2HKUA

Structural genomics, the crystal structure of a putative transcriptional regulator from rhodococcus sp. rha1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
191
structure length
191
Chain Sequence
b'QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A putative transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription regulator
total genus 79
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16914 TetR_C_12 Bacterial transcriptional repressor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hkuA00
3MNLA 3HTIA 5CXGA 2HXIA 3NI7A 5FKOA 4AUXA 5HSZA 2OERA 3O8HA 2UXOA 2XB5A 1JUMA 3FK6A 3BTIA 2REKA 3BHQA 1VI0A 2FQ4A 3KNWA 2UXHA 4V2GA 2Y31A 2YVHA 3FRQA 3F1BA 5IP6A 3CJDA 2GUHA 3DCFA 3CWRA 3BQZA 3AQSA 3BR1A 3LSJA 2VKVA 5EFYA 3GEUA 3MVPA 1JUPA 4AF5A 2QCOA 2O7OA 2NX4A 1UI6A 5FMPA 3VW2A 3ZQHA 2JJ7A 2VKEA 2XGDA 5AQCA 3ZQIA 2OI8A 3G1OA 3NPIA 2RHAA 5C4YA 5F0CA 3B6AA 2PBXA 5F0FA 1RPWA 2NS8A 4M3FA 5D18A 3B81A 4D5FA 3IH4A 3P9TA 4B3AA 3KKDA 3FIWA 2EH3A 1Z77A 2HQ5A 4KWAA 4M3BA 5D19A 3PASA 3BQYA 3RH2A 3V78A 5J1UA 2JK3A 2QOPA 2FJ1A 1ZKGA 5FKKA 2W53A 5HBUA 3CDLA 3C07A 2GFNA 3VP5A 4L62A 3VVXA 2Y2ZA 2GENA 4D7MA 3LOCA 2UXIA 5IPAA 2IAIA 3ZQGA 5K7FA 1SGMA 3HGGA 2QTQA 4GFKA 1ORKA 3BR0A 4JL3A 5F08A 5EZGA 4DW6A 4MK6A 2TRTA 3CCYA 5HAWA 2X6OA 2DG7A 4ABZA 3BJBA 3ANGA 3NNRA 3NRGA 2VPRA 5H9TA 3BR2A 2ZCNA 2NP3A 2QKOA 3BR3A 3COLA 3VIBA 3T6NA 2IBDA 4HKUA 4I6ZA 2ZOYA 2HXOA 4UDSA 3AQTA 3QPSA 4D5CA 3EGQA 3VVZA 3BTLA 3BNIA 3E7QA 5IOYA 3CRJA 3WHBA 4X1EA 1ZK8A 3HIMA 4D7NA 1T33A 2Y30A 2Q24A 2XPUA 2HYTA 3TP3A 3F0CA 2ID6A 3LWJA 2TCTA 3IUVA 3HTJA 5FKMA 3QBMA 3VW1A 5GPCA 3HTHA 2GBYA 4XK4A 5CW8A 1U9NA 3HE0A 5FKNA 3ON2A 3HGYA 2XPVA 4JKZA 3O8GA 2XGCA 3HTAA 5J3LA 2FBQA 4JYKA 3GZIA 3ON4A 3EUPA 5IOZA 2RASA 3ZQFA 3BTJA 2NP5A 2X9DA 1A6IA 2HKUA 1JT6A 3O60A 3C2BA 4MO7A 4NN1A 2ZB9A 3VOXA 2DG8A 1T56A 5GP9A 3PM1A 3Q0VA 1QPIA 3Q0WA 5FKLA 1U9OA 3RD3A 3BTCA 1JT0A 4G12A 3DEWA 3KKCA 2O7TA 1Z0XA 3VUQA 5FGLA 4JNNA 4GCLA 3G7RA 4ACIA 2XDNA 3BCGA 4B1RA 2DTZA 2ZCXA 5D1RA 2G7SA 2OF7A 3NXCA 3BR6A 3ZQLA 2WGBA 2XGEA 3G56A 3G1MA 3QKXA 4CGRA 3VW0A 5K7ZA 5EYRA 4GFLA 3FK7A 2QIBA 2G0EA 5J1YA 4GCKA 4M3DA 4I76A 3VOKA 3BR5A 2OPTA 5K7HA 2ID3A 2G7GA 3IH2A 4MXMA 3WHCA 