4NN1A

Crystal structure of transcriptional regulator rv1219c of mycobacterium tuberculosis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
LTAHARIREAAIEQFGRHGFGVGLRAIAEAAGVSAALVIHHFGSKEGLRKACDDFVAEEIRSSKAAALKSNDPTTWLAQMAEIESYAPLMAYLVRSMQSGGELAKMLWQKMIDNAEEYLDEGVRAGTVKPSRDPRARARFLAITGGGGFLLYLQMHENPTDLRAALRDYAHDMVLPSLEVYTEGLLADRAMYEAFLAEAQQGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of the transcriptional regulator Rv1219c of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 81
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17933 TetR_C_25 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4nn1A00
1Z77A 3HTAA 2O7OA 1T33A 3ZQFA 2OI8A 3O8HA 3LSPA 3G1MA 2ZOYA 3EUPA 3LWJA 2ZCMA 3BR0A 1RKWA 2ZOZA 3VOXA 5F04A 1UI6A 2HYTA 2YVEA 4M3BA 2UXIA 3VPRA 3BT9A 3VP5A 4I76A 4M3GA 2GUHA 3BHQA 2IBDA 3LJLA 4DW6A 5F08A 3VW0A 4D7NA 3DCFA 3VVYA 4ACIA 5HAWA 3LOCA 4MO7A 3Q0VA 2XB5A 3F1BA 4V2GA 2VKVA 3TP3A 5FKNA 5K7ZA 2TRTA 3C07A 4JNNA 3G7RA 4PXIA 1JUMA 5F1JA 2OERA 3BQZA 3LHQA 5CW8A 3NXCA 3V78A 5F0CA 2IEKA 4X1EA 2XPVA 3BR3A 2XPWA 3FIWA 4D7MA 1JT0A 3F0CA 3IUVA 4GFKA 4GFLA 4B3AA 5HSZA 4G12A 3ANGA 5AQCA 2XPUA 5CXIA 3VW1A 3QKXA 3BJBA 5EZGA 5CXGA 2NS7A 3EGQA 3HTHA 2HYJA 5F0FA 2GENA 5EZHA 4M3DA 3V6GA 3FK7A 3G1OA 2WV1A 3GZIA 2G0EA 2RAEA 1QVUA 3WHBA 2UXPA 2EH3A 5IPAA 1Z0XA 5K7FA 5FKOA 3RH2A 2Q24A 3ZQLA 3VVZA 5J1UA 3AQSA 4AC6A 4I6ZA 5IP6A 4V2FA 4XK4A 3LSJA 1ZKGA 3PM1A 5J1YA 3VW2A 4GCLA 3QPSA 2HKUA 3SFIA 2DG7A 2G7SA 2ID6A 1JTXA 3KKCA 5HBUA 5H9TA 5GPCA 5FKMA 2DTZA 5IOYA 1JUSA 3G1LA 2DG8A 4JL3A 3B6CA 4L62A 3COLA 2ID3A 3KNWA 4YZEA 4GCTA 2QCOA 2UXOA 5D1RA 2FD5A 3QBMA 2X9DA 4W1UA 3Q3SA 3T6NA 5F0HA 2GBYA 4MK6A 5GPAA 3CDLA 3IH3A 5FGLA 3NRGA 3JSJA 3BR2A 3C2BA 3MNLA 3P9TA 3IH4A 2VPRA 2PZ9A 2Y2ZA 2RASA 3FK6A 2TCTA 3DEWA 2IAIA 2OF7A 1U9OA 2REKA 3CCYA 3HTJA 2RHAA 2FBQA 2W53A 3ANPA 1T56A 2VKEA 3ZQHA 2UXUA 2G7LA 2QTQA 3KZ9A 5C4YA 3DPJA 5EFYA 5J1RA 3ON2A 2WGBA 1SGMA 5FKLA 4CGRA 4W97A 1A6IA 5F27A 2Y31A 4D5FA 2G7GA 3FRQA 3HGYA 5FHPA 2JK3A 3B6AA 3BTJA 3ZQGA 3SDGA 3CRJA 1UI5A 3BTCA 2HXOA 2QOPA 3BR5A 4M3EA 3CJDA 2XGDA 3TP0A 2FX0A 4ME9A 1ORKA 3B81A 2IU5A 2F07A 4AUXA 5GP9A 3ON4A 3QPLA 1RPWA 1QVTA 3HGGA 4GCKA 2NP3A 3GEUA 3Q0UA 4NELA 3HE0A 3CWRA 4MXMA 