2WGBA

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
175
Chain Sequence
b'SGARERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASPEYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
molecule tags Transcription
source organism Mycobacterium smegmatis
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
total genus 62
structure length 175
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2wgbA00
2DTZA 4CGRA 3FRQA 3O8GA 1JUSA 2GBYA 3QKXA 2O7TA 2O7OA 3Q3SA 2XPWA 3FK6A 2IBDA 2WUIA 3TP0A 3BR2A 2RAEA 2VKEA 2UXHA 4B3AA 3AQSA 3BRUA 2TRTA 3IUVA 3ANPA 5EYRA 3GZIA 5J3LA 2FD5A 2NX4A 2GUHA 2F07A 5F0CA 3NRGA 4W97A 2XPUA 2IAIA 3NNRA 4AUXA 4M3BA 3B81A 4V2GA 2XRLA 3GEUA 2JJ7A 3CCYA 5HBUA 3V78A 3C07A 1UI5A 3LSRA 2OPTA 5HAWA 4MXMA 5J1UA 3VVZA 3C2BA 2ZCMA 3HTIA 1JTYA 3G1LA 5D19A 1T56A 4NELA 3BTCA 3JSJA 2QCOA 1A6IA 1JUMA 2IU5A 3KNWA 4D5CA 5IOYA 3BHQA 2DG8A 2WGBA 1QPIA 2PBXA 2XGCA 5K7HA 3FK7A 3ON4A 4HKUA 3KKDA 1Z77A 3LHQA 3MVPA 3BR5A 4AF5A 2VPRA 3BCGA 2OERA 2ID6A 3CRJA 3ON2A 3BNIA 2ZCNA 3KZ9A 3E7QA 3LJLA 3QPLA 4JL3A 4DW6A 3VOKA 2X6OA 3G1MA 3T6NA 2GFNA 2XGDA 2RHAA 2HYTA 4W1UA 2HXOA 3WHBA 2UXUA 2ZB9A 1RKWA 3DEWA 3VVXA 1T33A 2Y2ZA 4ACIA 1RPWA 3IH2A 3VW2A 5HSZA 3NPIA 1Z0XA 4KWAA 3HTHA 5CXGA 2D6YA 3CDLA 5FKKA 2JK3A 4D7NA 5F0HA 4GCTA 3ZQHA 1RKTA 2YVEA 2ID3A 3LOCA 1UI6A 3ZQLA 3DCFA 4NN1A 3PM1A 4AC6A 2DG7A 2FBQA 4ICHA 1ZK8A 2PZ9A 3Q0WA 2QOPA 5C4YA 2Y30A 4I6ZA 3BJBA 2UXOA 5EZGA 1ZKGA 3HIMA 4L62A 4B1RA 4M3DA 5EFYA 1JT6A 2HXIA 3CJDA 4D5FA 3LSPA 3HGYA 2QKOA 3HGGA 4MO7A 5CW8A 5F04A 2Y31A 2W53A 3O8HA 3NI7A 4M3FA 5GPCA 2GENA 2YVHA 3G7RA 2RASA 3Q0UA 2NP3A 3F1BA 2ZCXA 2X9DA 2QWTA 2NP5A 3ZQIA 1U9NA 3SFIA 3WHCA 2QIBA 4GCKA 3BR1A 3DPJA 2XB5A 3B6AA 2REKA 3HTAA 3PPBA 4MK6A 4JKZA 4ME9A 3BQZA 2VKVA 5GP9A 4X1EA 4V2FA 2ZOYA 3RH2A 3RD3A 5F08A 2NS7A 5IP6A 3QBMA 2I10A 5IPAA 3SDGA 1JT0A 2Q24A 5F27A 3VVYA 3BT9A 4GCLA 3MNLA 3QPSA 3O60A 5D1RA 3G56A 5FGLA 5FKLA 5FKMA 3VIBA 3AQTA 2TCTA 2NS8A 3VOXA 4PXIA 4M3EA 3HE0A 3QQAA 3Q0VA 3TP3A 5K7FA 1QVTA 3ZQFA 4JNNA 3V6GA 5K7ZA 2IEKA 3BTLA 2XPVA 5FKNA 2HKUA 4AC0A 1U9OA 1BJZA 3EUPA 3F0CA 3BR0A 4I76A 2FQ4A 2HYJA 3NXCA 1JUPA 4GFKA 3VW1A 3VUQA 4YZEA 1JTXA 5AQCA 3COLA 2OI8A 2ZOZA 2QTQA 3PASA 