3RH2A

Crystal structure of a tetr-like transcriptional regulator (sama_0099) from shewanella amazonensis sb2b at 2.42 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
210
structure length
210
Chain Sequence
MKTRDKIIQASLELFNEHGERTITTNHIAAHLDISPGNLYYHFRNKEDIIRCIFDQYEQHLLLGFKPYADQKVDLELLMSYFDAMFYTMWQFRFMYANLADILARDDTLKARYLKVQQAVLEQSIAVLNQLKKDGILQIEDERIADLADTIKMIIGFWISYKLTQSSIATISKASLYEGLLRVLMIFKAYSTPDSLANFDRLEQHFRSQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Hypothetical TetR-like transcriptional regulator
publication title Crystal structure of a Hypothetical TetR-like transcriptional regulator (Sama_0099) from SHEWANELLA AMAZONENSIS SB2B at 2.42 A resolution
rcsb
source organism Shewanella amazonensis
total genus 75
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13972 TetR Bacterial transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3rh2A00
2HYTA 2D6YA 3GZIA 3G7RA 3BNIA 2GUHA 2REKA 4M3EA 3T6NA 3BR3A 3PM1A 4GFLA 1QVTA 5FHPA 2HXOA 3O8GA 2PZ9A 3HGYA 5K58A 1ZK8A 3ON4A 3BQZA 3VOKA 3V78A 1A6IA 2JK3A 2TRTA 2UXHA 2O7TA 3IH3A 2ZOZA 3BCGA 2XGCA 3CRJA 5F0CA 4XK4A 3VIBA 5HAWA 3BTJA 2GFNA 2JJ7A 1Z77A 1UI5A 3F1BA 5K7FA 2UXOA 5FKNA 5D1RA 3LWJA 3ON2A 2FBQA 2X9DA 1RKTA 3VVXA 4M3FA 4NN1A 3HTJA 2IU5A 4L62A 3RD3A 2HXIA 3LHQA 1RKWA 2OPTA 2ID3A 2XPVA 2UXIA 1BJZA 2NS7A 4YZEA 4KWAA 2EH3A 2IAIA 4W1UA 2QCOA 3C2BA 2Q24A 3DPJA 3E7QA 3AQSA 5F08A 3VPRA 2YVEA 2IBDA 3ZQFA 4GCLA 2NP5A 2XGDA 4JKZA 4AUXA 3C07A 3PPBA 5EZGA 2I10A 3BR6A 1ZKGA 5GP9A 5AQCA 2QOPA 2FX0A 4AC0A 4M3GA 2DG8A 5F0HA 1JUPA 3KZ9A 4AF5A 3ZQGA 2WUIA 4M3BA 3VVYA 4W97A 5K7HA 3CJDA 5EFYA 4I6ZA 3G56A 3KKDA 2WV1A 4GCTA 2RASA 3O8HA 3LSJA 2G7SA 3G1LA 3ZQIA 2G7GA 5F0FA 4GFKA 1U9NA 3AQTA 3BHQA 2Y31A 2XB5A 3IH4A 2XPWA 3KKCA 3WHBA 2ZCMA 5FKLA 3IUVA 3MNLA 5CW8A 5FKOA 2GBYA 3TP0A 1SGMA 2G7LA 3IH2A 2ZOYA 3DEWA 3VUQA 3ZQHA 3DCFA 4JYKA 4D7NA 3LOCA 5F1JA 4B3AA 3QQAA 3B6AA 2OF7A 5HBUA 2NP3A 3BR2A 3LSRA 3HIMA 1JT6A 4DW6A 4ICHA 3Q0WA 5F27A 2FJ1A 1RPWA 4JNNA 2RAEA 3BRUA 3LJLA 5H9TA 3Q3SA 3HTIA 3CWRA 3GEUA 3G1OA 2X6OA 5EYRA 2HKUA 2IEKA 2VKEA 1QPIA 4D7MA 2VKVA 4G12A 3TP3A 4M3DA 3HTHA 3FRQA 5FGLA 3EGQA 3B6CA 3NRGA 1ORKA 4V2GA 5F04A 4B1RA 5J1YA 3QPLA 2QWTA 3COLA 3VVZA 3P9TA 2UXUA 3Q0UA 3JSJA 2W53A 5FKMA 5IP6A 3NPIA 