3BRUA

Crystal structure of regulatory protein tetr from rhodobacter sphaeroides
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
DASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein, TetR family
publication title Crystal structure of regulatory protein TetR from Rhodobacter sphaeroides.
rcsb
source organism Rhodobacter sphaeroides 2.4.1
total genus 71
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bruA00
3O8GA 3G1MA 3ON2A 3ZQIA 5F0CA 4I6ZA 3FRQA 5K7ZA 3BRUA 2X9DA 1BJZA 3NNRA 3E7QA 5AQCA 3HTJA 2OERA 2HKUA 3LSPA 5J1RA 4JL3A 2REKA 4V2GA 3BTIA 3GEUA 3CRJA 2VPRA 4NN1A 2I10A 3FIWA 5D1RA 3BTJA 2FJ1A 2RHAA 2ZOZA 1RPWA 2OI8A 3EUPA 3HTAA 2DTZA 5IP6A 5IOZA 3BCGA 2GFNA 4GCTA 3Q0VA 1UI5A 1T56A 5FKNA 3G1LA 2XRLA 1JUSA 3IUVA 5J1UA 3DPJA 3BR5A 2Y2ZA 2XGDA 2JK3A 2QCOA 3BR3A 4JNNA 5CXIA 3COLA 4G12A 3JSJA 3PASA 3EGQA 3BTCA 3NRGA 3B81A 2G7GA 1ZKGA 4AC6A 3MNLA 1UI6A 2WUIA 4M3EA 5GPAA 3KKCA 3LHQA 5CXGA 5GP9A 3C07A 4UDSA 3NI7A 3ZQHA 3BNIA 3CJDA 2UXHA 4GFKA 4M3DA 5EZGA 4AUXA 3KZ9A 2TRTA 3P9TA 3BHQA 3DEWA 5FGLA 1Z0XA 1JT0A 4AF5A 1U9NA 3FK6A 2WV1A 3BR6A 3VIBA 5HSZA 3HTHA 4ACIA 2XGEA 3BR0A 4L62A 3BT9A 3VVXA 5FHPA 3SDGA 4GCLA 3Q0UA 3Q0WA 1JUPA 2IEKA 3VW0A 2O7TA 2O7OA 2XGCA 2IAIA 3LOCA 2IU5A 3VP5A 3QKXA 5F04A 4MK6A 3CCYA 2YVEA 2G3BA 2Y30A 2HXIA 3ZQFA 4MO7A 3LSRA 4ABZA 2ZCMA 2FQ4A 4I76A 5J1YA 1ORKA 3O8HA 2GBYA 4MXMA 2ZOYA 3WHCA 2XB5A 4M3GA 4AC0A 3C2BA 3LSJA 3VOXA 3BR1A 3FK7A 4ICHA 1U9OA 2QTQA 1JT6A 3GZIA 5DAJA 2QKOA 5F08A 2QOPA 2GENA 3V78A 4D7NA 2D6YA 2NP3A 1JUMA 2NS7A 4GFLA 2XPVA 3BQYA 4HKUA 3KNWA 3F0CA 4D5CA 2DG7A 4X1EA 4W1UA 1JTYA 5IPAA 1ZK8A 2TCTA 4PXIA 3VOKA 3VUQA 2ZCXA 2FD5A 3VVZA 4ME9A 5FKKA 5IOYA 3VPRA 2W53A 2XDNA 1RKTA 5FMPA 2NS8A 3CDLA 2JJ7A 2F07A 5J3LA 5F0HA 2ZB9A 4YZEA 2HYTA 3VW1A 1T33A 2DG8A 2Q24A 3ANPA 2G7SA 3G1OA 5C4YA 2WGBA 1QVTA 2HXOA 2UXOA 3IH4A 2GUHA 2VKEA 2NX4A 5D18A 3HE0A 2RAEA 1SGMA 3IH3A 2QWTA 3F1BA 3NPIA 2IBDA 2EH3A 3B6AA 2YVHA 2G0EA 3S5RA 2PBXA 4W97A 2OF7A 3HIMA 3MVPA 5EYRA 3HGYA 5F27A 4B3AA 5HAWA 3G56A 3KKDA 3G7RA 5GPCA 4JYKA 3QPLA 3AQSA 3TP0A 2X6OA 4CGRA 4KWAA 4M3BA 2ZCNA 5K7FA 2NP5A 2G7LA 2HQ5A 2RASA 1RKWA 3HTIA 5D19A 2QIBA 2HYJA 2UXIA 2FBQA 2ID6A 3PPBA 4D5FA 3QQAA 1QPIA 3QBMA 