3RH2A

Crystal structure of a tetr-like transcriptional regulator (sama_0099) from shewanella amazonensis sb2b at 2.42 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
210
structure length
210
Chain Sequence
b'MKTRDKIIQASLELFNEHGERTITTNHIAAHLDISPGNLYYHFRNKEDIIRCIFDQYEQHLLLGFKPYADQKVDLELLMSYFDAMFYTMWQFRFMYANLADILARDDTLKARYLKVQQAVLEQSIAVLNQLKKDGILQIEDERIADLADTIKMIIGFWISYKLTQSSIATISKASLYEGLLRVLMIFKAYSTPDSLANFDRLEQHFRSQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical TetR-like transcriptional regulator
molecule tags Dna binding protein
source organism Shewanella amazonensis
publication title Crystal structure of a Hypothetical TetR-like transcriptional regulator (Sama_0099) from SHEWANELLA AMAZONENSIS SB2B at 2.42 A resolution
rcsb
total genus 75
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13972 TetR Bacterial transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3rh2A00
3QKXA 2O7TA 3VUQA 3LWJA 2XPWA 1JTXA 3IH4A 1JUPA 2NS7A 4G12A 5EZGA 5DAJA 3O8GA 1JUMA 3EGQA 2TCTA 3C2BA 4CGRA 3HTAA 3TP0A 2IAIA 3HIMA 5EYRA 4JKZA 5HSZA 4X1EA 1UI6A 3FIWA 3BR0A 3Q0WA 3PPBA 2XDNA 3NNRA 3FK7A 3IUVA 3BTCA 3BR1A 2FJ1A 4B1RA 4D5FA 4MXMA 5CW8A 4NN1A 5GPAA 2Y30A 4ICHA 2JK3A 2HYTA 2TRTA 2UXUA 5F1JA 3V6GA 3WHCA 5FMPA 1ZK8A 2ID3A 5IP6A 1QPIA 3VW1A 2HKUA 3BTJA 3GZIA 3VPRA 5D18A 2REKA 3AQSA 3B6CA 1ZKGA 2YVEA 4ACIA 4PXIA 3CDLA 2RASA 3G1MA 1QVTA 3LJLA 2G3BA 4M3FA 3HTJA 3VVZA 3E7QA 3Q3SA 3ON2A 2XRLA 5J1UA 4GFKA 2XGEA 4KWAA 2OF7A 3RH2A 2EH3A 3KKDA 3KZ9A 5J3LA 2RAEA 2PZ9A 3CJDA 3QPLA 2OERA 4I6ZA 3VW0A 5H9TA 4D5CA 5K58A 3RD3A 2DTZA 3BR5A 3VVYA 1QVUA 2ZCMA 3B6AA 2ZOYA 5FKKA 2Q24A 3DPJA 2OPTA 3SDGA 3BQZA 3ZQLA 2UXIA 5D19A 4AUXA 5K7FA 2HYJA 3V78A 2XB5A 4JNNA 4W1UA 5GPCA 3NRGA 3BNIA 5EFYA 3BT9A 3LSRA 2XGCA 4MO7A 2O7OA 3BTLA 1JTYA 2QKOA 2ZOZA 3MVPA 2ZCNA 3NXCA 2JJ7A 2UXHA 2G7SA 3NI7A 2D6YA 4AC0A 1A6IA 3AQTA 3ZQIA 1UI5A 2IU5A 2G7GA 1JT6A 3BR3A 5GP9A 4GCLA 3VP5A 5CXIA 4ME9A 4UDSA 3G1OA 2FQ4A 2V57A 2ZCXA 4M3GA 3HTHA 2F07A 3HTIA 2G7LA 3C07A 2FD5A 5IPAA 3G56A 4HKUA 2GBYA 2YVHA 3O8HA 3VVXA 3ZQGA 5CXGA 3IH2A 4M3BA 4ABZA 3O60A 4D7NA 4YZEA 3IH3A 1RKTA 2NP3A 4M3EA 2WV1A 2UXPA 4W97A 3BR6A 1U9OA 5K7HA 4GFLA 3TP3A 1ORKA 1SGMA 4M3DA 3LSPA 4I76A 4B3AA 2HXOA 3ZQFA 2VKEA 3ZQHA 4JL3A 2GUHA 