3COLA

Crystal structure of putative transcription regulator from lactobacillus plantarum
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
180
Chain Sequence
NKQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRILSTTDLDRLSDSTIDVTTRIRLYVQQVYDYSLANPDSLTIIQQIKALNGQDADPNNIVANLLTAAIDAKVIKQLPVSLHMGVVFSTIHTHTTNISKGRYAQDQYTFGDIFQMIWDAMKQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative transcription regulator
publication title Crystal structure of putative transcription regulator from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
total genus 64
structure length 180
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3colA00
2NP5A 2FBQA 2X6OA 2OI8A 3VOKA 3B81A 3LHQA 4GFKA 3CRJA 3KKCA 5K7FA 3CCYA 5HBUA 3G1LA 2XGEA 2X9DA 3QKXA 2OERA 3HTAA 2RHAA 2HKUA 2XPVA 4G12A 4ME9A 3T6NA 2XPUA 5HAWA 5FGLA 4GFLA 3VW2A 4D7MA 2ZB9A 3G1OA 3F0CA 4D7NA 2HYTA 3BR3A 5F0FA 5EZHA 3NXCA 3VVZA 3C2BA 2QKOA 2REKA 3QQAA 4I6ZA 3BTJA 5IOZA 4JL3A 4CGRA 4M3GA 5FKNA 3Q0WA 3S5RA 3O60A 1JT0A 3HIMA 2DG7A 3BR6A 4GCLA 3ON2A 2TCTA 2HXIA 5AQCA 2NS8A 3DPJA 3SDGA 3P9TA 4MO7A 1JTYA 2XRLA 5F04A 3FK6A 2VPRA 2IU5A 2PZ9A 2ZCXA 5IOYA 3F1BA 5DAJA 2UXHA 1U9NA 3FRQA 2ZOZA 2D6YA 1Z77A 3NRGA 1JUPA 2OF7A 2FD5A 4B1RA 3NI7A 3FK7A 4DW6A 2ZCMA 3WHBA 5CXIA 1U9OA 1ZKGA 3LSPA 2NX4A 3KKDA 2G0EA 3CWRA 2RASA 3BR5A 3IH3A 4ACIA 3GZIA 4M3BA 2Q24A 3E7QA 3FIWA 4AC6A 4JNNA 2PBXA 1SGMA 4GCKA 3AQSA 3V6GA 3B6CA 4AF5A 4PXIA 3MNLA 5FKLA 1RPWA 2RAEA 2UXUA 2IAIA 5FHPA 3RH2A 4ICHA 3ANGA 3VP5A 5GPCA 1UI5A 3HTJA 5K58A 4GCTA 3LWJA 3HGGA 2EH3A 2QWTA 1QPIA 4M3DA 2VKEA 3MVPA 5GPAA 2F07A 3LSJA 5EZGA 3IH4A 5D1RA 3VVXA 3QPSA 5EYRA 4L62A 3BT9A 3IH2A 3VOXA 2ZCNA 3Q0UA 4KWAA 2NS7A 3PASA 2ID3A 4NN1A 4V2GA 3VW0A 4MK6A 2Y30A 5K7HA 3Q3SA 2IEKA 5IPAA 5F1JA 3ZQHA 2G3BA 3HTHA 3NPIA 3V78A 3BQZA 5FKMA 1BJZA 5IP6A 2DTZA 3BTCA 2O7OA 2W53A 3Q0VA 3TP0A 2UXPA 2DG8A 3VUQA 4JYKA 2V57A 2NP3A 3G7RA 2IBDA 3NNRA 5F08A 5J1YA 5D18A 3VIBA 3DEWA 3CDLA 2Y31A 4D5CA 4D5FA 4M3FA 1QVUA 2JJ7A 1VI0A 2GUHA 5C4YA 2G7LA 2G7SA 3DCFA 1RKWA 2FX0A 4XK4A 5EFYA 3EUPA 2ID6A 3VVYA 2TRTA 3WHCA 2UXIA 2HYJA 1ZK8A 3AQTA 2FJ1A 3BCGA 4W1UA 3RD3A 3C07A 4HKUA 4X1EA 3PM1A 2QCOA 3JSJA 3ON4A 2GBYA 5FKOA 2G7GA 2OPTA 2UXOA 3G1MA 4MXMA 5CW8A 3LSRA 