2XPWA 3WHBA 3T6NA 3VW2A 4DW6A 3HGGA 1JTXA 5FKLA 1QVUA 4D7MA 1Z77A 3V6GA 3DCFA 4V2FA 3IH2A 5CW8A 3BJBA 3BTLA 4JKZA 5F1JA 3ZQGA 4XK4A 5HBUA 3ZQLA 5H9TA 2UXUA 3QPSA 3RD3A 2UXPA 2XPUA 3LWJA 3CWRA 3TP3A 3RH2A 3NXCA 4GCKA 5EFYA 3ON4A 2V57A 5FKOA 3O60A 4B1RA 2VKVA 5K58A 1A6IA 3PM1A 2FX0A 3AQTA 5K7HA 3BR2A 3SFIA 3B6CA 3LJLA 1VI0A 2OPTA 5FKMA 2Y31A 5EZHA 4NELA 3VVYA 2ID3A 3Q3SA 5F0FA 4M3FA 2PZ9A 3BQZA 3ANGA
chains in the Genus database with same CATH superfamily
3O8GA 3KYLA 3G1MA 3ON2A 3ZQIA 5F0CA 4I6ZA 3FRQA 5K7ZA 3BRUA 2X9DA 1BJZA 3NNRA 3E7QA 5AQCA 2R7UA 3HTJA 2OERA 2HKUA 3LSPA 5J1RA 4JL3A 2REKA 4V2GA 2B3WA 3BTIA 3GEUA 3CRJA 2VPRA 4NN1A 2I10A 3FIWA 5D1RA 3BTJA 2FJ1A 2RHAA 2R7OA 2ZOZA 1RPWA 2OI8A 3EUPA 3HTAA 2DTZA 5IP6A 5IOZA 3BCGA 2GFNA 4GCTA 3Q0VA 1UI5A 1T56A 5FKNA 3G1LA 2XRLA 1JUSA 3IUVA 5J1UA 3DPJA 3BR5A 2Y2ZA 2XGDA 2JK3A 2QCOA 3BR3A 5CXIA 4JNNA 3VTIA 3COLA 2ZY9A 4G12A 3JSJA 3PASA 3EGQA 2R7XA 3BTCA 3NRGA 3B81A 2R7VA 2G7GA 1ZKGA 4AC6A 4U9NA 3MNLA 1UI6A 2R7QA 2WUIA 4M3EA 5GPAA 3KKCA 3LHQA 5CXGA 5GP9A 3C07A 4UDSA 3NI7A 3ZQHA 3BNIA 3CJDA 2UXHA 4GFKA 4M3DA 5EZGA 4AUXA 3KZ9A 2TRTA 3P9TA 3BHQA 3DEWA 5FGLA 1Z0XA 1JT0A 4AF5A 4U9LA 1U9NA 3FK6A 2WV1A 3BR6A 3VIBA 2R7WA 5HSZA 3HTHA 5CQGA 4ACIA 2XGEA 3BR0A 4L62A 3DU6A 3BT9A 3VVXA 5FHPA 3SDGA 4GCLA 3Q0UA 3Q0WA 1JUPA 2IEKA 3VW0A 2O7TA 2O7OA 2XGCA 2IAIA 3LOCA 2IU5A 3VP5A 3QKXA 5F04A 3NS4A 4MK6A 3CCYA 2YVEA 2G3BA 2Y30A 2HXIA 3ZQFA 4MO7A 3LSRA 4ABZA 2ZCMA 2FQ4A 4I76A 3DU5A 5J1YA 1ORKA 3O8HA 2GBYA 4MXMA 2ZOYA 3WHCA 2XB5A 4M3GA 4AC0A 3C2BA 3LSJA 3VOXA 3BR1A 3FK7A 4ICHA 1U9OA 2QTQA 1JT6A 3GZIA 5DAJA 2QKOA 5F08A 2QOPA 2GENA 2R7TA 3V78A 4D7NA 2D6YA 2NP3A 1JUMA 2PFVA 2NS7A 4GFLA 2XPVA 3BQYA 4HKUA 3KNWA 3F0CA 4D5CA 2DG7A 4X1EA 4W1UA 1JTYA 5IPAA 1ZK8A 2TCTA 4PXIA 3VOKA 3VUQA 2ZCXA 2FD5A 3VVZA 4ME9A 5FKKA 5IOYA 3VPRA 2W53A 2XDNA 1RKTA 5FMPA 2NS8A 3CDLA 2JJ7A 2F07A 5J3LA 5F0HA 2ZB9A 4YZEA 2HYTA 3VW1A 1T33A 2DG8A 2Q24A 4C2MA 3ANPA 2G7SA 3G1OA 5C4YA 2WGBA 1QVTA 2HXOA 2UXOA 3IH4A 2GUHA 4DVYP 2VKEA 2NX4A 5D18A 3HE0A 2RAEA 1SGMA 3IH3A 2QWTA 3F1BA 3NPIA 2IBDA 2EH3A 3B6AA 2YVHA 2G0EA 3S5RA 2PBXA 4W97A 2OF7A 3HIMA 3MVPA 5EYRA 3HGYA 5F27A 4B3AA 5HAWA 3G56A 4WIBA 3KKDA 3G7RA 5GPCA 