3RH2A

Crystal structure of a tetr-like transcriptional regulator (sama_0099) from shewanella amazonensis sb2b at 2.42 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
210
structure length
210
Chain Sequence
b'MKTRDKIIQASLELFNEHGERTITTNHIAAHLDISPGNLYYHFRNKEDIIRCIFDQYEQHLLLGFKPYADQKVDLELLMSYFDAMFYTMWQFRFMYANLADILARDDTLKARYLKVQQAVLEQSIAVLNQLKKDGILQIEDERIADLADTIKMIIGFWISYKLTQSSIATISKASLYEGLLRVLMIFKAYSTPDSLANFDRLEQHFRSQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical TetR-like transcriptional regulator
publication title Crystal structure of a Hypothetical TetR-like transcriptional regulator (Sama_0099) from SHEWANELLA AMAZONENSIS SB2B at 2.42 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Dna binding protein
total genus 75
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13972 TetR Bacterial transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3rh2A00
3O8HA 3VVZA 3Q0VA 2ZCNA 5K7ZA 2JK3A 3IH2A 5K58A 3CWRA 5IOYA 3LWJA 3BTLA 2XDNA 3BTCA 3G1MA 3CRJA 3VVXA 4D5FA 3NPIA 4D7NA 2WV1A 2FQ4A 5FKMA 2NS7A 2TCTA 4M3GA 1JUPA 3PASA 2HXIA 5F08A 3MNLA 3SFIA 1SGMA 3LJLA 2XPWA 2UXPA 5FKLA 1Z0XA 5GP9A 5F0HA 1JTYA 2XGCA 3EGQA 3VW2A 2NX4A 3V6GA 2GUHA 2YVHA 2QKOA 3O60A 2HKUA 1JTXA 3ZQFA 5J1YA 4W97A 4JYKA 3HTJA 4M3DA 1RKWA 2D6YA 2QTQA 3GEUA 3ON2A 3ZQHA 3G1LA 4B3AA 3BRUA 3DEWA 4GCTA 4B1RA 3BJBA 2XPVA 3QPLA 4GCLA 2UXIA 4JKZA 3ANPA 5F04A 2VKVA 5F1JA 2VPRA 3E7QA 4V2FA 3HIMA 4AC0A 2RAEA 3VW1A 5K7HA 1ZKGA 2Q24A 2X9DA 2XB5A 5HAWA 2FJ1A 2ZCMA 1VI0A 2NS8A 3KZ9A 3S5RA 5FMPA 3VOXA 2G0EA 5D18A 2GBYA 1QVUA 1JT6A 3NI7A 3BTIA 5CW8A 2YVEA 2Y2ZA 5HBUA 1JT0A 5FKNA 3BQYA 2IBDA 4I6ZA 2HQ5A 2Y30A 3LOCA 2WUIA 4ME9A 2XRLA 3Q0UA 3BR6A 3VPRA 2PZ9A 5GPAA 3LHQA 3F1BA 2ID3A 3IH4A 3VUQA 2OI8A 5EFYA 5HSZA 2DG7A 3COLA 3FK7A 2WGBA 3PM1A 3BCGA 5EZHA 3VVYA 3Q0WA 2ID6A 5EYRA 1Z77A 1ORKA 3NRGA 2FX0A 2G3BA 2O7TA 3BR1A 5D19A 5DAJA 1QPIA 3ANGA 2RASA 3HTHA 4NELA 3B6AA 3IUVA 1RPWA 3TP0A 3QBMA 3CJDA 4UDSA 3HTIA 2G7SA 5IPAA 3LSPA 2EH3A 2XGDA 3BNIA 4AF5A 2O7OA 5J1RA 1T56A 5J1UA 3F0CA 5FKOA 5EZGA 2V57A 3FK6A 5F27A 4MO7A 2GENA 3LSRA 5D1RA 2OF7A 3V78A 2HXOA 4D7MA 5CXGA 2FD5A 3VIBA 2ZOZA 3TP3A 2QWTA 2QOPA 3HGYA 5FHPA 2Y31A 3KKDA 3O8GA 3JSJA 2NP3A 3HTAA 4JNNA 3BR5A 2W53A 3HGGA 5F0CA 2DTZA 2XGEA 