2WGBA

Crystal structure of the tetr-like transcriptional regulator lfrr from mycobacterium smegmatis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
175
Chain Sequence
SGARERTRRAILDAAMLVLADHPTAALGDIAAAAGVGRSTVHRYYPERTDLLRALARHVHDLSNAAIERADPTSGPVDAALRRVVESQLDLGPIVLFVYYEPSILADPELAAYFDIGDEAIVEVLNRASPEYPPGWARRVFWALMQAGYEAAKDGMPRHQIVDAIMTSLTSGIIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TETR FAMILY TRANSCRIPTIONAL REPRESSOR LFRR
publication title Structural Plasticity and Distinct Drug-Binding Modes of Lfrr, a Mycobacterial Efflux Pump Regulator.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 62
structure length 175
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2wgbA00
3Q0WA 3ON2A 2HYJA 2NS8A 1RKTA 3CDLA 3BCGA 2Y2ZA 1ORKA 3B81A 3LOCA 3MNLA 4KWAA 2PBXA 3FRQA 3V78A 2UXOA 1T33A 1JT6A 5EZGA 4ACIA 4AC0A 2EH3A 2UXPA 5F0FA 3G1MA 3AQSA 1RKWA 2XPVA 3NI7A 3VP5A 2XGDA 3LHQA 5FKOA 4NN1A 3NXCA 3HIMA 4D7MA 4DW6A 2HXOA 1U9OA 1VI0A 3O8GA 4ICHA 2NP5A 2UXHA 4YZEA 3FK6A 3HE0A 3VIBA 1JUPA 4W1UA 2ID3A 3BTLA 2HQ5A 3G1LA 1JT0A 2XGEA 3CCYA 3Q3SA 3LSRA 1SGMA 3ZQIA 3LSPA 5EZHA 3T6NA 2RAEA 2DTZA 3RD3A 2ZB9A 4B3AA 5EYRA 4M3GA 3DCFA 2G3BA 1JTYA 2UXUA 2XPWA 3VVXA 2V57A 3O60A 3QPSA 4V2GA 2YVHA 4JKZA 3MVPA 3B6AA 3IH2A 2DG8A 5K7FA 2GENA 3BR2A 4W97A 5F04A 3WHBA 2RHAA 3Q0UA 5IPAA 4PXIA 5GPCA 3B6CA 5J1UA 1BJZA 2QCOA 4GCKA 3COLA 4UDSA 4AC6A 1Z0XA 5FHPA 5F1JA 3HTAA 5GP9A 2ZCMA 3FK7A 5IOYA 3SFIA 3EGQA 2FBQA 5FKMA 3VOKA 3LWJA 3BR5A 2XDNA 3BHQA 3BTJA 5H9TA 3BQZA 2REKA 3CWRA 5D18A 3ON4A 3G56A 2JK3A 3IUVA 3LSJA 3ANPA 3C2BA 5IOZA 2HKUA 3SDGA 4GCLA 2QTQA 2NS7A 3HGGA 2TRTA 3VW1A 2HYTA 2YVEA 2WGBA 3NRGA 3F1BA 3PM1A 5EFYA 5K58A 2Q24A 3TP0A 3LJLA 2ZOZA 1QVUA 1JUMA 4M3DA 5F0HA 2XB5A 4G12A 3NNRA 3AQTA 3HTIA 4M3BA 4NELA 2QOPA 3G7RA 5C4YA 2Y31A 5J3LA 2XRLA 3HTHA 2UXIA 4MK6A 2NX4A 2JJ7A 2X9DA 3E7QA 3VUQA 2ZOYA 2TCTA 2XPUA 5FMPA 3BNIA 2IBDA 5GPAA 3CJDA 5CW8A 1UI6A 3QKXA 5K7ZA 2OERA 4M3EA 2X6OA 2VPRA 3ZQGA 3BR6A 3GZIA 2VKEA 3S5RA 3VW2A 3BR3A 3HGYA 1JUSA 2G7GA 3C07A 2WV1A 2IU5A 4XK4A 3P9TA 5DAJA 5F08A 3BRUA 2IAIA 4I6ZA 3O8HA 2WUIA 1RPWA 3CRJA 4D5FA 5F27A 2F07A 4MO7A 3QBMA 3G1OA 2GBYA 3VVZA 2G7SA 3DEWA 5CXIA 3BQYA 4D5CA 5FGLA 5HBUA 2G7LA 2GUHA 2GFNA 2ZCNA 3VPRA 