2HKUA

Structural genomics, the crystal structure of a putative transcriptional regulator from rhodococcus sp. rha1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
191
structure length
191
Chain Sequence
QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription regulator
molecule keywords A putative transcriptional regulator
total genus 79
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16914 TetR_C_12 Bacterial transcriptional repressor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hkuA00
1VI0A 3Q3SA 2QOPA 3LWJA 2Y2ZA 3VP5A 2ZCMA 4M3GA 3BTLA 3VW1A 2XDNA 2QIBA 3BR0A 5FKMA 5F1JA 3BR6A 3IH4A 4UDSA 3BCGA 2UXPA 3VOKA 2XGEA 2FJ1A 4B3AA 2FBQA 2F07A 3KKCA 5EZHA 3CJDA 5AQCA 3NRGA 2HKUA 5F08A 1QVUA 5FHPA 3JSJA 4JNNA 3B6AA 5D1RA 3QPSA 5H9TA 4GCKA 3TP0A 5D19A 2TCTA 3BR2A 3DPJA 5K7FA 2X6OA 2WV1A 1T33A 1JT0A 2GFNA 2OI8A 2QWTA 2FX0A 3KZ9A 2GBYA 2VKEA 2XB5A 2NP5A 4G12A 2YVEA 2FQ4A 2I10A 2G7LA 3F0CA 3COLA 3G7RA 3HE0A 5EFYA 3HTIA 2G7SA 3O60A 1Z77A 3ZQGA 2V57A 5CXGA 2YVHA 3BR1A 2NX4A 3BHQA 4V2FA 2NS8A 3GEUA 5FGLA 3AQSA 3DEWA 5F27A 5EYRA 5IPAA 3VIBA 4YZEA 2O7OA 5F04A 3VUQA 3QBMA 2ZOZA 4AC0A 1QPIA 1Z0XA 1UI6A 3C2BA 3QKXA 2REKA 5HBUA 3V78A 2QKOA 4JKZA 2HYTA 3RH2A 3G1MA 5HSZA 4HKUA 3ZQHA 2UXIA 3LSRA 3NPIA 5C4YA 2XGCA 3HTHA 5FKLA 5D18A 5GPAA 2PBXA 3ANPA 3LSJA 3BRUA 3TP3A 3FK6A 3ON4A 3WHBA 2XRLA 1U9OA 2XPWA 3ANGA 2GUHA 2UXUA 3AQTA 3BNIA 1QVTA 3CRJA 4M3DA 2OPTA 2NP3A 3BTIA 2HQ5A 3F1BA 3LSPA 3QPLA 1T56A 5FKOA 4AC6A 2XPUA 3WHCA 3E7QA 3BQZA 3BJBA 4ABZA 2HYJA 2UXHA 4XK4A 3NI7A 2EH3A 2IU5A 3HIMA 3PPBA 2PZ9A 3CCYA 4NELA 2Y31A 2ZCNA 3V6GA 1ZKGA 3T6NA 4I6ZA 3IUVA 1RKTA 2RAEA 4GCTA 2GENA 3LOCA 5J3LA 3PASA 1JTXA 2X9DA 2RASA 2FD5A 3EUPA 4W97A 3FRQA 2D6YA 4M3BA 5CXIA 3IH2A 3SFIA 3HGGA 3VOXA 3LJLA 2ZB9A 4MK6A 5K7HA 2WGBA 5K7ZA 3O8HA 4D7NA 4JL3A 4ACIA 5GPCA 3QQAA 2TRTA 4X1EA 1A6IA 2QCOA 3B6CA 2UXOA 4D5CA 2DG8A 2VKVA 3P9TA 5IOZA 3VW0A 3RD3A 1ZK8A 1JT6A 1ORKA 5GP9A 4M3EA 4ME9A 3VVXA 5K58A 4V2GA 4PXIA 4GFKA 3FIWA 2ZOYA 3MVPA 4DW6A 5FMPA 5IP6A 3IH3A 3G1LA 1RKWA 3C07A 2XGDA 3Q0VA 3BT9A 4D7MA 2ID6A 3Q0UA 3SDGA 4AUXA 2G7GA 2WUIA 2HXOA 5FKKA 4NN1A 2IBDA 3BTJA 5EZGA 4MXMA 5HAWA 3ON2A 2IEKA 3ZQLA 3G1OA 2RHAA 2JK3A 2Q24A 4I76A 2JJ7A 