3BTCA

Crystal structure of qacr(e57q) bound to malachite green
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btcA02
1RKTA 2LR8A 2MW8A 2GFNA 3ANGA 2LP0A 1OFCX 5EFYA 1ITYA 2N8GA 1MBKA 1E3OC 1B72B 3BT9A 1HCRA 1BW6A 1Y1WJ 2QCOA 2IAIA 4A3FJ 1FEXA 3DEWA 3VVXA 2B63J 5EGOA 2XPVA 2P81A 2RHAA 3IH3A 1EF4A 4UDSA 2Y0SN 1Q1VA 3PASA 2MG4A 4DYCA 2EZIA 4C2MJ 5M5WJ 2ZB9A 1JKRC 1G2HA 3BHQA 4BBSJ 2HOSA 5F0CA 3CRJA 3GEUA 2EQRA 3VPRA 3HE0A 3TW7A 4M3FA 2DA7A 1GVDA 3BR2A 3HOXJ 1VFCA 2Y31A 3FK6A 3HGGA 4IEJA 1O4XA 3G7RA 5HSZA 5FKLA 3GTMJ 3E7QA 4MK6A 4M3GA 2K9QA 5C4YA 3VUQA 3LWJA 5FKMA 2XRLA 4MFEA 2GLOA 1XS9A 3G1LA 3HKZN 1PUFB 1MNMC 1T56A 2R93J 3VW2A 4JX6A 3FISA 3O8HA 4GFBA 5M5XJ 1B8IA 1HDDC 3I4MJ 2NVTJ 2HDDA 5D1RA 1FIAA 4JNNA 3TW6A 1JJ6C 5IP7J 1GDTA 5IOZA 1X2MA 5E3NA 1NTCA 2TCTA 3BQYA 4C3HJ 1GUUA 2XGDA 3LNQA 3HOWJ 3CJDA 1MSEC 5FLVA 4B1RA 3AQTA 1TWAJ 2JJ7A 4IHYA 1RPWA 1IRZA 5J1YA 5FMPA 1QVTA 1Z0XA 5DAJA 2DTZA 4NELA 1WCMJ 2FBQA 3ZQCA 2ID3A 2PZ9A 3P9TA 4D5FA 5AQCA 2R92J 2OERA 3KKCA 4EEFG 5K7ZA 5E3OA 3OSFA 3PM1A 4MO7A 3TP3A 5CXGA 2X6OA 3F1BA 1P7IA 2R5ZA 4NN1A 3A01A 4DYQA 3TP0A 2DN0A 1VNDA 3FIWA 4IHWA 3VOKA 3Q0WA 1RKWA 3BJBA 4BKXA 3C07A 2ZCXA 2ECBA 2R5YB 2REKA 3JRGA 4ABZA 3NAUA 3RQIA 3CQZJ 2UXUA 1F36A 1BW5A 1U9OA 4GFLA 3VP5A 3Q0UA 3JRCA 2DMNA 2YUSA 1LE8B 5CXIA 2D6YA 2ZOYA 2JA6J 2HKUA 2XSDC 2WB1N 2CJJA 4GCLA 1OCTC 5IOYA 2HXIA 3HTHA 3CWRA 3BTJA 2JA7J 1JT6A 3RZOJ 4CYCA 1ZGWA 2UXPA 2M9HA 5CW8A 3VVYA 3H0GJ 1K83J 2QTQA 1MSFC 2WUIA 3NI7A 3EGQA 2Y30A 2G7GA 1WGXA 3Q3SA 1S7EA 3LSPA 2ME0A 2ZOZA 2CQQA 2IU5A 3F0CA 3OOUA 5E3MA 2JA8J 2G0EA 2TRTA 3BG5A 1RR7A 2XGEA 3JREA 3GTGJ 3HTAA 1I3QJ 3BTCA 1JKPC 4X6AJ 5IYCJ 5EGOB 3OSGA 4XRMA 2LLKA 1SFOJ 2QF7A 1MH4A 5FHPA 2HOTA 1JKOC 3KKDA 1JUMA 2F07A 1W0UA 3S1QJ 4RDUA 2M0CA 1ETWA 4RBOA 5K7FA 3G1MA 5IYDJ 2Y2ZA 4D5CA 4MXMA 2R7ZJ 4UUTA 2HI3A 3JRHA 3QPSA 3JRFA 3S15J 2QKOA 3GBGA 3HGYA 4FISA 3S2HJ 2GUHA 3D1NI 2HXOA 3E7LA 1BJZA 1RETA 5EF6A 5F08A 3HTJA 1VI0A 3MKLA 1AKHA 1HOMA 2DG7A 2HYTA 1AU7A 1IUFA 1P7JA 4DYRA 1ZR2A 1I6HJ 1B8IB 3H3VK 1FTZA 2EBIA 4X1EA 2R0QC 3PO3J 3HOVJ 3V6GA 3S2DJ 5F0FA 4A3JJ 2VI6A 2E2HJ 3BTLA 3AQSA 3SDGA 5C4JJ 2Y9YA 4HKUA 3G56A 2KT0A 2DA3A 3GTQJ 4M3BA 3DCFA 2G3BA 1IV6A 3IH4A 4A3KJ 2ZCMA 2RASA 3G1OA 3ON2A 4XICA 3FK7A 2LTPA 3VVZA 4JX5A 2HOAA 2CUFA 3SJMA 3S1MJ 4D7MA 3V78A 1FJLA 2NOGA 4JKZA 2E2JJ 3HEFA 2DMPA 1Y1VJ 3GZIA 2CRGA 3W6VA 2R5ZB 3IV5A 3SFIA 3OIOA 2L0KA 3A01B 1U8BA 1MBFA 1UI6A 2NS7A 4D7NA 1MBGA 2VUMJ 3GTLJ 2MSYA 3HOUJ 4A3IJ 3ZQFA 3IH2A 4A3EJ 5FKOA 5FKNA 2JMWA 4V2FA 2DMTA 5DTDA 1T33A 3HM5A 5IP6A 2XB0X 5F0HA 2PBXA 5IPAA 4FE7A 3TEDA 1H8AC 4AC0A 1BL0A 1YRNA 5D18A 5JLWA 4A3LJ 4CYCB 3RZDJ 2CU7A 3CDLA 1JUPA 5K7HA 1UG2A 2O9LA 2IEKA 4DZJA 1TWGJ 4CGRA 3NRGA 1ZK8A 2YS9A 2CQXA 4S0HB 1SANA 4PXIA 4GFKA 3JRIA 4DZPA 2LFBA 4A3DJ 1IJWC 5F27A 4C3JJ 1HF0A 1ETYA 2WGBA 2COBA 2GBYA 2DJNA 2H1KA 4A3BJ 2YVHA 4Y52J 1QVUA 2YVEA 3ZQLA 5IYBJ 2PMZN 2NS8A 2DG8A 2L7MP 3S14J 1X2NA 3GTOJ 4W1UA 3HIMA 4A3GJ 1QRYA 5FLMJ 4UUSA 1SGMA 2XPUA 4JL3A 3ANPA 3JSJA 2DMQA 4A93J 2K40A 2O7TA 1WPKA 2GENA 4AYBN 3MN2A 1ZKGA 2CUEA 3FRQA 3LSJA 4QSHA 3A02A 3HDDA 1JJ8C 1BA5A 5EG0A 3S1NJ 1X58A 3O8GA 4Y7NJ 1JKQC 2LVSA 4FE4A 4BXXJ 3VW0A 2NP5A 2EZKA 5K58A 3HB9A 2OPTA 2UXIA 2OF7A 4JP0A 2IBDA 1ETKA 1AKHB 3COLA 4W97A 3LHQA 2M2EA 2LKXA 2E19A 4C3IJ 1U78A 2NX4A 2XPWA 4XRSG 3K2AA 3WHCA 1GV2A 2ELKA 1HLVA 4BY1J 3RD3A 2O8KA 3I4NJ 2E2IJ 3NXCA 5C3EJ 4XRSA 1F43A 2KDZA 1LFBA 2DA4A 3JR9A 1ETQA 3BRUA 2MGQA 2JN6A 4A69C 4BY7J 4L5EA 2DA5A 2EZHA 3GTKJ 4IHVA 2VPRA 1ZQ3P 4A3CJ 1TWCJ 1A5JA 1I50J 1APLC 1Z77A 2ME6A 4QIWN 1JTYA 2X9DA 3LOCA 3WHBA 4J19A 2UXHA 3QPLA 5HAWA 1TWHJ 1GT0C 3CMYA 2NVYJ 3C2BA 1ZTRA 2JWTA 2K9NA 3FKIJ 4I6ZA 4A3MJ 2L7ZA 4AC6A 2VKEA 2FX0A 1IDZA 2L9RA 3B6AA 3EUPA 3NNRA 4NDLA 2G7SA 2G7LA 3T6NA 1OCPA 4IHXA 1ETXA 9ANTA 2XGCA 3O60A 3BR1A 4V2GA 1H88C 3BG3A 3BR5A 1NK3P 2YU9J 5C4XJ 2QIBA 4M3EA 2E1OA 4MFDA 3L1PA 1B72A 4ME9A 4GCTA 1W0TA 1IGNA 5DS9A 1XG1A 4DW6A 3UKGA 1UMQA 3NARA 3S16J 1YRNB 4XIDA 2NVQJ 3KNWA 5C44J 4GCKA 2DMUA 3GTJJ 1FIPA 3LSRA 1HDPA 5J3LA 3RH2A 3QQAA 1DU0A 2LY9A 1VF9A 3B6CA 4AF5A 3BR3A 3VW1A 5EZHA 1POGA 5M5YJ 3K7AJ 2XDNA 1RESA 5HODA 1U9NA 5M3FJ 4LOCA 2L7FP 5FGLA 5HBUA 1R9TJ 3NPIA 3M4OJ 2M34A 2ID6A 3HTIA 2WV1A 4JYKA 3ZOBA 4MLOA 3BCGA 5JLXA 5J1UA 1WH5A 2O7OA 2JK3A 4L62A 1IC8A 2QOPA 2FD5A 1LFUP 4B3AA 2M8GX 1MBJA 2ECCA 1IG7A 3JRDA 1PUFA 3S5RA 2K9SA 5F04A 5EEAA 3MNLA 1QPIA 3PO2J 4ICHA 3CCYA 4UUSB 1NK2P 1AHDP 3JRAA 2EZLA 3ON4A 2OI8A 1JTXA 1WH7A 2JA5J 5GP9A 2FQ4A 5FKKA 2H8RA 1ENHA 1ETOA 1GV5A 3GTPJ 3LSGA 5EG0B 3BG9A 3Q0VA 5BNGA 2Q24A 2RAEA 2LD5A 2AHQA 2AO9A 1MBHA 1TC3C 1CQTA 1DU6A 2WAQN 3HBLA 3A03A 3ZQGA 1MH3A 3PPBA 2D5VA 3BTIA 1A6IA 3BR6A 4G12A 5EYRA 4FTHA 2HYJA 3ZQIA 3JRBA 2FJ1A 2DA1A 2NVXJ 4QTRA 2QWTA 2HQ5A 5F1JA 2I10A 2DA6A 2W48A 2W53A 4AUXA 5J1RA 3KZ9A 2Y9ZA 4FCYA 4XK4A 3B81A 1H89C 2UXOA 5E3LA 1ZR4A 4YZEA 2DA2A 5FJ8J 3M3YJ 1K61A 3VIBA 1TWFJ 2R5YA 4M3DA 2ZCNA 1WI3A 5M3MJ 2NP3A 1JT0A 1FTTA 4MIMA 3BNIA 3HOZJ 3DPJA 2X48A 1IDYA 4M6VA 1ORKA 3LJLA 3S17J 4KWAA 1LE8A 5EZGA 3BQZA 2GM4A 1ETVA 5H9TA 3HOYJ 2VKVA 1UHSA 3VOXA 1JUSA 3QKXA 1JGGA 5GPCA 4I76A 1D5YA 3RKQA 4ACIA 1MBEA 1OJLA 2LK2A 4JX4A 1UI5A 5GPAA 3IUVA 5EDNA 3ZQHA 3S1RJ 4BBRJ 5D19A 2XB5A 2EH3A 3BR0A 3MVPA 5IP9J 3QBMA 4B4CA 2V57A 1XC5A 4HNVA
chains in the Genus database with same CATH superfamily
2HPMA 3TOBA 3NRVA 5JVTA 2GXGA 2MW8A 5D8LB 2COMA 4BU2A 2IS6A 3I59B 3HJEA 2IP2A 1XMXA 2N8GA 1E3OC 1G8XA 1QHGA 1Y1WJ 3OOPA 3IKVA 4EMSA 4A3FJ 3HYIA 2MC4A 3IL2A 4HBLA 2GOMA 5AONA 2XPVA 3OMYA 1SFXA 2WAFA 3F8BA 3EPZA 3IH3A 4LGWA 2X4HA 5CVJA 4XM3A 2CV0A 1EF4A 2DQRA 5CVVA 2L9NA 2MG4A 4YRVA 1DP7P 3ERMA 4I0AA 4CSWA 4BBSJ 3MZHA 2HOSA 2LY1A 1XSXA 4M3FA 2DA7A 2VJJA 3C2HA 4IKFA 3BR2A 4E7ZA 2RN7A 4IOAF 4BUPA 4XKWA 2RC4A 2VASA 1FY7A 1M1EB 3FMRA 4I09A 1SMYF 1SVLA 2K9QA 5ILUA 2CQ7A 1GXPA 4KDPA 2GLOA 3HKZN 1Z6RA 2KZGA 4AIKA 2L4AA 4L0YB 1D5VA 3CMAI 4GFBA 1HQCA 1HDDC 3I4MJ 2EPFA 3K4CA 1R23A 2NVTJ 3NS4A 4BNCA 2F48A 2HDDA 5D1RA 1FOYA 1XCVA 1GDTA 5LHHA 5E3NA 1Z91A 1NTCA 1OCZH 4C3HJ 1GUUA 1X1BA 2XGDA 1MSEC 1SMTA 2FA5A 2JZYA 4FX4A 1IRZA 3KP7A 5FMPA 5IT9Z 4GXOA 1Z0XA 2CMPA 1X3UA 5DAJA 1G3TA 5F1RA 2B3WA 2PZ9A 4LG0A 4CICA 2STTA 4WWCA 2VJIA 2L02A 5HLTA 3P9TA 4D5FA 4U7DA 2K02A 3GZ6A 2ESHA 4WIBA 5LFAA 1BIAA 3OIPA 2DCEA 1ZRFA 2F4IA 5D5XB 1BN5A 5FB2A 1RIOH 1U6GA 1J9IA 1P7IA 4Y4RA 3JTHA 2FU4A 3SZPA 3A01A 4HNUA 1PUEE 5FGMA 3TP0A 3CUQA 1VNDA 2IS4A 2LYCA 1I1SA 1JXSA 1RKWA 3OS2A 3OS1A 4NQWB 4H0EA 3ML6A 3JSOA 4ABZA 2HKOA 4XR6A 3FXUA 2A5WA 3WE3A 1BW5A 1QQIA 4GFLA 1K78B 3Q0UA 5L3DA 2KRHA 2DMNA 1LE8B 3H3UA 2R7OA 2KL4A 2PN6A 4TV7A 2XSDC 2CJJA 1BI1A 1OCTC 3QWLA 4P96A 5DUKA 2QKLB 1ZGWA 3CC4I 2KFDA 4Y17A 3VVYA 1R22A 3H0GJ 2QVOA 4Y15A 3NI7A 4B44A 4G7OF 2NVUB 4LMYA 2G7GA 3ONQA 2FJI1 2F6CA 2Z9OA 5E79C 2A07F 2OZ6A 3OYFA 2IU5A 3IC7A 5E3MA 3CJQB 3HTAA 2XGEA 3BTCA 5IYCJ 1SFOJ 1D1BA 1MH4A 2R7RA 2LOOA 1JUMA 2F07A 3S1QJ 3O3KA 1XB4A 2P6SA 4U0WA 2ZNZA 1UFMA 4RBOA 2CO5A 2E36A 2EFPA 3G1MA 5IYDJ 5DM6F 4OINF 1VQOI 4UUTA 2E34A 2HI3A 1FYMA 3LWFA 4GO1A 3JRFA 3LSTA 2ISYA 4P9FA 1K79A 5TISC 3GLLA 3ZMSA 2QKOA 2R4GA 1USTA 1PVEA 1V55H 1OPCA 2FNPA 1ZRDA 1RETA 3W2VA 5EF6A 2HR3A 5B1AH 4D9JA 1VI0A 1W1WE 1KU9A 3UNGC 3RQ4A 3CF5F 3H9GA 2DG7A 2B7EA 1WZ2A 4DYRA 2E7XA 3H3VK 2FSWA 4X1EA 3MAJA 3LA2A 3H5AA 3S2DJ 1VQKI 5F0FA 4A3JJ 1D1CA 2DDAA 2VI6A 1FYLA 2NXNB 4RAGA 2ZXIA 5JFRA 1T08B 3T0YA 4CDGA 3JW4A 1UZCA 4EJUA 3GTQJ 3KZZA 3P9CA 4HF2A 3DCFA 2KJBA 3IH4A 2EIJH 3VOEA 3ZR8X 2RASA 3G1OA 3ON2A 4KNYA 3FK7A 4XLFA 4LG0B 2P5KA 1V5EA 4ZYHA 2R7XA 5J4VA 2BHYA 4ZYAA 3PUFA 2DYRH 4D7MA 1PP7U 1QNTA 2BY2A 3VSLA 1GVJA 3HEFA 4YIIA 5FD5A 1I1GA 1DUXC 1EH6A 4XLHA 3W6VA 3OYGA 3A01B 3E6MA 1Z67A 2L0KA 2E5ZA 2LREA 3SZGA 3O6BB 2B1EA 3CUQB 5FFZA 4D7NA 1A35A 1KU2A 1KQ0A 2B0LA 2MSYA 3VEPA 3GTLJ 4GYGA 2PEXA 1IUYA 4BGDA 5FKOA 3W6KB 2JPCA 2F4MB 2WY8Q 5CKTA 3HOTA 5IP6A 1X3WB 5DTDA 3HM5A 3QU6A 2LKSA 3K1MA 4M73A 2ETHA 4FE7A 4BEHA 3TEDA 4AVZA 1V5FA 1BL0A 2DK5A 5D18A 2DW4A 4N4OB 4CCJA 4C2MA 4U7BA 1V3FA 4A3LJ 4A0ZA 2A3SA 5EEHA 5F64A 5ED4A 2HU9A 3D5SC 4RB1A 4JOMA 2RGVA 4S05A 1G3SA 1R00A 2KISA 2E35A 3AL0C 3CCJI 4CGRA 1SFEA 2EWNA 2CQXA 5TGTA 2DYSH 3ZMUA 4PGGA 2MBFA 3HPGA 4PXIA 1TLHB 4X0GA 3L7WA 3A0HC 2QENA 4UUVA 2VOPA 3HSEA 3WTXC 1ETYA 4KJZA 2GQQA 2E1NA 3EDPA 2VC1A 1TW3A 3ZRGA 3JSPA 3GVAA 3S14J 1MNEA 2VJ4A 1WJFA 1MZBA 4N4NB 2CWEA 1ZHFA 3WTSC 1XX5A 2R7QA 4JL3A 2DMQA 2P0WA 3M8FA 3HRSA 3DWLE 1OKRA 1IRFA 4A12A 3MN2A 1ZKGA 4ITVA 4RAFA 3VYTB 3FRQA 3LMMA 1YO5C 3R0JA 2XRNA 5EG0A 1XGSA 1BJAA 4G7ZF 3SXYA 3OYIA 4Y7NJ 2W00A 4BXXJ 3VW0A 4HV5A 2NP5A 4KT5C 1TT5B 3BG7A 5K58A 5DDGA 3DKYA 5JHFA 2UXIA 2OF7A 2YU3A 3H9QA 2ZSIB 2BGCA 2MD5A 3WTWC 1JGSA 2FE3A 2ZXWH 2LKXA 2QKMB 4B09A 1U78A 2XPWA 2A68F 3PUBA 3GYHX 3K70D 2R7TA 2RQQA 2ZJQF 1X1PA 5C3EJ 2HTSA 1XDSA 2GXAA 3GMEA 1XTAA 2HWVA 4KICA 1D3YA 2F2EA 3DBLB 4BYYA 1RZ4A 4O3MA 4L5EA 3GTKJ 5LEJA 1TWCJ 3QOEA 2LBFA 2GA2A 1Z77A 2ME6A 1WQ2A 3OWTA 1R1VA 3OYCA 1TWHJ 2DBBA 4HNTA 1GT0C 3FKIJ 1L0OC 2VKEA 2MH9A 1SAUA 4FASD 3B6AA 3F22A 1A04A 2G7LA 4CGZA 1V5GA 2H09A 3BJ6A 5LEKA 9ANTA 2XGCA 3K0LA 2HOEA 1H88C 2X51A 2YU9J 3AAFA 5C4XJ 1GLNA 1FBSA 2LY2A 3MZ8A 1B72A 4ME9A 3W2AA 1FBQA 1YS6A 2JUGA 3UKGA 3H5NA 1WJ5A 4BEHB 4PCQA 4CH7A 3S16J 1YJWI 4XIDA 1XGNA 3BPVA 4A2UA 1ZYRF 3OV8A 1QBJA 5C44J 3RCOA 1YI2I 4UV8A 2MYSA 3CMEI 3EUAA 4KT6A 2CGPA 2D1HA 2BE5F 3FF5A 3NWSA 4RA2A 3LNQA 3QQAA 5HLHA 1DU0A 2QSFX 3BR3A 4EM2A 1MD0A 1TT0A 4ZJZA 1L3LA 5M5YJ 3U9GA 3QRFF 3K7AJ 1HSJA 5M3FJ 1YIOA 5FD6A 2V6CA 5K5RA 2BY3A 3HTIA 2QLZA 2WV1A 4JYKA 3ZCOA 4MLOA 2VQHA 4BXFA 4XLPF 3BCGA 5JLXA 3L00A 