2ZOZA

Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
172
structure length
172
Chain Sequence
TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 65
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zozA00
1SGMA 1QPIA 1JTYA 5F27A 2D6YA 3VVZA 2UXHA 3COLA 2QCOA 3VUQA 2NS7A 2TCTA 2UXUA 5CW8A 2ZOYA 2ZOZA 3F0CA 3QPSA 2X9DA 3DCFA 4NN1A 2FQ4A 4GCKA 3EUPA 2PZ9A 3CRJA 5J1UA 3TP0A 3FIWA 4D5CA 4ACIA 2XRLA 1ZK8A 4V2GA 2PBXA 5GPCA 3B81A 4GFKA 5EYRA 2NX4A 4DW6A 1ZKGA 3Q0UA 4AC6A 3IH2A 3FRQA 3NPIA 2G3BA 3BT9A 3BTCA 2VPRA 2HYTA 4JNNA 5FKKA 2YVEA 3S5RA 5D1RA 5FKMA 2Y30A 3VP5A 3ON4A 2XGDA 2ZCXA 2IBDA 4D7NA 5HSZA 4G12A 5EZGA 2IAIA 3BR3A 5F0CA 3ZQLA 3KZ9A 2F07A 5K7FA 2O7OA 3AQTA 5F0HA 3BTLA 2FJ1A 2UXIA 3QKXA 4YZEA 3LWJA 2QTQA 4M3BA 3G7RA 4CGRA 3IUVA 2QIBA 5FKNA 5IP6A 2WV1A 2YVHA 4L62A 4GCLA 3G1OA 5FGLA 3B6AA 3GEUA 3JSJA 3VOKA 3BR6A 2G7LA 2FBQA 5D18A 2XGEA 3ANGA 3BR0A 4W97A 3G56A 3TP3A 3HGYA 3V6GA 3Q0VA 3HTAA 4B1RA 1T56A 1JT6A 2I10A 2ZB9A 4V2FA 5F08A 3FK7A 3VW1A 5FMPA 3SDGA 5HBUA 3MNLA 3G1LA 2JJ7A 5J1RA 2W53A 3NI7A 3BR2A 4MO7A 4JL3A 5CXGA 5CXIA 2XDNA 3HGGA 5HAWA 5F0FA 4ICHA 2RAEA 5GPAA 3MVPA 3B6CA 2RASA 3Q3SA 3DPJA 1RPWA 4AC0A 4UDSA 5GP9A 3CJDA 3NXCA 3KKCA 1Z77A 4AUXA 2G0EA 3C07A 2HYJA 4GFLA 4AF5A 4M3GA 3BTJA 4W1UA 5C4YA 2TRTA 4JKZA 3BR1A 1JUMA 3CCYA 4KWAA 3VIBA 3BR5A 3G1MA 2Y2ZA 1ORKA 3VW2A 3QQAA 2XGCA 5IOZA 2FX0A 4XK4A 3FK6A 3P9TA 2GUHA 3NRGA 3BNIA 3Q0WA 2QKOA 1T33A 2NP3A 2HXIA 4PXIA 2G7SA 2Y31A 2HXOA 3O60A 1JTXA 3RH2A 2X6OA 3PASA 2XPWA 2DTZA 4M3DA 2WGBA 3F1BA 3CWRA 3WHCA 2QWTA 5DAJA 4I6ZA 2GFNA 2NS8A 3ZQFA 2HKUA 3KNWA 4X1EA 1U9NA 5F04A 5J1YA 5FKOA 1BJZA 3O8HA 3LJLA 3NNRA 3ON2A 3HTHA 3LOCA 4ABZA 3WHBA 5K7HA 2REKA 3BTIA 3KKDA 3V78A 2Q24A 3GZIA 2OF7A 1UI5A 2JK3A 3VVXA 1RKTA 5IPAA 1VI0A 2RHAA 3BQYA 5H9TA 3ZQHA 4B3AA 4HKUA 2OERA 3O8GA 4D7MA 3IH4A 5AQCA 1JUPA 1QVUA 3QPLA 3CDLA 2GBYA 3ZQGA 2FD5A 3E7QA 4GCTA 3VOXA 3BRUA 3EGQA 2IU5A 4MXMA 2XB5A 2ID3A 2OPTA 3RD3A 5FKLA 2ZCMA 2VKEA 3ZQIA 2DG7A 4ME9A 2O7TA 3ANPA 5J3LA 4D5FA 3LHQA 3HE0A 4JYKA 1QVTA 5FHPA 5EFYA 2V57A 3C2BA 3SFIA 3LSRA 2UXOA 1U9OA 2ID6A 2NP5A 4I76A 1JUSA 3VPRA 3AQSA 4MK6A 3LSPA 3HTIA 3BQZA 2WUIA 2G7GA 3T6NA 2DG8A 5F1JA 3QBMA 1UI6A 3PPBA 2XPVA 5IOYA 3IH3A 2GENA 1RKWA 2XPUA 1Z0XA 4M3FA 2ZCNA 5EZHA 3PM1A 1JT0A 2HQ5A 3BHQA 3LSJA 3VW0A 3BCGA 2QOPA 2IEKA 3VVYA 5K7ZA 3HIMA 4NELA 4M3EA 3BJBA 5D19A 2VKVA 3HTJA 5K58A 2OI8A 2UXPA 1A6IA 2EH3A 3DEWA
