2ZOZA

Crystal structure of the ethidium-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
172
structure length
172
Chain Sequence
TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 65
structure length 172
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zozA00
4GFKA 4X1EA 4AC6A 3QPLA 3LOCA 3O8HA 4GCLA 3LJLA 2Y30A 1ZK8A 2JJ7A 3ZQIA 5J1RA 2Y31A 3FRQA 3KNWA 2ZCMA 3BTCA 3ANPA 3V6GA 2GENA 3IH4A 5HAWA 4I6ZA 4MO7A 2OERA 5F27A 3LSJA 2UXUA 5IPAA 3BRUA 3LWJA 3EGQA 4UDSA 2NP5A 3SFIA 5J1YA 2O7OA 3VW0A 3RH2A 4DW6A 5DAJA 3ON2A 3S5RA 5K7HA 3HIMA 1BJZA 2G0EA 4M3EA 2X6OA 3NPIA 2FBQA 3HTIA 3BR2A 4GFLA 2HKUA 4CGRA 5CW8A 2WV1A 3CCYA 3G56A 3F1BA 1JTYA 5J1UA 3VIBA 3C07A 2G3BA 2OI8A 4JKZA 3QBMA 3HGGA 3FK6A 4G12A 2ZOZA 2IEKA 2ZOYA 2RHAA 5GPCA 3QPSA 2JK3A 2GUHA 3O60A 4M3DA 2TCTA 3KKCA 1VI0A 3KZ9A 3JSJA 1A6IA 4M3FA 5F0CA 2RASA 2Q24A 3HTHA 4B1RA 5D1RA 2ZCNA 5IOZA 3RD3A 3G1OA 3LHQA 3Q3SA 4JYKA 5IOYA 3SDGA 4M3GA 2QKOA 3BJBA 3PPBA 3NXCA 3WHCA 2UXPA 2O7TA 2DG8A 4YZEA 5F08A 2D6YA 3BTJA 3VOXA 3VP5A 2ZB9A 2OF7A 4B3AA 1T33A 4MK6A 2XGDA 2F07A 2EH3A 4XK4A 3B6AA 2HQ5A 3VW1A 3TP3A 2HYJA 3BNIA 4AUXA 3NI7A 2XGCA 3O8GA 1JTXA 3CJDA 2GBYA 3BR1A 3CWRA 2QTQA 3VVYA 2Y2ZA 2VKVA 1JUSA 1RPWA 3AQSA 3VOKA 2IBDA 2QIBA 2ID6A 2NS7A 2G7LA 2NX4A 2UXIA 2OPTA 3IUVA 5K7ZA 5EZGA 5FKLA 4L62A 3G1LA 2QOPA 3EUPA 1JT0A 2YVEA 5FHPA 2IU5A 4GCTA 4HKUA 3PASA 3BR0A 3FIWA 3MVPA 3ZQLA 2HYTA 5C4YA 1U9OA 3VVZA 2ID3A 2DG7A 3CDLA 1ZKGA 1QVTA 2ZCXA 5K7FA 5K58A 3CRJA 5HSZA 1SGMA 5FKMA 2XRLA 3BHQA 2VKEA 5F0HA 1ORKA 3BR6A 1RKWA 2GFNA 2REKA 2TRTA 1QPIA 3QQAA 4KWAA 4ICHA 3TP0A 4I76A 5FKOA 4JL3A 2I10A 2IAIA 4JNNA 2XGEA 2XDNA 1UI5A 2XPUA 4ACIA 3ANGA 4W97A 5EZHA 2FD5A 2FQ4A 3ZQHA 2QWTA 2PZ9A 2HXIA 5AQCA 5FKKA 3BT9A 3BQZA 3ON4A 5D18A 2WGBA 3NNRA 2G7GA 4NN1A 2FX0A 5GPAA 5FMPA 4NELA 2X9DA 2FJ1A 5EFYA 2XPWA 4D5FA 4V2FA 2RAEA 3VW2A 3LSPA 2V57A 5F1JA 3FK7A 4ABZA 3MNLA 3F0CA 4MXMA 3IH2A 4AC0A 4M3BA 3QKXA 3HTAA 4D7NA 3P9TA 2W53A 1JUMA 3AQTA 3BR5A 3IH3A 2QCOA 3LSRA 3ZQGA 1U9NA 3BTIA 5CXGA 5J3LA 3Q0VA 3C2BA 1Z0XA 3B6CA 3PM1A 1JUPA 5F04A 3G7RA 3GZIA 4D7MA 3DCFA 5CXIA 2UXHA 3DEWA 3BCGA 5FKNA 3WHBA 1QVUA 3Q0UA 3V78A 5D19A 4W1UA 2WUIA 3COLA 5HBUA 3DPJA 2PBXA 2YVHA 3BTLA 3VUQA 4AF5A 5H9TA 2HXOA 1T56A 3NRGA 2UXOA 4V2GA 3T6NA 4ME9A 5FGLA 3KKDA 5GP9A 4D5CA 3Q0WA 2XB5A 2G7SA 2DTZA 4PXIA 5EYRA 3BR3A 5IP6A 3HE0A 1Z77A 3VVXA 1UI6A 3E7QA 3GEUA 5F0FA 3BQYA 3HGYA 2NS8A 2XPVA 3B81A 1JT6A 3HTJA 3G1MA 2VPRA 3VPRA 2NP3A 4GCKA 1RKTA 3ZQFA
