2V57A

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
171
Chain Sequence
ERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
total genus 66
structure length 171
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2v57A00
5IOYA 4M3DA 4D7NA 2NS7A 2NP3A 3WHCA 1QVTA 5F27A 4ACIA 4M3FA 1JT6A 2RASA 2TCTA 3Q0UA 3BR5A 1JUSA 3LWJA 2YVEA 5F0CA 3FK7A 3Q0WA 2WUIA 3G1OA 4NN1A 3AQTA 5D1RA 2VKVA 3QPSA 2WGBA 5J3LA 2FD5A 3GEUA 4GCLA 1JTYA 3G56A 3BR1A 2XB5A 2QKOA 1T33A 2XPVA 4ABZA 3G7RA 3EGQA 5IOZA 3JSJA 3MVPA 5CW8A 2IU5A 2OI8A 3FRQA 4GFKA 3CCYA 5EYRA 2G7LA 1QVUA 3E7QA 3NPIA 2DG7A 2W53A 3VVXA 2HKUA 5K58A 5IP6A 2RAEA 3VOXA 4B3AA 2HQ5A 1JUMA 2XRLA 3BTJA 3VPRA 3BNIA 3B81A 3VOKA 4AUXA 3COLA 3BT9A 2UXOA 1SGMA 3MNLA 5K7ZA 5HBUA 1Z77A 3SDGA 5FKLA 1JTXA 5K7HA 4XK4A 3KZ9A 3VW1A 4JYKA 3SFIA 3GZIA 2X6OA 3HTAA 2Y31A 1BJZA 3IUVA 1Z0XA 4PXIA 4DW6A 2OF7A 2XPUA 3KKDA 3G1MA 3QKXA 2VPRA 4GCKA 3ZQHA 2XGEA 2REKA 5F1JA 3HTJA 1UI5A 2HYTA 1QPIA 2IBDA 3BTCA 4X1EA 5F04A 2GENA 5FKNA 4ME9A 4HKUA 5F08A 2EH3A 5FKOA 3Q3SA 1T56A 2HXOA 3PM1A 4CGRA 4AF5A 3C07A 5GPAA 3WHBA 3T6NA 2G0EA 3LSPA 5DAJA 4JL3A 3AQSA 1UI6A 2IAIA 4GCTA 2Y2ZA 3BTLA 2OERA 2TRTA 2I10A 2FBQA 3VW2A 2ID6A 4YZEA 3ANPA 2HXIA 5F0FA 1VI0A 5EZGA 2PBXA 3ON2A 3BR6A 2O7TA 2OPTA 2QWTA 5C4YA 3KKCA 4L62A 3BQYA 3BHQA 2JK3A 5K7FA 3HTHA 2G7SA 3V6GA 1RPWA 3LSRA 4G12A 4UDSA 2X9DA 5EZHA 2ZCNA 3C2BA 3VVYA 2F07A 3LHQA 3HTIA 1RKTA 2JJ7A 2GBYA 4D5CA 3TP3A 4B1RA 5F0HA 3LOCA 3NNRA 3QBMA 3BQZA 3S5RA 2UXHA 4AC6A 5CXIA 3BR2A 3EUPA 3PPBA 3HGGA 5FKMA 2UXUA 2ZCXA 4MO7A 2QCOA 2UXIA 3VP5A 5CXGA 2GFNA 2Q24A 5HSZA 4I76A 3B6AA 2DTZA 3DPJA 1A6IA 4M3GA 3CRJA 3HGYA 4D5FA 4I6ZA 3IH2A 3VUQA 5FHPA 1ORKA 3VVZA 5H9TA 5GPCA 3CWRA 4AC0A 2V57A 2XPWA 3BCGA 5D18A 3G1LA 3IH3A 2VKEA 1U9OA 1ZK8A 3F1BA 5J1UA 4D7MA 2NP5A 2QIBA 5GP9A 3O8GA 3TP0A 3ZQIA 2O7OA 4GFLA 5J1YA 2WV1A 2FX0A 3BJBA 4MXMA 1JUPA 4W97A 2XDNA 2UXPA 3HIMA 4KWAA 1U9NA 1RKWA 3LJLA 5FMPA 3BRUA 2ZOZA 5FKKA 3ON4A 2RHAA 2XGCA 4W1UA 3Q0VA 3QQAA 2Y30A 4M3BA 3FK6A 2IEKA 3ZQGA 5IPAA 2FJ1A 3HE0A 3RD3A 2XGDA 3O60A 1JT0A 3NXCA 2QOPA 3CDLA 4JNNA 2NS8A 5D19A 2G3BA 2FQ4A 3DCFA 1ZKGA 2YVHA 2PZ9A 3ANGA 2ZB9A 5J1RA 3ZQLA 3KNWA 3NRGA 3DEWA 4V2GA 3VIBA 2HYJA 5EFYA 2GUHA 3ZQFA 2ZOYA 3RH2A 2DG8A 3P9TA 3BR0A 2QTQA 3LSJA 3IH4A 3BTIA 3PASA 3V78A 4NELA 4V2FA 2G7GA 3QPLA 5HAWA 3BR3A 4M3EA 4ICHA 3B6CA 3CJDA 3NI7A 4MK6A 3FIWA 5AQCA 3VW0A 2NX4A 2ID3A 2ZCMA 3F0CA 3O8HA 2D6YA 4JKZA 5FGLA
