2V57A

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis in complex with proflavine
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
176
structure length
171
Chain Sequence
ERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIITLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription
total genus 66
structure length 171
sequence length 176
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2v57A00
5CW8A 1QVUA 5HBUA 2TRTA 3BTIA 1QVTA 3MNLA 3GEUA 5AQCA 5FGLA 2UXIA 4AC0A 1ORKA 2HYJA 4GCLA 1T56A 5C4YA 2X6OA 2G7SA 2ZCXA 5IP6A 3FRQA 3BCGA 2Y2ZA 5J1UA 4M3DA 1JT0A 2IBDA 2RASA 2FD5A 2DTZA 3CDLA 2JJ7A 3CRJA 3HTHA 1JT6A 3LSPA 5EZHA 4NN1A 2QOPA 2X9DA 4PXIA 5F04A 3HTAA 3B6CA 3O60A 5IOYA 3AQTA 4CGRA 4GFKA 3ON2A 5FKKA 5F0FA 3CCYA 5DAJA 3VVYA 2IAIA 3T6NA 2I10A 3PPBA 3BRUA 3VVZA 3BHQA 2QCOA 2GUHA 4JNNA 3SDGA 3G56A 2UXPA 4HKUA 3FK7A 2XB5A 4M3EA 2G7GA 3C07A 2IU5A 2O7OA 2PZ9A 2TCTA 2NX4A 3VVXA 5GPCA 3JSJA 2W53A 5D19A 3BR5A 3FK6A 2V57A 1ZK8A 2VPRA 2YVEA 2ZOYA 2YVHA 2OPTA 3ON4A 4ACIA 3ANPA 5FMPA 2DG7A 5EZGA 4MK6A 2QWTA 2XGDA 3WHCA 4V2GA 2EH3A 2PBXA 3HTIA 3QKXA 4GCTA 3LJLA 2IEKA 3IH3A 1Z0XA 2OF7A 2OERA 4XK4A 3E7QA 3LWJA 2WGBA 2HKUA 3V6GA 3PM1A 4ABZA 4B3AA 4D5FA 3RD3A 2GBYA 3QPSA 3C2BA 3BQZA 5EFYA 3Q0UA 2UXUA 1ZKGA 3EGQA 3KKCA 3KZ9A 2HXOA 2G0EA 2REKA 3F0CA 2GFNA 4UDSA 5FKLA 1UI6A 5IOZA 5K7FA 4YZEA 3BTJA 3BNIA 5IPAA 3O8HA 3HIMA 3BQYA 3VUQA 3EUPA 2FX0A 3NXCA 3AQSA 3BR3A 1U9OA 3VW1A 2FQ4A 3ZQGA 3HGGA 4D5CA 5FKNA 4V2FA 2QKOA 5EYRA 5F08A 4G12A 3KNWA 3BR2A 1T33A 5J3LA 1VI0A 3HE0A 2HXIA 3BT9A 5D18A 3LHQA 3LOCA 4M3BA 2UXHA 2RHAA 3TP3A 2GENA 4L62A 4MXMA 4W97A 3FIWA 2XPVA 3CJDA 4M3GA 2XDNA 2DG8A 2OI8A 5GP9A 2VKEA 4KWAA 5F1JA 3V78A 2Y31A 2QIBA 4W1UA 5J1RA 3B6AA 5CXGA 3NNRA 3LSJA 3COLA 3PASA 5F27A 2WV1A 1A6IA 3IH2A 2ZCNA 3GZIA 2XGEA 4DW6A 1JUSA 2XGCA 3BTCA 4AUXA 3IH4A 3VOKA 2HYTA 2G3BA 1RPWA 3MVPA 2QTQA 3ZQHA 3TP0A 2XRLA 3ZQIA 3VP5A 3G1OA 1RKTA 3Q0WA 3SFIA 2G7LA 2HQ5A 5FKOA 5K7ZA 3BR0A 3VIBA 3DCFA 4D7NA 1JTYA 4D7MA 1SGMA 1QPIA 1BJZA 2ZOZA 5K7HA 5H9TA 5HAWA 3ANGA 2NS7A 4GCKA 2ZB9A 3BR6A 4AC6A 3LSRA 3P9TA 3BJBA 3S5RA 3B81A 3HGYA 4I6ZA 2NS8A 2ID3A 5F0HA 3BR1A 3QPLA 3DPJA 3BTLA 4I76A 5F0CA 3VOXA 2ID6A 4JKZA 3NRGA 