3NXCA

Molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
177
Chain Sequence
b'RNRREEILQSLALMLESITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHARLQGRINQLFERIEAQLRQVLREKRMREGGYATDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type protein slmA
publication title Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 63
structure length 177
sequence length 190
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nxcA00
4JNNA 2VPRA 2QOPA 5C4YA 3V78A 3BT9A 4AC6A 2FJ1A 3E7QA 1ZKGA 3LWJA 4AC0A 2RHAA 2NX4A 3HGGA 5DAJA 3CCYA 1BJZA 3BNIA 1RKWA 3JSJA 4M3FA 3HE0A 3BR3A 3BR2A 3V6GA 2WV1A 2O7OA 3GZIA 2QTQA 1QVTA 4L62A 5D18A 2UXPA 3VVZA 3NRGA 2X6OA 2O7TA 3QKXA 1VI0A 5F08A 3VW1A 3LSJA 3KNWA 3BTLA 5IOYA 3ANPA 5K7HA 2G7LA 2RAEA 2UXIA 3F1BA 3AQSA 3KKCA 3BQYA 2FQ4A 4XK4A 2Q24A 3C07A 3G1OA 3QQAA 5H9TA 3VOKA 5CXGA 2QWTA 3ZQGA 3O60A 2JJ7A 5F04A 5K7FA 2GFNA 1U9OA 3WHCA 1UI5A 3NPIA 3LOCA 5FKOA 3ZQLA 1JTXA 1A6IA 2FD5A 5CXIA 4D7NA 3RH2A 4NELA 2PZ9A 3SFIA 3VVYA 4KWAA 1JUMA 3S5RA 4D5FA 3BCGA 3TP3A 2G3BA 2OI8A 5HSZA 2RASA 3FK7A 4GFLA 4ACIA 4I76A 2VKEA 5F0FA 2XDNA 5GP9A 3DPJA 1SGMA 4AF5A 2G0EA 2ZOYA 3B81A 3BTIA 2F07A 2FBQA 3G1LA 2TRTA 2I10A 3IH3A 4X1EA 1Z0XA 4B1RA 2NS8A 2VKVA 3VOXA 3EGQA 3KKDA 3VW2A 3TP0A 4W97A 3FIWA 3G7RA 4YZEA 2PBXA 2ZB9A 3O8GA 3PASA 3PPBA 4V2FA 2XPVA 1JUSA 3ON4A 3NNRA 2EH3A 2HYJA 2UXHA 3COLA 2UXOA 3BHQA 3BTJA 3MVPA 3O8HA 3B6AA 4GCLA 3LJLA 3DEWA 2OF7A 5FMPA 5FGLA 3EUPA 4ME9A 5F0CA 2NP3A 2XGEA 2ZCNA 3VUQA 4M3EA 2NS7A 1JT0A 2NP5A 3VVXA 3CDLA 2G7SA 3DCFA 4M3GA 3ZQFA 5D19A 4DW6A 5F27A 3PM1A 2Y30A 5D1RA 2ID6A 1JT6A 3CRJA 4B3AA 5F0HA 3LHQA 3QPSA 3BR0A 3FRQA 2XB5A 5J1UA 2REKA 2XPWA 5IP6A 4ICHA 5GPAA 3F0CA 3RD3A 5FKLA 2Y2ZA 3ZQHA 5HAWA 2YVHA 2HYTA 2DG7A 2XGDA 2OERA 2ZOZA 5FHPA 4CGRA 3NI7A 2WUIA 1UI6A 4ABZA 5FKMA 2IAIA 3BRUA 5EYRA 5J3LA 1T33A 3ANGA 1JUPA 1Z77A 4UDSA 2GBYA 4MXMA 1JTYA 2QKOA 3Q0UA 2G7GA 1ORKA 4GFKA 2XPUA 3VIBA 5K7ZA 4M3BA 1RPWA 4GCKA 1T56A 2GENA 3G1MA 5CW8A 2QIBA 2DTZA 3BJBA 3LSRA 2W53A 1U9NA 2XGCA 3C2BA 3ON2A 3SDGA 3HTJA 2V57A 2Y31A 5FKNA 5AQCA 2XRLA 4MO7A 3IH4A 3BR6A 2QCOA 3HTAA 3QPLA 1RKTA 3HTHA 5J1YA 3VW0A 2WGBA 3BR5A 3HTIA 4AUXA 4I6ZA 4D7MA 3Q0WA 3NXCA 4V2GA 4M3DA 2UXUA 2ZCXA 