3BRUA

Crystal structure of regulatory protein tetr from rhodobacter sphaeroides
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
b'DASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein, TetR family
publication title Crystal structure of regulatory protein TetR from Rhodobacter sphaeroides.
rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Transcription
total genus 71
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bruA00
2FJ1A 5F1JA 2IAIA 4ME9A 4V2FA 5FGLA 3LWJA 4NN1A 3MNLA 2HYJA 3ZQGA 3S5RA 2YVHA 2UXOA 4D7MA 2VKEA 3ON4A 3HTJA 5EYRA 5FKLA 3G7RA 3BHQA 5D18A 2IEKA 1VI0A 5CXIA 3IUVA 3BT9A 3BCGA 2G7LA 5CXGA 3SFIA 1ORKA 5IOZA 2WGBA 5IOYA 3MVPA 3BTCA 3VIBA 4GCLA 3ZQLA 2ZCNA 4GFLA 3VVYA 3QQAA 1Z0XA 2QWTA 2QTQA 2ZCMA 4M3GA 3RH2A 3FK6A 5IPAA 2HYTA 5C4YA 4CGRA 5EFYA 2ZB9A 4D5FA 3HTAA 2XGEA 2IBDA 3HIMA 4DW6A 2ZOYA 3IH4A 3QKXA 2ID3A 5AQCA 3QPLA 3EUPA 1UI6A 2RHAA 2VPRA 5FMPA 4GCTA 2PBXA 3LHQA 2XPVA 5J1UA 5K58A 3HTIA 2FX0A 2FQ4A 2QKOA 2V57A 3O60A 1U9OA 3ON2A 3O8HA 3BR0A 3FRQA 4GCKA 3QBMA 3B6AA 3Q3SA 5F04A 3VP5A 5FHPA 2FBQA 4M3DA 4HKUA 2ID6A 3G1MA 3VW0A 2XGDA 3HGYA 3PASA 3CCYA 4JKZA 5F27A 1ZKGA 3KNWA 3WHBA 1JTYA 5FKKA 3CJDA 3IH2A 4PXIA 1JUPA 3BR1A 1QVTA 4MXMA 1T33A 5HAWA 4D7NA 4AC0A 5F0HA 3Q0VA 2WV1A 4JYKA 4MK6A 3KZ9A 3BTJA 3T6NA 1ZK8A 5FKNA 3C07A 3VPRA 5FKOA 2XDNA 3E7QA 3WHCA 2REKA 5D1RA 4L62A 2VKVA 2X9DA 4ABZA 3FIWA 5DAJA 3B6CA 4G12A 2TCTA 4I76A 3DEWA 1SGMA 4B3AA 4ICHA 4JL3A 3O8GA 4GFKA 3NNRA 2ZCXA 3BR3A 3BTIA 4ACIA 4I6ZA 3VW2A 2DG8A 3V78A 3NXCA 3VW1A 4YZEA 3F0CA 2IU5A 3NI7A 3DPJA 3BR2A 1A6IA 2RAEA 2GBYA 2GUHA 3ANGA 2UXPA 3BR6A 2X6OA 2QOPA 4V2GA 4W97A 5J1RA 2Y2ZA 2NP3A 3BQYA 3LSPA 1RKTA 3IH3A 4JNNA 3PM1A 2EH3A 5GP9A 3NPIA 1JT0A 2NS7A 2D6YA 2OPTA 5FKMA 2XGCA 2HQ5A 2DG7A 4M3EA 4X1EA 4B1RA 2GFNA 2DTZA 4XK4A 2FD5A 2QIBA 3EGQA 2OF7A 5EZHA 3ZQHA 4AC6A 2G0EA 3NRGA 3LSJA 2HKUA 1U9NA 2JK3A 4AF5A 2XRLA 3VOKA 3Q0WA 2XPUA 3GZIA 1JUSA 2GENA 2W53A 2Y31A 5J3LA 3VOXA 1Z77A 1T56A 1JT6A 3JSJA 3BRUA 4MO7A 5EZGA 2TRTA 2O7OA 4M3BA 3C2BA 1UI5A 5K7ZA 2RASA 5J1YA 2I10A 2OERA 2JJ7A 3TP0A 1RPWA 3BNIA 5H9TA 3KKCA 2WUIA 2UXUA 3GEUA 3TP3A 3HE0A 1RKWA 3QPSA 3ANPA 3KKDA 3F1BA 5F0CA 5HBUA 3CWRA 3SDGA 3CDLA 4AUXA 2G7SA 