3O60A

The crystal structure of lin0861 from listeria innocua to 2.8a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
b'NYVKVHQPLNVDLRTQKTQTKLYTVLERFYVEDRTFESISIKDLCEQARVSRATFYRHHKEIIQVIEVQILRTMQYFSLEFDQIILTKENIQRLILRTIQKNPLLFQVIFWSRAENIFIDVVSGEILRISLLKEVSFSDSKFMPNCFARMILSLAAEIQQSNKDYTNDQLVELIQEAARFLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin0861 protein
molecule tags Structural genomics, unknown function
source organism Listeria innocua
publication title The Crystal Structure of Lin0861 from Listeria innocua to 2.8A
rcsb
total genus 58
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3o60A00
2GUHA 3HTHA 3NNRA 4B1RA 3Q0WA 3C07A 3NRGA 2G7LA 3E7QA 3ZQHA 2RAEA 4GFKA 3CJDA 3TP3A 5K7ZA 5FKOA 3HGYA 1A6IA 2PZ9A 3HGGA 3CDLA 3VVZA 2VPRA 5FGLA 5FKNA 2RHAA 3BR0A 5F0CA 2HXIA 3VOKA 4D5FA 4M3EA 4V2FA 2V57A 2ID6A 2YVEA 3NXCA 2QWTA 3BTLA 2QOPA 4AUXA 2FBQA 1Z77A 3NI7A 4M3GA 1JTYA 4DW6A 5DAJA 2O7OA 2FD5A 2IBDA 3BCGA 4NELA 2NS8A 3HTJA 3GZIA 4W1UA 1ZKGA 1JTXA 2Y31A 3ZQLA 2GBYA 3SDGA 5J1YA 3VP5A 2G0EA 1VI0A 5F0FA 3VPRA 3VW2A 3AQTA 1RPWA 3ON2A 1RKWA 1ZK8A 2OERA 4JKZA 5EFYA 5IP6A 3Q0VA 2TCTA 3FK6A 3QPLA 3GEUA 2QTQA 3JSJA 4MK6A 4I6ZA 3C2BA 3VW1A 1QVUA 2O7TA 3G1LA 2Y30A 3G7RA 1U9OA 2QKOA 4AF5A 3QBMA 2G7GA 3BRUA 2WV1A 2X9DA 2XRLA 3SFIA 3EUPA 3LWJA 3BR5A 3VOXA 3VVXA 4V2GA 3G1OA 5K58A 3COLA 3IH2A 2ZB9A 3ANPA 4X1EA 3IH4A 2UXUA 3WHCA 2NP5A 4ACIA 2HXOA 5J3LA 5CXIA 4ICHA 3IUVA 3FK7A 2EH3A 3EGQA 4MXMA 5F08A 5F1JA 2YVHA 3BQZA 4L62A 3V6GA 1Z0XA 2TRTA 1JT6A 3KNWA 4W97A 1ORKA 3BTJA 2D6YA 5FKLA 5AQCA 5HSZA 3LHQA 3CWRA 4GCLA 3ZQFA 1QPIA 3HTAA 4PXIA 2XGCA 2ZCXA 4NN1A 5EYRA 5K7FA 2PBXA 2G7SA 4HKUA 2DG7A 2GENA 3G56A 3HTIA 4YZEA 5EZGA 2X6OA 3P9TA 5J1UA 4I76A 1BJZA 2XPVA 3BJBA 2JJ7A 2FJ1A 5HBUA 3PASA 5IPAA 2FQ4A 2Q24A 2ZOZA 5GPCA 3RD3A 4ME9A 1JUMA 2NS7A 5CW8A 2NX4A 1T33A 2DTZA 2XPUA 3F0CA 3DEWA 2XDNA 3QKXA 4AC0A 5J1RA 2UXHA 5H9TA 4G12A 3RH2A 2HQ5A 3LSJA 2UXPA 5IOZA 2XGDA 3HIMA 3KKCA 5FKMA 2ID3A 2ZOYA 3CCYA 4JL3A 2ZCMA 1JUPA 2REKA 3LJLA 2WUIA 3ON4A 3Q3SA 3V78A 3BR2A 3BT9A 2OI8A 3BTIA 3VVYA 3BHQA 3VUQA 3QQAA 5CXGA 4JYKA 3LSRA 2HKUA 5GPAA 3MVPA 3BTCA 1SGMA 3BR1A 5D19A 3FIWA 3QPSA 4M3DA 5HAWA 5GP9A 2JK3A 2IAIA 2DG8A 2QIBA 2Y2ZA 2FX0A 1T56A 