3G7RA 2XPUA 5FKLA 3T6NA 3ANGA 3BCGA 3GEUA 5EZHA 5J1RA 4JYKA 2NS8A 5K7ZA 2Y2ZA 3BHQA 5AQCA 3PM1A 2QTQA 3MNLA 3F0CA 3QQAA 4V2GA 2VKVA 2RHAA 1JT0A 2ZB9A 5FKOA 2DG7A 3P9TA 3B81A 5F08A 4D7MA 3VIBA 2OI8A 2NP5A 3PASA 1JUSA 3LOCA 3WHBA 5F0HA 4V2FA 3VW2A 5F27A 5FKMA 3F1BA 2WGBA 2DG8A 5F0FA 4AF5A 2IEKA 1T33A 1U9NA 1VI0A 3DCFA 2XPVA 4DW6A 4L62A 2PBXA 5FGLA 5D1RA 3VOXA 5F04A 3FK6A 3SFIA 3S5RA 2I10A 3BR2A 2IBDA 3BTIA 1Z77A 2QWTA 3COLA 1T56A 3LHQA 5C4YA 3Q0VA 3FRQA 3BRUA 2X9DA 3BJBA 4XK4A 3Q0UA 3KKCA 5IOYA 2QIBA 1RPWA 3G1LA 3KNWA 5IOZA 3NPIA 2FX0A 3DEWA 2QOPA 3JSJA 2GFNA 2G0EA 2VPRA 1Z0XA 3HGGA 2ID6A 2HXIA 2W53A 3CCYA 3CRJA 3EUPA 2Y31A 2FBQA 2QCOA 2UXOA 3LSJA 3QBMA 5FHPA 3CWRA 1RKWA 3ANPA 5HBUA 2NX4A 3HGYA 5J1YA 2XGDA 4NELA 4GCKA 5F0CA 4MK6A 4AC6A 1BJZA 2GENA 4GCTA 3BQYA 3HE0A 3ON4A 3QPSA 3VOKA 2WUIA 2X6OA 5HAWA 5FKNA 2HQ5A
chains in the Genus database with same CATH superfamily
3QKXA 2O7TA 4OD5A 2A2FX 3VUQA 3LWJA 2XPWA 1JTXA 3IH4A 1JUPA 2NS7A 4G12A 5EZGA 5DAJA 3O8GA 1JUMA 2B3WA 3EGQA 2YVXA 2TCTA 3C2BA 4CGRA 3HTAA 3TP0A 3VTIA 2IAIA 2R7UA 3HIMA 5EYRA 4JKZA 5HSZA 3SWHA 4X1EA 1UI6A 3FIWA 3K8PC 3BR0A 3Q0WA 3PPBA 2XDNA 2PFVA 3NNRA 3FK7A 3IUVA 3BTCA 3BR1A 2R7RA 2FJ1A 4B1RA 4D5FA 4MXMA 5CW8A 4NN1A 5GPAA 3NS4A 2Y30A 4ICHA 2JK3A 2HYTA 2TRTA 2UXUA 5F1JA 3V6GA 3WHCA 5FMPA 3DU6A 1ZK8A 2ID3A 5IP6A 1QPIA 3VW1A 2HKUA 3BTJA 3GZIA 3VPRA 5D18A 2REKA 3AQSA 3B6CA 4U9LA 1ZKGA 2YVEA 4OD4A 4ACIA 3FHNA 4PXIA 3CDLA 2R7QA 2RASA 3G1MA 1QVTA 3LJLA 2G3BA 4M3FA 3HTJA 3VVZA 3E7QA 3Q3SA 3ON2A 2XRLA 5J1UA 4GFKA 2XGEA 4KWAA 2OF7A 3RH2A 2EH3A 3KKDA 3KZ9A 5J3LA 2RAEA 2PZ9A 3CJDA 3QPLA 2OERA 4C2MA 4I6ZA 3VW0A 5H9TA 4D5CA 5K58A 3RD3A 2DTZA 3BR5A 3VVYA 1QVUA 2ZCMA 3B6AA 2ZOYA 5FKKA 2Q24A 3DPJA 2OPTA 3SDGA 3BQZA 3ZQLA 2UXIA 5D19A 4AUXA 5K7FA 2R7VA 2HYJA 3V78A 2XB5A 4JNNA 4W1UA 5GPCA 3NRGA 3BNIA 5EFYA 3BT9A 3LSRA 2XGCA 4MO7A 2O7OA 2ZY9A 3BTLA 1JTYA 2QKOA 2ZOZA 3MVPA 2ZCNA 3NXCA 2JJ7A 2UXHA 2G7SA 3NI7A 2D6YA 4AC0A 1A6IA 3AQTA 3ZQIA 1UI5A 2IU5A 2G7GA 1JT6A 3BR3A 5GP9A 4GCLA 3VP5A 5CXIA 4ME9A 4UDSA 3G1OA 2FQ4A 2R7XA 2R7TA 2V57A 2ZCXA 4M3GA 3HTHA 2F07A 3HTIA 2G7LA 3C07A 2FD5A 5IPAA 3G56A 4HKUA 2GBYA 2YVHA 3O8HA 3VVXA 3ZQGA 5CXGA 3IH2A 4M3BA 4ABZA 3O60A 4D7NA 4YZEA 3KYLA 3IH3A 1RKTA 2NP3A 4M3EA 2WV1A 2UXPA 