3TP3A

Structure of hth-type transcriptional regulator ethr, g106w mutant
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
194
structure length
194
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTWINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator EthR
publication title Structural activation of the transcriptional repressor EthR from Mycobacterium tuberculosis by single amino acid change mimicking natural and synthetic ligands.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 82
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3tp3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3tp3A02
2RAEA 1YRNB 5D19A 1FTZA 1U78A 3C2BA 4FTHA 1EF4A 3EGQA 2UXUA 3DPJA 2H8RA 3HB9A 1D5YA 3OOUA 2VKVA 3BR6A 4A3CJ 5EF6A 5IP7J 2DA7A 2DTZA 2O7OA 4FCYA 3S5RA 4A3MJ 2NX4A 1GDTA 3JRBA 2JA6J 2Y9ZA 5F08A 2EBIA 3LSJA 5J1RA 3K7AJ 3ZQHA 2MSYA 3BTJA 1ZGWA 3E7LA 2DMNA 2LLKA 2XPVA 1ETVA 2IU5A 3A03A 1WCMJ 1MBKA 2UXOA 1X58A 1JTXA 2NS8A 3S16J 2M34A 2FQ4A 3VVXA 4DZJA 3PO3J 2JWTA 4RDUA 3IH2A 5M3FJ 3RD3A 2LP0A 4M3FA 2DN0A 1ETQA 4M3BA 1Q1VA 1TWFJ 1Z0XA 2L0KA 2LKXA 5C4JJ 2DA2A 2R93J 1MNMC 3BR3A 5FLVA 5CW8A 2HQ5A 3GBGA 3IV5A 5IP6A 2OERA 1E3OC 2ELKA 2O7TA 3OSFA 3JR9A 5FKKA 5FKNA 1F43A 1H89C 3T6NA 2M0CA 3NARA 2YUSA 2R5YB 2G3BA 2L7MP 2NP3A 3ZQLA 1FTTA 1VF9A 1I3QJ 5IOZA 2JMWA 3BTLA 2G7GA 1ORKA 2G0EA 3B6CA 3CMYA 5HSZA 5C44J 1TWAJ 3O8GA 3MN2A 3JSJA 2DA4A 1OCTC 1B72B 4A3LJ 4BY1J 4D5CA 1ETOA 3GTPJ 5C4XJ 2DMQA 1MSEC 1HOMA 1NK3P 4S0HB 3JRFA 4A3BJ 2HKUA 2PBXA 3KKCA 2X9DA 2ID3A 3LSPA 2L7ZA 3PO2J 2LTPA 2QOPA 4C2MJ 2CQQA 2IBDA 4JYKA 3RQIA 1AHDP 2R5ZB 4JX6A 2ZB9A 5DTDA 3OIOA 4D7NA 1GT0C 3MKLA 4A3JJ 1VNDA 2DMPA 1K61A 3C07A 5DAJA 2E2JJ 3LOCA 4M3GA 4IHYA 3WHBA 4BBRJ 4L5EA 3VUQA 3QPLA 1X2MA 4J19A 2G7LA 1IDZA 5EZGA 1JUSA 5EG0A 3G7RA 3NAUA 3TW7A 1I6HJ 4DYCA 3HM5A 3QPSA 2M9HA 2OI8A 2GM4A 2WAQN 4JKZA 5FGLA 1MBGA 3TP0A 3HGGA 5EZHA 1NK2P 3HKZN 2HXOA 2VI6A 2EH3A 3TP3A 5IOYA 5CXGA 1U8BA 3HIMA 2EZIA 4MIMA 2VKEA 2UXIA 1MBJA 3HEFA 1MH4A 1GUUA 2YVHA 1RPWA 2D6YA 3BR2A 2CRGA 4MXMA 2JA5J 3W6VA 3KNWA 3VW0A 1QVUA 2K9SA 4UUSA 3A01B 3H3VK 4D5FA 1TWHJ 3FIWA 5HODA 3PM1A 2UXHA 3VP5A 4JP0A 4AC0A 3NRGA 2E19A 1IGNA 3BHQA 2L9RA 5M5WJ 2QCOA 3BRUA 1JUMA 3D1NI 1AKHA 3HOXJ 3BT9A 4JX4A 5F0FA 4AYBN 1A5JA 1QRYA 1UHSA 1RETA 4EEFG 2JJ7A 5E3MA 2ZOYA 2E1OA 1LFUP 3COLA 2JK3A 4M6VA 2EZKA 1XC5A 1H8AC 1ETKA 3K2AA 5IYCJ 3IH3A 3VOXA 1RKTA 1UG2A 2LY9A 5IYDJ 2NVYJ 3AQTA 2N8GA 2LVSA 2E2IJ 4ABZA 3GTLJ 3A02A 3JRGA 3HTIA 5E3LA 3ZQFA 2IEKA 2VPRA 5K58A 5EGOA 4W1UA 2HOSA 2HOTA 4C3IJ 3L1PA 5E3NA 3BQYA 5FKMA 4B1RA 3VPRA 3BTCA 4UDSA 2EZHA 1FEXA 3B81A 3BR1A 4XK4A 3G1LA 4A3KJ 4M3DA 2JN6A 4G12A 4YZEA 1WH5A 3BR0A 3BG9A 3TW6A 2IAIA 1TWCJ 3JRAA 1PUFB 3V78A 1NTCA 2REKA 4QIWN 3HOZJ 2MW8A 1IJWC 2DA6A 5FKOA 2LK2A 1MBHA 1XG1A 2EQRA 2DA3A 2XB0X 2P81A 2HYTA 2XGDA 4NELA 4BXXJ 5FLMJ 3HBLA 1LE8A 1OCPA 3HDDA 2D5VA 2QKOA 5J1UA 2OF7A 1YRNA 3S17J 2G7SA 4GCKA 2X48A 3ANGA 4UUTA 2ECCA 3I4NJ 4JX5A 5C4YA 3JRCA 1MBEA 2AHQA 3DCFA 3S14J 2XB5A 2I10A 1GV2A 2Y0SN 2O9LA 1UI6A 4W97A 3M3YJ 3ON2A 2LFBA 3BG3A 2COBA 1QVTA 3Q3SA 2O8KA 4FE7A 4HNVA 1U9OA 5K7ZA 3UKGA 1JUPA 1UMQA 1WGXA 1B8IB 3HTJA 3ON4A 3JRIA 1HCRA 3FKIJ 5M5YJ 3S1NJ 2QWTA 5H9TA 2GFNA 1ITYA 2XPWA 4DZPA 2VUMJ 4BKXA 4CYCB 4RBOA 1HLVA 3AQSA 3O8HA 4IHXA 2ZOZA 2XGEA 1T56A 4A93J 2Q24A 4C3HJ 4XRSG 1U9NA 3I4MJ 2QTQA 3BJBA 1G2HA 1H88C 1ENHA 3H0GJ 4AUXA 4B3AA 2H1KA 3NI7A 4DW6A 4NDLA 3O60A 1I50J 2JA8J 3SJMA 3LSGA 3FRQA 3P9TA 3V6GA 4QTRA 2RASA 3ZQIA 2TRTA 3LJLA 3QQAA 2NVTJ 1VI0A 2F07A 2R5YA 3S15J 4A3DJ 3NXCA 3G1MA 1POGA 4X6AJ 1IV6A 1WI3A 1Z77A 3Q0WA 5C3EJ 2DG8A 2HXIA 3GTKJ 4A3GJ 3HTHA 3MNLA 4FE4A 3GTQJ 3HOVJ 4GFLA 5F04A 2CUFA 3SFIA 2OPTA 2ME6A 1JT0A 4A3IJ 2NP5A 2Y31A 3ZQCA 3QBMA 5F0CA 2DMUA 5EGOB 2KDZA 3S1RJ 2XDNA 2DJNA 2WB1N 4IEJA 1MSFC 3LWJA 2B63J 1JKQC 2HYJA 1HDDC 3HOWJ 1WH7A 3ANPA 2HOAA 4CGRA 2YS9A 4KWAA 2HI3A 3Q0VA 5EYRA 4D7MA 1BL0A 1W0UA 2LR8A 3HGYA 5IP9J 4GCLA 1IUFA 5GP9A 2AO9A 3OSGA 4MK6A 5EFYA 1JT6A 1K83J 3LNQA 2PZ9A 1IC8A 2ZCNA 1FIAA 3NPIA 4FISA 4IHVA 5F27A 3ZOBA 5EDNA 1LE8B 3HE0A 1JKOC 3WHCA 4BY7J 4A3EJ 3IUVA 3BNIA 2UXPA 1XS9A 1GVDA 9ANTA 3F1BA 4JNNA 4B4CA 2WGBA 1ZTRA 5IYBJ 4MFDA 2L7FP 2DG7A 5J1YA 3S1MJ 2NS7A 3FK7A 2XPUA 2GLOA 2QIBA 2W48A 3FISA 2FJ1A 1FJLA 2DA5A 4DYRA 3VW2A 2FX0A 3S1QJ 1W0TA 3EUPA 3RZDJ 5K7FA 1OFCX 4X1EA 2R0QC 1TC3C 2NOGA 3HTAA 1JTYA 2GUHA 5E3OA 2R92J 1OJLA 4AC6A 2QF7A 5IPAA 4BBSJ 2WUIA 3ZQGA 3CRJA 3VVZA 2NVQJ 3MVPA 3PASA 3GZIA 1ZK8A 1MH3A 1ETXA 1HF0A 4XIDA 1BA5A 4L62A 2X6OA 5K7HA 3A01A 1SGMA 3VOKA 3VIBA 4XRMA 3FK6A 5F0HA 5HBUA 4JL3A 4A69C 2V57A 1DU0A 3E7QA 1RKWA 4PXIA 4ME9A 1JJ6C 3GTOJ 5JLWA 1BW5A 4V2FA 5J3LA 1JGGA 4Y7NJ 3QKXA 1WPKA 1CQTA 2DMTA 1ZKGA 5EG0B 1JKRC 1ZR4A 3G56A 3IH4A 4HKUA 3G1OA 4GCTA 2HDDA 5BNGA 1SFOJ 3Q0UA 4C3JJ 4M3EA 3GTJJ 2YU9J 1FIPA 4ICHA 3NNRA 3CJDA 3GEUA 5HAWA 1AU7A 2JA7J 1BJZA 4LOCA 5D1RA 1MBFA 4GFBA 4GFKA 3LSRA 3TEDA 1ZQ3P 1BW6A 3F0CA 2M8GX 2Y2ZA 1IG7A 3BCGA 1HDPA 1S7EA 5GPAA 3HOUJ 4UUSB 2ZCXA 3KZ9A 1DU6A 1RR7A 3VVYA 1X2NA 3B6AA 4MFEA 3KKDA 2Y30A 2CQXA 1A6IA 2MGQA 2E2HJ 3M4OJ 2K9NA 2ID6A 2TCTA 1R9TJ 1PUFA 1GV5A 2M2EA 2W53A 1AKHB 4XICA 3DEWA 2GBYA 1ETYA 5M5XJ 5FKLA 1P7JA 2DA1A 4I76A 5FJ8J 5EEAA 3CWRA 4A3FJ 5JLXA 3JREA 2Y9YA 1ZR2A 5DS9A 4ACIA 2FBQA 1QPIA 4MLOA 2MG4A 3S2DJ 4XRSA 2K9QA 1B72A 2NVXJ 3HOYJ 3RH2A 1JKPC 4IHWA 2PMZN 2ZCMA 3JRDA 2CU7A 3SDGA 1JJ8C 3PPBA 1IDYA 1IRZA 4V2GA 1F36A 3CQZJ 3BG5A 4I6ZA 3BTIA 1TWGJ 5D18A 2CUEA 3CCYA 2ECBA 3RZOJ 1B8IA 3JRHA 1Y1VJ 3VW1A 2K40A 3GTMJ 3CDLA 3RKQA 5FHPA 2R7ZJ 2R5ZA 1APLC 2FD5A 1Y1WJ 1SANA 2KT0A 5M3MJ 4Y52J 1RESA 2EZLA 4DYQA 4CYCA 2RHAA 3LHQA 3GTGJ 4QSHA 1UI5A 1ETWA 2CJJA 5AQCA 2LD5A 2XSDC 5FMPA 4MO7A 5F1JA 1VFCA 2GENA 1P7IA 5CXIA 1O4XA 2WV1A 3S2HJ 5GPCA 1LFBA 1T33A 3BR5A 2YVEA 2XRLA 3BQZA 4NN1A 2ME0A 4AF5A 2XGCA
chains in the Genus database with same CATH superfamily
2RAEA 3W3CA 4IHSA 3MZHA 2EWNA 4ZYEA 4II3A 2VBXA 3EGQA 1EJ9A 3DPJA 1YLFA 2W24A 3HHGA 2VBYA 4CO8A 1MMNA 2TDXA 1G3SA 1UB9A 2O7OA 3ECHA 1I5ZA 4B48A 3KYLA 1HSJA 4A3MJ 3ISPA 3L2VA 1J09A 3JRBA 4B43A 4YEJA 3RSNA 2EBIA 5J1RA 2OCEA 3I9V2 2XIGA 3BTJA 2DXIA 3ML6A 2LLKA 1F5TA 5HLTA 3D5LA 3WODF 4BAYA 1USSA 3VDXA 2CGPA 3S16J 1SFEA 2OCCH 3WE2A 4RMNA 3FKJA 1ZN2A 3IH2A 1ZAOA 2XVCA 4HZFA 4LJZF 4OOIA 5BPIA 4M3BA 1Z0XA 1TWFJ 3ZGKA 3F6VA 3CLQA 4DIQA 2DA2A 2R93J 3KYCB 3BWGA 4RLQA 5CYVA 4IJAA 1MNMC 5FLVA 2W85A 4QPOA 5CW8A 1D1AA 3GBGA 3ZMVA 1LEAA 2IGOA 2ELKA 2X6WA 5KCMA 2AQEA 1F43A 3PFYA 1XB4A 2ZSHB 4I98B 2G3BA 4YIIA 2L7MP 1SD5A 3DXJF 3ZQLA 2VONA 1OMIA 4CCOA 3ZMZA 1I3QJ 1FTTA 2M7AA 2JMWA 4A12A 2STTA 2VOPA 2IXSA 3B6CA 1YJWI 2Z1DA 1NH3A 6PAXA 2OZ6A 3CMYA 4AU7A 4HAMA 3GXOA 5H6RA 2IS6A 3O8GA 3S93A 3H9QA 2KZVA 5E1ZB 4A3LJ 1R4NB 1HW2A 4A0ZA 3ZN0A 2V1UA 4D5CA 1PUEE 2BE5F 4EM1A 1XGMA 1RR8C 1MSEC 3GTPJ 3F8NA 2A69F 1VQ4I 2FBIA 2HKUA 1S8NA 1TQIA 2WAFA 1FWZA 1J2XA 3RIRA 4JYKA 3RQIA 3FXRA 2VJ5A 4HX8A 2R5ZB 2E60A 3QWLA 2HS5A 4LGWA 1HSTA 3ECOA 2LKSA 2DW4A 3WGHA 1VNDA 3CMAI 4BE0A 1K61A 4OD4A 1X1DA 3CD6I 3I59B 2H1LA 3FXKA 1E3PA 1EA3A 3WHBA 4L5EA 4ZDPA 1X2MA 1IDZA 1JUSA 2EFWA 1K78A 5EG0A 5HDGA 4CZZA 2ZXHA 4DYCA 5JHUA 2A3SA 1R5HA 3PQKA 3QPSA 4OINF 1HW1A 4CCMA 4U88A 3TP0A 3HGGA 3HRTA 3K4BA 4MQVA 5FO5A 3WTUC 2IJLA 1YW7A 2LY1A 4II2A 1NK2P 3TP3A 2HXOA 5CXGA 4DBRA 3E6BA 1U8BA 3HIMA 2VASA 2BY1A 1ULYA 2VKEA 1WJBA 1SAUA 3GLXA 3QYFA 1MBJA 4M73A 3SYTA 3NRVA 3WU1B 2OTLI 4RM2A 4WCGA 2A6HF 2NNNA 3HYIA 2RQPA 3GFMA 1AWCA 2XDVA 4ON0A 5J8CA 2LSOA 2JA5J 1S29A 2AQFA 3KNWA 4AWXB 4OIOF 3VW0A 4G7HF 4IKFA 3A1YA 5HLHA 5DM7F 4GGGA 2V6EA 3PM1A 2X1EA 2UXHA 3QOEA 2PMHA 2NYXA 4G9YA 3SZGA 3WTSC 2L9RA 2F5FA 2PQ8A 4XN0A 3BRUA 2P8TA 1DP7P 3HOXJ 1X1AA 3KZYA 4JX4A 1F4KA 1P6RA 4UV9A 2H8WA 1RETA 1UHMA 4EEFG 1ERDA 3FXUA 3DLAA 3TOBA 2M87A 4QWQA 1YYVA 4MQ9F 4WWCA 3VOXA 1UG2A 2XAGA 2L01A 3GZ6A 1XSVA 2E2IJ 3E5QA 1IO2A 4ABZA 1FSEA 3GTLJ 5CKTA 2CMPA 5E3LA 4Q4ZF 1W7PA 2IEKA 3N05A 2VQHA 5EGOA 2BVMA 2OA4A 4L5JA 2P6SA 4BQNA 3CUQC 4CDGA 1WVRA 4RB1A 1RC9A 1GLNA 4HNUA 2XF7A 4E7KA 3EYIA 4M74A 2JRTA 4UUVA 2F5DA 1PUFB 1TWCJ 1IV8A 3P5JA 3J7AY 3K8PC 1IJWC 1PVEA 2DA6A 2DA3A 3B02A 3F8FA 4NQWA 2XGDA 4NELA 4BXXJ 1G8XA 5FLMJ 3HDDA 2QKOA 4HG2A 5J1UA 4JQFA 2CV0A 4GCKA 2X48A 3HKZA 3HUGA 5AONA 3ANGA 2JVGA 4JX5A 3OV8A 1YJNI 1ACIA 1MBEA 4WXHA 2AHQA 3DCFA 2QSFX 3PIOF 1JXSA 4NUBA 4W97A 2OQGA 2HOEA 3OYIA 3ON2A 3BG3A 2COBA 3BG7A 2O8KA 3H0DA 4HNVA 1U9OA 1LEBA 3ULQB 5K7ZA 1DPUA 4Z6YA 3EETA 3HTUA 3HRUA 1D1CA 4BGDA 1YJ9I 3W6JB 1B8IB 5M5YJ 4XKCA 5H9TA 2MH9A 3GX4X 4AVPA 5TRDA 4CYDA 3PQJA 3E3VA 2CS3A 2FOWA 4GO1A 1FYKA 3AQSA 2Q1ZB 1T56A 4DVYP 4EJOA 1WRJA 2RN7A 2QTQA 3QPTA 3JSPA 2BY3A 4HQMA 2GXGA 1A04A 3SJMA 3P9TA 1YS7A 2TRTA 3K1PA 4ZZDA 2EB7A 2F07A 2HZDA 3EUAA 2EPFA 2QUFA 4BE2A 2DK8A 1T8IA 4XKVA 1O57A 2ZBKA 3HTHA 1JE8A 1H9GA 4M71A 1SD4A 4FE4A 4U0WA 5F64A 3OYFA 2A07F 4GFLA 3GFIA 2CUFA 4OAYA 4PGHA 3SFIA 4LK0F 4A3IJ 2KFDA 3RDIA 4LLLA 2A6EF 1OR7C 2OV7A 1ZG5A 3GEZA 2LMDA 3U9GA 1SEUA 5K5RA 5D5XB 1N78A 2ZJRF 2HVRA 2JRMA 3ZRGA 3ANPA 5A2QZ 2BW3A 4E7JA 3OWTA 4EJUA 4KWAA 2HI3A 4RA2A 5HS9A 2ZNYA 3VODA 4PJNA 2FNAA 4ENNA 1ZGJA 2W1OA 1IN6A 2JQ7A 3KIOA 3VYTB 4E7ZA 2ZCNA 1FPQA 2ZC2A 3FWEA 3K6GA 1R5ID 2XHKA 2XKOA 5F27A 2X85A 4MHGA 1TQPA 2DFFA 1FP1D 4CGZA 3ABTA 3FHNA 1GVDA 4JNNA 4EV0A 2L7FP 1PDNC 2DDAA 2XPUA 1KYZA 4XN3A 4BH9A 4ZYDA 3N4MA 1VQ5I 3AG4H 3FISA 4DYRA 2FX0A 3S1QJ 1YITI 4LG0A 2DT7B 2YR2A 3ABKH 3RZDJ 4V19K 1JTYA 5E3OA 3QRFF 2QF7A 3F8CA 4BBSJ 2WUIA 4ENMA 2PMUA 3VVZA 4BEHA 2X6XA 3GZIA 2PEXA 4XIDA 2MD0A 4L62A 2X6OA 3A01A 4F91B 3R60A 4XRMA 4M9XA 3MKZA 2E7XA 5LD2C 1DU0A 4A6DA 3E7QA 2M4GA 1JJ6C 2OAZA 3M8FA 2RNGA 3WGIA 2V1XA 4G6QA 1QGPA 3R0JA 4OD5A 5CVIA 