3O60A

The crystal structure of lin0861 from listeria innocua to 2.8a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
NYVKVHQPLNVDLRTQKTQTKLYTVLERFYVEDRTFESISIKDLCEQARVSRATFYRHHKEIIQVIEVQILRTMQYFSLEFDQIILTKENIQRLILRTIQKNPLLFQVIFWSRAENIFIDVVSGEILRISLLKEVSFSDSKFMPNCFARMILSLAAEIQQSNKDYTNDQLVELIQEAARFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin0861 protein
publication title The Crystal Structure of Lin0861 from Listeria innocua to 2.8A
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3o60A00
1ZK8A 3HGYA 3V6GA 3BTJA 2HKUA 3EUPA 4MK6A 4W1UA 2O7OA 1RKTA 3BR5A 2XPWA 1A6IA 3IH4A 2G3BA 3BTLA 5IPAA 2YVHA 3VVXA 2JK3A 1QPIA 3C07A 4JYKA 4JL3A 3IH3A 3BHQA 4UDSA 3HGGA 2HXOA 5EZHA 5D19A 3ZQHA 4M3EA 3V78A 3KZ9A 2DG7A 4GFLA 3EGQA 1RKWA 3BT9A 5CW8A 2UXPA 4NELA 2G0EA 2IBDA 3O60A 3VIBA 3JSJA 2EH3A 3NRGA 4V2FA 5IP6A 3G56A 2DTZA 4X1EA 3Q3SA 4ICHA 2JJ7A 1QVTA 3NPIA 3CCYA 3BR0A 5HSZA 3VP5A 3G1OA 2RHAA 3HE0A 3FK6A 3B6AA 2NS7A 4AC6A 2DG8A 1VI0A 3ON4A 4GFKA 2WUIA 2XGEA 2ZB9A 3Q0VA 2ZCXA 3PASA 3PPBA 2UXUA 3LOCA 4M3BA 4MO7A 3HTJA 3CWRA 3RD3A 4MXMA 4W97A 4GCKA 4YZEA 1JUPA 3VVZA 1QVUA 4I6ZA 3VW1A 3MVPA 1SGMA 3VW0A 1Z0XA 3COLA 4PXIA 3P9TA 5CXGA 3AQSA 4M3GA 3C2BA 3PM1A 5EFYA 3ANGA 1ZKGA 2OPTA 5D18A 3QQAA 3Q0UA 1T33A 3KNWA 2VKEA 1JT0A 2HYJA 2Y2ZA 1ORKA 3WHBA 2QTQA 3LHQA 5DAJA 3KKDA 3DEWA 2Y31A 3CRJA 4JNNA 4JKZA 5CXIA 4G12A 2OERA 3ZQLA 3WHCA 2IEKA 2RAEA 3NI7A 3F1BA 2HQ5A 2QWTA 3S5RA 3LWJA 4ACIA 2XPVA 3HIMA 4AUXA 2HXIA 3ON2A 2F07A 3QKXA 2FQ4A 2X9DA 5K7HA 1JUSA 2REKA 1JTXA 3VVYA 3BR1A 4GCLA 1U9OA 3FIWA 2PZ9A 2XGDA 3Q0WA 1JT6A 2ZOZA 2ZCMA 2V57A 1U9NA 3VW2A 2NS8A 2ID6A 3FRQA 2GUHA 2HYTA 2GENA 2RASA 2WV1A 2VPRA 3DPJA 3NNRA 2X6OA 5FKKA 2PBXA 3GZIA 5F08A 3BR6A 2D6YA 3ANPA 4B1RA 4D7MA 2QCOA 3LSRA 3BQYA 2UXOA 5FGLA 4M3FA 2TRTA 3TP3A 3B6CA 3QBMA 1RPWA 3IH2A 2NP3A 2WGBA 5F04A 3BTIA 3HTIA 3BNIA 2OI8A 4D7NA 3LSPA 2FX0A 3BTCA 1UI5A 4D5CA 1UI6A 1BJZA 3BR3A 2QIBA 3MNLA 1JTYA 3ZQGA 4AF5A 5K7FA 5F0CA 2FJ1A 5IOYA 4ME9A 3NXCA 5J1UA 2Q24A 3E7QA 2G7LA 2GFNA 4B3AA 3FK7A 3CDLA 4L62A 3F0CA 2VKVA 4XK4A 3HTHA 2I10A 3CJDA 3VUQA 3LSJA 3QPLA 3ZQIA 3G1LA 2XB5A 4I76A 2IU5A 5K58A 5FMPA 2IAIA 3HTAA 5F1JA 3RH2A 2NP5A 5GPAA 3BRUA 3LJLA 5HBUA 3BCGA 2G7GA 