2ZOZA

Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
172
structure length
172
Chain Sequence
b'TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
molecule tags Transcription
source organism Corynebacterium glutamicum
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
total genus 65
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zozA00
4X1EA 2Y2ZA 3HGYA 2IAIA 1JUPA 2EH3A 1ZKGA 4XK4A 3LSJA 2G7SA 3BTJA 2YVEA 5J1UA 2XGDA 2HXOA 2GENA 2FBQA 4JKZA 2XGEA 3FK6A 3C07A 3BCGA 3CRJA 5D18A 3BR0A 2ZCNA 3QKXA 5FKMA 3LWJA 5D1RA 3CJDA 4ICHA 2XPWA 2FJ1A 4B3AA 2NP3A 5IOZA 4M3BA 3KKCA 3V78A 4JL3A 4GFLA 2D6YA 4V2GA 2NP5A 4DW6A 3EUPA 2NS8A 3BQZA 3HGGA 5EFYA 4D7MA 2UXIA 4AC6A 2X6OA 5CW8A 3DEWA 3C2BA 3ZQLA 3NRGA 2DG8A 1JTYA 2OF7A 5FKNA 2FD5A 4ACIA 3E7QA 1UI5A 2OI8A 3QPSA 2HQ5A 2XPVA 1SGMA 2ID6A 1QPIA 2OPTA 3G56A 2ZOZA 1BJZA 5F04A 3LSRA 1RPWA 2Q24A 2V57A 2ZCMA 5K58A 2RASA 2NX4A 3G1OA 1JUSA 3GZIA 4KWAA 3B6AA 2IEKA 2O7TA 2ZB9A 2Y30A 3KZ9A 3O8GA 2ID3A 4MK6A 3O8HA 4GFKA 3PM1A 2W53A 3MNLA 4D7NA 3FIWA 3BR1A 1QVUA 4JYKA 4D5FA 2GFNA 2QOPA 2GBYA 5F08A 3BR2A 5FHPA 5CXIA 2QCOA 4I76A 1JT6A 2VKVA 2PZ9A 2QKOA 3VVYA 3WHBA 3BQYA 3BTLA 3QQAA 3BJBA 1U9NA 2OERA 5HSZA 2DG7A 2X9DA 3VOXA 1UI6A 3KNWA 2XGCA 2I10A 2FQ4A 2YVHA 2GUHA 4GCKA 3F0CA 2HXIA 2QWTA 2F07A 5EYRA 5K7HA 1JT0A 2JK3A 3VUQA 3WHCA 4AC0A 2JJ7A 3HIMA 3BRUA 5F0CA 5EZHA 2HYTA 3Q0UA 2ZCXA 4CGRA 4GCLA 5F27A 3AQTA 2RHAA 1ZK8A 2RAEA 1JTXA 3G7RA 3DPJA 3VP5A 5IPAA 3IH3A 3HTIA 5F1JA 2ZOYA 3ZQFA 5K7ZA 3BR5A 3SFIA 3SDGA 5J1YA 2Y31A 4D5CA 2TRTA 4ME9A 5GP9A 3BNIA 5AQCA 4HKUA 2REKA 2IBDA 5DAJA 3DCFA 1Z77A 4B1RA 5J3LA 4YZEA 3ON4A 4PXIA 3LHQA 3NXCA 3BR6A 4M3GA 3ANPA 2QIBA 2WV1A 5CXGA 3RH2A 3BT9A 3JSJA 1Z0XA 2XPUA 2WGBA 3VVZA 3CDLA 3LOCA 4AF5A 4L62A 2UXHA 5GPCA 1T56A 3Q0WA 3O60A 1JUMA 3ZQHA 5FKKA 2FX0A 2G3BA 2VKEA 3VW2A 3Q0VA 5C4YA 2G0EA 5K7FA 3ON2A 4G12A 3Q3SA 3GEUA 3NI7A 5FMPA 3LJLA 2HKUA 4W97A 1A6IA 3BTIA 3HTHA 4GCTA 2O7OA 3KKDA 3HE0A 3HTAA 3COLA 3NNRA 4NELA 3IUVA 5D19A 3IH4A 4V2FA 4M3FA 3MVPA 3PASA 3TP0A 3T6NA 3IH2A 2NS7A 2XRLA 3ANGA 2QTQA 3EGQA 3LSPA 3G1MA 5EZGA 3B81A 5HAWA 3G1LA 3VVXA 3F1BA 3VOKA 3S5RA 3VW1A 2UXOA 2HYJA 2G7GA 5H9TA 3FK7A 1QVTA 5FKLA 3AQSA 2PBXA 