2ZCMA

Crystal structure of icar, a repressor of the tetr family
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
184
structure length
177
Chain Sequence
MKDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFIDFMYSIDGLYQFLFKFIFDVDERYIKLYVQLSSAPEALNSEIKHHLQEINTTLHDELIKYYDPTHIALDKEDFINMILMFLETWYFRASFSQKFGIIEDSKNRFKDQVYSLLNVFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of IcaR, a repressor of the TetR family implicated in biofilm formation in Staphylococcus epidermidis
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription
molecule keywords Biofilm operon icaABCD HTH-type negative transcriptional reg
total genus 72
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zcmA00
5FKNA 2IEKA 2ZOYA 3ON2A 2FX0A 2QWTA 4NN1A 4JYKA 2PZ9A 3NRGA 1A6IA 3LJLA 5F0FA 2WUIA 4L62A 2GFNA 1T56A 1JTYA 4B3AA 3WHCA 2NS7A 2OF7A 3NPIA 3FK6A 3BJBA 3O8GA 3AQSA 4G12A 5K58A 5F1JA 2QOPA 3HTIA 5FKMA 2ID6A 2XPVA 4M3EA 2X6OA 3BQYA 3DPJA 3T6NA 4UDSA 4W97A 1RPWA 3ZQFA 4AF5A 5F0HA 2F07A 4KWAA 4V2FA 3CWRA 2OPTA 1Z0XA 3LSJA 2ZB9A 2W53A 2TRTA 2Y2ZA 1VI0A 3GZIA 2O7TA 3HTHA 2QTQA 4ICHA 4M3DA 2ZCNA 2UXOA 2GUHA 5IOZA 2QKOA 2HXIA 3LSPA 3B81A 3FRQA 2NX4A 3SDGA 5FGLA 1QPIA 5H9TA 4JL3A 5DAJA 4XK4A 2JK3A 2X9DA 3VIBA 4AUXA 5J1UA 4I6ZA 3NXCA 3LOCA 3BR0A 5F27A 3VW0A 1SGMA 2XGEA 3BR1A 2UXHA 2D6YA 1QVTA 3QPSA 3F0CA 2HXOA 2O7OA 3BHQA 2ZCXA 5GP9A 2VKEA 3KZ9A 4AC6A 2G7LA 1UI5A 5EZHA 4ME9A 2NP3A 3HIMA 3F1BA 5D18A 3VVYA 3DEWA 3VVXA 2GBYA 3BQZA 3IH2A 2HYJA 3VVZA 4GCTA 3VW2A 5J3LA 5FKLA 1BJZA 2XB5A 4CGRA 3IH4A 2YVHA 2Q24A 3PM1A 2HYTA 5J1YA 4B1RA 2XGDA 4I76A 4DW6A 3P9TA 2OERA 1JUMA 3CRJA 3JSJA 3HTAA 4D7MA 5K7ZA 2G7SA 5D1RA 3G1LA 1JUSA 2IAIA 5CXIA 3BR5A 4ACIA 3TP3A 2DG7A 2HKUA 4D5CA 2XRLA 3QKXA 3Q0UA 2ZOZA 5D19A 5HSZA 3PPBA 3S5RA 1JT0A 5F04A 3BTJA 5FHPA 3IH3A 5CW8A 3BNIA 3QBMA 2DG8A 3B6CA 1U9NA 2DTZA 5EZGA 3BRUA 5K7FA 3LWJA 3NI7A 5HAWA 3VOXA 4MK6A 3ZQHA 5IP6A 2QIBA 2UXUA 2IBDA 3VP5A 2G0EA 5GPAA 3G1MA 4HKUA 4D7NA 3ZQLA 4JNNA 4V2GA 5F08A 1Z77A 3B6AA 3RH2A 2GENA 2NP5A 3BR2A 3GEUA 4ABZA 2FQ4A 2XGCA 2FJ1A 2TCTA 1U9OA 4M3GA 3BR6A 3E7QA 4YZEA 3Q0VA 4M3FA 3NNRA 2G3BA 3V6GA 2YVEA 3G56A 2V57A 3VPRA 5CXGA 3SFIA 5IOYA 2FBQA 1ZKGA 3BT9A 2JJ7A 1RKTA 3RD3A 1T33A 5EFYA 2XDNA 2UXPA 3DCFA 