4W97A 3BR6A 1U9OA 5K7HA 4GFLA 3TP3A 1ORKA 1SGMA 4M3DA 3LSPA 4I76A 4B3AA 2HXOA 2R7WA 3ZQFA 2VKEA 3ZQHA 4JL3A 2GUHA 3G7RA 2XPUA 5FKLA 3T6NA 3ANGA 3BCGA 3GEUA 5EZHA 5J1RA 4JYKA 2NS8A 4DVYP 5K7ZA 2Y2ZA 3BHQA 5AQCA 3PM1A 2QTQA 3MNLA 3F0CA 3QQAA 4V2GA 2VKVA 2RHAA 1JT0A 2ZB9A 5FKOA 2DG7A 2B1EA 3P9TA 3B81A 5F08A 4D7MA 3VIBA 2OI8A 2NP5A 3PASA 1JUSA 3LOCA 3WHBA 5F0HA 4V2FA 3VW2A 5F27A 5FKMA 3F1BA 2WGBA 2DG8A 5F0FA 4AF5A 2IEKA 1T33A 1U9NA 4U9NA 1VI0A 3DCFA 2XPVA 4DW6A 4L62A 2PBXA 3DU5A 5FGLA 5CQGA 5D1RA 3VOXA 5F04A 3FK6A 3SFIA 2FJI1 3S5RA 2I10A 3BR2A 2IBDA 3BTIA 4IRVA 1Z77A 2QWTA 3COLA 1T56A 3LHQA 5C4YA 3Q0VA 3FRQA 3BRUA 2X9DA 3BJBA 4XK4A 3Q0UA 3KKCA 5IOYA 2QIBA 1RPWA 3G1LA 3KNWA 5IOZA 3NPIA 2FX0A 3DEWA 2QOPA 3JSJA 2GFNA 2G0EA 2VPRA 1Z0XA 3HGGA 2ID6A 2HXIA 2W53A 3CCYA 3CRJA 3EUPA 2Y31A 2FBQA 2QCOA 2UXOA 3LSJA 3QBMA 5FHPA 2R7SA 3CWRA 1RKWA 3ANPA 5HBUA 2R7OA 2NX4A 3HGYA 5J1YA 2XGDA 4NELA 4GCKA 4WIBA 5F0CA 4MK6A 4AC6A 1BJZA 2GENA 4GCTA 3BQYA 3HE0A 3ON4A 3QPSA 3VOKA 2WUIA 2X6OA 5HAWA 5FKNA 2HQ5A
chains in the Genus database with same CATH topology
3QKXA 2O7TA 3VUQA 3LWJA 2XPWA 1JTXA 3IH4A 1JUPA 2NS7A 4G12A 5EZGA 5DAJA 3O8GA 1JUMA 3EGQA 2TCTA 3C2BA 4CGRA 3HTAA 3TP0A 2IAIA 3HIMA 5EYRA 4JKZA 5HSZA 4X1EA 1UI6A 3FIWA 3BR0A 3Q0WA 3PPBA 2XDNA 3NNRA 3FK7A 3IUVA 3BTCA 3BR1A 2FJ1A 4B1RA 4D5FA 4MXMA 5CW8A 4NN1A 5GPAA 2Y30A 4ICHA 2JK3A 2HYTA 2TRTA 2UXUA 5F1JA 3V6GA 3WHCA 5FMPA 1ZK8A 2ID3A 5IP6A 1QPIA 3VW1A 2HKUA 3BTJA 3GZIA 3VPRA 5D18A 2REKA 3AQSA 3B6CA 1ZKGA 2YVEA 4ACIA 4PXIA 3CDLA 2RASA 3G1MA 1QVTA 3LJLA 2G3BA 4M3FA 3HTJA 3VVZA 3E7QA 3Q3SA 3ON2A 2XRLA 5J1UA 4GFKA 2XGEA 4KWAA 2OF7A 3RH2A 2EH3A 3KKDA 3KZ9A 5J3LA 2RAEA 2PZ9A 3CJDA 3QPLA 2OERA 4I6ZA 3VW0A 5H9TA 4D5CA 5K58A 3RD3A 2DTZA 3BR5A 3VVYA 1QVUA 2ZCMA 3B6AA 2ZOYA 5FKKA 2Q24A 3DPJA 2OPTA 3SDGA 3BQZA 3ZQLA 2UXIA 5D19A 4AUXA 5K7FA 2HYJA 3V78A 2XB5A 4JNNA 4W1UA 5GPCA 3NRGA 3BNIA 5EFYA 3BT9A 3LSRA 2XGCA 4MO7A 2O7OA 3BTLA 1JTYA 2QKOA 2ZOZA 3MVPA 2ZCNA 3NXCA 2JJ7A 2UXHA 2G7SA 3NI7A 2D6YA 4AC0A 1A6IA 3AQTA 3ZQIA 1UI5A 2IU5A 2G7GA 1JT6A 3BR3A 5GP9A 4GCLA 3VP5A 5CXIA 4ME9A 4UDSA 3G1OA 2FQ4A 2V57A 2ZCXA 4M3GA 3HTHA 2F07A 3HTIA 2G7LA 3C07A 2FD5A 5IPAA 3G56A 4HKUA 2GBYA 2YVHA 3O8HA 3VVXA 3ZQGA 5CXGA 3IH2A 4M3BA 4ABZA 3O60A 4D7NA 4YZEA 