2HKUA

Structural genomics, the crystal structure of a putative transcriptional regulator from rhodococcus sp. rha1
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
191
structure length
191
Chain Sequence
QTRDALFTAATELFLEHGEGVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAEDDAATAETVGDYTEKLVGSLLGPGAPSVELFTSAMLMTGRRSELRDLITDTLRTLHSSGEVALIRTLMRTGWQLRAGIDVESKAFWSAIFGLVIQKTATGESFGYSLEEAVAVIFANLQIPETVRNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords A putative transcriptional regulator
publication title The crystal structure of a transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
total genus 79
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16914 TetR_C_12 Bacterial transcriptional repressor C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hkuA00
5D19A 3ZQIA 2FX0A 3IUVA 2QIBA 3IH2A 3VW0A 4KWAA 5K7FA 2PZ9A 4GCTA 2QTQA 3DPJA 2XGCA 5FGLA 2W53A 3PPBA 3IH3A 3BTCA 3LJLA 1QPIA 2GFNA 5EYRA 2G0EA 4JNNA 3ZQLA 3BR6A 2XGDA 2XPVA 3CRJA 3LSJA 2Q24A 3ON4A 3QKXA 3ZQGA 3BR5A 3BCGA 3G1LA 1U9OA 2ZB9A 4M3FA 2HYTA 3HIMA 1VI0A 2RAEA 2YVHA 2XPUA 3B6AA 2OI8A 3BR2A 4AC0A 3PM1A 4ACIA 3JSJA 3G56A 1JUSA 3VIBA 2FQ4A 2VPRA 2IU5A 2Y2ZA 2OERA 3Q0UA 2EH3A 2G7SA 2ID3A 3NXCA 3P9TA 5J1UA 1ZKGA 3PASA 3ANGA 5C4YA 3BR0A 2G3BA 3AQSA 4GFLA 4V2GA 3TP0A 2HXIA 3O8GA 2G7LA 4JYKA 1Z77A 3BRUA 2WUIA 5D1RA 2ZOZA 2O7TA 5GPAA 4GCKA 2G7GA 3VUQA 3KKDA 5FKLA 5H9TA 3CWRA 2I10A 2FJ1A 2IAIA 5F1JA 2XGEA 2OPTA 2XDNA 4YZEA 3LSRA 3NRGA 2Y30A 3VP5A 3RH2A 3ANPA 2IEKA 3FK7A 3HGGA 2DTZA 3C2BA 2Y31A 2V57A 5CW8A 3CDLA 4ABZA 3LSPA 3QPLA 3VW2A 2HKUA 3Q3SA 3HGYA 3V6GA 2QKOA 5J1YA 3EUPA 5F0HA 3QBMA 3F1BA 5K7ZA 3BQYA 2ZOYA 4MK6A 3COLA 3BT9A 2HQ5A 5EFYA 3B81A 5IOZA 4JL3A 5J3LA 3BNIA 4AUXA 5K7HA 4GFKA 4DW6A 3KZ9A 1RKTA 4D7NA 4M3EA 1QVUA 3HTHA 3CJDA 1T33A 2NP3A 4I6ZA 5FKMA 4G12A 2DG7A 2UXUA 2REKA 5IOYA 3Q0WA 3ON2A 2TRTA 5F04A 3QQAA 1SGMA 4B1RA 2UXIA 3HTIA 5F27A 3SDGA 2IBDA 3DCFA 1ZK8A 2UXHA 2O7OA 3VW1A 4HKUA 1A6IA 2NS7A 3BTLA 2ID6A 2X9DA 2ZCXA 3HTJA 3G7RA 1RKWA 2GENA 5CXGA 1JUPA 3DEWA 4MXMA 3LWJA 2XPWA 3FIWA 4W1UA 3NPIA 4M3DA 2VKVA 3HE0A 4B3AA 2FD5A 2VKEA 4D7MA 3MVPA 3C07A 5F0CA 3F0CA 5AQCA 3NI7A 3CCYA 1ORKA 3T6NA 4V2FA 3O8HA 4M3BA 3BTIA 2HYJA 2X6OA 3ZQHA 3VVZA 3VVYA 5GPCA 