1ORKA 4MO7A 3QBMA 3V6GA 3VW0A 3VPRA 2UXPA 4W1UA 5IP6A 3TP3A 3B6CA 3VIBA 2IU5A 5F0HA 2XB5A 3ZQIA 5IOYA 1T33A 5HBUA 4AUXA 3BTCA 3RD3A 2UXUA 4M3EA 2WUIA 3P9TA 3CCYA 1RKWA 4M3DA 2TCTA 3NPIA 3HTJA 5GPAA 2G7LA 3PPBA 3BHQA 1RKTA 3QPLA 2VPRA 2DTZA 4MXMA 1U9OA 5FGLA 2XDNA 5FKOA 3FRQA 5F0FA 3BR3A 5J1RA 3ZQGA 1VI0A 4UDSA 4ABZA 4NN1A 4I6ZA 3CWRA 4JNNA
chains in the Genus database with same CATH superfamily
4X1EA 2Y2ZA 3HGYA 2IAIA 1JUPA 2EH3A 1ZKGA 4XK4A 3LSJA 2G7SA 3BTJA 2YVEA 5J1UA 2R7RA 2XGDA 2HXOA 2GENA 2R7SA 2FBQA 4JKZA 2XGEA 3FK6A 3C07A 4U9NA 3BCGA 3CRJA 5CQGA 5D18A 3BR0A 2ZCNA 3QKXA 5FKMA 3LWJA 5D1RA 3CJDA 3DU5A 4ICHA 2XPWA 2FJ1A 4B3AA 2NP3A 5IOZA 4M3BA 3KKCA 3V78A 4JL3A 4GFLA 2D6YA 4V2GA 2NP5A 4DW6A 3EUPA 2NS8A 3BQZA 3HGGA 2YVXA 4IRVA 5EFYA 4D7MA 2UXIA 4AC6A 2X6OA 5CW8A 3DEWA 3C2BA 3ZQLA 3NRGA 2DG8A 1JTYA 2OF7A 4OD4A 5FKNA 2FD5A 4ACIA 3E7QA 1UI5A 2OI8A 3QPSA 2HQ5A 2XPVA 1SGMA 2ID6A 1QPIA 2OPTA 3G56A 2ZOZA 1BJZA 5F04A 3LSRA 1RPWA 2Q24A 2V57A 2ZCMA 5K58A 2RASA 2NX4A 3G1OA 1JUSA 3GZIA 4KWAA 3B6AA 2IEKA 2O7TA 2ZB9A 2Y30A 3KZ9A 3O8GA 2ID3A 4MK6A 3O8HA 4GFKA 2R7VA 3PM1A 2W53A 3MNLA 4D7NA 3FIWA 3BR1A 1QVUA 4JYKA 4D5FA 2GFNA 2QOPA 2GBYA 2R7UA 5F08A 3BR2A 5FHPA 5CXIA 2QCOA 4I76A 1JT6A 2VKVA 2PZ9A 2QKOA 3VVYA 3WHBA 3BQYA 3BTLA 3QQAA 3BJBA 1U9NA 2OERA 5HSZA 3DU6A 2DG7A 2X9DA 3VOXA 1UI6A 3KNWA 2XGCA 2I10A 2FQ4A 2YVHA 2GUHA 4GCKA 3F0CA 2HXIA 2QWTA 2F07A 5EYRA 5K7HA 1JT0A 2B1EA 2JK3A 3VUQA 3WHCA 4AC0A 2JJ7A 3HIMA 3BRUA 5F0CA 5EZHA 2HYTA 3Q0UA 4U9LA 2ZY9A 2ZCXA 4CGRA 4GCLA 5F27A 3AQTA 2RHAA 1ZK8A 2RAEA 1JTXA 3G7RA 3DPJA 3VP5A 5IPAA 2R7TA 3IH3A 3HTIA 5F1JA 2ZOYA 3ZQFA 5K7ZA 3BR5A 3SFIA 3SDGA 5J1YA 2Y31A 4D5CA 2TRTA 4ME9A 3FHNA 5GP9A 3BNIA 5AQCA 4HKUA 2REKA 2IBDA 5DAJA 3DCFA 1Z77A 4B1RA 5J3LA 4YZEA 3ON4A 4PXIA 4DVYP 3LHQA 3NXCA 3BR6A 4M3GA 3ANPA 2QIBA 2WV1A 5CXGA 2B3WA 3RH2A 3K8PC 3BT9A 3JSJA 1Z0XA 2XPUA 2WGBA 3VVZA 3CDLA 3LOCA 4AF5A 4L62A 2UXHA 2FJI1 1T56A 5GPCA 3Q0WA 3O60A 1JUMA 3ZQHA 5FKKA 2FX0A 2G3BA 2VKEA 3VW2A 3Q0VA 5C4YA 2G0EA 5K7FA 3ON2A 4G12A 3VTIA 2A2FX 3Q3SA 3GEUA 3NI7A 5FMPA 3LJLA 2HKUA 4W97A 1A6IA 3BTIA 3HTHA 4GCTA 2O7OA 3KKDA 3HE0A 3HTAA 2PFVA 3COLA 3NNRA 4NELA 3IUVA 5D19A 3IH4A 2R7QA 4V2FA 