3VOXA 3QBMA 4MK6A 3ZQLA 3MVPA 3BR0A 1T33A 2ID6A 2QKOA 2OI8A 3NNRA 4I76A 3ANGA 3VW2A 2GENA 3QKXA 2QIBA 3BR1A 4D5FA 2NS8A 3FIWA 4JL3A 5GPCA 3SFIA 1JT0A 2V57A 5D18A 2QTQA 5J3LA 4PXIA 5CXIA 3VW1A 3Q0VA 3NI7A 2PBXA 2XDNA 3BTLA 3BTIA 3SDGA 3CDLA 3B81A 1UI6A 5GPAA 2NX4A 3F0CA 1U9OA 3VW0A 3LSPA 3NXCA 5FMPA 2F07A 2XRLA 4NELA 3S5RA 5C4YA 2OERA 5J1RA 3BR5A 5IPAA 2WGBA 4UDSA 5D19A 4CGRA 2HYJA 5DAJA 3QPSA 4AC6A 3FK6A 5K7ZA 4GCKA 2G0EA 2VPRA 5HSZA 3HTAA 4ABZA 4ME9A 2FD5A 2XGEA 3VP5A 3G1MA 3BJBA 3BT9A 3PASA 1JUSA 5EZHA 4MXMA 5FKKA 1JUMA 4X1EA 1JTXA 3BQYA 3BTCA 2HQ5A 2RHAA 1JTYA 3HGGA 4HKUA 3ANPA 3V6GA 2O7OA 3O60A 3CCYA 3RH2A 2DTZA 3FK7A 2Y30A 4MO7A 1T56A 2FQ4A 2DG7A 5J1UA 2YVHA 3HE0A 1Z0XA 2TCTA 2UXPA 2ZB9A 1VI0A 2G3BA 4D5CA 5CXGA 2ZCXA 3KNWA 2ZCNA 5IOZA 4V2FA 4ACIA 3EUPA 3WHCA 1QVUA 5IOYA 2Y2ZA 2XPUA
chains in the Genus database with same CATH superfamily
3NS4A 2HYTA 2D6YA 3GZIA 3G7RA 3BNIA 2GUHA 2REKA 4M3EA 3T6NA 3BR3A 3PM1A 4GFLA 1QVTA 2R7SA 5FHPA 2HXOA 3O8GA 2PZ9A 3HGYA 5K58A 1ZK8A 3ON4A 3BQZA 3VOKA 3V78A 1A6IA 2JK3A 2TRTA 2UXHA 2O7TA 3IH3A 2ZOZA 3BCGA 2XGCA 3CRJA 5F0CA 4XK4A 3VIBA 2YVXA 5HAWA 2R7VA 3BTJA 2GFNA 2JJ7A 3K8PC 1Z77A 1UI5A 3F1BA 5K7FA 2UXOA 5FKNA 5D1RA 3LWJA 3ON2A 2FJI1 2FBQA 3DU5A 2X9DA 1RKTA 3VVXA 4DVYP 4M3FA 4NN1A 3HTJA 2IU5A 4L62A 3RD3A 3KYLA 2HXIA 3LHQA 1RKWA 2OPTA 2R7UA 2ID3A 2XPVA 2UXIA 1BJZA 2NS7A 4YZEA 5CQGA 4KWAA 2EH3A 2IAIA 4W1UA 2QCOA 3C2BA 2Q24A 3DPJA 3E7QA 3AQSA 5F08A 3VPRA 2YVEA 2R7RA 2IBDA 3ZQFA 4GCLA 2NP5A 2XGDA 4JKZA 4AUXA 3C07A 3PPBA 5EZGA 2I10A 3BR6A 1ZKGA 5GP9A 4WIBA 5AQCA 2QOPA 2FX0A 4AC0A 3DU6A 2B3WA 4M3GA 2DG8A 5F0HA 1JUPA 3KZ9A 4AF5A 3ZQGA 2WUIA 4M3BA 3VVYA 4W97A 5K7HA 3CJDA 5EFYA 4I6ZA 3G56A 3KKDA 2R7WA 2WV1A 4GCTA 2RASA 3O8HA 2R7TA 3LSJA 2G7SA 3G1LA 3ZQIA 2G7GA 5F0FA 3FHNA 4GFKA 1U9NA 3AQTA 3BHQA 2Y31A 2XB5A 3IH4A 2XPWA 3KKCA 3WHBA 2ZCMA 5FKLA 3IUVA 3MNLA 5CW8A 5FKOA 2GBYA 3TP0A 1SGMA 2G7LA 3IH2A 2ZOYA 3DEWA 3VUQA 3ZQHA 3DCFA 4JYKA 4D7NA 3LOCA 5F1JA 4B3AA 3QQAA 3B6AA 2OF7A 5HBUA 2NP3A 3BR2A 3LSRA 3HIMA 2R7XA 1JT6A 4DW6A 4U9NA 4ICHA 3Q0WA 5F27A 2FJ1A 1RPWA 4JNNA 2RAEA 3BRUA 3LJLA 5H9TA 3Q3SA 3HTIA 3CWRA 3GEUA 3G1OA 2X6OA 5EYRA 2HKUA 2IEKA 2VKEA 1QPIA 4D7MA 2VKVA 4G12A 3TP3A 4M3DA 3HTHA 3FRQA 2R7QA 5FGLA 3EGQA 3B6CA 3NRGA 