5FKOA 5CXIA 3FIWA 4G12A 3HTJA 2XDNA 3VW0A 2XGEA 3EGQA 4UDSA 5IOZA 3VPRA 5K58A 4XK4A 3VP5A 5DAJA 2OF7A 5GPAA 5H9TA 3BTJA 2G7GA 2FJ1A 3BTIA 5J1YA 3S5RA 2G7SA 3CWRA 3BR6A 2WV1A 2FX0A 1VI0A 4ABZA 3ZQGA 2UXPA 3BQYA 3LSJA 5EZHA 2G7LA 5D18A 4GFLA 4M3GA 5FMPA 2G3BA 4D7MA 3IH3A 3IH4A 3P9TA 1ORKA 3KKCA 5FHPA 5F1JA 5J1RA 5F0FA 3G1OA 3BR3A 2HQ5A 2G0EA 2UXIA 3ANGA 1SGMA 1QVUA 2EH3A 4JYKA 3LWJA 2V57A 3B6CA
chains in the Genus database with same CATH superfamily
2ZY9A 2DTZA 4CGRA 3FRQA 3O8GA 2R7OA 1JUSA 2GBYA 3QKXA 2O7TA 2O7OA 3Q3SA 2XPWA 3FK6A 3FHNA 2IBDA 2WUIA 4IRVA 3BR2A 3TP0A 2RAEA 2VKEA 2UXHA 4B3AA 3AQSA 3BRUA 2TRTA 3IUVA 3ANPA 5EYRA 3GZIA 5J3LA 2FD5A 2NX4A 2GUHA 2F07A 5F0CA 3NRGA 4W97A 2XPUA 2A2FX 2IAIA 3NNRA 4AUXA 4M3BA 3B81A 4V2GA 2XRLA 2B1EA 3GEUA 4OD4A 2JJ7A 3CCYA 5HBUA 3V78A 3C07A 1UI5A 3LSRA 2OPTA 5HAWA 4MXMA 5J1UA 3VVZA 3C2BA 2ZCMA 3HTIA 1JTYA 3G1LA 5D19A 1T56A 4NELA 3BTCA 3JSJA 2QCOA 1A6IA 1JUMA 2R7WA 2IU5A 3KNWA 4D5CA 5IOYA 3BHQA 2DG8A 2WGBA 1QPIA 2PBXA 2XGCA 5K7HA 3FK7A 3ON4A 4HKUA 4WIBA 3KKDA 1Z77A 3LHQA 3MVPA 3BR5A 4AF5A 2VPRA 3BCGA 2OERA 2ID6A 3CRJA 3ON2A 3BNIA 2ZCNA 3KZ9A 3E7QA 3LJLA 3QPLA 4JL3A 4DW6A 3VOKA 2X6OA 3G1MA 3T6NA 3DU5A 2GFNA 2XGDA 2RHAA 2HYTA 4W1UA 2HXOA 3WHBA 2UXUA 2ZB9A 1RKWA 3DEWA 3VVXA 1T33A 2Y2ZA 4ACIA 1RPWA 3IH2A 3VW2A 5HSZA 3NPIA 1Z0XA 4KWAA 3HTHA 5CXGA 2D6YA 3CDLA 5FKKA 2JK3A 4D7NA 5F0HA 4GCTA 3ZQHA 1RKTA 2YVEA 2ID3A 3LOCA 1UI6A 3ZQLA 3DCFA 4NN1A 3PM1A 4AC6A 2DG7A 2FBQA 4ICHA 4C2MA 1ZK8A 2PZ9A 3Q0WA 2QOPA 5C4YA 2Y30A 4I6ZA 3BJBA 2UXOA 4U9NA 5EZGA 1ZKGA 3HIMA 4L62A 4B1RA 4M3DA 5EFYA 1JT6A 2R7XA 2R7RA 2HXIA 3CJDA 4D5FA 3LSPA 3HGYA 2QKOA 3HGGA 4MO7A 5CW8A 5F04A 2Y31A 2W53A 3O8HA 3NI7A 4M3FA 5GPCA 3KYLA 2GENA 2YVHA 3G7RA 2RASA 2B3WA 3Q0UA 2NP3A 3F1BA 2ZCXA 2X9DA 2QWTA 2NP5A 3ZQIA 1U9NA 3SFIA 3WHCA 2QIBA 4GCKA 5CQGA 2R7UA 3BR1A 3DPJA 2XB5A 3B6AA 2REKA 3HTAA 3PPBA 4MK6A 4JKZA 4ME9A 3BQZA 2VKVA 5GP9A 4X1EA 4V2FA 2ZOYA 3RH2A 3RD3A 5F08A 2NS7A 2PFVA 5IP6A 3QBMA 2I10A 5IPAA 3SDGA 2FJI1 1JT0A 2Q24A 5F27A 3VVYA 3BT9A 4GCLA 3MNLA 3QPSA 3O60A 5D1RA 3G56A 2R7TA 5FGLA 2R7SA 5FKLA 4OD5A 5FKMA 3VIBA 3AQTA 2TCTA 3NS4A 2NS8A 3VOXA 4PXIA 4M3EA 3TP3A 3HE0A 3QQAA 3Q0VA 5K7FA 2R7VA 1QVTA 