4NN1A

Crystal structure of transcriptional regulator rv1219c of mycobacterium tuberculosis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
LTAHARIREAAIEQFGRHGFGVGLRAIAEAAGVSAALVIHHFGSKEGLRKACDDFVAEEIRSSKAAALKSNDPTTWLAQMAEIESYAPLMAYLVRSMQSGGELAKMLWQKMIDNAEEYLDEGVRAGTVKPSRDPRARARFLAITGGGGFLLYLQMHENPTDLRAALRDYAHDMVLPSLEVYTEGLLADRAMYEAFLAEAQQGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of the transcriptional regulator Rv1219c of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 81
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17933 TetR_C_25 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4nn1A00
4PXIA 3BR0A 3BT9A 4V2FA 2RHAA 3BR5A 2D6YA 5FGLA 4D5CA 3PASA 4MO7A 1QPIA 1T33A 2NS7A 3ZQFA 2O7OA 3O60A 2GUHA 1RPWA 2IU5A 2OPTA 2V57A 2G7GA 3EUPA 2WUIA 3G1OA 2F07A 2HQ5A 4GCTA 2ZOYA 5FKMA 4HKUA 2UXIA 3V6GA 2FJ1A 5IPAA 3EGQA 3NI7A 3TP3A 3P9TA 3LSRA 5HAWA 2VKEA 4MXMA 3NXCA 5EYRA 2YVEA 4X1EA 4GFKA 3RH2A 4M3EA 4W97A 1QVTA 3QPLA 2FD5A 2XGEA 3JSJA 5CW8A 3COLA 2NS8A 1ZKGA 5FKKA 3C07A 3Q0VA 3SFIA 4M3GA 2FBQA 2TCTA 3QKXA 2VKVA 3TP0A 2NX4A 5EFYA 5K7HA 2ID6A 3G56A 3BNIA 3RD3A 5GPAA 3KNWA 2Y31A 2XPUA 2G7LA 3VP5A 5C4YA 5FHPA 3T6NA 3E7QA 2DTZA 2ID3A 4V2GA 2X6OA 3FIWA 2WV1A 2ZCMA 3CDLA 3BR2A 1SGMA 5F08A 3ZQHA 4JYKA 4I6ZA 5D19A 2XGDA 3HTIA 1JT6A 2XRLA 5J3LA 3AQSA 3BQYA 2O7TA 3LOCA 3DCFA 2YVHA 2Y2ZA 4D5FA 5EZHA 3ZQLA 3CJDA 5FKOA 1T56A 4CGRA 2ZOZA 1UI6A 3HIMA 4B1RA 3NPIA 3ZQIA 3F1BA 5K7ZA 3ANGA 4ICHA 2G0EA 2QWTA 3O8GA 3LHQA 2QTQA 2GBYA 4JKZA 4W1UA 2HYJA 5F0CA 4ACIA 2GFNA 5F04A 3BR3A 3ON2A 4AC6A 4JNNA 2DG7A 3HTJA 3PPBA 3VVYA 2JK3A 4AC0A 3LWJA 2IEKA 5K58A 1QVUA 2HXIA 4NELA 3F0CA 4G12A 3G7RA 3GZIA 2JJ7A 1JTXA 4I76A 1A6IA 2HKUA 2FQ4A 1UI5A 5FKLA 3DEWA 3VW2A 4L62A 2EH3A 3LSPA 1JUMA 2ZB9A 3HGGA 2GENA 2XDNA 3B81A 3BRUA 2WGBA 5AQCA 5F0FA 2TRTA 5GPCA 3BR1A 5F1JA 3ZQGA 3BHQA 2OI8A 5IP6A 3HTAA 3S5RA 1JUSA 2UXPA 2XB5A 5CXIA 2XGCA 2RASA 3AQTA 5J1UA 3BTCA 2VPRA 5F0HA 3NRGA 2Y30A 5HBUA 3VUQA 4ME9A 3QPSA 1JT0A 2FX0A 4B3AA 2REKA 3CCYA 3KKCA 2IAIA 4GCKA 1Z0XA 2XPVA 3Q0WA 3G1MA 4NN1A 2Q24A 5HSZA 3BCGA 3C2BA 2OF7A 2UXUA 4YZEA 3VVZA 3BR6A 2ZCNA 4JL3A 2QCOA 3PM1A 3HGYA 2HXOA 4MK6A 4M3BA 2W53A 1JUPA 2G3BA 3O8HA 1Z77A 5D18A 2IBDA 3KKDA 4ABZA 