3B6AA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with actinorhodin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
213
Chain Sequence
MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActR protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 70
structure length 213
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6aA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6aA02
1R9TJ 3EUPA 3I4NJ 2DN0A 3BG3A 1Z77A 3VOKA 3HM5A 3LJLA 3IH2A 5F0FA 3JRFA 2COBA 3ZQCA 2E19A 3FK6A 3HE0A 1QVUA 2DA3A 1JT6A 2XGCA 1UI6A 2P81A 1ETQA 2DMTA 3JRDA 3HTJA 3NXCA 2PBXA 5D18A 4AC6A 3A01A 2L0KA 1IDZA 2GUHA 3VIBA 2G7SA 3BQYA 3GEUA 4FCYA 2CQXA 4LOCA 1JJ6C 2H8RA 2XPUA 2NVXJ 1RPWA 4UDSA 1S7EA 2ZCMA 2UXPA 3ZQLA 2Y0SN 2FQ4A 5DS9A 3D1NI 2MGQA 1O4XA 4RBOA 3CMYA 2HI3A 4A3CJ 5FKKA 3JRHA 2VI6A 1XG1A 4A3EJ 2XSDC 1MSEC 4RDUA 4PXIA 1SGMA 3A01B 2YU9J 3E7QA 3G56A 2E1OA 2JA5J 2JN6A 5FJ8J 5EGOA 5J1YA 3NRGA 3TW7A 3GBGA 5BNGA 1AHDP 4IHWA 3S1RJ 2MSYA 1UMQA 1AU7A 3DEWA 5IYBJ 4HNVA 4XRSG 2UXOA 4NN1A 3AQSA 3HGYA 2OF7A 3S2HJ 1VI0A 3QBMA 4M6VA 4Y7NJ 1DU0A 2X9DA 1BJZA 4G12A 3HOUJ 2ZCXA 3B6CA 4A3DJ 3VP5A 2K9QA 5EGOB 1W0UA 2DA4A 9ANTA 3LWJA 2G0EA 2HYTA 1MH3A 3Q0VA 3M3YJ 4ICHA 2M9HA 3COLA 1X2MA 1Z0XA 3L1PA 1ETVA 3HOWJ 1LFUP 1GUUA 1MBHA 2F07A 4UUSA 3LNQA 3VW1A 4MIMA 1FJLA 2LK2A 2DA1A 3HEFA 2CU7A 3HOXJ 2WB1N 3FIWA 3S16J 5EG0A 1MSFC 2NP5A 3RKQA 4KWAA 4JX6A 5CXIA 3HGGA 2OERA 2OPTA 2DMPA 1JKRC 5FKNA 2CRGA 5K7ZA 3HOVJ 5HSZA 1T33A 1RKTA 5IOZA 4A3LJ 4X6AJ 3E7LA 4UUSB 4Y52J 4DZPA 3VUQA 2IU5A 2LY9A 2NS8A 4D7MA 2HDDA 5DAJA 4YZEA 5F27A 5EG0B 5E3OA 1K83J 2NS7A 3VVZA 3OSFA 2XPWA 3V6GA 1JJ8C 3MNLA 2XGDA 5EEAA 3SFIA 3ZOBA 3BCGA 3QPSA 4ME9A 2K9SA 2DMUA 4CYCA 4ACIA 3CWRA 1POGA 2K40A 2ELKA 3OIOA 4XK4A 4XICA 3JRIA 4FE7A 3RQIA 3KKCA 2ZCNA 1WGXA 3C07A 5K58A 4MXMA 1XC5A 1QRYA 2K9NA 2WGBA 2JA8J 4BKXA 3O8HA 1OCTC 1ZKGA 3NNRA 2AO9A 3KKDA 3QKXA 4C3IJ 1JTYA 1MNMC 1FIPA 3BT9A 1JKPC 2ME6A 1U78A 2LVSA 1BA5A 3NAUA 4CYCB 3GTPJ 2YVHA 5GP9A 1WPKA 2IBDA 2DG8A 3BRUA 2QCOA 1MBGA 3G7RA 2CUFA 2I10A 1ZR4A 3KNWA 4GFLA 1VF9A 3IV5A 2W48A 1VNDA 1TWCJ 4W1UA 2X48A 3G1LA 3IUVA 4XRMA 3BR3A 4BXXJ 2XB5A 1OJLA 1UG2A 2JJ7A 4D5FA 3I4MJ 2O7TA 3H0GJ 4IHYA 2NVYJ 5K7FA 3JRAA 2DMQA 2NP3A 3LSPA 4EEFG 3CRJA 2NX4A 3JRGA 3Q3SA 4L62A 3S1QJ 4JKZA 2QF7A 2O9LA 1ETWA 2DA7A 2ID6A 2EQRA 3BR5A 5FLVA 2R92J 1JT0A 3HTIA 2IAIA 1P7IA 3CQZJ 3BR1A 5C4JJ 3S14J 4XIDA 2XGEA 4JYKA 4FE4A 2UXHA 2NVTJ 1Q1VA 3TW6A 3EGQA 1F36A 1HOMA 5F0HA 2EH3A 2KT0A 1W0TA 5M5XJ 2O8KA 2RHAA 2DJNA 2GM4A 2VPRA 3VVXA 5H9TA 5EFYA 2Y31A 3PPBA 3DPJA 1IDYA 3PO3J 2HKUA 2DA2A 2R5YA 2W53A 1ETKA 3BNIA 2Y2ZA 4FISA 3GTKJ 2XDNA 3HB9A 4JX4A 3C2BA 1WI3A 2CUEA 5IYDJ 4A3BJ 4M3EA 1H88C 4DZJA 5IOYA 4M3FA 1TWAJ 4V2FA 2AHQA 2L7ZA 3RD3A 1ZQ3P 1H89C 2JMWA 2DG7A 4NDLA 3B81A 1NK2P 5M5WJ 4HKUA 5EDNA 3TP0A 2R5YB 4B1RA 2LR8A 2CJJA 3BJBA 4DYQA 4L5EA 5M3FJ 3BR6A 2HOSA 1APLC 2GLOA 1EF4A 5F0CA 3NARA 3LSJA 3MN2A 4A3MJ 1U8BA 3LSRA 3AQTA 3GTLJ 1ZGWA 1B72A 2LP0A 5GPCA 1MBEA 2PMZN 3GTOJ 2ID3A 5JLXA 1TWFJ 3ZQIA 4MK6A 3WHBA 4GCTA 2M0CA 3OOUA 5HODA 3ZQFA 4DW6A 3PM1A 3O8GA 5FGLA 3HTAA 3G1OA 3K7AJ 3PASA 1HDPA 2VKEA 3G1MA 2YVEA 3S1MJ 5F1JA 1JKQC 3HTHA 2RAEA 2Y9YA 2LLKA 2DMNA 4BBRJ 1B72B 2NVQJ 1D5YA 1MBJA 4A3GJ 2RASA 4IHVA 4GFKA 3NI7A 1RETA 2EZLA 5IP6A 4UUTA 4JX5A 3O60A 2DTZA 4D5CA 1ETXA 5E3NA 3M4OJ 3UKGA 5IPAA 3S2DJ 5D1RA 1ZK8A 1RESA 5IP9J 4AC0A 2HXIA 3JR9A 1AKHA 1UI5A 3ANGA 3HIMA 1BW5A 2E2IJ 3HKZN 3OSGA 2JA6J 1ITYA 3F1BA 2G7GA 4I6ZA 4QIWN 3BTCA 2L7MP 3FK7A 4IEJA 5M5YJ 4J19A 2NOGA 3JRCA 2LKXA 4A3JJ 3JRBA 1IG7A 4MFDA 5DTDA 1SFOJ 1HDDC 2JK3A 3CDLA 1GV5A 1LE8A 2MG4A 2VUMJ 1F43A 3NPIA 3BTLA 5F04A 5C4XJ 3V78A 2L7FP 2X6OA 1AKHB 4A69C 4C3HJ 4C2MJ 2HYJA 5IP7J 2ECBA 1WH5A 3B6AA 1VFCA 2QWTA 1IRZA 3ANPA 2E2JJ 4M3BA 2R5ZA 3BHQA 1PUFA 3S5RA 2VKVA 2XRLA 1B8IA 2FX0A 4XRSA 2L9RA 1NTCA 2MW8A 5J1RA 2R7ZJ 2XB0X 3ZQGA 1FIAA 1LE8B 1MH4A 3CCYA 3LSGA 3MKLA 1I6HJ 2REKA 2WUIA 5FKMA 4CGRA 4B3AA 4IHXA 2D5VA 2UXIA 4GFBA 3QPLA 2E2HJ 2Y30A 2WAQN 4GCKA 1JUSA 4ABZA 3ON2A 2GBYA 1XS9A 5J3LA 1OFCX 2EZHA 3BG5A 2D6YA 2R5ZB 1PUFB 3ZQHA 1B8IB 3JREA 1WH7A 1ZTRA 1IJWC 5C3EJ 1TWHJ 3Q0WA 3TEDA 1T56A 2ECCA 2OI8A 1G2HA 3KZ9A 1A5JA 3QQAA 5JLWA 5FKOA 2ZB9A 2DA6A 3HOYJ 3S1NJ 3BQZA 3GTMJ 5FHPA 1YRNB 1JTXA 2HOTA 2EZKA 4B4CA 3H3VK 2DA5A 3LHQA 4A3IJ 1GDTA 2EBIA 4D7NA 3S17J 4BY7J 3A02A 2TCTA 3JSJA 1IC8A 1U9NA 3IH3A 2JA7J 3T6NA 5EZGA 4X1EA 1QVTA 5C4YA 3FKIJ 3VVYA 4AF5A 4W97A 1GVDA 3HDDA 4DYCA 2QOPA 5HAWA 2WV1A 2O7OA 1IUFA 1GT0C 1FTTA 1ETYA 1NK3P 1DU6A 2V57A 3VW2A 3MVPA 2FBQA 1JUMA 4M3DA 2EZIA 1U9OA 3RZDJ 3GTJJ 1K61A 2G7LA 1FTZA 2YS9A 1TC3C 4BY1J 4DYRA 2PZ9A 1E3OC 3BG9A 2CQQA 1ETOA 4A3KJ 1TWGJ 4V2GA 1MBKA 1HLVA 2IEKA 3HOZJ 2M8GX 3IH4A 3CJDA 5E3MA 4JP0A 1P7JA 4MO7A 5FKLA 1IGNA 1MBFA 1LFBA 2GENA 3K2AA 2UXUA 5CW8A 3W6VA 1WCMJ 5J1UA 2HQ5A 2YUSA 3WHCA 4I76A 1H8AC 3VPRA 3VOXA 3TP3A 1JGGA 2HOAA 1JKOC 1Y1WJ 3PO2J 1RKWA 3GZIA 2QTQA 5EF6A 4A3FJ 1HCRA 2B63J 2M2EA 2ZOYA 3Q0UA 1ENHA 2TRTA 3ON4A 1BW6A 2HXOA 2N8GA 2G3BA 5EYRA 1GV2A 3VW0A 1SANA 1FEXA 3FRQA 1UHSA 4M3GA 3S15J 3F0CA 1ORKA 1X58A 4AYBN 3DCFA 2H1KA 2KDZA 5F08A 4JL3A 4JNNA 3BTIA 1QPIA 2LTPA 4FTHA 2LD5A 2XPVA 5CXGA 1RR7A 4QSHA 5C44J 3BTJA 4MLOA 5FMPA 5FLMJ 4A93J 4QTRA 3RH2A 1HF0A 3GTGJ 1JUPA 3BR2A 1OCPA 2M34A 3SDGA 1I50J 3HBLA 3GTQJ 4S0HB 3A03A 2JWTA 5IYCJ 1I3QJ 2Y9ZA 4BBSJ 4NELA 5AQCA 2QIBA 2FD5A 2QKOA 5M3MJ 5E3LA 4C3JJ 2GFNA 1A6IA 1BL0A 5K7HA 3LOCA 5D19A 1CQTA 3RZOJ 4GCLA 3SJMA 3BR0A 3P9TA 2FJ1A 4AUXA 1YRNA 2ME0A 2LFBA 3FISA 1Y1VJ 4MFEA 1ZR2A 1IV6A 5HBUA 1X2NA 5GPAA 5EZHA 2R93J 2ZOZA 2Q24A 2R0QC
chains in the Genus database with same CATH superfamily
4BDYA 2GXAA 4J01A 4NHJA 4E7SA 3ZQCA 4UNOA 4PUSA 3HE0A 4L9JA 2DA3A 5TGTA 3TGNA 3FZVA 4UVAA 1OKRA 1UI6A 2DMTA 3JRDA 3NXCA 3KZIC 1YJWI 3FBIB 3VIBA 3DWLE 1W5TA 3HRTA 2G7SA 3GX4X 3EUAA 1P4WA 1S7EA 3GMEA 3ZQLA 2Y0SN 3LSTA 3SEZA 3B73A 3D0SA 1O4XA 3L2RA 1WJEA 3BCAA 3JSOA 2DK8A 2VI6A 2O8XA 1MSEC 4CCJA 4RDUA 1YW7A 3SZTA 2EB7A 1W5SA 2YU9J 2JUCA 2K5CA 1BM9A 1T0FC 2Z16A 4BE2A 3E7QA 3HOSA 5EGOA 4IZZA 4PJLA 3KX2A 3G6EI 3FHZA 3NRGA 5BNGA 1AHDP 2DJIA 5FLXK 2MSYA 4RLQA 5FD5A 5H6RA 2DAOA 3CP2A 2UXOA 4OU0A 4U0YA 3AQSA 1MNEA 2OF7A 1KU2A 3S2HJ 5HNHA 2HVRA 2ELHA 2RC4A 3PFIA 1YIJI 2JVHA 2OCCH 4F92B 4Y7NJ 1DU0A 2F5VA 1V5EA 3EUHA 2CO5A 2CUZA 3B6CA 3CJTB 2L2OA 4D0PA 1W0UA 2QBYB 4Q5SF 1OQYA 1MH3A 1FMVA 4ICHA 2K7LA 2TDXA 5E17F 3CMAI 2XKOA 1IRXA 1ETVA 2V9VA 4Y33A 3HOWJ 1C0WA 1IXRC 1SMYF 3IAS2 2LBFB 1I39A 5LFAA 2WC2A 4XOPA 3VW1A 4MIMA 1FJLA 1ZGJA 2VBXA 3U2RA 3HOXJ 4BDZA 2RDPA 2HOEA 3FF5A 3OYNA 4JX6A 1MZBA 1UCRA 5CXIA 4XLHA 2LNBA 2OERA 3QAHA 3KP6A 2DOFA 3RQ4A 1T33A 1DGRM 1PJRA 2HU9A 5ILVA 5DEQA 1OISA 3ONQA 4RB2C 2DT5A 4F91B 4YZEA 2EFQA 5F27A 3CDIA 3HTSB 2VONA 2JUGA 2RREA 5GAHJ 1YX3A 2XGDA 1K4SA 1NG7A 3QPTA 3QPSA 2O6GE 4NB5A 4AIHA 4ME9A 2GAUA 4ENJA 3SYTA 1POGA 4PJMA 2E1CA 2A69F 4XICA 3JRIA 1I1SA 2RVCA 3V8KA 1WGXA 5H6QA 3C07A 3EYYA 4XNFA 4MXMA 4HYEA 1QRYA 5CKTA 1B59A 2QGUA 4Y13A 1XMKA 1XPXA 3H3ZA 1R4NB 4C3IJ 3DBLB 2W82A 1MGTA 1FIPA 3BT9A 2ZO4A 3CMEI 1U78A 1OR7C 1BA5A 1R23A 3NAUA 2YVHA 1XSDA 4B47A 2IBDA 2DG8A 1I3AA 1A31A 4IOAF 3QWLA 5HS8A 4IRGA 4I2OA 3HRUA 2CUFA 3KNWA 1V4RA 1VF9A 4RA2A 2X48A 3O3KA 3VSKA 1OJLA 2JJ7A 2HDWA 1QQIA 3T5XA 4LGWA 3I4MJ 3OWTA 2E1NA 5E20A 2G7HA 1MIJA 3CO7C 1KQ8A 4EEFG 4KIGA 3U1KA 4U7BA 3Q3SA 3J80Z 3WTVC 1OLTA 3HRSA 2QF7A 2FBKA 2ID6A 1HSJA 2R4GA 1T6SA 3GYHX 3BDDA 1P7IA 1RR8C 1WJCA 2KL4A 1JHFA 3S14J 1V54H 2XGEA 5FRMA 1J09A 2R7RA 2UXHA 1Q1VA 1ZELA 2L3DA 4BE1A 4XLEA 4YIIA 5F0HA 1W0TA 2M0MA 1D3YA 2MH9A 2RHAA 4LG0A 2VPRA 2E34A 3VVXA 2Y31A 1EV7A 3H92A 3RKXA 2W25A 3E97A 2CV1A 3CCVI 2R5YA 2YPRA 2W53A 1HKSA 3BNIA 4XN0A 4ZYGA 2XDNA 3CUQB 3C2BA 2CUEA 5IYDJ 3KP5A 1H88C 4M3FA 4V2FA 2JSCA 3OYJA 2L7ZA 1EKEA 2ZY9A 1OMIA 3RD3A 3OYAA 4Q48A 2DOAA 4NDLA 4ANJA 2RN7A 5EDNA 1JI8A 3WG7H 3AAFA 2CJJA 3BJBA 4DYQA 3MQ0A 1YW9A 4L5EA 4FHTA 3OYMA 2HOSA 3W2AA 1L3LA 4XLCA 5FO5A 5F0CA 3MN2A 3KZYA 2H6CA 4CSWA 3LSRA 3GTLJ 2VJ4A 4IKFA 2LP0A 2R7SA 1EA3A 4DJAA 4PDKA 4Y4RA 1EJ9A 2NRAC 2XGXA 4E70A 4UY8I 1TQIA 2EILH 5ICEA 4GCTA 3OOUA 5HODA 2VQLA 5A2QK 3ABMH 4G9YA 4NQWA 1FBUA 3N05A 3S1MJ 1T39A 3KEYA 2DMNA 1J5YA 2F2EA 2NVQJ 1X4OA 1QNTA 1O3RA 2IS4A 1FP2A 4GFKA 3NI7A 2EFOA 1MMAA 5IP6A 5BPDA 1VQ8I 4ENKA 3DFGA 3M8EA 4RM2A 3CDHA 5IPAA 3UKGA 2QQAA 5D1RA 1R5ID 4HAMA 3ECHA 1ZHFA 2ZNYA 3VTIA 3VDXA 5B66C 4AC0A 3JR9A 4E7JA 1STZA 1BI3A 2JPCA 2X6WA 1FSEA 3HIMA 3ERMA 3HKZN 4A12A 2JA6J 3S93A 2G7GA 1Z6RA 2KMUA 3S2WA 3FK7A 2LRDA 1IG7A 2RNGA 4GRIA 4AYBA 3CC4I 4MFDA 1SFOJ 3RTRA 4XKVA 1HDDC 3NRVA 3GW2A 2JK3A 3EUKL 5TISC 3QU3A 3CF5F 4KNYA 2VB6A 1F43A 3NPIA 3REOA 1CF7B 3IRQA 5C4XJ 1AKHB 4CO8A 1HQCA 4U7DA 1IZ1A 3WU0A 2BE5F 2HYJA 3T0YA 5D6FA 2W4SA 3QU6A 1FNNA 3B6AA 5ILSA 2VKDA 1IRZA 1EH6A 3H5RA 3I56I 4LIUA 4HA8A 2VOPA 2VKVA 3IC7A 3K4KA 2L9RA 5J1RA 1O57A 5LRSA 3PIOF 2WAFA 1LE8B 3LSGA 2REKA 2ZSIB 4B3AA 1T08B 4GFBA 3QPLA 1R49A 4ABZA 3BJOA 4BE0A 1Y0UA 2EZHA 2R5ZB 1PUFB 3ZQHA 1IO2A 3V7CA 2M3AA 2OBPA 5C3EJ 2GA1A 1GXPA 3Q0WA 2CW7A 2OI8A 1X1DA 4YG2F 5FKOA 3HOYJ 1WRJA 1ONVA 1YRNB 4BH9A 4BQNA 2W7NA 2W1OA 3F6VA 3V8JA 1REPC 1BI1A 4F3QA 4A3IJ 1YLFA 1UHWA 4BY7J 2KKOA 1VQ4I 3L09A 3J81K 4PFOA 1D0YA 3S8PA 2BHZA 5IT9Z 3FKIJ 3VVYA 2ICWG 2O3FA 2JRTA 4AF5A 1TZLA 2BXZA 2WV1A 1YS7A 3BZ6A 3OY9A 3MKZA 1FTTA 1ETYA 2GZWA 2ZXHA 1XB4A 3KYLA 1S7OA 4XLAA 4IVNA 2DQRA 3HSFA 3E6CC 3RZDJ 3DXJF 2G7LA 1IN8A 5KK1A 3BPVA 1TC3C 3BCBA 1Z7UA 2ZXIA 2PZ9A 3BG9A 3AG2H 4CCOA 5DCMA 3UR3C 4AU7A 1TWGJ 4E7KA 4V2GA 1FPQA 2C6YA 2OAZA 1IRFA 3CJRB 3VSLA 3WODF 3WTWC 3DLLF 1VQ7I 3HOZJ 4OD4A 2M8GX 1D5VA 3IP4B 3UNGC 3IH4A 4MTDA 3E1SA 2XHKA 