3CWRA 2OPTA 2HQ5A 3T6NA 2FX0A 3B6CA 4NN1A 4G12A 3IH2A 2TCTA 4PXIA 5F1JA 3P9TA 2X9DA 3HIMA 2D6YA 4JL3A 3LSPA 1QPIA 2HXIA 4JYKA 4GCTA 1QVUA 4MK6A 5EZHA 2IEKA 3AQTA 4HKUA 3BTCA 5IPAA 3QBMA 5IOZA 3KZ9A 3CJDA 2JK3A 3BR1A 3G56A 2HXOA 5J1RA 3FK6A 3ZQIA 2IU5A 2YVEA 3GEUA 3HGYA 2GUHA 3MNLA 5EFYA 5EZGA 2ID3A 3VP5A 3WHBA 4D5CA 5FKKA 4JKZA 5HBUA 2ZCMA 2DG8A 2HKUA 3Q3SA 1ZK8A 5GPCA 3IUVA 3VPRA 3BQZA 2IBDA 3Q0VA 5K58A 4W1UA
chains in the Genus database with same CATH superfamily
4JNNA 2VPRA 2QOPA 5C4YA 3V78A 2R7XA 3BT9A 4AC6A 2FJ1A 3E7QA 1ZKGA 3LWJA 4AC0A 2RHAA 2NX4A 3HGGA 5DAJA 3CCYA 1BJZA 3BNIA 1RKWA 3JSJA 4M3FA 3HE0A 3BR3A 3BR2A 3V6GA 2WV1A 2O7OA 3GZIA 2QTQA 1QVTA 4L62A 5D18A 2UXPA 3VVZA 3NRGA 2X6OA 2O7TA 3QKXA 1VI0A 5F08A 3VW1A 3LSJA 3KNWA 3BTLA 2ZY9A 5IOYA 3ANPA 5K7HA 2G7LA 2RAEA 2UXIA 4U9LA 3F1BA 3AQSA 3KKCA 3BQYA 2FQ4A 4XK4A 2Q24A 3C07A 3G1OA 3QQAA 5H9TA 3VOKA 5CXGA 2QWTA 3ZQGA 3DU5A 3O60A 2JJ7A 5F04A 5K7FA 2GFNA 1U9OA 3WHCA 1UI5A 3NPIA 3LOCA 5FKOA 3ZQLA 2PFVA 1JTXA 1A6IA 2FD5A 5CXIA 4D7NA 3RH2A 4NELA 2PZ9A 3SFIA 3VVYA 4KWAA 1JUMA 3S5RA 4D5FA 3BCGA 3TP3A 2G3BA 2OI8A 5HSZA 2RASA 3FK7A 2R7QA 4GFLA 4ACIA 4I76A 2VKEA 5F0FA 4U9NA 2FJI1 3DU6A 2XDNA 5GP9A 3DPJA 1SGMA 4AF5A 2G0EA 2ZOYA 3B81A 3BTIA 2F07A 2FBQA 3G1LA 2TRTA 2I10A 3IH3A 4X1EA 1Z0XA 4B1RA 4DVYP 2NS8A 2VKVA 3VOXA 3EGQA 3KKDA 3VW2A 3TP0A 4W97A 4WIBA 2R7RA 3FIWA 3G7RA 4YZEA 5CQGA 2PBXA 2ZB9A 3O8GA 3PASA 3PPBA 4V2FA 2XPVA 1JUSA 3ON4A 3NNRA 2EH3A 2HYJA 2UXHA 3COLA 2R7SA 2UXOA 3BHQA 3BTJA 4OD5A 3MVPA 3O8HA 3B6AA 4GCLA 3LJLA 3DEWA 2OF7A 5FMPA 5FGLA 3EUPA 4ME9A 3KYLA 5F0CA 2NP3A 2XGEA 2ZCNA 2B3WA 3VUQA 4M3EA 2NS7A 1JT0A 2NP5A 3VVXA 3CDLA 2G7SA 3DCFA 4M3GA 3ZQFA 5D19A 4DW6A 2R7UA 5F27A 3PM1A 2Y30A 5D1RA 2ID6A 1JT6A 3CRJA 4B3AA 5F0HA 3LHQA 3QPSA 3BR0A 3FRQA 2XB5A 5J1UA 2REKA 2XPWA 5IP6A 4ICHA 5GPAA 3F0CA 3RD3A 2R7OA 5FKLA 2Y2ZA 3ZQHA 5HAWA 2YVHA 2HYTA 2DG7A 2XGDA 2OERA 2ZOZA 5FHPA 4CGRA 3NI7A 2WUIA 1UI6A 4ABZA 5FKMA 2IAIA 3BRUA 5EYRA 5J3LA 1T33A 3ANGA 1JUPA 1Z77A 4UDSA 2GBYA 4MXMA 1JTYA 2QKOA 3Q0UA 2G7GA 1ORKA 4GFKA 3K8PC 2XPUA 3VIBA 5K7ZA 4M3BA 1RPWA 4GCKA 1T56A 2GENA 3G1MA 5CW8A 2QIBA 2DTZA 3BJBA 3LSRA 2W53A 1U9NA 2XGCA 3C2BA 3ON2A 3SDGA 3HTJA 2V57A 2Y31A 