chains in the Genus database with same CATH superfamily
4GFKA 4X1EA 4AC6A 3QPLA 3LOCA 3O8HA 4GCLA 3LJLA 2Y30A 1ZK8A 2JJ7A 3ZQIA 5J1RA 2Y31A 3FRQA 3KNWA 2ZCMA 3BTCA 3ANPA 3V6GA 2GENA 3IH4A 5HAWA 4I6ZA 4MO7A 2OERA 5F27A 3LSJA 2UXUA 5IPAA 3BRUA 3K8PC 3EGQA 3LWJA 4UDSA 2NP5A 3SFIA 5J1YA 2O7OA 3VW0A 3RH2A 4DW6A 2R7QA 5DAJA 3ON2A 3S5RA 2FJI1 5K7HA 3HIMA 1BJZA 2G0EA 4M3EA 2X6OA 3NPIA 2FBQA 3HTIA 3BR2A 4GFLA 2HKUA 4CGRA 5CW8A 2WV1A 3CCYA 2PFVA 3G56A 3F1BA 1JTYA 3KYLA 5J1UA 3VIBA 2R7VA 3C07A 2G3BA 2OI8A 4JKZA 3QBMA 3HGGA 3FK6A 4G12A 2ZOZA 2IEKA 2ZOYA 2RHAA 5GPCA 3QPSA 2JK3A 2GUHA 3O60A 4M3DA 2TCTA 3KKCA 1VI0A 3KZ9A 3NS4A 3JSJA 1A6IA 4M3FA 5F0CA 2RASA 2Q24A 3HTHA 4B1RA 5D1RA 2ZCNA 5IOZA 3RD3A 3G1OA 3LHQA 3Q3SA 4JYKA 5IOYA 2R7OA 4M3GA 3SDGA 2QKOA 3BJBA 3PPBA 3NXCA 3WHCA 2UXPA 2O7TA 2DG8A 4YZEA 5F08A 2D6YA 3BTJA 3VOXA 3VP5A 2R7RA 2ZB9A 2OF7A 4B3AA 1T33A 4MK6A 2XGDA 2F07A 2EH3A 4XK4A 3B6AA 2R7UA 2HQ5A 3SWHA 3VW1A 3TP3A 2HYJA 3BNIA 4AUXA 3NI7A 2XGCA 3O8GA 1JTXA 4OD4A 3CJDA 2GBYA 3BR1A 3CWRA 2QTQA 3VVYA 2Y2ZA 2VKVA 1JUSA 1RPWA 3AQSA 3VOKA 2IBDA 2QIBA 2ID6A 2NS7A 2G7LA 2NX4A 2UXIA 2OPTA 3IUVA 5K7ZA 5EZGA 5FKLA 4L62A 3G1LA 2QOPA 3EUPA 1JT0A 2YVEA 5FHPA 2IU5A 4GCTA 4IRVA 4HKUA 3PASA 3BR0A 3FIWA 3MVPA 3ZQLA 2HYTA 5C4YA 1U9OA 3VVZA 2ID3A 2DG7A 3CDLA 1ZKGA 1QVTA 3VTIA 2ZCXA 5K7FA 5K58A 3CRJA 5HSZA 4DVYP 1SGMA 5FKMA 2XRLA 3BHQA 2VKEA 5F0HA 1ORKA 3BR6A 1RKWA 2GFNA 2REKA 2TRTA 4U9NA 1QPIA 3QQAA 4KWAA 4ICHA 3TP0A 4I76A 5FKOA 4JL3A 2I10A 2IAIA 4JNNA 2XGEA 2XDNA 2B1EA 1UI5A 2XPUA 4ACIA 3ANGA 4W97A 2R7SA 5EZHA 2FD5A 2FQ4A 3ZQHA 2QWTA 2PZ9A 2HXIA 5AQCA 2R7WA 5FKKA 2B3WA 2YVXA 3FHNA 3BT9A 3BQZA 3ON4A 5D18A 2WGBA 3NNRA 2G7GA 4NN1A 2FX0A 5GPAA 5FMPA 4NELA 2X9DA 2FJ1A 5EFYA 2XPWA 4D5FA 4V2FA 2RAEA 3VW2A 3LSPA 2V57A 5F1JA 3FK7A 4ABZA 3MNLA 3F0CA 4MXMA 3IH2A 4AC0A 4M3BA 3QKXA 3HTAA 4D7NA 3P9TA 2W53A 1JUMA 3AQTA 3BR5A 3IH3A 2QCOA 3LSRA 3ZQGA 