4NN1A

Crystal structure of transcriptional regulator rv1219c of mycobacterium tuberculosis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
LTAHARIREAAIEQFGRHGFGVGLRAIAEAAGVSAALVIHHFGSKEGLRKACDDFVAEEIRSSKAAALKSNDPTTWLAQMAEIESYAPLMAYLVRSMQSGGELAKMLWQKMIDNAEEYLDEGVRAGTVKPSRDPRARARFLAITGGGGFLLYLQMHENPTDLRAALRDYAHDMVLPSLEVYTEGLLADRAMYEAFLAEAQQGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator
publication title Crystal structure of the transcriptional regulator Rv1219c of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 81
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17933 TetR_C_25 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4nn1A00
3BTJA 3VVYA 3KNWA 5GPAA 3BR0A 3HGYA 3ZQGA 5J3LA 5IP6A 2Q24A 2OERA 5J1RA 2HKUA 1UI5A 3NNRA 3VVXA 3PASA 1JUSA 3SDGA 2NS7A 4GCLA 2GBYA 5EFYA 3G56A 2HYTA 4ME9A 2XB5A 1RKWA 3VOXA 3T6NA 3Q3SA 2ZCNA 3C07A 2RHAA 2GUHA 3BQYA 5K7HA 2FBQA 3C2BA 2QWTA 3BR1A 3TP0A 5GP9A 3GZIA 3ZQHA 4M3FA 3CCYA 1JT6A 5DAJA 5IOZA 3F1BA 3BR5A 3KKDA 3G7RA 2O7OA 2XDNA 5FMPA 5HBUA 2I10A 4MXMA 2EH3A 3QPLA 3BTIA 3RD3A 2WGBA 2PBXA 5FKOA 3HTIA 2IU5A 3LSPA 3F0CA 3IUVA 3BJBA 3V6GA 2HXOA 2QCOA 2FX0A 3BR3A 5F27A 3ZQLA 2NP5A 2FJ1A 2V57A 3S5RA 4M3GA 2TCTA 3HGGA 3VUQA 5FKLA 3NI7A 2FQ4A 3LWJA 3LOCA 3NXCA 3FK7A 2WUIA 3B81A 2G7SA 3VP5A 2O7TA 2ZB9A 5FKMA 2REKA 4XK4A 4V2GA 2IBDA 1RPWA 2G0EA 3E7QA 2PZ9A 2VPRA 5F0FA 2NS8A 2UXOA 5EYRA 1JUMA 4L62A 5C4YA 4AC6A 3NPIA 2QOPA 2XPVA 3BNIA 3CDLA 3TP3A 3ZQFA 1QVTA 2VKEA 4D5FA 3WHBA 3FIWA 3MVPA 2GFNA 2JJ7A 3AQSA 2IAIA 3PPBA 3BR2A 3HTJA 5F04A 1QVUA 2XGEA 1JTYA 4NN1A 3QBMA 4ACIA 2XPUA 2NP3A 4MO7A 3O8HA 3LSJA 2DTZA 3HTAA 2YVHA 4AF5A 2UXUA 2XGDA 4I76A 3DPJA 4D7MA 4ICHA 5GPCA 3HIMA 4M3EA 4G12A 3BCGA 5F0HA 3NRGA 4JNNA 4YZEA 1UI6A 3MNLA 4HKUA 3B6AA 2X6OA 3ZQIA 2OPTA 2XPWA 3QKXA 2GENA 4NELA 3Q0UA 4JKZA 2QTQA 1ZK8A 2G7GA 5D19A 2UXHA 4GFLA 3BHQA 2XGCA 4JYKA 2NX4A 1JUPA 5IPAA 3EUPA 4I6ZA 5CXIA 4X1EA 1Z0XA 1ORKA 4AUXA 2JK3A 4DW6A 2XRLA 2RAEA 2WV1A 3Q0WA 3JSJA 1SGMA 3LHQA 4V2FA 3O60A 5IOYA 1VI0A 2Y31A 2YVEA 3VW0A 3PM1A 5K58A 4W97A 1BJZA 3BQZA 3EGQA 2DG8A 3VIBA 1JTXA 2HYJA 4KWAA 4UDSA 3B6CA 5CW8A 1A6IA 3G1OA 2W53A 2TRTA 2HQ5A 3G1MA 3V78A 2OF7A 5J1UA 5EZGA 2ZOYA 2QKOA 3DCFA 3IH4A 3FRQA 2HXIA 