4YZEA

Crystal structure of e.coli nemr reduced form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
HDTREHLLATGEQLSLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAYHQRLTELLQSGEGNYRDRILAYYQQTLNQFSQHGTISGCLTVKLSAEVSDLSEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAHVKNIIATPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor NemR
publication title Does the Transcription Factor NemR Use a Regulatory Sulfenamide Bond to Sense Bleach?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 74
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4yzeA00
4D5CA 4YZEA 1T56A 3GZIA 2ZOYA 3DPJA 5FKKA 4AUXA 2QKOA 2EH3A 1JT6A 3PPBA 3Q0VA 2G0EA 2UXHA 4GCTA 3NRGA 5EZGA 1JTXA 3QPLA 3CRJA 2TCTA 5EFYA 3SDGA 2NP3A 3BR2A 3EGQA 4HKUA 2W53A 4X1EA 4GCLA 3DEWA 4CGRA 5K58A 1JUSA 2VKEA 3FK7A 4M3DA 5HSZA 4AF5A 3ON2A 2IEKA 3BTLA 3HGYA 3BQYA 3LOCA 4NELA 3BR6A 2HXOA 1ZK8A 3HTIA 3ZQGA 5F0CA 3KKDA 2XPWA 4ME9A 5CXIA 3F0CA 3BR1A 5IOZA 3BR0A 1JUMA 3F1BA 4MK6A 2NS8A 4JYKA 4ACIA 1ZKGA 2PZ9A 3G7RA 3NNRA 5FKOA 3JSJA 2OF7A 3HIMA 4V2FA 4I6ZA 3S5RA 5F1JA 5GP9A 3ZQHA 3COLA 1ORKA 1RKTA 4D7NA 5H9TA 5D1RA 3VOXA 4D5FA 2FD5A 5F08A 5K7ZA 5FKLA 1VI0A 2YVEA 5CXGA 2HYTA 3E7QA 3IH4A 2XGCA 4JNNA 3VOKA 3V78A 3WHCA 1A6IA 3Q0WA 2I10A 3QBMA 2DTZA 2OI8A 3CDLA 2G7LA 3TP0A 2ZCXA 2XGDA 4DW6A 3CWRA 5IOYA 2G3BA 5GPCA 3VVYA 3P9TA 1SGMA 4M3BA 3C2BA 5DAJA 3MVPA 1JTYA 3VVXA 4M3GA 4D7MA 1UI6A 2G7GA 2VPRA 3WHBA 2GUHA 3LWJA 2REKA 2FBQA 2DG8A 2OPTA 3RH2A 5HAWA 3IH3A 4B3AA 4B1RA 1RPWA 3BQZA 2G7SA 3VPRA 4W97A 5D19A 2JJ7A 2WUIA 2IBDA 2V57A 2QOPA 3VW1A 2IU5A 2HYJA 3NXCA 4JL3A 5J1UA 3FIWA 1Z77A 2F07A 3IH2A 1JUPA 5IP6A 2D6YA 2GBYA 2UXIA 3FRQA 3VP5A 3B6CA 3HGGA 3CJDA 5J1YA 3QQAA 3O60A 4XK4A 5EZHA 5IPAA 3LHQA 3SFIA 5CW8A 2XB5A 2X9DA 5FKNA 4NN1A 2NP5A 2ID3A 2HKUA 2HQ5A 5FHPA 2QIBA 1U9NA 3FK6A 4GFKA 2ZB9A 3VVZA 2ZCMA 3BTCA 2HXIA 1Z0XA 2QWTA 2XGEA 5F0FA 3PASA 3AQTA 2RHAA 2NS7A 4M3FA 2PBXA 3QKXA 3CCYA 5HBUA 2RAEA 3KKCA 3BHQA 3EUPA 2FQ4A 3BR5A 3VIBA 3HTHA 3GEUA 3ZQFA 4MO7A 1BJZA 1QPIA 2FX0A 2DG7A 2XPVA 5FKMA 3B6AA 1QVUA 3BCGA 5AQCA 3ON4A 5J3LA 3BRUA 3HE0A 3Q0UA 3BJBA 3BTIA 2XPUA 3BTJA 3DCFA 2FJ1A 2GFNA 2ID6A 2Y31A 5F0HA 2ZOZA 5FMPA 3VW2A 4V2GA 1QVTA 3TP3A 3IUVA 5K7FA 4JKZA 