2HKUA

Structural genomics, the crystal structure of a putative transcriptional regulator from rhodococcus sp. rha1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
191
structure length
191
Chain Sequence
b'QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A putative transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription regulator
total genus 79
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16914 TetR_C_12 Bacterial transcriptional repressor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hkuA00
1JTYA 4XK4A 4JNNA 1JT0A 2OERA 5F0CA 5H9TA 5EZHA 3BQYA 1JTXA 2XPWA 3EUPA 3KKDA 3RD3A 2ZOYA 3MNLA 5D1RA 2PZ9A 5IOYA 4GCLA 3O60A 3ANPA 2ZCMA 2IBDA 3NI7A 4B1RA 2XGEA 3VVZA 4ABZA 5D18A 3LSRA 5GPAA 2HQ5A 2RASA 3O8HA 4W1UA 4ME9A 2RAEA 3BTJA 5HSZA 3BJBA 3BTIA 5C4YA 4CGRA 2HYTA 1VI0A 5F0FA 2FJ1A 1T33A 2G0EA 1UI5A 4D7MA 4GCKA 5CXGA 4X1EA 2QTQA 3QBMA 1T56A 2GBYA 4D5FA 2UXOA 3S5RA 3VOKA 4D7NA 3VW1A 2QIBA 3BNIA 2D6YA 3CDLA 1JT6A 5CXIA 1QPIA 2HXIA 3Q0UA 3SDGA 2O7OA 3ZQLA 5F27A 3FK7A 3IH3A 1QVTA 3QPSA 2IU5A 3HTIA 2WUIA 4HKUA 3CJDA 1UI6A 3BR1A 3AQTA 2Y31A 2DTZA 3B6CA 3NXCA 1U9OA 3VP5A 2GUHA 3VOXA 4AC6A 2XGCA 2FX0A 2QWTA 3VW2A 2VPRA 3LOCA 2VKEA 3BHQA 2DG7A 3E7QA 4I6ZA 3VPRA 3KZ9A 2IAIA 3F1BA 3BCGA 3Q0WA 3C07A 2ID6A 3FK6A 2QKOA 2XDNA 3HGYA 3FRQA 2GENA 2UXPA 3CRJA 3ZQHA 3F0CA 2G7SA 3C2BA 3PPBA 1Z0XA 2X9DA 2JK3A 2V57A 3VVYA 4MK6A 1JUSA 2VKVA 3DEWA 3ON4A 3NNRA 3VIBA 1ZK8A 3ZQGA 1RPWA 2ZB9A 3QQAA 4B3AA 1ZKGA 5F0HA 5J1UA 5FGLA 2QOPA 2G7LA 5F1JA 2ZCXA 3BR6A 3BRUA 2RHAA 1JUPA 4AC0A 5J1RA 5K58A 2ZOZA 3VVXA 5FMPA 1A6IA 4GFLA 3BTCA 2XPVA 3AQSA 2TRTA 3G1LA 2OF7A 3ANGA 1QVUA 3BR0A 4DW6A 4MXMA 5IP6A 5IPAA 3P9TA 5F04A 2FD5A 5K7FA 4JL3A 2NS7A 4KWAA 3HIMA 3G1MA 3PM1A 3WHBA 2UXIA 2UXUA 2OI8A 2NP3A 5FKNA 2F07A 4UDSA 2XRLA 4AF5A 2WV1A 3ZQIA 5K7HA 3BR5A 3JSJA 2WGBA 4NN1A 3BT9A 2W53A 3LSPA 5HBUA 3IH2A 4D5CA 5D19A 2YVEA 4PXIA 3TP0A 4NELA 2FQ4A 5F08A 2G7GA 4JYKA 3G7RA 3MVPA 2YVHA 2DG8A 5FKMA 3HGGA 2G3BA 4M3GA 2TCTA 4GCTA 2EH3A 4ACIA 3HTAA 2UXHA 4I76A 3EGQA 4V2GA 4M3EA 5FHPA 4YZEA 5J1YA 5EZGA 2QCOA 2XGDA 3IH4A 3T6NA 3B81A 2HKUA 5AQCA 2ID3A 3CCYA 2FBQA 3COLA 3VUQA 3DPJA 4GFKA 3NRGA 4M3DA 2X6OA 4M3FA 5CW8A 5EFYA 1ORKA 2GFNA 