4YZEA

Crystal structure of e.coli nemr reduced form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
HDTREHLLATGEQLSLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAYHQRLTELLQSGEGNYRDRILAYYQQTLNQFSQHGTISGCLTVKLSAEVSDLSEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAHVKNIIATPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor NemR
publication title Does the Transcription Factor NemR Use a Regulatory Sulfenamide Bond to Sense Bleach?
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4yzeA00
3VW0A 3O8GA 5CXGA 4GFLA 2HXOA 2ID3A 5EYRA 2O7TA 3COLA 2ZOZA 5IOZA 3G1LA 2OI8A 4M3FA 3DPJA 2XPUA 3MNLA 2GENA 2XPVA 1T56A 2IBDA 2QIBA 5FGLA 2NS7A 3BQYA 3RH2A 4NN1A 2IU5A 4D5CA 3EUPA 3HGYA 4NELA 3DEWA 5HBUA 2G7LA 1QPIA 1JT6A 3BHQA 3HTIA 4D7MA 4D7NA 3KZ9A 3NRGA 3BJBA 1JUMA 3GEUA 1RKWA 3Q0VA 2EH3A 3ZQGA 4AF5A 3HTJA 1UI6A 2UXOA 2PBXA 2RAEA 4M3GA 3TP0A 1ZKGA 3VW2A 5D1RA 3HGGA 5K58A 2FX0A 3PASA 2ZCNA 1JUSA 5EZHA 1QVTA 4MXMA 3FIWA 4JKZA 2Y30A 5C4YA 3G1OA 2OPTA 5IPAA 3V78A 5F27A 3O60A 5FMPA 2OF7A 4GCLA 3QPLA 3P9TA 2JJ7A 3G1MA 5D19A 2RHAA 2XDNA 4JL3A 3LSPA 2Y2ZA 3CCYA 2FD5A 2DTZA 2ZB9A 2GFNA 3RD3A 3V6GA 3BTIA 2ZCMA 2NP5A 3IH3A 3ZQLA 4JNNA 1SGMA 5J1YA 3G56A 2QWTA 2ZOYA 4GCTA 3MVPA 3Q3SA 5HAWA 3BQZA 4G12A 2NX4A 1Z77A 1ORKA 3BTLA 4ICHA 3F0CA 3C2BA 2HKUA 3DCFA 4JYKA 3ZQIA 4XK4A 3IH4A 3NPIA 2HXIA 3ANPA 5F0CA 3AQSA 5K7HA 3ON4A 3HE0A 4AC6A 3VW1A 4AUXA 5CW8A 3GZIA 5F0HA 4L62A 4GFKA 2QCOA 3CDLA 1JT0A 3SFIA 2XGCA 3ZQHA 3JSJA 3O8HA 3VOXA 3IUVA 3QBMA 5GPAA 2W53A 2VKEA 4W97A 5K7ZA 2X9DA 2WUIA 2QOPA 3CRJA 3CJDA 2Q24A 3B6AA 5F08A 5H9TA 5CXIA 2G7SA 5EZGA 1QVUA 4UDSA 5IOYA 4I6ZA 3F1BA 2G7GA 3BNIA 1U9OA 5J1UA 2UXUA 3Q0UA 2VPRA 3QPSA 3LOCA 3KNWA 4M3DA 5F0FA 2Y31A 4X1EA 3BR0A 3BR3A 3QQAA 2ID6A 2F07A 3FRQA 2XPWA 3T6NA 1U9NA 3BR1A 1VI0A 3VP5A 5D18A 3VOKA 4B3AA 3ANGA 5FKOA 1BJZA 4PXIA 2V57A 4CGRA 5FKKA 1ZK8A 3VPRA 3VVYA 4D5FA 2QKOA 1JTXA 3HTAA 1T33A 3BR2A 2VKVA 2ZCXA 4YZEA 5EFYA 2UXPA 2RASA 2XB5A 2IAIA 2FQ4A 5K7FA 2IEKA 3AQTA 4MK6A 3KKCA 3QKXA 3B6CA 3VVXA 2FJ1A 1JTYA 2X6OA 4HKUA 2DG7A 2QTQA 2UXIA 3G7RA 5HSZA 3Q0WA 2NS8A 3SDGA 3PM1A 3NNRA 5J3LA 3HIMA 3NI7A 2NP3A 2OERA 2O7OA 3B81A 2WGBA 3VIBA 3BTJA 2YVHA 5FKNA 3VVZA 1Z0XA 3HTHA 