2OPTA 2X6OA 2XGEA 5D18A 5IOZA 5K58A 3BR1A 3S5RA 2ZCNA 2PBXA 3AQTA 3G56A 2JJ7A 2XDNA 3VIBA 4AF5A 5K7HA 3VUQA 1JTYA 3WHCA 5J3LA 4JKZA 4ABZA 3VOKA 3BTIA 4JYKA 3NI7A 1QPIA 3NPIA 4ICHA 3E7QA 2QIBA 3BR6A 3O60A 2G3BA 2GFNA 5EYRA 1JUPA 1ZK8A 4HKUA 2XRLA 2HQ5A 1BJZA 2QWTA 3KKDA 1JT6A 3NNRA 2I10A 4NN1A 3PPBA 2XGCA 4KWAA 2FJ1A 4UDSA 3LSRA 3BNIA 3HTIA 3QQAA 4D5CA 1VI0A 3RD3A 5FMPA 4AC0A 2V57A 2HXIA 3Q0WA 3BTLA 5DAJA 1RKTA 2UXHA 2QKOA 3VVXA 2NP5A 2Y30A 2ZCXA 2NX4A 3BCGA 2ZB9A 4B1RA 3ZQIA 3PASA 4M3FA 2WUIA 2FQ4A 5D19A 3BQYA 2D6YA 5FKKA 3HIMA 3O8GA 3MVPA 2O7TA 2YVHA 3BRUA 1U9NA 3IH2A 2NS8A
chains in the Genus database with same CATH superfamily
1Z77A 3HTAA 2O7OA 3DU5A 1T33A 4U9NA 2OI8A 3O8HA 3ZQFA 3LSPA 3G1MA 2ZOYA 3EUPA 3LWJA 2ZCMA 3BR0A 4WIBA 1RKWA 2ZOZA 3FHNA 3VOXA 5F04A 1UI6A 4C2MA 2HYTA 2YVEA 5CQGA 4M3BA 2UXIA 2FJI1 3VPRA 3BT9A 3VP5A 4I76A 4M3GA 2GUHA 3BHQA 2IBDA 3LJLA 4DW6A 5F08A 3VW0A 4D7NA 3DCFA 3VVYA 4ACIA 5HAWA 3LOCA 4MO7A 3Q0VA 2XB5A 3F1BA 4V2GA 2VKVA 3TP3A 5FKNA 5K7ZA 2TRTA 3C07A 4JNNA 3G7RA 4PXIA 1JUMA 5F1JA 2OERA 3BQZA 3LHQA 5CW8A 3NXCA 3V78A 5F0CA 2IEKA 4X1EA 2XPVA 3BR3A 2XPWA 3FIWA 2R7QA 4D7MA 1JT0A 3F0CA 3IUVA 4GFKA 4GFLA 4B3AA 5HSZA 4G12A 3ANGA 5AQCA 2XPUA 2B3WA 3SWHA 5CXIA 3VW1A 4OD4A 3QKXA 3BJBA 5EZGA 5CXGA 2NS7A 3EGQA 3HTHA 2HYJA 5F0FA 2GENA 5EZHA 4M3DA 3V6GA 3FK7A 4DVYP 3G1OA 2WV1A 3GZIA 2G0EA 2RAEA 1QVUA 3WHBA 2UXPA 2EH3A 5IPAA 1Z0XA 5K7FA 5FKOA 3RH2A 2Q24A 3ZQLA 3VVZA 5J1UA 3AQSA 4AC6A 4I6ZA 5IP6A 4V2FA 4XK4A 3LSJA 1ZKGA 3PM1A 5J1YA 3VW2A 4GCLA 3QPSA 2R7OA 2HKUA 3KYLA 3SFIA 2DG7A 2G7SA 2ID6A 1JTXA 3KKCA 5HBUA 5H9TA 5GPCA 2PFVA 5FKMA 2DTZA 5IOYA 1JUSA 3G1LA 2DG8A 4JL3A 3B6CA 4L62A 3COLA 3VTIA 2ID3A 3KNWA 4YZEA 4GCTA 2QCOA 2UXOA 5D1RA 2FD5A 3QBMA 2X9DA 4W1UA 3Q3SA 3T6NA 2YVXA 5F0HA 2GBYA 4MK6A 5GPAA 3CDLA 3IH3A 5FGLA 3NRGA 3JSJA 3BR2A 3C2BA 3MNLA 3P9TA 3IH4A 2VPRA 2PZ9A 2R7UA 2Y2ZA 2RASA 3FK6A 2TCTA 3DEWA 2IAIA 2OF7A 1U9OA 2REKA 3CCYA 3HTJA 2RHAA 2FBQA 2W53A 3ANPA 1T56A 2VKEA 3ZQHA 2UXUA 2G7LA 2R7VA 2QTQA 3KZ9A 5C4YA 3DPJA 5EFYA 5J1RA 3ON2A 2WGBA 1SGMA 5FKLA 4CGRA 4W97A 1A6IA 4U9LA 5F27A 2Y31A 4D5FA 2G7GA 3FRQA 3HGYA 5FHPA 2JK3A 3B6AA 3BTJA 3NS4A 3ZQGA 3SDGA 3CRJA 1UI5A 2A2FX 3BTCA 2HXOA 2QOPA 3BR5A 4M3EA 3CJDA 