2HKUA

Structural genomics, the crystal structure of a putative transcriptional regulator from rhodococcus sp. rha1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
191
structure length
191
Chain Sequence
QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription regulator
molecule keywords A putative transcriptional regulator
total genus 79
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16914 TetR_C_12 Bacterial transcriptional repressor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hkuA00
4NN1A 2ZB9A 5J3LA 5DAJA 5F27A 3NPIA 2VPRA 5CXIA 2HYTA 5J1YA 5F1JA 3AQTA 3VOKA 1JTXA 2QCOA 1QVUA 3Q3SA 2DTZA 4M3DA 5C4YA 5FKNA 2IBDA 2TCTA 5F08A 3LWJA 2WV1A 2UXIA 5H9TA 3MVPA 2REKA 2ZOZA 2NX4A 3IH4A 2OF7A 1U9OA 3ZQLA 4DW6A 2ZCNA 4GFKA 2DG8A 3V78A 3ANGA 2I10A 2GENA 3BR0A 3G1MA 2XGDA 5K7ZA 3FIWA 3LSJA 4I76A 2JK3A 4GCLA 3RD3A 2Y2ZA 2ZCXA 2UXOA 5D1RA 1ZK8A 3NI7A 1JT6A 1SGMA 3ON4A 3HTAA 2G7GA 4M3EA 3QPSA 4NELA 5EFYA 3VPRA 2IAIA 4I6ZA 2ZOYA 3F0CA 4AC0A 5FKMA 3GEUA 3Q0WA 3VVYA 3LSPA 2XDNA 4JNNA 2FBQA 4UDSA 2QTQA 3G1LA 3CDLA 1QPIA 5CW8A 2Q24A 4D7MA 3PM1A 3VVZA 4KWAA 3TP0A 4ACIA 3VUQA 3IUVA 2Y30A 5D19A 3BTIA 4GCKA 2QWTA 4M3BA 2QOPA 5F04A 3BQYA 3WHBA 2XGEA 3HGYA 3V6GA 3HE0A 4AC6A 3MNLA 2HQ5A 3GZIA 2HXIA 2VKEA 4XK4A 3BTJA 3ZQGA 3FK7A 3G1OA 2WGBA 1RKTA 3NRGA 2XRLA 2PZ9A 2FX0A 3SFIA 2OERA 3HIMA 2FQ4A 2QKOA 3CJDA 3BR2A 3BR1A 1VI0A 3BHQA 3AQSA 5K58A 3B6AA 2ID6A 2FD5A 3C2BA 5AQCA 2D6YA 3B6CA 3T6NA 3BTCA 1ZKGA 3G7RA 2G7LA 3DPJA 2O7OA 3ON2A 4M3GA 3NXCA 3DCFA 1JT0A 2DG7A 4MO7A 4AUXA 3VW1A 3BNIA 5FKOA 5HBUA 3JSJA 4JKZA 3KNWA 2GBYA 2NP3A 1A6IA 4JL3A 2XPWA 2JJ7A 3O8HA 5IOZA 2GFNA 3F1BA 2ID3A 4D7NA 5FKLA 3C07A 5GP9A 3COLA 3RH2A 3BCGA 5K7HA 5F0HA 3E7QA 3LJLA 3HGGA 1JUSA 3O60A 4ME9A 2HXOA 2HKUA 3VVXA 2O7TA 3IH2A 4HKUA 2EH3A 3VW2A 3QPLA 1T33A 2YVEA 5J1UA 2GUHA 4B1RA 3LSRA 3VP5A 3PPBA 3BQZA 4AF5A 3KZ9A 3CCYA 4L62A 4B3AA 3IH3A 2HYJA 2F07A 3HTIA 2YVHA 2NS8A 3QQAA 3WHCA 5FMPA 3EUPA 2UXHA 2V57A 3BT9A 3BRUA 1JTYA 2G3BA 4MK6A 1Z77A 5FGLA 3DEWA 3NNRA 2IEKA 1RKWA 3QKXA 4W1UA 3KKCA 2XGCA 2G7SA 2IU5A 4W97A 3ZQFA 3BR3A 3HTHA 4ICHA 3VW0A 2W53A 3BTLA 2ZCMA 3G56A 1JUMA 5EZHA 3FRQA 5FHPA 3ZQHA 5EZGA 3VIBA 2G0EA 1JUPA 2OPTA 2OI8A 4JYKA 2XB5A 