3O60A

The crystal structure of lin0861 from listeria innocua to 2.8a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
b'NYVKVHQPLNVDLRTQKTQTKLYTVLERFYVEDRTFESISIKDLCEQARVSRATFYRHHKEIIQVIEVQILRTMQYFSLEFDQIILTKENIQRLILRTIQKNPLLFQVIFWSRAENIFIDVVSGEILRISLLKEVSFSDSKFMPNCFARMILSLAAEIQQSNKDYTNDQLVELIQEAARFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin0861 protein
publication title The Crystal Structure of Lin0861 from Listeria innocua to 2.8A
rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3o60A00
5C4YA 3V78A 5F0FA 4I76A 1JT6A 3ZQLA 2G7SA 3HGYA 5DAJA 5F08A 5J1UA 2O7OA 3DPJA 4I6ZA 4JYKA 4W1UA 2HYTA 2ID6A 2FX0A 2YVHA 2XPVA 2RHAA 2UXPA 3AQTA 2REKA 5J3LA 3VOKA 5EYRA 2FJ1A 2GUHA 2TRTA 5FKLA 3ZQHA 4ME9A 3BR1A 3HTHA 3QQAA 5F0CA 4B3AA 3ANGA 2ZB9A 2QCOA 4UDSA 3HE0A 3IH4A 3JSJA 2X6OA 2XDNA 3LJLA 3VPRA 1BJZA 1JUMA 2Y30A 4V2GA 2PZ9A 3E7QA 3FK6A 2XPWA 1RPWA 3P9TA 4JKZA 3CWRA 4PXIA 5FMPA 2IBDA 5CXIA 3VVYA 1U9OA 5HBUA 5H9TA 5HSZA 2OF7A 3BJBA 3FRQA 2HXOA 1ORKA 3VP5A 4GCLA 4D7MA 3VW1A 4L62A 3O8GA 3LWJA 3VUQA 3O8HA 3Q0WA 4AC0A 2XGEA 3IUVA 3BR0A 2G0EA 5F0HA 5J1RA 4MK6A 3NRGA 2XRLA 3BR2A 3Q0UA 3LHQA 2I10A 3BT9A 5EZHA 4M3EA 5K7ZA 5EFYA 3G1OA 2RAEA 3FIWA 3G7RA 2HKUA 3S5RA 1SGMA 2WV1A 5F27A 5IP6A 3RH2A 3TP0A 3Q0VA 5IPAA 2EH3A 5K7HA 3WHBA 5F04A 3VVXA 3QKXA 3BTJA 3CCYA 4XK4A 4GCKA 3BQZA 1UI6A 4D5CA 3DCFA 2X9DA 3HTJA 3BHQA 2G7GA 4ICHA 2FD5A 2UXUA 2XPUA 3FK7A 4AUXA 1QVTA 2IAIA 3ON2A 2VKEA 3KNWA 3COLA 2HXIA 2DG7A 1JUSA 4X1EA 3DEWA 3VVZA 3LSJA 3QBMA 2OPTA 1ZKGA 4AC6A 4NELA 2ZOZA 4V2FA 2DG8A 5IOZA 4M3GA 2NS8A 3C07A 3MNLA 1JTYA 5FKOA 2DTZA 4M3DA 2O7TA 5CXGA 5D19A 4MO7A 3LSPA 5GPCA 2G3BA 3BR6A 1ZK8A 2JJ7A 3HGGA 3V6GA 4G12A 2QKOA 3B6AA 2NP5A 3KKDA 5GPAA 3WHCA 4HKUA 3BTIA 2Y2ZA 2NS7A 1QVUA 1JT0A 3AQSA 5AQCA 3BRUA 4AF5A 2ZOYA 3EGQA 2QTQA 5J1YA 1VI0A 2GENA 3EUPA 5D18A 2W53A 1QPIA 4DW6A 2VPRA 5HAWA 3VOXA 2QIBA 2RASA 4MXMA 3MVPA 3ANPA 3B6CA 3PM1A 5GP9A 2IEKA 2IU5A 3BQYA 2UXIA 3BR3A 3QPSA 3G1LA 4GFLA 1T33A 5FGLA 2ZCNA 2Q24A 5D1RA 3VIBA 4GCTA 4KWAA 3NXCA 2PBXA 3SDGA 4NN1A 5CW8A 1RKWA 5F1JA 3NPIA 3B81A 2JK3A 1A6IA 3KZ9A 2ID3A 2FQ4A 4CGRA 3KKCA 2F07A 3BTLA 4YZEA 3BCGA 2QWTA 3PPBA 3G1MA 1RKTA 2HYJA 4JL3A 1Z77A 3LSRA 4GFKA 2ZCXA 3BNIA 