 5FKKA 2CRGA 5IP7J 2Y2ZA 4A69C 2LTPA 1QVTA 2E2IJ 2CQXA 5IOYA 2QWTA 2JA5J 1DU0A 2EZLA 3K7AJ 3OOUA 3TW7A 4M3EA 4MIMA 3HBLA 2B63J 2MSYA 3G56A 3NPIA 4IHXA 3GTGJ 4GCTA 2HOTA 3VUQA 3OIOA 3HTHA 2O7TA 3S1NJ 2M8GX 3ZQHA 5EG0B 2VKEA 1PUFA 1BJZA 2N8GA 5M5YJ 1MBHA 2UXUA 3BTLA 3M4OJ 4BBRJ 4BXXJ 1ETQA 3B6CA 4FCYA 1ZKGA 3CDLA 3LJLA 3BG5A 1H89C 9ANTA 4BY7J 4CYCB 3VW0A 3JRFA 3E7LA 2HQ5A 2VI6A 1RPWA 1Z77A 1ETVA 3S1QJ 5F08A 3HM5A 3WHCA 2XDNA 1CQTA 2QCOA 3Q0VA 1MH3A 4QTRA 2M9HA 4BKXA 1HDPA 5IP9J 4D7MA 2RHAA 1A5JA 3FK7A 2VPRA 2REKA 1YRNB 1F43A 1ZTRA 2R0QC 5FJ8J 2ZB9A 1WH7A 5JLWA 2LD5A 4BBSJ 2MGQA 1AU7A 3LSPA 4RDUA 4X6AJ 2XGEA 3HOYJ 3VVZA 2WGBA 4IHYA 3BR6A 3HKZN 2GLOA 3HOZJ 2JWTA 5D18A 5D19A 2GBYA 4AUXA 3P9TA 2UXHA 3LWJA 1DU6A 1X2NA 1OCPA 3BR2A 5F0FA 3VPRA 3IV5A 4S0HB 2E2HJ 2MW8A 1U78A 1S7EA 5M5WJ 4W97A 2G7GA 4D5FA 4NN1A 4X1EA 4UUSA 3GEUA 3G1LA 1TC3C 3ON2A 4M3DA 2WB1N 2NOGA 1T33A 2HKUA 2DA6A 1B72B 4V2FA 3NARA 2EBIA 2W53A 1W0UA 2M2EA 2FJ1A 2MG4A 3SDGA 4IEJA 2UXIA 1ENHA 3S2DJ 4JX6A 1WCMJ 2R5ZA 3ZQGA 5FKMA 1XG1A 1NK3P 3S16J 5F1JA 2CJJA 3KNWA 3JRHA 1JKPC 3HTAA 2G7LA 3IH2A 3BQYA 3QQAA 1TWAJ 2DA5A 3T6NA 1GV2A 5J1YA 5C4JJ 1QVUA 3LNQA 5GPAA 1RESA 1D5YA 2K9NA 2L9RA 2LY9A 2R92J 2O8KA 2D6YA 3HIMA 4GFLA 2ELKA 2X9DA 4YZEA 4IHVA 4IHWA 3LSRA 2E2JJ 3I4NJ 1TWFJ 2GUHA 1OFCX 2PBXA 1WGXA 3BHQA 1MBJA 1Y1WJ 3FKIJ 2DJNA 5IYCJ 4DZJA 1K61A 1P7IA 2HXIA 1ITYA 5J3LA 1IGNA 4JNNA 3S15J 3JRCA 2XB5A 1JKRC 1G2HA 3CJDA 5K7HA 3HDDA 2JA8J 3HE0A 4V2GA 1UG2A 4A3KJ 4AYBN 3A01B 1B8IB 1LE8B 1IDYA 4KWAA 2DA3A 3QBMA 1MBFA 2EQRA 5FKOA 5DTDA 4XRSG 3AQTA 5E3LA 4FE7A 1HOMA 2WV1A 3OSGA 2AHQA 2LR8A 3IUVA 5HODA 3S14J 3Q0UA 2G3BA 1VF9A 1MNMC 3HTIA 1WH5A 1RKWA 5FMPA 1FIPA 1K83J 1IJWC 2NVYJ 2IU5A 1Y1VJ 4BY1J 1OJLA 1HDDC 2X6OA 2LP0A 5JLXA 3S2HJ 3JRBA 3VP5A 1JUPA 2G7SA 5K58A 5EYRA 1JT0A 3LSJA 3NXCA 4A3IJ 3QPLA 3COLA 4HNVA 2HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZH A;  1U9N A;  2H1K A;  1TWC J;  1RKT A;  4UUT A;  4CYC A;  3D1N I;  4UDS A;  2ECC A;  4L62 A;  4JKZ A;  3FIW A;  3G1O A;  3NAU A;  4ACI A;  3O60 A;  3GZI A;  3W6V A;  3BG3 A;  2Y30 A;  4RBO A;  4XRM A;  1GVD A;  1SAN A;  2YS9 A;  2CQQ A;  2XB0 X;  3ON4 A;  5J1R A;  2R5Y B;  5EFY A;  3HTJ A;  2JA6 J;  4M3B A;  1U9O A;  5E3M A;  4ABZ A;  4JL3 A;  4C3H J;  3BT9 A;  2HXO A;  4NDL A;  4XIC A;  2OF7 A;  1YRN A;  1UI6 A;  1MBE A;  3HGY A;  2Y9Z A;  2XRL A;  3VIB A;  4B3A A;  2NVX J;  1HF0 A;  2LKX A;  3BCG A;  3BJB A;  4A3M J;  3WHB A;  4M3G A;  1PUF B;  2H8R A;  1QRY A;  2Y0S N;  1SGM A;  3RH2 A;  2JMW A;  3GTJ J;  1NTC A;  3I4M J;  5HAW A;  3S1R J;  3ZQL A;  4NEL A;  3PPB A;  5H9T A;  2IBD A;  4JX5 A;  1R9T J;  5C3E J;  2XPU A;  5F0C A;  5CXI A;  3KKC A;  3M3Y J;  3FK6 A;  3C2B A;  3VVX A;  2ECB A;  2F07 A;  5E3N A;  4J19 A;  2E19 A;  1UI5 A;  1IRZ A;  1E3O C;  5IPA A;  1B72 A;  1MH4 A;  4GCL A;  2ZOZ A;  4DZP A;  3O8H A;  1BW6 A;  3HGG A;  1I6H J;  4Y52 J;  4HKU A;  2UXO A;  2QOP A;  3H3V K;  4DW6 A;  3B81 A;  2HYT A;  2L0K A;  1ZK8 A;  2XPW A;  2O9L A;  5DS9 A;  2LK2 A;  3BR0 A;  4DYC A;  3JRD A;  3JRI A;  4A3L J;  2DMN A;  4JX4 A;  2NVT J;  1UHS A;  2HDD A;  1XC5 A;  1ORK A;  3BQZ A;  1JGG A;  4XK4 A;  2DMQ A;  3CMY A;  2DG8 A;  5F27 A;  5DAJ A;  2YVE A;  2QIB A;  3BG9 A;  3DCF A;  4A3C J;  3TP0 A;  5BNG A;  2YUS A;  2CUE A;  4LOC A;  3IH3 A;  1MSE C;  2NX4 A;  2EZI A;  3L1P A;  4A3D J;  4UUS B;  3F1B A;  1BW5 A;  3KKD A;  1IDZ A;  2E1O A;  4EEF G;  4A3E J;  3BNI A;  2NP3 A;  3PM1 A;  2DG7 A;  4MFE A;  2CUF A;  3MNL A;  1ETX A;  3H0G J;  1IUF A;  2JN6 A;  1AKH B;  2XSD C;  3OSF A;  4M3F A;  3RZD J;  1EF4 A;  3MN2 A;  3BTI A;  2XGC A;  1B8I A;  3S17 J;  3BTJ A;  5EDN A;  1LE8 A;  5C44 J;  5E3O A;  2FQ4 A;  1GDT A;  5EEA A;  3E7Q A;  2FD5 A;  2O7O A;  3RZO J;  4A93 J;  2HYJ A;  1AHD P;  4A3F J;  1GUU A;  1VND A;  3A02 A;  2ZCM A;  3FIS A;  1FIA A;  5EGO B;  4I76 A;  4FE4 A;  3PO2 J;  4DYQ A;  2L7Z A;  3BR3 A;  2ZOY A;  4JYK A;  3GTQ J;  2Q24 A;  4GFB A;  2ME0 A;  1ZR4 A;  4GFK A;  5C4Y A;  1UMQ A;  4ICH A;  2NS8 A;  2V57 A;  1ETW A;  4XID A;  1FJL A;  3ANG A;  3TW6 A;  2JA7 J;  1A6I A;  2IAI A;  5EG0 A;  1FTT A;  3CQZ J;  4FIS A;  3LOC A;  1ETY A;  2FBQ A;  1MBK A;  1JUM A;  5F04 A;  3TED A;  2JK3 A;  5FHP A;  2I10 A;  3ZQI A;  5GPC A;  2GEN A;  2TRT A;  3MKL A;  3ZQC A;  3EGQ A;  1I3Q J;  2M0C A;  2G0E A;  2ID6 A;  5IOZ A;  1Q1V A;  3PO3 J;  4C2M J;  3BTC A;  3SJM A;  1U8B A;  2YU9 J;  2DA1 A;  2R5Y A;  4CGR A;  3SFI A;  2R93 J;  3QPS A;  3VW2 A;  3DPJ A;  2WUI A;  1TWG J;  4Y7N J;  3GTM J;  1T56 A;  2DA4 A;  3Q0W A;  1JT6 A;  2NS7 A;  5M3F J;  1FTZ A;  4AC6 A;  2DTZ A;  1HLV A;  4C3J J;  3VOX A;  2DMU A;  3V6G A;  1SFO J;  2WAQ N;  4G12 A;  1JKQ C;  1F36 A;  2NVQ J;  5CW8 A;  3DEW A;  5M3M J;  3A03 A;  3S5R A;  2COB A;  3HEF A;  3AQS A;  2DN0 A;  1VFC A;  2P81 A;  5HBU A;  2K9Q A;  4L5E A;  1VI0 A;  4A3G J;  2QKO A;  5HSZ A;  3KZ9 A;  2M34 A;  1JTY A;  1ZGW A;  1W0T A;  1MSF C;  2ZCN A;  3NI7 A;  5EZG A;  2GM4 A;  5AQC A;  4C3I J;  4QSH A;  1OCT C;  4AF5 A;  3K2A A;  2Y31 A;  2L7M P;  5FKL A;  1WPK A;  3CCY A;  3GBG A;  4MFD A;  1TWH J;  2Y9Y A;  3JRE A;  1POG A;  4FTH A;  5FLV A;  5J1U A;  1BL0 A;  2ZCX A;  5EZH A;  5M5X J;  5F0H A;  1JUS A;  4XRS A;  2OI8 A;  4A3J J;  3HB9 A;  1WI3 A;  1IG7 A;  4D5C A;  4JP0 A;  3GTP J;  3S1M J;  4I6Z A;  3CWR A;  3EUP A;  2KDZ A;  2QF7 A;  4DYR A;  4QIW N;  3UKG A;  2VUM J;  2QTQ A;  3JSJ A;  5FKN A;  3TP3 A;  3RQI A;  1NK2 P;  2RAS A;  1H8A C;  3LSG A;  4MO7 A;  3JRG A;  3G7R A;  1ZR2 A;  2EZK A;  3HOV J;  2NP5 A;  1GT0 C;  3VVY A;  5IP6 A;  4GCK A;  3GTO J;  2PZ9 A;  2LLK A;  3ZOB A;  5FGL A;  1LFB A;  1LFU P;  1APL C;  3LHQ A;  2X48 A;  1QPI A;  3V78 A;  4W1U A;  4MLO A;  2ME6 A;  1JJ8 C;  5K7Z A;  2R7Z J;  3CRJ A;  2KT0 A;  1FEX A;  3FRQ A;  3ZQF A;  4B1R A;  2AO9 A;  2D5V A;  3RKQ A;  3BR1 A;  1JTX A;  1RR7 A;  1X2M A;  2DMP A;  3IH4 A;  