chains in the Genus database with same CATH superfamily
1SGMA 1QPIA 4OD5A 1JTYA 2A2FX 5F27A 2D6YA 3VVZA 2UXHA 3COLA 2FJI1 2QCOA 3VUQA 2NS7A 2TCTA 2UXUA 5CW8A 2B3WA 2ZOYA 2ZOZA 3F0CA 3QPSA 2X9DA 3DCFA 4NN1A 2FQ4A 4GCKA 3EUPA 2PZ9A 3CRJA 5J1UA 3TP0A 3FIWA 4D5CA 4ACIA 2XRLA 1ZK8A 4V2GA 2PBXA 5GPCA 3B81A 4GFKA 5EYRA 2NX4A 4DW6A 1ZKGA 3Q0UA 4AC6A 3IH2A 3FRQA 3NPIA 2G3BA 3BT9A 3BTCA 2VPRA 2HYTA 4JNNA 5FKKA 2YVEA 3S5RA 5D1RA 5FKMA 2Y30A 3VP5A 3ON4A 2XGDA 2ZCXA 2IBDA 4D7NA 5HSZA 4G12A 5EZGA 2IAIA 3BR3A 5F0CA 3ZQLA 3KZ9A 2R7RA 2F07A 5K7FA 2O7OA 3AQTA 5F0HA 3BTLA 2FJ1A 2UXIA 3QKXA 4YZEA 3LWJA 2QTQA 4M3BA 3G7RA 4CGRA 3IUVA 2QIBA 5FKNA 5IP6A 2WV1A 2YVHA 4WIBA 4GCLA 4L62A 3G1OA 5FGLA 3B6AA 3GEUA 3JSJA 3VOKA 3BR6A 2G7LA 2FBQA 5D18A 2XGEA 3ANGA 4C2MA 3BR0A 4W97A 3G56A 3TP3A 3HGYA 3V6GA 3Q0VA 3HTAA 4B1RA 1T56A 1JT6A 2I10A 2ZB9A 4V2FA 5F08A 3FK7A 3VW1A 5FMPA 3SDGA 5HBUA 3MNLA 3G1LA 2JJ7A 5J1RA 2W53A 3NI7A 3BR2A 4MO7A 4JL3A 5CXGA 5CXIA 2XDNA 3HGGA 3NS4A 5HAWA 5F0FA 4ICHA 2RAEA 5GPAA 3MVPA 3B6CA 2RASA 3Q3SA 3DPJA 1RPWA 4U9NA 4AC0A 2B1EA 4UDSA 5GP9A 3CJDA 3NXCA 3KKCA 1Z77A 4AUXA 2G0EA 3C07A 2HYJA 4GFLA 4AF5A 4M3GA 3BTJA 4W1UA 5C4YA 2TRTA 4JKZA 3BR1A 1JUMA 2R7WA 3CCYA 4KWAA 3VIBA 3BR5A 3G1MA 2Y2ZA 1ORKA 3VW2A 2YVXA 3QQAA 2XGCA 5IOZA 2FX0A 4XK4A 3FK6A 3P9TA 2GUHA 3NRGA 3BNIA 3Q0WA 2QKOA 1T33A 2NP3A 2HXIA 4PXIA 2G7SA 2Y31A 2HXOA 3O60A 1JTXA 3RH2A 2X6OA 2R7VA 3PASA 5CQGA 2XPWA 2DTZA 4M3DA 2WGBA 3F1BA 3KYLA 3CWRA 3WHCA 2QWTA 3DU5A 4OD4A 5DAJA 3VTIA 4I6ZA 2GFNA 2NS8A 2R7QA 3ZQFA 2HKUA 3KNWA 4X1EA 1U9NA 5F04A 5J1YA 5FKOA 1BJZA 3O8HA 3LJLA 3NNRA 3ON2A 2R7XA 3HTHA 3LOCA 4ABZA 3WHBA 2R7UA 5K7HA 2REKA 3BTIA 3KKDA 3V78A 2Q24A 3GZIA 2OF7A 1UI5A 2JK3A 3VVXA 1RKTA 5IPAA 1VI0A 4U9LA 2RHAA 2R7TA 3FHNA 3BQYA 5H9TA 3ZQHA 4B3AA 4HKUA 2OERA 2PFVA 3O8GA 4D7MA 3IH4A 3DU6A 5AQCA 1JUPA 1QVUA 3QPLA 3CDLA 2GBYA 3ZQGA 2ZY9A 2FD5A 3E7QA 4GCTA 3VOXA 3BRUA 3EGQA 2IU5A 4MXMA 2XB5A 2ID3A 2OPTA 3RD3A 