3ZQFA 4JNNA 3V6GA 5K7ZA 2IEKA 3BTLA 2XPVA 5FKNA 2HKUA 4AC0A 1U9OA 1BJZA 3EUPA 3F0CA 3BR0A 4I76A 2FQ4A 2HYJA 3NXCA 1JUPA 4GFKA 3VW1A 2YVXA 3VUQA 4YZEA 1JTXA 5AQCA 3COLA 3DU6A 2OI8A 2ZOZA 2QTQA 3PASA 3K8PC 5FKOA 5CXIA 3FIWA 4G12A 3HTJA 3SWHA 2XDNA 3VW0A 2XGEA 3EGQA 4UDSA 4U9LA 5IOZA 4DVYP 3VPRA 5K58A 4XK4A 3VP5A 5DAJA 2OF7A 5GPAA 5H9TA 3BTJA 2G7GA 2FJ1A 3BTIA 5J1YA 3S5RA 2G7SA 3CWRA 3BR6A 2WV1A 2FX0A 1VI0A 4ABZA 3ZQGA 2UXPA 3BQYA 3LSJA 5EZHA 2G7LA 5D18A 4GFLA 4M3GA 5FMPA 2G3BA 4D7MA 3IH3A 3IH4A 3P9TA 1ORKA 3KKCA 5FHPA 2R7QA 3VTIA 5F1JA 5J1RA 5F0FA 3G1OA 3BR3A 2HQ5A 2G0EA 2UXIA 3ANGA 1SGMA 1QVUA 2EH3A 4JYKA 3LWJA 2V57A 3B6CA
chains in the Genus database with same CATH topology
2DTZA 4CGRA 3FRQA 3O8GA 1JUSA 2GBYA 3QKXA 2O7TA 2O7OA 3Q3SA 2XPWA 3FK6A 2IBDA 2WUIA 3TP0A 3BR2A 2RAEA 2VKEA 2UXHA 4B3AA 3AQSA 3BRUA 2TRTA 3IUVA 3ANPA 5EYRA 3GZIA 5J3LA 2FD5A 2NX4A 2GUHA 2F07A 5F0CA 3NRGA 4W97A 2XPUA 2IAIA 3NNRA 4AUXA 4M3BA 3B81A 4V2GA 2XRLA 3GEUA 2JJ7A 3CCYA 5HBUA 3V78A 3C07A 1UI5A 3LSRA 2OPTA 5HAWA 4MXMA 5J1UA 3VVZA 3C2BA 2ZCMA 3HTIA 1JTYA 3G1LA 5D19A 1T56A 4NELA 3BTCA 3JSJA 2QCOA 1A6IA 1JUMA 2IU5A 3KNWA 4D5CA 5IOYA 3BHQA 2DG8A 2WGBA 1QPIA 2PBXA 2XGCA 5K7HA 3FK7A 3ON4A 4HKUA 3KKDA 1Z77A 3LHQA 3MVPA 3BR5A 4AF5A 2VPRA 3BCGA 2OERA 2ID6A 3CRJA 3ON2A 3BNIA 2ZCNA 3KZ9A 3E7QA 3LJLA 3QPLA 4JL3A 4DW6A 3VOKA 2X6OA 3G1MA 3T6NA 2GFNA 2XGDA 2RHAA 2HYTA 4W1UA 2HXOA 3WHBA 2UXUA 2ZB9A 1RKWA 3DEWA 3VVXA 1T33A 2Y2ZA 4ACIA 1RPWA 3IH2A 3VW2A 5HSZA 3NPIA 1Z0XA 4KWAA 3HTHA 5CXGA 2D6YA 3CDLA 5FKKA 2JK3A 4D7NA 5F0HA 4GCTA 3ZQHA 1RKTA 2YVEA 2ID3A 3LOCA 1UI6A 3ZQLA 3DCFA 4NN1A 3PM1A 4AC6A 2DG7A 2FBQA 4ICHA 1ZK8A 2PZ9A 3Q0WA 2QOPA 5C4YA 2Y30A 4I6ZA 3BJBA 2UXOA 5EZGA 1ZKGA 3HIMA 4L62A 4B1RA 4M3DA 5EFYA 1JT6A 2HXIA 3CJDA 4D5FA 3LSPA 3HGYA 2QKOA 3HGGA 4MO7A 5CW8A 5F04A 2Y31A 2W53A 3O8HA 3NI7A 4M3FA 5GPCA 2GENA 2YVHA 3G7RA 2RASA 3Q0UA 2NP3A 3F1BA 2ZCXA 2X9DA 2QWTA 2NP5A 3ZQIA 1U9NA 3SFIA 3WHCA 2QIBA 4GCKA 3BR1A 3DPJA 2XB5A 3B6AA 2REKA 3HTAA 3PPBA 4MK6A 4JKZA 4ME9A 3BQZA 2VKVA 5GP9A 4X1EA 4V2FA 2ZOYA 3RH2A 3RD3A 5F08A 2NS7A 5IP6A 3QBMA 2I10A 5IPAA 3SDGA 1JT0A 2Q24A 5F27A 3VVYA 3BT9A 4GCLA 3MNLA 3QPSA 3O60A 5D1RA 3G56A 5FGLA 5FKLA 5FKMA 