4V2FA 4PXIA 3TP3A 5GPCA 3KKDA 3EGQA 3BR5A 3CWRA 3VOXA 4M3FA 3O8GA 5HAWA 5K7FA 3PASA 3BJBA 3Q0VA 1RPWA 2PBXA 3ANPA 5FKKA 5IOYA 4ABZA 1ORKA 2RHAA 3B81A 3CRJA 5GPAA 2X6OA 3S5RA 4G12A 3ZQIA 3P9TA 1UI5A 3LOCA 3FK6A 2UXUA 2RAEA 5J1RA 1UI6A 4GCTA 5CXGA 3Q0UA 4MXMA 2RASA 1T56A 2QIBA 1Z0XA 3QBMA 4YZEA 5D18A 1BJZA 4GFLA 1QVTA 5F0CA 1U9NA 4X1EA 5IPAA 4V2GA 2XPVA 5EYRA 3SDGA 2FJ1A 3LHQA 2XPUA 4D5CA 2NP5A 4D5FA 2TRTA 3BR6A 2VKVA 2WUIA 2NS7A 5HSZA 4CGRA 5F0FA 2UXPA 2Y31A 5IP6A 3HTJA 2X9DA
chains in the Genus database with same CATH superfamily
2B1EA 4NN1A 2ZB9A 5J3LA 5DAJA 5F27A 3NPIA 2VPRA 5CXIA 2HYTA 5J1YA 5F1JA 3AQTA 3VOKA 1JTXA 2QCOA 2R7OA 1QVUA 3Q3SA 2DTZA 4M3DA 5C4YA 5FKNA 2IBDA 2TCTA 5F08A 3LWJA 2WV1A 2UXIA 5H9TA 3MVPA 2REKA 3DU6A 2ZOZA 2NX4A 2PFVA 3IH4A 2OF7A 1U9OA 3ZQLA 4DW6A 2ZCNA 4GFKA 2DG8A 3V78A 3ANGA 2I10A 2GENA 2YVXA 3BR0A 3G1MA 2A2FX 2XGDA 5K7ZA 3FIWA 3LSJA 4I76A 2JK3A 4GCLA 3RD3A 2Y2ZA 2ZCXA 2UXOA 5D1RA 1ZK8A 3NI7A 1JT6A 1SGMA 3ON4A 3HTAA 2G7GA 4M3EA 3QPSA 4NELA 5EFYA 3VPRA 2IAIA 4I6ZA 2ZOYA 3F0CA 4AC0A 5FKMA 3GEUA 2R7RA 3Q0WA 3VVYA 5CQGA 3LSPA 2XDNA 2FJI1 4JNNA 2FBQA 4UDSA 2QTQA 3G1LA 3CDLA 1QPIA 5CW8A 2Q24A 4D7MA 3PM1A 3VVZA 4KWAA 3TP0A 4ACIA 3VUQA 3IUVA 2Y30A 5D19A 3BTIA 4GCKA 2QWTA 4M3BA 2QOPA 5F04A 3BQYA 3WHBA 2XGEA 3HGYA 3V6GA 3HE0A 4AC6A 3MNLA 2HQ5A 3GZIA 2HXIA 2VKEA 4XK4A 3BTJA 3ZQGA 3FK7A 3G1OA 2WGBA 1RKTA 3NRGA 2XRLA 2PZ9A 2FX0A 3SFIA 2OERA 3HIMA 2FQ4A 2QKOA 3CJDA 3BR2A 3BR1A 2R7SA 1VI0A 3BHQA 3AQSA 5K58A 3B6AA 2ID6A 2FD5A 4WIBA 3C2BA 5AQCA 2D6YA 3B6CA 3T6NA 3BTCA 1ZKGA 3G7RA 2G7LA 3DPJA 2O7OA 3ON2A 4M3GA 3NXCA 3DCFA 1JT0A 2DG7A 4MO7A 4AUXA 4OD4A 2R7TA 3VW1A 3BNIA 5FKOA 5HBUA 3JSJA 4JKZA 3KNWA 2GBYA 2NP3A 1A6IA 4JL3A 2XPWA 2JJ7A 3O8HA 5IOZA 2GFNA 3F1BA 2ID3A 4D7NA 5FKLA 4U9LA 3C07A 5GP9A 3COLA 3RH2A 3BCGA 5K7HA 5F0HA 3E7QA 3LJLA 3HGGA 1JUSA 3O60A 4ME9A 2HXOA 2HKUA 3VVXA 2O7TA 3IH2A 4HKUA 2EH3A 3VW2A 3QPLA 1T33A 2YVEA 5J1UA 2GUHA 4B1RA 3LSRA 2R7VA 3VP5A 3PPBA 3BQZA 4AF5A 3KZ9A 3CCYA 4L62A 4B3AA 3IH3A 2HYJA 2F07A 3HTIA 2YVHA 2NS8A 3QQAA 3WHCA 5FMPA 3EUPA 2UXHA 2V57A 3BT9A 3BRUA 1JTYA 2G3BA 4MK6A 1Z77A 4U9NA 5FGLA 3DEWA 3NNRA 2IEKA 1RKWA 3QKXA 4W1UA 3KKCA 2XGCA 2G7SA 2IU5A 4W97A 3ZQFA 3BR3A 