3NXCA

Molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
177
Chain Sequence
RNRREEILQSLALMLESITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHARLQGRINQLFERIEAQLRQVLREKRMREGGYATDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type protein slmA
publication title Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 63
structure length 177
sequence length 190
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nxcA00
1RPWA 3CCYA 2VKEA 2XGDA 4D7MA 4B1RA 1VI0A 2ID3A 5FKOA 3Q0VA 2NP3A 5F0CA 2XGEA 3F0CA 5EZGA 3VW0A 5F0FA 3HE0A 3O8GA 3BTLA 5D1RA 4V2FA 3WHCA 4KWAA 3LWJA 3IH4A 1JUSA 2RHAA 2OERA 1JUPA 3BRUA 2HQ5A 3G56A 4V2GA 2XDNA 5FHPA 3PASA 3FRQA 2NX4A 4M3GA 3V6GA 2JJ7A 1JT0A 3P9TA 3TP3A 3VVXA 3ON2A 3QQAA 2FQ4A 2GUHA 3VW2A 1U9OA 3B6CA 4MK6A 3HGYA 3VP5A 3LSPA 3BR0A 3LSRA 4UDSA 2G0EA 3NNRA 3NPIA 2ID6A 2DTZA 3IH3A 3O8HA 2DG8A 3GZIA 3T6NA 2NP5A 3ZQGA 2TCTA 3BR3A 3C07A 3G1OA 3Q0WA 1A6IA 2VKVA 2X6OA 3F1BA 3BR5A 2D6YA 2QOPA 3PM1A 4JYKA 2PBXA 3VOKA 1Z0XA 2RAEA 2JK3A 2HXOA 5CXGA 2XB5A 3FIWA 2UXIA 3ZQFA 5IPAA 1JUMA 3LOCA 2G7SA 2Y31A 4W1UA 3BHQA 2F07A 3BT9A 3ANGA 3IH2A 1QVUA 2NS7A 4M3BA 1SGMA 5AQCA 3BTIA 3VVYA 3RD3A 2OPTA 1RKTA 2ZCMA 3C2BA 3TP0A 3HTIA 3HTJA 4HKUA 2QWTA 5GP9A 5DAJA 3G1LA 2QKOA 5J1UA 5EYRA 5J1RA 3BQYA 5K58A 5K7FA 1QVTA 5H9TA 3CDLA 3PPBA 2FX0A 1RKWA 2OF7A 3G1MA 4JNNA 3DCFA 2O7OA 3NRGA 2G3BA 5HAWA 2W53A 2UXOA 3ZQHA 2TRTA 3LHQA 3NXCA 4D5CA 3BCGA 1Z77A 2XRLA 4MO7A 2ZB9A 3VOXA 3FK7A 3HGGA 5FMPA 2FD5A 1JT6A 2QIBA 4NELA 2I10A 5HSZA 1ZK8A 4I6ZA 3MNLA 3VUQA 2FJ1A 5F27A 3Q0UA 4GCLA 4W97A 3S5RA 2XPVA 5J3LA 2XPWA 2UXUA 4AF5A 2REKA 2YVHA 4GFLA 3MVPA 3QPSA 3BJBA 3FK6A 2PZ9A 2ZCNA 3BQZA 3DPJA 3VPRA 4L62A 5HBUA 2OI8A 3BTJA 2FBQA 3QKXA 3RH2A 4G12A 5D19A 2EH3A 3SDGA 3QPLA 3BR2A 3HTHA 5J1YA 2IU5A 3HTAA 3ANPA 3B6AA 2HYTA 1UI6A 4I76A 4D5FA 3Q3SA 3BNIA 2RASA 3QBMA 4AUXA 4MXMA 3BTCA 2X9DA 5FKNA 4B3AA 5CXIA 2ZOZA 4GCKA 5C4YA 5F08A 4ICHA 4AC0A 3COLA 2NS8A 5CW8A 3BR6A 2XPUA 3JSJA 2HKUA 3IUVA 2WGBA 5D18A 5K7ZA 1QPIA 4GCTA 4YZEA 4ACIA 3VIBA 2Y2ZA 1ORKA 4AC6A 2GENA 5F04A 3E7QA 4GFKA 2HXIA 2Q24A 3HIMA 5K7HA 4JKZA 3GEUA 2WUIA 1U9NA 3ON4A 3NI7A 3WHBA 2UXPA 4M3EA 2IBDA 3VW1A 2QTQA 3AQTA 3BR1A 3VVZA 5GPAA 4PXIA 