3NXCA

Molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
177
Chain Sequence
RNRREEILQSLALMLESITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHARLQGRINQLFERIEAQLRQVLREKRMREGGYATDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords HTH-type protein slmA
total genus 63
structure length 177
sequence length 190
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nxcA00
3C2BA 3G1LA 3S5RA 3DPJA 2YVHA 2WGBA 5F1JA 3FK7A 5J1RA 1RPWA 3RH2A 2ZOZA 3MVPA 5J1YA 2RHAA 3HGYA 3NNRA 1JTXA 3SDGA 4HKUA 5DAJA 5GPAA 1QVTA 2HXOA 4JYKA 3BTLA 5HBUA 3TP3A 2QTQA 1JUMA 5F08A 2FD5A 5FKLA 3LSJA 5F04A 3O8HA 3BT9A 3QPSA 3DEWA 2Q24A 2EH3A 2I10A 2Y30A 4KWAA 4ME9A 4MXMA 3NRGA 1A6IA 3BR2A 2G7LA 4D7NA 3KNWA 2XDNA 3BRUA 2OERA 1ZKGA 2NP3A 4NELA 3BJBA 4D7MA 2TCTA 2VKVA 2OI8A 5FGLA 3VPRA 3NXCA 2DG8A 4DW6A 3AQSA 3SFIA 3HTIA 3CCYA 3O60A 3IUVA 3BTJA 3CJDA 3VOXA 3VVYA 2Y31A 4JL3A 4ACIA 5FKMA 3KZ9A 4M3FA 3VP5A 4M3BA 2UXHA 3BQZA 3ZQLA 4AUXA 5F0FA 3BR0A 3Q0WA 4W1UA 3WHBA 3KKDA 3Q0VA 3QPLA 2TRTA 5GP9A 3QKXA 4GCKA 2VKEA 2XGDA 3AQTA 2W53A 2XGCA 2WUIA 3VVXA 3VOKA 5IPAA 5K7ZA 5FMPA 3EUPA 5IOYA 2RASA 2OPTA 4D5FA 3IH2A 2G3BA 3GEUA 5D1RA 3IH3A 4V2GA 5AQCA 2OF7A 3PM1A 2IU5A 3G1MA 5K7HA 2DG7A 5D18A 3HTJA 5FKKA 3Q0UA 5H9TA 3ZQHA 3LJLA 5GPCA 3G1OA 4AF5A 4M3DA 1UI6A 3HIMA 3C07A 3VW2A 3VW0A 3BR3A 2G7SA 3Q3SA 4M3GA 3VUQA 1U9NA 3P9TA 3GZIA 4CGRA 4GFKA 2IBDA 2UXOA 2ZCNA 3EGQA 2HYTA 1QVUA 2X9DA 3G56A 3HTAA 3HGGA 4I76A 5J3LA 2FBQA 2UXUA 2GUHA 5K58A 4GCLA 2UXIA 3ZQIA 2DTZA 4YZEA 3G7RA 3FRQA 2ZCXA 3RD3A 3PPBA 3LHQA 2IAIA 5J1UA 1JUPA 5EZGA 3B81A 2NX4A 2QWTA 1T56A 2G7GA 4X1EA 3NPIA 3VIBA 5FKNA 3B6AA 2WV1A 3V6GA 1T33A 2ID6A 2XPWA 5HAWA 3LSRA 4B1RA 3BHQA 5K7FA 1Z77A 4V2FA 4GFLA 2FJ1A 2O7TA 2GENA 2ZCMA 4L62A 1VI0A 5EFYA 1Z0XA 1RKWA 5FKOA 2JJ7A 2Y2ZA 4XK4A 1RKTA 4MK6A 2G0EA 2QCOA 4JKZA 4W97A 3ON2A 2F07A 1JT6A 1U9OA 4AC6A 1JUSA 2REKA 3BQYA 2PZ9A 5F0HA 3V78A 2XGEA 3BTCA 1ORKA 2XRLA 3FIWA 1QPIA 3JSJA 3LSPA 2FQ4A 2NS8A 2JK3A 1JTYA 2QKOA 3IH4A 4UDSA 1SGMA 3CWRA 3T6NA 3VW1A 3BNIA 5C4YA 2GFNA 4NN1A 1JT0A 5CXIA 5EZHA 3CRJA 3BR6A 2RAEA 3BR1A 3ON4A 2X6OA 4G12A 4D5CA 2QOPA 2FX0A 3BR5A 3O8GA 2HYJA 4MO7A 4JNNA 4ABZA 3FK6A 3PASA 2ID3A 2PBXA 2GBYA 3F0CA 2XPUA 