3GEUA 3VVZA 2DG7A 2Y30A 2G3BA 3BTLA 5HAWA 3ANGA 3ANPA 3CWRA 5FKNA 3RH2A 5F08A 2ID6A 2F07A 2ID3A 4W1UA 1U9NA 5CXGA 5K7FA 3IH3A 2ZOZA 4GCTA 5HSZA 2D6YA 5D18A 3ON4A 3KKCA 3HTHA 4M3DA 5EZHA 5FKKA 2FD5A 4M3BA 3QPSA 4GFKA 3BT9A 4AC0A 3Q0VA 4D5CA 1T56A 3WHCA 4GCKA 1JT0A 5F1JA 3P9TA 1U9OA 5H9TA 2RASA 3VPRA 2QIBA 3IH2A 3CJDA 4ABZA 1QPIA 4CGRA 2OI8A 4B1RA 3HE0A 2UXPA 2UXIA 1T33A 3LSRA 5F0CA 3VW1A 3VOKA 2ZCMA 3CRJA 4D7NA 3KZ9A 4JL3A 3O8GA 1Z77A 3BR6A 2X9DA 5FGLA 3DEWA 2Y2ZA 3ON2A 3COLA 4PXIA 1ZKGA 5D1RA 3SFIA 2VKVA 5K7ZA 3VW2A 1RKTA 2G7LA 2IEKA 3AQTA 3LJLA 4B3AA 2ZCXA 5J1YA 5AQCA 3BRUA 3QQAA 3G1LA 5FHPA 3BTCA 4MK6A 3FK6A
chains in the Genus database with same CATH superfamily
3BTJA 3VVYA 3KNWA 4C2MA 5GPAA 3BR0A 3HGYA 3ZQGA 5J3LA 5IP6A 2Q24A 2OERA 5J1RA 2HKUA 1UI5A 3NNRA 3VVXA 3PASA 1JUSA 3SDGA 2NS7A 4GCLA 2GBYA 5EFYA 3G56A 2HYTA 4ME9A 2XB5A 1RKWA 3VOXA 3T6NA 3Q3SA 2ZCNA 3C07A 2RHAA 2GUHA 3BQYA 5CQGA 5K7HA 2FBQA 3C2BA 2QWTA 3BR1A 3TP0A 5GP9A 2ZY9A 3GZIA 3ZQHA 4M3FA 3CCYA 1JT6A 5DAJA 5IOZA 3F1BA 3BR5A 3KKDA 3G7RA 2O7OA 2XDNA 5FMPA 5HBUA 2I10A 4MXMA 2EH3A 3QPLA 3BTIA 3RD3A 2WGBA 2B3WA 2PBXA 5FKOA 3HTIA 2IU5A 3LSPA 3F0CA 3IUVA 3BJBA 3V6GA 2HXOA 2QCOA 2FX0A 3BR3A 5F27A 3ZQLA 2NP5A 2YVXA 2FJ1A 2V57A 3S5RA 4M3GA 2TCTA 3HGGA 3VUQA 2R7SA 5FKLA 3NI7A 2FQ4A 3LWJA 3LOCA 3NXCA 3FK7A 2WUIA 3B81A 2G7SA 3VP5A 3VTIA 2O7TA 2R7UA 2ZB9A 3DU6A 5FKMA 2REKA 4XK4A 4V2GA 2IBDA 1RPWA 3NS4A 2G0EA 3E7QA 2PZ9A 2VPRA 5F0FA 2NS8A 2UXOA 5EYRA 1JUMA 4L62A 5C4YA 4AC6A 3NPIA 2QOPA 2XPVA 3BNIA 3CDLA 3TP3A 3ZQFA 1QVTA 2VKEA 4D5FA 3WHBA 3FIWA 3MVPA 2GFNA 2JJ7A 3AQSA 2IAIA 3FHNA 3PPBA 3BR2A 3HTJA 5F04A 1QVUA 2XGEA 1JTYA 4NN1A 3QBMA 4ACIA 2XPUA 2NP3A 3DU5A 4MO7A 3O8HA 3LSJA 2DTZA 3HTAA 2YVHA 4AF5A 2UXUA 2XGDA 4I76A 3DPJA 4D7MA 4ICHA 5GPCA 3HIMA 4M3EA 4G12A 3BCGA 5F0HA 3NRGA 4JNNA 4YZEA 1UI6A 3MNLA 4HKUA 3KYLA 3B6AA 2X6OA 3ZQIA 2OPTA 2R7VA 2XPWA 3QKXA 2GENA 4NELA 3K8PC 4IRVA 3Q0UA 4JKZA 2QTQA 1ZK8A 2R7QA 2G7GA 5D19A 2R7WA 2UXHA 4GFLA 3BHQA 2XGCA 4JYKA 2NX4A 1JUPA 5IPAA 3EUPA 4I6ZA 5CXIA 4X1EA 1Z0XA 1ORKA 4AUXA 4U9LA 2JK3A 2B1EA 4DW6A 2XRLA 2RAEA 2WV1A 3Q0WA 3JSJA 1SGMA 2FJI1 3LHQA 4V2FA 3O60A 5IOYA 1VI0A 2Y31A 2YVEA 3VW0A 3PM1A 5K58A 4W97A 1BJZA 3BQZA 3EGQA 2DG8A 1JTXA 2HYJA 