chains in the Genus database with same CATH superfamily
5IOYA 4M3DA 4D7NA 2NS7A 2NP3A 3WHCA 1QVTA 5F27A 4ACIA 4M3FA 1JT6A 2RASA 2TCTA 3Q0UA 3BR5A 1JUSA 3LWJA 2YVEA 5F0CA 3FK7A 3Q0WA 2WUIA 3NS4A 3G1OA 4NN1A 2B3WA 3AQTA 5D1RA 2VKVA 2R7OA 3QPSA 2WGBA 5J3LA 2FD5A 3FHNA 3GEUA 4GCLA 1JTYA 3G56A 3VTIA 3BR1A 2XB5A 2QKOA 1T33A 2XPVA 4ABZA 2R7QA 3G7RA 3EGQA 5IOZA 3JSJA 3MVPA 5CW8A 2IU5A 2OI8A 3FRQA 4GFKA 3CCYA 5EYRA 3KYLA 2G7LA 1QVUA 3E7QA 4IRVA 2PFVA 3NPIA 2DG7A 2W53A 3VVXA 2HKUA 5K58A 5IP6A 2RAEA 3VOXA 4B3AA 2HQ5A 1JUMA 2XRLA 3BTJA 3VPRA 3BNIA 3B81A 3VOKA 4AUXA 3COLA 3BT9A 2UXOA 1SGMA 3MNLA 5K7ZA 5HBUA 1Z77A 3SDGA 5FKLA 1JTXA 5K7HA 4XK4A 3KZ9A 3VW1A 4JYKA 3SFIA 3GZIA 2X6OA 3HTAA 2Y31A 1BJZA 3IUVA 4OD5A 1Z0XA 4PXIA 4DW6A 2OF7A 2XPUA 3KKDA 3G1MA 3QKXA 2VPRA 4GCKA 3ZQHA 2B1EA 2XGEA 2REKA 5F1JA 3HTJA 1UI5A 2HYTA 1QPIA 2IBDA 2ZY9A 3BTCA 4X1EA 5F04A 2GENA 5FKNA 4ME9A 2R7WA 4HKUA 5F08A 2R7XA 2EH3A 5FKOA 3Q3SA 1T56A 2HXOA 3PM1A 4CGRA 4AF5A 3C07A 5GPAA 3WHBA 3T6NA 2G0EA 3LSPA 5DAJA 4JL3A 3AQSA 2R7VA 1UI6A 2IAIA 4GCTA 2Y2ZA 3BTLA 2OERA 2TRTA 2I10A 2FBQA 3VW2A 2YVXA 2ID6A 4YZEA 3ANPA 2HXIA 5F0FA 1VI0A 5EZGA 2R7RA 2PBXA 3ON2A 3BR6A 2O7TA 2OPTA 2QWTA 5C4YA 3KKCA 4L62A 3BQYA 3BHQA 2JK3A 5K7FA 3HTHA 2G7SA 4OD4A 3V6GA 1RPWA 4G12A 4UDSA 3LSRA 2X9DA 5EZHA 2ZCNA 3C2BA 3VVYA 2F07A 3LHQA 3HTIA 1RKTA 2JJ7A 2GBYA 4D5CA 3TP3A 4B1RA 3SWHA 5F0HA 3LOCA 3NNRA 3QBMA 3BQZA 3S5RA 2UXHA 4AC6A 5CXIA 3BR2A 3EUPA 3PPBA 3HGGA 5FKMA 2UXUA 2ZCXA 4MO7A 2QCOA 2UXIA 3VP5A 5CXGA 3K8PC 2GFNA 2Q24A 5HSZA 4I76A 3B6AA 2DTZA 3DPJA 1A6IA 4M3GA 3CRJA 3HGYA 2FJI1 4D5FA 2R7TA 4I6ZA 3IH2A 3VUQA 5FHPA 1ORKA 3VVZA 5H9TA 5GPCA 3CWRA 4AC0A 2V57A 2XPWA 3BCGA 5D18A 2A2FX 3G1LA 3IH3A 2VKEA 1U9OA 1ZK8A 3F1BA 5J1UA 4D7MA 2R7UA 2NP5A 2QIBA 5GP9A 3O8GA 4WIBA 3TP0A 5CQGA 3ZQIA 2O7OA 4GFLA 5J1YA 2WV1A 3DU6A 2FX0A 3DU5A 3BJBA 4MXMA 1JUPA 4W97A 4DVYP 2XDNA 2UXPA 3HIMA 4KWAA 1U9NA 1RKWA 3LJLA 5FMPA 3BRUA 2ZOZA 