2I10A 3BNIA 4V2FA 3COLA 2QOPA 2VKVA 3BRUA 2WUIA 2XGCA 3G56A 4W97A 3O8HA 4JKZA 3SFIA 3GEUA 3VPRA 3LJLA 2HXOA 3B6AA 1ORKA 5J3LA 3KZ9A 3O8GA 5F27A 3ZQFA 3CJDA 1Z0XA 5K7ZA 3HTIA 5GP9A 3IUVA 3BHQA 3VW1A 4B3AA 5H9TA 3ZQGA 2XPWA 5F0CA 2QTQA 5FKKA 2HQ5A 1UI6A 1JTXA 3HGYA 3BTLA 2O7TA 1T56A 1JUMA 1RKTA 3HE0A 5D19A 5FMPA 4I76A 2XB5A 3BQYA 3TP3A 3LOCA 2YVHA 3BR1A 5J1UA 1JT6A 4M3EA 1JUSA 3ZQIA 2JK3A 3QPLA 3BR0A 3QBMA 3KNWA 2Y2ZA 2YVEA 5J1RA 2FQ4A 4AUXA 2XDNA 1T33A 5F0HA 2WGBA 4ABZA 4YZEA 3BJBA 4AC0A 3BR2A 5HSZA 3ANPA 4UDSA 3ZQLA 2ZOYA 3PPBA 2GENA 1QVTA 2GFNA 2QIBA 2XGDA 2WV1A 5CXGA 4NELA 3EGQA 3BTIA 1A6IA
chains in the Genus database with same CATH superfamily
2NP5A 2FBQA 2X6OA 4OD5A 2OI8A 3VOKA 3B81A 3LHQA 4GFKA 3CRJA 3KKCA 5K7FA 3CCYA 5HBUA 3G1LA 2XGEA 2X9DA 3QKXA 2OERA 3HTAA 2RHAA 2HKUA 2XPVA 4G12A 4ME9A 3T6NA 2XPUA 5HAWA 5FGLA 4GFLA 3VW2A 4D7MA 2ZB9A 2R7OA 3G1OA 3F0CA 4D7NA 2HYTA 3BR3A 5F0FA 5EZHA 4U9NA 3NXCA 3VVZA 4DVYP 3C2BA 2QKOA 2REKA 3QQAA 4I6ZA 3BTJA 5IOZA 4JL3A 4CGRA 4M3GA 5FKNA 3Q0WA 3S5RA 3O60A 1JT0A 3HIMA 2DG7A 3BR6A 4GCLA 2R7VA 3ON2A 3DU6A 2TCTA 2HXIA 5AQCA 2NS8A 3DPJA 3SDGA 3P9TA 4MO7A 1JTYA 2XRLA 5F04A 3FK6A 2VPRA 2IU5A 2PZ9A 2ZCXA 5IOYA 3DU5A 3F1BA 5DAJA 2UXHA 1U9NA 2B3WA 3FRQA 2ZOZA 2D6YA 1Z77A 3NRGA 1JUPA 2OF7A 2FD5A 2R7SA 4B1RA 3NI7A 3FK7A 4DW6A 2ZCMA 3WHBA 5CXIA 1U9OA 1ZKGA 3LSPA 2NX4A 3KKDA 2G0EA 3CWRA 2RASA 3BR5A 3IH3A 4ACIA 3GZIA 4M3BA 3NS4A 2Q24A 3E7QA 3FIWA 4AC6A 4JNNA 2PBXA 1SGMA 4GCKA 2PFVA 3AQSA 3V6GA 3B6CA 4AF5A 4PXIA 3MNLA 5FKLA 1RPWA 2RAEA 2UXUA 2IAIA 5FHPA 3RH2A 4ICHA 3ANGA 3VP5A 5GPCA 1UI5A 3HTJA 5K58A 2B1EA 4GCTA 3LWJA 3HGGA 2EH3A 2QWTA 1QPIA 4OD4A 4M3DA 2VKEA 3MVPA 5GPAA 3KYLA 2F07A 3LSJA 5EZGA 3IH4A 5D1RA 3VVXA 3QPSA 5EYRA 4L62A 3BT9A 3IH2A 2ZCNA 3Q0UA 3VOXA 4KWAA 2NS7A 3PASA 2ID3A 3SWHA 4NN1A 4V2GA 3VW0A 4MK6A 2Y30A 5K7HA 3Q3SA 2IEKA 5IPAA 5F1JA 3ZQHA 2G3BA 3HTHA 2FJI1 3NPIA 3V78A 3BQZA 5FKMA 1BJZA 5IP6A 2DTZA 3BTCA 2O7OA 4C2MA 2W53A 3Q0VA 3TP0A 2UXPA 2DG8A 3VUQA 4JYKA 2V57A 2NP3A 3G7RA 2IBDA 3NNRA 5F08A 5J1YA 5D18A 3VIBA 3DEWA 3CDLA 2Y31A 4D5CA 4D5FA 4M3FA 1QVUA 2JJ7A 1VI0A 2GUHA 5C4YA 2G7LA 2G7SA 3DCFA 1RKWA 2FX0A 4XK4A 5EFYA 3EUPA 2ID6A 3VVYA 2TRTA 3WHCA 2UXIA 2HYJA 5CQGA 1ZK8A 2R7XA 3AQTA 