2ZCMA

Crystal structure of icar, a repressor of the tetr family
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
184
structure length
177
Chain Sequence
MKDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFIDFMYSIDGLYQFLFKFIFDVDERYIKLYVQLSSAPEALNSEIKHHLQEINTTLHDELIKYYDPTHIALDKEDFINMILMFLETWYFRASFSQKFGIIEDSKNRFKDQVYSLLNVFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biofilm operon icaABCD HTH-type negative transcriptional reg
publication title Crystal structure of IcaR, a repressor of the TetR family implicated in biofilm formation in Staphylococcus epidermidis
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription
total genus 72
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zcmA00
1BJZA 4ACIA 4GCLA 2PZ9A 3VVYA 2XGEA 5HBUA 1RKWA 5IPAA 3COLA 2IEKA 3LHQA 4AC6A 1JT0A 5FKNA 3KKCA 2TRTA 3KNWA 3QKXA 2XRLA 4D7NA 3E7QA 3LSJA 4M3FA 5EZGA 2QIBA 3EGQA 4MO7A 3VPRA 3HE0A 3BTIA 3BT9A 2Y30A 2PBXA 2ZB9A 2UXIA 1UI5A 1RPWA 3AQTA 3QPSA 3F0CA 3G1OA 5D18A 4GCKA 2G0EA 2TCTA 2VPRA 5CXIA 3DCFA 3Q0WA 3LSPA 3BJBA 4JKZA 1Z0XA 4G12A 3T6NA 1U9OA 2JK3A 3ON2A 4YZEA 5CW8A 3ANPA 4XK4A 2GBYA 5FGLA 1Z77A 5EZHA 3B6AA 1QVTA 3PPBA 3BR5A 3IUVA 5FKKA 3BRUA 2UXOA 3BR6A 4W1UA 4HKUA 4ICHA 3B81A 2REKA 2QWTA 4W97A 2FQ4A 3GZIA 3IH4A 3BNIA 2G7SA 3CDLA 5CXGA 3NRGA 5FKOA 3BR3A 3NI7A 2D6YA 5GPCA 4UDSA 4AC0A 2IU5A 3PM1A 4GFKA 2QTQA 2GFNA 3F1BA 3ZQGA 3EUPA 3QBMA 2UXHA 2G7GA 1JUPA 5FHPA 4B3AA 2XPUA 2OI8A 1JTYA 3BTLA 4AF5A 2XPWA 3G7RA 3VW1A 2QOPA 1JT6A 5D19A 1QVUA 5J1YA 2JJ7A 5D1RA 5K7HA 3Q3SA 2G7LA 3FRQA 1VI0A 2HXIA 3VOKA 3ZQFA 4X1EA 3CCYA 3CJDA 3C07A 1T56A 2W53A 3VVZA 3O60A 4MK6A 2HKUA 2FX0A 3LOCA 5EFYA 3BR1A 1JUSA 5J3LA 1QPIA 2UXPA 1SGMA 2DG7A 3JSJA 2NS7A 2OPTA 4M3GA 2V57A 3WHCA 2O7OA 2Y31A 5F04A 2I10A 3TP3A 4ME9A 2G3BA 2NS8A 4I76A 4I6ZA 3AQSA 3DEWA 3FIWA 2VKVA 2RHAA 3KZ9A 2NX4A 3CRJA 2ZCNA 3VUQA 2ZCMA 3BQZA 5F27A 2OF7A 3BQYA 3RH2A 3HGYA 4GCTA 4MXMA 1U9NA 2XPVA 4M3BA 2FD5A 2NP5A 3Q0VA 4M3DA 3FK7A 4JNNA 4V2GA 5DAJA 5F0CA 4DW6A 1T33A 3BHQA 5HSZA 5H9TA 2XGDA 3VVXA 3O8HA 3SFIA 2YVEA 4JYKA 3HTIA 3MVPA 4D5CA 3KKDA 3B6CA 5IOYA 2O7TA 3TP0A 4ABZA 3LJLA 2HXOA 3RD3A 4V2FA 3PASA 2FJ1A 3FK6A 5K7ZA 3HGGA 3SDGA 4D7MA 3HTJA 3QPLA 1ORKA 2EH3A 3BCGA 4JL3A 2ZCXA 5FKLA 