3JR9 A;  3JRA A;  1XS9 A;  1AKH A;  4ME9 A;  4D7N A;  1RET A;  3HOW J;  4AC0 A;  2RAE A;  2LFB A;  2LVS A;  2VKV A;  1IV6 A;  1ZQ3 P;  3NNR A;  3A01 A;  2DMT A;  1O4X A;  1I50 J;  2UXP A;  3G1M A;  5IYB J;  3HOX J;  2L7F P;  2R5Z B;  5EGO A;  1JKO C;  2HI3 A;  1Z0X A;  5IYD J;  4MK6 A;  2TCT A;  1P7J A;  1X58 A;  3C07 A;  1JJ6 C;  3GTK J;  2OER A;  3Q3S A;  3PAS A;  2JJ7 A;  3GTL J;  4MXM A;  5D1R A;  4M6V A;  1MBG A;  3BR5 A;  2ID3 A;  2PMZ N;  2DA7 A;  3RD3 A;  5C4X J;  5EF6 A;  3F0C A;  5FLM J;  2FX0 A;  3MVP A;  3ANP A;  4PXI A;  3BRU A;  3B6A A;  3VW1 A;  2EH3 A;  1IC8 A;  3QKX A;  5GP9 A;  2XGD A;  3HOU J;  2GFN A;  1ETO A;  1GV5 A;  4B4C A;  2YVH A;  1H88 C;  5CXG A;  2HOA A;  2K9S A;  2CU7 A;  5K7F A;  2XPV A;  1BA5 A;  3NRG A;  2IEK A;  1HCR A;  2W48 A;  3O8G A;  4A3B J;  2K40 A;  2DA2 A;  3VOK A;  1ETK A;  2OPT A;  5FKK A;  2CRG A;  5IP7 J;  2Y2Z A;  4A69 C;  2LTP A;  1QVT A;  2E2I J;  2CQX A;  5IOY A;  2QWT A;  2JA5 J;  1DU0 A;  2EZL A;  3K7A J;  3OOU A;  3TW7 A;  4M3E A;  4MIM A;  3HBL A;  2B63 J;  2MSY A;  3G56 A;  3NPI A;  4IHX A;  3GTG J;  4GCT A;  2HOT A;  3VUQ A;  3OIO A;  3HTH A;  2O7T A;  3S1N J;  2M8G X;  3ZQH A;  5EG0 B;  2VKE A;  1PUF A;  1BJZ A;  2N8G A;  5M5Y J;  1MBH A;  2UXU A;  3BTL A;  3M4O J;  4BBR J;  4BXX J;  1ETQ A;  3B6C A;  4FCY A;  1ZKG A;  3CDL A;  3LJL A;  3BG5 A;  1H89 C;  9ANT A;  4BY7 J;  4CYC B;  3VW0 A;  3JRF A;  3E7L A;  2HQ5 A;  2VI6 A;  1RPW A;  1Z77 A;  1ETV A;  3S1Q J;  5F08 A;  3HM5 A;  3WHC A;  2XDN A;  1CQT A;  2QCO A;  3Q0V A;  1MH3 A;  4QTR A;  2M9H A;  4BKX A;  1HDP A;  5IP9 J;  4D7M A;  2RHA A;  1A5J A;  3FK7 A;  2VPR A;  2REK A;  1YRN B;  1F43 A;  1ZTR A;  2R0Q C;  5FJ8 J;  2ZB9 A;  1WH7 A;  5JLW A;  2LD5 A;  4BBS J;  2MGQ A;  1AU7 A;  3LSP A;  4RDU A;  4X6A J;  2XGE A;  3HOY J;  3VVZ A;  2WGB A;  4IHY A;  3BR6 A;  3HKZ N;  2GLO A;  3HOZ J;  2JWT A;  5D18 A;  5D19 A;  2GBY A;  4AUX A;  3P9T A;  2UXH A;  3LWJ A;  1DU6 A;  1X2N A;  1OCP A;  3BR2 A;  5F0F A;  3VPR A;  3IV5 A;  4S0H B;  2E2H J;  2MW8 A;  1U78 A;  1S7E A;  5M5W J;  4W97 A;  2G7G A;  4D5F A;  4NN1 A;  4X1E A;  4UUS A;  3GEU A;  3G1L A;  1TC3 C;  3ON2 A;  4M3D A;  2WB1 N;  2NOG A;  1T33 A;  2HKU A;  2DA6 A;  1B72 B;  4V2F A;  3NAR A;  2EBI A;  2W53 A;  1W0U A;  2M2E A;  2FJ1 A;  2MG4 A;  3SDG A;  4IEJ A;  2UXI A;  1ENH A;  3S2D J;  4JX6 A;  1WCM J;  2R5Z A;  3ZQG A;  5FKM A;  1XG1 A;  1NK3 P;  3S16 J;  5F1J A;  2CJJ A;  3KNW A;  3JRH A;  1JKP C;  3HTA A;  2G7L A;  3IH2 A;  3BQY A;  3QQA A;  1TWA J;  2DA5 A;  3T6N A;  1GV2 A;  5J1Y A;  5C4J J;  1QVU A;  3LNQ A;  5GPA A;  1RES A;  1D5Y A;  2K9N A;  2L9R A;  2LY9 A;  2R92 J;  2O8K A;  2D6Y A;  3HIM A;  4GFL A;  2ELK A;  2X9D A;  4YZE A;  4IHV A;  4IHW A;  3LSR A;  2E2J J;  3I4N J;  1TWF J;  2GUH A;  1OFC X;  2PBX A;  1WGX A;  3BHQ A;  1MBJ A;  1Y1W J;  3FKI J;  2DJN A;  5IYC J;  4DZJ A;  1K61 A;  1P7I A;  2HXI A;  1ITY A;  5J3L A;  1IGN A;  4JNN A;  3S15 J;  3JRC A;  2XB5 A;  1JKR C;  1G2H A;  3CJD A;  5K7H A;  3HDD A;  2JA8 J;  3HE0 A;  4V2G A;  1UG2 A;  4A3K J;  4AYB N;  3A01 B;  1B8I B;  1LE8 B;  1IDY A;  4KWA A;  2DA3 A;  3QBM A;  1MBF A;  2EQR A;  5FKO A;  5DTD A;  4XRS G;  3AQT A;  5E3L A;  4FE7 A;  1HOM A;  2WV1 A;  3OSG A;  2AHQ A;  2LR8 A;  3IUV A;  5HOD A;  3S14 J;  3Q0U A;  2G3B A;  1VF9 A;  1MNM C;  3HTI A;  1WH5 A;  1RKW A;  5FMP A;  1FIP A;  1K83 J;  1IJW C;  2NVY J;  2IU5 A;  1Y1V J;  4BY1 J;  1OJL A;  1HDD C;  2X6O A;  2LP0 A;  5JLX A;  3S2H J;  3JRB A;  3VP5 A;  1JUP A;  2G7S A;  5K58 A;  5EYR A;  1JT0 A;  3LSJ A;  3NXC A;  4A3I J;  3QPL A;  3COL A;  4HNV A;  2HOS A; 
#chains in the Genus database with same CATH topology
 2OCC H;  1WJC A;  3EET A;  1XTA A;  3ZMD A;  2ZNY A;  3HC7 A;  4L62 A;  4IKF A;  4UDS A;  2GWR A;  3H3U A;  3ZXS A;  3DKW A;  4M72 A;  2IS2 A;  2BV6 A;  3G1O A;  3O60 A;  1R4M B;  3W6V A;  2A69 F;  3SZG A;  1D0Z A;  2Y30 A;  3VWB A;  3VTI A;  3PFY A;  4CCN A;  4PK4 A;  1Q1H A;  2HR3 A;  4RB2 C;  2Z9O A;  4LFU A;  1D1A A;  3W6J B;  4XKW A;  5J1R A;  4A0Z A;  1E3H A;  5DD8 A;  2MYS A;  5EEH A;  5TGT A;  4JL3 A;  1B4A A;  1DPR A;  2DLL A;  1UI6 A;  4DQ2 A;  3E5U A;  1U3E M;  5BMZ A;  3VIB A;  4U0W A;  4B3A A;  4U7D A;  1LDK B;  2JUC A;  2LKX A;  3KP7 A;  1J9I A;  1LVK A;  5D6E A;  5D6F A;  3VSL A;  2H8R A;  3ZMU A;  3RH2 A;  1WJD A;  5AON A;  2MBF A;  3S1R J;  5H9T A;  3PPB A;  2IBD A;  1Z3X A;  4F52 A;  1R9T J;  1IZ1 A;  2XPU A;  1BR2 A;  2QQ9 A;  5CXI A;  3DP7 A;  1XPX A;  3M3Y J;  3C2B A;  3VVX A;  2V26 A;  1X4P A;  2V1D A;  1OCO H;  4LIU A;  3AFH A;  1J5Y A;  3FBN B;  3KX2 A;  3GCM A;  4XM3 A;  4F7Z A;  2X4H A;  5IPA A;  4HDU A;  1K78 A;  2ZOZ A;  4DZP A;  1ERD A;  3HGG A;  1FSE A;  3SEZ A;  1BBY A;  1TQM A;  1QZE A;  3C2H A;  3KLN A;  1PDN C;  3B81 A;  2O9L A;  3FX3 A;  5LFA A;  1YIO A;  1B6A A;  2ETH A;  2X0L A;  2DMN A;  3V4G A;  3DPT A;  2PLY A;  5JFR A;  1ULY A;  2CH0 A;  3HOS A;  3Q5F A;  5KHD A;  3BQZ A;  4HF2 A;  2XAS A;  3NQO A;  2CSO A;  4XK4 A;  2DMQ A;  1MDM A;  2YVE A;  2QSG X;  1ZYR F;  2OJE D;  2DOF A;  4G7Z F;  4Y3O A;  5BOX A;  2M3A A;  5E8I A;  3IH3 A;  1VQN I;  1J2X A;  3L1P A;  4UVB A;  4LK0 F;  1BIA A;  3IC7 A;  5E79 C;  1UG0 A;  4A3E J;  3MZY A;  1FYM A;  2KIQ A;  4MFE A;  4A6D A;  2H94 A;  3G73 A;  1ETX A;  3H0G J;  1FBU A;  2RGV A;  3F6O A;  3K10 A;  3OIQ A;  4BAY A;  1AKH B;  3MN2 A;  3BTI A;  3PSI A;  2EV6 A;  2XGC A;  3RKY A;  3W2V A;  3ZMV A;  3CCE I;  2FQ4 A;  3BZC A;  3PSF A;  1BM9 A;  2JPC A;  3FMR A;  2K86 A;  1T98 A;  2FD5 A;  1SC7 A;  3RZO J;  2VQL A;  1MMD A;  4XLE A;  2L01 A;  1GUU A;  1FOY A;  1VND A;  4DBR A;  3RI4 A;  3H35 A;  1G3Y A;  1FIA A;  4I76 A;  2R7W A;  2YVX A;  2P8T A;  5K5O A;  1I3A A;  2L7Z A;  2RC4 A;  3BR3 A;  1R22 A;  5LGU A;  5JVT A;  2EV0 A;  3KZZ A;  2ME0 A;  3J80 Z;  5C4Y A;  4XR6 A;  2VOD A;  1YS7 A;  2ZSI B;  1MNE A;  