4YZEA

Crystal structure of e.coli nemr reduced form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
193
structure length
193
Chain Sequence
b'HDTREHLLATGEQLSLQRGFTGMGLSELLKTAEVPKGSFYHYFRSKEAFGVAMLERHYAAYHQRLTELLQSGEGNYRDRILAYYQQTLNQFSQHGTISGCLTVKLSAEVSDLSEDMRSAMDKGARGVIALLSQALENGRENHSLTFSGEPLQQAQVLYALWLGANLQAKISRSFEPLENALAHVKNIIATPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor NemR
publication title Does the Transcription Factor NemR Use a Regulatory Sulfenamide Bond to Sense Bleach?
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 74
structure length 193
sequence length 193
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4yzeA00
4YZEA 3NXCA 2QKOA 3HTIA 4GFLA 2UXOA 3BTLA 2F07A 3GEUA 1A6IA 5CXGA 3NNRA 4GCLA 5FKOA 5EZHA 3V6GA 5FMPA 4DW6A 3VVZA 3O8GA 4B1RA 4M3EA 2OI8A 4G12A 2XGDA 2RASA 2GENA 5K7ZA 4B3AA 4PXIA 3G56A 5K7HA 5IP6A 4AF5A 5K7FA 2QOPA 2HYTA 2NP3A 4HKUA 3COLA 2OF7A 3FIWA 2Q24A 4M3DA 2Y2ZA 2XGCA 5F04A 1ZK8A 2UXIA 2HYJA 2IAIA 2ZOYA 5EZGA 2QTQA 2D6YA 2UXPA 3ANPA 4M3FA 2XDNA 1JUMA 4XK4A 4D7NA 5D1RA 3DEWA 3LSJA 2HXOA 2IBDA 2RAEA 1JT6A 1ZKGA 3G1LA 2G7GA 1RKTA 2GUHA 4GCKA 3LJLA 5F1JA 1JTYA 3VOKA 1U9NA 5FKKA 4M3BA 3IH4A 3HGYA 4ACIA 1SGMA 3HTHA 3DCFA 3EUPA 3F1BA 2ZCNA 5EYRA 2VKVA 1BJZA 2DTZA 1Z77A 3SFIA 3O8HA 2FD5A 3Q0VA 4ABZA 2O7TA 4W1UA 4AUXA 3HGGA 3BT9A 2JJ7A 3HTAA 5FGLA 3BCGA 3PPBA 3VPRA 2XPWA 3ZQGA 5CXIA 3NRGA 4GFKA 3ON2A 3BTJA 2NX4A 3E7QA 4NN1A 3C07A 3GZIA 3BNIA 1UI5A 4GCTA 3CDLA 3VP5A 3G1OA 3JSJA 2EH3A 3VVYA 2XPUA 3BQYA 3Q0WA 3ZQFA 3KKDA 3BQZA 2JK3A 2REKA 1UI6A 1QVTA 4CGRA 3Q0UA 3P9TA 3T6NA 1T56A 3LWJA 4MXMA 3FK6A 2FX0A 1ORKA 2QWTA 3C2BA 3BTIA 3VW1A 3LSPA 3BRUA 5H9TA 3HTJA 4D5CA 3VW0A 2DG7A 3QPLA 3WHCA 2XRLA 5DAJA 1JT0A 2OERA 3S5RA 5K58A 2VKEA 5GPAA 5EFYA 2HKUA 3ZQHA 4JYKA 5GP9A 3NI7A 2NS8A 3VIBA 3MNLA 3TP0A 1VI0A 3IUVA 2V57A 5HSZA 3CWRA 4AC0A 2ZOZA 3DPJA 3LSRA 2Y31A 3TP3A 1JUSA 3AQTA 2XB5A 2NS7A 5J1YA 3Q3SA 3ON4A 3RD3A 3CJDA 3EGQA 3WHBA 4ICHA 5F0HA 3BTCA 4M3GA 3BJBA 3FK7A 3BR0A 1Z0XA 3KZ9A 3CCYA 4V2GA 5IOZA 2HQ5A 3PM1A 2OPTA 1RKWA 4D5FA 5F08A 3VUQA 2WUIA 3HIMA 3G1MA 2FJ1A 2QIBA 4D7MA 4I76A 2XGEA 3KKCA 2ID3A 2QCOA 3HE0A 3RH2A 3ZQIA 2UXHA 2RHAA 2W53A 1U9OA 5J3LA 5J1UA 5CW8A 4MO7A 2TCTA 2YVHA 