4NN1A

Crystal structure of transcriptional regulator rv1219c of mycobacterium tuberculosis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
LTAHARIREAAIEQFGRHGFGVGLRAIAEAAGVSAALVIHHFGSKEGLRKACDDFVAEEIRSSKAAALKSNDPTTWLAQMAEIESYAPLMAYLVRSMQSGGELAKMLWQKMIDNAEEYLDEGVRAGTVKPSRDPRARARFLAITGGGGFLLYLQMHENPTDLRAALRDYAHDMVLPSLEVYTEGLLADRAMYEAFLAEAQQGEAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the transcriptional regulator Rv1219c of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords Transcriptional regulator
total genus 81
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17933 TetR_C_25 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4nn1A00
2Q24A 3HIMA 2DG7A 3MVPA 3G56A 5FKNA 3O60A 3EUPA 2FJ1A 1Z77A 3QBMA 3FIWA 2HYJA 3BQYA 3B6CA 2QCOA 3QKXA 3FRQA 3LSPA 2FD5A 5C4YA 4I6ZA 4W1UA 3ON2A 2V57A 2GENA 3MNLA 4NN1A 1T33A 5FKLA 2JJ7A 5CW8A 3BT9A 3VPRA 2PBXA 2G7SA 2NX4A 2WV1A 5IOYA 3BTJA 2NP5A 4CGRA 4B3AA 5DAJA 4M3DA 1QVTA 3B81A 2O7OA 3O8GA 3VVXA 3CRJA 3BR1A 2HXIA 3Q0VA 3BQZA 5FMPA 2QIBA 4L62A 3VW0A 4MXMA 2XDNA 3HTAA 2G7GA 5HSZA 5IOZA 4ABZA 3NPIA 5EFYA 5EYRA 3BCGA 3F1BA 3HTHA 3CWRA 2UXIA 3BR5A 4YZEA 2GUHA 3DCFA 4D5CA 2ZOYA 4M3FA 5K7ZA 3Q3SA 3B6AA 4GCKA 3TP0A 3VUQA 3G7RA 3ZQGA 5EZGA 4D7NA 2WUIA 2IEKA 3V6GA 4M3GA 2GBYA 3LSJA 1A6IA 1JTYA 2TCTA 3VP5A 5FKOA 3AQTA 5F27A 5GPCA 4G12A 2JK3A 2TRTA 3LWJA 2O7TA 4MO7A 2RHAA 3VW1A 5HBUA 3VIBA 2UXUA 1U9OA 4B1RA 5EZHA 3ZQHA 3BTIA 2G0EA 2HQ5A 5D19A 5K7HA 2YVEA 4XK4A 5D1RA 3LHQA 4KWAA 1Z0XA 2I10A 3NXCA 3PPBA 1RKWA 3CJDA 4M3EA 5GP9A 1JUSA 4UDSA 3ON4A 5K58A 2EH3A 4GCLA 5CXGA 3AQSA 3PASA 4D7MA 1ORKA 1QVUA 4ME9A 3VOXA 4ACIA 3IH2A 5K7FA 1JUPA 2HKUA 3JSJA 3DPJA 2G7LA 2ZOZA 2GFNA 3BR0A 1ZK8A 5AQCA 3NNRA 2DTZA 3WHCA 3SFIA 4M3BA 3VW2A 3KKCA 3QPLA 1RPWA 2UXPA 2ZCXA 2VPRA 3KKDA 2RAEA 4W97A 3T6NA 2XB5A 5J3LA 4DW6A 3IH4A 3LJLA 4V2GA 3BJBA 3FK7A 2W53A 2OI8A 3BR6A 3V78A 2D6YA 4V2FA 2XPVA 3IUVA 5F0HA 2ZB9A 3QQAA 3HTIA 3PM1A 4I76A 3KNWA 2VKVA 5FKMA 4NELA 5CXIA 4AF5A 3GEUA 3VVZA 2OERA 3BNIA 2Y31A 2HXOA 3RH2A 4GFKA 4JKZA 5FGLA 2QWTA 3QPSA 2NP3A 2XGEA 4JYKA 1ZKGA 1JUMA 1JTXA 5F0CA 5FHPA 3CDLA 5FKKA 2G3BA 4GFLA 2QOPA 5IP6A 2PZ9A 4ICHA 1QPIA 3E7QA 3LSRA 1JT6A 2Y2ZA 2XGDA 2X6OA 3COLA 2ID6A 2ID3A 1RKTA 