5FKNA 5AQCA 2XRLA 2A2FX 4MO7A 3IH4A 3BR6A 2QCOA 3HTAA 3QPLA 1RKTA 3HTHA 5J1YA 3VW0A 2WGBA 2R7VA 3BR5A 3HTIA 4AUXA 4I6ZA 4D7MA 3NS4A 3Q0WA 2YVXA 3NXCA 4V2GA 4M3DA 2UXUA 2ZCXA 3CWRA 2OPTA 2HQ5A 3T6NA 2FX0A 3B6CA 4NN1A 4G12A 3IH2A 3SWHA 2TCTA 4PXIA 5F1JA 3P9TA 4C2MA 2X9DA 3HIMA 2D6YA 4JL3A 3LSPA 1QPIA 2HXIA 4OD4A 4JYKA 4GCTA 1QVUA 4MK6A 5EZHA 2IEKA 3AQTA 4HKUA 3BTCA 3FHNA 5IPAA 3QBMA 5IOZA 3KZ9A 3VTIA 3CJDA 2JK3A 3BR1A 3G56A 2HXOA 5J1RA 3FK6A 3ZQIA 2IU5A 2YVEA 3GEUA 3HGYA 2GUHA 3MNLA 5EFYA 5EZGA 2ID3A 3VP5A 3WHBA 2B1EA 4D5CA 2R7TA 5FKKA 4JKZA 5HBUA 2ZCMA 2DG8A 2R7WA 2HKUA 3Q3SA 1ZK8A 5GPCA 4IRVA 3IUVA 3VPRA 3BQZA 2IBDA 3Q0VA 5K58A 4W1UA
chains in the Genus database with same CATH topology
4JNNA 2VPRA 2QOPA 5C4YA 3V78A 3BT9A 4AC6A 2FJ1A 3E7QA 1ZKGA 3LWJA 4AC0A 2RHAA 2NX4A 3HGGA 5DAJA 3CCYA 1BJZA 3BNIA 1RKWA 3JSJA 4M3FA 3HE0A 3BR3A 3BR2A 3V6GA 2WV1A 2O7OA 3GZIA 2QTQA 1QVTA 4L62A 5D18A 2UXPA 3VVZA 3NRGA 2X6OA 2O7TA 3QKXA 1VI0A 5F08A 3VW1A 3LSJA 3KNWA 3BTLA 5IOYA 3ANPA 5K7HA 2G7LA 2RAEA 2UXIA 3F1BA 3AQSA 3KKCA 3BQYA 2FQ4A 4XK4A 2Q24A 3C07A 3G1OA 3QQAA 5H9TA 3VOKA 5CXGA 2QWTA 3ZQGA 3O60A 2JJ7A 5F04A 5K7FA 2GFNA 1U9OA 3WHCA 1UI5A 3NPIA 3LOCA 5FKOA 3ZQLA 1JTXA 1A6IA 2FD5A 5CXIA 4D7NA 3RH2A 4NELA 2PZ9A 3SFIA 3VVYA 4KWAA 1JUMA 3S5RA 4D5FA 3BCGA 3TP3A 2G3BA 2OI8A 5HSZA 2RASA 3FK7A 4GFLA 4ACIA 4I76A 2VKEA 5F0FA 2XDNA 5GP9A 3DPJA 1SGMA 4AF5A 2G0EA 2ZOYA 3B81A 3BTIA 2F07A 2FBQA 3G1LA 2TRTA 2I10A 3IH3A 4X1EA 1Z0XA 4B1RA 2NS8A 2VKVA 3VOXA 3EGQA 3KKDA 3VW2A 3TP0A 4W97A 3FIWA 3G7RA 4YZEA 2PBXA 2ZB9A 3O8GA 3PASA 3PPBA 4V2FA 2XPVA 1JUSA 3ON4A 3NNRA 2EH3A 2HYJA 2UXHA 3COLA 2UXOA 3BHQA 3BTJA 3MVPA 3O8HA 3B6AA 4GCLA 3LJLA 3DEWA 2OF7A 5FMPA 5FGLA 3EUPA 4ME9A 5F0CA 2NP3A 2XGEA 2ZCNA 3VUQA 4M3EA 2NS7A 1JT0A 2NP5A 3VVXA 3CDLA 2G7SA 3DCFA 4M3GA 3ZQFA 5D19A 4DW6A 5F27A 3PM1A 2Y30A 5D1RA 2ID6A 1JT6A 3CRJA 4B3AA 5F0HA 3LHQA 3QPSA 3BR0A 3FRQA 2XB5A 5J1UA 2REKA 2XPWA 5IP6A 4ICHA 5GPAA 3F0CA 3RD3A 5FKLA 2Y2ZA 3ZQHA 5HAWA 2YVHA 2HYTA 2DG7A 2XGDA 2OERA 2ZOZA 5FHPA 4CGRA 3NI7A 2WUIA 1UI6A 4ABZA 5FKMA 2IAIA 3BRUA 5EYRA 5J3LA 1T33A 3ANGA 1JUPA 1Z77A 4UDSA 2GBYA 4MXMA 1JTYA 2QKOA 3Q0UA 2G7GA 1ORKA 4GFKA 2XPUA 3VIBA 5K7ZA 4M3BA 1RPWA 