5FKKA 3ON4A 2RHAA 2XGCA 4W1UA 3Q0VA 3QQAA 2Y30A 4M3BA 3FK6A 2IEKA 3ZQGA 5IPAA 2FJ1A 3HE0A 3RD3A 2XGDA 3O60A 1JT0A 3NXCA 2QOPA 3CDLA 4JNNA 2NS8A 5D19A 2G3BA 2FQ4A 3DCFA 1ZKGA 2YVHA 2PZ9A 3ANGA 2ZB9A 5J1RA 4C2MA 3ZQLA 3KNWA 3NRGA 2R7SA 3DEWA 4V2GA 3VIBA 2HYJA 5EFYA 2GUHA 3ZQFA 2ZOYA 3RH2A 2DG8A 3P9TA 3BR0A 2QTQA 3LSJA 3IH4A 3BTIA 3PASA 4U9NA 3V78A 4NELA 4V2FA 2G7GA 3QPLA 5HAWA 3BR3A 4M3EA 4ICHA 3B6CA 3CJDA 3NI7A 4MK6A 3FIWA 5AQCA 3VW0A 2NX4A 2ID3A 2ZCMA 3F0CA 3O8HA 4U9LA 2D6YA 4JKZA 5FGLA
chains in the Genus database with same CATH topology
5IOYA 4M3DA 4D7NA 2NS7A 2NP3A 3WHCA 1QVTA 5F27A 4ACIA 4M3FA 1JT6A 2RASA 2TCTA 3Q0UA 3BR5A 1JUSA 3LWJA 2YVEA 5F0CA 3FK7A 3Q0WA 2WUIA 3G1OA 4NN1A 3AQTA 5D1RA 2VKVA 3QPSA 2WGBA 5J3LA 2FD5A 3GEUA 4GCLA 1JTYA 3G56A 3BR1A 2XB5A 2QKOA 1T33A 2XPVA 4ABZA 3G7RA 3EGQA 5IOZA 3JSJA 3MVPA 5CW8A 2IU5A 2OI8A 3FRQA 4GFKA 3CCYA 5EYRA 2G7LA 1QVUA 3E7QA 3NPIA 2DG7A 2W53A 3VVXA 2HKUA 5K58A 5IP6A 2RAEA 3VOXA 4B3AA 2HQ5A 1JUMA 2XRLA 3BTJA 3VPRA 3BNIA 3B81A 3VOKA 4AUXA 3COLA 3BT9A 2UXOA 1SGMA 3MNLA 5K7ZA 5HBUA 1Z77A 3SDGA 5FKLA 1JTXA 5K7HA 4XK4A 3KZ9A 3VW1A 4JYKA 3SFIA 3GZIA 2X6OA 3HTAA 2Y31A 1BJZA 3IUVA 1Z0XA 4PXIA 4DW6A 2OF7A 2XPUA 3KKDA 3G1MA 3QKXA 2VPRA 4GCKA 3ZQHA 2XGEA 2REKA 5F1JA 3HTJA 1UI5A 2HYTA 1QPIA 2IBDA 3BTCA 4X1EA 5F04A 2GENA 5FKNA 4ME9A 4HKUA 5F08A 2EH3A 5FKOA 3Q3SA 1T56A 2HXOA 3PM1A 4CGRA 4AF5A 3C07A 5GPAA 3WHBA 3T6NA 2G0EA 3LSPA 5DAJA 4JL3A 3AQSA 1UI6A 2IAIA 4GCTA 2Y2ZA 3BTLA 2OERA 2TRTA 2I10A 2FBQA 3VW2A 2ID6A 4YZEA 3ANPA 2HXIA 5F0FA 1VI0A 5EZGA 2PBXA 3ON2A 3BR6A 2O7TA 2OPTA 2QWTA 5C4YA 3KKCA 4L62A 3BQYA 3BHQA 2JK3A 5K7FA 3HTHA 2G7SA 3V6GA 1RPWA 3LSRA 4G12A 4UDSA 2X9DA 5EZHA 2ZCNA 3C2BA 3VVYA 2F07A 3LHQA 3HTIA 1RKTA 2JJ7A 2GBYA 4D5CA 3TP3A 4B1RA 5F0HA 3LOCA 3NNRA 3QBMA 3BQZA 3S5RA 2UXHA 4AC6A 5CXIA 3BR2A 3EUPA 3PPBA 3HGGA 5FKMA 2UXUA 2ZCXA 4MO7A 2QCOA 2UXIA 3VP5A 5CXGA 2GFNA 2Q24A 5HSZA 4I76A 3B6AA 2DTZA 3DPJA 1A6IA 4M3GA 3CRJA 3HGYA 4D5FA 4I6ZA 3IH2A 3VUQA 5FHPA 1ORKA 3VVZA 5H9TA 5GPCA 3CWRA 4AC0A 2V57A 2XPWA 3BCGA 5D18A 3G1LA 3IH3A 2VKEA 1U9OA 1ZK8A 3F1BA 5J1UA 4D7MA 2NP5A 2QIBA 5GP9A 3O8GA 3TP0A 3ZQIA 2O7OA 4GFLA 5J1YA 2WV1A 2FX0A 3BJBA 