3RH2A

Crystal structure of a tetr-like transcriptional regulator (sama_0099) from shewanella amazonensis sb2b at 2.42 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
210
structure length
210
Chain Sequence
MKTRDKIIQASLELFNEHGERTITTNHIAAHLDISPGNLYYHFRNKEDIIRCIFDQYEQHLLLGFKPYADQKVDLELLMSYFDAMFYTMWQFRFMYANLADILARDDTLKARYLKVQQAVLEQSIAVLNQLKKDGILQIEDERIADLADTIKMIIGFWISYKLTQSSIATISKASLYEGLLRVLMIFKAYSTPDSLANFDRLEQHFRSQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical TetR-like transcriptional regulator
publication title Crystal structure of a Hypothetical TetR-like transcriptional regulator (Sama_0099) from SHEWANELLA AMAZONENSIS SB2B at 2.42 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Dna binding protein
total genus 75
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13972 TetR Bacterial transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3rh2A00
1U9OA 1T56A 4W97A 4AC6A 1UI6A 1BJZA 2XGCA 2W53A 2NP5A 2DG7A 3FK7A 4MK6A 3RD3A 2G7SA 4GCLA 3ON4A 3DCFA 2ID3A 2FJ1A 5F27A 2RHAA 2X9DA 5CXIA 3FRQA 5FKKA 3VOKA 3C07A 2OI8A 2IEKA 2IU5A 3VVXA 5EFYA 5C4YA 3CRJA 2REKA 4AC0A 2G3BA 3PPBA 4B3AA 3Q0VA 4GFLA 2XPUA 1JUMA 2O7TA 1VI0A 1JT0A 5D1RA 4YZEA 1QPIA 2QKOA 2NX4A 2NP3A 2NS8A 5EZHA 4CGRA 5EYRA 5FKLA 3EGQA 3WHCA 4JL3A 3CDLA 3CWRA 2JK3A 2IBDA 1ZKGA 3G7RA 2VKVA 3VVZA 1QVTA 3BR5A 3IUVA 3F0CA 3DEWA 2UXUA 1SGMA 2WUIA 2OERA 3B6CA 2DG8A 4G12A 3HTJA 5IOYA 4NELA 2Y31A 5D19A 5HAWA 4D7NA 3VW1A 4M3EA 5F0CA 4GCKA 4AUXA 2YVHA 5CXGA 3PASA 3HTHA 5F08A 2FBQA 2TCTA 4D5CA 5DAJA 3ZQGA 2QTQA 5IPAA 1ORKA 2JJ7A 5J1UA 2UXIA 4B1RA 2G7GA 3COLA 3TP3A 3KNWA 3Q0UA 4HKUA 3ZQHA 3ANGA 2Y30A 5IP6A 3BQYA 3BT9A 2EH3A 5FGLA 2XGEA 1UI5A 2QWTA 4D5FA 2ZB9A 2OF7A 5FHPA 5K7HA 5F0HA 2O7OA 3CCYA 3HTAA 3CJDA 4DW6A 2Y2ZA 4JYKA 4MO7A 2HKUA 5FMPA 2ZCMA 3O8GA 3KZ9A 4JNNA 3ZQLA 5EZGA 3V6GA 3HGYA 3FK6A 2OPTA 3HGGA 1RPWA 4AF5A 4XK4A 2I10A 3RH2A 4W1UA 5GPCA 4V2FA 3KKCA 2UXHA 3LHQA 3GEUA 4UDSA 3ZQIA 2QCOA 3QBMA 3SFIA 2X6OA 3VUQA 3F1BA 5F0FA 2XPWA 3BJBA 1RKWA 4NN1A 3BR3A 3GZIA 4GFKA 3BR6A 1JTYA 3QKXA 3SDGA 2UXOA 5J1YA 2HYTA 4GCTA 3G56A 4ABZA 5FKMA 3BTJA 5J3LA 4ICHA 3IH4A 2PBXA 3Q0WA 1JTXA 4X1EA 2D6YA 3DPJA 3VW2A 5F1JA 2HYJA 2ZCNA 2TRTA 5AQCA 2ZOYA 2XRLA 5FKNA 2GUHA 3VP5A 3HIMA 2FD5A 1RKTA 5HSZA 