3KZZA 1K78B 1ZKGA 5EG0B 1JKRC 1OYYA 1ZR4A 1SMTA 5LEKA 4HKUA 1U6GA 2GA1A 3G1OA 2X0LA 3FXJA 2HDDA 2JSCA 3K4NA 1J7KA 4A6EA 4C3JJ 4LG3A 1SFOJ 5E8GA 4KA4A 1ZRCA 3E1SA 4OMYA 1Y8QB 3KLNA 3V7SA 5LHGA 3NNRA 3H1CA 3ERMA 3OYMA 5HAWA 1BI1A 2W82A 1XGOA 1YE9A 4LOCA 3CDHA 1MBFA 2MC4A 4GFBA 1IRXA 5EEGA 3L2RA 2P5LC 4GFKA 4TV7A 1N75A 2CH0A 5ICCA 4R8HA 1IXRC 4CCLA 5E1WA 3LSRA 3TEDA 4MNUA 1VQMI 4LLNA 1ZQ3P 2HWVA 3K4MA 1QZYA 3LA2A 3EDPA 5LEJA 3VSKA 1HDPA 2DBBA 3KZIC 1S3JA 1PJRA 2L9SA 2R7OA 2LBFA 3HPGA 2YPRA 4S05A 3J80K 4MFEA 4EJWA 3S2WA 2Y30A 3KFWX 3U21A 2CQXA 2MGQA 2WV0A 3A0HC 4ESJA 4Q48A 3CDIA 3G71I 2TCTA 1R9TJ 1W7PD 4UB6C 2FU4A 4XR6A 2IS4A 2GBYA 1ODDA 4OAZA 4XLPF 3FBNB 1W5CC 2GIZA 4L9NA 1BOBA 3O3KA 1P7JA 2DA1A 1U5TC 1TBXA 3JREA 2K3FA 3AAFA 1T2KA 2F4IA 2OUMA 1IN7A 3BP8A 3OIQA 5IT3A 1B6AA 1W7PB 2IA0A 4AD9A 1Z21A 3TO6A 2L4MA 2GOXB 2E1MB 2WTEA 1R49A 1LDJA 1JJ8C 3PPBA 3GZ5A 1TZLA 4V2GA 2L9NA 3CQZJ 3DU6A 1B1BA 2Y75A 3OYLA 3KP3A 4XONA 1I6XA 3JRHA 3VW1A 2BY0A 2VIXA 3JSOA 2R7ZJ 3E0JB 4YIFA 2R5ZA 2XAJA 4F52A 1Y1WJ 4HF2A 3W6KB 5D5UB 1V54H 4CHUA 1RZ4A 2M0MA 3SXYA 1K4TA 2UZKA 1UI5A 3PUFA 5AQCA 2GAUA 2LD5A 3DPLC 2A5WA 5FMPA 3J81Z 4WIBA 2VXZA 1Y56A 4HV6A 1P7IA 3PNTA 4BS9A 5F1JA 5BQTA 4Y13A 1O4XA 5GPCA 5D5WB 1T33A 1YX5A 4NN1A 2XRLA 2KLOA 2IGMA 2DK5A 4AF5A 3HL2A 4GCVA 1FTZA 1I1SA 2YU3A 3HB9A 4BJ6C 1D5YA 4LLGF 2B0LA 4A3CJ 2XASA 4NHJA 5L3GA 2DA7A 2DTZA 2GWRA 4F93B 1S72I 1HBXG 5KVRA 3GF2A 2VJ4A 5J8FA 2OTJI 2JA6J 2DPDA 2Y9ZA 1I1GA 5GAHJ 3ZQHA 4FHTA 4KITB 1ETVA 2IU5A 3A03A 2Z2SB 4KIBA 2BXZA 1A31A 2M34A 2FQ4A 3K4CA 3RKWA 1FY7A 4DZJA 3VVXA 3H9GA 4DNCA 3RD3A 4M3FA 3W2VA 1ETQA 4WX9A 1ZRDA 4BDYA 3BJOA 1XN7A 5C4JJ 3MZ8A 2DI3A 3BR3A 4HX7A 4Q47A 4O5VA 2CQKA 1E3OC 2EK5A 3CP8A 3CCSI 2UWMA 3OSFA 3JR9A 3QYBA 3DBHB 4PUSA 1H89C 4GYGA 1TNSA 2M0CA 2YUSA 3H5NA 2PMZA 2R7SA 3RYPA 5IOZA 3OS1A 2Q0OA 1R4MB 4XMYA 2VQGA 1ORKA 1FMWA 4L5IA 4C2TA 1Z3YA 5HSZA 3ZPLA 3MN2A 3KP2A 2DA4A 3K70C 3I5UA 1OCTC 1VZ0A 3LAPA 3WTWC 1OKRA 2OBPA 3GMEA 3CCRI 3FMRA 2FA5A 2GQQA 4FX0A 1T39A 4EM2A 1ZARA 3JRFA 4EQQA 5L3DA 2PBXA 1A35A 1G3WA 3MMYB 4I01A 2X9DA 2GZWA 2BW3B 2ID3A 3LSPA 3AKZA 3PO2J 4C2MJ 1P2FA 2IS1A 2M5WA 2CQQA 1FOKA 3U1KA 4U87A 1AHDP 1IN8A 3WTZA 3AL0C 1W5SA 1PP8F 3QU6A 2R7RA 4D7NA 1GT0C 1R00A 4RGUA 2DMPA 5DAJA 1YTYA 4NC8A 3LOCA 3VYSB 1E2XA 3P7NA 2DTRA 1KYWA 3VUQA 3I56I 4J19A 2ESNA 2ZNZA 5DCMA 1FBQA 2D45A 4GDFA 3NAUA 2KJBA 2M7BA 3TW7A 1I6HJ 3HM5A 4BQQA 3F23A 2M9HA 3GLLA 1X3WB 1T6SA 3L2CA 1T0FC 2GM4A 2GA2A 3V7CA 1DDNA 3WTXC 4L0YB 4ANJA 2ISYA 2HTSA 2QENA 2VI6A 4CCNA 1YI2I 2H09A 2HYGD 2M30A 4MIMA 3LSIA 2UXIA 4HSTA 4IXAA 4CA0A 5ILSA 3N97A 2RNJA 5E20A 4IPAA 4AIDA 2YVHA 2QYOA 2J5PA 3P9KA 3TDUC 3BR2A 4BQOA 4BEHB 2KIUA 4ZYGA 1QQIA 1IRFA 3HSFA 1Y6IA 2ZFUA 4EMSA 1VQ9I 5IT9Z 1QVUA 3A01B 4UUSA 3BZCA 1SMYF 2DOEA 2L02A 5HODA 3LA7A 4UV8A 4JP0A 2K27A 1R7JA 2E19A 3H5RA 2CV1A 3TGNA 1YG2A 5CPRB 3OL3A 5M5WJ 2QCOA 3DEUA 5E8IA 2O6GE 3HSEA 1JUMA 2DJIA 2L4AA 2ACJA 2OQRA 3AG3H 2R7QA 3BT9A 3NWTA 4BQAA 1VTNC 3OYGA 4K2EA 2EA2A 2ZOYA 1LFUP 2JK3A 2EZKA 1XC5A 1F9NA 1X19A 3K2AA 3DPTA 3IH3A 1RKTA 2LY9A 2ZJQF 2QEXI 3VSLA 2LVSA 3LSKA 3JRGA 2HYFA 1L0OC 1WQ2A 2HOSA 4HV5A 4C3IJ 1QA6A 2DDBA 3BQYA 5FKMA 4UDSA 3CC7I 2CW7A 1R1UA 4HPQA 1FEXA 2LBFB 3B81A 3BR1A 2PN6A 2Y69H 1RI7A 1FBSA 3CJTB 3I3LA 4N0BA 4A3KJ 2R7VA 3ZQ7A 1RUOA 3OYJA 5ILVA 2L7KA 1S7OA 5H6QA 1QZEA 1OCCH 1OYIA 2QKLB 3BG9A 3C2GA 3TW6A 1XDSA 3JRAA 2X1DA 1G3TA 3A2KA 3HOZJ 4CSWA 1KONA 2LK2A 2EQRA 2XAFA 4B3XA 2HVSA 2VJJA 3C18A 1R23A 3WG9A 2D5VA 2OF7A 4XOTA 2G7SA 5FLXZ 4IHTA 2ECCA 5CVJA 4CUGA 3P9IA 4L9VA 3VTIA 2QQBA 3CCQI 1OCOH 1XGSA 2I10A 4ZZLA 5GTIC 3G3ZA 4JBAA 1R71A 2O9LA 1UI6A 1P9QC 3M3YJ 1VQ6I 2LFBA 4RS8A 1BIBA 2VE8A 2EIJH 1JUPA 4R1HA 4KDPA 3ON4A 3CCMI 3DWLE 3PL8A 3AG1H 1XCBA 2CSOA 2GIVA 2XPWA 3A4CA 3ZXSA 2PFBA 4BKXA 2RGVA 2DU9A 4E7SA 1HLVA 1P92A 4IHXA 2ZOZA 2XGEA 5DUIA 1WSUA 5JR3A 4A93J 4P96A 4E6KG 2W4SA 1U9NA 3I4MJ 2VLAA 2P7CB 1G2HA 1DUXC 2BY2A 2R7DA 2VN2A 2D2WA 2HU9A 4AUXA 1H9TA 2H1KA 4L0ZB 3NI7A 3DQVC 2F2EA 1I50J 4G7ZF 2B7EA 3M7GA 3LSGA 3HJEA 4QTRA 2LF8A 1Z6RA 3U2RA 2RASA 5CVVA 4DBQA 3H92A 3F22A 2NVTJ 1VQNI 1BN5A 4D1QA 1LNWA 2R5YA 2FNPA 1FC3A 1MMDA 3GFLA 2VL8A 3OOPA 5J6XA 3F6OA 3FF5A 3KEYA 3KCCA 1A6QA 1HQCA 1ON1A 4YFNF 1IV6A 1IAWA 1Z77A 2K3PA 4O6JA 5FFZA 1H0MA 2Z99A 4Q5SF 3CJRB 2KHMA 3WGGA 1LPQA 3GTKJ 4Z2YA 1K6OA 1O3RA 4A0XA 3HOVJ 5F04A 3LQQA 1UCRA 2XROA 2ME6A 4BXUA 4OIRF 2NP5A 2Y31A 2KDZA 2DMUA 2FBHA 3CCLI 2XDNA 2LNBA 4YELA 2DJNA 2WB1N 4IEJA 2B63J 1JKQC 1MIJA 1OPCA 4FASD 3FX3A 5F6FA 1SFKA 5HDNA 2NXNB 2HOAA 1PYVA 3Q0VA 1ZELA 5FD5A 4IO9F 5BOXA 3SDBA 1BL0A 5IP9J 1IUFA 2VXDA 2AO9A 3W2WA 4F7ZA 3OSGA 1JT6A 1DGRM 3BDDA 3CC4I 3BJAA 1FOYA 4FISA 5LRSA 2XF6A 4JOMA 5CVRA 1O3SA 1HKSA 2LREA 2FE3A 3R61A 1LE8B 3HE0A 1I27A 2V4JC 4B8XA 5L3CA 4A3EJ 3IUVA 4XLHA 2UXPA 1XS9A 9ANTA 2D1VA 1USTA 2VT3A 4GYIA 5D6FA 2RREA 4HF0A 2X6YA 2NNYA 5L3EA 3LSMA 5J1YA 4YG2F 2DG7A 1EV7A 3C2HA 2NS7A 3FK7A 5BMZA 4N9IA 4LB5A 2QIBA 2DA5A 1W0TA 2HPMA 3EUPA 5K7FA 1OFCX 2YX7A 1J59A 5L3BA 3HTAA 3AFHA 2R92J 1EKEA 3MAJA 1E0EA 1X4PA 5IPAA 4IL6C 2CV2A 3PASA 3K1NA 4P5OA 4XORA 1ETXA 3M1CA 4HDVA 2EFQA 2DFIA 1SGMA 3FK6A 5F0HA 2DCEA 1Z9CA 4UNOA 5HBUA 1MNEA 1XX5A 3K1MA 4U0VA 4A69C 1R58A 5GAEJ 5ICGA 2ZXIA 4PXIA 2E34A 1ON2A 5JLWA 3OS2A 5J3LA 1JGGA 2CFXA 3QU3A 3PFIA 3QKXA 1CQTA 3V42A 5EJCA 5DCMB 3K9TA 4DQ2A 3G56A 3IH4A 3TMOA 4EM0B 4GCTA 1MJAA 2GXBA 2KRFA 5BNGA 3Q0UA 5TJJA 4BU2A 4A0YA 1I3AA 3KP4A 3E5XA 1LVKA 4PDKA 3BPVA 2Z5UA 2K4JA 5FGMA 4LB6B 2HEOA 3GEUA 2K9MA 1YQAA 4NB5A 1X3UA 5D1RA 1D3YA 2P5KA 2O61A 1WJ5A 2H94A 1D8KA 4B47A 1V3FA 4HEA2 3F0CA 2M8GX 1STZA 1IG7A 4ZYAA 3GCMA 1S7EA 1CF7B 1KU2A 4UUSB 3KEQA 3KZ9A 1RR7A 3GFJA 2O0YA 3D5SC 1ZG3A 4G8XA 3M4OJ 2P0WA 2K02A 3J80Z 3SEZA 2DODA 2W53A 5ILUA 4UB8C 3LSTA 1V4RA 5M5XJ 4BJTA 3BG6A 3NEUA 2R7UA 4UY8I 2Z3YA 2HDWA 3I53A 4I76A 5FJ8J 3Q5FA 3RKXA 4P9FA 5JLXA 3IC7A 1SVMA 4LD5A 2VT2A 2PJPA 1JHHA 2DYSH 1E3HA 1R1VA 2VC1A 1O3QA 2NRAC 4PGGA 4RB3C 1IXSB 3H36A 3S2DJ 4XRSA 3T5XA 2NVXJ 3EQLF 1WJAA 1FYLA 3UNGC 1IDYA 1IUYA 3M9AA 2Z9OA 1F36A 2FRHA 3BG5A 3BTIA 3JAMZ 4P9UA 3SHFA 2K40A 3RKQA 3IL2A 1ZHFA 2O03A 5M3MJ 1RESA 4DYQA 1QNTA 2JUGA 4CYCA 3LHQA 2VJIA 4CCKA 3CCJI 2JA2A 3MZYA 2XSDC 3KEOA 4MO7A 4FT8A 3SZTA 1VFCA 3ABLH 3BQZA 1D0YA 2XAQA 3KLOA 3H5AA 4PJJA 3TO9A 1TNTA 5D19A 2V1DA 1U3EM 1U78A 3TQNA 2ADUA 1TL8A 2VKDA 4XLNF 4HNTA 2P4WA 4FTHA 4EGZA 1NG7A 1KU9A 2UXUA 2H8RA 3FBIB 3DFGA 3CCUI 2VKVA 5HOOA 4F3QA 5EF6A 5IP7J 2BBYA 5FRNA 4FCYA 1E17A 1W1WE 3S5RA 2K86A 3PNVA 2EV6A 4I09A 3IRRA 3K4JA 3OYKA 2Q2EA 3CO7C 1L3LA 3T1BA 4ETSA 4HSRA 4HF1A 1G3YA 1MD0A 2MSYA 3E7LA 2DMNA 4AIJA 1W5TA 2XPVA 2MH2A 2WY8Q 3GYHX 5KK1A 2UXOA 1WCMJ 1X58A 2PI0A 4LIVA 2NS8A 3CJNA 2WBMA 3EUHC 3CCEI 1DP3A 2HQAA 3PO3J 3QP6A 4LITA 3F3XA 1T38A 1XMKA 1Q1VA 1SD7A 1RRJA 1D0ZA 2IP2A 1EH7A 3NWSA 4UHTA 2C6YA 2LKXA 5D8KB 1FNNA 4XKWA 5J40A 4KN7X 2W57A 4NC6A 5DEQA 3S8PA 2HQ5A 3LMMA 2VBZA 1MNDA 3L7WA 3R6SA 2BYVE 1Z6TA 2O7TA 2LF7A 1KA8A 3FMSA 3KE2A 4BXFA 3KX2A 1ZLKA 3DTEA 2R5YB 4CICA 4U7BA 2CFOA 2I8DA 3K69A 5HLGA 3J7AO 1QU3A 3WTVC 2KQRA 2G0EA 4I2OA 5HVQC 5HLIA 1MKMA 4ZYHA 1FX7A 2YVXA 4KISA 1TWAJ 4I0BA 5AIQA 2IRFG 4G6DA 4DJAA 1D1BA 2IGKA 3QODA 1B72B 3ZN1A 3DU5A 2ZY9A 1ETOA 3OR1C 1OYWA 5HNHA 4U0YA 1NK3P 2XF5A 1HOMA 3GW2A 4A3BJ 3KKCA 3FM5A 2ICWG 2L7ZA 2QOPA 2LTPA 4N4OB 2EJRA 1LQ1A 1RNLA 1DQUA 2ZO4A 4BNCA 2ZB9A 2HR3A 2DYRH 1QPMA 3MKLA 5E18F 3C07A 2E2JJ 4M3GA 4IHYA 4LFUA 4OIPF 4BE1A 4BHBA 2PFVA 1N25A 4RB2C 5ERIA 3WU2C 2OI8A 1Z3XA 4KN4X 4JKZA 1MMAA 2KISA 1IW7F 1D5VA 5EZHA 1NHAA 4EJTA 2P5VA 2L5QA 3CUQA 4IRGA 1MJ9A 4RAZA 5IOYA 3IKVA 2EFNA 1D8JA 3LL7A 3I64A 1YW9A 2EZIA 3DTKA 5GADJ 2R7XA 5FB2A 3HEFA 1MH4A 3CZ6A 2KP6A 3TO7A 1R22A 2CO5A 2V7FA 1RPWA 3VOEA 1T08B 3K10A 4LK1F 3G73A 2D6YA 2A68F 1W36D 2QA4I 3F72A 3OYCA 4MXMA 4XSZF 3C7JA 3M07A 3W6VA 1QO0D 2A6TA 2K9SA 4A5NA 1TWHJ 3FIWA 4KMFA 1JHFA 1M1EB 1K4SA 3BCAA 3CF5F 3O6BB 4AC0A 2PJRA 2F4MB 4DOZA 1ZYRF 5LHIA 2M4KA 1TP4A 3IUOA 4CXFA 1A5JA 2FMYA 3L2QA 1QRYA 1UHSA 3BC8A 1IF1A 2JJ7A 5CQEA 3BLYA 3ABUA 3T8RA 1ETKA 5IYCJ 1XSXA 3FXLA 1QBJA 2NVYJ 1BI0A 3AQTA 2N8GA 4XLEA 3OYHA 2QWWA 3LFKA 3IHUA 5DD4A 2ZXJA 5J4YA 3RI4A 3HTIA 2VPRA 3O2PE 5K58A 4W1UA 2MA3A 1LVAA 4J01A 2W00A 2HOTA 1HC8A 4BHPA 2M45A 4XLAA 4PK4A 2XRNA 5CVUA 3HZJA 3VPRA 5KHDA 2EZHA 2EA4A 3T0YA 3M8EA 2IPQX 3SWHA 4C2MA 4XK4A 3G1LA 2CQ7A 3QYEA 4M3DA 3E6MA 2IT0A 4U7DA 2HDCA 4Y33A 2B1EA 1WH5A 2KKOA 2GOMA 2BHZA 2IAIA 1BC8C 4RGXA 1NTCA 3CLOA 4QIWN 2EILH 2DOFA 2H6CA 2MW8A 3QOPA 3CESA 1XMXA 5FKOA 1XG1A 1HA8A 2XB0X 2O5RA 2DT6A 1D0XA 2MYSA 2P81A 3H3UA 4PSWA 5GTHC 3IAM2 1LE8A 1OCPA 3VWBA 3HPHA 4QPQA 1YRNA 3WU0A 3S17J 1MGTA 3ERED 2FOKA 4UUTA 5C4YA 3CUOA 4IVNA 1KZHA 4ZJZA 3JRCA 1Y39A 2BV6A 3OYAA 2B3WA 2X4HA 3S14J 1Y8RB 2XB5A 5H2FC 2WADA 3DV8A 2F48A 3WE3A 5LGUA 4ESFA 1TW3A 5D8LB 2HPIA 3FXOA 2QM3A 1QVTA 3Q3SA 5L3FA 2STWA 4FE7A 3MCZA 3PNYA 2VOOA 1WGXA 1ZH5A 4RAYA 3HTJA 4XQFA 1HCRA 3FKIJ 2QWTA 2GFNA 3RKYA 3ELKA 3T8TA 1BR1A 2LY2A 4DZPA 2E1MC 1RUNA 4CYCB 2IGNA 4C9YA 4QLCU 2ESHA 1ONVA 2Q24A 4XRSG 4KYWA 3BJBA 4EJVA 1BBYA 1ENHA 3H0GJ 1XGNA 3R0AA 1AOYA 3O60A 2ZFWA 4I99C 2E71A 3FRQA 3V6GA 2QVOA 2ELJA 2P6TA 3LJLA 3PJRA 5FROA 4YIRX 2R7WA 3NXCA 2Z16A 1NG6A 2XV4S 3GVAA 4S04A 3OY9A 2IVMA 2FUG2 2CYYA 4E7IA 2R7FA 4KUMA 5C3EJ 2FJI1 1Q1HA 2Q2EB 4A3GJ 1UHWA 1TW2A 2F6CA 2HFHA 3D5RC 3FM3A 4FQGA 3OYEA 1FOXA 4H4KC 4CCJA 4ESBA 2H27A 2OPTA 3G4SI 3IAS2 3PIPF 1HW5A 4PJMA 3ZP5A 2LG4A 2K5CA 5F0CA 2G7UA 1CF7A 1IZ1A 3L2WA 1MSFC 2A05A 3V8KA 4DGWB 2HYJA 3ZR8X 1HDDC 3HOWJ 2KIQA 4ZTFA 2F4OB 1T95A 2YS9A 3VB2A 5EYRA 4D7MA 1IN5A 3HGYA 4ZH4F 2RKHA 5GP9A 3PSIA 5AIPA 4HW0A 5EFYA 1TT5B 2E35A 5BPDA 3F9KA 3LNQA 1T98A 