3RH2A

Crystal structure of a tetr-like transcriptional regulator (sama_0099) from shewanella amazonensis sb2b at 2.42 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
210
structure length
210
Chain Sequence
MKTRDKIIQASLELFNEHGERTITTNHIAAHLDISPGNLYYHFRNKEDIIRCIFDQYEQHLLLGFKPYADQKVDLELLMSYFDAMFYTMWQFRFMYANLADILARDDTLKARYLKVQQAVLEQSIAVLNQLKKDGILQIEDERIADLADTIKMIIGFWISYKLTQSSIATISKASLYEGLLRVLMIFKAYSTPDSLANFDRLEQHFRSQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical TetR-like transcriptional regulator (Sama_0099) from SHEWANELLA AMAZONENSIS SB2B at 2.42 A resolution
rcsb
source organism Shewanella amazonensis
molecule tags Dna binding protein
molecule keywords Hypothetical TetR-like transcriptional regulator
total genus 75
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13972 TetR Bacterial transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3rh2A00
3BHQA 2GENA 3CCYA 3NXCA 3BR3A 2NX4A 2WUIA 2ZOZA 4V2FA 2FD5A 3VVXA 1JTXA 2O7TA 2VPRA 2NS8A 2QCOA 3BJBA 5D18A 2ZCXA 1JT6A 4AF5A 4B1RA 4GFKA 1JT0A 5CXGA 3QQAA 2XPVA 3VPRA 2RHAA 5D1RA 1QVUA 3GEUA 3RH2A 2QIBA 3BNIA 3VVYA 3E7QA 3QBMA 1U9OA 3V6GA 3LSJA 2Y2ZA 2FQ4A 3B6AA 3PPBA 5F0HA 2G7SA 2UXHA 3Q3SA 5HSZA 2OPTA 2QTQA 4UDSA 3C07A 2HXIA 3ZQHA 4GCKA 2X6OA 3G7RA 1A6IA 5D19A 3WHCA 3LSRA 3ZQGA 3ON2A 3BQYA 4AC0A 3HE0A 2WV1A 1Z77A 4CGRA 3CJDA 2XGCA 2GUHA 2DG7A 2PZ9A 2XGEA 3O60A 5FKLA 1U9NA 4XK4A 3COLA 4M3DA 3IH3A 3DEWA 2VKVA 5DAJA 3MNLA 4M3GA 5F0FA 5J1UA 2DG8A 2UXPA 4MXMA 1T33A 4JNNA 1RKTA 3VOKA 3BR6A 5GPCA 3ANGA 3IUVA 2FJ1A 3HTJA 2RASA 2G7LA 5F0CA 1Z0XA 3SDGA 5J1RA 2XDNA 3F0CA 3MVPA 3C2BA 3PM1A 1T56A 2FBQA 2OF7A 4X1EA 2XGDA 3JSJA 3VW1A 3BTLA 4GFLA 2YVHA 3NNRA 2XB5A 3KKDA 2WGBA 3GZIA 4MK6A 3QKXA 5IPAA 3AQTA 2G0EA 5FMPA 4KWAA 4B3AA 5EYRA 3BQZA 2EH3A 2GFNA 3BTIA 3LHQA 3VW2A 2V57A 3LJLA 4YZEA 3VUQA 4I6ZA 2XPWA 4M3FA 2Q24A 2JK3A 3WHBA 2NP3A 3FRQA 4HKUA 1VI0A 2HYJA 4NN1A 5HAWA 3ZQLA 2ZCNA 1ZK8A 4JL3A 3BR1A 4L62A 3AQSA 1JUSA 2IBDA 3HTAA 2W53A 3B6CA 5F27A 5FHPA 4D5CA 5J1YA 4G12A 2XRLA 2REKA 1JTYA 3BTJA 3F1BA 3BRUA 2D6YA 3G1OA 3KNWA 5IOYA 3DPJA 4D7NA 3HGYA 2OI8A 1JUMA 3HTIA 1QPIA 2XPUA 3ANPA 2HXOA 5EFYA 3BR5A 3G1LA 4M3BA 3KZ9A 3EUPA 3TP0A 4PXIA 5IOZA 3T6NA 3CRJA 3Q0VA 2I10A 5FKNA 1ZKGA 3QPLA 1ORKA 2F07A 