2ZOZA

Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
172
structure length
172
Chain Sequence
TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 65
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zozA00
3O8HA 2EH3A 3CRJA 3VOKA 1ZKGA 3O60A 3VVYA 2X6OA 1UI5A 4V2GA 2ZOYA 2XB5A 3DPJA 4HKUA 3HGYA 4MO7A 5HBUA 3QKXA 2OPTA 2NP3A 1BJZA 3F1BA 3P9TA 3WHCA 3ZQHA 5F0FA 2W53A 1Z0XA 2O7OA 5FKKA 3G7RA 4ME9A 1QVUA 4D5FA 2G7LA 2HKUA 3C07A 4I6ZA 4JYKA 3NXCA 3QBMA 5CXIA 5FHPA 3ON4A 5CW8A 3ZQFA 3BHQA 4AC6A 4NN1A 1JTXA 1T33A 3MNLA 1Z77A 3GEUA 5HSZA 2DG7A 2ZCNA 3JSJA 2OERA 3BR6A 2X9DA 5J1RA 5J3LA 3CDLA 3BRUA 3LWJA 4G12A 3Q0UA 5FKNA 3VVZA 1ZK8A 4GCKA 1JT0A 1RPWA 3AQTA 5J1YA 3NPIA 2Y31A 3V78A 2G7SA 2DTZA 2NS8A 2V57A 2GBYA 3FRQA 3HTJA 4M3EA 5K7FA 3NNRA 1JUSA 2ID3A 2FBQA 3BR0A 3BCGA 2ID6A 5FKMA 3RD3A 2PBXA 3EGQA 3LSJA 2HYTA 5J1UA 3KNWA 2YVEA 2IU5A 5F08A 4W1UA 5GPCA 3BR1A 2FX0A 3CJDA 3ANPA 5F1JA 4XK4A 4DW6A 2GUHA 3E7QA 3TP3A 4JKZA 5EZHA 3SDGA 2OF7A 4GFLA 2ZCMA 2HYJA 3BTJA 2IAIA 3CWRA 5H9TA 4UDSA 2RAEA 4MXMA 1ORKA 2Y2ZA 3EUPA 3B81A 5F0CA 1UI6A 2G3BA 2QOPA 2G0EA 1U9OA 3GZIA 3KZ9A 5D18A 3BQZA 3PM1A 4I76A 2UXUA 3TP0A 2WV1A 2XGEA 2XGDA 1JTYA 2HXIA 2UXHA 2RHAA 2D6YA 2JJ7A 2UXPA 3QQAA 4D5CA 5F27A 3COLA 2HXOA 3T6NA 3VW0A 5EYRA 4MK6A 3VPRA 5IOZA 4M3GA 4D7NA 2IBDA 3QPLA 2FQ4A 3LHQA 3S5RA 2IEKA 2QCOA 5FMPA 2QTQA 2RASA 4V2FA 4NELA 2VKEA 3LOCA 5D1RA 2XDNA 3HTAA 4CGRA 2QKOA 5K58A 2VKVA 4ACIA 3LSPA 3MVPA 1RKWA 2JK3A 3PPBA 4GFKA 3VOXA 2GFNA 3G1LA 2NP5A 3VP5A 2UXOA 2GENA 3C2BA 5DAJA 2DG8A 2XRLA 3BTIA 4ICHA 3G1OA 3BR2A 5EZGA 2FD5A 3IH2A 4JL3A 5EFYA 3KKDA 5D19A 3BJBA 1JUPA 5C4YA 4M3FA 3HIMA 4YZEA 1U9NA 2NX4A 2XPWA 1T56A 3G56A 3O8GA 3WHBA 1RKTA 3NRGA 2I10A 3Q0WA 5IP6A 2WUIA 2REKA 3BR3A 5IPAA 3B6AA 3QPSA 3BTLA 5K7ZA 2TRTA 3VVXA 3LSRA 3B6CA 4X1EA 4GCTA 5K7HA 3SFIA 1QVTA 3LJLA 4B3AA 2WGBA 2NS7A 3ZQGA 3BR5A 4ABZA 3FK7A 4AC0A 3V6GA 4JNNA 3PASA 3DEWA 3IH4A 5FGLA 3BNIA 3VW2A 3FK6A 4PXIA 2ZB9A 1JUMA 4M3DA 4KWAA 2OI8A 3VIBA 3HE0A 2QWTA 3G1MA 2G7GA 5F0HA 4B1RA 2Y30A 1QPIA 1A6IA 2FJ1A 2XPVA 3IH3A 4M3BA 5IOYA 2ZCXA 3KKCA 5GPAA 3HTHA 2TCTA 2HQ5A 2UXIA 2ZOZA 3AQSA 3CCYA 2PZ9A 4L62A 3ZQIA 2O7TA 1SGMA 1JT6A 1VI0A 5F04A 4AUXA 4D7MA 4GCLA 2QIBA 3DCFA 4W97A 3VW1A 3ANGA 2YVHA 3BQYA 2Q24A 3ZQLA 5FKLA 3HTIA 3FIWA 3ON2A 2F07A 2VPRA 3BT9A 5HAWA 3Q3SA 4AF5A 2XGCA 3Q0VA 5CXGA 2XPUA 5FKOA 5GP9A 3NI7A 3HGGA 3RH2A 5AQCA 3VUQA 3BTCA 3IUVA 3F0CA