3VTIA 3HTHA 4ICHA 3VW0A 2W53A 3BTLA 2ZCMA 3G56A 1JUMA 5EZHA 3SWHA 3FRQA 3NS4A 5FHPA 2R7QA 3ZQHA 5EZGA 3VIBA 2G0EA 1JUPA 2OPTA 2OI8A 4JYKA 2XB5A 4V2FA 4PXIA 3TP3A 5GPCA 3KKDA 3EGQA 3BR5A 3CWRA 3KYLA 3VOXA 4M3FA 3O8GA 5HAWA 3FHNA 5K7FA 3PASA 3BJBA 3Q0VA 1RPWA 2PBXA 3ANPA 5FKKA 5IOYA 4ABZA 1ORKA 2RHAA 3B81A 3CRJA 5GPAA 2X6OA 3S5RA 4IRVA 4G12A 3ZQIA 3P9TA 1UI5A 3LOCA 3FK6A 2UXUA 2RAEA 5J1RA 1UI6A 3DU5A 2B3WA 4GCTA 5CXGA 3Q0UA 4MXMA 2RASA 1T56A 2QIBA 1Z0XA 3QBMA 3K8PC 4YZEA 5D18A 1BJZA 4GFLA 4C2MA 1QVTA 5F0CA 1U9NA 4X1EA 5IPAA 4V2GA 2XPVA 5EYRA 3SDGA 2FJ1A 3LHQA 2XPUA 4D5CA 2NP5A 4D5FA 2TRTA 3BR6A 4DVYP 2VKVA 2WUIA 2NS7A 5HSZA 2R7WA 4CGRA 2R7UA 5F0FA 2R7XA 2ZY9A 2UXPA 2Y31A 5IP6A 4OD5A 3HTJA 2X9DA
chains in the Genus database with same CATH topology
4NN1A 2ZB9A 5J3LA 5DAJA 5F27A 3NPIA 2VPRA 5CXIA 2HYTA 5J1YA 5F1JA 3AQTA 3VOKA 1JTXA 2QCOA 1QVUA 3Q3SA 2DTZA 4M3DA 5C4YA 5FKNA 2IBDA 2TCTA 5F08A 3LWJA 2WV1A 2UXIA 5H9TA 3MVPA 2REKA 2ZOZA 2NX4A 3IH4A 2OF7A 1U9OA 3ZQLA 4DW6A 2ZCNA 4GFKA 2DG8A 3V78A 3ANGA 2I10A 2GENA 3BR0A 3G1MA 2XGDA 5K7ZA 3FIWA 3LSJA 4I76A 2JK3A 4GCLA 3RD3A 2Y2ZA 2ZCXA 2UXOA 5D1RA 1ZK8A 3NI7A 1JT6A 1SGMA 3ON4A 3HTAA 2G7GA 4M3EA 3QPSA 4NELA 5EFYA 3VPRA 2IAIA 4I6ZA 2ZOYA 3F0CA 4AC0A 5FKMA 3GEUA 3Q0WA 3VVYA 3LSPA 2XDNA 4JNNA 2FBQA 4UDSA 2QTQA 3G1LA 3CDLA 1QPIA 5CW8A 2Q24A 4D7MA 3PM1A 3VVZA 4KWAA 3TP0A 4ACIA 3VUQA 3IUVA 2Y30A 5D19A 3BTIA 4GCKA 2QWTA 4M3BA 2QOPA 5F04A 3BQYA 3WHBA 2XGEA 3HGYA 3V6GA 3HE0A 4AC6A 3MNLA 2HQ5A 3GZIA 2HXIA 2VKEA 4XK4A 3BTJA 3ZQGA 3FK7A 3G1OA 2WGBA 1RKTA 3NRGA 2XRLA 2PZ9A 2FX0A 3SFIA 2OERA 3HIMA 2FQ4A 2QKOA 3CJDA 3BR2A 3BR1A 1VI0A 3BHQA 3AQSA 5K58A 3B6AA 2ID6A 2FD5A 3C2BA 5AQCA 2D6YA 3B6CA 3T6NA 3BTCA 1ZKGA 3G7RA 2G7LA 3DPJA 2O7OA 3ON2A 4M3GA 3NXCA 3DCFA 1JT0A 2DG7A 4MO7A 4AUXA 3VW1A 3BNIA 5FKOA 5HBUA 3JSJA 4JKZA 3KNWA 2GBYA 2NP3A 1A6IA 4JL3A 2XPWA 2JJ7A 3O8HA 5IOZA 2GFNA 3F1BA 2ID3A 4D7NA 5FKLA 3C07A 5GP9A 3COLA 3RH2A 3BCGA 5K7HA 5F0HA 3E7QA 3LJLA 3HGGA 1JUSA 3O60A 4ME9A 2HXOA 2HKUA 3VVXA 2O7TA 3IH2A 4HKUA 2EH3A 3VW2A 3QPLA 1T33A 2YVEA 5J1UA 2GUHA 4B1RA 3LSRA 3VP5A 3PPBA 3BQZA 4AF5A 3KZ9A 3CCYA 4L62A 4B3AA 3IH3A 2HYJA 2F07A 3HTIA 2YVHA 2NS8A 3QQAA 3WHCA 5FMPA 3EUPA 2UXHA 2V57A 