5IOYA 3F0CA 2GFNA 5HAWA 3QQAA 1QPIA 2G7SA 2G0EA 3V78A 2VPRA 2G3BA 4W97A 3VVXA 2TRTA 5GPCA 1T33A 2Y30A 3FRQA 3NPIA 2ZB9A 4JKZA 4ME9A 2WGBA 3B6CA 4V2FA 1JUPA 3CRJA 2I10A 2IEKA 5F0CA 3G7RA 2UXUA 2XPVA 3QPSA 5FKLA 3BR5A 3IH3A 5C4YA 3ZQLA 5FKNA 5IPAA 2ZCXA 4AC6A 4UDSA 4X1EA 2FBQA 5AQCA 4KWAA 4I6ZA 2X6OA 1JTXA 3AQSA 2NP5A 3BR3A 2IU5A 3QKXA 3BR2A 2ID6A 3KNWA 5HBUA 3B6AA 2PBXA 2PZ9A 3IH2A 2O7OA 5FHPA 5D18A 5F0FA 3BR1A 3SDGA 2WV1A 4JNNA 5F27A 5J1RA 2G7LA 3QBMA 3PASA 4JL3A 3VW2A 5D19A 2HXIA 2ZCMA 4MK6A 3ANGA 3VOXA 3BR6A 4NELA 5FKMA 1QVUA 4L62A 3LHQA 2FQ4A 2X9DA 2YVEA 2DG8A 3BHQA 3LOCA 2GBYA 3MVPA 1RPWA 3B81A 3O60A
chains in the Genus database with same CATH superfamily
4YZEA 3NXCA 2QKOA 3HTIA 4GFLA 2UXOA 3BTLA 2F07A 3GEUA 1A6IA 5CXGA 3NNRA 3KYLA 4GCLA 5FKOA 5EZHA 3V6GA 5FMPA 4WIBA 4DW6A 3VVZA 3FHNA 2A2FX 3O8GA 4B1RA 4M3EA 2OI8A 4G12A 2XGDA 2RASA 2GENA 5K7ZA 4B3AA 4PXIA 3G56A 5K7HA 5IP6A 4AF5A 5K7FA 2QOPA 2HYTA 2NP3A 4HKUA 3COLA 2OF7A 3FIWA 2Q24A 4M3DA 2Y2ZA 2XGCA 5F04A 1ZK8A 2FJI1 2UXIA 2HYJA 2IAIA 2ZOYA 5EZGA 2QTQA 2D6YA 2UXPA 3ANPA 4M3FA 2YVXA 2XDNA 1JUMA 4XK4A 4D7NA 5D1RA 3DEWA 3LSJA 2HXOA 2IBDA 2RAEA 1JT6A 1ZKGA 3G1LA 2G7GA 1RKTA 2GUHA 4GCKA 3LJLA 3SWHA 5F1JA 1JTYA 3VOKA 1U9NA 5FKKA 4M3BA 3IH4A 3HGYA 4ACIA 1SGMA 3HTHA 3K8PC 3DCFA 3EUPA 3F1BA 2ZCNA 5EYRA 2PFVA 4U9NA 2VKVA 1BJZA 2DTZA 1Z77A 3SFIA 3O8HA 2FD5A 3Q0VA 4ABZA 2O7TA 4W1UA 4AUXA 3HGGA 3BT9A 2JJ7A 3HTAA 5FGLA 3BCGA 3PPBA 3VPRA 3VTIA 2XPWA 3DU6A 3ZQGA 5CXIA 3NRGA 4GFKA 3ON2A 3BTJA 2NX4A 3E7QA 4NN1A 2R7OA 3C07A 3GZIA 2R7VA 3BNIA 1UI5A 4GCTA 3CDLA 3VP5A 3G1OA 3JSJA 2EH3A 3VVYA 2XPUA 3BQYA 3Q0WA 3ZQFA 3KKDA 3BQZA 2JK3A 2REKA 1UI6A 1QVTA 4CGRA 3Q0UA 3P9TA 3T6NA 1T56A 4C2MA 3LWJA 4MXMA 3FK6A 2FX0A 1ORKA 2QWTA 3C2BA 3BTIA 3VW1A 3LSPA 3BRUA 5H9TA 3HTJA 4D5CA 2DG7A 3VW0A 3QPLA 3WHCA 2XRLA 5DAJA 1JT0A 2OERA 3S5RA 5K58A 2VKEA 5GPAA 5EFYA 2HKUA 3ZQHA 3NS4A 4JYKA 5GP9A 3NI7A 2NS8A 3VIBA 3MNLA 3TP0A 1VI0A 3IUVA 2V57A 2R7TA 5HSZA 3CWRA 4AC0A 2ZOZA 3DPJA 3LSRA 2Y31A 3TP3A 4DVYP 1JUSA 3AQTA 2XB5A 2NS7A 5J1YA 3Q3SA 3ON4A 3RD3A 3CJDA 3EGQA 3WHBA 4ICHA 5F0HA 3BTCA 4M3GA 3BJBA 3FK7A 3BR0A 1Z0XA 3KZ9A 3CCYA 4V2GA 2R7XA 5IOZA 2HQ5A 3PM1A 4OD4A 2OPTA 1RKWA 4D5FA 5F08A 3VUQA 2WUIA 3HIMA 3G1MA 2B3WA 