3ZQIA 2UXHA 1ZK8A 3G1OA 3DPJA 1T33A 3WHCA 2X6OA 4MK6A 3DCFA 3BR3A 2ZCXA 2F07A 3B6CA 3PPBA 2ZB9A 3FIWA 3CDLA 4GFKA 3WHBA 4ICHA 5FKKA 3SDGA 4D5CA 3KNWA 4NN1A 1U9NA 2IU5A 4ABZA 1RKTA 2PBXA 2DG8A 3P9TA 3G56A 3BT9A 4X1EA 4MXMA 1BJZA 3G7RA 3FRQA 3BQZA 3NNRA 3T6NA 4W1UA 4AUXA 3QKXA 4DW6A 2GFNA 1UI6A 1JUSA 4JL3A 3GZIA 3VOKA 1QVTA 1JUMA 4YZEA 2HYTA 3Q3SA 3C07A 5J3LA 2FBQA 3RH2A 4XK4A 3LSJA 3VW0A 2REKA 2RHAA 3BTJA 4GFLA 2ZOYA 4KWAA 3BR0A 3AQTA 4PXIA 3VP5A 2TRTA 3ON4A 3HE0A 3RD3A 2UXUA 5GPCA 4AC6A 3KKCA 3C2BA 3IH3A 5F0FA 2JJ7A 4I76A 4ACIA 3AQSA 3ZQGA 2XPUA 2I10A 3EUPA 4M3EA 3CCYA 2OERA 2IAIA 5CXIA 4HKUA 2HYJA 2VKEA 3BHQA 4CGRA 2OPTA 3BR2A 2QCOA 2IEKA 4L62A 2UXOA 4GCKA 5H9TA 3QPSA 4V2GA 5FGLA 2QIBA 1A6IA 5AQCA 3NXCA 4M3BA 5C4YA 2G7GA 2NP5A 4M3FA 5IP6A 3ZQLA 2G7LA 1UI5A 3B81A 1U9OA 4G12A 5IOZA 5K7FA 3QQAA 3MVPA
chains in the Genus database with same CATH superfamily
3O8HA 3VVZA 3KYLA 3Q0VA 2ZCNA 5K7ZA 2JK3A 3IH2A 5K58A 3CWRA 5IOYA 3LWJA 3BTLA 2XDNA 3BTCA 4OD5A 3G1MA 3CRJA 3VVXA 4D5FA 4C2MA 3NPIA 4D7NA 2WV1A 2FQ4A 5FKMA 2NS7A 2TCTA 4M3GA 1JUPA 3PASA 2HXIA 5F08A 3MNLA 3SFIA 1SGMA 3LJLA 2XPWA 2UXPA 5FKLA 1Z0XA 5GP9A 5F0HA 1JTYA 2XGCA 3EGQA 3VW2A 2NX4A 3V6GA 2GUHA 2YVHA 2QKOA 2R7VA 3O60A 2HKUA 1JTXA 3ZQFA 5J1YA 4W97A 4JYKA 3HTJA 2R7TA 4M3DA 1RKWA 2D6YA 2QTQA 3GEUA 3ON2A 3ZQHA 3G1LA 4B3AA 3BRUA 3DEWA 4GCTA 4B1RA 3BJBA 2XPVA 3QPLA 4GCLA 2UXIA 4JKZA 3ANPA 5F04A 2VKVA 5F1JA 2VPRA 3E7QA 4V2FA 3HIMA 4AC0A 2RAEA 3VW1A 5K7HA 1ZKGA 2Q24A 2X9DA 2XB5A 5HAWA 2FJ1A 2B3WA 2ZCMA 1VI0A 2NS8A 3KZ9A 3S5RA 5FMPA 3VOXA 2G0EA 5D18A 2GBYA 2PFVA 1QVUA 4DVYP 1JT6A 3NI7A 3BTIA 5CW8A 2YVEA 2Y2ZA 5HBUA 1JT0A 5FKNA 3BQYA 2IBDA 4I6ZA 2HQ5A 4WIBA 2Y30A 3LOCA 2WUIA 4ME9A 2R7XA 2XRLA 3Q0UA 3BR6A 2R7SA 3VPRA 2PZ9A 5GPAA 3VTIA 3LHQA 3NS4A 3F1BA 2ID3A 3IH4A 3VUQA 2OI8A 5EFYA 5HSZA 2DG7A 4OD4A 3COLA 3FK7A 3FHNA 2WGBA 3DU6A 3PM1A 3BCGA 5EZHA 3SWHA 3VVYA 3Q0WA 2R7WA 2ID6A 5EYRA 1Z77A 1ORKA 3NRGA 2FX0A 2G3BA 2O7TA 3BR1A 5D19A 5DAJA 1QPIA 3ANGA 2RASA 3HTHA 4NELA 3B6AA 2FJI1 3IUVA 1RPWA 3TP0A 3QBMA 3CJDA 4UDSA 3HTIA 2G7SA 5IPAA 3LSPA 2EH3A 2XGDA 3BNIA 4AF5A 2O7OA 5J1RA 1T56A 5J1UA 3F0CA 5FKOA 5EZGA 2V57A 5CQGA 3FK6A 5F27A 4MO7A 2GENA 3LSRA 5D1RA 2OF7A 3V78A 2HXOA 4D7MA 5CXGA 2FD5A 3VIBA 2R7UA 2ZOZA 3TP3A 