2DLLA 2EV6A 1UHMA 2VBXA 4L62A 3I56I 3WTYC 4RLQA 2K9SA 2UZKA 3P5JA 1LVKA 2XVCA 3H92A 3H0DA 3JRAA 2QQ9A 1B6AA 3F8CA 1WH7A 2JA5J 3G4SI 3TL4X 4BE0A 4HF0A 2V79A 2W85A 2HNHA 1LFPA 5EG0B 5L3CA 5LGNA 1YJNI 3Q0VA 1CGPA 3K9TA 4PJNA 4XLNF 2Q24A 2OU2A 1D8KA 1U3EM 1IO2A 1MBHA 1TC3C 2K5CA 1YW9A 2QWWA 3ZQGA 4RB3C 1MH3A 4PGHA 4B3XA 2ZY9A 3V7SA 1IN4A 2BZTA 4G12A 4M9SA 5EYRA 3QODA 2FJ1A 4QTRA 5DEQA 2HYFA 3KZ9A 2DA6A 2Q1ZB 3CUOA 5KCMA 1S3JA 4FCYA 1WRJA 1H89C 2UXOA 4IRVA 2HZDA 3DTKA 5E3LA 2D1VA 2FBHA 3RKYA 2UWMA 4EGZA 3M3YJ 3LFKA 4BS9A 5CVIA 1EH7A 3OYKA 4LLGF 1TWFJ 2R5YA 4M3DA 1UAAA 2ZCNA 2I5UA 2NP3A 2LBFB 2WWYA 4ZDLA 1R71A 3BNIA 3HOZJ 4OAZA 1T0FA 4S04A 3FXMA 5EEGA 3LJLA 5KVRA 3M8JA 4KWAA 2GM4A 1IN8A 2AXLA 4ZTJA 3FX3A 1T95A 4I76A 4NB5A 3GO5A 4ACIA 1MBEA 2LK2A 1DQUA 3HSFA 1HC8A 2XKOA 3IUVA 2FBKA 1KGSA 1HW5A 2XB5A 3MVPA 4HLYA 1XC5A 4IRHA 3W6JB 4CYDA 3S32A 2LR8A 2V9KA 1X19A 4RGSA 4L18B 5HS9A 6PAXA 3RTRA 2FXAA 1MBKA 1B72B 3H5RA 2A6EF 3IP4B 3N4MA 2M0MA 3CDIA 2B63J 2DFHA 5EGOA 1LPQA 2P81A 3EUHA 4LITA 2Q8KA 2RHAA 2MABA 1LDJA 1IXRC 1MKMA 3HSRA 5FROA 4DYCA 4C2MJ 5M5WJ 4XL9A 4ESBA 5B3SH 3DPTA 2ZB9A 1OYIA 2DDBA 4RLFA 2QA4I 3RSNA 1ZG5A 2BYVE 2CQKA 2Y69H 3CRJA 3GEUA 2PG4A 5J6XA 1TNSA 4XQFA 4HX8A 3HE0A 1HKTA 4LK0F 5TJJA 1GVDA 1EJ9A 1BI0A 1K6OA 4L9TA 1VFCA 2A2FX 2Y31A 4XBFA 4M6YA 3LL7A 2PJPA 2O5RA 4HAMA 3HGGA 3G7RA 4LJZF 2RNJA 2VL8A 3L2RA 5C4YA 1BR1A 3LWJA 3GZ5A 4MFEA 2NNYA 3G1LA 2GIVA 3VYRB 1MNMC 1LQ1A 4G6TB 4RM2A 3FISA 5E8GA 2VQLA 2XF7A 3O8HA 1EH8A 5M5XJ 4YFNF 3PL8A 3T1BA 4EJTA 3L2VA 2DT5A 1YW7A 5IOZA 2J5PA 4XKBA 1YOVB 3SDBA 3HOWJ 4YIFA 3V8KA 2OBPA 2OV7A 4IHYA 3KPHA 4M72A 2BV6A 2M7AA 2RVCA 1YLFA 2IVMA 1LJ9A 1O57A 2ID3A 2ESNA 4NC6A 3S3OA 3T5XA 2BOLA 4MEXF 2OERA 2AXTC 3KKCA 2KQRA 2QYOA 5K7ZA 3OSFA 4MO7A 2O0YA 3TP3A 2ZCWA 2X6OA 2WB1A 1ACIA 4U88A 2VT2A 4NHJA 3J80Z 1MMSA 4NN1A 3CMMA 1HW2A 5A2QZ 4HDVA 2K4JA 2CQNA 1JE8A 3VOKA 3Q0WA 4PSXA 3BJBA 2W4SA 2R5YB 3KEOA 2ICWG 5EJCA 3ZXSA 4C9YA 1Z05A 2UXUA 4N9HA 3TMOA 1QPMA 2XAQA 3WGHA 3KEYA 3JRCA 4F92B 1BC7C 2D6YA 3FBIB 1UELB 4GCLA 4KN7X 2AQFA 3HOSA 3CWRA 1UHWA 3MKWB 2JA7J 3RZOJ 1FSHA 1HW1A 2K27A 2EFNA 2KJCA 3RI4A 2QTQA 4ZDPA 1ZLJA 4WXCA 4AU7A 1RRJA 1G4DA 3EGQA 3MD2A 1OCRH 1P6RA 1SD5A 2FOKA 4B8XA 4I01A 3Q3SA 3A4CA 1F4KA 2QGUA 1UCRA 3D5LA 4DJAA 3IRRA 1LUJB 2P7VB 3F0CA 4AVPA 2JA8J 2E71A 1MMAA 2O3FA 5ILVA 3CLOA 1JKPC 3E6BA 3KP6A 5EGOB 2LG4A 3R60A 2QQBA 3KKDA 2VQCA 3NEUA 1W0UA 4RDUA 3KP4A 2R7SA 3QYBA 3WGIA 1ETWA 5CJ9A 2HPIA 3CJTB 4MXMA 3K1NA 3ABLH 2F5EA 3JRHA 4LIUA 4HQMA 2EV0A 3DTEA 3IUOA 3PFYA 3GBGA 3HGYA 2BVLA 4FISA 3S2HJ 2LF8A 2HXOA 2MC3A 4Z2YA 2E5NA 2IA2A 2Y48A 4QPOA 4R8HA 1VQ4I 1E3PA 2RREA 1RUNA 2DK8A 2ZBKA 1ZN2A 3FWEA 3HTJA 3PIOF 4Q48A 1XMKA 4ZYDA 1U5TA 3J81Z 2CUJA 4GRIA 2VLAA 1N75A 2R0QC 2FMYA 3HOVJ 3MKYB 2P7CB 3V6GA 3BPXA 3I5UA 4HG2A 2PI0A 3V7CA 2RKHA 3BTLA 2ZC2A 2AQEA 4HKUA 3WU0A 1LEBA 3G56A 3D0SA 4XN3A 2FNAA 3FM3A 4FETA 1BOAA 2GAUA 5GAGJ 5GADJ 5H6QA 5CQEA 4GYIA 1RI7A 1XDUA 4ENKA 2CUFA 1I6XA 2BY0A 4IQJA 3SYTA 4AM3A 1TQPA 1Y1VJ 3R4KA 5LGTA 4EM0B 3VODA 4HA8A 1KYWA 4ENJA 1YTYA 3DBRB 2R7VA 1U8BA 1MBFA 1W7PB 2NS7A 2XIGA 1MBGA 3LSIA 3Q9SA 2VPLA 3BZKA 3QPHA 3HOUJ 2KRFA 2IXSA 3ZQFA 3IH2A 4A3EJ 2DMTA 4H4KC 3B02A 2XB0X 2F5DA 4XRFA 4OWRB 2WY7Q 2H8WA 4M74A 2MLKA 1H8AC 2XUBA 5D6EA 1YRNA 2PFVA 5JLWA 1DPRA 3JTGA 3RZDJ 4HW0A 2PMZA 1S5LC 2WV0A 3VDXA 3ZQ7A 4IL6C 1J75A 2OCEA 3BZCA 3VB2A 2DOEA 1MDMA 2J5OA 2O9LA 1O3SA 4PJ0C 4DZJA 2MFZA 1ZK8A 4P55A 3EYIA 2HGCA 3F6OA 4EJOA 1WI9A 2LFBA 1WHUA 2OZUA 4MQ9F 3S2WA 1IJWC 4C3JJ 3M7GA 2CW0F 4A5MA 4J01A 2COBA 1REPC 2GBYA 2H1KA 3IRQA 2YVHA 4Y52J 3ZQLA 5IYBJ 2NS8A 2L7MP 3DU5A 2JVGA 2V1XA 5H20A 1IZ1A 4A3GJ 1QRYA 1BC8C 1SGMA 2E1MB 4ZC3A 4CCMA 2HEOA 2K40A 1WPKA 4QPQA 2K3FA 4AYBN 4A0YA 3CZ6A 1PYVA 2EIKH 2KZVA 1FBUA 3M1EA 3LSJA 1QU3A 5KAIC 4U87A 3FBNB 2HYGD 1KQ9A 1JKQC 2LVSA 4FE4A 5TRDA 2LH9A 1YIJI 2M45A 1Z9CA 2ZJ2A 3IKTA 4JP0A 1ETKA 3CUQC 1U5TB 2NNNA 3OYAA 2RV8A 4C3IJ 2NX4A 5F6FA 3K2AA 3WHCA 1GV2A 3IWFA 1RR8C 1HLVA 2QQ8A 3IWZA 3I4NJ 2E2IJ 1SVOA 1F43A 4I99C 1ETQA 4ENNA 3I53A 3OYLA 2EZHA 1LB2A 5HS7A 2DAOA 2Y0MA 1VQMI 1I50J 3TGNA 1APLC 1DDNA 1A5JA 4QIWN 2X9DA 3WHBA 4J19A 2UXHA 1ZRCA 5ICEA 2JSCA 2NVYJ 4ASNA 3C2BA 4F52A 4EGYA 3PQKA 1R7JA 2JWTA 1OR7A 3ABUA 2L7ZA 2QEXI 1YYVA 4MTDA 3CO6C 1I3AA 1I39A 3T8RA 2QM3A 1B59A 2DU9A 2IRFG 1E0EA 2W7NA 1FMVA 3EETA 4HZFA 4F3QA 4NDLA 3L09A 4PK4A 1IAWA 3MFKA 3F21A 1J2XA 4IHXA 1ETXA 2XF5A 4QLCU 3QAHA 2V1DA 4V2GA 3E1SA 4M3EA 3TKYA 3L1PA 3LQQA 4KIGA 5CYVA 1W0TA 1UMQA 3TQNA 2EA2A 3AG4H 3KP2A 2IGNA 5DCFA 4EV0A 3DQVC 1YRNB 2DPUA 4XORA 1FOXA 4MNUA 4A6DA 1DGRM 5B66C 4HDUA 3I4PA 2CW8A 2F4OB 4PJJA 1ONVA 1MDMB 3FMQA 3CCEI 4BE2A 2D2WA 5E18F 3CP8A 1YITI 2VBZA 2BXZA 2R3SA 4OD4A 3F8FA 3ZPLA 3L2WA 3F8MA 2XDNA 4BHBA 1XN7A 2A5YB 1U9NA 2M30A 5LHIA 3I71A 1O3RA 2L7FP 2W82A 3G3ZA 3NPIA 3Q9VA 2IJLA 1WJAA 3ZOBA 2ACJA 2ELJA 4OAYA 2L4MA 4BJTA 2JK3A 5D6FA 4XKVA 1UB9A 2WAQA 1SEUA 3S5RA 2ECCA 4RB2C 3JRDA 1PUFA 2ZXJA 4E7KA 2JA2A 1B4AA 2V7FA 3BLYA 5D5UB 1AHDP 5ILSA 2WBMA 2OI8A 1JTXA 3ROUA 3CCSI 1Z3YA 2XV4S 3DPUA 2BEOA 2H8RA 1EV7A 5LRRA 1E2XA 1ETOA 1YG2A 3DXJF 1GV5A 2LRDA 2GA1A 3ASNH 2X85A 2L01A 3PJRA 5CLSA 1Y8RB 4GCVA 2LD5A 2AO9A 2XAFA 2RQPA 2KP6A 1XCBA 1SFUA 2KIUA 1CQTA 1BR4A 4UB8C 3HBLA 1KU3A 3PPBA 3BTIA 3BR6A 1ZG3A 2HYJA 3FXLA 1FX7A 4CZZA 1D0XA 3L2CA 1FYKA 4U9LA 1G3WA 3M1CA 3RJPA 2W48A 2CYYA 3KP3A 2Y9ZA 4PFPA 4XK4A 5HS8A 4Q4ZF 1ZR4A 1P92A 4DOZA 3F6VA 4JK1X 4II3A 2JQ7A 4C30A 5ERIA 3VIBA 3J7ZI 3SWHA 2DXIA 4IVNA 2STWA 3C1DA 4MIMA 1BIBA 3DPJA 3AFHA 3HC7A 1ORKA 3GEZA 5EZGA 3BQZA 1ZLKA 1ETVA 2ISZA 4FT8A 5J47A 1UHSA 5DUIA 1TBXA 5CQGA 1R36A 1VZ0A 1G59A 1P4AA 1WKMA 3RKQA 4PZJA 1IF1A 3CJRB 1PDNC 4JX4A 4OU0A 5GPAA 1UI5A 4UY8I 1Y56A 4BBRJ 3GCMA 2EH3A 3I55I 2V57A 4HNVA 4ZH4F 3JCUC 1JHHA 2PFBA 5GAHJ 2OTLI 3ANGA 1U0JA 1ITYA 4UHTA 1HCRA 1BW6A 2JVHA 2FEZA 3KIOA 2BW3A 4G8XA 3TDZC 3DEWA 2NYXA 2PMHA 2R7DA 4CCLA 1OISA 3BG6A 3G6EI 3QPTA 4UDSA 2Y0SN 1LEAA 3N97A 3T8TA 1VQ9I 3CESA 1J5YA 3RPUD 2Q2EA 3CTAA 5DYMA 5FO5A 3HKZA 2W57A 4CUGA 2E60A 1ZG1A 1YS7A 4GDFA 3MMYB 3KYCB 2EQRA 2CS3A 2ELHA 3BZ6A 3VPRA 3A0BC 1Y0UA 3TW7A 3VSKA 2M7BA 4B43A 1SVMA 4WX9A 3HOXJ 1H9GA 4DQ2A 1T38A 3W2WA 1EKEA 5DM7F 4IEJA 5HSZA 4EJVA 5FKLA 3GTMJ 3HIFA 4HSRA 4XSXF 3E7QA 4MK6A 4M3GA 5K5OA 5DCMA 3UR3C 1S29A 2XRLA 5FKMA 2WC2A 4EM1A 3W3CA 3K4KA 1PUFB 4EJWA 2BHZA 4IXAA 1T56A 3LQRA 4NC7A 4JX6A 5E1WA 2VKDA 1FT9A 1B8IA 5DV5A 2V26A 1J09A 4BXUA 3K4BA 5IY5H 4BAYA 5IP7J 4BL0B 2FRHA 1X2MA 3LA3A 4BQQA 1K4SA 3MCZA 2IW5A 3BQYA 4HX4A 1QGPA 1SFKA 2WA0A 1WJCA 2HDWA 3I58A 2K7LA 1VQLI 5FLVA 4B1RA 3AQTA 1TWAJ 2JJ7A 3FZVA 1RPWA 2X6XA 4ANJA 2JRTA 2DTZA 2VBWA 4NELA 2ZXHA 2Q0OA 3CF2A 1OCOH 4E70A 3VFZA 5HDNA 3CC7I 3RKXA 4DIQA 1MJAA 5HLIA 5AQCA 1FMWA 2JTVA 2R92J 3KZIC 5E3OA 3PM1A 2IGOA 3E6CC 4PUSA 4CCNA 5ICCA 3E6DA 3DPLC 2R5ZA 4ZYGA 1KA8A 4ZTFA 1R1TA 4DYQA 1SD6A 1R5ID 2DN0A 1SC7A 3KLNA 4KISA 2X1CA 4BKXA 3WGGA 5HNFA 3DLAA 2ECBA 1K6YA 3BWGA 2ZCXA 3C07A 1OMIA 3LAPA 4BQOA 2YSRA 3NAUA 1Z1DA 3RQIA 3CQZJ 5KNLA 2OUMA 1WJDA 2V1NA 1F36A 2GZWA 4L0ZB 1B1BA 2HZTA 2LSOA 3VYSB 4JBAA 1A36A 1N25A 3I54A 2DPDA 5CXIA 1O7LA 4DGWB 3TO9A 2HXIA 3HTHA 1JI8A 2QSGX 1T6SA 4IZZA 4IRIA 4CYCA 2NOJB 3ISPA 2UXPA 2Z16A 1IN7A 2CFXA 4LD5A 4PDKA 5CW8A 3VTIA 4OD5A 2WUIA 4B47A 2Y30A 1WGXA 3H1CA 1S7EA 3LSPA 3JAMK 1OQYA 3K10A 4E7JA 3WU1B 1S8NA 2F5VA 3OOUA 1USSA 3BG5A 2VBYA 3E97A 3JREA 2BW3B 2EFQA 3GTGJ 4RGUA 1ERDA 2K9MA 1YQAA 1H0MA 3DLLF 4XRMA 2LLKA 2QF7A 2KIMA 1TQIA 4YFKF 3OYDA 1A6QA 2JRMA 2LF7A 4ZDOA 2Q2EB 2EIMH 2ZMEA 4M9ZA 1YX5A 2Y2ZA 3TDUC 4ESFA 4RM3A 1STZA 3DKWA 2A6TA 2Z1DA 1MW7A 3B73A 4I7HA 4BACA 3E3VA 4G94A 4UXNA 2IGMA 4M71A 2UV1A 1X1DA 3D1NI 1T39A 3E7LA 4F91B 1K7AA 3R6SA 1FSEA 5DCMB 3BP8A 1T8IA 3FXOA 3CCLI 3U21A 4C2TA 2YX7A 3J7YJ 1AKHA 1HOMA 2HYTA 3F9KA 1AU7A 2M3AA 2JT1A 4MQVA 1UJ8A 5GTIC 5J8CA 2E7WA 1B8IB 3AKZA 3GUDA 4Q47A 2EBIA 1FTZA 1P9QC 1VQ7I 3RPUA 2EJRA 4HRIA 5DD8A 2B9SA 3PSFA 4A5NA 3PSIA 1T0FC 2Y9YA 3FHNA 4JQFA 5J8FA 5L3EA 1Y6IA 1KU7A 3HHGA 2DA3A 4I2OA 4M3BA 2MA3A 4HQEA 3TO6A 3A2KA 2IGKA 3QP6A 2IPQX 2ZJPF 1IV6A 2G3BA 3HXLA 3ZN1A 3RPQA 5BQTA 2L2OA 4LFUA 4AWXB 4FHTA 1WVRA 4XICA 2LTPA 3VVZA 5CPRB 4JX5A 2EA4A 3K70C 3S1MJ 1TW2A 5HDGA 1FJLA 4CCOA 3LA7A 4RGXA 4RS8A 2CRGA 3OIQA 1S6LA 2EFOA 2R5ZB 3IV5A 3SFIA 3OIOA 5FLXK 2WAEA 2VUMJ 4L9NA 2JSPA 2M87A 3K4JA 3KZYA 3EUHC 2HVSA 1QZZA 1E3HA 2JMWA 4EVIA 4V2FA 2V4JC 1OCCH 5F0HA 3V8LA 4II2A 4Y33A 1VQ6I 1KONA 4IPAA 1IN6A 1IRXA 1ZELA 3F8NA 1IN5A 1LNWA 2OA4A 2P6TA 4KIBA 4R1HA 5K5QA 3K4MA 5J4YA 4MHGA 3GZNB 3I9V2 1R4NB 4CYCB 1BI3A 2VXDA 3SQNA 1J7KA 1YFHA 5JVGF 1LVAA 3CDLA 4YFXF 1JUPA 2PLYA 1UG2A 4BQAA 4EQQA 1MMGA 1FOKA 3NRGA 2YS9A 2LC2A 3WG7H 1SANA 3R61A 2DT7B 3C7JA 4HX7A 4GFKA 2EK5A 4DZPA 4ZZDA 3OYNA 5E8IA 5F27A 1HF0A 3HTSB 1TL8A 5CVRA 3HPHA 3ULQB 1QVUA 2YVEA 1P4WA 2DG8A 3H3ZA 2M5WA 1HXDA 1X2NA 2XAUA 1N77A 4Y3OA 2ZMEB 4F93B 3HIMA 2H6CA 5FLMJ 4IHSA 2VN2A 1U2WA 3ANPA 3OYJA 1D8JA 2O7TA 2GENA 2OJED 3WE2A 1ZGAA 3E5UA 3IAS2 4F55A 3P9IA 4QSHA 4LB6B 1FOWA 1BA5A 4BDYA 2VB6A 3CCVI 3S1NJ 1BM9A 1MGTA 3C18A 3DV8A 5DD4A 2FMLA 3BCAA 1ZREA 3PIPF 2EZKA 1I27A 3ESWB 3KLOA 2FQ3A 5CVUA 2IBDA 1AKHB 3COLA 1IXSB 2RNGA 3SEZA 4Y13A 4W97A 3K8PC 3HG9A 1DGWY 3LHQA 3WU2C 2E19A 2CUZA 1D1AA 5KK1A 4XRSG 5LGUA 3G71I 3F3XA 3BJOA 3U2RA 3RD3A 4BY1J 2O8KA 3NXCA 2DQLA 2EFWA 4XRSA 1RC9A 3ELKA 5L3FA 3SEQA 1Z7LA 1LFBA 3JR9A 5L3GA 3BRUA 3M07A 2VIXA 2MGQA 4CA0A 2JN6A 3H35A 4A3CJ 1ZQ3P 2QSHX 2VE8A 4HF1A 5FFXA 2P8TA 1JTYA 3J81K 4ZYEA 3CMYA 2I8DA 5K1YA 2K9NA 4L5JA 2DO7A 2XAHA 2H94A 4A3MJ 4AC6A 3K69A 2O61A 1F9NA 2Y75A 1KZHA 3MWMA 1XSDA 3GX4X 