3COLA

Crystal structure of putative transcription regulator from lactobacillus plantarum
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
180
Chain Sequence
b'NKQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRILSTTDLDRLSDSTIDVTTRIRLYVQQVYDYSLANPDSLTIIQQIKALNGQDADPNNIVANLLTAAIDAKVIKQLPVSLHMGVVFSTIHTHTTNISKGRYAQDQYTFGDIFQMIWDAMKQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcription regulator
publication title Crystal structure of putative transcription regulator from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Transcription regulator
total genus 64
structure length 180
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3colA00
2IEKA 2ZCXA 3LWJA 2QTQA 5HSZA 3RH2A 3LSRA 5EZHA 3BT9A 3TP3A 3FK7A 1SGMA 1T33A 1UI6A 4JNNA 4ACIA 3PASA 5FMPA 2XPUA 4AF5A 4GCKA 3VVYA 3RD3A 3O60A 5GP9A 3S5RA 2ZOYA 2V57A 3AQSA 3BJBA 1RPWA 1UI5A 3LSJA 2HXOA 3BR5A 3NPIA 2FX0A 1QVUA 3KZ9A 2FJ1A 2REKA 3NI7A 4B1RA 3VIBA 2DTZA 3SDGA 3B6AA 3VW2A 3VW1A 3IUVA 3BTLA 2UXHA 4JL3A 1JT0A 5AQCA 3TP0A 3IH2A 2DG8A 2ID3A 5F0CA 2OPTA 3VVXA 3FIWA 3IH4A 5K7ZA 2QOPA 1JTYA 3LJLA 3BR6A 3KKCA 1ORKA 3F1BA 2VPRA 3BHQA 3CWRA 3HGGA 5EZGA 3QPLA 3BTCA 3ON2A 3BTJA 3HTIA 5D1RA 3Q3SA 2RHAA 3EGQA 2UXUA 2G7LA 2XGDA 5FHPA 3QBMA 4AUXA 3BCGA 4L62A 3MVPA 2NS7A 5H9TA 3BR1A 1ZK8A 2ZCMA 2GUHA 4B3AA 3AQTA 1Z0XA 2TRTA 3QQAA 2XB5A 3V6GA 3LHQA 3Q0WA 2X6OA 3HTJA 3COLA 5EFYA 4XK4A 2QCOA 2NP3A 3ZQFA 4V2FA 2OI8A 3JSJA 1U9OA 3HTAA 5F04A 2F07A 1JT6A 3F0CA 3DPJA 1VI0A 2HYJA 3Q0UA 3BTIA 3KKDA 2QWTA 2XRLA 2HXIA 5GPAA 4GFKA 5FKLA 2X9DA 3ON4A 4AC0A 2DG7A 2WGBA 5J1RA 2G0EA 5FKMA 3ZQHA 3E7QA 4M3BA 5D19A 2Y31A 2HQ5A 4MXMA 3EUPA 1U9NA 2G3BA 3G1MA 3PPBA 4NN1A 3VOXA 3NNRA 4M3FA 3VPRA 5F1JA 2XGCA 5FGLA 2FD5A 1A6IA 4D5CA 4GFLA 1QVTA 5K58A 3CDLA 5DAJA 1RKTA 2JJ7A 4V2GA 5FKKA 1ZKGA 5IPAA 3VOKA 3SFIA 2UXOA 2Y30A 4I76A 3BNIA 2W53A 3VW0A 4X1EA 3V78A 3BR2A 4MK6A 3ANPA 2G7GA 3O8HA 5HAWA 5FKOA 5D18A 3PM1A 1BJZA 2PBXA 4M3GA 4GCTA 3HTHA 5K7FA 5FKNA 3DEWA 2OERA 2ID6A 3DCFA 2UXPA 3NRGA 4ME9A 3C07A 3FK6A 5J1UA 2WUIA 1RKWA 3O8GA 2QIBA 2PZ9A 3VUQA 4W1UA 2Y2ZA 4MO7A 5IP6A 4JYKA 1JUSA 2UXIA 2IU5A 3G1OA 2RASA 5GPCA 2FQ4A 3T6NA 4M3DA 3ZQIA 1T56A 2IBDA 3GEUA 3B81A 3IH3A 3Q0VA 3CRJA 5K7HA 5J3LA 3LSPA 2NX4A 