4GCKA 1T56A 2GENA 3G1MA 5CW8A 2QIBA 2DTZA 3BJBA 3LSRA 2W53A 1U9NA 2XGCA 3C2BA 3ON2A 3SDGA 3HTJA 2V57A 2Y31A 5FKNA 5AQCA 2XRLA 4MO7A 3IH4A 3BR6A 2QCOA 3HTAA 3QPLA 1RKTA 3HTHA 5J1YA 3VW0A 2WGBA 3BR5A 3HTIA 4AUXA 4I6ZA 4D7MA 3Q0WA 3NXCA 4V2GA 4M3DA 2UXUA 2ZCXA 3CWRA 2OPTA 2HQ5A 3T6NA 2FX0A 3B6CA 4NN1A 4G12A 3IH2A 2TCTA 4PXIA 5F1JA 3P9TA 2X9DA 3HIMA 2D6YA 4JL3A 3LSPA 1QPIA 2HXIA 4JYKA 4GCTA 1QVUA 4MK6A 5EZHA 2IEKA 3AQTA 4HKUA 3BTCA 5IPAA 3QBMA 5IOZA 3KZ9A 3CJDA 2JK3A 3BR1A 3G56A 2HXOA 5J1RA 3FK6A 3ZQIA 2IU5A 2YVEA 3GEUA 3HGYA 2GUHA 3MNLA 5EFYA 5EZGA 2ID3A 3VP5A 3WHBA 4D5CA 5FKKA 4JKZA 5HBUA 2ZCMA 2DG8A 2HKUA 3Q3SA 1ZK8A 5GPCA 3IUVA 3VPRA 3BQZA 2IBDA 3Q0VA 5K58A 4W1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNN A;  2VPR A;  2QOP A;  5C4Y A;  3V78 A;  3BT9 A;  4AC6 A;  2FJ1 A;  3E7Q A;  1ZKG A;  3LWJ A;  4AC0 A;  2RHA A;  2NX4 A;  3HGG A;  5DAJ A;  3CCY A;  1BJZ A;  3BNI A;  1RKW A;  3JSJ A;  4M3F A;  3HE0 A;  3BR3 A;  3BR2 A;  3V6G A;  2WV1 A;  2O7O A;  3GZI A;  2QTQ A;  1QVT A;  4L62 A;  5D18 A;  2UXP A;  3VVZ A;  3NRG A;  2X6O A;  2O7T A;  3QKX A;  1VI0 A;  5F08 A;  3VW1 A;  3LSJ A;  3KNW A;  3BTL A;  5IOY A;  3ANP A;  5K7H A;  2G7L A;  2RAE A;  2UXI A;  3F1B A;  3AQS A;  3KKC A;  3BQY A;  2FQ4 A;  4XK4 A;  2Q24 A;  3C07 A;  3G1O A;  3QQA A;  5H9T A;  3VOK A;  5CXG A;  2QWT A;  3ZQG A;  3O60 A;  2JJ7 A;  5F04 A;  5K7F A;  2GFN A;  1U9O A;  3WHC A;  1UI5 A;  3NPI A;  3LOC A;  5FKO A;  3ZQL A;  1JTX A;  1A6I A;  2FD5 A;  5CXI A;  4D7N A;  3RH2 A;  4NEL A;  2PZ9 A;  3SFI A;  3VVY A;  4KWA A;  1JUM A;  3S5R A;  4D5F A;  3BCG A;  3TP3 A;  2G3B A;  2OI8 A;  5HSZ A;  2RAS A;  3FK7 A;  4GFL A;  4ACI A;  4I76 A;  2VKE A;  5F0F A;  2XDN A;  5GP9 A;  3DPJ A;  1SGM A;  4AF5 A;  2G0E A;  2ZOY A;  3B81 A;  3BTI A;  2F07 A;  2FBQ A;  3G1L A;  2TRT A;  2I10 A;  3IH3 A;  4X1E A;  1Z0X A;  4B1R A;  2NS8 A;  2VKV A;  3VOX A;  3EGQ A;  3KKD A;  3VW2 A;  3TP0 A;  4W97 A;  3FIW A;  3G7R A;  4YZE A;  2PBX A;  2ZB9 A;  3O8G A;  3PAS A;  3PPB A;  4V2F A;  2XPV A;  1JUS A;  3ON4 A;  3NNR A;  2EH3 A;  2HYJ A;  2UXH A;  3COL A;  2UXO A;  3BHQ A;  3BTJ A;  3MVP A;  3O8H A;  3B6A A;  4GCL A;  3LJL A;  3DEW A;  2OF7 