4V2FA 2ZCXA 1T56A 2W53A 3QPLA 2QKOA 3GEUA 5D19A 3BTIA 2O7OA 4GFKA 4JL3A 5FKLA 3BR1A 3KKCA 4CGRA 2IEKA 5FKNA 4AF5A 4L62A 2XGCA 2Y30A 3DPJA 3IH4A 4AUXA 4GFLA 4JYKA 4ME9A 2O7TA 3ZQHA 3PASA 5K7HA 1ZKGA 3ZQFA 5J1RA 2RASA 3KZ9A 2QWTA 4MXMA 1U9NA 2I10A 2DG7A 3F0CA 3BTCA 2OI8A 3TP3A 4GCTA 2ID6A 2VKVA 2FX0A 3ZQLA 5D1RA 3Q0VA 2FD5A 5F0CA 3V6GA 2NP3A 1Z77A 1QPIA 2PZ9A 4HKUA 2QIBA 3VOXA 3BR0A 3VW0A 3HTJA 3RH2A 2FJ1A 3JSJA 3ANGA 3IH3A 2OPTA 3VVYA 3WHCA 3KNWA 5HAWA 3BJBA 4D7NA 2FQ4A 1UI5A 5IP6A 1JTXA 3QQAA 3PPBA 4ABZA 5AQCA 5HSZA 5J1YA 4X1EA 1QVTA 4I76A 3FIWA 5CXGA 4M3FA 2OF7A 4B1RA 1A6IA 5FKKA 2G0EA 1ZK8A 2D6YA 2HXIA 3BT9A 4JNNA 3NPIA 3EUPA 3KKDA
chains in the Genus database with same CATH superfamily
3Q0WA 3ON2A 2HYJA 2NS8A 1RKTA 3CDLA 3BCGA 2Y2ZA 1ORKA 3B81A 3LOCA 2A2FX 3MNLA 4KWAA 2PBXA 3FRQA 3V78A 2UXOA 1T33A 1JT6A 5EZGA 4ACIA 4AC0A 2EH3A 2UXPA 5F0FA 3G1MA 3AQSA 1RKWA 2XPVA 3NI7A 3VP5A 2XGDA 3LHQA 4WIBA 4NN1A 5FKOA 3NXCA 3HIMA 4D7MA 4DW6A 2HXOA 1U9OA 1VI0A 3O8GA 4ICHA 2NP5A 2UXHA 4YZEA 3FK6A 3HE0A 2B1EA 3VIBA 1JUPA 4W1UA 2ID3A 3BTLA 2HQ5A 3G1LA 4U9LA 1JT0A 2R7QA 2XGEA 3CCYA 3Q3SA 3LSRA 1SGMA 3ZQIA 3LSPA 5EZHA 3T6NA 2RAEA 2DTZA 3RD3A 2ZB9A 4B3AA 5EYRA 4M3GA 3DCFA 2G3BA 1JTYA 2UXUA 2XPWA 3VVXA 2V57A 3O60A 3QPSA 4V2GA 2YVHA 4JKZA 4C2MA 3MVPA 2R7UA 3B6AA 3IH2A 2DG8A 5K7FA 2GENA 3BR2A 4W97A 5F04A 3WHBA 2RHAA 3Q0UA 5IPAA 4PXIA 5GPCA 3B6CA 5J1UA 1BJZA 2QCOA 4GCKA 3COLA 4UDSA 4AC6A 1Z0XA 5FHPA 5F1JA 3HTAA 5GP9A 2ZCMA 3FK7A 5IOYA 3SFIA 3EGQA 2FBQA 5FKMA 3VOKA 3LWJA 3BR5A 2XDNA 3BHQA 3BTJA 5H9TA 2R7OA 3BQZA 2REKA 3CWRA 5D18A 3ON4A 3G56A 2JK3A 3IUVA 3LSJA 3ANPA 3C2BA 5IOZA 2R7XA 2HKUA 3SDGA 4GCLA 2QTQA 2NS7A 3HGGA 2TRTA 3VW1A 2HYTA 3SWHA 2YVEA 2WGBA 3NRGA 3F1BA 3K8PC 3PM1A 5EFYA 5K58A 2Q24A 3TP0A 3LJLA 2ZOZA 1QVUA 1JUMA 4M3DA 5F0HA 2XB5A 4G12A 3NNRA 2R7RA 3AQTA 3HTIA 4M3BA 4NELA 2QOPA 3G7RA 5C4YA 2Y31A 5J3LA 2XRLA 3HTHA 2UXIA 4MK6A 2NX4A 2JJ7A 2X9DA 3E7QA 3VUQA 2ZOYA 4OD5A 2TCTA 2XPUA 5FMPA 3BNIA 2IBDA 5GPAA 3CJDA 2ZY9A 5CW8A 1UI6A 3QKXA 5K7ZA 2OERA 4M3EA 2X6OA 2B3WA 2VPRA 2R7VA 3ZQGA 3BR6A 3GZIA 2VKEA 3S5RA 3VW2A 3BR3A 3HGYA 1JUSA 2G7GA 3C07A 2WV1A 2IU5A 4XK4A 3P9TA 5DAJA 5F08A 3BRUA 2IAIA 4I6ZA 3O8HA 2WUIA 1RPWA 3CRJA 4D5FA 5F27A 2F07A 4MO7A 