3VIBA 3AQTA 2TCTA 2NS8A 3VOXA 4PXIA 4M3EA 3HE0A 3QQAA 3Q0VA 3TP3A 5K7FA 1QVTA 3ZQFA 4JNNA 3V6GA 5K7ZA 2IEKA 3BTLA 2XPVA 5FKNA 2HKUA 4AC0A 1U9OA 1BJZA 3EUPA 3F0CA 3BR0A 4I76A 2FQ4A 2HYJA 3NXCA 1JUPA 4GFKA 3VW1A 3VUQA 4YZEA 1JTXA 5AQCA 3COLA 2OI8A 2ZOZA 2QTQA 3PASA 5FKOA 5CXIA 3FIWA 4G12A 3HTJA 2XDNA 3VW0A 2XGEA 3EGQA 4UDSA 5IOZA 3VPRA 5K58A 4XK4A 3VP5A 5DAJA 2OF7A 5GPAA 5H9TA 3BTJA 2G7GA 2FJ1A 3BTIA 5J1YA 3S5RA 2G7SA 3CWRA 3BR6A 2WV1A 2FX0A 1VI0A 4ABZA 3ZQGA 2UXPA 3BQYA 3LSJA 5EZHA 2G7LA 5D18A 4GFLA 4M3GA 5FMPA 2G3BA 4D7MA 3IH3A 3IH4A 3P9TA 1ORKA 3KKCA 5FHPA 5F1JA 5J1RA 5F0FA 3G1OA 3BR3A 2HQ5A 2G0EA 2UXIA 3ANGA 1SGMA 1QVUA 2EH3A 4JYKA 3LWJA 2V57A 3B6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTZ A;  4CGR A;  3FRQ A;  3O8G A;  1JUS A;  2GBY A;  3QKX A;  2O7T A;  2O7O A;  3Q3S A;  2XPW A;  3FK6 A;  2IBD A;  2WUI A;  3TP0 A;  3BR2 A;  2RAE A;  2VKE A;  2UXH A;  4B3A A;  3AQS A;  3BRU A;  2TRT A;  3IUV A;  3ANP A;  5EYR A;  3GZI A;  5J3L A;  2FD5 A;  2NX4 A;  2GUH A;  2F07 A;  5F0C A;  3NRG A;  4W97 A;  2XPU A;  2IAI A;  3NNR A;  4AUX A;  4M3B A;  3B81 A;  4V2G A;  2XRL A;  3GEU A;  2JJ7 A;  3CCY A;  5HBU A;  3V78 A;  3C07 A;  1UI5 A;  3LSR A;  2OPT A;  5HAW A;  4MXM A;  5J1U A;  3VVZ A;  3C2B A;  2ZCM A;  3HTI A;  1JTY A;  3G1L A;  5D19 A;  1T56 A;  4NEL A;  3BTC A;  3JSJ A;  2QCO A;  1A6I A;  1JUM A;  2IU5 A;  3KNW A;  4D5C A;  5IOY A;  3BHQ A;  2DG8 A;  2WGB A;  1QPI A;  2PBX A;  2XGC A;  5K7H A;  3FK7 A;  3ON4 A;  4HKU A;  3KKD A;  1Z77 A;  3LHQ A;  3MVP A;  3BR5 A;  4AF5 A;  2VPR A;  3BCG A;  2OER A;  2ID6 A;  3CRJ A;  3ON2 A;  3BNI A;  2ZCN A;  3KZ9 A;  3E7Q A;  3LJL A;  3QPL A;  4JL3 A;  4DW6 A;  3VOK A;  2X6O A;  3G1M A;  3T6N A;  2GFN A;  2XGD A;  2RHA A;  2HYT A;  4W1U A;  2HXO A;  3WHB A;  2UXU A;  2ZB9 A;  1RKW A;  3DEW A;  3VVX A;  1T33 A;  2Y2Z A;  4ACI A;  1RPW A;  3IH2 A;  3VW2 A;  5HSZ A;  3NPI A;  1Z0X A;  4KWA A;  3HTH A;  5CXG A;  2D6Y A;  3CDL A;  5FKK A;  2JK3 A;  4D7N A;  5F0H A;  4GCT A;  3ZQH A;  1RKT A;  2YVE A;  2ID3 A;  3LOC A;  1UI6 A;  3ZQL A;  3DCF A;  4NN1 A;  3PM1 A;  4AC6 A;  2DG7 A;  2FBQ A;  4ICH A;  1ZK8 A;  2PZ9 A;  3Q0W A;  2QOP A;  5C4Y A;  2Y30 A;  