4JYKA 3QPLA 3AQSA 3TP0A 2X6OA 4CGRA 4KWAA 4M3BA 2YVXA 2ZCNA 5K7FA 2NP5A 4OD5A 2G7LA 2HQ5A 2RASA 1RKWA 2FJI1 3HTIA 5D19A 2QIBA 2HYJA 2UXIA 2FBQA 2ID6A 3PPBA 4D5FA 3QQAA 2R7RA 1QPIA 3QBMA 2XPWA 3WHBA 3T6NA 3VW2A 4DW6A 3HGGA 1JTXA 5FKLA 1QVUA 4D7MA 1Z77A 3FHNA 3V6GA 3DCFA 4V2FA 3IH2A 5CW8A 3BJBA 2A2FX 3BTLA 4JKZA 5F1JA 3ZQGA 4XK4A 5HBUA 3ZQLA 5H9TA 2B1EA 2UXUA 3QPSA 3RD3A 3K8PC 2UXPA 2XPUA 3LWJA 3CWRA 3TP3A 3RH2A 3NXCA 4GCKA 5EFYA 3ON4A 2V57A 4OD4A 5FKOA 3O60A 4B1RA 2VKVA 5K58A 3SWHA 1A6IA 3PM1A 2FX0A 3AQTA 5K7HA 3BR2A 3SFIA 3B6CA 4IRVA 3LJLA 1VI0A 2OPTA 2R7SA 5FKMA 2Y31A 5EZHA 4NELA 3VVYA 2ID3A 3Q3SA 5F0FA 4M3FA 2PZ9A 3BQZA 3ANGA
chains in the Genus database with same CATH topology
3O8GA 3G1MA 3ON2A 3ZQIA 5F0CA 4I6ZA 3FRQA 5K7ZA 3BRUA 2X9DA 1BJZA 3NNRA 3E7QA 5AQCA 3HTJA 2OERA 2HKUA 3LSPA 5J1RA 4JL3A 2REKA 4V2GA 3BTIA 3GEUA 3CRJA 2VPRA 4NN1A 2I10A 3FIWA 5D1RA 3BTJA 2FJ1A 2RHAA 2ZOZA 1RPWA 2OI8A 3EUPA 3HTAA 2DTZA 5IP6A 5IOZA 3BCGA 2GFNA 4GCTA 3Q0VA 1UI5A 1T56A 5FKNA 3G1LA 2XRLA 1JUSA 3IUVA 5J1UA 3DPJA 3BR5A 2Y2ZA 2XGDA 2JK3A 2QCOA 3BR3A 4JNNA 5CXIA 3COLA 4G12A 3JSJA 3PASA 3EGQA 3BTCA 3NRGA 3B81A 2G7GA 1ZKGA 4AC6A 3MNLA 1UI6A 2WUIA 4M3EA 5GPAA 3KKCA 3LHQA 5CXGA 5GP9A 3C07A 4UDSA 3NI7A 3ZQHA 3BNIA 3CJDA 2UXHA 4GFKA 4M3DA 5EZGA 4AUXA 3KZ9A 2TRTA 3P9TA 3BHQA 3DEWA 5FGLA 1Z0XA 1JT0A 4AF5A 1U9NA 3FK6A 2WV1A 3BR6A 3VIBA 5HSZA 3HTHA 4ACIA 2XGEA 3BR0A 4L62A 3BT9A 3VVXA 5FHPA 3SDGA 4GCLA 3Q0UA 3Q0WA 1JUPA 2IEKA 3VW0A 2O7TA 2O7OA 2XGCA 2IAIA 3LOCA 2IU5A 3VP5A 3QKXA 5F04A 4MK6A 3CCYA 2YVEA 2G3BA 2Y30A 2HXIA 3ZQFA 4MO7A 3LSRA 4ABZA 2ZCMA 2FQ4A 4I76A 5J1YA 1ORKA 3O8HA 2GBYA 4MXMA 2ZOYA 3WHCA 2XB5A 4M3GA 4AC0A 3C2BA 3LSJA 3VOXA 3BR1A 3FK7A 4ICHA 1U9OA 2QTQA 1JT6A 3GZIA 5DAJA 2QKOA 5F08A 2QOPA 2GENA 3V78A 4D7NA 2D6YA 2NP3A 1JUMA 2NS7A 4GFLA 2XPVA 3BQYA 4HKUA 3KNWA 3F0CA 4D5CA 2DG7A 4X1EA 4W1UA 1JTYA 5IPAA 1ZK8A 2TCTA 4PXIA 3VOKA 3VUQA 2ZCXA 2FD5A 3VVZA 4ME9A 5FKKA 5IOYA 3VPRA 2W53A 2XDNA 1RKTA 5FMPA 2NS8A 3CDLA 2JJ7A 2F07A 5J3LA 5F0HA 2ZB9A 4YZEA 2HYTA 3VW1A 1T33A 2DG8A 2Q24A 3ANPA 2G7SA 3G1OA 5C4YA 2WGBA 1QVTA 2HXOA 2UXOA 3IH4A 2GUHA 2VKEA 2NX4A 5D18A 3HE0A 2RAEA 1SGMA 3IH3A 2QWTA 3F1BA 3NPIA 2IBDA 2EH3A 3B6AA 