3NXCA

Molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
190
structure length
177
Chain Sequence
RNRREEILQSLALMLESITTAKLAASVGVSEAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLLLGFGERNPGLTRILTGHARLQGRINQLFERIEAQLRQVLREKRMREGGYATDETLLASQILAFCEGMLSRFVRSEFKYRPTDDFDARWPLIAAQLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism by which the nucleoid occlusion factor, SlmA, keeps cytokinesis in check.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords HTH-type protein slmA
total genus 63
structure length 177
sequence length 190
ec nomenclature
pdb deposition date 2010-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3nxcA00
2FJ1A 5GPCA 3F0CA 1RPWA 2EH3A 5D1RA 4AC6A 2HXIA 3VPRA 4ACIA 3LSRA 2W53A 3B6CA 3O8GA 3QBMA 4D5FA 5FGLA 5IP6A 2ID6A 2IEKA 2QOPA 2XPUA 2F07A 2Q24A 3IH2A 3BTCA 4X1EA 2DG8A 3FK7A 3BHQA 2DG7A 3IH4A 3DCFA 2WUIA 5IPAA 3VW1A 3BR0A 4V2GA 2OPTA 4D5CA 5H9TA 2D6YA 4JYKA 3EUPA 1T33A 2XPVA 2ZOYA 3KZ9A 3LSJA 5CXIA 2FQ4A 3QKXA 5EZHA 3WHBA 2X6OA 3LOCA 3BTLA 5J1UA 3B6AA 5F1JA 2NP3A 2UXUA 5F0FA 4JKZA 4M3GA 4MXMA 2UXHA 5EFYA 2FBQA 2ZOZA 2G7GA 2XGDA 2XGEA 2HKUA 5IOYA 5K7ZA 3BCGA 1Z0XA 2G0EA 5HAWA 2GFNA 3NXCA 5F04A 4JL3A 1QVTA 2RASA 2XDNA 2HXOA 2HYJA 3NPIA 3EGQA 4JNNA 3BQYA 1Z77A 3ZQGA 3BR3A 5EZGA 2IU5A 3LWJA 5K7FA 3VIBA 3JSJA 5FKLA 2JJ7A 1ORKA 3BNIA 1SGMA 2XPWA 2VKEA 3ZQFA 3BRUA 1JUSA 3BQZA 3V6GA 2OERA 2OF7A 5F0HA 3MNLA 4AUXA 5FKOA 5J3LA 5FKMA 2G3BA 4B1RA 5D19A 5FHPA 2Y2ZA 3VP5A 3LHQA 3PASA 1JUMA 5J1YA 2HQ5A 1VI0A 3FK6A 3PM1A 3VUQA 3TP3A 2NS7A 3ANPA 3HGYA 4GCKA 2TCTA 2QTQA 5K7HA 2GBYA 5F08A 3ZQIA 4V2FA 2WV1A 3ZQHA 1JTXA 5EYRA 4AF5A 4HKUA 5AQCA 4ME9A 2UXIA 3QPSA 3BT9A 1ZK8A 4I6ZA 3LJLA 3BR2A 3T6NA 2O7OA 5GPAA 3BR1A 2X9DA 4D7NA 3ON2A 3G1MA 3BJBA 2FD5A 2GUHA 4ABZA 2ZB9A 3VW0A 3ANGA 4NN1A 3Q0VA 3G56A 3V78A 3SFIA 1A6IA 3BR5A 5HSZA 2NS8A 3FIWA 4MO7A 3BR6A 3IUVA 2UXOA 3VW2A 2IAIA 4M3DA 2PBXA 4DW6A 3S5RA 4M3FA 4ICHA 5K58A 3Q3SA 3CRJA 4GFKA 3ON4A 1QPIA 3CDLA 3WHCA 3E7QA 2QWTA 3KKDA 3HTIA 2UXPA 3CJDA 3F1BA 3HTJA 2VPRA 1UI6A 2JK3A 2XRLA 2WGBA 4M3EA 5FKKA 3SDGA 3TP0A 4GCTA 3HTHA 1JT6A 3KNWA 4NELA 4GCLA 2HYTA 2YVEA 3QPLA 3VVYA 5FMPA 2RHAA 3CCYA 4W1UA 1RKTA 4M3BA 3Q0WA 2GENA 5C4YA 4W97A 3DPJA 4PXIA 3HGGA 3CWRA 3RD3A 