2QWTA 2QOPA 3HGYA 5FHPA 2Y31A 3KKDA 3O8GA 3JSJA 2NP3A 3HTAA 4JNNA 3BR5A 2W53A 3HGGA 5F0CA 2DTZA 2XGEA 3ZQIA 2UXHA 1ZK8A 3G1OA 3DPJA 1T33A 3WHCA 2X6OA 4MK6A 3K8PC 3DCFA 3BR3A 2ZCXA 2F07A 3B6CA 3PPBA 2ZB9A 3FIWA 3CDLA 4GFKA 3WHBA 4ICHA 5FKKA 3SDGA 4D5CA 2R7RA 3KNWA 4NN1A 1U9NA 2IU5A 4ABZA 1RKTA 2PBXA 4U9LA 2DG8A 3P9TA 3G56A 3BT9A 4X1EA 4MXMA 2R7OA 1BJZA 2YVXA 3G7RA 3FRQA 3BQZA 3NNRA 3T6NA 4W1UA 4AUXA 3QKXA 4DW6A 2GFNA 1UI6A 1JUSA 4JL3A 3GZIA 3VOKA 1QVTA 1JUMA 4U9NA 2B1EA 4YZEA 2HYTA 3Q3SA 3C07A 5J3LA 2FBQA 3RH2A 4XK4A 3LSJA 3VW0A 2REKA 2RHAA 3BTJA 4GFLA 2ZOYA 4KWAA 3BR0A 3AQTA 3DU5A 4PXIA 3VP5A 2TRTA 2ZY9A 3HE0A 3ON4A 3RD3A 2UXUA 5GPCA 4AC6A 3KKCA 3C2BA 3IH3A 5F0FA 2JJ7A 4I76A 4ACIA 3AQSA 3ZQGA 2XPUA 2A2FX 2I10A 3EUPA 4M3EA 3CCYA 2OERA 2IAIA 4IRVA 5CXIA 4HKUA 2HYJA 2VKEA 3BHQA 4CGRA 2R7QA 2OPTA 3BR2A 2QCOA 2IEKA 4L62A 2UXOA 4GCKA 5H9TA 3QPSA 4V2GA 5FGLA 2QIBA 1A6IA 5AQCA 3NXCA 4M3BA 5C4YA 2G7GA 2NP5A 4M3FA 5IP6A 3ZQLA 2G7LA 1UI5A 3B81A 1U9OA 4G12A 5IOZA 5K7FA 3QQAA 3MVPA
chains in the Genus database with same CATH topology
3O8HA 3VVZA 3Q0VA 2ZCNA 5K7ZA 2JK3A 3IH2A 5K58A 3CWRA 5IOYA 3LWJA 3BTLA 2XDNA 3BTCA 3G1MA 3CRJA 3VVXA 4D5FA 3NPIA 4D7NA 2WV1A 2FQ4A 5FKMA 2NS7A 2TCTA 4M3GA 1JUPA 3PASA 2HXIA 5F08A 3MNLA 3SFIA 1SGMA 3LJLA 2XPWA 2UXPA 5FKLA 1Z0XA 5GP9A 5F0HA 1JTYA 2XGCA 3EGQA 3VW2A 2NX4A 3V6GA 2GUHA 2YVHA 2QKOA 3O60A 2HKUA 1JTXA 3ZQFA 5J1YA 4W97A 4JYKA 3HTJA 4M3DA 1RKWA 2D6YA 2QTQA 3GEUA 3ON2A 3ZQHA 3G1LA 4B3AA 3BRUA 3DEWA 4GCTA 4B1RA 3BJBA 2XPVA 3QPLA 4GCLA 2UXIA 4JKZA 3ANPA 5F04A 2VKVA 5F1JA 2VPRA 3E7QA 4V2FA 3HIMA 4AC0A 2RAEA 3VW1A 5K7HA 1ZKGA 2Q24A 2X9DA 2XB5A 5HAWA 2FJ1A 2ZCMA 1VI0A 2NS8A 3KZ9A 3S5RA 5FMPA 3VOXA 2G0EA 5D18A 2GBYA 1QVUA 1JT6A 3NI7A 3BTIA 5CW8A 2YVEA 2Y2ZA 5HBUA 1JT0A 5FKNA 3BQYA 2IBDA 4I6ZA 2HQ5A 2Y30A 3LOCA 2WUIA 4ME9A 2XRLA 3Q0UA 3BR6A 3VPRA 2PZ9A 5GPAA 3LHQA 3F1BA 2ID3A 3IH4A 3VUQA 2OI8A 5EFYA 5HSZA 2DG7A 3COLA 3FK7A 2WGBA 3PM1A 3BCGA 5EZHA 3VVYA 3Q0WA 2ID6A 5EYRA 1Z77A 1ORKA 3NRGA 2FX0A 2G3BA 2O7TA 3BR1A 5D19A 5DAJA 1QPIA 3ANGA 2RASA 3HTHA 4NELA 3B6AA 3IUVA 1RPWA 3TP0A 3QBMA 3CJDA 4UDSA 3HTIA 2G7SA 5IPAA 3LSPA 2EH3A 2XGDA 3BNIA 4AF5A 2O7OA 5J1RA 1T56A 5J1UA 3F0CA 5FKOA 5EZGA 2V57A 3FK6A 5F27A 4MO7A 2GENA 3LSRA 5D1RA 2OF7A 3V78A 