chains in the Genus database with same CATH superfamily
3O8HA 2EH3A 3CRJA 3VOKA 1ZKGA 3O60A 2PFVA 3VVYA 2X6OA 1UI5A 4V2GA 2ZOYA 2XB5A 3DPJA 4HKUA 4C2MA 3HGYA 4MO7A 5HBUA 3QKXA 2OPTA 2NP3A 1BJZA 3F1BA 3P9TA 3WHCA 3ZQHA 2R7XA 5F0FA 2W53A 1Z0XA 2O7OA 5FKKA 3G7RA 4ME9A 1QVUA 4D5FA 2G7LA 2HKUA 3C07A 4I6ZA 4JYKA 3NXCA 3QBMA 5CXIA 5FHPA 3ON4A 5CW8A 3ZQFA 3BHQA 4AC6A 3DU6A 4NN1A 1JTXA 1T33A 3MNLA 1Z77A 2R7VA 3GEUA 5HSZA 2DG7A 2ZCNA 3JSJA 2OERA 3BR6A 2X9DA 5J1RA 5J3LA 3CDLA 4DVYP 3BRUA 3LWJA 4G12A 3Q0UA 2FJI1 5FKNA 3VVZA 1ZK8A 4GCKA 1JT0A 1RPWA 3AQTA 5J1YA 3NPIA 3SWHA 2Y31A 3VTIA 3V78A 2G7SA 2ZY9A 2DTZA 2NS8A 2V57A 2GBYA 3FRQA 3HTJA 4M3EA 5K7FA 3NNRA 1JUSA 2ID3A 2FBQA 3BR0A 3BCGA 2ID6A 5FKMA 3RD3A 2PBXA 3EGQA 3LSJA 2HYTA 5J1UA 3KYLA 3KNWA 2YVEA 2IU5A 5F08A 4W1UA 5GPCA 3BR1A 2FX0A 2R7SA 3CJDA 3ANPA 5F1JA 4XK4A 4DW6A 2GUHA 3E7QA 3TP3A 4JKZA 5EZHA 3SDGA 2OF7A 4GFLA 2ZCMA 4IRVA 2HYJA 3BTJA 2IAIA 3CWRA 5H9TA 4UDSA 2RAEA 4MXMA 1ORKA 2Y2ZA 3EUPA 3B81A 5F0CA 1UI6A 2G3BA 2QOPA 2YVXA 3NS4A 2G0EA 1U9OA 3GZIA 3KZ9A 5D18A 3BQZA 3PM1A 4I76A 2UXUA 3TP0A 2WV1A 2XGEA 2XGDA 1JTYA 2HXIA 2UXHA 2RHAA 2D6YA 2JJ7A 2A2FX 2UXPA 3QQAA 4D5CA 5F27A 3COLA 2HXOA 3T6NA 3VW0A 5EYRA 4MK6A 3VPRA 5IOZA 4M3GA 4D7NA 2IBDA 3QPLA 2FQ4A 3FHNA 3LHQA 3S5RA 2IEKA 2QCOA 5FMPA 2QTQA 2RASA 4V2FA 4NELA 2VKEA 3LOCA 5D1RA 4U9LA 2XDNA 3HTAA 4CGRA 2QKOA 5K58A 2VKVA 4ACIA 2R7OA 3DU5A 3LSPA 3MVPA 1RKWA 2JK3A 3PPBA 4GFKA 3VOXA 2GFNA 3G1LA 2NP5A 3VP5A 2UXOA 2GENA 3C2BA 5DAJA 2DG8A 2XRLA 3BTIA 2B1EA 4ICHA 3G1OA 3BR2A 5EZGA 2FD5A 3IH2A 4JL3A 5EFYA 3KKDA 5D19A 3BJBA 1JUPA 5C4YA 4M3FA 3HIMA 4YZEA 1U9NA 2NX4A 2XPWA 1T56A 3G56A 3O8GA 3WHBA 1RKTA 3NRGA 2R7UA 2I10A 3Q0WA 5IP6A 2WUIA 2REKA 3BR3A 5IPAA 3B6AA 3QPSA 3BTLA 5K7ZA 2TRTA 3VVXA 3LSRA 3B6CA 4X1EA 4GCTA 5K7HA 3SFIA 1QVTA 2R7WA 3K8PC 3LJLA 4B3AA 2WGBA 2NS7A 3ZQGA 3BR5A 4ABZA 3FK7A 4AC0A 3V6GA 4JNNA 3PASA 3DEWA 3IH4A 5FGLA 3BNIA 3VW2A 3FK6A 5CQGA 4PXIA 2ZB9A 1JUMA 