5EYRA 4I6ZA 3TP0A 2XPVA 3HTHA 3NI7A 2ZOYA 2QIBA 3ZQFA 3QBMA 2VPRA 2HKUA 3BCGA 5IP6A 1UI5A 2HXIA 2XB5A 3E7QA 3ANPA 2V57A 3ANGA 4ICHA 1BJZA 5D19A 3ZQGA 1ZK8A 2IEKA 2O7OA 3KKCA 2NP5A 3LOCA 3COLA 5HSZA 4GCTA 5CXGA 3WHCA 2HQ5A 5CW8A 3BTIA 3LWJA 3CDLA 2UXPA 3QQAA 4PXIA 5F27A 5FHPA 2D6YA 2NS7A 4M3EA 5IOZA 2ZB9A 2YVEA 3HE0A 4B3AA 3DCFA 4AC0A 3MNLA 3B6CA 5F0CA 3F1BA 3VVZA
chains in the Genus database with same CATH superfamily
3C2BA 3G1LA 3S5RA 3DPJA 2YVHA 2WGBA 5F1JA 3FK7A 5J1RA 1RPWA 3RH2A 2ZOZA 3MVPA 5J1YA 2RHAA 3HGYA 3NNRA 1JTXA 3SDGA 4HKUA 5DAJA 5GPAA 3KYLA 1QVTA 2HXOA 4JYKA 3BTLA 5HBUA 3TP3A 2QTQA 1JUMA 5F08A 2FD5A 5FKLA 3LSJA 5F04A 2PFVA 3O8HA 3BT9A 3QPSA 3DEWA 2Q24A 2EH3A 2I10A 2Y30A 4KWAA 4ME9A 4MXMA 3NRGA 1A6IA 3BR2A 2G7LA 4D7NA 3KNWA 2R7OA 2XDNA 3BRUA 2OERA 1ZKGA 2NP3A 4NELA 3BJBA 4D7MA 2R7XA 2TCTA 2VKVA 2OI8A 5FGLA 3VPRA 3NXCA 3K8PC 3VTIA 2DG8A 4DW6A 3AQSA 3SFIA 3HTIA 3CCYA 3O60A 3IUVA 3BTJA 3CJDA 3VOXA 3VVYA 2Y31A 2R7QA 4JL3A 4ACIA 5FKMA 3KZ9A 4M3FA 3VP5A 4M3BA 2UXHA 3BQZA 3ZQLA 4AUXA 3SWHA 5F0FA 3BR0A 3Q0WA 4W1UA 3WHBA 3KKDA 3FHNA 3Q0VA 3QPLA 2TRTA 5GP9A 3QKXA 4U9NA 4GCKA 2VKEA 2XGDA 3AQTA 2W53A 2XGCA 2R7UA 2WUIA 3VVXA 3VOKA 5IPAA 5K7ZA 5FMPA 3EUPA 4WIBA 5IOYA 3DU6A 2RASA 4DVYP 2OPTA 4D5FA 3IH2A 2G3BA 3GEUA 5D1RA 3IH3A 4V2GA 5AQCA 2OF7A 3PM1A 2IU5A 3G1MA 5K7HA 2DG7A 5D18A 4IRVA 3HTJA 5FKKA 3Q0UA 5H9TA 3ZQHA 3LJLA 5GPCA 3G1OA 4AF5A 2R7RA 4M3DA 1UI6A 3HIMA 3C07A 3VW2A 3VW0A 3BR3A 2A2FX 4OD4A 2G7SA 3Q3SA 4M3GA 3VUQA 3P9TA 1U9NA 2FJI1 3GZIA 4CGRA 4GFKA 2IBDA 2UXOA 2ZCNA 3EGQA 2HYTA 1QVUA 2R7WA 2X9DA 3G56A 3HTAA 3HGGA 4I76A 5J3LA 2FBQA 2UXUA 2GUHA 5K58A 4GCLA 2UXIA 3ZQIA 2DTZA 4YZEA 3G7RA 3FRQA 2ZCXA 3RD3A 3PPBA 3LHQA 2IAIA 5J1UA 1JUPA 5EZGA 3B81A 2NX4A 2QWTA 1T56A 2G7GA 4X1EA 3NPIA 3VIBA 3DU5A 5FKNA 3B6AA 2WV1A 3V6GA 1T33A 2ID6A 2XPWA 5HAWA 3LSRA 4B1RA 3BHQA 5K7FA 1Z77A 3NS4A 4V2FA 4GFLA 2FJ1A 2O7TA 2GENA 2ZCMA 4L62A 1VI0A 5EFYA 1Z0XA 1RKWA 5FKOA 2JJ7A 2Y2ZA 4XK4A 1RKTA 4MK6A 2G0EA 2QCOA 4JKZA 4W97A 3ON2A 2F07A 1JT6A 1U9OA 4AC6A 1JUSA 2REKA 3BQYA 2PZ9A 2R7SA 5F0HA 3V78A 2XGEA 3BTCA 2B1EA 1ORKA 2XRLA 3FIWA 1QPIA 3JSJA 3LSPA 2FQ4A 2NS8A 2JK3A 1JTYA 2QKOA 3IH4A 4U9LA 4UDSA 1SGMA 3CWRA 