2Y48A 1FIAA 4IHVA 4KMUX 2UUZA 5HS7A 5D5VB 2BVLA 3ZOBA 4RLFA 2OJED 1O7FA 1FT9A 1S7AA 2P7VB 2V6CA 2GXAA 4BY7J 1WJDA 2JT1A 3F1BA 1B9MA 4B4CA 2WGBA 5IYBJ 2MABA 3HG9A 3REOA 2X1CA 2GLOA 2W48A 4IQ4A 2CW8A 1FJLA 4X1EA 2R0QC 1TC3C 4UVCA 1EH8A 1OJLA 1UG0A 3WTYC 1VQOI 3OR2C 3ZQGA 3CRJA 1O7LA 3GZNB 1GXPA 4G6TB 3RQ4A 2NVQJ 3MVPA 2CUJA 3OIPA 1ZK8A 2HGCA 4ZDOA 1BA5A 5E1XA 5K7HA 1U5TA 2DPUA 2V57A 4G94A 1FBUA 2L9VA 3MWMA 3JTGA 3GTOJ 5TISC 1BW5A 4V2FA 1R5GA 2FBKA 4Y7NJ 3HRMA 1X1BA 2R7TA 2DMTA 4IF4A 1IN4A 3DBLB 2BGCA 2F5VA 2HQNA 1K6YA 4L9TA 1BM9A 4O3MA 4WXCA 3FHZA 4D0PA 3CUQB 1FIPA 3DPUA 1KQ9A 1OISA 2L2OA 3TDZC 4ICHA 3CJDA 1YHQI 2PX9A 1YW8A 2WB1A 3QAHA 2V9PA 1ZG1A 1BR2A 1SAXA 4KICA 5DV5A 1G59A 5B1BH 2QBYA 1WI9A 2QLZA 4YFKF 1UJ8A 3MKWB 2WY7Q 2VBWA 1IXCA 1S6LA 2R3SA 3E6CC 5GPAA 4KT6A 1V5GA 2ZCXA 1YIOA 2E5NA 5LHHA 1X2NA 3B6AA 1WHUA 5LBQA 4C2UA 3I4PA 2PJRB 1A6IA 1QHHD 5DCFA 1OCZH 2EIKH 2L54A 5CLSA 2LOOA 3HTSB 3ASOH 2ID6A 2ZMEA 1GV5A 4XICA 4OWRB 4HOBA 4BUPA 3I58A 1DPRA 2LC2A 5FKLA 2WA0A 1GVJA 3F21A 5EEAA 4A3FJ 2HNHA 1OCRH 1SFUA 5LGNA 1ZR2A 4YRVA 5LGTA 2RQQA 2AXLA 5DS9A 2VPLA 3ABMH 2FBQA 4ACIA 1QPIA 4I7HA 2MG4A 2KIFA 3V8LA 3J7YJ 1VQ8I 2YSRA 2K9QA 1SC7A 1B72A 2F5EA 4RM3A 3RH2A 1P4WA 3HXLA 1JKPC 4IHWA 3B73A 3JRDA 3LAJA 3SDGA 4XKBA 3HOSA 1IRZA 2OD5A 2Z33A 1TWGJ 5D18A 3C1DA 3J7ZI 1OQYA 3CCYA 3RZOJ 3VEPA 1Y0UA 1Y1VJ 2K85A 3VYUB 3IKTA 3DKXA 4UVBA 1RIOH 3GTMJ 3I71A 4U9LA 3ROUA 3LQRA 1V5EA 2FD5A 3TOAA 1U2WA 2EZLA 5IT9K 2XC7A 2RHAA 3HIFA 1MZBA 2FQ3A 4QSHA 1ETWA 2CJJA 4A5MA 1I39A 2NAZA 4NNJA 4XSXF 5CXIA 3M8JA 4HLYA 3S2HJ 2YVEA 2EIMH 2V79A 2XGCA 2XGXA 1YRNB 4B09A 2E7WA 1BI2A 2IA2A 3C2BA 1R36A 1EF4A 1B4AA 3I55I 5EEHA 3CP2A 2R4GA 3EUKL 5CQGA 2ZSIB 3OOUA 3BR6A 3RTRA 3GUDA 4FETA 4UXNA 3TBIA 2W7NA 4HDUA 1S5LC 2NX4A 4AVZA 4P1WA 1GDTA 1Z91A 4KIFA 2KZGA 5F08A 3FMQA 3LSJA 1BR4A 3K7AJ 4HQEA 4EGYA 1ZGWA 1FOWA 4UVAA 3ZMSA 2UV1A 4Y3OA 1KU3A 4M6XA 1MBKA 1JTXA 5BS6A 3KP6A 2KMUA 1TQMA 2JWTA 2K9LA 2MBFA 2ZKZA 1WJCA 4RDUA 5M3FJ 2LP0A 3ESWB 2DN0A 1WKMA 2L0KA 1ZRFA 1HKTA 4M72A 2M8EA 5IY5H 1LKXA 2LH9A 3IV5A 5IP6A 2OERA 1MMSA 2EV0A 2BZTA 1T0FA 2HKOA 2M1BA 2QGUA 4BYYA 4F55A 2DO7A 5FKKA 3NS4A 4EVIA 5E79C 5FKNA 1MMGA 3CF2A 3T6NA 4IRHA 3NARA 2NP3A 2WAQA 5FLXK 1Z1DA 1VF9A 2QKMB 1XDUA 2QSHX 3BTLA 2G7GA 3CJQB 1FLIA 1QZZA 5LRRA 2CUZA 3CMEI 2CWEA 4HBLA 3CTAA 5C44J 3RJPA 3JSJA 1BC7C 1ZREA 3DKYA 4P55A 2QQ8A 5D4RA 1QHGA 5J4VA 4PCQA 1BOAA 2ELHA 3MKYB 2B9SA 4BY1J 4PSXA 5C4XJ 2DMQA 3MQ0A 1FMVA 4S0HB 1TLHB 4RAFA 4J00A 4HLXA 4ENKA 3CO6C 2KIMA 2VODA 3SFZA 2IBDA 4L18B 1XD7A 2CQNA 4XM3A 1V5FA 4JX6A 2YX4A 5DTDA 3OIOA 1MDMA 5DM6F 1J0RA 3F8MA 2XAHA 2ISZA 2VQCA 4AYBA 4XNFA 3A0BC 4A3JJ 2PLYA 2BHYA 4BBRJ 2XKPA 3QPLA 2G7LA 5JHFA 5EZGA 4XOPA 3G7RA 4G7OF 1UZCA 2VC0A 1UAAA 2WAQN 3BCBA 2DAOA 3ZQQA 2DT5A 5FGLA 1MBGA 4Y17A 3KPHA 5J47A 2LDUA 4R79A 2RC4A 2V1NA 5DDGA 5ICEA 2JTVA 3HKZN 2EH3A 3HOTA 2LKPA 3S32A 3L9FA 2JSPA 3QP5A 3E5UA 3DLLF 1VQ7I 1XMAA 3OYNA 2DOAA 1GUUA 3H9JA 1S9HA 3NQOA 3V8JA 3JCUC 4C30A 1CGPA 2CRGA 1KGSA 4X0GA 3H35A 4L9JA 4ASNA 2QSGX 3K4LA 1BJAA 1SVOA 4E70A 3BZKA 3H3VK 4CH7A 2KDOA 4D5FA 2WWYA 1U5TB 5JVGF 3VP5A 3NRGA 1IGNA 2KPMA 2HQRA 3BHQA 4XLCA 3S3OA 4KFCA 3UR3C 3FZVA 3D1NI 1AKHA 4BDZA 1G6NA 2ETHA 2JZYA 5F0FA 4AYBN 3DBRB 4BACA 1UELB 4PJ0C 3BROA 5E3MA 2E1OA 2IW5A 1ZGAA 5D6EA 4MTDA 3COLA 1H8AC 4M6VA 5KAFC 1GHCA 2CG4A 2BOLA 2Y0SA 1P4AA 4I02A 5DD8A 5K5QA 1O3TA 3EPZA 5IYDJ 1Z05A 3A02A 3ZQFA 1TTYA 1R6RA 1REPC 3E6DA 4A2UA 1WJFA 1BI3A 2MC3A 3EYYA 5JI6A 3L1PA 5E3NA 3OYBA 2QBYB 1LB2A 2RVCA 4LMYA 4B1RA 4MGRA 3BTCA 1UFMA 3DP7A 2WAEA 4YFXF 2Y0MA 3QPHA 3KETA 2QZ8A 2JVHA 1KU7A 2W84A 5K5OA 2EINH 4RGRA 2VKHA 2JN6A 4G12A 5CJ9A 4YZEA 3BR0A 2L3DA 1J9IA 2ZMEB 2BXYA 2JUCA 4AM3A 3V78A 2REKA 2RV8A 3SQNA 3AG2H 1MBHA 2DQRA 2Q8KA 2HYTA 3V4GA 1WFXA 1SFXA 3HBLA 3ZMDA 1MJBA 4ITVA 1YO5C 4B44A 1Y0NA 3ASNH 3I4NJ 2HKXA 2K7LA 2HZTA 3SEQA 5B1AH 2MLGA 3H3ZA 3RPUA 2XAUA 2D1HA 4FX4A 1GV2A 2M3AA 2Y0SN 2ZJ2A 4NC7A 2NVUB 4HX4A 1HKQA 3IWZA 4RAGA 1FP2A 3BY6A 2ZCWA 4ZDLA 1XCVA 4OMZA 5FD6A 1FSHA 2OZUA 3C3WA 1YX3A 3UKGA 1UMQA 5LFAA 2F5CA 3JRIA 3S1NJ 3GO5A 4KT5C 2PG4A 3LSHA 5JVTA 3FXQA 1VQPI 1ITYA 3K70D 4M6YA 1YIJI 1A36A 5DYMA 1VQKI 3IWFA 2VUMJ 4XL9A 4HYEA 4RBOA 1WJEA 3O8HA 2ZJPF 2E1NA 4AIKA 1Z67A 4C3HJ 2PBIA 3K0LA 4PFOA 1H88C 1LJ9A 3HC7A 3KYDB 4B3AA 4XRFA 1WWXA 3ZCOA 3BZ6A 2A61A 2FMLA 4NDLA 4DW6A 3FXMA 2JA8J 4WK8F 3KP7A 3ZQIA 4IRIA 3QQAA 3JW4A 2KRCA 1VI0A 3S15J 4A3DJ 3ONQA 3G1MA 2VQLA 1POGA 4X6AJ 3CC2I 3DKWA 2H6BA 1LUJB 1W4MA 1LFPA 1WI3A 2KJCA 2UXNA 3Q0WA 2DG8A 5KNLA 4H0EA 2RDPA 1TT0A 2HXIA 3R4KA 2AXTC 3L00A 4U9NA 3MNLA 3GTQJ 3IRQA 1YFHA 4N9HA 5B3SH 2G7HA 3X2QH 1JT0A 4E7LA 5K1YA 3ZQCA 3QBMA 2V9KA 5EGOB 3S1RJ 3JAMK 3AL0B 4HA8A 2E5ZA 4XLFA 5KAIC 3RYRA 5A2QK 4NBQA 2I5UA 3LWJA 1LDKB 1SVLA 2XSJC 1Z7UA 2EFOA 4WXDA 1WH7A 3VYRB 4CGRA 1W0UA 2LR8A 3I0TA 4CZCA 2ZXWH 4GRIA 3S3MA 1FYMA 3K2ZA 4GCLA 2KL4A 4MK6A 3HRSA 4PFPA 4EATA 2FF4A 1K83J 2X51A 1JGSA 1OLTA 2PZ9A 5E17F 1IC8A 3NPIA 3I59A 1B9NA 1K7AA 2LYCA 4NQWB 2K4BA 5GAGJ 4JK1X 1J5YA 4OU0A 4E7HA 5EDNA 3L2UA 2A2FX 2KRHA 3G2BA 3KP5A 3WHCA 1JKOC 1X4OA 1KQ0A 3PUBA 3OYDA 3HUGB 3BNIA 1FZPB 5FFXA 2O8XA 2FXAA 3RCOA 5F1RA 2ZMEC 1ZTRA 1F1ZA 4MFDA 2VE9A 3TKYA 4M9SA 1Z7LA 4LIUA 3S1MJ 3F8BA 1B59A 4KJZA 2FJ1A 2E36A 3BJ6A 3VW2A 1YOVB 2EV5A 3WTTC 4AC6A 1BIAA 2NOGA 1KQ8A 2GUHA 1X3ZB 2MLKA 3OL4A 2EFPA 1U0JA 3BPXA 3I54A 5B5EC 2JPBA 5FRMA 3MEXA 2A5YB 4HRIA 4IRVA 1MH3A 3IP4B 5ED4A 1U8RA 1HF0A 2CW0F 5TGTA 2BEOA 4JL3A 2UXXA 3VOKA 3DTIA 3LFUA 1K79A 3VIBA 2J5OA 1MDMB 4RGSA 3RPQA 5LLQA 4F92B 1RKWA 2O3FA 4ME9A 4GXOA 5DUKA 3TL4X 3HSRA 2FSWA 3L09A 1WPKA 4ENJA 4ZTJA 5HNFA 3G6EI 2IS2A 2DLLA 2LRDA 4IX7A 3DF8A 2V9VA 1EH6A 1OR7A 3CCVI 2AS5F 4IOAF 3Q9SA 3MD2A 2HVQA 4M3EA 3U1DA 3V7RA 5HDKA 3GTJJ 2YU9J 1XPXA 2NS0A 1X1PA 1J75A 4M9ZA 3MFKA 5D4SA 1AU7A 1PP7U 1LDDA 1P4XA 4XBFA 4KNYA 2JA7J 4AIHA 1C0WA 2COMA 2XUBA 1BJZA 1IRGA 2DFEA 3SZPA 3E97A 3LA3A 2MD5A 1BW6A 2HTJA 4I0AA 3W2AA 4MEYF 3ZMTA 3OS0A 2Y2ZA 3GWZA 4MEXF 1V55H 3BCGA 4IZZA 3HOUJ 3VVYA 2IA1A 1DU6A 3KKDA 4IOCF 4Y4RA 1DGWY 2E2HJ 4KIGA 2QQ9A 2K9NA 2VB6A 1PUFA 2M2EA 1AKHB 2FEZA 3DEWA 1ETYA 2OU2A 3M1EA 1N77A 3P9CA 1SD6A 4E4HA 3OMYA 3CWRA 3DEEA 1R1TA 2Y9YA 4Y15A 5B66C 4ZC3A 1YS6A 4MLOA 2G9WA 4MTEA 1XTAA 3HOYJ 3Q9VA 2WC2A 4BHCA 1AA7A 2PMZN 1W36C 2ZCMA 3EUHA 5H20A 2CU7A 3PSFA 4BJ5C 1ZLJA 5JFRA 1X1CA 4I6ZA 3D0SA 2QQAA 2CUEA 3BOQA 2ECBA 3K4KA 1B8IA 4RB0A 3CMMA 1G4DA 2OC6A 4LG0B 4IQJA 3CDLA 3COAC 5FHPA 1GXQA 1MW7A 2NOJB 4D9JA 3S3NA 1XSDA 3RPUD 3ZMUA 1APLC 3JTHA 1SANA 2KT0A 2MFZA 2DFHA 4Y52J 2E1CA 3FDYA 3J81K 2JPCA 2W25A 3VFZA 5HS8A 1WZ2A 3GTGJ 5ICFA 2V26A 4N4NB 4PZJA 4OIQF 2DQLA 3WG7H 1HXDA 1JI8A 3LWFA 2GENA 4BL0B 2WV1A 4PJLA 1LFBA 3BR5A 4WF2A 3HHHA 1VQLI 2ME0A
chains in the Genus database with same CATH topology
2RAEA 1YRNB 5D19A 1FTZA 1U78A 3C2BA 4FTHA 1EF4A 3EGQA 2UXUA 3DPJA 2H8RA 3HB9A 1D5YA 3OOUA 2VKVA 3BR6A 4A3CJ 5EF6A 5IP7J 2DA7A 2DTZA 2O7OA 4FCYA 3S5RA 4A3MJ 2NX4A 1GDTA 3JRBA 2JA6J 2Y9ZA 5F08A 2EBIA 3LSJA 5J1RA 3K7AJ 3ZQHA 2MSYA 3BTJA 1ZGWA 3E7LA 2DMNA 2LLKA 2XPVA 1ETVA 2IU5A 3A03A 1WCMJ 1MBKA 2UXOA 1X58A 1JTXA 2NS8A 3S16J 2M34A 2FQ4A 3VVXA 4DZJA 3PO3J 2JWTA 4RDUA 3IH2A 5M3FJ 3RD3A 2LP0A 4M3FA 2DN0A 1ETQA 4M3BA 1Q1VA 1TWFJ 1Z0XA 2L0KA 2LKXA 5C4JJ 2DA2A 2R93J 1MNMC 3BR3A 5FLVA 5CW8A 2HQ5A 3GBGA 3IV5A 5IP6A 2OERA 1E3OC 2ELKA 2O7TA 3OSFA 3JR9A 5FKKA 5FKNA 1F43A 1H89C 3T6NA 2M0CA 3NARA 2YUSA 2R5YB 2G3BA 2L7MP 2NP3A 3ZQLA 1FTTA 1VF9A 1I3QJ 5IOZA 2JMWA 3BTLA 2G7GA 1ORKA 2G0EA 3B6CA 3CMYA 5HSZA 5C44J 1TWAJ 3O8GA 3MN2A 3JSJA 2DA4A 1OCTC 1B72B 4A3LJ 4BY1J 4D5CA 1ETOA 3GTPJ 5C4XJ 2DMQA 1MSEC 1HOMA 1NK3P 4S0HB 3JRFA 4A3BJ 2HKUA 2PBXA 3KKCA 2X9DA 2ID3A 3LSPA 2L7ZA 3PO2J 2LTPA 2QOPA 4C2MJ 2CQQA 2IBDA 4JYKA 3RQIA 1AHDP 2R5ZB 4JX6A 2ZB9A 5DTDA 3OIOA 4D7NA 1GT0C 3MKLA 4A3JJ 1VNDA 2DMPA 1K61A 3C07A 5DAJA 2E2JJ 3LOCA 4M3GA 4IHYA 3WHBA 4BBRJ 4L5EA 3VUQA 3QPLA 1X2MA 4J19A 2G7LA 1IDZA 5EZGA 1JUSA 5EG0A 3G7RA 3NAUA 3TW7A 1I6HJ 4DYCA 3HM5A 3QPSA 2M9HA 2OI8A 2GM4A 2WAQN 4JKZA 5FGLA 1MBGA 3TP0A 3HGGA 5EZHA 1NK2P 3HKZN 2HXOA 2VI6A 2EH3A 3TP3A 5IOYA 5CXGA 1U8BA 3HIMA 2EZIA 4MIMA 2VKEA 2UXIA 1MBJA 3HEFA 1MH4A 1GUUA 2YVHA 1RPWA 2D6YA 3BR2A 2CRGA 4MXMA 2JA5J 3W6VA 3KNWA 3VW0A 1QVUA 2K9SA 4UUSA 3A01B 3H3VK 4D5FA 1TWHJ 3FIWA 5HODA 3PM1A 2UXHA 3VP5A 4JP0A 4AC0A 3NRGA 2E19A 1IGNA 3BHQA 2L9RA 5M5WJ 2QCOA 3BRUA 1JUMA 3D1NI 1AKHA 3HOXJ 3BT9A 4JX4A 5F0FA 4AYBN 1A5JA 1QRYA 1UHSA 1RETA 4EEFG 2JJ7A 5E3MA 2ZOYA 2E1OA 1LFUP 3COLA 2JK3A 4M6VA 2EZKA 1XC5A 1H8AC 1ETKA 3K2AA 5IYCJ 3IH3A 3VOXA 1RKTA 1UG2A 2LY9A 5IYDJ 2NVYJ 3AQTA 2N8GA 2LVSA 2E2IJ 4ABZA 3GTLJ 3A02A 3JRGA 3HTIA 5E3LA 3ZQFA 2IEKA 2VPRA 5K58A 5EGOA 4W1UA 2HOSA 2HOTA 4C3IJ 3L1PA 5E3NA 3BQYA 5FKMA 4B1RA 3VPRA 3BTCA 4UDSA 2EZHA 1FEXA 3B81A 3BR1A 4XK4A 3G1LA 4A3KJ 4M3DA 2JN6A 4G12A 4YZEA 1WH5A 3BR0A 3BG9A 3TW6A 2IAIA 1TWCJ 3JRAA 1PUFB 3V78A 1NTCA 2REKA 4QIWN 3HOZJ 2MW8A 1IJWC 2DA6A 5FKOA 2LK2A 1MBHA 1XG1A 2EQRA 2DA3A 2XB0X 2P81A 2HYTA 2XGDA 4NELA 4BXXJ 5FLMJ 3HBLA 1LE8A 1OCPA 3HDDA 2D5VA 2QKOA 5J1UA 2OF7A 1YRNA 3S17J 2G7SA 4GCKA 2X48A 3ANGA 4UUTA 2ECCA 3I4NJ 4JX5A 5C4YA 3JRCA 1MBEA 2AHQA 3DCFA 3S14J 2XB5A 2I10A 1GV2A 2Y0SN 2O9LA 1UI6A 4W97A 3M3YJ 3ON2A 2LFBA 3BG3A 2COBA 1QVTA 3Q3SA 2O8KA 4FE7A 4HNVA 1U9OA 5K7ZA 3UKGA 1JUPA 1UMQA 1WGXA 1B8IB 3HTJA 3ON4A 3JRIA 1HCRA 3FKIJ 5M5YJ 3S1NJ 2QWTA 5H9TA 2GFNA 1ITYA 2XPWA 4DZPA 2VUMJ 4BKXA 4CYCB 4RBOA 1HLVA 3AQSA 3O8HA 4IHXA 2ZOZA 2XGEA 1T56A 4A93J 2Q24A 4C3HJ 4XRSG 1U9NA 3I4MJ 2QTQA 3BJBA 1G2HA 1H88C 1ENHA 3H0GJ 4AUXA 4B3AA 2H1KA 3NI7A 4DW6A 4NDLA 3O60A 1I50J 2JA8J 3SJMA 3LSGA 3FRQA 3P9TA 3V6GA 4QTRA 2RASA 3ZQIA 2TRTA 