3B6AA

Crystal structure of the streptomyces coelicolor tetr family protein actr in complex with actinorhodin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
218
structure length
213
Chain Sequence
MAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRQGREQAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActR protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 70
structure length 213
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3b6aA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b6aA02
5F1JA 2DA4A 2M8GX 4MXMA 5F0CA 1I3QJ 2P81A 5K7HA 1TWFJ 2ID3A 2REKA 2DMQA 3G56A 1GV5A 2XB5A 2Y9YA 3HOUJ 5HBUA 4W97A 3VP5A 2E1OA 1GV2A 2O9LA 2JA8J 2B63J 1AU7A 2UXHA 2G0EA 2NVYJ 1VF9A 4S0HB 2XPUA 5E3LA 4BBRJ 3ANGA 3PASA 1BA5A 1JT6A 3OIOA 1RPWA 5C4YA 2KDZA 4HKUA 2UXIA 1SGMA 5EDNA 3JRBA 3ZQCA 2QWTA 3AQTA 3ON2A 2RAEA 2IBDA 2D6YA 2RHAA 1AKHA 3M4OJ 3MN2A 2KT0A 1F43A 2DMTA 4DZPA 5DTDA 4FTHA 3BR3A 5EF6A 3ANPA 3GZIA 3VPRA 1WCMJ 3HGGA 5FKLA 3ZQHA 5HAWA 4M6VA 3VIBA 3CDLA 5DAJA 1Y1VJ 5FHPA 3BR0A 2E2IJ 3MVPA 2E19A 2VKVA 1UI6A 2GUHA 1SFOJ 5C4JJ 2RASA 3HBLA 3S2DJ 5EGOA 2DN0A 1HDPA 3BT9A 1OFCX 2CQQA 2GBYA 4AYBN 1XG1A 4IHYA 3TP0A 2GM4A 1EF4A 4XICA 3O8GA 4AC0A 2ME0A 4JP0A 5F08A 2EZKA 3IH4A 3ZOBA 1LFBA 2FX0A 1Z77A 3W6VA 1MBHA 3I4NJ 5J3LA 5F04A 2PBXA 1JJ8C 1ENHA 2DMPA 2XPVA 1ETQA 3SFIA 1FIAA 3DEWA 3H0GJ 2AHQA 2ME6A 1F36A 2R0QC 3OSGA 2I10A 1BW6A 3FKIJ 2LVSA 2DMNA 3C2BA 5FJ8J 3QQAA 4MK6A 2ZB9A 3WHCA 3HE0A 3S1RJ 3HOVJ 1DU6A 2H8RA 1VFCA 5IYDJ 1O4XA 4BXXJ 4QSHA 2W48A 3E7QA 1JKPC 1SANA 4CYCB 4C3IJ 4FE7A 1TWGJ 3HOZJ 2EZIA 2VKEA 2XGEA 3A03A 1OCPA 1P7IA 3LSPA 2LKXA 1E3OC 4QTRA 2DMUA 3BTCA 3BTLA 1Y1WJ 1WH5A 3RD3A 1FIPA 1MH3A 2HI3A 1QPIA 5FLVA 1MBEA 1CQTA 2TCTA 4GCLA 5F27A 2YVHA 2HOTA 2YU9J 2Q24A 3EUPA 1JKOC 4IEJA 5E3MA 2F07A 3H3VK 4JX5A 2NS7A 2G7GA 1I6HJ 1RKTA 3BHQA 5FLMJ 2E2HJ 1PUFB 3S15J 3HTIA 2IU5A 5IP7J 3BNIA 2Y30A 4DW6A 1GVDA 2WGBA 3VVYA 4A3IJ 4A3BJ 5C3EJ 3S1QJ 3DCFA 1K61A 4UDSA 2GLOA 2W53A 5D1RA 3LSGA 1X58A 4J19A 2QTQA 2ZOYA 2G3BA 3VVZA 2UXUA 3HM5A 5AQCA 1GDTA 2HXOA 4BBSJ 5C44J 2PZ9A 1FJLA 4ACIA 4C3HJ 4D5CA 1MBFA 4DYQA 3GTOJ 3G7RA 4FCYA 3KKDA 5EYRA 3CCYA 3RKQA 4BY7J 5K7FA 4XIDA 3S1MJ 3Q0UA 2XSDC 3VW0A 3A02A 3FIWA 2VI6A 3GTKJ 1U78A 2MG4A 5EG0A 1ETWA 1RETA 4MFEA 2EH3A 4JL3A 2QF7A 1S7EA 1VI0A 4CGRA 5HSZA 1MBKA 3KZ9A 3JRDA 4C3JJ 3S2HJ 5IP9J 1GUUA 4M3BA 4DZJA 1XS9A 3HOXJ 2R5ZA 3S17J 1B8IB 4A3CJ 2N8GA 1MSEC 3OSFA 2NVXJ 2DJNA 3NXCA 1BJZA 5M3MJ 4AF5A 1ETYA 3KNWA 2JMWA 4GFBA 1MSFC 2X6OA 2L7MP 1Z0XA 4I76A 4IHWA 1JKQC 2X48A 2ECBA 1IRZA 2HOSA 4XRMA 1OJLA 3ZQIA 3BR1A 4A3KJ 4FE4A 5BNGA 3BR2A 2R5YB 4UUSB 2MSYA 2XRLA 1JJ6C 2IEKA 2HKUA 2LY9A 3GTQJ 2O8KA 3GBGA 4GCTA 1OCTC 3BTJA 3LNQA 1IDZA 3T6NA 1X2NA 3TEDA 3NNRA 3BQYA 1NK3P 1LE8A 1JTXA 1IV6A 3HKZN 1ZTRA 3TW6A 4XRSA 3BG9A 4CYCA 2IAIA 1ZR4A 3COLA 1LFUP 1RKWA 5F0FA 3WHBA 2TRTA 5FMPA 2Y0SN 9ANTA 3Q0WA 1UI5A 1VNDA 5GPCA 1WH7A 2YS9A 1H89C 3BJBA 2L7ZA 3BQZA 3BRUA 3I4MJ 3A01B 2X9DA 3TW7A 2CU7A 4X6AJ 3K2AA 4PXIA 2WAQN 2ZCNA 1UMQA 2CUEA 1U9OA 1IC8A 2EBIA 3S14J 1MNMC 1IGNA 1A6IA 4JX6A 5M3FJ 4JX4A 4M3GA 1JUMA 2FD5A 2PMZN 3JRAA 4M3EA 2GFNA 4XRSG 3BG5A 1YRNB 5DS9A 3NI7A 5FKKA 5EGOB 3UKGA 3GTPJ 3FISA 5HODA 2DA2A 3GTGJ 3HOWJ 2O7TA 1T56A 3BTIA 4W1UA 3L1PA 5CXGA 1HOMA 5GPAA 4A3DJ 1K83J 1ETXA 1U8BA 1APLC 3IH3A 3QPLA 3GEUA 2XPWA 1JUPA 2MGQA 2LD5A 4JYKA 2M2EA 2YUSA 5JLXA 2QCOA 1IJWC 3VW2A 4EEFG 1H88C 1MH4A 1POGA 3KKCA 2NVTJ 1UG2A 3VOKA 4LOCA 3EGQA 1QVTA 2QOPA 1BW5A 3IH2A 1AHDP 1ZK8A 5IOYA 3NARA 1WI3A 1WPKA 2Y31A 3HB9A 3Q0VA 1W0TA 4IHVA 4IHXA 3VUQA 2AO9A 5D19A 1TWHJ 3QBMA 4UUTA 4JNNA 1HLVA 1JT0A 1IDYA 5K7ZA 2L7FP 1FEXA 3GTJJ 3ZQGA 1B8IA 1JUSA 1ZKGA 2DTZA 4Y7NJ 2DG7A 1P7JA 3S1NJ 2NX4A 1RESA 3V78A 3VW1A 3CQZJ 1DU0A 2JJ7A 4B4CA 1HCRA 2OERA 4ICHA 3HEFA 4A93J 1B72B 4V2FA 2CUFA 2DA3A 4ABZA 2LLKA 2E2JJ 2EQRA 3CWRA 2HQ5A 3TP3A 3HTHA 3GTLJ 3B81A 2R92J 4GFKA 1ZGWA 2VUMJ 2JK3A 2CRGA 2DA7A 3HTJA 4NDLA 3QPSA 2OF7A 5FKMA 5E3NA 1X2MA 1MBJA 1ETOA 2R5YA 3DPJA 2EZHA 4UUSA 2M9HA 3JSJA 2M34A 1TC3C 5J1UA 5E3OA 2H1KA 2NOGA 5IP6A 3ON4A 5K58A 3NAUA 2R7ZJ 2ELKA 5J1RA 3B6CA 3K7AJ 4NN1A 2CJJA 4I6ZA 4X1EA 5J1YA 3HOYJ 4QIWN 5H9TA 2WV1A 4ME9A 3LWJA 1ETKA 3Q3SA 5EZGA 2WB1N 2WUIA 2D5VA 5CXIA 3HIMA 2JWTA 3RH2A 2XDNA 3VVXA 2HXIA 3BR6A 3BCGA 1JGGA 1XC5A 1IUFA 3IUVA 1JKRC 4AC6A 3SDGA 3LSRA 2K9QA 3NRGA 2K40A 3CMYA 1TWCJ 3A01A 3E7LA 3M3YJ 3JRHA 5IPAA 2NVQJ 3S16J 3PPBA 1QRYA 3S5RA 1W0UA 3BR5A 5EEAA 1NK2P 5C4XJ 5EG0B 5M5YJ 2XGDA 3G1OA 3HTAA 1HDDC 2R93J 1T33A 4D5FA 2ZCXA 3V6GA 5EFYA 4JKZA 1NTCA 1Q1VA 3RQIA 2CQXA 3O8HA 3F0CA 3PO2J 3SJMA 2NP5A 1YRNA 4BY1J 2JA5J 3ZQLA 2LR8A 4G12A 1QVUA 3G1MA 4MO7A 3NPIA 4NELA 4MLOA 1AKHB 1JTYA 1ZQ3P 1U9NA 1WGXA 5JLWA 4B3AA 2R5ZB 2GENA 2HYTA 2L9RA 2V57A 2G7SA 5CW8A 2OI8A 4L5EA 3JRIA 2OPTA 4HNVA 4RDUA 4D7MA 1D5YA 4V2GA 5M5XJ 3FRQA 2XGCA 2QIBA 1TWAJ 3P9TA 2COBA 3PM1A 3IV5A 4RBOA 2JA7J 2VPRA 1IG7A 1PUFA 2K9NA 4A3EJ 4B1RA 4BKXA 4GFLA 3JRCA 1UHSA 2DA5A 3HGYA 2O7OA 2MW8A 2DA6A 3MKLA 3RZOJ 2YVEA 2ID6A 3JRGA 1G2HA 3RZDJ 2UXOA 3LHQA 4A69C 1BL0A 3JREA 2JN6A 3LSJA 2QKOA 3CRJA 3FK7A 4XK4A 4DYRA 3O60A 1ZR2A 5M5WJ 1LE8B 2HYJA 3QKXA 3ZQFA 2DA1A 4AUXA 1B72A 2K9SA 4M3FA 1A5JA 4KWAA 1ORKA 2HDDA 1I50J 5GP9A 1H8AC 3VOXA 5EZHA 5F0HA 2ZOZA 1HF0A 4A3GJ 1ETVA 2ECCA 2UXPA 5FKOA 1FTZA 2LK2A 3C07A 2LP0A 2LFBA 4MFDA 5IYBJ 5D18A 4GCKA 2JA6J 2FQ4A 3HDDA 4A3JJ 2FJ1A 3JR9A 3BG3A 5FKNA 2NS8A 2DG8A 3LOCA 2XB0X 2M0CA 1GT0C 3GTMJ 4D7NA 4C2MJ 5IYCJ 3JRFA 4Y52J 1MBGA 3F1BA 3CJDA 2NP3A 2LTPA 3B6AA 3LJLA 3G1LA 1FTTA 4M3DA 5FGLA 1RR7A 2EZLA 2Y2ZA 3FK6A 3MNLA 2L0KA 3OOUA 4A3MJ 5IOZA 4L62A 3PO3J 2G7LA 3AQSA 2ZCMA 2FBQA 2Y9ZA 1R9TJ 4DYCA 4FISA 4MIMA 3D1NI 4A3FJ 1ITYA 4A3LJ 4YZEA 2HOAA
chains in the Genus database with same CATH superfamily
5F1JA 1ZN2A 4MXMA 5F0CA 3ZMVA 5FRMA 3GUDA 1KU7A 2PMUA 4E7IA 4BQAA 1JI8A 3CCVI 5BS6A 2HVRA 3ESWB 2AQEA 1YW8A 1R4NB 4C2UA 3S8PA 2JVGA 2UXHA 3DKYA 5FROA 2VB6A 4BBRJ 4UV9A 2ACJA 2PLYA 1W5SA 2EIJH 1RPWA 2D1VA 1U3EM 3ON2A 2RAEA 3WTWC 3WTXC 2RHAA 4X0GA 2LKSA 1KU9A 4HSTA 4L9JA 2KT0A 1ZH5A 5GAHJ 4LIUA 5DTDA 1XMXA 4XN3A 2RQQA 2K9LA 2P6SA 1UFMA 3VPRA 5E18F 4PGHA 1R7JA 2QSFX 1KONA 5L3EA 3F8NA 3L2UA 4M74A 5DAJA 2JSCA 3NQOA 3LAPA 3BR0A 4I02A 5E1XA 2EK5A 2GUHA 1RRJA 3MAJA 3IUOA 5C4JJ 1X4OA 4S04A 5BQTA 4IHTA 3HBLA 3B02A 1XSVA 5HVQC 2VASA 1ZGJA 2DDBA 2CQQA 5EJCA 1BOBA 4R8HA 3VTIA 2QYOA 4CUGA 2B0LA 3CF5F 1HSJA 3HSEA 2O03A 3C2GA 3TP0A 2GM4A 4XICA 3O8GA 2BY3A 2ZMEC 4JP0A 3GCMA 2RNJA 5TRDA 3KP5A 4A5NA 1LFBA 2W4SA 4L18B 1X1CA 1BI1A 1FT9A 5J3LA 4G6QA 3J80K 2PBXA 2CSOA 2L54A 1JJ8C 1ENHA 2V26A 2GOXB 2LREA 1VQ4I 4OIRF 3K4JA 3KE2A 2E7WA 4B3XA 2KHMA 3DEWA 1P4XA 2CFOA 1F36A 3GYHX 3VDXA 2L9SA 1IV8A 1BW6A 3H9QA 2DMNA 2V9VA 5FJ8J 2X1DA 2VXZA 2ZB9A 1F1ZA 3HE0A 3CCQI 3HOVJ 1DU6A 1QHGA 2V4JC 4XLPF 5KNLA 1VFCA 1MMDA 2DT6A 1O4XA 4BXXJ 3HHGA 3P5JA 4QSHA 4RAGA 2A6EF 4OMZA 1JKPC 4CYCB 1T0FA 1W5TA 1IN4A 4FE7A 2DFEA 1OCPA 1P7IA 5EEGA 2E36A 3TOBA 2DMUA 4XLCA 3SEZA 4E7SA 3O3KA 3CO6C 2KIFA 4HZFA 3VYSB 4E7ZA 1WH5A 1Y1WJ 1FIPA 2HI3A 2O8XA 3P9IA 5FLVA 3FXLA 3LSKA 4UVBA 1K4SA 1CQTA 2X51A 2TDXA 3F8FA 3QU6A 4RA2A 3ZN0A 1YE9A 2X1CA 4KIGA 4C2TA 2YVHA 3DXJF 3RQ4A 3CC2I 3DBRB 3HSFA 3L2CA 3ZN1A 2OCEA 4TV7A 4ANJA 4E7KA 2FQ3A 2G9WA 5FLMJ 3S15J 5ICEA 5IP7J 3BNIA 1YJNI 1O3RA 1GVDA 1OCOH 3E1SA 4HV5A 3RYRA 4GCVA 1Y0UA 5KAFC 3G71I 1WSUA 2YVXA 1G59A 1G8XA 2KRCA 2G3BA 5AQCA 3OR1C 2CUZA 3SYTA 1FJLA 2BVLA 2HQNA 2HQRA 3V42A 4C3HJ 5LGTA 4D5CA 1NH3A 3RYPA 3ZGKA 4A2UA 1A6QA 4XQFA 3RKQA 4GXOA 1LNWA 3GMEA 3A02A 2FOKA 4M72A 4CZCA 1K78B 1RETA 4KN4X 5LLQA 2EA2A 2E34A 4JL3A 2MA3A 1X1AA 4NQWB 2EV5A 5D5VB 1VI0A 5HSZA 3NRVA 4DNCA 2ZO4A 2P5LC 3E0JB 3FZVA 2ESNA 4MEXF 3HOXJ 3V8KA 3OIPA 1B8IB 2GXBA 3VEPA 4D0PA 3HRMA 4DIQA 4II3A 4MNUA 4FT8A 1IUYA 2K7LA 4WCGA 3OMYA 3PQKA 2XV4S 2QQ9A 3JW4A 3PNYA 4N4NB 4IL6C 1Z0XA 2BY0A 3BJOA 4UNOA 2ECBA 2L01A 1OJLA 2ZJRF 4KIBA 3ZQIA 4FE4A 3L9FA 2JTVA 2R5YB 3OYDA 3K4KA 1WJAA 3VYUB 2VIXA 2XRLA 2IEKA 2K3PA 3DKWA 3BCAA 3R60A 4CH7A 1MDMA 2LY9A 4V19K 2ZXHA 1CF7B 3ISPA 4J01A 2VT2A 1D1BA 2WV0A 5GTIC 1QO0D 1Z05A 3T6NA 2YPRA 4ZZLA 4OU0A 4L0YB 4RAFA 1LE8A 1HW1A 3CUQB 1Z6RA 3HKZN 4XRSA 3COLA 4WF2A 4EJUA 4QPOA 1LFUP 1W4MA 3IC7A 3WE2A 5FMPA 3GFLA 1USSA 3F21A 3OYEA 2OC6A 4HLYA 2YS9A 1OR7C 3MEXA 4HF0A 3BQZA 4JBAA 3MFKA 3A01B 3K2AA 2M1BA 2CUEA 3ML6A 3K4MA 1LEAA 3F23A 1A6IA 1MMSA 4HBLA 4M3GA 4ON0A 5HS8A 1JUMA 3BZ6A 3GLLA 1VQ5I 2CQNA 4CGZA 2PMZN 2CYYA 3F6OA 2LY1A 4KITB 5FB2A 3BG5A 5DS9A 3PFYA 2XAQA 5DCFA 2XAUA 1SVOA 3IWZA 3FMSA 4FETA 4BHCA 4UXNA 3PSFA 4XSZF 3SXYA 2V9PA 2HYGD 2ZFUA 2OZ6A 2FF4A 5J8CA 2GAUA 4F52A 2FJI1 3K69A 1Z91A 5J47A 3TO9A 3FMQA 1APLC 3QPLA 2YUSA 1IJWC 4I01A 4EEFG 3FXQA 2NOJB 4IO9F 1UG2A 4LOCA 4EJOA 2VQHA 3K4NA 3JTHA 5K1YA 2BZTA 2WAEA 1DPUA 5E1ZB 3VB2A 1W0TA 4IQJA 2AO9A 3DPLC 2EV0A 3QBMA 1JT0A 1IDYA 5DCMB 4LMYA 4DOZA 2P5VA 1LQ1A 1ON1A 2L7FP 1IN8A 3QWLA 1ZG3A 4ZYHA 2QKLB 1FEXA 3ZQGA 2NX4A 1JUSA 1ZKGA 3MZ8A 3VW1A 3PNTA 2F5DA 2KISA 4ZTJA 1HCRA 3HEFA 5HLIA 1U5TA 4A93J 1YOVB 2CUFA 2ADUA 4ABZA 4E70A 3HPGA 3VYTB 1D8JA 3EETA 2XAGA 2L4MA 1X3WB 2B7EA 1NG7A 2ZSIB 1T2KA 2R92J 1Z67A 1BBYA 2DA7A 3ASNH 2ICWG 3H92A 1O3QA 1N75A 4DGWB 3TOAA 2EA4A 2OF7A 5E3NA 1X2MA 1OYYA 3V7RA 1WQ2A 4GYIA 1ETOA 1ZRDA 1TQIA 3GXOA 3TL4X 3MZYA 2DLLA 5K5RA 4UUSA 3R61A 1KGSA 1OYIA 2J5PA 1LDKB 2P5KA 4QWQA 3CJNA 3G6EI 4A0ZA 3J7YJ 3NAUA 1HA8A 1YTYA 3GZ6A 2CJJA 2ISZA 3LFUA 1KQ8A 2M7BA 4QIWN 4ME9A 1BIBA 3IP4B 1YX5A 1YITI 3LWJA 3C1DA 2YR2A 2XRNA 4WXDA 2X6XA 5IT9K 4A3LJ 3DBHB 1MNEA 3KLOA 3QPTA 1R1TA 3RH2A 3VVXA 3LA2A 4GYGA 4L5JA 1QA6A 3FWEA 3DU6A 3GFJA 3IUVA 1JKRC 2MH9A 1CGPA 1ZREA 3SDGA 3G3ZA 3NRGA 2K40A 