5CXIA 2G3BA 2I10A 5J1RA 3LHQA 4NELA 3QPLA 1UI5A 4AC0A 3KZ9A 5GPAA 5F04A 2NS7A 1QVTA 4YZEA 3JSJA 3SFIA 3TP0A 2HYJA 2QWTA 1QVUA 2D6YA 4W97A 4ME9A 1JTYA 2IU5A 3V6GA 3IH3A 3BRUA 2IEKA 3Q3SA 3S5RA 3LSPA 5EZHA 1JTXA 3BT9A 2FD5A 3DPJA 3SDGA 2ZOZA 2ZCMA 3Q0UA 2PZ9A 4M3EA 2V57A 1JUSA 2UXUA 5F0HA 1RKTA 2XPWA 2XRLA 2UXPA 2FX0A 3ANPA 2RAEA 5F27A 4AC6A 5DAJA 4M3GA 5F1JA 4GCTA 2YVEA 4W1UA 2WV1A 3QQAA 3B6CA 5FHPA 1BJZA 5K58A 4V2FA 3VPRA 4ICHA 4PXIA 3LJLA 1RKWA 2F07A 2WUIA 3VVYA 3G1LA 3LSRA 2G7LA 3PPBA
chains in the Genus database with same CATH superfamily
3MNLA 3SWHA 3HTIA 4IRVA 5CXGA 2HXIA 3NI7A 5FKOA 4AUXA 5HSZA 2OERA 2B3WA 3O8HA 4C2MA 2UXOA 2XB5A 1JUMA 3FK6A 3BTIA 2REKA 3DU6A 3BHQA 1VI0A 2FQ4A 3KNWA 2UXHA 4V2GA 2Y31A 2YVHA 3FRQA 3F1BA 5IP6A 3CJDA 2GUHA 3DCFA 3CWRA 4OD5A 3BQZA 3AQSA 3BR1A 3LSJA 2VKVA 5EFYA 3GEUA 3MVPA 1JUPA 4AF5A 2QCOA 2O7OA 2NX4A 1UI6A 5FMPA 3VW2A 3ZQHA 2JJ7A 2VKEA 2XGDA 5AQCA 3ZQIA 2OI8A 3G1OA 3NPIA 2RHAA 5C4YA 5F0CA 3B6AA 2PBXA 5F0FA 1RPWA 2NS8A 4M3FA 5D18A 3B81A 4D5FA 3IH4A 2R7TA 3P9TA 4B3AA 2R7XA 3KKDA 3FIWA 2EH3A 1Z77A 2HQ5A 4KWAA 4M3BA 2R7VA 3FHNA 5D19A 3PASA 3BQYA 3RH2A 3V78A 5J1UA 2JK3A 2QOPA 2A2FX 2R7SA 2FJ1A 1ZKGA 3DU5A 5FKKA 4U9NA 2W53A 5HBUA 3CDLA 3C07A 2GFNA 3VP5A 4L62A 3VVXA 2Y2ZA 2GENA 4D7MA 3LOCA 2UXIA 5IPAA 2IAIA 3ZQGA 5K7FA 1SGMA 3HGGA 2QTQA 4GFKA 1ORKA 2B1EA 3BR0A 4JL3A 5F08A 5EZGA 4DW6A 4MK6A 2TRTA 3CCYA 5HAWA 2X6OA 2DG7A 4ABZA 3BJBA 3ANGA 3NNRA 3NRGA 2VPRA 5H9TA 3BR2A 2ZCNA 2NP3A 2QKOA 3BR3A 3COLA 3VIBA 3T6NA 2IBDA 4HKUA 4I6ZA 2ZOYA 2HXOA 4UDSA 2FJI1 3AQTA 3QPSA 4D5CA 3EGQA 3VVZA 2YVXA 3BTLA 3BNIA 3E7QA 5IOYA 3CRJA 3WHBA 4X1EA 1ZK8A 3HIMA 4D7NA 2R7RA 1T33A 2Y30A 2Q24A 2XPUA 2HYTA 2R7WA 3TP3A 3F0CA 2ID6A 3LWJA 2TCTA 3IUVA 3HTJA 5FKMA 3QBMA 3VW1A 5GPCA 3HTHA 2GBYA 4XK4A 5CW8A 1U9NA 3HE0A 5FKNA 3ON2A 3HGYA 2XPVA 2R7UA 4JKZA 3O8GA 2XGCA 3HTAA 5J3LA 2FBQA 4JYKA 3GZIA 3ON4A 3EUPA 5IOZA 2RASA 3ZQFA 3BTJA 2NP5A 2X9DA 1A6IA 2HKUA 1JT6A 3O60A 3C2BA 4MO7A 4NN1A 2ZB9A 3VOXA 2DG8A 1T56A 5GP9A 3PM1A 3Q0VA 1QPIA 3Q0WA 5FKLA 1U9OA 3RD3A 3BTCA 4U9LA 1JT0A 4G12A 3DEWA 3KKCA 2O7TA 1Z0XA 3VUQA 5FGLA 4JNNA 4GCLA 3G7RA 4ACIA 2XDNA 3BCGA 4B1RA 2DTZA 2ZCXA 5D1RA 5CQGA 2G7SA 2OF7A 3NXCA 3BR6A 3ZQLA 