2VKEA 3BNIA 3KKDA 3VIBA 3F1BA 5F27A 4M3FA 3VW0A 3WHBA 5D1RA 1UI5A 2XB5A 2QCOA 2VKVA 3B6AA 2G3BA 3T6NA 3IH3A 3NPIA 3TP0A 3B81A 3MNLA 4KWAA 3BQYA 5IOYA 2F07A 3HE0A 5F0HA 3B6CA 2XGEA 3ANGA 4B3AA 3O60A 5FMPA 3CRJA 2UXOA 3O8GA 4M3BA 1U9NA 4GCKA 2OPTA 2WGBA 2GFNA 1JUSA 5D18A 3AQSA 1RKTA 3PM1A 5FHPA 1JT0A 3S5RA 4XK4A 2W53A 4GCTA 5K7HA 3DPJA 3O8HA 2IU5A 2HYJA 3LSPA 2NP3A 2ZCNA 4D7MA 3BR6A 4AC6A 3BR3A 1QVTA 5F04A 2IEKA 5FKKA 2HYTA 5C4YA 3ZQIA 2XPWA 4GFLA 3KZ9A 2OF7A 4D5CA 2UXIA 3LOCA 4MO7A 2I10A 5EZHA 4CGRA 4UDSA 3G1MA 1UI6A 3PPBA 2RASA 4ABZA 4JNNA 4D7NA 3Q0UA 3ZQGA 3FRQA 3DCFA
chains in the Genus database with same CATH superfamily
2GUHA 3HTHA 3NNRA 4B1RA 3Q0WA 3C07A 3NRGA 2G7LA 3E7QA 3ZQHA 3NS4A 2RAEA 4GFKA 3CJDA 3TP3A 5K7ZA 2R7OA 5FKOA 3SWHA 3HGYA 1A6IA 2PZ9A 3HGGA 3CDLA 3VVZA 2R7UA 2VPRA 5FGLA 5CQGA 5FKNA 2RHAA 4U9LA 3BR0A 5F0CA 2HXIA 3VOKA 4DVYP 4D5FA 4M3EA 4V2FA 2V57A 2ID6A 2YVEA 3NXCA 2QWTA 3BTLA 2QOPA 4AUXA 2FBQA 1Z77A 3NI7A 4M3GA 1JTYA 4DW6A 5DAJA 2O7OA 2FD5A 2IBDA 2R7SA 3BCGA 4NELA 2PFVA 2NS8A 3HTJA 3GZIA 4W1UA 1ZKGA 1JTXA 2Y31A 3ZQLA 2GBYA 3SDGA 5J1YA 3VP5A 2G0EA 1VI0A 5F0FA 3DU6A 3VPRA 3VW2A 3AQTA 1RPWA 3ON2A 1RKWA 1ZK8A 2OERA 4JKZA 5EFYA 5IP6A 3Q0VA 2TCTA 3FK6A 3QPLA 3GEUA 2QTQA 3JSJA 2ZY9A 4MK6A 4I6ZA 3C2BA 3VW1A 1QVUA 2O7TA 3G1LA 2Y30A 3G7RA 1U9OA 2QKOA 4AF5A 3QBMA 2R7QA 2G7GA 3BRUA 2WV1A 2X9DA 2XRLA 3SFIA 3EUPA 3LWJA 3BR5A 3VOXA 3VVXA 4V2GA 3G1OA 5K58A 3COLA 3IH2A 2ZB9A 3ANPA 4X1EA 3IH4A 2UXUA 3WHCA 2NP5A 4ACIA 2HXOA 5J3LA 5CXIA 4ICHA 3IUVA 3FK7A 2EH3A 3EGQA 4MXMA 5F08A 5F1JA 2YVHA 3BQZA 4L62A 3V6GA 1Z0XA 2TRTA 1JT6A 3KNWA 4W97A 1ORKA 3BTJA 2D6YA 5FKLA 5AQCA 5HSZA 3LHQA 3CWRA 4OD4A 4GCLA 3ZQFA 1QPIA 3HTAA 4PXIA 2XGCA 2ZCXA 4NN1A 5EYRA 5K7FA 2PBXA 2G7SA 4HKUA 2DG7A 2GENA 3G56A 3HTIA 3VTIA 4YZEA 5EZGA 2X6OA 4WIBA 3P9TA 5J1UA 4I76A 1BJZA 2XPVA 3BJBA 2JJ7A 2FJ1A 5HBUA 3PASA 5IPAA 2FQ4A 2Q24A 2ZOZA 5GPCA 3RD3A 4ME9A 1JUMA 2NS7A 5CW8A 2NX4A 1T33A 2DTZA 2XPUA 3F0CA 3DEWA 2XDNA 3QKXA 4AC0A 5J1RA 2UXHA 5H9TA 4G12A 3RH2A 2HQ5A 3LSJA 2UXPA 5IOZA 2R7WA 2XGDA 3HIMA 3KKCA 5FKMA 4U9NA 3KYLA 2ID3A 3K8PC 2ZOYA 2B1EA 3CCYA 4JL3A 2ZCMA 1JUPA 2REKA 3LJLA 2WUIA 3ON4A 3Q3SA 3V78A 2B3WA 3BR2A 3BT9A 2OI8A 2R7TA 3BTIA 3VVYA 3BHQA 3VUQA 