2XGDA 3TP0A 2FX0A 4ME9A 1ORKA 3B81A 2IU5A 2F07A 4AUXA 5GP9A 3ON4A 3QPLA 1RPWA 1QVTA 3HGGA 4GCKA 2NP3A 3GEUA 3Q0UA 4NELA 3HE0A 3CWRA 4MXMA 2OPTA 2X6OA 2XGEA 5D18A 5IOZA 5K58A 3BR1A 3S5RA 2ZCNA 2PBXA 3AQTA 3G56A 4OD5A 2JJ7A 2XDNA 3VIBA 4AF5A 5K7HA 3VUQA 1JTYA 3WHCA 5J3LA 4JKZA 4ABZA 3VOKA 2R7TA 3BTIA 4JYKA 2R7XA 3NI7A 1QPIA 3NPIA 4ICHA 3E7QA 2QIBA 3BR6A 3O60A 2G3BA 2GFNA 5EYRA 1JUPA 1ZK8A 4IRVA 2ZY9A 4HKUA 2XRLA 2HQ5A 1BJZA 2QWTA 3KKDA 1JT6A 3NNRA 2I10A 4NN1A 3PPBA 2XGCA 4KWAA 2FJ1A 4UDSA 3LSRA 2R7WA 3BNIA 3HTIA 3QQAA 4D5CA 1VI0A 3RD3A 5FMPA 2R7SA 4AC0A 2V57A 2HXIA 3Q0WA 2R7RA 3BTLA 5DAJA 1RKTA 3K8PC 2UXHA 2QKOA 3VVXA 2NP5A 2Y30A 2ZCXA 2NX4A 3BCGA 2B1EA 2ZB9A 3DU6A 4B1RA 3ZQIA 3PASA 4M3FA 2WUIA 2FQ4A 5D19A 3BQYA 2D6YA 5FKKA 3HIMA 3O8GA 3MVPA 2O7TA 2YVHA 3BRUA 1U9NA 3IH2A 2NS8A
chains in the Genus database with same CATH topology
1Z77A 3HTAA 2O7OA 1T33A 3ZQFA 2OI8A 3O8HA 3LSPA 3G1MA 2ZOYA 3EUPA 3LWJA 2ZCMA 3BR0A 1RKWA 2ZOZA 3VOXA 5F04A 1UI6A 2HYTA 2YVEA 4M3BA 2UXIA 3VPRA 3BT9A 3VP5A 4I76A 4M3GA 2GUHA 3BHQA 2IBDA 3LJLA 4DW6A 5F08A 3VW0A 4D7NA 3DCFA 3VVYA 4ACIA 5HAWA 3LOCA 4MO7A 3Q0VA 2XB5A 3F1BA 4V2GA 2VKVA 3TP3A 5FKNA 5K7ZA 2TRTA 3C07A 4JNNA 3G7RA 4PXIA 1JUMA 5F1JA 2OERA 3BQZA 3LHQA 5CW8A 3NXCA 3V78A 5F0CA 2IEKA 4X1EA 2XPVA 3BR3A 2XPWA 3FIWA 4D7MA 1JT0A 3F0CA 3IUVA 4GFKA 4GFLA 4B3AA 5HSZA 4G12A 3ANGA 5AQCA 2XPUA 5CXIA 3VW1A 3QKXA 3BJBA 5EZGA 5CXGA 2NS7A 3EGQA 3HTHA 2HYJA 5F0FA 2GENA 5EZHA 4M3DA 3V6GA 3FK7A 3G1OA 2WV1A 3GZIA 2G0EA 2RAEA 1QVUA 3WHBA 2UXPA 2EH3A 5IPAA 1Z0XA 5K7FA 5FKOA 3RH2A 2Q24A 3ZQLA 3VVZA 5J1UA 3AQSA 4AC6A 4I6ZA 5IP6A 4V2FA 4XK4A 3LSJA 1ZKGA 3PM1A 5J1YA 3VW2A 4GCLA 3QPSA 2HKUA 3SFIA 2DG7A 2G7SA 2ID6A 1JTXA 3KKCA 5HBUA 5H9TA 5GPCA 5FKMA 2DTZA 5IOYA 1JUSA 3G1LA 2DG8A 4JL3A 3B6CA 4L62A 3COLA 2ID3A 3KNWA 4YZEA 4GCTA 2QCOA 2UXOA 5D1RA 2FD5A 3QBMA 2X9DA 4W1UA 3Q3SA 3T6NA 5F0HA 2GBYA 4MK6A 5GPAA 3CDLA 3IH3A 5FGLA 3NRGA 3JSJA 3BR2A 3C2BA 3MNLA 3P9TA 3IH4A 2VPRA 2PZ9A 2Y2ZA 2RASA 3FK6A 2TCTA 3DEWA 2IAIA 2OF7A 1U9OA 2REKA 3CCYA 3HTJA 2RHAA 2FBQA 2W53A 3ANPA 1T56A 2VKEA 3ZQHA 2UXUA 2G7LA 2QTQA 3KZ9A 5C4YA 3DPJA 5EFYA 5J1RA 3ON2A 2WGBA 1SGMA 5FKLA 4CGRA 4W97A 1A6IA 5F27A 2Y31A 4D5FA 2G7GA 3FRQA 3HGYA 5FHPA 2JK3A 