1ZRE A;  4NHJ A;  2DOD A;  2GA2 A;  2JA7 J;  3ELK A;  2M1B A;  2ZJQ F;  2MC4 A;  2TDX A;  2JK3 A;  5FHP A;  4GCV A;  3ZQI A;  5GPC A;  3K4N A;  2TRT A;  1G3S A;  1KU9 A;  3MKL A;  3EGQ A;  3SZP A;  3R61 A;  2G0E A;  5IOZ A;  1ZH5 A;  5D8K B;  1RI7 A;  1WFX A;  3OYK A;  4IXA A;  1U8B A;  1LPQ A;  4Q47 A;  3OR2 C;  4EM0 B;  4OOI A;  3EYY A;  2DA1 A;  3KYL A;  4U7B A;  3CCL I;  2VT2 A;  2KJB A;  4L0Y B;  4KIF A;  1LDD A;  3CUQ B;  4Y7N J;  3WGG A;  1DDN A;  1ZN2 A;  3GTM J;  3Q0W A;  2DPD A;  4IHS A;  3QAH A;  4U9L A;  1FTZ A;  4C3J J;  1WSU A;  2M4K A;  2WAQ N;  2PN6 A;  3GF2 A;  1F36 A;  2V6C A;  4A2U A;  2NVQ J;  3DEW A;  5M3M J;  2IJL A;  3PFI A;  2BXZ A;  1XD7 A;  2COB A;  3HEF A;  3T8R A;  5F6F A;  4DGW B;  4HX4 A;  1ZAR A;  2LH9 A;  4OIP F;  3FHN A;  2WC2 A;  3S8P A;  4CSW A;  3KZ9 A;  4ZZL A;  1ZGW A;  2A6T A;  3DBH B;  1Y0N A;  4B3X A;  4RGU A;  1MW7 A;  3OYE A;  2OA4 A;  3E97 A;  3AG3 H;  2ZJP F;  1WWX A;  2ZBK A;  4P9U A;  1V5F A;  3H1C A;  4D9J A;  5D5X B;  4MFD A;  1TWH J;  2Y9Y A;  3IP4 B;  3JRE A;  3CC4 I;  2IP2 A;  2PG4 A;  5ICF A;  4XL9 A;  2A3S A;  1B9N A;  2BY0 A;  3OYN A;  4I6Z A;  4EM2 A;  2XRO A;  3ASN H;  4QIW N;  1R5G A;  2GIV A;  5FKN A;  3TP3 A;  3ABM H;  4MO7 A;  3JRG A;  3WG7 H;  1R49 A;  1LEA A;  3N4M A;  2DJI A;  2LKP A;  3HHH A;  5HLI A;  3HOV J;  2NP5 A;  4QLC U;  1GT0 C;  1YX5 A;  3GTO J;  2LLK A;  3DTK A;  5FGL A;  2BVL A;  2GQQ A;  1APL C;  3LHQ A;  1V54 H;  2ME6 A;  2ZXW H;  2KT0 A;  4N9I A;  3ZQF A;  2D5V A;  2FU4 A;  4OAY A;  3TMO A;  1JGS A;  1JTX A;  1S5L C;  3L00 A;  4BJ6 C;  1AKH A;  3JR9 A;  4L0Z B;  2R7U A;  4BE2 A;  4MQ9 F;  4C9Y A;  2G7H A;  1HW5 A;  1O7F A;  2ZSH B;  4RS8 A;  3A01 A;  1O4X A;  2RNG A;  3C3W A;  4KYW A;  3QP6 A;  2NAZ A;  4HA8 A;  3G1M A;  5IYB J;  2DT6 A;  4HLY A;  2L7F P;  2X1C A;  4CA0 A;  1W36 D;  3IHU A;  1JKO C;  1MD0 A;  3D5L A;  1Z0X A;  3J7A O;  3KLO A;  4I7H A;  3QYB A;  1U8R A;  2RV8 A;  2TCT A;  2AXT C;  2FBI A;  5LLQ A;  4JOM A;  3RDI A;  4MGR A;  4L9V A;  2WY8 Q;  3GTL J;  3EQL F;  3BLY A;  4MXM A;  1MBG A;  3BR5 A;  5HS9 A;  3LA3 A;  5C4X J;  3GW2 A;  3M8F A;  3UNG C;  2M4G A;  5EF6 A;  1FOW A;  5HLG A;  3GME A;  3CCU I;  2FF4 A;  4HX8 A;  2V7F A;  2ISZ A;  4PXI A;  5TRD A;  2HVQ A;  1IC8 A;  2L3D A;  1W7P D;  3QKX A;  4ZTF A;  1ZRC A;  2BYV E;  2B0L A;  1W4M A;  2YX4 A;  4B4C A;  2YVH A;  2K9S A;  2BBY A;  4M71 A;  5K7F A;  2A68 F;  3O8G A;  4S04 A;  1LB2 A;  3ECH A;  1OR7 A;  2KRF A;  3FXM A;  1DP3 A;  2CRG A;  2OCE A;  2VJI A;  3U1D A;  2PX9 A;  1R1T A;  1Z6T A;  2LTP A;  2IS4 A;  2CQX A;  5LRR A;  3MKW B;  2GXG A;  3CUQ A;  2YU3 A;  1SVL A;  3F9K A;  3GUD A;  2HZT A;  4MIM A;  1YG2 A;  1R36 A;  3OYA A;  2OQG A;  3G56 A;  1OYI A;  1IF1 A;  3VSK A;  3GTG J;  2GXB A;  4GCT A;  1Z1D A;  5K1Y A;  4IRG A;  3SEQ A;  3K1P A;  5KNL A;  2STW A;  3I58 A;  4EM1 A;  2DO7 A;  4E7I A;  3ZQH A;  1SD4 A;  4MQV A;  1PUF A;  1BJZ A;  2NNN A;  1XSV A;  3P9I A;  2EPF A;  4WCG A;  2UXU A;  3M4O J;  4QPO A;  5CJ9 A;  3WTS C;  1GVJ A;  2FOW A;  3JTG A;  1BI3 A;  2DOE A;  1H89 C;  1DUX C;  2PJP A;  1LNW A;  3C2G A;  4CYC B;  1ZRF A;  2V9V A;  1RPW A;  2XAQ A;  3HM5 A;  3WHC A;  4UB6 C;  1Z67 A;  3BG7 A;  2QM3 A;  4O5V A;  3HL2 A;  1HST A;  1CQT A;  5CKT A;  4KIS A;  3J81 K;  2A6H F;  1AOY A;  3MKY B;  3AAF A;  1UFM A;  4UVA A;  2JT1 A;  5H6Q A;  2M9H A;  4BKX A;  1IW7 F;  3TQN A;  1HQC A;  3OIP A;  4EJU A;  3ZMT A;  4HG2 A;  2REK A;  1YRN B;  1MMG A;  1WHU A;  1ZTR A;  3R0A A;  2BOL A;  2KPM A;  2UZK A;  2M30 A;  2LD5 A;  3LSP A;  2ZO4 A;  2E5Z A;  2I5U A;  2L9V A;  2CW7 A;  3BR6 A;  4BH9 A;  4RMN A;  4UV8 A;  2GBY A;  3KEQ A;  2K9M A;  1X2N A;  1OCP A;  4FX0 A;  2VN2 A;  4XN0 A;  5GAG J;  1BOA A;  4KT6 A;  1K7A A;  3IV5 A;  3CCR I;  1G3T A;  5IY5 H;  1S7O A;  2DXI A;  1IN4 A;  2LG4 A;  3ZMZ A;  3PJR A;  4X1E A;  4UUS A;  3G1L A;  2QQB A;  2HTJ A;  1T33 A;  4NC7 A;  2F4M B;  3DLA A;  1K4T A;  4PCQ A;  2QBY B;  5LEK A;  1W0U A;  1IXS B;  3TO7 A;  2XF6 A;  3PUF A;  1J75 A;  2MG4 A;  3F21 A;  1G4D A;  2QLZ A;  2V9K A;  3HRS A;  5DDG A;  1USS A;  3S2D J;  4CYD A;  3I71 A;  1HKQ A;  5FKM A;  3LAP A;  4FAS D;  1VQ5 I;  3PNT A;  2KZG A;  2ZNZ A;  4CHU A;  3HTA A;  3BQY A;  2EA2 A;  2FSW A;  4U88 A;  1GV2 A;  3JAM Z;  1QVU A;  2HDW A;  3OYB A;  2R92 J;  3HIM A;  2X9D A;  1VQK I;  4WX9 A;  3ERE D;  2STT A;  5HS8 A;  1U6G A;  2PBX A;  2GA1 A;  1MBJ A;  2F5V A;  1YE9 A;  4ESJ A;  5ED4 A;  1R7J A;  1SFK A;  1YW7 A;  3LL7 A;  2B9S A;  4ENM A;  4CH7 A;  1W7P B;  4ZZD A;  3JRC A;  1VQP I;  3LFK A;  1JKR C;  3DV8 A;  1G2H A;  4WF2 A;  5K7H A;  3HDD A;  4V2G A;  2DFH A;  1KU2 A;  1YW8 A;  3A2K A;  2D45 A;  4L18 B;  1P4X A;  1LE8 B;  5E1Z B;  3PQJ A;  4ZC3 A;  4I01 A;  3QBM A;  2EQR A;  4NC6 A;  3BPX A;  5DTD A;  3KP4 A;  4J01 A;  3AQT A;  5E3L A;  2KZV A;  3IL2 A;  4N9H A;  2VPL A;  2VBX A;  1EV7 A;  3MD2 A;  2VBY A;  3K8P C;  3FXJ A;  2QA4 I;  4EVI A;  1IJW C;  2F5C A;  1P2F A;  3I5U A;  1ON2 A;  2ZFW A;  3IRQ A;  4BY1 J;  3I54 A;  1HDD C;  3Q9V A;  4CCJ A;  5ERI A;  3S2H J;  5JLX A;  3KCC A;  2G7S A;  3WTY C;  1Z7U A;  2G9W A;  4A3I J;  4BAC A;  3COL A;  4HNV A;  5B5E C;  3VYT B;  3CC7 I;  1YFH A;  1U9N A;  1YO5 C;  2H1K A;  2L5Q A;  2LKS A;  1RKT A;  4CYC A;  3D1N I;  2ECC A;  3CUQ C;  2LRD A;  4A12 A;  4XSZ F;  1ZLK A;  3U2R A;  2E7W A;  3GZI A;  4M9Z A;  3BG3 A;  4WK8 F;  1EKE A;  4DJA A;  5J47 A;  3MZH A;  4LLG F;  3CMA I;  2KRC A;  2E36 A;  3ON4 A;  4M3B A;  2A07 F;  5E3M A;  3ZR8 X;  2JUG A;  4C3H J;  1YRN A;  1U5T B;  1MBE A;  2FBK A;  2ISY A;  1TNS A;  2Y9Z A;  2HYF A;  4MHG A;  3RPU D;  2NVX J;  1D5V A;  2OZ6 A;  3BJA A;  3J7Y J;  3WHB A;  4M3G A;  3A0H C;  2ZME B;  1B59 A;  1QRY A;  2Y0S N;  1SGM A;  2PMZ A;  3HSE A;  2CFO A;  2JMW A;  2Z5U A;  2XV4 S;  1NTC A;  4P9F A;  3L2U A;  3KYD B;  3I4M J;  5F0C A;  1XGS A;  2VKD A;  3KKC