3GZIA 5FKNA 1JUMA 4GFLA 3BTCA 2ID3A 2O7TA 5J1YA 3CWRA 4M3FA 4W1UA 1JTYA 2W53A 2VPRA 3ZQIA 3NXCA 3FK7A 5J1UA 3MNLA 5F0CA 3BR3A 3B81A 1UI5A 2QTQA 2XPVA 4KWAA 3VPRA 1JUSA 4ICHA 3S5RA 2Y30A 3NNRA 3BR5A 4AF5A 4L62A 2DTZA 2DG7A 3G56A 3VW2A 3O8GA 3HGYA 4B1RA 5CW8A 5F0HA 3KNWA 3Q0WA 1RPWA 3VVZA 3BQYA 5IOYA 3VVYA 3EGQA 3CDLA 2ZCXA 4MO7A 5DAJA 5J1RA 2G0EA 1U9NA 2OERA 3PM1A 2G3BA 2IAIA 1JUPA 3LHQA 1SGMA 3ZQFA 3KKDA 3HTJA 3DCFA 2NS7A 4GCLA 4JYKA 4D5FA 3HTAA 2HXIA 1BJZA 4CGRA 5F0FA 2OF7A
chains in the Genus database with same CATH superfamily
1VI0A 3Q3SA 2QOPA 3LWJA 2Y2ZA 4U9NA 3VP5A 2ZCMA 4M3GA 3BTLA 3VW1A 2XDNA 2QIBA 3BR0A 5FKMA 5F1JA 3BR6A 3IH4A 4UDSA 3BCGA 2UXPA 3VOKA 2XGEA 2FJ1A 4IRVA 4B3AA 2FBQA 2F07A 3KKCA 4OD5A 5EZHA 3CJDA 5AQCA 3NRGA 2HKUA 5F08A 1QVUA 5FHPA 5CQGA 3JSJA 4JNNA 3B6AA 5D1RA 3QPSA 5H9TA 3KYLA 4GCKA 3TP0A 2R7XA 5D19A 2TCTA 3BR2A 3FHNA 3DPJA 5K7FA 2X6OA 2WV1A 1T33A 1JT0A 2GFNA 2OI8A 2QWTA 2FX0A 3KZ9A 2GBYA 2VKEA 2XB5A 2NP5A 4G12A 2YVEA 4WIBA 2FQ4A 2I10A 2G7LA 3F0CA 3COLA 3G7RA 3HE0A 5EFYA 2R7SA 3HTIA 2G7SA 3O60A 1Z77A 4U9LA 3ZQGA 2V57A 5CXGA 2YVHA 3BR1A 2NX4A 3BHQA 4V2FA 2NS8A 3GEUA 5FGLA 3AQSA 2R7UA 3DEWA 5F27A 5EYRA 5IPAA 3VIBA 4YZEA 2O7OA 5F04A 3VUQA 3QBMA 2ZOZA 4AC0A 1QPIA 1Z0XA 1UI6A 3C2BA 3DU5A 3QKXA 2REKA 5HBUA 3V78A 2QKOA 4JKZA 2HYTA 3RH2A 3G1MA 5HSZA 4HKUA 3ZQHA 2UXIA 3LSRA 3NPIA 5C4YA 2XGCA 3HTHA 5FKLA 5D18A 5GPAA 2PBXA 3ANPA 3LSJA 3BRUA 3TP3A 3FK6A 3ON4A 3WHBA 2XRLA 1U9OA 2XPWA 3ANGA 2GUHA 2UXUA 3AQTA 3BNIA 1QVTA 3CRJA 4M3DA 2OPTA 2NP3A 3BTIA 2HQ5A 3F1BA 3LSPA 3QPLA 1T56A 5FKOA 4AC6A 2XPUA 3WHCA 3E7QA 4OD4A 3BQZA 3BJBA 4ABZA 2HYJA 2UXHA 4XK4A 3NI7A 2EH3A 2IU5A 3HIMA 3PPBA 2PZ9A 3CCYA 4NELA 2Y31A 3K8PC 2ZCNA 3V6GA 2B1EA 1ZKGA 3T6NA 4I6ZA 3IUVA 1RKTA 2RAEA 2R7TA 4GCTA 2GENA 3LOCA 5J3LA 3PASA 1JTXA 2X9DA 2RASA 2FD5A 3EUPA 4W97A 3FRQA 2D6YA 4M3BA 5CXIA 3IH2A 3SFIA 3HGGA 3VOXA 2ZY9A 3LJLA 2ZB9A 4MK6A 5K7HA 2WGBA 5K7ZA 3O8HA 2R7QA 4D7NA 4JL3A 4ACIA 5GPCA 3QQAA 2TRTA 4X1EA 1A6IA 2QCOA 3B6CA 2UXOA 4D5CA 2DG8A 2VKVA 3P9TA 5IOZA 3VW0A 4C2MA 3RD3A 1ZK8A 1JT6A 1ORKA 5GP9A 4M3EA 4ME9A 3VVXA 5K58A 4V2GA 4PXIA 4GFKA 3FIWA 2ZOYA 3MVPA 2A2FX 4DW6A 5FMPA 5IP6A 3IH3A 3G1LA 1RKWA 3C07A 2XGDA 3NS4A 3Q0VA 