3VOXA 2X9DA 3QBMA 3Q0UA 3BTLA 3Q3SA 1U9OA 1JTYA 3BJBA 2UXHA 3MVPA 5F27A 4AF5A 3BTJA 3VW0A 3ON4A 3BQZA 3G1LA 2PZ9A 1BJZA 4GFLA 2RAEA 3ANPA 2I10A 1RKTA 3IH4A 5DAJA 2XPWA 3IH3A 3DPJA 3VIBA 3CWRA 5FMPA 4KWAA 3SDGA 4M3FA 4DW6A 3FRQA 4GCLA 3FK6A 3B6CA 4AUXA 3HE0A 3GEUA 3VPRA 2PBXA 2QKOA 1RKWA 1VI0A 3BTIA 3HTHA 2G7SA 3VOKA 3FK7A 5H9TA 4XK4A 5J1YA 2ZCXA 3VW1A 4M3DA 3MNLA 5K7FA 3B6AA 3IUVA 5FKNA 3WHBA 3QQAA 4D7NA 5D1RA 3V78A 3LSJA 3NNRA 5IOZA 5GP9A 2HYTA 3WHCA 4UDSA 2NP3A 5IOYA 3IH2A 2QIBA 3VVXA 2DG8A 2OERA 2QOPA 1ORKA 2UXOA 4D7MA 5EZGA 3LJLA 2NP5A 1ZK8A 3KZ9A 5J1RA 3CRJA 1U9NA 5CXGA
chains in the Genus database with same CATH superfamily
4PXIA 3BR0A 3BT9A 4V2FA 2RHAA 3BR5A 2D6YA 5FGLA 4D5CA 3PASA 4MO7A 1QPIA 1T33A 2NS7A 3ZQFA 2O7OA 3O60A 2GUHA 1RPWA 4DVYP 2IU5A 2OPTA 2V57A 2G7GA 3EUPA 2WUIA 3G1OA 2F07A 2HQ5A 4GCTA 2ZOYA 5FKMA 4HKUA 2UXIA 3V6GA 2FJ1A 5IPAA 3EGQA 3NI7A 3TP3A 3P9TA 3LSRA 5HAWA 2VKEA 4MXMA 2R7OA 3NXCA 5EYRA 2YVEA 4X1EA 4GFKA 3RH2A 4M3EA 4W97A 1QVTA 3QPLA 2FD5A 2XGEA 2A2FX 3KYLA 3JSJA 5CW8A 3COLA 2NS8A 1ZKGA 5FKKA 3C07A 3Q0VA 3SFIA 4M3GA 2FBQA 2TCTA 3QKXA 2VKVA 3TP0A 2R7VA 2NX4A 5EFYA 5K7HA 5CQGA 2ID6A 3G56A 3BNIA 3RD3A 5GPAA 3KNWA 2Y31A 2XPUA 2G7LA 3VP5A 5C4YA 5FHPA 3T6NA 3E7QA 2DTZA 2ID3A 4V2GA 2X6OA 3FIWA 2WV1A 2ZCMA 3CDLA 3BR2A 1SGMA 5F08A 3ZQHA 4JYKA 4I6ZA 5D19A 2XGDA 3HTIA 2R7WA 1JT6A 2XRLA 5J3LA 3AQSA 3BQYA 2O7TA 3LOCA 3DCFA 2YVHA 2Y2ZA 4D5FA 5EZHA 3ZQLA 3CJDA 5FKOA 1T56A 4CGRA 2ZOZA 1UI6A 3HIMA 4B1RA 3NPIA 3ZQIA 3F1BA 5K7ZA 3ANGA 4ICHA 3VTIA 2G0EA 2QWTA 3O8GA 3LHQA 2QTQA 2GBYA 4JKZA 4W1UA 2HYJA 5F0CA 4ACIA 2GFNA 5F04A 3BR3A 3ON2A 4AC6A 4JNNA 2DG7A 3HTJA 3PPBA 3VVYA 2JK3A 4AC0A 3LWJA 2IEKA 5K58A 1QVUA 2HXIA 4NELA 3F0CA 4G12A 3G7RA 3GZIA 2JJ7A 1JTXA 4I76A 1A6IA 2HKUA 2FQ4A 3DU6A 1UI5A 5FKLA 3DEWA 3VW2A 3DU5A 4L62A 2EH3A 3LSPA 1JUMA 2ZB9A 2R7XA 3HGGA 2GENA 2XDNA 3B81A 3BRUA 2WGBA 5AQCA 5F0FA 2TRTA 5GPCA 3BR1A 5F1JA 3ZQGA 3BHQA 2OI8A 4OD5A 3K8PC 5IP6A 3HTAA 2R7SA 3S5RA 1JUSA 2UXPA 2XB5A 5CXIA 2XGCA 3FHNA 2RASA 3AQTA 5J1UA 3BTCA 2VPRA 5F0HA 3NRGA 2Y30A 5HBUA 3VUQA 4ME9A 3QPSA 1JT0A 2FX0A 4B3AA 2REKA 3CCYA 3KKCA 3SWHA 2IAIA 4GCKA 1Z0XA 2XPVA 3Q0WA 4IRVA 3G1MA 4NN1A 2Q24A 5HSZA 3BCGA 3C2BA 2OF7A 2UXUA 4YZEA 3VVZA 