4MXMA 1JUPA 4W97A 2XDNA 2UXPA 3HIMA 4KWAA 1U9NA 1RKWA 3LJLA 5FMPA 3BRUA 2ZOZA 5FKKA 3ON4A 2RHAA 2XGCA 4W1UA 3Q0VA 3QQAA 2Y30A 4M3BA 3FK6A 2IEKA 3ZQGA 5IPAA 2FJ1A 3HE0A 3RD3A 2XGDA 3O60A 1JT0A 3NXCA 2QOPA 3CDLA 4JNNA 2NS8A 5D19A 2G3BA 2FQ4A 3DCFA 1ZKGA 2YVHA 2PZ9A 3ANGA 2ZB9A 5J1RA 3ZQLA 3KNWA 3NRGA 3DEWA 4V2GA 3VIBA 2HYJA 5EFYA 2GUHA 3ZQFA 2ZOYA 3RH2A 2DG8A 3P9TA 3BR0A 2QTQA 3LSJA 3IH4A 3BTIA 3PASA 3V78A 4NELA 4V2FA 2G7GA 3QPLA 5HAWA 3BR3A 4M3EA 4ICHA 3B6CA 3CJDA 3NI7A 4MK6A 3FIWA 5AQCA 3VW0A 2NX4A 2ID3A 2ZCMA 3F0CA 3O8HA 2D6YA 4JKZA 5FGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOY A;  4M3D A;  4D7N A;  2NS7 A;  2NP3 A;  3WHC A;  1QVT A;  5F27 A;  4ACI A;  4M3F A;  1JT6 A;  2RAS A;  2TCT A;  3Q0U A;  3BR5 A;  1JUS A;  3LWJ A;  2YVE A;  5F0C A;  3FK7 A;  3Q0W A;  2WUI A;  3G1O A;  4NN1 A;  3AQT A;  5D1R A;  2VKV A;  3QPS A;  2WGB A;  5J3L A;  2FD5 A;  3GEU A;  4GCL A;  1JTY A;  3G56 A;  3BR1 A;  2XB5 A;  2QKO A;  1T33 A;  2XPV A;  4ABZ A;  3G7R A;  3EGQ A;  5IOZ A;  3JSJ A;  3MVP A;  5CW8 A;  2IU5 A;  2OI8 A;  3FRQ A;  4GFK A;  3CCY A;  5EYR A;  2G7L A;  1QVU A;  3E7Q A;  3NPI A;  2DG7 A;  2W53 A;  3VVX A;  2HKU A;  5K58 A;  5IP6 A;  2RAE A;  3VOX A;  4B3A A;  2HQ5 A;  1JUM A;  2XRL A;  3BTJ A;  3VPR A;  3BNI A;  3B81 A;  3VOK A;  4AUX A;  3COL A;  3BT9 A;  2UXO A;  1SGM A;  3MNL A;  5K7Z A;  5HBU A;  1Z77 A;  3SDG A;  5FKL A;  1JTX A;  5K7H A;  4XK4 A;  3KZ9 A;  3VW1 A;  4JYK A;  3SFI A;  3GZI A;  2X6O A;  3HTA A;  2Y31 A;  1BJZ A;  3IUV A;  1Z0X A;  4PXI A;  4DW6 A;  2OF7 A;  2XPU A;  3KKD A;  3G1M A;  3QKX A;  2VPR A;  4GCK A;  3ZQH A;  2XGE A;  2REK A;  5F1J A;  3HTJ A;  1UI5 A;  2HYT A;  1QPI A;  2IBD A;  3BTC A;  4X1E A;  5F04 A;  2GEN A;  5FKN A;  4ME9 A;  4HKU A;  5F08 A;  2EH3 A;  5FKO A;  3Q3S A;  1T56 A;  2HXO A;  3PM1 A;  4CGR A;  4AF5 A;  3C07 A;  5GPA A;  3WHB A;  3T6N A;  2G0E A;  3LSP A;  5DAJ A;  4JL3 A;  3AQS A;  1UI6 A;  2IAI A;  4GCT A;  2Y2Z A;  3BTL A;  2OER A;  2TRT A;  2I10 A;  2FBQ A;  3VW2 A;  2ID6 A;  4YZE A;  3ANP A;  2HXI A;  5F0F A;  1VI0 A;  5EZG A;  2PBX A;  3ON2 A;  3BR6 A;  2O7T A;  2OPT A;  2QWT A;  5C4Y A;  3KKC A;  4L62 A;  