3O60A

The crystal structure of lin0861 from listeria innocua to 2.8a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
NYVKVHQPLNVDLRTQKTQTKLYTVLERFYVEDRTFESISIKDLCEQARVSRATFYRHHKEIIQVIEVQILRTMQYFSLEFDQIILTKENIQRLILRTIQKNPLLFQVIFWSRAENIFIDVVSGEILRISLLKEVSFSDSKFMPNCFARMILSLAAEIQQSNKDYTNDQLVELIQEAARFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Lin0861 from Listeria innocua to 2.8A
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin0861 protein
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3o60A00
1JT0A 3TP0A 4GCTA 1ZKGA 4D5CA 4G12A 2QCOA 1RKWA 3NI7A 2I10A 3HGYA 2NP5A 3BRUA 5FKKA 3SDGA 3B6AA 4W97A 3COLA 5CW8A 3LOCA 4JNNA 2IAIA 3LSRA 2QWTA 5F08A 1ORKA 2QKOA 5DAJA 3BNIA 5FMPA 3LSJA 5GPAA 1JUMA 3QBMA 4GCLA 3BR0A 5EFYA 2ZB9A 2GENA 3KKCA 3FIWA 3BCGA 2XGEA 3IUVA 4NELA 2IU5A 3O60A 2HXIA 3KKDA 1QVTA 3ZQHA 5EZGA 2XGCA 2QIBA 2XPWA 3BTIA 2X6OA 5GP9A 3FK7A 3C07A 3JSJA 4D7MA 3HTIA 4X1EA 2ID3A 3QKXA 3V6GA 4M3EA 5K7ZA 3VVYA 3G1LA 3F0CA 3G7RA 2XB5A 2HYTA 4NN1A 3S5RA 5J3LA 2Y30A 4ME9A 3CWRA 1UI6A 2OI8A 2EH3A 1A6IA 2XRLA 2FJ1A 3ANGA 3QPLA 3HE0A 4ABZA 2DG8A 2HQ5A 2XPVA 3CJDA 3WHBA 4JKZA 3P9TA 3VVXA 3HIMA 2PZ9A 4GCKA 1SGMA 1JUSA 2WUIA 4AF5A 1U9NA 3KNWA 2OPTA 2UXUA 2D6YA 3BTLA 3NNRA 5EYRA 3Q3SA 5HAWA 3LJLA 3NRGA 3VUQA 3AQSA 3PM1A 5F27A 4DW6A 2Y31A 5D19A 3ZQFA 3ZQGA 3RD3A 4M3FA 3DEWA 1U9OA 2NP3A 3VW0A 1Z0XA 4W1UA 4CGRA 3BTJA 5F04A 5K7FA 3ZQIA 1T33A 5J1UA 3AQTA 3BTCA 3IH2A 2ID6A 4MO7A 1UI5A 4MXMA 5K7HA 4ACIA 4D5FA 3BR5A 2GFNA 3NXCA 1T56A 4M3BA 3VOXA 4JL3A 3G56A 1VI0A 3MVPA 5AQCA 5FKOA 1JUPA 4KWAA 1QVUA 5HBUA 4I6ZA 3GEUA 5IOYA 5CXIA 5FGLA 2YVEA 3O8HA 2UXIA 3LHQA 3BJBA 5FHPA 2HYJA 1ZK8A 3Q0WA 2ZCXA 2ZCMA 4L62A 2VKEA 3LWJA 3CCYA 3EUPA 4B1RA 2TRTA 5FKLA 3MNLA 3IH4A 1QPIA 4JYKA 2VPRA 3G1OA 4I76A 4UDSA 3LSPA 5J1YA 3BR1A 4GFLA 3QQAA 3PPBA 2VKVA 2FQ4A 2G7LA 5IPAA 2G0EA 2O7TA 2PBXA 4PXIA 2TCTA 3V78A 3T6NA 2NS8A 3VPRA 3NPIA 3HTAA 2WV1A 2V57A 5IP6A 2Y2ZA 4GFKA 1Z77A 1RPWA 3Q0VA 1JTXA 4V2GA 2UXPA 2O7OA 3TP3A 2Q24A 1BJZA 5F0FA 5FKNA 3VP5A 1JTYA 4V2FA 5K58A 2WGBA 3BR2A 2QOPA 4B3AA 2DG7A 5EZHA 5F0CA 3BQZA 3DPJA 2W53A 2XPUA 2G7SA 2RHAA 3Q0UA 3FRQA 3ZQLA 3CDLA 1JT6A 3ON2A 3BT9A 2QTQA 5CXGA 3PASA 4HKUA 5HSZA 3VVZA 2G7GA 2X9DA 