2FJ1A 3BCGA 4W1UA 3RD3A 3C07A 4HKUA 4X1EA 3PM1A 2QCOA 3JSJA 4IRVA 3ON4A 2GBYA 3FHNA 5FKOA 2G7GA 2OPTA 2R7QA 2UXOA 3G1MA 4MXMA 5CW8A 3LSRA 2A2FX 2I10A 3BNIA 4V2FA 3COLA 3VTIA 2QOPA 2VKVA 3BRUA 2WUIA 2XGCA 3G56A 4W97A 3O8HA 4JKZA 3SFIA 2R7RA 2R7TA 3GEUA 3VPRA 3LJLA 2HXOA 3B6AA 1ORKA 5J3LA 3KZ9A 3O8GA 5F27A 3K8PC 3ZQFA 3CJDA 1Z0XA 5K7ZA 3HTIA 5GP9A 3IUVA 3BHQA 3VW1A 4B3AA 5H9TA 3ZQGA 2XPWA 2YVXA 5F0CA 2QTQA 5FKKA 2HQ5A 2ZY9A 1UI6A 1JTXA 3HGYA 3BTLA 2O7TA 4U9LA 2R7WA 1T56A 1JUMA 1RKTA 3HE0A 5D19A 5FMPA 4I76A 2XB5A 3BQYA 3TP3A 3LOCA 2YVHA 3BR1A 5J1UA 1JT6A 4M3EA 1JUSA 4WIBA 3ZQIA 2JK3A 3QPLA 3BR0A 3QBMA 2R7UA 3KNWA 2Y2ZA 2YVEA 5J1RA 2FQ4A 4AUXA 2XDNA 1T33A 5F0HA 2WGBA 4ABZA 4YZEA 3BJBA 4AC0A 3BR2A 5HSZA 3ANPA 4UDSA 3ZQLA 2ZOYA 3PPBA 2GENA 1QVTA 2GFNA 2QIBA 2XGDA 2WV1A 5CXGA 4NELA 3EGQA 3BTIA 1A6IA
chains in the Genus database with same CATH topology
2NP5A 2FBQA 2X6OA 2OI8A 3VOKA 3B81A 3LHQA 4GFKA 3CRJA 3KKCA 5K7FA 3CCYA 5HBUA 3G1LA 2XGEA 2X9DA 3QKXA 2OERA 3HTAA 2RHAA 2HKUA 2XPVA 4G12A 4ME9A 3T6NA 2XPUA 5HAWA 5FGLA 4GFLA 3VW2A 4D7MA 2ZB9A 3G1OA 3F0CA 4D7NA 2HYTA 3BR3A 5F0FA 5EZHA 3NXCA 3VVZA 3C2BA 2QKOA 2REKA 3QQAA 4I6ZA 3BTJA 5IOZA 4JL3A 4CGRA 4M3GA 5FKNA 3Q0WA 3S5RA 3O60A 1JT0A 3HIMA 2DG7A 3BR6A 4GCLA 3ON2A 2TCTA 2HXIA 5AQCA 2NS8A 3DPJA 3SDGA 3P9TA 4MO7A 1JTYA 2XRLA 5F04A 3FK6A 2VPRA 2IU5A 2PZ9A 2ZCXA 5IOYA 3F1BA 5DAJA 2UXHA 1U9NA 3FRQA 2ZOZA 2D6YA 1Z77A 3NRGA 1JUPA 2OF7A 2FD5A 4B1RA 3NI7A 3FK7A 4DW6A 2ZCMA 3WHBA 5CXIA 1U9OA 1ZKGA 3LSPA 2NX4A 3KKDA 2G0EA 3CWRA 2RASA 3BR5A 3IH3A 4ACIA 3GZIA 4M3BA 2Q24A 3E7QA 3FIWA 4AC6A 4JNNA 2PBXA 1SGMA 4GCKA 3AQSA 3V6GA 3B6CA 4AF5A 4PXIA 3MNLA 5FKLA 1RPWA 2RAEA 2UXUA 2IAIA 5FHPA 3RH2A 4ICHA 3ANGA 3VP5A 5GPCA 1UI5A 3HTJA 5K58A 4GCTA 3LWJA 3HGGA 2EH3A 2QWTA 1QPIA 4M3DA 2VKEA 3MVPA 5GPAA 2F07A 3LSJA 5EZGA 3IH4A 5D1RA 3VVXA 3QPSA 5EYRA 4L62A 3BT9A 3IH2A 3VOXA 2ZCNA 3Q0UA 4KWAA 2NS7A 3PASA 2ID3A 4NN1A 4V2GA 3VW0A 4MK6A 2Y30A 5K7HA 3Q3SA 2IEKA 5IPAA 5F1JA 3ZQHA 2G3BA 3HTHA 3NPIA 3V78A 3BQZA 5FKMA 1BJZA 5IP6A 2DTZA 3BTCA 2O7OA 2W53A 3Q0VA 3TP0A 2UXPA 2DG8A 3VUQA 4JYKA 2V57A 2NP3A 3G7RA 2IBDA 3NNRA 5F08A 5J1YA 5D18A 3VIBA 3DEWA 3CDLA 2Y31A 4D5CA 4D5FA 4M3FA 1QVUA 2JJ7A 1VI0A 2GUHA 5C4YA 2G7LA 2G7SA 