A;  5FMP A;  5FGL A;  3EUP A;  4ME9 A;  5F0C A;  2NP3 A;  2XGE A;  2ZCN A;  3VUQ A;  4M3E A;  2NS7 A;  1JT0 A;  2NP5 A;  3VVX A;  3CDL A;  2G7S A;  3DCF A;  4M3G A;  3ZQF A;  5D19 A;  4DW6 A;  5F27 A;  3PM1 A;  2Y30 A;  5D1R A;  2ID6 A;  1JT6 A;  3CRJ A;  4B3A A;  5F0H A;  3LHQ A;  3QPS A;  3BR0 A;  3FRQ A;  2XB5 A;  5J1U A;  2REK A;  2XPW A;  5IP6 A;  4ICH A;  5GPA A;  3F0C A;  3RD3 A;  5FKL A;  2Y2Z A;  3ZQH A;  5HAW A;  2YVH A;  2HYT A;  2DG7 A;  2XGD A;  2OER A;  2ZOZ A;  5FHP A;  4CGR A;  3NI7 A;  2WUI A;  1UI6 A;  4ABZ A;  5FKM A;  2IAI A;  3BRU A;  5EYR A;  5J3L A;  1T33 A;  3ANG A;  1JUP A;  1Z77 A;  4UDS A;  2GBY A;  4MXM A;  1JTY A;  2QKO A;  3Q0U A;  2G7G A;  1ORK A;  4GFK A;  2XPU A;  3VIB A;  5K7Z A;  4M3B A;  1RPW A;  4GCK A;  1T56 A;  2GEN A;  3G1M A;  5CW8 A;  2QIB A;  2DTZ A;  3BJB A;  3LSR A;  2W53 A;  1U9N A;  2XGC A;  3C2B A;  3ON2 A;  3SDG A;  3HTJ A;  2V57 A;  2Y31 A;  5FKN A;  5AQC A;  2XRL A;  4MO7 A;  3IH4 A;  3BR6 A;  2QCO A;  3HTA A;  3QPL A;  1RKT A;  3HTH A;  5J1Y A;  3VW0 A;  2WGB A;  3BR5 A;  3HTI A;  4AUX A;  4I6Z A;  4D7M A;  3Q0W A;  3NXC A;  4V2G A;  4M3D A;  2UXU A;  2ZCX A;  3CWR A;  2OPT A;  2HQ5 A;  3T6N A;  2FX0 A;  3B6C A;  4NN1 A;  4G12 A;  3IH2 A;  2TCT A;  4PXI A;  5F1J A;  3P9T A;  2X9D A;  3HIM A;  2D6Y A;  4JL3 A;  3LSP A;  1QPI A;  2HXI A;  4JYK A;  4GCT A;  1QVU A;  4MK6 A;  5EZH A;  2IEK A;  3AQT A;  4HKU A;  3BTC A;  5IPA A;  3QBM A;  5IOZ A;  3KZ9 A;  3CJD A;  2JK3 A;  3BR1 A;  3G56 A;  2HXO A;  5J1R A;  3FK6 A;  3ZQI A;  2IU5 A;  2YVE A;  3GEU A;  3HGY A;  2GUH A;  3MNL A;  5EFY A;  5EZG A;  2ID3 A;  3VP5 A;  3WHB A;  4D5C A;  5FKK A;  4JKZ A;  5HBU A;  2ZCM A;  2DG8 A;  2HKU A;  3Q3S A;  1ZK8 A;  5GPC A;  3IUV A;  3VPR A;  3BQZ A;  2IBD A;  3Q0V A;  5K58 A;  4W1U A; 
#chains in the Genus database with same CATH topology
 4JNN A;  2VPR A;  2QOP A;  5C4Y A;  3V78 A;  2R7X A;  3BT9 A;  4AC6 A;  2FJ1 A;  3E7Q A;  1ZKG A;  3LWJ A;  4AC0 A;  2RHA A;  2NX4 A;  3HGG A;  5DAJ A;  3CCY A;  1BJZ A;  3BNI A;  1RKW A;  3JSJ A;  4M3F A;  3HE0 A;  3BR3 A;  3BR2 A;  3V6G A;  2WV1 A;  2O7O A;  3GZI A;  2QTQ A;  1QVT A;  4L62 A;  5D18 A;  2UXP A;  3VVZ A;  3NRG