3HE0A 2O7OA 3LOCA 2FBQA 2HYTA 1Z77A 3ANGA 5IOZA 2HKUA 3NXCA 5F0HA 4D7MA 2XGEA 3QKXA 4I6ZA 4NELA 3G56A 2ZCNA 5CXIA 5HBUA 3G1LA 2Q24A 2EH3A 5F08A 3BQYA 5F0FA 4ABZA 2GFNA 1JTXA 3MNLA 4PXIA 4D7NA 3WHCA 3BQZA 3P9TA 2GENA 3G7RA 4YZEA 1QPIA 5CXGA 3CCYA 2VKEA 4DW6A 3BRUA 4AC6A 2YVHA 3WHBA 3GZIA 2O7TA 4JKZA 5C4YA 4GCLA 2XDNA 3VP5A 4M3EA 2OF7A 2TCTA 3ZQGA 5J1YA 2VKVA 2ZOZA 2NP5A 2YVEA 4CGRA 2JK3A 2XPWA 4KWAA 2WV1A 5F27A 4UDSA 4ICHA 4W97A 5EYRA 3ZQLA 3BR0A 2D6YA 3HGYA 5CW8A 2I10A 3KNWA 4D5FA 2GBYA 3C2BA 3B6CA 3CJDA 4HKUA 2QKOA 2ZB9A 2XPVA 2RAEA 3HIMA 3QPSA 3VVZA 2G7SA 5IOYA 1JUPA 2IAIA 3BR3A 1JUMA 2NS8A 4G12A 3FRQA
chains in the Genus database with same CATH superfamily
2IEKA 2ZCXA 3LWJA 2QTQA 5HSZA 3RH2A 3LSRA 5EZHA 3BT9A 3TP3A 3FK7A 1SGMA 1T33A 1UI6A 4WIBA 4JNNA 4ACIA 3NS4A 3PASA 5FMPA 2XPUA 4AF5A 4GCKA 3VVYA 3RD3A 3O60A 4DVYP 5GP9A 3S5RA 2ZOYA 2V57A 3AQSA 3BJBA 2B3WA 1RPWA 4U9LA 1UI5A 3LSJA 2HXOA 3BR5A 3NPIA 2FX0A 1QVUA 3KZ9A 2FJ1A 2REKA 3NI7A 4B1RA 3VIBA 2DTZA 3SDGA 3B6AA 3VW2A 3VW1A 3IUVA 3BTLA 2UXHA 4JL3A 1JT0A 5AQCA 3TP0A 3IH2A 2DG8A 2ID3A 5F0CA 2OPTA 3VVXA 3FIWA 3IH4A 5K7ZA 2QOPA 1JTYA 3LJLA 3BR6A 3KKCA 1ORKA 3F1BA 2VPRA 3BHQA 3CWRA 3HGGA 5EZGA 3QPLA 3BTCA 3ON2A 3BTJA 3HTIA 5D1RA 3Q3SA 2RHAA 3EGQA 2UXUA 2G7LA 2XGDA 5FHPA 3QBMA 4AUXA 3BCGA 4L62A 3MVPA 2NS7A 5H9TA 3BR1A 1ZK8A 2ZCMA 3VTIA 2GUHA 5CQGA 4B3AA 3AQTA 1Z0XA 2TRTA 3QQAA 2XB5A 3V6GA 3LHQA 3Q0WA 2X6OA 3HTJA 3COLA 5EFYA 4XK4A 2QCOA 2NP3A 3ZQFA 4V2FA 4C2MA 2OI8A 3JSJA 1U9OA 3HTAA 5F04A 2F07A 1JT6A 3KYLA 3F0CA 3DPJA 1VI0A 2HYJA 3Q0UA 3BTIA 3KKDA 2QWTA 2XRLA 2HXIA 5GPAA 2B1EA 4GFKA 3DU6A 5FKLA 2X9DA 3ON4A 4AC0A 2DG7A 2PFVA 2WGBA 5J1RA 2G0EA 5FKMA 3ZQHA 3E7QA 4M3BA 5D19A 2Y31A 2HQ5A 4MXMA 3FHNA 3EUPA 1U9NA 2G3BA 3G1MA 3PPBA 4NN1A 2A2FX 3VOXA 3NNRA 4M3FA 3VPRA 5F1JA 2R7SA 2XGCA 5FGLA 4U9NA 2FD5A 2R7RA 1A6IA 4IRVA 4D5CA 4GFLA 2YVXA 1QVTA 5K58A 3CDLA 5DAJA 1RKTA 2JJ7A 4V2GA 5FKKA 1ZKGA 5IPAA 3VOKA 3SFIA 2UXOA 2Y30A 4I76A 3BNIA 2W53A 3VW0A 4X1EA 3V78A 3BR2A 4MK6A 3ANPA 2G7GA 3O8HA 5HAWA 5FKOA 5D18A 3PM1A 1BJZA 2PBXA 4M3GA 4GCTA 3HTHA 5K7FA 5FKNA 3DEWA 2OERA 2ID6A 3DCFA 4OD4A 2UXPA 3NRGA 4ME9A 3C07A 3FK6A 5J1UA 2WUIA 1RKWA 3O8GA 2QIBA 2PZ9A 3VUQA 4W1UA 2Y2ZA 4MO7A 5IP6A 4JYKA 1JUSA 