3COLA

Crystal structure of putative transcription regulator from lactobacillus plantarum
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
187
structure length
180
Chain Sequence
NKQVKIQDAVAAIILAEGPAGVSTTKVAKRVGIAQSNVYLYFKNKQALIDSVYARETNRILSTTDLDRLSDSTIDVTTRIRLYVQQVYDYSLANPDSLTIIQQIKALNGQDADPNNIVANLLTAAIDAKVIKQLPVSLHMGVVFSTIHTHTTNISKGRYAQDQYTFGDIFQMIWDAMKQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcription regulator
publication title Crystal structure of putative transcription regulator from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Transcription regulator
total genus 64
structure length 180
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3colA00
3TP3A 3IH3A 3ZQHA 2OF7A 3WHCA 4JKZA 3BR1A 2Y31A 4D5CA 3IH2A 3DCFA 2FQ4A 2FD5A 4JNNA 5K7FA 2XRLA 4AC0A 3MNLA 3CDLA 2WGBA 3VIBA 5IPAA 1T56A 3BTJA 2HYJA 3FK6A 2QWTA 3BQZA 2HXIA 3G7RA 3PM1A 3NPIA 3SFIA 2O7OA 3VOXA 5HBUA 3CRJA 4W97A 2TCTA 3HTIA 5J3LA 2ZCXA 2IAIA 5EZHA 4AF5A 4CGRA 2YVHA 3LSRA 3VUQA 4GCKA 4V2FA 5HSZA 2GUHA 4MXMA 4M3EA 3HTJA 4X1EA 2GBYA 3CWRA 2NP5A 5IP6A 4NELA 2G7GA 3BR6A 3HGGA 2D6YA 3VPRA 2I10A 3BR5A 1QPIA 4L62A 2F07A 2NP3A 2NS8A 3BRUA 4AC6A 2PZ9A 4AUXA 3VW2A 3FIWA 3KKCA 3B6CA 2Y30A 1VI0A 2G3BA 3ON2A 4GCTA 3EUPA 1SGMA 1JT6A 3COLA 3BNIA 5HAWA 2TRTA 2ZB9A 1JTYA 2VPRA 3C07A 3Q0VA 3LSJA 3O60A 2IEKA 3HTAA 3CCYA 3Q0UA 1UI6A 5H9TA 5FKKA 3BTIA 2QIBA 5D1RA 3MVPA 1RKTA 2G0EA 2UXHA 3CJDA 2Q24A 3NNRA 5GPCA 2QOPA 5F08A 5J1RA 3VVXA 1JT0A 1ZKGA 2HQ5A 2JK3A 2ZOYA 3VVZA 3VVYA 2QKOA 2REKA 4NN1A 2VKEA 2GFNA 5EYRA 5J1UA 3KNWA 3VOKA 2ID3A 2UXIA 2IBDA 5FHPA 3NI7A 1ZK8A 2ZOZA 4I76A 2GENA 2FBQA 4UDSA 3GZIA 3AQTA 1QVUA 2XGCA 1A6IA 5C4YA 2NX4A 3QKXA 2G7SA 1JUMA 3ZQFA 5K7ZA 4D5FA 2RAEA 1Z0XA 3SDGA 2UXPA 3T6NA 4DW6A 3GEUA 3IUVA 1Z77A 2XGEA 3QPLA 2EH3A 5D19A 3VW1A 5CXGA 4KWAA 2HKUA 2OERA 5DAJA 4ICHA 5FMPA 3FRQA 2DTZA 4V2GA 3LHQA 3DPJA 2XPWA 3HGYA 3WHBA 3HTHA 5F0HA 3Q0WA 3RH2A 4MO7A 5FKLA 4HKUA 5F0FA 4G12A 2IU5A 2XB5A 4M3BA 1RKWA 4YZEA 2XPVA 3C2BA 2QCOA 4B3AA 5D18A 4M3FA 3ZQGA 4XK4A 5K7HA 5F27A 2QTQA 3BCGA 5K58A 3KKDA 5CW8A 5EZGA 2RHAA 3BQYA 2UXUA 4ABZA 4B1RA 3ON4A 5J1YA 3B81A 3G1MA 1RPWA 4GFKA 3ZQLA 5IOZA 2O7TA 2HXOA 3HE0A 3QBMA 3RD3A 3V6GA 3BTLA 3VW0A 4PXIA 3BR0A 1JUPA 