3QBMA 3G1OA 2GBYA 3VVZA 2G7SA 3DEWA 5CXIA 3BQYA 2R7SA 4D5CA 5FGLA 5HBUA 2G7LA 2GUHA 2GFNA 2ZCNA 3VPRA 4V2FA 2ZCXA 1T56A 2W53A 3QPLA 2QKOA 3GEUA 5D19A 3BTIA 2O7OA 4GFKA 4JL3A 5FKLA 4OD4A 3BR1A 3KKCA 4CGRA 2IEKA 5FKNA 5CQGA 4AF5A 4L62A 2XGCA 3DU6A 2Y30A 2R7WA 3DPJA 3IH4A 4AUXA 2YVXA 4GFLA 4JYKA 4ME9A 2O7TA 3ZQHA 3PASA 5K7HA 1ZKGA 3ZQFA 5J1RA 2RASA 3KZ9A 2QWTA 4MXMA 1U9NA 2I10A 2DG7A 3F0CA 3BTCA 3FHNA 2OI8A 3TP3A 4GCTA 2ID6A 2VKVA 2FX0A 3ZQLA 5D1RA 3Q0VA 2FD5A 2FJI1 5F0CA 3V6GA 2NP3A 1Z77A 1QPIA 2PZ9A 4HKUA 2QIBA 3VOXA 3BR0A 3VW0A 3HTJA 3RH2A 2FJ1A 3JSJA 3ANGA 3IH3A 3KYLA 2OPTA 3VVYA 3WHCA 3KNWA 5HAWA 2PFVA 3BJBA 4D7NA 2FQ4A 1UI5A 4IRVA 5IP6A 1JTXA 3QQAA 3PPBA 4ABZA 5AQCA 5HSZA 5J1YA 4X1EA 4DVYP 1QVTA 3DU5A 4I76A 2R7TA 3FIWA 5CXGA 3NS4A 4M3FA 2OF7A 4U9NA 3VTIA 4B1RA 1A6IA 5FKKA 2G0EA 1ZK8A 2D6YA 2HXIA 3BT9A 4JNNA 3NPIA 3EUPA 3KKDA
chains in the Genus database with same CATH topology
3Q0WA 3ON2A 2HYJA 2NS8A 1RKTA 3CDLA 3BCGA 2Y2ZA 1ORKA 3B81A 3LOCA 3MNLA 4KWAA 2PBXA 3FRQA 3V78A 2UXOA 1T33A 1JT6A 5EZGA 4ACIA 4AC0A 2EH3A 2UXPA 5F0FA 3G1MA 3AQSA 1RKWA 2XPVA 3NI7A 3VP5A 2XGDA 3LHQA 5FKOA 4NN1A 3NXCA 3HIMA 4D7MA 4DW6A 2HXOA 1U9OA 1VI0A 3O8GA 4ICHA 2NP5A 2UXHA 4YZEA 3FK6A 3HE0A 3VIBA 1JUPA 4W1UA 2ID3A 3BTLA 2HQ5A 3G1LA 1JT0A 2XGEA 3CCYA 3Q3SA 3LSRA 1SGMA 3ZQIA 3LSPA 5EZHA 3T6NA 2RAEA 2DTZA 3RD3A 2ZB9A 4B3AA 5EYRA 4M3GA 3DCFA 2G3BA 1JTYA 2UXUA 2XPWA 3VVXA 2V57A 3O60A 3QPSA 4V2GA 2YVHA 4JKZA 3MVPA 3B6AA 3IH2A 2DG8A 5K7FA 2GENA 3BR2A 4W97A 5F04A 3WHBA 2RHAA 3Q0UA 5IPAA 4PXIA 5GPCA 3B6CA 5J1UA 1BJZA 2QCOA 4GCKA 3COLA 4UDSA 4AC6A 1Z0XA 5FHPA 5F1JA 3HTAA 5GP9A 2ZCMA 3FK7A 5IOYA 3SFIA 3EGQA 2FBQA 5FKMA 3VOKA 3LWJA 3BR5A 2XDNA 3BHQA 3BTJA 5H9TA 3BQZA 2REKA 3CWRA 5D18A 3ON4A 3G56A 2JK3A 3IUVA 3LSJA 3ANPA 3C2BA 5IOZA 2HKUA 3SDGA 4GCLA 2QTQA 2NS7A 3HGGA 2TRTA 3VW1A 2HYTA 2YVEA 2WGBA 3NRGA 3F1BA 3PM1A 5EFYA 5K58A 2Q24A 3TP0A 3LJLA 2ZOZA 1QVUA 1JUMA 4M3DA 5F0HA 2XB5A 4G12A 3NNRA 3AQTA 3HTIA 4M3BA 4NELA 2QOPA 3G7RA 5C4YA 2Y31A 5J3LA 2XRLA 3HTHA 2UXIA 4MK6A 2NX4A 2JJ7A 2X9DA 3E7QA 3VUQA 2ZOYA 2TCTA 2XPUA 5FMPA 3BNIA 2IBDA 5GPAA 3CJDA 5CW8A 1UI6A 3QKXA 5K7ZA 2OERA 4M3EA 2X6OA 2VPRA 3ZQGA 3BR6A 3GZIA 2VKEA 3S5RA 3VW2A 3BR3A 3HGYA 1JUSA 2G7GA 3C07A 2WV1A 