2G7SA 3ZN0A 3T6NA 1IXCA 3KE2A 1Y8QB 4MEYF 3FXJA 2A05A 2HQRA 1VTNC 3O60A 2DFIA 3BR1A 3REOA 1NK3P 2QIBA 2XDVA 1Q1HA 1VQ8I 4XOTA 5JI6A 1XG1A 4XONA 3FXKA 3K6GA 2QBYA 2E1MC 4IHTA 2QUFA 1XGMA 2NVQJ 3KNWA 1FLIA 2DMUA 1WJBA 3DBHB 4WF2A 3ECOA 4UVAA 2RDPA 2WADA 3AG3H 3ZMDA 5J3LA 3E0JB 3LFUA 5IT9K 4NUBA 4KN4X 2LNBA 3LSKA 2IA1A 4BE1A 2W24A 3B6CA 1F1ZA 2VQGA 2ZFUA 3GW2A 5D5WB 3VW1A 5EZHA 1POGA 1S9HA 2XGXA 1DPUA 1RESA 5HODA 4I98B 4LOCA 5HBUA 5FGLA 1U5TC 1R9TJ 1J59A 3M4OJ 3GFJA 2L5QA 3CCQI 4BDZA 2IS2A 5J1UA 3OL3A 2P5VA 1WH5A 2O7OA 2V9PA 2X6YA 4WXDA 2R7WA 2ZSHB 4AD9A 4B3AA 4ETSA 1MBJA 3FM5A 1IG7A 4HEA2 4WXHA 5EEAA 3MNLA 2K3PA 3DP7A 1QPIA 3PO2J 1XGOA 5H2FC 3CCYA 3TO7A 5ICGA 1NK2P 4O6JA 2EZLA 5GP9A 2FQ4A 2W84A 5FKKA 3I0TA 2PMUA 3E5XA 2CW7A 4F7ZA 3LSGA 3J7AY 4DBQA 3FXRA 3BG9A 5BNGA 4CXFA 1BI2A 2L9VA 2AHQA 1MJ9A 5D4RA 2MLGA 2ZNYA 3DEEA 4K2EA 1B9MA 3A03A 2IT0A 2G9WA 2KKOA 1T98A 2X6WA 1YJ9I 4P9UA 2HVRA 2R7FA 4FTHA 2Z99A 3X2QH 4D1QA 3I3LA 3JRBA 1DP3A 2DA1A 2NVXJ 2HQ5A 5F1JA 3U1DA 4HSTA 2I10A 4MGRA 5J1RA 1X4PA 2A69F 2EINH 4BHCA 3HUGA 3B81A 4A0XA 4KMFA 2GXBA 4YZEA 1LKXA 2ZJRF 2FF4A 3L9FA 1K61A 1D0YA 4IOCF 2OCCH 5M3MJ 5AIQA 4UVCA 1FTTA 4ENMA 1X1AA 3RYRA 3K4NA 4M6VA 1IDYA 2W1OA 3CDHA 4G6DA 3S17J 4IX7A 4MTEA 5H9TA 3HOYJ 4QWQA 3P7NA 4M6XA 1HA8A 1V4RA 3GWZA 1EA3A 1R49A 1IV8A 1XPXA 1D5YA 1XD7A 4KFCA 1OJLA 2JUCA 2VXZA 3ZGKA 1W36C 4XLAA 5EDNA 3S1RJ 1ON2A 3QBMA 1NH3A 1O4XA 4RAYA 1VQPI 1RKTA 2L3DA 1MIJA 2GFNA 3C3WA 4E7IA 4NNJA 3OYHA 2H27A 4UNOA 2LP0A 1OFCX 3SHFA 5EFYA 1NHAA 1V54H 3BT9A 2QCOA 2IAIA 1FEXA 2XKPA 2R7UA 3V8JA 3VVXA 2MD0A 2QBYB 1PJRA 1N78A 3LSMA 1D0ZA 4BQNA 3BC8A 1Q1VA 4I02A 5KAFC 2PJRA 4LIVA 3PASA 2EZIA 2M1BA 2DT6A 1Z3XA 4P5OA 4CCKA 1JKRC 4OMZA 1G2HA 3BHQA 1QZYA 2M4KA 3DFGA 5F0CA 3HTUA 5LHGA 2CH0A 3FHZA 1KYZA 1QHHD 2L7KA 3V42A 5GTHC 2VKHA 1AA7A 2KDOA 3FK6A 3P9KA 1W4MA 1WSUA 3KCCA 2X0LA 2CSOA 3V7RA 4BJ5C 1RUOA 1J0RA 4U0YA 3KEQA 3VUQA 1R5GA 3OR2C 4HPQA 4L9VA 1CF7A 1XS9A 2R93J 3VW2A 3K1PA 4AIJA 1LDKB 4EATA 3GFLA 2KIQA 4HV6A 4CHUA 3ZMVA 5HVQC 4BH9A 3MEXA 1HKQA 1TP4A 5LLQA 1P4XA 2K9LA 5HDKA 3S3MA 4YG2F 1FIAA 1O3TA 2Z5UA 4JNNA 3TW6A 1JJ6C 1Y39A 2ZO4A 4WCGA 1W5TA 2IS1A 2TCTA 4G9YA 3CJDA 4E4HA 4OIQF 2MH2A 3N05A 4E7HA 4E7SA 5J1YA 1OR7C 1QVTA 1LDDA 1X4OA 1WCMJ 2FBQA 3ZQCA 4IF4A 5FRNA 3ZP5A 4G7HF 1ZH5A 1R4MB 4EEFG 4V19K 2OQGA 4J00A 3KP5A 5CXGA 4IJAA 1ODDA 2DJIA 3HRMA 3F1BA 2KMUA 2PQ8A 3HUGB 1E17A 4PFOA 3FIWA 4LG3A 4IHWA 1AWCA 1FZPB 2XASA 4I0BA 1F5TA 2FOWA 4RMNA 4XOPA 4L5IA 3JRGA 2REKA 4Z6YA 2HS5A 1OYYA 2OC6A 3SZTA 3GFMA 4U9NA 2LDUA 3OYMA 2V6EA 1HSTA 4XSZF 1U9OA 3VP5A 1WWXA 3CJNA 4LK1F 2YUSA 3BY6A 4E6KG 4KYWA 2ZOYA 2JA6J 4DVYP 2HKUA 2WB1N 5IOYA 2F5CA 3BTJA 1JT6A 1TTYA 4OOIA 2EB7A 2M9HA 3RIRA 2YVXA 1K83J 1MSFC 2XHKA 2HTJA 2KPMA 3IHUA 5BMZA 5FRMA 2DTRA 4KITB 2VONA 3MKZA 3CCRI 2FUG2 1ZAOA 3ECHA 3FDYA 2OAZA 2ZOZA 2ME0A 5LBQA 2CQQA 1OYWA 3WTUC 2G0EA 2TRTA 5HNHA 1RR7A 1A31A 4OIPF 1I3QJ 1TZLA 1XSVA 4UB6C 4O5VA 4G6QA 4X6AJ 3OSGA 2OTJI 1HKSA 5FHPA 4DNCA 2HOTA 1JKOC 3KFWX 1O7FA 3PNTA 4ZZLA 5BPIA 2D45A 3EQLF 1K4TA 2PJRB 4OIOF 2M0CA 1U8RA 2Z2SB 3V4GA 2CG4A 3K4LA 3WG9A 1QO0D 3DTIA 2XAJA 3DF8A 1S7OA 4D5CA 5K7FA 2R7ZJ 4N9IA 3QYEA 3U1KA 3QPSA 1KQ8A 2A6HF 5D8KB 3S15J 1Z7UA 1B9NA 3AL0B 4KMUX 2GUHA 2OQRA 3LAJA 2YX4A 2M8EA 4P1WA 1BJZA 2DOAA 5F08A 1CF7B 2JPBA 2M4GA 2K85A 3OYEA 1TQMA 3MKLA 3OS0A 1TNTA 2XROA 1IUFA 1P7JA 1ZR2A 1I6HJ 4UV9A 1ZARA 3PO3J 4FQGA 3L2QA 2DODA 3HZJA 3BCBA 1MJBA 3S93A 2E2HJ 3HHHA 5LRSA 3AQSA 3SDGA 5C4JJ 4XMYA 1YHQI 3VYUB 4XLEA 3WODF 2L54A 3AG1H 2KT0A 3D5RC 3SFZA 3J7AO 3KETA 2CV2A 2CV1A 4A3KJ 2ZCMA 1R58A 1JHFA 1ULYA 4BHPA 2X1DA 1FWZA 2HOAA 3SJMA 3BJAA 3V78A 3CLQA 2NOGA 3FMSA 4JKZA 2E2JJ 3GZIA 2DMPA 3BDDA 4YELA 3A1YA 3GFIA 3Q5FA 3AG2H 5B5EC 2A61A 1YX3A 1R1UA 2LMDA 2K4BA 3CCMI 3OL4A 3PQJA 1IRGA 1UI6A 4NC8A 3WTVC 2KDZA 1QA6A 3ABMH 1UG0A 4PSWA 3FXQA 4ESJA 4A3IJ 1XMAA 3L2UA 5FKNA 3TBIA 3OY9A 1T33A 2PBXA 3S3NA 5IPAA 1FNNA 1BR2A 4AC0A 2NRAC 3CC2I 1SD7A 3RKWA 2K86A 5BPDA 2DOFA 3QP5A 2VOOA 5HLGA 2QZ8A 1BOBA 2CU7A 5B1BH 3OYBA 4LLNA 2ZKZA 3S8PA 5K7HA 3BOQA 2GOXB 2IEKA 1TWGJ 3E5QA 1P2FA 3ERED 4S0HB 4N0BA 3G2BA 2HFHA 4AIDA 3JRIA 3ZMZA 1W7PD 4L9JA 4AYBA 3EUKL 2PX9A 4OIRF 1HBXG 2AS5F 4A3DJ 3O2PE 1MMDA 2WGBA 2KLOA 3PFIA 4R79A 5E1XA 1MMNA 2DJNA 1FPQA 1GXQA 3CD6I 4YIRX 4A3BJ 2PMZN 4CZCA 1SD4A 3IAM2 3CCUI 4PJLA 3GTOJ 2G7UA 4W1UA 1OLTA 4UUSA 5H6RA 2XPUA 2W25A 3JSJA 3I64A 4KA4A 4A93J 2EV5A 2O8XA 4HLXA 3COAC 3CO7C 4IO9F 5E1ZB 3DU6A 4XNFA 1W5SA 2CUEA 1IW7F 2UXXA 2DFEA 1R6RA 3HDDA 3A02A 1JJ8C 3ABKH 2NAZA 3QYFA 3CP2A 1PP8F 1X58A 1Y0NA 3O8GA 2P4WA 1X1CA 5IT3A 5GAEJ 5JR3A 3HB9A 2OPTA 2KIFA 2L9SA 4DBRA 4RB0A 3LSHA 3JAMZ 1NG6A 4YEJA 5BOXA 2M2EA 1SAXA 2KHMA 3ZMTA 2DI3A 2X1EA 3QOPA 3PNVA 2ELKA 2IA0A 4HYEA 4D0PA 4XKCA 2VT3A 3GXOA 2DA4A 2GIZA 2YPRA 2BVMA 3C2GA 3KYDB 3ZQQA 2LKPA 4B48A 3WTZA 4C2UA 4A69C 2BY1A 4BY7J 5HOOA 4LB5A 2DA5A 3VWBA 4IHVA 2VPRA 1W5CC 3H36A 3HRUA 1Z21A 2UXNA 1AOYA 3LOCA 2XF6A 2H1LA 3M9AA 3QPLA 3BROA 5HAWA 4Q5SF 2V9VA 1H9TA 1ZTRA 3NQOA 4FX0A 1VQNI 4I6ZA 3DKXA 2GWRA 5L3BA 3HRTA 1FC3A 2FX0A 1WFXA 1IDZA 2L9RA 3MZYA 3M8EA 1ZGJA 4IQ4A 3EUPA 3NNRA 2H6BA 4XN0A 1WJEA 1G6NA 1O3QA 1ON1A 1OCPA 4XLCA 1FP1D 2EILH 2XSJC 4RGRA 3RDIA 2G7HA 2XC7A 5E17F 3BG3A 3BR5A 1X3ZB 2XAGA 3GF2A 3I59A 4KUMA 2E1OA 4MFDA 4GCTA 1IGNA 2ZMEC 2E1CA 5DS9A 3TOAA 1S7AA 2UUZA 4DW6A 3NWTA 3NARA 2O03A 4GCKA 1YW8A 3GTJJ 1FIPA 2WTEA 3WTTC 2FBIA 2VE9A 2VODA 5D5VB 3DEUA 3LSRA 1HDPA 1Z6TA 2F5FA 3KX2A 3R0AA 3KYLA 2TDXA 3F72A 3RH2A 2LY9A 3H9JA 5AIPA 1VF9A 3FKJA 4AF5A 4BJ6C 2YR2A 1FP2A 5KHDA 3OR1C 5JHUA 1G3YA 4NBQA 4M9XA 2M34A 4HOBA 2ID6A 1I5ZA 5FLXZ 3J80K 3PNYA 3HL2A 4ON0A 5A2QK 2FD5A 4E7LA 1LFUP 1IC8A 2QOPA 2M8GX 1NG7A 5F04A 5ICFA 4ICHA 4UUSB 1GHCA 1S72I 1VQ5I 3ON4A 3G73A 4LLLA 2HDCA 5BS6A 2BXYA 2Z3YA 2HQNA 4OMYA 1ENHA 2C6YA 2QQAA 5J40A 3GTPJ 4UVBA 1YE9A 1T2KA 2OD5A 2RAEA 1W7PA 1W36D 2HVQA 4WK8F 2WAQN 1DU6A 4RAZA 3ASOH 2VC0A 2ZFWA 2ADUA 2D5VA 2VJ5A 1A6IA 4PJMA 1C0WA 5E20A 3GLXA 3RYPA 3ZQIA 1MNDA 2QWTA 2P5LC 1R5HA 2W53A 2NS0A 3QU3A 2V1UA 4AUXA 4IRGA 2DA2A 5FJ8J 4GGGA 4NQWA 3EYYA 3MQ0A 1WI3A 4CO8A 3K2ZA 2HKXA 4AIHA 1JT0A 2DFFA 2Z33A 2X48A 4A6EA 1RNLA 1K78A 1LE8A 2PBIA 1QZEA 2CFOA 5D4SA 2VKVA 3VOXA 1JUSA 3QKXA 1JGGA 2HQAA 2BBYA 4KIFA 3ABTA 5GPCA 5LD2C 1BBYA 2Y0SA 2O6GE 4U0VA 3F23A 3ZQHA 5D19A 3BR0A 2KRCA 5IP9J 4B4CA
chains in the Genus database with same CATH topology
1RKTA 2LR8A 2MW8A 2GFNA 3ANGA 2LP0A 1OFCX 5EFYA 1ITYA 2N8GA 1MBKA 1E3OC 1B72B 3BT9A 1HCRA 1BW6A 1Y1WJ 2QCOA 2IAIA 4A3FJ 1FEXA 3DEWA 3VVXA 2B63J 5EGOA 2XPVA 2P81A 2RHAA 3IH3A 1EF4A 4UDSA 2Y0SN 1Q1VA 3PASA 2MG4A 4DYCA 2EZIA 4C2MJ 5M5WJ 2ZB9A 1JKRC 1G2HA 3BHQA 4BBSJ 2HOSA 5F0CA 3CRJA 3GEUA 2EQRA 3VPRA 3HE0A 3TW7A 4M3FA 2DA7A 1GVDA 3BR2A 3HOXJ 1VFCA 2Y31A 3FK6A 3HGGA 4IEJA 1O4XA 3G7RA 5HSZA 5FKLA 3GTMJ 3E7QA 4MK6A 4M3GA 2K9QA 5C4YA 3VUQA 3LWJA 5FKMA 2XRLA 4MFEA 2GLOA 1XS9A 3G1LA 3HKZN 1PUFB 1MNMC 1T56A 2R93J 3VW2A 4JX6A 3FISA 3O8HA 4GFBA 5M5XJ 1B8IA 1HDDC 3I4MJ 2NVTJ 2HDDA 5D1RA 1FIAA 4JNNA 3TW6A 1JJ6C 5IP7J 1GDTA 5IOZA 1X2MA 5E3NA 1NTCA 2TCTA 3BQYA 4C3HJ 1GUUA 2XGDA 3LNQA 3HOWJ 3CJDA 1MSEC 5FLVA 4B1RA 3AQTA 1TWAJ 2JJ7A 4IHYA 1RPWA 1IRZA 5J1YA 5FMPA 1QVTA 1Z0XA 5DAJA 2DTZA 4NELA 1WCMJ 2FBQA 3ZQCA 2ID3A 2PZ9A 3P9TA 4D5FA 5AQCA 2R92J 2OERA 3KKCA 4EEFG 5K7ZA 5E3OA 3OSFA 3PM1A 4MO7A 3TP3A 5CXGA 2X6OA 3F1BA 1P7IA 2R5ZA 4NN1A 3A01A 4DYQA 3TP0A 2DN0A 1VNDA 3FIWA 4IHWA 3VOKA 3Q0WA 1RKWA 3BJBA 4BKXA 3C07A 2ZCXA 2ECBA 2R5YB 2REKA 3JRGA 4ABZA 3NAUA 3RQIA 3CQZJ 2UXUA 1F36A 1BW5A 1U9OA 4GFLA 3VP5A 3Q0UA 3JRCA 2DMNA 2YUSA 1LE8B 5CXIA 2D6YA 2ZOYA 2JA6J 2HKUA 2XSDC 2WB1N 2CJJA 4GCLA 1OCTC 5IOYA 2HXIA 3HTHA 3CWRA 3BTJA 2JA7J 1JT6A 3RZOJ 4CYCA 1ZGWA 2UXPA 2M9HA 5CW8A 3VVYA 3H0GJ 1K83J 2QTQA 1MSFC 2WUIA 3NI7A 3EGQA 2Y30A 2G7GA 1WGXA 3Q3SA 1S7EA 3LSPA 2ME0A 2ZOZA 2CQQA 2IU5A 3F0CA 3OOUA 5E3MA 2JA8J 2G0EA 2TRTA 3BG5A 1RR7A 2XGEA 3JREA 3GTGJ 3HTAA 1I3QJ 3BTCA 1JKPC 4X6AJ 5IYCJ 5EGOB 3OSGA 4XRMA 2LLKA 1SFOJ 2QF7A 1MH4A 5FHPA 2HOTA 1JKOC 3KKDA 1JUMA 2F07A 1W0UA 3S1QJ 4RDUA 2M0CA 1ETWA 4RBOA 5K7FA 3G1MA 5IYDJ 2Y2ZA 4D5CA 4MXMA 2R7ZJ 4UUTA 2HI3A 3JRHA 3QPSA 3JRFA 3S15J 2QKOA 3GBGA 3HGYA 4FISA 3S2HJ 2GUHA 3D1NI 2HXOA 3E7LA 1BJZA 1RETA 5EF6A 5F08A 3HTJA 1VI0A 3MKLA 1AKHA 1HOMA 2DG7A 2HYTA 1AU7A 1IUFA 1P7JA 4DYRA 1ZR2A 1I6HJ 1B8IB 3H3VK 1FTZA 2EBIA 4X1EA 2R0QC 3PO3J 3HOVJ 3V6GA 3S2DJ 5F0FA 4A3JJ 2VI6A 2E2HJ 3BTLA 3AQSA 3SDGA 5C4JJ 2Y9YA 4HKUA 3G56A 2KT0A 2DA3A 3GTQJ 4M3BA 3DCFA 2G3BA 1IV6A 3IH4A 4A3KJ 2ZCMA 2RASA 3G1OA 3ON2A 4XICA 3FK7A 2LTPA 3VVZA 4JX5A 2HOAA 2CUFA 3SJMA 3S1MJ 4D7MA 3V78A 1FJLA 2NOGA 4JKZA 2E2JJ 3HEFA 2DMPA 1Y1VJ 3GZIA 2CRGA 3W6VA 2R5ZB 3IV5A 3SFIA 3OIOA 2L0KA 3A01B 1U8BA 1MBFA 1UI6A 2NS7A 4D7NA 1MBGA 2VUMJ 3GTLJ 2MSYA 3HOUJ 4A3IJ 3ZQFA 3IH2A 4A3EJ 5FKOA 5FKNA 2JMWA 4V2FA 2DMTA 5DTDA 1T33A 3HM5A 5IP6A 2XB0X 5F0HA 2PBXA 5IPAA 4FE7A 3TEDA 1H8AC 4AC0A 1BL0A 1YRNA 5D18A 5JLWA 4A3LJ 4CYCB 3RZDJ 2CU7A 3CDLA 1JUPA 5K7HA 1UG2A 2O9LA 2IEKA 4DZJA 1TWGJ 4CGRA 3NRGA 1ZK8A 2YS9A 2CQXA 4S0HB 1SANA 4PXIA 4GFKA 3JRIA 4DZPA 2LFBA 4A3DJ 1IJWC 5F27A 4C3JJ 1HF0A 1ETYA 2WGBA 2COBA 2GBYA 2DJNA 2H1KA 4A3BJ 2YVHA 4Y52J 1QVUA 2YVEA 3ZQLA 5IYBJ 2PMZN 2NS8A 2DG8A 2L7MP 3S14J 1X2NA 3GTOJ 4W1UA 3HIMA 4A3GJ 1QRYA 5FLMJ 4UUSA 1SGMA 2XPUA 4JL3A 3ANPA 3JSJA 2DMQA 4A93J 2K40A 2O7TA 1WPKA 2GENA 4AYBN 3MN2A 1ZKGA 2CUEA 3FRQA 3LSJA 4QSHA 3A02A 3HDDA 1JJ8C 1BA5A 5EG0A 3S1NJ 1X58A 3O8GA 4Y7NJ 1JKQC 2LVSA 4FE4A 4BXXJ 3VW0A 2NP5A 2EZKA 5K58A 3HB9A 2OPTA 2UXIA 2OF7A 4JP0A 2IBDA 1ETKA 1AKHB 3COLA 4W97A 3LHQA 2M2EA 2LKXA 2E19A 4C3IJ 