3WHCA 5FKOA 2HXOA 3LSJA 3QKXA 3QPLA 3Q0VA 5FKKA 3G1OA 3V78A 4G12A 4ICHA 3V6GA 2NS8A 3IUVA 3HE0A 3HTJA 3BQZA 2NP5A 3LWJA 2ZCNA 3DCFA 3O8GA 3Q3SA 3ON2A 4AUXA 3G56A 3PASA 2OPTA 2HYJA 2Q24A 3FIWA 5HAWA 3GEUA 4W97A 1RKTA 2REKA 4MO7A 3TP3A 3SFIA 5K7ZA 1SGMA 5IOZA 3RH2A 5J3LA 3BR3A 3KNWA 3GZIA 3KKCA 5GPCA 3LJLA 2XPUA 4V2FA 4JKZA 2Y2ZA 4M3BA 1RKWA 1Z77A 1BJZA 5DAJA 3BTLA 3VW0A 2IEKA 2PBXA 3NPIA 1U9NA 2JJ7A 3BR2A 4L62A 3B6AA 3CWRA 1JUMA 2O7TA 3ZQFA 2Y30A 3LHQA 2XB5A 5FKLA 2I10A 5GP9A 2NX4A 3HTHA 5EYRA
chains in the Genus database with same CATH superfamily
1JTYA 4XK4A 4JNNA 1JT0A 2OERA 5F0CA 5H9TA 5EZHA 3BQYA 1JTXA 2XPWA 3EUPA 3KKDA 3RD3A 2ZOYA 3MNLA 5D1RA 2PZ9A 5IOYA 3SWHA 4GCLA 3O60A 3ANPA 2ZCMA 2IBDA 3NI7A 4B1RA 2XGEA 3VTIA 3VVZA 4ABZA 5D18A 3LSRA 5GPAA 2HQ5A 2RASA 3O8HA 4W1UA 4ME9A 2RAEA 3BTJA 5HSZA 3BJBA 3BTIA 5C4YA 4CGRA 2HYTA 1VI0A 5F0FA 2FJ1A 3FHNA 4IRVA 1T33A 2G0EA 1UI5A 4D7MA 4GCKA 5CXGA 4X1EA 4DVYP 2QTQA 3QBMA 1T56A 2GBYA 4D5FA 2UXOA 3S5RA 3VOKA 4D7NA 3VW1A 2QIBA 3BNIA 2D6YA 3CDLA 1JT6A 5CXIA 5CQGA 1QPIA 2HXIA 3Q0UA 3SDGA 2A2FX 2O7OA 3ZQLA 5F27A 3FK7A 3IH3A 1QVTA 3QPSA 2IU5A 3HTIA 2WUIA 4HKUA 3CJDA 1UI6A 3BR1A 3AQTA 2Y31A 2DTZA 3B6CA 3NXCA 1U9OA 3VP5A 2GUHA 3VOXA 4AC6A 3NS4A 2XGCA 2FX0A 2QWTA 3VW2A 2VPRA 3LOCA 2ZY9A 2R7WA 2VKEA 3BHQA 2DG7A 3E7QA 4I6ZA 3VPRA 3KZ9A 2IAIA 3F1BA 3BCGA 2B3WA 3Q0WA 3C07A 2ID6A 3FK6A 2QKOA 2XDNA 3HGYA 3FRQA 2GENA 2UXPA 3CRJA 3ZQHA 3F0CA 2G7SA 3C2BA 3PPBA 1Z0XA 2R7TA 2X9DA 2JK3A 2V57A 3VVYA 4MK6A 1JUSA 2VKVA 3DEWA 3ON4A 3NNRA 3VIBA 1ZK8A 3ZQGA 1RPWA 2ZB9A 3QQAA 4B3AA 2R7SA 1ZKGA 2R7RA 5F0HA 5J1UA 5FGLA 2QOPA 2G7LA 5F1JA 2ZCXA 3BR6A 3BRUA 4OD5A 2RHAA 1JUPA 4AC0A 5J1RA 5K58A 2ZOZA 3VVXA 5FMPA 1A6IA 4GFLA 3BTCA 2XPVA 3AQSA 2TRTA 3G1LA 2OF7A 3ANGA 1QVUA 3BR0A 4U9LA 4DW6A 4MXMA 5IP6A 5IPAA 3P9TA 5F04A 2FJI1 2FD5A 5K7FA 4JL3A 2NS7A 2YVXA 4KWAA 3HIMA 3G1MA 3PM1A 3WHBA 2UXIA 2UXUA 2OI8A 2NP3A 5FKNA 2F07A 4UDSA 4U9NA 2XRLA 4AF5A 2WV1A 3ZQIA 5K7HA 3BR5A 3DU6A 3JSJA 2WGBA 4NN1A 3BT9A 2W53A 3LSPA 5HBUA 3IH2A 4D5CA 5D19A 2YVEA 4PXIA 3TP0A 4NELA 4C2MA 2FQ4A 5F08A 2G7GA 4JYKA 3G7RA 3MVPA 2YVHA 2DG8A 5FKMA 3HGGA 2R7OA 2G3BA 4M3GA 2TCTA 4GCTA 2EH3A 4ACIA 3HTAA 2UXHA 2PFVA 4I76A 3EGQA 4V2GA 4M3EA 