3O60A

The crystal structure of lin0861 from listeria innocua to 2.8a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
NYVKVHQPLNVDLRTQKTQTKLYTVLERFYVEDRTFESISIKDLCEQARVSRATFYRHHKEIIQVIEVQILRTMQYFSLEFDQIILTKENIQRLILRTIQKNPLLFQVIFWSRAENIFIDVVSGEILRISLLKEVSFSDSKFMPNCFARMILSLAAEIQQSNKDYTNDQLVELIQEAARFLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Lin0861 from Listeria innocua to 2.8A
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
molecule keywords Lin0861 protein
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3o60A00
3QBMA 2I10A 1QPIA 2GENA 4M3BA 4I76A 3BNIA 3P9TA 4XK4A 5C4YA 2OF7A 3G1MA 2VKEA 3IH4A 2W53A 4V2GA 3RH2A 4NELA 2UXOA 2G7LA 1JTYA 5HBUA 3JSJA 3HGGA 3NI7A 3VUQA 5GPCA 3DEWA 3VOXA 2QWTA 3QPSA 2FJ1A 2V57A 2YVHA 3LWJA 5IOZA 2XRLA 1RPWA 2GBYA 3WHCA 5K7HA 3VVYA 2O7TA 3VW2A 3CRJA 3DPJA 4JL3A 4GFLA 5K7ZA 3LSRA 2RHAA 3DCFA 3G7RA 3C07A 3FRQA 3IUVA 3IH2A 3BR3A 2XB5A 3TP3A 4ME9A 4CGRA 3AQTA 3BT9A 4GCLA 5H9TA 3GEUA 3O60A 5HSZA 3ZQGA 2TRTA 2ZCNA 3VW1A 5F27A 4ABZA 1VI0A 4L62A 1U9NA 2TCTA 5FKLA 3E7QA 2IAIA 3B6AA 1Z77A 2VPRA 3VOKA 2NS8A 1T56A 1UI6A 3KKDA 2REKA 4AUXA 3CCYA 2NP5A 2G7SA 5J1RA 5GPAA 4I6ZA 2ZCXA 3ZQIA 4AC0A 5F08A 2D6YA 3ZQLA 2WV1A 3BJBA 3BR6A 4DW6A 4MXMA 2HXIA 2X6OA 4JKZA 4D7NA 3NRGA 2G3BA 1ZKGA 3CDLA 3QPLA 2UXPA 2RAEA 2NP3A 3VW0A 5CW8A 1JT0A 3Q0UA 1JT6A 2WUIA 3MVPA 3PPBA 3LOCA 1QVTA 5J1UA 3LSJA 2DTZA 2QKOA 4D5FA 3TP0A 4YZEA 3QKXA 2Y2ZA 3BR0A 3HTIA 5DAJA 3BQZA 5K58A 3EUPA 2HKUA 3ANPA 4GFKA 3RD3A 3B6CA 3VVZA 3B81A 3G1LA 3ZQHA 3CWRA 3HGYA 3BR2A 2DG8A 5J3LA 3LHQA 3Q3SA 1A6IA 4NN1A 3FK6A 2QTQA 5CXGA 1JUSA 3IH3A 5F0HA 3BR1A 2UXUA 1JTXA 3VPRA 3G56A 2ZCMA 4AC6A 3BTLA 3BCGA 2VKVA 2YVEA 4JNNA 5FKKA 4PXIA 3S5RA 2UXIA 4UDSA 4W1UA 1UI5A 3BQYA 3WHBA 3BHQA 2FX0A 5IPAA 5FMPA 2XPVA 5D19A 2IBDA 2G7GA 1RKTA 2UXHA 4M3DA 3BR5A 5EFYA 2X9DA 3C2BA 3Q0WA 1ZK8A 2XGEA 4GCTA 2HXOA 2HQ5A 3ON2A 5EZHA 2ID3A 2ZOYA 3BRUA 3T6NA 5J1YA 5D1RA 5EZGA 3F1BA 5K7FA 3CJDA 4W97A 2DG7A 4D5CA 2F07A 4HKUA 3O8GA 1BJZA 3LSPA 3KKCA 2Q24A 3V6GA 2HYJA 5GP9A 3VP5A 5FKNA 1T33A 2O7OA 3V78A 3AQSA 5F1JA 2OI8A 5F04A 2JK3A 3HIMA 5AQCA 3Q0VA 2G0EA 3HTJA 3ON4A 5F0FA 1ORKA 3BTCA 3GZIA 5FHPA 5IP6A 2RASA 5D18A 3PASA 2GUHA 3EGQA 3NPIA 4M3EA 3KNWA 