3NXCA

Molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
177
Chain Sequence
RNRREEILQSLALMLESITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHARLQGRINQLFERIEAQLRQVLREKRMREGGYATDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type protein slmA
publication title Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 63
structure length 177
sequence length 190
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nxcA00
5HBUA 1QPIA 2XPUA 4ABZA 5GPCA 2HYTA 4W1UA 2FBQA 2O7TA 2UXIA 3ZQFA 5EZGA 3ZQGA 3TP3A 1Z77A 2XB5A 2QKOA 3FIWA 2G3BA 3EGQA 2HXIA 2V57A 2GFNA 2ZOYA 3B81A 5FHPA 2OI8A 3DCFA 3CDLA 3CCYA 5D19A 2FJ1A 3QPLA 5FKNA 2TRTA 3KKDA 1A6IA 3VW2A 3E7QA 2ZCXA 3Q3SA 2PZ9A 4W97A 2G7GA 4X1EA 4D5CA 3C07A 5F08A 3BTJA 2GBYA 2QIBA 5IPAA 4M3GA 3RD3A 5CXIA 2OERA 3CJDA 3Q0WA 3ON2A 1BJZA 3ANPA 4AF5A 3VPRA 5HSZA 2QOPA 3KZ9A 2W53A 1JUPA 3BRUA 5F1JA 2IBDA 2WUIA 3BHQA 3HIMA 5AQCA 2DTZA 2FQ4A 5K58A 2HYJA 3DPJA 2XPVA 5CXGA 4MO7A 2F07A 4JL3A 4GCKA 2UXHA 2VKVA 5F27A 3B6CA 1SGMA 4HKUA 2G0EA 2WV1A 3ON4A 3VVYA 4B3AA 4M3BA 1U9NA 1T33A 4AUXA 2QWTA 4MXMA 3LSPA 1JT0A 3VUQA 4D7NA 3VOXA 3ANGA 4JKZA 4L62A 2ZCMA 1ZK8A 3V6GA 2X6OA 1UI6A 3QPSA 4GFKA 4YZEA 5GP9A 5EYRA 3LWJA 2G7LA 3VIBA 1RKTA 2VPRA 5EFYA 3G56A 4ICHA 2OPTA 3VVXA 4NELA 1QVTA 3O8HA 3VVZA 2JK3A 5K7FA 2UXUA 3GZIA 4G12A 5FGLA 3HTJA 2ZOZA 3VW1A 5FKKA 2JJ7A 3QKXA 5F0FA 3JSJA 5J1UA 2NP5A 3AQTA 3ZQLA 4GFLA 2NS7A 2REKA 4JYKA 5K7HA 3Q0VA 5D18A 2IAIA 2HKUA 3B6AA 4D5FA 1VI0A 4AC0A 3LOCA 2QTQA 2XGEA 3NPIA 3G1OA 2ID6A 1U9OA 1ORKA 2I10A 3IUVA 3MNLA 3BR0A 1ZKGA 1QVUA 3LSJA 4DW6A 3COLA 3QBMA 4I6ZA 3ZQHA 3HTAA 4M3EA 2G7SA 5H9TA 2WGBA 4NN1A 4V2GA 3G1MA 3BCGA 2OF7A 3C2BA 2DG8A 2XGCA 4M3DA 3V78A 3WHBA 3BTLA 2D6YA 3BQYA 3BT9A 3NRGA 3BR2A 5J1RA 2NX4A 3BQZA 2HQ5A 2Y31A 3RH2A 3SDGA 2Q24A 4ME9A 4M3FA 5FKMA 2O7OA 5FMPA 5HAWA 2Y2ZA 3CWRA 3QQAA 3GEUA 3O8GA 3BTIA 3KKCA 5D1RA 4PXIA 3O60A 2FD5A 3FRQA 4AC6A 4GCTA 2HXOA 1JUMA 3Q0UA 3HTHA 5F04A 3WHCA 2RAEA 2EH3A 1JTXA 3PPBA 2XDNA 2UXPA 2YVHA 3G7RA 2XGDA 3IH3A 5K7ZA 5J3LA 3VW0A 2ZCNA 5F0HA 3PM1A 3T6NA 1JTYA 2QCOA 4I76A 2YVEA 4UDSA 5DAJA 5F0CA 1UI5A 1JUSA 5IOZA 4ACIA 4JNNA 5C4YA 3S5RA 3NNRA 2UXOA 4MK6A 4V2FA 5J1YA 3LJLA 3TP0A 2TCTA 4KWAA 