3IH3A 1RKTA 2NP3A 4M3EA 2WV1A 2UXPA 4W97A 3BR6A 1U9OA 5K7HA 4GFLA 3TP3A 1ORKA 1SGMA 4M3DA 3LSPA 4I76A 4B3AA 2HXOA 3ZQFA 2VKEA 3ZQHA 4JL3A 2GUHA 3G7RA 2XPUA 5FKLA 3T6NA 3ANGA 3BCGA 3GEUA 5EZHA 5J1RA 4JYKA 2NS8A 5K7ZA 2Y2ZA 3BHQA 5AQCA 3PM1A 2QTQA 3MNLA 3F0CA 3QQAA 4V2GA 2VKVA 2RHAA 1JT0A 2ZB9A 5FKOA 2DG7A 3P9TA 3B81A 5F08A 4D7MA 3VIBA 2OI8A 2NP5A 3PASA 1JUSA 3LOCA 3WHBA 5F0HA 4V2FA 3VW2A 5F27A 5FKMA 3F1BA 2WGBA 2DG8A 5F0FA 4AF5A 2IEKA 1T33A 1U9NA 1VI0A 3DCFA 2XPVA 4DW6A 4L62A 2PBXA 5FGLA 5D1RA 3VOXA 5F04A 3FK6A 3SFIA 3S5RA 2I10A 3BR2A 2IBDA 3BTIA 1Z77A 2QWTA 3COLA 1T56A 3LHQA 5C4YA 3Q0VA 3FRQA 3BRUA 2X9DA 3BJBA 4XK4A 3Q0UA 3KKCA 5IOYA 2QIBA 1RPWA 3G1LA 3KNWA 5IOZA 3NPIA 2FX0A 3DEWA 2QOPA 3JSJA 2GFNA 2G0EA 2VPRA 1Z0XA 3HGGA 2ID6A 2HXIA 2W53A 3CCYA 3CRJA 3EUPA 2Y31A 2FBQA 2QCOA 2UXOA 3LSJA 3QBMA 5FHPA 3CWRA 1RKWA 3ANPA 5HBUA 2NX4A 3HGYA 5J1YA 2XGDA 4NELA 4GCKA 5F0CA 4MK6A 4AC6A 1BJZA 2GENA 4GCTA 3BQYA 3HE0A 3ON4A 3QPSA 3VOKA 2WUIA 2X6OA 5HAWA 5FKNA 2HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKX A;  2O7T A;  3VUQ A;  3LWJ A;  2XPW A;  1JTX A;  3IH4 A;  1JUP A;  2NS7 A;  4G12 A;  5EZG A;  5DAJ A;  3O8G A;  1JUM A;  3EGQ A;  2TCT A;  3C2B A;  4CGR A;  3HTA A;  3TP0 A;  2IAI A;  3HIM A;  5EYR A;  4JKZ A;  5HSZ A;  4X1E A;  1UI6 A;  3FIW A;  3BR0 A;  3Q0W A;  3PPB A;  2XDN A;  3NNR A;  3FK7 A;  3IUV A;  3BTC A;  3BR1 A;  2FJ1 A;  4B1R A;  4D5F A;  4MXM A;  5CW8 A;  4NN1 A;  5GPA A;  2Y30 A;  4ICH A;  2JK3 A;  2HYT A;  2TRT A;  2UXU A;  5F1J A;  3V6G A;  3WHC A;  5FMP A;  1ZK8 A;  2ID3 A;  5IP6 A;  1QPI A;  3VW1 A;  2HKU A;  3BTJ A;  3GZI A;  3VPR A;  5D18 A;  2REK A;  3AQS A;  3B6C A;  1ZKG A;  2YVE A;  4ACI A;  4PXI A;  3CDL A;  2RAS A;  3G1M A;  1QVT A;  3LJL A;  2G3B A;  4M3F A;  3HTJ A;  3VVZ A;  3E7Q A;  3Q3S A;  3ON2 A;  2XRL A;  5J1U A;  4GFK A;  2XGE A;  4KWA A;  2OF7 A;  3RH2 A;  2EH3 A;  3KKD A;  3KZ9 A;  5J3L A;  2RAE A;  2PZ9 A;  3CJD A;  3QPL A;  2OER A;  4I6Z A;  3VW0 A;  5H9T A;  4D5C A;  5K58 A;  3RD3 A;  2DTZ A;  3BR5 A;  3VVY A;  1QVU A;  2ZCM A;  3B6A A;  2ZOY A;  5FKK A;  2Q24 A;  3DPJ A;  2OPT A;  3SDG A;  3BQZ A;  3ZQL A;  2UXI A;  5D19 A;  4AUX A;  5K7F A;  2HYJ A;  3V78 A;  2XB5 A;  4JNN A;  4W1U A;  5GPC A;  3NRG A;  3BNI