3B6AA 3BTJA 3ZQGA 3SDGA 3CRJA 1UI5A 3BTCA 2HXOA 2QOPA 3BR5A 4M3EA 3CJDA 2XGDA 3TP0A 2FX0A 4ME9A 1ORKA 3B81A 2IU5A 2F07A 4AUXA 5GP9A 3ON4A 3QPLA 1RPWA 1QVTA 3HGGA 4GCKA 2NP3A 3GEUA 3Q0UA 4NELA 3HE0A 3CWRA 4MXMA 2OPTA 2X6OA 2XGEA 5D18A 5IOZA 5K58A 3BR1A 3S5RA 2ZCNA 2PBXA 3AQTA 3G56A 2JJ7A 2XDNA 3VIBA 4AF5A 5K7HA 3VUQA 1JTYA 3WHCA 5J3LA 4JKZA 4ABZA 3VOKA 3BTIA 4JYKA 3NI7A 1QPIA 3NPIA 4ICHA 3E7QA 2QIBA 3BR6A 3O60A 2G3BA 2GFNA 5EYRA 1JUPA 1ZK8A 4HKUA 2XRLA 2HQ5A 1BJZA 2QWTA 3KKDA 1JT6A 3NNRA 2I10A 4NN1A 3PPBA 2XGCA 4KWAA 2FJ1A 4UDSA 3LSRA 3BNIA 3HTIA 3QQAA 4D5CA 1VI0A 3RD3A 5FMPA 4AC0A 2V57A 2HXIA 3Q0WA 3BTLA 5DAJA 1RKTA 2UXHA 2QKOA 3VVXA 2NP5A 2Y30A 2ZCXA 2NX4A 3BCGA 2ZB9A 4B1RA 3ZQIA 3PASA 4M3FA 2WUIA 2FQ4A 5D19A 3BQYA 2D6YA 5FKKA 3HIMA 3O8GA 3MVPA 2O7TA 2YVHA 3BRUA 1U9NA 3IH2A 2NS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z77 A;  3HTA A;  2O7O A;  1T33 A;  3ZQF A;  2OI8 A;  3O8H A;  3LSP A;  3G1M A;  2ZOY A;  3EUP A;  3LWJ A;  2ZCM A;  3BR0 A;  1RKW A;  2ZOZ A;  3VOX A;  5F04 A;  1UI6 A;  2HYT A;  2YVE A;  4M3B A;  2UXI A;  3VPR A;  3BT9 A;  3VP5 A;  4I76 A;  4M3G A;  2GUH A;  3BHQ A;  2IBD A;  3LJL A;  4DW6 A;  5F08 A;  3VW0 A;  4D7N A;  3DCF A;  3VVY A;  4ACI A;  5HAW A;  3LOC A;  4MO7 A;  3Q0V A;  2XB5 A;  3F1B A;  4V2G A;  2VKV A;  3TP3 A;  5FKN A;  5K7Z A;  2TRT A;  3C07 A;  4JNN A;  3G7R A;  4PXI A;  1JUM A;  5F1J A;  2OER A;  3BQZ A;  3LHQ A;  5CW8 A;  3NXC A;  3V78 A;  5F0C A;  2IEK A;  4X1E A;  2XPV A;  3BR3 A;  2XPW A;  3FIW A;  4D7M A;  1JT0 A;  3F0C A;  3IUV A;  4GFK A;  4GFL A;  4B3A A;  5HSZ A;  4G12 A;  3ANG A;  5AQC A;  2XPU A;  5CXI A;  3VW1 A;  3QKX A;  3BJB A;  5EZG A;  5CXG A;  2NS7 A;  3EGQ A;  3HTH A;  2HYJ A;  5F0F A;  2GEN A;  5EZH A;  4M3D A;  3V6G A;  3FK7 A;  3G1O A;  2WV1 A;  3GZI A;  2G0E A;  2RAE A;  1QVU A;  3WHB A;  2UXP A;  2EH3 A;  5IPA A;  1Z0X A;  5K7F A;  5FKO A;  3RH2 A;  2Q24 A;  3ZQL A;  3VVZ A;  5J1U A;  3AQS A;  4AC6 A;  4I6Z A;  5IP6 A;  4V2F A;  4XK4 A;  3LSJ A;  1ZKG A;  3PM1 A;  5J1Y A;  3VW2 A;  4GCL A;  3QPS A;  2HKU A;  3SFI A;  2DG7 A;  2G7S A;  2ID6 A;  1JTX A;  3KKC A;  5HBU A;  5H9T A;  5GPC A;  5FKM A;  2DTZ A;  5IOY A;  1JUS A;  3G1L A;  2DG8 A;  4JL3 A;  