3VIBA 4KWAA 4UDSA 3B6CA 5CW8A 1A6IA 3G1OA 2W53A 2TRTA 2HQ5A 3G1MA 3V78A 2OF7A 5J1UA 4OD4A 5EZGA 2ZOYA 2QKOA 2PFVA 2R7XA 3DCFA 3IH4A 3FRQA 2HXIA 3GEUA 4DVYP 3VVZA 2DG7A 2Y30A 2G3BA 3BTLA 5HAWA 3ANGA 3ANPA 3SWHA 3CWRA 5FKNA 3RH2A 2A2FX 5F08A 2ID6A 2F07A 2ID3A 4W1UA 1U9NA 5CXGA 5K7FA 3IH3A 2ZOZA 4GCTA 5HSZA 2D6YA 5D18A 3ON4A 3KKCA 3HTHA 4M3DA 5EZHA 5FKKA 2FD5A 4M3BA 3QPSA 4GFKA 4U9NA 3BT9A 4AC0A 3Q0VA 4D5CA 1T56A 3WHCA 4GCKA 1JT0A 5F1JA 3P9TA 1U9OA 5H9TA 2RASA 2QIBA 3VPRA 4OD5A 3IH2A 3CJDA 4ABZA 1QPIA 4CGRA 2OI8A 4B1RA 3HE0A 2UXPA 2UXIA 1T33A 3LSRA 4WIBA 2R7RA 5F0CA 3VW1A 3VOKA 2ZCMA 3CRJA 4D7NA 3KZ9A 2R7TA 4JL3A 3O8GA 1Z77A 2R7OA 3BR6A 2X9DA 5FGLA 3DEWA 2Y2ZA 3ON2A 3COLA 4PXIA 1ZKGA 5D1RA 3SFIA 2VKVA 5K7ZA 3VW2A 1RKTA 2G7LA 2IEKA 3AQTA 3LJLA 4B3AA 2ZCXA 5J1YA 5AQCA 3BRUA 3QQAA 3G1LA 5FHPA 3BTCA 4MK6A 3FK6A
chains in the Genus database with same CATH topology
3BTJA 3VVYA 3KNWA 5GPAA 3BR0A 3HGYA 3ZQGA 5J3LA 5IP6A 2Q24A 2OERA 5J1RA 2HKUA 1UI5A 3NNRA 3VVXA 3PASA 1JUSA 3SDGA 2NS7A 4GCLA 2GBYA 5EFYA 3G56A 2HYTA 4ME9A 2XB5A 1RKWA 3VOXA 3T6NA 3Q3SA 2ZCNA 3C07A 2RHAA 2GUHA 3BQYA 5K7HA 2FBQA 3C2BA 2QWTA 3BR1A 3TP0A 5GP9A 3GZIA 3ZQHA 4M3FA 3CCYA 1JT6A 5DAJA 5IOZA 3F1BA 3BR5A 3KKDA 3G7RA 2O7OA 2XDNA 5FMPA 5HBUA 2I10A 4MXMA 2EH3A 3QPLA 3BTIA 3RD3A 2WGBA 2PBXA 5FKOA 3HTIA 2IU5A 3LSPA 3F0CA 3IUVA 3BJBA 3V6GA 2HXOA 2QCOA 2FX0A 3BR3A 5F27A 3ZQLA 2NP5A 2FJ1A 2V57A 3S5RA 4M3GA 2TCTA 3HGGA 3VUQA 5FKLA 3NI7A 2FQ4A 3LWJA 3LOCA 3NXCA 3FK7A 2WUIA 3B81A 2G7SA 3VP5A 2O7TA 2ZB9A 5FKMA 2REKA 4XK4A 4V2GA 2IBDA 1RPWA 2G0EA 3E7QA 2PZ9A 2VPRA 5F0FA 2NS8A 2UXOA 5EYRA 1JUMA 4L62A 5C4YA 4AC6A 3NPIA 2QOPA 2XPVA 3BNIA 3CDLA 3TP3A 3ZQFA 1QVTA 2VKEA 4D5FA 3WHBA 3FIWA 3MVPA 2GFNA 2JJ7A 3AQSA 2IAIA 3PPBA 3BR2A 3HTJA 5F04A 1QVUA 2XGEA 1JTYA 4NN1A 3QBMA 4ACIA 2XPUA 2NP3A 4MO7A 3O8HA 3LSJA 2DTZA 3HTAA 2YVHA 4AF5A 2UXUA 2XGDA 4I76A 3DPJA 4D7MA 4ICHA 5GPCA 3HIMA 4M3EA 4G12A 3BCGA 5F0HA 3NRGA 4JNNA 4YZEA 1UI6A 3MNLA 4HKUA 3B6AA 2X6OA 3ZQIA 2OPTA 2XPWA 3QKXA 2GENA 4NELA 3Q0UA 4JKZA 2QTQA 1ZK8A 2G7GA 5D19A 2UXHA 4GFLA 3BHQA 2XGCA 4JYKA 2NX4A 1JUPA 5IPAA 3EUPA 4I6ZA 5CXIA 4X1EA 1Z0XA 1ORKA 4AUXA 2JK3A 4DW6A 2XRLA 2RAEA 2WV1A 3Q0WA 3JSJA 1SGMA 3LHQA 4V2FA 3O60A 5IOYA 1VI0A 