3NXCA 5FKMA 4I76A 2HQ5A 3WHBA 3S5RA 3PPBA 4ACIA 2XGDA 3BR5A 1UI5A 3KKDA 5J1RA 5FHPA 5GPCA 4ABZA 1RPWA 2TCTA 4MO7A 3VUQA 1RKTA 3FK7A 2GUHA 2GBYA 4GCKA 3LSJA 5AQCA 4W1UA 3CWRA 3BRUA 3FK6A 3ON2A 4M3EA 3BCGA 5F04A 4V2FA 3E7QA 2JK3A 5GP9A 3LSRA 2UXHA 3LWJA 2D6YA 3LJLA 4AC0A 2XRLA 2HYTA 2HYJA 3WHCA 2PZ9A 4KWAA 5F1JA 4ME9A 3EGQA 3LHQA 1A6IA 4M3BA 2DG8A 3ZQFA 2TRTA 2I10A 4V2GA 3BT9A 3IH2A 4B1RA 3C07A 2G0EA 2G3BA 5FKLA 1JUPA 2FBQA 2YVEA 5DAJA 3BTCA 4DW6A 2XGEA 5IP6A 3BR6A 2REKA 2WV1A 3TP3A
chains in the Genus database with same CATH superfamily
3VW0A 3O8GA 5CXGA 4GFLA 2HXOA 2ID3A 5EYRA 2O7TA 3FHNA 3COLA 2ZOZA 5IOZA 3G1LA 2OI8A 4M3FA 3DPJA 2XPUA 3MNLA 2GENA 2XPVA 1T56A 2IBDA 2QIBA 5FGLA 2NS7A 3BQYA 3RH2A 4NN1A 2IU5A 4D5CA 3EUPA 3HGYA 4NELA 3DEWA 5HBUA 2G7LA 1QPIA 2R7XA 3DU6A 1JT6A 3BHQA 3HTIA 3NS4A 4D7MA 4D7NA 3KZ9A 3NRGA 3BJBA 1JUMA 3GEUA 1RKWA 3Q0VA 2EH3A 3ZQGA 4AF5A 3HTJA 1UI6A 2FJI1 2UXOA 2PBXA 2RAEA 4M3GA 3TP0A 1ZKGA 3VW2A 5D1RA 3HGGA 5K58A 2FX0A 4C2MA 3PASA 2ZCNA 1JUSA 5EZHA 1QVTA 4MXMA 3FIWA 4JKZA 2Y30A 5C4YA 3G1OA 2OPTA 5IPAA 3V78A 5F27A 3O60A 2PFVA 5FMPA 2OF7A 4GCLA 4U9NA 3QPLA 3P9TA 4WIBA 2JJ7A 3G1MA 5D19A 2RHAA 2XDNA 4JL3A 3LSPA 2Y2ZA 3CCYA 2FD5A 2DTZA 2ZB9A 2GFNA 3RD3A 3VTIA 3V6GA 3BTIA 2ZCMA 2NP5A 3IH3A 3ZQLA 4JNNA 1SGMA 5J1YA 2R7WA 3G56A 4U9LA 2QWTA 2ZOYA 3K8PC 4GCTA 3MVPA 3Q3SA 5HAWA 3BQZA 4G12A 2NX4A 1Z77A 1ORKA 3BTLA 4ICHA 3F0CA 3C2BA 2HKUA 3DCFA 4JYKA 3ZQIA 4XK4A 3IH4A 2R7OA 3NPIA 2HXIA 3ANPA 5F0CA 3AQSA 5K7HA 3ON4A 3HE0A 4AC6A 3VW1A 4AUXA 5CW8A 3GZIA 5F0HA 4L62A 4GFKA 2QCOA 3CDLA 1JT0A 3SFIA 2XGCA 3ZQHA 3JSJA 3O8HA 3VOXA 3IUVA 3QBMA 5GPAA 2W53A 2VKEA 4W97A 5K7ZA 2R7TA 2X9DA 2WUIA 2QOPA 3CRJA 3CJDA 2Q24A 3B6AA 5F08A 5H9TA 5CXIA 2G7SA 5EZGA 3DU5A 1QVUA 4UDSA 5IOYA 2B1EA 4I6ZA 3F1BA 2A2FX 2G7GA 3BNIA 1U9OA 4OD5A 5J1UA 2UXUA 3Q0UA 2VPRA 3QPSA 3LOCA 3KNWA 4M3DA 5F0FA 2Y31A 4X1EA 2R7QA 3BR0A 3BR3A 3QQAA 2ID6A 2F07A 3FRQA 2XPWA 3T6NA 1U9NA 3BR1A 1VI0A 3VP5A 5D18A 3VOKA 4B3AA 3ANGA 5FKOA 1BJZA 4PXIA 2R7UA 2V57A 4CGRA 5FKKA 1ZK8A 3VPRA 3VVYA 4D5FA 2QKOA 1JTXA 3HTAA 1T33A 3BR2A 2VKVA 2ZCXA 4YZEA 5EFYA 2UXPA 2RASA 2XB5A 2IAIA 2FQ4A 5K7FA 2R7SA 2IEKA 2B3WA 3AQTA 4MK6A 3KKCA 3QKXA 3B6CA 3VVXA 2FJ1A 1JTYA 3KYLA 