A;  2Y69 H;  4CO8 A;  5CPR B;  4HV6 A;  5E3N A;  4J19 A;  1IRZ A;  1MH4 A;  1WJE A;  2QBY A;  1BW6 A;  2ZY9 A;  1I6H J;  4HKU A;  2BE5 F;  2HPI A;  3H3V K;  3V8J A;  3BJ6 A;  2XAJ A;  1SMT A;  2HYT A;  2FQ3 A;  4LLN A;  2KIM A;  3K9T A;  4WXD A;  3CJT B;  4DYC A;  4CZC A;  3JRD A;  3ZPL A;  1XMK A;  1IN7 A;  3HZJ A;  1A36 A;  1UHS A;  2HDD A;  2GXA A;  1XC5 A;  1XX5 A;  2ZJR F;  4HRI A;  1UST A;  3CMY A;  5DAJ A;  3I59 A;  3BG9 A;  4IVN A;  5BNG A;  3GFL A;  2YUS A;  4CDG A;  4H4K C;  2K7L A;  3CF5 F;  4LOC A;  2XIG A;  3LFU A;  4NBQ A;  2NX4 A;  2EZI A;  5LHI A;  2K02 A;  5D5V B;  2L9N A;  4EEF G;  1W7P A;  3BNI A;  4PSW A;  1KGS A;  1XN7 A;  3PM1 A;  2CUF A;  3CP8 A;  1IUF A;  1E17 A;  4LIV A;  3COA C;  4IZZ A;  1YIT I;  1BOB A;  3KP6 A;  1PP8 F;  4YIF A;  1LE8 A;  1DGR M;  3FF5 A;  1EH8 A;  5J6X A;  4CZZ A;  5C44 J;  2J5O A;  1ZG1 A;  5DEQ A;  2RQQ A;  1R5I D;  4G9Y A;  3NWS A;  1AHD P;  3D5S C;  4A3F J;  4XN3 A;  3A02 A;  5E18 F;  2ZCM A;  5LRS A;  1X1C A;  1V55 H;  2PBI A;  4UB8 C;  2D2W A;  2XAG A;  3PO2 J;  3OS0 A;  3EYI A;  1UB9 A;  3GTQ J;  5HS7 A;  2RN7 A;  2Z99 A;  1WI9 A;  4Y13 A;  1ZR4 A;  1FX7 A;  2FUG 2;  2KLO A;  2OC6 A;  3ANG A;  2R7S A;  4HF1 A;  2X85 A;  1X3Z B;  2HQR A;  3FXO A;  1A6I A;  2IAI A;  3DKX A;  5EG0 A;  4FIS A;  1KU7 A;  3LOC A;  5ICG A;  1SVM A;  1U2W A;  2GOM A;  3VOE A;  4AD9 A;  4E70 A;  5BQT A;  4BL0 B;  3KZI C;  1WQ2 A;  2M0C A;  2ZKZ A;  2OUM A;  4IOA F;  3CJR B;  3QU3 A;  4RB1 A;  3PO3 J;  4E7L A;  2F48 A;  4FT8 A;  3BTC A;  2KMU A;  3H9J A;  3WOD F;  2MA3 A;  2KIU A;  4EAT A;  3SJM A;  4B09 A;  4ETS A;  1JXS A;  3H5A A;  3SFI A;  3I56 I;  3QPS A;  5J8C A;  5F64 A;  4I99 C;  2WUI A;  1T56 A;  1U5T A;  3QPH A;  4BQA A;  4AC6 A;  1DGW Y;  3F8B A;  1HLV A;  2O8X A;  1MMS A;  2BEO A;  1SFO J;  1O3Q A;  2PI0 A;  3SWH A;  1YYV A;  3DKY A;  3I55 I;  2ZME A;  1Z6R A;  3A03 A;  1KQ8 A;  5D4S A;  3I53 A;  3HSR A;  3DBL B;  3AQS A;  4A6E A;  3VYR B;  4PJ0 C;  2H27 A;  3F3X A;  1VI0 A;  3L9F A;  2QKO A;  2XRN A;  1JTY A;  3JCU C;  1KYW A;  3RTR A;  3T8T A;  3LQQ A;  5EZG A;  3L7W A;  3I64 A;  1FMW A;  2EIN H;  1F5T A;  2JZY A;  4P5O A;  3Q9S A;  4AF5 A;  1QPM A;  3GO5 A;  2BW3 B;  2R7T A;  3AG2 H;  5FKL A;  4E7H A;  4AYB A;  4WXH A;  3AKZ A;  5CLS A;  2ZCX A;  3WGH A;  5EZH A;  5TIS C;  2P7C B;  1N78 A;  4R1H A;  2VJ4 A;  2M87 A;  4IRH A;  3TBI A;  5LHH A;  3W3C A;  2CV1 A;  3F8N A;  2B7E A;  3V42 A;  3GTP J;  2V4J C;  4Y33 A;  3DLL F;  2HPM A;  3CWR A;  2KDZ A;  2QF7 A;  4DYR A;  3CCS I;  3SDB A;  3MAJ A;  1MIJ A;  1H8A C;  4B8X A;  2XKP A;  2KIS A;  2EFQ A;  1STZ A;  4WWC A;  1W5C C;  5IP6 A;  2DK5 A;  3CC2 I;  2M7A A;  1O7L A;  4GCK A;  5CVR A;  3ZOB A;  4BHP A;  3NWT A;  1TW2 A;  1SD7 A;  1LFU P;  1LKX A;  3HXL A;  2X48 A;  5J4V A;  3V78 A;  4MLO A;  4E7J A;  3KFW X;  3K4C A;  5K7Z A;  2QWW A;  1FSH A;  3ZQQ A;  3CRJ A;  1GLN A;  3E1S A;  2NVU B;  4B1R A;  3K6G A;  5JHF A;  3KEY A;  4BDZ A;  1DP7 P;  2WA0 A;  3BR1 A;  5K5Q A;  5FO5 A;  1XS9 A;  4ME9 A;  3IH4 A;  4XSX F;  1FP2 A;  1W36 C;  1RET A;  2WAD A;  3HRT A;  2IGK A;  2LNB A;  3ROU A;  1OIS A;  2VJ5 A;  4PGG A;  4ASN A;  2LFB A;  1FYL A;  1IV6 A;  4UNO A;  3NNR A;  5DUK A;  2DMT A;  3OR1 C;  1I50 J;  4M74 A;  1KQ9 A;  2DT7 B;  4B48 A;  4LK1 F;  2ICW G;  5CVV A;  2DPU A;  1S72 I;  4MNU A;  1Y39 A;  4MK6 A;  5FD5 A;  3HPG A;  5CQG A;  4XKB A;  1YW9 A;  1JJ6 C;  3C07 A;  2Q8K A;  2OER A;  1UCR A;  1VQM I;  5D1R A;  2PMZ N;  2K3F A;  4HAM A;  1LUJ B;  4YIR X;  3CUO A;  1F9N A;  1X1B A;  2DA7 A;  2DQL A;  4Q4Z F;  2ZXJ A;  3PIP F;  4E7K A;  3NRV A;  4MTD A;  3E6B A;  4R79 A;  3ZQ7 A;  1UJ8 A;  2K4J A;  4LMY A;  5HOO A;  4PJM A;  2XF5 A;  3BRU A;  3VDX A;  4NUB A;  5E20 A;  4B43 A;  3OL3 A;  2EH3 A;  5J40 A;  4B44 A;  3VW1 A;  4N0B A;  2CQ7 A;  5L3C A;  2R7D A;  1JI8 A;  1OQY A;  1F4K A;  1ETO A;  4HW0 A;  4I02 A;  3V7R A;  1R00 A;  2CV0 A;  2HOA A;  2CU7 A;  3OY9 A;  2X6W A;  4A0X A;  3LSI A;  1WJA A;  1HCR A;  4PFP A;  1WJF A;  1IRF A;  4KN7 X;  4A3B J;  1EH6 A;  2NYX A;  3VOK A;  3FXR A;  2Y2Z A;  1YHQ I;  2DAO A;  2VAS A;  4XNF A;  4OWR B;  2E2I J;  5IOY A;  3VYU B;  2E34 A;  2CW0 F;  2W1O A;  3LSM A;  3TGN A;  2EZL A;  3K7A J;  4IF4 A;  3GFI A;  3K4B A;  1ZRD A;  2DDB A;  2HKO A;  3ECO A;  2Z33 A;  2R7V A;  3NPI A;  2MLK A;  3TL4 X;  1KA8 A;  1Z7L A;  4Y15 A;  1E0E A;  3OYL A;  3HTH A;  1UHW A;  3CF2 A;  1YOV B;  3S1N J;  4EJV A;  2M8G X;  2VKE A;  4L9J A;  4F92 B;  2O5R A;  3DWL E;  4G6D A;  3PNY A;  5M5Y J;  2OV7 A;  4BQO A;  4XKC A;  2XAU A;  1ETQ A;  4BXX J;  1ZKG A;  3F72 A;  3ZRG A;  4MTE A;  4PSX A;  2F5F A;  3E7L A;  2HQ5 A;  2BW3 A;  1ETV A;  3S1Q J;  1JHH A;  5F08 A;  1U5T C;  4ENK A;  4Q5S F;  2XDN A;  5A2Q K;  2HDC A;  3TOB A;  4EJT A;  2LF7 A;  2QCO A;  3Q0V A;  3WE2 A;  3WU0 A;  2ZME C;  1FNN A;  4EGZ A;  4QTR A;  1R4N B;  2RDP A;  1Y8R B;  2ZFU A;  4D7M A;  2VON A;  2RHA A;  2VPR A;  2VT3 A;  1RZ4 A;  1TP4 A;  2VB6 A;  3LSK A;  2LBF B;  1ON1 A;  2XSJ C;  4X0G A;  4OMZ A;  1ZG3 A;  2ZB9 A;  2L2O A;  5JLW A;  2O6G E;  2GIZ A;  2BY1 A;  2WGB A;  2M5W A;  3ASO H;  1RR8 C;  2P7V B;  3HKZ N;  3OYF A;  2VOO A;  2YR2 A;  3JAM K;  4F91 B;  2E5N A;  2F6C A;  5B3S H;  1FBS A;  5F0F A;  4BS9 A;  1S7A A;  4Y17 A;  4YG2 F;  5ICC A;  4S0H B;  5ILV A;  2MW8 A;  1RUN A;  2E2H J;  2JQ7 A;  1S7E A;  5M5W J;  2G7G A;  2L4A A;  3X2Q H;  4D5F A;  2XC7 A;  4C2M A;  1TT5 B;  3GEU A;  2HS5 A;  2VL8 A;  1JHF A;  1B72 B;  4V2F A;  3EUH A;  1U0J A;  1X1D A;  2W53 A;  1YI2 I;  2M2E A;  4U87 A;  3SDG A;  2IA2 A;  3IKV A;  5BS6 A;  3N97 A;  2J5P A;  4TV7 A;  4XLP F;  1TZL A;  1XG1 A;  4PZJ A;  3WTZ A;  3S16 J;  3JRH A;  3QRF F;  4DOZ A;  1SD5 A;  1JKP C;  1GHC A;  3QQA A;  1TWA J;  1W5S A;  5J1Y A;  3OYI A;  5EEG A;  2BGC A;  3ML6 A;  2LY9 A;  2D1H A;  1LJ9 A;  3JSP A;  1IRG A;  1N75 A;  2E2J J;  3IAM 