2ZCMA

Crystal structure of icar, a repressor of the tetr family
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
184
structure length
177
Chain Sequence
MKDKIIDNAITLFSEKGYDGTTLDDISKSVNIKKASLYYHYDNKEEIYRKSVENCFNYFIDFMYSIDGLYQFLFKFIFDVDERYIKLYVQLSSAPEALNSEIKHHLQEINTTLHDELIKYYDPTHIALDKEDFINMILMFLETWYFRASFSQKFGIIEDSKNRFKDQVYSLLNVFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biofilm operon icaABCD HTH-type negative transcriptional reg
publication title Crystal structure of IcaR, a repressor of the TetR family implicated in biofilm formation in Staphylococcus epidermidis
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription
total genus 72
structure length 177
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zcmA00
4AC0A 3DEWA 3KKCA 5K58A 3BHQA 2IAIA 5K7ZA 3B6CA 3P9TA 5F0FA 1QVUA 2ZCXA 2ID3A 3B81A 4YZEA 5HAWA 3GEUA 4NN1A 2O7TA 5F27A 3NXCA 3WHCA 3TP3A 5J1UA 2QKOA 3B6AA 5FKLA 4HKUA 3HTIA 2XPWA 3S5RA 3V78A 2V57A 5GPCA 3Q3SA 3IH4A 2RHAA 3ZQFA 3LSJA 4L62A 3VVYA 3VVZA 4I76A 2HXOA 4M3GA 2QWTA 1RPWA 1UI6A 1JUPA 1Z77A 1JT6A 4MO7A 4M3BA 3F0CA 4D7MA 1JUSA 3BRUA 2FD5A 2NS7A 2ID6A 5GP9A 5HSZA 3LSPA 2HYJA 3ZQLA 4GCTA 3O8HA 2Y31A 2XGCA 2DTZA 3G1LA 2WGBA 3Q0VA 4AUXA 2TRTA 4NELA 5CXIA 2O7OA 3LHQA 4MXMA 5EZGA 5FKMA 3QKXA 3CJDA 3IUVA 5IOZA 2VKVA 2UXOA 2FQ4A 3FIWA 3VW1A 4JNNA 3LJLA 4UDSA 5HBUA 5CW8A 5FKOA 3EUPA 4I6ZA 2DG7A 2ZOYA 3BTIA 2EH3A 3ZQGA 4V2FA 3BNIA 4ABZA 5FKNA 2OF7A 4B1RA 3MNLA 5FKKA 3C2BA 1QVTA 1T56A 2OI8A 3WHBA 5IOYA 3BR6A 3FK7A 3SFIA 4XK4A 1QPIA 2IEKA 5AQCA 4KWAA 2GENA 3HTJA 3AQTA 3VOKA 1JTYA 3RD3A 2G7GA 2WUIA 2X9DA 3RH2A 3O60A 4W97A 5J1RA 3BR1A 3LOCA 4JL3A 3DCFA 4D5CA 5EYRA 5J3LA 1BJZA 3VIBA 3G1MA 4D7NA 2XPUA 5F0HA 4JYKA 3VPRA 5FHPA 1A6IA 2X6OA 2GUHA 1VI0A 2UXHA 5D19A 3ON4A 3F1BA 1ZK8A 3KKDA 3CWRA 3T6NA 2RASA 3CDLA 3HE0A 3G1OA 1U9NA 3E7QA 2VPRA 2Y30A 5EZHA 2FX0A 3NPIA 2REKA 2G3BA 3DPJA 4ACIA 2ZCNA 3CCYA 5EFYA 2DG8A 3AQSA 2PBXA 4B3AA 5D1RA 3G56A 3BR2A 3VW2A 2PZ9A 5F04A 3FRQA 5K7FA 3PASA 2QIBA 3BQYA 3ANGA 1JUMA 2XRLA 3HTHA 3KNWA 3VP5A 4GCLA 3NI7A 3BR3A 2NP3A 3JSJA 3NRGA 4GFKA 2TCTA 4M3EA 3ON2A 3ZQIA 3VVXA 2D6YA 2YVEA 1RKTA 3QPLA 2NP5A 2GFNA 5FMPA 5CXGA 2FJ1A 3Q0WA 3ZQHA 5C4YA 3HGYA 4X1EA 2WV1A 4V2GA 4G12A 3PPBA 4ME9A 4M3FA 