2FJ1A 2QIBA 4D7MA 4I76A 2XGEA 3KKCA 2ID3A 2QCOA 3HE0A 3RH2A 4U9LA 3ZQIA 2UXHA 2RHAA 2W53A 1U9OA 5J3LA 5J1UA 5CW8A 4MO7A 2TCTA 2YVHA 2R7QA 5IOYA 3F0CA 2GFNA 5HAWA 3QQAA 1QPIA 2G7SA 2G0EA 3V78A 2VPRA 2G3BA 4W97A 3VVXA 2TRTA 5GPCA 2R7RA 1T33A 2Y30A 3FRQA 3NPIA 2ZB9A 4JKZA 4ME9A 2WGBA 3B6CA 4V2FA 1JUPA 3CRJA 2I10A 2IEKA 4OD5A 5F0CA 3G7RA 2UXUA 2XPVA 3QPSA 5FKLA 3BR5A 3IH3A 5C4YA 3ZQLA 5FKNA 5IPAA 2ZCXA 4AC6A 4UDSA 5CQGA 4X1EA 2FBQA 5AQCA 2ZY9A 4KWAA 4I6ZA 2X6OA 1JTXA 2R7UA 3AQSA 2NP5A 3BR3A 2IU5A 2B1EA 3BR2A 2ID6A 3QKXA 3DU5A 3KNWA 5HBUA 3B6AA 2PBXA 2PZ9A 3IH2A 2O7OA 5FHPA 2R7SA 5D18A 5F0FA 3BR1A 3SDGA 2WV1A 4JNNA 5F27A 5J1RA 2G7LA 3QBMA 3PASA 4JL3A 3VW2A 5D19A 2HXIA 2ZCMA 4MK6A 3ANGA 3VOXA 3BR6A 4NELA 4IRVA 5FKMA 1QVUA 4L62A 3LHQA 2FQ4A 2X9DA 2YVEA 2DG8A 3BHQA 3LOCA 2GBYA 3MVPA 1RPWA 3B81A 3O60A 2R7WA
chains in the Genus database with same CATH topology
4YZEA 3NXCA 2QKOA 3HTIA 4GFLA 2UXOA 3BTLA 2F07A 3GEUA 1A6IA 5CXGA 3NNRA 4GCLA 5FKOA 5EZHA 3V6GA 5FMPA 4DW6A 3VVZA 3O8GA 4B1RA 4M3EA 2OI8A 4G12A 2XGDA 2RASA 2GENA 5K7ZA 4B3AA 4PXIA 3G56A 5K7HA 5IP6A 4AF5A 5K7FA 2QOPA 2HYTA 2NP3A 4HKUA 3COLA 2OF7A 3FIWA 2Q24A 4M3DA 2Y2ZA 2XGCA 5F04A 1ZK8A 2UXIA 2HYJA 2IAIA 2ZOYA 5EZGA 2QTQA 2D6YA 2UXPA 3ANPA 4M3FA 2XDNA 1JUMA 4XK4A 4D7NA 5D1RA 3DEWA 3LSJA 2HXOA 2IBDA 2RAEA 1JT6A 1ZKGA 3G1LA 2G7GA 1RKTA 2GUHA 4GCKA 3LJLA 5F1JA 1JTYA 3VOKA 1U9NA 5FKKA 4M3BA 3IH4A 3HGYA 4ACIA 1SGMA 3HTHA 3DCFA 3EUPA 3F1BA 2ZCNA 5EYRA 2VKVA 1BJZA 2DTZA 1Z77A 3SFIA 3O8HA 2FD5A 3Q0VA 4ABZA 2O7TA 4W1UA 4AUXA 3HGGA 3BT9A 2JJ7A 3HTAA 5FGLA 3BCGA 3PPBA 3VPRA 2XPWA 3ZQGA 5CXIA 3NRGA 4GFKA 3ON2A 3BTJA 2NX4A 3E7QA 4NN1A 3C07A 3GZIA 3BNIA 1UI5A 4GCTA 3CDLA 3VP5A 3G1OA 3JSJA 2EH3A 3VVYA 2XPUA 3BQYA 3Q0WA 3ZQFA 3KKDA 3BQZA 2JK3A 2REKA 1UI6A 1QVTA 4CGRA 3Q0UA 3P9TA 3T6NA 1T56A 3LWJA 4MXMA 3FK6A 2FX0A 1ORKA 2QWTA 3C2BA 3BTIA 3VW1A 3LSPA 3BRUA 5H9TA 3HTJA 4D5CA 3VW0A 2DG7A 3QPLA 3WHCA 2XRLA 5DAJA 1JT0A 2OERA 3S5RA 5K58A 2VKEA 5GPAA 5EFYA 2HKUA 3ZQHA 4JYKA 5GP9A 3NI7A 2NS8A 3VIBA 3MNLA 3TP0A 1VI0A 3IUVA 2V57A 5HSZA 3CWRA 4AC0A 2ZOZA 3DPJA 3LSRA 2Y31A 3TP3A 1JUSA 3AQTA 2XB5A 2NS7A 5J1YA 3Q3SA 3ON4A 3RD3A 3CJDA 3EGQA 3WHBA 4ICHA 5F0HA 3BTCA 4M3GA 3BJBA 3FK7A 3BR0A 1Z0XA 3KZ9A 3CCYA 