1T33A 5FKLA 2Y30A 5FGLA 5IP6A 2ZOYA 2XGCA 3DEWA 5GPCA 4NN1A 2V57A 3ZQLA 4JL3A 2IEKA 3CWRA 3KZ9A 1BJZA 3ZQIA 5IOYA 1ZKGA 4CGRA 3EGQA 3AQSA 2G7GA 3LJLA 2DG7A 4D7NA 3CJDA 5FKMA 4M3FA 1T56A 3V78A 2GFNA 4ME9A 3KNWA 2ZCXA 3SFIA 2G7LA 2QCOA 2IAIA 2O7TA 3KKDA 3LSJA 1JTXA 2GBYA 3O60A 1JTYA 2HYJA 3B81A 4XK4A 1UI5A 4M3DA 3CRJA 2UXHA 3KKCA 4ABZA 2YVEA 5EZHA 3G7RA 3EUPA 4DW6A 4X1EA 5EFYA 5F1JA 5F0HA 5FKKA 5IOZA 2VPRA 2WV1A
chains in the Genus database with same CATH superfamily
1RPWA 3CCYA 2VKEA 2XGDA 4D7MA 4B1RA 1VI0A 2ID3A 5FKOA 3Q0VA 2NP3A 5F0CA 2XGEA 3F0CA 5EZGA 3VW0A 5F0FA 2ZY9A 2R7XA 3HE0A 3O8GA 3BTLA 5D1RA 4V2FA 3WHCA 4KWAA 3LWJA 3IH4A 1JUSA 2RHAA 2OERA 1JUPA 3BRUA 4IRVA 2HQ5A 3G56A 4V2GA 2XDNA 5FHPA 3PASA 3FRQA 2NX4A 4M3GA 5CQGA 3DU6A 3V6GA 2JJ7A 1JT0A 3P9TA 3TP3A 3VVXA 3ON2A 4WIBA 3QQAA 2R7QA 2FQ4A 2GUHA 3VW2A 1U9OA 3B6CA 4MK6A 3FHNA 3DU5A 3HGYA 3VP5A 3LSPA 3BR0A 3LSRA 4UDSA 2G0EA 3NNRA 3NPIA 2ID6A 2DTZA 3IH3A 3O8HA 2DG8A 3GZIA 3T6NA 2NP5A 3ZQGA 2TCTA 3BR3A 3C07A 3G1OA 3Q0WA 1A6IA 2VKVA 2X6OA 3F1BA 3BR5A 2D6YA 2QOPA 3PM1A 4JYKA 2PBXA 2R7TA 3VOKA 1Z0XA 2RAEA 2JK3A 2A2FX 2HXOA 5CXGA 2XB5A 3FIWA 2UXIA 3ZQFA 5IPAA 1JUMA 3LOCA 2YVXA 2G7SA 2Y31A 4W1UA 3BHQA 2F07A 3BT9A 3ANGA 3IH2A 1QVUA 2NS7A 3SWHA 4M3BA 1SGMA 5AQCA 3BTIA 3VVYA 3RD3A 2OPTA 1RKTA 2ZCMA 3C2BA 3TP0A 3HTIA 3HTJA 4HKUA 2QWTA 5GP9A 5DAJA 3G1LA 2QKOA 5J1UA 5EYRA 5J1RA 3BQYA 5K58A 5K7FA 1QVTA 5H9TA 3CDLA 3PPBA 2FX0A 1RKWA 2OF7A 3G1MA 4JNNA 3DCFA 2O7OA 3NRGA 2G3BA 5HAWA 2W53A 2UXOA 3ZQHA 2TRTA 3LHQA 3NXCA 4D5CA 3BCGA 1Z77A 2XRLA 4MO7A 2ZB9A 3VOXA 3FK7A 3HGGA 4OD5A 2FJI1 5FMPA 2FD5A 2B1EA 1JT6A 2QIBA 4NELA 2I10A 5HSZA 1ZK8A 4DVYP 4I6ZA 3MNLA 3VUQA 2FJ1A 5F27A 3Q0UA 3K8PC 4GCLA 4W97A 3S5RA 2R7UA 2XPVA 5J3LA 2XPWA 2UXUA 4AF5A 2REKA 2YVHA 4GFLA 3MVPA 3QPSA 3BJBA 3FK6A 3VTIA 2PZ9A 2ZCNA 3BQZA 3DPJA 3VPRA 4L62A 5HBUA 2OI8A 3BTJA 2FBQA 3QKXA 3RH2A 4U9NA 4G12A 5D19A 2EH3A 3SDGA 3QPLA 3BR2A 3HTHA 5J1YA 2IU5A 3HTAA 3ANPA 3B6AA 2HYTA 2B3WA 1UI6A 4I76A 4D5FA 3Q3SA 3BNIA 2RASA 3QBMA 4AUXA 4MXMA 3BTCA 2X9DA 5FKNA 4B3AA 5CXIA 2ZOZA 4GCKA 5C4YA 5F08A 4ICHA 4AC0A 3COLA 5CW8A 2NS8A 3BR6A 2XPUA 3JSJA 2HKUA 3IUVA 2WGBA 3NS4A 5D18A 5K7ZA 1QPIA 4GCTA 4YZEA 4ACIA 3VIBA 