2Y30A

Simocyclinone d8 bound form of tetr-like repressor simr
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
242
structure length
227
Chain Sequence
EPVSIWMLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 85
structure length 227
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y30A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y30A02
4I6ZA 3HOXJ 1AU7A 3CJDA 5IP6A 2O7TA 5EGOA 4JKZA 5C4JJ 4RDUA 2ZOYA 1ZTRA 5FKMA 2XSDC 3VIBA 3ZQGA 2NP5A 2GFNA 5J1RA 2K40A 1ETVA 2DMQA 4ME9A 2JK3A 2M2EA 2VKVA 1JTXA 3FK7A 1WGXA 4X1EA 2DMTA 1IV6A 3FK6A 3D1NI 4L62A 3TEDA 3QPLA 2NVYJ 3JRGA 3CMYA 1G2HA 4A3JJ 2UXHA 2V57A 2DA2A 5JLXA 2GBYA 3FKIJ 3WHCA 2DA4A 2O7OA 4I76A 3BTCA 3SDGA 1JKPC 3VOKA 1H89C 2HOSA 2UXUA 3SFIA 3GTMJ 2XDNA 3DPJA 3Q3SA 3S14J 5E3OA 2R5YA 4V2GA 3NAUA 3FISA 4AC6A 3KZ9A 3S15J 2KT0A 3COLA 4DZJA 2CRGA 4XK4A 5DTDA 2E2HJ 3VW2A 3B6CA 1E3OC 3S1NJ 2M0CA 5FHPA 2LD5A 1OCTC 3HGYA 2WAQN 1MBGA 3QPSA 5GPAA 3IH3A 2ECCA 3H0GJ 5EG0A 1JUSA 5K58A 3BQZA 1XS9A 2K9SA 3EUPA 3QQAA 1P7IA 3CWRA 2XGEA 4AF5A 1TWAJ 2ECBA 1JKOC 3TP3A 3PO3J 3BG9A 3HGGA 2QF7A 5M5XJ 4MK6A 1A5JA 2R5ZB 3OSGA 1IRZA 3BRUA 2PMZN 3JRDA 1CQTA 3PPBA 2LY9A 2DG8A 3C2BA 3V78A 3QBMA 3LOCA 3LSPA 1TWFJ 4W1UA 1NTCA 4GFBA 1AHDP 2DA1A 5EFYA 3ZQIA 2OF7A 4M6VA 1SANA 3A02A 3E7LA 3HB9A 1PUFA 4A93J 3LWJA 3DCFA 5EZHA 3ZQLA 5E3NA 3Q0WA 4MLOA 4QSHA 5AQCA 2JA5J 5FKKA 1FTTA 1OCPA 2LVSA 1T56A 4BXXJ 3BG5A 1EF4A 1JTYA 2LK2A 1NK3P 3VP5A 3KKDA 5K7HA 4DYQA 2NVXJ 1U78A 2YU9J 3MKLA 3IH4A 3GEUA 1WH7A 3S16J 3L1PA 1X58A 3HE0A 3HTIA 2HQ5A 4A3BJ 2ME0A 3JRHA 2R92J 2HI3A 3B6AA 3BR1A 2QCOA 2X48A 3O60A 2Y30A 3EGQA 1TWGJ 2N8GA 1NK2P 5IPAA 4C3JJ 1B8IA 2UXPA 2VKEA 3HOZJ 5C4YA 4IHYA 5F08A 2OERA 2NOGA 1U9OA 4AC0A 1LE8A 4IHVA 2WB1N 1ETXA 3ZQHA 1MBKA 1JT0A 1AKHB 4JP0A 1JKRC 1WCMJ 1FIPA 2DMNA 3PM1A 5BNGA 2NX4A 1JJ8C 1BW5A 4CYCB 2L9RA 5IOYA 3BR2A 3S1RJ 2ZCMA 2XPUA 1W0TA 2FJ1A 4MO7A 3W6VA 2IAIA 3FRQA 1ZR2A 1U8BA 1IDZA 3BCGA 2EBIA 5IYBJ 4A3FJ 3JSJA 4D5CA 5M5YJ 1VFCA 3M4OJ 4UUTA 4FE4A 3G7RA 3HOVJ 1OJLA 3S2HJ 3NXCA 1FJLA 3MN2A 4YZEA 2KDZA 2F07A 1UMQA 4C3IJ 1D5YA 5GPCA 2GLOA 2O9LA 2O8KA 2JA7J 3ZQCA 2G7GA 2ZCXA 3VW1A 4GCLA 2CUFA 2H8RA 3UKGA 1IC8A 1GUUA 2Y9YA 4ABZA 2ZCNA 3JRCA 4A3GJ 4JX5A 3TP0A 3BHQA 2QTQA 3KKCA 1TWCJ 1IJWC 2W53A 2Y0SN 4L5EA 5K7FA 1UI5A 1S7EA 2L0KA 4BKXA 5FJ8J 3G1MA 4A3CJ 1BA5A 4GFLA 5HAWA 4BY1J 4NN1A 1JT6A 4A69C 3A01B 2G3BA 1WPKA 3K7AJ 4AYBN 5F1JA 1B72B 3JR9A 2X9DA 3S5RA 3QKXA 3HIMA 3O8GA 1GDTA 2CU7A 5F0HA 4JX6A 4FTHA 1JJ6C 3P9TA 1XG1A 2DA7A 3JRBA 2EZIA 2W48A 4FE7A 4JNNA 3TW6A 2CQXA 2HKUA 1GT0C 2LLKA 1A6IA 1ZQ3P 1I3QJ 5GP9A 1X2NA 2AHQA 3VVXA 3LJLA 4HNVA 3S2DJ 5H9TA 2NVQJ 2YVEA 2ID6A 2GENA 5M3MJ 1MSFC 1LFBA 1ETOA 1UG2A 2REKA 3Q0UA 3I4MJ 1ZR4A 1HOMA 3LSGA 2FQ4A 2FX0A 5FLVA 3A03A 1MBEA 1H88C 2XRLA 3HTHA 1BW6A 5FLMJ 4FCYA 4KWAA 5FKOA 4C3HJ 4IEJA 1YRNB 2MSYA 2RHAA 3ZQFA 2LP0A 3BR6A 3BT9A 1FEXA 1MH4A 2D5VA 4M3DA 1BL0A 3KNWA 4QTRA 2MW8A 2XPWA 3BNIA 2ME6A 4Y7NJ 2COBA 2G7LA 2ZB9A 2Q24A 5EGOB 3RD3A 2PZ9A 2QOPA 1SFOJ 3JRAA 4CGRA 5M5WJ 1RETA 4NELA 2XB5A 2NP3A 1MH3A 3BR0A 1Y1VJ 3VOXA 5JLWA 1Y1WJ 1JUPA 2GM4A 3C07A 2XB0X 1FTZA 1F36A 3A01A 3GTJJ 2R93J 1RR7A 3LSRA 3GTLJ 1P7JA 1IUFA 2M8GX 4UUSB 1HF0A 3G1LA 5J1UA 4D7MA 3NRGA 1QVTA 3CDLA 5FKLA 1MBHA 5DAJA 2HOAA 3MVPA 4QIWN 1TC3C 2DA5A 1DU0A 3NPIA 1GVDA 3M3YJ 3NI7A 3HBLA 2YVHA 3GTOJ 1ETYA 2DMPA 2JJ7A 1DU6A 4M3EA 4NDLA 4BY7J 1VF9A 4GFKA 3BJBA 1ETWA 3ZOBA 3ON4A 1WI3A 2R5YB 1ZKGA 9ANTA 4A3MJ 1X2MA 1K83J 5E3LA 1APLC 1HDPA 4AUXA 1I6HJ 2JWTA 5IP9J 1SGMA 3AQTA 5D18A 5D1RA 4ICHA 3ANGA 2ZOZA 2ID3A 2VUMJ 2B63J 2G0EA 3JRFA 2K9NA 3E7QA 4HKUA 3LSJA 4JL3A 2R5ZA 2FD5A 4DW6A 1MBJA 2WUIA 2Y9ZA 5F0FA 3ON2A 2EH3A 5HBUA 2AO9A 1JKQC 4XIDA 2DMUA 1K61A 3LHQA 1ETKA 5EG0B 4XRSA 1IG7A 2X6OA 2I10A 4BBRJ 4LOCA 4A3LJ 3GBGA 3B81A 2YS9A 3G1OA 2FBQA 3PASA 5EEAA 4IHXA 5FMPA 3RZOJ 5CXGA 3VVYA 2HXOA 1VNDA 2CQQA 3BR3A 1W0UA 1MSEC 3WHBA 2EQRA 3HKZN 2JA8J 1I50J 3HOWJ 2IBDA 2JMWA 4IHWA 1BJZA 1RPWA 4C2MJ 1JUMA 3CCYA 4V2FA 5DS9A 1ZK8A 3RZDJ 1Z0XA 2CUEA 4G12A 1UHSA 5J1YA 3HOUJ 4DZPA 4Y52J 1ITYA 1PUFB 3ANPA 5E3MA 3H3VK 2D6YA 2MGQA 3JRIA 2R7ZJ 3BTJA 2LKXA 2WV1A 5K7ZA 4UDSA 4B3AA 2NVTJ 3F1BA 2L7MP 1MNMC 5D19A 4RBOA 2HDDA 3F0CA 3O8HA 4UUSA 5C4XJ 5EDNA 2UXIA 3HDDA 2LR8A 2HOTA 3IUVA 2JN6A 1RESA 4GCKA 1QRYA 1RKTA 2EZLA 1R9TJ 3RKQA 2Y2ZA 4D7NA 3SJMA 4PXIA 1AKHA 1POGA 2EZHA 2L7ZA 4A3EJ 4B4CA 2YUSA 4DYCA 1TWHJ 