3L2QA 1TNTA 1IGNA 2DT6A 1XSVA 4EATA 2E36A 4IRVA 1IW7F 1YIOA 2P5LC 1IF1A 1T98A 3K2AA 2Q2EB 4IXAA 3ZMUA 3G4SI 3W6VA 3DKWA 1D8JA 3CUQC 3D5LA 2YUSA 2VC1A 2NOJB 4I76A 2XIGA 5AIQA 5EEHA 1QGPA 1JXSA 2HOAA 3ZMDA 4CH7A 4XBFA 2WY7Q 1R1VA 2QTQA 2M45A 2LKSA 1HCRA 1YHQI 4FX4A 2TRTA 1Z9CA 3ZQQA 3L2CA 3MCZA 3E5QA 4M6YA 1FEXA 4U0WA 1QZEA 3ABLH 4M3GA 4LB6B 4P1WA 2RNJA 4IF4A 4PJNA 1XGSA 3P9CA 1WZ2A 3BZKA 4EJTA 2MABA 3BTIA 1RR7A 2AXLA 3QOEA 1BBYA 4G7OF 1P6RA 4A93J 2A5YB 2FF4A 4QTRA 1HF0A 3RH2A 1JUPA 2M34A 2VXZA 3OYCA 3HBLA 5GAEJ 3KE2A 2WV0A 1SC7A 3VB2A 1YQAA 2CW0F 4MHGA 2GXBA 3J7ZI 5CQGA 4YELA 2JWTA 2Y9ZA 1J59A 3KP7A 3TL4X 5M3MJ 5E79C 3GLLA 3ESWB 3OMYA 2QKMB 1A6IA 3LOCA 2B3WA 1GXQA 3ML6A 2I5UA 1TQMA 1HXDA 1FOKA 2H27A 1FWZA 2OZ6A 2CFXA 2ACJA 2K3FA 5LGUA 1OCCH 3CZ6A 3WU1B 2R7XA 1X1AA 2CQNA 2PJRA 2LFBA 3K2ZA 1QZZA 5GPAA 2UUZA 3NQOA 2Q24A 1R9TJ 2HDCA 3I55I 4A0XA 2EFWA 3I4NJ 2DN0A 1A6QA 3EUPA 3BG3A 4C2MA 5ED4A 5E1XA 3O6BB 2E19A 3FK6A 2VPLA 1QVUA 2JTVA 2PX9A 4Z2YA 1JT6A 1FLIA 1ETQA 2K3PA 3ELKA 5D18A 4IO9F 2L0KA 3TKYA 3K70C 3S3MA 3BQYA 4RGUA 4R8HA 1OYIA 4PJJA 1JJ6C 1SD5A 2M4KA 4UV8A 2FQ4A 5DS9A 3TO9A 5F6FA 4A3CJ 1YE9A 1LVAA 2LF8A 3JRHA 4M9ZA 2CV2A 3KYCB 4BHPA 3W2WA 3ULQB 4FX0A 1R5HA 2EV6A 4IRIA 2CFOA 2BVMA 2V1NA 4A6EA 4EQQA 1SGMA 3A01B 3CP8A 3IWFA 3G56A 2XF7A 2QSHX 2JA5J 1I27A 2JN6A 3HSEA 1K6YA 2E7XA 5FJ8J 2HKXA 4HOBA 2Z3YA 5J1YA 4ZZLA 2L9SA 3GBGA 2EIJH 1SAXA 2LYCA 2O0YA 1PVEA 1W7PA 2IA2A 2Y0MA 3S1RJ 2YX4A 1F4KA 5J40A 2A5WA 4HNVA 3I53A 4HBLA 3WGIA 2P5KA 2OJED 1Y8QB 4LG0B 3QBMA 1HW1A 1BJZA 3K4LA 1J0RA 3RSNA 2K9QA 1IRGA 9ANTA 3FBNB 2KPMA 1MDMB 3CF2A 3Q0VA 2IGMA 4LLGF 4ZYHA 1ODDA 2IP2A 3JW4A 2H94A 3U21A 4P55A 5LBQA 2VQGA 1LFUP 5F64A 3E6MA 3K10A 1D1AA 1WKMA 2F07A 1I5ZA 2FMYA 1RUOA 1IAWA 3LFUA 2QQBA 3VOEA 4BXUA 5F1RA 4LMYA 3DV8A 5FGMA 5CYVA 2CU7A 2E5NA 2WB1N 4DOZA 1MSFC 4DBQA 3WU2C 3RKQA 3CCEI 2Y48A 3K1MA 4D9JA 2DMPA 4EGYA 1JKRC 2XROA 4GCVA 3K4NA 5FKNA 2IA1A 5HSZA 3L9FA 2A6HF 3QOPA 3E7LA 2X6YA 2HTJA 4UUSB 3TDUC 1G8XA 3CJQB 3LSMA 2NS8A 4D7MA 2HDDA 5DAJA 3CCQI 1FBQA 1Z91A 5EG0B 3FHNA 1ZRCA 3OSFA 5D8KB 2XPWA 5BQTA 2GXGA 5DV5A 4ITVA 1JJ8C 4JOMA 3SFZA 3IKTA 4GDFA 3WE3A 3GZNB 4PSXA 2XVCA 4EGZA 3ZPLA 2DQLA 1Z3XA 3HC7A 4FE7A 3KKCA 2ZCNA 3IHUA 4KDPA 1XC5A 2BY0A 2WGBA 1JHHA 4BKXA 3R61A 3LAJA 1ZAOA 2G9WA 3QPHA 2AO9A 2VQCA 2K85A 2DTRA 4BUPA 2DFHA 1XMXA 2KHMA 2QM3A 3ZGKA 4UHTA 2LVSA 2E5ZA 1LVKA 4CYCB 5GP9A 1FYMA 1BI2A 5HLIA 3BRUA 3V8LA 1BN5A 2QCOA 2PI0A 1XCBA 2XAUA 4A0ZA 1V5GA 1ZR4A 2V1DA 4GFLA 2HPIA 1XCVA 1VNDA 1TWCJ 2MA3A 3HJEA 4W1UA 4HQMA 3WGHA 4AIDA 3CCSI 3M8FA 3IUVA 4XRMA 3BR3A 1QO0D 2XB5A 3HUGB 1UG2A 5LRRA 1VQPI 2O7TA 2V26A 4Y15A 4G8XA 5K7FA 3F6OA 1V55H 4AM3A 2NP3A 3LSPA 2LDUA 1UG0A 4N0BA 3B02A 4RGRA 5J47A 2O9LA 4B8XA 2DA7A 1J2XA 4IX7A 1JT0A 1G3YA 2IAIA 2L9NA 4B3XA 2EPFA 2V6EA 5LGTA 1ERDA 4BJ6C 1KA8A 1XSXA 2W24A 2WTEA 2OV7A 3AG3H 1U5TA 3TO6A 5HLGA 4HSRA 1E3HA 3F8NA 3DBRB 5M5XJ 2VODA 5H9TA 4IQJA 1WWXA 3J7YJ 3NEUA 1DPUA 1WFXA 2HKUA 1B1BA 3I4PA 4UVBA 4FISA 2QSFX 4OAYA 3DPTA 4JX4A 3I64A 1YJNI 2J5PA 1TWAJ 2OZUA 4BACA 2VC0A 4YFXF 2JMWA 4NUBA 4MEXF 1NK2P 3HPGA 3CCLI 2OTJI 5CVIA 4O3MA 4B1RA 2LR8A 5J8FA 3E6BA 3J7AO 5M3FJ 2GLOA 2KP6A 2JRMA 5L3DA 1ZLJA 1U3EM 1MJAA 3NARA 3LSJA 2L02A 2FSWA 1FOYA 2UV1A 4IPAA 2KRCA 3CUOA 1MBEA 3GTOJ 3DU5A 2R7DA 2LY2A 5JLXA 3PQJA 3ZQIA 3BG6A 3WHBA 3I5UA 3DQVC 4A2UA 1S8NA 3O8GA 3PM1A 2UZKA 4KMFA 3K7AJ 2BEOA 2Z33A 4RAGA 1HDPA 4OOIA 4HQEA 4G6TB 2YVEA 2BYVE 5F1JA 3OYIA 3HTHA 4KIBA 4EM0B 4F93B 4HG2A 4BBRJ 1B72B 2STTA 4I01A 1MBJA 4HZFA 1G6NA 1BIAA 2UXXA 5DDGA 4BGDA 4XQFA 5H20A 4UUTA 4E7LA 4KISA 3O60A 2VBZA 2DTZA 1JE8A 1ZYRF 1DP3A 1MMNA 4OMZA 5CVUA 3HSRA 5E3NA 3M4OJ 3R4KA 2HKOA 4AD9A 2BY3A 5D5VB 3S2DJ 5D5XB 4QWQA 1ZK8A 3HL2A 3ERED 3FXJA 5IP9J 2RV8A 3FXUA 4BQAA 1BIBA 4RB1A 1SFUA 4A5NA 4I6ZA 2AQFA 3WG9A 5M5YJ 4A3JJ 4WXCA 2NOGA 4ESFA 1YW8A 1RI7A 1GVJA 2E7WA 5TRDA 3CDLA 1GV5A 3ISPA 5JHUA 5J8CA 5CQEA 1WJAA 2QENA 2ZC2A 3BTLA 2QUFA 5CVJA 5F04A 1YO5C 1T0FA 4I7HA 5CJ9A 2X6OA 5HS7A 2OA4A 5B1AH 1W5CC 4A69C 2YVXA 2Q1ZB 3C1DA 2A6EF 4C3HJ 5IP7J 2ECBA 4HPQA 1N25A 1WH5A 3DTKA 4E7HA 2QWTA 2E2JJ 4M3BA 4IQ4A 2IA0A 2OD5A 3S5RA 4O5VA 2FX0A 1Z7LA 3JSPA 2PG4A 1NTCA 2MW8A 2VIXA 4WF2A 4I02A 3HPHA 3QP5A 2XB0X 2BW3A 3TOBA 2IJLA 1FIAA 5JI6A 3CCYA 3V42A 2K02A 1P9QC 1W36D 3SDBA 2LG4A 1I6HJ 3GCMA 4CGRA 3QYEA 5CLSA 2HVSA 2E2HJ 2Y30A 2WAQN 4P9FA 1JUSA 4GCKA 4PGGA 2GBYA 1XS9A 2HPMA 4XLFA 1OFCX 2D6YA 1Y8RB 2CW8A 4L5IA 1B8IB 3JREA 2QSGX 1NHAA 1WH7A 1UELB 3CCUI 2MD5A 1TWHJ 1E2XA 3P7NA 1T56A 3KZ9A 3N4MA 1G2HA 2LKPA 2RKHA 1A5JA 1X4PA 3K6GA 3BQZA 3BG7A 4CCLA 3F8BA 1W7PD 3GTMJ 3S1NJ 1FMWA 1JTXA 3KFWX 4U9LA 2GOXB 2EZKA 4EJWA 3ZMZA 2ZFUA 4UVCA 3LHQA 3PJRA 4XOTA 3RJPA 3A02A 1TP4A 3DTEA 2XC7A 3CO6C 3JCUC 2E1MB 5HVQC 1OYYA 1U9NA 3IH3A 2VJJA 4KITB 2DPDA 3T6NA 5EZGA 1QVTA 2L7KA 5C4YA 4UB6C 4I0BA 1FYKA 4UB8C 4FQGA 2QOPA 2O7OA 2OQRA 5FLXZ 4JQFA 3JAMZ 5LEKA 3VW2A 4CXFA 3MKYB 3RYPA 2IRFG 2VJIA 1JUMA 2ZMEB 4M3DA 4J00A 5IT9K 2FBQA 2HZDA 1U9OA 2YS9A 4II2A 4BY1J 1GHCA 2GOMA 3F8FA 4DYRA 2XDVA 3H0DA 4A3KJ 2Q0OA 4N9IA 2PQ8A 4XN3A 3MZYA 1HLVA 1P92A 4JBAA 1FY7A 1F1ZA 3WTXC 1OR7A 1Z1DA 4KMUX 1USTA 2GENA 3LSHA 5CW8A 3PNTA 6PAXA 1WCMJ 1YG2A 3FWEA 1B6AA 4ENMA 1QZYA 3OYDA 1K6OA 3I3LA 2ESHA 4F7ZA 5JVGF 3VPRA 2ZNZA 4ON0A 2H8WA 3GFLA 1JGGA 2X1DA 2COMA 3ASNH 3PUBA 1V3FA 3AFHA 2A07F 2LSOA 1RKWA 2P4WA 3VYTB 1EH7A 3R0AA 5EF6A 3P5JA 5KHDA 4A3FJ 2GA2A 1BW6A 2HXOA 2N8GA 2R7WA 3DBHB 5EYRA 2G3BA 1RRJA 4I0AA 1XDSA 4AWXB 3CC2I 2ZFWA 3LSKA 3FRQA 1UHSA 2YU3A 3S15J 3F0CA 1X58A 4QLCU 3NWTA 4OMYA 2FOWA 2HWVA 3U1DA 3M8JA 1KU7A 3ECOA 1S72I 3ZP5A 2DW4A 4RAFA 4JL3A 3R0JA 4JK1X 1QPIA 4FTHA 2LD5A 1N78A 4QSHA 1PYVA 3SHFA 3TBIA 5L3GA 2XF6A 4MLOA 4LK0F 4C2TA 4YEJA 3IUOA 3GTGJ 3SDGA 5B3SH 3GTQJ 3I59B 2VL8A 4NELA 1I3QJ 4D1QA 5D4SA 2QKOA 4BNCA 3F23A 1Q1HA 1MJ9A 2JPBA 2KFDA 2DODA 5K7HA 4HW0A 4HV6A 2ZJQF 1CQTA 5D19A 3RZOJ 2EFPA 1YYVA 3H9QA 3BR0A 5B5EC 2FJ1A 5CPRB 3CCJI 4WWCA 2ME0A 4M9SA 4MFEA 1ZR2A 1IXSB 2MC3A 3EDPA 4C30A 1G3WA 2R7FA 2CH0A 4MNUA 3VOKA 3HM5A 5F0FA 2EK5A 3H5NA 5KAFC 3JRFA 1S5LC 4L9VA 2OUMA 4B09A 3C2GA 2XGCA 2R7UA 2NNYA 1XGMA 3HTJA 2X4HA 2PBXA 4AC6A 1E3PA 3RI4A 3QODA 4GXOA 1XN7A 4NC8A 2CQXA 4LOCA 2XPUA 2P6TA 1RPWA 5DCFA 2XAFA 4Q47A 2UXPA 4XM3A 4Y17A 1UZCA 2MGQA 5FB2A 1XD7A 1TQPA 5FKKA 3U9GA 2DPUA 1FX7A 1HW5A 4L9NA 1XG1A 5E8IA 4A3EJ 2Y0SA 4PCQA 4PXIA 1SFXA 2BY1A 2AS5F 2X1CA 2B7EA 3D5RC 2IGOA 5FFZA 2JSPA 2E1OA 3GEZA 4CZCA 1MMSA 1F5TA 2HS5A 2WAEA 3TW7A 2MLGA 2I8DA 5HDGA 4IHWA 1J9IA 1FSHA 3W6JB 1FOXA 1VQ9I 2PMHA 1UMQA 4HLYA 2K4BA 5IYBJ 1R1UA 4XRSG 1PP8F 4NN1A 3RYRA 4MGRA 3Q9VA 2QKLB 4P5OA 4M6VA 3EYIA 1UJ8A 2X9DA 2ZCXA 5HDNA 4A3DJ 5EGOB 3LWJA 3VP5A 2M30A 1D0XA 2HYTA 3OYHA 1LFPA 1YI2I 2Z1DA 2EWNA 4BQOA 1M1EB 2M9HA 1D0ZA 1Z0XA 5EJCA 3QP6A 1T95A 3LL7A 1KYWA 2BGCA 3C7JA 3E5XA 4LJZF 3MZHA 2E1MC 3ZN1A 1YFHA 3ASOH 1LDDA 5A2QZ 5KNLA 3FKJA 1ZLKA 5CVVA 2B0LA 3HEFA 3OOPA 4P96A 3S16J 3K8PC 5KCMA 1BC7C 1KU3A 1R1TA 4B48A 5D8LB 2ZMEC 2ZSHB 1B4AA 1S3JA 2P7CB 5K7ZA 2XAJA 2K9LA 4A3LJ 1RKTA 5IOZA 4X6AJ 1ZG3A 1S9HA 4O6JA 3O2PE 3T8RA 3VUQA 2IU5A 2P0WA 3GWZA 2PEXA 3ZMVA 2O5RA 4AVZA 5E3OA 2NS7A 3VVZA 1WI9A 1TW3A 4WK8F 3V6GA 3ABUA 5IT3A 4OD5A 3ZOBA 1S29A 1WJBA 3KZZA 3SZGA 2DMUA 3CWRA 2BOLA 4RB3C 2ELKA 2P8TA 3K4BA 3RQIA 2AQEA 3FDYA 1O7FA 5K58A 3H5AA 2VT2A 4HX8A 1MKMA 3PNVA 3GO5A 2J5OA 3NNRA 3KKDA 2XAHA 3SQNA 4KT6A 4WIBA 1SFKA 1MNMC 1TLHB 2CWEA 1MJBA 3GUDA 1H0MA 1JKPC 4BXFA 4LIVA 3LA3A 3GTPJ 2CQ7A 5E1WA 1WPKA 5DUIA 5HOOA 2W57A 4HLXA 3G7RA 4ZYDA 3IV5A 1WJDA 3N97A 3GVAA 1KYZA 1Y6IA 2VKHA 3G1LA 2LC2A 4BXXJ 4D5FA 3H0GJ 4IHYA 2NVYJ 3JRAA 4C2UA 4RGSA 2HTSA 3S3NA 1RUNA 1DQUA 3CRJA 1QHHD 2HNHA 1PUEE 4L62A 5E1ZB 4JKZA 4RAYA 1ETWA 1LEBA 2FU4A 5FFXA 2R92J 1RC9A 3HTUA 2FMLA 3CQZJ 4U0VA 5C4JJ 3DEUA 3TOAA 3HHHA 3EGQA 4HNUA 2EH3A 1LB2A 2D1HA 2O8KA 1YS6A 1SD6A 2VASA 5L3BA 2ZJRF 5EFYA 3DP7A 3PPBA 1QPMA 2M87A 1IDYA 3FMRA 5J4YA 2DA2A 3FXKA 3ZRGA 3J81Z 4CZZA 1P4AA 1ETKA 1R36A 2FE3A 3KEQA 3GTKJ 1G59A 3HG9A 4PK4A 1UHMA 1Y0NA 1TNSA 1LKXA 2LOOA 4A3BJ 4XRFA 3RPUA 1X19A 5L3CA 2AHQA 2GIZA 1ZQ3P 1H89C 1O7LA 2Q8KA 3I0TA 2EJRA 4Q4ZF 2FOKA 2PLYA 2IXSA 4XKCA 2KIFA 5M5WJ 2DG7A 2QQ9A 3K1NA 2UXNA 2DYRH 4NC7A 2R5YB 3E3VA 3T1BA 1KQ9A 1A36A 3AKZA 1KQ0A 3BR6A 2X0LA 1EF4A 1ZRDA 1FT9A 4A3MJ 1U8BA 4CICA 3ZCOA 5GPCA 2IT0A 5DM7F 2PMZN 1VQKI 1SVMA 2K4JA 1WJFA 3PL8A 3WGGA 3OS0A 4MK6A 3MZ8A 5FROA 4IHSA 2LH9A 1K78A 1NH3A 4XONA 4DW6A 3HTAA 3G1OA 2RQPA 1H9TA 2VKEA 2VQHA 3G1MA 3M9AA 1JKQC 2RAEA 2Y9YA 4IHVA 4CCMA 3KEOA 1AA7A 3KYDB 4UV9A 3K69A 3K4JA 4HDUA 3S3OA 1RETA 2EZLA 4MQVA 1OCOH 4NC6A 4FASD 4U88A 1ETXA 3D5SC 1MNDA 1J7KA 2M1BA 2EIKH 1U2WA 2L54A 4NQWB 2XASA 2DOEA 1P4XA 2AXTC 4II3A 1AKHA 1LQ1A 3ANGA 4U87A 1R58A 2VOOA 1UI5A 1BW5A 2E2IJ 4LG3A 3JTGA 1U6GA 4IOCF 3BTCA 2PFBA 4IEJA 4J19A 3JTHA 1YOVB 3Q5FA 3EUHC 3HKZA 3RPQA 4EJOA 2CMPA 1LE8A 2KRFA 2WBMA 5J4VA 2VUMJ 1TW2A 1DGWY 3OS2A 2L7FP 3BLYA 1X3UA 1WSUA 2FBHA 3TQNA 4NBQA 2IGNA 4KN7X 2XSJC 4C2MJ 1DUXC 1ACIA 4XSXF 1SMTA 2ISZA 5ERIA 3OYEA 1G3TA 3F22A 3BHQA 2DI3A 2R5ZA 1PUFA 2XRLA 2VXDA 4XRSA 3BJAA 3LWFA 3ABKH 3DKYA 2R7ZJ 4YIFA 1MH4A 3COAC 2YR2A 1HKTA 2WUIA 4E7IA 3CCMI 2HQRA 1D1CA 1IXCA 4G94A 3ON2A 5JFRA 2FNPA 5K5OA 5J3LA 1J75A 4BEHA 2O61A 4F55A 2MC4A 3J80K 2Y69H 2G7UA 3IRRA 1CGPA 4HF0A 3EPZA 3OYGA 1FP1D 3VWBA 2ECCA 4NNJA 1B9NA 3QQAA 2ZB9A 4HEA2 3ZXSA 3F8MA 2MD0A 3ZQ7A 3BROA 2HOTA 1HKQA 2IVMA 3H3VK 2DA5A 3PSFA 3RIRA 4WX9A 2XV4S 1GDTA 2EBIA 4OIOF 4MQ9F 3OIQA 4ZDPA 4ETSA 2TCTA 2ZXWH 3FM3A 4EMSA 3MD2A 1IC8A 3VEPA 3FX3A 4W97A 3SXYA 1SEUA 4DYCA 5HDKA 2V57A 1KZHA 1TT0A 3MVPA 2CG4A 2EZIA 3DF8A 1K61A 2ADUA 4ZYAA 1VTNC 1VQLI 3AG4H 