4M3DA 4KWAA 2OI8A 3VIBA 3HE0A 2QWTA 3G1MA 2G7GA 5F0HA 4B1RA 2Y30A 1QPIA 1A6IA 2FJ1A 2XPVA 3IH3A 4M3BA 5IOYA 2ZCXA 4U9NA 3KKCA 5GPAA 3HTHA 2TCTA 2R7RA 2HQ5A 2UXIA 4OD5A 2ZOZA 3AQSA 3CCYA 2PZ9A 4L62A 3ZQIA 2O7TA 2R7QA 1SGMA 1JT6A 1VI0A 5F04A 4AUXA 4D7MA 4GCLA 2QIBA 3DCFA 4W97A 3VW1A 3ANGA 2YVHA 3BQYA 2Q24A 3ZQLA 5FKLA 3HTIA 3FIWA 4OD4A 3ON2A 2F07A 2VPRA 3BT9A 5HAWA 3Q3SA 4AF5A 2XGCA 3Q0VA 5CXGA 2XPUA 5FKOA 5GP9A 3NI7A 3HGGA 3RH2A 2B3WA 5AQCA 3VUQA 2R7TA 3BTCA 3IUVA 4WIBA 3F0CA
chains in the Genus database with same CATH topology
3O8HA 2EH3A 3CRJA 3VOKA 1ZKGA 3O60A 3VVYA 2X6OA 1UI5A 4V2GA 2ZOYA 2XB5A 3DPJA 4HKUA 3HGYA 4MO7A 5HBUA 3QKXA 2OPTA 2NP3A 1BJZA 3F1BA 3P9TA 3WHCA 3ZQHA 5F0FA 2W53A 1Z0XA 2O7OA 5FKKA 3G7RA 4ME9A 1QVUA 4D5FA 2G7LA 2HKUA 3C07A 4I6ZA 4JYKA 3NXCA 3QBMA 5CXIA 5FHPA 3ON4A 5CW8A 3ZQFA 3BHQA 4AC6A 4NN1A 1JTXA 1T33A 3MNLA 1Z77A 3GEUA 5HSZA 2DG7A 2ZCNA 3JSJA 2OERA 3BR6A 2X9DA 5J1RA 5J3LA 3CDLA 3BRUA 3LWJA 4G12A 3Q0UA 5FKNA 3VVZA 1ZK8A 4GCKA 1JT0A 1RPWA 3AQTA 5J1YA 3NPIA 2Y31A 3V78A 2G7SA 2DTZA 2NS8A 2V57A 2GBYA 3FRQA 3HTJA 4M3EA 5K7FA 3NNRA 1JUSA 2ID3A 2FBQA 3BR0A 3BCGA 2ID6A 5FKMA 3RD3A 2PBXA 3EGQA 3LSJA 2HYTA 5J1UA 3KNWA 2YVEA 2IU5A 5F08A 4W1UA 5GPCA 3BR1A 2FX0A 3CJDA 3ANPA 5F1JA 4XK4A 4DW6A 2GUHA 3E7QA 3TP3A 4JKZA 5EZHA 3SDGA 2OF7A 4GFLA 2ZCMA 2HYJA 3BTJA 2IAIA 3CWRA 5H9TA 4UDSA 2RAEA 4MXMA 1ORKA 2Y2ZA 3EUPA 3B81A 5F0CA 1UI6A 2G3BA 2QOPA 2G0EA 1U9OA 3GZIA 3KZ9A 5D18A 3BQZA 3PM1A 4I76A 2UXUA 3TP0A 2WV1A 2XGEA 2XGDA 1JTYA 2HXIA 2UXHA 2RHAA 2D6YA 2JJ7A 2UXPA 3QQAA 4D5CA 5F27A 3COLA 2HXOA 3T6NA 3VW0A 5EYRA 4MK6A 3VPRA 5IOZA 4M3GA 4D7NA 2IBDA 3QPLA 2FQ4A 3LHQA 3S5RA 2IEKA 2QCOA 5FMPA 2QTQA 2RASA 4V2FA 4NELA 2VKEA 3LOCA 5D1RA 2XDNA 3HTAA 4CGRA 2QKOA 5K58A 2VKVA 4ACIA 3LSPA 3MVPA 1RKWA 2JK3A 3PPBA 4GFKA 3VOXA 2GFNA 3G1LA 2NP5A 3VP5A 2UXOA 2GENA 3C2BA 5DAJA 2DG8A 2XRLA 3BTIA 4ICHA 3G1OA 3BR2A 5EZGA 2FD5A 3IH2A 4JL3A 5EFYA 3KKDA 5D19A 3BJBA 1JUPA 5C4YA 4M3FA 3HIMA 4YZEA 1U9NA 2NX4A 2XPWA 1T56A 3G56A 3O8GA 3WHBA 1RKTA 3NRGA 2I10A 3Q0WA 5IP6A 2WUIA 2REKA 3BR3A 5IPAA 3B6AA 3QPSA 3BTLA 5K7ZA 2TRTA 3VVXA 3LSRA 3B6CA 4X1EA 4GCTA 5K7HA 3SFIA 1QVTA 3LJLA 4B3AA 2WGBA 2NS7A 