3IH2A 1ETQA 1B8IB 5EYRA 5CW8A 4GCTA 4CYCA 2NS8A 2XGCA 2HYJA 2XGDA 3RH2A 1LE8B 3S1MJ 2QWTA 2OPTA 2RAEA 2R0QC 3HOYJ 5C3EJ 4JYKA 1HCRA 2E1OA 2ELKA 2M34A 4MXMA 5J3LA 5CXIA 1XC5A 1FIAA 3K2AA 2M9HA 2P81A 4J19A 4JX4A 1UI6A 3VUQA 2LFBA 2HXIA 2HYTA 4W97A 1Z77A 5IOZA 4XRSG 4X6AJ 3VPRA 2JA6J 2VPRA 4DYRA 2G7SA 3BTLA 1QVUA 4MFEA 1OFCX 3OIOA 3OOUA 3GTQJ 2VI6A 2PBXA 2E2JJ 4M3GA 5EF6A 3IV5A 4B1RA 1ENHA 2E2IJ 2GUHA 3BR5A 3NNRA 2CJJA 1U9NA 2E19A 2Y31A 3VW0A 4FISA 3PO2J 2QKOA 2TCTA 4XRMA 3CQZJ 3JREA 4A3DJ 3BG3A 4XICA 2RASA 4M3FA 1Q1VA 1IGNA 1B72A 5F0CA 5IYDJ 2DG7A 4MFDA 5HODA 1T33A 2WGBA 3VVZA 4D5FA 2EZKA 3GTKJ 1IDYA 1HDDC 2OI8A 3BTIA 2DTZA 5HSZA 5IYCJ 4M3BA 5M3FJ 2QIBA 1HLVA 2K9QA 3I4NJ 2IEKA 1QPIA 1H8AC 3V6GA 3DEWA 5F27A 2L7FP 5FGLA 4S0HB 1WH5A 1GV2A 4ACIA 2LTPA 5IP7J 1JGGA 2DA3A 3GTGJ 3GZIA 3HTJA 2UXOA 3HTAA 3CRJA 3Q0VA 3S17J 2NS7A 3HEFA 1F43A 3HM5A 4BBSJ 2IU5A 3BQYA 3LNQA 2H1KA 5FKNA 1MBFA 3RQIA 1RKWA 2DJNA 3FIWA 5F04A 3OSFA 3G56A 3NARA 4MIMA 3TW7A 1LFUP 1O4XA 4EEFG 3MNLA 4A3KJ 2MG4A 3AQSA 3S1QJ 5EZGA 1YRNA 3T6NA 1VI0A 2DA6A 5C44J 3GTPJ 2DN0A 2XPVA 1GV5A 4A3IJ 1ORKA 1ZGWA 2TRTA
chains in the Genus database with same CATH superfamily
1OYIA 2OC6A 3CJDA 4II3A 1TLHB 2BY1A 4U0YA 3LSHA 5C4JJ 4RDUA 3MKZA 2FF4A 2M7AA 1LVAA 3VIBA 3ZN0A 1YHQI 1SMYF 2A6TA 4CCJA 5J1RA 4KNYA 2QENA 5H2FC 2LDUA 2BHZA 4ME9A 2JK3A 2M2EA 1KZHA 3G71I 1T8IA 1JTXA 2GXGA 3DF8A 3FXOA 4ZZLA 2QEXI 1WVRA 2OUMA 4XLAA 3I5UA 3QPLA 5K1YA 4YIRX 3HRUA 5HDGA 3BJAA 1CF7A 2V57A 3OY9A 1A04A 2F5VA 3T1BA 1A6QA 1RR8C 5DD8A 3FKIJ 2DA4A 3I56I 4I76A 3CO6C 2IS1A 2ZBKA 2O8XA 3F8BA 1X4OA 1BI2A 3I3LA 2LRDA 4PUSA 2HOSA 2YX4A 3E6DA 3DPJA 1D5VA 3KLOA 2KRHA 4QWQA 1Z67A 1E2XA 3K4JA 1F4KA 1TW3A 3PQJA 4DNCA 2D1VA 1HKTA 4XLFA 2CRGA 4XK4A 4ZDPA 3SZTA 3T8TA 2X0LA 2OBPA 4XRFA 1LNWA 4CUGA 4DGWB 3IUOA 5BMZA 1OCTC 3WTWC 4WCGA 2XAQA 4M73A 2ECCA 3H0GJ 2DPDA 5K58A 5CQEA 1XS9A 1Z91A 3CWRA 1P7IA 2XGEA 3QP5A 5HS7A 2ECBA 3TP3A 1FLIA 1EJ9A 1R36A 3IAM2 3LA2A 3HGGA 3W2WA 1IRZA 2HOEA 1OR7C 2K4BA 2DG8A 4RA2A 5HS9A 2E1CA 1WFXA 3HIFA 1AWCA 3DV8A 1EH8A 3LOCA 4N9HA 2L54A 2LH9A 1FP1D 2NYXA 3QOPA 1NTCA 3WU1B 2XROA 5EFYA 5H20A 4PSXA 3ZQIA 2K86A 3LFKA 1MIJA 2OF7A 4M6VA 3A02A 3CZ6A 3HB9A 2A69F 3VB2A 4L9NA 3DCFA 5EZHA 3HSEA 5E3NA 3ZQLA 4GGGA 3N97A 2HDCA 1X1BA 4MLOA 2BHYA 4KUMA 5HDKA 5HLGA 2R7OA 3V42A 5FKKA 2BZTA 1T38A 1FTTA 3LAJA 2VKHA 2KRFA 3BG5A 3IC7A 2ELHA 2NVXJ 1U78A 4ENKA 3MKLA 5KHDA 2LMDA 1WH7A 1T0FC 1X58A 3ABLH 3TOBA 2BY2A 2XIGA 2IGKA 2ME0A 3TO9A 3LAPA 2QCOA 2X48A 3L2QA 2OV7A 3GVAA 2Z9OA 3FHNA 2Y30A 3VYUB 1TQPA 1IZ1A 1Z6TA 3ZR8X 2N8GA 4XMYA 3SEZA 4G7HF 1SAXA 2CV2A 2VKEA 4LLNA 1UHWA 2KISA 1ZG5A 5L3GA 1YJNI 1LE8A 1Z1DA 1YIOA 3CESA 5D8KB 4IRVA 3CF2A 2Z1DA 4Q4ZF 3RSNA 2NNYA 2OQGA 3G73A 2X1CA 3FBIB 2G9WA 2JT1A 4ENMA 3ASOH 4XSZF 3K4LA 3GXOA 3F23A 3EUAA 1FOXA 1P4AA 3QYEA 4OWRB 1T6SA 2PEXA 2E35A 2EBIA 5CKTA 3CUOA 4BHPA 5FRNA 3C2GA 5A2QZ 3CC2I 4CCOA 1VQMI 4AIKA 4YZEA 2VC0A 3CJQB 3TQNA 5KCMA 2WY7Q 1SEUA 3DPTA 1D5YA 2JA7J 2O8KA 1GLNA 2OD5A 4Q48A 3ZQCA 3J80Z 3DLAA 2ZCNA 1H9GA 4HDVA 5LGTA 3J7YJ 3QODA 3QAHA 1VQ8I 4A3GJ 3KKCA 3O2PE 1TWCJ 1IJWC 4Q47A 2Y0SN 4ZC3A 5IT3A 2L0KA 2DYRH 1WJDA 3HG9A 4XLNF 2E71A 4XN3A 2E36A 3HYIA 1JT6A 3VYTB 5BPIA 3BPXA 3PJRA 1H0MA 2XUBA 4A69C 1W7PB 1S7OA 3JTHA 1YYVA 3VDXA 4I09A 3JR9A 4O3MA 3FX3A 1ZELA 2ZNYA 2FA5A 2L7KA 3K4KA 4AIJA 1L3LA 2A61A 3CCUI 3B02A 1K6OA 5LEKA 2X6YA 1TP4A 2DA7A 2GXAA 3JRBA 2EZIA 4L18B 3K4MA 3RKYA 2VT2A 2R7WA 1G3WA 3W6JB 3DKXA 4DJAA 1A6IA 3BLYA 1XMKA 2FBHA 2K4JA 5GP9A 4Z2YA 4OINF 3VVXA 3TOAA 5KAFC 4KMFA 4BHCA 3G4SI 4P96A 3V7SA 2YVEA 1HW5A 4AWXB 4FQGA 3F3XA 2ID6A 4LG0B 1XCBA 2O5RA 1R23A 1PP7U 1ETOA 1UG2A 4G9YA 1N77A 2WY8Q 1ZREA 3CCVI 2REKA 4P9UA 5E79C 1KU7A 1ZR4A 1E3PA 2FQ4A 1YOVB 1MBEA 2XRLA 1KQ8A 1S8NA 3HTHA 5FLMJ 2F6CA 2KKOA 3COAC 4ZYDA 4C2MA 1FYMA 3LL7A 1TTYA 3PQKA 1YW7A 4YRVA 3CMAI 1X19A 3BT9A 2RNJA 3ZQ7A 1JE8A 2A2FX 3RJPA 3A0HC 4OU0A 5FD6A 3FXMA 4QTRA 5GAHJ 3AG2H 3BNIA 2ME6A 1FOWA 2V79A 3DPUA 3E6CC 2Q24A 2EIKH 4EQQA 1PDNC 4CGRA 1I39A 3CC7I 5FLXK 1C0WA 2FXAA 3MD2A 2L3DA 1MH3A 1DPUA 3BR0A 1Y1VJ 2HQNA 3GZ6A 3HHGA 3R60A 2HNHA 2XB0X 1D0ZA 3IKTA 3E6MA 1K7AA 3TGNA 4NNJA 1CF7B 3EYYA 1RR7A 1F9NA 2A5WA 3D5RC 1FOKA 3KEOA 4OAZA 1MGTA 4FT8A 2QYOA 3NRGA 1IRXA 3WTYC 3VWBA 5DAJA 4UVBA 2EA2A 3LSTA 4QIWN 2DA5A 2WB1A 1Z9CA 1W5CC 1FBQA 3REOA 3N05A 2E1MC 3M3YJ 4AM3A 3NI7A 2CFXA 3SHFA 3CD6I 1V54H 1ZKGA 