3DCFA 1RKWA 2FX0A 4XK4A 5EFYA 3EUPA 2ID6A 3VVYA 2TRTA 3WHCA 2UXIA 2HYJA 1ZK8A 3AQTA 2FJ1A 3BCGA 4W1UA 3RD3A 3C07A 4HKUA 4X1EA 3PM1A 2QCOA 3JSJA 3ON4A 2GBYA 5FKOA 2G7GA 2OPTA 2UXOA 3G1MA 4MXMA 5CW8A 3LSRA 2I10A 3BNIA 4V2FA 3COLA 2QOPA 2VKVA 3BRUA 2WUIA 2XGCA 3G56A 4W97A 3O8HA 4JKZA 3SFIA 3GEUA 3VPRA 3LJLA 2HXOA 3B6AA 1ORKA 5J3LA 3KZ9A 3O8GA 5F27A 3ZQFA 3CJDA 1Z0XA 5K7ZA 3HTIA 5GP9A 3IUVA 3BHQA 3VW1A 4B3AA 5H9TA 3ZQGA 2XPWA 5F0CA 2QTQA 5FKKA 2HQ5A 1UI6A 1JTXA 3HGYA 3BTLA 2O7TA 1T56A 1JUMA 1RKTA 3HE0A 5D19A 5FMPA 4I76A 2XB5A 3BQYA 3TP3A 3LOCA 2YVHA 3BR1A 5J1UA 1JT6A 4M3EA 1JUSA 3ZQIA 2JK3A 3QPLA 3BR0A 3QBMA 3KNWA 2Y2ZA 2YVEA 5J1RA 2FQ4A 4AUXA 2XDNA 1T33A 5F0HA 2WGBA 4ABZA 4YZEA 3BJBA 4AC0A 3BR2A 5HSZA 3ANPA 4UDSA 3ZQLA 2ZOYA 3PPBA 2GENA 1QVTA 2GFNA 2QIBA 2XGDA 2WV1A 5CXGA 4NELA 3EGQA 3BTIA 1A6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NP5 A;  2FBQ A;  2X6O A;  2OI8 A;  3VOK A;  3B81 A;  3LHQ A;  4GFK A;  3CRJ A;  3KKC A;  5K7F A;  3CCY A;  5HBU A;  3G1L A;  2XGE A;  2X9D A;  3QKX A;  2OER A;  3HTA A;  2RHA A;  2HKU A;  2XPV A;  4G12 A;  4ME9 A;  3T6N A;  2XPU A;  5HAW A;  5FGL A;  4GFL A;  3VW2 A;  4D7M A;  2ZB9 A;  3G1O A;  3F0C A;  4D7N A;  2HYT A;  3BR3 A;  5F0F A;  5EZH A;  3NXC A;  3VVZ A;  3C2B A;  2QKO A;  2REK A;  3QQA A;  4I6Z A;  3BTJ A;  5IOZ A;  4JL3 A;  4CGR A;  4M3G A;  5FKN A;  3Q0W A;  3S5R A;  3O60 A;  1JT0 A;  3HIM A;  2DG7 A;  3BR6 A;  4GCL A;  3ON2 A;  2TCT A;  2HXI A;  5AQC A;  2NS8 A;  3DPJ A;  3SDG A;  3P9T A;  4MO7 A;  1JTY A;  2XRL A;  5F04 A;  3FK6 A;  2VPR A;  2IU5 A;  2PZ9 A;  2ZCX A;  5IOY A;  3F1B A;  5DAJ A;  2UXH A;  1U9N A;  3FRQ A;  2ZOZ A;  2D6Y A;  1Z77 A;  3NRG A;  1JUP A;  2OF7 A;  2FD5 A;  4B1R A;  3NI7 A;  3FK7 A;  4DW6 A;  2ZCM A;  3WHB A;  5CXI A;  1U9O A;  1ZKG A;  3LSP A;  2NX4 A;  3KKD A;  2G0E A;  3CWR A;  2RAS A;  3BR5 A;  3IH3 A;  4ACI A;  3GZI A;  4M3B A;  2Q24 A;  3E7Q A;  3FIW A;  4AC6 A;  4JNN A;  2PBX A;  1SGM A;  4GCK A;  3AQS A;  3V6G A;  3B6C A;  4AF5 A;  4PXI A;  3MNL A;  5FKL A;  1RPW A;  2RAE A;  2UXU A;  2IAI A;  5FHP A;  3RH2 A;  4ICH A;  3ANG A;  3VP5 A;  5GPC A;  1UI5 A;  3HTJ A;  5K58 A;  4GCT A;  3LWJ A;  3HGG A;  2EH3 A;  2QWT A;  1QPI A;  4M3D A;  