2X6OA 4HKUA 2DG7A 2QTQA 2UXIA 3G7RA 5HSZA 3Q0WA 2NS8A 3SDGA 3PM1A 3NNRA 5J3LA 3HIMA 3NI7A 2NP3A 2OERA 2O7OA 2R7RA 3B81A 2WGBA 3BTJA 3VIBA 2YVHA 5FKNA 3VVZA 1Z0XA 3HTHA 3NXCA 5FKMA 2YVXA 4I76A 2HQ5A 3WHBA 3S5RA 3PPBA 4ACIA 2XGDA 3BR5A 1UI5A 3KKDA 5J1RA 4DVYP 2ZY9A 5FHPA 5GPCA 2R7VA 4ABZA 1RPWA 2TCTA 4MO7A 3VUQA 1RKTA 3FK7A 2GUHA 2GBYA 4GCKA 3LSJA 5AQCA 4W1UA 4OD4A 3CWRA 3BRUA 3FK6A 3ON2A 4M3EA 3BCGA 5F04A 4V2FA 3E7QA 2JK3A 5GP9A 3SWHA 4IRVA 3LSRA 2UXHA 3LWJA 2D6YA 3LJLA 4AC0A 2XRLA 2HYTA 2HYJA 5CQGA 3WHCA 2PZ9A 4KWAA 5F1JA 4ME9A 3EGQA 3LHQA 1A6IA 4M3BA 2DG8A 3ZQFA 2TRTA 2I10A 4V2GA 3BT9A 3IH2A 4B1RA 3C07A 2G0EA 2G3BA 5FKLA 1JUPA 2FBQA 2YVEA 5DAJA 3BTCA 4DW6A 2XGEA 5IP6A 3BR6A 2REKA 2WV1A 3TP3A
chains in the Genus database with same CATH topology
3VW0A 3O8GA 5CXGA 4GFLA 2HXOA 2ID3A 5EYRA 2O7TA 3COLA 2ZOZA 5IOZA 3G1LA 2OI8A 4M3FA 3DPJA 2XPUA 3MNLA 2GENA 2XPVA 1T56A 2IBDA 2QIBA 5FGLA 2NS7A 3BQYA 3RH2A 4NN1A 2IU5A 4D5CA 3EUPA 3HGYA 4NELA 3DEWA 5HBUA 2G7LA 1QPIA 1JT6A 3BHQA 3HTIA 4D7MA 4D7NA 3KZ9A 3NRGA 3BJBA 1JUMA 3GEUA 1RKWA 3Q0VA 2EH3A 3ZQGA 4AF5A 3HTJA 1UI6A 2UXOA 2PBXA 2RAEA 4M3GA 3TP0A 1ZKGA 3VW2A 5D1RA 3HGGA 5K58A 2FX0A 3PASA 2ZCNA 1JUSA 5EZHA 1QVTA 4MXMA 3FIWA 4JKZA 2Y30A 5C4YA 3G1OA 2OPTA 5IPAA 3V78A 5F27A 3O60A 5FMPA 2OF7A 4GCLA 3QPLA 3P9TA 2JJ7A 3G1MA 5D19A 2RHAA 2XDNA 4JL3A 3LSPA 2Y2ZA 3CCYA 2FD5A 2DTZA 2ZB9A 2GFNA 3RD3A 3V6GA 3BTIA 2ZCMA 2NP5A 3IH3A 3ZQLA 4JNNA 1SGMA 5J1YA 3G56A 2QWTA 2ZOYA 4GCTA 3MVPA 3Q3SA 5HAWA 3BQZA 4G12A 2NX4A 1Z77A 1ORKA 3BTLA 4ICHA 3F0CA 3C2BA 2HKUA 3DCFA 4JYKA 3ZQIA 4XK4A 3IH4A 3NPIA 2HXIA 3ANPA 5F0CA 3AQSA 5K7HA 3ON4A 3HE0A 4AC6A 3VW1A 4AUXA 5CW8A 3GZIA 5F0HA 4L62A 4GFKA 2QCOA 3CDLA 1JT0A 3SFIA 2XGCA 3ZQHA 3JSJA 3O8HA 3VOXA 3IUVA 3QBMA 5GPAA 2W53A 2VKEA 4W97A 5K7ZA 2X9DA 2WUIA 2QOPA 3CRJA 3CJDA 2Q24A 3B6AA 5F08A 5H9TA 5CXIA 2G7SA 5EZGA 1QVUA 4UDSA 5IOYA 4I6ZA 3F1BA 2G7GA 3BNIA 1U9OA 5J1UA 2UXUA 3Q0UA 2VPRA 3QPSA 3LOCA 3KNWA 4M3DA 5F0FA 2Y31A 4X1EA 3BR0A 3BR3A 3QQAA 2ID6A 2F07A 3FRQA 2XPWA 3T6NA 1U9NA 3BR1A 1VI0A 3VP5A 5D18A 3VOKA 4B3AA 3ANGA 5FKOA 1BJZA 4PXIA 2V57A 4CGRA 5FKKA 1ZK8A 3VPRA 3VVYA 4D5FA 2QKOA 1JTXA 3HTAA 1T33A 3BR2A 2VKVA 2ZCXA 4YZEA 5EFYA 2UXPA 2RASA 2XB5A 