2UXHA 3G7RA 5D1RA 5FKMA 2GBYA 3O8HA 2FBQA 5FKOA 3DCFA 3VPRA 2XGCA 3IUVA 1JUMA 5AQCA 3G1MA 3O8GA 5GP9A 4D5FA 4M3DA 5FHPA 2XRLA 2OF7A 4AC0A 2W53A 5F27A 2Y30A 4GCTA 2FD5A 2QOPA 5J1YA 5H9TA 3GEUA 3SDGA 5HAWA 5J3LA 3BR2A 2ZCNA 3BJBA 5F0FA 3SFIA 1Z77A 5FKLA 5F0HA 4ABZA 2YVEA 5K7ZA 5IOZA 3VOKA 3ZQFA 5GPCA 2ID3A 2UXIA 2TCTA 4V2GA 5J1RA 5FKNA 5EYRA 3B81A 5C4YA 4CGRA 3TP0A 2O7TA 2ZOYA 2QKOA 3T6NA 4DW6A 2XPUA 3KKCA 5EZGA 2XDNA 2NX4A 2G7SA 1T56A 3AQTA 3BQZA 4NN1A 4HKUA 3QPSA 3VOXA 4KWAA
chains in the Genus database with same CATH superfamily
1ZK8A 3HGYA 3V6GA 3BTJA 2HKUA 3EUPA 4MK6A 4W1UA 2O7OA 1RKTA 3BR5A 2XPWA 1A6IA 3IH4A 2G3BA 3BTLA 5IPAA 2YVHA 3VVXA 2JK3A 1QPIA 3C07A 4JYKA 4JL3A 3IH3A 2R7RA 3BHQA 4UDSA 3HGGA 2HXOA 3NS4A 5EZHA 5D19A 3ZQHA 4M3EA 3V78A 3KZ9A 2DG7A 4GFLA 3EGQA 3K8PC 1RKWA 2ZY9A 3BT9A 5CW8A 2UXPA 4NELA 2G0EA 2IBDA 4C2MA 3O60A 3VIBA 3JSJA 2EH3A 3NRGA 4V2FA 5IP6A 2A2FX 2YVXA 2R7VA 3G56A 2DTZA 4X1EA 3Q3SA 2B3WA 4ICHA 2JJ7A 1QVTA 2R7UA 3NPIA 3CCYA 3BR0A 5HSZA 3VP5A 3G1OA 2RHAA 3HE0A 3FK6A 3B6AA 2NS7A 4AC6A 2B1EA 1VI0A 2DG8A 3ON4A 4GFKA 2WUIA 2XGEA 2ZB9A 3Q0VA 2ZCXA 3PASA 3PPBA 2UXUA 3LOCA 4M3BA 4OD4A 4MO7A 3HTJA 3CWRA 2FJI1 3RD3A 4MXMA 4W97A 4GCKA 4YZEA 1JUPA 3VVZA 1QVUA 3VTIA 4I6ZA 3VW1A 3MVPA 1SGMA 3VW0A 1Z0XA 3COLA 4PXIA 3P9TA 5CXGA 3AQSA 4M3GA 3C2BA 3PM1A 5EFYA 3ANGA 1ZKGA 2OPTA 5D18A 3QQAA 3Q0UA 1T33A 3KNWA 4U9NA 2VKEA 1JT0A 2HYJA 2Y2ZA 1ORKA 3WHBA 2QTQA 3LHQA 5DAJA 3KKDA 3DEWA 2Y31A 3CRJA 4JNNA 4JKZA 5CXIA 4G12A 2OERA 3ZQLA 3WHCA 2IEKA 2RAEA 3NI7A 3F1BA 2HQ5A 2QWTA 3S5RA 3LWJA 4ACIA 2XPVA 3HIMA 2R7QA 4AUXA 2HXIA 3ON2A 2F07A 3QKXA 2FQ4A 2X9DA 5K7HA 1JUSA 2REKA 1JTXA 3VVYA 3BR1A 2R7OA 4GCLA 1U9OA 3FIWA 2PZ9A 2XGDA 3Q0WA 1JT6A 2ZOZA 2ZCMA 2V57A 1U9NA 3VW2A 2NS8A 2ID6A 3FRQA 2GUHA 3DU6A 2HYTA 2GENA 2RASA 2WV1A 2VPRA 3DPJA 3DU5A 3NNRA 2X6OA 5FKKA 2PBXA 3GZIA 5F08A 3BR6A 4DVYP 2D6YA 3ANPA 4B1RA 4D7MA 2QCOA 4OD5A 3LSRA 3BQYA 2UXOA 5FGLA 4M3FA 2TRTA 3TP3A 3B6CA 3QBMA 1RPWA 3IH2A 2NP3A 2WGBA 5F04A 3BTIA 3HTIA 3BNIA 2OI8A 4D7NA 3LSPA 2FX0A 3BTCA 1UI5A 4D5CA 1UI6A 1BJZA 3BR3A 2QIBA 3MNLA 1JTYA 3ZQGA 4AF5A 5K7FA 5F0CA 2FJ1A 3SWHA 5IOYA 4ME9A 3NXCA 5J1UA 2Q24A 3E7QA 2G7LA 2GFNA 4B3AA 2R7TA 3FK7A 3CDLA 4L62A 