4M3BA 5HBUA 3ZQGA 2VKVA 3V78A 2Y30A 3MVPA 4MXMA 4GFKA 2WGBA 3LHQA 3HGYA 3TP0A 2EH3A 2FD5A 3C07A 3BTCA 5FKOA 5K7HA 3ANPA 3LSRA 3C2BA 3G7RA 2ID3A 3AQTA 5J1RA 2RHAA 3COLA 4X1EA 2ZCMA 2XPUA 4MO7A 5F0CA 1JT6A 3BTIA 3CJDA 3Q0WA 3O8HA 1UI6A 2OI8A 2Y31A 3O60A 4GFLA 4JKZA 3BTLA 3WHBA 3EGQA 4PXIA 4W1UA 2REKA 3ZQIA 2WV1A 3ON4A 5EYRA 5FKKA 3MNLA 4GCLA 2RAEA 3EUPA 3HE0A 1ZK8A 3KKCA 5FMPA 5C4YA 3VUQA 4GCKA 4NELA 2UXIA 3QQAA 2NS8A 3CDLA 2IU5A 3Q3SA 3KNWA 2RASA 1JTXA 3BR3A 3PASA 3BCGA 3ANGA 5IPAA 1RKWA 3VOKA 3G1OA 3HGGA 2VPRA 4D5FA 3QPLA 5AQCA 3FIWA 2G7GA 2I10A 2QCOA 2XPWA 3HTJA 3FK7A 1ORKA 2PBXA 3IUVA 3CCYA 5GPCA 3KKDA 1JUPA 1QVUA 3VW1A 4AC0A 2HQ5A
chains in the Genus database with same CATH superfamily
5FKNA 2IEKA 2ZOYA 3ON2A 2FX0A 2QWTA 4NN1A 4JYKA 2PZ9A 2FJI1 3NRGA 1A6IA 3LJLA 4OD4A 5F0FA 2WUIA 2ZY9A 4L62A 2GFNA 2B1EA 1T56A 1JTYA 4B3AA 2R7TA 3WHCA 2NS7A 2OF7A 3NPIA 3FK6A 4U9LA 3BJBA 3O8GA 3AQSA 4G12A 5K58A 5F1JA 2QOPA 3HTIA 2R7SA 5FKMA 2ID6A 2R7WA 2XPVA 4M3EA 2X6OA 3BQYA 3DPJA 3T6NA 4UDSA 4W97A 1RPWA 3ZQFA 4AF5A 5F0HA 2F07A 4KWAA 4V2FA 3CWRA 2OPTA 1Z0XA 3LSJA 2ZB9A 2W53A 2TRTA 2Y2ZA 1VI0A 3GZIA 2O7TA 3HTHA 2QTQA 4ICHA 4M3DA 2ZCNA 2UXOA 2GUHA 2QKOA 5IOZA 2HXIA 3LSPA 3B81A 3FRQA 2NX4A 3SDGA 5FGLA 1QPIA 5H9TA 4JL3A 5DAJA 4XK4A 2JK3A 2X9DA 3VIBA 2A2FX 4AUXA 5J1UA 4I6ZA 3NXCA 3LOCA 3BR0A 5F27A 3VW0A 1SGMA 2XGEA 3BR1A 2UXHA 3SWHA 2D6YA 1QVTA 3QPSA 3F0CA 2HXOA 2O7OA 3BHQA 2ZCXA 5GP9A 2VKEA 3KZ9A 4AC6A 2G7LA 1UI5A 5EZHA 4ME9A 2NP3A 3HIMA 3F1BA 5D18A 3VVYA 3DEWA 3VVXA 2GBYA 3BQZA 3IH2A 2HYJA 2R7UA 3VVZA 4GCTA 3VW2A 5J3LA 5FKLA 1BJZA 2R7OA 3FHNA 4C2MA 2XB5A 2PFVA 4CGRA 3IH4A 2YVHA 2Q24A 3PM1A 2HYTA 4IRVA 4B1RA 5J1YA 2XGDA 4I76A 4DW6A 3P9TA 2OERA 1JUMA 3CRJA 3JSJA 3HTAA 4D7MA 2R7XA 5K7ZA 2G7SA 5D1RA 3G1LA 1JUSA 2IAIA 5CXIA 3BR5A 4ACIA 3DU6A 3TP3A 2DG7A 2HKUA 4D5CA 2XRLA 3QKXA 3Q0UA 3DU5A 2ZOZA 5D19A 5HSZA 3PPBA 3S5RA 2R7RA 1JT0A 5F04A 3BTJA 5FHPA 3IH3A 5CW8A 3BNIA 3QBMA 2DG8A 3B6CA 1U9NA 2DTZA 5EZGA 3BRUA 5K7FA 3LWJA 3NI7A 5HAWA 3VOXA 4MK6A 3VTIA 2B3WA 3ZQHA 5IP6A 4OD5A 2QIBA 2UXUA 2IBDA 3VP5A 2G0EA 5GPAA 3G1MA 4HKUA 4D7NA 3ZQLA 4JNNA 4V2GA 5F08A 1Z77A 3B6AA 3RH2A 2GENA 2NP5A 3BR2A 3GEUA 4ABZA 3K8PC 2FQ4A 2XGCA 2FJ1A 2TCTA 1U9OA 4U9NA 4M3GA 3BR6A 