2IAIA 2FQ4A 5K7FA 2IEKA 3AQTA 4MK6A 3KKCA 3QKXA 3B6CA 3VVXA 2FJ1A 1JTYA 2X6OA 4HKUA 2DG7A 2QTQA 2UXIA 3G7RA 5HSZA 3Q0WA 2NS8A 3SDGA 3PM1A 3NNRA 5J3LA 3HIMA 3NI7A 2NP3A 2OERA 2O7OA 3B81A 2WGBA 3VIBA 3BTJA 2YVHA 5FKNA 3VVZA 1Z0XA 3HTHA 3NXCA 5FKMA 4I76A 2HQ5A 3WHBA 3S5RA 3PPBA 4ACIA 2XGDA 3BR5A 1UI5A 3KKDA 5J1RA 5FHPA 5GPCA 4ABZA 1RPWA 2TCTA 4MO7A 3VUQA 1RKTA 3FK7A 2GUHA 2GBYA 4GCKA 3LSJA 5AQCA 4W1UA 3CWRA 3BRUA 3FK6A 3ON2A 4M3EA 3BCGA 5F04A 4V2FA 3E7QA 2JK3A 5GP9A 3LSRA 2UXHA 3LWJA 2D6YA 3LJLA 4AC0A 2XRLA 2HYTA 2HYJA 3WHCA 2PZ9A 4KWAA 5F1JA 4ME9A 3EGQA 3LHQA 1A6IA 4M3BA 2DG8A 3ZQFA 2TRTA 2I10A 4V2GA 3BT9A 3IH2A 4B1RA 3C07A 2G0EA 2G3BA 5FKLA 1JUPA 2FBQA 2YVEA 5DAJA 3BTCA 4DW6A 2XGEA 5IP6A 3BR6A 2REKA 2WV1A 3TP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VW0 A;  3O8G A;  5CXG A;  4GFL A;  2HXO A;  2ID3 A;  5EYR A;  2O7T A;  3COL A;  2ZOZ A;  5IOZ A;  3G1L A;  2OI8 A;  4M3F A;  3DPJ A;  2XPU A;  3MNL A;  2GEN A;  2XPV A;  1T56 A;  2IBD A;  2QIB A;  5FGL A;  2NS7 A;  3BQY A;  3RH2 A;  4NN1 A;  2IU5 A;  4D5C A;  3EUP A;  3HGY A;  4NEL A;  3DEW A;  5HBU A;  2G7L A;  1QPI A;  1JT6 A;  3BHQ A;  3HTI A;  4D7M A;  4D7N A;  3KZ9 A;  3NRG A;  3BJB A;  1JUM A;  3GEU A;  1RKW A;  3Q0V A;  2EH3 A;  3ZQG A;  4AF5 A;  3HTJ A;  1UI6 A;  2UXO A;  2PBX A;  2RAE A;  4M3G A;  3TP0 A;  1ZKG A;  3VW2 A;  5D1R A;  3HGG A;  5K58 A;  2FX0 A;  3PAS A;  2ZCN A;  1JUS A;  5EZH A;  1QVT A;  4MXM A;  3FIW A;  4JKZ A;  2Y30 A;  5C4Y A;  3G1O A;  2OPT A;  5IPA A;  3V78 A;  5F27 A;  3O60 A;  5FMP A;  2OF7 A;  4GCL A;  3QPL A;  3P9T A;  2JJ7 A;  3G1M A;  5D19 A;  2RHA A;  2XDN A;  4JL3 A;  3LSP A;  2Y2Z A;  3CCY A;  2FD5 A;  2DTZ A;  2ZB9 A;  2GFN A;  3RD3 A;  3V6G A;  3BTI A;  2ZCM A;  2NP5 A;  3IH3 A;  3ZQL A;  4JNN A;  1SGM A;  5J1Y A;  3G56 A;  2QWT A;  2ZOY A;  4GCT A;  3MVP A;  3Q3S A;  5HAW A;  3BQZ A;  4G12 A;  2NX4 A;  1Z77 A;  1ORK A;  3BTL A;  4ICH A;  3F0C A;  3C2B A;  2HKU A;  3DCF A;  4JYK A;  3ZQI A;  4XK4 A;  3IH4 A;  3NPI A;  2HXI A;  3ANP A;  5F0C A;  3AQS A;  5K7H A;  3ON4 A;  3HE0 A;  4AC6 A;  3VW1 A;  4AUX A;  5CW8 A;  3GZI A;  5F0H A;  4L62 A;  4GFK A;  2QCO A;  3CDL A;  1JT0 A;  3SFI A;  2XGC A;  3ZQH A;  