1RKWA 4ICHA 1Z77A 4B1RA 3HTJA 5J1YA 4JYKA 3WHBA 5GPAA 3ZQLA 2O7TA 3IUVA 3VW0A 3G7RA 5FKMA 2Q24A 3ZQFA 3QQAA 2NP5A 3Q3SA 3NI7A 5FHPA 2FJ1A 2ZCMA 3O8GA 4JL3A 1UI5A 5D1RA 4M3FA 1JUMA 3KKDA 4AF5A 3G1LA 3CWRA 3VPRA 2XPWA 5K58A 3NPIA 3G1MA 2NP3A 2RAEA 5CXIA 3DEWA 2FBQA 2WUIA 2F07A 2JK3A 3F1BA 3QBMA 2XPUA 1JUPA 3RH2A 1U9NA 4X1EA 2Y30A 1JTXA 4MO7A 2D6YA 4NELA 2UXOA 4ME9A 3VW2A 5HSZA 2VKVA 3Q0VA 4GFLA
chains in the Genus database with same CATH superfamily
5CW8A 1QVUA 5HBUA 2TRTA 3BTIA 1QVTA 3MNLA 3GEUA 5AQCA 5FGLA 2UXIA 2A2FX 4AC0A 1ORKA 2HYJA 4GCLA 1T56A 3FHNA 5C4YA 2X6OA 2G7SA 2YVXA 2ZCXA 5IP6A 3FRQA 3BCGA 2Y2ZA 5J1UA 4M3DA 1JT0A 5CQGA 2IBDA 2RASA 2FD5A 2DTZA 3CDLA 2JJ7A 3CRJA 3HTHA 1JT6A 3LSPA 5EZHA 4NN1A 2QOPA 2X9DA 4PXIA 5F04A 3HTAA 3B6CA 3O60A 5IOYA 3AQTA 4CGRA 4GFKA 3ON2A 5FKKA 2R7QA 5F0FA 3CCYA 5DAJA 3VVYA 2IAIA 3T6NA 2I10A 3PPBA 3BRUA 3VVZA 3BHQA 2GUHA 2QCOA 4JNNA 3SDGA 3DU5A 3G56A 2UXPA 4HKUA 3FK7A 2XB5A 4M3EA 2G7GA 3C07A 2IU5A 2O7OA 2PZ9A 2TCTA 2NX4A 3VVXA 5GPCA 3JSJA 4OD4A 2W53A 5D19A 3BR5A 3FK6A 2V57A 1ZK8A 2VPRA 2YVEA 2R7OA 2ZOYA 2YVHA 2OPTA 3ON4A 4DVYP 4ACIA 3ANPA 5FMPA 2DG7A 5EZGA 4MK6A 2QWTA 2XGDA 3WHCA 4V2GA 2EH3A 2PBXA 3HTIA 3QKXA 2B1EA 4GCTA 3LJLA 2IEKA 3IH3A 1Z0XA 2OF7A 2OERA 4XK4A 3E7QA 3LWJA 3SWHA 2WGBA 2HKUA 3V6GA 3PM1A 4ABZA 4B3AA 4D5FA 3RD3A 2GBYA 3QPSA 3C2BA 3BQZA 5EFYA 3Q0UA 2UXUA 1ZKGA 3EGQA 3KKCA 3KZ9A 2HXOA 2G0EA 2REKA 2B3WA 3F0CA 2GFNA 4UDSA 5FKLA 1UI6A 5IOZA 5K7FA 4YZEA 3BTJA 4IRVA 3BNIA 2R7XA 3DU6A 5IPAA 3O8HA 3HIMA 3BQYA 3VUQA 3EUPA 2FX0A 2PFVA 2R7RA 3NXCA 3NS4A 3AQSA 3BR3A 1U9OA 3VW1A 2FQ4A 3ZQGA 4WIBA 3HGGA 4D5CA 4U9NA 5FKNA 4V2FA 2QKOA 5EYRA 5F08A 4G12A 3KNWA 3BR2A 1T33A 3VTIA 2FJI1 5J3LA 1VI0A 3HE0A 2HXIA 3BT9A 5D18A 3LHQA 3LOCA 4M3BA 2UXHA 2RHAA 3TP3A 2GENA 4L62A 4MXMA 4W97A 3FIWA 2XPVA 3CJDA 4M3GA 2XDNA 2DG8A 2OI8A 5GP9A 2VKEA 3KYLA 4KWAA 5F1JA 3V78A 2Y31A 2QIBA 4W1UA 5J1RA 3B6AA 5CXGA 3NNRA 3LSJA 2ZY9A 3COLA 3PASA 5F27A 2WV1A 1A6IA 3IH2A 2ZCNA 3GZIA 2XGEA 4DW6A 1JUSA 2XGCA 3BTCA 4AUXA 3IH4A 3VOKA 2HYTA 2G3BA 1RPWA 3MVPA 2QTQA 3ZQHA 3TP0A 2XRLA 4OD5A 3ZQIA 3VP5A 3G1OA 2R7VA 1RKTA 2R7WA 3Q0WA 3SFIA 2G7LA 4C2MA 2HQ5A 5FKOA 5K7ZA 3BR0A 3VIBA 3DCFA 4D7NA 1JTYA 