3BR6A 2ZCNA 4JL3A 2QCOA 2YVXA 3HGYA 3PM1A 2HXOA 2B1EA 4MK6A 2R7UA 4M3BA 2W53A 1JUPA 2G3BA 4OD4A 4U9LA 3O8HA 1Z77A 5D18A 2IBDA 3KKDA 4ABZA 3VOXA 2X9DA 3QBMA 3Q0UA 3BTLA 3Q3SA 4C2MA 1U9OA 1JTYA 3BJBA 2UXHA 3MVPA 5F27A 3NS4A 3BTJA 4AF5A 3VW0A 3ON4A 3BQZA 3G1LA 2PZ9A 1BJZA 4GFLA 2RAEA 3ANPA 2I10A 1RKTA 3IH4A 5DAJA 2XPWA 3IH3A 3DPJA 2R7RA 3VIBA 3CWRA 5FMPA 4KWAA 3SDGA 4M3FA 4DW6A 3FRQA 4GCLA 3FK6A 3B6CA 4AUXA 4WIBA 3HE0A 3GEUA 3VPRA 2PBXA 2QKOA 1RKWA 1VI0A 3BTIA 3HTHA 2G7SA 3VOKA 3FK7A 5H9TA 4XK4A 5J1YA 2ZCXA 3VW1A 4M3DA 3MNLA 5K7FA 3B6AA 2R7TA 3IUVA 5FKNA 3WHBA 3QQAA 4D7NA 5D1RA 3V78A 2R7QA 3LSJA 3NNRA 5IOZA 5GP9A 2HYTA 3WHCA 4UDSA 2NP3A 5IOYA 3IH2A 2QIBA 3VVXA 2DG8A 2OERA 2QOPA 1ORKA 2UXOA 4D7MA 5EZGA 3LJLA 4U9NA 2FJI1 2NP5A 2ZY9A 1ZK8A 3KZ9A 5J1RA 2B3WA 3CRJA 1U9NA 5CXGA 2PFVA
chains in the Genus database with same CATH topology
4PXIA 3BR0A 3BT9A 4V2FA 2RHAA 3BR5A 2D6YA 5FGLA 4D5CA 3PASA 4MO7A 1QPIA 1T33A 2NS7A 3ZQFA 2O7OA 3O60A 2GUHA 1RPWA 2IU5A 2OPTA 2V57A 2G7GA 3EUPA 2WUIA 3G1OA 2F07A 2HQ5A 4GCTA 2ZOYA 5FKMA 4HKUA 2UXIA 3V6GA 2FJ1A 5IPAA 3EGQA 3NI7A 3TP3A 3P9TA 3LSRA 5HAWA 2VKEA 4MXMA 3NXCA 5EYRA 2YVEA 4X1EA 4GFKA 3RH2A 4M3EA 4W97A 1QVTA 3QPLA 2FD5A 2XGEA 3JSJA 5CW8A 3COLA 2NS8A 1ZKGA 5FKKA 3C07A 3Q0VA 3SFIA 4M3GA 2FBQA 2TCTA 3QKXA 2VKVA 3TP0A 2NX4A 5EFYA 5K7HA 2ID6A 3G56A 3BNIA 3RD3A 5GPAA 3KNWA 2Y31A 2XPUA 2G7LA 3VP5A 5C4YA 5FHPA 3T6NA 3E7QA 2DTZA 2ID3A 4V2GA 2X6OA 3FIWA 2WV1A 2ZCMA 3CDLA 3BR2A 1SGMA 5F08A 3ZQHA 4JYKA 4I6ZA 5D19A 2XGDA 3HTIA 1JT6A 2XRLA 5J3LA 3AQSA 3BQYA 2O7TA 3LOCA 3DCFA 2YVHA 2Y2ZA 4D5FA 5EZHA 3ZQLA 3CJDA 5FKOA 1T56A 4CGRA 2ZOZA 1UI6A 3HIMA 4B1RA 3NPIA 3ZQIA 3F1BA 5K7ZA 3ANGA 4ICHA 2G0EA 2QWTA 3O8GA 3LHQA 2QTQA 2GBYA 4JKZA 4W1UA 2HYJA 5F0CA 4ACIA 2GFNA 5F04A 3BR3A 3ON2A 4AC6A 4JNNA 2DG7A 3HTJA 3PPBA 3VVYA 2JK3A 4AC0A 3LWJA 2IEKA 5K58A 1QVUA 2HXIA 4NELA 3F0CA 4G12A 3G7RA 3GZIA 2JJ7A 1JTXA 4I76A 1A6IA 2HKUA 2FQ4A 1UI5A 5FKLA 3DEWA 3VW2A 4L62A 2EH3A 3LSPA 1JUMA 2ZB9A 3HGGA 2GENA 2XDNA 3B81A 3BRUA 2WGBA 5AQCA 5F0FA 2TRTA 5GPCA 3BR1A 5F1JA 3ZQGA 3BHQA 2OI8A 5IP6A 3HTAA 3S5RA 1JUSA 2UXPA 2XB5A 5CXIA 2XGCA 2RASA 3AQTA 5J1UA 3BTCA 2VPRA 5F0HA 3NRGA 2Y30A 5HBUA 3VUQA 4ME9A 3QPSA 1JT0A 2FX0A 4B3AA 2REKA 