2HYTA 2JJ7A 3NXCA 2XGDA 2OERA 3KZ9A 1JUMA 3HE0A 5EYRA 4KWAA 3FIWA 2PZ9A 2FD5A 2ZB9A 3BTJA 2XPUA 3BTIA 2OPTA 2GFNA 1U9OA 4M3GA 2ZOZA 4GCKA 2NX4A 4MK6A 3COLA 4X1EA 4B1RA 2QIBA 2XGCA 5FGLA 2ID6A 3FK7A 4D7MA 4M3FA 3SFIA 2EH3A 2Y31A 2WGBA 2QOPA 2XDNA 3HTHA 1RKWA 4B3AA 2Y30A 3HTAA 2NS7A 4V2FA 2FQ4A 3LJLA 3PM1A 1QVUA 4JYKA 4MO7A 5IOYA 5FKOA 2XPWA 3G1OA 3O8HA 4ACIA 2FBQA 5HAWA 2PBXA 3MNLA 3VVXA 5CXIA 3ANGA 4G12A 3VIBA 4AF5A 1Z0XA 3NNRA 5F0CA 1JUPA 3ZQFA 4ICHA 5FKMA 2QCOA 1SGMA 2IU5A 2IEKA 3SDGA 3QQAA 3F0CA
chains in the Genus database with same CATH superfamily
3QBMA 2I10A 1QPIA 2GENA 4OD5A 4M3BA 4I76A 3BNIA 3P9TA 4XK4A 5C4YA 2OF7A 2R7UA 3G1MA 2VKEA 3IH4A 2W53A 4V2GA 3RH2A 4NELA 2UXOA 2G7LA 1JTYA 5HBUA 2R7SA 3JSJA 3HGGA 3NI7A 3VUQA 5GPCA 3DEWA 3VOXA 2QWTA 3QPSA 2FJ1A 2V57A 2YVHA 3LWJA 5IOZA 2XRLA 1RPWA 3SWHA 2GBYA 4IRVA 3WHCA 5K7HA 3VVYA 2O7TA 3VW2A 3CRJA 3DPJA 4WIBA 4JL3A 4GFLA 5K7ZA 3DU5A 2RHAA 3DCFA 3LSRA 3G7RA 3C07A 3FRQA 2PFVA 3IUVA 3IH2A 3BR3A 2XB5A 3TP3A 4ME9A 4CGRA 3AQTA 2A2FX 4U9LA 3BT9A 4GCLA 5H9TA 3GEUA 3O60A 5HSZA 3ZQGA 2TRTA 2ZCNA 3VW1A 5F27A 4ABZA 1VI0A 4L62A 1U9NA 2TCTA 5FKLA 3E7QA 2IAIA 3B6AA 1Z77A 2VPRA 3VOKA 3NS4A 2FJI1 2NS8A 4DVYP 1T56A 1UI6A 3KKDA 2REKA 4AUXA 3CCYA 2NP5A 2G7SA 5J1RA 5GPAA 4I6ZA 3K8PC 2ZCXA 3ZQIA 4AC0A 5F08A 2D6YA 3ZQLA 2WV1A 3BJBA 3BR6A 2R7XA 4DW6A 4MXMA 2HXIA 2X6OA 4JKZA 4D7NA 3NRGA 2G3BA 1ZKGA 3CDLA 2R7QA 3QPLA 2UXPA 2RAEA 2NP3A 3VW0A 5CW8A 1JT0A 3Q0UA 1JT6A 2WUIA 2YVXA 3MVPA 3PPBA 3LOCA 1QVTA 5J1UA 3LSJA 2DTZA 3FHNA 2QKOA 4D5FA 3TP0A 4YZEA 3QKXA 2Y2ZA 3BR0A 3HTIA 5DAJA 3BQZA 5K58A 3EUPA 2HKUA 3ANPA 4GFKA 3RD3A 3B6CA 3VVZA 3B81A 3G1LA 3ZQHA 3CWRA 3HGYA 3BR2A 2DG8A 5J3LA 3LHQA 3Q3SA 1A6IA 4NN1A 3FK6A 2QTQA 5CXGA 1JUSA 3IH3A 5F0HA 3BR1A 2B3WA 2UXUA 1JTXA 3VPRA 3G56A 2ZCMA 4AC6A 3BTLA 3BCGA 2VKVA 2YVEA 4JNNA 5FKKA 4PXIA 3S5RA 2UXIA 4UDSA 4W1UA 1UI5A 3BQYA 3WHBA 3BHQA 2FX0A 5IPAA 5FMPA 2XPVA 5D19A 2IBDA 2G7GA 1RKTA 2UXHA 2R7TA 4M3DA 3BR5A 5EFYA 4C2MA 2X9DA 3C2BA 3Q0WA 1ZK8A 2XGEA 4GCTA 2HXOA 2HQ5A 3ON2A 5EZHA 2ID3A 2ZOYA 3BRUA 3T6NA 5J1YA 5D1RA 5EZGA 3F1BA 5K7FA 3CJDA 3KYLA 4W97A 2DG7A 4D5CA 2F07A 4HKUA 3O8GA 1BJZA 3LSPA 3KKCA 4OD4A 4U9NA 2Q24A 3V6GA 2HYJA 5GP9A 3VP5A 5FKNA 1T33A 