5FKLA 2ZCMA 2VKEA 3ZQIA 2DG7A 4ME9A 2O7TA 3ANPA 5J3LA 4D5FA 3LHQA 3HE0A 4JYKA 1QVTA 5FHPA 5EFYA 3K8PC 2V57A 3C2BA 3SFIA 3LSRA 2UXOA 1U9OA 2ID6A 2R7SA 2NP5A 4I76A 1JUSA 3VPRA 3AQSA 4MK6A 3LSPA 3HTIA 3BQZA 2WUIA 2G7GA 3T6NA 2DG8A 5F1JA 3QBMA 1UI6A 3PPBA 2XPVA 4DVYP 5IOYA 3IH3A 2GENA 1RKWA 2XPUA 1Z0XA 4M3FA 2ZCNA 5EZHA 4IRVA 3PM1A 1JT0A 3SWHA 2HQ5A 3BHQA 3LSJA 3VW0A 3BCGA 2QOPA 2IEKA 3VVYA 2R7OA 5K7ZA 3HIMA 4NELA 4M3EA 3BJBA 5D19A 2VKVA 3HTJA 5K58A 2OI8A 2UXPA 1A6IA 2EH3A 3DEWA
chains in the Genus database with same CATH topology
1SGMA 1QPIA 1JTYA 5F27A 2D6YA 3VVZA 2UXHA 3COLA 2QCOA 3VUQA 2NS7A 2TCTA 2UXUA 5CW8A 2ZOYA 2ZOZA 3F0CA 3QPSA 2X9DA 3DCFA 4NN1A 2FQ4A 4GCKA 3EUPA 2PZ9A 3CRJA 5J1UA 3TP0A 3FIWA 4D5CA 4ACIA 2XRLA 1ZK8A 4V2GA 2PBXA 5GPCA 3B81A 4GFKA 5EYRA 2NX4A 4DW6A 1ZKGA 3Q0UA 4AC6A 3IH2A 3FRQA 3NPIA 2G3BA 3BT9A 3BTCA 2VPRA 2HYTA 4JNNA 5FKKA 2YVEA 3S5RA 5D1RA 5FKMA 2Y30A 3VP5A 3ON4A 2XGDA 2ZCXA 2IBDA 4D7NA 5HSZA 4G12A 5EZGA 2IAIA 3BR3A 5F0CA 3ZQLA 3KZ9A 2F07A 5K7FA 2O7OA 3AQTA 5F0HA 3BTLA 2FJ1A 2UXIA 3QKXA 4YZEA 3LWJA 2QTQA 4M3BA 3G7RA 4CGRA 3IUVA 2QIBA 5FKNA 5IP6A 2WV1A 2YVHA 4L62A 4GCLA 3G1OA 5FGLA 3B6AA 3GEUA 3JSJA 3VOKA 3BR6A 2G7LA 2FBQA 5D18A 2XGEA 3ANGA 3BR0A 4W97A 3G56A 3TP3A 3HGYA 3V6GA 3Q0VA 3HTAA 4B1RA 1T56A 1JT6A 2I10A 2ZB9A 4V2FA 5F08A 3FK7A 3VW1A 5FMPA 3SDGA 5HBUA 3MNLA 3G1LA 2JJ7A 5J1RA 2W53A 3NI7A 3BR2A 4MO7A 4JL3A 5CXGA 5CXIA 2XDNA 3HGGA 5HAWA 5F0FA 4ICHA 2RAEA 5GPAA 3MVPA 3B6CA 2RASA 3Q3SA 3DPJA 1RPWA 4AC0A 4UDSA 5GP9A 3CJDA 3NXCA 3KKCA 1Z77A 4AUXA 2G0EA 3C07A 2HYJA 4GFLA 4AF5A 4M3GA 3BTJA 4W1UA 5C4YA 2TRTA 4JKZA 3BR1A 1JUMA 3CCYA 4KWAA 3VIBA 3BR5A 3G1MA 2Y2ZA 1ORKA 3VW2A 3QQAA 2XGCA 5IOZA 2FX0A 4XK4A 3FK6A 3P9TA 2GUHA 3NRGA 3BNIA 3Q0WA 2QKOA 1T33A 2NP3A 2HXIA 4PXIA 2G7SA 2Y31A 2HXOA 3O60A 1JTXA 3RH2A 2X6OA 3PASA 2XPWA 2DTZA 4M3DA 2WGBA 3F1BA 3CWRA 3WHCA 2QWTA 5DAJA 4I6ZA 2GFNA 2NS8A 3ZQFA 2HKUA 3KNWA 4X1EA 1U9NA 5F04A 5J1YA 5FKOA 1BJZA 3O8HA 3LJLA 3NNRA 3ON2A 3HTHA 3LOCA 4ABZA 3WHBA 5K7HA 2REKA 3BTIA 3KKDA 3V78A 2Q24A 3GZIA 2OF7A 1UI5A 2JK3A 3VVXA 1RKTA 5IPAA 1VI0A 2RHAA 3BQYA 5H9TA 3ZQHA 4B3AA 4HKUA 2OERA 3O8GA 4D7MA 3IH4A 5AQCA 1JUPA 1QVUA 3QPLA 