3MVPA 5K58A 2XGDA 2WGBA 2UXPA 3E7QA 1Z0XA 3QPLA 5J1RA 1JT6A 2FQ4A 3BTLA 4M3FA 2G0EA 3G1OA 3VVYA 4L62A 3NI7A 2ID6A 3BCGA 4JKZA 3ZQFA 3T6NA 5GPAA 1A6IA 5HBUA 5K7FA 2V57A 2DTZA 3ON2A 3QQAA 3ANPA 4M3GA 2HQ5A 4I6ZA 3VIBA 5H9TA 3S5RA 4KWAA 3PM1A 1JUSA 3VW0A 3AQTA 3KKDA 3VPRA 3O60A 1Z77A 4ACIA 2G7LA 1QVUA 3BHQA 3NNRA 3LSJA 5IOZA 3TP0A 3BR0A 2RASA 3LJLA 2FX0A 5K7ZA 5CW8A 4I76A 2GFNA 3Q3SA 2VKEA 2XDNA 3WHBA 2PZ9A 3BRUA 2QOPA 4V2GA 2NS7A 3G1MA 3NXCA 2XPVA 3EUPA 3LOCA 3B81A 2YVEA 1JUPA 3IH3A 3NPIA 4M3DA 3G1LA 5GP9A 4D7MA 5FKOA 2IAIA 4M3BA 5D18A 3LWJA 3AQSA 3QPSA 3BQZA 3IH2A 2ZOZA 3FIWA 2WV1A 2VPRA 2RAEA 3BR2A 3NRGA 2QIBA 3V78A 1T33A 3O8HA 5F04A 3BNIA 2GBYA 2XB5A 2ZCXA 3BTIA 4MXMA 1ZK8A 2F07A 3MNLA 3HE0A 3C2BA 2GENA 3VOXA 3B6AA 3LSPA 4ME9A 3LSRA 2HXIA 3JSJA 4PXIA 3HTIA 2Q24A 2HXOA 1U9NA 3BR1A 3BTCA 3P9TA
chains in the Genus database with same CATH superfamily
1U9OA 1T56A 4W97A 4AC6A 1UI6A 1BJZA 2XGCA 2W53A 2NP5A 2DG7A 3FK7A 4MK6A 3RD3A 2R7XA 2G7SA 4GCLA 3ON4A 3DCFA 2ID3A 2FJ1A 5F27A 3DU5A 2RHAA 2X9DA 5CXIA 3FRQA 5FKKA 3VOKA 3C07A 2OI8A 2IEKA 2IU5A 3VVXA 5EFYA 5C4YA 3CRJA 2REKA 4AC0A 2G3BA 3PPBA 4B3AA 3Q0VA 4GFLA 2XPUA 1JUMA 2O7TA 1VI0A 1JT0A 2R7TA 5D1RA 4YZEA 4OD4A 1QPIA 2QKOA 2NX4A 2NP3A 2NS8A 5EZHA 4CGRA 5EYRA 5FKLA 3EGQA 3WHCA 4JL3A 3CDLA 3CWRA 2JK3A 2IBDA 3FHNA 1ZKGA 3SWHA 3G7RA 2VKVA 3VVZA 1QVTA 3BR5A 4OD5A 3IUVA 3F0CA 3DEWA 2UXUA 1SGMA 2WUIA 2OERA 3B6CA 2DG8A 4G12A 3HTJA 5IOYA 4NELA 2Y31A 5D19A 5HAWA 4D7NA 3VW1A 4M3EA 5F0CA 4GCKA 4AUXA 2YVHA 5CXGA 3PASA 3HTHA 2R7OA 2FBQA 2TCTA 5F08A 4D5CA 5DAJA 3ZQGA 2QTQA 2YVXA 5IPAA 1ORKA 2JJ7A 2R7WA 5J1UA 2UXIA 4B1RA 2G7GA 3COLA 3TP3A 3KNWA 3Q0UA 4HKUA 3ZQHA 3ANGA 2Y30A 5IP6A 3BQYA 3KYLA 3BT9A 2EH3A 2R7QA 5FGLA 2XGEA 1UI5A 2QWTA 4D5FA 2ZB9A 2OF7A 5FHPA 2PFVA 5K7HA 5F0HA 2O7OA 4WIBA 3CCYA 3HTAA 3DU6A 3CJDA 4DW6A 2Y2ZA 4JYKA 4MO7A 2HKUA 5FMPA 2ZCMA 3O8GA 3KZ9A 4JNNA 4C2MA 3ZQLA 5EZGA 3V6GA 3HGYA 3FK6A 2OPTA 3HGGA 1RPWA 4AF5A 4XK4A 2I10A 3RH2A 4W1UA 5GPCA 4V2FA 3KKCA 2UXHA 3LHQA 3GEUA 4UDSA 3ZQIA 2QCOA 3QBMA 3SFIA 2X6OA 3VUQA 3F1BA 5F0FA 2XPWA 3BJBA 1RKWA 4NN1A 3BR3A 3GZIA 4GFKA 3BR6A 1JTYA 3QKXA 4U9LA 3SDGA 2UXOA 5J1YA 2HYTA 4GCTA 3G56A 2R7UA 4ABZA 5FKMA 2R7VA 3BTJA 5J3LA 4ICHA 3IH4A 2PBXA 3Q0WA 1JTXA 4X1EA 2D6YA 3DPJA 