2VKE A;  3MVP A;  5GPA A;  2F07 A;  3LSJ A;  5EZG A;  3IH4 A;  5D1R A;  3VVX A;  3QPS A;  5EYR A;  4L62 A;  3BT9 A;  3IH2 A;  3VOX A;  2ZCN A;  3Q0U A;  4KWA A;  2NS7 A;  3PAS A;  2ID3 A;  4NN1 A;  4V2G A;  3VW0 A;  4MK6 A;  2Y30 A;  5K7H A;  3Q3S A;  2IEK A;  5IPA A;  5F1J A;  3ZQH A;  2G3B A;  3HTH A;  3NPI A;  3V78 A;  3BQZ A;  5FKM A;  1BJZ A;  5IP6 A;  2DTZ A;  3BTC A;  2O7O A;  2W53 A;  3Q0V A;  3TP0 A;  2UXP A;  2DG8 A;  3VUQ A;  4JYK A;  2V57 A;  2NP3 A;  3G7R A;  2IBD A;  3NNR A;  5F08 A;  5J1Y A;  5D18 A;  3VIB A;  3DEW A;  3CDL A;  2Y31 A;  4D5C A;  4D5F A;  4M3F A;  1QVU A;  2JJ7 A;  1VI0 A;  2GUH A;  5C4Y A;  2G7L A;  2G7S A;  3DCF A;  1RKW A;  2FX0 A;  4XK4 A;  5EFY A;  3EUP A;  2ID6 A;  3VVY A;  2TRT A;  3WHC A;  2UXI A;  2HYJ A;  1ZK8 A;  3AQT A;  2FJ1 A;  3BCG A;  4W1U A;  3RD3 A;  3C07 A;  4HKU A;  4X1E A;  3PM1 A;  2QCO A;  3JSJ A;  3ON4 A;  2GBY A;  5FKO A;  2G7G A;  2OPT A;  2UXO A;  3G1M A;  4MXM A;  5CW8 A;  3LSR A;  2I10 A;  3BNI A;  4V2F A;  3COL A;  2QOP A;  2VKV A;  3BRU A;  2WUI A;  2XGC A;  3G56 A;  4W97 A;  3O8H A;  4JKZ A;  3SFI A;  3GEU A;  3VPR A;  3LJL A;  2HXO A;  3B6A A;  1ORK A;  5J3L A;  3KZ9 A;  3O8G A;  5F27 A;  3ZQF A;  3CJD A;  1Z0X A;  5K7Z A;  3HTI A;  5GP9 A;  3IUV A;  3BHQ A;  3VW1 A;  4B3A A;  5H9T A;  3ZQG A;  2XPW A;  5F0C A;  2QTQ A;  5FKK A;  2HQ5 A;  1UI6 A;  1JTX A;  3HGY A;  3BTL A;  2O7T A;  1T56 A;  1JUM A;  1RKT A;  3HE0 A;  5D19 A;  5FMP A;  4I76 A;  2XB5 A;  3BQY A;  3TP3 A;  3LOC A;  2YVH A;  3BR1 A;  5J1U A;  1JT6 A;  4M3E A;  1JUS A;  3ZQI A;  2JK3 A;  3QPL A;  3BR0 A;  3QBM A;  3KNW A;  2Y2Z A;  2YVE A;  5J1R A;  2FQ4 A;  4AUX A;  2XDN A;  1T33 A;  5F0H A;  2WGB A;  4ABZ A;  4YZE A;  3BJB A;  4AC0 A;  3BR2 A;  5HSZ A;  3ANP A;  4UDS A;  3ZQL A;  2ZOY A;  3PPB A;  2GEN A;  1QVT A;  2GFN A;  2QIB A;  2XGD A;  2WV1 A;  5CXG A;  4NEL A;  3EGQ A;  3BTI A;  1A6I A; 
#chains in the Genus database with same CATH topology