3Q0UA 5K7HA 5K7FA 5FKKA 5EZHA 3CDLA 2QKOA 5CXIA 3ZQIA 3FIWA 2G7GA 5CW8A 4D7MA 3G1MA 3O8HA 3BR0A 3BT9A 1QVTA 4AUXA 2QOPA 4NELA 2DTZA 4I76A 5IP6A 3VW0A 1RKWA 2NS7A 1UI5A 1UI6A 2NP5A 2HQ5A 3BR2A 2ZOYA 3V78A 5FGLA 4AC6A 5F1JA 3EGQA 5EZGA 3G56A 3HGGA 3TP3A 4MO7A 3NRGA 2X9DA 2HYTA 5FKOA 3VIBA 2FX0A 3S5RA 2JJ7A 2O7OA 3FK6A 3LWJA 3DCFA 3LSPA 2HKUA 3B81A 1BJZA 2TCTA 2GBYA 3NPIA 2Y31A 5K58A 4JKZA 2UXIA 3VVZA 3Q0WA 5GP9A 3BTCA 2QWTA 1RPWA 4W97A 3ON4A 5F04A 2ZCMA 2Y30A 4D5FA 5F08A 1JUPA 3IH2A 2IAIA 4ACIA 5K7ZA 4ABZA 2ID6A 5FKMA 5C4YA 3VOXA 3RD3A 4JYKA 3VP5A 4GCTA 3NI7A 5GPAA 3KKCA 2VKEA 2RAEA 2IEKA 3SFIA 2IU5A 3ZQFA 5H9TA 4DW6A 4GCLA 3BCGA 5HBUA 3O8GA 3HIMA 2G3BA 5J3LA 4ME9A 3PASA 3HTHA 3QPSA 2OERA 2ID3A 2UXUA 4W1UA 1SGMA 3FK7A 2ZB9A 3IH4A 4M3EA 2YVEA 3LOCA 5AQCA 3P9TA 4ICHA 3CWRA 2UXOA 2TRTA 2PBXA 4V2GA
chains in the Genus database with same CATH superfamily
3K8PC 3BHQA 2GENA 3CCYA 3NXCA 3BR3A 2NX4A 2WUIA 2ZOZA 4V2FA 2FD5A 3VVXA 1JTXA 2O7TA 2R7TA 2VPRA 2NS8A 2QCOA 3BJBA 5D18A 2ZCXA 1JT6A 4AF5A 4B1RA 4GFKA 1JT0A 3DU5A 5CXGA 3VTIA 3QQAA 2XPVA 3VPRA 2RHAA 5D1RA 1QVUA 3GEUA 3RH2A 2QIBA 3BNIA 4U9NA 3VVYA 3E7QA 3QBMA 1U9OA 3V6GA 3LSJA 2Y2ZA 2FQ4A 3B6AA 3PPBA 5F0HA 2G7SA 2R7WA 2UXHA 2ZY9A 3Q3SA 5HSZA 2OPTA 2QTQA 4UDSA 3C07A 2HXIA 3ZQHA 4GCKA 2X6OA 3G7RA 1A6IA 5D19A 3WHCA 3LSRA 3ZQGA 3ON2A 3BQYA 2R7RA 4AC0A 3HE0A 2WV1A 1Z77A 2YVXA 4CGRA 3CJDA 2XGCA 2GUHA 2DG7A 2PZ9A 2XGEA 3O60A 5FKLA 1U9NA 4XK4A 3COLA 4M3DA 3IH3A 3DEWA 2VKVA 5DAJA 3MNLA 4M3GA 5F0FA 5J1UA 2DG8A 2UXPA 2A2FX 4MXMA 1T33A 4JNNA 4U9LA 1RKTA 3VOKA 3BR6A 5GPCA 3ANGA 4C2MA 2R7UA 3IUVA 2FJ1A 3HTJA 2RASA 2G7LA 2R7QA 5F0CA 1Z0XA 3SDGA 5J1RA 2XDNA 3F0CA 3MVPA 3C2BA 3PM1A 1T56A 2FBQA 2OF7A 4X1EA 2XGDA 3JSJA 3VW1A 3BTLA 4GFLA 2YVHA 3NNRA 3DU6A 2XB5A 3KKDA 2WGBA 2PFVA 3GZIA 4MK6A 3QKXA 5IPAA 3AQTA 2G0EA 5FMPA 4KWAA 4B3AA 5EYRA 3BQZA 2EH3A 2GFNA 3BTIA 3LHQA 3VW2A 2V57A 3LJLA 4YZEA 3VUQA 2B3WA 4I6ZA 2B1EA 2XPWA 4M3FA 2Q24A 3SWHA 2JK3A 3WHBA 2NP3A 3FRQA 4HKUA 1VI0A 2HYJA 4NN1A 5HAWA 3ZQLA 2ZCNA 1ZK8A 4JL3A 3BR1A 4L62A 3AQSA 1JUSA 2IBDA 3HTAA 2W53A 3B6CA 5F27A 5FHPA 4D5CA 5J1YA 4G12A 2XRLA 4IRVA 2REKA 1JTYA 3BTJA 3F1BA 3BRUA 2D6YA 3G1OA 3KNWA 5IOYA 3DPJA 4D7NA 3HGYA 2OI8A 1JUMA 3HTIA 1QPIA 2XPUA 2R7OA 3ANPA 2HXOA 5EFYA 