2IU5A 4XK4A 3P9TA 5DAJA 5F08A 3BRUA 2IAIA 4I6ZA 3O8HA 2WUIA 1RPWA 3CRJA 4D5FA 5F27A 2F07A 4MO7A 3QBMA 3G1OA 2GBYA 3VVZA 2G7SA 3DEWA 5CXIA 3BQYA 4D5CA 5FGLA 5HBUA 2G7LA 2GUHA 2GFNA 2ZCNA 3VPRA 4V2FA 2ZCXA 1T56A 2W53A 3QPLA 2QKOA 3GEUA 5D19A 3BTIA 2O7OA 4GFKA 4JL3A 5FKLA 3BR1A 3KKCA 4CGRA 2IEKA 5FKNA 4AF5A 4L62A 2XGCA 2Y30A 3DPJA 3IH4A 4AUXA 4GFLA 4JYKA 4ME9A 2O7TA 3ZQHA 3PASA 5K7HA 1ZKGA 3ZQFA 5J1RA 2RASA 3KZ9A 2QWTA 4MXMA 1U9NA 2I10A 2DG7A 3F0CA 3BTCA 2OI8A 3TP3A 4GCTA 2ID6A 2VKVA 2FX0A 3ZQLA 5D1RA 3Q0VA 2FD5A 5F0CA 3V6GA 2NP3A 1Z77A 1QPIA 2PZ9A 4HKUA 2QIBA 3VOXA 3BR0A 3VW0A 3HTJA 3RH2A 2FJ1A 3JSJA 3ANGA 3IH3A 2OPTA 3VVYA 3WHCA 3KNWA 5HAWA 3BJBA 4D7NA 2FQ4A 1UI5A 5IP6A 1JTXA 3QQAA 3PPBA 4ABZA 5AQCA 5HSZA 5J1YA 4X1EA 1QVTA 4I76A 3FIWA 5CXGA 4M3FA 2OF7A 4B1RA 1A6IA 5FKKA 2G0EA 1ZK8A 2D6YA 2HXIA 3BT9A 4JNNA 3NPIA 3EUPA 3KKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0W A;  3ON2 A;  2HYJ A;  2NS8 A;  1RKT A;  3CDL A;  3BCG A;  2Y2Z A;  1ORK A;  3B81 A;  3LOC A;  3MNL A;  4KWA A;  2PBX A;  3FRQ A;  3V78 A;  2UXO A;  1T33 A;  1JT6 A;  5EZG A;  4ACI A;  4AC0 A;  2EH3 A;  2UXP A;  5F0F A;  3G1M A;  3AQS A;  1RKW A;  2XPV A;  3NI7 A;  3VP5 A;  2XGD A;  3LHQ A;  5FKO A;  4NN1 A;  3NXC A;  3HIM A;  4D7M A;  4DW6 A;  2HXO A;  1U9O A;  1VI0 A;  3O8G A;  4ICH A;  2NP5 A;  2UXH A;  4YZE A;  3FK6 A;  3HE0 A;  3VIB A;  1JUP A;  4W1U A;  2ID3 A;  3BTL A;  2HQ5 A;  3G1L A;  1JT0 A;  2XGE A;  3CCY A;  3Q3S A;  3LSR A;  1SGM A;  3ZQI A;  3LSP A;  5EZH A;  3T6N A;  2RAE A;  2DTZ A;  3RD3 A;  2ZB9 A;  4B3A A;  5EYR A;  4M3G A;  3DCF A;  2G3B A;  1JTY A;  2UXU A;  2XPW A;  3VVX A;  2V57 A;  3O60 A;  3QPS A;  4V2G A;  2YVH A;  4JKZ A;  3MVP A;  3B6A A;  3IH2 A;  2DG8 A;  5K7F A;  2GEN A;  3BR2 A;  4W97 A;  5F04 A;  3WHB A;  2RHA A;  3Q0U A;  5IPA A;  4PXI A;  5GPC A;  3B6C A;  5J1U A;  1BJZ A;  2QCO A;  4GCK A;  3COL A;  4UDS A;  4AC6 A;  1Z0X A;  5FHP A;  5F1J A;  3HTA A;  5GP9 A;  2ZCM A;  3FK7 A;  5IOY A;  3SFI A;  3EGQ A;  2FBQ A;  5FKM A;  3VOK A;  3LWJ A;  3BR5 A;  2XDN A;  3BHQ A;  3BTJ A;  5H9T A;  3BQZ A;  2REK A;  3CWR A;  5D18 A;  3ON4 A;  3G56 A;  2JK3 A;  3IUV A;  3LSJ A;  3ANP A;  3C2B A;  5IOZ A;  2HKU A;  3SDG A;  4GCL A;  