2HKUA

Structural genomics, the crystal structure of a putative transcriptional regulator from rhodococcus sp. rha1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
191
structure length
191
Chain Sequence
QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A putative transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription regulator
total genus 79
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16914 TetR_C_12 Bacterial transcriptional repressor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hkuA00
2O7TA 5F27A 3P9TA 3AQSA 3G1MA 2OF7A 2XPUA 1ZK8A 3ZQGA 1Z77A 3VPRA 4I6ZA 3V6GA 2PZ9A 4XK4A 2JK3A 2FQ4A 2WUIA 5EZGA 3DCFA 4V2FA 3VVYA 3QPLA 3BTJA 3CDLA 5HBUA 3FIWA 2HXIA 2UXUA 3TP3A 3TP0A 5IPAA 5J1UA 5F08A 2NS7A 3HIMA 4YZEA 5CXGA 2OPTA 3BQYA 2QIBA 2HYJA 3C2BA 3B6AA 1QVTA 2XRLA 1RKWA 2G7GA 2Y2ZA 3Q3SA 5GP9A 3QPSA 5K7HA 2O7OA 4DW6A 2QWTA 5K7ZA 2IAIA 2NP5A 5F0CA 1U9NA 3Q0UA 4W97A 2QCOA 2VKEA 3LOCA 2TCTA 5AQCA 2VKVA 3F1BA 4D7MA 5IP6A 1RKTA 3HTAA 2UXPA 4M3EA 3JSJA 3BQZA 3WHCA 3BT9A 3FK6A 5K58A 3C07A 1BJZA 4ME9A 3BRUA 5D19A 5D1RA 3B81A 3Q0WA 3V78A 5F0FA 5DAJA 4AF5A 2ID6A 1JUMA 2IBDA 3ON2A 5H9TA 4GCTA 2NS8A 5EYRA 1ORKA 1T56A 5FGLA 4AUXA 1QVUA 3HGGA 2RASA 3MVPA 4L62A 5J1YA 3G1LA 2HQ5A 4GCLA 5HAWA 5C4YA 4M3GA 3LSPA 2HKUA 3BHQA 3BNIA 1JT0A 3COLA 4MXMA 5CW8A 4GCKA 4ABZA 2JJ7A 3VIBA 2YVHA 3G56A 3BR3A 3KZ9A 2GBYA 4MK6A 2UXOA 2G7LA 3BR5A 1JTXA 5K7FA 3E7QA 2ZOYA 3PPBA 2UXHA 2ZCMA 2TRTA 3FK7A 3QBMA 3GEUA 5FHPA 1JT6A 1A6IA 3O8HA 2PBXA 3MNLA 3HGYA 3SDGA 4X1EA 2FD5A 2Y31A 5FKOA 1JTYA 3CJDA 3VW2A 2XPWA 2RHAA 4UDSA 4ACIA 3KKCA 2GENA 1T33A 3VOKA 3ON4A 3ZQHA 5FKKA 3ZQLA 3NNRA 3HTHA 3QKXA 2XPVA 3O60A 3LHQA 2WGBA 2IU5A 2GFNA 3KNWA 4M3BA 4NN1A 3SFIA 3DPJA 5IOYA 1U9OA 2ZOZA 3ZQIA 5GPAA 2X9DA 2DG7A 2XGEA 3DEWA 2XGCA 5F1JA 2NP3A 1Z0XA 2QKOA 3IH3A 2EH3A 4B3AA 3EGQA 5FMPA 4NELA 2OERA 3VOXA 4W1UA 3BCGA 1JUSA 1UI5A 3IH2A 2ZCNA 4AC6A 3VVZA 2W53A 5FKMA 3BTCA 2IEKA 2UXIA 4GFKA 3Q0VA 2I10A 2Y30A 3CWRA 2V57A 2VPRA 2FJ1A 3LSJA 4GFLA 3VW1A 2F07A 1RPWA 3BR1A 5GPCA 2FX0A 5D18A 2X6OA 2XGDA 5HSZA 3IH4A 1VI0A 3HTIA 3QQAA 4JNNA 5F0HA 2FBQA 3NRGA 3HE0A 3FRQA 5EFYA 4I76A 3S5RA 2WV1A 4AC0A 3G1OA 1UI6A 4G12A 3CCYA 2XB5A 3WHBA 2ZB9A 1QPIA 