4PXIA 3Q0VA 2GBYA 3LOCA 2PBXA 2NS8A 5HAWA 1BJZA 3BQZA 2WGBA 1U9NA 3AQTA 4X1EA 2NX4A 3EGQA 2DG8A 3B6CA 3BR3A 3MNLA 2QWTA 4AC6A 2RHAA 4CGRA 5IP6A 2UXOA 2XB5A 3BTJA 1UI6A 4MO7A 2WV1A 5J1RA 5CXIA 5HSZA 4W97A 2JJ7A 3QPSA 3G1OA 5IPAA 3HTAA 1QVTA 2D6YA 2YVEA 5EZHA 4XK4A 3VOKA 5FHPA 3VVXA 4D5FA 2QOPA 3WHBA 1RPWA 1JTYA 4D5CA 2OF7A 2F07A 3G1MA 2ZCMA 3BR1A 3WHCA 2NP5A 5D18A 5DAJA 3S5RA 3LHQA 2ZCNA 4L62A 3FK6A 5FMPA 3NNRA 2FBQA 4AF5A 3E7QA 5EZGA 5K58A 3TP3A 3V78A 1UI5A 2JK3A 3O60A 5FKKA 4UDSA 1JTXA 3GZIA 3FRQA 4GCLA 3BJBA 3KKCA 4NELA 2XRLA 3GEUA 5FKNA 4JKZA 1JT0A 3VOXA 2QCOA 4NN1A 3BHQA 1JT6A 1JUMA 3RD3A 4ME9A 4I76A 5F08A 5F0FA 2GUHA 3IH4A 5HBUA 4ICHA 3ZQFA 1Z0XA 5GP9A 3KNWA 4M3GA 2UXPA 1T56A 2RASA 3SFIA 5FKOA 2TCTA 3VPRA 2HXOA
chains in the Genus database with same CATH superfamily
5D19A 3ZQIA 2FX0A 3IUVA 2QIBA 3IH2A 3VW0A 4KWAA 5K7FA 2PZ9A 3NS4A 4GCTA 2QTQA 3DPJA 2B3WA 2XGCA 5FGLA 2W53A 3PPBA 4OD5A 3IH3A 3BTCA 3LJLA 1QPIA 2GFNA 5EYRA 2G0EA 4JNNA 3ZQLA 3BR6A 2XGDA 2XPVA 3CRJA 3LSJA 2Q24A 3ON4A 3QKXA 3ZQGA 3BR5A 3BCGA 3G1LA 1U9OA 2R7VA 2ZB9A 4M3FA 2HYTA 2ZY9A 1VI0A 3HIMA 2RAEA 2YVHA 2XPUA 3B6AA 2OI8A 3BR2A 4AC0A 3PM1A 4ACIA 3JSJA 3G56A 1JUSA 3VIBA 2FQ4A 4U9NA 2VPRA 2IU5A 2Y2ZA 2OERA 3Q0UA 2EH3A 2G7SA 2ID3A 3NXCA 3P9TA 5J1UA 5CQGA 1ZKGA 3PASA 3ANGA 5C4YA 3BR0A 2G3BA 3AQSA 4GFLA 4V2GA 3TP0A 2HXIA 3O8GA 2G7LA 4JYKA 4WIBA 1Z77A 3BRUA 2WUIA 5D1RA 2ZOZA 2O7TA 5GPAA 4GCKA 2G7GA 3VUQA 3KKDA 5FKLA 2R7QA 5H9TA 3CWRA 2I10A 2FJ1A 2IAIA 5F1JA 2XGEA 2OPTA 2XDNA 4YZEA 3LSRA 3NRGA 2Y30A 3VP5A 3RH2A 3ANPA 2IEKA 3FK7A 3HGGA 2DTZA 3C2BA 2Y31A 2V57A 5CW8A 3CDLA 4ABZA 3LSPA 2FJI1 3QPLA 3VW2A 2HKUA 3Q3SA 3HGYA 3V6GA 2QKOA 5J1YA 3EUPA 5F0HA 3QBMA 3F1BA 5K7ZA 3BQYA 2ZOYA 4MK6A 3COLA 3BT9A 2HQ5A 5EFYA 3B81A 5IOZA 4JL3A 5J3LA 2R7UA 3BNIA 4AUXA 5K7HA 4GFKA 4DW6A 3KZ9A 1RKTA 4D7NA 4M3EA 1QVUA 3HTHA 3CJDA 1T33A 2NP3A 4I6ZA 5FKMA 4G12A 2DG7A 2UXUA 2REKA 5IOYA 3Q0WA 3ON2A 2TRTA 5F04A 3QQAA 2R7SA 1SGMA 4B1RA 2UXIA 3HTIA 5F27A 3SDGA 2IBDA 3DCFA 2R7WA 1ZK8A 2UXHA 2O7OA 3VW1A 4HKUA 1A6IA 2NS7A 3BTLA 2ID6A 2X9DA 2ZCXA 3HTJA 3G7RA 1RKWA 2GENA 3SWHA 5CXGA 4C2MA 1JUPA 3DEWA 4MXMA 3FHNA 2R7XA 3LWJA 2XPWA 3FIWA 4W1UA 3NPIA 3K8PC 4M3DA 2VKVA 3HE0A 4B3AA 2FD5A 2VKEA 4D7MA 3MVPA 3C07A 5F0CA 3F0CA 