2Y2ZA 1ORKA 4AC6A 2GENA 5F04A 3E7QA 3KYLA 4GFKA 2R7WA 2HXIA 2Q24A 3HIMA 5K7HA 4JKZA 3GEUA 2WUIA 1U9NA 3ON4A 3NI7A 4C2MA 3WHBA 2UXPA 4M3EA 2IBDA 3VW1A 2QTQA 3AQTA 3BR1A 3VVZA 5GPAA 4PXIA 1T33A 5FKLA 2Y30A 5FGLA 5IP6A 2ZOYA 2XGCA 3DEWA 5GPCA 4NN1A 2V57A 3ZQLA 4JL3A 2IEKA 3CWRA 3KZ9A 1BJZA 3ZQIA 5IOYA 1ZKGA 4CGRA 3EGQA 2R7RA 3AQSA 2G7GA 3LJLA 2DG7A 4D7NA 3CJDA 2R7SA 5FKMA 4M3FA 1T56A 3V78A 2GFNA 2R7OA 4ME9A 3KNWA 2ZCXA 3SFIA 2G7LA 2QCOA 2IAIA 2O7TA 2R7VA 3KKDA 3LSJA 1JTXA 2GBYA 3O60A 1JTYA 2HYJA 3B81A 4XK4A 1UI5A 4M3DA 3CRJA 2UXHA 3KKCA 4ABZA 2YVEA 5EZHA 3G7RA 3EUPA 4DW6A 4X1EA 5EFYA 4U9LA 5F1JA 4OD4A 2PFVA 5F0HA 5FKKA 5IOZA 2VPRA 2WV1A
chains in the Genus database with same CATH topology
1RPWA 3CCYA 2VKEA 2XGDA 4D7MA 4B1RA 1VI0A 2ID3A 5FKOA 3Q0VA 2NP3A 5F0CA 2XGEA 3F0CA 5EZGA 3VW0A 5F0FA 3HE0A 3O8GA 3BTLA 5D1RA 4V2FA 3WHCA 4KWAA 3LWJA 3IH4A 1JUSA 2RHAA 2OERA 1JUPA 3BRUA 2HQ5A 3G56A 4V2GA 2XDNA 5FHPA 3PASA 3FRQA 2NX4A 4M3GA 3V6GA 2JJ7A 1JT0A 3P9TA 3TP3A 3VVXA 3ON2A 3QQAA 2FQ4A 2GUHA 3VW2A 1U9OA 3B6CA 4MK6A 3HGYA 3VP5A 3LSPA 3BR0A 3LSRA 4UDSA 2G0EA 3NNRA 3NPIA 2ID6A 2DTZA 3IH3A 3O8HA 2DG8A 3GZIA 3T6NA 2NP5A 3ZQGA 2TCTA 3BR3A 3C07A 3G1OA 3Q0WA 1A6IA 2VKVA 2X6OA 3F1BA 3BR5A 2D6YA 2QOPA 3PM1A 4JYKA 2PBXA 3VOKA 1Z0XA 2RAEA 2JK3A 2HXOA 5CXGA 2XB5A 3FIWA 2UXIA 3ZQFA 5IPAA 1JUMA 3LOCA 2G7SA 2Y31A 4W1UA 3BHQA 2F07A 3BT9A 3ANGA 3IH2A 1QVUA 2NS7A 4M3BA 1SGMA 5AQCA 3BTIA 3VVYA 3RD3A 2OPTA 1RKTA 2ZCMA 3C2BA 3TP0A 3HTIA 3HTJA 4HKUA 2QWTA 5GP9A 5DAJA 3G1LA 2QKOA 5J1UA 5EYRA 5J1RA 3BQYA 5K58A 5K7FA 1QVTA 5H9TA 3CDLA 3PPBA 2FX0A 1RKWA 2OF7A 3G1MA 4JNNA 3DCFA 2O7OA 3NRGA 2G3BA 5HAWA 2W53A 2UXOA 3ZQHA 2TRTA 3LHQA 3NXCA 4D5CA 3BCGA 1Z77A 2XRLA 4MO7A 2ZB9A 3VOXA 3FK7A 3HGGA 5FMPA 2FD5A 1JT6A 2QIBA 4NELA 2I10A 5HSZA 1ZK8A 4I6ZA 3MNLA 3VUQA 2FJ1A 5F27A 3Q0UA 4GCLA 4W97A 3S5RA 2XPVA 5J3LA 2XPWA 2UXUA 4AF5A 2REKA 2YVHA 4GFLA 3MVPA 3QPSA 3BJBA 3FK6A 2PZ9A 2ZCNA 3BQZA 3DPJA 3VPRA 4L62A 5HBUA 2OI8A 3BTJA 2FBQA 3QKXA 3RH2A 4G12A 5D19A 2EH3A 3SDGA 3QPLA 3BR2A 3HTHA 5J1YA 2IU5A 3HTAA 3ANPA 3B6AA 2HYTA 1UI6A 4I76A 4D5FA 3Q3SA 3BNIA 2RASA 3QBMA 4AUXA 4MXMA 3BTCA 2X9DA 5FKNA 4B3AA 5CXIA 2ZOZA 4GCKA 5C4YA 5F08A 4ICHA 4AC0A 3COLA 2NS8A 5CW8A 3BR6A 2XPUA 3JSJA 2HKUA 3IUVA 2WGBA 5D18A 5K7ZA 1QPIA 4GCTA 4YZEA 4ACIA 3VIBA 2Y2ZA 1ORKA 4AC6A 2GENA 5F04A 3E7QA 4GFKA 2HXIA 2Q24A 3HIMA 5K7HA 4JKZA 3GEUA 2WUIA 1U9NA 3ON4A 3NI7A 3WHBA 2UXPA 4M3EA 2IBDA 3VW1A 2QTQA 3AQTA 3BR1A 3VVZA 5GPAA 4PXIA 1T33A 5FKLA 2Y30A 5FGLA 5IP6A 2ZOYA 2XGCA 3DEWA 5GPCA 4NN1A 2V57A 3ZQLA 4JL3A 2IEKA 3CWRA 3KZ9A 1BJZA 3ZQIA 5IOYA 1ZKGA 4CGRA 3EGQA 3AQSA 2G7GA 3LJLA 2DG7A 4D7NA 3CJDA 5FKMA 4M3FA 1T56A 3V78A 2GFNA 4ME9A 3KNWA 2ZCXA 3SFIA 2G7LA 2QCOA 2IAIA 2O7TA 3KKDA 3LSJA 1JTXA 2GBYA 3O60A 1JTYA 2HYJA 3B81A 4XK4A 1UI5A 4M3DA 3CRJA 2UXHA 3KKCA 4ABZA 2YVEA 5EZHA 3G7RA 3EUPA 4DW6A 4X1EA 5EFYA 5F1JA 5F0HA 5FKKA 5IOZA 2VPRA 2WV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPW A;  3CCY A;  2VKE A;  2XGD A;  4D7M A;  4B1R A;  1VI0 A;  2ID3 A;  5FKO A;  3Q0V A;  2NP3 A;  5F0C A;  2XGE A;  3F0C A;  5EZG A;  3VW0 A;  5F0F A;  3HE0 A;  3O8G A;  3BTL A;  5D1R A;  4V2F A;  3WHC A;  4KWA A;  3LWJ A;  3IH4 A;  1JUS A;  2RHA A;  2OER A;  1JUP A;  3BRU A;  2HQ5 A;  3G56 A;  4V2G A;  2XDN A;  5FHP A;  3PAS A;  3FRQ A;  2NX4 A;  4M3G A;  3V6G A;  2JJ7 A;  1JT0 A;  3P9T A;  3TP3 A;  3VVX A;  3ON2 A;  3QQA A;  2FQ4 A;  2GUH A;  3VW2 A;  1U9O A;  3B6C A;  4MK6 A;  3HGY A;  3VP5 A;  3LSP A;  3BR0 A;  3LSR A;  4UDS A;  2G0E A;  3NNR A;  3NPI A;  2ID6 A;  2DTZ A;  3IH3 A;  3O8H A;  2DG8 A;  3GZI A;  3T6N A;  2NP5 A;  3ZQG A;  2TCT A;  3BR3 A;  3C07 A;  3G1O A;  3Q0W A;  1A6I A;  2VKV A;  2X6O A;  3F1B A;  3BR5 A;  2D6Y A;  2QOP A;  3PM1 A;  4JYK A;  2PBX A;  3VOK A;  1Z0X A;  2RAE A;  2JK3 A;  2HXO A;  5CXG A;  2XB5 A;  3FIW A;  2UXI A;  3ZQF A;  5IPA A;  1JUM A;  3LOC A;  2G7S A;  2Y31 A;  4W1U A;  3BHQ A;  2F07 A;  3BT9 A;  3ANG A;  3IH2 A;  1QVU A;  2NS7 A;  4M3B A;  1SGM A;  5AQC A;  3BTI A;  3VVY A;  3RD3 A;  2OPT A;  1RKT A;  2ZCM A;  3C2B A;  3TP0 A;  3HTI A;  3HTJ A;  4HKU A;  2QWT A;  5GP9 A;  5DAJ A;  3G1L A;  2QKO A;  5J1U A;  5EYR A;  5J1R A;  3BQY A;  5K58 A;  5K7F A;  1QVT A;  5H9T A;  3CDL A;  3PPB A;  2FX0 A;  1RKW A;  2OF7 A;  3G1M A;  4JNN A;  3DCF A;  2O7O A;  3NRG A;  2G3B A;  5HAW A;  2W53 A;  2UXO A;  3ZQH A;  2TRT A;  3LHQ A;  3NXC A;  4D5C A;  3BCG A;  