3P9TA 4B1RA 2NS8A 1RPWA 3ZQIA 3BR6A 2Y30A 3BR3A 5IP6A 3KNWA 3VP5A 2FX0A 4CGRA 2IEKA 2XPWA 5EZHA 3SFIA 3G1LA 3IH2A 4D7MA 2DG7A 3F0CA 3NI7A 1RKWA 3BR5A 3VOKA 3FK7A 5FKOA 2NP3A 5FKLA 3HGGA 3F1BA 4GCLA 3PASA 3HTIA 2X9DA 5IOYA 3BR1A 3AQSA 1T56A 5GPAA 3HE0A 3IH4A 2GENA 2PBXA 3LSRA 2GUHA 2XRLA 2IU5A 3HGYA 4XK4A 3FK6A 3MVPA 5CW8A 2RASA 3DEWA 3BJBA 3NXCA 1JT6A 3BTCA 3CRJA 2VKEA 2ID3A 2RHAA 3EUPA 3BNIA 3LHQA 2ZB9A 1Z0XA
chains in the Genus database with same CATH superfamily
5HBUA 1QPIA 2XPUA 4ABZA 5GPCA 2HYTA 4W1UA 2FBQA 2O7TA 2UXIA 3ZQFA 5EZGA 3ZQGA 3TP3A 1Z77A 4OD4A 2XB5A 2QKOA 3FIWA 2G3BA 3EGQA 2HXIA 2V57A 2GFNA 2ZOYA 3B81A 5FHPA 2OI8A 3DCFA 3CDLA 3CCYA 5D19A 2FJ1A 2FJI1 3QPLA 5FKNA 2TRTA 3KKDA 1A6IA 3VW2A 3E7QA 2ZCXA 3Q3SA 2PZ9A 4W97A 2G7GA 4X1EA 3VTIA 4D5CA 3C07A 5F08A 3BTJA 2GBYA 2QIBA 5IPAA 4M3GA 3RD3A 5CXIA 2OERA 3CJDA 3Q0WA 4C2MA 3ON2A 1BJZA 3ANPA 4AF5A 3VPRA 5HSZA 2QOPA 3KZ9A 5CQGA 2W53A 1JUPA 3SWHA 3BRUA 5F1JA 2IBDA 2WUIA 3BHQA 3FHNA 3HIMA 5AQCA 2DTZA 2FQ4A 5K58A 2HYJA 3DPJA 2XPVA 5CXGA 4MO7A 2F07A 4JL3A 4GCKA 2UXHA 2VKVA 2R7OA 2R7QA 5F27A 3B6CA 1SGMA 3NS4A 4HKUA 2G0EA 2WV1A 3ON4A 3VVYA 4B3AA 4M3BA 1U9NA 1T33A 4AUXA 2QWTA 4MXMA 3LSPA 1JT0A 3VUQA 4D7NA 3VOXA 3ANGA 4JKZA 4L62A 2ZCMA 1ZK8A 3V6GA 2X6OA 1UI6A 2B3WA 3QPSA 4GFKA 2PFVA 4YZEA 5GP9A 5EYRA 3LWJA 2G7LA 3VIBA 1RKTA 2VPRA 5EFYA 3G56A 4ICHA 2OPTA 3VVXA 4NELA 1QVTA 3O8HA 3VVZA 2JK3A 5K7FA 2UXUA 3GZIA 4G12A 5FGLA 3HTJA 2ZOZA 3VW1A 5FKKA 2JJ7A 3QKXA 5F0FA 4IRVA 3JSJA 5J1UA 2NP5A 2R7SA 3AQTA 3ZQLA 4GFLA 2NS7A 2REKA 4JYKA 5K7HA 3Q0VA 5D18A 2IAIA 2HKUA 3B6AA 4D5FA 1VI0A 4AC0A 3LOCA 2QTQA 2XGEA 3NPIA 3G1OA 2ID6A 1U9OA 1ORKA 2I10A 3IUVA 3MNLA 3BR0A 1ZKGA 1QVUA 3K8PC 3LSJA 4DW6A 3COLA 3QBMA 4I6ZA 3ZQHA 3HTAA 4M3EA 2A2FX 2G7SA 5H9TA 2WGBA 4NN1A 4V2GA 3G1MA 3BCGA 2OF7A 3C2BA 2DG8A 2XGCA 4M3DA 3V78A 2R7XA 3WHBA 3BTLA 2D6YA 3BQYA 3BT9A 3NRGA 3BR2A 5J1RA 2NX4A 3BQZA 2HQ5A 2Y31A 3RH2A 3SDGA 2Q24A 4ME9A 4M3FA 5FKMA 2O7OA 5FMPA 5HAWA 2Y2ZA 3CWRA 3QQAA 3GEUA 3O8GA 3BTIA 3KKCA 5D1RA 4PXIA 3O60A 2FD5A 3FRQA 2R7TA 4AC6A 4DVYP 4GCTA 2HXOA 1JUMA 3Q0UA 3HTHA 4WIBA 5F04A 4U9NA 3WHCA 2RAEA 2EH3A 1JTXA 3PPBA 2XDNA 2UXPA 2YVHA 3G7RA 2XGDA 3IH3A 5K7ZA 5J3LA 3VW0A 2ZCNA 