3B6C A;  4L62 A;  3COL A;  2ID3 A;  3KNW A;  4YZE A;  4GCT A;  2QCO A;  2UXO A;  5D1R A;  2FD5 A;  3QBM A;  2X9D A;  4W1U A;  3Q3S A;  3T6N A;  5F0H A;  2GBY A;  4MK6 A;  5GPA A;  3CDL A;  3IH3 A;  5FGL A;  3NRG A;  3JSJ A;  3BR2 A;  3C2B A;  3MNL A;  3P9T A;  3IH4 A;  2VPR A;  2PZ9 A;  2Y2Z A;  2RAS A;  3FK6 A;  2TCT A;  3DEW A;  2IAI A;  2OF7 A;  1U9O A;  2REK A;  3CCY A;  3HTJ A;  2RHA A;  2FBQ A;  2W53 A;  3ANP A;  1T56 A;  2VKE A;  3ZQH A;  2UXU A;  2G7L A;  2QTQ A;  3KZ9 A;  5C4Y A;  3DPJ A;  5EFY A;  5J1R A;  3ON2 A;  2WGB A;  1SGM A;  5FKL A;  4CGR A;  4W97 A;  1A6I A;  5F27 A;  2Y31 A;  4D5F A;  2G7G A;  3FRQ A;  3HGY A;  5FHP A;  2JK3 A;  3B6A A;  3BTJ A;  3ZQG A;  3SDG A;  3CRJ A;  1UI5 A;  3BTC A;  2HXO A;  2QOP A;  3BR5 A;  4M3E A;  3CJD A;  2XGD A;  3TP0 A;  2FX0 A;  4ME9 A;  1ORK A;  3B81 A;  2IU5 A;  2F07 A;  4AUX A;  5GP9 A;  3ON4 A;  3QPL A;  1RPW A;  1QVT A;  3HGG A;  4GCK A;  2NP3 A;  3GEU A;  3Q0U A;  4NEL A;  3HE0 A;  3CWR A;  4MXM A;  2OPT A;  2X6O A;  2XGE A;  5D18 A;  5IOZ A;  5K58 A;  3BR1 A;  3S5R A;  2ZCN A;  2PBX A;  3AQT A;  3G56 A;  2JJ7 A;  2XDN A;  3VIB A;  4AF5 A;  5K7H A;  3VUQ A;  1JTY A;  3WHC A;  5J3L A;  4JKZ A;  4ABZ A;  3VOK A;  3BTI A;  4JYK A;  3NI7 A;  1QPI A;  3NPI A;  4ICH A;  3E7Q A;  2QIB A;  3BR6 A;  3O60 A;  2G3B A;  2GFN A;  5EYR A;  1JUP A;  1ZK8 A;  4HKU A;  2XRL A;  2HQ5 A;  1BJZ A;  2QWT A;  3KKD A;  1JT6 A;  3NNR A;  2I10 A;  4NN1 A;  3PPB A;  2XGC A;  4KWA A;  2FJ1 A;  4UDS A;  3LSR A;  3BNI A;  3HTI A;  3QQA A;  4D5C A;  1VI0 A;  3RD3 A;  5FMP A;  4AC0 A;  2V57 A;  2HXI A;  3Q0W A;  3BTL A;  5DAJ A;  1RKT A;  2UXH A;  2QKO A;  3VVX A;  2NP5 A;  2Y30 A;  2ZCX A;  2NX4 A;  3BCG A;  2ZB9 A;  4B1R A;  3ZQI A;  3PAS A;  4M3F A;  2WUI A;  2FQ4 A;  5D19 A;  3BQY A;  2D6Y A;  5FKK A;  3HIM A;  3O8G A;  3MVP A;  2O7T A;  2YVH A;  3BRU A;  1U9N A;  3IH2 A;  2NS8 A; 
#chains in the Genus database with same CATH topology
