3BRUA

Crystal structure of regulatory protein tetr from rhodobacter sphaeroides
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
191
structure length
191
Chain Sequence
DASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein, TetR family
publication title Crystal structure of regulatory protein TetR from Rhodobacter sphaeroides.
rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Transcription
total genus 71
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16925 TetR_C_13 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3bruA00
3DEWA 3HGGA 3VW2A 2XPUA 4YZEA 3BTJA 2EH3A 4GCKA 3FRQA 2XB5A 2HQ5A 4MXMA 3VW0A 3FK7A 4ICHA 3Q0UA 3FIWA 5FKOA 4ABZA 5IPAA 2FD5A 2ID6A 4W1UA 2QTQA 5F0CA 2NP5A 2TRTA 2ZB9A 3NI7A 3CWRA 5J3LA 2I10A 4JYKA 5IOZA 2XGEA 2DTZA 2QKOA 2XGDA 1U9OA 3O60A 4CGRA 2NS8A 2UXIA 3BQYA 3ZQHA 3QKXA 3LOCA 3CJDA 1JUPA 2WV1A 1RPWA 2Y2ZA 3HGYA 4HKUA 4D7NA 2G0EA 3E7QA 4GFKA 4V2GA 2ZCNA 4M3GA 2ZCMA 1ORKA 3C2BA 3ZQGA 3WHCA 4M3FA 5HAWA 3BTLA 3AQSA 3BJBA 3LHQA 5J1YA 3BT9A 3KKDA 3CRJA 3LSJA 2GFNA 4GCLA 1Z0XA 2YVHA 3EGQA 5CW8A 2FBQA 4M3DA 3ANGA 2DG7A 4JKZA 3BR2A 3VP5A 2FJ1A 3HTJA 4JNNA 2Q24A 2QIBA 5GPAA 5F27A 2FX0A 2ZOYA 5F08A 5IP6A 3VVZA 1UI5A 1JUMA 3VVXA 3HIMA 1SGMA 4L62A 2RASA 3QPSA 2NS7A 4ACIA 3B6AA 1QVTA 3VVYA 4G12A 3QQAA 2G7LA 3C07A 5EZHA 3B81A 2HYTA 3F1BA 3NPIA 2OPTA 3BNIA 3IH4A 4I6ZA 2GENA 2D6YA 3Q3SA 3G1LA 3BR0A 5FKKA 3NRGA 3Q0WA 3NXCA 3V78A 2X9DA 4B3AA 3T6NA 4B1RA 4JL3A 2ZCXA 4D5CA 2O7TA 5AQCA 2HXIA 1QVUA 5HBUA 3S5RA 5F0FA 3ON4A 2UXPA 1BJZA 3TP3A 2XPWA 5CXGA 3DPJA 2HKUA 5D19A 2VKEA 5K7HA 1JT6A 3O8HA 3PPBA 3COLA 4M3EA 4W97A 1T56A 4GCTA 3G1OA 3MNLA 3HTHA 5FKNA 3G1MA 1U9NA 2PZ9A 3TP0A 2XPVA 4XK4A 3B6CA 2RAEA 3BR5A 3ANPA 2XDNA 1RKWA 3QBMA 2OI8A 4AC0A 2W53A 3NNRA 2DG8A 1UI6A 5J1RA 2O7OA 2RHAA 3KKCA 2PBXA 5D1RA 5GP9A 1ZKGA 3O8GA 3G7RA 5FHPA 4D5FA 1ZK8A 3LSPA 2HYJA 5DAJA 3HTIA 4D7MA 3LJLA 5FKLA 2Y30A 5EFYA 3PASA 5FMPA 3BQZA 5GPCA 3LWJA 3ZQFA 3BR3A 2UXUA 2WUIA 2HXOA 1JTXA 2UXHA 3VIBA 3BR6A 2NP3A 3VW1A 2VKVA 1JUSA 2QCOA 2V57A 3P9TA 5F04A 4AC6A 3RH2A 3VPRA 4DW6A 3SFIA 3V6GA 3GEUA 3SDGA 4ME9A 2UXOA 5IOYA 1RKTA 3RD3A 5F0HA 2G7GA 2IAIA 4M3BA 1T33A 4UDSA 2TCTA 1Z77A 2WGBA 3CCYA 3CDLA 5F1JA 1VI0A 2VPRA 