4YZEA

Crystal structure of e.coli nemr reduced form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
HDTREHLLATGEQLSLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAYHQRLTELLQSGEGNYRDRILAYYQQTLNQFSQHGTISGCLTVKLSAEVSDLSEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAHVKNIIATPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Does the Transcription Factor NemR Use a Regulatory Sulfenamide Bond to Sense Bleach?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor NemR
total genus 74
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4yzeA00
5FKOA 3HIMA 3ON4A 5FKLA 5F04A 2G7GA 3AQTA 3PPBA 3WHCA 2ID3A 2OI8A 4YZEA 1Z0XA 4AF5A 1JT0A 3BTLA 2XGCA 3QPLA 3BR5A 2QIBA 2G3BA 2O7TA 3BHQA 1T56A 3HTAA 4JNNA 2Q24A 2XGDA 3HTJA 3S5RA 3SFIA 5J1RA 3NRGA 3VW1A 3KZ9A 2ZCMA 5FHPA 5F0FA 3LWJA 2OF7A 4MXMA 2WUIA 3E7QA 2QWTA 2G7SA 1JT6A 3LJLA 2Y31A 3G7RA 4GCLA 3LSPA 3T6NA 4G12A 5EYRA 2VKEA 3G1LA 2G7LA 5K7HA 3HTHA 2RASA 4UDSA 3B6CA 2PZ9A 2REKA 2IAIA 2V57A 2QCOA 5J1UA 2RHAA 3F0CA 5D1RA 1RKWA 5FGLA 3BTJA 3LSRA 4D7NA 4ACIA 2HKUA 3Q0VA 2Y2ZA 1VI0A 3BRUA 5CXGA 5D18A 3V6GA 3QKXA 2HYTA 2GUHA 3KKCA 1SGMA 3VPRA 2TCTA 4GCTA 2UXOA 5CW8A 3VW2A 2PBXA 3BQYA 3NXCA 4B1RA 3BR6A 2ID6A 2UXUA 4GFLA 4X1EA 3B6AA 3BNIA 3DPJA 1QVTA 5J1YA 4ME9A 4GCKA 1JTYA 4B3AA 4ABZA 2NS7A 3BCGA 2QTQA 2NS8A 3ON2A 2D6YA 2NP3A 3ANGA 4I6ZA 3BR3A 5GP9A 2NX4A 4NN1A 5GPAA 4V2FA 2XRLA 4M3DA 3HGYA 2HYJA 3VP5A 3VIBA 3PM1A 3FK7A 4I76A 4W97A 1U9OA 3VVYA 1A6IA 1UI5A 3FRQA 4D7MA 3MNLA 5FKKA 3VOKA 1ORKA 3ZQGA 5F0HA 4AC6A 2TRTA 3ZQIA 3VW0A 5C4YA 3BJBA 3HTIA 5H9TA 2I10A 1JUPA 2YVEA 4L62A 4JYKA 3NPIA 3O8GA 3ZQFA 2GENA 5K7ZA 5HBUA 3CCYA 2HXOA 3RH2A 3NNRA 3B81A 3ZQHA 2XPVA 3Q3SA 2NP5A 2UXIA 3TP3A 3CWRA 4ICHA 5GPCA 2DG8A 3GZIA 3VVXA 2QKOA 3LHQA 5FKMA 5IP6A 2G0EA 5IPAA 2XPUA 2W53A 5CXIA 3TP0A 2DTZA 3CRJA 2JJ7A 3KKDA 1Z77A 5EZHA 2ZOZA 2VKVA 3Q0UA 4AC0A 3FK6A 1RKTA 4HKUA 2VPRA 3ANPA 3O60A 4NELA 2F07A 5K7FA 3COLA 4XK4A 3O8HA 2QOPA 5K58A 3G1OA 4MK6A 3BQZA 2WGBA 5FMPA 3LOCA 3SDGA 3DEWA 2YVHA 2FBQA 2XPWA 1JTXA 3IH2A 3DCFA 2X6OA 2IU5A 3QQAA 3WHBA 3VVZA 3CDLA 2GBYA 2Y30A 2XGEA 1ZKGA 2FX0A 3LSJA 3BTIA 3EUPA 2WV1A 5F08A 2IBDA 5HSZA 2ZOYA 3BR1A 4V2GA 1JUMA 3FIWA 4MO7A 3VUQA 2HQ5A 1QPIA 