2G7SA 2G3BA 3VW0A 3KKDA 3G7RA 4D5FA 2DTZA 3HTJA 3BTLA 4JKZA 2YVEA 2G0EA 2NX4A 2HXOA 2DG8A 2ID3A 4V2GA 1ZKGA 5EZHA 2OI8A 2ZCXA 3BTIA 3PASA 4KWAA 4M3DA 4B1RA 1SGMA 3VP5A 3T6NA 5J3LA 3GZIA 3ANPA 5FKNA 4HKUA 2HYTA 4CGRA 3BR2A 3LJLA 3VVXA 2QOPA 4D5CA 3ANGA 3PM1A 3LWJA 3F0CA 4JYKA 2QTQA 3BJBA 4ICHA 4PXIA 2REKA 4M3FA 4JL3A 3ZQFA 4D7NA 5IOZA 5FKLA 3CRJA 2RAEA 3BR6A 2D6YA 2Q24A 5F04A 3RH2A 3RD3A 2XDNA 5CXIA 3NXCA 3NI7A 3LSRA 3IUVA 3BR0A 3AQTA 3NPIA 2GUHA 5J1RA 3B6CA 4MO7A 3VUQA 1JUPA 3EUPA 3O8GA
chains in the Genus database with same CATH superfamily
2O7TA 5F27A 3P9TA 3AQSA 3G1MA 2OF7A 2XPUA 1ZK8A 3ZQGA 1Z77A 3VPRA 4I6ZA 3V6GA 2PZ9A 4XK4A 2JK3A 2FQ4A 2WUIA 5EZGA 3DCFA 4V2FA 3VVYA 3QPLA 3BTJA 3CDLA 5HBUA 3FIWA 2HXIA 2UXUA 3TP3A 3TP0A 5IPAA 5J1UA 5F08A 2NS7A 3HIMA 4YZEA 5CXGA 2OPTA 3BQYA 2QIBA 2HYJA 3C2BA 3B6AA 1QVTA 2XRLA 1RKWA 2G7GA 2Y2ZA 4IRVA 3Q3SA 5GP9A 3QPSA 5K7HA 2O7OA 4DW6A 2QWTA 5K7ZA 2IAIA 2NP5A 5F0CA 1U9NA 3Q0UA 4W97A 2QCOA 2VKEA 3LOCA 2TCTA 5AQCA 2VKVA 3F1BA 4D7MA 5IP6A 1RKTA 3HTAA 2UXPA 4M3EA 3JSJA 4DVYP 3BQZA 3WHCA 3BT9A 3FK6A 5K58A 2R7TA 3C07A 1BJZA 4ME9A 3BRUA 5D19A 5D1RA 3B81A 3Q0WA 3V78A 5F0FA 5DAJA 4AF5A 2ID6A 1JUMA 2B3WA 2IBDA 3ON2A 3SWHA 5H9TA 4GCTA 2NS8A 5EYRA 1ORKA 1T56A 5FGLA 4AUXA 1QVUA 4WIBA 3HGGA 2RASA 3MVPA 4L62A 5J1YA 2PFVA 3G1LA 2HQ5A 4GCLA 5HAWA 5C4YA 4M3GA 3LSPA 2HKUA 3BHQA 3BNIA 1JT0A 3COLA 4MXMA 5CW8A 4GCKA 4ABZA 2FJI1 2JJ7A 3VIBA 2YVHA 3G56A 3BR3A 3KZ9A 2GBYA 4MK6A 4OD4A 2UXOA 2G7LA 3BR5A 1JTXA 5K7FA 3E7QA 2ZOYA 3PPBA 2UXHA 2ZCMA 2TRTA 3FK7A 3QBMA 3GEUA 3FHNA 5FHPA 2ZY9A 1JT6A 1A6IA 4OD5A 3O8HA 2PBXA 3MNLA 3HGYA 3SDGA 4X1EA 2FD5A 2Y31A 5FKOA 1JTYA 3CJDA 2R7VA 3VW2A 2XPWA 2RHAA 4UDSA 4ACIA 3KKCA 2GENA 1T33A 2R7RA 3VOKA 3K8PC 3ON4A 3ZQHA 5FKKA 3ZQLA 3NNRA 3HTHA 3QKXA 2XPVA 3O60A 3LHQA 2WGBA 2IU5A 2GFNA 3KNWA 4M3BA 4NN1A 3SFIA 3DPJA 5IOYA 1U9OA 2ZOZA 3ZQIA 5GPAA 2X9DA 2DG7A 2XGEA 2R7UA 3DEWA 4U9LA 2XGCA 5F1JA 2NP3A 1Z0XA 2QKOA 3IH3A 3NS4A 2EH3A 4B3AA 3EGQA 5FMPA 4NELA 2OERA 3VOXA 4W1UA 3BCGA 1JUSA 1UI5A 3IH2A 2ZCNA 4AC6A 3VVZA 2W53A 5FKMA 3BTCA 2IEKA 2UXIA 4GFKA 3Q0VA 2I10A 2Y30A 3CWRA 2V57A 2VPRA 2FJ1A 3LSJA 4GFLA 3VW1A 2F07A 5CQGA 1RPWA 3BR1A 3DU6A 5GPCA 2FX0A 5D18A 2X6OA 2XGDA 