4GCTA 1UI5A 3FK6A 3EGQA 2FQ4A 2NS8A 2XRLA 3G1LA 3BR3A 3HE0A 2IBDA 2XPUA 5GPAA 3HTJA 2VKEA 3P9TA 5D18A 5H9TA 2FBQA 3BHQA 3BTLA 5F1JA 5J1RA 4D5FA 3VVYA 3C2BA 2UXHA 3GZIA 4X1EA 4MK6A 5IPAA 3G1OA 3HGYA 3NI7A 2XPWA 2QKOA 5HAWA 2ZCMA 3IH3A 2OF7A 3C07A 2UXOA 2F07A 2XGCA 5F0FA 4AC6A 4PXIA 3ANPA 3G1MA 3F0CA 5J1YA 4AUXA 3Q0WA 2IAIA 2IU5A 1T56A 2ZCNA 2QTQA 1VI0A 2FX0A 3O8HA 1BJZA 3SDGA 4JL3A 2DG8A 3TP3A 3CCYA 2OPTA 4JNNA 3S5RA 4AC0A 1SGMA 2HYTA 3KZ9A 3ZQIA 2X9DA 2YVHA 3NRGA 3BR2A 3BTCA 5F04A 3ZQFA 3Q0UA 3ANGA 3LOCA 1JT0A 3HGGA 2REKA 5J1UA 3RD3A 5F08A 2RASA 1U9NA 3DEWA 2NS7A 2Y30A 3WHBA 4HKUA 3BRUA 3ZQLA 1UI6A 3VOKA 2WGBA
chains in the Genus database with same CATH superfamily
2Q24A 3HIMA 2DG7A 3MVPA 4WIBA 3G56A 5FKNA 3O60A 3EUPA 2FJ1A 3FHNA 1Z77A 2A2FX 3QBMA 3FIWA 2HYJA 3BQYA 3B6CA 2R7UA 2QCOA 3QKXA 3FRQA 3LSPA 2FD5A 5C4YA 4I6ZA 4W1UA 3ON2A 2V57A 2GENA 3MNLA 4NN1A 1T33A 5FKLA 2JJ7A 5CW8A 3BT9A 3VPRA 2PBXA 2G7SA 2NX4A 2WV1A 5IOYA 3BTJA 2NP5A 4CGRA 4B3AA 5DAJA 4M3DA 1QVTA 3B81A 2O7OA 3O8GA 3VVXA 3CRJA 3BR1A 2HXIA 3Q0VA 4U9NA 3BQZA 5FMPA 2QIBA 4L62A 3VW0A 4MXMA 2XDNA 3HTAA 2G7GA 4C2MA 5HSZA 5IOZA 2R7VA 4ABZA 2R7TA 3NPIA 5EFYA 5EYRA 3BCGA 3F1BA 3HTHA 3CWRA 2UXIA 3BR5A 4YZEA 2GUHA 3DCFA 4D5CA 2ZOYA 4M3FA 5K7ZA 3Q3SA 3B6AA 4GCKA 3TP0A 3VUQA 3G7RA 3ZQGA 5EZGA 4D7NA 2WUIA 2IEKA 3V6GA 2B1EA 4M3GA 2GBYA 4U9LA 3LSJA 1A6IA 1JTYA 2TCTA 3VP5A 5FKOA 3AQTA 5F27A 5GPCA 2R7SA 4G12A 2JK3A 2TRTA 3LWJA 2O7TA 4MO7A 2RHAA 3VW1A 5HBUA 3VIBA 2UXUA 1U9OA 3DU6A 4B1RA 5EZHA 3ZQHA 3BTIA 2G0EA 2HQ5A 5D19A 5K7HA 3K8PC 2YVEA 4XK4A 5D1RA 3LHQA 4KWAA 2R7QA 1Z0XA 2I10A 3NXCA 3PPBA 1RKWA 4IRVA 3CJDA 4M3EA 5CQGA 5GP9A 1JUSA 4UDSA 3ON4A 5K58A 2EH3A 4GCLA 5CXGA 3AQSA 3PASA 4D7MA 1ORKA 1QVUA 4ME9A 3VOXA 4ACIA 3IH2A 5K7FA 1JUPA 2HKUA 3JSJA 3DPJA 2G7LA 2ZOZA 2GFNA 3BR0A 1ZK8A 5AQCA 3NNRA 2DTZA 3WHCA 3SFIA 4M3BA 3VW2A 3KKCA 3QPLA 1RPWA 2UXPA 2PFVA 2ZY9A 2ZCXA 4OD4A 2YVXA 2VPRA 3KKDA 2RAEA 4W97A 3VTIA 3T6NA 2XB5A 5J3LA 4DW6A 3IH4A 3LJLA 4V2GA 3BJBA 3FK7A 2W53A 2OI8A 3BR6A 3V78A 2D6YA 4V2FA 2XPVA 3IUVA 5F0HA 2ZB9A 3QQAA 3HTIA 3PM1A 4I76A 3KNWA 2VKVA 5FKMA 4NELA 5CXIA 4AF5A 3GEUA 3VVZA 2OERA 3BNIA 2Y31A 2HXOA 3RH2A 4GFKA 4JKZA 5FGLA 2R7RA 3DU5A 2QWTA 3QPSA 2NP3A 2XGEA 4JYKA 1ZKGA 