3F0CA 2VKVA 4XK4A 3HTHA 2I10A 3CJDA 2R7SA 4WIBA 3VUQA 3LSJA 3QPLA 5CQGA 3ZQIA 3G1LA 2XB5A 4I76A 2IU5A 5K58A 5FMPA 2IAIA 3HTAA 5F1JA 3RH2A 2NP5A 5GPAA 3BRUA 3LJLA 3FHNA 5HBUA 2R7WA 3BCGA 2G7GA 2UXHA 3G7RA 5D1RA 5FKMA 2GBYA 3O8HA 2FBQA 5FKOA 3DCFA 3VPRA 2XGCA 3IUVA 1JUMA 5AQCA 3G1MA 3O8GA 5GP9A 4D5FA 4M3DA 5FHPA 2XRLA 2OF7A 4AC0A 2W53A 5F27A 2Y30A 4GCTA 4U9LA 2FD5A 2QOPA 5J1YA 5H9TA 3GEUA 3SDGA 5HAWA 5J3LA 3KYLA 2R7XA 3BR2A 2ZCNA 3BJBA 5F0FA 3SFIA 1Z77A 5FKLA 5F0HA 4ABZA 2YVEA 5K7ZA 5IOZA 3VOKA 3ZQFA 5GPCA 2ID3A 2UXIA 2TCTA 4V2GA 5J1RA 5FKNA 5EYRA 3B81A 5C4YA 4CGRA 3TP0A 2O7TA 2ZOYA 4IRVA 2QKOA 3T6NA 4DW6A 2XPUA 3KKCA 5EZGA 2XDNA 2NX4A 2PFVA 2G7SA 1T56A 3AQTA 3BQZA 4NN1A 4HKUA 3QPSA 3VOXA 4KWAA
chains in the Genus database with same CATH topology
1ZK8A 3HGYA 3V6GA 3BTJA 2HKUA 3EUPA 4MK6A 4W1UA 2O7OA 1RKTA 3BR5A 2XPWA 1A6IA 3IH4A 2G3BA 3BTLA 5IPAA 2YVHA 3VVXA 2JK3A 1QPIA 3C07A 4JYKA 4JL3A 3IH3A 3BHQA 4UDSA 3HGGA 2HXOA 5EZHA 5D19A 3ZQHA 4M3EA 3V78A 3KZ9A 2DG7A 4GFLA 3EGQA 1RKWA 3BT9A 5CW8A 2UXPA 4NELA 2G0EA 2IBDA 3O60A 3VIBA 3JSJA 2EH3A 3NRGA 4V2FA 5IP6A 3G56A 2DTZA 4X1EA 3Q3SA 4ICHA 2JJ7A 1QVTA 3NPIA 3CCYA 3BR0A 5HSZA 3VP5A 3G1OA 2RHAA 3HE0A 3FK6A 3B6AA 2NS7A 4AC6A 2DG8A 1VI0A 3ON4A 4GFKA 2WUIA 2XGEA 2ZB9A 3Q0VA 2ZCXA 3PASA 3PPBA 2UXUA 3LOCA 4M3BA 4MO7A 3HTJA 3CWRA 3RD3A 4MXMA 4W97A 4GCKA 4YZEA 1JUPA 3VVZA 1QVUA 4I6ZA 3VW1A 3MVPA 1SGMA 3VW0A 1Z0XA 3COLA 4PXIA 3P9TA 5CXGA 3AQSA 4M3GA 3C2BA 3PM1A 5EFYA 3ANGA 1ZKGA 2OPTA 5D18A 3QQAA 3Q0UA 1T33A 3KNWA 2VKEA 1JT0A 2HYJA 2Y2ZA 1ORKA 3WHBA 2QTQA 3LHQA 5DAJA 3KKDA 3DEWA 2Y31A 3CRJA 4JNNA 4JKZA 5CXIA 4G12A 2OERA 3ZQLA 3WHCA 2IEKA 2RAEA 3NI7A 3F1BA 2HQ5A 2QWTA 3S5RA 3LWJA 4ACIA 2XPVA 3HIMA 4AUXA 2HXIA 3ON2A 2F07A 3QKXA 2FQ4A 2X9DA 5K7HA 1JUSA 2REKA 1JTXA 3VVYA 3BR1A 4GCLA 1U9OA 3FIWA 2PZ9A 2XGDA 3Q0WA 1JT6A 2ZOZA 2ZCMA 2V57A 1U9NA 3VW2A 2NS8A 2ID6A 3FRQA 2GUHA 2HYTA 2GENA 2RASA 2WV1A 2VPRA 3DPJA 3NNRA 2X6OA 5FKKA 2PBXA 3GZIA 5F08A 3BR6A 2D6YA 3ANPA 4B1RA 4D7MA 2QCOA 3LSRA 3BQYA 2UXOA 5FGLA 4M3FA 2TRTA 3TP3A 3B6CA 3QBMA 1RPWA 3IH2A 2NP3A 2WGBA 5F04A 3BTIA 3HTIA 3BNIA 2OI8A 4D7NA 3LSPA 2FX0A 3BTCA 1UI5A 4D5CA 1UI6A 1BJZA 3BR3A 2QIBA 3MNLA 1JTYA 3ZQGA 4AF5A 5K7FA 5F0CA 