3E7QA 4YZEA 3Q0VA 4M3FA 3NNRA 2G3BA 3V6GA 2YVEA 3KYLA 3G56A 2V57A 3VPRA 5CXGA 3SFIA 5IOYA 2FBQA 1ZKGA 3BT9A 2JJ7A 1RKTA 3RD3A 4DVYP 1T33A 5EFYA 2XDNA 2UXPA 3DCFA 4M3BA 5HBUA 3ZQGA 2VKVA 3NS4A 3V78A 2YVXA 2Y30A 3MVPA 4MXMA 4GFKA 2WGBA 3LHQA 3HGYA 3TP0A 2EH3A 2FD5A 3C07A 3BTCA 5FKOA 5K7HA 3ANPA 3LSRA 3C2BA 3G7RA 2ID3A 3AQTA 5J1RA 2RHAA 3COLA 4X1EA 2ZCMA 2XPUA 4MO7A 5F0CA 1JT6A 3BTIA 3CJDA 3Q0WA 3O8HA 1UI6A 2OI8A 2Y31A 3O60A 4GFLA 4JKZA 3BTLA 3WHBA 3EGQA 4PXIA 2R7QA 4W1UA 2R7VA 2REKA 3ZQIA 2WV1A 3ON4A 5EYRA 5FKKA 3MNLA 4GCLA 2RAEA 3EUPA 3HE0A 1ZK8A 3KKCA 5FMPA 5C4YA 3VUQA 4GCKA 4NELA 2UXIA 3QQAA 2NS8A 3CDLA 2IU5A 3Q3SA 5CQGA 3KNWA 2RASA 1JTXA 3BR3A 4WIBA 3PASA 3BCGA 3ANGA 5IPAA 1RKWA 3VOKA 3G1OA 3HGGA 2VPRA 4D5FA 3QPLA 5AQCA 3FIWA 2G7GA 2I10A 2QCOA 2XPWA 3HTJA 3FK7A 1ORKA 2PBXA 3IUVA 3CCYA 5GPCA 3KKDA 1JUPA 1QVUA 3VW1A 4AC0A 2HQ5A
chains in the Genus database with same CATH topology
5FKNA 2IEKA 2ZOYA 3ON2A 2FX0A 2QWTA 4NN1A 4JYKA 2PZ9A 3NRGA 1A6IA 3LJLA 5F0FA 2WUIA 4L62A 2GFNA 1T56A 1JTYA 4B3AA 3WHCA 2NS7A 2OF7A 3NPIA 3FK6A 3BJBA 3O8GA 3AQSA 4G12A 5K58A 5F1JA 2QOPA 3HTIA 5FKMA 2ID6A 2XPVA 4M3EA 2X6OA 3BQYA 3DPJA 3T6NA 4UDSA 4W97A 1RPWA 3ZQFA 4AF5A 5F0HA 2F07A 4KWAA 4V2FA 3CWRA 2OPTA 1Z0XA 3LSJA 2ZB9A 2W53A 2TRTA 2Y2ZA 1VI0A 3GZIA 2O7TA 3HTHA 2QTQA 4ICHA 4M3DA 2ZCNA 2UXOA 2GUHA 5IOZA 2QKOA 2HXIA 3LSPA 3B81A 3FRQA 2NX4A 3SDGA 5FGLA 1QPIA 5H9TA 4JL3A 5DAJA 4XK4A 2JK3A 2X9DA 3VIBA 4AUXA 5J1UA 4I6ZA 3NXCA 3LOCA 3BR0A 5F27A 3VW0A 1SGMA 2XGEA 3BR1A 2UXHA 2D6YA 1QVTA 3QPSA 3F0CA 2HXOA 2O7OA 3BHQA 2ZCXA 5GP9A 2VKEA 3KZ9A 4AC6A 2G7LA 1UI5A 5EZHA 4ME9A 2NP3A 3HIMA 3F1BA 5D18A 3VVYA 3DEWA 3VVXA 2GBYA 3BQZA 3IH2A 2HYJA 3VVZA 4GCTA 3VW2A 5J3LA 5FKLA 1BJZA 2XB5A 4CGRA 3IH4A 2YVHA 2Q24A 3PM1A 2HYTA 5J1YA 4B1RA 2XGDA 4I76A 4DW6A 3P9TA 2OERA 1JUMA 3CRJA 3JSJA 3HTAA 4D7MA 5K7ZA 2G7SA 5D1RA 3G1LA 1JUSA 2IAIA 5CXIA 3BR5A 4ACIA 3TP3A 2DG7A 2HKUA 4D5CA 2XRLA 3QKXA 3Q0UA 2ZOZA 5D19A 5HSZA 3PPBA 3S5RA 1JT0A 5F04A 3BTJA 5FHPA 3IH3A 5CW8A 3BNIA 3QBMA 2DG8A 3B6CA 1U9NA 2DTZA 5EZGA 3BRUA 5K7FA 3LWJA 3NI7A 5HAWA 3VOXA 4MK6A 3ZQHA 5IP6A 2QIBA 2UXUA 2IBDA 3VP5A 2G0EA 5GPAA 3G1MA 4HKUA 4D7NA 3ZQLA 4JNNA 4V2GA 5F08A 1Z77A 3B6AA 3RH2A 2GENA 2NP5A 3BR2A 3GEUA 4ABZA 