2;  1WRJ A;  4XOR A;  1E3P A;  1QNT A;  5GAH J;  2CWE A;  2E1C A;  3TOA A;  3ZCO A;  1K61 A;  1PVE A;  3TO6 A;  4XQF A;  3HTU A;  1OYY A;  1FWZ A;  3S15 J;  3WTW C;  3LAJ A;  3KYC B;  5IT3 A;  2QSH X;  3KIO A;  2HVR A;  3HE0 A;  2P5K A;  1FP1 D;  4AYB N;  4IO9 F;  1ONV A;  4KFC A;  3QOP A;  4I0A A;  2ACJ A;  1MJA A;  4RA2 A;  4YFN F;  2KQR A;  3DPL C;  2L4M A;  3L2C A;  1T2K A;  2A5Y B;  2RRE A;  4YRV A;  5FKO A;  1VQ6 I;  1NG6 A;  1FT9 A;  2W25 A;  3OSG A;  3CDH A;  4LJZ F;  1D8J A;  2LR8 A;  2YSR A;  5HOD A;  1Y8Q B;  1FZP B;  1VF9 A;  1WH5 A;  5FMP A;  3KE2 A;  4PDK A;  2VIX A;  2XKO A;  1Y1V J;  1ZG5 A;  5LGN A;  2LF8 A;  3VYS B;  2X6O A;  1JUP A;  1SEU A;  3DU6 A;  4YFK F;  4ZJZ A;  3V7C A;  3LSJ A;  2P6T A;  2E1N A;  2HOS A;  4ZYE A;  4EJO A;  4OIR F;  2ELJ A;  1LEB A;  1TWC J;  1ODD A;  3H5R A;  3E0J B;  2Q1Z B;  4JKZ A;  1DQU A;  2OTJ I;  2EFP A;  2FEZ A;  2KKO A;  3EUK L;  3NAU A;  4ACI A;  1KYZ A;  3MFK A;  4GDF A;  2IGN A;  3CES A;  1ZEL A;  2IA0 A;  3ULQ B;  4XRM A;  2DBB A;  2FA5 A;  2HQA A;  4R8H A;  1BJA A;  1D0Y A;  2CQQ A;  2YS9 A;  2XB0 X;  5EFY A;  2R5Y B;  4BQN A;  1P4A A;  2NNY A;  1U9O A;  1R5H A;  5BPI A;  2VQH A;  5CYV A;  2CV2 A;  3BT9 A;  3KP2 A;  2HXO A;  4NDL A;  1HW2 A;  1YTY A;  5D8L B;  5LGT A;  1EA3 A;  5FFX A;  1VZ0 A;  1UZC A;  1NHA A;  4A3M J;  4ZDP A;  2OBP A;  4LGW A;  2X6Y A;  1MZB A;  3GTJ J;  2CS3 A;  1BN5 A;  4BEH B;  2Z3Y A;  4UVC A;  3F23 A;  1XMA A;  5B1A H;  2VQG A;  4NEL A;  1LQ1 A;  3VOD A;  5C3E J;  5CVU A;  2PMU A;  5JR3 A;  3HRM A;  2ADU A;  3FK6 A;  1BR4 A;  3R0J A;  2W7N A;  4PGH A;  2DK8 A;  3TDZ C;  4KMF A;  1K4S A;  2E19 A;  3U21 A;  4IX7 A;  1UI5 A;  3CMM A;  3HG9 A;  1J09 A;  1E3O C;  2HTS A;  2R3S A;  3QWL A;  1MGT A;  1B72 A;  4GCL A;  2W00 A;  2V79 A;  5A2Q Z;  4BQQ A;  2FOK A;  5D4R A;  3GFM A;  3SXY A;  4LG0 B;  2QOP A;  4DW6 A;  2L0K A;  1J7K A;  1EH7 A;  3C18 A;  5DS9 A;  5J4Y A;  1IN5 A;  1PYV A;  2LYC A;  4A3L J;  3OOP A;  3RKW A;  4RB3 C;  3I0T A;  4NQW B;  2BHZ A;  2NVT J;  1FLI A;  4O3M A;  1D1C A;  3E5X A;  2DG8 A;  4KIT B;  4G6T B;  2QIB A;  4XLF A;  4A3C J;  1A04 A;  3TP0 A;  1IRX A;  4HF0 A;  3KZY A;  5HDN A;  4II2 A;  1UAA A;  1GXQ A;  2F4I A;  2RKH A;  1ACI A;  3EUH C;  3HUG B;  3U9G A;  3BPV A;  4A3D J;  2B1E A;  3KKD A;  2AXL A;  1IDZ A;  4A5N A;  2WY7 Q;  1YIJ I;  4XRF A;  1VQ9 I;  3K4M A;  3KET A;  5CVI A;  1MJ9 A;  2IVM A;  1M1E B;  4XBF A;  2DG7 A;  2QUF A;  1YS6 A;  3IWZ A;  2JN6 A;  3HOT A;  3OSF A;  4M3F A;  3QP5 A;  2RVC A;  3BTJ A;  5EDN A;  5E3O A;  1GDT A;  4QWQ A;  5EEA A;  2WTE A;  3BRO A;  3E7Q A;  2F4O B;  2O7O A;  2DYS H;  4A93 J;  2HYJ A;  3RYR A;  3L2W A;  4MEY F;  5EGO B;  3BJO A;  1H9G A;  1OLT A;  2XGX A;  2K9L A;  4FE4 A;  4BXU A;  2WBM A;  5J8F A;  2ZXH A;  4AU7 A;  2KJC A;  4UUV A;  2V1X A;  3EUA A;  4IJA A;  3OS2 A;  2ZOY A;  2XF7 A;  3SQN A;  4L5J A;  1QHH D;  4GFB A;  4U0Y A;  1G59 A;  2RQP A;  1UMQ A;  3IKT A;  4ICH A;  2V57 A;  3KEO A;  1ETW A;  4U0V A;  3VEP A;  4CIC A;  2X1D A;  2F5D A;  4EMS A;  3TW6 A;  1ZGJ A;  3GFJ A;  3MEX A;  3CQZ J;  1ETY A;  1JUM A;  3TED A;  2E60 A;  2PFB A;  2GEN A;  2H1L A;  3VB2 A;  1I3Q J;  4F55 A;  2O0Y A;  2ID6 A;  2WB1 A;  1Q1V A;  2ELH A;  1XDU A;  1HKT A;  5KAI C;  3IUO A;  1L3L A;  4YEL A;  2HVS A;  2KIF A;  4F3Q A;  2P0W A;  2R5Y A;  5F1R A;  1S9H A;  2PEX A;  4N4O B;  4BJT A;  2JTV A;  4RLQ A;  3OYM A;  4BNC A;  2IXS A;  4J00 A;  3DPJ A;  1SFE A;  1TWG J;  3V7S A;  1I1G A;  3RQ4 A;  2DA4 A;  2EIK H;  1A6Q A;  1JT6 A;  2W85 A;  3FMQ A;  2NS7 A;  4IQJ A;  2MAB A;  3VOX A;  2VBZ A;  2DMU A;  4LB6 B;  1JKQ C;  2M8E A;  2K27 A;  5HLH A;  2JSP A;  3S5R A;  4FET A;  2HNH A;  2QQ8 A;  3REO A;  4BYY A;  1VFC A;  2CGP A;  2DDA A;  5HBU A;  2K9Q A;  1O3R A;  3PUB A;  4XLC A;  1K6O A;  1W0T A;  4DBQ A;  3NI7 A;  2V1N A;  4HQE A;  4NC8 A;  3CDI A;  5AQC A;  3BG6 A;  1N25 A;  2F5E A;  5DM7 F;  1OCT C;  3K70 D;  1WKM A;  3DPU A;  2Y31 A;  3H5N A;  2L7M P;  1TQP A;  1F1Z A;  3ABU A;  3OWT A;  3T1B A;  4FTH A;  1POG A;  5FLV A;  5J1U A;  1BL0 A;  4AVP A;  5M5X J;  2OI8 A;  5F0H A;  1JUS A;  2LMD A;  3MWM A;  4I09 A;  3ONQ A;  2W57 A;  3S1M J;  1O57 A;  1I5Z A;  1R6R A;  3EUP A;  2VUM J;  3UKG A;  2QTQ A;  3BWG A;  3CO7 C;  3G3Z A;  2E1M B;  1UHM A;  4RAY A;  3RQI A;  1T39 A;  2RAS A;  4IPA A;  4C2U A;  4KJZ A;  2DI3 A;  3CJQ B;  3KP5 A;  3G7R A;  2EJR A;  2EZK A;  1XDS A;  1ZR2 A;  1HC8 A;  5HVQ C;  2BZT A;  3VVY A;  4O6J A;  2PZ9 A;  5JI6 A;  4BU2 A;  4C2T A;  3GZN B;  2FMY A;  1XGM A;  2CG4 A;  2LDU A;  3H0D A;  2BVM A;  4KMU X;  1FC3 A;  3LWF A;  5DYM A;  3DTE A;  2R7Z J;  3S2W A;  1FEX A;  3FRQ A;  4Z6Y A;  1I39 A;  2KFD A;  1K78 B;  1VQ8 I;  1V5E A;  4A0Y A;  2DMP A;  1X2M A;  3IRR A;  3AG1 H;  4AID A;  2KL4 A;  5HLT A;  2YPR A;  1E2X A;  2DCE A;  2DFF A;  4AC0 A;  2RAE A;  1XSX A;  1T95 A;  3RIR A;  3SYT A;  1ZLJ A;  1ZQ3 P;  3HSF A;  3P9C A;  4HX7 A;  2UXP A;  3LST A;  2QEX I;  2QGU A;  3FM3 A;  3QYE A;  5HNF A;  2R5Z B;  1FOX A;  5EGO A;  4ZYD A;  2HI3 A;  2HQN A;  4JQF A;  5IYD J;  1C0W A;  1RIO H;  1X58 A;  1OYW A;  1TNT A;  3GTK J;  4XOT A;  4IQ4 A;  2LY2 A;  3Q3S A;  5H20 A;  5HNH A;  3PAS A;  4P55 A;  4YII A;  2ID3 A;  1VTN C;  5AIP A;  4ZYG A;  3HJE A;  3A4C A;  3RD3 A;  2H09 A;  2I8D A;  2XAF A;  4EGY A;  1G3W A;  2R7O A;  1T6S A;  2V9P A;  1TT0 A;  4BE0 A;  2CFX A;  3F0C A;  4G7H F;  5FLM J;  1HW1 A;  5E17 F;  4KA4 A;  3MVP A;  3M8E A;  3ANP A;  1L0O C;  4LLL A;  3FKJ A;  2HKX A;  1G6N A;  2XGD A;  2G7U A;  1V5G A;  1PUE E;  3HOU J;  3BCB A;  3L2V A;  2EFN A;  2GFN A;  1R23 A;  5CXG A;  3U1K A;  2ZCW A;  1BA5 A;  4UV9 A;  3NRG A;  3BC8 A;  2EIL H;  2ZXI A;  1TTY A;  3E6C C;  2DA2 A;  2OQR A;  5FGM A;  2VOP A;  4LG3 A;  1ETK A;  1ZGA A;  2OPT A;  4GO1 A;  2P6S A;  5FKK A;  4PJL A;  5L3F A;  4LIT A;  1DPU A;  1QVT A;  3BCA A;  2X51 A;  