3BR5A 3G1LA 4M3BA 3KZ9A 3EUPA 3TP0A 4PXIA 5IOZA 2R7SA 2R7XA 3T6NA 3CRJA 3Q0VA 2I10A 5FKNA 1ZKGA 3QPLA 1ORKA 2F07A 3Q0UA 4DVYP 5K7FA 5K7HA 5FKKA 5EZHA 3CDLA 2QKOA 5CXIA 3ZQIA 3FIWA 2G7GA 5CW8A 4D7MA 3G1MA 3O8HA 3BR0A 3BT9A 1QVTA 4AUXA 2QOPA 4NELA 2DTZA 4I76A 5IP6A 3VW0A 1RKWA 2NS7A 3FHNA 1UI5A 1UI6A 2NP5A 3KYLA 2HQ5A 3BR2A 2ZOYA 3V78A 5FGLA 4AC6A 5F1JA 4OD5A 3EGQA 5EZGA 3G56A 3HGGA 3TP3A 4MO7A 3NRGA 2X9DA 2HYTA 5FKOA 3VIBA 2FX0A 3S5RA 2JJ7A 2O7OA 3FK6A 3LWJA 3DCFA 3LSPA 2HKUA 3B81A 4OD4A 1BJZA 2TCTA 2GBYA 3NPIA 2Y31A 4JKZA 5K58A 2UXIA 3VVZA 3Q0WA 5GP9A 3NS4A 3BTCA 2QWTA 1RPWA 4W97A 3ON4A 5F04A 2ZCMA 2Y30A 4D5FA 5F08A 1JUPA 2FJI1 2IAIA 3IH2A 4ACIA 5K7ZA 4ABZA 2ID6A 5FKMA 5C4YA 3VOXA 3RD3A 4JYKA 3VP5A 4GCTA 3NI7A 4WIBA 5GPAA 3KKCA 2VKEA 2RAEA 2IEKA 3SFIA 2IU5A 3ZQFA 5H9TA 4DW6A 4GCLA 3BCGA 5HBUA 3O8GA 3HIMA 2G3BA 5J3LA 4ME9A 3PASA 3HTHA 3QPSA 2OERA 2ID3A 2UXUA 5CQGA 4W1UA 1SGMA 3FK7A 2ZB9A 3IH4A 2R7VA 4M3EA 2YVEA 3LOCA 5AQCA 3P9TA 4ICHA 3CWRA 2UXOA 2TRTA 2PBXA 4V2GA
chains in the Genus database with same CATH topology
3BHQA 2GENA 3CCYA 3NXCA 3BR3A 2NX4A 2WUIA 2ZOZA 4V2FA 2FD5A 3VVXA 1JTXA 2O7TA 2VPRA 2NS8A 2QCOA 3BJBA 5D18A 2ZCXA 1JT6A 4AF5A 4B1RA 4GFKA 1JT0A 5CXGA 3QQAA 2XPVA 3VPRA 2RHAA 5D1RA 1QVUA 3GEUA 3RH2A 2QIBA 3BNIA 3VVYA 3E7QA 3QBMA 1U9OA 3V6GA 3LSJA 2Y2ZA 2FQ4A 3B6AA 3PPBA 5F0HA 2G7SA 2UXHA 3Q3SA 5HSZA 2OPTA 2QTQA 4UDSA 3C07A 2HXIA 3ZQHA 4GCKA 2X6OA 3G7RA 1A6IA 5D19A 3WHCA 3LSRA 3ZQGA 3ON2A 3BQYA 4AC0A 3HE0A 2WV1A 1Z77A 4CGRA 3CJDA 2XGCA 2GUHA 2DG7A 2PZ9A 2XGEA 3O60A 5FKLA 1U9NA 4XK4A 3COLA 4M3DA 3IH3A 3DEWA 2VKVA 5DAJA 3MNLA 4M3GA 5F0FA 5J1UA 2DG8A 2UXPA 4MXMA 1T33A 4JNNA 1RKTA 3VOKA 3BR6A 5GPCA 3ANGA 3IUVA 2FJ1A 3HTJA 2RASA 2G7LA 5F0CA 1Z0XA 3SDGA 5J1RA 2XDNA 3F0CA 3MVPA 3C2BA 3PM1A 1T56A 2FBQA 2OF7A 4X1EA 2XGDA 3JSJA 3VW1A 3BTLA 4GFLA 2YVHA 3NNRA 2XB5A 3KKDA 2WGBA 3GZIA 4MK6A 3QKXA 5IPAA 3AQTA 2G0EA 5FMPA 4KWAA 4B3AA 5EYRA 3BQZA 2EH3A 2GFNA 3BTIA 3LHQA 3VW2A 2V57A 3LJLA 4YZEA 3VUQA 4I6ZA 2XPWA 4M3FA 2Q24A 2JK3A 3WHBA 2NP3A 3FRQA 4HKUA 1VI0A 2HYJA 4NN1A 5HAWA 3ZQLA 2ZCNA 1ZK8A 4JL3A 3BR1A 4L62A 3AQSA 1JUSA 2IBDA 3HTAA 2W53A 3B6CA 5F27A 5FHPA 4D5CA 5J1YA 4G12A 2XRLA 2REKA 1JTYA 3BTJA 3F1BA 3BRUA 2D6YA 3G1OA 3KNWA 5IOYA 3DPJA 4D7NA 3HGYA 2OI8A 