4I6Z A;  3BJB A;  2UXO A;  5EZG A;  1ZKG A;  3HIM A;  4L62 A;  4B1R A;  4M3D A;  5EFY A;  1JT6 A;  2HXI A;  3CJD A;  4D5F A;  3LSP A;  3HGY A;  2QKO A;  3HGG A;  4MO7 A;  5CW8 A;  5F04 A;  2Y31 A;  2W53 A;  3O8H A;  3NI7 A;  4M3F A;  5GPC A;  2GEN A;  2YVH A;  3G7R A;  2RAS A;  3Q0U A;  2NP3 A;  3F1B A;  2ZCX A;  2X9D A;  2QWT A;  2NP5 A;  3ZQI A;  1U9N A;  3SFI A;  3WHC A;  2QIB A;  4GCK A;  3BR1 A;  3DPJ A;  2XB5 A;  3B6A A;  2REK A;  3HTA A;  3PPB A;  4MK6 A;  4JKZ A;  4ME9 A;  3BQZ A;  2VKV A;  5GP9 A;  4X1E A;  4V2F A;  2ZOY A;  3RH2 A;  3RD3 A;  5F08 A;  2NS7 A;  5IP6 A;  3QBM A;  2I10 A;  5IPA A;  3SDG A;  1JT0 A;  2Q24 A;  5F27 A;  3VVY A;  3BT9 A;  4GCL A;  3MNL A;  3QPS A;  3O60 A;  5D1R A;  3G56 A;  5FGL A;  5FKL A;  5FKM A;  3VIB A;  3AQT A;  2TCT A;  2NS8 A;  3VOX A;  4PXI A;  4M3E A;  3HE0 A;  3QQA A;  3Q0V A;  3TP3 A;  5K7F A;  1QVT A;  3ZQF A;  4JNN A;  3V6G A;  5K7Z A;  2IEK A;  3BTL A;  2XPV A;  5FKN A;  2HKU A;  4AC0 A;  1U9O A;  1BJZ A;  3EUP A;  3F0C A;  3BR0 A;  4I76 A;  2FQ4 A;  2HYJ A;  3NXC A;  1JUP A;  4GFK A;  3VW1 A;  3VUQ A;  4YZE A;  1JTX A;  5AQC A;  3COL A;  2OI8 A;  2ZOZ A;  2QTQ A;  3PAS A;  5FKO A;  5CXI A;  3FIW A;  4G12 A;  3HTJ A;  2XDN A;  3VW0 A;  2XGE A;  3EGQ A;  4UDS A;  5IOZ A;  3VPR A;  5K58 A;  4XK4 A;  3VP5 A;  5DAJ A;  2OF7 A;  5GPA A;  5H9T A;  3BTJ A;  2G7G A;  2FJ1 A;  3BTI A;  5J1Y A;  3S5R A;  2G7S A;  3CWR A;  3BR6 A;  2WV1 A;  2FX0 A;  1VI0 A;  4ABZ A;  3ZQG A;  2UXP A;  3BQY A;  3LSJ A;  5EZH A;  2G7L A;  5D18 A;  4GFL A;  4M3G A;  5FMP A;  2G3B A;  4D7M A;  3IH3 A;  3IH4 A;  3P9T A;  1ORK A;  3KKC A;  5FHP A;  5F1J A;  5J1R A;  5F0F A;  3G1O A;  3BR3 A;  2HQ5 A;  2G0E A;  2UXI A;  3ANG A;  1SGM A;  1QVU A;  2EH3 A;  4JYK A;  3LWJ A;  2V57 A;  3B6C A; 
#chains in the Genus database with same CATH topology
 2ZY9 A;  2DTZ A;  4CGR A;  3FRQ A;  3O8G A;  2R7O A;  1JUS A;  2GBY A;  3QKX A;  2O7T A;  2O7O A;  3Q3S A;  2XPW A;  3FK6 A;  3FHN A;  2IBD A;  2WUI A;  4IRV A;  3BR2 A;  3TP0 A;  2RAE A;  2VKE A;  2UXH A;  4B3A A;  3AQS A;  3BRU A;  2TRT A;  3IUV A;  3ANP A;  5EYR A;  3GZI A;  5J3L A;  2FD5 A;  2NX4 A;  2GUH A;  2F07 A;  5F0C A;  