2HXOA 4D7MA 5CXGA 2FD5A 3VIBA 2ZOZA 3TP3A 2QWTA 2QOPA 3HGYA 5FHPA 2Y31A 3KKDA 3O8GA 3JSJA 2NP3A 3HTAA 4JNNA 3BR5A 2W53A 3HGGA 5F0CA 2DTZA 2XGEA 3ZQIA 2UXHA 1ZK8A 3G1OA 3DPJA 1T33A 3WHCA 2X6OA 4MK6A 3DCFA 3BR3A 2ZCXA 2F07A 3B6CA 3PPBA 2ZB9A 3FIWA 3CDLA 4GFKA 3WHBA 4ICHA 5FKKA 3SDGA 4D5CA 3KNWA 4NN1A 1U9NA 2IU5A 4ABZA 1RKTA 2PBXA 2DG8A 3P9TA 3G56A 3BT9A 4X1EA 4MXMA 1BJZA 3G7RA 3FRQA 3BQZA 3NNRA 3T6NA 4W1UA 4AUXA 3QKXA 4DW6A 2GFNA 1UI6A 1JUSA 4JL3A 3GZIA 3VOKA 1QVTA 1JUMA 4YZEA 2HYTA 3Q3SA 3C07A 5J3LA 2FBQA 3RH2A 4XK4A 3LSJA 3VW0A 2REKA 2RHAA 3BTJA 4GFLA 2ZOYA 4KWAA 3BR0A 3AQTA 4PXIA 3VP5A 2TRTA 3ON4A 3HE0A 3RD3A 2UXUA 5GPCA 4AC6A 3KKCA 3C2BA 3IH3A 5F0FA 2JJ7A 4I76A 4ACIA 3AQSA 3ZQGA 2XPUA 2I10A 3EUPA 4M3EA 3CCYA 2OERA 2IAIA 5CXIA 4HKUA 2HYJA 2VKEA 3BHQA 4CGRA 2OPTA 3BR2A 2QCOA 2IEKA 4L62A 2UXOA 4GCKA 5H9TA 3QPSA 4V2GA 5FGLA 2QIBA 1A6IA 5AQCA 3NXCA 4M3BA 5C4YA 2G7GA 2NP5A 4M3FA 5IP6A 3ZQLA 2G7LA 1UI5A 3B81A 1U9OA 4G12A 5IOZA 5K7FA 3QQAA 3MVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8H A;  3VVZ A;  3Q0V A;  2ZCN A;  5K7Z A;  2JK3 A;  3IH2 A;  5K58 A;  3CWR A;  5IOY A;  3LWJ A;  3BTL A;  2XDN A;  3BTC A;  3G1M A;  3CRJ A;  3VVX A;  4D5F A;  3NPI A;  4D7N A;  2WV1 A;  2FQ4 A;  5FKM A;  2NS7 A;  2TCT A;  4M3G A;  1JUP A;  3PAS A;  2HXI A;  5F08 A;  3MNL A;  3SFI A;  1SGM A;  3LJL A;  2XPW A;  2UXP A;  5FKL A;  1Z0X A;  5GP9 A;  5F0H A;  1JTY A;  2XGC A;  3EGQ A;  3VW2 A;  2NX4 A;  3V6G A;  2GUH A;  2YVH A;  2QKO A;  3O60 A;  2HKU A;  1JTX A;  3ZQF A;  5J1Y A;  4W97 A;  4JYK A;  3HTJ A;  4M3D A;  1RKW A;  2D6Y A;  2QTQ A;  3GEU A;  3ON2 A;  3ZQH A;  3G1L A;  4B3A A;  3BRU A;  3DEW A;  4GCT A;  4B1R A;  3BJB A;  2XPV A;  3QPL A;  4GCL A;  2UXI A;  4JKZ A;  3ANP A;  5F04 A;  2VKV A;  5F1J A;  2VPR A;  3E7Q A;  4V2F A;  3HIM A;  4AC0 A;  2RAE A;  3VW1 A;  5K7H A;  1ZKG A;  2Q24 A;  2X9D A;  2XB5 A;  5HAW A;  2FJ1 A;  2ZCM A;  1VI0 A;  2NS8 A;  3KZ9 A;  3S5R A;  5FMP A;  3VOX A;  2G0E A;  5D18 A;  2GBY A;  1QVU A;  1JT6 A;  3NI7 A;  3BTI A;  5CW8 A;  2YVE A;  2Y2Z A;  5HBU A;  1JT0 A;  5FKN A;  3BQY A;  2IBD A;  4I6Z A;  2HQ5 A;  2Y30 A;  3LOC A;  2WUI A;  4ME9 A;  2XRL A;  3Q0U A;  3BR6 A;  3VPR A;  2PZ9 A;  5GPA A;  3LHQ A;  3F1B A;  2ID3 A;  3IH4 