2V57A

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
171
Chain Sequence
b'ERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
molecule tags Transcription
source organism Mycobacterium smegmatis
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
total genus 66
structure length 171
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2v57A00
3CCYA 4ME9A 2DG8A 2FQ4A 3NRGA 5AQCA 3P9TA 2X9DA 4PXIA 5F0FA 4JL3A 5CXIA 2HQ5A 3HGYA 4ICHA 1JTYA 3BR5A 4ABZA 3ON2A 3GEUA 3Q0WA 3VVYA 4MO7A 3B6CA 2XPUA 3F0CA 2V57A 4KWAA 5J1YA 3LJLA 3FK7A 4GCLA 5D18A 2XDNA 3MNLA 2G0EA 5K7FA 3F1BA 4NN1A 2HXIA 2GBYA 4V2FA 2HYTA 4M3FA 4D5CA 1JUPA 2PBXA 5CXGA 5FKNA 4L62A 2WV1A 2YVEA 5FKOA 5D1RA 1Z0XA 3VW1A 4B3AA 5D19A 4D7NA 4GCTA 3ZQGA 3TP0A 2XRLA 3CRJA 3MVPA 5FKMA 4I76A 3ZQIA 1JT0A 5J1UA 3LWJA 3BR3A 2QWTA 3QPLA 2NP3A 3BTIA 4G12A 2UXIA 2D6YA 3SDGA 3PPBA 2HKUA 5HAWA 4W97A 2QIBA 4GCKA 3NI7A 3V6GA 4D7MA 3LSRA 2NX4A 5IOYA 3DCFA 3TP3A 5F08A 2G3BA 4MK6A 3VOXA 3Q0UA 3BR2A 5C4YA 3IH2A 2XGDA 5FKLA 2FX0A 4JYKA 4NELA 2UXPA 3VIBA 3EUPA 3BTJA 4I6ZA 3BJBA 3BRUA 3DEWA 2GUHA 3B81A 5K7ZA 1UI6A 2FBQA 3VP5A 4YZEA 2ID6A 3KNWA 5F1JA 3KKCA 3PASA 2VPRA 3IH4A 2YVHA 4GFLA 4XK4A 3LSPA 3CDLA 3RD3A 3NNRA 4AF5A 1BJZA 3ZQHA 5IP6A 1JUMA 3Q3SA 3KZ9A 4V2GA 4M3GA 2HXOA 2XGEA 3G1MA 4MXMA 1RPWA 5IOZA 2OI8A 5F0CA 2HYJA 2NS7A 2RAEA 1RKWA 2XPWA 1A6IA 3BR1A 3O8HA 2UXOA 1QVTA 2IAIA 2OPTA 5F27A 3FIWA 2ZOZA 3BQYA 1SGMA 2IBDA 3VW0A 3BCGA 3JSJA 4B1RA 2IEKA 5HSZA 2VKVA 2O7OA 3LOCA 3BTLA 2ZB9A 1U9OA 4M3EA 3BTCA 3C2BA 3RH2A 1VI0A 4ACIA 3PM1A 3BR6A 2WUIA 3Q0VA 3G56A 2IU5A 2OF7A 2WGBA 3VUQA 4M3DA 5J1RA 1ZKGA 3HTIA 2G7SA 2RASA 1RKTA 1U9NA 2GFNA 4CGRA 1QVUA 2G7GA 2Y30A 5EYRA 3BT9A 5FMPA 3QBMA 3HTHA 5F0HA 2O7TA 3O8GA 5K58A 3VVXA 3V78A 2NP5A 5F04A 1JT6A 2QTQA 3LSJA 2XPVA 3C07A 2VKEA 3VPRA 3BHQA 4M3BA 2F07A 1UI5A 5EZGA 3O60A 5HBUA 4AC6A 3SFIA 3HGGA 4X1EA 1Z77A 2JK3A 5EZHA 3HTJA 2FJ1A 2PZ9A 4HKUA 2XGCA 2UXHA 2Q24A 3CWRA 5DAJA 3QPSA 3S5RA 2Y2ZA 3ON4A 3QQAA 3VOKA 3FRQA 2GENA 3ZQLA 2TRTA 5H9TA 5FGLA 3IUVA 3AQTA 3E7QA 2TCTA 2ID3A 2G7LA 3LHQA 4DW6A 1T56A 2I10A 2QCOA 3WHBA 2JJ7A 3HIMA 3BQZA 5J3LA 3CJDA 3HTAA 1JUSA 3EGQA 3NPIA 5FHPA 3G1OA 3BR0A 3ANPA 4JKZA 5GPAA 1JTXA 