3CCYA 3KKCA 2IAIA 4GCKA 1Z0XA 2XPVA 3Q0WA 3G1MA 4NN1A 2Q24A 5HSZA 3BCGA 3C2BA 2OF7A 2UXUA 4YZEA 3VVZA 3BR6A 2ZCNA 4JL3A 2QCOA 3PM1A 3HGYA 2HXOA 4MK6A 4M3BA 2W53A 1JUPA 2G3BA 3O8HA 1Z77A 5D18A 2IBDA 3KKDA 4ABZA 3VOXA 2X9DA 3QBMA 3Q0UA 3BTLA 3Q3SA 1U9OA 1JTYA 3BJBA 2UXHA 3MVPA 5F27A 4AF5A 3BTJA 3VW0A 3ON4A 3BQZA 3G1LA 2PZ9A 1BJZA 4GFLA 2RAEA 3ANPA 2I10A 1RKTA 3IH4A 5DAJA 2XPWA 3IH3A 3DPJA 3VIBA 3CWRA 5FMPA 4KWAA 3SDGA 4M3FA 4DW6A 3FRQA 4GCLA 3FK6A 3B6CA 4AUXA 3HE0A 3GEUA 3VPRA 2PBXA 2QKOA 1RKWA 1VI0A 3BTIA 3HTHA 2G7SA 3VOKA 3FK7A 5H9TA 4XK4A 5J1YA 2ZCXA 3VW1A 4M3DA 3MNLA 5K7FA 3B6AA 3IUVA 5FKNA 3WHBA 3QQAA 4D7NA 5D1RA 3V78A 3LSJA 3NNRA 5IOZA 5GP9A 2HYTA 3WHCA 4UDSA 2NP3A 5IOYA 3IH2A 2QIBA 3VVXA 2DG8A 2OERA 2QOPA 1ORKA 2UXOA 4D7MA 5EZGA 3LJLA 2NP5A 1ZK8A 3KZ9A 5J1RA 3CRJA 1U9NA 5CXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXI A;  3BR0 A;  3BT9 A;  4V2F A;  2RHA A;  3BR5 A;  2D6Y A;  5FGL A;  4D5C A;  3PAS A;  4MO7 A;  1QPI A;  1T33 A;  2NS7 A;  3ZQF A;  2O7O A;  3O60 A;  2GUH A;  1RPW A;  2IU5 A;  2OPT A;  2V57 A;  2G7G A;  3EUP A;  2WUI A;  3G1O A;  2F07 A;  2HQ5 A;  4GCT A;  2ZOY A;  5FKM A;  4HKU A;  2UXI A;  3V6G A;  2FJ1 A;  5IPA A;  3EGQ A;  3NI7 A;  3TP3 A;  3P9T A;  3LSR A;  5HAW A;  2VKE A;  4MXM A;  3NXC A;  5EYR A;  2YVE A;  4X1E A;  4GFK A;  3RH2 A;  4M3E A;  4W97 A;  1QVT A;  3QPL A;  2FD5 A;  2XGE A;  3JSJ A;  5CW8 A;  3COL A;  2NS8 A;  1ZKG A;  5FKK A;  3C07 A;  3Q0V A;  3SFI A;  4M3G A;  2FBQ A;  2TCT A;  3QKX A;  2VKV A;  3TP0 A;  2NX4 A;  5EFY A;  5K7H A;  2ID6 A;  3G56 A;  3BNI A;  3RD3 A;  5GPA A;  3KNW A;  2Y31 A;  2XPU A;  2G7L A;  3VP5 A;  5C4Y A;  5FHP A;  3T6N A;  3E7Q A;  2DTZ A;  2ID3 A;  4V2G A;  2X6O A;  3FIW A;  2WV1 A;  2ZCM A;  3CDL A;  3BR2 A;  1SGM A;  5F08 A;  3ZQH A;  4JYK A;  4I6Z A;  5D19 A;  2XGD A;  3HTI A;  1JT6 A;  2XRL A;  5J3L A;  3AQS A;  3BQY A;  2O7T A;  3LOC A;  3DCF A;  2YVH A;  2Y2Z A;  4D5F A;  5EZH A;  3ZQL A;  3CJD A;  5FKO A;  1T56 A;  4CGR A;  2ZOZ A;  1UI6 A;  3HIM A;  4B1R A;  3NPI A;  3ZQI A;  3F1B A;  5K7Z A;  3ANG A;  4ICH A;  2G0E A;  2QWT A;  3O8G A;  3LHQ A;  2QTQ A;  2GBY A;  4JKZ A;  4W1U A;  2HYJ A;  5F0C A;  4ACI A;  2GFN A;  5F04 A;  3BR3 A;  