3LOCA 3S5RA 3JSJA 5EFYA 3G1LA 3B6AA 2JJ7A 2NS7A 3BT9A 4ACIA 1ORKA 3QPSA 3QQAA 4I6ZA 2XDNA 5F1JA 4JL3A 2G7LA 2ID6A 3BHQA 1T33A 5GPAA 3AQSA 4JYKA 2W53A 5FGLA 1UI5A 5FKNA 3LJLA 5CXIA 2PBXA 3PASA 4D7MA 3G1OA 2FJ1A 1JUSA 3LSPA 1U9NA 3BR3A 2DG7A 2OPTA 3FK7A 1JTXA 3ANPA 5FKOA 3BR2A 2YVEA 4D7NA 5GP9A 2ZCMA 4W1UA 3Q3SA 2HYTA 5F0CA 2OI8A 1BJZA 1QVTA 5FKMA 2VKVA 2Y2ZA 3BJBA 4MK6A 2RASA 3O8GA 2V57A 3O8HA 3F0CA 5AQCA 3P9TA 5F04A 3E7QA 2WV1A 1U9OA 2XGDA 3PPBA 2X6OA 4ME9A 3NXCA 4GFLA 2XPUA 3G56A 2DG8A 4GCLA 2X9DA 3HIMA 3V78A 3VP5A 3ANGA 4M3GA 4M3DA 2ZCNA 3NRGA 2WUIA 3F1BA 3BTCA 2UXOA 2FX0A 3ZQIA 5IOYA 3KZ9A 3IH4A 3EGQA 3LWJA 3TP0A 3DEWA
chains in the Genus database with same CATH superfamily
2R7SA 3TP3A 3IH3A 3ZQHA 2OF7A 3WHCA 4JKZA 3BR1A 2Y31A 4D5CA 3IH2A 3DCFA 2FQ4A 2FD5A 4JNNA 5K7FA 2XRLA 4AC0A 3MNLA 2R7VA 3CDLA 2WGBA 3VIBA 5IPAA 1T56A 3BTJA 2HYJA 3NS4A 3FK6A 2QWTA 3BQZA 2HXIA 3G7RA 3PM1A 3NPIA 3SFIA 2O7OA 3VOXA 5HBUA 3CRJA 4W97A 2TCTA 3HTIA 5J3LA 4U9NA 2ZCXA 2IAIA 5EZHA 4AF5A 2B3WA 4CGRA 2YVHA 3LSRA 3VUQA 4GCKA 4V2FA 5HSZA 2GUHA 4MXMA 4OD4A 4M3EA 3HTJA 4X1EA 2GBYA 3CWRA 2NP5A 5IP6A 4NELA 2G7GA 3BR6A 3HGGA 2D6YA 3VPRA 2I10A 3BR5A 1QPIA 4L62A 2F07A 2NP3A 2NS8A 3BRUA 4AC6A 2PZ9A 4AUXA 3VW2A 3FIWA 3KKCA 3B6CA 2Y30A 1VI0A 2G3BA 3ON2A 3DU5A 4GCTA 3EUPA 1SGMA 1JT6A 3COLA 3BNIA 5HAWA 2TRTA 2ZB9A 1JTYA 2VPRA 3C07A 3Q0VA 3LSJA 3O60A 2IEKA 3HTAA 3CCYA 3Q0UA 1UI6A 5H9TA 5FKKA 3BTIA 2QIBA 5D1RA 3MVPA 1RKTA 2G0EA 2UXHA 3CJDA 2Q24A 3NNRA 5GPCA 2QOPA 5F08A 3SWHA 5J1RA 3VVXA 1JT0A 1ZKGA 2HQ5A 2JK3A 2ZOYA 3VVZA 3VVYA 2QKOA 2REKA 4NN1A 2VKEA 2GFNA 5EYRA 5J1UA 3KNWA 3VOKA 2ID3A 2UXIA 2IBDA 5FHPA 5CQGA 3NI7A 2YVXA 1ZK8A 2ZOZA 4I76A 3K8PC 2GENA 2FBQA 4UDSA 3GZIA 3AQTA 2R7UA 1QVUA 2XGCA 1A6IA 5C4YA 2NX4A 2R7RA 3QKXA 2G7SA 1JUMA 3ZQFA 3KYLA 5K7ZA 4D5FA 2R7QA 2RAEA 1Z0XA 3SDGA 2UXPA 3T6NA 4U9LA 4DW6A 3GEUA 3IUVA 1Z77A 2XGEA 3QPLA 2EH3A 5D19A 3VW1A 5CXGA 4KWAA 2HKUA 2OERA 5DAJA 4ICHA 5FMPA 3FRQA 2DTZA 4V2GA 2R7XA 3LHQA 3DPJA 2XPWA 3HGYA 3WHBA 3HTHA 5F0HA 3Q0WA 3RH2A 4MO7A 5FKLA 4HKUA 5F0FA 4G12A 2IU5A 2XB5A 4M3BA 1RKWA 4YZEA 2XPVA 3C2BA 2QCOA 4B3AA 5D18A 4M3FA 3ZQGA 4XK4A 5K7HA 5F27A 2QTQA 3BCGA 5K58A 3KKDA 5CW8A 5EZGA 2RHAA 3BQYA 2UXUA 4ABZA 4B1RA 3ON4A 5J1YA 