3HE0A 5GPCA 3KKDA 2QOPA 4GFKA 3ANGA 4JNNA 3ZQFA 2NS8A 2OERA 2ZCXA 2XB5A 5CW8A 2UXUA 2ZOYA 3AQSA 3G7RA 1ORKA 3VW2A 3B6AA 5EFYA 1QPIA 2FD5A 2DG7A 3T6NA 2DTZA 1T33A 2ZCNA 4D5FA 4AUXA 4W1UA 3FK6A 2QKOA 2RHAA 1ZK8A 3VVZA 3BNIA 5GP9A 3QKXA 3DPJA 4AC0A 5IPAA 2REKA 3COLA 4UDSA 5K7HA 2Y31A 2EH3A 3IH3A 2ZCMA 5FKKA 2W53A 3WHCA 3G1LA 2X6OA 3NXCA 3GZIA
chains in the Genus database with same CATH superfamily
3CCYA 4ME9A 2DG8A 2FQ4A 2B3WA 3NRGA 5AQCA 3P9TA 2X9DA 4PXIA 5F0FA 4JL3A 5CXIA 2HQ5A 3HGYA 4ICHA 1JTYA 3BR5A 4ABZA 3ON2A 3GEUA 3Q0WA 3VVYA 4MO7A 3B6CA 4U9LA 2XPUA 3F0CA 2V57A 4KWAA 5J1YA 3LJLA 3FK7A 4GCLA 2FJI1 5D18A 2XDNA 3MNLA 2G0EA 5K7FA 3F1BA 4NN1A 2HXIA 2GBYA 4V2FA 2HYTA 3KYLA 4M3FA 4D5CA 1JUPA 2PBXA 5CXGA 5FKNA 2R7UA 4L62A 2WV1A 2YVEA 5FKOA 5D1RA 2R7SA 1Z0XA 3VW1A 4B3AA 5D19A 4D7NA 4GCTA 3ZQGA 3TP0A 2XRLA 3CRJA 4WIBA 3MVPA 2PFVA 5FKMA 4I76A 3ZQIA 1JT0A 5J1UA 3LWJA 3BR3A 2QWTA 3QPLA 2NP3A 3BTIA 4G12A 2UXIA 2D6YA 3SDGA 3PPBA 2HKUA 5HAWA 4W97A 2QIBA 4GCKA 3NI7A 3V6GA 4D7MA 3LSRA 3NS4A 2NX4A 5IOYA 3DCFA 3TP3A 5F08A 2G3BA 4MK6A 3VOXA 3Q0UA 3BR2A 5C4YA 3IH2A 2XGDA 5FKLA 2FX0A 4JYKA 4NELA 2UXPA 3VIBA 3EUPA 3BTJA 4I6ZA 3BJBA 3BRUA 3DEWA 2GUHA 3B81A 5K7ZA 1UI6A 2B1EA 2FBQA 3VP5A 4YZEA 2ID6A 3KNWA 5F1JA 3KKCA 3PASA 2VPRA 3IH4A 2YVHA 4GFLA 4XK4A 3LSPA 3CDLA 3RD3A 3NNRA 4AF5A 1BJZA 3ZQHA 5IP6A 1JUMA 3Q3SA 3KZ9A 4V2GA 4M3GA 2HXOA 2XGEA 3G1MA 4IRVA 4MXMA 2R7RA 1RPWA 5IOZA 2OI8A 5F0CA 2A2FX 2HYJA 2NS7A 2RAEA 1RKWA 2XPWA 1A6IA 3BR1A 3O8HA 2UXOA 1QVTA 2IAIA 2OPTA 4C2MA 5F27A 3FIWA 2ZOZA 3BQYA 1SGMA 2IBDA 3VW0A 3BCGA 3JSJA 4B1RA 2IEKA 5HSZA 2VKVA 2O7OA 3LOCA 3BTLA 2ZB9A 1U9OA 4M3EA 4OD4A 3BTCA 3C2BA 3RH2A 1VI0A 4ACIA 3PM1A 3BR6A 2WUIA 3Q0VA 3G56A 2IU5A 2OF7A 2WGBA 3VUQA 4M3DA 5J1RA 1ZKGA 3HTIA 2G7SA 5CQGA 2RASA 1RKTA 1U9NA 2GFNA 2R7QA 4CGRA 1QVUA 2G7GA 2Y30A 5EYRA 3BT9A 5FMPA 3QBMA 3HTHA 4U9NA 5F0HA 2O7TA 3O8GA 5K58A 3VVXA 3V78A 2NP5A 5F04A 1JT6A 2QTQA 3LSJA 2XPVA 3C07A 2VKEA 3VPRA 3BHQA 4M3BA 2F07A 1UI5A 2R7TA 5EZGA 3O60A 5HBUA 4AC6A 3SFIA 3HGGA 4X1EA 1Z77A 2JK3A 5EZHA 3HTJA 2FJ1A 2PZ9A 2R7WA 4DVYP 4HKUA 2XGCA 2UXHA 2Q24A 3CWRA 5DAJA 3QPSA 3S5RA 4OD5A 2YVXA 2R7VA 2Y2ZA 3ON4A 3QQAA 3VOKA 3FRQA 2GENA 3ZQLA 