4D7MA 1SGMA 1QPIA 1BJZA 2ZOZA 2R7TA 5K7HA 5H9TA 5HAWA 3ANGA 2NS7A 4GCKA 2ZB9A 3BR6A 4AC6A 3LSRA 3P9TA 3BJBA 3S5RA 3B81A 3HGYA 4I6ZA 2NS8A 2ID3A 3K8PC 5F0HA 3BR1A 3QPLA 3DPJA 3BTLA 4I76A 5F0CA 3VOXA 2ID6A 4JKZA 3NRGA 1RKWA 4ICHA 1Z77A 4B1RA 3HTJA 5J1YA 4JYKA 3WHBA 5GPAA 3ZQLA 2O7TA 3IUVA 3VW0A 3G7RA 5FKMA 2Q24A 3ZQFA 3QQAA 2NP5A 3Q3SA 3NI7A 5FHPA 2FJ1A 2ZCMA 3O8GA 4JL3A 1UI5A 5D1RA 4M3FA 1JUMA 2R7UA 3KKDA 4AF5A 3G1LA 3CWRA 3VPRA 2XPWA 5K58A 3NPIA 4U9LA 3G1MA 2NP3A 2RAEA 5CXIA 3DEWA 2FBQA 2WUIA 2F07A 2JK3A 3F1BA 3QBMA 2XPUA 1JUPA 3RH2A 1U9NA 4X1EA 2Y30A 1JTXA 4MO7A 2D6YA 2R7SA 4NELA 2UXOA 4ME9A 3VW2A 5HSZA 2VKVA 3Q0VA 4GFLA
chains in the Genus database with same CATH topology
5CW8A 1QVUA 5HBUA 2TRTA 3BTIA 1QVTA 3MNLA 3GEUA 5AQCA 5FGLA 2UXIA 4AC0A 1ORKA 2HYJA 4GCLA 1T56A 5C4YA 2X6OA 2G7SA 2ZCXA 5IP6A 3FRQA 3BCGA 2Y2ZA 5J1UA 4M3DA 1JT0A 2IBDA 2RASA 2FD5A 2DTZA 3CDLA 2JJ7A 3CRJA 3HTHA 1JT6A 3LSPA 5EZHA 4NN1A 2QOPA 2X9DA 4PXIA 5F04A 3HTAA 3B6CA 3O60A 5IOYA 3AQTA 4CGRA 4GFKA 3ON2A 5FKKA 5F0FA 3CCYA 5DAJA 3VVYA 2IAIA 3T6NA 2I10A 3PPBA 3BRUA 3VVZA 3BHQA 2QCOA 2GUHA 4JNNA 3SDGA 3G56A 2UXPA 4HKUA 3FK7A 2XB5A 4M3EA 2G7GA 3C07A 2IU5A 2O7OA 2PZ9A 2TCTA 2NX4A 3VVXA 5GPCA 3JSJA 2W53A 5D19A 3BR5A 3FK6A 2V57A 1ZK8A 2VPRA 2YVEA 2ZOYA 2YVHA 2OPTA 3ON4A 4ACIA 3ANPA 5FMPA 2DG7A 5EZGA 4MK6A 2QWTA 2XGDA 3WHCA 4V2GA 2EH3A 2PBXA 3HTIA 3QKXA 4GCTA 3LJLA 2IEKA 3IH3A 1Z0XA 2OF7A 2OERA 4XK4A 3E7QA 3LWJA 2WGBA 2HKUA 3V6GA 3PM1A 4ABZA 4B3AA 4D5FA 3RD3A 2GBYA 3QPSA 3C2BA 3BQZA 5EFYA 3Q0UA 2UXUA 1ZKGA 3EGQA 3KKCA 3KZ9A 2HXOA 2G0EA 2REKA 3F0CA 2GFNA 4UDSA 5FKLA 1UI6A 5IOZA 5K7FA 4YZEA 3BTJA 3BNIA 5IPAA 3O8HA 3HIMA 3BQYA 3VUQA 3EUPA 2FX0A 3NXCA 3AQSA 3BR3A 1U9OA 3VW1A 2FQ4A 3ZQGA 3HGGA 4D5CA 5FKNA 4V2FA 2QKOA 5EYRA 5F08A 4G12A 3KNWA 3BR2A 1T33A 5J3LA 1VI0A 3HE0A 2HXIA 3BT9A 5D18A 3LHQA 3LOCA 4M3BA 2UXHA 2RHAA 3TP3A 2GENA 4L62A 4MXMA 4W97A 3FIWA 2XPVA 3CJDA 4M3GA 2XDNA 2DG8A 2OI8A 5GP9A 2VKEA 4KWAA 5F1JA 3V78A 2Y31A 2QIBA 4W1UA 5J1RA 3B6AA 5CXGA 3NNRA 3LSJA 3COLA 3PASA 5F27A 2WV1A 1A6IA 3IH2A 2ZCNA 3GZIA 2XGEA 4DW6A 1JUSA 2XGCA 3BTCA 4AUXA 3IH4A 3VOKA 2HYTA 2G3BA 1RPWA 3MVPA 2QTQA 3ZQHA 3TP0A 2XRLA 3ZQIA 3VP5A 3G1OA 1RKTA 3Q0WA 