1BJZA 2G7LA 3FRQA 3COLA 4XK4A 3G1LA 5D18A 4GFLA 2PZ9A 3C07A 2OI8A 1T56A 2RAEA 5F0CA 3NNRA 3VOKA 5J1RA 4L62A 2ZCMA 2VKVA 3AQTA 2FX0A 3RH2A 3IH3A 2O7TA 3AQSA 3HTAA 4UDSA 2QCOA 3GEUA 2I10A 2ZCXA 2ZCNA 3BTIA 5IOZA 1QVUA 5GP9A 2IBDA 3BTJA 3O60A 1U9NA 3C2BA 3Q0UA 5FKNA 5CXGA 1ZKGA 2TRTA 5HBUA 4I76A 4B3AA 3KKCA 1JUPA 2XGCA 4CGRA 3LSPA 3VVXA 3VVZA 4KWAA 3GZIA 3MVPA 4YZEA 3G1OA 3PPBA 3P9TA 2DTZA 4G12A 2YVHA 2Y31A 2Y30A 2NP5A 3NRGA 3B81A 1JTYA 1RKWA 2REKA 3QQAA 3HIMA 3G7RA 4AC0A 3HE0A 3NI7A 2NX4A 3O8HA 2G7SA 2QKOA 2QIBA 1JT0A 1UI5A 5DAJA 2XB5A 5F27A 3DEWA 2V57A 5CW8A 1U9OA 4D7MA 4MK6A 2ID3A 3ZQLA 3VOXA
chains in the Genus database with same CATH superfamily
2FJ1A 5GPCA 3F0CA 1RPWA 2EH3A 5D1RA 4AC6A 2HXIA 3VPRA 4ACIA 3LSRA 2W53A 3B6CA 3O8GA 3QBMA 4D5FA 5FGLA 5IP6A 2ID6A 2IEKA 2QOPA 2XPUA 2F07A 2Q24A 3IH2A 3BTCA 4X1EA 2DG8A 3FK7A 3BHQA 2DG7A 2R7VA 3IH4A 3DCFA 2WUIA 5IPAA 3VW1A 3BR0A 4V2GA 2OPTA 4D5CA 5H9TA 2D6YA 4JYKA 3EUPA 1T33A 2XPVA 2ZOYA 3KZ9A 3LSJA 5CXIA 2FQ4A 3QKXA 3K8PC 5EZHA 3WHBA 2X6OA 3LOCA 3BTLA 5J1UA 3B6AA 5F1JA 2NP3A 2UXUA 5F0FA 4JKZA 4M3GA 4MXMA 2UXHA 5EFYA 2FBQA 2ZOZA 4DVYP 2G7GA 2XGDA 2XGEA 2HKUA 2YVXA 5IOYA 5K7ZA 3DU5A 3BCGA 2R7XA 1Z0XA 2G0EA 4OD4A 5HAWA 2GFNA 3NXCA 5F04A 4JL3A 1QVTA 2RASA 2XDNA 2HXOA 2HYJA 3NPIA 3EGQA 4JNNA 3BQYA 4IRVA 1Z77A 3ZQGA 3BR3A 5EZGA 3FHNA 2IU5A 3LWJA 5K7FA 3VIBA 3JSJA 5FKLA 2JJ7A 1ORKA 3BNIA 1SGMA 2XPWA 2VKEA 3NS4A 3ZQFA 3BRUA 1JUSA 3BQZA 3V6GA 2ZY9A 2OERA 2OF7A 5F0HA 3MNLA 4AUXA 5FKOA 5J3LA 5FKMA 2G3BA 4B1RA 5D19A 5FHPA 2Y2ZA 3VP5A 3LHQA 3PASA 1JUMA 5J1YA 2HQ5A 1VI0A 3FK6A 3PM1A 3VUQA 3TP3A 2NS7A 3ANPA 3HGYA 4GCKA 2TCTA 2QTQA 5K7HA 2R7WA 2GBYA 5F08A 3ZQIA 4V2FA 2WV1A 3ZQHA 1JTXA 5EYRA 3KYLA 4AF5A 4HKUA 5CQGA 2A2FX 5AQCA 4ME9A 2UXIA 3QPSA 3VTIA 3BT9A 1ZK8A 4I6ZA 3LJLA 3BR2A 3T6NA 2O7OA 5GPAA 3BR1A 2X9DA 4D7NA 3ON2A 3G1MA 3BJBA 2FD5A 2GUHA 4ABZA 2ZB9A 3VW0A 3ANGA 4NN1A 3Q0VA 3G56A 3V78A 3SFIA 1A6IA 3BR5A 5HSZA 2R7QA 4C2MA 2NS8A 3FIWA 4MO7A 3BR6A 3IUVA 2UXOA 3VW2A 2IAIA 4M3DA 2PBXA 4DW6A 3S5RA 4M3FA 4ICHA 5K58A 3Q3SA 3CRJA 4GFKA 3ON4A 1QPIA 3CDLA 3WHCA 3E7QA 2QWTA 3KKDA 3HTIA 2UXPA 3CJDA 3F1BA 3HTJA 2VPRA 1UI6A 2JK3A 2XRLA 2B1EA 2WGBA 4M3EA 5FKKA 3SDGA 3TP0A 4GCTA 3HTHA 1JT6A 3KNWA 4NELA 