2TRTA 5H9TA 5FGLA 3IUVA 3AQTA 3E7QA 2TCTA 2ID3A 2G7LA 3LHQA 4DW6A 1T56A 2I10A 2QCOA 3WHBA 2JJ7A 3HIMA 3BQZA 5J3LA 2ZY9A 3CJDA 3HTAA 1JUSA 3EGQA 3NPIA 5FHPA 3G1OA 3K8PC 3BR0A 3ANPA 4JKZA 5GPAA 1JTXA 3HE0A 5GPCA 3SWHA 3KKDA 2QOPA 4GFKA 3ANGA 4JNNA 3ZQFA 2NS8A 2OERA 2ZCXA 2XB5A 5CW8A 2UXUA 2ZOYA 3AQSA 3G7RA 1ORKA 3VW2A 3B6AA 5EFYA 1QPIA 2FD5A 2DG7A 3T6NA 2DTZA 3DU6A 1T33A 2R7OA 2ZCNA 4D5FA 4AUXA 4W1UA 3FK6A 2QKOA 2RHAA 1ZK8A 2R7XA 3VVZA 3BNIA 5GP9A 3QKXA 3DPJA 4AC0A 5IPAA 3DU5A 2REKA 3VTIA 3COLA 4UDSA 3FHNA 5K7HA 2Y31A 2EH3A 3IH3A 2ZCMA 5FKKA 2W53A 3WHCA 3G1LA 2X6OA 3NXCA 3GZIA
chains in the Genus database with same CATH topology
3CCYA 4ME9A 2DG8A 2FQ4A 3NRGA 5AQCA 3P9TA 2X9DA 4PXIA 5F0FA 4JL3A 5CXIA 2HQ5A 3HGYA 4ICHA 1JTYA 3BR5A 4ABZA 3ON2A 3GEUA 3Q0WA 3VVYA 4MO7A 3B6CA 2XPUA 3F0CA 2V57A 4KWAA 5J1YA 3LJLA 3FK7A 4GCLA 5D18A 2XDNA 3MNLA 2G0EA 5K7FA 3F1BA 4NN1A 2HXIA 2GBYA 4V2FA 2HYTA 4M3FA 4D5CA 1JUPA 2PBXA 5CXGA 5FKNA 4L62A 2WV1A 2YVEA 5FKOA 5D1RA 1Z0XA 3VW1A 4B3AA 5D19A 4D7NA 4GCTA 3ZQGA 3TP0A 2XRLA 3CRJA 3MVPA 5FKMA 4I76A 3ZQIA 1JT0A 5J1UA 3LWJA 3BR3A 2QWTA 3QPLA 2NP3A 3BTIA 4G12A 2UXIA 2D6YA 3SDGA 3PPBA 2HKUA 5HAWA 4W97A 2QIBA 4GCKA 3NI7A 3V6GA 4D7MA 3LSRA 2NX4A 5IOYA 3DCFA 3TP3A 5F08A 2G3BA 4MK6A 3VOXA 3Q0UA 3BR2A 5C4YA 3IH2A 2XGDA 5FKLA 2FX0A 4JYKA 4NELA 2UXPA 3VIBA 3EUPA 3BTJA 4I6ZA 3BJBA 3BRUA 3DEWA 2GUHA 3B81A 5K7ZA 1UI6A 2FBQA 3VP5A 4YZEA 2ID6A 3KNWA 5F1JA 3KKCA 3PASA 2VPRA 3IH4A 2YVHA 4GFLA 4XK4A 3LSPA 3CDLA 3RD3A 3NNRA 4AF5A 1BJZA 3ZQHA 5IP6A 1JUMA 3Q3SA 3KZ9A 4V2GA 4M3GA 2HXOA 2XGEA 3G1MA 4MXMA 1RPWA 5IOZA 2OI8A 5F0CA 2HYJA 2NS7A 2RAEA 1RKWA 2XPWA 1A6IA 3BR1A 3O8HA 2UXOA 1QVTA 2IAIA 2OPTA 5F27A 3FIWA 2ZOZA 3BQYA 1SGMA 2IBDA 3VW0A 3BCGA 3JSJA 4B1RA 2IEKA 5HSZA 2VKVA 2O7OA 3LOCA 3BTLA 2ZB9A 1U9OA 4M3EA 3BTCA 3C2BA 3RH2A 1VI0A 4ACIA 3PM1A 3BR6A 2WUIA 3Q0VA 3G56A 2IU5A 2OF7A 2WGBA 3VUQA 4M3DA 5J1RA 1ZKGA 3HTIA 2G7SA 2RASA 1RKTA 1U9NA 2GFNA 4CGRA 1QVUA 2G7GA 2Y30A 5EYRA 3BT9A 5FMPA 3QBMA 3HTHA 5F0HA 2O7TA 3O8GA 5K58A 3VVXA 3V78A 2NP5A 5F04A 1JT6A 2QTQA 3LSJA 2XPVA 3C07A 2VKEA 3VPRA 3BHQA 4M3BA 2F07A 1UI5A 5EZGA 3O60A 5HBUA 4AC6A 3SFIA 3HGGA 4X1EA 1Z77A 2JK3A 5EZHA 3HTJA 2FJ1A 2PZ9A 