3T6NA 3VW1A 3BNIA 5C4YA 2GFNA 4NN1A 1JT0A 5CXIA 5EZHA 3CRJA 2ZY9A 3BR6A 2RAEA 3BR1A 3ON4A 2X6OA 4G12A 4D5CA 2QOPA 2FX0A 3BR5A 3O8GA 2HYJA 5CQGA 4MO7A 4JNNA 4ABZA 3FK6A 3PASA 2ID3A 2PBXA 2GBYA 3F0CA 2XPUA 5EYRA 4I6ZA 3TP0A 2XPVA 3HTHA 3NI7A 2ZOYA 2QIBA 3ZQFA 3QBMA 2VPRA 2HKUA 3BCGA 5IP6A 1UI5A 2HXIA 2XB5A 3E7QA 3ANPA 2V57A 3ANGA 4ICHA 2B3WA 1BJZA 5D19A 3ZQGA 1ZK8A 2IEKA 2O7OA 3KKCA 2NP5A 2R7TA 3LOCA 3COLA 5HSZA 4GCTA 5CXGA 3WHCA 2HQ5A 5CW8A 2YVXA 3BTIA 3LWJA 3CDLA 2UXPA 4C2MA 3QQAA 4PXIA 5F27A 5FHPA 2D6YA 2NS7A 4M3EA 5IOZA 2ZB9A 2YVEA 3HE0A 2R7VA 4B3AA 3DCFA 4AC0A 3MNLA 3B6CA 4OD5A 5F0CA 3F1BA 3VVZA
chains in the Genus database with same CATH topology
3C2BA 3G1LA 3S5RA 3DPJA 2YVHA 2WGBA 5F1JA 3FK7A 5J1RA 1RPWA 3RH2A 2ZOZA 3MVPA 5J1YA 2RHAA 3HGYA 3NNRA 1JTXA 3SDGA 4HKUA 5DAJA 5GPAA 1QVTA 2HXOA 4JYKA 3BTLA 5HBUA 3TP3A 2QTQA 1JUMA 5F08A 2FD5A 5FKLA 3LSJA 5F04A 3O8HA 3BT9A 3QPSA 3DEWA 2Q24A 2EH3A 2I10A 2Y30A 4KWAA 4ME9A 4MXMA 3NRGA 1A6IA 3BR2A 2G7LA 4D7NA 3KNWA 2XDNA 3BRUA 2OERA 1ZKGA 2NP3A 4NELA 3BJBA 4D7MA 2TCTA 2VKVA 2OI8A 5FGLA 3VPRA 3NXCA 2DG8A 4DW6A 3AQSA 3SFIA 3HTIA 3CCYA 3O60A 3IUVA 3BTJA 3CJDA 3VOXA 3VVYA 2Y31A 4JL3A 4ACIA 5FKMA 3KZ9A 4M3FA 3VP5A 4M3BA 2UXHA 3BQZA 3ZQLA 4AUXA 5F0FA 3BR0A 3Q0WA 4W1UA 3WHBA 3KKDA 3Q0VA 3QPLA 2TRTA 5GP9A 3QKXA 4GCKA 2VKEA 2XGDA 3AQTA 2W53A 2XGCA 2WUIA 3VVXA 3VOKA 5IPAA 5K7ZA 5FMPA 3EUPA 5IOYA 2RASA 2OPTA 4D5FA 3IH2A 2G3BA 3GEUA 5D1RA 3IH3A 4V2GA 5AQCA 2OF7A 3PM1A 2IU5A 3G1MA 5K7HA 2DG7A 5D18A 3HTJA 5FKKA 3Q0UA 5H9TA 3ZQHA 3LJLA 5GPCA 3G1OA 4AF5A 4M3DA 1UI6A 3HIMA 3C07A 3VW2A 3VW0A 3BR3A 2G7SA 3Q3SA 4M3GA 3VUQA 1U9NA 3P9TA 3GZIA 4CGRA 4GFKA 2IBDA 2UXOA 2ZCNA 3EGQA 2HYTA 1QVUA 2X9DA 3G56A 3HTAA 3HGGA 4I76A 5J3LA 2FBQA 2UXUA 2GUHA 5K58A 4GCLA 2UXIA 3ZQIA 2DTZA 4YZEA 3G7RA 3FRQA 2ZCXA 3RD3A 3PPBA 3LHQA 2IAIA 5J1UA 1JUPA 5EZGA 3B81A 2NX4A 2QWTA 1T56A 2G7GA 4X1EA 3NPIA 3VIBA 5FKNA 3B6AA 2WV1A 3V6GA 1T33A 2ID6A 2XPWA 5HAWA 3LSRA 4B1RA 3BHQA 5K7FA 1Z77A 4V2FA 4GFLA 2FJ1A 2O7TA 2GENA 2ZCMA 4L62A 1VI0A 5EFYA 1Z0XA 1RKWA 5FKOA 2JJ7A 2Y2ZA 4XK4A 1RKTA 4MK6A 2G0EA 2QCOA 4JKZA 4W97A 3ON2A 2F07A 1JT6A 1U9OA 4AC6A 1JUSA 2REKA 3BQYA 2PZ9A 5F0HA 3V78A 2XGEA 3BTCA 1ORKA 