3VW2A 5F1JA 2HYJA 2ZCNA 4IRVA 2TRTA 5AQCA 2ZOYA 2XRLA 5FKNA 2GUHA 3VP5A 3HIMA 2A2FX 2FD5A 1RKTA 5HSZA 3MVPA 5K58A 2XGDA 2WGBA 2UXPA 3E7QA 1Z0XA 3QPLA 5J1RA 3K8PC 1JT6A 2FQ4A 5CQGA 3BTLA 4M3FA 2G0EA 3G1OA 3VVYA 2R7RA 4L62A 3NI7A 2ID6A 3BCGA 4JKZA 3ZQFA 3T6NA 5GPAA 1A6IA 5HBUA 5K7FA 2V57A 2DTZA 3ON2A 3QQAA 3ANPA 4M3GA 2HQ5A 3VTIA 4I6ZA 3VIBA 5H9TA 3S5RA 4KWAA 3PM1A 1JUSA 3VW0A 3NS4A 3AQTA 3KKDA 3VPRA 3O60A 1Z77A 4ACIA 2G7LA 1QVUA 3BHQA 3NNRA 3LSJA 5IOZA 3TP0A 3BR0A 2RASA 3LJLA 2FX0A 5K7ZA 5CW8A 4I76A 2GFNA 3Q3SA 2VKEA 2FJI1 2XDNA 3WHBA 2PZ9A 3BRUA 2QOPA 4V2GA 2NS7A 3G1MA 3NXCA 2XPVA 3EUPA 3LOCA 3B81A 2YVEA 1JUPA 3IH3A 3NPIA 4M3DA 3G1LA 2B1EA 5GP9A 4D7MA 5FKOA 2IAIA 4M3BA 4U9NA 5D18A 3LWJA 3AQSA 3QPSA 2R7SA 3BQZA 3IH2A 2ZOZA 3FIWA 2WV1A 2VPRA 2RAEA 3BR2A 3NRGA 2QIBA 3V78A 1T33A 3O8HA 5F04A 3BNIA 2GBYA 2XB5A 2ZCXA 3BTIA 4MXMA 1ZK8A 2F07A 3MNLA 3HE0A 4DVYP 3C2BA 2GENA 3VOXA 3B6AA 2B3WA 3LSPA 2ZY9A 4ME9A 3LSRA 2HXIA 3JSJA 4PXIA 3HTIA 2Q24A 2HXOA 1U9NA 3BR1A 3BTCA 3P9TA
chains in the Genus database with same CATH topology
1U9OA 1T56A 4W97A 4AC6A 1UI6A 1BJZA 2XGCA 2W53A 2NP5A 2DG7A 3FK7A 4MK6A 3RD3A 2G7SA 4GCLA 3ON4A 3DCFA 2ID3A 2FJ1A 5F27A 2RHAA 2X9DA 5CXIA 3FRQA 5FKKA 3VOKA 3C07A 2OI8A 2IEKA 2IU5A 3VVXA 5EFYA 5C4YA 3CRJA 2REKA 4AC0A 2G3BA 3PPBA 4B3AA 3Q0VA 4GFLA 2XPUA 1JUMA 2O7TA 1VI0A 1JT0A 5D1RA 4YZEA 1QPIA 2QKOA 2NX4A 2NP3A 2NS8A 5EZHA 4CGRA 5EYRA 5FKLA 3EGQA 3WHCA 4JL3A 3CDLA 3CWRA 2JK3A 2IBDA 1ZKGA 3G7RA 2VKVA 3VVZA 1QVTA 3BR5A 3IUVA 3F0CA 3DEWA 2UXUA 1SGMA 2WUIA 2OERA 3B6CA 2DG8A 4G12A 3HTJA 5IOYA 4NELA 2Y31A 5D19A 5HAWA 4D7NA 3VW1A 4M3EA 5F0CA 4GCKA 4AUXA 2YVHA 5CXGA 3PASA 3HTHA 5F08A 2FBQA 2TCTA 4D5CA 5DAJA 3ZQGA 2QTQA 5IPAA 1ORKA 2JJ7A 5J1UA 2UXIA 4B1RA 2G7GA 3COLA 3TP3A 3KNWA 3Q0UA 4HKUA 3ZQHA 3ANGA 2Y30A 5IP6A 3BQYA 3BT9A 2EH3A 5FGLA 2XGEA 1UI5A 2QWTA 4D5FA 2ZB9A 2OF7A 5FHPA 5K7HA 5F0HA 2O7OA 3CCYA 3HTAA 3CJDA 4DW6A 2Y2ZA 4JYKA 4MO7A 2HKUA 5FMPA 2ZCMA 3O8GA 3KZ9A 4JNNA 3ZQLA 5EZGA 3V6GA 3HGYA 3FK6A 2OPTA 3HGGA 1RPWA 4AF5A 4XK4A 2I10A 3RH2A 4W1UA 5GPCA 4V2FA 3KKCA 2UXHA 3LHQA 3GEUA 4UDSA 3ZQIA 2QCOA 3QBMA 3SFIA 2X6OA 3VUQA 3F1BA 5F0FA 2XPWA 3BJBA 1RKWA 4NN1A 3BR3A 3GZIA 4GFKA 3BR6A 1JTYA 3QKXA 3SDGA 2UXOA 5J1YA 2HYTA 4GCTA 3G56A 4ABZA 5FKMA 