3BRUA

Crystal structure of regulatory protein tetr from rhodobacter sphaeroides
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
DASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of regulatory protein TetR from Rhodobacter sphaeroides.
rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Transcription
molecule keywords Regulatory protein, TetR family
total genus 71
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bruA00
2UXOA 3T6NA 2Y30A 4D5CA 2DTZA 3HGGA 5DAJA 5K58A 2HYTA 3BR5A 5EZGA 3ZQGA 2G7GA 3KKCA 2XB5A 2Q24A 2OPTA 4DW6A 5J1YA 1QPIA 4AC6A 4JNNA 2HXIA 1Z0XA 3BTLA 2QCOA 2HXOA 1ZK8A 3HTIA 3NPIA 4D7MA 3E7QA 3CRJA 3MVPA 3F0CA 2RASA 2XDNA 3ANPA 3C07A 4W1UA 3G7RA 5HBUA 1ZKGA 3DEWA 5F08A 2G3BA 2VKEA 2VKVA 4MO7A 3FK6A 2UXIA 3HIMA 3PM1A 2XRLA 3ZQLA 2YVEA 3C2BA 2WV1A 5F04A 1QVTA 4AC0A 3HTHA 3BR3A 3BTIA 3BTCA 3Q3SA 2OI8A 3PPBA 1A6IA 3EGQA 5F27A 2X9DA 3BR0A 1RPWA 3BRUA 2WGBA 3KNWA 3BT9A 4M3BA 5EZHA 2UXUA 2NX4A 3B6CA 1JUMA 3O8GA 4PXIA 3VVYA 2UXPA 3VW1A 5D19A 3SFIA 3Q0UA 4UDSA 2Y2ZA 3Q0VA 2EH3A 3LSPA 3VIBA 2NP3A 5F0HA 3FIWA 3KZ9A 2G7SA 4B1RA 1JTXA 3P9TA 4NN1A 4I76A 2IAIA 3AQSA 3HTJA 5FHPA 3ON2A 5FKNA 2OERA 3TP3A 3LOCA 4JL3A 4ACIA 1QVUA 5F1JA 1JT0A 2QOPA 3VVZA 5IOZA 3BNIA 2XGEA 3V78A 3LSRA 2RHAA 3COLA 3O8HA 3NRGA 4I6ZA 2ZCMA 5H9TA 2JK3A 4GCKA 3ZQFA 1JT6A 1SGMA 2I10A 3EUPA 1UI6A 5F0CA 3BR6A 5K7FA 4AUXA 3CJDA 3QPSA 3G1OA 3IUVA 3SDGA 2NP5A 2FX0A 3LHQA 3QPLA 2ZCNA 4ME9A 2NS7A 3HGYA 4B3AA 5IOYA 4M3FA 1JTYA 4M3DA 1ORKA 5D18A 5FKMA 2IEKA 3QBMA 3WHCA 1RKWA 3CDLA 3S5RA 2V57A 5K7HA 2XGCA 3VOKA 5EFYA 2IU5A 3O60A 4X1EA 5FGLA 3GZIA 3G1MA 1JUPA 4YZEA 2X6OA 2QWTA 2QIBA 1UI5A 1Z77A 5J3LA 3TP0A 4MK6A 2YVHA 4CGRA 3LJLA 3QKXA 4M3GA 1T33A 1BJZA 3Q0WA 3VUQA 3ANGA 5HAWA 2PBXA 4HKUA 3RH2A 3BTJA 3ZQIA 2FQ4A 1VI0A 2NS8A 3BQYA 5K7ZA 5FKLA 2JJ7A 3CWRA 3VVXA 5F0FA 4JYKA 2FJ1A 3B6AA 5IP6A 3PASA 3VP5A 2XPUA 2W53A 3GEUA 3AQTA 4KWAA 2PZ9A 4NELA 5FMPA 2RAEA 3QQAA 2GBYA 2HYJA 2HKUA 5AQCA 2QTQA 3LWJA 2TCTA 5J1RA 1JUSA 2F07A 3JSJA 4L62A 2REKA 3BJBA 4GFLA 2XGDA 3NXCA 4ICHA 2D6YA 4V2GA 5CXGA 3FRQA 5GPCA 2O7TA 2G7LA 3VW2A 4XK4A 2GFNA 3VPRA 1T56A 3NI7A 2ZOYA 4GCLA 4V2FA 2QKOA 4W97A 4GCTA 5CXIA 1U9OA 2DG7A 2FBQA 3HTAA 3V6GA 5C4YA 