3B81A 3G1MA 1RPWA 4GFKA 3ZQLA 5IOZA 2O7TA 2HXOA 3HE0A 3QBMA 3RD3A 3V6GA 3BTLA 3VW0A 4OD5A 4PXIA 3BR0A 1JUPA 3LOCA 3S5RA 3JSJA 5EFYA 3G1LA 3B6AA 2JJ7A 4C2MA 2NS7A 3BT9A 4ACIA 1ORKA 3QPSA 3QQAA 4I6ZA 2XDNA 5F1JA 4JL3A 2G7LA 2ID6A 3BHQA 1T33A 2B1EA 5GPAA 4DVYP 3AQSA 4JYKA 2W53A 5FGLA 1UI5A 5FKNA 3LJLA 5CXIA 2R7WA 2PBXA 3PASA 4D7MA 3G1OA 2FJ1A 1JUSA 3LSPA 1U9NA 3BR3A 2DG7A 2OPTA 3FK7A 2R7TA 1JTXA 3ANPA 5FKOA 4IRVA 3BR2A 2YVEA 4D7NA 5GP9A 2ZCMA 4W1UA 3Q3SA 2HYTA 2ZY9A 5F0CA 2OI8A 1BJZA 1QVTA 5FKMA 2VKVA 2Y2ZA 2PFVA 3BJBA 4MK6A 2RASA 3O8GA 3DU6A 2V57A 3O8HA 3F0CA 5AQCA 3P9TA 5F04A 3E7QA 2WV1A 1U9OA 2XGDA 3PPBA 2X6OA 4ME9A 3NXCA 3VTIA 3FHNA 4GFLA 2XPUA 3G56A 2DG8A 4GCLA 2FJI1 2X9DA 3HIMA 3V78A 4WIBA 3VP5A 3ANGA 4M3GA 4M3DA 2A2FX 2ZCNA 3NRGA 2WUIA 3F1BA 2R7OA 3BTCA 2UXOA 2FX0A 3ZQIA 5IOYA 3KZ9A 3IH4A 3EGQA 3LWJA 3TP0A 3DEWA
chains in the Genus database with same CATH topology
3TP3A 3IH3A 3ZQHA 2OF7A 3WHCA 4JKZA 3BR1A 2Y31A 4D5CA 3IH2A 3DCFA 2FQ4A 2FD5A 4JNNA 5K7FA 2XRLA 4AC0A 3MNLA 3CDLA 2WGBA 3VIBA 5IPAA 1T56A 3BTJA 2HYJA 3FK6A 2QWTA 3BQZA 2HXIA 3G7RA 3PM1A 3NPIA 3SFIA 2O7OA 3VOXA 5HBUA 3CRJA 4W97A 2TCTA 3HTIA 5J3LA 2ZCXA 2IAIA 5EZHA 4AF5A 4CGRA 2YVHA 3LSRA 3VUQA 4GCKA 4V2FA 5HSZA 2GUHA 4MXMA 4M3EA 3HTJA 4X1EA 2GBYA 3CWRA 2NP5A 5IP6A 4NELA 2G7GA 3BR6A 3HGGA 2D6YA 3VPRA 2I10A 3BR5A 1QPIA 4L62A 2F07A 2NP3A 2NS8A 3BRUA 4AC6A 2PZ9A 4AUXA 3VW2A 3FIWA 3KKCA 3B6CA 2Y30A 1VI0A 2G3BA 3ON2A 4GCTA 3EUPA 1SGMA 1JT6A 3COLA 3BNIA 5HAWA 2TRTA 2ZB9A 1JTYA 2VPRA 3C07A 3Q0VA 3LSJA 3O60A 2IEKA 3HTAA 3CCYA 3Q0UA 1UI6A 5H9TA 5FKKA 3BTIA 2QIBA 5D1RA 3MVPA 1RKTA 2G0EA 2UXHA 3CJDA 2Q24A 3NNRA 5GPCA 2QOPA 5F08A 5J1RA 3VVXA 1JT0A 1ZKGA 2HQ5A 2JK3A 2ZOYA 3VVZA 3VVYA 2QKOA 2REKA 4NN1A 2VKEA 2GFNA 5EYRA 5J1UA 3KNWA 3VOKA 2ID3A 2UXIA 2IBDA 5FHPA 3NI7A 1ZK8A 2ZOZA 4I76A 2GENA 2FBQA 4UDSA 3GZIA 3AQTA 1QVUA 2XGCA 1A6IA 5C4YA 2NX4A 3QKXA 2G7SA 1JUMA 3ZQFA 5K7ZA 4D5FA 2RAEA 1Z0XA 3SDGA 2UXPA 3T6NA 4DW6A 3GEUA 3IUVA 1Z77A 2XGEA 3QPLA 2EH3A 5D19A 3VW1A 5CXGA 4KWAA 2HKUA 2OERA 5DAJA 4ICHA 5FMPA 3FRQA 2DTZA 4V2GA 3LHQA 3DPJA 2XPWA 3HGYA 3WHBA 3HTHA 5F0HA 3Q0WA 3RH2A 4MO7A 5FKLA 4HKUA 5F0FA 4G12A 2IU5A 2XB5A 4M3BA 1RKWA 4YZEA 2XPVA 3C2BA 2QCOA 4B3AA 5D18A 4M3FA 3ZQGA 