A;  2X6O A;  2O7T A;  3QKX A;  1VI0 A;  5F08 A;  3VW1 A;  3LSJ A;  3KNW A;  3BTL A;  2ZY9 A;  5IOY A;  3ANP A;  5K7H A;  2G7L A;  2RAE A;  2UXI A;  4U9L A;  3F1B A;  3AQS A;  3KKC A;  3BQY A;  2FQ4 A;  4XK4 A;  2Q24 A;  3C07 A;  3G1O A;  3QQA A;  5H9T A;  3VOK A;  5CXG A;  2QWT A;  3ZQG A;  3DU5 A;  3O60 A;  2JJ7 A;  5F04 A;  5K7F A;  2GFN A;  1U9O A;  3WHC A;  1UI5 A;  3NPI A;  3LOC A;  5FKO A;  3ZQL A;  2PFV A;  1JTX A;  1A6I A;  2FD5 A;  5CXI A;  4D7N A;  3RH2 A;  4NEL A;  2PZ9 A;  3SFI A;  3VVY A;  4KWA A;  1JUM A;  3S5R A;  4D5F A;  3BCG A;  3TP3 A;  2G3B A;  2OI8 A;  5HSZ A;  2RAS A;  3FK7 A;  2R7Q A;  4GFL A;  4ACI A;  4I76 A;  2VKE A;  5F0F A;  4U9N A;  2FJI 1;  3DU6 A;  2XDN A;  5GP9 A;  3DPJ A;  1SGM A;  4AF5 A;  2G0E A;  2ZOY A;  3B81 A;  3BTI A;  2F07 A;  2FBQ A;  3G1L A;  2TRT A;  2I10 A;  3IH3 A;  4X1E A;  1Z0X A;  4B1R A;  4DVY P;  2NS8 A;  2VKV A;  3VOX A;  3EGQ A;  3KKD A;  3VW2 A;  3TP0 A;  4W97 A;  4WIB A;  2R7R A;  3FIW A;  3G7R A;  4YZE A;  5CQG A;  2PBX A;  2ZB9 A;  3O8G A;  3PAS A;  3PPB A;  4V2F A;  2XPV A;  1JUS A;  3ON4 A;  3NNR A;  2EH3 A;  2HYJ A;  2UXH A;  3COL A;  2R7S A;  2UXO A;  3BHQ A;  3BTJ A;  4OD5 A;  3MVP A;  3O8H A;  3B6A A;  4GCL A;  3LJL A;  3DEW A;  2OF7 A;  5FMP A;  5FGL A;  3EUP A;  4ME9 A;  3KYL A;  5F0C A;  2NP3 A;  2XGE A;  2ZCN A;  2B3W A;  3VUQ A;  4M3E A;  2NS7 A;  1JT0 A;  2NP5 A;  3VVX A;  3CDL A;  2G7S A;  3DCF A;  4M3G A;  3ZQF A;  5D19 A;  4DW6 A;  2R7U A;  5F27 A;  3PM1 A;  2Y30 A;  5D1R A;  2ID6 A;  1JT6 A;  3CRJ A;  4B3A A;  5F0H A;  3LHQ A;  3QPS A;  3BR0 A;  3FRQ A;  2XB5 A;  5J1U A;  2REK A;  2XPW A;  5IP6 A;  4ICH A;  5GPA A;  3F0C A;  3RD3 A;  2R7O A;  5FKL A;  2Y2Z A;  3ZQH A;  5HAW A;  2YVH A;  2HYT A;  2DG7 A;  2XGD A;  2OER A;  2ZOZ A;  5FHP A;  4CGR A;  3NI7 A;  2WUI A;  1UI6 A;  4ABZ A;  5FKM A;  2IAI A;  3BRU A;  5EYR A;  5J3L A;  1T33 A;  3ANG A;  1JUP A;  1Z77 A;  4UDS A;  2GBY A;  4MXM A;  1JTY A;  2QKO A;  3Q0U A;  2G7G A;  1ORK A;  4GFK A;  3K8P C;  2XPU A;  3VIB A;  5K7Z A;  4M3B A;  1RPW A;  4GCK A;  1T56 A;  2GEN A;  3G1M A;  5CW8 A;  2QIB A;  2DTZ A;  3BJB A;  3LSR A;  2W53 A;  1U9N A;  2XGC A;  3C2B A;  3ON2 A;  