3BTJA 5J3LA 4ICHA 3IH4A 2PBXA 3Q0WA 1JTXA 4X1EA 2D6YA 3DPJA 3VW2A 5F1JA 2HYJA 2ZCNA 2TRTA 5AQCA 2ZOYA 2XRLA 5FKNA 2GUHA 3VP5A 3HIMA 2FD5A 1RKTA 5HSZA 3MVPA 5K58A 2XGDA 2WGBA 2UXPA 3E7QA 1Z0XA 3QPLA 5J1RA 1JT6A 2FQ4A 3BTLA 4M3FA 2G0EA 3G1OA 3VVYA 4L62A 3NI7A 2ID6A 3BCGA 4JKZA 3ZQFA 3T6NA 5GPAA 1A6IA 5HBUA 5K7FA 2V57A 2DTZA 3ON2A 3QQAA 3ANPA 4M3GA 2HQ5A 4I6ZA 3VIBA 5H9TA 3S5RA 4KWAA 3PM1A 1JUSA 3VW0A 3AQTA 3KKDA 3VPRA 3O60A 1Z77A 4ACIA 2G7LA 1QVUA 3BHQA 3NNRA 3LSJA 5IOZA 3TP0A 3BR0A 2RASA 3LJLA 2FX0A 5K7ZA 5CW8A 4I76A 2GFNA 3Q3SA 2VKEA 2XDNA 3WHBA 2PZ9A 3BRUA 2QOPA 4V2GA 2NS7A 3G1MA 3NXCA 2XPVA 3EUPA 3LOCA 3B81A 2YVEA 1JUPA 3IH3A 3NPIA 4M3DA 3G1LA 5GP9A 4D7MA 5FKOA 2IAIA 4M3BA 5D18A 3LWJA 3AQSA 3QPSA 3BQZA 3IH2A 2ZOZA 3FIWA 2WV1A 2VPRA 2RAEA 3BR2A 3NRGA 2QIBA 3V78A 1T33A 3O8HA 5F04A 3BNIA 2GBYA 2XB5A 2ZCXA 3BTIA 4MXMA 1ZK8A 2F07A 3MNLA 3HE0A 3C2BA 2GENA 3VOXA 3B6AA 3LSPA 4ME9A 3LSRA 2HXIA 3JSJA 4PXIA 3HTIA 2Q24A 2HXOA 1U9NA 3BR1A 3BTCA 3P9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9O A;  1T56 A;  4W97 A;  4AC6 A;  1UI6 A;  1BJZ A;  2XGC A;  2W53 A;  2NP5 A;  2DG7 A;  3FK7 A;  4MK6 A;  3RD3 A;  2G7S A;  4GCL A;  3ON4 A;  3DCF A;  2ID3 A;  2FJ1 A;  5F27 A;  2RHA A;  2X9D A;  5CXI A;  3FRQ A;  5FKK A;  3VOK A;  3C07 A;  2OI8 A;  2IEK A;  2IU5 A;  3VVX A;  5EFY A;  5C4Y A;  3CRJ A;  2REK A;  4AC0 A;  2G3B A;  3PPB A;  4B3A A;  3Q0V A;  4GFL A;  2XPU A;  1JUM A;  2O7T A;  1VI0 A;  1JT0 A;  5D1R A;  4YZE A;  1QPI A;  2QKO A;  2NX4 A;  2NP3 A;  2NS8 A;  5EZH A;  4CGR A;  5EYR A;  5FKL A;  3EGQ A;  3WHC A;  4JL3 A;  3CDL A;  3CWR A;  2JK3 A;  2IBD A;  1ZKG A;  3G7R A;  2VKV A;  3VVZ A;  1QVT A;  3BR5 A;  3IUV A;  3F0C A;  3DEW A;  2UXU A;  1SGM A;  2WUI A;  2OER A;  3B6C A;  2DG8 A;  4G12 A;  3HTJ A;  5IOY A;  4NEL A;  2Y31 A;  5D19 A;  5HAW A;  4D7N A;  3VW1 A;  4M3E A;  5F0C A;  4GCK A;  4AUX A;  2YVH A;  5CXG A;  3PAS A;  3HTH A;  5F08 A;  2FBQ A;  2TCT A;  4D5C A;  5DAJ A;  3ZQG A;  2QTQ A;  5IPA A;  1ORK A;  2JJ7 A;  5J1U A;  2UXI A;  4B1R A;  2G7G A;  3COL A;  3TP3 A;  3KNW A;  3Q0U A;  4HKU A;  3ZQH A;  3ANG A;  2Y30 A;  5IP6 A;  3BQY A;  3BT9 A;  2EH3 A;  5FGL A;  2XGE A;  1UI5 A;  2QWT A;  4D5F A;  2ZB9 A;  2OF7 A;  5FHP A;  5K7H A;  5F0H A;  