2WGBA 2XGEA 3G56A 3NS4A 3G1MA 3QKXA 4CGRA 3VW0A 5K7ZA 5EYRA 4GFLA 3FK7A 2QIBA 2G0EA 5J1YA 4GCKA 4M3DA 4I76A 3VOKA 3BR5A 2ZY9A 2OPTA 5K7HA 2ID3A 2G7GA 3IH2A 4MXMA 3WHCA 5CXIA 2G3BA 2I10A 5J1RA 3LHQA 4NELA 3QPLA 1UI5A 4WIBA 4AC0A 3KZ9A 5GPAA 5F04A 2NS7A 2PFVA 3KYLA 1QVTA 4YZEA 3JSJA 3SFIA 3TP0A 2HYJA 2QWTA 1QVUA 2D6YA 4W97A 4ME9A 1JTYA 2IU5A 3V6GA 3IH3A 3BRUA 2IEKA 3Q3SA 3S5RA 3LSPA 5EZHA 1JTXA 3BT9A 2FD5A 3DPJA 3SDGA 2ZOZA 2ZCMA 3Q0UA 2PZ9A 4DVYP 4M3EA 2V57A 1JUSA 2UXUA 5F0HA 2R7QA 1RKTA 4OD4A 2XPWA 2XRLA 2UXPA 3K8PC 2FX0A 3VTIA 3ANPA 2RAEA 5F27A 4AC6A 5DAJA 4M3GA 5F1JA 4GCTA 2YVEA 4W1UA 2WV1A 3QQAA 3B6CA 5FHPA 1BJZA 5K58A 4V2FA 3VPRA 4ICHA 4PXIA 3LJLA 1RKWA 2F07A 2WUIA 2R7OA 3G1LA 3VVYA 3LSRA 2G7LA 3PPBA
chains in the Genus database with same CATH topology
3MNLA 3HTIA 5CXGA 2HXIA 3NI7A 5FKOA 4AUXA 5HSZA 2OERA 3O8HA 2UXOA 2XB5A 1JUMA 3FK6A 3BTIA 2REKA 3BHQA 1VI0A 2FQ4A 3KNWA 2UXHA 4V2GA 2Y31A 2YVHA 3FRQA 3F1BA 5IP6A 3CJDA 2GUHA 3DCFA 3CWRA 3BQZA 3AQSA 3BR1A 3LSJA 2VKVA 5EFYA 3GEUA 3MVPA 1JUPA 4AF5A 2QCOA 2O7OA 2NX4A 1UI6A 5FMPA 3VW2A 3ZQHA 2JJ7A 2VKEA 2XGDA 5AQCA 3ZQIA 2OI8A 3G1OA 3NPIA 2RHAA 5C4YA 5F0CA 3B6AA 2PBXA 5F0FA 1RPWA 2NS8A 4M3FA 5D18A 3B81A 4D5FA 3IH4A 3P9TA 4B3AA 3KKDA 3FIWA 2EH3A 1Z77A 2HQ5A 4KWAA 4M3BA 5D19A 3PASA 3BQYA 3RH2A 3V78A 5J1UA 2JK3A 2QOPA 2FJ1A 1ZKGA 5FKKA 2W53A 5HBUA 3CDLA 3C07A 2GFNA 3VP5A 4L62A 3VVXA 2Y2ZA 2GENA 4D7MA 3LOCA 2UXIA 5IPAA 2IAIA 3ZQGA 5K7FA 1SGMA 3HGGA 2QTQA 4GFKA 1ORKA 3BR0A 4JL3A 5F08A 5EZGA 4DW6A 4MK6A 2TRTA 3CCYA 5HAWA 2X6OA 2DG7A 4ABZA 3BJBA 3ANGA 3NNRA 3NRGA 2VPRA 5H9TA 3BR2A 2ZCNA 2NP3A 2QKOA 3BR3A 3COLA 3VIBA 3T6NA 2IBDA 4HKUA 4I6ZA 2ZOYA 2HXOA 4UDSA 3AQTA 3QPSA 4D5CA 3EGQA 3VVZA 3BTLA 3BNIA 3E7QA 5IOYA 3CRJA 3WHBA 4X1EA 1ZK8A 3HIMA 4D7NA 1T33A 2Y30A 2Q24A 2XPUA 2HYTA 3TP3A 3F0CA 2ID6A 3LWJA 2TCTA 3IUVA 3HTJA 5FKMA 3QBMA 3VW1A 5GPCA 3HTHA 2GBYA 4XK4A 5CW8A 1U9NA 3HE0A 5FKNA 3ON2A 3HGYA 2XPVA 4JKZA 3O8GA 2XGCA 3HTAA 5J3LA 2FBQA 4JYKA 3GZIA 3ON4A 3EUPA 5IOZA 2RASA 3ZQFA 3BTJA 2NP5A 2X9DA 1A6IA 2HKUA 1JT6A 3O60A 3C2BA 4MO7A 4NN1A 2ZB9A 3VOXA 2DG8A 1T56A 5GP9A 3PM1A 3Q0VA 1QPIA 3Q0WA 5FKLA 1U9OA 3RD3A 3BTCA 1JT0A 4G12A 3DEWA 3KKCA 2O7TA 1Z0XA 3VUQA 5FGLA 4JNNA 