9ANTA 1E17A 3DTKA 2H6CA 4ZYEA 2K85A 1SGMA 1KU3A 2ZOZA 2ID3A 2O61A 2VUMJ 2K9NA 1N25A 2QQAA 1P6RA 2F5CA 2A6HF 3K4BA 1QNTA 2QUFA 4ZH4F 1ZG1A 5FFXA 1G59A 4CGZA 3ZMZA 2IS2A 3GLLA 2GA2A 1K61A 1ETKA 4XRSA 2VQLA 3TO7A 4A3LJ 3DBHB 1JGSA 2FUG2 3LQRA 5EEAA 2Q1ZB 2WAEA 4IHXA 3RZOJ 2HXOA 4HX8A 5D6FA 1VNDA 4ETSA 1W0UA 1MSEC 2HQAA 5FFZA 5CVIA 3WODF 3HOWJ 2ESHA 2JMWA 1WQ2A 4DVYP 3F21A 1BJZA 3AG1H 3GFLA 5DS9A 1Z0XA 2EILH 4CZZA 1QGPA 4MQVA 2RVCA 3SFZA 3OOPA 1HBXG 5D5VB 1G3SA 2MGQA 3BZ6A 3BTJA 1VQ7I 3PNTA 2KL4A 3W6KB 5K7ZA 2XVCA 4E7KA 2L7MP 5D19A 2HDDA 3GWZA 5L3BA 5EDNA 1K79A 3HDDA 2LR8A 4HRIA 3IUVA 1RESA 4GCKA 1Q1HA 2JQ7A 3RPUD 2ZSIB 4KT5C 1SD6A 1AKHA 4RAYA 4LGWA 4A3EJ 1FP2A 1W4MA 4B4CA 1IXSB 3O6BB 1XSDA 3T5XA 1V4RA 4GCTA 4CYCA 1OYWA 3ABUA 3MKYB 1LE8B 1ACIA 2E1OA 4A0XA 2H09A 4MXMA 5J3LA 4OIQF 4YELA 2HVSA 3BOQA 1O3QA 3KP6A 4B09A 1VQ5I 3VUQA 2Z2SB 4DQ2A 2VODA 4XRSG 4HV5A 5B1AH 1QVUA 5CQGA 2VI6A 2QLZA 3MZ8A 4Y13A 4M3GA 4NQWA 1P92A 2JA2A 4A0ZA 1WHUA 2W24A 1ENHA 2DT5A 3MQ0A 1BR1A 1ZRFA 3BR5A 3NNRA 2Y0MA 2CJJA 4EJUA 1U9NA 1X1AA 1BR2A 3DU6A 4U87A 3PO2J 4KT6A 4XRMA 2QKOA 3HXLA 1OISA 3JREA 1SAUA 4EM1A 3K70C 2PLYA 1LEAA 2P4WA 3BC8A 1D8KA 3BG3A 3G3ZA 3RIRA 1TT5B 5F0CA 4MFDA 5HODA 2K27A 1BR4A 1HW1A 2WGBA 3OIPA 3VVZA 2EZKA 5LBQA 4PK4A 3CCQI 1SVLA 2O03A 4F52A 3ML6A 5IYCJ 3HC7A 3QPTA 1V5GA 1HLVA 3TL4X 5HLIA 3VSKA 2X85A 4LITA 4NHJA 5DUIA 1GXQA 3H3UA 3V6GA 1WJ5A 4BS9A 3DEWA 2BE5F 4ZYAA 4S0HB 4HX4A 4DBQA 4ACIA 3QU3A 4KIBA 2BYVE 5IP7J 1RI7A 1JGGA 5AIQA 3OWTA 4EJTA 3AKZA 1KYWA 3FBNB 3CRJA 1STZA 2B3WA 2NS7A 3E3VA 3KCCA 1YO5C 2X1EA 3SDBA 4GCVA 1B4AA 2FBKA 1BIBA 1RKWA 2DJNA 4I0BA 4EMSA 4ZYGA 4MIMA 4EEFG 2PI0A 2DI3A 3MNLA 5ED4A 1YRNA 3T6NA 1VI0A 5C44J 3D5SC 2KZVA 2QQBA 1DP7P 2XPVA 2EV0A 2LKPA 2W1OA 2G7HA 4A3IJ 5GAGJ 2MH2A 4I6ZA 2HS5A 3L9FA 3JAMZ 4HF0A 1I27A 3RDIA 5E18F 4JKZA 2P7CB 3OYGA 2ZOYA 1ZTRA 2XSDC 5ICCA 4BNCA 2K40A 1ETVA 1UHMA 4B47A 4OAYA 2Q2EA 2YPRA 1XD7A 3J81Z 2K5CA 2ZC2A 1VQ9I 2VKVA 3FK7A 3KZZA 2DMTA 3LFUA 3F9KA 4LK1F 2NVYJ 2R7UA 4UHTA 1SVOA 2CQNA 2DA2A 3F6VA 3WHCA 4HF1A 2O7OA 3SDGA 1LB2A 4L0ZB 3VOKA 3JSOA 2HPMA 3AG3H 4HAMA 3SQNA 1LJ9A 4R79A 3GCMA 2CUZA 1S6LA 4LFUA 4P1WA 2L4AA 2ELJA 2R5YA 3U2RA 5ILVA 2V6CA 3NAUA 2MC4A 4AC6A 3ZMTA 1P2FA 2VOPA 1G3YA 1LDJA 3S15J 3COLA 5DTDA 2Z3YA 4CHUA 4L9TA 4WWCA 2V7FA 3V7CA 1E0EA 2M0CA 2ZXWH 3KLNA 3M9AA 1SD4A 3HGYA 3DLLF 2FNPA 4L9VA 2WAQN 3OL3A 2WBMA 3IH3A 2IP2A 2HEOA 4WXCA 1JUSA 1R1UA 3V8JA 2LBFB 3EUPA 2P6TA 2E34A 1MDMB 2CV0A 2R3SA 3HSFA 3R6SA 2UZKA 1X3UA 3BG9A 1GXPA 4MK6A 3M1CA 2VQGA 3GX4X 2PMZN 4CCLA 2W7NA 1VQ4I 2VASA 2UV1A 3LWFA 5AONA 1BOAA 5FGMA 1TWFJ 2MFZA 4W1UA 1OPCA 4GFBA 2IXSA 2DA1A 4KA4A 2DDAA 1SANA 4FASD 4EJVA 3LWJA 2FRHA 2Q0OA 2DQRA 2NS0A 1ZG3A 2XAGA 1WJEA 3OYCA 2P5KA 2QSFX 3Q0WA 5AQCA 4FX0A 2LVSA 1HQCA 1T56A 4E7SA 2IT0A 3VP5A 2LK2A 1NK3P 1KA8A 5K7HA 4DYQA 1VQPI 4K2EA 2FSWA 3GZNB 3S16J 3HE0A 2W25A 4AD9A 4IVNA 3DP7A 2ZNZA 3JRHA 2XF6A 4L9JA 2R92J 1TQIA 4U9NA 3TDUC 1DGWY 2A68F 3EGQA 4L5JA 2ISYA 1NK2P 1Z05A 2MBFA 2ESNA 3DXJF 5IPAA 4C3JJ 2CW7A 2M4KA 5C4YA 2HWVA 3HJEA 4XOPA 4UB6C 4M9XA 4IHVA 1FT9A 3ISPA 2ZKZA 5JFRA 1MBKA 1JT0A 2LG4A 1AKHB 4JP0A 5IY5H 3QYBA 4BH9A 1UAAA 1R00A 2UXXA 3KEYA 5BNGA 2NX4A 2HTSA 4CYCB 2L9RA 3BR2A 3NRVA 1W0TA 2FJ1A 4HSRA 4BACA 4BQNA 1OCRH 2L9VA 4XR6A 4BJ5C 1H9TA 1IW7F 1NG6A 1IDZA 3BCGA 1OKRA 3H9QA 5IYBJ 3ZMSA 4U9LA 5M5YJ 3M1EA 3DFGA 2XKOA 4UUTA 3G7RA 2IS6A 1OJLA 1QZYA 1REPC 1USSA 3MN2A 2KDZA 2F4MB 2M5WA 1UMQA 2GLOA 1JXSA 4RAZA 2O9LA 3VW1A 1IC8A 4ABZA 2QKLB 4A6DA 3JRCA 4JX5A 4RAGA 2WV0A 4G8XA 4HQEA 4CCKA 1B1BA 4NB5A 5K7FA 3H1CA 1VTNC 1S7EA 3IAS2 1UZCA 4BKXA 3G1MA 4F3QA 4A3CJ 1BA5A 5HAWA 3KEQA 4UB8C 2OQRA 2L5QA 4YIFA 5F1RA 3OS1A 3A01B 1B6AA 1WPKA 1P9QC 4AYBN 1MMSA 2EA4A 2X9DA 4HA8A 1TNTA 3HSRA 4PZJA 3QKXA 1WJFA 3IL2A 3HIMA 3W3CA 3CJNA 1T95A 3KP2A 5F0HA 2EINH 4JX6A 1MJAA 4QPQA 3P9TA 1KU9A 3KX2A 2ISZA 3TW6A 1IXCA 2GA1A 1R5ID 2LLKA 3I64A 4AIHA 1SMTA 2VJJA 1SFKA 1X2NA 4UVCA 4AVPA 2FJI1 4XKWA 2D1HA 1S5LC 3BROA 1PVEA 1J5YA 2NVQJ 1BI1A 2MC3A 2R7XA 4BDZA 2AXLA 2Y48A 3R4KA 5M3MJ 4CH7A 1LPQA 2GENA 2Y69H 1HKSA 2STTA 1WJAA 3R0AA 2Y75A 2STWA 2RNGA 3KZYA 5FLVA 3TMOA 1W7PD 1H88C 3P9IA 1IRGA 1MMGA 2R7FA 1MMNA 5FKOA 1VQOI 1Y39A 1CGPA 2F2EA 1YRNB 1NG7A 3ZQFA 2K3FA 4IZZA 2QM3A 5CLSA 1RUOA 1VZ0A 2RGVA 2MYSA 5CJ9A 3GW2A 5CPRB 2MW8A 5ICGA 3WTSC 1J9IA 3DEEA 3E5XA 1KONA 2ZB9A 4IJAA 4UNOA 5GTIC 1SFOJ 4XLEA 