3BTCA

Crystal structure of qacr(e57q) bound to malachite green
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIQESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btcA02
1YRNA 1YRNB 5IPAA 3FIWA 1MBFA 1GDTA 4B1RA 4D5CA 2CUFA 2LP0A 3KNWA 1FJLA 1IJWC 4AF5A 4CGRA 3FK6A 3LHQA 2EZHA 4X6AJ 3HE0A 3NXCA 1MBGA 1RESA 5EFYA 1MNMC 3VVZA 3IV5A 5J1RA 1LFBA 4DYRA 3VIBA 5FHPA 3TEDA 2JK3A 1RR7A 3RZDJ 1ZR4A 3QQAA 2X48A 5E3OA 5EGOA 5EGOB 5E3NA 2K9NA 2NS7A 1WI3A 3JRHA 2K9SA 2NOGA 1OJLA 1ZQ3P 1JTXA 4NELA 3GTQJ 5GPAA 1DU0A 2ZCNA 2DA3A 2OERA 1JKPC 5HODA 4XIDA 2COBA 4BXXJ 5JLWA 4A3CJ 1W0TA 3GZIA 5C4JJ 4XICA 2JA7J 1ORKA 4QTRA 2L7FP 3VW1A 1IV6A 3ZQHA 2VKEA 3BNIA 1BW6A 2NX4A 2M8GX 4ACIA 2XGEA 1TWCJ 2OPTA 3S16J 5IYDJ 2VPRA 1BA5A 2IU5A 2M2EA 3Q0VA 2G7LA 3Q3SA 2FX0A 3MKLA 2XGDA 4XK4A 4C3HJ 3K2AA 1SANA 2DN0A 3DEWA 3HOWJ 2XPWA 1MBEA 5EZGA 3LSPA 1X2MA 1ETOA 2L9RA 1I3QJ 3G1MA 3JRDA 2HYJA 9ANTA 1Z77A 4RBOA 4FE4A 2F07A 3Q0WA 3P9TA 2MW8A 2M34A 5D19A 3BR0A 3BTLA 2NS8A 2VUMJ 2RAEA 1Y1WJ 1OCPA 2HI3A 2PBXA 3UKGA 2R7ZJ 3NNRA 2LKXA 1H8AC 2QOPA 2OF7A 5C4XJ 3GEUA 4GFLA 5C44J 2XPVA 5IOZA 2XDNA 2E19A 3LJLA 2CRGA 1FTTA 4M3EA 2XRLA 1NTCA 5EF6A 3FRQA 2DG8A 3S14J 5M3MJ 4M3BA 2WB1N 2E2JJ 2ME0A 1JGGA 1JUSA 1F36A 1QRYA 4UUSB 3CMYA 5K7FA 1MSFC 1VFCA 4D7NA 5IP9J 3PO3J 1IDZA 2EQRA 3I4NJ 3B6CA 3JRGA 2M0CA 4D5FA 3HOUJ 2R5YA 2R5YB 2YU9J 4JKZA 2DMUA 2CQQA 4NDLA 3B81A 2PMZN 1FIPA 1ZTRA 1MBJA 3HTHA 2GBYA 4DW6A 2DG7A 5CW8A 3RQIA 1LE8A 1LE8B 2R0QC 3ZQCA 2HDDA 3NI7A 3CWRA 3BTCA 4IHXA 2GLOA 2V57A 5JLXA 1OCTC 1NK3P 1HCRA 2G3BA 2REKA 3VOKA 2FJ1A 3OIOA 1SFOJ 1JKQC 4A3JJ 1P7IA 2Y9ZA 4L5EA 3O8HA 3H0GJ 4BBRJ 1U8BA 1WCMJ 4GCTA 3BR2A 2DA4A 2XB0X 2ELKA 2DA1A 1GT0C 1FIAA 2H1KA 3VP5A 5HAWA 2QIBA 4LOCA 1ETXA 3BR1A 2ZCMA 4MO7A 4JYKA 3PM1A 3BHQA 4JX4A 2YUSA 2WAQN 5EYRA 5DS9A 5FKMA 5H9TA 3BRUA 3F1BA 3FKIJ 4G12A 2CJJA 3LSGA 5K7ZA 4A69C 2UXIA 3BG3A 5K7HA 3LSJA 2HKUA 2K40A 2YS9A 3SJMA 4MK6A 3CCYA 2GFNA 3IH2A 3TW6A 5EDNA 3ZQFA 4B3AA 4DZJA 4CYCB 4CYCA 4A3GJ 2UXUA 3CQZJ 3S15J 3RZOJ 2PZ9A 4MFDA 5FKOA 1Q1VA 2O9LA 4DZPA 1RPWA 4EEFG 4X1EA 4GFBA 4ME9A 4IHVA 3NRGA 3HGYA 2NVQJ 3C07A 1RKWA 3CDLA 2O7TA 1O4XA 2VI6A 3HOXJ 2L7MP 1H88C 2D5VA 5DAJA 4A3MJ 2Y2ZA 1ITYA 5FLVA 2DA7A 1IRZA 3VW0A 2L0KA 3IUVA 3S1NJ 4IHYA 1F43A 3EUPA 3HM5A 3MN2A 2Y9YA 3S1QJ 3BQZA 5IP7J 4J19A 2MG4A 2JWTA 3FK7A 1UG2A 3PASA 4AYBN 4JX5A 1FEXA 2UXHA 3M3YJ 1XC5A 4JL3A 2XPUA 2LTPA 4FISA 4W97A 3BTJA 5F0CA 1G2HA 1W0UA 3KKCA 3VUQA 4L62A 3RH2A 5K58A 4BY1J 5C3EJ 4DYCA 2IEKA 5BNGA 3AQSA 2G7GA 4BKXA 2JA8J 2DA6A 3OSGA 3LSRA 3JREA 1U9OA 5F08A 2X9DA 5GP9A 3BR5A 1ZGWA 2R5ZA 2R5ZB 4S0HB 5IYBJ 1P7JA 2NVTJ 4V2GA 1JJ8C 1GVDA 2R92J 3EGQA 4A3IJ 2DMTA 2KDZA 3S2HJ 3S17J 1EF4A 2LR8A 2CQXA 2Y0SN 2LVSA 3VVYA 1Z0XA 4XRSG 1HDDC 3RKQA 3H3VK 3CRJA 1IC8A 1MH4A 4C3IJ 2VKVA 2O8KA 4A3BJ 1B72A 4M3DA 1B72B 2HOSA 3JRFA 4A3FJ 3I4MJ 3HOVJ 4BBSJ 1UMQA 1IDYA 3LNQA 2FD5A 5FKNA 1B8IA 2UXOA 2XB5A 3VVXA 3S1RJ 4MIMA 3NAUA 5EZHA 3HTJA 2ID3A 5FJ8J 3HOZJ 1HF0A 3HEFA 2TRTA 1WGXA 2X6OA 4V2FA 3TP3A 1RKTA 2I10A 4BY7J 1A6IA 2ECCA 1Y1VJ 1PUFA 1GUUA 1ZK8A 2MSYA 3FISA 1A5JA 2ECBA 4AUXA 5IP6A 3COLA 1WH7A 3GTJJ 3S1MJ 3BR3A 3VW2A 3JSJA 3G1OA 4FE7A 2QTQA 2E2IJ 5C4YA 1UHSA 1T56A 5M3FJ 1MH3A 1MSEC 3OSFA 2HOTA 2ZCXA 2W53A 2WGBA 3ON4A 5FGLA 3V78A 1IG7A 5F0FA 4I6ZA 1VF9A 3VPRA 2DA5A 5D18A 1OFCX 1TWAJ 3L1PA 1JKRC 2AHQA 4XRSA 3GTGJ 2FBQA 3HTAA 2P81A 2QCOA 2RHAA 4Y52J 1JUPA 1QVUA 3ZQGA 3A02A 3HDDA 3A01A 5FKKA 3A01B 3BJBA 4RDUA 2EH3A 4MXMA 5AQCA 2G7SA 2EBIA 2OI8A 3SFIA 2GM4A 2JJ7A 5EG0A 3GTLJ 2CUEA 5EG0B 1I50J 3LOCA 4M3GA 2XSDC 1QVTA 2XGCA 1H89C 1FTZA 3ZQIA 2HYTA 1E3OC 2DJNA 5F0HA 2LD5A 3JR9A 2FQ4A 3BCGA 1BL0A 3A03A 2EZKA 5J1UA 1VI0A 2YVHA 1ETVA 4FCYA 2QWTA 3CJDA 2JMWA 1TWFJ 1R9TJ 3KZ9A 4GCLA 1UI6A 2Y30A 3MNLA 2G0EA 3ZQLA 2KT0A 3IH4A 5GPCA 4AC0A 1XS9A 5DTDA 1AU7A 3DCFA 3WHBA 2DMNA 1U78A 3ZOBA 2IAIA 4QSHA 5J1YA 2N8GA 3IH3A 3HB9A 3HOYJ 1IGNA 3G7RA 1K61A 3DPJA 3JRAA 2W48A 2HXOA 5CXGA 1TWGJ 2Q24A 2O7OA 4D7MA 2DMQA 3E7LA 2YVEA 3ON2A 3Q0UA 5EEAA 2DTZA 2DA2A 2ZB9A 3HKZN 1GV2A 2B63J 1JTYA 2E2HJ 1BJZA 1AHDP 4ICHA 3BG9A 1APLC 3G1LA 1BW5A 3S5RA 2E1OA 4W1UA 1SGMA 4UUTA 1WPKA 3GTKJ 1I6HJ 2R93J 1T33A 5M5WJ 3F0CA 2HOAA 1LFUP 3PPBA 4Y7NJ 1ZKGA 2ZOZA 3KKDA 2ID6A 4M6VA 1HOMA 3QBMA 5M5XJ 4HNVA 4MLOA 4DYQA 3OOUA 1JJ6C 1HLVA 4ABZA 4FTHA 1GV5A 3S2DJ 1S7EA 1JKOC 3O8GA 1WH5A 2D6YA 4A93J 2NP5A 1ETWA 3HIMA 1ETYA 1VNDA 3BT9A 4B4CA 2GENA 3ANGA 1AKHA 4GCKA 1AKHB 1TC3C 5E3LA 2UXPA 1RETA 3QPLA 5M5YJ 5E3MA 2JN6A 3JRCA 4HKUA 5F04A 4A3DJ 2H8RA 2CU7A 4XRMA 4YZEA 4UDSA 3C2BA 5IOYA 1DU6A 2IBDA 2NP3A 3QPSA 2LLKA 2LY9A 4I76A 2GUHA 4MFEA 2MGQA 3BR6A 1D5YA 3BG5A 2K9QA 5F27A 5F1JA 2ZOYA 4IHWA 3K7AJ 5IYCJ 3ANPA 5HBUA 1B8IB 1MBKA 5D1RA 1QPIA 3T6NA 1TWHJ 2EZLA 3QKXA 3M4OJ 4GFKA 1NK2P 4JP0A 2NVYJ 5FMPA 5CXIA 2LFBA 3G56A 4JNNA 3GTPJ 2EZIA 3TP0A 4UUSA 3D1NI 1ETKA 3W6VA 2WUIA 4C2MJ 4A3KJ 3BQYA 1X58A 2WV1A 1PUFB 4NN1A 3RD3A 4M3FA 4JX6A 2RASA 4C3JJ 1CQTA 5FKLA 3GTMJ 4IEJA 1MBHA 2AO9A 3E7QA 1JT6A 1XG1A 3NPIA 4QIWN 2HXIA 2TCTA 1K83J 1ENHA 1JUMA 2M9HA 2QF7A 3GTOJ 2LK2A 1UI5A 3B6AA 3NARA 5J3LA 3TW7A 3JRIA 2NVXJ 4PXIA 2QKOA 3HTIA 4A3LJ 3SDGA 4KWAA 1JT0A 2JA6J 2L7ZA 1ETQA 2JA5J 2HQ5A 3V6GA 3AQTA 3VOXA 1U9NA 1IUFA 4A3EJ 5HSZA 3MVPA 5FLMJ 3PO2J 2ME6A 1POGA 1HDPA 2Y31A 2DMPA 4AC6A 3HGGA 3HBLA 1X2NA 3WHCA 3O60A 3LWJA 1ZR2A 3BTIA 3JRBA 3GBGA
chains in the Genus database with same CATH superfamily
3WE3A 1RUNA 4F52A 3HPGA 4C9YA 3FIWA 2V79A 1GDTA 2P5KA 4AF5A 1X3UA 3LHQA 2EZHA 1I1GA 3ZRGA 1D1BA 1MJBA 4A12A 3NXCA 3CDIA 3GZ6A 4WCGA 2Q2EA 4QLCU 2Q2EB 3LSHA 5FRMA 1W5CC 5FHPA 3TEDA 2JK3A 1HW2A 1ZRCA 1MNDA 1ZR4A 3TO6A 1XGNA 5EGOA 5EGOB 4FX4A 3AFHA 5ICFA 4N9IA 2E60A 2RVCA 1OJLA 1JTXA 3CCEI 1T39A 5L3BA 3C7JA 5J47A 3K70C 1O3RA 5HODA 1JKPC 1WJFA 3E0JB 4IOCF 4BXXJ 2BV6A 1H9GA 2CYYA 1SEUA 3KLNA 2Z9OA 2BVLA 4CDGA 1ORKA 4XLAA 3UR3C 3J80Z 3G3ZA 3GMEA 3ZQHA 1XMXA 2VKEA 3BNIA 3V7SA 2VQHA 3M8FA 5LHHA 4ACIA 1MNEA 1ZELA 2GAUA 2OPTA 3AKZA 2CGPA 2V1UA 1XX5A 1WVRA 1BA5A 5GAGJ 2VONA 2M2EA 3RI4A 2G7LA 2AQFA 2XGDA 2Z3YA 1Z7UA 4XK4A 2GENA 4KISA 4EJUA 4IHTA 2XPWA 5D8LB 3JSPA 4OIRF 3DTIA 3LSPA 4AD9A 2XROA 2HPMA 1ETOA 2DFHA 1YX3A 1D1AA 2UXNA 4RBOA 1PDNC 2VKDA 2F07A 2W24A 3Q0WA 2M34A 4RAGA 2NVUB 4FHTA 4JOMA 2P4WA 3FXUA 3MKZA 3SEZA 4GFLA 1B59A 1Z67A 1MMDA 1N75A 3HRTA 4PJMA 2QA4I 5IOZA 4FX0A 2XDNA 4HOBA 2CV1A 3K4JA 2E19A 3CP2A 4HRIA 2W82A 2B9SA 4XSXF 4M3EA 5H2FC 3U21A 1SD6A 2F5CA 1IN5A 5EF6A 3GLLA 4FETA 1JGGA 5HVQC 1JUSA 3CMYA 3BCAA 3LFUA 2R7DA 4KFCA 2HYFA 1T98A 2CW7A 1ZGJA 2GWRA 2WAFA 4D7NA 4KMUX 1ON2A 2QZ8A 3WTVC 2EK5A 2MLGA 3B6CA 2O5RA 4D5FA 2IVMA 2R5YA 4D9JA 2R5YB 2YU9J 4NDLA 2OZUA 3NEUA 5DM6F 1AA7A 2GBYA 2F5FA 3GWZA 3BC8A 2M0MA 3N05A 2CQ7A 3KYDB 1U2WA 4CO8A 2GLOA 2B1EA 1H9TA 4OAZA 2RNJA 4KITB 2HKOA 1SAUA 2NXNB 3F8BA 3PUFA 4A3JJ 1P7IA 3O8HA 3H0GJ 1V5EA 3VYUB 2R7TA 4ZYAA 1G3TA 4UV8A 2BYVE 2VBZA 4L9NA 4EMSA 2C6YA 2HEOA 1KYZA 2L9SA 3TBIA 2XB0X 4YEJA 4XBFA 2VE9A 2DA1A 1GT0C 1FIAA 1LUJB 2IXSA 4GRIA 2X85A 5LEJA 3P9KA 1ETXA 5F64A 3V7CA 2JRMA 2P7CB 4U9LA 4JX4A 2YUSA 2ETHA 4IF4A 4KIGA 4R79A 1K7AA 2CV2A 2E1NA 3H35A 5H9TA 2H6BA 3FKIJ 2XAQA 4HZFA 3F1BA 3FM3A 2BHYA 1R22A 3KEOA 2EFOA 1PUEE 2P7VB 4L9VA 3LSJA 2HKUA 1R4NB 4M73A 3FMSA 2RDPA 2XKPA 4I02A 3SJMA 3COAC 2HU9A 4CA0A 5BPIA 4HX7A 1YJNI 2V1XA 3QYFA 3ZQFA 4A3GJ 2UXUA 4UV9A 2ESNA 2MYSA 1U8RA 4HF1A 2LC2A 1HW1A 2PZ9A 1TW3A 1Q1VA 2DO7A 3FWEA 3L2VA 1X19A 1K79A 3FXMA 2LSOA 2X4HA 4GCVA 3C07A 3CDLA 1ONVA 2BXZA 4Z6YA 3BP8A 2DODA 4PJNA 3SXYA 3OYBA 2D5VA 4LLGF 1ITYA 4KIBA 1KZHA 4L18B 1SFKA 4WXDA 2KIMA 3AAFA 1Y0NA 3HM5A 3MN2A 3PQKA 1TZLA 2Y9YA 1P4XA 2BY2A 3LWFA 3H0DA 1PJRA 2RQQA 3PASA 2NYXA 4AYBN 2ZXIA 2BHZA 1U5TB 2UXHA 1VTNC 4BHCA 1BOBA 1XC5A 4HQEA 1KU9A 5KK1A 4JL3A 3RKXA 3ESWB 3W2AA 2K02A 2HTJA 3KKCA 4AU7A 4HSTA 4CUGA 1K4SA 1SFEA 4YIFA 5K58A 4LMYA 2ZBKA 4NHJA 2IEKA 4U88A 5BNGA 3AQSA 2JA8J 2L54A 2DA6A 5B5EC 1FC3A 3KIOA 2X9DA 4X0GA 3ERED 1ZGWA 3BR5A 2MD5A 3WGIA 4G6QA 3IWFA 3OYNA 2IRFG 5IYBJ 3CMAI 3I9V2 1B6AA 4HG2A 2LKPA 3I5UA 4ZC3A 4A0YA 4BJTA 1FLIA 3DWLE 2R92J 2J5OA 2K3FA 4PSXA 2KDZA 2DOAA 4BXFA 5FD6A 5BPDA 1VQPI 5E8GA 3S3NA 4Y13A 3K4LA 1HDDC 3RKQA 4IQJA 3H3VK 3CRJA 2HQRA 3E6MA 4JBAA 1O57A 1F1ZA 4ZYHA 1VQ5I 3ERMA 2VKVA 4A3BJ 2CG4A 2YU3A 3T0YA 4ZH4F 1VZ0A 3JRFA 2OD5A 5JHUA 5FKNA 3GFIA 1R1TA 1DQUA 2VT3A 3JTGA 2KRFA 3NAUA 2D2WA 2EPFA 3BZCA 4ZYEA 1G6NA 2ID3A 5FJ8J 3HOZJ 2XUBA 1J09A 3LA7A 1N78A 1XB4A 4V2FA 3QRFF 1WFXA 2CUJA 4OMYA 3CD6I 2QYOA 5HLGA 2ECCA 3KP7A 2VPLA 2MSYA 3FISA 1A5JA 3C1DA 1T0FA 5IP6A 1WKMA 4H4KC 3G1OA 4FE7A 5H20A 2E2IJ 5C4YA 5M3FJ 1VQ8I 3RYRA 4V19K 2WGBA 4RAZA 3V78A 1QPMA 1UB9A 3M7GA 1VF9A 3C2GA 1SD5A 4PFPA 1MMSA 3EPZA 3F21A 2HQNA 4XRSA 3GTGJ 3WTWC 4UB6C 3HTAA 2QVOA 4B47A 2UZKA 1JUPA 3E97A 5DCMA 1F9NA 2ZFUA 5FKKA 5EEHA 5J6XA 1YHQI 2LF7A 4B8XA 2EBIA 2CWEA 4B09A 1YFHA 2PLYA 2GM4A 5EG0A 5EG0B 2EA2A 1QVTA 2XGCA 1JE8A 1KU7A 1R5HA 5GTHC 2LD5A 5TJJA 2COMA 3JR9A 4U9NA 1REPC 1AWCA 2EZKA 3LSKA 5L3DA 4IVNA 2YVHA 1IAWA 3CJDA 2JMWA 4FQGA 2WY7Q 2XAHA 2W00A 3HXLA 2Y30A 1D1CA 1R5GA 2G0EA 2KT0A 1HC8A 2CMPA 3IH4A 3R4KA 2BBYA 4XOTA 3PNTA 4XKBA 1Z6RA 4OAYA 2JTVA 1FMVA 5J1YA 2N8GA 3HOYJ 1IGNA 1FYLA 4CH7A 3MEXA 4E4HA 4IX7A 3DPJA 5J8CA 5CXGA 1XGSA 1M1EB 4BYYA 2O7OA 4D7MA 3ON2A 4N4OB 2CQKA 2ZB9A 3WU2C 1LVAA 4ON0A 3J7AO 1GV2A 2ZFWA 3ZMUA 5F1RA 1BJZA 2KDOA 4ICHA 4KMFA 1TT0A 1QBJA 4RB2C 1OR7A 4RLFA 2E1OA 3S5RA 3U1DA 1FBQA 1XGMA 1WHUA 3GTKJ 1E0EA 1JHHA 2ICWG 3PUBA 1FYMA 2HOAA 5LLQA 2DXIA 4Y7NJ 5ILVA 3KKDA 1ZG1A 5JR3A 2V9VA 3VYRB 2VJ4A 1HOMA 4CCJA 3S3MA 4KYWA 2O0YA 1G3WA 1QGPA 2R7XA 4FTHA 4DBRA 2ZC2A 4EJOA 2B3WA 