3NRG A;  4W97 A;  2XPU A;  2A2F X;  2IAI A;  3NNR A;  4AUX A;  4M3B A;  3B81 A;  4V2G A;  2XRL A;  2B1E A;  3GEU A;  4OD4 A;  2JJ7 A;  3CCY A;  5HBU A;  3V78 A;  3C07 A;  1UI5 A;  3LSR A;  2OPT A;  5HAW A;  4MXM A;  5J1U A;  3VVZ A;  3C2B A;  2ZCM A;  3HTI A;  1JTY A;  3G1L A;  5D19 A;  1T56 A;  4NEL A;  3BTC A;  3JSJ A;  2QCO A;  1A6I A;  1JUM A;  2R7W A;  2IU5 A;  3KNW A;  4D5C A;  5IOY A;  3BHQ A;  2DG8 A;  2WGB A;  1QPI A;  2PBX A;  2XGC A;  5K7H A;  3FK7 A;  3ON4 A;  4HKU A;  4WIB A;  3KKD A;  1Z77 A;  3LHQ A;  3MVP A;  3BR5 A;  4AF5 A;  2VPR A;  3BCG A;  2OER A;  2ID6 A;  3CRJ A;  3ON2 A;  3BNI A;  2ZCN A;  3KZ9 A;  3E7Q A;  3LJL A;  3QPL A;  4JL3 A;  4DW6 A;  3VOK A;  2X6O A;  3G1M A;  3T6N A;  3DU5 A;  2GFN A;  2XGD A;  2RHA A;  2HYT A;  4W1U A;  2HXO A;  3WHB A;  2UXU A;  2ZB9 A;  1RKW A;  3DEW A;  3VVX A;  1T33 A;  2Y2Z A;  4ACI A;  1RPW A;  3IH2 A;  3VW2 A;  5HSZ A;  3NPI A;  1Z0X A;  4KWA A;  3HTH A;  5CXG A;  2D6Y A;  3CDL A;  5FKK A;  2JK3 A;  4D7N A;  5F0H A;  4GCT A;  3ZQH A;  1RKT A;  2YVE A;  2ID3 A;  3LOC A;  1UI6 A;  3ZQL A;  3DCF A;  4NN1 A;  3PM1 A;  4AC6 A;  2DG7 A;  2FBQ A;  4ICH A;  4C2M A;  1ZK8 A;  2PZ9 A;  3Q0W A;  2QOP A;  5C4Y A;  2Y30 A;  4I6Z A;  3BJB A;  2UXO A;  4U9N A;  5EZG A;  1ZKG A;  3HIM A;  4L62 A;  4B1R A;  4M3D A;  5EFY A;  1JT6 A;  2R7X A;  2R7R A;  2HXI A;  3CJD A;  4D5F A;  3LSP A;  3HGY A;  2QKO A;  3HGG A;  4MO7 A;  5CW8 A;  5F04 A;  2Y31 A;  2W53 A;  3O8H A;  3NI7 A;  4M3F A;  5GPC A;  3KYL A;  2GEN A;  2YVH A;  3G7R A;  2RAS A;  2B3W A;  3Q0U A;  2NP3 A;  3F1B A;  2ZCX A;  2X9D A;  2QWT A;  2NP5 A;  3ZQI A;  1U9N A;  3SFI A;  3WHC A;  2QIB A;  4GCK A;  5CQG A;  2R7U A;  3BR1 A;  3DPJ A;  2XB5 A;  3B6A A;  2REK A;  3HTA A;  3PPB A;  4MK6 A;  4JKZ A;  4ME9 A;  3BQZ A;  2VKV A;  5GP9 A;  4X1E A;  4V2F A;  2ZOY A;  3RH2 A;  3RD3 A;  5F08 A;  2NS7 A;  2PFV A;  5IP6 A;  3QBM A;  2I10 A;  5IPA A;  3SDG A;  2FJI 1;  1JT0 A;  2Q24 A;  5F27 A;  3VVY A;  3BT9 A;  4GCL A;  3MNL A;  3QPS A;  3O60 A;  5D1R A;  3G56 A;  2R7T A;  5FGL A;  2R7S A;  5FKL A;  4OD5 A;  5FKM A;  3VIB A;  3AQT A;  2TCT A;  3NS4 A;  2NS8 A;  3VOX A;  4PXI A;  4M3E A;  3TP3 A;  3HE0 