3BTCA

Crystal structure of qacr(e57q) bound to malachite green
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btcA02
1GV2A 2REKA 4HKUA 2EQRA 4JP0A 1AHDP 3GZIA 3ON2A 3KNWA 5EZHA 2DMPA 1W0UA 4D7MA 3K7AJ 1RKWA 2I10A 1DU0A 1ORKA 1WCMJ 2XB5A 2YS9A 1ZQ3P 1IDYA 3BQYA 4A3IJ 3JRGA 2QCOA 3CQZJ 3TEDA 4Y7NJ 1JGGA 2TRTA 3HM5A 2LLKA 2CUEA 2TCTA 4GCLA 2JA6J 2O8KA 9ANTA 3OSFA 4M3EA 1B72B 3HOUJ 3HOWJ 1RESA 4JYKA 1ETWA 5HODA 1OCPA 1X2NA 5FLMJ 2Y9ZA 5F0HA 5K7FA 2QKOA 2GBYA 1TWFJ 3QBMA 4XRSG 1NK2P 4IEJA 2HOAA 4EEFG 3GBGA 3MVPA 4A3BJ 1WPKA 4B3AA 2L7FP 3VW1A 3HOVJ 1RR7A 1MBFA 5AQCA 1OCTC 3OOUA 3S15J 4V2FA 5IP7J 4A3EJ 3FIWA 2RAEA 4GFKA 3E7LA 2XGDA 3IUVA 3K2AA 2G0EA 5CXGA 3S14J 3OIOA 3VW0A 3GTJJ 4C3HJ 2M0CA 1BW6A 4M6VA 1D5YA 1MSEC 3CMYA 1JT0A 3BTCA 4B4CA 3FKIJ 3VP5A 1U78A 2WV1A 2ID3A 1B72A 3MNLA 3NI7A 1F43A 2ME0A 2GM4A 3TW6A 1HLVA 3NRGA 4GFLA 3VOXA 2M2EA 2GUHA 4PXIA 1Q1VA 5EG0B 3LHQA 3I4NJ 4JX6A 4DYQA 3SFIA 4BKXA 2G7SA 3BQZA 5M3MJ 1E3OC 2DG8A 2WGBA 1ETKA 2X9DA 5JLXA 1NK3P 1MBGA 1IJWC 3CCYA 2AO9A 5FKOA 1SFOJ 3BG9A 4XK4A 2WUIA 3GTPJ 4BBSJ 3JR9A 2MG4A 1ZGWA 4A3JJ 2R7ZJ 4V2GA 2DTZA 2DA3A 3GTOJ 1SANA 3LSJA 1TC3C 5GP9A 3GTQJ 4XICA 1LE8B 4M3GA 1FTTA 2NVYJ 2NOGA 4BY1J 3FISA 4AC0A 1UI5A 3ZQFA 2LP0A 3HTIA 3L1PA 2IBDA 3S1RJ 3LSGA 3AQSA 1X58A 2JA7J 5EG0A 4AC6A 2XPWA 2Y2ZA 1FEXA 4CGRA 1PUFB 2E2IJ 1SGMA 3ZOBA 1VF9A 2GENA 4BY7J 2YUSA 4D5FA 1MSFC 3HOYJ 2JMWA 2IEKA 2XPVA 3VPRA 1JKOC 3ZQHA 2E1OA 2HOSA 3M3YJ 1DU6A 3G1MA 4C3JJ 3TP3A 3LNQA 1TWHJ 3CRJA 1JUMA 3C07A 5EDNA 1Z0XA 1UMQA 4MO7A 4CYCB 2EZKA 4D5CA 1HDPA 1T33A 2DA5A 5EEAA 2DA2A 3A02A 2R92J 3EUPA 2O7OA 3TP0A 3F0CA 2D5VA 1LE8A 2XPUA 5FJ8J 2DMTA 2ID6A 5E3MA 1JKPC 2DMUA 5FGLA 4GFBA 2DA6A 5C44J 3QPSA 5HAWA 1MBHA 3HOXJ 3VVXA 3HGGA 3BTIA 1ZK8A 2EH3A 1PUFA 4M3BA 2OERA 3VVYA 3KKDA 5C4YA 1XC5A 2NVTJ 4MFDA 1QRYA 1G2HA 3A03A 3PO3J 3PM1A 3LSPA 5EGOB 1TWGJ 3NAUA 3QKXA 1QVUA 1W0TA 3EGQA 4FTHA 2LVSA 1UHSA 4FE4A 1ETOA 3HOZJ 5E3OA 5J1UA 3JRAA 3VW2A 4CYCA 3D1NI 2UXPA 4S0HB 2L9RA 4DYRA 2FJ1A 1EF4A 2OPTA 5FKKA 4FE7A 3UKGA 1MBJA 4LOCA 2V57A 2DA7A 1ITYA 2YVHA 3RZDJ 3IV5A 4DYCA 4FISA 2P81A 1U9OA 5M3FJ 2CQXA 2RASA 3H3VK 1MBEA 1MH4A 1T56A 2PMZN 4BBRJ 1JT6A 1ENHA 1WH7A 4JX4A 1O4XA 3S1NJ 5IOYA 5F04A 2Y9YA 4JX5A 1H88C 1UG2A 2ZCXA 3JSJA 3Q0WA 3HKZN 2DA1A 1A5JA 1MH3A 5GPCA 1HF0A 2LTPA 2R5YB 2LKXA 2HDDA 2X48A 2DJNA 4ME9A 5EGOA 2VKVA 2ZB9A 2ZCMA 1TWAJ 5C4XJ 1AKHB 5J1YA 3G7RA 5K58A 2K9SA 2DG7A 1IV6A 1AU7A 3ZQLA 3JRCA 4QSHA 3HEFA 3HE0A 2OI8A 1JKQC 3NXCA 3BCGA 3IH2A 1Y1WJ 2QIBA 3RD3A 3HIMA 5M5WJ 2JA5J 4A3GJ 1JJ6C 1JTYA 3G56A 5CW8A 1BL0A 2FBQA 4A3DJ 4HNVA 1GT0C 1GVDA 4M3DA 2QF7A 2NVQJ 3BR3A 1P7JA 3SDGA 2FX0A 2M8GX 2XDNA 1K61A 3G1OA 1BA5A 5F08A 2R5YA 3VVZA 2DMQA 2K9QA 2WAQN 1U8BA 2XRLA 3BG5A 3LJLA 3V6GA 3BT9A 2GLOA 2M34A 2NS8A 1AKHA 2ZCNA 1Y1VJ 3I4MJ 3B81A 3BNIA 1ETXA 1IGNA 2FD5A 4QTRA 1H8AC 1HCRA 4X1EA 1FTZA 2GFNA 1ZKGA 2COBA 3ZQIA 1XS9A 3DCFA 2G7GA 5H9TA 3VOKA 5D18A 1ETYA 2EBIA 3B6CA 3JREA 3OSGA 5IYBJ 3BRUA 1P7IA 3WHCA 4DZPA 1ETVA 4DZJA 4MFEA 3JRFA 5BNGA 2Y31A 1JJ8C 3GEUA 3GTKJ 2F07A 2JN6A 3ZQCA 1S7EA 3DEWA 4MLOA 5EZGA 5IP6A 4IHXA 1I3QJ 1VI0A 3PPBA 2HYTA 3Q0UA 4AF5A 5EF6A 1JKRC 4GCTA 3S16J 1JUSA 1LFBA 2KT0A 2IU5A 3WHBA 5E3LA 2LR8A 5J1RA 5IPAA 2M9HA 2ZOYA 3TW7A 2E2HJ 4KWAA 2MSYA 2Y30A 4XRSA 1A6IA 2RHAA 4IHWA 2HQ5A 4A3CJ 5GPAA 3HTHA 3MN2A 5DS9A 2AHQA 3JRDA 1B8IB 2K9NA 4RBOA 2PZ9A 3IH3A 4B1RA 2MGQA 2VUMJ 4UDSA 5FMPA 1I50J 4JNNA 2VPRA 5DAJA 1APLC 2D6YA 3FK6A 4Y52J 2QOPA 1MBKA 4L62A 4M3FA 2HKUA 3VIBA 2XB0X 3BR2A 5IOZA 4AUXA 4A3MJ 4X6AJ 2LK2A 3JRBA 3IH4A 5FKLA 2VI6A 4NELA 2YVEA 4AYBN 5DTDA 3DPJA 5HSZA 3BHQA 2LY9A 2X6OA 3LWJA 3ZQGA 3Q0VA 1IUFA 3BTLA 2R0QC 3AQTA 4C3IJ 5FKMA 3SJMA 2CUFA 3ANGA 1WGXA 4L5EA 1CQTA 2L7MP 3ON4A 1RETA 3BR1A 1VNDA 3G1LA 2NVXJ 1ZR4A 5J3LA 5M5YJ 4JKZA 3NPIA 4A3KJ 1H89C 2L7ZA 2OF7A 3A01B 1B8IA 5F1JA 3O8GA 2G3BA 1IC8A 2XGEA 2Y0SN 3E7QA 2DA4A 2G7LA 1JTXA 4W97A 3GTMJ 2DMNA 3S1QJ 2QWTA 3KKCA 5HBUA 3LSRA 3NNRA 3BG3A 4UUSB 4G12A 1POGA 5F0CA 2JJ7A 2R93J 5FKNA 3CJDA 3P9TA 3C2BA 4ACIA 2H1KA 1IG7A 4I6ZA 2JK3A 3O60A 1GUUA 4BXXJ 4A93J 2VKEA 2EZIA 4NDLA 1QVTA 2LD5A 5K7HA 1RKTA 4XIDA 4A3FJ 1IDZA 2H8RA 2ECCA 3RQIA 1K83J 2JWTA 3M4OJ 5C3EJ 4MIMA 3FK7A 2EZLA 2MW8A 1F36A 3HTAA 2EZHA 2HXIA 3RKQA 2CQQA 3HTJA 1RPWA 3S17J 4XRMA 3BR5A 4C2MJ 2R5ZB 3W6VA 3A01A 2UXHA 2NP3A 1Z77A 2XSDC 3VUQA 3Q3SA 2L0KA 4A69C 3PO2J 2YU9J 4MXMA 4UUSA 1VFCA 3B6AA 2ME6A 5EYRA 1X2MA 2XGCA 2LFBA 2ECBA 2FQ4A 3BR6A 1IRZA 3HBLA 1LFUP 3MKLA 1WI3A 3RH2A 5FHPA 1GDTA 3BR0A 1HOMA 4JL3A 2PBXA 1QPIA 3HDDA 1BW5A 5IP9J 2WB1N 3BTJA 3JRIA 1YRNB 2UXIA 3S2DJ 2N8GA 3FRQA 1FIPA 2W53A 3CDLA 5CXIA 1UI6A 2QTQA 3T6NA 2HOTA 4RDUA 3S5RA 4J19A 2O9LA 2UXOA 1I6HJ 2CRGA 4NN1A 3O8HA 2R5ZA 5FLVA 3ANPA 3QPLA 3LOCA 1R9TJ 2W48A 3F1BA 3HGYA 2E19A 1HDDC 1OFCX 3RZOJ 1FJLA 4W1UA 4DW6A 5JLWA 2UXUA 2CJJA 5C4JJ 1GV5A 4YZEA 5EFYA 2ELKA 2NX4A 2Q24A 1BJZA 4MK6A 2K40A 5F27A 1WH5A 2B63J 4A3LJ 3S2HJ 5IYDJ 4I76A 2HYJA 3CWRA 5M5XJ 1JUPA 2CU7A 4D7NA 2E2JJ 3KZ9A 2NS7A 3GTLJ 2HI3A 5IYCJ 3JRHA 2DN0A 1TWCJ 2KDZA 5E3NA 1YRNA 4GCKA 4ABZA 5D1RA 4IHYA 2NP5A 1MNMC 1ZR2A 2O7TA 5K7ZA 4IHVA 5D19A 1OJLA 4UUTA 3QQAA 2HXOA 4QIWN 2JA8J 3PASA 1NTCA 1ZTRA 5F0FA 3GTGJ 3HB9A 2ZOZA 3V78A 3NARA 1U9NA 3COLA 1XG1A 1FIAA 3S1MJ 3H0GJ 2IAIA 4ICHA 3BJBA 1ETQA 4FCYA
chains in the Genus database with same CATH superfamily
3K10A 3CC2I 2REKA 1YW9A 3KNWA 4A12A 4WXDA 2HEOA 1W0UA 4PUSA 4XLNF 3VDXA 2JSCA 1DU0A 2I10A 2PMHA 2BEOA 1X3ZB 2YS9A 5GAGJ 1Y8QB 2CUZA 1G3SA 2Q2EA 3HPGA 3W6KB 1IDYA 3QPTA 2COMA 3TEDA 1REPC 3HL2A 1I1SA 2M7BA 2TRTA 3BY6A 2HOEA 4P9FA 4UHTA 4PJJA 1J2XA 2O8KA 4F92B 5L3GA 3GFJA 3L2UA 3A0BC 1BOBA 1B72B 2ZFUA 3HOUJ 5HODA 4JYKA 2A68F 3IP4B 1P4AA 2GBYA 2RDPA 2AXTC 3RPQA 2R3SA 3QYBA 3R4KA 4IEJA 2HOAA 2VODA 3ABTA 1TLHB 3GBGA 3ELKA 5A2QK 1R36A 2L7FP 2E7XA 2OJED 2KIFA 1H9TA 2PMZA 3VW1A 2DT5A 1MBFA 3HHHA 3H5AA 1OCTC 3GO5A 2LKSA 3CTAA 3FIWA 3E6BA 2O3FA 4XOPA 4CICA 4PDKA 5BMZA 3VW0A 3FHNA 2WAFA 2Q8KA 3TQNA 3H1CA 3BC8A 3L7WA 4Q4ZF 2ZCWA 5K5OA 4XSZF 3IKTA 2A5YB 4G6TB 1MSEC 3CMYA 5HDGA 2DFEA 1MMAA 3K4MA 3FKIJ 2W1OA 5DM6F 1MMSA 1U78A 2UUZA 3NI7A 1F43A 2R4GA 2GM4A 1D1BA 1W5SA 2RC4A 2ZSIB 3K69A 1MDMA 1Q1VA 5EG0B 4ZYEA 3DBLB 3I4NJ 3HYIA 4JX6A 2XC7A 3ZMDA 2G7SA 3BQZA 2VBXA 3M8FA 2BV6A 4P55A 4YIRX 2JSPA 2M5WA 2OTJI 1XGNA 1NK3P 3FMSA 1MBGA 1SFOJ 1HW2A 1U8RA 2F5CA 4EVIA 4BJTA 5E8GA 2FF4A 3HG9A 3JR9A 4KT6A 5F1RA 1ZGWA 4A3JJ 4LG0B 3NRVA 4IF4A 5D4RA 2DA3A 5ICGA 1VZ0A 3I0TA 3QP5A 5FRNA 2WAQA 5HLHA 2E1CA 1YJ9I 4O3MA 4KUMA 1LE8B 1FTTA 2EWNA 3GLLA 3CC4I 2O6GE 4AC0A 1UI5A 3ZQFA 2LP0A 4Z2YA 4AU7A 1LJ9A 2RV8A 4HW0A 2IBDA 5LHIA 3FBIB 4P96A 2JA7J 4V19K 4IKFA 4XLEA 3FMQA 2Y2ZA 5HLIA 4AC6A 1S29A 2VOPA 1SGMA 2ICWG 1UFMA 3H9GA 5E1WA 3DXJF 3E6MA 2QQ8A 2GXAA 2DU9A 1IRFA 2DAOA 4MQVA 1Z9CA 3TP3A 1MGTA 3WU2C 3CCJI 1WKMA 2K7LA 3U2RA 1AWCA 2CYYA 1T33A 3LA3A 3FBNB 3A02A 2HVRA 3HJEA 5L3EA 2HQNA 3CCLI 2OCCH 3F0CA 3OOPA 1WRJA 3DBHB 4C2TA 4Y13A 3ABMH 2QQ9A 4LIUA 3MKWB 1JKPC 2Z16A 4YRVA 1BIAA 1DUXC 1YQAA 1OYYA 5TISC 2PLYA 3OIQA 3HGGA 1V4RA 2V7FA 5DEQA 5E8IA 2EH3A 4M3BA 3DU5A 2IRFG 2NVTJ 3GLXA 4M6YA 4MFDA 1O7FA 1QRYA 4FT8A 2M4KA 2YSRA 4MTDA 3LSPA 3NAUA 2E60A 3J7ZI 2P7VB 3BPVA 1KGSA 4M9ZA 4FTHA 2O0YA 3ASOH 5D5VB 1UHSA 5FD6A 1BI1A 5E3OA 1TTYA 2E1MB 3U21A 1YS7A 2FMLA 1S72I 4S0HB 2L9RA 4DYRA 2FJ1A 3A4CA 5HS9A 3CJNA 1ZELA 5TRDA 2VC0A 2AXLA 3O3KA 3UKGA 2PJRB 4EJVA 3BDDA 3LFUA 1FBQA 4DYCA 3G73A 2A3SA 2CQXA 3HRUA 3H3VK 1MH4A 4BBRJ 4BU2A 3CDIA 1WH7A 1O3SA 1FPQA 3S1NJ 3WG7H 4HZFA 3PJRA 3JSJA 1QHGA 4FX4A 4IOAF 2DA1A 3SHFA 1A5JA 4WIBA 2F48A 5J6XA 3GW2A 2LTPA 4Y3OA 2R5YB 2HDDA 5J4YA 3BJOA 2E5ZA 5EGOA 2ZCMA 1Z1DA 1TWAJ 4LLLA 4YFXF 2ZJRF 1R7JA 4HDUA 4CDGA 1SFXA 2B0LA 2K9SA 4IRIA 2LYCA 2V9KA 3J81Z 1W7PB 2HVSA 2QQBA 2R7QA 3EUKL 3JRCA 3HEFA 2HVQA 1JKQC 2E35A 4BQAA 1R1VA 5D8LB 4CHUA 3F23A 1Z91A 2QIBA 3ZN0A 1ZG5A 1XGSA 4E7HA 2CQ7A 4JBAA 3LSHA 2WWYA 3IKVA 4U87A 3TO6A 3WODF 4XM3A 3OYFA 4A6EA 4CCKA 4P9UA 2DOFA 1RUOA 3CMMA 2LREA 4EQQA 4E7ZA 3FWEA 4E7IA 1K61A 2CO5A 2ZCNA 2M34A 2WB1A 3HPHA 4WXCA 3I4MJ 4Z6YA 4M71A 1ETXA 2FD5A 4G6DA 2M3AA 3WTXC 3K1MA 4GDFA 6PAXA 4RB0A 3ZQIA 2KRFA 2QLZA 1XS9A 2ZSHB 3ROUA 2PMUA 2P5LC 1VQ6I 3FKJA 2XKOA 2RGVA 5IYBJ 3K70D 4DZJA 3GUDA 1GVJA 3JRFA 2HR3A 1XGOA 2YX4A 3MZYA 4DBQA 3GEUA 2JN6A 2VE8A 2VJJA 1I3QJ 2JPCA 3Q0UA 2IXSA 5EF6A 1JKRC 2EB7A 1JUSA 4I09A 1V5EA 1LFBA 2XAUA 2IU5A 4HV5A 5JFRA 3GZNB 3PFIA 5J1RA 1A35A 5GAHJ 3S3NA 1CF7B 1ACIA 3IAS2 4CGZA 1WJCA 3RKWA 2HQ5A 3MQ0A 4WK8F 3BOQA 3MN2A 3JRDA 1B8IB 3FM5A 5HDKA 1OYWA 3IH3A 5EJCA 1QHHD 2MGQA 3OYCA 1XN7A 1I50J 3FX3A 2VPRA 4JNNA 2JUCA 2QOPA 4Y52J 4L62A 3F8MA 4M3FA 3VIBA 3TDZC 4A3MJ 2Y69H 3RJPA 1IN4A 4BJ6C 4J00A 3IH4A 2KL4A 3K4LA 5FKLA 3V42A 4NELA 2LBFB 2YVEA 2FA5A 2TDXA 3DWLE 1UHMA 2PFBA 2ZXJA 1XPXA 3BHQA 4IHTA 3Q0VA 3CCMI 4IRVA 1IUFA 3BTLA 2R0QC 2F4IA 3AQTA 5FKMA 3SJMA 1LB2A 4L5EA 3ON4A 2ZJPF 3VEPA 1RETA 3LMMA 5M5YJ 4JKZA 3W2VA 4A0ZA 1DP3A 1USSA 3F22A 4A3KJ 2HYGD 2HDWA 5F1JA 2K02A 2VXZA 1DP7P 2G7LA 3FXLA 4PK4A 3S1QJ 1LUJB 3D5LA 1SFUA 2R93J 1AOYA 1RZ4A 3ISPA 4ACIA 5H2FC 2MBFA 3HIFA 5KAIC 4XN3A 5L3FA 3PFYA 2Y48A 4NDLA 4IJAA 2IGKA 2K3FA 3K4BA 3M4OJ 4ITVA 3CO7C 1GLNA 5C3EJ 1VQKI 4MIMA 2Y75A 2EZHA 3HTJA 3OYKA 4C2MJ 1Z77A 2FEZA 3VUQA 1OCRH 5ICEA 3L2VA 4LD5A 3HSFA 3KEYA 3PO2J 1XB4A 3B6AA 2M87A 1ON2A 2XGCA 1K78B 1IRZA 1FMVA 2ACJA 3UR3C 3MKLA 1T39A 2ZO4A 1IRXA 2ZKZA 3PSFA 5HLTA 1QPIA 1X1BA 4PJMA 3KYCB 4L18B 4XKWA 3EDPA 4LMYA 1RRJA 3QODA 5JVTA 1FIPA 2Q1ZB 3KEOA 2NXNB 2CW8A 4XLCA 1FYMA 3O6BB 2QTQA 2UXOA 5DCMB 5J8CA 1I6HJ 3RSNA 4NN1A 2R5ZA 1XDSA 2PBIA 3QPLA 1V3FA 1V5FA 