1ORKA 4V2GA 5F04A 4B1RA 5J1YA 3QPLA 2QWTA 3COLA 3VVZA 3P9TA 2UXUA 3Q0UA 3JSJA 2W53A 5FKMA 5IP6A 3NPIA 3VOXA 3QBMA 4MK6A 3ZQLA 3MVPA 3BR0A 1T33A 2ID6A 2QKOA 2OI8A 3NNRA 4I76A 3ANGA 3VW2A 2R7OA 2GENA 3QKXA 2QIBA 3BR1A 2PFVA 4D5FA 2NS8A 3FIWA 4JL3A 5GPCA 3SFIA 1JT0A 2V57A 5D18A 2B1EA 2QTQA 5J3LA 4PXIA 5CXIA 3VW1A 3Q0VA 3NI7A 2PBXA 2XDNA 3BTLA 3SWHA 3BTIA 3SDGA 4OD4A 4C2MA 3CDLA 3B81A 1UI6A 5GPAA 2NX4A 3F0CA 1U9OA 3VW0A 3LSPA 3NXCA 5FMPA 2F07A 2XRLA 4NELA 3S5RA 5C4YA 4OD5A 2OERA 5J1RA 3BR5A 5IPAA 2WGBA 4UDSA 5D19A 4CGRA 2HYJA 5DAJA 3QPSA 4AC6A 3FK6A 5K7ZA 2ZY9A 4GCKA 2G0EA 2VPRA 5HSZA 3HTAA 4ABZA 4ME9A 2FD5A 3VTIA 2XGEA 4U9LA 3VP5A 3G1MA 3BJBA 3BT9A 3PASA 1JUSA 5EZHA 4MXMA 5FKKA 1JUMA 4X1EA 1JTXA 3BQYA 3BTCA 2HQ5A 2RHAA 1JTYA 3HGGA 4HKUA 2A2FX 3ANPA 3V6GA 2O7OA 3O60A 3CCYA 3RH2A 2DTZA 3FK7A 2Y30A 4MO7A 1T56A 2FQ4A 2DG7A 5J1UA 2YVHA 3HE0A 4IRVA 1Z0XA 2TCTA 2UXPA 2ZB9A 1VI0A 2G3BA 4D5CA 5CXGA 2ZCXA 3KNWA 2ZCNA 5IOZA 4V2FA 4ACIA 3EUPA 3WHCA 1QVUA 5IOYA 2Y2ZA 2XPUA
chains in the Genus database with same CATH topology
2HYTA 2D6YA 3GZIA 3G7RA 3BNIA 2GUHA 2REKA 4M3EA 3T6NA 3BR3A 3PM1A 4GFLA 1QVTA 5FHPA 2HXOA 3O8GA 2PZ9A 3HGYA 5K58A 1ZK8A 3ON4A 3BQZA 3VOKA 3V78A 1A6IA 2JK3A 2TRTA 2UXHA 2O7TA 3IH3A 2ZOZA 3BCGA 2XGCA 3CRJA 5F0CA 4XK4A 3VIBA 5HAWA 3BTJA 2GFNA 2JJ7A 1Z77A 1UI5A 3F1BA 5K7FA 2UXOA 5FKNA 5D1RA 3LWJA 3ON2A 2FBQA 2X9DA 1RKTA 3VVXA 4M3FA 4NN1A 3HTJA 2IU5A 4L62A 3RD3A 2HXIA 3LHQA 1RKWA 2OPTA 2ID3A 2XPVA 2UXIA 1BJZA 2NS7A 4YZEA 4KWAA 2EH3A 2IAIA 4W1UA 2QCOA 3C2BA 2Q24A 3DPJA 3E7QA 3AQSA 5F08A 3VPRA 2YVEA 2IBDA 3ZQFA 4GCLA 2NP5A 2XGDA 4JKZA 4AUXA 3C07A 3PPBA 5EZGA 2I10A 3BR6A 1ZKGA 5GP9A 5AQCA 2QOPA 2FX0A 4AC0A 4M3GA 2DG8A 5F0HA 1JUPA 3KZ9A 4AF5A 3ZQGA 2WUIA 4M3BA 3VVYA 4W97A 5K7HA 3CJDA 5EFYA 4I6ZA 3G56A 3KKDA 2WV1A 4GCTA 2RASA 3O8HA 3LSJA 2G7SA 3G1LA 3ZQIA 2G7GA 5F0FA 4GFKA 1U9NA 3AQTA 3BHQA 2Y31A 2XB5A 3IH4A 2XPWA 3KKCA 3WHBA 2ZCMA 5FKLA 3IUVA 3MNLA 5CW8A 5FKOA 2GBYA 3TP0A 1SGMA 2G7LA 3IH2A 2ZOYA 3DEWA 3VUQA 3ZQHA 3DCFA 4JYKA 4D7NA 3LOCA 5F1JA 4B3AA 3QQAA 3B6AA 2OF7A 5HBUA 2NP3A 3BR2A 3LSRA 3HIMA 1JT6A 4DW6A 4ICHA 3Q0WA 5F27A 2FJ1A 1RPWA 4JNNA 2RAEA 3BRUA 3LJLA 5H9TA 3Q3SA 3HTIA 3CWRA 3GEUA 3G1OA 2X6OA 5EYRA 2HKUA 2IEKA 2VKEA 1QPIA 4D7MA 2VKVA 4G12A 