3BQYA 2IEKA 3GZIA 3VOKA 3ON4A 2XDNA 2JJ7A 3SFIA 2G3BA 4ICHA 2UXOA 5C4YA 3G1MA 3HTHA 5GPCA 5J1RA 3C2BA 3KZ9A 2FBQA 3O8GA 4XK4A 2GUHA 2YVHA 2HXOA 2GBYA 3BHQA 2NX4A 3WHCA 2IBDA 3FK6A 5D18A 4D7NA 3HTJA 2XGDA 3QPSA 3HGGA 2FX0A 5H9TA 5IOZA 5D1RA 4AC6A 2FD5A 2ZOYA 3VW1A 3E7QA 4YZEA 2ZCNA 5F1JA 2HKUA 3RH2A 3CRJA 4M3GA 4AUXA 2OERA 3B6CA 2OF7A 3F1BA 2REKA 2RASA 2F07A 4AC0A 2DTZA 2RAEA 3VW2A 3VIBA 3IH3A 5F0HA 3EGQA 2NS7A 3B81A 2JK3A 3BR6A 4M3DA 5FKMA 3BR3A 4MK6A 2ZOZA 1RKTA 3ANPA 2UXHA 3DCFA
chains in the Genus database with same CATH superfamily
1JT0A 3TP0A 4GCTA 1ZKGA 2R7QA 4D5CA 4G12A 2QCOA 1RKWA 3NI7A 2A2FX 2I10A 3HGYA 2NP5A 3BRUA 5FKKA 3SDGA 3B6AA 4W97A 3COLA 2R7WA 5CW8A 3LOCA 4JNNA 2IAIA 3LSRA 3VTIA 2QWTA 5F08A 1ORKA 2QKOA 5DAJA 3BNIA 5FMPA 3LSJA 5GPAA 1JUMA 3QBMA 4GCLA 3BR0A 5EFYA 2ZB9A 2GENA 3KKCA 3FIWA 3BCGA 2XGEA 3IUVA 4NELA 3K8PC 2IU5A 3O60A 4U9NA 2HXIA 3KKDA 1QVTA 3ZQHA 5EZGA 2XGCA 2QIBA 2XPWA 3BTIA 2X6OA 5GP9A 3FK7A 3C07A 3JSJA 4D7MA 3HTIA 4X1EA 2ID3A 3QKXA 3V6GA 4M3EA 5K7ZA 3VVYA 3G1LA 3F0CA 3G7RA 2XB5A 2HYTA 4NN1A 3S5RA 5J3LA 2Y30A 4ME9A 3CWRA 1UI6A 2OI8A 2EH3A 1A6IA 2XRLA 2FJ1A 3ANGA 3QPLA 3HE0A 4ABZA 2DG8A 2HQ5A 2XPVA 3CJDA 3WHBA 4JKZA 3P9TA 3VVXA 3HIMA 2PZ9A 4GCKA 1SGMA 1JUSA 2WUIA 4AF5A 1U9NA 3KNWA 2OPTA 2UXUA 2D6YA 3BTLA 3NNRA 5EYRA 4WIBA 3Q3SA 5HAWA 3LJLA 3NRGA 3VUQA 3AQSA 3PM1A 5F27A 4DW6A 2Y31A 5D19A 3ZQFA 2R7OA 3ZQGA 3RD3A 4M3FA 3DEWA 1U9OA 2NP3A 3VW0A 1Z0XA 4W1UA 4CGRA 3BTJA 5F04A 5K7FA 3ZQIA 1T33A 5J1UA 3AQTA 3BTCA 3IH2A 2ID6A 4MO7A 1UI5A 4MXMA 5K7HA 2R7TA 4ACIA 4D5FA 3BR5A 2GFNA 3NXCA 1T56A 4M3BA 3VOXA 4JL3A 3G56A 1VI0A 3MVPA 5AQCA 5FKOA 1JUPA 4KWAA 1QVUA 5HBUA 4I6ZA 3GEUA 5IOYA 5CXIA 5FGLA 2YVEA 3O8HA 2UXIA 3LHQA 3BJBA 5FHPA 2HYJA 1ZK8A 3Q0WA 2ZCXA 2ZCMA 4L62A 3KYLA 2VKEA 3LWJA 2FJI1 3CCYA 3EUPA 4B1RA 2TRTA 5FKLA 3MNLA 3IH4A 1QPIA 4JYKA 2VPRA 3G1OA 2B3WA 4I76A 2PFVA 4UDSA 3LSPA 3NS4A 5J1YA 3BR1A 4GFLA 3QQAA 3PPBA 2VKVA 2FQ4A 2G7LA 5IPAA 2G0EA 2R7UA 2O7TA 2PBXA 4PXIA 2TCTA 3V78A 3DU5A 3T6NA 4DVYP 4OD5A 2NS8A 3VPRA 3NPIA 3HTAA 2WV1A 2V57A 5IP6A 2Y2ZA 4GFKA 1Z77A 1RPWA 3Q0VA 1JTXA 4V2GA 2UXPA 2O7OA 3TP3A 2R7SA 2Q24A 1BJZA 5F0FA 5FKNA 3VP5A 1JTYA 4V2FA 5K58A 3DU6A 2WGBA 3BR2A 2QOPA 4B3AA 