1JUMA 1JTXA 5F0CA 5FHPA 3CDLA 5FKKA 2G3BA 4GFLA 2QOPA 5IP6A 2PZ9A 4ICHA 1QPIA 3SWHA 3E7QA 3LSRA 1JT6A 2Y2ZA 2XGDA 2X6OA 3COLA 2ID6A 2ID3A 1RKTA 2R7WA 4GCTA 1UI5A 3FK6A 3EGQA 2FQ4A 2NS8A 2XRLA 3G1LA 3BR3A 3HE0A 2IBDA 2XPUA 5GPAA 3HTJA 2VKEA 3P9TA 5D18A 5H9TA 2FBQA 3BHQA 3BTLA 5F1JA 5J1RA 4D5FA 3VVYA 3C2BA 2UXHA 3GZIA 4X1EA 4MK6A 5IPAA 3G1OA 3HGYA 3NI7A 2XPWA 2QKOA 3NS4A 5HAWA 2ZCMA 3IH3A 2OF7A 3C07A 2UXOA 2F07A 2XGCA 5F0FA 4AC6A 4PXIA 3ANPA 3G1MA 3F0CA 5J1YA 2FJI1 2B3WA 4AUXA 3Q0WA 2R7XA 2IAIA 2IU5A 1T56A 2ZCNA 4DVYP 2QTQA 1VI0A 2FX0A 3O8HA 1BJZA 3SDGA 4JL3A 2DG8A 3TP3A 3CCYA 2OPTA 2R7OA 4JNNA 3S5RA 4AC0A 1SGMA 2HYTA 3KZ9A 3ZQIA 2X9DA 2YVHA 3NRGA 3BR2A 3BTCA 5F04A 3ZQFA 3Q0UA 3ANGA 3LOCA 1JT0A 3HGGA 2REKA 5J1UA 3RD3A 3KYLA 5F08A 4OD5A 2RASA 1U9NA 3DEWA 2NS7A 2Y30A 3WHBA 4HKUA 3BRUA 3ZQLA 1UI6A 3VOKA 2WGBA
chains in the Genus database with same CATH topology
2Q24A 3HIMA 2DG7A 3MVPA 3G56A 5FKNA 3O60A 3EUPA 2FJ1A 1Z77A 3QBMA 3FIWA 2HYJA 3BQYA 3B6CA 2QCOA 3QKXA 3FRQA 3LSPA 2FD5A 5C4YA 4I6ZA 4W1UA 3ON2A 2V57A 2GENA 3MNLA 4NN1A 1T33A 5FKLA 2JJ7A 5CW8A 3BT9A 3VPRA 2PBXA 2G7SA 2NX4A 2WV1A 5IOYA 3BTJA 2NP5A 4CGRA 4B3AA 5DAJA 4M3DA 1QVTA 3B81A 2O7OA 3O8GA 3VVXA 3CRJA 3BR1A 2HXIA 3Q0VA 3BQZA 5FMPA 2QIBA 4L62A 3VW0A 4MXMA 2XDNA 3HTAA 2G7GA 5HSZA 5IOZA 4ABZA 3NPIA 5EFYA 5EYRA 3BCGA 3F1BA 3HTHA 3CWRA 2UXIA 3BR5A 4YZEA 2GUHA 3DCFA 4D5CA 2ZOYA 4M3FA 5K7ZA 3Q3SA 3B6AA 4GCKA 3TP0A 3VUQA 3G7RA 3ZQGA 5EZGA 4D7NA 2WUIA 2IEKA 3V6GA 4M3GA 2GBYA 3LSJA 1A6IA 1JTYA 2TCTA 3VP5A 5FKOA 3AQTA 5F27A 5GPCA 4G12A 2JK3A 2TRTA 3LWJA 2O7TA 4MO7A 2RHAA 3VW1A 5HBUA 3VIBA 2UXUA 1U9OA 4B1RA 5EZHA 3ZQHA 3BTIA 2G0EA 2HQ5A 5D19A 5K7HA 2YVEA 4XK4A 5D1RA 3LHQA 4KWAA 1Z0XA 2I10A 3NXCA 3PPBA 1RKWA 3CJDA 4M3EA 5GP9A 1JUSA 4UDSA 3ON4A 5K58A 2EH3A 4GCLA 5CXGA 3AQSA 3PASA 4D7MA 1ORKA 1QVUA 4ME9A 3VOXA 4ACIA 3IH2A 5K7FA 1JUPA 2HKUA 3JSJA 3DPJA 2G7LA 2ZOZA 2GFNA 3BR0A 1ZK8A 5AQCA 3NNRA 2DTZA 3WHCA 3SFIA 4M3BA 3VW2A 3KKCA 3QPLA 1RPWA 2UXPA 2ZCXA 2VPRA 3KKDA 2RAEA 4W97A 3T6NA 2XB5A 5J3LA 4DW6A 3IH4A 3LJLA 4V2GA 3BJBA 3FK7A 2W53A 2OI8A 3BR6A 3V78A 2D6YA 4V2FA 2XPVA 3IUVA 5F0HA 2ZB9A 3QQAA 3HTIA 3PM1A 4I76A 3KNWA 2VKVA 5FKMA 4NELA 5CXIA 4AF5A 3GEUA 3VVZA 2OERA 3BNIA 2Y31A 2HXOA 