3TP3A 4M3DA 3HTHA 3FRQA 5FGLA 3EGQA 3B6CA 3NRGA 1ORKA 4V2GA 5F04A 4B1RA 5J1YA 3QPLA 2QWTA 3COLA 3VVZA 3P9TA 2UXUA 3Q0UA 3JSJA 2W53A 5FKMA 5IP6A 3NPIA 3VOXA 3QBMA 4MK6A 3ZQLA 3MVPA 3BR0A 1T33A 2ID6A 2QKOA 2OI8A 3NNRA 4I76A 3ANGA 3VW2A 2GENA 3QKXA 2QIBA 3BR1A 4D5FA 2NS8A 3FIWA 4JL3A 5GPCA 3SFIA 1JT0A 2V57A 5D18A 2QTQA 5J3LA 4PXIA 5CXIA 3VW1A 3Q0VA 3NI7A 2PBXA 2XDNA 3BTLA 3BTIA 3SDGA 3CDLA 3B81A 1UI6A 5GPAA 2NX4A 3F0CA 1U9OA 3VW0A 3LSPA 3NXCA 5FMPA 2F07A 2XRLA 4NELA 3S5RA 5C4YA 2OERA 5J1RA 3BR5A 5IPAA 2WGBA 4UDSA 5D19A 4CGRA 2HYJA 5DAJA 3QPSA 4AC6A 3FK6A 5K7ZA 4GCKA 2G0EA 2VPRA 5HSZA 3HTAA 4ABZA 4ME9A 2FD5A 2XGEA 3VP5A 3G1MA 3BJBA 3BT9A 3PASA 1JUSA 5EZHA 4MXMA 5FKKA 1JUMA 4X1EA 1JTXA 3BQYA 3BTCA 2HQ5A 2RHAA 1JTYA 3HGGA 4HKUA 3ANPA 3V6GA 2O7OA 3O60A 3CCYA 3RH2A 2DTZA 3FK7A 2Y30A 4MO7A 1T56A 2FQ4A 2DG7A 5J1UA 2YVHA 3HE0A 1Z0XA 2TCTA 2UXPA 2ZB9A 1VI0A 2G3BA 4D5CA 5CXGA 2ZCXA 3KNWA 2ZCNA 5IOZA 4V2FA 4ACIA 3EUPA 3WHCA 1QVUA 5IOYA 2Y2ZA 2XPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HYT A;  2D6Y A;  3GZI A;  3G7R A;  3BNI A;  2GUH A;  2REK A;  4M3E A;  3T6N A;  3BR3 A;  3PM1 A;  4GFL A;  1QVT A;  5FHP A;  2HXO A;  3O8G A;  2PZ9 A;  3HGY A;  5K58 A;  1ZK8 A;  3ON4 A;  3BQZ A;  3VOK A;  3V78 A;  1A6I A;  2JK3 A;  2TRT A;  2UXH A;  2O7T A;  3IH3 A;  2ZOZ A;  3BCG A;  2XGC A;  3CRJ A;  5F0C A;  4XK4 A;  3VIB A;  5HAW A;  3BTJ A;  2GFN A;  2JJ7 A;  1Z77 A;  1UI5 A;  3F1B A;  5K7F A;  2UXO A;  5FKN A;  5D1R A;  3LWJ A;  3ON2 A;  2FBQ A;  2X9D A;  1RKT A;  3VVX A;  4M3F A;  4NN1 A;  3HTJ A;  2IU5 A;  4L62 A;  3RD3 A;  2HXI A;  3LHQ A;  1RKW A;  2OPT A;  2ID3 A;  2XPV A;  2UXI A;  1BJZ A;  2NS7 A;  4YZE A;  4KWA A;  2EH3 A;  2IAI A;  4W1U A;  2QCO A;  3C2B A;  2Q24 A;  3DPJ A;  3E7Q A;  3AQS A;  5F08 A;  3VPR A;  2YVE A;  2IBD A;  3ZQF A;  4GCL A;  2NP5 A;  2XGD A;  4JKZ A;  4AUX A;  3C07 A;  3PPB A;  5EZG A;  2I10 A;  3BR6 A;  1ZKG A;  5GP9 A;  5AQC A;  2QOP A;  2FX0 A;  4AC0 A;  4M3G A;  2DG8 A;  5F0H A;  1JUP A;  3KZ9 A;  4AF5 A;  3ZQG A;  2WUI A;  4M3B A;  3VVY A;  4W97 A;  5K7H A;  3CJD A;  5EFY A;  4I6Z A;  3G56 A;  3KKD A;  2WV1 A;  4GCT A;  2RAS A;  3O8H A;  3LSJ A;  2G7S A;  3G1L A;  3ZQI A;  2G7G A;  5F0F A;  4GFK A;  1U9N A;  3AQT A;  3BHQ A;  