4HKUA 2XGCA 2UXHA 2Q24A 3CWRA 5DAJA 3QPSA 3S5RA 2Y2ZA 3ON4A 3QQAA 3VOKA 3FRQA 2GENA 3ZQLA 2TRTA 5H9TA 5FGLA 3IUVA 3AQTA 3E7QA 2TCTA 2ID3A 2G7LA 3LHQA 4DW6A 1T56A 2I10A 2QCOA 3WHBA 2JJ7A 3HIMA 3BQZA 5J3LA 3CJDA 3HTAA 1JUSA 3EGQA 3NPIA 5FHPA 3G1OA 3BR0A 3ANPA 4JKZA 5GPAA 1JTXA 3HE0A 5GPCA 3KKDA 2QOPA 4GFKA 3ANGA 4JNNA 3ZQFA 2NS8A 2OERA 2ZCXA 2XB5A 5CW8A 2UXUA 2ZOYA 3AQSA 3G7RA 1ORKA 3VW2A 3B6AA 5EFYA 1QPIA 2FD5A 2DG7A 3T6NA 2DTZA 1T33A 2ZCNA 4D5FA 4AUXA 4W1UA 3FK6A 2QKOA 2RHAA 1ZK8A 3VVZA 3BNIA 5GP9A 3QKXA 3DPJA 4AC0A 5IPAA 2REKA 3COLA 4UDSA 5K7HA 2Y31A 2EH3A 3IH3A 2ZCMA 5FKKA 2W53A 3WHCA 3G1LA 2X6OA 3NXCA 3GZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCY A;  4ME9 A;  2DG8 A;  2FQ4 A;  3NRG A;  5AQC A;  3P9T A;  2X9D A;  4PXI A;  5F0F A;  4JL3 A;  5CXI A;  2HQ5 A;  3HGY A;  4ICH A;  1JTY A;  3BR5 A;  4ABZ A;  3ON2 A;  3GEU A;  3Q0W A;  3VVY A;  4MO7 A;  3B6C A;  2XPU A;  3F0C A;  2V57 A;  4KWA A;  5J1Y A;  3LJL A;  3FK7 A;  4GCL A;  5D18 A;  2XDN A;  3MNL A;  2G0E A;  5K7F A;  3F1B A;  4NN1 A;  2HXI A;  2GBY A;  4V2F A;  2HYT A;  4M3F A;  4D5C A;  1JUP A;  2PBX A;  5CXG A;  5FKN A;  4L62 A;  2WV1 A;  2YVE A;  5FKO A;  5D1R A;  1Z0X A;  3VW1 A;  4B3A A;  5D19 A;  4D7N A;  4GCT A;  3ZQG A;  3TP0 A;  2XRL A;  3CRJ A;  3MVP A;  5FKM A;  4I76 A;  3ZQI A;  1JT0 A;  5J1U A;  3LWJ A;  3BR3 A;  2QWT A;  3QPL A;  2NP3 A;  3BTI A;  4G12 A;  2UXI A;  2D6Y A;  3SDG A;  3PPB A;  2HKU A;  5HAW A;  4W97 A;  2QIB A;  4GCK A;  3NI7 A;  3V6G A;  4D7M A;  3LSR A;  2NX4 A;  5IOY A;  3DCF A;  3TP3 A;  5F08 A;  2G3B A;  4MK6 A;  3VOX A;  3Q0U A;  3BR2 A;  5C4Y A;  3IH2 A;  2XGD A;  5FKL A;  2FX0 A;  4JYK A;  4NEL A;  2UXP A;  3VIB A;  3EUP A;  3BTJ A;  4I6Z A;  3BJB A;  3BRU A;  3DEW A;  2GUH A;  3B81 A;  5K7Z A;  1UI6 A;  2FBQ A;  3VP5 A;  4YZE A;  2ID6 A;  3KNW A;  5F1J A;  3KKC A;  3PAS A;  2VPR A;  3IH4 A;  2YVH A;  4GFL A;  4XK4 A;  3LSP A;  3CDL A;  3RD3 A;  3NNR A;  4AF5 A;  1BJZ A;  3ZQH A;  5IP6 A;  1JUM A;  3Q3S A;  3KZ9 A;  4V2G A;  4M3G A;  2HXO A;  2XGE A;  3G1M A;  4MXM A;  1RPW A;  5IOZ A;  2OI8 A;  5F0C A;  2HYJ A;  2NS7 A;  2RAE A;  1RKW A;  2XPW A;  1A6I A;  3BR1 A;  3O8H A;  2UXO