2XDNA 4ABZA 5J1RA 2YVHA 2O7TA 5K7HA 3G1MA 3VUQA 5D18A 4ICHA 5F04A 3KZ9A 2O7OA 2JK3A 3NPIA 3NI7A 3ANPA 3BR3A 3VW0A 3BNIA 2Y30A 2OERA 4PXIA 4L62A 4AC6A 2RASA 5FGLA 2UXPA 3V6GA 2GENA 3ZQIA 1T33A 2QCOA 3HTJA 2Y2ZA 1U9OA 3QPSA 3O8HA 4M3EA 4AC0A 4GFLA 5EYRA 3G1OA 2XRLA 3RD3A 2X6OA 2IAIA 3KNWA 2VKVA 4GCKA 3HTAA 3ZQLA 3Q3SA 3AQSA 5C4YA 3B81A 2QTQA 3LSPA 3LSRA 1JT0A 2Q24A 2NX4A 4I76A 2TRTA 3ANGA 4MXMA 4UDSA 2UXOA 3G1LA 3PM1A 2WV1A 4KWAA 3C07A 3BT9A 3O8GA 3LJLA 1UI5A 5GPAA 2WGBA 3G56A 4W1UA 3MNLA 2ZCNA 3LSJA 2UXUA 4G12A 1RKWA 3T6NA 5F27A
chains in the Genus database with same CATH superfamily
4D5CA 4YZEA 1T56A 3GZIA 2ZOYA 3K8PC 3DPJA 5FKKA 4IRVA 4AUXA 2QKOA 2EH3A 1JT6A 3PPBA 3Q0VA 2G0EA 2UXHA 2FJI1 4GCTA 3NRGA 2PFVA 5EZGA 1JTXA 3QPLA 3CRJA 2TCTA 5EFYA 3SDGA 2NP3A 3BR2A 3EGQA 4HKUA 2W53A 4X1EA 4GCLA 3DEWA 4CGRA 5K58A 1JUSA 2VKEA 3FK7A 4M3DA 5HSZA 4AF5A 3ON2A 2IEKA 2R7XA 3BTLA 3HGYA 3BQYA 3LOCA 4NELA 3BR6A 2HXOA 1ZK8A 3HTIA 3ZQGA 5F0CA 3KKDA 2R7UA 2XPWA 4ME9A 2ZY9A 3KYLA 4OD4A 5CXIA 3F0CA 3BR1A 2B3WA 5IOZA 3BR0A 1JUMA 3F1BA 4MK6A 3NS4A 2NS8A 4JYKA 4ACIA 1ZKGA 2PZ9A 3G7RA 3NNRA 5CQGA 5FKOA 3JSJA 2OF7A 3HIMA 4V2FA 4I6ZA 3S5RA 5F1JA 5GP9A 4C2MA 3COLA 3ZQHA 1ORKA 1RKTA 4D7NA 5H9TA 5D1RA 3VOXA 4D5FA 2FD5A 5F08A 5K7ZA 5FKLA 1VI0A 2YVEA 5CXGA 2HYTA 3E7QA 3IH4A 2XGCA 4JNNA 3VOKA 3V78A 3WHCA 1A6IA 3Q0WA 2I10A 3QBMA 2DTZA 2OI8A 3CDLA 2G7LA 4OD5A 3TP0A 2ZCXA 2XGDA 4DW6A 3CWRA 5IOYA 2G3BA 5GPCA 3VVYA 3P9TA 1SGMA 4M3BA 3C2BA 5DAJA 3MVPA 1JTYA 3VVXA 4M3GA 4D7MA 1UI6A 2G7GA 2VPRA 3DU6A 3WHBA 2GUHA 3LWJA 2REKA 2FBQA 2DG8A 2OPTA 3RH2A 5HAWA 3IH3A 2R7QA 4B3AA 4B1RA 1RPWA 3BQZA 2G7SA 2R7RA 3VPRA 4W97A 5D19A 2JJ7A 2WUIA 2IBDA 2V57A 2QOPA 3VW1A 2IU5A 2HYJA 3NXCA 4U9NA 4JL3A 5J1UA 3FIWA 2R7TA 1Z77A 2F07A 3IH2A 1JUPA 5IP6A 2D6YA 2GBYA 2UXIA 3FRQA 3VP5A 3B6CA 2R7WA 3HGGA 3CJDA 5J1YA 3QQAA 3O60A 4XK4A 5EZHA 5IPAA 3LHQA 3SFIA 5CW8A 2XB5A 2X9DA 5FKNA 4NN1A 2NP5A 2ID3A 2HKUA 2HQ5A 5FHPA 2QIBA 1U9NA 3FK6A 4GFKA 2ZB9A 3VVZA 2ZCMA 3BTCA 2HXIA 1Z0XA 2QWTA 2XGEA 5F0FA 3PASA 3AQTA 2RHAA 2NS7A 4M3FA 2PBXA 3QKXA 3CCYA 5HBUA 2RAEA 3KKCA 3DU5A 3BHQA 3EUPA 2FQ4A 3BR5A 3VIBA 3HTHA 3GEUA 3ZQFA 4MO7A 1BJZA 1QPIA 2FX0A 2DG7A 2XPVA 5FKMA 3B6AA 1QVUA 4WIBA 3BCGA 5AQCA 