4GCLA 2HYTA 2YVEA 3QPLA 3VVYA 5FMPA 2RHAA 3CCYA 4W1UA 2R7SA 1RKTA 4M3BA 3Q0WA 4U9NA 2GENA 5C4YA 4W97A 3DPJA 4PXIA 3HGGA 3CWRA 3RD3A 1BJZA 2G7LA 3FRQA 3COLA 4XK4A 3G1LA 5D18A 4GFLA 2PZ9A 3C07A 2OI8A 1T56A 2RAEA 5F0CA 3NNRA 3VOKA 5J1RA 4L62A 2ZCMA 2VKVA 3AQTA 2FX0A 3RH2A 2B3WA 2R7RA 3IH3A 2O7TA 3AQSA 3HTAA 4UDSA 2QCOA 3GEUA 2I10A 2ZCXA 2ZCNA 2R7OA 3BTIA 5IOZA 2R7UA 1QVUA 5GP9A 2IBDA 3BTJA 3O60A 1U9NA 3C2BA 2FJI1 3Q0UA 5FKNA 5CXGA 1ZKGA 2TRTA 5HBUA 4I76A 4B3AA 3DU6A 3KKCA 1JUPA 2XGCA 4CGRA 3LSPA 3VVXA 3VVZA 4KWAA 3GZIA 3MVPA 4YZEA 3G1OA 3PPBA 3P9TA 2DTZA 4G12A 2R7TA 2YVHA 2Y31A 2Y30A 2NP5A 4OD5A 4WIBA 3NRGA 3B81A 1JTYA 1RKWA 2REKA 3QQAA 3HIMA 3G7RA 4AC0A 3SWHA 2PFVA 3HE0A 3NI7A 2NX4A 3O8HA 2G7SA 2QKOA 2QIBA 1JT0A 1UI5A 5DAJA 2XB5A 5F27A 3DEWA 4U9LA 2V57A 5CW8A 1U9OA 4D7MA 4MK6A 2ID3A 3ZQLA 3VOXA
chains in the Genus database with same CATH topology
2FJ1A 5GPCA 3F0CA 1RPWA 2EH3A 5D1RA 4AC6A 2HXIA 3VPRA 4ACIA 3LSRA 2W53A 3B6CA 3O8GA 3QBMA 4D5FA 5FGLA 5IP6A 2ID6A 2IEKA 2QOPA 2XPUA 2F07A 2Q24A 3IH2A 3BTCA 4X1EA 2DG8A 3FK7A 3BHQA 2DG7A 3IH4A 3DCFA 2WUIA 5IPAA 3VW1A 3BR0A 4V2GA 2OPTA 4D5CA 5H9TA 2D6YA 4JYKA 3EUPA 1T33A 2XPVA 2ZOYA 3KZ9A 3LSJA 5CXIA 2FQ4A 3QKXA 5EZHA 3WHBA 2X6OA 3LOCA 3BTLA 5J1UA 3B6AA 5F1JA 2NP3A 2UXUA 5F0FA 4JKZA 4M3GA 4MXMA 2UXHA 5EFYA 2FBQA 2ZOZA 2G7GA 2XGDA 2XGEA 2HKUA 5IOYA 5K7ZA 3BCGA 1Z0XA 2G0EA 5HAWA 2GFNA 3NXCA 5F04A 4JL3A 1QVTA 2RASA 2XDNA 2HXOA 2HYJA 3NPIA 3EGQA 4JNNA 3BQYA 1Z77A 3ZQGA 3BR3A 5EZGA 2IU5A 3LWJA 5K7FA 3VIBA 3JSJA 5FKLA 2JJ7A 1ORKA 3BNIA 1SGMA 2XPWA 2VKEA 3ZQFA 3BRUA 1JUSA 3BQZA 3V6GA 2OERA 2OF7A 5F0HA 3MNLA 4AUXA 5FKOA 5J3LA 5FKMA 2G3BA 4B1RA 5D19A 5FHPA 2Y2ZA 3VP5A 3LHQA 3PASA 1JUMA 5J1YA 2HQ5A 1VI0A 3FK6A 3PM1A 3VUQA 3TP3A 2NS7A 3ANPA 3HGYA 4GCKA 2TCTA 2QTQA 5K7HA 2GBYA 5F08A 3ZQIA 4V2FA 2WV1A 3ZQHA 1JTXA 5EYRA 4AF5A 4HKUA 5AQCA 4ME9A 2UXIA 3QPSA 3BT9A 1ZK8A 4I6ZA 3LJLA 3BR2A 3T6NA 2O7OA 5GPAA 3BR1A 2X9DA 4D7NA 3ON2A 3G1MA 3BJBA 2FD5A 2GUHA 4ABZA 2ZB9A 3VW0A 3ANGA 4NN1A 3Q0VA 3G56A 3V78A 3SFIA 1A6IA 3BR5A 5HSZA 2NS8A 3FIWA 4MO7A 3BR6A 3IUVA 2UXOA 3VW2A 2IAIA 4M3DA 2PBXA 4DW6A 3S5RA 4M3FA 4ICHA 5K58A 3Q3SA 3CRJA 4GFKA 3ON4A 1QPIA 3CDLA 3WHCA 3E7QA 2QWTA 3KKDA 3HTIA 2UXPA 3CJDA 3F1BA 3HTJA 