5F0HA 3PM1A 3T6NA 1JTYA 2QCOA 4I76A 2YVXA 2YVEA 4UDSA 5DAJA 5F0CA 1UI5A 1JUSA 5IOZA 4ACIA 4JNNA 5C4YA 3S5RA 3NNRA 2UXOA 4MK6A 4V2FA 5J1YA 3LJLA 3TP0A 2TCTA 3DU5A 4KWAA 3P9TA 4B1RA 2NS8A 1RPWA 3ZQIA 3BR6A 2Y30A 3BR3A 5IP6A 3KNWA 3VP5A 2FX0A 4U9LA 4CGRA 2IEKA 2XPWA 3DU6A 5EZHA 3SFIA 3G1LA 3IH2A 4D7MA 2DG7A 3F0CA 3NI7A 1RKWA 3BR5A 2R7WA 3VOKA 3FK7A 2R7UA 5FKOA 2NP3A 5FKLA 2R7RA 2ZY9A 3HGGA 3F1BA 2B1EA 4GCLA 3PASA 4OD5A 3HTIA 2X9DA 5IOYA 3BR1A 2R7VA 3AQSA 1T56A 5GPAA 3HE0A 3IH4A 2GENA 2PBXA 3LSRA 2GUHA 2XRLA 2IU5A 3HGYA 4XK4A 3FK6A 3MVPA 5CW8A 2RASA 3DEWA 3KYLA 3BJBA 3NXCA 1JT6A 3BTCA 3CRJA 2VKEA 2ID3A 2RHAA 3EUPA 3BNIA 3LHQA 2ZB9A 1Z0XA
chains in the Genus database with same CATH topology
5HBUA 1QPIA 2XPUA 4ABZA 5GPCA 2HYTA 4W1UA 2FBQA 2O7TA 2UXIA 3ZQFA 5EZGA 3ZQGA 3TP3A 1Z77A 2XB5A 2QKOA 3FIWA 2G3BA 3EGQA 2HXIA 2V57A 2GFNA 2ZOYA 3B81A 5FHPA 2OI8A 3DCFA 3CDLA 3CCYA 5D19A 2FJ1A 3QPLA 5FKNA 2TRTA 3KKDA 1A6IA 3VW2A 3E7QA 2ZCXA 3Q3SA 2PZ9A 4W97A 2G7GA 4X1EA 4D5CA 3C07A 5F08A 3BTJA 2GBYA 2QIBA 5IPAA 4M3GA 3RD3A 5CXIA 2OERA 3CJDA 3Q0WA 3ON2A 1BJZA 3ANPA 4AF5A 3VPRA 5HSZA 2QOPA 3KZ9A 2W53A 1JUPA 3BRUA 5F1JA 2IBDA 2WUIA 3BHQA 3HIMA 5AQCA 2DTZA 2FQ4A 5K58A 2HYJA 3DPJA 2XPVA 5CXGA 4MO7A 2F07A 4JL3A 4GCKA 2UXHA 2VKVA 5F27A 3B6CA 1SGMA 4HKUA 2G0EA 2WV1A 3ON4A 3VVYA 4B3AA 4M3BA 1U9NA 1T33A 4AUXA 2QWTA 4MXMA 3LSPA 1JT0A 3VUQA 4D7NA 3VOXA 3ANGA 4JKZA 4L62A 2ZCMA 1ZK8A 3V6GA 2X6OA 1UI6A 3QPSA 4GFKA 4YZEA 5GP9A 5EYRA 3LWJA 2G7LA 3VIBA 1RKTA 2VPRA 5EFYA 3G56A 4ICHA 2OPTA 3VVXA 4NELA 1QVTA 3O8HA 3VVZA 2JK3A 5K7FA 2UXUA 3GZIA 4G12A 5FGLA 3HTJA 2ZOZA 3VW1A 5FKKA 2JJ7A 3QKXA 5F0FA 3JSJA 5J1UA 2NP5A 3AQTA 3ZQLA 4GFLA 2NS7A 2REKA 4JYKA 5K7HA 3Q0VA 5D18A 2IAIA 2HKUA 3B6AA 4D5FA 1VI0A 4AC0A 3LOCA 2QTQA 2XGEA 3NPIA 3G1OA 2ID6A 1U9OA 1ORKA 2I10A 3IUVA 3MNLA 3BR0A 1ZKGA 1QVUA 3LSJA 4DW6A 3COLA 3QBMA 4I6ZA 3ZQHA 3HTAA 4M3EA 2G7SA 5H9TA 2WGBA 4NN1A 4V2GA 3G1MA 3BCGA 2OF7A 3C2BA 2DG8A 2XGCA 4M3DA 3V78A 3WHBA 3BTLA 2D6YA 3BQYA 3BT9A 3NRGA 3BR2A 5J1RA 2NX4A 3BQZA 2HQ5A 2Y31A 3RH2A 3SDGA 2Q24A 4ME9A 4M3FA 5FKMA 2O7OA 5FMPA 5HAWA 2Y2ZA 3CWRA 3QQAA 3GEUA 3O8GA 3BTIA 3KKCA 5D1RA 4PXIA 3O60A 2FD5A 3FRQA 4AC6A 4GCTA 2HXOA 1JUMA 3Q0UA 