5AQCA 3NI7A 3CCYA 1ORKA 3T6NA 4V2FA 3O8HA 4M3BA 3BTIA 2HYJA 2X6OA 3ZQHA 3VVZA 3VVYA 4OD4A 5GPCA 4U9LA 4PXIA 3Q0VA 2R7RA 2GBYA 3LOCA 2PBXA 2NS8A 3VTIA 1BJZA 5HAWA 3BQZA 2WGBA 2B1EA 1U9NA 3DU5A 2R7OA 3AQTA 4X1EA 2NX4A 3EGQA 2DG8A 3DU6A 3B6CA 3BR3A 3MNLA 2QWTA 4AC6A 2RHAA 4CGRA 5IP6A 2UXOA 2XB5A 3BTJA 1UI6A 4MO7A 2WV1A 5J1RA 5CXIA 5HSZA 4W97A 2JJ7A 3QPSA 3G1OA 5IPAA 3HTAA 1QVTA 2D6YA 2YVEA 5EZHA 4XK4A 3VOKA 5FHPA 3VVXA 4D5FA 4DVYP 2QOPA 3WHBA 1RPWA 1JTYA 4D5CA 2OF7A 2F07A 3G1MA 2ZCMA 3BR1A 3WHCA 2NP5A 5D18A 5DAJA 3S5RA 2PFVA 3LHQA 2A2FX 2ZCNA 4L62A 3FK6A 5FMPA 3NNRA 2FBQA 4AF5A 3KYLA 3E7QA 5EZGA 5K58A 3TP3A 3V78A 1UI5A 2JK3A 3O60A 5FKKA 4UDSA 1JTXA 3GZIA 3FRQA 4GCLA 3BJBA 3KKCA 4NELA 2XRLA 3GEUA 5FKNA 4JKZA 1JT0A 3VOXA 2QCOA 4NN1A 3BHQA 1JT6A 1JUMA 3RD3A 4ME9A 4I76A 4IRVA 5F08A 5F0FA 2GUHA 3IH4A 5HBUA 4ICHA 3ZQFA 1Z0XA 5GP9A 2YVXA 3KNWA 4M3GA 2UXPA 2R7TA 1T56A 2RASA 3SFIA 5FKOA 2TCTA 3VPRA 2HXOA
chains in the Genus database with same CATH topology
5D19A 3ZQIA 2FX0A 3IUVA 2QIBA 3IH2A 3VW0A 4KWAA 5K7FA 2PZ9A 4GCTA 2QTQA 3DPJA 2XGCA 5FGLA 2W53A 3PPBA 3IH3A 3BTCA 3LJLA 1QPIA 2GFNA 5EYRA 2G0EA 4JNNA 3ZQLA 3BR6A 2XGDA 2XPVA 3CRJA 3LSJA 2Q24A 3ON4A 3QKXA 3ZQGA 3BR5A 3BCGA 3G1LA 1U9OA 2ZB9A 4M3FA 2HYTA 3HIMA 1VI0A 2RAEA 2YVHA 2XPUA 3B6AA 2OI8A 3BR2A 4AC0A 3PM1A 4ACIA 3JSJA 3G56A 1JUSA 3VIBA 2FQ4A 2VPRA 2IU5A 2Y2ZA 2OERA 3Q0UA 2EH3A 2G7SA 2ID3A 3NXCA 3P9TA 5J1UA 1ZKGA 3PASA 3ANGA 5C4YA 3BR0A 2G3BA 3AQSA 4GFLA 4V2GA 3TP0A 2HXIA 3O8GA 2G7LA 4JYKA 1Z77A 3BRUA 2WUIA 5D1RA 2ZOZA 2O7TA 5GPAA 4GCKA 2G7GA 3VUQA 3KKDA 5FKLA 5H9TA 3CWRA 2I10A 2FJ1A 2IAIA 5F1JA 2XGEA 2OPTA 2XDNA 4YZEA 3LSRA 3NRGA 2Y30A 3VP5A 3RH2A 3ANPA 2IEKA 3FK7A 3HGGA 2DTZA 3C2BA 2Y31A 2V57A 5CW8A 3CDLA 4ABZA 3LSPA 3QPLA 3VW2A 2HKUA 3Q3SA 3HGYA 3V6GA 2QKOA 5J1YA 3EUPA 5F0HA 3QBMA 3F1BA 5K7ZA 3BQYA 2ZOYA 4MK6A 3COLA 3BT9A 2HQ5A 5EFYA 3B81A 5IOZA 4JL3A 5J3LA 3BNIA 4AUXA 5K7HA 4GFKA 4DW6A 3KZ9A 1RKTA 4D7NA 4M3EA 1QVUA 3HTHA 3CJDA 1T33A 2NP3A 4I6ZA 5FKMA 4G12A 2DG7A 2UXUA 2REKA 5IOYA 3Q0WA 3ON2A 2TRTA 5F04A 3QQAA 1SGMA 4B1RA 2UXIA 3HTIA 5F27A 3SDGA 2IBDA 3DCFA 1ZK8A 2UXHA 2O7OA 3VW1A 4HKUA 1A6IA 2NS7A 3BTLA 2ID6A 2X9DA 2ZCXA 3HTJA 3G7RA 1RKWA 2GENA 5CXGA 1JUPA 3DEWA 4MXMA 3LWJA 2XPWA 3FIWA 