3ZQGA 3BR5A 4ABZA 3FK7A 4AC0A 3V6GA 4JNNA 3PASA 3DEWA 3IH4A 5FGLA 3BNIA 3VW2A 3FK6A 4PXIA 2ZB9A 1JUMA 4M3DA 4KWAA 2OI8A 3VIBA 3HE0A 2QWTA 3G1MA 2G7GA 5F0HA 4B1RA 2Y30A 1QPIA 1A6IA 2FJ1A 2XPVA 3IH3A 4M3BA 5IOYA 2ZCXA 3KKCA 5GPAA 3HTHA 2TCTA 2HQ5A 2UXIA 2ZOZA 3AQSA 3CCYA 2PZ9A 4L62A 3ZQIA 2O7TA 1SGMA 1JT6A 1VI0A 5F04A 4AUXA 4D7MA 4GCLA 2QIBA 3DCFA 4W97A 3VW1A 3ANGA 2YVHA 3BQYA 2Q24A 3ZQLA 5FKLA 3HTIA 3FIWA 3ON2A 2F07A 2VPRA 3BT9A 5HAWA 3Q3SA 4AF5A 2XGCA 3Q0VA 5CXGA 2XPUA 5FKOA 5GP9A 3NI7A 3HGGA 3RH2A 5AQCA 3VUQA 3BTCA 3IUVA 3F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8H A;  2EH3 A;  3CRJ A;  3VOK A;  1ZKG A;  3O60 A;  3VVY A;  2X6O A;  1UI5 A;  4V2G A;  2ZOY A;  2XB5 A;  3DPJ A;  4HKU A;  3HGY A;  4MO7 A;  5HBU A;  3QKX A;  2OPT A;  2NP3 A;  1BJZ A;  3F1B A;  3P9T A;  3WHC A;  3ZQH A;  5F0F A;  2W53 A;  1Z0X A;  2O7O A;  5FKK A;  3G7R A;  4ME9 A;  1QVU A;  4D5F A;  2G7L A;  2HKU A;  3C07 A;  4I6Z A;  4JYK A;  3NXC A;  3QBM A;  5CXI A;  5FHP A;  3ON4 A;  5CW8 A;  3ZQF A;  3BHQ A;  4AC6 A;  4NN1 A;  1JTX A;  1T33 A;  3MNL A;  1Z77 A;  3GEU A;  5HSZ A;  2DG7 A;  2ZCN A;  3JSJ A;  2OER A;  3BR6 A;  2X9D A;  5J1R A;  5J3L A;  3CDL A;  3BRU A;  3LWJ A;  4G12 A;  3Q0U A;  5FKN A;  3VVZ A;  1ZK8 A;  4GCK A;  1JT0 A;  1RPW A;  3AQT A;  5J1Y A;  3NPI A;  2Y31 A;  3V78 A;  2G7S A;  2DTZ A;  2NS8 A;  2V57 A;  2GBY A;  3FRQ A;  3HTJ A;  4M3E A;  5K7F A;  3NNR A;  1JUS A;  2ID3 A;  2FBQ A;  3BR0 A;  3BCG A;  2ID6 A;  5FKM A;  3RD3 A;  2PBX A;  3EGQ A;  3LSJ A;  2HYT A;  5J1U A;  3KNW A;  2YVE A;  2IU5 A;  5F08 A;  4W1U A;  5GPC A;  3BR1 A;  2FX0 A;  3CJD A;  3ANP A;  5F1J A;  4XK4 A;  4DW6 A;  2GUH A;  3E7Q A;  3TP3 A;  4JKZ A;  5EZH A;  3SDG A;  2OF7 A;  4GFL A;  2ZCM A;  2HYJ A;  3BTJ A;  2IAI A;  3CWR A;  5H9T A;  4UDS A;  2RAE A;  4MXM A;  1ORK A;  2Y2Z A;  3EUP A;  3B81 A;  5F0C A;  1UI6 A;  2G3B A;  2QOP A;  2G0E A;  1U9O A;  3GZI A;  3KZ9 A;  5D18 A;  3BQZ A;  3PM1 A;  4I76 A;  2UXU A;  3TP0 A;  2WV1 A;  2XGE A;  2XGD A;  1JTY A;  2HXI A;  2UXH A;  2RHA A;  2D6Y A;  2JJ7 A;  2UXP A;  3QQA A;  4D5C A;  5F27 A;  3COL A;  2HXO A;  3T6N A;  3VW0 A;  5EYR A;  4MK6 A;  