2XRLA 3FIWA 1QPIA 3JSJA 3LSPA 2FQ4A 2NS8A 2JK3A 1JTYA 2QKOA 3IH4A 4UDSA 1SGMA 3CWRA 3T6NA 3VW1A 3BNIA 5C4YA 2GFNA 4NN1A 1JT0A 5CXIA 5EZHA 3CRJA 3BR6A 2RAEA 3BR1A 3ON4A 2X6OA 4G12A 4D5CA 2QOPA 2FX0A 3BR5A 3O8GA 2HYJA 4MO7A 4JNNA 4ABZA 3FK6A 3PASA 2ID3A 2PBXA 2GBYA 3F0CA 2XPUA 5EYRA 4I6ZA 3TP0A 2XPVA 3HTHA 3NI7A 2ZOYA 2QIBA 3ZQFA 3QBMA 2VPRA 2HKUA 3BCGA 5IP6A 1UI5A 2HXIA 2XB5A 3E7QA 3ANPA 2V57A 3ANGA 4ICHA 1BJZA 5D19A 3ZQGA 1ZK8A 2IEKA 2O7OA 3KKCA 2NP5A 3LOCA 3COLA 5HSZA 4GCTA 5CXGA 3WHCA 2HQ5A 5CW8A 3BTIA 3LWJA 3CDLA 2UXPA 3QQAA 4PXIA 5F27A 5FHPA 2D6YA 2NS7A 4M3EA 5IOZA 2ZB9A 2YVEA 3HE0A 4B3AA 3DCFA 4AC0A 3MNLA 3B6CA 5F0CA 3F1BA 3VVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2B A;  3G1L A;  3S5R A;  3DPJ A;  2YVH A;  2WGB A;  5F1J A;  3FK7 A;  5J1R A;  1RPW A;  3RH2 A;  2ZOZ A;  3MVP A;  5J1Y A;  2RHA A;  3HGY A;  3NNR A;  1JTX A;  3SDG A;  4HKU A;  5DAJ A;  5GPA A;  1QVT A;  2HXO A;  4JYK A;  3BTL A;  5HBU A;  3TP3 A;  2QTQ A;  1JUM A;  5F08 A;  2FD5 A;  5FKL A;  3LSJ A;  5F04 A;  3O8H A;  3BT9 A;  3QPS A;  3DEW A;  2Q24 A;  2EH3 A;  2I10 A;  2Y30 A;  4KWA A;  4ME9 A;  4MXM A;  3NRG A;  1A6I A;  3BR2 A;  2G7L A;  4D7N A;  3KNW A;  2XDN A;  3BRU A;  2OER A;  1ZKG A;  2NP3 A;  4NEL A;  3BJB A;  4D7M A;  2TCT A;  2VKV A;  2OI8 A;  5FGL A;  3VPR A;  3NXC A;  2DG8 A;  4DW6 A;  3AQS A;  3SFI A;  3HTI A;  3CCY A;  3O60 A;  3IUV A;  3BTJ A;  3CJD A;  3VOX A;  3VVY A;  2Y31 A;  4JL3 A;  4ACI A;  5FKM A;  3KZ9 A;  4M3F A;  3VP5 A;  4M3B A;  2UXH A;  3BQZ A;  3ZQL A;  4AUX A;  5F0F A;  3BR0 A;  3Q0W A;  4W1U A;  3WHB A;  3KKD A;  3Q0V A;  3QPL A;  2TRT A;  5GP9 A;  3QKX A;  4GCK A;  2VKE A;  2XGD A;  3AQT A;  2W53 A;  2XGC A;  2WUI A;  3VVX A;  3VOK A;  5IPA A;  5K7Z A;  5FMP A;  3EUP A;  5IOY A;  2RAS A;  2OPT A;  4D5F A;  3IH2 A;  2G3B A;  3GEU A;  5D1R A;  3IH3 A;  4V2G A;  5AQC A;  2OF7 A;  3PM1 A;  2IU5 A;  3G1M A;  5K7H A;  2DG7 A;  5D18 A;  3HTJ A;  5FKK A;  3Q0U A;  5H9T A;  3ZQH A;  3LJL A;  5GPC A;  3G1O A;  4AF5 A;  4M3D A;  1UI6 A;  3HIM A;  3C07 A;  3VW2 A;  3VW0 A;  3BR3 A;  2G7S A;  3Q3S A;  4M3G A;  3VUQ A;  1U9N A;  3P9T A;  3GZI A;  4CGR A;  4GFK A;  2IBD A;  2UXO A;  2ZCN