1ZKGA 4L62A 3ZQLA 3G1MA 3V6GA 2QKOA 3WHBA 3NXCA 3HTAA 3BR0A 3GEUA 1JUMA 3O8GA 2UXUA 2WV1A 2FBQA 2OERA 2HYTA 3LSRA 2IAIA 4KWAA 1ZK8A 2ID6A 2VKEA 5IP6A 3VP5A 4GFLA 3VOXA 2HYJA 2Q24A 2RAEA 5FKMA 3BTCA 2GENA 1JTXA 5IOZA 3DPJA 3VW2A 2Y2ZA 3MNLA 5GP9A 4PXIA 3VIBA 3C2BA 2QCOA 1A6IA 5GPAA 2X9DA 3V78A 2DTZA 3ANGA 4NELA 3NPIA 5F0FA 2WGBA 3ZQHA 3P9TA 4AUXA 3ZQIA 3G56A 2ID3A 5J1RA 2XGCA 5C4YA 3BTJA 2NP3A 3S5RA 3HIMA 3CWRA 3BR2A 2ZOZA 3LWJA 2XDNA 4NN1A 5F08A 2F07A 2HQ5A 3VW0A 1UI6A 2X6OA 2DG8A 1RKTA 5HAWA 3Q0UA 5AQCA 5F0HA 2WUIA 4D5FA 3ON4A 5J1UA 5K7FA 2ZOYA 3HTHA 5K58A 3IH2A 4B1RA 5F1JA 3G1LA 4M3EA 5FMPA 3IH3A 2XB5A 4CGRA 2YVHA 2GUHA 2RASA 3NNRA 2IBDA 3QQAA 5EYRA
chains in the Genus database with same CATH superfamily
1BJZA 4ACIA 4GCLA 2PZ9A 3VVYA 2XGEA 5HBUA 1RKWA 5IPAA 3COLA 2IEKA 3LHQA 4AC6A 1JT0A 3KYLA 5FKNA 4DVYP 3KKCA 2TRTA 3KNWA 3QKXA 2XRLA 4D7NA 3E7QA 3LSJA 4M3FA 5EZGA 2QIBA 3EGQA 4MO7A 3VPRA 2R7UA 3K8PC 3HE0A 3BTIA 3BT9A 2Y30A 2PBXA 2ZB9A 2UXIA 1UI5A 1RPWA 3AQTA 3QPSA 3F0CA 3G1OA 5D18A 4GCKA 2G0EA 2TCTA 2VPRA 2R7VA 5CXIA 3DCFA 3Q0WA 3LSPA 3BJBA 4JKZA 1Z0XA 4U9LA 4G12A 3T6NA 1U9OA 2JK3A 3ON2A 4YZEA 5CW8A 3ANPA 4XK4A 2GBYA 5FGLA 1Z77A 5EZHA 3B6AA 1QVTA 3PPBA 3BR5A 5CQGA 3IUVA 5FKKA 3BRUA 2UXOA 3BR6A 4W1UA 4HKUA 4ICHA 3B81A 2REKA 2QWTA 4W97A 2FQ4A 3GZIA 3IH4A 3BNIA 2G7SA 3CDLA 5CXGA 3NRGA 5FKOA 3BR3A 3NI7A 2D6YA 5GPCA 4UDSA 4AC0A 2IU5A 3PM1A 4GFKA 2QTQA 2GFNA 3F1BA 3ZQGA 3EUPA 3QBMA 2UXHA 2G7GA 1JUPA 5FHPA 3FHNA 4B3AA 2XPUA 2OI8A 1JTYA 3BTLA 3DU6A 4AF5A 2XPWA 3G7RA 3VW1A 2QOPA 1JT6A 5D19A 1QVUA 5J1YA 2JJ7A 5D1RA 5K7HA 4U9NA 3Q3SA 2G7LA 3FRQA 2R7XA 1VI0A 2HXIA 3VOKA 2R7OA 3ZQFA 4X1EA 3CCYA 3CJDA 3C07A 1T56A 2W53A 3VVZA 3O60A 4MK6A 2HKUA 2FX0A 3LOCA 5EFYA 3BR1A 1JUSA 5J3LA 1QPIA 2UXPA 1SGMA 2DG7A 3JSJA 2NS7A 2OPTA 4M3GA 2V57A 3WHCA 2O7OA 2Y31A 5F04A 2I10A 3TP3A 4ME9A 2G3BA 2NS8A 4I76A 4I6ZA 3AQSA 3DEWA 3FIWA 2VKVA 2RHAA 3KZ9A 2NX4A 3CRJA 2ZCNA 2ZCMA 3VUQA 3BQZA 5F27A 2B1EA 2OF7A 3BQYA 3RH2A 2YVXA 3HGYA 4GCTA 4MXMA 1U9NA 2XPVA 4OD4A 4M3BA 2FD5A 2NP5A 3Q0VA 4M3DA 3FK7A 4JNNA 4V2GA 5DAJA 5F0CA 4DW6A 1T33A 3BHQA 5HSZA 5H9TA 2XGDA 3VVXA 3O8HA 3SFIA 2YVEA 4JYKA 4IRVA 2R7RA 3HTIA 4C2MA 3MVPA 4D5CA 3KKDA 3B6CA 5IOYA 2O7TA 3TP0A 4ABZA 3LJLA 