3F8CA 4CUGA 2Q2EA 2DFIA 3JAMK 1E3OC 2CQQA 3LAPA 4LLLA 1DDNA 4Y3OA 3VYSB 2QZ8A 4CYDA 4PJ0C 4N4NB 2V4JC 3H3UA 3W3CA 3MAJA 1IN6A 2E60A 3CJDA 4M6XA 5LEJA 5E3MA 4JP0A 3R6SA 2A6TA 1GLNA 2R7VA 3K9TA 1XGOA 3A2KA 1OCRH 1A35A 1XTAA 1MBFA 1LFBA 1XMAA 4ZYEA 2CYYA 4LK1F 1WJ5A 2X51A 5J1UA 2HQ5A 3WHCA 1HC8A 5DCMB 1BR1A 2CV0A 3VOXA 3TP3A 4HV5A 1BJAA 5K5RA 4AIJA 5D5WB 2W84A 4XORA 5GADJ 1JKOC 4KFCA 2KIUA 2XF5A 3GZ6A 4X0GA 4OIQF 4ZTJA 2ZOYA 3ON4A 5ICGA 1GV2A 1IN4A 3OV8A 4ZC3A 3G3ZA 2MH2A 1SANA 2F5FA 3KCCA 1MMGA 2A3SA 3PFYA 3KPHA 3DCFA 3PNYA 2QLZA 2XAGA 1KGSA 4IL6C 2H1KA 2H6BA 4E4HA 2XAQA 3EETA 5F08A 2Z2SB 5E18F 2XPVA 5LD2C 5C44J 1LPQA 3BTJA 2FBIA 3EQLF 2F6CA 3TO7A 4RAZA 5LHIA 1ON2A 1SD7A 3BR2A 4EM2A 5HLHA 1PP7U 3ABTA 4ZTFA 4S0HB 5AQCA 4B44A 2QIBA 5E3LA 1WVRA 5IY5H 1XX5A 2GFNA 2ISYA 5BS6A 2HQAA 3HHGA 2BV6A 5D4RA 3AL0B 4A0YA 1ZN2A 4IJAA 3M7GA 3AG1H 1N77A 3FXLA 3P9TA 2IS1A 3CD6I 5JVTA 4AUXA 1BC8C 1I6XA 1R6RA 3PSIA 3GFIA 2DT7B 5D5UB 3FISA 1Y1VJ 1IV6A 4CGZA 5HBUA 1X2NA 5EZHA 2R93J 1XGNA 5EEGA 4AVPA 2R0QC 1FBSA 5FD6A 3HYIA 2V79A 2STWA 1Z77A 4L0YB 2NAZA 3LJLA 1VQOI 3IH2A 3ZMTA 5TJJA 2COBA 2WA0A 1G4DA 4LFUA 2YX7A 2EA4A 2EV0A 2P81A 4M73A 2VJ5A 2P6SA 4OIPF 3A01A 2PJRB 1IDZA 2GUHA 4G6QA 3CCRI 3ZR8X 3SWHA 2KIMA 2QVOA 5E8GA 4FCYA 2H8RA 2NVXJ 3GEUA 3KIOA 3WE2A 2PN6A 3GXOA 3F72A 4K2EA 3RPUD 1V5FA 2ZCMA 2RGVA 5JR3A 4UDSA 3VYUB 3D1NI 5JHFA 2BBYA 4RBOA 3CMYA 2HI3A 5ICFA 4EJUA 1X3WB 4KJZA 4BL0B 1O3TA 2FJI1 3CC7I 5CVRA 3TMOA 2XSDC 2ETHA 1Y56A 4G7ZF 2WWYA 1ZG5A 1SAUA 5H2FC 1R4MB 1O3QA 2DCEA 2CS3A 1X1CA 2D45A 1MDMA 4KIFA 2M7BA 1W1WE 3VODA 5ICCA 2VBYA 1VQNI 3CLQA 1AU7A 3DEWA 4HF1A 3V4GA 3DEEA 1S7AA 2Y75A 3A0HC 4MEYF 3HGYA 2IS6A 1T2KA 1VI0A 4L0ZB 2V6CA 1Y39A 4G12A 3DPUA 5J6XA 4G7HF 3HOUJ 2DA4A 1SVLA 2KZVA 2VBWA 3RCOA 3SEQA 2G0EA 4XR6A 4YIRX 3WTTC 1PDNC 1U8RA 4ZZDA 1K4TA 1W7PB 3M3YJ 3COLA 1X2MA 2ZJPF 2ZCWA 1ON1A 3L1PA 1KONA 1Z6TA 3C18A 1GUUA 2F5CA 4F52A 2PMUA 1ZREA 1MBHA 5L3FA 3IAM2 4UUSA 3LNQA 3FXMA 3NWSA 3CJNA 4M9XA 2LK2A 2DA1A 2LMDA 4C9YA 2B1EA 3FXRA 3FIWA 3M1CA 4PFPA 3K70D 5EG0A 4CCNA 2DU9A 2NP5A 2HEOA 2Z99A 4KWAA 3HOTA 2ZXJA 1R7JA 3HGGA 2PMZA 2V1UA 5K1YA 1YITI 2M8EA 4BYYA 4EVIA 4HNTA 2CQKA 2DLLA 2OPTA 2WB1A 4OIRF 5BPIA 3HOVJ 2CRGA 4A5MA 1UFMA 2IS2A 4BAYA 1D8KA 2KLOA 2W85A 2VE8A 3X2QH 3L2WA 1VQMI 3LSIA 4P9UA 4Y52J 2HZTA 2L4AA 1DPRA 4DZPA 5DM6F 2LY9A 2E71A 4XLPF 2F5EA 3F9KA 1K83J 2WY8Q 1K78B 2FQ3A 2V1XA 3CTAA 3MNLA 5EEAA 3SFIA 3BCGA 1FOWA 1VQ5I 4XLNF 4M72A 2K9SA 3W6KB 4CYCA 4ACIA 4M71A 5K5QA 2K40A 3OIOA 4XK4A 3DLAA 3V7RA 3MKWB 4YRVA 2KQRA 4OINF 1K79A 2K9NA 2JA8J 4ESJA 2DDBA 3O8HA 1T38A 1OCTC 3H36A 3OR2C 2JZYA 4BHBA 1ZKGA 3QKXA 1Z3YA 3CMMA 1FYLA 3HUGA 5L3EA 4EM1A 3OYFA 1JTYA 2VN2A 4S05A 1X1BA 2RQQA 2EA2A 2B9SA 4GGGA 3OL3A 4GO1A 2ME6A 2XKPA 3BP8A 4XSZF 1BI0A 2JT1A 5HS9A 4I98B 1G3SA 2L9VA 1E0EA 1MBGA 2FA5A 1ZRFA 2HFHA 2BZTA 3G2BA 2I10A 1LDKB 1USSA 1DP7P 2A2FX 2HR3A 2W48A 2HVQA 4U9NA 4BJTA 1QBJA 3QRFF 3BY6A 2DMQA 4PSWA 1SD4A 1T8IA 3KP4A 1A04A 3HZJA 4EV0A 4LLNA 3OYKA 5DYMA 2NX4A 3JRGA 3IKVA 3S1QJ 2NNNA 2KZGA 2QQ8A 4ZJZA 2M5WA 3C2HA 2EQRA 3BR5A 5FLVA 3HTIA 2KJCA 4CDGA 4HX4A 4TV7A 4KA4A 2CUJA 1HW2A 4H4KC 2ZKZA 3BR1A 4XIDA 2F5DA 4HF2A 1RIOH 4N4OB 2O03A 4JYKA 4FE4A 2KJBA 2NVTJ 2FEZA 3TW6A 3AL0C 1F36A 3A1YA 4XKWA 1HOMA 4RB0A 1D1BA 2KT0A 4L5JA 2XUBA 1VZ0A 3KLOA 2DXIA 3BPXA 2DJNA 4QPOA 3LQRA 4YFKF 2EIMH 4GYIA 2QYOA 3W2VA 4KICA 2GM4A 1I1GA 2A61A 1XDUA 3DPJA 5LGNA 3PO3J 2HQNA 1QA6A 2QBYA 1MMDA 4BJ5C 3Q9SA 1ULYA 2P7VB 2HYGD 3FXQA 4PZJA 4BEHB 2Y2ZA 1OCZH 2K27A 3I71A 4DBRA 3HIFA 1JGSA 1ZARA 2NS0A 2W00A 4N9HA 3HB9A 3VFZA 1NG6A 1E17A 3DKXA 1U5TB 1WI3A 2X6XA 5BMZA 1QU3A 2F4OB 2LBFA 4M3EA 4MTEA 4DZJA 3PUFA 5IOYA 1U0JA 3G71I 4DNCA 2F4MB 2ELJA 2V7FA 2QEXI 3B81A 4G6DA 1LEAA 2PJPA 3MMYB 4HKUA 3TP0A 3C3WA 2DBBA 1UB9A 3H1CA 3LMMA 4WXHA 3IWZA 1W4MA 4KT5C 1APLC 2EFNA 4PGHA 3TDZC 3ZN0A 3VYRB 3AQTA 1ZGWA 1EH8A 1B72A 1SFEA 2R7TA 2HGCA 2ZBKA 2L01A 1LNWA 4DVYP 2HYFA 2BVLA 2ID3A 3OYBA 1TWFJ 1L0OC 1X1PA 1Z05A 2M0CA 4RS8A 4YFNF 4ZH4F 1YJ9I 3ZQFA 2MLKA 3GF2A 1TL8A 5FGLA 1YTYA 2JVGA 3R60A 2OU2A 1W36C 3ROUA 3PASA 2KIQA 4V19K 1R00A 3QYFA 1UAAA 1BOAA 4FT8A 1OYWA 2JQ7A 4HRIA 5LLQA 2LLKA 4LITA 2IPQX 1D5YA 1P2FA 2A68F 4A3GJ 2RASA 4DGWB 2P5VA 1IUYA 4B43A 1TT5B 1BR2A 4JX5A 3HXLA 2VT3A 3K1PA 3H9GA 4D5CA 3KP3A 1TBXA 2XRNA 5LHHA 5ILUA 4HSTA 2F4IA 4UXNA 5AONA 1R22A 2ESNA 3OR1C 4KUMA 1RESA 2LREA 2HXIA 2IGKA 2GQQA 2X1EA 3CLOA 5GTIC 2GWRA 3OSGA 2VLAA 1FZPB 1ITYA 2K86A 3F1BA 4QIWN 2L7MP 3F21A 2OTLI 3JRCA 2D2WA 2LKXA 3HRMA 2A05A 3KP2A 3JRBA 5DTDA 2M7AA 3E6DA 2YSRA 3FMQA 4R79A 2OC6A 2MG4A 4LB5A 2FRHA 1LJ9A 2OCEA 1HA8A 4BS9A 2Z9OA 3V78A 3E5UA 3LA2A 3H9JA 4OWRB 2VE9A 4XKBA 2BHYA 3FXOA 4UUVA 4GYGA 2PFVA 1YX5A 1VFCA 3ANPA 3GFJA 3K4CA 1B8IA 3QYBA 3KETA 3K0LA 4E6KG 2DFEA 1ZH5A 4WCGA 3ZQGA 4ZDLA 3BOQA 4HDVA 1WQ2A 3MKLA 3P9KA 2JA2A 1BR4A 5FKMA 4IHXA 1HSTA 2D5VA 2UXIA 1FC3A 3MFKA 4I09A 3ZMSA 1RNLA 4KYWA 2LY1A 2V9KA 3BG5A 3A4CA 1B9MA 4I99C 4RMNA 1ZTRA 3CUQA 3E0JB 2R3SA 2WAQA 1S6LA 3DPLC 5DD4A 1IJWC 4ESBA 2BW3B 3WTYC 2ZJ2A 3TEDA 3L7WA 4BQQA 2CGPA 5JLWA 3H35A 2H1LA 2DA6A 4XMYA 2UWMA 3WTUC 5FHPA 4L18B 2DK5A 2EV5A 4CHUA 1MD0A 3LQQA 4B4CA 2MFZA 2R7OA 2ZMEA 5D6EA 4D7NA 3S17J 2NYXA 4IRHA 4RM3A 5LHGA 2R7QA 3GZ5A 1R5GA 3A0BC 3JSJA 4KN4X 2JA7J 2Z5UA 4X1EA 3MWMA 3L2VA 4OAZA 1GVDA 4Z6YA 3HDDA 4EJVA 5HAWA 3WTSC 2M4GA 3RDIA 5FRNA 1IUFA 2GIVA 3BJ6A 2DO7A 1GT0C 1NK3P 1DU6A 1ZGAA 2NVUB 2L4MA 1H9GA 1RZ4A 1LUJB 4FETA 1LDJA 3GTJJ 1FTZA 2NXNB 3OL4A 5KVRA 2EINH 2QA4I 3L00A 4CA0A 1ETOA 3OS1A 4ZDOA 2DFFA 1X3ZB 2V9PA 1MBKA 2IEKA 2WADA 4ASNA 3FM5A 2PBIA 3GFMA 5BOXA 1P7JA 2DYSH 3S32A 1VQ6I 4MO7A 5FKLA 2DDAA 2E35A 4L9TA 4LD5A 3BZCA 3I9V2 4E7ZA 2UXUA 3V7SA 4S04A 4AIKA 1K7AA 4HX7A 1ZG1A 3P9IA 3K4MA 3BWGA 3NS4A 1H8AC 1U5TC 2X85A 1SVOA 1IN7A 3J7AY 2QWWA 2D1VA 4DQ2A 5GTHC 1IV8A 1BOBA 4QPQA 3DU6A 1Y1WJ 3PO2J 3GZIA 3DTIA 1HBXG 2KISA 2B63J 2M2EA 3Q0UA 1ENHA 2OQGA 4BU2A 3VW0A 1KU9A 3WTZA 3F3XA 1CF7A 5HLTA 4R1HA 3PQKA 3I59A 2KDOA 1WHUA 1ORKA 3FMSA 4AYBN 3IL2A 1AWCA 3L2UA 1N75A 4WXDA 5AIPA 2KDZA 3CESA 1R71A 2MYSA 4JNNA 2LTPA 5CXGA 4A6DA 3T8TA 2IW5A 2MBFA 3LA7A 3M07A 4RLFA 5FMPA 5FLMJ 2BY2A 1OCPA 1I50J 5B1BH 5DUKA 1OPCA 3A03A 5IYCJ 4BBSJ 3GLXA 2FXAA 2FD5A 4XL9A 3OYLA 2H09A 3KLNA 5KAIC 4ENNA 5HNFA 4C3JJ 1O3SA 1Z67A 2K9MA 4CCKA 4RGXA 1QHGA 1TTYA 2L5QA 3I58A 1BL0A 3OIPA 5DD8A 5GAGJ 4H0EA 1Z21A 2LF7A 3I54A 3RKWA 4GCLA 3SJMA 2FUG2 3BC8A 4M74A 3MEXA 4IHTA 3RKYA 1AOYA 2KRHA 3G73A 1YRNA 3LFKA 2F48A 2FNAA 2BXYA 3SZPA 3M1EA 1IN5A 4DIQA 4BHCA 2ZOZA 2CSOA 1F9NA 1MW7A 3PIPF
chains in the Genus database with same CATH topology
1R9TJ 3EUPA 3I4NJ 2DN0A 3BG3A 1Z77A 3VOKA 3HM5A 3LJLA 3IH2A 5F0FA 3JRFA 2COBA 3ZQCA 2E19A 3FK6A 3HE0A 1QVUA 2DA3A 1JT6A 2XGCA 1UI6A 2P81A 1ETQA 2DMTA 3JRDA 3HTJA 3NXCA 2PBXA 5D18A 4AC6A 3A01A 2L0KA 1IDZA 2GUHA 3VIBA 2G7SA 3BQYA 3GEUA 4FCYA 2CQXA 4LOCA 1JJ6C 2H8RA 2XPUA 2NVXJ 1RPWA 4UDSA 1S7EA 2ZCMA 2UXPA 3ZQLA 2Y0SN 2FQ4A 5DS9A 3D1NI 2MGQA 1O4XA 4RBOA 3CMYA 2HI3A 4A3CJ 5FKKA 3JRHA 2VI6A 1XG1A 4A3EJ 2XSDC 1MSEC 4RDUA 4PXIA 1SGMA 3A01B 2YU9J 3E7QA 3G56A 2E1OA 2JA5J 2JN6A 5FJ8J 5EGOA 5J1YA 3NRGA 3TW7A 3GBGA 5BNGA 1AHDP 4IHWA 3S1RJ 2MSYA 1UMQA 1AU7A 3DEWA 5IYBJ 4HNVA 4XRSG 2UXOA 4NN1A 3AQSA 3HGYA 2OF7A 3S2HJ 1VI0A 3QBMA 4M6VA 4Y7NJ 1DU0A 2X9DA 1BJZA 4G12A 3HOUJ 2ZCXA 3B6CA 4A3DJ 3VP5A 2K9QA 5EGOB 1W0UA 2DA4A 9ANTA 3LWJA 2G0EA 2HYTA 1MH3A 3Q0VA 3M3YJ 4ICHA 2M9HA 3COLA 1X2MA 1Z0XA 3L1PA 1ETVA 3HOWJ 1LFUP 1GUUA 1MBHA 2F07A 4UUSA 3LNQA 3VW1A 4MIMA 1FJLA 2LK2A 2DA1A 3HEFA 2CU7A 3HOXJ 2WB1N 3FIWA 3S16J 5EG0A 1MSFC 2NP5A 3RKQA 4KWAA 4JX6A 5CXIA 3HGGA 2OERA 2OPTA 2DMPA 1JKRC 5FKNA 2CRGA 5K7ZA 3HOVJ 5HSZA 1T33A 1RKTA 5IOZA 4A3LJ 4X6AJ 3E7LA 4UUSB 4Y52J 4DZPA 3VUQA 2IU5A 2LY9A 2NS8A 4D7MA 2HDDA 5DAJA 4YZEA 5F27A 5EG0B 5E3OA 1K83J 2NS7A 3VVZA 3OSFA 2XPWA 3V6GA 1JJ8C 3MNLA 2XGDA 5EEAA 3SFIA 3ZOBA 3BCGA 3QPSA 4ME9A 2K9SA 2DMUA 4CYCA 4ACIA 3CWRA 1POGA 2K40A 2ELKA 3OIOA 4XK4A 4XICA 3JRIA 4FE7A 3RQIA 3KKCA 2ZCNA 1WGXA 3C07A 5K58A 4MXMA 1XC5A 1QRYA 2K9NA 2WGBA 2JA8J 4BKXA 3O8HA 1OCTC 1ZKGA 3NNRA 2AO9A 3KKDA 3QKXA 4C3IJ 1JTYA 1MNMC 1FIPA 3BT9A 1JKPC 2ME6A 1U78A 2LVSA 1BA5A 3NAUA 4CYCB 3GTPJ 2YVHA 5GP9A 1WPKA 2IBDA 2DG8A 3BRUA 2QCOA 1MBGA 3G7RA 2CUFA 2I10A 1ZR4A 3KNWA 4GFLA 1VF9A 3IV5A 2W48A 1VNDA 1TWCJ 4W1UA 2X48A 3G1LA 3IUVA 4XRMA 3BR3A 4BXXJ 2XB5A 1OJLA 1UG2A 2JJ7A 4D5FA 3I4MJ 2O7TA 3H0GJ 4IHYA 2NVYJ 5K7FA 3JRAA 2DMQA 2NP3A 3LSPA 4EEFG 3CRJA 2NX4A 3JRGA 3Q3SA 4L62A 3S1QJ 4JKZA 2QF7A 2O9LA 1ETWA 2DA7A 2ID6A 2EQRA 3BR5A 5FLVA 2R92J 1JT0A 3HTIA 2IAIA 1P7IA 3CQZJ 3BR1A 5C4JJ 3S14J 4XIDA 2XGEA 4JYKA 4FE4A 2UXHA 2NVTJ 1Q1VA 3TW6A 3EGQA 1F36A 1HOMA 5F0HA 2EH3A 2KT0A 1W0TA 5M5XJ 2O8KA 2RHAA 2DJNA 2GM4A 2VPRA 3VVXA 5H9TA 5EFYA 2Y31A 3PPBA 3DPJA 1IDYA 3PO3J 2HKUA 2DA2A 2R5YA 2W53A 1ETKA 3BNIA 2Y2ZA 4FISA 3GTKJ 2XDNA 3HB9A 4JX4A 3C2BA 1WI3A 2CUEA 5IYDJ 4A3BJ 4M3EA 1H88C 4DZJA 5IOYA 4M3FA 1TWAJ 4V2FA 2AHQA 2L7ZA 3RD3A 1ZQ3P 1H89C 2JMWA 2DG7A 4NDLA 3B81A 1NK2P 5M5WJ 4HKUA 5EDNA 3TP0A 2R5YB 4B1RA 2LR8A 2CJJA 3BJBA 4DYQA 4L5EA 5M3FJ 3BR6A 2HOSA 1APLC 2GLOA 1EF4A 5F0CA 3NARA 3LSJA 3MN2A 4A3MJ 1U8BA 3LSRA 3AQTA 3GTLJ 1ZGWA 1B72A 2LP0A 5GPCA 1MBEA 2PMZN 3GTOJ 2ID3A 5JLXA 1TWFJ 3ZQIA 4MK6A 3WHBA 4GCTA 2M0CA 3OOUA 5HODA 3ZQFA 4DW6A 3PM1A 3O8GA 5FGLA 3HTAA 3G1OA 3K7AJ 3PASA 1HDPA 2VKEA 3G1MA 2YVEA 3S1MJ 5F1JA 1JKQC 3HTHA 2RAEA 2Y9YA 2LLKA 2DMNA 4BBRJ 1B72B 2NVQJ 1D5YA 1MBJA 4A3GJ 2RASA 4IHVA 4GFKA 3NI7A 1RETA 2EZLA 5IP6A 4UUTA 4JX5A 3O60A 2DTZA 4D5CA 1ETXA 5E3NA 3M4OJ 3UKGA 5IPAA 3S2DJ 5D1RA 1ZK8A 1RESA 5IP9J 4AC0A 2HXIA 3JR9A 1AKHA 1UI5A 3ANGA 