2UXIA 3SWHA 2IU5A 3G1OA 2RASA 5GPCA 2FQ4A 3T6NA 4M3DA 1T56A 2IBDA 3ZQIA 4OD5A 3GEUA 3B81A 3IH3A 3K8PC 3Q0VA 3CRJA 5K7HA 5J3LA 3LSPA 2NX4A 3HE0A 2O7OA 3LOCA 2FBQA 2R7TA 2HYTA 1Z77A 2R7UA 3ANGA 5IOZA 2HKUA 3NXCA 5F0HA 4D7MA 2XGEA 3QKXA 4I6ZA 4NELA 3G56A 2ZCNA 5CXIA 5HBUA 3G1LA 2Q24A 2EH3A 5F08A 3BQYA 5F0FA 4ABZA 2GFNA 1JTXA 3MNLA 4PXIA 4D7NA 3WHCA 3BQZA 3P9TA 2GENA 3DU5A 3G7RA 4YZEA 1QPIA 5CXGA 3CCYA 2VKEA 2R7VA 4DW6A 3BRUA 4AC6A 2YVHA 3WHBA 3GZIA 2O7TA 4JKZA 5C4YA 4GCLA 2XDNA 3VP5A 4M3EA 2FJI1 2OF7A 2TCTA 3ZQGA 5J1YA 2VKVA 2ZOZA 2NP5A 2YVEA 4CGRA 2JK3A 2XPWA 4KWAA 2WV1A 5F27A 4UDSA 4ICHA 4W97A 5EYRA 3ZQLA 3BR0A 2D6YA 3HGYA 2R7OA 5CW8A 2I10A 3KNWA 4D5FA 2GBYA 3C2BA 2R7WA 3B6CA 3CJDA 4HKUA 2ZY9A 2QKOA 2ZB9A 2XPVA 2RAEA 3HIMA 3QPSA 3VVZA 2R7QA 2G7SA 5IOYA 1JUPA 2R7XA 2IAIA 3BR3A 1JUMA 2NS8A 4G12A 3FRQA
chains in the Genus database with same CATH topology
2IEKA 2ZCXA 3LWJA 2QTQA 5HSZA 3RH2A 3LSRA 5EZHA 3BT9A 3TP3A 3FK7A 1SGMA 1T33A 1UI6A 4JNNA 4ACIA 3PASA 5FMPA 2XPUA 4AF5A 4GCKA 3VVYA 3RD3A 3O60A 5GP9A 3S5RA 2ZOYA 2V57A 3AQSA 3BJBA 1RPWA 1UI5A 3LSJA 2HXOA 3BR5A 3NPIA 2FX0A 1QVUA 3KZ9A 2FJ1A 2REKA 3NI7A 4B1RA 3VIBA 2DTZA 3SDGA 3B6AA 3VW2A 3VW1A 3IUVA 3BTLA 2UXHA 4JL3A 1JT0A 5AQCA 3TP0A 3IH2A 2DG8A 2ID3A 5F0CA 2OPTA 3VVXA 3FIWA 3IH4A 5K7ZA 2QOPA 1JTYA 3LJLA 3BR6A 3KKCA 1ORKA 3F1BA 2VPRA 3BHQA 3CWRA 3HGGA 5EZGA 3QPLA 3BTCA 3ON2A 3BTJA 3HTIA 5D1RA 3Q3SA 2RHAA 3EGQA 2UXUA 2G7LA 2XGDA 5FHPA 3QBMA 4AUXA 3BCGA 4L62A 3MVPA 2NS7A 5H9TA 3BR1A 1ZK8A 2ZCMA 2GUHA 4B3AA 3AQTA 1Z0XA 2TRTA 3QQAA 2XB5A 3V6GA 3LHQA 3Q0WA 2X6OA 3HTJA 3COLA 5EFYA 4XK4A 2QCOA 2NP3A 3ZQFA 4V2FA 2OI8A 3JSJA 1U9OA 3HTAA 5F04A 2F07A 1JT6A 3F0CA 3DPJA 1VI0A 2HYJA 3Q0UA 3BTIA 3KKDA 2QWTA 2XRLA 2HXIA 5GPAA 4GFKA 5FKLA 2X9DA 3ON4A 4AC0A 2DG7A 2WGBA 5J1RA 2G0EA 5FKMA 3ZQHA 3E7QA 4M3BA 5D19A 2Y31A 2HQ5A 4MXMA 3EUPA 1U9NA 2G3BA 3G1MA 3PPBA 4NN1A 3VOXA 3NNRA 4M3FA 3VPRA 5F1JA 2XGCA 5FGLA 2FD5A 1A6IA 4D5CA 4GFLA 1QVTA 5K58A 3CDLA 5DAJA 1RKTA 2JJ7A 4V2GA 5FKKA 1ZKGA 5IPAA 3VOKA 3SFIA 2UXOA 2Y30A 4I76A 3BNIA 2W53A 3VW0A 4X1EA 3V78A 3BR2A 4MK6A 3ANPA 2G7GA 3O8HA 5HAWA 5FKOA 5D18A 3PM1A 1BJZA 2PBXA 4M3GA 4GCTA 3HTHA 5K7FA 5FKNA 3DEWA 2OERA 2ID6A 3DCFA 2UXPA 3NRGA 4ME9A 3C07A 3FK6A 