3BQY A;  3BHQ A;  2JK3 A;  5K7F A;  3HTH A;  2G7S A;  3V6G A;  1RPW A;  3LSR A;  4G12 A;  4UDS A;  2X9D A;  5EZH A;  2ZCN A;  3C2B A;  3VVY A;  2F07 A;  3LHQ A;  3HTI A;  1RKT A;  2JJ7 A;  2GBY A;  4D5C A;  3TP3 A;  4B1R A;  5F0H A;  3LOC A;  3NNR A;  3QBM A;  3BQZ A;  3S5R A;  2UXH A;  4AC6 A;  5CXI A;  3BR2 A;  3EUP A;  3PPB A;  3HGG A;  5FKM A;  2UXU A;  2ZCX A;  4MO7 A;  2QCO A;  2UXI A;  3VP5 A;  5CXG A;  2GFN A;  2Q24 A;  5HSZ A;  4I76 A;  3B6A A;  2DTZ A;  3DPJ A;  1A6I A;  4M3G A;  3CRJ A;  3HGY A;  4D5F A;  4I6Z A;  3IH2 A;  3VUQ A;  5FHP A;  1ORK A;  3VVZ A;  5H9T A;  5GPC A;  3CWR A;  4AC0 A;  2V57 A;  2XPW A;  3BCG A;  5D18 A;  3G1L A;  3IH3 A;  2VKE A;  1U9O A;  1ZK8 A;  3F1B A;  5J1U A;  4D7M A;  2NP5 A;  2QIB A;  5GP9 A;  3O8G A;  3TP0 A;  3ZQI A;  2O7O A;  4GFL A;  5J1Y A;  2WV1 A;  2FX0 A;  3BJB A;  4MXM A;  1JUP A;  4W97 A;  2XDN A;  2UXP A;  3HIM A;  4KWA A;  1U9N A;  1RKW A;  3LJL A;  5FMP A;  3BRU A;  2ZOZ A;  5FKK A;  3ON4 A;  2RHA A;  2XGC A;  4W1U A;  3Q0V A;  3QQA A;  2Y30 A;  4M3B A;  3FK6 A;  2IEK A;  3ZQG A;  5IPA A;  2FJ1 A;  3HE0 A;  3RD3 A;  2XGD A;  3O60 A;  1JT0 A;  3NXC A;  2QOP A;  3CDL A;  4JNN A;  2NS8 A;  5D19 A;  2G3B A;  2FQ4 A;  3DCF A;  1ZKG A;  2YVH A;  2PZ9 A;  3ANG A;  2ZB9 A;  5J1R A;  3ZQL A;  3KNW A;  3NRG A;  3DEW A;  4V2G A;  3VIB A;  2HYJ A;  5EFY A;  2GUH A;  3ZQF A;  2ZOY A;  3RH2 A;  2DG8 A;  3P9T A;  3BR0 A;  2QTQ A;  3LSJ A;  3IH4 A;  3BTI A;  3PAS A;  3V78 A;  4NEL A;  4V2F A;  2G7G A;  3QPL A;  5HAW A;  3BR3 A;  4M3E A;  4ICH A;  3B6C A;  3CJD A;  3NI7 A;  4MK6 A;  3FIW A;  5AQC A;  3VW0 A;  2NX4 A;  2ID3 A;  2ZCM A;  3F0C A;  3O8H A;  2D6Y A;  4JKZ A;  5FGL A; 
#chains in the Genus database with same CATH topology
 5IOY A;  4M3D A;  4D7N A;  2NS7 A;  2NP3 A;  3WHC A;  1QVT A;  5F27 A;  4ACI A;  4M3F A;  1JT6 A;  2RAS A;  2TCT A;  3Q0U A;  3BR5 A;  1JUS A;  3LWJ A;  2YVE A;  5F0C A;  3FK7 A;  3Q0W A;  2WUI A;  3NS4 A;  3G1O A;  4NN1 A;  2B3W A;  3AQT A;  5D1R A;  2VKV A;  2R7O A;  3QPS A;  2WGB A;  5J3L A;  2FD5 A;  3FHN A;  3GEU A;  4GCL A;  1JTY A;  3G56 A;  3VTI A;  3BR1 A;  2XB5 A;  2QKO A;  1T33 A;  2XPV A;  