3HTHA 5F04A 3WHCA 2RAEA 2EH3A 1JTXA 3PPBA 2XDNA 2UXPA 2YVHA 3G7RA 2XGDA 3IH3A 5K7ZA 5J3LA 3VW0A 2ZCNA 5F0HA 3PM1A 3T6NA 1JTYA 2QCOA 4I76A 2YVEA 4UDSA 5DAJA 5F0CA 1UI5A 1JUSA 5IOZA 4ACIA 4JNNA 5C4YA 3S5RA 3NNRA 2UXOA 4MK6A 4V2FA 5J1YA 3LJLA 3TP0A 2TCTA 4KWAA 3P9TA 4B1RA 2NS8A 1RPWA 3ZQIA 3BR6A 2Y30A 3BR3A 5IP6A 3KNWA 3VP5A 2FX0A 4CGRA 2IEKA 2XPWA 5EZHA 3SFIA 3G1LA 3IH2A 4D7MA 2DG7A 3F0CA 3NI7A 1RKWA 3BR5A 3VOKA 3FK7A 5FKOA 2NP3A 5FKLA 3HGGA 3F1BA 4GCLA 3PASA 3HTIA 2X9DA 5IOYA 3BR1A 3AQSA 1T56A 5GPAA 3HE0A 3IH4A 2GENA 2PBXA 3LSRA 2GUHA 2XRLA 2IU5A 3HGYA 4XK4A 3FK6A 3MVPA 5CW8A 2RASA 3DEWA 3BJBA 3NXCA 1JT6A 3BTCA 3CRJA 2VKEA 2ID3A 2RHAA 3EUPA 3BNIA 3LHQA 2ZB9A 1Z0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBU A;  1QPI A;  2XPU A;  4ABZ A;  5GPC A;  2HYT A;  4W1U A;  2FBQ A;  2O7T A;  2UXI A;  3ZQF A;  5EZG A;  3ZQG A;  3TP3 A;  1Z77 A;  2XB5 A;  2QKO A;  3FIW A;  2G3B A;  3EGQ A;  2HXI A;  2V57 A;  2GFN A;  2ZOY A;  3B81 A;  5FHP A;  2OI8 A;  3DCF A;  3CDL A;  3CCY A;  5D19 A;  2FJ1 A;  3QPL A;  5FKN A;  2TRT A;  3KKD A;  1A6I A;  3VW2 A;  3E7Q A;  2ZCX A;  3Q3S A;  2PZ9 A;  4W97 A;  2G7G A;  4X1E A;  4D5C A;  3C07 A;  5F08 A;  3BTJ A;  2GBY A;  2QIB A;  5IPA A;  4M3G A;  3RD3 A;  5CXI A;  2OER A;  3CJD A;  3Q0W A;  3ON2 A;  1BJZ A;  3ANP A;  4AF5 A;  3VPR A;  5HSZ A;  2QOP A;  3KZ9 A;  2W53 A;  1JUP A;  3BRU A;  5F1J A;  2IBD A;  2WUI A;  3BHQ A;  3HIM A;  5AQC A;  2DTZ A;  2FQ4 A;  5K58 A;  2HYJ A;  3DPJ A;  2XPV A;  5CXG A;  4MO7 A;  2F07 A;  4JL3 A;  4GCK A;  2UXH A;  2VKV A;  5F27 A;  3B6C A;  1SGM A;  4HKU A;  2G0E A;  2WV1 A;  3ON4 A;  3VVY A;  4B3A A;  4M3B A;  1U9N A;  1T33 A;  4AUX A;  2QWT A;  4MXM A;  3LSP A;  1JT0 A;  3VUQ A;  4D7N A;  3VOX A;  3ANG A;  4JKZ A;  4L62 A;  2ZCM A;  1ZK8 A;  3V6G A;  2X6O A;  1UI6 A;  3QPS A;  4GFK A;  4YZE A;  5GP9 A;  5EYR A;  3LWJ A;  2G7L A;  3VIB A;  1RKT A;  2VPR A;  5EFY A;  3G56 A;  4ICH A;  2OPT A;  3VVX A;  4NEL A;  1QVT A;  3O8H A;  3VVZ A;  2JK3 A;  5K7F A;  2UXU A;  3GZI A;  4G12 A;  5FGL A;  3HTJ A;  2ZOZ A;  3VW1 A;  5FKK A;  2JJ7 A;  3QKX A;  5F0F A;  3JSJ A;  5J1U A;  2NP5 A;  3AQT A;  3ZQL A;  4GFL A;  2NS7 A;  2REK A;  4JYK A;  