4M3FA 3MVPA 3PASA 3TP0A 3T6NA 3IH2A 2NS7A 3KYLA 2XRLA 3ANGA 2QTQA 3EGQA 3LSPA 3G1MA 5EZGA 3B81A 2R7XA 5HAWA 3G1LA 3VVXA 3F1BA 3VOKA 3S5RA 3VW1A 2UXOA 4C2MA 2HYJA 2G7GA 5H9TA 3FK7A 1QVTA 3NS4A 5FKLA 3AQSA 2PBXA 2R7WA 1ORKA 4MO7A 3QBMA 3V6GA 3VW0A 3VPRA 2UXPA 4WIBA 4W1UA 5IP6A 3TP3A 3B6CA 3VIBA 2IU5A 5F0HA 2XB5A 3ZQIA 5IOYA 1T33A 2R7OA 5HBUA 4AUXA 3BTCA 3RD3A 2UXUA 4M3EA 2WUIA 3P9TA 4OD5A 3CCYA 1RKWA 3SWHA 4M3DA 2TCTA 3NPIA 3HTJA 5GPAA 2G7LA 3PPBA 3BHQA 1RKTA 3QPLA 2VPRA 2DTZA 4MXMA 1U9OA 5FGLA 2XDNA 5FKOA 3FRQA 5F0FA 3BR3A 5J1RA 3ZQGA 1VI0A 4UDSA 4ABZA 4NN1A 4I6ZA 3CWRA 4JNNA
chains in the Genus database with same CATH topology
4X1EA 2Y2ZA 3HGYA 2IAIA 1JUPA 2EH3A 1ZKGA 4XK4A 3LSJA 2G7SA 3BTJA 2YVEA 5J1UA 2XGDA 2HXOA 2GENA 2FBQA 4JKZA 2XGEA 3FK6A 3C07A 3BCGA 3CRJA 5D18A 3BR0A 2ZCNA 3QKXA 5FKMA 3LWJA 5D1RA 3CJDA 4ICHA 2XPWA 2FJ1A 4B3AA 2NP3A 5IOZA 4M3BA 3KKCA 3V78A 4JL3A 4GFLA 2D6YA 4V2GA 2NP5A 4DW6A 3EUPA 2NS8A 3BQZA 3HGGA 5EFYA 4D7MA 2UXIA 4AC6A 2X6OA 5CW8A 3DEWA 3C2BA 3ZQLA 3NRGA 2DG8A 1JTYA 2OF7A 5FKNA 2FD5A 4ACIA 3E7QA 1UI5A 2OI8A 3QPSA 2HQ5A 2XPVA 1SGMA 2ID6A 1QPIA 2OPTA 3G56A 2ZOZA 1BJZA 5F04A 3LSRA 1RPWA 2Q24A 2V57A 2ZCMA 5K58A 2RASA 2NX4A 3G1OA 1JUSA 3GZIA 4KWAA 3B6AA 2IEKA 2O7TA 2ZB9A 2Y30A 3KZ9A 3O8GA 2ID3A 4MK6A 3O8HA 4GFKA 3PM1A 2W53A 3MNLA 4D7NA 3FIWA 3BR1A 1QVUA 4JYKA 4D5FA 2GFNA 2QOPA 2GBYA 5F08A 3BR2A 5FHPA 5CXIA 2QCOA 4I76A 1JT6A 2VKVA 2PZ9A 2QKOA 3VVYA 3WHBA 3BQYA 3BTLA 3QQAA 3BJBA 1U9NA 2OERA 5HSZA 2DG7A 2X9DA 3VOXA 1UI6A 3KNWA 2XGCA 2I10A 2FQ4A 2YVHA 2GUHA 4GCKA 3F0CA 2HXIA 2QWTA 2F07A 5EYRA 5K7HA 1JT0A 2JK3A 3VUQA 3WHCA 4AC0A 2JJ7A 3HIMA 3BRUA 5F0CA 5EZHA 2HYTA 3Q0UA 2ZCXA 4CGRA 4GCLA 5F27A 3AQTA 2RHAA 1ZK8A 2RAEA 1JTXA 3G7RA 3DPJA 3VP5A 5IPAA 3IH3A 3HTIA 5F1JA 2ZOYA 3ZQFA 5K7ZA 3BR5A 3SFIA 3SDGA 5J1YA 2Y31A 4D5CA 2TRTA 4ME9A 5GP9A 3BNIA 5AQCA 4HKUA 2REKA 2IBDA 5DAJA 3DCFA 1Z77A 4B1RA 5J3LA 4YZEA 3ON4A 4PXIA 3LHQA 3NXCA 3BR6A 4M3GA 3ANPA 2QIBA 2WV1A 5CXGA 3RH2A 3BT9A 3JSJA 1Z0XA 2XPUA 2WGBA 3VVZA 3CDLA 3LOCA 4AF5A 4L62A 2UXHA 5GPCA 1T56A 3Q0WA 3O60A 1JUMA 3ZQHA 5FKKA 2FX0A 2G3BA 2VKEA 3VW2A 3Q0VA 5C4YA 2G0EA 5K7FA 3ON2A 4G12A 3Q3SA 3GEUA 3NI7A 5FMPA 3LJLA 2HKUA 