4BYYA 1FOYA 2NP3A 5JLWA 4HV6A 1ODDA 3DQVC 3C07A 3OR1C 2ZFWA 3FMRA 5L3EA 4MEYF 3VYRB 2R93J 3LSRA 2M8GX 1X4PA 1IN7A 4OD5A 3R61A 3SEQA 3CDLA 2P5LC 3BG6A 4XBFA 3L2CA 1T98A 4Y17A 1TC3C 2W4SA 1DU0A 3CTAA 3NPIA 1GVDA 3NQOA 3H3ZA 3HBLA 2XDVA 2HU9A 3GTOJ 2WADA 3FZVA 4RGXA 4Z6YA 4GFKA 2HFHA 1Y0UA 1IV8A 1UFMA 1WI3A 3PUFA 3ZOBA 3CCEI 2R5YB 3H5AA 2BGCA 1K83J 4XLHA 1I5ZA 1ZHFA 1APLC 1I6HJ 3X2QH 5IP9J 5D18A 4B44A 4HYEA 3JRFA 3E7QA 3J7ZI 2RC4A 3LSJA 3KYCB 2R5ZA 2R7QA 3P9KA 2VJ4A 2XAJA 4DW6A 4D1QA 5F0FA 4EV0A 1KYZA 2AO9A 1JKQC 3WG7H 4XIDA 3M8FA 4RGSA 3EQLF 5TJJA 4N0BA 1FNNA 5JI6A 2I10A 4XQFA 2AXTC 2EK5A 4LOCA 2DXIA 4AIDA 2BV6A 4BQAA 5KK1A 2QQ8A 1HXDA 4BHBA 2FBQA 2OU2A 5FMPA 2F4OB 5CXGA 1R5GA 3F6OA 2R4GA 3RKWA 2CQQA 3BR3A 3WTZA 2EQRA 2Z16A 1FX7A 3HKZN 3G6EI 3RI4A 2UWMA 5EEGA 4E6KG 3OL4A 1I50J 2DTRA 2FOKA 2E1NA 2IBDA 3H92A 3GZ5A 4KN7X 5BQTA 2OTLI 4JBAA 1UJ8A 3I54A 2COMA 4HNTA 1ZGAA 1ZK8A 2HZTA 3HOUJ 1U2WA 1Z3YA 1ZAOA 1N78A 4WIBA 2CH0A 2XV4S 2QWWA 4RB0A 3ZN1A 3JRIA 2R7ZJ 2RDPA 3K1PA 4PJLA 1FY7A 4DIQA 1RUNA 4YFKF 4HF2A 3P9CA 2GZWA 1I1GA 1MNMC 3OYJA 1RIOH 4UUSA 3O8HA 3ZGKA 3BWGA 3GF2A 2ZSHB 2J5PA 2QQ9A 3OIQA 5LRRA 2M30A 2OCEA 3KE2A 4HW0A 3OS2A 3IRQA 4OD4A 3LA3A 3K2ZA 5DCMA 1ZGJA 4TV7A 2LNBA 2L7ZA 1TBXA 3V8LA 2YUSA 4F55A 2M45A 2FE3A 5IT9Z 5CW8A 4UY8I 2NS8A 2QWTA 2R0QC 1P4WA 4BAYA 3CMMA 4PDKA 4XL9A 5FB2A 1HCRA 2XKPA 1BI0A 2ELKA 4LMYA 1B9NA 1XC5A 1FIAA 3PFIA 3L2RA 2M9HA 2P81A 4J19A 3PSIA 1UI6A 1OLTA 2LFBA 2JUGA 2HXIA 4IOAF 1MD0A 1Z77A 3RKXA 3EDPA 5IOZA 3L2VA 3CCRI 1HW2A 3DBRB 4DYRA 1OFCX 4ZYHA 3HOSA 3RPUA 5K5RA 1Z7LA 2VL8A 3MKWB 1T39A 1F5TA 2E2JJ 1IN8A 1MKMA 3P5JA 2DODA 4ZJZA 1WKMA 4B1RA 5HOOA 1EV7A 3LMMA 4IO9F 2E2IJ 4HDUA 1N75A 2ETHA 2UUZA 2HVQA 2Y31A 5E8IA 1ULYA 2A3SA 5ICEA 3GFJA 2EJRA 2E1MB 4F7ZA 1S72I 2MH9A 4I02A 4A3DJ 4UVAA 2PQ8A 4LB6B 5J8CA 3GYHX 1TL8A 4UUVA 3BTIA 2DTZA 2V26A 4BU2A 6PAXA 3VEPA 4EJWA 2QIBA 4ENNA 4IRGA 2IPQX 4CICA 2ZJRF 4D0PA 3K70D 1YX3A 3I55I 3PUBA 4L0YB 5CYVA 4YIIA 1GV2A 2EFQA 1FC3A 4NC8A 2H27A 3HPGA 3WTVC 2K7LA 2YX7A 2DFIA 1ERDA 1ONVA 4M72A 4NC6A 2P5VA 2EFOA 2UXOA 3HTJA 2EB7A 3D0SA 3HEFA 4P9FA 1U8RA 5KNLA 1ZRDA 3LNQA 1MBFA 3GLXA 3VYSB 2ACJA 1D1BA 3EPZA 5D6EA 3LSIA 2L01A 3TW7A 1LFUP 3I58A 2IGOA 3K0LA 4EGYA 3AFHA 2B7EA 5DYMA 3WG9A 1FZPB 2DA6A 1D8JA 3HPHA 3VSLA 4E7ZA 3L09A 2LF8A 1HSJA 4BGDA 3E5UA 3MCZA 2BVMA 2DU9A 2TRTA 3HOTA 2A05A 3HOXJ 2LKSA 3S8PA 5BS6A 3DEUA 2ICWG 1YE9A 5LRSA 3C7JA 5FKMA 3HL2A 2GFNA 1XGNA 2MD0A 5DCFA 2KZGA 1UCRA 4U7DA 4E7HA 1W5SA 4X1EA 1WGXA 1ZLJA 1IV6A 1MZBA 4L62A 2HDWA 1S7AA 3CUQA 1HA8A 3TEDA 1QHHD 2ZY9A 2V9KA 3CMYA 2NRAC 2UXHA 5JLXA 2BEOA 3ZRGA 2DFFA 2ZJ2A 2GOXB 3BTCA 2QA4I 2F48A 3E0JB 1J2XA 5DEQA 3S3NA 1H89C 4IL6C 3U21A 4CO8A 3SFIA 1K4SA 2UXUA 2XDNA 2BBYA 1XDUA 2LOOA 4KISA 3Q3SA 1VQ6I 4XONA 3NEUA 3TKYA 5E3OA 2R7RA 1QZEA 2KQRA 4RM2A 1WWXA 3FISA 3KZ9A 1R1VA 4HPQA 2KT0A 3B73A 3PNYA 2E2HJ 3VW2A 2EPFA 1D1AA 3TDZC 4BE2A 1E3OC 2M8EA 3S1NJ 2XAHA 4UV8A 2LD5A 1R1TA 2WTEA 3GEZA 3RQ4A 4EM0B 1MBGA 4EM2A 3QPSA 5GPAA 5LD2C 3QU6A 2KHMA 2PN6A 5EG0A 3KP4A 1X3ZB 3BQZA 2VLAA 3LSMA 2HGCA 2BY3A 2K9SA 3V8KA 4WK8F 3QQAA 4AF5A 1SFXA 1ON2A 2WC2A 1JKOC 2VE9A 2E60A 3PO3J 4M9SA 1V5FA 2QF7A 2JSPA 5M5XJ 2R5ZB 3SWHA 3U1KA 2NOJB 5H6QA 3IKVA 4KJZA 3KZIC 1MW7A 1LVKA 3C2BA 2F4IA 4HBLA 2DPUA 3QBMA 2JRMA 3LA7A 3LSPA 3V78A 1DUXC 2NAZA 3Q5FA 3FXKA 2QBYA 3JW4A 3RYPA 2H6BA 3E7LA 3RTRA 1PUFA 2X4HA 3OYBA 2DOAA 4G94A 3KETA 2VPLA 5GADJ 2OA4A 1QA6A 1U3EM 5D5WB 2J5OA 4M74A 4QSHA 1OCOH 2FMLA 4U0VA 3QRFF 2ZJPF 1OCPA 4M71A 4BXXJ 1V55H 5J40A 2FNAA 2YU9J 1YS6A 3VODA 3GEUA 3ASNH 4UV9A 3HTIA 2H94A 5E8GA 1J09A 4BEHA 4FETA 2HQ5A 4A3BJ 3K8PC 4MQ9F 2CMPA 3O3KA 5BOXA 4BXUA 3O60A 4XN0A 5ERIA 1YQAA 4F92B 4C2UA 1FSHA 2RN7A 4RB2C 4I98B 2OERA 5F08A 4BJTA 4QPOA 1U9OA 4P5OA 4PJMA 2DFEA 4AC0A 2GOMA 1ETXA 2BXZA 3ECOA 4ITVA 4Q5SF 1TT0A 2VT3A 1BIAA 3CMEI 5DCMB 3NWTA 1JKRC 1WCMJ 4RLFA 2PJRA 4C30A 3DTIA 2XC7A 4KYWA 2DMNA 3W2AA 3FXRA 3ERMA 3RYRA 4XLPF 4M6XA 3PNVA 4MHGA 4IQJA 3S1RJ 2VOOA 3CP8A 2XPUA 4CCMA 4CZCA 4I2OA 2A07F 3W6VA 4N4OB 1MNDA 2IAIA 3I9V2 3ZMVA 3FRQA 1ZR2A 1E3HA 3WU0A 3EYIA 4D9JA 1A35A 3JSJA 4D5CA 5FLXZ 1LDKB 4Y33A 3QWLA 3IP4B 1XMXA 3HOVJ 2HZDA 4N4NB 1FJLA 4I0AA 4RGRA 1G8XA 3GUDA 1W36D 5JVTA 4DBRA 4C3IJ 3IHUA 2ZCXA 4MTDA 2H8RA 2Y9YA 2PFBA 3ONQA 3CLOA 3BHQA 3TP0A 2QTQA 2KIQA 4IHSA 2W53A 5GAEJ 3FXJA 4IKFA 4L5EA 4YFNF 2IA1A 4YEJA 3D5LA 4GFLA 4LD5A 2PMUA 