3ON2 A;  4AC6 A;  4JNN A;  2DG7 A;  3HTJ A;  3PPB A;  3VVY A;  2JK3 A;  4AC0 A;  3LWJ A;  2IEK A;  5K58 A;  1QVU A;  2HXI A;  4NEL A;  3F0C A;  4G12 A;  3G7R A;  3GZI A;  2JJ7 A;  1JTX A;  4I76 A;  1A6I A;  2HKU A;  2FQ4 A;  1UI5 A;  5FKL A;  3DEW A;  3VW2 A;  4L62 A;  2EH3 A;  3LSP A;  1JUM A;  2ZB9 A;  3HGG A;  2GEN A;  2XDN A;  3B81 A;  3BRU A;  2WGB A;  5AQC A;  5F0F A;  2TRT A;  5GPC A;  3BR1 A;  5F1J A;  3ZQG A;  3BHQ A;  2OI8 A;  5IP6 A;  3HTA A;  3S5R A;  1JUS A;  2UXP A;  2XB5 A;  5CXI A;  2XGC A;  2RAS A;  3AQT A;  5J1U A;  3BTC A;  2VPR A;  5F0H A;  3NRG A;  2Y30 A;  5HBU A;  3VUQ A;  4ME9 A;  3QPS A;  1JT0 A;  2FX0 A;  4B3A A;  2REK A;  3CCY A;  3KKC A;  2IAI A;  4GCK A;  1Z0X A;  2XPV A;  3Q0W A;  3G1M A;  4NN1 A;  2Q24 A;  5HSZ A;  3BCG A;  3C2B A;  2OF7 A;  2UXU A;  4YZE A;  3VVZ A;  3BR6 A;  2ZCN A;  4JL3 A;  2QCO A;  3PM1 A;  3HGY A;  2HXO A;  4MK6 A;  4M3B A;  2W53 A;  1JUP A;  2G3B A;  3O8H A;  1Z77 A;  5D18 A;  2IBD A;  3KKD A;  4ABZ A;  3VOX A;  2X9D A;  3QBM A;  3Q0U A;  3BTL A;  3Q3S A;  1U9O A;  1JTY A;  3BJB A;  2UXH A;  3MVP A;  5F27 A;  4AF5 A;  3BTJ A;  3VW0 A;  3ON4 A;  3BQZ A;  3G1L A;  2PZ9 A;  1BJZ A;  4GFL A;  2RAE A;  3ANP A;  2I10 A;  1RKT A;  3IH4 A;  5DAJ A;  2XPW A;  3IH3 A;  3DPJ A;  3VIB A;  3CWR A;  5FMP A;  4KWA A;  3SDG A;  4M3F A;  4DW6 A;  3FRQ A;  4GCL A;  3FK6 A;  3B6C A;  4AUX A;  3HE0 A;  3GEU A;  3VPR A;  2PBX A;  2QKO A;  1RKW A;  1VI0 A;  3BTI A;  3HTH A;  2G7S A;  3VOK A;  3FK7 A;  5H9T A;  4XK4 A;  5J1Y A;  2ZCX A;  3VW1 A;  4M3D A;  3MNL A;  5K7F A;  3B6A A;  3IUV A;  5FKN A;  3WHB A;  3QQA A;  4D7N A;  5D1R A;  3V78 A;  3LSJ A;  3NNR A;  5IOZ A;  5GP9 A;  2HYT A;  3WHC A;  4UDS A;  2NP3 A;  5IOY A;  3IH2 A;  2QIB A;  3VVX A;  2DG8 A;  2OER A;  2QOP A;  1ORK A;  2UXO A;  4D7M A;  5EZG A;  3LJL A;  2NP5 A;  1ZK8 A;  3KZ9 A;  5J1R A;  3CRJ A;  1U9N A;  5CXG A; 
#chains in the Genus database with same CATH topology