1JUMA 3HTIA 1QPIA 2XPUA 3ANPA 2HXOA 5EFYA 3BR5A 3G1LA 4M3BA 3KZ9A 3EUPA 3TP0A 4PXIA 5IOZA 3T6NA 3CRJA 3Q0VA 2I10A 5FKNA 1ZKGA 3QPLA 1ORKA 2F07A 3Q0UA 5K7HA 5K7FA 5FKKA 5EZHA 3CDLA 2QKOA 5CXIA 3ZQIA 3FIWA 2G7GA 5CW8A 4D7MA 3G1MA 3O8HA 3BR0A 3BT9A 1QVTA 4AUXA 2QOPA 4NELA 2DTZA 4I76A 5IP6A 3VW0A 1RKWA 2NS7A 1UI5A 1UI6A 2NP5A 2HQ5A 3BR2A 2ZOYA 3V78A 5FGLA 4AC6A 5F1JA 3EGQA 5EZGA 3G56A 3HGGA 3TP3A 4MO7A 3NRGA 2X9DA 2HYTA 5FKOA 3VIBA 2FX0A 3S5RA 2JJ7A 2O7OA 3FK6A 3LWJA 3DCFA 3LSPA 2HKUA 3B81A 1BJZA 2TCTA 2GBYA 3NPIA 2Y31A 5K58A 4JKZA 2UXIA 3VVZA 3Q0WA 5GP9A 3BTCA 2QWTA 1RPWA 4W97A 3ON4A 5F04A 2ZCMA 2Y30A 4D5FA 5F08A 1JUPA 3IH2A 2IAIA 4ACIA 5K7ZA 4ABZA 2ID6A 5FKMA 5C4YA 3VOXA 3RD3A 4JYKA 3VP5A 4GCTA 3NI7A 5GPAA 3KKCA 2VKEA 2RAEA 2IEKA 3SFIA 2IU5A 3ZQFA 5H9TA 4DW6A 4GCLA 3BCGA 5HBUA 3O8GA 3HIMA 2G3BA 5J3LA 4ME9A 3PASA 3HTHA 3QPSA 2OERA 2ID3A 2UXUA 4W1UA 1SGMA 3FK7A 2ZB9A 3IH4A 4M3EA 2YVEA 3LOCA 5AQCA 3P9TA 4ICHA 3CWRA 2UXOA 2TRTA 2PBXA 4V2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHQ A;  2GEN A;  3CCY A;  3NXC A;  3BR3 A;  2NX4 A;  2WUI A;  2ZOZ A;  4V2F A;  2FD5 A;  3VVX A;  1JTX A;  2O7T A;  2VPR A;  2NS8 A;  2QCO A;  3BJB A;  5D18 A;  2ZCX A;  1JT6 A;  4AF5 A;  4B1R A;  4GFK A;  1JT0 A;  5CXG A;  3QQA A;  2XPV A;  3VPR A;  2RHA A;  5D1R A;  1QVU A;  3GEU A;  3RH2 A;  2QIB A;  3BNI A;  3VVY A;  3E7Q A;  3QBM A;  1U9O A;  3V6G A;  3LSJ A;  2Y2Z A;  2FQ4 A;  3B6A A;  3PPB A;  5F0H A;  2G7S A;  2UXH A;  3Q3S A;  5HSZ A;  2OPT A;  2QTQ A;  4UDS A;  3C07 A;  2HXI A;  3ZQH A;  4GCK A;  2X6O A;  3G7R A;  1A6I A;  5D19 A;  3WHC A;  3LSR A;  3ZQG A;  3ON2 A;  3BQY A;  4AC0 A;  3HE0 A;  2WV1 A;  1Z77 A;  4CGR A;  3CJD A;  2XGC A;  2GUH A;  2DG7 A;  2PZ9 A;  2XGE A;  3O60 A;  5FKL A;  1U9N A;  4XK4 A;  3COL A;  4M3D A;  3IH3 A;  3DEW A;  2VKV A;  5DAJ A;  3MNL A;  4M3G A;  5F0F A;  5J1U A;  2DG8 A;  2UXP A;  4MXM A;  1T33 A;  4JNN A;  1RKT A;  3VOK A;  3BR6 A;  5GPC A;  3ANG A;  3IUV A;  2FJ1 A;  3HTJ A;  2RAS A;  2G7L A;  5F0C A;  1Z0X A;  3SDG A;  5J1R A;  2XDN A;  3F0C A;  3MVP A;  3C2B A;  3PM1 A;  1T56 A;  2FBQ A;  2OF7 A;  4X1E A;  2XGD A;  3JSJ A;  3VW1 A;  3BTL A;  4GFL A;  2YVH A;  3NNR A;  2XB5 A;  3KKD A;  2WGB A;  3GZI A;  4MK6 A;  3QKX A;  