2HQ5A 2OERA 3PM1A 2W53A 2VKEA 5D18A 5F1JA 2QOPA 2JJ7A 3HTAA 4M3DA 3KZ9A 1Z0XA 1U9OA 3O8GA 2ZOZA 5DAJA 4CGRA 3IH3A 1JT0A 4DW6A 3Q0UA 1RKWA 2G7SA 5F08A 2NS8A 3MVPA 2Y2ZA 4W1UA 2G0EA 2QCOA 4PXIA 3BQZA 3BJBA 3EGQA 2XPVA 2GBYA 3VW0A 5GPAA 1UI5A 2JK3A 2I10A 2NX4A 1SGMA 2RAEA 4ICHA 3BT9A 3C07A 3BTLA 1ZKGA 4GCKA 3IH2A 3LWJA 4MK6A 1JTXA 2FBQA 3HIMA 4AF5A 3COLA 5J1YA 4AC6A 2HKUA 3G7RA 2XGDA 3FK6A 2IBDA 2IU5A 3SDGA 2ZB9A 3BTJA 3ANPA 3HGGA 3QPSA 3QBMA 2XGEA 3TP0A 2YVHA 5IP6A 3BTCA 2Q24A 2XB5A 3BR5A 3VOXA 3NNRA 1T33A 5F0CA 3BR0A 1ORKA 4JKZA 2HXIA 5FGLA 2G7LA 2OPTA 2XDNA 3VUQA 3GZIA 2QTQA 2HYTA 2F07A 2ZCMA 5IPAA 3LSRA 2UXPA 5H9TA 2UXUA 3BCGA 4GFLA 2UXIA 3CRJA 5K7HA 4D5FA 3V6GA 3QQAA
chains in the Genus database with same CATH superfamily
4AC0A 3DEWA 3KKCA 5K58A 3BHQA 2IAIA 5K7ZA 3B6CA 3P9TA 5F0FA 1QVUA 2ZCXA 2ID3A 3B81A 3DU6A 4YZEA 5HAWA 3GEUA 2A2FX 4NN1A 2O7TA 5F27A 3NXCA 3WHCA 3TP3A 5J1UA 2QKOA 3B6AA 5FKLA 4HKUA 3HTIA 2XPWA 3S5RA 3V78A 2V57A 5GPCA 3Q3SA 4U9LA 3IH4A 2RHAA 3ZQFA 3LSJA 4L62A 3VVYA 3VVZA 4I76A 2HXOA 4M3GA 2QWTA 1RPWA 1UI6A 1JUPA 1Z77A 1JT6A 4MO7A 4M3BA 3F0CA 4D7MA 1JUSA 3BRUA 2FD5A 2NS7A 2ID6A 5GP9A 5HSZA 3LSPA 2HYJA 3ZQLA 4GCTA 3O8HA 2Y31A 2XGCA 2DTZA 3G1LA 2WGBA 3Q0VA 4AUXA 2TRTA 4NELA 5CXIA 2O7OA 3LHQA 4MXMA 5EZGA 5FKMA 3QKXA 3CJDA 3IUVA 5IOZA 2VKVA 2UXOA 2FQ4A 3FIWA 3VW1A 4JNNA 3LJLA 4UDSA 5HBUA 3KYLA 4OD4A 5CW8A 5FKOA 3EUPA 4I6ZA 2DG7A 2ZOYA 3BTIA 2EH3A 3ZQGA 4V2FA 3BNIA 4ABZA 5FKNA 2OF7A 4B1RA 3MNLA 5FKKA 3C2BA 1QVTA 1T56A 2OI8A 3WHBA 5IOYA 3BR6A 3FK7A 3SFIA 4XK4A 3VTIA 1QPIA 2R7XA 2IEKA 5AQCA 4KWAA 2GENA 3HTJA 3AQTA 2B3WA 3VOKA 1JTYA 3RD3A 4OD5A 2G7GA 2WUIA 2X9DA 3RH2A 3O60A 4W97A 5J1RA 3BR1A 3LOCA 4JL3A 3DCFA 4D5CA 2ZY9A 5EYRA 5J3LA 1BJZA 3VIBA 3NS4A 3G1MA 3FHNA 4D7NA 2XPUA 2R7VA 5F0HA 4JYKA 3VPRA 5FHPA 1A6IA 2X6OA 2GUHA 2R7OA 1VI0A 2UXHA 5D19A 3ON4A 3F1BA 1ZK8A 3KKDA 2YVXA 3CWRA 3T6NA 2RASA 3CDLA 3HE0A 3G1OA 1U9NA 3E7QA 2VPRA 2Y30A 5EZHA 2FX0A 3NPIA 2REKA 2G3BA 3DPJA 4ACIA 2ZCNA 3CCYA 5EFYA 2DG8A 3AQSA 2PBXA 4B3AA 5D1RA 3G56A 3BR2A 3VW2A 2PZ9A 4U9NA 5F04A 3FRQA 5K7FA 3PASA 2QIBA 3BQYA 3ANGA 1JUMA 2XRLA 3HTHA 3KNWA 3VP5A 4GCLA 3NI7A 3BR3A 2NP3A 3JSJA 3NRGA 4GFKA 2TCTA 4M3EA 3ON2A 3ZQIA 3VVXA 2D6YA 2YVEA 1RKTA 3QPLA 2NP5A 