2V57A

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
171
Chain Sequence
ERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 66
structure length 171
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2v57A00
3WHCA 5EZGA 3VIBA 5J1RA 2ZCNA 3ON2A 3FRQA 3BT9A 2IAIA 3ZQGA 5IOYA 3IH2A 5CXIA 3O8HA 3LSJA 3ZQHA 2YVEA 4PXIA 3HGYA 5FHPA 3BTCA 2G3BA 3BR2A 3BNIA 2QOPA 4I76A 3P9TA 3NRGA 3GZIA 2HQ5A 4MK6A 2FBQA 2QCOA 5HSZA 4M3FA 2EH3A 2FQ4A 3QKXA 5K7HA 4JYKA 5H9TA 1U9NA 2X6OA 5FKKA 4D5FA 4DW6A 5K58A 2X9DA 5HBUA 5J1YA 2DTZA 2RASA 1ZKGA 4GCTA 5J1UA 1JUPA 3G1LA 2RHAA 3TP3A 3CRJA 3COLA 2XGDA 3IH3A 1JT0A 3VVZA 2UXOA 2FX0A 1JUMA 4JNNA 3V78A 2XDNA 5IP6A 3PASA 2XB5A 5FKNA 1BJZA 4NELA 2D6YA 5DAJA 2PZ9A 3B6CA 2YVHA 4B1RA 2ZCXA 3IUVA 4GCKA 4MXMA 1ZK8A 3S5RA 3RD3A 3HTAA 1RPWA 4M3BA 2TCTA 2VKEA 4KWAA 1UI6A 4V2GA 4D7NA 3V6GA 5FKLA 5CW8A 2ZCMA 3VW1A 2O7OA 3EGQA 3Q3SA 2G7SA 2ZB9A 4M3EA 2REKA 5FGLA 3GEUA 2ZOYA 1UI5A 2JK3A 3VVYA 3NI7A 4W1UA 3QPSA 2VKVA 3Q0WA 2W53A 2IBDA 3Q0UA 2OF7A 3RH2A 5D19A 2NS7A 2O7TA 3LSRA 2HYTA 3SDGA 5D18A 2RAEA 4GFKA 3NNRA 4GFLA 3VVXA 2DG7A 3DEWA 4ABZA 3HTIA 4JL3A 4NN1A 3O8GA 3G56A 3CCYA 1RKWA 3PM1A 1A6IA 2I10A 2G7GA 5F08A 1Z77A 3BR0A 4I6ZA 1QVUA 3KKCA 4MO7A 2OI8A 3AQSA 2UXHA 3G7RA 5GP9A 5F0FA 5EYRA 2XGCA 3HTJA 5IPAA 3CDLA 2DG8A 2OERA 2XPVA 2UXUA 3BHQA 3F1BA 3ANGA 3NXCA 4XK4A 3VW0A 4D7MA 2NX4A 3DPJA 4L62A 1QVTA 4UDSA 3HE0A 3BTLA 3VP5A 5F0CA 2HKUA 4ICHA 3AQTA 3FIWA 2IU5A 3ZQFA 4G12A 2QTQA 1T56A 5F27A 1SGMA 2F07A 3QBMA 4W97A 2QKOA 2UXIA 3F0CA 2VPRA 5GPCA 2TRTA 3BRUA 3G1OA 3BR1A 5F04A 5K7ZA 3VOXA 2WUIA 5HAWA 2G7LA 5F1JA 4V2FA 2Y2ZA 1T33A 2HXIA 3BJBA 3VW2A 5EFYA 2GBYA 3FK7A 1Z0XA 2HYJA 2QIBA 2GUHA 3TP0A 5FMPA 2GFNA 3O60A 3CWRA 3ANPA 2JJ7A 2XPUA 3JSJA 4ACIA 2IEKA 2HXOA 2ID3A 5CXGA 2NP3A 3BR3A 3LJLA 1JTXA 3LOCA 3MVPA 3ZQLA 1JTYA 5D1RA 3B6AA 4JKZA 4B3AA 2Q24A 4CGRA 4ME9A 3ON4A 3FK6A 3VOKA 3KNWA 3Q0VA 5IOZA 2Y31A 3C2BA 2XGEA 3G1MA 2WV1A 3EUPA 3VUQA 4AC0A 5FKOA 2ID6A 4AF5A 2WGBA 3BCGA 3LWJA 3C07A 2XPWA 3WHBA 2Y30A 3LSPA 3BQYA 2NS8A 3BTJA 2OPTA 5GPAA 2V57A 2ZOZA 4HKUA 3QPLA 2FJ1A 3HTHA 3VPRA 3ZQIA 3T6NA 1U9OA 3BTIA 1QPIA 4D5CA 3SFIA 1RKTA 5FKMA 5AQCA 1VI0A 5J3LA 5F0HA 4AUXA 5C4YA 4M3DA 4GCLA 2XRLA 3DCFA 2NP5A 4YZEA 3B81A 3BR5A 1JT6A 3QQAA 2G0EA 2QWTA 3LHQA 3E7QA 4AC6A 5K7FA 2PBXA 3CJDA 3HGGA 1ORKA 5EZHA 1JUSA 3KKDA 2FD5A 3HIMA 3NPIA 2GENA 3BQZA 3MNLA 4M3GA 3BR6A 3IH4A 2UXPA 3KZ9A 4X1EA 3PPBA