3RH2A 4GFKA 4JKZA 5FGLA 2QWTA 3QPSA 2NP3A 2XGEA 4JYKA 1ZKGA 1JUMA 1JTXA 5F0CA 5FHPA 3CDLA 5FKKA 2G3BA 4GFLA 2QOPA 5IP6A 2PZ9A 4ICHA 1QPIA 3E7QA 3LSRA 1JT6A 2Y2ZA 2XGDA 2X6OA 3COLA 2ID6A 2ID3A 1RKTA 4GCTA 1UI5A 3FK6A 3EGQA 2FQ4A 2NS8A 2XRLA 3G1LA 3BR3A 3HE0A 2IBDA 2XPUA 5GPAA 3HTJA 2VKEA 3P9TA 5D18A 5H9TA 2FBQA 3BHQA 3BTLA 5F1JA 5J1RA 4D5FA 3VVYA 3C2BA 2UXHA 3GZIA 4X1EA 4MK6A 5IPAA 3G1OA 3HGYA 3NI7A 2XPWA 2QKOA 5HAWA 2ZCMA 3IH3A 2OF7A 3C07A 2UXOA 2F07A 2XGCA 5F0FA 4AC6A 4PXIA 3ANPA 3G1MA 3F0CA 5J1YA 4AUXA 3Q0WA 2IAIA 2IU5A 1T56A 2ZCNA 2QTQA 1VI0A 2FX0A 3O8HA 1BJZA 3SDGA 4JL3A 2DG8A 3TP3A 3CCYA 2OPTA 4JNNA 3S5RA 4AC0A 1SGMA 2HYTA 3KZ9A 3ZQIA 2X9DA 2YVHA 3NRGA 3BR2A 3BTCA 5F04A 3ZQFA 3Q0UA 3ANGA 3LOCA 1JT0A 3HGGA 2REKA 5J1UA 3RD3A 5F08A 2RASA 1U9NA 3DEWA 2NS7A 2Y30A 3WHBA 4HKUA 3BRUA 3ZQLA 1UI6A 3VOKA 2WGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q24 A;  3HIM A;  2DG7 A;  3MVP A;  3G56 A;  5FKN A;  3O60 A;  3EUP A;  2FJ1 A;  1Z77 A;  3QBM A;  3FIW A;  2HYJ A;  3BQY A;  3B6C A;  2QCO A;  3QKX A;  3FRQ A;  3LSP A;  2FD5 A;  5C4Y A;  4I6Z A;  4W1U A;  3ON2 A;  2V57 A;  2GEN A;  3MNL A;  4NN1 A;  1T33 A;  5FKL A;  2JJ7 A;  5CW8 A;  3BT9 A;  3VPR A;  2PBX A;  2G7S A;  2NX4 A;  2WV1 A;  5IOY A;  3BTJ A;  2NP5 A;  4CGR A;  4B3A A;  5DAJ A;  4M3D A;  1QVT A;  3B81 A;  2O7O A;  3O8G A;  3VVX A;  3CRJ A;  3BR1 A;  2HXI A;  3Q0V A;  3BQZ A;  5FMP A;  2QIB A;  4L62 A;  3VW0 A;  4MXM A;  2XDN A;  3HTA A;  2G7G A;  5HSZ A;  5IOZ A;  4ABZ A;  3NPI A;  5EFY A;  5EYR A;  3BCG A;  3F1B A;  3HTH A;  3CWR A;  2UXI A;  3BR5 A;  4YZE A;  2GUH A;  3DCF A;  4D5C A;  2ZOY A;  4M3F A;  5K7Z A;  3Q3S A;  3B6A A;  4GCK A;  3TP0 A;  3VUQ A;  3G7R A;  3ZQG A;  5EZG A;  4D7N A;  2WUI A;  2IEK A;  3V6G A;  4M3G A;  2GBY A;  3LSJ A;  1A6I A;  1JTY A;  2TCT A;  3VP5 A;  5FKO A;  3AQT A;  5F27 A;  5GPC A;  4G12 A;  2JK3 A;  2TRT A;  3LWJ A;  2O7T A;  4MO7 A;  2RHA A;  3VW1 A;  5HBU A;  3VIB A;  2UXU A;  1U9O A;  4B1R A;  5EZH A;  3ZQH A;  3BTI A;  2G0E A;  2HQ5 A;  5D19 A;  5K7H A;  2YVE A;  4XK4 A;  5D1R A;  3LHQ A;  4KWA A;  1Z0X A;  2I10 A;  3NXC A;  3PPB A;  1RKW A;  3CJD A;  4M3E A;  5GP9 A;  1JUS A;  4UDS A;  3ON4 A;  5K58 A;  2EH3 A;  4GCL A;  