3TO7A 2YX7A 4NC8A 4MEXF 3F1BA 3CP2A 4FHTA 4OD4A 4BS9A 5DCFA 4HF0A 3CLQA 3G4SI 2EFPA 2JUGA 4PSXA 5EFYA 2ZNYA 2ELKA 1BJZA 3PQJA 2JZYA 2K40A 1MNEA 4UY8I 2WBMA 3C3WA 4PSWA 2GZWA 3CWRA 4LB5A 2L3DA 3KZ9A 2NS7A 3GTLJ 2HI3A 3OL4A 5IYCJ 2DLLA 3JRHA 4GO1A 2KDZA 4GCKA 1LQ1A 2FBKA 4HBLA 2L9NA 3CO6C 2GXBA 3OL3A 2NP5A 1X4OA 2I5UA 3TMOA 1Y0UA 2F4OB 5AIQA 4CCNA 2JRTA 1MJ9A 1OJLA 3QQAA 4QIWN 3CUOA 4HPQA 3HXLA 4IQJA 5K1YA 2KP6A 5FRMA 2P8TA 3U1KA 3NARA 2OD5A 4B48A 4HX7A 1W7PD 2PN6A 2V9PA 1I39A 2DT6A 2Z1DA 3DPLC 3CESA 1ZLKA 1SVMA 2EK5A 4M6XA 1FBSA 4HKUA 3CLOA 1AHDP 1FWZA 3GZIA 4QWQA 2MH2A 2YU3A 1WSUA 1R23A 3OIPA 4D7MA 2HDCA 5BS6A 1ORKA 1TBXA 2CS3A 1ZQ3P 1LEBA 3E3VA 4A3IJ 3OWTA 3HUGB 3SEZA 1JGGA 3C7JA 4GCLA 3G6EI 5DUKA 4ENNA 9ANTA 5ICCA 4LG3A 3H36A 3KETA 4M3EA 1IUYA 3M1EA 2KISA 2XAQA 1MZBA 4LK0F 5IT9Z 3ZMVA 3EPZA 4ENMA 1ZRFA 4BNCA 2ZXWH 2QGUA 5K7FA 3ESWB 1D5VA 2PFVA 3WTVC 1TWFJ 5TJJA 3CUQC 2R7UA 4K2EA 1ONVA 4EEFG 4B3AA 1B1BA 4JOMA 4BQOA 2PX9A 3P9IA 2ZJQF 1QZYA 3BG7A 4RA2A 3OOUA 3DPUA 3U1DA 4CYDA 2M4GA 4V2FA 5IP7J 5ED4A 2AQEA 2RAEA 4GFKA 3MEXA 2OU2A 1MJAA 3OIOA 3S14J 5D8KB 4B3XA 3GTJJ 4C3HJ 2M0CA 4UUVA 1BW6A 2EILH 2X85A 2XGXA 2BY0A 4M6VA 2VOOA 4XKVA 2DQLA 3BTCA 2L2OA 4OOIA 5J40A 1SD7A 2WV1A 4WX9A 1R4NB 1B72A 2ZNZA 4A0XA 2MLKA 1FP2A 3DTEA 2D45A 1VQNI 2UWMA 2HTSA 2M2EA 3X2QH 5LEJA 5DD4A 4FQGA 5CLSA 4BKXA 4HQMA 1KU7A 1QO0D 1GXQA 2HFHA 1UELB 2WGBA 2X9DA 5JLXA 1E3HA 1QZZA 2VBYA 4XONA 1IJWC 2MH9A 5FKOA 4RB1A 4BBSJ 2DW4A 2K4JA 2QZ8A 5AIPA 4OIRF 3SZTA 1O3RA 2IW5A 3GTOJ 1SAXA 3QRFF 1B4AA 1RIOH 2FMYA 1TC3C 3H5NA 3HRTA 5J47A 2E34A 4I2OA 2NOGA 5FFZA 2ZBKA 3I71A 5AONA 3F21A 3FISA 4MTEA 4DJAA 3F8BA 5CQGA 3HTIA 1YIOA 3L1PA 3S1RJ 2NYXA 2X6WA 3LSMA 2WADA 5EG0A 2NOJB 4CGRA 1FEXA 2HQRA 1PUFB 2E2IJ 4OMYA 4EJOA 1VF9A 2GENA 2YUSA 4RGXA 3ECHA 4D5FA 1MSFC 2VQCA 2IS4A 1SFKA 1LVAA 3VPRA 2E1OA 1X1DA 2HOSA 1B9MA 2JTVA 1DU6A 1GXPA 3OMYA 4ANJA 3LNQA 2L4AA 1J9IA 1KU9A 3GZ6A 1W5TA 3FMRA 5BQTA 1UMQA 2OUMA 2P5VA 4MO7A 4LG0A 2EZKA 4D5CA 4CYCB 3L2QA 3ZMZA 2DA5A 2MLGA 5EEAA 1B59A 1N77A 1FYKA 1SAUA 2R7WA 5KHDA 1LE8A 3KIOA 3T8TA 2HTJA 4XR6A 2ID6A 2K3PA 5FGLA 2VPLA 2OA4A 4MHGA 1PUEE 4EM1A 5H20A 1IXRC 2ZC2A 3KX2A 3HOXJ 5A2QZ 3VVXA 3BTIA 2KLOA 1D3YA 4EGYA 1USTA 4LJZF 4LB6B 3L2RA 2ZY9A 2GA1A 1N25A 5C4YA 2RREA 3ZMSA 4QPQA 2FOWA 3K1NA 3AG3H 1G2HA 4U7BA 3PM1A 1TW2A 2ETHA 3F8FA 1QVUA 2D1VA 2K5CA 2KFDA 3AFHA 1W0TA 3EGQA 5J4VA 4HV6A 2LVSA 3HC7A 1YTYA 4IVNA 1FYLA 3QPHA 3PNTA 5J1UA 3JRAA 3BROA 3S3MA 1TT0A 2CV0A 5LLQA 2L5QA 3WGGA 2BVLA 2P4WA 2EJRA 2ZJ2A 2KZGA 5FKKA 1EH6A 2DOAA 4FE7A 5F6FA 2VXDA 1KZHA 2KRCA 4XBFA 3CD6I 2LF8A 4IPAA 2Y0SA 2YVHA 1YE9A 2Q0OA 2P81A 1U9OA 2RASA 2MABA 3W3CA 1F5TA 1MBEA 2PMZN 1T56A 1YW7A 1O4XA 2W57A 2PEXA 2ADUA 2Z5UA 3AAFA 4OAYA 3MMYB 2ZCXA 4ZTFA 4WXHA 1MH3A 1X3UA 3K0LA 5DD8A 1UAAA 4HNTA 2ZB9A 2BY3A 5HDNA 4ESFA 5C4XJ 3ZN1A 1AKHB 1T6SA 3G7RA 4E7KA 5K58A 3I54A 2ZMEC 4G6QA 3WTTC 5L3DA 1OLTA 3F6VA 4QSHA 1E2XA 4E7LA 4EJUA 4KJZA 3H92A 3AL0C 3IH2A 1Z7UA 1Y1WJ 2PJRA 1YX5A 3HIMA 2FNPA 5CYVA 2VT2A 1JJ6C 2STTA 1K4SA 1XD7A 4A2UA 4HF2A 5CW8A 4CZCA 3BP8A 1BL0A 3WGHA 1GT0C 1GVDA 2QF7A 3SDGA 2KQRA 1P4XA 5E18F 3V8JA 3ZPLA 3KYLA 3W2WA 4NC7A 1YYVA 1A6QA 3G1OA 3TL4X 2DDAA 5KK1A 1WJEA 1T98A 2L02A 3ZRGA 2R5YA 2K9QA 2WAQN 1JHFA 3LJLA 3BG5A 3ERMA 1X4PA 3R6SA 3BT9A 4Y17A 1TP4A 3BNIA 4II3A 4QTRA 4HLYA 1W7PA 1H8AC 3GEZA 1KQ9A 2G7GA 1QGPA 2V9VA 2W25A 3VTIA 5H9TA 2FE3A 1BR1A 2M30A 5D18A 3JREA 1DPUA 2XRNA 1ULYA 4DZPA 4ENJA 1ETVA 3QU3A 4MFEA 3TOBA 4BJ5C 2F07A 1BBYA 3ZQCA 3DEWA 1BM9A 2M8EA 4YIIA 5IP6A 3E1SA 5BOXA 2CW0F 4AF5A 4A5MA 3S16J 3GCMA 1HXDA 4Y4RA 1Y8RB 2KT0A 1PP8F 5E3LA 5CJ9A 5IPAA 3EQLF 5KVRA 1FOYA 3FXKA 5JHFA 3F9KA 4RAZA 1C0WA 2E2HJ 3HRSA 1R00A 2MSYA 4XRSA 2RHAA 5LRRA 1D8KA 2CFXA 5GPAA 3HTHA 1T0FA 4UVBA 2Y0MA 3KP7A 2AHQA 5DS9A 3DQVC 1QU3A 2PZ9A 2K9NA 3OYEA 4B1RA 2IGOA 5DAJA 3I64A 4CXFA 3LFKA 4UB6C 1APLC 3FK6A 1MBKA 3BR2A 4AUXA 2KMUA 4X6AJ 3I4PA 2VLAA 3L2WA 4LFUA 5GTIC 1TZLA 2KPMA 2VI6A 1S7AA 1VQPI 1QZEA 3ZQ7A 3CJRB 3V8LA 3GFMA 3DPJA 5HSZA 2XAFA 2X6OA 3LWJA 3MKZA 5TGTA 3ANGA 1WGXA 1CQTA 1WQ2A 3O2PE 1A31A 1CF7A 2DO7A 1XX5A 4RM2A 3G2BA 2NVXJ 4XMYA 4KIGA 3I59B 1SVLA 1TQPA 2RQPA 1ZAOA 3ZP5A 2DDBA 2L7ZA 4OD5A 1ODDA 1ZRDA 2DPDA 2OF7A 1WJBA 3U9GA 1B8IA 3O8GA 4BH9A 1LDJA 4DQ2A 2XGEA 2G3BA 2NRAC 2DPUA 3CF2A 5FFXA 1HA8A 2DMNA 3NQOA 3NNRA 2JRMA 3BG3A 2G7UA 1JHHA 1FY7A 3ZR8X 4HQEA 2OQRA 4TV7A 3P9TA 4A6DA 3C2BA 2LBFA 1QQIA 1VQ7I 1TL8A 2H1KA 4I6ZA 2J5OA 3GF2A 2W00A 2K85A 1HKQA 4KNYA 1P2FA 4XIDA 2EFOA 2H8RA 1WJAA 2ECCA 3RQIA 3VYSB 3OS0A 4U7DA 2JWTA 3A2KA 2H6BA 4YIFA 2D2WA 3K4CA 4XLAA 3COAC 1F36A 3RKQA 2HXIA 1PJRA 1RPWA 4XRMA 3B02A 3BR5A 4EJTA 2V6CA 2NP3A 3GFLA 3I9V2 1EA3A 3Q3SA 4XSXF 2IGMA 3ULQB 1YHQI 2YU9J 2A61A 3WG9A 1R5HA 2QQAA 4NQWB 4UVAA 3RCOA 1TNTA 3GWZA 2ECBA 4CUGA 3L00A 1S3JA 2KJBA 1LFUP 1EJ9A 1H9GA 3RH2A 5FHPA 3BR0A 4AM3A 4HYEA 2PBXA 3LSIA 4JL3A 2ZXHA 5IP9J 2WB1N 4EV0A 3S2DJ 1YO5C 2W53A 3CDLA 2OZUA 4OIPF 3NS4A 5CQEA 3FXUA 3T6NA 3OV8A 1SD5A 4J19A 2O9LA 3BPXA 5CVUA 5FLVA 3QYFA 3LOCA 3ZQQA 4I99C 2LKPA 2OTLI 4KA4A 4YFKF 1OMIA 3HGYA 2HNHA 3OYJA 2G9WA 1O3QA 3RZOJ 2X1DA 2JA2A 2QM3A 2OC6A 2DYRH 1BI2A 3NWSA 5C4JJ 1K78A 4I7HA 2NX4A 1YJNI 2CFOA 5LHGA 4MK6A 3T1BA 1R6RA 1G4DA 2IS1A 4A3LJ 5LRSA 3GZ5A 3KP4A 1JUPA 2CU7A 2CUJA 2GIVA 2D1HA 1FOKA 4E7JA 2DN0A 1KYZA 4ABZA 1V54H 2HS5A 2BHYA 1QBJA 3LQQA 1YLFA 3HOSA 1WI9A 3WE2A 2NNYA 5D19A 5B3SH 4UUTA 3DV8A 2JA8J 5DCMA 4PJLA 1NTCA 3CUQB 1KU3A 4D1QA 4RLQA 5F0FA 3LAJA 3N4MA 4AVPA 2R7SA 1R1UA 3V78A 2MA3A 2IA2A 1FIAA 2EFNA 4OAZA 1U5TB 3PIPF 1J0RA 1QA6A 2IAIA 3W2AA 3BJBA 2IA0A 4FX0A 3R61A 1GV2A 2XAHA 1KA8A 2RN7A 4CO8A 2EV5A 3ON2A 1BI3A 4BXFA 1XSDA 2VE9A 4I98B 3K7AJ 3T5XA 2L4MA 3OYMA 1WCMJ 2AQFA 2HYFA 2XB5A 3WU1B 2KJCA 4DOZA 1FOWA 4BXUA 2DFIA 4ZDLA 3JAMK 3CQZJ 4Q5SF 2MYSA 1RC9A 3RPUD 2F5EA 3BCAA 3HM5A 2XV4S 4CH7A 3DKWA 4ZDPA 1STZA 5CKTA 2CUEA 1JGSA 4N4OB 4KITB 2X6XA 2RKHA 2X6YA 4XOTA 2Z99A 3G71I 4OU0A 1D0XA 1ETWA 3LA2A 1OCPA 5FLMJ 1G3WA 1J5YA 3M8JA 4F55A 2QKOA 4BACA 3QBMA 1IRGA 3VOEA 3NWTA 4IHSA 2FUG2 2L9VA 1D0YA 3V4GA 3HOVJ 1RR7A 4CCOA 2V1NA 1UG0A 2LY1A 2V6EA 3S15J 4LIVA 3OYLA 2E5NA 2NNNA 3ECOA 4B09A 1Z05A 3HKZA 3E7LA 4NB5A 3CMEI 2G0EA 2A69F 5JHUA 1VQ5I 3DPTA 3VOXA 2P0WA 3HUGA 3OYDA 1FT9A 2HGCA 4MEYF 4LLGF 2NVUB 3VSKA 1JT0A 1N78A 3P9KA 3V7CA 2ID3A 1FSEA 2ME0A 1HLVA 2VJ4A 1BR2A 4PXIA 2HQAA 3LHQA 2V4JC 4DYQA 3N05A 4BDZA 3SFIA 4B43A 1D1CA 3EYIA 1FOXA 2WA0A 4RLFA 2B7EA 4RB3C 1VQ9I 1SFEA 3BG9A 1QPMA 4XK4A 1LNWA 2WUIA 5BPDA 2MG4A 1KQ0A 1NG7A 1G3YA 4Q47A 1WJFA 1SANA 2LH9A 3LSJA 4ON0A 1NH3A 1P9QC 2R7OA 2R7DA 3DEUA 5GP9A 4MGRA 2VL8A 4EM0B 2VQGA 4M3GA 2NVYJ 4XLFA 4BY1J 3SQNA 3F72A 2BW3B 3SDBA 4EATA 4NBQA 1G59A 2V79A 4L5JA 1JXSA 3LSGA 3AQSA 1X58A 2XPWA 2VASA 3CCQI 1W36C 4L0YB 4L0ZB 3F6OA 5HLGA 4IXAA 2MC3A 3HOYJ 1KU2A 2XAJA 2JMWA 3VB2A 2NAZA 3FXRA 3ZQHA 3J7AY 3G3ZA 3M3YJ 4PJNA 5B5EC 1JUMA 2FXAA 3J80K 1HDPA 2O7OA 3TP0A 2D5VA 1OYIA 4PCQA 3GFIA 2XPUA 4O5VA 5E3MA 3BCBA 2DMUA 4BYYA 4GFBA 2DA6A 2BVMA 4XQFA 2CMPA 4J01A 2K9LA 3JTHA 3LSTA 1YI2I 1DGWY 3KEQA 1MBHA 4PGHA 1D0ZA 3DKXA 3DLLF 1HSJA 1J75A 3CJQB 1NG6A 1W5CC 1PUFA 3CZ6A 3ONQA 4QLCU 1W4MA 2OERA 4BE1A 4ENKA 2HPIA 1XC5A 3KKDA 3VVYA 4AYBA 2R7XA 3A03A 2ZMEB 3PO3J 3MFKA 1TWGJ 4ZYDA 2DT7B 4II2A 4Y33A 5E20A 3AL0B 3VWBA 4KDPA 4FE4A 4UNOA 3P5JA 1WFXA 3A1YA 4B44A 4CYCA 3M7GA 1R49A 4G8XA 3CCVI 3HOTA 1EF4A 2OPTA 2ESNA 3QOEA 4IOCF 5HOOA 1MBJA 2F2EA 1TT5B 2ISZA 4PFPA 2LNBA 3KP5A 3IV5A 4FISA 3LQRA 4Y15A 1ZGJA 1IN7A 1P6RA 4MNUA 3H9QA 1JT6A 4JX4A 3ZXSA 2VBWA 4HX4A 1H88C 1UG2A 2X4HA 3V8KA 2EPFA 5F64A 3Q0WA 1M1EB 1K6OA 5GPCA 1HF0A 4M9XA 1RNLA 5FB2A 4ME9A 2X48A 4KICA 3IC7A 2VKVA 4HA8A 2H27A 1S9HA 3V7SA 4IL6C 1RR8C 1IF1A 2OQGA 3JW4A 4DIQA 3MKYB 5DUIA 4DNCA 1VQLI 2DG7A 4HDVA 1YJWI 1ZREA 1BN5A 4UXNA 4R79A 3ZQLA 1AU7A 4P5OA 2R7FA 3KCCA 5HNFA 3K1PA 3MWMA 2IS6A 1J7KA 4YG2F 2JA5J 4A3GJ 3NEUA 4UV8A 3K4NA 4BAYA 2EV0A 1JTYA 2W84A 3FXOA 4OIQF 3D5RC 1FMWA 2FBQA 4A3DJ 3OR2C 4HNVA 1E17A 3MAJA 2MFZA 4ESJA 4M3DA 1S8NA 2NVQJ 3BR3A 1P7JA 3RTRA 4L9VA 3SXYA 2E7WA 2A05A 3S2WA 4E4HA 5L3BA 5KNLA 1HQCA 1HBXG 3BWGA 1Z6TA 2X51A 1BA5A 5F08A 3VSLA 2VN2A 2V1UA 2BOLA 3VVZA 1U8BA 5JR3A 3EETA 4I02A 3TBIA 2B9SA 4F93B 2GLOA 3B81A 1AKHA 1RUNA 3KE2A 5JI6A 1MMDA 1ZN2A 3VYRB 1TW3A 1IGNA 2P5KA 1ZG3A 4KISA 1HCRA 4X1EA 2IJLA 3CF5F 1JE8A 2COBA 1FTZA 4BUPA 2GFNA 5E1ZB 1XDUA 2QA4I 4U0VA 3FM3A 4NUBA 3TOAA 3OSGA 3IWZA 1X19A 1P7IA 2P6TA 4KIBA 1WWXA 2KHMA 1LDDA 2Y31A 4WWCA 1LPQA 1JJ8C 3FHZA 3UNGC 1BC8C 4L9JA 2VKHA 3RKYA 1WJDA 3BLYA 4EGZA 3K8PC 1R71A 2Z3YA 2F6CA 3PPBA 2LF7A 4XRFA 3J7AO 1I27A 4ZYHA 1XCBA 2FU4A 2RNJA 3RYRA 3FF5A 1Z3YA 3HZJA 3K2ZA 1YITI 1U3EM 5FLXK 3C1DA 2GOMA 3CDHA 3WHBA 1Z21A 3IHUA 1YX3A 2JQ7A 3RPUA 2ZOYA 4AVZA 2M7AA 2JPBA 1OCZH 3OY9A 4IHWA 3LWFA 2OBPA 3DLAA 2FBIA 4D0PA 2BXYA 3ASNH 2GOXB 2H09A 4UDSA 3K4KA 2QBYB 5FMPA 4RB2C 5CPRB 3MZHA 2D6YA 1VQMI 3RQ4A 3OS2A 1S7OA 3WTZA 3N97A 1UZCA 4B47A 1PP7U 3HRMA 2O5RA 3QOPA 4HEA2 1ON1A 2O61A 5FD5A 3DU6A 3TKYA 1A36A 1BC7C 2LOOA 5DTDA 3VFZA 2VC1A 3ZQGA 1KQ8A 5DV5A 4C3IJ 2DODA 3HTSB 2L7MP 4EM2A 3LA7A 2QKLB 3G1LA 1V55H 1E3PA 1VNDA 2VT3A 1DDNA 1I6XA 4L9TA 5J3LA 4ZZDA 3Q5FA 4XKCA 2R7TA 1IXSB 1B6AA 1BOAA 3IRRA 2EIKH 1H89C 3OYAA 5LEKA 3A01B 4RMNA 2WC2A 4PJ0C 3AG1H 3I53A 2Y0SN 5ILUA 3E7QA 2UXNA 3GTMJ 3M07A 1BJAA 2QWTA 3KKCA 4OIOF 3LSRA 4CCJA 2DFHA 3E5QA 4UUSB 3GVAA 2IGNA 1XCVA 2KIMA 1UCRA 3DF8A 5LGNA 1XGMA 5F0CA 4KYWA 1G8XA 5FKNA 3CJDA 3M8EA 1WHUA 4BE2A 4U9NA 1IG7A 4UVCA 3HSRA 4BXXJ 2VKEA 1BIBA 1YW8A 1QVTA 3CP8A 4AD9A 3OYIA 2M0MA 2EIJH 1T8IA 3BJAA 4HX8A 1S6LA 1E0EA 2FQ3A 3I59A 