4YZEA

Crystal structure of e.coli nemr reduced form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
b'HDTREHLLATGEQLSLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAYHQRLTELLQSGEGNYRDRILAYYQQTLNQFSQHGTISGCLTVKLSAEVSDLSEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAHVKNIIATPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor NemR
molecule tags Transcription
source organism Escherichia coli
publication title Does the Transcription Factor NemR Use a Regulatory Sulfenamide Bond to Sense Bleach?
pubmed doi rcsb
total genus 74
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4yzeA00
4ME9A 4B1RA 2O7OA 4KWAA 3GZIA 3E7QA 3VW0A 5CW8A 3F0CA 2FJ1A 2GFNA 3GEUA 2ZB9A 2HQ5A 2WGBA 2FX0A 4D7NA 3BR3A 3LOCA 5EFYA 1RKTA 2IAIA 5EZGA 3HGGA 3VUQA 4DW6A 1SGMA 3O8HA 5FKMA 3AQTA 5FKLA 5J1UA 3VOKA 4ABZA 2UXPA 1Z0XA 3CJDA 3NRGA 2HXIA 4GCLA 3QPLA 2VPRA 3QPSA 3NPIA 2DG8A 4G12A 2RHAA 5FKOA 2ID3A 3ZQLA 3VIBA 4D7MA 3BR1A 2IEKA 2NP5A 2FQ4A 2XGCA 3IH2A 3BHQA 1U9NA 3BR2A 2VKVA 2XGEA 3ZQFA 3VVYA 1JTYA 1JT0A 4AC0A 3CWRA 1VI0A 2QTQA 3BR0A 3ANPA 1JTXA 4D5FA 2ZCMA 3IH3A 4AF5A 3Q0VA 2XB5A 3T6NA 5F0FA 2G7SA 4V2FA 4W1UA 1RPWA 4NELA 3Q0WA 5FKKA 2PBXA 3HTHA 3NNRA 3G7RA 4M3BA 4MO7A 2HKUA 1RKWA 3BQYA 2NX4A 3DEWA 1JUSA 2G0EA 3KKDA 5CXGA 2G7GA 3IH4A 1JUMA 3Q0UA 2O7TA 3CCYA 2ID6A 3V78A 3HGYA 3WHCA 3BJBA 3JSJA 3SFIA 5J3LA 4UDSA 5IOZA 2UXHA 5GP9A 5IOYA 3ANGA 3VVZA 1Z77A 4AUXA 3V6GA 5H9TA 3LSPA 2ZCXA 3LWJA 3MVPA 3VOXA 5F08A 5GPCA 5F0HA 4GFLA 3FRQA 2Y30A 3C07A 5F1JA 1ORKA 4ICHA 3ZQIA 3VW2A 5K7ZA 3IUVA 3BR5A 4PXIA 4I6ZA 4JL3A 3B6CA 5D18A 2WV1A 4M3GA 2OPTA 3DPJA 3TP3A 1ZK8A 4AC6A 1QPIA 3BRUA 2GUHA 3FK7A 2QKOA 2ZOYA 2FD5A 2VKEA 3G1OA 3BTLA 5F04A 3LHQA 3KZ9A 2XRLA 5J1RA 4B3AA 2REKA 3ON2A 5HBUA 2GBYA 4HKUA 4X1EA 2JJ7A 5AQCA 5EZHA 3VW1A 4CGRA 2V57A 5K7HA 3BTCA 2G3BA 2OI8A 2DTZA 5J1YA 3S5RA 3HE0A 5FHPA 4JYKA 5C4YA 4XK4A 3O60A 2I10A 3PASA 3ZQGA 2QCOA 1UI6A 5IPAA 3AQSA 2TCTA 3BTJA 3B81A 2D6YA 4JNNA 5F0CA 1JT6A 2PZ9A 2NP3A 3SDGA 4GCTA 2ZCNA 2UXOA 1ZKGA 3F1BA 2YVHA 2RASA 4D5CA 4MK6A 3G1LA 3BQZA 2ZOZA 5GPAA 4NN1A 1U9OA 2G7LA 2W53A 2XPWA 2WUIA 3VVXA 5IP6A 3PPBA 4YZEA 3CDLA 5D1RA 1A6IA 3RH2A 1BJZA 2EH3A 3QKXA 1QVUA 3ON4A 3G56A 1QVTA 4M3DA 4GCKA 2TRTA 2Y2ZA 