3BT9A 3BRUA 1JTYA 2G3BA 4MK6A 1Z77A 5FGLA 3DEWA 3NNRA 2IEKA 1RKWA 3QKXA 4W1UA 3KKCA 2XGCA 2G7SA 2IU5A 4W97A 3ZQFA 3BR3A 3HTHA 4ICHA 3VW0A 2W53A 3BTLA 2ZCMA 3G56A 1JUMA 5EZHA 3FRQA 5FHPA 3ZQHA 5EZGA 3VIBA 2G0EA 1JUPA 2OPTA 2OI8A 4JYKA 2XB5A 4V2FA 4PXIA 3TP3A 5GPCA 3KKDA 3EGQA 3BR5A 3CWRA 3VOXA 4M3FA 3O8GA 5HAWA 5K7FA 3PASA 3BJBA 3Q0VA 1RPWA 2PBXA 3ANPA 5FKKA 5IOYA 4ABZA 1ORKA 2RHAA 3B81A 3CRJA 5GPAA 2X6OA 3S5RA 4G12A 3ZQIA 3P9TA 1UI5A 3LOCA 3FK6A 2UXUA 2RAEA 5J1RA 1UI6A 4GCTA 5CXGA 3Q0UA 4MXMA 2RASA 1T56A 2QIBA 1Z0XA 3QBMA 4YZEA 5D18A 1BJZA 4GFLA 1QVTA 5F0CA 1U9NA 4X1EA 5IPAA 4V2GA 2XPVA 5EYRA 3SDGA 2FJ1A 3LHQA 2XPUA 4D5CA 2NP5A 4D5FA 2TRTA 3BR6A 2VKVA 2WUIA 2NS7A 5HSZA 4CGRA 5F0FA 2UXPA 2Y31A 5IP6A 3HTJA 2X9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NN1 A;  2ZB9 A;  5J3L A;  5DAJ A;  5F27 A;  3NPI A;  2VPR A;  5CXI A;  2HYT A;  5J1Y A;  5F1J A;  3AQT A;  3VOK A;  1JTX A;  2QCO A;  1QVU A;  3Q3S A;  2DTZ A;  4M3D A;  5C4Y A;  5FKN A;  2IBD A;  2TCT A;  5F08 A;  3LWJ A;  2WV1 A;  2UXI A;  5H9T A;  3MVP A;  2REK A;  2ZOZ A;  2NX4 A;  3IH4 A;  2OF7 A;  1U9O A;  3ZQL A;  4DW6 A;  2ZCN A;  4GFK A;  2DG8 A;  3V78 A;  3ANG A;  2I10 A;  2GEN A;  3BR0 A;  3G1M A;  2XGD A;  5K7Z A;  3FIW A;  3LSJ A;  4I76 A;  2JK3 A;  4GCL A;  3RD3 A;  2Y2Z A;  2ZCX A;  2UXO A;  5D1R A;  1ZK8 A;  3NI7 A;  1JT6 A;  1SGM A;  3ON4 A;  3HTA A;  2G7G A;  4M3E A;  3QPS A;  4NEL A;  5EFY A;  3VPR A;  2IAI A;  4I6Z A;  2ZOY A;  3F0C A;  4AC0 A;  5FKM A;  3GEU A;  3Q0W A;  3VVY A;  3LSP A;  2XDN A;  4JNN A;  2FBQ A;  4UDS A;  2QTQ A;  3G1L A;  3CDL A;  1QPI A;  5CW8 A;  2Q24 A;  4D7M A;  3PM1 A;  3VVZ A;  4KWA A;  3TP0 A;  4ACI A;  3VUQ A;  3IUV A;  2Y30 A;  5D19 A;  3BTI A;  4GCK A;  2QWT A;  4M3B A;  2QOP A;  5F04 A;  3BQY A;  3WHB A;  2XGE A;  3HGY A;  3V6G A;  3HE0 A;  4AC6 A;  3MNL A;  2HQ5 A;  3GZI A;  2HXI A;  2VKE A;  4XK4 A;  3BTJ A;  3ZQG A;  3FK7 A;  3G1O A;  2WGB A;  1RKT A;  3NRG A;  2XRL A;  2PZ9 A;  2FX0 A;  3SFI A;  2OER A;  3HIM A;  2FQ4 A;  2QKO A;  3CJD A;  3BR2 A;  3BR1 A;  1VI0 A;  3BHQ A;  3AQS A;  5K58 A;  3B6A A;  2ID6 A;  2FD5 A;  3C2B A;  5AQC A;  2D6Y A;  3B6C A;  3T6N A;  3BTC A;  1ZKG A;  3G7R A;  2G7L