2V57A

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
171
Chain Sequence
b'ERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription
total genus 66
structure length 171
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2v57A00
3B6AA 5D18A 3SFIA 5J1YA 3HGGA 2WV1A 4D7MA 1JUMA 3IH2A 2VKVA 3O8GA 1JT6A 5EZHA 5IOZA 5F0CA 3CWRA 3HTHA 2VPRA 2XPVA 3BR5A 3QQAA 3BR3A 2IEKA 3PASA 3V6GA 2UXOA 4ACIA 4AF5A 2ZCXA 4NN1A 2UXIA 5F1JA 4M3FA 3G7RA 2GBYA 5C4YA 3F1BA 3T6NA 1VI0A 3WHBA 5CXGA 3QKXA 1BJZA 2OERA 3SDGA 3BTIA 5FKOA 4I6ZA 3HTIA 2X6OA 3F0CA 5FMPA 4GCKA 2NX4A 3ON2A 2W53A 3BTCA 3HTAA 2UXHA 3NPIA 5AQCA 4V2FA 2NS7A 5EFYA 2YVEA 2FX0A 3P9TA 5F0FA 3KNWA 3AQTA 4HKUA 3RH2A 3NXCA 3C07A 3KKCA 3QPSA 3NI7A 3IUVA 2Y30A 3VUQA 2GFNA 3BR0A 4ABZA 5FKKA 2WGBA 4W97A 3FIWA 3FK6A 4JNNA 4D5FA 3IH3A 4L62A 2HXIA 3HE0A 3JSJA 1JUPA 1JTYA 4B3AA 5HAWA 1Z77A 3G1MA 4GFKA 5GP9A 5F0HA 2XDNA 2PBXA 3LHQA 3LSRA 3BQYA 2XGCA 2RHAA 4JKZA 4V2GA 2G3BA 2OPTA 4PXIA 2V57A 5K58A 2O7TA 3VOKA 3CRJA 1ZKGA 2QIBA 4D7NA 2HYTA 2XB5A 2YVHA 3EGQA 2IBDA 4KWAA 3NRGA 5F27A 3BHQA 2VKEA 4MK6A 3VVYA 2G0EA 3HIMA 3BT9A 3E7QA 1RKWA 4XK4A 3VW1A 3ANPA 3DCFA 3G1OA 4W1UA 3ZQFA 2ID6A 1ZK8A 2GENA 5CXIA 2XGEA 3IH4A 5F08A 4GCLA 3LOCA 1JUSA 5CW8A 2IAIA 2RASA 2HQ5A 4G12A 2FQ4A 3GEUA 3HGYA 3VVXA 3CDLA 4JYKA 2G7LA 1UI5A 3Q0VA 3VVZA 2ZOYA 2QCOA 3V78A 3C2BA 2XRLA 2GUHA 3AQSA 2QOPA 5J3LA 3BQZA 1JT0A 3COLA 2DG7A 4MO7A 3ZQHA 5GPCA 2NS8A 3FRQA 3G56A 2I10A 2NP5A 3HTJA 2UXPA 3PM1A 3VW0A 2HKUA 2IU5A 2Y31A 3O60A 1ORKA 3LSJA 4M3BA 3BCGA 3Q0WA 5FHPA 1U9OA 3KKDA 3BTJA 2Y2ZA 3Q3SA 3GZIA 5K7ZA 2DG8A 2X9DA 2REKA 2WUIA 4GCTA 4ICHA 2JJ7A 3ZQGA 3TP3A 4M3GA 5J1UA 1SGMA 3S5RA 3ANGA 3ZQIA 3QBMA 2ZCMA 1Z0XA 2O7OA 4M3DA 2D6YA 2G7SA 5HSZA 4D5CA 2ZB9A 4GFLA 3O8HA 3BR1A 2ZCNA 2OF7A 3B81A 5IPAA 1QVUA 2RAEA 3RD3A 2QKOA 5FKMA 2NP3A 3BRUA 2HYJA 5FKLA 5EYRA 3MVPA 2TRTA 1UI6A 2FBQA 3ON4A 5F04A 3VP5A 3VW2A 3ZQLA 3QPLA 1U9NA 2ID3A 2QTQA 2JK3A 3Q0UA 2Q24A 2XPUA 4JL3A 4NELA 2PZ9A 4X1EA 3VIBA 5EZGA 4DW6A 1QVTA 2FD5A 5IOYA 2EH3A 2HXOA 4I76A 4YZEA 3VOXA 1A6IA 2DTZA 5HBUA 5IP6A 3MNLA 1JTXA 4UDSA 3BNIA 4AC6A 3KZ9A 2UXUA 3BTLA 2ZOZA 1T56A 5J1RA 3FK7A 5DAJA 5D1RA 2FJ1A 4AC0A 3WHCA 1QPIA 3DPJA 4CGRA 3LJLA 5FKNA 2F07A 3LWJA 2OI8A 5D19A 3BR2A 2QWTA 3EUPA 4AUXA 3LSPA 2TCTA 3CJDA 3G1LA 5FGLA 2G7GA 1RPWA 2XGDA 3B6CA 1RKTA 1T33A 5H9TA 3BJBA 4B1RA 3TP0A 5K7FA 3VPRA 3CCYA 3DEWA 4M3EA 5GPAA 5K7HA 3PPBA 3NNRA 2XPWA 3BR6A 4MXMA 4ME9A