2HXOA 3RD3A 4V2FA 3PASA 2FJ1A 3FK6A 2R7TA 5K7ZA 3HGGA 3SDGA 4D7MA 3HTJA 3QPLA 1ORKA 2EH3A 3BCGA 4JL3A 2ZCXA 5FKLA 1ZKGA 4L62A 3VTIA 3ZQLA 3SWHA 2ZY9A 3G1MA 3V6GA 2QKOA 2PFVA 3WHBA 3NXCA 3HTAA 3BR0A 3GEUA 1JUMA 3O8GA 2UXUA 2WV1A 2FBQA 2OERA 2HYTA 3LSRA 2IAIA 4KWAA 1ZK8A 2ID6A 2VKEA 5IP6A 3VP5A 4GFLA 3VOXA 2HYJA 2Q24A 2RAEA 5FKMA 3BTCA 2GENA 4OD5A 1JTXA 5IOZA 3DPJA 3VW2A 2Y2ZA 3MNLA 5GP9A 4PXIA 3VIBA 3C2BA 2QCOA 1A6IA 2FJI1 5GPAA 2X9DA 3V78A 2DTZA 3ANGA 4NELA 2B3WA 3NPIA 2A2FX 5F0FA 2WGBA 3ZQHA 3P9TA 2R7WA 4AUXA 3ZQIA 3G56A 2ID3A 5J1RA 2XGCA 5C4YA 3BTJA 2NP3A 3S5RA 3HIMA 3CWRA 3BR2A 2ZOZA 3LWJA 2XDNA 4NN1A 5F08A 2F07A 2HQ5A 3VW0A 1UI6A 3NS4A 3DU5A 2X6OA 2DG8A 1RKTA 5HAWA 3Q0UA 5AQCA 5F0HA 2WUIA 2R7QA 4D5FA 3ON4A 5J1UA 5K7FA 2ZOYA 3HTHA 4WIBA 5K58A 3IH2A 4B1RA 2R7SA 5F1JA 3G1LA 4M3EA 5FMPA 3IH3A 2XB5A 4CGRA 2YVHA 2GUHA 2RASA 3NNRA 2IBDA 3QQAA 5EYRA
chains in the Genus database with same CATH topology
1BJZA 4ACIA 4GCLA 2PZ9A 3VVYA 2XGEA 5HBUA 1RKWA 5IPAA 3COLA 2IEKA 3LHQA 4AC6A 1JT0A 5FKNA 3KKCA 2TRTA 3KNWA 3QKXA 2XRLA 4D7NA 3E7QA 3LSJA 4M3FA 5EZGA 2QIBA 3EGQA 4MO7A 3VPRA 3HE0A 3BTIA 3BT9A 2Y30A 2PBXA 2ZB9A 2UXIA 1UI5A 1RPWA 3AQTA 3QPSA 3F0CA 3G1OA 5D18A 4GCKA 2G0EA 2TCTA 2VPRA 5CXIA 3DCFA 3Q0WA 3LSPA 3BJBA 4JKZA 1Z0XA 4G12A 3T6NA 1U9OA 2JK3A 3ON2A 4YZEA 5CW8A 3ANPA 4XK4A 2GBYA 5FGLA 1Z77A 5EZHA 3B6AA 1QVTA 3PPBA 3BR5A 3IUVA 5FKKA 3BRUA 2UXOA 3BR6A 4W1UA 4HKUA 4ICHA 3B81A 2REKA 2QWTA 4W97A 2FQ4A 3GZIA 3IH4A 3BNIA 2G7SA 3CDLA 5CXGA 3NRGA 5FKOA 3BR3A 3NI7A 2D6YA 5GPCA 4UDSA 4AC0A 2IU5A 3PM1A 4GFKA 2QTQA 2GFNA 3F1BA 3ZQGA 3EUPA 3QBMA 2UXHA 2G7GA 1JUPA 5FHPA 4B3AA 2XPUA 2OI8A 1JTYA 3BTLA 4AF5A 2XPWA 3G7RA 3VW1A 2QOPA 1JT6A 5D19A 1QVUA 5J1YA 2JJ7A 5D1RA 5K7HA 3Q3SA 2G7LA 3FRQA 1VI0A 2HXIA 3VOKA 3ZQFA 4X1EA 3CCYA 3CJDA 3C07A 1T56A 2W53A 3VVZA 3O60A 4MK6A 2HKUA 2FX0A 3LOCA 5EFYA 3BR1A 1JUSA 5J3LA 1QPIA 2UXPA 1SGMA 2DG7A 3JSJA 2NS7A 2OPTA 4M3GA 2V57A 3WHCA 2O7OA 2Y31A 5F04A 2I10A 3TP3A 4ME9A 2G3BA 2NS8A 4I76A 4I6ZA 3AQSA 3DEWA 3FIWA 2VKVA 2RHAA 3KZ9A 2NX4A 3CRJA 2ZCNA 3VUQA 2ZCMA 3BQZA 5F27A 2OF7A 3BQYA 3RH2A 3HGYA 4GCTA 4MXMA 1U9NA 2XPVA 4M3BA 2FD5A 2NP5A 3Q0VA 4M3DA 3FK7A 4JNNA 4V2GA 5DAJA 5F0CA 4DW6A 1T33A 3BHQA 5HSZA 5H9TA 2XGDA 3VVXA 