2FQ4A 2XGCA 2FJ1A 2TCTA 1U9OA 4M3GA 3BR6A 3E7QA 4YZEA 3Q0VA 4M3FA 3NNRA 2G3BA 3V6GA 2YVEA 3G56A 2V57A 3VPRA 5CXGA 3SFIA 5IOYA 2FBQA 1ZKGA 3BT9A 2JJ7A 1RKTA 3RD3A 1T33A 5EFYA 2XDNA 2UXPA 3DCFA 4M3BA 5HBUA 3ZQGA 2VKVA 3V78A 2Y30A 3MVPA 4MXMA 4GFKA 2WGBA 3LHQA 3HGYA 3TP0A 2EH3A 2FD5A 3C07A 3BTCA 5FKOA 5K7HA 3ANPA 3LSRA 3C2BA 3G7RA 2ID3A 3AQTA 5J1RA 2RHAA 3COLA 4X1EA 2ZCMA 2XPUA 4MO7A 5F0CA 1JT6A 3BTIA 3CJDA 3Q0WA 3O8HA 1UI6A 2OI8A 2Y31A 3O60A 4GFLA 4JKZA 3BTLA 3WHBA 3EGQA 4PXIA 4W1UA 2REKA 3ZQIA 2WV1A 3ON4A 5EYRA 5FKKA 3MNLA 4GCLA 2RAEA 3EUPA 3HE0A 1ZK8A 3KKCA 5FMPA 5C4YA 3VUQA 4GCKA 4NELA 2UXIA 3QQAA 2NS8A 3CDLA 2IU5A 3Q3SA 3KNWA 2RASA 1JTXA 3BR3A 3PASA 3BCGA 3ANGA 5IPAA 1RKWA 3VOKA 3G1OA 3HGGA 2VPRA 4D5FA 3QPLA 5AQCA 3FIWA 2G7GA 2I10A 2QCOA 2XPWA 3HTJA 3FK7A 1ORKA 2PBXA 3IUVA 3CCYA 5GPCA 3KKDA 1JUPA 1QVUA 3VW1A 4AC0A 2HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKN A;  2IEK A;  2ZOY A;  3ON2 A;  2FX0 A;  2QWT A;  4NN1 A;  4JYK A;  2PZ9 A;  3NRG A;  1A6I A;  3LJL A;  5F0F A;  2WUI A;  4L62 A;  2GFN A;  1T56 A;  1JTY A;  4B3A A;  3WHC A;  2NS7 A;  2OF7 A;  3NPI A;  3FK6 A;  3BJB A;  3O8G A;  3AQS A;  4G12 A;  5K58 A;  5F1J A;  2QOP A;  3HTI A;  5FKM A;  2ID6 A;  2XPV A;  4M3E A;  2X6O A;  3BQY A;  3DPJ A;  3T6N A;  4UDS A;  4W97 A;  1RPW A;  3ZQF A;  4AF5 A;  5F0H A;  2F07 A;  4KWA A;  4V2F A;  3CWR A;  2OPT A;  1Z0X A;  3LSJ A;  2ZB9 A;  2W53 A;  2TRT A;  2Y2Z A;  1VI0 A;  3GZI A;  2O7T A;  3HTH A;  2QTQ A;  4ICH A;  4M3D A;  2ZCN A;  2UXO A;  2GUH A;  5IOZ A;  2QKO A;  2HXI A;  3LSP A;  3B81 A;  3FRQ A;  2NX4 A;  3SDG A;  5FGL A;  1QPI A;  5H9T A;  4JL3 A;  5DAJ A;  4XK4 A;  2JK3 A;  2X9D A;  3VIB A;  4AUX A;  5J1U A;  4I6Z A;  3NXC A;  3LOC A;  3BR0 A;  5F27 A;  3VW0 A;  1SGM A;  2XGE A;  3BR1 A;  2UXH A;  2D6Y A;  1QVT A;  3QPS A;  3F0C A;  2HXO A;  2O7O A;  3BHQ A;  2ZCX A;  5GP9 A;  2VKE A;  3KZ9 A;  4AC6 A;  2G7L A;  1UI5 A;  5EZH A;  4ME9 A;  2NP3 A;  3HIM A;  3F1B A;  5D18 A;  3VVY A;  3DEW A;  3VVX A;  2GBY A;  3BQZ A;  3IH2 A;  2HYJ A;  3VVZ A;  4GCT A;  3VW2 A;  5J3L A;  5FKL A;  1BJZ A;  2XB5 A;  4CGR A;  3IH4 A;  2YVH A;  2Q24 A;  3PM1 A;  2HYT A;  5J1Y A;  4B1R A;  2XGD A;  4I76 A;  4DW6 A;  3P9T A;  