2Y31A 2YVEA 3VW0A 3PM1A 5K58A 4W97A 1BJZA 3BQZA 3EGQA 2DG8A 3VIBA 1JTXA 2HYJA 4KWAA 4UDSA 3B6CA 5CW8A 1A6IA 3G1OA 2W53A 2TRTA 2HQ5A 3G1MA 3V78A 2OF7A 5J1UA 5EZGA 2ZOYA 2QKOA 3DCFA 3IH4A 3FRQA 2HXIA 3GEUA 3VVZA 2DG7A 2Y30A 2G3BA 3BTLA 5HAWA 3ANGA 3ANPA 3CWRA 5FKNA 3RH2A 5F08A 2ID6A 2F07A 2ID3A 4W1UA 1U9NA 5CXGA 5K7FA 3IH3A 2ZOZA 4GCTA 5HSZA 2D6YA 5D18A 3ON4A 3KKCA 3HTHA 4M3DA 5EZHA 5FKKA 2FD5A 4M3BA 3QPSA 4GFKA 3BT9A 4AC0A 3Q0VA 4D5CA 1T56A 3WHCA 4GCKA 1JT0A 5F1JA 3P9TA 1U9OA 5H9TA 2RASA 3VPRA 2QIBA 3IH2A 3CJDA 4ABZA 1QPIA 4CGRA 2OI8A 4B1RA 3HE0A 2UXPA 2UXIA 1T33A 3LSRA 5F0CA 3VW1A 3VOKA 2ZCMA 3CRJA 4D7NA 3KZ9A 4JL3A 3O8GA 1Z77A 3BR6A 2X9DA 5FGLA 3DEWA 2Y2ZA 3ON2A 3COLA 4PXIA 1ZKGA 5D1RA 3SFIA 2VKVA 5K7ZA 3VW2A 1RKTA 2G7LA 2IEKA 3AQTA 3LJLA 4B3AA 2ZCXA 5J1YA 5AQCA 3BRUA 3QQAA 3G1LA 5FHPA 3BTCA 4MK6A 3FK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTJ A;  3VVY A;  3KNW A;  5GPA A;  3BR0 A;  3HGY A;  3ZQG A;  5J3L A;  5IP6 A;  2Q24 A;  2OER A;  5J1R A;  2HKU A;  1UI5 A;  3NNR A;  3VVX A;  3PAS A;  1JUS A;  3SDG A;  2NS7 A;  4GCL A;  2GBY A;  5EFY A;  3G56 A;  2HYT A;  4ME9 A;  2XB5 A;  1RKW A;  3VOX A;  3T6N A;  3Q3S A;  2ZCN A;  3C07 A;  2RHA A;  2GUH A;  3BQY A;  5K7H A;  2FBQ A;  3C2B A;  2QWT A;  3BR1 A;  3TP0 A;  5GP9 A;  3GZI A;  3ZQH A;  4M3F A;  3CCY A;  1JT6 A;  5DAJ A;  5IOZ A;  3F1B A;  3BR5 A;  3KKD A;  3G7R A;  2O7O A;  2XDN A;  5FMP A;  5HBU A;  2I10 A;  4MXM A;  2EH3 A;  3QPL A;  3BTI A;  3RD3 A;  2WGB A;  2PBX A;  5FKO A;  3HTI A;  2IU5 A;  3LSP A;  3F0C A;  3IUV A;  3BJB A;  3V6G A;  2HXO A;  2QCO A;  2FX0 A;  3BR3 A;  5F27 A;  3ZQL A;  2NP5 A;  2FJ1 A;  2V57 A;  3S5R A;  4M3G A;  2TCT A;  3HGG A;  3VUQ A;  5FKL A;  3NI7 A;  2FQ4 A;  3LWJ A;  3LOC A;  3NXC A;  3FK7 A;  2WUI A;  3B81 A;  2G7S A;  3VP5 A;  2O7T A;  2ZB9 A;  5FKM A;  2REK A;  4XK4 A;  4V2G A;  2IBD A;  1RPW A;  2G0E A;  3E7Q A;  2PZ9 A;  2VPR A;  5F0F A;  2NS8 A;  2UXO A;  5EYR A;  1JUM A;  4L62 A;  5C4Y A;  4AC6 A;  3NPI A;  2QOP A;  2XPV A;  3BNI A;  3CDL A;  3TP3 A;  3ZQF A;  1QVT A;  2VKE A;  4D5F A;  3WHB A;  3FIW A;  3MVP A;  2GFN A;  2JJ7 A;  3AQS A;  2IAI A;  3PPB A;  3BR2 A;  3HTJ A;  5F04 A;  1QVU A;  2XGE A;  1JTY A;  4NN1 A;  