3BT9A 4D7MA 2ID6A 3SDGA 3Q0UA 4AUXA 3VTIA 2G7GA 2WUIA 3SWHA 2HXOA 5FKKA 4NN1A 2IBDA 2PFVA 3BTJA 5EZGA 4MXMA 2R7VA 5HAWA 3ON2A 2IEKA 3ZQLA 3G1OA 2RHAA 2JK3A 2Q24A 4I76A 2JJ7A 3GZIA 5FKNA 1JUMA 4GFLA 3BTCA 2ID3A 2O7TA 4DVYP 5J1YA 3CWRA 4M3FA 4W1UA 1JTYA 2W53A 3DU6A 2VPRA 3ZQIA 3NXCA 3FK7A 5J1UA 2R7RA 3MNLA 5F0CA 3BR3A 3B81A 2FJI1 1UI5A 2QTQA 2XPVA 4KWAA 3VPRA 1JUSA 4ICHA 3S5RA 2Y30A 3NNRA 3BR5A 4AF5A 4L62A 2DTZA 2DG7A 3G56A 3VW2A 3O8GA 3HGYA 4B1RA 5CW8A 5F0HA 3KNWA 3Q0WA 1RPWA 3VVZA 2YVXA 3BQYA 5IOYA 2R7OA 3VVYA 3EGQA 3CDLA 2ZCXA 4MO7A 5DAJA 5J1RA 2G0EA 1U9NA 2OERA 3PM1A 2G3BA 2IAIA 1JUPA 3LHQA 1SGMA 3ZQFA 3KKDA 3HTJA 3DCFA 2R7WA 2NS7A 4GCLA 4JYKA 4D5FA 3HTAA 2HXIA 1BJZA 4CGRA 5F0FA 2B3WA 2OF7A
chains in the Genus database with same CATH topology
1VI0A 3Q3SA 2QOPA 3LWJA 2Y2ZA 3VP5A 2ZCMA 4M3GA 3BTLA 3VW1A 2XDNA 2QIBA 3BR0A 5FKMA 5F1JA 3BR6A 3IH4A 4UDSA 3BCGA 2UXPA 3VOKA 2XGEA 2FJ1A 4B3AA 2FBQA 2F07A 3KKCA 5EZHA 3CJDA 5AQCA 3NRGA 2HKUA 5F08A 1QVUA 5FHPA 3JSJA 4JNNA 3B6AA 5D1RA 3QPSA 5H9TA 4GCKA 3TP0A 5D19A 2TCTA 3BR2A 3DPJA 5K7FA 2X6OA 2WV1A 1T33A 1JT0A 2GFNA 2OI8A 2QWTA 2FX0A 3KZ9A 2GBYA 2VKEA 2XB5A 2NP5A 4G12A 2YVEA 2FQ4A 2I10A 2G7LA 3F0CA 3COLA 3G7RA 3HE0A 5EFYA 3HTIA 2G7SA 3O60A 1Z77A 3ZQGA 2V57A 5CXGA 2YVHA 3BR1A 2NX4A 3BHQA 4V2FA 2NS8A 3GEUA 5FGLA 3AQSA 3DEWA 5F27A 5EYRA 5IPAA 3VIBA 4YZEA 2O7OA 5F04A 3VUQA 3QBMA 2ZOZA 4AC0A 1QPIA 1Z0XA 1UI6A 3C2BA 3QKXA 2REKA 5HBUA 3V78A 2QKOA 4JKZA 2HYTA 3RH2A 3G1MA 5HSZA 4HKUA 3ZQHA 2UXIA 3LSRA 3NPIA 5C4YA 2XGCA 3HTHA 5FKLA 5D18A 5GPAA 2PBXA 3ANPA 3LSJA 3BRUA 3TP3A 3FK6A 3ON4A 3WHBA 2XRLA 1U9OA 2XPWA 3ANGA 2GUHA 2UXUA 3AQTA 3BNIA 1QVTA 3CRJA 4M3DA 2OPTA 2NP3A 3BTIA 2HQ5A 3F1BA 3LSPA 3QPLA 1T56A 5FKOA 4AC6A 2XPUA 3WHCA 3E7QA 3BQZA 3BJBA 4ABZA 2HYJA 2UXHA 4XK4A 3NI7A 2EH3A 2IU5A 3HIMA 3PPBA 2PZ9A 3CCYA 4NELA 2Y31A 2ZCNA 3V6GA 1ZKGA 3T6NA 4I6ZA 3IUVA 1RKTA 2RAEA 4GCTA 2GENA 3LOCA 5J3LA 3PASA 1JTXA 2X9DA 2RASA 2FD5A 3EUPA 4W97A 3FRQA 2D6YA 4M3BA 5CXIA 3IH2A 3SFIA 3HGGA 3VOXA 3LJLA 2ZB9A 4MK6A 5K7HA 2WGBA 5K7ZA 3O8HA 4D7NA 4JL3A 4ACIA 5GPCA 3QQAA 2TRTA 4X1EA 1A6IA 2QCOA 3B6CA 2UXOA 4D5CA 2DG8A 2VKVA 3P9TA 5IOZA 3VW0A 3RD3A 1ZK8A 1JT6A 1ORKA 5GP9A 4M3EA 4ME9A 3VVXA 5K58A 