A;  3DPJ A;  2O7O A;  3ON2 A;  4M3G A;  3NXC A;  3DCF A;  1JT0 A;  2DG7 A;  4MO7 A;  4AUX A;  3VW1 A;  3BNI A;  5FKO A;  5HBU A;  3JSJ A;  4JKZ A;  3KNW A;  2GBY A;  2NP3 A;  1A6I A;  4JL3 A;  2XPW A;  2JJ7 A;  3O8H A;  5IOZ A;  2GFN A;  3F1B A;  2ID3 A;  4D7N A;  5FKL A;  3C07 A;  5GP9 A;  3COL A;  3RH2 A;  3BCG A;  5K7H A;  5F0H A;  3E7Q A;  3LJL A;  3HGG A;  1JUS A;  3O60 A;  4ME9 A;  2HXO A;  2HKU A;  3VVX A;  2O7T A;  3IH2 A;  4HKU A;  2EH3 A;  3VW2 A;  3QPL A;  1T33 A;  2YVE A;  5J1U A;  2GUH A;  4B1R A;  3LSR A;  3VP5 A;  3PPB A;  3BQZ A;  4AF5 A;  3KZ9 A;  3CCY A;  4L62 A;  4B3A A;  3IH3 A;  2HYJ A;  2F07 A;  3HTI A;  2YVH A;  2NS8 A;  3QQA A;  3WHC A;  5FMP A;  3EUP A;  2UXH A;  2V57 A;  3BT9 A;  3BRU A;  1JTY A;  2G3B A;  4MK6 A;  1Z77 A;  5FGL A;  3DEW A;  3NNR A;  2IEK A;  1RKW A;  3QKX A;  4W1U A;  3KKC A;  2XGC A;  2G7S A;  2IU5 A;  4W97 A;  3ZQF A;  3BR3 A;  3HTH A;  4ICH A;  3VW0 A;  2W53 A;  3BTL A;  2ZCM A;  3G56 A;  1JUM A;  5EZH A;  3FRQ A;  5FHP A;  3ZQH A;  5EZG A;  3VIB A;  2G0E A;  1JUP A;  2OPT A;  2OI8 A;  4JYK A;  2XB5 A;  4V2F A;  4PXI A;  3TP3 A;  5GPC A;  3KKD A;  3EGQ A;  3BR5 A;  3CWR A;  3VOX A;  4M3F A;  3O8G A;  5HAW A;  5K7F A;  3PAS A;  3BJB A;  3Q0V A;  1RPW A;  2PBX A;  3ANP A;  5FKK A;  5IOY A;  4ABZ A;  1ORK A;  2RHA A;  3B81 A;  3CRJ A;  5GPA A;  2X6O A;  3S5R A;  4G12 A;  3ZQI A;  3P9T A;  1UI5 A;  3LOC A;  3FK6 A;  2UXU A;  2RAE A;  5J1R A;  1UI6 A;  4GCT A;  5CXG A;  3Q0U A;  4MXM A;  2RAS A;  1T56 A;  2QIB A;  1Z0X A;  3QBM A;  4YZE A;  5D18 A;  1BJZ A;  4GFL A;  1QVT A;  5F0C A;  1U9N A;  4X1E A;  5IPA A;  4V2G A;  2XPV A;  5EYR A;  3SDG A;  2FJ1 A;  3LHQ A;  2XPU A;  4D5C A;  2NP5 A;  4D5F A;  2TRT A;  3BR6 A;  2VKV A;  2WUI A;  2NS7 A;  5HSZ A;  4CGR A;  5F0F A;  2UXP A;  2Y31 A;  5IP6 A;  3HTJ A;  2X9D A; 
#chains in the Genus database with same CATH topology