3ON4A 5J3LA 3BRUA 3HE0A 3Q0UA 3BJBA 3BTIA 2XPUA 3BTJA 3DCFA 2FJ1A 2GFNA 2ID6A 2Y31A 5F0HA 2ZOZA 5FMPA 4DVYP 3VW2A 2R7SA 4V2GA 1QVTA 3TP3A 3IUVA 5K7FA 4JKZA 2XDNA 4ABZA 5J1RA 2YVHA 2O7TA 2YVXA 5K7HA 3G1MA 3VUQA 5D18A 4ICHA 5F04A 3KZ9A 2O7OA 4U9LA 2JK3A 3NPIA 3NI7A 3ANPA 3BR3A 3VW0A 3BNIA 2Y30A 2OERA 4PXIA 4L62A 4AC6A 2RASA 5FGLA 2UXPA 3V6GA 2GENA 3ZQIA 1T33A 2QCOA 3HTJA 2Y2ZA 1U9OA 3QPSA 3O8HA 4M3EA 4AC0A 4GFLA 5EYRA 3G1OA 3FHNA 2XRLA 3RD3A 3SWHA 2X6OA 2IAIA 3KNWA 2VKVA 4GCKA 3HTAA 3ZQLA 3Q3SA 3AQSA 5C4YA 3B81A 2QTQA 3LSPA 3LSRA 1JT0A 2Q24A 2NX4A 4I76A 2R7VA 2TRTA 3ANGA 4MXMA 2R7OA 4UDSA 2UXOA 3G1LA 3PM1A 2WV1A 4KWAA 3C07A 3BT9A 3O8GA 3LJLA 1UI5A 5GPAA 2WGBA 3G56A 2B1EA 4W1UA 3MNLA 2ZCNA 3LSJA 2UXUA 4G12A 3VTIA 1RKWA 3T6NA 5F27A 2A2FX
chains in the Genus database with same CATH topology
4D5CA 4YZEA 1T56A 3GZIA 2ZOYA 3DPJA 5FKKA 4AUXA 2QKOA 2EH3A 1JT6A 3PPBA 3Q0VA 2G0EA 2UXHA 4GCTA 3NRGA 5EZGA 1JTXA 3QPLA 3CRJA 2TCTA 5EFYA 3SDGA 2NP3A 3BR2A 3EGQA 4HKUA 2W53A 4X1EA 4GCLA 3DEWA 4CGRA 5K58A 1JUSA 2VKEA 3FK7A 4M3DA 5HSZA 4AF5A 3ON2A 2IEKA 3BTLA 3HGYA 3BQYA 3LOCA 4NELA 3BR6A 2HXOA 1ZK8A 3HTIA 3ZQGA 5F0CA 3KKDA 2XPWA 4ME9A 5CXIA 3F0CA 3BR1A 5IOZA 3BR0A 1JUMA 3F1BA 4MK6A 2NS8A 4JYKA 4ACIA 1ZKGA 2PZ9A 3G7RA 3NNRA 5FKOA 3JSJA 2OF7A 3HIMA 4V2FA 4I6ZA 3S5RA 5F1JA 5GP9A 3ZQHA 3COLA 1ORKA 1RKTA 4D7NA 5H9TA 5D1RA 3VOXA 4D5FA 2FD5A 5F08A 5K7ZA 5FKLA 1VI0A 2YVEA 5CXGA 2HYTA 3E7QA 3IH4A 2XGCA 4JNNA 3VOKA 3V78A 3WHCA 1A6IA 3Q0WA 2I10A 3QBMA 2DTZA 2OI8A 3CDLA 2G7LA 3TP0A 2ZCXA 2XGDA 4DW6A 3CWRA 5IOYA 2G3BA 5GPCA 3VVYA 3P9TA 1SGMA 4M3BA 3C2BA 5DAJA 3MVPA 1JTYA 3VVXA 4M3GA 4D7MA 1UI6A 2G7GA 2VPRA 3WHBA 2GUHA 3LWJA 2REKA 2FBQA 2DG8A 2OPTA 3RH2A 5HAWA 3IH3A 4B3AA 4B1RA 1RPWA 3BQZA 2G7SA 3VPRA 4W97A 5D19A 2JJ7A 2WUIA 2IBDA 2V57A 2QOPA 3VW1A 2IU5A 2HYJA 3NXCA 4JL3A 5J1UA 3FIWA 1Z77A 2F07A 3IH2A 1JUPA 5IP6A 2D6YA 2GBYA 2UXIA 3FRQA 3VP5A 3B6CA 3HGGA 3CJDA 5J1YA 3QQAA 3O60A 4XK4A 5EZHA 5IPAA 3LHQA 3SFIA 5CW8A 2XB5A 2X9DA 5FKNA 4NN1A 2NP5A 2ID3A 2HKUA 2HQ5A 5FHPA 2QIBA 1U9NA 3FK6A 4GFKA 2ZB9A 3VVZA 2ZCMA 3BTCA 2HXIA 1Z0XA 2QWTA 2XGEA 5F0FA 3PASA 3AQTA 2RHAA 2NS7A 4M3FA 2PBXA 3QKXA 3CCYA 5HBUA 2RAEA 3KKCA 3BHQA 3EUPA 2FQ4A 3BR5A 3VIBA 3HTHA 