1U9NA 3BTIA 5CXGA 5J3LA 2R7XA 3Q0VA 3C2BA 1Z0XA 3B6CA 3PM1A 1JUPA 3DU6A 5F04A 2R7TA 3DU5A 3G7RA 3GZIA 4D7MA 5CXIA 3DCFA 2UXHA 3DEWA 3BCGA 5FKNA 3WHBA 1QVUA 3Q0UA 3V78A 5D19A 4W1UA 2WUIA 3COLA 2ZY9A 5HBUA 3DPJA 2PBXA 2YVHA 3BTLA 3VUQA 4AF5A 5H9TA 2HXOA 1T56A 3NRGA 2UXOA 4V2GA 3T6NA 5CQGA 4ME9A 5FGLA 3KKDA 5GP9A 4D5CA 3Q0WA 2XB5A 4OD5A 2G7SA 2DTZA 4PXIA 5EYRA 3BR3A 5IP6A 3HE0A 1Z77A 3VVXA 1UI6A 3E7QA 3GEUA 2A2FX 4U9LA 5F0FA 3BQYA 3HGYA 2NS8A 2XPVA 3B81A 1JT6A 4C2MA 3HTJA 3G1MA 2VPRA 3VPRA 2NP3A 4WIBA 4GCKA 1RKTA 3ZQFA
chains in the Genus database with same CATH topology
4GFKA 4X1EA 4AC6A 3QPLA 3LOCA 3O8HA 4GCLA 3LJLA 2Y30A 1ZK8A 2JJ7A 3ZQIA 5J1RA 2Y31A 3FRQA 3KNWA 2ZCMA 3BTCA 3ANPA 3V6GA 2GENA 3IH4A 5HAWA 4I6ZA 4MO7A 2OERA 5F27A 3LSJA 2UXUA 5IPAA 3BRUA 3LWJA 3EGQA 4UDSA 2NP5A 3SFIA 5J1YA 2O7OA 3VW0A 3RH2A 4DW6A 5DAJA 3ON2A 3S5RA 5K7HA 3HIMA 1BJZA 2G0EA 4M3EA 2X6OA 3NPIA 2FBQA 3HTIA 3BR2A 4GFLA 2HKUA 4CGRA 5CW8A 2WV1A 3CCYA 3G56A 3F1BA 1JTYA 5J1UA 3VIBA 3C07A 2G3BA 2OI8A 4JKZA 3QBMA 3HGGA 3FK6A 4G12A 2ZOZA 2IEKA 2ZOYA 2RHAA 5GPCA 3QPSA 2JK3A 2GUHA 3O60A 4M3DA 2TCTA 3KKCA 1VI0A 3KZ9A 3JSJA 1A6IA 4M3FA 5F0CA 2RASA 2Q24A 3HTHA 4B1RA 5D1RA 2ZCNA 5IOZA 3RD3A 3G1OA 3LHQA 3Q3SA 4JYKA 5IOYA 3SDGA 4M3GA 2QKOA 3BJBA 3PPBA 3NXCA 3WHCA 2UXPA 2O7TA 2DG8A 4YZEA 5F08A 2D6YA 3BTJA 3VOXA 3VP5A 2ZB9A 2OF7A 4B3AA 1T33A 4MK6A 2XGDA 2F07A 2EH3A 4XK4A 3B6AA 2HQ5A 3VW1A 3TP3A 2HYJA 3BNIA 4AUXA 3NI7A 2XGCA 3O8GA 1JTXA 3CJDA 2GBYA 3BR1A 3CWRA 2QTQA 3VVYA 2Y2ZA 2VKVA 1JUSA 1RPWA 3AQSA 3VOKA 2IBDA 2QIBA 2ID6A 2NS7A 2G7LA 2NX4A 2UXIA 2OPTA 3IUVA 5K7ZA 5EZGA 5FKLA 4L62A 3G1LA 2QOPA 3EUPA 1JT0A 2YVEA 5FHPA 2IU5A 4GCTA 4HKUA 3PASA 3BR0A 3FIWA 3MVPA 3ZQLA 2HYTA 5C4YA 1U9OA 3VVZA 2ID3A 2DG7A 3CDLA 1ZKGA 1QVTA 2ZCXA 5K7FA 5K58A 3CRJA 5HSZA 1SGMA 5FKMA 2XRLA 3BHQA 2VKEA 5F0HA 1ORKA 3BR6A 1RKWA 2GFNA 2REKA 2TRTA 1QPIA 3QQAA 4KWAA 4ICHA 3TP0A 4I76A 5FKOA 4JL3A 2I10A 2IAIA 4JNNA 2XGEA 2XDNA 1UI5A 2XPUA 4ACIA 3ANGA 4W97A 5EZHA 2FD5A 2FQ4A 3ZQHA 2QWTA 2PZ9A 2HXIA 5AQCA 5FKKA 3BT9A 3BQZA 3ON4A 5D18A 2WGBA 3NNRA 2G7GA 4NN1A 2FX0A 5GPAA 5FMPA 4NELA 2X9DA 2FJ1A 5EFYA 2XPWA 4D5FA 4V2FA 2RAEA 3VW2A 3LSPA 2V57A 5F1JA 3FK7A 