 2B1E A;  4NN1 A;  2ZB9 A;  5J3L A;  5DAJ A;  5F27 A;  3NPI A;  2VPR A;  5CXI A;  2HYT A;  5J1Y A;  5F1J A;  3AQT A;  3VOK A;  1JTX A;  2QCO A;  2R7O A;  1QVU A;  3Q3S A;  2DTZ A;  4M3D A;  5C4Y A;  5FKN A;  2IBD A;  2TCT A;  5F08 A;  3LWJ A;  2WV1 A;  2UXI A;  5H9T A;  3MVP A;  2REK A;  3DU6 A;  2ZOZ A;  2NX4 A;  2PFV A;  3IH4 A;  2OF7 A;  1U9O A;  3ZQL A;  4DW6 A;  2ZCN A;  4GFK A;  2DG8 A;  3V78 A;  3ANG A;  2I10 A;  2GEN A;  2YVX A;  3BR0 A;  3G1M A;  2A2F X;  2XGD A;  5K7Z A;  3FIW A;  3LSJ A;  4I76 A;  2JK3 A;  4GCL A;  3RD3 A;  2Y2Z A;  2ZCX A;  2UXO A;  5D1R A;  1ZK8 A;  3NI7 A;  1JT6 A;  1SGM A;  3ON4 A;  3HTA A;  2G7G A;  4M3E A;  3QPS A;  4NEL A;  5EFY A;  3VPR A;  2IAI A;  4I6Z A;  2ZOY A;  3F0C A;  4AC0 A;  5FKM A;  3GEU A;  2R7R A;  3Q0W A;  3VVY A;  5CQG A;  3LSP A;  2XDN A;  2FJI 1;  4JNN A;  2FBQ A;  4UDS A;  2QTQ A;  3G1L A;  3CDL A;  1QPI A;  5CW8 A;  2Q24 A;  4D7M A;  3PM1 A;  3VVZ A;  4KWA A;  3TP0 A;  4ACI A;  3VUQ A;  3IUV A;  2Y30 A;  5D19 A;  3BTI A;  4GCK A;  2QWT A;  4M3B A;  2QOP A;  5F04 A;  3BQY A;  3WHB A;  2XGE A;  3HGY A;  3V6G A;  3HE0 A;  4AC6 A;  3MNL A;  2HQ5 A;  3GZI A;  2HXI A;  2VKE A;  4XK4 A;  3BTJ A;  3ZQG A;  3FK7 A;  3G1O A;  2WGB A;  1RKT A;  3NRG A;  2XRL A;  2PZ9 A;  2FX0 A;  3SFI A;  2OER A;  3HIM A;  2FQ4 A;  2QKO A;  3CJD A;  3BR2 A;  3BR1 A;  2R7S A;  1VI0 A;  3BHQ A;  3AQS A;  5K58 A;  3B6A A;  2ID6 A;  2FD5 A;  4WIB A;  3C2B A;  5AQC A;  2D6Y A;  3B6C A;  3T6N A;  3BTC A;  1ZKG A;  3G7R A;  2G7L A;  3DPJ A;  2O7O A;  3ON2 A;  4M3G A;  3NXC A;  3DCF A;  1JT0 A;  2DG7 A;  4MO7 A;  4AUX A;  4OD4 A;  2R7T A;  3VW1 A;  3BNI A;  5FKO A;  5HBU A;  3JSJ A;  4JKZ A;  3KNW A;  2GBY A;  2NP3 A;  1A6I A;  4JL3 A;  2XPW A;  2JJ7 A;  3O8H A;  5IOZ A;  2GFN A;  3F1B A;  2ID3 A;  4D7N A;  5FKL A;  4U9L A;  3C07 A;  5GP9 A;  3COL A;  3RH2 A;  3BCG A;  5K7H A;  5F0H A;  3E7Q A;  3LJL A;  3HGG A;  1JUS A;  3O60 A;  4ME9 A;  2HXO A;  2HKU A;  3VVX A;  2O7T A;  3IH2 A;  4HKU A;  2EH3 A;  3VW2 A;  3QPL A;  1T33 A;  2YVE A;  5J1U A;  2GUH A;  4B1R A;  3LSR A;  2R7V A;  3VP5 A;  3PPB A;  3BQZ A;  4AF5 A;  3KZ9 A;  3CCY A;  4L62 A;  4B3A A;  3IH3 A;  2HYJ A;  2F07 A;  3HTI A;  2YVH A;  2NS8 A;  3QQA A;  3WHC A;  5FMP A;  3EUP A;  2UXH A;  2V57 A;  3BT9 A;  3BRU A;  1JTY A;  2G3B A;  4MK6 A;  1Z77 A;  4U9N A;  5FGL A;  3DEW A;  3NNR A;  2IEK A;  1RKW A;  3QKX A;  4W1U A;  3KKC A;  2XGC A;  2G7S A;  2IU5 A;  4W97 A;  3ZQF A;  3BR3 A;  3VTI A;  3HTH A;  4ICH A;  3VW0 A;  