3CDLA 2GBYA 3ZQGA 2FD5A 3E7QA 4GCTA 3VOXA 3BRUA 3EGQA 2IU5A 4MXMA 2XB5A 2ID3A 2OPTA 3RD3A 5FKLA 2ZCMA 2VKEA 3ZQIA 2DG7A 4ME9A 2O7TA 3ANPA 5J3LA 4D5FA 3LHQA 3HE0A 4JYKA 1QVTA 5FHPA 5EFYA 2V57A 3C2BA 3SFIA 3LSRA 2UXOA 1U9OA 2ID6A 2NP5A 4I76A 1JUSA 3VPRA 3AQSA 4MK6A 3LSPA 3HTIA 3BQZA 2WUIA 2G7GA 3T6NA 2DG8A 5F1JA 3QBMA 1UI6A 3PPBA 2XPVA 5IOYA 3IH3A 2GENA 1RKWA 2XPUA 1Z0XA 4M3FA 2ZCNA 5EZHA 3PM1A 1JT0A 2HQ5A 3BHQA 3LSJA 3VW0A 3BCGA 2QOPA 2IEKA 3VVYA 5K7ZA 3HIMA 4NELA 4M3EA 3BJBA 5D19A 2VKVA 3HTJA 5K58A 2OI8A 2UXPA 1A6IA 2EH3A 3DEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGM A;  1QPI A;  1JTY A;  5F27 A;  2D6Y A;  3VVZ A;  2UXH A;  3COL A;  2QCO A;  3VUQ A;  2NS7 A;  2TCT A;  2UXU A;  5CW8 A;  2ZOY A;  2ZOZ A;  3F0C A;  3QPS A;  2X9D A;  3DCF A;  4NN1 A;  2FQ4 A;  4GCK A;  3EUP A;  2PZ9 A;  3CRJ A;  5J1U A;  3TP0 A;  3FIW A;  4D5C A;  4ACI A;  2XRL A;  1ZK8 A;  4V2G A;  2PBX A;  5GPC A;  3B81 A;  4GFK A;  5EYR A;  2NX4 A;  4DW6 A;  1ZKG A;  3Q0U A;  4AC6 A;  3IH2 A;  3FRQ A;  3NPI A;  2G3B A;  3BT9 A;  3BTC A;  2VPR A;  2HYT A;  4JNN A;  5FKK A;  2YVE A;  3S5R A;  5D1R A;  5FKM A;  2Y30 A;  3VP5 A;  3ON4 A;  2XGD A;  2ZCX A;  2IBD A;  4D7N A;  5HSZ A;  4G12 A;  5EZG A;  2IAI A;  3BR3 A;  5F0C A;  3ZQL A;  3KZ9 A;  2F07 A;  5K7F A;  2O7O A;  3AQT A;  5F0H A;  3BTL A;  2FJ1 A;  2UXI A;  3QKX A;  4YZE A;  3LWJ A;  2QTQ A;  4M3B A;  3G7R A;  4CGR A;  3IUV A;  2QIB A;  5FKN A;  5IP6 A;  2WV1 A;  2YVH A;  4L62 A;  4GCL A;  3G1O A;  5FGL A;  3B6A A;  3GEU A;  3JSJ A;  3VOK A;  3BR6 A;  2G7L A;  2FBQ A;  5D18 A;  2XGE A;  3ANG A;  3BR0 A;  4W97 A;  3G56 A;  3TP3 A;  3HGY A;  3V6G A;  3Q0V A;  3HTA A;  4B1R A;  1T56 A;  1JT6 A;  2I10 A;  2ZB9 A;  4V2F A;  5F08 A;  3FK7 A;  3VW1 A;  5FMP A;  3SDG A;  5HBU A;  3MNL A;  3G1L A;  2JJ7 A;  5J1R A;  2W53 A;  3NI7 A;  3BR2 A;  4MO7 A;  4JL3 A;  5CXG A;  5CXI A;  2XDN A;  3HGG A;  5HAW A;  5F0F A;  4ICH A;  2RAE A;  5GPA A;  3MVP A;  3B6C A;  2RAS A;  3Q3S A;  3DPJ A;  1RPW A;  4AC0 A;  4UDS A;  5GP9 A;  3CJD A;  3NXC A;  3KKC A;  1Z77 A;  4AUX A;  2G0E A;  3C07 A;  2HYJ A;  4GFL A;  4AF5 A;  4M3G A;  3BTJ A;  4W1U A;  5C4Y A;  