3JSJ A;  3O8H A;  3VOX A;  3IUV A;  3QBM A;  5GPA A;  2W53 A;  2VKE A;  4W97 A;  5K7Z A;  2X9D A;  2WUI A;  2QOP A;  3CRJ A;  3CJD A;  2Q24 A;  3B6A A;  5F08 A;  5H9T A;  5CXI A;  2G7S A;  5EZG A;  1QVU A;  4UDS A;  5IOY A;  4I6Z A;  3F1B A;  2G7G A;  3BNI A;  1U9O A;  5J1U A;  2UXU A;  3Q0U A;  2VPR A;  3QPS A;  3LOC A;  3KNW A;  4M3D A;  5F0F A;  2Y31 A;  4X1E A;  3BR0 A;  3BR3 A;  3QQA A;  2ID6 A;  2F07 A;  3FRQ A;  2XPW A;  3T6N A;  1U9N A;  3BR1 A;  1VI0 A;  3VP5 A;  5D18 A;  3VOK A;  4B3A A;  3ANG A;  5FKO A;  1BJZ A;  4PXI A;  2V57 A;  4CGR A;  5FKK A;  1ZK8 A;  3VPR A;  3VVY A;  4D5F A;  2QKO A;  1JTX A;  3HTA A;  1T33 A;  3BR2 A;  2VKV A;  2ZCX A;  4YZE A;  5EFY A;  2UXP A;  2RAS A;  2XB5 A;  2IAI A;  2FQ4 A;  5K7F A;  2IEK A;  3AQT A;  4MK6 A;  3KKC A;  3QKX A;  3B6C A;  3VVX A;  2FJ1 A;  1JTY A;  2X6O A;  4HKU A;  2DG7 A;  2QTQ A;  2UXI A;  3G7R A;  5HSZ A;  3Q0W A;  2NS8 A;  3SDG A;  3PM1 A;  3NNR A;  5J3L A;  3HIM A;  3NI7 A;  2NP3 A;  2OER A;  2O7O A;  3B81 A;  2WGB A;  3VIB A;  3BTJ A;  2YVH A;  5FKN A;  3VVZ A;  1Z0X A;  3HTH A;  3NXC A;  5FKM A;  4I76 A;  2HQ5 A;  3WHB A;  3S5R A;  3PPB A;  4ACI A;  2XGD A;  3BR5 A;  1UI5 A;  3KKD A;  5J1R A;  5FHP A;  5GPC A;  4ABZ A;  1RPW A;  2TCT A;  4MO7 A;  3VUQ A;  1RKT A;  3FK7 A;  2GUH A;  2GBY A;  4GCK A;  3LSJ A;  5AQC A;  4W1U A;  3CWR A;  3BRU A;  3FK6 A;  3ON2 A;  4M3E A;  3BCG A;  5F04 A;  4V2F A;  3E7Q A;  2JK3 A;  5GP9 A;  3LSR A;  2UXH A;  3LWJ A;  2D6Y A;  3LJL A;  4AC0 A;  2XRL A;  2HYT A;  2HYJ A;  3WHC A;  2PZ9 A;  4KWA A;  5F1J A;  4ME9 A;  3EGQ A;  3LHQ A;  1A6I A;  4M3B A;  2DG8 A;  3ZQF A;  2TRT A;  2I10 A;  4V2G A;  3BT9 A;  3IH2 A;  4B1R A;  3C07 A;  2G0E A;  2G3B A;  5FKL A;  1JUP A;  2FBQ A;  2YVE A;  5DAJ A;  3BTC A;  4DW6 A;  2XGE A;  5IP6 A;  3BR6 A;  2REK A;  2WV1 A;  3TP3 A; 
#chains in the Genus database with same CATH topology