3B81A 3G1LA 4MXMA 3KKDA 3RD3A 2HQ5A 5D1RA 2ID3A 3MNLA 5FKOA 3FK7A 4JKZA 4G12A 3DCFA 2ZB9A 2ZOZA 3BQZA 3LSJA 2DG8A 2O7OA 2XPWA 3F1BA 5CW8A 4M3EA 5FKKA 5GP9A 3BR2A 2OF7A 5EYRA 2ZCXA 2ID6A 2WUIA 3ON4A 2IBDA 2TRTA 2GUHA 3IH2A 3VOXA 3HE0A 3IH4A 4GFKA 2GENA 2FD5A 2VPRA 5HSZA 1RKTA 3VW0A 5IPAA 2UXHA 3BCGA 3BHQA 2G0EA 3IH3A 5J1UA 2Y31A 3CCYA 4ABZA 4D7NA 4AF5A 5GPAA 2XPVA 3DPJA 3NNRA 4D5FA 3BR1A 3ZQHA 1U9NA 3G56A 3WHBA
chains in the Genus database with same CATH superfamily
2UXOA 3T6NA 2Y30A 4D5CA 2DTZA 3HGGA 5DAJA 5K58A 2HYTA 3BR5A 5EZGA 3ZQGA 2G7GA 3KKCA 2XB5A 2Q24A 2OPTA 4DW6A 5J1YA 1QPIA 4AC6A 2R7RA 4JNNA 2HXIA 3FHNA 1Z0XA 3BTLA 2QCOA 2HXOA 1ZK8A 3HTIA 3NPIA 4D7MA 4OD5A 3E7QA 3CRJA 3MVPA 3F0CA 2RASA 2XDNA 3ANPA 3C07A 4W1UA 3G7RA 5HBUA 1ZKGA 3DEWA 5F08A 2G3BA 2VKEA 2VKVA 4MO7A 3FK6A 2UXIA 3HIMA 3PM1A 2XRLA 3ZQLA 2YVEA 3C2BA 2WV1A 5F04A 1QVTA 4AC0A 3HTHA 3BR3A 3BTIA 3BTCA 3Q3SA 2OI8A 3PPBA 1A6IA 3EGQA 5F27A 2X9DA 3BR0A 1RPWA 3BRUA 2WGBA 3KNWA 3BT9A 4M3BA 5EZHA 2UXUA 2NX4A 3K8PC 2B3WA 3B6CA 1JUMA 3O8GA 4PXIA 3VVYA 2UXPA 3VW1A 5D19A 3SFIA 3Q0UA 4UDSA 2Y2ZA 3Q0VA 2B1EA 2EH3A 3LSPA 3VIBA 2NP3A 5F0HA 3FIWA 3KZ9A 2G7SA 2ZY9A 4B1RA 1JTXA 3P9TA 4NN1A 4I76A 2IAIA 3AQSA 3HTJA 5FHPA 3ON2A 5FKNA 2OERA 2YVXA 3TP3A 3LOCA 4JL3A 4ACIA 1QVUA 5F1JA 1JT0A 2QOPA 3VVZA 5IOZA 3BNIA 2XGEA 3V78A 3LSRA 2RHAA 3COLA 3SWHA 3O8HA 3NRGA 4I6ZA 2ZCMA 5H9TA 2JK3A 4GCKA 3ZQFA 1JT6A 4U9LA 2PFVA 1SGMA 2I10A 3EUPA 1UI6A 5F0CA 3BR6A 5K7FA 4AUXA 3CJDA 3QPSA 3G1OA 3IUVA 2R7XA 3SDGA 5CQGA 2NP5A 2FX0A 3LHQA 3QPLA 2ZCNA 4ME9A 2NS7A 3HGYA 4B3AA 5IOYA 4M3FA 1JTYA 4M3DA 1ORKA 5D18A 5FKMA 2IEKA 3QBMA 3WHCA 1RKWA 4DVYP 3CDLA 3S5RA 2V57A 2A2FX 5K7HA 2XGCA 4C2MA 3VOKA 5EFYA 2IU5A 3O60A 4X1EA 4OD4A 5FGLA 3GZIA 2R7VA 3G1MA 1JUPA 4YZEA 2X6OA 2QWTA 2QIBA 1UI5A 1Z77A 5J3LA 3TP0A 4MK6A 2YVHA 4CGRA 3LJLA 3QKXA 4M3GA 1T33A 1BJZA 3Q0WA 3VUQA 3ANGA 5HAWA 2PBXA 4HKUA 4U9NA 3RH2A 3BTJA 3ZQIA 2FQ4A 1VI0A 2NS8A 3BQYA 5K7ZA 5FKLA 2JJ7A 3CWRA 3VVXA 5F0FA 4JYKA 2FJ1A 4WIBA 3B6AA 5IP6A 3PASA 3VP5A 2XPUA 2W53A 3GEUA 3AQTA 2FJI1 4KWAA 2PZ9A 4NELA 5FMPA 2RAEA 3QQAA 2GBYA 2HYJA 2HKUA 3KYLA 5AQCA 2QTQA 3LWJA 2TCTA 5J1RA 3VTIA 1JUSA 2F07A 3JSJA 4L62A 2REKA 3BJBA 4GFLA 