4W97A 1A6IA 3BTIA 3HTHA 4GCTA 2O7OA 3KKDA 3HE0A 3HTAA 3COLA 3NNRA 4NELA 3IUVA 5D19A 3IH4A 4V2FA 4M3FA 3MVPA 3PASA 3TP0A 3T6NA 3IH2A 2NS7A 2XRLA 3ANGA 2QTQA 3EGQA 3LSPA 3G1MA 5EZGA 3B81A 5HAWA 3G1LA 3VVXA 3F1BA 3VOKA 3S5RA 3VW1A 2UXOA 2HYJA 2G7GA 5H9TA 3FK7A 1QVTA 5FKLA 3AQSA 2PBXA 1ORKA 4MO7A 3QBMA 3V6GA 3VW0A 3VPRA 2UXPA 4W1UA 5IP6A 3TP3A 3B6CA 3VIBA 2IU5A 5F0HA 2XB5A 3ZQIA 5IOYA 1T33A 5HBUA 4AUXA 3BTCA 3RD3A 2UXUA 4M3EA 2WUIA 3P9TA 3CCYA 1RKWA 4M3DA 2TCTA 3NPIA 3HTJA 5GPAA 2G7LA 3PPBA 3BHQA 1RKTA 3QPLA 2VPRA 2DTZA 4MXMA 1U9OA 5FGLA 2XDNA 5FKOA 3FRQA 5F0FA 3BR3A 5J1RA 3ZQGA 1VI0A 4UDSA 4ABZA 4NN1A 4I6ZA 3CWRA 4JNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1E A;  2Y2Z A;  3HGY A;  2IAI A;  1JUP A;  2EH3 A;  1ZKG A;  4XK4 A;  3LSJ A;  2G7S A;  3BTJ A;  2YVE A;  5J1U A;  2XGD A;  2HXO A;  2GEN A;  2FBQ A;  4JKZ A;  2XGE A;  3FK6 A;  3C07 A;  3BCG A;  3CRJ A;  5D18 A;  3BR0 A;  2ZCN A;  3QKX A;  5FKM A;  3LWJ A;  5D1R A;  3CJD A;  4ICH A;  2XPW A;  2FJ1 A;  4B3A A;  2NP3 A;  5IOZ A;  4M3B A;  3KKC A;  3V78 A;  4JL3 A;  4GFL A;  2D6Y A;  4V2G A;  2NP5 A;  4DW6 A;  3EUP A;  2NS8 A;  3BQZ A;  3HGG A;  5EFY A;  4D7M A;  2UXI A;  4AC6 A;  2X6O A;  5CW8 A;  3DEW A;  3C2B A;  3ZQL A;  3NRG A;  2DG8 A;  1JTY A;  2OF7 A;  5FKN A;  2FD5 A;  4ACI A;  3E7Q A;  1UI5 A;  2OI8 A;  3QPS A;  2HQ5 A;  2XPV A;  1SGM A;  2ID6 A;  1QPI A;  2OPT A;  3G56 A;  2ZOZ A;  1BJZ A;  5F04 A;  3LSR A;  1RPW A;  2Q24 A;  2V57 A;  2ZCM A;  5K58 A;  2RAS A;  2NX4 A;  3G1O A;  1JUS A;  3GZI A;  4KWA A;  3B6A A;  2IEK A;  2O7T A;  2ZB9 A;  2Y30 A;  3KZ9 A;  3O8G A;  2ID3 A;  4MK6 A;  3O8H A;  4GFK A;  3PM1 A;  2W53 A;  3MNL A;  4D7N A;  3FIW A;  3BR1 A;  1QVU A;  4JYK A;  4D5F A;  2GFN A;  2QOP A;  2GBY A;  5F08 A;  3BR2 A;  5FHP A;  5CXI A;  2QCO A;  4I76 A;  1JT6 A;  2VKV A;  2PZ9 A;  2QKO A;  3VVY A;  3WHB A;  3BQY A;  3BTL A;  3QQA A;  3BJB A;  1U9N A;  2OER A;  5HSZ A;  2DG7 A;  2X9D A;  3VOX A;  1UI6 A;  3KNW A;  2XGC A;  2I10 A;  2FQ4 A;  2YVH A;  2GUH A;  4GCK A;  3F0C A;  2HXI A;  2QWT A;  2F07 A;  5EYR A;  5K7H A;  1JT0 A;  2JK3 A;  3VUQ A;  3WHC A;  4AC0 A;  2JJ7 A;  3HIM A;  3BRU A;  5F0C A;  5EZH A;  