1Z77 A;  2XRL A;  4MO7 A;  2ZB9 A;  3VOX A;  3FK7 A;  3HGG A;  5FMP A;  2FD5 A;  1JT6 A;  2QIB A;  4NEL A;  2I10 A;  5HSZ A;  1ZK8 A;  4I6Z A;  3MNL A;  3VUQ A;  2FJ1 A;  5F27 A;  3Q0U A;  4GCL A;  4W97 A;  3S5R A;  2XPV A;  5J3L A;  2XPW A;  2UXU A;  4AF5 A;  2REK A;  2YVH A;  4GFL A;  3MVP A;  3QPS A;  3BJB A;  3FK6 A;  2PZ9 A;  2ZCN A;  3BQZ A;  3DPJ A;  3VPR A;  4L62 A;  5HBU A;  2OI8 A;  3BTJ A;  2FBQ A;  3QKX A;  3RH2 A;  4G12 A;  5D19 A;  2EH3 A;  3SDG A;  3QPL A;  3BR2 A;  3HTH A;  5J1Y A;  2IU5 A;  3HTA A;  3ANP A;  3B6A A;  2HYT A;  1UI6 A;  4I76 A;  4D5F A;  3Q3S A;  3BNI A;  2RAS A;  3QBM A;  4AUX A;  4MXM A;  3BTC A;  2X9D A;  5FKN A;  4B3A A;  5CXI A;  2ZOZ A;  4GCK A;  5C4Y A;  5F08 A;  4ICH A;  4AC0 A;  3COL A;  2NS8 A;  5CW8 A;  3BR6 A;  2XPU A;  3JSJ A;  2HKU A;  3IUV A;  2WGB A;  5D18 A;  5K7Z A;  1QPI A;  4GCT A;  4YZE A;  4ACI A;  3VIB A;  2Y2Z A;  1ORK A;  4AC6 A;  2GEN A;  5F04 A;  3E7Q A;  4GFK A;  2HXI A;  2Q24 A;  3HIM A;  5K7H A;  4JKZ A;  3GEU A;  2WUI A;  1U9N A;  3ON4 A;  3NI7 A;  3WHB A;  2UXP A;  4M3E A;  2IBD A;  3VW1 A;  2QTQ A;  3AQT A;  3BR1 A;  3VVZ A;  5GPA A;  4PXI A;  1T33 A;  5FKL A;  2Y30 A;  5FGL A;  5IP6 A;  2ZOY A;  2XGC A;  3DEW A;  5GPC A;  4NN1 A;  2V57 A;  3ZQL A;  4JL3 A;  2IEK A;  3CWR A;  3KZ9 A;  1BJZ A;  3ZQI A;  5IOY A;  1ZKG A;  4CGR A;  3EGQ A;  3AQS A;  2G7G A;  3LJL A;  2DG7 A;  4D7N A;  3CJD A;  5FKM A;  4M3F A;  1T56 A;  3V78 A;  2GFN A;  4ME9 A;  3KNW A;  2ZCX A;  3SFI A;  2G7L A;  2QCO A;  2IAI A;  2O7T A;  3KKD A;  3LSJ A;  1JTX A;  2GBY A;  3O60 A;  1JTY A;  2HYJ A;  3B81 A;  4XK4 A;  1UI5 A;  4M3D A;  3CRJ A;  2UXH A;  3KKC A;  4ABZ A;  2YVE A;  5EZH A;  3G7R A;  3EUP A;  4DW6 A;  4X1E A;  5EFY A;  5F1J A;  5F0H A;  5FKK A;  5IOZ A;  2VPR A;  2WV1 A; 
#chains in the Genus database with same CATH topology
 1RPW A;  3CCY A;  2VKE A;  2XGD A;  4D7M A;  4B1R A;  1VI0 A;  2ID3 A;  5FKO A;  3Q0V A;  2NP3 A;  5F0C A;  2XGE A;  3F0C A;  5EZG A;  3VW0 A;  5F0F A;  2ZY9 A;  2R7X A;  3HE0 A;  3O8G A;  3BTL A;  5D1R A;  4V2F A;  3WHC A;  4KWA A;  3LWJ A;  3IH4 A;  1JUS A;  2RHA A;  2OER A;  1JUP A;  3BRU A;  4IRV A;  2HQ5 A;  3G56 A;  4V2G