3HIMA 1BW5A 2E2IJ 3HKZN 3OSGA 2JA6J 1ITYA 3F1BA 2G7GA 4I6ZA 4QIWN 3BTCA 2L7MP 3FK7A 4IEJA 5M5YJ 4J19A 2NOGA 3JRCA 2LKXA 4A3JJ 3JRBA 1IG7A 4MFDA 5DTDA 1SFOJ 1HDDC 2JK3A 3CDLA 1GV5A 1LE8A 2MG4A 2VUMJ 1F43A 3NPIA 3BTLA 5F04A 5C4XJ 3V78A 2L7FP 2X6OA 1AKHB 4A69C 4C3HJ 4C2MJ 2HYJA 5IP7J 2ECBA 1WH5A 3B6AA 1VFCA 2QWTA 1IRZA 3ANPA 2E2JJ 4M3BA 2R5ZA 3BHQA 1PUFA 3S5RA 2VKVA 2XRLA 1B8IA 2FX0A 4XRSA 2L9RA 1NTCA 2MW8A 5J1RA 2R7ZJ 2XB0X 3ZQGA 1FIAA 1LE8B 1MH4A 3CCYA 3LSGA 3MKLA 1I6HJ 2REKA 2WUIA 5FKMA 4CGRA 4B3AA 4IHXA 2D5VA 2UXIA 4GFBA 3QPLA 2E2HJ 2Y30A 2WAQN 4GCKA 1JUSA 4ABZA 3ON2A 2GBYA 1XS9A 5J3LA 1OFCX 2EZHA 3BG5A 2D6YA 2R5ZB 1PUFB 3ZQHA 1B8IB 3JREA 1WH7A 1ZTRA 1IJWC 5C3EJ 1TWHJ 3Q0WA 3TEDA 1T56A 2ECCA 2OI8A 1G2HA 3KZ9A 1A5JA 3QQAA 5JLWA 5FKOA 2ZB9A 2DA6A 3HOYJ 3S1NJ 3BQZA 3GTMJ 5FHPA 1YRNB 1JTXA 2HOTA 2EZKA 4B4CA 3H3VK 2DA5A 3LHQA 4A3IJ 1GDTA 2EBIA 4D7NA 3S17J 4BY7J 3A02A 2TCTA 3JSJA 1IC8A 1U9NA 3IH3A 2JA7J 3T6NA 5EZGA 4X1EA 1QVTA 5C4YA 3FKIJ 3VVYA 4AF5A 4W97A 1GVDA 3HDDA 4DYCA 2QOPA 5HAWA 2WV1A 2O7OA 1IUFA 1GT0C 1FTTA 1ETYA 1NK3P 1DU6A 2V57A 3VW2A 3MVPA 2FBQA 1JUMA 4M3DA 2EZIA 1U9OA 3RZDJ 3GTJJ 1K61A 2G7LA 1FTZA 2YS9A 1TC3C 4BY1J 4DYRA 2PZ9A 1E3OC 3BG9A 2CQQA 1ETOA 4A3KJ 1TWGJ 4V2GA 1MBKA 1HLVA 2IEKA 3HOZJ 2M8GX 3IH4A 3CJDA 5E3MA 4JP0A 1P7JA 4MO7A 5FKLA 1IGNA 1MBFA 1LFBA 2GENA 3K2AA 2UXUA 5CW8A 3W6VA 1WCMJ 5J1UA 2HQ5A 2YUSA 3WHCA 4I76A 1H8AC 3VPRA 3VOXA 3TP3A 1JGGA 2HOAA 1JKOC 1Y1WJ 3PO2J 1RKWA 3GZIA 2QTQA 5EF6A 4A3FJ 1HCRA 2B63J 2M2EA 2ZOYA 3Q0UA 1ENHA 2TRTA 3ON4A 1BW6A 2HXOA 2N8GA 2G3BA 5EYRA 1GV2A 3VW0A 1SANA 1FEXA 3FRQA 1UHSA 4M3GA 3S15J 3F0CA 1ORKA 1X58A 4AYBN 3DCFA 2H1KA 2KDZA 5F08A 4JL3A 4JNNA 3BTIA 1QPIA 2LTPA 4FTHA 2LD5A 2XPVA 5CXGA 1RR7A 4QSHA 5C44J 3BTJA 4MLOA 5FMPA 5FLMJ 4A93J 4QTRA 3RH2A 1HF0A 3GTGJ 1JUPA 3BR2A 1OCPA 2M34A 3SDGA 1I50J 3HBLA 3GTQJ 4S0HB 3A03A 2JWTA 5IYCJ 1I3QJ 2Y9ZA 4BBSJ 4NELA 5AQCA 2QIBA 2FD5A 2QKOA 5M3MJ 5E3LA 4C3JJ 2GFNA 1A6IA 1BL0A 5K7HA 3LOCA 5D19A 1CQTA 3RZOJ 4GCLA 3SJMA 3BR0A 3P9TA 2FJ1A 4AUXA 1YRNA 2ME0A 2LFBA 3FISA 1Y1VJ 4MFEA 1ZR2A 1IV6A 5HBUA 1X2NA 5GPAA 5EZHA 2R93J 2ZOZA 2Q24A 2R0QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R9T J;  3EUP A;  3I4N J;  2DN0 A;  3BG3 A;  1Z77 A;  3VOK A;  3HM5 A;  3LJL A;  3IH2 A;  5F0F A;  3JRF A;  2COB A;  3ZQC A;  2E19 A;  3FK6 A;  3HE0 A;  1QVU A;  2DA3 A;  1JT6 A;  2XGC A;  1UI6 A;  2P81 A;  1ETQ A;  2DMT A;  3JRD A;  3HTJ A;  3NXC A;  2PBX A;  5D18 A;  4AC6 A;  3A01 A;  2L0K A;  1IDZ A;  2GUH A;  3VIB A;  2G7S A;  3BQY A;  3GEU A;  4FCY A;  2CQX A;  4LOC A;  1JJ6 C;  2H8R A;  2XPU A;  2NVX J;  1RPW A;  4UDS A;  1S7E A;  2ZCM A;  2UXP A;  3ZQL A;  2Y0S N;  2FQ4 A;  5DS9 A;  3D1N I;  2MGQ A;  1O4X A;  4RBO A;  3CMY A;  2HI3 A;  4A3C J;  5FKK A;  3JRH A;  2VI6 A;  1XG1 A;  4A3E J;  2XSD C;  1MSE C;  4RDU A;  4PXI A;  1SGM A;  3A01 B;  2YU9 J;  3E7Q A;  3G56 A;  2E1O A;  2JA5 J;  2JN6 A;  5FJ8 J;  5EGO A;  5J1Y A;  3NRG A;  3TW7 A;  3GBG A;  5BNG A;  1AHD P;  4IHW A;  3S1R J;  2MSY A;  1UMQ A;  1AU7 A;  3DEW A;  5IYB J;  4HNV A;  4XRS G;  2UXO A;  4NN1 A;  3AQS A;  3HGY A;  2OF7 A;  3S2H J;  1VI0 A;  3QBM A;  4M6V A;  4Y7N J;  1DU0 A;  2X9D A;  1BJZ A;  4G12 A;  3HOU J;  2ZCX A;  3B6C A;  4A3D J;  3VP5 A;  2K9Q A;  5EGO B;  1W0U A;  2DA4 A;  9ANT A;  3LWJ A;  2G0E A;  2HYT A;  1MH3 A;  3Q0V A;  3M3Y J;  4ICH A;  2M9H A;  3COL A;  1X2M A;  1Z0X A;  3L1P A;  1ETV A;  3HOW J;  1LFU P;  1GUU A;  1MBH A;  2F07 A;  4UUS A;  3LNQ A;  3VW1 A;  4MIM A;  1FJL A;  2LK2 A;  2DA1 A;  3HEF A;  2CU7 A;  3HOX J;  2WB1 N;  3FIW A;  3S16 J;  5EG0 A;  1MSF C;  2NP5 A;  3RKQ A;  4KWA A;  4JX6 A;  5CXI A;  3HGG A;  2OER A;  2OPT A;  2DMP A;  1JKR C;  5FKN A;  2CRG A;  5K7Z A;  3HOV J;  5HSZ A;  1T33 A;  1RKT A;  5IOZ A;  4A3L J;  4X6A J;  3E7L A;  4UUS B;  4Y52 J;  4DZP A;  3VUQ A;  2IU5 A;  2LY9 A;  2NS8 A;  4D7M A;  2HDD A;  5DAJ A;  4YZE A;  5F27 A;  5EG0 B;  5E3O A;  1K83 J;  2NS7 A;  3VVZ A;  3OSF A;  2XPW A;  3V6G A;  1JJ8 C;  3MNL A;  2XGD A;  5EEA A;  3SFI A;  3ZOB A;  3BCG A;  3QPS A;  4ME9 A;  2K9S A;  2DMU A;  4CYC A;  4ACI A;  3CWR A;  1POG A;  2K40 A;  2ELK A;  3OIO A;  4XK4 A;  4XIC A;  3JRI A;  4FE7 A;  3RQI A;  3KKC A;  2ZCN A;  1WGX A;  3C07 A;  5K58 A;  4MXM A;  1XC5 A;  1QRY A;  2K9N A;  2WGB A;  2JA8 J;  4BKX A;  3O8H A;  1OCT C;  1ZKG A;  3NNR A;  2AO9 A;  3KKD A;  3QKX A;  4C3I J;  1JTY A;  1MNM C;  1FIP A;  3BT9 A;  1JKP C;  2ME6 A;  1U78 A;  2LVS A;  1BA5 A;  3NAU A;  4CYC B;  3GTP J;  2YVH A;  5GP9 A;  1WPK A;  2IBD A;  2DG8 A;  3BRU A;  2QCO A;  1MBG A;  3G7R A;  2CUF A;  2I10 A;  1ZR4 A;  3KNW A;  4GFL A;  1VF9 A;  3IV5 A;  2W48 A;  1VND A;  1TWC J;  4W1U A;  2X48 A;  3G1L A;  3IUV A;  4XRM A;  3BR3 A;  4BXX J;  2XB5 A;  1OJL A;  1UG2 A;  2JJ7 A;  4D5F A;  3I4M J;  2O7T A;  3H0G J;  4IHY A;  2NVY J;  5K7F A;  3JRA A;  2DMQ A;  2NP3 A;  3LSP A;  4EEF G;  3CRJ A;  2NX4 A;  3JRG A;  3Q3S A;  4L62 A;  3S1Q J;  4JKZ A;  2QF7 A;  2O9L A;  1ETW A;  2DA7 A;  2ID6 A;  2EQR A;  3BR5 A;  5FLV A;  2R92 J;  1JT0 A;  3HTI A;  2IAI A;  1P7I A;  3CQZ J;  3BR1 A;  5C4J J;  3S14 J;  4XID A;  2XGE A;  4JYK A;  4FE4 A;  2UXH A;  2NVT J;  1Q1V A;  3TW6 A;  3EGQ A;  1F36 A;  1HOM A;  5F0H A;  2EH3 A;  2KT0 A;  1W0T A;  5M5X J;  2O8K A;  2RHA A;  2DJN A;  2GM4 A;  2VPR A;  3VVX A;  5H9T A;  5EFY A;  2Y31 A;  3PPB A;  3DPJ A;  1IDY A;  3PO3 J;  2HKU A;  2DA2 A;  2R5Y A;  2W53 A;  1ETK A;  3BNI A;  2Y2Z A;  4FIS A;  3GTK J;  2XDN A;  3HB9 A;  4JX4 A;  3C2B A;  1WI3 A;  2CUE A;  5IYD J;  4A3B J;  4M3E A;  1H88 C;  4DZJ A;  5IOY A;  4M3F A;  1TWA J;  4V2F A;  2AHQ A;  2L7Z A;  3RD3 A;  1ZQ3 P;  1H89 C;  2JMW A;  2DG7 A;  4NDL A;  3B81 A;  1NK2 P;  5M5W J;  4HKU A;  5EDN A;  3TP0 A;  2R5Y B;  4B1R A;  2LR8 A;  2CJJ A;  3BJB A;  4DYQ A;  4L5E A;  5M3F J;  3BR6 A;  2HOS A;  1APL C;  2GLO A;  1EF4 A;  5F0C A;  3NAR A;  3LSJ A;  3MN2 A;  4A3M J;  1U8B A;  3LSR A;  3AQT A;  3GTL J;  1ZGW A;  1B72 A;  2LP0 A;  5GPC A;  1MBE A;  2PMZ N;  3GTO J;  2ID3 A;  5JLX A;  1TWF J;  3ZQI A;  4MK6 A;  3WHB A;  4GCT A;  2M0C A;  3OOU A;  5HOD A;  3ZQF A;  4DW6 A;  3PM1 A;  3O8G A;  5FGL A;  3HTA A;  3G1O A;  3K7A J;  3PAS A;  1HDP A;  2VKE A;  3G1M A;  2YVE A;  3S1M J;  5F1J A;  1JKQ C;  3HTH A;  2RAE A;  2Y9Y A;  2LLK A;  2DMN A;  4BBR J;  1B72 B;  2NVQ J;  1D5Y A;  1MBJ A;  4A3G J;  2RAS A;  4IHV A;  4GFK A;  3NI7 A;  1RET A;  2EZL A;  5IP6 A;  4UUT A;  4JX5 A;  3O60 A;  2DTZ A;  4D5C A;  1ETX A;  5E3N A;  3M4O J;  3UKG A;  5IPA A;  3S2D J;  5D1R A;  1ZK8 A;  1RES A;  5IP9 J;  4AC0 A;  2HXI A;  3JR9 A;  1AKH A;  1UI5 A;  3ANG A;  3HIM A;  1BW5 A;  2E2I J;  3HKZ N;  3OSG A;  2JA6 J;  1ITY A;  3F1B A;  2G7G A;  4I6Z A;  4QIW N;  3BTC A;  2L7M P;  3FK7 A;  4IEJ A;  5M5Y J;  4J19 A;  2NOG A;  3JRC A;  2LKX A;  4A3J J;  3JRB A;  1IG7 A;  4MFD A;  5DTD A;  1SFO J;  1HDD C;  2JK3 A;  3CDL A;  1GV5 A;  1LE8 A;  2MG4 A;  2VUM J;  1F43 A;  3NPI A;  3BTL A;  5F04 A;  5C4X J;  3V78 A;  2L7F P;  2X6O A;  1AKH B;  4A69 C;  4C3H J;  4C2M J;  2HYJ A;  5IP7 J;  2ECB A;  1WH5 A;  3B6A A;  1VFC A;  2QWT A;  1IRZ A;  3ANP A;  2E2J J;  4M3B A;  2R5Z A;  3BHQ A;  1PUF A;  3S5R A;  2VKV A;  2XRL A;  1B8I A;  2FX0 A;  4XRS A;  2L9R A;  1NTC A;  2MW8 A;  5J1R A;  2R7Z J;  2XB0 X;  3ZQG A;  1FIA A;  1LE8 B;  1MH4 A;  3CCY A;  3LSG A;  3MKL A;  1I6H J;  2REK A;  2WUI A;  5FKM A;  4CGR A;  4B3A A;  4IHX A;  2D5V A;  2UXI A;  4GFB A;  3QPL A;  2E2H J;  2Y30 A;  2WAQ N;  4GCK A;  1JUS A;  4ABZ A;  3ON2 A;  2GBY A;  1XS9 A;  5J3L A;  1OFC X;  2EZH A;  3BG5 A;  2D6Y A;  2R5Z B;  1PUF B;  3ZQH A;  1B8I B;  3JRE A;  1WH7 A;  1ZTR A;  1IJW C;  5C3E J;  1TWH J;  3Q0W A;  3TED A;  1T56 A;  2ECC A;  2OI8 A;  1G2H A;  3KZ9 A;  1A5J A;  3QQA A;  5JLW A;  5FKO A;  2ZB9 A;  2DA6 A;  3HOY J;  3S1N J;  3BQZ A;  3GTM J;  5FHP A;  1YRN B;  1JTX A;  2HOT A;  2EZK A;  4B4C A;  3H3V K;  2DA5 A;  3LHQ A;  4A3I J;  1GDT A;  2EBI A;  4D7N A;  3S17 J;  4BY7 J;  3A02 A;  2TCT A;  3JSJ A;  1IC8 A;  1U9N A;  3IH3 A;  2JA7 J;  3T6N A;  5EZG A;  4X1E A;  1QVT A;  5C4Y A;  3FKI J;  3VVY A;  4AF5 A;  4W97 A;  1GVD A;  3HDD A;  4DYC A;  2QOP A;  5HAW A;  2WV1 A;  2O7O A;  1IUF A;  1GT0 C;  1FTT A;  1ETY A;  1NK3 P;  1DU6 A;  2V57 A;  3VW2 A;  3MVP A;  2FBQ A;  1JUM A;  4M3D A;  2EZI A;  1U9O A;  3RZD J;  3GTJ J;  1K61 A;  2G7L A;  1FTZ A;  2YS9 A;  1TC3 C;  4BY1 J;  4DYR A;  2PZ9 A;  1E3O C;  3BG9 A;  2CQQ A;  1ETO A;  4A3K J;  1TWG J;  4V2G A;  1MBK A;  1HLV A;  2IEK A;  3HOZ J;  2M8G X;  3IH4 A;  3CJD A;  5E3M A;  4JP0 A;  1P7J A;  4MO7 A;  5FKL A;  1IGN A;  1MBF A;  1LFB A;  2GEN A;  3K2A A;  2UXU A;  5CW8 A;  3W6V A;  1WCM J;  5J1U A;  2HQ5 A;  2YUS A;  3WHC A;  4I76 A;  1H8A C;  3VPR A;  3VOX A;  3TP3 A;  1JGG A;  2HOA A;  1JKO C;  1Y1W J;  3PO2 J;  1RKW A;  3GZI A;  2QTQ A;  5EF6 A;  4A3F J;  1HCR A;  2B63 J;  2M2E A;  2ZOY A;  3Q0U A;  1ENH A;  2TRT A;  3ON4 A;  1BW6 A;  2HXO A;  2N8G A;  2G3B A;  5EYR A;  1GV2 A;  3VW0 A;  1SAN A;  1FEX A;  3FRQ A;  1UHS A;  4M3G A;  3S15 J;  3F0C A;  1ORK A;  1X58 A;  4AYB N;  3DCF A;  2H1K A;  2KDZ A;  5F08 A;  4JL3 A;  4JNN A;  3BTI A;  1QPI A;  2LTP A;  4FTH A;  2LD5 A;  2XPV A;  5CXG A;  1RR7 A;  4QSH A;  5C44 J;  3BTJ A;  4MLO A;  5FMP A;  5FLM J;  4A93 J;  4QTR A;  3RH2 A;  1HF0 A;  3GTG J;  1JUP A;  3BR2 A;  1OCP A;  2M34 A;  3SDG A;  1I50 J;  3HBL A;  3GTQ J;  4S0H B;  3A03 A;  2JWT A;  5IYC J;  1I3Q J;  2Y9Z A;  4BBS J;  4NEL A;  5AQC A;  2QIB A;  2FD5 A;  2QKO A;  5M3M J;  5E3L A;  4C3J J;  2GFN A;  1A6I A;  1BL0 A;  5K7H A;  3LOC A;  5D19 A;  1CQT A;  3RZO J;  4GCL A;  3SJM A;  3BR0 A;  3P9T A;  2FJ1 A;  4AUX A;  1YRN A;  2ME0 A;  2LFB A;  3FIS A;  1Y1V J;  4MFE A;  1ZR2 A;  1IV6 A;  5HBU A;  1X2N A;  5GPA A;  5EZH A;  2R93 J;  2ZOZ A;  2Q24 A;  2R0Q C; 