2HYT A;  3Q0U A;  2ZCX A;  4CGR A;  4GCL A;  5F27 A;  3AQT A;  2RHA A;  1ZK8 A;  2RAE A;  1JTX A;  3G7R A;  3DPJ A;  3VP5 A;  5IPA A;  3IH3 A;  3HTI A;  5F1J A;  2ZOY A;  3ZQF A;  5K7Z A;  3BR5 A;  3SFI A;  3SDG A;  5J1Y A;  2Y31 A;  4D5C A;  2TRT A;  4ME9 A;  5GP9 A;  3BNI A;  5AQC A;  4HKU A;  2REK A;  2IBD A;  5DAJ A;  3DCF A;  1Z77 A;  4B1R A;  5J3L A;  4YZE A;  3ON4 A;  4PXI A;  3LHQ A;  3NXC A;  3BR6 A;  4M3G A;  3ANP A;  2QIB A;  2WV1 A;  5CXG A;  3RH2 A;  3BT9 A;  3JSJ A;  1Z0X A;  2XPU A;  2WGB A;  3VVZ A;  3CDL A;  3LOC A;  4AF5 A;  4L62 A;  2UXH A;  5GPC A;  1T56 A;  3Q0W A;  3O60 A;  1JUM A;  3ZQH A;  5FKK A;  2FX0 A;  2G3B A;  2VKE A;  3VW2 A;  3Q0V A;  5C4Y A;  2G0E A;  5K7F A;  3ON2 A;  4G12 A;  3Q3S A;  3GEU A;  3NI7 A;  5FMP A;  3LJL A;  2HKU A;  4W97 A;  1A6I A;  3BTI A;  3HTH A;  4GCT A;  2O7O A;  3KKD A;  3HE0 A;  3HTA A;  3COL A;  3NNR A;  4NEL A;  3IUV A;  5D19 A;  3IH4 A;  4V2F A;  4M3F A;  3MVP A;  3PAS A;  3TP0 A;  3T6N A;  3IH2 A;  2NS7 A;  2XRL A;  3ANG A;  2QTQ A;  3EGQ A;  3LSP A;  3G1M A;  5EZG A;  3B81 A;  5HAW A;  3G1L A;  3VVX A;  3F1B A;  3VOK A;  3S5R A;  3VW1 A;  2UXO A;  2HYJ A;  2G7G A;  5H9T A;  3FK7 A;  1QVT A;  5FKL A;  3AQS A;  2PBX A;  1ORK A;  4MO7 A;  3QBM A;  3V6G A;  3VW0 A;  3VPR A;  2UXP A;  4W1U A;  5IP6 A;  3TP3 A;  3B6C A;  3VIB A;  2IU5 A;  5F0H A;  2XB5 A;  3ZQI A;  5IOY A;  1T33 A;  5HBU A;  4AUX A;  3BTC A;  3RD3 A;  2UXU A;  4M3E A;  2WUI A;  3P9T A;  3CCY A;  1RKW A;  4M3D A;  2TCT A;  3NPI A;  3HTJ A;  5GPA A;  2G7L A;  3PPB A;  3BHQ A;  1RKT A;  3QPL A;  2VPR A;  2DTZ A;  4MXM A;  1U9O A;  5FGL A;  2XDN A;  5FKO A;  3FRQ A;  5F0F A;  3BR3 A;  5J1R A;  3ZQG A;  1VI0 A;  4UDS A;  4ABZ A;  4NN1 A;  4I6Z A;  3CWR A;  4JNN A; 
#chains in the Genus database with same CATH topology
 4X1E A;  2Y2Z A;  3HGY A;  2IAI A;  1JUP A;  2EH3 A;  1ZKG A;  4XK4 A;  3LSJ A;  2G7S A;  3BTJ A;  2YVE A;  5J1U A;  2R7R A;  2XGD A;  2HXO A;  2GEN A;  2R7S A;  2FBQ A;  4JKZ A;  2XGE A;  3FK6 A;  3C07 A;  4U9N A;  3BCG A;  3CRJ A;  5CQG A;  5D18 A;  3BR0 A;  2ZCN A;  3QKX A;  5FKM A;  3LWJ A;  5D1R A;  3CJD A;  3DU5 A;  4ICH A;  2XPW A;  2FJ1 A;  4B3A A;  