4W1UA 3NPIA 4M3DA 2VKVA 3HE0A 4B3AA 2FD5A 2VKEA 4D7MA 3MVPA 3C07A 5F0CA 3F0CA 5AQCA 3NI7A 3CCYA 1ORKA 3T6NA 4V2FA 3O8HA 4M3BA 3BTIA 2HYJA 2X6OA 3ZQHA 3VVZA 3VVYA 5GPCA 4PXIA 3Q0VA 2GBYA 3LOCA 2PBXA 2NS8A 5HAWA 1BJZA 3BQZA 2WGBA 1U9NA 3AQTA 4X1EA 2NX4A 3EGQA 2DG8A 3B6CA 3BR3A 3MNLA 2QWTA 4AC6A 2RHAA 4CGRA 5IP6A 2UXOA 2XB5A 3BTJA 1UI6A 4MO7A 2WV1A 5J1RA 5CXIA 5HSZA 4W97A 2JJ7A 3QPSA 3G1OA 5IPAA 3HTAA 1QVTA 2D6YA 2YVEA 5EZHA 4XK4A 3VOKA 5FHPA 3VVXA 4D5FA 2QOPA 3WHBA 1RPWA 1JTYA 4D5CA 2OF7A 2F07A 3G1MA 2ZCMA 3BR1A 3WHCA 2NP5A 5D18A 5DAJA 3S5RA 3LHQA 2ZCNA 4L62A 3FK6A 5FMPA 3NNRA 2FBQA 4AF5A 3E7QA 5EZGA 5K58A 3TP3A 3V78A 1UI5A 2JK3A 3O60A 5FKKA 4UDSA 1JTXA 3GZIA 3FRQA 4GCLA 3BJBA 3KKCA 4NELA 2XRLA 3GEUA 5FKNA 4JKZA 1JT0A 3VOXA 2QCOA 4NN1A 3BHQA 1JT6A 1JUMA 3RD3A 4ME9A 4I76A 5F08A 5F0FA 2GUHA 3IH4A 5HBUA 4ICHA 3ZQFA 1Z0XA 5GP9A 3KNWA 4M3GA 2UXPA 1T56A 2RASA 3SFIA 5FKOA 2TCTA 3VPRA 2HXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D19 A;  3ZQI A;  2FX0 A;  3IUV A;  2QIB A;  3IH2 A;  3VW0 A;  4KWA A;  5K7F A;  2PZ9 A;  4GCT A;  2QTQ A;  3DPJ A;  2XGC A;  5FGL A;  2W53 A;  3PPB A;  3IH3 A;  3BTC A;  3LJL A;  1QPI A;  2GFN A;  5EYR A;  2G0E A;  4JNN A;  3ZQL A;  3BR6 A;  2XGD A;  2XPV A;  3CRJ A;  3LSJ A;  2Q24 A;  3ON4 A;  3QKX A;  3ZQG A;  3BR5 A;  3BCG A;  3G1L A;  1U9O A;  2ZB9 A;  4M3F A;  2HYT A;  3HIM A;  1VI0 A;  2RAE A;  2YVH A;  2XPU A;  3B6A A;  2OI8 A;  3BR2 A;  4AC0 A;  3PM1 A;  4ACI A;  3JSJ A;  3G56 A;  1JUS A;  3VIB A;  2FQ4 A;  2VPR A;  2IU5 A;  2Y2Z A;  2OER A;  3Q0U A;  2EH3 A;  2G7S A;  2ID3 A;  3NXC A;  3P9T A;  5J1U A;  1ZKG A;  3PAS A;  3ANG A;  5C4Y A;  3BR0 A;  2G3B A;  3AQS A;  4GFL A;  4V2G A;  3TP0 A;  2HXI A;  3O8G A;  2G7L A;  4JYK A;  1Z77 A;  3BRU A;  2WUI A;  5D1R A;  2ZOZ A;  2O7T A;  5GPA A;  4GCK A;  2G7G A;  3VUQ A;  3KKD A;  5FKL A;  5H9T A;  3CWR A;  2I10 A;  2FJ1 A;  2IAI A;  5F1J A;  2XGE A;  2OPT A;  2XDN A;  4YZE A;  3LSR A;  3NRG A;  2Y30 A;  3VP5 A;  3RH2 A;  3ANP A;  2IEK A;  3FK7 A;  3HGG A;  2DTZ A;  3C2B A;  2Y31 A;  2V57 A;  5CW8 A;  3CDL A;  4ABZ A;  3LSP A;  3QPL A;  3VW2 A;  2HKU A;  3Q3S A;  3HGY A;  3V6G A;  2QKO A;  5J1Y A;  3EUP A;  5F0H A;  3QBM A;  3F1B A;  5K7Z A;  3BQY A;  2ZOY A;  