2QTQ A;  2NS7 A;  3HGG A;  2TRT A;  3VW1 A;  2HYT A;  2YVE A;  2WGB A;  3NRG A;  3F1B A;  3PM1 A;  5EFY A;  5K58 A;  2Q24 A;  3TP0 A;  3LJL A;  2ZOZ A;  1QVU A;  1JUM A;  4M3D A;  5F0H A;  2XB5 A;  4G12 A;  3NNR A;  3AQT A;  3HTI A;  4M3B A;  4NEL A;  2QOP A;  3G7R A;  5C4Y A;  2Y31 A;  5J3L A;  2XRL A;  3HTH A;  2UXI A;  4MK6 A;  2NX4 A;  2JJ7 A;  2X9D A;  3E7Q A;  3VUQ A;  2ZOY A;  2TCT A;  2XPU A;  5FMP A;  3BNI A;  2IBD A;  5GPA A;  3CJD A;  5CW8 A;  1UI6 A;  3QKX A;  5K7Z A;  2OER A;  4M3E A;  2X6O A;  2VPR A;  3ZQG A;  3BR6 A;  3GZI A;  2VKE A;  3S5R A;  3VW2 A;  3BR3 A;  3HGY A;  1JUS A;  2G7G A;  3C07 A;  2WV1 A;  2IU5 A;  4XK4 A;  3P9T A;  5DAJ A;  5F08 A;  3BRU A;  2IAI A;  4I6Z A;  3O8H A;  2WUI A;  1RPW A;  3CRJ A;  4D5F A;  5F27 A;  2F07 A;  4MO7 A;  3QBM A;  3G1O A;  2GBY A;  3VVZ A;  2G7S A;  3DEW A;  5CXI A;  3BQY A;  4D5C A;  5FGL A;  5HBU A;  2G7L A;  2GUH A;  2GFN A;  2ZCN A;  3VPR A;  4V2F A;  2ZCX A;  1T56 A;  2W53 A;  3QPL A;  2QKO A;  3GEU A;  5D19 A;  3BTI A;  2O7O A;  4GFK A;  4JL3 A;  5FKL A;  3BR1 A;  3KKC A;  4CGR A;  2IEK A;  5FKN A;  4AF5 A;  4L62 A;  2XGC A;  2Y30 A;  3DPJ A;  3IH4 A;  4AUX A;  4GFL A;  4JYK A;  4ME9 A;  2O7T A;  3ZQH A;  3PAS A;  5K7H A;  1ZKG A;  3ZQF A;  5J1R A;  2RAS A;  3KZ9 A;  2QWT A;  4MXM A;  1U9N A;  2I10 A;  2DG7 A;  3F0C A;  3BTC A;  2OI8 A;  3TP3 A;  4GCT A;  2ID6 A;  2VKV A;  2FX0 A;  3ZQL A;  5D1R A;  3Q0V A;  2FD5 A;  5F0C A;  3V6G A;  2NP3 A;  1Z77 A;  1QPI A;  2PZ9 A;  4HKU A;  2QIB A;  3VOX A;  3BR0 A;  3VW0 A;  3HTJ A;  3RH2 A;  2FJ1 A;  3JSJ A;  3ANG A;  3IH3 A;  2OPT A;  3VVY A;  3WHC A;  3KNW A;  5HAW A;  3BJB A;  4D7N A;  2FQ4 A;  1UI5 A;  5IP6 A;  1JTX A;  3QQA A;  3PPB A;  4ABZ A;  5AQC A;  5HSZ A;  5J1Y A;  4X1E A;  1QVT A;  4I76 A;  3FIW A;  5CXG A;  4M3F A;  2OF7 A;  4B1R A;  1A6I A;  5FKK A;  2G0E A;  1ZK8 A;  2D6Y A;  2HXI A;  3BT9 A;  4JNN A;  3NPI A;  3EUP A;  3KKD A; 
#chains in the Genus database with same CATH topology