A;  3VUQ A;  2OI8 A;  5EFY A;  5HSZ A;  2DG7 A;  3COL A;  3FK7 A;  2WGB A;  3PM1 A;  3BCG A;  5EZH A;  3VVY A;  3Q0W A;  2ID6 A;  5EYR A;  1Z77 A;  1ORK A;  3NRG A;  2FX0 A;  2G3B A;  2O7T A;  3BR1 A;  5D19 A;  5DAJ A;  1QPI A;  3ANG A;  2RAS A;  3HTH A;  4NEL A;  3B6A A;  3IUV A;  1RPW A;  3TP0 A;  3QBM A;  3CJD A;  4UDS A;  3HTI A;  2G7S A;  5IPA A;  3LSP A;  2EH3 A;  2XGD A;  3BNI A;  4AF5 A;  2O7O A;  5J1R A;  1T56 A;  5J1U A;  3F0C A;  5FKO A;  5EZG A;  2V57 A;  3FK6 A;  5F27 A;  4MO7 A;  2GEN A;  3LSR A;  5D1R A;  2OF7 A;  3V78 A;  2HXO A;  4D7M A;  5CXG A;  2FD5 A;  3VIB A;  2ZOZ A;  3TP3 A;  2QWT A;  2QOP A;  3HGY A;  5FHP A;  2Y31 A;  3KKD A;  3O8G A;  3JSJ A;  2NP3 A;  3HTA A;  4JNN A;  3BR5 A;  2W53 A;  3HGG A;  5F0C A;  2DTZ A;  2XGE A;  3ZQI A;  2UXH A;  1ZK8 A;  3G1O A;  3DPJ A;  1T33 A;  3WHC A;  2X6O A;  4MK6 A;  3DCF A;  3BR3 A;  2ZCX A;  2F07 A;  3B6C A;  3PPB A;  2ZB9 A;  3FIW A;  3CDL A;  4GFK A;  3WHB A;  4ICH A;  5FKK A;  3SDG A;  4D5C A;  3KNW A;  4NN1 A;  1U9N A;  2IU5 A;  4ABZ A;  1RKT A;  2PBX A;  2DG8 A;  3P9T A;  3G56 A;  3BT9 A;  4X1E A;  4MXM A;  1BJZ A;  3G7R A;  3FRQ A;  3BQZ A;  3NNR A;  3T6N A;  4W1U A;  4AUX A;  3QKX A;  4DW6 A;  2GFN A;  1UI6 A;  1JUS A;  4JL3 A;  3GZI A;  3VOK A;  1QVT A;  1JUM A;  4YZE A;  2HYT A;  3Q3S A;  3C07 A;  5J3L A;  2FBQ A;  3RH2 A;  4XK4 A;  3LSJ A;  3VW0 A;  2REK A;  2RHA A;  3BTJ A;  4GFL A;  2ZOY A;  4KWA A;  3BR0 A;  3AQT A;  4PXI A;  3VP5 A;  2TRT A;  3ON4 A;  3HE0 A;  3RD3 A;  2UXU A;  5GPC A;  4AC6 A;  3KKC A;  3C2B A;  3IH3 A;  5F0F A;  2JJ7 A;  4I76 A;  4ACI A;  3AQS A;  3ZQG A;  2XPU A;  2I10 A;  3EUP A;  4M3E A;  3CCY A;  2OER A;  2IAI A;  5CXI A;  4HKU A;  2HYJ A;  2VKE A;  3BHQ A;  4CGR A;  2OPT A;  3BR2 A;  2QCO A;  2IEK A;  4L62 A;  2UXO A;  4GCK A;  5H9T A;  3QPS A;  4V2G A;  5FGL A;  2QIB A;  1A6I A;  5AQC A;  3NXC A;  4M3B A;  5C4Y A;  2G7G A;  2NP5 A;  4M3F A;  5IP6 A;  3ZQL A;  2G7L A;  1UI5 A;  3B81 A;  1U9O A;  4G12 A;  5IOZ A;  5K7F A;  3QQA A;  3MVP A; 
#chains in the Genus database with same CATH topology
