3B6AA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with actinorhodin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
213
Chain Sequence
MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords ActR protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 70
structure length 213
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6aA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6aA02
1HDDC 2YU9J 5EZHA 2HDDA 3FK7A 4LOCA 2PZ9A 3EGQA 4ME9A 3S15J 2NP3A 1RPWA 4M3BA 2GENA 2E2HJ 1Q1VA 1ZGWA 3BTCA 2EZLA 3HE0A 5FKNA 2VKEA 1SFOJ 1MBGA 1JT6A 2HYTA 1UI6A 4EEFG 2E2JJ 5EG0B 2QCOA 1ETYA 4G12A 1R9TJ 3GTJJ 1X2MA 2R5ZB 1HOMA 4DZJA 2CQQA 2R92J 4AC6A 2R7ZJ 5F0HA 3JR9A 1FEXA 4V2FA 2KDZA 3S2HJ 1QRYA 1Z77A 1ZR2A 2ECBA 3L1PA 2N8GA 3LWJA 1IUFA 3E7QA 1QVUA 4D7MA 3IH2A 1FIAA 2NS8A 4C3HJ 2Y9YA 2EQRA 4BXXJ 1A6IA 4A3BJ 2LFBA 2WAQN 4Y7NJ 2LK2A 4FE4A 2D5VA 2WUIA 1IG7A 2ZCXA 5FJ8J 2CUEA 3COLA 1NTCA 5C3EJ 2ZOYA 4XK4A 5CXIA 2R5YB 2FJ1A 1W0TA 3JRBA 4CGRA 4ICHA 2LR8A 1CQTA 4S0HB 1IV6A 4GCTA 2DA3A 2HOTA 3KKDA 2JA8J 3BR1A 3RKQA 2FQ4A 3A02A 3LJLA 5D19A 2LY9A 2OF7A 3BR6A 2QWTA 2DN0A 2H8RA 2GFNA 1JUSA 3P9TA 3T6NA 2IBDA 2RASA 3VOXA 1BW6A 1P7JA 2RAEA 3HBLA 5EGOA 2HI3A 1OCTC 9ANTA 3B81A 3ZQCA 2RHAA 4CYCA 4NELA 2Y31A 2K9SA 2ZCMA 4YZEA 2DMNA 5HAWA 3HIMA 2K9NA 1XG1A 2OI8A 2F07A 1WGXA 1MBHA 1JKRC 1OJLA 2QF7A 2XPVA 2XGCA 5DS9A 3KZ9A 1PUFB 3AQTA 1BW5A 3WHBA 1LE8A 1RKWA 4J19A 2DG8A 2LP0A 2G0EA 3RQIA 2YVHA 5GPCA 4C3IJ 5M5XJ 3PASA 3S5RA 5FKOA 1H89C 3ZQIA 1ENHA 1ETKA 3LSJA 4A3MJ 2WV1A 2GUHA 3OSFA 1H8AC 2DA7A 2AO9A 2OERA 5IYDJ 1I6HJ 3GTGJ 3BTJA 2VKVA 1HCRA 3BT9A 2HOAA 2ELKA 1MH4A 4XRMA 1FTTA 2JN6A 5M5WJ 3VUQA 4A3GJ 2YS9A 5K58A 1U9OA 4M3FA 3FK6A 1OFCX 3Q3SA 4L62A 4JX5A 3GTOJ 4BBRJ 1JUPA 5GPAA 5IP9J 2UXOA 4GFKA 4A3IJ 4AC0A 1JTYA 3G56A 2WB1N 1ZTRA 5CXGA 4IHYA 3GEUA 3ZQGA 3UKGA 5HBUA 2DMUA 2H1KA 2G7LA 4JKZA 5JLXA 1A5JA 4MFEA 4QIWN 1B72B 1GV2A 3PO2J 3BR3A 4M3EA 3NARA 2O9LA 3S17J 4MXMA 4AF5A 5F0FA 1OCPA 3GTLJ 3I4MJ 3PM1A 5K7HA 2ME0A 1RR7A 3SJMA 4XRSG 3BTLA 5IYBJ 1AU7A 1B8IA 2WGBA 2X6OA 4V2GA 1JJ8C 3AQSA 4JX4A 4DYQA 1E3OC 3ANGA 1JGGA 1VI0A 3S1MJ 4BBSJ 1F43A 2FD5A 2G7GA 3TP3A 3WHCA 1JJ6C 3BR2A 3O8HA 5D1RA 4MO7A 3LOCA 3V78A 2LLKA 3HGGA 1TWCJ 2GLOA 5F1JA 5C44J 1AKHB 4KWAA 1GVDA 3BR5A 5AQCA 3VOKA 1DU0A 1W0UA 2K9QA 3JRIA 3HTHA 5FKKA 2D6YA 4UUTA 3BJBA 2ECCA 2FBQA 4UUSB 3GZIA 3HB9A 2V57A 1WH7A 3NPIA 3CDLA 3VW2A 2JWTA 1RKTA 1HF0A 2HKUA 3QBMA 5CW8A 2XPUA 3A01A 4A3KJ 5EF6A 2Y30A 1Z0XA 2NS7A 5EZGA 2IEKA 4IHVA 1RESA 3JRHA 3HEFA 2G7SA 3VVYA 2QTQA 3S16J 5J3LA 4M3DA 3HTJA 4IHXA 2HXOA 3GTKJ 1SANA 3CQZJ 2ID3A 2JJ7A 1K61A 2MGQA 3LSPA 4IEJA 3QQAA 3CWRA 3ZOBA 1HDPA 1UG2A 4ABZA 2EH3A 1BA5A 4MK6A 2X48A 3Q0WA 3BTIA 3FKIJ 4DZPA 2ME6A 4UDSA 5EDNA 1IC8A 2NVXJ 2M34A 5EYRA 3S14J 5HODA 3JRAA 3JRGA 1ETWA 5E3MA 2R0QC 4B3AA 2NX4A 3Q0VA 3S2DJ 1WH5A 3RZOJ 3KKCA 3G1LA 4FTHA 3FRQA 1P7IA 4HKUA 3BR0A 3CMYA 3HKZN 4JYKA 4JNNA 3MN2A 4XIDA 1I50J 5C4XJ 1ETXA 3ON2A 4HNVA 1TC3C 5BNGA 2NOGA 2QKOA 3BQZA 2LVSA 4QSHA 3NAUA 1NK3P 1ITYA 3F0CA 4RBOA 2EZHA 2X9DA 1YRNA 3ZQFA 4X6AJ 4RDUA 5J1RA 3PPBA 4NDLA 1GT0C 3HOWJ 4A93J 2DMQA 2JA5J 5E3NA 2EBIA 2ZB9A 4DW6A 4B4CA 5DTDA 1XS9A 3S1QJ 3BNIA 3LSGA 4L5EA 2E1OA 2REKA 5EGOB 3BG5A 4C3JJ 1MSEC 2UXHA 1QPIA 2UXIA 4I6ZA 2KT0A 4W1UA 1DU6A 3MKLA 1XC5A 4CYCB 2B63J 2IU5A 3C07A 3CCYA 2XGEA 1Y1VJ 2DA5A 3TW6A 2YVEA 1WCMJ 1UI5A 2ZOZA 2UXUA 2QOPA 2DJNA 3SFIA 1IGNA 3F1BA 2UXPA 3B6AA 3V6GA 2LD5A 1JKPC 2IAIA 1UHSA 4M6VA 5FLMJ 1Y1WJ 5C4JJ 2JK3A 2NVTJ 3S1NJ 3MVPA 4M3GA 1VNDA 3HDDA 4A3JJ 2MSYA 1LFBA 1LE8B 3VVZA 5D18A 2R93J 1WPKA 1U9NA 3OSGA 3IUVA 2COBA 2VUMJ 3G7RA 5K7ZA 5IPAA 3VIBA 2CU7A 3HGYA 5J1UA 1K83J 4GCKA 3QPSA 5EG0A 1MSFC 4ACIA 3GTMJ 3B6CA 3HOUJ 2O7OA 2VPRA 3JREA 3BRUA 2R5ZA 5M5YJ 2XB0X 3BG9A 4JL3A 1IJWC 1H88C 2NP5A 4FISA 1MNMC 3QPLA 4D7NA 3K2AA 4A3EJ 2HOSA 3ANPA 3A03A 3NI7A 2W53A 3TP0A 3JRCA 2HYJA 3W6VA 1MBFA 2M2EA 2DA4A 5E3LA 3D1NI 2L7ZA 2Y0SN 1U8BA 1JT0A 2XRLA 1GUUA 3M3YJ 2XPWA 1ETOA 5FGLA 1F36A 5E3OA 2R5YA 2DMTA 2Y9ZA 1SGMA 1BL0A 3RD3A 2GM4A 3GTPJ 5HSZA 1B8IB 2CJJA 3VP5A 3NXCA 2E19A 2XSDC 5M3FJ 3DPJA 2XB5A 2JA6J 5EFYA 4BKXA 5F27A 2O7TA 3QKXA 5EEAA 3E7LA 4DYCA 4GCLA 1LFUP 1JKOC 3O8GA 1ZQ3P 2XDNA 1JKQC 5H9TA 5F08A 3OOUA 1VF9A 2NVYJ 2PMZN 4B1RA 3DCFA 3BCGA 3HTIA 1ETVA 1MBJA 3LNQA 2EZIA 5M3MJ 4JX6A 4Y52J 2DG7A 1X58A 3GTQJ 2AHQA 4JP0A 4XRSA 1IRZA 2PBXA 4FE7A 2ZCNA 4A3FJ 4DYRA 4D5CA 2JA7J 1EF4A 3TEDA 3VVXA 4IHWA 4BY1J 5F04A 3KNWA 4PXIA 3H3VK 3BHQA 2L0KA 1VFCA 1PUFA 3HOXJ 2G3BA 2K40A 1MBKA 2P81A 3HOVJ 5IOYA 2TRTA 3A01B 2L7MP 5FMPA 3Q0UA 2CUFA 1U78A 1X2NA 1T33A 5JLWA 3LSRA 3OIOA 5J1YA 2YUSA 4MLOA 3IV5A 1GV5A 5IP7J 5GP9A 2M0CA 2LKXA 3S1RJ 5F0CA 4A3CJ 2QIBA 3M4OJ 1MBEA 4W97A 2XGDA 3GBGA 1QVTA 1TWAJ 1FTZA 2CRGA 3VPRA 3ON4A 2LTPA 2TCTA 3H0GJ 3G1OA 3HTAA 4C2MJ 1JTXA 5K7FA 1FIPA 3DEWA 1FJLA 2JMWA 1TWHJ 3SDGA 4GFLA 5FHPA 1ZR4A 3I4NJ 2DA1A 4GFBA 3CJDA 1TWGJ 2Y2ZA 1B72A 3JRDA 3VW1A 1G2HA 2VI6A 2M9HA 3ZQHA 1HLVA 3CRJA 3JSJA 5IOZA 3G1MA 4AYBN 2OPTA 4BY7J 3MNLA 3BQYA 1I3QJ 3VW0A 5DAJA 1NK2P 1POGA 1JUMA 2MG4A 1S7EA 3HM5A 3K7AJ 3ZQLA 4D5FA 4AUXA 1IDYA 1RETA 4A3DJ 2FX0A 2CQXA 3C2BA 3IH3A 4QTRA 5FLVA 3FISA 2DMPA 3TW7A 3PO3J 5FKMA 1WI3A 2L9RA 1YRNB 2NVQJ 5IYCJ 1ZK8A 3NRGA 3RH2A 2I10A 2MW8A 2HQ5A 3NNRA 1AKHA 1IDZA 1T56A 1GDTA 3HOZJ 4NN1A 3LHQA 1ORKA 3IH4A 1TWFJ 3EUPA 1O4XA 2DTZA 1APLC 4UUSA 4A3LJ 3RZDJ 1ZKGA 2DA2A 3O60A 4XICA 2EZKA 1D5YA 1MH3A 3HOYJ 2O8KA 2HXIA 2ID6A 2DA6A 1BJZA 5FKLA 4A69C 1ETQA 2W48A 4I76A 3FIWA 2E2IJ 3JRFA 2M8GX 3BG3A 4MFDA 4MIMA 2L7FP 2GBYA 5C4YA 4X1EA 2Q24A 5IP6A 1AHDP 4FCYA 1UMQA
chains in the Genus database with same CATH superfamily
2K9MA 1WJFA 1HDDC 2YU9J 4KMFA 2CQKA 1TNTA 5JR3A 1U5TC 3LSIA 3S15J 2NP3A 4B44A 1R1UA 2QA4I 2E2HJ 2WV0A 2MC3A 3DTEA 2XC7A 2W7NA 2Y48A 1ZGWA 2VKEA 2UWMA 2PJRA 1V55H 2ESNA 5KVRA 1W7PB 1ETYA 2ELJA 3LAPA 3JTHA 2CO5A 1X2MA 1HOMA 2V1XA 3VTIA 2R92J 1KZHA 5F0HA 3AKZA 1KONA 3JR9A 2A5WA 1ZR2A 2FBHA 3V42A 3L1PA 1MD0A 4KICA 1QVUA 2P7CB 2JTVA 3IH2A 2LRDA 1H0MA 3KIOA 4F3QA 1F1ZA 2WA0A 1CF7B 2P0WA 4S04A 2LFBA 2WAQN 3FMQA 2Z9OA 1H9GA 4OMZA 3TOAA 1RI7A 2CUEA 3KYDB 1OKRA 3DPLC 5CXIA 2R5YB 2LR8A 4O6JA 2DA3A 2ETHA 3KKDA 5HNHA 3PJRA 1IW7F 3BR1A 3RKQA 2G7UA 2VBZA 3EYYA 3BR6A 1S6LA 5EEHA 5LEKA 3TBIA 4XKVA 1JUSA 3P7NA 3VOXA 9ANTA 2RAEA 3HBLA 5EGOA 3NS4A 2X6YA 3ZQCA 1RUNA 2RHAA 4CYCA 2ADUA 4HLYA 4UV8A 2K9NA 1X1BA 1XG1A 3N05A 4NNJA 5E8IA 3OYFA 1N25A 2O5RA 3OIQA 2EJRA 4J00A 3KZZA 2E1NA 4XN3A 1R6RA 3CZ6A 4IL6C 2XPVA 2LDUA 4PUSA 3FWEA 1UG0A 2V1NA 2V9KA 1PUFB 3AQTA 3WHBA 2F4OB 2LP0A 4GO1A 4IOAF 2LMDA 5GPCA 5M5XJ 3FXUA 4IHSA 3ZR8X 2PMZA 2A6HF 3E5QA 3JCUC 3T1BA 2A6EF 3SFZA 1R23A 2ZJRF 1GXQA 3HUGB 1MJAA 3IAS2 3KP4A 3K70D 1G3YA 3OSFA 1J59A 2DA7A 2YPRA 1WFXA 3H1CA 3GTGJ 3BTJA 1BI3A 1HCRA 4GYIA 1MH4A 3W2VA 4XRMA 2JN6A 3OWTA 5M5WJ 1AHDP 3ZMUA 5LHIA 5K58A 3OYNA 4M3FA 3BPXA 3FK6A 4X0GA 3WTTC 1S8NA 4D1QA 3GTOJ 4BHPA 2DYRH 5GPAA 5IP9J 3F21A 2KJBA 2UXOA 4L9TA 4AC0A 1JTYA 4A3IJ 3G56A 2M5WA 1W5TA 2DMUA 1V5EA 2G7LA 5GTHC 3BWGA 4A0YA 4FASD 4MFEA 4NBQA 2XKPA 4QIWN 1B72B 4CSWA 1SD7A 3OS0A 4IOCF 2ZO4A 3GTLJ 5D6EA 2MABA 2LY1A 3E97A 5K7HA 2W84A 2CUJA 1B9MA 3BTLA 5IYBJ 4OIPF 1JJ8C 3JTGA 3KCCA 4DYQA 1MMAA 3OYDA 1E3OC 5DM6F 3OS1A 3ANGA 1LEAA 1VTNC 4RGUA 3HRSA 2G7GA 3KLNA 3S2WA 1ZGJA 4P9UA 2P6SA 1JJ6C 3BR2A 2VJ4A 3DTKA 4HLXA 1Y39A 3LOCA 3M8EA 3V78A 2HGCA 3COAC 2CV2A 3U1KA 1Y6IA 3HGGA 4AU7A 5F1JA 3ZN0A 2W00A 1AKHB 3BR5A 1U5TB 3PIPF 5FFXA 4WCGA 3CF5F 3CD6I 2BGCA 1W0UA 3GUDA 4AVZA 5HOOA 2XHKA 2CV1A 3FF5A 3JSOA 5FRMA 2O8XA 4MQVA 5EEGA 1O3QA 3C2GA 3HSEA 3HB9A 5L3GA 4K2EA 2DW4A 3CUOA 2WADA 1G8XA 2JWTA 1HXDA 3K4LA 4L0YB 3QBMA 3V8KA 2XPUA 1Z0XA 2LKPA 5EZGA 3HPGA 4UVBA 5D4RA 3MKYB 2LF7A 4ZDPA 3HIFA 3S16J 4ZZDA 4TV7A 2DODA 2NYXA 1T2KA 4IHXA 2ZXIA 2X51A 5H6RA 4A6EA 2NNYA 1RUOA 1TW2A 1XTAA 5F64A 3CQZJ 3SZGA 1Z3YA 1K6OA 3GWZA 2MGQA 4HOBA 3CC4I 1R00A 1ZRCA 1UG2A 1P2FA 2H6BA 4UVAA 2EB7A 2H27A 4MK6A 1ZG1A 2X48A 3BTIA 4EVIA 4FT8A 2G9WA 1IC8A 2NVXJ 3S14J 1XGMA 2VL8A 2IGNA 1ETWA 2R0QC 1YHQI 2OV7A 2QENA 4ZYDA 2E35A 3BG7A 2WY8Q 3Q0VA 3X2QH 3LSTA 1WSUA 1FOWA 3PNYA 2HPIA 3ABTA 3CTAA 2D45A 4LD5A 3DKYA 2KP6A 3IWFA 1V5FA 4XIDA 5KAFC 1ETXA 2MBFA 2E1CA 3ERMA 3EETA 1IO2A 2NOGA 2CS3A 1NK3P 2B7EA 1WVRA 3ISPA 1YJNI 2EZHA 2F4MB 2X9DA 3ZQFA 4E7JA 4P1WA 2CH0A 5J1RA 2FE3A 3K4CA 1CGPA 1HW1A 2GZWA 2RC4A 2NAZA 1GT0C 5B1BH 1YI2I 1D1AA 2L9NA 5E3NA 4DW6A 4IRHA 4NC6A 3SYTA 2M3AA 1XS9A 3ZMSA 4L5EA 2REKA 3IHUA 1MSEC 4RGSA 3U1DA 2KT0A 4W1UA 1A31A 3GFLA 1YJWI 2NXNB 2IU5A 2OZ6A 3CCYA 3TW6A 2YVEA 1WCMJ 3UNGC 1UJ8A 2DT5A 3W6KB 5BPIA 2EILH 2CQ7A 1BIBA 2DJNA 2HU9A 4EM0B 2GXBA 1WZ2A 1IGNA 1GHCA 3B6AA 1U6GA 2R7UA 5F6FA 3IP4B 1BI0A 4M6VA 1OISA 1Y1WJ 5C4JJ 2JK3A 1SFKA 4A3JJ 2MSYA 4UXNA 3FBIB 5LBQA 3L2CA 2VXZA 3GFMA 1LE8B 3VVZA 1SAUA 3LSMA 4G7OF 1WPKA 1U9NA 2DOFA 2EINH 1IXCA 2Z2SB 5DD8A 2HKOA 2NRAC 2XKOA 4I0AA 1Z05A 2QKLB 4YFNF 1V54H 1W4MA 2QYOA 4HDUA 4Q47A 2IS4A 3B6CA 3HRMA 4F55A 2O7OA 2XB0X 3BG9A 3BP8A 4JL3A 3DWLE 2DFEA 4D7NA 3K2AA 3LSHA 3MCZA 4DNCA 3DBRB 4RAYA 4CDGA 2M2EA 2RQPA 2DA4A 4M9SA 5LLQA 2LH9A 3K4MA 1YE9A 3EDPA 1JT0A 3M3YJ 2RVCA 3TKYA 3LFUA 3HTUA 3E6BA 2OCCH 3P9IA 3RD3A 2A07F 4LG0B 1X4PA 2DFIA 4EGZA 3R0AA 4MTEA 4IJAA 4O5VA 1Z67A 3WTZA 2XSDC 1SVOA 2IS2A 3QKXA 5EEAA 4B47A 3E7LA 3DLLF 3O8GA 4BQOA 3CCJI 5D5VB 1REPC 3CCQI 1VF9A 2NVYJ 3UR3C 3CCEI 4B1RA 3EPZA 3F22A 1JI8A 2EZIA 5M3MJ 1X58A 2V7FA 4XRSA 4BXUA 4EJTA 2OTJI 2PBXA 4B09A 2ZCNA 4HSRA 2ZJQF 2GOXB 5K5QA 4V19K 1LJ9A 4N9HA 5F04A 2XUBA 4H4KC 3H9GA 3H3VK 1ZRDA 2KPMA 5ICFA 4Q48A 1N77A 3HOXJ 3HL2A 3HOVJ 5IOYA 3QYEA 2L7MP 3ABKH 3GEZA 3WU0A 3K70C 1K78B 2IA0A 5A2QZ 