2HXOA 2NX4A 2NP5A 2PZ9A 3BR5A 5K7HA 3LJLA 3ZQIA 1JTXA 3LOCA 3BJBA 3HTHA 3G56A 2G3BA 5F08A 1QPIA 3G1LA 2G7GA 3RD3A 3LSRA 3BQZA 2QCOA 3PPBA 3VVZA 3DCFA 3COLA 5GPAA 2OI8A 3Q0UA 5K7FA 2O7TA 3V6GA 2YVEA 5F0FA 1JUMA 4M3FA 5GPCA 3AQTA 2XB5A 4W1UA 2XPWA 3CRJA 2NS8A 2Y30A 5D19A 4D5CA 5HSZA 3AQSA 5IP6A 2Q24A 2UXHA 5CW8A 3ZQFA 3BTLA 3B81A 3G1OA 1BJZA 2ZOZA 3VVXA 4NELA 3HGGA 3VUQA 2F07A 3FK7A 3P9TA 2UXIA 1QVUA 2HXIA 4UDSA 4KWAA
chains in the Genus database with same CATH superfamily
2FJ1A 5F1JA 2IAIA 4ME9A 4V2FA 5FGLA 3LWJA 4NN1A 3MNLA 2HYJA 3ZQGA 3S5RA 2YVHA 2R7RA 2UXOA 4D7MA 3DU6A 2VKEA 3ON4A 3HTJA 5EYRA 5FKLA 3G7RA 3BHQA 5D18A 2IEKA 1VI0A 5CXIA 3IUVA 3BT9A 3BCGA 2FJI1 2G7LA 5CXGA 3SFIA 1ORKA 5IOZA 2WGBA 5IOYA 3MVPA 3BTCA 3VIBA 4GCLA 3ZQLA 2ZCNA 4GFLA 3VVYA 3QQAA 1Z0XA 2QWTA 2QTQA 2ZCMA 4M3GA 3RH2A 3FK6A 5IPAA 2HYTA 5C4YA 4CGRA 5EFYA 2ZB9A 4D5FA 3HTAA 2XGEA 2IBDA 3HIMA 4DW6A 2ZOYA 3IH4A 3QKXA 2ID3A 5AQCA 3QPLA 3EUPA 1UI6A 2RHAA 2VPRA 5FMPA 4GCTA 2PBXA 3LHQA 2XPVA 5J1UA 5K58A 3HTIA 2FX0A 2FQ4A 2QKOA 2V57A 3O60A 1U9OA 3ON2A 3O8HA 3BR0A 3FRQA 4GCKA 3QBMA 3B6AA 3Q3SA 5F04A 5CQGA 3VP5A 5FHPA 2FBQA 4M3DA 4HKUA 2ID6A 3G1MA 3VW0A 4OD5A 2XGDA 3HGYA 3PASA 3CCYA 4JKZA 5F27A 1ZKGA 3KNWA 3WHBA 1JTYA 5FKKA 3CJDA 2PFVA 3IH2A 4PXIA 1JUPA 3BR1A 1QVTA 4MXMA 1T33A 5HAWA 2R7XA 4D7NA 4AC0A 5F0HA 3Q0VA 2WV1A 4JYKA 4MK6A 3KZ9A 3BTJA 3T6NA 1ZK8A 5FKNA 3C07A 3VPRA 5FKOA 2XDNA 3E7QA 3WHCA 2REKA 5D1RA 4L62A 2VKVA 2X9DA 4ABZA 3FIWA 2R7SA 5DAJA 3B6CA 4C2MA 3SWHA 4G12A 2TCTA 4OD4A 4I76A 3DEWA 1SGMA 4B3AA 2YVXA 4ICHA 4JL3A 3O8GA 4GFKA 3NNRA 2R7UA 2ZCXA 3BR3A 3BTIA 4IRVA 4ACIA 4I6ZA 3VW2A 2DG8A 3V78A 3NXCA 3VW1A 4YZEA 2R7TA 3F0CA 2IU5A 3NI7A 3DPJA 3DU5A 3BR2A 1A6IA 2RAEA 2GBYA 2GUHA 2A2FX 3ANGA 2UXPA 3BR6A 4U9LA 2X6OA 2QOPA 4V2GA 4W97A 5J1RA 2Y2ZA 2NP3A 3BQYA 3LSPA 1RKTA 4JNNA 3IH3A 3K8PC 3PM1A 2EH3A 5GP9A 3NPIA 1JT0A 2NS7A 2D6YA 2OPTA 5FKMA 2XGCA 2HQ5A 2DG7A 4M3EA 4X1EA 4B1RA 2GFNA 2DTZA 4XK4A 2FD5A 2QIBA 3EGQA 2OF7A 5EZHA 3ZQHA 4AC6A 2G0EA 3NRGA 3LSJA 2HKUA 1U9NA 2JK3A 4AF5A 2XRLA 3VTIA 3VOKA 3Q0WA 2XPUA 3GZIA 1JUSA 2GENA 2W53A 2Y31A 5J3LA 3VOXA 1Z77A 1T56A 1JT6A 3JSJA 3NS4A 3BRUA 4MO7A 5EZGA 2TRTA 2O7OA 4M3BA 3C2BA 1UI5A 5K7ZA 4DVYP 