4W1UA 1RPWA 3IH3A 4JKZA 3HGGA 2XB5A 3G1MA 5DAJA 2DG7A 2GFNA 2OPTA 2FQ4A 3Q0WA 4DW6A 5F27A 4GFKA 1BJZA 5EZGA 3EGQA 3AQSA 5IOYA 5AQCA 2OERA 3MVPA 3V78A 3HE0A 4D5CA 5HAWA 4M3FA 2FD5A 5F0CA 4KWAA 1JUSA 2UXPA 3QBMA 2O7OA 4JL3A 3IUVA 3P9TA 3ZQLA 3F1BA 3BT9A 2ZB9A 4PXIA 2JK3A 3BR0A 2ZCNA 3C2BA 5IOZA 3BR2A 4M3BA 2EH3A 2HXIA 4AUXA 4M3GA 3G56A 4M3EA 2RAEA 5EFYA 1U9NA 5J3LA 2FJ1A 4CGRA 5D19A 3KNWA 3RD3A 3IH4A 3QPSA 3VOXA 5FKNA 3NI7A 1ZK8A 3BTCA 3C07A 2ZCXA 2UXHA 1T33A 1UI6A 3CJDA 3GEUA 3JSJA 1QVUA 2XDNA 2X9DA 4D5FA 2IEKA 5F1JA 3PASA
chains in the Genus database with same CATH superfamily
5FKOA 3HIMA 3ON4A 5FKLA 5F04A 2G7GA 3AQTA 3PPBA 3WHCA 2ID3A 2OI8A 4YZEA 1Z0XA 4AF5A 1JT0A 3BTLA 2XGCA 3QPLA 3BR5A 2QIBA 2G3BA 2O7TA 3BHQA 1T56A 3HTAA 4JNNA 2Q24A 2XGDA 3HTJA 3S5RA 3SFIA 5J1RA 3NRGA 3VW1A 3KZ9A 2ZCMA 2R7XA 5FHPA 5F0FA 3LWJA 2OF7A 4MXMA 2WUIA 3E7QA 2QWTA 2G7SA 1JT6A 3LJLA 2Y31A 3DU6A 3G7RA 4GCLA 3VTIA 3LSPA 3T6NA 4G12A 5EYRA 2VKEA 3G1LA 2G7LA 5K7HA 3HTHA 2RASA 4UDSA 3B6CA 2PZ9A 2REKA 3KYLA 2IAIA 2V57A 2QCOA 5J1UA 2RHAA 3F0CA 5D1RA 1RKWA 5FGLA 3BTJA 3LSRA 4D7NA 4ACIA 2HKUA 3Q0VA 2R7TA 2Y2ZA 2B3WA 1VI0A 3BRUA 5CXGA 5D18A 3V6GA 3QKXA 2HYTA 2GUHA 3KKCA 1SGMA 3VPRA 2TCTA 4GCTA 2R7VA 2UXOA 5CW8A 3VW2A 2PBXA 3BQYA 3NXCA 4B1RA 3BR6A 2ID6A 2UXUA 4GFLA 4X1EA 3B6AA 3BNIA 3DPJA 1QVTA 2PFVA 5J1YA 4ME9A 4GCKA 1JTYA 2ZY9A 4B3AA 4ABZA 2R7QA 2NS7A 4IRVA 3BCGA 2QTQA 2NS8A 3ON2A 2D6YA 2NP3A 3ANGA 4I6ZA 3BR3A 5GP9A 2NX4A 4NN1A 5GPAA 4V2FA 2XRLA 4M3DA 3HGYA 2HYJA 3VP5A 3VIBA 3SWHA 3PM1A 3FK7A 4I76A 4W97A 1U9OA 3VVYA 1A6IA 1UI5A 3FRQA 4D7MA 3MNLA 5FKKA 3VOKA 1ORKA 3ZQGA 5F0HA 4AC6A 2TRTA 3ZQIA 3VW0A 5C4YA 3BJBA 3HTIA 5H9TA 2I10A 1JUPA 2YVEA 4L62A 4JYKA 3NPIA 3O8GA 3ZQFA 2GENA 4C2MA 5K7ZA 5HBUA 3CCYA 2HXOA 3RH2A 3NNRA 3B81A 3ZQHA 2XPVA 3Q3SA 2NP5A 2UXIA 3TP3A 4OD4A 3CWRA 4ICHA 5GPCA 2DG8A 3GZIA 3VVXA 2R7OA 2QKOA 3LHQA 4U9NA 5FKMA 5IP6A 2G0EA 5IPAA 2XPUA 4U9LA 2W53A 5CXIA 3TP0A 2DTZA 3CRJA 2JJ7A 3KKDA 4DVYP 1Z77A 5EZHA 2ZOZA 2VKVA 3Q0UA 3K8PC 4WIBA 4AC0A 3FK6A 1RKTA 4HKUA 2VPRA 3ANPA 3O60A 4NELA 2F07A 5K7FA 3COLA 4XK4A 3O8HA 2QOPA 5K58A 3G1OA 4MK6A 3BQZA 2WGBA 2A2FX 5FMPA 3LOCA 2R7WA 2FJI1 3SDGA 3DEWA 2YVHA 2FBQA 2XPWA 1JTXA 3IH2A 3DCFA 2X6OA 2IU5A 