 4PXI A;  3BR0 A;  3BT9 A;  4V2F A;  2RHA A;  3BR5 A;  2D6Y A;  5FGL A;  4D5C A;  3PAS A;  4MO7 A;  1QPI A;  1T33 A;  2NS7 A;  3ZQF A;  2O7O A;  3O60 A;  2GUH A;  1RPW A;  4DVY P;  2IU5 A;  2OPT A;  2V57 A;  2G7G A;  3EUP A;  2WUI A;  3G1O A;  2F07 A;  2HQ5 A;  4GCT A;  2ZOY A;  5FKM A;  4HKU A;  2UXI A;  3V6G A;  2FJ1 A;  5IPA A;  3EGQ A;  3NI7 A;  3TP3 A;  3P9T A;  3LSR A;  5HAW A;  2VKE A;  4MXM A;  2R7O A;  3NXC A;  5EYR A;  2YVE A;  4X1E A;  4GFK A;  3RH2 A;  4M3E A;  4W97 A;  1QVT A;  3QPL A;  2FD5 A;  2XGE A;  2A2F X;  3KYL A;  3JSJ A;  5CW8 A;  3COL A;  2NS8 A;  1ZKG A;  5FKK A;  3C07 A;  3Q0V A;  3SFI A;  4M3G A;  2FBQ A;  2TCT A;  3QKX A;  2VKV A;  3TP0 A;  2R7V A;  2NX4 A;  5EFY A;  5K7H A;  5CQG A;  2ID6 A;  3G56 A;  3BNI A;  3RD3 A;  5GPA A;  3KNW A;  2Y31 A;  2XPU A;  2G7L A;  3VP5 A;  5C4Y A;  5FHP A;  3T6N A;  3E7Q A;  2DTZ A;  2ID3 A;  4V2G A;  2X6O A;  3FIW A;  2WV1 A;  2ZCM A;  3CDL A;  3BR2 A;  1SGM A;  5F08 A;  3ZQH A;  4JYK A;  4I6Z A;  5D19 A;  2XGD A;  3HTI A;  2R7W A;  1JT6 A;  2XRL A;  5J3L A;  3AQS A;  3BQY A;  2O7T A;  3LOC A;  3DCF A;  2YVH A;  2Y2Z A;  4D5F A;  5EZH A;  3ZQL A;  3CJD A;  5FKO A;  1T56 A;  4CGR A;  2ZOZ A;  1UI6 A;  3HIM A;  4B1R A;  3NPI A;  3ZQI A;  3F1B A;  5K7Z A;  3ANG A;  4ICH A;  3VTI A;  2G0E A;  2QWT A;  3O8G A;  3LHQ A;  2QTQ A;  2GBY A;  4JKZ A;  4W1U A;  2HYJ A;  5F0C A;  4ACI A;  2GFN A;  5F04 A;  3BR3 A;  3ON2 A;  4AC6 A;  4JNN A;  2DG7 A;  3HTJ A;  3PPB A;  3VVY A;  2JK3 A;  4AC0 A;  3LWJ A;  2IEK A;  5K58 A;  1QVU A;  2HXI A;  4NEL A;  3F0C A;  4G12 A;  3G7R A;  3GZI A;  2JJ7 A;  1JTX A;  4I76 A;  1A6I A;  2HKU A;  2FQ4 A;  3DU6 A;  1UI5 A;  5FKL A;  3DEW A;  3VW2 A;  3DU5 A;  4L62 A;  2EH3 A;  3LSP A;  1JUM A;  2ZB9 A;  2R7X A;  3HGG A;  2GEN A;  2XDN A;  3B81 A;  3BRU A;  2WGB A;  5AQC A;  5F0F A;  2TRT A;  5GPC A;  3BR1 A;  5F1J A;  3ZQG A;  3BHQ A;  2OI8 A;  4OD5 A;  3K8P C;  5IP6 A;  3HTA A;  2R7S A;  3S5R A;  1JUS A;  2UXP A;  2XB5 A;  5CXI A;  2XGC A;  3FHN A;  2RAS A;  3AQT A;  5J1U A;  3BTC A;  2VPR A;  5F0H A;  3NRG A;  2Y30 A;  5HBU A;  3VUQ A;  4ME9 A;  3QPS A;  1JT0 A;  2FX0 A;  4B3A A;  2REK A;  3CCY A;  3KKC A;  3SWH A;  2IAI A;  4GCK A;  1Z0X A;  2XPV A;  3Q0W A;  4IRV A;  3G1M A;  4NN1 A;  2Q24 A;  5HSZ A;  3BCG A;  3C2B A;  2OF7 A;  2UXU A;  4YZE A;  3VVZ A;  3BR6 A;  2ZCN A;  4JL3 A;  2QCO A;  2YVX A;  3HGY A;  3PM1 A;  2HXO A;  2B1E A;  4MK6 A;  2R7U A;  4M3B A;  2W53 A;  1JUP A;  2G3B A;  