4XK4A 5K7HA 5F27A 2QTQA 3BCGA 5K58A 3KKDA 5CW8A 5EZGA 2RHAA 3BQYA 2UXUA 4ABZA 4B1RA 3ON4A 5J1YA 3B81A 3G1MA 1RPWA 4GFKA 3ZQLA 5IOZA 2O7TA 2HXOA 3HE0A 3QBMA 3RD3A 3V6GA 3BTLA 3VW0A 4PXIA 3BR0A 1JUPA 3LOCA 3S5RA 3JSJA 5EFYA 3G1LA 3B6AA 2JJ7A 2NS7A 3BT9A 4ACIA 1ORKA 3QPSA 3QQAA 4I6ZA 2XDNA 5F1JA 4JL3A 2G7LA 2ID6A 3BHQA 1T33A 5GPAA 3AQSA 4JYKA 2W53A 5FGLA 1UI5A 5FKNA 3LJLA 5CXIA 2PBXA 3PASA 4D7MA 3G1OA 2FJ1A 1JUSA 3LSPA 1U9NA 3BR3A 2DG7A 2OPTA 3FK7A 1JTXA 3ANPA 5FKOA 3BR2A 2YVEA 4D7NA 5GP9A 2ZCMA 4W1UA 3Q3SA 2HYTA 5F0CA 2OI8A 1BJZA 1QVTA 5FKMA 2VKVA 2Y2ZA 3BJBA 4MK6A 2RASA 3O8GA 2V57A 3O8HA 3F0CA 5AQCA 3P9TA 5F04A 3E7QA 2WV1A 1U9OA 2XGDA 3PPBA 2X6OA 4ME9A 3NXCA 4GFLA 2XPUA 3G56A 2DG8A 4GCLA 2X9DA 3HIMA 3V78A 3VP5A 3ANGA 4M3GA 4M3DA 2ZCNA 3NRGA 2WUIA 3F1BA 3BTCA 2UXOA 2FX0A 3ZQIA 5IOYA 3KZ9A 3IH4A 3EGQA 3LWJA 3TP0A 3DEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP3 A;  3IH3 A;  3ZQH A;  2OF7 A;  3WHC A;  4JKZ A;  3BR1 A;  2Y31 A;  4D5C A;  3IH2 A;  3DCF A;  2FQ4 A;  2FD5 A;  4JNN A;  5K7F A;  2XRL A;  4AC0 A;  3MNL A;  3CDL A;  2WGB A;  3VIB A;  5IPA A;  1T56 A;  3BTJ A;  2HYJ A;  3FK6 A;  2QWT A;  3BQZ A;  2HXI A;  3G7R A;  3PM1 A;  3NPI A;  3SFI A;  2O7O A;  3VOX A;  5HBU A;  3CRJ A;  4W97 A;  2TCT A;  3HTI A;  5J3L A;  2ZCX A;  2IAI A;  5EZH A;  4AF5 A;  4CGR A;  2YVH A;  3LSR A;  3VUQ A;  4GCK A;  4V2F A;  5HSZ A;  2GUH A;  4MXM A;  4M3E A;  3HTJ A;  4X1E A;  2GBY A;  3CWR A;  2NP5 A;  5IP6 A;  4NEL A;  2G7G A;  3BR6 A;  3HGG A;  2D6Y A;  3VPR A;  2I10 A;  3BR5 A;  1QPI A;  4L62 A;  2F07 A;  2NP3 A;  2NS8 A;  3BRU A;  4AC6 A;  2PZ9 A;  4AUX A;  3VW2 A;  3FIW A;  3KKC A;  3B6C A;  2Y30 A;  1VI0 A;  2G3B A;  3ON2 A;  4GCT A;  3EUP A;  1SGM A;  1JT6 A;  3COL A;  3BNI A;  5HAW A;  2TRT A;  2ZB9 A;  1JTY A;  2VPR A;  3C07 A;  3Q0V A;  3LSJ A;  3O60 A;  2IEK A;  3HTA A;  3CCY A;  3Q0U A;  1UI6 A;  5H9T A;  5FKK A;  3BTI A;  2QIB A;  5D1R A;  3MVP A;  1RKT A;  2G0E A;  2UXH A;  3CJD A;  2Q24 A;  3NNR A;  5GPC A;  2QOP A;  5F08 A;  5J1R A;  3VVX A;  1JT0 A;  1ZKG A;  2HQ5 A;  2JK3 A;  2ZOY A;  3VVZ A;  3VVY A;  2QKO A;  2REK A;  4NN1 A;  2VKE A;  2GFN A;  5EYR A;  5J1U A;  3KNW A;  3VOK A;  2ID3 A;  2UXI A;  2IBD A;  5FHP A;  