5HSZA 3IH4A 1VI0A 3HTIA 3QQAA 4JNNA 5F0HA 2FBQA 3NRGA 3HE0A 3FRQA 5EFYA 2B1EA 4I76A 3VTIA 3S5RA 2WV1A 4AC0A 3G1OA 1UI6A 4G12A 3CCYA 2R7QA 4C2MA 2XB5A 3WHBA 2ZB9A 2A2FX 1QPIA 2G7SA 2G3BA 3VW0A 3KKDA 3G7RA 4D5FA 2DTZA 3HTJA 3BTLA 4JKZA 2YVEA 2G0EA 2NX4A 2HXOA 2DG8A 3DU5A 2YVXA 2ID3A 4V2GA 1ZKGA 5EZHA 2OI8A 2ZCXA 3BTIA 3PASA 4KWAA 4M3DA 4B1RA 1SGMA 3VP5A 2R7WA 3T6NA 5J3LA 3GZIA 3ANPA 5FKNA 4HKUA 2R7XA 2HYTA 4CGRA 3BR2A 3LJLA 3VVXA 2QOPA 4D5CA 3ANGA 3PM1A 3LWJA 3F0CA 4JYKA 2QTQA 3BJBA 4ICHA 4PXIA 2REKA 4M3FA 4JL3A 3ZQFA 4D7NA 5IOZA 5FKLA 3CRJA 4U9NA 2RAEA 3BR6A 3KYLA 2D6YA 2R7OA 2Q24A 5F04A 3RH2A 3RD3A 2XDNA 5CXIA 3NXCA 3NI7A 3LSRA 3IUVA 3BR0A 3AQTA 3NPIA 2GUHA 5J1RA 3B6CA 4MO7A 2R7SA 3VUQA 1JUPA 3EUPA 3O8GA
chains in the Genus database with same CATH topology
2O7TA 5F27A 3P9TA 3AQSA 3G1MA 2OF7A 2XPUA 1ZK8A 3ZQGA 1Z77A 3VPRA 4I6ZA 3V6GA 2PZ9A 4XK4A 2JK3A 2FQ4A 2WUIA 5EZGA 3DCFA 4V2FA 3VVYA 3QPLA 3BTJA 3CDLA 5HBUA 3FIWA 2HXIA 2UXUA 3TP3A 3TP0A 5IPAA 5J1UA 5F08A 2NS7A 3HIMA 4YZEA 5CXGA 2OPTA 3BQYA 2QIBA 2HYJA 3C2BA 3B6AA 1QVTA 2XRLA 1RKWA 2G7GA 2Y2ZA 3Q3SA 5GP9A 3QPSA 5K7HA 2O7OA 4DW6A 2QWTA 5K7ZA 2IAIA 2NP5A 5F0CA 1U9NA 3Q0UA 4W97A 2QCOA 2VKEA 3LOCA 2TCTA 5AQCA 2VKVA 3F1BA 4D7MA 5IP6A 1RKTA 3HTAA 2UXPA 4M3EA 3JSJA 3BQZA 3WHCA 3BT9A 3FK6A 5K58A 3C07A 1BJZA 4ME9A 3BRUA 5D19A 5D1RA 3B81A 3Q0WA 3V78A 5F0FA 5DAJA 4AF5A 2ID6A 1JUMA 2IBDA 3ON2A 5H9TA 4GCTA 2NS8A 5EYRA 1ORKA 1T56A 5FGLA 4AUXA 1QVUA 3HGGA 2RASA 3MVPA 4L62A 5J1YA 3G1LA 2HQ5A 4GCLA 5HAWA 5C4YA 4M3GA 3LSPA 2HKUA 3BHQA 3BNIA 1JT0A 3COLA 4MXMA 5CW8A 4GCKA 4ABZA 2JJ7A 3VIBA 2YVHA 3G56A 3BR3A 3KZ9A 2GBYA 4MK6A 2UXOA 2G7LA 3BR5A 1JTXA 5K7FA 3E7QA 2ZOYA 3PPBA 2UXHA 2ZCMA 2TRTA 3FK7A 3QBMA 3GEUA 5FHPA 1JT6A 1A6IA 3O8HA 2PBXA 3MNLA 3HGYA 3SDGA 4X1EA 2FD5A 2Y31A 5FKOA 1JTYA 3CJDA 3VW2A 2XPWA 2RHAA 4UDSA 4ACIA 3KKCA 2GENA 1T33A 3VOKA 3ON4A 3ZQHA 5FKKA 3ZQLA 3NNRA 3HTHA 3QKXA 2XPVA 3O60A 3LHQA 2WGBA 2IU5A 2GFNA 3KNWA 4M3BA 4NN1A 3SFIA 3DPJA 5IOYA 1U9OA 2ZOZA 3ZQIA 5GPAA 2X9DA 2DG7A 2XGEA 3DEWA 2XGCA 5F1JA 2NP3A 1Z0XA 2QKOA 3IH3A 2EH3A 4B3AA 3EGQA 5FMPA 4NELA 2OERA 3VOXA 4W1UA 3BCGA 1JUSA 1UI5A 3IH2A 2ZCNA 4AC6A 3VVZA 2W53A 5FKMA 3BTCA 2IEKA 2UXIA 4GFKA 3Q0VA 2I10A 2Y30A 