3COLA 3BT9A 2Y31A 2DG7A 3KKCA 3G1MA 3LJLA 3FK6A 3BTIA 3HTIA 2NS8A 3VPRA 2GENA 3P9TA 2HYJA 2XPVA 4M3FA 3C2BA 1UI5A 2YVEA 3NI7A 2OERA 5EYRA 3TP0A 5HAWA 3BR6A 3VP5A 2XGDA 3HIMA 2QIBA 4MXMA 3DCFA 5K7FA 5K58A 3CRJA 2OF7A 4GFKA 4I76A 3FIWA 3B6AA 5DAJA 2IU5A 3EUPA 1T33A 4M3EA 2FBQA 2UXUA 3QQAA 2JK3A 3MNLA 3O8GA 4JKZA 3EGQA 2QWTA 3HTJA 2XPUA 5HSZA 5D19A 2Q24A 3NXCA 3QBMA 3Q3SA 2RAEA 3ZQHA 4W97A 2HYTA 2QOPA 5CXIA 2UXIA 3RD3A 3BNIA 3HTAA 4ACIA 5FKNA 2X6OA 2HXOA 2IBDA 5FGLA 2XDNA 2F07A 1JUPA 5F27A 2NS7A 3WHBA 3LSJA 4L62A 2X9DA 5FMPA 3LSRA 3BCGA 3KNWA 3PM1A 4V2GA 1T56A
chains in the Genus database with same CATH superfamily
4ME9A 2R7WA 4B1RA 2O7OA 4KWAA 2R7TA 3DU6A 3GZIA 3E7QA 3VW0A 5CW8A 3F0CA 2FJ1A 2GFNA 3GEUA 2ZB9A 2HQ5A 2WGBA 2FX0A 2R7RA 4D7NA 3K8PC 3BR3A 3LOCA 5EFYA 1RKTA 2IAIA 5EZGA 4U9LA 3HGGA 3VUQA 4DW6A 1SGMA 3O8HA 5FKMA 3AQTA 3VTIA 5FKLA 5J1UA 2R7SA 3KYLA 3VOKA 4ABZA 2UXPA 1Z0XA 3CJDA 3NRGA 2HXIA 4GCLA 3QPLA 2VPRA 3QPSA 3NPIA 2DG8A 3DU5A 4G12A 2RHAA 5FKOA 2ID3A 3ZQLA 3VIBA 4D7MA 3BR1A 2IEKA 2NP5A 2FQ4A 2XGCA 3IH2A 3BHQA 1U9NA 3BR2A 2VKVA 2XGEA 3ZQFA 2FJI1 3VVYA 1JTYA 1JT0A 4AC0A 3CWRA 1VI0A 2QTQA 3BR0A 3ANPA 1JTXA 4D5FA 2ZCMA 3IH3A 4AF5A 3Q0VA 2XB5A 3T6NA 5F0FA 2G7SA 4V2FA 4W1UA 1RPWA 4NELA 3Q0WA 5FKKA 2PBXA 3HTHA 3NNRA 3G7RA 4M3BA 4MO7A 2HKUA 1RKWA 3BQYA 2NX4A 3DEWA 1JUSA 2G0EA 3KKDA 5CXGA 2G7GA 3IH4A 1JUMA 3Q0UA 2O7TA 3CCYA 2ID6A 3V78A 3HGYA 3WHCA 3BJBA 3JSJA 3SFIA 5J3LA 4UDSA 5IOZA 2UXHA 5GP9A 4IRVA 5IOYA 3ANGA 3VVZA 1Z77A 4AUXA 3V6GA 5H9TA 2R7OA 3LSPA 2ZCXA 3LWJA 3MVPA 3VOXA 5F08A 5GPCA 5F0HA 4GFLA 3FRQA 2Y30A 3C07A 5F1JA 1ORKA 4ICHA 3ZQIA 3VW2A 5K7ZA 3IUVA 3BR5A 4PXIA 4I6ZA 3SWHA 4JL3A 3B6CA 5D18A 2WV1A 4M3GA 2OPTA 3DPJA 3TP3A 1ZK8A 4AC6A 1QPIA 3BRUA 2GUHA 3FK7A 2QKOA 2ZOYA 2FD5A 2VKEA 3G1OA 3BTLA 5F04A 2A2FX 3LHQA 3KZ9A 2XRLA 5J1RA 4B3AA 2REKA 3ON2A 5HBUA 2GBYA 4HKUA 4X1EA 2JJ7A 5AQCA 5EZHA 3VW1A 4CGRA 2V57A 5K7HA 3BTCA 2G3BA 2OI8A 2DTZA 5J1YA 4DVYP 3S5RA 3HE0A 5FHPA 4JYKA 5C4YA 4XK4A 2YVXA 3O60A 2I10A 3PASA 3ZQGA 2B3WA 1UI6A 2QCOA 5IPAA 3AQSA 2TCTA 3BTJA 5CQGA 3B81A 2D6YA 4JNNA 5F0CA 1JT6A 2PZ9A 2NP3A 3SDGA 4GCTA 2ZCNA 2B1EA 2UXOA 1ZKGA 3F1BA 2YVHA 2RASA 4D5CA 4MK6A 3G1LA 3BQZA 2ZOZA 5GPAA 4NN1A 1U9OA 2G7LA 