4OD4 A;  4U9L A;  3O8H A;  1Z77 A;  5D18 A;  2IBD A;  3KKD A;  4ABZ A;  3VOX A;  2X9D A;  3QBM A;  3Q0U A;  3BTL A;  3Q3S A;  4C2M A;  1U9O A;  1JTY A;  3BJB A;  2UXH A;  3MVP A;  5F27 A;  3NS4 A;  3BTJ A;  4AF5 A;  3VW0 A;  3ON4 A;  3BQZ A;  3G1L A;  2PZ9 A;  1BJZ A;  4GFL A;  2RAE A;  3ANP A;  2I10 A;  1RKT A;  3IH4 A;  5DAJ A;  2XPW A;  3IH3 A;  3DPJ A;  2R7R A;  3VIB A;  3CWR A;  5FMP A;  4KWA A;  3SDG A;  4M3F A;  4DW6 A;  3FRQ A;  4GCL A;  3FK6 A;  3B6C A;  4AUX A;  4WIB A;  3HE0 A;  3GEU A;  3VPR A;  2PBX A;  2QKO A;  1RKW A;  1VI0 A;  3BTI A;  3HTH A;  2G7S A;  3VOK A;  3FK7 A;  5H9T A;  4XK4 A;  5J1Y A;  2ZCX A;  3VW1 A;  4M3D A;  3MNL A;  5K7F A;  3B6A A;  2R7T A;  3IUV A;  5FKN A;  3WHB A;  3QQA A;  4D7N A;  5D1R A;  3V78 A;  2R7Q A;  3LSJ A;  3NNR A;  5IOZ A;  5GP9 A;  2HYT A;  3WHC A;  4UDS A;  2NP3 A;  5IOY A;  3IH2 A;  2QIB A;  3VVX A;  2DG8 A;  2OER A;  2QOP A;  1ORK A;  2UXO A;  4D7M A;  5EZG A;  3LJL A;  4U9N A;  2FJI 1;  2NP5 A;  2ZY9 A;  1ZK8 A;  3KZ9 A;  5J1R A;  2B3W A;  3CRJ A;  1U9N A;  5CXG A;  2PFV A; 
#chains in the Genus database with same CATH homology
 4PXI A;  3BR0 A;  3BT9 A;  4V2F A;  2RHA A;  3BR5 A;  2D6Y A;  5FGL A;  4D5C A;  3PAS A;  4MO7 A;  1QPI A;  1T33 A;  2NS7 A;  3ZQF A;  2O7O A;  3O60 A;  2GUH A;  1RPW A;  2IU5 A;  2OPT A;  2V57 A;  2G7G A;  3EUP A;  2WUI A;  3G1O A;  2F07 A;  2HQ5 A;  4GCT A;  2ZOY A;  5FKM A;  4HKU A;  2UXI A;  3V6G A;  2FJ1 A;  5IPA A;  3EGQ A;  3NI7 A;  3TP3 A;  3P9T A;  3LSR A;  5HAW A;  2VKE A;  4MXM A;  3NXC A;  5EYR A;  2YVE A;  4X1E A;  4GFK A;  3RH2 A;  4M3E A;  4W97 A;  1QVT A;  3QPL A;  2FD5 A;  2XGE A;  3JSJ A;  5CW8 A;  3COL A;  2NS8 A;  1ZKG A;  5FKK A;  3C07 A;  3Q0V A;  3SFI A;  4M3G A;  2FBQ A;  2TCT A;  3QKX A;  2VKV A;  3TP0 A;  2NX4 A;  5EFY A;  5K7H A;  2ID6 A;  3G56 A;  3BNI A;  3RD3 A;  5GPA A;  3KNW A;  2Y31 A;  2XPU A;  2G7L A;  3VP5 A;  5C4Y A;  5FHP A;  3T6N A;  3E7Q A;  2DTZ A;  2ID3 A;  4V2G A;  2X6O A;  3FIW A;  2WV1 A;  2ZCM A;  3CDL A;  3BR2 A;  1SGM A;  5F08 A;  3ZQH A;  4JYK A;  4I6Z A;  5D19 A;  2XGD A;  3HTI A;  1JT6 A;  2XRL A;  5J3L A;  3AQS A;  3BQY A;  2O7T A;  3LOC A;  3DCF A;  2YVH A;  2Y2Z A;  4D5F A;  5EZH A;  