4V2GA 4PXIA 4GFKA 3FIWA 2ZOYA 3MVPA 4DW6A 5FMPA 5IP6A 3IH3A 3G1LA 1RKWA 3C07A 2XGDA 3Q0VA 3BT9A 4D7MA 2ID6A 3Q0UA 3SDGA 4AUXA 2G7GA 2WUIA 2HXOA 5FKKA 4NN1A 2IBDA 3BTJA 5EZGA 4MXMA 5HAWA 3ON2A 2IEKA 3ZQLA 3G1OA 2RHAA 2JK3A 2Q24A 4I76A 2JJ7A 3GZIA 5FKNA 1JUMA 4GFLA 3BTCA 2ID3A 2O7TA 5J1YA 3CWRA 4M3FA 4W1UA 1JTYA 2W53A 2VPRA 3ZQIA 3NXCA 3FK7A 5J1UA 3MNLA 5F0CA 3BR3A 3B81A 1UI5A 2QTQA 2XPVA 4KWAA 3VPRA 1JUSA 4ICHA 3S5RA 2Y30A 3NNRA 3BR5A 4AF5A 4L62A 2DTZA 2DG7A 3G56A 3VW2A 3O8GA 3HGYA 4B1RA 5CW8A 5F0HA 3KNWA 3Q0WA 1RPWA 3VVZA 3BQYA 5IOYA 3VVYA 3EGQA 3CDLA 2ZCXA 4MO7A 5DAJA 5J1RA 2G0EA 1U9NA 2OERA 3PM1A 2G3BA 2IAIA 1JUPA 3LHQA 1SGMA 3ZQFA 3KKDA 3HTJA 3DCFA 2NS7A 4GCLA 4JYKA 4D5FA 3HTAA 2HXIA 1BJZA 4CGRA 5F0FA 2OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI0 A;  3Q3S A;  2QOP A;  3LWJ A;  2Y2Z A;  3VP5 A;  2ZCM A;  4M3G A;  3BTL A;  3VW1 A;  2XDN A;  2QIB A;  3BR0 A;  5FKM A;  5F1J A;  3BR6 A;  3IH4 A;  4UDS A;  3BCG A;  2UXP A;  3VOK A;  2XGE A;  2FJ1 A;  4B3A A;  2FBQ A;  2F07 A;  3KKC A;  5EZH A;  3CJD A;  5AQC A;  3NRG A;  2HKU A;  5F08 A;  1QVU A;  5FHP A;  3JSJ A;  4JNN A;  3B6A A;  5D1R A;  3QPS A;  5H9T A;  4GCK A;  3TP0 A;  5D19 A;  2TCT A;  3BR2 A;  3DPJ A;  5K7F A;  2X6O A;  2WV1 A;  1T33 A;  1JT0 A;  2GFN A;  2OI8 A;  2QWT A;  2FX0 A;  3KZ9 A;  2GBY A;  2VKE A;  2XB5 A;  2NP5 A;  4G12 A;  2YVE A;  2FQ4 A;  2I10 A;  2G7L A;  3F0C A;  3COL A;  3G7R A;  3HE0 A;  5EFY A;  3HTI A;  2G7S A;  3O60 A;  1Z77 A;  3ZQG A;  2V57 A;  5CXG A;  2YVH A;  3BR1 A;  2NX4 A;  3BHQ A;  4V2F A;  2NS8 A;  3GEU A;  5FGL A;  3AQS A;  3DEW A;  5F27 A;  5EYR A;  5IPA A;  3VIB A;  4YZE A;  2O7O A;  5F04 A;  3VUQ A;  3QBM A;  2ZOZ A;  4AC0 A;  1QPI A;  1Z0X A;  1UI6 A;  3C2B A;  3QKX A;  2REK A;  5HBU A;  3V78 A;  2QKO A;  4JKZ A;  2HYT A;  3RH2 A;  3G1M A;  5HSZ A;  4HKU A;  3ZQH A;  2UXI A;  3LSR A;  3NPI A;  5C4Y A;  2XGC A;  3HTH A;  5FKL A;  5D18 A;  5GPA A;  2PBX A;  3ANP A;  3LSJ A;  3BRU A;  3TP3 A;  3FK6 A;  3ON4 A;  3WHB A;  2XRL A;  1U9O A;  2XPW A;  3ANG A;  2GUH A;  2UXU A;  3AQT A;  3BNI A;  1QVT A;  3CRJ A;  4M3D A;  2OPT A;  2NP3 A;  3BTI A;  2HQ5 A;  3F1B A;  3LSP A;  3QPL A;  1T56 A;  5FKO A;  4AC6 