3O8HA 3SFIA 2YVEA 4JYKA 3HTIA 3MVPA 4D5CA 3KKDA 3B6CA 5IOYA 2O7TA 3TP0A 4ABZA 3LJLA 2HXOA 3RD3A 4V2FA 3PASA 2FJ1A 3FK6A 5K7ZA 3HGGA 3SDGA 4D7MA 3HTJA 3QPLA 1ORKA 2EH3A 3BCGA 4JL3A 2ZCXA 5FKLA 1ZKGA 4L62A 3ZQLA 3G1MA 3V6GA 2QKOA 3WHBA 3NXCA 3HTAA 3BR0A 3GEUA 1JUMA 3O8GA 2UXUA 2WV1A 2FBQA 2OERA 2HYTA 3LSRA 2IAIA 4KWAA 1ZK8A 2ID6A 2VKEA 5IP6A 3VP5A 4GFLA 3VOXA 2HYJA 2Q24A 2RAEA 5FKMA 3BTCA 2GENA 1JTXA 5IOZA 3DPJA 3VW2A 2Y2ZA 3MNLA 5GP9A 4PXIA 3VIBA 3C2BA 2QCOA 1A6IA 5GPAA 2X9DA 3V78A 2DTZA 3ANGA 4NELA 3NPIA 5F0FA 2WGBA 3ZQHA 3P9TA 4AUXA 3ZQIA 3G56A 2ID3A 5J1RA 2XGCA 5C4YA 3BTJA 2NP3A 3S5RA 3HIMA 3CWRA 3BR2A 2ZOZA 3LWJA 2XDNA 4NN1A 5F08A 2F07A 2HQ5A 3VW0A 1UI6A 2X6OA 2DG8A 1RKTA 5HAWA 3Q0UA 5AQCA 5F0HA 2WUIA 4D5FA 3ON4A 5J1UA 5K7FA 2ZOYA 3HTHA 5K58A 3IH2A 4B1RA 5F1JA 3G1LA 4M3EA 5FMPA 3IH3A 2XB5A 4CGRA 2YVHA 2GUHA 2RASA 3NNRA 2IBDA 3QQAA 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BJZ A;  4ACI A;  4GCL A;  2PZ9 A;  3VVY A;  2XGE A;  5HBU A;  1RKW A;  5IPA A;  3COL A;  2IEK A;  3LHQ A;  4AC6 A;  1JT0 A;  5FKN A;  3KKC A;  2TRT A;  3KNW A;  3QKX A;  2XRL A;  4D7N A;  3E7Q A;  3LSJ A;  4M3F A;  5EZG A;  2QIB A;  3EGQ A;  4MO7 A;  3VPR A;  3HE0 A;  3BTI A;  3BT9 A;  2Y30 A;  2PBX A;  2ZB9 A;  2UXI A;  1UI5 A;  1RPW A;  3AQT A;  3QPS A;  3F0C A;  3G1O A;  5D18 A;  4GCK A;  2G0E A;  2TCT A;  2VPR A;  5CXI A;  3DCF A;  3Q0W A;  3LSP A;  3BJB A;  4JKZ A;  1Z0X A;  4G12 A;  3T6N A;  1U9O A;  2JK3 A;  3ON2 A;  4YZE A;  5CW8 A;  3ANP A;  4XK4 A;  2GBY A;  5FGL A;  1Z77 A;  5EZH A;  3B6A A;  1QVT A;  3PPB A;  3BR5 A;  3IUV A;  5FKK A;  3BRU A;  2UXO A;  3BR6 A;  4W1U A;  4HKU A;  4ICH A;  3B81 A;  2REK A;  2QWT A;  4W97 A;  2FQ4 A;  3GZI A;  3IH4 A;  3BNI A;  2G7S A;  3CDL A;  5CXG A;  3NRG A;  5FKO A;  3BR3 A;  3NI7 A;  2D6Y A;  5GPC A;  4UDS A;  4AC0 A;  2IU5 A;  3PM1 A;  4GFK A;  2QTQ A;  2GFN A;  3F1B A;  3ZQG A;  3EUP A;  3QBM A;  2UXH A;  2G7G A;  1JUP A;  5FHP A;  4B3A A;  2XPU A;  2OI8 A;  1JTY A;  3BTL A;  4AF5 A;  2XPW A;  3G7R A;  3VW1 A;  2QOP A;  1JT6 A;  5D19 A;  1QVU A;  5J1Y A;  2JJ7 A;  5D1R A;  5K7H A;  3Q3S A;  2G7L A;  3FRQ A;  1VI0 A;  2HXI A;  3VOK A;  3ZQF A;  4X1E A;  3CCY A;  3CJD A;  3C07 A;  1T56 A;  2W53 A;  