3NI7 A;  1ZK8 A;  2ZOZ A;  4I76 A;  2GEN A;  2FBQ A;  4UDS A;  3GZI A;  3AQT A;  1QVU A;  2XGC A;  1A6I A;  5C4Y A;  2NX4 A;  3QKX A;  2G7S A;  1JUM A;  3ZQF A;  5K7Z A;  4D5F A;  2RAE A;  1Z0X A;  3SDG A;  2UXP A;  3T6N A;  4DW6 A;  3GEU A;  3IUV A;  1Z77 A;  2XGE A;  3QPL A;  2EH3 A;  5D19 A;  3VW1 A;  5CXG A;  4KWA A;  2HKU A;  2OER A;  5DAJ A;  4ICH A;  5FMP A;  3FRQ A;  2DTZ A;  4V2G A;  3LHQ A;  3DPJ A;  2XPW A;  3HGY A;  3WHB A;  3HTH A;  5F0H A;  3Q0W A;  3RH2 A;  4MO7 A;  5FKL A;  4HKU A;  5F0F A;  4G12 A;  2IU5 A;  2XB5 A;  4M3B A;  1RKW A;  4YZE A;  2XPV A;  3C2B A;  2QCO A;  4B3A A;  5D18 A;  4M3F A;  3ZQG A;  4XK4 A;  5K7H A;  5F27 A;  2QTQ A;  3BCG A;  5K58 A;  3KKD A;  5CW8 A;  5EZG A;  2RHA A;  3BQY A;  2UXU A;  4ABZ A;  4B1R A;  3ON4 A;  5J1Y A;  3B81 A;  3G1M A;  1RPW A;  4GFK A;  3ZQL A;  5IOZ A;  2O7T A;  2HXO A;  3HE0 A;  3QBM A;  3RD3 A;  3V6G A;  3BTL A;  3VW0 A;  4PXI A;  3BR0 A;  1JUP A;  3LOC A;  3S5R A;  3JSJ A;  5EFY A;  3G1L A;  3B6A A;  2JJ7 A;  2NS7 A;  3BT9 A;  4ACI A;  1ORK A;  3QPS A;  3QQA A;  4I6Z A;  2XDN A;  5F1J A;  4JL3 A;  2G7L A;  2ID6 A;  3BHQ A;  1T33 A;  5GPA A;  3AQS A;  4JYK A;  2W53 A;  5FGL A;  1UI5 A;  5FKN A;  3LJL A;  5CXI A;  2PBX A;  3PAS A;  4D7M A;  3G1O A;  2FJ1 A;  1JUS A;  3LSP A;  1U9N A;  3BR3 A;  2DG7 A;  2OPT A;  3FK7 A;  1JTX A;  3ANP A;  5FKO A;  3BR2 A;  2YVE A;  4D7N A;  5GP9 A;  2ZCM A;  4W1U A;  3Q3S A;  2HYT A;  5F0C A;  2OI8 A;  1BJZ A;  1QVT A;  5FKM A;  2VKV A;  2Y2Z A;  3BJB A;  4MK6 A;  2RAS A;  3O8G A;  2V57 A;  3O8H A;  3F0C A;  5AQC A;  3P9T A;  5F04 A;  3E7Q A;  2WV1 A;  1U9O A;  2XGD A;  3PPB A;  2X6O A;  4ME9 A;  3NXC A;  4GFL A;  2XPU A;  3G56 A;  2DG8 A;  4GCL A;  2X9D A;  3HIM A;  3V78 A;  3VP5 A;  3ANG A;  4M3G A;  4M3D A;  2ZCN A;  3NRG A;  2WUI A;  3F1B A;  3BTC A;  2UXO A;  2FX0 A;  3ZQI A;  5IOY A;  3KZ9 A;  3IH4 A;  3EGQ A;  3LWJ A;  3TP0 A;  3DEW A; 
#chains in the Genus database with same CATH topology