2FJ1A 5IOYA 4ME9A 3NXCA 5J1UA 2Q24A 3E7QA 2G7LA 2GFNA 4B3AA 3FK7A 3CDLA 4L62A 3F0CA 2VKVA 4XK4A 3HTHA 2I10A 3CJDA 3VUQA 3LSJA 3QPLA 3ZQIA 3G1LA 2XB5A 4I76A 2IU5A 5K58A 5FMPA 2IAIA 3HTAA 5F1JA 3RH2A 2NP5A 5GPAA 3BRUA 3LJLA 5HBUA 3BCGA 2G7GA 2UXHA 3G7RA 5D1RA 5FKMA 2GBYA 3O8HA 2FBQA 5FKOA 3DCFA 3VPRA 2XGCA 3IUVA 1JUMA 5AQCA 3G1MA 3O8GA 5GP9A 4D5FA 4M3DA 5FHPA 2XRLA 2OF7A 4AC0A 2W53A 5F27A 2Y30A 4GCTA 2FD5A 2QOPA 5J1YA 5H9TA 3GEUA 3SDGA 5HAWA 5J3LA 3BR2A 2ZCNA 3BJBA 5F0FA 3SFIA 1Z77A 5FKLA 5F0HA 4ABZA 2YVEA 5K7ZA 5IOZA 3VOKA 3ZQFA 5GPCA 2ID3A 2UXIA 2TCTA 4V2GA 5J1RA 5FKNA 5EYRA 3B81A 5C4YA 4CGRA 3TP0A 2O7TA 2ZOYA 2QKOA 3T6NA 4DW6A 2XPUA 3KKCA 5EZGA 2XDNA 2NX4A 2G7SA 1T56A 3AQTA 3BQZA 4NN1A 4HKUA 3QPSA 3VOXA 4KWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK8 A;  3HGY A;  3V6G A;  3BTJ A;  2HKU A;  3EUP A;  4MK6 A;  4W1U A;  2O7O A;  1RKT A;  3BR5 A;  2XPW A;  1A6I A;  3IH4 A;  2G3B A;  3BTL A;  5IPA A;  2YVH A;  3VVX A;  2JK3 A;  1QPI A;  3C07 A;  4JYK A;  4JL3 A;  3IH3 A;  3BHQ A;  4UDS A;  3HGG A;  2HXO A;  5EZH A;  5D19 A;  3ZQH A;  4M3E A;  3V78 A;  3KZ9 A;  2DG7 A;  4GFL A;  3EGQ A;  1RKW A;  3BT9 A;  5CW8 A;  2UXP A;  4NEL A;  2G0E A;  2IBD A;  3O60 A;  3VIB A;  3JSJ A;  2EH3 A;  3NRG A;  4V2F A;  5IP6 A;  3G56 A;  2DTZ A;  4X1E A;  3Q3S A;  4ICH A;  2JJ7 A;  1QVT A;  3NPI A;  3CCY A;  3BR0 A;  5HSZ A;  3VP5 A;  3G1O A;  2RHA A;  3HE0 A;  3FK6 A;  3B6A A;  2NS7 A;  4AC6 A;  2DG8 A;  1VI0 A;  3ON4 A;  4GFK A;  2WUI A;  2XGE A;  2ZB9 A;  3Q0V A;  2ZCX A;  3PAS A;  3PPB A;  2UXU A;  3LOC A;  4M3B A;  4MO7 A;  3HTJ A;  3CWR A;  3RD3 A;  4MXM A;  4W97 A;  4GCK A;  4YZE A;  1JUP A;  3VVZ A;  1QVU A;  4I6Z A;  3VW1 A;  3MVP A;  1SGM A;  3VW0 A;  1Z0X A;  3COL A;  4PXI A;  3P9T A;  5CXG A;  3AQS A;  4M3G A;  3C2B A;  3PM1 A;  5EFY A;  3ANG A;  1ZKG A;  2OPT A;  5D18 A;  3QQA A;  3Q0U A;  1T33 A;  3KNW A;  2VKE A;  1JT0 A;  2HYJ A;  2Y2Z A;  1ORK A;  3WHB A;  2QTQ A;  3LHQ A;  5DAJ A;  3KKD A;  3DEW A;  2Y31 A;  3CRJ A;  4JNN A;  4JKZ A;  5CXI A;  4G12 A;  2OER A;  3ZQL A;  3WHC A;  2IEK A;  2RAE A;  3NI7 A;  3F1B A;  2HQ5 A;  2QWT A;  3S5R A;  3LWJ A;  4ACI A;  2XPV A;  3HIM A;  4AUX A;  2HXI A;  