2Y31 A;  2XB5 A;  3IH4 A;  2XPW A;  3KKC A;  3WHB A;  2ZCM A;  5FKL A;  3IUV A;  3MNL A;  5CW8 A;  5FKO A;  2GBY A;  3TP0 A;  1SGM A;  2G7L A;  3IH2 A;  2ZOY A;  3DEW A;  3VUQ A;  3ZQH A;  3DCF A;  4JYK A;  4D7N A;  3LOC A;  5F1J A;  4B3A A;  3QQA A;  3B6A A;  2OF7 A;  5HBU A;  2NP3 A;  3BR2 A;  3LSR A;  3HIM A;  1JT6 A;  4DW6 A;  4ICH A;  3Q0W A;  5F27 A;  2FJ1 A;  1RPW A;  4JNN A;  2RAE A;  3BRU A;  3LJL A;  5H9T A;  3Q3S A;  3HTI A;  3CWR A;  3GEU A;  3G1O A;  2X6O A;  5EYR A;  2HKU A;  2IEK A;  2VKE A;  1QPI A;  4D7M A;  2VKV A;  4G12 A;  3TP3 A;  4M3D A;  3HTH A;  3FRQ A;  5FGL A;  3EGQ A;  3B6C A;  3NRG A;  1ORK A;  4V2G A;  5F04 A;  4B1R A;  5J1Y A;  3QPL A;  2QWT A;  3COL A;  3VVZ A;  3P9T A;  2UXU A;  3Q0U A;  3JSJ A;  2W53 A;  5FKM A;  5IP6 A;  3NPI A;  3VOX A;  3QBM A;  4MK6 A;  3ZQL A;  3MVP A;  3BR0 A;  1T33 A;  2ID6 A;  2QKO A;  2OI8 A;  3NNR A;  4I76 A;  3ANG A;  3VW2 A;  2GEN A;  3QKX A;  2QIB A;  3BR1 A;  4D5F A;  2NS8 A;  3FIW A;  4JL3 A;  5GPC A;  3SFI A;  1JT0 A;  2V57 A;  5D18 A;  2QTQ A;  5J3L A;  4PXI A;  5CXI A;  3VW1 A;  3Q0V A;  3NI7 A;  2PBX A;  2XDN A;  3BTL A;  3BTI A;  3SDG A;  3CDL A;  3B81 A;  1UI6 A;  5GPA A;  2NX4 A;  3F0C A;  1U9O A;  3VW0 A;  3LSP A;  3NXC A;  5FMP A;  2F07 A;  2XRL A;  4NEL A;  3S5R A;  5C4Y A;  2OER A;  5J1R A;  3BR5 A;  5IPA A;  2WGB A;  4UDS A;  5D19 A;  4CGR A;  2HYJ A;  5DAJ A;  3QPS A;  4AC6 A;  3FK6 A;  5K7Z A;  4GCK A;  2G0E A;  2VPR A;  5HSZ A;  3HTA A;  4ABZ A;  4ME9 A;  2FD5 A;  2XGE A;  3VP5 A;  3G1M A;  3BJB A;  3BT9 A;  3PAS A;  1JUS A;  5EZH A;  4MXM A;  5FKK A;  1JUM A;  4X1E A;  1JTX A;  3BQY A;  3BTC A;  2HQ5 A;  2RHA A;  1JTY A;  3HGG A;  4HKU A;  3ANP A;  3V6G A;  2O7O A;  3O60 A;  3CCY A;  3RH2 A;  2DTZ A;  3FK7 A;  2Y30 A;  4MO7 A;  1T56 A;  2FQ4 A;  2DG7 A;  5J1U A;  2YVH A;  3HE0 A;  1Z0X A;  2TCT A;  2UXP A;  2ZB9 A;  1VI0 A;  2G3B A;  4D5C A;  5CXG A;  2ZCX A;  3KNW A;  2ZCN A;  5IOZ A;  4V2F A;  4ACI A;  3EUP A;  3WHC A;  1QVU A;  5IOY A;  2Y2Z A;  2XPU A; 
#chains in the Genus database with same CATH topology