3CWRA 2V57A 2VPRA 2FJ1A 3LSJA 4GFLA 3VW1A 2F07A 1RPWA 3BR1A 5GPCA 2FX0A 5D18A 2X6OA 2XGDA 5HSZA 3IH4A 1VI0A 3HTIA 3QQAA 4JNNA 5F0HA 2FBQA 3NRGA 3HE0A 3FRQA 5EFYA 4I76A 3S5RA 2WV1A 4AC0A 3G1OA 1UI6A 4G12A 3CCYA 2XB5A 3WHBA 2ZB9A 1QPIA 2G7SA 2G3BA 3VW0A 3KKDA 3G7RA 4D5FA 2DTZA 3HTJA 3BTLA 4JKZA 2YVEA 2G0EA 2NX4A 2HXOA 2DG8A 2ID3A 4V2GA 1ZKGA 5EZHA 2OI8A 2ZCXA 3BTIA 3PASA 4KWAA 4M3DA 4B1RA 1SGMA 3VP5A 3T6NA 5J3LA 3GZIA 3ANPA 5FKNA 4HKUA 2HYTA 4CGRA 3BR2A 3LJLA 3VVXA 2QOPA 4D5CA 3ANGA 3PM1A 3LWJA 3F0CA 4JYKA 2QTQA 3BJBA 4ICHA 4PXIA 2REKA 4M3FA 4JL3A 3ZQFA 4D7NA 5IOZA 5FKLA 3CRJA 2RAEA 3BR6A 2D6YA 2Q24A 5F04A 3RH2A 3RD3A 2XDNA 5CXIA 3NXCA 3NI7A 3LSRA 3IUVA 3BR0A 3AQTA 3NPIA 2GUHA 5J1RA 3B6CA 4MO7A 3VUQA 1JUPA 3EUPA 3O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O7T A;  5F27 A;  3P9T A;  3AQS A;  3G1M A;  2OF7 A;  2XPU A;  1ZK8 A;  3ZQG A;  1Z77 A;  3VPR A;  4I6Z A;  3V6G A;  2PZ9 A;  4XK4 A;  2JK3 A;  2FQ4 A;  2WUI A;  5EZG A;  3DCF A;  4V2F A;  3VVY A;  3QPL A;  3BTJ A;  3CDL A;  5HBU A;  3FIW A;  2HXI A;  2UXU A;  3TP3 A;  3TP0 A;  5IPA A;  5J1U A;  5F08 A;  2NS7 A;  3HIM A;  4YZE A;  5CXG A;  2OPT A;  3BQY A;  2QIB A;  2HYJ A;  3C2B A;  3B6A A;  1QVT A;  2XRL A;  1RKW A;  2G7G A;  2Y2Z A;  3Q3S A;  5GP9 A;  3QPS A;  5K7H A;  2O7O A;  4DW6 A;  2QWT A;  5K7Z A;  2IAI A;  2NP5 A;  5F0C A;  1U9N A;  3Q0U A;  4W97 A;  2QCO A;  2VKE A;  3LOC A;  2TCT A;  5AQC A;  2VKV A;  3F1B A;  4D7M A;  5IP6 A;  1RKT A;  3HTA A;  2UXP A;  4M3E A;  3JSJ A;  3BQZ A;  3WHC A;  3BT9 A;  3FK6 A;  5K58 A;  3C07 A;  1BJZ A;  4ME9 A;  3BRU A;  5D19 A;  5D1R A;  3B81 A;  3Q0W A;  3V78 A;  5F0F A;  5DAJ A;  4AF5 A;  2ID6 A;  1JUM A;  2IBD A;  3ON2 A;  5H9T A;  4GCT A;  2NS8 A;  5EYR A;  1ORK A;  1T56 A;  5FGL A;  4AUX A;  1QVU A;  3HGG A;  2RAS A;  3MVP A;  4L62 A;  5J1Y A;  3G1L A;  2HQ5 A;  4GCL A;  5HAW A;  5C4Y A;  4M3G A;  3LSP A;  2HKU A;  3BHQ A;  3BNI A;  1JT0 A;  3COL A;  4MXM A;  5CW8 A;  4GCK A;  4ABZ A;  2JJ7 A;  3VIB A;  2YVH A;  3G56 A;  3BR3 A;  3KZ9 A;  2GBY A;  4MK6 A;  2UXO A;  2G7L A;  3BR5 A;  1JTX A;  5K7F A;  3E7Q A;  2ZOY A;  3PPB A;  2UXH A;  2ZCM A;  2TRT A;  3FK7 A;  3QBM A;  3GEU A;  5FHP A;  1JT6 