2ZCMA

Crystal structure of icar, a repressor of the tetr family
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
184
structure length
177
Chain Sequence
MKDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFIDFMYSIDGLYQFLFKFIFDVDERYIKLYVQLSSAPEALNSEIKHHLQEINTTLHDELIKYYDPTHIALDKEDFINMILMFLETWYFRASFSQKFGIIEDSKNRFKDQVYSLLNVFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Biofilm operon icaABCD HTH-type negative transcriptional reg
publication title Crystal structure of IcaR, a repressor of the TetR family implicated in biofilm formation in Staphylococcus epidermidis
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 72
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zcmA00
2RASA 3Q3SA 3BQZA 4GCLA 4V2GA 2QKOA 2JJ7A 2QTQA 2GENA 2XGCA 4M3DA 3FRQA 2WV1A 2ZCMA 3BT9A 3EGQA 3LOCA 5F04A 3CJDA 3BR0A 1JUPA 3ZQLA 1BJZA 3S5RA 1RPWA 4B3AA 1JTXA 4KWAA 3KKDA 3EUPA 5D18A 3NRGA 3V6GA 2YVHA 4JNNA 2G3BA 2PBXA 2ZCNA 4M3FA 4MK6A 3PPBA 1Z77A 3BR3A 4M3BA 4JL3A 5F0HA 1UI6A 3NNRA 4ACIA 5K58A 3IH3A 1JT6A 4ME9A 5HSZA 3C07A 3FIWA 4AC6A 2UXUA 5CXIA 5FKLA 2G7SA 3VVXA 4CGRA 3BHQA 5FKOA 3VPRA 4W1UA 5F1JA 3LJLA 3HTIA 5J1YA 3G56A 2ZB9A 3B6CA 3F1BA 2I10A 1SGMA 5FHPA 3BTCA 3O60A 5GPCA 2X6OA 3VIBA 3WHCA 4D5FA 5F0CA 1QVUA 3LSJA 4M3EA 3BJBA 4GFLA 3ZQHA 3QQAA 3KZ9A 5FGLA 2REKA 2TCTA 4PXIA 3O8GA 2JK3A 2D6YA 4D7NA 5EFYA 3CDLA 5IOYA 3BR2A 2OF7A 5K7HA 3IH2A 2RHAA 3VW2A 1ZK8A 3P9TA 3LSPA 2O7OA 5EYRA 3B81A 2TRTA 3C2BA 2XB5A 3CCYA 2WGBA 3ZQGA 4XK4A 2UXHA 3BTLA 3BRUA 3AQSA 5D1RA 1ORKA 3SDGA 5FMPA 5J3LA 1VI0A 3Q0VA 2ID6A 2XGDA 3HTAA 3VOXA 3QKXA 3IH4A 3VUQA 3LWJA 1U9OA 2UXIA 3GEUA 2FJ1A 5IOZA 3HTHA 1UI5A 5F08A 2F07A 3BCGA 2EH3A 2ZCXA 3GZIA 2QIBA 3Q0WA 2HXIA 2ZOZA 4G12A 2IBDA 3VOKA 4MXMA 4X1EA 3HTJA 2GBYA 1JT0A 4JYKA 2HQ5A 3HGGA 2OPTA 5EZHA 3BNIA 2VKEA 2Q24A 4B1RA 4W97A 1QPIA 2WUIA 3SFIA 2NS7A 4GCTA 3WHBA 4JKZA 2X9DA 2PZ9A 3O8HA 3CWRA 2IU5A 3ZQIA 5J1UA 2QWTA 4YZEA 5FKKA 3DEWA 3VW1A 4D5CA 3BQYA 2XGEA 3HGYA 4ICHA 2G0EA 3BTJA 4D7MA 2W53A 2IEKA 2FBQA 2FQ4A 3ANPA 1JUMA 3TP0A 2XRLA 3BR5A 3BTIA 1ZKGA 3QPSA 4AF5A 2UXOA 3ZQFA 3IUVA 4UDSA 4GCKA 2XDNA 2V57A 3HIMA 5K7ZA 2Y30A 3G7RA 3JSJA 4V2FA 2XPUA 5F27A 2FX0A 4HKUA 1QVTA 5K7FA 5J1RA 3V78A 2NP5A 2G7GA 3RH2A 5FKMA 3B6AA 