2JA5 J;  1P92 A;  1DU0 A;  5L3E A;  3GZ5 A;  3TW7 A;  2UUZ A;  3CLQ A;  3OYH A;  1JE8 A;  3HBL A;  4C30 A;  2XHK A;  1SMY F;  4IHX A;  4OIQ F;  1YQA A;  3F8F A;  5JHU A;  2HOT A;  3VUQ A;  2P4W A;  3M8J A;  4EJW A;  4ZDL A;  2MFZ A;  4AIK A;  2O7T A;  2M45 A;  1O3T A;  4RGR A;  2N8G A;  2QKM B;  2R7Q A;  2UV1 A;  3M9A A;  5E1X A;  2VJJ A;  2QKL B;  4BBR J;  2JVH A;  3DFG A;  3B6C A;  4FCY A;  3OYC A;  3CDL A;  2ZC2 A;  4F93 B;  1QBJ A;  3BG5 A;  3R60 A;  2LY1 A;  4QPQ A;  9ANT A;  1YX3 A;  2WAF A;  3OMY A;  5L3B A;  4BE1 A;  3VW0 A;  3JRF A;  2VI6 A;  4OIN F;  3FZV A;  5IT9 K;  3GX4 X;  3FDY A;  2QEN A;  4PJN A;  1YJN I;  2PQ8 A;  5EJC A;  1X1A A;  4XLA A;  3DQV C;  5DUI A;  3RKX A;  3J7A Y;  1MH3 A;  3LA7 A;  3DU5 A;  3GZ6 A;  1G8X A;  1S29 A;  2CW8 A;  2D1V A;  1A5J A;  3B02 A;  3FK7 A;  2V1U A;  1IN6 A;  4DVY P;  2R0Q C;  2HU9 A;  2DFE A;  2HOE A;  5FJ8 J;  2MLG A;  4BBS J;  2Z2S B;  2MC3 A;  4EV0 A;  1AU7 A;  4RDU A;  4OMY A;  4X6A J;  5K5R A;  2XGE A;  2Y48 A;  2Z1D A;  2GLO A;  3LSH A;  2JWT A;  3MCZ A;  4XON A;  5D18 A;  3PQK A;  2UXH A;  3LWJ A;  1KU3 A;  2VXD A;  2VKH A;  1DU6 A;  3BR2 A;  5FLX K;  4RM2 A;  1FOK A;  1GXP A;  4W97 A;  2IGO A;  1QQI A;  3ON2 A;  3WTX C;  4M3D A;  2UXN A;  2WB1 N;  2HKU A;  3GXO A;  5GAE J;  3JSO A;  4NB5 A;  5HDK A;  4XMY A;  3NAR A;  2EBI A;  1TLH B;  2FJ1 A;  3WTV C;  5GTH C;  3H36 A;  2CUJ A;  4IEJ A;  3DBR B;  3T5X A;  4D1Q A;  2R5Z A;  3AL0 B;  4V19 K;  3HYI A;  4YFX F;  3KNW A;  1R1V A;  2DA5 A;  2O3F A;  1YJ9 I;  4LB5 A;  2OZU A;  3HRU A;  4HQM A;  3WE3 A;  3PL8 A;  4YZE A;  3CP2 A;  1K79 A;  4IHW A;  3LSR A;  2GUH A;  1TWF J;  4AIJ A;  2PFV A;  2LOO A;  2JPB A;  1HSJ A;  3GWZ A;  3O3K A;  4M9X A;  1Y1W J;  5FFZ A;  3B73 A;  5IYC J;  2UXX A;  3FXK A;  4DZJ A;  1QU3 A;  2CYY A;  1P7I A;  2HXI A;  4JK1 X;  2PMH A;  2FNP A;  4KIC A;  5J3L A;  1WJB A;  2XB5 A;  4KN4 X;  1X3W B;  3BOQ A;  5FRM A;  2MH9 A;  3TO9 A;  2VE8 A;  1J0R A;  1UG2 A;  3I4P A;  4ZYA A;  3A01 B;  3K4J A;  3DEE A;  2K4B A;  4ENJ A;  1B8I B;  1V3F A;  1IDY A;  4RAZ A;  3HIF A;  1MBF A;  4ANJ A;  2VBW A;  4XRS G;  1MKM A;  4RLF A;  1EJ9 A;  1HOM A;  1P4W A;  1R58 A;  4N4N B;  1P9Q C;  4Q48 A;  2ESH A;  3MMY B;  3S14 J;  2DW4 A;  4ESB A;  2G3B A;  1IV8 A;  1RKW A;  4CCK A;  1FIP A;  1K83 J;  3DF8 A;  4D0P A;  2HEO A;  2NVY J;  2LRE A;  5KAF C;  1OJL A;  3JRB A;  3VP5 A;  2KHM A;  3RPU A;  5K58 A;  5EYR A;  3H3Z A;  3NXC A;  1BI2 A;  1S8N A;  2MD0 A;  1B9M A;  3L2R A;  2EZH A;  3OYD A;  3OYJ A;  4ITV A;  1VQL I;  4M73 A;  4UUT A;  1ZHF A;  3QOD A;  3K1N A;  1TBX A;  4BHC A;  4CUG A;  2KP6 A;  3ABT A;  1D8K A;  3F8C A;  3FIW A;  4KIG A;  1NG7 A;  3F8M A;  1Y6I A;  2NRA C;  2EIM H;  1Z91 A;  4RBO A;  1GVD A;  2NXN B;  1SAN A;  2FJI 1;  1LFP A;  1QZZ A;  3NS4 A;  3HTJ A;  2JA6 J;  1XSD A;  2YX7 A;  2Z16 A;  4ABZ A;  4CGZ A;  4HZF A;  1V4R A;  4GXO A;  3ZP5 A;  4RB0 A;  4XIC A;  1LVA A;  2BHY A;  2F2E A;  2OF7 A;  2HGC A;  3HGY A;  1RNL A;  2XRL A;  1AA7 A;  2QQA A;  3OL4 A;  3LQR A;  1HF0 A;  1Z9C A;  3BCG A;  3BJB A;  3L2Q A;  4AIH A;  2WWY A;  1PUF B;  4OU0 A;  5FB2 A;  2DYR H;  3K4L A;  3CD6 I;  4ESF A;  2VLA A;  4FX4 A;  2GZW A;  4NNJ A;  2A5W A;  2DTR A;  3ZQL A;  1R71 A;  5HAW A;  4JX5 A;  3F22 A;  2OU2 A;  4EQQ A;  2Q0O A;  2DT5 A;  4U9N A;  3BDD A;  1MMA A;  2ECB A;  3C1D A;  2DFI A;  3D5R C;  1Z05 A;  2F07 A;  4S05 A;  3CZ6 A;  4MEX F;  1TQI A;  1LDJ A;  3W2A A;  5IT9 Z;  2BXY A;  4WXC A;  1X4O A;  4BXF A;  5JVG F;  2E1M C;  4B47 A;  3O8H A;  4RAG A;  3RSN A;  4Y52 J;  4CXF A;  4II3 A;  2EV5 A;  2UXO A;  3ESW B;  2FE3 A;  1WVR A;  1ZK8 A;  2XPW A;  4G94 A;  4OAZ A;  1OCC H;  1CF7 B;  3RCO A;  3NEU A;  1FBQ A;  2LK2 A;  4A5M A;  1QA6 A;  1VQ4 I;  4HST A;  3BR0 A;  3H9Q A;  3JRI A;  3CCQ I;  4JX4 A;  1RUO A;  1D0X A;  2P5V A;  1ORK A;  3K2Z A;  2R4G A;  2AQF A;  1JGG A;  3ZMS A;  4OD5 A;  5F27 A;  1A31 A;  4M9S A;  3DCF A;  4HV5 A;  2CUE A;  3MQ0 A;  1K6Y A;  1MSE C;  4K2E A;  2EFW A;  4HPQ A;  5FLX Z;  4I0B A;  3FM5 A;  4RGS A;  1BIB A;  4UUS B;  1AWC A;  3F1B A;  3JW4 A;  4I2O A;  3WTT C;  2E1O A;  1BW5 A;  1I1S A;  3GLX A;  5HDG A;  3M7G A;  3WGI A;  2FXA A;  4Z2Y A;  2EIJ H;  2NP3 A;  3ISP A;  3P7N A;  4LD5 A;  2ESN A;  4BHB A;  3MNL A;  2RNJ A;  1W5T A;  4BDY A;  2FNA A;  4RM3 A;  3BY6 A;  2XSD C;  3RZD J;  2IS1 A;  2JRM A;  2X1E A;  6PAX A;  1EF4 A;  3S17 J;  2L02 A;  1B8I A;  5CVJ A;  1X19 A;  2GAU A;  3P5J A;  1IXR C;  3ABK H;  3RPQ A;  3S3N A;  1WJ5 A;  2WAE A;  1MJB A;  3FIS A;  1FYK A;  1BR1 A;  3E6M A;  1XB4 A;  1Y56 A;  4RAF A;  4WIB A;  2Y0S A;  2P5L C;  4DYQ A;  1RRJ A;  4JYK A;  1HKS A;  2AQE A;  2Q24 A;  1IUY A;  2IW5 A;  1IXC A;  1QGP A;  3EPZ A;  3QOE A;  3O6B B;  5DV5 A;  3G4S I;  2H6C A;  4GFK A;  3FWE A;  2NS8 A;  1S6L A;  3ERM A;  4XID A;  1FJL A;  2EK5 A;  3ZN1 A;  1FTT A;  3EDP A;  2FBQ A;  4IHT A;  1MBK A;  5F04 A;  4GGG A;  3ZGK A;  2I10 A;  2Y0M A;  4GRI A;  4XLN F;  4L5I A;  3RYP A;  4HNU A;  5DM6 F;  4UHT A;  3ZQC A;  5GAD J;  2EB7 A;  2W84 A;  3H9G A;  3O2P E;  4CCM A;  3CCJ I;  3L09 A;  2LC2 A;  4C2M J;  1MMN A;  3WG9 A;  3MKZ A;  4ZH4 F;  2YU9 J;  4KIB A;  3GEZ A;  1VQO I;  4CGR A;  2JVG A;  1XMX A;  4OD4 A;  4YEJ A;  2R93 J;  3VW2 A;  3N05 A;  4ZYH A;  5M3F J;  3JTH A;  2DTZ A;  1KQ0 A;  3V6G A;  3CO6 C;  3G71 I;  4G12 A;  3J7Z I;  3A0B C;  2LBF A;  2MH2 A;  3T0Y A;  5CW8 A;  2ZJ2 A;  5LD2 C;  5KK1 A;  4BJ5 C;  3BZ6 A;  2DN0 A;  1Z21 A;  2P81 A;  3K70 C;  4HDV A;  2QYO A;  4L5E A;  2IRF G;  4A3G J;  5HSZ A;  2R7F A;  1Z3Y A;  2M34 A;  3IAS 2;  1MSF C;  2ZCN A;  3E6D A;  2L54 A;  2GM4 A;  3PNV A;  2A61 A;  2CO5 A;  4C3I J;  3C7J A;  4QSH A;  2EFO A;  3K2A A;  2Y75 A;  5FRN A;  5E1W A;  1WZ2 A;  1WPK A;  5LBQ A;  2MD5 A;  3CCY A;  3GBG A;  5E8G A;  2CQK A;  1PP7 U;  2K5C A;  1CF7 A;  4XRS A;  5B66 C;  1T08 B;  3RJP A;  3S93 A;  