3OR2C 4BEHA 2NVQJ 5IPAA 1TNTA 5DYMA 2EINH 1QRYA 1FWZA 1XGSA 3N97A 2JPBA 1NK2P 3W6KB 3BDDA 2IS2A 2FUG2 5M5YJ 2PX9A 3LQQA 1I3AA 1MKMA 2R93J 2ZCXA 3R0AA 5EFYA 3ZPLA 3V6GA 3T1BA 2CQXA 2QZ8A 5TISC 1DGWY 4BY1J 2BVMA 4G12A 2XAJA 2QSGX 3NPIA 1XX5A 2IGMA 2R7RA 5ILSA 2NXNB 2ZNYA 4BS9A 1AKHB 2V1XA 2MABA 4P5OA 5CQGA 1U9NA 2VOPA 2GENA 1V54H 3WTUC 2RN7A 4OD4A 3S3NA 2G7SA 5CW8A 2A61A 5D8LB 4Q48A 1ONVA 1D0ZA 4RM2A 1D5YA 4WWCA 4EV0A 1VQ9I 3P9TA 1GXPA 3IV5A 1ZRCA 4RBOA 1K79A 1FX7A 1IG7A 4A3EJ 3PUFA 4GFLA 3JRCA 3HGYA 3IRQA 1FMVA 2O7OA 3MKLA 3BLYA 5B66C 2VBWA 2K86A 2HTJA 1G2HA 3RZDJ 2UXOA 4CYDA 3LHQA 1TZLA 2BXYA 2ZJ2A 3ABLH 4PJNA 2JN6A 3LSJA 3H5AA 1BM9A 2ETHA 2RDPA 3FK7A 4ZDOA 3I59A 2DOAA 3O60A 2VE8A 3OYLA 1MNDA 2X85A 3CJRB 1NG6A 1IZ1A 5J4YA 2IA1A 4XONA 2DA1A 4AUXA 4OOIA 3CCMI 2K9SA 1TQPA 1T8IA 2HDDA 3DU5A 2LMDA 5F0HA 1LEBA 2M87A 4CSWA 3C07A 5FKOA 1FTZA 4CICA 1ODDA 1SEUA 1DDNA 2LFBA 4MFDA 1U8RA 4BQNA 2L5QA 2XHKA 2JQ7A 5HLGA 4ZZDA 3GF2A 2PI0A 3HDDA 2MD5A 2Q2EA 4BAYA 1J9IA 4NC6A 1R1UA 2NS8A 4A6EA 5IYCJ 1U0JA 1BJAA 4B47A 2OU2A 2NP3A 2LTPA 4LLGF 3B6AA 1K4TA 3J81Z 2A6TA 3G1LA 3P9CA 4NC8A 2DBBA 3IWFA 3FK6A 5IOZA 1TTYA 4XLHA 1QNTA 2Y9ZA 2DU9A 4IX7A 4ENNA 2M8EA 3GWZA 1U6GA 1GHCA 4YZEA 3OYJA 2H1LA 2X0LA 2AS5F 1JHFA 2A69F 2IS6A 2Z3YA 1TWFJ 3AG1H 2ID3A 4PSWA 5L3FA 2ZXJA 2FMLA 5LGUA 2Y9YA 1V5EA 2VBZA 1T0FC 3P7NA 4EM0B 1GV2A 3CLQA 2E71A 1PJRA 4L9NA 2DFIA 2NVYJ 2XPUA 4WX9A 3PASA 2F2EA 2V6EA 4PGGA 5GAGJ 2XAHA 1B9MA 5C4YA 1VQKI 1SGMA 2QWTA 1AOYA 5F64A 3VOEA 2IBDA 2A6HF 2IJLA 3EUHC 2R7SA 2HU9A 3W2AA 3MN2A 1P4AA 3KZZA 4FTHA 3RKYA 2HR3A 1D1AA 5JVGF 3GZIA 4F7ZA 2YU3A 5FKLA 3E5XA 5HAWA 1XGOA 2MD0A 4MEYF 4N0BA 3ZCOA 4EQQA 1UI6A 4IPAA 2RASA 1EH6A 3FXOA 1B6AA 3OS1A 4NB5A 2XGXA 4YIIA 4RAZA 2DN0A 2L7KA 2Z9OA 4GDFA 1HDPA 3KZYA 3CO7C 3EYIA 2LC2A 2GBYA 3ERMA 1L3LA 4AYBN 3D5RC 4IHYA 1QZEA 3RPUA 5ICFA 4AC0A 4AWXB 3HOSA 1FYLA 3OL4A 5FFZA 4PJJA 1MBHA 1RUOA 3I4NJ 5F04A 2Q0OA 1ZELA 3DF8A 3LA3A 2V1UA 2IVMA 1I1SA 2XPVA 4YIRX 1YFHA 3S2WA 3PSIA 3SFIA 3H0GJ 3I53A 3OSGA 3OL3A 2KRFA 3GZ5A 2I10A 2Q8KA 3SZGA 3JSPA 1GVJA 2PN6A 3FHZA 1Z9CA 2LVSA 3C2BA 3HRTA 2WY7Q 3HG9A 3I71A 4HV6A 4BQQA 5CPRB 1XSDA 2F4MB 4RAYA 2HWVA 4RB1A 3CC4I 1YQAA 1IN5A 2Y69H 1DQUA 1WWXA 2W48A 3U1DA 3ZMTA 5BPDA 3E7QA 3Q9SA 1SANA 3LMMA 4KMFA 2ISYA 4HEA2 2EZIA 2VKEA 1QGPA 1R6RA 1C0WA 4QTRA 3K70C 3V8JA 2DFFA 1MZBA 2IP2A 1KYZA 2HDCA 3AL0B 1MH3A 1QPIA 2VL8A 1MBEA 2TCTA 4GCLA 1LDDA 4M9SA 2UXXA 2KJCA 1FYKA 1MJAA 3CF2A 2YU9J 2CGPA 3CD6I 4IEJA 2E1NA 1SC7A 3H3VK 3PL8A 2NS7A 2G7GA 4N9IA 4EJWA 3WG7H 3HTIA 3KP7A 2Y30A 4A3IJ 4A3BJ 3ZMSA 5HNFA 3S1QJ 3DCFA 1PYVA 3N05A 2Q1ZB 4E6KG 3SZPA 4IF4A 2W53A 5D1RA 3OYHA 3J7AY 4J19A 2NYXA 1AA7A 2CWEA 2UXUA 1EV7A 5BPIA 4FX0A 2C6YA 2RREA 3SEQA 1ERDA 3UR3C 1X1PA 1MBFA 4LFUA 3KKDA 3VYRB 3LQRA 2FOWA 3S1MJ 2AXLA 4DBRA 4ZYDA 3A0BC 1FBSA 1U78A 2MG4A 5EG0A 2H27A 1ETWA 2I8DA 1G4DA 3SDBA 1TW2A 1TL8A 2QF7A 2Z99A 3AKZA 3I54A 3CDHA 1S7EA 1XSXA 2KIUA 4CGRA 3JRDA 3T5XA 2IXSA 5D6EA 3V8LA 1GUUA 1LPQA 1XS9A 3I0TA 2XKPA 5ILUA 4A3CJ 2E1MC 1IW7F 1VTNC 3F6VA 4BHPA 4BYYA 3OY9A 4LJZF 1MJ9A 4BGDA 1R5GA 4G7OF 2R4GA 3RDIA 1MSFC 4GFBA 3K0LA 3C2HA 4I76A 3QRFF 2KRHA 3H0DA 3LL7A 3M1EA 2ZXWH 4D9JA 5ICCA 4U0YA 1O3SA 1FZPB 4A3KJ 3U21A 4EJVA 4O6JA 5JR3A 3ZQQA 3ZMUA 3GTQJ 2O8KA 4GCTA 1U5TC 2QVOA 3BTJA 2NS0A 2KKOA 3E97A 5L3DA 2BOLA 1IDZA 1MIJA 2ZC2A 1R00A 1X2NA 3AAFA 3TEDA 3BQYA 1KA8A 4AIKA 1R5ID 3BG9A 4CYCA 2IAIA 3NS4A 1RKWA 3GEZA 4RLFA 3WHBA 2TRTA 4ETSA 3PQJA 1J7KA 3HOTA 4PZJA 3Q0WA 5DM6F 1UI5A 2EFPA 5GPCA 3F3XA 1WH7A 2Y48A 4A0XA 2Y0SA 4XMYA 1OMIA 2L7ZA 5H20A 2UWMA 1MMGA 2PBIA 4L0ZB 4F93B 4LITA 4DQ2A 3TW7A 1TP4A 2CU7A 4CZZA 3DP7A 3TDZC 2DXIA 4X6AJ 4N9HA 4XKBA 1HKQA 2E5ZA 4HLXA 2W24A 4L9TA 2EBIA 2IGOA 3WTVC 1MNMC 2KLOA 5DEQA 3S14J 4JX4A 1UELB 1J5YA 5JHUA 3OYCA 2WAQA 2FD5A 2GFNA 3L00A 2STTA 4G6DA 2EFNA 3HL2A 4XRSG 1YRNB 3WTSC 3S3MA 3HOWJ 1T56A 1UZCA 2HVQA 4YELA 3LSIA 2FBIA 1IXSB 2R7XA 3ECOA 3CLOA 3KYDB 3I56I 1K83J 1O57A 4YRVA 1UHMA 1XD7A 3EUHA 1JHHA 1MJBA 4IXAA 5LRRA 3JAMZ 3VW2A 3T8RA 1H88C 1MH4A 4OAYA 2K85A 3M8JA 1K78A 4I0AA 2QOPA 5DDGA 1AHDP 1ZK8A 2W57A 3NARA 2BHYA 2FEZA 1WI3A 1WPKA 2Y31A 3JCUC 2PG4A 4NQWA 1VQ7I 3VUQA 3HHHA 3U1KA 1Z7LA 5D19A 4UUTA 1FP1D 2BHZA 1X1BA 4JNNA 2QUFA 2BV6A 4OWRB 1DUXC 1E2XA 2NNYA 2BY2A 3I4PA 4WXHA 1B8IA 2DG7A 1YS6A 1P7JA 1V4RA 1DU0A 4B4CA 4M6XA 4ZDLA 2ESHA 3VSKA 1EJ9A 2E2JJ 2HQ5A 2LF8A 3LWFA 1OCCH 3W6JB 2XDVA 3TP3A 1D0YA 2W7NA 2JK3A 1F5TA 3CP8A 2ELHA 3ZXSA 4NDLA 3QPSA 3VWBA 1WHUA 1TNSA 1MBJA 2CMPA 5L3CA 4HSRA 2R5YA 5J4VA 2EZHA 4AIHA 1O7LA 2NOGA 4ITVA 5IP6A 1CF7A 2CW0F 2RV8A 5J40A 3HC7A 5K58A 4HPQA 3FF5A 1XMAA 2JVHA 3BP8A 5J1YA 4CCLA 3CZ6A 5H9TA 2WV1A 4BH9A 1SFXA 3CUQA 2L9NA 4OIPF 2D5VA 5H2FC 5FLXK 5CXIA 2GZWA 4Y15A 2V1DA 2JUGA 1HKTA 3BR6A 1JGGA 1SFEA 1IUFA 3DKXA 1HSTA 3N4MA 4IRVA 4AC6A 2GQQA 2DDAA 3ZMDA 3KCCA 1T08B 1TWCJ 3A01A 3HYIA 1MGTA 3R4KA 3JRHA 4IQ4A 1IRFA 2EWNA 2F4OB 1FSEA 2HZTA 2YX7A 3BR5A 3LSTA 1EA3A 5EEAA 5C4XJ 2XGDA 3G1OA 3HTAA 3OOPA 2CS3A 3MKYB 4OINF 3WGGA 1Q1VA 1DPRA 2NP5A 1HXDA 4KT5C 4GRIA 3ZQLA 4BQOA 2WWYA 3G1MA 1G6NA 3OS2A 2L02A 3H5RA 4OD5A 3F72A 4UVCA 3RJPA 2V57A 1DP7P 2OI8A 1W7PD 2HPMA 3B73A 4PFOA 5DD8A 5TJJA 3QYBA 3C18A 2VKDA 4D7MA 3DTEA 4YFNF 3J80Z 4V2GA 2PQ8A 3D5LA 1S8NA 2DTRA 2QSHX 2F5FA 1PUFA 2OJED 3IHUA 2CW8A 1VQMI 3BPVA 6PAXA 2R7VA 1R22A 2VBYA 4P9UA 4O3MA 3RZOJ 2DA6A 5DCMA 1MDMB 2ID6A 3EYYA 3VFZA 3HUGB 3JRGA 3LA7A 1A36A 3K9TA 1BL0A 3CUOA 1YG2A 3JREA 3BG7A 3JSOA 3E5UA 5CYVA 5HS9A 1ZR2A 3FXUA 5M5WJ 1LE8B 4I7HA 2KQRA 2HYJA 2JT1A 2QKMB 3SQNA 1YIOA 2IA2A 2DK5A 5GP9A 2EFOA 3TGNA 5J8FA 1HF0A 5K5QA 4HAMA 2ECCA 3EDPA 3QOEA 4ESJA 2F5VA 3CP2A 3PIOF 4BHBA 3E6BA 3BC8A 5D18A 2Y0MA 2JA6J 5J6XA 3M8EA 2VJIA 3FM5A 1YHQI 3IL2A 1X3ZB 4D1QA 3I64A 1RI7A 5FKNA 3MKZA 1ZLKA 2DG8A 3LOCA 2XB0X 4D7NA 3CCSI 2BEOA 2H94A 2MFZA 4KT6A 1T6SA 3F1BA 3ZR8X 3CJDA 4JOMA 5JI6A 3LJLA 3OIQA 3FXRA 1N78A 2OAZA 3DTIA 5HDGA 3ABTA 5FGLA 1KQ9A 1RR7A 2WBMA 3CDIA 1LFPA 2Y2ZA 3NWSA 2WAFA 2L0KA 3OOUA 4M6YA 4CHUA 5D4SA 2M7AA 4XOTA 1WJEA 3CMEI 3PO3J 4MGRA 2ZCMA 3AQSA 2FBQA 4L62A 3V4GA 1R36A 4MIMA 1N25A 2OD5A 4B44A 5LD2C 4HW0A 1Y8RB 4F92B 4Z2YA 2VQCA 5GADJ 2P81A 4QPQA 2JRMA 1J09A 5JFRA 2REKA 2DMQA 3G56A 5D5XB 1G3YA 1BIAA 5HBUA 1QQIA 4W97A 1ON2A 3VP5A 2EB7A 5TGTA 4UV8A 3A2KA 1AU7A 2G0EA 2DCEA 4LG3A 2IGNA 1RNLA 1HW5A 2GWRA 2PMHA 1PP7U 1N77A 1BA5A 3C7JA 1XMKA 1JT6A 2LH9A 4A12A 1YS7A 1HW2A 3OYGA 2M30A 2UXIA 1VQ8I 2CQKA 3JRBA 1BI3A 2WB1A 4U0WA 2A05A 2KDOA 2D6YA 2VT3A 1AKHA 1XCBA 4FHTA 1YJWI 1F43A 4DZPA 3BR3A 5EF6A 2NNNA 3EUKL 2GIVA 1MW7A 1WCMJ 2E5NA 3HGGA 2HYFA 2GXAA 4RS8A 4OIOF 2ZY9A 4KMUX 2DAOA 5F1RA 3VIBA 2ZMEB 3CDLA 5FHPA 3MVPA 2E19A 1IN7A 2VOOA 3SHFA 1XGNA 1S3JA 2BW3B 1T39A 5B1AH 1K7AA 3AG4H 3TO7A 4YIFA 5EGOA 3T8TA 4F55A 2VE9A 4C2MA 1OFCX 2XVCA 2OUMA 4RLQA 5AIPA 2AQFA 2A3SA 1XG1A 1KU3A 4B09A 4LG0B 2VN2A 2ME0A 3DEEA 5F08A 3J7ZI 2NAZA 2ZCWA 3ECHA 3TDUC 2FX0A 1Z77A 3RIRA 4EM2A 3W6VA 3LFKA 2GA1A 2VXDA 4P1WA 3PNVA 5L3GA 4BACA 2H8WA 2R7DA 2QBYA 1BI2A 1ETQA 2MYSA 1UB9A 4EVIA 3GX4X 1FIAA 3K1MA 1X1DA 4KN7X 5LEJA 2JUCA 2M4GA 1QZYA 3ELKA 4IHSA 4XKVA 3QQAA 1BR2A 2WADA 4XR6A 3S1RJ 3EUAA 1FPQA 2KZVA 1E0EA 3H5NA 4ENMA 3WODF 5BMZA 3KP6A 4KA4A 1TWGJ 2K4BA 2XGEA 3HOZJ 3KIOA 3TO6A 2LBFB 3CJQB 3LSPA 2LKXA 3RCOA 4HNUA 5LHHA 2CUJA 3ROUA 3BTLA 2DJIA 2LDUA 1WI9A 4UY8I 4AM3A 2LOOA 3L2RA 2DO7A 2HOTA 4IVNA 2Q24A 3EUPA 2DYRH 5D6FA 1D3YA 1JKOC 3KEOA 5E3MA 2F07A 1TW3A 4BUPA 2BXZA 2XF7A 3R0JA 1RKTA 4MQVA 1Z3YA 4CO8A 2JZYA 5B5EC 3MMYB 1ZAOA 3VVYA 2VC0A 4Q47A 4BE2A 4UDSA 1QHHD 3WU1B 3A4CA 5KAIC 4YG2F 1X58A 2QTQA 4XSXF 3OYAA 3RPQA 2HXOA 4BBSJ 3MKWB 2PZ9A 3KYCB 1I27A 3OYKA 5LEKA 1E3PA 3GTOJ 4R1HA 2KFDA 3G7RA 4HA8A 2DPDA 3CCYA 4BY7J 3MQ0A 2IPQX 2VQLA 3BWGA 3Q0UA 2DI3A 1VQ6I 3GTKJ 1S6LA 4LK1F 5E8IA 4BE0A 3FM3A 3DTKA 2EH3A 3K4BA 4BU2A 3I5UA 2HKOA 4ZYGA 1TBXA 4HF2A 1MBKA 3D5SC 2MBFA 5A2QZ 4GO1A 4C3JJ 3EQLF 3S2HJ 2CQ7A 3KZ9A 2QGUA 5IP9J 2Q2EB 1YYVA 2ZFWA 1M1EB 5HDKA 1BR1A 4U88A 3WU2C 4U9LA 3I3LA 3GLXA 2R5ZA 3S17J 2MH2A 1MSEC 2EFQA 1WJCA 3WGIA 2DJNA 3OSFA 2NVXJ 3NXCA 1Y39A 1PVEA 1R58A 3H3ZA 4AF5A 1ETYA 2XASA 5IT9Z 1W7PB 4IKFA 1IXRC 2EIKH 3GO5A 2X6OA 4AVPA 2L7MP 5D8KB 4IHWA 2X48A 2M5WA 5KK1A 4XRMA 1EH8A 1OKRA 1XB4A 1A04A 2HOEA 3BR1A 5CKTA 5BNGA 2V1NA 5H6QA 2BY1A 4L5IA 3L7WA 2P4WA 4Q4ZF 1Z21A 1OCTC 3LNQA 3DLAA 5HNHA 1LVKA 2VKHA 3TQNA 4KYWA 1NK3P 5CVVA 1JTXA 1IV6A 2PJRA 1YI2I 1X3UA 1ZR4A 5IT3A 4IRHA 5F0FA 1SMYF 1Z6TA 2O6GE 4BJ6C 3DFGA 2VC1A 4P9FA 4PJMA 1QBJA 9ANTA 2DT7B 2M0MA 1W36C 2HPIA 3MD2A 4HQEA 2K4JA 3W2VA 3CESA 3BPXA 4JQFA 1H89C 3BJBA 2ZKZA 4LD5A 2FE3A 3ZMZA 3I4MJ 3V7CA 2HQAA 4XLNF 2FBKA 3H1CA 3UNGC 3G4SI 3CUQC 1Y0NA 5LRSA 1UMQA 1FOKA 1U9OA 1BOAA 1IGNA 5M3FJ 1UCRA 2P0WA 2A2FX 5DD4A 3I58A 3M9AA 4M3EA 4RGXA 3W3CA 5FRNA 5FKKA 1AWCA 3GTPJ 2O7TA 2DA2A 3DPUA 4E7HA 4W1UA 3SFZA 1JXSA 1B1BA 3OYNA 5CXGA 1T98A 4S05A 4A3DJ 3I9V2 2JSPA 4HG2A 5DV5A 1LUJB 1U8BA 2RGVA 2XPWA 1SVMA 4PCQA 1JUPA 2DT5A 1RUNA 4UB8C 2VPLA 4JYKA 3PJRA 4DVYP 2QCOA 1RR8C 3HJEA 2LNBA 3KP4A 3DQVC 1POGA 1BC8C 2JPCA 3VOKA 5E1WA 3HTUA 3H36A 3EGQA 5GAEJ 2OZUA 1BW5A 3IH2A 3K70D 2RNGA 1NHAA 2M45A 1JE8A 3Q0VA 1I39A 2JA2A 5CVUA 2B9SA 3K6GA 1HBXG 4CDGA 3ABMH 2IGKA 2V79A 1HLVA 1KQ0A 1W5CC 2FRHA 3IAS2 5K7ZA 1FOXA 5D4RA 1G3SA 1OQYA 1TQMA 3GTJJ 2FSWA 4M9ZA 3L09A 3K4LA 2VONA 3V78A 5JVTA 2EFWA 2X6YA 2HTSA 1RESA 2JJ7A 5ILVA 1V3FA 4LLLA 2CG4A 3KZIC 1B72B 4V2FA 3TMOA 4XKWA 3OYFA 2DA3A 3GW2A 4FX4A 1XGMA 3QOPA 4M71A 4F3QA 3HTHA 3FDYA 4Z6YA 3H9GA 4O5VA 4PJLA 3GTLJ 3TKYA 1ZARA 2CRGA 3I55I 3HTJA 3ERED 3S93A 1GLNA 4IJAA 1W1WE 2WY8Q 1KYWA 5AIQA 3DPJA 5E20A 1T95A 3K1PA 4MHGA 1IO2A 1TC3C 2H1KA 5E3OA 2X4HA 