2YVHA 2G0EA 3S5RA 2PBXA 4W97A 2OF7A 3HIMA 3MVPA 5EYRA 3HGYA 5F27A 4B3AA 5HAWA 3G56A 3KKDA 3G7RA 5GPCA 4JYKA 3QPLA 3AQSA 3TP0A 2X6OA 4CGRA 4KWAA 4M3BA 2ZCNA 5K7FA 2NP5A 2G7LA 2HQ5A 2RASA 1RKWA 3HTIA 5D19A 2QIBA 2HYJA 2UXIA 2FBQA 2ID6A 3PPBA 4D5FA 3QQAA 1QPIA 3QBMA 2XPWA 3WHBA 3T6NA 3VW2A 4DW6A 3HGGA 1JTXA 5FKLA 1QVUA 4D7MA 1Z77A 3V6GA 3DCFA 4V2FA 3IH2A 5CW8A 3BJBA 3BTLA 4JKZA 5F1JA 3ZQGA 4XK4A 5HBUA 3ZQLA 5H9TA 2UXUA 3QPSA 3RD3A 2UXPA 2XPUA 3LWJA 3CWRA 3TP3A 3RH2A 3NXCA 4GCKA 5EFYA 3ON4A 2V57A 5FKOA 3O60A 4B1RA 2VKVA 5K58A 1A6IA 3PM1A 2FX0A 3AQTA 5K7HA 3BR2A 3SFIA 3B6CA 3LJLA 1VI0A 2OPTA 5FKMA 2Y31A 5EZHA 4NELA 3VVYA 2ID3A 3Q3SA 5F0FA 4M3FA 2PZ9A 3BQZA 3ANGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8G A;  3G1M A;  3ON2 A;  3ZQI A;  5F0C A;  4I6Z A;  3FRQ A;  5K7Z A;  3BRU A;  2X9D A;  1BJZ A;  3NNR A;  3E7Q A;  5AQC A;  3HTJ A;  2OER A;  2HKU A;  3LSP A;  5J1R A;  4JL3 A;  2REK A;  4V2G A;  3BTI A;  3GEU A;  3CRJ A;  2VPR A;  4NN1 A;  2I10 A;  3FIW A;  5D1R A;  3BTJ A;  2FJ1 A;  2RHA A;  2ZOZ A;  1RPW A;  2OI8 A;  3EUP A;  3HTA A;  2DTZ A;  5IP6 A;  5IOZ A;  3BCG A;  2GFN A;  4GCT A;  3Q0V A;  1UI5 A;  1T56 A;  5FKN A;  3G1L A;  2XRL A;  1JUS A;  3IUV A;  5J1U A;  3DPJ A;  3BR5 A;  2Y2Z A;  2XGD A;  2JK3 A;  2QCO A;  3BR3 A;  4JNN A;  5CXI A;  3COL A;  4G12 A;  3JSJ A;  3PAS A;  3EGQ A;  3BTC A;  3NRG A;  3B81 A;  2G7G A;  1ZKG A;  4AC6 A;  3MNL A;  1UI6 A;  2WUI A;  4M3E A;  5GPA A;  3KKC A;  3LHQ A;  5CXG A;  5GP9 A;  3C07 A;  4UDS A;  3NI7 A;  3ZQH A;  3BNI A;  3CJD A;  2UXH A;  4GFK A;  4M3D A;  5EZG A;  4AUX A;  3KZ9 A;  2TRT A;  3P9T A;  3BHQ A;  3DEW A;  5FGL A;  1Z0X A;  1JT0 A;  4AF5 A;  1U9N A;  3FK6 A;  2WV1 A;  3BR6 A;  3VIB A;  5HSZ A;  3HTH A;  4ACI A;  2XGE A;  3BR0 A;  4L62 A;  3BT9 A;  3VVX A;  5FHP A;  3SDG A;  4GCL A;  3Q0U A;  3Q0W A;  1JUP A;  2IEK A;  3VW0 A;  2O7T A;  2O7O A;  2XGC A;  2IAI A;  3LOC A;  2IU5 A;  3VP5 A;  3QKX A;  5F04 A;  4MK6 A;  3CCY A;  2YVE A;  2G3B A;  2Y30 A;  2HXI A;  3ZQF A;  4MO7 A;  3LSR A;  4ABZ A;  2ZCM A;  2FQ4 A;  4I76 A;  5J1Y A;  1ORK A;  3O8H A;  2GBY A;  4MXM A;  2ZOY A;  3WHC A;  2XB5 A;  4M3G A;  4AC0 A;  3C2B A;  3LSJ A;  3VOX