3QQAA 5CXGA 4JYKA 3LSRA 2HKUA 5GPAA 3MVPA 3BTCA 1SGMA 3BR1A 5D19A 3FIWA 3QPSA 4M3DA 5HAWA 5GP9A 2JK3A 2IAIA 2DG8A 2QIBA 2Y2ZA 2FX0A 4C2MA 1T56A 2VKEA 3BNIA 3KKDA 3VIBA 3F1BA 5F27A 2R7VA 4M3FA 4IRVA 3VW0A 3WHBA 5D1RA 1UI5A 2XB5A 2QCOA 2VKVA 3B6AA 2G3BA 3T6NA 3IH3A 3NPIA 3TP0A 3B81A 3MNLA 4KWAA 3BQYA 5IOYA 2F07A 2FJI1 3HE0A 5F0HA 3B6CA 2XGEA 3ANGA 2YVXA 4B3AA 3FHNA 3O60A 5FMPA 3CRJA 2UXOA 3O8GA 4M3BA 1U9NA 4GCKA 2OPTA 2WGBA 2GFNA 1JUSA 5D18A 3AQSA 1RKTA 3PM1A 5FHPA 2R7RA 1JT0A 3S5RA 4XK4A 2W53A 4GCTA 5K7HA 3DPJA 3O8HA 2IU5A 2HYJA 3LSPA 2NP3A 2ZCNA 4OD5A 4D7MA 3BR6A 4AC6A 3BR3A 1QVTA 5F04A 2A2FX 2R7XA 3DU5A 2IEKA 5FKKA 2HYTA 5C4YA 3ZQIA 2XPWA 4GFLA 3KZ9A 2OF7A 4D5CA 2UXIA 3LOCA 4MO7A 2I10A 5EZHA 4CGRA 4UDSA 3G1MA 1UI6A 3PPBA 2RASA 4ABZA 4JNNA 4D7NA 3Q0UA 3ZQGA 3FRQA 3DCFA
chains in the Genus database with same CATH topology
2GUHA 3HTHA 3NNRA 4B1RA 3Q0WA 3C07A 3NRGA 2G7LA 3E7QA 3ZQHA 2RAEA 4GFKA 3CJDA 3TP3A 5K7ZA 5FKOA 3HGYA 1A6IA 2PZ9A 3HGGA 3CDLA 3VVZA 2VPRA 5FGLA 5FKNA 2RHAA 3BR0A 5F0CA 2HXIA 3VOKA 4D5FA 4M3EA 4V2FA 2V57A 2ID6A 2YVEA 3NXCA 2QWTA 3BTLA 2QOPA 4AUXA 2FBQA 1Z77A 3NI7A 4M3GA 1JTYA 4DW6A 5DAJA 2O7OA 2FD5A 2IBDA 3BCGA 4NELA 2NS8A 3HTJA 3GZIA 4W1UA 1ZKGA 1JTXA 2Y31A 3ZQLA 2GBYA 3SDGA 5J1YA 3VP5A 2G0EA 1VI0A 5F0FA 3VPRA 3VW2A 3AQTA 1RPWA 3ON2A 1RKWA 1ZK8A 2OERA 4JKZA 5EFYA 5IP6A 3Q0VA 2TCTA 3FK6A 3QPLA 3GEUA 2QTQA 3JSJA 4MK6A 4I6ZA 3C2BA 3VW1A 1QVUA 2O7TA 3G1LA 2Y30A 3G7RA 1U9OA 2QKOA 4AF5A 3QBMA 2G7GA 3BRUA 2WV1A 2X9DA 2XRLA 3SFIA 3EUPA 3LWJA 3BR5A 3VOXA 3VVXA 4V2GA 3G1OA 5K58A 3COLA 3IH2A 2ZB9A 3ANPA 4X1EA 3IH4A 2UXUA 3WHCA 2NP5A 4ACIA 2HXOA 5J3LA 5CXIA 4ICHA 3IUVA 3FK7A 2EH3A 3EGQA 4MXMA 5F08A 5F1JA 2YVHA 3BQZA 4L62A 3V6GA 1Z0XA 2TRTA 1JT6A 3KNWA 4W97A 1ORKA 3BTJA 2D6YA 5FKLA 5AQCA 5HSZA 3LHQA 3CWRA 4GCLA 3ZQFA 1QPIA 3HTAA 4PXIA 2XGCA 2ZCXA 4NN1A 5EYRA 5K7FA 2PBXA 2G7SA 4HKUA 2DG7A 2GENA 3G56A 3HTIA 4YZEA 5EZGA 2X6OA 3P9TA 5J1UA 4I76A 1BJZA 2XPVA 3BJBA 2JJ7A 2FJ1A 5HBUA 3PASA 5IPAA 2FQ4A 2Q24A 2ZOZA 5GPCA 3RD3A 4ME9A 1JUMA 2NS7A 5CW8A 2NX4A 1T33A 2DTZA 2XPUA 3F0CA 3DEWA 2XDNA 3QKXA 4AC0A 5J1RA 2UXHA 5H9TA 4G12A 3RH2A 2HQ5A 3LSJA 2UXPA 5IOZA 2XGDA 3HIMA 3KKCA 5FKMA 2ID3A 2ZOYA 3CCYA 4JL3A 2ZCMA 1JUPA 2REKA 