4ABZA 3MNLA 3F0CA 4MXMA 3IH2A 4AC0A 4M3BA 3QKXA 3HTAA 4D7NA 3P9TA 2W53A 1JUMA 3AQTA 3BR5A 3IH3A 2QCOA 3LSRA 3ZQGA 1U9NA 3BTIA 5CXGA 5J3LA 3Q0VA 3C2BA 1Z0XA 3B6CA 3PM1A 1JUPA 5F04A 3G7RA 3GZIA 4D7MA 3DCFA 5CXIA 2UXHA 3DEWA 3BCGA 5FKNA 3WHBA 1QVUA 3Q0UA 3V78A 5D19A 4W1UA 2WUIA 3COLA 5HBUA 3DPJA 2PBXA 2YVHA 3BTLA 3VUQA 4AF5A 5H9TA 2HXOA 1T56A 3NRGA 2UXOA 4V2GA 3T6NA 4ME9A 5FGLA 3KKDA 5GP9A 4D5CA 3Q0WA 2XB5A 2G7SA 2DTZA 4PXIA 5EYRA 3BR3A 5IP6A 3HE0A 1Z77A 3VVXA 1UI6A 3E7QA 3GEUA 5F0FA 3BQYA 3HGYA 2NS8A 2XPVA 3B81A 1JT6A 3HTJA 3G1MA 2VPRA 3VPRA 2NP3A 4GCKA 1RKTA 3ZQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFK A;  4X1E A;  4AC6 A;  3QPL A;  3LOC A;  3O8H A;  4GCL A;  3LJL A;  2Y30 A;  1ZK8 A;  2JJ7 A;  3ZQI A;  5J1R A;  2Y31 A;  3FRQ A;  3KNW A;  2ZCM A;  3BTC A;  3ANP A;  3V6G A;  2GEN A;  3IH4 A;  5HAW A;  4I6Z A;  4MO7 A;  2OER A;  5F27 A;  3LSJ A;  2UXU A;  5IPA A;  3BRU A;  3LWJ A;  3EGQ A;  4UDS A;  2NP5 A;  3SFI A;  5J1Y A;  2O7O A;  3VW0 A;  3RH2 A;  4DW6 A;  5DAJ A;  3ON2 A;  3S5R A;  5K7H A;  3HIM A;  1BJZ A;  2G0E A;  4M3E A;  2X6O A;  3NPI A;  2FBQ A;  3HTI A;  3BR2 A;  4GFL A;  2HKU A;  4CGR A;  5CW8 A;  2WV1 A;  3CCY A;  3G56 A;  3F1B A;  1JTY A;  5J1U A;  3VIB A;  3C07 A;  2G3B A;  2OI8 A;  4JKZ A;  3QBM A;  3HGG A;  3FK6 A;  4G12 A;  2ZOZ A;  2IEK A;  2ZOY A;  2RHA A;  5GPC A;  3QPS A;  2JK3 A;  2GUH A;  3O60 A;  4M3D A;  2TCT A;  3KKC A;  1VI0 A;  3KZ9 A;  3JSJ A;  1A6I A;  4M3F A;  5F0C A;  2RAS A;  2Q24 A;  3HTH A;  4B1R A;  5D1R A;  2ZCN A;  5IOZ A;  3RD3 A;  3G1O A;  3LHQ A;  3Q3S A;  4JYK A;  5IOY A;  3SDG A;  4M3G A;  2QKO A;  3BJB A;  3PPB A;  3NXC A;  3WHC A;  2UXP A;  2O7T A;  2DG8 A;  4YZE A;  5F08 A;  2D6Y A;  3BTJ A;  3VOX A;  3VP5 A;  2ZB9 A;  2OF7 A;  4B3A A;  1T33 A;  4MK6 A;  2XGD A;  2F07 A;  2EH3 A;  4XK4 A;  3B6A A;  2HQ5 A;  3VW1 A;  3TP3 A;  2HYJ A;  3BNI A;  4AUX A;  3NI7 A;  2XGC A;  3O8G A;  1JTX A;  3CJD A;  2GBY A;  3BR1 A;  3CWR A;  2QTQ A;  3VVY A;  2Y2Z A;  2VKV A;  1JUS A;  1RPW A;  3AQS A;  3VOK A;  2IBD A;  2QIB A;  2ID6 A;  2NS7 A;  2G7L A;  2NX4 A;  2UXI A;  2OPT A;  3IUV A;  5K7Z A;  5EZG A;  5FKL A;  4L62 A;  3G1L A;  