3S2DJ 4GXOA 1X1CA 4OWRB 3CF2A 2KZGA 1C0WA 2D6YA 1ON1A 1X1PA 3ANGA 4Q4ZF 1D0XA 2UXPA 4XMYA 3OYJA 1HKSA 1SD7A 5M5YJ 3G4SI 3PQJA 5F04A 3QWLA 1V5FA 4XRMA 4F3QA 4YZEA 1KONA 3RIRA 1MD0A 5K5OA 1K6YA 3A0HC 2ZKZA 2EB7A 2MGQA 2HTSA 1D5YA 2UXXA 1YIJI 5IYCJ 3ANPA 4CZZA 1QPIA 2JVHA 2EZLA 4PUSA 1XPXA 1TQIA 2L4AA 4GFKA 2NVYJ 5FMPA 2DW4A 2XGXA 1I3AA 2JT1A 3K4BA 1VQ4I 4CICA 2A61A 3TL4X 4Q5SF 4UUSA 4G94A 4ENNA 1HA8A 4JK1X 3SHFA 3I55I 3TQNA 4M3FA 2ELJA 4JX6A 4C3JJ 2IPQX 1TNTA 2DDAA 4IEJA 1Z9CA 1IN4A 1JT6A 1MMGA 1XG1A 3CUQA 3O3KA 3NPIA 4GYGA 3FBIB 2HXIA 3QYBA 3R60A 4BJ6C 1ZRDA 1K83J 4BAYA 1CF7A 1CF7B 3ABUA 1IRXA 5E1ZB 2QF7A 3LAPA 1UI5A 3NARA 5J3LA 1XMAA 3KP6A 1DPRA 2NOJB 3G2BA 2QKOA 1ZG5A 2IGOA 3DBHB 4XORA 2JA5J 4H0EA 3AQTA 1V3FA 2DBBA 2EIKH 2A68F 4CSWA 5HSZA 4C30A 1R23A 3MVPA 5JI6A 3PO2J 1BI0A 1IO2A 1POGA 1GVJA 1LPQA 2DMPA 3HBLA 1X2NA 2YX7A 4M74A 2NAZA 1YITI 1ZR2A 3I3LA 1YRNA 3F8MA 1YRNB 5J40A 3GLXA 1GXPA 3LSTA 3I64A 1TQPA 4PFOA 2LNBA 3C2HA 2L3DA 3U9GA 3OS1A 3GF2A 1JXSA 3HOTA 4U0YA 1DUXC 1W7PB 4RB1A 1RNLA 1MBGA 4LGWA 3V4GA 3CCUI 1MNMC 3VVZA 1MMAA 1QZEA 3IV5A 1F4KA 3L2WA 1ZYRF 3LSMA 2K9MA 2OTJI 1G3SA 1V4RA 5CYVA 2KPMA 3RZDJ 3KPHA 2X48A 5E3OA 5J8FA 1MKMA 1YE9A 4OOIA 3FMQA 1ZLKA 1YOVB 1YYVA 1WI3A 3JRHA 2VQGA 4J00A 3GTQJ 1DU0A 4KICA 3FX3A 2E1MB 4GDFA 3CDHA 4XIDA 2IGKA 1W0TA 4A6EA 3GZIA 4OD5A 4F55A 1SFUA 2LRDA 1XN7A 1GHCA 2W85A 4DNCA 5B1BH 1QA6A 4BACA 3EUHC 3L2RA 2M8GX 2NX4A 3CCRI 2XGEA 1TWCJ 1BR2A 2VPRA 4PJJA 3Q0VA 3Q3SA 3VB2A 3MMYB 1Z3YA 2JUGA 2JA2A 1Z21A 2DN0A 3KZYA 3HOWJ 3GUDA 1VQ9I 1X2MA 3R0JA 1I3QJ 2EV6A 3G1MA 4B48A 2HYJA 9ANTA 1Z77A 3VYSB 2HFHA 4KN7X 1Y39A 1J75A 3K1NA 2MW8A 3IRQA 2KIQA 3BR0A 1K78A 2NS8A 4P9UA 1K78B 2RAEA 1Y1WJ 2HNHA 4ITVA 3B73A 2HI3A 1R49A 4GYIA 3REOA 2QOPA 2FXAA 1KGSA 5C4XJ 1QNTA 1X1AA 4I09A 2XPVA 1Y0UA 2Z1DA 1SMYF 1XDSA 3HSFA 4B43A 1ZLJA 1UHWA 3LJLA 3Q9VA 2CRGA 5LD2C 2IJLA 1BM9A 5DYMA 3GFJA 2DOFA 2V9KA 3DPLC 1NTCA 4LB5A 4KN4X 2LY2A 3CCJI 2DU9A 5M3MJ 2DQRA 4EQQA 5CVJA 3M1EA 2BVMA 2ME0A 2DLLA 1F36A 4I99C 1PVEA 1SC7A 4OU0A 3P9IA 2H09A 3M9AA 3I4NJ 2DT5A 4PGGA 1TBXA 4ZZLA 1X3WB 2QKMB 4AIDA 3ULQB 2DMUA 3L2QA 1ZREA 2CQQA 4U87A 1LDDA 3I4PA 4DW6A 3H9JA 2STTA 3MQ0A 3IRRA 2DG7A 2L4MA 3RQIA 2R0QC 2M4KA 3ZQCA 3NI7A 1D0ZA 4E7IA 4BQOA 3FXKA 4IO9F 2CFXA 1NK3P 4M9SA 2G3BA 4DIQA 3K9TA 3VOKA 4YELA 2V7FA 1EH8A 3LFKA 4HBLA 3WU1B 2XDVA 1FMWA 4RA2A 5ICCA 1OYWA 2JVGA 3QYEA 3DPUA 2E35A 4GCTA 4EATA 2DA4A 4ZZDA 2ELKA 2A6EF 3OWTA 2IA1A 2QIBA 1P2FA 1YX5A 3BR1A 2KMUA 4MO7A 1X1DA 2EINH 2HS5A 2D1HA 3LA3A 3CJTB 4E7HA 4ENKA 4YFKF 1XCBA 3N97A 2KRCA 4G12A 2XAJA 4AIHA 4IRVA 3LSGA 4A69C 3I54A 1DDNA 1ZARA 3K4MA 5HS7A 1B1BA 5ICGA 1WRJA 2G9WA 2YS9A 5LGNA 4XLEA 2KQRA 2GFNA 2OCCH 2A69F 2EV5A 2P5LC 4AM3A 5TGTA 4RGUA 4CYCA 4B3AA 4CYCB 2P5VA 1T2KA 4RGSA 1HKQA 1YW9A 3QOEA 1ZRFA 2FNAA 3RZOJ 5FKOA 4K2EA 3BWGA 2O9LA 4E70A 2V6CA 4BE0A 4ME9A 3NRGA 2E7XA 2NVQJ 1RKWA 3CCSI 2J5PA 2L7MP 2V6EA 1H88C 5DAJA 2HVQA 3LAJA 2Y2ZA 4XL9A 1V5GA 2F4MB 1R58A 2BY0A 5HS8A 1VQ6I 2R7OA 3TO9A 2L0KA 1YS6A 3U1KA 2LBFA 4J01A 3MZYA 1FP1D 2UV1A 2Y48A 2EWNA 3OV8A 2AXTC 4HX4A 2ZJPF 1F43A 3EUPA 3S1QJ 1SVLA 1F5TA 3BCBA 3FK7A 1OLTA 1W7PD 3KP5A 3M3YJ 3DQVC 1FSHA 3EETA 5F6FA 2XPUA 2VASA 4FISA 5F0CA 3BTJA 1G2HA 4XLPF 2ACJA 3VUQA 3H3UA 3RH2A 1W5TA 1MGTA 4YIIA 1U5TC 3KFWX 5C3EJ 2A05A 1Z1DA 4BKXA 5DEQA 1MMNA 3LSRA 3JREA 3OSGA 4N4NB 1R00A 2A2FX 5F08A 2OBPA 2EA4A 1YW8A 3CESA 2R5ZA 2QEXI 2R5ZB 5FFZA 4PK4A 2L5QA 2OC6A 4TV7A 1JJ8C 2QBYB 2QBYA 3G6EI 2IP2A 2PBIA 1SD4A 1EJ9A 3FXQA 1IV8A 4UVBA 3S17J 3KEQA 4HLXA 2LR8A 3A0BC 2VN2A 3PSIA 3V8LA 4ENMA 3OYFA 1E2XA 2P6SA 3AG3H 3BJOA 4XRSG 5GAHJ 4ASNA 3CC7I 3CLOA 2GIVA 4QWQA 4IQ4A 4M3DA 1IXCA 1YI2I 3HOVJ 2FD5A 3OIPA 3SFZA 4EJWA 4ZTFA 1B8IA 4L5IA 1LDJA 5HLHA 4P9FA 3OYCA 3S1RJ 3VVXA 1YO5C 3F9KA 2KZVA 4A0ZA 4NC8A 3EUKL 1L0OC 1KQ8A 4A6DA 1WGXA 1X4OA 1X1BA 2X6OA 2FUG2 3CP8A 2FBKA 3F72A 1RKTA 2I10A 3HKZA 2VL8A 4WX9A 4IZZA 1GUUA 2VLAA 3OYEA 2EIMH 4AYBA 2XASA 2ECBA 3EYIA 3KLOA 5DV5A 1WH7A 3S1MJ 3VW2A 1XD7A 3L7WA 3NS4A 4ZTJA 3KP3A 1MSEC 1LKXA 3MKWB 2OUMA 2E71A 3VSKA 2ZCXA 3ON4A 2W53A 2XHKA 2DAOA 3T5XA 4IKFA 4NC6A 1RIOH 3O6BB 2DA5A 3P5JA 5GTIC 1DP3A 3CCLI 3FKJA 1JKRC 4I98B 1IN8A 2FSWA 2P81A 2QCOA 4RLQA 5E20A 4Y52J 4Y3OA 3ZQGA 1D3YA 3K4NA 4EJTA 5AQCA 2X1EA 4RDUA 2G7SA 3SFIA 1O7LA 3S8PA 3LQQA 1RRJA 1MJAA 1I50J 3RYPA 3GTLJ 1LJ9A 5F0HA 3E6BA 3BCGA 2V26A 4CXFA 1R36A 2EILH 5J1UA 2QUFA 2ZSIB 3KP2A 1TWFJ 2VXZA 1MIJA 2WADA 1BOAA 1XGOA 2E5ZA 4DGWB 4GCLA 1UI6A 1YS7A 3L00A 3MNLA 3ZQLA 3HOSA 2D45A 3BROA 2W4SA 3J81K 2QQAA 4WXHA 4AC0A 3SYTA 2D1VA 1XS9A 5DTDA 1AU7A 3WHBA 2MH9A 3F6OA 4EM0B 5GADJ 1IUYA 1YW7A 2IAIA 4QSHA 4IPAA 4Q48A 3ECOA 3IH3A 2DI3A 3HB9A 2OA4A 4O6JA 4A0XA 3OOPA 3ML6A 2XF7A 3TMOA 3JTHA 3CLQA 3JRAA 2Q24A 4UB8C 2PQ8A 4PGHA 3HKZN 2H27A 1RZ4A 2E2HJ 4KA4A 1PP8F 2F48A 4NUBA 4PCQA 4ZYDA 4UVCA 3WGHA 2X51A 4KDPA 1BW5A 4XKCA 5BS6A 2XV4S 3D5SC 1T33A 5M5WJ 3F0CA 1ZKGA 1USTA 4BS9A 1DGRM 3NWSA 4FT8A 4M6VA 5M5XJ 3H9GA 5KAFC 5D5VB 3F3XA 4DYQA 1Z91A 3OOUA 2ADUA 3LMMA 3SZTA 4I0BA 3KYLA 3O8GA 1WQ2A 4MQVA 4LD5A 2R7VA 3MZHA 3QPTA 1W36D 2NP5A 3ZPLA 1VNDA 1ODDA 3BT9A 4M71A 3QPHA 3CO6C 1AKHA 1AKHB 1LNWA 2A5YB 2LDUA 1G4DA 3DPTA 1TC3C 1QZZA 1Y8QB 1IRGA 3DEUA 4LK0F 2QGUA 5E3MA 2JN6A 3JRCA 4KT6A 1FOXA 2STWA 4E7JA 4UDSA 3QPSA 2LLKA 2GUHA 4I76A 4MFEA 1FWZA 5LHIA 5F27A 2FOWA 5E1WA 2F5VA 2P0WA 5FRNA 2F2EA 4G8XA 5D1RA 5TISC 1K4TA 3QKXA 1U0JA 3HYIA 1N25A 1WJAA 1BBYA 2FA5A 4JNNA 3GTPJ 3D1NI 1ETKA 4F7ZA 3W6VA 4C2MJ 2IS4A 4A3KJ 3BQYA 2VC0A 1S72I 3W2WA 2KIUA 2HWVA 4C2UA 5FKLA 5IY5H 3E5XA 2AO9A 2XVCA 3MKYB 1J5YA 1KQ9A 1I5ZA 2TCTA 4RAFA 2Q8KA 1ENHA 2Q1ZB 2RREA 5LFAA 3CF5F 3CTAA 2GOXB 5KVRA 4B44A 1YQAA 4ESBA 4PXIA 3KETA 4F91B 1T08B 5D4RA 2DDBA 4KWAA 1XDUA 1JT0A 2JA6J 2HQ5A 3VOXA 4I0AA 1U9NA 4A3EJ 1SVOA 2QLZA 5DCMB 2H94A 4RM2A 2GXGA 2Y31A 5DUIA 3OYDA 2HDCA 3O60A 1B9MA 2M45A 2ISZA 4A2UA 5HS9A 4ETSA 5D8KB 2JRTA 1VQMI 4XLHA 3H92A 3J81Z 3QP6A 2XF6A 3TOAA 4B1RA 1IZ1A 2CUFA 2UUZA 2LP0A 3LL7A 4BHBA 2PJPA 4CGRA 2A6HF 3CMMA 4QPOA 4WXCA 5L3FA 3HRMA 2BW3A 3GYHX 3HE0A 5FO5A 1RESA 5EFYA 3L9FA 1LFBA 1AOYA 1DGWY 4Q47A 4DYRA 3VIBA 1YJ9I 2VBXA 2W7NA 1RR7A 1TLHB 5HDGA 3DBLB 3I0TA 2YR2A 1NH3A 3ZXSA 5L3CA 3P7NA 2K9NA 2NS7A 1TP4A 3OL3A 4HSRA 2K9SA 1ZQ3P 4P5OA 2VIXA 4NELA 3OYIA 2ZCNA 2DA3A 2WA0A 2OERA 4S05A 3RSNA 2HOEA 4NB5A 4U0VA 3H5NA 4XKVA 3H5AA 2I8DA 2LF8A 5JLWA 4A3CJ 1R71A 1P9QC 3PL8A 1MW7A 1FBSA 2E1MC 3DU5A 3ZQQA 3CJRB 2VJIA 2L7FP 3R6SA 4BQNA 1I1SA 3SDBA 1IN6A 4WIBA 1BW6A 2ZXJA 3DEEA 1BC8C 3S16J 2LMDA 5LRRA 2IGMA 4II2A 2HYGD 1S3JA 3J7ZI 2HPIA 3LA2A 3ZMDA 2PJRA 4C3HJ 2PJRB 2XKOA 3K10A 4WF2A 1SANA 2CW8A 4KUMA 1MBEA 2L9RA 2R4GA 3PSFA 2ZO4A 4FE4A 5HLIA 1S7AA 3HJEA 3I56I 5CPRB 2MC4A 2ISYA 3TGNA 1BI1A 5D19A 3FDYA 3IL2A 3I53A 2OAZA 1J59A 4M9XA 2PBXA 2CSOA 3K70D 5KAIC 5CJ9A 4LLLA 4YG2F 3ZGKA 3NNRA 1H8AC 2WTEA 4IL6C 4RM3A 1VQLI 2YVXA 3FZVA 2XIGA 2ZNYA 3T8RA 2LKSA 4HV6A 3HHGA 4BJ5C 4O3MA 2XSJC 2BY1A 1LVKA 2Z99A 2EFQA 2ESHA 3DF8A 2ZY9A 2ZJQF 4HEA2 3K8PC 3HC7A 3S14J 1XSVA 4M3BA 1DPUA 3VDXA 1QRYA 2L02A 4UUSB 3AL0B 3ZMZA 4XLFA 4MTEA 5K7FA 2R7SA 1MSFC 1FYKA 1VFCA 2FJI1 5IP9J 4I01A 1IDZA 2NS0A 4BXUA 5CVRA 2I5UA 2EQRA 5DDGA 1GLNA 1IRFA 3QP5A 5D5UB 3D5LA 1EA3A 4BGDA 3CUQB 4JKZA 2B0LA 2MLKA 5B1AH 2HVRA 1QO0D 2PMZN 3B81A 1MBJA 5E8IA 5DUKA 3FXRA 1QHGA 5E18F 2HDDA 5CVIA 3CWRA 3KE2A 3W6KB 4S04A 3L2UA 5JLXA 1OCTC 1UFMA 3OL4A 1E3PA 5CVVA 4N0BA 5AIPA 1HCRA 3CZ6A 4Y15A 2REKA 1UHMA 3OIOA 1SAXA 1YG2A 3K4CA 4L9TA 3TKYA 1U8BA 3MCZA 5H6QA 3F22A 3HRSA 3FHNA 3BR2A 3M8JA 2MABA 2RKHA 3FXOA 4PSWA 2WAEA 2X6WA 4B3XA 4LOCA 3ZR8X 2ZCMA 4HV5A 4JYKA 3PM1A 2KKOA 3BHQA 1BIBA 2E34A 4UY8I 4ZYGA 2EIJH 2NRAC 3NRVA 2CJJA 2HZDA 3B02A 2RV8A 2Z16A 3C3WA 2X6YA 5BQTA 3JCUC 2UXIA 2HQAA 2ZSHB 3FMRA 3TDZC 3WU0A 2PMUA 5HDNA 4MK6A 3CCYA 4FASD 3HZJA 4HQMA 2EFWA 2VODA 2QM3A 3F23A 4DZJA 3PNYA 3S15J 2JQ7A 2PX9A 1TQMA 2LREA 4MFDA 2WWYA 2MC3A 1RPWA 3SWHA 5CKTA 3WTSC 3NWTA 3HUGA 3HGYA 2E7WA 3HUGB 3ECHA 3F8FA 3DFGA 2O7TA 1O4XA 2VI6A 1W36C 2L01A 1UZCA 1XMKA 4AIJA 3FM5A 2IA2A 1IRZA 2W25A 3VW0A 3HTUA 2W57A 1XSXA 2K85A 5ERIA 3JW4A 3A2KA 5IT3A 4IHYA 5D6FA 4BU2A 2ZNZA 3BQZA 4G6DA 5IP7J 5JVTA 3OYHA 2EV0A 2JWTA 1UG2A 2JZYA 2KJBA 1UG0A 2RGVA 3FBNB 1ZAOA 2X0LA 2XC7A 2VJ5A 4HX8A 1QU3A 3DU6A 2AXLA 2CO5A 2QSHX 3T1BA 4I2OA 3IKTA 4U7BA 1FX7A 1W0UA 4EGZA 1WJDA 2L7KA 4BY1J 4BQAA 2LH9A 2G7GA 2HKXA 2FU4A 3L09A 3DBRB 4A5NA 3SZPA 3ABTA 1VQ7I 2K9LA 4E6KG 2OU2A 1LDKB 4MEXF 5DD8A 2NVTJ 4PJLA 4E7SA 2DT7B 2MD0A 1GVDA 4ENJA 3EGQA 4A3IJ 3BPVA 2QQ8A 3QOPA 3VSLA 1IXRC 1K6OA 4LG0A 3QU3A 4LG0B 1EF4A 4GGGA 3L2CA 1WSUA 2Z33A 2CQXA 3O2PE 2BE5F 2LVSA 5LGTA 3VVYA 2M8EA 4DOZA 3QU6A 3BPXA 3EQLF 5IT9K 1MH4A 2DFEA 4BE1A 2R7QA 1OCOH 2HOSA 5E1XA 1UMQA 3LNQA 2CV0A 5CLSA 2UXOA 2XB5A 1J2XA 4NC7A 5EZHA 3BZ6A 3HTJA 1P6RA 3V7RA 2FF4A 2Y75A 2VJJA 3HEFA 2TRTA 1HF0A 1BJAA 3HIFA 1A04A 3TP3A 3W2VA 3A1YA 1A35A 1A6IA 4Y4RA 5FFXA 5K1YA 1PUFA 2W84A 4RAYA 1QQIA 3VODA 2E1CA 3VYTB 3DXJF 4XR6A 4YIRX 2L9VA 3S93A 1BC7C 4AUXA 3COLA 2QTQA 5A2QK 1T56A 4MEYF 1MH3A 2M7AA 3DTKA 5JVGF 2HOTA 5HDKA 1DP7P 3ASNH 3IC7A 5F0FA 3ZMVA 3BOQA 4I6ZA 5ICEA 1R4MB 1OFCX 3OY9A 4OD4A 1U3EM 1B4AA 3KX2A 4HYEA 1HBXG 3SZGA 4M6XA 3A02A 4M9ZA 1SMTA 3A01A 3A01B 3HDDA 3BJBA 2EH3A 2OQGA 2LY1A 3HSRA 3LOCA 4M3GA 2XSDC 2HYTA 1P92A 1GXQA 1I39A 4E7ZA 1FP2A 2KIFA 4CCKA 5LEKA 3A03A 3T8TA 1FOKA 2DQLA 3ISPA 1VI0A 2GXAA 5D4SA 2KJCA 4U7DA 2O3FA 1NG6A 2KHMA 3KZ9A 4BDZA 5FGMA 2RN7A 2QSGX 3DLLF 1R1VA 5GPCA 2CH0A 3CCVI 4CZCA 3GO5A 3IUOA 5ED4A 2KLOA 4PJ0C 2A5WA 2DMNA 3D0SA 3R61A 1OMIA 3E1SA 1O3SA 3G7RA 3N4MA 2BEOA 3IAS2 2W48A 1USSA 2DMQA 