3LJLA 2WUIA 3ON4A 3Q3SA 3V78A 3BR2A 3BT9A 2OI8A 3BTIA 3VVYA 3BHQA 3VUQA 3QQAA 5CXGA 4JYKA 3LSRA 2HKUA 5GPAA 3MVPA 3BTCA 1SGMA 3BR1A 5D19A 3FIWA 3QPSA 4M3DA 5HAWA 5GP9A 2JK3A 2IAIA 2DG8A 2QIBA 2Y2ZA 2FX0A 1T56A 2VKEA 3BNIA 3KKDA 3VIBA 3F1BA 5F27A 4M3FA 3VW0A 3WHBA 5D1RA 1UI5A 2XB5A 2QCOA 2VKVA 3B6AA 2G3BA 3T6NA 3IH3A 3NPIA 3TP0A 3B81A 3MNLA 4KWAA 3BQYA 5IOYA 2F07A 3HE0A 5F0HA 3B6CA 2XGEA 3ANGA 4B3AA 3O60A 5FMPA 3CRJA 2UXOA 3O8GA 4M3BA 1U9NA 4GCKA 2OPTA 2WGBA 2GFNA 1JUSA 5D18A 3AQSA 1RKTA 3PM1A 5FHPA 1JT0A 3S5RA 4XK4A 2W53A 4GCTA 5K7HA 3DPJA 3O8HA 2IU5A 2HYJA 3LSPA 2NP3A 2ZCNA 4D7MA 3BR6A 4AC6A 3BR3A 1QVTA 5F04A 2IEKA 5FKKA 2HYTA 5C4YA 3ZQIA 2XPWA 4GFLA 3KZ9A 2OF7A 4D5CA 2UXIA 3LOCA 4MO7A 2I10A 5EZHA 4CGRA 4UDSA 3G1MA 1UI6A 3PPBA 2RASA 4ABZA 4JNNA 4D7NA 3Q0UA 3ZQGA 3FRQA 3DCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUH A;  3HTH A;  3NNR A;  4B1R A;  3Q0W A;  3C07 A;  3NRG A;  2G7L A;  3E7Q A;  3ZQH A;  2RAE A;  4GFK A;  3CJD A;  3TP3 A;  5K7Z A;  5FKO A;  3HGY A;  1A6I A;  2PZ9 A;  3HGG A;  3CDL A;  3VVZ A;  2VPR A;  5FGL A;  5FKN A;  2RHA A;  3BR0 A;  5F0C A;  2HXI A;  3VOK A;  4D5F A;  4M3E A;  4V2F A;  2V57 A;  2ID6 A;  2YVE A;  3NXC A;  2QWT A;  3BTL A;  2QOP A;  4AUX A;  2FBQ A;  1Z77 A;  3NI7 A;  4M3G A;  1JTY A;  4DW6 A;  5DAJ A;  2O7O A;  2FD5 A;  2IBD A;  3BCG A;  4NEL A;  2NS8 A;  3HTJ A;  3GZI A;  4W1U A;  1ZKG A;  1JTX A;  2Y31 A;  3ZQL A;  2GBY A;  3SDG A;  5J1Y A;  3VP5 A;  2G0E A;  1VI0 A;  5F0F A;  3VPR A;  3VW2 A;  3AQT A;  1RPW A;  3ON2 A;  1RKW A;  1ZK8 A;  2OER A;  4JKZ A;  5EFY A;  5IP6 A;  3Q0V A;  2TCT A;  3FK6 A;  3QPL A;  3GEU A;  2QTQ A;  3JSJ A;  4MK6 A;  4I6Z A;  3C2B A;  3VW1 A;  1QVU A;  2O7T A;  3G1L A;  2Y30 A;  3G7R A;  1U9O A;  2QKO A;  4AF5 A;  3QBM A;  2G7G A;  3BRU A;  2WV1 A;  2X9D A;  2XRL A;  3SFI A;  3EUP A;  3LWJ A;  3BR5 A;  3VOX A;  3VVX A;  4V2G A;  3G1O A;  5K58 A;  3COL A;  3IH2 A;  2ZB9 A;  3ANP A;  4X1E A;  3IH4 A;  2UXU A;  3WHC A;  2NP5 A;  4ACI A;  2HXO A;  5J3L A;  5CXI A;  4ICH A;  3IUV A;  3FK7 A;  2EH3 A;  3EGQ A;  4MXM A;  5F08 A;  5F1J A;  2YVH A;  3BQZ A;  4L62 A;  3V6G A;  1Z0X A;  2TRT A;  1JT6 A;  3KNW A;  4W97 A;  1ORK A;  3BTJ A;  2D6Y A;  5FKL