2RASA 5J1YA 2I10A 2OERA 2JJ7A 3TP0A 1RPWA 3BNIA 5H9TA 3KKCA 2WUIA 2UXUA 3GEUA 3TP3A 3HE0A 1RKWA 3QPSA 3ANPA 3KKDA 3F1BA 5F0CA 5HBUA 3CWRA 3SDGA 3CDLA 4AUXA 2G7SA 2HXOA 2NX4A 2NP5A 3FHNA 2PZ9A 3BR5A 5K7HA 3LJLA 3ZQIA 1JTXA 3LOCA 3BJBA 3HTHA 3G56A 2G3BA 5F08A 1QPIA 3G1LA 2G7GA 4WIBA 2R7VA 3RD3A 3LSRA 3BQZA 2R7OA 2QCOA 3PPBA 3VVZA 3DCFA 3COLA 5GPAA 2OI8A 3Q0UA 5K7FA 2O7TA 3V6GA 2YVEA 5F0FA 1JUMA 4M3FA 5GPCA 3AQTA 2XB5A 4W1UA 2XPWA 3CRJA 2NS8A 2Y30A 2R7QA 5D19A 4D5CA 5HSZA 4U9NA 3AQSA 5IP6A 2Q24A 2UXHA 5CW8A 3ZQFA 2ZY9A 3BTLA 3B81A 3G1OA 1BJZA 2R7WA 2ZOZA 3VVXA 3KYLA 4NELA 3HGGA 2B1EA 3VUQA 2F07A 2B3WA 3FK7A 3P9TA 2UXIA 1QVUA 2HXIA 4UDSA 4KWAA
chains in the Genus database with same CATH topology
2FJ1A 5F1JA 2IAIA 4ME9A 4V2FA 5FGLA 3LWJA 4NN1A 3MNLA 2HYJA 3ZQGA 3S5RA 2YVHA 2UXOA 4D7MA 2VKEA 3ON4A 3HTJA 5EYRA 5FKLA 3G7RA 3BHQA 5D18A 2IEKA 1VI0A 5CXIA 3IUVA 3BT9A 3BCGA 2G7LA 5CXGA 3SFIA 1ORKA 5IOZA 2WGBA 5IOYA 3MVPA 3BTCA 3VIBA 4GCLA 3ZQLA 2ZCNA 4GFLA 3VVYA 3QQAA 1Z0XA 2QWTA 2QTQA 2ZCMA 4M3GA 3RH2A 3FK6A 5IPAA 2HYTA 5C4YA 4CGRA 5EFYA 2ZB9A 4D5FA 3HTAA 2XGEA 2IBDA 3HIMA 4DW6A 2ZOYA 3IH4A 3QKXA 2ID3A 5AQCA 3QPLA 3EUPA 1UI6A 2RHAA 2VPRA 5FMPA 4GCTA 2PBXA 3LHQA 2XPVA 5J1UA 5K58A 3HTIA 2FX0A 2FQ4A 2QKOA 2V57A 3O60A 1U9OA 3ON2A 3O8HA 3BR0A 3FRQA 4GCKA 3QBMA 3B6AA 3Q3SA 5F04A 3VP5A 5FHPA 2FBQA 4M3DA 4HKUA 2ID6A 3G1MA 3VW0A 2XGDA 3HGYA 3PASA 3CCYA 4JKZA 5F27A 1ZKGA 3KNWA 3WHBA 1JTYA 5FKKA 3CJDA 3IH2A 4PXIA 1JUPA 3BR1A 1QVTA 4MXMA 1T33A 5HAWA 4D7NA 4AC0A 5F0HA 3Q0VA 2WV1A 4JYKA 4MK6A 3KZ9A 3BTJA 3T6NA 1ZK8A 5FKNA 3C07A 3VPRA 5FKOA 2XDNA 3E7QA 3WHCA 2REKA 5D1RA 4L62A 2VKVA 2X9DA 4ABZA 3FIWA 5DAJA 3B6CA 4G12A 2TCTA 4I76A 3DEWA 1SGMA 4B3AA 4ICHA 4JL3A 3O8GA 4GFKA 3NNRA 2ZCXA 3BR3A 3BTIA 4ACIA 4I6ZA 3VW2A 2DG8A 3V78A 3NXCA 3VW1A 4YZEA 3F0CA 2IU5A 3NI7A 3DPJA 3BR2A 1A6IA 2RAEA 2GBYA 2GUHA 3ANGA 2UXPA 3BR6A 2X6OA 2QOPA 4V2GA 4W97A 5J1RA 2Y2ZA 2NP3A 3BQYA 3LSPA 1RKTA 3IH3A 4JNNA 3PM1A 2EH3A 5GP9A 3NPIA 1JT0A 2NS7A 2D6YA 2OPTA 5FKMA 2XGCA 2HQ5A 2DG7A 4M3EA 4X1EA 4B1RA 2GFNA 2DTZA 4XK4A 2FD5A 2QIBA 3EGQA 2OF7A 5EZHA 3ZQHA 4AC6A 2G0EA 3NRGA 3LSJA 2HKUA 1U9NA 2JK3A 4AF5A 2XRLA 3VOKA 3Q0WA 2XPUA 3GZIA 1JUSA 2GENA 2W53A 