4YZEA

Crystal structure of e.coli nemr reduced form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
HDTREHLLATGEQLSLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAYHQRLTELLQSGEGNYRDRILAYYQQTLNQFSQHGTISGCLTVKLSAEVSDLSEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAHVKNIIATPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Does the Transcription Factor NemR Use a Regulatory Sulfenamide Bond to Sense Bleach?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor NemR
total genus 74
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4yzeA00
3PPBA 1T56A 2DTZA 1JT6A 2W53A 5K7ZA 5D19A 1JUPA 3V6GA 3BR3A 3HIMA 3NXCA 5D18A 2GENA 2G7GA 5J1UA 4ICHA 5HAWA 5IP6A 2HYTA 5F0HA 3ZQLA 2G7LA 4B3AA 5GPCA 4ME9A 4M3DA 3VVZA 1RKWA 2JJ7A 4MO7A 3Q0UA 5F1JA 2ZCNA 4KWAA 2X6OA 2XDNA 3EGQA 3HTJA 1VI0A 3VPRA 3T6NA 2NS7A 5F0CA 3KNWA 3BR2A 3IH3A 4HKUA 3EUPA 3QPSA 2NP5A 2UXUA 4D7NA 3HTAA 3VW1A 3B6AA 2GBYA 3DPJA 2TCTA 5D1RA 4PXIA 2VKEA 3C07A 2NX4A 3VVXA 4JNNA 4I6ZA 3BT9A 2ZOYA 5J3LA 3HE0A 5K58A 5GP9A 5CXGA 5AQCA 2TRTA 3BRUA 3IH2A 2XB5A 2FD5A 5K7HA 1ORKA 2UXOA 4D5FA 4AC6A 2G0EA 2HYJA 2VPRA 5FKOA 2ZB9A 3Q0WA 5IOZA 2G7SA 3CJDA 2OPTA 4M3BA 3AQTA 5C4YA 2QWTA 2OF7A 4M3FA 2DG8A 3NNRA 4NN1A 1T33A 4CGRA 3FK7A 3GZIA 1RPWA 5HSZA 3CRJA 5CXIA 3MNLA 3FK6A 1U9OA 3BR1A 3HTHA 2X9DA 4V2FA 2IBDA 3ZQIA 3TP3A 5F08A 2IAIA 5J1YA 3BCGA 3VUQA 3BTJA 3LSJA 4GCTA 3LSRA 2OI8A 4V2GA 3LHQA 2PBXA 3O8GA 2WV1A 2G3BA 2FJ1A 2O7OA 3DCFA 2ID3A 2ZCXA 3IUVA 2QIBA 3JSJA 2Y31A 1UI5A 3O8HA 3QKXA 5J1RA 3G7RA 5DAJA 2RASA 3BQYA 2UXPA 2PZ9A 3LSPA 3KZ9A 3BR6A 3QBMA 3B81A 2IEKA 4GFKA 2DG7A 3NI7A 2HKUA 3LWJA 2GFNA 3RH2A 1UI6A 2O7TA 2Q24A 4W1UA 2YVEA 3V78A 5F27A 3Q0VA 2XGDA 3WHCA 1JT0A 2FQ4A 5FHPA 3G56A 2HQ5A 2RHAA 5FKLA 5HBUA 2UXIA 4AF5A 1ZK8A 2ZOZA 1QVTA 4GCKA 1Z77A 2QOPA 3G1MA 2XPWA 1U9NA 3C2BA 1Z0XA 3ZQGA 3RD3A 4XK4A 4JL3A 2XRLA 2V57A 5EYRA 4UDSA 1ZKGA 3CDLA 3ON4A 2GUHA 2D6YA 5EZGA 5F0FA 3CCYA 3B6CA 3COLA 2UXHA 3VP5A 4MK6A 4NELA 1SGMA 3VIBA 3BTIA 2WUIA 5F04A 1JUMA 2YVHA 2QTQA 4AUXA 3ON2A 2XPUA 3AQSA 4ABZA 3BR5A 2WGBA 3P9TA 5FKNA 4X1EA 3ZQHA 4L62A 3G1OA 3BTCA 1JTYA 2JK3A 3BNIA 2NP3A 2Y2ZA 2HXIA 2ZCMA 4M3GA 2XGCA 3ANPA 1JTXA 3HGYA 3NRGA 4GCLA 3IH4A 2I10A 2XPVA 4JYKA 