3GEUA 3ZQFA 4MO7A 1BJZA 1QPIA 2FX0A 2DG7A 2XPVA 5FKMA 3B6AA 1QVUA 3BCGA 5AQCA 3ON4A 5J3LA 3BRUA 3HE0A 3Q0UA 3BJBA 3BTIA 2XPUA 3BTJA 3DCFA 2FJ1A 2GFNA 2ID6A 2Y31A 5F0HA 2ZOZA 5FMPA 3VW2A 4V2GA 1QVTA 3TP3A 3IUVA 5K7FA 4JKZA 2XDNA 4ABZA 5J1RA 2YVHA 2O7TA 5K7HA 3G1MA 3VUQA 5D18A 4ICHA 5F04A 3KZ9A 2O7OA 2JK3A 3NPIA 3NI7A 3ANPA 3BR3A 3VW0A 3BNIA 2Y30A 2OERA 4PXIA 4L62A 4AC6A 2RASA 5FGLA 2UXPA 3V6GA 2GENA 3ZQIA 1T33A 2QCOA 3HTJA 2Y2ZA 1U9OA 3QPSA 3O8HA 4M3EA 4AC0A 4GFLA 5EYRA 3G1OA 2XRLA 3RD3A 2X6OA 2IAIA 3KNWA 2VKVA 4GCKA 3HTAA 3ZQLA 3Q3SA 3AQSA 5C4YA 3B81A 2QTQA 3LSPA 3LSRA 1JT0A 2Q24A 2NX4A 4I76A 2TRTA 3ANGA 4MXMA 4UDSA 2UXOA 3G1LA 3PM1A 2WV1A 4KWAA 3C07A 3BT9A 3O8GA 3LJLA 1UI5A 5GPAA 2WGBA 3G56A 4W1UA 3MNLA 2ZCNA 3LSJA 2UXUA 4G12A 1RKWA 3T6NA 5F27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D5C A;  4YZE A;  1T56 A;  3GZI A;  2ZOY A;  3DPJ A;  5FKK A;  4AUX A;  2QKO A;  2EH3 A;  1JT6 A;  3PPB A;  3Q0V A;  2G0E A;  2UXH A;  4GCT A;  3NRG A;  5EZG A;  1JTX A;  3QPL A;  3CRJ A;  2TCT A;  5EFY A;  3SDG A;  2NP3 A;  3BR2 A;  3EGQ A;  4HKU A;  2W53 A;  4X1E A;  4GCL A;  3DEW A;  4CGR A;  5K58 A;  1JUS A;  2VKE A;  3FK7 A;  4M3D A;  5HSZ A;  4AF5 A;  3ON2 A;  2IEK A;  3BTL A;  3HGY A;  3BQY A;  3LOC A;  4NEL A;  3BR6 A;  2HXO A;  1ZK8 A;  3HTI A;  3ZQG A;  5F0C A;  3KKD A;  2XPW A;  4ME9 A;  5CXI A;  3F0C A;  3BR1 A;  5IOZ A;  3BR0 A;  1JUM A;  3F1B A;  4MK6 A;  2NS8 A;  4JYK A;  4ACI A;  1ZKG A;  2PZ9 A;  3G7R A;  3NNR A;  5FKO A;  3JSJ A;  2OF7 A;  3HIM A;  4V2F A;  4I6Z A;  3S5R A;  5F1J A;  5GP9 A;  3ZQH A;  3COL A;  1ORK A;  1RKT A;  4D7N A;  5H9T A;  5D1R A;  3VOX A;  4D5F A;  2FD5 A;  5F08 A;  5K7Z A;  5FKL A;  1VI0 A;  2YVE A;  5CXG A;  2HYT A;  3E7Q A;  3IH4 A;  2XGC A;  4JNN A;  3VOK A;  3V78 A;  3WHC A;  1A6I A;  3Q0W A;  2I10 A;  3QBM A;  2DTZ A;  2OI8 A;  3CDL A;  2G7L A;  3TP0 A;  2ZCX A;  2XGD A;  4DW6 A;  3CWR A;  5IOY A;  2G3B A;  5GPC A;  3VVY A;  3P9T A;  1SGM A;  4M3B A;  3C2B A;  5DAJ A;  3MVP A;  1JTY A;  3VVX A;  4M3G A;  4D7M A;  1UI6 A;  2G7G A;  2VPR A;  3WHB A;  2GUH A;  3LWJ A;  2REK A;  2FBQ A;  2DG8 A;  2OPT A;  3RH2 A;  5HAW A;  3IH3 A;  4B3A A;  4B1R A;  1RPW A;  3BQZ A;  2G7S A;  3VPR A;  4W97 A;  5D19 A;  2JJ7 A;  2WUI A;  2IBD A;  2V57 A;  2QOP A;  3VW1 A;  2IU5 A;  2HYJ A;  3NXC A;  4JL3 A;  5J1U A;  3FIW A;  1Z77 A;  2F07 A;  3IH2 A;  1JUP A;  5IP6 A;  2D6Y A;  2GBY A;  2UXI A;  3FRQ A;  3VP5 A;  3B6C A;  3HGG A;  3CJD A;  5J1Y A;  3QQA A;  3O60 A;  4XK4 A;  5EZH A;  5IPA A;  3LHQ A;  3SFI A;  5CW8 A;  2XB5 A;  2X9D A;  5FKN A;  4NN1 A;  2NP5 A;  2ID3 A;  2HKU A;  2HQ5 A;  5FHP A;  2QIB A;  1U9N A;  3FK6 A;  4GFK A;  2ZB9 A;  3VVZ A;  2ZCM A;  3BTC A;  2HXI A;  1Z0X A;  2QWT A;  2XGE A;  5F0F A;  3PAS A;  3AQT A;  2RHA A;  2NS7 A;  4M3F A;  2PBX A;  3QKX A;  3CCY A;  5HBU A;  2RAE A;  3KKC A;  3BHQ A;  3EUP A;  2FQ4 A;  3BR5 A;  3VIB A;  3HTH A;  3GEU A;  3ZQF A;  4MO7 A;  1BJZ A;  1QPI A;  2FX0 A;  2DG7 A;  2XPV A;  5FKM A;  3B6A A;  1QVU A;  3BCG A;  5AQC A;  3ON4 A;  5J3L A;  3BRU A;  3HE0 A;  3Q0U A;  3BJB A;  3BTI A;  2XPU A;  3BTJ A;  3DCF A;  2FJ1 A;  2GFN A;  2ID6 A;  2Y31 A;  5F0H A;  2ZOZ A;  5FMP A;  3VW2 A;  4V2G A;  1QVT A;  3TP3 A;  3IUV A;  5K7F A;  4JKZ A;  2XDN A;  4ABZ A;  5J1R A;  2YVH A;  2O7T A;  5K7H A;  3G1M A;  3VUQ A;  5D18 A;  4ICH A;  5F04 A;  3KZ9 A;  2O7O A;  2JK3 A;  3NPI A;  3NI7 A;  3ANP A;  3BR3 A;  3VW0 A;  3BNI A;  2Y30 A;  2OER A;  4PXI A;  4L62 A;  4AC6 A;  2RAS A;  5FGL A;  2UXP A;  3V6G A;  2GEN A;  3ZQI A;  1T33 A;  2QCO A;  3HTJ A;  2Y2Z A;  1U9O A;  3QPS A;  3O8H A;  4M3E A;  4AC0 A;  4GFL A;  5EYR A;  3G1O A;  2XRL A;  3RD3 A;  2X6O A;  2IAI A;  3KNW A;  2VKV A;  4GCK A;  3HTA A;  3ZQL A;  3Q3S A;  3AQS A;  5C4Y A;  3B81 A;  2QTQ A;  3LSP A;  3LSR A;  1JT0 A;  2Q24 A;  2NX4 A;  4I76 A;  2TRT A;  3ANG A;  4MXM A;  4UDS A;  2UXO A;  3G1L A;  3PM1 A;  2WV1 A;  4KWA A;  3C07 A;  3BT9 A;  3O8G A;  3LJL A;  1UI5 A;  5GPA A;  2WGB A;  3G56 A;  4W1U A;  3MNL A;  2ZCN A;  3LSJ A;  2UXU A;  4G12 A;  1RKW A;  3T6N A;  5F27 A; 
#chains in the Genus database with same CATH topology