A;  5AQC A;  5HSZ A;  3LHQ A;  3CWR A;  4GCL A;  3ZQF A;  1QPI A;  3HTA A;  4PXI A;  2XGC A;  2ZCX A;  4NN1 A;  5EYR A;  5K7F A;  2PBX A;  2G7S A;  4HKU A;  2DG7 A;  2GEN A;  3G56 A;  3HTI A;  4YZE A;  5EZG A;  2X6O A;  3P9T A;  5J1U A;  4I76 A;  1BJZ A;  2XPV A;  3BJB A;  2JJ7 A;  2FJ1 A;  5HBU A;  3PAS A;  5IPA A;  2FQ4 A;  2Q24 A;  2ZOZ A;  5GPC A;  3RD3 A;  4ME9 A;  1JUM A;  2NS7 A;  5CW8 A;  2NX4 A;  1T33 A;  2DTZ A;  2XPU A;  3F0C A;  3DEW A;  2XDN A;  3QKX A;  4AC0 A;  5J1R A;  2UXH A;  5H9T A;  4G12 A;  3RH2 A;  2HQ5 A;  3LSJ A;  2UXP A;  5IOZ A;  2XGD A;  3HIM A;  3KKC A;  5FKM A;  2ID3 A;  2ZOY A;  3CCY A;  4JL3 A;  2ZCM A;  1JUP A;  2REK A;  3LJL A;  2WUI A;  3ON4 A;  3Q3S A;  3V78 A;  3BR2 A;  3BT9 A;  2OI8 A;  3BTI A;  3VVY A;  3BHQ A;  3VUQ A;  3QQA A;  5CXG A;  4JYK A;  3LSR A;  2HKU A;  5GPA A;  3MVP A;  3BTC A;  1SGM A;  3BR1 A;  5D19 A;  3FIW A;  3QPS A;  4M3D A;  5HAW A;  5GP9 A;  2JK3 A;  2IAI A;  2DG8 A;  2QIB A;  2Y2Z A;  2FX0 A;  1T56 A;  2VKE A;  3BNI A;  3KKD A;  3VIB A;  3F1B A;  5F27 A;  4M3F A;  3VW0 A;  3WHB A;  5D1R A;  1UI5 A;  2XB5 A;  2QCO A;  2VKV A;  3B6A A;  2G3B A;  3T6N A;  3IH3 A;  3NPI A;  3TP0 A;  3B81 A;  3MNL A;  4KWA A;  3BQY A;  5IOY A;  2F07 A;  3HE0 A;  5F0H A;  3B6C A;  2XGE A;  3ANG A;  4B3A A;  3O60 A;  5FMP A;  3CRJ A;  2UXO A;  3O8G A;  4M3B A;  1U9N A;  4GCK A;  2OPT A;  2WGB A;  2GFN A;  1JUS A;  5D18 A;  3AQS A;  1RKT A;  3PM1 A;  5FHP A;  1JT0 A;  3S5R A;  4XK4 A;  2W53 A;  4GCT A;  5K7H A;  3DPJ A;  3O8H A;  2IU5 A;  2HYJ A;  3LSP A;  2NP3 A;  2ZCN A;  4D7M A;  3BR6 A;  4AC6 A;  3BR3 A;  1QVT A;  5F04 A;  2IEK A;  5FKK A;  2HYT A;  5C4Y A;  3ZQI A;  2XPW A;  4GFL A;  3KZ9 A;  2OF7 A;  4D5C A;  2UXI A;  3LOC A;  4MO7 A;  2I10 A;  5EZH A;  4CGR A;  4UDS A;  3G1M A;  1UI6 A;  3PPB A;  2RAS A;  4ABZ A;  4JNN A;  4D7N A;  3Q0U A;  3ZQG A;  3FRQ A;  3DCF A; 
#chains in the Genus database with same CATH topology