5CXG A;  3AQS A;  3PAS A;  4D7M A;  1ORK A;  1QVU A;  4ME9 A;  3VOX A;  4ACI A;  3IH2 A;  5K7F A;  1JUP A;  2HKU A;  3JSJ A;  3DPJ A;  2G7L A;  2ZOZ A;  2GFN A;  3BR0 A;  1ZK8 A;  5AQC A;  3NNR A;  2DTZ A;  3WHC A;  3SFI A;  4M3B A;  3VW2 A;  3KKC A;  3QPL A;  1RPW A;  2UXP A;  2ZCX A;  2VPR A;  3KKD A;  2RAE A;  4W97 A;  3T6N A;  2XB5 A;  5J3L A;  4DW6 A;  3IH4 A;  3LJL A;  4V2G A;  3BJB A;  3FK7 A;  2W53 A;  2OI8 A;  3BR6 A;  3V78 A;  2D6Y A;  4V2F A;  2XPV A;  3IUV A;  5F0H A;  2ZB9 A;  3QQA A;  3HTI A;  3PM1 A;  4I76 A;  3KNW A;  2VKV A;  5FKM A;  4NEL A;  5CXI A;  4AF5 A;  3GEU A;  3VVZ A;  2OER A;  3BNI A;  2Y31 A;  2HXO A;  3RH2 A;  4GFK A;  4JKZ A;  5FGL A;  2QWT A;  3QPS A;  2NP3 A;  2XGE A;  4JYK A;  1ZKG A;  1JUM A;  1JTX A;  5F0C A;  5FHP A;  3CDL A;  5FKK A;  2G3B A;  4GFL A;  2QOP A;  5IP6 A;  2PZ9 A;  4ICH A;  1QPI A;  3E7Q A;  3LSR A;  1JT6 A;  2Y2Z A;  2XGD A;  2X6O A;  3COL A;  2ID6 A;  2ID3 A;  1RKT A;  4GCT A;  1UI5 A;  3FK6 A;  3EGQ A;  2FQ4 A;  2NS8 A;  2XRL A;  3G1L A;  3BR3 A;  3HE0 A;  2IBD A;  2XPU A;  5GPA A;  3HTJ A;  2VKE A;  3P9T A;  5D18 A;  5H9T A;  2FBQ A;  3BHQ A;  3BTL A;  5F1J A;  5J1R A;  4D5F A;  3VVY A;  3C2B A;  2UXH A;  3GZI A;  4X1E A;  4MK6 A;  5IPA A;  3G1O A;  3HGY A;  3NI7 A;  2XPW A;  2QKO A;  5HAW A;  2ZCM A;  3IH3 A;  2OF7 A;  3C07 A;  2UXO A;  2F07 A;  2XGC A;  5F0F A;  4AC6 A;  4PXI A;  3ANP A;  3G1M A;  3F0C A;  5J1Y A;  4AUX A;  3Q0W A;  2IAI A;  2IU5 A;  1T56 A;  2ZCN A;  2QTQ A;  1VI0 A;  2FX0 A;  3O8H A;  1BJZ A;  3SDG A;  4JL3 A;  2DG8 A;  3TP3 A;  3CCY A;  2OPT A;  4JNN A;  3S5R A;  4AC0 A;  1SGM A;  2HYT A;  3KZ9 A;  3ZQI A;  2X9D A;  2YVH A;  3NRG A;  3BR2 A;  3BTC A;  5F04 A;  3ZQF A;  3Q0U A;  3ANG A;  3LOC A;  1JT0 A;  3HGG A;  2REK A;  5J1U A;  3RD3 A;  5F08 A;  2RAS A;  1U9N A;  3DEW A;  2NS7 A;  2Y30 A;  3WHB A;  4HKU A;  3BRU A;  3ZQL A;  1UI6 A;  3VOK A;  2WGB A; 
#chains in the Genus database with same CATH topology