3VPR A;  5IOZ A;  4M3G A;  4D7N A;  2IBD A;  3QPL A;  2FQ4 A;  3LHQ A;  3S5R A;  2IEK A;  2QCO A;  5FMP A;  2QTQ A;  2RAS A;  4V2F A;  4NEL A;  2VKE A;  3LOC A;  5D1R A;  2XDN A;  3HTA A;  4CGR A;  2QKO A;  5K58 A;  2VKV A;  4ACI A;  3LSP A;  3MVP A;  1RKW A;  2JK3 A;  3PPB A;  4GFK A;  3VOX A;  2GFN A;  3G1L A;  2NP5 A;  3VP5 A;  2UXO A;  2GEN A;  3C2B A;  5DAJ A;  2DG8 A;  2XRL A;  3BTI A;  4ICH A;  3G1O A;  3BR2 A;  5EZG A;  2FD5 A;  3IH2 A;  4JL3 A;  5EFY A;  3KKD A;  5D19 A;  3BJB A;  1JUP A;  5C4Y A;  4M3F A;  3HIM A;  4YZE A;  1U9N A;  2NX4 A;  2XPW A;  1T56 A;  3G56 A;  3O8G A;  3WHB A;  1RKT A;  3NRG A;  2I10 A;  3Q0W A;  5IP6 A;  2WUI A;  2REK A;  3BR3 A;  5IPA A;  3B6A A;  3QPS A;  3BTL A;  5K7Z A;  2TRT A;  3VVX A;  3LSR A;  3B6C A;  4X1E A;  4GCT A;  5K7H A;  3SFI A;  1QVT A;  3LJL A;  4B3A A;  2WGB A;  2NS7 A;  3ZQG A;  3BR5 A;  4ABZ A;  3FK7 A;  4AC0 A;  3V6G A;  4JNN A;  3PAS A;  3DEW A;  3IH4 A;  5FGL A;  3BNI A;  3VW2 A;  3FK6 A;  4PXI A;  2ZB9 A;  1JUM A;  4M3D A;  4KWA A;  2OI8 A;  3VIB A;  3HE0 A;  2QWT A;  3G1M A;  2G7G A;  5F0H A;  4B1R A;  2Y30 A;  1QPI A;  1A6I A;  2FJ1 A;  2XPV A;  3IH3 A;  4M3B A;  5IOY A;  2ZCX A;  3KKC A;  5GPA A;  3HTH A;  2TCT A;  2HQ5 A;  2UXI A;  2ZOZ A;  3AQS A;  3CCY A;  2PZ9 A;  4L62 A;  3ZQI A;  2O7T A;  1SGM A;  1JT6 A;  1VI0 A;  5F04 A;  4AUX A;  4D7M A;  4GCL A;  2QIB A;  3DCF A;  4W97 A;  3VW1 A;  3ANG A;  2YVH A;  3BQY A;  2Q24 A;  3ZQL A;  5FKL A;  3HTI A;  3FIW A;  3ON2 A;  2F07 A;  2VPR A;  3BT9 A;  5HAW A;  3Q3S A;  4AF5 A;  2XGC A;  3Q0V A;  5CXG A;  2XPU A;  5FKO A;  5GP9 A;  3NI7 A;  3HGG A;  3RH2 A;  5AQC A;  3VUQ A;  3BTC A;  3IUV A;  3F0C A; 
#chains in the Genus database with same CATH topology
 3O8H A;  2EH3 A;  3CRJ A;  3VOK A;  1ZKG A;  3O60 A;  2PFV A;  3VVY A;  2X6O A;  1UI5 A;  4V2G A;  2ZOY A;  2XB5 A;  3DPJ A;  4HKU A;  4C2M A;  3HGY A;  4MO7 A;  5HBU A;  3QKX A;  2OPT A;  2NP3 A;  1BJZ A;  3F1B A;  3P9T A;  3WHC A;  3ZQH A;  2R7X A;  5F0F A;  2W53 A;  1Z0X A;  2O7O A;  5FKK A;  3G7R A;  4ME9 A;  1QVU A;  4D5F A;  2G7L A;  2HKU A;  3C07 A;  4I6Z A;  4JYK A;  3NXC A;  3QBM A;  5CXI A;  5FHP