2Y31A 5J3LA 3VOXA 1Z77A 1T56A 1JT6A 3JSJA 3BRUA 4MO7A 5EZGA 2TRTA 2O7OA 4M3BA 3C2BA 1UI5A 5K7ZA 2RASA 5J1YA 2I10A 2OERA 2JJ7A 3TP0A 1RPWA 3BNIA 5H9TA 3KKCA 2WUIA 2UXUA 3GEUA 3TP3A 3HE0A 1RKWA 3QPSA 3ANPA 3KKDA 3F1BA 5F0CA 5HBUA 3CWRA 3SDGA 3CDLA 4AUXA 2G7SA 2HXOA 2NX4A 2NP5A 2PZ9A 3BR5A 5K7HA 3LJLA 3ZQIA 1JTXA 3LOCA 3BJBA 3HTHA 3G56A 2G3BA 5F08A 1QPIA 3G1LA 2G7GA 3RD3A 3LSRA 3BQZA 2QCOA 3PPBA 3VVZA 3DCFA 3COLA 5GPAA 2OI8A 3Q0UA 5K7FA 2O7TA 3V6GA 2YVEA 5F0FA 1JUMA 4M3FA 5GPCA 3AQTA 2XB5A 4W1UA 2XPWA 3CRJA 2NS8A 2Y30A 5D19A 4D5CA 5HSZA 3AQSA 5IP6A 2Q24A 2UXHA 5CW8A 3ZQFA 3BTLA 3B81A 3G1OA 1BJZA 2ZOZA 3VVXA 4NELA 3HGGA 3VUQA 2F07A 3FK7A 3P9TA 2UXIA 1QVUA 2HXIA 4UDSA 4KWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ1 A;  5F1J A;  2IAI A;  4ME9 A;  4V2F A;  5FGL A;  3LWJ A;  4NN1 A;  3MNL A;  2HYJ A;  3ZQG A;  3S5R A;  2YVH A;  2UXO A;  4D7M A;  2VKE A;  3ON4 A;  3HTJ A;  5EYR A;  5FKL A;  3G7R A;  3BHQ A;  5D18 A;  2IEK A;  1VI0 A;  5CXI A;  3IUV A;  3BT9 A;  3BCG A;  2G7L A;  5CXG A;  3SFI A;  1ORK A;  5IOZ A;  2WGB A;  5IOY A;  3MVP A;  3BTC A;  3VIB A;  4GCL A;  3ZQL A;  2ZCN A;  4GFL A;  3VVY A;  3QQA A;  1Z0X A;  2QWT A;  2QTQ A;  2ZCM A;  4M3G A;  3RH2 A;  3FK6 A;  5IPA A;  2HYT A;  5C4Y A;  4CGR A;  5EFY A;  2ZB9 A;  4D5F A;  3HTA A;  2XGE A;  2IBD A;  3HIM A;  4DW6 A;  2ZOY A;  3IH4 A;  3QKX A;  2ID3 A;  5AQC A;  3QPL A;  3EUP A;  1UI6 A;  2RHA A;  2VPR A;  5FMP A;  4GCT A;  2PBX A;  3LHQ A;  2XPV A;  5J1U A;  5K58 A;  3HTI A;  2FX0 A;  2FQ4 A;  2QKO A;  2V57 A;  3O60 A;  1U9O A;  3ON2 A;  3O8H A;  3BR0 A;  3FRQ A;  4GCK A;  3QBM A;  3B6A A;  3Q3S A;  5F04 A;  3VP5 A;  5FHP A;  2FBQ A;  4M3D A;  4HKU A;  2ID6 A;  3G1M A;  3VW0 A;  2XGD A;  3HGY A;  3PAS A;  3CCY A;  4JKZ A;  5F27 A;  1ZKG A;  3KNW A;  3WHB A;  1JTY A;  5FKK A;  3CJD A;  3IH2 A;  4PXI A;  1JUP A;  3BR1 A;  1QVT A;  4MXM A;  1T33 A;  5HAW A;  4D7N A;  4AC0 A;  5F0H A;  3Q0V A;  2WV1 A;  4JYK A;  4MK6 A;  3KZ9 A;  3BTJ A;  3T6N A;  1ZK8 A;  5FKN A;  3C07 A;  3VPR A;  5FKO A;  2XDN A;  3E7Q A;  3WHC A;  2REK A;  5D1R A;  4L62 A;  2VKV A;  2X9D A;  4ABZ A;  3FIW A;  5DAJ A;  3B6C A;  4G12 A;  2TCT A;  4I76 A;  3DEW A;  1SGM