2DG7A 5EZHA 2ZY9A 5F0CA 3BQZA 3DPJA 2W53A 2XPUA 2G7SA 2RHAA 3Q0UA 3FRQA 3ZQLA 3CDLA 1JT6A 3ON2A 3BT9A 2QTQA 5CXGA 3PASA 2R7VA 4HKUA 5HSZA 2B1EA 3VVZA 2G7GA 2X9DA 3BQYA 4C2MA 2IEKA 3GZIA 3VOKA 3ON4A 2XDNA 2JJ7A 3SFIA 2G3BA 4ICHA 2UXOA 5C4YA 3G1MA 3HTHA 5GPCA 5J1RA 3C2BA 3KZ9A 2FBQA 3O8GA 4XK4A 2GUHA 2YVHA 2HXOA 2GBYA 3BHQA 2NX4A 3WHCA 2IBDA 3FK6A 5D18A 2R7RA 4D7NA 3FHNA 2R7XA 3HTJA 2XGDA 3QPSA 3HGGA 2FX0A 5H9TA 5IOZA 5D1RA 4AC6A 2FD5A 2ZOYA 3VW1A 3E7QA 5CQGA 4YZEA 2ZCNA 5F1JA 2HKUA 3RH2A 4OD4A 3CRJA 4M3GA 4AUXA 2OERA 3B6CA 2OF7A 3F1BA 2REKA 2RASA 2F07A 4AC0A 2DTZA 2RAEA 3VW2A 3VIBA 3IH3A 4U9LA 5F0HA 3EGQA 4IRVA 2NS7A 3B81A 2JK3A 3BR6A 4M3DA 5FKMA 3BR3A 4MK6A 2ZOZA 2YVXA 3SWHA 1RKTA 3ANPA 2UXHA 3DCFA
chains in the Genus database with same CATH topology
1JT0A 3TP0A 4GCTA 1ZKGA 4D5CA 4G12A 2QCOA 1RKWA 3NI7A 2I10A 3HGYA 2NP5A 3BRUA 5FKKA 3SDGA 3B6AA 4W97A 3COLA 5CW8A 3LOCA 4JNNA 2IAIA 3LSRA 2QWTA 5F08A 1ORKA 2QKOA 5DAJA 3BNIA 5FMPA 3LSJA 5GPAA 1JUMA 3QBMA 4GCLA 3BR0A 5EFYA 2ZB9A 2GENA 3KKCA 3FIWA 3BCGA 2XGEA 3IUVA 4NELA 2IU5A 3O60A 2HXIA 3KKDA 1QVTA 3ZQHA 5EZGA 2XGCA 2QIBA 2XPWA 3BTIA 2X6OA 5GP9A 3FK7A 3C07A 3JSJA 4D7MA 3HTIA 4X1EA 2ID3A 3QKXA 3V6GA 4M3EA 5K7ZA 3VVYA 3G1LA 3F0CA 3G7RA 2XB5A 2HYTA 4NN1A 3S5RA 5J3LA 2Y30A 4ME9A 3CWRA 1UI6A 2OI8A 2EH3A 1A6IA 2XRLA 2FJ1A 3ANGA 3QPLA 3HE0A 4ABZA 2DG8A 2HQ5A 2XPVA 3CJDA 3WHBA 4JKZA 3P9TA 3VVXA 3HIMA 2PZ9A 4GCKA 1SGMA 1JUSA 2WUIA 4AF5A 1U9NA 3KNWA 2OPTA 2UXUA 2D6YA 3BTLA 3NNRA 5EYRA 3Q3SA 5HAWA 3LJLA 3NRGA 3VUQA 3AQSA 3PM1A 5F27A 4DW6A 2Y31A 5D19A 3ZQFA 3ZQGA 3RD3A 4M3FA 3DEWA 1U9OA 2NP3A 3VW0A 1Z0XA 4W1UA 4CGRA 3BTJA 5F04A 5K7FA 3ZQIA 1T33A 5J1UA 3AQTA 3BTCA 3IH2A 2ID6A 4MO7A 1UI5A 4MXMA 5K7HA 4ACIA 4D5FA 3BR5A 2GFNA 3NXCA 1T56A 4M3BA 3VOXA 4JL3A 3G56A 1VI0A 3MVPA 5AQCA 5FKOA 1JUPA 4KWAA 1QVUA 5HBUA 4I6ZA 3GEUA 5IOYA 5CXIA 5FGLA 2YVEA 3O8HA 2UXIA 3LHQA 3BJBA 5FHPA 2HYJA 1ZK8A 3Q0WA 2ZCXA 2ZCMA 4L62A 2VKEA 3LWJA 3CCYA 3EUPA 4B1RA 2TRTA 5FKLA 3MNLA 3IH4A 1QPIA 4JYKA 2VPRA 3G1OA 4I76A 4UDSA 3LSPA 5J1YA 3BR1A 4GFLA 3QQAA 3PPBA 2VKVA 2FQ4A 2G7LA 5IPAA 2G0EA 2O7TA 2PBXA 4PXIA 2TCTA 3V78A 3T6NA 2NS8A 3VPRA 3NPIA 3HTAA 2WV1A 2V57A 5IP6A 2Y2ZA 4GFKA 1Z77A 1RPWA 3Q0VA 1JTXA 