3SFIA 2G7LA 2HQ5A 5FKOA 5K7ZA 3BR0A 3VIBA 3DCFA 4D7NA 1JTYA 4D7MA 1SGMA 1QPIA 1BJZA 2ZOZA 5K7HA 5H9TA 5HAWA 3ANGA 2NS7A 4GCKA 2ZB9A 3BR6A 4AC6A 3LSRA 3P9TA 3BJBA 3S5RA 3B81A 3HGYA 4I6ZA 2NS8A 2ID3A 5F0HA 3BR1A 3QPLA 3DPJA 3BTLA 4I76A 5F0CA 3VOXA 2ID6A 4JKZA 3NRGA 1RKWA 4ICHA 1Z77A 4B1RA 3HTJA 5J1YA 4JYKA 3WHBA 5GPAA 3ZQLA 2O7TA 3IUVA 3VW0A 3G7RA 5FKMA 2Q24A 3ZQFA 3QQAA 2NP5A 3Q3SA 3NI7A 5FHPA 2FJ1A 2ZCMA 3O8GA 4JL3A 1UI5A 5D1RA 4M3FA 1JUMA 3KKDA 4AF5A 3G1LA 3CWRA 3VPRA 2XPWA 5K58A 3NPIA 3G1MA 2NP3A 2RAEA 5CXIA 3DEWA 2FBQA 2WUIA 2F07A 2JK3A 3F1BA 3QBMA 2XPUA 1JUPA 3RH2A 1U9NA 4X1EA 2Y30A 1JTXA 4MO7A 2D6YA 4NELA 2UXOA 4ME9A 3VW2A 5HSZA 2VKVA 3Q0VA 4GFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CW8 A;  1QVU A;  5HBU A;  2TRT A;  3BTI A;  1QVT A;  3MNL A;  3GEU A;  5AQC A;  5FGL A;  2UXI A;  4AC0 A;  1ORK A;  2HYJ A;  4GCL A;  1T56 A;  5C4Y A;  2X6O A;  2G7S A;  2ZCX A;  5IP6 A;  3FRQ A;  3BCG A;  2Y2Z A;  5J1U A;  4M3D A;  1JT0 A;  2IBD A;  2RAS A;  2FD5 A;  2DTZ A;  3CDL A;  2JJ7 A;  3CRJ A;  3HTH A;  1JT6 A;  3LSP A;  5EZH A;  4NN1 A;  2QOP A;  2X9D A;  4PXI A;  5F04 A;  3HTA A;  3B6C A;  3O60 A;  5IOY A;  3AQT A;  4CGR A;  4GFK A;  3ON2 A;  5FKK A;  5F0F A;  3CCY A;  5DAJ A;  3VVY A;  2IAI A;  3T6N A;  2I10 A;  3PPB A;  3BRU A;  3VVZ A;  3BHQ A;  2QCO A;  2GUH A;  4JNN A;  3SDG A;  3G56 A;  2UXP A;  4HKU A;  3FK7 A;  2XB5 A;  4M3E A;  2G7G A;  3C07 A;  2IU5 A;  2O7O A;  2PZ9 A;  2TCT A;  2NX4 A;  3VVX A;  5GPC A;  3JSJ A;  2W53 A;  5D19 A;  3BR5 A;  3FK6 A;  2V57 A;  1ZK8 A;  2VPR A;  2YVE A;  2ZOY A;  2YVH A;  2OPT A;  3ON4 A;  4ACI A;  3ANP A;  5FMP A;  2DG7 A;  5EZG A;  4MK6 A;  2QWT A;  2XGD A;  3WHC A;  4V2G A;  2EH3 A;  2PBX A;  3HTI A;  3QKX A;  4GCT A;  3LJL A;  2IEK A;  3IH3 A;  1Z0X A;  2OF7 A;  2OER A;  4XK4 A;  3E7Q A;  3LWJ A;  2WGB A;  2HKU A;  3V6G A;  3PM1 A;  4ABZ A;  4B3A A;  4D5F A;  3RD3 A;  2GBY A;  3QPS A;  3C2B A;  3BQZ A;  5EFY A;  3Q0U A;  2UXU A;  1ZKG A;  3EGQ A;  3KKC A;  3KZ9 A;  2HXO A;  2G0E A;  2REK A;  3F0C A;  2GFN A;  4UDS A;  5FKL A;  1UI6 A;  5IOZ A;  5K7F A;  4YZE A;  3BTJ A;  3BNI A;  5IPA A;  3O8H A;  3HIM A;  3BQY A;  3VUQ A;  3EUP A;  2FX0 