4ABZ A;  2R7Q A;  3G7R A;  3EGQ A;  5IOZ A;  3JSJ A;  3MVP A;  5CW8 A;  2IU5 A;  2OI8 A;  3FRQ A;  4GFK A;  3CCY A;  5EYR A;  3KYL A;  2G7L A;  1QVU A;  3E7Q A;  4IRV A;  2PFV A;  3NPI A;  2DG7 A;  2W53 A;  3VVX A;  2HKU A;  5K58 A;  5IP6 A;  2RAE A;  3VOX A;  4B3A A;  2HQ5 A;  1JUM A;  2XRL A;  3BTJ A;  3VPR A;  3BNI A;  3B81 A;  3VOK A;  4AUX A;  3COL A;  3BT9 A;  2UXO A;  1SGM A;  3MNL A;  5K7Z A;  5HBU A;  1Z77 A;  3SDG A;  5FKL A;  1JTX A;  5K7H A;  4XK4 A;  3KZ9 A;  3VW1 A;  4JYK A;  3SFI A;  3GZI A;  2X6O A;  3HTA A;  2Y31 A;  1BJZ A;  3IUV A;  4OD5 A;  1Z0X A;  4PXI A;  4DW6 A;  2OF7 A;  2XPU A;  3KKD A;  3G1M A;  3QKX A;  2VPR A;  4GCK A;  3ZQH A;  2B1E A;  2XGE A;  2REK A;  5F1J A;  3HTJ A;  1UI5 A;  2HYT A;  1QPI A;  2IBD A;  2ZY9 A;  3BTC A;  4X1E A;  5F04 A;  2GEN A;  5FKN A;  4ME9 A;  2R7W A;  4HKU A;  5F08 A;  2R7X A;  2EH3 A;  5FKO A;  3Q3S A;  1T56 A;  2HXO A;  3PM1 A;  4CGR A;  4AF5 A;  3C07 A;  5GPA A;  3WHB A;  3T6N A;  2G0E A;  3LSP A;  5DAJ A;  4JL3 A;  3AQS A;  2R7V A;  1UI6 A;  2IAI A;  4GCT A;  2Y2Z A;  3BTL A;  2OER A;  2TRT A;  2I10 A;  2FBQ A;  3VW2 A;  2YVX A;  2ID6 A;  4YZE A;  3ANP A;  2HXI A;  5F0F A;  1VI0 A;  5EZG A;  2R7R A;  2PBX A;  3ON2 A;  3BR6 A;  2O7T A;  2OPT A;  2QWT A;  5C4Y A;  3KKC A;  4L62 A;  3BQY A;  3BHQ A;  2JK3 A;  5K7F A;  3HTH A;  2G7S A;  4OD4 A;  3V6G A;  1RPW A;  4G12 A;  4UDS A;  3LSR A;  2X9D A;  5EZH A;  2ZCN A;  3C2B A;  3VVY A;  2F07 A;  3LHQ A;  3HTI A;  1RKT A;  2JJ7 A;  2GBY A;  4D5C A;  3TP3 A;  4B1R A;  3SWH A;  5F0H A;  3LOC A;  3NNR A;  3QBM A;  3BQZ A;  3S5R A;  2UXH A;  4AC6 A;  5CXI A;  3BR2 A;  3EUP A;  3PPB A;  3HGG A;  5FKM A;  2UXU A;  2ZCX A;  4MO7 A;  2QCO A;  2UXI A;  3VP5 A;  5CXG A;  3K8P C;  2GFN A;  2Q24 A;  5HSZ A;  4I76 A;  3B6A A;  2DTZ A;  3DPJ A;  1A6I A;  4M3G A;  3CRJ A;  3HGY A;  2FJI 1;  4D5F A;  2R7T A;  4I6Z A;  3IH2 A;  3VUQ A;  5FHP A;  1ORK A;  3VVZ A;  5H9T A;  5GPC A;  3CWR A;  4AC0 A;  2V57 A;  2XPW A;  3BCG A;  5D18 A;  2A2F X;  3G1L A;  3IH3 A;  2VKE A;  1U9O A;  1ZK8 A;  3F1B A;  5J1U A;  4D7M A;  2R7U A;  2NP5 A;  2QIB A;  5GP9 A;  3O8G A;  4WIB A;  3TP0 A;  5CQG A;  