1U78A 2NX4A 2XPWA 4XRSG 3K2AA 3WHCA 1GV2A 2ELKA 1HLVA 4BY1J 3RD3A 2O8KA 3I4NJ 2E2IJ 3NXCA 5C3EJ 4XRSA 1F43A 2KDZA 1LFBA 2DA4A 3JR9A 1ETQA 3BRUA 2MGQA 2JN6A 4A69C 4BY7J 4L5EA 2DA5A 2EZHA 3GTKJ 4IHVA 2VPRA 1ZQ3P 4A3CJ 1TWCJ 1A5JA 1I50J 1APLC 1Z77A 2ME6A 4QIWN 1JTYA 2X9DA 3LOCA 3WHBA 4J19A 2UXHA 3QPLA 5HAWA 1TWHJ 1GT0C 3CMYA 2NVYJ 3C2BA 1ZTRA 2JWTA 2K9NA 3FKIJ 4I6ZA 4A3MJ 2L7ZA 4AC6A 2VKEA 2FX0A 1IDZA 2L9RA 3B6AA 3EUPA 3NNRA 4NDLA 2G7SA 2G7LA 3T6NA 1OCPA 4IHXA 1ETXA 9ANTA 2XGCA 3O60A 3BR1A 4V2GA 1H88C 3BG3A 3BR5A 1NK3P 2YU9J 5C4XJ 2QIBA 4M3EA 2E1OA 4MFDA 3L1PA 1B72A 4ME9A 4GCTA 1W0TA 1IGNA 5DS9A 1XG1A 4DW6A 3UKGA 1UMQA 3NARA 3S16J 1YRNB 4XIDA 2NVQJ 3KNWA 5C44J 4GCKA 2DMUA 3GTJJ 1FIPA 3LSRA 1HDPA 5J3LA 3RH2A 3QQAA 1DU0A 2LY9A 1VF9A 3B6CA 4AF5A 3BR3A 3VW1A 5EZHA 1POGA 5M5YJ 3K7AJ 2XDNA 1RESA 5HODA 1U9NA 5M3FJ 4LOCA 2L7FP 5FGLA 5HBUA 1R9TJ 3NPIA 3M4OJ 2M34A 2ID6A 3HTIA 2WV1A 4JYKA 3ZOBA 4MLOA 3BCGA 5JLXA 5J1UA 1WH5A 2O7OA 2JK3A 4L62A 1IC8A 2QOPA 2FD5A 1LFUP 4B3AA 2M8GX 1MBJA 2ECCA 1IG7A 3JRDA 1PUFA 3S5RA 2K9SA 5F04A 5EEAA 3MNLA 1QPIA 3PO2J 4ICHA 3CCYA 4UUSB 1NK2P 1AHDP 3JRAA 2EZLA 3ON4A 2OI8A 1JTXA 1WH7A 2JA5J 5GP9A 2FQ4A 5FKKA 2H8RA 1ENHA 1ETOA 1GV5A 3GTPJ 3LSGA 5EG0B 3BG9A 3Q0VA 5BNGA 2Q24A 2RAEA 2LD5A 2AHQA 2AO9A 1MBHA 1TC3C 1CQTA 1DU6A 2WAQN 3HBLA 3A03A 3ZQGA 1MH3A 3PPBA 2D5VA 3BTIA 1A6IA 3BR6A 4G12A 5EYRA 4FTHA 2HYJA 3ZQIA 3JRBA 2FJ1A 2DA1A 2NVXJ 4QTRA 2QWTA 2HQ5A 5F1JA 2I10A 2DA6A 2W48A 2W53A 4AUXA 5J1RA 3KZ9A 2Y9ZA 4FCYA 4XK4A 3B81A 1H89C 2UXOA 5E3LA 1ZR4A 4YZEA 2DA2A 5FJ8J 3M3YJ 1K61A 3VIBA 1TWFJ 2R5YA 4M3DA 2ZCNA 1WI3A 5M3MJ 2NP3A 1JT0A 1FTTA 4MIMA 3BNIA 3HOZJ 3DPJA 2X48A 1IDYA 4M6VA 1ORKA 3LJLA 3S17J 4KWAA 1LE8A 5EZGA 3BQZA 2GM4A 1ETVA 5H9TA 3HOYJ 2VKVA 1UHSA 3VOXA 1JUSA 3QKXA 1JGGA 5GPCA 4I76A 1D5YA 3RKQA 4ACIA 1MBEA 1OJLA 2LK2A 4JX4A 1UI5A 5GPAA 3IUVA 5EDNA 3ZQHA 3S1RJ 4BBRJ 5D19A 2XB5A 2EH3A 3BR0A 3MVPA 5IP9J 3QBMA 4B4CA 2V57A 1XC5A 4HNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKT A;  2LR8 A;  2MW8 A;  2GFN A;  3ANG A;  2LP0 A;  1OFC X;  5EFY A;  1ITY A;  2N8G A;  1MBK A;  1E3O C;  1B72 B;  3BT9 A;  1HCR A;  1BW6 A;  1Y1W J;  2QCO A;  2IAI A;  4A3F J;  1FEX A;  3DEW A;  3VVX A;  2B63 J;  5EGO A;  2XPV A;  2P81 A;  2RHA A;  3IH3 A;  1EF4 A;  4UDS A;  2Y0S N;  1Q1V A;  3PAS A;  2MG4 A;  4DYC A;  2EZI A;  4C2M J;  5M5W J;  2ZB9 A;  1JKR C;  1G2H A;  3BHQ A;  4BBS J;  2HOS A;  5F0C A;  3CRJ A;  3GEU A;  2EQR A;  3VPR A;  3HE0 A;  3TW7 A;  4M3F A;  2DA7 A;  1GVD A;  3BR2 A;  3HOX J;  1VFC A;  2Y31 A;  3FK6 A;  3HGG A;  4IEJ A;  1O4X A;  3G7R A;  5HSZ A;  5FKL A;  3GTM J;  3E7Q A;  4MK6 A;  4M3G A;  2K9Q A;  5C4Y A;  3VUQ A;  3LWJ A;  5FKM A;  2XRL A;  4MFE A;  2GLO A;  1XS9 A;  3G1L A;  3HKZ N;  1PUF B;  1MNM C;  1T56 A;  2R93 J;  3VW2 A;  4JX6 A;  3FIS A;  3O8H A;  4GFB A;  5M5X J;  1B8I A;  1HDD C;  3I4M J;  2NVT J;  2HDD A;  5D1R A;  1FIA A;  4JNN A;  3TW6 A;  1JJ6 C;  5IP7 J;  1GDT A;  5IOZ A;  1X2M A;  5E3N A;  1NTC A;  2TCT A;  3BQY A;  4C3H J;  1GUU A;  2XGD A;  3LNQ A;  3HOW J;  3CJD A;  1MSE C;  5FLV A;  4B1R A;  3AQT A;  1TWA J;  2JJ7 A;  4IHY A;  1RPW A;  1IRZ A;  5J1Y A;  5FMP A;  1QVT A;  1Z0X A;  5DAJ A;  2DTZ A;  4NEL A;  1WCM J;  2FBQ A;  3ZQC A;  2ID3 A;  2PZ9 A;  3P9T A;  4D5F A;  5AQC A;  2R92 J;  2OER A;  3KKC A;  4EEF G;  5K7Z A;  5E3O A;  3OSF A;  3PM1 A;  4MO7 A;  3TP3 A;  5CXG A;  2X6O A;  3F1B A;  1P7I A;  2R5Z A;  4NN1 A;  3A01 A;  4DYQ A;  3TP0 A;  2DN0 A;  1VND A;  3FIW A;  4IHW A;  3VOK A;  3Q0W A;  1RKW A;  3BJB A;  4BKX A;  3C07 A;  2ZCX A;  2ECB A;  2R5Y B;  2REK A;  3JRG A;  4ABZ A;  3NAU A;  3RQI A;  3CQZ J;  2UXU A;  1F36 A;  1BW5 A;  1U9O A;  4GFL A;  3VP5 A;  3Q0U A;  3JRC A;  2DMN A;  2YUS A;  1LE8 B;  5CXI A;  2D6Y A;  2ZOY A;  2JA6 J;  2HKU A;  2XSD C;  2WB1 N;  2CJJ A;  4GCL A;  1OCT C;  5IOY A;  2HXI A;  3HTH A;  3CWR A;  3BTJ A;  2JA7 J;  1JT6 A;  3RZO J;  4CYC A;  1ZGW A;  2UXP A;  2M9H A;  5CW8 A;  3VVY A;  3H0G J;  1K83 J;  2QTQ A;  1MSF C;  2WUI A;  3NI7 A;  3EGQ A;  2Y30 A;  2G7G A;  1WGX A;  3Q3S A;  1S7E A;  3LSP A;  2ME0 A;  2ZOZ A;  2CQQ A;  2IU5 A;  3F0C A;  3OOU A;  5E3M A;  2JA8 J;  2G0E A;  2TRT A;  3BG5 A;  1RR7 A;  2XGE A;  3JRE A;  3GTG J;  3HTA A;  1I3Q J;  3BTC A;  1JKP C;  4X6A J;  5IYC J;  5EGO B;  3OSG A;  4XRM A;  2LLK A;  1SFO J;  2QF7 A;  1MH4 A;  5FHP A;  2HOT A;  1JKO C;  3KKD A;  1JUM A;  2F07 A;  1W0U A;  3S1Q J;  4RDU A;  2M0C A;  1ETW A;  4RBO A;  5K7F A;  3G1M A;  5IYD J;  2Y2Z A;  4D5C A;  4MXM A;  2R7Z J;  4UUT A;  2HI3 A;  3JRH A;  3QPS A;  3JRF A;  3S15 J;  2QKO A;  3GBG A;  3HGY A;  4FIS A;  3S2H J;  2GUH A;  3D1N I;  2HXO A;  3E7L A;  1BJZ A;  1RET A;  5EF6 A;  5F08 A;  3HTJ A;  1VI0 A;  3MKL A;  1AKH A;  1HOM A;  2DG7 A;  2HYT A;  1AU7 A;  1IUF A;  1P7J A;  4DYR A;  1ZR2 A;  1I6H J;  1B8I B;  3H3V K;  1FTZ A;  2EBI A;  4X1E A;  2R0Q C;  3PO3 J;  3HOV J;  3V6G A;  3S2D J;  5F0F A;  4A3J J;  2VI6 A;  2E2H J;  3BTL A;  3AQS A;  3SDG A;  5C4J J;  2Y9Y A;  4HKU A;  3G56 A;  2KT0 A;  2DA3 A;  3GTQ J;  4M3B A;  3DCF A;  2G3B A;  1IV6 A;  3IH4 A;  4A3K J;  2ZCM A;  2RAS A;  3G1O A;  3ON2 A;  4XIC A;  3FK7 A;  2LTP A;  3VVZ A;  4JX5 A;  2HOA A;  2CUF A;  3SJM A;  3S1M J;  4D7M A;  3V78 A;  1FJL A;  2NOG A;  4JKZ A;  2E2J J;  3HEF A;  2DMP A;  1Y1V J;  3GZI A;  2CRG A;  3W6V A;  2R5Z B;  3IV5 A;  3SFI A;  3OIO A;  2L0K A;  3A01 B;  1U8B A;  1MBF A;  1UI6 A;  2NS7 A;  4D7N A;  1MBG A;  2VUM J;  3GTL J;  2MSY A;  3HOU J;  4A3I J;  3ZQF A;  3IH2 A;  4A3E J;  5FKO A;  5FKN A;  2JMW A;  4V2F A;  2DMT A;  5DTD A;  1T33 A;  3HM5 A;  5IP6 A;  2XB0 X;  5F0H A;  2PBX A;  5IPA A;  4FE7 A;  3TED A;  1H8A C;  4AC0 A;  1BL0 A;  1YRN A;  5D18 A;  5JLW A;  4A3L J;  4CYC B;  3RZD J;  2CU7 A;  3CDL A;  1JUP A;  5K7H A;  1UG2 A;  2O9L A;  2IEK A;  4DZJ A;  1TWG J;  4CGR A;  3NRG A;  1ZK8 A;  2YS9 A;  2CQX A;  4S0H B;  1SAN A;  4PXI A;  4GFK A;  3JRI A;  4DZP A;  2LFB A;  4A3D J;  1IJW C;  5F27 A;  4C3J J;  1HF0 A;  1ETY A;  2WGB A;  2COB A;  2GBY A;  2DJN A;  2H1K A;  4A3B J;  2YVH A;  4Y52 J;  1QVU A;  2YVE A;  3ZQL A;  5IYB J;  2PMZ N;  2NS8 A;  2DG8 A;  2L7M P;  3S14 J;  1X2N A;  3GTO J;  4W1U A;  3HIM A;  4A3G J;  1QRY A;  5FLM J;  4UUS A;  1SGM A;  2XPU A;  4JL3 A;  3ANP A;  3JSJ A;  2DMQ A;  4A93 J;  2K40 A;  2O7T A;  1WPK A;  2GEN A;  4AYB N;  3MN2 A;  1ZKG A;  2CUE A;  3FRQ A;  3LSJ A;  4QSH A;  3A02 A;  3HDD A;  1JJ8 C;  1BA5 A;  5EG0 A;  3S1N J;  1X58 A;  3O8G A;  4Y7N J;  1JKQ C;  2LVS A;  4FE4 A;  4BXX J;  3VW0 A;  2NP5 A;  2EZK A;  5K58 A;  3HB9 A;  2OPT A;  2UXI A;  2OF7 A;  4JP0 A;  2IBD A;  1ETK A;  1AKH B;  3COL A;  4W97 A;  3LHQ A;  2M2E A;  2LKX A;  2E19 A;  4C3I J;  1U78 A;  2NX4 A;  2XPW A;  4XRS G;  3K2A A;  3WHC A;  1GV2 A;  2ELK A;  1HLV A;  4BY1 J;  3RD3 A;  2O8K A;  3I4N J;  2E2I J;  3NXC A;  5C3E J;  4XRS A;  1F43 A;  2KDZ A;  1LFB A;  2DA4 A;  3JR9 A;  1ETQ A;  3BRU A;  2MGQ A;  2JN6 A;  4A69 C;  4BY7 J;  4L5E A;  2DA5 A;  2EZH A;  3GTK J;  4IHV A;  2VPR A;  1ZQ3 P;  4A3C J;  1TWC J;  1A5J A;  1I50 J;  1APL C;  1Z77 A;  2ME6 A;  4QIW N;  1JTY A;  2X9D A;  3LOC A;  3WHB A;  4J19 A;  2UXH A;  3QPL A;  5HAW A;  1TWH J;  1GT0 C;  3CMY A;  2NVY J;  3C2B A;  1ZTR A;  2JWT A;  2K9N A;  3FKI J;  4I6Z A;  4A3M J;  2L7Z A;  4AC6 A;  2VKE A;  2FX0 A;  1IDZ A;  2L9R A;  3B6A A;  3EUP A;  3NNR A;  4NDL A;  2G7S A;  2G7L A;  3T6N A;  1OCP A;  4IHX A;  1ETX A;  9ANT A;  2XGC A;  3O60 A;  3BR1 A;  4V2G A;  1H88 C;  3BG3 A;  3BR5 A;  1NK3 P;  2YU9 J;  5C4X J;  2QIB A;  4M3E A;  2E1O A;  4MFD A;  3L1P A;  1B72 A;  4ME9 A;  4GCT A;  1W0T A;  1IGN A;  5DS9 A;  1XG1 A;  4DW6 A;  3UKG A;  1UMQ A;  3NAR A;  3S16 J;  1YRN B;  4XID A;  2NVQ J;  3KNW A;  5C44 J;  4GCK A;  2DMU A;  3GTJ J;  1FIP A;  3LSR A;  1HDP A;  5J3L A;  3RH2 A;  3QQA A;  1DU0 A;  2LY9 A;  1VF9 A;  3B6C A;  4AF5 A;  3BR3 A;  3VW1 A;  5EZH A;  1POG A;  5M5Y J;  3K7A J;  2XDN A;  1RES A;  5HOD A;  1U9N A;  5M3F J;  4LOC A;  2L7F P;  5FGL A;  5HBU A;  1R9T J;  3NPI A;  3M4O J;  2M34 A;  2ID6 A;  3HTI A;  2WV1 A;  4JYK A;  3ZOB A;  4MLO A;  3BCG A;  5JLX A;  5J1U A;  1WH5 A;  2O7O A;  2JK3 A;  4L62 A;  1IC8 A;  2QOP A;  2FD5 A;  1LFU P;  4B3A A;  2M8G X;  1MBJ A;  2ECC A;  1IG7 A;  3JRD A;  1PUF A;  3S5R A;  2K9S A;  5F04 A;  5EEA A;  3MNL A;  1QPI A;  3PO2 J;  4ICH A;  3CCY A;  4UUS B;  1NK2 P;  1AHD P;  3JRA A;  2EZL A;  3ON4 A;  2OI8 A;  1JTX A;  1WH7 A;  2JA5 J;  5GP9 A;  2FQ4 A;  5FKK A;  2H8R A;  1ENH A;  1ETO A;  1GV5 A;  3GTP J;  3LSG A;  5EG0 B;  3BG9 A;  3Q0V A;  5BNG A;  2Q24 A;  2RAE A;  2LD5 A;  2AHQ A;  2AO9 A;  1MBH A;  1TC3 C;  1CQT A;  1DU6 A;  2WAQ N;  3HBL A;  3A03 A;  3ZQG A;  1MH3 A;  3PPB A;  2D5V A;  3BTI A;  1A6I A;  3BR6 A;  4G12 A;  5EYR A;  4FTH A;  2HYJ A;  3ZQI A;  3JRB A;  2FJ1 A;  2DA1 A;  2NVX J;  4QTR A;  2QWT A;  2HQ5 A;  5F1J A;  2I10 A;  2DA6 A;  2W48 A;  2W53 A;  4AUX A;  5J1R A;  3KZ9 A;  2Y9Z A;  4FCY A;  4XK4 A;  3B81 A;  1H89 C;  2UXO A;  5E3L A;  1ZR4 A;  4YZE A;  2DA2 A;  5FJ8 J;  3M3Y J;  1K61 A;  3VIB A;  1TWF J;  2R5Y A;  4M3D A;  2ZCN A;  1WI3 A;  5M3M J;  2NP3 A;  1JT0 A;  1FTT A;  4MIM A;  3BNI A;  3HOZ J;  3DPJ A;  2X48 A;  1IDY A;  4M6V A;  1ORK A;  3LJL A;  3S17 J;  4KWA A;  1LE8 A;  5EZG A;  3BQZ A;  2GM4 A;  1ETV A;  5H9T A;  3HOY J;  2VKV A;  1UHS A;  3VOX A;  1JUS A;  3QKX A;  1JGG A;  5GPC A;  4I76 A;  1D5Y A;  3RKQ A;  4ACI A;  1MBE A;  1OJL A;  2LK2 A;  4JX4 A;  1UI5 A;  5GPA A;  3IUV A;  5EDN A;  3ZQH A;  3S1R J;  4BBR J;  5D19 A;  2XB5 A;  2EH3 A;  3BR0 A;  3MVP A;  5IP9 J;  3QBM A;  4B4C A;  2V57 A;  1XC5 A;  4HNV A; 