2YVEA 3Q0UA 2DA2A 1T95A 2LBFB 4RB3C 2KISA 4WK8F 2B63J 3BDDA 2FNPA 3I59A 3I59B 2B7EA 2JUCA 3KCCA 2H6CA 1APLC 3R0AA 3EUHA 2Z2SB 3G1LA 3PFYA 3VFZA 1FBUA 2F5EA 2CW0F 4W1UA 1WPKA 2DYSH 1YLFA 3OMYA 4BL0B 3WTYC 2FE3A 4XN0A 1WZ2A 3PPBA 2ID6A 2A07F 2AS5F 2BY3A 3WTTC 2GXBA 2UWMA 2R3SA 2CS3A 1VQNI 3KZIC 5HOOA 3MD2A 2L9NA 4HNVA 1FT9A 3CJQB 1JJ6C 3V8KA 3E6CC 2ZMEA 2ZMEB 2VXDA 5KNLA 1GV5A 5D6EA 3GZNB 1S7EA 1H0MA 1JKOC 4LK1F 2DFFA 3GFMA 1WH5A 2HGCA 2VBWA 3HIMA 4XLNF 4CCMA 4HA8A 4GCKA 4G9YA 5IT9Z 1JHFA 3K1PA 4HKUA 4HF0A 4A3DJ 1HSJA 3C2BA 4C2MA 4Z2YA 2Q0OA 2CUZA 2NP3A 2PN6A 3BR6A 4P96A 3ZP5A 2XAUA 4UXNA 4ESJA 5F1JA 5BMZA 4IHWA 3A4CA 3K7AJ 4PZJA 2X1DA 2PEXA 2K7LA 4WWCA 1B8IB 3DLAA 1TWHJ 3ZMTA 3ZMSA 5CXIA 2LFBA 4L5JA 2M5WA 3G56A 2M4GA 1UAAA 3GFLA 5A2QZ 4LITA 1WJ5A 4F93B 2K4BA 1Z6TA 1T8IA 3CUOA 3AG1H 2WV1A 2BOLA 1FPQA 3NQOA 3RD3A 1STZA 2EFNA 2RASA 1OCRH 1CQTA 1FOYA 4KNYA 4CHUA 4ZDPA 1OKRA 2O8XA 4LJZF 3VEPA 3RQ4A 3FF5A 4OMZA 1BIAA 1QZYA 1T0FC 2XAFA 1JUMA 4L0YB 1ULYA 2M9HA 2QQBA 1D8JA 2DK8A 3B6AA 4XRFA 3TW7A 1R7JA 1NHAA 2NVXJ 2GA2A 3GZ5A 3ABKH 1W5SA 3RPQA 3AG2H 4L0ZB 1S7OA 3S32A 3V6GA 1UELB 1MJ9A 1IF1A 1HSTA 1D5VA 4ZJZA 2IW5A 1IUFA 4CCLA 3RPUA 2VOOA 4MGRA 4E7KA 3AG4H 1KA8A 3RCOA 4AVPA 5LRSA 2IS6A 1HDPA 4D1QA 1I27A 3Q9SA 3WHCA 4XNFA 3G73A 3QAHA 4G7ZF 2MA3A 3JRBA 3GBGA 3EUAA 4HF2A 2OV7A 1E3HA 5IPAA 1LFPA 1MBFA 2FQ3A 1KYWA 3F8CA 4D5CA 3K0LA 2M1BA 3OS2A 1FJLA 1IJWC 1FZPB 2E36A 3KNWA 3FK6A 4BUPA 2DPUA 4ZDOA 4XKWA 4EV0A 4AIKA 1R1UA 3K69A 4X6AJ 1OCZH 5J4VA 1HW5A 5D5WB 3LQRA 3OYKA 4UHTA 5J1RA 2ZXHA 1UCRA 1RC9A 1S9HA 1OQYA 2OZ6A 1A31A 2WB1A 1W1WE 3C18A 3QQAA 3GX4X 2KFDA 5E3NA 3BG7A 5FB2A 3WTXC 1KU3A 2NOGA 2LYCA 3KP4A 1EV7A 5GPAA 2HZTA 1Z3XA 1G3YA 4DVYP 4RB0A 3JAMK 2COBA 2DPDA 1ZGAA 5CVUA 5C4JJ 3EYYA 4XICA 2WV0A 2JA7J 5LBQA 3HTSB 3M07A 2DFIA 4QTRA 1WJCA 3VW1A 2VKHA 1UJ8A 5D5XB 5K5QA 4UUVA 1IV6A 2W1OA 4XM3A 4BE2A 3HSEA 1OR7C 5IYDJ 2VB6A 3DKYA 2IU5A 4N9HA 2FX0A 2V1NA 3MKLA 4NBQA 3PIOF 3DV8A 3K2AA 4R1HA 4IJAA 4XONA 3DEWA 3K4KA 3W3CA 5EZGA 1MZBA 1A36A 1U5TA 4UNOA 4P55A 3JRDA 2LOOA 1BN5A 1IXSB 2X1CA 3HPHA 2VQCA 5DM7F 3P9TA 3F8NA 1O7FA 3BTLA 2VUMJ 2QENA 3X2QH 1RR8C 1S29A 2HVSA 1OCPA 2CFOA 2WAQA 3I71A 3UKGA 1OYYA 2R7ZJ 2LKXA 4PDKA 5AIQA 2OF7A 2IA0A 2L2OA 3GCMA 1WJBA 4QPQA 2WY8Q 3SEQA 1B9NA 5B66C 3GEUA 5C44J 4BQQA 1L3LA 2QQ9A 4MTDA 1FTTA 2XRLA 2DYRH 3K6GA 3FRQA 3BZKA 2DG8A 2NNNA 3I58A 2WB1N 1OCCH 2E2JJ 1Z05A 3HRUA 2ZJ2A 4IRIA 1LB2A 1U6GA 4P1WA 5JHFA 3PO3J 3PJRA 1TL8A 3H36A 2FOKA 2G7HA 3AL0C 3DP7A 3JRGA 4IRGA 2M0CA 3TOBA 4ESFA 3HOUJ 3WTZA 1SFXA 2K86A 1FIPA 1ZTRA 3H9QA 4DBQA 3HTHA 2F6CA 1Z7LA 1D8KA 5CW8A 1LE8A 2OTLI 1LE8B 3CUQC 1RUOA 1X4PA 3BTCA 4IHXA 1BR4A 4LIVA 3ROUA 2V57A 2GOMA 3Q5FA 1ZG3A 1TW2A 2LG4A 2FJ1A 1SFOJ 1JKQC 2RC4A 2Y9ZA 4BNCA 1T6SA 4L5EA 4BBRJ 3TDUC 3WTUC 3E5QA 5FLXK 2VQLA 3ABMH 1WCMJ 4RGRA 2P8TA 3OYMA 1O3TA 2JPCA 2DOEA 2PG4A 2FMYA 4ANJA 2KRHA 2H1KA 3VP5A 2GQQA 5HAWA 1PYVA 2HDWA 2K3PA 1FY7A 5DCFA 5ILSA 4MNUA 4NQWA 2Y69H 2WAQN 2BW3B 4NQWB 5HNFA 5EYRA 1I6XA 5DS9A 5FKMA 1R6RA 2M30A 3BRUA 3VOEA 3E5UA 5K7ZA 2EJRA 1LQ1A 2Y0SA 3BG3A 2PMHA 5CQEA 5K7HA 1QHHD 3JAMZ 2YX4A 4YFNF 2MBFA 2K40A 3EDPA 3OIQA 2A6TA 3IH2A 3TW6A 5EDNA 3CQZJ 3ELKA 1XSDA 2FRHA 3OYGA 3OR2C 3ZQ7A 2F5DA 3WODF 2M87A 4DZPA 4EEFG 3RPUD 4X1EA 2H8WA 2PMZA 2ZJRF 3CCMI 2OQRA 4BDYA 3MFKA 1LEAA 1KU2A 5TRDA 4GFBA 4IHVA 3BJ6A 3ZN0A 3J7YJ 1X3ZB 1ACIA 3M8EA 3HOXJ 2ELHA 1Y56A 4A3MJ 4CCNA 4IOAF 2Z5UA 5FLVA 2DA7A 4XQFA 3CMEI 1V55H 5HLTA 1FSEA 5LHGA 3IUVA 3S1NJ 2IT0A 2A3SA 1TNSA 3S3OA 2RQPA 4J19A 2MG4A 2RNGA 4A5MA 4OIPF 4HAMA 1WWXA 4JX5A 3H5RA 3J7AY 1FEXA 1HQCA 3JSOA 2LTPA 3FXLA 4W97A 2ZCWA 4O5VA 2BXYA 2V4JC 3PIPF 2QSFX 4DJAA 4L62A 2VBYA 1CGPA 4HNUA 4L9JA 1PP7U 1G59A 3ZN1A 3WGGA 4DYCA 4M6YA 5E17F 4HDVA 4R8HA 2TDXA 2BGCA 1U9OA 2MFZA 5KHDA 1Y8RB 5GP9A 4S0HB 3SQNA 3V8JA 1P7JA 1N77A 4V2GA 3H3ZA 3D5RC 1P4WA 4II3A 2CQNA 4C2TA 2DMTA 3S2HJ 1OPCA 3BLYA 1D0YA 2JSPA 2IGNA 3CO7C 2XAGA 2Y0SN 4BH9A 5L3EA 4XOPA 5ILUA 1S5LC 4AVZA 1Z0XA 1YJWI 2MH2A 2E5NA 5EJCA 5LGUA 1IC8A 1YTYA 4KJZA 1O3QA 4C3IJ 2O8KA 4XN3A 2KP6A 1B72A 3CC4I 1B72B 3I4MJ 4BBSJ 2YPRA 4BEHA 4BEHB 4CCOA 4A3FJ 1IDYA 1ZHFA 2OCEA 4RS8A 1J7KA 3ONQA 4CYDA 4MIMA 1VQOI 3QODA 1OISA 4EM2A 2PFVA 1VQKI 4BY7J 1OYIA 2Y0MA 3P9CA 4UVAA 3IKVA 3RDIA 1Y1VJ 1J0RA 5L3GA 5FLXZ 4HLYA 1ZK8A 1W4MA 2XF5A 1JI8A 2R7WA 3FHZA 3GTJJ 3BR3A 3MWMA 4EGYA 3JSJA 4OIQF 2P6TA 4MHGA 1ERDA 1UHSA 1HKTA 3LSIA 3HG9A 3OSFA 5FGLA 4KIFA 2GZWA 3F6VA 1IG7A 2JSCA 4RGXA 4HW0A 5EEGA 4F92B 3CCQI 3VPRA 1LEBA 5JFRA 1Y6IA 5D18A 1TWAJ 2X6XA 3UNGC 3L1PA 2G7UA 4LG3A 2AHQA 4NNJA 5CQGA 2FBQA 3CJNA 2RHAA 1NG7A 1QVUA 2VC1A 4LB6B 2V1DA 4IRHA 1XCVA 4MXMA 2OI8A 4CGZA 5GAEJ 2JJ7A 1S6LA 2VE8A 4EVIA 2CUEA 2M7BA 1WI9A 1E17A 1FTZA 1H89C 1EH7A 3ZQIA 1E3OC 2DJNA 2DJIA 2K27A 2DT6A 4MQ9F 2FQ4A 3GW2A 1BL0A 3KZZA 1R5ID 1ETVA 1ZN2A 2FBIA 4FCYA 2WC2A 3W6JB 3WE2A 2QWTA 3V42A 5HNHA 1R9TJ 3BY6A 5FD5A 3OYAA 3PFIA 3S2WA 2K4JA 1TTYA 2OJED 3K1MA 1W7PA 5AONA 3FXJA 2PFBA 2DTRA 3GXOA 2FBHA 2M3AA 2VT2A 3DCFA 1J9IA 1U78A 3ZOBA 4IXAA 3CC2I 3KYCB 3U2RA 1K61A 4HDUA 3BG6A 1Q1HA 2HXOA 1TWGJ 1V54H 3E7LA 1EKEA 3MZ8A 5EEAA 1FNNA 2DTZA 1EH6A 2QWWA 1G8XA 4JQFA 2IS2A 4RMNA 3H1CA 3IHUA 3KEYA 1JTYA 4U0WA 1WJEA 1AHDP 2NNYA 3BG9A 2DCEA 3DKXA 4BHPA 2R7FA 1P4AA 5KCMA 1BR1A 2K5CA 1SGMA 2DK5A 4EJVA 4UUTA 3RKYA 4G7HF 1I6HJ 4LFUA 2F4OB 2R93J 4YRVA 2FEZA 2GA1A 1LFUP 2WBMA 2ZOZA 5J4YA 2QKLB 3HL2A 3QBMA 3RKWA 1RI7A 3WG7H 4MLOA 3J80K 2R7UA 1XTAA 1MDMA 1BI2A 5FROA 1MDMB 1HLVA 4ABZA 4KT5C 2YSRA 3OR1C 1S8NA 3OS0A 2HR3A 3IP4B 2H1LA 3M1CA 3TO7A 4A93J 1ETWA 2ZMEC 1ETYA 2BZTA 3E3VA 3IWZA 4B4CA 4XSZF 1TT5B 4IHSA 5E3LA 4EM1A 3MAJA 4G7OF 1RETA 2FMLA 2F4IA 2ZXWH 3QPLA 3K2ZA 6PAXA 1BI3A 1KQ0A 2XRNA 2H8RA 2CU7A 4OIOF 4E7LA 2AQEA 5IOYA 2GIZA 1T38A 1DU6A 2IBDA 4LLNA 3IAM2 4GO1A 3GVAA 2LY9A 3RTRA 4D0PA 2IS1A 4XLCA 3BG5A 2K9QA 2ZOYA 4LIUA 4Y33A 5HBUA 4I7HA 3T6NA 1MBKA 3GEZA 4HPQA 3M4OJ 1SVMA 4JP0A 4M72A 1NK2P 4DQ2A 2O03A 3ABLH 3VWBA 3E6DA 5E79C 1YIOA 2EZIA 3TP0A 4AWXB 1HXDA 5K5RA 3HHHA 3BJAA 2WUIA 1X58A 4NN1A 5DD4A 1PUFB 1FOWA 5BOXA 4HNTA 2O61A 3GTMJ 1MBHA 3E7QA 4QIWN 2JPBA 2EFPA 1IN7A 4YFXF 2R7RA 3GTOJ 2LK2A 4ZDLA 1A6QA 3JRIA 3HTIA 3G71I 1JGSA 4A3LJ 3SDGA 3PNVA 2L7ZA 1ETQA 3ZCOA 1ZH5A 2O6GE 3RJPA 5B3SH 5FLMJ 2ME6A 2PI0A 2V9PA 5H6RA 2VOPA 3ASOH 3OYLA 2KL4A 3DKWA 4Y17A 4AC6A 3DTEA 3WG9A 3HGGA 4G6TB 3LWJA 4OINF 3VTIA 3BTIA 1IW7F
chains in the Genus database with same CATH topology
1YRNA 1YRNB 5IPAA 3FIWA 1MBFA 1GDTA 4B1RA 4D5CA 2CUFA 2LP0A 3KNWA 1FJLA 1IJWC 4AF5A 4CGRA 3FK6A 3LHQA 2EZHA 4X6AJ 3HE0A 3NXCA 1MBGA 1RESA 5EFYA 1MNMC 3VVZA 3IV5A 5J1RA 1LFBA 4DYRA 3VIBA 5FHPA 3TEDA 2JK3A 1RR7A 3RZDJ 1ZR4A 3QQAA 2X48A 5E3OA 5EGOA 5EGOB 5E3NA 2K9NA 2NS7A 1WI3A 3JRHA 2K9SA 2NOGA 1OJLA 1ZQ3P 1JTXA 4NELA 3GTQJ 5GPAA 1DU0A 2ZCNA 2DA3A 2OERA 1JKPC 5HODA 4XIDA 2COBA 4BXXJ 5JLWA 4A3CJ 1W0TA 3GZIA 5C4JJ 4XICA 2JA7J 1ORKA 4QTRA 2L7FP 3VW1A 1IV6A 3ZQHA 2VKEA 3BNIA 1BW6A 2NX4A 2M8GX 4ACIA 2XGEA 1TWCJ 2OPTA 3S16J 5IYDJ 2VPRA 1BA5A 2IU5A 2M2EA 3Q0VA 2G7LA 3Q3SA 2FX0A 3MKLA 2XGDA 4XK4A 4C3HJ 3K2AA 1SANA 2DN0A 3DEWA 3HOWJ 2XPWA 1MBEA 5EZGA 3LSPA 1X2MA 1ETOA 2L9RA 1I3QJ 3G1MA 3JRDA 2HYJA 9ANTA 1Z77A 4RBOA 4FE4A 2F07A 3Q0WA 3P9TA 2MW8A 2M34A 5D19A 3BR0A 3BTLA 2NS8A 2VUMJ 2RAEA 1Y1WJ 1OCPA 2HI3A 2PBXA 3UKGA 2R7ZJ 3NNRA 2LKXA 1H8AC 2QOPA 2OF7A 5C4XJ 3GEUA 4GFLA 5C44J 2XPVA 5IOZA 2XDNA 2E19A 3LJLA 2CRGA 1FTTA 4M3EA 2XRLA 1NTCA 5EF6A 3FRQA 2DG8A 3S14J 5M3MJ 4M3BA 2WB1N 2E2JJ 2ME0A 1JGGA 1JUSA 1F36A 1QRYA 4UUSB 3CMYA 5K7FA 1MSFC 1VFCA 4D7NA 5IP9J 3PO3J 1IDZA 2EQRA 3I4NJ 3B6CA 3JRGA 2M0CA 4D5FA 3HOUJ 2R5YA 2R5YB 2YU9J 4JKZA 2DMUA 2CQQA 4NDLA 3B81A 2PMZN 1FIPA 1ZTRA 1MBJA 3HTHA 2GBYA 4DW6A 2DG7A 5CW8A 3RQIA 1LE8A 1LE8B 2R0QC 3ZQCA 2HDDA 3NI7A 3CWRA 3BTCA 4IHXA 2GLOA 2V57A 5JLXA 1OCTC 1NK3P 1HCRA 2G3BA 2REKA 3VOKA 2FJ1A 3OIOA 1SFOJ 1JKQC 4A3JJ 1P7IA 2Y9ZA 4L5EA 3O8HA 3H0GJ 4BBRJ 1U8BA 1WCMJ 4GCTA 3BR2A 2DA4A 2XB0X 2ELKA 2DA1A 1GT0C 1FIAA 2H1KA 3VP5A 5HAWA 2QIBA 4LOCA 1ETXA 3BR1A 2ZCMA 4MO7A 4JYKA 3PM1A 3BHQA 4JX4A 2YUSA 2WAQN 5EYRA 5DS9A 5FKMA 5H9TA 3BRUA 3F1BA 3FKIJ 4G12A 2CJJA 3LSGA 5K7ZA 4A69C 2UXIA 3BG3A 5K7HA 3LSJA 2HKUA 2K40A 2YS9A 3SJMA 4MK6A 3CCYA 2GFNA 3IH2A 3TW6A 5EDNA 3ZQFA 4B3AA 4DZJA 4CYCB 4CYCA 4A3GJ 2UXUA 3CQZJ 3S15J 3RZOJ 2PZ9A 4MFDA 5FKOA 1Q1VA 2O9LA 4DZPA 1RPWA 4EEFG 4X1EA 4GFBA 4ME9A 4IHVA 3NRGA 3HGYA 2NVQJ 3C07A 1RKWA 3CDLA 2O7TA 1O4XA 2VI6A 3HOXJ 2L7MP 1H88C 2D5VA 5DAJA 4A3MJ 2Y2ZA 1ITYA 5FLVA 2DA7A 1IRZA 3VW0A 2L0KA 3IUVA 3S1NJ 4IHYA 1F43A 3EUPA 3HM5A 3MN2A 2Y9YA 3S1QJ 3BQZA 5IP7J 4J19A 2MG4A 2JWTA 3FK7A 1UG2A 3PASA 4AYBN 4JX5A 1FEXA 2UXHA 3M3YJ 1XC5A 4JL3A 2XPUA 2LTPA 4FISA 4W97A 3BTJA 5F0CA 1G2HA 1W0UA 3KKCA 3VUQA 4L62A 3RH2A 5K58A 4BY1J 5C3EJ 4DYCA 2IEKA 5BNGA 3AQSA 2G7GA 4BKXA 2JA8J 2DA6A 3OSGA 3LSRA 3JREA 1U9OA 5F08A 2X9DA 5GP9A 3BR5A 1ZGWA 2R5ZA 2R5ZB 4S0HB 5IYBJ 1P7JA 2NVTJ 4V2GA 1JJ8C 1GVDA 2R92J 3EGQA 4A3IJ 2DMTA 2KDZA 3S2HJ 3S17J 1EF4A 2LR8A 2CQXA 2Y0SN 2LVSA 3VVYA 1Z0XA 4XRSG 1HDDC 3RKQA 3H3VK 3CRJA 1IC8A 1MH4A 4C3IJ 2VKVA 2O8KA 4A3BJ 1B72A 4M3DA 1B72B 2HOSA 3JRFA 4A3FJ 3I4MJ 3HOVJ 4BBSJ 1UMQA 1IDYA 3LNQA 2FD5A 5FKNA 1B8IA 2UXOA 2XB5A 3VVXA 3S1RJ 4MIMA 3NAUA 5EZHA 3HTJA 2ID3A 5FJ8J 3HOZJ 1HF0A 3HEFA 2TRTA 1WGXA 2X6OA 4V2FA 3TP3A 1RKTA 2I10A 4BY7J 1A6IA 2ECCA 1Y1VJ 1PUFA 1GUUA 1ZK8A 2MSYA 3FISA 1A5JA 2ECBA 4AUXA 5IP6A 3COLA 1WH7A 3GTJJ 3S1MJ 3BR3A 3VW2A 3JSJA 3G1OA 4FE7A 2QTQA 2E2IJ 5C4YA 1UHSA 1T56A 5M3FJ 1MH3A 1MSEC 3OSFA 2HOTA 2ZCXA 2W53A 2WGBA 3ON4A 5FGLA 3V78A 1IG7A 5F0FA 4I6ZA 1VF9A 3VPRA 2DA5A 5D18A 1OFCX 1TWAJ 