2O7OA 3V78A 3AQSA 5F1JA 2OI8A 5F04A 2JK3A 3HIMA 5AQCA 3Q0VA 3VTIA 2G0EA 3HTJA 3ON4A 5F0FA 1ORKA 3BTCA 3GZIA 5FHPA 2RASA 5IP6A 5D18A 3PASA 2GUHA 3EGQA 3NPIA 4M3EA 3KNWA 2HYTA 2R7WA 2JJ7A 3NXCA 2XGDA 2OERA 3KZ9A 1JUMA 3HE0A 5EYRA 4KWAA 3FIWA 2PZ9A 2FD5A 2ZB9A 3BTJA 2XPUA 3BTIA 2OPTA 2GFNA 1U9OA 4M3GA 2ZOZA 4GCKA 2NX4A 4MK6A 3COLA 4X1EA 4B1RA 2QIBA 2XGCA 2B1EA 5FGLA 2ID6A 3FK7A 4D7MA 4M3FA 3SFIA 2R7OA 2EH3A 2Y31A 2WGBA 2QOPA 2ZY9A 2XDNA 3HTHA 1RKWA 4B3AA 2Y30A 3HTAA 2NS7A 4V2FA 2FQ4A 3LJLA 3PM1A 1QVUA 4JYKA 4MO7A 5IOYA 5FKOA 2XPWA 3DU6A 3G1OA 3O8HA 4ACIA 2FBQA 5HAWA 2PBXA 3MNLA 2R7VA 3VVXA 5CXIA 3ANGA 4G12A 3VIBA 4AF5A 1Z0XA 3NNRA 5CQGA 5F0CA 1JUPA 3ZQFA 4ICHA 2R7RA 5FKMA 2QCOA 1SGMA 2IU5A 2IEKA 3SDGA 3QQAA 3F0CA
chains in the Genus database with same CATH topology
3QBMA 2I10A 1QPIA 2GENA 4M3BA 4I76A 3BNIA 3P9TA 4XK4A 5C4YA 2OF7A 3G1MA 2VKEA 3IH4A 2W53A 4V2GA 3RH2A 4NELA 2UXOA 2G7LA 1JTYA 5HBUA 3JSJA 3HGGA 3NI7A 3VUQA 5GPCA 3DEWA 3VOXA 2QWTA 3QPSA 2FJ1A 2V57A 2YVHA 3LWJA 5IOZA 2XRLA 1RPWA 2GBYA 3WHCA 5K7HA 3VVYA 2O7TA 3VW2A 3CRJA 3DPJA 4JL3A 4GFLA 5K7ZA 3LSRA 2RHAA 3DCFA 3G7RA 3C07A 3FRQA 3IUVA 3IH2A 3BR3A 2XB5A 3TP3A 4ME9A 4CGRA 3AQTA 3BT9A 4GCLA 5H9TA 3GEUA 3O60A 5HSZA 3ZQGA 2TRTA 2ZCNA 3VW1A 5F27A 4ABZA 1VI0A 4L62A 1U9NA 2TCTA 5FKLA 3E7QA 2IAIA 3B6AA 1Z77A 2VPRA 3VOKA 2NS8A 1T56A 1UI6A 3KKDA 2REKA 4AUXA 3CCYA 2NP5A 2G7SA 5J1RA 5GPAA 4I6ZA 2ZCXA 3ZQIA 4AC0A 5F08A 2D6YA 3ZQLA 2WV1A 3BJBA 3BR6A 4DW6A 4MXMA 2HXIA 2X6OA 4JKZA 4D7NA 3NRGA 2G3BA 1ZKGA 3CDLA 3QPLA 2UXPA 2RAEA 2NP3A 3VW0A 5CW8A 1JT0A 3Q0UA 1JT6A 2WUIA 3MVPA 3PPBA 3LOCA 1QVTA 5J1UA 3LSJA 2DTZA 2QKOA 4D5FA 3TP0A 4YZEA 3QKXA 2Y2ZA 3BR0A 3HTIA 5DAJA 3BQZA 5K58A 3EUPA 2HKUA 3ANPA 4GFKA 3RD3A 3B6CA 3VVZA 3B81A 3G1LA 3ZQHA 3CWRA 3HGYA 3BR2A 2DG8A 5J3LA 3LHQA 3Q3SA 1A6IA 4NN1A 3FK6A 2QTQA 5CXGA 1JUSA 3IH3A 5F0HA 3BR1A 2UXUA 1JTXA 3VPRA 3G56A 2ZCMA 4AC6A 3BTLA 3BCGA 2VKVA 2YVEA 4JNNA 5FKKA 4PXIA 3S5RA 2UXIA 4UDSA 4W1UA 1UI5A 3BQYA 3WHBA 3BHQA 2FX0A 5IPAA 5FMPA 2XPVA 5D19A 2IBDA 2G7GA 1RKTA 2UXHA 4M3DA 3BR5A 5EFYA 2X9DA 3C2BA 3Q0WA 1ZK8A 2XGEA 4GCTA 2HXOA 2HQ5A 3ON2A 5EZHA 2ID3A 2ZOYA 3BRUA 3T6NA 5J1YA 5D1RA 5EZGA 3F1BA 5K7FA 3CJDA 4W97A 2DG7A 4D5CA 2F07A 