1FC3A 4L9VA 3S3OA 1ZG5A 2R7ZJ 2ELKA 3K7AJ 4NN1A 3FBNB 1WKMA 2MC3A 4ESBA 3HOYJ 3RSNA 1PUEE 2EV6A 4CXFA 1ETKA 3Q3SA 2WB1N 3S32A 2FNPA 2WUIA 2M4KA 3WTZA 4ENKA 2XAFA 1BR4A 5BOXA 2HXIA 1V5FA 2LF7A 1WJFA 2L9VA 1SFUA 4IOAF 2K9QA 2GXGA 3CMYA 4G94A 3DV8A 1D0XA 2LRDA 3S16J 3CCLI 3F9KA 1J2XA 2K02A 3A0HC 2P7CB 3S5RA 5JHFA 2YSRA 1I5ZA 5IY5H 2O5RA 5EG0B 3BZCA 4BJ5C 5EEHA 1T33A 4U9NA 3O6BB 3FXJA 4XLEA 2E1CA 1NTCA 2LKPA 1VQPI 3O8HA 3F0CA 2A5YB 4BJTA 3SJMA 1YRNA 2LR8A 2KMUA 3PFIA 3CCEI 1QVUA 3CCRI 4G9YA 3O2PE 4MO7A 4NELA 4MLOA 3ONQA 2UUZA 1ZQ3P 5JLWA 2FXAA 2HEOA 2HYTA 4E4HA 2HS5A 2A68F 2OTJI 1ULYA 1FLIA 1UJ8A 3JRIA 2HDWA 2OPTA 2IW5A 3Q9VA 2XKOA 3IAM2 3JTGA 4NC7A 3FRQA 2QIBA 1TWAJ 4YEJA 3PM1A 1RIOH 4I2OA 2VPRA 1PP8F 1S7OA 2K9NA 3RKWA 3ZRGA 4B43A 4BKXA 1XDSA 1UHSA 3GZNB 4YFXF 4OIQF 4II2A 4HNTA 1WJBA 4H0EA 1S7AA 4UB6C 2FBHA 1Y56A 4M73A 5CVRA 1BN5A 4XK4A 1WFXA 1OPCA 4LK0F 4XL9A 2XC7A 3ABKH 1FY7A 3COAC 4LB6B 3QAHA 3K1NA 3PUBA 3ZQFA 1LB2A 3QPHA 4KISA 4M3FA 4G7HF 1ORKA 2VJJA 2Z1DA 1H8AC 2V7FA 3CJTB 3KP3A 3VOXA 3FXKA 1O7FA 1STZA 2EPFA 4A3GJ 3BOQA 1ETVA 2ZBKA 5HLTA 1OYWA 2DQLA 3KETA 4GCKA 2FQ4A 3A1YA 3HTSB 2ZSHB 1FNNA 4LIVA 4A3JJ 2FJ1A 3JR9A 2FA5A 3BG3A 2O61A 1ZHFA 5FGMA 2M0CA 3GTMJ 4GGGA 1IRGA 3WG9A 1FOWA 1MBGA 3K2ZA 2NVUB 2CV1A 4HX8A 3MZHA 1TT0A 5B1BH 2O3FA 5E17F 1FMWA 2HZDA 4EM1A 2CH0A 4EGZA 3KEQA 5ICGA 3MNLA 2BGCA 2LYCA 3F8MA 2G7LA 2DYSH 2IS4A 4I99C 2VLAA 3NWTA 1R5HA 4FISA 4A3FJ 3D1NI 5HDNA 4EGYA 5CLSA 2R7QA 2ZJPF 2MC4A 4RGRA 2DA4A 2M8GX 4MTDA 1FYMA 1I3QJ 2LSOA 2HNHA 4BL0B 2DPUA 2CW7A 1I1GA 1MMAA 4HX7A 3WGHA 5K7HA 2OV7A 4NHJA 4XOPA 1GV5A 2XB5A 3HOUJ 4XN0A 2Z33A 2E1OA 2O9LA 2JA8J 2RQPA 1BC7C 2QM3A 2B63J 1YW7A 4AD9A 3HRUA 1VF9A 4S0HB 3DWLE 5E3LA 5E79C 3ANGA 4BXFA 2KP6A 4NUBA 3RTRA 3T0YA 3OIOA 1R49A 1E17A 2KDZA 1SAXA 4HKUA 3AQTA 5EDNA 4A0YA 3ZQCA 2R7FA 2QA4I 3KP2A 3DPTA 3M4OJ 2DMTA 2H6BA 2R7OA 3F8CA 4XLFA 5CQEA 1YW9A 3ANPA 4G8XA 4KNYA 4WXCA 2NRAC 1IN6A 2A5WA 2W1OA 1A35A 1SFKA 3K4CA 3ZQHA 1MD0A 4M6VA 3IKVA 3OV8A 2O0YA 1Y1VJ 4ESFA 1JJ6C 3MCZA 5CVJA 2E2IJ 2HFHA 3KFWX 3WU0A 2VKVA 4K2EA 4BDYA 2VJ4A 2XIGA 1SFOJ 4Y3OA 1FBQA 3M1CA 4BDZA 3S2DJ 2R7WA 3G2BA 5FFXA 1S72I 1J59A 3BT9A 3ULQB 1B9NA 1FSHA 5HOOA 3HUGA 4LB5A 3KLNA 3HIFA 1EF4A 3FXMA 3FKJA 4MQ9F 5ED4A 4HQMA 1K6OA 3FBIB 4ZJZA 3TBIA 2EZKA 2MLKA 3IH4A 3ZOBA 2FU4A 3BZKA 4AYBA 4B8XA 4XBFA 4QLCU 1ACIA 4MTEA 3CMAI 3BCBA 4KDPA 1T38A 2G7HA 3FMRA 3OWTA 3CCJI 2KIQA 2DMPA 2L2OA 2X6WA 3QP5A 4RGUA 4EMSA 4HDVA 1P9QC 4F91B 3P9KA 2ZXIA 2AHQA 2PEXA 2RKHA 2ME6A 2R0QC 1IAWA 1REPC 5CJ9A 4XORA 1G3TA 1R23A 2F5EA 3FKIJ 4MK6A 4M9XA 1XDUA 3LSMA 3WHCA 2H09A 2CO5A 2H8RA 5ERIA 2E35A 4Y17A 5IYDJ 3ZQ7A 4IRIA 1FOYA 1SVLA 3L2VA 4FQGA 1XN7A 2DQRA 3QODA 1XTAA 4E7LA 1XCVA 4C3IJ 2W82A 1VQNI 4U7DA 3A03A 3E6CC 4U7BA 1E3OC 1IRXA 3VSLA 3HXLA 3BTCA 3HZJA 5LHIA 2GOMA 4ZTFA 3RD3A 3IRRA 4IRGA 1D1CA 1D8KA 4WK8F 2IS1A 2R7UA 1Z1DA 1LJ9A 2P6TA 4OMYA 5F27A 1EKEA 2PFVA 4WIBA 4JX5A 2IA0A 1I6HJ 3GVAA 1QPMA 3KYLA 5L3BA 1D5VA 3BHQA 3E3VA 2E2HJ 3J81K 1PUFB 5H6RA 2IU5A 4XNFA 4DW6A 2WGBA 3HRSA 5LHGA 3LSHA 3AL0C 5E8GA 5C3EJ 1K61A 2WC2A 3M7GA 4DJAA 2ZJQF 3RPUD 4AIJA 2ZNZA 3RKXA 3LSGA 2GLOA 4A5MA 2XF6A 3W2WA 3OS0A 2ZOYA 2Z5UA 1YO5C 3VVZA 3HM5A 1GDTA 2I5UA 4I0BA 5C44J 1H9GA 4EATA 2OTLI 2WTEA 4ACIA 2BE5F 4PFPA 2UV1A 5FD5A 4DYQA 4FCYA 3SWHA 4CCOA 5EYRA 2E1MB 2W85A 5K7FA 4XIDA 2CFXA 1Z3XA 4ZDPA 4Y33A 1FBUA 1SD5A 3FIWA 2ZMEA 2VI6A 2XSDC 1ZRFA 3VW0A 1I6XA 2D1HA 4MFEA 1YIJI 2XROA 1YLFA 2BW3A 2IRFG 3PIPF 1RZ4A 2P8TA 1WZ2A 4RM3A 4XM3A 3H9JA 4EJTA 3H3UA 5A2QK 4M3BA 4DZJA 4AIDA 1O3TA 4U0VA 1H0MA 2N8GA 4LG0A 3E5QA 2OBPA 2H6CA 1BJZA 5M3MJ 2AXTC 4BE1A 3KNWA 1U5TB 2JMWA 4IOCF 4NNJA 1SAUA 5FLXZ 5FO5A 2G7UA 2F48A 2STWA 1P2FA 2Z16A 1JKQC 2V6CA 4KIFA 1IRZA 2HOSA 2B1EA 2M3AA 2VBXA 3BR2A 3BY6A 4UUSB 2MSYA 2MLGA 1KZHA 2DOEA 2HKUA 4ZC3A 3GBGA 1WRJA 1ZYRF 3CTAA 1S5LC 4HDUA 3KPHA 2GIZA 2UZKA 2W00A 3NNRA 5LFAA 2RVCA 2Y75A 2QQBA 1ZTRA 4P96A 3U2RA 3TW6A 2LY2A 4KICA 4AVZA 2LBFA 1OISA 2Y0SN 3IKTA 3AFHA 1VZ0A 2EIMH 4J00A 2E60A 1VNDA 3L2QA 2B3WA 1HKSA 4LGWA 4U87A 2F5CA 1R71A 4CCMA 3BRUA 3QYFA 2HGCA 4BEHB 2X9DA 1Y6IA 3VODA 3L2WA 4PXIA 2WAQN 3G73A 2ZCNA 3AG3H 3Q5FA 4UVAA 5D5UB 4I98B 1J75A 1IC8A 4CCJA 3OYIA 4JX6A 4PDKA 2YX4A 2OQGA 2JRTA 1U2WA 3WTTC 5F6FA 3JRAA 2IT0A 1MMNA 3QP6A 3NI7A 5EGOB 3UKGA 3FISA 5HODA 3GTGJ 1RC9A 2R7TA 3BTIA 1SD6A 1EH7A 3L1PA 4Y13A 3ABUA 1K6YA 1HOMA 5DUIA 3RI4A 3KX2A 4XKCA 3BJ6A 1LKXA 2OA4A 5GPAA 3R6SA 2VODA 1OLTA 1SD4A 1ETXA 1P4WA 2QEXI 3IH3A 3GEUA 2QQ8A 4CCKA 1XPXA 1IF1A 2LD5A 2MGQA 2M2EA 5JLXA 1G3WA 2CV2A 4CCNA 2D45A 2F6CA 3WE3A 4KFCA 4CA0A 4N4OB 3KKCA 2NVTJ 5DUKA 3EPZA 3FX3A 2QBYB 1QVTA 3F22A 4C30A 4RB2C 4UHTA 5IOYA 3HB9A 4IHVA 4IHXA 1TWHJ 3CMMA 3J7AO 4XLAA 5GTHC 2VJ5A 3K8PC 4ZH4F 4Y7NJ 2HKXA 2DTZA 3GFIA 3S1NJ 3I59B 3CQZJ 4HX4A 5DM7F 2OERA 3GFMA 2P7VB 4KJZA 4ICHA 2LLKA 3CWRA 2EQRA 1W7PA 1LVAA 1USTA 1ZG1A 3CCUI 2COMA 4UUVA 2D2WA 4Y4RA 2KJBA 3B81A 2K3FA 4IZZA 4GFKA 1ZGWA 2VUMJ 4G6TB 3WTYC 1UAAA 2EJRA 2ELJA 3DEUA 5KCMA 1PDNC 5FKMA 1QZZA 2X1EA 1B59A 1P92A 4OAZA 3AG2H 2XF5A 1UHWA 2M9HA 3JSJA 2M34A 1F4KA 3E6DA 3F8BA 1OR7A 5J1UA 3BJAA 2Z2SB 2E7XA 3ON4A 1B4AA 4HF1A 3QYEA 3KEYA 1ZLJA 3B6CA 3REOA 2FNAA 5J1RA 1BI0A 1SMTA 4X1EA 4I6ZA 1H9TA 4ZYAA 5B3SH 3C3WA 1L0OC 2DOFA 3OYMA 3CC7I 2OCCH 5EZGA 1DP3A 3HIMA 2JWTA 3HSRA 2XDNA 3BCGA 1P6RA 4PSXA 1VQLI 3D0SA 3LAJA 1XC5A 2BBYA 4AU7A 2R3SA 3LSRA 4HRIA 2BYVE 3E7LA 1OCZH 4B48A 3M3YJ 3PPBA 1W0UA 1X4PA 4ASNA 2QENA 4RB0A 4LLNA 2PFBA 2K5CA 1ZGAA 1HDDC 1QU3A 4D5FA 4JKZA 4PJ0C 3ASOH 1E3HA 3RQIA 3M07A 4HYEA 4RMNA 5HLHA 3PO2J 3MWMA 1TLHB 2JA5J 5D5WB 4RB3C 3HKZA 4ZYEA 4H4KC 1JTYA 3DBLB 2XSJC 4G7ZF 1WGXA 2F4IA 3FHNA 4B3AA 3X2QH 4R79A 2L9RA 5KHDA 2R5ZB 3NEUA 2KZGA 4L5EA 1WJDA 2VQGA 3U9GA 4DBQA 2OQRA 4FASD 4HNVA 4RDUA 1FP2A 2QLZA 4BNCA 5M5XJ 1J0RA 4BXUA 2XGCA 4I09A 1KU2A 2COBA 5AONA 5LGNA 2W25A 2JA7J 1W36D 1GXQA 4ENJA 1JGSA 3BG6A 4B1RA 5KVRA 2DA5A 3M8FA 1S29A 2PMZA 2RC4A 1Z7UA 2MW8A 2YVEA 1F9NA 3K10A 3H35A 2GA2A 1LDJA 2DODA 4A69C 2QKOA 3CRJA 4DYRA 2K9MA 1DGRM 2QWWA 1WJ5A 3OYBA 2V9KA 3QKXA 1B72A 2PJRB 2CV0A 4PUSA 2KL4A 1A5JA 4KWAA 1I50J 3HPHA 4NBQA 3SZTA 5EZHA 5FD6A 3JAMK 2ZOZA 1TT5B 1WVRA 1S9HA 2DK8A 2UXPA 5K5OA 2LK2A 2LP0A 1VQOI 4HOBA 4P55A 1YX3A 1HQCA 2K27A 1X19A 2A07F 4C9YA 2W84A 5IYBJ 2EILH 4Q5SF 1SD7A 1V55H 2UXNA 3QU3A 3ZP5A 1OCRH 4E7JA 2FMYA 1R4MB 2PJPA 5HS7A 1V5GA 4KUMA 1GT0C 2DW4A 2QQAA 4C2MJ 3JRFA 4Y52J 3V7SA 4JK1X 1YJ9I 4XRFA 2KPMA 2L4AA 1FTTA 4M3DA 4A6DA 1A31A 1R1VA 4YFKF 2EZLA 2XUBA 2KIMA 1UG0A 4A3MJ 2J5OA 1HC8A 2WA0A 4PK4A 2DFHA 3DLLF 5CVIA 1R9TJ 1IXCA 3E6MA 4DYCA 5LBQA 3BROA 2LG4A 4RGSA 2HVSA 1ITYA 1Y8QB 1Q1HA 2HOAA 2L3DA
chains in the Genus database with same CATH topology
5F1JA 2DA4A 2M8GX 4MXMA 5F0CA 1I3QJ 2P81A 5K7HA 1TWFJ 2ID3A 2REKA 2DMQA 3G56A 1GV5A 2XB5A 2Y9YA 3HOUJ 5HBUA 4W97A 3VP5A 2E1OA 1GV2A 2O9LA 2JA8J 2B63J 1AU7A 2UXHA 2G0EA 2NVYJ 1VF9A 4S0HB 2XPUA 5E3LA 4BBRJ 3ANGA 3PASA 1BA5A 1JT6A 3OIOA 1RPWA 5C4YA 2KDZA 4HKUA 2UXIA 1SGMA 5EDNA 3JRBA 3ZQCA 2QWTA 3AQTA 3ON2A 2RAEA 2IBDA 2D6YA 2RHAA 1AKHA 3M4OJ 3MN2A 2KT0A 1F43A 2DMTA 4DZPA 5DTDA 4FTHA 3BR3A 5EF6A 3ANPA 3GZIA 3VPRA 1WCMJ 3HGGA 5FKLA 3ZQHA 5HAWA 4M6VA 3VIBA 3CDLA 5DAJA 1Y1VJ 5FHPA 3BR0A 2E2IJ 3MVPA 2E19A 2VKVA 1UI6A 2GUHA 1SFOJ 5C4JJ 2RASA 3HBLA 3S2DJ 5EGOA 2DN0A 1HDPA 3BT9A 1OFCX 2CQQA 2GBYA 4AYBN 1XG1A 4IHYA 3TP0A 2GM4A 1EF4A 4XICA 3O8GA 4AC0A 2ME0A 4JP0A 5F08A 2EZKA 3IH4A 3ZOBA 1LFBA 2FX0A 1Z77A 3W6VA 1MBHA 3I4NJ 5J3LA 5F04A 2PBXA 1JJ8C 1ENHA 2DMPA 2XPVA 1ETQA 3SFIA 1FIAA 3DEWA 3H0GJ 2AHQA 2ME6A 1F36A 2R0QC 3OSGA 2I10A 1BW6A 3FKIJ 2LVSA 2DMNA 3C2BA 5FJ8J 3QQAA 4MK6A 2ZB9A 3WHCA 3HE0A 3S1RJ 3HOVJ 1DU6A 2H8RA 1VFCA 5IYDJ 1O4XA 4BXXJ 4QSHA 2W48A 3E7QA 1JKPC 1SANA 4CYCB 4C3IJ 4FE7A 1TWGJ 3HOZJ 2EZIA 2VKEA 2XGEA 3A03A 1OCPA 1P7IA 3LSPA 2LKXA 1E3OC 4QTRA 2DMUA 3BTCA 3BTLA 1Y1WJ 1WH5A 3RD3A 1FIPA 1MH3A 2HI3A 1QPIA 5FLVA 1MBEA 1CQTA 2TCTA 4GCLA 5F27A 2YVHA 2HOTA 2YU9J 2Q24A 3EUPA 1JKOC 4IEJA 5E3MA 2F07A 3H3VK 4JX5A 2NS7A 2G7GA 1I6HJ 1RKTA 3BHQA 5FLMJ 2E2HJ 1PUFB 3S15J 3HTIA 2IU5A 5IP7J 3BNIA 2Y30A 4DW6A 1GVDA 2WGBA 3VVYA 4A3IJ 4A3BJ 5C3EJ 3S1QJ 3DCFA 1K61A 4UDSA 2GLOA 2W53A 5D1RA 3LSGA 1X58A 4J19A 2QTQA 2ZOYA 2G3BA 3VVZA 2UXUA 3HM5A 5AQCA 1GDTA 2HXOA 4BBSJ 5C44J 2PZ9A 1FJLA 4ACIA 4C3HJ 4D5CA 1MBFA 4DYQA 3GTOJ 3G7RA 4FCYA 3KKDA 5EYRA 3CCYA 3RKQA 4BY7J 5K7FA 4XIDA 3S1MJ 3Q0UA 2XSDC 3VW0A 3A02A 3FIWA 2VI6A 3GTKJ 1U78A 2MG4A 5EG0A 1ETWA 1RETA 4MFEA 2EH3A 4JL3A 2QF7A 1S7EA 1VI0A 4CGRA 5HSZA 1MBKA 3KZ9A 3JRDA 4C3JJ 3S2HJ 5IP9J 1GUUA 4M3BA 4DZJA 1XS9A 3HOXJ 2R5ZA 3S17J 1B8IB 4A3CJ 2N8GA 1MSEC 3OSFA 2NVXJ 2DJNA 3NXCA 1BJZA 5M3MJ 4AF5A 1ETYA 3KNWA 2JMWA 4GFBA 1MSFC 2X6OA 2L7MP 1Z0XA 4I76A 4IHWA 1JKQC 2X48A 2ECBA 1IRZA 2HOSA 4XRMA 1OJLA 3ZQIA 3BR1A 4A3KJ 4FE4A 5BNGA 3BR2A 2R5YB 4UUSB 2MSYA 2XRLA 1JJ6C 2IEKA 2HKUA 2LY9A 3GTQJ 2O8KA 3GBGA 4GCTA 1OCTC 3BTJA 3LNQA 1IDZA 3T6NA 1X2NA 3TEDA 3NNRA 3BQYA 1NK3P 1LE8A 1JTXA 1IV6A 3HKZN 1ZTRA 3TW6A 4XRSA 3BG9A 4CYCA 2IAIA 1ZR4A 3COLA 1LFUP 1RKWA 5F0FA 3WHBA 2TRTA 5FMPA 2Y0SN 9ANTA 3Q0WA 1UI5A 1VNDA 5GPCA 1WH7A 2YS9A 1H89C 3BJBA 2L7ZA 3BQZA 3BRUA 3I4MJ 3A01B 2X9DA 3TW7A 2CU7A 4X6AJ 3K2AA 4PXIA 2WAQN 2ZCNA 1UMQA 2CUEA 1U9OA 1IC8A 2EBIA 3S14J 1MNMC 1IGNA 1A6IA 4JX6A 5M3FJ 4JX4A 4M3GA 1JUMA 2FD5A 2PMZN 3JRAA 4M3EA 2GFNA 4XRSG 3BG5A 1YRNB 5DS9A 3NI7A 5FKKA 5EGOB 3UKGA 3GTPJ 3FISA 5HODA 2DA2A 3GTGJ 3HOWJ 2O7TA 1T56A 3BTIA 4W1UA 3L1PA 5CXGA 1HOMA 5GPAA 4A3DJ 1K83J 1ETXA 1U8BA 1APLC 3IH3A 3QPLA 3GEUA 2XPWA 1JUPA 2MGQA 2LD5A 4JYKA 2M2EA 2YUSA 5JLXA 2QCOA 1IJWC 3VW2A 4EEFG 1H88C 1MH4A 1POGA 3KKCA 2NVTJ 1UG2A 3VOKA 4LOCA 