A;  3ON4 A;  5CW8 A;  3ZQF A;  3BHQ A;  4AC6 A;  3DU6 A;  4NN1 A;  1JTX A;  1T33 A;  3MNL A;  1Z77 A;  2R7V A;  3GEU A;  5HSZ A;  2DG7 A;  2ZCN A;  3JSJ A;  2OER A;  3BR6 A;  2X9D A;  5J1R A;  5J3L A;  3CDL A;  4DVY P;  3BRU A;  3LWJ A;  4G12 A;  3Q0U A;  2FJI 1;  5FKN A;  3VVZ A;  1ZK8 A;  4GCK A;  1JT0 A;  1RPW A;  3AQT A;  5J1Y A;  3NPI A;  3SWH A;  2Y31 A;  3VTI A;  3V78 A;  2G7S A;  2ZY9 A;  2DTZ A;  2NS8 A;  2V57 A;  2GBY A;  3FRQ A;  3HTJ A;  4M3E A;  5K7F A;  3NNR A;  1JUS A;  2ID3 A;  2FBQ A;  3BR0 A;  3BCG A;  2ID6 A;  5FKM A;  3RD3 A;  2PBX A;  3EGQ A;  3LSJ A;  2HYT A;  5J1U A;  3KYL A;  3KNW A;  2YVE A;  2IU5 A;  5F08 A;  4W1U A;  5GPC A;  3BR1 A;  2FX0 A;  2R7S A;  3CJD A;  3ANP A;  5F1J A;  4XK4 A;  4DW6 A;  2GUH A;  3E7Q A;  3TP3 A;  4JKZ A;  5EZH A;  3SDG A;  2OF7 A;  4GFL A;  2ZCM A;  4IRV A;  2HYJ A;  3BTJ A;  2IAI A;  3CWR A;  5H9T A;  4UDS A;  2RAE A;  4MXM A;  1ORK A;  2Y2Z A;  3EUP A;  3B81 A;  5F0C A;  1UI6 A;  2G3B A;  2QOP A;  2YVX A;  3NS4 A;  2G0E A;  1U9O A;  3GZI A;  3KZ9 A;  5D18 A;  3BQZ A;  3PM1 A;  4I76 A;  2UXU A;  3TP0 A;  2WV1 A;  2XGE A;  2XGD A;  1JTY A;  2HXI A;  2UXH A;  2RHA A;  2D6Y A;  2JJ7 A;  2A2F X;  2UXP A;  3QQA A;  4D5C A;  5F27 A;  3COL A;  2HXO A;  3T6N A;  3VW0 A;  5EYR A;  4MK6 A;  3VPR A;  5IOZ A;  4M3G A;  4D7N A;  2IBD A;  3QPL A;  2FQ4 A;  3FHN A;  3LHQ A;  3S5R A;  2IEK A;  2QCO A;  5FMP A;  2QTQ A;  2RAS A;  4V2F A;  4NEL A;  2VKE A;  3LOC A;  5D1R A;  4U9L A;  2XDN A;  3HTA A;  4CGR A;  2QKO A;  5K58 A;  2VKV A;  4ACI A;  2R7O A;  3DU5 A;  3LSP A;  3MVP A;  1RKW A;  2JK3 A;  3PPB A;  4GFK A;  3VOX A;  2GFN A;  3G1L A;  2NP5 A;  3VP5 A;  2UXO A;  2GEN A;  3C2B A;  5DAJ A;  2DG8 A;  2XRL A;  3BTI A;  2B1E A;  4ICH A;  3G1O A;  3BR2 A;  5EZG A;  2FD5 A;  3IH2 A;  4JL3 A;  5EFY A;  3KKD A;  5D19 A;  3BJB A;  1JUP A;  5C4Y A;  4M3F A;  3HIM A;  4YZE A;  1U9N A;  2NX4 A;  2XPW A;  1T56 A;  3G56 A;  3O8G A;  3WHB A;  1RKT A;  3NRG A;  2R7U A;  2I10 A;  3Q0W A;  5IP6 A;  2WUI A;  2REK A;  3BR3 A;  5IPA A;  3B6A A;  3QPS A;  3BTL A;  5K7Z A;  2TRT A;  3VVX A;  3LSR A;  3B6C A;  4X1E A;  4GCT A;  5K7H A;  3SFI A;  