5EZGA 4M3BA 2XGDA 4ACIA 3F1BA 3NI7A 2HQ5A 2NX4A 2TCTA 3IH2A 4JNNA 2UXHA 2OERA 3PASA 2V57A 3Q3SA 5K58A 3T6NA 5FKNA 2GBYA 3HTAA 2OI8A 3CDLA 3NNRA 3TP3A 3RD3A 1UI5A 3SFIA 2UXOA 3C2BA 3IH3A 4D5FA 5IOYA 3G56A 5FHPA 2WGBA 3ZQGA 3GZIA 2NP3A 1U9NA 3F0CA 2YVEA 3VW0A 3O60A 2XGCA 4ABZA 3VW2A 4D7NA 3CJDA 1JUPA 5FKKA 3ZQIA 1JTXA 3CRJA 2Y31A 3QPLA 1Z0XA 3ZQFA 5K7FA 4M3FA 3BTCA 2ZCMA 3HTIA 2GFNA 4B1RA 2VKVA 2QOPA 4W97A 2XB5A 1T56A 3GEUA 3LOCA 2FBQA 3HIMA 2G7LA 3BR5A 5FKMA 2WUIA 3ON4A 2D6YA
chains in the Genus database with same CATH superfamily
5C4YA 3V78A 5F0FA 4I76A 1JT6A 3ZQLA 2G7SA 2B1EA 3HGYA 5DAJA 5F08A 5J1UA 2O7OA 3DPJA 4I6ZA 4JYKA 4W1UA 2HYTA 2ID6A 2FX0A 2YVHA 2XPVA 2RHAA 2UXPA 3AQTA 2REKA 5J3LA 3VOKA 5EYRA 2FJ1A 2GUHA 2TRTA 5FKLA 3ZQHA 2R7RA 4ME9A 3BR1A 3HTHA 3QQAA 5F0CA 4B3AA 3ANGA 2ZB9A 2QCOA 2R7UA 4UDSA 3HE0A 3IH4A 3JSJA 3NS4A 2X6OA 2XDNA 3LJLA 3VPRA 1BJZA 3VTIA 1JUMA 2Y30A 4V2GA 2PZ9A 3E7QA 3FK6A 2XPWA 1RPWA 3P9TA 4JKZA 3CWRA 4PXIA 4OD4A 5FMPA 2IBDA 5CXIA 3VVYA 1U9OA 5HBUA 5H9TA 5HSZA 4C2MA 2OF7A 3BJBA 3FRQA 2HXOA 1ORKA 3VP5A 4GCLA 4D7MA 3VW1A 4L62A 3O8GA 3LWJA 3VUQA 3O8HA 3DU5A 3Q0WA 4AC0A 2XGEA 3IUVA 3BR0A 2G0EA 4IRVA 5F0HA 4DVYP 5J1RA 4MK6A 3NRGA 4OD5A 2XRLA 3BR2A 3Q0UA 3LHQA 2I10A 3BT9A 5EZHA 4M3EA 5K7ZA 5EFYA 3G1OA 2RAEA 3FIWA 3G7RA 3DU6A 2HKUA 3S5RA 1SGMA 2WV1A 5F27A 5IP6A 3RH2A 3TP0A 3Q0VA 5IPAA 2EH3A 5K7HA 3WHBA 5F04A 3VVXA 3QKXA 3BTJA 3CCYA 4XK4A 4GCKA 3BQZA 1UI6A 4D5CA 3DCFA 2X9DA 3HTJA 3BHQA 2G7GA 4ICHA 2FD5A 2UXUA 2XPUA 3FK7A 4AUXA 1QVTA 2IAIA 3ON2A 2VKEA 3KNWA 3COLA 2HXIA 2DG7A 1JUSA 4X1EA 3DEWA 3VVZA 3LSJA 3QBMA 2OPTA 1ZKGA 4AC6A 4NELA 2ZOZA 4V2FA 2DG8A 5IOZA 4M3GA 2NS8A 3C07A 3MNLA 1JTYA 5FKOA 2DTZA 4M3DA 2O7TA 5CXGA 5D19A 4MO7A 3LSPA 3FHNA 5GPCA 2G3BA 3BR6A 1ZK8A 2JJ7A 3HGGA 3V6GA 4G12A 2QKOA 3B6AA 2NP5A 3KKDA 5GPAA 3WHCA 4HKUA 3BTIA 2Y2ZA 2NS7A 1QVUA 1JT0A 3AQSA 2A2FX 3SWHA 5AQCA 3BRUA 4AF5A 2ZOYA 4U9LA 3EGQA 2QTQA 5J1YA 1VI0A 2GENA 3EUPA 5D18A 2W53A 1QPIA 4DW6A 2VPRA 5HAWA 3VOXA 2QIBA 2RASA 4MXMA 3MVPA 3ANPA 3B6CA 3PM1A 5GP9A 2IEKA 2IU5A 3BQYA 2UXIA 3BR3A 3QPSA 3G1LA 4GFLA 1T33A 5CQGA 4U9NA 5FGLA 2ZCNA 2Q24A 5D1RA 3VIBA 4GCTA 4KWAA 3NXCA 2PBXA 3SDGA 4NN1A 5CW8A 1RKWA 5F1JA 3NPIA 3B81A 