5J1YA 2YUSA 3HRUA 4PSXA 2DXIA 2YU3A 3DU5A 2OTLI 3OYHA 2Z16A 2QIBA 3M4OJ 1KGSA 3IKVA 3MZHA 1FC3A 1I5ZA 4A5MA 4DJAA 4BJ6C 1EKEA 3TO6A 2JT1A 1EH6A 2EV6A 4AIHA 4CCNA 4RM3A 2LTPA 4KN4X 1QO0D 4JQFA 1OCCH 3G1OA 4AD9A 2YR2A 1O3TA 4HPQA 1TQIA 1G59A 4XMYA 1OCZH 3DEWA 3DKXA 3HTSB 1MIJA 3SDGA 5FHPA 2E71A 2DO7A 4HQMA 4NC7A 3I4NJ 2K27A 4CCOA 5HS8A 3HRTA 3G6EI 1R7JA 4WXCA 3H3UA 4ON0A 1SMTA 3AL0C 4E7HA 3CRJA 1ON2A 3G1MA 5B3SH 4BY7J 1NK2P 3BJAA 3F72A 1L3LA 3JAMZ 3K7AJ 3R60A 1X3WB 4D5FA 1QHHD 3C3WA 3HG9A 1RETA 4M9ZA 4PGHA 1R58A 1FYKA 2CQXA 3C2BA 5FLVA 1Z91A 2E60A 4ZH4F 3FXRA 1IXSB 1ZELA 1WI3A 4RAFA 2NVQJ 4E7KA 4XKBA 2I10A 2HQ5A 4BHBA 4J01A 2XAJA 5DCFA 3FHZA 2PQ8A 3FXOA 3A0BC 2QZ8A 4LFUA 4UV9A 1YS6A 3SDBA 1G6NA 2V1UA 5BQTA 2DFHA 1XD7A 3IH4A 3E5XA 3EUPA 1T0FC 2BHZA 4A3LJ 3CCUI 3O60A 4EJOA 1LKXA 2EZKA 5DUIA 3HOYJ 1QNTA 2OU2A 4KITB 1U3EM 4A69C 3W2AA 2K3FA 2LYCA 3V7RA 3KETA 2NVUB 1R5ID 3KE2A 2M8GX 3JRFA 2CSOA 1ZARA 2QGUA 1IN5A 4DOZA 1D0ZA 5L3BA 2ISYA 3VYSB 1R4NB 1S3JA 3OYMA 2CW0F 1UMQA 2O9LA 1TQPA 3ZGKA 4XLHA 2HDDA 2X1CA 4LOCA 3EGQA 4ME9A 1RPWA 4A6DA 2GENA 4N9IA 2IVMA 4YELA 3BTCA 3HE0A 1EA3A 5D5WB 1ZG3A 2LBFA 1SFOJ 1JT6A 2HYTA 2F5FA 3KLOA 1ZLKA 2E2JJ 2V6EA 1UI6A 2F5CA 2RDPA 2R5ZB 1FYMA 1OYYA 1BC8C 2CQQA 1QHGA 3F8CA 4U7BA 1XMXA 3J80Z 2JA2A 1ZN2A 2QQBA 4HW0A 1FEXA 3S2HJ 1Z77A 2K9LA 2DDBA 1E2XA 3EUHA 1FIAA 1XSDA 2Y9YA 2VOPA 4E7LA 1OR7C 2O03A 1Z21A 4CYDA 4FE4A 5J8CA 1HBXG 3K2ZA 1W36D 2ZCXA 1BOBA 1IG7A 2XSJC 2F4IA 4JOMA 1GVJA 2A6TA 2ZOYA 4XK4A 1T39A 4CHUA 1KYZA 4IZZA 3M9AA 1W0TA 1D0XA 1NH3A 4CGRA 5DDGA 4ICHA 1UELB 2KZVA 2HOTA 1NG7A 2V6CA 3T8TA 1RNLA 1J2XA 3A02A 4CCMA 2VONA 3LJLA 4YIRX 1DQUA 4HNUA 1FOYA 3K69A 5CVVA 4F91B 2H8RA 1XN7A 1S29A 1BW6A 1P7JA 2R7FA 4CICA 2HI3A 3LQQA 1K4TA 3OL3A 3S3MA 3HIMA 2OI8A 2F07A 4ENMA 3KPHA 4HF2A 1MBHA 3H35A 1OJLA 2CFXA 1IXRC 2VJIA 2L4MA 2XGCA 2AXTC 5DS9A 2BV6A 3VDXA 2HPMA 1E17A 3KZ9A 1FT9A 3I55I 1BW5A 1LB2A 2FRHA 1ZH5A 3OYBA 2DG8A 3MAJA 3EUKL 2G0EA 1BI1A 2YVHA 3FMRA 4NQWA 2QEXI 3E6CC 3AL0B 1X1CA 1EV7A 5FKOA 2BOLA 1H89C 1ETKA 2L4AA 3LSJA 2L01A 4L0ZB 2V9PA 1GXPA 1IRGA 2GUHA 2O61A 4F92B 3CC7I 3LA7A 2AO9A 3R6SA 2QBYA 1IAWA 5IYDJ 2HDWA 2VKVA 3FM3A 4BE2A 3VOEA 1U9OA 4F93B 3DPTA 3Q3SA 2FBIA 4JX5A 5FLXZ 2KIQA 3AFHA 5B1AH 3DKWA 4GFKA 2KQRA 4AIKA 1ZTRA 3P9KA 2M87A 2IGMA 3HKZA 3ZQGA 2VBWA 3KP3A 3MFKA 3UKGA 2H1KA 5H2FC 3PFYA 3PSIA 4KNYA 4LK0F 2WWYA 3GX4X 3K4KA 1GV2A 4IKFA 3BR3A 5DV5A 3S17J 3I4MJ 4M6YA 3PM1A 1VQMI 2KIFA 2ME0A 4B8XA 3SZTA 1TL8A 1Z1DA 4XORA 1B8IA 2WGBA 4V2GA 4HRIA 2DI3A 4JX4A 5JFRA 1K7AA 3AQSA 4UB6C 3DXJF 1JGGA 2K4JA 2E5ZA 3S1MJ 2FA5A 4PK4A 2DT7B 3J7AY 2F48A 3HPHA 1VQ8I 2NNNA 1EJ9A 2EIMH 1AOYA 2DQLA 4L9VA 3GFJA 5D1RA 4I2OA 1TWCJ 2DU9A 3K1NA 5JI6A 1MMNA 4KWAA 1GVDA 5AQCA 3VOKA 1DU0A 2JUGA 2VT3A 1UHWA 2K9QA 1USTA 4R1HA 3V7CA 2GWRA 5LHHA 2XF6A 2X85A 4OWRB 3WG9A 4U9NA 3GVAA 4UUSB 2PLYA 3HSRA 2NS0A 3WU2C 1WH7A 3QU6A 3QYBA 4E4HA 3CDLA 4ETSA 1RKTA 3H5RA 2HKUA 3DFGA 5CW8A 2CW7A 3CUQA 4UB8C 2Y30A 3MEXA 2IEKA 2KRCA 2VE8A 4LGWA 4EMSA 1ZG5A 2QTQA 4XSZF 1G4DA 1P4AA 4XOTA 4D0PA 2JZYA 1EH8A 4M3DA 3IRRA 4DIQA 1ODDA 4HX8A 3HTJA 4HAMA 5E1XA 2X1EA 3O2PE 2ZMEA 3QOEA 3GTKJ 1SANA 4HNTA 1XGSA 2JJ7A 4BQQA 1R71A 4A5NA 4GXOA 2BY3A 3WU1B 3RPUA 1HDPA 4ABZA 4I7HA 3K6GA 3OYKA 5CQEA 1TT0A 4L18B 1LDDA 1P4WA 2CMPA 2ME6A 1HSJA 1WJBA 1BR2A 1YFHA 2M34A 2LSOA 2EV5A 5HODA 5LEJA 2DK5A 1G3TA 3JRAA 2Y0SA 5ILVA 1ZAOA 4FX0A 4B3AA 2ESHA 3OOPA 3K1PA 1WH5A 4U0WA 3CP8A 2QWWA 3G1LA 4OOIA 4AVPA 1IV8A 2Y75A 1KQ9A 4HKUA 3BR0A 2GA1A 3RYRA 3S3OA 4Y4RA 3BLYA 4JYKA 4FHTA 2KKOA 2F5EA 3MN2A 4G7ZF 1I50J 2CUZA 1PYVA 3MQ0A 3ON2A 4HNVA 1SAXA 2V9VA 2AS5F 4XLPF 5ILUA 1XPXA 4XM3A 2QKOA 3BQZA 4U9LA 4RMNA 2LVSA 2H09A 3A0HC 1XCBA 3NAUA 4QSHA 2PN6A 4LLGF 1YRNA 2IT0A 4X6AJ 4RDUA 3RCOA 1WJEA 3PPBA 3B73A 1OQYA 3CC2I 1X1PA 2DBBA 3I71A 2EBIA 5E20A 2JA5J 4O3MA 3BNIA 3M8JA 1S72I 1ACIA 1F4KA 2LKSA 2JSPA 3BG5A 4BEHA 2DYSH 2HWVA 3FM5A 1S5LC 3C07A 2BEOA 1Y1VJ 1ONVA 4IQ4A 2VBXA 4KT6A 4P9FA 2UXUA 3SFIA 1I39A 3ASOH 3CJNA 3KP6A 3V6GA 1UZCA 3GMEA 2LD5A 1SD6A 2IAIA 3PUBA 4XSXF 3U21A 3ZPLA 1D1BA 4R79A 4BUPA 3HHHA 2R7SA 3J7AO 4M3GA 2UXNA 1VNDA 2OQRA 3HDDA 1VQ4I 1E3HA 1VQ6I 5HNFA 4IRIA 2R93J 4HDVA 4KN7X 3FMSA 3A4CA 1B4AA 3DEEA 1T98A 4LJZF 4XL9A 4ENNA 2M4KA 1YTYA 4Y15A 3CLQA 3G7RA 2XAFA 4MNUA 2BHYA 2EIJH 2HYGD 1VQNI 3VIBA 2DCEA 3VYTB 2IS1A 6PAXA 4EM1A 1W7PA 1MSFC 4WXDA 4ACIA 3GTMJ 2DOAA 3HOUJ 3EUAA 2JRTA 4GYGA 4HYEA 1IJWC 2PFBA 2R7OA 2VC1A 4A3EJ 2X0LA 2EA4A 2GIZA 5HLIA 3TP0A 3L2WA 1W36C 2AXLA 5J6XA 2QSFX 3ZRGA 1CF7A 2L7ZA 3ROUA 1YJ9I 2DT6A 1DP7P 1GUUA 1O3SA 5FGLA 1Q1HA 3I54A 2P5KA 4S05A 4LLNA 2JSCA 2R5YA 2DMTA 2CGPA 1SGMA 3DLAA 2YX4A 3GTPJ 4DBRA 3CCRI 3G71I 3QODA 3NXCA 2Y0MA 3CJRB 1P6RA 5M3FJ 3DPJA 3L2QA 2JA6J 4BKXA 5F27A 4C2UA 2O7TA 3WTVC 4B3XA 2ZSHB 4DYCA 1R4MB 1SVLA 3U9GA 1SD4A 2XDNA 4AM3A 1NG6A 1UB9A 2VQGA 3KYCB 1ETVA 2MYSA 1TBXA 1Z7UA 1D0YA 3A1YA 1IRZA 2FSWA 1BR4A 5FB2A 2BVLA 4M71A 1I27A 4KIFA 4OINF 1EF4A 1FNNA 3RPQA 4ZJZA 3TEDA 3VVXA 4XN0A 3ZXSA 1YLFA 2R7WA 3J7ZI 3BHQA 2L0KA 1VFCA 1PUFA 1BOAA 4I99C 1DPRA 3IUOA 3A01B 3LAJA 3Q0UA 1U78A 1XCVA 2B0LA 2VASA 1T33A 1FSEA 2XVCA 3LSRA 5DCMA 2JQ7A 4U7DA 3HUGA 2LKXA 1FX7A 3D0SA 1ULYA 5CKTA 1MBEA 3IRQA 3GO5A 4W97A 4NUBA 2DTRA 4EJVA 4BGDA 1YW7A 3GBGA 1PP7U 2FJI1 1TWAJ 1XMKA 3CP2A 2DDAA 2FNAA 2PX9A 4PZJA 4KMUX 2A2FX 4U87A 3ON4A 2KIUA 3L09A 2TCTA 2W25A 1PP8F 1QA6A 1FBQA 4IPAA 4L9NA 2XGXA 4IRVA 3DPUA 1JTXA 2XIGA 4I98B 4IXAA 2PEXA 1FJLA 2JMWA 1TWHJ 2DA1A 1XGOA 3Q9SA 1B72A 3VW1A 2L3DA 1G2HA 2VI6A 4IX7A 3QPTA 4XOPA 2J5PA 1ZYRF 1AA7A 4AYBN 2B9SA 1TZLA 3BQYA 3HXLA 2HTSA 4PJJA 1T08B 3ZQLA 1XSVA 4N0BA 2WC2A 4KA4A 1IDYA 5GAEJ 3FDYA 3VYUB 4RB2C 3F8FA 3FISA 2Z1DA 4ZC3A 2HVQA 2HEOA 3ZMDA 1FBUA 3I0TA 5E8GA 1VQ9I 1MDMB 1OPCA 1RR8C 3ABLH 3NNRA 3GZ5A 1AKHA 2WY7Q 1U5TA 4YRVA 2IP2A 2ZNZA 4M73A 1IN4A 4ANJA 4XKWA 3J81K 1GDTA 5IY5H 3E6DA 3FX3A 1TWFJ 2TDXA 3R61A 4ZTFA 2DTZA 1APLC 3BG6A 1SFXA 1FOKA 2DA2A 4XICA 1D5YA 1MH3A 3LWFA 1LVAA 1BJZA 1JHHA 1TLHB 5FKLA 3A2KA 3FXMA 5BOXA 2W48A 5LD2C 1FOXA 2E2IJ 4MTDA 3M8FA 2ZXHA 2Q1ZB 3H36A 4ZDLA 3SXYA 1WHUA 1XDUA 2GBYA 5C4YA 1LEBA 2VKDA 5ILSA 5IP6A 4WWCA 2R7XA 2HOEA 3OYIA 4FCYA 2OZUA 4CH7A 5EZHA 2HQRA 3KZYA 3FK7A 2PZ9A 3OS2A 2IRFG 4LIUA 2WBMA 1Q1VA 2EZLA 2XF5A 1EH7A 4EEFG 2R7VA 2WB1A 5EG0B 2QCOA 4WF2A 2UZKA 4G12A 4D9JA 2VPLA 3KP5A 3PNTA 1I1SA 3I5UA 4AC6A 4BNCA 2R7ZJ 3I59B 4RB0A 3NRVA 1WRJA 2KDZA 2ECBA 4XLCA 1A04A 3LWJA 1IUFA 5IT9K 4D7MA 3E7QA 1Z6RA 2P6TA 4C3HJ 2IJLA 2BY1A 2NS8A 1IRFA 2STTA 4A3BJ 3WGIA 2PMUA 2LK2A 4E70A 2D5VA 3CO6C 2WUIA 1KQ0A 3G2BA 3MD2A 1LUJB 3COLA 3KEQA 5HS9A 5KK1A 2FJ1A 1S7AA 3I58A 1YX5A 3Q5FA 3ABUA 3MMYB 1CQTA 1WQ2A 4HX4A 2ACJA 1FP2A 2KFDA 4HA8A 3RSNA 1T95A 2OF7A 3QYFA 2QWTA 4XQFA 2DN0A 3WTXC 5K1YA 3C2HA 3MZYA 4FQGA 4YIIA 2ZC2A 2E1MC 3VB2A 4Q4ZF 2GFNA 3M7GA 4PJMA 4EV0A 4QPOA 4AIDA 4IRGA 3F6VA 4NELA 2Y31A 2K9SA 2ZCMA 3FZVA 4II2A 2E7WA 2HVSA 2JPBA 3SEZA 4XONA 4LB6B 3EYIA 2Z3YA 3E1SA 5HDKA 3G73A 5J8FA 2XAUA 4LITA 5HVQC 5D5XB 2CWEA 4LIVA 1MZBA 1LDKB 5JHUA 1RKWA 1LE8A 2UV1A 4BQNA 4C3IJ 4P5OA 2QSHX 2FOWA 1Z7LA 1R5GA 3JSPA 3PASA 4RA2A 3S5RA 2KLOA 3MKZA 1QU3A 4A3MJ 1ENHA 1LFPA 3LFKA 2RN7A 3GYHX 2ISZA 2OERA 5E17F 1I6HJ 5GAGJ 3BT9A 2EFNA 1ZLJA 2ELKA 2HOAA 4FETA 5CVJA 4IHTA 1YW9A 3VUQA 4A3GJ 2YS9A 3CCLI 5FD6A 3WTUC 5FFZA 3QP6A 1KYWA 1QPMA 3CDHA 3VODA 4DBQA 5ICCA 3WGHA 4C9YA 5CXGA 4IHYA 3I9V2 4P55A 2M30A 4E7IA 4JKZA 5JLXA 4CCKA 2F5VA 3LA3A 2ZY9A 3PO2J 4LLLA 3NARA 4AF5A 3ECOA 1OCPA 4G6TB 5F0FA 4MHGA 4ESFA 2IW5A 1G3SA 1VQ5I 4NQWB 2E7XA 1QZZA 1DGWY 2BW3B 4LG0A 1HC8A 2VJ5A 3OV8A 4ITVA 1RR7A 4C30A 1AU7A 1MMGA 2STWA 2EFWA 5K5OA 1VQPI 3ZN1A 4BACA 1VI0A 1W5CC 1HW2A 2L54A 1F43A 3NWSA 4RAZA 2A05A 1BI2A 2P5VA 3TP3A 2IA2A 3GLLA 4KISA 3O8HA 3GLXA 2ZKZA 4MO7A 2HR3A 4DVYP 3OR2C 2VLAA 3F9KA 2DPUA 4E7SA 2M4GA 4BHCA 3JRIA 3IAM2 4UUTA 2VXDA 2CQNA 3HJEA 2COMA 2ECCA 3V4GA 3FXQA 4BAYA 2Q2EB 4HSTA 1IN8A 2B1EA 3QAHA 2V57A 2EA2A 3VW2A 1F9NA 1HF0A 4OAZA 3VWBA 4A3KJ 5EF6A 2H8WA 4QLCU 1K78A 4IHVA 3K4BA 1RESA 3HEFA 2G7SA 4PDKA 3TQNA 3BCAA 2W4SA 3WTWC 2XV4S 5J3LA 1LQ1A 4BS9A 2HXOA 2ID3A 2EFOA 3TMOA 1E0EA 1K61A 1V3FA 3QP5A 2FXAA 4HX7A 3N97A 1V5GA 4HV5A 1YQAA 5JHFA 2RGVA 1A36A 3ZOBA 1MKMA 3CLOA 4JK1X 2EH3A 1BA5A 2PJRB 4OIOF 1OYWA 1YX3A 2DJIA 2KHMA 4UDSA 4HF0A 2EFPA 3DBHB 3FKJA 5EYRA 3SEQA 4ESBA 1JHFA 3ZMTA 5DM7F 5ED4A 1R1TA 2YX7A 2E1MB 4M6XA 2FMYA 2NX4A 2LY2A 2EV0A 4XLFA 3RZOJ 3KKCA 3CUQB 3ELKA 1PVEA 2FBKA 3M1CA 2IXSA 1P7IA 2KRHA 1VQOI 2K86A 3HKZN 3CMYA 3HOTA 4WIBA 4ZZLA 2G7HA 1BBYA 4JNNA 1R49A 1YYVA 3W6JB 3CCMI 2ICWG 2UXXA 2KISA 2A68F 2ZMEB 1TC3C 5BNGA 4UHTA 5KNLA 1Z6TA 1KU9A 1UFMA 3GW2A 2FQ3A 3PL8A 3HOWJ 2Z99A 2DMQA 2OCEA 2W24A 2ZB9A 4RLQA 3OIPA 5DTDA 3BDDA 3D5SC 3KP7A 2XASA 3ULQB 4B4CA 5HLGA 1ZREA 3S1QJ 2E1OA 5EGOB 4RB3C 1FMWA 4C3JJ 2UXHA 4G8XA 4I6ZA 5CVUA 4OMYA 2MA3A 1XC5A 2L2OA 4PFOA 4PSWA 4CYCB 1C0WA 2B63J 3D5LA 5HLTA 5LGUA 1OCRH 3W3CA 1UI5A 1HKQA 3BJ6A 2QOPA 4KIBA 5HDGA 3F1BA 2UXPA 1I3AA 1IUYA 4QWQA 5L3EA 2PJPA 4G6QA 4F52A 1UHSA 2M8EA 1B9NA 1X19A 2DOEA 5FLMJ 3S1NJ 1UHMA 4CGZA 3OY9A 3OSGA 4EM2A 2ELHA 4CZCA 2MLKA 4U0YA 2VUMJ 3VEPA 2GA2A 5IPAA 5K7ZA 3IKTA 2IA1A 4P96A 2CU7A 3HGYA 5J1UA 1K83J 4GCKA 3QPSA 3QRFF 1QZEA 2OBPA 3FXLA 2VPRA 3BRUA 2R5ZA 2F5DA 1TNSA 3B02A 5TGTA 4AWXB 1FYLA 1H88C 2NP5A 4IF4A 2MD0A 3QPLA 3ANPA 2HOSA 2FEZA 1TP4A 2A3SA 2E34A 3A03A 2W53A 3NI7A 2HYJA 3L7WA 3W6VA 1MBFA 1J0RA 3WE3A 5E3LA 2K3PA 3ZMVA 1XSXA 1P92A 2BBYA 2Y0SN 1U8BA 4ENKA 2QM3A 1U2WA 1IRXA 1ETOA 3BY6A 5J47A 5FLXK 3BROA 2Y69H 5E3OA 2BZTA 1K6YA 2Y9ZA 2O6GE 1YIJI 2E36A 5LFAA 2GM4A 4BQAA 3IWZA 1MGTA 2FMLA 5GADJ 2HFHA 3OR1C 3QU3A 2A61A 5B66C 