5K7H A;  3Q0V A;  5D18 A;  2IAI A;  2HKU A;  3B6A A;  4D5F A;  1VI0 A;  4AC0 A;  3LOC A;  2QTQ A;  2XGE A;  3NPI A;  3G1O A;  2ID6 A;  1U9O A;  1ORK A;  2I10 A;  3IUV A;  3MNL A;  3BR0 A;  1ZKG A;  1QVU A;  3LSJ A;  4DW6 A;  3COL A;  3QBM A;  4I6Z A;  3ZQH A;  3HTA A;  4M3E A;  2G7S A;  5H9T A;  2WGB A;  4NN1 A;  4V2G A;  3G1M A;  3BCG A;  2OF7 A;  3C2B A;  2DG8 A;  2XGC A;  4M3D A;  3V78 A;  3WHB A;  3BTL A;  2D6Y A;  3BQY A;  3BT9 A;  3NRG A;  3BR2 A;  5J1R A;  2NX4 A;  3BQZ A;  2HQ5 A;  2Y31 A;  3RH2 A;  3SDG A;  2Q24 A;  4ME9 A;  4M3F A;  5FKM A;  2O7O A;  5FMP A;  5HAW A;  2Y2Z A;  3CWR A;  3QQA A;  3GEU A;  3O8G A;  3BTI A;  3KKC A;  5D1R A;  4PXI A;  3O60 A;  2FD5 A;  3FRQ A;  4AC6 A;  4GCT A;  2HXO A;  1JUM A;  3Q0U A;  3HTH A;  5F04 A;  3WHC A;  2RAE A;  2EH3 A;  1JTX A;  3PPB A;  2XDN A;  2UXP A;  2YVH A;  3G7R A;  2XGD A;  3IH3 A;  5K7Z A;  5J3L A;  3VW0 A;  2ZCN A;  5F0H A;  3PM1 A;  3T6N A;  1JTY A;  2QCO A;  4I76 A;  2YVE A;  4UDS A;  5DAJ A;  5F0C A;  1UI5 A;  1JUS A;  5IOZ A;  4ACI A;  4JNN A;  5C4Y A;  3S5R A;  3NNR A;  2UXO A;  4MK6 A;  4V2F A;  5J1Y A;  3LJL A;  3TP0 A;  2TCT A;  4KWA A;  3P9T A;  4B1R A;  2NS8 A;  1RPW A;  3ZQI A;  3BR6 A;  2Y30 A;  3BR3 A;  5IP6 A;  3KNW A;  3VP5 A;  2FX0 A;  4CGR A;  2IEK A;  2XPW A;  5EZH A;  3SFI A;  3G1L A;  3IH2 A;  4D7M A;  2DG7 A;  3F0C A;  3NI7 A;  1RKW A;  3BR5 A;  3VOK A;  3FK7 A;  5FKO A;  2NP3 A;  5FKL A;  3HGG A;  3F1B A;  4GCL A;  3PAS A;  3HTI A;  2X9D A;  5IOY A;  3BR1 A;  3AQS A;  1T56 A;  5GPA A;  3HE0 A;  3IH4 A;  2GEN A;  2PBX A;  3LSR A;  2GUH A;  2XRL A;  2IU5 A;  3HGY A;  4XK4 A;  3FK6 A;  3MVP A;  5CW8 A;  2RAS A;  3DEW A;  3BJB A;  3NXC A;  1JT6 A;  3BTC A;  3CRJ A;  2VKE A;  2ID3 A;  2RHA A;  3EUP A;  3BNI A;  3LHQ A;  2ZB9 A;  1Z0X A; 
#chains in the Genus database with same CATH topology
 5HBU A;  1QPI A;  2XPU A;  4ABZ A;  5GPC A;  2HYT A;  4W1U A;  2FBQ A;  2O7T A;  2UXI A;  3ZQF A;  5EZG A;  3ZQG A;  3TP3 A;  1Z77 A;  4OD4 A;  2XB5 A;  2QKO A;  3FIW A;  2G3B A;  3EGQ A;  2HXI A;  2V57 A;  2GFN A;  2ZOY A;  3B81 A;  5FHP A;  2OI8 A;  3DCF A;  3CDL A;  3CCY A;  5D19 A;  2FJ1 A;  2FJI 1;  3QPL A;  5FKN A;  2TRT