3EGQA 1QVTA 2QOPA 1BW5A 3IH2A 1AHDP 1ZK8A 5IOYA 3NARA 1WI3A 1WPKA 2Y31A 3HB9A 3Q0VA 1W0TA 4IHVA 4IHXA 3VUQA 2AO9A 5D19A 1TWHJ 3QBMA 4UUTA 4JNNA 1HLVA 1JT0A 1IDYA 5K7ZA 2L7FP 1FEXA 3GTJJ 3ZQGA 1B8IA 1JUSA 1ZKGA 2DTZA 4Y7NJ 2DG7A 1P7JA 3S1NJ 2NX4A 1RESA 3V78A 3VW1A 3CQZJ 1DU0A 2JJ7A 4B4CA 1HCRA 2OERA 4ICHA 3HEFA 4A93J 1B72B 4V2FA 2CUFA 2DA3A 4ABZA 2LLKA 2E2JJ 2EQRA 3CWRA 2HQ5A 3TP3A 3HTHA 3GTLJ 3B81A 2R92J 4GFKA 1ZGWA 2VUMJ 2JK3A 2CRGA 2DA7A 3HTJA 4NDLA 3QPSA 2OF7A 5FKMA 5E3NA 1X2MA 1MBJA 1ETOA 2R5YA 3DPJA 2EZHA 4UUSA 2M9HA 3JSJA 2M34A 1TC3C 5J1UA 5E3OA 2H1KA 2NOGA 5IP6A 3ON4A 5K58A 3NAUA 2R7ZJ 2ELKA 5J1RA 3B6CA 3K7AJ 4NN1A 2CJJA 4I6ZA 4X1EA 5J1YA 3HOYJ 4QIWN 5H9TA 2WV1A 4ME9A 3LWJA 1ETKA 3Q3SA 5EZGA 2WB1N 2WUIA 2D5VA 5CXIA 3HIMA 2JWTA 3RH2A 2XDNA 3VVXA 2HXIA 3BR6A 3BCGA 1JGGA 1XC5A 1IUFA 3IUVA 1JKRC 4AC6A 3SDGA 3LSRA 2K9QA 3NRGA 2K40A 3CMYA 1TWCJ 3A01A 3E7LA 3M3YJ 3JRHA 5IPAA 2NVQJ 3S16J 3PPBA 1QRYA 3S5RA 1W0UA 3BR5A 5EEAA 1NK2P 5C4XJ 5EG0B 5M5YJ 2XGDA 3G1OA 3HTAA 1HDDC 2R93J 1T33A 4D5FA 2ZCXA 3V6GA 5EFYA 4JKZA 1NTCA 1Q1VA 3RQIA 2CQXA 3O8HA 3F0CA 3PO2J 3SJMA 2NP5A 1YRNA 4BY1J 2JA5J 3ZQLA 2LR8A 4G12A 1QVUA 3G1MA 4MO7A 3NPIA 4NELA 4MLOA 1AKHB 1JTYA 1ZQ3P 1U9NA 1WGXA 5JLWA 4B3AA 2R5ZB 2GENA 2HYTA 2L9RA 2V57A 2G7SA 5CW8A 2OI8A 4L5EA 3JRIA 2OPTA 4HNVA 4RDUA 4D7MA 1D5YA 4V2GA 5M5XJ 3FRQA 2XGCA 2QIBA 1TWAJ 3P9TA 2COBA 3PM1A 3IV5A 4RBOA 2JA7J 2VPRA 1IG7A 1PUFA 2K9NA 4A3EJ 4B1RA 4BKXA 4GFLA 3JRCA 1UHSA 2DA5A 3HGYA 2O7OA 2MW8A 2DA6A 3MKLA 3RZOJ 2YVEA 2ID6A 3JRGA 1G2HA 3RZDJ 2UXOA 3LHQA 4A69C 1BL0A 3JREA 2JN6A 3LSJA 2QKOA 3CRJA 3FK7A 4XK4A 4DYRA 3O60A 1ZR2A 5M5WJ 1LE8B 2HYJA 3QKXA 3ZQFA 2DA1A 4AUXA 1B72A 2K9SA 4M3FA 1A5JA 4KWAA 1ORKA 2HDDA 1I50J 5GP9A 1H8AC 3VOXA 5EZHA 5F0HA 2ZOZA 1HF0A 4A3GJ 1ETVA 2ECCA 2UXPA 5FKOA 1FTZA 2LK2A 3C07A 2LP0A 2LFBA 4MFDA 5IYBJ 5D18A 4GCKA 2JA6J 2FQ4A 3HDDA 4A3JJ 2FJ1A 3JR9A 3BG3A 5FKNA 2NS8A 2DG8A 3LOCA 2XB0X 2M0CA 1GT0C 3GTMJ 4D7NA 4C2MJ 5IYCJ 3JRFA 4Y52J 1MBGA 3F1BA 3CJDA 2NP3A 2LTPA 3B6AA 3LJLA 3G1LA 1FTTA 4M3DA 5FGLA 1RR7A 2EZLA 2Y2ZA 3FK6A 3MNLA 2L0KA 3OOUA 4A3MJ 5IOZA 4L62A 3PO3J 2G7LA 3AQSA 2ZCMA 2FBQA 2Y9ZA 1R9TJ 4DYCA 4FISA 4MIMA 3D1NI 4A3FJ 1ITYA 4A3LJ 4YZEA 2HOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1J A;  2DA4 A;  2M8G X;  4MXM A;  5F0C A;  1I3Q J;  2P81 A;  5K7H A;  1TWF J;  2ID3 A;  2REK A;  2DMQ A;  3G56 A;  1GV5 A;  2XB5 A;  2Y9Y A;  3HOU J;  5HBU A;  4W97 A;  3VP5 A;  2E1O A;  1GV2 A;  2O9L A;  2JA8 J;  2B63 J;  1AU7 A;  2UXH A;  2G0E A;  2NVY J;  1VF9 A;  4S0H B;  2XPU A;  5E3L A;  4BBR J;  3ANG A;  3PAS A;  1BA5 A;  1JT6 A;  3OIO A;  1RPW A;  5C4Y A;  2KDZ A;  4HKU A;  2UXI A;  1SGM A;  5EDN A;  3JRB A;  3ZQC A;  2QWT A;  3AQT A;  3ON2 A;  2RAE A;  2IBD A;  2D6Y A;  2RHA A;  1AKH A;  3M4O J;  3MN2 A;  2KT0 A;  1F43 A;  2DMT A;  4DZP A;  5DTD A;  4FTH A;  3BR3 A;  5EF6 A;  3ANP A;  3GZI A;  3VPR A;  1WCM J;  3HGG A;  5FKL A;  3ZQH A;  5HAW A;  4M6V A;  3VIB A;  3CDL A;  5DAJ A;  1Y1V J;  5FHP A;  3BR0 A;  2E2I J;  3MVP A;  2E19 A;  2VKV A;  1UI6 A;  2GUH A;  1SFO J;  5C4J J;  2RAS A;  3HBL A;  3S2D J;  5EGO A;  2DN0 A;  1HDP A;  3BT9 A;  1OFC X;  2CQQ A;  2GBY A;  4AYB N;  1XG1 A;  4IHY A;  3TP0 A;  2GM4 A;  1EF4 A;  4XIC A;  3O8G A;  4AC0 A;  2ME0 A;  4JP0 A;  5F08 A;  2EZK A;  3IH4 A;  3ZOB A;  1LFB A;  2FX0 A;  1Z77 A;  3W6V A;  1MBH A;  3I4N J;  5J3L A;  5F04 A;  2PBX A;  1JJ8 C;  1ENH A;  2DMP A;  2XPV A;  1ETQ A;  3SFI A;  1FIA A;  3DEW A;  3H0G J;  2AHQ A;  2ME6 A;  1F36 A;  2R0Q C;  3OSG A;  2I10 A;  1BW6 A;  3FKI J;  2LVS A;  2DMN A;  3C2B A;  5FJ8 J;  3QQA A;  4MK6 A;  2ZB9 A;  3WHC A;  3HE0 A;  3S1R J;  3HOV J;  1DU6 A;  2H8R A;  1VFC A;  5IYD J;  1O4X A;  4BXX J;  4QSH A;  2W48 A;  3E7Q A;  1JKP C;  1SAN A;  4CYC B;  4C3I J;  4FE7 A;  1TWG J;  3HOZ J;  2EZI A;  2VKE A;  2XGE A;  3A03 A;  1OCP A;  1P7I A;  3LSP A;  2LKX A;  1E3O C;  4QTR A;  2DMU A;  3BTC A;  3BTL A;  1Y1W J;  1WH5 A;  3RD3 A;  1FIP A;  1MH3 A;  2HI3 A;  1QPI A;  5FLV A;  1MBE A;  1CQT A;  2TCT A;  4GCL A;  5F27 A;  2YVH A;  2HOT A;  2YU9 J;  2Q24 A;  3EUP A;  1JKO C;  4IEJ A;  5E3M A;  2F07 A;  3H3V K;  4JX5 A;  2NS7 A;  2G7G A;  1I6H J;  1RKT A;  3BHQ A;  5FLM J;  2E2H J;  1PUF B;  3S15 J;  3HTI A;  2IU5 A;  5IP7 J;  3BNI A;  2Y30 A;  4DW6 A;  1GVD A;  2WGB A;  3VVY A;  4A3I J;  4A3B J;  5C3E J;  3S1Q J;  3DCF A;  1K61 A;  4UDS A;  2GLO A;  2W53 A;  5D1R A;  3LSG A;  1X58 A;  4J19 A;  2QTQ A;  2ZOY A;  2G3B A;  3VVZ A;  2UXU A;  3HM5 A;  5AQC A;  1GDT A;  2HXO A;  4BBS J;  5C44 J;  2PZ9 A;  1FJL A;  4ACI A;  4C3H J;  4D5C A;  1MBF A;  4DYQ A;  3GTO J;  3G7R A;  4FCY A;  3KKD A;  5EYR A;  3CCY A;  3RKQ A;  4BY7 J;  5K7F A;  4XID A;  3S1M J;  3Q0U A;  2XSD C;  3VW0 A;  3A02 A;  3FIW A;  2VI6 A;  3GTK J;  1U78 A;  2MG4 A;  5EG0 A;  1ETW A;  1RET A;  4MFE A;  2EH3 A;  4JL3 A;  2QF7 A;  1S7E A;  1VI0 A;  4CGR A;  5HSZ A;  1MBK A;  3KZ9 A;  3JRD A;  4C3J J;  3S2H J;  5IP9 J;  1GUU A;  4M3B A;  4DZJ A;  1XS9 A;  3HOX J;  2R5Z A;  3S17 J;  1B8I B;  4A3C J;  2N8G A;  1MSE C;  3OSF A;  2NVX J;  2DJN A;  3NXC A;  1BJZ A;  5M3M J;  4AF5 A;  1ETY A;  3KNW A;  2JMW A;  4GFB A;  1MSF C;  2X6O A;  2L7M P;  1Z0X A;  4I76 A;  4IHW A;  1JKQ C;  2X48 A;  2ECB A;  1IRZ A;  2HOS A;  4XRM A;  1OJL A;  3ZQI A;  3BR1 A;  4A3K J;  4FE4 A;  5BNG A;  3BR2 A;  2R5Y B;  4UUS B;  2MSY A;  2XRL A;  1JJ6 C;  2IEK A;  2HKU A;  2LY9 A;  3GTQ J;  2O8K A;  3GBG A;  4GCT A;  1OCT C;  3BTJ A;  3LNQ A;  1IDZ A;  3T6N A;  1X2N A;  3TED A;  3NNR A;  3BQY A;  1NK3 P;  1LE8 A;  1JTX A;  1IV6 A;  3HKZ N;  1ZTR A;  3TW6 A;  4XRS A;  3BG9 A;  4CYC A;  2IAI A;  1ZR4 A;  3COL A;  1LFU P;  1RKW A;  5F0F A;  3WHB A;  2TRT A;  5FMP A;  2Y0S N;  9ANT A;  3Q0W A;  1UI5 A;  1VND A;  5GPC A;  1WH7 A;  2YS9 A;  1H89 C;  3BJB A;  2L7Z A;  3BQZ A;  3BRU A;  3I4M J;  3A01 B;  2X9D A;  3TW7 A;  2CU7 A;  4X6A J;  3K2A A;  4PXI A;  2WAQ N;  2ZCN A;  1UMQ A;  2CUE A;  1U9O A;  1IC8 A;  2EBI A;  3S14 J;  1MNM C;  1IGN A;  1A6I A;  4JX6 A;  5M3F J;  4JX4 A;  4M3G A;  1JUM A;  2FD5 A;  2PMZ N;  3JRA A;  4M3E A;  2GFN A;  4XRS G;  3BG5 A;  1YRN B;  5DS9 A;  3NI7 A;  5FKK A;  5EGO B;  3UKG A;  3GTP J;  3FIS A;  5HOD A;  2DA2 A;  3GTG J;  3HOW J;  2O7T A;  1T56 A;  3BTI A;  4W1U A;  3L1P A;  5CXG A;  1HOM A;  5GPA A;  4A3D J;  1K83 J;  1ETX A;  1U8B A;  1APL C;  3IH3 A;  3QPL A;  3GEU A;  2XPW A;  1JUP A;  2MGQ A;  2LD5 A;  4JYK A;  2M2E A;  2YUS A;  5JLX A;  2QCO A;  1IJW C;  3VW2 A;  4EEF G;  1H88 C;  1MH4 A;  1POG A;  3KKC A;  2NVT J;  1UG2 A;  3VOK A;  4LOC A;  3EGQ A;  1QVT A;  2QOP A;  1BW5 A;  3IH2 A;  1AHD P;  1ZK8 A;  5IOY A;  3NAR A;  1WI3 A;  1WPK A;  2Y31 A;  3HB9 A;  3Q0V A;  1W0T A;  4IHV A;  4IHX A;  3VUQ A;  2AO9 A;  5D19 A;  1TWH J;  3QBM A;  4UUT A;  4JNN A;  1HLV A;  1JT0 A;  1IDY A;  5K7Z A;  2L7F P;  1FEX A;  3GTJ J;  3ZQG A;  1B8I A;  1JUS A;  1ZKG A;  2DTZ A;  4Y7N J;  2DG7 A;  1P7J A;  3S1N J;  2NX4 A;  1RES A;  3V78 A;  3VW1 A;  3CQZ J;  1DU0 A;  2JJ7 A;  4B4C A;  1HCR A;  2OER A;  4ICH A;  3HEF A;  4A93 J;  1B72 B;  4V2F A;  2CUF A;  2DA3 A;  4ABZ A;  2LLK A;  2E2J J;  2EQR A;  3CWR A;  2HQ5 A;  3TP3 A;  3HTH A;  3GTL J;  3B81 A;  2R92 J;  4GFK A;  1ZGW A;  2VUM J;  2JK3 A;  2CRG A;  2DA7 A;  3HTJ A;  4NDL A;  3QPS A;  2OF7 A;  5FKM A;  5E3N A;  1X2M A;  1MBJ A;  1ETO A;  2R5Y A;  3DPJ A;  2EZH A;  4UUS A;  2M9H A;  3JSJ A;  2M34 A;  1TC3 C;  5J1U A;  5E3O A;  2H1K A;  2NOG A;  5IP6 A;  3ON4 A;  5K58 A;  3NAU A;  2R7Z J;  2ELK A;  5J1R A;  3B6C A;  3K7A J;  4NN1 A;  2CJJ A;  4I6Z A;  4X1E A;  5J1Y A;  3HOY J;  4QIW N;  5H9T A;  2WV1 A;  4ME9 A;  3LWJ A;  1ETK A;  3Q3S A;  5EZG A;  2WB1 N;  2WUI A;  2D5V A;  5CXI A;  3HIM A;  2JWT A;  3RH2 A;  2XDN A;  3VVX A;  2HXI A;  3BR6 A;  3BCG A;  1JGG A;  1XC5 A;  1IUF A;  3IUV A;  1JKR C;  4AC6 A;  3SDG A;  3LSR A;  2K9Q A;  3NRG A;  2K40 A;  3CMY A;  1TWC J;  3A01 A;  3E7L A;  3M3Y J;  3JRH A;  5IPA A;  2NVQ J;  3S16 J;  3PPB A;  1QRY A;  3S5R A;  1W0U A;  3BR5 A;  5EEA A;  1NK2 P;  5C4X J;  5EG0 B;  5M5Y J;  2XGD A;  3G1O A;  3HTA A;  1HDD C;  2R93 J;  1T33 A;  4D5F A;  2ZCX A;  3V6G A;  5EFY A;  4JKZ A;  1NTC A;  1Q1V A;  3RQI A;  2CQX A;  3O8H A;  3F0C A;  3PO2 J;  3SJM A;  2NP5 A;  1YRN A;  4BY1 J;  2JA5 J;  3ZQL A;  2LR8 A;  4G12 A;  1QVU A;  3G1M A;  4MO7 A;  3NPI A;  4NEL A;  4MLO A;  1AKH B;  1JTY A;  1ZQ3 P;  1U9N A;  1WGX A;  5JLW A;  4B3A A;  2R5Z B;  2GEN A;  2HYT A;  2L9R A;  2V57 A;  2G7S A;  5CW8 A;  2OI8 A;  4L5E A;  3JRI A;  2OPT A;  4HNV A;  4RDU A;  4D7M A;  1D5Y A;  4V2G A;  5M5X J;  3FRQ A;  2XGC A;  2QIB A;  1TWA J;  3P9T A;  2COB A;  3PM1 A;  3IV5 A;  4RBO A;  2JA7 J;  2VPR A;  1IG7 A;  1PUF A;  2K9N A;  4A3E J;  4B1R A;  4BKX A;  4GFL A;  3JRC A;  1UHS A;  2DA5 A;  3HGY A;  2O7O A;  2MW8 A;  2DA6 A;  3MKL A;  3RZO J;  2YVE A;  2ID6 A;  3JRG A;  1G2H A;  3RZD J;  2UXO A;  3LHQ A;  4A69 C;  1BL0 A;  3JRE A;  2JN6 A;  3LSJ A;  2QKO A;  3CRJ A;  3FK7 A;  4XK4 A;  4DYR A;  3O60 A;  1ZR2 A;  5M5W J;  1LE8 B;  2HYJ A;  3QKX A;  3ZQF A;  2DA1 A;  4AUX A;  1B72 A;  2K9S A;  4M3F A;  1A5J A;  4KWA A;  1ORK A;  2HDD A;  1I50 J;  5GP9 A;  1H8A C;  3VOX A;  5EZH A;  5F0H A;  2ZOZ A;  1HF0 A;  4A3G J;  1ETV A;  2ECC A;  2UXP A;  5FKO A;  1FTZ A;  2LK2 A;  3C07 A;  2LP0 A;  2LFB A;  4MFD A;  5IYB J;  5D18 A;  4GCK A;  2JA6 J;  2FQ4 A;  3HDD A;  4A3J J;  2FJ1 A;  3JR9 A;  3BG3 A;  5FKN A;  2NS8 A;  2DG8 A;  3LOC A;  2XB0 X;  2M0C A;  1GT0 C;  3GTM J;  4D7N A;  4C2M J;  5IYC J;  3JRF A;  4Y52 J;  1MBG A;  3F1B A;  3CJD A;  2NP3 A;  2LTP A;  3B6A A;  3LJL A;  3G1L A;  1FTT A;  4M3D A;  5FGL A;  1RR7 A;  2EZL A;  2Y2Z A;  3FK6 A;  3MNL A;  2L0K A;  3OOU A;  4A3M J;  5IOZ A;  4L62 A;  3PO3 J;  2G7L A;  3AQS A;  2ZCM A;  2FBQ A;  2Y9Z A;  1R9T J;  4DYC A;  4FIS A;  4MIM A;  3D1N I;  4A3F J;  1ITY A;  4A3L J;  4YZE A;  2HOA A; 