 3NS4 A;  2HYT A;  2D6Y A;  3GZI A;  3G7R A;  3BNI A;  2GUH A;  2REK A;  4M3E A;  3T6N A;  3BR3 A;  3PM1 A;  4GFL A;  1QVT A;  2R7S A;  5FHP A;  2HXO A;  3O8G A;  2PZ9 A;  3HGY A;  5K58 A;  1ZK8 A;  3ON4 A;  3BQZ A;  3VOK A;  3V78 A;  1A6I A;  2JK3 A;  2TRT A;  2UXH A;  2O7T A;  3IH3 A;  2ZOZ A;  3BCG A;  2XGC A;  3CRJ A;  5F0C A;  4XK4 A;  3VIB A;  2YVX A;  5HAW A;  2R7V A;  3BTJ A;  2GFN A;  2JJ7 A;  3K8P C;  1Z77 A;  1UI5 A;  3F1B A;  5K7F A;  2UXO A;  5FKN A;  5D1R A;  3LWJ A;  3ON2 A;  2FJI 1;  2FBQ A;  3DU5 A;  2X9D A;  1RKT A;  3VVX A;  4DVY P;  4M3F A;  4NN1 A;  3HTJ A;  2IU5 A;  4L62 A;  3RD3 A;  3KYL A;  2HXI A;  3LHQ A;  1RKW A;  2OPT A;  2R7U A;  2ID3 A;  2XPV A;  2UXI A;  1BJZ A;  2NS7 A;  4YZE A;  5CQG A;  4KWA A;  2EH3 A;  2IAI A;  4W1U A;  2QCO A;  3C2B A;  2Q24 A;  3DPJ A;  3E7Q A;  3AQS A;  5F08 A;  3VPR A;  2YVE A;  2R7R A;  2IBD A;  3ZQF A;  4GCL A;  2NP5 A;  2XGD A;  4JKZ A;  4AUX A;  3C07 A;  3PPB A;  5EZG A;  2I10 A;  3BR6 A;  1ZKG A;  5GP9 A;  4WIB A;  5AQC A;  2QOP A;  2FX0 A;  4AC0 A;  3DU6 A;  2B3W A;  4M3G A;  2DG8 A;  5F0H A;  1JUP A;  3KZ9 A;  4AF5 A;  3ZQG A;  2WUI A;  4M3B A;  3VVY A;  4W97 A;  5K7H A;  3CJD A;  5EFY A;  4I6Z A;  3G56 A;  3KKD A;  2R7W A;  2WV1 A;  4GCT A;  2RAS A;  3O8H A;  2R7T A;  3LSJ A;  2G7S A;  3G1L A;  3ZQI A;  2G7G A;  5F0F A;  3FHN A;  4GFK A;  1U9N A;  3AQT A;  3BHQ A;  2Y31 A;  2XB5 A;  3IH4 A;  2XPW A;  3KKC A;  3WHB A;  2ZCM A;  5FKL A;  3IUV A;  3MNL A;  5CW8 A;  5FKO A;  2GBY A;  3TP0 A;  1SGM A;  2G7L A;  3IH2 A;  2ZOY A;  3DEW A;  3VUQ A;  3ZQH A;  3DCF A;  4JYK A;  4D7N A;  3LOC A;  5F1J A;  4B3A A;  3QQA A;  3B6A A;  2OF7 A;  5HBU A;  2NP3 A;  3BR2 A;  3LSR A;  3HIM A;  2R7X A;  1JT6 A;  4DW6 A;  4U9N A;  4ICH A;  3Q0W A;  5F27 A;  2FJ1 A;  1RPW A;  4JNN A;  2RAE A;  3BRU A;  3LJL A;  5H9T A;  3Q3S A;  3HTI A;  3CWR A;  3GEU A;  3G1O A;  2X6O A;  5EYR A;  2HKU A;  2IEK A;  2VKE A;  1QPI A;  4D7M A;  2VKV A;  4G12 A;  3TP3 A;  4M3D A;  3HTH A;  3FRQ A;  2R7Q A;  5FGL A;  3EGQ A;  3B6C A;  3NRG A;  1ORK A;  4V2G A;  5F04 A;  4B1R A;  5J1Y A;  3QPL A;  2QWT A;  3COL A;  3VVZ A;  3P9T A;  2UXU A;  3Q0U A;  3JSJ A;  2W53 A;  5FKM A;  5IP6 A;  3NPI A;  3VOX A;  3QBM A;  4MK6 A;  3ZQL A;  3MVP A;  3BR0 A;  1T33 A;  2ID6 A;  2QKO A;  2OI8 A;  3NNR A;  4I76 A;  3ANG A;  3VW2 A;  2R7O A;  2GEN A;  3QKX A;  2QIB A;  3BR1 A;  2PFV A;  4D5F A;  2NS8 A;  