4V2GA 5IOZA 2HQ5A 3PM1A 2OPTA 1RKWA 4D5FA 5F08A 3VUQA 2WUIA 3HIMA 3G1MA 2FJ1A 2QIBA 4D7MA 4I76A 2XGEA 3KKCA 2ID3A 2QCOA 3HE0A 3RH2A 3ZQIA 2UXHA 2RHAA 2W53A 1U9OA 5J3LA 5J1UA 5CW8A 4MO7A 2TCTA 2YVHA 5IOYA 3F0CA 2GFNA 5HAWA 3QQAA 1QPIA 2G7SA 2G0EA 3V78A 2VPRA 2G3BA 4W97A 3VVXA 2TRTA 5GPCA 1T33A 2Y30A 3FRQA 3NPIA 2ZB9A 4JKZA 4ME9A 2WGBA 3B6CA 4V2FA 1JUPA 3CRJA 2I10A 2IEKA 5F0CA 3G7RA 2UXUA 2XPVA 3QPSA 5FKLA 3BR5A 3IH3A 5C4YA 3ZQLA 5FKNA 5IPAA 2ZCXA 4AC6A 4UDSA 4X1EA 2FBQA 5AQCA 4KWAA 4I6ZA 2X6OA 1JTXA 3AQSA 2NP5A 3BR3A 2IU5A 3QKXA 3BR2A 2ID6A 3KNWA 5HBUA 3B6AA 2PBXA 2PZ9A 3IH2A 2O7OA 5FHPA 5D18A 5F0FA 3BR1A 3SDGA 2WV1A 4JNNA 5F27A 5J1RA 2G7LA 3QBMA 3PASA 4JL3A 3VW2A 5D19A 2HXIA 2ZCMA 4MK6A 3ANGA 3VOXA 3BR6A 4NELA 5FKMA 1QVUA 4L62A 3LHQA 2FQ4A 2X9DA 2YVEA 2DG8A 3BHQA 3LOCA 2GBYA 3MVPA 1RPWA 3B81A 3O60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZE A;  3NXC A;  2QKO A;  3HTI A;  4GFL A;  2UXO A;  3BTL A;  2F07 A;  3GEU A;  1A6I A;  5CXG A;  3NNR A;  4GCL A;  5FKO A;  5EZH A;  3V6G A;  5FMP A;  4DW6 A;  3VVZ A;  3O8G A;  4B1R A;  4M3E A;  2OI8 A;  4G12 A;  2XGD A;  2RAS A;  2GEN A;  5K7Z A;  4B3A A;  4PXI A;  3G56 A;  5K7H A;  5IP6 A;  4AF5 A;  5K7F A;  2QOP A;  2HYT A;  2NP3 A;  4HKU A;  3COL A;  2OF7 A;  3FIW A;  2Q24 A;  4M3D A;  2Y2Z A;  2XGC A;  5F04 A;  1ZK8 A;  2UXI A;  2HYJ A;  2IAI A;  2ZOY A;  5EZG A;  2QTQ A;  2D6Y A;  2UXP A;  3ANP A;  4M3F A;  2XDN A;  1JUM A;  4XK4 A;  4D7N A;  5D1R A;  3DEW A;  3LSJ A;  2HXO A;  2IBD A;  2RAE A;  1JT6 A;  1ZKG A;  3G1L A;  2G7G A;  1RKT A;  2GUH A;  4GCK A;  3LJL A;  5F1J A;  1JTY A;  3VOK A;  1U9N A;  5FKK A;  4M3B A;  3IH4 A;  3HGY A;  4ACI A;  1SGM A;  3HTH A;  3DCF A;  3EUP A;  3F1B A;  2ZCN A;  5EYR A;  2VKV A;  1BJZ A;  2DTZ A;  1Z77 A;  3SFI A;  3O8H A;  2FD5 A;  3Q0V A;  4ABZ A;  2O7T A;  4W1U A;  4AUX A;  3HGG A;  3BT9 A;  2JJ7 A;  3HTA A;  5FGL A;  3BCG A;  3PPB A;  3VPR A;  2XPW A;  3ZQG A;  5CXI A;  3NRG A;  4GFK A;  3ON2 A;  3BTJ A;  2NX4 A;  3E7Q A;  4NN1 A;  3C07 A;  3GZI A;  3BNI A;  1UI5 A;  4GCT A;  3CDL A;  3VP5 A;  3G1O A;  3JSJ A;  2EH3 A;  3VVY A;  2XPU A;  3BQY A;  3Q0W A;  3ZQF A;  3KKD A;  3BQZ A;  2JK3 A;  2REK A;  1UI6 A;  1QVT A;  4CGR A;  3Q0U