2JK3A 1A6IA 3KZ9A 2ID3A 2FQ4A 4CGRA 3KKCA 2F07A 3BTLA 4YZEA 3BCGA 2QWTA 3PPBA 3G1MA 1RKTA 2HYJA 4JL3A 1Z77A 3LSRA 3KYLA 4GFKA 2ZCXA 3BNIA 5EZGA 2B3WA 2FJI1 4M3BA 2XGDA 4ACIA 3F1BA 3NI7A 2HQ5A 2NX4A 2TCTA 3IH2A 4JNNA 2R7TA 2R7VA 2UXHA 2OERA 3PASA 2V57A 3Q3SA 5K58A 3T6NA 5FKNA 2R7XA 2YVXA 2GBYA 3HTAA 2OI8A 2ZY9A 3CDLA 2PFVA 3NNRA 3TP3A 3RD3A 1UI5A 3SFIA 2UXOA 3C2BA 3IH3A 2R7SA 4D5FA 5IOYA 3G56A 5FHPA 2WGBA 3ZQGA 3GZIA 2NP3A 1U9NA 3F0CA 2YVEA 3VW0A 3O60A 2XGCA 4ABZA 3VW2A 4D7NA 3CJDA 1JUPA 5FKKA 1JTXA 3CRJA 3ZQIA 2Y31A 3QPLA 1Z0XA 3ZQFA 5K7FA 4M3FA 3BTCA 2ZCMA 3HTIA 2GFNA 4B1RA 4WIBA 3K8PC 2VKVA 2QOPA 2R7QA 4W97A 2XB5A 1T56A 3GEUA 3LOCA 2FBQA 3HIMA 2G7LA 3BR5A 2R7WA 5FKMA 2WUIA 3ON4A 2R7OA 2D6YA
chains in the Genus database with same CATH topology
5C4YA 3V78A 5F0FA 4I76A 1JT6A 3ZQLA 2G7SA 3HGYA 5DAJA 5F08A 5J1UA 2O7OA 3DPJA 4I6ZA 4JYKA 4W1UA 2HYTA 2ID6A 2FX0A 2YVHA 2XPVA 2RHAA 2UXPA 3AQTA 2REKA 5J3LA 3VOKA 5EYRA 2FJ1A 2GUHA 2TRTA 5FKLA 3ZQHA 4ME9A 3BR1A 3HTHA 3QQAA 5F0CA 4B3AA 3ANGA 2ZB9A 2QCOA 4UDSA 3HE0A 3IH4A 3JSJA 2X6OA 2XDNA 3LJLA 3VPRA 1BJZA 1JUMA 2Y30A 4V2GA 2PZ9A 3E7QA 3FK6A 2XPWA 1RPWA 3P9TA 4JKZA 3CWRA 4PXIA 5FMPA 2IBDA 5CXIA 3VVYA 1U9OA 5HBUA 5H9TA 5HSZA 2OF7A 3BJBA 3FRQA 2HXOA 1ORKA 3VP5A 4GCLA 4D7MA 3VW1A 4L62A 3O8GA 3LWJA 3VUQA 3O8HA 3Q0WA 4AC0A 2XGEA 3IUVA 3BR0A 2G0EA 5F0HA 5J1RA 4MK6A 3NRGA 2XRLA 3BR2A 3Q0UA 3LHQA 2I10A 3BT9A 5EZHA 4M3EA 5K7ZA 5EFYA 3G1OA 2RAEA 3FIWA 3G7RA 2HKUA 3S5RA 1SGMA 2WV1A 5F27A 5IP6A 3RH2A 3TP0A 3Q0VA 5IPAA 2EH3A 5K7HA 3WHBA 5F04A 3VVXA 3QKXA 3BTJA 3CCYA 4XK4A 4GCKA 3BQZA 1UI6A 4D5CA 3DCFA 2X9DA 3HTJA 3BHQA 2G7GA 4ICHA 2FD5A 2UXUA 2XPUA 3FK7A 4AUXA 1QVTA 2IAIA 3ON2A 2VKEA 3KNWA 3COLA 2HXIA 2DG7A 1JUSA 4X1EA 3DEWA 3VVZA 3LSJA 3QBMA 2OPTA 1ZKGA 4AC6A 4NELA 2ZOZA 4V2FA 2DG8A 5IOZA 4M3GA 2NS8A 3C07A 3MNLA 1JTYA 5FKOA 2DTZA 4M3DA 2O7TA 5CXGA 5D19A 4MO7A 3LSPA 5GPCA 2G3BA 3BR6A 1ZK8A 2JJ7A 3HGGA 3V6GA 4G12A 2QKOA 3B6AA 2NP5A 3KKDA 5GPAA 3WHCA 4HKUA 3BTIA 2Y2ZA 2NS7A 1QVUA 1JT0A 3AQSA 5AQCA 3BRUA 4AF5A 2ZOYA 3EGQA 2QTQA 5J1YA 1VI0A 2GENA 3EUPA 5D18A 2W53A 1QPIA 4DW6A 2VPRA 5HAWA 3VOXA 2QIBA 2RASA 4MXMA 3MVPA 3ANPA 3B6CA 3PM1A 5GP9A 2IEKA 2IU5A 3BQYA 2UXIA 3BR3A 3QPSA 3G1LA 