 3Q0W A;  3ON2 A;  2HYJ A;  2NS8 A;  1RKT A;  3CDL A;  3BCG A;  2Y2Z A;  1ORK A;  3B81 A;  3LOC A;  2A2F X;  3MNL A;  4KWA A;  2PBX A;  3FRQ A;  3V78 A;  2UXO A;  1T33 A;  1JT6 A;  5EZG A;  4ACI A;  4AC0 A;  2EH3 A;  2UXP A;  5F0F A;  3G1M A;  3AQS A;  1RKW A;  2XPV A;  3NI7 A;  3VP5 A;  2XGD A;  3LHQ A;  4WIB A;  4NN1 A;  5FKO A;  3NXC A;  3HIM A;  4D7M A;  4DW6 A;  2HXO A;  1U9O A;  1VI0 A;  3O8G A;  4ICH A;  2NP5 A;  2UXH A;  4YZE A;  3FK6 A;  3HE0 A;  2B1E A;  3VIB A;  1JUP A;  4W1U A;  2ID3 A;  3BTL A;  2HQ5 A;  3G1L A;  4U9L A;  1JT0 A;  2R7Q A;  2XGE A;  3CCY A;  3Q3S A;  3LSR A;  1SGM A;  3ZQI A;  3LSP A;  5EZH A;  3T6N A;  2RAE A;  2DTZ A;  3RD3 A;  2ZB9 A;  4B3A A;  5EYR A;  4M3G A;  3DCF A;  2G3B A;  1JTY A;  2UXU A;  2XPW A;  3VVX A;  2V57 A;  3O60 A;  3QPS A;  4V2G A;  2YVH A;  4JKZ A;  4C2M A;  3MVP A;  2R7U A;  3B6A A;  3IH2 A;  2DG8 A;  5K7F A;  2GEN A;  3BR2 A;  4W97 A;  5F04 A;  3WHB A;  2RHA A;  3Q0U A;  5IPA A;  4PXI A;  5GPC A;  3B6C A;  5J1U A;  1BJZ A;  2QCO A;  4GCK A;  3COL A;  4UDS A;  4AC6 A;  1Z0X A;  5FHP A;  5F1J A;  3HTA A;  5GP9 A;  2ZCM A;  3FK7 A;  5IOY A;  3SFI A;  3EGQ A;  2FBQ A;  5FKM A;  3VOK A;  3LWJ A;  3BR5 A;  2XDN A;  3BHQ A;  3BTJ A;  5H9T A;  2R7O A;  3BQZ A;  2REK A;  3CWR A;  5D18 A;  3ON4 A;  3G56 A;  2JK3 A;  3IUV A;  3LSJ A;  3ANP A;  3C2B A;  5IOZ A;  2R7X A;  2HKU A;  3SDG A;  4GCL A;  2QTQ A;  2NS7 A;  3HGG A;  2TRT A;  3VW1 A;  2HYT A;  3SWH A;  2YVE A;  2WGB A;  3NRG A;  3F1B A;  3K8P C;  3PM1 A;  5EFY A;  5K58 A;  2Q24 A;  3TP0 A;  3LJL A;  2ZOZ A;  1QVU A;  1JUM A;  4M3D A;  5F0H A;  2XB5 A;  4G12 A;  3NNR A;  2R7R A;  3AQT A;  3HTI A;  4M3B A;  4NEL A;  2QOP A;  3G7R A;  5C4Y A;  2Y31 A;  5J3L A;  2XRL A;  3HTH A;  2UXI A;  4MK6 A;  2NX4 A;  2JJ7 A;  2X9D A;  3E7Q A;  3VUQ A;  2ZOY A;  4OD5 A;  2TCT A;  2XPU A;  5FMP A;  3BNI A;  2IBD A;  5GPA A;  3CJD A;  2ZY9 A;  5CW8 A;  1UI6 A;  3QKX A;  5K7Z A;  2OER A;  4M3E A;  2X6O A;  2B3W A;  2VPR A;  2R7V A;  3ZQG A;  3BR6 A;  3GZI A;  2VKE A;  3S5R A;  3VW2 A;  3BR3 A;  3HGY A;  1JUS A;  2G7G A;  3C07 A;  2WV1 A;  2IU5 A;  4XK4 A;  3P9T A;  5DAJ A;  5F08 A;  3BRU A;  2IAI A;  4I6Z A;  3O8H A;  2WUI A;  1RPW A;  3CRJ A;  4D5F A;  5F27 A;  2F07 A;  4MO7 A;  3QBM A;  3G1O A;  2GBY A;  3VVZ A;  2G7S A;  3DEW A;  5CXI A;  3BQY A;  2R7S A;  4D5C A;  5FGL A;  5HBU A;  2G7L A;  2GUH A;  2GFN A;  2ZCN A;  3VPR A;  4V2F A;  2ZCX A;  1T56 A;  2W53 A;  3QPL A;  