 2Q24 A;  3HIM A;  2DG7 A;  3MVP A;  4WIB A;  3G56 A;  5FKN A;  3O60 A;  3EUP A;  2FJ1 A;  3FHN A;  1Z77 A;  2A2F X;  3QBM A;  3FIW A;  2HYJ A;  3BQY A;  3B6C A;  2R7U A;  2QCO A;  3QKX A;  3FRQ A;  3LSP A;  2FD5 A;  5C4Y A;  4I6Z A;  4W1U A;  3ON2 A;  2V57 A;  2GEN A;  3MNL A;  4NN1 A;  1T33 A;  5FKL A;  2JJ7 A;  5CW8 A;  3BT9 A;  3VPR A;  2PBX A;  2G7S A;  2NX4 A;  2WV1 A;  5IOY A;  3BTJ A;  2NP5 A;  4CGR A;  4B3A A;  5DAJ A;  4M3D A;  1QVT A;  3B81 A;  2O7O A;  3O8G A;  3VVX A;  3CRJ A;  3BR1 A;  2HXI A;  3Q0V A;  4U9N A;  3BQZ A;  5FMP A;  2QIB A;  4L62 A;  3VW0 A;  4MXM A;  2XDN A;  3HTA A;  2G7G A;  4C2M A;  5HSZ A;  5IOZ A;  2R7V A;  4ABZ A;  2R7T A;  3NPI A;  5EFY A;  5EYR A;  3BCG A;  3F1B A;  3HTH A;  3CWR A;  2UXI A;  3BR5 A;  4YZE A;  2GUH A;  3DCF A;  4D5C A;  2ZOY A;  4M3F A;  5K7Z A;  3Q3S A;  3B6A A;  4GCK A;  3TP0 A;  3VUQ A;  3G7R A;  3ZQG A;  5EZG A;  4D7N A;  2WUI A;  2IEK A;  3V6G A;  2B1E A;  4M3G A;  2GBY A;  4U9L A;  3LSJ A;  1A6I A;  1JTY A;  2TCT A;  3VP5 A;  5FKO A;  3AQT A;  5F27 A;  5GPC A;  2R7S A;  4G12 A;  2JK3 A;  2TRT A;  3LWJ A;  2O7T A;  4MO7 A;  2RHA A;  3VW1 A;  5HBU A;  3VIB A;  2UXU A;  1U9O A;  3DU6 A;  4B1R A;  5EZH A;  3ZQH A;  3BTI A;  2G0E A;  2HQ5 A;  5D19 A;  5K7H A;  3K8P C;  2YVE A;  4XK4 A;  5D1R A;  3LHQ A;  4KWA A;  2R7Q A;  1Z0X A;  2I10 A;  3NXC A;  3PPB A;  1RKW A;  4IRV A;  3CJD A;  4M3E A;  5CQG A;  5GP9 A;  1JUS A;  4UDS A;  3ON4 A;  5K58 A;  2EH3 A;  4GCL A;  5CXG A;  3AQS A;  3PAS A;  4D7M A;  1ORK A;  1QVU A;  4ME9 A;  3VOX A;  4ACI A;  3IH2 A;  5K7F A;  1JUP A;  2HKU A;  3JSJ A;  3DPJ A;  2G7L A;  2ZOZ A;  2GFN A;  3BR0 A;  1ZK8 A;  5AQC A;  3NNR A;  2DTZ A;  3WHC A;  3SFI A;  4M3B A;  3VW2 A;  3KKC A;  3QPL A;  1RPW A;  2UXP A;  2PFV A;  2ZY9 A;  2ZCX A;  4OD4 A;  2YVX A;  2VPR A;  3KKD A;  2RAE A;  4W97 A;  3VTI A;  3T6N A;  2XB5 A;  5J3L A;  4DW6 A;  3IH4 A;  3LJL A;  4V2G A;  3BJB A;  3FK7 A;  2W53 A;  2OI8 A;  3BR6 A;  3V78 A;  2D6Y A;  4V2F A;  2XPV A;  3IUV A;  5F0H A;  2ZB9 A;  3QQA A;  3HTI A;  3PM1 A;  4I76 A;  3KNW A;  2VKV A;  5FKM A;  4NEL A;  5CXI A;  4AF5 A;  3GEU A;  3VVZ A;  2OER A;  3BNI A;  2Y31 A;  2HXO A;  3RH2 A;  4GFK A;  4JKZ A;  5FGL A;  2R7R A;  3DU5 A;  2QWT A;  3QPS A;  2NP3 A;  2XGE A;  4JYK A;  1ZKG A;  1JUM A;  1JTX A;  5F0C A;  5FHP A;  3CDL A;  5FKK A;  2G3B A;  4GFL A;  2QOP A;  5IP6 A;  2PZ9 A;  4ICH A;  1QPI A;  3SWH A;  3E7Q A;  3LSR A;  1JT6 A;  2Y2Z A;  2XGD