A;  5EFY A;  3BT9 A;  3LSR A;  2XGC A;  4MO7 A;  2O7O A;  3BTL A;  1JTY A;  2QKO A;  2ZOZ A;  3MVP A;  2ZCN A;  3NXC A;  2JJ7 A;  2UXH A;  2G7S A;  3NI7 A;  2D6Y A;  4AC0 A;  1A6I A;  3AQT A;  3ZQI A;  1UI5 A;  2IU5 A;  2G7G A;  1JT6 A;  3BR3 A;  5GP9 A;  4GCL A;  3VP5 A;  5CXI A;  4ME9 A;  4UDS A;  3G1O A;  2FQ4 A;  2V57 A;  2ZCX A;  4M3G A;  3HTH A;  2F07 A;  3HTI A;  2G7L A;  3C07 A;  2FD5 A;  5IPA A;  3G56 A;  4HKU A;  2GBY A;  2YVH A;  3O8H A;  3VVX A;  3ZQG A;  5CXG A;  3IH2 A;  4M3B A;  4ABZ A;  3O60 A;  4D7N A;  4YZE A;  3IH3 A;  1RKT A;  2NP3 A;  4M3E A;  2WV1 A;  2UXP A;  4W97 A;  3BR6 A;  1U9O A;  5K7H A;  4GFL A;  3TP3 A;  1ORK A;  1SGM A;  4M3D A;  3LSP A;  4I76 A;  4B3A A;  2HXO A;  3ZQF A;  2VKE A;  3ZQH A;  4JL3 A;  2GUH A;  3G7R A;  2XPU A;  5FKL A;  3T6N A;  3ANG A;  3BCG A;  3GEU A;  5EZH A;  5J1R A;  4JYK A;  2NS8 A;  5K7Z A;  2Y2Z A;  3BHQ A;  5AQC A;  3PM1 A;  2QTQ A;  3MNL A;  3F0C A;  3QQA A;  4V2G A;  2VKV A;  2RHA A;  1JT0 A;  2ZB9 A;  5FKO A;  2DG7 A;  3P9T A;  3B81 A;  5F08 A;  4D7M A;  3VIB A;  2OI8 A;  2NP5 A;  3PAS A;  1JUS A;  3LOC A;  3WHB A;  5F0H A;  4V2F A;  3VW2 A;  5F27 A;  5FKM A;  3F1B A;  2WGB A;  2DG8 A;  5F0F A;  4AF5 A;  2IEK A;  1T33 A;  1U9N A;  1VI0 A;  3DCF A;  2XPV A;  4DW6 A;  4L62 A;  2PBX A;  5FGL A;  5D1R A;  3VOX A;  5F04 A;  3FK6 A;  3SFI A;  3S5R A;  2I10 A;  3BR2 A;  2IBD A;  3BTI A;  1Z77 A;  2QWT A;  3COL A;  1T56 A;  3LHQ A;  5C4Y A;  3Q0V A;  3FRQ A;  3BRU A;  2X9D A;  3BJB A;  4XK4 A;  3Q0U A;  3KKC A;  5IOY A;  2QIB A;  1RPW A;  3G1L A;  3KNW A;  5IOZ A;  3NPI A;  2FX0 A;  3DEW A;  2QOP A;  3JSJ A;  2GFN A;  2G0E A;  2VPR A;  1Z0X A;  3HGG A;  2ID6 A;  2HXI A;  2W53 A;  3CCY A;  3CRJ A;  3EUP A;  2Y31 A;  2FBQ A;  2QCO A;  2UXO A;  3LSJ A;  3QBM A;  5FHP A;  3CWR A;  1RKW A;  3ANP A;  5HBU A;  2NX4 A;  3HGY A;  5J1Y A;  2XGD A;  4NEL A;  4GCK A;  5F0C A;  4MK6 A;  4AC6 A;  1BJZ A;  2GEN A;  4GCT A;  3BQY A;  3HE0 A;  3ON4 A;  3QPS A;  3VOK A;  2WUI A;  2X6O A;  5HAW A;  5FKN A;  2HQ5 A; 
#chains in the Genus database with same CATH topology