2GFNA 5FMPA 5CXGA 2FJ1A 3Q0WA 3ZQHA 5C4YA 3HGYA 4X1EA 2WV1A 4V2GA 4G12A 3PPBA 4ME9A 4M3FA 2HQ5A 2OERA 3PM1A 2W53A 2VKEA 5D18A 5F1JA 2QOPA 2JJ7A 3HTAA 4M3DA 3KZ9A 1Z0XA 2R7RA 1U9OA 3O8GA 2ZOZA 5DAJA 4CGRA 3IH3A 1JT0A 4DW6A 3Q0UA 1RKWA 2G7SA 5F08A 4C2MA 5CQGA 2NS8A 3MVPA 2Y2ZA 4W1UA 2G0EA 2R7UA 2QCOA 4PXIA 3BQZA 3K8PC 3BJBA 3EGQA 2XPVA 2GBYA 3VW0A 5GPAA 1UI5A 2JK3A 2I10A 2NX4A 1SGMA 2RAEA 3DU5A 4ICHA 3BT9A 3C07A 3BTLA 1ZKGA 2FJI1 4WIBA 4GCKA 3IH2A 3LWJA 4MK6A 2R7WA 1JTXA 2FBQA 2B1EA 3HIMA 4AF5A 3COLA 5J1YA 4AC6A 2HKUA 3G7RA 2XGDA 3FK6A 2IBDA 2IU5A 3SDGA 2ZB9A 3BTJA 3ANPA 3HGGA 3QPSA 3QBMA 2XGEA 3TP0A 2YVHA 5IP6A 3BTCA 4IRVA 2Q24A 2XB5A 3BR5A 2R7QA 3VOXA 3NNRA 1T33A 5F0CA 4DVYP 3BR0A 1ORKA 4JKZA 2HXIA 5FGLA 3SWHA 2G7LA 2OPTA 2XDNA 3VUQA 3GZIA 2QTQA 2R7SA 2HYTA 2PFVA 2F07A 2ZCMA 5IPAA 3LSRA 2UXPA 5H9TA 2UXUA 3BCGA 4GFLA 2UXIA 3CRJA 2R7TA 5K7HA 4D5FA 3V6GA 3QQAA
chains in the Genus database with same CATH topology
4AC0A 3DEWA 3KKCA 5K58A 3BHQA 2IAIA 5K7ZA 3B6CA 3P9TA 5F0FA 1QVUA 2ZCXA 2ID3A 3B81A 4YZEA 5HAWA 3GEUA 4NN1A 2O7TA 5F27A 3NXCA 3WHCA 3TP3A 5J1UA 2QKOA 3B6AA 5FKLA 4HKUA 3HTIA 2XPWA 3S5RA 3V78A 2V57A 5GPCA 3Q3SA 3IH4A 2RHAA 3ZQFA 3LSJA 4L62A 3VVYA 3VVZA 4I76A 2HXOA 4M3GA 2QWTA 1RPWA 1UI6A 1JUPA 1Z77A 1JT6A 4MO7A 4M3BA 3F0CA 4D7MA 1JUSA 3BRUA 2FD5A 2NS7A 2ID6A 5GP9A 5HSZA 3LSPA 2HYJA 3ZQLA 4GCTA 3O8HA 2Y31A 2XGCA 2DTZA 3G1LA 2WGBA 3Q0VA 4AUXA 2TRTA 4NELA 5CXIA 2O7OA 3LHQA 4MXMA 5EZGA 5FKMA 3QKXA 3CJDA 3IUVA 5IOZA 2VKVA 2UXOA 2FQ4A 3FIWA 3VW1A 4JNNA 3LJLA 4UDSA 5HBUA 5CW8A 5FKOA 3EUPA 4I6ZA 2DG7A 2ZOYA 3BTIA 2EH3A 3ZQGA 4V2FA 3BNIA 4ABZA 5FKNA 2OF7A 4B1RA 3MNLA 5FKKA 3C2BA 1QVTA 1T56A 2OI8A 3WHBA 5IOYA 3BR6A 3FK7A 3SFIA 4XK4A 1QPIA 2IEKA 5AQCA 4KWAA 2GENA 3HTJA 3AQTA 3VOKA 1JTYA 3RD3A 2G7GA 2WUIA 2X9DA 3RH2A 3O60A 4W97A 5J1RA 3BR1A 3LOCA 4JL3A 3DCFA 4D5CA 5EYRA 5J3LA 1BJZA 3VIBA 3G1MA 4D7NA 2XPUA 5F0HA 4JYKA 3VPRA 5FHPA 1A6IA 2X6OA 2GUHA 1VI0A 2UXHA 5D19A 3ON4A 3F1BA 1ZK8A 3KKDA 3CWRA 3T6NA 2RASA 3CDLA 3HE0A 3G1OA 1U9NA 3E7QA 2VPRA 2Y30A 5EZHA 2FX0A 3NPIA 2REKA 2G3BA 3DPJA 4ACIA 2ZCNA 3CCYA 5EFYA 2DG8A 3AQSA 2PBXA 4B3AA 5D1RA 3G56A 3BR2A 3VW2A 2PZ9A 5F04A 3FRQA 5K7FA 3PASA 2QIBA 3BQYA 3ANGA 1JUMA 2XRLA 3HTHA 3KNWA 3VP5A 4GCLA 