chains in the Genus database with same CATH superfamily
3B6AA 5D18A 3SFIA 2R7QA 5J1YA 3HGGA 2WV1A 4D7MA 3DU6A 1JUMA 3FHNA 3IH2A 2VKVA 3O8GA 1JT6A 5EZHA 5IOZA 4C2MA 5F0CA 3CWRA 3HTHA 2VPRA 2XPVA 3BR5A 3QQAA 3BR3A 2IEKA 3PASA 3V6GA 2UXOA 4ACIA 4AF5A 2ZCXA 2R7SA 4WIBA 4DVYP 4NN1A 2UXIA 5F1JA 4M3FA 3G7RA 2GBYA 5C4YA 3F1BA 3T6NA 1VI0A 3WHBA 5CXGA 3QKXA 1BJZA 2OERA 3SDGA 3BTIA 5FKOA 4I6ZA 3HTIA 2X6OA 3F0CA 5FMPA 3KYLA 4GCKA 2NX4A 3ON2A 2W53A 3BTCA 3HTAA 2UXHA 3NPIA 5AQCA 4V2FA 2NS7A 5EFYA 2YVEA 2FX0A 2B1EA 3P9TA 5F0FA 3KNWA 3AQTA 4HKUA 3VTIA 3RH2A 3NXCA 2R7RA 3C07A 3KKCA 3QPSA 3NI7A 3IUVA 2Y30A 3VUQA 2GFNA 3BR0A 4ABZA 5FKKA 2WGBA 4W97A 3FIWA 3FK6A 4JNNA 4D5FA 3IH3A 4L62A 2HXIA 3HE0A 3JSJA 1JUPA 1JTYA 4B3AA 5HAWA 1Z77A 3G1MA 4GFKA 5GP9A 5F0HA 2XDNA 2PBXA 3LHQA 3LSRA 3BQYA 2XGCA 2RHAA 4JKZA 4V2GA 2G3BA 2OPTA 4PXIA 2V57A 5K58A 2O7TA 3VOKA 3CRJA 1ZKGA 2QIBA 4D7NA 2HYTA 2B3WA 2XB5A 2YVHA 3EGQA 2IBDA 4KWAA 3NRGA 5F27A 3BHQA 2VKEA 4MK6A 3VVYA 2G0EA 3HIMA 3BT9A 3E7QA 4U9LA 1RKWA 4XK4A 3VW1A 2R7UA 3ANPA 3DCFA 3G1OA 4W1UA 2ID6A 3ZQFA 1ZK8A 2GENA 5CXIA 2XGEA 3IH4A 5CQGA 5F08A 4GCLA 3LOCA 1JUSA 5CW8A 2IAIA 2RASA 2HQ5A 4G12A 2FQ4A 3GEUA 3HGYA 3VVXA 3CDLA 4JYKA 2G7LA 1UI5A 3Q0VA 4IRVA 3VVZA 2ZOYA 2QCOA 3V78A 3C2BA 2XRLA 2GUHA 3AQSA 2QOPA 2A2FX 5J3LA 3BQZA 1JT0A 3COLA 3DU5A 2DG7A 2PFVA 4MO7A 3ZQHA 5GPCA 2NS8A 2R7VA 3FRQA 3G56A 2I10A 2NP5A 3HTJA 2UXPA 3PM1A 3VW0A 2HKUA 2IU5A 2Y31A 3O60A 1ORKA 3LSJA 4M3BA 3K8PC 3BCGA 3Q0WA 4OD5A 5FHPA 1U9OA 3KKDA 3BTJA 2Y2ZA 3Q3SA 3GZIA 5K7ZA 2DG8A 2X9DA 2YVXA 2REKA 2WUIA 4GCTA 4ICHA 2JJ7A 3ZQGA 3TP3A 4M3GA 5J1UA 1SGMA 3S5RA 2R7XA 3ANGA 3ZQIA 3QBMA 2ZCMA 1Z0XA 2O7OA 4M3DA 2D6YA 2G7SA 5HSZA 4D5CA 2ZB9A 4GFLA 3O8HA 3BR1A 2ZCNA 2OF7A 3B81A 5IPAA 1QVUA 2RAEA 3RD3A 2QKOA 5FKMA 2NP3A 3BRUA 2HYJA 5FKLA 5EYRA 3MVPA 2TRTA 1UI6A 2FBQA 3ON4A 2R7OA 5F04A 3VP5A 3VW2A 3ZQLA 3QPLA 1U9NA 2ID3A 2R7WA 2QTQA 2JK3A 3Q0UA 2Q24A 2XPUA 4JL3A 