A;  3EGQ A;  2HYT A;  1QVU A;  2X9D A;  3G56 A;  3HTA A;  3HGG A;  4I76 A;  5J3L A;  2FBQ A;  2UXU A;  2GUH A;  5K58 A;  4GCL A;  2UXI A;  3ZQI A;  2DTZ A;  4YZE A;  3G7R A;  3FRQ A;  2ZCX A;  3RD3 A;  3PPB A;  3LHQ A;  2IAI A;  5J1U A;  1JUP A;  5EZG A;  3B81 A;  2NX4 A;  2QWT A;  1T56 A;  2G7G A;  4X1E A;  3NPI A;  3VIB A;  5FKN A;  3B6A A;  2WV1 A;  3V6G A;  1T33 A;  2ID6 A;  2XPW A;  5HAW A;  3LSR A;  4B1R A;  3BHQ A;  5K7F A;  1Z77 A;  4V2F A;  4GFL A;  2FJ1 A;  2O7T A;  2GEN A;  2ZCM A;  4L62 A;  1VI0 A;  5EFY A;  1Z0X A;  1RKW A;  5FKO A;  2JJ7 A;  2Y2Z A;  4XK4 A;  1RKT A;  4MK6 A;  2G0E A;  2QCO A;  4JKZ A;  4W97 A;  3ON2 A;  2F07 A;  1JT6 A;  1U9O A;  4AC6 A;  1JUS A;  2REK A;  3BQY A;  2PZ9 A;  5F0H A;  3V78 A;  2XGE A;  3BTC A;  1ORK A;  2XRL A;  3FIW A;  1QPI A;  3JSJ A;  3LSP A;  2FQ4 A;  2NS8 A;  2JK3 A;  1JTY A;  2QKO A;  3IH4 A;  4UDS A;  1SGM A;  3CWR A;  3T6N A;  3VW1 A;  3BNI A;  5C4Y A;  2GFN A;  4NN1 A;  1JT0 A;  5CXI A;  5EZH A;  3CRJ A;  3BR6 A;  2RAE A;  3BR1 A;  3ON4 A;  2X6O A;  4G12 A;  4D5C A;  2QOP A;  2FX0 A;  3BR5 A;  3O8G A;  2HYJ A;  4MO7 A;  4JNN A;  4ABZ A;  3FK6 A;  3PAS A;  2ID3 A;  2PBX A;  2GBY A;  3F0C A;  2XPU A;  5EYR A;  4I6Z A;  3TP0 A;  2XPV A;  3HTH A;  3NI7 A;  2ZOY A;  2QIB A;  3ZQF A;  3QBM A;  2VPR A;  2HKU A;  3BCG A;  5IP6 A;  1UI5 A;  2HXI A;  2XB5 A;  3E7Q A;  3ANP A;  2V57 A;  3ANG A;  4ICH A;  1BJZ A;  5D19 A;  3ZQG A;  1ZK8 A;  2IEK A;  2O7O A;  3KKC A;  2NP5 A;  3LOC A;  3COL A;  5HSZ A;  4GCT A;  5CXG A;  3WHC A;  2HQ5 A;  5CW8 A;  3BTI A;  3LWJ A;  3CDL A;  2UXP A;  3QQA A;  4PXI A;  5F27 A;  5FHP A;  2D6Y A;  2NS7 A;  4M3E A;  5IOZ A;  2ZB9 A;  2YVE A;  3HE0 A;  4B3A A;  3DCF A;  4AC0 A;  3MNL A;  3B6C A;  5F0C A;  3F1B A;  3VVZ A; 
#chains in the Genus database with same CATH topology
 3C2B A;  3G1L A;  3S5R A;  3DPJ A;  2YVH A;  2WGB A;  5F1J A;  3FK7 A;  5J1R A;  1RPW A;  3RH2 A;  2ZOZ A;  3MVP A;  5J1Y A;  2RHA A;  3HGY A;  3NNR A;  1JTX A;  3SDG A;  4HKU A;  5DAJ A;  5GPA A;  3KYL A;  1QVT A;  2HXO A;  4JYK A;  3BTL A;  5HBU A;  3TP3 A;  2QTQ A;  1JUM A;  5F08 A;  2FD5 A;  5FKL A;  3LSJ A;  5F04 A;  2PFV A;  3O8H A;  3BT9 