2VPRA 4ABZA 3LSRA 4GFKA 2IAIA 2FD5A 3TP3A 4DW6A 1T33A 3BR1A 5HAWA 3PASA 2HXOA 3VVZA 5C4YA 5AQCA 5CW8A 1A6IA 3LHQA 3RD3A 1RKWA 3KKCA 4L62A 5FKNA 2DG8A 2NP3A 3FK6A 5IP6A 2Y2ZA 1RKTA 3VP5A 5H9TA 4MO7A 3T6NA 2UXPA 5F0FA 3MVPA 3G1OA 2HYTA 3QBMA 2OI8A 1T56A 3DPJA 1U9NA 2OERA 3CRJA 3FK7A 2DG7A 3ANGA 2DTZA 2Y31A 2O7TA 2ID3A 4AUXA 3NXCA 2NS8A 2HYJA 1JUSA 2HKUA 3KNWA 3MNLA 2QOPA 2G7LA 2NX4A 3VW0A 5IPAA 2GFNA 3G1LA 3QPLA 5EZGA 2GUHA 3HE0A 3DCFA 4NELA 2QCOA 4I76A 2ZOYA 2VKVA 5CXGA 5D19A 3G1MA 3ON2A 5DAJA 3ON4A 3COLA 3Q0UA 5GP9A 3AQTA 4NN1A 2RAEA 3BR6A 4AC0A 4M3GA 3VVYA 3NI7A 1JTYA 4I6ZA 2XPWA 3PM1A 5HBUA 1Z0XA 2YVEA 3F0CA 3NPIA 2XPVA 5GPAA 3E7QA
chains in the Genus database with same CATH superfamily
2RASA 2R7RA 3Q3SA 3BQZA 4GCLA 2FJI1 4V2GA 2QKOA 2JJ7A 2QTQA 2GENA 2XGCA 4M3DA 3FRQA 2WV1A 2ZCMA 3BT9A 3EGQA 3LOCA 5F04A 3CJDA 3BR0A 1JUPA 3ZQLA 1BJZA 3S5RA 1RPWA 4B3AA 1JTXA 4OD5A 4KWAA 3KKDA 3EUPA 5D18A 2R7VA 3NRGA 3V6GA 4WIBA 2YVHA 4JNNA 2G3BA 2PBXA 2ZCNA 4M3FA 4MK6A 3PPBA 1Z77A 3BR3A 4M3BA 2R7XA 4JL3A 5F0HA 1UI6A 3NNRA 4ACIA 5K58A 3IH3A 1JT6A 4ME9A 5HSZA 3C07A 3FIWA 3FHNA 4AC6A 2UXUA 5CXIA 5FKLA 2G7SA 3VVXA 4CGRA 3BHQA 5FKOA 3DU5A 3VPRA 4W1UA 5F1JA 2YVXA 3LJLA 3HTIA 5J1YA 3G56A 2ZB9A 3B6CA 3F1BA 2I10A 1SGMA 5FHPA 3BTCA 3O60A 5GPCA 2X6OA 3VIBA 3WHCA 4D5FA 5F0CA 1QVUA 3LSJA 4M3EA 3BJBA 4GFLA 3ZQHA 3QQAA 2B3WA 3KZ9A 5FGLA 2REKA 2TCTA 4PXIA 3O8GA 2JK3A 2D6YA 4D7NA 5EFYA 3CDLA 5IOYA 3BR2A 2OF7A 5K7HA 3IH2A 2RHAA 3VW2A 2R7TA 1ZK8A 3P9TA 3LSPA 2O7OA 4IRVA 5EYRA 3B81A 2TRTA 3C2BA 2XB5A 3CCYA 2WGBA 3ZQGA 4XK4A 2UXHA 3BTLA 3BRUA 3AQSA 5D1RA 1ORKA 3SDGA 5FMPA 5J3LA 1VI0A 3Q0VA 2ID6A 2XGDA 3HTAA 3VOXA 3QKXA 3IH4A 3VUQA 3LWJA 1U9OA 2UXIA 3GEUA 2FJ1A 5IOZA 3HTHA 1UI5A 5F08A 2F07A 3BCGA 2EH3A 2ZCXA 3GZIA 2QIBA 3Q0WA 2HXIA 2ZOZA 4G12A 2IBDA 3VOKA 4MXMA 4X1EA 3HTJA 2GBYA 1JT0A 4JYKA 2HQ5A 3HGGA 2OPTA 5EZHA 3BNIA 2VKEA 2ZY9A 2Q24A 4B1RA 4W97A 1QPIA 2WUIA 3SFIA 2NS7A 4GCTA 3WHBA 4JKZA 2X9DA 2PZ9A 4U9NA 2R7WA 3O8HA 3CWRA 2A2FX 2IU5A 3ZQIA 5J1UA 2QWTA 4YZEA 5FKKA 3DEWA 3VW1A 4D5CA 3BQYA 2XGEA 3HGYA 4ICHA 2G0EA 3BTJA 4D7MA 2W53A 2IEKA 2FBQA 2FQ4A 3ANPA 1JUMA 3TP0A 2XRLA 3BR5A 3BTIA 1ZKGA 3QPSA 4AF5A 2UXOA 4C2MA 3ZQFA 3IUVA 4UDSA 5CQGA 4GCKA 2XDNA 2V57A 3HIMA 