2O7O A;  3CCY A;  3HTA A;  3CJD A;  4DW6 A;  2Y2Z A;  4JYK A;  4MO7 A;  2HKU A;  5FMP A;  2ZCM A;  3O8G A;  3KZ9 A;  4JNN A;  3ZQL A;  5EZG A;  3V6G A;  3HGY A;  3FK6 A;  2OPT A;  3HGG A;  1RPW A;  4AF5 A;  4XK4 A;  2I10 A;  3RH2 A;  4W1U A;  5GPC A;  4V2F A;  3KKC A;  2UXH A;  3LHQ A;  3GEU A;  4UDS A;  3ZQI A;  2QCO A;  3QBM A;  3SFI A;  2X6O A;  3VUQ A;  3F1B A;  5F0F A;  2XPW A;  3BJB A;  1RKW A;  4NN1 A;  3BR3 A;  3GZI A;  4GFK A;  3BR6 A;  1JTY A;  3QKX A;  3SDG A;  2UXO A;  5J1Y A;  2HYT A;  4GCT A;  3G56 A;  4ABZ A;  5FKM A;  3BTJ A;  5J3L A;  4ICH A;  3IH4 A;  2PBX A;  3Q0W A;  1JTX A;  4X1E A;  2D6Y A;  3DPJ A;  3VW2 A;  5F1J A;  2HYJ A;  2ZCN A;  2TRT A;  5AQC A;  2ZOY A;  2XRL A;  5FKN A;  2GUH A;  3VP5 A;  3HIM A;  2FD5 A;  1RKT A;  5HSZ A;  3MVP A;  5K58 A;  2XGD A;  2WGB A;  2UXP A;  3E7Q A;  1Z0X A;  3QPL A;  5J1R A;  1JT6 A;  2FQ4 A;  3BTL A;  4M3F A;  2G0E A;  3G1O A;  3VVY A;  4L62 A;  3NI7 A;  2ID6 A;  3BCG A;  4JKZ A;  3ZQF A;  3T6N A;  5GPA A;  1A6I A;  5HBU A;  5K7F A;  2V57 A;  2DTZ A;  3ON2 A;  3QQA A;  3ANP A;  4M3G A;  2HQ5 A;  4I6Z A;  3VIB A;  5H9T A;  3S5R A;  4KWA A;  3PM1 A;  1JUS A;  3VW0 A;  3AQT A;  3KKD A;  3VPR A;  3O60 A;  1Z77 A;  4ACI A;  2G7L A;  1QVU A;  3BHQ A;  3NNR A;  3LSJ A;  5IOZ A;  3TP0 A;  3BR0 A;  2RAS A;  3LJL A;  2FX0 A;  5K7Z A;  5CW8 A;  4I76 A;  2GFN A;  3Q3S A;  2VKE A;  2XDN A;  3WHB A;  2PZ9 A;  3BRU A;  2QOP A;  4V2G A;  2NS7 A;  3G1M A;  3NXC A;  2XPV A;  3EUP A;  3LOC A;  3B81 A;  2YVE A;  1JUP A;  3IH3 A;  3NPI A;  4M3D A;  3G1L A;  5GP9 A;  4D7M A;  5FKO A;  2IAI A;  4M3B A;  5D18 A;  3LWJ A;  3AQS A;  3QPS A;  3BQZ A;  3IH2 A;  2ZOZ A;  3FIW A;  2WV1 A;  2VPR A;  2RAE A;  3BR2 A;  3NRG A;  2QIB A;  3V78 A;  1T33 A;  3O8H A;  5F04 A;  3BNI A;  2GBY A;  2XB5 A;  2ZCX A;  3BTI A;  4MXM A;  1ZK8 A;  2F07 A;  3MNL A;  3HE0 A;  3C2B A;  2GEN A;  3VOX A;  3B6A A;  3LSP A;  4ME9 A;  3LSR A;  2HXI A;  3JSJ A;  4PXI A;  3HTI A;  2Q24 A;  2HXO A;  1U9N A;  3BR1 A;  3BTC A;  3P9T A; 
#chains in the Genus database with same CATH topology