4GCLA 3G7RA 4ACIA 2XDNA 3BCGA 4B1RA 2DTZA 2ZCXA 5D1RA 2G7SA 2OF7A 3NXCA 3BR6A 3ZQLA 2WGBA 2XGEA 3G56A 3G1MA 3QKXA 4CGRA 3VW0A 5K7ZA 5EYRA 4GFLA 3FK7A 2QIBA 2G0EA 5J1YA 4GCKA 4M3DA 4I76A 3VOKA 3BR5A 2OPTA 5K7HA 2ID3A 2G7GA 3IH2A 4MXMA 3WHCA 5CXIA 2G3BA 2I10A 5J1RA 3LHQA 4NELA 3QPLA 1UI5A 4AC0A 3KZ9A 5GPAA 5F04A 2NS7A 1QVTA 4YZEA 3JSJA 3SFIA 3TP0A 2HYJA 2QWTA 1QVUA 2D6YA 4W97A 4ME9A 1JTYA 2IU5A 3V6GA 3IH3A 3BRUA 2IEKA 3Q3SA 3S5RA 3LSPA 5EZHA 1JTXA 3BT9A 2FD5A 3DPJA 3SDGA 2ZOZA 2ZCMA 3Q0UA 2PZ9A 4M3EA 2V57A 1JUSA 2UXUA 5F0HA 1RKTA 2XPWA 2XRLA 2UXPA 2FX0A 3ANPA 2RAEA 5F27A 4AC6A 5DAJA 4M3GA 5F1JA 4GCTA 2YVEA 4W1UA 2WV1A 3QQAA 3B6CA 5FHPA 1BJZA 5K58A 4V2FA 3VPRA 4ICHA 4PXIA 3LJLA 1RKWA 2F07A 2WUIA 3VVYA 3G1LA 3LSRA 2G7LA 3PPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNL A;  3HTI A;  5CXG A;  2HXI A;  3NI7 A;  5FKO A;  4AUX A;  5HSZ A;  2OER A;  3O8H A;  2UXO A;  2XB5 A;  1JUM A;  3FK6 A;  3BTI A;  2REK A;  3BHQ A;  1VI0 A;  2FQ4 A;  3KNW A;  2UXH A;  4V2G A;  2Y31 A;  2YVH A;  3FRQ A;  3F1B A;  5IP6 A;  3CJD A;  2GUH A;  3DCF A;  3CWR A;  3BQZ A;  3AQS A;  3BR1 A;  3LSJ A;  2VKV A;  5EFY A;  3GEU A;  3MVP A;  1JUP A;  4AF5 A;  2QCO A;  2O7O A;  2NX4 A;  1UI6 A;  5FMP A;  3VW2 A;  3ZQH A;  2JJ7 A;  2VKE A;  2XGD A;  5AQC A;  3ZQI A;  2OI8 A;  3G1O A;  3NPI A;  2RHA A;  5C4Y A;  5F0C A;  3B6A A;  2PBX A;  5F0F A;  1RPW A;  2NS8 A;  4M3F A;  5D18 A;  3B81 A;  4D5F A;  3IH4 A;  3P9T A;  4B3A A;  3KKD A;  3FIW A;  2EH3 A;  1Z77 A;  2HQ5 A;  4KWA A;  4M3B A;  5D19 A;  3PAS A;  3BQY A;  3RH2 A;  3V78 A;  5J1U A;  2JK3 A;  2QOP A;  2FJ1 A;  1ZKG A;  5FKK A;  2W53 A;  5HBU A;  3CDL A;  3C07 A;  2GFN A;  3VP5 A;  4L62 A;  3VVX A;  2Y2Z A;  2GEN A;  4D7M A;  3LOC A;  2UXI A;  5IPA A;  2IAI A;  3ZQG A;  5K7F A;  1SGM A;  3HGG A;  2QTQ A;  4GFK A;  1ORK A;  3BR0 A;  4JL3 A;  5F08 A;  5EZG A;  4DW6 A;  4MK6 A;  2TRT A;  3CCY A;  5HAW A;  2X6O A;  2DG7 A;  4ABZ A;  3BJB A;  3ANG A;  3NNR A;  3NRG A;  2VPR A;  5H9T A;  3BR2 A;  2ZCN A;  2NP3 A;  2QKO A;  3BR3 A;  3COL A;  3VIB A;  3T6N A;  2IBD A;  4HKU A;  4I6Z A;  2ZOY A;  2HXO A;  4UDS A;  3AQT A;  3QPS A;  4D5C A;  3EGQ A;  3VVZ A;  3BTL A;  3BNI A;  3E7Q A;  5IOY