3TP3A

Structure of hth-type transcriptional regulator ethr, g106w mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
194
structure length
194
Chain Sequence
b'GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTWINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Structural activation of the transcriptional repressor EthR from Mycobacterium tuberculosis by single amino acid change mimicking natural and synthetic ligands.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 82
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3tp3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3tp3A02
4NDLA 1IJWC 3S1NJ 3UKGA 1HLVA 2OPTA 1FJLA 2G3BA 2Y31A 2VI6A 4IEJA 3JRBA 1FEXA 1NK3P 2D5VA 2AO9A 2PBXA 3ANGA 1RKWA 3PO3J 1RKTA 3RQIA 1U9OA 1TC3C 5E3OA 1WPKA 4XICA 4ABZA 3S1RJ 5FGLA 3V78A 3SFIA 3KZ9A 2L0KA 3HTAA 2QF7A 2LTPA 3QPLA 1PUFB 5E3NA 5D1RA 2RHAA 2XRLA 1OCTC 4J19A 4M3EA 5EZHA 5M5WJ 1OFCX 3BTIA 2M0CA 1OCPA 5F0FA 2X48A 2ZOZA 2DA1A 4BKXA 2NVQJ 2DN0A 1ZQ3P 3EUPA 3E7QA 4NELA 1WI3A 1A6IA 1LFUP 2E19A 3HM5A 3SDGA 1Y1VJ 2COBA 2Y9ZA 3S15J 5CXGA 3HOZJ 3BR3A 1JUSA 2DA3A 2ME0A 4CGRA 2K9QA 4G12A 1AHDP 3KNWA 4QSHA 3BCGA 3VIBA 1X2MA 3RZDJ 2EZKA 2L7ZA 2YVHA 4GFKA 3BJBA 3AQSA 1GVDA 1W0TA 2DJNA 2RASA 2WGBA 1E3OC 3NI7A 2E2JJ 2M34A 4A3EJ 2ZCNA 1APLC 1QPIA 4Y7NJ 4AC6A 4S0HB 1JTXA 3W6VA 1UI5A 2QOPA 1IRZA 3HB9A 2LFBA 2XDNA 2DA7A 4JYKA 4B4CA 3GTKJ 3NARA 2JMWA 2LK2A 5C3EJ 1GV5A 2DA4A 1JJ6C 2JA5J 4A69C 4B1RA 3ZQFA 4M3BA 5F27A 4A3FJ 1QRYA 3TW7A 1I50J 3BNIA 1X2NA 2DA6A 2AHQA 1R9TJ 1XG1A 2WUIA 2EQRA 1Y1WJ 3QBMA 3VVYA 1K61A 1RETA 5DTDA 3JRCA 2R5YA 1FTTA 4A3CJ 5K58A 4DYRA 2UXIA 1RESA 2Y30A 4EEFG 4X6AJ 3TP3A 3BR2A 2OI8A 4QTRA 1Q1VA 3BTCA 2L9RA 2E2IJ 5EZGA 1MH4A 4FISA 3A01A 3LJLA 4JL3A 5HODA 3BQZA 4MXMA 2ECCA 1ETVA 2QCOA 3HTIA 1WGXA 3S1QJ 1IDYA 1JKOC 5M5YJ 4GCTA 1HDDC 4MLOA 1A5JA 5CW8A 2Q24A 3OOUA 4FE7A 4A93J 2ZCXA 4ACIA 4C3HJ 4M6VA 4W1UA 2R5YB 1BW6A 2OF7A 2XGEA 5IPAA 3DCFA 1B72A 2UXOA 1Z77A 4DYCA 4I6ZA 1BA5A 2L7FP 2QWTA 1XC5A 3LOCA 3OSGA 4W97A 4GCLA 3RZOJ 3E7LA 3S16J 2UXPA 2YVEA 3A01B 2O9LA 3TW6A 3GTJJ 2JN6A 3C2BA 3CDLA 2O7OA 5J1RA 4PXIA 1NTCA 5K7FA 2HYTA 2PMZN 2EZLA 1ZGWA 1TWAJ 2G0EA 3VW2A 2KT0A 1WCMJ 5IYDJ 3FIWA 1ETYA 4C3JJ 1I6HJ 3FISA 4IHXA 3B6CA 3LSRA 2KDZA 3G7RA 5C4JJ 5M3MJ 2H1KA 3PPBA 2IAIA 1DU6A 3VOXA 5K7HA 3O8GA 2JJ7A 3VP5A 1B72B 4B3AA 5M5XJ 2GLOA 3CJDA 3O8HA 3BT9A 4XK4A 1ZR4A 2O8KA 3NPIA 2XPUA 4AUXA 1IC8A 2L7MP 2IU5A 1ORKA 3BG9A 1ZK8A 1B8IA 3S1MJ 2NP5A 1X58A 1MBFA 1JUMA 3ZOBA 1XS9A 1TWHJ 3C07A 3HBLA 1GUUA 3V6GA 1JT6A 3NAUA 3GEUA 4AF5A 5DS9A 1UMQA 3IH4A 2Y0SN 4ME9A 5EFYA 3JR9A 1JKQC 2H8RA 5J1YA 3T6NA 3GTLJ 2CUEA 1Z0XA 3ZQHA 2E2HJ 1ZTRA 2EH3A 1FIAA 5IOYA 3NXCA 2LLKA 2QTQA 3CRJA 4IHWA 2E1OA 2HKUA 2R5ZA 1TWFJ 4BXXJ 4JX5A 1ETWA 1F36A 2K40A 3HGYA 4BY1J 5F0CA 2VPRA 1RR7A 2HDDA 5GPAA 3HOXJ 4DW6A 3MKLA 1B8IB 5AQCA 5M3FJ 4AC0A 4FCYA 1D5YA 2R7ZJ 5FKMA 2HQ5A 3NRGA 1BJZA 3MVPA 3TEDA 5F0HA 2ZB9A 2M8GX 5GP9A 4BBSJ 3S17J 4A3JJ 3LSJA 1MBEA 1ETKA 2F07A 4C3IJ 1BL0A 2PZ9A 2JK3A 2X6OA 5IP7J 1LFBA 1ETOA 1JGGA 2GUHA 2NP3A 5FHPA 3VW1A 5HSZA 3FK7A 4UDSA 2VKEA 1RPWA 1MBKA 5EGOA 1ZR2A 3LSGA 2JWTA 3G1MA 5IYCJ 1SFOJ 5FKOA 2XB5A 3ON2A 4MO7A 2R5ZB 1W0UA 2Y9YA 5EYRA 3QPSA 2GBYA 1JJ8C 4D5CA 4NN1A 2ID3A 1OJLA 2M2EA 2DMQA 4JNNA 2WAQN 2CUFA 4FE4A 2TRTA 5EF6A 1T56A 1P7IA 1I3QJ 2YU9J 1IGNA 5K7ZA 3MNLA 3HOVJ 3HTJA 1SANA 1K83J 4M3FA 5C44J 2ID6A 3CMYA 5EGOB 4UUSA 4X1EA 2HOTA 3LNQA 2NVYJ 5BNGA 4HNVA 3A03A 4GFLA 5FKLA 2XGCA 3QQAA 5IP6A 3OSFA 3IH2A 3CCYA 2YUSA 1MNMC 3BRUA 3BR0A 3NNRA 2EZHA 1H88C 1MSEC 4MIMA 1JKRC 3HOYJ 5EDNA 3MN2A 1UHSA 3AQTA 3HTHA 2HXOA 4KWAA 2HYJA 1MBHA 2XSDC 1DU0A 5EEAA 4IHYA 3M4OJ 1SGMA 4UUTA 3GTPJ 1U8BA 4BY7J 5D19A 3TP0A 1P7JA 5F08A 2DG8A 1MH3A 1MBGA 3PASA 1T33A 4M3GA 4AYBN 2IBDA 4XRSG 2FBQA 4UUSB 1POGA 5E3MA 3S2HJ 4DZJA 5FLVA 2NOGA 4MK6A 4V2FA 3S5RA 2NVXJ 3Q0VA 3BQYA 1MBJA 4YZEA 4A3IJ 1TWGJ 2X9DA 2DMUA 2MG4A 2Y2ZA 1GT0C 3H3VK 3JRFA 3FK6A 4A3KJ 3RH2A 3F0CA 2LVSA 3S14J 2NVTJ 4JX6A 5E3LA 3ZQIA 2CJJA 5EG0A 2LKXA 2FQ4A 3P9TA 3BG3A 3JRDA 1JKPC 3K2AA 3G1OA 2JA7J 2DA2A 2XB0X 3BR1A 2IEKA 2W53A 2P81A 2ZOYA 3LWJA 5HBUA 3HKZN 3L1PA 3FKIJ 3O60A 1ETXA 4JX4A 3IH3A 4I76A 1UG2A 4M3DA 5FKNA 1U78A 2NS8A 1BW5A 2NX4A 5IYBJ 4QIWN 2UXHA 5F1JA 1H89C 2DMNA 2UXUA 2FJ1A 5IOZA 3BTJA 2GENA 3F1BA 4D5FA 3CQZJ 2DMPA 2CRGA 1ITYA 1QVTA 4XIDA 3VOKA 5EG0B 1H8AC 4Y52J 3GTMJ 5H9TA 3ON4A 4MFDA 3G1LA 4C2MJ 3K7AJ 2N8GA 3PO2J 3IUVA 3HIMA 5JLXA 1FTZA 3A02A 2CU7A 2R93J 3D1NI 3GTOJ 3BTLA 2MSYA 5HAWA 2I10A 2FX0A 1AKHA 3M3YJ 4MFEA 2R92J 4A3GJ 1CQTA 2OERA 2WB1N 2M9HA 3PM1A 2ECBA 2G7SA 4A3BJ 2XPVA 2DMTA 3HOUJ 4BBRJ 3ANPA 4IHVA 1NK2P 1JT0A 5IP9J 4HKUA 3CWRA 4A3MJ 4D7NA 3KKDA 2GFNA 2O7TA 3H0GJ 4LOCA 3DPJA 4GCKA 3VPRA 1S7EA 2HOAA 2REKA 2EBIA 2D6YA 3S2DJ 5J3LA 2HI3A 2LD5A 2QIBA 2K9SA 4DYQA 1TWCJ 1WH5A 2DG7A 2G7GA 4FTHA 1QVUA 1U9NA 4XRMA 4A3LJ 1F43A 2ZCMA 3G56A 5GPCA 1VI0A 1AKHB 1ENHA 2CQXA 2EZIA 3JRAA 2HXIA 9ANTA 3GZIA 3KKCA 4JKZA 1FIPA 1HDPA 3Q3SA 2G7LA 3COLA 2LP0A 2TCTA 2VUMJ 2LY9A 3JRGA 4RDUA 1IG7A 2VKVA 3WHBA 3SJMA 3HGGA 5CXIA 4DZPA 2XPWA 2JA6J 1UI6A 5DAJA 2DTZA 2XGDA 2ELKA 5FLMJ 5FJ8J 3GBGA 3RKQA 3FRQA 3B81A 3Q0UA 4XRSA 4CYCA 4L5EA 3ZQGA 3QKXA 2LR8A 3IV5A 2NS7A 3Q0WA 3OIOA 2FD5A 4L62A 3GTGJ 3EGQA 3VUQA 2K9NA 1EF4A 5J1UA 4D7MA 3LHQA 3HDDA 5JLWA 1HF0A 1YRNA 2B63J 1MSFC 5F04A 3HOWJ 1VF9A 1AU7A 2MGQA 3HE0A 3DEWA 3JRHA 1G2HA 3RD3A 3ZQCA 1IDZA 3BG5A 2V57A 1LE8A 3B6AA 1WH7A 2RAEA 3JREA 1O4XA 3BR6A 4CYCB 2CQQA 4RBOA 3LSPA 3I4MJ 5C4XJ 2MW8A 2ME6A 3JRIA 4A3DJ 1HCRA 3VW0A 4V2GA 1GDTA 4GFBA 2YS9A 3JSJA 4JP0A 5FMPA 1GV2A 1HOMA 1IUFA 1YRNB 3I4NJ 3BHQA 2JA8J 3BR5A 1VFCA 3WHCA 2GM4A 3GTQJ 3ZQLA 1ETQA 1LE8B 2QKOA 2WV1A 5D18A 3VVZA 1JUPA 2W48A 3VVXA 1PUFA 2R0QC 1JTYA 5C4YA 1ZKGA 1IV6A 3HEFA 1VNDA 5FKKA 4ICHA 2HOSA 2DA5A
chains in the Genus database with same CATH superfamily
1IJWC 3S1NJ 1BIAA 1HLVA 2Y31A 2QM3A 3CTAA 3JRBA 2CFXA 4OAZA 3MZHA 4RB1A 2DPUA 1WI9A 1DP7P 3I71A 3ANGA 5AIPA 3P9IA 1V5EA 5LHGA 2R7TA 3RQIA 3WTWC 4HF1A 3WE3A 1VQOI 1SD6A 2L02A 5ERIA 2DYSH 3S1RJ 2UV1A 4G7HF 3GLLA 1PJRA 4BEHA 1R22A 3QYEA 4J01A 1WJBA 2XRLA 3LFUA 3SZTA 2DOAA 4M72A 5FB2A 3MD2A 2DBBA 4XQFA 4M73A 3BTIA 4P1WA 2ZOZA 2DA1A 2STWA 4BKXA 2DN0A 2IP2A 2E19A 1Y1VJ 2COBA 4KIFA 2Y69H 2ZCWA 5CXGA 4C2UA 5F1RA 1TT0A 3H5NA 2K9QA 1ODDA 4BHBA 4G94A 4FX0A 5ICCA 1IAWA 2EZKA 2L7ZA 2YVHA 4U88A 5H20A 3H9GA 3VOEA 4BDZA 2DJNA 3NI7A 2M34A 2WC2A 2V6CA 2FNAA 4Y7NJ 1ON1A 1UI5A 3I58A 1SFXA 1Y6IA 2JMWA 2LK2A 5C3EJ 3NS4A 1AWCA 1MMAA 3F8MA 3VYSB 2JA5J 3IL2A 1QRYA 1D1CA 2WAEA 4XL9A 1I50J 2WA0A 3BNIA 2FU4A 3AAFA 3CJNA 4NC6A 2EJRA 3RYPA 1MNDA 2TDXA 3QBMA 1K4TA 1Y0UA 1K61A 1RETA 2F4OB 5DTDA 4ZZDA 1D8JA 4DYRA 4HZFA 2Q1ZB 2GA1A 3KPHA 2Y30A 5LRSA 2Z5UA 1QNTA 1RZ4A 1WKMA 4L9NA 2VKHA 3I5UA 3DBLB 3DQVC 2XC7A 3QOPA 4YIFA 3W2AA 5ILVA 2L9RA 1VQ4I 3I59B 4IRGA 3BQZA 1ETVA 3DU6A 2OUMA 3N4MA 3U2RA 4ENMA 1H9GA 1Z21A 3NWTA 3V8KA 5K5RA 2AQEA 3PIOF 2IGKA 4FE7A 2K85A 1AA7A 3WU1B 2F5DA 2OF7A 5IPAA 1JI8A 2HDWA 3BROA 1Z77A 4BQOA 3OL3A 1L3LA 2M0MA 4QWQA 3LMMA 4GCLA 3ZCOA 3E7LA 4OD4A 2DQRA 1J7KA 3GTJJ 2JN6A 3C2BA 2R7UA 2HYTA 3H9QA 2EZLA 2X4HA 2G0EA 2UUZA 5IYDJ 1ETYA 3PSFA 5CQEA 4B48A 3B6CA 1ON2A 5M3MJ 2H1KA 3PPBA 2IAIA 1DU6A 4N9HA 3RYRA 4CDGA 3O8GA 3IRRA 3K70D 5D6EA 2JJ7A 1MGTA 2FXAA 3WODF 2G9WA 2JSCA 2V9PA 1B72B 2GLOA 5M5XJ 3EYIA 2PFBA 1T39A 2XPUA 1HXDA 3A0HC 3BG9A 2X1DA 1FP2A 2FNPA 3CC2I 3N97A 3F8FA 5E1WA 2R7DA 1P4WA 1JUMA 3FBNB 3HBLA 3J80K 3V6GA 3LSMA 4HNTA 4ITVA 3GEUA 1X1AA 2IS2A 1QQIA 5DS9A 1UMQA 2LMDA 4ME9A 2UWMA 1J59A 1MZBA 2ZC2A 1R5HA 1YX3A 2RVCA 3CCEI 3GTLJ 3ZQHA 3GZ6A 1FMVA 3ZMUA 2VONA 3NXCA 1J9IA 4OMYA 3F8CA 5ICFA 4BY1J 5HLTA 2OCEA 1ZYRF 1CGPA 4CZCA 4LFUA 5AQCA 5M3FJ 5BMZA 3TEDA 2IS1A 2ZB9A 4BBSJ 1QPMA 1XMKA 1D0YA 1SD7A 2BY2A 3C2GA 4C3IJ 4PFOA 3BC8A 2K3PA 2ISYA 3CCUI 1JGGA 3X2QH 5HSZA 1YE9A 1K4SA 2FQ3A 1UJ8A 2VKEA 1LB2A 4IVNA 3IHUA 1JE8A 4HF2A 2JUCA 2P5KA 1X1BA 4XLHA 4WCGA 3Q9SA 5IYCJ 1FBUA 5FD6A 1S8NA 1ONVA 3QPSA 4LMYA 2GBYA 1SMYF 2A6TA 3FXQA 1JHFA 1SMTA 3KP2A 4D5CA 1WHUA 2M2EA 1XB4A 2DMQA 1CF7A 2TRTA 3S32A 4PJNA 1P7IA 3MNLA 2EFNA 2HOEA 1RI7A 1WVRA 2RGVA 3CCLI 4PDKA 1K83J 3HUGA 1FBQA 2P6SA 2P7CB 1O57A 3FMSA 4P5OA 4PJMA 4AWXB 4UUSA 4Q4ZF 3LNQA 1S9HA 5HDNA 5TGTA 3A03A 4I01A 2V4JC 5IP6A 3IH2A 3SZGA 2YUSA 2F4IA 1PDNC 2PJRB 3OYEA 1U2WA 2DFFA 2V79A 3B73A 4B3XA 2VJ5A 2R7RA 1S3JA 4MIMA 3HOYJ 5EDNA 3AQTA 4XN3A 4L0YB 4KWAA 3LAPA 1OCZH 1MBHA 1P92A 4IHYA 4UUTA 3GTPJ 5D8LB 2O0YA 3QYBA 3TP0A 3CCSI 1P7JA 4HX4A 4ZZLA 4IO9F 2WWYA 2DYRH 3PASA 3E1SA 2KRFA 2YSRA 5DM6F 4M3GA 1U5TA 2X1EA 4P96A 4KT5C 4C2TA 4XLNF 4ENJA 1IXRC 4V2FA 2WY7Q 4LG0A 5B5EC 3Q0VA 2NVXJ 2X9DA 1BI1A 3H3VK 5HVQC 3JRFA 5H6RA 3REOA 2BZTA 3HSFA 3DEEA 4II3A 4HQMA 4DQ2A 2XV4S 2PMHA 3SZPA 4BDYA 3CD6I 4HV6A 3IRQA 3W2WA 3JTGA 5K5QA 2JA7J 2DA2A 3WGHA 2IEKA 1HW2A 2ZOYA 1F1ZA 2CYYA 4D0PA 4JOMA 3HKZN 3F9KA 3L1PA 4HLXA 4BJ6C 3FKIJ 3CCMI 5D5UB 1ETXA 3EQLF 3ONQA 1UG2A 2ZKZA 4D1QA 4LJZF 3ECOA 2QBYA 1D8KA 2HVQA 2UXHA 2DMNA 4HDUA 2OZ6A 2CRGA 3ELKA 5HNHA 1ITYA 1A31A 3CUQA 3KP6A 3FDYA 3L2QA 3BG7A 4Y52J 1GHCA 2AQFA 3E97A 3ZMSA 3PO2J 1VQ9I 3IUVA 1OYIA 3FF5A 1YQAA 3H35A 5JLXA 1FTZA 3KP4A 2AS5F 3LL7A 4LLGF 2MSYA 2RNGA 5HAWA 1D3YA 1FC3A 4MFEA 4BQNA 3OYKA 1BR2A 3PM1A 3LQQA 4A3BJ 2BXYA 2XPVA 4FETA 4IHVA 2DW4A 2E36A 5IP9J 5J6XA 2YU3A 1GLNA 2BYVE 2BGCA 3KKDA 1QHGA 4YIRX 3K1PA 2O7TA 4LOCA 3DPJA 2QQBA 4GCKA 3GF2A 3ASNH 2REKA 1TP4A 3K4KA 4IHSA 5J3LA 4QPOA 2HI3A 4UY8I 3HRSA 2LD5A 1J09A 1ZH5A 3HZJA 4F91B 2KLOA 2DG7A 3HRMA 1O3QA 4OD5A 2G7HA 2VOPA 2ZCMA 4HAMA 2ZJPF 4XNFA 3G56A 2L9VA 3F21A 1AKHB 4CZZA 3JRAA 5AIQA 2MLGA 3VWBA 2XHKA 2W7NA 3EUAA 1UELB 1XSVA 