A;  3P9T A;  3T6N A;  1T56 A;  3LWJ A;  4MXM A;  3FK6 A;  2FX0 A;  1ORK A;  2QWT A;  3C2B A;  3BTI A;  3VW1 A;  3LSP A;  3BRU A;  5H9T A;  3HTJ A;  4D5C A;  3VW0 A;  2DG7 A;  3QPL A;  3WHC A;  2XRL A;  5DAJ A;  1JT0 A;  2OER A;  3S5R A;  5K58 A;  2VKE A;  5GPA A;  5EFY A;  2HKU A;  3ZQH A;  4JYK A;  5GP9 A;  3NI7 A;  2NS8 A;  3VIB A;  3MNL A;  3TP0 A;  1VI0 A;  3IUV A;  2V57 A;  5HSZ A;  3CWR A;  4AC0 A;  2ZOZ A;  3DPJ A;  3LSR A;  2Y31 A;  3TP3 A;  1JUS A;  3AQT A;  2XB5 A;  2NS7 A;  5J1Y A;  3Q3S A;  3ON4 A;  3RD3 A;  3CJD A;  3EGQ A;  3WHB A;  4ICH A;  5F0H A;  3BTC A;  4M3G A;  3BJB A;  3FK7 A;  3BR0 A;  1Z0X A;  3KZ9 A;  3CCY A;  4V2G A;  5IOZ A;  2HQ5 A;  3PM1 A;  2OPT A;  1RKW A;  4D5F A;  5F08 A;  3VUQ A;  2WUI A;  3HIM A;  3G1M A;  2FJ1 A;  2QIB A;  4D7M A;  4I76 A;  2XGE A;  3KKC A;  2ID3 A;  2QCO A;  3HE0 A;  3RH2 A;  3ZQI A;  2UXH A;  2RHA A;  2W53 A;  1U9O A;  5J3L A;  5J1U A;  5CW8 A;  4MO7 A;  2TCT A;  2YVH A;  5IOY A;  3F0C A;  2GFN A;  5HAW A;  3QQA A;  1QPI A;  2G7S A;  2G0E A;  3V78 A;  2VPR A;  2G3B A;  4W97 A;  3VVX A;  2TRT A;  5GPC A;  1T33 A;  2Y30 A;  3FRQ A;  3NPI A;  2ZB9 A;  4JKZ A;  4ME9 A;  2WGB A;  3B6C A;  4V2F A;  1JUP A;  3CRJ A;  2I10 A;  2IEK A;  5F0C A;  3G7R A;  2UXU A;  2XPV A;  3QPS A;  5FKL A;  3BR5 A;  3IH3 A;  5C4Y A;  3ZQL A;  5FKN A;  5IPA A;  2ZCX A;  4AC6 A;  4UDS A;  4X1E A;  2FBQ A;  5AQC A;  4KWA A;  4I6Z A;  2X6O A;  1JTX A;  3AQS A;  2NP5 A;  3BR3 A;  2IU5 A;  3QKX A;  3BR2 A;  2ID6 A;  3KNW A;  5HBU A;  3B6A A;  2PBX A;  2PZ9 A;  3IH2 A;  2O7O A;  5FHP A;  5D18 A;  5F0F A;  3BR1 A;  3SDG A;  2WV1 A;  4JNN A;  5F27 A;  5J1R A;  2G7L A;  3QBM A;  3PAS A;  4JL3 A;  3VW2 A;  5D19 A;  2HXI A;  2ZCM A;  4MK6 A;  3ANG A;  3VOX A;  3BR6 A;  4NEL A;  5FKM A;  1QVU A;  4L62 A;  3LHQ A;  2FQ4 A;  2X9D A;  2YVE A;  2DG8 A;  3BHQ A;  3LOC A;  2GBY A;  3MVP A;  1RPW A;  3B81 A;  3O60 A; 
#chains in the Genus database with same CATH topology