5K7ZA 2Y30A 3G7RA 3JSJA 4V2FA 2XPUA 5F27A 2FX0A 4HKUA 1QVTA 5K7FA 5J1RA 3V78A 2NP5A 2G7GA 3RH2A 5FKMA 3SWHA 2R7UA 3B6AA 2VPRA 4ABZA 3LSRA 4GFKA 2IAIA 2FD5A 3TP3A 4DW6A 1T33A 3BR1A 4DVYP 5HAWA 3PASA 2HXOA 3VVZA 5C4YA 5AQCA 5CW8A 1A6IA 3LHQA 3RD3A 1RKWA 3KKCA 4L62A 2R7QA 5FKNA 2DG8A 2NP3A 3FK6A 5IP6A 2Y2ZA 1RKTA 3VP5A 5H9TA 2R7SA 4MO7A 3T6NA 2UXPA 5F0FA 3MVPA 3G1OA 2HYTA 3QBMA 2OI8A 1T56A 3DPJA 1U9NA 2OERA 3CRJA 3FK7A 2DG7A 3ANGA 2DTZA 2Y31A 2O7TA 2ID3A 4AUXA 3NXCA 2NS8A 2HYJA 1JUSA 4OD4A 2HKUA 3KNWA 3MNLA 2QOPA 2R7OA 2G7LA 2NX4A 2PFVA 3VW0A 5IPAA 2GFNA 3G1LA 3QPLA 5EZGA 3KYLA 4U9LA 2GUHA 3VTIA 3HE0A 3DCFA 3K8PC 4NELA 2QCOA 4I76A 2ZOYA 2B1EA 2VKVA 5CXGA 5D19A 3G1MA 3ON2A 5DAJA 3ON4A 3COLA 3Q0UA 5GP9A 3AQTA 4NN1A 2RAEA 3BR6A 4AC0A 4M3GA 3VVYA 3NS4A 3NI7A 1JTYA 4I6ZA 3DU6A 2XPWA 3PM1A 5HBUA 1Z0XA 2YVEA 3F0CA 3NPIA 2XPVA 5GPAA 3E7QA
chains in the Genus database with same CATH topology
2RASA 3Q3SA 3BQZA 4GCLA 4V2GA 2QKOA 2JJ7A 2QTQA 2GENA 2XGCA 4M3DA 3FRQA 2WV1A 2ZCMA 3BT9A 3EGQA 3LOCA 5F04A 3CJDA 3BR0A 1JUPA 3ZQLA 1BJZA 3S5RA 1RPWA 4B3AA 1JTXA 4KWAA 3KKDA 3EUPA 5D18A 3NRGA 3V6GA 2YVHA 4JNNA 2G3BA 2PBXA 2ZCNA 4M3FA 4MK6A 3PPBA 1Z77A 3BR3A 4M3BA 4JL3A 5F0HA 1UI6A 3NNRA 4ACIA 5K58A 3IH3A 1JT6A 4ME9A 5HSZA 3C07A 3FIWA 4AC6A 2UXUA 5CXIA 5FKLA 2G7SA 3VVXA 4CGRA 3BHQA 5FKOA 3VPRA 4W1UA 5F1JA 3LJLA 3HTIA 5J1YA 3G56A 2ZB9A 3B6CA 3F1BA 2I10A 1SGMA 5FHPA 3BTCA 3O60A 5GPCA 2X6OA 3VIBA 3WHCA 4D5FA 5F0CA 1QVUA 3LSJA 4M3EA 3BJBA 4GFLA 3ZQHA 3QQAA 3KZ9A 5FGLA 2REKA 2TCTA 4PXIA 3O8GA 2JK3A 2D6YA 4D7NA 5EFYA 3CDLA 5IOYA 3BR2A 2OF7A 5K7HA 3IH2A 2RHAA 3VW2A 1ZK8A 3P9TA 3LSPA 2O7OA 5EYRA 3B81A 2TRTA 3C2BA 2XB5A 3CCYA 2WGBA 3ZQGA 4XK4A 2UXHA 3BTLA 3BRUA 3AQSA 5D1RA 1ORKA 3SDGA 5FMPA 5J3LA 1VI0A 3Q0VA 2ID6A 2XGDA 3HTAA 3VOXA 3QKXA 3IH4A 3VUQA 3LWJA 1U9OA 2UXIA 3GEUA 2FJ1A 5IOZA 3HTHA 1UI5A 5F08A 2F07A 3BCGA 2EH3A 2ZCXA 3GZIA 2QIBA 3Q0WA 2HXIA 2ZOZA 4G12A 2IBDA 3VOKA 4MXMA 4X1EA 3HTJA 2GBYA 1JT0A 4JYKA 2HQ5A 3HGGA 2OPTA 5EZHA 3BNIA 2VKEA 2Q24A 4B1RA 4W97A 1QPIA 2WUIA 3SFIA 2NS7A 4GCTA 3WHBA 4JKZA 2X9DA 2PZ9A 3O8HA 3CWRA 2IU5A 3ZQIA 5J1UA 2QWTA 4YZEA 5FKKA 3DEWA 3VW1A 4D5CA 3BQYA 2XGEA 3HGYA 4ICHA 2G0EA 3BTJA 4D7MA 2W53A 2IEKA 2FBQA 2FQ4A 3ANPA 1JUMA 3TP0A 