4BY1J 1X3WB 2CS3A 1OQYA 4G7ZF 2E7WA 5HLHA 2W85A 4BDYA 1DGRM 3CO7C 2VXZA 5F1JA 4G6DA 3H5NA 3CCSI 3S5RA 5B3SH 2EV6A 4V19K 3V4GA 3O8GA 2L9NA 5L3DA 4KITB 3ABKH 2CU7A 1GDTA 3I59A 2X1DA 4OIRF 1JJ6C 2QVOA 1FYKA 1XG1A 2QKMB 3QP6A 3AL0C 4EVIA 2W48A 4FE7A 4JNNA 1QO0D 3NWSA 4E7JA 2CQXA 1Y8RB 1GT0C 5AIPA 2X6XA 1ZQ3P 3I71A 2QSGX 3KP5A 1EH7A 1U6GA 3KPHA 1IO2A 3DWLE 3L00A 5H6RA 1Z3XA 2WAQA 3LJLA 2CQ7A 3S2DJ 4CSWA 5B1BH 2QGUA 3FXUA 1MSFC 4KN4X 2D2WA 2RQQA 2VE8A 4HEA2 3Q0UA 5J6XA 3A2KA 5ICFA 3I4MJ 3NS4A 2XRNA 2FX0A 2JPCA 2PMZA 3FDYA 3A03A 4FCYA 4C3HJ 3E97A 4O5VA 5LHGA 3GMEA 2L02A 2MSYA 2RHAA 2BY0A 3N4MA 3BR6A 3ZMUA 2DQLA 3F8NA 5ILUA 2O3FA 4WX9A 4MEXF 4BQOA 3M8EA 3WU2C 4M3DA 4CDGA 2UXNA 3C2HA 3HRMA 5CVRA 3MEXA 1SD7A 2PZ9A 4E7LA 2B0LA 2QOPA 3RD3A 3JRAA 5M5WJ 3MMYB 1RETA 2LREA 1IN5A 2XB5A 1LQ1A 4NELA 1QPMA 5A2QK 1VQKI 1MMDA 1XGOA 1JUPA 3FXQA 4ZTJA 4EATA 4ASNA 4IQ4A 4A12A 3J7AY 2DBBA 1W7PA 3CUQB 1F36A 2L2OA 4HLXA 3UNGC 4FX4A 3J80K 3GTJJ 4EJOA 2BOLA 1IUFA 1AA7A 1HF0A 5FRMA 3F72A 1OCZH 3G1LA 5J1UA 4LJZF 2OZUA 5FKLA 2HQRA 1MBHA 2P8TA 3K4CA 2HOAA 4XKBA 2VB6A 3H9GA 3HRSA 1U5TA 4QLCU 1QZZA 4J00A 3CUQC 1DQUA 1ETYA 2DMPA 4M3EA 1W1WE 4F91B 3OYFA 3M07A 3BJBA 1ETWA 2G7UA 1X2MA 3R0JA 2IGMA 5E3LA 1F1ZA 1HDPA 3BJOA 3WGIA 2JWTA 1R6RA 1BOBA 2D45A 4HLYA 3SXYA 5D1RA 2VBZA 2NVUB 1S9HA 1I1SA 2EV5A 3ANGA 3I53A 2MABA 4IF4A 3ZCOA 4JL3A 2ADUA 3JTGA 1K78A 2WUIA 3ON2A 1EA3A 2EH3A 4DOZA 1M1EB 3LHQA 2HPIA 5EG0B 3CJRB 2X6OA 4I99C 1BJAA 2ZO4A 4BBRJ 1YTYA 2YS9A 3G1OA 3SYTA 5LHHA 3VVYA 3AAFA 2OJED 4NQWB 3WHBA 1YJ9I 1UG0A 3K9TA 3F8CA 1B9MA 2JTVA 2AS5F 2P6SA 2K02A 2V1DA 4RAFA 1R4NB 3BZCA 4GRIA 3EUKL 3CCYA 2QBYB 4PJ0C 1ZRCA 3RZDJ 2CUEA 3K1MA 5HVQC 4DZPA 4GDFA 3PIOF 4LG3A 1ITYA 1RRJA 1PUFB 3ANPA 2R7VA 5E3MA 2D6YA 4ESFA 4AYBA 3WGHA 3DKWA 4E7IA 1R22A 1KU2A 2L9SA 1XB4A 2LKXA 5TRDA 3F8FA 4Y3OA 4UDSA 2NVTJ 3QOEA 3S32A 4RBOA 2CQKA 3F0CA 1V5EA 3WTTC 3OYDA 2HOTA 2JN6A 4BEHB 5L3FA 1QRYA 1ZN2A 1RKTA 2VN2A 1WJBA 2EZLA 2VJIA 1R9TJ 1SFEA 2CSOA 2Y2ZA 4D7NA 2CW0F 1POGA 2IA2A 2EZHA 3HTUA 4HZFA 3E1SA 5ILSA 4BQQA 2VKDA 5LLQA 3ESWB 3CC4I 5EYRA 3FF5A 5BPDA 2XGDA 4XORA 4MTEA 3ULQB 4HX7A 2LYCA 4JYKA 1P4XA 1SC7A 2XHKA 2FQ3A 2PJRB 2VONA 1J7KA 2DK8A 2WAFA 3K2AA 1XDSA 4OOIA 3CCMI 3SZGA 4U0WA 2GIVA 2MLKA 5JR3A 5K5OA 3CF5F 4W97A 3GFIA 2DOEA 2VBXA 5D4RA 4X6AJ 4G6QA 2VPRA 4B3XA 2G7SA 4MFEA 3IRRA 3OIOA 2KIMA 2B9SA 2X51A 3GTQJ 2P7VB 5B5EC 2V6EA 5E1WA 3ROUA 3L7WA 2QZ8A 1PUEE 1S29A 4WXHA 2GUHA 3Q9VA 1L0OC 2CGPA 3VW0A 2Q2EB 5TISC 5JHFA 2VIXA 2Z5UA 3BZKA 2ZXJA 1R4MB 1GVJA 1YIJI 4L5IA 4ESBA 2Z33A 4XICA 3E5QA 4M3FA 1IUYA 1Q1VA 1IGNA 1B72A 2DO7A 2DG7A 1T33A 3K6GA 3GTKJ 1IDYA 5KAIC 1HDDC 3BG7A 4RLQA 4ZDOA 1KQ9A 3GFMA 1RNLA 5HSZA 1JHFA 1YW9A 2AQFA 2K9QA 3KYDB 3F8MA 3I4NJ 3ECHA 4LLGF 1R7JA 1IAWA 2W82A 1K6YA 4YG2F 1QPIA 3H5RA 1I3AA 1LFPA 2DJIA 2IJLA 1H8AC 1TNSA 5KVRA 5FGLA 1WH5A 4UXNA 3A1YA 3PFYA 2LTPA 2RQPA 3KYLA 4II2A 2DA3A 3I59B 3GZIA 3VTIA 1I6XA 3HTAA 3Q0VA 2L4MA 2KJCA 1F43A 1YG2A 2RV8A 3HM5A 2R7DA 4BBSJ 2IU5A 1IN4A 5FKNA 2DDBA 2V1UA 1HSTA 2H8WA 4JOMA 3RQIA 2KFDA 5F04A 3OSFA 3NARA 1G4DA 3G56A 4A5MA 4M9ZA 3CLQA 4A3KJ 2MG4A 3AQSA 3S1QJ 5EZGA 5J8FA 4PSWA 3GTPJ 2DN0A 1GV5A 3FXLA 3DU5A 4PCQA 1ZGWA 4ESJA 2V4JC 3HKZA 1AU7A 5LEJA 5IP6A 2O7TA 2Y0SA 5EGOA 5K5QA 1FMWA 2KPMA 2E5ZA 3ZQGA 3CDHA 2NP5A 1Y8QB 2CYYA 1SD5A 4BUPA 2P0WA 1D1CA 4O6JA 4B8XA 2DMQA 3KIOA 2KJBA 5DD4A 3FK6A 3D1NI 2PJPA 2V1XA 2XF5A 4JQFA 1ZARA 4Y4RA 3JRGA 1G2HA 4RB3C 4A3JJ 3C3WA 2ZXHA 2KRCA 2DK5A 4PFPA 2GBYA 3GO5A 2IS4A 2LSOA 3FM5A 4KFCA 1JKPC 3HTSB 3RCOA 4U7BA 3EUHA 5F64A 1FSEA 3GTMJ 1VQLI 3ZP5A 3BCAA 3DPLC 4LLLA 3CCJI 3S14J 1NHAA 1Z7UA 2W00A 4V2GA 1LKXA 2PG4A 4OMZA 5DDGA 2V1NA 3U9GA 1R49A 5E20A 2FOWA 2JSCA 4DZJA 4IRIA 1G6NA 4KIGA 3B6CA 1U5TB 2FBIA 3TBIA 3OV8A 1W5TA 1WSUA 1XSXA 4CXFA 5FHPA 1QU3A 4HOBA 2M3AA 1JHHA 3C1DA 3K10A 3LQQA 4XKVA 1Y0NA 5J4VA 2VBYA 1YI2I 1YW8A 4XSXF 1R71A 2MLGA 1TWAJ 1OCCH 1YX5A 5HLTA 4AVZA 4E4HA 2CG4A 4HG2A 1U5TC 2E5NA 1PYVA 2IVMA 3OSGA 1A5JA 1K78B 3BRUA 3JRDA 1CQTA 2XGXA 3PPBA 2GQQA 2LY9A 5DM6F 5LFAA 3S93A 1O57A 1AHDP 2HR3A 2A5YB 3WGGA 4HNUA 2H1LA 4PFOA 1HC8A 1TW2A 3OYMA 3WTXC 4A93J 3FMQA 3H36A 3OS0A 4RGUA 2KLOA 2M7BA 3BDDA 1FBUA 1UB9A 2BW3A 2DW4A 3M7GA 3OR2C 4KMUX 4I7HA 1YLFA 3JAMK 2R7SA 2E7XA 1R58A 2HKOA 2JA5J 1YS7A 1EF4A 1JTYA 3KKDA 5GTHC 4HQMA 5DUKA 1UELB 1LDDA 3IH4A 4LK0F 2GIZA 2OCCH 3L1PA 3H0DA 2CW8A 4ZDLA 3J81K 2HVRA 3ZMDA 