1XGNA 2E19A 1MNEA 3ZQ7A 1PDNC 3AG2H 4Y13A 3RJPA 2KMUA 2MC4A 3HHGA 2QSGX 3E5UA 4HQEA 3LSKA 1P4XA 2R7DA 4XRFA 4GCLA 1FY7A 2R3SA 1YG2A 2IS6A 4GRIA 1R22A 4HZFA 5F08A 3V8JA 3OOUA 4BL0B 4I02A 3GZNB 2PMZN 3DCFA 3BCGA 3HTIA 1MBJA 4BDYA 4YIFA 4JX6A 4Y52J 2DG7A 4G7HF 5HS7A 3QPHA 4JP0A 2B3WA 2GIVA 3RQ4A 4FE7A 3BJOA 2H6CA 3P9CA 1W5SA 2X4HA 1BJAA 2QVOA 3PSFA 4KT5C 4NB5A 4Z2YA 1IF1A 3PQKA 3R0JA 5J40A 3K0LA 4PXIA 5HLHA 2JVHA 2E5NA 2G3BA 4HV6A 2K40A 2WAEA 2C6YA 4L5IA 4MQ9F 3ONQA 2TRTA 1BIAA 4HF1A 1LVKA 1BM9A 4I09A 2GQQA 4BE1A 1DDNA 5JLWA 4N4NB 2MH2A 5FGMA 3ML6A 3IV5A 5GP9A 2M0CA 2BVMA 5F0CA 1WI9A 3O6BB 3TL4X 4EJUA 2QKMB 2RNGA 1QVTA 1Z3XA 1FTZA 3VPRA 3BC8A 5ERIA 2K7LA 3CMMA 3CCSI 1R36A 2J5OA 4RGXA 3HTAA 3F8NA 2KJCA 5K7FA 3N4MA 3I56I 1TT5B 3VFZA 4YG2F 2WAQA 2DPDA 2HZDA 5GTIC 5L3FA 5L3DA 1TWGJ 2Y2ZA 3RKYA 4CA0A 4MEYF 1VZ0A 1GLNA 2M9HA 1HLVA 1P9QC 1T0FA 1QZYA 1OMIA 3C18A 3FBNB 3MNLA 1KU3A 2Q0OA 5DCMB 3ZQQA 3VW0A 1POGA 1JUMA 3CO7C 1T6SA 3LQRA 4OIRF 2VQHA 1S7EA 3HM5A 4PJNA 1O57A 4E7ZA 3DU6A 3LA2A 4AUXA 4ESJA 2ZFWA 3IH3A 2DMPA 3TW7A 1F5TA 5FKMA 2L9RA 2HDCA 4OIQF 3PO3J 1K4SA 4C2MA 1ZK8A 3NRGA 1WWXA 2CYYA 3RH2A 1HKSA 4WXHA 4XBFA 2HZTA 3RPUD 3U2RA 4OD5A 4G6DA 5DEQA 4ZYAA 2VBYA 2YSRA 1T56A 1KQ8A 3HOZJ 3CF2A 4Q5SF 2A69F 2QQ8A 4NN1A 1FZPB 1ORKA 3H5NA 3RTRA 4ZYEA 3TDUC 3T0YA 2BY0A 3QWLA 4UUSA 1KU2A 1ZKGA 4I01A 3RZDJ 4KIGA 1H9TA 1QBJA 2O8KA 3OMYA 2VQLA 2DA6A 1J75A 4CUGA 4XLAA 3KZIC 5KCMA 2R7RA 3BG3A 3TDZC 5D8LB 4DGWB 1DUXC 2ZCWA 3M07A 4MIMA 3S3NA 3CCVI 3F23A 4BXFA 1OR7A 4ENJA 1A6QA 2EPFA 4HBLA 2XAQA 1Y8RB 3KP2A 4YEJA 2P4WA 1XB4A 3CMEI 1JGSA 1FBSA 2VOOA 2CW8A 1R1VA 4PFPA 4M3BA 4WK8F 1T38A 2XROA 3WE2A 5FKNA 1ON1A 1X1DA 2GOMA 3CESA 5CLSA 1MBGA 2ZJPF 4YFKF 4KDPA 3WTSC 4M72A 4B43A 1R9TJ 1HKTA 3ZMZA 3GTJJ 4DZJA 3H5AA 1SMYF 3RDIA 2VE9A 2MD5A 2OUMA 1ZRFA 4V2FA 1QRYA 5J4YA 2N8GA 4M9XA 4G94A 3CJQB 4A0XA 1HA8A 2EQRA 4BXXJ 4L5JA 4Y17A 4PJ0C 1A6IA 3F8BA 5F1RA 2IGOA 4Y7NJ 4U88A 4JBAA 5FJ8J 3O3KA 1KA8A 1X3ZB 2EIKH 1NTCA 3DTIA 2K4BA 3CJTB 3EQLF 1MJBA 5FD5A 5C3EJ 3K10A 3V8LA 1SC7A 4GDFA 3BOQA 5L3CA 5JVTA 3WG7H 4RM2A 2L02A 1PJRA 4CXFA 3JRBA 5BMZA 5H6QA 4S0HB 1IV6A 1UAAA 4GCTA 5DYMA 1L0OC 4GCVA 2LG4A 3J7YJ 2JA8J 2ZBKA 2FQ4A 3BZKA 3L00A 3AAFA 2QQAA 1YITI 5D19A 2LY9A 4QPQA 2Q8KA 1X1AA 3C7JA 3TGNA 3OYAA 2KDOA 3LMMA 2M1BA 3K1MA 4LMYA 3P9TA 3T6NA 4ZYHA 2IBDA 1W7PD 2RASA 3DQVC 1OCTC 1YIOA 3ZCOA 3B81A 4EATA 5GAHJ 3EUHC 2OJED 2V1DA 4YZEA 2DMNA 1A35A 5HAWA 3H0DA 2FOKA 3S32A 1MMDA 1V4RA 1WGXA 5CVRA 3V7SA 1STZA 1RC9A 1JKRC 4UVCA 2KRFA 3DP7A 2L7KA 3G3ZA 2QF7A 3DBLB 4A12A 3CDIA 3VSKA 1USSA 3PQJA 3MWMA 5ICGA 4HG2A 4J19A 3BPVA 5HDNA 3RQIA 1I1GA 3J81Z 3GFIA 2BE5F 4EJWA 1M1EB 5J4VA 2DK8A 2JPCA 3KFWX 3ZQIA 3S8PA 2WV1A 2CFOA 2Z5UA 3T5XA 3RYPA 3SWHA 2VJJA 2JUCA 1H8AC 2XDVA 3K8PC 1YOVB 1VQKI 2RNJA 2HQAA 4KJZA 1FTTA 3PNVA 1OFCX 2RQQA 3AG1H 4L62A 2FNPA 4BBRJ 1O7FA 1JUPA 4RGRA 1WJ5A 3HC7A 2GXGA 2WB1N 4RS8A 5D4SA 3GEUA 2PG4A 5HBUA 3H9QA 2R7TA 1DP3A 1A5JA 3FHNA 1TW3A 4M3EA 5CPRB 3ABMH 3F6OA 4LK1F 3OYLA 3GZ6A 4MXMA 4FX4A 1MJ9A 5B5EC 3OL4A 2LOOA 4XR6A 1JE8A 3SJMA 1WJCA 4XRSG 2BY2A 2X6WA 3SZPA 2X6OA 2VN2A 1K79A 4PJLA 2P8TA 1SD5A 1WJAA 1PUEE 1SEUA 4M74A 4BBSJ 1N78A 2FD5A 3HSFA 5IT9Z 4XNFA 3QOPA 2WTEA 3RKXA 2KL4A 3OYEA 3WHCA 3L2VA 5JVGF 1DPUA 3F3XA 1OCOH 2LLKA 4ZYGA 4BE0A 2GLOA 5C44J 4DQ2A 3PIOF 4AYBA 5E1WA 4II3A 3HTHA 5FKKA 3W2WA 2D6YA 3REOA 1S9HA 3L2RA 3BJBA 4CZZA 2FBQA 5DUKA 4CO8A 3GZIA 3NPIA 2XRNA 1LDJA 4IQJA 3ESWB 1Y56A 3F8MA 3A01A 4RB1A 2GXAA 2NS7A 4LG3A 3R4KA 5E18F 3JRHA 2H94A 1D3YA 4XLNF 1IZ1A 3VVYA 2LREA 2D2WA 3P5JA 1FP1D 2M45A 2RV8A 1D8KA 1E3PA 1IN7A 4EQQA 3LSPA 1D5VA 2CG4A 3LL7A 4BH9A 2MLGA 4IEJA 3QQAA 4BJ5C 3CWRA 1N75A 3KEYA 1J9IA 2LBFB 3Q0WA 2LNBA 2O3FA 2W82A 3FKIJ 4DZPA 2AQEA 5EDNA 2JVGA 5TRDA 3JRGA 1QGPA 2NOJB 3DF8A 3CUQC 5E3MA 3I4PA 2L9SA 5AIQA 3KEOA 3S2DJ 2RKHA 2HYFA 4PGGA 3K9TA 3MKWB 2PI0A 4RAGA 4FTHA 2QQ9A 3FRQA 5E79C 2I8DA 2V79A 1IN6A 2ZMEC 3FXJA 1KU7A 1U0JA 1FPQA 3C1DA 4F7ZA 5C4XJ 1YW8A 3ASNH 3BZCA 3AG4H 1B1BA 3K4JA 1ITYA 2F6CA 3OYGA 2MH9A 3F0CA 4RBOA 2LF8A 2DLLA 3GXOA 4IO9F 2CV0A 4C2TA 1MDMA 3DEUA 1Y8QB 2X6XA 1QQIA 3WGGA 4A2UA 4NDLA 1HSTA 3VSLA 3CMAI 4A93J 1X4OA 4H0EA 2W57A 2QUFA 4BYYA 2YVXA 5LRRA 1LNWA 3LSGA 2L9VA 5CYVA 5A2QK 4L9JA 4Y33A 4B48A 1HW5A 4CCLA 1QPIA 3MKLA 4I0BA 1DU6A 2UXIA 1BR1A 2P5LC 2JRMA 2VB6A 2XGEA 2DA5A 3MZ8A 2ZXJA 3H92A 2EK5A 1BN5A 2ZOZA 4YFXF 3NQOA 2OD5A 2V26A 3FXKA 1JKPC 4OAYA 2HNHA 2FUG2 3RIRA 1TQMA 2ZFUA 3I3LA 2NVTJ 2PBIA 1W1WE 3BZ6A 1RIOH 3MVPA 5CQGA 1JXSA 1LFBA 2IPQX 5D18A 2OC6A 2XAGA 5EJCA 3IUVA 1J09A 2COBA 2P7VB 1FMVA 1TTYA 3D5RC 2HTJA 3GF2A 3ECHA 1SVMA 2IGKA 2O0YA 3NWTA 4RLFA 2DAOA 5EG0A 2QBYB 2QLZA 2W85A 3T8RA 3JREA 1MNDA 5D8KB 2M0MA 4G9YA 5M5YJ 3G4SI 5FRNA 3HYIA 5D5UB 3JAMK 3I59A 4FISA 1MNMC 4UUVA 1SFEA 2BXYA 2R4GA 3JRCA 2OAZA 1Y0NA 2BYVE 2K5CA 2XAHA 4BU2A 3D1NI 1MMSA 1AWCA 5DD4A 5CVIA 1HQCA 1J5YA 2XRLA 5CJ9A 5ICEA 2XPWA 1F36A 3PFIA 4U0VA 1S7OA 3WODF 3E3VA 1X3UA 1BL0A 1DGRM 5AONA 1D1CA 5HSZA 5AIPA 3L9FA 1B8IB 2CJJA 3VP5A 1O7LA 5KHDA 1XX5A 4BDZA 4KFCA 5D6FA 2AQFA 2LC2A 2XB5A 1B59A 5EFYA 3WTYC 5BPDA 3L2UA 3OYJA 4AIJA 1LFUP 1JKOC 1ZQ3P 4CCJA 1JKQC 2W1OA 3HOSA 3JW4A 3H3ZA 1ERDA 5H9TA 1RZ4A 1SFUA 2R7QA 3K4NA 3LNQA 1B6AA 3PUFA 5LHGA 2D1VA 2VIXA 3GTQJ 2AHQA 2Z33A 3Q9VA 1J7KA 3GCMA 4IVNA 5BS6A 3KX2A 4DYRA 4A3FJ 4D5CA 2JA7J 2VODA 2M7AA 4HEA2 1G3WA 2HVRA 4IHWA 4BY1J 1D8JA 3KNWA 2I5UA 4XKCA 5LGTA 2ZJ2A 3S93A 5LGNA 1MBKA 2P81A 2BXZA 1RRJA 1ZHFA 5FMPA 1YO5C 2CUFA 1X2NA 3AG3H 2F2EA 3OIOA 3HZJA 4MLOA 1GV5A 2K85A 4MGRA 5IP7J 3J80K 3H9JA 1BC7C 3S1RJ 3I64A 4A3CJ 2VQCA 3I53A 5KAIC 1LPQA 2XGDA 4NC8A 2HKXA 2ZSIB 3NEUA 4XLEA 2PFVA 4KUMA 2CRGA 1UCRA 3M1EA 2FU4A 1T8IA 1FSHA 2PMHA 3H0GJ 5IT3A 4E6KG 4LB5A 2EFQA 4C2MJ 2X1DA 1FIPA 4GFLA 5K5RA 4Y3OA 2RREA 2DQRA 1ZR4A 4Z6YA 4PCQA 4GFBA 5H20A 3CJDA 2MFZA 1Z9CA 3JRDA 1FWZA 2OA4A 4ASNA 1MW7A 2KZGA 2ZXWH 3ZQHA 3JSJA 5IOZA 2OQGA 2L5QA 3SHFA 2BW3A 5TISC 4R8HA 2A5YB 2OPTA 1I3QJ 4BJTA 4KYWA 5DAJA 4A0ZA 2V4JC 1VQLI 2EWNA 2MG4A 4NHJA 2GAUA 4A3DJ 4OU0A 2FX0A 5LRSA 4QTRA 2VT2A 1WKMA 3SQNA 1ZGAA 2ZNYA 1OYIA 1YRNB 2HS5A 5E1ZB 5TJJA 5IYCJ 2XF7A 4ZDOA 2VKHA 3DV8A 2M7BA 1R5HA 2MW8A 3E0JB 2HQNA 3E6MA 3VYRB 2UUZA 1O3RA 1FLIA 3KYLA 3RKWA 3ERED 5FROA 1IDZA 4MEXF 3IL2A 4N4OB 1U8RA 4UY8I 4OD4A 4GGGA 3LHQA 4BEHB 1XDSA 2K02A 2Q2EA 1O4XA 2FF4A 2D1HA 2HXIA 2KIMA 3TOBA 2ID6A 3IC7A 3RI4A 1ETQA 2VC0A 4EGYA 3ZP5A 4I76A 3FIWA 1OLTA 3TO7A 3BCBA 1I6XA 4MFDA 1Y0UA 1WJDA 2L7FP 2DFFA 1NHAA 5FO5A 4WX9A 2WAFA 4ZTJA 4X1EA 4UNOA 2Q24A 1YS7A 2H1LA 3TO9A 1XMAA 3OYCA 1VQ7I
chains in the Genus database with same CATH topology
1HDDC 2YU9J 5EZHA 2HDDA 3FK7A 4LOCA 2PZ9A 3EGQA 4ME9A 3S15J 2NP3A 1RPWA 4M3BA 2GENA 2E2HJ 1Q1VA 1ZGWA 3BTCA 2EZLA 3HE0A 5FKNA 2VKEA 1SFOJ 1MBGA 1JT6A 2HYTA 1UI6A 4EEFG 2E2JJ 5EG0B 2QCOA 1ETYA 4G12A 1R9TJ 3GTJJ 1X2MA 2R5ZB 1HOMA 4DZJA 2CQQA 2R92J 4AC6A 2R7ZJ 5F0HA 3JR9A 1FEXA 4V2FA 2KDZA 3S2HJ 1QRYA 1Z77A 1ZR2A 2ECBA 3L1PA 2N8GA 3LWJA 1IUFA 3E7QA 1QVUA 4D7MA 3IH2A 1FIAA 2NS8A 4C3HJ 2Y9YA 2EQRA 4BXXJ 1A6IA 4A3BJ 2LFBA 2WAQN 4Y7NJ 2LK2A 4FE4A 2D5VA 2WUIA 1IG7A 2ZCXA 5FJ8J 2CUEA 3COLA 1NTCA 5C3EJ 2ZOYA 4XK4A 5CXIA 2R5YB 2FJ1A 1W0TA 3JRBA 4CGRA 4ICHA 2LR8A 1CQTA 4S0HB 1IV6A 4GCTA 2DA3A 2HOTA 3KKDA 2JA8J 3BR1A 3RKQA 2FQ4A 3A02A 3LJLA 5D19A 2LY9A 2OF7A 3BR6A 2QWTA 2DN0A 2H8RA 2GFNA 1JUSA 3P9TA 3T6NA 2IBDA 2RASA 3VOXA 1BW6A 1P7JA 2RAEA 3HBLA 5EGOA 2HI3A 1OCTC 9ANTA 3B81A 3ZQCA 2RHAA 4CYCA 4NELA 2Y31A 2K9SA 2ZCMA 4YZEA 2DMNA 5HAWA 3HIMA 2K9NA 1XG1A 2OI8A 2F07A 1WGXA 1MBHA 1JKRC 1OJLA 2QF7A 2XPVA 2XGCA 5DS9A 3KZ9A 1PUFB 3AQTA 1BW5A 3WHBA 1LE8A 1RKWA 4J19A 2DG8A 2LP0A 2G0EA 3RQIA 2YVHA 5GPCA 4C3IJ 5M5XJ 3PASA 3S5RA 5FKOA 1H89C 3ZQIA 1ENHA 1ETKA 3LSJA 4A3MJ 2WV1A 2GUHA 3OSFA 1H8AC 2DA7A 2AO9A 2OERA 5IYDJ 1I6HJ 3GTGJ 3BTJA 2VKVA 1HCRA 3BT9A 2HOAA 2ELKA 1MH4A 4XRMA 1FTTA 2JN6A 5M5WJ 3VUQA 4A3GJ 2YS9A 5K58A 1U9OA 4M3FA 3FK6A 1OFCX 3Q3SA 4L62A 4JX5A 3GTOJ 4BBRJ 1JUPA 5GPAA 5IP9J 2UXOA 4GFKA 4A3IJ 4AC0A 1JTYA 3G56A 2WB1N 1ZTRA 5CXGA 4IHYA 3GEUA 3ZQGA 3UKGA 5HBUA 2DMUA 2H1KA 2G7LA 4JKZA 5JLXA 1A5JA 4MFEA 4QIWN 1B72B 1GV2A 3PO2J 3BR3A 4M3EA 3NARA 2O9LA 3S17J 4MXMA 4AF5A 5F0FA 1OCPA 3GTLJ 3I4MJ 3PM1A 5K7HA 2ME0A 1RR7A 3SJMA 4XRSG 3BTLA 5IYBJ 1AU7A 1B8IA 2WGBA 2X6OA 4V2GA 1JJ8C 3AQSA 4JX4A 4DYQA 1E3OC 3ANGA 1JGGA 1VI0A 3S1MJ 4BBSJ 1F43A 2FD5A 2G7GA 3TP3A 3WHCA 1JJ6C 3BR2A 3O8HA 5D1RA 4MO7A 3LOCA 3V78A 2LLKA 3HGGA 1TWCJ 2GLOA 5F1JA 5C44J 1AKHB 4KWAA 1GVDA 3BR5A 5AQCA 3VOKA 1DU0A 1W0UA 2K9QA 3JRIA 3HTHA 5FKKA 2D6YA 4UUTA 3BJBA 2ECCA 2FBQA 4UUSB 3GZIA 3HB9A 2V57A 1WH7A 3NPIA 3CDLA 3VW2A 2JWTA 1RKTA 1HF0A 2HKUA 3QBMA 5CW8A 2XPUA 3A01A 4A3KJ 5EF6A 2Y30A 1Z0XA 2NS7A 5EZGA 2IEKA 4IHVA 1RESA 3JRHA 3HEFA 2G7SA 3VVYA 2QTQA 3S16J 5J3LA 4M3DA 3HTJA 4IHXA 2HXOA 3GTKJ 1SANA 3CQZJ 2ID3A 2JJ7A 1K61A 2MGQA 3LSPA 4IEJA 3QQAA 3CWRA 3ZOBA 1HDPA 1UG2A 4ABZA 2EH3A 1BA5A 4MK6A 2X48A 3Q0WA 3BTIA 3FKIJ 4DZPA 2ME6A 4UDSA 5EDNA 1IC8A 2NVXJ 2M34A 5EYRA 3S14J 5HODA 3JRAA 3JRGA 1ETWA 5E3MA 2R0QC 4B3AA 2NX4A 3Q0VA 3S2DJ 1WH5A 3RZOJ 3KKCA 3G1LA 4FTHA 3FRQA 1P7IA 4HKUA 3BR0A 3CMYA 3HKZN 4JYKA 4JNNA 3MN2A 4XIDA 1I50J 5C4XJ 1ETXA 3ON2A 4HNVA 1TC3C 5BNGA 2NOGA 2QKOA 3BQZA 2LVSA 4QSHA 3NAUA 1NK3P 1ITYA 3F0CA 4RBOA 2EZHA 2X9DA 1YRNA 3ZQFA 4X6AJ 4RDUA 5J1RA 3PPBA 4NDLA 1GT0C 3HOWJ 4A93J 2DMQA 2JA5J 5E3NA 2EBIA 2ZB9A 4DW6A 4B4CA 5DTDA 1XS9A 3S1QJ 3BNIA 3LSGA 4L5EA 2E1OA 2REKA 5EGOB 3BG5A 4C3JJ 1MSEC 2UXHA 1QPIA 2UXIA 4I6ZA 2KT0A 4W1UA 1DU6A 3MKLA 1XC5A 4CYCB 2B63J 2IU5A 3C07A 3CCYA 2XGEA 1Y1VJ 2DA5A 3TW6A 2YVEA 1WCMJ 1UI5A 2ZOZA 2UXUA 2QOPA 2DJNA 3SFIA 1IGNA 3F1BA 2UXPA 3B6AA 3V6GA 2LD5A 1JKPC 2IAIA 1UHSA 4M6VA 5FLMJ 1Y1WJ 5C4JJ 2JK3A 2NVTJ 3S1NJ 3MVPA 4M3GA 1VNDA 3HDDA 4A3JJ 2MSYA 1LFBA 1LE8B 3VVZA 5D18A 2R93J 1WPKA 1U9NA 3OSGA 3IUVA 2COBA 2VUMJ 3G7RA 5K7ZA 5IPAA 3VIBA 2CU7A 3HGYA 5J1UA 1K83J 4GCKA 3QPSA 5EG0A 1MSFC 4ACIA 3GTMJ 3B6CA 3HOUJ 2O7OA 2VPRA 3JREA 3BRUA 2R5ZA 5M5YJ 2XB0X 3BG9A 4JL3A 1IJWC 1H88C 2NP5A 4FISA 1MNMC 3QPLA 4D7NA 3K2AA 4A3EJ 2HOSA 3ANPA 3A03A 3NI7A 2W53A 3TP0A 3JRCA 2HYJA 3W6VA 1MBFA 2M2EA 2DA4A 5E3LA 3D1NI 2L7ZA 2Y0SN 1U8BA 1JT0A 2XRLA 1GUUA 3M3YJ 2XPWA 1ETOA 5FGLA 1F36A 5E3OA 2R5YA 2DMTA 2Y9ZA 1SGMA 1BL0A 3RD3A 2GM4A 3GTPJ 5HSZA 1B8IB 2CJJA 3VP5A 3NXCA 2E19A 2XSDC 5M3FJ 3DPJA 2XB5A 2JA6J 5EFYA 4BKXA 5F27A 2O7TA 3QKXA 5EEAA 3E7LA 4DYCA 4GCLA 1LFUP 1JKOC 3O8GA 1ZQ3P 2XDNA 1JKQC 5H9TA 5F08A 3OOUA 1VF9A 2NVYJ 2PMZN 4B1RA 3DCFA 3BCGA 3HTIA 1ETVA 1MBJA 3LNQA 2EZIA 5M3MJ 4JX6A 4Y52J 2DG7A 1X58A 3GTQJ 2AHQA 4JP0A 4XRSA 1IRZA 2PBXA 4FE7A 2ZCNA 4A3FJ 4DYRA 4D5CA 2JA7J 1EF4A 3TEDA 3VVXA 4IHWA 4BY1J 5F04A 3KNWA 4PXIA 3H3VK 3BHQA 2L0KA 1VFCA 1PUFA 3HOXJ 2G3BA 2K40A 1MBKA 2P81A 3HOVJ 5IOYA 2TRTA 3A01B 2L7MP 5FMPA 3Q0UA 2CUFA 1U78A 1X2NA 1T33A 5JLWA 3LSRA 3OIOA 5J1YA 2YUSA 4MLOA 3IV5A 1GV5A 5IP7J 5GP9A 2M0CA 2LKXA 3S1RJ 5F0CA 4A3CJ 2QIBA 3M4OJ 1MBEA 4W97A 2XGDA 3GBGA 1QVTA 1TWAJ 1FTZA 2CRGA 3VPRA 3ON4A 2LTPA 2TCTA 3H0GJ 3G1OA 3HTAA 4C2MJ 1JTXA 5K7FA 1FIPA 3DEWA 1FJLA 2JMWA 1TWHJ 3SDGA 4GFLA 5FHPA 1ZR4A 3I4NJ 2DA1A 4GFBA 3CJDA 1TWGJ 2Y2ZA 1B72A 3JRDA 3VW1A 1G2HA 2VI6A 2M9HA 3ZQHA 1HLVA 3CRJA 3JSJA 5IOZA 3G1MA 4AYBN 2OPTA 4BY7J 3MNLA 3BQYA 1I3QJ 3VW0A 5DAJA 1NK2P 1POGA 1JUMA 2MG4A 1S7EA 3HM5A 3K7AJ 3ZQLA 4D5FA 4AUXA 1IDYA 1RETA 4A3DJ 2FX0A 2CQXA 3C2BA 3IH3A 4QTRA 5FLVA 3FISA 2DMPA 3TW7A 3PO3J 5FKMA 1WI3A 2L9RA 1YRNB 2NVQJ 5IYCJ 1ZK8A 3NRGA 3RH2A 2I10A 2MW8A 2HQ5A 3NNRA 1AKHA 1IDZA 1T56A 1GDTA 3HOZJ 4NN1A 3LHQA 1ORKA 3IH4A 1TWFJ 3EUPA 1O4XA 2DTZA 1APLC 4UUSA 4A3LJ 3RZDJ 1ZKGA 2DA2A 3O60A 4XICA 2EZKA 1D5YA 1MH3A 3HOYJ 2O8KA 2HXIA 2ID6A 2DA6A 1BJZA 5FKLA 4A69C 1ETQA 2W48A 4I76A 3FIWA 2E2IJ 3JRFA 2M8GX 3BG3A 4MFDA 4MIMA 2L7FP 2GBYA 5C4YA 4X1EA 2Q24A 5IP6A 1AHDP 4FCYA 1UMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDD C;  2YU9 J;  5EZH A;  2HDD A;  3FK7 A;  4LOC A;  2PZ9 A;  3EGQ A;  4ME9 A;  3S15 J;  2NP3 A;  1RPW A;  4M3B A;  2GEN A;  2E2H J;  1Q1V A;  1ZGW A;  3BTC A;  2EZL A;  3HE0 A;  5FKN A;  2VKE A;  1SFO J;  1MBG A;  1JT6 A;  2HYT A;  1UI6 A;  4EEF G;  2E2J J;  5EG0 B;  2QCO A;  1ETY A;  4G12 A;  1R9T J;  3GTJ J;  1X2M A;  2R5Z B;  1HOM A;  4DZJ A;  2CQQ A;  2R92 J;  4AC6 A;  2R7Z J;  5F0H A;  3JR9 A;  1FEX A;  4V2F A;  2KDZ A;  3S2H J;  1QRY A;  1Z77 A;  1ZR2 A;  2ECB A;  3L1P A;  2N8G A;  3LWJ A;  1IUF A;  3E7Q A;  1QVU A;  4D7M A;  3IH2 A;  1FIA A;  2NS8 A;  4C3H J;  2Y9Y A;  2EQR A;  4BXX J;  1A6I A;  4A3B J;  2LFB A;  2WAQ N;  4Y7N J;  2LK2 A;  4FE4 A;  2D5V A;  2WUI A;  1IG7 A;  2ZCX A;  5FJ8 J;  2CUE A;  3COL A;  1NTC A;  5C3E J;  2ZOY A;  4XK4 A;  5CXI A;  2R5Y B;  2FJ1 A;  1W0T A;  3JRB A;  4CGR A;  4ICH A;  2LR8 A;  1CQT A;  4S0H B;  1IV6 A;  4GCT A;  2DA3 A;  2HOT A;  3KKD A;  2JA8 J;  3BR1 A;  3RKQ A;  2FQ4 A;  3A02 A;  3LJL A;  5D19 A;  2LY9 A;  2OF7 A;  3BR6 A;  2QWT A;  2DN0 A;  2H8R A;  2GFN A;  1JUS A;  3P9T A;  3T6N A;  2IBD A;  2RAS A;  3VOX A;  1BW6 A;  1P7J A;  2RAE A;  3HBL A;  5EGO A;  2HI3 A;  1OCT C;  9ANT A;  3B81 A;  3ZQC A;  2RHA A;  4CYC A;  4NEL A;  2Y31 A;  2K9S A;  2ZCM A;  4YZE A;  2DMN A;  5HAW A;  3HIM A;  2K9N A;  1XG1 A;  2OI8 A;  2F07 A;  1WGX A;  1MBH A;  1JKR C;  1OJL A;  2QF7 A;  2XPV A;  2XGC A;  5DS9 A;  3KZ9 A;  1PUF B;  3AQT A;  1BW5 A;  3WHB A;  1LE8 A;  1RKW A;  4J19 A;  2DG8 A;  2LP0 A;  2G0E A;  3RQI A;  2YVH A;  5GPC A;  4C3I J;  5M5X J;  3PAS A;  3S5R A;  5FKO A;  1H89 C;  3ZQI A;  1ENH A;  1ETK A;  3LSJ A;  4A3M J;  2WV1 A;  2GUH A;  3OSF A;  1H8A C;  2DA7 A;  2AO9 A;  2OER A;  5IYD J;  1I6H J;  3GTG J;  3BTJ A;  2VKV A;  1HCR A;  3BT9 A;  2HOA A;  2ELK A;  1MH4 A;  4XRM A;  1FTT A;  2JN6 A;  5M5W J;  3VUQ A;  4A3G J;  2YS9 A;  5K58 A;  1U9O A;  4M3F A;  3FK6 A;  1OFC X;  3Q3S A;  4L62 A;  4JX5 A;  3GTO J;  4BBR J;  1JUP A;  5GPA A;  5IP9 J;  2UXO A;  4GFK A;  4A3I J;  4AC0 A;  1JTY A;  3G56 A;  2WB1 N;  1ZTR A;  5CXG A;  4IHY A;  3GEU A;  3ZQG A;  3UKG A;  5HBU A;  2DMU A;  2H1K A;  2G7L A;  4JKZ A;  5JLX A;  1A5J A;  4MFE A;  4QIW N;  1B72 B;  1GV2 A;  3PO2 J;  3BR3 A;  4M3E A;  3NAR A;  2O9L A;  3S17 J;  4MXM A;  4AF5 A;  5F0F A;  1OCP A;  3GTL J;  3I4M J;  3PM1 A;  5K7H A;  2ME0 A;  1RR7 A;  3SJM A;  4XRS G;  3BTL A;  5IYB J;  1AU7 A;  1B8I A;  2WGB A;  2X6O A;  4V2G A;  1JJ8 C;  3AQS A;  4JX4 A;  4DYQ A;  1E3O C;  3ANG A;  1JGG A;  1VI0 A;  3S1M J;  4BBS J;  1F43 A;  2FD5 A;  2G7G A;  3TP3 A;  3WHC A;  1JJ6 C;  3BR2 A;  3O8H A;  5D1R A;  4MO7 A;  3LOC A;  3V78 A;  2LLK A;  3HGG A;  1TWC J;  2GLO A;  5F1J A;  5C44 J;  1AKH B;  4KWA A;  1GVD A;  3BR5 A;  5AQC A;  3VOK A;  1DU0 A;  1W0U A;  2K9Q A;  3JRI A;  3HTH A;  5FKK A;  2D6Y A;  4UUT A;  3BJB A;  2ECC A;  2FBQ A;  4UUS B;  3GZI A;  3HB9 A;  2V57 A;  1WH7 A;  3NPI A;  3CDL A;  3VW2 A;  2JWT A;  1RKT A;  1HF0 A;  2HKU A;  3QBM A;  5CW8 A;  2XPU A;  3A01 A;  4A3K J;  5EF6 A;  2Y30 A;  1Z0X A;  2NS7 A;  5EZG A;  2IEK A;  4IHV A;  1RES A;  3JRH A;  3HEF A;  2G7S A;  3VVY A;  2QTQ A;  3S16 J;  5J3L A;  4M3D A;  3HTJ A;  4IHX A;  2HXO A;  3GTK J;  1SAN A;  3CQZ J;  2ID3 A;  2JJ7 A;  1K61 A;  2MGQ A;  3LSP A;  4IEJ A;  3QQA A;  3CWR A;  3ZOB A;  1HDP A;  1UG2 A;  4ABZ A;  2EH3 A;  1BA5 A;  4MK6 A;  2X48 A;  3Q0W A;  3BTI A;  3FKI J;  4DZP A;  2ME6 A;  4UDS A;  5EDN A;  1IC8 A;  2NVX J;  2M34 A;  5EYR A;  3S14 J;  5HOD A;  3JRA A;  3JRG A;  1ETW A;  5E3M A;  2R0Q C;  4B3A A;  2NX4 A;  3Q0V A;  3S2D J;  1WH5 A;  3RZO J;  3KKC A;  3G1L A;  4FTH A;  3FRQ A;  1P7I A;  4HKU A;  3BR0 A;  3CMY A;  3HKZ N;  4JYK A;  4JNN A;  3MN2 A;  4XID A;  1I50 J;  5C4X J;  1ETX A;  3ON2 A;  4HNV A;  1TC3 C;  5BNG A;  2NOG A;  2QKO A;  3BQZ A;  2LVS A;  4QSH A;  3NAU A;  1NK3 P;  1ITY A;  3F0C A;  4RBO A;  2EZH A;  2X9D A;  1YRN A;  3ZQF A;  4X6A J;  4RDU A;  5J1R A;  3PPB A;  4NDL A;  1GT0 C;  3HOW J;  4A93 J;  2DMQ A;  2JA5 J;  5E3N A;  2EBI A;  2ZB9 A;  4DW6 A;  4B4C A;  5DTD A;  1XS9 A;  3S1Q J;  3BNI A;  3LSG A;  4L5E A;  2E1O A;  2REK A;  5EGO B;  3BG5 A;  4C3J J;  1MSE C;  2UXH A;  1QPI A;  2UXI A;  4I6Z A;  2KT0 A;  4W1U A;  1DU6 A;  3MKL A;  1XC5 A;  4CYC B;  2B63 J;  2IU5 A;  3C07 A;  3CCY A;  2XGE A;  1Y1V J;  2DA5 A;  3TW6 A;  2YVE A;  1WCM J;  1UI5 A;  2ZOZ A;  2UXU A;  2QOP A;  2DJN A;  3SFI A;  1IGN A;  3F1B A;  2UXP A;  3B6A A;  3V6G A;  2LD5 A;  1JKP C;  2IAI A;  1UHS A;  4M6V A;  5FLM J;  1Y1W J;  5C4J J;  2JK3 A;  2NVT J;  3S1N J;  3MVP A;  4M3G A;  1VND A;  3HDD A;  4A3J J;  2MSY A;  1LFB A;  1LE8 B;  3VVZ A;  5D18 A;  2R93 J;  1WPK A;  1U9N A;  3OSG A;  3IUV A;  2COB A;  2VUM J;  3G7R A;  5K7Z A;  5IPA A;  3VIB A;  2CU7 A;  3HGY A;  5J1U A;  1K83 J;  4GCK A;  3QPS A;  5EG0 A;  1MSF C;  4ACI A;  3GTM J;  3B6C A;  3HOU J;  2O7O A;  2VPR A;  3JRE A;  3BRU A;  2R5Z A;  5M5Y J;  2XB0 X;  3BG9 A;  4JL3 A;  1IJW C;  1H88 C;  2NP5 A;  4FIS A;  1MNM C;  3QPL A;  4D7N A;  3K2A A;  4A3E J;  2HOS A;  3ANP A;  3A03 A;  3NI7 A;  2W53 A;  3TP0 A;  3JRC A;  2HYJ A;  3W6V A;  1MBF A;  2M2E A;  2DA4 A;  5E3L A;  3D1N I;  2L7Z A;  2Y0S N;  1U8B A;  1JT0 A;  2XRL A;  1GUU A;  3M3Y J;  2XPW A;  1ETO A;  5FGL A;  1F36 A;  5E3O A;  2R5Y A;  2DMT A;  2Y9Z A;  1SGM A;  1BL0 A;  3RD3 A;  2GM4 A;  3GTP J;  5HSZ A;  1B8I B;  2CJJ A;  3VP5 A;  3NXC A;  2E19 A;  2XSD C;  5M3F J;  3DPJ A;  2XB5 A;  2JA6 J;  5EFY A;  4BKX A;  5F27 A;  2O7T A;  3QKX A;  5EEA A;  3E7L A;  4DYC A;  4GCL A;  1LFU P;  1JKO C;  3O8G A;  1ZQ3 P;  2XDN A;  1JKQ C;  5H9T A;  5F08 A;  3OOU A;  1VF9 A;  2NVY J;  2PMZ N;  4B1R A;  3DCF A;  3BCG A;  3HTI A;  1ETV A;  1MBJ A;  3LNQ A;  2EZI A;  5M3M J;  4JX6 A;  4Y52 J;  2DG7 A;  1X58 A;  3GTQ J;  2AHQ A;  4JP0 A;  4XRS A;  1IRZ A;  2PBX A;  4FE7 A;  2ZCN A;  4A3F J;  4DYR A;  4D5C A;  2JA7 J;  1EF4 A;  3TED A;  3VVX A;  4IHW A;  4BY1 J;  5F04 A;  3KNW A;  4PXI A;  3H3V K;  3BHQ A;  2L0K A;  1VFC A;  1PUF A;  3HOX J;  2G3B A;  2K40 A;  1MBK A;  2P81 A;  3HOV J;  5IOY A;  2TRT A;  3A01 B;  2L7M P;  5FMP A;  3Q0U A;  2CUF A;  1U78 A;  1X2N A;  1T33 A;  5JLW A;  3LSR A;  3OIO A;  5J1Y A;  2YUS A;  4MLO A;  3IV5 A;  1GV5 A;  5IP7 J;  5GP9 A;  2M0C A;  2LKX A;  3S1R J;  5F0C A;  4A3C J;  2QIB A;  3M4O J;  1MBE A;  4W97 A;  2XGD A;  3GBG A;  1QVT A;  1TWA J;  1FTZ A;  2CRG A;  3VPR A;  3ON4 A;  2LTP A;  2TCT A;  3H0G J;  3G1O A;  3HTA A;  4C2M J;  1JTX A;  5K7F A;  1FIP A;  3DEW A;  1FJL A;  2JMW A;  1TWH J;  3SDG A;  4GFL A;  5FHP A;  1ZR4 A;  3I4N J;  2DA1 A;  4GFB A;  3CJD A;  1TWG J;  2Y2Z A;  1B72 A;  3JRD A;  3VW1 A;  1G2H A;  2VI6 A;  2M9H A;  3ZQH A;  1HLV A;  3CRJ A;  3JSJ A;  5IOZ A;  3G1M A;  4AYB N;  2OPT A;  4BY7 J;  3MNL A;  3BQY A;  1I3Q J;  3VW0 A;  5DAJ A;  1NK2 P;  1POG A;  1JUM A;  2MG4 A;  1S7E A;  3HM5 A;  3K7A J;  3ZQL A;  4D5F A;  4AUX A;  1IDY A;  1RET A;  4A3D J;  2FX0 A;  2CQX A;  3C2B A;  3IH3 A;  4QTR A;  5FLV A;  3FIS A;  2DMP A;  3TW7 A;  3PO3 J;  5FKM A;  1WI3 A;  2L9R A;  1YRN B;  2NVQ J;  5IYC J;  1ZK8 A;  3NRG A;  3RH2 A;  2I10 A;  2MW8 A;  2HQ5 A;  3NNR A;  1AKH A;  1IDZ A;  1T56 A;  1GDT A;  3HOZ J;  4NN1 A;  3LHQ A;  1ORK A;  3IH4 A;  1TWF J;  3EUP A;  1O4X A;  2DTZ A;  1APL C;  4UUS A;  4A3L J;  3RZD J;  1ZKG A;  2DA2 A;  3O60 A;  4XIC A;  2EZK A;  1D5Y A;  1MH3 A;  3HOY J;  2O8K A;  2HXI A;  2ID6 A;  2DA6 A;  1BJZ A;  5FKL A;  4A69 C;  1ETQ A;  2W48 A;  4I76 A;  3FIW A;  2E2I J;  3JRF A;  2M8G X;  3BG3 A;  4MFD A;  4MIM A;  2L7F P;  2GBY A;  5C4Y A;  4X1E A;  2Q24 A;  5IP6 A;  1AHD P;  4FCY A;  1UMQ A; 