3M7GA 1FYLA 1TZLA 4EM2A 3WE2A 1G4DA 4IRIA 2LYCA 5ED4A 1T08B 1WJEA 2XKOA 3J7YJ 1IRGA 3COLA 2V1DA 2M45A 2CG4A 3T1BA 3GLXA 1UHWA 4DZPA 5TRDA 3CESA 1BIBA 2XGDA 2OBPA 1YLFA 1X1DA 3HKZA 5FJ8J 3DV8A 3GUDA 4DJAA 1SAUA 3RKQA 4WXDA 3B81A 2VN2A 4BE2A 3K4JA 3ZQGA 1TNSA 1LUJB 4UXNA 1EH7A 2KFDA 4PJJA 3VSKA 1R23A 1JGSA 2QSFX 1XCBA 5DM7F 2E1CA 5J4VA 1Z6RA 1EF4A 5KAIC 5CVJA 3RCOA 2XVCA 3RTRA 1NG6A 3T8RA 1YRNA 1USSA 2VQHA 2VJIA 3GZ5A 4NC8A 2MC4A 4AVPA 1HKQA 1X4OA 1XTAA 3KX2A 3J7ZI 4KMFA 4Q5SF 3RD3A 3ZQCA 1IDZA 3RJPA 3IP4B 3O6BB 2DXIA 1W4MA 3BR6A 3L2RA 3LSPA 5LEKA 1DGRM 2MW8A 5BPDA 3I4MJ 4A6EA 2ME6A 3GEZA 4PSWA 3JRIA 1I1SA 2OZUA 3TO7A 3FKJA 5HOOA 3VW0A 3TO9A 3FXJA 4PGGA 2YS9A 5ILSA 1V4RA 4DNCA 3FXKA 1HOMA 1IUFA 2JUGA 2VQCA 3BHQA 1EKEA 2CW7A 1NH3A 1T2KA 1VFCA 3S3NA 1BC7C 3GTQJ 2EIKH 2R7WA 3MFKA 1LKXA 1MDMA 4II2A 1ETQA 3HG9A 3ERED 2K5CA 2WV1A 4IL6C 1LE8B 2QKOA 5D18A 1D5VA 2R0QC 1K78A 2XRNA 1FWZA 1MKMA 5E8IA 4ENKA 5C4YA 3OYGA 3Q9VA 1KA8A 1IV6A 4Q47A 4RGUA 4GCVA 2HOSA 2HYGD 4NDLA 5FROA 2Z2SB 4BHCA 2WAQA 1R1VA 3UKGA 4A0YA 3VDXA 2Z16A 2G3BA 2VI6A 3UR3C 1KYWA 4IEJA 4DGWB 1YHQI 2V9KA 2PBXA 3QRFF 4XLPF 4OINF 4I7HA 3EUHC 1VQ7I 1RKTA 1U9OA 1A6QA 2M7AA 3KETA 1YJWI 4ABZA 5GAEJ 3DWLE 2L0KA 3QPLA 1A36A 5E3NA 1MMNA 4IQ4A 2RHAA 3OYBA 1LVKA 1R00A 1OCTC 2Z3YA 2MC3A 4M6YA 4G6TB 2L5QA 2PEXA 3FXMA 3HC7A 1OCPA 2X48A 1STZA 3LWFA 4IRHA 1BN5A 1BOBA 1ZQ3P 3EUPA 2Q2EA 3V8LA 1XSXA 4U7DA 1LFUP 3SDGA 1EH8A 2PI0A 2PJPA 4AM3A 3S15J 3V7CA 4EJVA 3HOZJ 4X0GA 3BR3A 2K4BA 4GXOA 2WAFA 3M8JA 3L2VA 1W5SA 4G12A 1AHDP 3OOPA 3VIBA 3RZDJ 2LF7A 5CVVA 4UV8A 3AG3H 4ESBA 3BJBA 2VB6A 3AQSA 3BZCA 3K70C 1YIOA 4NQWA 2EV6A 4G7OF 3VFZA 4ON0A 4KITB 2WGBA 3K1NA 2E2JJ 1IN4A 4EJWA 5HLHA 4KFCA 2ZCNA 1OR7C 4AC6A 4HEA2 4DBRA 3ISPA 5HNFA 4B4CA 3E6BA 3OMYA 3KEQA 4KT6A 2I5UA 4HDVA 1QGPA 3K10A 2V6EA 3ZQFA 2E35A 4M3BA 1QU3A 3GW2A 3TW7A 3VYRB 1YJNI 1YOVB 1WJDA 3FBIB 1VTNC 1KQ8A 1Z05A 2HQAA 4RMNA 2VBXA 2EQRA 3Q5FA 3FMQA 1QBJA 4YG2F 2KKOA 3GFJA 2DQLA 1RESA 3CLQA 3TP3A 1I39A 2CO5A 3BR2A 2OI8A 4PCQA 4RGXA 2HYFA 1M1EB 5HDKA 2K3FA 3DP7A 4S05A 3AG1H 3A01A 4JL3A 4P55A 5DV5A 5HODA 1Z3XA 1WGXA 3LSHA 3WGIA 4U0WA 4XR6A 3S1QJ 1IDYA 3CJQB 1P4XA 4I02A 3VEPA 3IWZA 5M5YJ 1TQIA 4RB3C 5DD4A 5CW8A 2KL4A 2ZFUA 5LGTA 5IT9Z 3DF8A 3QWLA 4RS8A 4ACIA 1N78A 4C3HJ 1H0MA 4BJTA 1X4PA 1FOKA 4KISA 2VE9A 3I0TA 3IKVA 1B6AA 2QQ8A 2IJLA 3K8PC 1MMDA 2RN7A 3D0SA 3W6JB 4CA0A 4DYCA 4P9FA 1BC8C 3VB2A 2PMUA 2E1MB 4Z2YA 3WTZA 1R4NB 4W97A 2IGNA 3H36A 1IN5A 3OYFA 4B47A 4RLQA 3IKTA 3TW6A 2DT7B 2X85A 5J1RA 1T6SA 3QYFA 4BJ5C 2FBHA 2PMZN 3HTUA 3BCBA 4JQFA 2BW3A 4M71A 4MEYF 3VW2A 2FMYA 2ZNYA 2KT0A 4RGRA 1G3TA 1KONA 2H8WA 3GCMA 3QOEA 1I6HJ 3FISA 2GIVA 3CCRI 4IHXA 3G7RA 5ICEA 3G2BA 3G6EI 2DO7A 1Y8RB 1A04A 1T95A 4U0VA 4UVAA 3H1CA 1D1AA 5B3SH 2Y0MA 3EPZA 1TT5B 4R1HA 2EFOA 1R5GA 4L9TA 3KYDB 5B1BH 2ZSHB 4WK8F 4XK4A 3CJDA 3JW4A 2IU5A 2M8EA 4CYDA 5CVUA 2WY8Q 1LPQA 1B8IA 1XPXA 1X58A 2ZSIB 1YYVA 1TQPA 2QQ9A 4KUMA 4N9IA 1XS9A 4C2MA 3C07A 1V55H 2XAJA 5FLXZ 3NAUA 3CCQI 4AF5A 1HW5A 2LY1A 4MEXF 4EGZA 4KNYA 2Y0SN 2BE5F 2YR2A 5EFYA 2H8RA 2EB7A 5J1YA 2AXTC 2EH3A 5IOYA 1FIAA 1O7LA 2HU9A 3NRVA 4PUSA 4XORA 2QTQA 3CRJA 3LA2A 3WG7H 2MA3A 1VQ5I 2HKUA 1WSUA 2R5ZA 3VYTB 3GYHX 1F36A 2GA2A 3HGYA 2VPRA 2HDDA 4FT8A 4OIOF 3HOXJ 4L0ZB 3OY9A 5DUIA 4AU7A 2Q8KA 3MKYB 4AC0A 1D5YA 2QVOA 5FKMA 4CCOA 2LNBA 1BJZA 3BP8A 5GP9A 1U3EM 5KVRA 5D5XB 1ETKA 3RKXA 1K79A 1BL0A 1F4KA 2PZ9A 2JK3A 1ETOA 4XOTA 2NP3A 2HZTA 3VW1A 3ZQQA 1RPWA 1MBKA 1ZR2A 1W5TA 5LRRA 3TL4X 2CFOA 2E1NA 2CMPA 1YW9A 3E6MA 2FF4A 3QODA 3ON2A 1S7AA 3O3KA 2LH9A 4A12A 2Y9YA 2PMZA 1K7AA 4NN1A 4XRFA 2ID3A 2H94A 1OJLA 4I2OA 1B4AA 3J81Z 4JNNA 2CUFA 1UCRA 5EF6A 1T56A 2E7WA 2KIMA 2YU9J 4E7IA 3SEQA 1IGNA 2QKLB 5A2QZ 5K7ZA 2MFZA 3KZYA 5C44J 4UHTA 2XGXA 2X51A 2ZXIA 3GFIA 2JPBA 4AVZA 1MJAA 2VE8A 3OYJA 4GFLA 5FKLA 2FMLA 2DT6A 3CCYA 2ZJQF 2RREA 5HLGA 1MNMC 3BRUA 3NNRA 2EZHA 2D1VA 1JKRC 3MN2A 3OYCA 3HTHA 2K4JA 1PP8F 2HXOA 5HLIA 2A6HF 3OYLA 3I55I 2KJBA 3UNGC 5K5OA 1UG0A 2NS0A 4EVIA 3WG9A 5EEAA 1DU0A 3MEXA 4P9UA 2DPDA 1CF7B 2Y0SA 3O2PE 4BU2A 4E7LA 2E5ZA 2E7XA 5BOXA 3P7NA 2EA4A 1O3TA 2HEOA 2JSPA 2XAFA 1MBGA 3NEUA 4Y4RA 4AYBN 3HUGB 4UUSB 2M87A 2ZO4A 5FLVA 3K0LA 2CV0A 1G3WA 1X3ZB 2CSOA 4E6KG 2HVSA 3BQYA 4A3IJ 1TWGJ 2JRMA 2XIGA 4RLFA 2A69F 2DMUA 2Y2ZA 3A0BC 3ZMTA 1GT0C 3NQOA 1G59A 1U8RA 3FK6A 2B3WA 3RH2A 4H4KC 1R6RA 4JX6A 2NVTJ 2KMUA 2DCEA 2KZVA 1YW8A 4M74A 3BG3A 2F48A 3LFKA 3ZR8X 1HC8A 3HOSA 2VPLA 3HIFA 1U5TB 3OIPA 5KCMA 2L7KA 1VQMI 3JSOA 3KYCB 3QKXA 3HSEA 1KQ9A 1LDKB 4L18B 3LSIA 2FBKA 5FKNA 4LG0B 5LEJA 5F1JA 1H89C 3BJ6A 4KDPA 4PJLA 1DPUA 1K6OA 2J5OA 2OV7A 4D5FA 3L00A 5DD8A 3F8BA 3I54A 4BL0B 2BY3A 2BBYA 2IRFG 2PLYA 2O3FA 3L2WA 3GTMJ 5H9TA 1ZGJA 2DOFA 3G1LA 4C2MJ 1XSDA 3ON4A 3IAS2 1OLTA 2F5FA 2FBIA 2IW5A 2V26A 4IX7A 4Q48A 4FX4A 3GTOJ 4BXUA 1IF1A 2DK8A 4LD5A 1SFKA 4F93B 2R93J 3H3UA 2FX0A 3M3YJ 1X19A 3R60A 1ZG1A 1S72I 2R92J 1CQTA 3FHNA 2WB1N 2M9HA 3F22A 2XUBA 4XLEA 3E5XA 4BBRJ 1LJ9A 2QBYB 2PFVA 3KP7A 2ZMEC 5TJJA 3RPUA 1I1GA 1T0FC 1OCOH 3COAC 4R8HA 3BZ6A 3R0AA 4KICA 3CJRB 3VPRA 2HOAA 2ACJA 2EBIA 4XM3A 3CUQB 1VQKI 4L9JA 3S2DJ 2VT2A 2LC2A 2LDUA 2IVMA 4XOPA 4C9YA 5GTIC 4DYQA 1TWCJ 5FFZA 3PNVA 3SEZA 1WH5A 1YI2I 2A5WA 2XF7A 3I64A 2DT5A 4XRMA 1FMWA 5E1XA 3BOQA 3FM5A 5DDGA 3U9GA 2CQ7A 1ENHA 2L3DA 4CSWA 4YRVA 3GZIA 1XD7A 2HTJA 2KIQA 4ZTFA 4UV9A 1FIPA 1G3SA 2RV8A 3GFLA 1MIJA 4N0BA 5FLXK 2LP0A 2TCTA 1R49A 4KYWA 2LY9A 2YVXA 4RDUA 2L4AA 1SVOA 5FGMA 4GYGA 2V7FA 1ZRDA 1V54H 1WJ5A 1UI6A 5DAJA 2DTZA 4KN4X 3OYIA 1Z91A 3D5SC 2ELKA 3A2KA 3GBGA 4CICA 2W84A 3OS1A 2NNYA 4M6XA 4XRSA 3KEYA 3RPQA 2LR8A 3IV5A 3R61A 3OIOA 4ESJA 2R7SA 2K27A 3GTGJ 2PN6A 2JQ7A 5KAFC 2V1NA 3JAMZ 1BM9A 2LRDA 3LHQA 1D1BA 3HDDA 5J8FA 1I27A 3ZPLA 2B63J 4ZH4F 4KA4A 5F04A 3ABTA 1VF9A 4HOBA 3OYNA 3JRHA 4KMUX 3CMAI 2ESNA 4OU0A 2JZYA 3BG6A 2OAZA 3CF2A 1RRJA 3MKZA 1ZRCA 5LHIA 2M1BA 4F7ZA 5K1YA 3JREA 3ML6A 1O4XA 3BLYA 4HV5A 2WB1A 3WGGA 5BPIA 1XGNA 3ABLH 1G8XA 2IGOA 1XDSA 2QUFA 3BPVA 5ICGA 1HCRA 3J81K 2GAUA 4F55A 1V5GA 4BH9A 3JSJA 4EV0A 4JP0A 3WTSC 1SFEA 1R71A 2HFHA 1GV2A 2H09A 1VQNI 5A2QK 2H6BA 1YRNB 3BR5A 3PQJA 2QEXI 2EFWA 1QO0D 3IWFA 4ZYAA 2ESHA 3QP6A 2HS5A 2W25A 3BCAA 1MJBA 3TOAA 4F3QA 2DFEA 1T38A 1JUPA 2W48A 2W85A 3VVZA 1PUFA 5CPRB 1P6RA 3H5RA 1A35A 3K4LA 3U1DA 1BI2A 2F6CA 3S8PA 4ICHA 2DA5A 2KIUA 2P6TA 2Z33A 1FOYA 2BHZA 3DPLC 4WX9A 3VODA 1FEXA 2AO9A 2OTLI 2IS4A 1PP7U 1LEBA 2DFHA 1MDMB 1TC3C 1YIJI 4XICA 4WWCA 2LBFA 4WXHA 3SFIA 3TOBA 3KZ9A 2JRTA 2GOXB 2LTPA 1K78B 2RQQA 1YJ9I 1MNEA 1QHHD 2NRAC 2B7EA 4M3EA 5EZHA 3ZXSA 5CJ9A 2M0CA 1X3WB 1HSTA 4PGHA 2NVQJ 4FASD 3K4NA 4LLLA 3EUKL 1Y56A 1A6IA 2NOJB 2ZNZA 3HM5A 3PSIA 3DPUA 3FMRA 4G6DA 3MAJA 3TDZC 2CQNA 1JUSA 4LLNA 5F64A 4CGRA 2EV0A 1ZELA 2DLLA 1LNWA 3VYUB 4QSHA 5JR3A 3TQNA 5E20A 2Q0OA 2EK5A 1KU9A 1GVDA 4Y15A 2D45A 1FSHA 5HS7A 2GWRA 2OTJI 3QU6A 2EIJH 1E3OC 5FD5A 3QPHA 3CUOA 4Y3OA 1ZARA 3K69A 4A3EJ 1APLC 1QPIA 1MMGA 1S7OA 2KRHA 2HPIA 2Q2EB 3I53A 4IJAA 3EUHA 2QOPA 1FPQA 1I5ZA 2LFBA 2M3AA 3HB9A 1IRZA 4JYKA 4MHGA 3GTKJ 1E2XA 3NARA 2DA4A 1JJ6C 1Y0NA 4Y17A 4A69C 1EA3A 5DCMA 4B1RA 3RKWA 4HRIA 4A3FJ 2NAZA 4LITA 2V1UA 1ZN2A 1FYKA 2DA6A 1IN7A 3ZQ7A 1R9TJ 1XG1A 3OWTA 2WUIA 4DIQA 2R4GA 1Y1WJ 4M9SA 3KZIC 1DQUA 4NQWB 4WF2A 4B44A 5E79C 3JRCA 2R5YA 1YTYA 4A3CJ 5K58A 2UXIA 4EEFG 2QGUA 3J7AY 4J00A 4QTRA 4O6JA 2M4GA 2IA2A 2CUJA 2UZKA 4HA8A 5DUKA 5D5WB 4G9YA 5EZGA 2MD0A 4FISA 2ICWG 1T8IA 1J2XA 2QCOA 3BZKA 3CLOA 1D0ZA 2MH2A 3H92A 2W1OA 1QZEA 5L3FA 1OYYA 4NHJA 4QLCU 4IOCF 5B66C 2VXDA 2L4MA 3PL8A 1HDDC 1A5JA 4N4NB 2VC1A 4LB6B 4E7JA 2ZCXA 4U9NA 1TW2A 4W1UA 3SWHA 4ETSA 3OV8A 3C1DA 2XGEA 1HW1A 4NC7A 2OU2A 1OR7A 2R7FA 2ZJRF 2LREA 3DCFA 1FNNA 4I6ZA 2QWTA 5E18F 3AFHA 3DU5A 1KZHA 5E17F 1BA5A 4G7ZF 1H9TA 3RKYA 3K6GA 3RZOJ 2HVRA 2UXPA 2XROA 1R58A 3A01B 3RSNA 1OMIA 3ESWB 2W57A 1E3HA 3CDLA 2O7OA 1NTCA 1EJ9A 2XSJC 1ZGWA 1TWAJ 1PVEA 4RAYA 3FIWA 3DBRB 4XN0A 1V5FA 3CO6C 4ZC3A 2PG4A 3LSRA 2KDZA 3E6DA 3K2ZA 4K2EA 5K7HA 3QPTA 3C7JA 3DTIA 1W36D 3VP5A 2OCCH 2DFIA 5B1AH 4I98B 3I56I 4CUGA 5DEQA 2O8XA 5L3DA 3O8HA 1ZR4A 2O8KA 3NPIA 5JVGF 4AUXA 5F6FA 2L7MP 1IC8A 4GRIA 2ZBKA 4E7KA 1UB9A 5CVRA 2WADA 2XF6A 2JA2A 3ZOBA 1TWHJ 4XLCA 2QWWA 1GUUA 1N77A 2BW3B 3D5RC 1JT6A 2K7LA 1B59A 2PQ8A 1Z6TA 3ASOH 3IH4A 4B8XA 3JR9A 1JKQC 3FXRA 1O3RA 3K4MA 3P9CA 2BXZA 3T6NA 2CUEA 2FEZA 3CCVI 4EQQA 2E2HJ 1ZTRA 4BACA 2PX9A 2W4SA 3H3ZA 2E1OA 4ZYHA 4YFXF 3HHGA 1TWFJ 4BXXJ 4UVCA 1ETWA 2K40A 5HDGA 2L2OA 5F0CA 1RR7A 3IAM2 5GPAA 4DW6A 3I3LA 4AD9A 1WWXA 1B8IB 2Z99A 4BEHB 3NRGA 3MVPA 3WTTC 5F0HA 2HDCA 4HQEA 3S17J 1B9NA 3GZNB 4A3JJ 1LEAA 1MBEA 1XGMA 3JTHA 2FUG2 4O5VA 2F07A 2X6XA 4LGWA 4CCMA 2X6OA 4YIIA 3TO6A 4NNJA 1LFBA 2ZXJA 5IP7J 5FHPA 2F2EA 5EGOA 2W82A 2JWTA 1BI3A 1KYZA 2K9MA 3KYLA 1HQCA 1SVLA 1XN7A 1SFOJ 5FKOA 4MO7A 2R5ZB 1W0UA 1RIOH 2P7VB 4I0BA 2RKHA 3ZMZA 4EM0B 1UZCA 1DDNA 2BVLA 2EV5A 3OYAA 4FE4A 3RI4A 3D5LA 4U0YA 3RPUD 1I3QJ 1ULYA 2HZDA 4MGRA 1S29A 4Y13A 3HTJA 1SANA 3KZZA 3OS0A 2XAHA 3CMYA 4X1EA 2HOTA 1LQ1A 1PUEE 3FZVA 2NVYJ 4RAGA 4M9ZA 5EEHA 2QYOA 4AIHA 4ESFA 4HNVA 1O3SA 1P9QC 2XGCA 3C2HA 3QQAA 3OSFA 4LIVA 5JHFA 1VQPI 2R7QA 5KK1A 1H88C 1MSEC 3K1MA 1L0OC 1UHSA 3DTEA 1VQ6I 5DCFA 4A0XA 3KCCA 2HPMA 2GQQA 2HYJA 2F4MB 4L9VA 1ZLKA 4YELA 3M4OJ 1SGMA 2XF5A 3HSRA 4HSRA 5F08A 3F6OA 1MH3A 1J0RA 1T33A 1YFHA 3RQ4A 3GWZA 2CWEA 3AG4H 3ZGKA 1POGA 4RAZA 4MQ9F 5E3MA 4DZJA 1XMXA 1K6YA 1OCRH 2O5RA 2NOGA 1FZPB 2FRHA 2IPQX 4BYYA 4ZYDA 1MBJA 4YZEA 1FP1D 3AG2H 1KU7A 1TNTA 3R4KA 2MG4A 2KDOA 3WU2C 2WTEA 4CO8A 5E1ZB 1IW7F 2CQKA 5E3LA 3ZQIA 5EG0A 4CCJA 2FQ4A 5GADJ 3AKZA 5BS6A 4UB6C 3JRDA 1DGWY 2STTA 3K2AA 5FRNA 1E0EA 3G1OA 1RR8C 4ENNA 3H5AA 3LWJA 2P81A 