4MK6 A;  3COL A;  3BT9 A;  2HQ5 A;  5EFY A;  3B81 A;  5IOZ A;  4JL3 A;  5J3L A;  3BNI A;  4AUX A;  5K7H A;  4GFK A;  4DW6 A;  3KZ9 A;  1RKT A;  4D7N A;  4M3E A;  1QVU A;  3HTH A;  3CJD A;  1T33 A;  2NP3 A;  4I6Z A;  5FKM A;  4G12 A;  2DG7 A;  2UXU A;  2REK A;  5IOY A;  3Q0W A;  3ON2 A;  2TRT A;  5F04 A;  3QQA A;  1SGM A;  4B1R A;  2UXI A;  3HTI A;  5F27 A;  3SDG A;  2IBD A;  3DCF A;  1ZK8 A;  2UXH A;  2O7O A;  3VW1 A;  4HKU A;  1A6I A;  2NS7 A;  3BTL A;  2ID6 A;  2X9D A;  2ZCX A;  3HTJ A;  3G7R A;  1RKW A;  2GEN A;  5CXG A;  1JUP A;  3DEW A;  4MXM A;  3LWJ A;  2XPW A;  3FIW A;  4W1U A;  3NPI A;  4M3D A;  2VKV A;  3HE0 A;  4B3A A;  2FD5 A;  2VKE A;  4D7M A;  3MVP A;  3C07 A;  5F0C A;  3F0C A;  5AQC A;  3NI7 A;  3CCY A;  1ORK A;  3T6N A;  4V2F A;  3O8H A;  4M3B A;  3BTI A;  2HYJ A;  2X6O A;  3ZQH A;  3VVZ A;  3VVY A;  5GPC A;  4PXI A;  3Q0V A;  2GBY A;  3LOC A;  2PBX A;  2NS8 A;  5HAW A;  1BJZ A;  3BQZ A;  2WGB A;  1U9N A;  3AQT A;  4X1E A;  2NX4 A;  3EGQ A;  2DG8 A;  3B6C A;  3BR3 A;  3MNL A;  2QWT A;  4AC6 A;  2RHA A;  4CGR A;  5IP6 A;  2UXO A;  2XB5 A;  3BTJ A;  1UI6 A;  4MO7 A;  2WV1 A;  5J1R A;  5CXI A;  5HSZ A;  4W97 A;  2JJ7 A;  3QPS A;  3G1O A;  5IPA A;  3HTA A;  1QVT A;  2D6Y A;  2YVE A;  5EZH A;  4XK4 A;  3VOK A;  5FHP A;  3VVX A;  4D5F A;  2QOP A;  3WHB A;  1RPW A;  1JTY A;  4D5C A;  2OF7 A;  2F07 A;  3G1M A;  2ZCM A;  3BR1 A;  3WHC A;  2NP5 A;  5D18 A;  5DAJ A;  3S5R A;  3LHQ A;  2ZCN A;  4L62 A;  3FK6 A;  5FMP A;  3NNR A;  2FBQ A;  4AF5 A;  3E7Q A;  5EZG A;  5K58 A;  3TP3 A;  3V78 A;  1UI5 A;  2JK3 A;  3O60 A;  5FKK A;  4UDS A;  1JTX A;  3GZI A;  3FRQ A;  4GCL A;  3BJB A;  3KKC A;  4NEL A;  2XRL A;  3GEU A;  5FKN A;  4JKZ A;  1JT0 A;  3VOX A;  2QCO A;  4NN1 A;  3BHQ A;  1JT6 A;  1JUM A;  3RD3 A;  4ME9 A;  4I76 A;  5F08 A;  5F0F A;  2GUH A;  3IH4 A;  5HBU A;  4ICH A;  3ZQF A;  1Z0X A;  5GP9 A;  3KNW A;  4M3G A;  2UXP A;  1T56 A;  2RAS A;  3SFI A;  5FKO A;  2TCT A;  3VPR A;  2HXO A; 
#chains in the Genus database with same CATH topology