 3QKX A;  2O7T A;  4OD5 A;  2A2F X;  3VUQ A;  3LWJ A;  2XPW A;  1JTX A;  3IH4 A;  1JUP A;  2NS7 A;  4G12 A;  5EZG A;  5DAJ A;  3O8G A;  1JUM A;  2B3W A;  3EGQ A;  2YVX A;  2TCT A;  3C2B A;  4CGR A;  3HTA A;  3TP0 A;  3VTI A;  2IAI A;  2R7U A;  3HIM A;  5EYR A;  4JKZ A;  5HSZ A;  3SWH A;  4X1E A;  1UI6 A;  3FIW A;  3K8P C;  3BR0 A;  3Q0W A;  3PPB A;  2XDN A;  2PFV A;  3NNR A;  3FK7 A;  3IUV A;  3BTC A;  3BR1 A;  2R7R A;  2FJ1 A;  4B1R A;  4D5F A;  4MXM A;  5CW8 A;  4NN1 A;  5GPA A;  3NS4 A;  2Y30 A;  4ICH A;  2JK3 A;  2HYT A;  2TRT A;  2UXU A;  5F1J A;  3V6G A;  3WHC A;  5FMP A;  3DU6 A;  1ZK8 A;  2ID3 A;  5IP6 A;  1QPI A;  3VW1 A;  2HKU A;  3BTJ A;  3GZI A;  3VPR A;  5D18 A;  2REK A;  3AQS A;  3B6C A;  4U9L A;  1ZKG A;  2YVE A;  4OD4 A;  4ACI A;  3FHN A;  4PXI A;  3CDL A;  2R7Q A;  2RAS A;  3G1M A;  1QVT A;  3LJL A;  2G3B A;  4M3F A;  3HTJ A;  3VVZ A;  3E7Q A;  3Q3S A;  3ON2 A;  2XRL A;  5J1U A;  4GFK A;  2XGE A;  4KWA A;  2OF7 A;  3RH2 A;  2EH3 A;  3KKD A;  3KZ9 A;  5J3L A;  2RAE A;  2PZ9 A;  3CJD A;  3QPL A;  2OER A;  4C2M A;  4I6Z A;  3VW0 A;  5H9T A;  4D5C A;  5K58 A;  3RD3 A;  2DTZ A;  3BR5 A;  3VVY A;  1QVU A;  2ZCM A;  3B6A A;  2ZOY A;  5FKK A;  2Q24 A;  3DPJ A;  2OPT A;  3SDG A;  3BQZ A;  3ZQL A;  2UXI A;  5D19 A;  4AUX A;  5K7F A;  2R7V A;  2HYJ A;  3V78 A;  2XB5 A;  4JNN A;  4W1U A;  5GPC A;  3NRG A;  3BNI A;  5EFY A;  3BT9 A;  3LSR A;  2XGC A;  4MO7 A;  2O7O A;  2ZY9 A;  3BTL A;  1JTY A;  2QKO A;  2ZOZ A;  3MVP A;  2ZCN A;  3NXC A;  2JJ7 A;  2UXH A;  2G7S A;  3NI7 A;  2D6Y A;  4AC0 A;  1A6I A;  3AQT A;  3ZQI A;  1UI5 A;  2IU5 A;  2G7G A;  1JT6 A;  3BR3 A;  5GP9 A;  4GCL A;  3VP5 A;  5CXI A;  4ME9 A;  4UDS A;  3G1O A;  2FQ4 A;  2R7X A;  2R7T A;  2V57 A;  2ZCX A;  4M3G A;  3HTH A;  2F07 A;  3HTI A;  2G7L A;  3C07 A;  2FD5 A;  5IPA A;  3G56 A;  4HKU A;  2GBY A;  2YVH A;  3O8H A;  3VVX A;  3ZQG A;  5CXG A;  3IH2 A;  4M3B A;  4ABZ A;  3O60 A;  4D7N A;  4YZE A;  3KYL A;  3IH3 A;  1RKT A;  2NP3 A;  4M3E A;  2WV1 A;  2UXP A;  4W97 A;  3BR6 A;  1U9O A;  5K7H A;  4GFL A;  3TP3 A;  1ORK A;  1SGM A;  4M3D A;  3LSP A;  4I76 A;  4B3A A;  2HXO A;  2R7W A;  3ZQF A;  2VKE A;  3ZQH A;  4JL3 A;  2GUH A;  3G7R A;  2XPU A;  5FKL A;  3T6N A;  3ANG A;  3BCG A;  3GEU A;  5EZH A;  5J1R A;  4JYK A;  2NS8 A;  4DVY P;  5K7Z A;  2Y2Z A;  3BHQ A;  5AQC A;  3PM1 A;  2QTQ A;  3MNL A;  3F0C A;  3QQA A;  4V2G A;  2VKV A;  