#chains in the Genus database with same CATH topology
 2K9M A;  1WJF A;  1HDD C;  2YU9 J;  4KMF A;  2CQK A;  1TNT A;  5JR3 A;  1U5T C;  3LSI A;  3S15 J;  2NP3 A;  4B44 A;  1R1U A;  2QA4 I;  2E2H J;  2WV0 A;  2MC3 A;  3DTE A;  2XC7 A;  2W7N A;  2Y48 A;  1ZGW A;  2VKE A;  2UWM A;  2PJR A;  1V55 H;  2ESN A;  5KVR A;  1W7P B;  1ETY A;  2ELJ A;  3LAP A;  3JTH A;  2CO5 A;  1X2M A;  1HOM A;  2V1X A;  3VTI A;  2R92 J;  1KZH A;  5F0H A;  3AKZ A;  1KON A;  3JR9 A;  2A5W A;  1ZR2 A;  2FBH A;  3V42 A;  3L1P A;  1MD0 A;  4KIC A;  1QVU A;  2P7C B;  2JTV A;  3IH2 A;  2LRD A;  1H0M A;  3KIO A;  4F3Q A;  1F1Z A;  2WA0 A;  1CF7 B;  2P0W A;  4S04 A;  2LFB A;  2WAQ N;  3FMQ A;  2Z9O A;  1H9G A;  4OMZ A;  3TOA A;  1RI7 A;  2CUE A;  3KYD B;  1OKR A;  3DPL C;  5CXI A;  2R5Y B;  2LR8 A;  4O6J A;  2DA3 A;  2ETH A;  3KKD A;  5HNH A;  3PJR A;  1IW7 F;  3BR1 A;  3RKQ A;  2G7U A;  2VBZ A;  3EYY A;  3BR6 A;  1S6L A;  5EEH A;  5LEK A;  3TBI A;  4XKV A;  1JUS A;  3P7N A;  3VOX A;  9ANT A;  2RAE A;  3HBL A;  5EGO A;  3NS4 A;  2X6Y A;  3ZQC A;  1RUN A;  2RHA A;  4CYC A;  2ADU A;  4HLY A;  4UV8 A;  2K9N A;  1X1B A;  1XG1 A;  3N05 A;  4NNJ A;  5E8I A;  3OYF A;  1N25 A;  2O5R A;  3OIQ A;  2EJR A;  4J00 A;  3KZZ A;  2E1N A;  4XN3 A;  1R6R A;  3CZ6 A;  4IL6 C;  2XPV A;  2LDU A;  4PUS A;  3FWE A;  1UG0 A;  2V1N A;  2V9K A;  1PUF B;  3AQT A;  3WHB A;  2F4O B;  2LP0 A;  4GO1 A;  4IOA F;  2LMD A;  5GPC A;  5M5X J;  3FXU A;  4IHS A;  3ZR8 X;  2PMZ A;  2A6H F;  3E5Q A;  3JCU C;  3T1B A;  2A6E F;  3SFZ A;  1R23 A;  2ZJR F;  1GXQ A;  3HUG B;  1MJA A;  3IAS 2;  3KP4 A;  3K70 D;  1G3Y A;  3OSF A;  1J59 A;  2DA7 A;  2YPR A;  1WFX A;  3H1C A;  3GTG J;  3BTJ A;  1BI3 A;  1HCR A;  4GYI A;  1MH4 A;  3W2V A;  4XRM A;  2JN6 A;  3OWT A;  5M5W J;  1AHD P;  3ZMU A;  5LHI A;  5K58 A;  3OYN A;  4M3F A;  3BPX A;  3FK6 A;  4X0G A;  3WTT C;  1S8N A;  4D1Q A;  3GTO J;  4BHP A;  2DYR H;  5GPA A;  5IP9 J;  3F21 A;  2KJB A;  2UXO A;  4L9T A;  4AC0 A;  1JTY A;  4A3I J;  3G56 A;  2M5W A;  1W5T A;  2DMU A;  1V5E A;  2G7L A;  5GTH C;  3BWG A;  4A0Y A;  4FAS D;  4MFE A;  4NBQ A;  2XKP A;  4QIW N;  1B72 B;  4CSW A;  1SD7 A;  3OS0 A;  4IOC F;  2ZO4 A;  3GTL J;  5D6E A;  2MAB A;  2LY1 A;  3E97 A;  5K7H A;  2W84 A;  2CUJ A;  1B9M A;  3BTL A;  5IYB J;  4OIP F;  1JJ8 C;  3JTG A;  3KCC A;  4DYQ A;  1MMA A;  3OYD A;  1E3O C;  5DM6 F;  3OS1 A;  3ANG A;  1LEA A;  1VTN C;  4RGU A;  3HRS A;  2G7G A;  3KLN A;  3S2W A;  1ZGJ A;  4P9U A;  2P6S A;  1JJ6 C;  3BR2 A;  2VJ4 A;  3DTK A;  4HLX A;  1Y39 A;  3LOC A;  3M8E A;  3V78 A;  2HGC A;  3COA C;  2CV2 A;  3U1K A;  1Y6I A;  3HGG A;  4AU7 A;  5F1J A;  3ZN0 A;  2W00 A;  1AKH B;  3BR5 A;  1U5T B;  3PIP F;  5FFX A;  4WCG A;  3CF5 F;  3CD6 I;  2BGC A;  1W0U A;  3GUD A;  4AVZ A;  5HOO A;  2XHK A;  2CV1 A;  3FF5 A;  3JSO A;  5FRM A;  2O8X A;  4MQV A;  5EEG A;  1O3Q A;  3C2G A;  3HSE A;  3HB9 A;  5L3G A;  4K2E A;  2DW4 A;  3CUO A;  2WAD A;  1G8X A;  2JWT A;  1HXD A;  3K4L A;  4L0Y B;  3QBM A;  3V8K A;  2XPU A;  1Z0X A;  2LKP A;  5EZG A;  3HPG A;  4UVB A;  5D4R A;  3MKY B;  2LF7 A;  4ZDP A;  3HIF A;  3S16 J;  4ZZD A;  4TV7 A;  2DOD A;  2NYX A;  1T2K A;  4IHX A;  2ZXI A;  2X51 A;  5H6R A;  4A6E A;  2NNY A;  1RUO A;  1TW2 A;  1XTA A;  5F64 A;  3CQZ J;  3SZG A;  1Z3Y A;  1K6O A;  3GWZ A;  2MGQ A;  4HOB A;  3CC4 I;  1R00 A;  1ZRC A;  1UG2 A;  1P2F A;  2H6B A;  4UVA A;  2EB7 A;  2H27 A;  4MK6 A;  1ZG1 A;  2X48 A;  3BTI A;  4EVI A;  4FT8 A;  2G9W A;  1IC8 A;  2NVX J;  3S14 J;  1XGM A;  2VL8 A;  2IGN A;  1ETW A;  2R0Q C;  1YHQ I;  2OV7 A;  2QEN A;  4ZYD A;  2E35 A;  3BG7 A;  2WY8 Q;  3Q0V A;  3X2Q H;  3LST A;  1WSU A;  1FOW A;  3PNY A;  2HPI A;  3ABT A;  3CTA A;  2D45 A;  4LD5 A;  3DKY A;  2KP6 A;  3IWF A;  1V5F A;  4XID A;  5KAF C;  1ETX A;  2MBF A;  2E1C A;  3ERM A;  3EET A;  1IO2 A;  2NOG A;  2CS3 A;  1NK3 P;  2B7E A;  1WVR A;  3ISP A;  1YJN I;  2EZH A;  2F4M B;  2X9D A;  3ZQF A;  4E7J A;  4P1W A;  2CH0 A;  5J1R A;  2FE3 A;  3K4C A;  1CGP A;  1HW1 A;  2GZW A;  2RC4 A;  2NAZ A;  1GT0 C;  5B1B H;  1YI2 I;  1D1A A;  2L9N A;  5E3N A;  4DW6 A;  4IRH A;  4NC6 A;  3SYT A;  2M3A A;  1XS9 A;  3ZMS A;  4L5E A;  2REK A;  3IHU A;  1MSE C;  4RGS A;  3U1D A;  2KT0 A;  4W1U A;  1A31 A;  3GFL A;  1YJW I;  2NXN B;  2IU5 A;  2OZ6 A;  3CCY A;  3TW6 A;  2YVE A;  1WCM J;  3UNG C;  1UJ8 A;  2DT5 A;  3W6K B;  5BPI A;  2EIL H;  2CQ7 A;  1BIB A;  2DJN A;  2HU9 A;  4EM0 B;  2GXB A;  1WZ2 A;  1IGN A;  1GHC A;  3B6A A;  1U6G A;  2R7U A;  5F6F A;  3IP4 B;  1BI0 A;  4M6V A;  1OIS A;  1Y1W J;  5C4J J;  2JK3 A;  1SFK A;  4A3J J;  2MSY A;  4UXN A;  3FBI B;  5LBQ A;  3L2C A;  2VXZ A;  3GFM A;  1LE8 B;  3VVZ A;  1SAU A;  3LSM A;  4G7O F;  1WPK A;  1U9N A;  2DOF A;  2EIN H;  1IXC A;  2Z2S B;  5DD8 A;  2HKO A;  2NRA C;  2XKO A;  4I0A A;  1Z05 A;  2QKL B;  4YFN F;  1V54 H;  1W4M A;  2QYO A;  4HDU A;  4Q47 A;  2IS4 A;  3B6C A;  3HRM A;  4F55 A;  2O7O A;  2XB0 X;  3BG9 A;  3BP8 A;  4JL3 A;  3DWL E;  2DFE A;  4D7N A;  3K2A A;  3LSH A;  3MCZ A;  4DNC A;  3DBR B;  4RAY A;  4CDG A;  2M2E A;  2RQP A;  2DA4 A;  4M9S A;  5LLQ A;  2LH9 A;  3K4M A;  1YE9 A;  3EDP A;  1JT0 A;  3M3Y J;  2RVC A;  3TKY A;  3LFU A;  3HTU A;  3E6B A;  2OCC H;  3P9I A;  3RD3 A;  2A07 F;  4LG0 B;  1X4P A;  2DFI A;  4EGZ A;  3R0A A;  4MTE A;  4IJA A;  4O5V A;  1Z67 A;  3WTZ A;  2XSD C;  1SVO A;  2IS2 A;  3QKX A;  5EEA A;  4B47 A;  3E7L A;  3DLL F;  3O8G A;  4BQO A;  3CCJ I;  5D5V B;  1REP C;  3CCQ I;  1VF9 A;  2NVY J;  3UR3 C;  3CCE I;  4B1R A;  3EPZ A;  3F22 A;  1JI8 A;  2EZI A;  5M3M J;  1X58 A;  2V7F A;  4XRS A;  4BXU A;  4EJT A;  2OTJ I;  2PBX A;  4B09 A;  2ZCN A;  4HSR A;  2ZJQ F;  2GOX B;  5K5Q A;  4V19 K;  1LJ9 A;  4N9H A;  5F04 A;  2XUB A;  4H4K C;  3H9G A;  3H3V K;  1ZRD A;  2KPM A;  5ICF A;  4Q48 A;  1N77 A;  3HOX J;  3HL2 A;  3HOV J;  5IOY A;  3QYE A;  2L7M P;  3ABK H;  3GEZ A;  3WU0 A;  3K70 C;  1K78 B;  2IA0 A;  5A2Q Z;  5J1Y A;  2YUS A;  3HRU A;  4PSX A;  2DXI A;  2YU3 A;  3DU5 A;  2OTL I;  3OYH A;  2Z16 A;  2QIB A;  3M4O J;  1KGS A;  3IKV A;  3MZH A;  1FC3 A;  1I5Z A;  4A5M A;  4DJA A;  4BJ6 C;  1EKE A;  3TO6 A;  2JT1 A;  1EH6 A;  2EV6 A;  4AIH A;  4CCN A;  4RM3 A;  2LTP A;  4KN4 X;  1QO0 D;  4JQF A;  1OCC H;  3G1O A;  4AD9 A;  2YR2 A;  1O3T A;  4HPQ A;  1TQI A;  1G59 A;  4XMY A;  1OCZ H;  3DEW A;  3DKX A;  3HTS B;  1MIJ A;  3SDG A;  5FHP A;  2E71 A;  2DO7 A;  4HQM A;  4NC7 A;  3I4N J;  2K27 A;  4CCO A;  5HS8 A;  3HRT A;  3G6E I;  1R7J A;  4WXC A;  3H3U A;  4ON0 A;  1SMT A;  3AL0 C;  4E7H A;  3CRJ A;  1ON2 A;  3G1M A;  5B3S H;  4BY7 J;  1NK2 P;  3BJA A;  3F72 A;  1L3L A;  3JAM Z;  3K7A J;  3R60 A;  1X3W B;  4D5F A;  1QHH D;  3C3W A;  3HG9 A;  1RET A;  4M9Z A;  4PGH A;  1R58 A;  1FYK A;  2CQX A;  3C2B A;  5FLV A;  1Z91 A;  2E60 A;  4ZH4 F;  3FXR A;  1IXS B;  1ZEL A;  1WI3 A;  4RAF A;  2NVQ J;  4E7K A;  4XKB A;  2I10 A;  2HQ5 A;  4BHB A;  4J01 A;  2XAJ A;  5DCF A;  3FHZ A;  2PQ8 A;  3FXO A;  3A0B C;  2QZ8 A;  4LFU A;  4UV9 A;  1YS6 A;  3SDB A;  1G6N A;  2V1U A;  5BQT A;  2DFH A;  1XD7 A;  3IH4 A;  3E5X A;  3EUP A;  1T0F C;  2BHZ A;  4A3L J;  3CCU I;  3O60 A;  4EJO A;  1LKX A;  2EZK A;  5DUI A;  3HOY J;  1QNT A;  2OU2 A;  4KIT B;  1U3E M;  4A69 C;  3W2A A;  2K3F A;  2LYC A;  3V7R A;  3KET A;  2NVU B;  1R5I D;  3KE2 A;  2M8G X;  3JRF A;  2CSO A;  1ZAR A;  2QGU A;  1IN5 A;  4DOZ A;  1D0Z A;  5L3B A;  2ISY A;  3VYS B;  1R4N B;  1S3J A;  3OYM A;  2CW0 F;  1UMQ A;  2O9L A;  1TQP A;  3ZGK A;  4XLH A;  2HDD A;  2X1C A;  4LOC A;  3EGQ A;  4ME9 A;  1RPW A;  4A6D A;  2GEN A;  4N9I A;  2IVM A;  4YEL A;  3BTC A;  3HE0 A;  1EA3 A;  5D5W B;  1ZG3 A;  2LBF A;  1SFO J;  1JT6 A;  2HYT A;  2F5F A;  3KLO A;  1ZLK A;  2E2J J;  2V6E A;  1UI6 A;  2F5C A;  2RDP A;  2R5Z B;  1FYM A;  1OYY A;  1BC8 C;  2CQQ A;  1QHG A;  3F8C A;  4U7B A;  1XMX A;  3J80 Z;  2JA2 A;  1ZN2 A;  2QQB A;  4HW0 A;  1FEX A;  3S2H J;  1Z77 A;  2K9L A;  2DDB A;  1E2X A;  3EUH A;  1FIA A;  1XSD A;  2Y9Y A;  2VOP A;  4E7L A;  1OR7 C;  2O03 A;  1Z21 A;  4CYD A;  4FE4 A;  5J8C A;  1HBX G;  3K2Z A;  1W36 D;  2ZCX A;  1BOB A;  1IG7 A;  2XSJ C;  2F4I A;  4JOM A;  1GVJ A;  2A6T A;  2ZOY A;  4XK4 A;  1T39 A;  4CHU A;  1KYZ A;  4IZZ A;  3M9A A;  1W0T A;  1D0X A;  1NH3 A;  4CGR A;  5DDG A;  4ICH A;  1UEL B;  2KZV A;  2HOT A;  1NG7 A;  2V6C A;  3T8T A;  1RNL A;  1J2X A;  3A02 A;  4CCM A;  2VON A;  3LJL A;  4YIR X;  1DQU A;  4HNU A;  1FOY A;  3K69 A;  5CVV A;  4F91 B;  2H8R A;  1XN7 A;  1S29 A;  1BW6 A;  1P7J A;  2R7F A;  4CIC A;  2HI3 A;  3LQQ A;  1K4T A;  3OL3 A;  3S3M A;  3HIM A;  2OI8 A;  2F07 A;  4ENM A;  3KPH A;  4HF2 A;  1MBH A;  3H35 A;  1OJL A;  2CFX A;  1IXR C;  2VJI A;  2L4M A;  2XGC A;  2AXT C;  5DS9 A;  2BV6 A;  3VDX A;  2HPM A;  1E17 A;  3KZ9 A;  1FT9 A;  3I55 I;  1BW5 A;  1LB2 A;  2FRH A;  1ZH5 A;  3OYB A;  2DG8 A;  3MAJ A;  3EUK L;  2G0E A;  1BI1 A;  2YVH A;  3FMR A;  4NQW A;  2QEX I;  3E6C C;  3AL0 B;  1X1C A;  1EV7 A;  5FKO A;  2BOL A;  1H89 C;  1ETK A;  2L4A A;  3LSJ A;  2L01 A;  4L0Z B;  2V9P A;  1GXP A;  1IRG A;  2GUH A;  2O61 A;  4F92 B;  3CC7 I;  3LA7 A;  2AO9 A;  3R6S A;  2QBY A;  1IAW A;  5IYD J;  2HDW A;  2VKV