3VVZ A;  3O60 A;  4MK6 A;  2HKU A;  2FX0 A;  3LOC A;  5EFY A;  3BR1 A;  1JUS A;  5J3L A;  1QPI A;  2UXP A;  1SGM A;  2DG7 A;  3JSJ A;  2NS7 A;  2OPT A;  4M3G A;  2V57 A;  3WHC A;  2O7O A;  2Y31 A;  5F04 A;  2I10 A;  3TP3 A;  4ME9 A;  2G3B A;  2NS8 A;  4I76 A;  4I6Z A;  3AQS A;  3DEW A;  3FIW A;  2VKV A;  2RHA A;  3KZ9 A;  2NX4 A;  3CRJ A;  2ZCN A;  3VUQ A;  2ZCM A;  3BQZ A;  5F27 A;  2OF7 A;  3BQY A;  3RH2 A;  3HGY A;  4GCT A;  4MXM A;  1U9N A;  2XPV A;  4M3B A;  2FD5 A;  2NP5 A;  3Q0V A;  4M3D A;  3FK7 A;  4JNN A;  4V2G A;  5DAJ A;  5F0C A;  4DW6 A;  1T33 A;  3BHQ A;  5HSZ A;  5H9T A;  2XGD A;  3VVX A;  3O8H A;  3SFI A;  2YVE A;  4JYK A;  3HTI A;  3MVP A;  4D5C A;  3KKD A;  3B6C A;  5IOY A;  2O7T A;  3TP0 A;  4ABZ A;  3LJL A;  2HXO A;  3RD3 A;  4V2F A;  3PAS A;  2FJ1 A;  3FK6 A;  5K7Z A;  3HGG A;  3SDG A;  4D7M A;  3HTJ A;  3QPL A;  1ORK A;  2EH3 A;  3BCG A;  4JL3 A;  2ZCX A;  5FKL A;  1ZKG A;  4L62 A;  3ZQL A;  3G1M A;  3V6G A;  2QKO A;  3WHB A;  3NXC A;  3HTA A;  3BR0 A;  3GEU A;  1JUM A;  3O8G A;  2UXU A;  2WV1 A;  2FBQ A;  2OER A;  2HYT A;  3LSR A;  2IAI A;  4KWA A;  1ZK8 A;  2ID6 A;  2VKE A;  5IP6 A;  3VP5 A;  4GFL A;  3VOX A;  2HYJ A;  2Q24 A;  2RAE A;  5FKM A;  3BTC A;  2GEN A;  1JTX A;  5IOZ A;  3DPJ A;  3VW2 A;  2Y2Z A;  3MNL A;  5GP9 A;  4PXI A;  3VIB A;  3C2B A;  2QCO A;  1A6I A;  5GPA A;  2X9D A;  3V78 A;  2DTZ A;  3ANG A;  4NEL A;  3NPI A;  5F0F A;  2WGB A;  3ZQH A;  3P9T A;  4AUX A;  3ZQI A;  3G56 A;  2ID3 A;  5J1R A;  2XGC A;  5C4Y A;  3BTJ A;  2NP3 A;  3S5R A;  3HIM A;  3CWR A;  3BR2 A;  2ZOZ A;  3LWJ A;  2XDN A;  4NN1 A;  5F08 A;  2F07 A;  2HQ5 A;  3VW0 A;  1UI6 A;  2X6O A;  2DG8 A;  1RKT A;  5HAW A;  3Q0U A;  5AQC A;  5F0H A;  2WUI A;  4D5F A;  3ON4 A;  5J1U A;  5K7F A;  2ZOY A;  3HTH A;  5K58 A;  3IH2 A;  4B1R A;  5F1J A;  3G1L A;  4M3E A;  5FMP A;  3IH3 A;  2XB5 A;  4CGR A;  2YVH A;  2GUH A;  2RAS A;  3NNR A;  2IBD A;  3QQA A;  5EYR A; 
#chains in the Genus database with same CATH topology