2RHA A;  1JT0 A;  2ZB9 A;  5FKO A;  2DG7 A;  2B1E A;  3P9T A;  3B81 A;  5F08 A;  4D7M A;  3VIB A;  2OI8 A;  2NP5 A;  3PAS A;  1JUS A;  3LOC A;  3WHB A;  5F0H A;  4V2F A;  3VW2 A;  5F27 A;  5FKM A;  3F1B A;  2WGB A;  2DG8 A;  5F0F A;  4AF5 A;  2IEK A;  1T33 A;  1U9N A;  4U9N A;  1VI0 A;  3DCF A;  2XPV A;  4DW6 A;  4L62 A;  2PBX A;  3DU5 A;  5FGL A;  5CQG A;  5D1R A;  3VOX A;  5F04 A;  3FK6 A;  3SFI A;  2FJI 1;  3S5R A;  2I10 A;  3BR2 A;  2IBD A;  3BTI A;  4IRV A;  1Z77 A;  2QWT A;  3COL A;  1T56 A;  3LHQ A;  5C4Y A;  3Q0V A;  3FRQ A;  3BRU A;  2X9D A;  3BJB A;  4XK4 A;  3Q0U A;  3KKC A;  5IOY A;  2QIB A;  1RPW A;  3G1L A;  3KNW A;  5IOZ A;  3NPI A;  2FX0 A;  3DEW A;  2QOP A;  3JSJ A;  2GFN A;  2G0E A;  2VPR A;  1Z0X A;  3HGG A;  2ID6 A;  2HXI A;  2W53 A;  3CCY A;  3CRJ A;  3EUP A;  2Y31 A;  2FBQ A;  2QCO A;  2UXO A;  3LSJ A;  3QBM A;  5FHP A;  2R7S A;  3CWR A;  1RKW A;  3ANP A;  5HBU A;  2R7O A;  2NX4 A;  3HGY A;  5J1Y A;  2XGD A;  4NEL A;  4GCK A;  4WIB A;  5F0C A;  4MK6 A;  4AC6 A;  1BJZ A;  2GEN A;  4GCT A;  3BQY A;  3HE0 A;  3ON4 A;  3QPS A;  3VOK A;  2WUI A;  2X6O A;  5HAW A;  5FKN A;  2HQ5 A; 
#chains in the Genus database with same CATH homology
 3QKX A;  2O7T A;  3VUQ A;  3LWJ A;  2XPW A;  1JTX A;  3IH4 A;  1JUP A;  2NS7 A;  4G12 A;  5EZG A;  5DAJ A;  3O8G A;  1JUM A;  3EGQ A;  2TCT A;  3C2B A;  4CGR A;  3HTA A;  3TP0 A;  2IAI A;  3HIM A;  5EYR A;  4JKZ A;  5HSZ A;  4X1E A;  1UI6 A;  3FIW A;  3BR0 A;  3Q0W A;  3PPB A;  2XDN A;  3NNR A;  3FK7 A;  3IUV A;  3BTC A;  3BR1 A;  2FJ1 A;  4B1R A;  4D5F A;  4MXM A;  5CW8 A;  4NN1 A;  5GPA A;  2Y30 A;  4ICH A;  2JK3 A;  2HYT A;  2TRT A;  2UXU A;  5F1J A;  3V6G A;  3WHC A;  5FMP A;  1ZK8 A;  2ID3 A;  5IP6 A;  1QPI A;  3VW1 A;  2HKU A;  3BTJ A;  3GZI A;  3VPR A;  5D18 A;  2REK A;  3AQS A;  3B6C A;  1ZKG A;  2YVE A;  4ACI A;  4PXI A;  3CDL A;  2RAS A;  3G1M A;  1QVT A;  3LJL A;  2G3B A;  4M3F A;  3HTJ A;  3VVZ A;  3E7Q A;  3Q3S A;  3ON2 A;  2XRL A;  5J1U A;  4GFK A;  2XGE A;  4KWA A;  2OF7 A;  3RH2 A;  2EH3 A;  3KKD A;  3KZ9 A;  5J3L A;  2RAE A;  2PZ9 A;  3CJD A;  3QPL A;  2OER A;  4I6Z A;  3VW0 A;  5H9T A;  4D5C A;  5K58 A;  3RD3 A;  2DTZ A;  3BR5 A;  3VVY A;  1QVU A;  2ZCM A;  3B6A A;  2ZOY A;  5FKK A;  