A;  4B3A A;  4ICH A;  4JL3 A;  3O8G A;  4GFK A;  3NNR A;  2ZCX A;  3BR3 A;  3BTI A;  4ACI A;  4I6Z A;  3VW2 A;  2DG8 A;  3V78 A;  3NXC A;  3VW1 A;  4YZE A;  3F0C A;  2IU5 A;  3NI7 A;  3DPJ A;  3BR2 A;  1A6I A;  2RAE A;  2GBY A;  2GUH A;  3ANG A;  2UXP A;  3BR6 A;  2X6O A;  2QOP A;  4V2G A;  4W97 A;  5J1R A;  2Y2Z A;  2NP3 A;  3BQY A;  3LSP A;  1RKT A;  3IH3 A;  4JNN A;  3PM1 A;  2EH3 A;  5GP9 A;  3NPI A;  1JT0 A;  2NS7 A;  2D6Y A;  2OPT A;  5FKM A;  2XGC A;  2HQ5 A;  2DG7 A;  4M3E A;  4X1E A;  4B1R A;  2GFN A;  2DTZ A;  4XK4 A;  2FD5 A;  2QIB A;  3EGQ A;  2OF7 A;  5EZH A;  3ZQH A;  4AC6 A;  2G0E A;  3NRG A;  3LSJ A;  2HKU A;  1U9N A;  2JK3 A;  4AF5 A;  2XRL A;  3VOK A;  3Q0W A;  2XPU A;  3GZI A;  1JUS A;  2GEN A;  2W53 A;  2Y31 A;  5J3L A;  3VOX A;  1Z77 A;  1T56 A;  1JT6 A;  3JSJ A;  3BRU A;  4MO7 A;  5EZG A;  2TRT A;  2O7O A;  4M3B A;  3C2B A;  1UI5 A;  5K7Z A;  2RAS A;  5J1Y A;  2I10 A;  2OER A;  2JJ7 A;  3TP0 A;  1RPW A;  3BNI A;  5H9T A;  3KKC A;  2WUI A;  2UXU A;  3GEU A;  3TP3 A;  3HE0 A;  1RKW A;  3QPS A;  3ANP A;  3KKD A;  3F1B A;  5F0C A;  5HBU A;  3CWR A;  3SDG A;  3CDL A;  4AUX A;  2G7S A;  2HXO A;  2NX4 A;  2NP5 A;  2PZ9 A;  3BR5 A;  5K7H A;  3LJL A;  3ZQI A;  1JTX A;  3LOC A;  3BJB A;  3HTH A;  3G56 A;  2G3B A;  5F08 A;  1QPI A;  3G1L A;  2G7G A;  3RD3 A;  3LSR A;  3BQZ A;  2QCO A;  3PPB A;  3VVZ A;  3DCF A;  3COL A;  5GPA A;  2OI8 A;  3Q0U A;  5K7F A;  2O7T A;  3V6G A;  2YVE A;  5F0F A;  1JUM A;  4M3F A;  5GPC A;  3AQT A;  2XB5 A;  4W1U A;  2XPW A;  3CRJ A;  2NS8 A;  2Y30 A;  5D19 A;  4D5C A;  5HSZ A;  3AQS A;  5IP6 A;  2Q24 A;  2UXH A;  5CW8 A;  3ZQF A;  3BTL A;  3B81 A;  3G1O A;  1BJZ A;  2ZOZ A;  3VVX A;  4NEL A;  3HGG A;  3VUQ A;  2F07 A;  3FK7 A;  3P9T A;  2UXI A;  1QVU A;  2HXI A;  4UDS A;  4KWA A; 
#chains in the Genus database with same CATH topology
 2FJ1 A;  5F1J A;  2IAI A;  4ME9 A;  4V2F A;  5FGL A;  3LWJ A;  4NN1 A;  3MNL A;  2HYJ A;  3ZQG A;  3S5R A;  2YVH A;  2R7R A;  2UXO A;  4D7M A;  3DU6 A;  2VKE A;  3ON4 A;  3HTJ A;  5EYR A;  5FKL A;  3G7R A;  3BHQ A;  5D18 A;  2IEK A;  1VI0 A;  5CXI A;  3IUV A;  3BT9 A;  3BCG A;  2FJI 1;  2G7L A;  5CXG A;  3SFI A;  1ORK A;  