3SDG A;  3HTJ A;  2V57 A;  2Y31 A;  5FKN A;  5AQC A;  2XRL A;  2A2F X;  4MO7 A;  3IH4 A;  3BR6 A;  2QCO A;  3HTA A;  3QPL A;  1RKT A;  3HTH A;  5J1Y A;  3VW0 A;  2WGB A;  2R7V A;  3BR5 A;  3HTI A;  4AUX A;  4I6Z A;  4D7M A;  3NS4 A;  3Q0W A;  2YVX A;  3NXC A;  4V2G A;  4M3D A;  2UXU A;  2ZCX A;  3CWR A;  2OPT A;  2HQ5 A;  3T6N A;  2FX0 A;  3B6C A;  4NN1 A;  4G12 A;  3IH2 A;  3SWH A;  2TCT A;  4PXI A;  5F1J A;  3P9T A;  4C2M A;  2X9D A;  3HIM A;  2D6Y A;  4JL3 A;  3LSP A;  1QPI A;  2HXI A;  4OD4 A;  4JYK A;  4GCT A;  1QVU A;  4MK6 A;  5EZH A;  2IEK A;  3AQT A;  4HKU A;  3BTC A;  3FHN A;  5IPA A;  3QBM A;  5IOZ A;  3KZ9 A;  3VTI A;  3CJD A;  2JK3 A;  3BR1 A;  3G56 A;  2HXO A;  5J1R A;  3FK6 A;  3ZQI A;  2IU5 A;  2YVE A;  3GEU A;  3HGY A;  2GUH A;  3MNL A;  5EFY A;  5EZG A;  2ID3 A;  3VP5 A;  3WHB A;  2B1E A;  4D5C A;  2R7T A;  5FKK A;  4JKZ A;  5HBU A;  2ZCM A;  2DG8 A;  2R7W A;  2HKU A;  3Q3S A;  1ZK8 A;  5GPC A;  4IRV A;  3IUV A;  3VPR A;  3BQZ A;  2IBD A;  3Q0V A;  5K58 A;  4W1U A; 
#chains in the Genus database with same CATH homology
 4JNN A;  2VPR A;  2QOP A;  5C4Y A;  3V78 A;  3BT9 A;  4AC6 A;  2FJ1 A;  3E7Q A;  1ZKG A;  3LWJ A;  4AC0 A;  2RHA A;  2NX4 A;  3HGG A;  5DAJ A;  3CCY A;  1BJZ A;  3BNI A;  1RKW A;  3JSJ A;  4M3F A;  3HE0 A;  3BR3 A;  3BR2 A;  3V6G A;  2WV1 A;  2O7O A;  3GZI A;  2QTQ A;  1QVT A;  4L62 A;  5D18 A;  2UXP A;  3VVZ A;  3NRG A;  2X6O A;  2O7T A;  3QKX A;  1VI0 A;  5F08 A;  3VW1 A;  3LSJ A;  3KNW A;  3BTL A;  5IOY A;  3ANP A;  5K7H A;  2G7L A;  2RAE A;  2UXI A;  3F1B A;  3AQS A;  3KKC A;  3BQY A;  2FQ4 A;  4XK4 A;  2Q24 A;  3C07 A;  3G1O A;  3QQA A;  5H9T A;  3VOK A;  5CXG A;  2QWT A;  3ZQG A;  3O60 A;  2JJ7 A;  5F04 A;  5K7F A;  2GFN A;  1U9O A;  3WHC A;  1UI5 A;  3NPI A;  3LOC A;  5FKO A;  3ZQL A;  1JTX A;  1A6I A;  2FD5 A;  5CXI A;  4D7N A;  3RH2 A;  4NEL A;  2PZ9 A;  3SFI A;  3VVY A;  4KWA A;  1JUM A;  3S5R A;  4D5F A;  3BCG A;  3TP3 A;  2G3B A;  2OI8 A;  5HSZ A;  2RAS A;  3FK7 A;  4GFL A;  4ACI A;  4I76 A;  2VKE A;  5F0F A;  2XDN A;  5GP9 A;  3DPJ A;  1SGM A;  4AF5 A;  2G0E A;  2ZOY A;  3B81 A;  3BTI A;  2F07 A;  2FBQ A;  3G1L A;  2TRT A;  2I10 A;  3IH3 A;  4X1E A;  