3ON2 A;  2F07 A;  3QKX A;  2FQ4 A;  2X9D A;  5K7H A;  1JUS A;  2REK A;  1JTX A;  3VVY A;  3BR1 A;  4GCL A;  1U9O A;  3FIW A;  2PZ9 A;  2XGD A;  3Q0W A;  1JT6 A;  2ZOZ A;  2ZCM A;  2V57 A;  1U9N A;  3VW2 A;  2NS8 A;  2ID6 A;  3FRQ A;  2GUH A;  2HYT A;  2GEN A;  2RAS A;  2WV1 A;  2VPR A;  3DPJ A;  3NNR A;  2X6O A;  5FKK A;  2PBX A;  3GZI A;  5F08 A;  3BR6 A;  2D6Y A;  3ANP A;  4B1R A;  4D7M A;  2QCO A;  3LSR A;  3BQY A;  2UXO A;  5FGL A;  4M3F A;  2TRT A;  3TP3 A;  3B6C A;  3QBM A;  1RPW A;  3IH2 A;  2NP3 A;  2WGB A;  5F04 A;  3BTI A;  3HTI A;  3BNI A;  2OI8 A;  4D7N A;  3LSP A;  2FX0 A;  3BTC A;  1UI5 A;  4D5C A;  1UI6 A;  1BJZ A;  3BR3 A;  2QIB A;  3MNL A;  1JTY A;  3ZQG A;  4AF5 A;  5K7F A;  5F0C A;  2FJ1 A;  5IOY A;  4ME9 A;  3NXC A;  5J1U A;  2Q24 A;  3E7Q A;  2G7L A;  2GFN A;  4B3A A;  3FK7 A;  3CDL A;  4L62 A;  3F0C A;  2VKV A;  4XK4 A;  3HTH A;  2I10 A;  3CJD A;  3VUQ A;  3LSJ A;  3QPL A;  3ZQI A;  3G1L A;  2XB5 A;  4I76 A;  2IU5 A;  5K58 A;  5FMP A;  2IAI A;  3HTA A;  5F1J A;  3RH2 A;  2NP5 A;  5GPA A;  3BRU A;  3LJL A;  5HBU A;  3BCG A;  2G7G A;  2UXH A;  3G7R A;  5D1R A;  5FKM A;  2GBY A;  3O8H A;  2FBQ A;  5FKO A;  3DCF A;  3VPR A;  2XGC A;  3IUV A;  1JUM A;  5AQC A;  3G1M A;  3O8G A;  5GP9 A;  4D5F A;  4M3D A;  5FHP A;  2XRL A;  2OF7 A;  4AC0 A;  2W53 A;  5F27 A;  2Y30 A;  4GCT A;  2FD5 A;  2QOP A;  5J1Y A;  5H9T A;  3GEU A;  3SDG A;  5HAW A;  5J3L A;  3BR2 A;  2ZCN A;  3BJB A;  5F0F A;  3SFI A;  1Z77 A;  5FKL A;  5F0H A;  4ABZ A;  2YVE A;  5K7Z A;  5IOZ A;  3VOK A;  3ZQF A;  5GPC A;  2ID3 A;  2UXI A;  2TCT A;  4V2G A;  5J1R A;  5FKN A;  5EYR A;  3B81 A;  5C4Y A;  4CGR A;  3TP0 A;  2O7T A;  2ZOY A;  2QKO A;  3T6N A;  4DW6 A;  2XPU A;  3KKC A;  5EZG A;  2XDN A;  2NX4 A;  2G7S A;  1T56 A;  3AQT A;  3BQZ A;  4NN1 A;  4HKU A;  3QPS A;  3VOX A;  4KWA A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  3HGY A;  3V6G A;  3BTJ A;  2HKU A;  3EUP A;  4MK6 A;  4W1U A;  2O7O A;  1RKT A;  3BR5 A;  2XPW A;  1A6I A;  3IH4 A;  2G3B A;  3BTL A;  5IPA A;  2YVH A;  3VVX A;  2JK3 A;  1QPI A;  3C07 A;  4JYK A;  4JL3 A;  3IH3 A;  2R7R A;  3BHQ A;  4UDS A;  3HGG A;  2HXO A;  3NS4 A;  5EZH A;  5D19 A;  3ZQH A;  