4EGYA 3HYIA 1F5TA 1RC9A 4E7HA 4I76A 1U78A 1BW5A 4M3DA 2NS8A 4A0ZA 4V19K 3PJRA 4KIBA 3ROUA 2HKXA 2GENA 3CQZJ 3CZ6A 2DMPA 3QAHA 4XIDA 3VOKA 2F5CA 3JSPA 3LAJA 4MFDA 3K7AJ 3GVAA 3LQRA 1MW7A 3EETA 4PJ0C 3HIMA 3G4SI 3OR2C 5GAGJ 1TLHB 1J75A 2CU7A 3D1NI 3BTLA 4OAYA 3FM3A 2I10A 1KU3A 4AIDA 2MD5A 2VQLA 3HXLA 2OERA 2G7SA 1V3FA 1FYMA 2V1XA 3ANPA 1NK2P 3CWRA 4A3MJ 3MQ0A 2A2FX 3CF5F 2GFNA 2OC6A 3H0GJ 2A6EF 4H0EA 2CW0F 3F3XA 1HKTA 1SD5A 3RDIA 1S7EA 1OISA 1W7PA 4LK1F 2FOWA 2D6YA 1JXSA 3V42A 5D8KB 2HGCA 1BR4A 4GGGA 2H1LA 1Y8QB 2K9LA 4BQQA 2QIBA 2K9SA 3HTSB 3A1YA 3QP5A 3BJAA 2G7GA 1QVUA 2AXLA 4HNUA 4XMYA 4A3LJ 1F43A 2DK5A 3C3WA 1QZYA 2D2WA 5GPCA 5J8CA 1AOYA 2RNJA 3KKCA 1WJCA 3V4GA 2GIZA 4DOZA 2BEOA 4FQGA 2P0WA 3A4CA 4UB8C 2QLZA 4ZYGA 1BBYA 1RNLA 5CQGA 4EM1A 1BI0A 3ZRGA 1IN6A 2G7LA 5LBQA 1BJAA 2GOMA 5JVTA 3OIQA 2VKVA 3WHBA 3SJMA 4HG2A 2XPWA 2JA6J 1XMAA 3KLOA 4AIKA 2DDAA 3WU0A 2VQGA 2B9SA 4BS9A 3MZYA 5GAHJ 3ZN1A 4CYCA 3E5UA 4MTEA 2IXSA 3RIRA 2E5NA 2RQPA 2NS7A 2QSHX 3Q0WA 1E3PA 2ZMEA 2FD5A 2I8DA 1T0FA 3KFWX 1WZ2A 5L3CA 3ZMDA 3PIPF 3ECHA 4TV7A 1LDJA 1MMSA 1YX5A 4U87A 3HOWJ 4XLFA 1AU7A 1R5ID 2MGQA 1G2HA 1P4AA 2GXAA 1IRFA 4BQAA 5H6QA 3DTKA 3B6AA 1WH7A 1WJFA 2RAEA 3ZMVA 3CO7C 1HA8A 2KP6A 2HWVA 2L9NA 3S2WA 4YFNF 2KJCA 6PAXA 1LFPA 2DDBA 3MKWB 5C4XJ 4IRVA 2ZJ2A 4EATA 1U0JA 3R6SA 1YS7A 2X6YA 4V2GA 5FFXA 2VT3A 1GDTA 4GFBA 3HRUA 2HKOA 3KP3A 4QPQA 4CGZA 1OPCA 4EJUA 5D4RA 3I4NJ 3GFMA 3DFGA 4OIQF 1SAXA 3WHCA 2EWNA 2GM4A 2VC0A 1MD0A 4F92B 3TDUC 1I3AA 4RB0A 4EJTA 2VODA 4DVYP 3WTVC 5JFRA 3L2CA 3S3OA 1DPRA 1ZKGA 5FKKA 5LGNA 1WQ2A 1N25A 2OPTA 2A3SA 5IT9K 1FJLA 2RDPA 1ACIA 4EJOA 1O7FA 3V8JA 1NG7A 1NK3P 4CHUA 2D5VA 2FE3A 5ILUA 2MH9A 4IZZA 5E8GA 2JT1A 4R79A 1RKWA 3PO3J 2HTSA 3FWEA 4OMZA 4M9XA 2A68F 3ULQB 3GMEA 3CMEI 2X0LA 5E3OA 1WPKA 4E7ZA 5FGLA 3V78A 2LSOA 3DEUA 3HTAA 2QF7A 1PUFB 2BY0A 5D1RA 1IN8A 3GO5A 5IT3A 3WTYC 1HSJA 1R7JA 2FSWA 2GZWA 5IY5H 2O03A 3DXJF 4J19A 4XLAA 4HX8A 5M5WJ 1OFCX 1Z7UA 5F0FA 5FO5A 4ZJZA 2A07F 3E7QA 4NELA 1WI3A 2R7OA 2A05A 4AYBA 2E1MC 2P8TA 4RGSA 1FOWA 2Y9ZA 4OOIA 3V7RA 2A61A 1WFXA 2DA3A 1FX7A 1KGSA 2ME0A 4B43A 1REPC 1QA6A 1WRJA 2LBFB 1DUXC 2KZGA 2LOOA 3KNWA 1GVJA 3BCGA 2CV1A 1X2MA 1YITI 4GO1A 5LGUA 1SC7A 1JHHA 2OJED 1SD4A 4HX7A 4GFKA 4ZDPA 2JVGA 3HPHA 4HSTA 1W0TA 2RASA 1W36C 3LA3A 5BQTA 1OYWA 2X6WA 3M1EA 1TTYA 4A2UA 2VJJA 3K4CA 1LDDA 4S0HB 2DU9A 1JTXA 2Y75A 2MLKA 2Z1DA 1VQ8I 3W6VA 3CDHA 5CLSA 2IGMA 3DKWA 2DA7A 2XDNA 3G73A 3I59A 1GV5A 3QU3A 2QENA 4XKVA 2XDVA 3LA7A 2ZY9A 2V9VA 5F27A 2XKPA 1FOXA 1I6XA 1NHAA 3CP2A 4E4HA 4BGDA 1X2NA 2J5PA 3G71I 2AHQA 5KHDA 2EILH 3VVYA 3TKYA 4HYEA 2VASA 3KP5A 1FTTA 4XSXF 2M30A 4X6AJ 2EPFA 3FXOA 4BHPA 4O3MA 4HF0A 3T5XA 1Q1VA 4N4OB 2KRCA 3M1CA 3BTCA 2L01A 2E2IJ 2L54A 1MH4A 3LJLA 3PNTA 2VBYA 3MWMA 2ECCA 4FHTA 4MXMA 3HTIA 4BXFA 2DJIA 4U7BA 3ZP5A 5DCMB 3M07A 4G6QA 2KHMA 2B1EA 1JKOC 1TL8A 2VBWA 2NYXA 1KQ0A 2FOKA 1HBXG 1ERDA 2FJI1 4GCTA 4PZJA 1ZG5A 4MLOA 5LD2C 2Q24A 2VIXA 3M8EA 3OOUA 4A93J 1F9NA 4BNCA 3JCUC 4PFPA 4NBQA 4M6VA 1U6GA 2R5YB 1BW6A 3F6VA 2DI3A 5HS9A 2CW8A 1SEUA 3TMOA 1GXPA 1B72A 4CCKA 2UXOA 2L7FP 4L5IA 1R36A 1XC5A 3LOCA 2GXGA 3FXLA 3OSGA 2XAQA 1IO2A 1IXCA 1ZHFA 2QZ8A 2O6GE 5J4YA 3S16J 2YVEA 2O9LA 2EFQA 4HW0A 3CP8A 1S5LC 5L3BA 3R0JA 1Z9CA 4PXIA 3BJOA 5K7FA 1E17A 3SHFA 2F5EA 4JK1X 3TGNA 3BPXA 2DTRA 2G7UA 4KJZA 3AL0B 4CH7A 1USTA 1SFUA 1WCMJ 4HLYA 4C3JJ 3N05A 1ZG3A 1X1PA 2W00A 5C4JJ 2CS3A 3VOXA 4LK0F 3CC7I 2GXBA 5J40A 1J5YA 4CCLA 1X1CA 1MJ9A 3F8NA 5GTHC 2IA0A 4B3AA 2IA1A 2FA5A 2VOOA 4MTDA 4XKBA 3P9KA 1BOAA 2HQRA 3BT9A 3P5JA 3HL2A 2MYSA 4XBFA 1Z67A 3VSLA 3VTIA 1ORKA 4ASNA 4IOAF 3DLAA 3J7AO 1FSEA 1ZK8A 3S1MJ 2NP5A 3H0DA 3BDDA 4NUBA 3WTUC 4UNOA 1IZ1A 1XGOA 2LY2A 1MBFA 2VJ4A 4UVBA 5CKTA 4ZYEA 3C18A 2UXXA 3B02A 1Z7LA 2QKMB 2K02A 2ELHA 1YS6A 2BHYA 4CCNA 1Z0XA 3MZ8A 1FLIA 2X1CA 3SXYA 1UFMA 3IUOA 2QQAA 2CGPA 2LLKA 3IC7A 4IHWA 2EFPA 4A6DA 1IUYA 5D6FA 4JX5A 4IQJA 4BAYA 2VKDA 4XKWA 2VL8A 4LB5A 3OS2A 1XDUA 3PQKA 3MKLA 1R1UA 4FCYA 2R7ZJ 1X3UA 2HQ5A 1N75A 4D9JA 3FHZA 2M8GX 1KU2A 3HPGA 3LSJA 5D5VB 3M8FA 3H9JA 3L2UA 2GUHA 1UHMA 3FK7A 4UDSA 2E60A 3LSGA 3WTXC 1U5TC 4HPQA 3S93A 3NWSA 2H27A 2KQRA 3G1MA 2K86A 2PJRA 2XB5A 1DP3A 5LFAA 1FY7A 1ZRFA 1Z1DA 1G3YA 5EYRA 2QSGX 1JJ8C 3SYTA 4ZTJA 3L09A 4JBAA 3DKXA 2WV0A 2YX4A 2WAQN 4I0AA 3HOTA 2EA2A 4F52A 3DLLF 3DPTA 4IPAA 3HOVJ 1XCVA 2R3SA 4M3FA 3OR1C 3HRTA 2ID6A 5EGOB 1W7PD 1SVMA 4XONA 5BNGA 2LKSA 4RM2A 2Y48A 4WIBA 3W3CA 1QZZA 1D0XA 2JTVA 2UXNA 4RAFA 1B9MA 3BR0A 3CCJI 3CJTB 4MNUA 5H2FC 2W24A 4GDFA 3M9AA 1GXQA 3ABUA 2D1HA 3EYYA 2HR3A 3LSTA 4S04A 2XSDC 1S6LA 2IT0A 1U8BA 3PUBA 4BY7J 3CUQC 3PFYA 2ELJA 5D19A 5JHUA 2DG8A 2VBZA 2COMA 3U21A 2M5WA 5KNLA 2IBDA 2CUZA 3KE2A 4XRSG 3BY6A 4YFKF 2FBQA 4WXCA 3S2HJ 1ZLJA 2MABA 4MK6A 3S5RA 1IV8A 2WBMA 4KIGA 2HNHA 1YW7A 1EH6A 4HBLA 3SQNA 3LSKA 4A3KJ 3F0CA 2LVSA 3ZN0A 3S14J 4NB5A 3EDPA 2CJJA 2LKXA 3JAMK 3G3ZA 3KEOA 3MMYB 3P9TA 1P2FA 2YX7A 2L9SA 5EEGA 2DOEA 2M7BA 1JKPC 2DODA 1B1BA 2XB0X 3BR1A 2W53A 3MCZA 5HBUA 3CC4I 2VXZA 3OYHA 1YG2A 3O60A 3IH3A 4JX4A 3BWGA 2M4KA 4UUVA 2LF8A 2NX4A 2VLAA 5IYBJ 4A5MA 1R4MB 3T0YA 4QIWN 5L3EA 2UXUA 4OIRF 2FJ1A 2IS6A 3K9TA 5IOZA 3BTJA 3F1BA 1ZGAA 1YO5C 3E3VA 1QVTA 4ZDLA 2ZXWH 5EG0B 3SFZA 2DAOA 3ABKH 1H8AC 3W6KB 1TW3A 2PBIA 2ETHA 2N8GA 5HS8A 4G8XA 2P4WA 4AIJA 3A02A 2BY1A 1AKHA 4A3GJ 1RUOA 1BR1A 2ECBA 4OIPF 3I9V2 1OQYA 2DMTA 1IRXA 2OD5A 1Y39A 3HOUJ 1C0WA 1JT0A 1ZREA 2BVMA 1OCCH 3E5QA 4HKUA 4D7NA 5D4SA 1W1WE 2OQRA 2YPRA 5FRMA 5LHHA 4Z6YA 4IHTA 4RA2A 4BE1A 5CYVA 2Z9OA 2C6YA 3OYMA 4E70A 1XX5A 3KIOA 1T98A 2EINH 2E34A 3GXOA 3L7WA 1R1TA 3TBIA 4KN7X 1Z3YA 1HKSA 2RC4A 2A5YB 2ZXHA 2P5LC 4FTHA 2KISA 1U9NA 4XSZF 1W5CC 3OL4A 4BUPA 3DBHB 1VI0A 2XAUA 4PK4A 2CQXA 2EZIA 2HXIA 2MBFA 9ANTA 4JKZA 2P5VA 3ERMA 3AL0C 3FXUA 1HDPA 3Q3SA 2CH0A 1IXSB 4DBQA 3GX4X 2VUMJ 1ZAOA 3JRGA 1IG7A 1FBSA 2R7XA 2R7VA 1W7PB 3HGGA 3W2VA 5CXIA 4B09A 3OYDA 2NNNA 1FT9A 3V7SA 2ZFWA 1EV7A 5FLMJ 3PFIA 3T8TA 2B0LA 2O61A 5J47A 4CXFA 4IF4A 3FRQA 1Q1HA 3Q0UA 1LVAA 4L5EA 2NVUB 5LLQA 2OQGA 3FX3A 4YEJA 2ADUA 5JI6A 4C30A 5TISC 2NXNB 4IKFA 4U9LA 1VZ0A 2EIMH 4IXAA 3U1KA 4E7SA 2QA4I 5L3GA 4L62A 2KPMA 3EGQA 3VUQA 2K9NA 2BOLA 5DYMA 2LKPA 5J1UA 5CVIA 4D7MA 2OA4A 3F72A 5JLWA 1HF0A 5EJCA 3S3MA 1MSFC 3E0JB 4LIUA 3CMMA 3HE0A 4RM3A 3DEWA 2V57A 3BG5A 3HJEA 1G6NA 1LE8A 2ISZA 3L9FA 4ZDOA 1VQLI 3PNYA 1OKRA 3DKYA 2XASA 4EMSA 4BE0A 4CYCB 4LG3A 2JVHA 1TQMA 2KIFA 4MQVA 2CQQA 4RBOA 3SDBA 2ZMEB 4A3DJ 1UAAA 3F23A 3J80Z 2HQNA 1XGSA 4RB2C 1PYVA 3PUFA 5FMPA 2H6CA 3CDIA 2JA8J 4I99C 1WJAA 4A5NA 2F5VA 4GYIA 2BV6A 2XAGA 4XKCA 4OWRB 3I4PA 3ZQLA 1RUNA 2CV2A 2LG4A 1TBXA 3ABMH 4Y33A 3KLNA 4PSXA 3VVXA 3K4BA 2JPCA 2E71A 3HHHA 4L5JA 1JTYA 3HEFA 3E6CC 1VNDA 4ANJA 5AONA 4I09A
chains in the Genus database with same CATH topology
4NDLA 1IJWC 3S1NJ 3UKGA 1HLVA 2OPTA 1FJLA 2G3BA 2Y31A 2VI6A 4IEJA 3JRBA 1FEXA 1NK3P 2D5VA 2AO9A 2PBXA 3ANGA 1RKWA 3PO3J 1RKTA 3RQIA 1U9OA 1TC3C 5E3OA 1WPKA 4XICA 4ABZA 3S1RJ 5FGLA 3V78A 3SFIA 3KZ9A 2L0KA 3HTAA 2QF7A 2LTPA 3QPLA 1PUFB 5E3NA 5D1RA 2RHAA 2XRLA 1OCTC 4J19A 4M3EA 5EZHA 5M5WJ 1OFCX 3BTIA 2M0CA 1OCPA 5F0FA 2X48A 2ZOZA 2DA1A 4BKXA 2NVQJ 2DN0A 1ZQ3P 3EUPA 3E7QA 4NELA 1WI3A 1A6IA 1LFUP 2E19A 3HM5A 3SDGA 1Y1VJ 2COBA 2Y9ZA 3S15J 5CXGA 3HOZJ 3BR3A 1JUSA 2DA3A 2ME0A 4CGRA 2K9QA 4G12A 1AHDP 3KNWA 4QSHA 3BCGA 3VIBA 1X2MA 3RZDJ 2EZKA 2L7ZA 2YVHA 4GFKA 3BJBA 3AQSA 1GVDA 1W0TA 2DJNA 2RASA 2WGBA 1E3OC 3NI7A 2E2JJ 2M34A 4A3EJ 2ZCNA 1APLC 1QPIA 4Y7NJ 4AC6A 4S0HB 1JTXA 3W6VA 1UI5A 2QOPA 1IRZA 3HB9A 2LFBA 2XDNA 2DA7A 4JYKA 4B4CA 3GTKJ 3NARA 2JMWA 2LK2A 5C3EJ 1GV5A 2DA4A 1JJ6C 2JA5J 4A69C 4B1RA 3ZQFA 4M3BA 5F27A 4A3FJ 1QRYA 3TW7A 1I50J 3BNIA 1X2NA 2DA6A 2AHQA 1R9TJ 1XG1A 2WUIA 2EQRA 1Y1WJ 3QBMA 3VVYA 1K61A 1RETA 5DTDA 3JRCA 2R5YA 1FTTA 4A3CJ 5K58A 4DYRA 2UXIA 1RESA 2Y30A 4EEFG 4X6AJ 3TP3A 3BR2A 2OI8A 4QTRA 1Q1VA 3BTCA 2L9RA 2E2IJ 5EZGA 1MH4A 4FISA 3A01A 3LJLA 4JL3A 5HODA 3BQZA 4MXMA 2ECCA 1ETVA 2QCOA 3HTIA 1WGXA 3S1QJ 1IDYA 1JKOC 5M5YJ 4GCTA 1HDDC 4MLOA 1A5JA 5CW8A 2Q24A 3OOUA 4FE7A 4A93J 2ZCXA 4ACIA 4C3HJ 4M6VA 4W1UA 2R5YB 1BW6A 2OF7A 2XGEA 5IPAA 3DCFA 1B72A 2UXOA 1Z77A 4DYCA 4I6ZA 1BA5A 2L7FP 2QWTA 1XC5A 3LOCA 3OSGA 4W97A 4GCLA 3RZOJ 3E7LA 3S16J 2UXPA 2YVEA 3A01B 2O9LA 3TW6A 3GTJJ 2JN6A 3C2BA 3CDLA 2O7OA 5J1RA 4PXIA 1NTCA 5K7FA 2HYTA 2PMZN 2EZLA 1ZGWA 1TWAJ 2G0EA 3VW2A 2KT0A 1WCMJ 5IYDJ 3FIWA 1ETYA 4C3JJ 1I6HJ 3FISA 4IHXA 3B6CA 3LSRA 2KDZA 3G7RA 5C4JJ 5M3MJ 2H1KA 3PPBA 2IAIA 1DU6A 3VOXA 5K7HA 3O8GA 2JJ7A 3VP5A 1B72B 4B3AA 5M5XJ 2GLOA 3CJDA 3O8HA 3BT9A 4XK4A 1ZR4A 2O8KA 3NPIA 2XPUA 4AUXA 1IC8A 2L7MP 2IU5A 1ORKA 3BG9A 1ZK8A 1B8IA 3S1MJ 2NP5A 1X58A 1MBFA 1JUMA 3ZOBA 1XS9A 1TWHJ 3C07A 3HBLA 1GUUA 3V6GA 1JT6A 3NAUA 3GEUA 4AF5A 5DS9A 1UMQA 3IH4A 2Y0SN 4ME9A 5EFYA 3JR9A 1JKQC 2H8RA 5J1YA 3T6NA 3GTLJ 2CUEA 1Z0XA 3ZQHA 2E2HJ 1ZTRA 2EH3A 1FIAA 5IOYA 3NXCA 2LLKA 2QTQA 3CRJA 4IHWA 2E1OA 2HKUA 2R5ZA 1TWFJ 4BXXJ 4JX5A 1ETWA 1F36A 2K40A 3HGYA 4BY1J 5F0CA 2VPRA 1RR7A 2HDDA 5GPAA 3HOXJ 4DW6A 3MKLA 1B8IB 5AQCA 5M3FJ 4AC0A 4FCYA 1D5YA 2R7ZJ 5FKMA 2HQ5A 3NRGA 1BJZA 3MVPA 3TEDA 5F0HA 2ZB9A 2M8GX 5GP9A 4BBSJ 3S17J 4A3JJ 3LSJA 1MBEA 1ETKA 2F07A 4C3IJ 1BL0A 2PZ9A 2JK3A 2X6OA 5IP7J 1LFBA 1ETOA 1JGGA 2GUHA 2NP3A 5FHPA 3VW1A 5HSZA 3FK7A 4UDSA 2VKEA 1RPWA 1MBKA 5EGOA 1ZR2A 3LSGA 2JWTA 3G1MA 5IYCJ 1SFOJ 5FKOA 2XB5A 3ON2A 4MO7A 2R5ZB 1W0UA 2Y9YA 5EYRA 3QPSA 2GBYA 1JJ8C 4D5CA 4NN1A 2ID3A 1OJLA 2M2EA 2DMQA 4JNNA 2WAQN 2CUFA 4FE4A 2TRTA 5EF6A 1T56A 1P7IA 1I3QJ 2YU9J 1IGNA 5K7ZA 3MNLA 3HOVJ 3HTJA 1SANA 1K83J 4M3FA 5C44J 2ID6A 3CMYA 5EGOB 4UUSA 4X1EA 2HOTA 3LNQA 2NVYJ 5BNGA 4HNVA 3A03A 4GFLA 5FKLA 2XGCA 3QQAA 5IP6A 