1QVT A;  2R7W A;  3K8P C;  3LJL A;  4B3A A;  2WGB A;  2NS7 A;  3ZQG A;  3BR5 A;  4ABZ A;  3FK7 A;  4AC0 A;  3V6G A;  4JNN A;  3PAS A;  3DEW A;  3IH4 A;  5FGL A;  3BNI A;  3VW2 A;  3FK6 A;  5CQG A;  4PXI A;  2ZB9 A;  1JUM A;  4M3D A;  4KWA A;  2OI8 A;  3VIB A;  3HE0 A;  2QWT A;  3G1M A;  2G7G A;  5F0H A;  4B1R A;  2Y30 A;  1QPI A;  1A6I A;  2FJ1 A;  2XPV A;  3IH3 A;  4M3B A;  5IOY A;  2ZCX A;  4U9N A;  3KKC A;  5GPA A;  3HTH A;  2TCT A;  2R7R A;  2HQ5 A;  2UXI A;  4OD5 A;  2ZOZ A;  3AQS A;  3CCY A;  2PZ9 A;  4L62 A;  3ZQI A;  2O7T A;  2R7Q A;  1SGM A;  1JT6 A;  1VI0 A;  5F04 A;  4AUX A;  4D7M A;  4GCL A;  2QIB A;  3DCF A;  4W97 A;  3VW1 A;  3ANG A;  2YVH A;  3BQY A;  2Q24 A;  3ZQL A;  5FKL A;  3HTI A;  3FIW A;  4OD4 A;  3ON2 A;  2F07 A;  2VPR A;  3BT9 A;  5HAW A;  3Q3S A;  4AF5 A;  2XGC A;  3Q0V A;  5CXG A;  2XPU A;  5FKO A;  5GP9 A;  3NI7 A;  3HGG A;  3RH2 A;  2B3W A;  5AQC A;  3VUQ A;  2R7T A;  3BTC A;  3IUV A;  4WIB A;  3F0C A; 
#chains in the Genus database with same CATH homology
 3O8H A;  2EH3 A;  3CRJ A;  3VOK A;  1ZKG A;  3O60 A;  3VVY A;  2X6O A;  1UI5 A;  4V2G A;  2ZOY A;  2XB5 A;  3DPJ A;  4HKU A;  3HGY A;  4MO7 A;  5HBU A;  3QKX A;  2OPT A;  2NP3 A;  1BJZ A;  3F1B A;  3P9T A;  3WHC A;  3ZQH A;  5F0F A;  2W53 A;  1Z0X A;  2O7O A;  5FKK A;  3G7R A;  4ME9 A;  1QVU A;  4D5F A;  2G7L A;  2HKU A;  3C07 A;  4I6Z A;  4JYK A;  3NXC A;  3QBM A;  5CXI A;  5FHP A;  3ON4 A;  5CW8 A;  3ZQF A;  3BHQ A;  4AC6 A;  4NN1 A;  1JTX A;  1T33 A;  3MNL A;  1Z77 A;  3GEU A;  5HSZ A;  2DG7 A;  2ZCN A;  3JSJ A;  2OER A;  3BR6 A;  2X9D A;  5J1R A;  5J3L A;  3CDL A;  3BRU A;  3LWJ A;  4G12 A;  3Q0U A;  5FKN A;  3VVZ A;  1ZK8 A;  4GCK A;  1JT0 A;  1RPW A;  3AQT A;  5J1Y A;  3NPI A;  2Y31 A;  3V78 A;  2G7S A;  2DTZ A;  2NS8 A;  2V57 A;  2GBY A;  3FRQ A;  3HTJ A;  4M3E A;  5K7F A;  3NNR A;  1JUS A;  2ID3 A;  2FBQ A;  3BR0 A;  3BCG A;  2ID6 A;  5FKM A;  3RD3 A;  2PBX A;  3EGQ A;  3LSJ A;  2HYT A;  5J1U A;  3KNW A;  2YVE A;  2IU5 A;  5F08 A;  4W1U A;  5GPC A;  3BR1 A;  2FX0 A;  3CJD A;  3ANP A;  5F1J A;  4XK4 A;  4DW6 A;  2GUH A;  3E7Q A;  3TP3 A;  4JKZ A;  5EZH A;  3SDG A;  2OF7 A;  4GFL