#chains in the Genus database with same CATH topology
 5F1J A;  1ZN2 A;  4MXM A;  5F0C A;  3ZMV A;  5FRM A;  3GUD A;  1KU7 A;  2PMU A;  4E7I A;  4BQA A;  1JI8 A;  3CCV I;  5BS6 A;  2HVR A;  3ESW B;  2AQE A;  1YW8 A;  1R4N B;  4C2U A;  3S8P A;  2JVG A;  2UXH A;  3DKY A;  5FRO A;  2VB6 A;  4BBR J;  4UV9 A;  2ACJ A;  2PLY A;  1W5S A;  2EIJ H;  1RPW A;  2D1V A;  1U3E M;  3ON2 A;  2RAE A;  3WTW C;  3WTX C;  2RHA A;  4X0G A;  2LKS A;  1KU9 A;  4HST A;  4L9J A;  2KT0 A;  1ZH5 A;  5GAH J;  4LIU A;  5DTD A;  1XMX A;  4XN3 A;  2RQQ A;  2K9L A;  2P6S A;  1UFM A;  3VPR A;  5E18 F;  4PGH A;  1R7J A;  2QSF X;  1KON A;  5L3E A;  3F8N A;  3L2U A;  4M74 A;  5DAJ A;  2JSC A;  3NQO A;  3LAP A;  3BR0 A;  4I02 A;  5E1X A;  2EK5 A;  2GUH A;  1RRJ A;  3MAJ A;  3IUO A;  5C4J J;  1X4O A;  4S04 A;  5BQT A;  4IHT A;  3HBL A;  3B02 A;  1XSV A;  5HVQ C;  2VAS A;  1ZGJ A;  2DDB A;  2CQQ A;  5EJC A;  1BOB A;  4R8H A;  3VTI A;  2QYO A;  4CUG A;  2B0L A;  3CF5 F;  1HSJ A;  3HSE A;  2O03 A;  3C2G A;  3TP0 A;  2GM4 A;  4XIC A;  3O8G A;  2BY3 A;  2ZME C;  4JP0 A;  3GCM A;  2RNJ A;  5TRD A;  3KP5 A;  4A5N A;  1LFB A;  2W4S A;  4L18 B;  1X1C A;  1BI1 A;  1FT9 A;  5J3L A;  4G6Q A;  3J80 K;  2PBX A;  2CSO A;  2L54 A;  1JJ8 C;  1ENH A;  2V26 A;  2GOX B;  2LRE A;  1VQ4 I;  4OIR F;  3K4J A;  3KE2 A;  2E7W A;  4B3X A;  2KHM A;  3DEW A;  1P4X A;  2CFO A;  1F36 A;  3GYH X;  3VDX A;  2L9S A;  1IV8 A;  1BW6 A;  3H9Q A;  2DMN A;  2V9V A;  5FJ8 J;  2X1D A;  2VXZ A;  2ZB9 A;  1F1Z A;  3HE0 A;  3CCQ I;  3HOV J;  1DU6 A;  1QHG A;  2V4J C;  4XLP F;  5KNL A;  1VFC A;  1MMD A;  2DT6 A;  1O4X A;  4BXX J;  3HHG A;  3P5J A;  4QSH A;  4RAG A;  2A6E F;  4OMZ A;  1JKP C;  4CYC B;  1T0F A;  1W5T A;  1IN4 A;  4FE7 A;  2DFE A;  1OCP A;  1P7I A;  5EEG A;  2E36 A;  3TOB A;  2DMU A;  4XLC A;  3SEZ A;  4E7S A;  3O3K A;  3CO6 C;  2KIF A;  4HZF A;  3VYS B;  4E7Z A;  1WH5 A;  1Y1W J;  1FIP A;  2HI3 A;  2O8X A;  3P9I A;  5FLV A;  3FXL A;  3LSK A;  4UVB A;  1K4S A;  1CQT A;  2X51 A;  2TDX A;  3F8F A;  3QU6 A;  4RA2 A;  3ZN0 A;  1YE9 A;  2X1C A;  4KIG A;  4C2T A;  2YVH A;  3DXJ F;  3RQ4 A;  3CC2 I;  3DBR B;  3HSF A;  3L2C A;  3ZN1 A;  2OCE A;  4TV7 A;  4ANJ A;  4E7K A;  2FQ3 A;  2G9W A;  5FLM J;  3S15 J;  5ICE A;  5IP7 J;  3BNI A;  1YJN I;  1O3R A;  1GVD A;  1OCO H;  3E1S A;  4HV5 A;  3RYR A;  4GCV A;  1Y0U A;  5KAF C;  3G71 I;  1WSU A;  2YVX A;  1G59 A;  1G8X A;  2KRC A;  2G3B A;  5AQC A;  3OR1 C;  2CUZ A;  3SYT A;  1FJL A;  2BVL A;  2HQN A;  2HQR A;  3V42 A;  4C3H J;  5LGT A;  4D5C A;  1NH3 A;  3RYP A;  3ZGK A;  4A2U A;  1A6Q A;  4XQF A;  3RKQ A;  4GXO A;  1LNW A;  3GME A;  3A02 A;  2FOK A;  4M72 A;  4CZC A;  1K78 B;  1RET A;  4KN4 X;  5LLQ A;  2EA2 A;  2E34 A;  4JL3 A;  2MA3 A;  1X1A A;  4NQW B;  2EV5 A;  5D5V B;  1VI0 A;  5HSZ A;  3NRV A;  4DNC A;  2ZO4 A;  2P5L C;  3E0J B;  3FZV A;  2ESN A;  4MEX F;  3HOX J;  3V8K A;  3OIP A;  1B8I B;  2GXB A;  3VEP A;  4D0P A;  3HRM A;  4DIQ A;  4II3 A;  4MNU A;  4FT8 A;  1IUY A;  2K7L A;  4WCG A;  3OMY A;  3PQK A;  2XV4 S;  2QQ9 A;  3JW4 A;  3PNY A;  4N4N B;  4IL6 C;  1Z0X A;  2BY0 A;  3BJO A;  4UNO A;  2ECB A;  2L01 A;  1OJL A;  2ZJR F;  4KIB A;  3ZQI A;  4FE4 A;  3L9F A;  2JTV A;  2R5Y B;  3OYD A;  3K4K A;  1WJA A;  3VYU B;  2VIX A;  2XRL A;  2IEK A;  2K3P A;  3DKW A;  3BCA A;  3R60 A;  4CH7 A;  1MDM A;  2LY9 A;  4V19 K;  2ZXH A;  1CF7 B;  3ISP A;  4J01 A;  2VT2 A;  1D1B A;  2WV0 A;  5GTI C;  1QO0 D;  1Z05 A;  3T6N A;  2YPR A;  4ZZL A;  4OU0 A;  4L0Y B;  4RAF A;  1LE8 A;  1HW1 A;  3CUQ B;  1Z6R A;  3HKZ N;  4XRS A;  3COL A;  4WF2 A;  4EJU A;  4QPO A;  1LFU P;  1W4M A;  3IC7 A;  3WE2 A;  5FMP A;  3GFL A;  1USS A;  3F21 A;  3OYE A;  2OC6 A;  4HLY A;  2YS9 A;  1OR7 C;  3MEX A;  4HF0 A;  3BQZ A;  4JBA A;  3MFK A;  3A01 B;  3K2A A;  2M1B A;  2CUE A;  3ML6 A;  3K4M A;  1LEA A;  3F23 A;  1A6I A;  1MMS A;  4HBL A;  4M3G A;  4ON0 A;  5HS8 A;  1JUM A;  3BZ6 A;  3GLL A;  1VQ5 I;  2CQN A;  4CGZ A;  2PMZ N;  2CYY A;  3F6O A;  2LY1 A;  4KIT B;  5FB2 A;  3BG5 A;  5DS9 A;  3PFY A;  2XAQ A;  5DCF A;  2XAU A;  1SVO A;  3IWZ A;  3FMS A;  4FET A;  4BHC A;  4UXN A;  3PSF A;  4XSZ F;  3SXY A;  2V9P A;  2HYG D;  2ZFU A;  2OZ6 A;  2FF4 A;  5J8C A;  2GAU A;  4F52 A;  2FJI 1;  3K69 A;  1Z91 A;  5J47 A;  3TO9 A;  3FMQ A;  1APL C;  3QPL A;  2YUS A;  1IJW C;  4I01 A;  4EEF G;  3FXQ A;  2NOJ B;  4IO9 F;  1UG2 A;  4LOC A;  4EJO A;  2VQH A;  3K4N A;  3JTH A;  5K1Y A;  2BZT A;  2WAE A;  1DPU A;  5E1Z B;  3VB2 A;  1W0T A;  4IQJ A;  2AO9 A;  3DPL C;  2EV0 A;  3QBM A;  1JT0 A;  1IDY A;  5DCM B;  4LMY A;  4DOZ A;  2P5V A;  1LQ1 A;  1ON1 A;  2L7F P;  1IN8 A;  3QWL A;  1ZG3 A;  4ZYH A;  2QKL B;  1FEX A;  3ZQG A;  2NX4 A;  1JUS A;  1ZKG A;  3MZ8 A;  3VW1 A;  3PNT A;  2F5D A;  2KIS A;  4ZTJ A;  1HCR A;  3HEF A;  5HLI A;  1U5T A;  4A93 J;  1YOV B;  2CUF A;  2ADU A;  4ABZ A;  4E70 A;  3HPG A;  3VYT B;  1D8J A;  3EET A;  2XAG A;  2L4M A;  1X3W B;  2B7E A;  1NG7 A;  2ZSI B;  1T2K A;  2R92 J;  1Z67 A;  1BBY A;  2DA7 A;  3ASN H;  2ICW G;  3H92 A;  1O3Q A;  1N75 A;  4DGW B;  3TOA A;  2EA4 A;  2OF7 A;  5E3N A;  1X2M A;  1OYY A;  3V7R A;  1WQ2 A;  4GYI A;  1ETO A;  1ZRD A;  1TQI A;  3GXO A;  3TL4 X;  3MZY A;  2DLL A;  5K5R A;  4UUS A;  3R61 A;  1KGS A;  1OYI A;  2J5P A;  1LDK B;  2P5K A;  4QWQ A;  3CJN A;  3G6E I;  4A0Z A;  3J7Y J;  3NAU A;  1HA8 A;  1YTY A;  3GZ6 A;  2CJJ A;  2ISZ A;  3LFU A;  1KQ8 A;  2M7B A;  4QIW N;  4ME9 A;  1BIB A;  3IP4 B;  1YX5 A;  1YIT I;  3LWJ A;  3C1D A;  2YR2 A;  2XRN A;  4WXD A;  2X6X A;  5IT9 K;  4A3L J;  3DBH B;  1MNE A;  3KLO A;  3QPT A;  1R1T A;  3RH2 A;  3VVX A;  3LA2 A;  4GYG A;  4L5J A;  1QA6 A;  3FWE A;  3DU6 A;  3GFJ A;  3IUV A;  1JKR C;  2MH9 A;  1CGP A;  1ZRE A;  3SDG A;  3G3Z A;  3NRG A;  2K40 A;  3OR2 C;  4BEH A;  2NVQ J;  5IPA A;  1TNT A;  5DYM A;  2EIN H;  1QRY A;  1FWZ A;  1XGS A;  3N97 A;  2JPB A;  1NK2 P;  3W6K B;  3BDD A;  2IS2 A;  2FUG 2;  5M5Y J;  2PX9 A;  3LQQ A;  1I3A A;  1MKM A;  2R93 J;  2ZCX A;  3R0A A;  5EFY A;  3ZPL A;  3V6G A;  3T1B A;  2CQX A;  2QZ8 A;  5TIS C;  1DGW Y;  4BY1 J;  2BVM A;  4G12 A;  2XAJ A;  2QSG X;  3NPI A;  1XX5 A;  2IGM A;  2R7R A;  5ILS A;  2NXN B;  2ZNY A;  4BS9 A;  1AKH B;  2V1X A;  2MAB A;  4P5O A;  5CQG A;  1U9N A;  2VOP A;  2GEN A;  1V54 H;  3WTU C;  2RN7 A;  4OD4 A;  3S3N A;  2G7S A;  5CW8 A;  2A61 A;  5D8L B;  4Q48 A;  1ONV A;  1D0Z A;  4RM2 A;  1D5Y A;  4WWC A;  4EV0 A;  1VQ9 I;  3P9T A;  1GXP A;  3IV5 A;  1ZRC A;  4RBO A;  1K79 A;  1FX7 A;  1IG7 A;  4A3E J;  3PUF A;  4GFL A;  3JRC A;  3HGY A;  3IRQ A;  1FMV A;  2O7O A;  3MKL A;  3BLY A;  5B66 C;  2VBW A;  2K86 A;  2HTJ A;  1G2H A;  3RZD J;  2UXO A;  4CYD A;  3LHQ A;  1TZL A;  2BXY A;  2ZJ2 A;  3ABL H;  4PJN A;  2JN6 A;  3LSJ A;  3H5A A;  1BM9 A;  2ETH A;  2RDP A;  3FK7 A;  4ZDO A;  3I59 A;  2DOA A;  3O60 A;  2VE8 A;  3OYL A;  1MND A;  2X85 A;  3CJR B;  1NG6 A;  1IZ1 A;  5J4Y A;  2IA1 A;  4XON A;  2DA1 A;  4AUX A;  4OOI A;  3CCM I;  2K9S A;  1TQP A;  1T8I A;  2HDD A;  3DU5 A;  2LMD A;  5F0H A;  1LEB A;  2M87 A;  4CSW A;  3C07 A;  5FKO A;  1FTZ A;  4CIC A;  1ODD A;  1SEU A;  1DDN A;  2LFB A;  4MFD A;  1U8R A;  4BQN A;  2L5Q A;  2XHK A;  2JQ7 A;  5HLG A;  4ZZD A;  3GF2 A;  2PI0 A;  3HDD A;  2MD5 A;  2Q2E A;  4BAY A;  1J9I A;  4NC6 A;  1R1U A;  2NS8 A;  4A6E A;  5IYC J;  1U0J A;  1BJA A;  4B47 A;  2OU2 A;  2NP3 A;  2LTP A;  4LLG F;  3B6A A;  1K4T A;  3J81 Z;  2A6T A;  3G1L A;  3P9C A;  4NC8 A;  2DBB A;  3IWF A;  3FK6 A;  5IOZ A;  1TTY A;  4XLH A;  1QNT A;  2Y9Z A;  2DU9 A;  4IX7 A;  4ENN A;  2M8E A;  3GWZ A;  1U6G A;  1GHC A;  4YZE A;  3OYJ A;  2H1L A;  2X0L A;  2AS5 F;  1JHF A;  2A69 F;  2IS6 A;  2Z3Y A;  1TWF J;  3AG1 H;  2ID3 A;  4PSW A;  5L3F A;  2ZXJ A;  2FML A;  5LGU A;  2Y9Y A;  1V5E A;  2VBZ A;  1T0F C;  3P7N A;  4EM0 B;  1GV2 A;  3CLQ A;  2E71 A;  1PJR A;  4L9N A;  2DFI A;  2NVY J;  2XPU A;  4WX9 A;  3PAS A;  2F2E A;  2V6E A;  4PGG A;  5GAG J;  2XAH A;  1B9M A;  5C4Y A;  1VQK I;  1SGM A;  2QWT A;  1AOY A;  5F64 A;  3VOE A;  2IBD A;  2A6H F;  2IJL A;  3EUH C;  2R7S A;  2HU9 A;  3W2A A;  3MN2 A;  1P4A A;  3KZZ A;  4FTH A;  3RKY A;  2HR3 A;  1D1A A;  5JVG F;  3GZI A;  4F7Z A;  2YU3 A;  5FKL A;  3E5X A;  5HAW A;  1XGO A;  2MD0 A;  4MEY F;  4N0B A;  3ZCO A;  4EQQ A;  1UI6 A;  4IPA A;  2RAS A;  1EH6 A;  3FXO A;  1B6A A;  3OS1 A;  4NB5 A;  2XGX A;  4YII A;  4RAZ A;  2DN0 A;  2L7K A;  2Z9O A;  4GDF A;  1HDP A;  3KZY A;  3CO7 C;  3EYI A;  2LC2 A;  2GBY A;  3ERM A;  1L3L A;  4AYB N;  3D5R C;  4IHY A;  1QZE A;  3RPU A;  5ICF A;  4AC0 A;  4AWX B;  3HOS A;  1FYL A;  3OL4 A;  5FFZ A;  4PJJ A;  1MBH A;  1RUO A;  3I4N J;  5F04 A;  2Q0O A;  1ZEL A;  3DF8 A;  3LA3 A;  2V1U A;  2IVM A;  1I1S A;  2XPV A;  4YIR X;  1YFH A;  3S2W A;  3PSI A;  3SFI A;  3H0G J;  3I53 A;  3OSG A;  3OL3 A;  2KRF A;  3GZ5 A;  2I10 A;  2Q8K A;  3SZG A;  3JSP A;  1GVJ A;  2PN6 A;  3FHZ A;  1Z9C A;  2LVS A;  3C2B A;  3HRT A;  2WY7 Q;  3HG9 A;  3I71 A;  4HV6 A;  4BQQ A;  5CPR B;  1XSD A;  2F4M B;  4RAY A;  2HWV A;  4RB1 A;  3CC4 I;  1YQA A;  1IN5 A;  2Y69 H;  1DQU A;  1WWX A;  2W48 A;  3U1D A;  3ZMT