A;  3QPS A;  3DEW A;  2Q24 A;  2EH3 A;  2I10 A;  2Y30 A;  4KWA A;  4ME9 A;  4MXM A;  3NRG A;  1A6I A;  3BR2 A;  2G7L A;  4D7N A;  3KNW A;  2R7O A;  2XDN A;  3BRU A;  2OER A;  1ZKG A;  2NP3 A;  4NEL A;  3BJB A;  4D7M A;  2R7X A;  2TCT A;  2VKV A;  2OI8 A;  5FGL A;  3VPR A;  3NXC A;  3K8P C;  3VTI A;  2DG8 A;  4DW6 A;  3AQS A;  3SFI A;  3HTI A;  3CCY A;  3O60 A;  3IUV A;  3BTJ A;  3CJD A;  3VOX A;  3VVY A;  2Y31 A;  2R7Q A;  4JL3 A;  4ACI A;  5FKM A;  3KZ9 A;  4M3F A;  3VP5 A;  4M3B A;  2UXH A;  3BQZ A;  3ZQL A;  4AUX A;  3SWH A;  5F0F A;  3BR0 A;  3Q0W A;  4W1U A;  3WHB A;  3KKD A;  3FHN A;  3Q0V A;  3QPL A;  2TRT A;  5GP9 A;  3QKX A;  4U9N A;  4GCK A;  2VKE A;  2XGD A;  3AQT A;  2W53 A;  2XGC A;  2R7U A;  2WUI A;  3VVX A;  3VOK A;  5IPA A;  5K7Z A;  5FMP A;  3EUP A;  4WIB A;  5IOY A;  3DU6 A;  2RAS A;  4DVY P;  2OPT A;  4D5F A;  3IH2 A;  2G3B A;  3GEU A;  5D1R A;  3IH3 A;  4V2G A;  5AQC A;  2OF7 A;  3PM1 A;  2IU5 A;  3G1M A;  5K7H A;  2DG7 A;  5D18 A;  4IRV A;  3HTJ A;  5FKK A;  3Q0U A;  5H9T A;  3ZQH A;  3LJL A;  5GPC A;  3G1O A;  4AF5 A;  2R7R A;  4M3D A;  1UI6 A;  3HIM A;  3C07 A;  3VW2 A;  3VW0 A;  3BR3 A;  2A2F X;  4OD4 A;  2G7S A;  3Q3S A;  4M3G A;  3VUQ A;  3P9T A;  1U9N A;  2FJI 1;  3GZI A;  4CGR A;  4GFK A;  2IBD A;  2UXO A;  2ZCN A;  3EGQ A;  2HYT A;  1QVU A;  2R7W A;  2X9D A;  3G56 A;  3HTA A;  3HGG A;  4I76 A;  5J3L A;  2FBQ A;  2UXU A;  2GUH A;  5K58 A;  4GCL A;  2UXI A;  3ZQI A;  2DTZ A;  4YZE A;  3G7R A;  3FRQ A;  2ZCX A;  3RD3 A;  3PPB A;  3LHQ A;  2IAI A;  5J1U A;  1JUP A;  5EZG A;  3B81 A;  2NX4 A;  2QWT A;  1T56 A;  2G7G A;  4X1E A;  3NPI A;  3VIB A;  3DU5 A;  5FKN A;  3B6A A;  2WV1 A;  3V6G A;  1T33 A;  2ID6 A;  2XPW A;  5HAW A;  3LSR A;  4B1R A;  3BHQ A;  5K7F A;  1Z77 A;  3NS4 A;  4V2F A;  4GFL A;  2FJ1 A;  2O7T A;  2GEN A;  2ZCM A;  4L62 A;  1VI0 A;  5EFY A;  1Z0X A;  1RKW A;  5FKO A;  2JJ7 A;  2Y2Z A;  4XK4 A;  1RKT A;  4MK6 A;  2G0E A;  2QCO A;  4JKZ A;  4W97 A;  3ON2 A;  2F07 A;  1JT6 A;  1U9O A;  4AC6 A;  1JUS A;  2REK A;  3BQY A;  2PZ9 A;  2R7S A;  5F0H A;  3V78 A;  2XGE A;  3BTC A;  2B1E A;  1ORK A;  2XRL A;  3FIW A;  1QPI A;  3JSJ A;  3LSP A;  2FQ4 A;  2NS8 