3NI7A 3BR3A 2NP3A 3JSJA 3NRGA 4GFKA 2TCTA 4M3EA 3ON2A 3ZQIA 3VVXA 2D6YA 2YVEA 1RKTA 3QPLA 2NP5A 2GFNA 5FMPA 5CXGA 2FJ1A 3Q0WA 3ZQHA 5C4YA 3HGYA 4X1EA 2WV1A 4V2GA 4G12A 3PPBA 4ME9A 4M3FA 2HQ5A 2OERA 3PM1A 2W53A 2VKEA 5D18A 5F1JA 2QOPA 2JJ7A 3HTAA 4M3DA 3KZ9A 1Z0XA 1U9OA 3O8GA 2ZOZA 5DAJA 4CGRA 3IH3A 1JT0A 4DW6A 3Q0UA 1RKWA 2G7SA 5F08A 2NS8A 3MVPA 2Y2ZA 4W1UA 2G0EA 2QCOA 4PXIA 3BQZA 3BJBA 3EGQA 2XPVA 2GBYA 3VW0A 5GPAA 1UI5A 2JK3A 2I10A 2NX4A 1SGMA 2RAEA 4ICHA 3BT9A 3C07A 3BTLA 1ZKGA 4GCKA 3IH2A 3LWJA 4MK6A 1JTXA 2FBQA 3HIMA 4AF5A 3COLA 5J1YA 4AC6A 2HKUA 3G7RA 2XGDA 3FK6A 2IBDA 2IU5A 3SDGA 2ZB9A 3BTJA 3ANPA 3HGGA 3QPSA 3QBMA 2XGEA 3TP0A 2YVHA 5IP6A 3BTCA 2Q24A 2XB5A 3BR5A 3VOXA 3NNRA 1T33A 5F0CA 3BR0A 1ORKA 4JKZA 2HXIA 5FGLA 2G7LA 2OPTA 2XDNA 3VUQA 3GZIA 2QTQA 2HYTA 2F07A 2ZCMA 5IPAA 3LSRA 2UXPA 5H9TA 2UXUA 3BCGA 4GFLA 2UXIA 3CRJA 5K7HA 4D5FA 3V6GA 3QQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC0 A;  3DEW A;  3KKC A;  5K58 A;  3BHQ A;  2IAI A;  5K7Z A;  3B6C A;  3P9T A;  5F0F A;  1QVU A;  2ZCX A;  2ID3 A;  3B81 A;  4YZE A;  5HAW A;  3GEU A;  4NN1 A;  2O7T A;  5F27 A;  3NXC A;  3WHC A;  3TP3 A;  5J1U A;  2QKO A;  3B6A A;  5FKL A;  4HKU A;  3HTI A;  2XPW A;  3S5R A;  3V78 A;  2V57 A;  5GPC A;  3Q3S A;  3IH4 A;  2RHA A;  3ZQF A;  3LSJ A;  4L62 A;  3VVY A;  3VVZ A;  4I76 A;  2HXO A;  4M3G A;  2QWT A;  1RPW A;  1UI6 A;  1JUP A;  1Z77 A;  1JT6 A;  4MO7 A;  4M3B A;  3F0C A;  4D7M A;  1JUS A;  3BRU A;  2FD5 A;  2NS7 A;  2ID6 A;  5GP9 A;  5HSZ A;  3LSP A;  2HYJ A;  3ZQL A;  4GCT A;  3O8H A;  2Y31 A;  2XGC A;  2DTZ A;  3G1L A;  2WGB A;  3Q0V A;  4AUX A;  2TRT A;  4NEL A;  5CXI A;  2O7O A;  3LHQ A;  4MXM A;  5EZG A;  5FKM A;  3QKX A;  3CJD A;  3IUV A;  5IOZ A;  2VKV A;  2UXO A;  2FQ4 A;  3FIW A;  3VW1 A;  4JNN A;  3LJL A;  4UDS A;  5HBU A;  5CW8 A;  5FKO A;  3EUP A;  4I6Z A;  2DG7 A;  2ZOY A;  3BTI A;  2EH3 A;  3ZQG A;  4V2F A;  3BNI A;  4ABZ A;  5FKN A;  2OF7 A;  4B1R A;  3MNL A;  5FKK A;  3C2B A;  1QVT A;  1T56 A;  2OI8 A;  3WHB A;  5IOY A;  3BR6 A;  3FK7 A;  3SFI A;  4XK4 A;  1QPI A;  2IEK A;  5AQC A;  4KWA A;  2GEN A;  3HTJ A;  3AQT A;  3VOK A;  1JTY A;  3RD3 A;  2G7G A;  2WUI A;  2X9D A;  3RH2 A;  3O60 A;  4W97 A;  5J1R A;  3BR1 A;  