3L1PA 1JKRC 2AHQA 4XRSA 3GTGJ 2FBQA 3HTAA 2P81A 2QCOA 2RHAA 4Y52J 1JUPA 1QVUA 3ZQGA 3A02A 3HDDA 3A01A 5FKKA 3A01B 3BJBA 4RDUA 2EH3A 4MXMA 5AQCA 2G7SA 2EBIA 2OI8A 3SFIA 2GM4A 2JJ7A 5EG0A 3GTLJ 2CUEA 5EG0B 1I50J 3LOCA 4M3GA 2XSDC 1QVTA 2XGCA 1H89C 1FTZA 3ZQIA 2HYTA 1E3OC 2DJNA 5F0HA 2LD5A 3JR9A 2FQ4A 3BCGA 1BL0A 3A03A 2EZKA 5J1UA 1VI0A 2YVHA 1ETVA 4FCYA 2QWTA 3CJDA 2JMWA 1TWFJ 1R9TJ 3KZ9A 4GCLA 1UI6A 2Y30A 3MNLA 2G0EA 3ZQLA 2KT0A 3IH4A 5GPCA 4AC0A 1XS9A 5DTDA 1AU7A 3DCFA 3WHBA 2DMNA 1U78A 3ZOBA 2IAIA 4QSHA 5J1YA 2N8GA 3IH3A 3HB9A 3HOYJ 1IGNA 3G7RA 1K61A 3DPJA 3JRAA 2W48A 2HXOA 5CXGA 1TWGJ 2Q24A 2O7OA 4D7MA 2DMQA 3E7LA 2YVEA 3ON2A 3Q0UA 5EEAA 2DTZA 2DA2A 2ZB9A 3HKZN 1GV2A 2B63J 1JTYA 2E2HJ 1BJZA 1AHDP 4ICHA 3BG9A 1APLC 3G1LA 1BW5A 3S5RA 2E1OA 4W1UA 1SGMA 4UUTA 1WPKA 3GTKJ 1I6HJ 2R93J 1T33A 5M5WJ 3F0CA 2HOAA 1LFUP 3PPBA 4Y7NJ 1ZKGA 2ZOZA 3KKDA 2ID6A 4M6VA 1HOMA 3QBMA 5M5XJ 4HNVA 4MLOA 4DYQA 3OOUA 1JJ6C 1HLVA 4ABZA 4FTHA 1GV5A 3S2DJ 1S7EA 1JKOC 3O8GA 1WH5A 2D6YA 4A93J 2NP5A 1ETWA 3HIMA 1ETYA 1VNDA 3BT9A 4B4CA 2GENA 3ANGA 1AKHA 4GCKA 1AKHB 1TC3C 5E3LA 2UXPA 1RETA 3QPLA 5M5YJ 5E3MA 2JN6A 3JRCA 4HKUA 5F04A 4A3DJ 2H8RA 2CU7A 4XRMA 4YZEA 4UDSA 3C2BA 5IOYA 1DU6A 2IBDA 2NP3A 3QPSA 2LLKA 2LY9A 4I76A 2GUHA 4MFEA 2MGQA 3BR6A 1D5YA 3BG5A 2K9QA 5F27A 5F1JA 2ZOYA 4IHWA 3K7AJ 5IYCJ 3ANPA 5HBUA 1B8IB 1MBKA 5D1RA 1QPIA 3T6NA 1TWHJ 2EZLA 3QKXA 3M4OJ 4GFKA 1NK2P 4JP0A 2NVYJ 5FMPA 5CXIA 2LFBA 3G56A 4JNNA 3GTPJ 2EZIA 3TP0A 4UUSA 3D1NI 1ETKA 3W6VA 2WUIA 4C2MJ 4A3KJ 3BQYA 1X58A 2WV1A 1PUFB 4NN1A 3RD3A 4M3FA 4JX6A 2RASA 4C3JJ 1CQTA 5FKLA 3GTMJ 4IEJA 1MBHA 2AO9A 3E7QA 1JT6A 1XG1A 3NPIA 4QIWN 2HXIA 2TCTA 1K83J 1ENHA 1JUMA 2M9HA 2QF7A 3GTOJ 2LK2A 1UI5A 3B6AA 3NARA 5J3LA 3TW7A 3JRIA 2NVXJ 4PXIA 2QKOA 3HTIA 4A3LJ 3SDGA 4KWAA 1JT0A 2JA6J 2L7ZA 1ETQA 2JA5J 2HQ5A 3V6GA 3AQTA 3VOXA 1U9NA 1IUFA 4A3EJ 5HSZA 3MVPA 5FLMJ 3PO2J 2ME6A 1POGA 1HDPA 2Y31A 2DMPA 4AC6A 3HGGA 3HBLA 1X2NA 3WHCA 3O60A 3LWJA 1ZR2A 3BTIA 3JRBA 3GBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRN A;  1YRN B;  5IPA A;  3FIW A;  1MBF A;  1GDT A;  4B1R A;  4D5C A;  2CUF A;  2LP0 A;  3KNW A;  1FJL A;  1IJW C;  4AF5 A;  4CGR A;  3FK6 A;  3LHQ A;  2EZH A;  4X6A J;  3HE0 A;  3NXC A;  1MBG A;  1RES A;  5EFY A;  1MNM C;  3VVZ A;  3IV5 A;  5J1R A;  1LFB A;  4DYR A;  3VIB A;  5FHP A;  3TED A;  2JK3 A;  1RR7 A;  3RZD J;  1ZR4 A;  3QQA A;  2X48 A;  5E3O A;  5EGO A;  5EGO B;  5E3N A;  2K9N A;  2NS7 A;  1WI3 A;  3JRH A;  2K9S A;  2NOG A;  1OJL A;  1ZQ3 P;  1JTX A;  4NEL A;  3GTQ J;  5GPA A;  1DU0 A;  2ZCN A;  2DA3 A;  2OER A;  1JKP C;  5HOD A;  4XID A;  2COB A;  4BXX J;  5JLW A;  4A3C J;  1W0T A;  3GZI A;  5C4J J;  4XIC A;  2JA7 J;  1ORK A;  4QTR A;  2L7F P;  3VW1 A;  1IV6 A;  3ZQH A;  2VKE A;  3BNI A;  1BW6 A;  2NX4 A;  2M8G X;  4ACI A;  2XGE A;  1TWC J;  2OPT A;  3S16 J;  5IYD J;  2VPR A;  1BA5 A;  2IU5 A;  2M2E A;  3Q0V A;  2G7L A;  3Q3S A;  2FX0 A;  3MKL A;  2XGD A;  4XK4 A;  4C3H J;  3K2A A;  1SAN A;  2DN0 A;  3DEW A;  3HOW J;  2XPW A;  1MBE A;  5EZG A;  3LSP A;  1X2M A;  1ETO A;  2L9R A;  1I3Q J;  3G1M A;  3JRD A;  2HYJ A;  9ANT A;  1Z77 A;  4RBO A;  4FE4 A;  2F07 A;  3Q0W A;  3P9T A;  2MW8 A;  2M34 A;  5D19 A;  3BR0 A;  3BTL A;  2NS8 A;  2VUM J;  2RAE A;  1Y1W J;  1OCP A;  2HI3 A;  2PBX A;  3UKG A;  2R7Z J;  3NNR A;  2LKX A;  1H8A C;  2QOP A;  2OF7 A;  5C4X J;  3GEU A;  4GFL A;  5C44 J;  2XPV A;  5IOZ A;  2XDN A;  2E19 A;  3LJL A;  2CRG A;  1FTT A;  4M3E A;  2XRL A;  1NTC A;  5EF6 A;  3FRQ A;  2DG8 A;  3S14 J;  5M3M J;  4M3B A;  2WB1 N;  2E2J J;  2ME0 A;  1JGG A;  1JUS A;  1F36 A;  1QRY A;  4UUS B;  3CMY A;  5K7F A;  1MSF C;  1VFC A;  4D7N A;  5IP9 J;  3PO3 J;  1IDZ A;  2EQR A;  3I4N J;  3B6C A;  3JRG A;  2M0C A;  4D5F A;  3HOU J;  2R5Y A;  2R5Y B;  2YU9 J;  4JKZ A;  2DMU A;  2CQQ A;  4NDL A;  3B81 A;  2PMZ N;  1FIP A;  1ZTR A;  1MBJ A;  3HTH A;  2GBY A;  4DW6 A;  2DG7 A;  5CW8 A;  3RQI A;  1LE8 A;  1LE8 B;  2R0Q C;  3ZQC A;  2HDD A;  3NI7 A;  3CWR A;  3BTC A;  4IHX A;  2GLO A;  2V57 A;  5JLX A;  1OCT C;  1NK3 P;  1HCR A;  2G3B A;  2REK A;  3VOK A;  2FJ1 A;  3OIO A;  1SFO J;  1JKQ C;  4A3J J;  1P7I A;  2Y9Z A;  4L5E A;  3O8H A;  3H0G J;  4BBR J;  1U8B A;  1WCM J;  4GCT A;  3BR2 A;  2DA4 A;  2XB0 X;  2ELK A;  2DA1 A;  1GT0 C;  1FIA A;  2H1K A;  3VP5 A;  5HAW A;  2QIB A;  4LOC A;  1ETX A;  3BR1 A;  2ZCM A;  4MO7 A;  4JYK A;  3PM1 A;  3BHQ A;  4JX4 A;  2YUS A;  2WAQ N;  5EYR A;  5DS9 A;  5FKM A;  5H9T A;  3BRU A;  3F1B A;  3FKI J;  4G12 A;  2CJJ A;  3LSG A;  5K7Z A;  4A69 C;  2UXI A;  3BG3 A;  5K7H A;  3LSJ A;  2HKU A;  2K40 A;  2YS9 A;  3SJM A;  4MK6 A;  3CCY A;  2GFN A;  3IH2 A;  3TW6 A;  5EDN A;  3ZQF A;  4B3A A;  4DZJ A;  4CYC B;  4CYC A;  4A3G J;  2UXU A;  3CQZ J;  3S15 J;  3RZO J;  2PZ9 A;  4MFD A;  5FKO A;  1Q1V A;  2O9L A;  4DZP A;  1RPW A;  4EEF G;  4X1E A;  4GFB A;  4ME9 A;  4IHV A;  3NRG A;  3HGY A;  2NVQ J;  3C07 A;  1RKW A;  3CDL A;  2O7T A;  1O4X A;  2VI6 A;  3HOX J;  2L7M P;  1H88 C;  2D5V A;  5DAJ A;  4A3M J;  2Y2Z A;  1ITY A;  5FLV A;  2DA7 A;  1IRZ A;  3VW0 A;  2L0K A;  3IUV A;  3S1N J;  4IHY A;  1F43 A;  3EUP A;  3HM5 A;  3MN2 A;  2Y9Y A;  3S1Q J;  3BQZ A;  5IP7 J;  4J19 A;  2MG4 A;  2JWT A;  3FK7 A;  1UG2 A;  3PAS A;  4AYB N;  4JX5 A;  1FEX A;  2UXH A;  3M3Y J;  1XC5 A;  4JL3 A;  2XPU A;  2LTP A;  4FIS A;  4W97 A;  3BTJ A;  5F0C A;  1G2H A;  1W0U A;  3KKC A;  3VUQ A;  4L62 A;  3RH2 A;  5K58 A;  4BY1 J;  5C3E J;  4DYC A;  2IEK A;  5BNG A;  3AQS A;  2G7G A;  4BKX A;  2JA8 J;  2DA6 A;  3OSG A;  3LSR A;  3JRE A;  1U9O A;  5F08 A;  2X9D A;  5GP9 A;  3BR5 A;  1ZGW A;  2R5Z A;  2R5Z B;  4S0H B;  5IYB J;  1P7J A;  2NVT J;  4V2G A;  1JJ8 C;  1GVD A;  2R92 J;  3EGQ A;  4A3I J;  2DMT A;  2KDZ A;  3S2H J;  3S17 J;  1EF4 A;  2LR8 A;  2CQX A;  2Y0S N;  2LVS A;  3VVY A;  1Z0X A;  4XRS G;  1HDD C;  3RKQ A;  3H3V K;  3CRJ A;  1IC8 A;  1MH4 A;  4C3I J;  2VKV A;  2O8K A;  4A3B J;  1B72 A;  4M3D A;  1B72 B;  2HOS A;  3JRF A;  4A3F J;  3I4M J;  3HOV J;  4BBS J;  1UMQ A;  1IDY A;  3LNQ A;  2FD5 A;  5FKN A;  1B8I A;  2UXO A;  2XB5 A;  3VVX A;  3S1R J;  4MIM A;  3NAU A;  5EZH A;  3HTJ A;  2ID3 A;  5FJ8 J;  3HOZ J;  1HF0 A;  3HEF A;  2TRT A;  1WGX A;  2X6O A;  4V2F A;  3TP3 A;  1RKT A;  2I10 A;  4BY7 J;  1A6I A;  2ECC A;  1Y1V J;  1PUF A;  1GUU A;  1ZK8 A;  2MSY A;  3FIS A;  1A5J A;  2ECB A;  4AUX A;  5IP6 A;  3COL A;  1WH7 A;  3GTJ J;  3S1M J;  3BR3 A;  3VW2 A;  3JSJ A;  3G1O A;  4FE7 A;  2QTQ A;  2E2I J;  5C4Y A;  1UHS A;  1T56 A;  5M3F J;  1MH3 A;  1MSE C;  3OSF A;  2HOT A;  2ZCX A;  2W53 A;  2WGB A;  3ON4 A;  5FGL A;  3V78 A;  1IG7 A;  5F0F A;  4I6Z A;  1VF9 A;  3VPR A;  2DA5 A;  5D18 A;  1OFC X;  1TWA J;  3L1P A;  1JKR C;  2AHQ A;  4XRS A;  3GTG J;  2FBQ A;  3HTA A;  2P81 A;  2QCO A;  2RHA A;  4Y52 J;  1JUP A;  1QVU A;  3ZQG A;  3A02 A;  3HDD A;  3A01 A;  5FKK A;  3A01 B;  3BJB A;  4RDU A;  2EH3 A;  4MXM A;  5AQC A;  2G7S A;  2EBI A;  2OI8 A;  3SFI A;  2GM4 A;  2JJ7 A;  5EG0 A;  3GTL J;  2CUE A;  5EG0 B;  1I50 J;  3LOC A;  4M3G A;  2XSD C;  1QVT A;  2XGC A;  1H89 C;  1FTZ A;  3ZQI A;  2HYT A;  1E3O C;  2DJN A;  5F0H A;  2LD5 A;  3JR9 A;  2FQ4 A;  3BCG A;  1BL0 A;  3A03 A;  2EZK A;  5J1U A;  1VI0 A;  2YVH A;  1ETV A;  4FCY A;  2QWT A;  3CJD A;  2JMW A;  1TWF J;  1R9T J;  3KZ9 A;  4GCL A;  1UI6 A;  2Y30 A;  3MNL A;  2G0E A;  3ZQL A;  2KT0 A;  3IH4 A;  5GPC A;  4AC0 A;  1XS9 A;  5DTD A;  1AU7 A;  3DCF A;  3WHB A;  2DMN A;  1U78 A;  3ZOB A;  2IAI A;  4QSH A;  5J1Y A;  2N8G A;  3IH3 A;  3HB9 A;  3HOY J;  1IGN A;  3G7R A;  1K61 A;  3DPJ A;  3JRA A;  2W48 A;  2HXO A;  5CXG A;  1TWG J;  2Q24 A;  2O7O A;  4D7M A;  2DMQ A;  3E7L A;  2YVE A;  3ON2 A;  3Q0U A;  5EEA A;  2DTZ A;  2DA2 A;  2ZB9 A;  3HKZ N;  1GV2 A;  2B63 J;  1JTY A;  2E2H J;  1BJZ A;  1AHD P;  4ICH A;  3BG9 A;  1APL C;  3G1L A;  1BW5 A;  3S5R A;  2E1O A;  4W1U A;  1SGM A;  4UUT A;  1WPK A;  3GTK J;  1I6H J;  2R93 J;  1T33 A;  5M5W J;  3F0C A;  2HOA A;  1LFU P;  3PPB A;  4Y7N J;  1ZKG A;  2ZOZ A;  3KKD A;  2ID6 A;  4M6V A;  1HOM A;  3QBM A;  5M5X J;  4HNV A;  4MLO A;  4DYQ A;  3OOU A;  1JJ6 C;  1HLV A;  4ABZ A;  4FTH A;  1GV5 A;  3S2D J;  1S7E A;  1JKO C;  3O8G A;  1WH5 A;  2D6Y A;  4A93 J;  2NP5 A;  1ETW A;  3HIM A;  1ETY A;  1VND A;  3BT9 A;  4B4C A;  2GEN A;  3ANG A;  1AKH A;  4GCK A;  1AKH B;  1TC3 C;  5E3L A;  2UXP A;  1RET A;  3QPL A;  5M5Y J;  5E3M A;  2JN6 A;  3JRC A;  4HKU A;  5F04 A;  4A3D J;  2H8R A;  2CU7 A;  4XRM A;  4YZE A;  4UDS A;  3C2B A;  5IOY A;  1DU6 A;  2IBD A;  2NP3 A;  3QPS A;  2LLK A;  2LY9 A;  4I76 A;  2GUH A;  4MFE A;  2MGQ A;  3BR6 A;  1D5Y A;  3BG5 A;  2K9Q A;  5F27 A;  5F1J A;  2ZOY A;  4IHW A;  3K7A J;  5IYC J;  3ANP A;  5HBU A;  1B8I B;  1MBK A;  5D1R A;  1QPI A;  3T6N A;  1TWH J;  2EZL A;  3QKX A;  3M4O J;  4GFK A;  1NK2 P;  4JP0 A;  2NVY J;  5FMP A;  5CXI A;  2LFB A;  3G56 A;  4JNN A;  3GTP J;  2EZI A;  3TP0 A;  4UUS A;  3D1N I;  1ETK A;  3W6V A;  2WUI A;  4C2M J;  4A3K J;  3BQY A;  1X58 A;  2WV1 A;  1PUF B;  4NN1 A;  3RD3 A;  4M3F A;  4JX6 A;  2RAS A;  4C3J J;  1CQT A;  5FKL A;  3GTM J;  4IEJ A;  1MBH A;  2AO9 A;  3E7Q A;  1JT6 A;  1XG1 A;  3NPI A;  4QIW N;  2HXI A;  2TCT A;  1K83 J;  1ENH A;  1JUM A;  2M9H A;  2QF7 A;  3GTO J;  2LK2 A;  1UI5 A;  3B6A A;  3NAR A;  5J3L A;  3TW7 A;  3JRI A;  2NVX J;  4PXI A;  2QKO A;  3HTI A;  4A3L J;  3SDG A;  4KWA A;  1JT0 A;  2JA6 J;  2L7Z A;  1ETQ A;  2JA5 J;  2HQ5 A;  3V6G A;  3AQT A;  3VOX A;  1U9N A;  1IUF A;  4A3E J;  5HSZ A;  3MVP A;  5FLM J;  3PO2 J;  2ME6 A;  1POG A;  1HDP A;  2Y31 A;  2DMP A;  4AC6 A;  3HGG A;  3HBL A;  1X2N A;  3WHC A;  3O60 A;  3LWJ A;  1ZR2 A;  3BTI A;  3JRB A;  3GBG A; 