A;  2XPU A;  3WHC A;  3E7Q A;  3BQZ A;  3BJB A;  4ABZ A;  2HYJ A;  2UXH A;  4XK4 A;  3NI7 A;  2EH3 A;  2IU5 A;  3HIM A;  3PPB A;  2PZ9 A;  3CCY A;  4NEL A;  2Y31 A;  2ZCN A;  3V6G A;  1ZKG A;  3T6N A;  4I6Z A;  3IUV A;  1RKT A;  2RAE A;  4GCT A;  2GEN A;  3LOC A;  5J3L A;  3PAS A;  1JTX A;  2X9D A;  2RAS A;  2FD5 A;  3EUP A;  4W97 A;  3FRQ A;  2D6Y A;  4M3B A;  5CXI A;  3IH2 A;  3SFI A;  3HGG A;  3VOX A;  3LJL A;  2ZB9 A;  4MK6 A;  5K7H A;  2WGB A;  5K7Z A;  3O8H A;  4D7N A;  4JL3 A;  4ACI A;  5GPC A;  3QQA A;  2TRT A;  4X1E A;  1A6I A;  2QCO A;  3B6C A;  2UXO A;  4D5C A;  2DG8 A;  2VKV A;  3P9T A;  5IOZ A;  3VW0 A;  3RD3 A;  1ZK8 A;  1JT6 A;  1ORK A;  5GP9 A;  4M3E A;  4ME9 A;  3VVX A;  5K58 A;  4V2G A;  4PXI A;  4GFK A;  3FIW A;  2ZOY A;  3MVP A;  4DW6 A;  5FMP A;  5IP6 A;  3IH3 A;  3G1L A;  1RKW A;  3C07 A;  2XGD A;  3Q0V A;  3BT9 A;  4D7M A;  2ID6 A;  3Q0U A;  3SDG A;  4AUX A;  2G7G A;  2WUI A;  2HXO A;  5FKK A;  4NN1 A;  2IBD A;  3BTJ A;  5EZG A;  4MXM A;  5HAW A;  3ON2 A;  2IEK A;  3ZQL A;  3G1O A;  2RHA A;  2JK3 A;  2Q24 A;  4I76 A;  2JJ7 A;  3GZI A;  5FKN A;  1JUM A;  4GFL A;  3BTC A;  2ID3 A;  2O7T A;  5J1Y A;  3CWR A;  4M3F A;  4W1U A;  1JTY A;  2W53 A;  2VPR A;  3ZQI A;  3NXC A;  3FK7 A;  5J1U A;  3MNL A;  5F0C A;  3BR3 A;  3B81 A;  1UI5 A;  2QTQ A;  2XPV A;  4KWA A;  3VPR A;  1JUS A;  4ICH A;  3S5R A;  2Y30 A;  3NNR A;  3BR5 A;  4AF5 A;  4L62 A;  2DTZ A;  2DG7 A;  3G56 A;  3VW2 A;  3O8G A;  3HGY A;  4B1R A;  5CW8 A;  5F0H A;  3KNW A;  3Q0W A;  1RPW A;  3VVZ A;  3BQY A;  5IOY A;  3VVY A;  3EGQ A;  3CDL A;  2ZCX A;  4MO7 A;  5DAJ A;  5J1R A;  2G0E A;  1U9N A;  2OER A;  3PM1 A;  2G3B A;  2IAI A;  1JUP A;  3LHQ A;  1SGM A;  3ZQF A;  3KKD A;  3HTJ A;  3DCF A;  2NS7 A;  4GCL A;  4JYK A;  4D5F A;  3HTA A;  2HXI A;  1BJZ A;  4CGR A;  5F0F A;  2OF7 A; 
#chains in the Genus database with same CATH topology