 3VW0 A;  3O8G A;  5CXG A;  4GFL A;  2HXO A;  2ID3 A;  5EYR A;  2O7T A;  3FHN A;  3COL A;  2ZOZ A;  5IOZ A;  3G1L A;  2OI8 A;  4M3F A;  3DPJ A;  2XPU A;  3MNL A;  2GEN A;  2XPV A;  1T56 A;  2IBD A;  2QIB A;  5FGL A;  2NS7 A;  3BQY A;  3RH2 A;  4NN1 A;  2IU5 A;  4D5C A;  3EUP A;  3HGY A;  4NEL A;  3DEW A;  5HBU A;  2G7L A;  1QPI A;  2R7X A;  3DU6 A;  1JT6 A;  3BHQ A;  3HTI A;  3NS4 A;  4D7M A;  4D7N A;  3KZ9 A;  3NRG A;  3BJB A;  1JUM A;  3GEU A;  1RKW A;  3Q0V A;  2EH3 A;  3ZQG A;  4AF5 A;  3HTJ A;  1UI6 A;  2FJI 1;  2UXO A;  2PBX A;  2RAE A;  4M3G A;  3TP0 A;  1ZKG A;  3VW2 A;  5D1R A;  3HGG A;  5K58 A;  2FX0 A;  4C2M A;  3PAS A;  2ZCN A;  1JUS A;  5EZH A;  1QVT A;  4MXM A;  3FIW A;  4JKZ A;  2Y30 A;  5C4Y A;  3G1O A;  2OPT A;  5IPA A;  3V78 A;  5F27 A;  3O60 A;  2PFV A;  5FMP A;  2OF7 A;  4GCL A;  4U9N A;  3QPL A;  3P9T A;  4WIB A;  2JJ7 A;  3G1M A;  5D19 A;  2RHA A;  2XDN A;  4JL3 A;  3LSP A;  2Y2Z A;  3CCY A;  2FD5 A;  2DTZ A;  2ZB9 A;  2GFN A;  3RD3 A;  3VTI A;  3V6G A;  3BTI A;  2ZCM A;  2NP5 A;  3IH3 A;  3ZQL A;  4JNN A;  1SGM A;  5J1Y A;  2R7W A;  3G56 A;  4U9L A;  2QWT A;  2ZOY A;  3K8P C;  4GCT A;  3MVP A;  3Q3S A;  5HAW A;  3BQZ A;  4G12 A;  2NX4 A;  1Z77 A;  1ORK A;  3BTL A;  4ICH A;  3F0C A;  3C2B A;  2HKU A;  3DCF A;  4JYK A;  3ZQI A;  4XK4 A;  3IH4 A;  2R7O A;  3NPI A;  2HXI A;  3ANP A;  5F0C A;  3AQS A;  5K7H A;  3ON4 A;  3HE0 A;  4AC6 A;  3VW1 A;  4AUX A;  5CW8 A;  3GZI A;  5F0H A;  4L62 A;  4GFK A;  2QCO A;  3CDL A;  1JT0 A;  3SFI A;  2XGC A;  3ZQH A;  3JSJ A;  3O8H A;  3VOX A;  3IUV A;  3QBM A;  5GPA A;  2W53 A;  2VKE A;  4W97 A;  5K7Z A;  2R7T A;  2X9D A;  2WUI A;  2QOP A;  3CRJ A;  3CJD A;  2Q24 A;  3B6A A;  5F08 A;  5H9T A;  5CXI A;  2G7S A;  5EZG A;  3DU5 A;  1QVU A;  4UDS A;  5IOY A;  2B1E A;  4I6Z A;  3F1B A;  2A2F X;  2G7G A;  3BNI A;  1U9O A;  4OD5 A;  5J1U A;  2UXU A;  3Q0U A;  2VPR A;  3QPS A;  3LOC A;  3KNW A;  4M3D A;  5F0F A;  2Y31 A;  4X1E A;  2R7Q A;  3BR0 A;  3BR3 A;  3QQA A;  2ID6 A;  2F07 A;  3FRQ A;  2XPW A;  3T6N A;  1U9N A;  3BR1 A;  1VI0 A;  3VP5 A;  5D18 A;  3VOK A;  4B3A A;  3ANG A;  5FKO A;  1BJZ A;  4PXI A;  2R7U A;  2V57 A;  4CGR A;  5FKK A;  1ZK8 A;  3VPR A;  3VVY A;  4D5F A;  2QKO A;  1JTX A;  3HTA A;  1T33 A;  3BR2 A;  2VKV A;  2ZCX A;  4YZE A;  5EFY A;  2UXP A;  2RAS A;  2XB5 A;  2IAI A;  2FQ4 A;  5K7F A;  2R7S A;  2IEK A;  2B3W A;  3AQT A;  4MK6 A;  3KKC A;  3QKX A;  3B6C A;  3VVX A;  2FJ1 A;  1JTY A;  3KYL A;  2X6O A;  4HKU A;  2DG7 A;  2QTQ A;  