3QBM A;  4ACI A;  2XPU A;  2NP3 A;  4MO7 A;  3O8H A;  3LSJ A;  2DTZ A;  3HTA A;  2YVH A;  4AF5 A;  2UXU A;  2XGD A;  4I76 A;  3DPJ A;  4D7M A;  4ICH A;  5GPC A;  3HIM A;  4M3E A;  4G12 A;  3BCG A;  5F0H A;  3NRG A;  4JNN A;  4YZE A;  1UI6 A;  3MNL A;  4HKU A;  3B6A A;  2X6O A;  3ZQI A;  2OPT A;  2XPW A;  3QKX A;  2GEN A;  4NEL A;  3Q0U A;  4JKZ A;  2QTQ A;  1ZK8 A;  2G7G A;  5D19 A;  2UXH A;  4GFL A;  3BHQ A;  2XGC A;  4JYK A;  2NX4 A;  1JUP A;  5IPA A;  3EUP A;  4I6Z A;  5CXI A;  4X1E A;  1Z0X A;  1ORK A;  4AUX A;  2JK3 A;  4DW6 A;  2XRL A;  2RAE A;  2WV1 A;  3Q0W A;  3JSJ A;  1SGM A;  3LHQ A;  4V2F A;  3O60 A;  5IOY A;  1VI0 A;  2Y31 A;  2YVE A;  3VW0 A;  3PM1 A;  5K58 A;  4W97 A;  1BJZ A;  3BQZ A;  3EGQ A;  2DG8 A;  3VIB A;  1JTX A;  2HYJ A;  4KWA A;  4UDS A;  3B6C A;  5CW8 A;  1A6I A;  3G1O A;  2W53 A;  2TRT A;  2HQ5 A;  3G1M A;  3V78 A;  2OF7 A;  5J1U A;  5EZG A;  2ZOY A;  2QKO A;  3DCF A;  3IH4 A;  3FRQ A;  2HXI A;  3GEU A;  3VVZ A;  2DG7 A;  2Y30 A;  2G3B A;  3BTL A;  5HAW A;  3ANG A;  3ANP A;  3CWR A;  5FKN A;  3RH2 A;  5F08 A;  2ID6 A;  2F07 A;  2ID3 A;  4W1U A;  1U9N A;  5CXG A;  5K7F A;  3IH3 A;  2ZOZ A;  4GCT A;  5HSZ A;  2D6Y A;  5D18 A;  3ON4 A;  3KKC A;  3HTH A;  4M3D A;  5EZH A;  5FKK A;  2FD5 A;  4M3B A;  3QPS A;  4GFK A;  3BT9 A;  4AC0 A;  3Q0V A;  4D5C A;  1T56 A;  3WHC A;  4GCK A;  1JT0 A;  5F1J A;  3P9T A;  1U9O A;  5H9T A;  2RAS A;  3VPR A;  2QIB A;  3IH2 A;  3CJD A;  4ABZ A;  1QPI A;  4CGR A;  2OI8 A;  4B1R A;  3HE0 A;  2UXP A;  2UXI A;  1T33 A;  3LSR A;  5F0C A;  3VW1 A;  3VOK A;  2ZCM A;  3CRJ A;  4D7N A;  3KZ9 A;  4JL3 A;  3O8G A;  1Z77 A;  3BR6 A;  2X9D A;  5FGL A;  3DEW A;  2Y2Z A;  3ON2 A;  3COL A;  4PXI A;  1ZKG A;  5D1R A;  3SFI A;  2VKV A;  5K7Z A;  3VW2 A;  1RKT A;  2G7L A;  2IEK A;  3AQT A;  3LJL A;  4B3A A;  2ZCX A;  5J1Y A;  5AQC A;  3BRU A;  3QQA A;  3G1L A;  5FHP A;  3BTC A;  4MK6 A;  3FK6 A; 
#chains in the Genus database with same CATH topology