2XGDA 3NXCA 4ICHA 2D6YA 4V2GA 5CXGA 3FRQA 5GPCA 2O7TA 2G7LA 3VW2A 4XK4A 2GFNA 3VPRA 1T56A 3DU6A 3NI7A 2ZOYA 3NS4A 4GCLA 4V2FA 2QKOA 4W97A 4GCTA 3DU5A 5CXIA 1U9OA 2DG7A 2FBQA 3HTAA 3V6GA 5C4YA 3B81A 3G1LA 4MXMA 2R7OA 3KKDA 3RD3A 2HQ5A 5D1RA 2ID3A 3MNLA 5FKOA 3FK7A 4JKZA 4G12A 2R7UA 3DCFA 2ZB9A 2ZOZA 3BQZA 2R7TA 3LSJA 2DG8A 2O7OA 2XPWA 3F1BA 5CW8A 4M3EA 5FKKA 5GP9A 3BR2A 2OF7A 5EYRA 2ZCXA 2ID6A 2WUIA 3ON4A 2IBDA 2TRTA 2GUHA 3IH2A 3VOXA 3HE0A 3IH4A 4GFKA 2GENA 2FD5A 2VPRA 5HSZA 1RKTA 3VW0A 5IPAA 2UXHA 4IRVA 3BCGA 3BHQA 2G0EA 3IH3A 5J1UA 2Y31A 3CCYA 4ABZA 4D7NA 4AF5A 5GPAA 2XPVA 3DPJA 3NNRA 4D5FA 2R7SA 3BR1A 3ZQHA 1U9NA 2R7WA 3G56A 3WHBA 2R7QA
chains in the Genus database with same CATH topology
2UXOA 3T6NA 2Y30A 4D5CA 2DTZA 3HGGA 5DAJA 5K58A 2HYTA 3BR5A 5EZGA 3ZQGA 2G7GA 3KKCA 2XB5A 2Q24A 2OPTA 4DW6A 5J1YA 1QPIA 4AC6A 4JNNA 2HXIA 1Z0XA 3BTLA 2QCOA 2HXOA 1ZK8A 3HTIA 3NPIA 4D7MA 3E7QA 3CRJA 3MVPA 3F0CA 2RASA 2XDNA 3ANPA 3C07A 4W1UA 3G7RA 5HBUA 1ZKGA 3DEWA 5F08A 2G3BA 2VKEA 2VKVA 4MO7A 3FK6A 2UXIA 3HIMA 3PM1A 2XRLA 3ZQLA 2YVEA 3C2BA 2WV1A 5F04A 1QVTA 4AC0A 3HTHA 3BR3A 3BTIA 3BTCA 3Q3SA 2OI8A 3PPBA 1A6IA 3EGQA 5F27A 2X9DA 3BR0A 1RPWA 3BRUA 2WGBA 3KNWA 3BT9A 4M3BA 5EZHA 2UXUA 2NX4A 3B6CA 1JUMA 3O8GA 4PXIA 3VVYA 2UXPA 3VW1A 5D19A 3SFIA 3Q0UA 4UDSA 2Y2ZA 3Q0VA 2EH3A 3LSPA 3VIBA 2NP3A 5F0HA 3FIWA 3KZ9A 2G7SA 4B1RA 1JTXA 3P9TA 4NN1A 4I76A 2IAIA 3AQSA 3HTJA 5FHPA 3ON2A 5FKNA 2OERA 3TP3A 3LOCA 4JL3A 4ACIA 1QVUA 5F1JA 1JT0A 2QOPA 3VVZA 5IOZA 3BNIA 2XGEA 3V78A 3LSRA 2RHAA 3COLA 3O8HA 3NRGA 4I6ZA 2ZCMA 5H9TA 2JK3A 4GCKA 3ZQFA 1JT6A 1SGMA 2I10A 3EUPA 1UI6A 5F0CA 3BR6A 5K7FA 4AUXA 3CJDA 3QPSA 3G1OA 3IUVA 3SDGA 2NP5A 2FX0A 3LHQA 3QPLA 2ZCNA 4ME9A 2NS7A 3HGYA 4B3AA 5IOYA 4M3FA 1JTYA 4M3DA 1ORKA 5D18A 5FKMA 2IEKA 3QBMA 3WHCA 1RKWA 3CDLA 3S5RA 2V57A 5K7HA 2XGCA 3VOKA 5EFYA 2IU5A 3O60A 4X1EA 5FGLA 3GZIA 3G1MA 1JUPA 4YZEA 2X6OA 2QWTA 2QIBA 1UI5A 1Z77A 5J3LA 3TP0A 4MK6A 2YVHA 4CGRA 3LJLA 3QKXA 4M3GA 1T33A 1BJZA 3Q0WA 3VUQA 3ANGA 5HAWA 2PBXA 4HKUA 3RH2A 3BTJA 3ZQIA 2FQ4A 1VI0A 2NS8A 3BQYA 5K7ZA 5FKLA 2JJ7A 3CWRA 3VVXA 5F0FA 4JYKA 2FJ1A 3B6AA 5IP6A 3PASA 3VP5A 2XPUA 2W53A 3GEUA 3AQTA 4KWAA 2PZ9A 4NELA 5FMPA 2RAEA 3QQAA 2GBYA 