 4YZE A;  3NXC A;  2QKO A;  3HTI A;  4GFL A;  2UXO A;  3BTL A;  2F07 A;  3GEU A;  1A6I A;  5CXG A;  3NNR A;  3KYL A;  4GCL A;  5FKO A;  5EZH A;  3V6G A;  5FMP A;  4WIB A;  4DW6 A;  3VVZ A;  3FHN A;  2A2F X;  3O8G A;  4B1R A;  4M3E A;  2OI8 A;  4G12 A;  2XGD A;  2RAS A;  2GEN A;  5K7Z A;  4B3A A;  4PXI A;  3G56 A;  5K7H A;  5IP6 A;  4AF5 A;  5K7F A;  2QOP A;  2HYT A;  2NP3 A;  4HKU A;  3COL A;  2OF7 A;  3FIW A;  2Q24 A;  4M3D A;  2Y2Z A;  2XGC A;  5F04 A;  1ZK8 A;  2FJI 1;  2UXI A;  2HYJ A;  2IAI A;  2ZOY A;  5EZG A;  2QTQ A;  2D6Y A;  2UXP A;  3ANP A;  4M3F A;  2YVX A;  2XDN A;  1JUM A;  4XK4 A;  4D7N A;  5D1R A;  3DEW A;  3LSJ A;  2HXO A;  2IBD A;  2RAE A;  1JT6 A;  1ZKG A;  3G1L A;  2G7G A;  1RKT A;  2GUH A;  4GCK A;  3LJL A;  3SWH A;  5F1J A;  1JTY A;  3VOK A;  1U9N A;  5FKK A;  4M3B A;  3IH4 A;  3HGY A;  4ACI A;  1SGM A;  3HTH A;  3K8P C;  3DCF A;  3EUP A;  3F1B A;  2ZCN A;  5EYR A;  2PFV A;  4U9N A;  2VKV A;  1BJZ A;  2DTZ A;  1Z77 A;  3SFI A;  3O8H A;  2FD5 A;  3Q0V A;  4ABZ A;  2O7T A;  4W1U A;  4AUX A;  3HGG A;  3BT9 A;  2JJ7 A;  3HTA A;  5FGL A;  3BCG A;  3PPB A;  3VPR A;  3VTI A;  2XPW A;  3DU6 A;  3ZQG A;  5CXI A;  3NRG A;  4GFK A;  3ON2 A;  3BTJ A;  2NX4 A;  3E7Q A;  4NN1 A;  2R7O A;  3C07 A;  3GZI A;  2R7V A;  3BNI A;  1UI5 A;  4GCT A;  3CDL A;  3VP5 A;  3G1O A;  3JSJ A;  2EH3 A;  3VVY A;  2XPU A;  3BQY A;  3Q0W A;  3ZQF A;  3KKD A;  3BQZ A;  2JK3 A;  2REK A;  1UI6 A;  1QVT A;  4CGR A;  3Q0U A;  3P9T A;  3T6N A;  1T56 A;  4C2M A;  3LWJ A;  4MXM A;  3FK6 A;  2FX0 A;  1ORK A;  2QWT A;  3C2B A;  3BTI A;  3VW1 A;  3LSP A;  3BRU A;  5H9T A;  3HTJ A;  4D5C A;  2DG7 A;  3VW0 A;  3QPL A;  3WHC A;  2XRL A;  5DAJ A;  1JT0 A;  2OER A;  3S5R A;  5K58 A;  2VKE A;  5GPA A;  5EFY A;  2HKU A;  3ZQH A;  3NS4 A;  4JYK A;  5GP9 A;  3NI7 A;  2NS8 A;  3VIB A;  3MNL A;  3TP0 A;  1VI0 A;  3IUV A;  2V57 A;  2R7T A;  5HSZ A;  3CWR A;  4AC0 A;  2ZOZ A;  3DPJ A;  3LSR A;  2Y31 A;  3TP3 A;  4DVY P;  1JUS A;  3AQT A;  2XB5 A;  2NS7 A;  5J1Y A;  3Q3S A;  3ON4 A;  3RD3 A;  3CJD A;  3EGQ A;  3WHB A;  4ICH A;  5F0H A;  3BTC A;  4M3G A;  3BJB A;  3FK7 A;  3BR0 A;  1Z0X A;  3KZ9 A;  3CCY A;  4V2G A;  2R7X A;  5IOZ A;  2HQ5 A;  3PM1 A;  4OD4 A;  2OPT A;  1RKW A;  4D5F A;  5F08 A;  3VUQ A;  2WUI A;  3HIM A;  3G1M A;  2B3W A;  2FJ1 A;  2QIB A;  4D7M A;  4I76 A;  2XGE A;  3KKC A;  2ID3 A;  2QCO A;  3HE0 A;  3RH2 A;  4U9L A;  3ZQI A;  2UXH A;  2RHA A;  2W53 A;  1U9O A;  5J3L A;  5J1U A;  