5E1XA 1MJ9A 2HI3A 3B6AA 3BR1A 1U0JA 2I5UA 1TWGJ 1RC9A 1B8IA 5JVGF 2UXPA 4IPAA 3HOZJ 4IHYA 1YITI 2NOGA 2JZYA 2EIMH 2JUCA 3A0BC 2WB1N 4PJNA 3ZQHA 4E70A 3BCBA 4WF2A 3HUGA 1FIPA 5EJCA 1FMVA 3U1DA 3FMSA 2OTJI 3PM1A 2IA0A 1FWZA 1MJBA 5LHIA 1ZLKA 1JJ8C 2RKHA 1BW5A 2CUJA 2LBFA 1J0RA 5IOYA 5DM7F 2LY1A 1MDMA 2ZCMA 3Q9SA 1Z6RA 2AQEA 4IX7A 4MO7A 1Z21A 3OYNA 3L2WA 2GAUA 4PGHA 4A2UA 3OMYA 1X1DA 2I8DA 1U8BA 3K69A 3T8RA 4A3FJ 3M4OJ 1VFCA 5HS8A 4FE4A 2O0YA 2DCEA 3S2HJ 3NXCA 1MMAA 2F07A 4A6EA 4AU7A 3OYIA 2G7GA 5CVUA 3T0YA 5GPCA 4U88A 4GCLA 2CUFA 3UKGA 1QBJA 1GUUA 3BY6A 3KP7A 5HNFA 2DT7B 1KGSA 1AOYA 4ANJA 4BXFA 5LGUA 1UI5A 1EKEA 3F22A 5FJ8J 4RS8A 2RREA 2PX9A 4XM3A 1BN5A 2ZMEA 1DDNA 4NN1A 2PBIA 4I01A 4G7OF 3HRTA 4IXAA 4NBQA 4LB5A 4N9IA 4C9YA 2G3BA 3K7AJ 4RB1A 4JK1X 1B72B 2LF7A 5F6FA 2XAFA 2PMHA 2IRFG 2B1EA 5D4SA 2VJ5A 3H9JA 4GO1A 4J01A 4M6YA 4FTHA 2MA3A 4R1HA 2CFOA 2JVHA 3IWFA 3K4NA 1JI8A 3PSFA 2HKUA 3PL8A 4ENJA 2KP6A 4PJJA 3KFWX 1I3QJ 2V9PA 2AHQA 2JVGA 2F5DA 3E6BA 4HNVA 5H9TA 4GXOA 3VOEA 5JHUA 5EEHA 3OYHA 1XTAA 2K9MA 3ELKA 1LUJB 2GWRA 4XNFA 1LFBA 1J75A 1OYYA 3I0TA 2K9LA 1RZ4A 5D5UB 1WRJA 1HOMA 3LSGA 4H4KC 4B48A 5TGTA 1BW6A 2C6YA 4CYDA 4KWAA 1J59A 3L2UA 3MZHA 1A36A 3W2VA 4IEJA 4G6TB 2ZCWA 3S2WA 5CVVA 2LP0A 3SZPA 1T08B 3UR3C 1EH6A 1FEXA 3RPQA 4XOTA 1MH4A 4H0EA 2YU3A 4RMNA 2CWEA 1PP8F 2D5VA 1WI9A 1BL0A 2CV1A 1VQNI 3KNWA 2XPWA 1S3JA 5FROA 4Y7NJ 2COBA 5D8LB 2G7LA 2KIFA 2Z99A 5EGOB 2YVXA 1FPQA 1OMIA 3OYKA 1A31A 2DT6A 5DV5A 3VOXA 4GYIA 2F5FA 1Y1WJ 3LSKA 3WE3A 2GM4A 1XN7A 2DLLA 5HDNA 1FTZA 1XMAA 1BI3A 3A01A 2HTJA 3S3MA 3A4CA 1XX5A 2M4GA 5J4YA 1SVMA 2JRTA 1K4TA 3GTLJ 1P7JA 4P55A 4UUSB 3HZJA 4IHTA 4FHTA 4D7MA 2FU4A 1XPXA 1QVTA 3TO6A 3DTEA 3MVPA 4ZTFA 5HNHA 1Y56A 2YSRA 4LIVA 4HSTA 2YVHA 2DAOA 2NXNB 1OR7A 1HKQA 5FD5A 2JJ7A 1DU6A 4NDLA 1FYLA 4BY7J 1VF9A 2VXDA 3ON4A 1GHCA 1O7FA 2OZ6A 4YFXF 4C2TA 4CCNA 4A3MJ 3ZPLA 4AUXA 3AQTA 5E1ZB 1KQ0A 2ZXIA 4ICHA 3S3OA 2B63J 5CVJA 2G0EA 2XAUA 4B43A 2VQHA 2M1BA 3MWMA 3EUHC 4HKUA 4F93B 2FD5A 3G2BA 3IWZA 1MBJA 3FHZA 2Y9ZA 2JPBA 3AG4H 5HBUA 3ABMH 2EFNA 2DMUA 1QHGA 4R8HA 3J7AO 1IG7A 1O3RA 2DOFA 2EFWA 3GBGA 3B81A 4LIUA 4OIPF 3PASA 1TQMA 2DFHA 3QYFA 1T0FA 2IW5A 3WE2A 4A5NA 1WJCA 2VBWA 4OMYA 3VFZA 1O3TA 4RM3A 2F5EA 4KICA 1IF1A 2JA8J 4BE0A 3ERED 4IHWA 3P7NA 1RPWA 1XGMA 1JUMA 2YR2A 4KIFA 4C2MJ 5FO5A 4S04A 4V2FA 4OIOF 1IRFA 4G12A 2W57A 1UHSA 3AL0B 5J1YA 2XF7A 5L3CA 3OYEA 3V7RA 4Y52J 2PFVA 3OYAA 3H3VK 1MNEA 5LGNA 1T2KA 3CP2A 2DYSH 4Y15A 2KDOA 3MZYA 2WA0A 1XGSA 2W84A 2BW3B 3WTUC 4BE1A 2WV1A 4B3AA 3F1BA 1XCVA 2K3PA 1BM9A 3KP3A 5C4XJ 2UXIA 1D3YA 1DPRA 3FM3A 3MAJA 2KIUA 3RKQA 1B59A 4EGZA 3SJMA 4PXIA 4S05A 3ZQQA 1NH3A 1YFHA 1R5HA 2IGNA 4ON0A 2LY2A 4GYGA 4DYCA 1TWHJ 3PIPF 3IH2A 1ETQA 1FBSA 2ZJQF 1B8IB 2XGCA 2HYJA 2HYGD 3RH2A 3S1MJ 3DBLB 2OPTA 2RAEA 4BJ6C 2FMYA 3HOYJ 5C3EJ 1D0YA 4A0YA 2M34A 2HYFA 3HUGB 2Q8KA 5CXIA 2KMUA 1PJRA 4CA0A 2M87A 1G3TA 3QPHA 4JX4A 3K1NA 3BPVA 2OAZA 1V3FA 2HYTA 1BBYA 1O3SA 3VPRA 2JA6J 1XSVA 3BTLA 4MNUA 2A6EF 3OOUA 1QQIA 5E17F 2PBXA 1ZH5A 5EF6A 1USTA 3IV5A 4IRHA 2O6GE 2LC2A 1TZLA 4NC7A 2FEZA 2E19A 5B66C 4FISA 2TCTA 3EETA 3CQZJ 1DP3A 3DKYA 3CDIA 2RASA 1O7LA 5D5XB 3JSPA 5IYDJ 3FWEA 4NUBA 1Y6IA 4D5FA 2EIJH 2OI8A 3BJ6A 2X6WA 1IN6A 4M3BA 2ZMEB 4XKCA 5M3FJ 2GXBA 4MGRA 3H35A 3C18A 2BXYA 2M0MA 2XSJC 2ZFUA 4BL0B 2IEKA 2EFPA 2R7TA 4X0GA 5F27A 2BVLA 1LEBA 2L7FP 4ZZDA 3JCUC 1BC7C 3GTGJ 2ZMEC 3M8JA 1WZ2A 4LG0A 3I4PA 4IOCF 3S17J 1X1CA 3CJTB 2NNNA 3BQYA 2H1KA 1YJWI 3MFKA 3FIWA 5J47A 3CCLI 4KDPA 1ZYRF 1O4XA 1ON1A 2HKXA 2TDXA 3OYLA 3BP8A 2VQCA 3HHHA 1IXRC 4XLCA 1BC8C 3FKJA 1X1PA 4PGGA 1W36C 1SFUA 2WWYA 5IT9K 1D0XA 4WXDA 2VC1A 1ORKA 2V9VA 3ZXSA 2EWNA 2QSHX 3ABTA 2MD5A 2CO5A 2XASA
chains in the Genus database with same CATH topology