A;  3KKD A;  1A6I A;  3VW2 A;  3E7Q A;  2ZCX A;  3Q3S A;  2PZ9 A;  4W97 A;  2G7G A;  4X1E A;  3VTI A;  4D5C A;  3C07 A;  5F08 A;  3BTJ A;  2GBY A;  2QIB A;  5IPA A;  4M3G A;  3RD3 A;  5CXI A;  2OER A;  3CJD A;  3Q0W A;  4C2M A;  3ON2 A;  1BJZ A;  3ANP A;  4AF5 A;  3VPR A;  5HSZ A;  2QOP A;  3KZ9 A;  5CQG A;  2W53 A;  1JUP A;  3SWH A;  3BRU A;  5F1J A;  2IBD A;  2WUI A;  3BHQ A;  3FHN A;  3HIM A;  5AQC A;  2DTZ A;  2FQ4 A;  5K58 A;  2HYJ A;  3DPJ A;  2XPV A;  5CXG A;  4MO7 A;  2F07 A;  4JL3 A;  4GCK A;  2UXH A;  2VKV A;  2R7O A;  2R7Q A;  5F27 A;  3B6C A;  1SGM A;  3NS4 A;  4HKU A;  2G0E A;  2WV1 A;  3ON4 A;  3VVY A;  4B3A A;  4M3B A;  1U9N A;  1T33 A;  4AUX A;  2QWT A;  4MXM A;  3LSP A;  1JT0 A;  3VUQ A;  4D7N A;  3VOX A;  3ANG A;  4JKZ A;  4L62 A;  2ZCM A;  1ZK8 A;  3V6G A;  2X6O A;  1UI6 A;  2B3W A;  3QPS A;  4GFK A;  2PFV A;  4YZE A;  5GP9 A;  5EYR A;  3LWJ A;  2G7L A;  3VIB A;  1RKT A;  2VPR A;  5EFY A;  3G56 A;  4ICH A;  2OPT A;  3VVX A;  4NEL A;  1QVT A;  3O8H A;  3VVZ A;  2JK3 A;  5K7F A;  2UXU A;  3GZI A;  4G12 A;  5FGL A;  3HTJ A;  2ZOZ A;  3VW1 A;  5FKK A;  2JJ7 A;  3QKX A;  5F0F A;  4IRV A;  3JSJ A;  5J1U A;  2NP5 A;  2R7S A;  3AQT A;  3ZQL A;  4GFL A;  2NS7 A;  2REK A;  4JYK A;  5K7H A;  3Q0V A;  5D18 A;  2IAI A;  2HKU A;  3B6A A;  4D5F A;  1VI0 A;  4AC0 A;  3LOC A;  2QTQ A;  2XGE A;  3NPI A;  3G1O A;  2ID6 A;  1U9O A;  1ORK A;  2I10 A;  3IUV A;  3MNL A;  3BR0 A;  1ZKG A;  1QVU A;  3K8P C;  3LSJ A;  4DW6 A;  3COL A;  3QBM A;  4I6Z A;  3ZQH A;  3HTA A;  4M3E A;  2A2F X;  2G7S A;  5H9T A;  2WGB A;  4NN1 A;  4V2G A;  3G1M A;  3BCG A;  2OF7 A;  3C2B A;  2DG8 A;  2XGC A;  4M3D A;  3V78 A;  2R7X A;  3WHB A;  3BTL A;  2D6Y A;  3BQY A;  3BT9 A;  3NRG A;  3BR2 A;  5J1R A;  2NX4 A;  3BQZ A;  2HQ5 A;  2Y31 A;  3RH2 A;  3SDG A;  2Q24 A;  4ME9 A;  4M3F A;  5FKM A;  2O7O A;  5FMP A;  5HAW A;  2Y2Z A;  3CWR A;  3QQA A;  3GEU A;  3O8G A;  3BTI A;  3KKC A;  5D1R A;  4PXI A;  3O60 A;  2FD5 A;  3FRQ A;  2R7T A;  4AC6 A;  4DVY P;  4GCT A;  2HXO A;  1JUM A;  3Q0U A;  3HTH A;  4WIB A;  5F04 A;  4U9N A;  3WHC A;  2RAE A;  2EH3 A;  1JTX A;  3PPB A;  2XDN A;  2UXP A;  2YVH A;  3G7R A;  2XGD A;  3IH3 A;  