#chains in the Genus database with same CATH topology
 2HPM A;  3TOB A;  3NRV A;  5JVT A;  2GXG A;  2MW8 A;  5D8L B;  2COM A;  4BU2 A;  2IS6 A;  3I59 B;  3HJE A;  2IP2 A;  1XMX A;  2N8G A;  1E3O C;  1G8X A;  1QHG A;  1Y1W J;  3OOP A;  3IKV A;  4EMS A;  4A3F J;  3HYI A;  2MC4 A;  3IL2 A;  4HBL A;  2GOM A;  5AON A;  2XPV A;  3OMY A;  1SFX A;  2WAF A;  3F8B A;  3EPZ A;  3IH3 A;  4LGW A;  2X4H A;  5CVJ A;  4XM3 A;  2CV0 A;  1EF4 A;  2DQR A;  5CVV A;  2L9N A;  2MG4 A;  4YRV A;  1DP7 P;  3ERM A;  4I0A A;  4CSW A;  4BBS J;  3MZH A;  2HOS A;  2LY1 A;  1XSX A;  4M3F A;  2DA7 A;  2VJJ A;  3C2H A;  4IKF A;  3BR2 A;  4E7Z A;  2RN7 A;  4IOA F;  4BUP A;  4XKW A;  2RC4 A;  2VAS A;  1FY7 A;  1M1E B;  3FMR A;  4I09 A;  1SMY F;  1SVL A;  2K9Q A;  5ILU A;  2CQ7 A;  1GXP A;  4KDP A;  2GLO A;  3HKZ N;  1Z6R A;  2KZG A;  4AIK A;  2L4A A;  4L0Y B;  1D5V A;  3CMA I;  4GFB A;  1HQC A;  1HDD C;  3I4M J;  2EPF A;  3K4C A;  1R23 A;  2NVT J;  3NS4 A;  4BNC A;  2F48 A;  2HDD A;  5D1R A;  1FOY A;  1XCV A;  1GDT A;  5LHH A;  5E3N A;  1Z91 A;  1NTC A;  1OCZ H;  4C3H J;  1GUU A;  1X1B A;  2XGD A;  1MSE C;  1SMT A;  2FA5 A;  2JZY A;  4FX4 A;  1IRZ A;  3KP7 A;  5FMP A;  5IT9 Z;  4GXO A;  1Z0X A;  2CMP A;  1X3U A;  5DAJ A;  1G3T A;  5F1R A;  2B3W A;  2PZ9 A;  4LG0 A;  4CIC A;  2STT A;  4WWC A;  2VJI A;  2L02 A;  5HLT A;  3P9T A;  4D5F A;  4U7D A;  2K02 A;  3GZ6 A;  2ESH A;  4WIB A;  5LFA A;  1BIA A;  3OIP A;  2DCE A;  1ZRF A;  2F4I A;  5D5X B;  1BN5 A;  5FB2 A;  1RIO H;  1U6G A;  1J9I A;  1P7I A;  4Y4R A;  3JTH A;  2FU4 A;  3SZP A;  3A01 A;  4HNU A;  1PUE E;  5FGM A;  3TP0 A;  3CUQ A;  1VND A;  2IS4 A;  2LYC A;  1I1S A;  1JXS A;  1RKW A;  3OS2 A;  3OS1 A;  4NQW B;  4H0E A;  3ML6 A;  3JSO A;  4ABZ A;  2HKO A;  4XR6 A;  3FXU A;  2A5W A;  3WE3 A;  1BW5 A;  1QQI A;  4GFL A;  1K78 B;  3Q0U A;  5L3D A;  2KRH A;  2DMN A;  1LE8 B;  3H3U A;  2R7O A;  2KL4 A;  2PN6 A;  4TV7 A;  2XSD C;  2CJJ A;  1BI1 A;  1OCT C;  3QWL A;  4P96 A;  5DUK A;  2QKL B;  1ZGW A;  3CC4 I;  2KFD A;  4Y17 A;  3VVY A;  1R22 A;  3H0G J;  2QVO A;  4Y15 A;  3NI7 A;  4B44 A;  4G7O F;  2NVU B;  4LMY A;  2G7G A;  3ONQ A;  2FJI 1;  2F6C A;  2Z9O A;  5E79 C;  2A07 F;  2OZ6 A;  3OYF A;  2IU5 A;  3IC7 A;  5E3M A;  3CJQ B;  3HTA A;  2XGE A;  3BTC A;  5IYC J;  1SFO J;  1D1B A;  1MH4 A;  2R7R A;  2LOO A;  1JUM A;  2F07 A;  3S1Q J;  3O3K A;  1XB4 A;  2P6S A;  4U0W A;  2ZNZ A;  1UFM A;  4RBO A;  2CO5 A;  2E36 A;  2EFP A;  3G1M A;  5IYD J;  5DM6 F;  4OIN F;  1VQO I;  4UUT A;  2E34 A;  2HI3 A;  1FYM A;  3LWF A;  4GO1 A;  3JRF A;  3LST A;  2ISY A;  4P9F A;  1K79 A;  5TIS C;  3GLL A;  3ZMS A;  2QKO A;  2R4G A;  1UST A;  1PVE A;  1V55 H;  1OPC A;  2FNP A;  1ZRD A;  1RET A;  3W2V A;  5EF6 A;  2HR3 A;  5B1A H;  4D9J A;  1VI0 A;  1W1W E;  1KU9 A;  3UNG C;  3RQ4 A;  3CF5 F;  3H9G A;  2DG7 A;  2B7E A;  1WZ2 A;  4DYR A;  2E7X A;  3H3V K;  2FSW A;  4X1E A;  3MAJ A;  3LA2 A;  3H5A A;  3S2D J;  1VQK I;  5F0F A;  4A3J J;  1D1C A;  2DDA A;  2VI6 A;  1FYL A;  2NXN B;  4RAG A;  2ZXI A;  5JFR A;  1T08 B;  3T0Y A;  4CDG A;  3JW4 A;  1UZC A;  4EJU A;  3GTQ J;  3KZZ A;  3P9C A;  4HF2 A;  3DCF A;  2KJB A;  3IH4 A;  2EIJ H;  3VOE A;  3ZR8 X;  2RAS A;  3G1O A;  3ON2 A;  4KNY A;  3FK7 A;  4XLF A;  4LG0 B;  2P5K A;  1V5E A;  4ZYH A;  2R7X A;  5J4V A;  2BHY A;  4ZYA A;  3PUF A;  2DYR H;  4D7M A;  1PP7 U;  1QNT A;  2BY2 A;  3VSL A;  1GVJ A;  3HEF A;  4YII A;  5FD5 A;  1I1G A;  1DUX C;  1EH6 A;  4XLH A;  3W6V A;  3OYG A;  3A01 B;  3E6M A;  1Z67 A;  2L0K A;  2E5Z A;  2LRE A;  3SZG A;  3O6B B;  2B1E A;  3CUQ B;  5FFZ A;  4D7N A;  1A35 A;  1KU2 A;  1KQ0 A;  2B0L A;  2MSY A;  3VEP A;  3GTL J;  4GYG A;  2PEX A;  1IUY A;  4BGD A;  5FKO A;  3W6K B;  2JPC A;  2F4M B;  2WY8 Q;  5CKT A;  3HOT A;  5IP6 A;  1X3W B;  5DTD A;  3HM5 A;  3QU6 A;  2LKS A;  3K1M A;  4M73 A;  2ETH A;  4FE7 A;  4BEH A;  3TED A;  4AVZ A;  1V5F A;  1BL0 A;  2DK5 A;  5D18 A;  2DW4 A;  4N4O B;  4CCJ A;  4C2M A;  4U7B A;  1V3F A;  4A3L J;  4A0Z A;  2A3S A;  5EEH A;  5F64 A;  5ED4 A;  2HU9 A;  3D5S C;  4RB1 A;  4JOM A;  2RGV A;  4S05 A;  1G3S A;  1R00 A;  2KIS A;  2E35 A;  3AL0 C;  3CCJ I;  4CGR A;  1SFE A;  2EWN A;  2CQX A;  5TGT A;  2DYS H;  3ZMU A;  4PGG A;  2MBF A;  3HPG A;  4PXI A;  1TLH B;  4X0G A;  3L7W A;  3A0H C;  2QEN A;  4UUV A;  2VOP A;  3HSE A;  3WTX C;  1ETY A;  4KJZ A;  2GQQ A;  2E1N A;  3EDP A;  2VC1 A;  1TW3 A;  3ZRG A;  3JSP A;  3GVA A;  3S14 J;  1MNE A;  2VJ4 A;  1WJF A;  1MZB A;  4N4N B;  2CWE A;  1ZHF A;  3WTS C;  1XX5 A;  2R7Q A;  4JL3 A;  2DMQ A;  2P0W A;  3M8F A;  3HRS A;  3DWL E;  1OKR A;  1IRF A;  4A12 A;  3MN2 A;  1ZKG A;  4ITV A;  4RAF A;  3VYT B;  3FRQ A;  3LMM A;  1YO5 C;  3R0J A;  2XRN A;  5EG0 A;  1XGS A;  1BJA A;  4G7Z F;  3SXY A;  3OYI A;  4Y7N J;  2W00 A;  4BXX J;  3VW0 A;  4HV5 A;  2NP5 A;  4KT5 C;  1TT5 B;  3BG7 A;  5K58 A;  5DDG A;  3DKY A;  5JHF A;  2UXI A;  2OF7 A;  2YU3 A;  3H9Q A;  2ZSI B;  2BGC A;  2MD5 A;  3WTW C;  1JGS A;  2FE3 A;  2ZXW H;  2LKX A;  2QKM B;  4B09 A;  1U78 A;  2XPW A;  2A68 F;  3PUB A;  3GYH X;  3K70 D;  2R7T A;  2RQQ A;  2ZJQ F;  1X1P A;  5C3E J;  2HTS A;  1XDS A;  2GXA A;  3GME A;  1XTA A;  2HWV A;  4KIC A;  1D3Y A;  2F2E A;  3DBL B;  4BYY A;  1RZ4 A;  4O3M A;  4L5E A;  3GTK J;  5LEJ A;  1TWC J;  3QOE A;  2LBF A;  2GA2 A;  1Z77 A;  2ME6 A;  1WQ2 A;  3OWT A;  1R1V A;  3OYC A;  1TWH J;  2DBB A;  4HNT A;  1GT0 C;  3FKI J;  1L0O C;  2VKE A;  2MH9 A;  1SAU A;  4FAS D;  3B6A A;  3F22 A;  1A04 A;  2G7L A;  4CGZ A;  1V5G A;  2H09 A;  3BJ6 A;  5LEK A;  9ANT A;  2XGC A;  3K0L A;  2HOE A;  1H88 C;  2X51 A;  2YU9 J;  3AAF A;  5C4X J;  1GLN A;  1FBS A;  2LY2 A;  3MZ8 A;  1B72 A;  4ME9 A;  3W2A A;  1FBQ A;  1YS6 A;  2JUG A;  3UKG A;  3H5N A;  1WJ5 A;  4BEH B;  4PCQ A;  4CH7 A;  3S16 J;  1YJW I;  4XID A;  1XGN A;  3BPV A;  4A2U A;  1ZYR F;  3OV8 A;  1QBJ A;  5C44 J;  3RCO A;  1YI2 I;  4UV8 A;  2MYS A;  3CME I;  3EUA A;  4KT6 A;  2CGP A;  2D1H A;  2BE5 F;  3FF5 A;  3NWS A;  4RA2 A;  3LNQ A;  3QQA A;  5HLH A;  1DU0 A;  2QSF X;  3BR3 A;  4EM2 A;  1MD0 A;  1TT0 A;  4ZJZ A;  1L3L A;  5M5Y J;  3U9G A;  3QRF F;  3K7A J;  1HSJ A;  5M3F J;  1YIO A;  5FD6 A;  2V6C A;  5K5R A;  2BY3 A;  3HTI A;  2QLZ A;  2WV1 A;  4JYK A;  3ZCO A;  4MLO A;  2VQH A;  4BXF A;  4XLP F;  3BCG A;  5JLX A;  3L00 A;  2DLL A;  2EV6 A;  1UHM A;  2VBX A;  4L62 A;  3I56 I;  3WTY C;  4RLQ A;  2K9S A;  2UZK A;  3P5J A;  1LVK A;  2XVC A;  3H92 A;  3H0D A;  3JRA A;  2QQ9 A;  1B6A A;  3F8C A;  1WH7 A;  2JA5 J;  3G4S I;  3TL4 X;  4BE0 A;  4HF0 A;  2V79 A;  2W85 A;  2HNH A;  1LFP A;  5EG0 B;  5L3C A;  5LGN A;  1YJN I;  3Q0V A;  1CGP A;  3K9T A;  4PJN A;  4XLN F;  2Q24 A;  2OU2 A;  1D8K A;  1U3E M;  1IO2 A;  1MBH A;  1TC3 C;  2K5C A;  1YW9 A;  2QWW A;  3ZQG A;  4RB3 C;  1MH3 A;  4PGH A;  4B3X A;  2ZY9 A;  3V7S A;  1IN4 A;  2BZT A;  4G12 A;  4M9S A;  5EYR A;  3QOD A;  2FJ1 A;  4QTR A;  5DEQ A;  2HYF A;  3KZ9 A;  2DA6 A;  2Q1Z B;  3CUO A;  5KCM A;  1S3J A;  4FCY A;  1WRJ A;  1H89 C;  2UXO A;  4IRV A;  2HZD A;  3DTK A;  5E3L A;  2D1V A;  2FBH A;  3RKY A;  2UWM A;  4EGZ A;  3M3Y J;  3LFK A;  4BS9 A;  5CVI A;  1EH7 A;  3OYK A;  4LLG F;  1TWF J;  2R5Y A;  4M3D A;  1UAA A;  2ZCN A;  2I5U A;  2NP3 A;  2LBF B;  2WWY A;  4ZDL A;  1R71 A;  3BNI A;  3HOZ J;  4OAZ A;  1T0F A;  4S04 A;  3FXM A;  5EEG A;  3LJL A;  5KVR A;  3M8J A;  4KWA A;  2GM4 A;  1IN8 A;  2AXL A;  4ZTJ A;  3FX3 A;  1T95 A;  4I76 A;  4NB5 A;  3GO5 A;  4ACI A;  1MBE A;  2LK2 A;  1DQU A;  3HSF A;  1HC8 A;  2XKO A;  3IUV A;  2FBK A;  1KGS A;  1HW5 A;  2XB5 A;  3MVP A;  4HLY A;  1XC5 A;  4IRH A;  3W6J B;  4CYD A;  3S32 A;  2LR8 A;  2V9K A;  1X19 A;  4RGS A;  4L18 B;  5HS9 A;  6PAX A;  3RTR A;  2FXA A;  1MBK A;  1B72 B;  3H5R A;  2A6E F;  3IP4 B;  3N4M A;  2M0M A;  3CDI A;  2B63 J;  2DFH A;  5EGO A;  1LPQ A;  2P81 A;  3EUH A;  4LIT A;  2Q8K A;  2RHA A;  2MAB A;  1LDJ A;  1IXR C;  1MKM A;  3HSR A;  5FRO A;  4DYC A;  4C2M J;  5M5W J;  4XL9 A;  4ESB A;  5B3S H;  3DPT A;  2ZB9 A;  1OYI A;  2DDB A;  4RLF A;  2QA4 I;  3RSN A;  1ZG5 A;  2BYV E;  2CQK A;  2Y69 H;  3CRJ A;  3GEU A;  2PG4 A;  5J6X A;  1TNS A;  4XQF A;  4HX8 A;  3HE0 A;  1HKT A;  4LK0 F;  5TJJ A;  1GVD A;  1EJ9 A;  1BI0 A;  1K6O A;  4L9T A;  1VFC A;  2A2F X;  2Y31 A;  4XBF A;  4M6Y A;  3LL7 A;  2PJP A;  2O5R A;  4HAM A;  3HGG A;  3G7R A;  4LJZ F;  2RNJ A;  2VL8 A;  3L2R A;  5C4Y A;  1BR1 A;  3LWJ A;  3GZ5 A;  4MFE A;  2NNY A;  3G1L A;  2GIV A;  3VYR B;  1MNM C;  1LQ1 A;  4G6T B;  4RM2 A;  3FIS A;  5E8G A;  2VQL A;  2XF7 A;  3O8H A;  1EH8 A;  5M5X J;  4YFN F;  3PL8 A;  3T1B A;  4EJT A;  3L2V A;  2DT5 A;  1YW7 A;  5IOZ A;  2J5P A;  4XKB A;  1YOV B;  3SDB A;  3HOW J;  4YIF A;  3V8K A;  2OBP A;  2OV7 A;  4IHY A;  3KPH A;  4M72 A;  2BV6 A;  2M7A A;  2RVC A;  1YLF A;  2IVM A;  1LJ9 A;  1O57 A;  2ID3 A;  2ESN A;  4NC6 A;  3S3O A;  3T5X A;  2BOL A;  4MEX F;  2OER A;  2AXT C;  3KKC A;  2KQR A;  2QYO A;  5K7Z A;  3OSF A;  4MO7 A;  2O0Y A;  3TP3 A;  2ZCW A;  2X6O A;  2WB1 A;  1ACI A;  4U88 A;  2VT2 A;  4NHJ A;  3J80 Z;  1MMS A;  4NN1 A;  3CMM A;  1HW2 A;  5A2Q Z;  4HDV A;  2K4J A;  2CQN A;  1JE8 A;  3VOK A;  3Q0W A;  4PSX A;  3BJB A;  2W4S A;  2R5Y B;  3KEO A;  2ICW G;  5EJC A;  3ZXS A;  4C9Y A;  1Z05 A;  2UXU A;  4N9H A;  