2XRLA 3BR5A 3BTIA 1ZKGA 3QPSA 4AF5A 2UXOA 3ZQFA 3IUVA 4UDSA 4GCKA 2XDNA 2V57A 3HIMA 5K7ZA 2Y30A 3G7RA 3JSJA 4V2FA 2XPUA 5F27A 2FX0A 4HKUA 1QVTA 5K7FA 5J1RA 3V78A 2NP5A 2G7GA 3RH2A 5FKMA 3B6AA 2VPRA 4ABZA 3LSRA 4GFKA 2IAIA 2FD5A 3TP3A 4DW6A 1T33A 3BR1A 5HAWA 3PASA 2HXOA 3VVZA 5C4YA 5AQCA 5CW8A 1A6IA 3LHQA 3RD3A 1RKWA 3KKCA 4L62A 5FKNA 2DG8A 2NP3A 3FK6A 5IP6A 2Y2ZA 1RKTA 3VP5A 5H9TA 4MO7A 3T6NA 2UXPA 5F0FA 3MVPA 3G1OA 2HYTA 3QBMA 2OI8A 1T56A 3DPJA 1U9NA 2OERA 3CRJA 3FK7A 2DG7A 3ANGA 2DTZA 2Y31A 2O7TA 2ID3A 4AUXA 3NXCA 2NS8A 2HYJA 1JUSA 2HKUA 3KNWA 3MNLA 2QOPA 2G7LA 2NX4A 3VW0A 5IPAA 2GFNA 3G1LA 3QPLA 5EZGA 2GUHA 3HE0A 3DCFA 4NELA 2QCOA 4I76A 2ZOYA 2VKVA 5CXGA 5D19A 3G1MA 3ON2A 5DAJA 3ON4A 3COLA 3Q0UA 5GP9A 3AQTA 4NN1A 2RAEA 3BR6A 4AC0A 4M3GA 3VVYA 3NI7A 1JTYA 4I6ZA 2XPWA 3PM1A 5HBUA 1Z0XA 2YVEA 3F0CA 3NPIA 2XPVA 5GPAA 3E7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAS A;  3Q3S A;  3BQZ A;  4GCL A;  4V2G A;  2QKO A;  2JJ7 A;  2QTQ A;  2GEN A;  2XGC A;  4M3D A;  3FRQ A;  2WV1 A;  2ZCM A;  3BT9 A;  3EGQ A;  3LOC A;  5F04 A;  3CJD A;  3BR0 A;  1JUP A;  3ZQL A;  1BJZ A;  3S5R A;  1RPW A;  4B3A A;  1JTX A;  4KWA A;  3KKD A;  3EUP A;  5D18 A;  3NRG A;  3V6G A;  2YVH A;  4JNN A;  2G3B A;  2PBX A;  2ZCN A;  4M3F A;  4MK6 A;  3PPB A;  1Z77 A;  3BR3 A;  4M3B A;  4JL3 A;  5F0H A;  1UI6 A;  3NNR A;  4ACI A;  5K58 A;  3IH3 A;  1JT6 A;  4ME9 A;  5HSZ A;  3C07 A;  3FIW A;  4AC6 A;  2UXU A;  5CXI A;  5FKL A;  2G7S A;  3VVX A;  4CGR A;  3BHQ A;  5FKO A;  3VPR A;  4W1U A;  5F1J A;  3LJL A;  3HTI A;  5J1Y A;  3G56 A;  2ZB9 A;  3B6C A;  3F1B A;  2I10 A;  1SGM A;  5FHP A;  3BTC A;  3O60 A;  5GPC A;  2X6O A;  3VIB A;  3WHC A;  4D5F A;  5F0C A;  1QVU A;  3LSJ A;  4M3E A;  3BJB A;  4GFL A;  3ZQH A;  3QQA A;  3KZ9 A;  5FGL A;  2REK A;  2TCT A;  4PXI A;  3O8G A;  2JK3 A;  2D6Y A;  4D7N A;  5EFY A;  3CDL A;  5IOY A;  3BR2 A;  2OF7 A;  5K7H A;  3IH2 A;  2RHA A;  3VW2 A;  1ZK8 A;  3P9T A;  3LSP A;  2O7O A;  5EYR A;  3B81 A;  2TRT A;  3C2B A;  2XB5 A;  3CCY A;  2WGB A;  3ZQG A;  4XK4 A;  2UXH A;  3BTL A;  3BRU A;  3AQS A;  5D1R A;  1ORK A;  3SDG A;  5FMP A;  5J3L A;  1VI0 A;  3Q0V A;  2ID6 A;  2XGD A;  3HTA A;  3VOX A;  3QKX A;  3IH4 A;  3VUQ A;  