5FHPA 4YZEA 5J1YA 5EZGA 2QCOA 2XGDA 3IH4A 3T6NA 3B81A 2HKUA 5AQCA 2ID3A 3CCYA 2R7VA 2FBQA 3COLA 3VUQA 3DPJA 2B1EA 4GFKA 3NRGA 4M3DA 2X6OA 4M3FA 5CW8A 5EFYA 1ORKA 2GFNA 4WIBA 3WHCA 5FKOA 2HXOA 3LSJA 3QKXA 3QPLA 3Q0VA 5FKKA 3G1OA 3V78A 4G12A 4ICHA 3V6GA 2NS8A 2R7QA 3IUVA 3HE0A 3HTJA 3BQZA 2NP5A 3LWJA 2ZCNA 3DCFA 3O8GA 3Q3SA 3ON2A 4AUXA 3G56A 3PASA 2OPTA 2HYJA 2Q24A 4OD4A 3FIWA 5HAWA 3GEUA 3KYLA 4W97A 1RKTA 2REKA 4MO7A 3TP3A 3SFIA 5K7ZA 1SGMA 5IOZA 3RH2A 5J3LA 3BR3A 3KNWA 3GZIA 3KKCA 5GPCA 3LJLA 2R7UA 2XPUA 3K8PC 4V2FA 4JKZA 2Y2ZA 4M3BA 1RKWA 1Z77A 1BJZA 5DAJA 3BTLA 3VW0A 2IEKA 2PBXA 3NPIA 1U9NA 2JJ7A 3BR2A 4L62A 3B6AA 3CWRA 3DU5A 1JUMA 2O7TA 3ZQFA 2Y30A 3LHQA 2R7XA 2XB5A 5FKLA 2I10A 5GP9A 2NX4A 3HTHA 5EYRA
chains in the Genus database with same CATH topology
1JTYA 4XK4A 4JNNA 1JT0A 2OERA 5F0CA 5H9TA 5EZHA 3BQYA 1JTXA 2XPWA 3EUPA 3KKDA 3RD3A 2ZOYA 3MNLA 5D1RA 2PZ9A 5IOYA 4GCLA 3O60A 3ANPA 2ZCMA 2IBDA 3NI7A 4B1RA 2XGEA 3VVZA 4ABZA 5D18A 3LSRA 5GPAA 2HQ5A 2RASA 3O8HA 4W1UA 4ME9A 2RAEA 3BTJA 5HSZA 3BJBA 3BTIA 5C4YA 4CGRA 2HYTA 1VI0A 5F0FA 2FJ1A 1T33A 2G0EA 1UI5A 4D7MA 4GCKA 5CXGA 4X1EA 2QTQA 3QBMA 1T56A 2GBYA 4D5FA 2UXOA 3S5RA 3VOKA 4D7NA 3VW1A 2QIBA 3BNIA 2D6YA 3CDLA 1JT6A 5CXIA 1QPIA 2HXIA 3Q0UA 3SDGA 2O7OA 3ZQLA 5F27A 3FK7A 3IH3A 1QVTA 3QPSA 2IU5A 3HTIA 2WUIA 4HKUA 3CJDA 1UI6A 3BR1A 3AQTA 2Y31A 2DTZA 3B6CA 3NXCA 1U9OA 3VP5A 2GUHA 3VOXA 4AC6A 2XGCA 2FX0A 2QWTA 3VW2A 2VPRA 3LOCA 2VKEA 3BHQA 2DG7A 3E7QA 4I6ZA 3VPRA 3KZ9A 2IAIA 3F1BA 3BCGA 3Q0WA 3C07A 2ID6A 3FK6A 2QKOA 2XDNA 3HGYA 3FRQA 2GENA 2UXPA 3CRJA 3ZQHA 3F0CA 2G7SA 3C2BA 3PPBA 1Z0XA 2X9DA 2JK3A 2V57A 3VVYA 4MK6A 1JUSA 2VKVA 3DEWA 3ON4A 3NNRA 3VIBA 1ZK8A 3ZQGA 1RPWA 2ZB9A 3QQAA 4B3AA 1ZKGA 5F0HA 5J1UA 5FGLA 2QOPA 2G7LA 5F1JA 2ZCXA 3BR6A 3BRUA 2RHAA 1JUPA 4AC0A 5J1RA 5K58A 2ZOZA 3VVXA 5FMPA 1A6IA 4GFLA 3BTCA 2XPVA 3AQSA 2TRTA 3G1LA 2OF7A 3ANGA 1QVUA 3BR0A 4DW6A 4MXMA 5IP6A 5IPAA 3P9TA 5F04A 2FD5A 5K7FA 4JL3A 2NS7A 4KWAA 3HIMA 3G1MA 3PM1A 3WHBA 2UXIA 2UXUA 2OI8A 2NP3A 5FKNA 2F07A 4UDSA 2XRLA 4AF5A 2WV1A 3ZQIA 5K7HA 3BR5A 3JSJA 2WGBA 4NN1A 3BT9A 2W53A 3LSPA 5HBUA 3IH2A 4D5CA 5D19A 2YVEA 4PXIA 3TP0A 4NELA 2FQ4A 5F08A 2G7GA 4JYKA 3G7RA 3MVPA 2YVHA 2DG8A 5FKMA 3HGGA 2G3BA 4M3GA 2TCTA 4GCTA 2EH3A 4ACIA 3HTAA 2UXHA 4I76A 3EGQA 4V2GA 4M3EA 5FHPA 4YZEA 5J1YA 5EZGA 2QCOA 2XGDA 3IH4A 3T6NA 3B81A 2HKUA 5AQCA 2ID3A 3CCYA 2FBQA 3COLA 3VUQA 3DPJA 4GFKA 3NRGA 4M3DA 2X6OA 4M3FA 5CW8A 5EFYA 1ORKA 2GFNA 3WHCA 5FKOA 2HXOA 3LSJA 3QKXA 3QPLA 3Q0VA 5FKKA 3G1OA 3V78A 4G12A 4ICHA 3V6GA 2NS8A 3IUVA 3HE0A 3HTJA 3BQZA 2NP5A 3LWJA 2ZCNA 3DCFA 3O8GA 3Q3SA 3ON2A 4AUXA 3G56A 3PASA 2OPTA 2HYJA 2Q24A 3FIWA 5HAWA 3GEUA 4W97A 1RKTA 2REKA 4MO7A 3TP3A 3SFIA 5K7ZA 1SGMA 5IOZA 3RH2A 5J3LA 3BR3A 3KNWA 3GZIA 3KKCA 5GPCA 3LJLA 2XPUA 4V2FA 4JKZA 2Y2ZA 4M3BA 1RKWA 1Z77A 1BJZA 5DAJA 3BTLA 3VW0A 2IEKA 2PBXA 3NPIA 1U9NA 2JJ7A 3BR2A 4L62A 3B6AA 3CWRA 1JUMA 2O7TA 3ZQFA 2Y30A 3LHQA 2XB5A 5FKLA 2I10A 5GP9A 2NX4A 3HTHA 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTY A;  4XK4 A;  4JNN A;  1JT0 A;  2OER A;  5F0C A;  5H9T A;  5EZH A;  3BQY A;  1JTX A;  2XPW A;  3EUP A;  3KKD A;  3RD3 A;  2ZOY A;  3MNL A;  5D1R A;  2PZ9 A;  5IOY A;  4GCL A;  3O60 A;  3ANP A;  2ZCM A;  2IBD A;  3NI7 A;  4B1R A;  2XGE A;  3VVZ A;  4ABZ A;  5D18 A;  3LSR A;  5GPA A;  2HQ5 A;  2RAS A;  3O8H A;  4W1U A;  4ME9 A;  2RAE A;  3BTJ A;  5HSZ A;  3BJB A;  3BTI A;  5C4Y A;  4CGR A;  2HYT A;  1VI0 A;  5F0F A;  2FJ1 A;  1T33 A;  2G0E A;  1UI5 A;  4D7M A;  4GCK A;  5CXG A;  4X1E A;  2QTQ A;  3QBM A;  1T56 A;  2GBY A;  4D5F A;  2UXO A;  3S5R A;  3VOK A;  4D7N A;  3VW1 A;  2QIB A;  3BNI A;  2D6Y A;  3CDL A;  1JT6 A;  5CXI A;  1QPI A;  2HXI A;  3Q0U A;  3SDG A;  2O7O A;  3ZQL A;  5F27 A;  3FK7 A;  3IH3 A;  1QVT A;  3QPS A;  2IU5 A;  3HTI A;  2WUI A;  4HKU A;  3CJD A;  1UI6 A;  3BR1 A;  3AQT A;  2Y31 A;  2DTZ A;  3B6C A;  3NXC A;  1U9O A;  3VP5 A;  2GUH A;  3VOX A;  4AC6 A;  2XGC A;  2FX0 A;  2QWT A;  3VW2 A;  2VPR A;  3LOC A;  2VKE A;  3BHQ A;  2DG7 A;  3E7Q A;  4I6Z A;  3VPR A;  3KZ9 A;  2IAI A;  3F1B A;  3BCG A;  3Q0W A;  3C07 A;  2ID6 A;  3FK6 A;  2QKO A;  2XDN A;  3HGY A;  3FRQ A;  2GEN A;  2UXP A;  3CRJ A;  3ZQH A;  3F0C A;  2G7S A;  3C2B A;  3PPB A;  1Z0X A;  2X9D A;  2JK3 A;  2V57 A;  3VVY A;  4MK6 A;  1JUS A;  2VKV A;  3DEW A;  3ON4 A;  3NNR A;  3VIB A;  1ZK8 A;  3ZQG A;  1RPW A;  2ZB9 A;  3QQA A;  4B3A A;  1ZKG A;  5F0H A;  5J1U