 3O8H A;  3VVZ A;  3KYL A;  3Q0V A;  2ZCN A;  5K7Z A;  2JK3 A;  3IH2 A;  5K58 A;  3CWR A;  5IOY A;  3LWJ A;  3BTL A;  2XDN A;  3BTC A;  4OD5 A;  3G1M A;  3CRJ A;  3VVX A;  4D5F A;  4C2M A;  3NPI A;  4D7N A;  2WV1 A;  2FQ4 A;  5FKM A;  2NS7 A;  2TCT A;  4M3G A;  1JUP A;  3PAS A;  2HXI A;  5F08 A;  3MNL A;  3SFI A;  1SGM A;  3LJL A;  2XPW A;  2UXP A;  5FKL A;  1Z0X A;  5GP9 A;  5F0H A;  1JTY A;  2XGC A;  3EGQ A;  3VW2 A;  2NX4 A;  3V6G A;  2GUH A;  2YVH A;  2QKO A;  2R7V A;  3O60 A;  2HKU A;  1JTX A;  3ZQF A;  5J1Y A;  4W97 A;  4JYK A;  3HTJ A;  2R7T A;  4M3D A;  1RKW A;  2D6Y A;  2QTQ A;  3GEU A;  3ON2 A;  3ZQH A;  3G1L A;  4B3A A;  3BRU A;  3DEW A;  4GCT A;  4B1R A;  3BJB A;  2XPV A;  3QPL A;  4GCL A;  2UXI A;  4JKZ A;  3ANP A;  5F04 A;  2VKV A;  5F1J A;  2VPR A;  3E7Q A;  4V2F A;  3HIM A;  4AC0 A;  2RAE A;  3VW1 A;  5K7H A;  1ZKG A;  2Q24 A;  2X9D A;  2XB5 A;  5HAW A;  2FJ1 A;  2B3W A;  2ZCM A;  1VI0 A;  2NS8 A;  3KZ9 A;  3S5R A;  5FMP A;  3VOX A;  2G0E A;  5D18 A;  2GBY A;  2PFV A;  1QVU A;  4DVY P;  1JT6 A;  3NI7 A;  3BTI A;  5CW8 A;  2YVE A;  2Y2Z A;  5HBU A;  1JT0 A;  5FKN A;  3BQY A;  2IBD A;  4I6Z A;  2HQ5 A;  4WIB A;  2Y30 A;  3LOC A;  2WUI A;  4ME9 A;  2R7X A;  2XRL A;  3Q0U A;  3BR6 A;  2R7S A;  3VPR A;  2PZ9 A;  5GPA A;  3VTI A;  3LHQ A;  3NS4 A;  3F1B A;  2ID3 A;  3IH4 A;  3VUQ A;  2OI8 A;  5EFY A;  5HSZ A;  2DG7 A;  4OD4 A;  3COL A;  3FK7 A;  3FHN A;  2WGB A;  3DU6 A;  3PM1 A;  3BCG A;  5EZH A;  3SWH A;  3VVY A;  3Q0W A;  2R7W A;  2ID6 A;  5EYR A;  1Z77 A;  1ORK A;  3NRG A;  2FX0 A;  2G3B A;  2O7T A;  3BR1 A;  5D19 A;  5DAJ A;  1QPI A;  3ANG A;  2RAS A;  3HTH A;  4NEL A;  3B6A A;  2FJI 1;  3IUV A;  1RPW A;  3TP0 A;  3QBM A;  3CJD A;  4UDS A;  3HTI A;  2G7S A;  5IPA A;  3LSP A;  2EH3 A;  2XGD A;  3BNI A;  4AF5 A;  2O7O A;  5J1R A;  1T56 A;  5J1U A;  3F0C A;  5FKO A;  5EZG A;  2V57 A;  5CQG A;  3FK6 A;  5F27 A;  4MO7 A;  2GEN A;  3LSR A;  5D1R A;  2OF7 A;  3V78 A;  2HXO A;  4D7M A;  5CXG A;  2FD5 A;  3VIB A;  2R7U A;  2ZOZ A;  3TP3 A;  2QWT A;  2QOP A;  3HGY A;  5FHP A;  2Y31 A;  3KKD A;  3O8G A;  3JSJ A;  2NP3 A;  3HTA A;  4JNN A;  3BR5 A;  2W53 A;  3HGG A;  5F0C A;  2DTZ A;  2XGE A;  3ZQI A;  2UXH A;  1ZK8 A;  3G1O A;  3DPJ A;  1T33 A;  3WHC A;  2X6O A;  4MK6 A;  3K8P C;  3DCF A;  3BR3 A;  2ZCX A;  2F07 A;  3B6C A;  3PPB A;  2ZB9 A;  3FIW A;  3CDL A;  4GFK A;  3WHB A;  4ICH A;  5FKK A;  3SDG