5J1UA 2WUIA 1RKWA 3O8GA 2QIBA 2PZ9A 3VUQA 4W1UA 2Y2ZA 4MO7A 5IP6A 4JYKA 1JUSA 2UXIA 2IU5A 3G1OA 2RASA 5GPCA 2FQ4A 3T6NA 4M3DA 3ZQIA 1T56A 2IBDA 3GEUA 3B81A 3IH3A 3Q0VA 3CRJA 5K7HA 5J3LA 3LSPA 2NX4A 3HE0A 2O7OA 3LOCA 2FBQA 2HYTA 1Z77A 3ANGA 5IOZA 2HKUA 3NXCA 5F0HA 4D7MA 2XGEA 3QKXA 4I6ZA 4NELA 3G56A 2ZCNA 5CXIA 5HBUA 3G1LA 2Q24A 2EH3A 5F08A 3BQYA 5F0FA 4ABZA 2GFNA 1JTXA 3MNLA 4PXIA 4D7NA 3WHCA 3BQZA 3P9TA 2GENA 3G7RA 4YZEA 1QPIA 5CXGA 3CCYA 2VKEA 4DW6A 3BRUA 4AC6A 2YVHA 3WHBA 3GZIA 2O7TA 4JKZA 5C4YA 4GCLA 2XDNA 3VP5A 4M3EA 2OF7A 2TCTA 3ZQGA 5J1YA 2VKVA 2ZOZA 2NP5A 2YVEA 4CGRA 2JK3A 2XPWA 4KWAA 2WV1A 5F27A 4UDSA 4ICHA 4W97A 5EYRA 3ZQLA 3BR0A 2D6YA 3HGYA 5CW8A 2I10A 3KNWA 4D5FA 2GBYA 3C2BA 3B6CA 3CJDA 4HKUA 2QKOA 2ZB9A 2XPVA 2RAEA 3HIMA 3QPSA 3VVZA 2G7SA 5IOYA 1JUPA 2IAIA 3BR3A 1JUMA 2NS8A 4G12A 3FRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEK A;  2ZCX A;  3LWJ A;  2QTQ A;  5HSZ A;  3RH2 A;  3LSR A;  5EZH A;  3BT9 A;  3TP3 A;  3FK7 A;  1SGM A;  1T33 A;  1UI6 A;  4JNN A;  4ACI A;  3PAS A;  5FMP A;  2XPU A;  4AF5 A;  4GCK A;  3VVY A;  3RD3 A;  3O60 A;  5GP9 A;  3S5R A;  2ZOY A;  2V57 A;  3AQS A;  3BJB A;  1RPW A;  1UI5 A;  3LSJ A;  2HXO A;  3BR5 A;  3NPI A;  2FX0 A;  1QVU A;  3KZ9 A;  2FJ1 A;  2REK A;  3NI7 A;  4B1R A;  3VIB A;  2DTZ A;  3SDG A;  3B6A A;  3VW2 A;  3VW1 A;  3IUV A;  3BTL A;  2UXH A;  4JL3 A;  1JT0 A;  5AQC A;  3TP0 A;  3IH2 A;  2DG8 A;  2ID3 A;  5F0C A;  2OPT A;  3VVX A;  3FIW A;  3IH4 A;  5K7Z A;  2QOP A;  1JTY A;  3LJL A;  3BR6 A;  3KKC A;  1ORK A;  3F1B A;  2VPR A;  3BHQ A;  3CWR A;  3HGG A;  5EZG A;  3QPL A;  3BTC A;  3ON2 A;  3BTJ A;  3HTI A;  5D1R A;  3Q3S A;  2RHA A;  3EGQ A;  2UXU A;  2G7L A;  2XGD A;  5FHP A;  3QBM A;  4AUX A;  3BCG A;  4L62 A;  3MVP A;  2NS7 A;  5H9T A;  3BR1 A;  1ZK8 A;  2ZCM A;  2GUH A;  4B3A A;  3AQT A;  1Z0X A;  2TRT A;  3QQA A;  2XB5 A;  3V6G A;  3LHQ A;  3Q0W A;  2X6O A;  3HTJ A;  3COL A;  5EFY A;  4XK4 A;  2QCO A;  2NP3 A;  3ZQF A;  4V2F A;  2OI8 A;  3JSJ A;  1U9O A;  3HTA A;  5F04 A;  2F07 A;  1JT6 A;  3F0C A;  3DPJ A;  1VI0 A;  2HYJ A;  3Q0U A;  3BTI A;  3KKD A;  2QWT A;  2XRL A;  2HXI A;  5GPA A;  4GFK A;  5FKL A;  2X9D A;  3ON4 A;  4AC0 A;  2DG7 A;  2WGB A;  