A;  3FM3 A;  4BE2 A;  3VOE A;  1U9O A;  4F93 B;  3DPT A;  3Q3S A;  2FBI A;  4JX5 A;  5FLX Z;  2KIQ A;  3AFH A;  5B1A H;  3DKW A;  4GFK A;  2KQR A;  4AIK A;  1ZTR A;  3P9K A;  2M87 A;  2IGM A;  3HKZ A;  3ZQG A;  2VBW A;  3KP3 A;  3MFK A;  3UKG A;  2H1K A;  5H2F C;  3PFY A;  3PSI A;  4KNY A;  4LK0 F;  2WWY A;  3GX4 X;  3K4K A;  1GV2 A;  4IKF A;  3BR3 A;  5DV5 A;  3S17 J;  3I4M J;  4M6Y A;  3PM1 A;  1VQM I;  2KIF A;  2ME0 A;  4B8X A;  3SZT A;  1TL8 A;  1Z1D A;  4XOR A;  1B8I A;  2WGB A;  4V2G A;  4HRI A;  2DI3 A;  4JX4 A;  5JFR A;  1K7A A;  3AQS A;  4UB6 C;  3DXJ F;  1JGG A;  2K4J A;  2E5Z A;  3S1M J;  2FA5 A;  4PK4 A;  2DT7 B;  3J7A Y;  2F48 A;  3HPH A;  1VQ8 I;  2NNN A;  1EJ9 A;  2EIM H;  1AOY A;  2DQL A;  4L9V A;  3GFJ A;  5D1R A;  4I2O A;  1TWC J;  2DU9 A;  3K1N A;  5JI6 A;  1MMN A;  4KWA A;  1GVD A;  5AQC A;  3VOK A;  1DU0 A;  2JUG A;  2VT3 A;  1UHW A;  2K9Q A;  1UST A;  4R1H A;  3V7C A;  2GWR A;  5LHH A;  2XF6 A;  2X85 A;  4OWR B;  3WG9 A;  4U9N A;  3GVA A;  4UUS B;  2PLY A;  3HSR A;  2NS0 A;  3WU2 C;  1WH7 A;  3QU6 A;  3QYB A;  4E4H A;  3CDL A;  4ETS A;  1RKT A;  3H5R A;  2HKU A;  3DFG A;  5CW8 A;  2CW7 A;  3CUQ A;  4UB8 C;  2Y30 A;  3MEX A;  2IEK A;  2KRC A;  2VE8 A;  4LGW A;  4EMS A;  1ZG5 A;  2QTQ A;  4XSZ F;  1G4D A;  1P4A A;  4XOT A;  4D0P A;  2JZY A;  1EH8 A;  4M3D A;  3IRR A;  4DIQ A;  1ODD A;  4HX8 A;  3HTJ A;  4HAM A;  5E1X A;  2X1E A;  3O2P E;  2ZME A;  3QOE A;  3GTK J;  1SAN A;  4HNT A;  1XGS A;  2JJ7 A;  4BQQ A;  1R71 A;  4A5N A;  4GXO A;  2BY3 A;  3WU1 B;  3RPU A;  1HDP A;  4ABZ A;  4I7H A;  3K6G A;  3OYK A;  5CQE A;  1TT0 A;  4L18 B;  1LDD A;  1P4W A;  2CMP A;  2ME6 A;  1HSJ A;  1WJB A;  1BR2 A;  1YFH A;  2M34 A;  2LSO A;  2EV5 A;  5HOD A;  5LEJ A;  2DK5 A;  1G3T A;  3JRA A;  2Y0S A;  5ILV A;  1ZAO A;  4FX0 A;  4B3A A;  2ESH A;  3OOP A;  3K1P A;  1WH5 A;  4U0W A;  3CP8 A;  2QWW A;  3G1L A;  4OOI A;  4AVP A;  1IV8 A;  2Y75 A;  1KQ9 A;  4HKU A;  3BR0 A;  2GA1 A;  3RYR A;  3S3O A;  4Y4R A;  3BLY A;  4JYK A;  4FHT A;  2KKO A;  2F5E A;  3MN2 A;  4G7Z F;  1I50 J;  2CUZ A;  1PYV A;  3MQ0 A;  3ON2 A;  4HNV A;  1SAX A;  2V9V A;  2AS5 F;  4XLP F;  5ILU A;  1XPX A;  4XM3 A;  2QKO A;  3BQZ A;  4U9L A;  4RMN A;  2LVS A;  2H09 A;  3A0H C;  1XCB A;  3NAU A;  4QSH A;  2PN6 A;  4LLG F;  1YRN A;  2IT0 A;  4X6A J;  4RDU A;  3RCO A;  1WJE A;  3PPB A;  3B73 A;  1OQY A;  3CC2 I;  1X1P A;  2DBB A;  3I71 A;  2EBI A;  5E20 A;  2JA5 J;  4O3M A;  3BNI A;  3M8J A;  1S72 I;  1ACI A;  1F4K A;  2LKS A;  2JSP A;  3BG5 A;  4BEH A;  2DYS H;  2HWV A;  3FM5 A;  1S5L C;  3C07 A;  2BEO A;  1Y1V J;  1ONV A;  4IQ4 A;  2VBX A;  4KT6 A;  4P9F A;  2UXU A;  3SFI A;  1I39 A;  3ASO H;  3CJN A;  3KP6 A;  3V6G A;  1UZC A;  3GME A;  2LD5 A;  1SD6 A;  2IAI A;  3PUB A;  4XSX F;  3U21 A;  3ZPL A;  1D1B A;  4R79 A;  4BUP A;  3HHH A;  2R7S A;  3J7A O;  4M3G A;  2UXN A;  1VND A;  2OQR A;  3HDD A;  1VQ4 I;  1E3H A;  1VQ6 I;  5HNF A;  4IRI A;  2R93 J;  4HDV A;  4KN7 X;  3FMS A;  3A4C A;  1B4A A;  3DEE A;  1T98 A;  4LJZ F;  4XL9 A;  4ENN A;  2M4K A;  1YTY A;  4Y15 A;  3CLQ A;  3G7R A;  2XAF A;  4MNU A;  2BHY A;  2EIJ H;  2HYG D;  1VQN I;  3VIB A;  2DCE A;  3VYT B;  2IS1 A;  6PAX A;  4EM1 A;  1W7P A;  1MSF C;  4WXD A;  4ACI A;  3GTM J;  2DOA A;  3HOU J;  3EUA A;  2JRT A;  4GYG A;  4HYE A;  1IJW C;  2PFB A;  2R7O A;  2VC1 A;  4A3E J;  2X0L A;  2EA4 A;  2GIZ A;  5HLI A;  3TP0 A;  3L2W A;  1W36 C;  2AXL A;  5J6X A;  2QSF X;  3ZRG A;  1CF7 A;  2L7Z A;  3ROU A;  1YJ9 I;  2DT6 A;  1DP7 P;  1GUU A;  1O3S A;  5FGL A;  1Q1H A;  3I54 A;  2P5K A;  4S05 A;  4LLN A;  2JSC A;  2R5Y A;  2DMT A;  2CGP A;  1SGM A;  3DLA A;  2YX4 A;  3GTP J;  4DBR A;  3CCR I;  3G71 I;  3QOD A;  3NXC A;  2Y0M A;  3CJR B;  1P6R A;  5M3F J;  3DPJ A;  3L2Q A;  2JA6 J;  4BKX A;  5F27 A;  4C2U A;  2O7T A;  3WTV C;  4B3X A;  2ZSH B;  4DYC A;  1R4M B;  1SVL A;  3U9G A;  1SD4 A;  2XDN A;  4AM3 A;  1NG6 A;  1UB9 A;  2VQG A;  3KYC B;  1ETV A;  2MYS A;  1TBX A;  1Z7U A;  1D0Y A;  3A1Y A;  1IRZ A;  2FSW A;  1BR4 A;  5FB2 A;  2BVL A;  4M71 A;  1I27 A;  4KIF A;  4OIN F;  1EF4 A;  1FNN A;  3RPQ A;  4ZJZ A;  3TED A;  3VVX A;  4XN0 A;  3ZXS A;  1YLF A;  2R7W A;  3J7Z I;  3BHQ A;  2L0K A;  1VFC A;  1PUF A;  1BOA A;  4I99 C;  1DPR A;  3IUO A;  3A01 B;  3LAJ A;  3Q0U A;  1U78 A;  1XCV A;  2B0L A;  2VAS A;  1T33 A;  1FSE A;  2XVC A;  3LSR A;  5DCM A;  2JQ7 A;  4U7D A;  3HUG A;  2LKX A;  1FX7 A;  3D0S A;  1ULY A;  5CKT A;  1MBE A;  3IRQ A;  3GO5 A;  4W97 A;  4NUB A;  2DTR A;  4EJV A;  4BGD A;  1YW7 A;  3GBG A;  1PP7 U;  2FJI 1;  1TWA J;  1XMK A;  3CP2 A;  2DDA A;  2FNA A;  2PX9 A;  4PZJ A;  4KMU X;  2A2F X;  4U87 A;  3ON4 A;  2KIU A;  3L09 A;  2TCT A;  2W25 A;  1PP8 F;  1QA6 A;  1FBQ A;  4IPA A;  4L9N A;  2XGX A;  4IRV A;  3DPU A;  1JTX A;  2XIG A;  4I98 B;  4IXA A;  2PEX A;  1FJL A;  2JMW A;  1TWH J;  2DA1 A;  1XGO A;  3Q9S A;  1B72 A;  3VW1 A;  2L3D A;  1G2H A;  2VI6 A;  4IX7 A;  3QPT A;  4XOP A;  2J5P A;  1ZYR F;  1AA7 A;  4AYB N;  2B9S A;  1TZL A;  3BQY A;  3HXL A;  2HTS A;  4PJJ A;  1T08 B;  3ZQL A;  1XSV A;  4N0B A;  2WC2 A;  4KA4 A;  1IDY A;  5GAE J;  3FDY A;  3VYU B;  4RB2 C;  3F8F A;  3FIS A;  2Z1D A;  4ZC3 A;  2HVQ A;  2HEO A;  3ZMD A;  1FBU A;  3I0T A;  5E8G A;  1VQ9 I;  1MDM B;  1OPC A;  1RR8 C;  3ABL H;  3NNR A;  3GZ5 A;  1AKH A;  2WY7 Q;  1U5T A;  4YRV A;  2IP2 A;  2ZNZ A;  4M73 A;  1IN4 A;  4ANJ A;  4XKW A;  3J81 K;  1GDT A;  5IY5 H;  3E6D A;  3FX3 A;  1TWF J;  2TDX A;  3R61 A;  4ZTF A;  2DTZ A;  1APL C;  3BG6 A;  1SFX A;  1FOK A;  2DA2 A;  4XIC A;  1D5Y A;  1MH3 A;  3LWF A;  1LVA A;  1BJZ A;  1JHH A;  1TLH B;  5FKL A;  3A2K A;  3FXM A;  5BOX A;  2W48 A;  5LD2 C;  1FOX A;  2E2I J;  4MTD A;  3M8F A;  2ZXH A;  2Q1Z B;  3H36 A;  4ZDL A;  3SXY A;  1WHU A;  1XDU A;  2GBY A;  5C4Y A;  1LEB A;  2VKD A;  5ILS A;  5IP6 A;  4WWC A;  2R7X A;  2HOE A;  3OYI A;  4FCY A;  2OZU A;  4CH7 A;  5EZH A;  2HQR A;  3KZY A;  3FK7 A;  2PZ9 A;  3OS2 A;  2IRF G;  4LIU A;  2WBM A;  1Q1V A;  2EZL A;  2XF5 A;  1EH7 A;  4EEF G;  2R7V A;  2WB1 A;  5EG0 B;  2QCO A;  4WF2 A;  2UZK A;  4G12 A;  4D9J A;  2VPL A;  3KP5 A;  3PNT A;  1I1S A;  3I5U A;  4AC6 A;  4BNC A;  2R7Z J;  3I59 B;  4RB0 A;  3NRV A;  1WRJ A;  2KDZ A;  2ECB A;  4XLC A;  1A04 A;  3LWJ A;  1IUF A;  5IT9 K;  4D7M A;  3E7Q A;  1Z6R A;  2P6T A;  4C3H J;  2IJL A;  2BY1 A;  2NS8 A;  1IRF A;  2STT A;  4A3B J;  3WGI A;  2PMU A;  2LK2 A;  4E70 A;  2D5V A;  3CO6 C;  2WUI A;  1KQ0 A;  3G2B A;  3MD2 A;  1LUJ B;  3COL A;  3KEQ A;  5HS9 A;  5KK1 A;  2FJ1 A;  1S7A A;  3I58 A;  1YX5 A;  3Q5F A;  3ABU A;  3MMY B;  1CQT A;  1WQ2 A;  4HX4 A;  2ACJ A;  1FP2 A;  2KFD A;  4HA8 A;  3RSN A;  1T95 A;  2OF7 A;  3QYF A;  2QWT A;  4XQF A;  2DN0 A;  3WTX C;  5K1Y A;  3C2H A;  3MZY A;  4FQG A;  4YII A;  2ZC2 A;  2E1M C;  3VB2 A;  4Q4Z F;  2GFN A;  3M7G A;  4PJM A;  4EV0 A;  4QPO A;  4AID A;  4IRG A;  3F6V A;  4NEL A;  2Y31 A;  2K9S A;  2ZCM A;  3FZV A;  4II2 A;  2E7W A;  2HVS A;  2JPB A;  3SEZ A;  4XON A;  4LB6 B;  3EYI A;  2Z3Y A;  3E1S A;  5HDK A;  3G73 A;  5J8F A;  2XAU A;  4LIT A;  5HVQ C;  5D5X B;  2CWE A;  4LIV A;  1MZB A;  1LDK B;  5JHU A;  1RKW A;  1LE8 A;  2UV1 A;  4BQN A;  4C3I J;  4P5O A;  2QSH X;  2FOW A;  1Z7L A;  1R5G A;  3JSP A;  3PAS A;  4RA2 A;  3S5R A;  2KLO A;  3MKZ A;  1QU3 A;  4A3M J;  1ENH A;  1LFP A;  3LFK A;  2RN7 A;  3GYH X;  2ISZ A;  2OER A;  5E17 F;  1I6H J;  5GAG J;  3BT9 A;  2EFN A;  1ZLJ A;  2ELK A;  2HOA A;  4FET A;  5CVJ A;  4IHT A;  1YW9 A;  3VUQ A;  4A3G J;  2YS9 A;  3CCL I;  5FD6 A;  3WTU C;  5FFZ A;  3QP6 A;  1KYW A;  1QPM A;  3CDH A;  3VOD A;  4DBQ A;  5ICC A;  3WGH A;  4C9Y A;  5CXG A;  4IHY A;  3I9V 2;  4P55 A;  2M30 A;  4E7I A;  4JKZ A;  5JLX A;  4CCK A;  2F5V A;  3LA3 A;  2ZY9 A;  3PO2 J;  4LLL A;  3NAR A;  4AF5 A;  3ECO A;  1OCP A;  4G6T B;  5F0F A;  4MHG A;  4ESF A;  2IW5 A;  1G3S A;  1VQ5 I;  4NQW B;  2E7X A;  1QZZ A;  1DGW Y;  2BW3 B;  4LG0 A;  1HC8 A;  2VJ5 A;  3OV8 A;  4ITV A;  1RR7 A;  4C30 A;  1AU7 A;  1MMG A;  2STW A;  2EFW A;  5K5O A;  1VQP I;  3ZN1 A;  4BAC A;  1VI0 A;  1W5C C;  1HW2 A;  2L54 A;  1F43 A;  3NWS A;  4RAZ A;  2A05 A;  1BI2 A;  2P5V A;  3TP3 A;  2IA2 A;  3GLL A;  4KIS A;  3O8H A;  3GLX A;  2ZKZ A;  4MO7 A;  2HR3 A;  4DVY P;  3OR2 C;  2VLA A;  3F9K A;  2DPU A;  4E7S A;  2M4G A;  4BHC A;  3JRI A;  3IAM 2;  4UUT A;  2VXD A;  2CQN A;  3HJE A;  2COM A;  2ECC A;  3V4G A;  3FXQ A;  4BAY A;  2Q2E B;  4HST A;  1IN8 A;  2B1E A;  3QAH A;  2V57 A;  2EA2 A;  3VW2 A;  1F9N A;  1HF0 A;  4OAZ A;  3VWB A;  4A3K J;  5EF6 A;  2H8W A;  4QLC U;  1K78 A;  4IHV A;  3K4B A;  1RES A;  3HEF A;  2G7S A;  4PDK A;  3TQN A;  3BCA A;  2W4S A;  3WTW C;  2XV4 S;  5J3L A;  1LQ1 A;  4BS9 A;  2HXO A;  2ID3 A;  2EFO A;  3TMO A;  1E0E A;  1K61 A;  1V3F A;  3QP5 A;  2FXA A;  4HX7 A;  3N97 A;  1V5G A;  4HV5 A;  1YQA A;  5JHF A;  2RGV A;  1A36 A;  3ZOB A;  1MKM A;  3CLO A;  4JK1 X;  2EH3 A;  1BA5 A;  2PJR B;  4OIO F;  1OYW A;  1YX3 A;  2DJI A;  2KHM A;  4UDS A;  4HF0 A;  2EFP A;  3DBH B;  3FKJ A;  5EYR A;  3SEQ A;  4ESB A;  1JHF A;  3ZMT A;  5DM7 F;  5ED4 A;  1R1T A;  2YX7 A;  2E1M B;  4M6X A;  2FMY A;  2NX4 A;  2LY2 A;  2EV0 A;  4XLF A;  3RZO J;  3KKC A;  3CUQ B;  3ELK A;  1PVE A;  2FBK A;  3M1C A;  2IXS A;  1P7I A;  2KRH A;  1VQO I;  2K86 A;  3HKZ N;  3CMY A;  3HOT A;  4WIB A;  4ZZL A;  2G7H A;  1BBY A;  4JNN A;  1R49 A;  1YYV A;  3W6J B;  3CCM I;  2ICW G;  2UXX A;  2KIS A;  2A68 F;  2ZME B;  1TC3 C;  5BNG A;  4UHT A;  5KNL