 4D5C A;  4YZE A;  1T56 A;  3GZI A;  2ZOY A;  3K8P C;  3DPJ A;  5FKK A;  4IRV A;  4AUX A;  2QKO A;  2EH3 A;  1JT6 A;  3PPB A;  3Q0V A;  2G0E A;  2UXH A;  2FJI 1;  4GCT A;  3NRG A;  2PFV A;  5EZG A;  1JTX A;  3QPL A;  3CRJ A;  2TCT A;  5EFY A;  3SDG A;  2NP3 A;  3BR2 A;  3EGQ A;  4HKU A;  2W53 A;  4X1E A;  4GCL A;  3DEW A;  4CGR A;  5K58 A;  1JUS A;  2VKE A;  3FK7 A;  4M3D A;  5HSZ A;  4AF5 A;  3ON2 A;  2IEK A;  2R7X A;  3BTL A;  3HGY A;  3BQY A;  3LOC A;  4NEL A;  3BR6 A;  2HXO A;  1ZK8 A;  3HTI A;  3ZQG A;  5F0C A;  3KKD A;  2R7U A;  2XPW A;  4ME9 A;  2ZY9 A;  3KYL A;  4OD4 A;  5CXI A;  3F0C A;  3BR1 A;  2B3W A;  5IOZ A;  3BR0 A;  1JUM A;  3F1B A;  4MK6 A;  3NS4 A;  2NS8 A;  4JYK A;  4ACI A;  1ZKG A;  2PZ9 A;  3G7R A;  3NNR A;  5CQG A;  5FKO A;  3JSJ A;  2OF7 A;  3HIM A;  4V2F A;  4I6Z A;  3S5R A;  5F1J A;  5GP9 A;  4C2M A;  3COL A;  3ZQH A;  1ORK A;  1RKT A;  4D7N A;  5H9T A;  5D1R A;  3VOX A;  4D5F A;  2FD5 A;  5F08 A;  5K7Z A;  5FKL A;  1VI0 A;  2YVE A;  5CXG A;  2HYT A;  3E7Q A;  3IH4 A;  2XGC A;  4JNN A;  3VOK A;  3V78 A;  3WHC A;  1A6I A;  3Q0W A;  2I10 A;  3QBM A;  2DTZ A;  2OI8 A;  3CDL A;  2G7L A;  4OD5 A;  3TP0 A;  2ZCX A;  2XGD A;  4DW6 A;  3CWR A;  5IOY A;  2G3B A;  5GPC A;  3VVY A;  3P9T A;  1SGM A;  4M3B A;  3C2B A;  5DAJ A;  3MVP A;  1JTY A;  3VVX A;  4M3G A;  4D7M A;  1UI6 A;  2G7G A;  2VPR A;  3DU6 A;  3WHB A;  2GUH A;  3LWJ A;  2REK A;  2FBQ A;  2DG8 A;  2OPT A;  3RH2 A;  5HAW A;  3IH3 A;  2R7Q A;  4B3A A;  4B1R A;  1RPW A;  3BQZ A;  2G7S A;  2R7R A;  3VPR A;  4W97 A;  5D19 A;  2JJ7 A;  2WUI A;  2IBD A;  2V57 A;  2QOP A;  3VW1 A;  2IU5 A;  2HYJ A;  3NXC A;  4U9N A;  4JL3 A;  5J1U A;  3FIW A;  2R7T A;  1Z77 A;  2F07 A;  3IH2 A;  1JUP A;  5IP6 A;  2D6Y A;  2GBY A;  2UXI A;  3FRQ A;  3VP5 A;  3B6C A;  2R7W A;  3HGG A;  3CJD A;  5J1Y A;  3QQA A;  3O60 A;  4XK4 A;  5EZH A;  5IPA A;  3LHQ A;  3SFI A;  5CW8 A;  2XB5 A;  2X9D A;  5FKN A;  4NN1 A;  2NP5 A;  2ID3 A;  2HKU A;  2HQ5 A;  5FHP A;  2QIB A;  1U9N A;  3FK6 A;  4GFK A;  2ZB9 A;  3VVZ A;  2ZCM A;  3BTC A;  2HXI A;  1Z0X A;  2QWT A;  2XGE A;  5F0F A;  3PAS A;  3AQT A;  2RHA A;  2NS7 A;  4M3F A;  2PBX A;  3QKX A;  3CCY A;  5HBU A;  2RAE A;  3KKC A;  3DU5 A;  3BHQ A;  3EUP A;  2FQ4 A;  3BR5 A;  3VIB A;  3HTH A;  3GEU A;  3ZQF A;  4MO7 A;  1BJZ A;  1QPI A;  2FX0 A;  2DG7 A;  2XPV A;  5FKM A;  3B6A A;  1QVU A;  4WIB A;  3BCG A;  5AQC A;  3ON4 A;  5J3L A;  3BRU A;  3HE0 A;  3Q0U A;  3BJB A;  3BTI A;  2XPU A;  3BTJ A;  3DCF