#chains in the Genus database with same CATH topology
 4BDY A;  2GXA A;  4J01 A;  4NHJ A;  4E7S A;  3ZQC A;  4UNO A;  4PUS A;  3HE0 A;  4L9J A;  2DA3 A;  5TGT A;  3TGN A;  3FZV A;  4UVA A;  1OKR A;  1UI6 A;  2DMT A;  3JRD A;  3NXC A;  3KZI C;  1YJW I;  3FBI B;  3VIB A;  3DWL E;  1W5T A;  3HRT A;  2G7S A;  3GX4 X;  3EUA A;  1P4W A;  1S7E A;  3GME A;  3ZQL A;  2Y0S N;  3LST A;  3SEZ A;  3B73 A;  3D0S A;  1O4X A;  3L2R A;  1WJE A;  3BCA A;  3JSO A;  2DK8 A;  2VI6 A;  2O8X A;  1MSE C;  4CCJ A;  4RDU A;  1YW7 A;  3SZT A;  2EB7 A;  1W5S A;  2YU9 J;  2JUC A;  2K5C A;  1BM9 A;  1T0F C;  2Z16 A;  4BE2 A;  3E7Q A;  3HOS A;  5EGO A;  4IZZ A;  4PJL A;  3KX2 A;  3G6E I;  3FHZ A;  3NRG A;  5BNG A;  1AHD P;  2DJI A;  5FLX K;  2MSY A;  4RLQ A;  5FD5 A;  5H6R A;  2DAO A;  3CP2 A;  2UXO A;  4OU0 A;  4U0Y A;  3AQS A;  1MNE A;  2OF7 A;  1KU2 A;  3S2H J;  5HNH A;  2HVR A;  2ELH A;  2RC4 A;  3PFI A;  1YIJ I;  2JVH A;  2OCC H;  4F92 B;  4Y7N J;  1DU0 A;  2F5V A;  1V5E A;  3EUH A;  2CO5 A;  2CUZ A;  3B6C A;  3CJT B;  2L2O A;  4D0P A;  1W0U A;  2QBY B;  4Q5S F;  1OQY A;  1MH3 A;  1FMV A;  4ICH A;  2K7L A;  2TDX A;  5E17 F;  3CMA I;  2XKO A;  1IRX A;  1ETV A;  2V9V A;  4Y33 A;  3HOW J;  1C0W A;  1IXR C;  1SMY F;  3IAS 2;  2LBF B;  1I39 A;  5LFA A;  2WC2 A;  4XOP A;  3VW1 A;  4MIM A;  1FJL A;  1ZGJ A;  2VBX A;  3U2R A;  3HOX J;  4BDZ A;  2RDP A;  2HOE A;  3FF5 A;  3OYN A;  4JX6 A;  1MZB A;  1UCR A;  5CXI A;  4XLH A;  2LNB A;  2OER A;  3QAH A;  3KP6 A;  2DOF A;  3RQ4 A;  1T33 A;  1DGR M;  1PJR A;  2HU9 A;  5ILV A;  5DEQ A;  1OIS A;  3ONQ A;  4RB2 C;  2DT5 A;  4F91 B;  4YZE A;  2EFQ A;  5F27 A;  3CDI A;  3HTS B;  2VON A;  2JUG A;  2RRE A;  5GAH J;  1YX3 A;  2XGD A;  1K4S A;  1NG7 A;  3QPT A;  3QPS A;  2O6G E;  4NB5 A;  4AIH A;  4ME9 A;  2GAU A;  4ENJ A;  3SYT A;  1POG A;  4PJM A;  2E1C A;  2A69 F;  4XIC A;  3JRI A;  1I1S A;  2RVC A;  3V8K A;  1WGX A;  5H6Q A;  3C07 A;  3EYY A;  4XNF A;  4MXM A;  4HYE A;  1QRY A;  5CKT A;  1B59 A;  2QGU A;  4Y13 A;  1XMK A;  1XPX A;  3H3Z A;  1R4N B;  4C3I J;  3DBL B;  2W82 A;  1MGT A;  1FIP A;  3BT9 A;  2ZO4 A;  3CME I;  1U78 A;  1OR7 C;  1BA5 A;  1R23 A;  3NAU A;  2YVH A;  1XSD A;  4B47 A;  2IBD A;  2DG8 A;  1I3A A;  1A31 A;  4IOA F;  3QWL A;  5HS8 A;  4IRG A;  4I2O A;  3HRU A;  2CUF A;  3KNW A;  1V4R A;  1VF9 A;  4RA2 A;  2X48 A;  3O3K A;  3VSK A;  1OJL A;  2JJ7 A;  2HDW A;  1QQI A;  3T5X A;  4LGW A;  3I4M J;  3OWT A;  2E1N A;  5E20 A;  2G7H A;  1MIJ A;  3CO7 C;  1KQ8 A;  4EEF G;  4KIG A;  3U1K A;  4U7B A;  3Q3S A;  3J80 Z;  3WTV C;  1OLT A;  3HRS A;  2QF7 A;  2FBK A;  2ID6 A;  1HSJ A;  2R4G A;  1T6S A;  3GYH X;  3BDD A;  1P7I A;  1RR8 C;  1WJC A;  2KL4 A;  1JHF A;  3S14 J;  1V54 H;  2XGE A;  5FRM A;  1J09 A;  2R7R A;  2UXH A;  1Q1V A;  1ZEL A;  2L3D A;  4BE1 A;  4XLE A;  4YII A;  5F0H A;  1W0T A;  2M0M A;  1D3Y A;  2MH9 A;  2RHA A;  4LG0 A;  2VPR A;  2E34 A;  3VVX A;  2Y31 A;  1EV7 A;  3H92 A;  3RKX A;  2W25 A;  3E97 A;  2CV1 A;  3CCV I;  2R5Y A;  2YPR A;  2W53 A;  1HKS A;  3BNI A;  4XN0 A;  4ZYG A;  2XDN A;  3CUQ B;  3C2B A;  2CUE A;  5IYD J;  3KP5 A;  1H88 C;  4M3F A;  4V2F A;  2JSC A;  3OYJ A;  2L7Z A;  1EKE A;  2ZY9 A;  1OMI A;  3RD3 A;  3OYA A;  4Q48 A;  2DOA A;  4NDL A;  4ANJ A;  2RN7 A;  5EDN A;  1JI8 A;  3WG7 H;  3AAF A;  2CJJ A;  3BJB A;  4DYQ A;  3MQ0 A;  1YW9 A;  4L5E A;  4FHT A;  3OYM A;  2HOS A;  3W2A A;  1L3L A;  4XLC A;  5FO5 A;  5F0C A;  3MN2 A;  3KZY A;  2H6C A;  4CSW A;  3LSR A;  3GTL J;  2VJ4 A;  4IKF A;  2LP0 A;  2R7S A;  1EA3 A;  4DJA A;  4PDK A;  4Y4R A;  1EJ9 A;  2NRA C;  2XGX A;  4E70 A;  4UY8 I;  1TQI A;  2EIL H;  5ICE A;  4GCT A;  3OOU A;  5HOD A;  2VQL A;  5A2Q K;  3ABM H;  4G9Y A;  4NQW A;  1FBU A;  3N05 A;  3S1M J;  1T39 A;  3KEY A;  2DMN A;  1J5Y A;  2F2E A;  2NVQ J;  1X4O A;  1QNT A;  1O3R A;  2IS4 A;  1FP2 A;  4GFK A;  3NI7 A;  2EFO A;  1MMA A;  5IP6 A;  5BPD A;  1VQ8 I;  4ENK A;  3DFG A;  3M8E A;  4RM2 A;  3CDH A;  5IPA A;  3UKG A;  2QQA A;  5D1R A;  1R5I D;  4HAM A;  3ECH A;  1ZHF A;  2ZNY A;  3VTI A;  3VDX A;  5B66 C;  4AC0 A;  3JR9 A;  4E7J A;  1STZ A;  1BI3 A;  2JPC A;  2X6W A;  1FSE A;  3HIM A;  3ERM A;  3HKZ N;  4A12 A;  2JA6 J;  3S93 A;  2G7G A;  1Z6R A;  2KMU A;  3S2W A;  3FK7 A;  2LRD A;  1IG7 A;  2RNG A;  4GRI A;  4AYB A;  3CC4 I;  4MFD A;  1SFO J;  3RTR A;  4XKV A;  1HDD C;  3NRV A;  3GW2 A;  2JK3 A;  3EUK L;  5TIS C;  3QU3 A;  3CF5 F;  4KNY A;  2VB6 A;  1F43 A;  3NPI A;  3REO A;  1CF7 B;  3IRQ A;  5C4X J;  1AKH B;  4CO8 A;  1HQC A;  4U7D A;  1IZ1 A;  3WU0 A;  2BE5 F;  2HYJ A;  3T0Y A;  5D6F A;  2W4S A;  3QU6 A;  1FNN A;  3B6A A;  5ILS A;  2VKD A;  1IRZ A;  1EH6 A;  3H5R A;  3I56 I;  4LIU A;  4HA8 A;  2VOP A;  2VKV A;  3IC7 A;  3K4K A;  2L9R A;  5J1R A;  1O57 A;  5LRS A;  3PIO F;  2WAF A;  1LE8 B;  3LSG A;  2REK A;  2ZSI B;  4B3A A;  1T08 B;  4GFB A;  3QPL A;  1R49 A;  4ABZ A;  3BJO A;  4BE0 A;  1Y0U A;  2EZH A;  2R5Z B;  1PUF B;  3ZQH A;  1IO2 A;  3V7C A;  2M3A A;  2OBP A;  5C3E J;  2GA1 A;  1GXP A;  3Q0W A;  2CW7 A;  2OI8 A;  1X1D A;  4YG2 F;  5FKO A;  3HOY J;  1WRJ A;  1ONV A;  1YRN B;  4BH9 A;  4BQN A;  2W7N A;  2W1O A;  3F6V A;  3V8J A;  1REP C;  1BI1 A;  4F3Q A;  4A3I J;  1YLF A;  1UHW A;  4BY7 J;  2KKO A;  1VQ4 I;  3L09 A;  3J81 K;  4PFO A;  1D0Y A;  3S8P A;  2BHZ A;  5IT9 Z;  3FKI J;  3VVY A;  2ICW G;  2O3F A;  2JRT A;  4AF5 A;  1TZL A;  2BXZ A;  2WV1 A;  1YS7 A;  3BZ6 A;  3OY9 A;  3MKZ A;  1FTT A;  1ETY A;  2GZW A;  2ZXH A;  1XB4 A;  3KYL A;  1S7O A;  4XLA A;  4IVN A;  2DQR A;  3HSF A;  3E6C C;  3RZD J;  3DXJ F;  2G7L A;  1IN8 A;  5KK1 A;  3BPV A;  1TC3 C;  3BCB A;  1Z7U A;  2ZXI A;  2PZ9 A;  3BG9 A;  3AG2 H;  4CCO A;  5DCM A;  3UR3 C;  4AU7 A;  1TWG J;  4E7K A;  4V2G A;  1FPQ A;  2C6Y A;  2OAZ A;  1IRF A;  3CJR B;  3VSL A;  3WOD F;  3WTW C;  3DLL F;  1VQ7 I;  3HOZ J;  4OD4 A;  2M8G X;  1D5V A;  3IP4 B;  3UNG C;  3IH4 A;  4MTD A;  3E1S A;  2XHK A;  3L2Q A;  1TNT A;  1IGN A;  2DT6 A;  1XSV A;  4EAT A;  2E36 A;  4IRV A;  1IW7 F;  1YIO A;  2P5L C;  1IF1 A;  1T98 A;  3K2A A;  2Q2E B;  4IXA A;  3ZMU A;  3G4S I;  3W6V A;  3DKW A;  1D8J A;  3CUQ C;  3D5L A;  2YUS A;  2VC1 A;  2NOJ B;  4I76 A;  2XIG A;  5AIQ A;  5EEH A;  1QGP A;  1JXS A;  2HOA A;  3ZMD A;  4CH7 A;  4XBF A;  2WY7 Q;  1R1V A;  2QTQ A;  2M45 A;  2LKS A;  1HCR A;  1YHQ I;  4FX4 A;  2TRT A;  1Z9C A;  3ZQQ A;  3L2C A;  3MCZ A;  3E5Q A;  4M6Y A;  1FEX A;  4U0W A;  1QZE A;  3ABL H;  4M3G A;  4LB6 B;  4P1W A;  2RNJ A;  4IF4 A;  4PJN A;  1XGS A;  3P9C A;  1WZ2 A;  3BZK A;  4EJT A;  2MAB A;  3BTI A;  1RR7 A;  2AXL A;  3QOE A;  1BBY A;  4G7O F;  1P6R A;  4A93 J;  2A5Y B;  2FF4 A;  4QTR A;  1HF0 A;  3RH2 A;  1JUP A;  2M34 A;  2VXZ A;  3OYC A;  3HBL A;  5GAE J;  3KE2 A;  2WV0 A;  1SC7 A;  3VB2 A;  1YQA A;  2CW0 F;  4MHG A;  2GXB A;  3J7Z I;  5CQG A;  4YEL A;  2JWT A;  2Y9Z A;  1J59 A;  3KP7 A;  3TL4 X;  5M3M J;  5E79 C;  3GLL A;  3ESW B;  3OMY A;  2QKM B;  1A6I A;  3LOC A;  2B3W A;  1GXQ A;  3ML6 A;  2I5U A;  1TQM A;  1HXD A;  1FOK A;  2H27 A;  1FWZ A;  2OZ6 A;  2CFX A;  2ACJ A;  2K3F A;  5LGU A;  1OCC H;  3CZ6 A;  3WU1 B;  2R7X A;  1X1A A;  2CQN A;  2PJR A;  2LFB A;  3K2Z A;  1QZZ A;  5GPA A;  2UUZ A;  3NQO A;  2Q24 A;  1R9T J;  2HDC A;  3I55 I;  4A0X A;  2EFW A;  3I4N J;  2DN0 A;  1A6Q A;  3EUP A;  3BG3 A;  4C2M A;  5ED4 A;  5E1X A;  3O6B B;  2E19 A;  3FK6 A;  2VPL A;  1QVU A;  2JTV A;  2PX9 A;  4Z2Y A;  1JT6 A;  1FLI A;  1ETQ A;  2K3P A;  3ELK A;  5D18 A;  4IO9 F;  2L0K A;  3TKY A;  3K70 C;  3S3M A;  3BQY A;  4RGU A;  4R8H A;  1OYI A;  4PJJ A;  1JJ6 C;  1SD5 A;  2M4K A;  4UV8 A;  2FQ4 A;  5DS9 A;  3TO9 A;  5F6F A;  4A3C J;  1YE9 A;  1LVA A;  2LF8 A;  3JRH A;  4M9Z A;  2CV2 A;  3KYC B;  4BHP A;  3W2W A;  3ULQ B;  4FX0 A;  1R5H A;  2EV6 A;  4IRI A;  2CFO A;  2BVM A;  2V1N A;  4A6E A;  4EQQ A;  1SGM A;  3A01 B;  3CP8 A;  3IWF A;  3G56 A;  2XF7 A;  2QSH X;  2JA5 J;  1I27 A;  2JN6 A;  3HSE A;  1K6Y A;  2E7X A;  5FJ8 J;  2HKX A;  4HOB A;  2Z3Y A;  5J1Y A;  4ZZL A;  2L9S A;  3GBG A;  2EIJ H;  1SAX A;  2LYC A;  2O0Y A;  1PVE A;  1W7P A;  2IA2 A;  2Y0M A;  3S1R J;  2YX4 A;  1F4K A;  5J40 A;  2A5W A;  4HNV A;  3I53 A;  4HBL A;  3WGI A;  2P5K A;  2OJE D;  1Y8Q B;  4LG0 B;  3QBM A;  1HW1 A;  1BJZ A;  3K4L A;  1J0R A;  3RSN A;  2K9Q A;  1IRG A;  9ANT A;  3FBN B;  2KPM A;  1MDM B;  3CF2 A;  3Q0V A;  2IGM A;  4LLG F;  4ZYH A;  1ODD A;  2IP2 A;  3JW4 A;  2H94 A;  3U21 A;  4P55 A;  5LBQ A;  2VQG A;  1LFU P;  5F64 A;  3E6M A;  3K10 A;  1D1A A;  1WKM A;  2F07 A;  1I5Z A;  2FMY A;  1RUO A;  1IAW A;  3LFU A;  2QQB A;  3VOE A;  4BXU A;  5F1R A;  4LMY A;  3DV8 A;  5FGM A;  5CYV A;  2CU7 A;  2E5N A;  2WB1 N;  4DOZ A;  1MSF C;  4DBQ A;  3WU2 C;  3RKQ A;  3CCE I;  2Y48 A;  3K1M A;  4D9J A;  2DMP A;  4EGY A;  1JKR C;  2XRO A;  4GCV A;  3K4N A;  5FKN A;  2IA1 A;  5HSZ A;  3L9F A;  2A6H F;  3QOP A;  3E7L A;  2X6Y A;  2HTJ A;  4UUS B;  3TDU C;  1G8X A;  3CJQ B;  3LSM A;  2NS8 A;  4D7M A;  2HDD A;  5DAJ A;  3CCQ I;  1FBQ A;  1Z91 A;  5EG0 B;  3FHN A;  1ZRC A;  3OSF A;  5D8K B;  2XPW A;  5BQT A;  2GXG A;  5DV5 A;  4ITV A;  1JJ8 C;  4JOM A;  3SFZ A;  3IKT A;  4GDF A;  3WE3 A;  3GZN