2TRT A;  4JKZ A;  3BR1 A;  1JUM A;  3CCY A;  4KWA A;  3VIB A;  3BR5 A;  3G1M A;  2Y2Z A;  1ORK A;  3VW2 A;  3QQA A;  2XGC A;  5IOZ A;  2FX0 A;  4XK4 A;  3FK6 A;  3P9T A;  2GUH A;  3NRG A;  3BNI A;  3Q0W A;  2QKO A;  1T33 A;  2NP3 A;  2HXI A;  4PXI A;  2G7S A;  2Y31 A;  2HXO A;  3O60 A;  1JTX A;  3RH2 A;  2X6O A;  3PAS A;  2XPW A;  2DTZ A;  4M3D A;  2WGB A;  3F1B A;  3CWR A;  3WHC A;  2QWT A;  5DAJ A;  4I6Z A;  2GFN A;  2NS8 A;  3ZQF A;  2HKU A;  3KNW A;  4X1E A;  1U9N A;  5F04 A;  5J1Y A;  5FKO A;  1BJZ A;  3O8H A;  3LJL A;  3NNR A;  3ON2 A;  3HTH A;  3LOC A;  4ABZ A;  3WHB A;  5K7H A;  2REK A;  3BTI A;  3KKD A;  3V78 A;  2Q24 A;  3GZI A;  2OF7 A;  1UI5 A;  2JK3 A;  3VVX A;  1RKT A;  5IPA A;  1VI0 A;  2RHA A;  3BQY A;  5H9T A;  3ZQH A;  4B3A A;  4HKU A;  2OER A;  3O8G A;  4D7M A;  3IH4 A;  5AQC A;  1JUP A;  1QVU A;  3QPL A;  3CDL A;  2GBY A;  3ZQG A;  2FD5 A;  3E7Q A;  4GCT A;  3VOX A;  3BRU A;  3EGQ A;  2IU5 A;  4MXM A;  2XB5 A;  2ID3 A;  2OPT A;  3RD3 A;  5FKL A;  2ZCM A;  2VKE A;  3ZQI A;  2DG7 A;  4ME9 A;  2O7T A;  3ANP A;  5J3L A;  4D5F A;  3LHQ A;  3HE0 A;  4JYK A;  1QVT A;  5FHP A;  5EFY A;  2V57 A;  3C2B A;  3SFI A;  3LSR A;  2UXO A;  1U9O A;  2ID6 A;  2NP5 A;  4I76 A;  1JUS A;  3VPR A;  3AQS A;  4MK6 A;  3LSP A;  3HTI A;  3BQZ A;  2WUI A;  2G7G A;  3T6N A;  2DG8 A;  5F1J A;  3QBM A;  1UI6 A;  3PPB A;  2XPV A;  5IOY A;  3IH3 A;  2GEN A;  1RKW A;  2XPU A;  1Z0X A;  4M3F A;  2ZCN A;  5EZH A;  3PM1 A;  1JT0 A;  2HQ5 A;  3BHQ A;  3LSJ A;  3VW0 A;  3BCG A;  2QOP A;  2IEK A;  3VVY A;  5K7Z A;  3HIM A;  4NEL A;  4M3E A;  3BJB A;  5D19 A;  2VKV A;  3HTJ A;  5K58 A;  2OI8 A;  2UXP A;  1A6I A;  2EH3 A;  3DEW A; 
#chains in the Genus database with same CATH topology
 1SGM A;  1QPI A;  4OD5 A;  1JTY A;  2A2F X;  5F27 A;  2D6Y A;  3VVZ A;  2UXH A;  3COL A;  2FJI 1;  2QCO A;  3VUQ A;  2NS7 A;  2TCT A;  2UXU A;  5CW8 A;  2B3W A;  2ZOY A;  2ZOZ A;  3F0C A;  3QPS A;  2X9D A;  3DCF A;  4NN1 A;  2FQ4 A;  4GCK A;  3EUP A;  2PZ9 A;  3CRJ A;  5J1U A;  3TP0 A;  3FIW A;  4D5C A;  4ACI A;  2XRL A;  1ZK8 A;  4V2G A;  2PBX A;  5GPC A;  3B81 A;  4GFK A;  5EYR A;  2NX4 A;  4DW6 A;  1ZKG