A;  5BPD A;  3E7Q A;  3Q9S A;  1SAN A;  3LMM A;  4KMF A;  2ISY A;  4HEA 2;  2EZI A;  2VKE A;  1QGP A;  1R6R A;  1C0W A;  4QTR A;  3K70 C;  3V8J A;  2DFF A;  1MZB A;  2IP2 A;  1KYZ A;  2HDC A;  3AL0 B;  1MH3 A;  1QPI A;  2VL8 A;  1MBE A;  2TCT A;  4GCL A;  1LDD A;  4M9S A;  2UXX A;  2KJC A;  1FYK A;  1MJA A;  3CF2 A;  2YU9 J;  2CGP A;  3CD6 I;  4IEJ A;  2E1N A;  1SC7 A;  3H3V K;  3PL8 A;  2NS7 A;  2G7G A;  4N9I A;  4EJW A;  3WG7 H;  3HTI A;  3KP7 A;  2Y30 A;  4A3I J;  4A3B J;  3ZMS A;  5HNF A;  3S1Q J;  3DCF A;  1PYV A;  3N05 A;  2Q1Z B;  4E6K G;  3SZP A;  4IF4 A;  2W53 A;  5D1R A;  3OYH A;  3J7A Y;  4J19 A;  2NYX A;  1AA7 A;  2CWE A;  2UXU A;  1EV7 A;  5BPI A;  4FX0 A;  2C6Y A;  2RRE A;  3SEQ A;  1ERD A;  3UR3 C;  1X1P A;  1MBF A;  4LFU A;  3KKD A;  3VYR B;  3LQR A;  2FOW A;  3S1M J;  2AXL A;  4DBR A;  4ZYD A;  3A0B C;  1FBS A;  1U78 A;  2MG4 A;  5EG0 A;  2H27 A;  1ETW A;  2I8D A;  1G4D A;  3SDB A;  1TW2 A;  1TL8 A;  2QF7 A;  2Z99 A;  3AKZ A;  3I54 A;  3CDH A;  1S7E A;  1XSX A;  2KIU A;  4CGR A;  3JRD A;  3T5X A;  2IXS A;  5D6E A;  3V8L A;  1GUU A;  1LPQ A;  1XS9 A;  3I0T A;  2XKP A;  5ILU A;  4A3C J;  2E1M C;  1IW7 F;  1VTN C;  3F6V A;  4BHP A;  4BYY A;  3OY9 A;  4LJZ F;  1MJ9 A;  4BGD A;  1R5G A;  4G7O F;  2R4G A;  3RDI A;  1MSF C;  4GFB A;  3K0L A;  3C2H A;  4I76 A;  3QRF F;  2KRH A;  3H0D A;  3LL7 A;  3M1E A;  2ZXW H;  4D9J A;  5ICC A;  4U0Y A;  1O3S A;  1FZP B;  4A3K J;  3U21 A;  4EJV A;  4O6J A;  5JR3 A;  3ZQQ A;  3ZMU A;  3GTQ J;  2O8K A;  4GCT A;  1U5T C;  2QVO A;  3BTJ A;  2NS0 A;  2KKO A;  3E97 A;  5L3D A;  2BOL A;  1IDZ A;  1MIJ A;  2ZC2 A;  1R00 A;  1X2N A;  3AAF A;  3TED A;  3BQY A;  1KA8 A;  4AIK A;  1R5I D;  3BG9 A;  4CYC A;  2IAI A;  3NS4 A;  1RKW A;  3GEZ A;  4RLF A;  3WHB A;  2TRT A;  4ETS A;  3PQJ A;  1J7K A;  3HOT A;  4PZJ A;  3Q0W A;  5DM6 F;  1UI5 A;  2EFP A;  5GPC A;  3F3X A;  1WH7 A;  2Y48 A;  4A0X A;  2Y0S A;  4XMY A;  1OMI A;  2L7Z A;  5H20 A;  2UWM A;  1MMG A;  2PBI A;  4L0Z B;  4F93 B;  4LIT A;  4DQ2 A;  3TW7 A;  1TP4 A;  2CU7 A;  4CZZ A;  3DP7 A;  3TDZ C;  2DXI A;  4X6A J;  4N9H A;  4XKB A;  1HKQ A;  2E5Z A;  4HLX A;  2W24 A;  4L9T A;  2EBI A;  2IGO A;  3WTV C;  1MNM C;  2KLO A;  5DEQ A;  3S14 J;  4JX4 A;  1UEL B;  1J5Y A;  5JHU A;  3OYC A;  2WAQ A;  2FD5 A;  2GFN A;  3L00 A;  2STT A;  4G6D A;  2EFN A;  3HL2 A;  4XRS G;  1YRN B;  3WTS C;  3S3M A;  3HOW J;  1T56 A;  1UZC A;  2HVQ A;  4YEL A;  3LSI A;  2FBI A;  1IXS B;  2R7X A;  3ECO A;  3CLO A;  3KYD B;  3I56 I;  1K83 J;  1O57 A;  4YRV A;  1UHM A;  1XD7 A;  3EUH A;  1JHH A;  1MJB A;  4IXA A;  5LRR A;  3JAM Z;  3VW2 A;  3T8R A;  1H88 C;  1MH4 A;  4OAY A;  2K85 A;  3M8J A;  1K78 A;  4I0A A;  2QOP A;  5DDG A;  1AHD P;  1ZK8 A;  2W57 A;  3NAR A;  2BHY A;  2FEZ A;  1WI3 A;  1WPK A;  2Y31 A;  3JCU C;  2PG4 A;  4NQW A;  1VQ7 I;  3VUQ A;  3HHH A;  3U1K A;  1Z7L A;  5D19 A;  4UUT A;  1FP1 D;  2BHZ A;  1X1B A;  4JNN A;  2QUF A;  2BV6 A;  4OWR B;  1DUX C;  1E2X A;  2NNY A;  2BY2 A;  3I4P A;  4WXH A;  1B8I A;  2DG7 A;  1YS6 A;  1P7J A;  1V4R A;  1DU0 A;  4B4C A;  4M6X A;  4ZDL A;  2ESH A;  3VSK A;  1EJ9 A;  2E2J J;  2HQ5 A;  2LF8 A;  3LWF A;  1OCC H;  3W6J B;  2XDV A;  3TP3 A;  1D0Y A;  2W7N A;  2JK3 A;  1F5T A;  3CP8 A;  2ELH A;  3ZXS A;  4NDL A;  3QPS A;  3VWB A;  1WHU A;  1TNS A;  1MBJ A;  2CMP A;  5L3C A;  4HSR A;  2R5Y A;  5J4V A;  2EZH A;  4AIH A;  1O7L A;  2NOG A;  4ITV A;  5IP6 A;  1CF7 A;  2CW0 F;  2RV8 A;  5J40 A;  3HC7 A;  5K58 A;  4HPQ A;  3FF5 A;  1XMA A;  2JVH A;  3BP8 A;  5J1Y A;  4CCL A;  3CZ6 A;  5H9T A;  2WV1 A;  4BH9 A;  1SFX A;  3CUQ A;  2L9N A;  4OIP F;  2D5V A;  5H2F C;  5FLX K;  5CXI A;  2GZW A;  4Y15 A;  2V1D A;  2JUG A;  1HKT A;  3BR6 A;  1JGG A;  1SFE A;  1IUF A;  3DKX A;  1HST A;  3N4M A;  4IRV A;  4AC6 A;  2GQQ A;  2DDA A;  3ZMD A;  3KCC A;  1T08 B;  1TWC J;  3A01 A;  3HYI A;  1MGT A;  3R4K A;  3JRH A;  4IQ4 A;  1IRF A;  2EWN A;  2F4O B;  1FSE A;  2HZT A;  2YX7 A;  3BR5 A;  3LST A;  1EA3 A;  5EEA A;  5C4X J;  2XGD A;  3G1O A;  3HTA A;  3OOP A;  2CS3 A;  3MKY B;  4OIN F;  3WGG A;  1Q1V A;  1DPR A;  2NP5 A;  1HXD A;  4KT5 C;  4GRI A;  3ZQL A;  4BQO A;  2WWY A;  3G1M A;  1G6N A;  3OS2 A;  2L02 A;  3H5R A;  4OD5 A;  3F72 A;  4UVC A;  3RJP A;  2V57 A;  1DP7 P;  2OI8 A;  1W7P D;  2HPM A;  3B73 A;  4PFO A;  5DD8 A;  5TJJ A;  3QYB A;  3C18 A;  2VKD A;  4D7M A;  3DTE A;  4YFN F;  3J80 Z;  4V2G A;  2PQ8 A;  3D5L A;  1S8N A;  2DTR A;  2QSH X;  2F5F A;  1PUF A;  2OJE D;  3IHU A;  2CW8 A;  1VQM I;  3BPV A;  6PAX A;  2R7V A;  1R22 A;  2VBY A;  4P9U A;  4O3M A;  3RZO J;  2DA6 A;  5DCM A;  1MDM B;  2ID6 A;  3EYY A;  3VFZ A;  3HUG B;  3JRG A;  3LA7 A;  1A36 A;  3K9T A;  1BL0 A;  3CUO A;  1YG2 A;  3JRE A;  3BG7 A;  3JSO A;  3E5U A;  5CYV A;  5HS9 A;  1ZR2 A;  3FXU A;  5M5W J;  1LE8 B;  4I7H A;  2KQR A;  2HYJ A;  2JT1 A;  2QKM B;  3SQN A;  1YIO A;  2IA2 A;  2DK5 A;  5GP9 A;  2EFO A;  3TGN A;  5J8F A;  1HF0 A;  5K5Q A;  4HAM A;  2ECC A;  3EDP A;  3QOE A;  4ESJ A;  2F5V A;  3CP2 A;  3PIO F;  4BHB A;  3E6B A;  3BC8 A;  5D18 A;  2Y0M A;  2JA6 J;  5J6X A;  3M8E A;  2VJI A;  3FM5 A;  1YHQ I;  3IL2 A;  1X3Z B;  4D1Q A;  3I64 A;  1RI7 A;  5FKN A;  3MKZ A;  1ZLK A;  2DG8 A;  3LOC A;  2XB0 X;  4D7N A;  3CCS I;  2BEO A;  2H94 A;  2MFZ A;  4KT6 A;  1T6S A;  3F1B A;  3ZR8 X;  3CJD A;  4JOM A;  5JI6 A;  3LJL A;  3OIQ A;  3FXR A;  1N78 A;  2OAZ A;  3DTI A;  5HDG A;  3ABT A;  5FGL A;  1KQ9 A;  1RR7 A;  2WBM A;  3CDI A;  1LFP A;  2Y2Z A;  3NWS A;  2WAF A;  2L0K A;  3OOU A;  4M6Y A;  4CHU A;  5D4S A;  2M7A A;  4XOT A;  1WJE A;  3CME I;  3PO3 J;  4MGR A;  2ZCM A;  3AQS A;  2FBQ A;  4L62 A;  3V4G A;  1R36 A;  4MIM A;  1N25 A;  2OD5 A;  4B44 A;  5LD2 C;  4HW0 A;  1Y8R B;  4F92 B;  4Z2Y A;  2VQC A;  5GAD J;  2P81 A;  4QPQ A;  2JRM A;  1J09 A;  5JFR A;  2REK A;  2DMQ A;  3G56 A;  5D5X B;  1G3Y A;  1BIA A;  5HBU A;  1QQI A;  4W97 A;  1ON2 A;  3VP5 A;  2EB7 A;  5TGT A;  4UV8 A;  3A2K A;  1AU7 A;  2G0E A;  2DCE A;  4LG3 A;  2IGN A;  1RNL A;  1HW5 A;  2GWR A;  2PMH A;  1PP7 U;  1N77 A;  1BA5 A;  3C7J A;  1XMK A;  1JT6 A;  2LH9 A;  4A12 A;  1YS7 A;  1HW2 A;  3OYG A;  2M30 A;  2UXI A;  1VQ8 I;  2CQK A;  3JRB A;  1BI3 A;  2WB1 A;  4U0W A;  2A05 A;  2KDO A;  2D6Y A;  2VT3 A;  1AKH A;  1XCB A;  4FHT A;  1YJW I;  1F43 A;  4DZP A;  3BR3 A;  5EF6 A;  2NNN A;  3EUK L;  2GIV A;  1MW7 A;  1WCM J;  2E5N A;  3HGG A;  2HYF A;  2GXA A;  4RS8 A;  4OIO F;  2ZY9 A;  4KMU X;  2DAO A;  5F1R A;  3VIB A;  2ZME B;  3CDL A;  5FHP A;  3MVP A;  2E19 A;  1IN7 A;  2VOO A;  3SHF A;  1XGN A;  1S3J A;  2BW3 B;  1T39 A;  5B1A H;  1K7A A;  3AG4 H;  3TO7 A;  4YIF A;  5EGO A;  3T8T A;  4F55 A;  2VE9 A;  4C2M A;  1OFC X;  2XVC A;  2OUM A;  4RLQ A;  5AIP A;  2AQF A;  2A3S A;  1XG1 A;  1KU3 A;  4B09 A;  4LG0 B;  2VN2 A;  2ME0 A;  3DEE A;  5F08 A;  3J7Z I;  2NAZ A;  2ZCW A;  3ECH A;  3TDU C;  2FX0 A;  1Z77 A;  3RIR A;  4EM2 A;  3W6V A;  3LFK A;  2GA1 A;  2VXD A;  4P1W A;  3PNV A;  5L3G A;  4BAC A;  2H8W A;  2R7D A;  2QBY A;  1BI2 A;  1ETQ A;  2MYS A;  1UB9 A;  4EVI A;  3GX4 X;  1FIA A;  3K1M A;  1X1D A;  4KN7 X;  5LEJ A;  2JUC A;  2M4G A;  1QZY A;  3ELK A;  4IHS A;  4XKV A;  3QQA A;  1BR2 A;  2WAD A;  4XR6 A;  3S1R J;  3EUA A;  1FPQ A;  2KZV A;  1E0E A;  3H5N A;  4ENM A;  3WOD F;  5BMZ A;  3KP6 A;  4KA4 A;  1TWG J;  2K4B A;  2XGE A;  3HOZ J;  3KIO A;  3TO6 A;  2LBF B;  3CJQ B;  3LSP A;  2LKX A;  3RCO A;  4HNU A;  5LHH A;  2CUJ A;  3ROU A;  3BTL A;  2DJI A;  2LDU A;  1WI9 A;  4UY8 I;  4AM3 A;  2LOO A;  3L2R A;  2DO7 A;  2HOT A;  4IVN A;  2Q24 A;  3EUP A;  2DYR H;  5D6F A;  1D3Y A;  1JKO C;  3KEO A;  5E3M A;  2F07 A;  1TW3 A;  4BUP A;  2BXZ A;  2XF7 A;  3R0J A;  1RKT A;  4MQV A;  1Z3Y A;  4CO8 A;  2JZY A;  5B5E C;  3MMY B;  1ZAO A;  3VVY A;  2VC0 A;  4Q47 A;  4BE2 A;  4UDS A;  1QHH D;  3WU1 B;  3A4C A;  5KAI C;  4YG2 F;  1X58 A;  2QTQ A;  4XSX F;  3OYA A;  3RPQ A;  2HXO A;  4BBS J;  3MKW B;  2PZ9 A;  3KYC B;  1I27 A;  3OYK A;  5LEK A;  1E3P A;  3GTO J;  4R1H A;  2KFD A;  3G7R A;  4HA8 A;  2DPD A;  3CCY A;  4BY7 J;  3MQ0 A;  2IPQ X;  2VQL A;  3BWG A;  3Q0U A;  2DI3 A;  1VQ6 I;  3GTK J;  1S6L A;  4LK1 F;  5E8I A;  4BE0 A;  3FM3 A;  3DTK A;  2EH3 A;  3K4B A;  4BU2 A;  3I5U A;  2HKO A;  4ZYG A;  1TBX A;  4HF2 A;  1MBK A;  3D5S C;  2MBF A;  5A2Q Z;  4GO1 A;  4C3J J;  3EQL F;  3S2H J;  2CQ7 A;  3KZ9 A;  2QGU A;  5IP9 J;  2Q2E B;  1YYV A;  2ZFW A;  1M1E B;  5HDK A;  1BR1 A;  4U88 A;  3WU2 C;  4U9L A;  3I3L A;  3GLX A;  2R5Z A;  3S17 J;  2MH2 A;  1MSE C;  2EFQ A;  1WJC A;  3WGI A;  2DJN A;  3OSF A;  2NVX J;  3NXC A;  1Y39 A;  1PVE A;  1R58 A;  3H3Z A;  4AF5 A;  1ETY A;  2XAS A;  5IT9 Z;  1W7P B;  4IKF A;  1IXR C;  2EIK H;  3GO5 A;  2X6O A;  4AVP A;  2L7M P;  5D8K B;  4IHW A;  2X48 A;  2M5W A;  5KK1 A;  4XRM A;  1EH8 A;  1OKR A;  1XB4 A;  1A04 A;  2HOE A;  3BR1 A;  5CKT A;  5BNG A;  2V1N A;  5H6Q A;  2BY1 A;  4L5I A;  3L7W A;  2P4W A;  4Q4Z F;  1Z21 A;  1OCT C;  3LNQ A;  3DLA A;  5HNH A;  1LVK A;  2VKH A;  3TQN A;  4KYW A;  1NK3 P;  5CVV A;  1JTX A;  1IV6 A;  2PJR A;  1YI2 I;  1X3U A;  1ZR4 A;  5IT3 A;  4IRH A;  5F0F A;  1SMY F;  1Z6T A;  2O6G E;  4BJ6 C;  3DFG A;  2VC1 A;  4P9F A;  4PJM A;  1QBJ A;  9ANT A;  2DT7 B;  2M0M A;  1W36 C;  2HPI A;  3MD2 A;  4HQE A;  2K4J A;  3W2V A;  3CES A;  3BPX A;  4JQF A;  1H89 C;  3BJB A;  2ZKZ A;  4LD5 A;  2FE3 A;  3ZMZ A;  3I4M J;  3V7C A;  2HQA A;  4XLN F;  2FBK A;  3H1C A;  3UNG C;  3G4S I;  3CUQ C;  1Y0N A;  5LRS A;  1UMQ A;  1FOK A;  1U9O A;  