 5D19 A;  3ZQI A;  2FX0 A;  3IUV A;  2QIB A;  3IH2 A;  3VW0 A;  4KWA A;  5K7F A;  2PZ9 A;  3NS4 A;  4GCT A;  2QTQ A;  3DPJ A;  2B3W A;  2XGC A;  5FGL A;  2W53 A;  3PPB A;  4OD5 A;  3IH3 A;  3BTC A;  3LJL A;  1QPI A;  2GFN A;  5EYR A;  2G0E A;  4JNN A;  3ZQL A;  3BR6 A;  2XGD A;  2XPV A;  3CRJ A;  3LSJ A;  2Q24 A;  3ON4 A;  3QKX A;  3ZQG A;  3BR5 A;  3BCG A;  3G1L A;  1U9O A;  2R7V A;  2ZB9 A;  4M3F A;  2HYT A;  2ZY9 A;  1VI0 A;  3HIM A;  2RAE A;  2YVH A;  2XPU A;  3B6A A;  2OI8 A;  3BR2 A;  4AC0 A;  3PM1 A;  4ACI A;  3JSJ A;  3G56 A;  1JUS A;  3VIB A;  2FQ4 A;  4U9N A;  2VPR A;  2IU5 A;  2Y2Z A;  2OER A;  3Q0U A;  2EH3 A;  2G7S A;  2ID3 A;  3NXC A;  3P9T A;  5J1U A;  5CQG A;  1ZKG A;  3PAS A;  3ANG A;  5C4Y A;  3BR0 A;  2G3B A;  3AQS A;  4GFL A;  4V2G A;  3TP0 A;  2HXI A;  3O8G A;  2G7L A;  4JYK A;  4WIB A;  1Z77 A;  3BRU A;  2WUI A;  5D1R A;  2ZOZ A;  2O7T A;  5GPA A;  4GCK A;  2G7G A;  3VUQ A;  3KKD A;  5FKL A;  2R7Q A;  5H9T A;  3CWR A;  2I10 A;  2FJ1 A;  2IAI A;  5F1J A;  2XGE A;  2OPT A;  2XDN A;  4YZE A;  3LSR A;  3NRG A;  2Y30 A;  3VP5 A;  3RH2 A;  3ANP A;  2IEK A;  3FK7 A;  3HGG A;  2DTZ A;  3C2B A;  2Y31 A;  2V57 A;  5CW8 A;  3CDL A;  4ABZ A;  3LSP A;  2FJI 1;  3QPL A;  3VW2 A;  2HKU A;  3Q3S A;  3HGY A;  3V6G A;  2QKO A;  5J1Y A;  3EUP A;  5F0H A;  3QBM A;  3F1B A;  5K7Z A;  3BQY A;  2ZOY A;  4MK6 A;  3COL A;  3BT9 A;  2HQ5 A;  5EFY A;  3B81 A;  5IOZ A;  4JL3 A;  5J3L A;  2R7U A;  3BNI A;  4AUX A;  5K7H A;  4GFK A;  4DW6 A;  3KZ9 A;  1RKT A;  4D7N A;  4M3E A;  1QVU A;  3HTH A;  3CJD A;  1T33 A;  2NP3 A;  4I6Z A;  5FKM A;  4G12 A;  2DG7 A;  2UXU A;  2REK A;  5IOY A;  3Q0W A;  3ON2 A;  2TRT A;  5F04 A;  3QQA A;  2R7S A;  1SGM A;  4B1R A;  2UXI A;  3HTI A;  5F27 A;  3SDG A;  2IBD A;  3DCF A;  2R7W A;  1ZK8 A;  2UXH A;  2O7O A;  3VW1 A;  4HKU A;  1A6I A;  2NS7 A;  3BTL A;  2ID6 A;  2X9D A;  2ZCX A;  3HTJ A;  3G7R A;  1RKW A;  2GEN A;  3SWH A;  5CXG A;  4C2M A;  1JUP A;  3DEW A;  4MXM A;  3FHN A;  2R7X A;  3LWJ A;  2XPW A;  3FIW A;  4W1U A;  3NPI A;  3K8P C;  4M3D A;  2VKV A;  3HE0 A;  4B3A A;  2FD5 A;  2VKE A;  4D7M A;  3MVP A;  3C07 A;  5F0C A;  3F0C A;  5AQC A;  3NI7 A;  3CCY A;  1ORK A;  3T6N A;  4V2F A;  3O8H A;  4M3B A;  3BTI A;  2HYJ A;  2X6O A;  3ZQH A;  3VVZ A;  3VVY A;  4OD4 A;  5GPC A;  4U9L A;  4PXI A;  3Q0V A;  2R7R A;  2GBY A;  3LOC A;  2PBX A;  2NS8 A;  3VTI A;  1BJZ A;  5HAW A;  3BQZ A;  2WGB A;  2B1E A;  1U9N