A;  3NXC A;  3AQS A;  3BR3 A;  1U9O A;  3VW1 A;  2FQ4 A;  3ZQG A;  3HGG A;  4D5C A;  5FKN A;  4V2F A;  2QKO A;  5EYR A;  5F08 A;  4G12 A;  3KNW A;  3BR2 A;  1T33 A;  5J3L A;  1VI0 A;  3HE0 A;  2HXI A;  3BT9 A;  5D18 A;  3LHQ A;  3LOC A;  4M3B A;  2UXH A;  2RHA A;  3TP3 A;  2GEN A;  4L62 A;  4MXM A;  4W97 A;  3FIW A;  2XPV A;  3CJD A;  4M3G A;  2XDN A;  2DG8 A;  2OI8 A;  5GP9 A;  2VKE A;  4KWA A;  5F1J A;  3V78 A;  2Y31 A;  2QIB A;  4W1U A;  5J1R A;  3B6A A;  5CXG A;  3NNR A;  3LSJ A;  3COL A;  3PAS A;  5F27 A;  2WV1 A;  1A6I A;  3IH2 A;  2ZCN A;  3GZI A;  2XGE A;  4DW6 A;  1JUS A;  2XGC A;  3BTC A;  4AUX A;  3IH4 A;  3VOK A;  2HYT A;  2G3B A;  1RPW A;  3MVP A;  2QTQ A;  3ZQH A;  3TP0 A;  2XRL A;  3ZQI A;  3VP5 A;  3G1O A;  1RKT A;  3Q0W A;  3SFI A;  2G7L A;  2HQ5 A;  5FKO A;  5K7Z A;  3BR0 A;  3VIB A;  3DCF A;  4D7N A;  1JTY A;  4D7M A;  1SGM A;  1QPI A;  1BJZ A;  2ZOZ A;  5K7H A;  5H9T A;  5HAW A;  3ANG A;  2NS7 A;  4GCK A;  2ZB9 A;  3BR6 A;  4AC6 A;  3LSR A;  3P9T A;  3BJB A;  3S5R A;  3B81 A;  3HGY A;  4I6Z A;  2NS8 A;  2ID3 A;  5F0H A;  3BR1 A;  3QPL A;  3DPJ A;  3BTL A;  4I76 A;  5F0C A;  3VOX A;  2ID6 A;  4JKZ A;  3NRG A;  1RKW A;  4ICH A;  1Z77 A;  4B1R A;  3HTJ A;  5J1Y A;  4JYK A;  3WHB A;  5GPA A;  3ZQL A;  2O7T A;  3IUV A;  3VW0 A;  3G7R A;  5FKM A;  2Q24 A;  3ZQF A;  3QQA A;  2NP5 A;  3Q3S A;  3NI7 A;  5FHP A;  2FJ1 A;  2ZCM A;  3O8G A;  4JL3 A;  1UI5 A;  5D1R A;  4M3F A;  1JUM A;  3KKD A;  4AF5 A;  3G1L A;  3CWR A;  3VPR A;  2XPW A;  5K58 A;  3NPI A;  3G1M A;  2NP3 A;  2RAE A;  5CXI A;  3DEW A;  2FBQ A;  2WUI A;  2F07 A;  2JK3 A;  3F1B A;  3QBM A;  2XPU A;  1JUP A;  3RH2 A;  1U9N A;  4X1E A;  2Y30 A;  1JTX A;  4MO7 A;  2D6Y A;  4NEL A;  2UXO A;  4ME9 A;  3VW2 A;  5HSZ A;  2VKV A;  3Q0V A;  4GFL A; 
#chains in the Genus database with same CATH topology
 5CW8 A;  1QVU A;  5HBU A;  2TRT A;  3BTI A;  1QVT A;  3MNL A;  3GEU A;  5AQC A;  5FGL A;  2UXI A;  2A2F X;  4AC0 A;  1ORK A;  2HYJ A;  4GCL A;  1T56 A;  3FHN A;  5C4Y A;  2X6O A;  2G7S A;  2YVX A;  2ZCX A;  5IP6 A;  3FRQ A;  3BCG A;  2Y2Z A;  5J1U A;  4M3D A;  1JT0 A;  5CQG A;  2IBD A;  2RAS A;  2FD5 A;  2DTZ A;  3CDL A;  2JJ7 A;  