5K7Z A;  5J3L A;  3VW0 A;  2ZCN A;  5F0H A;  3PM1 A;  3T6N A;  1JTY A;  2QCO A;  4I76 A;  2YVX A;  2YVE A;  4UDS A;  5DAJ A;  5F0C A;  1UI5 A;  1JUS A;  5IOZ A;  4ACI A;  4JNN A;  5C4Y A;  3S5R A;  3NNR A;  2UXO A;  4MK6 A;  4V2F A;  5J1Y A;  3LJL A;  3TP0 A;  2TCT A;  3DU5 A;  4KWA A;  3P9T A;  4B1R A;  2NS8 A;  1RPW A;  3ZQI A;  3BR6 A;  2Y30 A;  3BR3 A;  5IP6 A;  3KNW A;  3VP5 A;  2FX0 A;  4U9L A;  4CGR A;  2IEK A;  2XPW A;  3DU6 A;  5EZH A;  3SFI A;  3G1L A;  3IH2 A;  4D7M A;  2DG7 A;  3F0C A;  3NI7 A;  1RKW A;  3BR5 A;  2R7W A;  3VOK A;  3FK7 A;  2R7U A;  5FKO A;  2NP3 A;  5FKL A;  2R7R A;  2ZY9 A;  3HGG A;  3F1B A;  2B1E A;  4GCL A;  3PAS A;  4OD5 A;  3HTI A;  2X9D A;  5IOY A;  3BR1 A;  2R7V A;  3AQS A;  1T56 A;  5GPA A;  3HE0 A;  3IH4 A;  2GEN A;  2PBX A;  3LSR A;  2GUH A;  2XRL A;  2IU5 A;  3HGY A;  4XK4 A;  3FK6 A;  3MVP A;  5CW8 A;  2RAS A;  3DEW A;  3KYL A;  3BJB A;  3NXC A;  1JT6 A;  3BTC A;  3CRJ A;  2VKE A;  2ID3 A;  2RHA A;  3EUP A;  3BNI A;  3LHQ A;  2ZB9 A;  1Z0X A; 
#chains in the Genus database with same CATH homology
 5HBU A;  1QPI A;  2XPU A;  4ABZ A;  5GPC A;  2HYT A;  4W1U A;  2FBQ A;  2O7T A;  2UXI A;  3ZQF A;  5EZG A;  3ZQG A;  3TP3 A;  1Z77 A;  2XB5 A;  2QKO A;  3FIW A;  2G3B A;  3EGQ A;  2HXI A;  2V57 A;  2GFN A;  2ZOY A;  3B81 A;  5FHP A;  2OI8 A;  3DCF A;  3CDL A;  3CCY A;  5D19 A;  2FJ1 A;  3QPL A;  5FKN A;  2TRT A;  3KKD A;  1A6I A;  3VW2 A;  3E7Q A;  2ZCX A;  3Q3S A;  2PZ9 A;  4W97 A;  2G7G A;  4X1E A;  4D5C A;  3C07 A;  5F08 A;  3BTJ A;  2GBY A;  2QIB A;  5IPA A;  4M3G A;  3RD3 A;  5CXI A;  2OER A;  3CJD A;  3Q0W A;  3ON2 A;  1BJZ A;  3ANP A;  4AF5 A;  3VPR A;  5HSZ A;  2QOP A;  3KZ9 A;  2W53 A;  1JUP A;  3BRU A;  5F1J A;  2IBD A;  2WUI A;  3BHQ A;  3HIM A;  5AQC A;  2DTZ A;  2FQ4 A;  5K58 A;  2HYJ A;  3DPJ A;  2XPV A;  5CXG A;  4MO7 A;  2F07 A;  4JL3 A;  4GCK A;  2UXH A;  2VKV A;  5F27 A;  3B6C A;  1SGM A;  4HKU A;  2G0E A;  2WV1 A;  3ON4 A;  3VVY A;  4B3A A;  4M3B A;  1U9N A;  1T33 A;  4AUX A;  2QWT A;  4MXM A;  3LSP A;  1JT0 A;  3VUQ A;  4D7N A;  3VOX A;  3ANG A;  4JKZ A;  4L62 A;  2ZCM A;  1ZK8 A;  3V6G A;  2X6O A;  1UI6 A;  3QPS A;  4GFK A;  4YZE A;  5GP9 A;  