A;  3Q0U A;  4AC6 A;  3IH2 A;  3FRQ A;  3NPI A;  2G3B A;  3BT9 A;  3BTC A;  2VPR A;  2HYT A;  4JNN A;  5FKK A;  2YVE A;  3S5R A;  5D1R A;  5FKM A;  2Y30 A;  3VP5 A;  3ON4 A;  2XGD A;  2ZCX A;  2IBD A;  4D7N A;  5HSZ A;  4G12 A;  5EZG A;  2IAI A;  3BR3 A;  5F0C A;  3ZQL A;  3KZ9 A;  2R7R A;  2F07 A;  5K7F A;  2O7O A;  3AQT A;  5F0H A;  3BTL A;  2FJ1 A;  2UXI A;  3QKX A;  4YZE A;  3LWJ A;  2QTQ A;  4M3B A;  3G7R A;  4CGR A;  3IUV A;  2QIB A;  5FKN A;  5IP6 A;  2WV1 A;  2YVH A;  4WIB A;  4GCL A;  4L62 A;  3G1O A;  5FGL A;  3B6A A;  3GEU A;  3JSJ A;  3VOK A;  3BR6 A;  2G7L A;  2FBQ A;  5D18 A;  2XGE A;  3ANG A;  4C2M A;  3BR0 A;  4W97 A;  3G56 A;  3TP3 A;  3HGY A;  3V6G A;  3Q0V A;  3HTA A;  4B1R A;  1T56 A;  1JT6 A;  2I10 A;  2ZB9 A;  4V2F A;  5F08 A;  3FK7 A;  3VW1 A;  5FMP A;  3SDG A;  5HBU A;  3MNL A;  3G1L A;  2JJ7 A;  5J1R A;  2W53 A;  3NI7 A;  3BR2 A;  4MO7 A;  4JL3 A;  5CXG A;  5CXI A;  2XDN A;  3HGG A;  3NS4 A;  5HAW A;  5F0F A;  4ICH A;  2RAE A;  5GPA A;  3MVP A;  3B6C A;  2RAS A;  3Q3S A;  3DPJ A;  1RPW A;  4U9N A;  4AC0 A;  2B1E A;  4UDS A;  5GP9 A;  3CJD A;  3NXC A;  3KKC A;  1Z77 A;  4AUX A;  2G0E A;  3C07 A;  2HYJ A;  4GFL A;  4AF5 A;  4M3G A;  3BTJ A;  4W1U A;  5C4Y A;  2TRT A;  4JKZ A;  3BR1 A;  1JUM A;  2R7W A;  3CCY A;  4KWA A;  3VIB A;  3BR5 A;  3G1M A;  2Y2Z A;  1ORK A;  3VW2 A;  2YVX A;  3QQA A;  2XGC A;  5IOZ A;  2FX0 A;  4XK4 A;  3FK6 A;  3P9T A;  2GUH A;  3NRG A;  3BNI A;  3Q0W A;  2QKO A;  1T33 A;  2NP3 A;  2HXI A;  4PXI A;  2G7S A;  2Y31 A;  2HXO A;  3O60 A;  1JTX A;  3RH2 A;  2X6O A;  2R7V A;  3PAS A;  5CQG A;  2XPW A;  2DTZ A;  4M3D A;  2WGB A;  3F1B A;  3KYL A;  3CWR A;  3WHC A;  2QWT A;  3DU5 A;  4OD4 A;  5DAJ A;  3VTI A;  4I6Z A;  2GFN A;  2NS8 A;  2R7Q A;  3ZQF A;  2HKU A;  3KNW A;  4X1E A;  1U9N A;  5F04 A;  5J1Y A;  5FKO A;  1BJZ A;  3O8H A;  3LJL A;  3NNR A;  3ON2 A;  2R7X A;  3HTH A;  3LOC A;  4ABZ A;  3WHB A;  2R7U A;  5K7H A;  2REK A;  3BTI A;  3KKD A;  3V78 A;  2Q24 A;  3GZI A;  2OF7 A;  1UI5 A;  2JK3 A;  3VVX A;  1RKT A;  5IPA A;  1VI0 A;  4U9L A;  2RHA A;  2R7T A;  3FHN A;  3BQY A;  5H9T A;  3ZQH A;  4B3A A;  4HKU A;  2OER A;  