#chains in the Genus database with same CATH topology
 3WE3 A;  1RUN A;  4F52 A;  3HPG A;  4C9Y A;  3FIW A;  2V79 A;  1GDT A;  2P5K A;  4AF5 A;  1X3U A;  3LHQ A;  2EZH A;  1I1G A;  3ZRG A;  1D1B A;  1MJB A;  4A12 A;  3NXC A;  3CDI A;  3GZ6 A;  4WCG A;  2Q2E A;  4QLC U;  2Q2E B;  3LSH A;  5FRM A;  1W5C C;  5FHP A;  3TED A;  2JK3 A;  1HW2 A;  1ZRC A;  1MND A;  1ZR4 A;  3TO6 A;  1XGN A;  5EGO A;  5EGO B;  4FX4 A;  3AFH A;  5ICF A;  4N9I A;  2E60 A;  2RVC A;  1OJL A;  1JTX A;  3CCE I;  1T39 A;  5L3B A;  3C7J A;  5J47 A;  3K70 C;  1O3R A;  5HOD A;  1JKP C;  1WJF A;  3E0J B;  4IOC F;  4BXX J;  2BV6 A;  1H9G A;  2CYY A;  1SEU A;  3KLN A;  2Z9O A;  2BVL A;  4CDG A;  1ORK A;  4XLA A;  3UR3 C;  3J80 Z;  3G3Z A;  3GME A;  3ZQH A;  1XMX A;  2VKE A;  3BNI A;  3V7S A;  2VQH A;  3M8F A;  5LHH A;  4ACI A;  1MNE A;  1ZEL A;  2GAU A;  2OPT A;  3AKZ A;  2CGP A;  2V1U A;  1XX5 A;  1WVR A;  1BA5 A;  5GAG J;  2VON A;  2M2E A;  3RI4 A;  2G7L A;  2AQF A;  2XGD A;  2Z3Y A;  1Z7U A;  4XK4 A;  2GEN A;  4KIS A;  4EJU A;  4IHT A;  2XPW A;  5D8L B;  3JSP A;  4OIR F;  3DTI A;  3LSP A;  4AD9 A;  2XRO A;  2HPM A;  1ETO A;  2DFH A;  1YX3 A;  1D1A A;  2UXN A;  4RBO A;  1PDN C;  2VKD A;  2F07 A;  2W24 A;  3Q0W A;  2M34 A;  4RAG A;  2NVU B;  4FHT A;  4JOM A;  2P4W A;  3FXU A;  3MKZ A;  3SEZ A;  4GFL A;  1B59 A;  1Z67 A;  1MMD A;  1N75 A;  3HRT A;  4PJM A;  2QA4 I;  5IOZ A;  4FX0 A;  2XDN A;  4HOB A;  2CV1 A;  3K4J A;  2E19 A;  3CP2 A;  4HRI A;  2W82 A;  2B9S A;  4XSX F;  4M3E A;  5H2F C;  3U21 A;  1SD6 A;  2F5C A;  1IN5 A;  5EF6 A;  3GLL A;  4FET A;  1JGG A;  5HVQ C;  1JUS A;  3CMY A;  3BCA A;  3LFU A;  2R7D A;  4KFC A;  2HYF A;  1T98 A;  2CW7 A;  1ZGJ A;  2GWR A;  2WAF A;  4D7N A;  4KMU X;  1ON2 A;  2QZ8 A;  3WTV C;  2EK5 A;  2MLG A;  3B6C A;  2O5R A;  4D5F A;  2IVM A;  2R5Y A;  4D9J A;  2R5Y B;  2YU9 J;  4NDL A;  2OZU A;  3NEU A;  5DM6 F;  1AA7 A;  2GBY A;  2F5F A;  3GWZ A;  3BC8 A;  2M0M A;  3N05 A;  2CQ7 A;  3KYD B;  1U2W A;  4CO8 A;  2GLO A;  2B1E A;  1H9T A;  4OAZ A;  2RNJ A;  4KIT B;  2HKO A;  1SAU A;  2NXN B;  3F8B A;  3PUF A;  4A3J J;  1P7I A;  3O8H A;  3H0G J;  1V5E A;  3VYU B;  2R7T A;  4ZYA A;  1G3T A;  4UV8 A;  2BYV E;  2VBZ A;  4L9N A;  4EMS A;  2C6Y A;  2HEO A;  1KYZ A;  2L9S A;  3TBI A;  2XB0 X;  4YEJ A;  4XBF A;  2VE9 A;  2DA1 A;  1GT0 C;  1FIA A;  1LUJ B;  2IXS A;  4GRI A;  2X85 A;  5LEJ A;  3P9K A;  1ETX A;  5F64 A;  3V7C A;  2JRM A;  2P7C B;  4U9L A;  4JX4 A;  2YUS A;  2ETH A;  4IF4 A;  4KIG A;  4R79 A;  1K7A A;  2CV2 A;  2E1N A;  3H35 A;  5H9T A;  2H6B A;  3FKI J;  2XAQ A;  4HZF A;  3F1B A;  3FM3 A;  2BHY A;  1R22 A;  3KEO A;  2EFO A;  1PUE E;  2P7V B;  4L9V A;  3LSJ A;  2HKU A;  1R4N B;  4M73 A;  3FMS A;  2RDP A;  2XKP A;  4I02 A;  3SJM A;  3COA C;  2HU9 A;  4CA0 A;  5BPI A;  4HX7 A;  1YJN I;  2V1X A;  3QYF A;  3ZQF A;  4A3G J;  2UXU A;  4UV9 A;  2ESN A;  2MYS A;  1U8R A;  4HF1 A;  2LC2 A;  1HW1 A;  2PZ9 A;  1TW3 A;  1Q1V A;  2DO7 A;  3FWE A;  3L2V A;  1X19 A;  1K79 A;  3FXM A;  2LSO A;  2X4H A;  4GCV A;  3C07 A;  3CDL A;  1ONV A;  2BXZ A;  4Z6Y A;  3BP8 A;  2DOD A;  4PJN A;  3SXY A;  3OYB A;  2D5V A;  4LLG F;  1ITY A;  4KIB A;  1KZH A;  4L18 B;  1SFK A;  4WXD A;  2KIM A;  3AAF A;  1Y0N A;  3HM5 A;  3MN2 A;  3PQK A;  1TZL A;  2Y9Y A;  1P4X A;  2BY2 A;  3LWF A;  3H0D A;  1PJR A;  2RQQ A;  3PAS A;  2NYX A;  4AYB N;  2ZXI A;  2BHZ A;  1U5T B;  2UXH A;  1VTN C;  4BHC A;  1BOB A;  1XC5 A;  4HQE A;  1KU9 A;  5KK1 A;  4JL3 A;  3RKX A;  3ESW B;  3W2A A;  2K02 A;  2HTJ A;  3KKC A;  4AU7 A;  4HST A;  4CUG A;  1K4S A;  1SFE A;  4YIF A;  5K58 A;  4LMY A;  2ZBK A;  4NHJ A;  2IEK A;  4U88 A;  5BNG A;  3AQS A;  2JA8 J;  2L54 A;  2DA6 A;  5B5E C;  1FC3 A;  3KIO A;  2X9D A;  4X0G A;  3ERE D;  1ZGW A;  3BR5 A;  2MD5 A;  3WGI A;  4G6Q A;  3IWF A;  3OYN A;  2IRF G;  5IYB J;  3CMA I;  3I9V 2;  1B6A A;  4HG2 A;  2LKP A;  3I5U A;  4ZC3 A;  4A0Y A;  4BJT A;  1FLI A;  3DWL E;  2R92 J;  2J5O A;  2K3F A;  4PSX A;  2KDZ A;  2DOA A;  4BXF A;  5FD6 A;  5BPD A;  1VQP I;  5E8G A;  3S3N A;  4Y13 A;  3K4L A;  1HDD C;  3RKQ A;  4IQJ A;  3H3V K;  3CRJ A;  2HQR A;  3E6M A;  4JBA A;  1O57 A;  1F1Z A;  4ZYH A;  1VQ5 I;  3ERM A;  2VKV A;  4A3B J;  2CG4 A;  2YU3 A;  3T0Y A;  4ZH4 F;  1VZ0 A;  3JRF A;  2OD5 A;  5JHU A;  5FKN A;  3GFI A;  1R1T A;  1DQU A;  2VT3 A;  3JTG A;  2KRF A;  3NAU A;  2D2W A;  2EPF A;  3BZC A;  4ZYE A;  1G6N A;  2ID3 A;  5FJ8 J;  3HOZ J;  2XUB A;  1J09 A;  3LA7 A;  1N78 A;  1XB4 A;  4V2F A;  3QRF F;  1WFX A;  2CUJ A;  4OMY A;  3CD6 I;  2QYO A;  5HLG A;  2ECC A;  3KP7 A;  2VPL A;  2MSY A;  3FIS A;  1A5J A;  3C1D A;  1T0F A;  5IP6 A;  1WKM A;  4H4K C;  3G1O A;  4FE7 A;  5H20 A;  2E2I J;  5C4Y A;  5M3F J;  1VQ8 I;  3RYR A;  4V19 K;  2WGB A;  4RAZ A;  3V78 A;  1QPM A;  1UB9 A;  3M7G A;  1VF9 A;  3C2G A;  1SD5 A;  4PFP A;  1MMS A;  3EPZ A;  3F21 A;  2HQN A;  4XRS A;  3GTG J;  3WTW C;  4UB6 C;  3HTA A;  2QVO A;  4B47 A;  2UZK A;  1JUP A;  3E97 A;  5DCM A;  1F9N A;  2ZFU A;  5FKK A;  5EEH A;  5J6X A;  1YHQ I;  2LF7 A;  4B8X A;  2EBI A;  2CWE A;  4B09 A;  1YFH A;  2PLY A;  2GM4 A;  5EG0 A;  5EG0 B;  2EA2 A;  1QVT A;  2XGC A;  1JE8 A;  1KU7 A;  1R5H A;  5GTH C;  2LD5 A;  5TJJ A;  2COM A;  3JR9 A;  4U9N A;  1REP C;  1AWC A;  2EZK A;  3LSK A;  5L3D A;  4IVN A;  2YVH A;  1IAW A;  3CJD A;  2JMW A;  4FQG A;  2WY7 Q;  2XAH A;  2W00 A;  3HXL A;  2Y30 A;  1D1C A;  1R5G A;  2G0E A;  2KT0 A;  1HC8 A;  2CMP A;  3IH4 A;  3R4K A;  2BBY A;  4XOT A;  3PNT A;  4XKB A;  1Z6R A;  4OAY A;  2JTV A;  1FMV A;  5J1Y A;  2N8G A;  3HOY J;  1IGN A;  1FYL A;  4CH7 A;  3MEX A;  4E4H A;  4IX7 A;  3DPJ A;  5J8C A;  5CXG A;  1XGS A;  1M1E B;  4BYY A;  2O7O A;  4D7M A;  3ON2 A;  4N4O B;  2CQK A;  2ZB9 A;  3WU2 C;  1LVA A;  4ON0 A;  3J7A O;  1GV2 A;  2ZFW A;  3ZMU A;  5F1R A;  1BJZ A;  2KDO A;  4ICH A;  4KMF A;  1TT0 A;  1QBJ A;  4RB2 C;  1OR7 A;  4RLF A;  2E1O A;  3S5R A;  3U1D A;  1FBQ A;  1XGM A;  1WHU A;  3GTK J;  1E0E A;  1JHH A;  2ICW G;  3PUB A;  1FYM A;  2HOA A;  5LLQ A;  2DXI A;  4Y7N J;  5ILV A;  3KKD A;  1ZG1 A;  5JR3 A;  2V9V A;  3VYR B;  2VJ4 A;  1HOM A;  4CCJ A;  3S3M A;  4KYW A;  2O0Y A;  1G3W A;  1QGP A;  2R7X A;  4FTH A;  4DBR A;  2ZC2 A;  4EJO A;  2B3W A;  3S2D J;  4GXO A;  1X1C A;  4OWR B;  3CF2 A;  2KZG A;  1C0W A;  2D6Y A;  1ON1 A;  1X1P A;  3ANG A;  4Q4Z F;  1D0X A;  2UXP A;  4XMY A;  3OYJ A;  1HKS A;  1SD7 A;  5M5Y J;  3G4S I;  3PQJ A;  5F04 A;  3QWL A;  1V5F A;  4XRM A;  4F3Q A;  4YZE A;  1KON A;  3RIR A;  1MD0 A;  5K5O A;  1K6Y A;  3A0H C;  2ZKZ A;  2EB7 A;  2MGQ A;  2HTS A;  1D5Y A;  2UXX A;  1YIJ I;  5IYC J;  3ANP A;  4CZZ A;  1QPI A;  2JVH A;  2EZL A;  4PUS A;  1XPX A;  1TQI A;  2L4A A;  4GFK A;  2NVY J;  5FMP A;  2DW4 A;  2XGX A;  1I3A A;  2JT1 A;  3K4B A;  1VQ4 I;  4CIC A;  2A61 A;  3TL4 X;  4Q5S F;  4UUS A;  4G94 A;  4ENN A;  1HA8 A;  4JK1 X;  3SHF A;  3I55 I;  3TQN A;  4M3F A;  2ELJ A;  4JX6 A;  4C3J J;  2IPQ X;  1TNT A;  2DDA A;  4IEJ A;  1Z9C A;  1IN4 A;  1JT6 A;  1MMG A;  1XG1 A;  3CUQ A;  3O3K A;  3NPI A;  4GYG A;  3FBI B;  2HXI A;  3QYB A;  3R60 A;  4BJ6 C;  1ZRD A;  1K83 J;  4BAY A;  1CF7 A;  1CF7 B;  3ABU A;  1IRX A;  5E1Z B;  2QF7 A;  3LAP A;  1UI5 A;  3NAR A;  5J3L A;  1XMA A;  3KP6 A;  1DPR A;  2NOJ B;  3G2B A;  2QKO A;  1ZG5 A;  2IGO A;  3DBH B;  4XOR A;  2JA5 J;  4H0E A;  3AQT A;  1V3F A;  2DBB A;  2EIK H;  2A68 F;  4CSW A;  5HSZ A;  4C30 A;  1R23 A;  3MVP A;  5JI6 A;  3PO2 J;  1BI0 A;  1IO2 A;  1POG A;  1GVJ A;  1LPQ A;  2DMP A;  3HBL A;  1X2N A;  2YX7 A;  4M74 A;  2NAZ A;  1YIT I;  1ZR2 A;  3I3L A;  1YRN A;  3F8M A;  1YRN B;  5J40 A;  3GLX A;  1GXP A;  3LST A;  3I64 A;  1TQP A;  4PFO A;  2LNB A;  3C2H A;  2L3D A;  3U9G A;  3OS1 A;  3GF2 A;  1JXS A;  3HOT A;  4U0Y A;  1DUX C;  1W7P B;  4RB1 A;  1RNL A;  1MBG A;  4LGW A;  3V4G A;  3CCU I;  1MNM C;  3VVZ A;  1MMA A;  1QZE A;  3IV5 A;  1F4K A;  3L2W A;  1ZYR F;  3LSM A;  2K9M A;  2OTJ I;  1G3S A;  1V4R A;  5CYV A;  2KPM A;  3RZD J;  3KPH A;  2X48 A;  5E3O A;  5J8F A;  1MKM A;  1YE9 A;  4OOI A;  3FMQ A;  1ZLK A;  1YOV B;  1YYV A;  1WI3 A;  3JRH A;  2VQG A;  4J00 A;  3GTQ J;  1DU0 A;  4KIC A;  3FX3 A;  2E1M B;  4GDF A;  3CDH A;  4XID A;  2IGK A;  1W0T A;  4A6E A;  3GZI A;  4OD5 A;  4F55 A;  1SFU A;  2LRD A;  1XN7 A;  1GHC A;  2W85 A;  4DNC A;  5B1B H;  1QA6 A;  4BAC A;  3EUH C;  3L2R A;  2M8G X;  2NX4 A;  3CCR I;  2XGE A;  1TWC J;  1BR2 A;  2VPR A;  4PJJ A;  3Q0V A;  3Q3S A;  3VB2 A;  3MMY B;  1Z3Y A;  2JUG A;  2JA2 A;  1Z21 A;  2DN0 A;  3KZY A;  3HOW J;  3GUD A;  1VQ9 I;  1X2M A;  3R0J A;  1I3Q J;  2EV6 A;  3G1M A;  4B48 A;  2HYJ A;  9ANT A;  1Z77 A;  3VYS B;  2HFH A;  4KN7 X;  1Y39 A;  1J75 A;  3K1N A;  2MW8 A;  3IRQ A;  2KIQ A;  3BR0 A;  1K78 A;  2NS8 A;  4P9U A;  1K78 B;  2RAE A;  1Y1W J;  2HNH A;  4ITV A;  3B73 A;  2HI3 A;  1R49 A;  4GYI A;  3REO A;  2QOP A;  2FXA A;  1KGS A;  5C4X J;  1QNT A;  1X1A A;  4I09 A;  2XPV A;  1Y0U A;  2Z1D A;  1SMY F;  1XDS A;  3HSF A;  4B43 A;  1ZLJ A;  1UHW A;  3LJL A;  3Q9V A;  2CRG A;  5LD2 C;  2IJL A;  1BM9 A;  5DYM A;  3GFJ A;  2DOF A;  2V9K A;  3DPL C;  1NTC A;  4LB5 A;  4KN4 X;  2LY2 A;  3CCJ I;  2DU9 A;  5M3M J;  2DQR A;  4EQQ A;  5CVJ A;  3M1E A;  2BVM A;  2ME0 A;  2DLL A;  1F36 A;  