 2GUH A;  3HTH A;  3NNR A;  4B1R A;  3Q0W A;  3C07 A;  3NRG A;  2G7L A;  3E7Q A;  3ZQH A;  3NS4 A;  2RAE A;  4GFK A;  3CJD A;  3TP3 A;  5K7Z A;  2R7O A;  5FKO A;  3SWH A;  3HGY A;  1A6I A;  2PZ9 A;  3HGG A;  3CDL A;  3VVZ A;  2R7U A;  2VPR A;  5FGL A;  5CQG A;  5FKN A;  2RHA A;  4U9L A;  3BR0 A;  5F0C A;  2HXI A;  3VOK A;  4DVY P;  4D5F A;  4M3E A;  4V2F A;  2V57 A;  2ID6 A;  2YVE A;  3NXC A;  2QWT A;  3BTL A;  2QOP A;  4AUX A;  2FBQ A;  1Z77 A;  3NI7 A;  4M3G A;  1JTY A;  4DW6 A;  5DAJ A;  2O7O A;  2FD5 A;  2IBD A;  2R7S A;  3BCG A;  4NEL A;  2PFV A;  2NS8 A;  3HTJ A;  3GZI A;  4W1U A;  1ZKG A;  1JTX A;  2Y31 A;  3ZQL A;  2GBY A;  3SDG A;  5J1Y A;  3VP5 A;  2G0E A;  1VI0 A;  5F0F A;  3DU6 A;  3VPR A;  3VW2 A;  3AQT A;  1RPW A;  3ON2 A;  1RKW A;  1ZK8 A;  2OER A;  4JKZ A;  5EFY A;  5IP6 A;  3Q0V A;  2TCT A;  3FK6 A;  3QPL A;  3GEU A;  2QTQ A;  3JSJ A;  2ZY9 A;  4MK6 A;  4I6Z A;  3C2B A;  3VW1 A;  1QVU A;  2O7T A;  3G1L A;  2Y30 A;  3G7R A;  1U9O A;  2QKO A;  4AF5 A;  3QBM A;  2R7Q A;  2G7G A;  3BRU A;  2WV1 A;  2X9D A;  2XRL A;  3SFI A;  3EUP A;  3LWJ A;  3BR5 A;  3VOX A;  3VVX A;  4V2G A;  3G1O A;  5K58 A;  3COL A;  3IH2 A;  2ZB9 A;  3ANP A;  4X1E A;  3IH4 A;  2UXU A;  3WHC A;  2NP5 A;  4ACI A;  2HXO A;  5J3L A;  5CXI A;  4ICH A;  3IUV A;  3FK7 A;  2EH3 A;  3EGQ A;  4MXM A;  5F08 A;  5F1J A;  2YVH A;  3BQZ A;  4L62 A;  3V6G A;  1Z0X A;  2TRT A;  1JT6 A;  3KNW A;  4W97 A;  1ORK A;  3BTJ A;  2D6Y A;  5FKL A;  5AQC A;  5HSZ A;  3LHQ A;  3CWR A;  4OD4 A;  4GCL A;  3ZQF A;  1QPI A;  3HTA A;  4PXI A;  2XGC A;  2ZCX A;  4NN1 A;  5EYR A;  5K7F A;  2PBX A;  2G7S A;  4HKU A;  2DG7 A;  2GEN A;  3G56 A;  3HTI A;  3VTI A;  4YZE A;  5EZG A;  2X6O A;  4WIB A;  3P9T A;  5J1U A;  4I76 A;  1BJZ A;  2XPV A;  3BJB A;  2JJ7 A;  2FJ1 A;  5HBU A;  3PAS A;  5IPA A;  2FQ4 A;  2Q24 A;  2ZOZ A;  5GPC A;  3RD3 A;  4ME9 A;  1JUM A;  2NS7 A;  5CW8 A;  2NX4 A;  1T33 A;  2DTZ A;  2XPU A;  3F0C A;  3DEW A;  2XDN A;  3QKX A;  4AC0 A;  5J1R A;  2UXH A;  5H9T A;  4G12 A;  3RH2 A;  2HQ5 A;  3LSJ A;  2UXP A;  5IOZ A;  2R7W A;  2XGD A;  3HIM A;  3KKC A;  5FKM A;  4U9N A;  3KYL A;  2ID3 A;  3K8P C;  2ZOY A;  2B1E A;  3CCY A;  4JL3 A;  2ZCM A;  1JUP A;  2REK A;  3LJL A;  2WUI A;  3ON4 A;  3Q3S A;  3V78 A;  2B3W A;  3BR2 A;  3BT9 A;  2OI8 A;  2R7T A;  3BTI A;  3VVY A;  3BHQ A;  3VUQ A;  3QQA A;  5CXG A;  4JYK A;  3LSR A;  2HKU A;  5GPA A;  3MVP A;  3BTC A;  1SGM A;  3BR1 A;  5D19 A;  3FIW A;  3QPS A;  4M3D A;  