3QQAA 3WHBA 3VVZA 3CDLA 2GBYA 2Y30A 2XGEA 1ZKGA 2FX0A 3LSJA 3BTIA 3EUPA 2WV1A 5F08A 2IBDA 5HSZA 2ZOYA 3BR1A 4V2GA 1JUMA 3FIWA 4MO7A 3VUQA 2HQ5A 1QPIA 4W1UA 2B1EA 5CQGA 1RPWA 3IH3A 3FHNA 4JKZA 3HGGA 2XB5A 3G1MA 5DAJA 2DG7A 2GFNA 2OPTA 2FQ4A 3Q0WA 4DW6A 5F27A 3DU5A 1BJZA 4GFKA 5EZGA 3EGQA 3AQSA 5IOYA 5AQCA 2OERA 3MVPA 2R7SA 4OD5A 3V78A 3HE0A 4D5CA 2R7RA 5HAWA 4M3FA 2FD5A 5F0CA 4KWAA 1JUSA 3NS4A 2UXPA 3QBMA 2O7OA 4JL3A 3IUVA 3P9TA 3ZQLA 3F1BA 3BT9A 2ZB9A 4PXIA 2YVXA 2JK3A 3BR0A 2ZCNA 3C2BA 5IOZA 3BR2A 4M3BA 2EH3A 2HXIA 4AUXA 4M3GA 3G56A 4M3EA 2RAEA 5EFYA 1U9NA 5J3LA 2FJ1A 4CGRA 5D19A 3KNWA 3RD3A 3IH4A 3QPSA 3VOXA 5FKNA 3NI7A 1ZK8A 3BTCA 3C07A 2R7UA 2ZCXA 2UXHA 1T33A 1UI6A 3CJDA 3GEUA 3JSJA 1QVUA 2XDNA 2X9DA 4D5FA 2IEKA 5F1JA 3PASA
chains in the Genus database with same CATH topology
5FKOA 3HIMA 3ON4A 5FKLA 5F04A 2G7GA 3AQTA 3PPBA 3WHCA 2ID3A 2OI8A 4YZEA 1Z0XA 4AF5A 1JT0A 3BTLA 2XGCA 3QPLA 3BR5A 2QIBA 2G3BA 2O7TA 3BHQA 1T56A 3HTAA 4JNNA 2Q24A 2XGDA 3HTJA 3S5RA 3SFIA 5J1RA 3NRGA 3VW1A 3KZ9A 2ZCMA 5FHPA 5F0FA 3LWJA 2OF7A 4MXMA 2WUIA 3E7QA 2QWTA 2G7SA 1JT6A 3LJLA 2Y31A 3G7RA 4GCLA 3LSPA 3T6NA 4G12A 5EYRA 2VKEA 3G1LA 2G7LA 5K7HA 3HTHA 2RASA 4UDSA 3B6CA 2PZ9A 2REKA 2IAIA 2V57A 2QCOA 5J1UA 2RHAA 3F0CA 5D1RA 1RKWA 5FGLA 3BTJA 3LSRA 4D7NA 4ACIA 2HKUA 3Q0VA 2Y2ZA 1VI0A 3BRUA 5CXGA 5D18A 3V6GA 3QKXA 2HYTA 2GUHA 3KKCA 1SGMA 3VPRA 2TCTA 4GCTA 2UXOA 5CW8A 3VW2A 2PBXA 3BQYA 3NXCA 4B1RA 3BR6A 2ID6A 2UXUA 4GFLA 4X1EA 3B6AA 3BNIA 3DPJA 1QVTA 5J1YA 4ME9A 4GCKA 1JTYA 4B3AA 4ABZA 2NS7A 3BCGA 2QTQA 2NS8A 3ON2A 2D6YA 2NP3A 3ANGA 4I6ZA 3BR3A 5GP9A 2NX4A 4NN1A 5GPAA 4V2FA 2XRLA 4M3DA 3HGYA 2HYJA 3VP5A 3VIBA 3PM1A 3FK7A 4I76A 4W97A 1U9OA 3VVYA 1A6IA 1UI5A 3FRQA 4D7MA 3MNLA 5FKKA 3VOKA 1ORKA 3ZQGA 5F0HA 4AC6A 2TRTA 3ZQIA 3VW0A 5C4YA 3BJBA 3HTIA 5H9TA 2I10A 1JUPA 2YVEA 4L62A 4JYKA 3NPIA 3O8GA 3ZQFA 2GENA 5K7ZA 5HBUA 3CCYA 2HXOA 3RH2A 3NNRA 3B81A 3ZQHA 2XPVA 3Q3SA 2NP5A 2UXIA 3TP3A 3CWRA 4ICHA 5GPCA 2DG8A 3GZIA 3VVXA 2QKOA 3LHQA 5FKMA 5IP6A 2G0EA 5IPAA 2XPUA 2W53A 5CXIA 3TP0A 2DTZA 3CRJA 2JJ7A 3KKDA 1Z77A 5EZHA 2ZOZA 2VKVA 3Q0UA 4AC0A 3FK6A 1RKTA 4HKUA 2VPRA 3ANPA 3O60A 4NELA 2F07A 5K7FA 3COLA 4XK4A 3O8HA 2QOPA 5K58A 3G1OA 4MK6A 3BQZA 2WGBA 