3TMO A;  1QPM A;  2XAQ A;  3WGH A;  3KEY A;  3JRC A;  4F92 B;  1BC7 C;  2D6Y A;  3FBI B;  1UEL B;  4GCL A;  4KN7 X;  2AQF A;  3HOS A;  3CWR A;  1UHW A;  3MKW B;  2JA7 J;  3RZO J;  1FSH A;  1HW1 A;  2K27 A;  2EFN A;  2KJC A;  3RI4 A;  2QTQ A;  4ZDP A;  1ZLJ A;  4WXC A;  4AU7 A;  1RRJ A;  1G4D A;  3EGQ A;  3MD2 A;  1OCR H;  1P6R A;  1SD5 A;  2FOK A;  4B8X A;  4I01 A;  3Q3S A;  3A4C A;  1F4K A;  2QGU A;  1UCR A;  3D5L A;  4DJA A;  3IRR A;  1LUJ B;  2P7V B;  3F0C A;  4AVP A;  2JA8 J;  2E71 A;  1MMA A;  2O3F A;  5ILV A;  3CLO A;  1JKP C;  3E6B A;  3KP6 A;  5EGO B;  2LG4 A;  3R60 A;  2QQB A;  3KKD A;  2VQC A;  3NEU A;  1W0U A;  4RDU A;  3KP4 A;  2R7S A;  3QYB A;  3WGI A;  1ETW A;  5CJ9 A;  2HPI A;  3CJT B;  4MXM A;  3K1N A;  3ABL H;  2F5E A;  3JRH A;  4LIU A;  4HQM A;  2EV0 A;  3DTE A;  3IUO A;  3PFY A;  3GBG A;  3HGY A;  2BVL A;  4FIS A;  3S2H J;  2LF8 A;  2HXO A;  2MC3 A;  4Z2Y A;  2E5N A;  2IA2 A;  2Y48 A;  4QPO A;  4R8H A;  1VQ4 I;  1E3P A;  2RRE A;  1RUN A;  2DK8 A;  2ZBK A;  1ZN2 A;  3FWE A;  3HTJ A;  3PIO F;  4Q48 A;  1XMK A;  4ZYD A;  1U5T A;  3J81 Z;  2CUJ A;  4GRI A;  2VLA A;  1N75 A;  2R0Q C;  2FMY A;  3HOV J;  3MKY B;  2P7C B;  3V6G A;  3BPX A;  3I5U A;  4HG2 A;  2PI0 A;  3V7C A;  2RKH A;  3BTL A;  2ZC2 A;  2AQE A;  4HKU A;  3WU0 A;  1LEB A;  3G56 A;  3D0S A;  4XN3 A;  2FNA A;  3FM3 A;  4FET A;  1BOA A;  2GAU A;  5GAG J;  5GAD J;  5H6Q A;  5CQE A;  4GYI A;  1RI7 A;  1XDU A;  4ENK A;  2CUF A;  1I6X A;  2BY0 A;  4IQJ A;  3SYT A;  4AM3 A;  1TQP A;  1Y1V J;  3R4K A;  5LGT A;  4EM0 B;  3VOD A;  4HA8 A;  1KYW A;  4ENJ A;  1YTY A;  3DBR B;  2R7V A;  1U8B A;  1MBF A;  1W7P B;  2NS7 A;  2XIG A;  1MBG A;  3LSI A;  3Q9S A;  2VPL A;  3BZK A;  3QPH A;  3HOU J;  2KRF A;  2IXS A;  3ZQF A;  3IH2 A;  4A3E J;  2DMT A;  4H4K C;  3B02 A;  2XB0 X;  2F5D A;  4XRF A;  4OWR B;  2WY7 Q;  2H8W A;  4M74 A;  2MLK A;  1H8A C;  2XUB A;  5D6E A;  1YRN A;  2PFV A;  5JLW A;  1DPR A;  3JTG A;  3RZD J;  4HW0 A;  2PMZ A;  1S5L C;  2WV0 A;  3VDX A;  3ZQ7 A;  4IL6 C;  1J75 A;  2OCE A;  3BZC A;  3VB2 A;  2DOE A;  1MDM A;  2J5O A;  2O9L A;  1O3S A;  4PJ0 C;  4DZJ A;  2MFZ A;  1ZK8 A;  4P55 A;  3EYI A;  2HGC A;  3F6O A;  4EJO A;  1WI9 A;  2LFB A;  1WHU A;  2OZU A;  4MQ9 F;  3S2W A;  1IJW C;  4C3J J;  3M7G A;  2CW0 F;  4A5M A;  4J01 A;  2COB A;  1REP C;  2GBY A;  2H1K A;  3IRQ A;  2YVH A;  4Y52 J;  3ZQL A;  5IYB J;  2NS8 A;  2L7M P;  3DU5 A;  2JVG A;  2V1X A;  5H20 A;  1IZ1 A;  4A3G J;  1QRY A;  1BC8 C;  1SGM A;  2E1M B;  4ZC3 A;  4CCM A;  2HEO A;  2K40 A;  1WPK A;  4QPQ A;  2K3F A;  4AYB N;  4A0Y A;  3CZ6 A;  1PYV A;  2EIK H;  2KZV A;  1FBU A;  3M1E A;  3LSJ A;  1QU3 A;  5KAI C;  4U87 A;  3FBN B;  2HYG D;  1KQ9 A;  1JKQ C;  2LVS A;  4FE4 A;  5TRD A;  2LH9 A;  1YIJ I;  2M45 A;  1Z9C A;  2ZJ2 A;  3IKT A;  4JP0 A;  1ETK A;  3CUQ C;  1U5T B;  2NNN A;  3OYA A;  2RV8 A;  4C3I J;  2NX4 A;  5F6F A;  3K2A A;  3WHC A;  1GV2 A;  3IWF A;  1RR8 C;  1HLV A;  2QQ8 A;  3IWZ A;  3I4N J;  2E2I J;  1SVO A;  1F43 A;  4I99 C;  1ETQ A;  4ENN A;  3I53 A;  3OYL A;  2EZH A;  1LB2 A;  5HS7 A;  2DAO A;  2Y0M A;  1VQM I;  1I50 J;  3TGN A;  1APL C;  1DDN A;  1A5J A;  4QIW N;  2X9D A;  3WHB A;  4J19 A;  2UXH A;  1ZRC A;  5ICE A;  2JSC A;  2NVY J;  4ASN A;  3C2B A;  4F52 A;  4EGY A;  3PQK A;  1R7J A;  2JWT A;  1OR7 A;  3ABU A;  2L7Z A;  2QEX I;  1YYV A;  4MTD A;  3CO6 C;  1I3A A;  1I39 A;  3T8R A;  2QM3 A;  1B59 A;  2DU9 A;  2IRF G;  1E0E A;  2W7N A;  1FMV A;  3EET A;  4HZF A;  4F3Q A;  4NDL A;  3L09 A;  4PK4 A;  1IAW A;  3MFK A;  3F21 A;  1J2X A;  4IHX A;  1ETX A;  2XF5 A;  4QLC U;  3QAH A;  2V1D A;  4V2G A;  3E1S A;  4M3E A;  3TKY A;  3L1P A;  3LQQ A;  4KIG A;  5CYV A;  1W0T A;  1UMQ A;  3TQN A;  2EA2 A;  3AG4 H;  3KP2 A;  2IGN A;  5DCF A;  4EV0 A;  3DQV C;  1YRN B;  2DPU A;  4XOR A;  1FOX A;  4MNU A;  4A6D A;  1DGR M;  5B66 C;  4HDU A;  3I4P A;  2CW8 A;  2F4O B;  4PJJ A;  1ONV A;  1MDM B;  3FMQ A;  3CCE I;  4BE2 A;  2D2W A;  5E18 F;  3CP8 A;  1YIT I;  2VBZ A;  2BXZ A;  2R3S A;  4OD4 A;  3F8F A;  3ZPL A;  3L2W A;  3F8M A;  2XDN A;  4BHB A;  1XN7 A;  2A5Y B;  1U9N A;  2M30 A;  5LHI A;  3I71 A;  1O3R A;  2L7F P;  2W82 A;  3G3Z A;  3NPI A;  3Q9V A;  2IJL A;  1WJA A;  3ZOB A;  2ACJ A;  2ELJ A;  4OAY A;  2L4M A;  4BJT A;  2JK3 A;  5D6F A;  4XKV A;  1UB9 A;  2WAQ A;  1SEU A;  3S5R A;  2ECC A;  4RB2 C;  3JRD A;  1PUF A;  2ZXJ A;  4E7K A;  2JA2 A;  1B4A A;  2V7F A;  3BLY A;  5D5U B;  1AHD P;  5ILS A;  2WBM A;  2OI8 A;  1JTX A;  3ROU A;  3CCS I;  1Z3Y A;  2XV4 S;  3DPU A;  2BEO A;  2H8R A;  1EV7 A;  5LRR A;  1E2X A;  1ETO A;  1YG2 A;  3DXJ F;  1GV5 A;  2LRD A;  2GA1 A;  3ASN H;  2X85 A;  2L01 A;  3PJR A;  5CLS A;  1Y8R B;  4GCV A;  2LD5 A;  2AO9 A;  2XAF A;  2RQP A;  2KP6 A;  1XCB A;  1SFU A;  2KIU A;  1CQT A;  1BR4 A;  4UB8 C;  3HBL A;  1KU3 A;  3PPB A;  3BTI A;  3BR6 A;  1ZG3 A;  2HYJ A;  3FXL A;  1FX7 A;  4CZZ A;  1D0X A;  3L2C A;  1FYK A;  4U9L A;  1G3W A;  3M1C A;  3RJP A;  2W48 A;  2CYY A;  3KP3 A;  2Y9Z A;  4PFP A;  4XK4 A;  5HS8 A;  4Q4Z F;  1ZR4 A;  1P92 A;  4DOZ A;  3F6V A;  4JK1 X;  4II3 A;  2JQ7 A;  4C30 A;  5ERI A;  3VIB A;  3J7Z I;  3SWH A;  2DXI A;  4IVN A;  2STW A;  3C1D A;  4MIM A;  1BIB A;  3DPJ A;  3AFH A;  3HC7 A;  1ORK A;  3GEZ A;  5EZG A;  3BQZ A;  1ZLK A;  1ETV A;  2ISZ A;  4FT8 A;  5J47 A;  1UHS A;  5DUI A;  1TBX A;  5CQG A;  1R36 A;  1VZ0 A;  1G59 A;  1P4A A;  1WKM A;  3RKQ A;  4PZJ A;  1IF1 A;  3CJR B;  1PDN C;  4JX4 A;  4OU0 A;  5GPA A;  1UI5 A;  4UY8 I;  1Y56 A;  4BBR J;  3GCM A;  2EH3 A;  3I55 I;  2V57 A;  4HNV A;  4ZH4 F;  3JCU C;  1JHH A;  2PFB A;  5GAH J;  2OTL I;  3ANG A;  1U0J A;  1ITY A;  4UHT A;  1HCR A;  1BW6 A;  2JVH A;  2FEZ A;  3KIO A;  2BW3 A;  4G8X A;  3TDZ C;  3DEW A;  2NYX A;  2PMH A;  2R7D A;  4CCL A;  1OIS A;  3BG6 A;  3G6E I;  3QPT A;  4UDS A;  2Y0S N;  1LEA A;  3N97 A;  3T8T A;  1VQ9 I;  3CES A;  1J5Y A;  3RPU D;  2Q2E A;  3CTA A;  5DYM A;  5FO5 A;  3HKZ A;  2W57 A;  4CUG A;  2E60 A;  1ZG1 A;  1YS7 A;  4GDF A;  3MMY B;  3KYC B;  2EQR A;  2CS3 A;  2ELH A;  3BZ6 A;  3VPR A;  3A0B C;  1Y0U A;  3TW7 A;  3VSK A;  2M7B A;  4B43 A;  1SVM A;  4WX9 A;  3HOX J;  1H9G A;  4DQ2 A;  1T38 A;  3W2W A;  1EKE A;  5DM7 F;  4IEJ A;  5HSZ A;  4EJV A;  5FKL A;  3GTM J;  3HIF A;  4HSR A;  4XSX F;  3E7Q A;  4MK6 A;  4M3G A;  5K5O A;  5DCM A;  3UR3 C;  1S29 A;  2XRL A;  5FKM A;  2WC2 A;  4EM1 A;  3W3C A;  3K4K A;  1PUF B;  4EJW A;  2BHZ A;  4IXA A;  1T56 A;  3LQR A;  4NC7 A;  4JX6 A;  5E1W A;  2VKD A;  1FT9 A;  1B8I A;  5DV5 A;  2V26 A;  1J09 A;  4BXU A;  3K4B A;  5IY5 H;  4BAY A;  5IP7 J;  4BL0 B;  2FRH A;  1X2M A;  3LA3 A;  4BQQ A;  1K4S A;  3MCZ A;  2IW5 A;  3BQY A;  4HX4 A;  1QGP A;  1SFK A;  2WA0 A;  1WJC A;  2HDW A;  3I58 A;  2K7L A;  1VQL I;  5FLV A;  4B1R A;  3AQT A;  1TWA J;  2JJ7 A;  3FZV A;  1RPW A;  2X6X A;  4ANJ A;  2JRT A;  2DTZ A;  2VBW A;  4NEL A;  2ZXH A;  2Q0O A;  3CF2 A;  1OCO H;  4E70 A;  3VFZ A;  5HDN A;  3CC7 I;  3RKX A;  4DIQ A;  1MJA A;  5HLI A;  5AQC A;  1FMW A;  2JTV A;  2R92 J;  3KZI C;  5E3O A;  3PM1 A;  2IGO A;  3E6C C;  4PUS A;  4CCN A;  5ICC A;  3E6D A;  3DPL C;  2R5Z A;  4ZYG A;  1KA8 A;  4ZTF A;  1R1T A;  4DYQ A;  1SD6 A;  1R5I D;  2DN0 A;  1SC7 A;  3KLN A;  4KIS A;  2X1C A;  4BKX A;  3WGG A;  5HNF A;  3DLA A;  2ECB A;  1K6Y A;  3BWG A;  2ZCX A;  3C07 A;  1OMI A;  3LAP A;  4BQO A;  2YSR A;  3NAU A;  1Z1D A;  3RQI A;  3CQZ J;  5KNL A;  2OUM A;  1WJD A;  2V1N A;  1F36 A;  2GZW A;  4L0Z B;  1B1B A;  2HZT A;  2LSO A;  3VYS B;  4JBA A;  1A36 A;  1N25 A;  3I54 A;  2DPD A;  5CXI A;  1O7L A;  4DGW B;  3TO9 A;  2HXI A;  3HTH A;  1JI8 A;  2QSG X;  1T6S A;  4IZZ A;  4IRI A;  4CYC A;  2NOJ B;  3ISP A;  2UXP A;  2Z16 A;  1IN7 A;  2CFX A;  4LD5 A;  4PDK A;  5CW8 A;  3VTI A;  4OD5 A;  2WUI A;  4B47 A;  2Y30 A;  1WGX A;  3H1C A;  1S7E A;  3LSP A;  3JAM K;  1OQY A;  3K10 A;  4E7J A;  3WU1 B;  1S8N A;  2F5V A;  3OOU A;  1USS A;  3BG5 A;  2VBY A;  3E97 A;  3JRE A;  2BW3 B;  2EFQ A;  3GTG J;  4RGU A;  1ERD A;  2K9M A;  1YQA A;  1H0M A;  3DLL F;  4XRM A;  2LLK A;  2QF7 A;  2KIM A;  1TQI A;  4YFK F;  3OYD A;  1A6Q A;  2JRM A;  2LF7 A;  4ZDO A;  2Q2E B;  2EIM H;  2ZME A;  4M9Z A;  1YX5 A;  2Y2Z A;  3TDU C;  4ESF A;  4RM3 A;  1STZ A;  3DKW A;  2A6T A;  2Z1D A;  1MW7 A;  3B73 A;  4I7H A;  4BAC A;  3E3V A;  4G94 A;  4UXN A;  2IGM A;  4M71 A;  2UV1 A;  1X1D A;  3D1N I;  1T39 A;  3E7L A;  4F91 B;  1K7A A;  3R6S A;  1FSE A;  5DCM B;  3BP8 A;  1T8I A;  3FXO A;  3CCL I;  3U21 A;  4C2T A;  2YX7 A;  3J7Y J;  1AKH A;  1HOM A;  2HYT A;  3F9K A;  1AU7 A;  2M3A A;  2JT1 A;  4MQV A;  1UJ8 A;  5GTI C;  5J8C A;  2E7W A;  1B8I B;  3AKZ A;  3GUD A;  4Q47 A;  2EBI A;  1FTZ A;  1P9Q C;  1VQ7 I;  3RPU A;  2EJR A;  4HRI A;  5DD8 A;  2B9S A;  3PSF A;  4A5N A;  3PSI A;  1T0F C;  2Y9Y A;  3FHN A;  4JQF A;  5J8F A;  5L3E A;  1Y6I A;  1KU7 A;  3HHG A;  2DA3 A;  4I2O A;  4M3B A;  2MA3 A;  4HQE A;  3TO6 A;  3A2K A;  2IGK A;  3QP6 A;  2IPQ X;  2ZJP F;  1IV6 A;  2G3B A;  3HXL A;  3ZN1 A;  3RPQ A;  5BQT A;  2L2O A;  4LFU A;  4AWX B;  4FHT A;  1WVR A;  4XIC A;  2LTP A;  3VVZ A;  5CPR B;  4JX5 A;  2EA4 A;  3K70 C;  3S1M J;  1TW2 A;  5HDG A;  1FJL A;  4CCO A;  3LA7 A;  4RGX A;  4RS8 A;  2CRG A;  3OIQ A;  1S6L A;  2EFO A;  2R5Z B;  3IV5 A;  3SFI A;  3OIO A;  5FLX K;  2WAE A;  2VUM J;  4L9N A;  2JSP A;  2M87 A;  3K4J A;  3KZY A;  3EUH C;  2HVS A;  1QZZ A;  1E3H A;  2JMW A;  4EVI A;  4V2F A;  2V4J C;  1OCC H;  5F0H