chains in the Genus database with same CATH superfamily
3WHCA 5EZGA 3VIBA 5J1RA 2ZCNA 3ON2A 3FRQA 3BT9A 2IAIA 3ZQGA 5IOYA 3IH2A 4OD4A 5CXIA 3O8HA 3LSJA 3ZQHA 2YVEA 4PXIA 3HGYA 5FHPA 3BTCA 2G3BA 3BR2A 3BNIA 2QOPA 4I76A 3P9TA 3NRGA 3GZIA 2HQ5A 2R7VA 4MK6A 2FBQA 3DU6A 2QCOA 5HSZA 4M3FA 2EH3A 2FQ4A 3QKXA 5K7HA 4JYKA 5H9TA 1U9NA 2X6OA 5FKKA 4D5FA 4DW6A 2R7WA 5K58A 2X9DA 5HBUA 5J1YA 2DTZA 2RASA 1ZKGA 4GCTA 5J1UA 1JUPA 3G1LA 2RHAA 3TP3A 3CRJA 3COLA 2XGDA 2A2FX 3IH3A 1JT0A 3VVZA 2UXOA 2FX0A 1JUMA 4JNNA 3V78A 3K8PC 2XDNA 5IP6A 3PASA 2XB5A 5FKNA 1BJZA 4NELA 2D6YA 5DAJA 2PZ9A 3B6CA 2YVHA 4B1RA 2ZCXA 3IUVA 4GCKA 4MXMA 1ZK8A 3S5RA 3RD3A 3HTAA 1RPWA 4M3BA 3VTIA 2TCTA 2VKEA 4KWAA 1UI6A 4V2GA 4D7NA 3V6GA 5FKLA 2YVXA 5CW8A 2ZCMA 3VW1A 2O7OA 3EGQA 3Q3SA 2G7SA 2ZB9A 4M3EA 2REKA 5FGLA 3GEUA 2ZOYA 1UI5A 2JK3A 3VVYA 3NI7A 4W1UA 3QPSA 2VKVA 3Q0WA 2W53A 2IBDA 3Q0UA 2OF7A 3RH2A 5D19A 2NS7A 2O7TA 3LSRA 2HYTA 3SDGA 5D18A 2RAEA 4GFKA 3NNRA 4GFLA 3VVXA 2DG7A 3DEWA 2R7SA 4ABZA 3HTIA 4JL3A 4NN1A 3O8GA 2R7OA 3G56A 3CCYA 1RKWA 3PM1A 1A6IA 2I10A 4U9NA 2G7GA 5F08A 2FJI1 1Z77A 3BR0A 4I6ZA 1QVUA 3KKCA 4IRVA 4MO7A 2OI8A 3AQSA 2UXHA 3G7RA 5GP9A 5F0FA 4WIBA 5EYRA 2XGCA 3HTJA 5IPAA 3CDLA 2DG8A 2OERA 2XPVA 2UXUA 3BHQA 3F1BA 3ANGA 3NXCA 4XK4A 3VW0A 4D7MA 2NX4A 3DPJA 4L62A 1QVTA 4UDSA 3HE0A 3BTLA 3VP5A 5F0CA 2HKUA 4ICHA 3AQTA 3FIWA 2IU5A 5CQGA 3ZQFA 2R7UA 4G12A 2QTQA 1T56A 5F27A 1SGMA 2F07A 3QBMA 4W97A 2QKOA 2UXIA 3F0CA 2VPRA 5GPCA 2TRTA 3BRUA 3G1OA 3BR1A 5F04A 5K7ZA 3VOXA 2WUIA 5HAWA 2G7LA 3NS4A 2PFVA 5F1JA 4V2FA 3KYLA 2Y2ZA 1T33A 2HXIA 3BJBA 3VW2A 5EFYA 2GBYA 3FK7A 1Z0XA 2HYJA 2QIBA 2ZY9A 2GUHA 3TP0A 5FMPA 2GFNA 3O60A 3CWRA 3ANPA 2JJ7A 2XPUA 3JSJA 4ACIA 4DVYP 2IEKA 2HXOA 2ID3A 5CXGA 2NP3A 3BR3A 3LJLA 1JTXA 4OD5A 3LOCA 3MVPA 3ZQLA 1JTYA 5D1RA 3SWHA 3B6AA 4JKZA 4B3AA 2Q24A 4CGRA 4ME9A 3ON4A 3FK6A 3VOKA 3KNWA 3Q0VA 5IOZA 2Y31A 3C2BA 2XGEA 3G1MA 2R7QA 2WV1A 3EUPA 3VUQA 4AC0A 5FKOA 2ID6A 4AF5A 