4V2GA 2UXPA 2O7OA 3TP3A 2Q24A 1BJZA 5F0FA 5FKNA 3VP5A 1JTYA 4V2FA 5K58A 2WGBA 3BR2A 2QOPA 4B3AA 2DG7A 5EZHA 5F0CA 3BQZA 3DPJA 2W53A 2XPUA 2G7SA 2RHAA 3Q0UA 3FRQA 3ZQLA 3CDLA 1JT6A 3ON2A 3BT9A 2QTQA 5CXGA 3PASA 4HKUA 5HSZA 3VVZA 2G7GA 2X9DA 3BQYA 2IEKA 3GZIA 3VOKA 3ON4A 2XDNA 2JJ7A 3SFIA 2G3BA 4ICHA 2UXOA 5C4YA 3G1MA 3HTHA 5GPCA 5J1RA 3C2BA 3KZ9A 2FBQA 3O8GA 4XK4A 2GUHA 2YVHA 2HXOA 2GBYA 3BHQA 2NX4A 3WHCA 2IBDA 3FK6A 5D18A 4D7NA 3HTJA 2XGDA 3QPSA 3HGGA 2FX0A 5H9TA 5IOZA 5D1RA 4AC6A 2FD5A 2ZOYA 3VW1A 3E7QA 4YZEA 2ZCNA 5F1JA 2HKUA 3RH2A 3CRJA 4M3GA 4AUXA 2OERA 3B6CA 2OF7A 3F1BA 2REKA 2RASA 2F07A 4AC0A 2DTZA 2RAEA 3VW2A 3VIBA 3IH3A 5F0HA 3EGQA 2NS7A 3B81A 2JK3A 3BR6A 4M3DA 5FKMA 3BR3A 4MK6A 2ZOZA 1RKTA 3ANPA 2UXHA 3DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT0 A;  3TP0 A;  4GCT A;  1ZKG A;  4D5C A;  4G12 A;  2QCO A;  1RKW A;  3NI7 A;  2I10 A;  3HGY A;  2NP5 A;  3BRU A;  5FKK A;  3SDG A;  3B6A A;  4W97 A;  3COL A;  5CW8 A;  3LOC A;  4JNN A;  2IAI A;  3LSR A;  2QWT A;  5F08 A;  1ORK A;  2QKO A;  5DAJ A;  3BNI A;  5FMP A;  3LSJ A;  5GPA A;  1JUM A;  3QBM A;  4GCL A;  3BR0 A;  5EFY A;  2ZB9 A;  2GEN A;  3KKC A;  3FIW A;  3BCG A;  2XGE A;  3IUV A;  4NEL A;  2IU5 A;  3O60 A;  2HXI A;  3KKD A;  1QVT A;  3ZQH A;  5EZG A;  2XGC A;  2QIB A;  2XPW A;  3BTI A;  2X6O A;  5GP9 A;  3FK7 A;  3C07 A;  3JSJ A;  4D7M A;  3HTI A;  4X1E A;  2ID3 A;  3QKX A;  3V6G A;  4M3E A;  5K7Z A;  3VVY A;  3G1L A;  3F0C A;  3G7R A;  2XB5 A;  2HYT A;  4NN1 A;  3S5R A;  5J3L A;  2Y30 A;  4ME9 A;  3CWR A;  1UI6 A;  2OI8 A;  2EH3 A;  1A6I A;  2XRL A;  2FJ1 A;  3ANG A;  3QPL A;  3HE0 A;  4ABZ A;  2DG8 A;  2HQ5 A;  2XPV A;  3CJD A;  3WHB A;  4JKZ A;  3P9T A;  3VVX A;  3HIM A;  2PZ9 A;  4GCK A;  1SGM A;  1JUS A;  2WUI A;  4AF5 A;  1U9N A;  3KNW A;  2OPT A;  2UXU A;  2D6Y A;  3BTL A;  3NNR A;  5EYR A;  3Q3S A;  5HAW A;  3LJL A;  3NRG A;  3VUQ A;  3AQS A;  3PM1 A;  5F27 A;  4DW6 A;  2Y31 A;  5D19 A;  3ZQF A;  3ZQG A;  3RD3 A;  4M3F A;  3DEW A;  1U9O A;  2NP3 A;  3VW0 A;  1Z0X A;  4W1U A;  4CGR A;  3BTJ A;  5F04 A;  5K7F A;  3ZQI A;  1T33 A;  5J1U A;  3AQT A;  3BTC A;  3IH2 A;  2ID6 A;  4MO7 A;  1UI5 A;  4MXM A;  5K7H A;  4ACI A;  4D5F A;  