4HKUA 3O8GA 1BJZA 3LSPA 3KKCA 2Q24A 3V6GA 2HYJA 5GP9A 3VP5A 5FKNA 1T33A 2O7OA 3V78A 3AQSA 5F1JA 2OI8A 5F04A 2JK3A 3HIMA 5AQCA 3Q0VA 2G0EA 3HTJA 3ON4A 5F0FA 1ORKA 3BTCA 3GZIA 5FHPA 5IP6A 2RASA 5D18A 3PASA 2GUHA 3EGQA 3NPIA 4M3EA 3KNWA 2HYTA 2JJ7A 3NXCA 2XGDA 2OERA 3KZ9A 1JUMA 3HE0A 5EYRA 4KWAA 3FIWA 2PZ9A 2FD5A 2ZB9A 3BTJA 2XPUA 3BTIA 2OPTA 2GFNA 1U9OA 4M3GA 2ZOZA 4GCKA 2NX4A 4MK6A 3COLA 4X1EA 4B1RA 2QIBA 2XGCA 5FGLA 2ID6A 3FK7A 4D7MA 4M3FA 3SFIA 2EH3A 2Y31A 2WGBA 2QOPA 2XDNA 3HTHA 1RKWA 4B3AA 2Y30A 3HTAA 2NS7A 4V2FA 2FQ4A 3LJLA 3PM1A 1QVUA 4JYKA 4MO7A 5IOYA 5FKOA 2XPWA 3G1OA 3O8HA 4ACIA 2FBQA 5HAWA 2PBXA 3MNLA 3VVXA 5CXIA 3ANGA 4G12A 3VIBA 4AF5A 1Z0XA 3NNRA 5F0CA 1JUPA 3ZQFA 4ICHA 5FKMA 2QCOA 1SGMA 2IU5A 2IEKA 3SDGA 3QQAA 3F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBM A;  2I10 A;  1QPI A;  2GEN A;  4M3B A;  4I76 A;  3BNI A;  3P9T A;  4XK4 A;  5C4Y A;  2OF7 A;  3G1M A;  2VKE A;  3IH4 A;  2W53 A;  4V2G A;  3RH2 A;  4NEL A;  2UXO A;  2G7L A;  1JTY A;  5HBU A;  3JSJ A;  3HGG A;  3NI7 A;  3VUQ A;  5GPC A;  3DEW A;  3VOX A;  2QWT A;  3QPS A;  2FJ1 A;  2V57 A;  2YVH A;  3LWJ A;  5IOZ A;  2XRL A;  1RPW A;  2GBY A;  3WHC A;  5K7H A;  3VVY A;  2O7T A;  3VW2 A;  3CRJ A;  3DPJ A;  4JL3 A;  4GFL A;  5K7Z A;  3LSR A;  2RHA A;  3DCF A;  3G7R A;  3C07 A;  3FRQ A;  3IUV A;  3IH2 A;  3BR3 A;  2XB5 A;  3TP3 A;  4ME9 A;  4CGR A;  3AQT A;  3BT9 A;  4GCL A;  5H9T A;  3GEU A;  3O60 A;  5HSZ A;  3ZQG A;  2TRT A;  2ZCN A;  3VW1 A;  5F27 A;  4ABZ A;  1VI0 A;  4L62 A;  1U9N A;  2TCT A;  5FKL A;  3E7Q A;  2IAI A;  3B6A A;  1Z77 A;  2VPR A;  3VOK A;  2NS8 A;  1T56 A;  1UI6 A;  3KKD A;  2REK A;  4AUX A;  3CCY A;  2NP5 A;  2G7S A;  5J1R A;  5GPA A;  4I6Z A;  2ZCX A;  3ZQI A;  4AC0 A;  5F08 A;  2D6Y A;  3ZQL A;  2WV1 A;  3BJB A;  3BR6 A;  4DW6 A;  4MXM A;  2HXI A;  2X6O A;  4JKZ A;  4D7N A;  3NRG A;  2G3B A;  1ZKG A;  3CDL A;  3QPL A;  2UXP A;  2RAE A;  2NP3 A;  3VW0 A;  5CW8 A;  1JT0 A;  3Q0U A;  1JT6 A;  2WUI A;  3MVP A;  3PPB A;  3LOC A;  1QVT A;  5J1U A;  3LSJ A;  2DTZ A;  2QKO A;  4D5F A;  3TP0 A;  4YZE A;  3QKX A;  2Y2Z A;  3BR0 A;  3HTI A;  5DAJ A;  3BQZ A;  5K58 A;  3EUP A;  2HKU A;  3ANP A;  4GFK A;  3RD3 A;  3B6C A;  