2WGBA 3BCGA 3LWJA 3C07A 2XPWA 3WHBA 2Y30A 3LSPA 3BQYA 2NS8A 3BTJA 4C2MA 2OPTA 5GPAA 2V57A 2ZOZA 4HKUA 3QPLA 2FJ1A 3HTHA 3VPRA 3ZQIA 3T6NA 1U9OA 2R7RA 3BTIA 1QPIA 2B1EA 4D5CA 3SFIA 1RKTA 5FKMA 5AQCA 1VI0A 5J3LA 5F0HA 4AUXA 5C4YA 4M3DA 4GCLA 2XRLA 3DCFA 2NP5A 4YZEA 3B81A 3BR5A 1JT6A 3QQAA 2G0EA 2QWTA 3DU5A 3LHQA 3E7QA 4AC6A 5K7FA 2PBXA 3CJDA 2B3WA 3HGGA 1ORKA 5EZHA 4U9LA 1JUSA 3KKDA 2FD5A 3HIMA 3FHNA 3NPIA 2GENA 3BQZA 2R7XA 3MNLA 4M3GA 2R7TA 3BR6A 3IH4A 2UXPA 3KZ9A 4X1EA 3PPBA
chains in the Genus database with same CATH topology
3WHCA 5EZGA 3VIBA 5J1RA 2ZCNA 3ON2A 3FRQA 3BT9A 2IAIA 3ZQGA 5IOYA 3IH2A 5CXIA 3O8HA 3LSJA 3ZQHA 2YVEA 4PXIA 3HGYA 5FHPA 3BTCA 2G3BA 3BR2A 3BNIA 2QOPA 4I76A 3P9TA 3NRGA 3GZIA 2HQ5A 4MK6A 2FBQA 2QCOA 5HSZA 4M3FA 2EH3A 2FQ4A 3QKXA 5K7HA 4JYKA 5H9TA 1U9NA 2X6OA 5FKKA 4D5FA 4DW6A 5K58A 2X9DA 5HBUA 5J1YA 2DTZA 2RASA 1ZKGA 4GCTA 5J1UA 1JUPA 3G1LA 2RHAA 3TP3A 3CRJA 3COLA 2XGDA 3IH3A 1JT0A 3VVZA 2UXOA 2FX0A 1JUMA 4JNNA 3V78A 2XDNA 5IP6A 3PASA 2XB5A 5FKNA 1BJZA 4NELA 2D6YA 5DAJA 2PZ9A 3B6CA 2YVHA 4B1RA 2ZCXA 3IUVA 4GCKA 4MXMA 1ZK8A 3S5RA 3RD3A 3HTAA 1RPWA 4M3BA 2TCTA 2VKEA 4KWAA 1UI6A 4V2GA 4D7NA 3V6GA 5FKLA 5CW8A 2ZCMA 3VW1A 2O7OA 3EGQA 3Q3SA 2G7SA 2ZB9A 4M3EA 2REKA 5FGLA 3GEUA 2ZOYA 1UI5A 2JK3A 3VVYA 3NI7A 4W1UA 3QPSA 2VKVA 3Q0WA 2W53A 2IBDA 3Q0UA 2OF7A 3RH2A 5D19A 2NS7A 2O7TA 3LSRA 2HYTA 3SDGA 5D18A 2RAEA 4GFKA 3NNRA 4GFLA 3VVXA 2DG7A 3DEWA 4ABZA 3HTIA 4JL3A 4NN1A 3O8GA 3G56A 3CCYA 1RKWA 3PM1A 1A6IA 2I10A 2G7GA 5F08A 1Z77A 3BR0A 4I6ZA 1QVUA 3KKCA 4MO7A 2OI8A 3AQSA 2UXHA 3G7RA 5GP9A 5F0FA 5EYRA 2XGCA 3HTJA 5IPAA 3CDLA 2DG8A 2OERA 2XPVA 2UXUA 3BHQA 3F1BA 3ANGA 3NXCA 4XK4A 3VW0A 4D7MA 2NX4A 3DPJA 4L62A 1QVTA 4UDSA 3HE0A 3BTLA 3VP5A 5F0CA 2HKUA 4ICHA 3AQTA 3FIWA 2IU5A 3ZQFA 4G12A 2QTQA 1T56A 5F27A 1SGMA 2F07A 3QBMA 4W97A 2QKOA 2UXIA 3F0CA 2VPRA 5GPCA 2TRTA 3BRUA 3G1OA 3BR1A 5F04A 5K7ZA 3VOXA 2WUIA 5HAWA 2G7LA 5F1JA 4V2FA 2Y2ZA 1T33A 2HXIA 3BJBA 3VW2A 5EFYA 2GBYA 3FK7A 1Z0XA 2HYJA 2QIBA 2GUHA 3TP0A 5FMPA 2GFNA 3O60A 3CWRA 3ANPA 2JJ7A 2XPUA 3JSJA 4ACIA 2IEKA 2HXOA 2ID3A 5CXGA 2NP3A 3BR3A 3LJLA 1JTXA 3LOCA 3MVPA 3ZQLA 1JTYA 5D1RA 3B6AA 4JKZA 4B3AA 2Q24A 4CGRA 