A;  3DU5 A;  2R7O A;  3AQT A;  4X1E A;  2NX4 A;  3EGQ A;  2DG8 A;  3DU6 A;  3B6C A;  3BR3 A;  3MNL A;  2QWT A;  4AC6 A;  2RHA A;  4CGR A;  5IP6 A;  2UXO A;  2XB5 A;  3BTJ A;  1UI6 A;  4MO7 A;  2WV1 A;  5J1R A;  5CXI A;  5HSZ A;  4W97 A;  2JJ7 A;  3QPS A;  3G1O A;  5IPA A;  3HTA A;  1QVT A;  2D6Y A;  2YVE A;  5EZH A;  4XK4 A;  3VOK A;  5FHP A;  3VVX A;  4D5F A;  4DVY P;  2QOP A;  3WHB A;  1RPW A;  1JTY A;  4D5C A;  2OF7 A;  2F07 A;  3G1M A;  2ZCM A;  3BR1 A;  3WHC A;  2NP5 A;  5D18 A;  5DAJ A;  3S5R A;  2PFV A;  3LHQ A;  2A2F X;  2ZCN A;  4L62 A;  3FK6 A;  5FMP A;  3NNR A;  2FBQ A;  4AF5 A;  3KYL A;  3E7Q A;  5EZG A;  5K58 A;  3TP3 A;  3V78 A;  1UI5 A;  2JK3 A;  3O60 A;  5FKK A;  4UDS A;  1JTX A;  3GZI A;  3FRQ A;  4GCL A;  3BJB A;  3KKC A;  4NEL A;  2XRL A;  3GEU A;  5FKN A;  4JKZ A;  1JT0 A;  3VOX A;  2QCO A;  4NN1 A;  3BHQ A;  1JT6 A;  1JUM A;  3RD3 A;  4ME9 A;  4I76 A;  4IRV A;  5F08 A;  5F0F A;  2GUH A;  3IH4 A;  5HBU A;  4ICH A;  3ZQF A;  1Z0X A;  5GP9 A;  2YVX A;  3KNW A;  4M3G A;  2UXP A;  2R7T A;  1T56 A;  2RAS A;  3SFI A;  5FKO A;  2TCT A;  3VPR A;  2HXO A; 
#chains in the Genus database with same CATH homology
 5D19 A;  3ZQI A;  2FX0 A;  3IUV A;  2QIB A;  3IH2 A;  3VW0 A;  4KWA A;  5K7F A;  2PZ9 A;  4GCT A;  2QTQ A;  3DPJ A;  2XGC A;  5FGL A;  2W53 A;  3PPB A;  3IH3 A;  3BTC A;  3LJL A;  1QPI A;  2GFN A;  5EYR A;  2G0E A;  4JNN A;  3ZQL A;  3BR6 A;  2XGD A;  2XPV A;  3CRJ A;  3LSJ A;  2Q24 A;  3ON4 A;  3QKX A;  3ZQG A;  3BR5 A;  3BCG A;  3G1L A;  1U9O A;  2ZB9 A;  4M3F A;  2HYT A;  3HIM A;  1VI0 A;  2RAE A;  2YVH A;  2XPU A;  3B6A A;  2OI8 A;  3BR2 A;  4AC0 A;  3PM1 A;  4ACI A;  3JSJ A;  3G56 A;  1JUS A;  3VIB A;  2FQ4 A;  2VPR A;  2IU5 A;  2Y2Z A;  2OER A;  3Q0U A;  2EH3 A;  2G7S A;  2ID3 A;  3NXC A;  3P9T A;  5J1U A;  1ZKG A;  3PAS A;  3ANG A;  5C4Y A;  3BR0 A;  2G3B A;  3AQS A;  4GFL A;  4V2G A;  3TP0 A;  2HXI A;  3O8G A;  2G7L A;  4JYK A;  1Z77 A;  3BRU A;  2WUI A;  5D1R A;  2ZOZ A;  2O7T A;  5GPA A;  4GCK A;  2G7G A;  3VUQ A;  3KKD A;  5FKL A;  5H9T A;  3CWR A;  2I10 A;  2FJ1 A;  2IAI A;  5F1J A;  2XGE A;  2OPT A;  2XDN A;  4YZE A;  3LSR A;  3NRG A;  2Y30 A;  3VP5 A;  3RH2 A;  3ANP A;  2IEK A;  3FK7 A;  3HGG A;  2DTZ A;  