3LWJ A;  1U9O A;  2UXI A;  3GEU A;  2FJ1 A;  5IOZ A;  3HTH A;  1UI5 A;  5F08 A;  2F07 A;  3BCG A;  2EH3 A;  2ZCX A;  3GZI A;  2QIB A;  3Q0W A;  2HXI A;  2ZOZ A;  4G12 A;  2IBD A;  3VOK A;  4MXM A;  4X1E A;  3HTJ A;  2GBY A;  1JT0 A;  4JYK A;  2HQ5 A;  3HGG A;  2OPT A;  5EZH A;  3BNI A;  2VKE A;  2Q24 A;  4B1R A;  4W97 A;  1QPI A;  2WUI A;  3SFI A;  2NS7 A;  4GCT A;  3WHB A;  4JKZ A;  2X9D A;  2PZ9 A;  3O8H A;  3CWR A;  2IU5 A;  3ZQI A;  5J1U A;  2QWT A;  4YZE A;  5FKK A;  3DEW A;  3VW1 A;  4D5C A;  3BQY A;  2XGE A;  3HGY A;  4ICH A;  2G0E A;  3BTJ A;  4D7M A;  2W53 A;  2IEK A;  2FBQ A;  2FQ4 A;  3ANP A;  1JUM A;  3TP0 A;  2XRL A;  3BR5 A;  3BTI A;  1ZKG A;  3QPS A;  4AF5 A;  2UXO A;  3ZQF A;  3IUV A;  4UDS A;  4GCK A;  2XDN A;  2V57 A;  3HIM A;  5K7Z A;  2Y30 A;  3G7R A;  3JSJ A;  4V2F A;  2XPU A;  5F27 A;  2FX0 A;  4HKU A;  1QVT A;  5K7F A;  5J1R A;  3V78 A;  2NP5 A;  2G7G A;  3RH2 A;  5FKM A;  3B6A A;  2VPR A;  4ABZ A;  3LSR A;  4GFK A;  2IAI A;  2FD5 A;  3TP3 A;  4DW6 A;  1T33 A;  3BR1 A;  5HAW A;  3PAS A;  2HXO A;  3VVZ A;  5C4Y A;  5AQC A;  5CW8 A;  1A6I A;  3LHQ A;  3RD3 A;  1RKW A;  3KKC A;  4L62 A;  5FKN A;  2DG8 A;  2NP3 A;  3FK6 A;  5IP6 A;  2Y2Z A;  1RKT A;  3VP5 A;  5H9T A;  4MO7 A;  3T6N A;  2UXP A;  5F0F A;  3MVP A;  3G1O A;  2HYT A;  3QBM A;  2OI8 A;  1T56 A;  3DPJ A;  1U9N A;  2OER A;  3CRJ A;  3FK7 A;  2DG7 A;  3ANG A;  2DTZ A;  2Y31 A;  2O7T A;  2ID3 A;  4AUX A;  3NXC A;  2NS8 A;  2HYJ A;  1JUS A;  2HKU A;  3KNW A;  3MNL A;  2QOP A;  2G7L A;  2NX4 A;  3VW0 A;  5IPA A;  2GFN A;  3G1L A;  3QPL A;  5EZG A;  2GUH A;  3HE0 A;  3DCF A;  4NEL A;  2QCO A;  4I76 A;  2ZOY A;  2VKV A;  5CXG A;  5D19 A;  3G1M A;  3ON2 A;  5DAJ A;  3ON4 A;  3COL A;  3Q0U A;  5GP9 A;  3AQT A;  4NN1 A;  2RAE A;  3BR6 A;  4AC0 A;  4M3G A;  3VVY A;  3NI7 A;  1JTY A;  4I6Z A;  2XPW A;  3PM1 A;  5HBU A;  1Z0X A;  2YVE A;  3F0C A;  3NPI A;  2XPV A;  5GPA A;  3E7Q A; 
#chains in the Genus database with same CATH topology