4GFLA 1T33A 5FGLA 2ZCNA 2Q24A 5D1RA 3VIBA 4GCTA 4KWAA 3NXCA 2PBXA 3SDGA 4NN1A 5CW8A 1RKWA 5F1JA 3NPIA 3B81A 2JK3A 1A6IA 3KZ9A 2ID3A 2FQ4A 4CGRA 3KKCA 2F07A 3BTLA 4YZEA 3BCGA 2QWTA 3PPBA 3G1MA 1RKTA 2HYJA 4JL3A 1Z77A 3LSRA 4GFKA 2ZCXA 3BNIA 5EZGA 4M3BA 2XGDA 4ACIA 3F1BA 3NI7A 2HQ5A 2NX4A 2TCTA 3IH2A 4JNNA 2UXHA 2OERA 3PASA 2V57A 3Q3SA 5K58A 3T6NA 5FKNA 2GBYA 3HTAA 2OI8A 3CDLA 3NNRA 3TP3A 3RD3A 1UI5A 3SFIA 2UXOA 3C2BA 3IH3A 4D5FA 5IOYA 3G56A 5FHPA 2WGBA 3ZQGA 3GZIA 2NP3A 1U9NA 3F0CA 2YVEA 3VW0A 3O60A 2XGCA 4ABZA 3VW2A 4D7NA 3CJDA 1JUPA 5FKKA 3ZQIA 1JTXA 3CRJA 2Y31A 3QPLA 1Z0XA 3ZQFA 5K7FA 4M3FA 3BTCA 2ZCMA 3HTIA 2GFNA 4B1RA 2VKVA 2QOPA 4W97A 2XB5A 1T56A 3GEUA 3LOCA 2FBQA 3HIMA 2G7LA 3BR5A 5FKMA 2WUIA 3ON4A 2D6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Y A;  3V78 A;  5F0F A;  4I76 A;  1JT6 A;  3ZQL A;  2G7S A;  3HGY A;  5DAJ A;  5F08 A;  5J1U A;  2O7O A;  3DPJ A;  4I6Z A;  4JYK A;  4W1U A;  2HYT A;  2ID6 A;  2FX0 A;  2YVH A;  2XPV A;  2RHA A;  2UXP A;  3AQT A;  2REK A;  5J3L A;  3VOK A;  5EYR A;  2FJ1 A;  2GUH A;  2TRT A;  5FKL A;  3ZQH A;  4ME9 A;  3BR1 A;  3HTH A;  3QQA A;  5F0C A;  4B3A A;  3ANG A;  2ZB9 A;  2QCO A;  4UDS A;  3HE0 A;  3IH4 A;  3JSJ A;  2X6O A;  2XDN A;  3LJL A;  3VPR A;  1BJZ A;  1JUM A;  2Y30 A;  4V2G A;  2PZ9 A;  3E7Q A;  3FK6 A;  2XPW A;  1RPW A;  3P9T A;  4JKZ A;  3CWR A;  4PXI A;  5FMP A;  2IBD A;  5CXI A;  3VVY A;  1U9O A;  5HBU A;  5H9T A;  5HSZ A;  2OF7 A;  3BJB A;  3FRQ A;  2HXO A;  1ORK A;  3VP5 A;  4GCL A;  4D7M A;  3VW1 A;  4L62 A;  3O8G A;  3LWJ A;  3VUQ A;  3O8H A;  3Q0W A;  4AC0 A;  2XGE A;  3IUV A;  3BR0 A;  2G0E A;  5F0H A;  5J1R A;  4MK6 A;  3NRG A;  2XRL A;  3BR2 A;  3Q0U A;  3LHQ A;  2I10 A;  3BT9 A;  5EZH A;  4M3E A;  5K7Z A;  5EFY A;  3G1O A;  2RAE A;  3FIW A;  3G7R A;  2HKU A;  3S5R A;  1SGM A;  2WV1 A;  5F27 A;  5IP6 A;  3RH2 A;  3TP0 A;  3Q0V A;  5IPA A;  2EH3 A;  5K7H A;  3WHB A;  5F04 A;  3VVX A;  3QKX A;  3BTJ A;  3CCY A;  4XK4 A;  4GCK A;  3BQZ A;  1UI6 A;  4D5C A;  3DCF A;  2X9D A;  3HTJ A;  3BHQ A;  2G7G A;  4ICH A;  2FD5 A;  2UXU A;  2XPU A;  3FK7 A;  4AUX A;  1QVT A;  2IAI A;  3ON2 A;  2VKE A;  3KNW A;  3COL A;  2HXI A;  2DG7 A;  1JUS A;  4X1E