5IOZ A;  2WGB A;  5IOY A;  3MVP A;  3BTC A;  3VIB A;  4GCL A;  3ZQL A;  2ZCN A;  4GFL A;  3VVY A;  3QQA A;  1Z0X A;  2QWT A;  2QTQ A;  2ZCM A;  4M3G A;  3RH2 A;  3FK6 A;  5IPA A;  2HYT A;  5C4Y A;  4CGR A;  5EFY A;  2ZB9 A;  4D5F A;  3HTA A;  2XGE A;  2IBD A;  3HIM A;  4DW6 A;  2ZOY A;  3IH4 A;  3QKX A;  2ID3 A;  5AQC A;  3QPL A;  3EUP A;  1UI6 A;  2RHA A;  2VPR A;  5FMP A;  4GCT A;  2PBX A;  3LHQ A;  2XPV A;  5J1U A;  5K58 A;  3HTI A;  2FX0 A;  2FQ4 A;  2QKO A;  2V57 A;  3O60 A;  1U9O A;  3ON2 A;  3O8H A;  3BR0 A;  3FRQ A;  4GCK A;  3QBM A;  3B6A A;  3Q3S A;  5F04 A;  5CQG A;  3VP5 A;  5FHP A;  2FBQ A;  4M3D A;  4HKU A;  2ID6 A;  3G1M A;  3VW0 A;  4OD5 A;  2XGD A;  3HGY A;  3PAS A;  3CCY A;  4JKZ A;  5F27 A;  1ZKG A;  3KNW A;  3WHB A;  1JTY A;  5FKK A;  3CJD A;  2PFV A;  3IH2 A;  4PXI A;  1JUP A;  3BR1 A;  1QVT A;  4MXM A;  1T33 A;  5HAW A;  2R7X A;  4D7N A;  4AC0 A;  5F0H A;  3Q0V A;  2WV1 A;  4JYK A;  4MK6 A;  3KZ9 A;  3BTJ A;  3T6N A;  1ZK8 A;  5FKN A;  3C07 A;  3VPR A;  5FKO A;  2XDN A;  3E7Q A;  3WHC A;  2REK A;  5D1R A;  4L62 A;  2VKV A;  2X9D A;  4ABZ A;  3FIW A;  2R7S A;  5DAJ A;  3B6C A;  4C2M A;  3SWH A;  4G12 A;  2TCT A;  4OD4 A;  4I76 A;  3DEW A;  1SGM A;  4B3A A;  2YVX A;  4ICH A;  4JL3 A;  3O8G A;  4GFK A;  3NNR A;  2R7U A;  2ZCX A;  3BR3 A;  3BTI A;  4IRV A;  4ACI A;  4I6Z A;  3VW2 A;  2DG8 A;  3V78 A;  3NXC A;  3VW1 A;  4YZE A;  2R7T A;  3F0C A;  2IU5 A;  3NI7 A;  3DPJ A;  3DU5 A;  3BR2 A;  1A6I A;  2RAE A;  2GBY A;  2GUH A;  2A2F X;  3ANG A;  2UXP A;  3BR6 A;  4U9L A;  2X6O A;  2QOP A;  4V2G A;  4W97 A;  5J1R A;  2Y2Z A;  2NP3 A;  3BQY A;  3LSP A;  1RKT A;  4JNN A;  3IH3 A;  3K8P C;  3PM1 A;  2EH3 A;  5GP9 A;  3NPI A;  1JT0 A;  2NS7 A;  2D6Y A;  2OPT A;  5FKM A;  2XGC A;  2HQ5 A;  2DG7 A;  4M3E A;  4X1E A;  4B1R A;  2GFN A;  2DTZ A;  4XK4 A;  2FD5 A;  2QIB A;  3EGQ A;  2OF7 A;  5EZH A;  3ZQH A;  4AC6 A;  2G0E A;  3NRG A;  3LSJ A;  2HKU A;  1U9N A;  2JK3 A;  4AF5 A;  2XRL A;  3VTI A;  3VOK A;  3Q0W A;  2XPU A;  3GZI A;  1JUS A;  2GEN A;  2W53 A;  2Y31 A;  5J3L A;  3VOX A;  1Z77 A;  1T56 A;  1JT6 A;  3JSJ A;  3NS4 A;  3BRU A;  4MO7 A;  5EZG A;  2TRT A;  2O7O A;  4M3B A;  3C2B A;  