A;  1QVT A;  2IAI A;  2OPT A;  5F27 A;  3FIW A;  2ZOZ A;  3BQY A;  1SGM A;  2IBD A;  3VW0 A;  3BCG A;  3JSJ A;  4B1R A;  2IEK A;  5HSZ A;  2VKV A;  2O7O A;  3LOC A;  3BTL A;  2ZB9 A;  1U9O A;  4M3E A;  3BTC A;  3C2B A;  3RH2 A;  1VI0 A;  4ACI A;  3PM1 A;  3BR6 A;  2WUI A;  3Q0V A;  3G56 A;  2IU5 A;  2OF7 A;  2WGB A;  3VUQ A;  4M3D A;  5J1R A;  1ZKG A;  3HTI A;  2G7S A;  2RAS A;  1RKT A;  1U9N A;  2GFN A;  4CGR A;  1QVU A;  2G7G A;  2Y30 A;  5EYR A;  3BT9 A;  5FMP A;  3QBM A;  3HTH A;  5F0H A;  2O7T A;  3O8G A;  5K58 A;  3VVX A;  3V78 A;  2NP5 A;  5F04 A;  1JT6 A;  2QTQ A;  3LSJ A;  2XPV A;  3C07 A;  2VKE A;  3VPR A;  3BHQ A;  4M3B A;  2F07 A;  1UI5 A;  5EZG A;  3O60 A;  5HBU A;  4AC6 A;  3SFI A;  3HGG A;  4X1E A;  1Z77 A;  2JK3 A;  5EZH A;  3HTJ A;  2FJ1 A;  2PZ9 A;  4HKU A;  2XGC A;  2UXH A;  2Q24 A;  3CWR A;  5DAJ A;  3QPS A;  3S5R A;  2Y2Z A;  3ON4 A;  3QQA A;  3VOK A;  3FRQ A;  2GEN A;  3ZQL A;  2TRT A;  5H9T A;  5FGL A;  3IUV A;  3AQT A;  3E7Q A;  2TCT A;  2ID3 A;  2G7L A;  3LHQ A;  4DW6 A;  1T56 A;  2I10 A;  2QCO A;  3WHB A;  2JJ7 A;  3HIM A;  3BQZ A;  5J3L A;  3CJD A;  3HTA A;  1JUS A;  3EGQ A;  3NPI A;  5FHP A;  3G1O A;  3BR0 A;  3ANP A;  4JKZ A;  5GPA A;  1JTX A;  3HE0 A;  5GPC A;  3KKD A;  2QOP A;  4GFK A;  3ANG A;  4JNN A;  3ZQF A;  2NS8 A;  2OER A;  2ZCX A;  2XB5 A;  5CW8 A;  2UXU A;  2ZOY A;  3AQS A;  3G7R A;  1ORK A;  3VW2 A;  3B6A A;  5EFY A;  1QPI A;  2FD5 A;  2DG7 A;  3T6N A;  2DTZ A;  1T33 A;  2ZCN A;  4D5F A;  4AUX A;  4W1U A;  3FK6 A;  2QKO A;  2RHA A;  1ZK8 A;  3VVZ A;  3BNI A;  5GP9 A;  3QKX A;  3DPJ A;  4AC0 A;  5IPA A;  2REK A;  3COL A;  4UDS A;  5K7H A;  2Y31 A;  2EH3 A;  3IH3 A;  2ZCM A;  5FKK A;  2W53 A;  3WHC A;  3G1L A;  2X6O A;  3NXC A;  3GZI A; 
#chains in the Genus database with same CATH topology
 3CCY A;  4ME9 A;  2DG8 A;  2FQ4 A;  2B3W A;  3NRG A;  5AQC A;  3P9T A;  2X9D A;  4PXI A;  5F0F A;  4JL3 A;  5CXI A;  2HQ5 A;  3HGY A;  4ICH A;  1JTY A;  3BR5 A;  4ABZ A;  3ON2 A;  3GEU A;  3Q0W A;  3VVY A;  4MO7 A;  3B6C A;  4U9L A;  2XPU A;  3F0C A;  2V57 A;  4KWA A;  5J1Y A;  3LJL A;  3FK7 A;  4GCL A;  2FJI 1;  5D18 A;  2XDN A;  3MNL A;  2G0E A;  5K7F A;  