1BOA A;  1IGN A;  5M3F J;  1UCR A;  2P0W A;  2A2F X;  5DD4 A;  3I58 A;  3M9A A;  4M3E A;  4RGX A;  3W3C A;  5FRN A;  5FKK A;  1AWC A;  3GTP J;  2O7T A;  2DA2 A;  3DPU A;  4E7H A;  4W1U A;  3SFZ A;  1JXS A;  1B1B A;  3OYN A;  5CXG A;  1T98 A;  4S05 A;  4A3D J;  3I9V 2;  2JSP A;  4HG2 A;  5DV5 A;  1LUJ B;  1U8B A;  2RGV A;  2XPW A;  1SVM A;  4PCQ A;  1JUP A;  2DT5 A;  1RUN A;  4UB8 C;  2VPL A;  4JYK A;  3PJR A;  4DVY P;  2QCO A;  1RR8 C;  3HJE A;  2LNB A;  3KP4 A;  3DQV C;  1POG A;  1BC8 C;  2JPC A;  3VOK A;  5E1W A;  3HTU A;  3H36 A;  3EGQ A;  5GAE J;  2OZU A;  1BW5 A;  3IH2 A;  3K70 D;  2RNG A;  1NHA A;  2M45 A;  1JE8 A;  3Q0V A;  1I39 A;  2JA2 A;  5CVU A;  2B9S A;  3K6G A;  1HBX G;  4CDG A;  3ABM H;  2IGK A;  2V79 A;  1HLV A;  1KQ0 A;  1W5C C;  2FRH A;  3IAS 2;  5K7Z A;  1FOX A;  5D4R A;  1G3S A;  1OQY A;  1TQM A;  3GTJ J;  2FSW A;  4M9Z A;  3L09 A;  3K4L A;  2VON A;  3V78 A;  5JVT A;  2EFW A;  2X6Y A;  2HTS A;  1RES A;  2JJ7 A;  5ILV A;  1V3F A;  4LLL A;  2CG4 A;  3KZI C;  1B72 B;  4V2F A;  3TMO A;  4XKW A;  3OYF A;  2DA3 A;  3GW2 A;  4FX4 A;  1XGM A;  3QOP A;  4M71 A;  4F3Q A;  3HTH A;  3FDY A;  4Z6Y A;  3H9G A;  4O5V A;  4PJL A;  3GTL J;  3TKY A;  1ZAR A;  2CRG A;  3I55 I;  3HTJ A;  3ERE D;  3S93 A;  1GLN A;  4IJA A;  1W1W E;  2WY8 Q;  1KYW A;  5AIQ A;  3DPJ A;  5E20 A;  1T95 A;  3K1P A;  4MHG A;  1IO2 A;  1TC3 C;  2H1K A;  5E3O A;  2X4H A;  1FC3 A;  4L9V A;  3S3O A;  1ZG5 A;  2R7Z J;  2ELK A;  3K7A J;  4NN1 A;  3FBN B;  1WKM A;  2MC3 A;  4ESB A;  3HOY J;  3RSN A;  1PUE E;  2EV6 A;  4CXF A;  1ETK A;  3Q3S A;  2WB1 N;  3S32 A;  2FNP A;  2WUI A;  2M4K A;  3WTZ A;  4ENK A;  2XAF A;  1BR4 A;  5BOX A;  2HXI A;  1V5F A;  2LF7 A;  1WJF A;  2L9V A;  1SFU A;  4IOA F;  2K9Q A;  2GXG A;  3CMY A;  4G94 A;  3DV8 A;  1D0X A;  2LRD A;  3S16 J;  3CCL I;  3F9K A;  1J2X A;  2K02 A;  3A0H C;  2P7C B;  3S5R A;  5JHF A;  2YSR A;  1I5Z A;  5IY5 H;  2O5R A;  5EG0 B;  3BZC A;  4BJ5 C;  5EEH A;  1T33 A;  4U9N A;  3O6B B;  3FXJ A;  4XLE A;  2E1C A;  1NTC A;  2LKP A;  1VQP I;  3O8H A;  3F0C A;  2A5Y B;  4BJT A;  3SJM A;  1YRN A;  2LR8 A;  2KMU A;  3PFI A;  3CCE I;  1QVU A;  3CCR I;  4G9Y A;  3O2P E;  4MO7 A;  4NEL A;  4MLO A;  3ONQ A;  2UUZ A;  1ZQ3 P;  5JLW A;  2FXA A;  2HEO A;  2HYT A;  4E4H A;  2HS5 A;  2A68 F;  2OTJ I;  1ULY A;  1FLI A;  1UJ8 A;  3JRI A;  2HDW A;  2OPT A;  2IW5 A;  3Q9V A;  2XKO A;  3IAM 2;  3JTG A;  4NC7 A;  3FRQ A;  2QIB A;  1TWA J;  4YEJ A;  3PM1 A;  1RIO H;  4I2O A;  2VPR A;  1PP8 F;  1S7O A;  2K9N A;  3RKW A;  3ZRG A;  4B43 A;  4BKX A;  1XDS A;  1UHS A;  3GZN B;  4YFX F;  4OIQ F;  4II2 A;  4HNT A;  1WJB A;  4H0E A;  1S7A A;  4UB6 C;  2FBH A;  1Y56 A;  4M73 A;  5CVR A;  1BN5 A;  4XK4 A;  1WFX A;  1OPC A;  4LK0 F;  4XL9 A;  2XC7 A;  3ABK H;  1FY7 A;  3COA C;  4LB6 B;  3QAH A;  3K1N A;  3PUB A;  3ZQF A;  1LB2 A;  3QPH A;  4KIS A;  4M3F A;  4G7H F;  1ORK A;  2VJJ A;  2Z1D A;  1H8A C;  2V7F A;  3CJT B;  3KP3 A;  3VOX A;  3FXK A;  1O7F A;  1STZ A;  2EPF A;  4A3G J;  3BOQ A;  1ETV A;  2ZBK A;  5HLT A;  1OYW A;  2DQL A;  3KET A;  4GCK A;  2FQ4 A;  3A1Y A;  3HTS B;  2ZSH B;  1FNN A;  4LIV A;  4A3J J;  2FJ1 A;  3JR9 A;  2FA5 A;  3BG3 A;  2O61 A;  1ZHF A;  5FGM A;  2M0C A;  3GTM J;  4GGG A;  1IRG A;  3WG9 A;  1FOW A;  1MBG A;  3K2Z A;  2NVU B;  2CV1 A;  4HX8 A;  3MZH A;  1TT0 A;  5B1B H;  2O3F A;  5E17 F;  1FMW A;  2HZD A;  4EM1 A;  2CH0 A;  4EGZ A;  3KEQ A;  5ICG A;  3MNL A;  2BGC A;  2LYC A;  3F8M A;  2G7L A;  2DYS H;  2IS4 A;  4I99 C;  2VLA A;  3NWT A;  1R5H A;  4FIS A;  4A3F J;  3D1N I;  5HDN A;  4EGY A;  5CLS A;  2R7Q A;  2ZJP F;  2MC4 A;  4RGR A;  2DA4 A;  2M8G X;  4MTD A;  1FYM A;  1I3Q J;  2LSO A;  2HNH A;  4BL0 B;  2DPU A;  2CW7 A;  1I1G A;  1MMA A;  4HX7 A;  3WGH A;  5K7H A;  2OV7 A;  4NHJ A;  4XOP A;  1GV5 A;  2XB5 A;  3HOU J;  4XN0 A;  2Z33 A;  2E1O A;  2O9L A;  2JA8 J;  2RQP A;  1BC7 C;  2QM3 A;  2B63 J;  1YW7 A;  4AD9 A;  3HRU A;  1VF9 A;  4S0H B;  3DWL E;  5E3L A;  5E79 C;  3ANG A;  4BXF A;  2KP6 A;  4NUB A;  3RTR A;  3T0Y A;  3OIO A;  1R49 A;  1E17 A;  2KDZ A;  1SAX A;  4HKU A;  3AQT A;  5EDN A;  4A0Y A;  3ZQC A;  2R7F A;  2QA4 I;  3KP2 A;  3DPT A;  3M4O J;  2DMT A;  2H6B A;  2R7O A;  3F8C A;  4XLF A;  5CQE A;  1YW9 A;  3ANP A;  4G8X A;  4KNY A;  4WXC A;  2NRA C;  1IN6 A;  2A5W A;  2W1O A;  1A35 A;  1SFK A;  3K4C A;  3ZQH A;  1MD0 A;  4M6V A;  3IKV A;  3OV8 A;  2O0Y A;  1Y1V J;  4ESF A;  1JJ6 C;  3MCZ A;  5CVJ A;  2E2I J;  2HFH A;  3KFW X;  3WU0 A;  2VKV A;  4K2E A;  4BDY A;  2VJ4 A;  2XIG A;  1SFO J;  4Y3O A;  1FBQ A;  3M1C A;  4BDZ A;  3S2D J;  2R7W A;  3G2B A;  5FFX A;  1S72 I;  1J59 A;  3BT9 A;  3ULQ B;  1B9N A;  1FSH A;  5HOO A;  3HUG A;  4LB5 A;  3KLN A;  3HIF A;  1EF4 A;  3FXM A;  3FKJ A;  4MQ9 F;  5ED4 A;  4HQM A;  1K6O A;  3FBI B;  4ZJZ A;  3TBI A;  2EZK A;  2MLK A;  3IH4 A;  3ZOB A;  2FU4 A;  3BZK A;  4AYB A;  4B8X A;  4XBF A;  4QLC U;  1ACI A;  4MTE A;  3CMA I;  3BCB A;  4KDP A;  1T38 A;  2G7H A;  3FMR A;  3OWT A;  3CCJ I;  2KIQ A;  2DMP A;  2L2O A;  2X6W A;  3QP5 A;  4RGU A;  4EMS A;  4HDV A;  1P9Q C;  4F91 B;  3P9K A;  2ZXI A;  2AHQ A;  2PEX A;  2RKH A;  2ME6 A;  2R0Q C;  1IAW A;  1REP C;  5CJ9 A;  4XOR A;  1G3T A;  1R23 A;  2F5E A;  3FKI J;  4MK6 A;  4M9X A;  1XDU A;  3LSM A;  3WHC A;  2H09 A;  2CO5 A;  2H8R A;  5ERI A;  2E35 A;  4Y17 A;  5IYD J;  3ZQ7 A;  4IRI A;  1FOY A;  1SVL A;  3L2V A;  4FQG A;  1XN7 A;  2DQR A;  3QOD A;  1XTA A;  4E7L A;  1XCV A;  4C3I J;  2W82 A;  1VQN I;  4U7D A;  3A03 A;  3E6C C;  4U7B A;  1E3O C;  1IRX A;  3VSL A;  3HXL A;  3BTC A;  3HZJ A;  5LHI A;  2GOM A;  4ZTF A;  3RD3 A;  3IRR A;  4IRG A;  1D1C A;  1D8K A;  4WK8 F;  2IS1 A;  2R7U A;  1Z1D A;  1LJ9 A;  2P6T A;  4OMY A;  5F27 A;  1EKE A;  2PFV A;  4WIB A;  4JX5 A;  2IA0 A;  1I6H J;  3GVA A;  1QPM A;  3KYL A;  5L3B A;  1D5V A;  3BHQ A;  3E3V A;  2E2H J;  3J81 K;  1PUF B;  5H6R A;  2IU5 A;  4XNF A;  4DW6 A;  2WGB A;  3HRS A;  5LHG A;  3LSH A;  3AL0 C;  5E8G A;  5C3E J;  1K61 A;  2WC2 A;  3M7G A;  4DJA A;  2ZJQ F;  3RPU D;  4AIJ A;  2ZNZ A;  3RKX A;  3LSG A;  2GLO A;  4A5M A;  2XF6 A;  3W2W A;  3OS0 A;  2ZOY A;  2Z5U A;  1YO5 C;  3VVZ A;  3HM5 A;  1GDT A;  2I5U A;  4I0B A;  5C44 J;  1H9G A;  4EAT A;  2OTL I;  2WTE A;  4ACI A;  2BE5 F;  4PFP A;  2UV1 A;  5FD5 A;  4DYQ A;  4FCY A;  3SWH A;  4CCO A;  5EYR A;  2E1M B;  2W85 A;  5K7F A;  4XID A;  2CFX A;  1Z3X A;  4ZDP A;  4Y33 A;  1FBU A;  1SD5 A;  3FIW A;  2ZME A;  2VI6 A;  2XSD C;  1ZRF A;  3VW0 A;  1I6X A;  2D1H A;  4MFE A;  1YIJ I;  2XRO A;  1YLF A;  2BW3 A;  2IRF G;  3PIP F;  1RZ4 A;  2P8T A;  1WZ2 A;  4RM3 A;  4XM3 A;  3H9J A;  4EJT A;  3H3U A;  5A2Q K;  4M3B A;  4DZJ A;  4AID A;  1O3T A;  4U0V A;  1H0M A;  2N8G A;  4LG0 A;  3E5Q A;  2OBP A;  2H6C A;  1BJZ A;  5M3M J;  2AXT C;  4BE1 A;  3KNW A;  1U5T B;  2JMW A;  4IOC F;  4NNJ A;  1SAU A;  5FLX Z;  5FO5 A;  2G7U A;  2F48 A;  2STW A;  1P2F A;  2Z16 A;  1JKQ C;  2V6C A;  4KIF A;  1IRZ A;  2HOS A;  2B1E A;  2M3A A;  2VBX A;  3BR2 A;  3BY6 A;  4UUS B;  2MSY A;  2MLG A;  1KZH A;  2DOE A;  2HKU A;  4ZC3 A;  3GBG A;  1WRJ A;  1ZYR F;  3CTA A;  1S5L C;  4HDU A;  3KPH A;  2GIZ A;  2UZK A;  2W00 A;  3NNR A;  5LFA A;  2RVC A;  2Y75 A;  2QQB A;  1ZTR A;  4P96 A;  3U2R A;  3TW6 A;  2LY2 A;  4KIC A;  4AVZ A;  2LBF A;  1OIS A;  2Y0S N;  3IKT A;  3AFH A;  1VZ0 A;  2EIM H;  4J00 A;  2E60 A;  1VND A;  3L2Q A;  2B3W A;  1HKS A;  4LGW A;  4U87 A;  2F5C A;  1R71 A;  4CCM A;  3BRU A;  3QYF A;  2HGC A;  4BEH B;  2X9D A;  1Y6I A;  3VOD A;  3L2W A;  4PXI A;  2WAQ N;  3G73 A;  2ZCN A;  3AG3 H;  3Q5F A;  4UVA A;  5D5U B;  4I98 B;  1J75 A;  1IC8 A;  4CCJ A;  3OYI A;  4JX6 A;  4PDK A;  2YX4 A;  2OQG A;  2JRT A;  1U2W A;  3WTT C;  5F6F A;  3JRA A;  2IT0 A;  1MMN A;  3QP6 A;  3NI7 A;  5EGO B;  3UKG A;  3FIS A;  5HOD A;  3GTG J;  1RC9 A;  2R7T A;  3BTI A;  1SD6 A;  1EH7 A;  3L1P A;  4Y13 A;  3ABU A;  1K6Y A;  1HOM A;  5DUI A;  3RI4 A;  3KX2 A;  4XKC A;  3BJ6 A;  1LKX A;  2OA4 A;  5GPA A;  3R6S A;  2VOD A;  1OLT A;  1SD4 A;  1ETX A;  1P4W A;  2QEX I;  3IH3 A;  3GEU A;  2QQ8 A;  4CCK A;  1XPX A;  1IF1 A;  2LD5 A;  2MGQ A;  2M2E A;  5JLX A;  1G3W A;  2CV2 A;  4CCN A;  2D45 A;  2F6C A;  3WE3 A;  4KFC A;  4CA0 A;  4N4O B;  3KKC A;  2NVT J;  5DUK A;  3EPZ A;  3FX3 A;  2QBY B;  1QVT A;  3F22 A;  4C30 A;  4RB2 C;  4UHT A;  5IOY A;  3HB9 A;  4IHV A;  4IHX A;  1TWH J;  3CMM A;  3J7A O;  4XLA A;  5GTH C;  2VJ5 A;  3K8P C;  4ZH4 F;  4Y7N J;  2HKX A;  2DTZ A;  3GFI A;  3S1N J;  3I59 B;  3CQZ J;  4HX4 A;  5DM7 F;  2OER A;  3GFM A;  2P7V B;  4KJZ A;  4ICH A;  2LLK A;  3CWR A;  2EQR A;  1W7P A;  1LVA A;  1UST A;  1ZG1 A;  3CCU I;  2COM A;  4UUV A;  2D2W A;  4Y4R A;  2KJB A;  3B81 A;  2K3F A;  4IZZ A;  4GFK A;  1ZGW A;  2VUM J;  4G6T B;  3WTY C;  1UAA A;  2EJR A;  2ELJ A;  3DEU A;  5KCM A;  1PDN C;  5FKM A;  1QZZ A;  2X1E A;  1B59 A;  1P92 A;  4OAZ A;  3AG2 H;  2XF5 A;  1UHW A;  2M9H A;  3JSJ A;  2M34 A;  1F4K A;  3E6D A;  3F8B A;  1OR7 A;  5J1U A;  3BJA A;  2Z2S B;  2E7X A;  3ON4 A;  1B4A A;  4HF1 A;  3QYE A;  3KEY A;  1ZLJ A;  3B6C A;  3REO A;  2FNA A;  5J1R A;  1BI0 A;  1SMT A;  4X1E A;  4I6Z A;  1H9T A;  4ZYA A;  5B3S H;  3C3W A;  1L0O C;  2DOF A;  3OYM A;  3CC7 I;  2OCC H;  5EZG A;  1DP3 A;  3HIM A;  2JWT A;  3HSR A;  2XDN A;  3BCG A;  1P6R A;  4PSX A;  1VQL I;  3D0S A;  3LAJ A;  1XC5 A;  2BBY A;  4AU7 A;  2R3S A;  3LSR A;  4HRI A;  2BYV E;  3E7L A;  1OCZ H;  4B48 A;  3M3Y J;  3PPB A;  1W0U A;  1X4P A;  4ASN A;  2QEN A;  4RB0 A;  