4ME9A 3ON4A 3FK6A 3VOKA 3KNWA 3Q0VA 5IOZA 2Y31A 3C2BA 2XGEA 3G1MA 2WV1A 3EUPA 3VUQA 4AC0A 5FKOA 2ID6A 4AF5A 2WGBA 3BCGA 3LWJA 3C07A 2XPWA 3WHBA 2Y30A 3LSPA 3BQYA 2NS8A 3BTJA 2OPTA 5GPAA 2V57A 2ZOZA 4HKUA 3QPLA 2FJ1A 3HTHA 3VPRA 3ZQIA 3T6NA 1U9OA 3BTIA 1QPIA 4D5CA 3SFIA 1RKTA 5FKMA 5AQCA 1VI0A 5J3LA 5F0HA 4AUXA 5C4YA 4M3DA 4GCLA 2XRLA 3DCFA 2NP5A 4YZEA 3B81A 3BR5A 1JT6A 3QQAA 2G0EA 2QWTA 3LHQA 3E7QA 4AC6A 5K7FA 2PBXA 3CJDA 3HGGA 1ORKA 5EZHA 1JUSA 3KKDA 2FD5A 3HIMA 3NPIA 2GENA 3BQZA 3MNLA 4M3GA 3BR6A 3IH4A 2UXPA 3KZ9A 4X1EA 3PPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WHC A;  5EZG A;  3VIB A;  5J1R A;  2ZCN A;  3ON2 A;  3FRQ A;  3BT9 A;  2IAI A;  3ZQG A;  5IOY A;  3IH2 A;  5CXI A;  3O8H A;  3LSJ A;  3ZQH A;  2YVE A;  4PXI A;  3HGY A;  5FHP A;  3BTC A;  2G3B A;  3BR2 A;  3BNI A;  2QOP A;  4I76 A;  3P9T A;  3NRG A;  3GZI A;  2HQ5 A;  4MK6 A;  2FBQ A;  2QCO A;  5HSZ A;  4M3F A;  2EH3 A;  2FQ4 A;  3QKX A;  5K7H A;  4JYK A;  5H9T A;  1U9N A;  2X6O A;  5FKK A;  4D5F A;  4DW6 A;  5K58 A;  2X9D A;  5HBU A;  5J1Y A;  2DTZ A;  2RAS A;  1ZKG A;  4GCT A;  5J1U A;  1JUP A;  3G1L A;  2RHA A;  3TP3 A;  3CRJ A;  3COL A;  2XGD A;  3IH3 A;  1JT0 A;  3VVZ A;  2UXO A;  2FX0 A;  1JUM A;  4JNN A;  3V78 A;  2XDN A;  5IP6 A;  3PAS A;  2XB5 A;  5FKN A;  1BJZ A;  4NEL A;  2D6Y A;  5DAJ A;  2PZ9 A;  3B6C A;  2YVH A;  4B1R A;  2ZCX A;  3IUV A;  4GCK A;  4MXM A;  1ZK8 A;  3S5R A;  3RD3 A;  3HTA A;  1RPW A;  4M3B A;  2TCT A;  2VKE A;  4KWA A;  1UI6 A;  4V2G A;  4D7N A;  3V6G A;  5FKL A;  5CW8 A;  2ZCM A;  3VW1 A;  2O7O A;  3EGQ A;  3Q3S A;  2G7S A;  2ZB9 A;  4M3E A;  2REK A;  5FGL A;  3GEU A;  2ZOY A;  1UI5 A;  2JK3 A;  3VVY A;  3NI7 A;  4W1U A;  3QPS A;  2VKV A;  3Q0W A;  2W53 A;  2IBD A;  3Q0U A;  2OF7 A;  3RH2 A;  5D19 A;  2NS7 A;  2O7T A;  3LSR A;  2HYT A;  3SDG A;  5D18 A;  2RAE A;  4GFK A;  3NNR A;  4GFL A;  3VVX A;  2DG7 A;  3DEW A;  4ABZ A;  3HTI A;  4JL3 A;  4NN1 A;  3O8G A;  3G56 A;  3CCY A;  1RKW A;  3PM1 A;  1A6I A;  2I10 A;  2G7G A;  5F08 A;  1Z77 A;  3BR0 A;  4I6Z A;  1QVU A;  3KKC A;  4MO7 A;  2OI8 A;  3AQS A;  2UXH A;  3G7R A;  5GP9 A;  5F0F A;  5EYR A;  2XGC A;  3HTJ A;  