3BR5 A;  2GFN A;  3NXC A;  1T56 A;  4M3B A;  3VOX A;  4JL3 A;  3G56 A;  1VI0 A;  3MVP A;  5AQC A;  5FKO A;  1JUP A;  4KWA A;  1QVU A;  5HBU A;  4I6Z A;  3GEU A;  5IOY A;  5CXI A;  5FGL A;  2YVE A;  3O8H A;  2UXI A;  3LHQ A;  3BJB A;  5FHP A;  2HYJ A;  1ZK8 A;  3Q0W A;  2ZCX A;  2ZCM A;  4L62 A;  2VKE A;  3LWJ A;  3CCY A;  3EUP A;  4B1R A;  2TRT A;  5FKL A;  3MNL A;  3IH4 A;  1QPI A;  4JYK A;  2VPR A;  3G1O A;  4I76 A;  4UDS A;  3LSP A;  5J1Y A;  3BR1 A;  4GFL A;  3QQA A;  3PPB A;  2VKV A;  2FQ4 A;  2G7L A;  5IPA A;  2G0E A;  2O7T A;  2PBX A;  4PXI A;  2TCT A;  3V78 A;  3T6N A;  2NS8 A;  3VPR A;  3NPI A;  3HTA A;  2WV1 A;  2V57 A;  5IP6 A;  2Y2Z A;  4GFK A;  1Z77 A;  1RPW A;  3Q0V A;  1JTX A;  4V2G A;  2UXP A;  2O7O A;  3TP3 A;  2Q24 A;  1BJZ A;  5F0F A;  5FKN A;  3VP5 A;  1JTY A;  4V2F A;  5K58 A;  2WGB A;  3BR2 A;  2QOP A;  4B3A A;  2DG7 A;  5EZH A;  5F0C A;  3BQZ A;  3DPJ A;  2W53 A;  2XPU A;  2G7S A;  2RHA A;  3Q0U A;  3FRQ A;  3ZQL A;  3CDL A;  1JT6 A;  3ON2 A;  3BT9 A;  2QTQ A;  5CXG A;  3PAS A;  4HKU A;  5HSZ A;  3VVZ A;  2G7G A;  2X9D A;  3BQY A;  2IEK A;  3GZI A;  3VOK A;  3ON4 A;  2XDN A;  2JJ7 A;  3SFI A;  2G3B A;  4ICH A;  2UXO A;  5C4Y A;  3G1M A;  3HTH A;  5GPC A;  5J1R A;  3C2B A;  3KZ9 A;  2FBQ A;  3O8G A;  4XK4 A;  2GUH A;  2YVH A;  2HXO A;  2GBY A;  3BHQ A;  2NX4 A;  3WHC A;  2IBD A;  3FK6 A;  5D18 A;  4D7N A;  3HTJ A;  2XGD A;  3QPS A;  3HGG A;  2FX0 A;  5H9T A;  5IOZ A;  5D1R A;  4AC6 A;  2FD5 A;  2ZOY A;  3VW1 A;  3E7Q A;  4YZE A;  2ZCN A;  5F1J A;  2HKU A;  3RH2 A;  3CRJ A;  4M3G A;  4AUX A;  2OER A;  3B6C A;  2OF7 A;  3F1B A;  2REK A;  2RAS A;  2F07 A;  4AC0 A;  2DTZ A;  2RAE A;  3VW2 A;  3VIB A;  3IH3 A;  5F0H A;  3EGQ A;  2NS7 A;  3B81 A;  2JK3 A;  3BR6 A;  4M3D A;  5FKM A;  3BR3 A;  4MK6 A;  2ZOZ A;  1RKT A;  3ANP A;  2UXH A;  3DCF A; 
#chains in the Genus database with same CATH topology