1Z0X A;  4B1R A;  2NS8 A;  2VKV A;  3VOX A;  3EGQ A;  3KKD A;  3VW2 A;  3TP0 A;  4W97 A;  3FIW A;  3G7R A;  4YZE A;  2PBX A;  2ZB9 A;  3O8G A;  3PAS A;  3PPB A;  4V2F A;  2XPV A;  1JUS A;  3ON4 A;  3NNR A;  2EH3 A;  2HYJ A;  2UXH A;  3COL A;  2UXO A;  3BHQ A;  3BTJ A;  3MVP A;  3O8H A;  3B6A A;  4GCL A;  3LJL A;  3DEW A;  2OF7 A;  5FMP A;  5FGL A;  3EUP A;  4ME9 A;  5F0C A;  2NP3 A;  2XGE A;  2ZCN A;  3VUQ A;  4M3E A;  2NS7 A;  1JT0 A;  2NP5 A;  3VVX A;  3CDL A;  2G7S A;  3DCF A;  4M3G A;  3ZQF A;  5D19 A;  4DW6 A;  5F27 A;  3PM1 A;  2Y30 A;  5D1R A;  2ID6 A;  1JT6 A;  3CRJ A;  4B3A A;  5F0H A;  3LHQ A;  3QPS A;  3BR0 A;  3FRQ A;  2XB5 A;  5J1U A;  2REK A;  2XPW A;  5IP6 A;  4ICH A;  5GPA A;  3F0C A;  3RD3 A;  5FKL A;  2Y2Z A;  3ZQH A;  5HAW A;  2YVH A;  2HYT A;  2DG7 A;  2XGD A;  2OER A;  2ZOZ A;  5FHP A;  4CGR A;  3NI7 A;  2WUI A;  1UI6 A;  4ABZ A;  5FKM A;  2IAI A;  3BRU A;  5EYR A;  5J3L A;  1T33 A;  3ANG A;  1JUP A;  1Z77 A;  4UDS A;  2GBY A;  4MXM A;  1JTY A;  2QKO A;  3Q0U A;  2G7G A;  1ORK A;  4GFK A;  2XPU A;  3VIB A;  5K7Z A;  4M3B A;  1RPW A;  4GCK A;  1T56 A;  2GEN A;  3G1M A;  5CW8 A;  2QIB A;  2DTZ A;  3BJB A;  3LSR A;  2W53 A;  1U9N A;  2XGC A;  3C2B A;  3ON2 A;  3SDG A;  3HTJ A;  2V57 A;  2Y31 A;  5FKN A;  5AQC A;  2XRL A;  4MO7 A;  3IH4 A;  3BR6 A;  2QCO A;  3HTA A;  3QPL A;  1RKT A;  3HTH A;  5J1Y A;  3VW0 A;  2WGB A;  3BR5 A;  3HTI A;  4AUX A;  4I6Z A;  4D7M A;  3Q0W A;  3NXC A;  4V2G A;  4M3D A;  2UXU A;  2ZCX A;  3CWR A;  2OPT A;  2HQ5 A;  3T6N A;  2FX0 A;  3B6C A;  4NN1 A;  4G12 A;  3IH2 A;  2TCT A;  4PXI A;  5F1J A;  3P9T A;  2X9D A;  3HIM A;  2D6Y A;  4JL3 A;  3LSP A;  1QPI A;  2HXI A;  4JYK A;  4GCT A;  1QVU A;  4MK6 A;  5EZH A;  2IEK A;  3AQT A;  4HKU A;  3BTC A;  5IPA A;  3QBM A;  5IOZ A;  3KZ9 A;  3CJD A;  2JK3 A;  3BR1 A;  3G56 A;  2HXO A;  5J1R A;  3FK6 A;  3ZQI A;  2IU5 A;  2YVE A;  3GEU A;  3HGY A;  2GUH A;  3MNL A;  5EFY A;  5EZG A;  2ID3 A;  3VP5 A;  3WHB A;  4D5C A;  5FKK A;  4JKZ A;  5HBU A;  2ZCM A;  2DG8 A;  2HKU A;  3Q3S A;  1ZK8 A;  5GPC A;  3IUV A;  3VPR A;  3BQZ A;  2IBD A;  3Q0V A;  5K58 A;  4W1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...