A;  3BR1 A;  3FK7 A;  4ICH A;  1U9O A;  2QTQ A;  1JT6 A;  3GZI A;  5DAJ A;  2QKO A;  5F08 A;  2QOP A;  2GEN A;  3V78 A;  4D7N A;  2D6Y A;  2NP3 A;  1JUM A;  2NS7 A;  4GFL A;  2XPV A;  3BQY A;  4HKU A;  3KNW A;  3F0C A;  4D5C A;  2DG7 A;  4X1E A;  4W1U A;  1JTY A;  5IPA A;  1ZK8 A;  2TCT A;  4PXI A;  3VOK A;  3VUQ A;  2ZCX A;  2FD5 A;  3VVZ A;  4ME9 A;  5FKK A;  5IOY A;  3VPR A;  2W53 A;  2XDN A;  1RKT A;  5FMP A;  2NS8 A;  3CDL A;  2JJ7 A;  2F07 A;  5J3L A;  5F0H A;  2ZB9 A;  4YZE A;  2HYT A;  3VW1 A;  1T33 A;  2DG8 A;  2Q24 A;  3ANP A;  2G7S A;  3G1O A;  5C4Y A;  2WGB A;  1QVT A;  2HXO A;  2UXO A;  3IH4 A;  2GUH A;  2VKE A;  2NX4 A;  5D18 A;  3HE0 A;  2RAE A;  1SGM A;  3IH3 A;  2QWT A;  3F1B A;  3NPI A;  2IBD A;  2EH3 A;  3B6A A;  2YVH A;  2G0E A;  3S5R A;  2PBX A;  4W97 A;  2OF7 A;  3HIM A;  3MVP A;  5EYR A;  3HGY A;  5F27 A;  4B3A A;  5HAW A;  3G56 A;  3KKD A;  3G7R A;  5GPC A;  4JYK A;  3QPL A;  3AQS A;  3TP0 A;  2X6O A;  4CGR A;  4KWA A;  4M3B A;  2ZCN A;  5K7F A;  2NP5 A;  2G7L A;  2HQ5 A;  2RAS A;  1RKW A;  3HTI A;  5D19 A;  2QIB A;  2HYJ A;  2UXI A;  2FBQ A;  2ID6 A;  3PPB A;  4D5F A;  3QQA A;  1QPI A;  3QBM A;  2XPW A;  3WHB A;  3T6N A;  3VW2 A;  4DW6 A;  3HGG A;  1JTX A;  5FKL A;  1QVU A;  4D7M A;  1Z77 A;  3V6G A;  3DCF A;  4V2F A;  3IH2 A;  5CW8 A;  3BJB A;  3BTL A;  4JKZ A;  5F1J A;  3ZQG A;  4XK4 A;  5HBU A;  3ZQL A;  5H9T A;  2UXU A;  3QPS A;  3RD3 A;  2UXP A;  2XPU A;  3LWJ A;  3CWR A;  3TP3 A;  3RH2 A;  3NXC A;  4GCK A;  5EFY A;  3ON4 A;  2V57 A;  5FKO A;  3O60 A;  4B1R A;  2VKV A;  5K58 A;  1A6I A;  3PM1 A;  2FX0 A;  3AQT A;  5K7H A;  3BR2 A;  3SFI A;  3B6C A;  3LJL A;  1VI0 A;  2OPT A;  5FKM A;  2Y31 A;  5EZH A;  4NEL A;  3VVY A;  2ID3 A;  3Q3S A;  5F0F A;  4M3F A;  2PZ9 A;  3BQZ A;  3ANG A; 
#chains in the Genus database with same CATH topology
 3O8G A;  3KYL A;  3G1M A;  3ON2 A;  3ZQI A;  5F0C A;  4I6Z A;  3FRQ A;  5K7Z A;  3BRU A;  2X9D A;  1BJZ A;  3NNR A;  3E7Q A;  5AQC A;  2R7U A;  3HTJ A;  2OER A;  2HKU A;  3LSP A;  5J1R A;  4JL3 A;  2REK A;  4V2G A;  2B3W A;  3BTI A;  3GEU A;  3CRJ A;  2VPR A;  4NN1 A;  2I10 A;  3FIW A;  5D1R A;  3BTJ A;  2FJ1 A;  2RHA A;  2R7O A;  