1QVUA 3QPLA 3HTIA 2RAEA 3BJBA 3F0CA 3VOXA 1A6IA 3BTLA 3DEWA 3FIWA 3GEUA 3WHBA 3LJLA 5H9TA 1JUSA 4W97A 3G1LA 2HXOA 2ID6A 2IU5A 3NPIA 3MVPA 5FKKA 3BR0A 3VW0A 5K7FA 3QQAA 2FBQA 1QPIA 5EFYA 3VVYA 4I76A 3BQZA 4MXMA 3Q3SA 3CWRA 3VW2A 4D7MA 4YZEA 3SDGA 2QKOA 2VKVA 2QCOA 3PM1A 2NS8A 1RKTA 3F1BA 2FX0A 4B1RA 4JKZA 5IOYA 3BHQA 5FMPA 5FKMA 3S5RA 3PASA 5IPAA 2OERA 2XGEA 3HGGA 5CW8A 1BJZA 4ACIA 2EH3A 4M3EA 5EZHA 4D5CA 3SFIA 3TP0A 4GFLA 5GPAA 3LOCA 2F07A 3KKCA 3KKDA 2Y30A 3VOKA 3E7QA 4G12A 3FRQA 3O60A 5FGLA 4DW6A 3ANGA 4AC0A 3ZQFA 2REKA
chains in the Genus database with same CATH superfamily
3PPBA 1T56A 2DTZA 1JT6A 2W53A 4OD5A 3FHNA 5K7ZA 5D19A 1JUPA 3V6GA 3BR3A 3HIMA 3NXCA 5D18A 2GENA 2G7GA 2R7UA 5J1UA 3VTIA 4ICHA 2R7SA 5HAWA 2ZY9A 5IP6A 2HYTA 5F0HA 3ZQLA 2R7RA 2G7LA 4B3AA 5GPCA 4ME9A 4M3DA 3VVZA 1RKWA 2JJ7A 4MO7A 3Q0UA 5F1JA 2ZCNA 4KWAA 2X6OA 2XDNA 3EGQA 3HTJA 1VI0A 3VPRA 4IRVA 3T6NA 2NS7A 5F0CA 3KNWA 3BR2A 3IH3A 3DU6A 4HKUA 3EUPA 3QPSA 2NP5A 2UXUA 4D7NA 3HTAA 3VW1A 3B6AA 2GBYA 3DPJA 2TCTA 5D1RA 4PXIA 2VKEA 3C07A 2NX4A 3VVXA 4JNNA 4I6ZA 3BT9A 2ZOYA 4WIBA 5J3LA 3HE0A 5K58A 5GP9A 5CXGA 5AQCA 2TRTA 3BRUA 3IH2A 2XB5A 2FD5A 5K7HA 1ORKA 2UXOA 4D5FA 4AC6A 2G0EA 2HYJA 2VPRA 5FKOA 2ZB9A 3Q0WA 5IOZA 2G7SA 3CJDA 2OPTA 4M3BA 3AQTA 5C4YA 2QWTA 2OF7A 4M3FA 2DG8A 3NNRA 4NN1A 1T33A 4CGRA 3FK7A 3GZIA 1RPWA 5HSZA 3CRJA 5CXIA 3MNLA 3FK6A 1U9OA 3BR1A 3HTHA 2X9DA 4V2FA 2IBDA 3ZQIA 4U9LA 3TP3A 5F08A 2IAIA 5J1YA 3BCGA 3VUQA 2R7WA 3BTJA 3LSJA 4GCTA 3LSRA 2OI8A 4V2GA 4C2MA 5CQGA 2A2FX 3LHQA 2PBXA 3O8GA 2WV1A 2G3BA 2FJ1A 2O7OA 3DCFA 2ID3A 2ZCXA 3IUVA 2QIBA 3JSJA 2Y31A 1UI5A 3O8HA 3QKXA 5J1RA 3G7RA 5DAJA 2RASA 3BQYA 2UXPA 2PZ9A 3LSPA 3KZ9A 3BR6A 3QBMA 3B81A 2IEKA 4GFKA 2DG7A 3NI7A 2HKUA 3LWJA 2GFNA 3RH2A 1UI6A 2O7TA 2Q24A 4W1UA 3KYLA 2YVEA 3V78A 5F27A 3Q0VA 2XGDA 3WHCA 1JT0A 2FQ4A 5FHPA 3G56A 2HQ5A 2RHAA 5FKLA 5HBUA 2UXIA 4AF5A 1ZK8A 2ZOZA 1QVTA 4GCKA 1Z77A 2QOPA 3G1MA 2XPWA 1U9NA 3C2BA 1Z0XA 3ZQGA 3RD3A 4XK4A 4JL3A 2XRLA 2V57A 5EYRA 4UDSA 1ZKGA 3CDLA 3ON4A 2GUHA 2D6YA 5EZGA 5F0FA 3CCYA 3B6CA 3COLA 2UXHA 3VP5A 4MK6A 4NELA 1SGMA 3VIBA 3BTIA 2WUIA 5F04A 1JUMA 2YVHA 2PFVA 2QTQA 4AUXA 3ON2A 2R7TA 2XPUA 3AQSA 4ABZA 3BR5A 2WGBA 3P9TA 5FKNA 4X1EA 3ZQHA 4L62A 