2W53A 2XPWA 2WUIA 3VVXA 5IP6A 3PPBA 2PFVA 4YZEA 3CDLA 5D1RA 1A6IA 3RH2A 1BJZA 3NS4A 2EH3A 3QKXA 1QVUA 3ON4A 4C2MA 3G56A 1QVTA 4M3DA 4GCKA 2TRTA 2R7VA 4WIBA 2Y2ZA 3COLA 3BT9A 2Y31A 2DG7A 3KKCA 3G1MA 3LJLA 3FK6A 4OD4A 3BTIA 3HTIA 2NS8A 3VPRA 2R7UA 2GENA 3P9TA 2HYJA 2XPVA 4M3FA 3C2BA 1UI5A 2YVEA 3NI7A 2OERA 5EYRA 3TP0A 5HAWA 3BR6A 3VP5A 2XGDA 3FHNA 3HIMA 2QIBA 4MXMA 3DCFA 5K7FA 5K58A 3CRJA 2OF7A 4GFKA 4I76A 3FIWA 3B6AA 5DAJA 2IU5A 4U9NA 3EUPA 1T33A 4M3EA 2FBQA 2UXUA 3QQAA 4OD5A 2JK3A 3MNLA 3O8GA 4JKZA 3EGQA 2QWTA 3HTJA 2XPUA 5HSZA 5D19A 2Q24A 3NXCA 3QBMA 3Q3SA 2RAEA 3ZQHA 4W97A 2HYTA 2QOPA 5CXIA 2UXIA 3RD3A 3BNIA 3HTAA 4ACIA 5FKNA 2X6OA 2HXOA 2IBDA 2R7QA 5FGLA 2R7XA 2XDNA 2F07A 1JUPA 5F27A 2NS7A 3WHBA 3LSJA 4L62A 2X9DA 5FMPA 3LSRA 3BCGA 2ZY9A 3KNWA 3PM1A 4V2GA 1T56A
chains in the Genus database with same CATH topology
4ME9A 4B1RA 2O7OA 4KWAA 3GZIA 3E7QA 3VW0A 5CW8A 3F0CA 2FJ1A 2GFNA 3GEUA 2ZB9A 2HQ5A 2WGBA 2FX0A 4D7NA 3BR3A 3LOCA 5EFYA 1RKTA 2IAIA 5EZGA 3HGGA 3VUQA 4DW6A 1SGMA 3O8HA 5FKMA 3AQTA 5FKLA 5J1UA 3VOKA 4ABZA 2UXPA 1Z0XA 3CJDA 3NRGA 2HXIA 4GCLA 3QPLA 2VPRA 3QPSA 3NPIA 2DG8A 4G12A 2RHAA 5FKOA 2ID3A 3ZQLA 3VIBA 4D7MA 3BR1A 2IEKA 2NP5A 2FQ4A 2XGCA 3IH2A 3BHQA 1U9NA 3BR2A 2VKVA 2XGEA 3ZQFA 3VVYA 1JTYA 1JT0A 4AC0A 3CWRA 1VI0A 2QTQA 3BR0A 3ANPA 1JTXA 4D5FA 2ZCMA 3IH3A 4AF5A 3Q0VA 2XB5A 3T6NA 5F0FA 2G7SA 4V2FA 4W1UA 1RPWA 4NELA 3Q0WA 5FKKA 2PBXA 3HTHA 3NNRA 3G7RA 4M3BA 4MO7A 2HKUA 1RKWA 3BQYA 2NX4A 3DEWA 1JUSA 2G0EA 3KKDA 5CXGA 2G7GA 3IH4A 1JUMA 3Q0UA 2O7TA 3CCYA 2ID6A 3V78A 3HGYA 3WHCA 3BJBA 3JSJA 3SFIA 5J3LA 4UDSA 5IOZA 2UXHA 5GP9A 5IOYA 3ANGA 3VVZA 1Z77A 4AUXA 3V6GA 5H9TA 3LSPA 2ZCXA 3LWJA 3MVPA 3VOXA 5F08A 5GPCA 5F0HA 4GFLA 3FRQA 2Y30A 3C07A 5F1JA 1ORKA 4ICHA 3ZQIA 3VW2A 5K7ZA 3IUVA 3BR5A 4PXIA 4I6ZA 4JL3A 3B6CA 5D18A 2WV1A 4M3GA 2OPTA 3DPJA 3TP3A 1ZK8A 4AC6A 1QPIA 3BRUA 2GUHA 3FK7A 2QKOA 2ZOYA 2FD5A 2VKEA 3G1OA 3BTLA 5F04A 3LHQA 3KZ9A 2XRLA 5J1RA 4B3AA 2REKA 3ON2A 5HBUA 2GBYA 4HKUA 4X1EA 2JJ7A 5AQCA 5EZHA 3VW1A 4CGRA 2V57A 5K7HA 3BTCA 2G3BA 2OI8A 2DTZA 5J1YA 3S5RA 3HE0A 5FHPA 4JYKA 5C4YA 4XK4A 3O60A 2I10A 3PASA 3ZQGA 2QCOA 1UI6A 5IPAA 3AQSA 2TCTA 3BTJA 3B81A 2D6YA 4JNNA 5F0CA 1JT6A 2PZ9A 2NP3A 3SDGA 4GCTA 2ZCNA 