A;  5FGL A;  2QOP A;  2G7L A;  5F1J A;  2ZCX A;  3BR6 A;  3BRU A;  2RHA A;  1JUP A;  4AC0 A;  5J1R A;  5K58 A;  2ZOZ A;  3VVX A;  5FMP A;  1A6I A;  4GFL A;  3BTC A;  2XPV A;  3AQS A;  2TRT A;  3G1L A;  2OF7 A;  3ANG A;  1QVU A;  3BR0 A;  4DW6 A;  4MXM A;  5IP6 A;  5IPA A;  3P9T A;  5F04 A;  2FD5 A;  5K7F A;  4JL3 A;  2NS7 A;  4KWA A;  3HIM A;  3G1M A;  3PM1 A;  3WHB A;  2UXI A;  2UXU A;  2OI8 A;  2NP3 A;  5FKN A;  2F07 A;  4UDS A;  2XRL A;  4AF5 A;  2WV1 A;  3ZQI A;  5K7H A;  3BR5 A;  3JSJ A;  2WGB A;  4NN1 A;  3BT9 A;  2W53 A;  3LSP A;  5HBU A;  3IH2 A;  4D5C A;  5D19 A;  2YVE A;  4PXI A;  3TP0 A;  4NEL A;  2FQ4 A;  5F08 A;  2G7G A;  4JYK A;  3G7R A;  3MVP A;  2YVH A;  2DG8 A;  5FKM A;  3HGG A;  2G3B A;  4M3G A;  2TCT A;  4GCT A;  2EH3 A;  4ACI A;  3HTA A;  2UXH A;  4I76 A;  3EGQ A;  4V2G A;  4M3E A;  5FHP A;  4YZE A;  5J1Y A;  5EZG A;  2QCO A;  2XGD A;  3IH4 A;  3T6N A;  3B81 A;  2HKU A;  5AQC A;  2ID3 A;  3CCY A;  2FBQ A;  3COL A;  3VUQ A;  3DPJ A;  4GFK A;  3NRG A;  4M3D A;  2X6O A;  4M3F A;  5CW8 A;  5EFY A;  1ORK A;  2GFN A;  3WHC A;  5FKO A;  2HXO A;  3LSJ A;  3QKX A;  3QPL A;  3Q0V A;  5FKK A;  3G1O A;  3V78 A;  4G12 A;  4ICH A;  3V6G A;  2NS8 A;  3IUV A;  3HE0 A;  3HTJ A;  3BQZ A;  2NP5 A;  3LWJ A;  2ZCN A;  3DCF A;  3O8G A;  3Q3S A;  3ON2 A;  4AUX A;  3G56 A;  3PAS A;  2OPT A;  2HYJ A;  2Q24 A;  3FIW A;  5HAW A;  3GEU A;  4W97 A;  1RKT A;  2REK A;  4MO7 A;  3TP3 A;  3SFI A;  5K7Z A;  1SGM A;  5IOZ A;  3RH2 A;  5J3L A;  3BR3 A;  3KNW A;  3GZI A;  3KKC A;  5GPC A;  3LJL A;  2XPU A;  4V2F A;  4JKZ A;  2Y2Z A;  4M3B A;  1RKW A;  1Z77 A;  1BJZ A;  5DAJ A;  3BTL A;  3VW0 A;  2IEK A;  2PBX A;  3NPI A;  1U9N A;  2JJ7 A;  3BR2 A;  4L62 A;  3B6A A;  3CWR A;  1JUM A;  2O7T A;  3ZQF A;  2Y30 A;  3LHQ A;  2XB5 A;  5FKL A;  2I10 A;  5GP9 A;  2NX4 A;  3HTH A;  5EYR A; 
#chains in the Genus database with same CATH topology