3OSFA 3IH2A 3CCYA 2YUSA 1MNMC 3BRUA 3BR0A 3NNRA 2EZHA 1H88C 1MSEC 4MIMA 1JKRC 3HOYJ 5EDNA 3MN2A 1UHSA 3AQTA 3HTHA 2HXOA 4KWAA 2HYJA 1MBHA 2XSDC 1DU0A 5EEAA 4IHYA 3M4OJ 1SGMA 4UUTA 3GTPJ 1U8BA 4BY7J 5D19A 3TP0A 1P7JA 5F08A 2DG8A 1MH3A 1MBGA 3PASA 1T33A 4M3GA 4AYBN 2IBDA 4XRSG 2FBQA 4UUSB 1POGA 5E3MA 3S2HJ 4DZJA 5FLVA 2NOGA 4MK6A 4V2FA 3S5RA 2NVXJ 3Q0VA 3BQYA 1MBJA 4YZEA 4A3IJ 1TWGJ 2X9DA 2DMUA 2MG4A 2Y2ZA 1GT0C 3H3VK 3JRFA 3FK6A 4A3KJ 3RH2A 3F0CA 2LVSA 3S14J 2NVTJ 4JX6A 5E3LA 3ZQIA 2CJJA 5EG0A 2LKXA 2FQ4A 3P9TA 3BG3A 3JRDA 1JKPC 3K2AA 3G1OA 2JA7J 2DA2A 2XB0X 3BR1A 2IEKA 2W53A 2P81A 2ZOYA 3LWJA 5HBUA 3HKZN 3L1PA 3FKIJ 3O60A 1ETXA 4JX4A 3IH3A 4I76A 1UG2A 4M3DA 5FKNA 1U78A 2NS8A 1BW5A 2NX4A 5IYBJ 4QIWN 2UXHA 5F1JA 1H89C 2DMNA 2UXUA 2FJ1A 5IOZA 3BTJA 2GENA 3F1BA 4D5FA 3CQZJ 2DMPA 2CRGA 1ITYA 1QVTA 4XIDA 3VOKA 5EG0B 1H8AC 4Y52J 3GTMJ 5H9TA 3ON4A 4MFDA 3G1LA 4C2MJ 3K7AJ 2N8GA 3PO2J 3IUVA 3HIMA 5JLXA 1FTZA 3A02A 2CU7A 2R93J 3D1NI 3GTOJ 3BTLA 2MSYA 5HAWA 2I10A 2FX0A 1AKHA 3M3YJ 4MFEA 2R92J 4A3GJ 1CQTA 2OERA 2WB1N 2M9HA 3PM1A 2ECBA 2G7SA 4A3BJ 2XPVA 2DMTA 3HOUJ 4BBRJ 3ANPA 4IHVA 1NK2P 1JT0A 5IP9J 4HKUA 3CWRA 4A3MJ 4D7NA 3KKDA 2GFNA 2O7TA 3H0GJ 4LOCA 3DPJA 4GCKA 3VPRA 1S7EA 2HOAA 2REKA 2EBIA 2D6YA 3S2DJ 5J3LA 2HI3A 2LD5A 2QIBA 2K9SA 4DYQA 1TWCJ 1WH5A 2DG7A 2G7GA 4FTHA 1QVUA 1U9NA 4XRMA 4A3LJ 1F43A 2ZCMA 3G56A 5GPCA 1VI0A 1AKHB 1ENHA 2CQXA 2EZIA 3JRAA 2HXIA 9ANTA 3GZIA 3KKCA 4JKZA 1FIPA 1HDPA 3Q3SA 2G7LA 3COLA 2LP0A 2TCTA 2VUMJ 2LY9A 3JRGA 4RDUA 1IG7A 2VKVA 3WHBA 3SJMA 3HGGA 5CXIA 4DZPA 2XPWA 2JA6J 1UI6A 5DAJA 2DTZA 2XGDA 2ELKA 5FLMJ 5FJ8J 3GBGA 3RKQA 3FRQA 3B81A 3Q0UA 4XRSA 4CYCA 4L5EA 3ZQGA 3QKXA 2LR8A 3IV5A 2NS7A 3Q0WA 3OIOA 2FD5A 4L62A 3GTGJ 3EGQA 3VUQA 2K9NA 1EF4A 5J1UA 4D7MA 3LHQA 3HDDA 5JLWA 1HF0A 1YRNA 2B63J 1MSFC 5F04A 3HOWJ 1VF9A 1AU7A 2MGQA 3HE0A 3DEWA 3JRHA 1G2HA 3RD3A 3ZQCA 1IDZA 3BG5A 2V57A 1LE8A 3B6AA 1WH7A 2RAEA 3JREA 1O4XA 3BR6A 4CYCB 2CQQA 4RBOA 3LSPA 3I4MJ 5C4XJ 2MW8A 2ME6A 3JRIA 4A3DJ 1HCRA 3VW0A 4V2GA 1GDTA 4GFBA 2YS9A 3JSJA 4JP0A 5FMPA 1GV2A 1HOMA 1IUFA 1YRNB 3I4NJ 3BHQA 2JA8J 3BR5A 1VFCA 3WHCA 2GM4A 3GTQJ 3ZQLA 1ETQA 1LE8B 2QKOA 2WV1A 5D18A 3VVZA 1JUPA 2W48A 3VVXA 1PUFA 2R0QC 1JTYA 5C4YA 1ZKGA 1IV6A 3HEFA 1VNDA 5FKKA 4ICHA 2HOSA 2DA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NDL A;  1IJW C;  3S1N J;  3UKG A;  1HLV A;  2OPT A;  1FJL A;  2G3B A;  2Y31 A;  2VI6 A;  4IEJ A;  3JRB A;  1FEX A;  1NK3 P;  2D5V A;  2AO9 A;  2PBX A;  3ANG A;  1RKW A;  3PO3 J;  1RKT A;  3RQI A;  1U9O A;  1TC3 C;  5E3O A;  1WPK A;  4XIC A;  4ABZ A;  3S1R J;  5FGL A;  3V78 A;  3SFI A;  3KZ9 A;  2L0K A;  3HTA A;  2QF7 A;  2LTP A;  3QPL A;  1PUF B;  5E3N A;  5D1R A;  2RHA A;  2XRL A;  1OCT C;  4J19 A;  4M3E A;  5EZH A;  5M5W J;  1OFC X;  3BTI A;  2M0C A;  1OCP A;  5F0F A;  2X48 A;  2ZOZ A;  2DA1 A;  4BKX A;  2NVQ J;  2DN0 A;  1ZQ3 P;  3EUP A;  3E7Q A;  4NEL A;  1WI3 A;  1A6I A;  1LFU P;  2E19 A;  3HM5 A;  3SDG A;  1Y1V J;  2COB A;  2Y9Z A;  3S15 J;  5CXG A;  3HOZ J;  3BR3 A;  1JUS A;  2DA3 A;  2ME0 A;  4CGR A;  2K9Q A;  4G12 A;  1AHD P;  3KNW A;  4QSH A;  3BCG A;  3VIB A;  1X2M A;  3RZD J;  2EZK A;  2L7Z A;  2YVH A;  4GFK A;  3BJB A;  3AQS A;  1GVD A;  1W0T A;  2DJN A;  2RAS A;  2WGB A;  1E3O C;  3NI7 A;  2E2J J;  2M34 A;  4A3E J;  2ZCN A;  1APL C;  1QPI A;  4Y7N J;  4AC6 A;  4S0H B;  1JTX A;  3W6V A;  1UI5 A;  2QOP A;  1IRZ A;  3HB9 A;  2LFB A;  2XDN A;  2DA7 A;  4JYK A;  4B4C A;  3GTK J;  3NAR A;  2JMW A;  2LK2 A;  5C3E J;  1GV5 A;  2DA4 A;  1JJ6 C;  2JA5 J;  4A69 C;  4B1R A;  3ZQF A;  4M3B A;  5F27 A;  4A3F J;  1QRY A;  3TW7 A;  1I50 J;  3BNI A;  1X2N A;  2DA6 A;  2AHQ A;  1R9T J;  1XG1 A;  2WUI A;  2EQR A;  1Y1W J;  3QBM A;  3VVY A;  1K61 A;  1RET A;  5DTD A;  3JRC A;  2R5Y A;  1FTT A;  4A3C J;  5K58 A;  4DYR A;  2UXI A;  1RES A;  2Y30 A;  4EEF G;  4X6A J;  3TP3 A;  3BR2 A;  2OI8 A;  4QTR A;  1Q1V A;  3BTC A;  2L9R A;  2E2I J;  5EZG A;  1MH4 A;  4FIS A;  3A01 A;  3LJL A;  4JL3 A;  5HOD A;  3BQZ A;  4MXM A;  2ECC A;  1ETV A;  2QCO A;  3HTI A;  1WGX A;  3S1Q J;  1IDY A;  1JKO C;  5M5Y J;  4GCT A;  1HDD C;  4MLO A;  1A5J A;  5CW8 A;  2Q24 A;  3OOU A;  4FE7 A;  4A93 J;  2ZCX A;  4ACI A;  4C3H J;  4M6V A;  4W1U A;  2R5Y B;  1BW6 A;  2OF7 A;  2XGE A;  5IPA A;  3DCF A;  1B72 A;  2UXO A;  1Z77 A;  4DYC A;  4I6Z A;  1BA5 A;  2L7F P;  2QWT A;  1XC5 A;  3LOC A;  3OSG A;  4W97 A;  4GCL A;  3RZO J;  3E7L A;  3S16 J;  2UXP A;  2YVE A;  3A01 B;  2O9L A;  3TW6 A;  3GTJ J;  2JN6 A;  3C2B A;  3CDL A;  2O7O A;  5J1R A;  4PXI A;  1NTC A;  5K7F A;  2HYT A;  2PMZ N;  2EZL A;  1ZGW A;  1TWA J;  2G0E A;  3VW2 A;  2KT0 A;  1WCM J;  5IYD J;  3FIW A;  1ETY A;  4C3J J;  1I6H J;  3FIS A;  4IHX A;  3B6C A;  3LSR A;  2KDZ A;  3G7R A;  5C4J J;  5M3M J;  2H1K A;  3PPB A;  2IAI A;  1DU6 A;  3VOX A;  5K7H A;  3O8G A;  2JJ7 A;  3VP5 A;  1B72 B;  4B3A A;  5M5X J;  2GLO A;  3CJD A;  3O8H A;  3BT9 A;  4XK4 A;  1ZR4 A;  2O8K A;  3NPI A;  2XPU A;  4AUX A;  1IC8 A;  2L7M P;  2IU5 A;  1ORK A;  3BG9 A;  1ZK8 A;  1B8I A;  3S1M J;  2NP5 A;  1X58 A;  1MBF A;  1JUM A;  3ZOB A;  1XS9 A;  1TWH J;  3C07 A;  3HBL A;  1GUU A;  3V6G A;  1JT6 A;  3NAU A;  3GEU A;  4AF5 A;  5DS9 A;  1UMQ A;  3IH4 A;  2Y0S N;  4ME9 A;  5EFY A;  3JR9 A;  1JKQ C;  2H8R A;  5J1Y A;  3T6N A;  3GTL J;  2CUE A;  1Z0X A;  3ZQH A;  2E2H J;  1ZTR A;  2EH3 A;  1FIA A;  5IOY A;  3NXC A;  2LLK A;  2QTQ A;  3CRJ A;  4IHW A;  2E1O A;  2HKU A;  2R5Z A;  1TWF J;  4BXX J;  4JX5 A;  1ETW A;  1F36 A;  2K40 A;  3HGY A;  4BY1 J;  5F0C A;  2VPR A;  1RR7 A;  2HDD A;  5GPA A;  3HOX J;  4DW6 A;  3MKL A;  1B8I B;  5AQC A;  5M3F J;  4AC0 A;  4FCY A;  1D5Y A;  2R7Z J;  5FKM A;  2HQ5 A;  3NRG A;  1BJZ A;  3MVP A;  3TED A;  5F0H A;  2ZB9 A;  2M8G X;  5GP9 A;  4BBS J;  3S17 J;  4A3J J;  3LSJ A;  1MBE A;  1ETK A;  2F07 A;  4C3I J;  1BL0 A;  2PZ9 A;  2JK3 A;  2X6O A;  5IP7 J;  1LFB A;  1ETO A;  1JGG A;  2GUH A;  2NP3 A;  5FHP A;  3VW1 A;  5HSZ A;  3FK7 A;  4UDS A;  2VKE A;  1RPW A;  1MBK A;  5EGO A;  1ZR2 A;  3LSG A;  2JWT A;  3G1M A;  5IYC J;  1SFO J;  5FKO A;  2XB5 A;  3ON2 A;  4MO7 A;  2R5Z B;  1W0U A;  2Y9Y A;  5EYR A;  3QPS A;  2GBY A;  1JJ8 C;  4D5C A;  4NN1 A;  2ID3 A;  1OJL A;  2M2E A;  2DMQ A;  4JNN A;  2WAQ N;  2CUF A;  4FE4 A;  2TRT A;  5EF6 A;  1T56 A;  1P7I A;  1I3Q J;  2YU9 J;  1IGN A;  5K7Z A;  3MNL A;  3HOV J;  3HTJ A;  1SAN A;  1K83 J;  4M3F A;  5C44 J;  2ID6 A;  3CMY A;  5EGO B;  4UUS A;  4X1E A;  2HOT A;  3LNQ A;  2NVY J;  5BNG A;  4HNV A;  3A03 A;  4GFL A;  5FKL A;  2XGC A;  3QQA A;  5IP6 A;  3OSF A;  3IH2 A;  3CCY A;  2YUS A;  1MNM C;  3BRU A;  3BR0 A;  3NNR A;  2EZH A;  1H88 C;  1MSE C;  4MIM A;  1JKR C;  3HOY J;  5EDN A;  3MN2 A;  1UHS A;  3AQT A;  3HTH A;  2HXO A;  4KWA A;  2HYJ A;  1MBH A;  2XSD C;  1DU0 A;  5EEA A;  4IHY A;  3M4O J;  1SGM A;  4UUT A;  3GTP J;  1U8B A;  4BY7 J;  5D19 A;  3TP0 A;  1P7J A;  5F08 A;  2DG8 A;  1MH3 A;  1MBG A;  3PAS A;  1T33 A;  4M3G A;  4AYB N;  2IBD A;  4XRS G;  2FBQ A;  4UUS B;  1POG A;  5E3M A;  3S2H J;  4DZJ A;  5FLV A;  2NOG A;  4MK6 A;  4V2F A;  3S5R A;  2NVX J;  3Q0V A;  3BQY A;  1MBJ A;  4YZE A;  4A3I J;  1TWG J;  2X9D A;  2DMU A;  2MG4 A;  2Y2Z A;  1GT0 C;  3H3V K;  3JRF A;  3FK6 A;  4A3K J;  3RH2 A;  3F0C A;  2LVS A;  3S14 J;  2NVT J;  4JX6 A;  5E3L A;  3ZQI A;  2CJJ A;  5EG0 A;  2LKX A;  2FQ4 A;  3P9T A;  3BG3 A;  3JRD A;  1JKP C;  3K2A A;  3G1O A;  2JA7 J;  2DA2 A;  2XB0 X;  3BR1 A;  2IEK A;  2W53 A;  2P81 A;  2ZOY A;  3LWJ A;  5HBU A;  3HKZ N;  3L1P A;  3FKI J;  3O60 A;  1ETX A;  4JX4 A;  3IH3 A;  4I76 A;  1UG2 A;  4M3D A;  5FKN A;  1U78 A;  2NS8 A;  1BW5 A;  2NX4 A;  5IYB J;  4QIW N;  2UXH A;  5F1J A;  1H89 C;  2DMN A;  2UXU A;  2FJ1 A;  5IOZ A;  3BTJ A;  2GEN A;  3F1B A;  4D5F A;  3CQZ J;  2DMP A;  2CRG A;  1ITY A;  1QVT A;  4XID A;  3VOK A;  5EG0 B;  1H8A C;  4Y52 J;  3GTM J;  5H9T A;  3ON4 A;  4MFD A;  3G1L A;  4C2M J;  3K7A J;  2N8G A;  3PO2 J;  3IUV A;  3HIM A;  5JLX A;  1FTZ A;  3A02 A;  2CU7 A;  2R93 J;  3D1N I;  3GTO J;  3BTL A;  2MSY A;  5HAW A;  2I10 A;  2FX0 A;  1AKH A;  3M3Y J;  4MFE A;  2R92 J;  4A3G J;  1CQT A;  2OER A;  2WB1 N;  2M9H A;  3PM1 A;  2ECB A;  2G7S A;  4A3B J;  2XPV A;  2DMT A;  3HOU J;  4BBR J;  3ANP A;  4IHV A;  1NK2 P;  1JT0 A;  5IP9 J;  4HKU A;  3CWR A;  4A3M J;  4D7N A;  3KKD A;  2GFN A;  2O7T A;  3H0G J;  4LOC A;  3DPJ A;  4GCK A;  3VPR A;  1S7E A;  2HOA A;  2REK A;  2EBI A;  2D6Y A;  3S2D J;  5J3L A;  2HI3 A;  2LD5 A;  2QIB A;  2K9S A;  4DYQ A;  1TWC J;  1WH5 A;  2DG7 A;  2G7G A;  4FTH A;  1QVU A;  1U9N A;  4XRM A;  4A3L J;  1F43 A;  2ZCM A;  3G56 A;  5GPC A;  1VI0 A;  1AKH B;  1ENH A;  2CQX A;  2EZI A;  3JRA A;  2HXI A;  9ANT A;  3GZI A;  3KKC A;  4JKZ A;  1FIP A;  1HDP A;  3Q3S A;  2G7L A;  3COL A;  2LP0 A;  2TCT A;  2VUM J;  2LY9 A;  3JRG A;  4RDU A;  1IG7 A;  2VKV A;  3WHB A;  3SJM A;  3HGG A;  5CXI A;  4DZP A;  2XPW A;  2JA6 J;  1UI6 A;  5DAJ A;  2DTZ A;  2XGD A;  2ELK A;  5FLM J;  5FJ8 J;  3GBG A;  3RKQ A;  3FRQ A;  3B81 A;  3Q0U A;  4XRS A;  4CYC A;  4L5E A;  3ZQG A;  3QKX A;  2LR8 A;  3IV5 A;  2NS7 A;  3Q0W A;  3OIO A;  2FD5 A;  4L62 A;  3GTG J;  3EGQ A;  3VUQ A;  2K9N A;  1EF4 A;  5J1U A;  4D7M A;  3LHQ A;  3HDD A;  5JLW A;  1HF0 A;  1YRN A;  2B63 J;  1MSF C;  5F04 A;  3HOW J;  1VF9 A;  1AU7 A;  2MGQ A;  3HE0 A;  3DEW A;  3JRH A;  1G2H A;  3RD3 A;  3ZQC A;  1IDZ A;  3BG5 A;  2V57 A;  1LE8 A;  3B6A A;  1WH7 A;  2RAE A;  3JRE A;  1O4X A;  3BR6 A;  4CYC B;  2CQQ A;  4RBO A;  3LSP A;  3I4M J;  5C4X J;  2MW8 A;  2ME6 A;  3JRI A;  4A3D J;  1HCR A;  3VW0 A;  4V2G A;  1GDT A;  4GFB A;  2YS9 A;  3JSJ A;  4JP0 A;  5FMP A;  1GV2 A;  1HOM A;  1IUF A;  1YRN B;  3I4N J;  3BHQ A;  2JA8 J;  3BR5 A;  1VFC A;  3WHC A;  2GM4 A;  3GTQ J;  3ZQL A;  1ETQ A;  1LE8 B;  2QKO A;  2WV1 A;  5D18 A;  3VVZ A;  1JUP A;  2W48 A;  3VVX A;  1PUF A;  2R0Q C;  1JTY A;  5C4Y A;  1ZKG A;  1IV6 A;  3HEF A;  1VND A;  5FKK A;  4ICH A;  2HOS A;  2DA5 A; 