A;  1A6I A;  3O8H A;  2PBX A;  3MNL A;  3HGY A;  3SDG A;  4X1E A;  2FD5 A;  2Y31 A;  5FKO A;  1JTY A;  3CJD A;  3VW2 A;  2XPW A;  2RHA A;  4UDS A;  4ACI A;  3KKC A;  2GEN A;  1T33 A;  3VOK A;  3ON4 A;  3ZQH A;  5FKK A;  3ZQL A;  3NNR A;  3HTH A;  3QKX A;  2XPV A;  3O60 A;  3LHQ A;  2WGB A;  2IU5 A;  2GFN A;  3KNW A;  4M3B A;  4NN1 A;  3SFI A;  3DPJ A;  5IOY A;  1U9O A;  2ZOZ A;  3ZQI A;  5GPA A;  2X9D A;  2DG7 A;  2XGE A;  3DEW A;  2XGC A;  5F1J A;  2NP3 A;  1Z0X A;  2QKO A;  3IH3 A;  2EH3 A;  4B3A A;  3EGQ A;  5FMP A;  4NEL A;  2OER A;  3VOX A;  4W1U A;  3BCG A;  1JUS A;  1UI5 A;  3IH2 A;  2ZCN A;  4AC6 A;  3VVZ A;  2W53 A;  5FKM A;  3BTC A;  2IEK A;  2UXI A;  4GFK A;  3Q0V A;  2I10 A;  2Y30 A;  3CWR A;  2V57 A;  2VPR A;  2FJ1 A;  3LSJ A;  4GFL A;  3VW1 A;  2F07 A;  1RPW A;  3BR1 A;  5GPC A;  2FX0 A;  5D18 A;  2X6O A;  2XGD A;  5HSZ A;  3IH4 A;  1VI0 A;  3HTI A;  3QQA A;  4JNN A;  5F0H A;  2FBQ A;  3NRG A;  3HE0 A;  3FRQ A;  5EFY A;  4I76 A;  3S5R A;  2WV1 A;  4AC0 A;  3G1O A;  1UI6 A;  4G12 A;  3CCY A;  2XB5 A;  3WHB A;  2ZB9 A;  1QPI A;  2G7S A;  2G3B A;  3VW0 A;  3KKD A;  3G7R A;  4D5F A;  2DTZ A;  3HTJ A;  3BTL A;  4JKZ A;  2YVE A;  2G0E A;  2NX4 A;  2HXO A;  2DG8 A;  2ID3 A;  4V2G A;  1ZKG A;  5EZH A;  2OI8 A;  2ZCX A;  3BTI A;  3PAS A;  4KWA A;  4M3D A;  4B1R A;  1SGM A;  3VP5 A;  3T6N A;  5J3L A;  3GZI A;  3ANP A;  5FKN A;  4HKU A;  2HYT A;  4CGR A;  3BR2 A;  3LJL A;  3VVX A;  2QOP A;  4D5C A;  3ANG A;  3PM1 A;  3LWJ A;  3F0C A;  4JYK A;  2QTQ A;  3BJB A;  4ICH A;  4PXI A;  2REK A;  4M3F A;  4JL3 A;  3ZQF A;  4D7N A;  5IOZ A;  5FKL A;  3CRJ A;  2RAE A;  3BR6 A;  2D6Y A;  2Q24 A;  5F04 A;  3RH2 A;  3RD3 A;  2XDN A;  5CXI A;  3NXC A;  3NI7 A;  3LSR A;  3IUV A;  3BR0 A;  3AQT A;  3NPI A;  2GUH A;  5J1R A;  3B6C A;  4MO7 A;  3VUQ A;  1JUP A;  3EUP A;  3O8G A; 
#chains in the Genus database with same CATH topology