2VPRA 1UI6A 2JK3A 2XRLA 2WGBA 4M3EA 5FKKA 3SDGA 3TP0A 4GCTA 3HTHA 1JT6A 3KNWA 4NELA 4GCLA 2HYTA 2YVEA 3QPLA 3VVYA 5FMPA 2RHAA 3CCYA 4W1UA 1RKTA 4M3BA 3Q0WA 2GENA 5C4YA 4W97A 3DPJA 4PXIA 3HGGA 3CWRA 3RD3A 1BJZA 2G7LA 3FRQA 3COLA 4XK4A 3G1LA 5D18A 4GFLA 2PZ9A 3C07A 2OI8A 1T56A 2RAEA 5F0CA 3NNRA 3VOKA 5J1RA 4L62A 2ZCMA 2VKVA 3AQTA 2FX0A 3RH2A 3IH3A 2O7TA 3AQSA 3HTAA 4UDSA 2QCOA 3GEUA 2I10A 2ZCXA 2ZCNA 3BTIA 5IOZA 1QVUA 5GP9A 2IBDA 3BTJA 3O60A 1U9NA 3C2BA 3Q0UA 5FKNA 5CXGA 1ZKGA 2TRTA 5HBUA 4I76A 4B3AA 3KKCA 1JUPA 2XGCA 4CGRA 3LSPA 3VVXA 3VVZA 4KWAA 3GZIA 3MVPA 4YZEA 3G1OA 3PPBA 3P9TA 2DTZA 4G12A 2YVHA 2Y31A 2Y30A 2NP5A 3NRGA 3B81A 1JTYA 1RKWA 2REKA 3QQAA 3HIMA 3G7RA 4AC0A 3HE0A 3NI7A 2NX4A 3O8HA 2G7SA 2QKOA 2QIBA 1JT0A 1UI5A 5DAJA 2XB5A 5F27A 3DEWA 2V57A 5CW8A 1U9OA 4D7MA 4MK6A 2ID3A 3ZQLA 3VOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ1 A;  5GPC A;  3F0C A;  1RPW A;  2EH3 A;  5D1R A;  4AC6 A;  2HXI A;  3VPR A;  4ACI A;  3LSR A;  2W53 A;  3B6C A;  3O8G A;  3QBM A;  4D5F A;  5FGL A;  5IP6 A;  2ID6 A;  2IEK A;  2QOP A;  2XPU A;  2F07 A;  2Q24 A;  3IH2 A;  3BTC A;  4X1E A;  2DG8 A;  3FK7 A;  3BHQ A;  2DG7 A;  3IH4 A;  3DCF A;  2WUI A;  5IPA A;  3VW1 A;  3BR0 A;  4V2G A;  2OPT A;  4D5C A;  5H9T A;  2D6Y A;  4JYK A;  3EUP A;  1T33 A;  2XPV A;  2ZOY A;  3KZ9 A;  3LSJ A;  5CXI A;  2FQ4 A;  3QKX A;  5EZH A;  3WHB A;  2X6O A;  3LOC A;  3BTL A;  5J1U A;  3B6A A;  5F1J A;  2NP3 A;  2UXU A;  5F0F A;  4JKZ A;  4M3G A;  4MXM A;  2UXH A;  5EFY A;  2FBQ A;  2ZOZ A;  2G7G A;  2XGD A;  2XGE A;  2HKU A;  5IOY A;  5K7Z A;  3BCG A;  1Z0X A;  2G0E A;  5HAW A;  2GFN A;  3NXC A;  5F04 A;  4JL3 A;  1QVT A;  2RAS A;  2XDN A;  2HXO A;  2HYJ A;  3NPI A;  3EGQ A;  4JNN A;  3BQY A;  1Z77 A;  3ZQG A;  3BR3 A;  5EZG A;  2IU5 A;  3LWJ A;  5K7F A;  3VIB A;  3JSJ A;  5FKL A;  2JJ7 A;  1ORK A;  3BNI A;  1SGM A;  2XPW A;  2VKE A;  3ZQF A;  3BRU A;  1JUS A;  3BQZ A;  3V6G A;  2OER A;  2OF7 A;  5F0H A;  3MNL A;  4AUX A;  5FKO A;  5J3L A;  5FKM A;  2G3B A;  4B1R A;  5D19 A;  5FHP A;  2Y2Z A;  3VP5 A;  3LHQ A;  3PAS A;  1JUM A;  5J1Y A;  2HQ5 A;  1VI0 A;  3FK6 A;  3PM1 A;  3VUQ A;  3TP3 A;  2NS7 A;  3ANP A;  3HGY A;  4GCK A;  2TCT A;  2QTQ A;  5K7H A;  