A;  3QQA A;  3Q0V A;  5K7F A;  2R7V A;  1QVT A;  3ZQF A;  4JNN A;  3V6G A;  5K7Z A;  2IEK A;  3BTL A;  2XPV A;  5FKN A;  2HKU A;  4AC0 A;  1U9O A;  1BJZ A;  3EUP A;  3F0C A;  3BR0 A;  4I76 A;  2FQ4 A;  2HYJ A;  3NXC A;  1JUP A;  4GFK A;  3VW1 A;  2YVX A;  3VUQ A;  4YZE A;  1JTX A;  5AQC A;  3COL A;  3DU6 A;  2OI8 A;  2ZOZ A;  2QTQ A;  3PAS A;  3K8P C;  5FKO A;  5CXI A;  3FIW A;  4G12 A;  3HTJ A;  3SWH A;  2XDN A;  3VW0 A;  2XGE A;  3EGQ A;  4UDS A;  4U9L A;  5IOZ A;  4DVY P;  3VPR A;  5K58 A;  4XK4 A;  3VP5 A;  5DAJ A;  2OF7 A;  5GPA A;  5H9T A;  3BTJ A;  2G7G A;  2FJ1 A;  3BTI A;  5J1Y A;  3S5R A;  2G7S A;  3CWR A;  3BR6 A;  2WV1 A;  2FX0 A;  1VI0 A;  4ABZ A;  3ZQG A;  2UXP A;  3BQY A;  3LSJ A;  5EZH A;  2G7L A;  5D18 A;  4GFL A;  4M3G A;  5FMP A;  2G3B A;  4D7M A;  3IH3 A;  3IH4 A;  3P9T A;  1ORK A;  3KKC A;  5FHP A;  2R7Q A;  3VTI A;  5F1J A;  5J1R A;  5F0F A;  3G1O A;  3BR3 A;  2HQ5 A;  2G0E A;  2UXI A;  3ANG A;  1SGM A;  1QVU A;  2EH3 A;  4JYK A;  3LWJ A;  2V57 A;  3B6C A; 
#chains in the Genus database with same CATH homology
 2DTZ A;  4CGR A;  3FRQ A;  3O8G A;  1JUS A;  2GBY A;  3QKX A;  2O7T A;  2O7O A;  3Q3S A;  2XPW A;  3FK6 A;  2IBD A;  2WUI A;  3TP0 A;  3BR2 A;  2RAE A;  2VKE A;  2UXH A;  4B3A A;  3AQS A;  3BRU A;  2TRT A;  3IUV A;  3ANP A;  5EYR A;  3GZI A;  5J3L A;  2FD5 A;  2NX4 A;  2GUH A;  2F07 A;  5F0C A;  3NRG A;  4W97 A;  2XPU A;  2IAI A;  3NNR A;  4AUX A;  4M3B A;  3B81 A;  4V2G A;  2XRL A;  3GEU A;  2JJ7 A;  3CCY A;  5HBU A;  3V78 A;  3C07 A;  1UI5 A;  3LSR A;  2OPT A;  5HAW A;  4MXM A;  5J1U A;  3VVZ A;  3C2B A;  2ZCM A;  3HTI A;  1JTY A;  3G1L A;  5D19 A;  1T56 A;  4NEL A;  3BTC A;  3JSJ A;  2QCO A;  1A6I A;  1JUM A;  2IU5 A;  3KNW A;  4D5C A;  5IOY A;  3BHQ A;  2DG8 A;  2WGB A;  1QPI A;  2PBX A;  2XGC A;  5K7H A;  3FK7 A;  3ON4 A;  4HKU A;  3KKD A;  1Z77 A;  3LHQ A;  3MVP A;  3BR5 A;  4AF5 A;  2VPR A;  3BCG A;  2OER A;  2ID6 A;  3CRJ A;  3ON2 A;  3BNI A;  2ZCN A;  3KZ9 A;  3E7Q A;  3LJL A;  3QPL A;  4JL3 A;  4DW6 A;  3VOK A;  2X6O A;  3G1M A;  3T6N A;  2GFN A;  2XGD A;  2RHA A;  2HYT A;  4W1U A;  2HXO A;  3WHB A;  2UXU A;  2ZB9 A;  1RKW A;  3DEW A;  3VVX A;  1T33 A;  