3CRJ A;  3HTH A;  1JT6 A;  3LSP A;  5EZH A;  4NN1 A;  2QOP A;  2X9D A;  4PXI A;  5F04 A;  3HTA A;  3B6C A;  3O60 A;  5IOY A;  3AQT A;  4CGR A;  4GFK A;  3ON2 A;  5FKK A;  2R7Q A;  5F0F A;  3CCY A;  5DAJ A;  3VVY A;  2IAI A;  3T6N A;  2I10 A;  3PPB A;  3BRU A;  3VVZ A;  3BHQ A;  2GUH A;  2QCO A;  4JNN A;  3SDG A;  3DU5 A;  3G56 A;  2UXP A;  4HKU A;  3FK7 A;  2XB5 A;  4M3E A;  2G7G A;  3C07 A;  2IU5 A;  2O7O A;  2PZ9 A;  2TCT A;  2NX4 A;  3VVX A;  5GPC A;  3JSJ A;  4OD4 A;  2W53 A;  5D19 A;  3BR5 A;  3FK6 A;  2V57 A;  1ZK8 A;  2VPR A;  2YVE A;  2R7O A;  2ZOY A;  2YVH A;  2OPT A;  3ON4 A;  4DVY P;  4ACI A;  3ANP A;  5FMP A;  2DG7 A;  5EZG A;  4MK6 A;  2QWT A;  2XGD A;  3WHC A;  4V2G A;  2EH3 A;  2PBX A;  3HTI A;  3QKX A;  2B1E A;  4GCT A;  3LJL A;  2IEK A;  3IH3 A;  1Z0X A;  2OF7 A;  2OER A;  4XK4 A;  3E7Q A;  3LWJ A;  3SWH A;  2WGB A;  2HKU A;  3V6G A;  3PM1 A;  4ABZ A;  4B3A A;  4D5F A;  3RD3 A;  2GBY A;  3QPS A;  3C2B A;  3BQZ A;  5EFY A;  3Q0U A;  2UXU A;  1ZKG A;  3EGQ A;  3KKC A;  3KZ9 A;  2HXO A;  2G0E A;  2REK A;  2B3W A;  3F0C A;  2GFN A;  4UDS A;  5FKL A;  1UI6 A;  5IOZ A;  5K7F A;  4YZE A;  3BTJ A;  4IRV A;  3BNI A;  2R7X A;  3DU6 A;  5IPA A;  3O8H A;  3HIM A;  3BQY A;  3VUQ A;  3EUP A;  2FX0 A;  2PFV A;  2R7R A;  3NXC A;  3NS4 A;  3AQS A;  3BR3 A;  1U9O A;  3VW1 A;  2FQ4 A;  3ZQG A;  4WIB A;  3HGG A;  4D5C A;  4U9N A;  5FKN A;  4V2F A;  2QKO A;  5EYR A;  5F08 A;  4G12 A;  3KNW A;  3BR2 A;  1T33 A;  3VTI A;  2FJI 1;  5J3L A;  1VI0 A;  3HE0 A;  2HXI A;  3BT9 A;  5D18 A;  3LHQ A;  3LOC A;  4M3B A;  2UXH A;  2RHA A;  3TP3 A;  2GEN A;  4L62 A;  4MXM A;  4W97 A;  3FIW A;  2XPV A;  3CJD A;  4M3G A;  2XDN A;  2DG8 A;  2OI8 A;  5GP9 A;  2VKE A;  3KYL A;  4KWA A;  5F1J A;  3V78 A;  2Y31 A;  2QIB A;  4W1U A;  5J1R A;  3B6A A;  5CXG A;  3NNR A;  3LSJ A;  2ZY9 A;  3COL A;  3PAS A;  5F27 A;  2WV1 A;  1A6I A;  3IH2 A;  2ZCN A;  3GZI A;  2XGE A;  4DW6 A;  1JUS A;  2XGC A;  3BTC A;  4AUX A;  3IH4 A;  3VOK A;  2HYT A;  2G3B A;  1RPW A;  3MVP A;  2QTQ A;  3ZQH A;  3TP0 A;  2XRL A;  4OD5 A;  3ZQI A;  3VP5 A;  3G1O A;  2R7V A;  1RKT A;  2R7W A;  3Q0W A;  3SFI A;  2G7L A;  4C2M A;  2HQ5 A;  5FKO A;  5K7Z