3F0CA 3QPLA 2XRLA 2FQ4A 5D18A 2Y31A 3KZ9A 2NX4A 2QWTA 5HSZA 2JJ7A 3PM1A 4MO7A 5K7FA 2G3BA 5K7ZA 2GBYA 3VOXA 3HTAA 3BHQA 2XGCA 3IH3A 4V2FA 4PXIA 3VOKA 5CXIA 5K58A 2IEKA 4GFLA 2JK3A 2G7SA 3ZQIA 4AUXA 3G56A 3AQTA 2QOPA 3EUPA 3BCGA 3FK6A 5EZGA 3KNWA 1A6IA 4NELA 2IU5A 3BRUA 4MK6A 3GZIA 3ON2A 1JTYA 4NN1A 3IUVA 3VUQA 3BR1A 3Q0VA 2X6OA 5EYRA 2OF7A 4AF5A 3ZQLA 2YVEA 3HE0A 3BTIA 2REKA 5H9TA 2F07A 3LSRA 2ZOZA 2IBDA 3MVPA 4KWAA 4X1EA 2OERA 4I76A 3DCFA 1JT0A 5FGLA 5FKMA 5C4YA 1QPIA 3IH2A 3BTCA 2ID3A 3JSJA 5J1UA 3WHBA 2GUHA
chains in the Genus database with same CATH superfamily
3DEWA 3HGGA 3VW2A 2XPUA 4YZEA 3BTJA 2EH3A 4WIBA 4GCKA 3FRQA 2XB5A 2HQ5A 4MXMA 3VW0A 3FK7A 4ICHA 3Q0UA 3FIWA 5FKOA 4ABZA 5IPAA 2FD5A 2ID6A 4W1UA 3K8PC 2QTQA 5F0CA 2NP5A 2TRTA 2ZB9A 3NI7A 3CWRA 2PFVA 5J3LA 2I10A 4JYKA 5IOZA 2XGEA 2DTZA 2QKOA 2XGDA 1U9OA 3O60A 4CGRA 3NS4A 2NS8A 2UXIA 3BQYA 3ZQHA 3QKXA 3LOCA 3CJDA 1JUPA 2WV1A 1RPWA 2Y2ZA 3HGYA 3DU6A 4HKUA 4D7NA 2G0EA 3E7QA 4GFKA 4V2GA 2ZCNA 4M3GA 2ZCMA 1ORKA 3C2BA 3ZQGA 3WHCA 4M3FA 5HAWA 3BTLA 4U9LA 3AQSA 3BJBA 3LHQA 5J1YA 2R7QA 3BT9A 3KKDA 3CRJA 3LSJA 2GFNA 4GCLA 1Z0XA 2YVHA 3EGQA 5CW8A 2FBQA 4M3DA 3ANGA 2DG7A 4JKZA 3BR2A 3VP5A 2FJ1A 3HTJA 4JNNA 2Q24A 2QIBA 5GPAA 5F27A 2FX0A 2ZOYA 5F08A 5IP6A 3VVZA 1UI5A 3SWHA 1JUMA 3VVXA 3HIMA 1SGMA 4L62A 2RASA 3QPSA 2NS7A 4ACIA 3B6AA 1QVTA 2R7OA 3VVYA 4G12A 3QQAA 4C2MA 2G7LA 3C07A 5EZHA 3B81A 2HYTA 3F1BA 3NPIA 2OPTA 3BNIA 3IH4A 4I6ZA 2GENA 2D6YA 3Q3SA 3G1LA 3BR0A 5FKKA 3NRGA 3Q0WA 3NXCA 3V78A 2B3WA 2X9DA 2R7XA 4B3AA 3T6NA 4B1RA 4JL3A 2ZCXA 4D5CA 2O7TA 5AQCA 2HXIA 4IRVA 1QVUA 5HBUA 3S5RA 5F0FA 3ON4A 2UXPA 1BJZA 3TP3A 2XPWA 5CXGA 3DPJA 2HKUA 5D19A 4OD4A 2VKEA 5K7HA 1JT6A 3O8HA 3PPBA 3COLA 4M3EA 4W97A 1T56A 4GCTA 3G1OA 3MNLA 3HTHA 5FKNA 3G1MA 1U9NA 2PZ9A 3TP0A 2XPVA 4XK4A 3B6CA 5CQGA 2RAEA 2R7TA 3BR5A 3ANPA 2XDNA 1RKWA 3QBMA 2OI8A 4AC0A 2W53A 3NNRA 2DG8A 1UI6A 5J1RA 2A2FX 2R7WA 2FJI1 2O7OA 2RHAA 3KKCA 2PBXA 5D1RA 5GP9A 1ZKGA 3O8GA 3G7RA 5FHPA 4D5FA 1ZK8A 3LSPA 2HYJA 5DAJA 3HTIA 4D7MA 3LJLA 3DU5A 5FKLA 2Y30A 5EFYA 3PASA 5FMPA 3BQZA 5GPCA 3LWJA 3ZQFA 2ZY9A 3BR3A 2UXUA 4DVYP 2WUIA 2HXOA 1JTXA 2UXHA 3VIBA 3KYLA 3BR6A 2NP3A 3VW1A 2VKVA 1JUSA 2QCOA 2V57A 3P9TA 5F04A 4AC6A 