 2RAS A;  2R7R A;  3Q3S A;  3BQZ A;  4GCL A;  2FJI 1;  4V2G A;  2QKO A;  2JJ7 A;  2QTQ A;  2GEN A;  2XGC A;  4M3D A;  3FRQ A;  2WV1 A;  2ZCM A;  3BT9 A;  3EGQ A;  3LOC A;  5F04 A;  3CJD A;  3BR0 A;  1JUP A;  3ZQL A;  1BJZ A;  3S5R A;  1RPW A;  4B3A A;  1JTX A;  4OD5 A;  4KWA A;  3KKD A;  3EUP A;  5D18 A;  2R7V A;  3NRG A;  3V6G A;  4WIB A;  2YVH A;  4JNN A;  2G3B A;  2PBX A;  2ZCN A;  4M3F A;  4MK6 A;  3PPB A;  1Z77 A;  3BR3 A;  4M3B A;  2R7X A;  4JL3 A;  5F0H A;  1UI6 A;  3NNR A;  4ACI A;  5K58 A;  3IH3 A;  1JT6 A;  4ME9 A;  5HSZ A;  3C07 A;  3FIW A;  3FHN A;  4AC6 A;  2UXU A;  5CXI A;  5FKL A;  2G7S A;  3VVX A;  4CGR A;  3BHQ A;  5FKO A;  3DU5 A;  3VPR A;  4W1U A;  5F1J A;  2YVX A;  3LJL A;  3HTI A;  5J1Y A;  3G56 A;  2ZB9 A;  3B6C A;  3F1B A;  2I10 A;  1SGM A;  5FHP A;  3BTC A;  3O60 A;  5GPC A;  2X6O A;  3VIB A;  3WHC A;  4D5F A;  5F0C A;  1QVU A;  3LSJ A;  4M3E A;  3BJB A;  4GFL A;  3ZQH A;  3QQA A;  2B3W A;  3KZ9 A;  5FGL A;  2REK A;  2TCT A;  4PXI A;  3O8G A;  2JK3 A;  2D6Y A;  4D7N A;  5EFY A;  3CDL A;  5IOY A;  3BR2 A;  2OF7 A;  5K7H A;  3IH2 A;  2RHA A;  3VW2 A;  2R7T A;  1ZK8 A;  3P9T A;  3LSP A;  2O7O A;  4IRV A;  5EYR A;  3B81 A;  2TRT A;  3C2B A;  2XB5 A;  3CCY A;  2WGB A;  3ZQG A;  4XK4 A;  2UXH A;  3BTL A;  3BRU A;  3AQS A;  5D1R A;  1ORK A;  3SDG A;  5FMP A;  5J3L A;  1VI0 A;  3Q0V A;  2ID6 A;  2XGD A;  3HTA A;  3VOX A;  3QKX A;  3IH4 A;  3VUQ A;  3LWJ A;  1U9O A;  2UXI A;  3GEU A;  2FJ1 A;  5IOZ A;  3HTH A;  1UI5 A;  5F08 A;  2F07 A;  3BCG A;  2EH3 A;  2ZCX A;  3GZI A;  2QIB A;  3Q0W A;  2HXI A;  2ZOZ A;  4G12 A;  2IBD A;  3VOK A;  4MXM A;  4X1E A;  3HTJ A;  2GBY A;  1JT0 A;  4JYK A;  2HQ5 A;  3HGG A;  2OPT A;  5EZH A;  3BNI A;  2VKE A;  2ZY9 A;  2Q24 A;  4B1R A;  4W97 A;  1QPI A;  2WUI A;  3SFI A;  2NS7 A;  4GCT A;  3WHB A;  4JKZ A;  2X9D A;  2PZ9 A;  4U9N A;  2R7W A;  3O8H A;  3CWR A;  2A2F X;  2IU5 A;  3ZQI A;  5J1U A;  2QWT A;  4YZE A;  5FKK A;  3DEW A;  3VW1 A;  4D5C A;  3BQY A;  2XGE A;  3HGY A;  4ICH A;  2G0E A;  3BTJ A;  4D7M A;  2W53 A;  2IEK A;  2FBQ A;  2FQ4 A;  3ANP A;  1JUM A;  3TP0 A;  2XRL A;  3BR5 A;  3BTI A;  1ZKG A;  3QPS A;  4AF5 A;  2UXO A;  4C2M A;  3ZQF A;  3IUV A;  4UDS A;  5CQG A;  4GCK A;  2XDN A;  2V57 A;  3HIM A;  5K7Z A;  2Y30 A;  3G7R A;  3JSJ A;  4V2F A;  2XPU A;  5F27 A;  2FX0 A;  4HKU A;  1QVT A;  5K7F A;  5J1R A;  3V78 A;  2NP5 A;  2G7G A;  3RH2 A;  5FKM A;  3SWH A;  2R7U A;  3B6A A;  2VPR A;  4ABZ A;  