4I99 C;  1PVE A;  1SC7 A;  4OU0 A;  3P9I A;  2H09 A;  3M9A A;  3I4N J;  2DT5 A;  4PGG A;  1TBX A;  4ZZL A;  1X3W B;  2QKM B;  4AID A;  3ULQ B;  2DMU A;  3L2Q A;  1ZRE A;  2CQQ A;  4U87 A;  1LDD A;  3I4P A;  4DW6 A;  3H9J A;  2STT A;  3MQ0 A;  3IRR A;  2DG7 A;  2L4M A;  3RQI A;  2R0Q C;  2M4K A;  3ZQC A;  3NI7 A;  1D0Z A;  4E7I A;  4BQO A;  3FXK A;  4IO9 F;  2CFX A;  1NK3 P;  4M9S A;  2G3B A;  4DIQ A;  3K9T A;  3VOK A;  4YEL A;  2V7F A;  1EH8 A;  3LFK A;  4HBL A;  3WU1 B;  2XDV A;  1FMW A;  4RA2 A;  5ICC A;  1OYW A;  2JVG A;  3QYE A;  3DPU A;  2E35 A;  4GCT A;  4EAT A;  2DA4 A;  4ZZD A;  2ELK A;  2A6E F;  3OWT A;  2IA1 A;  2QIB A;  1P2F A;  1YX5 A;  3BR1 A;  2KMU A;  4MO7 A;  1X1D A;  2EIN H;  2HS5 A;  2D1H A;  3LA3 A;  3CJT B;  4E7H A;  4ENK A;  4YFK F;  1XCB A;  3N97 A;  2KRC A;  4G12 A;  2XAJ A;  4AIH A;  4IRV A;  3LSG A;  4A69 C;  3I54 A;  1DDN A;  1ZAR A;  3K4M A;  5HS7 A;  1B1B A;  5ICG A;  1WRJ A;  2G9W A;  2YS9 A;  5LGN A;  4XLE A;  2KQR A;  2GFN A;  2OCC H;  2A69 F;  2EV5 A;  2P5L C;  4AM3 A;  5TGT A;  4RGU A;  4CYC A;  4B3A A;  4CYC B;  2P5V A;  1T2K A;  4RGS A;  1HKQ A;  1YW9 A;  3QOE A;  1ZRF A;  2FNA A;  3RZO J;  5FKO A;  4K2E A;  3BWG A;  2O9L A;  4E70 A;  2V6C A;  4BE0 A;  4ME9 A;  3NRG A;  2E7X A;  2NVQ J;  1RKW A;  3CCS I;  2J5P A;  2L7M P;  2V6E A;  1H88 C;  5DAJ A;  2HVQ A;  3LAJ A;  2Y2Z A;  4XL9 A;  1V5G A;  2F4M B;  1R58 A;  2BY0 A;  5HS8 A;  1VQ6 I;  2R7O A;  3TO9 A;  2L0K A;  1YS6 A;  3U1K A;  2LBF A;  4J01 A;  3MZY A;  1FP1 D;  2UV1 A;  2Y48 A;  2EWN A;  3OV8 A;  2AXT C;  4HX4 A;  2ZJP F;  1F43 A;  3EUP A;  3S1Q J;  1SVL A;  1F5T A;  3BCB A;  3FK7 A;  1OLT A;  1W7P D;  3KP5 A;  3M3Y J;  3DQV C;  1FSH A;  3EET A;  5F6F A;  2XPU A;  2VAS A;  4FIS A;  5F0C A;  3BTJ A;  1G2H A;  4XLP F;  2ACJ A;  3VUQ A;  3H3U A;  3RH2 A;  1W5T A;  1MGT A;  4YII A;  1U5T C;  3KFW X;  5C3E J;  2A05 A;  1Z1D A;  4BKX A;  5DEQ A;  1MMN A;  3LSR A;  3JRE A;  3OSG A;  4N4N B;  1R00 A;  2A2F X;  5F08 A;  2OBP A;  2EA4 A;  1YW8 A;  3CES A;  2R5Z A;  2QEX I;  2R5Z B;  5FFZ A;  4PK4 A;  2L5Q A;  2OC6 A;  4TV7 A;  1JJ8 C;  2QBY B;  2QBY A;  3G6E I;  2IP2 A;  2PBI A;  1SD4 A;  1EJ9 A;  3FXQ A;  1IV8 A;  4UVB A;  3S17 J;  3KEQ A;  4HLX A;  2LR8 A;  3A0B C;  2VN2 A;  3PSI A;  3V8L A;  4ENM A;  3OYF A;  1E2X A;  2P6S A;  3AG3 H;  3BJO A;  4XRS G;  5GAH J;  4ASN A;  3CC7 I;  3CLO A;  2GIV A;  4QWQ A;  4IQ4 A;  4M3D A;  1IXC A;  1YI2 I;  3HOV J;  2FD5 A;  3OIP A;  3SFZ A;  4EJW A;  4ZTF A;  1B8I A;  4L5I A;  1LDJ A;  5HLH A;  4P9F A;  3OYC A;  3S1R J;  3VVX A;  1YO5 C;  3F9K A;  2KZV A;  4A0Z A;  4NC8 A;  3EUK L;  1L0O C;  1KQ8 A;  4A6D A;  1WGX A;  1X4O A;  1X1B A;  2X6O A;  2FUG 2;  3CP8 A;  2FBK A;  3F72 A;  1RKT A;  2I10 A;  3HKZ A;  2VL8 A;  4WX9 A;  4IZZ A;  1GUU A;  2VLA A;  3OYE A;  2EIM H;  4AYB A;  2XAS A;  2ECB A;  3EYI A;  3KLO A;  5DV5 A;  1WH7 A;  3S1M J;  3VW2 A;  1XD7 A;  3L7W A;  3NS4 A;  4ZTJ A;  3KP3 A;  1MSE C;  1LKX A;  3MKW B;  2OUM A;  2E71 A;  3VSK A;  2ZCX A;  3ON4 A;  2W53 A;  2XHK A;  2DAO A;  3T5X A;  4IKF A;  4NC6 A;  1RIO H;  3O6B B;  2DA5 A;  3P5J A;  5GTI C;  1DP3 A;  3CCL I;  3FKJ A;  1JKR C;  4I98 B;  1IN8 A;  2FSW A;  2P81 A;  2QCO A;  4RLQ A;  5E20 A;  4Y52 J;  4Y3O A;  3ZQG A;  1D3Y A;  3K4N A;  4EJT A;  5AQC A;  2X1E A;  4RDU A;  2G7S A;  3SFI A;  1O7L A;  3S8P A;  3LQQ A;  1RRJ A;  1MJA A;  1I50 J;  3RYP A;  3GTL J;  1LJ9 A;  5F0H A;  3E6B A;  3BCG A;  2V26 A;  4CXF A;  1R36 A;  2EIL H;  5J1U A;  2QUF A;  2ZSI B;  3KP2 A;  1TWF J;  2VXZ A;  1MIJ A;  2WAD A;  1BOA A;  1XGO A;  2E5Z A;  4DGW B;  4GCL A;  1UI6 A;  1YS7 A;  3L00 A;  3MNL A;  3ZQL A;  3HOS A;  2D45 A;  3BRO A;  2W4S A;  3J81 K;  2QQA A;  4WXH A;  4AC0 A;  3SYT A;  2D1V A;  1XS9 A;  5DTD A;  1AU7 A;  3WHB A;  2MH9 A;  3F6O A;  4EM0 B;  5GAD J;  1IUY A;  1YW7 A;  2IAI A;  4QSH A;  4IPA A;  4Q48 A;  3ECO A;  3IH3 A;  2DI3 A;  3HB9 A;  2OA4 A;  4O6J A;  4A0X A;  3OOP A;  3ML6 A;  2XF7 A;  3TMO A;  3JTH A;  3CLQ A;  3JRA A;  2Q24 A;  4UB8 C;  2PQ8 A;  4PGH A;  3HKZ N;  2H27 A;  1RZ4 A;  2E2H J;  4KA4 A;  1PP8 F;  2F48 A;  4NUB A;  4PCQ A;  4ZYD A;  4UVC A;  3WGH A;  2X51 A;  4KDP A;  1BW5 A;  4XKC A;  5BS6 A;  2XV4 S;  3D5S C;  1T33 A;  5M5W J;  3F0C A;  1ZKG A;  1UST A;  4BS9 A;  1DGR M;  3NWS A;  4FT8 A;  4M6V A;  5M5X J;  3H9G A;  5KAF C;  5D5V B;  3F3X A;  4DYQ A;  1Z91 A;  3OOU A;  2ADU A;  3LMM A;  3SZT A;  4I0B A;  3KYL A;  3O8G A;  1WQ2 A;  4MQV A;  4LD5 A;  2R7V A;  3MZH A;  3QPT A;  1W36 D;  2NP5 A;  3ZPL A;  1VND A;  1ODD A;  3BT9 A;  4M71 A;  3QPH A;  3CO6 C;  1AKH A;  1AKH B;  1LNW A;  2A5Y B;  2LDU A;  1G4D A;  3DPT A;  1TC3 C;  1QZZ A;  1Y8Q B;  1IRG A;  3DEU A;  4LK0 F;  2QGU A;  5E3M A;  2JN6 A;  3JRC A;  4KT6 A;  1FOX A;  2STW A;  4E7J A;  4UDS A;  3QPS A;  2LLK A;  2GUH A;  4I76 A;  4MFE A;  1FWZ A;  5LHI A;  5F27 A;  2FOW A;  5E1W A;  2F5V A;  2P0W A;  5FRN A;  2F2E A;  4G8X A;  5D1R A;  5TIS C;  1K4T A;  3QKX A;  1U0J A;  3HYI A;  1N25 A;  1WJA A;  1BBY A;  2FA5 A;  4JNN A;  3GTP J;  3D1N I;  1ETK A;  4F7Z A;  3W6V A;  4C2M J;  2IS4 A;  4A3K J;  3BQY A;  2VC0 A;  1S72 I;  3W2W A;  2KIU A;  2HWV A;  4C2U A;  5FKL A;  5IY5 H;  3E5X A;  2AO9 A;  2XVC A;  3MKY B;  1J5Y A;  1KQ9 A;  1I5Z A;  2TCT A;  4RAF A;  2Q8K A;  1ENH A;  2Q1Z B;  2RRE A;  5LFA A;  3CF5 F;  3CTA A;  2GOX B;  5KVR A;  4B44 A;  1YQA A;  4ESB A;  4PXI A;  3KET A;  4F91 B;  1T08 B;  5D4R A;  2DDB A;  4KWA A;  1XDU A;  1JT0 A;  2JA6 J;  2HQ5 A;  3VOX A;  4I0A A;  1U9N A;  4A3E J;  1SVO A;  2QLZ A;  5DCM B;  2H94 A;  4RM2 A;  2GXG A;  2Y31 A;  5DUI A;  3OYD A;  2HDC A;  3O60 A;  1B9M A;  2M45 A;  2ISZ A;  4A2U A;  5HS9 A;  4ETS A;  5D8K B;  2JRT A;  1VQM I;  4XLH A;  3H92 A;  3J81 Z;  3QP6 A;  2XF6 A;  3TOA A;  4B1R A;  1IZ1 A;  2CUF A;  2UUZ A;  2LP0 A;  3LL7 A;  4BHB A;  2PJP A;  4CGR A;  2A6H F;  3CMM A;  4QPO A;  4WXC A;  5L3F A;  3HRM A;  2BW3 A;  3GYH X;  3HE0 A;  5FO5 A;  1RES A;  5EFY A;  3L9F A;  1LFB A;  1AOY A;  1DGW Y;  4Q47 A;  4DYR A;  3VIB A;  1YJ9 I;  2VBX A;  2W7N A;  1RR7 A;  1TLH B;  5HDG A;  3DBL B;  3I0T A;  2YR2 A;  1NH3 A;  3ZXS A;  5L3C A;  3P7N A;  2K9N A;  2NS7 A;  1TP4 A;  3OL3 A;  4HSR A;  2K9S A;  1ZQ3 P;  4P5O A;  2VIX A;  4NEL A;  3OYI A;  2ZCN A;  2DA3 A;  2WA0 A;  2OER A;  4S05 A;  3RSN A;  2HOE A;  4NB5 A;  4U0V A;  3H5N A;  4XKV A;  3H5A A;  2I8D A;  2LF8 A;  5JLW A;  4A3C J;  1R71 A;  1P9Q C;  3PL8 A;  1MW7 A;  1FBS A;  2E1M C;  3DU5 A;  3ZQQ A;  3CJR B;  2VJI A;  2L7F P;  3R6S A;  4BQN A;  1I1S A;  3SDB A;  1IN6 A;  4WIB A;  1BW6 A;  2ZXJ A;  3DEE A;  1BC8 C;  3S16 J;  2LMD A;  5LRR A;  2IGM A;  4II2 A;  2HYG D;  1S3J A;  3J7Z I;  2HPI A;  3LA2 A;  3ZMD A;  2PJR A;  4C3H J;  2PJR B;  2XKO A;  3K10 A;  4WF2 A;  1SAN A;  2CW8 A;  4KUM A;  1MBE A;  2L9R A;  2R4G A;  3PSF A;  2ZO4 A;  4FE4 A;  5HLI A;  1S7A A;  3HJE A;  3I56 I;  5CPR B;  2MC4 A;  2ISY A;  3TGN A;  1BI1 A;  5D19 A;  3FDY A;  3IL2 A;  3I53 A;  2OAZ A;  1J59 A;  4M9X A;  2PBX A;  2CSO A;  3K70 D;  5KAI C;  5CJ9 A;  4LLL A;  4YG2 F;  3ZGK A;  3NNR A;  1H8A C;  2WTE A;  4IL6 C;  4RM3 A;  1VQL I;  2YVX A;  3FZV A;  2XIG A;  2ZNY A;  3T8R A;  2LKS A;  4HV6 A;  3HHG A;  4BJ5 C;  4O3M A;  2XSJ C;  2BY1 A;  1LVK A;  2Z99 A;  2EFQ A;  2ESH A;  3DF8 A;  2ZY9 A;  2ZJQ F;  4HEA 2;  3K8P C;  3HC7 A;  3S14 J;  1XSV A;  4M3B A;  1DPU A;  3VDX A;  1QRY A;  2L02 A;  4UUS B;  3AL0 B;  3ZMZ A;  4XLF A;  4MTE A;  5K7F A;  2R7S A;  1MSF C;  1FYK A;  1VFC A;  2FJI 1;  5IP9 J;  4I01 A;  1IDZ A;  2NS0 A;  4BXU A;  5CVR A;  2I5U A;  2EQR A;  5DDG A;  1GLN A;  1IRF A;  3QP5 A;  5D5U B;  3D5L A;  1EA3 A;  4BGD A;  3CUQ B;  4JKZ A;  2B0L A;  2MLK A;  5B1A H;  2HVR A;  1QO0 D;  2PMZ N;  3B81 A;  1MBJ A;  5E8I A;  5DUK A;  3FXR A;  1QHG A;  5E18 F;  2HDD A;  5CVI A;  3CWR A;  3KE2 A;  3W6K B;  4S04 A;  3L2U A;  5JLX A;  1OCT C;  1UFM A;  3OL4 A;  1E3P A;  5CVV A;  4N0B A;  5AIP A;  1HCR A;  3CZ6 A;  4Y15 A;  2REK A;  1UHM A;  3OIO A;  1SAX A;  1YG2 A;  3K4C A;  4L9T A;  3TKY A;  1U8B A;  3MCZ A;  5H6Q A;  3F22 A;  3HRS A;  3FHN A;  3BR2 A;  3M8J A;  2MAB A;  2RKH A;  3FXO A;  4PSW A;  2WAE A;  2X6W A;  4B3X A;  4LOC A;  3ZR8 X;  2ZCM A;  4HV5 A;  4JYK A;  3PM1 A;  2KKO A;  3BHQ A;  1BIB A;  2E34 A;  4UY8 I;  4ZYG A;  2EIJ H;  2NRA C;  3NRV A;  2CJJ A;  2HZD A;  3B02 A;  2RV8 A;  2Z16 A;  3C3W A;  2X6Y A;  5BQT A;  3JCU C;  2UXI A;  2HQA A;  2ZSH B;  3FMR A;  3TDZ C;  3WU0 A;  2PMU A;  5HDN A;  4MK6 A;  3CCY A;  4FAS D;  3HZJ A;  4HQM A;  2EFW A;  2VOD A;  2QM3 A;  3F23 A;  4DZJ A;  3PNY A;  3S15 J;  2JQ7 A;  2PX9 A;  1TQM A;  2LRE A;  4MFD A;  2WWY A;  2MC3 A;  1RPW A;  3SWH A;  5CKT A;  3WTS C;  3NWT A;  3HUG A;  3HGY A;  2E7W A;  3HUG B;  3ECH A;  3F8F A;  3DFG A;  2O7T A;  1O4X A;  2VI6 A;  1W36 C;  2L01 A;  1UZC A;  1XMK A;  4AIJ A;  3FM5 A;  2IA2 A;  1IRZ A;  2W25 A;  3VW0 A;  3HTU A;  2W57 A;  1XSX A;  2K85 A;  5ERI A;  3JW4 A;  3A2K A;  5IT3 A;  4IHY A;  5D6F A;  4BU2 A;  2ZNZ A;  3BQZ A;  4G6D A;  5IP7 J;  5JVT A;  3OYH A;  2EV0 A;  2JWT A;  1UG2 A;  2JZY A;  2KJB A;  1UG0 A;  2RGV A;  3FBN B;  1ZAO A;  2X0L A;  2XC7 A;  2VJ5 A;  4HX8 A;  1QU3 A;  3DU6 A;  2AXL A;  2CO5 A;  2QSH X;  3T1B A;  4I2O A;  3IKT A;  4U7B A;  1FX7 A;  1W0U A;  4EGZ A;  1WJD A;  2L7K A;  4BY1 J;  4BQA A;  2LH9 A;  2G7G A;  2HKX A;  2FU4 A;  3L09 A;  3DBR B;  4A5N A;  3SZP A;  3ABT A;  1VQ7 I;  2K9L A;  4E6K G;  2OU2 A;  1LDK