3LOC A;  4JL3 A;  3DCF A;  4D5C A;  5EYR A;  5J3L A;  1BJZ A;  3VIB A;  3G1M A;  4D7N A;  2XPU A;  5F0H A;  4JYK A;  3VPR A;  5FHP A;  1A6I A;  2X6O A;  2GUH A;  1VI0 A;  2UXH A;  5D19 A;  3ON4 A;  3F1B A;  1ZK8 A;  3KKD A;  3CWR A;  3T6N A;  2RAS A;  3CDL A;  3HE0 A;  3G1O A;  1U9N A;  3E7Q A;  2VPR A;  2Y30 A;  5EZH A;  2FX0 A;  3NPI A;  2REK A;  2G3B A;  3DPJ A;  4ACI A;  2ZCN A;  3CCY A;  5EFY A;  2DG8 A;  3AQS A;  2PBX A;  4B3A A;  5D1R A;  3G56 A;  3BR2 A;  3VW2 A;  2PZ9 A;  5F04 A;  3FRQ A;  5K7F A;  3PAS A;  2QIB A;  3BQY A;  3ANG A;  1JUM A;  2XRL A;  3HTH A;  3KNW A;  3VP5 A;  4GCL A;  3NI7 A;  3BR3 A;  2NP3 A;  3JSJ A;  3NRG A;  4GFK A;  2TCT A;  4M3E A;  3ON2 A;  3ZQI A;  3VVX A;  2D6Y A;  2YVE A;  1RKT A;  3QPL A;  2NP5 A;  2GFN A;  5FMP A;  5CXG A;  2FJ1 A;  3Q0W A;  3ZQH A;  5C4Y A;  3HGY A;  4X1E A;  2WV1 A;  4V2G A;  4G12 A;  3PPB A;  4ME9 A;  4M3F A;  2HQ5 A;  2OER A;  3PM1 A;  2W53 A;  2VKE A;  5D18 A;  5F1J A;  2QOP A;  2JJ7 A;  3HTA A;  4M3D A;  3KZ9 A;  1Z0X A;  1U9O A;  3O8G A;  2ZOZ A;  5DAJ A;  4CGR A;  3IH3 A;  1JT0 A;  4DW6 A;  3Q0U A;  1RKW A;  2G7S A;  5F08 A;  2NS8 A;  3MVP A;  2Y2Z A;  4W1U A;  2G0E A;  2QCO A;  4PXI A;  3BQZ A;  3BJB A;  3EGQ A;  2XPV A;  2GBY A;  3VW0 A;  5GPA A;  1UI5 A;  2JK3 A;  2I10 A;  2NX4 A;  1SGM A;  2RAE A;  4ICH A;  3BT9 A;  3C07 A;  3BTL A;  1ZKG A;  4GCK A;  3IH2 A;  3LWJ A;  4MK6 A;  1JTX A;  2FBQ A;  3HIM A;  4AF5 A;  3COL A;  5J1Y A;  4AC6 A;  2HKU A;  3G7R A;  2XGD A;  3FK6 A;  2IBD A;  2IU5 A;  3SDG A;  2ZB9 A;  3BTJ A;  3ANP A;  3HGG A;  3QPS A;  3QBM A;  2XGE A;  3TP0 A;  2YVH A;  5IP6 A;  3BTC A;  2Q24 A;  2XB5 A;  3BR5 A;  3VOX A;  3NNR A;  1T33 A;  5F0C A;  3BR0 A;  1ORK A;  4JKZ A;  2HXI A;  5FGL A;  2G7L A;  2OPT A;  2XDN A;  3VUQ A;  3GZI A;  2QTQ A;  2HYT A;  2F07 A;  2ZCM A;  5IPA A;  3LSR A;  2UXP A;  5H9T A;  2UXU A;  3BCG A;  4GFL A;  2UXI A;  3CRJ A;  5K7H A;  4D5F A;  3V6G A;  3QQA A; 
#chains in the Genus database with same CATH topology