4M3E A;  3V78 A;  3KZ9 A;  2DG7 A;  4GFL A;  3EGQ A;  3K8P C;  1RKW A;  2ZY9 A;  3BT9 A;  5CW8 A;  2UXP A;  4NEL A;  2G0E A;  2IBD A;  4C2M A;  3O60 A;  3VIB A;  3JSJ A;  2EH3 A;  3NRG A;  4V2F A;  5IP6 A;  2A2F X;  2YVX A;  2R7V A;  3G56 A;  2DTZ A;  4X1E A;  3Q3S A;  2B3W A;  4ICH A;  2JJ7 A;  1QVT A;  2R7U A;  3NPI A;  3CCY A;  3BR0 A;  5HSZ A;  3VP5 A;  3G1O A;  2RHA A;  3HE0 A;  3FK6 A;  3B6A A;  2NS7 A;  4AC6 A;  2B1E A;  1VI0 A;  2DG8 A;  3ON4 A;  4GFK A;  2WUI A;  2XGE A;  2ZB9 A;  3Q0V A;  2ZCX A;  3PAS A;  3PPB A;  2UXU A;  3LOC A;  4M3B A;  4OD4 A;  4MO7 A;  3HTJ A;  3CWR A;  2FJI 1;  3RD3 A;  4MXM A;  4W97 A;  4GCK A;  4YZE A;  1JUP A;  3VVZ A;  1QVU A;  3VTI A;  4I6Z A;  3VW1 A;  3MVP A;  1SGM A;  3VW0 A;  1Z0X A;  3COL A;  4PXI A;  3P9T A;  5CXG A;  3AQS A;  4M3G A;  3C2B A;  3PM1 A;  5EFY A;  3ANG A;  1ZKG A;  2OPT A;  5D18 A;  3QQA A;  3Q0U A;  1T33 A;  3KNW A;  4U9N A;  2VKE A;  1JT0 A;  2HYJ A;  2Y2Z A;  1ORK A;  3WHB A;  2QTQ A;  3LHQ A;  5DAJ A;  3KKD A;  3DEW A;  2Y31 A;  3CRJ A;  4JNN A;  4JKZ A;  5CXI A;  4G12 A;  2OER A;  3ZQL A;  3WHC A;  2IEK A;  2RAE A;  3NI7 A;  3F1B A;  2HQ5 A;  2QWT A;  3S5R A;  3LWJ A;  4ACI A;  2XPV A;  3HIM A;  2R7Q A;  4AUX A;  2HXI A;  3ON2 A;  2F07 A;  3QKX A;  2FQ4 A;  2X9D A;  5K7H A;  1JUS A;  2REK A;  1JTX A;  3VVY A;  3BR1 A;  2R7O A;  4GCL A;  1U9O A;  3FIW A;  2PZ9 A;  2XGD A;  3Q0W A;  1JT6 A;  2ZOZ A;  2ZCM A;  2V57 A;  1U9N A;  3VW2 A;  2NS8 A;  2ID6 A;  3FRQ A;  2GUH A;  3DU6 A;  2HYT A;  2GEN A;  2RAS A;  2WV1 A;  2VPR A;  3DPJ A;  3DU5 A;  3NNR A;  2X6O A;  5FKK A;  2PBX A;  3GZI A;  5F08 A;  3BR6 A;  4DVY P;  2D6Y A;  3ANP A;  4B1R A;  4D7M A;  2QCO A;  4OD5 A;  3LSR A;  3BQY A;  2UXO A;  5FGL A;  4M3F A;  2TRT A;  3TP3 A;  3B6C A;  3QBM A;  1RPW A;  3IH2 A;  2NP3 A;  2WGB A;  5F04 A;  3BTI A;  3HTI A;  3BNI A;  2OI8 A;  4D7N A;  3LSP A;  2FX0 A;  3BTC A;  1UI5 A;  4D5C A;  1UI6 A;  1BJZ A;  3BR3 A;  2QIB A;  3MNL A;  1JTY A;  3ZQG A;  4AF5 A;  5K7F A;  5F0C A;  2FJ1 A;  3SWH A;  5IOY A;  4ME9 A;  3NXC A;  5J1U A;  2Q24 A;  3E7Q A;  2G7L A;  2GFN A;  4B3A A;  2R7T A;  3FK7 A;  3CDL A;  4L62 A;  3F0C A;  2VKV A;  4XK4 A;  3HTH A;  2I10 