 2O7T A;  5F27 A;  3P9T A;  3AQS A;  3G1M A;  2OF7 A;  2XPU A;  1ZK8 A;  3ZQG A;  1Z77 A;  3VPR A;  4I6Z A;  3V6G A;  2PZ9 A;  4XK4 A;  2JK3 A;  2FQ4 A;  2WUI A;  5EZG A;  3DCF A;  4V2F A;  3VVY A;  3QPL A;  3BTJ A;  3CDL A;  5HBU A;  3FIW A;  2HXI A;  2UXU A;  3TP3 A;  3TP0 A;  5IPA A;  5J1U A;  5F08 A;  2NS7 A;  3HIM A;  4YZE A;  5CXG A;  2OPT A;  3BQY A;  2QIB A;  2HYJ A;  3C2B A;  3B6A A;  1QVT A;  2XRL A;  1RKW A;  2G7G A;  2Y2Z A;  4IRV A;  3Q3S A;  5GP9 A;  3QPS A;  5K7H A;  2O7O A;  4DW6 A;  2QWT A;  5K7Z A;  2IAI A;  2NP5 A;  5F0C A;  1U9N A;  3Q0U A;  4W97 A;  2QCO A;  2VKE A;  3LOC A;  2TCT A;  5AQC A;  2VKV A;  3F1B A;  4D7M A;  5IP6 A;  1RKT A;  3HTA A;  2UXP A;  4M3E A;  3JSJ A;  4DVY P;  3BQZ A;  3WHC A;  3BT9 A;  3FK6 A;  5K58 A;  2R7T A;  3C07 A;  1BJZ A;  4ME9 A;  3BRU A;  5D19 A;  5D1R A;  3B81 A;  3Q0W A;  3V78 A;  5F0F A;  5DAJ A;  4AF5 A;  2ID6 A;  1JUM A;  2B3W A;  2IBD A;  3ON2 A;  3SWH A;  5H9T A;  4GCT A;  2NS8 A;  5EYR A;  1ORK A;  1T56 A;  5FGL A;  4AUX A;  1QVU A;  4WIB A;  3HGG A;  2RAS A;  3MVP A;  4L62 A;  5J1Y A;  2PFV A;  3G1L A;  2HQ5 A;  4GCL A;  5HAW A;  5C4Y A;  4M3G A;  3LSP A;  2HKU A;  3BHQ A;  3BNI A;  1JT0 A;  3COL A;  4MXM A;  5CW8 A;  4GCK A;  4ABZ A;  2FJI 1;  2JJ7 A;  3VIB A;  2YVH A;  3G56 A;  3BR3 A;  3KZ9 A;  2GBY A;  4MK6 A;  4OD4 A;  2UXO A;  2G7L A;  3BR5 A;  1JTX A;  5K7F A;  3E7Q A;  2ZOY A;  3PPB A;  2UXH A;  2ZCM A;  2TRT A;  3FK7 A;  3QBM A;  3GEU A;  3FHN A;  5FHP A;  2ZY9 A;  1JT6 A;  1A6I A;  4OD5 A;  3O8H A;  2PBX A;  3MNL A;  3HGY A;  3SDG A;  4X1E A;  2FD5 A;  2Y31 A;  5FKO A;  1JTY A;  3CJD A;  2R7V A;  3VW2 A;  2XPW A;  2RHA A;  4UDS A;  4ACI A;  3KKC A;  2GEN A;  1T33 A;  2R7R A;  3VOK A;  3K8P C;  3ON4 A;  3ZQH A;  5FKK A;  3ZQL A;  3NNR A;  3HTH A;  3QKX A;  2XPV A;  3O60 A;  3LHQ A;  2WGB A;  2IU5 A;  2GFN A;  3KNW A;  4M3B A;  4NN1 A;  3SFI A;  3DPJ A;  5IOY A;  1U9O A;  2ZOZ A;  3ZQI A;  5GPA A;  2X9D A;  2DG7 A;  2XGE A;  2R7U A;  3DEW A;  4U9L A;  2XGC A;  5F1J A;  2NP3 A;  1Z0X A;  2QKO A;  3IH3 A;  3NS4 A;  2EH3 A;  4B3A A;  3EGQ A;  5FMP A;  4NEL A;  2OER A;  3VOX A;  4W1U A;  3BCG A;  1JUS A;  1UI5 A;  3IH2 A;  2ZCN A;  4AC6 A;  3VVZ A;  2W53 A;  5FKM A;  3BTC A;  2IEK A;  2UXI A;  4GFK A;  3Q0V A;  2I10 A;  2Y30 A;  3CWR A;  2V57 A;  2VPR A;  2FJ1 A;  3LSJ A;  4GFL A;  3VW1 A;  2F07 A;  5CQG A;  1RPW A;  3BR1 A;  3DU6 A;  5GPC A;  2FX0 A;  5D18 A;  2X6O A;  2XGD A;  5HSZ A;  3IH4 A;  1VI0 A;  3HTI A;  3QQA A;  4JNN