5IPA A;  3CDL A;  2DG8 A;  2OER A;  2XPV A;  2UXU A;  3BHQ A;  3F1B A;  3ANG A;  3NXC A;  4XK4 A;  3VW0 A;  4D7M A;  2NX4 A;  3DPJ A;  4L62 A;  1QVT A;  4UDS A;  3HE0 A;  3BTL A;  3VP5 A;  5F0C A;  2HKU A;  4ICH A;  3AQT A;  3FIW A;  2IU5 A;  3ZQF A;  4G12 A;  2QTQ A;  1T56 A;  5F27 A;  1SGM A;  2F07 A;  3QBM A;  4W97 A;  2QKO A;  2UXI A;  3F0C A;  2VPR A;  5GPC A;  2TRT A;  3BRU A;  3G1O A;  3BR1 A;  5F04 A;  5K7Z A;  3VOX A;  2WUI A;  5HAW A;  2G7L A;  5F1J A;  4V2F A;  2Y2Z A;  1T33 A;  2HXI A;  3BJB A;  3VW2 A;  5EFY A;  2GBY A;  3FK7 A;  1Z0X A;  2HYJ A;  2QIB A;  2GUH A;  3TP0 A;  5FMP A;  2GFN A;  3O60 A;  3CWR A;  3ANP A;  2JJ7 A;  2XPU A;  3JSJ A;  4ACI A;  2IEK A;  2HXO A;  2ID3 A;  5CXG A;  2NP3 A;  3BR3 A;  3LJL A;  1JTX A;  3LOC A;  3MVP A;  3ZQL A;  1JTY A;  5D1R A;  3B6A A;  4JKZ A;  4B3A A;  2Q24 A;  4CGR A;  4ME9 A;  3ON4 A;  3FK6 A;  3VOK A;  3KNW A;  3Q0V A;  5IOZ A;  2Y31 A;  3C2B A;  2XGE A;  3G1M A;  2WV1 A;  3EUP A;  3VUQ A;  4AC0 A;  5FKO A;  2ID6 A;  4AF5 A;  2WGB A;  3BCG A;  3LWJ A;  3C07 A;  2XPW A;  3WHB A;  2Y30 A;  3LSP A;  3BQY A;  2NS8 A;  3BTJ A;  2OPT A;  5GPA A;  2V57 A;  2ZOZ A;  4HKU A;  3QPL A;  2FJ1 A;  3HTH A;  3VPR A;  3ZQI A;  3T6N A;  1U9O A;  3BTI A;  1QPI A;  4D5C A;  3SFI A;  1RKT A;  5FKM A;  5AQC A;  1VI0 A;  5J3L A;  5F0H A;  4AUX A;  5C4Y A;  4M3D A;  4GCL A;  2XRL A;  3DCF A;  2NP5 A;  4YZE A;  3B81 A;  3BR5 A;  1JT6 A;  3QQA A;  2G0E A;  2QWT A;  3LHQ A;  3E7Q A;  4AC6 A;  5K7F A;  2PBX A;  3CJD A;  3HGG A;  1ORK A;  5EZH A;  1JUS A;  3KKD A;  2FD5 A;  3HIM A;  3NPI A;  2GEN A;  3BQZ A;  3MNL A;  4M3G A;  3BR6 A;  3IH4 A;  2UXP A;  3KZ9 A;  4X1E A;  3PPB A; 
#chains in the Genus database with same CATH topology
 3WHC A;  5EZG A;  3VIB A;  5J1R A;  2ZCN A;  3ON2 A;  3FRQ A;  3BT9 A;  2IAI A;  3ZQG A;  5IOY A;  3IH2 A;  4OD4 A;  5CXI A;  3O8H A;  3LSJ A;  3ZQH A;  2YVE A;  4PXI A;  3HGY A;  5FHP A;  3BTC A;  2G3B A;  3BR2 A;  3BNI A;  2QOP A;  4I76 A;  3P9T A;  3NRG A;  3GZI A;  2HQ5 A;  2R7V A;  4MK6 A;  2FBQ A;  3DU6 A;  2QCO A;  5HSZ A;  4M3F A;  2EH3 A;  2FQ4 A;  3QKX A;  5K7H A;  4JYK A;  5H9T A;  1U9N A;  2X6O