 3BTJ A;  3VVY A;  3KNW A;  4C2M A;  5GPA A;  3BR0 A;  3HGY A;  3ZQG A;  5J3L A;  5IP6 A;  2Q24 A;  2OER A;  5J1R A;  2HKU A;  1UI5 A;  3NNR A;  3VVX A;  3PAS A;  1JUS A;  3SDG A;  2NS7 A;  4GCL A;  2GBY A;  5EFY A;  3G56 A;  2HYT A;  4ME9 A;  2XB5 A;  1RKW A;  3VOX A;  3T6N A;  3Q3S A;  2ZCN A;  3C07 A;  2RHA A;  2GUH A;  3BQY A;  5CQG A;  5K7H A;  2FBQ A;  3C2B A;  2QWT A;  3BR1 A;  3TP0 A;  5GP9 A;  2ZY9 A;  3GZI A;  3ZQH A;  4M3F A;  3CCY A;  1JT6 A;  5DAJ A;  5IOZ A;  3F1B A;  3BR5 A;  3KKD A;  3G7R A;  2O7O A;  2XDN A;  5FMP A;  5HBU A;  2I10 A;  4MXM A;  2EH3 A;  3QPL A;  3BTI A;  3RD3 A;  2WGB A;  2B3W A;  2PBX A;  5FKO A;  3HTI A;  2IU5 A;  3LSP A;  3F0C A;  3IUV A;  3BJB A;  3V6G A;  2HXO A;  2QCO A;  2FX0 A;  3BR3 A;  5F27 A;  3ZQL A;  2NP5 A;  2YVX A;  2FJ1 A;  2V57 A;  3S5R A;  4M3G A;  2TCT A;  3HGG A;  3VUQ A;  2R7S A;  5FKL A;  3NI7 A;  2FQ4 A;  3LWJ A;  3LOC A;  3NXC A;  3FK7 A;  2WUI A;  3B81 A;  2G7S A;  3VP5 A;  3VTI A;  2O7T A;  2R7U A;  2ZB9 A;  3DU6 A;  5FKM A;  2REK A;  4XK4 A;  4V2G A;  2IBD A;  1RPW A;  3NS4 A;  2G0E A;  3E7Q A;  2PZ9 A;  2VPR A;  5F0F A;  2NS8 A;  2UXO A;  5EYR A;  1JUM A;  4L62 A;  5C4Y A;  4AC6 A;  3NPI A;  2QOP A;  2XPV A;  3BNI A;  3CDL A;  3TP3 A;  3ZQF A;  1QVT A;  2VKE A;  4D5F A;  3WHB A;  3FIW A;  3MVP A;  2GFN A;  2JJ7 A;  3AQS A;  2IAI A;  3FHN A;  3PPB A;  3BR2 A;  3HTJ A;  5F04 A;  1QVU A;  2XGE A;  1JTY A;  4NN1 A;  3QBM A;  4ACI A;  2XPU A;  2NP3 A;  3DU5 A;  4MO7 A;  3O8H A;  3LSJ A;  2DTZ A;  3HTA A;  2YVH A;  4AF5 A;  2UXU A;  2XGD A;  4I76 A;  3DPJ A;  4D7M A;  4ICH A;  5GPC A;  3HIM A;  4M3E A;  4G12 A;  3BCG A;  5F0H A;  3NRG A;  4JNN A;  4YZE A;  1UI6 A;  3MNL A;  4HKU A;  3KYL A;  3B6A A;  2X6O A;  3ZQI A;  2OPT A;  2R7V A;  2XPW A;  3QKX A;  2GEN A;  4NEL A;  3K8P C;  4IRV A;  3Q0U A;  4JKZ A;  2QTQ A;  1ZK8 A;  2R7Q A;  2G7G A;  5D19 A;  2R7W A;  2UXH A;  4GFL A;  3BHQ A;  2XGC A;  4JYK A;  2NX4 A;  1JUP A;  5IPA A;  3EUP A;  4I6Z A;  5CXI A;  4X1E A;  1Z0X A;  1ORK A;  4AUX A;  4U9L A;  2JK3 A;  2B1E A;  4DW6 A;  2XRL A;  2RAE A;  2WV1 A;  3Q0W A;  3JSJ A;  1SGM A;  2FJI 1;  3LHQ A;  4V2F A;  3O60 A;  5IOY A;  1VI0 A;  2Y31 A;  2YVE A;  3VW0 A;  3PM1 A;  5K58 A;  4W97 A;  1BJZ A;  3BQZ A;  3EGQ A;  2DG8 A;  1JTX A;  2HYJ A;  3VIB A;  4KWA A;  4UDS A;  3B6C A;  5CW8 A;  1A6I A;  3G1O A;  2W53 A;  2TRT A;  2HQ5 A;  3G1M A;  3V78 A;  2OF7 A;  5J1U A;  4OD4 A;  5EZG A;  2ZOY A;  2QKO A;  2PFV