A;  3CRJ A;  3WHB A;  4X1E A;  1ZK8 A;  3HIM A;  4D7N A;  1T33 A;  2Y30 A;  2Q24 A;  2XPU A;  2HYT A;  3TP3 A;  3F0C A;  2ID6 A;  3LWJ A;  2TCT A;  3IUV A;  3HTJ A;  5FKM A;  3QBM A;  3VW1 A;  5GPC A;  3HTH A;  2GBY A;  4XK4 A;  5CW8 A;  1U9N A;  3HE0 A;  5FKN A;  3ON2 A;  3HGY A;  2XPV A;  4JKZ A;  3O8G A;  2XGC A;  3HTA A;  5J3L A;  2FBQ A;  4JYK A;  3GZI A;  3ON4 A;  3EUP A;  5IOZ A;  2RAS A;  3ZQF A;  3BTJ A;  2NP5 A;  2X9D A;  1A6I A;  2HKU A;  1JT6 A;  3O60 A;  3C2B A;  4MO7 A;  4NN1 A;  2ZB9 A;  3VOX A;  2DG8 A;  1T56 A;  5GP9 A;  3PM1 A;  3Q0V A;  1QPI A;  3Q0W A;  5FKL A;  1U9O A;  3RD3 A;  3BTC A;  1JT0 A;  4G12 A;  3DEW A;  3KKC A;  2O7T A;  1Z0X A;  3VUQ A;  5FGL A;  4JNN A;  4GCL A;  3G7R A;  4ACI A;  2XDN A;  3BCG A;  4B1R A;  2DTZ A;  2ZCX A;  5D1R A;  2G7S A;  2OF7 A;  3NXC A;  3BR6 A;  3ZQL A;  2WGB A;  2XGE A;  3G56 A;  3G1M A;  3QKX A;  4CGR A;  3VW0 A;  5K7Z A;  5EYR A;  4GFL A;  3FK7 A;  2QIB A;  2G0E A;  5J1Y A;  4GCK A;  4M3D A;  4I76 A;  3VOK A;  3BR5 A;  2OPT A;  5K7H A;  2ID3 A;  2G7G A;  3IH2 A;  4MXM A;  3WHC A;  5CXI A;  2G3B A;  2I10 A;  5J1R A;  3LHQ A;  4NEL A;  3QPL A;  1UI5 A;  4AC0 A;  3KZ9 A;  5GPA A;  5F04 A;  2NS7 A;  1QVT A;  4YZE A;  3JSJ A;  3SFI A;  3TP0 A;  2HYJ A;  2QWT A;  1QVU A;  2D6Y A;  4W97 A;  4ME9 A;  1JTY A;  2IU5 A;  3V6G A;  3IH3 A;  3BRU A;  2IEK A;  3Q3S A;  3S5R A;  3LSP A;  5EZH A;  1JTX A;  3BT9 A;  2FD5 A;  3DPJ A;  3SDG A;  2ZOZ A;  2ZCM A;  3Q0U A;  2PZ9 A;  4M3E A;  2V57 A;  1JUS A;  2UXU A;  5F0H A;  1RKT A;  2XPW A;  2XRL A;  2UXP A;  2FX0 A;  3ANP A;  2RAE A;  5F27 A;  4AC6 A;  5DAJ A;  4M3G A;  5F1J A;  4GCT A;  2YVE A;  4W1U A;  2WV1 A;  3QQA A;  3B6C A;  5FHP A;  1BJZ A;  5K58 A;  4V2F A;  3VPR A;  4ICH A;  4PXI A;  3LJL A;  1RKW A;  2F07 A;  2WUI A;  3VVY A;  3G1L A;  3LSR A;  2G7L A;  3PPB A; 
#chains in the Genus database with same CATH topology