3C2B A;  2Y31 A;  2V57 A;  5CW8 A;  3CDL A;  4ABZ A;  3LSP A;  3QPL A;  3VW2 A;  2HKU A;  3Q3S A;  3HGY A;  3V6G A;  2QKO A;  5J1Y A;  3EUP A;  5F0H A;  3QBM A;  3F1B A;  5K7Z A;  3BQY A;  2ZOY A;  4MK6 A;  3COL A;  3BT9 A;  2HQ5 A;  5EFY A;  3B81 A;  5IOZ A;  4JL3 A;  5J3L A;  3BNI A;  4AUX A;  5K7H A;  4GFK A;  4DW6 A;  3KZ9 A;  1RKT A;  4D7N A;  4M3E A;  1QVU A;  3HTH A;  3CJD A;  1T33 A;  2NP3 A;  4I6Z A;  5FKM A;  4G12 A;  2DG7 A;  2UXU A;  2REK A;  5IOY A;  3Q0W A;  3ON2 A;  2TRT A;  5F04 A;  3QQA A;  1SGM A;  4B1R A;  2UXI A;  3HTI A;  5F27 A;  3SDG A;  2IBD A;  3DCF A;  1ZK8 A;  2UXH A;  2O7O A;  3VW1 A;  4HKU A;  1A6I A;  2NS7 A;  3BTL A;  2ID6 A;  2X9D A;  2ZCX A;  3HTJ A;  3G7R A;  1RKW A;  2GEN A;  5CXG A;  1JUP A;  3DEW A;  4MXM A;  3LWJ A;  2XPW A;  3FIW A;  4W1U A;  3NPI A;  4M3D A;  2VKV A;  3HE0 A;  4B3A A;  2FD5 A;  2VKE A;  4D7M A;  3MVP A;  3C07 A;  5F0C A;  3F0C A;  5AQC A;  3NI7 A;  3CCY A;  1ORK A;  3T6N A;  4V2F A;  3O8H A;  4M3B A;  3BTI A;  2HYJ A;  2X6O A;  3ZQH A;  3VVZ A;  3VVY A;  5GPC A;  4PXI A;  3Q0V A;  2GBY A;  3LOC A;  2PBX A;  2NS8 A;  5HAW A;  1BJZ A;  3BQZ A;  2WGB A;  1U9N A;  3AQT A;  4X1E A;  2NX4 A;  3EGQ A;  2DG8 A;  3B6C A;  3BR3 A;  3MNL A;  2QWT A;  4AC6 A;  2RHA A;  4CGR A;  5IP6 A;  2UXO A;  2XB5 A;  3BTJ A;  1UI6 A;  4MO7 A;  2WV1 A;  5J1R A;  5CXI A;  5HSZ A;  4W97 A;  2JJ7 A;  3QPS A;  3G1O A;  5IPA A;  3HTA A;  1QVT A;  2D6Y A;  2YVE A;  5EZH A;  4XK4 A;  3VOK A;  5FHP A;  3VVX A;  4D5F A;  2QOP A;  3WHB A;  1RPW A;  1JTY A;  4D5C A;  2OF7 A;  2F07 A;  3G1M A;  2ZCM A;  3BR1 A;  3WHC A;  2NP5 A;  5D18 A;  5DAJ A;  3S5R A;  3LHQ A;  2ZCN A;  4L62 A;  3FK6 A;  5FMP A;  3NNR A;  2FBQ A;  4AF5 A;  3E7Q A;  5EZG A;  5K58 A;  3TP3 A;  3V78 A;  1UI5 A;  2JK3 A;  3O60 A;  5FKK A;  4UDS A;  1JTX A;  3GZI A;  3FRQ A;  4GCL A;  3BJB A;  3KKC A;  4NEL A;  2XRL A;  3GEU A;  5FKN A;  4JKZ A;  1JT0 A;  3VOX A;  2QCO A;  4NN1 A;  3BHQ A;  1JT6 A;  1JUM A;  3RD3 A;  4ME9 A;  4I76 A;  5F08 A;  5F0F A;  2GUH A;  3IH4 A;  5HBU A;  4ICH A;  3ZQF A;  1Z0X A;  5GP9 A;  3KNW A;  4M3G A;  2UXP A;  1T56 A;  2RAS A;  3SFI A;  5FKO A;  2TCT A;  3VPR A;  2HXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...