3FIW A;  4JL3 A;  5GPC A;  3SFI A;  1JT0 A;  2V57 A;  5D18 A;  2B1E A;  2QTQ A;  5J3L A;  4PXI A;  5CXI A;  3VW1 A;  3Q0V A;  3NI7 A;  2PBX A;  2XDN A;  3BTL A;  3SWH A;  3BTI A;  3SDG A;  4OD4 A;  4C2M A;  3CDL A;  3B81 A;  1UI6 A;  5GPA A;  2NX4 A;  3F0C A;  1U9O A;  3VW0 A;  3LSP A;  3NXC A;  5FMP A;  2F07 A;  2XRL A;  4NEL A;  3S5R A;  5C4Y A;  4OD5 A;  2OER A;  5J1R A;  3BR5 A;  5IPA A;  2WGB A;  4UDS A;  5D19 A;  4CGR A;  2HYJ A;  5DAJ A;  3QPS A;  4AC6 A;  3FK6 A;  5K7Z A;  2ZY9 A;  4GCK A;  2G0E A;  2VPR A;  5HSZ A;  3HTA A;  4ABZ A;  4ME9 A;  2FD5 A;  3VTI A;  2XGE A;  4U9L A;  3VP5 A;  3G1M A;  3BJB A;  3BT9 A;  3PAS A;  1JUS A;  5EZH A;  4MXM A;  5FKK A;  1JUM A;  4X1E A;  1JTX A;  3BQY A;  3BTC A;  2HQ5 A;  2RHA A;  1JTY A;  3HGG A;  4HKU A;  2A2F X;  3ANP A;  3V6G A;  2O7O A;  3O60 A;  3CCY A;  3RH2 A;  2DTZ A;  3FK7 A;  2Y30 A;  4MO7 A;  1T56 A;  2FQ4 A;  2DG7 A;  5J1U A;  2YVH A;  3HE0 A;  4IRV A;  1Z0X A;  2TCT A;  2UXP A;  2ZB9 A;  1VI0 A;  2G3B A;  4D5C A;  5CXG A;  2ZCX A;  3KNW A;  2ZCN A;  5IOZ A;  4V2F A;  4ACI A;  3EUP A;  3WHC A;  1QVU A;  5IOY A;  2Y2Z A;  2XPU A; 
#chains in the Genus database with same CATH homology
 2HYT A;  2D6Y A;  3GZI A;  3G7R A;  3BNI A;  2GUH A;  2REK A;  4M3E A;  3T6N A;  3BR3 A;  3PM1 A;  4GFL A;  1QVT A;  5FHP A;  2HXO A;  3O8G A;  2PZ9 A;  3HGY A;  5K58 A;  1ZK8 A;  3ON4 A;  3BQZ A;  3VOK A;  3V78 A;  1A6I A;  2JK3 A;  2TRT A;  2UXH A;  2O7T A;  3IH3 A;  2ZOZ A;  3BCG A;  2XGC A;  3CRJ A;  5F0C A;  4XK4 A;  3VIB A;  5HAW A;  3BTJ A;  2GFN A;  2JJ7 A;  1Z77 A;  1UI5 A;  3F1B A;  5K7F A;  2UXO A;  5FKN A;  5D1R A;  3LWJ A;  3ON2 A;  2FBQ A;  2X9D A;  1RKT A;  3VVX A;  4M3F A;  4NN1 A;  3HTJ A;  2IU5 A;  4L62 A;  3RD3 A;  2HXI A;  3LHQ A;  1RKW A;  2OPT A;  2ID3 A;  2XPV A;  2UXI A;  1BJZ A;  2NS7 A;  4YZE A;  4KWA A;  2EH3 A;  2IAI A;  4W1U A;  2QCO A;  3C2B A;  2Q24 A;  3DPJ A;  3E7Q A;  3AQS A;  5F08 A;  3VPR A;  2YVE A;  2IBD A;  3ZQF A;  4GCL A;  2NP5 A;  2XGD A;  4JKZ A;  4AUX A;  3C07 A;  3PPB A;  5EZG A;  2I10 A;  3BR6 A;  1ZKG A;  5GP9 A;  5AQC A;  2QOP A;  2FX0 A;  4AC0 A;  4M3G A;  2DG8 A;  5F0H A;  1JUP A;  3KZ9 A;  4AF5 A;  3ZQG A;  2WUI A;  4M3B A;  3VVY A;  4W97 A;  5K7H A;  3CJD