2HYJA 2HKUA 5AQCA 2QTQA 3LWJA 2TCTA 5J1RA 1JUSA 2F07A 3JSJA 4L62A 2REKA 3BJBA 4GFLA 2XGDA 3NXCA 4ICHA 2D6YA 4V2GA 5CXGA 3FRQA 5GPCA 2O7TA 2G7LA 3VW2A 4XK4A 2GFNA 3VPRA 1T56A 3NI7A 2ZOYA 4GCLA 4V2FA 2QKOA 4W97A 4GCTA 5CXIA 1U9OA 2DG7A 2FBQA 3HTAA 3V6GA 5C4YA 3B81A 3G1LA 4MXMA 3KKDA 3RD3A 2HQ5A 5D1RA 2ID3A 3MNLA 5FKOA 3FK7A 4JKZA 4G12A 3DCFA 2ZB9A 2ZOZA 3BQZA 3LSJA 2DG8A 2O7OA 2XPWA 3F1BA 5CW8A 4M3EA 5FKKA 5GP9A 3BR2A 2OF7A 5EYRA 2ZCXA 2ID6A 2WUIA 3ON4A 2IBDA 2TRTA 2GUHA 3IH2A 3VOXA 3HE0A 3IH4A 4GFKA 2GENA 2FD5A 2VPRA 5HSZA 1RKTA 3VW0A 5IPAA 2UXHA 3BCGA 3BHQA 2G0EA 3IH3A 5J1UA 2Y31A 3CCYA 4ABZA 4D7NA 4AF5A 5GPAA 2XPVA 3DPJA 3NNRA 4D5FA 3BR1A 3ZQHA 1U9NA 3G56A 3WHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXO A;  3T6N A;  2Y30 A;  4D5C A;  2DTZ A;  3HGG A;  5DAJ A;  5K58 A;  2HYT A;  3BR5 A;  5EZG A;  3ZQG A;  2G7G A;  3KKC A;  2XB5 A;  2Q24 A;  2OPT A;  4DW6 A;  5J1Y A;  1QPI A;  4AC6 A;  4JNN A;  2HXI A;  1Z0X A;  3BTL A;  2QCO A;  2HXO A;  1ZK8 A;  3HTI A;  3NPI A;  4D7M A;  3E7Q A;  3CRJ A;  3MVP A;  3F0C A;  2RAS A;  2XDN A;  3ANP A;  3C07 A;  4W1U A;  3G7R A;  5HBU A;  1ZKG A;  3DEW A;  5F08 A;  2G3B A;  2VKE A;  2VKV A;  4MO7 A;  3FK6 A;  2UXI A;  3HIM A;  3PM1 A;  2XRL A;  3ZQL A;  2YVE A;  3C2B A;  2WV1 A;  5F04 A;  1QVT A;  4AC0 A;  3HTH A;  3BR3 A;  3BTI A;  3BTC A;  3Q3S A;  2OI8 A;  3PPB A;  1A6I A;  3EGQ A;  5F27 A;  2X9D A;  3BR0 A;  1RPW A;  3BRU A;  2WGB A;  3KNW A;  3BT9 A;  4M3B A;  5EZH A;  2UXU A;  2NX4 A;  3B6C A;  1JUM A;  3O8G A;  4PXI A;  3VVY A;  2UXP A;  3VW1 A;  5D19 A;  3SFI A;  3Q0U A;  4UDS A;  2Y2Z A;  3Q0V A;  2EH3 A;  3LSP A;  3VIB A;  2NP3 A;  5F0H A;  3FIW A;  3KZ9 A;  2G7S A;  4B1R A;  1JTX A;  3P9T A;  4NN1 A;  4I76 A;  2IAI A;  3AQS A;  3HTJ A;  5FHP A;  3ON2 A;  5FKN A;  2OER A;  3TP3 A;  3LOC A;  4JL3 A;  4ACI A;  1QVU A;  5F1J A;  1JT0 A;  2QOP A;  3VVZ A;  5IOZ A;  3BNI A;  2XGE A;  3V78 A;  3LSR A;  2RHA A;  3COL A;  3O8H A;  3NRG A;  4I6Z A;  2ZCM A;  5H9T A;  2JK3 A;  4GCK A;  3ZQF A;  1JT6 A;  1SGM A;  2I10 A;  3EUP A;  1UI6 A;  5F0C A;  3BR6 A;  5K7F A;  4AUX A;  3CJD A;  3QPS A;  3G1O A;  3IUV A;  3SDG A;  2NP5 A;  2FX0 A;  3LHQ A;  3QPL