3LJLA 3QQAA 2NVTJ 1VI0A 2F07A 2R5YA 3S15J 4A3DJ 3NXCA 3G1MA 1POGA 4X6AJ 1IV6A 1WI3A 1Z77A 3Q0WA 5C3EJ 2DG8A 2HXIA 3GTKJ 4A3GJ 3HTHA 3MNLA 4FE4A 3GTQJ 3HOVJ 4GFLA 5F04A 2CUFA 3SFIA 2OPTA 2ME6A 1JT0A 4A3IJ 2NP5A 2Y31A 3ZQCA 3QBMA 5F0CA 2DMUA 5EGOB 2KDZA 3S1RJ 2XDNA 2DJNA 2WB1N 4IEJA 1MSFC 3LWJA 2B63J 1JKQC 2HYJA 1HDDC 3HOWJ 1WH7A 3ANPA 2HOAA 4CGRA 2YS9A 4KWAA 2HI3A 3Q0VA 5EYRA 4D7MA 1BL0A 1W0UA 2LR8A 3HGYA 5IP9J 4GCLA 1IUFA 5GP9A 2AO9A 3OSGA 4MK6A 5EFYA 1JT6A 1K83J 3LNQA 2PZ9A 1IC8A 2ZCNA 1FIAA 3NPIA 4FISA 4IHVA 5F27A 3ZOBA 5EDNA 1LE8B 3HE0A 1JKOC 3WHCA 4BY7J 4A3EJ 3IUVA 3BNIA 2UXPA 1XS9A 1GVDA 9ANTA 3F1BA 4JNNA 4B4CA 2WGBA 1ZTRA 5IYBJ 4MFDA 2L7FP 2DG7A 5J1YA 3S1MJ 2NS7A 3FK7A 2XPUA 2GLOA 2QIBA 2W48A 3FISA 2FJ1A 1FJLA 2DA5A 4DYRA 3VW2A 2FX0A 3S1QJ 1W0TA 3EUPA 3RZDJ 5K7FA 1OFCX 4X1EA 2R0QC 1TC3C 2NOGA 3HTAA 1JTYA 2GUHA 5E3OA 2R92J 1OJLA 4AC6A 2QF7A 5IPAA 4BBSJ 2WUIA 3ZQGA 3CRJA 3VVZA 2NVQJ 3MVPA 3PASA 3GZIA 1ZK8A 1MH3A 1ETXA 1HF0A 4XIDA 1BA5A 4L62A 2X6OA 5K7HA 3A01A 1SGMA 3VOKA 3VIBA 4XRMA 3FK6A 5F0HA 5HBUA 4JL3A 4A69C 2V57A 1DU0A 3E7QA 1RKWA 4PXIA 4ME9A 1JJ6C 3GTOJ 5JLWA 1BW5A 4V2FA 5J3LA 1JGGA 4Y7NJ 3QKXA 1WPKA 1CQTA 2DMTA 1ZKGA 5EG0B 1JKRC 1ZR4A 3G56A 3IH4A 4HKUA 3G1OA 4GCTA 2HDDA 5BNGA 1SFOJ 3Q0UA 4C3JJ 4M3EA 3GTJJ 2YU9J 1FIPA 4ICHA 3NNRA 3CJDA 3GEUA 5HAWA 1AU7A 2JA7J 1BJZA 4LOCA 5D1RA 1MBFA 4GFBA 4GFKA 3LSRA 3TEDA 1ZQ3P 1BW6A 3F0CA 2M8GX 2Y2ZA 1IG7A 3BCGA 1HDPA 1S7EA 5GPAA 3HOUJ 4UUSB 2ZCXA 3KZ9A 1DU6A 1RR7A 3VVYA 1X2NA 3B6AA 4MFEA 3KKDA 2Y30A 2CQXA 1A6IA 2MGQA 2E2HJ 3M4OJ 2K9NA 2ID6A 2TCTA 1R9TJ 1PUFA 1GV5A 2M2EA 2W53A 1AKHB 4XICA 3DEWA 2GBYA 1ETYA 5M5XJ 5FKLA 1P7JA 2DA1A 4I76A 5FJ8J 5EEAA 3CWRA 4A3FJ 5JLXA 3JREA 2Y9YA 1ZR2A 5DS9A 4ACIA 2FBQA 1QPIA 4MLOA 2MG4A 3S2DJ 4XRSA 2K9QA 1B72A 2NVXJ 3HOYJ 3RH2A 1JKPC 4IHWA 2PMZN 2ZCMA 3JRDA 2CU7A 3SDGA 1JJ8C 3PPBA 1IDYA 1IRZA 4V2GA 1F36A 3CQZJ 3BG5A 4I6ZA 3BTIA 1TWGJ 5D18A 2CUEA 3CCYA 2ECBA 3RZOJ 1B8IA 3JRHA 1Y1VJ 3VW1A 2K40A 3GTMJ 3CDLA 3RKQA 5FHPA 2R7ZJ 2R5ZA 1APLC 2FD5A 1Y1WJ 1SANA 2KT0A 5M3MJ 4Y52J 1RESA 2EZLA 4DYQA 4CYCA 2RHAA 3LHQA 3GTGJ 4QSHA 1UI5A 1ETWA 2CJJA 5AQCA 2LD5A 2XSDC 5FMPA 4MO7A 5F1JA 1VFCA 2GENA 1P7IA 5CXIA 1O4XA 2WV1A 3S2HJ 5GPCA 1LFBA 1T33A 3BR5A 2YVEA 2XRLA 3BQZA 4NN1A 2ME0A 4AF5A 2XGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAE A;  1YRN B;  5D19 A;  1FTZ A;  1U78 A;  3C2B A;  4FTH A;  1EF4 A;  3EGQ A;  2UXU A;  3DPJ A;  2H8R A;  3HB9 A;  1D5Y A;  3OOU A;  2VKV A;  3BR6 A;  4A3C J;  5EF6 A;  5IP7 J;  2DA7 A;  2DTZ A;  2O7O A;  4FCY A;  3S5R A;  4A3M J;  2NX4 A;  1GDT A;  3JRB A;  2JA6 J;  2Y9Z A;  5F08 A;  2EBI A;  3LSJ A;  5J1R A;  3K7A J;  3ZQH A;  2MSY A;  3BTJ A;  1ZGW A;  3E7L A;  2DMN A;  2LLK A;  2XPV A;  1ETV A;  2IU5 A;  3A03 A;  1WCM J;  1MBK A;  2UXO A;  1X58 A;  1JTX A;  2NS8 A;  3S16 J;  2M34 A;  2FQ4 A;  3VVX A;  4DZJ A;  3PO3 J;  2JWT A;  4RDU A;  3IH2 A;  5M3F J;  3RD3 A;  2LP0 A;  4M3F A;  2DN0 A;  1ETQ A;  4M3B A;  1Q1V A;  1TWF J;  1Z0X A;  2L0K A;  2LKX A;  5C4J J;  2DA2 A;  2R93 J;  1MNM C;  3BR3 A;  5FLV A;  5CW8 A;  2HQ5 A;  3GBG A;  3IV5 A;  5IP6 A;  2OER A;  1E3O C;  2ELK A;  2O7T A;  3OSF A;  3JR9 A;  5FKK A;  5FKN A;  1F43 A;  1H89 C;  3T6N A;  2M0C A;  3NAR A;  2YUS A;  2R5Y B;  2G3B A;  2L7M P;  2NP3 A;  3ZQL A;  1FTT A;  1VF9 A;  1I3Q J;  5IOZ A;  2JMW A;  3BTL A;  2G7G A;  1ORK A;  2G0E A;  3B6C A;  3CMY A;  5HSZ A;  5C44 J;  1TWA J;  3O8G A;  3MN2 A;  3JSJ A;  2DA4 A;  1OCT C;  1B72 B;  4A3L J;  4BY1 J;  4D5C A;  1ETO A;  3GTP J;  5C4X J;  2DMQ A;  1MSE C;  1HOM A;  1NK3 P;  4S0H B;  3JRF A;  4A3B J;  2HKU A;  2PBX A;  3KKC A;  2X9D A;  2ID3 A;  3LSP A;  2L7Z A;  3PO2 J;  2LTP A;  2QOP A;  4C2M J;  2CQQ A;  2IBD A;  4JYK A;  3RQI A;  1AHD P;  2R5Z B;  4JX6 A;  2ZB9 A;  5DTD A;  3OIO A;  4D7N A;  1GT0 C;  3MKL A;  4A3J J;  1VND A;  2DMP A;  1K61 A;  3C07 A;  5DAJ A;  2E2J J;  3LOC A;  4M3G A;  4IHY A;  3WHB A;  4BBR J;  4L5E A;  3VUQ A;  3QPL A;  1X2M A;  4J19 A;  2G7L A;  1IDZ A;  5EZG A;  1JUS A;  5EG0 A;  3G7R A;  3NAU A;  3TW7 A;  1I6H J;  4DYC A;  3HM5 A;  3QPS A;  2M9H A;  2OI8 A;  2GM4 A;  2WAQ N;  4JKZ A;  5FGL A;  1MBG A;  3TP0 A;  3HGG A;  5EZH A;  1NK2 P;  3HKZ N;  2HXO A;  2VI6 A;  2EH3 A;  3TP3 A;  5IOY A;  5CXG A;  1U8B A;  3HIM A;  2EZI A;  4MIM A;  2VKE A;  2UXI A;  1MBJ A;  3HEF A;  1MH4 A;  1GUU A;  2YVH A;  1RPW A;  2D6Y A;  3BR2 A;  2CRG A;  4MXM A;  2JA5 J;  3W6V A;  3KNW A;  3VW0 A;  1QVU A;  2K9S A;  4UUS A;  3A01 B;  3H3V K;  4D5F A;  1TWH J;  3FIW A;  5HOD A;  3PM1 A;  2UXH A;  3VP5 A;  4JP0 A;  4AC0 A;  3NRG A;  2E19 A;  1IGN A;  3BHQ A;  2L9R A;  5M5W J;  2QCO A;  3BRU A;  1JUM A;  3D1N I;  1AKH A;  3HOX J;  3BT9 A;  4JX4 A;  5F0F A;  4AYB N;  1A5J A;  1QRY A;  1UHS A;  1RET A;  4EEF G;  2JJ7 A;  5E3M A;  2ZOY A;  2E1O A;  1LFU P;  3COL A;  2JK3 A;  4M6V A;  2EZK A;  1XC5 A;  1H8A C;  1ETK A;  3K2A A;  5IYC J;  3IH3 A;  3VOX A;  1RKT A;  1UG2 A;  2LY9 A;  5IYD J;  2NVY J;  3AQT A;  2N8G A;  2LVS A;  2E2I J;  4ABZ A;  3GTL J;  3A02 A;  3JRG A;  3HTI A;  5E3L A;  3ZQF A;  2IEK A;  2VPR A;  5K58 A;  5EGO A;  4W1U A;  2HOS A;  2HOT A;  4C3I J;  3L1P A;  5E3N A;  3BQY A;  5FKM A;  4B1R A;  3VPR A;  3BTC A;  4UDS A;  2EZH A;  1FEX A;  3B81 A;  3BR1 A;  4XK4 A;  3G1L A;  4A3K J;  4M3D A;  2JN6 A;  4G12 A;  4YZE A;  1WH5 A;  3BR0 A;  3BG9 A;  3TW6 A;  2IAI A;  1TWC J;  3JRA A;  1PUF B;  3V78 A;  1NTC A;  2REK A;  4QIW N;  3HOZ J;  2MW8 A;  1IJW C;  2DA6 A;  5FKO A;  2LK2 A;  1MBH A;  1XG1 A;  2EQR A;  2DA3 A;  2XB0 X;  2P81 A;  2HYT A;  2XGD A;  4NEL A;  4BXX J;  5FLM J;  3HBL A;  1LE8 A;  1OCP A;  3HDD A;  2D5V A;  2QKO A;  5J1U A;  2OF7 A;  1YRN A;  3S17 J;  2G7S A;  4GCK A;  2X48 A;  3ANG A;  4UUT A;  2ECC A;  3I4N J;  4JX5 A;  5C4Y A;  3JRC A;  1MBE A;  2AHQ A;  3DCF A;  3S14 J;  2XB5 A;  2I10 A;  1GV2 A;  2Y0S N;  2O9L A;  1UI6 A;  4W97 A;  3M3Y J;  3ON2 A;  2LFB A;  3BG3 A;  2COB A;  1QVT A;  3Q3S A;  2O8K A;  4FE7 A;  4HNV A;  1U9O A;  5K7Z A;  3UKG A;  1JUP A;  1UMQ A;  1WGX A;  1B8I B;  3HTJ A;  3ON4 A;  3JRI A;  1HCR A;  3FKI J;  5M5Y J;  3S1N J;  2QWT A;  5H9T A;  2GFN A;  1ITY A;  2XPW A;  4DZP A;  2VUM J;  4BKX A;  4CYC B;  4RBO A;  1HLV A;  3AQS A;  3O8H A;  4IHX A;  2ZOZ A;  2XGE A;  1T56 A;  4A93 J;  2Q24 A;  4C3H J;  4XRS G;  1U9N A;  3I4M J;  2QTQ A;  3BJB A;  1G2H A;  1H88 C;  1ENH A;  3H0G J;  4AUX A;  4B3A A;  2H1K A;  3NI7 A;  4DW6 A;  4NDL A;  3O60 A;  1I50 J;  2JA8 J;  3SJM A;  3LSG A;  3FRQ A;  3P9T A;  3V6G A;  4QTR A;  2RAS A;  3ZQI A;  2TRT A;  3LJL A;  3QQA A;  2NVT J;  1VI0 A;  2F07 A;  2R5Y A;  3S15 J;  4A3D J;  3NXC A;  3G1M A;  1POG A;  4X6A J;  1IV6 A;  1WI3 A;  1Z77 A;  3Q0W A;  5C3E J;  2DG8 A;  2HXI A;  3GTK J;  4A3G J;  3HTH A;  3MNL A;  4FE4 A;  3GTQ J;  3HOV J;  4GFL A;  5F04 A;  2CUF A;  3SFI A;  2OPT A;  2ME6 A;  1JT0 A;  4A3I J;  2NP5 A;  2Y31 A;  3ZQC A;  3QBM A;  5F0C A;  2DMU A;  5EGO B;  2KDZ A;  3S1R J;  2XDN A;  2DJN A;  2WB1 N;  4IEJ A;  1MSF C;  3LWJ A;  2B63 J;  1JKQ C;  2HYJ A;  1HDD C;  3HOW J;  1WH7 A;  3ANP A;  2HOA A;  4CGR A;  2YS9 A;  4KWA A;  2HI3 A;  3Q0V A;  5EYR A;  4D7M A;  1BL0 A;  1W0U A;  2LR8 A;  3HGY A;  5IP9 J;  4GCL A;  1IUF A;  5GP9 A;  2AO9 A;  3OSG A;  4MK6 A;  5EFY A;  1JT6 A;  1K83 J;  3LNQ A;  2PZ9 A;  1IC8 A;  2ZCN A;  1FIA A;  3NPI A;  4FIS A;  4IHV A;  5F27 A;  3ZOB A;  5EDN A;  1LE8 B;  3HE0 A;  1JKO C;  3WHC A;  4BY7 J;  4A3E J;  3IUV A;  3BNI A;  2UXP A;  1XS9 A;  1GVD A;  9ANT A;  3F1B A;  4JNN A;  4B4C A;  2WGB A;  1ZTR A;  5IYB J;  4MFD A;  2L7F P;  2DG7 A;  5J1Y A;  3S1M J;  2NS7 A;  3FK7 A;  2XPU A;  2GLO A;  2QIB A;  2W48 A;  3FIS A;  2FJ1 A;  1FJL A;  2DA5 A;  4DYR A;  3VW2 A;  2FX0 A;  3S1Q J;  1W0T A;  3EUP A;  3RZD J;  5K7F A;  1OFC X;  4X1E A;  2R0Q C;  1TC3 C;  2NOG A;  3HTA A;  1JTY A;  2GUH A;  5E3O A;  2R92 J;  1OJL A;  4AC6 A;  2QF7 A;  5IPA A;  4BBS J;  2WUI A;  3ZQG A;  3CRJ A;  3VVZ A;  2NVQ J;  3MVP A;  3PAS A;  3GZI A;  1ZK8 A;  1MH3 A;  1ETX A;  1HF0 A;  4XID A;  1BA5 A;  4L62 A;  2X6O A;  5K7H A;  3A01 A;  1SGM A;  3VOK A;  3VIB A;  4XRM A;  3FK6 A;  5F0H A;  5HBU A;  4JL3 A;  4A69 C;  2V57 A;  1DU0 A;  3E7Q A;  1RKW A;  4PXI A;  4ME9 A;  1JJ6 C;  3GTO J;  5JLW A;  1BW5 A;  4V2F A;  5J3L A;  1JGG A;  4Y7N J;  3QKX A;  1WPK A;  1CQT A;  2DMT A;  1ZKG A;  5EG0 B;  1JKR C;  1ZR4 A;  3G56 A;  3IH4 A;  4HKU A;  3G1O A;  4GCT A;  2HDD A;  5BNG A;  1SFO J;  3Q0U A;  4C3J J;  4M3E A;  3GTJ J;  2YU9 J;  1FIP A;  4ICH A;  3NNR A;  3CJD A;  3GEU A;  5HAW A;  1AU7 A;  2JA7 J;  1BJZ A;  4LOC A;  5D1R A;  1MBF A;  4GFB A;  4GFK A;  3LSR A;  3TED A;  1ZQ3 P;  1BW6 A;  3F0C A;  2M8G X;  2Y2Z A;  1IG7 A;  3BCG A;  1HDP A;  1S7E A;  5GPA A;  3HOU J;  4UUS B;  2ZCX A;  3KZ9 A;  1DU6 A;  1RR7 A;  3VVY A;  1X2N A;  3B6A A;  4MFE A;  3KKD A;  2Y30 A;  2CQX A;  1A6I A;  2MGQ A;  2E2H J;  3M4O J;  2K9N A;  2ID6 A;  2TCT A;  1R9T J;  1PUF A;  1GV5 A;  2M2E A;  2W53 A;  1AKH B;  4XIC A;  3DEW A;  2GBY A;  1ETY A;  5M5X J;  5FKL A;  1P7J A;  2DA1 A;  4I76 A;  5FJ8 J;  5EEA A;  3CWR A;  4A3F J;  5JLX A;  3JRE A;  2Y9Y A;  1ZR2 A;  5DS9 A;  4ACI A;  2FBQ A;  1QPI A;  4MLO A;  2MG4 A;  3S2D J;  4XRS A;  2K9Q A;  1B72 A;  2NVX J;  3HOY J;  3RH2 A;  1JKP C;  4IHW A;  2PMZ N;  2ZCM A;  3JRD A;  2CU7 A;  3SDG A;  1JJ8 C;  3PPB A;  1IDY A;  1IRZ A;  4V2G A;  1F36 A;  3CQZ J;  3BG5 A;  4I6Z A;  3BTI A;  1TWG J;  5D18 A;  2CUE A;  3CCY A;  2ECB A;  3RZO J;  1B8I A;  3JRH A;  1Y1V J;  3VW1 A;  2K40 A;  3GTM J;  3CDL A;  3RKQ A;  5FHP A;  2R7Z J;  2R5Z A;  1APL C;  2FD5 A;  1Y1W J;  1SAN A;  2KT0 A;  5M3M J;  4Y52 J;  1RES A;  2EZL A;  4DYQ A;  4CYC A;  2RHA A;  3LHQ A;  3GTG J;  4QSH A;  1UI5 A;  1ETW A;  2CJJ A;  5AQC A;  2LD5 A;  2XSD C;  5FMP A;  4MO7 A;  5F1J A;  1VFC A;  2GEN A;  1P7I A;  5CXI A;  1O4X A;  2WV1 A;  3S2H J;  5GPC A;  1LFB A;  1T33 A;  3BR5 A;  2YVE A;  2XRL A;  3BQZ A;  4NN1 A;  2ME0 A;  4AF5 A;  2XGC A; 