2NP3 A;  5IOZ A;  4M3B A;  3KKC A;  3V78 A;  4JL3 A;  4GFL A;  2D6Y A;  4V2G A;  2NP5 A;  4DW6 A;  3EUP A;  2NS8 A;  3BQZ A;  3HGG A;  2YVX A;  4IRV A;  5EFY A;  4D7M A;  2UXI A;  4AC6 A;  2X6O A;  5CW8 A;  3DEW A;  3C2B A;  3ZQL A;  3NRG A;  2DG8 A;  1JTY A;  2OF7 A;  4OD4 A;  5FKN A;  2FD5 A;  4ACI A;  3E7Q A;  1UI5 A;  2OI8 A;  3QPS A;  2HQ5 A;  2XPV A;  1SGM A;  2ID6 A;  1QPI A;  2OPT A;  3G56 A;  2ZOZ A;  1BJZ A;  5F04 A;  3LSR A;  1RPW A;  2Q24 A;  2V57 A;  2ZCM A;  5K58 A;  2RAS A;  2NX4 A;  3G1O A;  1JUS A;  3GZI A;  4KWA A;  3B6A A;  2IEK A;  2O7T A;  2ZB9 A;  2Y30 A;  3KZ9 A;  3O8G A;  2ID3 A;  4MK6 A;  3O8H A;  4GFK A;  2R7V A;  3PM1 A;  2W53 A;  3MNL A;  4D7N A;  3FIW A;  3BR1 A;  1QVU A;  4JYK A;  4D5F A;  2GFN A;  2QOP A;  2GBY A;  2R7U A;  5F08 A;  3BR2 A;  5FHP A;  5CXI A;  2QCO A;  4I76 A;  1JT6 A;  2VKV A;  2PZ9 A;  2QKO A;  3VVY A;  3WHB A;  3BQY A;  3BTL A;  3QQA A;  3BJB A;  1U9N A;  2OER A;  5HSZ A;  3DU6 A;  2DG7 A;  2X9D A;  3VOX A;  1UI6 A;  3KNW A;  2XGC A;  2I10 A;  2FQ4 A;  2YVH A;  2GUH A;  4GCK A;  3F0C A;  2HXI A;  2QWT A;  2F07 A;  5EYR A;  5K7H A;  1JT0 A;  2B1E A;  2JK3 A;  3VUQ A;  3WHC A;  4AC0 A;  2JJ7 A;  3HIM A;  3BRU A;  5F0C A;  5EZH A;  2HYT A;  3Q0U A;  4U9L A;  2ZY9 A;  2ZCX A;  4CGR A;  4GCL A;  5F27 A;  3AQT A;  2RHA A;  1ZK8 A;  2RAE A;  1JTX A;  3G7R A;  3DPJ A;  3VP5 A;  5IPA A;  2R7T A;  3IH3 A;  3HTI A;  5F1J A;  2ZOY A;  3ZQF A;  5K7Z A;  3BR5 A;  3SFI A;  3SDG A;  5J1Y A;  2Y31 A;  4D5C A;  2TRT A;  4ME9 A;  3FHN A;  5GP9 A;  3BNI A;  5AQC A;  4HKU A;  2REK A;  2IBD A;  5DAJ A;  3DCF A;  1Z77 A;  4B1R A;  5J3L A;  4YZE A;  3ON4 A;  4PXI A;  4DVY P;  3LHQ A;  3NXC A;  3BR6 A;  4M3G A;  3ANP A;  2QIB A;  2WV1 A;  5CXG A;  2B3W A;  3RH2 A;  3K8P C;  3BT9 A;  3JSJ A;  1Z0X A;  2XPU A;  2WGB A;  3VVZ A;  3CDL A;  3LOC A;  4AF5 A;  4L62 A;  2UXH A;  2FJI 1;  1T56 A;  5GPC A;  3Q0W A;  3O60 A;  1JUM A;  3ZQH A;  5FKK A;  2FX0 A;  2G3B A;  2VKE A;  3VW2 A;  3Q0V A;  5C4Y A;  2G0E A;  5K7F A;  3ON2 A;  4G12 A;  3VTI A;  2A2F X;  3Q3S A;  3GEU A;  3NI7 A;  5FMP A;  3LJL A;  2HKU A;  4W97 A;  1A6I A;  3BTI A;  3HTH A;  4GCT A;  2O7O A;  3KKD