4NELA 2PZ9A 4X1EA 3NS4A 3VIBA 5EZGA 2FJI1 4DW6A 1QVTA 2FD5A 5IOYA 2EH3A 3SWHA 2HXOA 4I76A 4YZEA 3VOXA 1A6IA 2DTZA 5HBUA 5IP6A 3MNLA 1JTXA 4UDSA 3BNIA 4AC6A 3KZ9A 2UXUA 3BTLA 2ZOZA 1T56A 5J1RA 3FK7A 5DAJA 5D1RA 2FJ1A 4AC0A 3WHCA 1QPIA 3DPJA 4CGRA 3LJLA 5FKNA 2F07A 3LWJA 2OI8A 5D19A 3BR2A 2QWTA 3EUPA 4AUXA 3LSPA 2TCTA 3CJDA 3G1LA 5FGLA 2R7TA 2G7GA 1RPWA 2XGDA 3B6CA 1RKTA 1T33A 4OD4A 5H9TA 3BJBA 4B1RA 3TP0A 5K7FA 3VPRA 3CCYA 3DEWA 4M3EA 5GPAA 5K7HA 3PPBA 3NNRA 2XPWA 3BR6A 4U9NA 4MXMA 4ME9A 2ZY9A
chains in the Genus database with same CATH topology
3B6AA 5D18A 3SFIA 5J1YA 3HGGA 2WV1A 4D7MA 1JUMA 3IH2A 2VKVA 3O8GA 1JT6A 5EZHA 5IOZA 5F0CA 3CWRA 3HTHA 2VPRA 2XPVA 3BR5A 3QQAA 3BR3A 2IEKA 3PASA 3V6GA 2UXOA 4ACIA 4AF5A 2ZCXA 4NN1A 2UXIA 5F1JA 4M3FA 3G7RA 2GBYA 5C4YA 3F1BA 3T6NA 1VI0A 3WHBA 5CXGA 3QKXA 1BJZA 2OERA 3SDGA 3BTIA 5FKOA 4I6ZA 3HTIA 2X6OA 3F0CA 5FMPA 4GCKA 2NX4A 3ON2A 2W53A 3BTCA 3HTAA 2UXHA 3NPIA 5AQCA 4V2FA 2NS7A 5EFYA 2YVEA 2FX0A 3P9TA 5F0FA 3KNWA 3AQTA 4HKUA 3RH2A 3NXCA 3C07A 3KKCA 3QPSA 3NI7A 3IUVA 2Y30A 3VUQA 2GFNA 3BR0A 4ABZA 5FKKA 2WGBA 4W97A 3FIWA 3FK6A 4JNNA 4D5FA 3IH3A 4L62A 2HXIA 3HE0A 3JSJA 1JUPA 1JTYA 4B3AA 5HAWA 1Z77A 3G1MA 4GFKA 5GP9A 5F0HA 2XDNA 2PBXA 3LHQA 3LSRA 3BQYA 2XGCA 2RHAA 4JKZA 4V2GA 2G3BA 2OPTA 4PXIA 2V57A 5K58A 2O7TA 3VOKA 3CRJA 1ZKGA 2QIBA 4D7NA 2HYTA 2XB5A 2YVHA 3EGQA 2IBDA 4KWAA 3NRGA 5F27A 3BHQA 2VKEA 4MK6A 3VVYA 2G0EA 3HIMA 3BT9A 3E7QA 1RKWA 4XK4A 3VW1A 3ANPA 3DCFA 3G1OA 4W1UA 3ZQFA 2ID6A 1ZK8A 2GENA 5CXIA 2XGEA 3IH4A 5F08A 4GCLA 3LOCA 1JUSA 5CW8A 2IAIA 2RASA 2HQ5A 4G12A 2FQ4A 3GEUA 3HGYA 3VVXA 3CDLA 4JYKA 2G7LA 1UI5A 3Q0VA 3VVZA 2ZOYA 2QCOA 3V78A 3C2BA 2XRLA 2GUHA 3AQSA 2QOPA 5J3LA 3BQZA 1JT0A 3COLA 2DG7A 4MO7A 3ZQHA 5GPCA 2NS8A 3FRQA 3G56A 2I10A 2NP5A 3HTJA 2UXPA 3PM1A 3VW0A 2HKUA 2IU5A 2Y31A 3O60A 1ORKA 3LSJA 4M3BA 3BCGA 3Q0WA 5FHPA 1U9OA 3KKDA 3BTJA 2Y2ZA 3Q3SA 3GZIA 5K7ZA 2DG8A 2X9DA 2REKA 2WUIA 4GCTA 4ICHA 2JJ7A 3ZQGA 3TP3A 4M3GA 5J1UA 1SGMA 3S5RA 3ANGA 3ZQIA 3QBMA 2ZCMA 1Z0XA 2O7OA 4M3DA 2D6YA 2G7SA 5HSZA 4D5CA 2ZB9A 4GFLA 3O8HA 3BR1A 2ZCNA 2OF7A 3B81A 5IPAA 1QVUA 2RAEA 3RD3A 2QKOA 5FKMA 2NP3A 3BRUA 2HYJA 5FKLA 5EYRA 3MVPA 2TRTA 1UI6A 