2QOP A;  3EUP A;  1JT0 A;  2YVE A;  5FHP A;  2IU5 A;  4GCT A;  4HKU A;  3PAS A;  3BR0 A;  3FIW A;  3MVP A;  3ZQL A;  2HYT A;  5C4Y A;  1U9O A;  3VVZ A;  2ID3 A;  2DG7 A;  3CDL A;  1ZKG A;  1QVT A;  2ZCX A;  5K7F A;  5K58 A;  3CRJ A;  5HSZ A;  1SGM A;  5FKM A;  2XRL A;  3BHQ A;  2VKE A;  5F0H A;  1ORK A;  3BR6 A;  1RKW A;  2GFN A;  2REK A;  2TRT A;  1QPI A;  3QQA A;  4KWA A;  4ICH A;  3TP0 A;  4I76 A;  5FKO A;  4JL3 A;  2I10 A;  2IAI A;  4JNN A;  2XGE A;  2XDN A;  1UI5 A;  2XPU A;  4ACI A;  3ANG A;  4W97 A;  5EZH A;  2FD5 A;  2FQ4 A;  3ZQH A;  2QWT A;  2PZ9 A;  2HXI A;  5AQC A;  5FKK A;  3BT9 A;  3BQZ A;  3ON4 A;  5D18 A;  2WGB A;  3NNR A;  2G7G A;  4NN1 A;  2FX0 A;  5GPA A;  5FMP A;  4NEL A;  2X9D A;  2FJ1 A;  5EFY A;  2XPW A;  4D5F A;  4V2F A;  2RAE A;  3VW2 A;  3LSP A;  2V57 A;  5F1J A;  3FK7 A;  4ABZ A;  3MNL A;  3F0C A;  4MXM A;  3IH2 A;  4AC0 A;  4M3B A;  3QKX A;  3HTA A;  4D7N A;  3P9T A;  2W53 A;  1JUM A;  3AQT A;  3BR5 A;  3IH3 A;  2QCO A;  3LSR A;  3ZQG A;  1U9N A;  3BTI A;  5CXG A;  5J3L A;  3Q0V A;  3C2B A;  1Z0X A;  3B6C A;  3PM1 A;  1JUP A;  5F04 A;  3G7R A;  3GZI A;  4D7M A;  3DCF A;  5CXI A;  2UXH A;  3DEW A;  3BCG A;  5FKN A;  3WHB A;  1QVU A;  3Q0U A;  3V78 A;  5D19 A;  4W1U A;  2WUI A;  3COL A;  5HBU A;  3DPJ A;  2PBX A;  2YVH A;  3BTL A;  3VUQ A;  4AF5 A;  5H9T A;  2HXO A;  1T56 A;  3NRG A;  2UXO A;  4V2G A;  3T6N A;  4ME9 A;  5FGL A;  3KKD A;  5GP9 A;  4D5C A;  3Q0W A;  2XB5 A;  2G7S A;  2DTZ A;  4PXI A;  5EYR A;  3BR3 A;  5IP6 A;  3HE0 A;  1Z77 A;  3VVX A;  1UI6 A;  3E7Q A;  3GEU A;  5F0F A;  3BQY A;  3HGY A;  2NS8 A;  2XPV A;  3B81 A;  1JT6 A;  3HTJ A;  3G1M A;  2VPR A;  3VPR A;  2NP3 A;  4GCK A;  1RKT A;  3ZQF A; 
#chains in the Genus database with same CATH topology
 4GFK A;  4X1E A;  4AC6 A;  3QPL A;  3LOC A;  3O8H A;  4GCL A;  3LJL A;  2Y30 A;  1ZK8 A;  2JJ7 A;  3ZQI A;  5J1R A;  2Y31 A;  3FRQ A;  3KNW A;  2ZCM A;  3BTC A;  3ANP A;  3V6G A;  2GEN A;  3IH4 A;  5HAW A;  4I6Z A;  4MO7 A;  2OER A;  5F27 A;  3LSJ A;  2UXU A;  5IPA A;  3BRU A;  3K8P C;  3EGQ A;  3LWJ A;  4UDS A;  2NP5 A;  3SFI A;  5J1Y A;  2O7O A;  3VW0 A;  3RH2 A;  4DW6 A;  2R7Q A;  5DAJ A;  3ON2 A;  3S5R A;  2FJI 1;  5K7H A;  3HIM A;  1BJZ A;  2G0E A;  4M3E A;  2X6O A;  3NPI A;  2FBQ A;  3HTI A;  3BR2 A;  4GFL A;  2HKU A;  4CGR A;  5CW8 A;  2WV1 A;  3CCY A;  2PFV A;  3G56 A;  3F1B A;  1JTY A;  3KYL A;  5J1U A;  3VIB A;  2R7V A;  3C07 A;  2G3B A;  2OI8 A;  4JKZ A;  3QBM A;  3HGG A;  3FK6 A;  4G12 A;  2ZOZ A;  2IEK A;  2ZOY A;  2RHA A;  5GPC A;  3QPS A;  2JK3 A;  2GUH A;  3O60 A;  4M3D A;  2TCT A;  3KKC A;  1VI0 A;  3KZ9 A;  3NS4 A;  3JSJ A;  1A6I A;  4M3F A;  5F0C A;  2RAS A;  2Q24 A;  3HTH A;  4B1R A;  5D1R A;  2ZCN A;  5IOZ A;  3RD3 A;  3G1O A;  3LHQ A;  3Q3S A;  4JYK A;  5IOY A;  2R7O A;  4M3G A;  3SDG A;  2QKO A;  3BJB A;  3PPB A;  3NXC A;  3WHC A;  2UXP A;  2O7T A;  2DG8 A;  4YZE A;  5F08 A;  2D6Y A;  3BTJ A;  3VOX A;  3VP5 A;  2R7R A;  2ZB9 A;  2OF7 A;  4B3A A;  1T33 A;  4MK6 A;  2XGD A;  2F07 A;  2EH3 A;  4XK4 A;  3B6A A;  2R7U A;  2HQ5 A;  3SWH A;  3VW1 A;  3TP3 A;  2HYJ A;  3BNI A;  4AUX A;  3NI7 A;  2XGC A;  3O8G A;  1JTX A;  4OD4 A;  3CJD A;  2GBY A;  3BR1 A;  3CWR A;  2QTQ A;  3VVY A;  2Y2Z A;  2VKV A;  1JUS A;  1RPW A;  3AQS A;  3VOK A;  2IBD A;  2QIB A;  2ID6 A;  2NS7 A;  2G7L A;  2NX4 A;  2UXI A;  2OPT A;  3IUV A;  5K7Z A;  5EZG A;  5FKL A;  4L62 A;  3G1L A;  2QOP A;  3EUP A;  1JT0 A;  2YVE A;  5FHP A;  2IU5 A;  4GCT A;  4IRV A;  4HKU A;  3PAS A;  3BR0 A;  3FIW A;  3MVP A;  3ZQL A;  2HYT A;  5C4Y A;  1U9O A;  3VVZ A;  2ID3 A;  2DG7 A;  3CDL A;  1ZKG A;  1QVT A;  3VTI A;  2ZCX A;  5K7F A;  5K58 A;  3CRJ A;  5HSZ A;  4DVY P;  1SGM A;  5FKM A;  2XRL A;  3BHQ A;  2VKE A;  5F0H A;  1ORK A;  3BR6 A;  1RKW A;  2GFN A;  2REK A;  2TRT A;  4U9N A;  1QPI A;  3QQA A;  4KWA A;  4ICH A;  3TP0 A;  4I76 A;  5FKO A;  4JL3 A;  2I10 A;  2IAI A;  4JNN A;  2XGE A;  2XDN A;  2B1E A;  1UI5 A;  2XPU A;  4ACI A;  3ANG A;  4W97 A;  2R7S A;  5EZH A;  2FD5 A;  2FQ4 A;  3ZQH A;  2QWT A;  2PZ9 A;  2HXI A;  5AQC A;  2R7W A;  5FKK A;  2B3W A;  2YVX A;  3FHN A;  3BT9 A;  3BQZ A;  3ON4 A;  5D18 A;  2WGB A;  3NNR A;  2G7G A;  4NN1 A;  2FX0 A;  5GPA A;  5FMP A;  4NEL A;  2X9D A;  2FJ1 A;  5EFY A;  2XPW A;  4D5F A;  4V2F A;  2RAE A;  3VW2 A;  3LSP A;  2V57 A;  5F1J A;  3FK7 