A;  3CJD A;  2R7S A;  4WIB A;  3VUQ A;  3LSJ A;  3QPL A;  5CQG A;  3ZQI A;  3G1L A;  2XB5 A;  4I76 A;  2IU5 A;  5K58 A;  5FMP A;  2IAI A;  3HTA A;  5F1J A;  3RH2 A;  2NP5 A;  5GPA A;  3BRU A;  3LJL A;  3FHN A;  5HBU A;  2R7W A;  3BCG A;  2G7G A;  2UXH A;  3G7R A;  5D1R A;  5FKM A;  2GBY A;  3O8H A;  2FBQ A;  5FKO A;  3DCF A;  3VPR A;  2XGC A;  3IUV A;  1JUM A;  5AQC A;  3G1M A;  3O8G A;  5GP9 A;  4D5F A;  4M3D A;  5FHP A;  2XRL A;  2OF7 A;  4AC0 A;  2W53 A;  5F27 A;  2Y30 A;  4GCT A;  4U9L A;  2FD5 A;  2QOP A;  5J1Y A;  5H9T A;  3GEU A;  3SDG A;  5HAW A;  5J3L A;  3KYL A;  2R7X A;  3BR2 A;  2ZCN A;  3BJB A;  5F0F A;  3SFI A;  1Z77 A;  5FKL A;  5F0H A;  4ABZ A;  2YVE A;  5K7Z A;  5IOZ A;  3VOK A;  3ZQF A;  5GPC A;  2ID3 A;  2UXI A;  2TCT A;  4V2G A;  5J1R A;  5FKN A;  5EYR A;  3B81 A;  5C4Y A;  4CGR A;  3TP0 A;  2O7T A;  2ZOY A;  4IRV A;  2QKO A;  3T6N A;  4DW6 A;  2XPU A;  3KKC A;  5EZG A;  2XDN A;  2NX4 A;  2PFV A;  2G7S A;  1T56 A;  3AQT A;  3BQZ A;  4NN1 A;  4HKU A;  3QPS A;  3VOX A;  4KWA A; 
#chains in the Genus database with same CATH homology
 1ZK8 A;  3HGY A;  3V6G A;  3BTJ A;  2HKU A;  3EUP A;  4MK6 A;  4W1U A;  2O7O A;  1RKT A;  3BR5 A;  2XPW A;  1A6I A;  3IH4 A;  2G3B A;  3BTL A;  5IPA A;  2YVH A;  3VVX A;  2JK3 A;  1QPI A;  3C07 A;  4JYK A;  4JL3 A;  3IH3 A;  3BHQ A;  4UDS A;  3HGG A;  2HXO A;  5EZH A;  5D19 A;  3ZQH A;  4M3E A;  3V78 A;  3KZ9 A;  2DG7 A;  4GFL A;  3EGQ A;  1RKW A;  3BT9 A;  5CW8 A;  2UXP A;  4NEL A;  2G0E A;  2IBD A;  3O60 A;  3VIB A;  3JSJ A;  2EH3 A;  3NRG A;  4V2F A;  5IP6 A;  3G56 A;  2DTZ A;  4X1E A;  3Q3S A;  4ICH A;  2JJ7 A;  1QVT A;  3NPI A;  3CCY A;  3BR0 A;  5HSZ A;  3VP5 A;  3G1O A;  2RHA A;  3HE0 A;  3FK6 A;  3B6A A;  2NS7 A;  4AC6 A;  2DG8 A;  1VI0 A;  3ON4 A;  4GFK A;  2WUI A;  2XGE A;  2ZB9 A;  3Q0V A;  2ZCX A;  3PAS A;  3PPB A;  2UXU A;  3LOC A;  4M3B A;  4MO7 A;  3HTJ A;  3CWR A;  3RD3 A;  4MXM A;  4W97 A;  4GCK A;  4YZE A;  1JUP A;  3VVZ A;  1QVU A;  4I6Z A;  3VW1 A;  3MVP A;  1SGM A;  3VW0 A;  1Z0X A;  3COL A;  4PXI A;  3P9T A;  5CXG A;  3AQS A;  4M3G A;  3C2B A;  3PM1 A;  5EFY A;  3ANG A;  1ZKG A;  2OPT A;  5D18 A;  3QQA A;  3Q0U A;  1T33 A;  3KNW A;  