2R7SA 3RH2A 3VPRA 4DW6A 3SFIA 3V6GA 3GEUA 3SDGA 2R7VA 4ME9A 2UXOA 5IOYA 1RKTA 3RD3A 5F0HA 2G7GA 2IAIA 4M3BA 1T33A 4OD5A 4UDSA 2TCTA 1Z77A 2WGBA 3CCYA 3CDLA 5F1JA 1VI0A 2VPRA 3F0CA 3QPLA 3VTIA 2XRLA 2R7RA 2FQ4A 5D18A 2Y31A 3KZ9A 2NX4A 2QWTA 5HSZA 2JJ7A 3FHNA 2B1EA 3PM1A 4MO7A 5K7FA 2G3BA 5K7ZA 2GBYA 3VOXA 3HTAA 3BHQA 2XGCA 3IH3A 4V2FA 4PXIA 2R7UA 3VOKA 5CXIA 5K58A 2IEKA 4GFLA 2JK3A 2G7SA 3ZQIA 4AUXA 3G56A 3AQTA 2QOPA 3EUPA 3BCGA 3FK6A 5EZGA 3KNWA 1A6IA 4NELA 2IU5A 3BRUA 4MK6A 3GZIA 3ON2A 4U9NA 1JTYA 4NN1A 3IUVA 3VUQA 3BR1A 3Q0VA 2X6OA 5EYRA 2OF7A 4AF5A 3ZQLA 2YVEA 3HE0A 3BTIA 2REKA 5H9TA 2F07A 3LSRA 2ZOZA 2YVXA 2IBDA 3MVPA 4KWAA 4X1EA 2OERA 4I76A 3DCFA 1JT0A 5FGLA 5FKMA 5C4YA 1QPIA 3IH2A 3BTCA 2ID3A 3JSJA 5J1UA 3WHBA 2GUHA
chains in the Genus database with same CATH topology
3DEWA 3HGGA 3VW2A 2XPUA 4YZEA 3BTJA 2EH3A 4GCKA 3FRQA 2XB5A 2HQ5A 4MXMA 3VW0A 3FK7A 4ICHA 3Q0UA 3FIWA 5FKOA 4ABZA 5IPAA 2FD5A 2ID6A 4W1UA 2QTQA 5F0CA 2NP5A 2TRTA 2ZB9A 3NI7A 3CWRA 5J3LA 2I10A 4JYKA 5IOZA 2XGEA 2DTZA 2QKOA 2XGDA 1U9OA 3O60A 4CGRA 2NS8A 2UXIA 3BQYA 3ZQHA 3QKXA 3LOCA 3CJDA 1JUPA 2WV1A 1RPWA 2Y2ZA 3HGYA 4HKUA 4D7NA 2G0EA 3E7QA 4GFKA 4V2GA 2ZCNA 4M3GA 2ZCMA 1ORKA 3C2BA 3ZQGA 3WHCA 4M3FA 5HAWA 3BTLA 3AQSA 3BJBA 3LHQA 5J1YA 3BT9A 3KKDA 3CRJA 3LSJA 2GFNA 4GCLA 1Z0XA 2YVHA 3EGQA 5CW8A 2FBQA 4M3DA 3ANGA 2DG7A 4JKZA 3BR2A 3VP5A 2FJ1A 3HTJA 4JNNA 2Q24A 2QIBA 5GPAA 5F27A 2FX0A 2ZOYA 5F08A 5IP6A 3VVZA 1UI5A 1JUMA 3VVXA 3HIMA 1SGMA 4L62A 2RASA 3QPSA 2NS7A 4ACIA 3B6AA 1QVTA 3VVYA 4G12A 3QQAA 2G7LA 3C07A 5EZHA 3B81A 2HYTA 3F1BA 3NPIA 2OPTA 3BNIA 3IH4A 4I6ZA 2GENA 2D6YA 3Q3SA 3G1LA 3BR0A 5FKKA 3NRGA 3Q0WA 3NXCA 3V78A 2X9DA 4B3AA 3T6NA 4B1RA 4JL3A 2ZCXA 4D5CA 2O7TA 5AQCA 2HXIA 1QVUA 5HBUA 3S5RA 5F0FA 3ON4A 2UXPA 1BJZA 3TP3A 2XPWA 5CXGA 3DPJA 2HKUA 5D19A 2VKEA 5K7HA 1JT6A 3O8HA 3PPBA 3COLA 4M3EA 4W97A 1T56A 4GCTA 3G1OA 3MNLA 3HTHA 5FKNA 3G1MA 1U9NA 2PZ9A 3TP0A 2XPVA 4XK4A 3B6CA 2RAEA 3BR5A 3ANPA 2XDNA 1RKWA 3QBMA 2OI8A 4AC0A 2W53A 3NNRA 2DG8A 1UI6A 5J1RA 2O7OA 2RHAA 3KKCA 2PBXA 5D1RA 5GP9A 1ZKGA 3O8GA 3G7RA 5FHPA 4D5FA 1ZK8A 3LSPA 2HYJA 5DAJA 3HTIA 4D7MA 3LJLA 5FKLA 2Y30A 5EFYA 3PASA 5FMPA 3BQZA 5GPCA 3LWJA 3ZQFA 3BR3A 2UXUA 2WUIA 2HXOA 1JTXA 