5IPA A;  3AQT A;  2G0E A;  5FMP A;  4KWA A;  4B3A A;  5EYR A;  3BQZ A;  2EH3 A;  2GFN A;  3BTI A;  3LHQ A;  3VW2 A;  2V57 A;  3LJL A;  4YZE A;  3VUQ A;  4I6Z A;  2XPW A;  4M3F A;  2Q24 A;  2JK3 A;  3WHB A;  2NP3 A;  3FRQ A;  4HKU A;  1VI0 A;  2HYJ A;  4NN1 A;  5HAW A;  3ZQL A;  2ZCN A;  1ZK8 A;  4JL3 A;  3BR1 A;  4L62 A;  3AQS A;  1JUS A;  2IBD A;  3HTA A;  2W53 A;  3B6C A;  5F27 A;  5FHP A;  4D5C A;  5J1Y A;  4G12 A;  2XRL A;  2REK A;  1JTY A;  3BTJ A;  3F1B A;  3BRU A;  2D6Y A;  3G1O A;  3KNW A;  5IOY A;  3DPJ A;  4D7N A;  3HGY A;  2OI8 A;  1JUM A;  3HTI A;  1QPI A;  2XPU A;  3ANP A;  2HXO A;  5EFY A;  3BR5 A;  3G1L A;  4M3B A;  3KZ9 A;  3EUP A;  3TP0 A;  4PXI A;  5IOZ A;  3T6N A;  3CRJ A;  3Q0V A;  2I10 A;  5FKN A;  1ZKG A;  3QPL A;  1ORK A;  2F07 A;  3Q0U A;  5K7H A;  5K7F A;  5FKK A;  5EZH A;  3CDL A;  2QKO A;  5CXI A;  3ZQI A;  3FIW A;  2G7G A;  5CW8 A;  4D7M A;  3G1M A;  3O8H A;  3BR0 A;  3BT9 A;  1QVT A;  4AUX A;  2QOP A;  4NEL A;  2DTZ A;  4I76 A;  5IP6 A;  3VW0 A;  1RKW A;  2NS7 A;  1UI5 A;  1UI6 A;  2NP5 A;  2HQ5 A;  3BR2 A;  2ZOY A;  3V78 A;  5FGL A;  4AC6 A;  5F1J A;  3EGQ A;  5EZG A;  3G56 A;  3HGG A;  3TP3 A;  4MO7 A;  3NRG A;  2X9D A;  2HYT A;  5FKO A;  3VIB A;  2FX0 A;  3S5R A;  2JJ7 A;  2O7O A;  3FK6 A;  3LWJ A;  3DCF A;  3LSP A;  2HKU A;  3B81 A;  1BJZ A;  2TCT A;  2GBY A;  3NPI A;  2Y31 A;  5K58 A;  4JKZ A;  2UXI A;  3VVZ A;  3Q0W A;  5GP9 A;  3BTC A;  2QWT A;  1RPW A;  4W97 A;  3ON4 A;  5F04 A;  2ZCM A;  2Y30 A;  4D5F A;  5F08 A;  1JUP A;  3IH2 A;  2IAI A;  4ACI A;  5K7Z A;  4ABZ A;  2ID6 A;  5FKM A;  5C4Y A;  3VOX A;  3RD3 A;  4JYK A;  3VP5 A;  4GCT A;  3NI7 A;  5GPA A;  3KKC A;  2VKE A;  2RAE A;  2IEK A;  3SFI A;  2IU5 A;  3ZQF A;  5H9T A;  4DW6 A;  4GCL A;  3BCG A;  5HBU A;  3O8G A;  3HIM A;  2G3B A;  5J3L A;  4ME9 A;  3PAS A;  3HTH A;  3QPS A;  2OER A;  2ID3 A;  2UXU A;  4W1U A;  1SGM A;  3FK7 A;  2ZB9 A;  3IH4 A;  4M3E A;  2YVE A;  3LOC A;  5AQC A;  3P9T A;  4ICH A;  3CWR A;  2UXO A;  2TRT A;  2PBX A;  4V2G A; 
#chains in the Genus database with same CATH topology