2UXOA 1ZKGA 3F1BA 2YVHA 2RASA 4D5CA 4MK6A 3G1LA 3BQZA 2ZOZA 5GPAA 4NN1A 1U9OA 2G7LA 2W53A 2XPWA 2WUIA 3VVXA 5IP6A 3PPBA 4YZEA 3CDLA 5D1RA 1A6IA 3RH2A 1BJZA 2EH3A 3QKXA 1QVUA 3ON4A 3G56A 1QVTA 4M3DA 4GCKA 2TRTA 2Y2ZA 3COLA 3BT9A 2Y31A 2DG7A 3KKCA 3G1MA 3LJLA 3FK6A 3BTIA 3HTIA 2NS8A 3VPRA 2GENA 3P9TA 2HYJA 2XPVA 4M3FA 3C2BA 1UI5A 2YVEA 3NI7A 2OERA 5EYRA 3TP0A 5HAWA 3BR6A 3VP5A 2XGDA 3HIMA 2QIBA 4MXMA 3DCFA 5K7FA 5K58A 3CRJA 2OF7A 4GFKA 4I76A 3FIWA 3B6AA 5DAJA 2IU5A 3EUPA 1T33A 4M3EA 2FBQA 2UXUA 3QQAA 2JK3A 3MNLA 3O8GA 4JKZA 3EGQA 2QWTA 3HTJA 2XPUA 5HSZA 5D19A 2Q24A 3NXCA 3QBMA 3Q3SA 2RAEA 3ZQHA 4W97A 2HYTA 2QOPA 5CXIA 2UXIA 3RD3A 3BNIA 3HTAA 4ACIA 5FKNA 2X6OA 2HXOA 2IBDA 5FGLA 2XDNA 2F07A 1JUPA 5F27A 2NS7A 3WHBA 3LSJA 4L62A 2X9DA 5FMPA 3LSRA 3BCGA 3KNWA 3PM1A 4V2GA 1T56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME9 A;  4B1R A;  2O7O A;  4KWA A;  3GZI A;  3E7Q A;  3VW0 A;  5CW8 A;  3F0C A;  2FJ1 A;  2GFN A;  3GEU A;  2ZB9 A;  2HQ5 A;  2WGB A;  2FX0 A;  4D7N A;  3BR3 A;  3LOC A;  5EFY A;  1RKT A;  2IAI A;  5EZG A;  3HGG A;  3VUQ A;  4DW6 A;  1SGM A;  3O8H A;  5FKM A;  3AQT A;  5FKL A;  5J1U A;  3VOK A;  4ABZ A;  2UXP A;  1Z0X A;  3CJD A;  3NRG A;  2HXI A;  4GCL A;  3QPL A;  2VPR A;  3QPS A;  3NPI A;  2DG8 A;  4G12 A;  2RHA A;  5FKO A;  2ID3 A;  3ZQL A;  3VIB A;  4D7M A;  3BR1 A;  2IEK A;  2NP5 A;  2FQ4 A;  2XGC A;  3IH2 A;  3BHQ A;  1U9N A;  3BR2 A;  2VKV A;  2XGE A;  3ZQF A;  3VVY A;  1JTY A;  1JT0 A;  4AC0 A;  3CWR A;  1VI0 A;  2QTQ A;  3BR0 A;  3ANP A;  1JTX A;  4D5F A;  2ZCM A;  3IH3 A;  4AF5 A;  3Q0V A;  2XB5 A;  3T6N A;  5F0F A;  2G7S A;  4V2F A;  4W1U A;  1RPW A;  4NEL A;  3Q0W A;  5FKK A;  2PBX A;  3HTH A;  3NNR A;  3G7R A;  4M3B A;  4MO7 A;  2HKU A;  1RKW A;  3BQY A;  2NX4 A;  3DEW A;  1JUS A;  2G0E A;  3KKD A;  5CXG A;  2G7G A;  3IH4 A;  1JUM A;  3Q0U A;  2O7T A;  3CCY A;  2ID6 A;  3V78 A;  3HGY A;  3WHC A;  3BJB A;  3JSJ A;  3SFI A;  5J3L A;  4UDS A;  5IOZ A;  2UXH A;  5GP9 A;  5IOY A;  3ANG A;  3VVZ A;  1Z77 A;  4AUX A;  3V6G A;  5H9T A;  3LSP A;  2ZCX A;  3LWJ A;  3MVP A;  3VOX A;  5F08 A;  5GPC A;  5F0H A;  4GFL A;  3FRQ A;  2Y30 A;  3C07 A;  5F1J A;  1ORK A;  4ICH A;  3ZQI A;  3VW2 A;  5K7Z A;  