3VVZ A;  3B81 A;  3G1L A;  3ZQH A;  3CWR A;  3HGY A;  3BR2 A;  2DG8 A;  5J3L A;  3LHQ A;  3Q3S A;  1A6I A;  4NN1 A;  3FK6 A;  2QTQ A;  5CXG A;  1JUS A;  3IH3 A;  5F0H A;  3BR1 A;  2UXU A;  1JTX A;  3VPR A;  3G56 A;  2ZCM A;  4AC6 A;  3BTL A;  3BCG A;  2VKV A;  2YVE A;  4JNN A;  5FKK A;  4PXI A;  3S5R A;  2UXI A;  4UDS A;  4W1U A;  1UI5 A;  3BQY A;  3WHB A;  3BHQ A;  2FX0 A;  5IPA A;  5FMP A;  2XPV A;  5D19 A;  2IBD A;  2G7G A;  1RKT A;  2UXH A;  4M3D A;  3BR5 A;  5EFY A;  2X9D A;  3C2B A;  3Q0W A;  1ZK8 A;  2XGE A;  4GCT A;  2HXO A;  2HQ5 A;  3ON2 A;  5EZH A;  2ID3 A;  2ZOY A;  3BRU A;  3T6N A;  5J1Y A;  5D1R A;  5EZG A;  3F1B A;  5K7F A;  3CJD A;  4W97 A;  2DG7 A;  4D5C A;  2F07 A;  4HKU A;  3O8G A;  1BJZ A;  3LSP A;  3KKC A;  2Q24 A;  3V6G A;  2HYJ A;  5GP9 A;  3VP5 A;  5FKN A;  1T33 A;  2O7O A;  3V78 A;  3AQS A;  5F1J A;  2OI8 A;  5F04 A;  2JK3 A;  3HIM A;  5AQC A;  3Q0V A;  2G0E A;  3HTJ A;  3ON4 A;  5F0F A;  1ORK A;  3BTC A;  3GZI A;  5FHP A;  5IP6 A;  2RAS A;  5D18 A;  3PAS A;  2GUH A;  3EGQ A;  3NPI A;  4M3E A;  3KNW A;  2HYT A;  2JJ7 A;  3NXC A;  2XGD A;  2OER A;  3KZ9 A;  1JUM A;  3HE0 A;  5EYR A;  4KWA A;  3FIW A;  2PZ9 A;  2FD5 A;  2ZB9 A;  3BTJ A;  2XPU A;  3BTI A;  2OPT A;  2GFN A;  1U9O A;  4M3G A;  2ZOZ A;  4GCK A;  2NX4 A;  4MK6 A;  3COL A;  4X1E A;  4B1R A;  2QIB A;  2XGC A;  5FGL A;  2ID6 A;  3FK7 A;  4D7M A;  4M3F A;  3SFI A;  2EH3 A;  2Y31 A;  2WGB A;  2QOP A;  2XDN A;  3HTH A;  1RKW A;  4B3A A;  2Y30 A;  3HTA A;  2NS7 A;  4V2F A;  2FQ4 A;  3LJL A;  3PM1 A;  1QVU A;  4JYK A;  4MO7 A;  5IOY A;  5FKO A;  2XPW A;  3G1O A;  3O8H A;  4ACI A;  2FBQ A;  5HAW A;  2PBX A;  3MNL A;  3VVX A;  5CXI A;  3ANG A;  4G12 A;  3VIB A;  4AF5 A;  1Z0X A;  3NNR A;  5F0C A;  1JUP A;  3ZQF A;  4ICH A;  5FKM A;  2QCO A;  1SGM A;  2IU5 A;  2IEK A;  3SDG A;  3QQA A;  3F0C A; 
#chains in the Genus database with same CATH topology