2UXI A;  3G7R A;  5HSZ A;  3Q0W A;  2NS8 A;  3SDG A;  3PM1 A;  3NNR A;  5J3L A;  3HIM A;  3NI7 A;  2NP3 A;  2OER A;  2O7O A;  2R7R A;  3B81 A;  2WGB A;  3BTJ A;  3VIB A;  2YVH A;  5FKN A;  3VVZ A;  1Z0X A;  3HTH A;  3NXC A;  5FKM A;  2YVX A;  4I76 A;  2HQ5 A;  3WHB A;  3S5R A;  3PPB A;  4ACI A;  2XGD A;  3BR5 A;  1UI5 A;  3KKD A;  5J1R A;  4DVY P;  2ZY9 A;  5FHP A;  5GPC A;  2R7V A;  4ABZ A;  1RPW A;  2TCT A;  4MO7 A;  3VUQ A;  1RKT A;  3FK7 A;  2GUH A;  2GBY A;  4GCK A;  3LSJ A;  5AQC A;  4W1U A;  4OD4 A;  3CWR A;  3BRU A;  3FK6 A;  3ON2 A;  4M3E A;  3BCG A;  5F04 A;  4V2F A;  3E7Q A;  2JK3 A;  5GP9 A;  3SWH A;  4IRV A;  3LSR A;  2UXH A;  3LWJ A;  2D6Y A;  3LJL A;  4AC0 A;  2XRL A;  2HYT A;  2HYJ A;  5CQG A;  3WHC A;  2PZ9 A;  4KWA A;  5F1J A;  4ME9 A;  3EGQ A;  3LHQ A;  1A6I A;  4M3B A;  2DG8 A;  3ZQF A;  2TRT A;  2I10 A;  4V2G A;  3BT9 A;  3IH2 A;  4B1R A;  3C07 A;  2G0E A;  2G3B A;  5FKL A;  1JUP A;  2FBQ A;  2YVE A;  5DAJ A;  3BTC A;  4DW6 A;  2XGE A;  5IP6 A;  3BR6 A;  2REK A;  2WV1 A;  3TP3 A; 
#chains in the Genus database with same CATH homology
 3VW0 A;  3O8G A;  5CXG A;  4GFL A;  2HXO A;  2ID3 A;  5EYR A;  2O7T A;  3COL A;  2ZOZ A;  5IOZ A;  3G1L A;  2OI8 A;  4M3F A;  3DPJ A;  2XPU A;  3MNL A;  2GEN A;  2XPV A;  1T56 A;  2IBD A;  2QIB A;  5FGL A;  2NS7 A;  3BQY A;  3RH2 A;  4NN1 A;  2IU5 A;  4D5C A;  3EUP A;  3HGY A;  4NEL A;  3DEW A;  5HBU A;  2G7L A;  1QPI A;  1JT6 A;  3BHQ A;  3HTI A;  4D7M A;  4D7N A;  3KZ9 A;  3NRG A;  3BJB A;  1JUM A;  3GEU A;  1RKW A;  3Q0V A;  2EH3 A;  3ZQG A;  4AF5 A;  3HTJ A;  1UI6 A;  2UXO A;  2PBX A;  2RAE A;  4M3G A;  3TP0 A;  1ZKG A;  3VW2 A;  5D1R A;  3HGG A;  5K58 A;  2FX0 A;  3PAS A;  2ZCN A;  1JUS A;  5EZH A;  1QVT A;  4MXM A;  3FIW A;  4JKZ A;  2Y30 A;  5C4Y A;  3G1O A;  2OPT A;  5IPA A;  3V78 A;  5F27 A;  3O60 A;  5FMP A;  2OF7 A;  4GCL A;  3QPL A;  3P9T A;  2JJ7 A;  3G1M A;  5D19 A;  2RHA A;  2XDN A;  4JL3 A;  3LSP A;  2Y2Z A;  3CCY A;  2FD5 A;  2DTZ A;  2ZB9 A;  2GFN A;  3RD3 A;  3V6G A;  3BTI A;  2ZCM A;  2NP5 A;  3IH3 A;  3ZQL A;  4JNN A;  1SGM A;  5J1Y A;  3G56 A;  2QWT A;  2ZOY A;  4GCT A;  3MVP A;  3Q3S A;  5HAW A;  3BQZ A;  4G12 A;  2NX4 A;  1Z77 