A;  5FKK A;  4D5F A;  4DW6 A;  2R7W A;  5K58 A;  2X9D A;  5HBU A;  5J1Y A;  2DTZ A;  2RAS A;  1ZKG A;  4GCT A;  5J1U A;  1JUP A;  3G1L A;  2RHA A;  3TP3 A;  3CRJ A;  3COL A;  2XGD A;  2A2F X;  3IH3 A;  1JT0 A;  3VVZ A;  2UXO A;  2FX0 A;  1JUM A;  4JNN A;  3V78 A;  3K8P C;  2XDN A;  5IP6 A;  3PAS A;  2XB5 A;  5FKN A;  1BJZ A;  4NEL A;  2D6Y A;  5DAJ A;  2PZ9 A;  3B6C A;  2YVH A;  4B1R A;  2ZCX A;  3IUV A;  4GCK A;  4MXM A;  1ZK8 A;  3S5R A;  3RD3 A;  3HTA A;  1RPW A;  4M3B A;  3VTI A;  2TCT A;  2VKE A;  4KWA A;  1UI6 A;  4V2G A;  4D7N A;  3V6G A;  5FKL A;  2YVX A;  5CW8 A;  2ZCM A;  3VW1 A;  2O7O A;  3EGQ A;  3Q3S A;  2G7S A;  2ZB9 A;  4M3E A;  2REK A;  5FGL A;  3GEU A;  2ZOY A;  1UI5 A;  2JK3 A;  3VVY A;  3NI7 A;  4W1U A;  3QPS A;  2VKV A;  3Q0W A;  2W53 A;  2IBD A;  3Q0U A;  2OF7 A;  3RH2 A;  5D19 A;  2NS7 A;  2O7T A;  3LSR A;  2HYT A;  3SDG A;  5D18 A;  2RAE A;  4GFK A;  3NNR A;  4GFL A;  3VVX A;  2DG7 A;  3DEW A;  2R7S A;  4ABZ A;  3HTI A;  4JL3 A;  4NN1 A;  3O8G A;  2R7O A;  3G56 A;  3CCY A;  1RKW A;  3PM1 A;  1A6I A;  2I10 A;  4U9N A;  2G7G A;  5F08 A;  2FJI 1;  1Z77 A;  3BR0 A;  4I6Z A;  1QVU A;  3KKC A;  4IRV A;  4MO7 A;  2OI8 A;  3AQS A;  2UXH A;  3G7R A;  5GP9 A;  5F0F A;  4WIB A;  5EYR A;  2XGC A;  3HTJ A;  5IPA A;  3CDL A;  2DG8 A;  2OER A;  2XPV A;  2UXU A;  3BHQ A;  3F1B A;  3ANG A;  3NXC A;  4XK4 A;  3VW0 A;  4D7M A;  2NX4 A;  3DPJ A;  4L62 A;  1QVT A;  4UDS A;  3HE0 A;  3BTL A;  3VP5 A;  5F0C A;  2HKU A;  4ICH A;  3AQT A;  3FIW A;  2IU5 A;  5CQG A;  3ZQF A;  2R7U A;  4G12 A;  2QTQ A;  1T56 A;  5F27 A;  1SGM A;  2F07 A;  3QBM A;  4W97 A;  2QKO A;  2UXI A;  3F0C A;  2VPR A;  5GPC A;  2TRT A;  3BRU A;  3G1O A;  3BR1 A;  5F04 A;  5K7Z A;  3VOX A;  2WUI A;  5HAW A;  2G7L A;  3NS4 A;  2PFV A;  5F1J A;  4V2F A;  3KYL A;  2Y2Z A;  1T33 A;  2HXI A;  3BJB A;  3VW2 A;  5EFY A;  2GBY A;  3FK7 A;  1Z0X A;  2HYJ A;  2QIB A;  2ZY9 A;  2GUH A;  3TP0 A;  5FMP A;  2GFN A;  3O60 A;  3CWR A;  3ANP A;  2JJ7 A;  2XPU A;  3JSJ A;  4ACI A;  4DVY P;  2IEK A;  2HXO A;  2ID3 A;  5CXG A;  2NP3 A;  3BR3 A;  3LJL A;  1JTX A;  4OD5 A;  3LOC A;  3MVP A;  3ZQL A;  1JTY A;  5D1R A;  