3LSR A;  4GFK A;  2IAI A;  2FD5 A;  3TP3 A;  4DW6 A;  1T33 A;  3BR1 A;  4DVY P;  5HAW A;  3PAS A;  2HXO A;  3VVZ A;  5C4Y A;  5AQC A;  5CW8 A;  1A6I A;  3LHQ A;  3RD3 A;  1RKW A;  3KKC A;  4L62 A;  2R7Q A;  5FKN A;  2DG8 A;  2NP3 A;  3FK6 A;  5IP6 A;  2Y2Z A;  1RKT A;  3VP5 A;  5H9T A;  2R7S A;  4MO7 A;  3T6N A;  2UXP A;  5F0F A;  3MVP A;  3G1O A;  2HYT A;  3QBM A;  2OI8 A;  1T56 A;  3DPJ A;  1U9N A;  2OER A;  3CRJ A;  3FK7 A;  2DG7 A;  3ANG A;  2DTZ A;  2Y31 A;  2O7T A;  2ID3 A;  4AUX A;  3NXC A;  2NS8 A;  2HYJ A;  1JUS A;  4OD4 A;  2HKU A;  3KNW A;  3MNL A;  2QOP A;  2R7O A;  2G7L A;  2NX4 A;  2PFV A;  3VW0 A;  5IPA A;  2GFN A;  3G1L A;  3QPL A;  5EZG A;  3KYL A;  4U9L A;  2GUH A;  3VTI A;  3HE0 A;  3DCF A;  3K8P C;  4NEL A;  2QCO A;  4I76 A;  2ZOY A;  2B1E A;  2VKV A;  5CXG A;  5D19 A;  3G1M A;  3ON2 A;  5DAJ A;  3ON4 A;  3COL A;  3Q0U A;  5GP9 A;  3AQT A;  4NN1 A;  2RAE A;  3BR6 A;  4AC0 A;  4M3G A;  3VVY A;  3NS4 A;  3NI7 A;  1JTY A;  4I6Z A;  3DU6 A;  2XPW A;  3PM1 A;  5HBU A;  1Z0X A;  2YVE A;  3F0C A;  3NPI A;  2XPV A;  5GPA A;  3E7Q A; 
#chains in the Genus database with same CATH homology
 2RAS A;  3Q3S A;  3BQZ A;  4GCL A;  4V2G A;  2QKO A;  2JJ7 A;  2QTQ A;  2GEN A;  2XGC A;  4M3D A;  3FRQ A;  2WV1 A;  2ZCM A;  3BT9 A;  3EGQ A;  3LOC A;  5F04 A;  3CJD A;  3BR0 A;  1JUP A;  3ZQL A;  1BJZ A;  3S5R A;  1RPW A;  4B3A A;  1JTX A;  4KWA A;  3KKD A;  3EUP A;  5D18 A;  3NRG A;  3V6G A;  2YVH A;  4JNN A;  2G3B A;  2PBX A;  2ZCN A;  4M3F A;  4MK6 A;  3PPB A;  1Z77 A;  3BR3 A;  4M3B A;  4JL3 A;  5F0H A;  1UI6 A;  3NNR A;  4ACI A;  5K58 A;  3IH3 A;  1JT6 A;  4ME9 A;  5HSZ A;  3C07 A;  3FIW A;  4AC6 A;  2UXU A;  5CXI A;  5FKL A;  2G7S A;  3VVX A;  4CGR A;  3BHQ A;  5FKO A;  3VPR A;  4W1U A;  5F1J A;  3LJL A;  3HTI A;  5J1Y A;  3G56 A;  2ZB9 A;  3B6C A;  3F1B A;  2I10 A;  1SGM A;  5FHP A;  3BTC A;  3O60 A;  5GPC A;  2X6O A;  3VIB A;  3WHC A;  4D5F A;  5F0C A;  1QVU A;  3LSJ A;  4M3E A;  3BJB A;  4GFL A;  3ZQH A;  3QQA A;  3KZ9 A;  5FGL A;  2REK A;  2TCT A;  4PXI A;  3O8G A;  2JK3 A;  2D6Y A;  4D7N A;  5EFY A;  3CDL A;  5IOY A;  3BR2 A;  2OF7 A;  5K7H A;  3IH2 A;  2RHA A;  3VW2 A;  1ZK8 A;  3P9T A;  3LSP A;  2O7O A;  5EYR A;  