 1JTY A;  4XK4 A;  4JNN A;  1JT0 A;  2OER A;  5F0C A;  5H9T A;  5EZH A;  3BQY A;  1JTX A;  2XPW A;  3EUP A;  3KKD A;  3RD3 A;  2ZOY A;  3MNL A;  5D1R A;  2PZ9 A;  5IOY A;  3SWH A;  4GCL A;  3O60 A;  3ANP A;  2ZCM A;  2IBD A;  3NI7 A;  4B1R A;  2XGE A;  3VTI A;  3VVZ A;  4ABZ A;  5D18 A;  3LSR A;  5GPA A;  2HQ5 A;  2RAS A;  3O8H A;  4W1U A;  4ME9 A;  2RAE A;  3BTJ A;  5HSZ A;  3BJB A;  3BTI A;  5C4Y A;  4CGR A;  2HYT A;  1VI0 A;  5F0F A;  2FJ1 A;  3FHN A;  4IRV A;  1T33 A;  2G0E A;  1UI5 A;  4D7M A;  4GCK A;  5CXG A;  4X1E A;  4DVY P;  2QTQ A;  3QBM A;  1T56 A;  2GBY A;  4D5F A;  2UXO A;  3S5R A;  3VOK A;  4D7N A;  3VW1 A;  2QIB A;  3BNI A;  2D6Y A;  3CDL A;  1JT6 A;  5CXI A;  5CQG A;  1QPI A;  2HXI A;  3Q0U A;  3SDG A;  2A2F X;  2O7O A;  3ZQL A;  5F27 A;  3FK7 A;  3IH3 A;  1QVT A;  3QPS A;  2IU5 A;  3HTI A;  2WUI A;  4HKU A;  3CJD A;  1UI6 A;  3BR1 A;  3AQT A;  2Y31 A;  2DTZ A;  3B6C A;  3NXC A;  1U9O A;  3VP5 A;  2GUH A;  3VOX A;  4AC6 A;  3NS4 A;  2XGC A;  2FX0 A;  2QWT A;  3VW2 A;  2VPR A;  3LOC A;  2ZY9 A;  2R7W A;  2VKE A;  3BHQ A;  2DG7 A;  3E7Q A;  4I6Z A;  3VPR A;  3KZ9 A;  2IAI A;  3F1B A;  3BCG A;  2B3W A;  3Q0W A;  3C07 A;  2ID6 A;  3FK6 A;  2QKO A;  2XDN A;  3HGY A;  3FRQ A;  2GEN A;  2UXP A;  3CRJ A;  3ZQH A;  3F0C A;  2G7S A;  3C2B A;  3PPB A;  1Z0X A;  2R7T A;  2X9D A;  2JK3 A;  2V57 A;  3VVY A;  4MK6 A;  1JUS A;  2VKV A;  3DEW A;  3ON4 A;  3NNR A;  3VIB A;  1ZK8 A;  3ZQG A;  1RPW A;  2ZB9 A;  3QQA A;  4B3A A;  2R7S A;  1ZKG A;  2R7R A;  5F0H A;  5J1U A;  5FGL A;  2QOP A;  2G7L A;  5F1J A;  2ZCX A;  3BR6 A;  3BRU A;  4OD5 A;  2RHA A;  1JUP A;  4AC0 A;  5J1R A;  5K58 A;  2ZOZ A;  3VVX A;  5FMP A;  1A6I A;  4GFL A;  3BTC A;  2XPV A;  3AQS A;  2TRT A;  3G1L A;  2OF7 A;  3ANG A;  1QVU A;  3BR0 A;  4U9L A;  4DW6 A;  4MXM A;  5IP6 A;  5IPA A;  3P9T A;  5F04 A;  2FJI 1;  2FD5 A;  5K7F A;  4JL3 A;  2NS7 A;  2YVX A;  4KWA A;  3HIM A;  3G1M A;  3PM1 A;  3WHB A;  2UXI A;  2UXU A;  2OI8 A;  2NP3 A;  5FKN A;  2F07 A;  4UDS A;  4U9N A;  2XRL A;  4AF5 A;  2WV1 A;  3ZQI A;  5K7H A;  3BR5 A;  3DU6 A;  3JSJ A;  2WGB A;  4NN1 A;  3BT9 A;  2W53 A;  3LSP A;  5HBU A;  3IH2 A;  4D5C A;  5D19 A;  2YVE A;  4PXI A;  3TP0 A;  4NEL A;  4C2M A;  2FQ4 A;  5F08 A;  2G7G A;  4JYK A;  3G7R A;  3MVP A;  2YVH A;  2DG8 A;  5FKM A;  3HGG A;  2R7O A;  2G3B A;  4M3G A;  2TCT A;  4GCT A;  2EH3 A;  4ACI A;  3HTA A;  2UXH A;  2PFV A;  4I76 A;  3EGQ A;  4V2G A;  4M3E A;  5FHP A;  4YZE A;  5J1Y A;  5EZG A;  2QCO A;  