5FMPA 3LOCA 3SDGA 3DEWA 2YVHA 2FBQA 2XPWA 1JTXA 3IH2A 3DCFA 2X6OA 2IU5A 3QQAA 3WHBA 3VVZA 3CDLA 2GBYA 2Y30A 2XGEA 1ZKGA 2FX0A 3LSJA 3BTIA 3EUPA 2WV1A 5F08A 2IBDA 5HSZA 2ZOYA 3BR1A 4V2GA 1JUMA 3FIWA 4MO7A 3VUQA 2HQ5A 1QPIA 4W1UA 1RPWA 3IH3A 4JKZA 3HGGA 2XB5A 3G1MA 5DAJA 2DG7A 2GFNA 2OPTA 2FQ4A 3Q0WA 4DW6A 5F27A 4GFKA 1BJZA 5EZGA 3EGQA 3AQSA 5IOYA 5AQCA 2OERA 3MVPA 3V78A 3HE0A 4D5CA 5HAWA 4M3FA 2FD5A 5F0CA 4KWAA 1JUSA 2UXPA 3QBMA 2O7OA 4JL3A 3IUVA 3P9TA 3ZQLA 3F1BA 3BT9A 2ZB9A 4PXIA 2JK3A 3BR0A 2ZCNA 3C2BA 5IOZA 3BR2A 4M3BA 2EH3A 2HXIA 4AUXA 4M3GA 3G56A 4M3EA 2RAEA 5EFYA 1U9NA 5J3LA 2FJ1A 4CGRA 5D19A 3KNWA 3RD3A 3IH4A 3QPSA 3VOXA 5FKNA 3NI7A 1ZK8A 3BTCA 3C07A 2ZCXA 2UXHA 1T33A 1UI6A 3CJDA 3GEUA 3JSJA 1QVUA 2XDNA 2X9DA 4D5FA 2IEKA 5F1JA 3PASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKO A;  3HIM A;  3ON4 A;  5FKL A;  5F04 A;  2G7G A;  3AQT A;  3PPB A;  3WHC A;  2ID3 A;  2OI8 A;  4YZE A;  1Z0X A;  4AF5 A;  1JT0 A;  3BTL A;  2XGC A;  3QPL A;  3BR5 A;  2QIB A;  2G3B A;  2O7T A;  3BHQ A;  1T56 A;  3HTA A;  4JNN A;  2Q24 A;  2XGD A;  3HTJ A;  3S5R A;  3SFI A;  5J1R A;  3NRG A;  3VW1 A;  3KZ9 A;  2ZCM A;  5FHP A;  5F0F A;  3LWJ A;  2OF7 A;  4MXM A;  2WUI A;  3E7Q A;  2QWT A;  2G7S A;  1JT6 A;  3LJL A;  2Y31 A;  3G7R A;  4GCL A;  3LSP A;  3T6N A;  4G12 A;  5EYR A;  2VKE A;  3G1L A;  2G7L A;  5K7H A;  3HTH A;  2RAS A;  4UDS A;  3B6C A;  2PZ9 A;  2REK A;  2IAI A;  2V57 A;  2QCO A;  5J1U A;  2RHA A;  3F0C A;  5D1R A;  1RKW A;  5FGL A;  3BTJ A;  3LSR A;  4D7N A;  4ACI A;  2HKU A;  3Q0V A;  2Y2Z A;  1VI0 A;  3BRU A;  5CXG A;  5D18 A;  3V6G A;  3QKX A;  2HYT A;  2GUH A;  3KKC A;  1SGM A;  3VPR A;  2TCT A;  4GCT A;  2UXO A;  5CW8 A;  3VW2 A;  2PBX A;  3BQY A;  3NXC A;  4B1R A;  3BR6 A;  2ID6 A;  2UXU A;  4GFL A;  4X1E A;  3B6A A;  3BNI A;  3DPJ A;  1QVT A;  5J1Y A;  4ME9 A;  4GCK A;  1JTY A;  4B3A A;  4ABZ A;  2NS7 A;  3BCG A;  2QTQ A;  2NS8 A;  3ON2 A;  2D6Y A;  2NP3 A;  3ANG A;  4I6Z A;  3BR3 A;  5GP9 A;  2NX4 A;  4NN1 A;  5GPA A;  4V2F A;  2XRL A;  4M3D A;  3HGY A;  2HYJ A;  3VP5 A;  3VIB A;  3PM1 A;  3FK7 A;  4I76 A;  4W97 A;  1U9O A;  3VVY A;  1A6I A;  1UI5 A;  3FRQ A;  4D7M A;  3MNL A;  5FKK A;  3VOK A;  1ORK