A;  3DEW A;  3VVZ A;  3LSJ A;  3QBM A;  2OPT A;  1ZKG A;  4AC6 A;  4NEL A;  2ZOZ A;  4V2F A;  2DG8 A;  5IOZ A;  4M3G A;  2NS8 A;  3C07 A;  3MNL A;  1JTY A;  5FKO A;  2DTZ A;  4M3D A;  2O7T A;  5CXG A;  5D19 A;  4MO7 A;  3LSP A;  5GPC A;  2G3B A;  3BR6 A;  1ZK8 A;  2JJ7 A;  3HGG A;  3V6G A;  4G12 A;  2QKO A;  3B6A A;  2NP5 A;  3KKD A;  5GPA A;  3WHC A;  4HKU A;  3BTI A;  2Y2Z A;  2NS7 A;  1QVU A;  1JT0 A;  3AQS A;  5AQC A;  3BRU A;  4AF5 A;  2ZOY A;  3EGQ A;  2QTQ A;  5J1Y A;  1VI0 A;  2GEN A;  3EUP A;  5D18 A;  2W53 A;  1QPI A;  4DW6 A;  2VPR A;  5HAW A;  3VOX A;  2QIB A;  2RAS A;  4MXM A;  3MVP A;  3ANP A;  3B6C A;  3PM1 A;  5GP9 A;  2IEK A;  2IU5 A;  3BQY A;  2UXI A;  3BR3 A;  3QPS A;  3G1L A;  4GFL A;  1T33 A;  5FGL A;  2ZCN A;  2Q24 A;  5D1R A;  3VIB A;  4GCT A;  4KWA A;  3NXC A;  2PBX A;  3SDG A;  4NN1 A;  5CW8 A;  1RKW A;  5F1J A;  3NPI A;  3B81 A;  2JK3 A;  1A6I A;  3KZ9 A;  2ID3 A;  2FQ4 A;  4CGR A;  3KKC A;  2F07 A;  3BTL A;  4YZE A;  3BCG A;  2QWT A;  3PPB A;  3G1M A;  1RKT A;  2HYJ A;  4JL3 A;  1Z77 A;  3LSR A;  4GFK A;  2ZCX A;  3BNI A;  5EZG A;  4M3B A;  2XGD A;  4ACI A;  3F1B A;  3NI7 A;  2HQ5 A;  2NX4 A;  2TCT A;  3IH2 A;  4JNN A;  2UXH A;  2OER A;  3PAS A;  2V57 A;  3Q3S A;  5K58 A;  3T6N A;  5FKN A;  2GBY A;  3HTA A;  2OI8 A;  3CDL A;  3NNR A;  3TP3 A;  3RD3 A;  1UI5 A;  3SFI A;  2UXO A;  3C2B A;  3IH3 A;  4D5F A;  5IOY A;  3G56 A;  5FHP A;  2WGB A;  3ZQG A;  3GZI A;  2NP3 A;  1U9N A;  3F0C A;  2YVE A;  3VW0 A;  3O60 A;  2XGC A;  4ABZ A;  3VW2 A;  4D7N A;  3CJD A;  1JUP A;  5FKK A;  3ZQI A;  1JTX A;  3CRJ A;  2Y31 A;  3QPL A;  1Z0X A;  3ZQF A;  5K7F A;  4M3F A;  3BTC A;  2ZCM A;  3HTI A;  2GFN A;  4B1R A;  2VKV A;  2QOP A;  4W97 A;  2XB5 A;  1T56 A;  3GEU A;  3LOC A;  2FBQ A;  3HIM A;  2G7L A;  3BR5 A;  5FKM A;  2WUI A;  3ON4 A;  2D6Y A; 
#chains in the Genus database with same CATH topology