2OER A;  1JUM A;  3CRJ A;  3JSJ A;  3HTA A;  4D7M A;  5K7Z A;  2G7S A;  5D1R A;  3G1L A;  1JUS A;  2IAI A;  5CXI A;  3BR5 A;  4ACI A;  3TP3 A;  2DG7 A;  2HKU A;  4D5C A;  2XRL A;  3QKX A;  3Q0U A;  2ZOZ A;  5D19 A;  5HSZ A;  3PPB A;  3S5R A;  1JT0 A;  5F04 A;  3BTJ A;  5FHP A;  3IH3 A;  5CW8 A;  3BNI A;  3QBM A;  2DG8 A;  3B6C A;  1U9N A;  2DTZ A;  5EZG A;  3BRU A;  5K7F A;  3LWJ A;  3NI7 A;  5HAW A;  3VOX A;  4MK6 A;  3ZQH A;  5IP6 A;  2QIB A;  2UXU A;  2IBD A;  3VP5 A;  2G0E A;  5GPA A;  3G1M A;  4HKU A;  4D7N A;  3ZQL A;  4JNN A;  4V2G A;  5F08 A;  1Z77 A;  3B6A A;  3RH2 A;  2GEN A;  2NP5 A;  3BR2 A;  3GEU A;  4ABZ A;  2FQ4 A;  2XGC A;  2FJ1 A;  2TCT A;  1U9O A;  4M3G A;  3BR6 A;  3E7Q A;  4YZE A;  3Q0V A;  4M3F A;  3NNR A;  2G3B A;  3V6G A;  2YVE A;  3G56 A;  2V57 A;  3VPR A;  5CXG A;  3SFI A;  5IOY A;  2FBQ A;  1ZKG A;  3BT9 A;  2JJ7 A;  1RKT A;  3RD3 A;  1T33 A;  5EFY A;  2XDN A;  2UXP A;  3DCF A;  4M3B A;  5HBU A;  3ZQG A;  2VKV A;  3V78 A;  2Y30 A;  3MVP A;  4MXM A;  4GFK A;  2WGB A;  3LHQ A;  3HGY A;  3TP0 A;  2EH3 A;  2FD5 A;  3C07 A;  3BTC A;  5FKO A;  5K7H A;  3ANP A;  3LSR A;  3C2B A;  3G7R A;  2ID3 A;  3AQT A;  5J1R A;  2RHA A;  3COL A;  4X1E A;  2ZCM A;  2XPU A;  4MO7 A;  5F0C A;  1JT6 A;  3BTI A;  3CJD A;  3Q0W A;  3O8H A;  1UI6 A;  2OI8 A;  2Y31 A;  3O60 A;  4GFL A;  4JKZ A;  3BTL A;  3WHB A;  3EGQ A;  4PXI A;  4W1U A;  2REK A;  3ZQI A;  2WV1 A;  3ON4 A;  5EYR A;  5FKK A;  3MNL A;  4GCL A;  2RAE A;  3EUP A;  3HE0 A;  1ZK8 A;  3KKC A;  5FMP A;  5C4Y A;  3VUQ A;  4GCK A;  4NEL A;  2UXI A;  3QQA A;  2NS8 A;  3CDL A;  2IU5 A;  3Q3S A;  3KNW A;  2RAS A;  1JTX A;  3BR3 A;  3PAS A;  3BCG A;  3ANG A;  5IPA A;  1RKW A;  3VOK A;  3G1O A;  3HGG A;  2VPR A;  4D5F A;  3QPL A;  5AQC A;  3FIW A;  2G7G A;  2I10 A;  2QCO A;  2XPW A;  3HTJ A;  3FK7 A;  1ORK A;  2PBX A;  3IUV A;  3CCY A;  5GPC A;  3KKD A;  1JUP A;  1QVU A;  3VW1 A;  4AC0 A;  2HQ5 A; 
#chains in the Genus database with same CATH topology