B;  4MEX F;  5DD8 A;  2NVT J;  4PJL A;  4E7S A;  2DT7 B;  2MD0 A;  1GVD A;  4ENJ A;  3EGQ A;  4A3I J;  3BPV A;  2QQ8 A;  3QOP A;  3VSL A;  1IXR C;  1K6O A;  4LG0 A;  3QU3 A;  4LG0 B;  1EF4 A;  4GGG A;  3L2C A;  1WSU A;  2Z33 A;  2CQX A;  3O2P E;  2BE5 F;  2LVS A;  5LGT A;  3VVY A;  2M8E A;  4DOZ A;  3QU6 A;  3BPX A;  3EQL F;  5IT9 K;  1MH4 A;  2DFE A;  4BE1 A;  2R7Q A;  1OCO H;  2HOS A;  5E1X A;  1UMQ A;  3LNQ A;  2CV0 A;  5CLS A;  2UXO A;  2XB5 A;  1J2X A;  4NC7 A;  5EZH A;  3BZ6 A;  3HTJ A;  1P6R A;  3V7R A;  2FF4 A;  2Y75 A;  2VJJ A;  3HEF A;  2TRT A;  1HF0 A;  1BJA A;  3HIF A;  1A04 A;  3TP3 A;  3W2V A;  3A1Y A;  1A35 A;  1A6I A;  4Y4R A;  5FFX A;  5K1Y A;  1PUF A;  2W84 A;  4RAY A;  1QQI A;  3VOD A;  2E1C A;  3VYT B;  3DXJ F;  4XR6 A;  4YIR X;  2L9V A;  3S93 A;  1BC7 C;  4AUX A;  3COL A;  2QTQ A;  5A2Q K;  1T56 A;  4MEY F;  1MH3 A;  2M7A A;  3DTK A;  5JVG F;  2HOT A;  5HDK A;  1DP7 P;  3ASN H;  3IC7 A;  5F0F A;  3ZMV A;  3BOQ A;  4I6Z A;  5ICE A;  1R4M B;  1OFC X;  3OY9 A;  4OD4 A;  1U3E M;  1B4A A;  3KX2 A;  4HYE A;  1HBX G;  3SZG A;  4M6X A;  3A02 A;  4M9Z A;  1SMT A;  3A01 A;  3A01 B;  3HDD A;  3BJB A;  2EH3 A;  2OQG A;  2LY1 A;  3HSR A;  3LOC A;  4M3G A;  2XSD C;  2HYT A;  1P92 A;  1GXQ A;  1I39 A;  4E7Z A;  1FP2 A;  2KIF A;  4CCK A;  5LEK A;  3A03 A;  3T8T A;  1FOK A;  2DQL A;  3ISP A;  1VI0 A;  2GXA A;  5D4S A;  2KJC A;  4U7D A;  2O3F A;  1NG6 A;  2KHM A;  3KZ9 A;  4BDZ A;  5FGM A;  2RN7 A;  2QSG X;  3DLL F;  1R1V A;  5GPC A;  2CH0 A;  3CCV I;  4CZC A;  3GO5 A;  3IUO A;  5ED4 A;  2KLO A;  4PJ0 C;  2A5W A;  2DMN A;  3D0S A;  3R61 A;  1OMI A;  3E1S A;  1O3S A;  3G7R A;  3N4M A;  2BEO A;  3IAS 2;  2W48 A;  1USS A;  2DMQ A;  2YVE A;  3Q0U A;  2DA2 A;  1T95 A;  2LBF B;  4RB3 C;  2KIS A;  4WK8 F;  2B63 J;  3BDD A;  2FNP A;  3I59 A;  3I59 B;  2B7E A;  2JUC A;  3KCC A;  2H6C A;  1APL C;  3R0A A;  3EUH A;  2Z2S B;  3G1L A;  3PFY A;  3VFZ A;  1FBU A;  2F5E A;  2CW0 F;  4W1U A;  1WPK A;  2DYS H;  1YLF A;  3OMY A;  4BL0 B;  3WTY C;  2FE3 A;  4XN0 A;  1WZ2 A;  3PPB A;  2ID6 A;  2A07 F;  2AS5 F;  2BY3 A;  3WTT C;  2GXB A;  2UWM A;  2R3S A;  2CS3 A;  1VQN I;  3KZI C;  5HOO A;  3MD2 A;  2L9N A;  4HNV A;  1FT9 A;  3CJQ B;  1JJ6 C;  3V8K A;  3E6C C;  2ZME A;  2ZME B;  2VXD A;  5KNL A;  1GV5 A;  5D6E A;  3GZN B;  1S7E A;  1H0M A;  1JKO C;  4LK1 F;  2DFF A;  3GFM A;  1WH5 A;  2HGC A;  2VBW A;  3HIM A;  4XLN F;  4CCM A;  4HA8 A;  4GCK A;  4G9Y A;  5IT9 Z;  1JHF A;  3K1P A;  4HKU A;  4HF0 A;  4A3D J;  1HSJ A;  3C2B A;  4C2M A;  4Z2Y A;  2Q0O A;  2CUZ A;  2NP3 A;  2PN6 A;  3BR6 A;  4P96 A;  3ZP5 A;  2XAU A;  4UXN A;  4ESJ A;  5F1J A;  5BMZ A;  4IHW A;  3A4C A;  3K7A J;  4PZJ A;  2X1D A;  2PEX A;  2K7L A;  4WWC A;  1B8I B;  3DLA A;  1TWH J;  3ZMT A;  3ZMS A;  5CXI A;  2LFB A;  4L5J A;  2M5W A;  3G56 A;  2M4G A;  1UAA A;  3GFL A;  5A2Q Z;  4LIT A;  1WJ5 A;  4F93 B;  2K4B A;  1Z6T A;  1T8I A;  3CUO A;  3AG1 H;  2WV1 A;  2BOL A;  1FPQ A;  3NQO A;  3RD3 A;  1STZ A;  2EFN A;  2RAS A;  1OCR H;  1CQT A;  1FOY A;  4KNY A;  4CHU A;  4ZDP A;  1OKR A;  2O8X A;  4LJZ F;  3VEP A;  3RQ4 A;  3FF5 A;  4OMZ A;  1BIA A;  1QZY A;  1T0F C;  2XAF A;  1JUM A;  4L0Y B;  1ULY A;  2M9H A;  2QQB A;  1D8J A;  2DK8 A;  3B6A A;  4XRF A;  3TW7 A;  1R7J A;  1NHA A;  2NVX J;  2GA2 A;  3GZ5 A;  3ABK H;  1W5S A;  3RPQ A;  3AG2 H;  4L0Z B;  1S7O A;  3S32 A;  3V6G A;  1UEL B;  1MJ9 A;  1IF1 A;  1HST A;  1D5V A;  4ZJZ A;  2IW5 A;  1IUF A;  4CCL A;  3RPU A;  2VOO A;  4MGR A;  4E7K A;  3AG4 H;  1KA8 A;  3RCO A;  4AVP A;  5LRS A;  2IS6 A;  1HDP A;  4D1Q A;  1I27 A;  3Q9S A;  3WHC A;  4XNF A;  3G73 A;  3QAH A;  4G7Z F;  2MA3 A;  3JRB A;  3GBG A;  3EUA A;  4HF2 A;  2OV7 A;  1E3H A;  5IPA A;  1LFP A;  1MBF A;  2FQ3 A;  1KYW A;  3F8C A;  4D5C A;  3K0L A;  2M1B A;  3OS2 A;  1FJL A;  1IJW C;  1FZP B;  2E36 A;  3KNW A;  3FK6 A;  4BUP A;  2DPU A;  4ZDO A;  4XKW A;  4EV0 A;  4AIK A;  1R1U A;  3K69 A;  4X6A J;  1OCZ H;  5J4V A;  1HW5 A;  5D5W B;  3LQR A;  3OYK A;  4UHT A;  5J1R A;  2ZXH A;  1UCR A;  1RC9 A;  1S9H A;  1OQY A;  2OZ6 A;  1A31 A;  2WB1 A;  1W1W E;  3C18 A;  3QQA A;  3GX4 X;  2KFD A;  5E3N A;  3BG7 A;  5FB2 A;  3WTX C;  1KU3 A;  2NOG A;  2LYC A;  3KP4 A;  1EV7 A;  5GPA A;  2HZT A;  1Z3X A;  1G3Y A;  4DVY P;  4RB0 A;  3JAM K;  2COB A;  2DPD A;  1ZGA A;  5CVU A;  5C4J J;  3EYY A;  4XIC A;  2WV0 A;  2JA7 J;  5LBQ A;  3HTS B;  3M07 A;  2DFI A;  4QTR A;  1WJC A;  3VW1 A;  2VKH A;  1UJ8 A;  5D5X B;  5K5Q A;  4UUV A;  1IV6 A;  2W1O A;  4XM3 A;  4BE2 A;  3HSE A;  1OR7 C;  5IYD J;  2VB6 A;  3DKY A;  2IU5 A;  4N9H A;  2FX0 A;  2V1N A;  3MKL A;  4NBQ A;  3PIO F;  3DV8 A;  3K2A A;  4R1H A;  4IJA A;  4XON A;  3DEW A;  3K4K A;  3W3C A;  5EZG A;  1MZB A;  1A36 A;  1U5T A;  4UNO A;  4P55 A;  3JRD A;  2LOO A;  1BN5 A;  1IXS B;  2X1C A;  3HPH A;  2VQC A;  5DM7 F;  3P9T A;  3F8N A;  1O7F A;  3BTL A;  2VUM J;  2QEN A;  3X2Q H;  1RR8 C;  1S29 A;  2HVS A;  1OCP A;  2CFO A;  2WAQ A;  3I71 A;  3UKG A;  1OYY A;  2R7Z J;  2LKX A;  4PDK A;  5AIQ A;  2OF7 A;  2IA0 A;  2L2O A;  3GCM A;  1WJB A;  4QPQ A;  2WY8 Q;  3SEQ A;  1B9N A;  5B66 C;  3GEU A;  5C44 J;  4BQQ A;  1L3L A;  2QQ9 A;  4MTD A;  1FTT A;  2XRL A;  2DYR H;  3K6G A;  3FRQ A;  3BZK A;  2DG8 A;  2NNN A;  3I58 A;  2WB1 N;  1OCC H;  2E2J J;  1Z05 A;  3HRU A;  2ZJ2 A;  4IRI A;  1LB2 A;  1U6G A;  4P1W A;  5JHF A;  3PO3 J;  3PJR A;  1TL8 A;  3H36 A;  2FOK A;  2G7H A;  3AL0 C;  3DP7 A;  3JRG A;  4IRG A;  2M0C A;  3TOB A;  4ESF A;  3HOU J;  3WTZ A;  1SFX A;  2K86 A;  1FIP A;  1ZTR A;  3H9Q A;  4DBQ A;  3HTH A;  2F6C A;  1Z7L A;  1D8K A;  5CW8 A;  1LE8 A;  2OTL I;  1LE8 B;  3CUQ C;  1RUO A;  1X4P A;  3BTC A;  4IHX A;  1BR4 A;  4LIV A;  3ROU A;  2V57 A;  2GOM A;  3Q5F A;  1ZG3 A;  1TW2 A;  2LG4 A;  2FJ1 A;  1SFO J;  1JKQ C;  2RC4 A;  2Y9Z A;  4BNC A;  1T6S A;  4L5E A;  4BBR J;  3TDU C;  3WTU C;  3E5Q A;  5FLX K;  2VQL A;  3ABM H;  1WCM J;  4RGR A;  2P8T A;  3OYM A;  1O3T A;  2JPC A;  2DOE A;  2PG4 A;  2FMY A;  4ANJ A;  2KRH A;  2H1K A;  3VP5 A;  2GQQ A;  5HAW A;  1PYV A;  2HDW A;  2K3P A;  1FY7 A;  5DCF A;  5ILS A;  4MNU A;  4NQW A;  2Y69 H;  2WAQ N;  2BW3 B;  4NQW B;  5HNF A;  5EYR A;  1I6X A;  5DS9 A;  5FKM A;  1R6R A;  2M30 A;  3BRU A;  3VOE A;  3E5U A;  5K7Z A;  2EJR A;  1LQ1 A;  2Y0S A;  3BG3 A;  2PMH A;  5CQE A;  5K7H A;  1QHH D;  3JAM Z;  2YX4 A;  4YFN F;  2MBF A;  2K40 A;  3EDP A;  3OIQ A;  2A6T A;  3IH2 A;  3TW6 A;  5EDN A;  3CQZ J;  3ELK A;  1XSD A;  2FRH A;  3OYG A;  3OR2 C;  3ZQ7 A;  2F5D A;  3WOD F;  2M87 A;  4DZP A;  4EEF G;  3RPU D;  4X1E A;  2H8W A;  2PMZ A;  2ZJR F;  3CCM I;  2OQR A;  4BDY A;  3MFK A;  1LEA A;  1KU2 A;  5TRD A;  4GFB A;  4IHV A;  3BJ6 A;  3ZN0 A;  3J7Y J;  1X3Z B;  1ACI A;  3M8E A;  3HOX J;  2ELH A;  1Y56 A;  4A3M J;  4CCN A;  4IOA F;  2Z5U A;  5FLV A;  2DA7 A;  4XQF A;  3CME I;  1V55 H;  5HLT A;  1FSE A;  5LHG A;  3IUV A;  3S1N J;  2IT0 A;  2A3S A;  1TNS A;  3S3O A;  2RQP A;  4J19 A;  2MG4 A;  2RNG A;  4A5M A;  4OIP F;  4HAM A;  1WWX A;  4JX5 A;  3H5R A;  3J7A Y;  1FEX A;  1HQC A;  3JSO A;  2LTP A;  3FXL A;  4W97 A;  2ZCW A;  4O5V A;  2BXY A;  2V4J C;  3PIP F;  2QSF X;  4DJA A;  4L62 A;  2VBY A;  1CGP A;  4HNU A;  4L9J A;  1PP7 U;  1G59 A;  3ZN1 A;  3WGG A;  4DYC A;  4M6Y A;  5E17 F;  4HDV A;  4R8H A;  2TDX A;  2BGC A;  1U9O A;  2MFZ A;  5KHD A;  1Y8R B;  5GP9 A;  4S0H B;  3SQN A;  3V8J A;  1P7J A;  1N77 A;  4V2G A;  3H3Z A;  3D5R C;  1P4W A;  4II3 A;  2CQN A;  4C2T A;  2DMT A;  3S2H J;  1OPC A;  3BLY A;  1D0Y A;  2JSP A;  2IGN A;  3CO7 C;  2XAG A;  2Y0S N;  4BH9 A;  5L3E A;  4XOP A;  5ILU A;  1S5L C;  4AVZ A;  1Z0X A;  1YJW I;  2MH2 A;  2E5N A;  5EJC A;  5LGU A;  1IC8 A;  1YTY A;  4KJZ A;  1O3Q A;  4C3I J;  2O8K A;  4XN3 A;  2KP6 A;  1B72 A;  3CC4 I;  1B72 B;  3I4M J;  4BBS J;  2YPR A;  4BEH A;  4BEH B;  4CCO A;  4A3F J;  1IDY A;  1ZHF A;  2OCE A;  4RS8 A;  1J7K A;  3ONQ A;  4CYD A;  4MIM A;  1VQO I;  3QOD A;  1OIS A;  4EM2 A;  2PFV A;  1VQK I;  4BY7 J;  1OYI A;  2Y0M A;  3P9C A;  4UVA A;  3IKV A;  3RDI A;  1Y1V J;  1J0R A;  5L3G A;  5FLX Z;  4HLY A;  1ZK8 A;  1W4M A;  2XF5 A;  1JI8 A;  2R7W A;  3FHZ A;  3GTJ J;  3BR3 A;  3MWM A;  4EGY A;  3JSJ A;  4OIQ F;  2P6T A;  4MHG A;  1ERD A;  1UHS A;  1HKT A;  3LSI A;  3HG9 A;  3OSF A;  5FGL A;  4KIF A;  2GZW A;  3F6V A;  1IG7 A;  2JSC A;  4RGX A;  4HW0 A;  5EEG A;  4F92 B;  3CCQ I;  3VPR A;  1LEB A;  5JFR A;  1Y6I A;  5D18 A;  1TWA J;  2X6X A;  3UNG C;  3L1P A;  2G7U A;  4LG3 A;  2AHQ A;  4NNJ A;  5CQG A;  2FBQ A;  3CJN A;  2RHA A;  1NG7 A;  1QVU A;  2VC1 A;  4LB6 B;  2V1D A;  4IRH A;  1XCV A;  4MXM A;  2OI8 A;  4CGZ A;  5GAE J;  2JJ7 A;  1S6L A;  2VE8 A;  4EVI A;  2CUE A;  2M7B A;  1WI9 A;  1E17 A;  1FTZ A;  1H89 C;  1EH7 A;  3ZQI A;  1E3O C;  2DJN A;  2DJI A;  2K27 A;  2DT6 A;  4MQ9 F;  2FQ4 A;  3GW2 A;  1BL0 A;  3KZZ A;  1R5I D;  1ETV A;  1ZN2 A;  2FBI A;  4FCY A;  2WC2 A;  3W6J B;  3WE2 A;  2QWT A;  3V42 A;  5HNH A;  1R9T J;  3BY6 A;  5FD5 A;  3OYA A;  3PFI A;  3S2W A;  2K4J A;  1TTY A;  2OJE D;  3K1M A;  1W7P A;  5AON A;  3FXJ A;  2PFB A;  2DTR A;  3GXO A;  2FBH A;  2M3A A;  2VT2 A;  3DCF A;  1J9I A;  1U78 A;  3ZOB A;  4IXA A;  3CC2 I;  3KYC B;  3U2R A;  1K61 A;  4HDU A;  3BG6 A;  1Q1H A;  2HXO A;  1TWG J;  1V54 H;  3E7L A;  1EKE A;  3MZ8 A;  5EEA A;  1FNN A;  2DTZ A;  1EH6 A;  2QWW A;  1G8X A;  4JQF A;  2IS2 A;  4RMN A;  3H1C A;  3IHU A;  3KEY A;  1JTY A;  4U0W A;  1WJE A;  1AHD P;  2NNY