A;  2JK3 A;  1JTY A;  2QKO A;  3IH4 A;  4U9L A;  4UDS A;  1SGM A;  3CWR A;  3T6N A;  3VW1 A;  3BNI A;  5C4Y A;  2GFN A;  4NN1 A;  1JT0 A;  5CXI A;  5EZH A;  3CRJ A;  2ZY9 A;  3BR6 A;  2RAE A;  3BR1 A;  3ON4 A;  2X6O A;  4G12 A;  4D5C A;  2QOP A;  2FX0 A;  3BR5 A;  3O8G A;  2HYJ A;  5CQG A;  4MO7 A;  4JNN A;  4ABZ A;  3FK6 A;  3PAS A;  2ID3 A;  2PBX A;  2GBY A;  3F0C A;  2XPU A;  5EYR A;  4I6Z A;  3TP0 A;  2XPV A;  3HTH A;  3NI7 A;  2ZOY A;  2QIB A;  3ZQF A;  3QBM A;  2VPR A;  2HKU A;  3BCG A;  5IP6 A;  1UI5 A;  2HXI A;  2XB5 A;  3E7Q A;  3ANP A;  2V57 A;  3ANG A;  4ICH A;  2B3W A;  1BJZ A;  5D19 A;  3ZQG A;  1ZK8 A;  2IEK A;  2O7O A;  3KKC A;  2NP5 A;  2R7T A;  3LOC A;  3COL A;  5HSZ A;  4GCT A;  5CXG A;  3WHC A;  2HQ5 A;  5CW8 A;  2YVX A;  3BTI A;  3LWJ A;  3CDL A;  2UXP A;  4C2M A;  3QQA A;  4PXI A;  5F27 A;  5FHP A;  2D6Y A;  2NS7 A;  4M3E A;  5IOZ A;  2ZB9 A;  2YVE A;  3HE0 A;  2R7V A;  4B3A A;  3DCF A;  4AC0 A;  3MNL A;  3B6C A;  4OD5 A;  5F0C A;  3F1B A;  3VVZ A; 
#chains in the Genus database with same CATH homology
 3C2B A;  3G1L A;  3S5R A;  3DPJ A;  2YVH A;  2WGB A;  5F1J A;  3FK7 A;  5J1R A;  1RPW A;  3RH2 A;  2ZOZ A;  3MVP A;  5J1Y A;  2RHA A;  3HGY A;  3NNR A;  1JTX A;  3SDG A;  4HKU A;  5DAJ A;  5GPA A;  1QVT A;  2HXO A;  4JYK A;  3BTL A;  5HBU A;  3TP3 A;  2QTQ A;  1JUM A;  5F08 A;  2FD5 A;  5FKL A;  3LSJ A;  5F04 A;  3O8H A;  3BT9 A;  3QPS A;  3DEW A;  2Q24 A;  2EH3 A;  2I10 A;  2Y30 A;  4KWA A;  4ME9 A;  4MXM A;  3NRG A;  1A6I A;  3BR2 A;  2G7L A;  4D7N A;  3KNW A;  2XDN A;  3BRU A;  2OER A;  1ZKG A;  2NP3 A;  4NEL A;  3BJB A;  4D7M A;  2TCT A;  2VKV A;  2OI8 A;  5FGL A;  3VPR A;  3NXC A;  2DG8 A;  4DW6 A;  3AQS A;  3SFI A;  3HTI A;  3CCY A;  3O60 A;  3IUV A;  3BTJ A;  3CJD A;  3VOX A;  3VVY A;  2Y31 A;  4JL3 A;  4ACI A;  5FKM A;  3KZ9 A;  4M3F A;  3VP5 A;  4M3B A;  2UXH A;  3BQZ A;  3ZQL A;  4AUX A;  5F0F A;  3BR0 A;  3Q0W A;  4W1U A;  3WHB A;  3KKD A;  3Q0V A;  3QPL A;  2TRT A;  5GP9 A;  3QKX A;  4GCK A;  2VKE A;  2XGD A;  3AQT A;  2W53 A;  2XGC A;  2WUI A;  3VVX A;  3VOK A;  5IPA A;  5K7Z A;  5FMP A;  3EUP A;  5IOY A;  2RAS A;  2OPT A;  4D5F A;  3IH2 A;  2G3B A;  3GEU