3G1OA 3BTCA 1JTYA 4DVYP 2JK3A 3BNIA 2NP3A 3K8PC 2Y2ZA 2HXIA 2ZCMA 4M3GA 2XGCA 3ANPA 1JTXA 3HGYA 3NRGA 4GCLA 3IH4A 3NS4A 2I10A 2XPVA 4JYKA 1QVUA 3QPLA 3HTIA 2RAEA 3BJBA 3F0CA 3VOXA 1A6IA 3BTLA 3DEWA 2B1EA 3FIWA 3GEUA 3WHBA 3LJLA 4OD4A 5H9TA 1JUSA 4W97A 3G1LA 2HXOA 2ID6A 2IU5A 3NPIA 3MVPA 5FKKA 3BR0A 3VW0A 5K7FA 3QQAA 2FBQA 2YVXA 1QPIA 5EFYA 4U9NA 3VVYA 4I76A 2FJI1 2R7XA 3BQZA 4MXMA 3Q3SA 3CWRA 3VW2A 4D7MA 4YZEA 3SDGA 2B3WA 2QKOA 2VKVA 2QCOA 3PM1A 2NS8A 3SWHA 1RKTA 3F1BA 2FX0A 4B1RA 4JKZA 5IOYA 3BHQA 5FMPA 5FKMA 2R7OA 3S5RA 3PASA 5IPAA 2OERA 2XGEA 3HGGA 5CW8A 1BJZA 4ACIA 2EH3A 4M3EA 5EZHA 4D5CA 3SFIA 3TP0A 4GFLA 5GPAA 3LOCA 3DU5A 2F07A 3KKCA 3KKDA 2R7QA 2Y30A 3VOKA 2R7VA 3E7QA 4G12A 3FRQA 3O60A 5FGLA 4DW6A 3ANGA 4AC0A 3ZQFA 2REKA
chains in the Genus database with same CATH topology
3PPBA 1T56A 2DTZA 1JT6A 2W53A 5K7ZA 5D19A 1JUPA 3V6GA 3BR3A 3HIMA 3NXCA 5D18A 2GENA 2G7GA 5J1UA 4ICHA 5HAWA 5IP6A 2HYTA 5F0HA 3ZQLA 2G7LA 4B3AA 5GPCA 4ME9A 4M3DA 3VVZA 1RKWA 2JJ7A 4MO7A 3Q0UA 5F1JA 2ZCNA 4KWAA 2X6OA 2XDNA 3EGQA 3HTJA 1VI0A 3VPRA 3T6NA 2NS7A 5F0CA 3KNWA 3BR2A 3IH3A 4HKUA 3EUPA 3QPSA 2NP5A 2UXUA 4D7NA 3HTAA 3VW1A 3B6AA 2GBYA 3DPJA 2TCTA 5D1RA 4PXIA 2VKEA 3C07A 2NX4A 3VVXA 4JNNA 4I6ZA 3BT9A 2ZOYA 5J3LA 3HE0A 5K58A 5GP9A 5CXGA 5AQCA 2TRTA 3BRUA 3IH2A 2XB5A 2FD5A 5K7HA 1ORKA 2UXOA 4D5FA 4AC6A 2G0EA 2HYJA 2VPRA 5FKOA 2ZB9A 3Q0WA 5IOZA 2G7SA 3CJDA 2OPTA 4M3BA 3AQTA 5C4YA 2QWTA 2OF7A 4M3FA 2DG8A 3NNRA 4NN1A 1T33A 4CGRA 3FK7A 3GZIA 1RPWA 5HSZA 3CRJA 5CXIA 3MNLA 3FK6A 1U9OA 3BR1A 3HTHA 2X9DA 4V2FA 2IBDA 3ZQIA 3TP3A 5F08A 2IAIA 5J1YA 3BCGA 3VUQA 3BTJA 3LSJA 4GCTA 3LSRA 2OI8A 4V2GA 3LHQA 2PBXA 3O8GA 2WV1A 2G3BA 2FJ1A 2O7OA 3DCFA 2ID3A 2ZCXA 3IUVA 2QIBA 3JSJA 2Y31A 1UI5A 3O8HA 3QKXA 5J1RA 3G7RA 5DAJA 2RASA 3BQYA 2UXPA 2PZ9A 3LSPA 3KZ9A 3BR6A 3QBMA 3B81A 2IEKA 4GFKA 2DG7A 3NI7A 2HKUA 3LWJA 2GFNA 3RH2A 1UI6A 2O7TA 2Q24A 4W1UA 2YVEA 3V78A 5F27A 3Q0VA 2XGDA 3WHCA 1JT0A 2FQ4A 5FHPA 3G56A 2HQ5A 2RHAA 5FKLA 5HBUA 2UXIA 4AF5A 1ZK8A 2ZOZA 1QVTA 4GCKA 1Z77A 2QOPA 3G1MA 2XPWA 1U9NA 3C2BA 1Z0XA 3ZQGA 3RD3A 4XK4A 4JL3A 2XRLA 2V57A 5EYRA 4UDSA 1ZKGA 3CDLA 3ON4A 2GUHA 2D6YA 5EZGA 5F0FA 3CCYA 3B6CA 3COLA 2UXHA 3VP5A 4MK6A 4NELA 1SGMA 3VIBA 3BTIA 