3ZQL A;  3CJD A;  5FKO A;  1T56 A;  4CGR A;  2ZOZ A;  1UI6 A;  3HIM A;  4B1R A;  3NPI A;  3ZQI A;  3F1B A;  5K7Z A;  3ANG A;  4ICH A;  2G0E A;  2QWT A;  3O8G A;  3LHQ A;  2QTQ A;  2GBY A;  4JKZ A;  4W1U A;  2HYJ A;  5F0C A;  4ACI A;  2GFN A;  5F04 A;  3BR3 A;  3ON2 A;  4AC6 A;  4JNN A;  2DG7 A;  3HTJ A;  3PPB A;  3VVY A;  2JK3 A;  4AC0 A;  3LWJ A;  2IEK A;  5K58 A;  1QVU A;  2HXI A;  4NEL A;  3F0C A;  4G12 A;  3G7R A;  3GZI A;  2JJ7 A;  1JTX A;  4I76 A;  1A6I A;  2HKU A;  2FQ4 A;  1UI5 A;  5FKL A;  3DEW A;  3VW2 A;  4L62 A;  2EH3 A;  3LSP A;  1JUM A;  2ZB9 A;  3HGG A;  2GEN A;  2XDN A;  3B81 A;  3BRU A;  2WGB A;  5AQC A;  5F0F A;  2TRT A;  5GPC A;  3BR1 A;  5F1J A;  3ZQG A;  3BHQ A;  2OI8 A;  5IP6 A;  3HTA A;  3S5R A;  1JUS A;  2UXP A;  2XB5 A;  5CXI A;  2XGC A;  2RAS A;  3AQT A;  5J1U A;  3BTC A;  2VPR A;  5F0H A;  3NRG A;  2Y30 A;  5HBU A;  3VUQ A;  4ME9 A;  3QPS A;  1JT0 A;  2FX0 A;  4B3A A;  2REK A;  3CCY A;  3KKC A;  2IAI A;  4GCK A;  1Z0X A;  2XPV A;  3Q0W A;  3G1M A;  4NN1 A;  2Q24 A;  5HSZ A;  3BCG A;  3C2B A;  2OF7 A;  2UXU A;  4YZE A;  3VVZ A;  3BR6 A;  2ZCN A;  4JL3 A;  2QCO A;  3PM1 A;  3HGY A;  2HXO A;  4MK6 A;  4M3B A;  2W53 A;  1JUP A;  2G3B A;  3O8H A;  1Z77 A;  5D18 A;  2IBD A;  3KKD A;  4ABZ A;  3VOX A;  2X9D A;  3QBM A;  3Q0U A;  3BTL A;  3Q3S A;  1U9O A;  1JTY A;  3BJB A;  2UXH A;  3MVP A;  5F27 A;  4AF5 A;  3BTJ A;  3VW0 A;  3ON4 A;  3BQZ A;  3G1L A;  2PZ9 A;  1BJZ A;  4GFL A;  2RAE A;  3ANP A;  2I10 A;  1RKT A;  3IH4 A;  5DAJ A;  2XPW A;  3IH3 A;  3DPJ A;  3VIB A;  3CWR A;  5FMP A;  4KWA A;  3SDG A;  4M3F A;  4DW6 A;  3FRQ A;  4GCL A;  3FK6 A;  3B6C A;  4AUX A;  3HE0 A;  3GEU A;  3VPR A;  2PBX A;  2QKO A;  1RKW A;  1VI0 A;  3BTI A;  3HTH A;  2G7S A;  3VOK A;  3FK7 A;  5H9T A;  4XK4 A;  5J1Y A;  2ZCX A;  3VW1 A;  4M3D A;  3MNL A;  5K7F A;  3B6A A;  3IUV A;  5FKN A;  3WHB A;  3QQA A;  4D7N A;  5D1R A;  3V78 A;  3LSJ A;  3NNR A;  5IOZ A;  5GP9 A;  2HYT A;  3WHC A;  4UDS A;  2NP3 A;  5IOY A;  3IH2 A;  2QIB A;  3VVX A;  2DG8 A;  2OER A;  2QOP A;  1ORK A;  2UXO A;  4D7M A;  5EZG A;  3LJL A;  2NP5 A;  1ZK8 A;  3KZ9 A;  5J1R A;  3CRJ A;  1U9N A;  5CXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...