 3K8P C;  3BHQ A;  2GEN A;  3CCY A;  3NXC A;  3BR3 A;  2NX4 A;  2WUI A;  2ZOZ A;  4V2F A;  2FD5 A;  3VVX A;  1JTX A;  2O7T A;  2R7T A;  2VPR A;  2NS8 A;  2QCO A;  3BJB A;  5D18 A;  2ZCX A;  1JT6 A;  4AF5 A;  4B1R A;  4GFK A;  1JT0 A;  3DU5 A;  5CXG A;  3VTI A;  3QQA A;  2XPV A;  3VPR A;  2RHA A;  5D1R A;  1QVU A;  3GEU A;  3RH2 A;  2QIB A;  3BNI A;  4U9N A;  3VVY A;  3E7Q A;  3QBM A;  1U9O A;  3V6G A;  3LSJ A;  2Y2Z A;  2FQ4 A;  3B6A A;  3PPB A;  5F0H A;  2G7S A;  2R7W A;  2UXH A;  2ZY9 A;  3Q3S A;  5HSZ A;  2OPT A;  2QTQ A;  4UDS A;  3C07 A;  2HXI A;  3ZQH A;  4GCK A;  2X6O A;  3G7R A;  1A6I A;  5D19 A;  3WHC A;  3LSR A;  3ZQG A;  3ON2 A;  3BQY A;  2R7R A;  4AC0 A;  3HE0 A;  2WV1 A;  1Z77 A;  2YVX A;  4CGR A;  3CJD A;  2XGC A;  2GUH A;  2DG7 A;  2PZ9 A;  2XGE A;  3O60 A;  5FKL A;  1U9N A;  4XK4 A;  3COL A;  4M3D A;  3IH3 A;  3DEW A;  2VKV A;  5DAJ A;  3MNL A;  4M3G A;  5F0F A;  5J1U A;  2DG8 A;  2UXP A;  2A2F X;  4MXM A;  1T33 A;  4JNN A;  4U9L A;  1RKT A;  3VOK A;  3BR6 A;  5GPC A;  3ANG A;  4C2M A;  2R7U A;  3IUV A;  2FJ1 A;  3HTJ A;  2RAS A;  2G7L A;  2R7Q A;  5F0C A;  1Z0X A;  3SDG A;  5J1R A;  2XDN A;  3F0C A;  3MVP A;  3C2B A;  3PM1 A;  1T56 A;  2FBQ A;  2OF7 A;  4X1E A;  2XGD A;  3JSJ A;  3VW1 A;  3BTL A;  4GFL A;  2YVH A;  3NNR A;  3DU6 A;  2XB5 A;  3KKD A;  2WGB A;  2PFV A;  3GZI A;  4MK6 A;  3QKX A;  5IPA A;  3AQT A;  2G0E A;  5FMP A;  4KWA A;  4B3A A;  5EYR A;  3BQZ A;  2EH3 A;  2GFN A;  3BTI A;  3LHQ A;  3VW2 A;  2V57 A;  3LJL A;  4YZE A;  3VUQ A;  2B3W A;  4I6Z A;  2B1E A;  2XPW A;  4M3F A;  2Q24 A;  3SWH A;  2JK3 A;  3WHB A;  2NP3 A;  3FRQ A;  4HKU A;  1VI0 A;  2HYJ A;  4NN1 A;  5HAW A;  3ZQL A;  2ZCN A;  1ZK8 A;  4JL3 A;  3BR1 A;  4L62 A;  3AQS A;  1JUS A;  2IBD A;  3HTA A;  2W53 A;  3B6C A;  5F27 A;  5FHP A;  4D5C A;  5J1Y A;  4G12 A;  2XRL A;  4IRV A;  2REK A;  1JTY A;  3BTJ A;  3F1B A;  3BRU A;  2D6Y A;  3G1O A;  3KNW A;  5IOY A;  3DPJ A;  4D7N A;  3HGY A;  2OI8 A;  1JUM A;  3HTI A;  1QPI A;  2XPU A;  2R7O A;  3ANP A;  2HXO A;  5EFY A;  3BR5 A;  3G1L A;  4M3B A;  3KZ9 A;  3EUP A;  3TP0 A;  4PXI A;  5IOZ A;  2R7S A;  2R7X A;  3T6N A;  3CRJ A;  3Q0V A;  2I10 A;  5FKN A;  1ZKG A;  3QPL A;  1ORK A;  2F07 A;  3Q0U A;  4DVY P;  5K7F A;  5K7H A;  5FKK A;  5EZH A;  3CDL A;  2QKO A;  5CXI A;  3ZQI A;  3FIW A;  2G7G A;  5CW8 A;  4D7M A;  3G1M A;  3O8H A;  3BR0 A;  3BT9 A;  1QVT A;  4AUX A;  2QOP A;  