2GBY A;  5F08 A;  3ZQI A;  4V2F A;  2WV1 A;  3ZQH A;  1JTX A;  5EYR A;  4AF5 A;  4HKU A;  5AQC A;  4ME9 A;  2UXI A;  3QPS A;  3BT9 A;  1ZK8 A;  4I6Z A;  3LJL A;  3BR2 A;  3T6N A;  2O7O A;  5GPA A;  3BR1 A;  2X9D A;  4D7N A;  3ON2 A;  3G1M A;  3BJB A;  2FD5 A;  2GUH A;  4ABZ A;  2ZB9 A;  3VW0 A;  3ANG A;  4NN1 A;  3Q0V A;  3G56 A;  3V78 A;  3SFI A;  1A6I A;  3BR5 A;  5HSZ A;  2NS8 A;  3FIW A;  4MO7 A;  3BR6 A;  3IUV A;  2UXO A;  3VW2 A;  2IAI A;  4M3D A;  2PBX A;  4DW6 A;  3S5R A;  4M3F A;  4ICH A;  5K58 A;  3Q3S A;  3CRJ A;  4GFK A;  3ON4 A;  1QPI A;  3CDL A;  3WHC A;  3E7Q A;  2QWT A;  3KKD A;  3HTI A;  2UXP A;  3CJD A;  3F1B A;  3HTJ A;  2VPR A;  1UI6 A;  2JK3 A;  2XRL A;  2WGB A;  4M3E A;  5FKK A;  3SDG A;  3TP0 A;  4GCT A;  3HTH A;  1JT6 A;  3KNW A;  4NEL A;  4GCL A;  2HYT A;  2YVE A;  3QPL A;  3VVY A;  5FMP A;  2RHA A;  3CCY A;  4W1U A;  1RKT A;  4M3B A;  3Q0W A;  2GEN A;  5C4Y A;  4W97 A;  3DPJ A;  4PXI A;  3HGG A;  3CWR A;  3RD3 A;  1BJZ A;  2G7L A;  3FRQ A;  3COL A;  4XK4 A;  3G1L A;  5D18 A;  4GFL A;  2PZ9 A;  3C07 A;  2OI8 A;  1T56 A;  2RAE A;  5F0C A;  3NNR A;  3VOK A;  5J1R A;  4L62 A;  2ZCM A;  2VKV A;  3AQT A;  2FX0 A;  3RH2 A;  3IH3 A;  2O7T A;  3AQS A;  3HTA A;  4UDS A;  2QCO A;  3GEU A;  2I10 A;  2ZCX A;  2ZCN A;  3BTI A;  5IOZ A;  1QVU A;  5GP9 A;  2IBD A;  3BTJ A;  3O60 A;  1U9N A;  3C2B A;  3Q0U A;  5FKN A;  5CXG A;  1ZKG A;  2TRT A;  5HBU A;  4I76 A;  4B3A A;  3KKC A;  1JUP A;  2XGC A;  4CGR A;  3LSP A;  3VVX A;  3VVZ A;  4KWA A;  3GZI A;  3MVP A;  4YZE A;  3G1O A;  3PPB A;  3P9T A;  2DTZ A;  4G12 A;  2YVH A;  2Y31 A;  2Y30 A;  2NP5 A;  3NRG A;  3B81 A;  1JTY A;  1RKW A;  2REK A;  3QQA A;  3HIM A;  3G7R A;  4AC0 A;  3HE0 A;  3NI7 A;  2NX4 A;  3O8H A;  2G7S A;  2QKO A;  2QIB A;  1JT0 A;  1UI5 A;  5DAJ A;  2XB5 A;  5F27 A;  3DEW A;  2V57 A;  5CW8 A;  1U9O A;  4D7M A;  4MK6 A;  2ID3 A;  3ZQL A;  3VOX A; 
#chains in the Genus database with same CATH topology