A;  2XDN A;  5FHP A;  3PAS A;  3FRQ A;  2NX4 A;  4M3G A;  5CQG A;  3DU6 A;  3V6G A;  2JJ7 A;  1JT0 A;  3P9T A;  3TP3 A;  3VVX A;  3ON2 A;  4WIB A;  3QQA A;  2R7Q A;  2FQ4 A;  2GUH A;  3VW2 A;  1U9O A;  3B6C A;  4MK6 A;  3FHN A;  3DU5 A;  3HGY A;  3VP5 A;  3LSP A;  3BR0 A;  3LSR A;  4UDS A;  2G0E A;  3NNR A;  3NPI A;  2ID6 A;  2DTZ A;  3IH3 A;  3O8H A;  2DG8 A;  3GZI A;  3T6N A;  2NP5 A;  3ZQG A;  2TCT A;  3BR3 A;  3C07 A;  3G1O A;  3Q0W A;  1A6I A;  2VKV A;  2X6O A;  3F1B A;  3BR5 A;  2D6Y A;  2QOP A;  3PM1 A;  4JYK A;  2PBX A;  2R7T A;  3VOK A;  1Z0X A;  2RAE A;  2JK3 A;  2A2F X;  2HXO A;  5CXG A;  2XB5 A;  3FIW A;  2UXI A;  3ZQF A;  5IPA A;  1JUM A;  3LOC A;  2YVX A;  2G7S A;  2Y31 A;  4W1U A;  3BHQ A;  2F07 A;  3BT9 A;  3ANG A;  3IH2 A;  1QVU A;  2NS7 A;  3SWH A;  4M3B A;  1SGM A;  5AQC A;  3BTI A;  3VVY A;  3RD3 A;  2OPT A;  1RKT A;  2ZCM A;  3C2B A;  3TP0 A;  3HTI A;  3HTJ A;  4HKU A;  2QWT A;  5GP9 A;  5DAJ A;  3G1L A;  2QKO A;  5J1U A;  5EYR A;  5J1R A;  3BQY A;  5K58 A;  5K7F A;  1QVT A;  5H9T A;  3CDL A;  3PPB A;  2FX0 A;  1RKW A;  2OF7 A;  3G1M A;  4JNN A;  3DCF A;  2O7O A;  3NRG A;  2G3B A;  5HAW A;  2W53 A;  2UXO A;  3ZQH A;  2TRT A;  3LHQ A;  3NXC A;  4D5C A;  3BCG A;  1Z77 A;  2XRL A;  4MO7 A;  2ZB9 A;  3VOX A;  3FK7 A;  3HGG A;  4OD5 A;  2FJI 1;  5FMP A;  2FD5 A;  2B1E A;  1JT6 A;  2QIB A;  4NEL A;  2I10 A;  5HSZ A;  1ZK8 A;  4DVY P;  4I6Z A;  3MNL A;  3VUQ A;  2FJ1 A;  5F27 A;  3Q0U A;  3K8P C;  4GCL A;  4W97 A;  3S5R A;  2R7U A;  2XPV A;  5J3L A;  2XPW A;  2UXU A;  4AF5 A;  2REK A;  2YVH A;  4GFL A;  3MVP A;  3QPS A;  3BJB A;  3FK6 A;  3VTI A;  2PZ9 A;  2ZCN A;  3BQZ A;  3DPJ A;  3VPR A;  4L62 A;  5HBU A;  2OI8 A;  3BTJ A;  2FBQ A;  3QKX A;  3RH2 A;  4U9N A;  4G12 A;  5D19 A;  2EH3 A;  3SDG A;  3QPL A;  3BR2 A;  3HTH A;  5J1Y A;  2IU5 A;  3HTA A;  3ANP A;  3B6A A;  2HYT A;  2B3W A;  1UI6 A;  4I76 A;  4D5F A;  3Q3S A;  3BNI A;  2RAS A;  3QBM A;  4AUX A;  4MXM A;  3BTC A;  2X9D A;  5FKN A;  4B3A A;  5CXI A;  2ZOZ A;  4GCK A;  5C4Y A;  5F08 A;  4ICH A;  4AC0 A;  3COL A;  5CW8 A;  2NS8 A;  3BR6 A;  2XPU A;  3JSJ A;  2HKU A;  3IUV A;  2WGB A;  3NS4 A;  5D18 A;  5K7Z A;  1QPI A;  