2W53 A;  3BTL A;  2ZCM A;  3G56 A;  1JUM A;  5EZH A;  3SWH A;  3FRQ A;  3NS4 A;  5FHP A;  2R7Q A;  3ZQH A;  5EZG A;  3VIB A;  2G0E A;  1JUP A;  2OPT A;  2OI8 A;  4JYK A;  2XB5 A;  4V2F A;  4PXI A;  3TP3 A;  5GPC A;  3KKD A;  3EGQ A;  3BR5 A;  3CWR A;  3KYL A;  3VOX A;  4M3F A;  3O8G A;  5HAW A;  3FHN A;  5K7F A;  3PAS A;  3BJB A;  3Q0V A;  1RPW A;  2PBX A;  3ANP A;  5FKK A;  5IOY A;  4ABZ A;  1ORK A;  2RHA A;  3B81 A;  3CRJ A;  5GPA A;  2X6O A;  3S5R A;  4IRV A;  4G12 A;  3ZQI A;  3P9T A;  1UI5 A;  3LOC A;  3FK6 A;  2UXU A;  2RAE A;  5J1R A;  1UI6 A;  3DU5 A;  2B3W A;  4GCT A;  5CXG A;  3Q0U A;  4MXM A;  2RAS A;  1T56 A;  2QIB A;  1Z0X A;  3QBM A;  3K8P C;  4YZE A;  5D18 A;  1BJZ A;  4GFL A;  4C2M A;  1QVT A;  5F0C A;  1U9N A;  4X1E A;  5IPA A;  4V2G A;  2XPV A;  5EYR A;  3SDG A;  2FJ1 A;  3LHQ A;  2XPU A;  4D5C A;  2NP5 A;  4D5F A;  2TRT A;  3BR6 A;  4DVY P;  2VKV A;  2WUI A;  2NS7 A;  5HSZ A;  2R7W A;  4CGR A;  2R7U A;  5F0F A;  2R7X A;  2ZY9 A;  2UXP A;  2Y31 A;  5IP6 A;  4OD5 A;  3HTJ A;  2X9D A; 
#chains in the Genus database with same CATH homology
 4NN1 A;  2ZB9 A;  5J3L A;  5DAJ A;  5F27 A;  3NPI A;  2VPR A;  5CXI A;  2HYT A;  5J1Y A;  5F1J A;  3AQT A;  3VOK A;  1JTX A;  2QCO A;  1QVU A;  3Q3S A;  2DTZ A;  4M3D A;  5C4Y A;  5FKN A;  2IBD A;  2TCT A;  5F08 A;  3LWJ A;  2WV1 A;  2UXI A;  5H9T A;  3MVP A;  2REK A;  2ZOZ A;  2NX4 A;  3IH4 A;  2OF7 A;  1U9O A;  3ZQL A;  4DW6 A;  2ZCN A;  4GFK A;  2DG8 A;  3V78 A;  3ANG A;  2I10 A;  2GEN A;  3BR0 A;  3G1M A;  2XGD A;  5K7Z A;  3FIW A;  3LSJ A;  4I76 A;  2JK3 A;  4GCL A;  3RD3 A;  2Y2Z A;  2ZCX A;  2UXO A;  5D1R A;  1ZK8 A;  3NI7 A;  1JT6 A;  1SGM A;  3ON4 A;  3HTA A;  2G7G A;  4M3E A;  3QPS A;  4NEL A;  5EFY A;  3VPR A;  2IAI A;  4I6Z A;  2ZOY A;  3F0C A;  4AC0 A;  5FKM A;  3GEU A;  3Q0W A;  3VVY A;  3LSP A;  2XDN A;  4JNN A;  2FBQ A;  4UDS A;  2QTQ A;  3G1L A;  3CDL A;  1QPI A;  5CW8 A;  2Q24 A;  4D7M A;  3PM1 A;  3VVZ A;  4KWA A;  3TP0 A;  4ACI A;  3VUQ A;  3IUV A;  2Y30 A;  5D19 A;  3BTI A;  4GCK A;  2QWT A;  4M3B A;  2QOP A;  5F04 A;  3BQY A;  3WHB A;  2XGE A;  3HGY A;  3V6G A;  3HE0 A;  4AC6 A;  3MNL A;  2HQ5 A;  3GZI A;  2HXI A;  2VKE A;  4XK4 