A;  2X6O A;  3COL A;  2ID6 A;  2ID3 A;  1RKT A;  2R7W A;  4GCT A;  1UI5 A;  3FK6 A;  3EGQ A;  2FQ4 A;  2NS8 A;  2XRL A;  3G1L A;  3BR3 A;  3HE0 A;  2IBD A;  2XPU A;  5GPA A;  3HTJ A;  2VKE A;  3P9T A;  5D18 A;  5H9T A;  2FBQ A;  3BHQ A;  3BTL A;  5F1J A;  5J1R A;  4D5F A;  3VVY A;  3C2B A;  2UXH A;  3GZI A;  4X1E A;  4MK6 A;  5IPA A;  3G1O A;  3HGY A;  3NI7 A;  2XPW A;  2QKO A;  3NS4 A;  5HAW A;  2ZCM A;  3IH3 A;  2OF7 A;  3C07 A;  2UXO A;  2F07 A;  2XGC A;  5F0F A;  4AC6 A;  4PXI A;  3ANP A;  3G1M A;  3F0C A;  5J1Y A;  2FJI 1;  2B3W A;  4AUX A;  3Q0W A;  2R7X A;  2IAI A;  2IU5 A;  1T56 A;  2ZCN A;  4DVY P;  2QTQ A;  1VI0 A;  2FX0 A;  3O8H A;  1BJZ A;  3SDG A;  4JL3 A;  2DG8 A;  3TP3 A;  3CCY A;  2OPT A;  2R7O A;  4JNN A;  3S5R A;  4AC0 A;  1SGM A;  2HYT A;  3KZ9 A;  3ZQI A;  2X9D A;  2YVH A;  3NRG A;  3BR2 A;  3BTC A;  5F04 A;  3ZQF A;  3Q0U A;  3ANG A;  3LOC A;  1JT0 A;  3HGG A;  2REK A;  5J1U A;  3RD3 A;  3KYL A;  5F08 A;  4OD5 A;  2RAS A;  1U9N A;  3DEW A;  2NS7 A;  2Y30 A;  3WHB A;  4HKU A;  3BRU A;  3ZQL A;  1UI6 A;  3VOK A;  2WGB A; 
#chains in the Genus database with same CATH homology
 2Q24 A;  3HIM A;  2DG7 A;  3MVP A;  3G56 A;  5FKN A;  3O60 A;  3EUP A;  2FJ1 A;  1Z77 A;  3QBM A;  3FIW A;  2HYJ A;  3BQY A;  3B6C A;  2QCO A;  3QKX A;  3FRQ A;  3LSP A;  2FD5 A;  5C4Y A;  4I6Z A;  4W1U A;  3ON2 A;  2V57 A;  2GEN A;  3MNL A;  4NN1 A;  1T33 A;  5FKL A;  2JJ7 A;  5CW8 A;  3BT9 A;  3VPR A;  2PBX A;  2G7S A;  2NX4 A;  2WV1 A;  5IOY A;  3BTJ A;  2NP5 A;  4CGR A;  4B3A A;  5DAJ A;  4M3D A;  1QVT A;  3B81 A;  2O7O A;  3O8G A;  3VVX A;  3CRJ A;  3BR1 A;  2HXI A;  3Q0V A;  3BQZ A;  5FMP A;  2QIB A;  4L62 A;  3VW0 A;  4MXM A;  2XDN A;  3HTA A;  2G7G A;  5HSZ A;  5IOZ A;  4ABZ A;  3NPI A;  5EFY A;  5EYR A;  3BCG A;  3F1B A;  3HTH A;  3CWR A;  2UXI A;  3BR5 A;  4YZE A;  2GUH A;  3DCF A;  4D5C A;  2ZOY A;  4M3F A;  5K7Z A;  3Q3S A;  3B6A A;  4GCK A;  3TP0 A;  3VUQ A;  3G7R A;  3ZQG A;  5EZG A;  4D7N A;  2WUI A;  2IEK A;  3V6G A;  4M3G A;  2GBY A;  3LSJ A;  1A6I A;  1JTY A;  2TCT A;  3VP5 A;  5FKO A;  3AQT A;  5F27 A;  5GPC A;  4G12 A;  2JK3 A;  2TRT A;  3LWJ A;  2O7T A;  4MO7 A;  2RHA A;  3VW1 A;  5HBU A;  3VIB A;  2UXU A;  1U9O