2VKE A;  1JT0 A;  2HYJ A;  2Y2Z A;  1ORK A;  3WHB A;  2QTQ A;  3LHQ A;  5DAJ A;  3KKD A;  3DEW A;  2Y31 A;  3CRJ A;  4JNN A;  4JKZ A;  5CXI A;  4G12 A;  2OER A;  3ZQL A;  3WHC A;  2IEK A;  2RAE A;  3NI7 A;  3F1B A;  2HQ5 A;  2QWT A;  3S5R A;  3LWJ A;  4ACI A;  2XPV A;  3HIM A;  4AUX A;  2HXI A;  3ON2 A;  2F07 A;  3QKX A;  2FQ4 A;  2X9D A;  5K7H A;  1JUS A;  2REK A;  1JTX A;  3VVY A;  3BR1 A;  4GCL A;  1U9O A;  3FIW A;  2PZ9 A;  2XGD A;  3Q0W A;  1JT6 A;  2ZOZ A;  2ZCM A;  2V57 A;  1U9N A;  3VW2 A;  2NS8 A;  2ID6 A;  3FRQ A;  2GUH A;  2HYT A;  2GEN A;  2RAS A;  2WV1 A;  2VPR A;  3DPJ A;  3NNR A;  2X6O A;  5FKK A;  2PBX A;  3GZI A;  5F08 A;  3BR6 A;  2D6Y A;  3ANP A;  4B1R A;  4D7M A;  2QCO A;  3LSR A;  3BQY A;  2UXO A;  5FGL A;  4M3F A;  2TRT A;  3TP3 A;  3B6C A;  3QBM A;  1RPW A;  3IH2 A;  2NP3 A;  2WGB A;  5F04 A;  3BTI A;  3HTI A;  3BNI A;  2OI8 A;  4D7N A;  3LSP A;  2FX0 A;  3BTC A;  1UI5 A;  4D5C A;  1UI6 A;  1BJZ A;  3BR3 A;  2QIB A;  3MNL A;  1JTY A;  3ZQG A;  4AF5 A;  5K7F A;  5F0C A;  2FJ1 A;  5IOY A;  4ME9 A;  3NXC A;  5J1U A;  2Q24 A;  3E7Q A;  2G7L A;  2GFN A;  4B3A A;  3FK7 A;  3CDL A;  4L62 A;  3F0C A;  2VKV A;  4XK4 A;  3HTH A;  2I10 A;  3CJD A;  3VUQ A;  3LSJ A;  3QPL A;  3ZQI A;  3G1L A;  2XB5 A;  4I76 A;  2IU5 A;  5K58 A;  5FMP A;  2IAI A;  3HTA A;  5F1J A;  3RH2 A;  2NP5 A;  5GPA A;  3BRU A;  3LJL A;  5HBU A;  3BCG A;  2G7G A;  2UXH A;  3G7R A;  5D1R A;  5FKM A;  2GBY A;  3O8H A;  2FBQ A;  5FKO A;  3DCF A;  3VPR A;  2XGC A;  3IUV A;  1JUM A;  5AQC A;  3G1M A;  3O8G A;  5GP9 A;  4D5F A;  4M3D A;  5FHP A;  2XRL A;  2OF7 A;  4AC0 A;  2W53 A;  5F27 A;  2Y30 A;  4GCT A;  2FD5 A;  2QOP A;  5J1Y A;  5H9T A;  3GEU A;  3SDG A;  5HAW A;  5J3L A;  3BR2 A;  2ZCN A;  3BJB A;  5F0F A;  3SFI A;  1Z77 A;  5FKL A;  5F0H A;  4ABZ A;  2YVE A;  5K7Z A;  5IOZ A;  3VOK A;  3ZQF A;  5GPC A;  2ID3 A;  2UXI A;  2TCT A;  4V2G A;  5J1R A;  5FKN A;  5EYR A;  3B81 A;  5C4Y A;  4CGR A;  3TP0 A;  2O7T A;  2ZOY A;  2QKO A;  3T6N A;  4DW6 A;  2XPU A;  3KKC A;  5EZG A;  2XDN A;  2NX4 A;  2G7S A;  1T56 A;  3AQT A;  3BQZ A;  4NN1 A;  4HKU A;  3QPS A;  3VOX A;  4KWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...