5HAW A;  5GP9 A;  2JK3 A;  2IAI A;  2DG8 A;  2QIB A;  2Y2Z A;  2FX0 A;  4C2M A;  1T56 A;  2VKE A;  3BNI A;  3KKD A;  3VIB A;  3F1B A;  5F27 A;  2R7V A;  4M3F A;  4IRV A;  3VW0 A;  3WHB A;  5D1R A;  1UI5 A;  2XB5 A;  2QCO A;  2VKV A;  3B6A A;  2G3B A;  3T6N A;  3IH3 A;  3NPI A;  3TP0 A;  3B81 A;  3MNL A;  4KWA A;  3BQY A;  5IOY A;  2F07 A;  2FJI 1;  3HE0 A;  5F0H A;  3B6C A;  2XGE A;  3ANG A;  2YVX A;  4B3A A;  3FHN A;  3O60 A;  5FMP A;  3CRJ A;  2UXO A;  3O8G A;  4M3B A;  1U9N A;  4GCK A;  2OPT A;  2WGB A;  2GFN A;  1JUS A;  5D18 A;  3AQS A;  1RKT A;  3PM1 A;  5FHP A;  2R7R A;  1JT0 A;  3S5R A;  4XK4 A;  2W53 A;  4GCT A;  5K7H A;  3DPJ A;  3O8H A;  2IU5 A;  2HYJ A;  3LSP A;  2NP3 A;  2ZCN A;  4OD5 A;  4D7M A;  3BR6 A;  4AC6 A;  3BR3 A;  1QVT A;  5F04 A;  2A2F X;  2R7X A;  3DU5 A;  2IEK A;  5FKK A;  2HYT A;  5C4Y A;  3ZQI A;  2XPW A;  4GFL A;  3KZ9 A;  2OF7 A;  4D5C A;  2UXI A;  3LOC A;  4MO7 A;  2I10 A;  5EZH A;  4CGR A;  4UDS A;  3G1M A;  1UI6 A;  3PPB A;  2RAS A;  4ABZ A;  4JNN A;  4D7N A;  3Q0U A;  3ZQG A;  3FRQ A;  3DCF A; 
#chains in the Genus database with same CATH homology
 2GUH A;  3HTH A;  3NNR A;  4B1R A;  3Q0W A;  3C07 A;  3NRG A;  2G7L A;  3E7Q A;  3ZQH A;  2RAE A;  4GFK A;  3CJD A;  3TP3 A;  5K7Z A;  5FKO A;  3HGY A;  1A6I A;  2PZ9 A;  3HGG A;  3CDL A;  3VVZ A;  2VPR A;  5FGL A;  5FKN A;  2RHA A;  3BR0 A;  5F0C A;  2HXI A;  3VOK A;  4D5F A;  4M3E A;  4V2F A;  2V57 A;  2ID6 A;  2YVE A;  3NXC A;  2QWT A;  3BTL A;  2QOP A;  4AUX A;  2FBQ A;  1Z77 A;  3NI7 A;  4M3G A;  1JTY A;  4DW6 A;  5DAJ A;  2O7O A;  2FD5 A;  2IBD A;  3BCG A;  4NEL A;  2NS8 A;  3HTJ A;  3GZI A;  4W1U A;  1ZKG A;  1JTX A;  2Y31 A;  3ZQL A;  2GBY A;  3SDG A;  5J1Y A;  3VP5 A;  2G0E A;  1VI0 A;  5F0F A;  3VPR A;  3VW2 A;  3AQT A;  1RPW A;  3ON2 A;  1RKW A;  1ZK8 A;  2OER A;  4JKZ A;  5EFY A;  5IP6 A;  3Q0V A;  2TCT A;  3FK6 A;  3QPL A;  3GEU A;  2QTQ A;  3JSJ A;  4MK6 A;  4I6Z A;  3C2B A;  3VW1 A;  1QVU A;  2O7T A;  3G1L A;  2Y30 A;  3G7R A;  1U9O A;  2QKO A;  4AF5 A;  3QBM A;  2G7G A;  3BRU A;  2WV1 A;  2X9D A;  2XRL A;  3SFI A;  3EUP A;  3LWJ A;  3BR5 A;  3VOX A;  3VVX A;  4V2G A;  3G1O A;  5K58 A;  3COL A;  3IH2 A;  2ZB9 A;  3ANP A;  