A;  4B1R A;  5EZH A;  3ZQH A;  3BTI A;  2G0E A;  2HQ5 A;  5D19 A;  5K7H A;  2YVE A;  4XK4 A;  5D1R A;  3LHQ A;  4KWA A;  1Z0X A;  2I10 A;  3NXC A;  3PPB A;  1RKW A;  3CJD A;  4M3E A;  5GP9 A;  1JUS A;  4UDS A;  3ON4 A;  5K58 A;  2EH3 A;  4GCL A;  5CXG A;  3AQS A;  3PAS A;  4D7M A;  1ORK A;  1QVU A;  4ME9 A;  3VOX A;  4ACI A;  3IH2 A;  5K7F A;  1JUP A;  2HKU A;  3JSJ A;  3DPJ A;  2G7L A;  2ZOZ A;  2GFN A;  3BR0 A;  1ZK8 A;  5AQC A;  3NNR A;  2DTZ A;  3WHC A;  3SFI A;  4M3B A;  3VW2 A;  3KKC A;  3QPL A;  1RPW A;  2UXP A;  2ZCX A;  2VPR A;  3KKD A;  2RAE A;  4W97 A;  3T6N A;  2XB5 A;  5J3L A;  4DW6 A;  3IH4 A;  3LJL A;  4V2G A;  3BJB A;  3FK7 A;  2W53 A;  2OI8 A;  3BR6 A;  3V78 A;  2D6Y A;  4V2F A;  2XPV A;  3IUV A;  5F0H A;  2ZB9 A;  3QQA A;  3HTI A;  3PM1 A;  4I76 A;  3KNW A;  2VKV A;  5FKM A;  4NEL A;  5CXI A;  4AF5 A;  3GEU A;  3VVZ A;  2OER A;  3BNI A;  2Y31 A;  2HXO A;  3RH2 A;  4GFK A;  4JKZ A;  5FGL A;  2QWT A;  3QPS A;  2NP3 A;  2XGE A;  4JYK A;  1ZKG A;  1JUM A;  1JTX A;  5F0C A;  5FHP A;  3CDL A;  5FKK A;  2G3B A;  4GFL A;  2QOP A;  5IP6 A;  2PZ9 A;  4ICH A;  1QPI A;  3E7Q A;  3LSR A;  1JT6 A;  2Y2Z A;  2XGD A;  2X6O A;  3COL A;  2ID6 A;  2ID3 A;  1RKT A;  4GCT A;  1UI5 A;  3FK6 A;  3EGQ A;  2FQ4 A;  2NS8 A;  2XRL A;  3G1L A;  3BR3 A;  3HE0 A;  2IBD A;  2XPU A;  5GPA A;  3HTJ A;  2VKE A;  3P9T A;  5D18 A;  5H9T A;  2FBQ A;  3BHQ A;  3BTL A;  5F1J A;  5J1R A;  4D5F A;  3VVY A;  3C2B A;  2UXH A;  3GZI A;  4X1E A;  4MK6 A;  5IPA A;  3G1O A;  3HGY A;  3NI7 A;  2XPW A;  2QKO A;  5HAW A;  2ZCM A;  3IH3 A;  2OF7 A;  3C07 A;  2UXO A;  2F07 A;  2XGC A;  5F0F A;  4AC6 A;  4PXI A;  3ANP A;  3G1M A;  3F0C A;  5J1Y A;  4AUX A;  3Q0W A;  2IAI A;  2IU5 A;  1T56 A;  2ZCN A;  2QTQ A;  1VI0 A;  2FX0 A;  3O8H A;  1BJZ A;  3SDG A;  4JL3 A;  2DG8 A;  3TP3 A;  3CCY A;  2OPT A;  4JNN A;  3S5R A;  4AC0 A;  1SGM A;  2HYT A;  3KZ9 A;  3ZQI A;  2X9D A;  2YVH A;  3NRG A;  3BR2 A;  3BTC A;  5F04 A;  3ZQF A;  3Q0U A;  3ANG A;  3LOC A;  1JT0 A;  3HGG A;  2REK A;  5J1U A;  3RD3 A;  5F08 A;  2RAS A;  1U9N A;  3DEW A;  2NS7 A;  2Y30 A;  3WHB A;  4HKU A;  3BRU A;  3ZQL A;  1UI6 A;  3VOK A;  2WGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...