 2NP5 A;  2FBQ A;  2X6O A;  4OD5 A;  2OI8 A;  3VOK A;  3B81 A;  3LHQ A;  4GFK A;  3CRJ A;  3KKC A;  5K7F A;  3CCY A;  5HBU A;  3G1L A;  2XGE A;  2X9D A;  3QKX A;  2OER A;  3HTA A;  2RHA A;  2HKU A;  2XPV A;  4G12 A;  4ME9 A;  3T6N A;  2XPU A;  5HAW A;  5FGL A;  4GFL A;  3VW2 A;  4D7M A;  2ZB9 A;  2R7O A;  3G1O A;  3F0C A;  4D7N A;  2HYT A;  3BR3 A;  5F0F A;  5EZH A;  4U9N A;  3NXC A;  3VVZ A;  4DVY P;  3C2B A;  2QKO A;  2REK A;  3QQA A;  4I6Z A;  3BTJ A;  5IOZ A;  4JL3 A;  4CGR A;  4M3G A;  5FKN A;  3Q0W A;  3S5R A;  3O60 A;  1JT0 A;  3HIM A;  2DG7 A;  3BR6 A;  4GCL A;  2R7V A;  3ON2 A;  3DU6 A;  2TCT A;  2HXI A;  5AQC A;  2NS8 A;  3DPJ A;  3SDG A;  3P9T A;  4MO7 A;  1JTY A;  2XRL A;  5F04 A;  3FK6 A;  2VPR A;  2IU5 A;  2PZ9 A;  2ZCX A;  5IOY A;  3DU5 A;  3F1B A;  5DAJ A;  2UXH A;  1U9N A;  2B3W A;  3FRQ A;  2ZOZ A;  2D6Y A;  1Z77 A;  3NRG A;  1JUP A;  2OF7 A;  2FD5 A;  2R7S A;  4B1R A;  3NI7 A;  3FK7 A;  4DW6 A;  2ZCM A;  3WHB A;  5CXI A;  1U9O A;  1ZKG A;  3LSP A;  2NX4 A;  3KKD A;  2G0E A;  3CWR A;  2RAS A;  3BR5 A;  3IH3 A;  4ACI A;  3GZI A;  4M3B A;  3NS4 A;  2Q24 A;  3E7Q A;  3FIW A;  4AC6 A;  4JNN A;  2PBX A;  1SGM A;  4GCK A;  2PFV A;  3AQS A;  3V6G A;  3B6C A;  4AF5 A;  4PXI A;  3MNL A;  5FKL A;  1RPW A;  2RAE A;  2UXU A;  2IAI A;  5FHP A;  3RH2 A;  4ICH A;  3ANG A;  3VP5 A;  5GPC A;  1UI5 A;  3HTJ A;  5K58 A;  2B1E A;  4GCT A;  3LWJ A;  3HGG A;  2EH3 A;  2QWT A;  1QPI A;  4OD4 A;  4M3D A;  2VKE A;  3MVP A;  5GPA A;  3KYL A;  2F07 A;  3LSJ A;  5EZG A;  3IH4 A;  5D1R A;  3VVX A;  3QPS A;  5EYR A;  4L62 A;  3BT9 A;  3IH2 A;  2ZCN A;  3Q0U A;  3VOX A;  4KWA A;  2NS7 A;  3PAS A;  2ID3 A;  3SWH A;  4NN1 A;  4V2G A;  3VW0 A;  4MK6 A;  2Y30 A;  5K7H A;  3Q3S A;  2IEK A;  5IPA A;  5F1J A;  3ZQH A;  2G3B A;  3HTH A;  2FJI 1;  3NPI A;  3V78 A;  3BQZ A;  5FKM A;  1BJZ A;  5IP6 A;  2DTZ A;  3BTC A;  2O7O A;  4C2M A;  2W53 A;  3Q0V A;  3TP0 A;  2UXP A;  2DG8 A;  3VUQ A;  4JYK A;  2V57 A;  2NP3 A;  3G7R A;  2IBD A;  3NNR A;  5F08 A;  5J1Y A;  5D18 A;  3VIB A;  3DEW A;  3CDL A;  2Y31 A;  4D5C A;  4D5F A;  4M3F A;  1QVU A;  2JJ7 A;  1VI0 A;  2GUH A;  5C4Y A;  2G7L A;  2G7S A;  3DCF A;  1RKW A;  2FX0 A;  4XK4 A;  5EFY A;  3EUP A;  2ID6 A;  3VVY A;  2TRT A;  3WHC A;  2UXI A;  2HYJ A;  5CQG A;  1ZK8 A;  2R7X A;  3AQT A;  2FJ1 A;  3BCG A;  4W1U A;  3RD3 A;  3C07 A;  4HKU A;  4X1E A;  3PM1 A;  2QCO A;  3JSJ A;  4IRV A;  3ON4 A;  2GBY A;  3FHN A;  5FKO A;  2G7G A;  2OPT A;  