3IUV A;  3BR5 A;  4PXI A;  4I6Z A;  4JL3 A;  3B6C A;  5D18 A;  2WV1 A;  4M3G A;  2OPT A;  3DPJ A;  3TP3 A;  1ZK8 A;  4AC6 A;  1QPI A;  3BRU A;  2GUH A;  3FK7 A;  2QKO A;  2ZOY A;  2FD5 A;  2VKE A;  3G1O A;  3BTL A;  5F04 A;  3LHQ A;  3KZ9 A;  2XRL A;  5J1R A;  4B3A A;  2REK A;  3ON2 A;  5HBU A;  2GBY A;  4HKU A;  4X1E A;  2JJ7 A;  5AQC A;  5EZH A;  3VW1 A;  4CGR A;  2V57 A;  5K7H A;  3BTC A;  2G3B A;  2OI8 A;  2DTZ A;  5J1Y A;  3S5R A;  3HE0 A;  5FHP A;  4JYK A;  5C4Y A;  4XK4 A;  3O60 A;  2I10 A;  3PAS A;  3ZQG A;  2QCO A;  1UI6 A;  5IPA A;  3AQS A;  2TCT A;  3BTJ A;  3B81 A;  2D6Y A;  4JNN A;  5F0C A;  1JT6 A;  2PZ9 A;  2NP3 A;  3SDG A;  4GCT A;  2ZCN A;  2UXO A;  1ZKG A;  3F1B A;  2YVH A;  2RAS A;  4D5C A;  4MK6 A;  3G1L A;  3BQZ A;  2ZOZ A;  5GPA A;  4NN1 A;  1U9O A;  2G7L A;  2W53 A;  2XPW A;  2WUI A;  3VVX A;  5IP6 A;  3PPB A;  4YZE A;  3CDL A;  5D1R A;  1A6I A;  3RH2 A;  1BJZ A;  2EH3 A;  3QKX A;  1QVU A;  3ON4 A;  3G56 A;  1QVT A;  4M3D A;  4GCK A;  2TRT A;  2Y2Z A;  3COL A;  3BT9 A;  2Y31 A;  2DG7 A;  3KKC A;  3G1M A;  3LJL A;  3FK6 A;  3BTI A;  3HTI A;  2NS8 A;  3VPR A;  2GEN A;  3P9T A;  2HYJ A;  2XPV A;  4M3F A;  3C2B A;  1UI5 A;  2YVE A;  3NI7 A;  2OER A;  5EYR A;  3TP0 A;  5HAW A;  3BR6 A;  3VP5 A;  2XGD A;  3HIM A;  2QIB A;  4MXM A;  3DCF A;  5K7F A;  5K58 A;  3CRJ A;  2OF7 A;  4GFK A;  4I76 A;  3FIW A;  3B6A A;  5DAJ A;  2IU5 A;  3EUP A;  1T33 A;  4M3E A;  2FBQ A;  2UXU A;  3QQA A;  2JK3 A;  3MNL A;  3O8G A;  4JKZ A;  3EGQ A;  2QWT A;  3HTJ A;  2XPU A;  5HSZ A;  5D19 A;  2Q24 A;  3NXC A;  3QBM A;  3Q3S A;  2RAE A;  3ZQH A;  4W97 A;  2HYT A;  2QOP A;  5CXI A;  2UXI A;  3RD3 A;  3BNI A;  3HTA A;  4ACI A;  5FKN A;  2X6O A;  2HXO A;  2IBD A;  5FGL A;  2XDN A;  2F07 A;  1JUP A;  5F27 A;  2NS7 A;  3WHB A;  3LSJ A;  4L62 A;  2X9D A;  5FMP A;  3LSR A;  3BCG A;  3KNW A;  3PM1 A;  4V2G A;  1T56 A; 
#chains in the Genus database with same CATH topology