 5C4Y A;  3V78 A;  5F0F A;  4I76 A;  1JT6 A;  3ZQL A;  2G7S A;  2B1E A;  3HGY A;  5DAJ A;  5F08 A;  5J1U A;  2O7O A;  3DPJ A;  4I6Z A;  4JYK A;  4W1U A;  2HYT A;  2ID6 A;  2FX0 A;  2YVH A;  2XPV A;  2RHA A;  2UXP A;  3AQT A;  2REK A;  5J3L A;  3VOK A;  5EYR A;  2FJ1 A;  2GUH A;  2TRT A;  5FKL A;  3ZQH A;  2R7R A;  4ME9 A;  3BR1 A;  3HTH A;  3QQA A;  5F0C A;  4B3A A;  3ANG A;  2ZB9 A;  2QCO A;  2R7U A;  4UDS A;  3HE0 A;  3IH4 A;  3JSJ A;  3NS4 A;  2X6O A;  2XDN A;  3LJL A;  3VPR A;  1BJZ A;  3VTI A;  1JUM A;  2Y30 A;  4V2G A;  2PZ9 A;  3E7Q A;  3FK6 A;  2XPW A;  1RPW A;  3P9T A;  4JKZ A;  3CWR A;  4PXI A;  4OD4 A;  5FMP A;  2IBD A;  5CXI A;  3VVY A;  1U9O A;  5HBU A;  5H9T A;  5HSZ A;  4C2M A;  2OF7 A;  3BJB A;  3FRQ A;  2HXO A;  1ORK A;  3VP5 A;  4GCL A;  4D7M A;  3VW1 A;  4L62 A;  3O8G A;  3LWJ A;  3VUQ A;  3O8H A;  3DU5 A;  3Q0W A;  4AC0 A;  2XGE A;  3IUV A;  3BR0 A;  2G0E A;  4IRV A;  5F0H A;  4DVY P;  5J1R A;  4MK6 A;  3NRG A;  4OD5 A;  2XRL A;  3BR2 A;  3Q0U A;  3LHQ A;  2I10 A;  3BT9 A;  5EZH A;  4M3E A;  5K7Z A;  5EFY A;  3G1O A;  2RAE A;  3FIW A;  3G7R A;  3DU6 A;  2HKU A;  3S5R A;  1SGM A;  2WV1 A;  5F27 A;  5IP6 A;  3RH2 A;  3TP0 A;  3Q0V A;  5IPA A;  2EH3 A;  5K7H A;  3WHB A;  5F04 A;  3VVX A;  3QKX A;  3BTJ A;  3CCY A;  4XK4 A;  4GCK A;  3BQZ A;  1UI6 A;  4D5C A;  3DCF A;  2X9D A;  3HTJ A;  3BHQ A;  2G7G A;  4ICH A;  2FD5 A;  2UXU A;  2XPU A;  3FK7 A;  4AUX A;  1QVT A;  2IAI A;  3ON2 A;  2VKE A;  3KNW A;  3COL A;  2HXI A;  2DG7 A;  1JUS A;  4X1E A;  3DEW A;  3VVZ A;  3LSJ A;  3QBM A;  2OPT A;  1ZKG A;  4AC6 A;  4NEL A;  2ZOZ A;  4V2F A;  2DG8 A;  5IOZ A;  4M3G A;  2NS8 A;  3C07 A;  3MNL A;  1JTY A;  5FKO A;  2DTZ A;  4M3D A;  2O7T A;  5CXG A;  5D19 A;  4MO7 A;  3LSP A;  3FHN A;  5GPC A;  2G3B A;  3BR6 A;  1ZK8 A;  2JJ7 A;  3HGG A;  3V6G A;  4G12 A;  2QKO A;  3B6A A;  2NP5 A;  3KKD A;  5GPA A;  3WHC A;  4HKU A;  3BTI A;  2Y2Z A;  2NS7 A;  1QVU A;  1JT0 A;  3AQS A;  2A2F X;  3SWH A;  5AQC A;  3BRU A;  4AF5 A;  2ZOY A;  4U9L A;  3EGQ A;  2QTQ A;  5J1Y A;  1VI0 A;  2GEN A;  3EUP A;  5D18 A;  2W53 A;  1QPI A;  4DW6 A;  2VPR A;  5HAW A;  3VOX A;  2QIB A;  2RAS A;  4MXM A;  3MVP A;  3ANP A;  3B6C A;  3PM1 A;  5GP9 A;  2IEK A;  2IU5 A;  3BQY A;  2UXI A;  3BR3 A;  3QPS A;  3G1L A;  4GFL A;  1T33 A;  5CQG A;  4U9N A;  5FGL A;  2ZCN A;  2Q24 A;  5D1R A;  3VIB A;  4GCT A;  4KWA A;  3NXC A;  2PBX A;  3SDG A;  4NN1 A;  5CW8 A;  1RKW A;  5F1J A;  3NPI A;  3B81 A;  2JK3 A;  1A6I A;  3KZ9 A;  2ID3 A;  2FQ4 A;  4CGR A;  3KKC A;  2F07 A;  3BTL A;  4YZE A;  3BCG A;  2QWT A;  3PPB A;  3G1M A;  1RKT A;  2HYJ A;  4JL3 A;  1Z77 A;  3LSR A;  3KYL A;  4GFK A;  2ZCX A;  3BNI A;  5EZG A;  2B3W A;  2FJI 1;  4M3B A;  2XGD A;  4ACI A;  3F1B A;  3NI7 A;  2HQ5 A;  2NX4 A;  2TCT A;  3IH2 A;  4JNN A;  2R7T A;  2R7V A;  2UXH A;  2OER A;  3PAS A;  2V57 A;  3Q3S A;  5K58 A;  3T6N A;  5FKN A;  2R7X A;  2YVX A;  2GBY A;  3HTA A;  2OI8 A;  2ZY9 A;  3CDL A;  2PFV A;  3NNR A;  3TP3 A;  3RD3 A;  1UI5 A;  3SFI A;  2UXO A;  3C2B A;  3IH3 A;  2R7S A;  4D5F A;  5IOY A;  3G56 A;  5FHP A;  2WGB A;  3ZQG A;  3GZI A;  2NP3 A;  1U9N A;  3F0C A;  2YVE A;  3VW0 A;  3O60 A;  2XGC A;  4ABZ A;  3VW2 A;  4D7N A;  3CJD A;  1JUP A;  5FKK A;  1JTX A;  3CRJ A;  3ZQI A;  2Y31 A;  3QPL A;  1Z0X A;  3ZQF A;  5K7F A;  4M3F A;  3BTC A;  2ZCM A;  3HTI A;  2GFN A;  4B1R A;  4WIB A;  3K8P C;  2VKV A;  2QOP A;  2R7Q A;  4W97 A;  2XB5 A;  1T56 A;  3GEU A;  3LOC A;  2FBQ A;  3HIM A;  2G7L A;  3BR5 A;  2R7W A;  5FKM A;  2WUI A;  3ON4 A;  2R7O A;  2D6Y A; 
#chains in the Genus database with same CATH homology
 5C4Y A;  3V78 A;  5F0F A;  4I76 A;  1JT6 A;  3ZQL A;  2G7S A;  3HGY A;  5DAJ A;  5F08 A;  5J1U A;  2O7O A;  3DPJ A;  4I6Z A;  4JYK A;  4W1U A;  2HYT A;  2ID6 A;  2FX0 A;  2YVH A;  2XPV A;  2RHA A;  2UXP A;  3AQT A;  2REK A;  5J3L A;  3VOK A;  5EYR A;  2FJ1 A;  2GUH A;  2TRT A;  5FKL A;  3ZQH A;  4ME9 A;  3BR1 A;  3HTH A;  3QQA A;  5F0C A;  4B3A A;  3ANG A;  2ZB9 A;  2QCO A;  4UDS A;  3HE0 A;  3IH4 A;  3JSJ A;  2X6O A;  2XDN A;  3LJL A;  3VPR A;  1BJZ A;  1JUM A;  2Y30 A;  4V2G A;  2PZ9 A;  3E7Q A;  3FK6 A;  2XPW A;  1RPW A;  3P9T A;  4JKZ A;  3CWR A;  4PXI A;  5FMP A;  2IBD A;  5CXI A;  3VVY A;  1U9O A;  5HBU A;  5H9T A;  5HSZ A;  2OF7 A;  3BJB A;  3FRQ A;  2HXO A;  1ORK A;  3VP5 A;  4GCL A;  4D7M A;  3VW1 A;  4L62 A;  3O8G A;  3LWJ A;  3VUQ A;  3O8H A;  3Q0W A;  4AC0 A;  2XGE A;  3IUV A;  3BR0 A;  2G0E A;  5F0H A;  5J1R A;  4MK6 A;  3NRG A;  2XRL A;  3BR2 A;  3Q0U A;  3LHQ A;  2I10 A;  3BT9 A;  5EZH A;  4M3E A;  5K7Z A;  5EFY A;  3G1O A;  2RAE A;  3FIW A;  3G7R A;  2HKU A;  3S5R A;  1SGM A;  2WV1 A;  5F27 A;  5IP6 A;  3RH2 A;  3TP0 A;  3Q0V A;  5IPA