 1Z77 A;  3HTA A;  2O7O A;  3DU5 A;  1T33 A;  4U9N A;  2OI8 A;  3O8H A;  3ZQF A;  3LSP A;  3G1M A;  2ZOY A;  3EUP A;  3LWJ A;  2ZCM A;  3BR0 A;  4WIB A;  1RKW A;  2ZOZ A;  3FHN A;  3VOX A;  5F04 A;  1UI6 A;  4C2M A;  2HYT A;  2YVE A;  5CQG A;  4M3B A;  2UXI A;  2FJI 1;  3VPR A;  3BT9 A;  3VP5 A;  4I76 A;  4M3G A;  2GUH A;  3BHQ A;  2IBD A;  3LJL A;  4DW6 A;  5F08 A;  3VW0 A;  4D7N A;  3DCF A;  3VVY A;  4ACI A;  5HAW A;  3LOC A;  4MO7 A;  3Q0V A;  2XB5 A;  3F1B A;  4V2G A;  2VKV A;  3TP3 A;  5FKN A;  5K7Z A;  2TRT A;  3C07 A;  4JNN A;  3G7R A;  4PXI A;  1JUM A;  5F1J A;  2OER A;  3BQZ A;  3LHQ A;  5CW8 A;  3NXC A;  3V78 A;  5F0C A;  2IEK A;  4X1E A;  2XPV A;  3BR3 A;  2XPW A;  3FIW A;  2R7Q A;  4D7M A;  1JT0 A;  3F0C A;  3IUV A;  4GFK A;  4GFL A;  4B3A A;  5HSZ A;  4G12 A;  3ANG A;  5AQC A;  2XPU A;  2B3W A;  3SWH A;  5CXI A;  3VW1 A;  4OD4 A;  3QKX A;  3BJB A;  5EZG A;  5CXG A;  2NS7 A;  3EGQ A;  3HTH A;  2HYJ A;  5F0F A;  2GEN A;  5EZH A;  4M3D A;  3V6G A;  3FK7 A;  4DVY P;  3G1O A;  2WV1 A;  3GZI A;  2G0E A;  2RAE A;  1QVU A;  3WHB A;  2UXP A;  2EH3 A;  5IPA A;  1Z0X A;  5K7F A;  5FKO A;  3RH2 A;  2Q24 A;  3ZQL A;  3VVZ A;  5J1U A;  3AQS A;  4AC6 A;  4I6Z A;  5IP6 A;  4V2F A;  4XK4 A;  3LSJ A;  1ZKG A;  3PM1 A;  5J1Y A;  3VW2 A;  4GCL A;  3QPS A;  2R7O A;  2HKU A;  3KYL A;  3SFI A;  2DG7 A;  2G7S A;  2ID6 A;  1JTX A;  3KKC A;  5HBU A;  5H9T A;  5GPC A;  2PFV A;  5FKM A;  2DTZ A;  5IOY A;  1JUS A;  3G1L A;  2DG8 A;  4JL3 A;  3B6C A;  4L62 A;  3COL A;  3VTI A;  2ID3 A;  3KNW A;  4YZE A;  4GCT A;  2QCO A;  2UXO A;  5D1R A;  2FD5 A;  3QBM A;  2X9D A;  4W1U A;  3Q3S A;  3T6N A;  2YVX A;  5F0H A;  2GBY A;  4MK6 A;  5GPA A;  3CDL A;  3IH3 A;  5FGL A;  3NRG A;  3JSJ A;  3BR2 A;  3C2B A;  3MNL A;  3P9T A;  3IH4 A;  2VPR A;  2PZ9 A;  2R7U A;  2Y2Z A;  2RAS A;  3FK6 A;  2TCT A;  3DEW A;  2IAI A;  2OF7 A;  1U9O A;  2REK A;  3CCY A;  3HTJ A;  2RHA A;  2FBQ A;  2W53 A;  3ANP A;  1T56 A;  2VKE A;  3ZQH A;  2UXU A;  2G7L A;  2R7V A;  2QTQ A;  3KZ9 A;  5C4Y A;  3DPJ A;  5EFY A;  5J1R A;  3ON2 A;  2WGB A;  1SGM A;  5FKL A;  4CGR A;  4W97 A;  1A6I A;  4U9L A;  5F27 A;  2Y31 A;  4D5F A;  2G7G A;  3FRQ A;  3HGY A;  5FHP A;  2JK3 A;  3B6A A;  3BTJ A;  3NS4 A;  3ZQG A;  3SDG A;  3CRJ A;  1UI5 A;  2A2F X;  3BTC A;  2HXO A;  2QOP A;  3BR5 A;  4M3E A;  3CJD A;  2XGD A;  3TP0 A;  2FX0 A;  4ME9 A;  1ORK A;  3B81 A;  2IU5 A;  2F07 A;  4AUX A;  5GP9 A;  3ON4 A;  3QPL A;  1RPW A;  1QVT A;  3HGG A;  