4I6ZA 3HOXJ 1AU7A 3CJDA 5IP6A 2O7TA 5EGOA 4JKZA 5C4JJ 4RDUA 2ZOYA 1ZTRA 5FKMA 2XSDC 3VIBA 3ZQGA 2NP5A 2GFNA 5J1RA 2K40A 1ETVA 2DMQA 4ME9A 2JK3A 2M2EA 2VKVA 1JTXA 3FK7A 1WGXA 4X1EA 2DMTA 1IV6A 3FK6A 3D1NI 4L62A 3TEDA 3QPLA 2NVYJ 3JRGA 3CMYA 1G2HA 4A3JJ 2UXHA 2V57A 2DA2A 5JLXA 2GBYA 3FKIJ 3WHCA 2DA4A 2O7OA 4I76A 3BTCA 3SDGA 1JKPC 3VOKA 1H89C 2HOSA 2UXUA 3SFIA 3GTMJ 2XDNA 3DPJA 3Q3SA 3S14J 5E3OA 2R5YA 4V2GA 3NAUA 3FISA 4AC6A 3KZ9A 3S15J 2KT0A 3COLA 4DZJA 2CRGA 4XK4A 5DTDA 2E2HJ 3VW2A 3B6CA 1E3OC 3S1NJ 2M0CA 5FHPA 2LD5A 1OCTC 3HGYA 2WAQN 1MBGA 3QPSA 5GPAA 3IH3A 2ECCA 3H0GJ 5EG0A 1JUSA 5K58A 3BQZA 1XS9A 2K9SA 3EUPA 3QQAA 1P7IA 3CWRA 2XGEA 4AF5A 1TWAJ 2ECBA 1JKOC 3TP3A 3PO3J 3BG9A 3HGGA 2QF7A 5M5XJ 4MK6A 1A5JA 2R5ZB 3OSGA 1IRZA 3BRUA 2PMZN 3JRDA 1CQTA 3PPBA 2LY9A 2DG8A 3C2BA 3V78A 3QBMA 3LOCA 3LSPA 1TWFJ 4W1UA 1NTCA 4GFBA 1AHDP 2DA1A 5EFYA 3ZQIA 2OF7A 4M6VA 1SANA 3A02A 3E7LA 3HB9A 1PUFA 4A93J 3LWJA 3DCFA 5EZHA 3ZQLA 5E3NA 3Q0WA 4MLOA 4QSHA 5AQCA 2JA5J 5FKKA 1FTTA 1OCPA 2LVSA 1T56A 4BXXJ 3BG5A 1EF4A 1JTYA 2LK2A 1NK3P 3VP5A 3KKDA 5K7HA 4DYQA 2NVXJ 1U78A 2YU9J 3MKLA 3IH4A 3GEUA 1WH7A 3S16J 3L1PA 1X58A 3HE0A 3HTIA 2HQ5A 4A3BJ 2ME0A 3JRHA 2R92J 2HI3A 3B6AA 3BR1A 2QCOA 2X48A 3O60A 2Y30A 3EGQA 1TWGJ 2N8GA 1NK2P 5IPAA 4C3JJ 1B8IA 2UXPA 2VKEA 3HOZJ 5C4YA 4IHYA 5F08A 2OERA 2NOGA 1U9OA 4AC0A 1LE8A 4IHVA 2WB1N 1ETXA 3ZQHA 1MBKA 1JT0A 1AKHB 4JP0A 1JKRC 1WCMJ 1FIPA 2DMNA 3PM1A 5BNGA 2NX4A 1JJ8C 1BW5A 4CYCB 2L9RA 5IOYA 3BR2A 3S1RJ 2ZCMA 2XPUA 1W0TA 2FJ1A 4MO7A 3W6VA 2IAIA 3FRQA 1ZR2A 1U8BA 1IDZA 3BCGA 2EBIA 5IYBJ 4A3FJ 3JSJA 4D5CA 5M5YJ 1VFCA 3M4OJ 4UUTA 4FE4A 3G7RA 3HOVJ 1OJLA 3S2HJ 3NXCA 1FJLA 3MN2A 4YZEA 2KDZA 2F07A 1UMQA 4C3IJ 1D5YA 5GPCA 2GLOA 2O9LA 2O8KA 2JA7J 3ZQCA 2G7GA 2ZCXA 3VW1A 4GCLA 2CUFA 2H8RA 3UKGA 1IC8A 1GUUA 2Y9YA 4ABZA 2ZCNA 3JRCA 4A3GJ 4JX5A 3TP0A 3BHQA 2QTQA 3KKCA 1TWCJ 1IJWC 2W53A 2Y0SN 4L5EA 5K7FA 1UI5A 1S7EA 2L0KA 4BKXA 5FJ8J 3G1MA 4A3CJ 1BA5A 4GFLA 5HAWA 4BY1J 4NN1A 1JT6A 4A69C 3A01B 2G3BA 1WPKA 3K7AJ 4AYBN 5F1JA 1B72B 3JR9A 2X9DA 3S5RA 3QKXA 3HIMA 3O8GA 1GDTA 2CU7A 5F0HA 4JX6A 4FTHA 1JJ6C 3P9TA 1XG1A 2DA7A 3JRBA 2EZIA 2W48A 4FE7A 4JNNA 3TW6A 2CQXA 2HKUA 1GT0C 2LLKA 1A6IA 1ZQ3P 1I3QJ 5GP9A 1X2NA 2AHQA 3VVXA 3LJLA 4HNVA 3S2DJ 5H9TA 2NVQJ 2YVEA 2ID6A 2GENA 5M3MJ 1MSFC 1LFBA 1ETOA 1UG2A 2REKA 3Q0UA 3I4MJ 1ZR4A 1HOMA 3LSGA 2FQ4A 2FX0A 5FLVA 3A03A 1MBEA 1H88C 2XRLA 3HTHA 1BW6A 5FLMJ 4FCYA 4KWAA 5FKOA 4C3HJ 4IEJA 1YRNB 2MSYA 2RHAA 3ZQFA 2LP0A 3BR6A 3BT9A 1FEXA 1MH4A 2D5VA 4M3DA 1BL0A 3KNWA 4QTRA 2MW8A 2XPWA 3BNIA 2ME6A 4Y7NJ 2COBA 2G7LA 2ZB9A 2Q24A 5EGOB 3RD3A 2PZ9A 2QOPA 1SFOJ 3JRAA 4CGRA 5M5WJ 1RETA 4NELA 2XB5A 2NP3A 1MH3A 3BR0A 1Y1VJ 3VOXA 5JLWA 1Y1WJ 1JUPA 2GM4A 3C07A 2XB0X 1FTZA 1F36A 3A01A 3GTJJ 2R93J 1RR7A 3LSRA 3GTLJ 1P7JA 1IUFA 2M8GX 4UUSB 1HF0A 3G1LA 5J1UA 4D7MA 3NRGA 1QVTA 3CDLA 5FKLA 1MBHA 5DAJA 2HOAA 3MVPA 4QIWN 1TC3C 2DA5A 1DU0A 3NPIA 1GVDA 3M3YJ 3NI7A 3HBLA 2YVHA 3GTOJ 1ETYA 2DMPA 2JJ7A 1DU6A 4M3EA 4NDLA 4BY7J 1VF9A 4GFKA 3BJBA 1ETWA 3ZOBA 3ON4A 1WI3A 2R5YB 1ZKGA 9ANTA 4A3MJ 1X2MA 1K83J 5E3LA 1APLC 1HDPA 4AUXA 1I6HJ 2JWTA 5IP9J 1SGMA 3AQTA 5D18A 5D1RA 4ICHA 3ANGA 2ZOZA 2ID3A 2VUMJ 2B63J 2G0EA 3JRFA 2K9NA 3E7QA 4HKUA 3LSJA 4JL3A 2R5ZA 2FD5A 4DW6A 1MBJA 2WUIA 2Y9ZA 5F0FA 3ON2A 2EH3A 5HBUA 2AO9A 1JKQC 4XIDA 2DMUA 1K61A 3LHQA 1ETKA 5EG0B 4XRSA 1IG7A 2X6OA 2I10A 4BBRJ 4LOCA 4A3LJ 3GBGA 3B81A 2YS9A 3G1OA 2FBQA 3PASA 5EEAA 4IHXA 5FMPA 3RZOJ 5CXGA 3VVYA 2HXOA 1VNDA 2CQQA 3BR3A 1W0UA 1MSEC 3WHBA 2EQRA 3HKZN 2JA8J 1I50J 3HOWJ 2IBDA 2JMWA 4IHWA 1BJZA 1RPWA 4C2MJ 1JUMA 3CCYA 4V2FA 5DS9A 1ZK8A 3RZDJ 1Z0XA 2CUEA 4G12A 1UHSA 5J1YA 3HOUJ 4DZPA 4Y52J 1ITYA 1PUFB 3ANPA 5E3MA 3H3VK 2D6YA 2MGQA 3JRIA 2R7ZJ 3BTJA 2LKXA 2WV1A 5K7ZA 4UDSA 4B3AA 2NVTJ 3F1BA 2L7MP 1MNMC 5D19A 4RBOA 2HDDA 3F0CA 3O8HA 4UUSA 5C4XJ 5EDNA 2UXIA 3HDDA 2LR8A 2HOTA 3IUVA 2JN6A 1RESA 4GCKA 1QRYA 1RKTA 2EZLA 1R9TJ 3RKQA 2Y2ZA 4D7NA 3SJMA 4PXIA 1AKHA 1POGA 2EZHA 2L7ZA 4A3EJ 4B4CA 2YUSA 4DYCA 1TWHJ 3IH2A 1ETQA 1B8IB 5EYRA 5CW8A 4GCTA 4CYCA 2NS8A 2XGCA 2HYJA 2XGDA 3RH2A 1LE8B 3S1MJ 2QWTA 2OPTA 2RAEA 2R0QC 3HOYJ 5C3EJ 4JYKA 1HCRA 2E1OA 2ELKA 2M34A 4MXMA 5J3LA 5CXIA 1XC5A 1FIAA 3K2AA 2M9HA 2P81A 4J19A 4JX4A 1UI6A 3VUQA 2LFBA 2HXIA 2HYTA 4W97A 1Z77A 5IOZA 4XRSG 4X6AJ 3VPRA 2JA6J 2VPRA 4DYRA 2G7SA 3BTLA 1QVUA 4MFEA 1OFCX 3OIOA 3OOUA 3GTQJ 2VI6A 2PBXA 2E2JJ 4M3GA 5EF6A 3IV5A 4B1RA 1ENHA 2E2IJ 2GUHA 3BR5A 3NNRA 2CJJA 1U9NA 2E19A 2Y31A 3VW0A 4FISA 3PO2J 2QKOA 2TCTA 4XRMA 3CQZJ 3JREA 4A3DJ 3BG3A 4XICA 2RASA 4M3FA 1Q1VA 1IGNA 1B72A 5F0CA 5IYDJ 2DG7A 4MFDA 5HODA 1T33A 2WGBA 3VVZA 4D5FA 2EZKA 3GTKJ 1IDYA 1HDDC 2OI8A 3BTIA 2DTZA 5HSZA 5IYCJ 4M3BA 5M3FJ 2QIBA 1HLVA 2K9QA 3I4NJ 2IEKA 1QPIA 1H8AC 3V6GA 3DEWA 5F27A 2L7FP 5FGLA 4S0HB 1WH5A 1GV2A 4ACIA 2LTPA 5IP7J 1JGGA 2DA3A 3GTGJ 3GZIA 3HTJA 2UXOA 3HTAA 3CRJA 3Q0VA 3S17J 2NS7A 3HEFA 1F43A 3HM5A 4BBSJ 2IU5A 3BQYA 3LNQA 2H1KA 5FKNA 1MBFA 3RQIA 1RKWA 2DJNA 3FIWA 5F04A 3OSFA 3G56A 3NARA 4MIMA 3TW7A 1LFUP 1O4XA 