A;  2FJ1 A;  2GFN A;  2ID6 A;  2Y31 A;  5F0H A;  2ZOZ A;  5FMP A;  4DVY P;  3VW2 A;  2R7S A;  4V2G A;  1QVT A;  3TP3 A;  3IUV A;  5K7F A;  4JKZ A;  2XDN A;  4ABZ A;  5J1R A;  2YVH A;  2O7T A;  2YVX A;  5K7H A;  3G1M A;  3VUQ A;  5D18 A;  4ICH A;  5F04 A;  3KZ9 A;  2O7O A;  4U9L A;  2JK3 A;  3NPI A;  3NI7 A;  3ANP A;  3BR3 A;  3VW0 A;  3BNI A;  2Y30 A;  2OER A;  4PXI A;  4L62 A;  4AC6 A;  2RAS A;  5FGL A;  2UXP A;  3V6G A;  2GEN A;  3ZQI A;  1T33 A;  2QCO A;  3HTJ A;  2Y2Z A;  1U9O A;  3QPS A;  3O8H A;  4M3E A;  4AC0 A;  4GFL A;  5EYR A;  3G1O A;  3FHN A;  2XRL A;  3RD3 A;  3SWH A;  2X6O A;  2IAI A;  3KNW A;  2VKV A;  4GCK A;  3HTA A;  3ZQL A;  3Q3S A;  3AQS A;  5C4Y A;  3B81 A;  2QTQ A;  3LSP A;  3LSR A;  1JT0 A;  2Q24 A;  2NX4 A;  4I76 A;  2R7V A;  2TRT A;  3ANG A;  4MXM A;  2R7O A;  4UDS A;  2UXO A;  3G1L A;  3PM1 A;  2WV1 A;  4KWA A;  3C07 A;  3BT9 A;  3O8G A;  3LJL A;  1UI5 A;  5GPA A;  2WGB A;  3G56 A;  2B1E A;  4W1U A;  3MNL A;  2ZCN A;  3LSJ A;  2UXU A;  4G12 A;  3VTI A;  1RKW A;  3T6N A;  5F27 A;  2A2F X; 
#chains in the Genus database with same CATH homology
 4D5C A;  4YZE A;  1T56 A;  3GZI A;  2ZOY A;  3DPJ A;  5FKK A;  4AUX A;  2QKO A;  2EH3 A;  1JT6 A;  3PPB A;  3Q0V A;  2G0E A;  2UXH A;  4GCT A;  3NRG A;  5EZG A;  1JTX A;  3QPL A;  3CRJ A;  2TCT A;  5EFY A;  3SDG A;  2NP3 A;  3BR2 A;  3EGQ A;  4HKU A;  2W53 A;  4X1E A;  4GCL A;  3DEW A;  4CGR A;  5K58 A;  1JUS A;  2VKE A;  3FK7 A;  4M3D A;  5HSZ A;  4AF5 A;  3ON2 A;  2IEK A;  3BTL A;  3HGY A;  3BQY A;  3LOC A;  4NEL A;  3BR6 A;  2HXO A;  1ZK8 A;  3HTI A;  3ZQG A;  5F0C A;  3KKD A;  2XPW A;  4ME9 A;  5CXI A;  3F0C A;  3BR1 A;  5IOZ A;  3BR0 A;  1JUM A;  3F1B A;  4MK6 A;  2NS8 A;  4JYK A;  4ACI A;  1ZKG A;  2PZ9 A;  3G7R A;  3NNR A;  5FKO A;  3JSJ A;  2OF7 A;  3HIM A;  4V2F A;  4I6Z A;  3S5R A;  5F1J A;  5GP9 A;  3ZQH A;  3COL A;  1ORK A;  1RKT A;  4D7N A;  5H9T A;  5D1R A;  3VOX A;  4D5F A;  2FD5 A;  5F08 A;  5K7Z A;  5FKL A;  1VI0 A;  2YVE A;  5CXG A;  2HYT A;  3E7Q A;  3IH4 A;  2XGC A;  4JNN A;  3VOK A;  3V78 A;  3WHC A;  1A6I A;  3Q0W A;  2I10 A;  3QBM A;  2DTZ A;  2OI8 A;  3CDL A;  2G7L A;  3TP0 A;  2ZCX A;  2XGD A;  4DW6 A;  3CWR A;  5IOY A;  