A;  5D1R A;  3IH3 A;  4V2G A;  5AQC A;  2OF7 A;  3PM1 A;  2IU5 A;  3G1M A;  5K7H A;  2DG7 A;  5D18 A;  3HTJ A;  5FKK A;  3Q0U A;  5H9T A;  3ZQH A;  3LJL A;  5GPC A;  3G1O A;  4AF5 A;  4M3D A;  1UI6 A;  3HIM A;  3C07 A;  3VW2 A;  3VW0 A;  3BR3 A;  2G7S A;  3Q3S A;  4M3G A;  3VUQ A;  1U9N A;  3P9T A;  3GZI A;  4CGR A;  4GFK A;  2IBD A;  2UXO A;  2ZCN A;  3EGQ A;  2HYT A;  1QVU A;  2X9D A;  3G56 A;  3HTA A;  3HGG A;  4I76 A;  5J3L A;  2FBQ A;  2UXU A;  2GUH A;  5K58 A;  4GCL A;  2UXI A;  3ZQI A;  2DTZ A;  4YZE A;  3G7R A;  3FRQ A;  2ZCX A;  3RD3 A;  3PPB A;  3LHQ A;  2IAI A;  5J1U A;  1JUP A;  5EZG A;  3B81 A;  2NX4 A;  2QWT A;  1T56 A;  2G7G A;  4X1E A;  3NPI A;  3VIB A;  5FKN A;  3B6A A;  2WV1 A;  3V6G A;  1T33 A;  2ID6 A;  2XPW A;  5HAW A;  3LSR A;  4B1R A;  3BHQ A;  5K7F A;  1Z77 A;  4V2F A;  4GFL A;  2FJ1 A;  2O7T A;  2GEN A;  2ZCM A;  4L62 A;  1VI0 A;  5EFY A;  1Z0X A;  1RKW A;  5FKO A;  2JJ7 A;  2Y2Z A;  4XK4 A;  1RKT A;  4MK6 A;  2G0E A;  2QCO A;  4JKZ A;  4W97 A;  3ON2 A;  2F07 A;  1JT6 A;  1U9O A;  4AC6 A;  1JUS A;  2REK A;  3BQY A;  2PZ9 A;  5F0H A;  3V78 A;  2XGE A;  3BTC A;  1ORK A;  2XRL A;  3FIW A;  1QPI A;  3JSJ A;  3LSP A;  2FQ4 A;  2NS8 A;  2JK3 A;  1JTY A;  2QKO A;  3IH4 A;  4UDS A;  1SGM A;  3CWR A;  3T6N A;  3VW1 A;  3BNI A;  5C4Y A;  2GFN A;  4NN1 A;  1JT0 A;  5CXI A;  5EZH A;  3CRJ A;  3BR6 A;  2RAE A;  3BR1 A;  3ON4 A;  2X6O A;  4G12 A;  4D5C A;  2QOP A;  2FX0 A;  3BR5 A;  3O8G A;  2HYJ A;  4MO7 A;  4JNN A;  4ABZ A;  3FK6 A;  3PAS A;  2ID3 A;  2PBX A;  2GBY A;  3F0C A;  2XPU A;  5EYR A;  4I6Z A;  3TP0 A;  2XPV A;  3HTH A;  3NI7 A;  2ZOY A;  2QIB A;  3ZQF A;  3QBM A;  2VPR A;  2HKU A;  3BCG A;  5IP6 A;  1UI5 A;  2HXI A;  2XB5 A;  3E7Q A;  3ANP A;  2V57 A;  3ANG A;  4ICH A;  1BJZ A;  5D19 A;  3ZQG A;  1ZK8 A;  2IEK A;  2O7O A;  3KKC A;  2NP5 A;  3LOC A;  3COL A;  5HSZ A;  4GCT A;  5CXG A;  3WHC A;  2HQ5 A;  5CW8 A;  3BTI A;  3LWJ A;  3CDL A;  2UXP A;  3QQA A;  4PXI A;  5F27 A;  5FHP A;  2D6Y A;  2NS7 A;  4M3E A;  5IOZ A;  2ZB9 A;  2YVE A;  3HE0 A;  4B3A A;  3DCF A;  4AC0 A;  3MNL A;  3B6C A;  5F0C A;  3F1B A;  3VVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...