2UXHA 3VIBA 3BR6A 2NP3A 3VW1A 2VKVA 1JUSA 2QCOA 2V57A 3P9TA 5F04A 4AC6A 3RH2A 3VPRA 4DW6A 3SFIA 3V6GA 3GEUA 3SDGA 4ME9A 2UXOA 5IOYA 1RKTA 3RD3A 5F0HA 2G7GA 2IAIA 4M3BA 1T33A 4UDSA 2TCTA 1Z77A 2WGBA 3CCYA 3CDLA 5F1JA 1VI0A 2VPRA 3F0CA 3QPLA 2XRLA 2FQ4A 5D18A 2Y31A 3KZ9A 2NX4A 2QWTA 5HSZA 2JJ7A 3PM1A 4MO7A 5K7FA 2G3BA 5K7ZA 2GBYA 3VOXA 3HTAA 3BHQA 2XGCA 3IH3A 4V2FA 4PXIA 3VOKA 5CXIA 5K58A 2IEKA 4GFLA 2JK3A 2G7SA 3ZQIA 4AUXA 3G56A 3AQTA 2QOPA 3EUPA 3BCGA 3FK6A 5EZGA 3KNWA 1A6IA 4NELA 2IU5A 3BRUA 4MK6A 3GZIA 3ON2A 1JTYA 4NN1A 3IUVA 3VUQA 3BR1A 3Q0VA 2X6OA 5EYRA 2OF7A 4AF5A 3ZQLA 2YVEA 3HE0A 3BTIA 2REKA 5H9TA 2F07A 3LSRA 2ZOZA 2IBDA 3MVPA 4KWAA 4X1EA 2OERA 4I76A 3DCFA 1JT0A 5FGLA 5FKMA 5C4YA 1QPIA 3IH2A 3BTCA 2ID3A 3JSJA 5J1UA 3WHBA 2GUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEW A;  3HGG A;  3VW2 A;  2XPU A;  4YZE A;  3BTJ A;  2EH3 A;  4GCK A;  3FRQ A;  2XB5 A;  2HQ5 A;  4MXM A;  3VW0 A;  3FK7 A;  4ICH A;  3Q0U A;  3FIW A;  5FKO A;  4ABZ A;  5IPA A;  2FD5 A;  2ID6 A;  4W1U A;  2QTQ A;  5F0C A;  2NP5 A;  2TRT A;  2ZB9 A;  3NI7 A;  3CWR A;  5J3L A;  2I10 A;  4JYK A;  5IOZ A;  2XGE A;  2DTZ A;  2QKO A;  2XGD A;  1U9O A;  3O60 A;  4CGR A;  2NS8 A;  2UXI A;  3BQY A;  3ZQH A;  3QKX A;  3LOC A;  3CJD A;  1JUP A;  2WV1 A;  1RPW A;  2Y2Z A;  3HGY A;  4HKU A;  4D7N A;  2G0E A;  3E7Q A;  4GFK A;  4V2G A;  2ZCN A;  4M3G A;  2ZCM A;  1ORK A;  3C2B A;  3ZQG A;  3WHC A;  4M3F A;  5HAW A;  3BTL A;  3AQS A;  3BJB A;  3LHQ A;  5J1Y A;  3BT9 A;  3KKD A;  3CRJ A;  3LSJ A;  2GFN A;  4GCL A;  1Z0X A;  2YVH A;  3EGQ A;  5CW8 A;  2FBQ A;  4M3D A;  3ANG A;  2DG7 A;  4JKZ A;  3BR2 A;  3VP5 A;  2FJ1 A;  3HTJ A;  4JNN A;  2Q24 A;  2QIB A;  5GPA A;  5F27 A;  2FX0 A;  2ZOY A;  5F08 A;  5IP6 A;  3VVZ A;  1UI5 A;  1JUM A;  3VVX A;  3HIM A;  1SGM A;  4L62 A;  2RAS A;  3QPS A;  2NS7 A;  4ACI A;  3B6A A;  1QVT A;  3VVY A;  4G12 A;  3QQA A;  2G7L A;  3C07 A;  5EZH A;  3B81 A;  2HYT A;  3F1B A;  3NPI A;  2OPT A;  3BNI A;  3IH4 A;  4I6Z A;  2GEN A;  2D6Y A;  3Q3S A;  3G1L A;  3BR0 A;  5FKK A;  3NRG A;  3Q0W A;  3NXC A;  3V78 A;  2X9D A;  4B3A A;  3T6N A;  4B1R A;  4JL3 A;  2ZCX A;  4D5C A;  2O7T A;  5AQC A;  2HXI A;  1QVU A;  5HBU A;  3S5R