 3QBM A;  2I10 A;  1QPI A;  2GEN A;  4OD5 A;  4M3B A;  4I76 A;  3BNI A;  3P9T A;  4XK4 A;  5C4Y A;  2OF7 A;  2R7U A;  3G1M A;  2VKE A;  3IH4 A;  2W53 A;  4V2G A;  3RH2 A;  4NEL A;  2UXO A;  2G7L A;  1JTY A;  5HBU A;  2R7S A;  3JSJ A;  3HGG A;  3NI7 A;  3VUQ A;  5GPC A;  3DEW A;  3VOX A;  2QWT A;  3QPS A;  2FJ1 A;  2V57 A;  2YVH A;  3LWJ A;  5IOZ A;  2XRL A;  1RPW A;  3SWH A;  2GBY A;  4IRV A;  3WHC A;  5K7H A;  3VVY A;  2O7T A;  3VW2 A;  3CRJ A;  3DPJ A;  4WIB A;  4JL3 A;  4GFL A;  5K7Z A;  3DU5 A;  2RHA A;  3DCF A;  3LSR A;  3G7R A;  3C07 A;  3FRQ A;  2PFV A;  3IUV A;  3IH2 A;  3BR3 A;  2XB5 A;  3TP3 A;  4ME9 A;  4CGR A;  3AQT A;  2A2F X;  4U9L A;  3BT9 A;  4GCL A;  5H9T A;  3GEU A;  3O60 A;  5HSZ A;  3ZQG A;  2TRT A;  2ZCN A;  3VW1 A;  5F27 A;  4ABZ A;  1VI0 A;  4L62 A;  1U9N A;  2TCT A;  5FKL A;  3E7Q A;  2IAI A;  3B6A A;  1Z77 A;  2VPR A;  3VOK A;  3NS4 A;  2FJI 1;  2NS8 A;  4DVY P;  1T56 A;  1UI6 A;  3KKD A;  2REK A;  4AUX A;  3CCY A;  2NP5 A;  2G7S A;  5J1R A;  5GPA A;  4I6Z A;  3K8P C;  2ZCX A;  3ZQI A;  4AC0 A;  5F08 A;  2D6Y A;  3ZQL A;  2WV1 A;  3BJB A;  3BR6 A;  2R7X A;  4DW6 A;  4MXM A;  2HXI A;  2X6O A;  4JKZ A;  4D7N A;  3NRG A;  2G3B A;  1ZKG A;  3CDL A;  2R7Q A;  3QPL A;  2UXP A;  2RAE A;  2NP3 A;  3VW0 A;  5CW8 A;  1JT0 A;  3Q0U A;  1JT6 A;  2WUI A;  2YVX A;  3MVP A;  3PPB A;  3LOC A;  1QVT A;  5J1U A;  3LSJ A;  2DTZ A;  3FHN A;  2QKO A;  4D5F A;  3TP0 A;  4YZE A;  3QKX A;  2Y2Z A;  3BR0 A;  3HTI A;  5DAJ A;  3BQZ A;  5K58 A;  3EUP A;  2HKU A;  3ANP A;  4GFK A;  3RD3 A;  3B6C A;  3VVZ A;  3B81 A;  3G1L A;  3ZQH A;  3CWR A;  3HGY A;  3BR2 A;  2DG8 A;  5J3L A;  3LHQ A;  3Q3S A;  1A6I A;  4NN1 A;  3FK6 A;  2QTQ A;  5CXG A;  1JUS A;  3IH3 A;  5F0H A;  3BR1 A;  2B3W A;  2UXU A;  1JTX A;  3VPR A;  3G56 A;  2ZCM A;  4AC6 A;  3BTL A;  3BCG A;  2VKV A;  2YVE A;  4JNN A;  5FKK A;  4PXI A;  3S5R A;  2UXI A;  4UDS A;  4W1U A;  1UI5 A;  3BQY A;  3WHB A;  3BHQ A;  2FX0 A;  5IPA A;  5FMP A;  2XPV A;  5D19 A;  2IBD A;  2G7G A;  1RKT A;  2UXH A;  2R7T A;  4M3D A;  3BR5 A;  5EFY A;  4C2M A;  2X9D A;  3C2B A;  3Q0W A;  1ZK8 A;  2XGE A;  4GCT A;  2HXO A;  2HQ5 A;  3ON2 A;  5EZH A;  2ID3 A;  2ZOY A;  3BRU A;  3T6N A;  5J1Y A;  5D1R A;  5EZG A;  3F1B A;  5K7F A;  3CJD A;  3KYL A;  4W97 A;  2DG7 A;  4D5C A;  2F07 A;  4HKU A;  3O8G A;  1BJZ A;  3LSP A;  3KKC A;  4OD4 A;  4U9N A;  2Q24 A;  3V6G A;  2HYJ A;  5GP9 A;  3VP5 A;  5FKN A;  1T33 A;  2O7O A;  3V78 A;  3AQS A;  5F1J A;  2OI8 A;  5F04 A;  