A;  3BTJ A;  3ZQG A;  3FK7 A;  3G1O A;  2WGB A;  1RKT A;  3NRG A;  2XRL A;  2PZ9 A;  2FX0 A;  3SFI A;  2OER A;  3HIM A;  2FQ4 A;  2QKO A;  3CJD A;  3BR2 A;  3BR1 A;  1VI0 A;  3BHQ A;  3AQS A;  5K58 A;  3B6A A;  2ID6 A;  2FD5 A;  3C2B A;  5AQC A;  2D6Y A;  3B6C A;  3T6N A;  3BTC A;  1ZKG A;  3G7R A;  2G7L A;  3DPJ A;  2O7O A;  3ON2 A;  4M3G A;  3NXC A;  3DCF A;  1JT0 A;  2DG7 A;  4MO7 A;  4AUX A;  3VW1 A;  3BNI A;  5FKO A;  5HBU A;  3JSJ A;  4JKZ A;  3KNW A;  2GBY A;  2NP3 A;  1A6I A;  4JL3 A;  2XPW A;  2JJ7 A;  3O8H A;  5IOZ A;  2GFN A;  3F1B A;  2ID3 A;  4D7N A;  5FKL A;  3C07 A;  5GP9 A;  3COL A;  3RH2 A;  3BCG A;  5K7H A;  5F0H A;  3E7Q A;  3LJL A;  3HGG A;  1JUS A;  3O60 A;  4ME9 A;  2HXO A;  2HKU A;  3VVX A;  2O7T A;  3IH2 A;  4HKU A;  2EH3 A;  3VW2 A;  3QPL A;  1T33 A;  2YVE A;  5J1U A;  2GUH A;  4B1R A;  3LSR A;  3VP5 A;  3PPB A;  3BQZ A;  4AF5 A;  3KZ9 A;  3CCY A;  4L62 A;  4B3A A;  3IH3 A;  2HYJ A;  2F07 A;  3HTI A;  2YVH A;  2NS8 A;  3QQA A;  3WHC A;  5FMP A;  3EUP A;  2UXH A;  2V57 A;  3BT9 A;  3BRU A;  1JTY A;  2G3B A;  4MK6 A;  1Z77 A;  5FGL A;  3DEW A;  3NNR A;  2IEK A;  1RKW A;  3QKX A;  4W1U A;  3KKC A;  2XGC A;  2G7S A;  2IU5 A;  4W97 A;  3ZQF A;  3BR3 A;  3HTH A;  4ICH A;  3VW0 A;  2W53 A;  3BTL A;  2ZCM A;  3G56 A;  1JUM A;  5EZH A;  3FRQ A;  5FHP A;  3ZQH A;  5EZG A;  3VIB A;  2G0E A;  1JUP A;  2OPT A;  2OI8 A;  4JYK A;  2XB5 A;  4V2F A;  4PXI A;  3TP3 A;  5GPC A;  3KKD A;  3EGQ A;  3BR5 A;  3CWR A;  3VOX A;  4M3F A;  3O8G A;  5HAW A;  5K7F A;  3PAS A;  3BJB A;  3Q0V A;  1RPW A;  2PBX A;  3ANP A;  5FKK A;  5IOY A;  4ABZ A;  1ORK A;  2RHA A;  3B81 A;  3CRJ A;  5GPA A;  2X6O A;  3S5R A;  4G12 A;  3ZQI A;  3P9T A;  1UI5 A;  3LOC A;  3FK6 A;  2UXU A;  2RAE A;  5J1R A;  1UI6 A;  4GCT A;  5CXG A;  3Q0U A;  4MXM A;  2RAS A;  1T56 A;  2QIB A;  1Z0X A;  3QBM A;  4YZE A;  5D18 A;  1BJZ A;  4GFL A;  1QVT A;  5F0C A;  1U9N A;  4X1E A;  5IPA A;  4V2G A;  2XPV A;  5EYR A;  3SDG A;  2FJ1 A;  3LHQ A;  2XPU A;  4D5C A;  2NP5 A;  4D5F A;  2TRT A;  3BR6 A;  2VKV A;  2WUI A;  2NS7 A;  5HSZ A;  4CGR A;  5F0F A;  2UXP A;  2Y31 A;  5IP6 A;  3HTJ A;  2X9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...