2R7Q A;  2UXO A;  3G1M A;  4MXM A;  5CW8 A;  3LSR A;  2A2F X;  2I10 A;  3BNI A;  4V2F A;  3COL A;  3VTI A;  2QOP A;  2VKV A;  3BRU A;  2WUI A;  2XGC A;  3G56 A;  4W97 A;  3O8H A;  4JKZ A;  3SFI A;  2R7R A;  2R7T A;  3GEU A;  3VPR A;  3LJL A;  2HXO A;  3B6A A;  1ORK A;  5J3L A;  3KZ9 A;  3O8G A;  5F27 A;  3K8P C;  3ZQF A;  3CJD A;  1Z0X A;  5K7Z A;  3HTI A;  5GP9 A;  3IUV A;  3BHQ A;  3VW1 A;  4B3A A;  5H9T A;  3ZQG A;  2XPW A;  2YVX A;  5F0C A;  2QTQ A;  5FKK A;  2HQ5 A;  2ZY9 A;  1UI6 A;  1JTX A;  3HGY A;  3BTL A;  2O7T A;  4U9L A;  2R7W A;  1T56 A;  1JUM A;  1RKT A;  3HE0 A;  5D19 A;  5FMP A;  4I76 A;  2XB5 A;  3BQY A;  3TP3 A;  3LOC A;  2YVH A;  3BR1 A;  5J1U A;  1JT6 A;  4M3E A;  1JUS A;  4WIB A;  3ZQI A;  2JK3 A;  3QPL A;  3BR0 A;  3QBM A;  2R7U A;  3KNW A;  2Y2Z A;  2YVE A;  5J1R A;  2FQ4 A;  4AUX A;  2XDN A;  1T33 A;  5F0H A;  2WGB A;  4ABZ A;  4YZE A;  3BJB A;  4AC0 A;  3BR2 A;  5HSZ A;  3ANP A;  4UDS A;  3ZQL A;  2ZOY A;  3PPB A;  2GEN A;  1QVT A;  2GFN A;  2QIB A;  2XGD A;  2WV1 A;  5CXG A;  4NEL A;  3EGQ A;  3BTI A;  1A6I A; 
#chains in the Genus database with same CATH homology
 2NP5 A;  2FBQ A;  2X6O A;  2OI8 A;  3VOK A;  3B81 A;  3LHQ A;  4GFK A;  3CRJ A;  3KKC A;  5K7F A;  3CCY A;  5HBU A;  3G1L A;  2XGE A;  2X9D A;  3QKX A;  2OER A;  3HTA A;  2RHA A;  2HKU A;  2XPV A;  4G12 A;  4ME9 A;  3T6N A;  2XPU A;  5HAW A;  5FGL A;  4GFL A;  3VW2 A;  4D7M A;  2ZB9 A;  3G1O A;  3F0C A;  4D7N A;  2HYT A;  3BR3 A;  5F0F A;  5EZH A;  3NXC A;  3VVZ A;  3C2B A;  2QKO A;  2REK A;  3QQA A;  4I6Z A;  3BTJ A;  5IOZ A;  4JL3 A;  4CGR A;  4M3G A;  5FKN A;  3Q0W A;  3S5R A;  3O60 A;  1JT0 A;  3HIM A;  2DG7 A;  3BR6 A;  4GCL A;  3ON2 A;  2TCT A;  2HXI A;  5AQC A;  2NS8 A;  3DPJ A;  3SDG A;  3P9T A;  4MO7 A;  1JTY A;  2XRL A;  5F04 A;  3FK6 A;  2VPR A;  2IU5 A;  2PZ9 A;  2ZCX A;  5IOY A;  3F1B A;  5DAJ A;  2UXH A;  1U9N A;  3FRQ A;  2ZOZ A;  2D6Y A;  1Z77 A;  3NRG A;  1JUP A;  2OF7 A;  2FD5 A;  4B1R A;  3NI7 A;  3FK7 A;  4DW6 A;  2ZCM A;  3WHB A;  5CXI A;  1U9O A;  1ZKG A;  3LSP A;  2NX4 A;  3KKD A;  2G0E A;  3CWR A;  2RAS A;  3BR5 A;  3IH3 A;  4ACI A;  3GZI A;  4M3B A;  2Q24 A;  3E7Q A;  3FIW A;  4AC6 A;  4JNN A;  2PBX A;  1SGM A;  