4BEHB 3DEEA 3ZGKA 1MMNA 4KN7X 3HTAA 4BL0B 3E6DA 3S17J 2DI3A 3W6VA 1O57A 3PNVA 2XSDC 4CZZA 5B1AH 2L0KA 3C18A 4A69C 4MXMA 2YPRA 4EMSA 1K7AA 2EINH 5KCMA 1YS6A 4RAGA 1GHCA 1X2MA 3RKXA 4D9JA 1Z67A 2VIXA 3WTSC 2LFBA 2DTRA 2HKXA 3BR6A 4U9LA 1U2WA 3S32A 1KONA 3T8RA 1HOMA 2PG4A 5IT3A 1BW5A 1OKRA 3BTJA 1FZPB 3JRIA 1IZ1A 1YRNB 2UXIA 4KMUX 2DCEA 2N8GA 1IXCA 2CSOA 4S04A 1WJ5A 2HKOA 1K79A 1T38A 4LLNA 2CV1A 4GYGA 4RDUA 3S5RA 1YIJI 4MQ9F 1IAWA 2CRGA 3O8HA 3KP6A 5LGUA 2VB6A 2FBHA 4XORA 1KYWA 1HKSA 2CWEA 2YR2A 3LSKA 2LC2A 3S93A 1HDDC 4W1UA 2VKDA 3I3LA 4NQWA 3OS1A 3WTWC 4AIKA 3MD2A 2CQNA 1X1PA 1PYVA 4YFNF 4YZEA 5D5XB 1ZH5A 4S05A 2CW7A 4BQNA 3DTKA 4M72A 4AIJA 1Y6IA 3DBRB 1WH5A 4PFOA 4R1HA 5F27A 4HSTA 4I76A 2HYJA 5IY5H 2B63J 3S2HJ 4YELA 2W4SA 4IQ4A 4D7NA 2GQQA 2M45A 5CVIA 1ZYRF 2IS2A 2BBYA 2DQRA 2Q2EB 4PZJA 3OYBA 3K9TA 3L2CA 5E3NA 5D1RA 3CC7I 1Q1HA 4CCMA 2HPMA 3KP2A 1ZR2A 1XSXA 2O7TA 5K7ZA 4IHVA 4XNFA 1R4MB 4ETSA 2HXOA 5EEHA 4NHJA 2XIGA 5B1BH 4IZZA 3GTGJ 3OR1C 4RM3A 2ZOZA 1U9NA 4IO9F 2XVCA 4G7ZF 1PDNC 3COLA 2NS0A 1TNSA 3K4JA 3H0GJ 3PUBA 2L9SA 2RVCA 2UXXA 2BXZA 2DFFA 1ETQA 4UB8C 4FCYA 2P6SA 2RQQA 1K6YA 2Z9OA 2LDUA 1VQOI 2EQRA 4JP0A 4N0BA 2A6HF 3ZMTA 4BHPA 3R0AA 2L7KA 3F8NA 3QYEA 1MD0A 5HVQC 5EZHA 2DMPA 5GAEJ 1OCOH 1HKTA 1RKWA 3H3UA 1YG2A 2HZDA 4OWRB 4DGWB 1L3LA 3EUAA 4F91B 4NC6A 3B73A 4HAMA 4ESBA 3BQYA 3ERED 3KZIC 1HSTA 3SYTA 2K9MA 3ABLH 2QCOA 3JRGA 3RIRA 3KFWX 4Y7NJ 2KZVA 4P1WA 5J8FA 2C6YA 2LLKA 3ML6A 4XN0A 3WE3A 2TCTA 4RAYA 5B66C 2JA6J 1B9NA 4EJWA 3OSFA 4X0GA 3F3XA 3CUQA 1UB9A 4G7HF 2CH0A 3HOWJ 4BQQA 2XUBA 2ZFWA 1RESA 2R7RA 1ZG1A 1MDMB 1X2NA 2Y9ZA 5F0HA 2PJPA 3KLNA 3REOA 1U5TA 3DFGA 3E6CC 5DYMA 4XRSG 1NK2P 1U6GA 4CCLA 1L0OC 2L01A 3MVPA 5LBQA 1WPKA 4A3BJ 2FRHA 4I0AA 1WVRA 5AQCA 1A04A 2F5DA 1OQYA 3S3OA 3FXMA 4A3EJ 2G7HA 2XGDA 3IUVA 3K2AA 5CXGA 1OR7A 5ILSA 1T2KA 1R1TA 1JI8A 4GRIA 3PUFA 4OMZA 5HS7A 1VQ4I 2QEXI 1W1WE 4KT5C 1D5YA 4B4CA 2VQLA 4HLXA 3VP5A 1HC8A 3MNLA 2IA1A 3K70C 1F1ZA 3QP6A 4ZYAA 1G3TA 2LSOA 3TW6A 3PIOF 3NRGA 4GFLA 4C9YA 1UJ8A 1SD4A 4M74A 4F3QA 4L9NA 2B3WA 2GUHA 3DKYA 1XTAA 4YEJA 2OV7A 3WU0A 2BZTA 2IP2A 4UV9A 2A6TA 5M3MJ 4IX7A 1E3OC 1IN6A 2DXIA 1ERDA 2DG8A 1ETKA 3R0JA 4IRHA 2R7VA 4FETA 2JT1A 3DP7A 3CCYA 2AO9A 4HSRA 3GTPJ 1PVEA 2MD5A 2HYTA 2R7ZJ 4V2GA 2DTZA 4LITA 3PQKA 3T0YA 3HTUA 2W85A 3F8CA 3BZ6A 4GYIA 1I5ZA 4ASNA 1EH8A 4XICA 3Q9VA 3GTQJ 3C2HA 4ZC3A 1YFHA 3J81K 2ZXIA 3CCUI 4KMFA 2UV1A 4OINF 1SVOA 2DOEA 3EUHA 2OAZA 3KZYA 2Z2SB 1D8JA 2K4BA 4XL9A 2EFQA 4FASD 2PI0A 4A0YA 3ZOBA 1UHWA 1H0MA 4BY7J 5FO5A 1XSVA 2LRDA 2WY7Q 2BYVE 2IEKA 1XMXA 2MC4A 3BZCA 2XPVA 1OISA 2XF5A 3CMAI 3TGNA 1JKOC 2A2FX 3JAMZ 3ZMUA 1J59A 3G1MA 4C3JJ 1TWHJ 4JK1X 3CRJA 3C2GA 3C07A 5EDNA 1Z0XA 3LL7A 3JSPA 1Z3XA 2KIQA 1LFPA 1F4KA 2CQKA 2O03A 1ZARA 2DA2A 2R92J 3EUPA 3IUOA 2CV2A 2E1NA 2WTEA 3IWFA 4GXOA 5FJ8J 4CSWA 2DK5A 2DMTA 5E1XA 2W7NA 2BW3A 2UZKA 1WZ2A 5ICFA 5HS8A 2FSWA 3QPSA 4F52A 5C44J 1FNNA 5HAWA 2BY2A 2H6CA 4ZYGA 4E6KG 2EA2A 4M73A 1Y56A 3JTGA 3M9AA 1ZK8A 2RNGA 2QSHX 4C30A 5LD2C 2A5WA 3AG4H 2QENA 1Y0NA 4ZDOA 5EGOB 3SZPA 3QKXA 1OCCH 3WGIA 4N9IA 4LGWA 1ETOA 3ABUA 3HOZJ 1HW5A 3VW2A 3CCSI 1NHAA 4ZJZA 1EV7A 2XDVA 3D1NI 2UXPA 4HRIA 2V1DA 4RAFA 2O8XA 3P7NA 3LAPA 3BG6A 4LOCA 3CJTB 1SMTA 2W82A 1FX7A 2ELHA 1I3AA 2DA7A 1MMGA 3KLOA 4WF2A 1ITYA 2V57A 3RZDJ 5JVGF 2E36A 3A0HC 2IPQX 2XF6A 5CVJA 3BZKA 1MW7A 5M3FJ 3E5UA 3V7RA 1ENHA 3S8PA 2BHZA 5IOYA 5F04A 2Y9YA 2AS5F 4JX5A 4O6JA 1DQUA 3M1CA 4RS8A 5D6EA 3HKZN 3E5XA 4GCVA 2ZMEA 2LKXA 2IVMA 2DJNA 3ABKH 4ZTJA 1R22A 1IW7F 1T95A 5J1YA 1IN8A 4LK1F 3SFZA 2QUFA 4WCGA 3H35A 1HW1A 1IV6A 5D5WB 3HE0A 3QAHA 4I01A 2GAUA 2OI8A 2Z33A 5DDGA 3NXCA 3BCGA 4HF1A 2V1XA 2E1MC 3RD3A 3PSIA 5M5WJ 2LG4A 3IRQA 1J09A 3BJ6A 3G56A 4U0WA 2EV6A 2KKOA 2DBBA 1VQ8I 1YOVB 1Z7LA 4BE0A 2F5VA 1RI7A 1AA7A 3AKZA 2P7CB 3HHGA 4BHBA 4KFCA 2FX0A 2M8GX 1R5GA 5HNHA 3FDYA 5H6RA 5FROA 1ZLJA 3J80Z 1O3TA 2XDNA 2X1EA 2DMQA 3V6GA 2V26A 2XRLA 4JQFA 4E7SA 3OYGA 1Z6RA 2STWA 2NS8A 4AIDA 2EA4A 1Y1VJ 1ZRCA 4CA0A 5KAFC 4U0YA 1DPRA 5D4SA 5GTHC 1ZKGA 3Q9SA 1XMKA 3DCFA 5DM7F 2BY1A 3H9JA 3VOKA 2FJI1 4HOBA 1ETYA 2EBIA 2W24A 3B6CA 3BRUA 5K5QA 3QU6A 3WHCA 1EKEA 5CVVA 5BNGA 2GIZA 3GTKJ 3CCEI 1S7EA 3DTIA 4MLOA 1MNDA 5EZGA 3IL2A 4IHXA 1VI0A 4R8HA 3GX4X 2WY8Q 1EH7A 3K6GA 4GCTA 3PNYA 2XHKA 3TO9A 4XKBA 2LR8A 4B8XA 2M9HA 4QPOA 3EYYA 5CVRA 1X1CA 2EFWA 1N75A 3MCZA 3TW7A 4KWAA 2DJIA 5GADJ 3OYHA 2Y30A 1A6IA 1LKXA 4A3CJ 2JVHA 4RBOA 1QNTA 2FOKA 2ELJA 5ILVA 3H3ZA 2A07F 2VUMJ 2M1BA 4G9YA 4XLPF 2L54A 3I56I 3H0DA 3H5RA 1R58A 1T0FC 2HKUA 2XB0X 5IOZA 4XLHA 1MKMA 2LK2A 3JRBA 4M9SA 4AYBN 3IAM2 3W6JB 1P4WA 4IRGA 1G6NA 4RGRA 3RYPA 1W36D 2LY9A 1CGPA 3FXQA 4KIFA 2H8WA 2VQHA 2CUFA 2VJIA 3J7YJ 3L9FA 2VJ5A 2J5PA 1R5ID 3BR1A 2QSGX 2XAGA 1ZR4A 2K86A 1LDKB 2EIMH 2BE5F 1FBUA 2E71A 3E0JB 2IT0A 3NPIA 2LMDA 1SMYF 5EEGA 3GYHX 5FGMA 5L3CA 2QYOA 2LY2A 3WTUC 1IC8A 1FLIA 1FC3A 2QBYA 2DA4A 5H6QA 1JTXA 4W97A 5LHHA 5ERIA 1ZGAA 3TDUC 5HBUA 4H4KC 1IV8A 1S5LC 2GA2A 4KN4X 4G12A 1POGA 2JJ7A 1LVKA 2X1CA 4I0BA 2HU9A 2QVOA 3OYNA 2HZTA 2XROA 2CGPA 1FSHA 2JK3A 3RI4A 3O60A 2QSFX 3D0SA 2K27A 3JSOA 1GUUA 2DK8A 4A93J 2DYSH 4RGUA 2CG4A 2VONA 2H94A 1ZHFA 2EZIA 2FNAA 2LD5A 2XKPA 1RKTA 5K7HA 3KP3A 4A3FJ 2KRHA 3I5UA 1K4TA 1IDZA 2ESHA 3VYTB 3FXJA 2VBZA 1K83J 1U5TC 3MZ8A 3FK7A 2EZLA 2F5FA 2A6EF 2OCEA 2PQ8A 2MW8A 1MJBA 1MIJA 4DBRA 2XSJC 2CQQA 3PL8A 2B1EA 2R5ZB 2GXGA 2UXHA 3A01A 3VYUB 1V5GA 1X1AA 5K5RA 1F9NA 3AG2H 1P92A 4UUSA 2H1LA 3D5SC 4N9HA 1VFCA 2ME6A 3E97A 4AIHA 5EYRA 1IO2A 3RDIA 1OR7C 3GMEA 1D1AA 2XF7A 5FLXZ 2WV0A 4Q48A 2FQ4A 2KIUA 5IT9K 3HBLA 1LEAA 1XMAA 4C2MA 1BR4A 3ZCOA 4ZH4F 1T08B 1WI3A 1GDTA 4U88A 2OZ6A 2JVGA 3HDDA 1TQMA 3QWLA 2HWVA 4L5IA 1I1GA 5D5UB 3FZVA 3FRQA 4G7OF 2GWRA 2MD0A 5CXIA 3L09A 1BI0A 3R60A 1UI6A 4BEHA 3KPHA 4GGGA 5E79C 1OPCA 2HOTA 4A5NA 4H0EA 3I58A 3WTYC 1U0JA 5BPIA 3ANPA 1R9TJ 1FP1D 2W48A 1TQIA 2E19A 1OFCX 1FJLA 5E17F 2XASA 4DW6A 5JLWA 3HSEA 2CJJA 2UXUA 4C2UA 3SEQA 3VODA 4BDYA 1GV5A 3SZGA 2Q24A 4NNJA 3KYDB 5IYDJ 3I55I 2BGCA 3GXOA 5M5XJ 4AWXB 1X3WB 3SWHA 2E2JJ 2I8DA 2QWWA 1TWCJ 4HG2A 3EUHC 1SD6A 1YRNA 3CCRI 2QKMB 4IHYA 2KDOA 3KZZA 4F7ZA 1MNMC 2ISYA 3P9CA 2X0LA 4G94A 4HNUA 4E70A 1SC7A 4N4NB 1Y39A 4DVYP 4PGGA 5LFAA 2YVXA 3PASA 4ZZLA 1ZTRA 1DGRM 1O7LA 3HB9A 4BHCA 1SEUA 4RGSA 1XG1A 2F4MB 5D6FA 1VTNC 1IN5A 4BGDA 2WAEA 3S1MJ 4ICHA 3JCUC 5LGTA
chains in the Genus database with same CATH topology
1GV2A 2REKA 4HKUA 2EQRA 4JP0A 1AHDP 3GZIA 3ON2A 3KNWA 5EZHA 2DMPA 1W0UA 4D7MA 3K7AJ 1RKWA 2I10A 1DU0A 1ORKA 1WCMJ 2XB5A 2YS9A 1ZQ3P 1IDYA 3BQYA 4A3IJ 3JRGA 2QCOA 3CQZJ 3TEDA 4Y7NJ 1JGGA 2TRTA 3HM5A 2LLKA 2CUEA 2TCTA 4GCLA 2JA6J 2O8KA 9ANTA 3OSFA 4M3EA 1B72B 3HOUJ 3HOWJ 1RESA 4JYKA 1ETWA 5HODA 1OCPA 1X2NA 5FLMJ 2Y9ZA 5F0HA 5K7FA 2QKOA 2GBYA 1TWFJ 3QBMA 4XRSG 1NK2P 4IEJA 2HOAA 4EEFG 3GBGA 3MVPA 4A3BJ 1WPKA 4B3AA 2L7FP 3VW1A 3HOVJ 1RR7A 1MBFA 5AQCA 1OCTC 3OOUA 3S15J 4V2FA 5IP7J 4A3EJ 3FIWA 2RAEA 4GFKA 3E7LA 2XGDA 3IUVA 3K2AA 2G0EA 5CXGA 3S14J 3OIOA 3VW0A 3GTJJ 4C3HJ 2M0CA 1BW6A 4M6VA 1D5YA 1MSEC 3CMYA 1JT0A 3BTCA 4B4CA 3FKIJ 3VP5A 1U78A 2WV1A 2ID3A 1B72A 3MNLA 3NI7A 1F43A 2ME0A 2GM4A 3TW6A 1HLVA 3NRGA 4GFLA 3VOXA 2M2EA 2GUHA 4PXIA 1Q1VA 5EG0B 3LHQA 3I4NJ 4JX6A 4DYQA 3SFIA 4BKXA 2G7SA 3BQZA 5M3MJ 1E3OC 2DG8A 2WGBA 1ETKA 2X9DA 5JLXA 1NK3P 1MBGA 1IJWC 3CCYA 2AO9A 5FKOA 1SFOJ 3BG9A 4XK4A 2WUIA 3GTPJ 4BBSJ 3JR9A 2MG4A 1ZGWA 4A3JJ 2R7ZJ 4V2GA 2DTZA 2DA3A 3GTOJ 1SANA 3LSJA 1TC3C 5GP9A 3GTQJ 4XICA 1LE8B 4M3GA 1FTTA 2NVYJ 2NOGA 4BY1J 3FISA 4AC0A 1UI5A 3ZQFA 2LP0A 3HTIA 3L1PA 2IBDA 3S1RJ 3LSGA 3AQSA 1X58A 2JA7J 5EG0A 4AC6A 2XPWA 2Y2ZA 1FEXA 4CGRA 1PUFB 2E2IJ 1SGMA 3ZOBA 1VF9A 2GENA 4BY7J 2YUSA 4D5FA 1MSFC 3HOYJ 2JMWA 2IEKA 2XPVA 3VPRA 1JKOC 3ZQHA 2E1OA 2HOSA 3M3YJ 1DU6A 3G1MA 4C3JJ 3TP3A 3LNQA 1TWHJ 3CRJA 1JUMA 3C07A 5EDNA 1Z0XA 1UMQA 4MO7A 4CYCB 2EZKA 4D5CA 1HDPA 1T33A 2DA5A 5EEAA 2DA2A 3A02A 2R92J 3EUPA 2O7OA 3TP0A 3F0CA 2D5VA 1LE8A 2XPUA 5FJ8J 2DMTA 2ID6A 5E3MA 1JKPC 2DMUA 5FGLA 4GFBA 2DA6A 5C44J 3QPSA 5HAWA 1MBHA 3HOXJ 3VVXA 3HGGA 3BTIA 1ZK8A 2EH3A 1PUFA 4M3BA 2OERA 3VVYA 3KKDA 5C4YA 1XC5A 2NVTJ 4MFDA 1QRYA 1G2HA 3A03A 3PO3J 3PM1A 3LSPA 5EGOB 1TWGJ 3NAUA 3QKXA 1QVUA 1W0TA 3EGQA 4FTHA 2LVSA 1UHSA 4FE4A 1ETOA 3HOZJ 5E3OA 5J1UA 3JRAA 3VW2A 4CYCA 3D1NI 2UXPA 4S0HB 2L9RA 4DYRA 2FJ1A 1EF4A 2OPTA 5FKKA 4FE7A 3UKGA 1MBJA 4LOCA 2V57A 2DA7A 1ITYA 2YVHA 3RZDJ 3IV5A 4DYCA 4FISA 2P81A 1U9OA 5M3FJ 2CQXA 2RASA 3H3VK 1MBEA 1MH4A 1T56A 2PMZN 4BBRJ 1JT6A 1ENHA 1WH7A 4JX4A 1O4XA 3S1NJ 5IOYA 5F04A 2Y9YA 4JX5A 1H88C 1UG2A 2ZCXA 3JSJA 3Q0WA 3HKZN 2DA1A 1A5JA 1MH3A 5GPCA 1HF0A 2LTPA 2R5YB 2LKXA 2HDDA 2X48A 2DJNA 4ME9A 5EGOA 2VKVA 2ZB9A 2ZCMA 1TWAJ 5C4XJ 1AKHB 5J1YA 3G7RA 5K58A 2K9SA 2DG7A 1IV6A 1AU7A 3ZQLA 3JRCA 4QSHA 3HEFA 3HE0A 2OI8A 1JKQC 3NXCA 3BCGA 3IH2A 1Y1WJ 2QIBA 3RD3A 3HIMA 5M5WJ 2JA5J 4A3GJ 1JJ6C 1JTYA 3G56A 5CW8A 1BL0A 2FBQA 4A3DJ 4HNVA 1GT0C 1GVDA 4M3DA 2QF7A 2NVQJ 3BR3A 1P7JA 3SDGA 2FX0A 2M8GX 2XDNA 1K61A 3G1OA 1BA5A 5F08A 2R5YA 3VVZA 2DMQA 2K9QA 2WAQN 1U8BA 2XRLA 3BG5A 3LJLA 3V6GA 3BT9A 2GLOA 2M34A 2NS8A 1AKHA 2ZCNA 1Y1VJ 3I4MJ 3B81A 3BNIA 1ETXA 1IGNA 2FD5A 4QTRA 1H8AC 1HCRA 4X1EA 1FTZA 2GFNA 1ZKGA 2COBA 3ZQIA 1XS9A 3DCFA 2G7GA 5H9TA 3VOKA 5D18A 1ETYA 2EBIA 3B6CA 3JREA 3OSGA 5IYBJ 3BRUA 1P7IA 3WHCA 4DZPA 1ETVA 4DZJA 4MFEA 3JRFA 5BNGA 2Y31A 1JJ8C 3GEUA 3GTKJ 2F07A 2JN6A 3ZQCA 1S7EA 3DEWA 4MLOA 5EZGA 5IP6A 4IHXA 1I3QJ 1VI0A 3PPBA 2HYTA 3Q0UA 4AF5A 5EF6A 1JKRC 4GCTA 3S16J 1JUSA 1LFBA 2KT0A 2IU5A 3WHBA 5E3LA 2LR8A 5J1RA 5IPAA 2M9HA 2ZOYA 3TW7A 2E2HJ 4KWAA 2MSYA 2Y30A 4XRSA 1A6IA 2RHAA 4IHWA 2HQ5A 