2WUIA 5F04A 1JUMA 2YVHA 2QTQA 4AUXA 3ON2A 2XPUA 3AQSA 4ABZA 3BR5A 2WGBA 3P9TA 5FKNA 4X1EA 3ZQHA 4L62A 3G1OA 3BTCA 1JTYA 2JK3A 3BNIA 2NP3A 2Y2ZA 2HXIA 2ZCMA 4M3GA 2XGCA 3ANPA 1JTXA 3HGYA 3NRGA 4GCLA 3IH4A 2I10A 2XPVA 4JYKA 1QVUA 3QPLA 3HTIA 2RAEA 3BJBA 3F0CA 3VOXA 1A6IA 3BTLA 3DEWA 3FIWA 3GEUA 3WHBA 3LJLA 5H9TA 1JUSA 4W97A 3G1LA 2HXOA 2ID6A 2IU5A 3NPIA 3MVPA 5FKKA 3BR0A 3VW0A 5K7FA 3QQAA 2FBQA 1QPIA 5EFYA 3VVYA 4I76A 3BQZA 4MXMA 3Q3SA 3CWRA 3VW2A 4D7MA 4YZEA 3SDGA 2QKOA 2VKVA 2QCOA 3PM1A 2NS8A 1RKTA 3F1BA 2FX0A 4B1RA 4JKZA 5IOYA 3BHQA 5FMPA 5FKMA 3S5RA 3PASA 5IPAA 2OERA 2XGEA 3HGGA 5CW8A 1BJZA 4ACIA 2EH3A 4M3EA 5EZHA 4D5CA 3SFIA 3TP0A 4GFLA 5GPAA 3LOCA 2F07A 3KKCA 3KKDA 2Y30A 3VOKA 3E7QA 4G12A 3FRQA 3O60A 5FGLA 4DW6A 3ANGA 4AC0A 3ZQFA 2REKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PPB A;  1T56 A;  2DTZ A;  1JT6 A;  2W53 A;  5K7Z A;  5D19 A;  1JUP A;  3V6G A;  3BR3 A;  3HIM A;  3NXC A;  5D18 A;  2GEN A;  2G7G A;  5J1U A;  4ICH A;  5HAW A;  5IP6 A;  2HYT A;  5F0H A;  3ZQL A;  2G7L A;  4B3A A;  5GPC A;  4ME9 A;  4M3D A;  3VVZ A;  1RKW A;  2JJ7 A;  4MO7 A;  3Q0U A;  5F1J A;  2ZCN A;  4KWA A;  2X6O A;  2XDN A;  3EGQ A;  3HTJ A;  1VI0 A;  3VPR A;  3T6N A;  2NS7 A;  5F0C A;  3KNW A;  3BR2 A;  3IH3 A;  4HKU A;  3EUP A;  3QPS A;  2NP5 A;  2UXU A;  4D7N A;  3HTA A;  3VW1 A;  3B6A A;  2GBY A;  3DPJ A;  2TCT A;  5D1R A;  4PXI A;  2VKE A;  3C07 A;  2NX4 A;  3VVX A;  4JNN A;  4I6Z A;  3BT9 A;  2ZOY A;  5J3L A;  3HE0 A;  5K58 A;  5GP9 A;  5CXG A;  5AQC A;  2TRT A;  3BRU A;  3IH2 A;  2XB5 A;  2FD5 A;  5K7H A;  1ORK A;  2UXO A;  4D5F A;  4AC6 A;  2G0E A;  2HYJ A;  2VPR A;  5FKO A;  2ZB9 A;  3Q0W A;  5IOZ A;  2G7S A;  3CJD A;  2OPT A;  4M3B A;  3AQT A;  5C4Y A;  2QWT A;  2OF7 A;  4M3F A;  2DG8 A;  3NNR A;  4NN1 A;  1T33 A;  4CGR A;  3FK7 A;  3GZI A;  1RPW A;  5HSZ A;  3CRJ A;  5CXI A;  3MNL A;  3FK6 A;  1U9O A;  3BR1 A;  3HTH A;  2X9D A;  4V2F A;  2IBD A;  3ZQI A;  3TP3 A;  5F08 A;  2IAI A;  5J1Y A;  3BCG A;  3VUQ A;  3BTJ A;  3LSJ A;  4GCT A;  3LSR A;  2OI8 A;  4V2G A;  3LHQ A;  2PBX A;  3O8G A;  2WV1 A;  2G3B A;  2FJ1 A;  2O7O A;  3DCF A;  2ID3 A;  2ZCX A;  3IUV A;  2QIB A;  3JSJ A;  2Y31 A;  1UI5 A;  3O8H A;  3QKX