2XGD A;  3IH4 A;  3T6N A;  3B81 A;  2HKU A;  5AQC A;  2ID3 A;  3CCY A;  2R7V A;  2FBQ A;  3COL A;  3VUQ A;  3DPJ A;  2B1E A;  4GFK A;  3NRG A;  4M3D A;  2X6O A;  4M3F A;  5CW8 A;  5EFY A;  1ORK A;  2GFN A;  4WIB A;  3WHC A;  5FKO A;  2HXO A;  3LSJ A;  3QKX A;  3QPL A;  3Q0V A;  5FKK A;  3G1O A;  3V78 A;  4G12 A;  4ICH A;  3V6G A;  2NS8 A;  2R7Q A;  3IUV A;  3HE0 A;  3HTJ A;  3BQZ A;  2NP5 A;  3LWJ A;  2ZCN A;  3DCF A;  3O8G A;  3Q3S A;  3ON2 A;  4AUX A;  3G56 A;  3PAS A;  2OPT A;  2HYJ A;  2Q24 A;  4OD4 A;  3FIW A;  5HAW A;  3GEU A;  3KYL A;  4W97 A;  1RKT A;  2REK A;  4MO7 A;  3TP3 A;  3SFI A;  5K7Z A;  1SGM A;  5IOZ A;  3RH2 A;  5J3L A;  3BR3 A;  3KNW A;  3GZI A;  3KKC A;  5GPC A;  3LJL A;  2R7U A;  2XPU A;  3K8P C;  4V2F A;  4JKZ A;  2Y2Z A;  4M3B A;  1RKW A;  1Z77 A;  1BJZ A;  5DAJ A;  3BTL A;  3VW0 A;  2IEK A;  2PBX A;  3NPI A;  1U9N A;  2JJ7 A;  3BR2 A;  4L62 A;  3B6A A;  3CWR A;  3DU5 A;  1JUM A;  2O7T A;  3ZQF A;  2Y30 A;  3LHQ A;  2R7X A;  2XB5 A;  5FKL A;  2I10 A;  5GP9 A;  2NX4 A;  3HTH A;  5EYR A; 
#chains in the Genus database with same CATH homology
 1JTY A;  4XK4 A;  4JNN A;  1JT0 A;  2OER A;  5F0C A;  5H9T A;  5EZH A;  3BQY A;  1JTX A;  2XPW A;  3EUP A;  3KKD A;  3RD3 A;  2ZOY A;  3MNL A;  5D1R A;  2PZ9 A;  5IOY A;  4GCL A;  3O60 A;  3ANP A;  2ZCM A;  2IBD A;  3NI7 A;  4B1R A;  2XGE A;  3VVZ A;  4ABZ A;  5D18 A;  3LSR A;  5GPA A;  2HQ5 A;  2RAS A;  3O8H A;  4W1U A;  4ME9 A;  2RAE A;  3BTJ A;  5HSZ A;  3BJB A;  3BTI A;  5C4Y A;  4CGR A;  2HYT A;  1VI0 A;  5F0F A;  2FJ1 A;  1T33 A;  2G0E A;  1UI5 A;  4D7M A;  4GCK A;  5CXG A;  4X1E A;  2QTQ A;  3QBM A;  1T56 A;  2GBY A;  4D5F A;  2UXO A;  3S5R A;  3VOK A;  4D7N A;  3VW1 A;  2QIB A;  3BNI A;  2D6Y A;  3CDL A;  1JT6 A;  5CXI A;  1QPI A;  2HXI A;  3Q0U A;  3SDG A;  2O7O A;  3ZQL A;  5F27 A;  3FK7 A;  3IH3 A;  1QVT A;  3QPS A;  2IU5 A;  3HTI A;  2WUI A;  4HKU A;  3CJD A;  1UI6 A;  3BR1 A;  3AQT A;  2Y31 A;  2DTZ A;  3B6C A;  3NXC A;  1U9O A;  3VP5 A;  2GUH A;  3VOX A;  4AC6 A;  2XGC A;  2FX0 A;  2QWT A;  3VW2 A;  2VPR A;  3LOC A;  2VKE A;  3BHQ A;  2DG7 A;  3E7Q A;  4I6Z A;  3VPR A;  3KZ9 A;  2IAI A;  3F1B A;  3BCG A;  3Q0W A;  3C07 A;  2ID6 A;  