2QKO A;  3GEU A;  5D19 A;  3BTI A;  2O7O A;  4GFK A;  4JL3 A;  5FKL A;  4OD4 A;  3BR1 A;  3KKC A;  4CGR A;  2IEK A;  5FKN A;  5CQG A;  4AF5 A;  4L62 A;  2XGC A;  3DU6 A;  2Y30 A;  2R7W A;  3DPJ A;  3IH4 A;  4AUX A;  2YVX A;  4GFL A;  4JYK A;  4ME9 A;  2O7T A;  3ZQH A;  3PAS A;  5K7H A;  1ZKG A;  3ZQF A;  5J1R A;  2RAS A;  3KZ9 A;  2QWT A;  4MXM A;  1U9N A;  2I10 A;  2DG7 A;  3F0C A;  3BTC A;  3FHN A;  2OI8 A;  3TP3 A;  4GCT A;  2ID6 A;  2VKV A;  2FX0 A;  3ZQL A;  5D1R A;  3Q0V A;  2FD5 A;  2FJI 1;  5F0C A;  3V6G A;  2NP3 A;  1Z77 A;  1QPI A;  2PZ9 A;  4HKU A;  2QIB A;  3VOX A;  3BR0 A;  3VW0 A;  3HTJ A;  3RH2 A;  2FJ1 A;  3JSJ A;  3ANG A;  3IH3 A;  3KYL A;  2OPT A;  3VVY A;  3WHC A;  3KNW A;  5HAW A;  2PFV A;  3BJB A;  4D7N A;  2FQ4 A;  1UI5 A;  4IRV A;  5IP6 A;  1JTX A;  3QQA A;  3PPB A;  4ABZ A;  5AQC A;  5HSZ A;  5J1Y A;  4X1E A;  4DVY P;  1QVT A;  3DU5 A;  4I76 A;  2R7T A;  3FIW A;  5CXG A;  3NS4 A;  4M3F A;  2OF7 A;  4U9N A;  3VTI A;  4B1R A;  1A6I A;  5FKK A;  2G0E A;  1ZK8 A;  2D6Y A;  2HXI A;  3BT9 A;  4JNN A;  3NPI A;  3EUP A;  3KKD A; 
#chains in the Genus database with same CATH homology
 3Q0W A;  3ON2 A;  2HYJ A;  2NS8 A;  1RKT A;  3CDL A;  3BCG A;  2Y2Z A;  1ORK A;  3B81 A;  3LOC A;  3MNL A;  4KWA A;  2PBX A;  3FRQ A;  3V78 A;  2UXO A;  1T33 A;  1JT6 A;  5EZG A;  4ACI A;  4AC0 A;  2EH3 A;  2UXP A;  5F0F A;  3G1M A;  3AQS A;  1RKW A;  2XPV A;  3NI7 A;  3VP5 A;  2XGD A;  3LHQ A;  5FKO A;  4NN1 A;  3NXC A;  3HIM A;  4D7M A;  4DW6 A;  2HXO A;  1U9O A;  1VI0 A;  3O8G A;  4ICH A;  2NP5 A;  2UXH A;  4YZE A;  3FK6 A;  3HE0 A;  3VIB A;  1JUP A;  4W1U A;  2ID3 A;  3BTL A;  2HQ5 A;  3G1L A;  1JT0 A;  2XGE A;  3CCY A;  3Q3S A;  3LSR A;  1SGM A;  3ZQI A;  3LSP A;  5EZH A;  3T6N A;  2RAE A;  2DTZ A;  3RD3 A;  2ZB9 A;  4B3A A;  5EYR A;  4M3G A;  3DCF A;  2G3B A;  1JTY A;  2UXU A;  2XPW A;  3VVX A;  2V57 A;  3O60 A;  3QPS A;  4V2G A;  2YVH A;  4JKZ A;  3MVP A;  3B6A A;  3IH2 A;  2DG8 A;  5K7F A;  2GEN A;  3BR2 A;  4W97 A;  5F04 A;  3WHB A;  2RHA A;  3Q0U A;  5IPA A;  4PXI A;  5GPC A;  3B6C A;  5J1U A;  1BJZ A;  2QCO A;  4GCK A;  3COL A;  4UDS A;  4AC6 A;  1Z0X A;  5FHP A;  5F1J A;  3HTA A;  5GP9 A;  2ZCM A;  3FK7 A;  5IOY A;  