A;  3BG9 A;  2DCE A;  3DKX A;  4BHP A;  2R7F A;  1P4A A;  5KCM A;  1BR1 A;  2K5C A;  1SGM A;  2DK5 A;  4EJV A;  4UUT A;  3RKY A;  4G7H F;  1I6H J;  4LFU A;  2F4O B;  2R93 J;  4YRV A;  2FEZ A;  2GA1 A;  1LFU P;  2WBM A;  2ZOZ A;  5J4Y A;  2QKL B;  3HL2 A;  3QBM A;  3RKW A;  1RI7 A;  3WG7 H;  4MLO A;  3J80 K;  2R7U A;  1XTA A;  1MDM A;  1BI2 A;  5FRO A;  1MDM B;  1HLV A;  4ABZ A;  4KT5 C;  2YSR A;  3OR1 C;  1S8N A;  3OS0 A;  2HR3 A;  3IP4 B;  2H1L A;  3M1C A;  3TO7 A;  4A93 J;  1ETW A;  2ZME C;  1ETY A;  2BZT A;  3E3V A;  3IWZ A;  4B4C A;  4XSZ F;  1TT5 B;  4IHS A;  5E3L A;  4EM1 A;  3MAJ A;  4G7O F;  1RET A;  2FML A;  2F4I A;  2ZXW H;  3QPL A;  3K2Z A;  6PAX A;  1BI3 A;  1KQ0 A;  2XRN A;  2H8R A;  2CU7 A;  4OIO F;  4E7L A;  2AQE A;  5IOY A;  2GIZ A;  1T38 A;  1DU6 A;  2IBD A;  4LLN A;  3IAM 2;  4GO1 A;  3GVA A;  2LY9 A;  3RTR A;  4D0P A;  2IS1 A;  4XLC A;  3BG5 A;  2K9Q A;  2ZOY A;  4LIU A;  4Y33 A;  5HBU A;  4I7H A;  3T6N A;  1MBK A;  3GEZ A;  4HPQ A;  3M4O J;  1SVM A;  4JP0 A;  4M72 A;  1NK2 P;  4DQ2 A;  2O03 A;  3ABL H;  3VWB A;  3E6D A;  5E79 C;  1YIO A;  2EZI A;  3TP0 A;  4AWX B;  1HXD A;  5K5R A;  3HHH A;  3BJA A;  2WUI A;  1X58 A;  4NN1 A;  5DD4 A;  1PUF B;  1FOW A;  5BOX A;  4HNT A;  2O61 A;  3GTM J;  1MBH A;  3E7Q A;  4QIW N;  2JPB A;  2EFP A;  1IN7 A;  4YFX F;  2R7R A;  3GTO J;  2LK2 A;  4ZDL A;  1A6Q A;  3JRI A;  3HTI A;  3G71 I;  1JGS A;  4A3L J;  3SDG A;  3PNV A;  2L7Z A;  1ETQ A;  3ZCO A;  1ZH5 A;  2O6G E;  3RJP A;  5B3S H;  5FLM J;  2ME6 A;  2PI0 A;  2V9P A;  5H6R A;  2VOP A;  3ASO H;  3OYL A;  2KL4 A;  3DKW A;  4Y17 A;  4AC6 A;  3DTE A;  3WG9 A;  3HGG A;  4G6T B;  3LWJ A;  4OIN F;  3VTI A;  3BTI A;  1IW7 F; 
#chains in the Genus database with same CATH homology
 1YRN A;  1YRN B;  5IPA A;  3FIW A;  1MBF A;  1GDT A;  4B1R A;  4D5C A;  2CUF A;  2LP0 A;  3KNW A;  1FJL A;  1IJW C;  4AF5 A;  4CGR A;  3FK6 A;  3LHQ A;  2EZH A;  4X6A J;  3HE0 A;  3NXC A;  1MBG A;  1RES A;  5EFY A;  1MNM C;  3VVZ A;  3IV5 A;  5J1R A;  1LFB A;  4DYR A;  3VIB A;  5FHP A;  3TED A;  2JK3 A;  1RR7 A;  3RZD J;  1ZR4 A;  3QQA A;  2X48 A;  5E3O A;  5EGO A;  5EGO B;  5E3N A;  2K9N A;  2NS7 A;  1WI3 A;  3JRH A;  2K9S A;  2NOG A;  1OJL A;  1ZQ3 P;  1JTX A;  4NEL A;  3GTQ J;  5GPA A;  1DU0 A;  2ZCN A;  2DA3 A;  2OER A;  1JKP C;  5HOD A;  4XID A;  2COB A;  4BXX J;  5JLW A;  4A3C J;  1W0T A;  3GZI A;  5C4J J;  4XIC A;  2JA7 J;  1ORK A;  4QTR A;  2L7F P;  3VW1 A;  1IV6 A;  3ZQH A;  2VKE A;  3BNI A;  1BW6 A;  2NX4 A;  2M8G X;  4ACI A;  2XGE A;  1TWC J;  2OPT A;  3S16 J;  5IYD J;  2VPR A;  1BA5 A;  2IU5 A;  2M2E A;  3Q0V A;  2G7L A;  3Q3S A;  2FX0 A;  3MKL A;  2XGD A;  4XK4 A;  4C3H J;  3K2A A;  1SAN A;  2DN0 A;  3DEW A;  3HOW J;  2XPW A;  1MBE A;  5EZG A;  3LSP A;  1X2M A;  1ETO A;  2L9R A;  1I3Q J;  3G1M A;  3JRD A;  2HYJ A;  9ANT A;  1Z77 A;  4RBO A;  4FE4 A;  2F07 A;  3Q0W A;  3P9T A;  2MW8 A;  2M34 A;  5D19 A;  3BR0 A;  3BTL A;  2NS8 A;  2VUM J;  2RAE A;  1Y1W J;  1OCP A;  2HI3 A;  2PBX A;  3UKG A;  2R7Z J;  3NNR A;  2LKX A;  1H8A C;  2QOP A;  2OF7 A;  5C4X J;  3GEU A;  4GFL A;  5C44 J;  2XPV A;  5IOZ A;  2XDN A;  2E19 A;  3LJL A;  2CRG A;  1FTT A;  4M3E A;  2XRL A;  1NTC A;  5EF6 A;  3FRQ A;  2DG8 A;  3S14 J;  5M3M J;  4M3B A;  2WB1 N;  2E2J J;  2ME0 A;  1JGG A;  1JUS A;  1F36 A;  1QRY A;  4UUS B;  3CMY A;  5K7F A;  1MSF C;  1VFC A;  4D7N A;  5IP9 J;  3PO3 J;  1IDZ A;  2EQR A;  3I4N J;  3B6C A;  3JRG A;  2M0C A;  4D5F A;  3HOU J;  2R5Y A;  2R5Y B;  2YU9 J;  4JKZ A;  2DMU A;  2CQQ A;  4NDL A;  3B81 A;  2PMZ N;  1FIP A;  1ZTR A;  1MBJ A;  3HTH A;  2GBY A;  4DW6 A;  2DG7 A;  5CW8 A;  3RQI A;  1LE8 A;  1LE8 B;  2R0Q C;  3ZQC A;  2HDD A;  3NI7 A;  3CWR A;  3BTC A;  4IHX A;  2GLO A;  2V57 A;  5JLX A;  1OCT C;  1NK3 P;  1HCR A;  2G3B A;  2REK A;  3VOK A;  2FJ1 A;  3OIO A;  1SFO J;  1JKQ C;  4A3J J;  1P7I A;  2Y9Z A;  4L5E A;  3O8H A;  3H0G J;  4BBR J;  1U8B A;  1WCM J;  4GCT A;  3BR2 A;  2DA4 A;  2XB0 X;  2ELK A;  2DA1 A;  1GT0 C;  1FIA A;  2H1K A;  3VP5 A;  5HAW A;  2QIB A;  4LOC A;  1ETX A;  3BR1 A;  2ZCM A;  4MO7 A;  4JYK A;  3PM1 A;  3BHQ A;  4JX4 A;  2YUS A;  2WAQ N;  5EYR A;  5DS9 A;  5FKM A;  5H9T A;  3BRU A;  3F1B A;  3FKI J;  4G12 A;  2CJJ A;  3LSG A;  5K7Z A;  4A69 C;  2UXI A;  3BG3 A;  5K7H A;  3LSJ A;  2HKU A;  2K40 A;  2YS9 A;  3SJM A;  4MK6 A;  3CCY A;  2GFN A;  3IH2 A;  3TW6 A;  5EDN A;  3ZQF A;  4B3A A;  4DZJ A;  4CYC B;  4CYC A;  4A3G J;  2UXU A;  3CQZ J;  3S15 J;  3RZO J;  2PZ9 A;  4MFD A;  5FKO A;  1Q1V A;  2O9L A;  4DZP A;  1RPW A;  4EEF G;  4X1E A;  4GFB A;  4ME9 A;  4IHV A;  3NRG A;  3HGY A;  2NVQ J;  3C07 A;  1RKW A;  3CDL A;  2O7T A;  1O4X A;  2VI6 A;  3HOX J;  2L7M P;  1H88 C;  2D5V A;  5DAJ A;  4A3M J;  2Y2Z A;  1ITY A;  5FLV A;  2DA7 A;  1IRZ A;  3VW0 A;  2L0K A;  3IUV A;  3S1N J;  4IHY A;  1F43 A;  3EUP A;  3HM5 A;  3MN2 A;  2Y9Y A;  3S1Q J;  3BQZ A;  5IP7 J;  4J19 A;  2MG4 A;  2JWT A;  3FK7 A;  1UG2 A;  3PAS A;  4AYB N;  4JX5 A;  1FEX A;  2UXH A;  3M3Y J;  1XC5 A;  4JL3 A;  2XPU A;  2LTP A;  4FIS A;  4W97 A;  3BTJ A;  5F0C A;  1G2H A;  1W0U A;  3KKC A;  3VUQ A;  4L62 A;  3RH2 A;  5K58 A;  4BY1 J;  5C3E J;  4DYC A;  2IEK A;  5BNG A;  3AQS A;  2G7G A;  4BKX A;  2JA8 J;  2DA6 A;  3OSG A;  3LSR A;  3JRE A;  1U9O A;  5F08 A;  2X9D A;  5GP9 A;  3BR5 A;  1ZGW A;  2R5Z A;  2R5Z B;  4S0H B;  5IYB J;  1P7J A;  2NVT J;  4V2G A;  1JJ8 C;  1GVD A;  2R92 J;  3EGQ A;  4A3I J;  2DMT A;  2KDZ A;  3S2H J;  3S17 J;  1EF4 A;  2LR8 A;  2CQX A;  2Y0S N;  2LVS A;  3VVY A;  1Z0X A;  4XRS G;  1HDD C;  3RKQ A;  3H3V K;  3CRJ A;  1IC8 A;  1MH4 A;  4C3I J;  2VKV A;  2O8K A;  4A3B J;  1B72 A;  4M3D A;  1B72 B;  2HOS A;  3JRF A;  4A3F J;  3I4M J;  3HOV J;  4BBS J;  1UMQ A;  1IDY A;  3LNQ A;  2FD5 A;  5FKN A;  1B8I A;  2UXO A;  2XB5 A;  3VVX A;  3S1R J;  4MIM A;  3NAU A;  5EZH A;  3HTJ A;  2ID3 A;  5FJ8 J;  3HOZ J;  1HF0 A;  3HEF A;  2TRT A;  1WGX A;  2X6O A;  4V2F A;  3TP3 A;  1RKT A;  2I10 A;  4BY7 J;  1A6I A;  2ECC A;  1Y1V J;  1PUF A;  1GUU A;  1ZK8 A;  2MSY A;  3FIS A;  1A5J A;  2ECB A;  4AUX A;  5IP6 A;  3COL A;  1WH7 A;  3GTJ J;  3S1M J;  3BR3 A;  3VW2 A;  3JSJ A;  3G1O A;  4FE7 A;  2QTQ A;  2E2I J;  5C4Y A;  1UHS A;  1T56 A;  5M3F J;  1MH3 A;  1MSE C;  3OSF A;  2HOT A;  2ZCX A;  2W53 A;  2WGB A;  3ON4 A;  5FGL A;  3V78 A;  1IG7 A;  5F0F A;  4I6Z A;  1VF9 A;  3VPR A;  2DA5 A;  5D18 A;  1OFC X;  1TWA J;  3L1P A;  1JKR C;  2AHQ A;  4XRS A;  3GTG J;  2FBQ A;  3HTA A;  2P81 A;  2QCO A;  2RHA A;  4Y52 J;  1JUP A;  1QVU A;  3ZQG A;  3A02 A;  3HDD A;  3A01 A;  5FKK A;  3A01 B;  3BJB A;  4RDU A;  2EH3 A;  4MXM A;  5AQC A;  2G7S A;  2EBI A;  2OI8 A;  3SFI A;  2GM4 A;  2JJ7 A;  5EG0 A;  3GTL J;  2CUE A;  5EG0 B;  1I50 J;  3LOC A;  4M3G A;  2XSD C;  1QVT A;  2XGC A;  1H89 C;  1FTZ A;  3ZQI A;  2HYT A;  1E3O C;  2DJN A;  5F0H A;  2LD5 A;  3JR9 A;  2FQ4 A;  3BCG A;  1BL0 A;  3A03 A;  2EZK A;  5J1U A;  1VI0 A;  2YVH A;  1ETV A;  4FCY A;  2QWT A;  3CJD A;  2JMW A;  1TWF J;  1R9T J;  3KZ9 A;  4GCL A;  1UI6 A;  2Y30 A;  3MNL A;  2G0E A;  3ZQL A;  2KT0 A;  3IH4 A;  5GPC A;  4AC0 A;  1XS9 A;  5DTD A;  1AU7 A;  3DCF A;  3WHB A;  2DMN A;  1U78 A;  3ZOB A;  2IAI A;  4QSH A;  5J1Y A;  2N8G A;  3IH3 A;  3HB9 A;  3HOY J;  1IGN A;  3G7R A;  1K61 A;  3DPJ A;  3JRA A;  2W48 A;  2HXO A;  5CXG A;  1TWG J;  2Q24 A;  2O7O A;  4D7M A;  2DMQ A;  3E7L A;  2YVE A;  3ON2 A;  3Q0U A;  5EEA A;  2DTZ A;  2DA2 A;  2ZB9 A;  3HKZ N;  1GV2 A;  2B63 J;  1JTY A;  2E2H J;  1BJZ A;  1AHD P;  4ICH A;  3BG9 A;  1APL C;  3G1L A;  1BW5 A;  3S5R A;  2E1O A;  4W1U A;  1SGM A;  4UUT A;  1WPK A;  3GTK J;  1I6H J;  2R93 J;  1T33 A;  5M5W J;  3F0C A;  2HOA A;  1LFU P;  3PPB A;  4Y7N J;  1ZKG A;  2ZOZ A;  3KKD A;  2ID6 A;  4M6V A;  1HOM A;  3QBM A;  5M5X J;  4HNV A;  4MLO A;  4DYQ A;  3OOU A;  1JJ6 C;  1HLV A;  4ABZ A;  4FTH A;  1GV5 A;  3S2D J;  1S7E A;  1JKO C;  3O8G A;  1WH5 A;  2D6Y A;  4A93 J;  2NP5 A;  1ETW A;  3HIM A;  1ETY A;  1VND A;  3BT9 A;  4B4C A;  2GEN A;  3ANG A;  1AKH A;  4GCK A;  1AKH B;  1TC3 C;  5E3L A;  2UXP A;  1RET A;  3QPL A;  5M5Y J;  5E3M A;  2JN6 A;  3JRC A;  4HKU A;  5F04 A;  4A3D J;  2H8R A;  2CU7 A;  4XRM A;  4YZE A;  4UDS A;  3C2B A;  5IOY A;  1DU6 A;  2IBD A;  2NP3 A;  3QPS A;  2LLK A;  2LY9 A;  4I76 A;  2GUH A;  4MFE A;  2MGQ A;  3BR6 A;  1D5Y A;  3BG5 A;  2K9Q A;  5F27 A;  5F1J A;  2ZOY A;  4IHW A;  3K7A J;  5IYC J;  3ANP A;  5HBU A;  1B8I B;  1MBK A;  5D1R A;  1QPI A;  3T6N A;  1TWH J;  2EZL A;  3QKX A;  3M4O J;  4GFK A;  1NK2 P;  4JP0 A;  2NVY J;  5FMP A;  5CXI A;  2LFB A;  3G56 A;  4JNN A;  3GTP J;  2EZI A;  3TP0 A;  4UUS A;  3D1N I;  1ETK A;  3W6V A;  2WUI A;  4C2M J;  4A3K J;  3BQY A;  1X58 A;  2WV1 A;  1PUF B;  4NN1 A;  3RD3 A;  4M3F A;  4JX6 A;  2RAS A;  4C3J J;  1CQT A;  5FKL A;  3GTM J;  4IEJ A;  1MBH A;  2AO9 A;  3E7Q A;  1JT6 A;  1XG1 A;  3NPI A;  4QIW N;  2HXI A;  2TCT A;  1K83 J;  1ENH A;  1JUM A;  2M9H A;  2QF7 A;  3GTO J;  2LK2 A;  1UI5 A;  3B6A A;  3NAR A;  5J3L A;  3TW7 A;  3JRI A;  2NVX J;  4PXI A;  2QKO A;  3HTI A;  4A3L J;  3SDG A;  4KWA A;  1JT0 A;  2JA6 J;  2L7Z A;  1ETQ A;  2JA5 J;  2HQ5 A;  3V6G A;  3AQT A;  3VOX A;  1U9N A;  1IUF A;  4A3E J;  5HSZ A;  3MVP A;  5FLM J;  3PO2 J;  2ME6 A;  1POG A;  1HDP A;  2Y31 A;  2DMP A;  4AC6 A;  3HGG A;  3HBL A;  1X2N A;  3WHC A;  3O60 A;  3LWJ A;  1ZR2 A;  3BTI A;  3JRB A;  3GBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...