A;  2ZCM A;  2HYJ A;  3BTJ A;  2IAI A;  3CWR A;  5H9T A;  4UDS A;  2RAE A;  4MXM A;  1ORK A;  2Y2Z A;  3EUP A;  3B81 A;  5F0C A;  1UI6 A;  2G3B A;  2QOP A;  2G0E A;  1U9O A;  3GZI A;  3KZ9 A;  5D18 A;  3BQZ A;  3PM1 A;  4I76 A;  2UXU A;  3TP0 A;  2WV1 A;  2XGE A;  2XGD A;  1JTY A;  2HXI A;  2UXH A;  2RHA A;  2D6Y A;  2JJ7 A;  2UXP A;  3QQA A;  4D5C A;  5F27 A;  3COL A;  2HXO A;  3T6N A;  3VW0 A;  5EYR A;  4MK6 A;  3VPR A;  5IOZ A;  4M3G A;  4D7N A;  2IBD A;  3QPL A;  2FQ4 A;  3LHQ A;  3S5R A;  2IEK A;  2QCO A;  5FMP A;  2QTQ A;  2RAS A;  4V2F A;  4NEL A;  2VKE A;  3LOC A;  5D1R A;  2XDN A;  3HTA A;  4CGR A;  2QKO A;  5K58 A;  2VKV A;  4ACI A;  3LSP A;  3MVP A;  1RKW A;  2JK3 A;  3PPB A;  4GFK A;  3VOX A;  2GFN A;  3G1L A;  2NP5 A;  3VP5 A;  2UXO A;  2GEN A;  3C2B A;  5DAJ A;  2DG8 A;  2XRL A;  3BTI A;  4ICH A;  3G1O A;  3BR2 A;  5EZG A;  2FD5 A;  3IH2 A;  4JL3 A;  5EFY A;  3KKD A;  5D19 A;  3BJB A;  1JUP A;  5C4Y A;  4M3F A;  3HIM A;  4YZE A;  1U9N A;  2NX4 A;  2XPW A;  1T56 A;  3G56 A;  3O8G A;  3WHB A;  1RKT A;  3NRG A;  2I10 A;  3Q0W A;  5IP6 A;  2WUI A;  2REK A;  3BR3 A;  5IPA A;  3B6A A;  3QPS A;  3BTL A;  5K7Z A;  2TRT A;  3VVX A;  3LSR A;  3B6C A;  4X1E A;  4GCT A;  5K7H A;  3SFI A;  1QVT A;  3LJL A;  4B3A A;  2WGB A;  2NS7 A;  3ZQG A;  3BR5 A;  4ABZ A;  3FK7 A;  4AC0 A;  3V6G A;  4JNN A;  3PAS A;  3DEW A;  3IH4 A;  5FGL A;  3BNI A;  3VW2 A;  3FK6 A;  4PXI A;  2ZB9 A;  1JUM A;  4M3D A;  4KWA A;  2OI8 A;  3VIB A;  3HE0 A;  2QWT A;  3G1M A;  2G7G A;  5F0H A;  4B1R A;  2Y30 A;  1QPI A;  1A6I A;  2FJ1 A;  2XPV A;  3IH3 A;  4M3B A;  5IOY A;  2ZCX A;  3KKC A;  5GPA A;  3HTH A;  2TCT A;  2HQ5 A;  2UXI A;  2ZOZ A;  3AQS A;  3CCY A;  2PZ9 A;  4L62 A;  3ZQI A;  2O7T A;  1SGM A;  1JT6 A;  1VI0 A;  5F04 A;  4AUX A;  4D7M A;  4GCL A;  2QIB A;  3DCF A;  4W97 A;  3VW1 A;  3ANG A;  2YVH A;  3BQY A;  2Q24 A;  3ZQL A;  5FKL A;  3HTI A;  3FIW A;  3ON2 A;  2F07 A;  2VPR A;  3BT9 A;  5HAW A;  3Q3S A;  4AF5 A;  2XGC A;  3Q0V A;  5CXG A;  2XPU A;  5FKO A;  5GP9 A;  3NI7 A;  3HGG A;  3RH2 A;  5AQC A;  3VUQ A;  3BTC A;  3IUV A;  3F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...