 4AC0 A;  3DEW A;  3KKC A;  5K58 A;  3BHQ A;  2IAI A;  5K7Z A;  3B6C A;  3P9T A;  5F0F A;  1QVU A;  2ZCX A;  2ID3 A;  3B81 A;  3DU6 A;  4YZE A;  5HAW A;  3GEU A;  2A2F X;  4NN1 A;  2O7T A;  5F27 A;  3NXC A;  3WHC A;  3TP3 A;  5J1U A;  2QKO A;  3B6A A;  5FKL A;  4HKU A;  3HTI A;  2XPW A;  3S5R A;  3V78 A;  2V57 A;  5GPC A;  3Q3S A;  4U9L A;  3IH4 A;  2RHA A;  3ZQF A;  3LSJ A;  4L62 A;  3VVY A;  3VVZ A;  4I76 A;  2HXO A;  4M3G A;  2QWT A;  1RPW A;  1UI6 A;  1JUP A;  1Z77 A;  1JT6 A;  4MO7 A;  4M3B A;  3F0C A;  4D7M A;  1JUS A;  3BRU A;  2FD5 A;  2NS7 A;  2ID6 A;  5GP9 A;  5HSZ A;  3LSP A;  2HYJ A;  3ZQL A;  4GCT A;  3O8H A;  2Y31 A;  2XGC A;  2DTZ A;  3G1L A;  2WGB A;  3Q0V A;  4AUX A;  2TRT A;  4NEL A;  5CXI A;  2O7O A;  3LHQ A;  4MXM A;  5EZG A;  5FKM A;  3QKX A;  3CJD A;  3IUV A;  5IOZ A;  2VKV A;  2UXO A;  2FQ4 A;  3FIW A;  3VW1 A;  4JNN A;  3LJL A;  4UDS A;  5HBU A;  3KYL A;  4OD4 A;  5CW8 A;  5FKO A;  3EUP A;  4I6Z A;  2DG7 A;  2ZOY A;  3BTI A;  2EH3 A;  3ZQG A;  4V2F A;  3BNI A;  4ABZ A;  5FKN A;  2OF7 A;  4B1R A;  3MNL A;  5FKK A;  3C2B A;  1QVT A;  1T56 A;  2OI8 A;  3WHB A;  5IOY A;  3BR6 A;  3FK7 A;  3SFI A;  4XK4 A;  3VTI A;  1QPI A;  2R7X A;  2IEK A;  5AQC A;  4KWA A;  2GEN A;  3HTJ A;  3AQT A;  2B3W A;  3VOK A;  1JTY A;  3RD3 A;  4OD5 A;  2G7G A;  2WUI A;  2X9D A;  3RH2 A;  3O60 A;  4W97 A;  5J1R A;  3BR1 A;  3LOC A;  4JL3 A;  3DCF A;  4D5C A;  2ZY9 A;  5EYR A;  5J3L A;  1BJZ A;  3VIB A;  3NS4 A;  3G1M A;  3FHN A;  4D7N A;  2XPU A;  2R7V A;  5F0H A;  4JYK A;  3VPR A;  5FHP A;  1A6I A;  2X6O A;  2GUH A;  2R7O A;  1VI0 A;  2UXH A;  5D19 A;  3ON4 A;  3F1B A;  1ZK8 A;  3KKD A;  2YVX A;  3CWR A;  3T6N A;  2RAS A;  3CDL A;  3HE0 A;  3G1O A;  1U9N A;  3E7Q A;  2VPR A;  2Y30 A;  5EZH A;  2FX0 A;  3NPI A;  2REK A;  2G3B A;  3DPJ A;  4ACI A;  2ZCN A;  3CCY A;  5EFY A;  2DG8 A;  3AQS A;  2PBX A;  4B3A A;  5D1R A;  3G56 A;  3BR2 A;  3VW2 A;  2PZ9 A;  4U9N A;  5F04 A;  3FRQ A;  5K7F A;  3PAS A;  2QIB A;  3BQY A;  3ANG A;  1JUM A;  2XRL A;  3HTH A;  3KNW A;  3VP5 A;  4GCL A;  3NI7 A;  3BR3 A;  2NP3 A;  3JSJ A;  3NRG A;  4GFK A;  2TCT A;  4M3E A;  3ON2 A;  3ZQI A;  3VVX A;  2D6Y A;  2YVE A;  1RKT A;  3QPL A;  2NP5 A;  2GFN A;  5FMP A;  5CXG A;  2FJ1 A;  3Q0W A;  3ZQH A;  5C4Y A;  3HGY A;  4X1E A;  2WV1 A;  4V2G A;  4G12 A;  3PPB A;  4ME9 A;  4M3F A;  2HQ5 A;  2OER A;  3PM1 A;  2W53 A;  2VKE A;  5D18 A;  5F1J A;  2QOP A;  2JJ7 A;  3HTA A;  4M3D