A;  3BR0 A;  3VIB A;  3DCF A;  4D7N A;  1JTY A;  4D7M A;  1SGM A;  1QPI A;  1BJZ A;  2ZOZ A;  2R7T A;  5K7H A;  5H9T A;  5HAW A;  3ANG A;  2NS7 A;  4GCK A;  2ZB9 A;  3BR6 A;  4AC6 A;  3LSR A;  3P9T A;  3BJB A;  3S5R A;  3B81 A;  3HGY A;  4I6Z A;  2NS8 A;  2ID3 A;  3K8P C;  5F0H A;  3BR1 A;  3QPL A;  3DPJ A;  3BTL A;  4I76 A;  5F0C A;  3VOX A;  2ID6 A;  4JKZ A;  3NRG A;  1RKW A;  4ICH A;  1Z77 A;  4B1R A;  3HTJ A;  5J1Y A;  4JYK A;  3WHB A;  5GPA A;  3ZQL A;  2O7T A;  3IUV A;  3VW0 A;  3G7R A;  5FKM A;  2Q24 A;  3ZQF A;  3QQA A;  2NP5 A;  3Q3S A;  3NI7 A;  5FHP A;  2FJ1 A;  2ZCM A;  3O8G A;  4JL3 A;  1UI5 A;  5D1R A;  4M3F A;  1JUM A;  2R7U A;  3KKD A;  4AF5 A;  3G1L A;  3CWR A;  3VPR A;  2XPW A;  5K58 A;  3NPI A;  4U9L A;  3G1M A;  2NP3 A;  2RAE A;  5CXI A;  3DEW A;  2FBQ A;  2WUI A;  2F07 A;  2JK3 A;  3F1B A;  3QBM A;  2XPU A;  1JUP A;  3RH2 A;  1U9N A;  4X1E A;  2Y30 A;  1JTX A;  4MO7 A;  2D6Y A;  2R7S A;  4NEL A;  2UXO A;  4ME9 A;  3VW2 A;  5HSZ A;  2VKV A;  3Q0V A;  4GFL A; 
#chains in the Genus database with same CATH homology
 5CW8 A;  1QVU A;  5HBU A;  2TRT A;  3BTI A;  1QVT A;  3MNL A;  3GEU A;  5AQC A;  5FGL A;  2UXI A;  4AC0 A;  1ORK A;  2HYJ A;  4GCL A;  1T56 A;  5C4Y A;  2X6O A;  2G7S A;  2ZCX A;  5IP6 A;  3FRQ A;  3BCG A;  2Y2Z A;  5J1U A;  4M3D A;  1JT0 A;  2IBD A;  2RAS A;  2FD5 A;  2DTZ A;  3CDL A;  2JJ7 A;  3CRJ A;  3HTH A;  1JT6 A;  3LSP A;  5EZH A;  4NN1 A;  2QOP A;  2X9D A;  4PXI A;  5F04 A;  3HTA A;  3B6C A;  3O60 A;  5IOY A;  3AQT A;  4CGR A;  4GFK A;  3ON2 A;  5FKK A;  5F0F A;  3CCY A;  5DAJ A;  3VVY A;  2IAI A;  3T6N A;  2I10 A;  3PPB A;  3BRU A;  3VVZ A;  3BHQ A;  2QCO A;  2GUH A;  4JNN A;  3SDG A;  3G56 A;  2UXP A;  4HKU A;  3FK7 A;  2XB5 A;  4M3E A;  2G7G A;  3C07 A;  2IU5 A;  2O7O A;  2PZ9 A;  2TCT A;  2NX4 A;  3VVX A;  5GPC A;  3JSJ A;  2W53 A;  5D19 A;  3BR5 A;  3FK6 A;  2V57 A;  1ZK8 A;  2VPR A;  2YVE A;  2ZOY A;  2YVH A;  2OPT A;  3ON4 A;  4ACI A;  3ANP A;  5FMP A;  2DG7 A;  5EZG A;  4MK6 A;  2QWT A;  2XGD A;  3WHC A;  4V2G A;  2EH3 A;  2PBX A;  3HTI A;  3QKX A;  4GCT A;  3LJL A;  2IEK A;  3IH3 A;  1Z0X A;  2OF7 A;  2OER A;  4XK4 A;  3E7Q A;  3LWJ A;  2WGB A;  