A;  2ZCN A;  4ME9 A;  2NS7 A;  3HGY A;  4B3A A;  5IOY A;  4M3F A;  1JTY A;  4M3D A;  1ORK A;  5D18 A;  5FKM A;  2IEK A;  3QBM A;  3WHC A;  1RKW A;  3CDL A;  3S5R A;  2V57 A;  5K7H A;  2XGC A;  3VOK A;  5EFY A;  2IU5 A;  3O60 A;  4X1E A;  5FGL A;  3GZI A;  3G1M A;  1JUP A;  4YZE A;  2X6O A;  2QWT A;  2QIB A;  1UI5 A;  1Z77 A;  5J3L A;  3TP0 A;  4MK6 A;  2YVH A;  4CGR A;  3LJL A;  3QKX A;  4M3G A;  1T33 A;  1BJZ A;  3Q0W A;  3VUQ A;  3ANG A;  5HAW A;  2PBX A;  4HKU A;  3RH2 A;  3BTJ A;  3ZQI A;  2FQ4 A;  1VI0 A;  2NS8 A;  3BQY A;  5K7Z A;  5FKL A;  2JJ7 A;  3CWR A;  3VVX A;  5F0F A;  4JYK A;  2FJ1 A;  3B6A A;  5IP6 A;  3PAS A;  3VP5 A;  2XPU A;  2W53 A;  3GEU A;  3AQT A;  4KWA A;  2PZ9 A;  4NEL A;  5FMP A;  2RAE A;  3QQA A;  2GBY A;  2HYJ A;  2HKU A;  5AQC A;  2QTQ A;  3LWJ A;  2TCT A;  5J1R A;  1JUS A;  2F07 A;  3JSJ A;  4L62 A;  2REK A;  3BJB A;  4GFL A;  2XGD A;  3NXC A;  4ICH A;  2D6Y A;  4V2G A;  5CXG A;  3FRQ A;  5GPC A;  2O7T A;  2G7L A;  3VW2 A;  4XK4 A;  2GFN A;  3VPR A;  1T56 A;  3NI7 A;  2ZOY A;  4GCL A;  4V2F A;  2QKO A;  4W97 A;  4GCT A;  5CXI A;  1U9O A;  2DG7 A;  2FBQ A;  3HTA A;  3V6G A;  5C4Y A;  3B81 A;  3G1L A;  4MXM A;  3KKD A;  3RD3 A;  2HQ5 A;  5D1R A;  2ID3 A;  3MNL A;  5FKO A;  3FK7 A;  4JKZ A;  4G12 A;  3DCF A;  2ZB9 A;  2ZOZ A;  3BQZ A;  3LSJ A;  2DG8 A;  2O7O A;  2XPW A;  3F1B A;  5CW8 A;  4M3E A;  5FKK A;  5GP9 A;  3BR2 A;  2OF7 A;  5EYR A;  2ZCX A;  2ID6 A;  2WUI A;  3ON4 A;  2IBD A;  2TRT A;  2GUH A;  3IH2 A;  3VOX A;  3HE0 A;  3IH4 A;  4GFK A;  2GEN A;  2FD5 A;  2VPR A;  5HSZ A;  1RKT A;  3VW0 A;  5IPA A;  2UXH A;  3BCG A;  3BHQ A;  2G0E A;  3IH3 A;  5J1U A;  2Y31 A;  3CCY A;  4ABZ A;  4D7N A;  4AF5 A;  5GPA A;  2XPV A;  3DPJ A;  3NNR A;  4D5F A;  3BR1 A;  3ZQH A;  1U9N A;  3G56 A;  3WHB A; 
#chains in the Genus database with same CATH topology
 2UXO A;  3T6N A;  2Y30 A;  4D5C A;  2DTZ A;  3HGG A;  5DAJ A;  5K58 A;  2HYT A;  3BR5 A;  5EZG A;  3ZQG A;  2G7G A;  3KKC A;  2XB5 A;  2Q24 A;  2OPT A;  4DW6 A;  5J1Y A;  1QPI A;  4AC6 A;  2R7R A;  4JNN A;  2HXI A;  3FHN A;  1Z0X A;  3BTL A;  2QCO A;  2HXO A;  1ZK8 A;  3HTI A;  3NPI A;  4D7M A;  4OD5 A;  3E7Q A;  3CRJ A;  3MVP