3FK6 A;  2QKO A;  2XDN A;  3HGY A;  3FRQ A;  2GEN A;  2UXP A;  3CRJ A;  3ZQH A;  3F0C A;  2G7S A;  3C2B A;  3PPB A;  1Z0X A;  2X9D A;  2JK3 A;  2V57 A;  3VVY A;  4MK6 A;  1JUS A;  2VKV A;  3DEW A;  3ON4 A;  3NNR A;  3VIB A;  1ZK8 A;  3ZQG A;  1RPW A;  2ZB9 A;  3QQA A;  4B3A A;  1ZKG A;  5F0H A;  5J1U A;  5FGL A;  2QOP A;  2G7L A;  5F1J A;  2ZCX A;  3BR6 A;  3BRU A;  2RHA A;  1JUP A;  4AC0 A;  5J1R A;  5K58 A;  2ZOZ A;  3VVX A;  5FMP A;  1A6I A;  4GFL A;  3BTC A;  2XPV A;  3AQS A;  2TRT A;  3G1L A;  2OF7 A;  3ANG A;  1QVU A;  3BR0 A;  4DW6 A;  4MXM A;  5IP6 A;  5IPA A;  3P9T A;  5F04 A;  2FD5 A;  5K7F A;  4JL3 A;  2NS7 A;  4KWA A;  3HIM A;  3G1M A;  3PM1 A;  3WHB A;  2UXI A;  2UXU A;  2OI8 A;  2NP3 A;  5FKN A;  2F07 A;  4UDS A;  2XRL A;  4AF5 A;  2WV1 A;  3ZQI A;  5K7H A;  3BR5 A;  3JSJ A;  2WGB A;  4NN1 A;  3BT9 A;  2W53 A;  3LSP A;  5HBU A;  3IH2 A;  4D5C A;  5D19 A;  2YVE A;  4PXI A;  3TP0 A;  4NEL A;  2FQ4 A;  5F08 A;  2G7G A;  4JYK A;  3G7R A;  3MVP A;  2YVH A;  2DG8 A;  5FKM A;  3HGG A;  2G3B A;  4M3G A;  2TCT A;  4GCT A;  2EH3 A;  4ACI A;  3HTA A;  2UXH A;  4I76 A;  3EGQ A;  4V2G A;  4M3E A;  5FHP A;  4YZE A;  5J1Y A;  5EZG A;  2QCO A;  2XGD A;  3IH4 A;  3T6N A;  3B81 A;  2HKU A;  5AQC A;  2ID3 A;  3CCY A;  2FBQ A;  3COL A;  3VUQ A;  3DPJ A;  4GFK A;  3NRG A;  4M3D A;  2X6O A;  4M3F A;  5CW8 A;  5EFY A;  1ORK A;  2GFN A;  3WHC A;  5FKO A;  2HXO A;  3LSJ A;  3QKX A;  3QPL A;  3Q0V A;  5FKK A;  3G1O A;  3V78 A;  4G12 A;  4ICH A;  3V6G A;  2NS8 A;  3IUV A;  3HE0 A;  3HTJ A;  3BQZ A;  2NP5 A;  3LWJ A;  2ZCN A;  3DCF A;  3O8G A;  3Q3S A;  3ON2 A;  4AUX A;  3G56 A;  3PAS A;  2OPT A;  2HYJ A;  2Q24 A;  3FIW A;  5HAW A;  3GEU A;  4W97 A;  1RKT A;  2REK A;  4MO7 A;  3TP3 A;  3SFI A;  5K7Z A;  1SGM A;  5IOZ A;  3RH2 A;  5J3L A;  3BR3 A;  3KNW A;  3GZI A;  3KKC A;  5GPC A;  3LJL A;  2XPU A;  4V2F A;  4JKZ A;  2Y2Z A;  4M3B A;  1RKW A;  1Z77 A;  1BJZ A;  5DAJ A;  3BTL A;  3VW0 A;  2IEK A;  2PBX A;  3NPI A;  1U9N A;  2JJ7 A;  3BR2 A;  4L62 A;  3B6A A;  3CWR A;  1JUM A;  2O7T A;  3ZQF A;  2Y30 A;  3LHQ A;  2XB5 A;  5FKL A;  2I10 A;  5GP9 A;  2NX4 A;  3HTH A;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...