 5FKN A;  2IEK A;  2ZOY A;  3ON2 A;  2FX0 A;  2QWT A;  4NN1 A;  4JYK A;  2PZ9 A;  2FJI 1;  3NRG A;  1A6I A;  3LJL A;  4OD4 A;  5F0F A;  2WUI A;  2ZY9 A;  4L62 A;  2GFN A;  2B1E A;  1T56 A;  1JTY A;  4B3A A;  2R7T A;  3WHC A;  2NS7 A;  2OF7 A;  3NPI A;  3FK6 A;  4U9L A;  3BJB A;  3O8G A;  3AQS A;  4G12 A;  5K58 A;  5F1J A;  2QOP A;  3HTI A;  2R7S A;  5FKM A;  2ID6 A;  2R7W A;  2XPV A;  4M3E A;  2X6O A;  3BQY A;  3DPJ A;  3T6N A;  4UDS A;  4W97 A;  1RPW A;  3ZQF A;  4AF5 A;  5F0H A;  2F07 A;  4KWA A;  4V2F A;  3CWR A;  2OPT A;  1Z0X A;  3LSJ A;  2ZB9 A;  2W53 A;  2TRT A;  2Y2Z A;  1VI0 A;  3GZI A;  2O7T A;  3HTH A;  2QTQ A;  4ICH A;  4M3D A;  2ZCN A;  2UXO A;  2GUH A;  2QKO A;  5IOZ A;  2HXI A;  3LSP A;  3B81 A;  3FRQ A;  2NX4 A;  3SDG A;  5FGL A;  1QPI A;  5H9T A;  4JL3 A;  5DAJ A;  4XK4 A;  2JK3 A;  2X9D A;  3VIB A;  2A2F X;  4AUX A;  5J1U A;  4I6Z A;  3NXC A;  3LOC A;  3BR0 A;  5F27 A;  3VW0 A;  1SGM A;  2XGE A;  3BR1 A;  2UXH A;  3SWH A;  2D6Y A;  1QVT A;  3QPS A;  3F0C A;  2HXO A;  2O7O A;  3BHQ A;  2ZCX A;  5GP9 A;  2VKE A;  3KZ9 A;  4AC6 A;  2G7L A;  1UI5 A;  5EZH A;  4ME9 A;  2NP3 A;  3HIM A;  3F1B A;  5D18 A;  3VVY A;  3DEW A;  3VVX A;  2GBY A;  3BQZ A;  3IH2 A;  2HYJ A;  2R7U A;  3VVZ A;  4GCT A;  3VW2 A;  5J3L A;  5FKL A;  1BJZ A;  2R7O A;  3FHN A;  4C2M A;  2XB5 A;  2PFV A;  4CGR A;  3IH4 A;  2YVH A;  2Q24 A;  3PM1 A;  2HYT A;  4IRV A;  4B1R A;  5J1Y A;  2XGD A;  4I76 A;  4DW6 A;  3P9T A;  2OER A;  1JUM A;  3CRJ A;  3JSJ A;  3HTA A;  4D7M A;  2R7X A;  5K7Z A;  2G7S A;  5D1R A;  3G1L A;  1JUS A;  2IAI A;  5CXI A;  3BR5 A;  4ACI A;  3DU6 A;  3TP3 A;  2DG7 A;  2HKU A;  4D5C A;  2XRL A;  3QKX A;  3Q0U A;  3DU5 A;  2ZOZ A;  5D19 A;  5HSZ A;  3PPB A;  3S5R A;  2R7R A;  1JT0 A;  5F04 A;  3BTJ A;  5FHP A;  3IH3 A;  5CW8 A;  3BNI A;  3QBM A;  2DG8 A;  3B6C A;  1U9N A;  2DTZ A;  5EZG A;  3BRU A;  5K7F A;  3LWJ A;  3NI7 A;  5HAW A;  3VOX A;  4MK6 A;  3VTI A;  2B3W A;  3ZQH A;  5IP6 A;  4OD5 A;  2QIB A;  2UXU A;  2IBD A;  3VP5 A;  2G0E A;  5GPA A;  3G1M A;  4HKU A;  4D7N A;  3ZQL A;  4JNN A;  4V2G A;  5F08 A;  1Z77 A;  3B6A A;  3RH2 A;  2GEN A;  2NP5 A;  3BR2 A;  3GEU A;  4ABZ A;  3K8P C;  2FQ4 A;  2XGC A;  2FJ1 A;  2TCT A;  1U9O A;  4U9N A;  4M3G A;  3BR6 A;  3E7Q A;  4YZE A;  3Q0V A;  4M3F A;  3NNR A;  2G3B A;  3V6G A;  2YVE A;  3KYL A;  3G56 A;  2V57 A;  3VPR A;  5CXG A;  3SFI A;  5IOY A;  2FBQ A;  1ZKG A;  3BT9 A;  2JJ7 A;  1RKT A;  3RD3 A;  4DVY P;  