 2R7S A;  3TP3 A;  3IH3 A;  3ZQH A;  2OF7 A;  3WHC A;  4JKZ A;  3BR1 A;  2Y31 A;  4D5C A;  3IH2 A;  3DCF A;  2FQ4 A;  2FD5 A;  4JNN A;  5K7F A;  2XRL A;  4AC0 A;  3MNL A;  2R7V A;  3CDL A;  2WGB A;  3VIB A;  5IPA A;  1T56 A;  3BTJ A;  2HYJ A;  3NS4 A;  3FK6 A;  2QWT A;  3BQZ A;  2HXI A;  3G7R A;  3PM1 A;  3NPI A;  3SFI A;  2O7O A;  3VOX A;  5HBU A;  3CRJ A;  4W97 A;  2TCT A;  3HTI A;  5J3L A;  4U9N A;  2ZCX A;  2IAI A;  5EZH A;  4AF5 A;  2B3W A;  4CGR A;  2YVH A;  3LSR A;  3VUQ A;  4GCK A;  4V2F A;  5HSZ A;  2GUH A;  4MXM A;  4OD4 A;  4M3E A;  3HTJ A;  4X1E A;  2GBY A;  3CWR A;  2NP5 A;  5IP6 A;  4NEL A;  2G7G A;  3BR6 A;  3HGG A;  2D6Y A;  3VPR A;  2I10 A;  3BR5 A;  1QPI A;  4L62 A;  2F07 A;  2NP3 A;  2NS8 A;  3BRU A;  4AC6 A;  2PZ9 A;  4AUX A;  3VW2 A;  3FIW A;  3KKC A;  3B6C A;  2Y30 A;  1VI0 A;  2G3B A;  3ON2 A;  3DU5 A;  4GCT A;  3EUP A;  1SGM A;  1JT6 A;  3COL A;  3BNI A;  5HAW A;  2TRT A;  2ZB9 A;  1JTY A;  2VPR A;  3C07 A;  3Q0V A;  3LSJ A;  3O60 A;  2IEK A;  3HTA A;  3CCY A;  3Q0U A;  1UI6 A;  5H9T A;  5FKK A;  3BTI A;  2QIB A;  5D1R A;  3MVP A;  1RKT A;  2G0E A;  2UXH A;  3CJD A;  2Q24 A;  3NNR A;  5GPC A;  2QOP A;  5F08 A;  3SWH A;  5J1R A;  3VVX A;  1JT0 A;  1ZKG A;  2HQ5 A;  2JK3 A;  2ZOY A;  3VVZ A;  3VVY A;  2QKO A;  2REK A;  4NN1 A;  2VKE A;  2GFN A;  5EYR A;  5J1U A;  3KNW A;  3VOK A;  2ID3 A;  2UXI A;  2IBD A;  5FHP A;  5CQG A;  3NI7 A;  2YVX A;  1ZK8 A;  2ZOZ A;  4I76 A;  3K8P C;  2GEN A;  2FBQ A;  4UDS A;  3GZI A;  3AQT A;  2R7U A;  1QVU A;  2XGC A;  1A6I A;  5C4Y A;  2NX4 A;  2R7R A;  3QKX A;  2G7S A;  1JUM A;  3ZQF A;  3KYL A;  5K7Z A;  4D5F A;  2R7Q A;  2RAE A;  1Z0X A;  3SDG A;  2UXP A;  3T6N A;  4U9L A;  4DW6 A;  3GEU A;  3IUV A;  1Z77 A;  2XGE A;  3QPL A;  2EH3 A;  5D19 A;  3VW1 A;  5CXG A;  4KWA A;  2HKU A;  2OER A;  5DAJ A;  4ICH A;  5FMP A;  3FRQ A;  2DTZ A;  4V2G A;  2R7X A;  3LHQ A;  3DPJ A;  2XPW A;  3HGY A;  3WHB A;  3HTH A;  5F0H A;  3Q0W A;  3RH2 A;  4MO7 A;  5FKL A;  4HKU A;  5F0F A;  4G12 A;  2IU5 A;  2XB5 A;  4M3B A;  1RKW A;  4YZE A;  2XPV A;  3C2B A;  2QCO A;  4B3A A;  5D18 A;  4M3F A;  3ZQG A;  4XK4 A;  5K7H A;  5F27 A;  2QTQ A;  3BCG A;  5K58 A;  3KKD A;  5CW8 A;  5EZG A;  2RHA A;  3BQY A;  2UXU A;  4ABZ A;  4B1R A;  3ON4 A;  5J1Y A;  3B81 A;  3G1M A;  1RPW A;  4GFK A;  3ZQL A;  5IOZ A;  2O7T A;  2HXO A;  3HE0 A;  3QBM A;  3RD3 A;  3V6G A;  3BTL A;  3VW0 A;  4OD5 A;  4PXI A;  3BR0 A;  1JUP A;  3LOC A;  3S5R A;  3JSJ A;  5EFY A;  3G1L A;  3B6A A;  2JJ7 A;  4C2M A;  2NS7 A;  3BT9 A;  4ACI A;  1ORK A;  3QPS A;  3QQA A;  4I6Z A;  2XDN A;  5F1J A;  4JL3 A;  2G7L A;  2ID6 A;  3BHQ A;  1T33 A;  2B1E A;  5GPA A;  4DVY P;  3AQS A;  4JYK A;  2W53 A;  5FGL A;  1UI5 A;  5FKN A;  3LJL A;  5CXI A;  2R7W A;  2PBX A;  3PAS A;  4D7M A;  3G1O A;  2FJ1 A;  1JUS A;  3LSP A;  1U9N A;  3BR3 A;  2DG7 A;  2OPT A;  3FK7 A;  2R7T A;  1JTX A;  3ANP A;  5FKO A;  4IRV A;  3BR2 A;  2YVE A;  4D7N A;  5GP9 A;  2ZCM A;  4W1U A;  3Q3S A;  2HYT A;  2ZY9 A;  5F0C A;  2OI8 A;  1BJZ A;  1QVT A;  5FKM A;  2VKV A;  2Y2Z A;  2PFV A;  3BJB A;  4MK6 A;  2RAS A;  3O8G A;  3DU6 A;  2V57 A;  3O8H A;  3F0C A;  5AQC A;  3P9T A;  5F04 A;  3E7Q A;  2WV1 A;  1U9O A;  2XGD A;  3PPB A;  2X6O A;  4ME9 A;  3NXC A;  3VTI A;  3FHN A;  4GFL A;  2XPU A;  3G56 A;  2DG8 A;  4GCL A;  2FJI 1;  2X9D A;  3HIM A;  3V78 A;  4WIB A;  3VP5 A;  3ANG A;  4M3G A;  4M3D A;  2A2F X;  2ZCN A;  3NRG A;  2WUI A;  3F1B A;  2R7O A;  3BTC A;  2UXO A;  2FX0 A;  3ZQI A;  5IOY A;  3KZ9 A;  3IH4 A;  3EGQ A;  3LWJ A;  3TP0 A;  3DEW A; 
#chains in the Genus database with same CATH homology
 3TP3 A;  3IH3 A;  3ZQH A;  2OF7 A;  3WHC A;  4JKZ A;  3BR1 A;  2Y31 A;  4D5C A;  3IH2 A;  3DCF A;  2FQ4 A;  2FD5 A;  4JNN A;  5K7F A;  2XRL A;  4AC0 A;  3MNL A;  3CDL A;  2WGB A;  3VIB A;  5IPA A;  1T56 A;  3BTJ A;  2HYJ A;  3FK6 A;  2QWT A;  3BQZ A;  2HXI A;  3G7R A;  3PM1 A;  3NPI A;  3SFI A;  2O7O A;  3VOX A;  5HBU A;  3CRJ A;  4W97 A;  2TCT A;  3HTI A;  5J3L A;  2ZCX A;  2IAI A;  5EZH A;  4AF5 A;  4CGR A;  2YVH A;  3LSR A;  3VUQ A;  4GCK A;  4V2F A;  5HSZ A;  2GUH A;  4MXM A;  4M3E A;  3HTJ A;  4X1E A;  2GBY A;  3CWR A;  2NP5 A;  5IP6 A;  4NEL A;  2G7G A;  3BR6 A;  3HGG A;  2D6Y A;  3VPR A;  2I10 A;  3BR5 A;  1QPI A;  4L62 A;  2F07 A;  2NP3 A;  2NS8 A;  3BRU A;  4AC6 A;  2PZ9 A;  4AUX A;  3VW2 A;  3FIW A;  3KKC A;  3B6C A;  2Y30 A;  1VI0 A;  2G3B A;  3ON2 A;  4GCT A;  3EUP A;  1SGM A;  1JT6 A;  3COL A;  3BNI A;  5HAW A;  2TRT A;  2ZB9 A;  1JTY A;  2VPR A;  3C07 A;  3Q0V A;  3LSJ A;  3O60 A;  2IEK A;  3HTA A;  3CCY A;  3Q0U A;  1UI6 A;  5H9T A;  5FKK A;  3BTI A;  2QIB A;  5D1R A;  3MVP A;  1RKT A;  2G0E A;  2UXH A;  3CJD A;  2Q24 