#chains in the Genus database with same CATH topology
 1IJW C;  3S1N J;  1BIA A;  1HLV A;  2Y31 A;  2QM3 A;  3CTA A;  3JRB A;  2CFX A;  4OAZ A;  3MZH A;  4RB1 A;  2DPU A;  1WI9 A;  1DP7 P;  3I71 A;  3ANG A;  5AIP A;  3P9I A;  1V5E A;  5LHG A;  2R7T A;  3RQI A;  3WTW C;  4HF1 A;  3WE3 A;  1VQO I;  1SD6 A;  2L02 A;  5ERI A;  2DYS H;  3S1R J;  2UV1 A;  4G7H F;  3GLL A;  1PJR A;  4BEH A;  1R22 A;  3QYE A;  4J01 A;  1WJB A;  2XRL A;  3LFU A;  3SZT A;  2DOA A;  4M72 A;  5FB2 A;  3MD2 A;  2DBB A;  4XQF A;  4M73 A;  3BTI A;  4P1W A;  2ZOZ A;  2DA1 A;  2STW A;  4BKX A;  2DN0 A;  2IP2 A;  2E19 A;  1Y1V J;  2COB A;  4KIF A;  2Y69 H;  2ZCW A;  5CXG A;  4C2U A;  5F1R A;  1TT0 A;  3H5N A;  2K9Q A;  1ODD A;  4BHB A;  4G94 A;  4FX0 A;  5ICC A;  1IAW A;  2EZK A;  2L7Z A;  2YVH A;  4U88 A;  5H20 A;  3H9G A;  3VOE A;  4BDZ A;  2DJN A;  3NI7 A;  2M34 A;  2WC2 A;  2V6C A;  2FNA A;  4Y7N J;  1ON1 A;  1UI5 A;  3I58 A;  1SFX A;  1Y6I A;  2JMW A;  2LK2 A;  5C3E J;  3NS4 A;  1AWC A;  1MMA A;  3F8M A;  3VYS B;  2JA5 J;  3IL2 A;  1QRY A;  1D1C A;  2WAE A;  4XL9 A;  1I50 J;  2WA0 A;  3BNI A;  2FU4 A;  3AAF A;  3CJN A;  4NC6 A;  2EJR A;  3RYP A;  1MND A;  2TDX A;  3QBM A;  1K4T A;  1Y0U A;  1K61 A;  1RET A;  2F4O B;  5DTD A;  4ZZD A;  1D8J A;  4DYR A;  4HZF A;  2Q1Z B;  2GA1 A;  3KPH A;  2Y30 A;  5LRS A;  2Z5U A;  1QNT A;  1RZ4 A;  1WKM A;  4L9N A;  2VKH A;  3I5U A;  3DBL B;  3DQV C;  2XC7 A;  3QOP A;  4YIF A;  3W2A A;  5ILV A;  2L9R A;  1VQ4 I;  3I59 B;  4IRG A;  3BQZ A;  1ETV A;  3DU6 A;  2OUM A;  3N4M A;  3U2R A;  4ENM A;  1H9G A;  1Z21 A;  3NWT A;  3V8K A;  5K5R A;  2AQE A;  3PIO F;  2IGK A;  4FE7 A;  2K85 A;  1AA7 A;  3WU1 B;  2F5D A;  2OF7 A;  5IPA A;  1JI8 A;  2HDW A;  3BRO A;  1Z77 A;  4BQO A;  3OL3 A;  1L3L A;  2M0M A;  4QWQ A;  3LMM A;  4GCL A;  3ZCO A;  3E7L A;  4OD4 A;  2DQR A;  1J7K A;  3GTJ J;  2JN6 A;  3C2B A;  2R7U A;  2HYT A;  3H9Q A;  2EZL A;  2X4H A;  2G0E A;  2UUZ A;  5IYD J;  1ETY A;  3PSF A;  5CQE A;  4B48 A;  3B6C A;  1ON2 A;  5M3M J;  2H1K A;  3PPB A;  2IAI A;  1DU6 A;  4N9H A;  3RYR A;  4CDG A;  3O8G A;  3IRR A;  3K70 D;  5D6E A;  2JJ7 A;  1MGT A;  2FXA A;  3WOD F;  2G9W A;  2JSC A;  2V9P A;  1B72 B;  2GLO A;  5M5X J;  3EYI A;  2PFB A;  1T39 A;  2XPU A;  1HXD A;  3A0H C;  3BG9 A;  2X1D A;  1FP2 A;  2FNP A;  3CC2 I;  3N97 A;  3F8F A;  5E1W A;  2R7D A;  1P4W A;  1JUM A;  3FBN B;  3HBL A;  3J80 K;  3V6G A;  3LSM A;  4HNT A;  4ITV A;  3GEU A;  1X1A A;  2IS2 A;  1QQI A;  5DS9 A;  1UMQ A;  2LMD A;  4ME9 A;  2UWM A;  1J59 A;  1MZB A;  2ZC2 A;  1R5H A;  1YX3 A;  2RVC A;  3CCE I;  3GTL J;  3ZQH A;  3GZ6 A;  1FMV A;  3ZMU A;  2VON A;  3NXC A;  1J9I A;  4OMY A;  3F8C A;  5ICF A;  4BY1 J;  5HLT A;  2OCE A;  1ZYR F;  1CGP A;  4CZC A;  4LFU A;  5AQC A;  5M3F J;  5BMZ A;  3TED A;  2IS1 A;  2ZB9 A;  4BBS J;  1QPM A;  1XMK A;  1D0Y A;  1SD7 A;  2BY2 A;  3C2G A;  4C3I J;  4PFO A;  3BC8 A;  2K3P A;  2ISY A;  3CCU I;  1JGG A;  3X2Q H;  5HSZ A;  1YE9 A;  1K4S A;  2FQ3 A;  1UJ8 A;  2VKE A;  1LB2 A;  4IVN A;  3IHU A;  1JE8 A;  4HF2 A;  2JUC A;  2P5K A;  1X1B A;  4XLH A;  4WCG A;  3Q9S A;  5IYC J;  1FBU A;  5FD6 A;  1S8N A;  1ONV A;  3QPS A;  4LMY A;  2GBY A;  1SMY F;  2A6T A;  3FXQ A;  1JHF A;  1SMT A;  3KP2 A;  4D5C A;  1WHU A;  2M2E A;  1XB4 A;  2DMQ A;  1CF7 A;  2TRT A;  3S32 A;  4PJN A;  1P7I A;  3MNL A;  2EFN A;  2HOE A;  1RI7 A;  1WVR A;  2RGV A;  3CCL I;  4PDK A;  1K83 J;  3HUG A;  1FBQ A;  2P6S A;  2P7C B;  1O57 A;  3FMS A;  4P5O A;  4PJM A;  4AWX B;  4UUS A;  4Q4Z F;  3LNQ A;  1S9H A;  5HDN A;  5TGT A;  3A03 A;  4I01 A;  2V4J C;  5IP6 A;  3IH2 A;  3SZG A;  2YUS A;  2F4I A;  1PDN C;  2PJR B;  3OYE A;  1U2W A;  2DFF A;  2V79 A;  3B73 A;  4B3X A;  2VJ5 A;  2R7R A;  1S3J A;  4MIM A;  3HOY J;  5EDN A;  3AQT A;  4XN3 A;  4L0Y B;  4KWA A;  3LAP A;  1OCZ H;  1MBH A;  1P92 A;  4IHY A;  4UUT A;  3GTP J;  5D8L B;  2O0Y A;  3QYB A;  3TP0 A;  3CCS I;  1P7J A;  4HX4 A;  4ZZL A;  4IO9 F;  2WWY A;  2DYR H;  3PAS A;  3E1S A;  2KRF A;  2YSR A;  5DM6 F;  4M3G A;  1U5T A;  2X1E A;  4P96 A;  4KT5 C;  4C2T A;  4XLN F;  4ENJ A;  1IXR C;  4V2F A;  2WY7 Q;  4LG0 A;  5B5E C;  3Q0V A;  2NVX J;  2X9D A;  1BI1 A;  3H3V K;  5HVQ C;  3JRF A;  5H6R A;  3REO A;  2BZT A;  3HSF A;  3DEE A;  4II3 A;  4HQM A;  4DQ2 A;  2XV4 S;  2PMH A;  3SZP A;  4BDY A;  3CD6 I;  4HV6 A;  3IRQ A;  3W2W A;  3JTG A;  5K5Q A;  2JA7 J;  2DA2 A;  3WGH A;  2IEK A;  1HW2 A;  2ZOY A;  1F1Z A;  2CYY A;  4D0P A;  4JOM A;  3HKZ N;  3F9K A;  3L1P A;  4HLX A;  4BJ6 C;  3FKI J;  3CCM I;  5D5U B;  1ETX A;  3EQL F;  3ONQ A;  1UG2 A;  2ZKZ A;  4D1Q A;  4LJZ F;  3ECO A;  2QBY A;  1D8K A;  2HVQ A;  2UXH A;  2DMN A;  4HDU A;  2OZ6 A;  2CRG A;  3ELK A;  5HNH A;  1ITY A;  1A31 A;  3CUQ A;  3KP6 A;  3FDY A;  3L2Q A;  3BG7 A;  4Y52 J;  1GHC A;  2AQF A;  3E97 A;  3ZMS A;  3PO2 J;  1VQ9 I;  3IUV A;  1OYI A;  3FF5 A;  1YQA A;  3H35 A;  5JLX A;  1FTZ A;  3KP4 A;  2AS5 F;  3LL7 A;  4LLG F;  2MSY A;  2RNG A;  5HAW A;  1D3Y A;  1FC3 A;  4MFE A;  4BQN A;  3OYK A;  1BR2 A;  3PM1 A;  3LQQ A;  4A3B J;  2BXY A;  2XPV A;  4FET A;  4IHV A;  2DW4 A;  2E36 A;  5IP9 J;  5J6X A;  2YU3 A;  1GLN A;  2BYV E;  2BGC A;  3KKD A;  1QHG A;  4YIR X;  3K1P A;  2O7T A;  4LOC A;  3DPJ A;  2QQB A;  4GCK A;  3GF2 A;  3ASN H;  2REK A;  1TP4 A;  3K4K A;  4IHS A;  5J3L A;  4QPO A;  2HI3 A;  4UY8 I;  3HRS A;  2LD5 A;  1J09 A;  1ZH5 A;  3HZJ A;  4F91 B;  2KLO A;  2DG7 A;  3HRM A;  1O3Q A;  4OD5 A;  2G7H A;  2VOP A;  2ZCM A;  4HAM A;  2ZJP F;  4XNF A;  3G56 A;  2L9V A;  3F21 A;  1AKH B;  4CZZ A;  3JRA A;  5AIQ A;  2MLG A;  3VWB A;  2XHK A;  2W7N A;  3EUA A;  1UEL B;  1XSV A;  3M7G A;  1FYL A;  1TZL A;  4EM2 A;  3WE2 A;  1G4D A;  4IRI A;  2LYC A;  5ED4 A;  1T08 B;  1WJE A;  2XKO A;  3J7Y J;  1IRG A;  3COL A;  2V1D A;  2M45 A;  2CG4 A;  3T1B A;  3GLX A;  1UHW A;  4DZP A;  5TRD A;  3CES A;  1BIB A;  2XGD A;  2OBP A;  1YLF A;  1X1D A;  3HKZ A;  5FJ8 J;  3DV8 A;  3GUD A;  4DJA A;  1SAU A;  3RKQ A;  4WXD A;  3B81 A;  2VN2 A;  4BE2 A;  3K4J A;  3ZQG A;  1TNS A;  1LUJ B;  4UXN A;  1EH7 A;  2KFD A;  4PJJ A;  3VSK A;  1R23 A;  1JGS A;  2QSF X;  1XCB A;  5DM7 F;  2E1C A;  5J4V A;  1Z6R A;  1EF4 A;  5KAI C;  5CVJ A;  3RCO A;  2XVC A;  3RTR A;  1NG6 A;  3T8R A;  1YRN A;  1USS A;  2VQH A;  2VJI A;  3GZ5 A;  4NC8 A;  2MC4 A;  4AVP A;  1HKQ A;  1X4O A;  1XTA A;  3KX2 A;  3J7Z I;  4KMF A;  4Q5S F;  3RD3 A;  3ZQC A;  1IDZ A;  3RJP A;  3IP4 B;  3O6B B;  2DXI A;  1W4M A;  3BR6 A;  3L2R A;  3LSP A;  5LEK A;  1DGR M;  2MW8 A;  5BPD A;  3I4M J;  4A6E A;  2ME6 A;  3GEZ A;  4PSW A;  3JRI A;  1I1S A;  2OZU A;  3TO7 A;  3FKJ A;  5HOO A;  3VW0 A;  3TO9 A;  3FXJ A;  4PGG A;  2YS9 A;  5ILS A;  1V4R A;  4DNC A;  3FXK A;  1HOM A;  1IUF A;  2JUG A;  2VQC A;  3BHQ A;  1EKE A;  2CW7 A;  1NH3 A;  1T2K A;  1VFC A;  3S3N A;  1BC7 C;  3GTQ J;  2EIK H;  2R7W A;  3MFK A;  1LKX A;  1MDM A;  4II2 A;  1ETQ A;  3HG9 A;  3ERE D;  2K5C A;  2WV1 A;  4IL6 C;  1LE8 B;  2QKO A;  5D18 A;  1D5V A;  2R0Q C;  1K78 A;  2XRN A;  1FWZ A;  1MKM A;  5E8I A;  4ENK A;  5C4Y A;  3OYG A;  3Q9V A;  1KA8 A;  1IV6 A;  4Q47 A;  4RGU A;  4GCV A;  2HOS A;  2HYG D;  4NDL A;  5FRO A;  2Z2S B;  4BHC A;  2WAQ A;  1R1V A;  3UKG A;  4A0Y A;  3VDX A;  2Z16 A;  2G3B A;  2VI6 A;  3UR3 C;  1KYW A;  4IEJ A;  4DGW B;  1YHQ I;  2V9K A;  2PBX A;  3QRF F;  4XLP F;  4OIN F;  4I7H A;  3EUH C;  1VQ7 I;  1RKT A;  1U9O A;  1A6Q A;  2M7A A;  3KET A;  1YJW I;  4ABZ A;  5GAE J;  3DWL E;  2L0K A;  3QPL A;  1A36 A;  5E3N A;  1MMN A;  4IQ4 A;  2RHA A;  3OYB A;  1LVK A;  1R00 A;  1OCT C;  2Z3Y A;  2MC3 A;  4M6Y A;  4G6T B;  2L5Q A;  2PEX A;  3FXM A;  3HC7 A;  1OCP A;  2X48 A;  1STZ A;  3LWF A;  4IRH A;  1BN5 A;  1BOB A;  1ZQ3 P;  3EUP A;  2Q2E A;  3V8L A;  1XSX A;  4U7D A;  1LFU P;  3SDG A;  1EH8 A;  2PI0 A;  2PJP A;  4AM3 A;  3S15 J;  3V7C A;  4EJV A;  3HOZ J;  4X0G A;  3BR3 A;  2K4B A;  4GXO A;  2WAF A;  3M8J A;  3L2V A;  1W5S A;  4G12 A;  1AHD P;  3OOP A;  3VIB A;  3RZD J;  2LF7 A;  5CVV A;  4UV8 A;  3AG3 H;  4ESB A;  3BJB A;  2VB6 A;  3AQS A;  3BZC A;  3K70 C;  1YIO A;  4NQW A;  2EV6 A;  4G7O F;  3VFZ A;  4ON0 A;  4KIT B;  2WGB A;  3K1N A;  2E2J J;  1IN4 A;  4EJW A;  5HLH A;  4KFC A;  2ZCN A;  1OR7 C;  4AC6 A;  4HEA 2;  4DBR A;  3ISP A;  5HNF A;  4B4C A;  3E6B A;  3OMY A;  3KEQ A;  4KT6 A;  2I5U A;  4HDV A;  1QGP A;  3K10 A;  2V6E A;  3ZQF A;  2E35 A;  4M3B A;  1QU3 A;  3GW2 A;  3TW7 A;  3VYR B;  1YJN I;  1YOV B;  1WJD A;  3FBI B;  1VTN C;  1KQ8 A;  1Z05 A;  2HQA A;  4RMN A;  2VBX A;  2EQR A;  3Q5F A;  3FMQ A;  1QBJ A;  4YG2 F;  2KKO A;  3GFJ A;  2DQL A;  1RES A;  3CLQ A;  3TP3 A;  1I39 A;  2CO5 A;  3BR2 A;  2OI8 A;  4PCQ A;  4RGX A;  2HYF A;  1M1E B;  5HDK A;  2K3F A;  3DP7 A;  4S05 A;  3AG1 H;  3A01 A;  4JL3 A;  4P55 A;  5DV5 A;  5HOD A;  1Z3X A;  1WGX A;  3LSH A;  3WGI A;  4U0W A;  4XR6 A;  3S1Q J;  1IDY A;  3CJQ B;  1P4X A;  4I02 A;  3VEP A;  3IWZ A;  5M5Y J;  1TQI A;  4RB3 C;  5DD4 A;  5CW8 A;  2KL4 A;  2ZFU A;  5LGT A;  5IT9 Z;  3DF8 A;  3QWL A;  4RS8 A;  4ACI A;  1N78 A;  4C3H J;  1H0M A;  4BJT A;  