1T33 A;  5EFY A;  2XDN A;  2UXP A;  3DCF A;  4M3B A;  5HBU A;  3ZQG A;  2VKV A;  3NS4 A;  3V78 A;  2YVX A;  2Y30 A;  3MVP A;  4MXM A;  4GFK A;  2WGB A;  3LHQ A;  3HGY A;  3TP0 A;  2EH3 A;  2FD5 A;  3C07 A;  3BTC A;  5FKO A;  5K7H A;  3ANP A;  3LSR A;  3C2B A;  3G7R A;  2ID3 A;  3AQT A;  5J1R A;  2RHA A;  3COL A;  4X1E A;  2ZCM A;  2XPU A;  4MO7 A;  5F0C A;  1JT6 A;  3BTI A;  3CJD A;  3Q0W A;  3O8H A;  1UI6 A;  2OI8 A;  2Y31 A;  3O60 A;  4GFL A;  4JKZ A;  3BTL A;  3WHB A;  3EGQ A;  4PXI A;  2R7Q A;  4W1U A;  2R7V A;  2REK A;  3ZQI A;  2WV1 A;  3ON4 A;  5EYR A;  5FKK A;  3MNL A;  4GCL A;  2RAE A;  3EUP A;  3HE0 A;  1ZK8 A;  3KKC A;  5FMP A;  5C4Y A;  3VUQ A;  4GCK A;  4NEL A;  2UXI A;  3QQA A;  2NS8 A;  3CDL A;  2IU5 A;  3Q3S A;  5CQG A;  3KNW A;  2RAS A;  1JTX A;  3BR3 A;  4WIB A;  3PAS A;  3BCG A;  3ANG A;  5IPA A;  1RKW A;  3VOK A;  3G1O A;  3HGG A;  2VPR A;  4D5F A;  3QPL A;  5AQC A;  3FIW A;  2G7G A;  2I10 A;  2QCO A;  2XPW A;  3HTJ A;  3FK7 A;  1ORK A;  2PBX A;  3IUV A;  3CCY A;  5GPC A;  3KKD A;  1JUP A;  1QVU A;  3VW1 A;  4AC0 A;  2HQ5 A; 
#chains in the Genus database with same CATH homology
 5FKN A;  2IEK A;  2ZOY A;  3ON2 A;  2FX0 A;  2QWT A;  4NN1 A;  4JYK A;  2PZ9 A;  3NRG A;  1A6I A;  3LJL A;  5F0F A;  2WUI A;  4L62 A;  2GFN A;  1T56 A;  1JTY A;  4B3A A;  3WHC A;  2NS7 A;  2OF7 A;  3NPI A;  3FK6 A;  3BJB A;  3O8G A;  3AQS A;  4G12 A;  5K58 A;  5F1J A;  2QOP A;  3HTI A;  5FKM A;  2ID6 A;  2XPV A;  4M3E A;  2X6O A;  3BQY A;  3DPJ A;  3T6N A;  4UDS A;  4W97 A;  1RPW A;  3ZQF A;  4AF5 A;  5F0H A;  2F07 A;  4KWA A;  4V2F A;  3CWR A;  2OPT A;  1Z0X A;  3LSJ A;  2ZB9 A;  2W53 A;  2TRT A;  2Y2Z A;  1VI0 A;  3GZI A;  2O7T A;  3HTH A;  2QTQ A;  4ICH A;  4M3D A;  2ZCN A;  2UXO A;  2GUH A;  5IOZ A;  2QKO A;  2HXI A;  3LSP A;  3B81 A;  3FRQ A;  2NX4 A;  3SDG A;  5FGL A;  1QPI A;  5H9T A;  4JL3 A;  5DAJ A;  4XK4 A;  2JK3 A;  2X9D A;  3VIB A;  4AUX A;  5J1U A;  4I6Z A;  3NXC A;  3LOC A;  3BR0 A;  5F27 A;  3VW0 A;  1SGM A;  2XGE A;  3BR1 A;  2UXH A;  2D6Y A;  1QVT A;  3QPS A;  3F0C A;  2HXO A;  2O7O A;  3BHQ A;  2ZCX A;  5GP9 A;  2VKE A;  3KZ9 A;  4AC6 A;  2G7L A;  1UI5 A;  5EZH A;  4ME9 A;  2NP3 A;  3HIM A;  3F1B A;  5D18 A;  