2Q24 A;  3DPJ A;  2OPT A;  3SDG A;  3BQZ A;  3ZQL A;  2UXI A;  5D19 A;  4AUX A;  5K7F A;  2HYJ A;  3V78 A;  2XB5 A;  4JNN A;  4W1U A;  5GPC A;  3NRG A;  3BNI A;  5EFY A;  3BT9 A;  3LSR A;  2XGC A;  4MO7 A;  2O7O A;  3BTL A;  1JTY A;  2QKO A;  2ZOZ A;  3MVP A;  2ZCN A;  3NXC A;  2JJ7 A;  2UXH A;  2G7S A;  3NI7 A;  2D6Y A;  4AC0 A;  1A6I A;  3AQT A;  3ZQI A;  1UI5 A;  2IU5 A;  2G7G A;  1JT6 A;  3BR3 A;  5GP9 A;  4GCL A;  3VP5 A;  5CXI A;  4ME9 A;  4UDS A;  3G1O A;  2FQ4 A;  2V57 A;  2ZCX A;  4M3G A;  3HTH A;  2F07 A;  3HTI A;  2G7L A;  3C07 A;  2FD5 A;  5IPA A;  3G56 A;  4HKU A;  2GBY A;  2YVH A;  3O8H A;  3VVX A;  3ZQG A;  5CXG A;  3IH2 A;  4M3B A;  4ABZ A;  3O60 A;  4D7N A;  4YZE A;  3IH3 A;  1RKT A;  2NP3 A;  4M3E A;  2WV1 A;  2UXP A;  4W97 A;  3BR6 A;  1U9O A;  5K7H A;  4GFL A;  3TP3 A;  1ORK A;  1SGM A;  4M3D A;  3LSP A;  4I76 A;  4B3A A;  2HXO A;  3ZQF A;  2VKE A;  3ZQH A;  4JL3 A;  2GUH A;  3G7R A;  2XPU A;  5FKL A;  3T6N A;  3ANG A;  3BCG A;  3GEU A;  5EZH A;  5J1R A;  4JYK A;  2NS8 A;  5K7Z A;  2Y2Z A;  3BHQ A;  5AQC A;  3PM1 A;  2QTQ A;  3MNL A;  3F0C A;  3QQA A;  4V2G A;  2VKV A;  2RHA A;  1JT0 A;  2ZB9 A;  5FKO A;  2DG7 A;  3P9T A;  3B81 A;  5F08 A;  4D7M A;  3VIB A;  2OI8 A;  2NP5 A;  3PAS A;  1JUS A;  3LOC A;  3WHB A;  5F0H A;  4V2F A;  3VW2 A;  5F27 A;  5FKM A;  3F1B A;  2WGB A;  2DG8 A;  5F0F A;  4AF5 A;  2IEK A;  1T33 A;  1U9N A;  1VI0 A;  3DCF A;  2XPV A;  4DW6 A;  4L62 A;  2PBX A;  5FGL A;  5D1R A;  3VOX A;  5F04 A;  3FK6 A;  3SFI A;  3S5R A;  2I10 A;  3BR2 A;  2IBD A;  3BTI A;  1Z77 A;  2QWT A;  3COL A;  1T56 A;  3LHQ A;  5C4Y A;  3Q0V A;  3FRQ A;  3BRU A;  2X9D A;  3BJB A;  4XK4 A;  3Q0U A;  3KKC A;  5IOY A;  2QIB A;  1RPW A;  3G1L A;  3KNW A;  5IOZ A;  3NPI A;  2FX0 A;  3DEW A;  2QOP A;  3JSJ A;  2GFN A;  2G0E A;  2VPR A;  1Z0X A;  3HGG A;  2ID6 A;  2HXI A;  2W53 A;  3CCY A;  3CRJ A;  3EUP A;  2Y31 A;  2FBQ A;  2QCO A;  2UXO A;  3LSJ A;  3QBM A;  5FHP A;  3CWR A;  1RKW A;  3ANP A;  5HBU A;  2NX4 A;  3HGY A;  5J1Y A;  2XGD A;  4NEL A;  4GCK A;  5F0C A;  4MK6 A;  4AC6 A;  1BJZ A;  2GEN A;  4GCT A;  3BQY A;  3HE0 A;  3ON4 A;  3QPS A;  3VOK A;  2WUI A;  2X6O A;  5HAW A;  5FKN A;  2HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...