B;  4PSX A;  2XVC A;  4EGZ A;  3ZPL A;  2DQL A;  1Z3X A;  3HC7 A;  4FE7 A;  3KKC A;  2ZCN A;  3IHU A;  4KDP A;  1XC5 A;  2BY0 A;  2WGB A;  1JHH A;  4BKX A;  3R61 A;  3LAJ A;  1ZAO A;  2G9W A;  3QPH A;  2AO9 A;  2VQC A;  2K85 A;  2DTR A;  4BUP A;  2DFH A;  1XMX A;  2KHM A;  2QM3 A;  3ZGK A;  4UHT A;  2LVS A;  2E5Z A;  1LVK A;  4CYC B;  5GP9 A;  1FYM A;  1BI2 A;  5HLI A;  3BRU A;  3V8L A;  1BN5 A;  2QCO A;  2PI0 A;  1XCB A;  2XAU A;  4A0Z A;  1V5G A;  1ZR4 A;  2V1D A;  4GFL A;  2HPI A;  1XCV A;  1VND A;  1TWC J;  2MA3 A;  3HJE A;  4W1U A;  4HQM A;  3WGH A;  4AID A;  3CCS I;  3M8F A;  3IUV A;  4XRM A;  3BR3 A;  1QO0 D;  2XB5 A;  3HUG B;  1UG2 A;  5LRR A;  1VQP I;  2O7T A;  2V26 A;  4Y15 A;  4G8X A;  5K7F A;  3F6O A;  1V55 H;  4AM3 A;  2NP3 A;  3LSP A;  2LDU A;  1UG0 A;  4N0B A;  3B02 A;  4RGR A;  5J47 A;  2O9L A;  4B8X A;  2DA7 A;  1J2X A;  4IX7 A;  1JT0 A;  1G3Y A;  2IAI A;  2L9N A;  4B3X A;  2EPF A;  2V6E A;  5LGT A;  1ERD A;  4BJ6 C;  1KA8 A;  1XSX A;  2W24 A;  2WTE A;  2OV7 A;  3AG3 H;  1U5T A;  3TO6 A;  5HLG A;  4HSR A;  1E3H A;  3F8N A;  3DBR B;  5M5X J;  2VOD A;  5H9T A;  4IQJ A;  1WWX A;  3J7Y J;  3NEU A;  1DPU A;  1WFX A;  2HKU A;  1B1B A;  3I4P A;  4UVB A;  4FIS A;  2QSF X;  4OAY A;  3DPT A;  4JX4 A;  3I64 A;  1YJN I;  2J5P A;  1TWA J;  2OZU A;  4BAC A;  2VC0 A;  4YFX F;  2JMW A;  4NUB A;  4MEX F;  1NK2 P;  3HPG A;  3CCL I;  2OTJ I;  5CVI A;  4O3M A;  4B1R A;  2LR8 A;  5J8F A;  3E6B A;  3J7A O;  5M3F J;  2GLO A;  2KP6 A;  2JRM A;  5L3D A;  1ZLJ A;  1U3E M;  1MJA A;  3NAR A;  3LSJ A;  2L02 A;  2FSW A;  1FOY A;  2UV1 A;  4IPA A;  2KRC A;  3CUO A;  1MBE A;  3GTO J;  3DU5 A;  2R7D A;  2LY2 A;  5JLX A;  3PQJ A;  3ZQI A;  3BG6 A;  3WHB A;  3I5U A;  3DQV C;  4A2U A;  1S8N A;  3O8G A;  3PM1 A;  2UZK A;  4KMF A;  3K7A J;  2BEO A;  2Z33 A;  4RAG A;  1HDP A;  4OOI A;  4HQE A;  4G6T B;  2YVE A;  2BYV E;  5F1J A;  3OYI A;  3HTH A;  4KIB A;  4EM0 B;  4F93 B;  4HG2 A;  4BBR J;  1B72 B;  2STT A;  4I01 A;  1MBJ A;  4HZF A;  1G6N A;  1BIA A;  2UXX A;  5DDG A;  4BGD A;  4XQF A;  5H20 A;  4UUT A;  4E7L A;  4KIS A;  3O60 A;  2VBZ A;  2DTZ A;  1JE8 A;  1ZYR F;  1DP3 A;  1MMN A;  4OMZ A;  5CVU A;  3HSR A;  5E3N A;  3M4O J;  3R4K A;  2HKO A;  4AD9 A;  2BY3 A;  5D5V B;  3S2D J;  5D5X B;  4QWQ A;  1ZK8 A;  3HL2 A;  3ERE D;  3FXJ A;  5IP9 J;  2RV8 A;  3FXU A;  4BQA A;  1BIB A;  4RB1 A;  1SFU A;  4A5N A;  4I6Z A;  2AQF A;  3WG9 A;  5M5Y J;  4A3J J;  4WXC A;  2NOG A;  4ESF A;  1YW8 A;  1RI7 A;  1GVJ A;  2E7W A;  5TRD A;  3CDL A;  1GV5 A;  3ISP A;  5JHU A;  5J8C A;  5CQE A;  1WJA A;  2QEN A;  2ZC2 A;  3BTL A;  2QUF A;  5CVJ A;  5F04 A;  1YO5 C;  1T0F A;  4I7H A;  5CJ9 A;  2X6O A;  5HS7 A;  2OA4 A;  5B1A H;  1W5C C;  4A69 C;  2YVX A;  2Q1Z B;  3C1D A;  2A6E F;  4C3H J;  5IP7 J;  2ECB A;  4HPQ A;  1N25 A;  1WH5 A;  3DTK A;  4E7H A;  2QWT A;  2E2J J;  4M3B A;  4IQ4 A;  2IA0 A;  2OD5 A;  3S5R A;  4O5V A;  2FX0 A;  1Z7L A;  3JSP A;  2PG4 A;  1NTC A;  2MW8 A;  2VIX A;  4WF2 A;  4I02 A;  3HPH A;  3QP5 A;  2XB0 X;  2BW3 A;  3TOB A;  2IJL A;  1FIA A;  5JI6 A;  3CCY A;  3V42 A;  2K02 A;  1P9Q C;  1W36 D;  3SDB A;  2LG4 A;  1I6H J;  3GCM A;  4CGR A;  3QYE A;  5CLS A;  2HVS A;  2E2H J;  2Y30 A;  2WAQ N;  4P9F A;  1JUS A;  4GCK A;  4PGG A;  2GBY A;  1XS9 A;  2HPM A;  4XLF A;  1OFC X;  2D6Y A;  1Y8R B;  2CW8 A;  4L5I A;  1B8I B;  3JRE A;  2QSG X;  1NHA A;  1WH7 A;  1UEL B;  3CCU I;  2MD5 A;  1TWH J;  1E2X A;  3P7N A;  1T56 A;  3KZ9 A;  3N4M A;  1G2H A;  2LKP A;  2RKH A;  1A5J A;  1X4P A;  3K6G A;  3BQZ A;  3BG7 A;  4CCL A;  3F8B A;  1W7P D;  3GTM J;  3S1N J;  1FMW A;  1JTX A;  3KFW X;  4U9L A;  2GOX B;  2EZK A;  4EJW A;  3ZMZ A;  2ZFU A;  4UVC A;  3LHQ A;  3PJR A;  4XOT A;  3RJP A;  3A02 A;  1TP4 A;  3DTE A;  2XC7 A;  3CO6 C;  3JCU C;  2E1M B;  5HVQ C;  1OYY A;  1U9N A;  3IH3 A;  2VJJ A;  4KIT B;  2DPD A;  3T6N A;  5EZG A;  1QVT A;  2L7K A;  5C4Y A;  4UB6 C;  4I0B A;  1FYK A;  4UB8 C;  4FQG A;  2QOP A;  2O7O A;  2OQR A;  5FLX Z;  4JQF A;  3JAM Z;  5LEK A;  3VW2 A;  4CXF A;  3MKY B;  3RYP A;  2IRF G;  2VJI A;  1JUM A;  2ZME B;  4M3D A;  4J00 A;  5IT9 K;  2FBQ A;  2HZD A;  1U9O A;  2YS9 A;  4II2 A;  4BY1 J;  1GHC A;  2GOM A;  3F8F A;  4DYR A;  2XDV A;  3H0D A;  4A3K J;  2Q0O A;  4N9I A;  2PQ8 A;  4XN3 A;  3MZY A;  1HLV A;  1P92 A;  4JBA A;  1FY7 A;  1F1Z A;  3WTX C;  1OR7 A;  1Z1D A;  4KMU X;  1UST A;  2GEN A;  3LSH A;  5CW8 A;  3PNT A;  6PAX A;  1WCM J;  1YG2 A;  3FWE A;  1B6A A;  4ENM A;  1QZY A;  3OYD A;  1K6O A;  3I3L A;  2ESH A;  4F7Z A;  5JVG F;  3VPR A;  2ZNZ A;  4ON0 A;  2H8W A;  3GFL A;  1JGG A;  2X1D A;  2COM A;  3ASN H;  3PUB A;  1V3F A;  3AFH A;  2A07 F;  2LSO A;  1RKW A;  2P4W A;  3VYT B;  1EH7 A;  3R0A A;  5EF6 A;  3P5J A;  5KHD A;  4A3F J;  2GA2 A;  1BW6 A;  2HXO A;  2N8G A;  2R7W A;  3DBH B;  5EYR A;  2G3B A;  1RRJ A;  4I0A A;  1XDS A;  4AWX B;  3CC2 I;  2ZFW A;  3LSK A;  3FRQ A;  1UHS A;  2YU3 A;  3S15 J;  3F0C A;  1X58 A;  4QLC U;  3NWT A;  4OMY A;  2FOW A;  2HWV A;  3U1D A;  3M8J A;  1KU7 A;  3ECO A;  1S72 I;  3ZP5 A;  2DW4 A;  4RAF A;  4JL3 A;  3R0J A;  4JK1 X;  1QPI A;  4FTH A;  2LD5 A;  1N78 A;  4QSH A;  1PYV A;  3SHF A;  3TBI A;  5L3G A;  2XF6 A;  4MLO A;  4LK0 F;  4C2T A;  4YEJ A;  3IUO A;  3GTG J;  3SDG A;  5B3S H;  3GTQ J;  3I59 B;  2VL8 A;  4NEL A;  1I3Q J;  4D1Q A;  5D4S A;  2QKO A;  4BNC A;  3F23 A;  1Q1H A;  1MJ9 A;  2JPB A;  2KFD A;  2DOD A;  5K7H A;  4HW0 A;  4HV6 A;  2ZJQ F;  1CQT A;  5D19 A;  3RZO J;  2EFP A;  1YYV A;  3H9Q A;  3BR0 A;  5B5E C;  2FJ1 A;  5CPR B;  3CCJ I;  4WWC A;  2ME0 A;  4M9S A;  4MFE A;  1ZR2 A;  1IXS B;  2MC3 A;  3EDP A;  4C30 A;  1G3W A;  2R7F A;  2CH0 A;  4MNU A;  3VOK A;  3HM5 A;  5F0F A;  2EK5 A;  3H5N A;  5KAF C;  3JRF A;  1S5L C;  4L9V A;  2OUM A;  4B09 A;  3C2G A;  2XGC A;  2R7U A;  2NNY A;  1XGM A;  3HTJ A;  2X4H A;  2PBX A;  4AC6 A;  1E3P A;  3RI4 A;  3QOD A;  4GXO A;  1XN7 A;  4NC8 A;  2CQX A;  4LOC A;  2XPU A;  2P6T A;  1RPW A;  5DCF A;  2XAF A;  4Q47 A;  2UXP A;  4XM3 A;  4Y17 A;  1UZC A;  2MGQ A;  5FB2 A;  1XD7 A;  1TQP A;  5FKK A;  3U9G A;  2DPU A;  1FX7 A;  1HW5 A;  4L9N A;  1XG1 A;  5E8I A;  4A3E J;  2Y0S A;  4PCQ A;  4PXI A;  1SFX A;  2BY1 A;  2AS5 F;  2X1C A;  2B7E A;  3D5R C;  2IGO A;  5FFZ A;  2JSP A;  2E1O A;  3GEZ A;  4CZC A;  1MMS A;  1F5T A;  2HS5 A;  2WAE A;  3TW7 A;  2MLG A;  2I8D A;  5HDG A;  4IHW A;  1J9I A;  1FSH A;  3W6J B;  1FOX A;  1VQ9 I;  2PMH A;  1UMQ A;  4HLY A;  2K4B A;  5IYB J;  1R1U A;  4XRS G;  1PP8 F;  4NN1 A;  3RYR A;  4MGR A;  3Q9V A;  2QKL B;  4P5O A;  4M6V A;  3EYI A;  1UJ8 A;  2X9D A;  2ZCX A;  5HDN A;  4A3D J;  5EGO B;  3LWJ A;  3VP5 A;  2M30 A;  1D0X A;  2HYT A;  3OYH A;  1LFP A;  1YI2 I;  2Z1D A;  2EWN A;  4BQO A;  1M1E B;  2M9H A;  1D0Z A;  1Z0X A;  5EJC A;  3QP6 A;  1T95 A;  3LL7 A;  1KYW A;  2BGC A;  3C7J A;  3E5X A;  4LJZ F;  3MZH A;  2E1M C;  3ZN1 A;  1YFH A;  3ASO H;  1LDD A;  5A2Q Z;  5KNL A;  3FKJ A;  1ZLK A;  5CVV A;  2B0L A;  3HEF A;  3OOP A;  4P96 A;  3S16 J;  3K8P C;  5KCM A;  1BC7 C;  1KU3 A;  1R1T A;  4B48 A;  5D8L B;  2ZME C;  2ZSH B;  1B4A A;  1S3J A;  2P7C B;  5K7Z A;  2XAJ A;  2K9L A;  4A3L J;  1RKT A;  5IOZ A;  4X6A J;  1ZG3 A;  1S9H A;  4O6J A;  3O2P E;  3T8R A;  3VUQ A;  2IU5 A;  2P0W A;  3GWZ A;  2PEX A;  3ZMV A;  2O5R A;  4AVZ A;  5E3O A;  2NS7 A;  3VVZ A;  1WI9 A;  1TW3 A;  4WK8 F;  3V6G A;  3ABU A;  5IT3 A;  4OD5 A;  3ZOB A;  1S29 A;  1WJB A;  3KZZ A;  3SZG A;  2DMU A;  3CWR A;  2BOL A;  4RB3 C;  2ELK A;  2P8T A;  3K4B A;  3RQI A;  2AQE A;  3FDY A;  1O7F A;  5K58 A;  3H5A A;  2VT2 A;  4HX8 A;  1MKM A;  3PNV A;  3GO5 A;  2J5O A;  3NNR A;  3KKD A;  2XAH A;  3SQN A;  4KT6 A;  4WIB A;  1SFK A;  1MNM C;  1TLH B;  2CWE A;  1MJB A;  3GUD A;  1H0M A;  1JKP C;  4BXF A;  4LIV A;  3LA3 A;  3GTP J;  2CQ7 A;  5E1W A;  1WPK A;  5DUI A;  5HOO A;  2W57 A;  4HLX A;  3G7R A;  4ZYD A;  3IV5 A;  1WJD A;  3N97 A;  3GVA A;  1KYZ A;  1Y6I A;  2VKH A;  3G1L A;  2LC2 A;  4BXX J;  4D5F A;  3H0G J;  4IHY A;  2NVY J;  3JRA A;  4C2U A;  4RGS A;  2HTS A;  3S3N A;  1RUN A;  1DQU A;  3CRJ A;  1QHH D;  2HNH A;  1PUE E;  4L62 A;  5E1Z B;  4JKZ A;  4RAY A;  1ETW A;  1LEB A;  2FU4 A;  5FFX A;  2R92 J;  1RC9 A;  3HTU A;  2FML A;  3CQZ J;  4U0V A;  5C4J J;  3DEU A;  3TOA A;  3HHH A;  3EGQ A;  4HNU A;  2EH3 A;  1LB2 A;  2D1H A;  2O8K A;  1YS6 A;  1SD6 A;  2VAS A;  5L3B A;  2ZJR F;  5EFY A;  3DP7 A;  3PPB A;  1QPM A;  2M87 A;  1IDY A;  3FMR A;  5J4Y A;  2DA2 A;  3FXK A;  3ZRG A;  3J81 Z;  4CZZ A;  1P4A A;  1ETK A;  1R36 A;  2FE3 A;  3KEQ A;  3GTK J;  1G59 A;  3HG9 A;  4PK4 A;  1UHM A;  1Y0N A;  1TNS A;  1LKX A;  2LOO A;  4A3B J;  4XRF A;  3RPU A;  1X19 A;  5L3C A;  2AHQ A;  2GIZ A;  1ZQ3 P;  1H89 C;  1O7L A;  2Q8K A;  3I0T A;  2EJR A;  4Q4Z F;  2FOK A;  2PLY A;  2IXS A;  4XKC A;  2KIF A;  5M5W J;  2DG7 A;  2QQ9 A;  3K1N A;  2UXN A;  2DYR H;  4NC7 A;  2R5Y B;  3E3V A;  3T1B A;  1KQ9 A;  1A36 A;  3AKZ A;  1KQ0 A;  3BR6 A;  2X0L A;  1EF4 A;  1ZRD A;  1FT9 A;  4A3M J;  1U8B A;  4CIC A;  3ZCO A;  5GPC A;  2IT0 A;  5DM7 F;  2PMZ N;  1VQK I;  1SVM A;  2K4J A;  1WJF A;  3PL8 A;  3WGG A;  3OS0 A;  4MK6 A;  3MZ8 A;  5FRO A;  4IHS A;  2LH9 A;  1K78 A;  1NH3 A;  4XON A;  4DW6 A;  3HTA A;  3G1O A;  2RQP A;  1H9T A;  2VKE A;  2VQH A;  3G1M A;  3M9A A;  1JKQ C;  2RAE A;  2Y9Y A;  4IHV A;  4CCM A;  3KEO A;  1AA7 A;  3KYD B;  4UV9 A;  3K69 A;  3K4J A;  4HDU A;  3S3O A;  1RET A;  2EZL A;  4MQV A;  1OCO H;  4NC6 A;  4FAS D;  4U88 A;  1ETX