 1VI0 A;  3Q3S A;  2QOP A;  3LWJ A;  2Y2Z A;  4U9N A;  3VP5 A;  2ZCM A;  4M3G A;  3BTL A;  3VW1 A;  2XDN A;  2QIB A;  3BR0 A;  5FKM A;  5F1J A;  3BR6 A;  3IH4 A;  4UDS A;  3BCG A;  2UXP A;  3VOK A;  2XGE A;  2FJ1 A;  4IRV A;  4B3A A;  2FBQ A;  2F07 A;  3KKC A;  4OD5 A;  5EZH A;  3CJD A;  5AQC A;  3NRG A;  2HKU A;  5F08 A;  1QVU A;  5FHP A;  5CQG A;  3JSJ A;  4JNN A;  3B6A A;  5D1R A;  3QPS A;  5H9T A;  3KYL A;  4GCK A;  3TP0 A;  2R7X A;  5D19 A;  2TCT A;  3BR2 A;  3FHN A;  3DPJ A;  5K7F A;  2X6O A;  2WV1 A;  1T33 A;  1JT0 A;  2GFN A;  2OI8 A;  2QWT A;  2FX0 A;  3KZ9 A;  2GBY A;  2VKE A;  2XB5 A;  2NP5 A;  4G12 A;  2YVE A;  4WIB A;  2FQ4 A;  2I10 A;  2G7L A;  3F0C A;  3COL A;  3G7R A;  3HE0 A;  5EFY A;  2R7S A;  3HTI A;  2G7S A;  3O60 A;  1Z77 A;  4U9L A;  3ZQG A;  2V57 A;  5CXG A;  2YVH A;  3BR1 A;  2NX4 A;  3BHQ A;  4V2F A;  2NS8 A;  3GEU A;  5FGL A;  3AQS A;  2R7U A;  3DEW A;  5F27 A;  5EYR A;  5IPA A;  3VIB A;  4YZE A;  2O7O A;  5F04 A;  3VUQ A;  3QBM A;  2ZOZ A;  4AC0 A;  1QPI A;  1Z0X A;  1UI6 A;  3C2B A;  3DU5 A;  3QKX A;  2REK A;  5HBU A;  3V78 A;  2QKO A;  4JKZ A;  2HYT A;  3RH2 A;  3G1M A;  5HSZ A;  4HKU A;  3ZQH A;  2UXI A;  3LSR A;  3NPI A;  5C4Y A;  2XGC A;  3HTH A;  5FKL A;  5D18 A;  5GPA A;  2PBX A;  3ANP A;  3LSJ A;  3BRU A;  3TP3 A;  3FK6 A;  3ON4 A;  3WHB A;  2XRL A;  1U9O A;  2XPW A;  3ANG A;  2GUH A;  2UXU A;  3AQT A;  3BNI A;  1QVT A;  3CRJ A;  4M3D A;  2OPT A;  2NP3 A;  3BTI A;  2HQ5 A;  3F1B A;  3LSP A;  3QPL A;  1T56 A;  5FKO A;  4AC6 A;  2XPU A;  3WHC A;  3E7Q A;  4OD4 A;  3BQZ A;  3BJB A;  4ABZ A;  2HYJ A;  2UXH A;  4XK4 A;  3NI7 A;  2EH3 A;  2IU5 A;  3HIM A;  3PPB A;  2PZ9 A;  3CCY A;  4NEL A;  2Y31 A;  3K8P C;  2ZCN A;  3V6G A;  2B1E A;  1ZKG A;  3T6N A;  4I6Z A;  3IUV A;  1RKT A;  2RAE A;  2R7T A;  4GCT A;  2GEN A;  3LOC A;  5J3L A;  3PAS A;  1JTX A;  2X9D A;  2RAS A;  2FD5 A;  3EUP A;  4W97 A;  3FRQ A;  2D6Y A;  4M3B A;  5CXI A;  3IH2 A;  3SFI A;  3HGG A;  3VOX A;  2ZY9 A;  3LJL A;  2ZB9 A;  4MK6 A;  5K7H A;  2WGB A;  5K7Z A;  3O8H A;  2R7Q A;  4D7N A;  4JL3 A;  4ACI A;  5GPC A;  3QQA A;  2TRT A;  4X1E A;  1A6I A;  2QCO A;  3B6C A;  2UXO A;  4D5C A;  2DG8 A;  2VKV A;  3P9T A;  5IOZ A;  3VW0 A;  4C2M A;  3RD3 A;  1ZK8 A;  1JT6 A;  1ORK A;  5GP9 A;  4M3E A;  4ME9 A;  3VVX A;  5K58 A;  4V2G A;  4PXI A;  4GFK A;  3FIW A;  2ZOY A;  3MVP A;  2A2F X;  4DW6 A;  5FMP A;  5IP6 A;  3IH3 A;  3G1L A;  1RKW A;  3C07 A;  2XGD A;  3NS4 A;  3Q0V A;  3BT9 A;  4D7M A;  2ID6 A;  3SDG A;  