A;  2R7X A;  3DCF A;  3IH4 A;  3FRQ A;  2HXI A;  3GEU A;  4DVY P;  3VVZ A;  2DG7 A;  2Y30 A;  2G3B A;  3BTL A;  5HAW A;  3ANG A;  3ANP A;  3SWH A;  3CWR A;  5FKN A;  3RH2 A;  2A2F X;  5F08 A;  2ID6 A;  2F07 A;  2ID3 A;  4W1U A;  1U9N A;  5CXG A;  5K7F A;  3IH3 A;  2ZOZ A;  4GCT A;  5HSZ A;  2D6Y A;  5D18 A;  3ON4 A;  3KKC A;  3HTH A;  4M3D A;  5EZH A;  5FKK A;  2FD5 A;  4M3B A;  3QPS A;  4GFK A;  4U9N A;  3BT9 A;  4AC0 A;  3Q0V A;  4D5C A;  1T56 A;  3WHC A;  4GCK A;  1JT0 A;  5F1J A;  3P9T A;  1U9O A;  5H9T A;  2RAS A;  2QIB A;  3VPR A;  4OD5 A;  3IH2 A;  3CJD A;  4ABZ A;  1QPI A;  4CGR A;  2OI8 A;  4B1R A;  3HE0 A;  2UXP A;  2UXI A;  1T33 A;  3LSR A;  4WIB A;  2R7R A;  5F0C A;  3VW1 A;  3VOK A;  2ZCM A;  3CRJ A;  4D7N A;  3KZ9 A;  2R7T A;  4JL3 A;  3O8G A;  1Z77 A;  2R7O A;  3BR6 A;  2X9D A;  5FGL A;  3DEW A;  2Y2Z A;  3ON2 A;  3COL A;  4PXI A;  1ZKG A;  5D1R A;  3SFI A;  2VKV A;  5K7Z A;  3VW2 A;  1RKT A;  2G7L A;  2IEK A;  3AQT A;  3LJL A;  4B3A A;  2ZCX A;  5J1Y A;  5AQC A;  3BRU A;  3QQA A;  3G1L A;  5FHP A;  3BTC A;  4MK6 A;  3FK6 A; 
#chains in the Genus database with same CATH homology
 3BTJ A;  3VVY A;  3KNW A;  5GPA A;  3BR0 A;  3HGY A;  3ZQG A;  5J3L A;  5IP6 A;  2Q24 A;  2OER A;  5J1R A;  2HKU A;  1UI5 A;  3NNR A;  3VVX A;  3PAS A;  1JUS A;  3SDG A;  2NS7 A;  4GCL A;  2GBY A;  5EFY A;  3G56 A;  2HYT A;  4ME9 A;  2XB5 A;  1RKW A;  3VOX A;  3T6N A;  3Q3S A;  2ZCN A;  3C07 A;  2RHA A;  2GUH A;  3BQY A;  5K7H A;  2FBQ A;  3C2B A;  2QWT A;  3BR1 A;  3TP0 A;  5GP9 A;  3GZI A;  3ZQH A;  4M3F A;  3CCY A;  1JT6 A;  5DAJ A;  5IOZ A;  3F1B A;  3BR5 A;  3KKD A;  3G7R A;  2O7O A;  2XDN A;  5FMP A;  5HBU A;  2I10 A;  4MXM A;  2EH3 A;  3QPL A;  3BTI A;  3RD3 A;  2WGB A;  2PBX A;  5FKO A;  3HTI A;  2IU5 A;  3LSP A;  3F0C A;  3IUV A;  3BJB A;  3V6G A;  2HXO A;  2QCO A;  2FX0 A;  3BR3 A;  5F27 A;  3ZQL A;  2NP5 A;  2FJ1 A;  2V57 A;  3S5R A;  4M3G A;  2TCT A;  3HGG A;  3VUQ A;  5FKL A;  3NI7 A;  2FQ4 A;  3LWJ A;  3LOC A;  3NXC A;  3FK7 A;  2WUI A;  3B81 A;  2G7S A;  3VP5 A;  2O7T A;  2ZB9 A;  5FKM A;  2REK A;  4XK4 A;  4V2G A;  2IBD A;  1RPW A;  2G0E A;  3E7Q A;  2PZ9 A;  2VPR A;  5F0F A;  2NS8 A;  2UXO A;  5EYR A;  1JUM A;  4L62 