2HKU A;  3V6G A;  3PM1 A;  4ABZ A;  4B3A A;  4D5F A;  3RD3 A;  2GBY A;  3QPS A;  3C2B A;  3BQZ A;  5EFY A;  3Q0U A;  2UXU A;  1ZKG A;  3EGQ A;  3KKC A;  3KZ9 A;  2HXO A;  2G0E A;  2REK A;  3F0C A;  2GFN A;  4UDS A;  5FKL A;  1UI6 A;  5IOZ A;  5K7F A;  4YZE A;  3BTJ A;  3BNI A;  5IPA A;  3O8H A;  3HIM A;  3BQY A;  3VUQ A;  3EUP A;  2FX0 A;  3NXC A;  3AQS A;  3BR3 A;  1U9O A;  3VW1 A;  2FQ4 A;  3ZQG A;  3HGG A;  4D5C A;  5FKN A;  4V2F A;  2QKO A;  5EYR A;  5F08 A;  4G12 A;  3KNW A;  3BR2 A;  1T33 A;  5J3L A;  1VI0 A;  3HE0 A;  2HXI A;  3BT9 A;  5D18 A;  3LHQ A;  3LOC A;  4M3B A;  2UXH A;  2RHA A;  3TP3 A;  2GEN A;  4L62 A;  4MXM A;  4W97 A;  3FIW A;  2XPV A;  3CJD A;  4M3G A;  2XDN A;  2DG8 A;  2OI8 A;  5GP9 A;  2VKE A;  4KWA A;  5F1J A;  3V78 A;  2Y31 A;  2QIB A;  4W1U A;  5J1R A;  3B6A A;  5CXG A;  3NNR A;  3LSJ A;  3COL A;  3PAS A;  5F27 A;  2WV1 A;  1A6I A;  3IH2 A;  2ZCN A;  3GZI A;  2XGE A;  4DW6 A;  1JUS A;  2XGC A;  3BTC A;  4AUX A;  3IH4 A;  3VOK A;  2HYT A;  2G3B A;  1RPW A;  3MVP A;  2QTQ A;  3ZQH A;  3TP0 A;  2XRL A;  3ZQI A;  3VP5 A;  3G1O A;  1RKT A;  3Q0W A;  3SFI A;  2G7L A;  2HQ5 A;  5FKO A;  5K7Z A;  3BR0 A;  3VIB A;  3DCF A;  4D7N A;  1JTY A;  4D7M A;  1SGM A;  1QPI A;  1BJZ A;  2ZOZ A;  5K7H A;  5H9T A;  5HAW A;  3ANG A;  2NS7 A;  4GCK A;  2ZB9 A;  3BR6 A;  4AC6 A;  3LSR A;  3P9T A;  3BJB A;  3S5R A;  3B81 A;  3HGY A;  4I6Z A;  2NS8 A;  2ID3 A;  5F0H A;  3BR1 A;  3QPL A;  3DPJ A;  3BTL A;  4I76 A;  5F0C A;  3VOX A;  2ID6 A;  4JKZ A;  3NRG A;  1RKW A;  4ICH A;  1Z77 A;  4B1R A;  3HTJ A;  5J1Y A;  4JYK A;  3WHB A;  5GPA A;  3ZQL A;  2O7T A;  3IUV A;  3VW0 A;  3G7R A;  5FKM A;  2Q24 A;  3ZQF A;  3QQA A;  2NP5 A;  3Q3S A;  3NI7 A;  5FHP A;  2FJ1 A;  2ZCM A;  3O8G A;  4JL3 A;  1UI5 A;  5D1R A;  4M3F A;  1JUM A;  3KKD A;  4AF5 A;  3G1L A;  3CWR A;  3VPR A;  2XPW A;  5K58 A;  3NPI A;  3G1M A;  2NP3 A;  2RAE A;  5CXI A;  3DEW A;  2FBQ A;  2WUI A;  2F07 A;  2JK3 A;  3F1B A;  3QBM A;  2XPU A;  1JUP A;  3RH2 A;  1U9N A;  4X1E A;  2Y30 A;  1JTX A;  4MO7 A;  2D6Y A;  4NEL A;  2UXO A;  4ME9 A;  3VW2 A;  5HSZ A;  2VKV A;  3Q0V A;  4GFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...