A;  3ZQG A;  5F0H A;  4AC6 A;  2TRT A;  3ZQI A;  3VW0 A;  5C4Y A;  3BJB A;  3HTI A;  5H9T A;  2I10 A;  1JUP A;  2YVE A;  4L62 A;  4JYK A;  3NPI A;  3O8G A;  3ZQF A;  2GEN A;  5K7Z A;  5HBU A;  3CCY A;  2HXO A;  3RH2 A;  3NNR A;  3B81 A;  3ZQH A;  2XPV A;  3Q3S A;  2NP5 A;  2UXI A;  3TP3 A;  3CWR A;  4ICH A;  5GPC A;  2DG8 A;  3GZI A;  3VVX A;  2QKO A;  3LHQ A;  5FKM A;  5IP6 A;  2G0E A;  5IPA A;  2XPU A;  2W53 A;  5CXI A;  3TP0 A;  2DTZ A;  3CRJ A;  2JJ7 A;  3KKD A;  1Z77 A;  5EZH A;  2ZOZ A;  2VKV A;  3Q0U A;  4AC0 A;  3FK6 A;  1RKT A;  4HKU A;  2VPR A;  3ANP A;  3O60 A;  4NEL A;  2F07 A;  5K7F A;  3COL A;  4XK4 A;  3O8H A;  2QOP A;  5K58 A;  3G1O A;  4MK6 A;  3BQZ A;  2WGB A;  5FMP A;  3LOC A;  3SDG A;  3DEW A;  2YVH A;  2FBQ A;  2XPW A;  1JTX A;  3IH2 A;  3DCF A;  2X6O A;  2IU5 A;  3QQA A;  3WHB A;  3VVZ A;  3CDL A;  2GBY A;  2Y30 A;  2XGE A;  1ZKG A;  2FX0 A;  3LSJ A;  3BTI A;  3EUP A;  2WV1 A;  5F08 A;  2IBD A;  5HSZ A;  2ZOY A;  3BR1 A;  4V2G A;  1JUM A;  3FIW A;  4MO7 A;  3VUQ A;  2HQ5 A;  1QPI A;  4W1U A;  1RPW A;  3IH3 A;  4JKZ A;  3HGG A;  2XB5 A;  3G1M A;  5DAJ A;  2DG7 A;  2GFN A;  2OPT A;  2FQ4 A;  3Q0W A;  4DW6 A;  5F27 A;  4GFK A;  1BJZ A;  5EZG A;  3EGQ A;  3AQS A;  5IOY A;  5AQC A;  2OER A;  3MVP A;  3V78 A;  3HE0 A;  4D5C A;  5HAW A;  4M3F A;  2FD5 A;  5F0C A;  4KWA A;  1JUS A;  2UXP A;  3QBM A;  2O7O A;  4JL3 A;  3IUV A;  3P9T A;  3ZQL A;  3F1B A;  3BT9 A;  2ZB9 A;  4PXI A;  2JK3 A;  3BR0 A;  2ZCN A;  3C2B A;  5IOZ A;  3BR2 A;  4M3B A;  2EH3 A;  2HXI A;  4AUX A;  4M3G A;  3G56 A;  4M3E A;  2RAE A;  5EFY A;  1U9N A;  5J3L A;  2FJ1 A;  4CGR A;  5D19 A;  3KNW A;  3RD3 A;  3IH4 A;  3QPS A;  3VOX A;  5FKN A;  3NI7 A;  1ZK8 A;  3BTC A;  3C07 A;  2ZCX A;  2UXH A;  1T33 A;  1UI6 A;  3CJD A;  3GEU A;  3JSJ A;  1QVU A;  2XDN A;  2X9D A;  4D5F A;  2IEK A;  5F1J A;  3PAS A; 
#chains in the Genus database with same CATH topology