3ZQI A;  2O7O A;  4GFL A;  5J1Y A;  2WV1 A;  3DU6 A;  2FX0 A;  3DU5 A;  3BJB A;  4MXM A;  1JUP A;  4W97 A;  4DVY P;  2XDN A;  2UXP A;  3HIM A;  4KWA A;  1U9N A;  1RKW A;  3LJL A;  5FMP A;  3BRU A;  2ZOZ A;  5FKK A;  3ON4 A;  2RHA A;  2XGC A;  4W1U A;  3Q0V A;  3QQA A;  2Y30 A;  4M3B A;  3FK6 A;  2IEK A;  3ZQG A;  5IPA A;  2FJ1 A;  3HE0 A;  3RD3 A;  2XGD A;  3O60 A;  1JT0 A;  3NXC A;  2QOP A;  3CDL A;  4JNN A;  2NS8 A;  5D19 A;  2G3B A;  2FQ4 A;  3DCF A;  1ZKG A;  2YVH A;  2PZ9 A;  3ANG A;  2ZB9 A;  5J1R A;  4C2M A;  3ZQL A;  3KNW A;  3NRG A;  2R7S A;  3DEW A;  4V2G A;  3VIB A;  2HYJ A;  5EFY A;  2GUH A;  3ZQF A;  2ZOY A;  3RH2 A;  2DG8 A;  3P9T A;  3BR0 A;  2QTQ A;  3LSJ A;  3IH4 A;  3BTI A;  3PAS A;  4U9N A;  3V78 A;  4NEL A;  4V2F A;  2G7G A;  3QPL A;  5HAW A;  3BR3 A;  4M3E A;  4ICH A;  3B6C A;  3CJD A;  3NI7 A;  4MK6 A;  3FIW A;  5AQC A;  3VW0 A;  2NX4 A;  2ID3 A;  2ZCM A;  3F0C A;  3O8H A;  4U9L A;  2D6Y A;  4JKZ A;  5FGL A; 
#chains in the Genus database with same CATH homology
 5IOY A;  4M3D A;  4D7N A;  2NS7 A;  2NP3 A;  3WHC A;  1QVT A;  5F27 A;  4ACI A;  4M3F A;  1JT6 A;  2RAS A;  2TCT A;  3Q0U A;  3BR5 A;  1JUS A;  3LWJ A;  2YVE A;  5F0C A;  3FK7 A;  3Q0W A;  2WUI A;  3G1O A;  4NN1 A;  3AQT A;  5D1R A;  2VKV A;  3QPS A;  2WGB A;  5J3L A;  2FD5 A;  3GEU A;  4GCL A;  1JTY A;  3G56 A;  3BR1 A;  2XB5 A;  2QKO A;  1T33 A;  2XPV A;  4ABZ A;  3G7R A;  3EGQ A;  5IOZ A;  3JSJ A;  3MVP A;  5CW8 A;  2IU5 A;  2OI8 A;  3FRQ A;  4GFK A;  3CCY A;  5EYR A;  2G7L A;  1QVU A;  3E7Q A;  3NPI A;  2DG7 A;  2W53 A;  3VVX A;  2HKU A;  5K58 A;  5IP6 A;  2RAE A;  3VOX A;  4B3A A;  2HQ5 A;  1JUM A;  2XRL A;  3BTJ A;  3VPR A;  3BNI A;  3B81 A;  3VOK A;  4AUX A;  3COL A;  3BT9 A;  2UXO A;  1SGM A;  3MNL A;  5K7Z A;  5HBU A;  1Z77 A;  3SDG A;  5FKL A;  1JTX A;  5K7H A;  4XK4 A;  3KZ9 A;  3VW1 A;  4JYK A;  3SFI A;  3GZI A;  2X6O A;  3HTA A;  2Y31 A;  1BJZ A;  3IUV A;  1Z0X A;  4PXI A;  4DW6 A;  2OF7 A;  2XPU A;  3KKD A;  3G1M A;  3QKX A;  2VPR A;  4GCK A;  3ZQH A;  2XGE A;  2REK A;  5F1J A;  3HTJ A;  1UI5 A;  2HYT A;  1QPI A;  2IBD A;  3BTC A;  4X1E A;  5F04 A;  2GEN A;  5FKN A;  4ME9 