4A3CJ 5GPAA 3HTHA 3MN2A 5DS9A 2AHQA 3JRDA 1B8IB 2K9NA 4RBOA 2PZ9A 3IH3A 4B1RA 2MGQA 2VUMJ 4UDSA 5FMPA 1I50J 4JNNA 2VPRA 5DAJA 1APLC 2D6YA 3FK6A 4Y52J 2QOPA 1MBKA 4L62A 4M3FA 2HKUA 3VIBA 2XB0X 3BR2A 5IOZA 4AUXA 4A3MJ 4X6AJ 2LK2A 3JRBA 3IH4A 5FKLA 2VI6A 4NELA 2YVEA 4AYBN 5DTDA 3DPJA 5HSZA 3BHQA 2LY9A 2X6OA 3LWJA 3ZQGA 3Q0VA 1IUFA 3BTLA 2R0QC 3AQTA 4C3IJ 5FKMA 3SJMA 2CUFA 3ANGA 1WGXA 4L5EA 1CQTA 2L7MP 3ON4A 1RETA 3BR1A 1VNDA 3G1LA 2NVXJ 1ZR4A 5J3LA 5M5YJ 4JKZA 3NPIA 4A3KJ 1H89C 2L7ZA 2OF7A 3A01B 1B8IA 5F1JA 3O8GA 2G3BA 1IC8A 2XGEA 2Y0SN 3E7QA 2DA4A 2G7LA 1JTXA 4W97A 3GTMJ 2DMNA 3S1QJ 2QWTA 3KKCA 5HBUA 3LSRA 3NNRA 3BG3A 4UUSB 4G12A 1POGA 5F0CA 2JJ7A 2R93J 5FKNA 3CJDA 3P9TA 3C2BA 4ACIA 2H1KA 1IG7A 4I6ZA 2JK3A 3O60A 1GUUA 4BXXJ 4A93J 2VKEA 2EZIA 4NDLA 1QVTA 2LD5A 5K7HA 1RKTA 4XIDA 4A3FJ 1IDZA 2H8RA 2ECCA 3RQIA 1K83J 2JWTA 3M4OJ 5C3EJ 4MIMA 3FK7A 2EZLA 2MW8A 1F36A 3HTAA 2EZHA 2HXIA 3RKQA 2CQQA 3HTJA 1RPWA 3S17J 4XRMA 3BR5A 4C2MJ 2R5ZB 3W6VA 3A01A 2UXHA 2NP3A 1Z77A 2XSDC 3VUQA 3Q3SA 2L0KA 4A69C 3PO2J 2YU9J 4MXMA 4UUSA 1VFCA 3B6AA 2ME6A 5EYRA 1X2MA 2XGCA 2LFBA 2ECBA 2FQ4A 3BR6A 1IRZA 3HBLA 1LFUP 3MKLA 1WI3A 3RH2A 5FHPA 1GDTA 3BR0A 1HOMA 4JL3A 2PBXA 1QPIA 3HDDA 1BW5A 5IP9J 2WB1N 3BTJA 3JRIA 1YRNB 2UXIA 3S2DJ 2N8GA 3FRQA 1FIPA 2W53A 3CDLA 5CXIA 1UI6A 2QTQA 3T6NA 2HOTA 4RDUA 3S5RA 4J19A 2O9LA 2UXOA 1I6HJ 2CRGA 4NN1A 3O8HA 2R5ZA 5FLVA 3ANPA 3QPLA 3LOCA 1R9TJ 2W48A 3F1BA 3HGYA 2E19A 1HDDC 1OFCX 3RZOJ 1FJLA 4W1UA 4DW6A 5JLWA 2UXUA 2CJJA 5C4JJ 1GV5A 4YZEA 5EFYA 2ELKA 2NX4A 2Q24A 1BJZA 4MK6A 2K40A 5F27A 1WH5A 2B63J 4A3LJ 3S2HJ 5IYDJ 4I76A 2HYJA 3CWRA 5M5XJ 1JUPA 2CU7A 4D7NA 2E2JJ 3KZ9A 2NS7A 3GTLJ 2HI3A 5IYCJ 3JRHA 2DN0A 1TWCJ 2KDZA 5E3NA 1YRNA 4GCKA 4ABZA 5D1RA 4IHYA 2NP5A 1MNMC 1ZR2A 2O7TA 5K7ZA 4IHVA 5D19A 1OJLA 4UUTA 3QQAA 2HXOA 4QIWN 2JA8J 3PASA 1NTCA 1ZTRA 5F0FA 3GTGJ 3HB9A 2ZOZA 3V78A 3NARA 1U9NA 3COLA 1XG1A 1FIAA 3S1MJ 3H0GJ 2IAIA 4ICHA 3BJBA 1ETQA 4FCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV2 A;  2REK A;  4HKU A;  2EQR A;  4JP0 A;  1AHD P;  3GZI A;  3ON2 A;  3KNW A;  5EZH A;  2DMP A;  1W0U A;  4D7M A;  3K7A J;  1RKW A;  2I10 A;  1DU0 A;  1ORK A;  1WCM J;  2XB5 A;  2YS9 A;  1ZQ3 P;  1IDY A;  3BQY A;  4A3I J;  3JRG A;  2QCO A;  3CQZ J;  3TED A;  4Y7N J;  1JGG A;  2TRT A;  3HM5 A;  2LLK A;  2CUE A;  2TCT A;  4GCL A;  2JA6 J;  2O8K A;  9ANT A;  3OSF A;  4M3E A;  1B72 B;  3HOU J;  3HOW J;  1RES A;  4JYK A;  1ETW A;  5HOD A;  1OCP A;  1X2N A;  5FLM J;  2Y9Z A;  5F0H A;  5K7F A;  2QKO A;  2GBY A;  1TWF J;  3QBM A;  4XRS G;  1NK2 P;  4IEJ A;  2HOA A;  4EEF G;  3GBG A;  3MVP A;  4A3B J;  1WPK A;  4B3A A;  2L7F P;  3VW1 A;  3HOV J;  1RR7 A;  1MBF A;  5AQC A;  1OCT C;  3OOU A;  3S15 J;  4V2F A;  5IP7 J;  4A3E J;  3FIW A;  2RAE A;  4GFK A;  3E7L A;  2XGD A;  3IUV A;  3K2A A;  2G0E A;  5CXG A;  3S14 J;  3OIO A;  3VW0 A;  3GTJ J;  4C3H J;  2M0C A;  1BW6 A;  4M6V A;  1D5Y A;  1MSE C;  3CMY A;  1JT0 A;  3BTC A;  4B4C A;  3FKI J;  3VP5 A;  1U78 A;  2WV1 A;  2ID3 A;  1B72 A;  3MNL A;  3NI7 A;  1F43 A;  2ME0 A;  2GM4 A;  3TW6 A;  1HLV A;  3NRG A;  4GFL A;  3VOX A;  2M2E A;  2GUH A;  4PXI A;  1Q1V A;  5EG0 B;  3LHQ A;  3I4N J;  4JX6 A;  4DYQ A;  3SFI A;  4BKX A;  2G7S A;  3BQZ A;  5M3M J;  1E3O C;  2DG8 A;  2WGB A;  1ETK A;  2X9D A;  5JLX A;  1NK3 P;  1MBG A;  1IJW C;  3CCY A;  2AO9 A;  5FKO A;  1SFO J;  3BG9 A;  4XK4 A;  2WUI A;  3GTP J;  4BBS J;  3JR9 A;  2MG4 A;  1ZGW A;  4A3J J;  2R7Z J;  4V2G A;  2DTZ A;  2DA3 A;  3GTO J;  1SAN A;  3LSJ A;  1TC3 C;  5GP9 A;  3GTQ J;  4XIC A;  1LE8 B;  4M3G A;  1FTT A;  2NVY J;  2NOG A;  4BY1 J;  3FIS A;  4AC0 A;  1UI5 A;  3ZQF A;  2LP0 A;  3HTI A;  3L1P A;  2IBD A;  3S1R J;  3LSG A;  3AQS A;  1X58 A;  2JA7 J;  5EG0 A;  4AC6 A;  2XPW A;  2Y2Z A;  1FEX A;  4CGR A;  1PUF B;  2E2I J;  1SGM A;  3ZOB A;  1VF9 A;  2GEN A;  4BY7 J;  2YUS A;  4D5F A;  1MSF C;  3HOY J;  2JMW A;  2IEK A;  2XPV A;  3VPR A;  1JKO C;  3ZQH A;  2E1O A;  2HOS A;  3M3Y J;  1DU6 A;  3G1M A;  4C3J J;  3TP3 A;  3LNQ A;  1TWH J;  3CRJ A;  1JUM A;  3C07 A;  5EDN A;  1Z0X A;  1UMQ A;  4MO7 A;  4CYC B;  2EZK A;  4D5C A;  1HDP A;  1T33 A;  2DA5 A;  5EEA A;  2DA2 A;  3A02 A;  2R92 J;  3EUP A;  2O7O A;  3TP0 A;  3F0C A;  2D5V A;  1LE8 A;  2XPU A;  5FJ8 J;  2DMT A;  2ID6 A;  5E3M A;  1JKP C;  2DMU A;  5FGL A;  4GFB A;  2DA6 A;  5C44 J;  3QPS A;  5HAW A;  1MBH A;  3HOX J;  3VVX A;  3HGG A;  3BTI A;  1ZK8 A;  2EH3 A;  1PUF A;  4M3B A;  2OER A;  3VVY A;  3KKD A;  5C4Y A;  1XC5 A;  2NVT J;  4MFD A;  1QRY A;  1G2H A;  3A03 A;  3PO3 J;  3PM1 A;  3LSP A;  5EGO B;  1TWG J;  3NAU A;  3QKX A;  1QVU A;  1W0T A;  3EGQ A;  4FTH A;  2LVS A;  1UHS A;  4FE4 A;  1ETO A;  3HOZ J;  5E3O A;  5J1U A;  3JRA A;  3VW2 A;  4CYC A;  3D1N I;  2UXP A;  4S0H B;  2L9R A;  4DYR A;  2FJ1 A;  1EF4 A;  2OPT A;  5FKK A;  4FE7 A;  3UKG A;  1MBJ A;  4LOC A;  2V57 A;  2DA7 A;  1ITY A;  2YVH A;  3RZD J;  3IV5 A;  4DYC A;  4FIS A;  2P81 A;  1U9O A;  5M3F J;  2CQX A;  2RAS A;  3H3V K;  1MBE A;  1MH4 A;  1T56 A;  2PMZ N;  4BBR J;  1JT6 A;  1ENH A;  1WH7 A;  4JX4 A;  1O4X A;  3S1N J;  5IOY A;  5F04 A;  2Y9Y A;  4JX5 A;  1H88 C;  1UG2 A;  2ZCX A;  3JSJ A;  3Q0W A;  3HKZ N;  2DA1 A;  1A5J A;  1MH3 A;  5GPC A;  1HF0 A;  2LTP A;  2R5Y B;  2LKX A;  2HDD A;  2X48 A;  2DJN A;  4ME9 A;  5EGO A;  2VKV A;  2ZB9 A;  2ZCM A;  1TWA J;  5C4X J;  1AKH B;  5J1Y A;  3G7R A;  5K58 A;  2K9S A;  2DG7 A;  1IV6 A;  1AU7 A;  3ZQL A;  3JRC A;  4QSH A;  3HEF A;  3HE0 A;  2OI8 A;  1JKQ C;  3NXC A;  3BCG A;  3IH2 A;  1Y1W J;  2QIB A;  3RD3 A;  3HIM A;  5M5W J;  2JA5 J;  4A3G J;  1JJ6 C;  1JTY A;  3G56 A;  5CW8 A;  1BL0 A;  2FBQ A;  4A3D J;  4HNV A;  1GT0 C;  1GVD A;  4M3D A;  2QF7 A;  2NVQ J;  3BR3 A;  1P7J A;  3SDG A;  2FX0 A;  2M8G X;  2XDN A;  1K61 A;  3G1O A;  1BA5 A;  5F08 A;  2R5Y A;  3VVZ A;  2DMQ A;  2K9Q A;  2WAQ N;  1U8B A;  2XRL A;  3BG5 A;  3LJL A;  3V6G A;  3BT9 A;  2GLO A;  2M34 A;  2NS8 A;  1AKH A;  2ZCN A;  1Y1V J;  3I4M J;  3B81 A;  3BNI A;  1ETX A;  1IGN A;  2FD5 A;  4QTR A;  1H8A C;  1HCR A;  4X1E A;  1FTZ A;  2GFN A;  1ZKG A;  2COB A;  3ZQI A;  1XS9 A;  3DCF A;  2G7G A;  5H9T A;  3VOK A;  5D18 A;  1ETY A;  2EBI A;  3B6C A;  3JRE A;  3OSG A;  5IYB J;  3BRU A;  1P7I A;  3WHC A;  4DZP A;  1ETV A;  4DZJ A;  4MFE A;  3JRF A;  5BNG A;  2Y31 A;  1JJ8 C;  3GEU A;  3GTK J;  2F07 A;  2JN6 A;  3ZQC A;  1S7E A;  3DEW A;  4MLO A;  5EZG A;  5IP6 A;  4IHX A;  1I3Q J;  1VI0 A;  3PPB A;  2HYT A;  3Q0U A;  4AF5 A;  5EF6 A;  1JKR C;  4GCT A;  3S16 J;  1JUS A;  1LFB A;  2KT0 A;  2IU5 A;  3WHB A;  5E3L A;  2LR8 A;  5J1R A;  5IPA A;  2M9H A;  2ZOY A;  3TW7 A;  2E2H J;  4KWA A;  2MSY A;  2Y30 A;  4XRS A;  1A6I A;  2RHA A;  4IHW A;  2HQ5 A;  4A3C J;  5GPA A;  3HTH A;  3MN2 A;  5DS9 A;  2AHQ A;  3JRD A;  1B8I B;  2K9N A;  4RBO A;  2PZ9 A;  3IH3 A;  4B1R A;  2MGQ A;  2VUM J;  4UDS A;  5FMP A;  1I50 J;  4JNN A;  2VPR A;  5DAJ A;  1APL C;  2D6Y A;  3FK6 A;  4Y52 J;  2QOP A;  1MBK A;  4L62 A;  4M3F A;  2HKU A;  3VIB A;  2XB0 X;  3BR2 A;  5IOZ A;  4AUX A;  4A3M J;  4X6A J;  2LK2 A;  3JRB A;  3IH4 A;  5FKL A;  2VI6 A;  4NEL A;  2YVE A;  4AYB N;  5DTD A;  3DPJ A;  5HSZ A;  3BHQ A;  2LY9 A;  2X6O A;  3LWJ A;  3ZQG A;  3Q0V A;  1IUF A;  3BTL A;  2R0Q C;  3AQT A;  4C3I J;  5FKM A;  3SJM A;  2CUF A;  3ANG A;  1WGX A;  4L5E A;  1CQT A;  2L7M P;  3ON4 A;  1RET A;  3BR1 A;  1VND A;  3G1L A;  2NVX J;  1ZR4 A;  5J3L A;  5M5Y J;  4JKZ A;  3NPI A;  4A3K J;  1H89 C;  2L7Z A;  2OF7 A;  3A01 B;  1B8I A;  5F1J A;  3O8G A;  2G3B A;  1IC8 A;  2XGE A;  2Y0S N;  3E7Q A;  2DA4 A;  2G7L A;  1JTX A;  4W97 A;  3GTM J;  2DMN A;  3S1Q J;  2QWT A;  3KKC A;  5HBU A;  3LSR A;  3NNR A;  3BG3 A;  4UUS B;  4G12 A;  1POG A;  5F0C A;  2JJ7 A;  2R93 J;  5FKN A;  3CJD A;  3P9T A;  3C2B A;  4ACI A;  2H1K A;  1IG7 A;  4I6Z A;  2JK3 A;  3O60 A;  1GUU A;  4BXX J;  4A93 J;  2VKE A;  2EZI A;  4NDL A;  1QVT A;  2LD5 A;  5K7H A;  1RKT A;  4XID A;  4A3F J;  1IDZ A;  2H8R A;  2ECC A;  3RQI A;  1K83 J;  2JWT A;  3M4O J;  5C3E J;  4MIM A;  3FK7 A;  2EZL A;  2MW8 A;  1F36 A;  3HTA A;  2EZH A;  2HXI A;  3RKQ A;  2CQQ A;  3HTJ A;  1RPW A;  3S17 J;  4XRM A;  3BR5 A;  4C2M J;  2R5Z B;  3W6V A;  3A01 A;  2UXH A;  2NP3 A;  1Z77 A;  2XSD C;  3VUQ A;  3Q3S A;  2L0K A;  4A69 C;  3PO2 J;  2YU9 J;  4MXM A;  4UUS A;  1VFC A;  3B6A A;  2ME6 A;  5EYR A;  1X2M A;  2XGC A;  2LFB A;  2ECB A;  2FQ4 A;  3BR6 A;  1IRZ A;  3HBL A;  1LFU P;  3MKL A;  1WI3 A;  3RH2 A;  5FHP A;  1GDT A;  3BR0 A;  1HOM A;  4JL3 A;  2PBX A;  1QPI A;  3HDD A;  1BW5 A;  5IP9 J;  2WB1 N;  3BTJ A;  3JRI A;  1YRN B;  2UXI A;  3S2D J;  2N8G A;  3FRQ A;  1FIP A;  2W53 A;  3CDL A;  5CXI A;  1UI6 A;  2QTQ A;  3T6N A;  2HOT A;  4RDU A;  3S5R A;  4J19 A;  2O9L A;  2UXO A;  1I6H J;  2CRG A;  4NN1 A;  3O8H A;  2R5Z A;  5FLV A;  3ANP A;  3QPL A;  3LOC A;  1R9T J;  2W48 A;  3F1B A;  3HGY A;  2E19 A;  1HDD C;  1OFC X;  3RZO J;  1FJL A;  4W1U A;  4DW6 A;  5JLW A;  2UXU A;  2CJJ A;  5C4J J;  1GV5 A;  4YZE A;  5EFY A;  2ELK A;  2NX4 A;  2Q24 A;  1BJZ A;  4MK6 A;  2K40 A;  5F27 A;  1WH5 A;  2B63 J;  4A3L J;  3S2H J;  5IYD J;  4I76 A;  2HYJ A;  3CWR A;  5M5X J;  1JUP A;  2CU7 A;  4D7N A;  2E2J J;  3KZ9 A;  2NS7 A;  3GTL J;  2HI3 A;  5IYC J;  3JRH A;  2DN0 A;  1TWC J;  2KDZ A;  5E3N A;  1YRN A;  4GCK A;  4ABZ A;  5D1R A;  4IHY A;  2NP5 A;  1MNM C;  1ZR2 A;  2O7T A;  5K7Z A;  4IHV A;  5D19 A;  1OJL A;  4UUT A;  3QQA A;  2HXO A;  4QIW N;  2JA8 J;  3PAS A;  1NTC A;  1ZTR A;  5F0F A;  3GTG J;  3HB9 A;  2ZOZ A;  3V78 A;  3NAR A;  1U9N A;  3COL A;  1XG1 A;  1FIA A;  3S1M J;  3H0G J;  2IAI A;  4ICH A;  3BJB A;  1ETQ A;  4FCY A; 