 1BJZ A;  4ACI A;  4GCL A;  2PZ9 A;  3VVY A;  2XGE A;  5HBU A;  1RKW A;  5IPA A;  3COL A;  2IEK A;  3LHQ A;  4AC6 A;  1JT0 A;  3KYL A;  5FKN A;  4DVY P;  3KKC A;  2TRT A;  3KNW A;  3QKX A;  2XRL A;  4D7N A;  3E7Q A;  3LSJ A;  4M3F A;  5EZG A;  2QIB A;  3EGQ A;  4MO7 A;  3VPR A;  2R7U A;  3K8P C;  3HE0 A;  3BTI A;  3BT9 A;  2Y30 A;  2PBX A;  2ZB9 A;  2UXI A;  1UI5 A;  1RPW A;  3AQT A;  3QPS A;  3F0C A;  3G1O A;  5D18 A;  4GCK A;  2G0E A;  2TCT A;  2VPR A;  2R7V A;  5CXI A;  3DCF A;  3Q0W A;  3LSP A;  3BJB A;  4JKZ A;  1Z0X A;  4U9L A;  4G12 A;  3T6N A;  1U9O A;  2JK3 A;  3ON2 A;  4YZE A;  5CW8 A;  3ANP A;  4XK4 A;  2GBY A;  5FGL A;  1Z77 A;  5EZH A;  3B6A A;  1QVT A;  3PPB A;  3BR5 A;  5CQG A;  3IUV A;  5FKK A;  3BRU A;  2UXO A;  3BR6 A;  4W1U A;  4HKU A;  4ICH A;  3B81 A;  2REK A;  2QWT A;  4W97 A;  2FQ4 A;  3GZI A;  3IH4 A;  3BNI A;  2G7S A;  3CDL A;  5CXG A;  3NRG A;  5FKO A;  3BR3 A;  3NI7 A;  2D6Y A;  5GPC A;  4UDS A;  4AC0 A;  2IU5 A;  3PM1 A;  4GFK A;  2QTQ A;  2GFN A;  3F1B A;  3ZQG A;  3EUP A;  3QBM A;  2UXH A;  2G7G A;  1JUP A;  5FHP A;  3FHN A;  4B3A A;  2XPU A;  2OI8 A;  1JTY A;  3BTL A;  3DU6 A;  4AF5 A;  2XPW A;  3G7R A;  3VW1 A;  2QOP A;  1JT6 A;  5D19 A;  1QVU A;  5J1Y A;  2JJ7 A;  5D1R A;  5K7H A;  4U9N A;  3Q3S A;  2G7L A;  3FRQ A;  2R7X A;  1VI0 A;  2HXI A;  3VOK A;  2R7O A;  3ZQF A;  4X1E A;  3CCY A;  3CJD A;  3C07 A;  1T56 A;  2W53 A;  3VVZ A;  3O60 A;  4MK6 A;  2HKU A;  2FX0 A;  3LOC A;  5EFY A;  3BR1 A;  1JUS A;  5J3L A;  1QPI A;  2UXP A;  1SGM A;  2DG7 A;  3JSJ A;  2NS7 A;  2OPT A;  4M3G A;  2V57 A;  3WHC A;  2O7O A;  2Y31 A;  5F04 A;  2I10 A;  3TP3 A;  4ME9 A;  2G3B A;  2NS8 A;  4I76 A;  4I6Z A;  3AQS A;  3DEW A;  3FIW A;  2VKV A;  2RHA A;  3KZ9 A;  2NX4 A;  3CRJ A;  2ZCN A;  2ZCM A;  3VUQ A;  3BQZ A;  5F27 A;  2B1E A;  2OF7 A;  3BQY A;  3RH2 A;  2YVX A;  3HGY A;  4GCT A;  4MXM A;  1U9N A;  2XPV A;  4OD4 A;  4M3B A;  2FD5 A;  2NP5 A;  3Q0V A;  4M3D A;  3FK7 A;  4JNN A;  4V2G A;  5DAJ A;  5F0C A;  4DW6 A;  1T33 A;  3BHQ A;  5HSZ A;  5H9T A;  2XGD A;  3VVX A;  3O8H A;  3SFI A;  2YVE A;  4JYK A;  4IRV A;  2R7R A;  3HTI A;  4C2M A;  3MVP A;  4D5C A;  3KKD A;  3B6C A;  5IOY A;  2O7T A;  3TP0 A;  4ABZ A;  3LJL A;  2HXO A;  3RD3 A;  4V2F A;  3PAS A;  2FJ1 A;  3FK6 A;  2R7T A;  5K7Z A;  3HGG A;  3SDG A;  4D7M A;  3HTJ A;  3QPL A;  1ORK A;  2EH3 A;  3BCG A;  4JL3 A;  2ZCX A;  5FKL A;  1ZKG A;  4L62 A;  3VTI A;  3ZQL A;  3SWH A;  