A;  1Z6T A;  1KU9 A;  1UFM A;  3GW2 A;  2FQ3 A;  3PL8 A;  3HOW J;  2Z99 A;  2DMQ A;  2OCE A;  2W24 A;  2ZB9 A;  4RLQ A;  3OIP A;  5DTD A;  3BDD A;  3D5S C;  3KP7 A;  2XAS A;  3ULQ B;  4B4C A;  5HLG A;  1ZRE A;  3S1Q J;  2E1O A;  5EGO B;  4RB3 C;  1FMW A;  4C3J J;  2UXH A;  4G8X A;  4I6Z A;  5CVU A;  4OMY A;  2MA3 A;  1XC5 A;  2L2O A;  4PFO A;  4PSW A;  4CYC B;  1C0W A;  2B63 J;  3D5L A;  5HLT A;  5LGU A;  1OCR H;  3W3C A;  1UI5 A;  1HKQ A;  3BJ6 A;  2QOP A;  4KIB A;  5HDG A;  3F1B A;  2UXP A;  1I3A A;  1IUY A;  4QWQ A;  5L3E A;  2PJP A;  4G6Q A;  4F52 A;  1UHS A;  2M8E A;  1B9N A;  1X19 A;  2DOE A;  5FLM J;  3S1N J;  1UHM A;  4CGZ A;  3OY9 A;  3OSG A;  4EM2 A;  2ELH A;  4CZC A;  2MLK A;  4U0Y A;  2VUM J;  3VEP A;  2GA2 A;  5IPA A;  5K7Z A;  3IKT A;  2IA1 A;  4P96 A;  2CU7 A;  3HGY A;  5J1U A;  1K83 J;  4GCK A;  3QPS A;  3QRF F;  1QZE A;  2OBP A;  3FXL A;  2VPR A;  3BRU A;  2R5Z A;  2F5D A;  1TNS A;  3B02 A;  5TGT A;  4AWX B;  1FYL A;  1H88 C;  2NP5 A;  4IF4 A;  2MD0 A;  3QPL A;  3ANP A;  2HOS A;  2FEZ A;  1TP4 A;  2A3S A;  2E34 A;  3A03 A;  2W53 A;  3NI7 A;  2HYJ A;  3L7W A;  3W6V A;  1MBF A;  1J0R A;  3WE3 A;  5E3L A;  2K3P A;  3ZMV A;  1XSX A;  1P92 A;  2BBY A;  2Y0S N;  1U8B A;  4ENK A;  2QM3 A;  1U2W A;  1IRX A;  1ETO A;  3BY6 A;  5J47 A;  5FLX K;  3BRO A;  2Y69 H;  5E3O A;  2BZT A;  1K6Y A;  2Y9Z A;  2O6G E;  1YIJ I;  2E36 A;  5LFA A;  2GM4 A;  4BQA A;  3IWZ A;  1MGT A;  2FML A;  5GAD J;  2HFH A;  3OR1 C;  3QU3 A;  2A61 A;  5B66 C;  1XGN A;  2E19 A;  1MNE A;  3ZQ7 A;  1PDN C;  3AG2 H;  4Y13 A;  3RJP A;  2KMU A;  2MC4 A;  3HHG A;  2QSG X;  3E5U A;  4HQE A;  3LSK A;  1P4X A;  2R7D A;  4XRF A;  4GCL A;  1FY7 A;  2R3S A;  1YG2 A;  2IS6 A;  4GRI A;  1R22 A;  4HZF A;  5F08 A;  3V8J A;  3OOU A;  4BL0 B;  4I02 A;  3GZN B;  2PMZ N;  3DCF A;  3BCG A;  3HTI A;  1MBJ A;  4BDY A;  4YIF A;  4JX6 A;  4Y52 J;  2DG7 A;  4G7H F;  5HS7 A;  3QPH A;  4JP0 A;  2B3W A;  2GIV A;  3RQ4 A;  4FE7 A;  3BJO A;  2H6C A;  3P9C A;  1W5S A;  2X4H A;  1BJA A;  2QVO A;  3PSF A;  4KT5 C;  4NB5 A;  4Z2Y A;  1IF1 A;  3PQK A;  3R0J A;  5J40 A;  3K0L A;  4PXI A;  5HLH A;  2JVH A;  2E5N A;  2G3B A;  4HV6 A;  2K40 A;  2WAE A;  2C6Y A;  4L5I A;  4MQ9 F;  3ONQ A;  2TRT A;  1BIA A;  4HF1 A;  1LVK A;  1BM9 A;  4I09 A;  2GQQ A;  4BE1 A;  1DDN A;  5JLW A;  4N4N B;  2MH2 A;  5FGM A;  3ML6 A;  3IV5 A;  5GP9 A;  2M0C A;  2BVM A;  5F0C A;  1WI9 A;  3O6B B;  3TL4 X;  4EJU A;  2QKM B;  2RNG A;  1QVT A;  1Z3X A;  1FTZ A;  3VPR A;  3BC8 A;  5ERI A;  2K7L A;  3CMM A;  3CCS I;  1R36 A;  2J5O A;  4RGX A;  3HTA A;  3F8N A;  2KJC A;  5K7F A;  3N4M A;  3I56 I;  1TT5 B;  3VFZ A;  4YG2 F;  2WAQ A;  2DPD A;  2HZD A;  5GTI C;  5L3F A;  5L3D A;  1TWG J;  2Y2Z A;  3RKY A;  4CA0 A;  4MEY F;  1VZ0 A;  1GLN A;  2M9H A;  1HLV A;  1P9Q C;  1T0F A;  1QZY A;  1OMI A;  3C18 A;  3FBN B;  3MNL A;  1KU3 A;  2Q0O A;  5DCM B;  3ZQQ A;  3VW0 A;  1POG A;  1JUM A;  3CO7 C;  1T6S A;  3LQR A;  4OIR F;  2VQH A;  1S7E A;  3HM5 A;  4PJN A;  1O57 A;  4E7Z A;  3DU6 A;  3LA2 A;  4AUX A;  4ESJ A;  2ZFW A;  3IH3 A;  2DMP A;  3TW7 A;  1F5T A;  5FKM A;  2L9R A;  2HDC A;  4OIQ F;  3PO3 J;  1K4S A;  4C2M A;  1ZK8 A;  3NRG A;  1WWX A;  2CYY A;  3RH2 A;  1HKS A;  4WXH A;  4XBF A;  2HZT A;  3RPU D;  3U2R A;  4OD5 A;  4G6D A;  5DEQ A;  4ZYA A;  2VBY A;  2YSR A;  1T56 A;  1KQ8 A;  3HOZ J;  3CF2 A;  4Q5S F;  2A69 F;  2QQ8 A;  4NN1 A;  1FZP B;  1ORK A;  3H5N A;  3RTR A;  4ZYE A;  3TDU C;  3T0Y A;  2BY0 A;  3QWL A;  4UUS A;  1KU2 A;  1ZKG A;  4I01 A;  3RZD J;  4KIG A;  1H9T A;  1QBJ A;  2O8K A;  3OMY A;  2VQL A;  2DA6 A;  1J75 A;  4CUG A;  4XLA A;  3KZI C;  5KCM A;  2R7R A;  3BG3 A;  3TDZ C;  5D8L B;  4DGW B;  1DUX C;  2ZCW A;  3M07 A;  4MIM A;  3S3N A;  3CCV I;  3F23 A;  4BXF A;  1OR7 A;  4ENJ A;  1A6Q A;  2EPF A;  4HBL A;  2XAQ A;  1Y8R B;  3KP2 A;  4YEJ A;  2P4W A;  1XB4 A;  3CME I;  1JGS A;  1FBS A;  2VOO A;  2CW8 A;  1R1V A;  4PFP A;  4M3B A;  4WK8 F;  1T38 A;  2XRO A;  3WE2 A;  5FKN A;  1ON1 A;  1X1D A;  2GOM A;  3CES A;  5CLS A;  1MBG A;  2ZJP F;  4YFK F;  4KDP A;  3WTS C;  4M72 A;  4B43 A;  1R9T J;  1HKT A;  3ZMZ A;  3GTJ J;  4DZJ A;  3H5A A;  1SMY F;  3RDI A;  2VE9 A;  2MD5 A;  2OUM A;  1ZRF A;  4V2F A;  1QRY A;  5J4Y A;  2N8G A;  4M9X A;  4G94 A;  3CJQ B;  4A0X A;  1HA8 A;  2EQR A;  4BXX J;  4L5J A;  4Y17 A;  4PJ0 C;  1A6I A;  3F8B A;  5F1R A;  2IGO A;  4Y7N J;  4U88 A;  4JBA A;  5FJ8 J;  3O3K A;  1KA8 A;  1X3Z B;  2EIK H;  1NTC A;  3DTI A;  2K4B A;  3CJT B;  3EQL F;  1MJB A;  5FD5 A;  5C3E J;  3K10 A;  3V8L A;  1SC7 A;  4GDF A;  3BOQ A;  5L3C A;  5JVT A;  3WG7 H;  4RM2 A;  2L02 A;  1PJR A;  4CXF A;  3JRB A;  5BMZ A;  5H6Q A;  4S0H B;  1IV6 A;  1UAA A;  4GCT A;  5DYM A;  1L0O C;  4GCV A;  2LG4 A;  3J7Y J;  2JA8 J;  2ZBK A;  2FQ4 A;  3BZK A;  3L00 A;  3AAF A;  2QQA A;  1YIT I;  5D19 A;  2LY9 A;  4QPQ A;  2Q8K A;  1X1A A;  3C7J A;  3TGN A;  3OYA A;  2KDO A;  3LMM A;  2M1B A;  3K1M A;  4LMY A;  3P9T A;  3T6N A;  4ZYH A;  2IBD A;  1W7P D;  2RAS A;  3DQV C;  1OCT C;  1YIO A;  3ZCO A;  3B81 A;  4EAT A;  5GAH J;  3EUH C;  2OJE D;  2V1D A;  4YZE A;  2DMN A;  1A35 A;  5HAW A;  3H0D A;  2FOK A;  3S32 A;  1MMD A;  1V4R A;  1WGX A;  5CVR A;  3V7S A;  1STZ A;  1RC9 A;  1JKR C;  4UVC A;  2KRF A;  3DP7 A;  2L7K A;  3G3Z A;  2QF7 A;  3DBL B;  4A12 A;  3CDI A;  3VSK A;  1USS A;  3PQJ A;  3MWM A;  5ICG A;  4HG2 A;  4J19 A;  3BPV A;  5HDN A;  3RQI A;  1I1G A;  3J81 Z;  3GFI A;  2BE5 F;  4EJW A;  1M1E B;  5J4V A;  2DK8 A;  2JPC A;  3KFW X;  3ZQI A;  3S8P A;  2WV1 A;  2CFO A;  2Z5U A;  3T5X A;  3RYP A;  3SWH A;  2VJJ A;  2JUC A;  1H8A C;  2XDV A;  3K8P C;  1YOV B;  1VQK I;  2RNJ A;  2HQA A;  4KJZ A;  1FTT A;  3PNV A;  1OFC X;  2RQQ A;  3AG1 H;  4L62 A;  2FNP A;  4BBR J;  1O7F A;  1JUP A;  4RGR A;  1WJ5 A;  3HC7 A;  2GXG A;  2WB1 N;  4RS8 A;  5D4S A;  3GEU A;  2PG4 A;  5HBU A;  3H9Q A;  2R7T A;  1DP3 A;  1A5J A;  3FHN A;  1TW3 A;  4M3E A;  5CPR B;  3ABM H;  3F6O A;  4LK1 F;  3OYL A;  3GZ6 A;  4MXM A;  4FX4 A;  1MJ9 A;  5B5E C;  3OL4 A;  2LOO A;  4XR6 A;  1JE8 A;  3SJM A;  1WJC A;  4XRS G;  2BY2 A;  2X6W A;  3SZP A;  2X6O A;  2VN2 A;  1K79 A;  4PJL A;  2P8T A;  1SD5 A;  1WJA A;  1PUE E;  1SEU A;  4M74 A;  4BBS J;  1N78 A;  2FD5 A;  3HSF A;  5IT9 Z;  4XNF A;  3QOP A;  2WTE A;  3RKX A;  2KL4 A;  3OYE A;  3WHC A;  3L2V A;  5JVG F;  1DPU A;  3F3X A;  1OCO H;  2LLK A;  4ZYG A;  4BE0 A;  2GLO A;  5C44 J;  4DQ2 A;  3PIO F;  4AYB A;  5E1W A;  4II3 A;  3HTH A;  5FKK A;  3W2W A;  2D6Y A;  3REO A;  1S9H A;  3L2R A;  3BJB A;  4CZZ A;  2FBQ A;  5DUK A;  4CO8 A;  3GZI A;  3NPI A;  2XRN A;  1LDJ A;  4IQJ A;  3ESW B;  1Y56 A;  3F8M A;  3A01 A;  4RB1 A;  2GXA A;  2NS7 A;  4LG3 A;  3R4K A;  5E18 F;  3JRH A;  2H94 A;  1D3Y A;  4XLN F;  1IZ1 A;  3VVY A;  2LRE A;  2D2W A;  3P5J A;  1FP1 D;  2M45 A;  2RV8 A;  1D8K A;  1E3P A;  1IN7 A;  4EQQ A;  3LSP A;  1D5V A;  2CG4 A;  3LL7 A;  4BH9 A;  2MLG A;  4IEJ A;  3QQA A;  4BJ5 C;  3CWR A;  1N75 A;  3KEY A;  1J9I A;  2LBF B;  3Q0W A;  2LNB A;  2O3F A;  2W82 A;  3FKI J;  4DZP A;  2AQE A;  5EDN A;  2JVG A;  5TRD A;  3JRG A;  1QGP A;  2NOJ B;  3DF8 A;  3CUQ C;  5E3M A;  3I4P A;  2L9S A;  5AIQ A;  3KEO A;  3S2D J;  2RKH A;  2HYF A;  4PGG A;  3K9T A;  3MKW B;  2PI0 A;  4RAG A;  4FTH A;  2QQ9 A;  3FRQ A;  5E79 C;  2I8D A;  2V79 A;  1IN6 A;  2ZME C;  3FXJ A;  1KU7 A;  1U0J A;  1FPQ A;  3C1D A;  4F7Z A;  5C4X J;  1YW8 A;  3ASN H;  3BZC A;  3AG4 H;  1B1B A;  3K4J A;  1ITY A;  2F6C A;  3OYG A;  2MH9 A;  3F0C A;  4RBO A;  2LF8 A;  2DLL A;  3GXO A;  4IO9 F;  2CV0 A;  4C2T A;  1MDM A;  3DEU A;  1Y8Q B;  2X6X A;  1QQI A;  3WGG A;  4A2U A;  4NDL A;  1HST A;  3VSL A;  3CMA I;  4A93 J;  1X4O A;  4H0E A;  2W57 A;  2QUF A;  4BYY A;  2YVX A;  5LRR A;  1LNW A;  3LSG A;  2L9V A;  5CYV A;  5A2Q K;  4L9J A;  4Y33 A;  4B48 A;  1HW5 A;  4CCL A;  1QPI A;  3MKL A;  4I0B A;  1DU6 A;  2UXI A;  1BR1 A;  2P5L C;  2JRM A;  2VB6 A;  2XGE A;  2DA5 A;  3MZ8 A;  2ZXJ A;  3H92 A;  2EK5 A;  1BN5 A;  2ZOZ A;  4YFX F;  3NQO A;  2OD5 A;  2V26 A;  3FXK A;  1JKP C;  4OAY A;  2HNH A;  2FUG 2;  3RIR A;  1TQM A;  2ZFU A;  3I3L A;  2NVT J;  2PBI A;  1W1W E;  3BZ6 A;  1RIO H;  3MVP A;  5CQG A;  1JXS A;  1LFB A;  2IPQ X;  5D18 A;  2OC6 A;  2XAG A;  5EJC A;  3IUV A;  1J09 A;  2COB A;  2P7V B;  1FMV A;  1TTY A;  3D5R C;  2HTJ A;  3GF2 A;  3ECH A;  1SVM A;  2IGK A;  2O0Y A;  3NWT A;  4RLF A;  2DAO A;  5EG0 A;  2QBY B;  2QLZ A;  2W85 A;  3T8R A;  3JRE A;  1MND A;  5D8K B;  2M0M A;  4G9Y A;  5M5Y J;  3G4S I;  5FRN A;  3HYI A;  5D5U B;  3JAM K;  3I59 A;  4FIS A;  1MNM C;  4UUV A;  1SFE A;  2BXY A;  2R4G A;  3JRC A;  2OAZ A;  1Y0N A;  2BYV E;  2K5C A;  2XAH A;  4BU2 A;  3D1N I;  1MMS A;  1AWC A;  5DD4 A;  5CVI A;  1HQC A;  1J5Y A;  2XRL A;  5CJ9 A;  5ICE A;  2XPW A;  1F36 A;  3PFI A;  4U0V A;  1S7O A;  3WOD F;  3E3V A;  1X3U A;  1BL0 A;  1DGR M;  5AON A;  1D1C A;  5HSZ A;  5AIP A;  3L9F A;  1B8I B;  2CJJ A;  3VP5 A;  1O7L A;  5KHD A;  1XX5 A;  4BDZ A;  4KFC A;  5D6F A;  2AQF A;  2LC2 A;  2XB5 A;  1B59 A;  5EFY A;  3WTY C;  5BPD A;  3L2U A;  3OYJ A;  4AIJ A;  1LFU P;  1JKO C;  1ZQ3 P;  4CCJ A;  1JKQ C;  2W1O A;  3HOS A;  3JW4 A;  3H3Z A;  1ERD A;  5H9T A;  1RZ4 A;  1SFU A;  2R7Q A;  3K4N A;  3LNQ A;  1B6A A;  3PUF A;  5LHG A;  2D1V A;  2VIX A;  3GTQ J;  2AHQ A;  2Z33 A;  3Q9V A;  1J7K A;  3GCM A;  4IVN A;  5BS6 A;  3KX2 A;  4DYR A;  4A3F J;  4D5C A;  2JA7 J;  2VOD A;  2M7A A;  4HEA 2;  1G3W A;  2HVR A;  4IHW A;  4BY1 