A;  3V8L A;  4II2 A;  4Y33 A;  1VQ6 I;  1KON A;  4IPA A;  1IN6 A;  1IRX A;  1ZEL A;  3F8N A;  1IN5 A;  1LNW A;  2OA4 A;  2P6T A;  4KIB A;  4R1H A;  5K5Q A;  3K4M A;  5J4Y A;  4MHG A;  3GZN B;  3I9V 2;  1R4N B;  4CYC B;  1BI3 A;  2VXD A;  3SQN A;  1J7K A;  1YFH A;  5JVG F;  1LVA A;  3CDL A;  4YFX F;  1JUP A;  2PLY A;  1UG2 A;  4BQA A;  4EQQ A;  1MMG A;  1FOK A;  3NRG A;  2YS9 A;  2LC2 A;  3WG7 H;  1SAN A;  3R61 A;  2DT7 B;  3C7J A;  4HX7 A;  4GFK A;  2EK5 A;  4DZP A;  4ZZD A;  3OYN A;  5E8I A;  5F27 A;  1HF0 A;  3HTS B;  1TL8 A;  5CVR A;  3HPH A;  3ULQ B;  1QVU A;  2YVE A;  1P4W A;  2DG8 A;  3H3Z A;  2M5W A;  1HXD A;  1X2N A;  2XAU A;  1N77 A;  4Y3O A;  2ZME B;  4F93 B;  3HIM A;  2H6C A;  5FLM J;  4IHS A;  2VN2 A;  1U2W A;  3ANP A;  3OYJ A;  1D8J A;  2O7T A;  2GEN A;  2OJE D;  3WE2 A;  1ZGA A;  3E5U A;  3IAS 2;  4F55 A;  3P9I A;  4QSH A;  4LB6 B;  1FOW A;  1BA5 A;  4BDY A;  2VB6 A;  3CCV I;  3S1N J;  1BM9 A;  1MGT A;  3C18 A;  3DV8 A;  5DD4 A;  2FML A;  3BCA A;  1ZRE A;  3PIP F;  2EZK A;  1I27 A;  3ESW B;  3KLO A;  2FQ3 A;  5CVU A;  2IBD A;  1AKH B;  3COL A;  1IXS B;  2RNG A;  3SEZ A;  4Y13 A;  4W97 A;  3K8P C;  3HG9 A;  1DGW Y;  3LHQ A;  3WU2 C;  2E19 A;  2CUZ A;  1D1A A;  5KK1 A;  4XRS G;  5LGU A;  3G71 I;  3F3X A;  3BJO A;  3U2R A;  3RD3 A;  4BY1 J;  2O8K A;  3NXC A;  2DQL A;  2EFW A;  4XRS A;  1RC9 A;  3ELK A;  5L3F A;  3SEQ A;  1Z7L A;  1LFB A;  3JR9 A;  5L3G A;  3BRU A;  3M07 A;  2VIX A;  2MGQ A;  4CA0 A;  2JN6 A;  3H35 A;  4A3C J;  1ZQ3 P;  2QSH X;  2VE8 A;  4HF1 A;  5FFX A;  2P8T A;  1JTY A;  3J81 K;  4ZYE A;  3CMY A;  2I8D A;  5K1Y A;  2K9N A;  4L5J A;  2DO7 A;  2XAH A;  2H94 A;  4A3M J;  4AC6 A;  3K69 A;  2O61 A;  1F9N A;  2Y75 A;  1KZH A;  3MWM A;  1XSD A;  3GX4 X;  2G7S A;  3ZN0 A;  3T6N A;  1IXC A;  3KE2 A;  1Y8Q B;  4MEY F;  3FXJ A;  2A05 A;  2HQR A;  1VTN C;  3O60 A;  2DFI A;  3BR1 A;  3REO A;  1NK3 P;  2QIB A;  2XDV A;  1Q1H A;  1VQ8 I;  4XOT A;  5JI6 A;  1XG1 A;  4XON A;  3FXK A;  3K6G A;  2QBY A;  2E1M C;  4IHT A;  2QUF A;  1XGM A;  2NVQ J;  3KNW A;  1FLI A;  2DMU A;  1WJB A;  3DBH B;  4WF2 A;  3ECO A;  4UVA A;  2RDP A;  2WAD A;  3AG3 H;  3ZMD A;  5J3L A;  3E0J B;  3LFU A;  5IT9 K;  4NUB A;  4KN4 X;  2LNB A;  3LSK A;  2IA1 A;  4BE1 A;  2W24 A;  3B6C A;  1F1Z A;  2VQG A;  2ZFU A;  3GW2 A;  5D5W B;  3VW1 A;  5EZH A;  1POG A;  1S9H A;  2XGX A;  1DPU A;  1RES A;  5HOD A;  4I98 B;  4LOC A;  5HBU A;  5FGL A;  1U5T C;  1R9T J;  1J59 A;  3M4O J;  3GFJ A;  2L5Q A;  3CCQ I;  4BDZ A;  2IS2 A;  5J1U A;  3OL3 A;  2P5V A;  1WH5 A;  2O7O A;  2V9P A;  2X6Y A;  4WXD A;  2R7W A;  2ZSH B;  4AD9 A;  4B3A A;  4ETS A;  1MBJ A;  3FM5 A;  1IG7 A;  4HEA 2;  4WXH A;  5EEA A;  3MNL A;  2K3P A;  3DP7 A;  1QPI A;  3PO2 J;  1XGO A;  5H2F C;  3CCY A;  3TO7 A;  5ICG A;  1NK2 P;  4O6J A;  2EZL A;  5GP9 A;  2FQ4 A;  2W84 A;  5FKK A;  3I0T A;  2PMU A;  3E5X A;  2CW7 A;  4F7Z A;  3LSG A;  3J7A Y;  4DBQ A;  3FXR A;  3BG9 A;  5BNG A;  4CXF A;  1BI2 A;  2L9V A;  2AHQ A;  1MJ9 A;  5D4R A;  2MLG A;  2ZNY A;  3DEE A;  4K2E A;  1B9M A;  3A03 A;  2IT0 A;  2G9W A;  2KKO A;  1T98 A;  2X6W A;  1YJ9 I;  4P9U A;  2HVR A;  2R7F A;  4FTH A;  2Z99 A;  3X2Q H;  4D1Q A;  3I3L A;  3JRB A;  1DP3 A;  2DA1 A;  2NVX J;  2HQ5 A;  5F1J A;  3U1D A;  4HST A;  2I10 A;  4MGR A;  5J1R A;  1X4P A;  2A69 F;  2EIN H;  4BHC A;  3HUG A;  3B81 A;  4A0X A;  4KMF A;  2GXB A;  4YZE A;  1LKX A;  2ZJR F;  2FF4 A;  3L9F A;  1K61 A;  1D0Y A;  4IOC F;  2OCC H;  5M3M J;  5AIQ A;  4UVC A;  1FTT A;  4ENM A;  1X1A A;  3RYR A;  3K4N A;  4M6V A;  1IDY A;  2W1O A;  3CDH A;  4G6D A;  3S17 J;  4IX7 A;  4MTE A;  5H9T A;  3HOY J;  4QWQ A;  3P7N A;  4M6X A;  1HA8 A;  1V4R A;  3GWZ A;  1EA3 A;  1R49 A;  1IV8 A;  1XPX A;  1D5Y A;  1XD7 A;  4KFC A;  1OJL A;  2JUC A;  2VXZ A;  3ZGK A;  1W36 C;  4XLA A;  5EDN A;  3S1R J;  1ON2 A;  3QBM A;  1NH3 A;  1O4X A;  4RAY A;  1VQP I;  1RKT A;  2L3D A;  1MIJ A;  2GFN A;  3C3W A;  4E7I A;  4NNJ A;  3OYH A;  2H27 A;  4UNO A;  2LP0 A;  1OFC X;  3SHF A;  5EFY A;  1NHA A;  1V54 H;  3BT9 A;  2QCO A;  2IAI A;  1FEX A;  2XKP A;  2R7U A;  3V8J A;  3VVX A;  2MD0 A;  2QBY B;  1PJR A;  1N78 A;  3LSM A;  1D0Z A;  4BQN A;  3BC8 A;  1Q1V A;  4I02 A;  5KAF C;  2PJR A;  4LIV A;  3PAS A;  2EZI A;  2M1B A;  2DT6 A;  1Z3X A;  4P5O A;  4CCK A;  1JKR C;  4OMZ A;  1G2H A;  3BHQ A;  1QZY A;  2M4K A;  3DFG A;  5F0C A;  3HTU A;  5LHG A;  2CH0 A;  3FHZ A;  1KYZ A;  1QHH D;  2L7K A;  3V42 A;  5GTH C;  2VKH A;  1AA7 A;  2KDO A;  3FK6 A;  3P9K A;  1W4M A;  1WSU A;  3KCC A;  2X0L A;  2CSO A;  3V7R A;  4BJ5 C;  1RUO A;  1J0R A;  4U0Y A;  3KEQ A;  3VUQ A;  1R5G A;  3OR2 C;  4HPQ A;  4L9V A;  1CF7 A;  1XS9 A;  2R93 J;  3VW2 A;  3K1P A;  4AIJ A;  1LDK B;  4EAT A;  3GFL A;  2KIQ A;  4HV6 A;  4CHU A;  3ZMV A;  5HVQ C;  4BH9 A;  3MEX A;  1HKQ A;  1TP4 A;  5LLQ A;  1P4X A;  2K9L A;  5HDK A;  3S3M A;  4YG2 F;  1FIA A;  1O3T A;  2Z5U A;  4JNN A;  3TW6 A;  1JJ6 C;  1Y39 A;  2ZO4 A;  4WCG A;  1W5T A;  2IS1 A;  2TCT A;  4G9Y A;  3CJD A;  4E4H A;  4OIQ F;  2MH2 A;  3N05 A;  4E7H A;  4E7S A;  5J1Y A;  1OR7 C;  1QVT A;  1LDD A;  1X4O A;  1WCM J;  2FBQ A;  3ZQC A;  4IF4 A;  5FRN A;  3ZP5 A;  4G7H F;  1ZH5 A;  1R4M B;  4EEF G;  4V19 K;  2OQG A;  4J00 A;  3KP5 A;  5CXG A;  4IJA A;  1ODD A;  2DJI A;  3HRM A;  3F1B A;  2KMU A;  2PQ8 A;  3HUG B;  1E17 A;  4PFO A;  3FIW A;  4LG3 A;  4IHW A;  1AWC A;  1FZP B;  2XAS A;  4I0B A;  1F5T A;  2FOW A;  4RMN A;  4XOP A;  4L5I A;  3JRG A;  2REK A;  4Z6Y A;  2HS5 A;  1OYY A;  2OC6 A;  3SZT A;  3GFM A;  4U9N A;  2LDU A;  3OYM A;  2V6E A;  1HST A;  4XSZ F;  1U9O A;  3VP5 A;  1WWX A;  3CJN A;  4LK1 F;  2YUS A;  3BY6 A;  4E6K G;  4KYW A;  2ZOY A;  2JA6 J;  4DVY P;  2HKU A;  2WB1 N;  5IOY A;  2F5C A;  3BTJ A;  1JT6 A;  1TTY A;  4OOI A;  2EB7 A;  2M9H A;  3RIR A;  2YVX A;  1K83 J;  1MSF C;  2XHK A;  2HTJ A;  2KPM A;  3IHU A;  5BMZ A;  5FRM A;  2DTR A;  4KIT B;  2VON A;  3MKZ A;  3CCR I;  2FUG 2;  1ZAO A;  3ECH A;  3FDY A;  2OAZ A;  2ZOZ A;  2ME0 A;  5LBQ A;  2CQQ A;  1OYW A;  3WTU C;  2G0E A;  2TRT A;  5HNH A;  1RR7 A;  1A31 A;  4OIP F;  1I3Q J;  1TZL A;  1XSV A;  4UB6 C;  4O5V A;  4G6Q A;  4X6A J;  3OSG A;  2OTJ I;  1HKS A;  5FHP A;  4DNC A;  2HOT A;  1JKO C;  3KFW X;  1O7F A;  3PNT A;  4ZZL A;  5BPI A;  2D45 A;  3EQL F;  1K4T A;  2PJR B;  4OIO F;  2M0C A;  1U8R A;  2Z2S B;  3V4G A;  2CG4 A;  3K4L A;  3WG9 A;  1QO0 D;  3DTI A;  2XAJ A;  3DF8 A;  1S7O A;  4D5C A;  5K7F A;  2R7Z J;  4N9I A;  3QYE A;  3U1K A;  3QPS A;  1KQ8 A;  2A6H F;  5D8K B;  3S15 J;  1Z7U A;  1B9N A;  3AL0 B;  4KMU X;  2GUH A;  2OQR A;  3LAJ A;  2YX4 A;  2M8E A;  4P1W A;  1BJZ A;  2DOA A;  5F08 A;  1CF7 B;  2JPB A;  2M4G A;  2K85 A;  3OYE A;  1TQM A;  3MKL A;  3OS0 A;  1TNT A;  2XRO A;  1IUF A;  1P7J A;  1ZR2 A;  1I6H J;  4UV9 A;  1ZAR A;  3PO3 J;  4FQG A;  3L2Q A;  2DOD A;  3HZJ A;  3BCB A;  1MJB A;  3S93 A;  2E2H J;  3HHH A;  5LRS A;  3AQS A;  3SDG A;  5C4J J;  4XMY A;  1YHQ I;  3VYU B;  4XLE A;  3WOD F;  2L54 A;  3AG1 H;  2KT0 A;  3D5R C;  3SFZ A;  3J7A O;  3KET A;  2CV2 A;  2CV1 A;  4A3K J;  2ZCM A;  1R58 A;  1JHF A;  1ULY A;  4BHP A;  2X1D A;  1FWZ A;  2HOA A;  3SJM A;  3BJA A;  3V78 A;  3CLQ A;  2NOG A;  3FMS A;  4JKZ A;  2E2J J;  3GZI A;  2DMP A;  3BDD A;  4YEL A;  3A1Y A;  3GFI A;  3Q5F A;  3AG2 H;  5B5E C;  2A61 A;  1YX3 A;  1R1U A;  2LMD A;  2K4B A;  3CCM I;  3OL4 A;  3PQJ A;  1IRG A;  1UI6 A;  4NC8 A;  3WTV C;  2KDZ A;  1QA6 A;  3ABM H;  1UG0 A;  4PSW A;  3FXQ A;  4ESJ A;  4A3I J;  1XMA A;  3L2U A;  5FKN A;  3TBI A;  3OY9 A;  1T33 A;  2PBX A;  3S3N A;  5IPA A;  1FNN A;  1BR2 A;  4AC0 A;  2NRA C;  3CC2 I;  1SD7 A;  3RKW A;  2K86 A;  5BPD A;  2DOF A;  3QP5 A;  2VOO A;  5HLG A;  2QZ8 A;  1BOB A;  2CU7 A;  5B1B H;  3OYB A;  4LLN A;  2ZKZ A;  3S8P A;  5K7H A;  3BOQ A;  2GOX B;  2IEK A;  1TWG J;  3E5Q A;  1P2F A;  3ERE D;  4S0H B;  4N0B A;  3G2B A;  2HFH A;  4AID A;  3JRI A;  3ZMZ A;  1W7P D;  4L9J A;  4AYB A;  3EUK L;  2PX9 A;  4OIR F;  1HBX G;  2AS5 F;  4A3D J;  3O2P E;  1MMD A;  2WGB A;  2KLO A;  3PFI A;  4R79 A;  5E1X A;  1MMN A;  2DJN A;  1FPQ A;  1GXQ A;  3CD6 I;  4YIR X;  4A3B J;  2PMZ N;  4CZC A;  1SD4 A;  3IAM 2;  3CCU I;  4PJL A;  3GTO J;  2G7U A;  4W1U A;  1OLT A;  4UUS A;  5H6R A;  2XPU A;  2W25 A;  3JSJ A;  3I64 A;  4KA4 A;  4A93 J;  2EV5 A;  2O8X A;  4HLX A;  3COA C;  3CO7 C;  4IO9 F;  5E1Z B;  3DU6 A;  4XNF A;  1W5S A;  2CUE A;  1IW7 F;  2UXX A;  2DFE A;  1R6R A;  3HDD A;  3A02 A;  1JJ8 C;  3ABK H;  2NAZ A;  3QYF A;  3CP2 A;  1PP8 F;  1X58 A;  1Y0N A;  3O8G A;  2P4W A;  1X1C A;  5IT3 A;  5GAE J;  5JR3 A;  3HB9 A;  2OPT A;  2KIF A;  2L9S A;  4DBR A;  4RB0 A;  3LSH A;  3JAM Z;  1NG6 A;  4YEJ A;  5BOX A;  2M2E A;  1SAX A;  2KHM A;  3ZMT A;  2DI3 A;  2X1E A;  3QOP A;  3PNV A;  2ELK A;  2IA0 A;  4HYE A;  4D0P A;  4XKC A;  2VT3 A;  3GXO A;  2DA4 A;  2GIZ A;  2YPR A;  2BVM A;  3C2G A;  3KYD B;  3ZQQ A;  2LKP A;  4B48 A;  3WTZ A;  4C2U A;  4A69 C;  2BY1 A;  4BY7 J;  5HOO A;  4LB5 A;  2DA5 A;  3VWB A;  4IHV A;  2VPR A;  1W5C C;  3H36 A;  3HRU A;  1Z21 A;  2UXN A;  1AOY A;  3LOC A;  2XF6 A;  2H1L A;  3M9A A;  3QPL A;  3BRO A;  5HAW A;  4Q5S F;  2V9V A;  1H9T A;  1ZTR A;  3NQO A;  4FX0 A;  1VQN I;  4I6Z A;  3DKX A;  2GWR A;  5L3B A;  3HRT A;  1FC3 A;  2FX0 A;  1WFX A;  1IDZ A;  2L9R A;  3MZY A;  3M8E A;  1ZGJ A;  4IQ4 A;  3EUP A;  3NNR A;  2H6B A;  4XN0 A;  1WJE A;  1G6N A;  1O3Q A;  1ON1 A;  1OCP A;  4XLC A;  1FP1 