3SWH A;  3B6A A;  4JKZ A;  4B3A A;  2Q24 A;  4CGR A;  4ME9 A;  3ON4 A;  3FK6 A;  3VOK A;  3KNW A;  3Q0V A;  5IOZ A;  2Y31 A;  3C2B A;  2XGE A;  3G1M A;  2R7Q A;  2WV1 A;  3EUP A;  3VUQ A;  4AC0 A;  5FKO A;  2ID6 A;  4AF5 A;  2WGB A;  3BCG A;  3LWJ A;  3C07 A;  2XPW A;  3WHB A;  2Y30 A;  3LSP A;  3BQY A;  2NS8 A;  3BTJ A;  4C2M A;  2OPT A;  5GPA A;  2V57 A;  2ZOZ A;  4HKU A;  3QPL A;  2FJ1 A;  3HTH A;  3VPR A;  3ZQI A;  3T6N A;  1U9O A;  2R7R A;  3BTI A;  1QPI A;  2B1E A;  4D5C A;  3SFI A;  1RKT A;  5FKM A;  5AQC A;  1VI0 A;  5J3L A;  5F0H A;  4AUX A;  5C4Y A;  4M3D A;  4GCL A;  2XRL A;  3DCF A;  2NP5 A;  4YZE A;  3B81 A;  3BR5 A;  1JT6 A;  3QQA A;  2G0E A;  2QWT A;  3DU5 A;  3LHQ A;  3E7Q A;  4AC6 A;  5K7F A;  2PBX A;  3CJD A;  2B3W A;  3HGG A;  1ORK A;  5EZH A;  4U9L A;  1JUS A;  3KKD A;  2FD5 A;  3HIM A;  3FHN A;  3NPI A;  2GEN A;  3BQZ A;  2R7X A;  3MNL A;  4M3G A;  2R7T A;  3BR6 A;  3IH4 A;  2UXP A;  3KZ9 A;  4X1E A;  3PPB A; 
#chains in the Genus database with same CATH homology
 3WHC A;  5EZG A;  3VIB A;  5J1R A;  2ZCN A;  3ON2 A;  3FRQ A;  3BT9 A;  2IAI A;  3ZQG A;  5IOY A;  3IH2 A;  5CXI A;  3O8H A;  3LSJ A;  3ZQH A;  2YVE A;  4PXI A;  3HGY A;  5FHP A;  3BTC A;  2G3B A;  3BR2 A;  3BNI A;  2QOP A;  4I76 A;  3P9T A;  3NRG A;  3GZI A;  2HQ5 A;  4MK6 A;  2FBQ A;  2QCO A;  5HSZ A;  4M3F A;  2EH3 A;  2FQ4 A;  3QKX A;  5K7H A;  4JYK A;  5H9T A;  1U9N A;  2X6O A;  5FKK A;  4D5F A;  4DW6 A;  5K58 A;  2X9D A;  5HBU A;  5J1Y A;  2DTZ A;  2RAS A;  1ZKG A;  4GCT A;  5J1U A;  1JUP A;  3G1L A;  2RHA A;  3TP3 A;  3CRJ A;  3COL A;  2XGD A;  3IH3 A;  1JT0 A;  3VVZ A;  2UXO A;  2FX0 A;  1JUM A;  4JNN A;  3V78 A;  2XDN A;  5IP6 A;  3PAS A;  2XB5 A;  5FKN A;  1BJZ A;  4NEL A;  2D6Y A;  5DAJ A;  2PZ9 A;  3B6C A;  2YVH A;  4B1R A;  2ZCX A;  3IUV A;  4GCK A;  4MXM A;  1ZK8 A;  3S5R A;  3RD3 A;  3HTA A;  1RPW A;  4M3B A;  2TCT A;  2VKE A;  4KWA A;  1UI6 A;  4V2G A;  4D7N A;  3V6G A;  5FKL A;  5CW8 A;  2ZCM A;  3VW1 A;  2O7O A;  3EGQ A;  3Q3S A;  2G7S A;  2ZB9 A;  4M3E A;  2REK A;  5FGL A;  3GEU A;  2ZOY A;  1UI5 A;  2JK3 A;  3VVY A;  3NI7 A;  4W1U A;  3QPS A;  2VKV A;  3Q0W A;  2W53 A;  