2ZY9 A;  3G1M A;  3V6G A;  2QKO A;  2PFV A;  3WHB A;  3NXC A;  3HTA A;  3BR0 A;  3GEU A;  1JUM A;  3O8G A;  2UXU A;  2WV1 A;  2FBQ A;  2OER A;  2HYT A;  3LSR A;  2IAI A;  4KWA A;  1ZK8 A;  2ID6 A;  2VKE A;  5IP6 A;  3VP5 A;  4GFL A;  3VOX A;  2HYJ A;  2Q24 A;  2RAE A;  5FKM A;  3BTC A;  2GEN A;  4OD5 A;  1JTX A;  5IOZ A;  3DPJ A;  3VW2 A;  2Y2Z A;  3MNL A;  5GP9 A;  4PXI A;  3VIB A;  3C2B A;  2QCO A;  1A6I A;  2FJI 1;  5GPA A;  2X9D A;  3V78 A;  2DTZ A;  3ANG A;  4NEL A;  2B3W A;  3NPI A;  2A2F X;  5F0F A;  2WGB A;  3ZQH A;  3P9T A;  2R7W A;  4AUX A;  3ZQI A;  3G56 A;  2ID3 A;  5J1R A;  2XGC A;  5C4Y A;  3BTJ A;  2NP3 A;  3S5R A;  3HIM A;  3CWR A;  3BR2 A;  2ZOZ A;  3LWJ A;  2XDN A;  4NN1 A;  5F08 A;  2F07 A;  2HQ5 A;  3VW0 A;  1UI6 A;  3NS4 A;  3DU5 A;  2X6O A;  2DG8 A;  1RKT A;  5HAW A;  3Q0U A;  5AQC A;  5F0H A;  2WUI A;  2R7Q A;  4D5F A;  3ON4 A;  5J1U A;  5K7F A;  2ZOY A;  3HTH A;  4WIB A;  5K58 A;  3IH2 A;  4B1R A;  2R7S A;  5F1J A;  3G1L A;  4M3E A;  5FMP A;  3IH3 A;  2XB5 A;  4CGR A;  2YVH A;  2GUH A;  2RAS A;  3NNR A;  2IBD A;  3QQA A;  5EYR A; 
#chains in the Genus database with same CATH homology
 1BJZ A;  4ACI A;  4GCL A;  2PZ9 A;  3VVY A;  2XGE A;  5HBU A;  1RKW A;  5IPA A;  3COL A;  2IEK A;  3LHQ A;  4AC6 A;  1JT0 A;  5FKN A;  3KKC A;  2TRT A;  3KNW A;  3QKX A;  2XRL A;  4D7N A;  3E7Q A;  3LSJ A;  4M3F A;  5EZG A;  2QIB A;  3EGQ A;  4MO7 A;  3VPR A;  3HE0 A;  3BTI A;  3BT9 A;  2Y30 A;  2PBX A;  2ZB9 A;  2UXI A;  1UI5 A;  1RPW A;  3AQT A;  3QPS A;  3F0C A;  3G1O A;  5D18 A;  4GCK A;  2G0E A;  2TCT A;  2VPR A;  5CXI A;  3DCF A;  3Q0W A;  3LSP A;  3BJB A;  4JKZ A;  1Z0X A;  4G12 A;  3T6N A;  1U9O A;  2JK3 A;  3ON2 A;  4YZE A;  5CW8 A;  3ANP A;  4XK4 A;  2GBY A;  5FGL A;  1Z77 A;  5EZH A;  3B6A A;  1QVT A;  3PPB A;  3BR5 A;  3IUV A;  5FKK A;  3BRU A;  2UXO A;  3BR6 A;  4W1U A;  4HKU A;  4ICH A;  3B81 A;  2REK A;  2QWT A;  4W97 A;  2FQ4 A;  3GZI A;  3IH4 A;  3BNI A;  2G7S A;  3CDL A;  5CXG A;  3NRG A;  5FKO A;  3BR3 A;  3NI7 A;  2D6Y A;  5GPC A;  4UDS A;  4AC0 A;  2IU5 A;  3PM1 A;  4GFK A;  2QTQ A;  2GFN A;  3F1B A;  3ZQG A;  3EUP A;  3QBM A;  2UXH A;  2G7G A;  1JUP A;  5FHP A;  4B3A A;  2XPU A;  2OI8 A;  1JTY A;  3BTL