A;  3NNR A;  5GPC A;  2QOP A;  5F08 A;  5J1R A;  3VVX A;  1JT0 A;  1ZKG A;  2HQ5 A;  2JK3 A;  2ZOY A;  3VVZ A;  3VVY A;  2QKO A;  2REK A;  4NN1 A;  2VKE A;  2GFN A;  5EYR A;  5J1U A;  3KNW A;  3VOK A;  2ID3 A;  2UXI A;  2IBD A;  5FHP A;  3NI7 A;  1ZK8 A;  2ZOZ A;  4I76 A;  2GEN A;  2FBQ A;  4UDS A;  3GZI A;  3AQT A;  1QVU A;  2XGC A;  1A6I A;  5C4Y A;  2NX4 A;  3QKX A;  2G7S A;  1JUM A;  3ZQF A;  5K7Z A;  4D5F A;  2RAE A;  1Z0X A;  3SDG A;  2UXP A;  3T6N A;  4DW6 A;  3GEU A;  3IUV A;  1Z77 A;  2XGE A;  3QPL A;  2EH3 A;  5D19 A;  3VW1 A;  5CXG A;  4KWA A;  2HKU A;  2OER A;  5DAJ A;  4ICH A;  5FMP A;  3FRQ A;  2DTZ A;  4V2G A;  3LHQ A;  3DPJ A;  2XPW A;  3HGY A;  3WHB A;  3HTH A;  5F0H A;  3Q0W A;  3RH2 A;  4MO7 A;  5FKL A;  4HKU A;  5F0F A;  4G12 A;  2IU5 A;  2XB5 A;  4M3B A;  1RKW A;  4YZE A;  2XPV A;  3C2B A;  2QCO A;  4B3A A;  5D18 A;  4M3F A;  3ZQG A;  4XK4 A;  5K7H A;  5F27 A;  2QTQ A;  3BCG A;  5K58 A;  3KKD A;  5CW8 A;  5EZG A;  2RHA A;  3BQY A;  2UXU A;  4ABZ A;  4B1R A;  3ON4 A;  5J1Y A;  3B81 A;  3G1M A;  1RPW A;  4GFK A;  3ZQL A;  5IOZ A;  2O7T A;  2HXO A;  3HE0 A;  3QBM A;  3RD3 A;  3V6G A;  3BTL A;  3VW0 A;  4PXI A;  3BR0 A;  1JUP A;  3LOC A;  3S5R A;  3JSJ A;  5EFY A;  3G1L A;  3B6A A;  2JJ7 A;  2NS7 A;  3BT9 A;  4ACI A;  1ORK A;  3QPS A;  3QQA A;  4I6Z A;  2XDN A;  5F1J A;  4JL3 A;  2G7L A;  2ID6 A;  3BHQ A;  1T33 A;  5GPA A;  3AQS A;  4JYK A;  2W53 A;  5FGL A;  1UI5 A;  5FKN A;  3LJL A;  5CXI A;  2PBX A;  3PAS A;  4D7M A;  3G1O A;  2FJ1 A;  1JUS A;  3LSP A;  1U9N A;  3BR3 A;  2DG7 A;  2OPT A;  3FK7 A;  1JTX A;  3ANP A;  5FKO A;  3BR2 A;  2YVE A;  4D7N A;  5GP9 A;  2ZCM A;  4W1U A;  3Q3S A;  2HYT A;  5F0C A;  2OI8 A;  1BJZ A;  1QVT A;  5FKM A;  2VKV A;  2Y2Z A;  3BJB A;  4MK6 A;  2RAS A;  3O8G A;  2V57 A;  3O8H A;  3F0C A;  5AQC A;  3P9T A;  5F04 A;  3E7Q A;  2WV1 A;  1U9O A;  2XGD A;  3PPB A;  2X6O A;  4ME9 A;  3NXC A;  4GFL A;  2XPU A;  3G56 A;  2DG8 A;  4GCL A;  2X9D A;  3HIM A;  3V78 A;  3VP5 A;  3ANG A;  4M3G A;  4M3D A;  2ZCN A;  3NRG A;  2WUI A;  3F1B A;  3BTC A;  2UXO A;  2FX0 A;  3ZQI A;  5IOY A;  3KZ9 A;  3IH4 A;  3EGQ A;  3LWJ A;  3TP0 A;  3DEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...