3VVY A;  3DEW A;  3VVX A;  2GBY A;  3BQZ A;  3IH2 A;  2HYJ A;  3VVZ A;  4GCT A;  3VW2 A;  5J3L A;  5FKL A;  1BJZ A;  2XB5 A;  4CGR A;  3IH4 A;  2YVH A;  2Q24 A;  3PM1 A;  2HYT A;  5J1Y A;  4B1R A;  2XGD A;  4I76 A;  4DW6 A;  3P9T A;  2OER A;  1JUM A;  3CRJ A;  3JSJ A;  3HTA A;  4D7M A;  5K7Z A;  2G7S A;  5D1R A;  3G1L A;  1JUS A;  2IAI A;  5CXI A;  3BR5 A;  4ACI A;  3TP3 A;  2DG7 A;  2HKU A;  4D5C A;  2XRL A;  3QKX A;  3Q0U A;  2ZOZ A;  5D19 A;  5HSZ A;  3PPB A;  3S5R A;  1JT0 A;  5F04 A;  3BTJ A;  5FHP A;  3IH3 A;  5CW8 A;  3BNI A;  3QBM A;  2DG8 A;  3B6C A;  1U9N A;  2DTZ A;  5EZG A;  3BRU A;  5K7F A;  3LWJ A;  3NI7 A;  5HAW A;  3VOX A;  4MK6 A;  3ZQH A;  5IP6 A;  2QIB A;  2UXU A;  2IBD A;  3VP5 A;  2G0E A;  5GPA A;  3G1M A;  4HKU A;  4D7N A;  3ZQL A;  4JNN A;  4V2G A;  5F08 A;  1Z77 A;  3B6A A;  3RH2 A;  2GEN A;  2NP5 A;  3BR2 A;  3GEU A;  4ABZ A;  2FQ4 A;  2XGC A;  2FJ1 A;  2TCT A;  1U9O A;  4M3G A;  3BR6 A;  3E7Q A;  4YZE A;  3Q0V A;  4M3F A;  3NNR A;  2G3B A;  3V6G A;  2YVE A;  3G56 A;  2V57 A;  3VPR A;  5CXG A;  3SFI A;  5IOY A;  2FBQ A;  1ZKG A;  3BT9 A;  2JJ7 A;  1RKT A;  3RD3 A;  1T33 A;  5EFY A;  2XDN A;  2UXP A;  3DCF A;  4M3B A;  5HBU A;  3ZQG A;  2VKV A;  3V78 A;  2Y30 A;  3MVP A;  4MXM A;  4GFK A;  2WGB A;  3LHQ A;  3HGY A;  3TP0 A;  2EH3 A;  2FD5 A;  3C07 A;  3BTC A;  5FKO A;  5K7H A;  3ANP A;  3LSR A;  3C2B A;  3G7R A;  2ID3 A;  3AQT A;  5J1R A;  2RHA A;  3COL A;  4X1E A;  2ZCM A;  2XPU A;  4MO7 A;  5F0C A;  1JT6 A;  3BTI A;  3CJD A;  3Q0W A;  3O8H A;  1UI6 A;  2OI8 A;  2Y31 A;  3O60 A;  4GFL A;  4JKZ A;  3BTL A;  3WHB A;  3EGQ A;  4PXI A;  4W1U A;  2REK A;  3ZQI A;  2WV1 A;  3ON4 A;  5EYR A;  5FKK A;  3MNL A;  4GCL A;  2RAE A;  3EUP A;  3HE0 A;  1ZK8 A;  3KKC A;  5FMP A;  5C4Y A;  3VUQ A;  4GCK A;  4NEL A;  2UXI A;  3QQA A;  2NS8 A;  3CDL A;  2IU5 A;  3Q3S A;  3KNW A;  2RAS A;  1JTX A;  3BR3 A;  3PAS A;  3BCG A;  3ANG A;  5IPA A;  1RKW A;  3VOK A;  3G1O A;  3HGG A;  2VPR A;  4D5F A;  3QPL A;  5AQC A;  3FIW A;  2G7G A;  2I10 A;  2QCO A;  2XPW A;  3HTJ A;  3FK7 A;  1ORK A;  2PBX A;  3IUV A;  3CCY A;  5GPC A;  3KKD A;  1JUP A;  1QVU A;  3VW1 A;  4AC0 A;  2HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...