5J1R A;  2G0E A;  5FKM A;  3ZQH A;  3E7Q A;  4M3B A;  5D19 A;  2Y31 A;  2HQ5 A;  4MXM A;  3EUP A;  1U9N A;  2G3B A;  3G1M A;  3PPB A;  4NN1 A;  3VOX A;  3NNR A;  4M3F A;  3VPR A;  5F1J A;  2XGC A;  5FGL A;  2FD5 A;  1A6I A;  4D5C A;  4GFL A;  1QVT A;  5K58 A;  3CDL A;  5DAJ A;  1RKT A;  2JJ7 A;  4V2G A;  5FKK A;  1ZKG A;  5IPA A;  3VOK A;  3SFI A;  2UXO A;  2Y30 A;  4I76 A;  3BNI A;  2W53 A;  3VW0 A;  4X1E A;  3V78 A;  3BR2 A;  4MK6 A;  3ANP A;  2G7G A;  3O8H A;  5HAW A;  5FKO A;  5D18 A;  3PM1 A;  1BJZ A;  2PBX A;  4M3G A;  4GCT A;  3HTH A;  5K7F A;  5FKN A;  3DEW A;  2OER A;  2ID6 A;  3DCF A;  2UXP A;  3NRG A;  4ME9 A;  3C07 A;  3FK6 A;  5J1U A;  2WUI A;  1RKW A;  3O8G A;  2QIB A;  2PZ9 A;  3VUQ A;  4W1U A;  2Y2Z A;  4MO7 A;  5IP6 A;  4JYK A;  1JUS A;  2UXI A;  2IU5 A;  3G1O A;  2RAS A;  5GPC A;  2FQ4 A;  3T6N A;  4M3D A;  3ZQI A;  1T56 A;  2IBD A;  3GEU A;  3B81 A;  3IH3 A;  3Q0V A;  3CRJ A;  5K7H A;  5J3L A;  3LSP A;  2NX4 A;  3HE0 A;  2O7O A;  3LOC A;  2FBQ A;  2HYT A;  1Z77 A;  3ANG A;  5IOZ A;  2HKU A;  3NXC A;  5F0H A;  4D7M A;  2XGE A;  3QKX A;  4I6Z A;  4NEL A;  3G56 A;  2ZCN A;  5CXI A;  5HBU A;  3G1L A;  2Q24 A;  2EH3 A;  5F08 A;  3BQY A;  5F0F A;  4ABZ A;  2GFN A;  1JTX A;  3MNL A;  4PXI A;  4D7N A;  3WHC A;  3BQZ A;  3P9T A;  2GEN A;  3G7R A;  4YZE A;  1QPI A;  5CXG A;  3CCY A;  2VKE A;  4DW6 A;  3BRU A;  4AC6 A;  2YVH A;  3WHB A;  3GZI A;  2O7T A;  4JKZ A;  5C4Y A;  4GCL A;  2XDN A;  3VP5 A;  4M3E A;  2OF7 A;  2TCT A;  3ZQG A;  5J1Y A;  2VKV A;  2ZOZ A;  2NP5 A;  2YVE A;  4CGR A;  2JK3 A;  2XPW A;  4KWA A;  2WV1 A;  5F27 A;  4UDS A;  4ICH A;  4W97 A;  5EYR A;  3ZQL A;  3BR0 A;  2D6Y A;  3HGY A;  5CW8 A;  2I10 A;  3KNW A;  4D5F A;  2GBY A;  3C2B A;  3B6C A;  3CJD A;  4HKU A;  2QKO A;  2ZB9 A;  2XPV A;  2RAE A;  3HIM A;  3QPS A;  3VVZ A;  2G7S A;  5IOY A;  1JUP A;  2IAI A;  3BR3 A;  1JUM A;  2NS8 A;  4G12 A;  3FRQ A; 
#chains in the Genus database with same CATH topology