A;  5F0F A;  3ON4 A;  2UXP A;  1BJZ A;  3TP3 A;  2XPW A;  5CXG A;  3DPJ A;  2HKU A;  5D19 A;  2VKE A;  5K7H A;  1JT6 A;  3O8H A;  3PPB A;  3COL A;  4M3E A;  4W97 A;  1T56 A;  4GCT A;  3G1O A;  3MNL A;  3HTH A;  5FKN A;  3G1M A;  1U9N A;  2PZ9 A;  3TP0 A;  2XPV A;  4XK4 A;  3B6C A;  2RAE A;  3BR5 A;  3ANP A;  2XDN A;  1RKW A;  3QBM A;  2OI8 A;  4AC0 A;  2W53 A;  3NNR A;  2DG8 A;  1UI6 A;  5J1R A;  2O7O A;  2RHA A;  3KKC A;  2PBX A;  5D1R A;  5GP9 A;  1ZKG A;  3O8G A;  3G7R A;  5FHP A;  4D5F A;  1ZK8 A;  3LSP A;  2HYJ A;  5DAJ A;  3HTI A;  4D7M A;  3LJL A;  5FKL A;  2Y30 A;  5EFY A;  3PAS A;  5FMP A;  3BQZ A;  5GPC A;  3LWJ A;  3ZQF A;  3BR3 A;  2UXU A;  2WUI A;  2HXO A;  1JTX A;  2UXH A;  3VIB A;  3BR6 A;  2NP3 A;  3VW1 A;  2VKV A;  1JUS A;  2QCO A;  2V57 A;  3P9T A;  5F04 A;  4AC6 A;  3RH2 A;  3VPR A;  4DW6 A;  3SFI A;  3V6G A;  3GEU A;  3SDG A;  4ME9 A;  2UXO A;  5IOY A;  1RKT A;  3RD3 A;  5F0H A;  2G7G A;  2IAI A;  4M3B A;  1T33 A;  4UDS A;  2TCT A;  1Z77 A;  2WGB A;  3CCY A;  3CDL A;  5F1J A;  1VI0 A;  2VPR A;  3F0C A;  3QPL A;  2XRL A;  2FQ4 A;  5D18 A;  2Y31 A;  3KZ9 A;  2NX4 A;  2QWT A;  5HSZ A;  2JJ7 A;  3PM1 A;  4MO7 A;  5K7F A;  2G3B A;  5K7Z A;  2GBY A;  3VOX A;  3HTA A;  3BHQ A;  2XGC A;  3IH3 A;  4V2F A;  4PXI A;  3VOK A;  5CXI A;  5K58 A;  2IEK A;  4GFL A;  2JK3 A;  2G7S A;  3ZQI A;  4AUX A;  3G56 A;  3AQT A;  2QOP A;  3EUP A;  3BCG A;  3FK6 A;  5EZG A;  3KNW A;  1A6I A;  4NEL A;  2IU5 A;  3BRU A;  4MK6 A;  3GZI A;  3ON2 A;  1JTY A;  4NN1 A;  3IUV A;  3VUQ A;  3BR1 A;  3Q0V A;  2X6O A;  5EYR A;  2OF7 A;  4AF5 A;  3ZQL A;  2YVE A;  3HE0 A;  3BTI A;  2REK A;  5H9T A;  2F07 A;  3LSR A;  2ZOZ A;  2IBD A;  3MVP A;  4KWA A;  4X1E A;  2OER A;  4I76 A;  3DCF A;  1JT0 A;  5FGL A;  5FKM A;  5C4Y A;  1QPI A;  3IH2 A;  3BTC A;  2ID3 A;  3JSJ A;  5J1U A;  3WHB A;  2GUH A; 
#chains in the Genus database with same CATH topology