2JK3 A;  3HIM A;  5AQC A;  3Q0V A;  3VTI A;  2G0E A;  3HTJ A;  3ON4 A;  5F0F A;  1ORK A;  3BTC A;  3GZI A;  5FHP A;  2RAS A;  5IP6 A;  5D18 A;  3PAS A;  2GUH A;  3EGQ A;  3NPI A;  4M3E A;  3KNW A;  2HYT A;  2R7W A;  2JJ7 A;  3NXC A;  2XGD A;  2OER A;  3KZ9 A;  1JUM A;  3HE0 A;  5EYR A;  4KWA A;  3FIW A;  2PZ9 A;  2FD5 A;  2ZB9 A;  3BTJ A;  2XPU A;  3BTI A;  2OPT A;  2GFN A;  1U9O A;  4M3G A;  2ZOZ A;  4GCK A;  2NX4 A;  4MK6 A;  3COL A;  4X1E A;  4B1R A;  2QIB A;  2XGC A;  2B1E A;  5FGL A;  2ID6 A;  3FK7 A;  4D7M A;  4M3F A;  3SFI A;  2R7O A;  2EH3 A;  2Y31 A;  2WGB A;  2QOP A;  2ZY9 A;  2XDN A;  3HTH A;  1RKW A;  4B3A A;  2Y30 A;  3HTA A;  2NS7 A;  4V2F A;  2FQ4 A;  3LJL A;  3PM1 A;  1QVU A;  4JYK A;  4MO7 A;  5IOY A;  5FKO A;  2XPW A;  3DU6 A;  3G1O A;  3O8H A;  4ACI A;  2FBQ A;  5HAW A;  2PBX A;  3MNL A;  2R7V A;  3VVX A;  5CXI A;  3ANG A;  4G12 A;  3VIB A;  4AF5 A;  1Z0X A;  3NNR A;  5CQG A;  5F0C A;  1JUP A;  3ZQF A;  4ICH A;  2R7R A;  5FKM A;  2QCO A;  1SGM A;  2IU5 A;  2IEK A;  3SDG A;  3QQA A;  3F0C A; 
#chains in the Genus database with same CATH homology
 3QBM A;  2I10 A;  1QPI A;  2GEN A;  4M3B A;  4I76 A;  3BNI A;  3P9T A;  4XK4 A;  5C4Y A;  2OF7 A;  3G1M A;  2VKE A;  3IH4 A;  2W53 A;  4V2G A;  3RH2 A;  4NEL A;  2UXO A;  2G7L A;  1JTY A;  5HBU A;  3JSJ A;  3HGG A;  3NI7 A;  3VUQ A;  5GPC A;  3DEW A;  3VOX A;  2QWT A;  3QPS A;  2FJ1 A;  2V57 A;  2YVH A;  3LWJ A;  5IOZ A;  2XRL A;  1RPW A;  2GBY A;  3WHC A;  5K7H A;  3VVY A;  2O7T A;  3VW2 A;  3CRJ A;  3DPJ A;  4JL3 A;  4GFL A;  5K7Z A;  3LSR A;  2RHA A;  3DCF A;  3G7R A;  3C07 A;  3FRQ A;  3IUV A;  3IH2 A;  3BR3 A;  2XB5 A;  3TP3 A;  4ME9 A;  4CGR A;  3AQT A;  3BT9 A;  4GCL A;  5H9T A;  3GEU A;  3O60 A;  5HSZ A;  3ZQG A;  2TRT A;  2ZCN A;  3VW1 A;  5F27 A;  4ABZ A;  1VI0 A;  4L62 A;  1U9N A;  2TCT A;  5FKL A;  3E7Q A;  2IAI A;  3B6A A;  1Z77 A;  2VPR A;  3VOK A;  2NS8 A;  1T56 A;  1UI6 A;  3KKD A;  2REK A;  4AUX A;  3CCY A;  2NP5 A;  2G7S A;  5J1R A;  5GPA A;  4I6Z A;  2ZCX A;  3ZQI A;  4AC0 A;  5F08 A;  2D6Y A;  3ZQL A;  2WV1 A;  3BJB A;  3BR6 A;  4DW6 A;  4MXM A;  2HXI A;  2X6O A;  4JKZ A;  4D7N A;  3NRG A;  2G3B A;  1ZKG A;  3CDL A;  3QPL A;  