4LLN A;  2PFB A;  2K5C A;  1ZGA A;  1HDD C;  1QU3 A;  4D5F A;  4JKZ A;  4PJ0 C;  3ASO H;  1E3H A;  3RQI A;  3M07 A;  4HYE A;  4RMN A;  5HLH A;  3PO2 J;  3MWM A;  1TLH B;  2JA5 J;  5D5W B;  4RB3 C;  3HKZ A;  4ZYE A;  4H4K C;  1JTY A;  3DBL B;  2XSJ C;  4G7Z F;  1WGX A;  2F4I A;  3FHN A;  4B3A A;  3X2Q H;  4R79 A;  2L9R A;  5KHD A;  2R5Z B;  3NEU A;  2KZG A;  4L5E A;  1WJD A;  2VQG A;  3U9G A;  4DBQ A;  2OQR A;  4FAS D;  4HNV A;  4RDU A;  1FP2 A;  2QLZ A;  4BNC A;  5M5X J;  1J0R A;  4BXU A;  2XGC A;  4I09 A;  1KU2 A;  2COB A;  5AON A;  5LGN A;  2W25 A;  2JA7 J;  1W36 D;  1GXQ A;  4ENJ A;  1JGS A;  3BG6 A;  4B1R A;  5KVR A;  2DA5 A;  3M8F A;  1S29 A;  2PMZ A;  2RC4 A;  1Z7U A;  2MW8 A;  2YVE A;  1F9N A;  3K10 A;  3H35 A;  2GA2 A;  1LDJ A;  2DOD A;  4A69 C;  2QKO A;  3CRJ A;  4DYR A;  2K9M A;  1DGR M;  2QWW A;  1WJ5 A;  3OYB A;  2V9K A;  3QKX A;  1B72 A;  2PJR B;  2CV0 A;  4PUS A;  2KL4 A;  1A5J A;  4KWA A;  1I50 J;  3HPH A;  4NBQ A;  3SZT A;  5EZH A;  5FD6 A;  3JAM K;  2ZOZ A;  1TT5 B;  1WVR A;  1S9H A;  2DK8 A;  2UXP A;  5K5O A;  2LK2 A;  2LP0 A;  1VQO I;  4HOB A;  4P55 A;  1YX3 A;  1HQC A;  2K27 A;  1X19 A;  2A07 F;  4C9Y A;  2W84 A;  5IYB J;  2EIL H;  4Q5S F;  1SD7 A;  1V55 H;  2UXN A;  3QU3 A;  3ZP5 A;  1OCR H;  4E7J A;  2FMY A;  1R4M B;  2PJP A;  5HS7 A;  1V5G A;  4KUM A;  1GT0 C;  2DW4 A;  2QQA A;  4C2M J;  3JRF A;  4Y52 J;  3V7S A;  4JK1 X;  1YJ9 I;  4XRF A;  2KPM A;  2L4A A;  1FTT A;  4M3D A;  4A6D A;  1A31 A;  1R1V A;  4YFK F;  2EZL A;  2XUB A;  2KIM A;  1UG0 A;  4A3M J;  2J5O A;  1HC8 A;  2WA0 A;  4PK4 A;  2DFH A;  3DLL F;  5CVI A;  1R9T J;  1IXC A;  3E6M A;  4DYC A;  5LBQ A;  3BRO A;  2LG4 A;  4RGS A;  2HVS A;  1ITY A;  1Y8Q B;  1Q1H A;  2HOA A;  2L3D A; 
#chains in the Genus database with same CATH homology
 5F1J A;  2DA4 A;  2M8G X;  4MXM A;  5F0C A;  1I3Q J;  2P81 A;  5K7H A;  1TWF J;  2ID3 A;  2REK A;  2DMQ A;  3G56 A;  1GV5 A;  2XB5 A;  2Y9Y A;  3HOU J;  5HBU A;  4W97 A;  3VP5 A;  2E1O A;  1GV2 A;  2O9L A;  2JA8 J;  2B63 J;  1AU7 A;  2UXH A;  2G0E A;  2NVY J;  1VF9 A;  4S0H B;  2XPU A;  5E3L A;  4BBR J;  3ANG A;  3PAS A;  1BA5 A;  1JT6 A;  3OIO A;  1RPW A;  5C4Y A;  2KDZ A;  4HKU A;  2UXI A;  1SGM A;  5EDN A;  3JRB A;  3ZQC A;  2QWT A;  3AQT A;  3ON2 A;  2RAE A;  2IBD A;  2D6Y A;  2RHA A;  1AKH A;  3M4O J;  3MN2 A;  2KT0 A;  1F43 A;  2DMT A;  4DZP A;  5DTD A;  4FTH A;  3BR3 A;  5EF6 A;  3ANP A;  3GZI A;  3VPR A;  1WCM J;  3HGG A;  5FKL A;  3ZQH A;  5HAW A;  4M6V A;  3VIB A;  3CDL A;  5DAJ A;  1Y1V J;  5FHP A;  3BR0 A;  2E2I J;  3MVP A;  2E19 A;  2VKV A;  1UI6 A;  2GUH A;  1SFO J;  5C4J J;  2RAS A;  3HBL A;  3S2D J;  5EGO A;  2DN0 A;  1HDP A;  3BT9 A;  1OFC X;  2CQQ A;  2GBY A;  4AYB N;  1XG1 A;  4IHY A;  3TP0 A;  2GM4 A;  1EF4 A;  4XIC A;  3O8G A;  4AC0 A;  2ME0 A;  4JP0 A;  5F08 A;  2EZK A;  3IH4 A;  3ZOB A;  1LFB A;  2FX0 A;  1Z77 A;  3W6V A;  1MBH A;  3I4N J;  5J3L A;  5F04 A;  2PBX A;  1JJ8 C;  1ENH A;  2DMP A;  2XPV A;  1ETQ A;  3SFI A;  1FIA A;  3DEW A;  3H0G J;  2AHQ A;  2ME6 A;  1F36 A;  2R0Q C;  3OSG A;  2I10 A;  1BW6 A;  3FKI J;  2LVS A;  2DMN A;  3C2B A;  5FJ8 J;  3QQA A;  4MK6 A;  2ZB9 A;  3WHC A;  3HE0 A;  3S1R J;  3HOV J;  1DU6 A;  2H8R A;  1VFC A;  5IYD J;  1O4X A;  4BXX J;  4QSH A;  2W48 A;  3E7Q A;  1JKP C;  1SAN A;  4CYC B;  4C3I J;  4FE7 A;  1TWG J;  3HOZ J;  2EZI A;  2VKE A;  2XGE A;  3A03 A;  1OCP A;  1P7I A;  3LSP A;  2LKX A;  1E3O C;  4QTR A;  2DMU A;  3BTC A;  3BTL A;  1Y1W J;  1WH5 A;  3RD3 A;  1FIP A;  1MH3 A;  2HI3 A;  1QPI A;  5FLV A;  1MBE A;  1CQT A;  2TCT A;  4GCL A;  5F27 A;  2YVH A;  2HOT A;  2YU9 J;  2Q24 A;  3EUP A;  1JKO C;  4IEJ A;  5E3M A;  2F07 A;  3H3V K;  4JX5 A;  2NS7 A;  2G7G A;  1I6H J;  1RKT A;  3BHQ A;  5FLM J;  2E2H J;  1PUF B;  3S15 J;  3HTI A;  2IU5 A;  5IP7 J;  3BNI A;  2Y30 A;  4DW6 A;  1GVD A;  2WGB A;  3VVY A;  4A3I J;  4A3B J;  5C3E J;  3S1Q J;  3DCF A;  1K61 A;  4UDS A;  2GLO A;  2W53 A;  5D1R A;  3LSG A;  1X58 A;  4J19 A;  2QTQ A;  2ZOY A;  2G3B A;  3VVZ A;  2UXU A;  3HM5 A;  5AQC A;  1GDT A;  2HXO A;  4BBS J;  5C44 J;  2PZ9 A;  1FJL A;  4ACI A;  4C3H J;  4D5C A;  1MBF A;  4DYQ A;  3GTO J;  3G7R A;  4FCY A;  3KKD A;  5EYR A;  3CCY A;  3RKQ A;  4BY7 J;  5K7F A;  4XID A;  3S1M J;  3Q0U A;  2XSD C;  3VW0 A;  3A02 A;  3FIW A;  2VI6 A;  3GTK J;  1U78 A;  2MG4 A;  5EG0 A;  1ETW A;  1RET A;  4MFE A;  2EH3 A;  4JL3 A;  2QF7 A;  1S7E A;  1VI0 A;  4CGR A;  5HSZ A;  1MBK A;  3KZ9 A;  3JRD A;  4C3J J;  3S2H J;  5IP9 J;  1GUU A;  4M3B A;  4DZJ A;  1XS9 A;  3HOX J;  2R5Z A;  3S17 J;  1B8I B;  4A3C J;  2N8G A;  1MSE C;  3OSF A;  2NVX J;  2DJN A;  3NXC A;  1BJZ A;  5M3M J;  4AF5 A;  1ETY A;  3KNW A;  2JMW A;  4GFB A;  1MSF C;  2X6O A;  2L7M P;  1Z0X A;  4I76 A;  4IHW A;  1JKQ C;  2X48 A;  2ECB A;  1IRZ A;  2HOS A;  4XRM A;  1OJL A;  3ZQI A;  3BR1 A;  4A3K J;  4FE4 A;  5BNG A;  3BR2 A;  2R5Y B;  4UUS B;  2MSY A;  2XRL A;  1JJ6 C;  2IEK A;  2HKU A;  2LY9 A;  3GTQ J;  2O8K A;  3GBG A;  4GCT A;  1OCT C;  3BTJ A;  3LNQ A;  1IDZ A;  3T6N A;  1X2N A;  3TED A;  3NNR A;  3BQY A;  1NK3 P;  1LE8 A;  1JTX A;  1IV6 A;  3HKZ N;  1ZTR A;  3TW6 A;  4XRS A;  3BG9 A;  4CYC A;  2IAI A;  1ZR4 A;  3COL A;  1LFU P;  1RKW A;  5F0F A;  3WHB A;  2TRT A;  5FMP A;  2Y0S N;  9ANT A;  3Q0W A;  1UI5 A;  1VND A;  5GPC A;  1WH7 A;  2YS9 A;  1H89 C;  3BJB A;  2L7Z A;  3BQZ A;  3BRU A;  3I4M J;  3A01 B;  2X9D A;  3TW7 A;  2CU7 A;  4X6A J;  3K2A A;  4PXI A;  2WAQ N;  2ZCN A;  1UMQ A;  2CUE A;  1U9O A;  1IC8 A;  2EBI A;  3S14 J;  1MNM C;  1IGN A;  1A6I A;  4JX6 A;  5M3F J;  4JX4 A;  4M3G A;  1JUM A;  2FD5 A;  2PMZ N;  3JRA A;  4M3E A;  2GFN A;  4XRS G;  3BG5 A;  1YRN B;  5DS9 A;  3NI7 A;  5FKK A;  5EGO B;  3UKG A;  3GTP J;  3FIS A;  5HOD A;  2DA2 A;  3GTG J;  3HOW J;  2O7T A;  1T56 A;  3BTI A;  4W1U A;  3L1P A;  5CXG A;  1HOM A;  5GPA A;  4A3D J;  1K83 J;  1ETX A;  1U8B A;  1APL C;  3IH3 A;  3QPL A;  3GEU A;  2XPW A;  1JUP A;  2MGQ A;  2LD5 A;  4JYK A;  2M2E A;  2YUS A;  5JLX A;  2QCO A;  1IJW C;  3VW2 A;  4EEF G;  1H88 C;  1MH4 A;  1POG A;  3KKC A;  2NVT J;  1UG2 A;  3VOK A;  4LOC A;  3EGQ A;  1QVT A;  2QOP A;  1BW5 A;  3IH2 A;  1AHD P;  1ZK8 A;  5IOY A;  3NAR A;  1WI3 A;  1WPK A;  2Y31 A;  3HB9 A;  3Q0V A;  1W0T A;  4IHV A;  4IHX A;  3VUQ A;  2AO9 A;  5D19 A;  1TWH J;  3QBM A;  4UUT A;  4JNN A;  1HLV A;  1JT0 A;  1IDY A;  5K7Z A;  2L7F P;  1FEX A;  3GTJ J;  3ZQG A;  1B8I A;  1JUS A;  1ZKG A;  2DTZ A;  4Y7N J;  2DG7 A;  1P7J A;  3S1N J;  2NX4 A;  1RES A;  3V78 A;  3VW1 A;  3CQZ J;  1DU0 A;  2JJ7 A;  4B4C A;  1HCR A;  2OER A;  4ICH A;  3HEF A;  4A93 J;  1B72 B;  4V2F A;  2CUF A;  2DA3 A;  4ABZ A;  2LLK A;  2E2J J;  2EQR A;  3CWR A;  2HQ5 A;  3TP3 A;  3HTH A;  3GTL J;  3B81 A;  2R92 J;  4GFK A;  1ZGW A;  2VUM J;  2JK3 A;  2CRG A;  2DA7 A;  3HTJ A;  4NDL A;  3QPS A;  2OF7 A;  5FKM A;  5E3N A;  1X2M A;  1MBJ A;  1ETO A;  2R5Y A;  3DPJ A;  2EZH A;  4UUS A;  2M9H A;  3JSJ A;  2M34 A;  1TC3 C;  5J1U A;  5E3O A;  2H1K A;  2NOG A;  5IP6 A;  3ON4 A;  5K58 A;  3NAU A;  2R7Z J;  2ELK A;  5J1R A;  3B6C A;  3K7A J;  4NN1 A;  2CJJ A;  4I6Z A;  4X1E A;  5J1Y A;  3HOY J;  4QIW N;  5H9T A;  2WV1 A;  4ME9 A;  3LWJ A;  1ETK A;  3Q3S A;  5EZG A;  2WB1 N;  2WUI A;  2D5V A;  5CXI A;  3HIM A;  2JWT A;  3RH2 A;  2XDN A;  3VVX A;  2HXI A;  3BR6 A;  3BCG A;  1JGG A;  1XC5 A;  1IUF A;  3IUV A;  1JKR C;  4AC6 A;  3SDG A;  3LSR A;  2K9Q A;  3NRG A;  2K40 A;  3CMY A;  1TWC J;  3A01 A;  3E7L A;  3M3Y J;  3JRH A;  5IPA A;  2NVQ J;  3S16 J;  3PPB A;  1QRY A;  3S5R A;  1W0U A;  3BR5 A;  5EEA A;  1NK2 P;  5C4X J;  5EG0 B;  5M5Y J;  2XGD A;  3G1O A;  3HTA A;  1HDD C;  2R93 J;  1T33 A;  4D5F A;  2ZCX A;  3V6G A;  5EFY A;  4JKZ A;  1NTC A;  1Q1V A;  3RQI A;  2CQX A;  3O8H A;  3F0C A;  3PO2 J;  3SJM A;  2NP5 A;  1YRN A;  4BY1 J;  2JA5 J;  3ZQL A;  2LR8 A;  4G12 A;  1QVU A;  3G1M A;  4MO7 A;  3NPI A;  4NEL A;  4MLO A;  1AKH B;  1JTY A;  1ZQ3 P;  1U9N A;  1WGX A;  5JLW A;  4B3A A;  2R5Z B;  2GEN A;  2HYT A;  2L9R A;  2V57 A;  2G7S A;  5CW8 A;  2OI8 A;  4L5E A;  3JRI A;  2OPT A;  4HNV A;  4RDU A;  4D7M A;  1D5Y A;  4V2G A;  5M5X J;  3FRQ A;  2XGC A;  2QIB A;  1TWA J;  3P9T A;  2COB A;  3PM1 A;  3IV5 A;  4RBO A;  2JA7 J;  2VPR A;  1IG7 A;  1PUF A;  2K9N A;  4A3E J;  4B1R A;  4BKX A;  4GFL A;  3JRC A;  1UHS A;  2DA5 A;  3HGY A;  2O7O A;  2MW8 A;  2DA6 A;  3MKL A;  3RZO J;  2YVE A;  2ID6 A;  3JRG A;  1G2H A;  3RZD J;  2UXO A;  3LHQ A;  4A69 C;  1BL0 A;  3JRE A;  2JN6 A;  3LSJ A;  2QKO A;  3CRJ A;  3FK7 A;  4XK4 A;  4DYR A;  3O60 A;  1ZR2 A;  5M5W J;  1LE8 B;  2HYJ A;  3QKX A;  3ZQF A;  2DA1 A;  4AUX A;  1B72 A;  2K9S A;  4M3F A;  1A5J A;  4KWA A;  1ORK A;  2HDD A;  1I50 J;  5GP9 A;  1H8A C;  3VOX A;  5EZH A;  5F0H A;  2ZOZ A;  1HF0 A;  4A3G J;  1ETV A;  2ECC A;  2UXP A;  5FKO A;  1FTZ A;  2LK2 A;  3C07 A;  2LP0 A;  2LFB A;  4MFD A;  5IYB J;  5D18 A;  4GCK A;  2JA6 J;  2FQ4 A;  3HDD A;  4A3J J;  2FJ1 A;  3JR9 A;  3BG3 A;  5FKN A;  2NS8 A;  2DG8 A;  3LOC A;  2XB0 X;  2M0C A;  1GT0 C;  3GTM J;  4D7N A;  4C2M J;  5IYC J;  3JRF A;  4Y52 J;  1MBG A;  3F1B A;  3CJD A;  2NP3 A;  2LTP A;  3B6A A;  3LJL A;  3G1L A;  1FTT A;  4M3D A;  5FGL A;  1RR7 A;  2EZL A;  2Y2Z A;  3FK6 A;  3MNL A;  2L0K A;  3OOU A;  4A3M J;  5IOZ A;  4L62 A;  3PO3 J;  2G7L A;  3AQS A;  2ZCM A;  2FBQ A;  2Y9Z A;  1R9T J;  4DYC A;  4FIS A;  4MIM A;  3D1N I;  4A3F J;  1ITY A;  4A3L J;  4YZE A;  2HOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...