 3MNL A;  3SWH A;  3HTI A;  4IRV A;  5CXG A;  2HXI A;  3NI7 A;  5FKO A;  4AUX A;  5HSZ A;  2OER A;  2B3W A;  3O8H A;  4C2M A;  2UXO A;  2XB5 A;  1JUM A;  3FK6 A;  3BTI A;  2REK A;  3DU6 A;  3BHQ A;  1VI0 A;  2FQ4 A;  3KNW A;  2UXH A;  4V2G A;  2Y31 A;  2YVH A;  3FRQ A;  3F1B A;  5IP6 A;  3CJD A;  2GUH A;  3DCF A;  3CWR A;  4OD5 A;  3BQZ A;  3AQS A;  3BR1 A;  3LSJ A;  2VKV A;  5EFY A;  3GEU A;  3MVP A;  1JUP A;  4AF5 A;  2QCO A;  2O7O A;  2NX4 A;  1UI6 A;  5FMP A;  3VW2 A;  3ZQH A;  2JJ7 A;  2VKE A;  2XGD A;  5AQC A;  3ZQI A;  2OI8 A;  3G1O A;  3NPI A;  2RHA A;  5C4Y A;  5F0C A;  3B6A A;  2PBX A;  5F0F A;  1RPW A;  2NS8 A;  4M3F A;  5D18 A;  3B81 A;  4D5F A;  3IH4 A;  2R7T A;  3P9T A;  4B3A A;  2R7X A;  3KKD A;  3FIW A;  2EH3 A;  1Z77 A;  2HQ5 A;  4KWA A;  4M3B A;  2R7V A;  3FHN A;  5D19 A;  3PAS A;  3BQY A;  3RH2 A;  3V78 A;  5J1U A;  2JK3 A;  2QOP A;  2A2F X;  2R7S A;  2FJ1 A;  1ZKG A;  3DU5 A;  5FKK A;  4U9N A;  2W53 A;  5HBU A;  3CDL A;  3C07 A;  2GFN A;  3VP5 A;  4L62 A;  3VVX A;  2Y2Z A;  2GEN A;  4D7M A;  3LOC A;  2UXI A;  5IPA A;  2IAI A;  3ZQG A;  5K7F A;  1SGM A;  3HGG A;  2QTQ A;  4GFK A;  1ORK A;  2B1E A;  3BR0 A;  4JL3 A;  5F08 A;  5EZG A;  4DW6 A;  4MK6 A;  2TRT A;  3CCY A;  5HAW A;  2X6O A;  2DG7 A;  4ABZ A;  3BJB A;  3ANG A;  3NNR A;  3NRG A;  2VPR A;  5H9T A;  3BR2 A;  2ZCN A;  2NP3 A;  2QKO A;  3BR3 A;  3COL A;  3VIB A;  3T6N A;  2IBD A;  4HKU A;  4I6Z A;  2ZOY A;  2HXO A;  4UDS A;  2FJI 1;  3AQT A;  3QPS A;  4D5C A;  3EGQ A;  3VVZ A;  2YVX A;  3BTL A;  3BNI A;  3E7Q A;  5IOY A;  3CRJ A;  3WHB A;  4X1E A;  1ZK8 A;  3HIM A;  4D7N A;  2R7R A;  1T33 A;  2Y30 A;  2Q24 A;  2XPU A;  2HYT A;  2R7W A;  3TP3 A;  3F0C A;  2ID6 A;  3LWJ A;  2TCT A;  3IUV A;  3HTJ A;  5FKM A;  3QBM A;  3VW1 A;  5GPC A;  3HTH A;  2GBY A;  4XK4 A;  5CW8 A;  1U9N A;  3HE0 A;  5FKN A;  3ON2 A;  3HGY A;  2XPV A;  2R7U A;  4JKZ A;  3O8G A;  2XGC A;  3HTA A;  5J3L A;  2FBQ A;  4JYK A;  3GZI A;  3ON4 A;  3EUP A;  5IOZ A;  2RAS A;  3ZQF A;  3BTJ A;  2NP5 A;  2X9D A;  1A6I A;  2HKU A;  1JT6 A;  3O60 A;  3C2B A;  4MO7 A;  4NN1 A;  2ZB9 A;  3VOX A;  2DG8 A;  1T56 A;  5GP9 A;  3PM1 A;  3Q0V A;  1QPI A;  3Q0W A;  5FKL A;  1U9O A;  3RD3 A;  3BTC A;  4U9L A;  1JT0 A;  4G12 A;  3DEW A;  3KKC A;  2O7T A;  1Z0X A;  3VUQ A;  5FGL A;  4JNN A;  4GCL A;  3G7R A;  4ACI A;  2XDN A;  3BCG A;  4B1R A;  2DTZ A;  2ZCX A;  5D1R A;  5CQG A;  2G7S A;  2OF7 A;  3NXC A;  3BR6 A;  3ZQL A;  2WGB A;  2XGE A;  3G56 A;  3NS4 A;  3G1M A;  3QKX