4NEL A;  2DTZ A;  4I76 A;  5IP6 A;  3VW0 A;  1RKW A;  2NS7 A;  3FHN A;  1UI5 A;  1UI6 A;  2NP5 A;  3KYL A;  2HQ5 A;  3BR2 A;  2ZOY A;  3V78 A;  5FGL A;  4AC6 A;  5F1J A;  4OD5 A;  3EGQ A;  5EZG A;  3G56 A;  3HGG A;  3TP3 A;  4MO7 A;  3NRG A;  2X9D A;  2HYT A;  5FKO A;  3VIB A;  2FX0 A;  3S5R A;  2JJ7 A;  2O7O A;  3FK6 A;  3LWJ A;  3DCF A;  3LSP A;  2HKU A;  3B81 A;  4OD4 A;  1BJZ A;  2TCT A;  2GBY A;  3NPI A;  2Y31 A;  4JKZ A;  5K58 A;  2UXI A;  3VVZ A;  3Q0W A;  5GP9 A;  3NS4 A;  3BTC A;  2QWT A;  1RPW A;  4W97 A;  3ON4 A;  5F04 A;  2ZCM A;  2Y30 A;  4D5F A;  5F08 A;  1JUP A;  2FJI 1;  2IAI A;  3IH2 A;  4ACI A;  5K7Z A;  4ABZ A;  2ID6 A;  5FKM A;  5C4Y A;  3VOX A;  3RD3 A;  4JYK A;  3VP5 A;  4GCT A;  3NI7 A;  4WIB A;  5GPA A;  3KKC A;  2VKE A;  2RAE A;  2IEK A;  3SFI A;  2IU5 A;  3ZQF A;  5H9T A;  4DW6 A;  4GCL A;  3BCG A;  5HBU A;  3O8G A;  3HIM A;  2G3B A;  5J3L A;  4ME9 A;  3PAS A;  3HTH A;  3QPS A;  2OER A;  2ID3 A;  2UXU A;  5CQG A;  4W1U A;  1SGM A;  3FK7 A;  2ZB9 A;  3IH4 A;  2R7V A;  4M3E A;  2YVE A;  3LOC A;  5AQC A;  3P9T A;  4ICH A;  3CWR A;  2UXO A;  2TRT A;  2PBX A;  4V2G A; 
#chains in the Genus database with same CATH homology
 3BHQ A;  2GEN A;  3CCY A;  3NXC A;  3BR3 A;  2NX4 A;  2WUI A;  2ZOZ A;  4V2F A;  2FD5 A;  3VVX A;  1JTX A;  2O7T A;  2VPR A;  2NS8 A;  2QCO A;  3BJB A;  5D18 A;  2ZCX A;  1JT6 A;  4AF5 A;  4B1R A;  4GFK A;  1JT0 A;  5CXG A;  3QQA A;  2XPV A;  3VPR A;  2RHA A;  5D1R A;  1QVU A;  3GEU A;  3RH2 A;  2QIB A;  3BNI A;  3VVY A;  3E7Q A;  3QBM A;  1U9O A;  3V6G A;  3LSJ A;  2Y2Z A;  2FQ4 A;  3B6A A;  3PPB A;  5F0H A;  2G7S A;  2UXH A;  3Q3S A;  5HSZ A;  2OPT A;  2QTQ A;  4UDS A;  3C07 A;  2HXI A;  3ZQH A;  4GCK A;  2X6O A;  3G7R A;  1A6I A;  5D19 A;  3WHC A;  3LSR A;  3ZQG A;  3ON2 A;  3BQY A;  4AC0 A;  3HE0 A;  2WV1 A;  1Z77 A;  4CGR A;  3CJD A;  2XGC A;  2GUH A;  2DG7 A;  2PZ9 A;  2XGE A;  3O60 A;  5FKL A;  1U9N A;  4XK4 A;  3COL A;  4M3D A;  3IH3 A;  3DEW A;  2VKV A;  5DAJ A;  3MNL A;  4M3G A;  5F0F A;  5J1U A;  2DG8 A;  2UXP A;  4MXM A;  1T33 A;  4JNN A;  1RKT A;  3VOK A;  3BR6 A;  5GPC A;  3ANG A;  3IUV A;  2FJ1 A;  3HTJ A;  2RAS A;  2G7L A;  5F0C A;  1Z0X A;  3SDG A;  5J1R A;  2XDN A;  3F0C A;  3MVP A;  3C2B