#chains in the Genus database with same CATH topology
 2RAE A;  3W3C A;  4IHS A;  3MZH A;  2EWN A;  4ZYE A;  4II3 A;  2VBX A;  3EGQ A;  1EJ9 A;  3DPJ A;  1YLF A;  2W24 A;  3HHG A;  2VBY A;  4CO8 A;  1MMN A;  2TDX A;  1G3S A;  1UB9 A;  2O7O A;  3ECH A;  1I5Z A;  4B48 A;  3KYL A;  1HSJ A;  4A3M J;  3ISP A;  3L2V A;  1J09 A;  3JRB A;  4B43 A;  4YEJ A;  3RSN A;  2EBI A;  5J1R A;  2OCE A;  3I9V 2;  2XIG A;  3BTJ A;  2DXI A;  3ML6 A;  2LLK A;  1F5T A;  5HLT A;  3D5L A;  3WOD F;  4BAY A;  1USS A;  3VDX A;  2CGP A;  3S16 J;  1SFE A;  2OCC H;  3WE2 A;  4RMN A;  3FKJ A;  1ZN2 A;  3IH2 A;  1ZAO A;  2XVC A;  4HZF A;  4LJZ F;  4OOI A;  5BPI A;  4M3B A;  1Z0X A;  1TWF J;  3ZGK A;  3F6V A;  3CLQ A;  4DIQ A;  2DA2 A;  2R93 J;  3KYC B;  3BWG A;  4RLQ A;  5CYV A;  4IJA A;  1MNM C;  5FLV A;  2W85 A;  4QPO A;  5CW8 A;  1D1A A;  3GBG A;  3ZMV A;  1LEA A;  2IGO A;  2ELK A;  2X6W A;  5KCM A;  2AQE A;  1F43 A;  3PFY A;  1XB4 A;  2ZSH B;  4I98 B;  2G3B A;  4YII A;  2L7M P;  1SD5 A;  3DXJ F;  3ZQL A;  2VON A;  1OMI A;  4CCO A;  3ZMZ A;  1I3Q J;  1FTT A;  2M7A A;  2JMW A;  4A12 A;  2STT A;  2VOP A;  2IXS A;  3B6C A;  1YJW I;  2Z1D A;  1NH3 A;  6PAX A;  2OZ6 A;  3CMY A;  4AU7 A;  4HAM A;  3GXO A;  5H6R A;  2IS6 A;  3O8G A;  3S93 A;  3H9Q A;  2KZV A;  5E1Z B;  4A3L J;  1R4N B;  1HW2 A;  4A0Z A;  3ZN0 A;  2V1U A;  4D5C A;  1PUE E;  2BE5 F;  4EM1 A;  1XGM A;  1RR8 C;  1MSE C;  3GTP J;  3F8N A;  2A69 F;  1VQ4 I;  2FBI A;  2HKU A;  1S8N A;  1TQI A;  2WAF A;  1FWZ A;  1J2X A;  3RIR A;  4JYK A;  3RQI A;  3FXR A;  2VJ5 A;  4HX8 A;  2R5Z B;  2E60 A;  3QWL A;  2HS5 A;  4LGW A;  1HST A;  3ECO A;  2LKS A;  2DW4 A;  3WGH A;  1VND A;  3CMA I;  4BE0 A;  1K61 A;  4OD4 A;  1X1D A;  3CD6 I;  3I59 B;  2H1L A;  3FXK A;  1E3P A;  1EA3 A;  3WHB A;  4L5E A;  4ZDP A;  1X2M A;  1IDZ A;  1JUS A;  2EFW A;  1K78 A;  5EG0 A;  5HDG A;  4CZZ A;  2ZXH A;  4DYC A;  5JHU A;  2A3S A;  1R5H A;  3PQK A;  3QPS A;  4OIN F;  1HW1 A;  4CCM A;  4U88 A;  3TP0 A;  3HGG A;  3HRT A;  3K4B A;  4MQV A;  5FO5 A;  3WTU C;  2IJL A;  1YW7 A;  2LY1 A;  4II2 A;  1NK2 P;  3TP3 A;  2HXO A;  5CXG A;  4DBR A;  3E6B A;  1U8B A;  3HIM A;  2VAS A;  2BY1 A;  1ULY A;  2VKE A;  1WJB A;  1SAU A;  3GLX A;  3QYF A;  1MBJ A;  4M73 A;  3SYT A;  3NRV A;  3WU1 B;  2OTL I;  4RM2 A;  4WCG A;  2A6H F;  2NNN A;  3HYI A;  2RQP A;  3GFM A;  1AWC A;  2XDV A;  4ON0 A;  5J8C A;  2LSO A;  2JA5 J;  1S29 A;  2AQF A;  3KNW A;  4AWX B;  4OIO F;  3VW0 A;  4G7H F;  4IKF A;  3A1Y A;  5HLH A;  5DM7 F;  4GGG A;  2V6E A;  3PM1 A;  2X1E A;  2UXH A;  3QOE A;  2PMH A;  2NYX A;  4G9Y A;  3SZG A;  3WTS C;  2L9R A;  2F5F A;  2PQ8 A;  4XN0 A;  3BRU A;  2P8T A;  1DP7 P;  3HOX J;  1X1A A;  3KZY A;  4JX4 A;  1F4K A;  1P6R A;  4UV9 A;  2H8W A;  1RET A;  1UHM A;  4EEF G;  1ERD A;  3FXU A;  3DLA A;  3TOB A;  2M87 A;  4QWQ A;  1YYV A;  4MQ9 F;  4WWC A;  3VOX A;  1UG2 A;  2XAG A;  2L01 A;  3GZ6 A;  1XSV A;  2E2I J;  3E5Q A;  1IO2 A;  4ABZ A;  1FSE A;  3GTL J;  5CKT A;  2CMP A;  5E3L A;  4Q4Z F;  1W7P A;  2IEK A;  3N05 A;  2VQH A;  5EGO A;  2BVM A;  2OA4 A;  4L5J A;  2P6S A;  4BQN A;  3CUQ C;  4CDG A;  1WVR A;  4RB1 A;  1RC9 A;  1GLN A;  4HNU A;  2XF7 A;  4E7K A;  3EYI A;  4M74 A;  2JRT A;  4UUV A;  2F5D A;  1PUF B;  1TWC J;  1IV8 A;  3P5J A;  3J7A Y;  3K8P C;  1IJW C;  1PVE A;  2DA6 A;  2DA3 A;  3B02 A;  3F8F A;  4NQW A;  2XGD A;  4NEL A;  4BXX J;  1G8X A;  5FLM J;  3HDD A;  2QKO A;  4HG2 A;  5J1U A;  4JQF A;  2CV0 A;  4GCK A;  2X48 A;  3HKZ A;  3HUG A;  5AON A;  3ANG A;  2JVG A;  4JX5 A;  3OV8 A;  1YJN I;  1ACI A;  1MBE A;  4WXH A;  2AHQ A;  3DCF A;  2QSF X;  3PIO F;  1JXS A;  4NUB A;  4W97 A;  2OQG A;  2HOE A;  3OYI A;  3ON2 A;  3BG3 A;  2COB A;  3BG7 A;  2O8K A;  3H0D A;  4HNV A;  1U9O A;  1LEB A;  3ULQ B;  5K7Z A;  1DPU A;  4Z6Y A;  3EET A;  3HTU A;  3HRU A;  1D1C A;  4BGD A;  1YJ9 I;  3W6J B;  1B8I B;  5M5Y J;  4XKC A;  5H9T A;  2MH9 A;  3GX4 X;  4AVP A;  5TRD A;  4CYD A;  3PQJ A;  3E3V A;  2CS3 A;  2FOW A;  4GO1 A;  1FYK A;  3AQS A;  2Q1Z B;  1T56 A;  4DVY P;  4EJO A;  1WRJ A;  2RN7 A;  2QTQ A;  3QPT A;  3JSP A;  2BY3 A;  4HQM A;  2GXG A;  1A04 A;  3SJM A;  3P9T A;  1YS7 A;  2TRT A;  3K1P A;  4ZZD A;  2EB7 A;  2F07 A;  2HZD A;  3EUA A;  2EPF A;  2QUF A;  4BE2 A;  2DK8 A;  1T8I A;  4XKV A;  1O57 A;  2ZBK A;  3HTH A;  1JE8 A;  1H9G A;  4M71 A;  1SD4 A;  4FE4 A;  4U0W A;  5F64 A;  3OYF A;  2A07 F;  4GFL A;  3GFI A;  2CUF A;  4OAY A;  4PGH A;  3SFI A;  4LK0 F;  4A3I J;  2KFD A;  3RDI A;  4LLL A;  2A6E F;  1OR7 C;  2OV7 A;  1ZG5 A;  3GEZ A;  2LMD A;  3U9G A;  1SEU A;  5K5R A;  5D5X B;  1N78 A;  2ZJR F;  2HVR A;  2JRM A;  3ZRG A;  3ANP A;  5A2Q Z;  2BW3 A;  4E7J A;  3OWT A;  4EJU A;  4KWA A;  2HI3 A;  4RA2 A;  5HS9 A;  2ZNY A;  3VOD A;  4PJN A;  2FNA A;  4ENN A;  1ZGJ A;  2W1O A;  1IN6 A;  2JQ7 A;  3KIO A;  3VYT B;  4E7Z A;  2ZCN A;  1FPQ A;  2ZC2 A;  3FWE A;  3K6G A;  1R5I D;  2XHK A;  2XKO A;  5F27 A;  2X85 A;  4MHG A;  1TQP A;  2DFF A;  1FP1 D;  4CGZ A;  3ABT A;  3FHN A;  1GVD A;  4JNN A;  4EV0 A;  2L7F P;  1PDN C;  2DDA A;  2XPU A;  1KYZ A;  4XN3 A;  4BH9 A;  4ZYD A;  3N4M A;  1VQ5 I;  3AG4 H;  3FIS A;  4DYR A;  2FX0 A;  3S1Q J;  1YIT I;  4LG0 A;  2DT7 B;  2YR2 A;  3ABK H;  3RZD J;  4V19 K;  1JTY A;  5E3O A;  3QRF F;  2QF7 A;  3F8C A;  4BBS J;  2WUI A;  4ENM A;  2PMU A;  3VVZ A;  4BEH A;  2X6X A;  3GZI A;  2PEX A;  4XID A;  2MD0 A;  4L62 A;  2X6O A;  3A01 A;  4F91 B;  3R60 A;  4XRM A;  4M9X A;  3MKZ A;  2E7X A;  5LD2 C;  1DU0 A;  4A6D A;  3E7Q A;  2M4G A;  1JJ6 C;  2OAZ A;  3M8F A;  2RNG A;  3WGI A;  2V1X A;  4G6Q A;  1QGP A;  3R0J A;  4OD5 A;  5CVI A;  3KZZ A;  1K78 B;  1ZKG A;  5EG0 B;  1JKR C;  1OYY A;  1ZR4 A;  1SMT A;  5LEK A;  4HKU A;  1U6G A;  2GA1 A;  3G1O A;  2X0L A;  3FXJ A;  2HDD A;  2JSC A;  3K4N A;  1J7K A;  4A6E A;  4C3J J;  4LG3 A;  1SFO J;  5E8G A;  4KA4 A;  1ZRC A;  3E1S A;  4OMY A;  1Y8Q B;  3KLN A;  3V7S A;  5LHG A;  3NNR A;  3H1C A;  3ERM A;  3OYM A;  5HAW A;  1BI1 A;  2W82 A;  1XGO A;  1YE9 A;  4LOC A;  3CDH A;  1MBF A;  2MC4 A;  4GFB A;  1IRX A;  5EEG A;  3L2R A;  2P5L C;  4GFK A;  4TV7 A;  1N75 A;  2CH0 A;  5ICC A;  4R8H A;  1IXR C;  4CCL A;  5E1W A;  3LSR A;  3TED A;  4MNU A;  1VQM I;  4LLN A;  1ZQ3 P;  2HWV A;  3K4M A;  1QZY A;  3LA2 A;  3EDP A;  5LEJ A;  3VSK A;  1HDP A;  2DBB A;  3KZI C;  1S3J A;  1PJR A;  2L9S A;  2R7O A;  2LBF A;  3HPG A;  2YPR A;  4S05 A;  3J80 K;  4MFE A;  4EJW A;  3S2W A;  2Y30 A;  3KFW X;  3U21 A;  2CQX A;  2MGQ A;  2WV0 A;  3A0H C;  4ESJ A;  4Q48 A;  3CDI A;  3G71 I;  2TCT A;  1R9T J;  1W7P D;  4UB6 C;  2FU4 A;  4XR6 A;  2IS4 A;  2GBY A;  1ODD A;  4OAZ A;  4XLP F;  3FBN B;  1W5C C;  2GIZ A;  4L9N A;  1BOB A;  3O3K A;  1P7J A;  2DA1 A;  1U5T C;  1TBX A;  3JRE A;  2K3F A;  3AAF A;  1T2K A;  2F4I A;  2OUM A;  1IN7 A;  3BP8 A;  3OIQ A;  5IT3 A;  1B6A A;  1W7P B;  2IA0 A;  4AD9 A;  1Z21 A;  3TO6 A;  2L4M A;  2GOX B;  2E1M B;  2WTE A;  1R49 A;  1LDJ A;  1JJ8 C;  3PPB A;  3GZ5 A;  1TZL A;  4V2G A;  2L9N A;  3CQZ J;  3DU6 A;  1B1B A;  2Y75 A;  3OYL A;  3KP3 A;  4XON A;  1I6X A;  3JRH A;  3VW1 A;  2BY0 A;  2VIX A;  3JSO A;  2R7Z J;  3E0J B;  4YIF A;  2R5Z A;  2XAJ A;  4F52 A;  1Y1W J;  4HF2 A;  3W6K B;  5D5U B;  1V54 H;  4CHU A;  1RZ4 A;  2M0M A;  3SXY A;  1K4T A;  2UZK A;  1UI5 A;  3PUF A;  5AQC A;  2GAU A;  2LD5 A;  3DPL C;  2A5W A;  5FMP A;  3J81 Z;  4WIB A;  2VXZ A;  1Y56 A;  4HV6 A;  1P7I A;  3PNT A;  4BS9 A;  5F1J A;  5BQT A;  4Y13 A;  1O4X A;  5GPC A;  5D5W B;  1T33 A;  1YX5 A;  4NN1 A;  2XRL A;  2KLO A;  2IGM A;  2DK5 A;  4AF5 A;  3HL2 A;  4GCV A;  1FTZ A;  1I1S A;  2YU3 A;  3HB9 A;  4BJ6 C;  1D5Y A;  4LLG F;  2B0L A;  4A3C J;  2XAS A;  4NHJ A;  5L3G A;  2DA7 A;  2DTZ A;  2GWR A;  4F93 B;  1S72 I;  1HBX G;  5KVR A;  3GF2 A;  2VJ4 A;  5J8F A;  2OTJ I;  2JA6 J;  2DPD A;  2Y9Z A;  1I1G A;  5GAH J;  3ZQH A;  4FHT A;  4KIT B;  1ETV A;  2IU5 A;  3A03 A;  2Z2S B;  4KIB A;  2BXZ A;  1A31 A;  2M34 A;  2FQ4 A;  3K4C A;  3RKW A;  1FY7 A;  4DZJ A;  3VVX A;  3H9G A;  4DNC A;  3RD3 A;  4M3F A;  3W2V A;  1ETQ A;  4WX9 A;  1ZRD A;  4BDY A;  3BJO A;  1XN7 A;  5C4J J;  3MZ8 A;  2DI3 A;  3BR3 A;  4HX7 A;  4Q47 A;  4O5V A;  2CQK A;  1E3O C;  2EK5 A;  3CP8 A;  3CCS I;  2UWM A;  3OSF A;  3JR9 A;  3QYB A;  3DBH B;  4PUS A;  1H89 C;  4GYG A;  1TNS A;  2M0C A;  2YUS A;  3H5N A;  2PMZ A;  2R7S A;  3RYP A;  5IOZ A;  3OS1 A;  2Q0O A;  1R4M B;  4XMY A;  2VQG A;  1ORK A;  1FMW A;  4L5I A;  4C2T A;  1Z3Y A;  5HSZ A;  3ZPL A;  3MN2 A;  3KP2 A;  2DA4 A;  3K70 C;  3I5U A;  1OCT C;  1VZ0 A;  3LAP A;  3WTW C;  1OKR A;  2OBP A;  3GME A;  3CCR I;  3FMR A;  2FA5 A;  2GQQ A;  4FX0 A;  1T39 A;  4EM2 A;  1ZAR A;  3JRF A;  4EQQ A;  5L3D A;  2PBX A;  1A35 A;  1G3W A;  3MMY B;  4I01 A;  2X9D A;  2GZW A;  2BW3 B;  2ID3 A;  3LSP A;  3AKZ A;  3PO2 J;  4C2M J;  1P2F A;  2IS1 A;  2M5W A;  2CQQ A;  1FOK A;  3U1K A;  4U87 A;  1AHD P;  1IN8 A;  3WTZ A;  3AL0 C;  1W5S A;  1PP8 F;  3QU6 A;  2R7R A;  4D7N A;  1GT0 C;  1R00 A;  4RGU A;  2DMP A;  5DAJ A;  1YTY A;  4NC8 A;  3LOC A;  3VYS B;  1E2X A;  3P7N A;  