A;  3F0C A;  2RAS A;  2XDN A;  3ANP A;  3C07 A;  4W1U A;  3G7R A;  5HBU A;  1ZKG A;  3DEW A;  5F08 A;  2G3B A;  2VKE A;  2VKV A;  4MO7 A;  3FK6 A;  2UXI A;  3HIM A;  3PM1 A;  2XRL A;  3ZQL A;  2YVE A;  3C2B A;  2WV1 A;  5F04 A;  1QVT A;  4AC0 A;  3HTH A;  3BR3 A;  3BTI A;  3BTC A;  3Q3S A;  2OI8 A;  3PPB A;  1A6I A;  3EGQ A;  5F27 A;  2X9D A;  3BR0 A;  1RPW A;  3BRU A;  2WGB A;  3KNW A;  3BT9 A;  4M3B A;  5EZH A;  2UXU A;  2NX4 A;  3K8P C;  2B3W A;  3B6C A;  1JUM A;  3O8G A;  4PXI A;  3VVY A;  2UXP A;  3VW1 A;  5D19 A;  3SFI A;  3Q0U A;  4UDS A;  2Y2Z A;  3Q0V A;  2B1E A;  2EH3 A;  3LSP A;  3VIB A;  2NP3 A;  5F0H A;  3FIW A;  3KZ9 A;  2G7S A;  2ZY9 A;  4B1R A;  1JTX A;  3P9T A;  4NN1 A;  4I76 A;  2IAI A;  3AQS A;  3HTJ A;  5FHP A;  3ON2 A;  5FKN A;  2OER A;  2YVX A;  3TP3 A;  3LOC A;  4JL3 A;  4ACI A;  1QVU A;  5F1J A;  1JT0 A;  2QOP A;  3VVZ A;  5IOZ A;  3BNI A;  2XGE A;  3V78 A;  3LSR A;  2RHA A;  3COL A;  3SWH A;  3O8H A;  3NRG A;  4I6Z A;  2ZCM A;  5H9T A;  2JK3 A;  4GCK A;  3ZQF A;  1JT6 A;  4U9L A;  2PFV A;  1SGM A;  2I10 A;  3EUP A;  1UI6 A;  5F0C A;  3BR6 A;  5K7F A;  4AUX A;  3CJD A;  3QPS A;  3G1O A;  3IUV A;  2R7X A;  3SDG A;  5CQG A;  2NP5 A;  2FX0 A;  3LHQ A;  3QPL A;  2ZCN A;  4ME9 A;  2NS7 A;  3HGY A;  4B3A A;  5IOY A;  4M3F A;  1JTY A;  4M3D A;  1ORK A;  5D18 A;  5FKM A;  2IEK A;  3QBM A;  3WHC A;  1RKW A;  4DVY P;  3CDL A;  3S5R A;  2V57 A;  2A2F X;  5K7H A;  2XGC A;  4C2M A;  3VOK A;  5EFY A;  2IU5 A;  3O60 A;  4X1E A;  4OD4 A;  5FGL A;  3GZI A;  2R7V A;  3G1M A;  1JUP A;  4YZE A;  2X6O A;  2QWT A;  2QIB A;  1UI5 A;  1Z77 A;  5J3L A;  3TP0 A;  4MK6 A;  2YVH A;  4CGR A;  3LJL A;  3QKX A;  4M3G A;  1T33 A;  1BJZ A;  3Q0W A;  3VUQ A;  3ANG A;  5HAW A;  2PBX A;  4HKU A;  4U9N A;  3RH2 A;  3BTJ A;  3ZQI A;  2FQ4 A;  1VI0 A;  2NS8 A;  3BQY A;  5K7Z A;  5FKL A;  2JJ7 A;  3CWR A;  3VVX A;  5F0F A;  4JYK A;  2FJ1 A;  4WIB A;  3B6A A;  5IP6 A;  3PAS A;  3VP5 A;  2XPU A;  2W53 A;  3GEU A;  3AQT A;  2FJI 1;  4KWA A;  2PZ9 A;  4NEL A;  5FMP A;  2RAE A;  3QQA A;  2GBY A;  2HYJ A;  2HKU A;  3KYL A;  5AQC A;  2QTQ A;  3LWJ A;  2TCT A;  5J1R A;  3VTI A;  1JUS A;  2F07 A;  3JSJ A;  4L62 A;  