1X4P A;  1FOK A;  4KIS A;  2VE9 A;  3I0T A;  3IKV A;  1B6A A;  2QQ8 A;  2IJL A;  3K8P C;  1MMD A;  2RN7 A;  3D0S A;  3W6J B;  4CA0 A;  4DYC A;  4P9F A;  1BC8 C;  3VB2 A;  2PMU A;  2E1M B;  4Z2Y A;  3WTZ A;  1R4N B;  4W97 A;  2IGN A;  3H36 A;  1IN5 A;  3OYF A;  4B47 A;  4RLQ A;  3IKT A;  3TW6 A;  2DT7 B;  2X85 A;  5J1R A;  1T6S A;  3QYF A;  4BJ5 C;  2FBH A;  2PMZ N;  3HTU A;  3BCB A;  4JQF A;  2BW3 A;  4M71 A;  4MEY F;  3VW2 A;  2FMY A;  2ZNY A;  2KT0 A;  4RGR A;  1G3T A;  1KON A;  2H8W A;  3GCM A;  3QOE A;  1I6H J;  3FIS A;  2GIV A;  3CCR I;  4IHX A;  3G7R A;  5ICE A;  3G2B A;  3G6E I;  2DO7 A;  1Y8R B;  1A04 A;  1T95 A;  4U0V A;  4UVA A;  3H1C A;  1D1A A;  5B3S H;  2Y0M A;  3EPZ A;  1TT5 B;  4R1H A;  2EFO A;  1R5G A;  4L9T A;  3KYD B;  5B1B H;  2ZSH B;  4WK8 F;  4XK4 A;  3CJD A;  3JW4 A;  2IU5 A;  2M8E A;  4CYD A;  5CVU A;  2WY8 Q;  1LPQ A;  1B8I A;  1XPX A;  1X58 A;  2ZSI B;  1YYV A;  1TQP A;  2QQ9 A;  4KUM A;  4N9I A;  1XS9 A;  4C2M A;  3C07 A;  1V55 H;  2XAJ A;  5FLX Z;  3NAU A;  3CCQ I;  4AF5 A;  1HW5 A;  2LY1 A;  4MEX F;  4EGZ A;  4KNY A;  2Y0S N;  2BE5 F;  2YR2 A;  5EFY A;  2H8R A;  2EB7 A;  5J1Y A;  2AXT C;  2EH3 A;  5IOY A;  1FIA A;  1O7L A;  2HU9 A;  3NRV A;  4PUS A;  4XOR A;  2QTQ A;  3CRJ A;  3LA2 A;  3WG7 H;  2MA3 A;  1VQ5 I;  2HKU A;  1WSU A;  2R5Z A;  3VYT B;  3GYH X;  1F36 A;  2GA2 A;  3HGY A;  2VPR A;  2HDD A;  4FT8 A;  4OIO F;  3HOX J;  4L0Z B;  3OY9 A;  5DUI A;  4AU7 A;  2Q8K A;  3MKY B;  4AC0 A;  1D5Y A;  2QVO A;  5FKM A;  4CCO A;  2LNB A;  1BJZ A;  3BP8 A;  5GP9 A;  1U3E M;  5KVR A;  5D5X B;  1ETK A;  3RKX A;  1K79 A;  1BL0 A;  1F4K A;  2PZ9 A;  2JK3 A;  1ETO A;  4XOT A;  2NP3 A;  2HZT A;  3VW1 A;  3ZQQ A;  1RPW A;  1MBK A;  1ZR2 A;  1W5T A;  5LRR A;  3TL4 X;  2CFO A;  2E1N A;  2CMP A;  1YW9 A;  3E6M A;  2FF4 A;  3QOD A;  3ON2 A;  1S7A A;  3O3K A;  2LH9 A;  4A12 A;  2Y9Y A;  2PMZ A;  1K7A A;  4NN1 A;  4XRF A;  2ID3 A;  2H94 A;  1OJL A;  4I2O A;  1B4A A;  3J81 Z;  4JNN A;  2CUF A;  1UCR A;  5EF6 A;  1T56 A;  2E7W A;  2KIM A;  2YU9 J;  4E7I A;  3SEQ A;  1IGN A;  2QKL B;  5A2Q Z;  5K7Z A;  2MFZ A;  3KZY A;  5C44 J;  4UHT A;  2XGX A;  2X51 A;  2ZXI A;  3GFI A;  2JPB A;  4AVZ A;  1MJA A;  2VE8 A;  3OYJ A;  4GFL A;  5FKL A;  2FML A;  2DT6 A;  3CCY A;  2ZJQ F;  2RRE A;  5HLG A;  1MNM C;  3BRU A;  3NNR A;  2EZH A;  2D1V A;  1JKR C;  3MN2 A;  3OYC A;  3HTH A;  2K4J A;  1PP8 F;  2HXO A;  5HLI A;  2A6H F;  3OYL A;  3I55 I;  2KJB A;  3UNG C;  5K5O A;  1UG0 A;  2NS0 A;  4EVI A;  3WG9 A;  5EEA A;  1DU0 A;  3MEX A;  4P9U A;  2DPD A;  1CF7 B;  2Y0S A;  3O2P E;  4BU2 A;  4E7L A;  2E5Z A;  2E7X A;  5BOX A;  3P7N A;  2EA4 A;  1O3T A;  2HEO A;  2JSP A;  2XAF A;  1MBG A;  3NEU A;  4Y4R A;  4AYB N;  3HUG B;  4UUS B;  2M87 A;  2ZO4 A;  5FLV A;  3K0L A;  2CV0 A;  1G3W A;  1X3Z B;  2CSO A;  4E6K G;  2HVS A;  3BQY A;  4A3I J;  1TWG J;  2JRM A;  2XIG A;  4RLF A;  2A69 F;  2DMU A;  2Y2Z A;  3A0B C;  3ZMT A;  1GT0 C;  3NQO A;  1G59 A;  1U8R A;  3FK6 A;  2B3W A;  3RH2 A;  4H4K C;  1R6R A;  4JX6 A;  2NVT J;  2KMU A;  2DCE A;  2KZV A;  1YW8 A;  4M74 A;  3BG3 A;  2F48 A;  3LFK A;  3ZR8 X;  1HC8 A;  3HOS A;  2VPL A;  3HIF A;  1U5T B;  3OIP A;  5KCM A;  2L7K A;  1VQM I;  3JSO A;  3KYC B;  3QKX A;  3HSE A;  1KQ9 A;  1LDK B;  4L18 B;  3LSI A;  2FBK A;  5FKN A;  4LG0 B;  5LEJ A;  5F1J A;  1H89 C;  3BJ6 A;  4KDP A;  4PJL A;  1DPU A;  1K6O A;  2J5O A;  2OV7 A;  4D5F A;  3L00 A;  5DD8 A;  3F8B A;  3I54 A;  4BL0 B;  2BY3 A;  2BBY A;  2IRF G;  2PLY A;  2O3F A;  3L2W A;  3GTM J;  5H9T A;  1ZGJ A;  2DOF A;  3G1L A;  4C2M J;  1XSD A;  3ON4 A;  3IAS 2;  1OLT A;  2F5F A;  2FBI A;  2IW5 A;  2V26 A;  4IX7 A;  4Q48 A;  4FX4 A;  3GTO J;  4BXU A;  1IF1 A;  2DK8 A;  4LD5 A;  1SFK A;  4F93 B;  2R93 J;  3H3U A;  2FX0 A;  3M3Y J;  1X19 A;  3R60 A;  1ZG1 A;  1S72 I;  2R92 J;  1CQT A;  3FHN A;  2WB1 N;  2M9H A;  3F22 A;  2XUB A;  4XLE A;  3E5X A;  4BBR J;  1LJ9 A;  2QBY B;  2PFV A;  3KP7 A;  2ZME C;  5TJJ A;  3RPU A;  1I1G A;  1T0F C;  1OCO H;  3COA C;  4R8H A;  3BZ6 A;  3R0A A;  4KIC A;  3CJR B;  3VPR A;  2HOA A;  2ACJ A;  2EBI A;  4XM3 A;  3CUQ B;  1VQK I;  4L9J A;  3S2D J;  2VT2 A;  2LC2 A;  2LDU A;  2IVM A;  4XOP A;  4C9Y A;  5GTI C;  4DYQ A;  1TWC J;  5FFZ A;  3PNV A;  3SEZ A;  1WH5 A;  1YI2 I;  2A5W A;  2XF7 A;  3I64 A;  2DT5 A;  4XRM A;  1FMW A;  5E1X A;  3BOQ A;  3FM5 A;  5DDG A;  3U9G A;  2CQ7 A;  1ENH A;  2L3D A;  4CSW A;  4YRV A;  3GZI A;  1XD7 A;  2HTJ A;  2KIQ A;  4ZTF A;  4UV9 A;  1FIP A;  1G3S A;  2RV8 A;  3GFL A;  1MIJ A;  4N0B A;  5FLX K;  2LP0 A;  2TCT A;  1R49 A;  4KYW A;  2LY9 A;  2YVX A;  4RDU A;  2L4A A;  1SVO A;  5FGM A;  4GYG A;  2V7F A;  1ZRD A;  1V54 H;  1WJ5 A;  1UI6 A;  5DAJ A;  2DTZ A;  4KN4 X;  3OYI A;  1Z91 A;  3D5S C;  2ELK A;  3A2K A;  3GBG A;  4CIC A;  2W84 A;  3OS1 A;  2NNY A;  4M6X A;  4XRS A;  3KEY A;  3RPQ A;  2LR8 A;  3IV5 A;  3R61 A;  3OIO A;  4ESJ A;  2R7S A;  2K27 A;  3GTG J;  2PN6 A;  2JQ7 A;  5KAF C;  2V1N A;  3JAM Z;  1BM9 A;  2LRD A;  3LHQ A;  1D1B A;  3HDD A;  5J8F A;  1I27 A;  3ZPL A;  2B63 J;  4ZH4 F;  4KA4 A;  5F04 A;  3ABT A;  1VF9 A;  4HOB A;  3OYN A;  3JRH A;  4KMU X;  3CMA I;  2ESN A;  4OU0 A;  2JZY A;  3BG6 A;  2OAZ A;  3CF2 A;  1RRJ A;  3MKZ A;  1ZRC A;  5LHI A;  2M1B A;  4F7Z A;  5K1Y A;  3JRE A;  3ML6 A;  1O4X A;  3BLY A;  4HV5 A;  2WB1 A;  3WGG A;  5BPI A;  1XGN A;  3ABL H;  1G8X A;  2IGO A;  1XDS A;  2QUF A;  3BPV A;  5ICG A;  1HCR A;  3J81 K;  2GAU A;  4F55 A;  1V5G A;  4BH9 A;  3JSJ A;  4EV0 A;  4JP0 A;  3WTS C;  1SFE A;  1R71 A;  2HFH A;  1GV2 A;  2H09 A;  1VQN I;  5A2Q K;  2H6B A;  1YRN B;  3BR5 A;  3PQJ A;  2QEX I;  2EFW A;  1QO0 D;  3IWF A;  4ZYA A;  2ESH A;  3QP6 A;  2HS5 A;  2W25 A;  3BCA A;  1MJB A;  3TOA A;  4F3Q A;  2DFE A;  1T38 A;  1JUP A;  2W48 A;  2W85 A;  3VVZ A;  1PUF A;  5CPR B;  1P6R A;  3H5R A;  1A35 A;  3K4L A;  3U1D A;  1BI2 A;  2F6C A;  3S8P A;  4ICH A;  2DA5 A;  2KIU A;  2P6T A;  2Z33 A;  1FOY A;  2BHZ A;  3DPL C;  4WX9 A;  3VOD A;  1FEX A;  2AO9 A;  2OTL I;  2IS4 A;  1PP7 U;  1LEB A;  2DFH A;  1MDM B;  1TC3 C;  1YIJ I;  4XIC A;  4WWC A;  2LBF A;  4WXH A;  3SFI A;  3TOB A;  3KZ9 A;  2JRT A;  2GOX B;  2LTP A;  1K78 B;  2RQQ A;  1YJ9 I;  1MNE A;  1QHH D;  2NRA C;  2B7E A;  4M3E A;  5EZH A;  3ZXS A;  5CJ9 A;  2M0C A;  1X3W B;  1HST A;  4PGH A;  2NVQ J;  4FAS D;  3K4N A;  4LLL A;  3EUK L;  1Y56 A;  1A6I A;  2NOJ B;  2ZNZ A;  3HM5 A;  3PSI A;  3DPU A;  3FMR A;  4G6D A;  3MAJ A;  3TDZ C;  2CQN A;  1JUS A;  4LLN A;  5F64 A;  4CGR A;  2EV0 A;  1ZEL A;  2DLL A;  1LNW A;  3VYU B;  4QSH A;  5JR3 A;  3TQN A;  5E20 A;  2Q0O A;  2EK5 A;  1KU9 A;  1GVD A;  4Y15 A;  2D45 A;  1FSH A;  5HS7 A;  2GWR A;  2OTJ I;  3QU6 A;  2EIJ H;  1E3O C;  5FD5 A;  3QPH A;  3CUO A;  4Y3O A;  1ZAR A;  3K69 A;  4A3E J;  1APL C;  1QPI A;  1MMG A;  1S7O A;  2KRH A;  2HPI A;  2Q2E B;  3I53 A;  4IJA A;  3EUH A;  2QOP A;  1FPQ A;  1I5Z A;  2LFB A;  2M3A A;  3HB9 A;  1IRZ A;  4JYK A;  4MHG A;  3GTK J;  1E2X A;  3NAR A;  2DA4 A;  1JJ6 C;  1Y0N A;  4Y17 A;  4A69 C;  1EA3 A;  5DCM A;  4B1R A;  3RKW A;  4HRI A;  4A3F J;  2NAZ A;  4LIT A;  2V1U A;  1ZN2 A;  1FYK A;  2DA6 A;  1IN7 A;  3ZQ7 A;  1R9T J;  1XG1 A;  3OWT A;  2WUI A;  4DIQ A;  2R4G A;  1Y1W J;  4M9S A;  3KZI C;  1DQU A;  4NQW B;  4WF2 A;  4B44 A;  5E79 C;  3JRC A;  2R5Y A;  1YTY A;  4A3C J;  5K58 A;  2UXI A;  4EEF G;  2QGU A;  3J7A Y;  4J00 A;  4QTR A;  4O6J A;  2M4G A;  2IA2 A;  2CUJ A;  2UZK A;  4HA8 A;  5DUK A;  5D5W B;  4G9Y A;  5EZG A;  2MD0 A;  4FIS A;  2ICW G;  1T8I A;  1J2X A;  2QCO A;  3BZK A;  3CLO A;  1D0Z A;  2MH2 A;  3H92 A;  2W1O A;  1QZE A;  5L3F A;  1OYY A;  4NHJ A;  4QLC U;  4IOC F;  5B66 C;  2VXD A;  2L4M A;  3PL8 A;  1HDD C;  1A5J A;  4N4N B;  2VC1 A;  4LB6 B;  4E7J A;  2ZCX A;  4U9N A;  1TW2 A;  4W1U A;  3SWH A;  4ETS A;  3OV8 A;  3C1D A;  2XGE A;  1HW1 A;  4NC7 A;  2OU2 A;  1OR7 A;  2R7F A;  2ZJR F;  2LRE A;  3DCF A;  1FNN A;  4I6Z A;  2QWT A;  5E18 F;  3AFH A;  3DU5 A;  1KZH A;  5E17 F;  1BA5 A;  4G7Z F;  1H9T A;  3RKY A;  3K6G A;  3RZO J;  2HVR A;  2UXP A;  2XRO A;  1R58 A;  3A01 B;  3RSN A;  1OMI A;  3ESW B;  2W57 A;  1E3H A;  3CDL A;  2O7O A;  1NTC A;  1EJ9 A;  2XSJ C;  1ZGW A;  1TWA J;  1PVE A;  4RAY A;  3FIW A;  3DBR B;  4XN0 A;  1V5F A;  3CO6 C;  4ZC3 A;  2PG4 A;  3LSR A;  2KDZ A;  3E6D A;  3K2Z A;  4K2E A;  5K7H A;  3QPT A;  3C7J A;  3DTI A;  1W36 D;  3VP5 A;  2OCC H;  2DFI A;  5B1A H;  4I98 B;  3I56 I;  4CUG A;  5DEQ A;  2O8X A;  5L3D A;  3O8H A;  1ZR4 A;  2O8K A;  3NPI A;  5JVG F;  4AUX A;  5F6F A;  2L7M P;  1IC8 A;  4GRI A;  2ZBK A;  4E7K A;  1UB9 A;  5CVR A;  2WAD A;  2XF6 A;  2JA2 A;  3ZOB A;  1TWH J;  4XLC A;  2QWW A;  1GUU A;  1N77 A;  2BW3 B;  3D5R C;  1JT6 A;  2K7L A;  1B59 A;  2PQ8 A;  1Z6T A;  3ASO H;  3IH4 A;  4B8X A;  3JR9 A;  1JKQ C;  3FXR A;  1O3R A;  3K4M A;  3P9C A;  2BXZ A;  3T6N A;  2CUE A;  2FEZ A;  3CCV I;  4EQQ A;  2E2H J;  1ZTR A;  4BAC A;  2PX9 A;  2W4S A;  3H3Z A;  2E1O A;  4ZYH A;  4YFX F;  3HHG A;  1TWF J;  4BXX J;  4UVC A;  1ETW A;  2K40 A;  5HDG A;  2L2O A;  5F0C A;  1RR7 A;  3IAM 2;  5GPA A;  4DW6 A;  3I3L A;  4AD9 A;  1WWX A;  1B8I B;  2Z99 A;  4BEH B;  3NRG A;  3MVP A;  3WTT C;  5F0H A;  2HDC A;  4HQE A;  3S17 J;  1B9N A;  3GZN B;  4A3J J;  1LEA A;  1MBE A;  1XGM A;  3JTH A;  2FUG 2;  4O5V A;  2F07 A;  2X6X A;  4LGW A;  4CCM A;  2X6O A;  4YII A;  3TO6 A;  4NNJ A;  1LFB A;  2ZXJ A;  5IP7 J;  5FHP A;  2F2E A;  5EGO A;  2W82 A;  2JWT A;  1BI3 A;  1KYZ A;  2K9M A;  3KYL A;  1HQC A;  