5CW8 A;  4MO7 A;  2TCT A;  2YVH A;  2R7Q A;  5IOY A;  3F0C A;  2GFN A;  5HAW A;  3QQA A;  1QPI A;  2G7S A;  2G0E A;  3V78 A;  2VPR A;  2G3B A;  4W97 A;  3VVX A;  2TRT A;  5GPC A;  2R7R A;  1T33 A;  2Y30 A;  3FRQ A;  3NPI A;  2ZB9 A;  4JKZ A;  4ME9 A;  2WGB A;  3B6C A;  4V2F A;  1JUP A;  3CRJ A;  2I10 A;  2IEK A;  4OD5 A;  5F0C A;  3G7R A;  2UXU A;  2XPV A;  3QPS A;  5FKL A;  3BR5 A;  3IH3 A;  5C4Y A;  3ZQL A;  5FKN A;  5IPA A;  2ZCX A;  4AC6 A;  4UDS A;  5CQG A;  4X1E A;  2FBQ A;  5AQC A;  2ZY9 A;  4KWA A;  4I6Z A;  2X6O A;  1JTX A;  2R7U A;  3AQS A;  2NP5 A;  3BR3 A;  2IU5 A;  2B1E A;  3BR2 A;  2ID6 A;  3QKX A;  3DU5 A;  3KNW A;  5HBU A;  3B6A A;  2PBX A;  2PZ9 A;  3IH2 A;  2O7O A;  5FHP A;  2R7S A;  5D18 A;  5F0F A;  3BR1 A;  3SDG A;  2WV1 A;  4JNN A;  5F27 A;  5J1R A;  2G7L A;  3QBM A;  3PAS A;  4JL3 A;  3VW2 A;  5D19 A;  2HXI A;  2ZCM A;  4MK6 A;  3ANG A;  3VOX A;  3BR6 A;  4NEL A;  4IRV A;  5FKM A;  1QVU A;  4L62 A;  3LHQ A;  2FQ4 A;  2X9D A;  2YVE A;  2DG8 A;  3BHQ A;  3LOC A;  2GBY A;  3MVP A;  1RPW A;  3B81 A;  3O60 A;  2R7W A; 
#chains in the Genus database with same CATH homology
 4YZE A;  3NXC A;  2QKO A;  3HTI A;  4GFL A;  2UXO A;  3BTL A;  2F07 A;  3GEU A;  1A6I A;  5CXG A;  3NNR A;  4GCL A;  5FKO A;  5EZH A;  3V6G A;  5FMP A;  4DW6 A;  3VVZ A;  3O8G A;  4B1R A;  4M3E A;  2OI8 A;  4G12 A;  2XGD A;  2RAS A;  2GEN A;  5K7Z A;  4B3A A;  4PXI A;  3G56 A;  5K7H A;  5IP6 A;  4AF5 A;  5K7F A;  2QOP A;  2HYT A;  2NP3 A;  4HKU A;  3COL A;  2OF7 A;  3FIW A;  2Q24 A;  4M3D A;  2Y2Z A;  2XGC A;  5F04 A;  1ZK8 A;  2UXI A;  2HYJ A;  2IAI A;  2ZOY A;  5EZG A;  2QTQ A;  2D6Y A;  2UXP A;  3ANP A;  4M3F A;  2XDN A;  1JUM A;  4XK4 A;  4D7N A;  5D1R A;  3DEW A;  3LSJ A;  2HXO A;  2IBD A;  2RAE A;  1JT6 A;  1ZKG A;  3G1L A;  2G7G A;  1RKT A;  2GUH A;  4GCK A;  3LJL A;  5F1J A;  1JTY A;  3VOK A;  1U9N A;  5FKK A;  4M3B A;  3IH4 A;  3HGY A;  4ACI A;  1SGM A;  3HTH A;  3DCF A;  3EUP A;  3F1B A;  2ZCN A;  5EYR A;  2VKV A;  1BJZ A;  2DTZ A;  1Z77 A;  3SFI A;  3O8H A;  2FD5 A;  3Q0V A;  4ABZ A;  2O7T A;  4W1U A;  4AUX A;  3HGG A;  3BT9 A;  2JJ7 A;  3HTA A;  5FGL A;  3BCG A;  3PPB A;  3VPR A;  2XPW A;  3ZQG A;  5CXI A;  3NRG A;  4GFK