A;  3PM1 A;  1T56 A;  2FBQ A;  2OF7 A;  4X1E A;  2XGD A;  3JSJ A;  3VW1 A;  3BTL A;  4GFL A;  2YVH A;  3NNR A;  2XB5 A;  3KKD A;  2WGB A;  3GZI A;  4MK6 A;  3QKX A;  5IPA A;  3AQT A;  2G0E A;  5FMP A;  4KWA A;  4B3A A;  5EYR A;  3BQZ A;  2EH3 A;  2GFN A;  3BTI A;  3LHQ A;  3VW2 A;  2V57 A;  3LJL A;  4YZE A;  3VUQ A;  4I6Z A;  2XPW A;  4M3F A;  2Q24 A;  2JK3 A;  3WHB A;  2NP3 A;  3FRQ A;  4HKU A;  1VI0 A;  2HYJ A;  4NN1 A;  5HAW A;  3ZQL A;  2ZCN A;  1ZK8 A;  4JL3 A;  3BR1 A;  4L62 A;  3AQS A;  1JUS A;  2IBD A;  3HTA A;  2W53 A;  3B6C A;  5F27 A;  5FHP A;  4D5C A;  5J1Y A;  4G12 A;  2XRL A;  2REK A;  1JTY A;  3BTJ A;  3F1B A;  3BRU A;  2D6Y A;  3G1O A;  3KNW A;  5IOY A;  3DPJ A;  4D7N A;  3HGY A;  2OI8 A;  1JUM A;  3HTI A;  1QPI A;  2XPU A;  3ANP A;  2HXO A;  5EFY A;  3BR5 A;  3G1L A;  4M3B A;  3KZ9 A;  3EUP A;  3TP0 A;  4PXI A;  5IOZ A;  3T6N A;  3CRJ A;  3Q0V A;  2I10 A;  5FKN A;  1ZKG A;  3QPL A;  1ORK A;  2F07 A;  3Q0U A;  5K7H A;  5K7F A;  5FKK A;  5EZH A;  3CDL A;  2QKO A;  5CXI A;  3ZQI A;  3FIW A;  2G7G A;  5CW8 A;  4D7M A;  3G1M A;  3O8H A;  3BR0 A;  3BT9 A;  1QVT A;  4AUX A;  2QOP A;  4NEL A;  2DTZ A;  4I76 A;  5IP6 A;  3VW0 A;  1RKW A;  2NS7 A;  1UI5 A;  1UI6 A;  2NP5 A;  2HQ5 A;  3BR2 A;  2ZOY A;  3V78 A;  5FGL A;  4AC6 A;  5F1J A;  3EGQ A;  5EZG A;  3G56 A;  3HGG A;  3TP3 A;  4MO7 A;  3NRG A;  2X9D A;  2HYT A;  5FKO A;  3VIB A;  2FX0 A;  3S5R A;  2JJ7 A;  2O7O A;  3FK6 A;  3LWJ A;  3DCF A;  3LSP A;  2HKU A;  3B81 A;  1BJZ A;  2TCT A;  2GBY A;  3NPI A;  2Y31 A;  5K58 A;  4JKZ A;  2UXI A;  3VVZ A;  3Q0W A;  5GP9 A;  3BTC A;  2QWT A;  1RPW A;  4W97 A;  3ON4 A;  5F04 A;  2ZCM A;  2Y30 A;  4D5F A;  5F08 A;  1JUP A;  3IH2 A;  2IAI A;  4ACI A;  5K7Z A;  4ABZ A;  2ID6 A;  5FKM A;  5C4Y A;  3VOX A;  3RD3 A;  4JYK A;  3VP5 A;  4GCT A;  3NI7 A;  5GPA A;  3KKC A;  2VKE A;  2RAE A;  2IEK A;  3SFI A;  2IU5 A;  3ZQF A;  5H9T A;  4DW6 A;  4GCL A;  3BCG A;  5HBU A;  3O8G A;  3HIM A;  2G3B A;  5J3L A;  4ME9 A;  3PAS A;  3HTH A;  3QPS A;  2OER A;  2ID3 A;  2UXU A;  4W1U A;  1SGM A;  3FK7 A;  2ZB9 A;  3IH4 A;  4M3E A;  2YVE A;  3LOC A;  5AQC A;  3P9T A;  4ICH A;  3CWR A;  2UXO A;  2TRT A;  2PBX A;  4V2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...