2DTR A;  1KYW A;  3VUQ A;  3I56 I;  4J19 A;  2ESN A;  2ZNZ A;  5DCM A;  1FBQ A;  2D45 A;  4GDF A;  3NAU A;  2KJB A;  2M7B A;  3TW7 A;  1I6H J;  3HM5 A;  4BQQ A;  3F23 A;  2M9H A;  3GLL A;  1X3W B;  1T6S A;  3L2C A;  1T0F C;  2GM4 A;  2GA2 A;  3V7C A;  1DDN A;  3WTX C;  4L0Y B;  4ANJ A;  2ISY A;  2HTS A;  2QEN A;  2VI6 A;  4CCN A;  1YI2 I;  2H09 A;  2HYG D;  2M30 A;  4MIM A;  3LSI A;  2UXI A;  4HST A;  4IXA A;  4CA0 A;  5ILS A;  3N97 A;  2RNJ A;  5E20 A;  4IPA A;  4AID A;  2YVH A;  2QYO A;  2J5P A;  3P9K A;  3TDU C;  3BR2 A;  4BQO A;  4BEH B;  2KIU A;  4ZYG A;  1QQI A;  1IRF A;  3HSF A;  1Y6I A;  2ZFU A;  4EMS A;  1VQ9 I;  5IT9 Z;  1QVU A;  3A01 B;  4UUS A;  3BZC A;  1SMY F;  2DOE A;  2L02 A;  5HOD A;  3LA7 A;  4UV8 A;  4JP0 A;  2K27 A;  1R7J A;  2E19 A;  3H5R A;  2CV1 A;  3TGN A;  1YG2 A;  5CPR B;  3OL3 A;  5M5W J;  2QCO A;  3DEU A;  5E8I A;  2O6G E;  3HSE A;  1JUM A;  2DJI A;  2L4A A;  2ACJ A;  2OQR A;  3AG3 H;  2R7Q A;  3BT9 A;  3NWT A;  4BQA A;  1VTN C;  3OYG A;  4K2E A;  2EA2 A;  2ZOY A;  1LFU P;  2JK3 A;  2EZK A;  1XC5 A;  1F9N A;  1X19 A;  3K2A A;  3DPT A;  3IH3 A;  1RKT A;  2LY9 A;  2ZJQ F;  2QEX I;  3VSL A;  2LVS A;  3LSK A;  3JRG A;  2HYF A;  1L0O C;  1WQ2 A;  2HOS A;  4HV5 A;  4C3I J;  1QA6 A;  2DDB A;  3BQY A;  5FKM A;  4UDS A;  3CC7 I;  2CW7 A;  1R1U A;  4HPQ A;  1FEX A;  2LBF B;  3B81 A;  3BR1 A;  2PN6 A;  2Y69 H;  1RI7 A;  1FBS A;  3CJT B;  3I3L A;  4N0B A;  4A3K J;  2R7V A;  3ZQ7 A;  1RUO A;  3OYJ A;  5ILV A;  2L7K A;  1S7O A;  5H6Q A;  1QZE A;  1OCC H;  1OYI A;  2QKL B;  3BG9 A;  3C2G A;  3TW6 A;  1XDS A;  3JRA A;  2X1D A;  1G3T A;  3A2K A;  3HOZ J;  4CSW A;  1KON A;  2LK2 A;  2EQR A;  2XAF A;  4B3X A;  2HVS A;  2VJJ A;  3C18 A;  1R23 A;  3WG9 A;  2D5V A;  2OF7 A;  4XOT A;  2G7S A;  5FLX Z;  4IHT A;  2ECC A;  5CVJ A;  4CUG A;  3P9I A;  4L9V A;  3VTI A;  2QQB A;  3CCQ I;  1OCO H;  1XGS A;  2I10 A;  4ZZL A;  5GTI C;  3G3Z A;  4JBA A;  1R71 A;  2O9L A;  1UI6 A;  1P9Q C;  3M3Y J;  1VQ6 I;  2LFB A;  4RS8 A;  1BIB A;  2VE8 A;  2EIJ H;  1JUP A;  4R1H A;  4KDP A;  3ON4 A;  3CCM I;  3DWL E;  3PL8 A;  3AG1 H;  1XCB A;  2CSO A;  2GIV A;  2XPW A;  3A4C A;  3ZXS A;  2PFB A;  4BKX A;  2RGV A;  2DU9 A;  4E7S A;  1HLV A;  1P92 A;  4IHX A;  2ZOZ A;  2XGE A;  5DUI A;  1WSU A;  5JR3 A;  4A93 J;  4P96 A;  4E6K G;  2W4S A;  1U9N A;  3I4M J;  2VLA A;  2P7C B;  1G2H A;  1DUX C;  2BY2 A;  2R7D A;  2VN2 A;  2D2W A;  2HU9 A;  4AUX A;  1H9T A;  2H1K A;  4L0Z B;  3NI7 A;  3DQV C;  2F2E A;  1I50 J;  4G7Z F;  2B7E A;  3M7G A;  3LSG A;  3HJE A;  4QTR A;  2LF8 A;  1Z6R A;  3U2R A;  2RAS A;  5CVV A;  4DBQ A;  3H92 A;  3F22 A;  2NVT J;  1VQN I;  1BN5 A;  4D1Q A;  1LNW A;  2R5Y A;  2FNP A;  1FC3 A;  1MMD A;  3GFL A;  2VL8 A;  3OOP A;  5J6X A;  3F6O A;  3FF5 A;  3KEY A;  3KCC A;  1A6Q A;  1HQC A;  1ON1 A;  4YFN F;  1IV6 A;  1IAW A;  1Z77 A;  2K3P A;  4O6J A;  5FFZ A;  1H0M A;  2Z99 A;  4Q5S F;  3CJR B;  2KHM A;  3WGG A;  1LPQ A;  3GTK J;  4Z2Y A;  1K6O A;  1O3R A;  4A0X A;  3HOV J;  5F04 A;  3LQQ A;  1UCR A;  2XRO A;  2ME6 A;  4BXU A;  4OIR F;  2NP5 A;  2Y31 A;  2KDZ A;  2DMU A;  2FBH A;  3CCL I;  2XDN A;  2LNB A;  4YEL A;  2DJN A;  2WB1 N;  4IEJ A;  2B63 J;  1JKQ C;  1MIJ A;  1OPC A;  4FAS D;  3FX3 A;  5F6F A;  1SFK A;  5HDN A;  2NXN B;  2HOA A;  1PYV A;  3Q0V A;  1ZEL A;  5FD5 A;  4IO9 F;  5BOX A;  3SDB A;  1BL0 A;  5IP9 J;  1IUF A;  2VXD A;  2AO9 A;  3W2W A;  4F7Z A;  3OSG A;  1JT6 A;  1DGR M;  3BDD A;  3CC4 I;  3BJA A;  1FOY A;  4FIS A;  5LRS A;  2XF6 A;  4JOM A;  5CVR A;  1O3S A;  1HKS A;  2LRE A;  2FE3 A;  3R61 A;  1LE8 B;  3HE0 A;  1I27 A;  2V4J C;  4B8X A;  5L3C A;  4A3E J;  3IUV A;  4XLH A;  2UXP A;  1XS9 A;  9ANT A;  2D1V A;  1UST A;  2VT3 A;  4GYI A;  5D6F A;  2RRE A;  4HF0 A;  2X6Y A;  2NNY A;  5L3E A;  3LSM A;  5J1Y A;  4YG2 F;  2DG7 A;  1EV7 A;  3C2H A;  2NS7 A;  3FK7 A;  5BMZ A;  4N9I A;  4LB5 A;  2QIB A;  2DA5 A;  1W0T A;  2HPM A;  3EUP A;  5K7F A;  1OFC X;  2YX7 A;  1J59 A;  5L3B A;  3HTA A;  3AFH A;  2R92 J;  1EKE A;  3MAJ A;  1E0E A;  1X4P A;  5IPA A;  4IL6 C;  2CV2 A;  3PAS A;  3K1N A;  4P5O A;  4XOR A;  1ETX A;  3M1C A;  4HDV A;  2EFQ A;  2DFI A;  1SGM A;  3FK6 A;  5F0H A;  2DCE A;  1Z9C A;  4UNO A;  5HBU A;  1MNE A;  1XX5 A;  3K1M A;  4U0V A;  4A69 C;  1R58 A;  5GAE J;  5ICG A;  2ZXI A;  4PXI A;  2E34 A;  1ON2 A;  5JLW A;  3OS2 A;  5J3L A;  1JGG A;  2CFX A;  3QU3 A;  3PFI A;  3QKX A;  1CQT A;  3V42 A;  5EJC A;  5DCM B;  3K9T A;  4DQ2 A;  3G56 A;  3IH4 A;  3TMO A;  4EM0 B;  4GCT A;  1MJA A;  2GXB A;  2KRF A;  5BNG A;  3Q0U A;  5TJJ A;  4BU2 A;  4A0Y A;  1I3A A;  3KP4 A;  3E5X A;  1LVK A;  4PDK A;  3BPV A;  2Z5U A;  2K4J A;  5FGM A;  4LB6 B;  2HEO A;  3GEU A;  2K9M A;  1YQA A;  4NB5 A;  1X3U A;  5D1R A;  1D3Y A;  2P5K A;  2O61 A;  1WJ5 A;  2H94 A;  1D8K A;  4B47 A;  1V3F A;  4HEA 2;  3F0C A;  2M8G X;  1STZ A;  1IG7 A;  4ZYA A;  3GCM A;  1S7E A;  1CF7 B;  1KU2 A;  4UUS B;  3KEQ A;  3KZ9 A;  1RR7 A;  3GFJ A;  2O0Y A;  3D5S C;  1ZG3 A;  4G8X A;  3M4O J;  2P0W A;  2K02 A;  3J80 Z;  3SEZ A;  2DOD A;  2W53 A;  5ILU A;  4UB8 C;  3LST A;  1V4R A;  5M5X J;  4BJT A;  3BG6 A;  3NEU A;  2R7U A;  4UY8 I;  2Z3Y A;  2HDW A;  3I53 A;  4I76 A;  5FJ8 J;  3Q5F A;  3RKX A;  4P9F A;  5JLX A;  3IC7 A;  1SVM A;  4LD5 A;  2VT2 A;  2PJP A;  1JHH A;  2DYS H;  1E3H A;  1R1V A;  2VC1 A;  1O3Q A;  2NRA C;  4PGG A;  4RB3 C;  1IXS B;  3H36 A;  3S2D J;  4XRS A;  3T5X A;  2NVX J;  3EQL F;  1WJA A;  1FYL A;  3UNG C;  1IDY A;  1IUY A;  3M9A A;  2Z9O A;  1F36 A;  2FRH A;  3BG5 A;  3BTI A;  3JAM Z;  4P9U A;  3SHF A;  2K40 A;  3RKQ A;  3IL2 A;  1ZHF A;  2O03 A;  5M3M J;  1RES A;  4DYQ A;  1QNT A;  2JUG A;  4CYC A;  3LHQ A;  2VJI A;  4CCK A;  3CCJ I;  2JA2 A;  3MZY A;  2XSD C;  3KEO A;  4MO7 A;  4FT8 A;  3SZT A;  1VFC A;  3ABL H;  3BQZ A;  1D0Y A;  2XAQ A;  3KLO A;  3H5A A;  4PJJ A;  3TO9 A;  1TNT A;  5D19 A;  2V1D A;  1U3E M;  1U78 A;  3TQN A;  2ADU A;  1TL8 A;  2VKD A;  4XLN F;  4HNT A;  2P4W A;  4FTH A;  4EGZ A;  1NG7 A;  1KU9 A;  2UXU A;  2H8R A;  3FBI B;  3DFG A;  3CCU I;  2VKV A;  5HOO A;  4F3Q A;  5EF6 A;  5IP7 J;  2BBY A;  5FRN A;  4FCY A;  1E17 A;  1W1W E;  3S5R A;  2K86 A;  3PNV A;  2EV6 A;  4I09 A;  3IRR A;  3K4J A;  3OYK A;  2Q2E A;  3CO7 C;  1L3L A;  3T1B A;  4ETS A;  4HSR A;  4HF1 A;  1G3Y A;  1MD0 A;  2MSY A;  3E7L A;  2DMN A;  4AIJ A;  1W5T A;  2XPV A;  2MH2 A;  2WY8 Q;  3GYH X;  5KK1 A;  2UXO A;  1WCM J;  1X58 A;  2PI0 A;  4LIV A;  2NS8 A;  3CJN A;  2WBM A;  3EUH C;  3CCE I;  1DP3 A;  2HQA A;  3PO3 J;  3QP6 A;  4LIT A;  3F3X A;  1T38 A;  1XMK A;  1Q1V A;  1SD7 A;  1RRJ A;  1D0Z A;  2IP2 A;  1EH7 A;  3NWS A;  4UHT A;  2C6Y A;  2LKX A;  5D8K B;  1FNN A;  4XKW A;  5J40 A;  4KN7 X;  2W57 A;  4NC6 A;  5DEQ A;  3S8P A;  2HQ5 A;  3LMM A;  2VBZ A;  1MND A;  3L7W A;  3R6S A;  2BYV E;  1Z6T A;  2O7T A;  2LF7 A;  1KA8 A;  3FMS A;  3KE2 A;  4BXF A;  3KX2 A;  1ZLK A;  3DTE A;  2R5Y B;  4CIC A;  4U7B A;  2CFO A;  2I8D A;  3K69 A;  5HLG A;  3J7A O;  1QU3 A;  3WTV C;  2KQR A;  2G0E A;  4I2O A;  5HVQ C;  5HLI A;  1MKM A;  4ZYH A;  1FX7 A;  2YVX A;  4KIS A;  1TWA J;  4I0B A;  5AIQ A;  2IRF G;  4G6D A;  4DJA A;  1D1B A;  2IGK A;  3QOD A;  1B72 B;  3ZN1 A;  3DU5 A;  2ZY9 A;  1ETO A;  3OR1 C;  1OYW A;  5HNH A;  4U0Y A;  1NK3 P;  2XF5 A;  1HOM A;  3GW2 A;  4A3B J;  3KKC A;  3FM5 A;  2ICW G;  2L7Z A;  2QOP A;  2LTP A;  4N4O B;  2EJR A;  1LQ1 A;  1RNL A;  1DQU A;  2ZO4 A;  4BNC A;  2ZB9 A;  2HR3 A;  2DYR H;  1QPM A;  3MKL A;  5E18 F;  3C07 A;  2E2J J;  4M3G A;  4IHY A;  4LFU A;  4OIP F;  4BE1 A;  4BHB A;  2PFV A;  1N25 A;  4RB2 C;  5ERI A;  3WU2 C;  2OI8 A;  1Z3X A;  4KN4 X;  4JKZ A;  1MMA A;  2KIS A;  1IW7 F;  1D5V A;  5EZH A;  1NHA A;  4EJT A;  2P5V A;  2L5Q A;  3CUQ A;  4IRG A;  1MJ9 A;  4RAZ A;  5IOY A;  3IKV A;  2EFN A;  1D8J A;  3LL7 A;  3I64 A;  1YW9 A;  2EZI A;  3DTK A;  5GAD J;  2R7X A;  5FB2 A;  3HEF A;  1MH4 A;  3CZ6 A;  2KP6 A;  3TO7 A;  1R22 A;  2CO5 A;  2V7F A;  1RPW A;  3VOE A;  1T08 B;  3K10 A;  4LK1 F;  3G73 A;  2D6Y A;  2A68 F;  1W36 D;  2QA4 I;  3F72 A;  3OYC A;  4MXM A;  4XSZ F;  3C7J A;  3M07 A;  3W6V A;  1QO0 D;  2A6T A;  2K9S A;  4A5N A;  1TWH J;  3FIW A;  4KMF A;  1JHF A;  1M1E B;  1K4S A;  3BCA A;  3CF5 F;  3O6B B;  4AC0 A;  2PJR A;  2F4M B;  4DOZ A;  1ZYR F;  5LHI A;  2M4K A;  1TP4 A;  3IUO A;  4CXF A;  1A5J A;  2FMY A;  3L2Q A;  1QRY A;  1UHS A;  3BC8 A;  1IF1 A;  2JJ7 A;  5CQE A;  3BLY A;  3ABU A;  3T8R A;  1ETK A;  5IYC J;  1XSX A;  3FXL A;  1QBJ A;  2NVY J;  1BI0 A;  3AQT A;  2N8G A;  4XLE A;  3OYH A;  2QWW A;  3LFK A;  3IHU A;  5DD4 A;  2ZXJ A;  5J4Y A;  3RI4 A;  3HTI A;  2VPR A;  3O2P E;  5K58 A;  4W1U A;  2MA3 A;  1LVA A;  4J01 A;  2W00 A;  2HOT A;  1HC8 A;  4BHP A;  2M45 A;  4XLA A;  4PK4 A;  2XRN A;  5CVU A;  3HZJ A;  3VPR A;  5KHD A;  2EZH A;  2EA4 A;  3T0Y A;  3M8E A;  2IPQ X;  3SWH A;  4C2M A;  4XK4 A;  3G1L A;  2CQ7 A;  3QYE A;  4M3D A;  3E6M A;  2IT0 A;  4U7D A;  2HDC A;  4Y33 A;  2B1E A;  1WH5 A;  2KKO A;  2GOM A;  2BHZ A;  2IAI A;  1BC8 C;  4RGX A;  1NTC A;  3CLO A;  4QIW N;  2EIL H;  2DOF A;  2H6C A;  2MW8 A;  3QOP A;  3CES A;  1XMX A;  5FKO A;  1XG1 A;  1HA8 A;  2XB0 X;  2O5R A;  2DT6 A;  1D0X A;  2MYS A;  2P81 A;  3H3U A;  4PSW A;  5GTH C;  3IAM 2;  1LE8 A;  1OCP A;  3VWB A;  3HPH A;  4QPQ A;  1YRN A;  3WU0 A;  3S17 J;  1MGT A;  3ERE D;  2FOK A;  4UUT A;  5C4Y A;  3CUO A;  4IVN A;  1KZH A;  4ZJZ A;  3JRC A;  1Y39 A;  2BV6 A;  3OYA A;  2B3W A;  2X4H A;  3S14 J;  1Y8R B;  2XB5 A;  5H2F C;  2WAD A;  3DV8 