A;  3HE0 A;  3HTA A;  2PFV A;  3COL A;  3NNR A;  4NEL A;  3IUV A;  5D19 A;  3IH4 A;  2R7Q A;  4V2F A;  4M3F A;  3MVP A;  3PAS A;  3TP0 A;  3T6N A;  3IH2 A;  2NS7 A;  3KYL A;  2XRL A;  3ANG A;  2QTQ A;  3EGQ A;  3LSP A;  3G1M A;  5EZG A;  3B81 A;  2R7X A;  5HAW A;  3G1L A;  3VVX A;  3F1B A;  3VOK A;  3S5R A;  3VW1 A;  2UXO A;  4C2M A;  2HYJ A;  2G7G A;  5H9T A;  3FK7 A;  1QVT A;  3NS4 A;  5FKL A;  3AQS A;  2PBX A;  2R7W A;  1ORK A;  4MO7 A;  3QBM A;  3V6G A;  3VW0 A;  3VPR A;  2UXP A;  4WIB A;  4W1U A;  5IP6 A;  3TP3 A;  3B6C A;  3VIB A;  2IU5 A;  5F0H A;  2XB5 A;  3ZQI A;  5IOY A;  1T33 A;  2R7O A;  5HBU A;  4AUX A;  3BTC A;  3RD3 A;  2UXU A;  4M3E A;  2WUI A;  3P9T A;  4OD5 A;  3CCY A;  1RKW A;  3SWH A;  4M3D A;  2TCT A;  3NPI A;  3HTJ A;  5GPA A;  2G7L A;  3PPB A;  3BHQ A;  1RKT A;  3QPL A;  2VPR A;  2DTZ A;  4MXM A;  1U9O A;  5FGL A;  2XDN A;  5FKO A;  3FRQ A;  5F0F A;  3BR3 A;  5J1R A;  3ZQG A;  1VI0 A;  4UDS A;  4ABZ A;  4NN1 A;  4I6Z A;  3CWR A;  4JNN A; 
#chains in the Genus database with same CATH homology
 4X1E A;  2Y2Z A;  3HGY A;  2IAI A;  1JUP A;  2EH3 A;  1ZKG A;  4XK4 A;  3LSJ A;  2G7S A;  3BTJ A;  2YVE A;  5J1U A;  2XGD A;  2HXO A;  2GEN A;  2FBQ A;  4JKZ A;  2XGE A;  3FK6 A;  3C07 A;  3BCG A;  3CRJ A;  5D18 A;  3BR0 A;  2ZCN A;  3QKX A;  5FKM A;  3LWJ A;  5D1R A;  3CJD A;  4ICH A;  2XPW A;  2FJ1 A;  4B3A A;  2NP3 A;  5IOZ A;  4M3B A;  3KKC A;  3V78 A;  4JL3 A;  4GFL A;  2D6Y A;  4V2G A;  2NP5 A;  4DW6 A;  3EUP A;  2NS8 A;  3BQZ A;  3HGG A;  5EFY A;  4D7M A;  2UXI A;  4AC6 A;  2X6O A;  5CW8 A;  3DEW A;  3C2B A;  3ZQL A;  3NRG A;  2DG8 A;  1JTY A;  2OF7 A;  5FKN A;  2FD5 A;  4ACI A;  3E7Q A;  1UI5 A;  2OI8 A;  3QPS A;  2HQ5 A;  2XPV A;  1SGM A;  2ID6 A;  1QPI A;  2OPT A;  3G56 A;  2ZOZ A;  1BJZ A;  5F04 A;  3LSR A;  1RPW A;  2Q24 A;  2V57 A;  2ZCM A;  5K58 A;  2RAS A;  2NX4 A;  3G1O A;  1JUS A;  3GZI A;  4KWA A;  3B6A A;  2IEK A;  2O7T A;  2ZB9 A;  2Y30 A;  3KZ9 A;  3O8G A;  2ID3 A;  4MK6 A;  3O8H A;  4GFK A;  3PM1 A;  2W53 A;  3MNL A;  4D7N A;  3FIW A;  3BR1 A;  1QVU A;  4JYK A;  4D5F A;  2GFN A;  2QOP A;  2GBY A;  5F08 A;  3BR2 A;  5FHP A;  5CXI A;  2QCO A;  4I76 A;  