1UI5 A;  5K7Z A;  4DVY P;  2RAS A;  5J1Y A;  2I10 A;  2OER A;  2JJ7 A;  3TP0 A;  1RPW A;  3BNI A;  5H9T A;  3KKC A;  2WUI A;  2UXU A;  3GEU A;  3TP3 A;  3HE0 A;  1RKW A;  3QPS A;  3ANP A;  3KKD A;  3F1B A;  5F0C A;  5HBU A;  3CWR A;  3SDG A;  3CDL A;  4AUX A;  2G7S A;  2HXO A;  2NX4 A;  2NP5 A;  3FHN A;  2PZ9 A;  3BR5 A;  5K7H A;  3LJL A;  3ZQI A;  1JTX A;  3LOC A;  3BJB A;  3HTH A;  3G56 A;  2G3B A;  5F08 A;  1QPI A;  3G1L A;  2G7G A;  4WIB A;  2R7V A;  3RD3 A;  3LSR A;  3BQZ A;  2R7O A;  2QCO A;  3PPB A;  3VVZ A;  3DCF A;  3COL A;  5GPA A;  2OI8 A;  3Q0U A;  5K7F A;  2O7T A;  3V6G A;  2YVE A;  5F0F A;  1JUM A;  4M3F A;  5GPC A;  3AQT A;  2XB5 A;  4W1U A;  2XPW A;  3CRJ A;  2NS8 A;  2Y30 A;  2R7Q A;  5D19 A;  4D5C A;  5HSZ A;  4U9N A;  3AQS A;  5IP6 A;  2Q24 A;  2UXH A;  5CW8 A;  3ZQF A;  2ZY9 A;  3BTL A;  3B81 A;  3G1O A;  1BJZ A;  2R7W A;  2ZOZ A;  3VVX A;  3KYL A;  4NEL A;  3HGG A;  2B1E A;  3VUQ A;  2F07 A;  2B3W A;  3FK7 A;  3P9T A;  2UXI A;  1QVU A;  2HXI A;  4UDS A;  4KWA A; 
#chains in the Genus database with same CATH homology
 2FJ1 A;  5F1J A;  2IAI A;  4ME9 A;  4V2F A;  5FGL A;  3LWJ A;  4NN1 A;  3MNL A;  2HYJ A;  3ZQG A;  3S5R A;  2YVH A;  2UXO A;  4D7M A;  2VKE A;  3ON4 A;  3HTJ A;  5EYR A;  5FKL A;  3G7R A;  3BHQ A;  5D18 A;  2IEK A;  1VI0 A;  5CXI A;  3IUV A;  3BT9 A;  3BCG A;  2G7L A;  5CXG A;  3SFI A;  1ORK A;  5IOZ A;  2WGB A;  5IOY A;  3MVP A;  3BTC A;  3VIB A;  4GCL A;  3ZQL A;  2ZCN A;  4GFL A;  3VVY A;  3QQA A;  1Z0X A;  2QWT A;  2QTQ A;  2ZCM A;  4M3G A;  3RH2 A;  3FK6 A;  5IPA A;  2HYT A;  5C4Y A;  4CGR A;  5EFY A;  2ZB9 A;  4D5F A;  3HTA A;  2XGE A;  2IBD A;  3HIM A;  4DW6 A;  2ZOY A;  3IH4 A;  3QKX A;  2ID3 A;  5AQC A;  3QPL A;  3EUP A;  1UI6 A;  2RHA A;  2VPR A;  5FMP A;  4GCT A;  2PBX A;  3LHQ A;  2XPV A;  5J1U A;  5K58 A;  3HTI A;  2FX0 A;  2FQ4 A;  2QKO A;  2V57 A;  3O60 A;  1U9O A;  3ON2 A;  3O8H A;  3BR0 A;  3FRQ A;  4GCK A;  3QBM A;  3B6A A;  3Q3S A;  5F04 A;  3VP5 A;  5FHP A;  2FBQ A;  4M3D A;  4HKU A;  2ID6 A;  3G1M A;  3VW0 A;  2XGD A;  3HGY A;  3PAS A;  3CCY A;  4JKZ A;  5F27 A;  1ZKG A;  3KNW A;  3WHB A;  1JTY A;  5FKK A;  3CJD A;  3IH2 A;  4PXI A;  1JUP