#chains in the Genus database with same CATH topology
 3K10 A;  3CC2 I;  2REK A;  1YW9 A;  3KNW A;  4A12 A;  4WXD A;  2HEO A;  1W0U A;  4PUS A;  4XLN F;  3VDX A;  2JSC A;  1DU0 A;  2I10 A;  2PMH A;  2BEO A;  1X3Z B;  2YS9 A;  5GAG J;  1Y8Q B;  2CUZ A;  1G3S A;  2Q2E A;  3HPG A;  3W6K B;  1IDY A;  3QPT A;  2COM A;  3TED A;  1REP C;  3HL2 A;  1I1S A;  2M7B A;  2TRT A;  3BY6 A;  2HOE A;  4P9F A;  4UHT A;  4PJJ A;  1J2X A;  2O8K A;  4F92 B;  5L3G A;  3GFJ A;  3L2U A;  3A0B C;  1BOB A;  1B72 B;  2ZFU A;  3HOU J;  5HOD A;  4JYK A;  2A68 F;  3IP4 B;  1P4A A;  2GBY A;  2RDP A;  2AXT C;  3RPQ A;  2R3S A;  3QYB A;  3R4K A;  4IEJ A;  2HOA A;  2VOD A;  3ABT A;  1TLH B;  3GBG A;  3ELK A;  5A2Q K;  1R36 A;  2L7F P;  2E7X A;  2OJE D;  2KIF A;  1H9T A;  2PMZ A;  3VW1 A;  2DT5 A;  1MBF A;  3HHH A;  3H5A A;  1OCT C;  3GO5 A;  2LKS A;  3CTA A;  3FIW A;  3E6B A;  2O3F A;  4XOP A;  4CIC A;  4PDK A;  5BMZ A;  3VW0 A;  3FHN A;  2WAF A;  2Q8K A;  3TQN A;  3H1C A;  3BC8 A;  3L7W A;  4Q4Z F;  2ZCW A;  5K5O A;  4XSZ F;  3IKT A;  2A5Y B;  4G6T B;  1MSE C;  3CMY A;  5HDG A;  2DFE A;  1MMA A;  3K4M A;  3FKI J;  2W1O A;  5DM6 F;  1MMS A;  1U78 A;  2UUZ A;  3NI7 A;  1F43 A;  2R4G A;  2GM4 A;  1D1B A;  1W5S A;  2RC4 A;  2ZSI B;  3K69 A;  1MDM A;  1Q1V A;  5EG0 B;  4ZYE A;  3DBL B;  3I4N J;  3HYI A;  4JX6 A;  2XC7 A;  3ZMD A;  2G7S A;  3BQZ A;  2VBX A;  3M8F A;  2BV6 A;  4P55 A;  4YIR X;  2JSP A;  2M5W A;  2OTJ I;  1XGN A;  1NK3 P;  3FMS A;  1MBG A;  1SFO J;  1HW2 A;  1U8R A;  2F5C A;  4EVI A;  4BJT A;  5E8G A;  2FF4 A;  3HG9 A;  3JR9 A;  4KT6 A;  5F1R A;  1ZGW A;  4A3J J;  4LG0 B;  3NRV A;  4IF4 A;  5D4R A;  2DA3 A;  5ICG A;  1VZ0 A;  3I0T A;  3QP5 A;  5FRN A;  2WAQ A;  5HLH A;  2E1C A;  1YJ9 I;  4O3M A;  4KUM A;  1LE8 B;  1FTT A;  2EWN A;  3GLL A;  3CC4 I;  2O6G E;  4AC0 A;  1UI5 A;  3ZQF A;  2LP0 A;  4Z2Y A;  4AU7 A;  1LJ9 A;  2RV8 A;  4HW0 A;  2IBD A;  5LHI A;  3FBI B;  4P96 A;  2JA7 J;  4V19 K;  4IKF A;  4XLE A;  3FMQ A;  2Y2Z A;  5HLI A;  4AC6 A;  1S29 A;  2VOP A;  1SGM A;  2ICW G;  1UFM A;  3H9G A;  5E1W A;  3DXJ F;  3E6M A;  2QQ8 A;  2GXA A;  2DU9 A;  1IRF A;  2DAO A;  4MQV A;  1Z9C A;  3TP3 A;  1MGT A;  3WU2 C;  3CCJ I;  1WKM A;  2K7L A;  3U2R A;  1AWC A;  2CYY A;  1T33 A;  3LA3 A;  3FBN B;  3A02 A;  2HVR A;  3HJE A;  5L3E A;  2HQN A;  3CCL I;  2OCC H;  3F0C A;  3OOP A;  1WRJ A;  3DBH B;  4C2T A;  4Y13 A;  3ABM H;  2QQ9 A;  4LIU A;  3MKW B;  1JKP C;  2Z16 A;  4YRV A;  1BIA A;  1DUX C;  1YQA A;  1OYY A;  5TIS C;  2PLY A;  3OIQ A;  3HGG A;  1V4R A;  2V7F A;  5DEQ A;  5E8I A;  2EH3 A;  4M3B A;  3DU5 A;  2IRF G;  2NVT J;  3GLX A;  4M6Y A;  4MFD A;  1O7F A;  1QRY A;  4FT8 A;  2M4K A;  2YSR A;  4MTD A;  3LSP A;  3NAU A;  2E60 A;  3J7Z I;  2P7V B;  3BPV A;  1KGS A;  4M9Z A;  4FTH A;  2O0Y A;  3ASO H;  5D5V B;  1UHS A;  5FD6 A;  1BI1 A;  5E3O A;  1TTY A;  2E1M B;  3U21 A;  1YS7 A;  2FML A;  1S72 I;  4S0H B;  2L9R A;  4DYR A;  2FJ1 A;  3A4C A;  5HS9 A;  3CJN A;  1ZEL A;  5TRD A;  2VC0 A;  2AXL A;  3O3K A;  3UKG A;  2PJR B;  4EJV A;  3BDD A;  3LFU A;  1FBQ A;  4DYC A;  3G73 A;  2A3S A;  2CQX A;  3HRU A;  3H3V K;  1MH4 A;  4BBR J;  4BU2 A;  3CDI A;  1WH7 A;  1O3S A;  1FPQ A;  3S1N J;  3WG7 H;  4HZF A;  3PJR A;  3JSJ A;  1QHG A;  4FX4 A;  4IOA F;  2DA1 A;  3SHF A;  1A5J A;  4WIB A;  2F48 A;  5J6X A;  3GW2 A;  2LTP A;  4Y3O A;  2R5Y B;  2HDD A;  5J4Y A;  3BJO A;  2E5Z A;  5EGO A;  2ZCM A;  1Z1D A;  1TWA J;  4LLL A;  4YFX F;  2ZJR F;  1R7J A;  4HDU A;  4CDG A;  1SFX A;  2B0L A;  2K9S A;  4IRI A;  2LYC A;  2V9K A;  3J81 Z;  1W7P B;  2HVS A;  2QQB A;  2R7Q A;  3EUK L;  3JRC A;  3HEF A;  2HVQ A;  1JKQ C;  2E35 A;  4BQA A;  1R1V A;  5D8L B;  4CHU A;  3F23 A;  1Z91 A;  2QIB A;  3ZN0 A;  1ZG5 A;  1XGS A;  4E7H A;  2CQ7 A;  4JBA A;  3LSH A;  2WWY A;  3IKV A;  4U87 A;  3TO6 A;  3WOD F;  4XM3 A;  3OYF A;  4A6E A;  4CCK A;  4P9U A;  2DOF A;  1RUO A;  3CMM A;  2LRE A;  4EQQ A;  4E7Z A;  3FWE A;  4E7I A;  1K61 A;  2CO5 A;  2ZCN A;  2M34 A;  2WB1 A;  3HPH A;  4WXC A;  3I4M J;  4Z6Y A;  4M71 A;  1ETX A;  2FD5 A;  4G6D A;  2M3A A;  3WTX C;  3K1M A;  4GDF A;  6PAX A;  4RB0 A;  3ZQI A;  2KRF A;  2QLZ A;  1XS9 A;  2ZSH B;  3ROU A;  2PMU A;  2P5L C;  1VQ6 I;  3FKJ A;  2XKO A;  2RGV A;  5IYB J;  3K70 D;  4DZJ A;  3GUD A;  1GVJ A;  3JRF A;  2HR3 A;  1XGO A;  2YX4 A;  3MZY A;  4DBQ A;  3GEU A;  2JN6 A;  2VE8 A;  2VJJ A;  1I3Q J;  2JPC A;  3Q0U A;  2IXS A;  5EF6 A;  1JKR C;  2EB7 A;  1JUS A;  4I09 A;  1V5E A;  1LFB A;  2XAU A;  2IU5 A;  4HV5 A;  5JFR A;  3GZN B;  3PFI A;  5J1R A;  1A35 A;  5GAH J;  3S3N A;  1CF7 B;  1ACI A;  3IAS 2;  4CGZ A;  1WJC A;  3RKW A;  2HQ5 A;  3MQ0 A;  4WK8 F;  3BOQ A;  3MN2 A;  3JRD A;  1B8I B;  3FM5 A;  5HDK A;  1OYW A;  3IH3 A;  5EJC A;  1QHH D;  2MGQ A;  3OYC A;  1XN7 A;  1I50 J;  3FX3 A;  2VPR A;  4JNN A;  2JUC A;  2QOP A;  4Y52 J;  4L62 A;  3F8M A;  4M3F A;  3VIB A;  3TDZ C;  4A3M J;  2Y69 H;  3RJP A;  1IN4 A;  4BJ6 C;  4J00 A;  3IH4 A;  2KL4 A;  3K4L A;  5FKL A;  3V42 A;  4NEL A;  2LBF B;  2YVE A;  2FA5 A;  2TDX A;  3DWL E;  1UHM A;  2PFB A;  2ZXJ A;  1XPX A;  3BHQ A;  4IHT A;  3Q0V A;  3CCM I;  4IRV A;  1IUF A;  3BTL A;  2R0Q C;  2F4I A;  3AQT A;  5FKM A;  3SJM A;  1LB2 A;  4L5E A;  3ON4 A;  2ZJP F;  3VEP A;  1RET A;  3LMM A;  5M5Y J;  4JKZ A;  3W2V A;  4A0Z A;  1DP3 A;  1USS A;  3F22 A;  4A3K J;  2HYG D;  2HDW A;  5F1J A;  2K02 A;  2VXZ A;  1DP7 P;  2G7L A;  3FXL A;  4PK4 A;  3S1Q J;  1LUJ B;  3D5L A;  1SFU A;  2R93 J;  1AOY A;  1RZ4 A;  3ISP A;  4ACI A;  5H2F C;  2MBF A;  3HIF A;  5KAI C;  4XN3 A;  5L3F A;  3PFY A;  2Y48 A;  4NDL A;  4IJA A;  2IGK A;  2K3F A;  3K4B A;  3M4O J;  4ITV A;  3CO7 C;  1GLN A;  5C3E J;  1VQK I;  4MIM A;  2Y75 A;  2EZH A;  3HTJ A;  3OYK A;  4C2M J;  1Z77 A;  2FEZ A;  3VUQ A;  1OCR H;  5ICE A;  3L2V A;  4LD5 A;  3HSF A;  3KEY A;  3PO2 J;  1XB4 A;  3B6A A;  2M87 A;  1ON2 A;  2XGC A;  1K78 B;  1IRZ A;  1FMV A;  2ACJ A;  3UR3 C;  3MKL A;  1T39 A;  2ZO4 A;  1IRX A;  2ZKZ A;  3PSF A;  5HLT A;  1QPI A;  1X1B A;  4PJM A;  3KYC B;  4L18 B;  4XKW A;  3EDP A;  4LMY A;  1RRJ A;  3QOD A;  5JVT A;  1FIP A;  2Q1Z B;  3KEO A;  2NXN B;  2CW8 A;  4XLC A;  1FYM A;  3O6B B;  2QTQ A;  2UXO A;  5DCM B;  5J8C A;  1I6H J;  3RSN A;  4NN1 A;  2R5Z A;  1XDS A;  2PBI A;  3QPL A;  1V3F A;  1V5F A;  3TO7 A;  2YX7 A;  4NC8 A;  4MEX F;  3F1B A;  3CP2 A;  4FHT A;  4OD4 A;  4BS9 A;  5DCF A;  4HF0 A;  3CLQ A;  3G4S I;  2EFP A;  2JUG A;  4PSX A;  5EFY A;  2ZNY A;  2ELK A;  1BJZ A;  3PQJ A;  2JZY A;  2K40 A;  1MNE A;  4UY8 I;  2WBM A;  3C3W A;  4PSW A;  2GZW A;  3CWR A;  4LB5 A;  2L3D A;  3KZ9 A;  2NS7 A;  3GTL J;  2HI3 A;  3OL4 A;  5IYC J;  2DLL A;  3JRH A;  4GO1 A;  2KDZ A;  4GCK A;  1LQ1 A;  2FBK A;  4HBL A;  2L9N A;  3CO6 C;  2GXB A;  3OL3 A;  2NP5 A;  1X4O A;  2I5U A;  3TMO A;  1Y0U A;  2F4O B;  5AIQ A;  4CCN A;  2JRT A;  1MJ9 A;  1OJL A;  3QQA A;  4QIW N;  3CUO A;  4HPQ A;  3HXL A;  4IQJ A;  5K1Y A;  2KP6 A;  5FRM A;  2P8T A;  3U1K A;  3NAR A;  2OD5 A;  4B48 A;  4HX7 A;  1W7P D;  2PN6 A;  2V9P A;  1I39 A;  2DT6 A;  2Z1D A;  3DPL C;  3CES A;  1ZLK A;  1SVM A;  2EK5 A;  4M6X A;  1FBS A;  4HKU A;  3CLO A;  1AHD P;  1FWZ A;  3GZI A;  4QWQ A;  2MH2 A;  2YU3 A;  1WSU A;  1R23 A;  3OIP A;  4D7M A;  2HDC A;  5BS6 A;  1ORK A;  1TBX A;  2CS3 A;  1ZQ3 P;  1LEB A;  3E3V A;  4A3I J;  3OWT A;  3HUG B;  3SEZ A;  1JGG A;  3C7J A;  4GCL A;  3G6E I;  5DUK A;  4ENN A;  9ANT A;  5ICC A;  4LG3 A;  3H36 A;  3KET A;  4M3E A;  1IUY A;  3M1E A;  2KIS A;  2XAQ A;  1MZB A;  4LK0 F;  5IT9 Z;  3ZMV A;  3EPZ A;  4ENM A;  1ZRF A;  4BNC A;  2ZXW H;  2QGU A;  5K7F A;  3ESW B;  1D5V A;  2PFV A;  3WTV C;  1TWF J;  5TJJ A;  3CUQ C;  2R7U A;  4K2E A;  1ONV A;  4EEF G;  4B3A A;  1B1B A;  4JOM A;  4BQO A;  2PX9 A;  3P9I A;  2ZJQ F;  1QZY A;  3BG7 A;  4RA2 A;  3OOU A;  3DPU A;  3U1D A;  4CYD A;  2M4G A;  4V2F A;  5IP7 J;  5ED4 A;  2AQE A;  2RAE A;  4GFK A;  3MEX A;  2OU2 A;  1MJA A;  3OIO A;  3S14 J;  5D8K B;  4B3X A;  3GTJ J;  4C3H J;  2M0C A;  4UUV A;  1BW6 A;  2EIL H;  2X85 A;  2XGX A;  2BY0 A;  4M6V A;  2VOO A;  4XKV A;  2DQL A;  3BTC A;  2L2O A;  4OOI A;  5J40 A;  1SD7 A;  2WV1 A;  4WX9 A;  1R4N B;  1B72 A;  2ZNZ A;  4A0X A;  2MLK A;  1FP2 A;  3DTE A;  2D45 A;  1VQN I;  2UWM A;  2HTS A;  2M2E A;  3X2Q H;  5LEJ A;  5DD4 A;  4FQG A;  5CLS A;  4BKX A;  4HQM A;  1KU7 A;  1QO0 D;  1GXQ A;  2HFH A;  1UEL B;  2WGB A;  2X9D A;  5JLX A;  1E3H A;  1QZZ A;  2VBY A;  4XON A;  1IJW C;  2MH9 A;  5FKO A;  4RB1 A;  4BBS J;  2DW4 A;  2K4J A;  2QZ8 A;  5AIP A;  4OIR F;  3SZT A;  1O3R A;  2IW5 A;  3GTO J;  1SAX A;  3QRF F;  1B4A A;  1RIO H;  2FMY A;  1TC3 C;  3H5N A;  3HRT A;  5J47 A;  2E34 A;  4I2O A;  2NOG A;  5FFZ A;  2ZBK A;  3I71 A;  5AON A;  3F21 A;  3FIS A;  4MTE A;  4DJA A;  3F8B A;  5CQG A;  3HTI A;  1YIO A;  3L1P A;  3S1R J;  2NYX A;  2X6W A;  3LSM A;  2WAD A;  5EG0 A;  2NOJ B;  4CGR A;  1FEX A;  2HQR A;  1PUF B;  2E2I J;  4OMY A;  4EJO A;  1VF9 A;  2GEN A;  2YUS A;  4RGX A;  3ECH A;  4D5F A;  1MSF C;  2VQC A;  2IS4 A;  1SFK A;  1LVA A;  3VPR A;  2E1O A;  1X1D A;  2HOS A;  1B9M A;  2JTV A;  1DU6 A;  1GXP A;  3OMY A;  4ANJ A;  3LNQ A;  2L4A A;  1J9I A;  1KU9 A;  3GZ6 A;  1W5T A;  3FMR A;  5BQT A;  1UMQ A;  2OUM A;  2P5V A;  4MO7 A;  