2REK A;  3BJB A;  4GFL A;  2XGD A;  3NXC A;  4ICH A;  2D6Y A;  4V2G A;  5CXG A;  3FRQ A;  5GPC A;  2O7T A;  2G7L A;  3VW2 A;  4XK4 A;  2GFN A;  3VPR A;  1T56 A;  3DU6 A;  3NI7 A;  2ZOY A;  3NS4 A;  4GCL A;  4V2F A;  2QKO A;  4W97 A;  4GCT A;  3DU5 A;  5CXI A;  1U9O A;  2DG7 A;  2FBQ A;  3HTA A;  3V6G A;  5C4Y A;  3B81 A;  3G1L A;  4MXM A;  2R7O A;  3KKD A;  3RD3 A;  2HQ5 A;  5D1R A;  2ID3 A;  3MNL A;  5FKO A;  3FK7 A;  4JKZ A;  4G12 A;  2R7U A;  3DCF A;  2ZB9 A;  2ZOZ A;  3BQZ A;  2R7T A;  3LSJ A;  2DG8 A;  2O7O A;  2XPW A;  3F1B A;  5CW8 A;  4M3E A;  5FKK A;  5GP9 A;  3BR2 A;  2OF7 A;  5EYR A;  2ZCX A;  2ID6 A;  2WUI A;  3ON4 A;  2IBD A;  2TRT A;  2GUH A;  3IH2 A;  3VOX A;  3HE0 A;  3IH4 A;  4GFK A;  2GEN A;  2FD5 A;  2VPR A;  5HSZ A;  1RKT A;  3VW0 A;  5IPA A;  2UXH A;  4IRV A;  3BCG A;  3BHQ A;  2G0E A;  3IH3 A;  5J1U A;  2Y31 A;  3CCY A;  4ABZ A;  4D7N A;  4AF5 A;  5GPA A;  2XPV A;  3DPJ A;  3NNR A;  4D5F A;  2R7S A;  3BR1 A;  3ZQH A;  1U9N A;  2R7W A;  3G56 A;  3WHB A;  2R7Q A; 
#chains in the Genus database with same CATH homology
 2UXO A;  3T6N A;  2Y30 A;  4D5C A;  2DTZ A;  3HGG A;  5DAJ A;  5K58 A;  2HYT A;  3BR5 A;  5EZG A;  3ZQG A;  2G7G A;  3KKC A;  2XB5 A;  2Q24 A;  2OPT A;  4DW6 A;  5J1Y A;  1QPI A;  4AC6 A;  4JNN A;  2HXI A;  1Z0X A;  3BTL A;  2QCO A;  2HXO A;  1ZK8 A;  3HTI A;  3NPI A;  4D7M A;  3E7Q A;  3CRJ A;  3MVP A;  3F0C A;  2RAS A;  2XDN A;  3ANP A;  3C07 A;  4W1U A;  3G7R A;  5HBU A;  1ZKG A;  3DEW A;  5F08 A;  2G3B A;  2VKE A;  2VKV A;  4MO7 A;  3FK6 A;  2UXI A;  3HIM A;  3PM1 A;  2XRL A;  3ZQL A;  2YVE A;  3C2B A;  2WV1 A;  5F04 A;  1QVT A;  4AC0 A;  3HTH A;  3BR3 A;  3BTI A;  3BTC A;  3Q3S A;  2OI8 A;  3PPB A;  1A6I A;  3EGQ A;  5F27 A;  2X9D A;  3BR0 A;  1RPW A;  3BRU A;  2WGB A;  3KNW A;  3BT9 A;  4M3B A;  5EZH A;  2UXU A;  2NX4 A;  3B6C A;  1JUM A;  3O8G A;  4PXI A;  3VVY A;  2UXP A;  3VW1 A;  5D19 A;  3SFI A;  3Q0U A;  4UDS A;  2Y2Z A;  3Q0V A;  2EH3 A;  3LSP A;  3VIB A;  2NP3 A;  5F0H A;  3FIW A;  3KZ9 A;  2G7S A;  4B1R A;  1JTX A;  3P9T A;  4NN1 A;  4I76 A;  2IAI A;  3AQS A;  3HTJ A;  5FHP A;  3ON2 A;  5FKN A;  2OER A;  3TP3 A;  3LOC A;  4JL3 A;  4ACI A;  1QVU