5EYR A;  3LWJ A;  2G7L A;  3VIB A;  1RKT A;  2VPR A;  5EFY A;  3G56 A;  4ICH A;  2OPT A;  3VVX A;  4NEL A;  1QVT A;  3O8H A;  3VVZ A;  2JK3 A;  5K7F A;  2UXU A;  3GZI A;  4G12 A;  5FGL A;  3HTJ A;  2ZOZ A;  3VW1 A;  5FKK A;  2JJ7 A;  3QKX A;  5F0F A;  3JSJ A;  5J1U A;  2NP5 A;  3AQT A;  3ZQL A;  4GFL A;  2NS7 A;  2REK A;  4JYK A;  5K7H A;  3Q0V A;  5D18 A;  2IAI A;  2HKU A;  3B6A A;  4D5F A;  1VI0 A;  4AC0 A;  3LOC A;  2QTQ A;  2XGE A;  3NPI A;  3G1O A;  2ID6 A;  1U9O A;  1ORK A;  2I10 A;  3IUV A;  3MNL A;  3BR0 A;  1ZKG A;  1QVU A;  3LSJ A;  4DW6 A;  3COL A;  3QBM A;  4I6Z A;  3ZQH A;  3HTA A;  4M3E A;  2G7S A;  5H9T A;  2WGB A;  4NN1 A;  4V2G A;  3G1M A;  3BCG A;  2OF7 A;  3C2B A;  2DG8 A;  2XGC A;  4M3D A;  3V78 A;  3WHB A;  3BTL A;  2D6Y A;  3BQY A;  3BT9 A;  3NRG A;  3BR2 A;  5J1R A;  2NX4 A;  3BQZ A;  2HQ5 A;  2Y31 A;  3RH2 A;  3SDG A;  2Q24 A;  4ME9 A;  4M3F A;  5FKM A;  2O7O A;  5FMP A;  5HAW A;  2Y2Z A;  3CWR A;  3QQA A;  3GEU A;  3O8G A;  3BTI A;  3KKC A;  5D1R A;  4PXI A;  3O60 A;  2FD5 A;  3FRQ A;  4AC6 A;  4GCT A;  2HXO A;  1JUM A;  3Q0U A;  3HTH A;  5F04 A;  3WHC A;  2RAE A;  2EH3 A;  1JTX A;  3PPB A;  2XDN A;  2UXP A;  2YVH A;  3G7R A;  2XGD A;  3IH3 A;  5K7Z A;  5J3L A;  3VW0 A;  2ZCN A;  5F0H A;  3PM1 A;  3T6N A;  1JTY A;  2QCO A;  4I76 A;  2YVE A;  4UDS A;  5DAJ A;  5F0C A;  1UI5 A;  1JUS A;  5IOZ A;  4ACI A;  4JNN A;  5C4Y A;  3S5R A;  3NNR A;  2UXO A;  4MK6 A;  4V2F A;  5J1Y A;  3LJL A;  3TP0 A;  2TCT A;  4KWA A;  3P9T A;  4B1R A;  2NS8 A;  1RPW A;  3ZQI A;  3BR6 A;  2Y30 A;  3BR3 A;  5IP6 A;  3KNW A;  3VP5 A;  2FX0 A;  4CGR A;  2IEK A;  2XPW A;  5EZH A;  3SFI A;  3G1L A;  3IH2 A;  4D7M A;  2DG7 A;  3F0C A;  3NI7 A;  1RKW A;  3BR5 A;  3VOK A;  3FK7 A;  5FKO A;  2NP3 A;  5FKL A;  3HGG A;  3F1B A;  4GCL A;  3PAS A;  3HTI A;  2X9D A;  5IOY A;  3BR1 A;  3AQS A;  1T56 A;  5GPA A;  3HE0 A;  3IH4 A;  2GEN A;  2PBX A;  3LSR A;  2GUH A;  2XRL A;  2IU5 A;  3HGY A;  4XK4 A;  3FK6 A;  3MVP A;  5CW8 A;  2RAS A;  3DEW A;  3BJB A;  3NXC A;  1JT6 A;  3BTC A;  3CRJ A;  2VKE A;  2ID3 A;  2RHA A;  3EUP A;  3BNI A;  3LHQ A;  2ZB9 A;  1Z0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...