 3DEW A;  3HGG A;  3VW2 A;  2XPU A;  4YZE A;  3BTJ A;  2EH3 A;  4WIB A;  4GCK A;  3FRQ A;  2XB5 A;  2HQ5 A;  4MXM A;  3VW0 A;  3FK7 A;  4ICH A;  3Q0U A;  3FIW A;  5FKO A;  4ABZ A;  5IPA A;  2FD5 A;  2ID6 A;  4W1U A;  3K8P C;  2QTQ A;  5F0C A;  2NP5 A;  2TRT A;  2ZB9 A;  3NI7 A;  3CWR A;  2PFV A;  5J3L A;  2I10 A;  4JYK A;  5IOZ A;  2XGE A;  2DTZ A;  2QKO A;  2XGD A;  1U9O A;  3O60 A;  4CGR A;  3NS4 A;  2NS8 A;  2UXI A;  3BQY A;  3ZQH A;  3QKX A;  3LOC A;  3CJD A;  1JUP A;  2WV1 A;  1RPW A;  2Y2Z A;  3HGY A;  3DU6 A;  4HKU A;  4D7N A;  2G0E A;  3E7Q A;  4GFK A;  4V2G A;  2ZCN A;  4M3G A;  2ZCM A;  1ORK A;  3C2B A;  3ZQG A;  3WHC A;  4M3F A;  5HAW A;  3BTL A;  4U9L A;  3AQS A;  3BJB A;  3LHQ A;  5J1Y A;  2R7Q A;  3BT9 A;  3KKD A;  3CRJ A;  3LSJ A;  2GFN A;  4GCL A;  1Z0X A;  2YVH A;  3EGQ A;  5CW8 A;  2FBQ A;  4M3D A;  3ANG A;  2DG7 A;  4JKZ A;  3BR2 A;  3VP5 A;  2FJ1 A;  3HTJ A;  4JNN A;  2Q24 A;  2QIB A;  5GPA A;  5F27 A;  2FX0 A;  2ZOY A;  5F08 A;  5IP6 A;  3VVZ A;  1UI5 A;  3SWH A;  1JUM A;  3VVX A;  3HIM A;  1SGM A;  4L62 A;  2RAS A;  3QPS A;  2NS7 A;  4ACI A;  3B6A A;  1QVT A;  2R7O A;  3VVY A;  4G12 A;  3QQA A;  4C2M A;  2G7L A;  3C07 A;  5EZH A;  3B81 A;  2HYT A;  3F1B A;  3NPI A;  2OPT A;  3BNI A;  3IH4 A;  4I6Z A;  2GEN A;  2D6Y A;  3Q3S A;  3G1L A;  3BR0 A;  5FKK A;  3NRG A;  3Q0W A;  3NXC A;  3V78 A;  2B3W A;  2X9D A;  2R7X A;  4B3A A;  3T6N A;  4B1R A;  4JL3 A;  2ZCX A;  4D5C A;  2O7T A;  5AQC A;  2HXI A;  4IRV A;  1QVU A;  5HBU A;  3S5R A;  5F0F A;  3ON4 A;  2UXP A;  1BJZ A;  3TP3 A;  2XPW A;  5CXG A;  3DPJ A;  2HKU A;  5D19 A;  4OD4 A;  2VKE A;  5K7H A;  1JT6 A;  3O8H A;  3PPB A;  3COL A;  4M3E A;  4W97 A;  1T56 A;  4GCT A;  3G1O A;  3MNL A;  3HTH A;  5FKN A;  3G1M A;  1U9N A;  2PZ9 A;  3TP0 A;  2XPV A;  4XK4 A;  3B6C A;  5CQG A;  2RAE A;  2R7T A;  3BR5 A;  3ANP A;  2XDN A;  1RKW A;  3QBM A;  2OI8 A;  4AC0 A;  2W53 A;  3NNR A;  2DG8 A;  1UI6 A;  5J1R A;  2A2F X;  2R7W A;  2FJI 1;  2O7O A;  2RHA A;  3KKC A;  2PBX A;  5D1R A;  5GP9 A;  1ZKG A;  3O8G A;  3G7R A;  5FHP A;  4D5F A;  1ZK8 A;  3LSP A;  2HYJ A;  5DAJ A;  3HTI A;  4D7M A;  3LJL A;  3DU5 A;  5FKL A;  2Y30 A;  5EFY A;  3PAS A;  5FMP A;  3BQZ A;  5GPC A;  3LWJ A;  3ZQF A;  2ZY9 A;  3BR3 A;  2UXU A;  4DVY P;  2WUI A;  2HXO A;  1JTX A;  2UXH A;  3VIB A;  3KYL A;  3BR6 A;  2NP3 A;  3VW1 A;  2VKV A;  1JUS A;  2QCO A;  2V57 A;  3P9T A;  5F04 A;  4AC6 A;  2R7S A;  3RH2 A;  3VPR A;  4DW6 A;  3SFI A;  3V6G A;  3GEU A;  3SDG A;  