2UXP A;  2RAE A;  2NP3 A;  3VW0 A;  5CW8 A;  1JT0 A;  3Q0U A;  1JT6 A;  2WUI A;  3MVP A;  3PPB A;  3LOC A;  1QVT A;  5J1U A;  3LSJ A;  2DTZ A;  2QKO A;  4D5F A;  3TP0 A;  4YZE A;  3QKX A;  2Y2Z A;  3BR0 A;  3HTI A;  5DAJ A;  3BQZ A;  5K58 A;  3EUP A;  2HKU A;  3ANP A;  4GFK A;  3RD3 A;  3B6C A;  3VVZ A;  3B81 A;  3G1L A;  3ZQH A;  3CWR A;  3HGY A;  3BR2 A;  2DG8 A;  5J3L A;  3LHQ A;  3Q3S A;  1A6I A;  4NN1 A;  3FK6 A;  2QTQ A;  5CXG A;  1JUS A;  3IH3 A;  5F0H A;  3BR1 A;  2UXU A;  1JTX A;  3VPR A;  3G56 A;  2ZCM A;  4AC6 A;  3BTL A;  3BCG A;  2VKV A;  2YVE A;  4JNN A;  5FKK A;  4PXI A;  3S5R A;  2UXI A;  4UDS A;  4W1U A;  1UI5 A;  3BQY A;  3WHB A;  3BHQ A;  2FX0 A;  5IPA A;  5FMP A;  2XPV A;  5D19 A;  2IBD A;  2G7G A;  1RKT A;  2UXH A;  4M3D A;  3BR5 A;  5EFY A;  2X9D A;  3C2B A;  3Q0W A;  1ZK8 A;  2XGE A;  4GCT A;  2HXO A;  2HQ5 A;  3ON2 A;  5EZH A;  2ID3 A;  2ZOY A;  3BRU A;  3T6N A;  5J1Y A;  5D1R A;  5EZG A;  3F1B A;  5K7F A;  3CJD A;  4W97 A;  2DG7 A;  4D5C A;  2F07 A;  4HKU A;  3O8G A;  1BJZ A;  3LSP A;  3KKC A;  2Q24 A;  3V6G A;  2HYJ A;  5GP9 A;  3VP5 A;  5FKN A;  1T33 A;  2O7O A;  3V78 A;  3AQS A;  5F1J A;  2OI8 A;  5F04 A;  2JK3 A;  3HIM A;  5AQC A;  3Q0V A;  2G0E A;  3HTJ A;  3ON4 A;  5F0F A;  1ORK A;  3BTC A;  3GZI A;  5FHP A;  5IP6 A;  2RAS A;  5D18 A;  3PAS A;  2GUH A;  3EGQ A;  3NPI A;  4M3E A;  3KNW A;  2HYT A;  2JJ7 A;  3NXC A;  2XGD A;  2OER A;  3KZ9 A;  1JUM A;  3HE0 A;  5EYR A;  4KWA A;  3FIW A;  2PZ9 A;  2FD5 A;  2ZB9 A;  3BTJ A;  2XPU A;  3BTI A;  2OPT A;  2GFN A;  1U9O A;  4M3G A;  2ZOZ A;  4GCK A;  2NX4 A;  4MK6 A;  3COL A;  4X1E A;  4B1R A;  2QIB A;  2XGC A;  5FGL A;  2ID6 A;  3FK7 A;  4D7M A;  4M3F A;  3SFI A;  2EH3 A;  2Y31 A;  2WGB A;  2QOP A;  2XDN A;  3HTH A;  1RKW A;  4B3A A;  2Y30 A;  3HTA A;  2NS7 A;  4V2F A;  2FQ4 A;  3LJL A;  3PM1 A;  1QVU A;  4JYK A;  4MO7 A;  5IOY A;  5FKO A;  2XPW A;  3G1O A;  3O8H A;  4ACI A;  2FBQ A;  5HAW A;  2PBX A;  3MNL A;  3VVX A;  5CXI A;  3ANG A;  4G12 A;  3VIB A;  4AF5 A;  1Z0X A;  3NNR A;  5F0C A;  1JUP A;  3ZQF A;  4ICH A;  5FKM A;  2QCO A;  1SGM A;  2IU5 A;  2IEK A;  3SDG A;  3QQA A;  3F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...