2FBQA 3ON4A 5F04A 3VP5A 3VW2A 3ZQLA 3QPLA 1U9NA 2ID3A 2QTQA 2JK3A 3Q0UA 2Q24A 2XPUA 4JL3A 4NELA 2PZ9A 4X1EA 3VIBA 5EZGA 4DW6A 1QVTA 2FD5A 5IOYA 2EH3A 2HXOA 4I76A 4YZEA 3VOXA 1A6IA 2DTZA 5HBUA 5IP6A 3MNLA 1JTXA 4UDSA 3BNIA 4AC6A 3KZ9A 2UXUA 3BTLA 2ZOZA 1T56A 5J1RA 3FK7A 5DAJA 5D1RA 2FJ1A 4AC0A 3WHCA 1QPIA 3DPJA 4CGRA 3LJLA 5FKNA 2F07A 3LWJA 2OI8A 5D19A 3BR2A 2QWTA 3EUPA 4AUXA 3LSPA 2TCTA 3CJDA 3G1LA 5FGLA 2G7GA 1RPWA 2XGDA 3B6CA 1RKTA 1T33A 5H9TA 3BJBA 4B1RA 3TP0A 5K7FA 3VPRA 3CCYA 3DEWA 4M3EA 5GPAA 5K7HA 3PPBA 3NNRA 2XPWA 3BR6A 4MXMA 4ME9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6A A;  5D18 A;  3SFI A;  5J1Y A;  3HGG A;  2WV1 A;  4D7M A;  1JUM A;  3IH2 A;  2VKV A;  3O8G A;  1JT6 A;  5EZH A;  5IOZ A;  5F0C A;  3CWR A;  3HTH A;  2VPR A;  2XPV A;  3BR5 A;  3QQA A;  3BR3 A;  2IEK A;  3PAS A;  3V6G A;  2UXO A;  4ACI A;  4AF5 A;  2ZCX A;  4NN1 A;  2UXI A;  5F1J A;  4M3F A;  3G7R A;  2GBY A;  5C4Y A;  3F1B A;  3T6N A;  1VI0 A;  3WHB A;  5CXG A;  3QKX A;  1BJZ A;  2OER A;  3SDG A;  3BTI A;  5FKO A;  4I6Z A;  3HTI A;  2X6O A;  3F0C A;  5FMP A;  4GCK A;  2NX4 A;  3ON2 A;  2W53 A;  3BTC A;  3HTA A;  2UXH A;  3NPI A;  5AQC A;  4V2F A;  2NS7 A;  5EFY A;  2YVE A;  2FX0 A;  3P9T A;  5F0F A;  3KNW A;  3AQT A;  4HKU A;  3RH2 A;  3NXC A;  3C07 A;  3KKC A;  3QPS A;  3NI7 A;  3IUV A;  2Y30 A;  3VUQ A;  2GFN A;  3BR0 A;  4ABZ A;  5FKK A;  2WGB A;  4W97 A;  3FIW A;  3FK6 A;  4JNN A;  4D5F A;  3IH3 A;  4L62 A;  2HXI A;  3HE0 A;  3JSJ A;  1JUP A;  1JTY A;  4B3A A;  5HAW A;  1Z77 A;  3G1M A;  4GFK A;  5GP9 A;  5F0H A;  2XDN A;  2PBX A;  3LHQ A;  3LSR A;  3BQY A;  2XGC A;  2RHA A;  4JKZ A;  4V2G A;  2G3B A;  2OPT A;  4PXI A;  2V57 A;  5K58 A;  2O7T A;  3VOK A;  3CRJ A;  1ZKG A;  2QIB A;  4D7N A;  2HYT A;  2XB5 A;  2YVH A;  3EGQ A;  2IBD A;  4KWA A;  3NRG A;  5F27 A;  3BHQ A;  2VKE A;  4MK6 A;  3VVY A;  2G0E A;  3HIM A;  3BT9 A;  3E7Q A;  1RKW A;  4XK4 A;  3VW1 A;  3ANP A;  3DCF A;  3G1O A;  4W1U A;  3ZQF A;  2ID6 A;  1ZK8 A;  2GEN A;  5CXI A;  2XGE A;  3IH4 A;  5F08 A;  4GCL A;  3LOC A;  1JUS A;  5CW8 A;  2IAI A;  2RAS A;  2HQ5 A;  4G12 A;  2FQ4 A;  3GEU A;  3HGY A;  3VVX A;  3CDL