A;  5F0H A;  2FBQ A;  3NRG A;  3HE0 A;  3FRQ A;  5EFY A;  2B1E A;  4I76 A;  3VTI A;  3S5R A;  2WV1 A;  4AC0 A;  3G1O A;  1UI6 A;  4G12 A;  3CCY A;  2R7Q A;  4C2M A;  2XB5 A;  3WHB A;  2ZB9 A;  2A2F X;  1QPI A;  2G7S A;  2G3B A;  3VW0 A;  3KKD A;  3G7R A;  4D5F A;  2DTZ A;  3HTJ A;  3BTL A;  4JKZ A;  2YVE A;  2G0E A;  2NX4 A;  2HXO A;  2DG8 A;  3DU5 A;  2YVX A;  2ID3 A;  4V2G A;  1ZKG A;  5EZH A;  2OI8 A;  2ZCX A;  3BTI A;  3PAS A;  4KWA A;  4M3D A;  4B1R A;  1SGM A;  3VP5 A;  2R7W A;  3T6N A;  5J3L A;  3GZI A;  3ANP A;  5FKN A;  4HKU A;  2R7X A;  2HYT A;  4CGR A;  3BR2 A;  3LJL A;  3VVX A;  2QOP A;  4D5C A;  3ANG A;  3PM1 A;  3LWJ A;  3F0C A;  4JYK A;  2QTQ A;  3BJB A;  4ICH A;  4PXI A;  2REK A;  4M3F A;  4JL3 A;  3ZQF A;  4D7N A;  5IOZ A;  5FKL A;  3CRJ A;  4U9N A;  2RAE A;  3BR6 A;  3KYL A;  2D6Y A;  2R7O A;  2Q24 A;  5F04 A;  3RH2 A;  3RD3 A;  2XDN A;  5CXI A;  3NXC A;  3NI7 A;  3LSR A;  3IUV A;  3BR0 A;  3AQT A;  3NPI A;  2GUH A;  5J1R A;  3B6C A;  4MO7 A;  2R7S A;  3VUQ A;  1JUP A;  3EUP A;  3O8G A; 
#chains in the Genus database with same CATH homology
 2O7T A;  5F27 A;  3P9T A;  3AQS A;  3G1M A;  2OF7 A;  2XPU A;  1ZK8 A;  3ZQG A;  1Z77 A;  3VPR A;  4I6Z A;  3V6G A;  2PZ9 A;  4XK4 A;  2JK3 A;  2FQ4 A;  2WUI A;  5EZG A;  3DCF A;  4V2F A;  3VVY A;  3QPL A;  3BTJ A;  3CDL A;  5HBU A;  3FIW A;  2HXI A;  2UXU A;  3TP3 A;  3TP0 A;  5IPA A;  5J1U A;  5F08 A;  2NS7 A;  3HIM A;  4YZE A;  5CXG A;  2OPT A;  3BQY A;  2QIB A;  2HYJ A;  3C2B A;  3B6A A;  1QVT A;  2XRL A;  1RKW A;  2G7G A;  2Y2Z A;  3Q3S A;  5GP9 A;  3QPS A;  5K7H A;  2O7O A;  4DW6 A;  2QWT A;  5K7Z A;  2IAI A;  2NP5 A;  5F0C A;  1U9N A;  3Q0U A;  4W97 A;  2QCO A;  2VKE A;  3LOC A;  2TCT A;  5AQC A;  2VKV A;  3F1B A;  4D7M A;  5IP6 A;  1RKT A;  3HTA A;  2UXP A;  4M3E A;  3JSJ A;  3BQZ A;  3WHC A;  3BT9 A;  3FK6 A;  5K58 A;  3C07 A;  1BJZ A;  4ME9 A;  3BRU A;  5D19 A;  5D1R A;  3B81 A;  3Q0W A;  3V78 A;  5F0F A;  5DAJ A;  4AF5 A;  2ID6 A;  1JUM A;  2IBD A;  3ON2 A;  5H9T A;  4GCT A;  2NS8 A;  5EYR A;  1ORK A;  1T56 A;  5FGL A;  4AUX A;  1QVU A;  3HGG A;  2RAS A;  3MVP A;  4L62 A;  5J1Y A;  3G1L A;  2HQ5 A;  4GCL A;  5HAW A;  5C4Y A;  4M3G A;  3LSP