A;  5J1R A;  3G7R A;  5DAJ A;  2RAS A;  3BQY A;  2UXP A;  2PZ9 A;  3LSP A;  3KZ9 A;  3BR6 A;  3QBM A;  3B81 A;  2IEK A;  4GFK A;  2DG7 A;  3NI7 A;  2HKU A;  3LWJ A;  2GFN A;  3RH2 A;  1UI6 A;  2O7T A;  2Q24 A;  4W1U A;  2YVE A;  3V78 A;  5F27 A;  3Q0V A;  2XGD A;  3WHC A;  1JT0 A;  2FQ4 A;  5FHP A;  3G56 A;  2HQ5 A;  2RHA A;  5FKL A;  5HBU A;  2UXI A;  4AF5 A;  1ZK8 A;  2ZOZ A;  1QVT A;  4GCK A;  1Z77 A;  2QOP A;  3G1M A;  2XPW A;  1U9N A;  3C2B A;  1Z0X A;  3ZQG A;  3RD3 A;  4XK4 A;  4JL3 A;  2XRL A;  2V57 A;  5EYR A;  4UDS A;  1ZKG A;  3CDL A;  3ON4 A;  2GUH A;  2D6Y A;  5EZG A;  5F0F A;  3CCY A;  3B6C A;  3COL A;  2UXH A;  3VP5 A;  4MK6 A;  4NEL A;  1SGM A;  3VIB A;  3BTI A;  2WUI A;  5F04 A;  1JUM A;  2YVH A;  2QTQ A;  4AUX A;  3ON2 A;  2XPU A;  3AQS A;  4ABZ A;  3BR5 A;  2WGB A;  3P9T A;  5FKN A;  4X1E A;  3ZQH A;  4L62 A;  3G1O A;  3BTC A;  1JTY A;  2JK3 A;  3BNI A;  2NP3 A;  2Y2Z A;  2HXI A;  2ZCM A;  4M3G A;  2XGC A;  3ANP A;  1JTX A;  3HGY A;  3NRG A;  4GCL A;  3IH4 A;  2I10 A;  2XPV A;  4JYK A;  1QVU A;  3QPL A;  3HTI A;  2RAE A;  3BJB A;  3F0C A;  3VOX A;  1A6I A;  3BTL A;  3DEW A;  3FIW A;  3GEU A;  3WHB A;  3LJL A;  5H9T A;  1JUS A;  4W97 A;  3G1L A;  2HXO A;  2ID6 A;  2IU5 A;  3NPI A;  3MVP A;  5FKK A;  3BR0 A;  3VW0 A;  5K7F A;  3QQA A;  2FBQ A;  1QPI A;  5EFY A;  3VVY A;  4I76 A;  3BQZ A;  4MXM A;  3Q3S A;  3CWR A;  3VW2 A;  4D7M A;  4YZE A;  3SDG A;  2QKO A;  2VKV A;  2QCO A;  3PM1 A;  2NS8 A;  1RKT A;  3F1B A;  2FX0 A;  4B1R A;  4JKZ A;  5IOY A;  3BHQ A;  5FMP A;  5FKM A;  3S5R A;  3PAS A;  5IPA A;  2OER A;  2XGE A;  3HGG A;  5CW8 A;  1BJZ A;  4ACI A;  2EH3 A;  4M3E A;  5EZH A;  4D5C A;  3SFI A;  3TP0 A;  4GFL A;  5GPA A;  3LOC A;  2F07 A;  3KKC A;  3KKD A;  2Y30 A;  3VOK A;  3E7Q A;  4G12 A;  3FRQ A;  3O60 A;  5FGL A;  4DW6 A;  3ANG A;  4AC0 A;  3ZQF A;  2REK A; 
#chains in the Genus database with same CATH topology