2ZOZ A;  1RPW A;  2OI8 A;  3EUP A;  3HTA A;  2DTZ A;  5IP6 A;  5IOZ A;  3BCG A;  2GFN A;  4GCT A;  3Q0V A;  1UI5 A;  1T56 A;  5FKN A;  3G1L A;  2XRL A;  1JUS A;  3IUV A;  5J1U A;  3DPJ A;  3BR5 A;  2Y2Z A;  2XGD A;  2JK3 A;  2QCO A;  3BR3 A;  5CXI A;  4JNN A;  3VTI A;  3COL A;  2ZY9 A;  4G12 A;  3JSJ A;  3PAS A;  3EGQ A;  2R7X A;  3BTC A;  3NRG A;  3B81 A;  2R7V A;  2G7G A;  1ZKG A;  4AC6 A;  4U9N A;  3MNL A;  1UI6 A;  2R7Q A;  2WUI A;  4M3E A;  5GPA A;  3KKC A;  3LHQ A;  5CXG A;  5GP9 A;  3C07 A;  4UDS A;  3NI7 A;  3ZQH A;  3BNI A;  3CJD A;  2UXH A;  4GFK A;  4M3D A;  5EZG A;  4AUX A;  3KZ9 A;  2TRT A;  3P9T A;  3BHQ A;  3DEW A;  5FGL A;  1Z0X A;  1JT0 A;  4AF5 A;  4U9L A;  1U9N A;  3FK6 A;  2WV1 A;  3BR6 A;  3VIB A;  2R7W A;  5HSZ A;  3HTH A;  5CQG A;  4ACI A;  2XGE A;  3BR0 A;  4L62 A;  3DU6 A;  3BT9 A;  3VVX A;  5FHP A;  3SDG A;  4GCL A;  3Q0U A;  3Q0W A;  1JUP A;  2IEK A;  3VW0 A;  2O7T A;  2O7O A;  2XGC A;  2IAI A;  3LOC A;  2IU5 A;  3VP5 A;  3QKX A;  5F04 A;  3NS4 A;  4MK6 A;  3CCY A;  2YVE A;  2G3B A;  2Y30 A;  2HXI A;  3ZQF A;  4MO7 A;  3LSR A;  4ABZ A;  2ZCM A;  2FQ4 A;  4I76 A;  3DU5 A;  5J1Y A;  1ORK A;  3O8H A;  2GBY A;  4MXM A;  2ZOY A;  3WHC A;  2XB5 A;  4M3G A;  4AC0 A;  3C2B A;  3LSJ A;  3VOX A;  3BR1 A;  3FK7 A;  4ICH A;  1U9O A;  2QTQ A;  1JT6 A;  3GZI A;  5DAJ A;  2QKO A;  5F08 A;  2QOP A;  2GEN A;  2R7T A;  3V78 A;  4D7N A;  2D6Y A;  2NP3 A;  1JUM A;  2PFV A;  2NS7 A;  4GFL A;  2XPV A;  3BQY A;  4HKU A;  3KNW A;  3F0C A;  4D5C A;  2DG7 A;  4X1E A;  4W1U A;  1JTY A;  5IPA A;  1ZK8 A;  2TCT A;  4PXI A;  3VOK A;  3VUQ A;  2ZCX A;  2FD5 A;  3VVZ A;  4ME9 A;  5FKK A;  5IOY A;  3VPR A;  2W53 A;  2XDN A;  1RKT A;  5FMP A;  2NS8 A;  3CDL A;  2JJ7 A;  2F07 A;  5J3L A;  5F0H A;  2ZB9 A;  4YZE A;  2HYT A;  3VW1 A;  1T33 A;  2DG8 A;  2Q24 A;  4C2M A;  3ANP A;  2G7S A;  3G1O A;  5C4Y A;  2WGB A;  1QVT A;  2HXO A;  2UXO A;  3IH4 A;  2GUH A;  4DVY P;  2VKE A;  2NX4 A;  5D18 A;  3HE0 A;  2RAE A;  1SGM A;  3IH3 A;  2QWT A;  3F1B A;  3NPI A;  2IBD A;  2EH3 A;  3B6A A;  2YVH A;  2G0E A;  3S5R A;  2PBX A;  4W97 A;  2OF7 A;  3HIM A;  3MVP A;  5EYR A;  3HGY A;  5F27 A;  4B3A A;  5HAW A;  3G56 