 2IEK A;  2ZCX A;  3LWJ A;  2QTQ A;  5HSZ A;  3RH2 A;  3LSR A;  5EZH A;  3BT9 A;  3TP3 A;  3FK7 A;  1SGM A;  1T33 A;  1UI6 A;  4WIB A;  4JNN A;  4ACI A;  3NS4 A;  3PAS A;  5FMP A;  2XPU A;  4AF5 A;  4GCK A;  3VVY A;  3RD3 A;  3O60 A;  4DVY P;  5GP9 A;  3S5R A;  2ZOY A;  2V57 A;  3AQS A;  3BJB A;  2B3W A;  1RPW A;  4U9L A;  1UI5 A;  3LSJ A;  2HXO A;  3BR5 A;  3NPI A;  2FX0 A;  1QVU A;  3KZ9 A;  2FJ1 A;  2REK A;  3NI7 A;  4B1R A;  3VIB A;  2DTZ A;  3SDG A;  3B6A A;  3VW2 A;  3VW1 A;  3IUV A;  3BTL A;  2UXH A;  4JL3 A;  1JT0 A;  5AQC A;  3TP0 A;  3IH2 A;  2DG8 A;  2ID3 A;  5F0C A;  2OPT A;  3VVX A;  3FIW A;  3IH4 A;  5K7Z A;  2QOP A;  1JTY A;  3LJL A;  3BR6 A;  3KKC A;  1ORK A;  3F1B A;  2VPR A;  3BHQ A;  3CWR A;  3HGG A;  5EZG A;  3QPL A;  3BTC A;  3ON2 A;  3BTJ A;  3HTI A;  5D1R A;  3Q3S A;  2RHA A;  3EGQ A;  2UXU A;  2G7L A;  2XGD A;  5FHP A;  3QBM A;  4AUX A;  3BCG A;  4L62 A;  3MVP A;  2NS7 A;  5H9T A;  3BR1 A;  1ZK8 A;  2ZCM A;  3VTI A;  2GUH A;  5CQG A;  4B3A A;  3AQT A;  1Z0X A;  2TRT A;  3QQA A;  2XB5 A;  3V6G A;  3LHQ A;  3Q0W A;  2X6O A;  3HTJ A;  3COL A;  5EFY A;  4XK4 A;  2QCO A;  2NP3 A;  3ZQF A;  4V2F A;  4C2M A;  2OI8 A;  3JSJ A;  1U9O A;  3HTA A;  5F04 A;  2F07 A;  1JT6 A;  3KYL A;  3F0C A;  3DPJ A;  1VI0 A;  2HYJ A;  3Q0U A;  3BTI A;  3KKD A;  2QWT A;  2XRL A;  2HXI A;  5GPA A;  2B1E A;  4GFK A;  3DU6 A;  5FKL A;  2X9D A;  3ON4 A;  4AC0 A;  2DG7 A;  2PFV A;  2WGB A;  5J1R A;  2G0E A;  5FKM A;  3ZQH A;  3E7Q A;  4M3B A;  5D19 A;  2Y31 A;  2HQ5 A;  4MXM A;  3FHN A;  3EUP A;  1U9N A;  2G3B A;  3G1M A;  3PPB A;  4NN1 A;  2A2F X;  3VOX A;  3NNR A;  4M3F A;  3VPR A;  5F1J A;  2R7S A;  2XGC A;  5FGL A;  4U9N A;  2FD5 A;  2R7R A;  1A6I A;  4IRV A;  4D5C A;  4GFL A;  2YVX A;  1QVT A;  5K58 A;  3CDL A;  5DAJ A;  1RKT A;  2JJ7 A;  4V2G A;  5FKK A;  1ZKG A;  5IPA A;  3VOK A;  3SFI A;  2UXO A;  2Y30 A;  4I76 A;  3BNI A;  2W53 A;  3VW0 A;  4X1E A;  3V78 A;  3BR2 A;  4MK6 A;  3ANP A;  2G7G A;  3O8H A;  5HAW A;  5FKO A;  5D18 A;  3PM1 A;  1BJZ A;  2PBX A;  4M3G A;  4GCT A;  3HTH A;  5K7F A;  5FKN A;  3DEW A;  2OER A;  2ID6 A;  3DCF A;  4OD4 A;  2UXP A;  3NRG A;  4ME9 A;  3C07 A;  3FK6 A;  5J1U A;  2WUI A;  1RKW A;  3O8G A;  2QIB A;  2PZ9 A;  3VUQ A;  4W1U A;  2Y2Z A;  4MO7 A;  5IP6 A;  4JYK A;  1JUS A;  2UXI A;  3SWH A;  2IU5 A;  3G1O A;  2RAS A;  5GPC A;  2FQ4 A;  3T6N A;  4M3D A;  1T56 A;  2IBD A;  3ZQI A;  4OD5 A;  3GEU A;  3B81 A;  3IH3 A;  3K8P C;  3Q0V A;  