A;  4CGR A;  3VW0 A;  5K7Z A;  5EYR A;  4GFL A;  3FK7 A;  2QIB A;  2G0E A;  5J1Y A;  4GCK A;  4M3D A;  4I76 A;  3VOK A;  3BR5 A;  2ZY9 A;  2OPT A;  5K7H A;  2ID3 A;  2G7G A;  3IH2 A;  4MXM A;  3WHC A;  5CXI A;  2G3B A;  2I10 A;  5J1R A;  3LHQ A;  4NEL A;  3QPL A;  1UI5 A;  4WIB A;  4AC0 A;  3KZ9 A;  5GPA A;  5F04 A;  2NS7 A;  2PFV A;  3KYL A;  1QVT A;  4YZE A;  3JSJ A;  3SFI A;  3TP0 A;  2HYJ A;  2QWT A;  1QVU A;  2D6Y A;  4W97 A;  4ME9 A;  1JTY A;  2IU5 A;  3V6G A;  3IH3 A;  3BRU A;  2IEK A;  3Q3S A;  3S5R A;  3LSP A;  5EZH A;  1JTX A;  3BT9 A;  2FD5 A;  3DPJ A;  3SDG A;  2ZOZ A;  2ZCM A;  3Q0U A;  2PZ9 A;  4DVY P;  4M3E A;  2V57 A;  1JUS A;  2UXU A;  5F0H A;  2R7Q A;  1RKT A;  4OD4 A;  2XPW A;  2XRL A;  2UXP A;  3K8P C;  2FX0 A;  3VTI A;  3ANP A;  2RAE A;  5F27 A;  4AC6 A;  5DAJ A;  4M3G A;  5F1J A;  4GCT A;  2YVE A;  4W1U A;  2WV1 A;  3QQA A;  3B6C A;  5FHP A;  1BJZ A;  5K58 A;  4V2F A;  3VPR A;  4ICH A;  4PXI A;  3LJL A;  1RKW A;  2F07 A;  2WUI A;  2R7O A;  3G1L A;  3VVY A;  3LSR A;  2G7L A;  3PPB A; 
#chains in the Genus database with same CATH homology
 3MNL A;  3HTI A;  5CXG A;  2HXI A;  3NI7 A;  5FKO A;  4AUX A;  5HSZ A;  2OER A;  3O8H A;  2UXO A;  2XB5 A;  1JUM A;  3FK6 A;  3BTI A;  2REK A;  3BHQ A;  1VI0 A;  2FQ4 A;  3KNW A;  2UXH A;  4V2G A;  2Y31 A;  2YVH A;  3FRQ A;  3F1B A;  5IP6 A;  3CJD A;  2GUH A;  3DCF A;  3CWR A;  3BQZ A;  3AQS A;  3BR1 A;  3LSJ A;  2VKV A;  5EFY A;  3GEU A;  3MVP A;  1JUP A;  4AF5 A;  2QCO A;  2O7O A;  2NX4 A;  1UI6 A;  5FMP A;  3VW2 A;  3ZQH A;  2JJ7 A;  2VKE A;  2XGD A;  5AQC A;  3ZQI A;  2OI8 A;  3G1O A;  3NPI A;  2RHA A;  5C4Y A;  5F0C A;  3B6A A;  2PBX A;  5F0F A;  1RPW A;  2NS8 A;  4M3F A;  5D18 A;  3B81 A;  4D5F A;  3IH4 A;  3P9T A;  4B3A A;  3KKD A;  3FIW A;  2EH3 A;  1Z77 A;  2HQ5 A;  4KWA A;  4M3B A;  5D19 A;  3PAS A;  3BQY A;  3RH2 A;  3V78 A;  5J1U A;  2JK3 A;  2QOP A;  2FJ1 A;  1ZKG A;  5FKK A;  2W53 A;  5HBU A;  3CDL A;  3C07 A;  2GFN A;  3VP5 A;  4L62 A;  3VVX A;  2Y2Z A;  2GEN A;  4D7M A;  3LOC A;  2UXI A;  5IPA A;  2IAI A;  3ZQG A;  5K7F A;  1SGM A;  3HGG A;  2QTQ A;  4GFK A;  1ORK A;  3BR0 A;  4JL3 A;  5F08 A;  5EZG A;  4DW6 A;  4MK6 A;  2TRT A;  3CCY