3F1B A;  4NN1 A;  2HXI A;  2GBY A;  4V2F A;  2HYT A;  3KYL A;  4M3F A;  4D5C A;  1JUP A;  2PBX A;  5CXG A;  5FKN A;  2R7U A;  4L62 A;  2WV1 A;  2YVE A;  5FKO A;  5D1R A;  2R7S A;  1Z0X A;  3VW1 A;  4B3A A;  5D19 A;  4D7N A;  4GCT A;  3ZQG A;  3TP0 A;  2XRL A;  3CRJ A;  4WIB A;  3MVP A;  2PFV A;  5FKM A;  4I76 A;  3ZQI A;  1JT0 A;  5J1U A;  3LWJ A;  3BR3 A;  2QWT A;  3QPL A;  2NP3 A;  3BTI A;  4G12 A;  2UXI A;  2D6Y A;  3SDG A;  3PPB A;  2HKU A;  5HAW A;  4W97 A;  2QIB A;  4GCK A;  3NI7 A;  3V6G A;  4D7M A;  3LSR A;  3NS4 A;  2NX4 A;  5IOY A;  3DCF A;  3TP3 A;  5F08 A;  2G3B A;  4MK6 A;  3VOX A;  3Q0U A;  3BR2 A;  5C4Y A;  3IH2 A;  2XGD A;  5FKL A;  2FX0 A;  4JYK A;  4NEL A;  2UXP A;  3VIB A;  3EUP A;  3BTJ A;  4I6Z A;  3BJB A;  3BRU A;  3DEW A;  2GUH A;  3B81 A;  5K7Z A;  1UI6 A;  2B1E A;  2FBQ A;  3VP5 A;  4YZE A;  2ID6 A;  3KNW A;  5F1J A;  3KKC A;  3PAS A;  2VPR A;  3IH4 A;  2YVH A;  4GFL A;  4XK4 A;  3LSP A;  3CDL A;  3RD3 A;  3NNR A;  4AF5 A;  1BJZ A;  3ZQH A;  5IP6 A;  1JUM A;  3Q3S A;  3KZ9 A;  4V2G A;  4M3G A;  2HXO A;  2XGE A;  3G1M A;  4IRV A;  4MXM A;  2R7R A;  1RPW A;  5IOZ A;  2OI8 A;  5F0C A;  2A2F X;  2HYJ A;  2NS7 A;  2RAE A;  1RKW A;  2XPW A;  1A6I A;  3BR1 A;  3O8H A;  2UXO A;  1QVT A;  2IAI A;  2OPT A;  4C2M A;  5F27 A;  3FIW A;  2ZOZ A;  3BQY A;  1SGM A;  2IBD A;  3VW0 A;  3BCG A;  3JSJ A;  4B1R A;  2IEK A;  5HSZ A;  2VKV A;  2O7O A;  3LOC A;  3BTL A;  2ZB9 A;  1U9O A;  4M3E A;  4OD4 A;  3BTC A;  3C2B A;  3RH2 A;  1VI0 A;  4ACI A;  3PM1 A;  3BR6 A;  2WUI A;  3Q0V A;  3G56 A;  2IU5 A;  2OF7 A;  2WGB A;  3VUQ A;  4M3D A;  5J1R A;  1ZKG A;  3HTI A;  2G7S A;  5CQG A;  2RAS A;  1RKT A;  1U9N A;  2GFN A;  2R7Q A;  4CGR A;  1QVU A;  2G7G A;  2Y30 A;  5EYR A;  3BT9 A;  5FMP A;  3QBM A;  3HTH A;  4U9N A;  5F0H A;  2O7T A;  3O8G A;  5K58 A;  3VVX A;  3V78 A;  2NP5 A;  5F04 A;  1JT6 A;  2QTQ A;  3LSJ A;  2XPV A;  3C07 A;  2VKE A;  3VPR A;  3BHQ A;  4M3B A;  2F07 A;  1UI5 A;  2R7T A;  5EZG A;  3O60 A;  5HBU A;  4AC6 A;  3SFI A;  3HGG A;  4X1E A;  1Z77 A;  2JK3 A;  5EZH A;  3HTJ A;  2FJ1 A;  2PZ9 A;  2R7W A;  4DVY P;  4HKU A;  2XGC A;  2UXH A;  2Q24 A;  3CWR A;  5DAJ A;  3QPS