4X1E A;  3IH4 A;  2UXU A;  3WHC A;  2NP5 A;  4ACI A;  2HXO A;  5J3L A;  5CXI A;  4ICH A;  3IUV A;  3FK7 A;  2EH3 A;  3EGQ A;  4MXM A;  5F08 A;  5F1J A;  2YVH A;  3BQZ A;  4L62 A;  3V6G A;  1Z0X A;  2TRT A;  1JT6 A;  3KNW A;  4W97 A;  1ORK A;  3BTJ A;  2D6Y A;  5FKL A;  5AQC A;  5HSZ A;  3LHQ A;  3CWR A;  4GCL A;  3ZQF A;  1QPI A;  3HTA A;  4PXI A;  2XGC A;  2ZCX A;  4NN1 A;  5EYR A;  5K7F A;  2PBX A;  2G7S A;  4HKU A;  2DG7 A;  2GEN A;  3G56 A;  3HTI A;  4YZE A;  5EZG A;  2X6O A;  3P9T A;  5J1U A;  4I76 A;  1BJZ A;  2XPV A;  3BJB A;  2JJ7 A;  2FJ1 A;  5HBU A;  3PAS A;  5IPA A;  2FQ4 A;  2Q24 A;  2ZOZ A;  5GPC A;  3RD3 A;  4ME9 A;  1JUM A;  2NS7 A;  5CW8 A;  2NX4 A;  1T33 A;  2DTZ A;  2XPU A;  3F0C A;  3DEW A;  2XDN A;  3QKX A;  4AC0 A;  5J1R A;  2UXH A;  5H9T A;  4G12 A;  3RH2 A;  2HQ5 A;  3LSJ A;  2UXP A;  5IOZ A;  2XGD A;  3HIM A;  3KKC A;  5FKM A;  2ID3 A;  2ZOY A;  3CCY A;  4JL3 A;  2ZCM A;  1JUP A;  2REK A;  3LJL A;  2WUI A;  3ON4 A;  3Q3S A;  3V78 A;  3BR2 A;  3BT9 A;  2OI8 A;  3BTI A;  3VVY A;  3BHQ A;  3VUQ A;  3QQA A;  5CXG A;  4JYK A;  3LSR A;  2HKU A;  5GPA A;  3MVP A;  3BTC A;  1SGM A;  3BR1 A;  5D19 A;  3FIW A;  3QPS A;  4M3D A;  5HAW A;  5GP9 A;  2JK3 A;  2IAI A;  2DG8 A;  2QIB A;  2Y2Z A;  2FX0 A;  1T56 A;  2VKE A;  3BNI A;  3KKD A;  3VIB A;  3F1B A;  5F27 A;  4M3F A;  3VW0 A;  3WHB A;  5D1R A;  1UI5 A;  2XB5 A;  2QCO A;  2VKV A;  3B6A A;  2G3B A;  3T6N A;  3IH3 A;  3NPI A;  3TP0 A;  3B81 A;  3MNL A;  4KWA A;  3BQY A;  5IOY A;  2F07 A;  3HE0 A;  5F0H A;  3B6C A;  2XGE A;  3ANG A;  4B3A A;  3O60 A;  5FMP A;  3CRJ A;  2UXO A;  3O8G A;  4M3B A;  1U9N A;  4GCK A;  2OPT A;  2WGB A;  2GFN A;  1JUS A;  5D18 A;  3AQS A;  1RKT A;  3PM1 A;  5FHP A;  1JT0 A;  3S5R A;  4XK4 A;  2W53 A;  4GCT A;  5K7H A;  3DPJ A;  3O8H A;  2IU5 A;  2HYJ A;  3LSP A;  2NP3 A;  2ZCN A;  4D7M A;  3BR6 A;  4AC6 A;  3BR3 A;  1QVT A;  5F04 A;  2IEK A;  5FKK A;  2HYT A;  5C4Y A;  3ZQI A;  2XPW A;  4GFL A;  3KZ9 A;  2OF7 A;  4D5C A;  2UXI A;  3LOC A;  4MO7 A;  2I10 A;  5EZH A;  4CGR A;  4UDS A;  3G1M A;  1UI6 A;  3PPB A;  2RAS A;  4ABZ A;  4JNN A;  4D7N A;  3Q0U A;  3ZQG A;  3FRQ A;  3DCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...