A;  2F48 A;  3WE3 A;  5LGU A;  4ESF A;  1TW3 A;  5D8L B;  2HPI A;  3FXO A;  2QM3 A;  1QVT A;  3Q3S A;  5L3F A;  2STW A;  4FE7 A;  3MCZ A;  3PNY A;  2VOO A;  1WGX A;  1ZH5 A;  4RAY A;  3HTJ A;  4XQF A;  1HCR A;  3FKI J;  2QWT A;  2GFN A;  3RKY A;  3ELK A;  3T8T A;  1BR1 A;  2LY2 A;  4DZP A;  2E1M C;  1RUN A;  4CYC B;  2IGN A;  4C9Y A;  4QLC U;  2ESH A;  1ONV A;  2Q24 A;  4XRS G;  4KYW A;  3BJB A;  4EJV A;  1BBY A;  1ENH A;  3H0G J;  1XGN A;  3R0A A;  1AOY A;  3O60 A;  2ZFW A;  4I99 C;  2E71 A;  3FRQ A;  3V6G A;  2QVO A;  2ELJ A;  2P6T A;  3LJL A;  3PJR A;  5FRO A;  4YIR X;  2R7W A;  3NXC A;  2Z16 A;  1NG6 A;  2XV4 S;  3GVA A;  4S04 A;  3OY9 A;  2IVM A;  2FUG 2;  2CYY A;  4E7I A;  2R7F A;  4KUM A;  5C3E J;  2FJI 1;  1Q1H A;  2Q2E B;  4A3G J;  1UHW A;  1TW2 A;  2F6C A;  2HFH A;  3D5R C;  3FM3 A;  4FQG A;  3OYE A;  1FOX A;  4H4K C;  4CCJ A;  4ESB A;  2H27 A;  2OPT A;  3G4S I;  3IAS 2;  3PIP F;  1HW5 A;  4PJM A;  3ZP5 A;  2LG4 A;  2K5C A;  5F0C A;  2G7U A;  1CF7 A;  1IZ1 A;  3L2W A;  1MSF C;  2A05 A;  3V8K A;  4DGW B;  2HYJ A;  3ZR8 X;  1HDD C;  3HOW J;  2KIQ A;  4ZTF A;  2F4O B;  1T95 A;  2YS9 A;  3VB2 A;  5EYR A;  4D7M A;  1IN5 A;  3HGY A;  4ZH4 F;  2RKH A;  5GP9 A;  3PSI A;  5AIP A;  4HW0 A;  5EFY A;  1TT5 B;  2E35 A;  5BPD A;  3F9K A;  3LNQ A;  1T98 A;  2Y48 A;  1FIA A;  4IHV A;  4KMU X;  2UUZ A;  5HS7 A;  5D5V B;  2BVL A;  3ZOB A;  4RLF A;  2OJE D;  1O7F A;  1FT9 A;  1S7A A;  2P7V B;  2V6C A;  2GXA A;  4BY7 J;  1WJD A;  2JT1 A;  3F1B A;  1B9M A;  4B4C A;  2WGB A;  5IYB J;  2MAB A;  3HG9 A;  3REO A;  2X1C A;  2GLO A;  2W48 A;  4IQ4 A;  2CW8 A;  1FJL A;  4X1E A;  2R0Q C;  1TC3 C;  4UVC A;  1EH8 A;  1OJL A;  1UG0 A;  3WTY C;  1VQO I;  3OR2 C;  3ZQG A;  3CRJ A;  1O7L A;  3GZN B;  1GXP A;  4G6T B;  3RQ4 A;  2NVQ J;  3MVP A;  2CUJ A;  3OIP A;  1ZK8 A;  2HGC A;  4ZDO A;  1BA5 A;  5E1X A;  5K7H A;  1U5T A;  2DPU A;  2V57 A;  4G94 A;  1FBU A;  2L9V A;  3MWM A;  3JTG A;  3GTO J;  5TIS C;  1BW5 A;  4V2F A;  1R5G A;  2FBK A;  4Y7N J;  3HRM A;  1X1B A;  2R7T A;  2DMT A;  4IF4 A;  1IN4 A;  3DBL B;  2BGC A;  2F5V A;  2HQN A;  1K6Y A;  4L9T A;  1BM9 A;  4O3M A;  4WXC A;  3FHZ A;  4D0P A;  3CUQ B;  1FIP A;  3DPU A;  1KQ9 A;  1OIS A;  2L2O A;  3TDZ C;  4ICH A;  3CJD A;  1YHQ I;  2PX9 A;  1YW8 A;  2WB1 A;  3QAH A;  2V9P A;  1ZG1 A;  1BR2 A;  1SAX A;  4KIC A;  5DV5 A;  1G59 A;  5B1B H;  2QBY A;  1WI9 A;  2QLZ A;  4YFK F;  1UJ8 A;  3MKW B;  2WY7 Q;  2VBW A;  1IXC A;  1S6L A;  2R3S A;  3E6C C;  5GPA A;  4KT6 A;  1V5G A;  2ZCX A;  1YIO A;  2E5N A;  5LHH A;  1X2N A;  3B6A A;  1WHU A;  5LBQ A;  4C2U A;  3I4P A;  2PJR B;  1A6I A;  1QHH D;  5DCF A;  1OCZ H;  2EIK H;  2L54 A;  5CLS A;  2LOO A;  3HTS B;  3ASO H;  2ID6 A;  2ZME A;  1GV5 A;  4XIC A;  4OWR B;  4HOB A;  4BUP A;  3I58 A;  1DPR A;  2LC2 A;  5FKL A;  2WA0 A;  1GVJ A;  3F21 A;  5EEA A;  4A3F J;  2HNH A;  1OCR H;  1SFU A;  5LGN A;  1ZR2 A;  4YRV A;  5LGT A;  2RQQ A;  2AXL A;  5DS9 A;  2VPL A;  3ABM H;  2FBQ A;  4ACI A;  1QPI A;  4I7H A;  2MG4 A;  2KIF A;  3V8L A;  3J7Y J;  1VQ8 I;  2YSR A;  2K9Q A;  1SC7 A;  1B72 A;  2F5E A;  4RM3 A;  3RH2 A;  1P4W A;  3HXL A;  1JKP C;  4IHW A;  3B73 A;  3JRD A;  3LAJ A;  3SDG A;  4XKB A;  3HOS A;  1IRZ A;  2OD5 A;  2Z33 A;  1TWG J;  5D18 A;  3C1D A;  3J7Z I;  1OQY A;  3CCY A;  3RZO J;  3VEP A;  1Y0U A;  1Y1V J;  2K85 A;  3VYU B;  3IKT A;  3DKX A;  4UVB A;  1RIO H;  3GTM J;  3I71 A;  4U9L A;  3ROU A;  3LQR A;  1V5E A;  2FD5 A;  3TOA A;  1U2W A;  2EZL A;  5IT9 K;  2XC7 A;  2RHA A;  3HIF A;  1MZB A;  2FQ3 A;  4QSH A;  1ETW A;  2CJJ A;  4A5M A;  1I39 A;  2NAZ A;  4NNJ A;  4XSX F;  5CXI A;  3M8J A;  4HLY A;  3S2H J;  2YVE A;  2EIM H;  2V79 A;  2XGC A;  2XGX A;  1YRN B;  4B09 A;  2E7W A;  1BI2 A;  2IA2 A;  3C2B A;  1R36 A;  1EF4 A;  1B4A A;  3I55 I;  5EEH A;  3CP2 A;  2R4G A;  3EUK L;  5CQG A;  2ZSI B;  3OOU A;  3BR6 A;  3RTR A;  3GUD A;  4FET A;  4UXN A;  3TBI A;  2W7N A;  4HDU A;  1S5L C;  2NX4 A;  4AVZ A;  4P1W A;  1GDT A;  1Z91 A;  4KIF A;  2KZG A;  5F08 A;  3FMQ A;  3LSJ A;  1BR4 A;  3K7A J;  4HQE A;  4EGY A;  1ZGW A;  1FOW A;  4UVA A;  3ZMS A;  2UV1 A;  4Y3O A;  1KU3 A;  4M6X A;  1MBK A;  1JTX A;  5BS6 A;  3KP6 A;  2KMU A;  1TQM A;  2JWT A;  2K9L A;  2MBF A;  2ZKZ A;  1WJC A;  4RDU A;  5M3F J;  2LP0 A;  3ESW B;  2DN0 A;  1WKM A;  2L0K A;  1ZRF A;  1HKT A;  4M72 A;  2M8E A;  5IY5 H;  1LKX A;  2LH9 A;  3IV5 A;  5IP6 A;  2OER A;  1MMS A;  2EV0 A;  2BZT A;  1T0F A;  2HKO A;  2M1B A;  2QGU A;  4BYY A;  4F55 A;  2DO7 A;  5FKK A;  3NS4 A;  4EVI A;  5E79 C;  5FKN A;  1MMG A;  3CF2 A;  3T6N A;  4IRH A;  3NAR A;  2NP3 A;  2WAQ A;  5FLX K;  1Z1D A;  1VF9 A;  2QKM B;  1XDU A;  2QSH X;  3BTL A;  2G7G A;  3CJQ B;  1FLI A;  1QZZ A;  5LRR A;  2CUZ A;  3CME I;  2CWE A;  4HBL A;  3CTA A;  5C44 J;  3RJP A;  3JSJ A;  1BC7 C;  1ZRE A;  3DKY A;  4P55 A;  2QQ8 A;  5D4R A;  1QHG A;  5J4V A;  4PCQ A;  1BOA A;  2ELH A;  3MKY B;  2B9S A;  4BY1 J;  4PSX A;  5C4X J;  2DMQ A;  3MQ0 A;  1FMV A;  4S0H B;  1TLH B;  4RAF A;  4J00 A;  4HLX A;  4ENK A;  3CO6 C;  2KIM A;  2VOD A;  3SFZ A;  2IBD A;  4L18 B;  1XD7 A;  2CQN A;  4XM3 A;  1V5F A;  4JX6 A;  2YX4 A;  5DTD A;  3OIO A;  1MDM A;  5DM6 F;  1J0R A;  3F8M A;  2XAH A;  2ISZ A;  2VQC A;  4AYB A;  4XNF A;  3A0B C;  4A3J J;  2PLY A;  2BHY A;  4BBR J;  2XKP A;  3QPL A;  2G7L A;  5JHF A;  5EZG A;  4XOP A;  3G7R A;  4G7O F;  1UZC A;  2VC0 A;  1UAA A;  2WAQ N;  3BCB A;  2DAO A;  3ZQQ A;  2DT5 A;  5FGL A;  1MBG A;  4Y17 A;  3KPH A;  5J47 A;  2LDU A;  4R79 A;  2RC4 A;  2V1N A;  5DDG A;  5ICE A;  2JTV A;  3HKZ N;  2EH3 A;  3HOT A;  2LKP A;  3S32 A;  3L9F A;  2JSP A;  3QP5 A;  3E5U A;  3DLL F;  1VQ7 I;  1XMA A;  3OYN A;  2DOA A;  1GUU A;  3H9J A;  1S9H A;  3NQO A;  3V8J A;  3JCU C;  4C30 A;  1CGP A;  2CRG A;  1KGS A;  4X0G A;  3H35 A;  4L9J A;  4ASN A;  2QSG X;  3K4L A;  1BJA A;  1SVO A;  4E70 A;  3BZK A;  3H3V K;  4CH7 A;  2KDO A;  4D5F A;  2WWY A;  1U5T B;  5JVG F;  3VP5 A;  3NRG A;  1IGN A;  2KPM A;  2HQR A;  3BHQ A;  4XLC A;  3S3O A;  4KFC A;  3UR3 C;  3FZV A;  3D1N I;  1AKH A;  4BDZ A;  1G6N A;  2ETH A;  2JZY A;  5F0F A;  4AYB N;  3DBR B;  4BAC A;  1UEL B;  4PJ0 C;  3BRO A;  5E3M A;  2E1O A;  2IW5 A;  1ZGA A;  5D6E A;  4MTD A;  3COL A;  1H8A C;  4M6V A;  5KAF C;  1GHC A;  2CG4 A;  2BOL A;  2Y0S A;  1P4A A;  4I02 A;  5DD8 A;  5K5Q A;  1O3T A;  3EPZ A;  5IYD J;  1Z05 A;  3A02 A;  3ZQF A;  1TTY A;  1R6R A;  1REP C;  3E6D A;  4A2U A;  1WJF A;  1BI3 A;  2MC3 A;  3EYY A;  5JI6 A;  3L1P A;  5E3N A;  3OYB A;  2QBY B;  1LB2 A;  2RVC A;  4LMY A;  4B1R A;  4MGR A;  3BTC A;  1UFM A;  3DP7 A;  2WAE A;  4YFX F;  2Y0M A;  3QPH A;  3KET A;  2QZ8 A;  2JVH A;  1KU7 A;  2W84 A;  5K5O A;  2EIN H;  4RGR A;  2VKH A;  2JN6 A;  4G12 A;  5CJ9 A;  4YZE A;  3BR0 A;  2L3D A;  1J9I A;  2ZME B;  2BXY A;  2JUC A;  4AM3 A;  3V78 A;  2REK A;  2RV8 A;  3SQN A;  3AG2 H;  1MBH A;  2DQR A;  2Q8K A;  2HYT A;  3V4G A;  1WFX A;  1SFX A;  3HBL A;  3ZMD A;  1MJB A;  4ITV A;  1YO5 C;  4B44 A;  1Y0N A;  3ASN H;  3I4N J;  2HKX A;  2K7L A;  2HZT A;  3SEQ A;  5B1A H;  2MLG A;  3H3Z A;  3RPU A;  2XAU A;  2D1H A;  4FX4 A;  1GV2 A;  2M3A A;  2Y0S N;  2ZJ2 A;  4NC7 A;  2NVU B;  4HX4 A;  1HKQ A;  3IWZ A;  4RAG A;  1FP2 A;  3BY6 A;  2ZCW A;  4ZDL A;  1XCV A;  4OMZ A;  5FD6 A;  1FSH A;  2OZU A;  3C3W A;  1YX3 A;  3UKG A;  1UMQ A;  5LFA A;  2F5C A;  3JRI A;  3S1N J;  3GO5 A;  4KT5 C;  2PG4 A;  3LSH A;  5JVT A;  3FXQ A;  1VQP I;  1ITY A;  3K70 D;  4M6Y A;  1YIJ I;  1A36 A;  5DYM A;  1VQK I;  3IWF A;  2VUM J;  4XL9 A;  4HYE A;  4RBO A;  1WJE A;  3O8H A;  2ZJP F;  2E1N A;  4AIK A;  1Z67 A;  4C3H J;  2PBI A;  3K0L A;  4PFO A;  1H88 C;  1LJ9 A;  3HC7 A;  3KYD B;  4B3A A;  4XRF A;  1WWX A;  3ZCO A;  3BZ6 A;  2A61 A;  2FML A;  4NDL A;  4DW6 A;  3FXM A;  2JA8 J;  4WK8 F;  3KP7 A;  3ZQI A;  4IRI A;  3QQA A;  3JW4 A;  2KRC A;  1VI0 A;  3S15 J;  4A3D J;  3ONQ A;  3G1M A;  2VQL A;  1POG A;  4X6A J;  3CC2 I;  3DKW A;  2H6B A;  1LUJ B;  1W4M A;  1LFP A;  1WI3 A;  2KJC A;  2UXN A;  3Q0W A;  2DG8 A;  5KNL A;  4H0E A;  2RDP A;  1TT0 A;  2HXI A;  3R4K A;  2AXT C;  3L00 A;  4U9N A;  3MNL A;  3GTQ J;  3IRQ A;  1YFH A;  4N9H A;  5B3S H;  2G7H A;  3X2Q H;  1JT0 A;  4E7L A;  5K1Y A;  3ZQC A;  3QBM A;  2V9K A;  5EGO B;  3S1R J;  3JAM K;  3AL0 B;  4HA8 A;  2E5Z A;  4XLF A;  5KAI C;  3RYR A;  5A2Q K;  4NBQ A;  2I5U A;  3LWJ A;  1LDK B;  1SVL A;  2XSJ C;  1Z7U A;  2EFO A;  4WXD A;  1WH7 A;  3VYR B;  4CGR A;  1W0U A;  2LR8 A;  3I0T A;  4CZC A;  2ZXW H;  4GRI A;  3S3M A;  1FYM A;  3K2Z A;  4GCL A;  2KL4 A;  4MK6 A;  3HRS A;  4PFP A;  4EAT A;  2FF4 A;  1K83 J;  2X51 A;  1JGS A;  1OLT A;  2PZ9 A;  5E17 F;  1IC8 A;  3NPI A;  3I59 A;  1B9N A;  1K7A A;  2LYC A;  4NQW B;  2K4B A;  5GAG J;  4JK1 X;  1J5Y A;  4OU0 A;  4E7H A;  5EDN A;  3L2U A;  2A2F X;  2KRH A;  3G2B A;  3KP5 A;  3WHC A;  1JKO C;  1X4O A;  1KQ0 A;  3PUB A;  3OYD A;  3HUG B;  3BNI A;  1FZP B;  5FFX A;  2O8X A;  2FXA A;  3RCO A;  5F1R A;  2ZME C;  1ZTR A;  1F1Z A;  4MFD A;  2VE9 A;  3TKY A;  4M9S A;  1Z7L A;  4LIU A;  3S1M J;  3F8B A;  1B59 A;  4KJZ A;  2FJ1 A;  2E36 A;  3BJ6 A;  3VW2 A;  1YOV B;  2EV5 A;  3WTT C;  4AC6 A;  1BIA A;  2NOG A;  1KQ8 A;  2GUH A;  1X3Z B;  2MLK A;  3OL4 A;  2EFP A;  1U0J A;  3BPX A;  3I54 A;  5B5E C;  2JPB A;  5FRM A;  3MEX A;  2A5Y B;  4HRI A;  4IRV A;  1MH3 A;  3IP4 B;  5ED4 A;  1U8R A;  1HF0 A;  2CW0 F;  5TGT A;  2BEO A;  4JL3 A;  2UXX A;  3VOK A;  3DTI A;  3LFU A;  1K79 A;  3VIB A;  2J5O A;  1MDM B;  4RGS A;  3RPQ A;  5LLQ A;  4F92 B;  1RKW A;  2O3F A;  4ME9 A;  4GXO A;  5DUK A;  3TL4 X;  3HSR A;  2FSW A;  3L09 A;  1WPK A;  4ENJ A;  4ZTJ A;  5HNF A;  3G6E I;  2IS2 A;  2DLL A;  2LRD A;  4IX7 A;  3DF8 A;  2V9V A;  1EH6 A;  1OR7 A;  3CCV I;  2AS5 F;  4IOA F;  3Q9S A;  3MD2 A;  2HVQ A;  4M3E A;  3U1D A;  3V7R A;  5HDK A;  3GTJ J;  2YU9 J;  1XPX A;  2NS0 A;  1X1P A;  1J75 A;  4M9Z A;  3MFK A;  5D4S A;  1AU7 A;  1PP7 U;  1LDD A;  1P4X A;  4XBF A;  4KNY A;  2JA7 J;  4AIH A;  1C0W A;  2COM A;  2XUB A;  1BJZ A;  1IRG A;  2DFE A;  3SZP A;  3E97 A;  3LA3 A;  2MD5 A;  1BW6 A;  2HTJ A;  4I0A A;  3W2A A;  4MEY F;  3ZMT A;  3OS0 A;  2Y2Z A;  3GWZ A;  4MEX F;  1V55 H;  3BCG A;  4IZZ A;  3HOU J;  3VVY A;  2IA1 A;  1DU6 A;  3KKD A;  4IOC F;  4Y4R A;  1DGW Y;  2E2H J;  4KIG A;  2QQ9 A;  2K9N A;  2VB6 A;  1PUF A;  2M2E A;  1AKH B;  2FEZ A;  3DEW A;  1ETY A;  2OU2 A;  3M1E A;  1N77 A;  3P9C A;  1SD6 A;  4E4H A;  3OMY A;  3CWR A;  3DEE A;  1R1T A;  2Y9Y A;  4Y15 A;  5B66 C;  4ZC3 A;  1YS6 A;  4MLO A;  2G9W A;  4MTE A;  1XTA A;  3HOY J;  3Q9V A;  2WC2 A;  4BHC A;  1AA7 A;  2PMZ N;  1W36 C;  2ZCM A;  3EUH A;  5H20 A;  2CU7 A;  3PSF A;  4BJ5 C;  1ZLJ A;  5JFR A;  1X1C A;  4I6Z A;  3D0S A;  2QQA A;  2CUE A;  3BOQ A;  2ECB A;  3K4K A;  1B8I A;  4RB0 A;  3CMM A;  1G4D A;  2OC6 A;  4LG0 B;  4IQJ A;  3CDL A;  3COA C;  5FHP A;  1GXQ A;  1MW7 A;  2NOJ B;  4D9J A;  3S3N A;  1XSD A;  3RPU D;  3ZMU A;  1APL C;  3JTH A;  1SAN A;  2KT0 A;  2MFZ A;  2DFH A;  4Y52 J;  2E1C A;  3FDY A;  3J81 K;  2JPC A;  2W25 A;  3VFZ A;  5HS8 A;  1WZ2 A;  3GTG J;  5ICF A;  2V26 A;  4N4N B;  4PZJ A;  4OIQ F;  2DQL A;  3WG7 H;  1HXD A;  1JI8 A;  3LWF A;  2GEN A;  4BL0 B;  2WV1 A;  4PJL A;  1LFB A;  3BR5 A;  4WF2 A;  3HHH A;  1VQL I;  2ME0 A; 
#chains in the Genus database with same CATH homology
 2RAE A;  1YRN B;  5D19 A;  1FTZ A;  1U78 A;  3C2B A;  4FTH A;  1EF4 A;  3EGQ A;  2UXU A;  3DPJ A;  2H8R A;  3HB9 A;  1D5Y A;  3OOU A;  2VKV A;  3BR6 A;  4A3C J;  5EF6 A;  5IP7 J;  2DA7 A;  2DTZ A;  2O7O A;  4FCY A;  3S5R A;  4A3M J;  2NX4 A;  1GDT A;  3JRB A;  2JA6 J;  2Y9Z A;  5F08 A;  2EBI A;  3LSJ A;  5J1R A;  3K7A J;  3ZQH A;  2MSY A;  3BTJ A;  1ZGW A;  3E7L A;  2DMN A;  2LLK A;  2XPV A;  1ETV A;  2IU5 A;  3A03 A;  1WCM J;  1MBK A;  2UXO A;  1X58 A;  1JTX A;  2NS8 A;  3S16 J;  2M34 A;  2FQ4 A;  3VVX A;  4DZJ A;  3PO3 J;  2JWT A;  4RDU A;  3IH2 A;  5M3F J;  3RD3 A;  2LP0 A;  4M3F A;  2DN0 A;  1ETQ A;  4M3B A;  1Q1V A;  1TWF J;  1Z0X A;  2L0K A;  2LKX A;  5C4J J;  2DA2 A;  2R93 J;  1MNM C;  3BR3 A;  5FLV A;  5CW8 A;  2HQ5 A;  3GBG A;  3IV5 A;  5IP6 A;  2OER A;  1E3O C;  2ELK A;  2O7T A;  3OSF A;  3JR9 A;  5FKK A;  5FKN A;  1F43 A;  1H89 C;  3T6N A;  2M0C A;  3NAR A;  2YUS A;  2R5Y B;  2G3B A;  2L7M P;  2NP3 A;  3ZQL A;  1FTT A;  1VF9 A;  1I3Q J;  5IOZ A;  2JMW A;  3BTL A;  2G7G A;  1ORK A;  2G0E A;  3B6C A;  3CMY A;  5HSZ A;  5C44 J;  1TWA J;  3O8G A;  3MN2 A;  3JSJ A;  2DA4 A;  1OCT C;  1B72 B;  4A3L J;  4BY1 J;  4D5C A;  1ETO A;  3GTP J;  5C4X J;  2DMQ A;  1MSE C;  1HOM A;  1NK3 P;  4S0H B;  3JRF A;  4A3B J;  2HKU A;  2PBX A;  3KKC A;  2X9D A;  2ID3 A;  3LSP A;  2L7Z A;  3PO2 J;  2LTP A;  2QOP A;  4C2M J;  2CQQ A;  2IBD A;  4JYK A;  3RQI A;  1AHD P;  2R5Z B;  4JX6 A;  2ZB9 A;  5DTD A;  3OIO A;  4D7N A;  1GT0 C;  3MKL A;  4A3J J;  1VND A;  2DMP A;  1K61 A;  3C07 A;  5DAJ A;  2E2J J;  3LOC A;  4M3G A;  4IHY A;  3WHB A;  4BBR J;  4L5E A;  3VUQ A;  3QPL A;  1X2M A;  4J19 A;  2G7L A;  1IDZ A;  5EZG A;  1JUS A;  5EG0 A;  3G7R A;  3NAU A;  3TW7 A;  1I6H J;  4DYC A;  3HM5 A;  3QPS A;  2M9H A;  2OI8 A;  2GM4 A;  2WAQ N;  4JKZ A;  5FGL A;  1MBG A;  3TP0 A;  3HGG A;  5EZH A;  1NK2 P;  3HKZ N;  2HXO A;  2VI6 A;  2EH3 A;  3TP3 A;  5IOY A;  5CXG A;  1U8B A;  3HIM A;  2EZI A;  4MIM A;  2VKE A;  2UXI A;  1MBJ A;  3HEF A;  1MH4 A;  1GUU A;  2YVH A;  1RPW A;  2D6Y A;  3BR2 A;  2CRG A;  4MXM A;  2JA5 J;  3W6V A;  3KNW A;  3VW0 A;  1QVU A;  2K9S A;  4UUS A;  3A01 B;  3H3V K;  4D5F A;  1TWH J;  3FIW A;  5HOD A;  3PM1 A;  2UXH A;  3VP5 A;  4JP0 A;  4AC0 A;  3NRG A;  2E19 A;  1IGN A;  3BHQ A;  2L9R A;  5M5W J;  2QCO A;  3BRU A;  1JUM A;  3D1N I;  1AKH A;  3HOX J;  3BT9 A;  4JX4 A;  5F0F A;  4AYB N;  1A5J A;  1QRY A;  1UHS A;  1RET A;  4EEF G;  2JJ7 A;  5E3M A;  2ZOY A;  2E1O A;  1LFU P;  3COL A;  2JK3 A;  4M6V A;  2EZK A;  1XC5 A;  1H8A C;  1ETK A;  3K2A A;  5IYC J;  3IH3 A;  3VOX A;  1RKT A;  1UG2 A;  2LY9 A;  5IYD J;  2NVY J;  3AQT A;  2N8G A;  2LVS A;  2E2I J;  4ABZ A;  3GTL J;  3A02 A;  3JRG A;  3HTI A;  5E3L A;  3ZQF A;  2IEK A;  2VPR A;  5K58 A;  5EGO A;  4W1U A;  2HOS A;  2HOT A;  4C3I J;  3L1P A;  5E3N A;  3BQY A;  5FKM A;  4B1R A;  3VPR A;  3BTC A;  4UDS A;  2EZH A;  1FEX A;  3B81 A;  3BR1 A;  4XK4 A;  3G1L A;  4A3K J;  4M3D A;  2JN6 A;  4G12 A;  4YZE A;  1WH5 A;  3BR0 A;  3BG9 A;  3TW6 A;  2IAI A;  1TWC J;  3JRA A;  1PUF B;  3V78 A;  1NTC A;  2REK A;  4QIW N;  3HOZ J;  2MW8 A;  1IJW C;  2DA6 A;  5FKO A;  2LK2 A;  1MBH A;  1XG1 A;  2EQR A;  2DA3 A;  2XB0 X;  2P81 A;  2HYT A;  2XGD A;  4NEL A;  4BXX J;  5FLM J;  3HBL A;  1LE8 A;  1OCP A;  3HDD A;  2D5V A;  2QKO A;  5J1U A;  2OF7 A;  1YRN A;  3S17 J;  2G7S A;  4GCK A;  2X48 A;  3ANG A;  4UUT A;  2ECC A;  3I4N J;  4JX5 A;  5C4Y A;  3JRC A;  1MBE A;  2AHQ A;  3DCF A;  3S14 J;  2XB5 A;  2I10 A;  1GV2 A;  2Y0S N;  2O9L A;  1UI6 A;  4W97 A;  3M3Y J;  3ON2 A;  2LFB A;  3BG3 A;  2COB A;  1QVT A;  3Q3S A;  2O8K A;  4FE7 A;  4HNV A;  1U9O A;  5K7Z A;  3UKG A;  1JUP A;  1UMQ A;  1WGX A;  1B8I B;  3HTJ A;  3ON4 A;  3JRI A;  1HCR A;  3FKI J;  5M5Y J;  3S1N J;  2QWT A;  5H9T A;  2GFN A;  1ITY A;  2XPW A;  4DZP A;  2VUM J;  4BKX A;  4CYC B;  4RBO A;  1HLV A;  3AQS A;  3O8H A;  4IHX A;  2ZOZ A;  2XGE A;  1T56 A;  4A93 J;  2Q24 A;  4C3H J;  4XRS G;  1U9N A;  3I4M J;  2QTQ A;  3BJB A;  1G2H A;  1H88 C;  1ENH A;  3H0G J;  4AUX A;  4B3A A;  2H1K A;  3NI7 A;  4DW6 A;  4NDL A;  3O60 A;  1I50 J;  2JA8 J;  3SJM A;  3LSG A;  3FRQ A;  3P9T A;  3V6G A;  4QTR A;  2RAS A;  3ZQI A;  2TRT A;  3LJL A;  3QQA A;  2NVT J;  1VI0 A;  2F07 A;  2R5Y A;  3S15 J;  4A3D J;  3NXC A;  3G1M A;  1POG A;  4X6A J;  1IV6 A;  1WI3 A;  1Z77 A;  3Q0W A;  5C3E J;  2DG8 A;  2HXI A;  3GTK J;  4A3G J;  3HTH A;  3MNL A;  4FE4 A;  3GTQ J;  3HOV J;  4GFL A;  5F04 A;  2CUF A;  3SFI A;  2OPT A;  2ME6 A;  1JT0 A;  4A3I J;  2NP5 A;  2Y31 A;  3ZQC A;  3QBM A;  5F0C A;  2DMU A;  5EGO B;  2KDZ A;  3S1R J;  2XDN A;  2DJN A;  2WB1 N;  4IEJ A;  1MSF C;  3LWJ A;  2B63 J;  1JKQ C;  2HYJ A;  1HDD C;  3HOW J;  1WH7 A;  3ANP A;  2HOA A;  4CGR A;  2YS9 A;  4KWA A;  2HI3 A;  3Q0V A;  5EYR A;  4D7M A;  1BL0 A;  1W0U A;  2LR8 A;  3HGY A;  5IP9 J;  4GCL A;  1IUF A;  5GP9 A;  2AO9 A;  3OSG A;  4MK6 A;  5EFY A;  1JT6 A;  1K83 J;  3LNQ A;  2PZ9 A;  1IC8 A;  2ZCN A;  1FIA A;  3NPI A;  4FIS A;  4IHV A;  5F27 A;  3ZOB A;  5EDN A;  1LE8 B;  3HE0 A;  1JKO C;  3WHC A;  4BY7 J;  4A3E J;  3IUV A;  3BNI A;  2UXP A;  1XS9 A;  1GVD A;  9ANT A;  3F1B A;  4JNN A;  4B4C A;  2WGB A;  1ZTR A;  5IYB J;  4MFD A;  2L7F P;  2DG7 A;  5J1Y A;  3S1M J;  2NS7 A;  3FK7 A;  2XPU A;  2GLO A;  2QIB A;  2W48 A;  3FIS A;  2FJ1 A;  1FJL A;  2DA5 A;  4DYR A;  3VW2 A;  2FX0 A;  3S1Q J;  1W0T A;  3EUP A;  3RZD J;  5K7F A;  1OFC X;  4X1E A;  2R0Q C;  1TC3 C;  2NOG A;  3HTA A;  1JTY A;  2GUH A;  5E3O A;  2R92 J;  1OJL A;  4AC6 A;  2QF7 A;  5IPA A;  4BBS J;  2WUI A;  3ZQG A;  3CRJ A;  3VVZ A;  2NVQ J;  3MVP A;  3PAS A;  3GZI A;  1ZK8 A;  1MH3 A;  1ETX A;  1HF0 A;  4XID A;  1BA5 A;  4L62 A;  2X6O A;  5K7H A;  3A01 A;  1SGM A;  3VOK A;  3VIB A;  4XRM A;  3FK6 A;  5F0H A;  5HBU A;  4JL3 A;  4A69 C;  2V57 A;  1DU0 A;  3E7Q A;  1RKW A;  4PXI A;  4ME9 A;  1JJ6 C;  3GTO J;  5JLW A;  1BW5 A;  4V2F A;  5J3L A;  1JGG A;  4Y7N J;  3QKX A;  1WPK A;  1CQT A;  2DMT A;  1ZKG A;  5EG0 B;  1JKR C;  1ZR4 A;  3G56 A;  3IH4 A;  4HKU A;  3G1O A;  4GCT A;  2HDD A;  5BNG A;  1SFO J;  3Q0U A;  4C3J J;  4M3E A;  3GTJ J;  2YU9 J;  1FIP A;  4ICH A;  3NNR A;  3CJD A;  3GEU A;  5HAW A;  1AU7 A;  2JA7 J;  1BJZ A;  4LOC A;  5D1R A;  1MBF A;  4GFB A;  4GFK A;  3LSR A;  3TED A;  1ZQ3 P;  1BW6 A;  3F0C A;  2M8G X;  2Y2Z A;  1IG7 A;  3BCG A;  1HDP A;  1S7E A;  5GPA A;  3HOU J;  4UUS B;  2ZCX A;  3KZ9 A;  1DU6 A;  1RR7 A;  3VVY A;  1X2N A;  3B6A A;  4MFE A;  3KKD A;  2Y30 A;  2CQX A;  1A6I A;  2MGQ A;  2E2H J;  3M4O J;  2K9N A;  2ID6 A;  2TCT A;  1R9T J;  1PUF A;  1GV5 A;  2M2E A;  2W53 A;  1AKH B;  4XIC A;  3DEW A;  2GBY A;  1ETY A;  5M5X J;  5FKL A;  1P7J A;  2DA1 A;  4I76 A;  5FJ8 J;  5EEA A;  3CWR A;  4A3F J;  5JLX A;  3JRE A;  2Y9Y A;  1ZR2 A;  5DS9 A;  4ACI A;  2FBQ A;  1QPI A;  4MLO A;  2MG4 A;  3S2D J;  4XRS A;  2K9Q A;  1B72 A;  2NVX J;  3HOY J;  3RH2 A;  1JKP C;  4IHW A;  2PMZ N;  2ZCM A;  3JRD A;  2CU7 A;  3SDG A;  1JJ8 C;  3PPB A;  1IDY A;  1IRZ A;  4V2G A;  1F36 A;  3CQZ J;  3BG5 A;  4I6Z A;  3BTI A;  1TWG J;  5D18 A;  2CUE A;  3CCY A;  2ECB A;  3RZO J;  1B8I A;  3JRH A;  1Y1V J;  3VW1 A;  2K40 A;  3GTM J;  3CDL A;  3RKQ A;  5FHP A;  2R7Z J;  2R5Z A;  1APL C;  2FD5 A;  1Y1W J;  1SAN A;  2KT0 A;  5M3M J;  4Y52 J;  1RES A;  2EZL A;  4DYQ A;  4CYC A;  2RHA A;  3LHQ A;  3GTG J;  4QSH A;  1UI5 A;  1ETW A;  2CJJ A;  5AQC A;  2LD5 A;  2XSD C;  5FMP A;  4MO7 A;  5F1J A;  1VFC A;  2GEN A;  1P7I A;  5CXI A;  1O4X A;  2WV1 A;  3S2H J;  5GPC A;  1LFB A;  1T33 A;  3BR5 A;  2YVE A;  2XRL A;  3BQZ A;  4NN1 A;  2ME0 A;  4AF5 A;  2XGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...