4GCK A;  2NP3 A;  3GEU A;  3Q0U A;  4NEL A;  3HE0 A;  3CWR A;  4MXM A;  2OPT A;  2X6O A;  2XGE A;  5D18 A;  5IOZ A;  5K58 A;  3BR1 A;  3S5R A;  2ZCN A;  2PBX A;  3AQT A;  3G56 A;  4OD5 A;  2JJ7 A;  2XDN A;  3VIB A;  4AF5 A;  5K7H A;  3VUQ A;  1JTY A;  3WHC A;  5J3L A;  4JKZ A;  4ABZ A;  3VOK A;  2R7T A;  3BTI A;  4JYK A;  2R7X A;  3NI7 A;  1QPI A;  3NPI A;  4ICH A;  3E7Q A;  2QIB A;  3BR6 A;  3O60 A;  2G3B A;  2GFN A;  5EYR A;  1JUP A;  1ZK8 A;  4IRV A;  2ZY9 A;  4HKU A;  2XRL A;  2HQ5 A;  1BJZ A;  2QWT A;  3KKD A;  1JT6 A;  3NNR A;  2I10 A;  4NN1 A;  3PPB A;  2XGC A;  4KWA A;  2FJ1 A;  4UDS A;  3LSR A;  2R7W A;  3BNI A;  3HTI A;  3QQA A;  4D5C A;  1VI0 A;  3RD3 A;  5FMP A;  2R7S A;  4AC0 A;  2V57 A;  2HXI A;  3Q0W A;  2R7R A;  3BTL A;  5DAJ A;  1RKT A;  3K8P C;  2UXH A;  2QKO A;  3VVX A;  2NP5 A;  2Y30 A;  2ZCX A;  2NX4 A;  3BCG A;  2B1E A;  2ZB9 A;  3DU6 A;  4B1R A;  3ZQI A;  3PAS A;  4M3F A;  2WUI A;  2FQ4 A;  5D19 A;  3BQY A;  2D6Y A;  5FKK A;  3HIM A;  3O8G A;  3MVP A;  2O7T A;  2YVH A;  3BRU A;  1U9N A;  3IH2 A;  2NS8 A; 
#chains in the Genus database with same CATH homology
 1Z77 A;  3HTA A;  2O7O A;  1T33 A;  3ZQF A;  2OI8 A;  3O8H A;  3LSP A;  3G1M A;  2ZOY A;  3EUP A;  3LWJ A;  2ZCM A;  3BR0 A;  1RKW A;  2ZOZ A;  3VOX A;  5F04 A;  1UI6 A;  2HYT A;  2YVE A;  4M3B A;  2UXI A;  3VPR A;  3BT9 A;  3VP5 A;  4I76 A;  4M3G A;  2GUH A;  3BHQ A;  2IBD A;  3LJL A;  4DW6 A;  5F08 A;  3VW0 A;  4D7N A;  3DCF A;  3VVY A;  4ACI A;  5HAW A;  3LOC A;  4MO7 A;  3Q0V A;  2XB5 A;  3F1B A;  4V2G A;  2VKV A;  3TP3 A;  5FKN A;  5K7Z A;  2TRT A;  3C07 A;  4JNN A;  3G7R A;  4PXI A;  1JUM A;  5F1J A;  2OER A;  3BQZ A;  3LHQ A;  5CW8 A;  3NXC A;  3V78 A;  5F0C A;  2IEK A;  4X1E A;  2XPV A;  3BR3 A;  2XPW A;  3FIW A;  4D7M A;  1JT0 A;  3F0C A;  3IUV A;  4GFK A;  4GFL A;  4B3A A;  5HSZ A;  4G12 A;  3ANG A;  5AQC A;  2XPU A;  5CXI A;  3VW1 A;  3QKX A;  3BJB A;  5EZG A;  5CXG A;  2NS7 A;  3EGQ A;  3HTH A;  2HYJ A;  5F0F A;  2GEN A;  5EZH A;  4M3D A;  3V6G A;  3FK7 A;  3G1O A;  2WV1 A;  3GZI A;  2G0E A;  2RAE A;  1QVU A;  3WHB A;  2UXP A;  2EH3 A;  5IPA A;  1Z0X A;  5K7F A;  5FKO A;  3RH2 A;  2Q24 A;  3ZQL A;  3VVZ A;  5J1U A;  3AQS A;  4AC6 A;  4I6Z A;  5IP6 A;  4V2F A;  4XK4 A;  3LSJ A;  1ZKG A;  3PM1 A;  5J1Y A;  3VW2 A;  4GCL A;  3QPS A;  2HKU A;  3SFI A;  2DG7 A;  2G7S A;  2ID6 A;  1JTX A;  3KKC A;  5HBU A;  5H9T A;  5GPC A;  5FKM A;  2DTZ A;  5IOY A;  1JUS A;  3G1L A;  2DG8 A;  4JL3 A;  3B6C A;  4L62 A;  3COL A;  2ID3 A;  3KNW A;  4YZE A;  4GCT A;  2QCO A;  2UXO A;  5D1R A;  2FD5 A;  3QBM A;  2X9D A;  4W1U A;  3Q3S A;  3T6N A;  5F0H A;  2GBY A;  4MK6 A;  5GPA A;  3CDL A;  3IH3 A;  5FGL A;  3NRG A;  3JSJ A;  3BR2 A;  3C2B A;  3MNL A;  3P9T A;  3IH4 A;  2VPR A;  2PZ9 A;  2Y2Z A;  2RAS A;  3FK6 A;  2TCT A;  3DEW A;  2IAI A;  2OF7 A;  1U9O A;  2REK A;  3CCY A;  3HTJ A;  2RHA A;  2FBQ A;  2W53 A;  3ANP A;  1T56 A;  2VKE A;  3ZQH A;  2UXU A;  2G7L A;  2QTQ A;  3KZ9 A;  5C4Y A;  3DPJ A;  5EFY A;  5J1R A;  3ON2 A;  2WGB A;  1SGM A;  5FKL A;  4CGR A;  4W97 A;  1A6I A;  5F27 A;  2Y31 A;  4D5F A;  2G7G A;  3FRQ A;  3HGY A;  5FHP A;  2JK3 A;  3B6A A;  3BTJ A;  3ZQG A;  3SDG A;  3CRJ A;  1UI5 A;  3BTC A;  2HXO A;  2QOP A;  3BR5 A;  4M3E A;  3CJD A;  2XGD A;  3TP0 A;  2FX0 A;  4ME9 A;  1ORK A;  3B81 A;  2IU5 A;  2F07 A;  4AUX A;  5GP9 A;  3ON4 A;  3QPL A;  1RPW A;  1QVT A;  3HGG A;  4GCK A;  2NP3 A;  3GEU A;  3Q0U A;  4NEL A;  3HE0 A;  3CWR A;  4MXM A;  2OPT A;  2X6O A;  2XGE A;  5D18 A;  5IOZ A;  5K58 A;  3BR1 A;  3S5R A;  2ZCN A;  2PBX A;  3AQT A;  3G56 A;  2JJ7 A;  2XDN A;  3VIB A;  4AF5 A;  5K7H A;  3VUQ A;  1JTY A;  3WHC A;  5J3L A;  4JKZ A;  4ABZ A;  3VOK A;  3BTI A;  4JYK A;  3NI7 A;  1QPI A;  3NPI A;  4ICH A;  3E7Q A;  2QIB A;  3BR6 A;  3O60 A;  2G3B A;  2GFN A;  5EYR A;  1JUP A;  1ZK8 A;  4HKU A;  2XRL A;  2HQ5 A;  1BJZ A;  2QWT A;  3KKD A;  1JT6 A;  3NNR A;  2I10 A;  4NN1 A;  3PPB A;  2XGC A;  4KWA A;  2FJ1 A;  4UDS A;  3LSR A;  3BNI A;  3HTI A;  3QQA A;  4D5C A;  1VI0 A;  3RD3 A;  5FMP A;  4AC0 A;  2V57 A;  2HXI A;  3Q0W A;  3BTL A;  5DAJ A;  1RKT A;  2UXH A;  2QKO A;  3VVX A;  2NP5 A;  2Y30 A;  2ZCX A;  2NX4 A;  3BCG A;  2ZB9 A;  4B1R A;  3ZQI A;  3PAS A;  4M3F A;  2WUI A;  2FQ4 A;  5D19 A;  3BQY A;  2D6Y A;  5FKK A;  3HIM A;  3O8G A;  3MVP A;  2O7T A;  2YVH A;  3BRU A;  1U9N A;  3IH2 A;  2NS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...