2IBD A;  3Q0U A;  2OF7 A;  3RH2 A;  5D19 A;  2NS7 A;  2O7T A;  3LSR A;  2HYT A;  3SDG A;  5D18 A;  2RAE A;  4GFK A;  3NNR A;  4GFL A;  3VVX A;  2DG7 A;  3DEW A;  4ABZ A;  3HTI A;  4JL3 A;  4NN1 A;  3O8G A;  3G56 A;  3CCY A;  1RKW A;  3PM1 A;  1A6I A;  2I10 A;  2G7G A;  5F08 A;  1Z77 A;  3BR0 A;  4I6Z A;  1QVU A;  3KKC A;  4MO7 A;  2OI8 A;  3AQS A;  2UXH A;  3G7R A;  5GP9 A;  5F0F A;  5EYR A;  2XGC A;  3HTJ A;  5IPA A;  3CDL A;  2DG8 A;  2OER A;  2XPV A;  2UXU A;  3BHQ A;  3F1B A;  3ANG A;  3NXC A;  4XK4 A;  3VW0 A;  4D7M A;  2NX4 A;  3DPJ A;  4L62 A;  1QVT A;  4UDS A;  3HE0 A;  3BTL A;  3VP5 A;  5F0C A;  2HKU A;  4ICH A;  3AQT A;  3FIW A;  2IU5 A;  3ZQF A;  4G12 A;  2QTQ A;  1T56 A;  5F27 A;  1SGM A;  2F07 A;  3QBM A;  4W97 A;  2QKO A;  2UXI A;  3F0C A;  2VPR A;  5GPC A;  2TRT A;  3BRU A;  3G1O A;  3BR1 A;  5F04 A;  5K7Z A;  3VOX A;  2WUI A;  5HAW A;  2G7L A;  5F1J A;  4V2F A;  2Y2Z A;  1T33 A;  2HXI A;  3BJB A;  3VW2 A;  5EFY A;  2GBY A;  3FK7 A;  1Z0X A;  2HYJ A;  2QIB A;  2GUH A;  3TP0 A;  5FMP A;  2GFN A;  3O60 A;  3CWR A;  3ANP A;  2JJ7 A;  2XPU A;  3JSJ A;  4ACI A;  2IEK A;  2HXO A;  2ID3 A;  5CXG A;  2NP3 A;  3BR3 A;  3LJL A;  1JTX A;  3LOC A;  3MVP A;  3ZQL A;  1JTY A;  5D1R A;  3B6A A;  4JKZ A;  4B3A A;  2Q24 A;  4CGR A;  4ME9 A;  3ON4 A;  3FK6 A;  3VOK A;  3KNW A;  3Q0V A;  5IOZ A;  2Y31 A;  3C2B A;  2XGE A;  3G1M A;  2WV1 A;  3EUP A;  3VUQ A;  4AC0 A;  5FKO A;  2ID6 A;  4AF5 A;  2WGB A;  3BCG A;  3LWJ A;  3C07 A;  2XPW A;  3WHB A;  2Y30 A;  3LSP A;  3BQY A;  2NS8 A;  3BTJ A;  2OPT A;  5GPA A;  2V57 A;  2ZOZ A;  4HKU A;  3QPL A;  2FJ1 A;  3HTH A;  3VPR A;  3ZQI A;  3T6N A;  1U9O A;  3BTI A;  1QPI A;  4D5C A;  3SFI A;  1RKT A;  5FKM A;  5AQC A;  1VI0 A;  5J3L A;  5F0H A;  4AUX A;  5C4Y A;  4M3D A;  4GCL A;  2XRL A;  3DCF A;  2NP5 A;  4YZE A;  3B81 A;  3BR5 A;  1JT6 A;  3QQA A;  2G0E A;  2QWT A;  3LHQ A;  3E7Q A;  4AC6 A;  5K7F A;  2PBX A;  3CJD A;  3HGG A;  1ORK A;  5EZH A;  1JUS A;  3KKD A;  2FD5 A;  3HIM A;  3NPI A;  2GEN A;  3BQZ A;  3MNL A;  4M3G A;  3BR6 A;  3IH4 A;  2UXP A;  3KZ9 A;  4X1E A;  3PPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...