2G3B A;  5GPC A;  3VVY A;  3P9T A;  1SGM A;  4M3B A;  3C2B A;  5DAJ A;  3MVP A;  1JTY A;  3VVX A;  4M3G A;  4D7M A;  1UI6 A;  2G7G A;  2VPR A;  3WHB A;  2GUH A;  3LWJ A;  2REK A;  2FBQ A;  2DG8 A;  2OPT A;  3RH2 A;  5HAW A;  3IH3 A;  4B3A A;  4B1R A;  1RPW A;  3BQZ A;  2G7S A;  3VPR A;  4W97 A;  5D19 A;  2JJ7 A;  2WUI A;  2IBD A;  2V57 A;  2QOP A;  3VW1 A;  2IU5 A;  2HYJ A;  3NXC A;  4JL3 A;  5J1U A;  3FIW A;  1Z77 A;  2F07 A;  3IH2 A;  1JUP A;  5IP6 A;  2D6Y A;  2GBY A;  2UXI A;  3FRQ A;  3VP5 A;  3B6C A;  3HGG A;  3CJD A;  5J1Y A;  3QQA A;  3O60 A;  4XK4 A;  5EZH A;  5IPA A;  3LHQ A;  3SFI A;  5CW8 A;  2XB5 A;  2X9D A;  5FKN A;  4NN1 A;  2NP5 A;  2ID3 A;  2HKU A;  2HQ5 A;  5FHP A;  2QIB A;  1U9N A;  3FK6 A;  4GFK A;  2ZB9 A;  3VVZ A;  2ZCM A;  3BTC A;  2HXI A;  1Z0X A;  2QWT A;  2XGE A;  5F0F A;  3PAS A;  3AQT A;  2RHA A;  2NS7 A;  4M3F A;  2PBX A;  3QKX A;  3CCY A;  5HBU A;  2RAE A;  3KKC A;  3BHQ A;  3EUP A;  2FQ4 A;  3BR5 A;  3VIB A;  3HTH A;  3GEU A;  3ZQF A;  4MO7 A;  1BJZ A;  1QPI A;  2FX0 A;  2DG7 A;  2XPV A;  5FKM A;  3B6A A;  1QVU A;  3BCG A;  5AQC A;  3ON4 A;  5J3L A;  3BRU A;  3HE0 A;  3Q0U A;  3BJB A;  3BTI A;  2XPU A;  3BTJ A;  3DCF A;  2FJ1 A;  2GFN A;  2ID6 A;  2Y31 A;  5F0H A;  2ZOZ A;  5FMP A;  3VW2 A;  4V2G A;  1QVT A;  3TP3 A;  3IUV A;  5K7F A;  4JKZ A;  2XDN A;  4ABZ A;  5J1R A;  2YVH A;  2O7T A;  5K7H A;  3G1M A;  3VUQ A;  5D18 A;  4ICH A;  5F04 A;  3KZ9 A;  2O7O A;  2JK3 A;  3NPI A;  3NI7 A;  3ANP A;  3BR3 A;  3VW0 A;  3BNI A;  2Y30 A;  2OER A;  4PXI A;  4L62 A;  4AC6 A;  2RAS A;  5FGL A;  2UXP A;  3V6G A;  2GEN A;  3ZQI A;  1T33 A;  2QCO A;  3HTJ A;  2Y2Z A;  1U9O A;  3QPS A;  3O8H A;  4M3E A;  4AC0 A;  4GFL A;  5EYR A;  3G1O A;  2XRL A;  3RD3 A;  2X6O A;  2IAI A;  3KNW A;  2VKV A;  4GCK A;  3HTA A;  3ZQL A;  3Q3S A;  3AQS A;  5C4Y A;  3B81 A;  2QTQ A;  3LSP A;  3LSR A;  1JT0 A;  2Q24 A;  2NX4 A;  4I76 A;  2TRT A;  3ANG A;  4MXM A;  4UDS A;  2UXO A;  3G1L A;  3PM1 A;  2WV1 A;  4KWA A;  3C07 A;  3BT9 A;  3O8G A;  3LJL A;  1UI5 A;  5GPA A;  2WGB A;  3G56 A;  4W1U A;  3MNL A;  2ZCN A;  3LSJ A;  2UXU A;  4G12 A;  1RKW A;  3T6N A;  5F27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...