A;  2EH3 A;  5K7H A;  3WHB A;  5F04 A;  3VVX A;  3QKX A;  3BTJ A;  3CCY A;  4XK4 A;  4GCK A;  3BQZ A;  1UI6 A;  4D5C A;  3DCF A;  2X9D A;  3HTJ A;  3BHQ A;  2G7G A;  4ICH A;  2FD5 A;  2UXU A;  2XPU A;  3FK7 A;  4AUX A;  1QVT A;  2IAI A;  3ON2 A;  2VKE A;  3KNW A;  3COL A;  2HXI A;  2DG7 A;  1JUS A;  4X1E A;  3DEW A;  3VVZ A;  3LSJ A;  3QBM A;  2OPT A;  1ZKG A;  4AC6 A;  4NEL A;  2ZOZ A;  4V2F A;  2DG8 A;  5IOZ A;  4M3G A;  2NS8 A;  3C07 A;  3MNL A;  1JTY A;  5FKO A;  2DTZ A;  4M3D A;  2O7T A;  5CXG A;  5D19 A;  4MO7 A;  3LSP A;  5GPC A;  2G3B A;  3BR6 A;  1ZK8 A;  2JJ7 A;  3HGG A;  3V6G A;  4G12 A;  2QKO A;  3B6A A;  2NP5 A;  3KKD A;  5GPA A;  3WHC A;  4HKU A;  3BTI A;  2Y2Z A;  2NS7 A;  1QVU A;  1JT0 A;  3AQS A;  5AQC A;  3BRU A;  4AF5 A;  2ZOY A;  3EGQ A;  2QTQ A;  5J1Y A;  1VI0 A;  2GEN A;  3EUP A;  5D18 A;  2W53 A;  1QPI A;  4DW6 A;  2VPR A;  5HAW A;  3VOX A;  2QIB A;  2RAS A;  4MXM A;  3MVP A;  3ANP A;  3B6C A;  3PM1 A;  5GP9 A;  2IEK A;  2IU5 A;  3BQY A;  2UXI A;  3BR3 A;  3QPS A;  3G1L A;  4GFL A;  1T33 A;  5FGL A;  2ZCN A;  2Q24 A;  5D1R A;  3VIB A;  4GCT A;  4KWA A;  3NXC A;  2PBX A;  3SDG A;  4NN1 A;  5CW8 A;  1RKW A;  5F1J A;  3NPI A;  3B81 A;  2JK3 A;  1A6I A;  3KZ9 A;  2ID3 A;  2FQ4 A;  4CGR A;  3KKC A;  2F07 A;  3BTL A;  4YZE A;  3BCG A;  2QWT A;  3PPB A;  3G1M A;  1RKT A;  2HYJ A;  4JL3 A;  1Z77 A;  3LSR A;  4GFK A;  2ZCX A;  3BNI A;  5EZG A;  4M3B A;  2XGD A;  4ACI A;  3F1B A;  3NI7 A;  2HQ5 A;  2NX4 A;  2TCT A;  3IH2 A;  4JNN A;  2UXH A;  2OER A;  3PAS A;  2V57 A;  3Q3S A;  5K58 A;  3T6N A;  5FKN A;  2GBY A;  3HTA A;  2OI8 A;  3CDL A;  3NNR A;  3TP3 A;  3RD3 A;  1UI5 A;  3SFI A;  2UXO A;  3C2B A;  3IH3 A;  4D5F A;  5IOY A;  3G56 A;  5FHP A;  2WGB A;  3ZQG A;  3GZI A;  2NP3 A;  1U9N A;  3F0C A;  2YVE A;  3VW0 A;  3O60 A;  2XGC A;  4ABZ A;  3VW2 A;  4D7N A;  3CJD A;  1JUP A;  5FKK A;  3ZQI A;  1JTX A;  3CRJ A;  2Y31 A;  3QPL A;  1Z0X A;  3ZQF A;  5K7F A;  4M3F A;  3BTC A;  2ZCM A;  3HTI A;  2GFN A;  4B1R A;  2VKV A;  2QOP A;  4W97 A;  2XB5 A;  1T56 A;  3GEU A;  3LOC A;  2FBQ A;  3HIM A;  2G7L A;  3BR5 A;  5FKM A;  2WUI A;  3ON4 A;  2D6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...