3SFI A;  3EGQ A;  2FBQ A;  5FKM A;  3VOK A;  3LWJ A;  3BR5 A;  2XDN A;  3BHQ A;  3BTJ A;  5H9T A;  3BQZ A;  2REK A;  3CWR A;  5D18 A;  3ON4 A;  3G56 A;  2JK3 A;  3IUV A;  3LSJ A;  3ANP A;  3C2B A;  5IOZ A;  2HKU A;  3SDG A;  4GCL A;  2QTQ A;  2NS7 A;  3HGG A;  2TRT A;  3VW1 A;  2HYT A;  2YVE A;  2WGB A;  3NRG A;  3F1B A;  3PM1 A;  5EFY A;  5K58 A;  2Q24 A;  3TP0 A;  3LJL A;  2ZOZ A;  1QVU A;  1JUM A;  4M3D A;  5F0H A;  2XB5 A;  4G12 A;  3NNR A;  3AQT A;  3HTI A;  4M3B A;  4NEL A;  2QOP A;  3G7R A;  5C4Y A;  2Y31 A;  5J3L A;  2XRL A;  3HTH A;  2UXI A;  4MK6 A;  2NX4 A;  2JJ7 A;  2X9D A;  3E7Q A;  3VUQ A;  2ZOY A;  2TCT A;  2XPU A;  5FMP A;  3BNI A;  2IBD A;  5GPA A;  3CJD A;  5CW8 A;  1UI6 A;  3QKX A;  5K7Z A;  2OER A;  4M3E A;  2X6O A;  2VPR A;  3ZQG A;  3BR6 A;  3GZI A;  2VKE A;  3S5R A;  3VW2 A;  3BR3 A;  3HGY A;  1JUS A;  2G7G A;  3C07 A;  2WV1 A;  2IU5 A;  4XK4 A;  3P9T A;  5DAJ A;  5F08 A;  3BRU A;  2IAI A;  4I6Z A;  3O8H A;  2WUI A;  1RPW A;  3CRJ A;  4D5F A;  5F27 A;  2F07 A;  4MO7 A;  3QBM A;  3G1O A;  2GBY A;  3VVZ A;  2G7S A;  3DEW A;  5CXI A;  3BQY A;  4D5C A;  5FGL A;  5HBU A;  2G7L A;  2GUH A;  2GFN A;  2ZCN A;  3VPR A;  4V2F A;  2ZCX A;  1T56 A;  2W53 A;  3QPL A;  2QKO A;  3GEU A;  5D19 A;  3BTI A;  2O7O A;  4GFK A;  4JL3 A;  5FKL A;  3BR1 A;  3KKC A;  4CGR A;  2IEK A;  5FKN A;  4AF5 A;  4L62 A;  2XGC A;  2Y30 A;  3DPJ A;  3IH4 A;  4AUX A;  4GFL A;  4JYK A;  4ME9 A;  2O7T A;  3ZQH A;  3PAS A;  5K7H A;  1ZKG A;  3ZQF A;  5J1R A;  2RAS A;  3KZ9 A;  2QWT A;  4MXM A;  1U9N A;  2I10 A;  2DG7 A;  3F0C A;  3BTC A;  2OI8 A;  3TP3 A;  4GCT A;  2ID6 A;  2VKV A;  2FX0 A;  3ZQL A;  5D1R A;  3Q0V A;  2FD5 A;  5F0C A;  3V6G A;  2NP3 A;  1Z77 A;  1QPI A;  2PZ9 A;  4HKU A;  2QIB A;  3VOX A;  3BR0 A;  3VW0 A;  3HTJ A;  3RH2 A;  2FJ1 A;  3JSJ A;  3ANG A;  3IH3 A;  2OPT A;  3VVY A;  3WHC A;  3KNW A;  5HAW A;  3BJB A;  4D7N A;  2FQ4 A;  1UI5 A;  5IP6 A;  1JTX A;  3QQA A;  3PPB A;  4ABZ A;  5AQC A;  5HSZ A;  5J1Y A;  4X1E A;  1QVT A;  4I76 A;  3FIW A;  5CXG A;  4M3F A;  2OF7 A;  4B1R A;  1A6I A;  5FKK A;  2G0E A;  1ZK8 A;  2D6Y A;  2HXI A;  3BT9 A;  4JNN A;  3NPI A;  3EUP A;  3KKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...