3B81 A;  2TRT A;  3C2B A;  2XB5 A;  3CCY A;  2WGB A;  3ZQG A;  4XK4 A;  2UXH A;  3BTL A;  3BRU A;  3AQS A;  5D1R A;  1ORK A;  3SDG A;  5FMP A;  5J3L A;  1VI0 A;  3Q0V A;  2ID6 A;  2XGD A;  3HTA A;  3VOX A;  3QKX A;  3IH4 A;  3VUQ A;  3LWJ A;  1U9O A;  2UXI A;  3GEU A;  2FJ1 A;  5IOZ A;  3HTH A;  1UI5 A;  5F08 A;  2F07 A;  3BCG A;  2EH3 A;  2ZCX A;  3GZI A;  2QIB A;  3Q0W A;  2HXI A;  2ZOZ A;  4G12 A;  2IBD A;  3VOK A;  4MXM A;  4X1E A;  3HTJ A;  2GBY A;  1JT0 A;  4JYK A;  2HQ5 A;  3HGG A;  2OPT A;  5EZH A;  3BNI A;  2VKE A;  2Q24 A;  4B1R A;  4W97 A;  1QPI A;  2WUI A;  3SFI A;  2NS7 A;  4GCT A;  3WHB A;  4JKZ A;  2X9D A;  2PZ9 A;  3O8H A;  3CWR A;  2IU5 A;  3ZQI A;  5J1U A;  2QWT A;  4YZE A;  5FKK A;  3DEW A;  3VW1 A;  4D5C A;  3BQY A;  2XGE A;  3HGY A;  4ICH A;  2G0E A;  3BTJ A;  4D7M A;  2W53 A;  2IEK A;  2FBQ A;  2FQ4 A;  3ANP A;  1JUM A;  3TP0 A;  2XRL A;  3BR5 A;  3BTI A;  1ZKG A;  3QPS A;  4AF5 A;  2UXO A;  3ZQF A;  3IUV A;  4UDS A;  4GCK A;  2XDN A;  2V57 A;  3HIM A;  5K7Z A;  2Y30 A;  3G7R A;  3JSJ A;  4V2F A;  2XPU A;  5F27 A;  2FX0 A;  4HKU A;  1QVT A;  5K7F A;  5J1R A;  3V78 A;  2NP5 A;  2G7G A;  3RH2 A;  5FKM A;  3B6A A;  2VPR A;  4ABZ A;  3LSR A;  4GFK A;  2IAI A;  2FD5 A;  3TP3 A;  4DW6 A;  1T33 A;  3BR1 A;  5HAW A;  3PAS A;  2HXO A;  3VVZ A;  5C4Y A;  5AQC A;  5CW8 A;  1A6I A;  3LHQ A;  3RD3 A;  1RKW A;  3KKC A;  4L62 A;  5FKN A;  2DG8 A;  2NP3 A;  3FK6 A;  5IP6 A;  2Y2Z A;  1RKT A;  3VP5 A;  5H9T A;  4MO7 A;  3T6N A;  2UXP A;  5F0F A;  3MVP A;  3G1O A;  2HYT A;  3QBM A;  2OI8 A;  1T56 A;  3DPJ A;  1U9N A;  2OER A;  3CRJ A;  3FK7 A;  2DG7 A;  3ANG A;  2DTZ A;  2Y31 A;  2O7T A;  2ID3 A;  4AUX A;  3NXC A;  2NS8 A;  2HYJ A;  1JUS A;  2HKU A;  3KNW A;  3MNL A;  2QOP A;  2G7L A;  2NX4 A;  3VW0 A;  5IPA A;  2GFN A;  3G1L A;  3QPL A;  5EZG A;  2GUH A;  3HE0 A;  3DCF A;  4NEL A;  2QCO A;  4I76 A;  2ZOY A;  2VKV A;  5CXG A;  5D19 A;  3G1M A;  3ON2 A;  5DAJ A;  3ON4 A;  3COL A;  3Q0U A;  5GP9 A;  3AQT A;  4NN1 A;  2RAE A;  3BR6 A;  4AC0 A;  4M3G A;  3VVY A;  3NI7 A;  1JTY A;  4I6Z A;  2XPW A;  3PM1 A;  5HBU A;  1Z0X A;  2YVE A;  3F0C A;  3NPI A;  2XPV A;  5GPA A;  3E7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...