4LG0 A;  2EZK A;  4D5C A;  4CYC B;  3L2Q A;  3ZMZ A;  2DA5 A;  2MLG A;  5EEA A;  1B59 A;  1N77 A;  1FYK A;  1SAU A;  2R7W A;  5KHD A;  1LE8 A;  3KIO A;  3T8T A;  2HTJ A;  4XR6 A;  2ID6 A;  2K3P A;  5FGL A;  2VPL A;  2OA4 A;  4MHG A;  1PUE E;  4EM1 A;  5H20 A;  1IXR C;  2ZC2 A;  3KX2 A;  3HOX J;  5A2Q Z;  3VVX A;  3BTI A;  2KLO A;  1D3Y A;  4EGY A;  1UST A;  4LJZ F;  4LB6 B;  3L2R A;  2ZY9 A;  2GA1 A;  1N25 A;  5C4Y A;  2RRE A;  3ZMS A;  4QPQ A;  2FOW A;  3K1N A;  3AG3 H;  1G2H A;  4U7B A;  3PM1 A;  1TW2 A;  2ETH A;  3F8F A;  1QVU A;  2D1V A;  2K5C A;  2KFD A;  3AFH A;  1W0T A;  3EGQ A;  5J4V A;  4HV6 A;  2LVS A;  3HC7 A;  1YTY A;  4IVN A;  1FYL A;  3QPH A;  3PNT A;  5J1U A;  3JRA A;  3BRO A;  3S3M A;  1TT0 A;  2CV0 A;  5LLQ A;  2L5Q A;  3WGG A;  2BVL A;  2P4W A;  2EJR A;  2ZJ2 A;  2KZG A;  5FKK A;  1EH6 A;  2DOA A;  4FE7 A;  5F6F A;  2VXD A;  1KZH A;  2KRC A;  4XBF A;  3CD6 I;  2LF8 A;  4IPA A;  2Y0S A;  2YVH A;  1YE9 A;  2Q0O A;  2P81 A;  1U9O A;  2RAS A;  2MAB A;  3W3C A;  1F5T A;  1MBE A;  2PMZ N;  1T56 A;  1YW7 A;  1O4X A;  2W57 A;  2PEX A;  2ADU A;  2Z5U A;  3AAF A;  4OAY A;  3MMY B;  2ZCX A;  4ZTF A;  4WXH A;  1MH3 A;  1X3U A;  3K0L A;  5DD8 A;  1UAA A;  4HNT A;  2ZB9 A;  2BY3 A;  5HDN A;  4ESF A;  5C4X J;  3ZN1 A;  1AKH B;  1T6S A;  3G7R A;  4E7K A;  5K58 A;  3I54 A;  2ZME C;  4G6Q A;  3WTT C;  5L3D A;  1OLT A;  3F6V A;  4QSH A;  1E2X A;  4E7L A;  4EJU A;  4KJZ A;  3H92 A;  3AL0 C;  3IH2 A;  1Z7U A;  1Y1W J;  2PJR A;  1YX5 A;  3HIM A;  2FNP A;  5CYV A;  2VT2 A;  1JJ6 C;  2STT A;  1K4S A;  1XD7 A;  4A2U A;  4HF2 A;  5CW8 A;  4CZC A;  3BP8 A;  1BL0 A;  3WGH A;  1GT0 C;  1GVD A;  2QF7 A;  3SDG A;  2KQR A;  1P4X A;  5E18 F;  3V8J A;  3ZPL A;  3KYL A;  3W2W A;  4NC7 A;  1YYV A;  1A6Q A;  3G1O A;  3TL4 X;  2DDA A;  5KK1 A;  1WJE A;  1T98 A;  2L02 A;  3ZRG A;  2R5Y A;  2K9Q A;  2WAQ N;  1JHF A;  3LJL A;  3BG5 A;  3ERM A;  1X4P A;  3R6S A;  3BT9 A;  4Y17 A;  1TP4 A;  3BNI A;  4II3 A;  4QTR A;  4HLY A;  1W7P A;  1H8A C;  3GEZ A;  1KQ9 A;  2G7G A;  1QGP A;  2V9V A;  2W25 A;  3VTI A;  5H9T A;  2FE3 A;  1BR1 A;  2M30 A;  5D18 A;  3JRE A;  1DPU A;  2XRN A;  1ULY A;  4DZP A;  4ENJ A;  1ETV A;  3QU3 A;  4MFE A;  3TOB A;  4BJ5 C;  2F07 A;  1BBY A;  3ZQC A;  3DEW A;  1BM9 A;  2M8E A;  4YII A;  5IP6 A;  3E1S A;  5BOX A;  2CW0 F;  4AF5 A;  4A5M A;  3S16 J;  3GCM A;  1HXD A;  4Y4R A;  1Y8R B;  2KT0 A;  1PP8 F;  5E3L A;  5CJ9 A;  5IPA A;  3EQL F;  5KVR A;  1FOY A;  3FXK A;  5JHF A;  3F9K A;  4RAZ A;  1C0W A;  2E2H J;  3HRS A;  1R00 A;  2MSY A;  4XRS A;  2RHA A;  5LRR A;  1D8K A;  2CFX A;  5GPA A;  3HTH A;  1T0F A;  4UVB A;  2Y0M A;  3KP7 A;  2AHQ A;  5DS9 A;  3DQV C;  1QU3 A;  2PZ9 A;  2K9N A;  3OYE A;  4B1R A;  2IGO A;  5DAJ A;  3I64 A;  4CXF A;  3LFK A;  4UB6 C;  1APL C;  3FK6 A;  1MBK A;  3BR2 A;  4AUX A;  2KMU A;  4X6A J;  3I4P A;  2VLA A;  3L2W A;  4LFU A;  5GTI C;  1TZL A;  2KPM A;  2VI6 A;  1S7A A;  1VQP I;  1QZE A;  3ZQ7 A;  3CJR B;  3V8L A;  3GFM A;  3DPJ A;  5HSZ A;  2XAF A;  2X6O A;  3LWJ A;  3MKZ A;  5TGT A;  3ANG A;  1WGX A;  1CQT A;  1WQ2 A;  3O2P E;  1A31 A;  1CF7 A;  2DO7 A;  1XX5 A;  4RM2 A;  3G2B A;  2NVX J;  4XMY A;  4KIG A;  3I59 B;  1SVL A;  1TQP A;  2RQP A;  1ZAO A;  3ZP5 A;  2DDB A;  2L7Z A;  4OD5 A;  1ODD A;  1ZRD A;  2DPD A;  2OF7 A;  1WJB A;  3U9G A;  1B8I A;  3O8G A;  4BH9 A;  1LDJ A;  4DQ2 A;  2XGE A;  2G3B A;  2NRA C;  2DPU A;  3CF2 A;  5FFX A;  1HA8 A;  2DMN A;  3NQO A;  3NNR A;  2JRM A;  3BG3 A;  2G7U A;  1JHH A;  1FY7 A;  3ZR8 X;  4HQE A;  2OQR A;  4TV7 A;  3P9T A;  4A6D A;  3C2B A;  2LBF A;  1QQI A;  1VQ7 I;  1TL8 A;  2H1K A;  4I6Z A;  2J5O A;  3GF2 A;  2W00 A;  2K85 A;  1HKQ A;  4KNY A;  1P2F A;  4XID A;  2EFO A;  2H8R A;  1WJA A;  2ECC A;  3RQI A;  3VYS B;  3OS0 A;  4U7D A;  2JWT A;  3A2K A;  2H6B A;  4YIF A;  2D2W A;  3K4C A;  4XLA A;  3COA C;  1F36 A;  3RKQ A;  2HXI A;  1PJR A;  1RPW A;  4XRM A;  3B02 A;  3BR5 A;  4EJT A;  2V6C A;  2NP3 A;  3GFL A;  3I9V 2;  1EA3 A;  3Q3S A;  4XSX F;  2IGM A;  3ULQ B;  1YHQ I;  2YU9 J;  2A61 A;  3WG9 A;  1R5H A;  2QQA A;  4NQW B;  4UVA A;  3RCO A;  1TNT A;  3GWZ A;  2ECB A;  4CUG A;  3L00 A;  1S3J A;  2KJB A;  1LFU P;  1EJ9 A;  1H9G A;  3RH2 A;  5FHP A;  3BR0 A;  4AM3 A;  4HYE A;  2PBX A;  3LSI A;  4JL3 A;  2ZXH A;  5IP9 J;  2WB1 N;  4EV0 A;  3S2D J;  1YO5 C;  2W53 A;  3CDL A;  2OZU A;  4OIP F;  3NS4 A;  5CQE A;  3FXU A;  3T6N A;  3OV8 A;  1SD5 A;  4J19 A;  2O9L A;  3BPX A;  5CVU A;  5FLV A;  3QYF A;  3LOC A;  3ZQQ A;  4I99 C;  2LKP A;  2OTL I;  4KA4 A;  4YFK F;  1OMI A;  3HGY A;  2HNH A;  3OYJ A;  2G9W A;  1O3Q A;  3RZO J;  2X1D A;  2JA2 A;  2QM3 A;  2OC6 A;  2DYR H;  1BI2 A;  3NWS A;  5C4J J;  1K78 A;  4I7H A;  2NX4 A;  1YJN I;  2CFO A;  5LHG A;  4MK6 A;  3T1B A;  1R6R A;  1G4D A;  2IS1 A;  4A3L J;  5LRS A;  3GZ5 A;  3KP4 A;  1JUP A;  2CU7 A;  2CUJ A;  2GIV A;  2D1H A;  1FOK A;  4E7J A;  2DN0 A;  1KYZ A;  4ABZ A;  1V54 H;  2HS5 A;  2BHY A;  1QBJ A;  3LQQ A;  1YLF A;  3HOS A;  1WI9 A;  3WE2 A;  2NNY A;  5D19 A;  5B3S H;  4UUT A;  3DV8 A;  2JA8 J;  5DCM A;  4PJL A;  1NTC A;  3CUQ B;  1KU3 A;  4D1Q A;  4RLQ A;  5F0F A;  3LAJ A;  3N4M A;  4AVP A;  2R7S A;  1R1U A;  3V78 A;  2MA3 A;  2IA2 A;  1FIA A;  2EFN A;  4OAZ A;  1U5T B;  3PIP F;  1J0R A;  1QA6 A;  2IAI A;  3W2A A;  3BJB A;  2IA0 A;  4FX0 A;  3R61 A;  1GV2 A;  2XAH A;  1KA8 A;  2RN7 A;  4CO8 A;  2EV5 A;  3ON2 A;  1BI3 A;  4BXF A;  1XSD A;  2VE9 A;  4I98 B;  3K7A J;  3T5X A;  2L4M A;  3OYM A;  1WCM J;  2AQF A;  2HYF A;  2XB5 A;  3WU1 B;  2KJC A;  4DOZ A;  1FOW A;  4BXU A;  2DFI A;  4ZDL A;  3JAM K;  3CQZ J;  4Q5S F;  2MYS A;  1RC9 A;  3RPU D;  2F5E A;  3BCA A;  3HM5 A;  2XV4 S;  4CH7 A;  3DKW A;  4ZDP A;  1STZ A;  5CKT A;  2CUE A;  1JGS A;  4N4O B;  4KIT B;  2X6X A;  2RKH A;  2X6Y A;  4XOT A;  2Z99 A;  3G71 I;  4OU0 A;  1D0X A;  1ETW A;  3LA2 A;  1OCP A;  5FLM J;  1G3W A;  1J5Y A;  3M8J A;  4F55 A;  2QKO A;  4BAC A;  3QBM A;  1IRG A;  3VOE A;  3NWT A;  4IHS A;  2FUG 2;  2L9V A;  1D0Y A;  3V4G A;  3HOV J;  1RR7 A;  4CCO A;  2V1N A;  1UG0 A;  2LY1 A;  2V6E A;  3S15 J;  4LIV A;  3OYL A;  2E5N A;  2NNN A;  3ECO A;  4B09 A;  1Z05 A;  3HKZ A;  3E7L A;  4NB5 A;  3CME I;  2G0E A;  2A69 F;  5JHU A;  1VQ5 I;  3DPT A;  3VOX A;  2P0W A;  3HUG A;  3OYD A;  1FT9 A;  2HGC A;  4MEY F;  4LLG F;  2NVU B;  3VSK A;  1JT0 A;  1N78 A;  3P9K A;  3V7C A;  2ID3 A;  1FSE A;  2ME0 A;  1HLV A;  2VJ4 A;  1BR2 A;  4PXI A;  2HQA A;  3LHQ A;  2V4J C;  4DYQ A;  3N05 A;  4BDZ A;  3SFI A;  4B43 A;  1D1C A;  3EYI A;  1FOX A;  2WA0 A;  4RLF A;  2B7E A;  4RB3 C;  1VQ9 I;  1SFE A;  3BG9 A;  1QPM A;  4XK4 A;  1LNW A;  2WUI A;  5BPD A;  2MG4 A;  1KQ0 A;  1NG7 A;  1G3Y A;  4Q47 A;  1WJF A;  1SAN A;  2LH9 A;  3LSJ A;  4ON0 A;  1NH3 A;  1P9Q C;  2R7O A;  2R7D A;  3DEU A;  5GP9 A;  4MGR A;  2VL8 A;  4EM0 B;  2VQG A;  4M3G A;  2NVY J;  4XLF A;  4BY1 J;  3SQN A;  3F72 A;  2BW3 B;  3SDB A;  4EAT A;  4NBQ A;  1G59 A;  2V79 A;  4L5J A;  1JXS A;  3LSG A;  3AQS A;  1X58 A;  2XPW A;  2VAS A;  3CCQ I;  1W36 C;  4L0Y B;  4L0Z B;  3F6O A;  5HLG A;  4IXA A;  2MC3 A;  3HOY J;  1KU2 A;  2XAJ A;  2JMW A;  3VB2 A;  2NAZ A;  3FXR A;  3ZQH A;  3J7A Y;  3G3Z A;  3M3Y J;  4PJN A;  5B5E C;  1JUM A;  2FXA A;  3J80 K;  1HDP A;  2O7O A;  3TP0 A;  2D5V A;  1OYI A;  4PCQ A;  3GFI A;  2XPU A;  4O5V A;  5E3M A;  3BCB A;  2DMU A;  4BYY A;  4GFB A;  2DA6 A;  2BVM A;  4XQF A;  2CMP A;  4J01 A;  2K9L A;  3JTH A;  3LST A;  1YI2 I;  1DGW Y;  3KEQ A;  1MBH A;  4PGH A;  1D0Z A;  3DKX A;  3DLL F;  1HSJ A;  1J75 A;  3CJQ B;  1NG6 A;  1W5C C;  1PUF A;  3CZ6 A;  3ONQ A;  4QLC U;  1W4M A;  2OER A;  4BE1 A;  4ENK A;  2HPI A;  1XC5 A;  3KKD A;  3VVY A;  4AYB A;  2R7X A;  3A03 A;  2ZME B;  3PO3 J;  3MFK A;  1TWG J;  4ZYD A;  2DT7 B;  4II2 A;  4Y33 A;  5E20 A;  3AL0 B;  3VWB A;  4KDP A;  4FE4 A;  4UNO A;  3P5J A;  1WFX A;  3A1Y A;  4B44 A;  4CYC A;  3M7G A;  1R49 A;  4G8X A;  3CCV I;  3HOT A;  1EF4 A;  2OPT A;  2ESN A;  3QOE A;  4IOC F;  5HOO A;  1MBJ A;  2F2E A;  1TT5 B;  2ISZ A;  4PFP A;  2LNB A;  3KP5 A;  3IV5 A;  4FIS A;  3LQR A;  4Y15 A;  1ZGJ A;  1IN7 A;  1P6R A;  4MNU A;  3H9Q A;  1JT6 A;  4JX4 A;  3ZXS A;  2VBW A;  4HX4 A;  1H88 C;  1UG2 A;  2X4H A;  3V8K A;  2EPF A;  5F64 A;  3Q0W A;  1M1E B;  1K6O A;  5GPC A;  1HF0 A;  4M9X A;  1RNL A;  5FB2 A;  4ME9 A;  2X48 A;  4KIC A;  3IC7 A;  2VKV A;  4HA8 A;  2H27 A;  1S9H A;  3V7S A;  4IL6 C;  1RR8 C;  1IF1 A;  2OQG A;  3JW4 A;  4DIQ A;  3MKY B;  5DUI A;  4DNC A;  1VQL I;  2DG7 A;  4HDV A;  1YJW I;  1ZRE A;  1BN5 A;  4UXN A;  4R79 A;  3ZQL A;  1AU7 A;  4P5O A;  2R7F A;  3KCC A;  5HNF A;  3K1P A;  3MWM A;  2IS6 A;  1J7K A;  4YG2 F;  2JA5 J;  4A3G J;  3NEU A;  4UV8 A;  3K4N A;  4BAY A;  2EV0 A;  1JTY A;  2W84 A;  3FXO A;  4OIQ F;  3D5R C;  1FMW A;  2FBQ A;  4A3D J;  3OR2 C;  4HNV A;  1E17 A;  3MAJ A;  2MFZ A;  4ESJ A;  4M3D A;  1S8N A;  2NVQ J;  3BR3 A;  1P7J A;  3RTR A;  4L9V A;  3SXY A;  2E7W A;  2A05 A;  3S2W A;  4E4H A;  5L3B A;  5KNL A;  1HQC A;  1HBX G;  3BWG A;  1Z6T A;  2X51 A;  1BA5 A;  5F08 A;  3VSL A;  2VN2 A;  2V1U A;  2BOL A;  3VVZ A;  1U8B A;  5JR3 A;  3EET A;  4I02 A;  3TBI A;  2B9S A;  4F93 B;  2GLO A;  3B81 A;  1AKH A;  1RUN A;  3KE2 A;  5JI6 A;  1MMD A;  1ZN2 A;  3VYR B;  1TW3 A;  1IGN A;  2P5K A;  1ZG3 A;  4KIS A;  1HCR A;  4X1E A;  2IJL A;  3CF5 F;  1JE8 A;  2COB A;  1FTZ A;  4BUP A;  2GFN A;  5E1Z B;  1XDU A;  2QA4 I;  4U0V A;  3FM3 A;  4NUB A;  3TOA