5H6R A;  3SFZ A;  4A3J J;  2R7R A;  1R1U A;  3HB9 A;  5KVR A;  1WI3 A;  1IG7 A;  2FML A;  4D5C A;  4JP0 A;  2O03 A;  3DEU A;  3R6S A;  5D5W B;  1TW3 A;  3MZ8 A;  2CUZ A;  3JSJ A;  1S3J A;  2VC1 A;  5FRO A;  1NK2 P;  3LSG A;  2HFH A;  3R4K A;  2QVO A;  4L9N A;  2C6Y A;  2W24 A;  1OMI A;  1P6R A;  4GYG A;  2IA1 A;  1LFB A;  3FHZ A;  3OS1 A;  1QPI A;  4AWX B;  1FMV A;  3M1E A;  2FRH A;  3E3V A;  4W1U A;  1JJ8 C;  3ABL H;  3K69 A;  1KZH A;  2FBH A;  2OAZ A;  2Q2E B;  1MND A;  1PJR A;  5FD6 A;  2AO9 A;  1O3S A;  3RKQ A;  4KT5 C;  1RR7 A;  2AS5 F;  3AL0 C;  4G8X A;  3JRA A;  4HNT A;  4D7N A;  3G2B A;  4G6Q A;  3W2W A;  3HOW J;  2W4S A;  4BUP A;  2W82 A;  2LVS A;  2X6X A;  2E71 A;  2VKV A;  1J59 A;  5LEJ A;  1B1B A;  2WV0 A;  1QHG A;  1D1B A;  3HOX J;  3WTU C;  4ENN A;  1BC7 C;  4GYI A;  2LSO A;  1QZY A;  2DOA A;  3I59 B;  2V6E A;  1P7J A;  2M7B A;  2JJ7 A;  2NOJ B;  3FXQ A;  4M6Y A;  5AIQ A;  4KDP A;  4M6V A;  1BC8 C;  3WU1 B;  2IT0 A;  2B3W A;  3CCV I;  2HZD A;  2E7X A;  1YLF A;  1OPC A;  4M6X A;  4E6K G;  3QPT A;  5CQE A;  3SZT A;  4HLX A;  3W6K B;  2FX0 A;  4RGX A;  3E5Q A;  3M1C A;  2CQN A;  3B6A A;  5LHG A;  2JA2 A;  2VE9 A;  5GP9 A;  3DTI A;  2L7K A;  3G6E I;  1T0F A;  4ZTJ A;  4FQG A;  1REP C;  1GV5 A;  3LMM A;  4HOB A;  4HYE A;  1H88 C;  2UWM A;  2XPV A;  2A2F X;  3HPH A;  3CJN A;  4KUM A;  3HHG A;  1N77 A;  2IEK A;  2W48 A;  1OCZ H;  2K40 A;  1TL8 A;  3D0S A;  1SFU A;  1D3Y A;  2E35 A;  2KRH A;  5IP7 J;  1RC9 A;  4A69 C;  2HWV A;  1BI0 A;  2PJR B;  4HEA 2;  2QWT A;  2XAH A;  5GTI C;  4G7O F;  3I3L A;  4ZDO A;  3OOU A;  1HA8 A;  2O61 A;  3I9V 2;  4OIO F;  4M3E A;  3CCM I;  2B63 J;  2MSY A;  2K3P A;  1FY7 A;  2IPQ X;  5DCM B;  2L9S A;  2VQC A;  4E7Z A;  3OIO A;  4IRV A;  3ZN0 A;  1OR7 C;  1XGN A;  1KON A;  5EG0 B;  1BI1 A;  2EA4 A;  2IS6 A;  1A35 A;  4L9T A;  2R7X A;  1MBH A;  4H0E A;  3OYG A;  3BTL A;  3K0L A;  1X3U A;  4BEH A;  1X1P A;  1SAX A;  1T38 A;  2KDO A;  2K85 A;  3LJL A;  1I27 A;  3BZK A;  2OD5 A;  5ILS A;  1OCR H;  3QU6 A;  2XVC A;  4BY7 J;  3A1Y A;  3TDU C;  2VC0 A;  3GLL A;  3IWF A;  1Z77 A;  4P96 A;  3CME I;  3HTS B;  2VXZ A;  1IAW A;  2XUB A;  3K1M A;  2OTL I;  1OKR A;  4AM3 A;  1H9T A;  1QO0 D;  3M07 A;  2H8W A;  3AG4 H;  2A05 A;  4E7S A;  4IOC F;  4CCL A;  4LG0 A;  1HDP A;  5IP9 J;  5ILU A;  1F43 A;  1HXD A;  2QZ8 A;  1SD6 A;  3GYH X;  3FMS A;  2A6E F;  1WH7 A;  4NQW A;  5DD4 A;  2HYG D;  2MGQ A;  1FPQ A;  4E4H A;  2BY3 A;  3S32 A;  3HOY J;  3VVZ A;  1IN8 A;  1SAU A;  3CLO A;  4DIQ A;  1SFX A;  3VFZ A;  4IHY A;  3HOZ J;  2DQR A;  3F6V A;  3QYF A;  4AUX A;  5D19 A;  3P9T A;  3V8K A;  1W1W E;  2Q2E A;  3VPR A;  2M0M A;  3P9K A;  1U78 A;  3HUG A;  4NN1 A;  5L3G A;  3J81 Z;  5B1B H;  4BGD A;  1TC3 C;  4PJJ A;  2NOG A;  4UY8 I;  2DA6 A;  3FXL A;  4I98 B;  3S3O A;  3WU2 C;  3V8L A;  1XCV A;  2GOX B;  3UR3 C;  1SVO A;  2UXI A;  1ENH A;  4JX6 A;  3FXU A;  1XCB A;  1VQ7 I;  1WCM J;  4XLH A;  3ZQG A;  2H6B A;  3CTA A;  1NK3 P;  4PFO A;  5F1J A;  2CJJ A;  2QSF X;  5DCF A;  4IRI A;  2G7L A;  3IH2 A;  3T6N A;  2WAQ A;  2XDV A;  5C4J J;  3LNQ A;  5GPA A;  1RES A;  1XGO A;  3DXJ F;  2K9N A;  1D5Y A;  2L9R A;  1MDM B;  4XOP A;  3FBI B;  2O8K A;  5ICE A;  5D5U B;  4FHT A;  2D6Y A;  2ELK A;  2JRT A;  4GFL A;  3J80 K;  4IHV A;  3I4N J;  4Y4R A;  1OFC X;  1Y0U A;  3K4K A;  1WGX A;  5KCM A;  3SHF A;  3BHQ A;  3FKI J;  2DJN A;  1I6X A;  4XKV A;  1H0M A;  1CGP A;  1ITY A;  1IGN A;  4JNN A;  4P1W A;  4KNY A;  3OV8 A;  3CJD A;  2JA8 J;  1UEL B;  4AVZ A;  5TJJ A;  1ZAO A;  4A3K J;  3KP3 A;  4KWA A;  4DNC A;  2DA3 A;  3LA2 A;  2PJR A;  2DU9 A;  4IL6 C;  3PIO F;  2EWN A;  3BP8 A;  4FE7 A;  2CMP A;  1NH3 A;  2NS0 A;  2BY2 A;  2WV1 A;  3S3M A;  2AHQ A;  2COM A;  4HBL A;  3IUV A;  4UXN A;  3H92 A;  3Q0U A;  4CCO A;  5DCM A;  5H2F C;  1YJW I;  4ON0 A;  1MNM C;  3HTI A;  2JSC A;  2IU5 A;  5BPD A;  1IO2 A;  3HKZ A;  5L3D A;  2IGM A;  3KPH A;  1T0F C;  1T8I A;  3TKY A;  2LP0 A;  4JBA A;  4HSR A;  3GVA A;  1JT0 A;  4PUS A;  3QPL A;  1HBX G; 
#chains in the Genus database with same CATH homology
 2EZH A;  1U9N A;  2H1K A;  1TWC J;  1RKT A;  4UUT A;  4CYC A;  3D1N I;  4UDS A;  2ECC A;  4L62 A;  4JKZ A;  3FIW A;  3G1O A;  3NAU A;  4ACI A;  3O60 A;  3GZI A;  3W6V A;  3BG3 A;  2Y30 A;  4RBO A;  4XRM A;  1GVD A;  1SAN A;  2YS9 A;  2CQQ A;  2XB0 X;  3ON4 A;  5J1R A;  2R5Y B;  5EFY A;  3HTJ A;  2JA6 J;  4M3B A;  1U9O A;  5E3M A;  4ABZ A;  4JL3 A;  4C3H J;  3BT9 A;  2HXO A;  4NDL A;  4XIC A;  2OF7 A;  1YRN A;  1UI6 A;  1MBE A;  3HGY A;  2Y9Z A;  2XRL A;  3VIB A;  4B3A A;  2NVX J;  1HF0 A;  2LKX A;  3BCG A;  3BJB A;  4A3M J;  3WHB A;  4M3G A;  1PUF B;  2H8R A;  1QRY A;  2Y0S N;  1SGM A;  3RH2 A;  2JMW A;  3GTJ J;  1NTC A;  3I4M J;  5HAW A;  3S1R J;  3ZQL A;  4NEL A;  3PPB A;  5H9T A;  2IBD A;  4JX5 A;  1R9T J;  5C3E J;  2XPU A;  5F0C A;  5CXI A;  3KKC A;  3M3Y J;  3FK6 A;  3C2B A;  3VVX A;  2ECB A;  2F07 A;  5E3N A;  4J19 A;  2E19 A;  1UI5 A;  1IRZ A;  1E3O C;  5IPA A;  1B72 A;  1MH4 A;  4GCL A;  2ZOZ A;  4DZP A;  3O8H A;  1BW6 A;  3HGG A;  1I6H J;  4Y52 J;  4HKU A;  2UXO A;  2QOP A;  3H3V K;  4DW6 A;  3B81 A;  2HYT A;  2L0K A;  1ZK8 A;  2XPW A;  2O9L A;  5DS9 A;  2LK2 A;  3BR0 A;  4DYC A;  3JRD A;  3JRI A;  4A3L J;  2DMN A;  4JX4 A;  2NVT J;  1UHS A;  2HDD A;  1XC5 A;  1ORK A;  3BQZ A;  1JGG A;  4XK4 A;  2DMQ A;  3CMY A;  2DG8 A;  5F27 A;  5DAJ A;  2YVE A;  2QIB A;  3BG9 A;  3DCF A;  4A3C J;  3TP0 A;  5BNG A;  2YUS A;  2CUE A;  4LOC A;  3IH3 A;  1MSE C;  2NX4 A;  2EZI A;  3L1P A;  4A3D J;  4UUS B;  3F1B A;  1BW5 A;  3KKD A;  1IDZ A;  2E1O A;  4EEF G;  4A3E J;  3BNI A;  2NP3 A;  3PM1 A;  2DG7 A;  4MFE A;  2CUF A;  3MNL A;  1ETX A;  3H0G J;  1IUF A;  2JN6 A;  1AKH B;  2XSD C;  3OSF A;  4M3F A;  3RZD J;  1EF4 A;  3MN2 A;  3BTI A;  2XGC A;  1B8I A;  3S17 J;  3BTJ A;  5EDN A;  1LE8 A;  5C44 J;  5E3O A;  