4GCT A;  4YZE A;  4ACI A;  3VIB A;  2Y2Z A;  1ORK A;  4AC6 A;  2GEN A;  5F04 A;  3E7Q A;  3KYL A;  4GFK A;  2R7W A;  2HXI A;  2Q24 A;  3HIM A;  5K7H A;  4JKZ A;  3GEU A;  2WUI A;  1U9N A;  3ON4 A;  3NI7 A;  4C2M A;  3WHB A;  2UXP A;  4M3E A;  2IBD A;  3VW1 A;  2QTQ A;  3AQT A;  3BR1 A;  3VVZ A;  5GPA A;  4PXI A;  1T33 A;  5FKL A;  2Y30 A;  5FGL A;  5IP6 A;  2ZOY A;  2XGC A;  3DEW A;  5GPC A;  4NN1 A;  2V57 A;  3ZQL A;  4JL3 A;  2IEK A;  3CWR A;  3KZ9 A;  1BJZ A;  3ZQI A;  5IOY A;  1ZKG A;  4CGR A;  3EGQ A;  2R7R A;  3AQS A;  2G7G A;  3LJL A;  2DG7 A;  4D7N A;  3CJD A;  2R7S A;  5FKM A;  4M3F A;  1T56 A;  3V78 A;  2GFN A;  2R7O A;  4ME9 A;  3KNW A;  2ZCX A;  3SFI A;  2G7L A;  2QCO A;  2IAI A;  2O7T A;  2R7V A;  3KKD A;  3LSJ A;  1JTX A;  2GBY A;  3O60 A;  1JTY A;  2HYJ A;  3B81 A;  4XK4 A;  1UI5 A;  4M3D A;  3CRJ A;  2UXH A;  3KKC A;  4ABZ A;  2YVE A;  5EZH A;  3G7R A;  3EUP A;  4DW6 A;  4X1E A;  5EFY A;  4U9L A;  5F1J A;  4OD4 A;  2PFV A;  5F0H A;  5FKK A;  5IOZ A;  2VPR A;  2WV1 A; 
#chains in the Genus database with same CATH homology
 1RPW A;  3CCY A;  2VKE A;  2XGD A;  4D7M A;  4B1R A;  1VI0 A;  2ID3 A;  5FKO A;  3Q0V A;  2NP3 A;  5F0C A;  2XGE A;  3F0C A;  5EZG A;  3VW0 A;  5F0F A;  3HE0 A;  3O8G A;  3BTL A;  5D1R A;  4V2F A;  3WHC A;  4KWA A;  3LWJ A;  3IH4 A;  1JUS A;  2RHA A;  2OER A;  1JUP A;  3BRU A;  2HQ5 A;  3G56 A;  4V2G A;  2XDN A;  5FHP A;  3PAS A;  3FRQ A;  2NX4 A;  4M3G A;  3V6G A;  2JJ7 A;  1JT0 A;  3P9T A;  3TP3 A;  3VVX A;  3ON2 A;  3QQA A;  2FQ4 A;  2GUH A;  3VW2 A;  1U9O A;  3B6C A;  4MK6 A;  3HGY A;  3VP5 A;  3LSP A;  3BR0 A;  3LSR A;  4UDS A;  2G0E A;  3NNR A;  3NPI A;  2ID6 A;  2DTZ A;  3IH3 A;  3O8H A;  2DG8 A;  3GZI A;  3T6N A;  2NP5 A;  3ZQG A;  2TCT A;  3BR3 A;  3C07 A;  3G1O A;  3Q0W A;  1A6I A;  2VKV A;  2X6O A;  3F1B A;  3BR5 A;  2D6Y A;  2QOP A;  3PM1 A;  4JYK A;  2PBX A;  3VOK A;  1Z0X A;  2RAE A;  2JK3 A;  2HXO A;  5CXG A;  2XB5 A;  3FIW A;  2UXI A;  3ZQF A;  5IPA A;  1JUM A;  3LOC A;  2G7S A;  2Y31 A;  4W1U A;  3BHQ A;  2F07 A;  3BT9 A;  3ANG A;  3IH2 A;  1QVU A;  2NS7 A;  4M3B A;  1SGM A;  5AQC A;  3BTI A;  3VVY A;  3RD3 A;  2OPT A;  1RKT A;  2ZCM A;  3C2B A;  