2PFV A;  3O8G A;  4D7M A;  3IH4 A;  3DU6 A;  5AQC A;  1JUP A;  1QVU A;  3QPL A;  3CDL A;  2GBY A;  3ZQG A;  2ZY9 A;  2FD5 A;  3E7Q A;  4GCT A;  3VOX A;  3BRU A;  3EGQ A;  2IU5 A;  4MXM A;  2XB5 A;  2ID3 A;  2OPT A;  3RD3 A;  5FKL A;  2ZCM A;  2VKE A;  3ZQI A;  2DG7 A;  4ME9 A;  2O7T A;  3ANP A;  5J3L A;  4D5F A;  3LHQ A;  3HE0 A;  4JYK A;  1QVT A;  5FHP A;  5EFY A;  3K8P C;  2V57 A;  3C2B A;  3SFI A;  3LSR A;  2UXO A;  1U9O A;  2ID6 A;  2R7S A;  2NP5 A;  4I76 A;  1JUS A;  3VPR A;  3AQS A;  4MK6 A;  3LSP A;  3HTI A;  3BQZ A;  2WUI A;  2G7G A;  3T6N A;  2DG8 A;  5F1J A;  3QBM A;  1UI6 A;  3PPB A;  2XPV A;  4DVY P;  5IOY A;  3IH3 A;  2GEN A;  1RKW A;  2XPU A;  1Z0X A;  4M3F A;  2ZCN A;  5EZH A;  4IRV A;  3PM1 A;  1JT0 A;  3SWH A;  2HQ5 A;  3BHQ A;  3LSJ A;  3VW0 A;  3BCG A;  2QOP A;  2IEK A;  3VVY A;  2R7O A;  5K7Z A;  3HIM A;  4NEL A;  4M3E A;  3BJB A;  5D19 A;  2VKV A;  3HTJ A;  5K58 A;  2OI8 A;  2UXP A;  1A6I A;  2EH3 A;  3DEW A; 
#chains in the Genus database with same CATH homology
 1SGM A;  1QPI A;  1JTY A;  5F27 A;  2D6Y A;  3VVZ A;  2UXH A;  3COL A;  2QCO A;  3VUQ A;  2NS7 A;  2TCT A;  2UXU A;  5CW8 A;  2ZOY A;  2ZOZ A;  3F0C A;  3QPS A;  2X9D A;  3DCF A;  4NN1 A;  2FQ4 A;  4GCK A;  3EUP A;  2PZ9 A;  3CRJ A;  5J1U A;  3TP0 A;  3FIW A;  4D5C A;  4ACI A;  2XRL A;  1ZK8 A;  4V2G A;  2PBX A;  5GPC A;  3B81 A;  4GFK A;  5EYR A;  2NX4 A;  4DW6 A;  1ZKG A;  3Q0U A;  4AC6 A;  3IH2 A;  3FRQ A;  3NPI A;  2G3B A;  3BT9 A;  3BTC A;  2VPR A;  2HYT A;  4JNN A;  5FKK A;  2YVE A;  3S5R A;  5D1R A;  5FKM A;  2Y30 A;  3VP5 A;  3ON4 A;  2XGD A;  2ZCX A;  2IBD A;  4D7N A;  5HSZ A;  4G12 A;  5EZG A;  2IAI A;  3BR3 A;  5F0C A;  3ZQL A;  3KZ9 A;  2F07 A;  5K7F A;  2O7O A;  3AQT A;  5F0H A;  3BTL A;  2FJ1 A;  2UXI A;  3QKX A;  4YZE A;  3LWJ A;  2QTQ A;  4M3B A;  3G7R A;  4CGR A;  3IUV A;  2QIB A;  5FKN A;  5IP6 A;  2WV1 A;  2YVH A;  4L62 A;  4GCL A;  3G1O A;  5FGL A;  3B6A A;  3GEU A;  3JSJ A;  3VOK A;  3BR6 A;  2G7L A;  2FBQ A;  5D18 A;  2XGE A;  3ANG A;  3BR0 A;  4W97 A;  3G56 A;  3TP3 A;  3HGY A;  3V6G A;  3Q0V A;  3HTA A;  4B1R A;  1T56 A;  1JT6 A;  2I10 A;  2ZB9 A;  4V2F A;  5F08 A;  