A;  4D5C A;  2R7R A;  3KNW A;  4NN1 A;  1U9N A;  2IU5 A;  4ABZ A;  1RKT A;  2PBX A;  4U9L A;  2DG8 A;  3P9T A;  3G56 A;  3BT9 A;  4X1E A;  4MXM A;  2R7O A;  1BJZ A;  2YVX A;  3G7R A;  3FRQ A;  3BQZ A;  3NNR A;  3T6N A;  4W1U A;  4AUX A;  3QKX A;  4DW6 A;  2GFN A;  1UI6 A;  1JUS A;  4JL3 A;  3GZI A;  3VOK A;  1QVT A;  1JUM A;  4U9N A;  2B1E A;  4YZE A;  2HYT A;  3Q3S A;  3C07 A;  5J3L A;  2FBQ A;  3RH2 A;  4XK4 A;  3LSJ A;  3VW0 A;  2REK A;  2RHA A;  3BTJ A;  4GFL A;  2ZOY A;  4KWA A;  3BR0 A;  3AQT A;  3DU5 A;  4PXI A;  3VP5 A;  2TRT A;  2ZY9 A;  3HE0 A;  3ON4 A;  3RD3 A;  2UXU A;  5GPC A;  4AC6 A;  3KKC A;  3C2B A;  3IH3 A;  5F0F A;  2JJ7 A;  4I76 A;  4ACI A;  3AQS A;  3ZQG A;  2XPU A;  2A2F X;  2I10 A;  3EUP A;  4M3E A;  3CCY A;  2OER A;  2IAI A;  4IRV A;  5CXI A;  4HKU A;  2HYJ A;  2VKE A;  3BHQ A;  4CGR A;  2R7Q A;  2OPT A;  3BR2 A;  2QCO A;  2IEK A;  4L62 A;  2UXO A;  4GCK A;  5H9T A;  3QPS A;  4V2G A;  5FGL A;  2QIB A;  1A6I A;  5AQC A;  3NXC A;  4M3B A;  5C4Y A;  2G7G A;  2NP5 A;  4M3F A;  5IP6 A;  3ZQL A;  2G7L A;  1UI5 A;  3B81 A;  1U9O A;  4G12 A;  5IOZ A;  5K7F A;  3QQA A;  3MVP A; 
#chains in the Genus database with same CATH homology
 3O8H A;  3VVZ A;  3Q0V A;  2ZCN A;  5K7Z A;  2JK3 A;  3IH2 A;  5K58 A;  3CWR A;  5IOY A;  3LWJ A;  3BTL A;  2XDN A;  3BTC A;  3G1M A;  3CRJ A;  3VVX A;  4D5F A;  3NPI A;  4D7N A;  2WV1 A;  2FQ4 A;  5FKM A;  2NS7 A;  2TCT A;  4M3G A;  1JUP A;  3PAS A;  2HXI A;  5F08 A;  3MNL A;  3SFI A;  1SGM A;  3LJL A;  2XPW A;  2UXP A;  5FKL A;  1Z0X A;  5GP9 A;  5F0H A;  1JTY A;  2XGC A;  3EGQ A;  3VW2 A;  2NX4 A;  3V6G A;  2GUH A;  2YVH A;  2QKO A;  3O60 A;  2HKU A;  1JTX A;  3ZQF A;  5J1Y A;  4W97 A;  4JYK A;  3HTJ A;  4M3D A;  1RKW A;  2D6Y A;  2QTQ A;  3GEU A;  3ON2 A;  3ZQH A;  3G1L A;  4B3A A;  3BRU A;  3DEW A;  4GCT A;  4B1R A;  3BJB A;  2XPV A;  3QPL A;  4GCL A;  2UXI A;  4JKZ A;  3ANP A;  5F04 A;  2VKV A;  5F1J A;  2VPR A;  3E7Q A;  4V2F A;  3HIM A;  4AC0 A;  2RAE A;  3VW1 A;  5K7H A;  1ZKG A;  2Q24 A;  2X9D A;  2XB5 A;  5HAW A;  2FJ1 A;  2ZCM A;  1VI0 A;  2NS8 A;  3KZ9 A;  3S5R A;  5FMP A;  3VOX A;  2G0E A;  5D18 A;  2GBY A;  1QVU A;  1JT6 A;  3NI7 A;  3BTI A;  5CW8 A;  2YVE A;  2Y2Z A;  5HBU A;  1JT0 A;  5FKN