 1U9O A;  1T56 A;  4W97 A;  4AC6 A;  1UI6 A;  1BJZ A;  2XGC A;  2W53 A;  2NP5 A;  2DG7 A;  3FK7 A;  4MK6 A;  3RD3 A;  2R7X A;  2G7S A;  4GCL A;  3ON4 A;  3DCF A;  2ID3 A;  2FJ1 A;  5F27 A;  3DU5 A;  2RHA A;  2X9D A;  5CXI A;  3FRQ A;  5FKK A;  3VOK A;  3C07 A;  2OI8 A;  2IEK A;  2IU5 A;  3VVX A;  5EFY A;  5C4Y A;  3CRJ A;  2REK A;  4AC0 A;  2G3B A;  3PPB A;  4B3A A;  3Q0V A;  4GFL A;  2XPU A;  1JUM A;  2O7T A;  1VI0 A;  1JT0 A;  2R7T A;  5D1R A;  4YZE A;  4OD4 A;  1QPI A;  2QKO A;  2NX4 A;  2NP3 A;  2NS8 A;  5EZH A;  4CGR A;  5EYR A;  5FKL A;  3EGQ A;  3WHC A;  4JL3 A;  3CDL A;  3CWR A;  2JK3 A;  2IBD A;  3FHN A;  1ZKG A;  3SWH A;  3G7R A;  2VKV A;  3VVZ A;  1QVT A;  3BR5 A;  4OD5 A;  3IUV A;  3F0C A;  3DEW A;  2UXU A;  1SGM A;  2WUI A;  2OER A;  3B6C A;  2DG8 A;  4G12 A;  3HTJ A;  5IOY A;  4NEL A;  2Y31 A;  5D19 A;  5HAW A;  4D7N A;  3VW1 A;  4M3E A;  5F0C A;  4GCK A;  4AUX A;  2YVH A;  5CXG A;  3PAS A;  3HTH A;  2R7O A;  2FBQ A;  2TCT A;  5F08 A;  4D5C A;  5DAJ A;  3ZQG A;  2QTQ A;  2YVX A;  5IPA A;  1ORK A;  2JJ7 A;  2R7W A;  5J1U A;  2UXI A;  4B1R A;  2G7G A;  3COL A;  3TP3 A;  3KNW A;  3Q0U A;  4HKU A;  3ZQH A;  3ANG A;  2Y30 A;  5IP6 A;  3BQY A;  3KYL A;  3BT9 A;  2EH3 A;  2R7Q A;  5FGL A;  2XGE A;  1UI5 A;  2QWT A;  4D5F A;  2ZB9 A;  2OF7 A;  5FHP A;  2PFV A;  5K7H A;  5F0H A;  2O7O A;  4WIB A;  3CCY A;  3HTA A;  3DU6 A;  3CJD A;  4DW6 A;  2Y2Z A;  4JYK A;  4MO7 A;  2HKU A;  5FMP A;  2ZCM A;  3O8G A;  3KZ9 A;  4JNN A;  4C2M A;  3ZQL A;  5EZG A;  3V6G A;  3HGY A;  3FK6 A;  2OPT A;  3HGG A;  1RPW A;  4AF5 A;  4XK4 A;  2I10 A;  3RH2 A;  4W1U A;  5GPC A;  4V2F A;  3KKC A;  2UXH A;  3LHQ A;  3GEU A;  4UDS A;  3ZQI A;  2QCO A;  3QBM A;  3SFI A;  2X6O A;  3VUQ A;  3F1B A;  5F0F A;  2XPW A;  3BJB A;  1RKW A;  4NN1 A;  3BR3 A;  3GZI A;  4GFK A;  3BR6 A;  1JTY A;  3QKX A;  4U9L A;  3SDG A;  2UXO A;  5J1Y A;  2HYT A;  4GCT A;  3G56 A;  2R7U A;  4ABZ A;  5FKM A;  2R7V A;  3BTJ A;  5J3L A;  4ICH A;  3IH4 A;  2PBX A;  3Q0W A;  1JTX A;  4X1E A;  2D6Y A;  3DPJ A;  3VW2 A;  5F1J A;  2HYJ A;  2ZCN A;  4IRV A;  2TRT A;  5AQC A;  2ZOY A;  2XRL A;  5FKN A;  2GUH A;  3VP5 A;  3HIM A;  2A2F X;  2FD5 A;  1RKT A;  5HSZ A;  3MVP A;  5K58 A;  2XGD A;  2WGB A;  2UXP A;  3E7Q A;  1Z0X A;  3QPL A;  5J1R A;  3K8P C;  1JT6 A;  2FQ4 A;  5CQG A;  3BTL A;  4M3F A;  2G0E A;  3G1O A;  3VVY A;  2R7R A;  4L62 A;  3NI7 A;  2ID6 A;  3BCG