1SVL A;  1XN7 A;  1SFO J;  5FKO A;  4MO7 A;  2R5Z B;  1W0U A;  1RIO H;  2P7V B;  4I0B A;  2RKH A;  3ZMZ A;  4EM0 B;  1UZC A;  1DDN A;  2BVL A;  2EV5 A;  3OYA A;  4FE4 A;  3RI4 A;  3D5L A;  4U0Y A;  3RPU D;  1I3Q J;  1ULY A;  2HZD A;  4MGR A;  1S29 A;  4Y13 A;  3HTJ A;  1SAN A;  3KZZ A;  3OS0 A;  2XAH A;  3CMY A;  4X1E A;  2HOT A;  1LQ1 A;  1PUE E;  3FZV A;  2NVY J;  4RAG A;  4M9Z A;  5EEH A;  2QYO A;  4AIH A;  4ESF A;  4HNV A;  1O3S A;  1P9Q C;  2XGC A;  3C2H A;  3QQA A;  3OSF A;  4LIV A;  5JHF A;  1VQP I;  2R7Q A;  5KK1 A;  1H88 C;  1MSE C;  3K1M A;  1L0O C;  1UHS A;  3DTE A;  1VQ6 I;  5DCF A;  4A0X A;  3KCC A;  2HPM A;  2GQQ A;  2HYJ A;  2F4M B;  4L9V A;  1ZLK A;  4YEL A;  3M4O J;  1SGM A;  2XF5 A;  3HSR A;  4HSR A;  5F08 A;  3F6O A;  1MH3 A;  1J0R A;  1T33 A;  1YFH A;  3RQ4 A;  3GWZ A;  2CWE A;  3AG4 H;  3ZGK A;  1POG A;  4RAZ A;  4MQ9 F;  5E3M A;  4DZJ A;  1XMX A;  1K6Y A;  1OCR H;  2O5R A;  2NOG A;  1FZP B;  2FRH A;  2IPQ X;  4BYY A;  4ZYD A;  1MBJ A;  4YZE A;  1FP1 D;  3AG2 H;  1KU7 A;  1TNT A;  3R4K A;  2MG4 A;  2KDO A;  3WU2 C;  2WTE A;  4CO8 A;  5E1Z B;  1IW7 F;  2CQK A;  5E3L A;  3ZQI A;  5EG0 A;  4CCJ A;  2FQ4 A;  5GAD J;  3AKZ A;  5BS6 A;  4UB6 C;  3JRD A;  1DGW Y;  2STT A;  3K2A A;  5FRN A;  1E0E A;  3G1O A;  1RR8 C;  4ENN A;  3H5A A;  3LWJ A;  2P81 A;  4EGY A;  3HYI A;  1F5T A;  1RC9 A;  4E7H A;  4I76 A;  1U78 A;  1BW5 A;  4M3D A;  2NS8 A;  4A0Z A;  4V19 K;  3PJR A;  4KIB A;  3ROU A;  2HKX A;  2GEN A;  3CQZ J;  3CZ6 A;  2DMP A;  3QAH A;  4XID A;  3VOK A;  2F5C A;  3JSP A;  3LAJ A;  4MFD A;  3K7A J;  3GVA A;  3LQR A;  1MW7 A;  3EET A;  4PJ0 C;  3HIM A;  3G4S I;  3OR2 C;  5GAG J;  1TLH B;  1J75 A;  2CU7 A;  3D1N I;  3BTL A;  4OAY A;  3FM3 A;  2I10 A;  1KU3 A;  4AID A;  2MD5 A;  2VQL A;  3HXL A;  2OER A;  2G7S A;  1V3F A;  1FYM A;  2V1X A;  3ANP A;  1NK2 P;  3CWR A;  4A3M J;  3MQ0 A;  2A2F X;  3CF5 F;  2GFN A;  2OC6 A;  3H0G J;  2A6E F;  4H0E A;  2CW0 F;  3F3X A;  1HKT A;  1SD5 A;  3RDI A;  1S7E A;  1OIS A;  1W7P A;  4LK1 F;  2FOW A;  2D6Y A;  1JXS A;  3V42 A;  5D8K B;  2HGC A;  1BR4 A;  4GGG A;  2H1L A;  1Y8Q B;  2K9L A;  4BQQ A;  2QIB A;  2K9S A;  3HTS B;  3A1Y A;  3QP5 A;  3BJA A;  2G7G A;  1QVU A;  2AXL A;  4HNU A;  4XMY A;  4A3L J;  1F43 A;  2DK5 A;  3C3W A;  1QZY A;  2D2W A;  5GPC A;  5J8C A;  1AOY A;  2RNJ A;  3KKC A;  1WJC A;  3V4G A;  2GIZ A;  4DOZ A;  2BEO A;  4FQG A;  2P0W A;  3A4C A;  4UB8 C;  2QLZ A;  4ZYG A;  1BBY A;  1RNL A;  5CQG A;  4EM1 A;  1BI0 A;  3ZRG A;  1IN6 A;  2G7L A;  5LBQ A;  1BJA A;  2GOM A;  5JVT A;  3OIQ A;  2VKV A;  3WHB A;  3SJM A;  4HG2 A;  2XPW A;  2JA6 J;  1XMA A;  3KLO A;  4AIK A;  2DDA A;  3WU0 A;  2VQG A;  2B9S A;  4BS9 A;  3MZY A;  5GAH J;  3ZN1 A;  4CYC A;  3E5U A;  4MTE A;  2IXS A;  3RIR A;  2E5N A;  2RQP A;  2NS7 A;  2QSH X;  3Q0W A;  1E3P A;  2ZME A;  2FD5 A;  2I8D A;  1T0F A;  3KFW X;  1WZ2 A;  5L3C A;  3ZMD A;  3PIP F;  3ECH A;  4TV7 A;  1LDJ A;  1MMS A;  1YX5 A;  4U87 A;  3HOW J;  4XLF A;  1AU7 A;  1R5I D;  2MGQ A;  1G2H A;  1P4A A;  2GXA A;  1IRF A;  4BQA A;  5H6Q A;  3DTK A;  3B6A A;  1WH7 A;  1WJF A;  2RAE A;  3ZMV A;  3CO7 C;  1HA8 A;  2KP6 A;  2HWV A;  2L9N A;  3S2W A;  4YFN F;  2KJC A;  6PAX A;  1LFP A;  2DDB A;  3MKW B;  5C4X J;  4IRV A;  2ZJ2 A;  4EAT A;  1U0J A;  3R6S A;  1YS7 A;  2X6Y A;  4V2G A;  5FFX A;  2VT3 A;  1GDT A;  4GFB A;  3HRU A;  2HKO A;  3KP3 A;  4QPQ A;  4CGZ A;  1OPC A;  4EJU A;  5D4R A;  3I4N J;  3GFM A;  3DFG A;  4OIQ F;  1SAX A;  3WHC A;  2EWN A;  2GM4 A;  2VC0 A;  1MD0 A;  4F92 B;  3TDU C;  1I3A A;  4RB0 A;  4EJT A;  2VOD A;  4DVY P;  3WTV C;  5JFR A;  3L2C A;  3S3O A;  1DPR A;  1ZKG A;  5FKK A;  5LGN A;  1WQ2 A;  1N25 A;  2OPT A;  2A3S A;  5IT9 K;  1FJL A;  2RDP A;  1ACI A;  4EJO A;  1O7F A;  3V8J A;  1NG7 A;  1NK3 P;  4CHU A;  2D5V A;  2FE3 A;  5ILU A;  2MH9 A;  4IZZ A;  5E8G A;  2JT1 A;  4R79 A;  1RKW A;  3PO3 J;  2HTS A;  3FWE A;  4OMZ A;  4M9X A;  2A68 F;  3ULQ B;  3GME A;  3CME I;  2X0L A;  5E3O A;  1WPK A;  4E7Z A;  5FGL A;  3V78 A;  2LSO A;  3DEU A;  3HTA A;  2QF7 A;  1PUF B;  2BY0 A;  5D1R A;  1IN8 A;  3GO5 A;  5IT3 A;  3WTY C;  1HSJ A;  1R7J A;  2FSW A;  2GZW A;  5IY5 H;  2O03 A;  3DXJ F;  4J19 A;  4XLA A;  4HX8 A;  5M5W J;  1OFC X;  1Z7U A;  5F0F A;  5FO5 A;  4ZJZ A;  2A07 F;  3E7Q A;  4NEL A;  1WI3 A;  2R7O A;  2A05 A;  4AYB A;  2E1M C;  2P8T A;  4RGS A;  1FOW A;  2Y9Z A;  4OOI A;  3V7R A;  2A61 A;  1WFX A;  2DA3 A;  1FX7 A;  1KGS A;  2ME0 A;  4B43 A;  1REP C;  1QA6 A;  1WRJ A;  2LBF B;  1DUX C;  2KZG A;  2LOO A;  3KNW A;  1GVJ A;  3BCG A;  2CV1 A;  1X2M A;  1YIT I;  4GO1 A;  5LGU A;  1SC7 A;  1JHH A;  2OJE D;  1SD4 A;  4HX7 A;  4GFK A;  4ZDP A;  2JVG A;  3HPH A;  4HST A;  1W0T A;  2RAS A;  1W36 C;  3LA3 A;  5BQT A;  1OYW A;  2X6W A;  3M1E A;  1TTY A;  4A2U A;  2VJJ A;  3K4C A;  1LDD A;  4S0H B;  2DU9 A;  1JTX A;  2Y75 A;  2MLK A;  2Z1D A;  1VQ8 I;  3W6V A;  3CDH A;  5CLS A;  2IGM A;  3DKW A;  2DA7 A;  2XDN A;  3G73 A;  3I59 A;  1GV5 A;  3QU3 A;  2QEN A;  4XKV A;  2XDV A;  3LA7 A;  2ZY9 A;  2V9V A;  5F27 A;  2XKP A;  1FOX A;  1I6X A;  1NHA A;  3CP2 A;  4E4H A;  4BGD A;  1X2N A;  2J5P A;  3G71 I;  2AHQ A;  5KHD A;  2EIL H;  3VVY A;  3TKY A;  4HYE A;  2VAS A;  3KP5 A;  1FTT A;  4XSX F;  2M30 A;  4X6A J;  2EPF A;  3FXO A;  4BHP A;  4O3M A;  4HF0 A;  3T5X A;  1Q1V A;  4N4O B;  2KRC A;  3M1C A;  3BTC A;  2L01 A;  2E2I J;  2L54 A;  1MH4 A;  3LJL A;  3PNT A;  2VBY A;  3MWM A;  2ECC A;  4FHT A;  4MXM A;  3HTI A;  4BXF A;  2DJI A;  4U7B A;  3ZP5 A;  5DCM B;  3M07 A;  4G6Q A;  2KHM A;  2B1E A;  1JKO C;  1TL8 A;  2VBW A;  2NYX A;  1KQ0 A;  2FOK A;  1HBX G;  1ERD A;  2FJI 1;  4GCT A;  4PZJ A;  1ZG5 A;  4MLO A;  5LD2 C;  2Q24 A;  2VIX A;  3M8E A;  3OOU A;  4A93 J;  1F9N A;  4BNC A;  3JCU C;  4PFP A;  4NBQ A;  4M6V A;  1U6G A;  2R5Y B;  1BW6 A;  3F6V A;  2DI3 A;  5HS9 A;  2CW8 A;  1SEU A;  3TMO A;  1GXP A;  1B72 A;  4CCK A;  2UXO A;  2L7F P;  4L5I A;  1R36 A;  1XC5 A;  3LOC A;  2GXG A;  3FXL A;  3OSG A;  2XAQ A;  1IO2 A;  1IXC A;  1ZHF A;  2QZ8 A;  2O6G E;  5J4Y A;  3S16 J;  2YVE A;  2O9L A;  2EFQ A;  4HW0 A;  3CP8 A;  1S5L C;  5L3B A;  3R0J A;  1Z9C A;  4PXI A;  3BJO A;  5K7F A;  1E17 A;  3SHF A;  2F5E A;  4JK1 X;  3TGN A;  3BPX A;  2DTR A;  2G7U A;  4KJZ A;  3AL0 B;  4CH7 A;  1UST A;  1SFU A;  1WCM J;  4HLY A;  4C3J J;  3N05 A;  1ZG3 A;  1X1P A;  2W00 A;  5C4J J;  2CS3 A;  3VOX A;  4LK0 F;  3CC7 I;  2GXB A;  5J40 A;  1J5Y A;  4CCL A;  1X1C A;  1MJ9 A;  3F8N A;  5GTH C;  2IA0 A;  4B3A A;  2IA1 A;  2FA5 A;  2VOO A;  4MTD A;  4XKB A;  3P9K A;  1BOA A;  2HQR A;  3BT9 A;  3P5J A;  3HL2 A;  2MYS A;  4XBF A;  1Z67 A;  3VSL A;  3VTI A;  1ORK A;  4ASN A;  4IOA F;  3DLA A;  3J7A O;  1FSE A;  1ZK8 A;  3S1M J;  2NP5 A;  3H0D A;  3BDD A;  4NUB A;  3WTU C;  4UNO A;  1IZ1 A;  1XGO A;  2LY2 A;  1MBF A;  2VJ4 A;  4UVB A;  5CKT A;  4ZYE A;  3C18 A;  2UXX A;  3B02 A;  1Z7L A;  2QKM B;  2K02 A;  2ELH A;  1YS6 A;  2BHY A;  4CCN A;  1Z0X A;  3MZ8 A;  1FLI A;  2X1C A;  3SXY A;  1UFM A;  3IUO A;  2QQA A;  2CGP A;  2LLK A;  3IC7 A;  4IHW A;  2EFP A;  4A6D A;  1IUY A;  5D6F A;  4JX5 A;  4IQJ A;  4BAY A;  2VKD A;  4XKW A;  2VL8 A;  4LB5 A;  3OS2 A;  1XDU A;  3PQK A;  3MKL A;  1R1U A;  4FCY A;  2R7Z J;  1X3U A;  2HQ5 A;  1N75 A;  4D9J A;  3FHZ A;  2M8G X;  1KU2 A;  3HPG A;  3LSJ A;  5D5V B;  3M8F A;  3H9J A;  3L2U A;  2GUH A;  1UHM A;  3FK7 A;  4UDS A;  2E60 A;  3LSG A;  3WTX C;  1U5T C;  4HPQ A;  3S93 A;  3NWS A;  2H27 A;  2KQR A;  3G1M A;  2K86 A;  2PJR A;  2XB5 A;  1DP3 A;  5LFA A;  1FY7 A;  1ZRF A;  1Z1D A;  1G3Y A;  5EYR A;  2QSG X;  1JJ8 C;  3SYT A;  4ZTJ A;  3L09 A;  4JBA A;  3DKX A;  2WV0 A;  2YX4 A;  2WAQ N;  4I0A A;  3HOT A;  2EA2 A;  4F52 A;  3DLL F;  3DPT A;  4IPA A;  3HOV J;  1XCV A;  2R3S A;  4M3F A;  3OR1 C;  3HRT A;  2ID6 A;  5EGO B;  1W7P D;  1SVM A;  4XON A;  5BNG A;  2LKS A;  4RM2 A;  2Y48 A;  4WIB A;  3W3C A;  1QZZ A;  1D0X A;  2JTV A;  2UXN A;  4RAF A;  1B9M A;  3BR0 A;  3CCJ I;  3CJT B;  4MNU A;  5H2F C;  2W24 A;  4GDF A;  3M9A A;  1GXQ A;  3ABU A;  2D1H A;  3EYY A;  2HR3 A;  3LST A;  4S04 A;  2XSD C;  1S6L A;  2IT0 A;  1U8B A;  3PUB A;  4BY7 J;  3CUQ C;  3PFY A;  2ELJ A;  5D19 A;  5JHU A;  2DG8 A;  2VBZ A;  2COM A;  3U21 A;  2M5W A;  5KNL A;  2IBD A;  2CUZ A;  3KE2 A;  4XRS G;  3BY6 A;  4YFK F;  2FBQ A;  4WXC A;  3S2H J;  1ZLJ A;  2MAB A;  4MK6 A;  3S5R A;  1IV8 A;  2WBM A;  4KIG A;  2HNH A;  1YW7 A;  1EH6 A;  4HBL A;  3SQN A;  3LSK A;  4A3K J;  3F0C A;  2LVS A;  3ZN0 A;  3S14 J;  4NB5 A;  3EDP A;  2CJJ A;  2LKX A;  3JAM K;  3G3Z A;  3KEO A;  3MMY B;  3P9T A;  1P2F A;  2YX7 A;  2L9S A;  5EEG A;  2DOE A;  2M7B A;  1JKP C;  2DOD A;  1B1B A;  2XB0 X;  3BR1 A;  2W53 A;  3MCZ A;  5HBU A;  3CC4 I;  2VXZ A;  3OYH A;  1YG2 A;  3O60 A;  3IH3 A;  4JX4 A;  3BWG A;  2M4K A;  4UUV A;  2LF8 A;  2NX4 A;  2VLA A;  5IYB J;  4A5M A;  1R4M B;  3T0Y A;  4QIW N;  5L3E A;  2UXU A;  4OIR F;  2FJ1 A;  2IS6 A;  3K9T A;  5IOZ A;  3BTJ A;  3F1B A;  1ZGA A;  1YO5 C;  3E3V A;  1QVT A;  4ZDL A;  2ZXW H;  5EG0 B;  3SFZ A;  2DAO A;  3ABK H;  1H8A C;  3W6K B;  1TW3 A;  2PBI A;  2ETH A;  2N8G A;  5HS8 A;  4G8X A;  2P4W A;  4AIJ A;  3A02 A;  2BY1 A;  1AKH A;  4A3G J;  1RUO A;  1BR1 A;  2ECB A;  4OIP F;  3I9V 2;  1OQY A;  2DMT A;  1IRX A;  2OD5 A;  1Y39 A;  3HOU J;  1C0W A;  1JT0 A;  1ZRE A;  2BVM A;  1OCC H;  3E5Q A;  4HKU A;  4D7N A;  5D4S A;  1W1W E;  2OQR A;  2YPR A;  5FRM A;  5LHH A;  4Z6Y A;  4IHT A;  4RA2 A;  4BE1 A;  5CYV A;  2Z9O A;  2C6Y