A;  3BQY A;  2IBD A;  4I6Z A;  2HQ5 A;  2Y30 A;  3LOC A;  2WUI A;  4ME9 A;  2XRL A;  3Q0U A;  3BR6 A;  3VPR A;  2PZ9 A;  5GPA A;  3LHQ A;  3F1B A;  2ID3 A;  3IH4 A;  3VUQ A;  2OI8 A;  5EFY A;  5HSZ A;  2DG7 A;  3COL A;  3FK7 A;  2WGB A;  3PM1 A;  3BCG A;  5EZH A;  3VVY A;  3Q0W A;  2ID6 A;  5EYR A;  1Z77 A;  1ORK A;  3NRG A;  2FX0 A;  2G3B A;  2O7T A;  3BR1 A;  5D19 A;  5DAJ A;  1QPI A;  3ANG A;  2RAS A;  3HTH A;  4NEL A;  3B6A A;  3IUV A;  1RPW A;  3TP0 A;  3QBM A;  3CJD A;  4UDS A;  3HTI A;  2G7S A;  5IPA A;  3LSP A;  2EH3 A;  2XGD A;  3BNI A;  4AF5 A;  2O7O A;  5J1R A;  1T56 A;  5J1U A;  3F0C A;  5FKO A;  5EZG A;  2V57 A;  3FK6 A;  5F27 A;  4MO7 A;  2GEN A;  3LSR A;  5D1R A;  2OF7 A;  3V78 A;  2HXO A;  4D7M A;  5CXG A;  2FD5 A;  3VIB A;  2ZOZ A;  3TP3 A;  2QWT A;  2QOP A;  3HGY A;  5FHP A;  2Y31 A;  3KKD A;  3O8G A;  3JSJ A;  2NP3 A;  3HTA A;  4JNN A;  3BR5 A;  2W53 A;  3HGG A;  5F0C A;  2DTZ A;  2XGE A;  3ZQI A;  2UXH A;  1ZK8 A;  3G1O A;  3DPJ A;  1T33 A;  3WHC A;  2X6O A;  4MK6 A;  3DCF A;  3BR3 A;  2ZCX A;  2F07 A;  3B6C A;  3PPB A;  2ZB9 A;  3FIW A;  3CDL A;  4GFK A;  3WHB A;  4ICH A;  5FKK A;  3SDG A;  4D5C A;  3KNW A;  4NN1 A;  1U9N A;  2IU5 A;  4ABZ A;  1RKT A;  2PBX A;  2DG8 A;  3P9T A;  3G56 A;  3BT9 A;  4X1E A;  4MXM A;  1BJZ A;  3G7R A;  3FRQ A;  3BQZ A;  3NNR A;  3T6N A;  4W1U A;  4AUX A;  3QKX A;  4DW6 A;  2GFN A;  1UI6 A;  1JUS A;  4JL3 A;  3GZI A;  3VOK A;  1QVT A;  1JUM A;  4YZE A;  2HYT A;  3Q3S A;  3C07 A;  5J3L A;  2FBQ A;  3RH2 A;  4XK4 A;  3LSJ A;  3VW0 A;  2REK A;  2RHA A;  3BTJ A;  4GFL A;  2ZOY A;  4KWA A;  3BR0 A;  3AQT A;  4PXI A;  3VP5 A;  2TRT A;  3ON4 A;  3HE0 A;  3RD3 A;  2UXU A;  5GPC A;  4AC6 A;  3KKC A;  3C2B A;  3IH3 A;  5F0F A;  2JJ7 A;  4I76 A;  4ACI A;  3AQS A;  3ZQG A;  2XPU A;  2I10 A;  3EUP A;  4M3E A;  3CCY A;  2OER A;  2IAI A;  5CXI A;  4HKU A;  2HYJ A;  2VKE A;  3BHQ A;  4CGR A;  2OPT A;  3BR2 A;  2QCO A;  2IEK A;  4L62 A;  2UXO A;  4GCK A;  5H9T A;  3QPS A;  4V2G A;  5FGL A;  2QIB A;  1A6I A;  5AQC A;  3NXC A;  4M3B A;  5C4Y A;  2G7G A;  2NP5 A;  4M3F A;  5IP6 A;  3ZQL A;  2G7L A;  1UI5 A;  3B81 A;  1U9O A;  4G12 A;  5IOZ A;  5K7F A;  3QQA A;  3MVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...