A;  4JKZ A;  3ZQF A;  3T6N A;  5GPA A;  1A6I A;  5HBU A;  5K7F A;  2V57 A;  2DTZ A;  3ON2 A;  3QQA A;  3ANP A;  4M3G A;  2HQ5 A;  3VTI A;  4I6Z A;  3VIB A;  5H9T A;  3S5R A;  4KWA A;  3PM1 A;  1JUS A;  3VW0 A;  3NS4 A;  3AQT A;  3KKD A;  3VPR A;  3O60 A;  1Z77 A;  4ACI A;  2G7L A;  1QVU A;  3BHQ A;  3NNR A;  3LSJ A;  5IOZ A;  3TP0 A;  3BR0 A;  2RAS A;  3LJL A;  2FX0 A;  5K7Z A;  5CW8 A;  4I76 A;  2GFN A;  3Q3S A;  2VKE A;  2FJI 1;  2XDN A;  3WHB A;  2PZ9 A;  3BRU A;  2QOP A;  4V2G A;  2NS7 A;  3G1M A;  3NXC A;  2XPV A;  3EUP A;  3LOC A;  3B81 A;  2YVE A;  1JUP A;  3IH3 A;  3NPI A;  4M3D A;  3G1L A;  2B1E A;  5GP9 A;  4D7M A;  5FKO A;  2IAI A;  4M3B A;  4U9N A;  5D18 A;  3LWJ A;  3AQS A;  3QPS A;  2R7S A;  3BQZ A;  3IH2 A;  2ZOZ A;  3FIW A;  2WV1 A;  2VPR A;  2RAE A;  3BR2 A;  3NRG A;  2QIB A;  3V78 A;  1T33 A;  3O8H A;  5F04 A;  3BNI A;  2GBY A;  2XB5 A;  2ZCX A;  3BTI A;  4MXM A;  1ZK8 A;  2F07 A;  3MNL A;  3HE0 A;  4DVY P;  3C2B A;  2GEN A;  3VOX A;  3B6A A;  2B3W A;  3LSP A;  2ZY9 A;  4ME9 A;  3LSR A;  2HXI A;  3JSJ A;  4PXI A;  3HTI A;  2Q24 A;  2HXO A;  1U9N A;  3BR1 A;  3BTC A;  3P9T A; 
#chains in the Genus database with same CATH homology
 1U9O A;  1T56 A;  4W97 A;  4AC6 A;  1UI6 A;  1BJZ A;  2XGC A;  2W53 A;  2NP5 A;  2DG7 A;  3FK7 A;  4MK6 A;  3RD3 A;  2G7S A;  4GCL A;  3ON4 A;  3DCF A;  2ID3 A;  2FJ1 A;  5F27 A;  2RHA A;  2X9D A;  5CXI A;  3FRQ A;  5FKK A;  3VOK A;  3C07 A;  2OI8 A;  2IEK A;  2IU5 A;  3VVX A;  5EFY A;  5C4Y A;  3CRJ A;  2REK A;  4AC0 A;  2G3B A;  3PPB A;  4B3A A;  3Q0V A;  4GFL A;  2XPU A;  1JUM A;  2O7T A;  1VI0 A;  1JT0 A;  5D1R A;  4YZE A;  1QPI A;  2QKO A;  2NX4 A;  2NP3 A;  2NS8 A;  5EZH A;  4CGR A;  5EYR A;  5FKL A;  3EGQ A;  3WHC A;  4JL3 A;  3CDL A;  3CWR A;  2JK3 A;  2IBD A;  1ZKG A;  3G7R A;  2VKV A;  3VVZ A;  1QVT A;  3BR5 A;  3IUV A;  3F0C A;  3DEW A;  2UXU A;  1SGM A;  2WUI A;  2OER A;  3B6C A;  2DG8 A;  4G12 A;  3HTJ A;  5IOY A;  4NEL A;  2Y31 A;  5D19 A;  5HAW A;  4D7N A;  3VW1 A;  4M3E A;  5F0C A;  4GCK A;  4AUX A;  2YVH A;  5CXG A;  3PAS A;  3HTH A;  5F08 A;  2FBQ A;  2TCT A;  4D5C A;  5DAJ A;  3ZQG A;  2QTQ A;  5IPA A;  1ORK A;  2JJ7 A;  5J1U A;  2UXI A;  4B1R A;  2G7G A;  3COL A;  3TP3 A;  3KNW A;  3Q0U