 1JT0 A;  3TP0 A;  4GCT A;  1ZKG A;  2R7Q A;  4D5C A;  4G12 A;  2QCO A;  1RKW A;  3NI7 A;  2A2F X;  2I10 A;  3HGY A;  2NP5 A;  3BRU A;  5FKK A;  3SDG A;  3B6A A;  4W97 A;  3COL A;  2R7W A;  5CW8 A;  3LOC A;  4JNN A;  2IAI A;  3LSR A;  3VTI A;  2QWT A;  5F08 A;  1ORK A;  2QKO A;  5DAJ A;  3BNI A;  5FMP A;  3LSJ A;  5GPA A;  1JUM A;  3QBM A;  4GCL A;  3BR0 A;  5EFY A;  2ZB9 A;  2GEN A;  3KKC A;  3FIW A;  3BCG A;  2XGE A;  3IUV A;  4NEL A;  3K8P C;  2IU5 A;  3O60 A;  4U9N A;  2HXI A;  3KKD A;  1QVT A;  3ZQH A;  5EZG A;  2XGC A;  2QIB A;  2XPW A;  3BTI A;  2X6O A;  5GP9 A;  3FK7 A;  3C07 A;  3JSJ A;  4D7M A;  3HTI A;  4X1E A;  2ID3 A;  3QKX A;  3V6G A;  4M3E A;  5K7Z A;  3VVY A;  3G1L A;  3F0C A;  3G7R A;  2XB5 A;  2HYT A;  4NN1 A;  3S5R A;  5J3L A;  2Y30 A;  4ME9 A;  3CWR A;  1UI6 A;  2OI8 A;  2EH3 A;  1A6I A;  2XRL A;  2FJ1 A;  3ANG A;  3QPL A;  3HE0 A;  4ABZ A;  2DG8 A;  2HQ5 A;  2XPV A;  3CJD A;  3WHB A;  4JKZ A;  3P9T A;  3VVX A;  3HIM A;  2PZ9 A;  4GCK A;  1SGM A;  1JUS A;  2WUI A;  4AF5 A;  1U9N A;  3KNW A;  2OPT A;  2UXU A;  2D6Y A;  3BTL A;  3NNR A;  5EYR A;  4WIB A;  3Q3S A;  5HAW A;  3LJL A;  3NRG A;  3VUQ A;  3AQS A;  3PM1 A;  5F27 A;  4DW6 A;  2Y31 A;  5D19 A;  3ZQF A;  2R7O A;  3ZQG A;  3RD3 A;  4M3F A;  3DEW A;  1U9O A;  2NP3 A;  3VW0 A;  1Z0X A;  4W1U A;  4CGR A;  3BTJ A;  5F04 A;  5K7F A;  3ZQI A;  1T33 A;  5J1U A;  3AQT A;  3BTC A;  3IH2 A;  2ID6 A;  4MO7 A;  1UI5 A;  4MXM A;  5K7H A;  2R7T A;  4ACI A;  4D5F A;  3BR5 A;  2GFN A;  3NXC A;  1T56 A;  4M3B A;  3VOX A;  4JL3 A;  3G56 A;  1VI0 A;  3MVP A;  5AQC A;  5FKO A;  1JUP A;  4KWA A;  1QVU A;  5HBU A;  4I6Z A;  3GEU A;  5IOY A;  5CXI A;  5FGL A;  2YVE A;  3O8H A;  2UXI A;  3LHQ A;  3BJB A;  5FHP A;  2HYJ A;  1ZK8 A;  3Q0W A;  2ZCX A;  2ZCM A;  4L62 A;  3KYL A;  2VKE A;  3LWJ A;  2FJI 1;  3CCY A;  3EUP A;  4B1R A;  2TRT A;  5FKL A;  3MNL A;  3IH4 A;  1QPI A;  4JYK A;  2VPR A;  3G1O A;  2B3W A;  4I76 A;  2PFV A;  4UDS A;  3LSP A;  3NS4 A;  5J1Y A;  3BR1 A;  4GFL A;  3QQA A;  3PPB A;  2VKV A;  2FQ4 A;  2G7L A;  5IPA A;  2G0E A;  2R7U A;  2O7T A;  2PBX A;  4PXI A;  2TCT A;  3V78 A;  3DU5 A;  3T6N A;  4DVY P;  4OD5 A;  2NS8 A;  3VPR A;  3NPI A;  3HTA A;  2WV1 A;  2V57 A;  5IP6 A;  2Y2Z A;  4GFK A;  1Z77 A;  1RPW A;  3Q0V A;  1JTX A;  4V2G A;  2UXP A;  2O7O A;  3TP3 A;  2R7S A;  2Q24 A;  1BJZ A;  5F0F A;  5FKN A;  3VP5 A;  1JTY A;  4V2F A;  5K58 A;  3DU6 A;  2WGB A;  3BR2 A;  2QOP A;  4B3A A;  2DG7 A;  5EZH A;  2ZY9 A;  5F0C A;  3BQZ A;  3DPJ A;  2W53 A;  2XPU A;  2G7S A;  2RHA A;  3Q0U A;  3FRQ A;  3ZQL A;  3CDL A;  1JT6 A;  3ON2 A;  3BT9 A;  2QTQ A;  5CXG A;  3PAS A;  2R7V A;  4HKU A;  5HSZ A;  2B1E A;  3VVZ A;  2G7G A;  2X9D A;  3BQY A;  4C2M A;  2IEK A;  3GZI A;  3VOK A;  3ON4 A;  2XDN A;  2JJ7 A;  3SFI A;  2G3B A;  4ICH A;  2UXO A;  5C4Y A;  3G1M A;  3HTH A;  5GPC A;  5J1R A;  3C2B A;  3KZ9 A;  2FBQ A;  3O8G A;  4XK4 A;  2GUH A;  2YVH A;  2HXO A;  2GBY A;  3BHQ A;  2NX4 A;  3WHC A;  2IBD A;  3FK6 A;  5D18 A;  2R7R A;  4D7N A;  3FHN A;  2R7X A;  3HTJ A;  2XGD A;  3QPS A;  3HGG A;  2FX0 A;  5H9T A;  5IOZ A;  5D1R A;  4AC6 A;  2FD5 A;  2ZOY A;  3VW1 A;  3E7Q A;  5CQG A;  4YZE A;  2ZCN A;  5F1J A;  2HKU A;  3RH2 A;  4OD4 A;  3CRJ A;  4M3G A;  4AUX A;  2OER A;  3B6C A;  2OF7 A;  3F1B A;  2REK A;  2RAS A;  2F07 A;  4AC0 A;  2DTZ A;  2RAE A;  3VW2 A;  3VIB A;  3IH3 A;  4U9L A;  5F0H A;  3EGQ A;  4IRV A;  2NS7 A;  3B81 A;  2JK3 A;  3BR6 A;  4M3D A;  5FKM A;  3BR3 A;  4MK6 A;  2ZOZ A;  2YVX A;  3SWH A;  1RKT A;  3ANP A;  2UXH A;  3DCF A; 
#chains in the Genus database with same CATH homology
 1JT0 A;  3TP0 A;  4GCT A;  1ZKG A;  4D5C A;  4G12 A;  2QCO A;  1RKW A;  3NI7 A;  2I10 A;  3HGY A;  2NP5 A;  3BRU A;  5FKK A;  3SDG A;  3B6A A;  4W97 A;  3COL A;  5CW8 A;  3LOC A;  4JNN A;  2IAI A;  3LSR A;  2QWT A;  5F08 A;  1ORK A;  2QKO A;  5DAJ A;  3BNI A;  5FMP A;  3LSJ A;  5GPA A;  1JUM A;  3QBM A;  4GCL A;  3BR0 A;  5EFY A;  2ZB9 A;  2GEN A;  3KKC A;  3FIW A;  3BCG A;  2XGE A;  3IUV A;  4NEL A;  2IU5 A;  3O60 A;  2HXI A;  3KKD A;  1QVT A;  3ZQH A;  5EZG A;  2XGC A;  2QIB A;  2XPW A;  3BTI A;  2X6O A;  5GP9 A;  3FK7 A;  3C07 A;  3JSJ A;  4D7M A;  3HTI A;  4X1E A;  2ID3 A;  3QKX A;  3V6G A;  4M3E A;  5K7Z A;  3VVY A;  3G1L A;  3F0C A;  3G7R A;  2XB5 A;  2HYT A;  4NN1 A;  3S5R A;  5J3L A;  2Y30 A;  4ME9 A;  3CWR A;  1UI6 A;  2OI8 A;  2EH3 A;  1A6I A;  2XRL A;  2FJ1 A;  3ANG A;  3QPL A;  3HE0 A;  4ABZ A;  2DG8 A;  2HQ5 A;  2XPV A;  3CJD A;  3WHB A;  4JKZ A;  3P9T A;  3VVX A;  3HIM A;  2PZ9 A;  4GCK A;  1SGM A;  1JUS A;  2WUI A;  4AF5 A;  1U9N A;  3KNW A;  2OPT A;  2UXU A;  2D6Y A;  3BTL A;  3NNR A;  5EYR A;  3Q3S A;  5HAW A;  3LJL A;  3NRG A;  3VUQ A;  3AQS A;  3PM1 A;  5F27 A;  4DW6 A;  2Y31 A;  5D19 A;  3ZQF A;  3ZQG A;  3RD3 A;  4M3F A;  3DEW A;  1U9O A;  2NP3 A;  3VW0 A;  1Z0X A;  4W1U A;  4CGR A;  3BTJ A;  5F04 A;  5K7F A;  3ZQI A;  1T33 A;  5J1U A;  3AQT A;  3BTC A;  3IH2 A;  2ID6 A;  4MO7 A;  1UI5 A;  4MXM A;  5K7H A;  4ACI A;  4D5F A;  3BR5 A;  2GFN A;  3NXC A;  1T56 A;  4M3B A;  3VOX A;  4JL3 A;  3G56 A;  1VI0 A;  3MVP A;  5AQC A;  5FKO A;  1JUP A;  4KWA A;  1QVU A;  5HBU A;  4I6Z A;  3GEU A;  5IOY A;  5CXI A;  5FGL A;  2YVE A;  3O8H A;  2UXI A;  3LHQ A;  3BJB A;  5FHP A;  2HYJ A;  1ZK8 A;  3Q0W A;  2ZCX A;  2ZCM A;  4L62 A;  2VKE A;  3LWJ A;  3CCY A;  3EUP A;  4B1R A;  2TRT A;  5FKL A;  3MNL A;  3IH4 A;  1QPI A;  4JYK A;  2VPR A;  3G1O A;  4I76 A;  4UDS A;  3LSP A;  5J1Y A;  3BR1 A;  4GFL A;  3QQA A;  3PPB A;  2VKV A;  2FQ4 A;  2G7L A;  5IPA A;  2G0E A;  2O7T A;  2PBX A;  4PXI A;  2TCT A;  3V78 A;  3T6N A;  2NS8 A;  3VPR A;  3NPI A;  3HTA A;  2WV1 A;  2V57 A;  5IP6 A;  2Y2Z A;  4GFK A;  1Z77 A;  1RPW A;  3Q0V A;  1JTX A;  4V2G A;  2UXP A;  2O7O A;  3TP3 A;  2Q24 A;  1BJZ A;  5F0F A;  5FKN A;  3VP5 A;  1JTY A;  4V2F A;  5K58 A;  2WGB A;  3BR2 A;  2QOP A;  4B3A A;  2DG7 A;  5EZH A;  5F0C A;  3BQZ A;  3DPJ A;  2W53 A;  2XPU A;  2G7S A;  2RHA A;  3Q0U A;  3FRQ A;  3ZQL A;  3CDL A;  1JT6 A;  3ON2 A;  3BT9 A;  2QTQ A;  5CXG A;  3PAS A;  4HKU A;  5HSZ A;  3VVZ A;  2G7G A;  2X9D A;  3BQY A;  2IEK A;  3GZI A;  3VOK A;  3ON4 A;  2XDN A;  2JJ7 A;  3SFI A;  2G3B A;  4ICH A;  2UXO A;  5C4Y A;  3G1M A;  3HTH A;  5GPC A;  5J1R A;  3C2B A;  3KZ9 A;  2FBQ A;  3O8G A;  4XK4 A;  2GUH A;  2YVH A;  2HXO A;  2GBY A;  3BHQ A;  2NX4 A;  3WHC A;  2IBD A;  3FK6 A;  5D18 A;  4D7N A;  3HTJ A;  2XGD A;  3QPS A;  3HGG A;  2FX0 A;  5H9T A;  5IOZ A;  5D1R A;  4AC6 A;  2FD5 A;  2ZOY A;  3VW1 A;  3E7Q A;  4YZE A;  2ZCN A;  5F1J A;  2HKU A;  3RH2 A;  3CRJ A;  4M3G A;  4AUX A;  2OER A;  3B6C A;  2OF7 A;  3F1B A;  2REK A;  2RAS A;  2F07 A;  4AC0 A;  2DTZ A;  2RAE A;  3VW2 A;  3VIB A;  3IH3 A;  5F0H A;  3EGQ A;  2NS7 A;  3B81 A;  2JK3 A;  3BR6 A;  4M3D A;  5FKM A;  3BR3 A;  4MK6 A;  2ZOZ A;  1RKT A;  3ANP A;  2UXH A;  3DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...