A;  3S5R A;  4OD5 A;  2YVX A;  2R7V A;  2Y2Z A;  3ON4 A;  3QQA A;  3VOK A;  3FRQ A;  2GEN A;  3ZQL A;  2TRT A;  5H9T A;  5FGL A;  3IUV A;  3AQT A;  3E7Q A;  2TCT A;  2ID3 A;  2G7L A;  3LHQ A;  4DW6 A;  1T56 A;  2I10 A;  2QCO A;  3WHB A;  2JJ7 A;  3HIM A;  3BQZ A;  5J3L A;  2ZY9 A;  3CJD A;  3HTA A;  1JUS A;  3EGQ A;  3NPI A;  5FHP A;  3G1O A;  3K8P C;  3BR0 A;  3ANP A;  4JKZ A;  5GPA A;  1JTX A;  3HE0 A;  5GPC A;  3SWH A;  3KKD A;  2QOP A;  4GFK A;  3ANG A;  4JNN A;  3ZQF A;  2NS8 A;  2OER A;  2ZCX A;  2XB5 A;  5CW8 A;  2UXU A;  2ZOY A;  3AQS A;  3G7R A;  1ORK A;  3VW2 A;  3B6A A;  5EFY A;  1QPI A;  2FD5 A;  2DG7 A;  3T6N A;  2DTZ A;  3DU6 A;  1T33 A;  2R7O A;  2ZCN A;  4D5F A;  4AUX A;  4W1U A;  3FK6 A;  2QKO A;  2RHA A;  1ZK8 A;  2R7X A;  3VVZ A;  3BNI A;  5GP9 A;  3QKX A;  3DPJ A;  4AC0 A;  5IPA A;  3DU5 A;  2REK A;  3VTI A;  3COL A;  4UDS A;  3FHN A;  5K7H A;  2Y31 A;  2EH3 A;  3IH3 A;  2ZCM A;  5FKK A;  2W53 A;  3WHC A;  3G1L A;  2X6O A;  3NXC A;  3GZI A; 
#chains in the Genus database with same CATH homology
 3CCY A;  4ME9 A;  2DG8 A;  2FQ4 A;  3NRG A;  5AQC A;  3P9T A;  2X9D A;  4PXI A;  5F0F A;  4JL3 A;  5CXI A;  2HQ5 A;  3HGY A;  4ICH A;  1JTY A;  3BR5 A;  4ABZ A;  3ON2 A;  3GEU A;  3Q0W A;  3VVY A;  4MO7 A;  3B6C A;  2XPU A;  3F0C A;  2V57 A;  4KWA A;  5J1Y A;  3LJL A;  3FK7 A;  4GCL A;  5D18 A;  2XDN A;  3MNL A;  2G0E A;  5K7F A;  3F1B A;  4NN1 A;  2HXI A;  2GBY A;  4V2F A;  2HYT A;  4M3F A;  4D5C A;  1JUP A;  2PBX A;  5CXG A;  5FKN A;  4L62 A;  2WV1 A;  2YVE A;  5FKO A;  5D1R A;  1Z0X A;  3VW1 A;  4B3A A;  5D19 A;  4D7N A;  4GCT A;  3ZQG A;  3TP0 A;  2XRL A;  3CRJ A;  3MVP A;  5FKM A;  4I76 A;  3ZQI A;  1JT0 A;  5J1U A;  3LWJ A;  3BR3 A;  2QWT A;  3QPL A;  2NP3 A;  3BTI A;  4G12 A;  2UXI A;  2D6Y A;  3SDG A;  3PPB A;  2HKU A;  5HAW A;  4W97 A;  2QIB A;  4GCK A;  3NI7 A;  3V6G A;  4D7M A;  3LSR A;  2NX4 A;  5IOY A;  3DCF A;  3TP3 A;  5F08 A;  2G3B A;  4MK6 A;  3VOX A;  3Q0U A;  3BR2 A;  5C4Y A;  3IH2 A;  2XGD A;  5FKL A;  2FX0 A;  4JYK A;  4NEL A;  2UXP A;  3VIB A;  3EUP A;  3BTJ A;  4I6Z A;  3BJB A;  3BRU A;  3DEW A;  2GUH A;  3B81 A;  5K7Z A;  1UI6 A;  2FBQ A;  3VP5 A;  