A;  3KZ9 A;  1Z0X A;  2R7R A;  1U9O A;  3O8G A;  2ZOZ A;  5DAJ A;  4CGR A;  3IH3 A;  1JT0 A;  4DW6 A;  3Q0U A;  1RKW A;  2G7S A;  5F08 A;  4C2M A;  5CQG A;  2NS8 A;  3MVP A;  2Y2Z A;  4W1U A;  2G0E A;  2R7U A;  2QCO A;  4PXI A;  3BQZ A;  3K8P C;  3BJB A;  3EGQ A;  2XPV A;  2GBY A;  3VW0 A;  5GPA A;  1UI5 A;  2JK3 A;  2I10 A;  2NX4 A;  1SGM A;  2RAE A;  3DU5 A;  4ICH A;  3BT9 A;  3C07 A;  3BTL A;  1ZKG A;  2FJI 1;  4WIB A;  4GCK A;  3IH2 A;  3LWJ A;  4MK6 A;  2R7W A;  1JTX A;  2FBQ A;  2B1E A;  3HIM A;  4AF5 A;  3COL A;  5J1Y A;  4AC6 A;  2HKU A;  3G7R A;  2XGD A;  3FK6 A;  2IBD A;  2IU5 A;  3SDG A;  2ZB9 A;  3BTJ A;  3ANP A;  3HGG A;  3QPS A;  3QBM A;  2XGE A;  3TP0 A;  2YVH A;  5IP6 A;  3BTC A;  4IRV A;  2Q24 A;  2XB5 A;  3BR5 A;  2R7Q A;  3VOX A;  3NNR A;  1T33 A;  5F0C A;  4DVY P;  3BR0 A;  1ORK A;  4JKZ A;  2HXI A;  5FGL A;  3SWH A;  2G7L A;  2OPT A;  2XDN A;  3VUQ A;  3GZI A;  2QTQ A;  2R7S A;  2HYT A;  2PFV A;  2F07 A;  2ZCM A;  5IPA A;  3LSR A;  2UXP A;  5H9T A;  2UXU A;  3BCG A;  4GFL A;  2UXI A;  3CRJ A;  2R7T A;  5K7H A;  4D5F A;  3V6G A;  3QQA A; 
#chains in the Genus database with same CATH homology
 4AC0 A;  3DEW A;  3KKC A;  5K58 A;  3BHQ A;  2IAI A;  5K7Z A;  3B6C A;  3P9T A;  5F0F A;  1QVU A;  2ZCX A;  2ID3 A;  3B81 A;  4YZE A;  5HAW A;  3GEU A;  4NN1 A;  2O7T A;  5F27 A;  3NXC A;  3WHC A;  3TP3 A;  5J1U A;  2QKO A;  3B6A A;  5FKL A;  4HKU A;  3HTI A;  2XPW A;  3S5R A;  3V78 A;  2V57 A;  5GPC A;  3Q3S A;  3IH4 A;  2RHA A;  3ZQF A;  3LSJ A;  4L62 A;  3VVY A;  3VVZ A;  4I76 A;  2HXO A;  4M3G A;  2QWT A;  1RPW A;  1UI6 A;  1JUP A;  1Z77 A;  1JT6 A;  4MO7 A;  4M3B A;  3F0C A;  4D7M A;  1JUS A;  3BRU A;  2FD5 A;  2NS7 A;  2ID6 A;  5GP9 A;  5HSZ A;  3LSP A;  2HYJ A;  3ZQL A;  4GCT A;  3O8H A;  2Y31 A;  2XGC A;  2DTZ A;  3G1L A;  2WGB A;  3Q0V A;  4AUX A;  2TRT A;  4NEL A;  5CXI A;  2O7O A;  3LHQ A;  4MXM A;  5EZG A;  5FKM A;  3QKX A;  3CJD A;  3IUV A;  5IOZ A;  2VKV A;  2UXO A;  2FQ4 A;  3FIW A;  3VW1 A;  4JNN A;  3LJL A;  4UDS A;  5HBU A;  5CW8 A;  5FKO A;  3EUP A;  4I6Z A;  2DG7 A;  2ZOY A;  3BTI A;  2EH3 A;  3ZQG A;  4V2F A;  3BNI A;  4ABZ A;  5FKN A;  2OF7 A;  4B1R A;  3MNL A;  5FKK A;  3C2B A;  1QVT A;  1T56 A;  2OI8 