A;  4WIB A;  3KKD A;  3G7R A;  5GPC A;  4JYK A;  3QPL A;  3AQS A;  3TP0 A;  2X6O A;  4CGR A;  4KWA A;  4M3B A;  2YVX A;  2ZCN A;  5K7F A;  2NP5 A;  4OD5 A;  2G7L A;  2HQ5 A;  2RAS A;  1RKW A;  2FJI 1;  3HTI A;  5D19 A;  2QIB A;  2HYJ A;  2UXI A;  2FBQ A;  2ID6 A;  3PPB A;  4D5F A;  3QQA A;  2R7R A;  1QPI A;  3QBM A;  2XPW A;  3WHB A;  3T6N A;  3VW2 A;  4DW6 A;  3HGG A;  1JTX A;  5FKL A;  1QVU A;  4D7M A;  1Z77 A;  3FHN A;  3V6G A;  3DCF A;  4V2F A;  3IH2 A;  5CW8 A;  3BJB A;  2A2F X;  3BTL A;  4JKZ A;  5F1J A;  3ZQG A;  4XK4 A;  5HBU A;  3ZQL A;  5H9T A;  2B1E A;  2UXU A;  3QPS A;  3RD3 A;  3K8P C;  2UXP A;  2XPU A;  3LWJ A;  3CWR A;  3TP3 A;  3RH2 A;  3NXC A;  4GCK A;  5EFY A;  3ON4 A;  2V57 A;  4OD4 A;  5FKO A;  3O60 A;  4B1R A;  2VKV A;  5K58 A;  3SWH A;  1A6I A;  3PM1 A;  2FX0 A;  3AQT A;  5K7H A;  3BR2 A;  3SFI A;  3B6C A;  4IRV A;  3LJL A;  1VI0 A;  2OPT A;  2R7S A;  5FKM A;  2Y31 A;  5EZH A;  4NEL A;  3VVY A;  2ID3 A;  3Q3S A;  5F0F A;  4M3F A;  2PZ9 A;  3BQZ A;  3ANG A; 
#chains in the Genus database with same CATH homology
 3O8G A;  3G1M A;  3ON2 A;  3ZQI A;  5F0C A;  4I6Z A;  3FRQ A;  5K7Z A;  3BRU A;  2X9D A;  1BJZ A;  3NNR A;  3E7Q A;  5AQC A;  3HTJ A;  2OER A;  2HKU A;  3LSP A;  5J1R A;  4JL3 A;  2REK A;  4V2G A;  3BTI A;  3GEU A;  3CRJ A;  2VPR A;  4NN1 A;  2I10 A;  3FIW A;  5D1R A;  3BTJ A;  2FJ1 A;  2RHA A;  2ZOZ A;  1RPW A;  2OI8 A;  3EUP A;  3HTA A;  2DTZ A;  5IP6 A;  5IOZ A;  3BCG A;  2GFN A;  4GCT A;  3Q0V A;  1UI5 A;  1T56 A;  5FKN A;  3G1L A;  2XRL A;  1JUS A;  3IUV A;  5J1U A;  3DPJ A;  3BR5 A;  2Y2Z A;  2XGD A;  2JK3 A;  2QCO A;  3BR3 A;  4JNN A;  5CXI A;  3COL A;  4G12 A;  3JSJ A;  3PAS A;  3EGQ A;  3BTC A;  3NRG A;  3B81 A;  2G7G A;  1ZKG A;  4AC6 A;  3MNL A;  1UI6 A;  2WUI A;  4M3E A;  5GPA A;  3KKC A;  3LHQ A;  5CXG A;  5GP9 A;  3C07 A;  4UDS A;  3NI7 A;  3ZQH A;  3BNI A;  3CJD A;  2UXH A;  4GFK A;  4M3D A;  5EZG A;  4AUX A;  3KZ9 A;  2TRT A;  3P9T A;  3BHQ A;  3DEW A;  5FGL A;  1Z0X A;  1JT0 A;  4AF5 A;  1U9N A;  3FK6 A;  2WV1 A;  3BR6 A;  3VIB A;  5HSZ A;  3HTH A;  4ACI A;  2XGE A;  3BR0 A;  4L62 A;  3BT9 A;  3VVX A;  5FHP A;  3SDG A;  4GCL A;  3Q0U A;  3Q0W A;  