 4ME9 A;  2R7W A;  4B1R A;  2O7O A;  4KWA A;  2R7T A;  3DU6 A;  3GZI A;  3E7Q A;  3VW0 A;  5CW8 A;  3F0C A;  2FJ1 A;  2GFN A;  3GEU A;  2ZB9 A;  2HQ5 A;  2WGB A;  2FX0 A;  2R7R A;  4D7N A;  3K8P C;  3BR3 A;  3LOC A;  5EFY A;  1RKT A;  2IAI A;  5EZG A;  4U9L A;  3HGG A;  3VUQ A;  4DW6 A;  1SGM A;  3O8H A;  5FKM A;  3AQT A;  3VTI A;  5FKL A;  5J1U A;  2R7S A;  3KYL A;  3VOK A;  4ABZ A;  2UXP A;  1Z0X A;  3CJD A;  3NRG A;  2HXI A;  4GCL A;  3QPL A;  2VPR A;  3QPS A;  3NPI A;  2DG8 A;  3DU5 A;  4G12 A;  2RHA A;  5FKO A;  2ID3 A;  3ZQL A;  3VIB A;  4D7M A;  3BR1 A;  2IEK A;  2NP5 A;  2FQ4 A;  2XGC A;  3IH2 A;  3BHQ A;  1U9N A;  3BR2 A;  2VKV A;  2XGE A;  3ZQF A;  2FJI 1;  3VVY A;  1JTY A;  1JT0 A;  4AC0 A;  3CWR A;  1VI0 A;  2QTQ A;  3BR0 A;  3ANP A;  1JTX A;  4D5F A;  2ZCM A;  3IH3 A;  4AF5 A;  3Q0V A;  2XB5 A;  3T6N A;  5F0F A;  2G7S A;  4V2F A;  4W1U A;  1RPW A;  4NEL A;  3Q0W A;  5FKK A;  2PBX A;  3HTH A;  3NNR A;  3G7R A;  4M3B A;  4MO7 A;  2HKU A;  1RKW A;  3BQY A;  2NX4 A;  3DEW A;  1JUS A;  2G0E A;  3KKD A;  5CXG A;  2G7G A;  3IH4 A;  1JUM A;  3Q0U A;  2O7T A;  3CCY A;  2ID6 A;  3V78 A;  3HGY A;  3WHC A;  3BJB A;  3JSJ A;  3SFI A;  5J3L A;  4UDS A;  5IOZ A;  2UXH A;  5GP9 A;  4IRV A;  5IOY A;  3ANG A;  3VVZ A;  1Z77 A;  4AUX A;  3V6G A;  5H9T A;  2R7O A;  3LSP A;  2ZCX A;  3LWJ A;  3MVP A;  3VOX A;  5F08 A;  5GPC A;  5F0H A;  4GFL A;  3FRQ A;  2Y30 A;  3C07 A;  5F1J A;  1ORK A;  4ICH A;  3ZQI A;  3VW2 A;  5K7Z A;  3IUV A;  3BR5 A;  4PXI A;  4I6Z A;  3SWH A;  4JL3 A;  3B6C A;  5D18 A;  2WV1 A;  4M3G A;  2OPT A;  3DPJ A;  3TP3 A;  1ZK8 A;  4AC6 A;  1QPI A;  3BRU A;  2GUH A;  3FK7 A;  2QKO A;  2ZOY A;  2FD5 A;  2VKE A;  3G1O A;  3BTL A;  5F04 A;  2A2F X;  3LHQ A;  3KZ9 A;  2XRL A;  5J1R A;  4B3A A;  2REK A;  3ON2 A;  5HBU A;  2GBY A;  4HKU A;  4X1E A;  2JJ7 A;  5AQC A;  5EZH A;  3VW1 A;  4CGR A;  2V57 A;  5K7H A;  3BTC A;  2G3B A;  2OI8 A;  2DTZ A;  5J1Y A;  4DVY P;  3S5R A;  3HE0 A;  5FHP A;  4JYK A;  5C4Y A;  4XK4 A;  2YVX A;  3O60 A;  2I10 A;  3PAS A;  3ZQG A;  2B3W A;  1UI6 A;  2QCO A;  5IPA A;  3AQS A;  2TCT A;  3BTJ A;  5CQG A;  3B81 A;  2D6Y A;  4JNN A;  5F0C A;  1JT6 A;  2PZ9 A;  2NP3 A;  3SDG A;  4GCT A;  2ZCN A;  2B1E A;  2UXO A;  1ZKG A;  3F1B A;  2YVH A;  2RAS A;  4D5C A;  4MK6 A;  3G1L A;  3BQZ A;  2ZOZ A;  5GPA A;  4NN1 A;  1U9O A;  2G7L A;  2W53 A;  2XPW A;  2WUI A;  3VVX A;  5IP6 A;  3PPB A;  2PFV A;  4YZE A;  3CDL A;  5D1R A;  1A6I A;  3RH2 A;  1BJZ A;  3NS4 