A;  3D5S C;  1MND A;  1J7K A;  2M1B A;  2EIK H;  1U2W A;  2L54 A;  4NQW B;  2XAS A;  2DOE A;  1P4X A;  2AXT C;  4II3 A;  1AKH A;  1LQ1 A;  3ANG A;  4U87 A;  1R58 A;  2VOO A;  1UI5 A;  1BW5 A;  2E2I J;  4LG3 A;  3JTG A;  1U6G A;  4IOC F;  3BTC A;  2PFB A;  4IEJ A;  4J19 A;  3JTH A;  1YOV B;  3Q5F A;  3EUH C;  3HKZ A;  3RPQ A;  4EJO A;  2CMP A;  1LE8 A;  2KRF A;  2WBM A;  5J4V A;  2VUM J;  1TW2 A;  1DGW Y;  3OS2 A;  2L7F P;  3BLY A;  1X3U A;  1WSU A;  2FBH A;  3TQN A;  4NBQ A;  2IGN A;  4KN7 X;  2XSJ C;  4C2M J;  1DUX C;  1ACI A;  4XSX F;  1SMT A;  2ISZ A;  5ERI A;  3OYE A;  1G3T A;  3F22 A;  3BHQ A;  2DI3 A;  2R5Z A;  1PUF A;  2XRL A;  2VXD A;  4XRS A;  3BJA A;  3LWF A;  3ABK H;  3DKY A;  2R7Z J;  4YIF A;  1MH4 A;  3COA C;  2YR2 A;  1HKT A;  2WUI A;  4E7I A;  3CCM I;  2HQR A;  1D1C A;  1IXC A;  4G94 A;  3ON2 A;  5JFR A;  2FNP A;  5K5O A;  5J3L A;  1J75 A;  4BEH A;  2O61 A;  4F55 A;  2MC4 A;  3J80 K;  2Y69 H;  2G7U A;  3IRR A;  1CGP A;  4HF0 A;  3EPZ A;  3OYG A;  1FP1 D;  3VWB A;  2ECC A;  4NNJ A;  1B9N A;  3QQA A;  2ZB9 A;  4HEA 2;  3ZXS A;  3F8M A;  2MD0 A;  3ZQ7 A;  3BRO A;  2HOT A;  1HKQ A;  2IVM A;  3H3V K;  2DA5 A;  3PSF A;  3RIR A;  4WX9 A;  2XV4 S;  1GDT A;  2EBI A;  4OIO F;  4MQ9 F;  3OIQ A;  4ZDP A;  4ETS A;  2TCT A;  2ZXW H;  3FM3 A;  4EMS A;  3MD2 A;  1IC8 A;  3VEP A;  3FX3 A;  4W97 A;  3SXY A;  1SEU A;  4DYC A;  5HDK A;  2V57 A;  1KZH A;  1TT0 A;  3MVP A;  2CG4 A;  2EZI A;  3DF8 A;  1K61 A;  2ADU A;  4ZYA A;  1VTN C;  1VQL I;  3AG4 H;  3F8C A;  4CUG A;  2Q2E A;  2DFI A;  3JAM K;  1E3O C;  2CQQ A;  3LAP A;  4LLL A;  1DDN A;  4Y3O A;  3VYS B;  2QZ8 A;  4CYD A;  4PJ0 C;  4N4N B;  2V4J C;  3H3U A;  3W3C A;  3MAJ A;  1IN6 A;  2E60 A;  3CJD A;  4M6X A;  5LEJ A;  5E3M A;  4JP0 A;  3R6S A;  2A6T A;  1GLN A;  2R7V A;  3K9T A;  1XGO A;  3A2K A;  1OCR H;  1A35 A;  1XTA A;  1MBF A;  1LFB A;  1XMA A;  4ZYE A;  2CYY A;  4LK1 F;  1WJ5 A;  2X51 A;  5J1U A;  2HQ5 A;  3WHC A;  1HC8 A;  5DCM B;  1BR1 A;  2CV0 A;  3VOX A;  3TP3 A;  4HV5 A;  1BJA A;  5K5R A;  4AIJ A;  5D5W B;  2W84 A;  4XOR A;  5GAD J;  1JKO C;  4KFC A;  2KIU A;  2XF5 A;  3GZ6 A;  4X0G A;  4OIQ F;  4ZTJ A;  2ZOY A;  3ON4 A;  5ICG A;  1GV2 A;  1IN4 A;  3OV8 A;  4ZC3 A;  3G3Z A;  2MH2 A;  1SAN A;  2F5F A;  3KCC A;  1MMG A;  2A3S A;  3PFY A;  3KPH A;  3DCF A;  3PNY A;  2QLZ A;  2XAG A;  1KGS A;  4IL6 C;  2H1K A;  2H6B A;  4E4H A;  2XAQ A;  3EET A;  5F08 A;  2Z2S B;  5E18 F;  2XPV A;  5LD2 C;  5C44 J;  1LPQ A;  3BTJ A;  2FBI A;  3EQL F;  2F6C A;  3TO7 A;  4RAZ A;  5LHI A;  1ON2 A;  1SD7 A;  3BR2 A;  4EM2 A;  5HLH A;  1PP7 U;  3ABT A;  4ZTF A;  4S0H B;  5AQC A;  4B44 A;  2QIB A;  5E3L A;  1WVR A;  5IY5 H;  1XX5 A;  2GFN A;  2ISY A;  5BS6 A;  2HQA A;  3HHG A;  2BV6 A;  5D4R A;  3AL0 B;  4A0Y A;  1ZN2 A;  4IJA A;  3M7G A;  3AG1 H;  1N77 A;  3FXL A;  3P9T A;  2IS1 A;  3CD6 I;  5JVT A;  4AUX A;  1BC8 C;  1I6X A;  1R6R A;  3PSI A;  3GFI A;  2DT7 B;  5D5U B;  3FIS A;  1Y1V J;  1IV6 A;  4CGZ A;  5HBU A;  1X2N A;  5EZH A;  2R93 J;  1XGN A;  5EEG A;  4AVP A;  2R0Q C;  1FBS A;  5FD6 A;  3HYI A;  2V79 A;  2STW A;  1Z77 A;  4L0Y B;  2NAZ A;  3LJL A;  1VQO I;  3IH2 A;  3ZMT A;  5TJJ A;  2COB A;  2WA0 A;  1G4D A;  4LFU A;  2YX7 A;  2EA4 A;  2EV0 A;  2P81 A;  4M73 A;  2VJ5 A;  2P6S A;  4OIP F;  3A01 A;  2PJR B;  1IDZ A;  2GUH A;  4G6Q A;  3CCR I;  3ZR8 X;  3SWH A;  2KIM A;  2QVO A;  5E8G A;  4FCY A;  2H8R A;  2NVX J;  3GEU A;  3KIO A;  3WE2 A;  2PN6 A;  3GXO A;  3F72 A;  4K2E A;  3RPU D;  1V5F A;  2ZCM A;  2RGV A;  5JR3 A;  4UDS A;  3VYU B;  3D1N I;  5JHF A;  2BBY A;  4RBO A;  3CMY A;  2HI3 A;  5ICF A;  4EJU A;  1X3W B;  4KJZ A;  4BL0 B;  1O3T A;  2FJI 1;  3CC7 I;  5CVR A;  3TMO A;  2XSD C;  2ETH A;  1Y56 A;  4G7Z F;  2WWY A;  1ZG5 A;  1SAU A;  5H2F C;  1R4M B;  1O3Q A;  2DCE A;  2CS3 A;  1X1C A;  2D45 A;  1MDM A;  4KIF A;  2M7B A;  1W1W E;  3VOD A;  5ICC A;  2VBY A;  1VQN I;  3CLQ A;  1AU7 A;  3DEW A;  4HF1 A;  3V4G A;  3DEE A;  1S7A A;  2Y75 A;  3A0H C;  4MEY F;  3HGY A;  2IS6 A;  1T2K A;  1VI0 A;  4L0Z B;  2V6C A;  1Y39 A;  4G12 A;  3DPU A;  5J6X A;  4G7H F;  3HOU J;  2DA4 A;  1SVL A;  2KZV A;  2VBW A;  3RCO A;  3SEQ A;  2G0E A;  4XR6 A;  4YIR X;  3WTT C;  1PDN C;  1U8R A;  4ZZD A;  1K4T A;  1W7P B;  3M3Y J;  3COL A;  1X2M A;  2ZJP F;  2ZCW A;  1ON1 A;  3L1P A;  1KON A;  1Z6T A;  3C18 A;  1GUU A;  2F5C A;  4F52 A;  2PMU A;  1ZRE A;  1MBH A;  5L3F A;  3IAM 2;  4UUS A;  3LNQ A;  3FXM A;  3NWS A;  3CJN A;  4M9X A;  2LK2 A;  2DA1 A;  2LMD A;  4C9Y A;  2B1E A;  3FXR A;  3FIW A;  3M1C A;  4PFP A;  3K70 D;  5EG0 A;  4CCN A;  2DU9 A;  2NP5 A;  2HEO A;  2Z99 A;  4KWA A;  3HOT A;  2ZXJ A;  1R7J A;  3HGG A;  2PMZ A;  2V1U A;  5K1Y A;  1YIT I;  2M8E A;  4BYY A;  4EVI A;  4HNT A;  2CQK A;  2DLL A;  2OPT A;  2WB1 A;  4OIR F;  5BPI A;  3HOV J;  2CRG A;  4A5M A;  1UFM A;  2IS2 A;  4BAY A;  1D8K A;  2KLO A;  2W85 A;  2VE8 A;  3X2Q H;  3L2W A;  1VQM I;  3LSI A;  4P9U A;  4Y52 J;  2HZT A;  2L4A A;  1DPR A;  4DZP A;  5DM6 F;  2LY9 A;  2E71 A;  4XLP F;  2F5E A;  3F9K A;  1K83 J;  2WY8 Q;  1K78 B;  2FQ3 A;  2V1X A;  3CTA A;  3MNL A;  5EEA A;  3SFI A;  3BCG A;  1FOW A;  1VQ5 I;  4XLN F;  4M72 A;  2K9S A;  3W6K B;  4CYC A;  4ACI A;  4M71 A;  5K5Q A;  2K40 A;  3OIO A;  4XK4 A;  3DLA A;  3V7R A;  3MKW B;  4YRV A;  2KQR A;  4OIN F;  1K79 A;  2K9N A;  2JA8 J;  4ESJ A;  2DDB A;  3O8H A;  1T38 A;  1OCT C;  3H36 A;  3OR2 C;  2JZY A;  4BHB A;  1ZKG A;  3QKX A;  1Z3Y A;  3CMM A;  1FYL A;  3HUG A;  5L3E A;  4EM1 A;  3OYF A;  1JTY A;  2VN2 A;  4S05 A;  1X1B A;  2RQQ A;  2EA2 A;  2B9S A;  4GGG A;  3OL3 A;  4GO1 A;  2ME6 A;  2XKP A;  3BP8 A;  4XSZ F;  1BI0 A;  2JT1 A;  5HS9 A;  4I98 B;  1G3S A;  2L9V A;  1E0E A;  1MBG A;  2FA5 A;  1ZRF A;  2HFH A;  2BZT A;  3G2B A;  2I10 A;  1LDK B;  1USS A;  1DP7 P;  2A2F X;  2HR3 A;  2W48 A;  2HVQ A;  4U9N A;  4BJT A;  1QBJ A;  3QRF F;  3BY6 A;  2DMQ A;  4PSW A;  1SD4 A;  1T8I A;  3KP4 A;  1A04 A;  3HZJ A;  4EV0 A;  4LLN A;  3OYK A;  5DYM A;  2NX4 A;  3JRG A;  3IKV A;  3S1Q J;  2NNN A;  2KZG A;  2QQ8 A;  4ZJZ A;  2M5W A;  3C2H A;  2EQR A;  3BR5 A;  5FLV A;  3HTI A;  2KJC A;  4CDG A;  4HX4 A;  4TV7 A;  4KA4 A;  2CUJ A;  1HW2 A;  4H4K C;  2ZKZ A;  3BR1 A;  4XID A;  2F5D A;  4HF2 A;  1RIO H;  4N4O B;  2O03 A;  4JYK A;  4FE4 A;  2KJB A;  2NVT J;  2FEZ A;  3TW6 A;  3AL0 C;  1F36 A;  3A1Y A;  4XKW A;  1HOM A;  4RB0 A;  1D1B A;  2KT0 A;  4L5J A;  2XUB A;  1VZ0 A;  3KLO A;  2DXI A;  3BPX A;  2DJN A;  4QPO A;  3LQR A;  4YFK F;  2EIM H;  4GYI A;  2QYO A;  3W2V A;  4KIC A;  2GM4 A;  1I1G A;  2A61 A;  1XDU A;  3DPJ A;  5LGN A;  3PO3 J;  2HQN A;  1QA6 A;  2QBY A;  1MMD A;  4BJ5 C;  3Q9S A;  1ULY A;  2P7V B;  2HYG D;  3FXQ A;  4PZJ A;  4BEH B;  2Y2Z A;  1OCZ H;  2K27 A;  3I71 A;  4DBR A;  3HIF A;  1JGS A;  1ZAR A;  2NS0 A;  2W00 A;  4N9H A;  3HB9 A;  3VFZ A;  1NG6 A;  1E17 A;  3DKX A;  1U5T B;  1WI3 A;  2X6X A;  5BMZ A;  1QU3 A;  2F4O B;  2LBF A;  4M3E A;  4MTE A;  4DZJ A;  3PUF A;  5IOY A;  1U0J A;  3G71 I;  4DNC A;  2F4M B;  2ELJ A;  2V7F A;  2QEX I;  3B81 A;  4G6D A;  1LEA A;  2PJP A;  3MMY B;  4HKU A;  3TP0 A;  3C3W A;  2DBB A;  1UB9 A;  3H1C A;  3LMM A;  4WXH A;  3IWZ A;  1W4M A;  4KT5 C;  1APL C;  2EFN A;  4PGH A;  3TDZ C;  3ZN0 A;  3VYR B;  3AQT A;  1ZGW A;  1EH8 A;  1B72 A;  1SFE A;  2R7T A;  2HGC A;  2ZBK A;  2L01 A;  1LNW A;  4DVY P;  2HYF A;  2BVL A;  2ID3 A;  3OYB A;  1TWF J;  1L0O C;  1X1P A;  1Z05 A;  2M0C A;  4RS8 A;  4YFN F;  4ZH4 F;  1YJ9 I;  3ZQF A;  2MLK A;  3GF2 A;  1TL8 A;  5FGL A;  1YTY A;  2JVG A;  3R60 A;  2OU2 A;  1W36 C;  3ROU A;  3PAS A;  2KIQ A;  4V19 K;  1R00 A;  3QYF A;  1UAA A;  1BOA A;  4FT8 A;  1OYW A;  2JQ7 A;  4HRI A;  5LLQ A;  2LLK A;  4LIT A;  2IPQ X;  1D5Y A;  1P2F A;  2A68 F;  4A3G J;  2RAS A;  4DGW B;  2P5V A;  1IUY A;  4B43 A;  1TT5 B;  1BR2 A;  4JX5 A;  3HXL A;  2VT3 A;  3K1P A;  3H9G A;  4D5C A;  3KP3 A;  1TBX A;  2XRN A;  5LHH A;  5ILU A;  4HST A;  2F4I A;  4UXN A;  5AON A;  1R22 A;  2ESN A;  3OR1 C;  4KUM A;  1RES A;  2LRE A;  2HXI A;  2IGK A;  2GQQ A;  2X1E A;  3CLO A;  5GTI C;  2GWR A;  3OSG A;  2VLA A;  1FZP B;  1ITY A;  2K86 A;  3F1B A;  4QIW N;  2L7M P;  3F21 A;  2OTL I;  3JRC A;  2D2W A;  2LKX A;  3HRM A;  2A05 A;  3KP2 A;  3JRB A;  5DTD A;  2M7A A;  3E6D A;  2YSR A;  3FMQ A;  4R79 A;  2OC6 A;  2MG4 A;  4LB5 A;  2FRH A;  1LJ9 A;  2OCE A;  1HA8 A;  4BS9 A;  2Z9O A;  3V78 A;  3E5U A;  3LA2 A;  3H9J A;  4OWR B;  2VE9 A;  4XKB A;  2BHY A;  3FXO A;  4UUV A;  4GYG A;  2PFV A;  1YX5 A;  1VFC A;  3ANP A;  3GFJ A;  3K4C A;  1B8I A;  3QYB A;  3KET A;  3K0L A;  4E6K G;  2DFE A;  1ZH5 A;  4WCG A;  3ZQG A;  4ZDL A;  3BOQ A;  4HDV A;  1WQ2 A;  3MKL A;  3P9K A;  2JA2 A;  1BR4 A;  5FKM A;  4IHX A;  1HST A;  2D5V A;  2UXI A;  1FC3 A;  3MFK A;  4I09 A;  3ZMS A;  1RNL A;  4KYW A;  2LY1 A;  2V9K A;  3BG5 A;  3A4C A;  1B9M A;  4I99 C;  4RMN A;  1ZTR A;  3CUQ A;  3E0J B;  2R3S A;  2WAQ A;  1S6L A;  3DPL C;  5DD4 A;  1IJW C;  4ESB A;  2BW3 B;  3WTY C;  2ZJ2 A;  3TED A;  3L7W A;  4BQQ A;  2CGP A;  5JLW A;  3H35 A;  2H1L A;  2DA6 A;  4XMY A;  2UWM A;  3WTU C;  5FHP A;  4L18 B;  2DK5 A;  2EV5 A;  4CHU A;  1MD0 A;  3LQQ A;  4B4C A;  2MFZ A;  2R7O A;  2ZME A;  5D6E A;  4D7N A;  3S17 J;  2NYX A;  4IRH A;  4RM3 A;  5LHG A;  2R7Q A;  3GZ5 A;  1R5G A;  3A0B C;  3JSJ A;  4KN4 X;  2JA7 J;  2Z5U A;  4X1E A;  3MWM A;  3L2V A;  4OAZ A;  1GVD A;  4Z6Y A;  3HDD A;  4EJV A;  5HAW A;  3WTS C;  2M4G A;  3RDI A;  5FRN A;  1IUF A;  2GIV