 2FJ1 A;  5GPC A;  3F0C A;  1RPW A;  2EH3 A;  5D1R A;  4AC6 A;  2HXI A;  3VPR A;  4ACI A;  3LSR A;  2W53 A;  3B6C A;  3O8G A;  3QBM A;  4D5F A;  5FGL A;  5IP6 A;  2ID6 A;  2IEK A;  2QOP A;  2XPU A;  2F07 A;  2Q24 A;  3IH2 A;  3BTC A;  4X1E A;  2DG8 A;  3FK7 A;  3BHQ A;  2DG7 A;  2R7V A;  3IH4 A;  3DCF A;  2WUI A;  5IPA A;  3VW1 A;  3BR0 A;  4V2G A;  2OPT A;  4D5C A;  5H9T A;  2D6Y A;  4JYK A;  3EUP A;  1T33 A;  2XPV A;  2ZOY A;  3KZ9 A;  3LSJ A;  5CXI A;  2FQ4 A;  3QKX A;  3K8P C;  5EZH A;  3WHB A;  2X6O A;  3LOC A;  3BTL A;  5J1U A;  3B6A A;  5F1J A;  2NP3 A;  2UXU A;  5F0F A;  4JKZ A;  4M3G A;  4MXM A;  2UXH A;  5EFY A;  2FBQ A;  2ZOZ A;  4DVY P;  2G7G A;  2XGD A;  2XGE A;  2HKU A;  2YVX A;  5IOY A;  5K7Z A;  3DU5 A;  3BCG A;  2R7X A;  1Z0X A;  2G0E A;  4OD4 A;  5HAW A;  2GFN A;  3NXC A;  5F04 A;  4JL3 A;  1QVT A;  2RAS A;  2XDN A;  2HXO A;  2HYJ A;  3NPI A;  3EGQ A;  4JNN A;  3BQY A;  4IRV A;  1Z77 A;  3ZQG A;  3BR3 A;  5EZG A;  3FHN A;  2IU5 A;  3LWJ A;  5K7F A;  3VIB A;  3JSJ A;  5FKL A;  2JJ7 A;  1ORK A;  3BNI A;  1SGM A;  2XPW A;  2VKE A;  3NS4 A;  3ZQF A;  3BRU A;  1JUS A;  3BQZ A;  3V6G A;  2ZY9 A;  2OER A;  2OF7 A;  5F0H A;  3MNL A;  4AUX A;  5FKO A;  5J3L A;  5FKM A;  2G3B A;  4B1R A;  5D19 A;  5FHP A;  2Y2Z A;  3VP5 A;  3LHQ A;  3PAS A;  1JUM A;  5J1Y A;  2HQ5 A;  1VI0 A;  3FK6 A;  3PM1 A;  3VUQ A;  3TP3 A;  2NS7 A;  3ANP A;  3HGY A;  4GCK A;  2TCT A;  2QTQ A;  5K7H A;  2R7W A;  2GBY A;  5F08 A;  3ZQI A;  4V2F A;  2WV1 A;  3ZQH A;  1JTX A;  5EYR A;  3KYL A;  4AF5 A;  4HKU A;  5CQG A;  2A2F X;  5AQC A;  4ME9 A;  2UXI A;  3QPS A;  3VTI A;  3BT9 A;  1ZK8 A;  4I6Z A;  3LJL A;  3BR2 A;  3T6N A;  2O7O A;  5GPA A;  3BR1 A;  2X9D A;  4D7N A;  3ON2 A;  3G1M A;  3BJB A;  2FD5 A;  2GUH A;  4ABZ A;  2ZB9 A;  3VW0 A;  3ANG A;  4NN1 A;  3Q0V A;  3G56 A;  3V78 A;  3SFI A;  1A6I A;  3BR5 A;  5HSZ A;  2R7Q A;  4C2M A;  2NS8 A;  3FIW A;  4MO7 A;  3BR6 A;  3IUV A;  2UXO A;  3VW2 A;  2IAI A;  4M3D A;  2PBX A;  4DW6 A;  3S5R A;  4M3F A;  4ICH A;  5K58 A;  3Q3S A;  3CRJ A;  4GFK A;  3ON4 A;  1QPI A;  3CDL A;  3WHC A;  3E7Q A;  2QWT A;  3KKD A;  3HTI A;  2UXP A;  3CJD A;  3F1B A;  3HTJ A;  2VPR A;  1UI6 A;  2JK3 A;  2XRL A;  2B1E A;  2WGB A;  4M3E A;  5FKK A;  3SDG A;  3TP0 A;  4GCT A;  3HTH A;  1JT6 A;  3KNW A;  4NEL A;  4GCL A;  2HYT A;  2YVE A;  3QPL A;  3VVY A;  5FMP A;  2RHA A;  3CCY A;  4W1U A;  2R7S A;  1RKT A;  4M3B A;  3Q0W A;  4U9N A;  2GEN A;  5C4Y A;  4W97 A;  