A;  5F1J A;  1JT0 A;  2QOP A;  3VVZ A;  5IOZ A;  3BNI A;  2XGE A;  3V78 A;  3LSR A;  2RHA A;  3COL A;  3O8H A;  3NRG A;  4I6Z A;  2ZCM A;  5H9T A;  2JK3 A;  4GCK A;  3ZQF A;  1JT6 A;  1SGM A;  2I10 A;  3EUP A;  1UI6 A;  5F0C A;  3BR6 A;  5K7F A;  4AUX A;  3CJD A;  3QPS A;  3G1O A;  3IUV A;  3SDG A;  2NP5 A;  2FX0 A;  3LHQ A;  3QPL A;  2ZCN A;  4ME9 A;  2NS7 A;  3HGY A;  4B3A A;  5IOY A;  4M3F A;  1JTY A;  4M3D A;  1ORK A;  5D18 A;  5FKM A;  2IEK A;  3QBM A;  3WHC A;  1RKW A;  3CDL A;  3S5R A;  2V57 A;  5K7H A;  2XGC A;  3VOK A;  5EFY A;  2IU5 A;  3O60 A;  4X1E A;  5FGL A;  3GZI A;  3G1M A;  1JUP A;  4YZE A;  2X6O A;  2QWT A;  2QIB A;  1UI5 A;  1Z77 A;  5J3L A;  3TP0 A;  4MK6 A;  2YVH A;  4CGR A;  3LJL A;  3QKX A;  4M3G A;  1T33 A;  1BJZ A;  3Q0W A;  3VUQ A;  3ANG A;  5HAW A;  2PBX A;  4HKU A;  3RH2 A;  3BTJ A;  3ZQI A;  2FQ4 A;  1VI0 A;  2NS8 A;  3BQY A;  5K7Z A;  5FKL A;  2JJ7 A;  3CWR A;  3VVX A;  5F0F A;  4JYK A;  2FJ1 A;  3B6A A;  5IP6 A;  3PAS A;  3VP5 A;  2XPU A;  2W53 A;  3GEU A;  3AQT A;  4KWA A;  2PZ9 A;  4NEL A;  5FMP A;  2RAE A;  3QQA A;  2GBY A;  2HYJ A;  2HKU A;  5AQC A;  2QTQ A;  3LWJ A;  2TCT A;  5J1R A;  1JUS A;  2F07 A;  3JSJ A;  4L62 A;  2REK A;  3BJB A;  4GFL A;  2XGD A;  3NXC A;  4ICH A;  2D6Y A;  4V2G A;  5CXG A;  3FRQ A;  5GPC A;  2O7T A;  2G7L A;  3VW2 A;  4XK4 A;  2GFN A;  3VPR A;  1T56 A;  3NI7 A;  2ZOY A;  4GCL A;  4V2F A;  2QKO A;  4W97 A;  4GCT A;  5CXI A;  1U9O A;  2DG7 A;  2FBQ A;  3HTA A;  3V6G A;  5C4Y A;  3B81 A;  3G1L A;  4MXM A;  3KKD A;  3RD3 A;  2HQ5 A;  5D1R A;  2ID3 A;  3MNL A;  5FKO A;  3FK7 A;  4JKZ A;  4G12 A;  3DCF A;  2ZB9 A;  2ZOZ A;  3BQZ A;  3LSJ A;  2DG8 A;  2O7O A;  2XPW A;  3F1B A;  5CW8 A;  4M3E A;  5FKK A;  5GP9 A;  3BR2 A;  2OF7 A;  5EYR A;  2ZCX A;  2ID6 A;  2WUI A;  3ON4 A;  2IBD A;  2TRT A;  2GUH A;  3IH2 A;  3VOX A;  3HE0 A;  3IH4 A;  4GFK A;  2GEN A;  2FD5 A;  2VPR A;  5HSZ A;  1RKT A;  3VW0 A;  5IPA A;  2UXH A;  3BCG A;  3BHQ A;  2G0E A;  3IH3 A;  5J1U A;  2Y31 A;  3CCY A;  4ABZ A;  4D7N A;  4AF5 A;  5GPA A;  2XPV A;  3DPJ A;  3NNR A;  4D5F A;  3BR1 A;  3ZQH A;  1U9N A;  3G56 A;  3WHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...