D;  2EIL H;  2XSJ C;  4RGR A;  3RDI A;  2G7H A;  2XC7 A;  5E17 F;  3BG3 A;  3BR5 A;  1X3Z B;  2XAG A;  3GF2 A;  3I59 A;  4KUM A;  2E1O A;  4MFD A;  4GCT A;  1IGN A;  2ZME C;  2E1C A;  5DS9 A;  3TOA A;  1S7A A;  2UUZ A;  4DW6 A;  3NWT A;  3NAR A;  2O03 A;  4GCK A;  1YW8 A;  3GTJ J;  1FIP A;  2WTE A;  3WTT C;  2FBI A;  2VE9 A;  2VOD A;  5D5V B;  3DEU A;  3LSR A;  1HDP A;  1Z6T A;  2F5F A;  3KX2 A;  3R0A A;  3KYL A;  2TDX A;  3F72 A;  3RH2 A;  2LY9 A;  3H9J A;  5AIP A;  1VF9 A;  3FKJ A;  4AF5 A;  4BJ6 C;  2YR2 A;  1FP2 A;  5KHD A;  3OR1 C;  5JHU A;  1G3Y A;  4NBQ A;  4M9X A;  2M34 A;  4HOB A;  2ID6 A;  1I5Z A;  5FLX Z;  3J80 K;  3PNY A;  3HL2 A;  4ON0 A;  5A2Q K;  2FD5 A;  4E7L A;  1LFU P;  1IC8 A;  2QOP A;  2M8G X;  1NG7 A;  5F04 A;  5ICF A;  4ICH A;  4UUS B;  1GHC A;  1S72 I;  1VQ5 I;  3ON4 A;  3G73 A;  4LLL A;  2HDC A;  5BS6 A;  2BXY A;  2Z3Y A;  2HQN A;  4OMY A;  1ENH A;  2C6Y A;  2QQA A;  5J40 A;  3GTP J;  4UVB A;  1YE9 A;  1T2K A;  2OD5 A;  2RAE A;  1W7P A;  1W36 D;  2HVQ A;  4WK8 F;  2WAQ N;  1DU6 A;  4RAZ A;  3ASO H;  2VC0 A;  2ZFW A;  2ADU A;  2D5V A;  2VJ5 A;  1A6I A;  4PJM A;  1C0W A;  5E20 A;  3GLX A;  3RYP A;  3ZQI A;  1MND A;  2QWT A;  2P5L C;  1R5H A;  2W53 A;  2NS0 A;  3QU3 A;  2V1U A;  4AUX A;  4IRG A;  2DA2 A;  5FJ8 J;  4GGG A;  4NQW A;  3EYY A;  3MQ0 A;  1WI3 A;  4CO8 A;  3K2Z A;  2HKX A;  4AIH A;  1JT0 A;  2DFF A;  2Z33 A;  2X48 A;  4A6E A;  1RNL A;  1K78 A;  1LE8 A;  2PBI A;  1QZE A;  2CFO A;  5D4S A;  2VKV A;  3VOX A;  1JUS A;  3QKX A;  1JGG A;  2HQA A;  2BBY A;  4KIF A;  3ABT A;  5GPC A;  5LD2 C;  1BBY A;  2Y0S A;  2O6G E;  4U0V A;  3F23 A;  3ZQH A;  5D19 A;  3BR0 A;  2KRC A;  5IP9 J;  4B4C A; 
#chains in the Genus database with same CATH homology
 1RKT A;  2LR8 A;  2MW8 A;  2GFN A;  3ANG A;  2LP0 A;  1OFC X;  5EFY A;  1ITY A;  2N8G A;  1MBK A;  1E3O C;  1B72 B;  3BT9 A;  1HCR A;  1BW6 A;  1Y1W J;  2QCO A;  2IAI A;  4A3F J;  1FEX A;  3DEW A;  3VVX A;  2B63 J;  5EGO A;  2XPV A;  2P81 A;  2RHA A;  3IH3 A;  1EF4 A;  4UDS A;  2Y0S N;  1Q1V A;  3PAS A;  2MG4 A;  4DYC A;  2EZI A;  4C2M J;  5M5W J;  2ZB9 A;  1JKR C;  1G2H A;  3BHQ A;  4BBS J;  2HOS A;  5F0C A;  3CRJ A;  3GEU A;  2EQR A;  3VPR A;  3HE0 A;  3TW7 A;  4M3F A;  2DA7 A;  1GVD A;  3BR2 A;  3HOX J;  1VFC A;  2Y31 A;  3FK6 A;  3HGG A;  4IEJ A;  1O4X A;  3G7R A;  5HSZ A;  5FKL A;  3GTM J;  3E7Q A;  4MK6 A;  4M3G A;  2K9Q A;  5C4Y A;  3VUQ A;  3LWJ A;  5FKM A;  2XRL A;  4MFE A;  2GLO A;  1XS9 A;  3G1L A;  3HKZ N;  1PUF B;  1MNM C;  1T56 A;  2R93 J;  3VW2 A;  4JX6 A;  3FIS A;  3O8H A;  4GFB A;  5M5X J;  1B8I A;  1HDD C;  3I4M J;  2NVT J;  2HDD A;  5D1R A;  1FIA A;  4JNN A;  3TW6 A;  1JJ6 C;  5IP7 J;  1GDT A;  5IOZ A;  1X2M A;  5E3N A;  1NTC A;  2TCT A;  3BQY A;  4C3H J;  1GUU A;  2XGD A;  3LNQ A;  3HOW J;  3CJD A;  1MSE C;  5FLV A;  4B1R A;  3AQT A;  1TWA J;  2JJ7 A;  4IHY A;  1RPW A;  1IRZ A;  5J1Y A;  5FMP A;  1QVT A;  1Z0X A;  5DAJ A;  2DTZ A;  4NEL A;  1WCM J;  2FBQ A;  3ZQC A;  2ID3 A;  2PZ9 A;  3P9T A;  4D5F A;  5AQC A;  2R92 J;  2OER A;  3KKC A;  4EEF G;  5K7Z A;  5E3O A;  3OSF A;  3PM1 A;  4MO7 A;  3TP3 A;  5CXG A;  2X6O A;  3F1B A;  1P7I A;  2R5Z A;  4NN1 A;  3A01 A;  4DYQ A;  3TP0 A;  2DN0 A;  1VND A;  3FIW A;  4IHW A;  3VOK A;  3Q0W A;  1RKW A;  3BJB A;  4BKX A;  3C07 A;  2ZCX A;  2ECB A;  2R5Y B;  2REK A;  3JRG A;  4ABZ A;  3NAU A;  3RQI A;  3CQZ J;  2UXU A;  1F36 A;  1BW5 A;  1U9O A;  4GFL A;  3VP5 A;  3Q0U A;  3JRC A;  2DMN A;  2YUS A;  1LE8 B;  5CXI A;  2D6Y A;  2ZOY A;  2JA6 J;  2HKU A;  2XSD C;  2WB1 N;  2CJJ A;  4GCL A;  1OCT C;  5IOY A;  2HXI A;  3HTH A;  3CWR A;  3BTJ A;  2JA7 J;  1JT6 A;  3RZO J;  4CYC A;  1ZGW A;  2UXP A;  2M9H A;  5CW8 A;  3VVY A;  3H0G J;  1K83 J;  2QTQ A;  1MSF C;  2WUI A;  3NI7 A;  3EGQ A;  2Y30 A;  2G7G A;  1WGX A;  3Q3S A;  1S7E A;  3LSP A;  2ME0 A;  2ZOZ A;  2CQQ A;  2IU5 A;  3F0C A;  3OOU A;  5E3M A;  2JA8 J;  2G0E A;  2TRT A;  3BG5 A;  1RR7 A;  2XGE A;  3JRE A;  3GTG J;  3HTA A;  1I3Q J;  3BTC A;  1JKP C;  4X6A J;  5IYC J;  5EGO B;  3OSG A;  4XRM A;  2LLK A;  1SFO J;  2QF7 A;  1MH4 A;  5FHP A;  2HOT A;  1JKO C;  3KKD A;  1JUM A;  2F07 A;  1W0U A;  3S1Q J;  4RDU A;  2M0C A;  1ETW A;  4RBO A;  5K7F A;  3G1M A;  5IYD J;  2Y2Z A;  4D5C A;  4MXM A;  2R7Z J;  4UUT A;  2HI3 A;  3JRH A;  3QPS A;  3JRF A;  3S15 J;  2QKO A;  3GBG A;  3HGY A;  4FIS A;  3S2H J;  2GUH A;  3D1N I;  2HXO A;  3E7L A;  1BJZ A;  1RET A;  5EF6 A;  5F08 A;  3HTJ A;  1VI0 A;  3MKL A;  1AKH A;  1HOM A;  2DG7 A;  2HYT A;  1AU7 A;  1IUF A;  1P7J A;  4DYR A;  1ZR2 A;  1I6H J;  1B8I B;  3H3V K;  1FTZ A;  2EBI A;  4X1E A;  2R0Q C;  3PO3 J;  3HOV J;  3V6G A;  3S2D J;  5F0F A;  4A3J J;  2VI6 A;  2E2H J;  3BTL A;  3AQS A;  3SDG A;  5C4J J;  2Y9Y A;  4HKU A;  3G56 A;  2KT0 A;  2DA3 A;  3GTQ J;  4M3B A;  3DCF A;  2G3B A;  1IV6 A;  3IH4 A;  4A3K J;  2ZCM A;  2RAS A;  3G1O A;  3ON2 A;  4XIC A;  3FK7 A;  2LTP A;  3VVZ A;  4JX5 A;  2HOA A;  2CUF A;  3SJM A;  3S1M J;  4D7M A;  3V78 A;  1FJL A;  2NOG A;  4JKZ A;  2E2J J;  3HEF A;  2DMP A;  1Y1V J;  3GZI A;  2CRG A;  3W6V A;  2R5Z B;  3IV5 A;  3SFI A;  3OIO A;  2L0K A;  3A01 B;  1U8B A;  1MBF A;  1UI6 A;  2NS7 A;  4D7N A;  1MBG A;  2VUM J;  3GTL J;  2MSY A;  3HOU J;  4A3I J;  3ZQF A;  3IH2 A;  4A3E J;  5FKO A;  5FKN A;  2JMW A;  4V2F A;  2DMT A;  5DTD A;  1T33 A;  3HM5 A;  5IP6 A;  2XB0 X;  5F0H A;  2PBX A;  5IPA A;  4FE7 A;  3TED A;  1H8A C;  4AC0 A;  1BL0 A;  1YRN A;  5D18 A;  5JLW A;  4A3L J;  4CYC B;  3RZD J;  2CU7 A;  3CDL A;  1JUP A;  5K7H A;  1UG2 A;  2O9L A;  2IEK A;  4DZJ A;  1TWG J;  4CGR A;  3NRG A;  1ZK8 A;  2YS9 A;  2CQX A;  4S0H B;  1SAN A;  4PXI A;  4GFK A;  3JRI A;  4DZP A;  2LFB A;  4A3D J;  1IJW C;  5F27 A;  4C3J J;  1HF0 A;  1ETY A;  2WGB A;  2COB A;  2GBY A;  2DJN A;  2H1K A;  4A3B J;  2YVH A;  4Y52 J;  1QVU A;  2YVE A;  3ZQL A;  5IYB J;  2PMZ N;  2NS8 A;  2DG8 A;  2L7M P;  3S14 J;  1X2N A;  3GTO J;  4W1U A;  3HIM A;  4A3G J;  1QRY A;  5FLM J;  4UUS A;  1SGM A;  2XPU A;  4JL3 A;  3ANP A;  3JSJ A;  2DMQ A;  4A93 J;  2K40 A;  2O7T A;  1WPK A;  2GEN A;  4AYB N;  3MN2 A;  1ZKG A;  2CUE A;  3FRQ A;  3LSJ A;  4QSH A;  3A02 A;  3HDD A;  1JJ8 C;  1BA5 A;  5EG0 A;  3S1N J;  1X58 A;  3O8G A;  4Y7N J;  1JKQ C;  2LVS A;  4FE4 A;  4BXX J;  3VW0 A;  2NP5 A;  2EZK A;  5K58 A;  3HB9 A;  2OPT A;  2UXI A;  2OF7 A;  4JP0 A;  2IBD A;  1ETK A;  1AKH B;  3COL A;  4W97 A;  3LHQ A;  2M2E A;  2LKX A;  2E19 A;  4C3I J;  1U78 A;  2NX4 A;  2XPW A;  4XRS G;  3K2A A;  3WHC A;  1GV2 A;  2ELK A;  1HLV A;  4BY1 J;  3RD3 A;  2O8K A;  3I4N J;  2E2I J;  3NXC A;  5C3E J;  4XRS A;  1F43 A;  2KDZ A;  1LFB A;  2DA4 A;  3JR9 A;  1ETQ A;  3BRU A;  2MGQ A;  2JN6 A;  4A69 C;  4BY7 J;  4L5E A;  2DA5 A;  2EZH A;  3GTK J;  4IHV A;  2VPR A;  1ZQ3 P;  4A3C J;  1TWC J;  1A5J A;  1I50 J;  1APL C;  1Z77 A;  2ME6 A;  4QIW N;  1JTY A;  2X9D A;  3LOC A;  3WHB A;  4J19 A;  2UXH A;  3QPL A;  5HAW A;  1TWH J;  1GT0 C;  3CMY A;  2NVY J;  3C2B A;  1ZTR A;  2JWT A;  2K9N A;  3FKI J;  4I6Z A;  4A3M J;  2L7Z A;  4AC6 A;  2VKE A;  2FX0 A;  1IDZ A;  2L9R A;  3B6A A;  3EUP A;  3NNR A;  4NDL A;  2G7S A;  2G7L A;  3T6N A;  1OCP A;  4IHX A;  1ETX A;  9ANT A;  2XGC A;  3O60 A;  3BR1 A;  4V2G A;  1H88 C;  3BG3 A;  3BR5 A;  1NK3 P;  2YU9 J;  5C4X J;  2QIB A;  4M3E A;  2E1O A;  4MFD A;  3L1P A;  1B72 A;  4ME9 A;  4GCT A;  1W0T A;  1IGN A;  5DS9 A;  1XG1 A;  4DW6 A;  3UKG A;  1UMQ A;  3NAR A;  3S16 J;  1YRN B;  4XID A;  2NVQ J;  3KNW A;  5C44 J;  4GCK A;  2DMU A;  3GTJ J;  1FIP A;  3LSR A;  1HDP A;  5J3L A;  3RH2 A;  3QQA A;  1DU0 A;  2LY9 A;  1VF9 A;  3B6C A;  4AF5 A;  3BR3 A;  3VW1 A;  5EZH A;  1POG A;  5M5Y J;  3K7A J;  2XDN A;  1RES A;  5HOD A;  1U9N A;  5M3F J;  4LOC A;  2L7F P;  5FGL A;  5HBU A;  1R9T J;  3NPI A;  3M4O J;  2M34 A;  2ID6 A;  3HTI A;  2WV1 A;  4JYK A;  3ZOB A;  4MLO A;  3BCG A;  5JLX A;  5J1U A;  1WH5 A;  2O7O A;  2JK3 A;  4L62 A;  1IC8 A;  2QOP A;  2FD5 A;  1LFU P;  4B3A A;  2M8G X;  1MBJ A;  2ECC A;  1IG7 A;  3JRD A;  1PUF A;  3S5R A;  2K9S A;  5F04 A;  5EEA A;  3MNL A;  1QPI A;  3PO2 J;  4ICH A;  3CCY A;  4UUS B;  1NK2 P;  1AHD P;  3JRA A;  2EZL A;  3ON4 A;  2OI8 A;  1JTX A;  1WH7 A;  2JA5 J;  5GP9 A;  2FQ4 A;  5FKK A;  2H8R A;  1ENH A;  1ETO A;  1GV5 A;  3GTP J;  3LSG A;  5EG0 B;  3BG9 A;  3Q0V A;  5BNG A;  2Q24 A;  2RAE A;  2LD5 A;  2AHQ A;  2AO9 A;  1MBH A;  1TC3 C;  1CQT A;  1DU6 A;  2WAQ N;  3HBL A;  3A03 A;  3ZQG A;  1MH3 A;  3PPB A;  2D5V A;  3BTI A;  1A6I A;  3BR6 A;  4G12 A;  5EYR A;  4FTH A;  2HYJ A;  3ZQI A;  3JRB A;  2FJ1 A;  2DA1 A;  2NVX J;  4QTR A;  2QWT A;  2HQ5 A;  5F1J A;  2I10 A;  2DA6 A;  2W48 A;  2W53 A;  4AUX A;  5J1R A;  3KZ9 A;  2Y9Z A;  4FCY A;  4XK4 A;  3B81 A;  1H89 C;  2UXO A;  5E3L A;  1ZR4 A;  4YZE A;  2DA2 A;  5FJ8 J;  3M3Y J;  1K61 A;  3VIB A;  1TWF J;  2R5Y A;  4M3D A;  2ZCN A;  1WI3 A;  5M3M J;  2NP3 A;  1JT0 A;  1FTT A;  4MIM A;  3BNI A;  3HOZ J;  3DPJ A;  2X48 A;  1IDY A;  4M6V A;  1ORK A;  3LJL A;  3S17 J;  4KWA A;  1LE8 A;  5EZG A;  3BQZ A;  2GM4 A;  1ETV A;  5H9T A;  3HOY J;  2VKV A;  1UHS A;  3VOX A;  1JUS A;  3QKX A;  1JGG A;  5GPC A;  4I76 A;  1D5Y A;  3RKQ A;  4ACI A;  1MBE A;  1OJL A;  2LK2 A;  4JX4 A;  1UI5 A;  5GPA A;  3IUV A;  5EDN A;  3ZQH A;  3S1R J;  4BBR J;  5D19 A;  2XB5 A;  2EH3 A;  3BR0 A;  3MVP A;  5IP9 J;  3QBM A;  4B4C A;  2V57 A;  1XC5 A;  4HNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...