A;  4HKU A;  5F08 A;  2EH3 A;  5FKO A;  3Q3S A;  1T56 A;  2HXO A;  3PM1 A;  4CGR A;  4AF5 A;  3C07 A;  5GPA A;  3WHB A;  3T6N A;  2G0E A;  3LSP A;  5DAJ A;  4JL3 A;  3AQS A;  1UI6 A;  2IAI A;  4GCT A;  2Y2Z A;  3BTL A;  2OER A;  2TRT A;  2I10 A;  2FBQ A;  3VW2 A;  2ID6 A;  4YZE A;  3ANP A;  2HXI A;  5F0F A;  1VI0 A;  5EZG A;  2PBX A;  3ON2 A;  3BR6 A;  2O7T A;  2OPT A;  2QWT A;  5C4Y A;  3KKC A;  4L62 A;  3BQY A;  3BHQ A;  2JK3 A;  5K7F A;  3HTH A;  2G7S A;  3V6G A;  1RPW A;  3LSR A;  4G12 A;  4UDS A;  2X9D A;  5EZH A;  2ZCN A;  3C2B A;  3VVY A;  2F07 A;  3LHQ A;  3HTI A;  1RKT A;  2JJ7 A;  2GBY A;  4D5C A;  3TP3 A;  4B1R A;  5F0H A;  3LOC A;  3NNR A;  3QBM A;  3BQZ A;  3S5R A;  2UXH A;  4AC6 A;  5CXI A;  3BR2 A;  3EUP A;  3PPB A;  3HGG A;  5FKM A;  2UXU A;  2ZCX A;  4MO7 A;  2QCO A;  2UXI A;  3VP5 A;  5CXG A;  2GFN A;  2Q24 A;  5HSZ A;  4I76 A;  3B6A A;  2DTZ A;  3DPJ A;  1A6I A;  4M3G A;  3CRJ A;  3HGY A;  4D5F A;  4I6Z A;  3IH2 A;  3VUQ A;  5FHP A;  1ORK A;  3VVZ A;  5H9T A;  5GPC A;  3CWR A;  4AC0 A;  2V57 A;  2XPW A;  3BCG A;  5D18 A;  3G1L A;  3IH3 A;  2VKE A;  1U9O A;  1ZK8 A;  3F1B A;  5J1U A;  4D7M A;  2NP5 A;  2QIB A;  5GP9 A;  3O8G A;  3TP0 A;  3ZQI A;  2O7O A;  4GFL A;  5J1Y A;  2WV1 A;  2FX0 A;  3BJB A;  4MXM A;  1JUP A;  4W97 A;  2XDN A;  2UXP A;  3HIM A;  4KWA A;  1U9N A;  1RKW A;  3LJL A;  5FMP A;  3BRU A;  2ZOZ A;  5FKK A;  3ON4 A;  2RHA A;  2XGC A;  4W1U A;  3Q0V A;  3QQA A;  2Y30 A;  4M3B A;  3FK6 A;  2IEK A;  3ZQG A;  5IPA A;  2FJ1 A;  3HE0 A;  3RD3 A;  2XGD A;  3O60 A;  1JT0 A;  3NXC A;  2QOP A;  3CDL A;  4JNN A;  2NS8 A;  5D19 A;  2G3B A;  2FQ4 A;  3DCF A;  1ZKG A;  2YVH A;  2PZ9 A;  3ANG A;  2ZB9 A;  5J1R A;  3ZQL A;  3KNW A;  3NRG A;  3DEW A;  4V2G A;  3VIB A;  2HYJ A;  5EFY A;  2GUH A;  3ZQF A;  2ZOY A;  3RH2 A;  2DG8 A;  3P9T A;  3BR0 A;  2QTQ A;  3LSJ A;  3IH4 A;  3BTI A;  3PAS A;  3V78 A;  4NEL A;  4V2F A;  2G7G A;  3QPL A;  5HAW A;  3BR3 A;  4M3E A;  4ICH A;  3B6C A;  3CJD A;  3NI7 A;  4MK6 A;  3FIW A;  5AQC A;  3VW0 A;  2NX4 A;  2ID3 A;  2ZCM A;  3F0C A;  3O8H A;  2D6Y A;  4JKZ A;  5FGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...