 3PPB A;  1T56 A;  2DTZ A;  1JT6 A;  2W53 A;  4OD5 A;  3FHN A;  5K7Z A;  5D19 A;  1JUP A;  3V6G A;  3BR3 A;  3HIM A;  3NXC A;  5D18 A;  2GEN A;  2G7G A;  2R7U A;  5J1U A;  3VTI A;  4ICH A;  2R7S A;  5HAW A;  2ZY9 A;  5IP6 A;  2HYT A;  5F0H A;  3ZQL A;  2R7R A;  2G7L A;  4B3A A;  5GPC A;  4ME9 A;  4M3D A;  3VVZ A;  1RKW A;  2JJ7 A;  4MO7 A;  3Q0U A;  5F1J A;  2ZCN A;  4KWA A;  2X6O A;  2XDN A;  3EGQ A;  3HTJ A;  1VI0 A;  3VPR A;  4IRV A;  3T6N A;  2NS7 A;  5F0C A;  3KNW A;  3BR2 A;  3IH3 A;  3DU6 A;  4HKU A;  3EUP A;  3QPS A;  2NP5 A;  2UXU A;  4D7N A;  3HTA A;  3VW1 A;  3B6A A;  2GBY A;  3DPJ A;  2TCT A;  5D1R A;  4PXI A;  2VKE A;  3C07 A;  2NX4 A;  3VVX A;  4JNN A;  4I6Z A;  3BT9 A;  2ZOY A;  4WIB A;  5J3L A;  3HE0 A;  5K58 A;  5GP9 A;  5CXG A;  5AQC A;  2TRT A;  3BRU A;  3IH2 A;  2XB5 A;  2FD5 A;  5K7H A;  1ORK A;  2UXO A;  4D5F A;  4AC6 A;  2G0E A;  2HYJ A;  2VPR A;  5FKO A;  2ZB9 A;  3Q0W A;  5IOZ A;  2G7S A;  3CJD A;  2OPT A;  4M3B A;  3AQT A;  5C4Y A;  2QWT A;  2OF7 A;  4M3F A;  2DG8 A;  3NNR A;  4NN1 A;  1T33 A;  4CGR A;  3FK7 A;  3GZI A;  1RPW A;  5HSZ A;  3CRJ A;  5CXI A;  3MNL A;  3FK6 A;  1U9O A;  3BR1 A;  3HTH A;  2X9D A;  4V2F A;  2IBD A;  3ZQI A;  4U9L A;  3TP3 A;  5F08 A;  2IAI A;  5J1Y A;  3BCG A;  3VUQ A;  2R7W A;  3BTJ A;  3LSJ A;  4GCT A;  3LSR A;  2OI8 A;  4V2G A;  4C2M A;  5CQG A;  2A2F X;  3LHQ A;  2PBX A;  3O8G A;  2WV1 A;  2G3B A;  2FJ1 A;  2O7O A;  3DCF A;  2ID3 A;  2ZCX A;  3IUV A;  2QIB A;  3JSJ A;  2Y31 A;  1UI5 A;  3O8H A;  3QKX A;  5J1R A;  3G7R A;  5DAJ A;  2RAS A;  3BQY A;  2UXP A;  2PZ9 A;  3LSP A;  3KZ9 A;  3BR6 A;  3QBM A;  3B81 A;  2IEK A;  4GFK A;  2DG7 A;  3NI7 A;  2HKU A;  3LWJ A;  2GFN A;  3RH2 A;  1UI6 A;  2O7T A;  2Q24 A;  4W1U A;  3KYL A;  2YVE A;  3V78 A;  5F27 A;  3Q0V A;  2XGD A;  3WHC A;  1JT0 A;  2FQ4 A;  5FHP A;  3G56 A;  2HQ5 A;  2RHA A;  5FKL A;  5HBU A;  2UXI A;  4AF5 A;  1ZK8 A;  2ZOZ A;  1QVT A;  4GCK A;  1Z77 A;  2QOP A;  3G1M A;  2XPW A;  1U9N A;  3C2B A;  1Z0X A;  3ZQG A;  3RD3 A;  4XK4 A;  4JL3 A;  2XRL A;  2V57 A;  5EYR A;  4UDS A;  1ZKG A;  3CDL A;  3ON4 A;  2GUH A;  2D6Y A;  5EZG A;  5F0F A;  3CCY A;  3B6C A;  3COL A;  2UXH A;  3VP5 A;  4MK6 A;  4NEL A;  1SGM A;  3VIB A;  3BTI A;  2WUI A;  5F04 A;  1JUM A;  2YVH A;  2PFV A;  2QTQ A;  4AUX A;  3ON2 A;  2R7T A;  2XPU A;  3AQS A;  4ABZ A;  3BR5 A;  2WGB A;  3P9T A;  5FKN A;  4X1E A;  3ZQH A;  4L62 A;  3G1O A;  3BTC A;  1JTY A;  4DVY P;  2JK3 A;  3BNI A;  2NP3 A;  3K8P C;  2Y2Z