3CRJ A;  5K7H A;  5J3L A;  3LSP A;  2NX4 A;  3HE0 A;  2O7O A;  3LOC A;  2FBQ A;  2R7T A;  2HYT A;  1Z77 A;  2R7U A;  3ANG A;  5IOZ A;  2HKU A;  3NXC A;  5F0H A;  4D7M A;  2XGE A;  3QKX A;  4I6Z A;  4NEL A;  3G56 A;  2ZCN A;  5CXI A;  5HBU A;  3G1L A;  2Q24 A;  2EH3 A;  5F08 A;  3BQY A;  5F0F A;  4ABZ A;  2GFN A;  1JTX A;  3MNL A;  4PXI A;  4D7N A;  3WHC A;  3BQZ A;  3P9T A;  2GEN A;  3DU5 A;  3G7R A;  4YZE A;  1QPI A;  5CXG A;  3CCY A;  2VKE A;  2R7V A;  4DW6 A;  3BRU A;  4AC6 A;  2YVH A;  3WHB A;  3GZI A;  2O7T A;  4JKZ A;  5C4Y A;  4GCL A;  2XDN A;  3VP5 A;  4M3E A;  2FJI 1;  2OF7 A;  2TCT A;  3ZQG A;  5J1Y A;  2VKV A;  2ZOZ A;  2NP5 A;  2YVE A;  4CGR A;  2JK3 A;  2XPW A;  4KWA A;  2WV1 A;  5F27 A;  4UDS A;  4ICH A;  4W97 A;  5EYR A;  3ZQL A;  3BR0 A;  2D6Y A;  3HGY A;  2R7O A;  5CW8 A;  2I10 A;  3KNW A;  4D5F A;  2GBY A;  3C2B A;  2R7W A;  3B6C A;  3CJD A;  4HKU A;  2ZY9 A;  2QKO A;  2ZB9 A;  2XPV A;  2RAE A;  3HIM A;  3QPS A;  3VVZ A;  2R7Q A;  2G7S A;  5IOY A;  1JUP A;  2R7X A;  2IAI A;  3BR3 A;  1JUM A;  2NS8 A;  4G12 A;  3FRQ A; 
#chains in the Genus database with same CATH homology
 2IEK A;  2ZCX A;  3LWJ A;  2QTQ A;  5HSZ A;  3RH2 A;  3LSR A;  5EZH A;  3BT9 A;  3TP3 A;  3FK7 A;  1SGM A;  1T33 A;  1UI6 A;  4JNN A;  4ACI A;  3PAS A;  5FMP A;  2XPU A;  4AF5 A;  4GCK A;  3VVY A;  3RD3 A;  3O60 A;  5GP9 A;  3S5R A;  2ZOY A;  2V57 A;  3AQS A;  3BJB A;  1RPW A;  1UI5 A;  3LSJ A;  2HXO A;  3BR5 A;  3NPI A;  2FX0 A;  1QVU A;  3KZ9 A;  2FJ1 A;  2REK A;  3NI7 A;  4B1R A;  3VIB A;  2DTZ A;  3SDG A;  3B6A A;  3VW2 A;  3VW1 A;  3IUV A;  3BTL A;  2UXH A;  4JL3 A;  1JT0 A;  5AQC A;  3TP0 A;  3IH2 A;  2DG8 A;  2ID3 A;  5F0C A;  2OPT A;  3VVX A;  3FIW A;  3IH4 A;  5K7Z A;  2QOP A;  1JTY A;  3LJL A;  3BR6 A;  3KKC A;  1ORK A;  3F1B A;  2VPR A;  3BHQ A;  3CWR A;  3HGG A;  5EZG A;  3QPL A;  3BTC A;  3ON2 A;  3BTJ A;  3HTI A;  5D1R A;  3Q3S A;  2RHA A;  3EGQ A;  2UXU A;  2G7L A;  2XGD A;  5FHP A;  3QBM A;  4AUX A;  3BCG A;  4L62 A;  3MVP A;  2NS7 A;  5H9T A;  3BR1 A;  1ZK8 A;  2ZCM A;  2GUH A;  4B3A A;  3AQT A;  1Z0X A;  2TRT A;  3QQA A;  2XB5 A;  3V6G A;  3LHQ A;  3Q0W A;  2X6O A;  3HTJ A;  3COL A;  5EFY A;  4XK4 A;  2QCO A;  2NP3 