2R7V A;  4ME9 A;  2UXO A;  5IOY A;  1RKT A;  3RD3 A;  5F0H A;  2G7G A;  2IAI A;  4M3B A;  1T33 A;  4OD5 A;  4UDS A;  2TCT A;  1Z77 A;  2WGB A;  3CCY A;  3CDL A;  5F1J A;  1VI0 A;  2VPR A;  3F0C A;  3QPL A;  3VTI A;  2XRL A;  2R7R A;  2FQ4 A;  5D18 A;  2Y31 A;  3KZ9 A;  2NX4 A;  2QWT A;  5HSZ A;  2JJ7 A;  3FHN A;  2B1E A;  3PM1 A;  4MO7 A;  5K7F A;  2G3B A;  5K7Z A;  2GBY A;  3VOX A;  3HTA A;  3BHQ A;  2XGC A;  3IH3 A;  4V2F A;  4PXI A;  2R7U A;  3VOK A;  5CXI A;  5K58 A;  2IEK A;  4GFL A;  2JK3 A;  2G7S A;  3ZQI A;  4AUX A;  3G56 A;  3AQT A;  2QOP A;  3EUP A;  3BCG A;  3FK6 A;  5EZG A;  3KNW A;  1A6I A;  4NEL A;  2IU5 A;  3BRU A;  4MK6 A;  3GZI A;  3ON2 A;  4U9N A;  1JTY A;  4NN1 A;  3IUV A;  3VUQ A;  3BR1 A;  3Q0V A;  2X6O A;  5EYR A;  2OF7 A;  4AF5 A;  3ZQL A;  2YVE A;  3HE0 A;  3BTI A;  2REK A;  5H9T A;  2F07 A;  3LSR A;  2ZOZ A;  2YVX A;  2IBD A;  3MVP A;  4KWA A;  4X1E A;  2OER A;  4I76 A;  3DCF A;  1JT0 A;  5FGL A;  5FKM A;  5C4Y A;  1QPI A;  3IH2 A;  3BTC A;  2ID3 A;  3JSJ A;  5J1U A;  3WHB A;  2GUH A; 
#chains in the Genus database with same CATH homology
 3DEW A;  3HGG A;  3VW2 A;  2XPU A;  4YZE A;  3BTJ A;  2EH3 A;  4GCK A;  3FRQ A;  2XB5 A;  2HQ5 A;  4MXM A;  3VW0 A;  3FK7 A;  4ICH A;  3Q0U A;  3FIW A;  5FKO A;  4ABZ A;  5IPA A;  2FD5 A;  2ID6 A;  4W1U A;  2QTQ A;  5F0C A;  2NP5 A;  2TRT A;  2ZB9 A;  3NI7 A;  3CWR A;  5J3L A;  2I10 A;  4JYK A;  5IOZ A;  2XGE A;  2DTZ A;  2QKO A;  2XGD A;  1U9O A;  3O60 A;  4CGR A;  2NS8 A;  2UXI A;  3BQY A;  3ZQH A;  3QKX A;  3LOC A;  3CJD A;  1JUP A;  2WV1 A;  1RPW A;  2Y2Z A;  3HGY A;  4HKU A;  4D7N A;  2G0E A;  3E7Q A;  4GFK A;  4V2G A;  2ZCN A;  4M3G A;  2ZCM A;  1ORK A;  3C2B A;  3ZQG A;  3WHC A;  4M3F A;  5HAW A;  3BTL A;  3AQS A;  3BJB A;  3LHQ A;  5J1Y A;  3BT9 A;  3KKD A;  3CRJ A;  3LSJ A;  2GFN A;  4GCL A;  1Z0X A;  2YVH A;  3EGQ A;  5CW8 A;  2FBQ A;  4M3D A;  3ANG A;  2DG7 A;  4JKZ A;  3BR2 A;  3VP5 A;  2FJ1 A;  3HTJ A;  4JNN A;  2Q24 A;  2QIB A;  5GPA A;  5F27 A;  2FX0 A;  2ZOY A;  5F08 A;  5IP6 A;  3VVZ A;  1UI5 A;  1JUM A;  3VVX A;  3HIM A;  1SGM A;  4L62 A;  2RAS A;  3QPS A;  2NS7 A;  4ACI A;  3B6A A;  1QVT A;  3VVY A;  4G12 A;  3QQA A;  2G7L A;  