3TP0 A;  3HTI A;  3HTJ A;  4HKU A;  2QWT A;  5GP9 A;  5DAJ A;  3G1L A;  2QKO A;  5J1U A;  5EYR A;  5J1R A;  3BQY A;  5K58 A;  5K7F A;  1QVT A;  5H9T A;  3CDL A;  3PPB A;  2FX0 A;  1RKW A;  2OF7 A;  3G1M A;  4JNN A;  3DCF A;  2O7O A;  3NRG A;  2G3B A;  5HAW A;  2W53 A;  2UXO A;  3ZQH A;  2TRT A;  3LHQ A;  3NXC A;  4D5C A;  3BCG A;  1Z77 A;  2XRL A;  4MO7 A;  2ZB9 A;  3VOX A;  3FK7 A;  3HGG A;  5FMP A;  2FD5 A;  1JT6 A;  2QIB A;  4NEL A;  2I10 A;  5HSZ A;  1ZK8 A;  4I6Z A;  3MNL A;  3VUQ A;  2FJ1 A;  5F27 A;  3Q0U A;  4GCL A;  4W97 A;  3S5R A;  2XPV A;  5J3L A;  2XPW A;  2UXU A;  4AF5 A;  2REK A;  2YVH A;  4GFL A;  3MVP A;  3QPS A;  3BJB A;  3FK6 A;  2PZ9 A;  2ZCN A;  3BQZ A;  3DPJ A;  3VPR A;  4L62 A;  5HBU A;  2OI8 A;  3BTJ A;  2FBQ A;  3QKX A;  3RH2 A;  4G12 A;  5D19 A;  2EH3 A;  3SDG A;  3QPL A;  3BR2 A;  3HTH A;  5J1Y A;  2IU5 A;  3HTA A;  3ANP A;  3B6A A;  2HYT A;  1UI6 A;  4I76 A;  4D5F A;  3Q3S A;  3BNI A;  2RAS A;  3QBM A;  4AUX A;  4MXM A;  3BTC A;  2X9D A;  5FKN A;  4B3A A;  5CXI A;  2ZOZ A;  4GCK A;  5C4Y A;  5F08 A;  4ICH A;  4AC0 A;  3COL A;  2NS8 A;  5CW8 A;  3BR6 A;  2XPU A;  3JSJ A;  2HKU A;  3IUV A;  2WGB A;  5D18 A;  5K7Z A;  1QPI A;  4GCT A;  4YZE A;  4ACI A;  3VIB A;  2Y2Z A;  1ORK A;  4AC6 A;  2GEN A;  5F04 A;  3E7Q A;  4GFK A;  2HXI A;  2Q24 A;  3HIM A;  5K7H A;  4JKZ A;  3GEU A;  2WUI A;  1U9N A;  3ON4 A;  3NI7 A;  3WHB A;  2UXP A;  4M3E A;  2IBD A;  3VW1 A;  2QTQ A;  3AQT A;  3BR1 A;  3VVZ A;  5GPA A;  4PXI A;  1T33 A;  5FKL A;  2Y30 A;  5FGL A;  5IP6 A;  2ZOY A;  2XGC A;  3DEW A;  5GPC A;  4NN1 A;  2V57 A;  3ZQL A;  4JL3 A;  2IEK A;  3CWR A;  3KZ9 A;  1BJZ A;  3ZQI A;  5IOY A;  1ZKG A;  4CGR A;  3EGQ A;  3AQS A;  2G7G A;  3LJL A;  2DG7 A;  4D7N A;  3CJD A;  5FKM A;  4M3F A;  1T56 A;  3V78 A;  2GFN A;  4ME9 A;  3KNW A;  2ZCX A;  3SFI A;  2G7L A;  2QCO A;  2IAI A;  2O7T A;  3KKD A;  3LSJ A;  1JTX A;  2GBY A;  3O60 A;  1JTY A;  2HYJ A;  3B81 A;  4XK4 A;  1UI5 A;  4M3D A;  3CRJ A;  2UXH A;  3KKC A;  4ABZ A;  2YVE A;  5EZH A;  3G7R A;  3EUP A;  4DW6 A;  4X1E A;  5EFY A;  5F1J A;  5F0H A;  5FKK A;  5IOZ A;  2VPR A;  2WV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...