1JUP A;  2IEK A;  3VW0 A;  2O7T A;  2O7O A;  2XGC A;  2IAI A;  3LOC A;  2IU5 A;  3VP5 A;  3QKX A;  5F04 A;  4MK6 A;  3CCY A;  2YVE A;  2G3B A;  2Y30 A;  2HXI A;  3ZQF A;  4MO7 A;  3LSR A;  4ABZ A;  2ZCM A;  2FQ4 A;  4I76 A;  5J1Y A;  1ORK A;  3O8H A;  2GBY A;  4MXM A;  2ZOY A;  3WHC A;  2XB5 A;  4M3G A;  4AC0 A;  3C2B A;  3LSJ A;  3VOX A;  3BR1 A;  3FK7 A;  4ICH A;  1U9O A;  2QTQ A;  1JT6 A;  3GZI A;  5DAJ A;  2QKO A;  5F08 A;  2QOP A;  2GEN A;  3V78 A;  4D7N A;  2D6Y A;  2NP3 A;  1JUM A;  2NS7 A;  4GFL A;  2XPV A;  3BQY A;  4HKU A;  3KNW A;  3F0C A;  4D5C A;  2DG7 A;  4X1E A;  4W1U A;  1JTY A;  5IPA A;  1ZK8 A;  2TCT A;  4PXI A;  3VOK A;  3VUQ A;  2ZCX A;  2FD5 A;  3VVZ A;  4ME9 A;  5FKK A;  5IOY A;  3VPR A;  2W53 A;  2XDN A;  1RKT A;  5FMP A;  2NS8 A;  3CDL A;  2JJ7 A;  2F07 A;  5J3L A;  5F0H A;  2ZB9 A;  4YZE A;  2HYT A;  3VW1 A;  1T33 A;  2DG8 A;  2Q24 A;  3ANP A;  2G7S A;  3G1O A;  5C4Y A;  2WGB A;  1QVT A;  2HXO A;  2UXO A;  3IH4 A;  2GUH A;  2VKE A;  2NX4 A;  5D18 A;  3HE0 A;  2RAE A;  1SGM A;  3IH3 A;  2QWT A;  3F1B A;  3NPI A;  2IBD A;  2EH3 A;  3B6A A;  2YVH A;  2G0E A;  3S5R A;  2PBX A;  4W97 A;  2OF7 A;  3HIM A;  3MVP A;  5EYR A;  3HGY A;  5F27 A;  4B3A A;  5HAW A;  3G56 A;  3KKD A;  3G7R A;  5GPC A;  4JYK A;  3QPL A;  3AQS A;  3TP0 A;  2X6O A;  4CGR A;  4KWA A;  4M3B A;  2ZCN A;  5K7F A;  2NP5 A;  2G7L A;  2HQ5 A;  2RAS A;  1RKW A;  3HTI A;  5D19 A;  2QIB A;  2HYJ A;  2UXI A;  2FBQ A;  2ID6 A;  3PPB A;  4D5F A;  3QQA A;  1QPI A;  3QBM A;  2XPW A;  3WHB A;  3T6N A;  3VW2 A;  4DW6 A;  3HGG A;  1JTX A;  5FKL A;  1QVU A;  4D7M A;  1Z77 A;  3V6G A;  3DCF A;  4V2F A;  3IH2 A;  5CW8 A;  3BJB A;  3BTL A;  4JKZ A;  5F1J A;  3ZQG A;  4XK4 A;  5HBU A;  3ZQL A;  5H9T A;  2UXU A;  3QPS A;  3RD3 A;  2UXP A;  2XPU A;  3LWJ A;  3CWR A;  3TP3 A;  3RH2 A;  3NXC A;  4GCK A;  5EFY A;  3ON4 A;  2V57 A;  5FKO A;  3O60 A;  4B1R A;  2VKV A;  5K58 A;  1A6I A;  3PM1 A;  2FX0 A;  3AQT A;  5K7H A;  3BR2 A;  3SFI A;  3B6C A;  3LJL A;  1VI0 A;  2OPT A;  5FKM A;  2Y31 A;  5EZH A;  4NEL A;  3VVY A;  2ID3 A;  3Q3S A;  5F0F A;  4M3F A;  2PZ9 A;  3BQZ A;  3ANG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...