A;  4ABZ A;  3MNL A;  3F0C A;  4MXM A;  3IH2 A;  4AC0 A;  4M3B A;  3QKX A;  3HTA A;  4D7N A;  3P9T A;  2W53 A;  1JUM A;  3AQT A;  3BR5 A;  3IH3 A;  2QCO A;  3LSR A;  3ZQG A;  1U9N A;  3BTI A;  5CXG A;  5J3L A;  2R7X A;  3Q0V A;  3C2B A;  1Z0X A;  3B6C A;  3PM1 A;  1JUP A;  3DU6 A;  5F04 A;  2R7T A;  3DU5 A;  3G7R A;  3GZI A;  4D7M A;  5CXI A;  3DCF A;  2UXH A;  3DEW A;  3BCG A;  5FKN A;  3WHB A;  1QVU A;  3Q0U A;  3V78 A;  5D19 A;  4W1U A;  2WUI A;  3COL A;  2ZY9 A;  5HBU A;  3DPJ A;  2PBX A;  2YVH A;  3BTL A;  3VUQ A;  4AF5 A;  5H9T A;  2HXO A;  1T56 A;  3NRG A;  2UXO A;  4V2G A;  3T6N A;  5CQG A;  4ME9 A;  5FGL A;  3KKD A;  5GP9 A;  4D5C A;  3Q0W A;  2XB5 A;  4OD5 A;  2G7S A;  2DTZ A;  4PXI A;  5EYR A;  3BR3 A;  5IP6 A;  3HE0 A;  1Z77 A;  3VVX A;  1UI6 A;  3E7Q A;  3GEU A;  2A2F X;  4U9L A;  5F0F A;  3BQY A;  3HGY A;  2NS8 A;  2XPV A;  3B81 A;  1JT6 A;  4C2M A;  3HTJ A;  3G1M A;  2VPR A;  3VPR A;  2NP3 A;  4WIB A;  4GCK A;  1RKT A;  3ZQF A; 
#chains in the Genus database with same CATH homology
 4GFK A;  4X1E A;  4AC6 A;  3QPL A;  3LOC A;  3O8H A;  4GCL A;  3LJL A;  2Y30 A;  1ZK8 A;  2JJ7 A;  3ZQI A;  5J1R A;  2Y31 A;  3FRQ A;  3KNW A;  2ZCM A;  3BTC A;  3ANP A;  3V6G A;  2GEN A;  3IH4 A;  5HAW A;  4I6Z A;  4MO7 A;  2OER A;  5F27 A;  3LSJ A;  2UXU A;  5IPA A;  3BRU A;  3LWJ A;  3EGQ A;  4UDS A;  2NP5 A;  3SFI A;  5J1Y A;  2O7O A;  3VW0 A;  3RH2 A;  4DW6 A;  5DAJ A;  3ON2 A;  3S5R A;  5K7H A;  3HIM A;  1BJZ A;  2G0E A;  4M3E A;  2X6O A;  3NPI A;  2FBQ A;  3HTI A;  3BR2 A;  4GFL A;  2HKU A;  4CGR A;  5CW8 A;  2WV1 A;  3CCY A;  3G56 A;  3F1B A;  1JTY A;  5J1U A;  3VIB A;  3C07 A;  2G3B A;  2OI8 A;  4JKZ A;  3QBM A;  3HGG A;  3FK6 A;  4G12 A;  2ZOZ A;  2IEK A;  2ZOY A;  2RHA A;  5GPC A;  3QPS A;  2JK3 A;  2GUH A;  3O60 A;  4M3D A;  2TCT A;  3KKC A;  1VI0 A;  3KZ9 A;  3JSJ A;  1A6I A;  4M3F A;  5F0C A;  2RAS A;  2Q24 A;  3HTH A;  4B1R A;  5D1R A;  2ZCN A;  5IOZ A;  3RD3 A;  3G1O A;  3LHQ A;  3Q3S A;  4JYK A;  5IOY A;  3SDG A;  4M3G A;  2QKO A;  3BJB A;  3PPB A;  3NXC A;  3WHC A;  2UXP A;  2O7T A;  2DG8 A;  4YZE A;  5F08 A;  2D6Y A;  3BTJ A;  3VOX A;  3VP5 A;  2ZB9 A;  2OF7 A;  