A;  3BJ6 A;  2DO7 A;  1GT0 C;  1NK3 P;  1DU6 A;  1ZGA A;  2NVU B;  2L4M A;  1H9G A;  1RZ4 A;  1LUJ B;  4FET A;  1LDJ A;  3GTJ J;  1FTZ A;  2NXN B;  3OL4 A;  5KVR A;  2EIN H;  2QA4 I;  3L00 A;  4CA0 A;  1ETO A;  3OS1 A;  4ZDO A;  2DFF A;  1X3Z B;  2V9P A;  1MBK A;  2IEK A;  2WAD A;  4ASN A;  3FM5 A;  2PBI A;  3GFM A;  5BOX A;  1P7J A;  2DYS H;  3S32 A;  1VQ6 I;  4MO7 A;  5FKL A;  2DDA A;  2E35 A;  4L9T A;  4LD5 A;  3BZC A;  3I9V 2;  4E7Z A;  2UXU A;  3V7S A;  4S04 A;  4AIK A;  1K7A A;  4HX7 A;  1ZG1 A;  3P9I A;  3K4M A;  3BWG A;  3NS4 A;  1H8A C;  1U5T C;  2X85 A;  1SVO A;  1IN7 A;  3J7A Y;  2QWW A;  2D1V A;  4DQ2 A;  5GTH C;  1IV8 A;  1BOB A;  4QPQ A;  3DU6 A;  1Y1W J;  3PO2 J;  3GZI A;  3DTI A;  1HBX G;  2KIS A;  2B63 J;  2M2E A;  3Q0U A;  1ENH A;  2OQG A;  4BU2 A;  3VW0 A;  1KU9 A;  3WTZ A;  3F3X A;  1CF7 A;  5HLT A;  4R1H A;  3PQK A;  3I59 A;  2KDO A;  1WHU A;  1ORK A;  3FMS A;  4AYB N;  3IL2 A;  1AWC A;  3L2U A;  1N75 A;  4WXD A;  5AIP A;  2KDZ A;  3CES A;  1R71 A;  2MYS A;  4JNN A;  2LTP A;  5CXG A;  4A6D A;  3T8T A;  2IW5 A;  2MBF A;  3LA7 A;  3M07 A;  4RLF A;  5FMP A;  5FLM J;  2BY2 A;  1OCP A;  1I50 J;  5B1B H;  5DUK A;  1OPC A;  3A03 A;  5IYC J;  4BBS J;  3GLX A;  2FXA A;  2FD5 A;  4XL9 A;  3OYL A;  2H09 A;  3KLN A;  5KAI C;  4ENN A;  5HNF A;  4C3J J;  1O3S A;  1Z67 A;  2K9M A;  4CCK A;  4RGX A;  1QHG A;  1TTY A;  2L5Q A;  3I58 A;  1BL0 A;  3OIP A;  5DD8 A;  5GAG J;  4H0E A;  1Z21 A;  2LF7 A;  3I54 A;  3RKW A;  4GCL A;  3SJM A;  2FUG 2;  3BC8 A;  4M74 A;  3MEX A;  4IHT A;  3RKY A;  1AOY A;  2KRH A;  3G73 A;  1YRN A;  3LFK A;  2F48 A;  2FNA A;  2BXY A;  3SZP A;  3M1E A;  1IN5 A;  4DIQ A;  4BHC A;  2ZOZ A;  2CSO A;  1F9N A;  1MW7 A;  3PIP F; 
#chains in the Genus database with same CATH homology
 1R9T J;  3EUP A;  3I4N J;  2DN0 A;  3BG3 A;  1Z77 A;  3VOK A;  3HM5 A;  3LJL A;  3IH2 A;  5F0F A;  3JRF A;  2COB A;  3ZQC A;  2E19 A;  3FK6 A;  3HE0 A;  1QVU A;  2DA3 A;  1JT6 A;  2XGC A;  1UI6 A;  2P81 A;  1ETQ A;  2DMT A;  3JRD A;  3HTJ A;  3NXC A;  2PBX A;  5D18 A;  4AC6 A;  3A01 A;  2L0K A;  1IDZ A;  2GUH A;  3VIB A;  2G7S A;  3BQY A;  3GEU A;  4FCY A;  2CQX A;  4LOC A;  1JJ6 C;  2H8R A;  2XPU A;  2NVX J;  1RPW A;  4UDS A;  1S7E A;  2ZCM A;  2UXP A;  3ZQL A;  2Y0S N;  2FQ4 A;  5DS9 A;  3D1N I;  2MGQ A;  1O4X A;  4RBO A;  3CMY A;  2HI3 A;  4A3C J;  5FKK A;  3JRH A;  2VI6 A;  1XG1 A;  4A3E J;  2XSD C;  1MSE C;  4RDU A;  4PXI A;  1SGM A;  3A01 B;  2YU9 J;  3E7Q A;  3G56 A;  2E1O A;  2JA5 J;  2JN6 A;  5FJ8 J;  5EGO A;  5J1Y A;  3NRG A;  3TW7 A;  3GBG A;  5BNG A;  1AHD P;  4IHW A;  3S1R J;  2MSY A;  1UMQ A;  1AU7 A;  3DEW A;  5IYB J;  4HNV A;  4XRS G;  2UXO A;  4NN1 A;  3AQS A;  3HGY A;  2OF7 A;  3S2H J;  1VI0 A;  3QBM A;  4M6V A;  4Y7N J;  1DU0 A;  2X9D A;  1BJZ A;  4G12 A;  3HOU J;  2ZCX A;  3B6C A;  4A3D J;  3VP5 A;  2K9Q A;  5EGO B;  1W0U A;  2DA4 A;  9ANT A;  3LWJ A;  2G0E A;  2HYT A;  1MH3 A;  3Q0V A;  3M3Y J;  4ICH A;  2M9H A;  3COL A;  1X2M A;  1Z0X A;  3L1P A;  1ETV A;  3HOW J;  1LFU P;  1GUU A;  1MBH A;  2F07 A;  4UUS A;  3LNQ A;  3VW1 A;  4MIM A;  1FJL A;  2LK2 A;  2DA1 A;  3HEF A;  2CU7 A;  3HOX J;  2WB1 N;  3FIW A;  3S16 J;  5EG0 A;  1MSF C;  2NP5 A;  3RKQ A;  4KWA A;  4JX6 A;  5CXI A;  3HGG A;  2OER A;  2OPT A;  2DMP A;  1JKR C;  5FKN A;  2CRG A;  5K7Z A;  3HOV J;  5HSZ A;  1T33 A;  1RKT A;  5IOZ A;  4A3L J;  4X6A J;  3E7L A;  4UUS B;  4Y52 J;  4DZP A;  3VUQ A;  2IU5 A;  2LY9 A;  2NS8 A;  4D7M A;  2HDD A;  5DAJ A;  4YZE A;  5F27 A;  5EG0 B;  5E3O A;  1K83 J;  2NS7 A;  3VVZ A;  3OSF A;  2XPW A;  3V6G A;  1JJ8 C;  3MNL A;  2XGD A;  5EEA A;  3SFI A;  3ZOB A;  3BCG A;  3QPS A;  4ME9 A;  2K9S A;  2DMU A;  4CYC A;  4ACI A;  3CWR A;  1POG A;  2K40 A;  2ELK A;  3OIO A;  4XK4 A;  4XIC A;  3JRI A;  4FE7 A;  3RQI A;  3KKC A;  2ZCN A;  1WGX A;  3C07 A;  5K58 A;  4MXM A;  1XC5 A;  1QRY A;  2K9N A;  2WGB A;  2JA8 J;  4BKX A;  3O8H A;  1OCT C;  1ZKG A;  3NNR A;  2AO9 A;  3KKD A;  3QKX A;  4C3I J;  1JTY A;  1MNM C;  1FIP A;  3BT9 A;  1JKP C;  2ME6 A;  1U78 A;  2LVS A;  1BA5 A;  3NAU A;  4CYC B;  3GTP J;  2YVH A;  5GP9 A;  1WPK A;  2IBD A;  2DG8 A;  3BRU A;  2QCO A;  1MBG A;  3G7R A;  2CUF A;  2I10 A;  1ZR4 A;  3KNW A;  4GFL A;  1VF9 A;  3IV5 A;  2W48 A;  1VND A;  1TWC J;  4W1U A;  2X48 A;  3G1L A;  3IUV A;  4XRM A;  3BR3 A;  4BXX J;  2XB5 A;  1OJL A;  1UG2 A;  2JJ7 A;  4D5F A;  3I4M J;  2O7T A;  3H0G J;  4IHY A;  2NVY J;  5K7F A;  3JRA A;  2DMQ A;  2NP3 A;  3LSP A;  4EEF G;  3CRJ A;  2NX4 A;  3JRG A;  3Q3S A;  4L62 A;  3S1Q J;  4JKZ A;  2QF7 A;  2O9L A;  1ETW A;  2DA7 A;  2ID6 A;  2EQR A;  3BR5 A;  5FLV A;  2R92 J;  1JT0 A;  3HTI A;  2IAI A;  1P7I A;  3CQZ J;  3BR1 A;  5C4J J;  3S14 J;  4XID A;  2XGE A;  4JYK A;  4FE4 A;  2UXH A;  2NVT J;  1Q1V A;  3TW6 A;  3EGQ A;  1F36 A;  1HOM A;  5F0H A;  2EH3 A;  2KT0 A;  1W0T A;  5M5X J;  2O8K A;  2RHA A;  2DJN A;  2GM4 A;  2VPR A;  3VVX A;  5H9T A;  5EFY A;  2Y31 A;  3PPB A;  3DPJ A;  1IDY A;  3PO3 J;  2HKU A;  2DA2 A;  2R5Y A;  2W53 A;  1ETK A;  3BNI A;  2Y2Z A;  4FIS A;  3GTK J;  2XDN A;  3HB9 A;  4JX4 A;  3C2B A;  1WI3 A;  2CUE A;  5IYD J;  4A3B J;  4M3E A;  1H88 C;  4DZJ A;  5IOY A;  4M3F A;  1TWA J;  4V2F A;  2AHQ A;  2L7Z A;  3RD3 A;  1ZQ3 P;  1H89 C;  2JMW A;  2DG7 A;  4NDL A;  3B81 A;  1NK2 P;  5M5W J;  4HKU A;  5EDN A;  3TP0 A;  2R5Y B;  4B1R A;  2LR8 A;  2CJJ A;  3BJB A;  4DYQ A;  4L5E A;  5M3F J;  3BR6 A;  2HOS A;  1APL C;  2GLO A;  1EF4 A;  5F0C A;  3NAR A;  3LSJ A;  3MN2 A;  4A3M J;  1U8B A;  3LSR A;  3AQT A;  3GTL J;  1ZGW A;  1B72 A;  2LP0 A;  5GPC A;  1MBE A;  2PMZ N;  3GTO J;  2ID3 A;  5JLX A;  1TWF J;  3ZQI A;  4MK6 A;  3WHB A;  4GCT A;  2M0C A;  3OOU A;  5HOD A;  3ZQF A;  4DW6 A;  3PM1 A;  3O8G A;  5FGL A;  3HTA A;  3G1O A;  3K7A J;  3PAS A;  1HDP A;  2VKE A;  3G1M A;  2YVE A;  3S1M J;  5F1J A;  1JKQ C;  3HTH A;  2RAE A;  2Y9Y A;  2LLK A;  2DMN A;  4BBR J;  1B72 B;  2NVQ J;  1D5Y A;  1MBJ A;  4A3G J;  2RAS A;  4IHV A;  4GFK A;  3NI7 A;  1RET A;  2EZL A;  5IP6 A;  4UUT A;  4JX5 A;  3O60 A;  2DTZ A;  4D5C A;  1ETX A;  5E3N A;  3M4O J;  3UKG A;  5IPA A;  3S2D J;  5D1R A;  1ZK8 A;  1RES A;  5IP9 J;  4AC0 A;  2HXI A;  3JR9 A;  1AKH A;  1UI5 A;  3ANG A;  3HIM A;  1BW5 A;  2E2I J;  3HKZ N;  3OSG A;  2JA6 J;  1ITY A;  3F1B A;  2G7G A;  4I6Z A;  4QIW N;  3BTC A;  2L7M P;  3FK7 A;  4IEJ A;  5M5Y J;  4J19 A;  2NOG A;  3JRC A;  2LKX A;  4A3J J;  3JRB A;  1IG7 A;  4MFD A;  5DTD A;  1SFO J;  1HDD C;  2JK3 A;  3CDL A;  1GV5 A;  1LE8 A;  2MG4 A;  2VUM J;  1F43 A;  3NPI A;  3BTL A;  5F04 A;  5C4X J;  3V78 A;  2L7F P;  2X6O A;  1AKH B;  4A69 C;  4C3H J;  4C2M J;  2HYJ A;  5IP7 J;  2ECB A;  1WH5 A;  3B6A A;  1VFC A;  2QWT A;  1IRZ A;  3ANP A;  2E2J J;  4M3B A;  2R5Z A;  3BHQ A;  1PUF A;  3S5R A;  2VKV A;  2XRL A;  1B8I A;  2FX0 A;  4XRS A;  2L9R A;  1NTC A;  2MW8 A;  5J1R A;  2R7Z J;  2XB0 X;  3ZQG A;  1FIA A;  1LE8 B;  1MH4 A;  3CCY A;  3LSG A;  3MKL A;  1I6H J;  2REK A;  2WUI A;  5FKM A;  4CGR A;  4B3A A;  4IHX A;  2D5V A;  2UXI A;  4GFB A;  3QPL A;  2E2H J;  2Y30 A;  2WAQ N;  4GCK A;  1JUS A;  4ABZ A;  3ON2 A;  2GBY A;  1XS9 A;  5J3L A;  1OFC X;  2EZH A;  3BG5 A;  2D6Y A;  2R5Z B;  1PUF B;  3ZQH A;  1B8I B;  3JRE A;  1WH7 A;  1ZTR A;  1IJW C;  5C3E J;  1TWH J;  3Q0W A;  3TED A;  1T56 A;  2ECC A;  2OI8 A;  1G2H A;  3KZ9 A;  1A5J A;  3QQA A;  5JLW A;  5FKO A;  2ZB9 A;  2DA6 A;  3HOY J;  3S1N J;  3BQZ A;  3GTM J;  5FHP A;  1YRN B;  1JTX A;  2HOT A;  2EZK A;  4B4C A;  3H3V K;  2DA5 A;  3LHQ A;  4A3I J;  1GDT A;  2EBI A;  4D7N A;  3S17 J;  4BY7 J;  3A02 A;  2TCT A;  3JSJ A;  1IC8 A;  1U9N A;  3IH3 A;  2JA7 J;  3T6N A;  5EZG A;  4X1E A;  1QVT A;  5C4Y A;  3FKI J;  3VVY A;  4AF5 A;  4W97 A;  1GVD A;  3HDD A;  4DYC A;  2QOP A;  5HAW A;  2WV1 A;  2O7O A;  1IUF A;  1GT0 C;  1FTT A;  1ETY A;  1NK3 P;  1DU6 A;  2V57 A;  3VW2 A;  3MVP A;  2FBQ A;  1JUM A;  4M3D A;  2EZI A;  1U9O A;  3RZD J;  3GTJ J;  1K61 A;  2G7L A;  1FTZ A;  2YS9 A;  1TC3 C;  4BY1 J;  4DYR A;  2PZ9 A;  1E3O C;  3BG9 A;  2CQQ A;  1ETO A;  4A3K J;  1TWG J;  4V2G A;  1MBK A;  1HLV A;  2IEK A;  3HOZ J;  2M8G X;  3IH4 A;  3CJD A;  5E3M A;  4JP0 A;  1P7J A;  4MO7 A;  5FKL A;  1IGN A;  1MBF A;  1LFB A;  2GEN A;  3K2A A;  2UXU A;  5CW8 A;  3W6V A;  1WCM J;  5J1U A;  2HQ5 A;  2YUS A;  3WHC A;  4I76 A;  1H8A C;  3VPR A;  3VOX A;  3TP3 A;  1JGG A;  2HOA A;  1JKO C;  1Y1W J;  3PO2 J;  1RKW A;  3GZI A;  2QTQ A;  5EF6 A;  4A3F J;  1HCR A;  2B63 J;  2M2E A;  2ZOY A;  3Q0U A;  1ENH A;  2TRT A;  3ON4 A;  1BW6 A;  2HXO A;  2N8G A;  2G3B A;  5EYR A;  1GV2 A;  3VW0 A;  1SAN A;  1FEX A;  3FRQ A;  1UHS A;  4M3G A;  3S15 J;  3F0C A;  1ORK A;  1X58 A;  4AYB N;  3DCF A;  2H1K A;  2KDZ A;  5F08 A;  4JL3 A;  4JNN A;  3BTI A;  1QPI A;  2LTP A;  4FTH A;  2LD5 A;  2XPV A;  5CXG A;  1RR7 A;  4QSH A;  5C44 J;  3BTJ A;  4MLO A;  5FMP A;  5FLM J;  4A93 J;  4QTR A;  3RH2 A;  1HF0 A;  3GTG J;  1JUP A;  3BR2 A;  1OCP A;  2M34 A;  3SDG A;  1I50 J;  3HBL A;  3GTQ J;  4S0H B;  3A03 A;  2JWT A;  5IYC J;  1I3Q J;  2Y9Z A;  4BBS J;  4NEL A;  5AQC A;  2QIB A;  2FD5 A;  2QKO A;  5M3M J;  5E3L A;  4C3J J;  2GFN A;  1A6I A;  1BL0 A;  5K7H A;  3LOC A;  5D19 A;  1CQT A;  3RZO J;  4GCL A;  3SJM A;  3BR0 A;  3P9T A;  2FJ1 A;  4AUX A;  1YRN A;  2ME0 A;  2LFB A;  3FIS A;  1Y1V J;  4MFE A;  1ZR2 A;  1IV6 A;  5HBU A;  1X2N A;  5GPA A;  5EZH A;  2R93 J;  2ZOZ A;  2Q24 A;  2R0Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...