4GCK A;  3AQS A;  3V6G A;  3B6C A;  4AF5 A;  4PXI A;  3MNL A;  5FKL A;  1RPW A;  2RAE A;  2UXU A;  2IAI A;  5FHP A;  3RH2 A;  4ICH A;  3ANG A;  3VP5 A;  5GPC A;  1UI5 A;  3HTJ A;  5K58 A;  4GCT A;  3LWJ A;  3HGG A;  2EH3 A;  2QWT A;  1QPI A;  4M3D A;  2VKE A;  3MVP A;  5GPA A;  2F07 A;  3LSJ A;  5EZG A;  3IH4 A;  5D1R A;  3VVX A;  3QPS A;  5EYR A;  4L62 A;  3BT9 A;  3IH2 A;  3VOX A;  2ZCN A;  3Q0U A;  4KWA A;  2NS7 A;  3PAS A;  2ID3 A;  4NN1 A;  4V2G A;  3VW0 A;  4MK6 A;  2Y30 A;  5K7H A;  3Q3S A;  2IEK A;  5IPA A;  5F1J A;  3ZQH A;  2G3B A;  3HTH A;  3NPI A;  3V78 A;  3BQZ A;  5FKM A;  1BJZ A;  5IP6 A;  2DTZ A;  3BTC A;  2O7O A;  2W53 A;  3Q0V A;  3TP0 A;  2UXP A;  2DG8 A;  3VUQ A;  4JYK A;  2V57 A;  2NP3 A;  3G7R A;  2IBD A;  3NNR A;  5F08 A;  5J1Y A;  5D18 A;  3VIB A;  3DEW A;  3CDL A;  2Y31 A;  4D5C A;  4D5F A;  4M3F A;  1QVU A;  2JJ7 A;  1VI0 A;  2GUH A;  5C4Y A;  2G7L A;  2G7S A;  3DCF A;  1RKW A;  2FX0 A;  4XK4 A;  5EFY A;  3EUP A;  2ID6 A;  3VVY A;  2TRT A;  3WHC A;  2UXI A;  2HYJ A;  1ZK8 A;  3AQT A;  2FJ1 A;  3BCG A;  4W1U A;  3RD3 A;  3C07 A;  4HKU A;  4X1E A;  3PM1 A;  2QCO A;  3JSJ A;  3ON4 A;  2GBY A;  5FKO A;  2G7G A;  2OPT A;  2UXO A;  3G1M A;  4MXM A;  5CW8 A;  3LSR A;  2I10 A;  3BNI A;  4V2F A;  3COL A;  2QOP A;  2VKV A;  3BRU A;  2WUI A;  2XGC A;  3G56 A;  4W97 A;  3O8H A;  4JKZ A;  3SFI A;  3GEU A;  3VPR A;  3LJL A;  2HXO A;  3B6A A;  1ORK A;  5J3L A;  3KZ9 A;  3O8G A;  5F27 A;  3ZQF A;  3CJD A;  1Z0X A;  5K7Z A;  3HTI A;  5GP9 A;  3IUV A;  3BHQ A;  3VW1 A;  4B3A A;  5H9T A;  3ZQG A;  2XPW A;  5F0C A;  2QTQ A;  5FKK A;  2HQ5 A;  1UI6 A;  1JTX A;  3HGY A;  3BTL A;  2O7T A;  1T56 A;  1JUM A;  1RKT A;  3HE0 A;  5D19 A;  5FMP A;  4I76 A;  2XB5 A;  3BQY A;  3TP3 A;  3LOC A;  2YVH A;  3BR1 A;  5J1U A;  1JT6 A;  4M3E A;  1JUS A;  3ZQI A;  2JK3 A;  3QPL A;  3BR0 A;  3QBM A;  3KNW A;  2Y2Z A;  2YVE A;  5J1R A;  2FQ4 A;  4AUX A;  2XDN A;  1T33 A;  5F0H A;  2WGB A;  4ABZ A;  4YZE A;  3BJB A;  4AC0 A;  3BR2 A;  5HSZ A;  3ANP A;  4UDS A;  3ZQL A;  2ZOY A;  3PPB A;  2GEN A;  1QVT A;  2GFN A;  2QIB A;  2XGD A;  2WV1 A;  5CXG A;  4NEL A;  3EGQ A;  3BTI A;  1A6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...