4B3A A;  1T33 A;  4MK6 A;  2XGD A;  2F07 A;  2EH3 A;  4XK4 A;  3B6A A;  2HQ5 A;  3VW1 A;  3TP3 A;  2HYJ A;  3BNI A;  4AUX A;  3NI7 A;  2XGC A;  3O8G A;  1JTX A;  3CJD A;  2GBY A;  3BR1 A;  3CWR A;  2QTQ A;  3VVY A;  2Y2Z A;  2VKV A;  1JUS A;  1RPW A;  3AQS A;  3VOK A;  2IBD A;  2QIB A;  2ID6 A;  2NS7 A;  2G7L A;  2NX4 A;  2UXI A;  2OPT A;  3IUV A;  5K7Z A;  5EZG A;  5FKL A;  4L62 A;  3G1L A;  2QOP A;  3EUP A;  1JT0 A;  2YVE A;  5FHP A;  2IU5 A;  4GCT A;  4HKU A;  3PAS A;  3BR0 A;  3FIW A;  3MVP A;  3ZQL A;  2HYT A;  5C4Y A;  1U9O A;  3VVZ A;  2ID3 A;  2DG7 A;  3CDL A;  1ZKG A;  1QVT A;  2ZCX A;  5K7F A;  5K58 A;  3CRJ A;  5HSZ A;  1SGM A;  5FKM A;  2XRL A;  3BHQ A;  2VKE A;  5F0H A;  1ORK A;  3BR6 A;  1RKW A;  2GFN A;  2REK A;  2TRT A;  1QPI A;  3QQA A;  4KWA A;  4ICH A;  3TP0 A;  4I76 A;  5FKO A;  4JL3 A;  2I10 A;  2IAI A;  4JNN A;  2XGE A;  2XDN A;  1UI5 A;  2XPU A;  4ACI A;  3ANG A;  4W97 A;  5EZH A;  2FD5 A;  2FQ4 A;  3ZQH A;  2QWT A;  2PZ9 A;  2HXI A;  5AQC A;  5FKK A;  3BT9 A;  3BQZ A;  3ON4 A;  5D18 A;  2WGB A;  3NNR A;  2G7G A;  4NN1 A;  2FX0 A;  5GPA A;  5FMP A;  4NEL A;  2X9D A;  2FJ1 A;  5EFY A;  2XPW A;  4D5F A;  4V2F A;  2RAE A;  3VW2 A;  3LSP A;  2V57 A;  5F1J A;  3FK7 A;  4ABZ A;  3MNL A;  3F0C A;  4MXM A;  3IH2 A;  4AC0 A;  4M3B A;  3QKX A;  3HTA A;  4D7N A;  3P9T A;  2W53 A;  1JUM A;  3AQT A;  3BR5 A;  3IH3 A;  2QCO A;  3LSR A;  3ZQG A;  1U9N A;  3BTI A;  5CXG A;  5J3L A;  3Q0V A;  3C2B A;  1Z0X A;  3B6C A;  3PM1 A;  1JUP A;  5F04 A;  3G7R A;  3GZI A;  4D7M A;  3DCF A;  5CXI A;  2UXH A;  3DEW A;  3BCG A;  5FKN A;  3WHB A;  1QVU A;  3Q0U A;  3V78 A;  5D19 A;  4W1U A;  2WUI A;  3COL A;  5HBU A;  3DPJ A;  2PBX A;  2YVH A;  3BTL A;  3VUQ A;  4AF5 A;  5H9T A;  2HXO A;  1T56 A;  3NRG A;  2UXO A;  4V2G A;  3T6N A;  4ME9 A;  5FGL A;  3KKD A;  5GP9 A;  4D5C A;  3Q0W A;  2XB5 A;  2G7S A;  2DTZ A;  4PXI A;  5EYR A;  3BR3 A;  5IP6 A;  3HE0 A;  1Z77 A;  3VVX A;  1UI6 A;  3E7Q A;  3GEU A;  5F0F A;  3BQY A;  3HGY A;  2NS8 A;  2XPV A;  3B81 A;  1JT6 A;  3HTJ A;  3G1M A;  2VPR A;  3VPR A;  2NP3 A;  4GCK A;  1RKT A;  3ZQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...