A;  2HKU A;  3BHQ A;  3BNI A;  1JT0 A;  3COL A;  4MXM A;  5CW8 A;  4GCK A;  4ABZ A;  2JJ7 A;  3VIB A;  2YVH A;  3G56 A;  3BR3 A;  3KZ9 A;  2GBY A;  4MK6 A;  2UXO A;  2G7L A;  3BR5 A;  1JTX A;  5K7F A;  3E7Q A;  2ZOY A;  3PPB A;  2UXH A;  2ZCM A;  2TRT A;  3FK7 A;  3QBM A;  3GEU A;  5FHP A;  1JT6 A;  1A6I A;  3O8H A;  2PBX A;  3MNL A;  3HGY A;  3SDG A;  4X1E A;  2FD5 A;  2Y31 A;  5FKO A;  1JTY A;  3CJD A;  3VW2 A;  2XPW A;  2RHA A;  4UDS A;  4ACI A;  3KKC A;  2GEN A;  1T33 A;  3VOK A;  3ON4 A;  3ZQH A;  5FKK A;  3ZQL A;  3NNR A;  3HTH A;  3QKX A;  2XPV A;  3O60 A;  3LHQ A;  2WGB A;  2IU5 A;  2GFN A;  3KNW A;  4M3B A;  4NN1 A;  3SFI A;  3DPJ A;  5IOY A;  1U9O A;  2ZOZ A;  3ZQI A;  5GPA A;  2X9D A;  2DG7 A;  2XGE A;  3DEW A;  2XGC A;  5F1J A;  2NP3 A;  1Z0X A;  2QKO A;  3IH3 A;  2EH3 A;  4B3A A;  3EGQ A;  5FMP A;  4NEL A;  2OER A;  3VOX A;  4W1U A;  3BCG A;  1JUS A;  1UI5 A;  3IH2 A;  2ZCN A;  4AC6 A;  3VVZ A;  2W53 A;  5FKM A;  3BTC A;  2IEK A;  2UXI A;  4GFK A;  3Q0V A;  2I10 A;  2Y30 A;  3CWR A;  2V57 A;  2VPR A;  2FJ1 A;  3LSJ A;  4GFL A;  3VW1 A;  2F07 A;  1RPW A;  3BR1 A;  5GPC A;  2FX0 A;  5D18 A;  2X6O A;  2XGD A;  5HSZ A;  3IH4 A;  1VI0 A;  3HTI A;  3QQA A;  4JNN A;  5F0H A;  2FBQ A;  3NRG A;  3HE0 A;  3FRQ A;  5EFY A;  4I76 A;  3S5R A;  2WV1 A;  4AC0 A;  3G1O A;  1UI6 A;  4G12 A;  3CCY A;  2XB5 A;  3WHB A;  2ZB9 A;  1QPI A;  2G7S A;  2G3B A;  3VW0 A;  3KKD A;  3G7R A;  4D5F A;  2DTZ A;  3HTJ A;  3BTL A;  4JKZ A;  2YVE A;  2G0E A;  2NX4 A;  2HXO A;  2DG8 A;  2ID3 A;  4V2G A;  1ZKG A;  5EZH A;  2OI8 A;  2ZCX A;  3BTI A;  3PAS A;  4KWA A;  4M3D A;  4B1R A;  1SGM A;  3VP5 A;  3T6N A;  5J3L A;  3GZI A;  3ANP A;  5FKN A;  4HKU A;  2HYT A;  4CGR A;  3BR2 A;  3LJL A;  3VVX A;  2QOP A;  4D5C A;  3ANG A;  3PM1 A;  3LWJ A;  3F0C A;  4JYK A;  2QTQ A;  3BJB A;  4ICH A;  4PXI A;  2REK A;  4M3F A;  4JL3 A;  3ZQF A;  4D7N A;  5IOZ A;  5FKL A;  3CRJ A;  2RAE A;  3BR6 A;  2D6Y A;  2Q24 A;  5F04 A;  3RH2 A;  3RD3 A;  2XDN A;  5CXI A;  3NXC A;  3NI7 A;  3LSR A;  3IUV A;  3BR0 A;  3AQT A;  3NPI A;  2GUH A;  5J1R A;  3B6C A;  4MO7 A;  3VUQ A;  1JUP A;  3EUP A;  3O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...