A;  3ON2 A;  3BTJ A;  2NX4 A;  3E7Q A;  4NN1 A;  3C07 A;  3GZI A;  3BNI A;  1UI5 A;  4GCT A;  3CDL A;  3VP5 A;  3G1O A;  3JSJ A;  2EH3 A;  3VVY A;  2XPU A;  3BQY A;  3Q0W A;  3ZQF A;  3KKD A;  3BQZ A;  2JK3 A;  2REK A;  1UI6 A;  1QVT A;  4CGR A;  3Q0U A;  3P9T A;  3T6N A;  1T56 A;  3LWJ A;  4MXM A;  3FK6 A;  2FX0 A;  1ORK A;  2QWT A;  3C2B A;  3BTI A;  3VW1 A;  3LSP A;  3BRU A;  5H9T A;  3HTJ A;  4D5C A;  3VW0 A;  2DG7 A;  3QPL A;  3WHC A;  2XRL A;  5DAJ A;  1JT0 A;  2OER A;  3S5R A;  5K58 A;  2VKE A;  5GPA A;  5EFY A;  2HKU A;  3ZQH A;  4JYK A;  5GP9 A;  3NI7 A;  2NS8 A;  3VIB A;  3MNL A;  3TP0 A;  1VI0 A;  3IUV A;  2V57 A;  5HSZ A;  3CWR A;  4AC0 A;  2ZOZ A;  3DPJ A;  3LSR A;  2Y31 A;  3TP3 A;  1JUS A;  3AQT A;  2XB5 A;  2NS7 A;  5J1Y A;  3Q3S A;  3ON4 A;  3RD3 A;  3CJD A;  3EGQ A;  3WHB A;  4ICH A;  5F0H A;  3BTC A;  4M3G A;  3BJB A;  3FK7 A;  3BR0 A;  1Z0X A;  3KZ9 A;  3CCY A;  4V2G A;  5IOZ A;  2HQ5 A;  3PM1 A;  2OPT A;  1RKW A;  4D5F A;  5F08 A;  3VUQ A;  2WUI A;  3HIM A;  3G1M A;  2FJ1 A;  2QIB A;  4D7M A;  4I76 A;  2XGE A;  3KKC A;  2ID3 A;  2QCO A;  3HE0 A;  3RH2 A;  3ZQI A;  2UXH A;  2RHA A;  2W53 A;  1U9O A;  5J3L A;  5J1U A;  5CW8 A;  4MO7 A;  2TCT A;  2YVH A;  5IOY A;  3F0C A;  2GFN A;  5HAW A;  3QQA A;  1QPI A;  2G7S A;  2G0E A;  3V78 A;  2VPR A;  2G3B A;  4W97 A;  3VVX A;  2TRT A;  5GPC A;  1T33 A;  2Y30 A;  3FRQ A;  3NPI A;  2ZB9 A;  4JKZ A;  4ME9 A;  2WGB A;  3B6C A;  4V2F A;  1JUP A;  3CRJ A;  2I10 A;  2IEK A;  5F0C A;  3G7R A;  2UXU A;  2XPV A;  3QPS A;  5FKL A;  3BR5 A;  3IH3 A;  5C4Y A;  3ZQL A;  5FKN A;  5IPA A;  2ZCX A;  4AC6 A;  4UDS A;  4X1E A;  2FBQ A;  5AQC A;  4KWA A;  4I6Z A;  2X6O A;  1JTX A;  3AQS A;  2NP5 A;  3BR3 A;  2IU5 A;  3QKX A;  3BR2 A;  2ID6 A;  3KNW A;  5HBU A;  3B6A A;  2PBX A;  2PZ9 A;  3IH2 A;  2O7O A;  5FHP A;  5D18 A;  5F0F A;  3BR1 A;  3SDG A;  2WV1 A;  4JNN A;  5F27 A;  5J1R A;  2G7L A;  3QBM A;  3PAS A;  4JL3 A;  3VW2 A;  5D19 A;  2HXI A;  2ZCM A;  4MK6 A;  3ANG A;  3VOX A;  3BR6 A;  4NEL A;  5FKM A;  1QVU A;  4L62 A;  3LHQ A;  2FQ4 A;  2X9D A;  2YVE A;  2DG8 A;  3BHQ A;  3LOC A;  2GBY A;  3MVP A;  1RPW A;  3B81 A;  3O60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...