A;  2HXI A;  2ZCM A;  4M3G A;  2XGC A;  3ANP A;  1JTX A;  3HGY A;  3NRG A;  4GCL A;  3IH4 A;  3NS4 A;  2I10 A;  2XPV A;  4JYK A;  1QVU A;  3QPL A;  3HTI A;  2RAE A;  3BJB A;  3F0C A;  3VOX A;  1A6I A;  3BTL A;  3DEW A;  2B1E A;  3FIW A;  3GEU A;  3WHB A;  3LJL A;  4OD4 A;  5H9T A;  1JUS A;  4W97 A;  3G1L A;  2HXO A;  2ID6 A;  2IU5 A;  3NPI A;  3MVP A;  5FKK A;  3BR0 A;  3VW0 A;  5K7F A;  3QQA A;  2FBQ A;  2YVX A;  1QPI A;  5EFY A;  4U9N A;  3VVY A;  4I76 A;  2FJI 1;  2R7X A;  3BQZ A;  4MXM A;  3Q3S A;  3CWR A;  3VW2 A;  4D7M A;  4YZE A;  3SDG A;  2B3W A;  2QKO A;  2VKV A;  2QCO A;  3PM1 A;  2NS8 A;  3SWH A;  1RKT A;  3F1B A;  2FX0 A;  4B1R A;  4JKZ A;  5IOY A;  3BHQ A;  5FMP A;  5FKM A;  2R7O A;  3S5R A;  3PAS A;  5IPA A;  2OER A;  2XGE A;  3HGG A;  5CW8 A;  1BJZ A;  4ACI A;  2EH3 A;  4M3E A;  5EZH A;  4D5C A;  3SFI A;  3TP0 A;  4GFL A;  5GPA A;  3LOC A;  3DU5 A;  2F07 A;  3KKC A;  3KKD A;  2R7Q A;  2Y30 A;  3VOK A;  2R7V A;  3E7Q A;  4G12 A;  3FRQ A;  3O60 A;  5FGL A;  4DW6 A;  3ANG A;  4AC0 A;  3ZQF A;  2REK A; 
#chains in the Genus database with same CATH homology
 3PPB A;  1T56 A;  2DTZ A;  1JT6 A;  2W53 A;  5K7Z A;  5D19 A;  1JUP A;  3V6G A;  3BR3 A;  3HIM A;  3NXC A;  5D18 A;  2GEN A;  2G7G A;  5J1U A;  4ICH A;  5HAW A;  5IP6 A;  2HYT A;  5F0H A;  3ZQL A;  2G7L A;  4B3A A;  5GPC A;  4ME9 A;  4M3D A;  3VVZ A;  1RKW A;  2JJ7 A;  4MO7 A;  3Q0U A;  5F1J A;  2ZCN A;  4KWA A;  2X6O A;  2XDN A;  3EGQ A;  3HTJ A;  1VI0 A;  3VPR A;  3T6N A;  2NS7 A;  5F0C A;  3KNW A;  3BR2 A;  3IH3 A;  4HKU A;  3EUP A;  3QPS A;  2NP5 A;  2UXU A;  4D7N A;  3HTA A;  3VW1 A;  3B6A A;  2GBY A;  3DPJ A;  2TCT A;  5D1R A;  4PXI A;  2VKE A;  3C07 A;  2NX4 A;  3VVX A;  4JNN A;  4I6Z A;  3BT9 A;  2ZOY A;  5J3L A;  3HE0 A;  5K58 A;  5GP9 A;  5CXG A;  5AQC A;  2TRT A;  3BRU A;  3IH2 A;  2XB5 A;  2FD5 A;  5K7H A;  1ORK A;  2UXO A;  4D5F A;  4AC6 A;  2G0E A;  2HYJ A;  2VPR A;  5FKO A;  2ZB9 A;  3Q0W A;  5IOZ A;  2G7S A;  3CJD A;  2OPT A;  4M3B A;  3AQT A;  5C4Y A;  2QWT A;  2OF7 A;  4M3F A;  2DG8 A;  3NNR A;  4NN1 A;  1T33 A;  4CGR A;  3FK7 A;  3GZI A;  1RPW A;  5HSZ A;  3CRJ A;  5CXI A;  3MNL A;  3FK6 A;  1U9O A;  3BR1 A;  3HTH A;  2X9D A;  