A;  4JYK A;  2G7L A;  1UI5 A;  3Q0V A;  3VVZ A;  2ZOY A;  2QCO A;  3V78 A;  3C2B A;  2XRL A;  2GUH A;  3AQS A;  2QOP A;  5J3L A;  3BQZ A;  1JT0 A;  3COL A;  2DG7 A;  4MO7 A;  3ZQH A;  5GPC A;  2NS8 A;  3FRQ A;  3G56 A;  2I10 A;  2NP5 A;  3HTJ A;  2UXP A;  3PM1 A;  3VW0 A;  2HKU A;  2IU5 A;  2Y31 A;  3O60 A;  1ORK A;  3LSJ A;  4M3B A;  3BCG A;  3Q0W A;  5FHP A;  1U9O A;  3KKD A;  3BTJ A;  2Y2Z A;  3Q3S A;  3GZI A;  5K7Z A;  2DG8 A;  2X9D A;  2REK A;  2WUI A;  4GCT A;  4ICH A;  2JJ7 A;  3ZQG A;  3TP3 A;  4M3G A;  5J1U A;  1SGM A;  3S5R A;  3ANG A;  3ZQI A;  3QBM A;  2ZCM A;  1Z0X A;  2O7O A;  4M3D A;  2D6Y A;  2G7S A;  5HSZ A;  4D5C A;  2ZB9 A;  4GFL A;  3O8H A;  3BR1 A;  2ZCN A;  2OF7 A;  3B81 A;  5IPA A;  1QVU A;  2RAE A;  3RD3 A;  2QKO A;  5FKM A;  2NP3 A;  3BRU A;  2HYJ A;  5FKL A;  5EYR A;  3MVP A;  2TRT A;  1UI6 A;  2FBQ A;  3ON4 A;  5F04 A;  3VP5 A;  3VW2 A;  3ZQL A;  3QPL A;  1U9N A;  2ID3 A;  2QTQ A;  2JK3 A;  3Q0U A;  2Q24 A;  2XPU A;  4JL3 A;  4NEL A;  2PZ9 A;  4X1E A;  3VIB A;  5EZG A;  4DW6 A;  1QVT A;  2FD5 A;  5IOY A;  2EH3 A;  2HXO A;  4I76 A;  4YZE A;  3VOX A;  1A6I A;  2DTZ A;  5HBU A;  5IP6 A;  3MNL A;  1JTX A;  4UDS A;  3BNI A;  4AC6 A;  3KZ9 A;  2UXU A;  3BTL A;  2ZOZ A;  1T56 A;  5J1R A;  3FK7 A;  5DAJ A;  5D1R A;  2FJ1 A;  4AC0 A;  3WHC A;  1QPI A;  3DPJ A;  4CGR A;  3LJL A;  5FKN A;  2F07 A;  3LWJ A;  2OI8 A;  5D19 A;  3BR2 A;  2QWT A;  3EUP A;  4AUX A;  3LSP A;  2TCT A;  3CJD A;  3G1L A;  5FGL A;  2G7G A;  1RPW A;  2XGD A;  3B6C A;  1RKT A;  1T33 A;  5H9T A;  3BJB A;  4B1R A;  3TP0 A;  5K7F A;  3VPR A;  3CCY A;  3DEW A;  4M3E A;  5GPA A;  5K7H A;  3PPB A;  3NNR A;  2XPW A;  3BR6 A;  4MXM A;  4ME9 A; 
#chains in the Genus database with same CATH topology
 3B6A A;  5D18 A;  3SFI A;  2R7Q A;  5J1Y A;  3HGG A;  2WV1 A;  4D7M A;  3DU6 A;  1JUM A;  3FHN A;  3IH2 A;  2VKV A;  3O8G A;  1JT6 A;  5EZH A;  5IOZ A;  4C2M A;  5F0C A;  3CWR A;  3HTH A;  2VPR A;  2XPV A;  3BR5 A;  3QQA A;  3BR3 A;  2IEK A;  3PAS A;  3V6G A;  2UXO A;  4ACI A;  4AF5 A;  2ZCX A;  2R7S A;  4WIB A;  4DVY P;  4NN1 A;  2UXI A;  5F1J A;  4M3F A;  3G7R A;  2GBY A;  5C4Y A;  3F1B A;  3T6N