A;  5EFY A;  4I6Z A;  3G56 A;  3KKD A;  2WV1 A;  4GCT A;  2RAS A;  3O8H A;  3LSJ A;  2G7S A;  3G1L A;  3ZQI A;  2G7G A;  5F0F A;  4GFK A;  1U9N A;  3AQT A;  3BHQ A;  2Y31 A;  2XB5 A;  3IH4 A;  2XPW A;  3KKC A;  3WHB A;  2ZCM A;  5FKL A;  3IUV A;  3MNL A;  5CW8 A;  5FKO A;  2GBY A;  3TP0 A;  1SGM A;  2G7L A;  3IH2 A;  2ZOY A;  3DEW A;  3VUQ A;  3ZQH A;  3DCF A;  4JYK A;  4D7N A;  3LOC A;  5F1J A;  4B3A A;  3QQA A;  3B6A A;  2OF7 A;  5HBU A;  2NP3 A;  3BR2 A;  3LSR A;  3HIM A;  1JT6 A;  4DW6 A;  4ICH A;  3Q0W A;  5F27 A;  2FJ1 A;  1RPW A;  4JNN A;  2RAE A;  3BRU A;  3LJL A;  5H9T A;  3Q3S A;  3HTI A;  3CWR A;  3GEU A;  3G1O A;  2X6O A;  5EYR A;  2HKU A;  2IEK A;  2VKE A;  1QPI A;  4D7M A;  2VKV A;  4G12 A;  3TP3 A;  4M3D A;  3HTH A;  3FRQ A;  5FGL A;  3EGQ A;  3B6C A;  3NRG A;  1ORK A;  4V2G A;  5F04 A;  4B1R A;  5J1Y A;  3QPL A;  2QWT A;  3COL A;  3VVZ A;  3P9T A;  2UXU A;  3Q0U A;  3JSJ A;  2W53 A;  5FKM A;  5IP6 A;  3NPI A;  3VOX A;  3QBM A;  4MK6 A;  3ZQL A;  3MVP A;  3BR0 A;  1T33 A;  2ID6 A;  2QKO A;  2OI8 A;  3NNR A;  4I76 A;  3ANG A;  3VW2 A;  2GEN A;  3QKX A;  2QIB A;  3BR1 A;  4D5F A;  2NS8 A;  3FIW A;  4JL3 A;  5GPC A;  3SFI A;  1JT0 A;  2V57 A;  5D18 A;  2QTQ A;  5J3L A;  4PXI A;  5CXI A;  3VW1 A;  3Q0V A;  3NI7 A;  2PBX A;  2XDN A;  3BTL A;  3BTI A;  3SDG A;  3CDL A;  3B81 A;  1UI6 A;  5GPA A;  2NX4 A;  3F0C A;  1U9O A;  3VW0 A;  3LSP A;  3NXC A;  5FMP A;  2F07 A;  2XRL A;  4NEL A;  3S5R A;  5C4Y A;  2OER A;  5J1R A;  3BR5 A;  5IPA A;  2WGB A;  4UDS A;  5D19 A;  4CGR A;  2HYJ A;  5DAJ A;  3QPS A;  4AC6 A;  3FK6 A;  5K7Z A;  4GCK A;  2G0E A;  2VPR A;  5HSZ A;  3HTA A;  4ABZ A;  4ME9 A;  2FD5 A;  2XGE A;  3VP5 A;  3G1M A;  3BJB A;  3BT9 A;  3PAS A;  1JUS A;  5EZH A;  4MXM A;  5FKK A;  1JUM A;  4X1E A;  1JTX A;  3BQY A;  3BTC A;  2HQ5 A;  2RHA A;  1JTY A;  3HGG A;  4HKU A;  3ANP A;  3V6G A;  2O7O A;  3O60 A;  3CCY A;  3RH2 A;  2DTZ A;  3FK7 A;  2Y30 A;  4MO7 A;  1T56 A;  2FQ4 A;  2DG7 A;  5J1U A;  2YVH A;  3HE0 A;  1Z0X A;  2TCT A;  2UXP A;  2ZB9 A;  1VI0 A;  2G3B A;  4D5C A;  5CXG A;  2ZCX A;  3KNW A;  2ZCN A;  5IOZ A;  4V2F A;  4ACI A;  3EUP A;  3WHC A;  1QVU A;  5IOY A;  2Y2Z A;  2XPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...