3C07 A;  5EZH A;  3B81 A;  2HYT A;  3F1B A;  3NPI A;  2OPT A;  3BNI A;  3IH4 A;  4I6Z A;  2GEN A;  2D6Y A;  3Q3S A;  3G1L A;  3BR0 A;  5FKK A;  3NRG A;  3Q0W A;  3NXC A;  3V78 A;  2X9D A;  4B3A A;  3T6N A;  4B1R A;  4JL3 A;  2ZCX A;  4D5C A;  2O7T A;  5AQC A;  2HXI A;  1QVU A;  5HBU A;  3S5R A;  5F0F A;  3ON4 A;  2UXP A;  1BJZ A;  3TP3 A;  2XPW A;  5CXG A;  3DPJ A;  2HKU A;  5D19 A;  2VKE A;  5K7H A;  1JT6 A;  3O8H A;  3PPB A;  3COL A;  4M3E A;  4W97 A;  1T56 A;  4GCT A;  3G1O A;  3MNL A;  3HTH A;  5FKN A;  3G1M A;  1U9N A;  2PZ9 A;  3TP0 A;  2XPV A;  4XK4 A;  3B6C A;  2RAE A;  3BR5 A;  3ANP A;  2XDN A;  1RKW A;  3QBM A;  2OI8 A;  4AC0 A;  2W53 A;  3NNR A;  2DG8 A;  1UI6 A;  5J1R A;  2O7O A;  2RHA A;  3KKC A;  2PBX A;  5D1R A;  5GP9 A;  1ZKG A;  3O8G A;  3G7R A;  5FHP A;  4D5F A;  1ZK8 A;  3LSP A;  2HYJ A;  5DAJ A;  3HTI A;  4D7M A;  3LJL A;  5FKL A;  2Y30 A;  5EFY A;  3PAS A;  5FMP A;  3BQZ A;  5GPC A;  3LWJ A;  3ZQF A;  3BR3 A;  2UXU A;  2WUI A;  2HXO A;  1JTX A;  2UXH A;  3VIB A;  3BR6 A;  2NP3 A;  3VW1 A;  2VKV A;  1JUS A;  2QCO A;  2V57 A;  3P9T A;  5F04 A;  4AC6 A;  3RH2 A;  3VPR A;  4DW6 A;  3SFI A;  3V6G A;  3GEU A;  3SDG A;  4ME9 A;  2UXO A;  5IOY A;  1RKT A;  3RD3 A;  5F0H A;  2G7G A;  2IAI A;  4M3B A;  1T33 A;  4UDS A;  2TCT A;  1Z77 A;  2WGB A;  3CCY A;  3CDL A;  5F1J A;  1VI0 A;  2VPR A;  3F0C A;  3QPL A;  2XRL A;  2FQ4 A;  5D18 A;  2Y31 A;  3KZ9 A;  2NX4 A;  2QWT A;  5HSZ A;  2JJ7 A;  3PM1 A;  4MO7 A;  5K7F A;  2G3B A;  5K7Z A;  2GBY A;  3VOX A;  3HTA A;  3BHQ A;  2XGC A;  3IH3 A;  4V2F A;  4PXI A;  3VOK A;  5CXI A;  5K58 A;  2IEK A;  4GFL A;  2JK3 A;  2G7S A;  3ZQI A;  4AUX A;  3G56 A;  3AQT A;  2QOP A;  3EUP A;  3BCG A;  3FK6 A;  5EZG A;  3KNW A;  1A6I A;  4NEL A;  2IU5 A;  3BRU A;  4MK6 A;  3GZI A;  3ON2 A;  1JTY A;  4NN1 A;  3IUV A;  3VUQ A;  3BR1 A;  3Q0V A;  2X6O A;  5EYR A;  2OF7 A;  4AF5 A;  3ZQL A;  2YVE A;  3HE0 A;  3BTI A;  2REK A;  5H9T A;  2F07 A;  3LSR A;  2ZOZ A;  2IBD A;  3MVP A;  4KWA A;  4X1E A;  2OER A;  4I76 A;  3DCF A;  1JT0 A;  5FGL A;  5FKM A;  5C4Y A;  1QPI A;  3IH2 A;  3BTC A;  2ID3 A;  3JSJ A;  5J1U A;  3WHB A;  2GUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...