3DPJ A;  4PXI A;  3HGG A;  3CWR A;  3RD3 A;  1BJZ A;  2G7L A;  3FRQ A;  3COL A;  4XK4 A;  3G1L A;  5D18 A;  4GFL A;  2PZ9 A;  3C07 A;  2OI8 A;  1T56 A;  2RAE A;  5F0C A;  3NNR A;  3VOK A;  5J1R A;  4L62 A;  2ZCM A;  2VKV A;  3AQT A;  2FX0 A;  3RH2 A;  2B3W A;  2R7R A;  3IH3 A;  2O7T A;  3AQS A;  3HTA A;  4UDS A;  2QCO A;  3GEU A;  2I10 A;  2ZCX A;  2ZCN A;  2R7O A;  3BTI A;  5IOZ A;  2R7U A;  1QVU A;  5GP9 A;  2IBD A;  3BTJ A;  3O60 A;  1U9N A;  3C2B A;  2FJI 1;  3Q0U A;  5FKN A;  5CXG A;  1ZKG A;  2TRT A;  5HBU A;  4I76 A;  4B3A A;  3DU6 A;  3KKC A;  1JUP A;  2XGC A;  4CGR A;  3LSP A;  3VVX A;  3VVZ A;  4KWA A;  3GZI A;  3MVP A;  4YZE A;  3G1O A;  3PPB A;  3P9T A;  2DTZ A;  4G12 A;  2R7T A;  2YVH A;  2Y31 A;  2Y30 A;  2NP5 A;  4OD5 A;  4WIB A;  3NRG A;  3B81 A;  1JTY A;  1RKW A;  2REK A;  3QQA A;  3HIM A;  3G7R A;  4AC0 A;  3SWH A;  2PFV A;  3HE0 A;  3NI7 A;  2NX4 A;  3O8H A;  2G7S A;  2QKO A;  2QIB A;  1JT0 A;  1UI5 A;  5DAJ A;  2XB5 A;  5F27 A;  3DEW A;  4U9L A;  2V57 A;  5CW8 A;  1U9O A;  4D7M A;  4MK6 A;  2ID3 A;  3ZQL A;  3VOX A; 
#chains in the Genus database with same CATH homology
 2FJ1 A;  5GPC A;  3F0C A;  1RPW A;  2EH3 A;  5D1R A;  4AC6 A;  2HXI A;  3VPR A;  4ACI A;  3LSR A;  2W53 A;  3B6C A;  3O8G A;  3QBM A;  4D5F A;  5FGL A;  5IP6 A;  2ID6 A;  2IEK A;  2QOP A;  2XPU A;  2F07 A;  2Q24 A;  3IH2 A;  3BTC A;  4X1E A;  2DG8 A;  3FK7 A;  3BHQ A;  2DG7 A;  3IH4 A;  3DCF A;  2WUI A;  5IPA A;  3VW1 A;  3BR0 A;  4V2G A;  2OPT A;  4D5C A;  5H9T A;  2D6Y A;  4JYK A;  3EUP A;  1T33 A;  2XPV A;  2ZOY A;  3KZ9 A;  3LSJ A;  5CXI A;  2FQ4 A;  3QKX A;  5EZH A;  3WHB A;  2X6O A;  3LOC A;  3BTL A;  5J1U A;  3B6A A;  5F1J A;  2NP3 A;  2UXU A;  5F0F A;  4JKZ A;  4M3G A;  4MXM A;  2UXH A;  5EFY A;  2FBQ A;  2ZOZ A;  2G7G A;  2XGD A;  2XGE A;  2HKU A;  5IOY A;  5K7Z A;  3BCG A;  1Z0X A;  2G0E A;  5HAW A;  2GFN A;  3NXC A;  5F04 A;  4JL3 A;  1QVT A;  2RAS A;  2XDN A;  2HXO A;  2HYJ A;  3NPI A;  3EGQ A;  4JNN A;  3BQY A;  1Z77 A;  3ZQG A;  3BR3 A;  5EZG A;  2IU5 A;  3LWJ A;  5K7F A;  3VIB A;  3JSJ A;  5FKL A;  2JJ7 A;  1ORK A;  3BNI A;  1SGM A;  2XPW A;  2VKE A;  3ZQF A;  3BRU A;  1JUS A;  3BQZ A;  3V6G A;  2OER A;  2OF7 A;  5F0H A;  