A;  1ORK A;  3BTL A;  4ICH A;  3F0C A;  3C2B A;  2HKU A;  3DCF A;  4JYK A;  3ZQI A;  4XK4 A;  3IH4 A;  3NPI A;  2HXI A;  3ANP A;  5F0C A;  3AQS A;  5K7H A;  3ON4 A;  3HE0 A;  4AC6 A;  3VW1 A;  4AUX A;  5CW8 A;  3GZI A;  5F0H A;  4L62 A;  4GFK A;  2QCO A;  3CDL A;  1JT0 A;  3SFI A;  2XGC A;  3ZQH A;  3JSJ A;  3O8H A;  3VOX A;  3IUV A;  3QBM A;  5GPA A;  2W53 A;  2VKE A;  4W97 A;  5K7Z A;  2X9D A;  2WUI A;  2QOP A;  3CRJ A;  3CJD A;  2Q24 A;  3B6A A;  5F08 A;  5H9T A;  5CXI A;  2G7S A;  5EZG A;  1QVU A;  4UDS A;  5IOY A;  4I6Z A;  3F1B A;  2G7G A;  3BNI A;  1U9O A;  5J1U A;  2UXU A;  3Q0U A;  2VPR A;  3QPS A;  3LOC A;  3KNW A;  4M3D A;  5F0F A;  2Y31 A;  4X1E A;  3BR0 A;  3BR3 A;  3QQA A;  2ID6 A;  2F07 A;  3FRQ A;  2XPW A;  3T6N A;  1U9N A;  3BR1 A;  1VI0 A;  3VP5 A;  5D18 A;  3VOK A;  4B3A A;  3ANG A;  5FKO A;  1BJZ A;  4PXI A;  2V57 A;  4CGR A;  5FKK A;  1ZK8 A;  3VPR A;  3VVY A;  4D5F A;  2QKO A;  1JTX A;  3HTA A;  1T33 A;  3BR2 A;  2VKV A;  2ZCX A;  4YZE A;  5EFY A;  2UXP A;  2RAS A;  2XB5 A;  2IAI A;  2FQ4 A;  5K7F A;  2IEK A;  3AQT A;  4MK6 A;  3KKC A;  3QKX A;  3B6C A;  3VVX A;  2FJ1 A;  1JTY A;  2X6O A;  4HKU A;  2DG7 A;  2QTQ A;  2UXI A;  3G7R A;  5HSZ A;  3Q0W A;  2NS8 A;  3SDG A;  3PM1 A;  3NNR A;  5J3L A;  3HIM A;  3NI7 A;  2NP3 A;  2OER A;  2O7O A;  3B81 A;  2WGB A;  3VIB A;  3BTJ A;  2YVH A;  5FKN A;  3VVZ A;  1Z0X A;  3HTH A;  3NXC A;  5FKM A;  4I76 A;  2HQ5 A;  3WHB A;  3S5R A;  3PPB A;  4ACI A;  2XGD A;  3BR5 A;  1UI5 A;  3KKD A;  5J1R A;  5FHP A;  5GPC A;  4ABZ A;  1RPW A;  2TCT A;  4MO7 A;  3VUQ A;  1RKT A;  3FK7 A;  2GUH A;  2GBY A;  4GCK A;  3LSJ A;  5AQC A;  4W1U A;  3CWR A;  3BRU A;  3FK6 A;  3ON2 A;  4M3E A;  3BCG A;  5F04 A;  4V2F A;  3E7Q A;  2JK3 A;  5GP9 A;  3LSR A;  2UXH A;  3LWJ A;  2D6Y A;  3LJL A;  4AC0 A;  2XRL A;  2HYT A;  2HYJ A;  3WHC A;  2PZ9 A;  4KWA A;  5F1J A;  4ME9 A;  3EGQ A;  3LHQ A;  1A6I A;  4M3B A;  2DG8 A;  3ZQF A;  2TRT A;  2I10 A;  4V2G A;  3BT9 A;  3IH2 A;  4B1R A;  3C07 A;  2G0E A;  2G3B A;  5FKL A;  1JUP A;  2FBQ A;  2YVE A;  5DAJ A;  3BTC A;  4DW6 A;  2XGE A;  5IP6 A;  3BR6 A;  2REK A;  2WV1 A;  3TP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...