A;  1VI0 A;  3WHB A;  5CXG A;  3QKX A;  1BJZ A;  2OER A;  3SDG A;  3BTI A;  5FKO A;  4I6Z A;  3HTI A;  2X6O A;  3F0C A;  5FMP A;  3KYL A;  4GCK A;  2NX4 A;  3ON2 A;  2W53 A;  3BTC A;  3HTA A;  2UXH A;  3NPI A;  5AQC A;  4V2F A;  2NS7 A;  5EFY A;  2YVE A;  2FX0 A;  2B1E A;  3P9T A;  5F0F A;  3KNW A;  3AQT A;  4HKU A;  3VTI A;  3RH2 A;  3NXC A;  2R7R A;  3C07 A;  3KKC A;  3QPS A;  3NI7 A;  3IUV A;  2Y30 A;  3VUQ A;  2GFN A;  3BR0 A;  4ABZ A;  5FKK A;  2WGB A;  4W97 A;  3FIW A;  3FK6 A;  4JNN A;  4D5F A;  3IH3 A;  4L62 A;  2HXI A;  3HE0 A;  3JSJ A;  1JUP A;  1JTY A;  4B3A A;  5HAW A;  1Z77 A;  3G1M A;  4GFK A;  5GP9 A;  5F0H A;  2XDN A;  2PBX A;  3LHQ A;  3LSR A;  3BQY A;  2XGC A;  2RHA A;  4JKZ A;  4V2G A;  2G3B A;  2OPT A;  4PXI A;  2V57 A;  5K58 A;  2O7T A;  3VOK A;  3CRJ A;  1ZKG A;  2QIB A;  4D7N A;  2HYT A;  2B3W A;  2XB5 A;  2YVH A;  3EGQ A;  2IBD A;  4KWA A;  3NRG A;  5F27 A;  3BHQ A;  2VKE A;  4MK6 A;  3VVY A;  2G0E A;  3HIM A;  3BT9 A;  3E7Q A;  4U9L A;  1RKW A;  4XK4 A;  3VW1 A;  2R7U A;  3ANP A;  3DCF A;  3G1O A;  4W1U A;  2ID6 A;  3ZQF A;  1ZK8 A;  2GEN A;  5CXI A;  2XGE A;  3IH4 A;  5CQG A;  5F08 A;  4GCL A;  3LOC A;  1JUS A;  5CW8 A;  2IAI A;  2RAS A;  2HQ5 A;  4G12 A;  2FQ4 A;  3GEU A;  3HGY A;  3VVX A;  3CDL A;  4JYK A;  2G7L A;  1UI5 A;  3Q0V A;  4IRV A;  3VVZ A;  2ZOY A;  2QCO A;  3V78 A;  3C2B A;  2XRL A;  2GUH A;  3AQS A;  2QOP A;  2A2F X;  5J3L A;  3BQZ A;  1JT0 A;  3COL A;  3DU5 A;  2DG7 A;  2PFV A;  4MO7 A;  3ZQH A;  5GPC A;  2NS8 A;  2R7V A;  3FRQ A;  3G56 A;  2I10 A;  2NP5 A;  3HTJ A;  2UXP A;  3PM1 A;  3VW0 A;  2HKU A;  2IU5 A;  2Y31 A;  3O60 A;  1ORK A;  3LSJ A;  4M3B A;  3K8P C;  3BCG A;  3Q0W A;  4OD5 A;  5FHP A;  1U9O A;  3KKD A;  3BTJ A;  2Y2Z A;  3Q3S A;  3GZI A;  5K7Z A;  2DG8 A;  2X9D A;  2YVX A;  2REK A;  2WUI A;  4GCT A;  4ICH A;  2JJ7 A;  3ZQG A;  3TP3 A;  4M3G A;  5J1U A;  1SGM A;  3S5R A;  2R7X A;  3ANG A;  3ZQI A;  3QBM A;  2ZCM A;  1Z0X A;  2O7O A;  4M3D A;  2D6Y A;  2G7S A;  5HSZ A;  4D5C A;  2ZB9 A;  4GFL A;  3O8H A;  3BR1 A;  2ZCN A;  2OF7 A;  3B81 A;  5IPA A;  1QVU A;  2RAE A;  3RD3 A;  2QKO A;  5FKM A;  2NP3 A;  3BRU A;  2HYJ A;  5FKL A;  5EYR A;  3MVP A;  2TRT A;  1UI6 A;  2FBQ A;  3ON4 A;  2R7O A;  5F04 A;  3VP5 A;  3VW2 A;  3ZQL A;  3QPL A;  1U9N A;  2ID3 A;  2R7W A;  2QTQ A;  2JK3 A;  3Q0U A;  2Q24 A;  2XPU A;  4JL3 A;  4NEL A;  2PZ9 A;  4X1E A;  3NS4 A;  3VIB A;  5EZG A;  2FJI 1;  4DW6 A;  1QVT A;  2FD5 A;  5IOY A;  2EH3 A;  3SWH A;  2HXO A;  4I76 A;  4YZE A;  3VOX A;  1A6I A;  2DTZ A;  5HBU A;  5IP6 A;  3MNL A;  1JTX A;  4UDS A;  3BNI A;  4AC6 A;  3KZ9 A;  2UXU A;  3BTL A;  2ZOZ A;  1T56 A;  5J1R A;  3FK7 A;  5DAJ A;  5D1R A;  2FJ1 A;  4AC0 A;  3WHC A;  1QPI A;  3DPJ A;  4CGR A;  3LJL A;  5FKN A;  2F07 A;  3LWJ A;  2OI8 A;  5D19 A;  3BR2 A;  2QWT A;  3EUP A;  4AUX A;  3LSP A;  2TCT A;  3CJD A;  3G1L A;  5FGL A;  2R7T A;  2G7G A;  1RPW A;  2XGD A;  3B6C A;  1RKT A;  1T33 A;  4OD4 A;  5H9T A;  3BJB A;  4B1R A;  3TP0 A;  5K7F A;  3VPR A;  3CCY A;  3DEW A;  4M3E A;  5GPA A;  5K7H A;  3PPB A;  3NNR A;  2XPW A;  3BR6 A;  4U9N A;  4MXM A;  4ME9 A;  2ZY9 A; 
#chains in the Genus database with same CATH homology
 3B6A A;  5D18 A;  3SFI A;  5J1Y A;  3HGG A;  2WV1 A;  4D7M A;  1JUM A;  3IH2 A;  2VKV A;  3O8G A;  1JT6 A;  5EZH A;  5IOZ A;  5F0C A;  3CWR A;  3HTH A;  2VPR A;  2XPV A;  3BR5 A;  3QQA A;  3BR3 A;  2IEK A;  3PAS A;  3V6G A;  2UXO A;  4ACI A;  4AF5 A;  2ZCX A;  4NN1 A;  2UXI A;  5F1J A;  4M3F A;  3G7R A;  2GBY A;  5C4Y A;  3F1B A;  3T6N A;  1VI0 A;  3WHB A;  5CXG A;  3QKX A;  1BJZ A;  2OER A;  3SDG A;  3BTI A;  5FKO A;  4I6Z A;  3HTI A;  2X6O A;  3F0C A;  5FMP A;  4GCK A;  2NX4 A;  3ON2 A;  2W53 A;  3BTC A;  3HTA A;  2UXH A;  3NPI A;  5AQC A;  4V2F A;  2NS7 A;  5EFY A;  2YVE A;  2FX0 A;  3P9T A;  5F0F A;  3KNW A;  3AQT A;  4HKU A;  3RH2 A;  3NXC A;  3C07 A;  3KKC A;  3QPS A;  3NI7 A;  3IUV A;  2Y30 A;  3VUQ A;  2GFN A;  3BR0 A;  4ABZ A;  5FKK A;  2WGB A;  4W97 A;  3FIW A;  3FK6 A;  4JNN A;  4D5F A;  3IH3 A;  4L62 A;  2HXI A;  3HE0 A;  3JSJ A;  1JUP A;  1JTY A;  4B3A A;  5HAW A;  1Z77 A;  3G1M A;  4GFK A;  5GP9 A;  5F0H A;  2XDN A;  2PBX A;  3LHQ A;  3LSR A;  3BQY A;  2XGC A;  2RHA A;  4JKZ A;  4V2G A;  2G3B A;  2OPT A;  4PXI A;  2V57 A;  5K58 A;  2O7T A;  3VOK A;  3CRJ A;  1ZKG A;  2QIB