A;  3WHB A;  5IOY A;  3BR6 A;  3FK7 A;  3SFI A;  4XK4 A;  1QPI A;  2IEK A;  5AQC A;  4KWA A;  2GEN A;  3HTJ A;  3AQT A;  3VOK A;  1JTY A;  3RD3 A;  2G7G A;  2WUI A;  2X9D A;  3RH2 A;  3O60 A;  4W97 A;  5J1R A;  3BR1 A;  3LOC A;  4JL3 A;  3DCF A;  4D5C A;  5EYR A;  5J3L A;  1BJZ A;  3VIB A;  3G1M A;  4D7N A;  2XPU A;  5F0H A;  4JYK A;  3VPR A;  5FHP A;  1A6I A;  2X6O A;  2GUH A;  1VI0 A;  2UXH A;  5D19 A;  3ON4 A;  3F1B A;  1ZK8 A;  3KKD A;  3CWR A;  3T6N A;  2RAS A;  3CDL A;  3HE0 A;  3G1O A;  1U9N A;  3E7Q A;  2VPR A;  2Y30 A;  5EZH A;  2FX0 A;  3NPI A;  2REK A;  2G3B A;  3DPJ A;  4ACI A;  2ZCN A;  3CCY A;  5EFY A;  2DG8 A;  3AQS A;  2PBX A;  4B3A A;  5D1R A;  3G56 A;  3BR2 A;  3VW2 A;  2PZ9 A;  5F04 A;  3FRQ A;  5K7F A;  3PAS A;  2QIB A;  3BQY A;  3ANG A;  1JUM A;  2XRL A;  3HTH A;  3KNW A;  3VP5 A;  4GCL A;  3NI7 A;  3BR3 A;  2NP3 A;  3JSJ A;  3NRG A;  4GFK A;  2TCT A;  4M3E A;  3ON2 A;  3ZQI A;  3VVX A;  2D6Y A;  2YVE A;  1RKT A;  3QPL A;  2NP5 A;  2GFN A;  5FMP A;  5CXG A;  2FJ1 A;  3Q0W A;  3ZQH A;  5C4Y A;  3HGY A;  4X1E A;  2WV1 A;  4V2G A;  4G12 A;  3PPB A;  4ME9 A;  4M3F A;  2HQ5 A;  2OER A;  3PM1 A;  2W53 A;  2VKE A;  5D18 A;  5F1J A;  2QOP A;  2JJ7 A;  3HTA A;  4M3D A;  3KZ9 A;  1Z0X A;  1U9O A;  3O8G A;  2ZOZ A;  5DAJ A;  4CGR A;  3IH3 A;  1JT0 A;  4DW6 A;  3Q0U A;  1RKW A;  2G7S A;  5F08 A;  2NS8 A;  3MVP A;  2Y2Z A;  4W1U A;  2G0E A;  2QCO A;  4PXI A;  3BQZ A;  3BJB A;  3EGQ A;  2XPV A;  2GBY A;  3VW0 A;  5GPA A;  1UI5 A;  2JK3 A;  2I10 A;  2NX4 A;  1SGM A;  2RAE A;  4ICH A;  3BT9 A;  3C07 A;  3BTL A;  1ZKG A;  4GCK A;  3IH2 A;  3LWJ A;  4MK6 A;  1JTX A;  2FBQ A;  3HIM A;  4AF5 A;  3COL A;  5J1Y A;  4AC6 A;  2HKU A;  3G7R A;  2XGD A;  3FK6 A;  2IBD A;  2IU5 A;  3SDG A;  2ZB9 A;  3BTJ A;  3ANP A;  3HGG A;  3QPS A;  3QBM A;  2XGE A;  3TP0 A;  2YVH A;  5IP6 A;  3BTC A;  2Q24 A;  2XB5 A;  3BR5 A;  3VOX A;  3NNR A;  1T33 A;  5F0C A;  3BR0 A;  1ORK A;  4JKZ A;  2HXI A;  5FGL A;  2G7L A;  2OPT A;  2XDN A;  3VUQ A;  3GZI A;  2QTQ A;  2HYT A;  2F07 A;  2ZCM A;  5IPA A;  3LSR A;  2UXP A;  5H9T A;  2UXU A;  3BCG A;  4GFL A;  2UXI A;  3CRJ A;  5K7H A;  4D5F A;  3V6G A;  3QQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...