A;  2EH3 A;  3QKX A;  1QVU A;  3ON4 A;  4C2M A;  3G56 A;  1QVT A;  4M3D A;  4GCK A;  2TRT A;  2R7V A;  4WIB A;  2Y2Z A;  3COL A;  3BT9 A;  2Y31 A;  2DG7 A;  3KKC A;  3G1M A;  3LJL A;  3FK6 A;  4OD4 A;  3BTI A;  3HTI A;  2NS8 A;  3VPR A;  2R7U A;  2GEN A;  3P9T A;  2HYJ A;  2XPV A;  4M3F A;  3C2B A;  1UI5 A;  2YVE A;  3NI7 A;  2OER A;  5EYR A;  3TP0 A;  5HAW A;  3BR6 A;  3VP5 A;  2XGD A;  3FHN A;  3HIM A;  2QIB A;  4MXM A;  3DCF A;  5K7F A;  5K58 A;  3CRJ A;  2OF7 A;  4GFK A;  4I76 A;  3FIW A;  3B6A A;  5DAJ A;  2IU5 A;  4U9N A;  3EUP A;  1T33 A;  4M3E A;  2FBQ A;  2UXU A;  3QQA A;  4OD5 A;  2JK3 A;  3MNL A;  3O8G A;  4JKZ A;  3EGQ A;  2QWT A;  3HTJ A;  2XPU A;  5HSZ A;  5D19 A;  2Q24 A;  3NXC A;  3QBM A;  3Q3S A;  2RAE A;  3ZQH A;  4W97 A;  2HYT A;  2QOP A;  5CXI A;  2UXI A;  3RD3 A;  3BNI A;  3HTA A;  4ACI A;  5FKN A;  2X6O A;  2HXO A;  2IBD A;  2R7Q A;  5FGL A;  2R7X A;  2XDN A;  2F07 A;  1JUP A;  5F27 A;  2NS7 A;  3WHB A;  3LSJ A;  4L62 A;  2X9D A;  5FMP A;  3LSR A;  3BCG A;  2ZY9 A;  3KNW A;  3PM1 A;  4V2G A;  1T56 A; 
#chains in the Genus database with same CATH homology
 4ME9 A;  4B1R A;  2O7O A;  4KWA A;  3GZI A;  3E7Q A;  3VW0 A;  5CW8 A;  3F0C A;  2FJ1 A;  2GFN A;  3GEU A;  2ZB9 A;  2HQ5 A;  2WGB A;  2FX0 A;  4D7N A;  3BR3 A;  3LOC A;  5EFY A;  1RKT A;  2IAI A;  5EZG A;  3HGG A;  3VUQ A;  4DW6 A;  1SGM A;  3O8H A;  5FKM A;  3AQT A;  5FKL A;  5J1U A;  3VOK A;  4ABZ A;  2UXP A;  1Z0X A;  3CJD A;  3NRG A;  2HXI A;  4GCL A;  3QPL A;  2VPR A;  3QPS A;  3NPI A;  2DG8 A;  4G12 A;  2RHA A;  5FKO A;  2ID3 A;  3ZQL A;  3VIB A;  4D7M A;  3BR1 A;  2IEK A;  2NP5 A;  2FQ4 A;  2XGC A;  3IH2 A;  3BHQ A;  1U9N A;  3BR2 A;  2VKV A;  2XGE A;  3ZQF A;  3VVY A;  1JTY A;  1JT0 A;  4AC0 A;  3CWR A;  1VI0 A;  2QTQ A;  3BR0 A;  3ANP A;  1JTX A;  4D5F A;  2ZCM A;  3IH3 A;  4AF5 A;  3Q0V A;  2XB5 A;  3T6N A;  5F0F A;  2G7S A;  4V2F A;  4W1U A;  1RPW A;  4NEL A;  3Q0W A;  5FKK A;  2PBX A;  3HTH A;  3NNR A;  3G7R A;  4M3B A;  4MO7 A;  2HKU A;  1RKW A;  3BQY A;  2NX4 A;  3DEW A;  1JUS A;  2G0E A;  3KKD A;  5CXG A;  2G7G A;  3IH4 A;  1JUM A;  3Q0U A;  2O7T A;  3CCY A;  2ID6 A;  3V78 A;  3HGY A;  3WHC A;  3BJB A;  3JSJ A;  3SFI A;  5J3L