A;  3BR1 A;  1QVT A;  4MXM A;  1T33 A;  5HAW A;  4D7N A;  4AC0 A;  5F0H A;  3Q0V A;  2WV1 A;  4JYK A;  4MK6 A;  3KZ9 A;  3BTJ A;  3T6N A;  1ZK8 A;  5FKN A;  3C07 A;  3VPR A;  5FKO A;  2XDN A;  3E7Q A;  3WHC A;  2REK A;  5D1R A;  4L62 A;  2VKV A;  2X9D A;  4ABZ A;  3FIW A;  5DAJ A;  3B6C A;  4G12 A;  2TCT A;  4I76 A;  3DEW A;  1SGM A;  4B3A A;  4ICH A;  4JL3 A;  3O8G A;  4GFK A;  3NNR A;  2ZCX A;  3BR3 A;  3BTI A;  4ACI A;  4I6Z A;  3VW2 A;  2DG8 A;  3V78 A;  3NXC A;  3VW1 A;  4YZE A;  3F0C A;  2IU5 A;  3NI7 A;  3DPJ A;  3BR2 A;  1A6I A;  2RAE A;  2GBY A;  2GUH A;  3ANG A;  2UXP A;  3BR6 A;  2X6O A;  2QOP A;  4V2G A;  4W97 A;  5J1R A;  2Y2Z A;  2NP3 A;  3BQY A;  3LSP A;  1RKT A;  3IH3 A;  4JNN A;  3PM1 A;  2EH3 A;  5GP9 A;  3NPI A;  1JT0 A;  2NS7 A;  2D6Y A;  2OPT A;  5FKM A;  2XGC A;  2HQ5 A;  2DG7 A;  4M3E A;  4X1E A;  4B1R A;  2GFN A;  2DTZ A;  4XK4 A;  2FD5 A;  2QIB A;  3EGQ A;  2OF7 A;  5EZH A;  3ZQH A;  4AC6 A;  2G0E A;  3NRG A;  3LSJ A;  2HKU A;  1U9N A;  2JK3 A;  4AF5 A;  2XRL A;  3VOK A;  3Q0W A;  2XPU A;  3GZI A;  1JUS A;  2GEN A;  2W53 A;  2Y31 A;  5J3L A;  3VOX A;  1Z77 A;  1T56 A;  1JT6 A;  3JSJ A;  3BRU A;  4MO7 A;  5EZG A;  2TRT A;  2O7O A;  4M3B A;  3C2B A;  1UI5 A;  5K7Z A;  2RAS A;  5J1Y A;  2I10 A;  2OER A;  2JJ7 A;  3TP0 A;  1RPW A;  3BNI A;  5H9T A;  3KKC A;  2WUI A;  2UXU A;  3GEU A;  3TP3 A;  3HE0 A;  1RKW A;  3QPS A;  3ANP A;  3KKD A;  3F1B A;  5F0C A;  5HBU A;  3CWR A;  3SDG A;  3CDL A;  4AUX A;  2G7S A;  2HXO A;  2NX4 A;  2NP5 A;  2PZ9 A;  3BR5 A;  5K7H A;  3LJL A;  3ZQI A;  1JTX A;  3LOC A;  3BJB A;  3HTH A;  3G56 A;  2G3B A;  5F08 A;  1QPI A;  3G1L A;  2G7G A;  3RD3 A;  3LSR A;  3BQZ A;  2QCO A;  3PPB A;  3VVZ A;  3DCF A;  3COL A;  5GPA A;  2OI8 A;  3Q0U A;  5K7F A;  2O7T A;  3V6G A;  2YVE A;  5F0F A;  1JUM A;  4M3F A;  5GPC A;  3AQT A;  2XB5 A;  4W1U A;  2XPW A;  3CRJ A;  2NS8 A;  2Y30 A;  5D19 A;  4D5C A;  5HSZ A;  3AQS A;  5IP6 A;  2Q24 A;  2UXH A;  5CW8 A;  3ZQF A;  3BTL A;  3B81 A;  3G1O A;  1BJZ A;  2ZOZ A;  3VVX A;  4NEL A;  3HGG A;  3VUQ A;  2F07 A;  3FK7 A;  3P9T A;  2UXI A;  1QVU A;  2HXI A;  4UDS A;  4KWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...