3Q0U A;  4AUX A;  3VTI A;  2G7G A;  2WUI A;  3SWH A;  2HXO A;  5FKK A;  4NN1 A;  2IBD A;  2PFV A;  3BTJ A;  5EZG A;  4MXM A;  2R7V A;  5HAW A;  3ON2 A;  2IEK A;  3ZQL A;  3G1O A;  2RHA A;  2JK3 A;  2Q24 A;  4I76 A;  2JJ7 A;  3GZI A;  5FKN A;  1JUM A;  4GFL A;  3BTC A;  2ID3 A;  2O7T A;  4DVY P;  5J1Y A;  3CWR A;  4M3F A;  4W1U A;  1JTY A;  2W53 A;  3DU6 A;  2VPR A;  3ZQI A;  3NXC A;  3FK7 A;  5J1U A;  2R7R A;  3MNL A;  5F0C A;  3BR3 A;  3B81 A;  2FJI 1;  1UI5 A;  2QTQ A;  2XPV A;  4KWA A;  3VPR A;  1JUS A;  4ICH A;  3S5R A;  2Y30 A;  3NNR A;  3BR5 A;  4AF5 A;  4L62 A;  2DTZ A;  2DG7 A;  3G56 A;  3VW2 A;  3O8G A;  3HGY A;  4B1R A;  5CW8 A;  5F0H A;  3KNW A;  3Q0W A;  1RPW A;  3VVZ A;  2YVX A;  3BQY A;  5IOY A;  2R7O A;  3VVY A;  3EGQ A;  3CDL A;  2ZCX A;  4MO7 A;  5DAJ A;  5J1R A;  2G0E A;  1U9N A;  2OER A;  3PM1 A;  2G3B A;  2IAI A;  1JUP A;  3LHQ A;  1SGM A;  3ZQF A;  3KKD A;  3HTJ A;  3DCF A;  2R7W A;  2NS7 A;  4GCL A;  4JYK A;  4D5F A;  3HTA A;  2HXI A;  1BJZ A;  4CGR A;  5F0F A;  2B3W A;  2OF7 A; 
#chains in the Genus database with same CATH homology
 1VI0 A;  3Q3S A;  2QOP A;  3LWJ A;  2Y2Z A;  3VP5 A;  2ZCM A;  4M3G A;  3BTL A;  3VW1 A;  2XDN A;  2QIB A;  3BR0 A;  5FKM A;  5F1J A;  3BR6 A;  3IH4 A;  4UDS A;  3BCG A;  2UXP A;  3VOK A;  2XGE A;  2FJ1 A;  4B3A A;  2FBQ A;  2F07 A;  3KKC A;  5EZH A;  3CJD A;  5AQC A;  3NRG A;  2HKU A;  5F08 A;  1QVU A;  5FHP A;  3JSJ A;  4JNN A;  3B6A A;  5D1R A;  3QPS A;  5H9T A;  4GCK A;  3TP0 A;  5D19 A;  2TCT A;  3BR2 A;  3DPJ A;  5K7F A;  2X6O A;  2WV1 A;  1T33 A;  1JT0 A;  2GFN A;  2OI8 A;  2QWT A;  2FX0 A;  3KZ9 A;  2GBY A;  2VKE A;  2XB5 A;  2NP5 A;  4G12 A;  2YVE A;  2FQ4 A;  2I10 A;  2G7L A;  3F0C A;  3COL A;  3G7R A;  3HE0 A;  5EFY A;  3HTI A;  2G7S A;  3O60 A;  1Z77 A;  3ZQG A;  2V57 A;  5CXG A;  2YVH A;  3BR1 A;  2NX4 A;  3BHQ A;  4V2F A;  2NS8 A;  3GEU A;  5FGL A;  3AQS A;  3DEW A;  5F27 A;  5EYR A;  5IPA A;  3VIB A;  4YZE A;  2O7O A;  5F04 A;  3VUQ A;  3QBM A;  2ZOZ A;  4AC0 A;  1QPI A;  1Z0X A;  1UI6 A;  3C2B A;  3QKX A;  2REK A;  5HBU A;  3V78 A;  2QKO A;  4JKZ A;  2HYT A;  3RH2 A;  3G1M A;  5HSZ A;  4HKU A;  3ZQH A;  2UXI A;  3LSR A;  3NPI A;  5C4Y