A;  3OSG A;  3IWZ A;  1X19 A;  1P7I A;  2P6T A;  4KIB A;  1WWX A;  2KHM A;  1LDD A;  2Y31 A;  4WWC A;  1LPQ A;  1JJ8 C;  3FHZ A;  3UNG C;  1BC8 C;  4L9J A;  2VKH A;  3RKY A;  1WJD A;  3BLY A;  4EGZ A;  3K8P C;  1R71 A;  2Z3Y A;  2F6C A;  3PPB A;  2LF7 A;  4XRF A;  3J7A O;  1I27 A;  4ZYH A;  1XCB A;  2FU4 A;  2RNJ A;  3RYR A;  3FF5 A;  1Z3Y A;  3HZJ A;  3K2Z A;  1YIT I;  1U3E M;  5FLX K;  3C1D A;  2GOM A;  3CDH A;  3WHB A;  1Z21 A;  3IHU A;  1YX3 A;  2JQ7 A;  3RPU A;  2ZOY A;  4AVZ A;  2M7A A;  2JPB A;  1OCZ H;  3OY9 A;  4IHW A;  3LWF A;  2OBP A;  3DLA A;  2FBI A;  4D0P A;  2BXY A;  3ASN H;  2GOX B;  2H09 A;  4UDS A;  3K4K A;  2QBY B;  5FMP A;  4RB2 C;  5CPR B;  3MZH A;  2D6Y A;  1VQM I;  3RQ4 A;  3OS2 A;  1S7O A;  3WTZ A;  3N97 A;  1UZC A;  4B47 A;  1PP7 U;  3HRM A;  2O5R A;  3QOP A;  4HEA 2;  1ON1 A;  2O61 A;  5FD5 A;  3DU6 A;  3TKY A;  1A36 A;  1BC7 C;  2LOO A;  5DTD A;  3VFZ A;  2VC1 A;  3ZQG A;  1KQ8 A;  5DV5 A;  4C3I J;  2DOD A;  3HTS B;  2L7M P;  4EM2 A;  3LA7 A;  2QKL B;  3G1L A;  1V55 H;  1E3P A;  1VND A;  2VT3 A;  1DDN A;  1I6X A;  4L9T A;  5J3L A;  4ZZD A;  3Q5F A;  4XKC A;  2R7T A;  1IXS B;  1B6A A;  1BOA A;  3IRR A;  2EIK H;  1H89 C;  3OYA A;  5LEK A;  3A01 B;  4RMN A;  2WC2 A;  4PJ0 C;  3AG1 H;  3I53 A;  2Y0S N;  5ILU A;  3E7Q A;  2UXN A;  3GTM J;  3M07 A;  1BJA A;  2QWT A;  3KKC A;  4OIO F;  3LSR A;  4CCJ A;  2DFH A;  3E5Q A;  4UUS B;  3GVA A;  2IGN A;  1XCV A;  2KIM A;  1UCR A;  3DF8 A;  5LGN A;  1XGM A;  5F0C A;  4KYW A;  1G8X A;  5FKN A;  3CJD A;  3M8E A;  1WHU A;  4BE2 A;  4U9N A;  1IG7 A;  4UVC A;  3HSR A;  4BXX J;  2VKE A;  1BIB A;  1YW8 A;  1QVT A;  3CP8 A;  4AD9 A;  3OYI A;  2M0M A;  2EIJ H;  1T8I A;  3BJA A;  4HX8 A;  1S6L A;  1E0E A;  2FQ3 A;  3I59 A;  4BEH B;  3DEE A;  3ZGK A;  1MMN A;  4KN7 X;  3HTA A;  4BL0 B;  3E6D A;  3S17 J;  2DI3 A;  3W6V A;  1O57 A;  3PNV A;  2XSD C;  4CZZ A;  5B1A H;  2L0K A;  3C18 A;  4A69 C;  4MXM A;  2YPR A;  4EMS A;  1K7A A;  2EIN H;  5KCM A;  1YS6 A;  4RAG A;  1GHC A;  1X2M A;  3RKX A;  4D9J A;  1Z67 A;  2VIX A;  3WTS C;  2LFB A;  2DTR A;  2HKX A;  3BR6 A;  4U9L A;  1U2W A;  3S32 A;  1KON A;  3T8R A;  1HOM A;  2PG4 A;  5IT3 A;  1BW5 A;  1OKR A;  3BTJ A;  1FZP B;  3JRI A;  1IZ1 A;  1YRN B;  2UXI A;  4KMU X;  2DCE A;  2N8G A;  1IXC A;  2CSO A;  4S04 A;  1WJ5 A;  2HKO A;  1K79 A;  1T38 A;  4LLN A;  2CV1 A;  4GYG A;  4RDU A;  3S5R A;  1YIJ I;  4MQ9 F;  1IAW A;  2CRG A;  3O8H A;  3KP6 A;  5LGU A;  2VB6 A;  2FBH A;  4XOR A;  1KYW A;  1HKS A;  2CWE A;  2YR2 A;  3LSK A;  2LC2 A;  3S93 A;  1HDD C;  4W1U A;  2VKD A;  3I3L A;  4NQW A;  3OS1 A;  3WTW C;  4AIK A;  3MD2 A;  2CQN A;  1X1P A;  1PYV A;  4YFN F;  4YZE A;  5D5X B;  1ZH5 A;  4S05 A;  2CW7 A;  4BQN A;  3DTK A;  4M72 A;  4AIJ A;  1Y6I A;  3DBR B;  1WH5 A;  4PFO A;  4R1H A;  5F27 A;  4HST A;  4I76 A;  2HYJ A;  5IY5 H;  2B63 J;  3S2H J;  4YEL A;  2W4S A;  4IQ4 A;  4D7N A;  2GQQ A;  2M45 A;  5CVI A;  1ZYR F;  2IS2 A;  2BBY A;  2DQR A;  2Q2E B;  4PZJ A;  3OYB A;  3K9T A;  3L2C A;  5E3N A;  5D1R A;  3CC7 I;  1Q1H A;  4CCM A;  2HPM A;  3KP2 A;  1ZR2 A;  1XSX A;  2O7T A;  5K7Z A;  4IHV A;  4XNF A;  1R4M B;  4ETS A;  2HXO A;  5EEH A;  4NHJ A;  2XIG A;  5B1B H;  4IZZ A;  3GTG J;  3OR1 C;  4RM3 A;  2ZOZ A;  1U9N A;  4IO9 F;  2XVC A;  4G7Z F;  1PDN C;  3COL A;  2NS0 A;  1TNS A;  3K4J A;  3H0G J;  3PUB A;  2L9S A;  2RVC A;  2UXX A;  2BXZ A;  2DFF A;  1ETQ A;  4UB8 C;  4FCY A;  2P6S A;  2RQQ A;  1K6Y A;  2Z9O A;  2LDU A;  1VQO I;  2EQR A;  4JP0 A;  4N0B A;  2A6H F;  3ZMT A;  4BHP A;  3R0A A;  2L7K A;  3F8N A;  3QYE A;  1MD0 A;  5HVQ C;  5EZH A;  2DMP A;  5GAE J;  1OCO H;  1HKT A;  1RKW A;  3H3U A;  1YG2 A;  2HZD A;  4OWR B;  4DGW B;  1L3L A;  3EUA A;  4F91 B;  4NC6 A;  3B73 A;  4HAM A;  4ESB A;  3BQY A;  3ERE D;  3KZI C;  1HST A;  3SYT A;  2K9M A;  3ABL H;  2QCO A;  3JRG A;  3RIR A;  3KFW X;  4Y7N J;  2KZV A;  4P1W A;  5J8F A;  2C6Y A;  2LLK A;  3ML6 A;  4XN0 A;  3WE3 A;  2TCT A;  4RAY A;  5B66 C;  2JA6 J;  1B9N A;  4EJW A;  3OSF A;  4X0G A;  3F3X A;  3CUQ A;  1UB9 A;  4G7H F;  2CH0 A;  3HOW J;  4BQQ A;  2XUB A;  2ZFW A;  1RES A;  2R7R A;  1ZG1 A;  1MDM B;  1X2N A;  2Y9Z A;  5F0H A;  2PJP A;  3KLN A;  3REO A;  1U5T A;  3DFG A;  3E6C C;  5DYM A;  4XRS G;  1NK2 P;  1U6G A;  4CCL A;  1L0O C;  2L01 A;  3MVP A;  5LBQ A;  1WPK A;  4A3B J;  2FRH A;  4I0A A;  1WVR A;  5AQC A;  1A04 A;  2F5D A;  1OQY A;  3S3O A;  3FXM A;  4A3E J;  2G7H A;  2XGD A;  3IUV A;  3K2A A;  5CXG A;  1OR7 A;  5ILS A;  1T2K A;  1R1T A;  1JI8 A;  4GRI A;  3PUF A;  4OMZ A;  5HS7 A;  1VQ4 I;  2QEX I;  1W1W E;  4KT5 C;  1D5Y A;  4B4C A;  2VQL A;  4HLX A;  3VP5 A;  1HC8 A;  3MNL A;  2IA1 A;  3K70 C;  1F1Z A;  3QP6 A;  4ZYA A;  1G3T A;  2LSO A;  3TW6 A;  3PIO F;  3NRG A;  4GFL A;  4C9Y A;  1UJ8 A;  1SD4 A;  4M74 A;  4F3Q A;  4L9N A;  2B3W A;  2GUH A;  3DKY A;  1XTA A;  4YEJ A;  2OV7 A;  3WU0 A;  2BZT A;  2IP2 A;  4UV9 A;  2A6T A;  5M3M J;  4IX7 A;  1E3O C;  1IN6 A;  2DXI A;  1ERD A;  2DG8 A;  1ETK A;  3R0J A;  4IRH A;  2R7V A;  4FET A;  2JT1 A;  3DP7 A;  3CCY A;  2AO9 A;  4HSR A;  3GTP J;  1PVE A;  2MD5 A;  2HYT A;  2R7Z J;  4V2G A;  2DTZ A;  4LIT A;  3PQK A;  3T0Y A;  3HTU A;  2W85 A;  3F8C A;  3BZ6 A;  4GYI A;  1I5Z A;  4ASN A;  1EH8 A;  4XIC A;  3Q9V A;  3GTQ J;  3C2H A;  4ZC3 A;  1YFH A;  3J81 K;  2ZXI A;  3CCU I;  4KMF A;  2UV1 A;  4OIN F;  1SVO A;  2DOE A;  3EUH A;  2OAZ A;  3KZY A;  2Z2S B;  1D8J A;  2K4B A;  4XL9 A;  2EFQ A;  4FAS D;  2PI0 A;  4A0Y A;  3ZOB A;  1UHW A;  1H0M A;  4BY7 J;  5FO5 A;  1XSV A;  2LRD A;  2WY7 Q;  2BYV E;  2IEK A;  1XMX A;  2MC4 A;  3BZC A;  2XPV A;  1OIS A;  2XF5 A;  3CMA I;  3TGN A;  1JKO C;  2A2F X;  3JAM Z;  3ZMU A;  1J59 A;  3G1M A;  4C3J J;  1TWH J;  4JK1 X;  3CRJ A;  3C2G A;  3C07 A;  5EDN A;  1Z0X A;  3LL7 A;  3JSP A;  1Z3X A;  2KIQ A;  1LFP A;  1F4K A;  2CQK A;  2O03 A;  1ZAR A;  2DA2 A;  2R92 J;  3EUP A;  3IUO A;  2CV2 A;  2E1N A;  2WTE A;  3IWF A;  4GXO A;  5FJ8 J;  4CSW A;  2DK5 A;  2DMT A;  5E1X A;  2W7N A;  2BW3 A;  2UZK A;  1WZ2 A;  5ICF A;  5HS8 A;  2FSW A;  3QPS A;  4F52 A;  5C44 J;  1FNN A;  5HAW A;  2BY2 A;  2H6C A;  4ZYG A;  4E6K G;  2EA2 A;  4M73 A;  1Y56 A;  3JTG A;  3M9A A;  1ZK8 A;  2RNG A;  2QSH X;  4C30 A;  5LD2 C;  2A5W A;  3AG4 H;  2QEN A;  1Y0N A;  4ZDO A;  5EGO B;  3SZP A;  3QKX A;  1OCC H;  3WGI A;  4N9I A;  4LGW A;  1ETO A;  3ABU A;  3HOZ J;  1HW5 A;  3VW2 A;  3CCS I;  1NHA A;  4ZJZ A;  1EV7 A;  2XDV A;  3D1N I;  2UXP A;  4HRI A;  2V1D A;  4RAF A;  2O8X A;  3P7N A;  3LAP A;  3BG6 A;  4LOC A;  3CJT B;  1SMT A;  2W82 A;  1FX7 A;  2ELH A;  1I3A A;  2DA7 A;  1MMG A;  3KLO A;  4WF2 A;  1ITY A;  2V57 A;  3RZD J;  5JVG F;  2E36 A;  3A0H C;  2IPQ X;  2XF6 A;  5CVJ A;  3BZK A;  1MW7 A;  5M3F J;  3E5U A;  3V7R A;  1ENH A;  3S8P A;  2BHZ A;  5IOY A;  5F04 A;  2Y9Y A;  2AS5 F;  4JX5 A;  4O6J A;  1DQU A;  3M1C A;  4RS8 A;  5D6E A;  3HKZ N;  3E5X A;  4GCV A;  2ZME A;  2LKX A;  2IVM A;  2DJN A;  3ABK H;  4ZTJ A;  1R22 A;  1IW7 F;  1T95 A;  5J1Y A;  1IN8 A;  4LK1 F;  3SFZ A;  2QUF A;  4WCG A;  3H35 A;  1HW1 A;  1IV6 A;  5D5W B;  3HE0 A;  3QAH A;  4I01 A;  2GAU A;  2OI8 A;  2Z33 A;  5DDG A;  3NXC A;  3BCG A;  4HF1 A;  2V1X A;  2E1M C;  3RD3 A;  3PSI A;  5M5W J;  2LG4 A;  3IRQ A;  1J09 A;  3BJ6 A;  3G56 A;  4U0W A;  2EV6 A;  2KKO A;  2DBB A;  1VQ8 I;  1YOV B;  1Z7L A;  4BE0 A;  2F5V A;  1RI7 A;  1AA7 A;  3AKZ A;  2P7C B;  3HHG A;  4BHB A;  4KFC A;  2FX0 A;  2M8G X;  1R5G A;  5HNH A;  3FDY A;  5H6R A;  5FRO A;  1ZLJ A;  3J80 Z;  1O3T A;  2XDN A;  2X1E A;  2DMQ A;  3V6G A;  2V26 A;  2XRL A;  4JQF A;  4E7S A;  3OYG A;  1Z6R A;  2STW A;  2NS8 A;  4AID A;  2EA4 A;  1Y1V J;  1ZRC A;  4CA0 A;  5KAF C;  4U0Y A;  1DPR A;  5D4S A;  5GTH C;  1ZKG A;  3Q9S A;  1XMK A;  3DCF A;  5DM7 F;  2BY1 A;  3H9J A;  3VOK A;  2FJI 1;  4HOB A;  1ETY A;  2EBI A;  2W24 A;  3B6C A;  3BRU A;  5K5Q A;  3QU6 A;  3WHC A;  1EKE A;  5CVV A;  5BNG A;  2GIZ A;  3GTK J;  3CCE I;  1S7E A;  3DTI A;  4MLO A;  1MND A;  5EZG A;  3IL2 A;  4IHX A;  1VI0 A;  4R8H A;  3GX4 X;  2WY8 Q;  1EH7 A;  3K6G A;  4GCT A;  3PNY A;  2XHK A;  3TO9 A;  4XKB A;  2LR8 A;  4B8X A;  2M9H A;  4QPO A;  3EYY A;  5CVR A;  1X1C A;  2EFW A;  1N75 A;  3MCZ A;  3TW7 A;  4KWA A;  2DJI A;  5GAD J;  3OYH A;  2Y30 A;  1A6I A;  1LKX A;  4A3C J;  2JVH A;  4RBO A;  1QNT A;  2FOK A;  2ELJ A;  5ILV A;  3H3Z A;  2A07 F;  2VUM J;  2M1B A;  4G9Y A;  4XLP F;  2L54 A;  3I56 I;  3H0D A;  3H5R A;  1R58 A;  1T0F C;  2HKU A;  2XB0 X;  5IOZ A;  4XLH A;  1MKM A;  2LK2 A;  3JRB A;  4M9S A;  4AYB N;  3IAM 2;  3W6J B;  1P4W A;  4IRG A;  1G6N A;  4RGR A;  3RYP A;  1W36 D;  2LY9 A;  1CGP A;  3FXQ A;  4KIF A;  2H8W A;  2VQH A;  2CUF A;  2VJI A;  3J7Y J;  3L9F A;  2VJ5 A;  2J5P A;  1R5I D;  3BR1 A;  2QSG X;  2XAG A;  1ZR4 A;  2K86 A;  1LDK B;  2EIM H;  2BE5 F;  1FBU A;  2E71 A;  3E0J B;  2IT0 A;  3NPI A;  2LMD A;  1SMY F;  5EEG A;  3GYH X;  5FGM A;  5L3C A;  2QYO A;  2LY2 A;  3WTU C;  1IC8 A;  1FLI A;  1FC3 A;  2QBY A;  2DA4 A;  5H6Q A;  1JTX A;  4W97 A;  5LHH A;  5ERI A;  1ZGA A;  3TDU C;  5HBU A;  4H4K C;  1IV8 A;  1S5L C;  2GA2 A;  4KN4 X;  4G12 A;  1POG A;  2JJ7 A;  1LVK A;  2X1C A;  4I0B A;  2HU9 A;  2QVO A;  3OYN A;  2HZT A;  2XRO A;  2CGP A;  1FSH A;  2JK3 A;  3RI4 A;  3O60 A;  2QSF X;  3D0S A;  2K27 A;  3JSO A;  1GUU A;  2DK8 A;  4A93 J;  2DYS H;  4RGU A;  2CG4 A;  2VON A;  2H94 A;  1ZHF A;  2EZI A;  2FNA A;  2LD5 A;  2XKP A;  1RKT