A;  4UDS A;  5IOZ A;  2UXH A;  5GP9 A;  5IOY A;  3ANG A;  3VVZ A;  1Z77 A;  4AUX A;  3V6G A;  5H9T A;  3LSP A;  2ZCX A;  3LWJ A;  3MVP A;  3VOX A;  5F08 A;  5GPC A;  5F0H A;  4GFL A;  3FRQ A;  2Y30 A;  3C07 A;  5F1J A;  1ORK A;  4ICH A;  3ZQI A;  3VW2 A;  5K7Z A;  3IUV A;  3BR5 A;  4PXI A;  4I6Z A;  4JL3 A;  3B6C A;  5D18 A;  2WV1 A;  4M3G A;  2OPT A;  3DPJ A;  3TP3 A;  1ZK8 A;  4AC6 A;  1QPI A;  3BRU A;  2GUH A;  3FK7 A;  2QKO A;  2ZOY A;  2FD5 A;  2VKE A;  3G1O A;  3BTL A;  5F04 A;  3LHQ A;  3KZ9 A;  2XRL A;  5J1R A;  4B3A A;  2REK A;  3ON2 A;  5HBU A;  2GBY A;  4HKU A;  4X1E A;  2JJ7 A;  5AQC A;  5EZH A;  3VW1 A;  4CGR A;  2V57 A;  5K7H A;  3BTC A;  2G3B A;  2OI8 A;  2DTZ A;  5J1Y A;  3S5R A;  3HE0 A;  5FHP A;  4JYK A;  5C4Y A;  4XK4 A;  3O60 A;  2I10 A;  3PAS A;  3ZQG A;  2QCO A;  1UI6 A;  5IPA A;  3AQS A;  2TCT A;  3BTJ A;  3B81 A;  2D6Y A;  4JNN A;  5F0C A;  1JT6 A;  2PZ9 A;  2NP3 A;  3SDG A;  4GCT A;  2ZCN A;  2UXO A;  1ZKG A;  3F1B A;  2YVH A;  2RAS A;  4D5C A;  4MK6 A;  3G1L A;  3BQZ A;  2ZOZ A;  5GPA A;  4NN1 A;  1U9O A;  2G7L A;  2W53 A;  2XPW A;  2WUI A;  3VVX A;  5IP6 A;  3PPB A;  4YZE A;  3CDL A;  5D1R A;  1A6I A;  3RH2 A;  1BJZ A;  2EH3 A;  3QKX A;  1QVU A;  3ON4 A;  3G56 A;  1QVT A;  4M3D A;  4GCK A;  2TRT A;  2Y2Z A;  3COL A;  3BT9 A;  2Y31 A;  2DG7 A;  3KKC A;  3G1M A;  3LJL A;  3FK6 A;  3BTI A;  3HTI A;  2NS8 A;  3VPR A;  2GEN A;  3P9T A;  2HYJ A;  2XPV A;  4M3F A;  3C2B A;  1UI5 A;  2YVE A;  3NI7 A;  2OER A;  5EYR A;  3TP0 A;  5HAW A;  3BR6 A;  3VP5 A;  2XGD A;  3HIM A;  2QIB A;  4MXM A;  3DCF A;  5K7F A;  5K58 A;  3CRJ A;  2OF7 A;  4GFK A;  4I76 A;  3FIW A;  3B6A A;  5DAJ A;  2IU5 A;  3EUP A;  1T33 A;  4M3E A;  2FBQ A;  2UXU A;  3QQA A;  2JK3 A;  3MNL A;  3O8G A;  4JKZ A;  3EGQ A;  2QWT A;  3HTJ A;  2XPU A;  5HSZ A;  5D19 A;  2Q24 A;  3NXC A;  3QBM A;  3Q3S A;  2RAE A;  3ZQH A;  4W97 A;  2HYT A;  2QOP A;  5CXI A;  2UXI A;  3RD3 A;  3BNI A;  3HTA A;  4ACI A;  5FKN A;  2X6O A;  2HXO A;  2IBD A;  5FGL A;  2XDN A;  2F07 A;  1JUP A;  5F27 A;  2NS7 A;  3WHB A;  3LSJ A;  4L62 A;  2X9D A;  5FMP A;  3LSR A;  3BCG A;  3KNW A;  3PM1 A;  4V2G A;  1T56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...