2Y2Z A;  4ACI A;  1RPW A;  3IH2 A;  3VW2 A;  5HSZ A;  3NPI A;  1Z0X A;  4KWA A;  3HTH A;  5CXG A;  2D6Y A;  3CDL A;  5FKK A;  2JK3 A;  4D7N A;  5F0H A;  4GCT A;  3ZQH A;  1RKT A;  2YVE A;  2ID3 A;  3LOC A;  1UI6 A;  3ZQL A;  3DCF A;  4NN1 A;  3PM1 A;  4AC6 A;  2DG7 A;  2FBQ A;  4ICH A;  1ZK8 A;  2PZ9 A;  3Q0W A;  2QOP A;  5C4Y A;  2Y30 A;  4I6Z A;  3BJB A;  2UXO A;  5EZG A;  1ZKG A;  3HIM A;  4L62 A;  4B1R A;  4M3D A;  5EFY A;  1JT6 A;  2HXI A;  3CJD A;  4D5F A;  3LSP A;  3HGY A;  2QKO A;  3HGG A;  4MO7 A;  5CW8 A;  5F04 A;  2Y31 A;  2W53 A;  3O8H A;  3NI7 A;  4M3F A;  5GPC A;  2GEN A;  2YVH A;  3G7R A;  2RAS A;  3Q0U A;  2NP3 A;  3F1B A;  2ZCX A;  2X9D A;  2QWT A;  2NP5 A;  3ZQI A;  1U9N A;  3SFI A;  3WHC A;  2QIB A;  4GCK A;  3BR1 A;  3DPJ A;  2XB5 A;  3B6A A;  2REK A;  3HTA A;  3PPB A;  4MK6 A;  4JKZ A;  4ME9 A;  3BQZ A;  2VKV A;  5GP9 A;  4X1E A;  4V2F A;  2ZOY A;  3RH2 A;  3RD3 A;  5F08 A;  2NS7 A;  5IP6 A;  3QBM A;  2I10 A;  5IPA A;  3SDG A;  1JT0 A;  2Q24 A;  5F27 A;  3VVY A;  3BT9 A;  4GCL A;  3MNL A;  3QPS A;  3O60 A;  5D1R A;  3G56 A;  5FGL A;  5FKL A;  5FKM A;  3VIB A;  3AQT A;  2TCT A;  2NS8 A;  3VOX A;  4PXI A;  4M3E A;  3HE0 A;  3QQA A;  3Q0V A;  3TP3 A;  5K7F A;  1QVT A;  3ZQF A;  4JNN A;  3V6G A;  5K7Z A;  2IEK A;  3BTL A;  2XPV A;  5FKN A;  2HKU A;  4AC0 A;  1U9O A;  1BJZ A;  3EUP A;  3F0C A;  3BR0 A;  4I76 A;  2FQ4 A;  2HYJ A;  3NXC A;  1JUP A;  4GFK A;  3VW1 A;  3VUQ A;  4YZE A;  1JTX A;  5AQC A;  3COL A;  2OI8 A;  2ZOZ A;  2QTQ A;  3PAS A;  5FKO A;  5CXI A;  3FIW A;  4G12 A;  3HTJ A;  2XDN A;  3VW0 A;  2XGE A;  3EGQ A;  4UDS A;  5IOZ A;  3VPR A;  5K58 A;  4XK4 A;  3VP5 A;  5DAJ A;  2OF7 A;  5GPA A;  5H9T A;  3BTJ A;  2G7G A;  2FJ1 A;  3BTI A;  5J1Y A;  3S5R A;  2G7S A;  3CWR A;  3BR6 A;  2WV1 A;  2FX0 A;  1VI0 A;  4ABZ A;  3ZQG A;  2UXP A;  3BQY A;  3LSJ A;  5EZH A;  2G7L A;  5D18 A;  4GFL A;  4M3G A;  5FMP A;  2G3B A;  4D7M A;  3IH3 A;  3IH4 A;  3P9T A;  1ORK A;  3KKC A;  5FHP A;  5F1J A;  5J1R A;  5F0F A;  3G1O A;  3BR3 A;  2HQ5 A;  2G0E A;  2UXI A;  3ANG A;  1SGM A;  1QVU A;  2EH3 A;  4JYK A;  3LWJ A;  2V57 A;  3B6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...