A;  5K7H A;  3KP3 A;  4A3F J;  2KRH A;  3I5U A;  1K4T A;  1IDZ A;  2ESH A;  3VYT B;  3FXJ A;  2VBZ A;  1K83 J;  1U5T C;  3MZ8 A;  3FK7 A;  2EZL A;  2F5F A;  2A6E F;  2OCE A;  2PQ8 A;  2MW8 A;  1MJB A;  1MIJ A;  4DBR A;  2XSJ C;  2CQQ A;  3PL8 A;  2B1E A;  2R5Z B;  2GXG A;  2UXH A;  3A01 A;  3VYU B;  1V5G A;  1X1A A;  5K5R A;  1F9N A;  3AG2 H;  1P92 A;  4UUS A;  2H1L A;  3D5S C;  4N9H A;  1VFC A;  2ME6 A;  3E97 A;  4AIH A;  5EYR A;  1IO2 A;  3RDI A;  1OR7 C;  3GME A;  1D1A A;  2XF7 A;  5FLX Z;  2WV0 A;  4Q48 A;  2FQ4 A;  2KIU A;  5IT9 K;  3HBL A;  1LEA A;  1XMA A;  4C2M A;  1BR4 A;  3ZCO A;  4ZH4 F;  1T08 B;  1WI3 A;  1GDT A;  4U88 A;  2OZ6 A;  2JVG A;  3HDD A;  1TQM A;  3QWL A;  2HWV A;  4L5I A;  1I1G A;  5D5U B;  3FZV A;  3FRQ A;  4G7O F;  2GWR A;  2MD0 A;  5CXI A;  3L09 A;  1BI0 A;  3R60 A;  1UI6 A;  4BEH A;  3KPH A;  4GGG A;  5E79 C;  1OPC A;  2HOT A;  4A5N A;  4H0E A;  3I58 A;  3WTY C;  1U0J A;  5BPI A;  3ANP A;  1R9T J;  1FP1 D;  2W48 A;  1TQI A;  2E19 A;  1OFC X;  1FJL A;  5E17 F;  2XAS A;  4DW6 A;  5JLW A;  3HSE A;  2CJJ A;  2UXU A;  4C2U A;  3SEQ A;  3VOD A;  4BDY A;  1GV5 A;  3SZG A;  2Q24 A;  4NNJ A;  3KYD B;  5IYD J;  3I55 I;  2BGC A;  3GXO A;  5M5X J;  4AWX B;  1X3W B;  3SWH A;  2E2J J;  2I8D A;  2QWW A;  1TWC J;  4HG2 A;  3EUH C;  1SD6 A;  1YRN A;  3CCR I;  2QKM B;  4IHY A;  2KDO A;  3KZZ A;  4F7Z A;  1MNM C;  2ISY A;  3P9C A;  2X0L A;  4G94 A;  4HNU A;  4E70 A;  1SC7 A;  4N4N B;  1Y39 A;  4DVY P;  4PGG A;  5LFA A;  2YVX A;  3PAS A;  4ZZL A;  1ZTR A;  1DGR M;  1O7L A;  3HB9 A;  4BHC A;  1SEU A;  4RGS A;  1XG1 A;  2F4M B;  5D6F A;  1VTN C;  1IN5 A;  4BGD A;  2WAE A;  3S1M J;  4ICH A;  3JCU C;  5LGT A; 
#chains in the Genus database with same CATH homology
 1GV2 A;  2REK A;  4HKU A;  2EQR A;  4JP0 A;  1AHD P;  3GZI A;  3ON2 A;  3KNW A;  5EZH A;  2DMP A;  1W0U A;  4D7M A;  3K7A J;  1RKW A;  2I10 A;  1DU0 A;  1ORK A;  1WCM J;  2XB5 A;  2YS9 A;  1ZQ3 P;  1IDY A;  3BQY A;  4A3I J;  3JRG A;  2QCO A;  3CQZ J;  3TED A;  4Y7N J;  1JGG A;  2TRT A;  3HM5 A;  2LLK A;  2CUE A;  2TCT A;  4GCL A;  2JA6 J;  2O8K A;  9ANT A;  3OSF A;  4M3E A;  1B72 B;  3HOU J;  3HOW J;  1RES A;  4JYK A;  1ETW A;  5HOD A;  1OCP A;  1X2N A;  5FLM J;  2Y9Z A;  5F0H A;  5K7F A;  2QKO A;  2GBY A;  1TWF J;  3QBM A;  4XRS G;  1NK2 P;  4IEJ A;  2HOA A;  4EEF G;  3GBG A;  3MVP A;  4A3B J;  1WPK A;  4B3A A;  2L7F P;  3VW1 A;  3HOV J;  1RR7 A;  1MBF A;  5AQC A;  1OCT C;  3OOU A;  3S15 J;  4V2F A;  5IP7 J;  4A3E J;  3FIW A;  2RAE A;  4GFK A;  3E7L A;  2XGD A;  3IUV A;  3K2A A;  2G0E A;  5CXG A;  3S14 J;  3OIO A;  3VW0 A;  3GTJ J;  4C3H J;  2M0C A;  1BW6 A;  4M6V A;  1D5Y A;  1MSE C;  3CMY A;  1JT0 A;  3BTC A;  4B4C A;  3FKI J;  3VP5 A;  1U78 A;  2WV1 A;  2ID3 A;  1B72 A;  3MNL A;  3NI7 A;  1F43 A;  2ME0 A;  2GM4 A;  3TW6 A;  1HLV A;  3NRG A;  4GFL A;  3VOX A;  2M2E A;  2GUH A;  4PXI A;  1Q1V A;  5EG0 B;  3LHQ A;  3I4N J;  4JX6 A;  4DYQ A;  3SFI A;  4BKX A;  2G7S A;  3BQZ A;  5M3M J;  1E3O C;  2DG8 A;  2WGB A;  1ETK A;  2X9D A;  5JLX A;  1NK3 P;  1MBG A;  1IJW C;  3CCY A;  2AO9 A;  5FKO A;  1SFO J;  3BG9 A;  4XK4 A;  2WUI A;  3GTP J;  4BBS J;  3JR9 A;  2MG4 A;  1ZGW A;  4A3J J;  2R7Z J;  4V2G A;  2DTZ A;  2DA3 A;  3GTO J;  1SAN A;  3LSJ A;  1TC3 C;  5GP9 A;  3GTQ J;  4XIC A;  1LE8 B;  4M3G A;  1FTT A;  2NVY J;  2NOG A;  4BY1 J;  3FIS A;  4AC0 A;  1UI5 A;  3ZQF A;  2LP0 A;  3HTI A;  3L1P A;  2IBD A;  3S1R J;  3LSG A;  3AQS A;  1X58 A;  2JA7 J;  5EG0 A;  4AC6 A;  2XPW A;  2Y2Z A;  1FEX A;  4CGR A;  1PUF B;  2E2I J;  1SGM A;  3ZOB A;  1VF9 A;  2GEN A;  4BY7 J;  2YUS A;  4D5F A;  1MSF C;  3HOY J;  2JMW A;  2IEK A;  2XPV A;  3VPR A;  1JKO C;  3ZQH A;  2E1O A;  2HOS A;  3M3Y J;  1DU6 A;  3G1M A;  4C3J J;  3TP3 A;  3LNQ A;  1TWH J;  3CRJ A;  1JUM A;  3C07 A;  5EDN A;  1Z0X A;  1UMQ A;  4MO7 A;  4CYC B;  2EZK A;  4D5C A;  1HDP A;  1T33 A;  2DA5 A;  5EEA A;  2DA2 A;  3A02 A;  2R92 J;  3EUP A;  2O7O A;  3TP0 A;  3F0C A;  2D5V A;  1LE8 A;  2XPU A;  5FJ8 J;  2DMT A;  2ID6 A;  5E3M A;  1JKP C;  2DMU A;  5FGL A;  4GFB A;  2DA6 A;  5C44 J;  3QPS A;  5HAW A;  1MBH A;  3HOX J;  3VVX A;  3HGG A;  3BTI A;  1ZK8 A;  2EH3 A;  1PUF A;  4M3B A;  2OER A;  3VVY A;  3KKD A;  5C4Y A;  1XC5 A;  2NVT J;  4MFD A;  1QRY A;  1G2H A;  3A03 A;  3PO3 J;  3PM1 A;  3LSP A;  5EGO B;  1TWG J;  3NAU A;  3QKX A;  1QVU A;  1W0T A;  3EGQ A;  4FTH A;  2LVS A;  1UHS A;  4FE4 A;  1ETO A;  3HOZ J;  5E3O A;  5J1U A;  3JRA A;  3VW2 A;  4CYC A;  3D1N I;  2UXP A;  4S0H B;  2L9R A;  4DYR A;  2FJ1 A;  1EF4 A;  2OPT A;  5FKK A;  4FE7 A;  3UKG A;  1MBJ A;  4LOC A;  2V57 A;  2DA7 A;  1ITY A;  2YVH A;  3RZD J;  3IV5 A;  4DYC A;  4FIS A;  2P81 A;  1U9O A;  5M3F J;  2CQX A;  2RAS A;  3H3V K;  1MBE A;  1MH4 A;  1T56 A;  2PMZ N;  4BBR J;  1JT6 A;  1ENH A;  1WH7 A;  4JX4 A;  1O4X A;  3S1N J;  5IOY A;  5F04 A;  2Y9Y A;  4JX5 A;  1H88 C;  1UG2 A;  2ZCX A;  3JSJ A;  3Q0W A;  3HKZ N;  2DA1 A;  1A5J A;  1MH3 A;  5GPC A;  1HF0 A;  2LTP A;  2R5Y B;  2LKX A;  2HDD A;  2X48 A;  2DJN A;  4ME9 A;  5EGO A;  2VKV A;  2ZB9 A;  2ZCM A;  1TWA J;  5C4X J;  1AKH B;  5J1Y A;  3G7R A;  5K58 A;  2K9S A;  2DG7 A;  1IV6 A;  1AU7 A;  3ZQL A;  3JRC A;  4QSH A;  3HEF A;  3HE0 A;  2OI8 A;  1JKQ C;  3NXC A;  3BCG A;  3IH2 A;  1Y1W J;  2QIB A;  3RD3 A;  3HIM A;  5M5W J;  2JA5 J;  4A3G J;  1JJ6 C;  1JTY A;  3G56 A;  5CW8 A;  1BL0 A;  2FBQ A;  4A3D J;  4HNV A;  1GT0 C;  1GVD A;  4M3D A;  2QF7 A;  2NVQ J;  3BR3 A;  1P7J A;  3SDG A;  2FX0 A;  2M8G X;  2XDN A;  1K61 A;  3G1O A;  1BA5 A;  5F08 A;  2R5Y A;  3VVZ A;  2DMQ A;  2K9Q A;  2WAQ N;  1U8B A;  2XRL A;  3BG5 A;  3LJL A;  3V6G A;  3BT9 A;  2GLO A;  2M34 A;  2NS8 A;  1AKH A;  2ZCN A;  1Y1V J;  3I4M J;  3B81 A;  3BNI A;  1ETX A;  1IGN A;  2FD5 A;  4QTR A;  1H8A C;  1HCR A;  4X1E A;  1FTZ A;  2GFN A;  1ZKG A;  2COB A;  3ZQI A;  1XS9 A;  3DCF A;  2G7G A;  5H9T A;  3VOK A;  5D18 A;  1ETY A;  2EBI A;  3B6C A;  3JRE A;  3OSG A;  5IYB J;  3BRU A;  1P7I A;  3WHC A;  4DZP A;  1ETV A;  4DZJ A;  4MFE A;  3JRF A;  5BNG A;  2Y31 A;  1JJ8 C;  3GEU A;  3GTK J;  2F07 A;  2JN6 A;  3ZQC A;  1S7E A;  3DEW A;  4MLO A;  5EZG A;  5IP6 A;  4IHX A;  1I3Q J;  1VI0 A;  3PPB A;  2HYT A;  3Q0U A;  4AF5 A;  5EF6 A;  1JKR C;  4GCT A;  3S16 J;  1JUS A;  1LFB A;  2KT0 A;  2IU5 A;  3WHB A;  5E3L A;  2LR8 A;  5J1R A;  5IPA A;  2M9H A;  2ZOY A;  3TW7 A;  2E2H J;  4KWA A;  2MSY A;  2Y30 A;  4XRS A;  1A6I A;  2RHA A;  4IHW A;  2HQ5 A;  4A3C J;  5GPA A;  3HTH A;  3MN2 A;  5DS9 A;  2AHQ A;  3JRD A;  1B8I B;  2K9N A;  4RBO A;  2PZ9 A;  3IH3 A;  4B1R A;  2MGQ A;  2VUM J;  4UDS A;  5FMP A;  1I50 J;  4JNN A;  2VPR A;  5DAJ A;  1APL C;  2D6Y A;  3FK6 A;  4Y52 J;  2QOP A;  1MBK A;  4L62 A;  4M3F A;  2HKU A;  3VIB A;  2XB0 X;  3BR2 A;  5IOZ A;  4AUX A;  4A3M J;  4X6A J;  2LK2 A;  3JRB A;  3IH4 A;  5FKL A;  2VI6 A;  4NEL A;  2YVE A;  4AYB N;  5DTD A;  3DPJ A;  5HSZ A;  3BHQ A;  2LY9 A;  2X6O A;  3LWJ A;  3ZQG A;  3Q0V A;  1IUF A;  3BTL A;  2R0Q C;  3AQT A;  4C3I J;  5FKM A;  3SJM A;  2CUF A;  3ANG A;  1WGX A;  4L5E A;  1CQT A;  2L7M P;  3ON4 A;  1RET A;  3BR1 A;  1VND A;  3G1L A;  2NVX J;  1ZR4 A;  5J3L A;  5M5Y J;  4JKZ A;  3NPI A;  4A3K J;  1H89 C;  2L7Z A;  2OF7 A;  3A01 B;  1B8I A;  5F1J A;  3O8G A;  2G3B A;  1IC8 A;  2XGE A;  2Y0S N;  3E7Q A;  2DA4 A;  2G7L A;  1JTX A;  4W97 A;  3GTM J;  2DMN A;  3S1Q J;  2QWT A;  3KKC A;  5HBU A;  3LSR A;  3NNR A;  3BG3 A;  4UUS B;  4G12 A;  1POG A;  5F0C A;  2JJ7 A;  2R93 J;  5FKN A;  3CJD A;  3P9T A;  3C2B A;  4ACI A;  2H1K A;  1IG7 A;  4I6Z A;  2JK3 A;  3O60 A;  1GUU A;  4BXX J;  4A93 J;  2VKE A;  2EZI A;  4NDL A;  1QVT A;  2LD5 A;  5K7H A;  1RKT A;  4XID A;  4A3F J;  1IDZ A;  2H8R A;  2ECC A;  3RQI A;  1K83 J;  2JWT A;  3M4O J;  5C3E J;  4MIM A;  3FK7 A;  2EZL A;  2MW8 A;  1F36 A;  3HTA A;  2EZH A;  2HXI A;  3RKQ A;  2CQQ A;  3HTJ A;  1RPW A;  3S17 J;  4XRM A;  3BR5 A;  4C2M J;  2R5Z B;  3W6V A;  3A01 A;  2UXH A;  2NP3 A;  1Z77 A;  2XSD C;  3VUQ A;  3Q3S A;  2L0K A;  4A69 C;  3PO2 J;  2YU9 J;  4MXM A;  4UUS A;  1VFC A;  3B6A A;  2ME6 A;  5EYR A;  1X2M A;  2XGC A;  2LFB A;  2ECB A;  2FQ4 A;  3BR6 A;  1IRZ A;  3HBL A;  1LFU P;  3MKL A;  1WI3 A;  3RH2 A;  5FHP A;  1GDT A;  3BR0 A;  1HOM A;  4JL3 A;  2PBX A;  1QPI A;  3HDD A;  1BW5 A;  5IP9 J;  2WB1 N;  3BTJ A;  3JRI A;  1YRN B;  2UXI A;  3S2D J;  2N8G A;  3FRQ A;  1FIP A;  2W53 A;  3CDL A;  5CXI A;  1UI6 A;  2QTQ A;  3T6N A;  2HOT A;  4RDU A;  3S5R A;  4J19 A;  2O9L A;  2UXO A;  1I6H J;  2CRG A;  4NN1 A;  3O8H A;  2R5Z A;  5FLV A;  3ANP A;  3QPL A;  3LOC A;  1R9T J;  2W48 A;  3F1B A;  3HGY A;  2E19 A;  1HDD C;  1OFC X;  3RZO J;  1FJL A;  4W1U A;  4DW6 A;  5JLW A;  2UXU A;  2CJJ A;  5C4J J;  1GV5 A;  4YZE A;  5EFY A;  2ELK A;  2NX4 A;  2Q24 A;  1BJZ A;  4MK6 A;  2K40 A;  5F27 A;  1WH5 A;  2B63 J;  4A3L J;  3S2H J;  5IYD J;  4I76 A;  2HYJ A;  3CWR A;  5M5X J;  1JUP A;  2CU7 A;  4D7N A;  2E2J J;  3KZ9 A;  2NS7 A;  3GTL J;  2HI3 A;  5IYC J;  3JRH A;  2DN0 A;  1TWC J;  2KDZ A;  5E3N A;  1YRN A;  4GCK A;  4ABZ A;  5D1R A;  4IHY A;  2NP5 A;  1MNM C;  1ZR2 A;  2O7T A;  5K7Z A;  4IHV A;  5D19 A;  1OJL A;  4UUT A;  3QQA A;  2HXO A;  4QIW N;  2JA8 J;  3PAS A;  1NTC A;  1ZTR A;  5F0F A;  3GTG J;  3HB9 A;  2ZOZ A;  3V78 A;  3NAR A;  1U9N A;  3COL A;  1XG1 A;  1FIA A;  3S1M J;  3H0G J;  2IAI A;  4ICH A;  3BJB A;  1ETQ A;  4FCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...