A;  4AF5 A;  2XPW A;  3G7R A;  3VW1 A;  2QOP A;  1JT6 A;  5D19 A;  1QVU A;  5J1Y A;  2JJ7 A;  5D1R A;  5K7H A;  3Q3S A;  2G7L A;  3FRQ A;  1VI0 A;  2HXI A;  3VOK A;  3ZQF A;  4X1E A;  3CCY A;  3CJD A;  3C07 A;  1T56 A;  2W53 A;  3VVZ A;  3O60 A;  4MK6 A;  2HKU A;  2FX0 A;  3LOC A;  5EFY A;  3BR1 A;  1JUS A;  5J3L A;  1QPI A;  2UXP A;  1SGM A;  2DG7 A;  3JSJ A;  2NS7 A;  2OPT A;  4M3G A;  2V57 A;  3WHC A;  2O7O A;  2Y31 A;  5F04 A;  2I10 A;  3TP3 A;  4ME9 A;  2G3B A;  2NS8 A;  4I76 A;  4I6Z A;  3AQS A;  3DEW A;  3FIW A;  2VKV A;  2RHA A;  3KZ9 A;  2NX4 A;  3CRJ A;  2ZCN A;  3VUQ A;  2ZCM A;  3BQZ A;  5F27 A;  2OF7 A;  3BQY A;  3RH2 A;  3HGY A;  4GCT A;  4MXM A;  1U9N A;  2XPV A;  4M3B A;  2FD5 A;  2NP5 A;  3Q0V A;  4M3D A;  3FK7 A;  4JNN A;  4V2G A;  5DAJ A;  5F0C A;  4DW6 A;  1T33 A;  3BHQ A;  5HSZ A;  5H9T A;  2XGD A;  3VVX A;  3O8H A;  3SFI A;  2YVE A;  4JYK A;  3HTI A;  3MVP A;  4D5C A;  3KKD A;  3B6C A;  5IOY A;  2O7T A;  3TP0 A;  4ABZ A;  3LJL A;  2HXO A;  3RD3 A;  4V2F A;  3PAS A;  2FJ1 A;  3FK6 A;  5K7Z A;  3HGG A;  3SDG A;  4D7M A;  3HTJ A;  3QPL A;  1ORK A;  2EH3 A;  3BCG A;  4JL3 A;  2ZCX A;  5FKL A;  1ZKG A;  4L62 A;  3ZQL A;  3G1M A;  3V6G A;  2QKO A;  3WHB A;  3NXC A;  3HTA A;  3BR0 A;  3GEU A;  1JUM A;  3O8G A;  2UXU A;  2WV1 A;  2FBQ A;  2OER A;  2HYT A;  3LSR A;  2IAI A;  4KWA A;  1ZK8 A;  2ID6 A;  2VKE A;  5IP6 A;  3VP5 A;  4GFL A;  3VOX A;  2HYJ A;  2Q24 A;  2RAE A;  5FKM A;  3BTC A;  2GEN A;  1JTX A;  5IOZ A;  3DPJ A;  3VW2 A;  2Y2Z A;  3MNL A;  5GP9 A;  4PXI A;  3VIB A;  3C2B A;  2QCO A;  1A6I A;  5GPA A;  2X9D A;  3V78 A;  2DTZ A;  3ANG A;  4NEL A;  3NPI A;  5F0F A;  2WGB A;  3ZQH A;  3P9T A;  4AUX A;  3ZQI A;  3G56 A;  2ID3 A;  5J1R A;  2XGC A;  5C4Y A;  3BTJ A;  2NP3 A;  3S5R A;  3HIM A;  3CWR A;  3BR2 A;  2ZOZ A;  3LWJ A;  2XDN A;  4NN1 A;  5F08 A;  2F07 A;  2HQ5 A;  3VW0 A;  1UI6 A;  2X6O A;  2DG8 A;  1RKT A;  5HAW A;  3Q0U A;  5AQC A;  5F0H A;  2WUI A;  4D5F A;  3ON4 A;  5J1U A;  5K7F A;  2ZOY A;  3HTH A;  5K58 A;  3IH2 A;  4B1R A;  5F1J A;  3G1L A;  4M3E A;  5FMP A;  3IH3 A;  2XB5 A;  4CGR A;  2YVH A;  2GUH A;  2RAS A;  3NNR A;  2IBD A;  3QQA A;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...