A;  4D7N A;  2HYT A;  2XB5 A;  2YVH A;  3EGQ A;  2IBD A;  4KWA A;  3NRG A;  5F27 A;  3BHQ A;  2VKE A;  4MK6 A;  3VVY A;  2G0E A;  3HIM A;  3BT9 A;  3E7Q A;  1RKW A;  4XK4 A;  3VW1 A;  3ANP A;  3DCF A;  3G1O A;  4W1U A;  3ZQF A;  2ID6 A;  1ZK8 A;  2GEN A;  5CXI A;  2XGE A;  3IH4 A;  5F08 A;  4GCL A;  3LOC A;  1JUS A;  5CW8 A;  2IAI A;  2RAS A;  2HQ5 A;  4G12 A;  2FQ4 A;  3GEU A;  3HGY A;  3VVX A;  3CDL A;  4JYK A;  2G7L A;  1UI5 A;  3Q0V A;  3VVZ A;  2ZOY A;  2QCO A;  3V78 A;  3C2B A;  2XRL A;  2GUH A;  3AQS A;  2QOP A;  5J3L A;  3BQZ A;  1JT0 A;  3COL A;  2DG7 A;  4MO7 A;  3ZQH A;  5GPC A;  2NS8 A;  3FRQ A;  3G56 A;  2I10 A;  2NP5 A;  3HTJ A;  2UXP A;  3PM1 A;  3VW0 A;  2HKU A;  2IU5 A;  2Y31 A;  3O60 A;  1ORK A;  3LSJ A;  4M3B A;  3BCG A;  3Q0W A;  5FHP A;  1U9O A;  3KKD A;  3BTJ A;  2Y2Z A;  3Q3S A;  3GZI A;  5K7Z A;  2DG8 A;  2X9D A;  2REK A;  2WUI A;  4GCT A;  4ICH A;  2JJ7 A;  3ZQG A;  3TP3 A;  4M3G A;  5J1U A;  1SGM A;  3S5R A;  3ANG A;  3ZQI A;  3QBM A;  2ZCM A;  1Z0X A;  2O7O A;  4M3D A;  2D6Y A;  2G7S A;  5HSZ A;  4D5C A;  2ZB9 A;  4GFL A;  3O8H A;  3BR1 A;  2ZCN A;  2OF7 A;  3B81 A;  5IPA A;  1QVU A;  2RAE A;  3RD3 A;  2QKO A;  5FKM A;  2NP3 A;  3BRU A;  2HYJ A;  5FKL A;  5EYR A;  3MVP A;  2TRT A;  1UI6 A;  2FBQ A;  3ON4 A;  5F04 A;  3VP5 A;  3VW2 A;  3ZQL A;  3QPL A;  1U9N A;  2ID3 A;  2QTQ A;  2JK3 A;  3Q0U A;  2Q24 A;  2XPU A;  4JL3 A;  4NEL A;  2PZ9 A;  4X1E A;  3VIB A;  5EZG A;  4DW6 A;  1QVT A;  2FD5 A;  5IOY A;  2EH3 A;  2HXO A;  4I76 A;  4YZE A;  3VOX A;  1A6I A;  2DTZ A;  5HBU A;  5IP6 A;  3MNL A;  1JTX A;  4UDS A;  3BNI A;  4AC6 A;  3KZ9 A;  2UXU A;  3BTL A;  2ZOZ A;  1T56 A;  5J1R A;  3FK7 A;  5DAJ A;  5D1R A;  2FJ1 A;  4AC0 A;  3WHC A;  1QPI A;  3DPJ A;  4CGR A;  3LJL A;  5FKN A;  2F07 A;  3LWJ A;  2OI8 A;  5D19 A;  3BR2 A;  2QWT A;  3EUP A;  4AUX A;  3LSP A;  2TCT A;  3CJD A;  3G1L A;  5FGL A;  2G7G A;  1RPW A;  2XGD A;  3B6C A;  1RKT A;  1T33 A;  5H9T A;  3BJB A;  4B1R A;  3TP0 A;  5K7F A;  3VPR A;  3CCY A;  3DEW A;  4M3E A;  5GPA A;  5K7H A;  3PPB A;  3NNR A;  2XPW A;  3BR6 A;  4MXM A;  4ME9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...