 5FKO A;  3HIM A;  3ON4 A;  5FKL A;  5F04 A;  2G7G A;  3AQT A;  3PPB A;  3WHC A;  2ID3 A;  2OI8 A;  4YZE A;  1Z0X A;  4AF5 A;  1JT0 A;  3BTL A;  2XGC A;  3QPL A;  3BR5 A;  2QIB A;  2G3B A;  2O7T A;  3BHQ A;  1T56 A;  3HTA A;  4JNN A;  2Q24 A;  2XGD A;  3HTJ A;  3S5R A;  3SFI A;  5J1R A;  3NRG A;  3VW1 A;  3KZ9 A;  2ZCM A;  2R7X A;  5FHP A;  5F0F A;  3LWJ A;  2OF7 A;  4MXM A;  2WUI A;  3E7Q A;  2QWT A;  2G7S A;  1JT6 A;  3LJL A;  2Y31 A;  3DU6 A;  3G7R A;  4GCL A;  3VTI A;  3LSP A;  3T6N A;  4G12 A;  5EYR A;  2VKE A;  3G1L A;  2G7L A;  5K7H A;  3HTH A;  2RAS A;  4UDS A;  3B6C A;  2PZ9 A;  2REK A;  3KYL A;  2IAI A;  2V57 A;  2QCO A;  5J1U A;  2RHA A;  3F0C A;  5D1R A;  1RKW A;  5FGL A;  3BTJ A;  3LSR A;  4D7N A;  4ACI A;  2HKU A;  3Q0V A;  2R7T A;  2Y2Z A;  2B3W A;  1VI0 A;  3BRU A;  5CXG A;  5D18 A;  3V6G A;  3QKX A;  2HYT A;  2GUH A;  3KKC A;  1SGM A;  3VPR A;  2TCT A;  4GCT A;  2R7V A;  2UXO A;  5CW8 A;  3VW2 A;  2PBX A;  3BQY A;  3NXC A;  4B1R A;  3BR6 A;  2ID6 A;  2UXU A;  4GFL A;  4X1E A;  3B6A A;  3BNI A;  3DPJ A;  1QVT A;  2PFV A;  5J1Y A;  4ME9 A;  4GCK A;  1JTY A;  2ZY9 A;  4B3A A;  4ABZ A;  2R7Q A;  2NS7 A;  4IRV A;  3BCG A;  2QTQ A;  2NS8 A;  3ON2 A;  2D6Y A;  2NP3 A;  3ANG A;  4I6Z A;  3BR3 A;  5GP9 A;  2NX4 A;  4NN1 A;  5GPA A;  4V2F A;  2XRL A;  4M3D A;  3HGY A;  2HYJ A;  3VP5 A;  3VIB A;  3SWH A;  3PM1 A;  3FK7 A;  4I76 A;  4W97 A;  1U9O A;  3VVY A;  1A6I A;  1UI5 A;  3FRQ A;  4D7M A;  3MNL A;  5FKK A;  3VOK A;  1ORK A;  3ZQG A;  5F0H A;  4AC6 A;  2TRT A;  3ZQI A;  3VW0 A;  5C4Y A;  3BJB A;  3HTI A;  5H9T A;  2I10 A;  1JUP A;  2YVE A;  4L62 A;  4JYK A;  3NPI A;  3O8G A;  3ZQF A;  2GEN A;  4C2M A;  5K7Z A;  5HBU A;  3CCY A;  2HXO A;  3RH2 A;  3NNR A;  3B81 A;  3ZQH A;  2XPV A;  3Q3S A;  2NP5 A;  2UXI A;  3TP3 A;  4OD4 A;  3CWR A;  4ICH A;  5GPC A;  2DG8 A;  3GZI A;  3VVX A;  2R7O A;  2QKO A;  3LHQ A;  4U9N A;  5FKM A;  5IP6 A;  2G0E A;  5IPA A;  2XPU A;  4U9L A;  2W53 A;  5CXI A;  3TP0 A;  2DTZ A;  3CRJ A;  2JJ7 A;  3KKD A;  4DVY P;  1Z77 A;  5EZH A;  2ZOZ A;  2VKV A;  3Q0U A;  3K8P C;  4WIB A;  4AC0 A;  3FK6 A;  1RKT A;  4HKU A;  2VPR A;  3ANP A;  3O60 A;  4NEL A;  2F07 A;  5K7F A;  3COL A;  4XK4 A;  3O8H A;  2QOP A;  5K58 A;  3G1O A;  4MK6 A;  3BQZ A;  2WGB A;  2A2F X;  5FMP A;  3LOC A;  2R7W A;  2FJI 1;  3SDG A;  3DEW A;  2YVH A;  2FBQ A;  2XPW A;  1JTX A;  3IH2 A;  3DCF A;  2X6O A;  2IU5 A;  3QQA A;  3WHB A;  3VVZ A;  3CDL A;  2GBY A;  2Y30 A;  2XGE A;  1ZKG A;  2FX0 