J;  1D8J A;  3KNW A;  2I5U A;  4XKC A;  5LGT A;  2ZJ2 A;  3S93 A;  5LGN A;  1MBK A;  2P81 A;  2BXZ A;  1RRJ A;  1ZHF A;  5FMP A;  1YO5 C;  2CUF A;  1X2N A;  3AG3 H;  2F2E A;  3OIO A;  3HZJ A;  4MLO A;  1GV5 A;  2K85 A;  4MGR A;  5IP7 J;  3J80 K;  3H9J A;  1BC7 C;  3S1R J;  3I64 A;  4A3C J;  2VQC A;  3I53 A;  5KAI C;  1LPQ A;  2XGD A;  4NC8 A;  2HKX A;  2ZSI B;  3NEU A;  4XLE A;  2PFV A;  4KUM A;  2CRG A;  1UCR A;  3M1E A;  2FU4 A;  1T8I A;  1FSH A;  2PMH A;  3H0G J;  5IT3 A;  4E6K G;  4LB5 A;  2EFQ A;  4C2M J;  2X1D A;  1FIP A;  4GFL A;  5K5R A;  4Y3O A;  2RRE A;  2DQR A;  1ZR4 A;  4Z6Y A;  4PCQ A;  4GFB A;  5H20 A;  3CJD A;  2MFZ A;  1Z9C A;  3JRD A;  1FWZ A;  2OA4 A;  4ASN A;  1MW7 A;  2KZG A;  2ZXW H;  3ZQH A;  3JSJ A;  5IOZ A;  2OQG A;  2L5Q A;  3SHF A;  2BW3 A;  5TIS C;  4R8H A;  2A5Y B;  2OPT A;  1I3Q J;  4BJT A;  4KYW A;  5DAJ A;  4A0Z A;  2V4J C;  1VQL I;  2EWN A;  2MG4 A;  4NHJ A;  2GAU A;  4A3D J;  4OU0 A;  2FX0 A;  5LRS A;  4QTR A;  2VT2 A;  1WKM A;  3SQN A;  1ZGA A;  2ZNY A;  1OYI A;  1YRN B;  2HS5 A;  5E1Z B;  5TJJ A;  5IYC J;  2XF7 A;  4ZDO A;  2VKH A;  3DV8 A;  2M7B A;  1R5H A;  2MW8 A;  3E0J B;  2HQN A;  3E6M A;  3VYR B;  2UUZ A;  1O3R A;  1FLI A;  3KYL A;  3RKW A;  3ERE D;  5FRO A;  1IDZ A;  4MEX F;  3IL2 A;  4N4O B;  1U8R A;  4UY8 I;  4OD4 A;  4GGG A;  3LHQ A;  4BEH B;  1XDS A;  2K02 A;  2Q2E A;  1O4X A;  2FF4 A;  2D1H A;  2HXI A;  2KIM A;  3TOB A;  2ID6 A;  3IC7 A;  3RI4 A;  1ETQ A;  2VC0 A;  4EGY A;  3ZP5 A;  4I76 A;  3FIW A;  1OLT A;  3TO7 A;  3BCB A;  1I6X A;  4MFD A;  1Y0U A;  1WJD A;  2L7F P;  2DFF A;  1NHA A;  5FO5 A;  4WX9 A;  2WAF A;  4ZTJ A;  4X1E A;  4UNO A;  2Q24 A;  1YS7 A;  2H1L A;  3TO9 A;  1XMA A;  3OYC A;  1VQ7 I; 
#chains in the Genus database with same CATH homology
 1HDD C;  2YU9 J;  5EZH A;  2HDD A;  3FK7 A;  4LOC A;  2PZ9 A;  3EGQ A;  4ME9 A;  3S15 J;  2NP3 A;  1RPW A;  4M3B A;  2GEN A;  2E2H J;  1Q1V A;  1ZGW A;  3BTC A;  2EZL A;  3HE0 A;  5FKN A;  2VKE A;  1SFO J;  1MBG A;  1JT6 A;  2HYT A;  1UI6 A;  4EEF G;  2E2J J;  5EG0 B;  2QCO A;  1ETY A;  4G12 A;  1R9T J;  3GTJ J;  1X2M A;  2R5Z B;  1HOM A;  4DZJ A;  2CQQ A;  2R92 J;  4AC6 A;  2R7Z J;  5F0H A;  3JR9 A;  1FEX A;  4V2F A;  2KDZ A;  3S2H J;  1QRY A;  1Z77 A;  1ZR2 A;  2ECB A;  3L1P A;  2N8G A;  3LWJ A;  1IUF A;  3E7Q A;  1QVU A;  4D7M A;  3IH2 A;  1FIA A;  2NS8 A;  4C3H J;  2Y9Y A;  2EQR A;  4BXX J;  1A6I A;  4A3B J;  2LFB A;  2WAQ N;  4Y7N J;  2LK2 A;  4FE4 A;  2D5V A;  2WUI A;  1IG7 A;  2ZCX A;  5FJ8 J;  2CUE A;  3COL A;  1NTC A;  5C3E J;  2ZOY A;  4XK4 A;  5CXI A;  2R5Y B;  2FJ1 A;  1W0T A;  3JRB A;  4CGR A;  4ICH A;  2LR8 A;  1CQT A;  4S0H B;  1IV6 A;  4GCT A;  2DA3 A;  2HOT A;  3KKD A;  2JA8 J;  3BR1 A;  3RKQ A;  2FQ4 A;  3A02 A;  3LJL A;  5D19 A;  2LY9 A;  2OF7 A;  3BR6 A;  2QWT A;  2DN0 A;  2H8R A;  2GFN A;  1JUS A;  3P9T A;  3T6N A;  2IBD A;  2RAS A;  3VOX A;  1BW6 A;  1P7J A;  2RAE A;  3HBL A;  5EGO A;  2HI3 A;  1OCT C;  9ANT A;  3B81 A;  3ZQC A;  2RHA A;  4CYC A;  4NEL A;  2Y31 A;  2K9S A;  2ZCM A;  4YZE A;  2DMN A;  5HAW A;  3HIM A;  2K9N A;  1XG1 A;  2OI8 A;  2F07 A;  1WGX A;  1MBH A;  1JKR C;  1OJL A;  2QF7 A;  2XPV A;  2XGC A;  5DS9 A;  3KZ9 A;  1PUF B;  3AQT A;  1BW5 A;  3WHB A;  1LE8 A;  1RKW A;  4J19 A;  2DG8 A;  2LP0 A;  2G0E A;  3RQI A;  2YVH A;  5GPC A;  4C3I J;  5M5X J;  3PAS A;  3S5R A;  5FKO A;  1H89 C;  3ZQI A;  1ENH A;  1ETK A;  3LSJ A;  4A3M J;  2WV1 A;  2GUH A;  3OSF A;  1H8A C;  2DA7 A;  2AO9 A;  2OER A;  5IYD J;  1I6H J;  3GTG J;  3BTJ A;  2VKV A;  1HCR A;  3BT9 A;  2HOA A;  2ELK A;  1MH4 A;  4XRM A;  1FTT A;  2JN6 A;  5M5W J;  3VUQ A;  4A3G J;  2YS9 A;  5K58 A;  1U9O A;  4M3F A;  3FK6 A;  1OFC X;  3Q3S A;  4L62 A;  4JX5 A;  3GTO J;  4BBR J;  1JUP A;  5GPA A;  5IP9 J;  2UXO A;  4GFK A;  4A3I J;  4AC0 A;  1JTY A;  3G56 A;  2WB1 N;  1ZTR A;  5CXG A;  4IHY A;  3GEU A;  3ZQG A;  3UKG A;  5HBU A;  2DMU A;  2H1K A;  2G7L A;  4JKZ A;  5JLX A;  1A5J A;  4MFE A;  4QIW N;  1B72 B;  1GV2 A;  3PO2 J;  3BR3 A;  4M3E A;  3NAR A;  2O9L A;  3S17 J;  4MXM A;  4AF5 A;  5F0F A;  1OCP A;  3GTL J;  3I4M J;  3PM1 A;  5K7H A;  2ME0 A;  1RR7 A;  3SJM A;  4XRS G;  3BTL A;  5IYB J;  1AU7 A;  1B8I A;  2WGB A;  2X6O A;  4V2G A;  1JJ8 C;  3AQS A;  4JX4 A;  4DYQ A;  1E3O C;  3ANG A;  1JGG A;  1VI0 A;  3S1M J;  4BBS J;  1F43 A;  2FD5 A;  2G7G A;  3TP3 A;  3WHC A;  1JJ6 C;  3BR2 A;  3O8H A;  5D1R A;  4MO7 A;  3LOC A;  3V78 A;  2LLK A;  3HGG A;  1TWC J;  2GLO A;  5F1J A;  5C44 J;  1AKH B;  4KWA A;  1GVD A;  3BR5 A;  5AQC A;  3VOK A;  1DU0 A;  1W0U A;  2K9Q A;  3JRI A;  3HTH A;  5FKK A;  2D6Y A;  4UUT A;  3BJB A;  2ECC A;  2FBQ A;  4UUS B;  3GZI A;  3HB9 A;  2V57 A;  1WH7 A;  3NPI A;  3CDL A;  3VW2 A;  2JWT A;  1RKT A;  1HF0 A;  2HKU A;  3QBM A;  5CW8 A;  2XPU A;  3A01 A;  4A3K J;  5EF6 A;  2Y30 A;  1Z0X A;  2NS7 A;  5EZG A;  2IEK A;  4IHV A;  1RES A;  3JRH A;  3HEF A;  2G7S A;  3VVY A;  2QTQ A;  3S16 J;  5J3L A;  4M3D A;  3HTJ A;  4IHX A;  2HXO A;  3GTK J;  1SAN A;  3CQZ J;  2ID3 A;  2JJ7 A;  1K61 A;  2MGQ A;  3LSP A;  4IEJ A;  3QQA A;  3CWR A;  3ZOB A;  1HDP A;  1UG2 A;  4ABZ A;  2EH3 A;  1BA5 A;  4MK6 A;  2X48 A;  3Q0W A;  3BTI A;  3FKI J;  4DZP A;  2ME6 A;  4UDS A;  5EDN A;  1IC8 A;  2NVX J;  2M34 A;  5EYR A;  3S14 J;  5HOD A;  3JRA A;  3JRG A;  1ETW A;  5E3M A;  2R0Q C;  4B3A A;  2NX4 A;  3Q0V A;  3S2D J;  1WH5 A;  3RZO J;  3KKC A;  3G1L A;  4FTH A;  3FRQ A;  1P7I A;  4HKU A;  3BR0 A;  3CMY A;  3HKZ N;  4JYK A;  4JNN A;  3MN2 A;  4XID A;  1I50 J;  5C4X J;  1ETX A;  3ON2 A;  4HNV A;  1TC3 C;  5BNG A;  2NOG A;  2QKO A;  3BQZ A;  2LVS A;  4QSH A;  3NAU A;  1NK3 P;  1ITY A;  3F0C A;  4RBO A;  2EZH A;  2X9D A;  1YRN A;  3ZQF A;  4X6A J;  4RDU A;  5J1R A;  3PPB A;  4NDL A;  1GT0 C;  3HOW J;  4A93 J;  2DMQ A;  2JA5 J;  5E3N A;  2EBI A;  2ZB9 A;  4DW6 A;  4B4C A;  5DTD A;  1XS9 A;  3S1Q J;  3BNI A;  3LSG A;  4L5E A;  2E1O A;  2REK A;  5EGO B;  3BG5 A;  4C3J J;  1MSE C;  2UXH A;  1QPI A;  2UXI A;  4I6Z A;  2KT0 A;  4W1U A;  1DU6 A;  3MKL A;  1XC5 A;  4CYC B;  2B63 J;  2IU5 A;  3C07 A;  3CCY A;  2XGE A;  1Y1V J;  2DA5 A;  3TW6 A;  2YVE A;  1WCM J;  1UI5 A;  2ZOZ A;  2UXU A;  2QOP A;  2DJN A;  3SFI A;  1IGN A;  3F1B A;  2UXP A;  3B6A A;  3V6G A;  2LD5 A;  1JKP C;  2IAI A;  1UHS A;  4M6V A;  5FLM J;  1Y1W J;  5C4J J;  2JK3 A;  2NVT J;  3S1N J;  3MVP A;  4M3G A;  1VND A;  3HDD A;  4A3J J;  2MSY A;  1LFB A;  1LE8 B;  3VVZ A;  5D18 A;  2R93 J;  1WPK A;  1U9N A;  3OSG A;  3IUV A;  2COB A;  2VUM J;  3G7R A;  5K7Z A;  5IPA A;  3VIB A;  2CU7 A;  3HGY A;  5J1U A;  1K83 J;  4GCK A;  3QPS A;  5EG0 A;  1MSF C;  4ACI A;  3GTM J;  3B6C A;  3HOU J;  2O7O A;  2VPR A;  3JRE A;  3BRU A;  2R5Z A;  5M5Y J;  2XB0 X;  3BG9 A;  4JL3 A;  1IJW C;  1H88 C;  2NP5 A;  4FIS A;  1MNM C;  3QPL A;  4D7N A;  3K2A A;  4A3E J;  2HOS A;  3ANP A;  3A03 A;  3NI7 A;  2W53 A;  3TP0 A;  3JRC A;  2HYJ A;  3W6V A;  1MBF A;  2M2E A;  2DA4 A;  5E3L A;  3D1N I;  2L7Z A;  2Y0S N;  1U8B A;  1JT0 A;  2XRL A;  1GUU A;  3M3Y J;  2XPW A;  1ETO A;  5FGL A;  1F36 A;  5E3O A;  2R5Y A;  2DMT A;  2Y9Z A;  1SGM A;  1BL0 A;  3RD3 A;  2GM4 A;  3GTP J;  5HSZ A;  1B8I B;  2CJJ A;  3VP5 A;  3NXC A;  2E19 A;  2XSD C;  5M3F J;  3DPJ A;  2XB5 A;  2JA6 J;  5EFY A;  4BKX A;  5F27 A;  2O7T A;  3QKX A;  5EEA A;  3E7L A;  4DYC A;  4GCL A;  1LFU P;  1JKO C;  3O8G A;  1ZQ3 P;  2XDN A;  1JKQ C;  5H9T A;  5F08 A;  3OOU A;  1VF9 A;  2NVY J;  2PMZ N;  4B1R A;  3DCF A;  3BCG A;  3HTI A;  1ETV A;  1MBJ A;  3LNQ A;  2EZI A;  5M3M J;  4JX6 A;  4Y52 J;  2DG7 A;  1X58 A;  3GTQ J;  2AHQ A;  4JP0 A;  4XRS A;  1IRZ A;  2PBX A;  4FE7 A;  2ZCN A;  4A3F J;  4DYR A;  4D5C A;  2JA7 J;  1EF4 A;  3TED A;  3VVX A;  4IHW A;  4BY1 J;  5F04 A;  3KNW A;  4PXI A;  3H3V K;  3BHQ A;  2L0K A;  1VFC A;  1PUF A;  3HOX J;  2G3B A;  2K40 A;  1MBK A;  2P81 A;  3HOV J;  5IOY A;  2TRT A;  3A01 B;  2L7M P;  5FMP A;  3Q0U A;  2CUF A;  1U78 A;  1X2N A;  1T33 A;  5JLW A;  3LSR A;  3OIO A;  5J1Y A;  2YUS A;  4MLO A;  3IV5 A;  1GV5 A;  5IP7 J;  5GP9 A;  2M0C A;  2LKX A;  3S1R J;  5F0C A;  4A3C J;  2QIB A;  3M4O J;  1MBE A;  4W97 A;  2XGD A;  3GBG A;  1QVT A;  1TWA J;  1FTZ A;  2CRG A;  3VPR A;  3ON4 A;  2LTP A;  2TCT A;  3H0G J;  3G1O A;  3HTA A;  4C2M J;  1JTX A;  5K7F A;  1FIP A;  3DEW A;  1FJL A;  2JMW A;  1TWH J;  3SDG A;  4GFL A;  5FHP A;  1ZR4 A;  3I4N J;  2DA1 A;  4GFB A;  3CJD A;  1TWG J;  2Y2Z A;  1B72 A;  3JRD A;  3VW1 A;  1G2H A;  2VI6 A;  2M9H A;  3ZQH A;  1HLV A;  3CRJ A;  3JSJ A;  5IOZ A;  3G1M A;  4AYB N;  2OPT A;  4BY7 J;  3MNL A;  3BQY A;  1I3Q J;  3VW0 A;  5DAJ A;  1NK2 P;  1POG A;  1JUM A;  2MG4 A;  1S7E A;  3HM5 A;  3K7A J;  3ZQL A;  4D5F A;  4AUX A;  1IDY A;  1RET A;  4A3D J;  2FX0 A;  2CQX A;  3C2B A;  3IH3 A;  4QTR A;  5FLV A;  3FIS A;  2DMP A;  3TW7 A;  3PO3 J;  5FKM A;  1WI3 A;  2L9R A;  1YRN B;  2NVQ J;  5IYC J;  1ZK8 A;  3NRG A;  3RH2 A;  2I10 A;  2MW8 A;  2HQ5 A;  3NNR A;  1AKH A;  1IDZ A;  1T56 A;  1GDT A;  3HOZ J;  4NN1 A;  3LHQ A;  1ORK A;  3IH4 A;  1TWF J;  3EUP A;  1O4X A;  2DTZ A;  1APL C;  4UUS A;  4A3L J;  3RZD J;  1ZKG A;  2DA2 A;  3O60 A;  4XIC A;  2EZK A;  1D5Y A;  1MH3 A;  3HOY J;  2O8K A;  2HXI A;  2ID6 A;  2DA6 A;  1BJZ A;  5FKL A;  4A69 C;  1ETQ A;  2W48 A;  4I76 A;  3FIW A;  2E2I J;  3JRF A;  2M8G X;  3BG3 A;  4MFD A;  4MIM A;  2L7F P;  2GBY A;  5C4Y A;  4X1E A;  2Q24 A;  5IP6 A;  1AHD P;  4FCY A;  1UMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...