4YZE A;  2ID6 A;  3KNW A;  5F1J A;  3KKC A;  3PAS A;  2VPR A;  3IH4 A;  2YVH A;  4GFL A;  4XK4 A;  3LSP A;  3CDL A;  3RD3 A;  3NNR A;  4AF5 A;  1BJZ A;  3ZQH A;  5IP6 A;  1JUM A;  3Q3S A;  3KZ9 A;  4V2G A;  4M3G A;  2HXO A;  2XGE A;  3G1M A;  4MXM A;  1RPW A;  5IOZ A;  2OI8 A;  5F0C A;  2HYJ A;  2NS7 A;  2RAE A;  1RKW A;  2XPW A;  1A6I A;  3BR1 A;  3O8H A;  2UXO A;  1QVT A;  2IAI A;  2OPT A;  5F27 A;  3FIW A;  2ZOZ A;  3BQY A;  1SGM A;  2IBD A;  3VW0 A;  3BCG A;  3JSJ A;  4B1R A;  2IEK A;  5HSZ A;  2VKV A;  2O7O A;  3LOC A;  3BTL A;  2ZB9 A;  1U9O A;  4M3E A;  3BTC A;  3C2B A;  3RH2 A;  1VI0 A;  4ACI A;  3PM1 A;  3BR6 A;  2WUI A;  3Q0V A;  3G56 A;  2IU5 A;  2OF7 A;  2WGB A;  3VUQ A;  4M3D A;  5J1R A;  1ZKG A;  3HTI A;  2G7S A;  2RAS A;  1RKT A;  1U9N A;  2GFN A;  4CGR A;  1QVU A;  2G7G A;  2Y30 A;  5EYR A;  3BT9 A;  5FMP A;  3QBM A;  3HTH A;  5F0H A;  2O7T A;  3O8G A;  5K58 A;  3VVX A;  3V78 A;  2NP5 A;  5F04 A;  1JT6 A;  2QTQ A;  3LSJ A;  2XPV A;  3C07 A;  2VKE A;  3VPR A;  3BHQ A;  4M3B A;  2F07 A;  1UI5 A;  5EZG A;  3O60 A;  5HBU A;  4AC6 A;  3SFI A;  3HGG A;  4X1E A;  1Z77 A;  2JK3 A;  5EZH A;  3HTJ A;  2FJ1 A;  2PZ9 A;  4HKU A;  2XGC A;  2UXH A;  2Q24 A;  3CWR A;  5DAJ A;  3QPS A;  3S5R A;  2Y2Z A;  3ON4 A;  3QQA A;  3VOK A;  3FRQ A;  2GEN A;  3ZQL A;  2TRT A;  5H9T A;  5FGL A;  3IUV A;  3AQT A;  3E7Q A;  2TCT A;  2ID3 A;  2G7L A;  3LHQ A;  4DW6 A;  1T56 A;  2I10 A;  2QCO A;  3WHB A;  2JJ7 A;  3HIM A;  3BQZ A;  5J3L A;  3CJD A;  3HTA A;  1JUS A;  3EGQ A;  3NPI A;  5FHP A;  3G1O A;  3BR0 A;  3ANP A;  4JKZ A;  5GPA A;  1JTX A;  3HE0 A;  5GPC A;  3KKD A;  2QOP A;  4GFK A;  3ANG A;  4JNN A;  3ZQF A;  2NS8 A;  2OER A;  2ZCX A;  2XB5 A;  5CW8 A;  2UXU A;  2ZOY A;  3AQS A;  3G7R A;  1ORK A;  3VW2 A;  3B6A A;  5EFY A;  1QPI A;  2FD5 A;  2DG7 A;  3T6N A;  2DTZ A;  1T33 A;  2ZCN A;  4D5F A;  4AUX A;  4W1U A;  3FK6 A;  2QKO A;  2RHA A;  1ZK8 A;  3VVZ A;  3BNI A;  5GP9 A;  3QKX A;  3DPJ A;  4AC0 A;  5IPA A;  2REK A;  3COL A;  4UDS A;  5K7H A;  2Y31 A;  2EH3 A;  3IH3 A;  2ZCM A;  5FKK A;  2W53 A;  3WHC A;  3G1L A;  2X6O A;  3NXC A;  3GZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...