A;  3LSJ A;  3BTI A;  3EUP A;  2WV1 A;  5F08 A;  2IBD A;  5HSZ A;  2ZOY A;  3BR1 A;  4V2G A;  1JUM A;  3FIW A;  4MO7 A;  3VUQ A;  2HQ5 A;  1QPI A;  4W1U A;  2B1E A;  5CQG A;  1RPW A;  3IH3 A;  3FHN A;  4JKZ A;  3HGG A;  2XB5 A;  3G1M A;  5DAJ A;  2DG7 A;  2GFN A;  2OPT A;  2FQ4 A;  3Q0W A;  4DW6 A;  5F27 A;  3DU5 A;  1BJZ A;  4GFK A;  5EZG A;  3EGQ A;  3AQS A;  5IOY A;  5AQC A;  2OER A;  3MVP A;  2R7S A;  4OD5 A;  3V78 A;  3HE0 A;  4D5C A;  2R7R A;  5HAW A;  4M3F A;  2FD5 A;  5F0C A;  4KWA A;  1JUS A;  3NS4 A;  2UXP A;  3QBM A;  2O7O A;  4JL3 A;  3IUV A;  3P9T A;  3ZQL A;  3F1B A;  3BT9 A;  2ZB9 A;  4PXI A;  2YVX A;  2JK3 A;  3BR0 A;  2ZCN A;  3C2B A;  5IOZ A;  3BR2 A;  4M3B A;  2EH3 A;  2HXI A;  4AUX A;  4M3G A;  3G56 A;  4M3E A;  2RAE A;  5EFY A;  1U9N A;  5J3L A;  2FJ1 A;  4CGR A;  5D19 A;  3KNW A;  3RD3 A;  3IH4 A;  3QPS A;  3VOX A;  5FKN A;  3NI7 A;  1ZK8 A;  3BTC A;  3C07 A;  2R7U A;  2ZCX A;  2UXH A;  1T33 A;  1UI6 A;  3CJD A;  3GEU A;  3JSJ A;  1QVU A;  2XDN A;  2X9D A;  4D5F A;  2IEK A;  5F1J A;  3PAS A; 
#chains in the Genus database with same CATH homology
 5FKO A;  3HIM A;  3ON4 A;  5FKL A;  5F04 A;  2G7G A;  3AQT A;  3PPB A;  3WHC A;  2ID3 A;  2OI8 A;  4YZE A;  1Z0X A;  4AF5 A;  1JT0 A;  3BTL A;  2XGC A;  3QPL A;  3BR5 A;  2QIB A;  2G3B A;  2O7T A;  3BHQ A;  1T56 A;  3HTA A;  4JNN A;  2Q24 A;  2XGD A;  3HTJ A;  3S5R A;  3SFI A;  5J1R A;  3NRG A;  3VW1 A;  3KZ9 A;  2ZCM A;  5FHP A;  5F0F A;  3LWJ A;  2OF7 A;  4MXM A;  2WUI A;  3E7Q A;  2QWT A;  2G7S A;  1JT6 A;  3LJL A;  2Y31 A;  3G7R A;  4GCL A;  3LSP A;  3T6N A;  4G12 A;  5EYR A;  2VKE A;  3G1L A;  2G7L A;  5K7H A;  3HTH A;  2RAS A;  4UDS A;  3B6C A;  2PZ9 A;  2REK A;  2IAI A;  2V57 A;  2QCO A;  5J1U A;  2RHA A;  3F0C A;  5D1R A;  1RKW A;  5FGL A;  3BTJ A;  3LSR A;  4D7N A;  4ACI A;  2HKU A;  3Q0V A;  2Y2Z A;  1VI0 A;  3BRU A;  5CXG A;  5D18 A;  3V6G A;  3QKX A;  2HYT A;  2GUH A;  3KKC A;  1SGM A;  3VPR A;  2TCT A;  4GCT A;  2UXO A;  5CW8 A;  3VW2 A;  2PBX A;  3BQY A;  3NXC A;  4B1R A;  3BR6 A;  2ID6 A;  2UXU A;  4GFL A;  4X1E A;  3B6A A;  3BNI A;  3DPJ A;  1QVT A;  5J1Y A;  4ME9 A;  4GCK A;  1JTY A;  4B3A A;  4ABZ A;  2NS7 A;  3BCG A;  2QTQ A;  