A;  2XGC A;  3HTH A;  5FKL A;  5D18 A;  5GPA A;  2PBX A;  3ANP A;  3LSJ A;  3BRU A;  3TP3 A;  3FK6 A;  3ON4 A;  3WHB A;  2XRL A;  1U9O A;  2XPW A;  3ANG A;  2GUH A;  2UXU A;  3AQT A;  3BNI A;  1QVT A;  3CRJ A;  4M3D A;  2OPT A;  2NP3 A;  3BTI A;  2HQ5 A;  3F1B A;  3LSP A;  3QPL A;  1T56 A;  5FKO A;  4AC6 A;  2XPU A;  3WHC A;  3E7Q A;  3BQZ A;  3BJB A;  4ABZ A;  2HYJ A;  2UXH A;  4XK4 A;  3NI7 A;  2EH3 A;  2IU5 A;  3HIM A;  3PPB A;  2PZ9 A;  3CCY A;  4NEL A;  2Y31 A;  2ZCN A;  3V6G A;  1ZKG A;  3T6N A;  4I6Z A;  3IUV A;  1RKT A;  2RAE A;  4GCT A;  2GEN A;  3LOC A;  5J3L A;  3PAS A;  1JTX A;  2X9D A;  2RAS A;  2FD5 A;  3EUP A;  4W97 A;  3FRQ A;  2D6Y A;  4M3B A;  5CXI A;  3IH2 A;  3SFI A;  3HGG A;  3VOX A;  3LJL A;  2ZB9 A;  4MK6 A;  5K7H A;  2WGB A;  5K7Z A;  3O8H A;  4D7N A;  4JL3 A;  4ACI A;  5GPC A;  3QQA A;  2TRT A;  4X1E A;  1A6I A;  2QCO A;  3B6C A;  2UXO A;  4D5C A;  2DG8 A;  2VKV A;  3P9T A;  5IOZ A;  3VW0 A;  3RD3 A;  1ZK8 A;  1JT6 A;  1ORK A;  5GP9 A;  4M3E A;  4ME9 A;  3VVX A;  5K58 A;  4V2G A;  4PXI A;  4GFK A;  3FIW A;  2ZOY A;  3MVP A;  4DW6 A;  5FMP A;  5IP6 A;  3IH3 A;  3G1L A;  1RKW A;  3C07 A;  2XGD A;  3Q0V A;  3BT9 A;  4D7M A;  2ID6 A;  3Q0U A;  3SDG A;  4AUX A;  2G7G A;  2WUI A;  2HXO A;  5FKK A;  4NN1 A;  2IBD A;  3BTJ A;  5EZG A;  4MXM A;  5HAW A;  3ON2 A;  2IEK A;  3ZQL A;  3G1O A;  2RHA A;  2JK3 A;  2Q24 A;  4I76 A;  2JJ7 A;  3GZI A;  5FKN A;  1JUM A;  4GFL A;  3BTC A;  2ID3 A;  2O7T A;  5J1Y A;  3CWR A;  4M3F A;  4W1U A;  1JTY A;  2W53 A;  2VPR A;  3ZQI A;  3NXC A;  3FK7 A;  5J1U A;  3MNL A;  5F0C A;  3BR3 A;  3B81 A;  1UI5 A;  2QTQ A;  2XPV A;  4KWA A;  3VPR A;  1JUS A;  4ICH A;  3S5R A;  2Y30 A;  3NNR A;  3BR5 A;  4AF5 A;  4L62 A;  2DTZ A;  2DG7 A;  3G56 A;  3VW2 A;  3O8G A;  3HGY A;  4B1R A;  5CW8 A;  5F0H A;  3KNW A;  3Q0W A;  1RPW A;  3VVZ A;  3BQY A;  5IOY A;  3VVY A;  3EGQ A;  3CDL A;  2ZCX A;  4MO7 A;  5DAJ A;  5J1R A;  2G0E A;  1U9N A;  2OER A;  3PM1 A;  2G3B A;  2IAI A;  1JUP A;  3LHQ A;  1SGM A;  3ZQF A;  3KKD A;  3HTJ A;  3DCF A;  2NS7 A;  4GCL A;  4JYK A;  4D5F A;  3HTA A;  2HXI A;  1BJZ A;  4CGR A;  5F0F A;  2OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...