1JT6 A;  2VKV A;  2PZ9 A;  2QKO A;  3VVY A;  3WHB A;  3BQY A;  3BTL A;  3QQA A;  3BJB A;  1U9N A;  2OER A;  5HSZ A;  2DG7 A;  2X9D A;  3VOX A;  1UI6 A;  3KNW A;  2XGC A;  2I10 A;  2FQ4 A;  2YVH A;  2GUH A;  4GCK A;  3F0C A;  2HXI A;  2QWT A;  2F07 A;  5EYR A;  5K7H A;  1JT0 A;  2JK3 A;  3VUQ A;  3WHC A;  4AC0 A;  2JJ7 A;  3HIM A;  3BRU A;  5F0C A;  5EZH A;  2HYT A;  3Q0U A;  2ZCX A;  4CGR A;  4GCL A;  5F27 A;  3AQT A;  2RHA A;  1ZK8 A;  2RAE A;  1JTX A;  3G7R A;  3DPJ A;  3VP5 A;  5IPA A;  3IH3 A;  3HTI A;  5F1J A;  2ZOY A;  3ZQF A;  5K7Z A;  3BR5 A;  3SFI A;  3SDG A;  5J1Y A;  2Y31 A;  4D5C A;  2TRT A;  4ME9 A;  5GP9 A;  3BNI A;  5AQC A;  4HKU A;  2REK A;  2IBD A;  5DAJ A;  3DCF A;  1Z77 A;  4B1R A;  5J3L A;  4YZE A;  3ON4 A;  4PXI A;  3LHQ A;  3NXC A;  3BR6 A;  4M3G A;  3ANP A;  2QIB A;  2WV1 A;  5CXG A;  3RH2 A;  3BT9 A;  3JSJ A;  1Z0X A;  2XPU A;  2WGB A;  3VVZ A;  3CDL A;  3LOC A;  4AF5 A;  4L62 A;  2UXH A;  5GPC A;  1T56 A;  3Q0W A;  3O60 A;  1JUM A;  3ZQH A;  5FKK A;  2FX0 A;  2G3B A;  2VKE A;  3VW2 A;  3Q0V A;  5C4Y A;  2G0E A;  5K7F A;  3ON2 A;  4G12 A;  3Q3S A;  3GEU A;  3NI7 A;  5FMP A;  3LJL A;  2HKU A;  4W97 A;  1A6I A;  3BTI A;  3HTH A;  4GCT A;  2O7O A;  3KKD A;  3HE0 A;  3HTA A;  3COL A;  3NNR A;  4NEL A;  3IUV A;  5D19 A;  3IH4 A;  4V2F A;  4M3F A;  3MVP A;  3PAS A;  3TP0 A;  3T6N A;  3IH2 A;  2NS7 A;  2XRL A;  3ANG A;  2QTQ A;  3EGQ A;  3LSP A;  3G1M A;  5EZG A;  3B81 A;  5HAW A;  3G1L A;  3VVX A;  3F1B A;  3VOK A;  3S5R A;  3VW1 A;  2UXO A;  2HYJ A;  2G7G A;  5H9T A;  3FK7 A;  1QVT A;  5FKL A;  3AQS A;  2PBX A;  1ORK A;  4MO7 A;  3QBM A;  3V6G A;  3VW0 A;  3VPR A;  2UXP A;  4W1U A;  5IP6 A;  3TP3 A;  3B6C A;  3VIB A;  2IU5 A;  5F0H A;  2XB5 A;  3ZQI A;  5IOY A;  1T33 A;  5HBU A;  4AUX A;  3BTC A;  3RD3 A;  2UXU A;  4M3E A;  2WUI A;  3P9T A;  3CCY A;  1RKW A;  4M3D A;  2TCT A;  3NPI A;  3HTJ A;  5GPA A;  2G7L A;  3PPB A;  3BHQ A;  1RKT A;  3QPL A;  2VPR A;  2DTZ A;  4MXM A;  1U9O A;  5FGL A;  2XDN A;  5FKO A;  3FRQ A;  5F0F A;  3BR3 A;  5J1R A;  3ZQG A;  1VI0 A;  4UDS A;  4ABZ A;  4NN1 A;  4I6Z A;  3CWR A;  4JNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...