2FQ4 A;  1GDT A;  5EEA A;  3E7Q A;  2FD5 A;  2O7O A;  3RZO J;  4A93 J;  2HYJ A;  1AHD P;  4A3F J;  1GUU A;  1VND A;  3A02 A;  2ZCM A;  3FIS A;  1FIA A;  5EGO B;  4I76 A;  4FE4 A;  3PO2 J;  4DYQ A;  2L7Z A;  3BR3 A;  2ZOY A;  4JYK A;  3GTQ J;  2Q24 A;  4GFB A;  2ME0 A;  1ZR4 A;  4GFK A;  5C4Y A;  1UMQ A;  4ICH A;  2NS8 A;  2V57 A;  1ETW A;  4XID A;  1FJL A;  3ANG A;  3TW6 A;  2JA7 J;  1A6I A;  2IAI A;  5EG0 A;  1FTT A;  3CQZ J;  4FIS A;  3LOC A;  1ETY A;  2FBQ A;  1MBK A;  1JUM A;  5F04 A;  3TED A;  2JK3 A;  5FHP A;  2I10 A;  3ZQI A;  5GPC A;  2GEN A;  2TRT A;  3MKL A;  3ZQC A;  3EGQ A;  1I3Q J;  2M0C A;  2G0E A;  2ID6 A;  5IOZ A;  1Q1V A;  3PO3 J;  4C2M J;  3BTC A;  3SJM A;  1U8B A;  2YU9 J;  2DA1 A;  2R5Y A;  4CGR A;  3SFI A;  2R93 J;  3QPS A;  3VW2 A;  3DPJ A;  2WUI A;  1TWG J;  4Y7N J;  3GTM J;  1T56 A;  2DA4 A;  3Q0W A;  1JT6 A;  2NS7 A;  5M3F J;  1FTZ A;  4AC6 A;  2DTZ A;  1HLV A;  4C3J J;  3VOX A;  2DMU A;  3V6G A;  1SFO J;  2WAQ N;  4G12 A;  1JKQ C;  1F36 A;  2NVQ J;  5CW8 A;  3DEW A;  5M3M J;  3A03 A;  3S5R A;  2COB A;  3HEF A;  3AQS A;  2DN0 A;  1VFC A;  2P81 A;  5HBU A;  2K9Q A;  4L5E A;  1VI0 A;  4A3G J;  2QKO A;  5HSZ A;  3KZ9 A;  2M34 A;  1JTY A;  1ZGW A;  1W0T A;  1MSF C;  2ZCN A;  3NI7 A;  5EZG A;  2GM4 A;  5AQC A;  4C3I J;  4QSH A;  1OCT C;  4AF5 A;  3K2A A;  2Y31 A;  2L7M P;  5FKL A;  1WPK A;  3CCY A;  3GBG A;  4MFD A;  1TWH J;  2Y9Y A;  3JRE A;  1POG A;  4FTH A;  5FLV A;  5J1U A;  1BL0 A;  2ZCX A;  5EZH A;  5M5X J;  5F0H A;  1JUS A;  4XRS A;  2OI8 A;  4A3J J;  3HB9 A;  1WI3 A;  1IG7 A;  4D5C A;  4JP0 A;  3GTP J;  3S1M J;  4I6Z A;  3CWR A;  3EUP A;  2KDZ A;  2QF7 A;  4DYR A;  4QIW N;  3UKG A;  2VUM J;  2QTQ A;  3JSJ A;  5FKN A;  3TP3 A;  3RQI A;  1NK2 P;  2RAS A;  1H8A C;  3LSG A;  4MO7 A;  3JRG A;  3G7R A;  1ZR2 A;  2EZK A;  3HOV J;  2NP5 A;  1GT0 C;  3VVY A;  5IP6 A;  4GCK A;  3GTO J;  2PZ9 A;  2LLK A;  3ZOB A;  5FGL A;  1LFB A;  1LFU P;  1APL C;  3LHQ A;  2X48 A;  1QPI A;  3V78 A;  4W1U A;  4MLO A;  2ME6 A;  1JJ8 C;  5K7Z A;  2R7Z J;  3CRJ A;  2KT0 A;  1FEX A;  3FRQ A;  3ZQF A;  4B1R A;  2AO9 A;  2D5V A;  3RKQ A;  3BR1 A;  1JTX A;  1RR7 A;  1X2M A;  2DMP A;  3IH4 A;  3JR9 A;  3JRA A;  1XS9 A;  1AKH A;  4ME9 A;  4D7N A;  1RET A;  3HOW J;  4AC0 A;  2RAE A;  2LFB A;  2LVS A;  2VKV A;  1IV6 A;  1ZQ3 P;  3NNR A;  3A01 A;  2DMT A;  1O4X A;  1I50 J;  2UXP A;  3G1M A;  5IYB J;  3HOX J;  2L7F P;  2R5Z B;  5EGO A;  1JKO C;  2HI3 A;  1Z0X A;  5IYD J;  4MK6 A;  2TCT A;  1P7J A;  1X58 A;  3C07 A;  1JJ6 C;  3GTK J;  2OER A;  3Q3S A;  3PAS A;  2JJ7 A;  3GTL J;  4MXM A;  5D1R A;  4M6V A;  1MBG A;  3BR5 A;  2ID3 A;  2PMZ N;  2DA7 A;  3RD3 A;  5C4X J;  5EF6 A;  3F0C A;  5FLM J;  2FX0 A;  3MVP A;  3ANP A;  4PXI A;  3BRU A;  3B6A A;  3VW1 A;  2EH3 A;  1IC8 A;  3QKX A;  5GP9 A;  2XGD A;  3HOU J;  2GFN A;  1ETO A;  1GV5 A;  4B4C A;  2YVH A;  1H88 C;  5CXG A;  2HOA A;  2K9S A;  2CU7 A;  5K7F A;  2XPV A;  1BA5 A;  3NRG A;  2IEK A;  1HCR A;  2W48 A;  3O8G A;  4A3B J;  2K40 A;  2DA2 A;  3VOK A;  1ETK A;  2OPT A;  5FKK A;  2CRG A;  5IP7 J;  2Y2Z A;  4A69 C;  2LTP A;  1QVT A;  2E2I J;  2CQX A;  5IOY A;  2QWT A;  2JA5 J;  1DU0 A;  2EZL A;  3K7A J;  3OOU A;  3TW7 A;  4M3E A;  4MIM A;  3HBL A;  2B63 J;  2MSY A;  3G56 A;  3NPI A;  4IHX A;  3GTG J;  4GCT A;  2HOT A;  3VUQ A;  3OIO A;  3HTH A;  2O7T A;  3S1N J;  2M8G X;  3ZQH A;  5EG0 B;  2VKE A;  1PUF A;  1BJZ A;  2N8G A;  5M5Y J;  1MBH A;  2UXU A;  3BTL A;  3M4O J;  4BBR J;  4BXX J;  1ETQ A;  3B6C A;  4FCY A;  1ZKG A;  3CDL A;  3LJL A;  3BG5 A;  1H89 C;  9ANT A;  4BY7 J;  4CYC B;  3VW0 A;  3JRF A;  3E7L A;  2HQ5 A;  2VI6 A;  1RPW A;  1Z77 A;  1ETV A;  3S1Q J;  5F08 A;  3HM5 A;  3WHC A;  2XDN A;  1CQT A;  2QCO A;  3Q0V A;  1MH3 A;  4QTR A;  2M9H A;  4BKX A;  1HDP A;  5IP9 J;  4D7M A;  2RHA A;  1A5J A;  3FK7 A;  2VPR A;  2REK A;  1YRN B;  1F43 A;  1ZTR A;  2R0Q C;  5FJ8 J;  2ZB9 A;  1WH7 A;  5JLW A;  2LD5 A;  4BBS J;  2MGQ A;  1AU7 A;  3LSP A;  4RDU A;  4X6A J;  2XGE A;  3HOY J;  3VVZ A;  2WGB A;  4IHY A;  3BR6 A;  3HKZ N;  2GLO A;  3HOZ J;  2JWT A;  5D18 A;  5D19 A;  2GBY A;  4AUX A;  3P9T A;  2UXH A;  3LWJ A;  1DU6 A;  1X2N A;  1OCP A;  3BR2 A;  5F0F A;  3VPR A;  3IV5 A;  4S0H B;  2E2H J;  2MW8 A;  1U78 A;  1S7E A;  5M5W J;  4W97 A;  2G7G A;  4D5F A;  4NN1 A;  4X1E A;  4UUS A;  3GEU A;  3G1L A;  1TC3 C;  3ON2 A;  4M3D A;  2WB1 N;  2NOG A;  1T33 A;  2HKU A;  2DA6 A;  1B72 B;  4V2F A;  3NAR A;  2EBI A;  2W53 A;  1W0U A;  2M2E A;  2FJ1 A;  2MG4 A;  3SDG A;  4IEJ A;  2UXI A;  1ENH A;  3S2D J;  4JX6 A;  1WCM J;  2R5Z A;  3ZQG A;  5FKM A;  1XG1 A;  1NK3 P;  3S16 J;  5F1J A;  2CJJ A;  3KNW A;  3JRH A;  1JKP C;  3HTA A;  2G7L A;  3IH2 A;  3BQY A;  3QQA A;  1TWA J;  2DA5 A;  3T6N A;  1GV2 A;  5J1Y A;  5C4J J;  1QVU A;  3LNQ A;  5GPA A;  1RES A;  1D5Y A;  2K9N A;  2L9R A;  2LY9 A;  2R92 J;  2O8K A;  2D6Y A;  3HIM A;  4GFL A;  2ELK A;  2X9D A;  4YZE A;  4IHV A;  4IHW A;  3LSR A;  2E2J J;  3I4N J;  1TWF J;  2GUH A;  1OFC X;  2PBX A;  1WGX A;  3BHQ A;  1MBJ A;  1Y1W J;  3FKI J;  2DJN A;  5IYC J;  4DZJ A;  1K61 A;  1P7I A;  2HXI A;  1ITY A;  5J3L A;  1IGN A;  4JNN A;  3S15 J;  3JRC A;  2XB5 A;  1JKR C;  1G2H A;  3CJD A;  5K7H A;  3HDD A;  2JA8 J;  3HE0 A;  4V2G A;  1UG2 A;  4A3K J;  4AYB N;  3A01 B;  1B8I B;  1LE8 B;  1IDY A;  4KWA A;  2DA3 A;  3QBM A;  1MBF A;  2EQR A;  5FKO A;  5DTD A;  4XRS G;  3AQT A;  5E3L A;  4FE7 A;  1HOM A;  2WV1 A;  3OSG A;  2AHQ A;  2LR8 A;  3IUV A;  5HOD A;  3S14 J;  3Q0U A;  2G3B A;  1VF9 A;  1MNM C;  3HTI A;  1WH5 A;  1RKW A;  5FMP A;  1FIP A;  1K83 J;  1IJW C;  2NVY J;  2IU5 A;  1Y1V J;  4BY1 J;  1OJL A;  1HDD C;  2X6O A;  2LP0 A;  5JLX A;  3S2H J;  3JRB A;  3VP5 A;  1JUP A;  2G7S A;  5K58 A;  5EYR A;  1JT0 A;  3LSJ A;  3NXC A;  4A3I J;  3QPL A;  3COL A;  4HNV A;  2HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...