A;  5C4Y A;  4AC6 A;  3NPI A;  2QOP A;  2XPV A;  3BNI A;  3CDL A;  3TP3 A;  3ZQF A;  1QVT A;  2VKE A;  4D5F A;  3WHB A;  3FIW A;  3MVP A;  2GFN A;  2JJ7 A;  3AQS A;  2IAI A;  3PPB A;  3BR2 A;  3HTJ A;  5F04 A;  1QVU A;  2XGE A;  1JTY A;  4NN1 A;  3QBM A;  4ACI A;  2XPU A;  2NP3 A;  4MO7 A;  3O8H A;  3LSJ A;  2DTZ A;  3HTA A;  2YVH A;  4AF5 A;  2UXU A;  2XGD A;  4I76 A;  3DPJ A;  4D7M A;  4ICH A;  5GPC A;  3HIM A;  4M3E A;  4G12 A;  3BCG A;  5F0H A;  3NRG A;  4JNN A;  4YZE A;  1UI6 A;  3MNL A;  4HKU A;  3B6A A;  2X6O A;  3ZQI A;  2OPT A;  2XPW A;  3QKX A;  2GEN A;  4NEL A;  3Q0U A;  4JKZ A;  2QTQ A;  1ZK8 A;  2G7G A;  5D19 A;  2UXH A;  4GFL A;  3BHQ A;  2XGC A;  4JYK A;  2NX4 A;  1JUP A;  5IPA A;  3EUP A;  4I6Z A;  5CXI A;  4X1E A;  1Z0X A;  1ORK A;  4AUX A;  2JK3 A;  4DW6 A;  2XRL A;  2RAE A;  2WV1 A;  3Q0W A;  3JSJ A;  1SGM A;  3LHQ A;  4V2F A;  3O60 A;  5IOY A;  1VI0 A;  2Y31 A;  2YVE A;  3VW0 A;  3PM1 A;  5K58 A;  4W97 A;  1BJZ A;  3BQZ A;  3EGQ A;  2DG8 A;  3VIB A;  1JTX A;  2HYJ A;  4KWA A;  4UDS A;  3B6C A;  5CW8 A;  1A6I A;  3G1O A;  2W53 A;  2TRT A;  2HQ5 A;  3G1M A;  3V78 A;  2OF7 A;  5J1U A;  5EZG A;  2ZOY A;  2QKO A;  3DCF A;  3IH4 A;  3FRQ A;  2HXI A;  3GEU A;  3VVZ A;  2DG7 A;  2Y30 A;  2G3B A;  3BTL A;  5HAW A;  3ANG A;  3ANP A;  3CWR A;  5FKN A;  3RH2 A;  5F08 A;  2ID6 A;  2F07 A;  2ID3 A;  4W1U A;  1U9N A;  5CXG A;  5K7F A;  3IH3 A;  2ZOZ A;  4GCT A;  5HSZ A;  2D6Y A;  5D18 A;  3ON4 A;  3KKC A;  3HTH A;  4M3D A;  5EZH A;  5FKK A;  2FD5 A;  4M3B A;  3QPS A;  4GFK A;  3BT9 A;  4AC0 A;  3Q0V A;  4D5C A;  1T56 A;  3WHC A;  4GCK A;  1JT0 A;  5F1J A;  3P9T A;  1U9O A;  5H9T A;  2RAS A;  3VPR A;  2QIB A;  3IH2 A;  3CJD A;  4ABZ A;  1QPI A;  4CGR A;  2OI8 A;  4B1R A;  3HE0 A;  2UXP A;  2UXI A;  1T33 A;  3LSR A;  5F0C A;  3VW1 A;  3VOK A;  2ZCM A;  3CRJ A;  4D7N A;  3KZ9 A;  4JL3 A;  3O8G A;  1Z77 A;  3BR6 A;  2X9D A;  5FGL A;  3DEW A;  2Y2Z A;  3ON2 A;  3COL A;  4PXI A;  1ZKG A;  5D1R A;  3SFI A;  2VKV A;  5K7Z A;  3VW2 A;  1RKT A;  2G7L A;  2IEK A;  3AQT A;  3LJL A;  4B3A A;  2ZCX A;  5J1Y A;  5AQC A;  3BRU A;  3QQA A;  3G1L A;  5FHP A;  3BTC A;  4MK6 A;  3FK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...