3MNL A;  4AUX A;  5FKO A;  5J3L A;  5FKM A;  2G3B A;  4B1R A;  5D19 A;  5FHP A;  2Y2Z A;  3VP5 A;  3LHQ A;  3PAS A;  1JUM A;  5J1Y A;  2HQ5 A;  1VI0 A;  3FK6 A;  3PM1 A;  3VUQ A;  3TP3 A;  2NS7 A;  3ANP A;  3HGY A;  4GCK A;  2TCT A;  2QTQ A;  5K7H A;  2GBY A;  5F08 A;  3ZQI A;  4V2F A;  2WV1 A;  3ZQH A;  1JTX A;  5EYR A;  4AF5 A;  4HKU A;  5AQC A;  4ME9 A;  2UXI A;  3QPS A;  3BT9 A;  1ZK8 A;  4I6Z A;  3LJL A;  3BR2 A;  3T6N A;  2O7O A;  5GPA A;  3BR1 A;  2X9D A;  4D7N A;  3ON2 A;  3G1M A;  3BJB A;  2FD5 A;  2GUH A;  4ABZ A;  2ZB9 A;  3VW0 A;  3ANG A;  4NN1 A;  3Q0V A;  3G56 A;  3V78 A;  3SFI A;  1A6I A;  3BR5 A;  5HSZ A;  2NS8 A;  3FIW A;  4MO7 A;  3BR6 A;  3IUV A;  2UXO A;  3VW2 A;  2IAI A;  4M3D A;  2PBX A;  4DW6 A;  3S5R A;  4M3F A;  4ICH A;  5K58 A;  3Q3S A;  3CRJ A;  4GFK A;  3ON4 A;  1QPI A;  3CDL A;  3WHC A;  3E7Q A;  2QWT A;  3KKD A;  3HTI A;  2UXP A;  3CJD A;  3F1B A;  3HTJ A;  2VPR A;  1UI6 A;  2JK3 A;  2XRL A;  2WGB A;  4M3E A;  5FKK A;  3SDG A;  3TP0 A;  4GCT A;  3HTH A;  1JT6 A;  3KNW A;  4NEL A;  4GCL A;  2HYT A;  2YVE A;  3QPL A;  3VVY A;  5FMP A;  2RHA A;  3CCY A;  4W1U A;  1RKT A;  4M3B A;  3Q0W A;  2GEN A;  5C4Y A;  4W97 A;  3DPJ A;  4PXI A;  3HGG A;  3CWR A;  3RD3 A;  1BJZ A;  2G7L A;  3FRQ A;  3COL A;  4XK4 A;  3G1L A;  5D18 A;  4GFL A;  2PZ9 A;  3C07 A;  2OI8 A;  1T56 A;  2RAE A;  5F0C A;  3NNR A;  3VOK A;  5J1R A;  4L62 A;  2ZCM A;  2VKV A;  3AQT A;  2FX0 A;  3RH2 A;  3IH3 A;  2O7T A;  3AQS A;  3HTA A;  4UDS A;  2QCO A;  3GEU A;  2I10 A;  2ZCX A;  2ZCN A;  3BTI A;  5IOZ A;  1QVU A;  5GP9 A;  2IBD A;  3BTJ A;  3O60 A;  1U9N A;  3C2B A;  3Q0U A;  5FKN A;  5CXG A;  1ZKG A;  2TRT A;  5HBU A;  4I76 A;  4B3A A;  3KKC A;  1JUP A;  2XGC A;  4CGR A;  3LSP A;  3VVX A;  3VVZ A;  4KWA A;  3GZI A;  3MVP A;  4YZE A;  3G1O A;  3PPB A;  3P9T A;  2DTZ A;  4G12 A;  2YVH A;  2Y31 A;  2Y30 A;  2NP5 A;  3NRG A;  3B81 A;  1JTY A;  1RKW A;  2REK A;  3QQA A;  3HIM A;  3G7R A;  4AC0 A;  3HE0 A;  3NI7 A;  2NX4 A;  3O8H A;  2G7S A;  2QKO A;  2QIB A;  1JT0 A;  1UI5 A;  5DAJ A;  2XB5 A;  5F27 A;  3DEW A;  2V57 A;  5CW8 A;  1U9O A;  4D7M A;  4MK6 A;  2ID3 A;  3ZQL A;  3VOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...