A;  4HKU A;  3ZQH A;  3ANG A;  2Y30 A;  5IP6 A;  3BQY A;  3BT9 A;  2EH3 A;  5FGL A;  2XGE A;  1UI5 A;  2QWT A;  4D5F A;  2ZB9 A;  2OF7 A;  5FHP A;  5K7H A;  5F0H A;  2O7O A;  3CCY A;  3HTA A;  3CJD A;  4DW6 A;  2Y2Z A;  4JYK A;  4MO7 A;  2HKU A;  5FMP A;  2ZCM A;  3O8G A;  3KZ9 A;  4JNN A;  3ZQL A;  5EZG A;  3V6G A;  3HGY A;  3FK6 A;  2OPT A;  3HGG A;  1RPW A;  4AF5 A;  4XK4 A;  2I10 A;  3RH2 A;  4W1U A;  5GPC A;  4V2F A;  3KKC A;  2UXH A;  3LHQ A;  3GEU A;  4UDS A;  3ZQI A;  2QCO A;  3QBM A;  3SFI A;  2X6O A;  3VUQ A;  3F1B A;  5F0F A;  2XPW A;  3BJB A;  1RKW A;  4NN1 A;  3BR3 A;  3GZI A;  4GFK A;  3BR6 A;  1JTY A;  3QKX A;  3SDG A;  2UXO A;  5J1Y A;  2HYT A;  4GCT A;  3G56 A;  4ABZ A;  5FKM A;  3BTJ A;  5J3L A;  4ICH A;  3IH4 A;  2PBX A;  3Q0W A;  1JTX A;  4X1E A;  2D6Y A;  3DPJ A;  3VW2 A;  5F1J A;  2HYJ A;  2ZCN A;  2TRT A;  5AQC A;  2ZOY A;  2XRL A;  5FKN A;  2GUH A;  3VP5 A;  3HIM A;  2FD5 A;  1RKT A;  5HSZ A;  3MVP A;  5K58 A;  2XGD A;  2WGB A;  2UXP A;  3E7Q A;  1Z0X A;  3QPL A;  5J1R A;  1JT6 A;  2FQ4 A;  3BTL A;  4M3F A;  2G0E A;  3G1O A;  3VVY A;  4L62 A;  3NI7 A;  2ID6 A;  3BCG A;  4JKZ A;  3ZQF A;  3T6N A;  5GPA A;  1A6I A;  5HBU A;  5K7F A;  2V57 A;  2DTZ A;  3ON2 A;  3QQA A;  3ANP A;  4M3G A;  2HQ5 A;  4I6Z A;  3VIB A;  5H9T A;  3S5R A;  4KWA A;  3PM1 A;  1JUS A;  3VW0 A;  3AQT A;  3KKD A;  3VPR A;  3O60 A;  1Z77 A;  4ACI A;  2G7L A;  1QVU A;  3BHQ A;  3NNR A;  3LSJ A;  5IOZ A;  3TP0 A;  3BR0 A;  2RAS A;  3LJL A;  2FX0 A;  5K7Z A;  5CW8 A;  4I76 A;  2GFN A;  3Q3S A;  2VKE A;  2XDN A;  3WHB A;  2PZ9 A;  3BRU A;  2QOP A;  4V2G A;  2NS7 A;  3G1M A;  3NXC A;  2XPV A;  3EUP A;  3LOC A;  3B81 A;  2YVE A;  1JUP A;  3IH3 A;  3NPI A;  4M3D A;  3G1L A;  5GP9 A;  4D7M A;  5FKO A;  2IAI A;  4M3B A;  5D18 A;  3LWJ A;  3AQS A;  3QPS A;  3BQZ A;  3IH2 A;  2ZOZ A;  3FIW A;  2WV1 A;  2VPR A;  2RAE A;  3BR2 A;  3NRG A;  2QIB A;  3V78 A;  1T33 A;  3O8H A;  5F04 A;  3BNI A;  2GBY A;  2XB5 A;  2ZCX A;  3BTI A;  4MXM A;  1ZK8 A;  2F07 A;  3MNL A;  3HE0 A;  3C2B A;  2GEN A;  3VOX A;  3B6A A;  3LSP A;  4ME9 A;  3LSR A;  2HXI A;  3JSJ A;  4PXI A;  3HTI A;  2Q24 A;  2HXO A;  1U9N A;  3BR1 A;  3BTC A;  3P9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...