A;  5HAW A;  2X6O A;  2DG7 A;  4ABZ A;  3BJB A;  3ANG A;  3NNR A;  3NRG A;  2VPR A;  5H9T A;  3BR2 A;  2ZCN A;  2NP3 A;  2QKO A;  3BR3 A;  3COL A;  3VIB A;  3T6N A;  2IBD A;  4HKU A;  4I6Z A;  2ZOY A;  2HXO A;  4UDS A;  3AQT A;  3QPS A;  4D5C A;  3EGQ A;  3VVZ A;  3BTL A;  3BNI A;  3E7Q A;  5IOY A;  3CRJ A;  3WHB A;  4X1E A;  1ZK8 A;  3HIM A;  4D7N A;  1T33 A;  2Y30 A;  2Q24 A;  2XPU A;  2HYT A;  3TP3 A;  3F0C A;  2ID6 A;  3LWJ A;  2TCT A;  3IUV A;  3HTJ A;  5FKM A;  3QBM A;  3VW1 A;  5GPC A;  3HTH A;  2GBY A;  4XK4 A;  5CW8 A;  1U9N A;  3HE0 A;  5FKN A;  3ON2 A;  3HGY A;  2XPV A;  4JKZ A;  3O8G A;  2XGC A;  3HTA A;  5J3L A;  2FBQ A;  4JYK A;  3GZI A;  3ON4 A;  3EUP A;  5IOZ A;  2RAS A;  3ZQF A;  3BTJ A;  2NP5 A;  2X9D A;  1A6I A;  2HKU A;  1JT6 A;  3O60 A;  3C2B A;  4MO7 A;  4NN1 A;  2ZB9 A;  3VOX A;  2DG8 A;  1T56 A;  5GP9 A;  3PM1 A;  3Q0V A;  1QPI A;  3Q0W A;  5FKL A;  1U9O A;  3RD3 A;  3BTC A;  1JT0 A;  4G12 A;  3DEW A;  3KKC A;  2O7T A;  1Z0X A;  3VUQ A;  5FGL A;  4JNN A;  4GCL A;  3G7R A;  4ACI A;  2XDN A;  3BCG A;  4B1R A;  2DTZ A;  2ZCX A;  5D1R A;  2G7S A;  2OF7 A;  3NXC A;  3BR6 A;  3ZQL A;  2WGB A;  2XGE A;  3G56 A;  3G1M A;  3QKX A;  4CGR A;  3VW0 A;  5K7Z A;  5EYR A;  4GFL A;  3FK7 A;  2QIB A;  2G0E A;  5J1Y A;  4GCK A;  4M3D A;  4I76 A;  3VOK A;  3BR5 A;  2OPT A;  5K7H A;  2ID3 A;  2G7G A;  3IH2 A;  4MXM A;  3WHC A;  5CXI A;  2G3B A;  2I10 A;  5J1R A;  3LHQ A;  4NEL A;  3QPL A;  1UI5 A;  4AC0 A;  3KZ9 A;  5GPA A;  5F04 A;  2NS7 A;  1QVT A;  4YZE A;  3JSJ A;  3SFI A;  3TP0 A;  2HYJ A;  2QWT A;  1QVU A;  2D6Y A;  4W97 A;  4ME9 A;  1JTY A;  2IU5 A;  3V6G A;  3IH3 A;  3BRU A;  2IEK A;  3Q3S A;  3S5R A;  3LSP A;  5EZH A;  1JTX A;  3BT9 A;  2FD5 A;  3DPJ A;  3SDG A;  2ZOZ A;  2ZCM A;  3Q0U A;  2PZ9 A;  4M3E A;  2V57 A;  1JUS A;  2UXU A;  5F0H A;  1RKT A;  2XPW A;  2XRL A;  2UXP A;  2FX0 A;  3ANP A;  2RAE A;  5F27 A;  4AC6 A;  5DAJ A;  4M3G A;  5F1J A;  4GCT A;  2YVE A;  4W1U A;  2WV1 A;  3QQA A;  3B6C A;  5FHP A;  1BJZ A;  5K58 A;  4V2F A;  3VPR A;  4ICH A;  4PXI A;  3LJL A;  1RKW A;  2F07 A;  2WUI A;  3VVY A;  3G1L A;  3LSR A;  2G7L A;  3PPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...