A;  3ZQF A;  4V2F A;  2OI8 A;  3JSJ A;  1U9O A;  3HTA A;  5F04 A;  2F07 A;  1JT6 A;  3F0C A;  3DPJ A;  1VI0 A;  2HYJ A;  3Q0U A;  3BTI A;  3KKD A;  2QWT A;  2XRL A;  2HXI A;  5GPA A;  4GFK A;  5FKL A;  2X9D A;  3ON4 A;  4AC0 A;  2DG7 A;  2WGB A;  5J1R A;  2G0E A;  5FKM A;  3ZQH A;  3E7Q A;  4M3B A;  5D19 A;  2Y31 A;  2HQ5 A;  4MXM A;  3EUP A;  1U9N A;  2G3B A;  3G1M A;  3PPB A;  4NN1 A;  3VOX A;  3NNR A;  4M3F A;  3VPR A;  5F1J A;  2XGC A;  5FGL A;  2FD5 A;  1A6I A;  4D5C A;  4GFL A;  1QVT A;  5K58 A;  3CDL A;  5DAJ A;  1RKT A;  2JJ7 A;  4V2G A;  5FKK A;  1ZKG A;  5IPA A;  3VOK A;  3SFI A;  2UXO A;  2Y30 A;  4I76 A;  3BNI A;  2W53 A;  3VW0 A;  4X1E A;  3V78 A;  3BR2 A;  4MK6 A;  3ANP A;  2G7G A;  3O8H A;  5HAW A;  5FKO A;  5D18 A;  3PM1 A;  1BJZ A;  2PBX A;  4M3G A;  4GCT A;  3HTH A;  5K7F A;  5FKN A;  3DEW A;  2OER A;  2ID6 A;  3DCF A;  2UXP A;  3NRG A;  4ME9 A;  3C07 A;  3FK6 A;  5J1U A;  2WUI A;  1RKW A;  3O8G A;  2QIB A;  2PZ9 A;  3VUQ A;  4W1U A;  2Y2Z A;  4MO7 A;  5IP6 A;  4JYK A;  1JUS A;  2UXI A;  2IU5 A;  3G1O A;  2RAS A;  5GPC A;  2FQ4 A;  3T6N A;  4M3D A;  3ZQI A;  1T56 A;  2IBD A;  3GEU A;  3B81 A;  3IH3 A;  3Q0V A;  3CRJ A;  5K7H A;  5J3L A;  3LSP A;  2NX4 A;  3HE0 A;  2O7O A;  3LOC A;  2FBQ A;  2HYT A;  1Z77 A;  3ANG A;  5IOZ A;  2HKU A;  3NXC A;  5F0H A;  4D7M A;  2XGE A;  3QKX A;  4I6Z A;  4NEL A;  3G56 A;  2ZCN A;  5CXI A;  5HBU A;  3G1L A;  2Q24 A;  2EH3 A;  5F08 A;  3BQY A;  5F0F A;  4ABZ A;  2GFN A;  1JTX A;  3MNL A;  4PXI A;  4D7N A;  3WHC A;  3BQZ A;  3P9T A;  2GEN A;  3G7R A;  4YZE A;  1QPI A;  5CXG A;  3CCY A;  2VKE A;  4DW6 A;  3BRU A;  4AC6 A;  2YVH A;  3WHB A;  3GZI A;  2O7T A;  4JKZ A;  5C4Y A;  4GCL A;  2XDN A;  3VP5 A;  4M3E A;  2OF7 A;  2TCT A;  3ZQG A;  5J1Y A;  2VKV A;  2ZOZ A;  2NP5 A;  2YVE A;  4CGR A;  2JK3 A;  2XPW A;  4KWA A;  2WV1 A;  5F27 A;  4UDS A;  4ICH A;  4W97 A;  5EYR A;  3ZQL A;  3BR0 A;  2D6Y A;  3HGY A;  5CW8 A;  2I10 A;  3KNW A;  4D5F A;  2GBY A;  3C2B A;  3B6C A;  3CJD A;  4HKU A;  2QKO A;  2ZB9 A;  2XPV A;  2RAE A;  3HIM A;  3QPS A;  3VVZ A;  2G7S A;  5IOY A;  1JUP A;  2IAI A;  3BR3 A;  1JUM A;  2NS8 A;  4G12 A;  3FRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...