3FK7 A;  3VW1 A;  5FMP A;  3SDG A;  5HBU A;  3MNL A;  3G1L A;  2JJ7 A;  5J1R A;  2W53 A;  3NI7 A;  3BR2 A;  4MO7 A;  4JL3 A;  5CXG A;  5CXI A;  2XDN A;  3HGG A;  5HAW A;  5F0F A;  4ICH A;  2RAE A;  5GPA A;  3MVP A;  3B6C A;  2RAS A;  3Q3S A;  3DPJ A;  1RPW A;  4AC0 A;  4UDS A;  5GP9 A;  3CJD A;  3NXC A;  3KKC A;  1Z77 A;  4AUX A;  2G0E A;  3C07 A;  2HYJ A;  4GFL A;  4AF5 A;  4M3G A;  3BTJ A;  4W1U A;  5C4Y A;  2TRT A;  4JKZ A;  3BR1 A;  1JUM A;  3CCY A;  4KWA A;  3VIB A;  3BR5 A;  3G1M A;  2Y2Z A;  1ORK A;  3VW2 A;  3QQA A;  2XGC A;  5IOZ A;  2FX0 A;  4XK4 A;  3FK6 A;  3P9T A;  2GUH A;  3NRG A;  3BNI A;  3Q0W A;  2QKO A;  1T33 A;  2NP3 A;  2HXI A;  4PXI A;  2G7S A;  2Y31 A;  2HXO A;  3O60 A;  1JTX A;  3RH2 A;  2X6O A;  3PAS A;  2XPW A;  2DTZ A;  4M3D A;  2WGB A;  3F1B A;  3CWR A;  3WHC A;  2QWT A;  5DAJ A;  4I6Z A;  2GFN A;  2NS8 A;  3ZQF A;  2HKU A;  3KNW A;  4X1E A;  1U9N A;  5F04 A;  5J1Y A;  5FKO A;  1BJZ A;  3O8H A;  3LJL A;  3NNR A;  3ON2 A;  3HTH A;  3LOC A;  4ABZ A;  3WHB A;  5K7H A;  2REK A;  3BTI A;  3KKD A;  3V78 A;  2Q24 A;  3GZI A;  2OF7 A;  1UI5 A;  2JK3 A;  3VVX A;  1RKT A;  5IPA A;  1VI0 A;  2RHA A;  3BQY A;  5H9T A;  3ZQH A;  4B3A A;  4HKU A;  2OER A;  3O8G A;  4D7M A;  3IH4 A;  5AQC A;  1JUP A;  1QVU A;  3QPL A;  3CDL A;  2GBY A;  3ZQG A;  2FD5 A;  3E7Q A;  4GCT A;  3VOX A;  3BRU A;  3EGQ A;  2IU5 A;  4MXM A;  2XB5 A;  2ID3 A;  2OPT A;  3RD3 A;  5FKL A;  2ZCM A;  2VKE A;  3ZQI A;  2DG7 A;  4ME9 A;  2O7T A;  3ANP A;  5J3L A;  4D5F A;  3LHQ A;  3HE0 A;  4JYK A;  1QVT A;  5FHP A;  5EFY A;  2V57 A;  3C2B A;  3SFI A;  3LSR A;  2UXO A;  1U9O A;  2ID6 A;  2NP5 A;  4I76 A;  1JUS A;  3VPR A;  3AQS A;  4MK6 A;  3LSP A;  3HTI A;  3BQZ A;  2WUI A;  2G7G A;  3T6N A;  2DG8 A;  5F1J A;  3QBM A;  1UI6 A;  3PPB A;  2XPV A;  5IOY A;  3IH3 A;  2GEN A;  1RKW A;  2XPU A;  1Z0X A;  4M3F A;  2ZCN A;  5EZH A;  3PM1 A;  1JT0 A;  2HQ5 A;  3BHQ A;  3LSJ A;  3VW0 A;  3BCG A;  2QOP A;  2IEK A;  3VVY A;  5K7Z A;  3HIM A;  4NEL A;  4M3E A;  3BJB A;  5D19 A;  2VKV A;  3HTJ A;  5K58 A;  2OI8 A;  2UXP A;  1A6I A;  2EH3 A;  3DEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...