4V2F A;  2IBD A;  3ZQI A;  3TP3 A;  5F08 A;  2IAI A;  5J1Y A;  3BCG A;  3VUQ A;  3BTJ A;  3LSJ A;  4GCT A;  3LSR A;  2OI8 A;  4V2G A;  3LHQ A;  2PBX A;  3O8G A;  2WV1 A;  2G3B A;  2FJ1 A;  2O7O A;  3DCF A;  2ID3 A;  2ZCX A;  3IUV A;  2QIB A;  3JSJ A;  2Y31 A;  1UI5 A;  3O8H A;  3QKX A;  5J1R A;  3G7R A;  5DAJ A;  2RAS A;  3BQY A;  2UXP A;  2PZ9 A;  3LSP A;  3KZ9 A;  3BR6 A;  3QBM A;  3B81 A;  2IEK A;  4GFK A;  2DG7 A;  3NI7 A;  2HKU A;  3LWJ A;  2GFN A;  3RH2 A;  1UI6 A;  2O7T A;  2Q24 A;  4W1U A;  2YVE A;  3V78 A;  5F27 A;  3Q0V A;  2XGD A;  3WHC A;  1JT0 A;  2FQ4 A;  5FHP A;  3G56 A;  2HQ5 A;  2RHA A;  5FKL A;  5HBU A;  2UXI A;  4AF5 A;  1ZK8 A;  2ZOZ A;  1QVT A;  4GCK A;  1Z77 A;  2QOP A;  3G1M A;  2XPW A;  1U9N A;  3C2B A;  1Z0X A;  3ZQG A;  3RD3 A;  4XK4 A;  4JL3 A;  2XRL A;  2V57 A;  5EYR A;  4UDS A;  1ZKG A;  3CDL A;  3ON4 A;  2GUH A;  2D6Y A;  5EZG A;  5F0F A;  3CCY A;  3B6C A;  3COL A;  2UXH A;  3VP5 A;  4MK6 A;  4NEL A;  1SGM A;  3VIB A;  3BTI A;  2WUI A;  5F04 A;  1JUM A;  2YVH A;  2QTQ A;  4AUX A;  3ON2 A;  2XPU A;  3AQS A;  4ABZ A;  3BR5 A;  2WGB A;  3P9T A;  5FKN A;  4X1E A;  3ZQH A;  4L62 A;  3G1O A;  3BTC A;  1JTY A;  2JK3 A;  3BNI A;  2NP3 A;  2Y2Z A;  2HXI A;  2ZCM A;  4M3G A;  2XGC A;  3ANP A;  1JTX A;  3HGY A;  3NRG A;  4GCL A;  3IH4 A;  2I10 A;  2XPV A;  4JYK A;  1QVU A;  3QPL A;  3HTI A;  2RAE A;  3BJB A;  3F0C A;  3VOX A;  1A6I A;  3BTL A;  3DEW A;  3FIW A;  3GEU A;  3WHB A;  3LJL A;  5H9T A;  1JUS A;  4W97 A;  3G1L A;  2HXO A;  2ID6 A;  2IU5 A;  3NPI A;  3MVP A;  5FKK A;  3BR0 A;  3VW0 A;  5K7F A;  3QQA A;  2FBQ A;  1QPI A;  5EFY A;  3VVY A;  4I76 A;  3BQZ A;  4MXM A;  3Q3S A;  3CWR A;  3VW2 A;  4D7M A;  4YZE A;  3SDG A;  2QKO A;  2VKV A;  2QCO A;  3PM1 A;  2NS8 A;  1RKT A;  3F1B A;  2FX0 A;  4B1R A;  4JKZ A;  5IOY A;  3BHQ A;  5FMP A;  5FKM A;  3S5R A;  3PAS A;  5IPA A;  2OER A;  2XGE A;  3HGG A;  5CW8 A;  1BJZ A;  4ACI A;  2EH3 A;  4M3E A;  5EZH A;  4D5C A;  3SFI A;  3TP0 A;  4GFL A;  5GPA A;  3LOC A;  2F07 A;  3KKC A;  3KKD A;  2Y30 A;  3VOK A;  3E7Q A;  4G12 A;  3FRQ A;  3O60 A;  5FGL A;  4DW6 A;  3ANG A;  4AC0 A;  3ZQF A;  2REK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...