A;  3OYM A;  4E70 A;  1XX5 A;  3KIO A;  1T98 A;  2EIN H;  2E34 A;  3GXO A;  3L7W A;  1R1T A;  3TBI A;  4KN7 X;  1Z3Y A;  1HKS A;  2RC4 A;  2A5Y B;  2ZXH A;  2P5L C;  4FTH A;  2KIS A;  1U9N A;  4XSZ F;  1W5C C;  3OL4 A;  4BUP A;  3DBH B;  1VI0 A;  2XAU A;  4PK4 A;  2CQX A;  2EZI A;  2HXI A;  2MBF A;  9ANT A;  4JKZ A;  2P5V A;  3ERM A;  3AL0 C;  3FXU A;  1HDP A;  3Q3S A;  2CH0 A;  1IXS B;  4DBQ A;  3GX4 X;  2VUM J;  1ZAO A;  3JRG A;  1IG7 A;  1FBS A;  2R7X A;  2R7V A;  1W7P B;  3HGG A;  3W2V A;  5CXI A;  4B09 A;  3OYD A;  2NNN A;  1FT9 A;  3V7S A;  2ZFW A;  1EV7 A;  5FLM J;  3PFI A;  3T8T A;  2B0L A;  2O61 A;  5J47 A;  4CXF A;  4IF4 A;  3FRQ A;  1Q1H A;  3Q0U A;  1LVA A;  4L5E A;  2NVU B;  5LLQ A;  2OQG A;  3FX3 A;  4YEJ A;  2ADU A;  5JI6 A;  4C30 A;  5TIS C;  2NXN B;  4IKF A;  4U9L A;  1VZ0 A;  2EIM H;  4IXA A;  3U1K A;  4E7S A;  2QA4 I;  5L3G A;  4L62 A;  2KPM A;  3EGQ A;  3VUQ A;  2K9N A;  2BOL A;  5DYM A;  2LKP A;  5J1U A;  5CVI A;  4D7M A;  2OA4 A;  3F72 A;  5JLW A;  1HF0 A;  5EJC A;  3S3M A;  1MSF C;  3E0J B;  4LIU A;  3CMM A;  3HE0 A;  4RM3 A;  3DEW A;  2V57 A;  3BG5 A;  3HJE A;  1G6N A;  1LE8 A;  2ISZ A;  3L9F A;  4ZDO A;  1VQL I;  3PNY A;  1OKR A;  3DKY A;  2XAS A;  4EMS A;  4BE0 A;  4CYC B;  4LG3 A;  2JVH A;  1TQM A;  2KIF A;  4MQV A;  2CQQ A;  4RBO A;  3SDB A;  2ZME B;  4A3D J;  1UAA A;  3F23 A;  3J80 Z;  2HQN A;  1XGS A;  4RB2 C;  1PYV A;  3PUF A;  5FMP A;  2H6C A;  3CDI A;  2JA8 J;  4I99 C;  1WJA A;  4A5N A;  2F5V A;  4GYI A;  2BV6 A;  2XAG A;  4XKC A;  4OWR B;  3I4P A;  3ZQL A;  1RUN A;  2CV2 A;  2LG4 A;  1TBX A;  3ABM H;  4Y33 A;  3KLN A;  4PSX A;  3VVX A;  3K4B A;  2JPC A;  2E71 A;  3HHH A;  4L5J A;  1JTY A;  3HEF A;  3E6C C;  1VND A;  4ANJ A;  5AON A;  4I09 A; 
#chains in the Genus database with same CATH homology
 4NDL A;  1IJW C;  3S1N J;  3UKG A;  1HLV A;  2OPT A;  1FJL A;  2G3B A;  2Y31 A;  2VI6 A;  4IEJ A;  3JRB A;  1FEX A;  1NK3 P;  2D5V A;  2AO9 A;  2PBX A;  3ANG A;  1RKW A;  3PO3 J;  1RKT A;  3RQI A;  1U9O A;  1TC3 C;  5E3O A;  1WPK A;  4XIC A;  4ABZ A;  3S1R J;  5FGL A;  3V78 A;  3SFI A;  3KZ9 A;  2L0K A;  3HTA A;  2QF7 A;  2LTP A;  3QPL A;  1PUF B;  5E3N A;  5D1R A;  2RHA A;  2XRL A;  1OCT C;  4J19 A;  4M3E A;  5EZH A;  5M5W J;  1OFC X;  3BTI A;  2M0C A;  1OCP A;  5F0F A;  2X48 A;  2ZOZ A;  2DA1 A;  4BKX A;  2NVQ J;  2DN0 A;  1ZQ3 P;  3EUP A;  3E7Q A;  4NEL A;  1WI3 A;  1A6I A;  1LFU P;  2E19 A;  3HM5 A;  3SDG A;  1Y1V J;  2COB A;  2Y9Z A;  3S15 J;  5CXG A;  3HOZ J;  3BR3 A;  1JUS A;  2DA3 A;  2ME0 A;  4CGR A;  2K9Q A;  4G12 A;  1AHD P;  3KNW A;  4QSH A;  3BCG A;  3VIB A;  1X2M A;  3RZD J;  2EZK A;  2L7Z A;  2YVH A;  4GFK A;  3BJB A;  3AQS A;  1GVD A;  1W0T A;  2DJN A;  2RAS A;  2WGB A;  1E3O C;  3NI7 A;  2E2J J;  2M34 A;  4A3E J;  2ZCN A;  1APL C;  1QPI A;  4Y7N J;  4AC6 A;  4S0H B;  1JTX A;  3W6V A;  1UI5 A;  2QOP A;  1IRZ A;  3HB9 A;  2LFB A;  2XDN A;  2DA7 A;  4JYK A;  4B4C A;  3GTK J;  3NAR A;  2JMW A;  2LK2 A;  5C3E J;  1GV5 A;  2DA4 A;  1JJ6 C;  2JA5 J;  4A69 C;  4B1R A;  3ZQF A;  4M3B A;  5F27 A;  4A3F J;  1QRY A;  3TW7 A;  1I50 J;  3BNI A;  1X2N A;  2DA6 A;  2AHQ A;  1R9T J;  1XG1 A;  2WUI A;  2EQR A;  1Y1W J;  3QBM A;  3VVY A;  1K61 A;  1RET A;  5DTD A;  3JRC A;  2R5Y A;  1FTT A;  4A3C J;  5K58 A;  4DYR A;  2UXI A;  1RES A;  2Y30 A;  4EEF G;  4X6A J;  3TP3 A;  3BR2 A;  2OI8 A;  4QTR A;  1Q1V A;  3BTC A;  2L9R A;  2E2I J;  5EZG A;  1MH4 A;  4FIS A;  3A01 A;  3LJL A;  4JL3 A;  5HOD A;  3BQZ A;  4MXM A;  2ECC A;  1ETV A;  2QCO A;  3HTI A;  1WGX A;  3S1Q J;  1IDY A;  1JKO C;  5M5Y J;  4GCT A;  1HDD C;  4MLO A;  1A5J A;  5CW8 A;  2Q24 A;  3OOU A;  4FE7 A;  4A93 J;  2ZCX A;  4ACI A;  4C3H J;  4M6V A;  4W1U A;  2R5Y B;  1BW6 A;  2OF7 A;  2XGE A;  5IPA A;  3DCF A;  1B72 A;  2UXO A;  1Z77 A;  4DYC A;  4I6Z A;  1BA5 A;  2L7F P;  2QWT A;  1XC5 A;  3LOC A;  3OSG A;  4W97 A;  4GCL A;  3RZO J;  3E7L A;  3S16 J;  2UXP A;  2YVE A;  3A01 B;  2O9L A;  3TW6 A;  3GTJ J;  2JN6 A;  3C2B A;  3CDL A;  2O7O A;  5J1R A;  4PXI A;  1NTC A;  5K7F A;  2HYT A;  2PMZ N;  2EZL A;  1ZGW A;  1TWA J;  2G0E A;  3VW2 A;  2KT0 A;  1WCM J;  5IYD J;  3FIW A;  1ETY A;  4C3J J;  1I6H J;  3FIS A;  4IHX A;  3B6C A;  3LSR A;  2KDZ A;  3G7R A;  5C4J J;  5M3M J;  2H1K A;  3PPB A;  2IAI A;  1DU6 A;  3VOX A;  5K7H A;  3O8G A;  2JJ7 A;  3VP5 A;  1B72 B;  4B3A A;  5M5X J;  2GLO A;  3CJD A;  3O8H A;  3BT9 A;  4XK4 A;  1ZR4 A;  2O8K A;  3NPI A;  2XPU A;  4AUX A;  1IC8 A;  2L7M P;  2IU5 A;  1ORK A;  3BG9 A;  1ZK8 A;  1B8I A;  3S1M J;  2NP5 A;  1X58 A;  1MBF A;  1JUM A;  3ZOB A;  1XS9 A;  1TWH J;  3C07 A;  3HBL A;  1GUU A;  3V6G A;  1JT6 A;  3NAU A;  3GEU A;  4AF5 A;  5DS9 A;  1UMQ A;  3IH4 A;  2Y0S N;  4ME9 A;  5EFY A;  3JR9 A;  1JKQ C;  2H8R A;  5J1Y A;  3T6N A;  3GTL J;  2CUE A;  1Z0X A;  3ZQH A;  2E2H J;  1ZTR A;  2EH3 A;  1FIA A;  5IOY A;  3NXC A;  2LLK A;  2QTQ A;  3CRJ A;  4IHW A;  2E1O A;  2HKU A;  2R5Z A;  1TWF J;  4BXX J;  4JX5 A;  1ETW A;  1F36 A;  2K40 A;  3HGY A;  4BY1 J;  5F0C A;  2VPR A;  1RR7 A;  2HDD A;  5GPA A;  3HOX J;  4DW6 A;  3MKL A;  1B8I B;  5AQC A;  5M3F J;  4AC0 A;  4FCY A;  1D5Y A;  2R7Z J;  5FKM A;  2HQ5 A;  3NRG A;  1BJZ A;  3MVP A;  3TED A;  5F0H A;  2ZB9 A;  2M8G X;  5GP9 A;  4BBS J;  3S17 J;  4A3J J;  3LSJ A;  1MBE A;  1ETK A;  2F07 A;  4C3I J;  1BL0 A;  2PZ9 A;  2JK3 A;  2X6O A;  5IP7 J;  1LFB A;  1ETO A;  1JGG A;  2GUH A;  2NP3 A;  5FHP A;  3VW1 A;  5HSZ A;  3FK7 A;  4UDS A;  2VKE A;  1RPW A;  1MBK A;  5EGO A;  1ZR2 A;  3LSG A;  2JWT A;  3G1M A;  5IYC J;  1SFO J;  5FKO A;  2XB5 A;  3ON2 A;  4MO7 A;  2R5Z B;  1W0U A;  2Y9Y A;  5EYR A;  3QPS A;  2GBY A;  1JJ8 C;  4D5C A;  4NN1 A;  2ID3 A;  1OJL A;  2M2E A;  2DMQ A;  4JNN A;  2WAQ N;  2CUF A;  4FE4 A;  2TRT A;  5EF6 A;  1T56 A;  1P7I A;  1I3Q J;  2YU9 J;  1IGN A;  5K7Z A;  3MNL A;  3HOV J;  3HTJ A;  1SAN A;  1K83 J;  4M3F A;  5C44 J;  2ID6 A;  3CMY A;  5EGO B;  4UUS A;  4X1E A;  2HOT A;  3LNQ A;  2NVY J;  5BNG A;  4HNV A;  3A03 A;  4GFL A;  5FKL A;  2XGC A;  3QQA A;  5IP6 A;  3OSF A;  3IH2 A;  3CCY A;  2YUS A;  1MNM C;  3BRU A;  3BR0 A;  3NNR A;  2EZH A;  1H88 C;  1MSE C;  4MIM A;  1JKR C;  3HOY J;  5EDN A;  3MN2 A;  1UHS A;  3AQT A;  3HTH A;  2HXO A;  4KWA A;  2HYJ A;  1MBH A;  2XSD C;  1DU0 A;  5EEA A;  4IHY A;  3M4O J;  1SGM A;  4UUT A;  3GTP J;  1U8B A;  4BY7 J;  5D19 A;  3TP0 A;  1P7J A;  5F08 A;  2DG8 A;  1MH3 A;  1MBG A;  3PAS A;  1T33 A;  4M3G A;  4AYB N;  2IBD A;  4XRS G;  2FBQ A;  4UUS B;  1POG A;  5E3M A;  3S2H J;  4DZJ A;  5FLV A;  2NOG A;  4MK6 A;  4V2F A;  3S5R A;  2NVX J;  3Q0V A;  3BQY A;  1MBJ A;  4YZE A;  4A3I J;  1TWG J;  2X9D A;  2DMU A;  2MG4 A;  2Y2Z A;  1GT0 C;  3H3V K;  3JRF A;  3FK6 A;  4A3K J;  3RH2 A;  3F0C A;  2LVS A;  3S14 J;  2NVT J;  4JX6 A;  5E3L A;  3ZQI A;  2CJJ A;  5EG0 A;  2LKX A;  2FQ4 A;  3P9T A;  3BG3 A;  3JRD A;  1JKP C;  3K2A A;  3G1O A;  2JA7 J;  2DA2 A;  2XB0 X;  3BR1 A;  2IEK A;  2W53 A;  2P81 A;  2ZOY A;  3LWJ A;  5HBU A;  3HKZ N;  3L1P A;  3FKI J;  3O60 A;  1ETX A;  4JX4 A;  3IH3 A;  4I76 A;  1UG2 A;  4M3D A;  5FKN A;  1U78 A;  2NS8 A;  1BW5 A;  2NX4 A;  5IYB J;  4QIW N;  2UXH A;  5F1J A;  1H89 C;  2DMN A;  2UXU A;  2FJ1 A;  5IOZ A;  3BTJ A;  2GEN A;  3F1B A;  4D5F A;  3CQZ J;  2DMP A;  2CRG A;  1ITY A;  1QVT A;  4XID A;  3VOK A;  5EG0 B;  1H8A C;  4Y52 J;  3GTM J;  5H9T A;  3ON4 A;  4MFD A;  3G1L A;  4C2M J;  3K7A J;  2N8G A;  3PO2 J;  3IUV A;  3HIM A;  5JLX A;  1FTZ A;  3A02 A;  2CU7 A;  2R93 J;  3D1N I;  3GTO J;  3BTL A;  2MSY A;  5HAW A;  2I10 A;  2FX0 A;  1AKH A;  3M3Y J;  4MFE A;  2R92 J;  4A3G J;  1CQT A;  2OER A;  2WB1 N;  2M9H A;  3PM1 A;  2ECB A;  2G7S A;  4A3B J;  2XPV A;  2DMT A;  3HOU J;  4BBR J;  3ANP A;  4IHV A;  1NK2 P;  1JT0 A;  5IP9 J;  4HKU A;  3CWR A;  4A3M J;  4D7N A;  3KKD A;  2GFN A;  2O7T A;  3H0G J;  4LOC A;  3DPJ A;  4GCK A;  3VPR A;  1S7E A;  2HOA A;  2REK A;  2EBI A;  2D6Y A;  3S2D J;  5J3L A;  2HI3 A;  2LD5 A;  2QIB A;  2K9S A;  4DYQ A;  1TWC J;  1WH5 A;  2DG7 A;  2G7G A;  4FTH A;  1QVU A;  1U9N A;  4XRM A;  4A3L J;  1F43 A;  2ZCM A;  3G56 A;  5GPC A;  1VI0 A;  1AKH B;  1ENH A;  2CQX A;  2EZI A;  3JRA A;  2HXI A;  9ANT A;  3GZI A;  3KKC A;  4JKZ A;  1FIP A;  1HDP A;  3Q3S A;  2G7L A;  3COL A;  2LP0 A;  2TCT A;  2VUM J;  2LY9 A;  3JRG A;  4RDU A;  1IG7 A;  2VKV A;  3WHB A;  3SJM A;  3HGG A;  5CXI A;  4DZP A;  2XPW A;  2JA6 J;  1UI6 A;  5DAJ A;  2DTZ A;  2XGD A;  2ELK A;  5FLM J;  5FJ8 J;  3GBG A;  3RKQ A;  3FRQ A;  3B81 A;  3Q0U A;  4XRS A;  4CYC A;  4L5E A;  3ZQG A;  3QKX A;  2LR8 A;  3IV5 A;  2NS7 A;  3Q0W A;  3OIO A;  2FD5 A;  4L62 A;  3GTG J;  3EGQ A;  3VUQ A;  2K9N A;  1EF4 A;  5J1U A;  4D7M A;  3LHQ A;  3HDD A;  5JLW A;  1HF0 A;  1YRN A;  2B63 J;  1MSF C;  5F04 A;  3HOW J;  1VF9 A;  1AU7 A;  2MGQ A;  3HE0 A;  3DEW A;  3JRH A;  1G2H A;  3RD3 A;  3ZQC A;  1IDZ A;  3BG5 A;  2V57 A;  1LE8 A;  3B6A A;  1WH7 A;  2RAE A;  3JRE A;  1O4X A;  3BR6 A;  4CYC B;  2CQQ A;  4RBO A;  3LSP A;  3I4M J;  5C4X J;  2MW8 A;  2ME6 A;  3JRI A;  4A3D J;  1HCR A;  3VW0 A;  4V2G A;  1GDT A;  4GFB A;  2YS9 A;  3JSJ A;  4JP0 A;  5FMP A;  1GV2 A;  1HOM A;  1IUF A;  1YRN B;  3I4N J;  3BHQ A;  2JA8 J;  3BR5 A;  1VFC A;  3WHC A;  2GM4 A;  3GTQ J;  3ZQL A;  1ETQ A;  1LE8 B;  2QKO A;  2WV1 A;  5D18 A;  3VVZ A;  1JUP A;  2W48 A;  3VVX A;  1PUF A;  2R0Q C;  1JTY A;  5C4Y A;  1ZKG A;  1IV6 A;  3HEF A;  1VND A;  5FKK A;  4ICH A;  2HOS A;  2DA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...