2NS8 A;  3ON2 A;  2D6Y A;  2NP3 A;  3ANG A;  4I6Z A;  3BR3 A;  5GP9 A;  2NX4 A;  4NN1 A;  5GPA A;  4V2F A;  2XRL A;  4M3D A;  3HGY A;  2HYJ A;  3VP5 A;  3VIB A;  3PM1 A;  3FK7 A;  4I76 A;  4W97 A;  1U9O A;  3VVY A;  1A6I A;  1UI5 A;  3FRQ A;  4D7M A;  3MNL A;  5FKK A;  3VOK A;  1ORK A;  3ZQG A;  5F0H A;  4AC6 A;  2TRT A;  3ZQI A;  3VW0 A;  5C4Y A;  3BJB A;  3HTI A;  5H9T A;  2I10 A;  1JUP A;  2YVE A;  4L62 A;  4JYK A;  3NPI A;  3O8G A;  3ZQF A;  2GEN A;  5K7Z A;  5HBU A;  3CCY A;  2HXO A;  3RH2 A;  3NNR A;  3B81 A;  3ZQH A;  2XPV A;  3Q3S A;  2NP5 A;  2UXI A;  3TP3 A;  3CWR A;  4ICH A;  5GPC A;  2DG8 A;  3GZI A;  3VVX A;  2QKO A;  3LHQ A;  5FKM A;  5IP6 A;  2G0E A;  5IPA A;  2XPU A;  2W53 A;  5CXI A;  3TP0 A;  2DTZ A;  3CRJ A;  2JJ7 A;  3KKD A;  1Z77 A;  5EZH A;  2ZOZ A;  2VKV A;  3Q0U A;  4AC0 A;  3FK6 A;  1RKT A;  4HKU A;  2VPR A;  3ANP A;  3O60 A;  4NEL A;  2F07 A;  5K7F A;  3COL A;  4XK4 A;  3O8H A;  2QOP A;  5K58 A;  3G1O A;  4MK6 A;  3BQZ A;  2WGB A;  5FMP A;  3LOC A;  3SDG A;  3DEW A;  2YVH A;  2FBQ A;  2XPW A;  1JTX A;  3IH2 A;  3DCF A;  2X6O A;  2IU5 A;  3QQA A;  3WHB A;  3VVZ A;  3CDL A;  2GBY A;  2Y30 A;  2XGE A;  1ZKG A;  2FX0 A;  3LSJ A;  3BTI A;  3EUP A;  2WV1 A;  5F08 A;  2IBD A;  5HSZ A;  2ZOY A;  3BR1 A;  4V2G A;  1JUM A;  3FIW A;  4MO7 A;  3VUQ A;  2HQ5 A;  1QPI A;  4W1U A;  1RPW A;  3IH3 A;  4JKZ A;  3HGG A;  2XB5 A;  3G1M A;  5DAJ A;  2DG7 A;  2GFN A;  2OPT A;  2FQ4 A;  3Q0W A;  4DW6 A;  5F27 A;  4GFK A;  1BJZ A;  5EZG A;  3EGQ A;  3AQS A;  5IOY A;  5AQC A;  2OER A;  3MVP A;  3V78 A;  3HE0 A;  4D5C A;  5HAW A;  4M3F A;  2FD5 A;  5F0C A;  4KWA A;  1JUS A;  2UXP A;  3QBM A;  2O7O A;  4JL3 A;  3IUV A;  3P9T A;  3ZQL A;  3F1B A;  3BT9 A;  2ZB9 A;  4PXI A;  2JK3 A;  3BR0 A;  2ZCN A;  3C2B A;  5IOZ A;  3BR2 A;  4M3B A;  2EH3 A;  2HXI A;  4AUX A;  4M3G A;  3G56 A;  4M3E A;  2RAE A;  5EFY A;  1U9N A;  5J3L A;  2FJ1 A;  4CGR A;  5D19 A;  3KNW A;  3RD3 A;  3IH4 A;  3QPS A;  3VOX A;  5FKN A;  3NI7 A;  1ZK8 A;  3BTC A;  3C07 A;  2ZCX A;  2UXH A;  1T33 A;  1UI6 A;  3CJD A;  3GEU A;  3JSJ A;  1QVU A;  2XDN A;  2X9D A;  4D5F A;  2IEK A;  5F1J A;  3PAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...