4EEFG 3MNLA 4A3KJ 2MG4A 3AQSA 3S1QJ 5EZGA 1YRNA 3T6NA 1VI0A 2DA6A 5C44J 3GTPJ 2DN0A 2XPVA 1GV5A 4A3IJ 1ORKA 1ZGWA 2TRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6Z A;  3HOX J;  1AU7 A;  3CJD A;  5IP6 A;  2O7T A;  5EGO A;  4JKZ A;  5C4J J;  4RDU A;  2ZOY A;  1ZTR A;  5FKM A;  2XSD C;  3VIB A;  3ZQG A;  2NP5 A;  2GFN A;  5J1R A;  2K40 A;  1ETV A;  2DMQ A;  4ME9 A;  2JK3 A;  2M2E A;  2VKV A;  1JTX A;  3FK7 A;  1WGX A;  4X1E A;  2DMT A;  1IV6 A;  3FK6 A;  3D1N I;  4L62 A;  3TED A;  3QPL A;  2NVY J;  3JRG A;  3CMY A;  1G2H A;  4A3J J;  2UXH A;  2V57 A;  2DA2 A;  5JLX A;  2GBY A;  3FKI J;  3WHC A;  2DA4 A;  2O7O A;  4I76 A;  3BTC A;  3SDG A;  1JKP C;  3VOK A;  1H89 C;  2HOS A;  2UXU A;  3SFI A;  3GTM J;  2XDN A;  3DPJ A;  3Q3S A;  3S14 J;  5E3O A;  2R5Y A;  4V2G A;  3NAU A;  3FIS A;  4AC6 A;  3KZ9 A;  3S15 J;  2KT0 A;  3COL A;  4DZJ A;  2CRG A;  4XK4 A;  5DTD A;  2E2H J;  3VW2 A;  3B6C A;  1E3O C;  3S1N J;  2M0C A;  5FHP A;  2LD5 A;  1OCT C;  3HGY A;  2WAQ N;  1MBG A;  3QPS A;  5GPA A;  3IH3 A;  2ECC A;  3H0G J;  5EG0 A;  1JUS A;  5K58 A;  3BQZ A;  1XS9 A;  2K9S A;  3EUP A;  3QQA A;  1P7I A;  3CWR A;  2XGE A;  4AF5 A;  1TWA J;  2ECB A;  1JKO C;  3TP3 A;  3PO3 J;  3BG9 A;  3HGG A;  2QF7 A;  5M5X J;  4MK6 A;  1A5J A;  2R5Z B;  3OSG A;  1IRZ A;  3BRU A;  2PMZ N;  3JRD A;  1CQT A;  3PPB A;  2LY9 A;  2DG8 A;  3C2B A;  3V78 A;  3QBM A;  3LOC A;  3LSP A;  1TWF J;  4W1U A;  1NTC A;  4GFB A;  1AHD P;  2DA1 A;  5EFY A;  3ZQI A;  2OF7 A;  4M6V A;  1SAN A;  3A02 A;  3E7L A;  3HB9 A;  1PUF A;  4A93 J;  3LWJ A;  3DCF A;  5EZH A;  3ZQL A;  5E3N A;  3Q0W A;  4MLO A;  4QSH A;  5AQC A;  2JA5 J;  5FKK A;  1FTT A;  1OCP A;  2LVS A;  1T56 A;  4BXX J;  3BG5 A;  1EF4 A;  1JTY A;  2LK2 A;  1NK3 P;  3VP5 A;  3KKD A;  5K7H A;  4DYQ A;  2NVX J;  1U78 A;  2YU9 J;  3MKL A;  3IH4 A;  3GEU A;  1WH7 A;  3S16 J;  3L1P A;  1X58 A;  3HE0 A;  3HTI A;  2HQ5 A;  4A3B J;  2ME0 A;  3JRH A;  2R92 J;  2HI3 A;  3B6A A;  3BR1 A;  2QCO A;  2X48 A;  3O60 A;  2Y30 A;  3EGQ A;  1TWG J;  2N8G A;  1NK2 P;  5IPA A;  4C3J J;  1B8I A;  2UXP A;  2VKE A;  3HOZ J;  5C4Y A;  4IHY A;  5F08 A;  2OER A;  2NOG A;  1U9O A;  4AC0 A;  1LE8 A;  4IHV A;  2WB1 N;  1ETX A;  3ZQH A;  1MBK A;  1JT0 A;  1AKH B;  4JP0 A;  1JKR C;  1WCM J;  1FIP A;  2DMN A;  3PM1 A;  5BNG A;  2NX4 A;  1JJ8 C;  1BW5 A;  4CYC B;  2L9R A;  5IOY A;  3BR2 A;  3S1R J;  2ZCM A;  2XPU A;  1W0T A;  2FJ1 A;  4MO7 A;  3W6V A;  2IAI A;  3FRQ A;  1ZR2 A;  1U8B A;  1IDZ A;  3BCG A;  2EBI A;  5IYB J;  4A3F J;  3JSJ A;  4D5C A;  5M5Y J;  1VFC A;  3M4O J;  4UUT A;  4FE4 A;  3G7R A;  3HOV J;  1OJL A;  3S2H J;  3NXC A;  1FJL A;  3MN2 A;  4YZE A;  2KDZ A;  2F07 A;  1UMQ A;  4C3I J;  1D5Y A;  5GPC A;  2GLO A;  2O9L A;  2O8K A;  2JA7 J;  3ZQC A;  2G7G A;  2ZCX A;  3VW1 A;  4GCL A;  2CUF A;  2H8R A;  3UKG A;  1IC8 A;  1GUU A;  2Y9Y A;  4ABZ A;  2ZCN A;  3JRC A;  4A3G J;  4JX5 A;  3TP0 A;  3BHQ A;  2QTQ A;  3KKC A;  1TWC J;  1IJW C;  2W53 A;  2Y0S N;  4L5E A;  5K7F A;  1UI5 A;  1S7E A;  2L0K A;  4BKX A;  5FJ8 J;  3G1M A;  4A3C J;  1BA5 A;  4GFL A;  5HAW A;  4BY1 J;  4NN1 A;  1JT6 A;  4A69 C;  3A01 B;  2G3B A;  1WPK A;  3K7A J;  4AYB N;  5F1J A;  1B72 B;  3JR9 A;  2X9D A;  3S5R A;  3QKX A;  3HIM A;  3O8G A;  1GDT A;  2CU7 A;  5F0H A;  4JX6 A;  4FTH A;  1JJ6 C;  3P9T A;  1XG1 A;  2DA7 A;  3JRB A;  2EZI A;  2W48 A;  4FE7 A;  4JNN A;  3TW6 A;  2CQX A;  2HKU A;  1GT0 C;  2LLK A;  1A6I A;  1ZQ3 P;  1I3Q J;  5GP9 A;  1X2N A;  2AHQ A;  3VVX A;  3LJL A;  4HNV A;  3S2D J;  5H9T A;  2NVQ J;  2YVE A;  2ID6 A;  2GEN A;  5M3M J;  1MSF C;  1LFB A;  1ETO A;  1UG2 A;  2REK A;  3Q0U A;  3I4M J;  1ZR4 A;  1HOM A;  3LSG A;  2FQ4 A;  2FX0 A;  5FLV A;  3A03 A;  1MBE A;  1H88 C;  2XRL A;  3HTH A;  1BW6 A;  5FLM J;  4FCY A;  4KWA A;  5FKO A;  4C3H J;  4IEJ A;  1YRN B;  2MSY A;  2RHA A;  3ZQF A;  2LP0 A;  3BR6 A;  3BT9 A;  1FEX A;  1MH4 A;  2D5V A;  4M3D A;  1BL0 A;  3KNW A;  4QTR A;  2MW8 A;  2XPW A;  3BNI A;  2ME6 A;  4Y7N J;  2COB A;  2G7L A;  2ZB9 A;  2Q24 A;  5EGO B;  3RD3 A;  2PZ9 A;  2QOP A;  1SFO J;  3JRA A;  4CGR A;  5M5W J;  1RET A;  4NEL A;  2XB5 A;  2NP3 A;  1MH3 A;  3BR0 A;  1Y1V J;  3VOX A;  5JLW A;  1Y1W J;  1JUP A;  2GM4 A;  3C07 A;  2XB0 X;  1FTZ A;  1F36 A;  3A01 A;  3GTJ J;  2R93 J;  1RR7 A;  3LSR A;  3GTL J;  1P7J A;  1IUF A;  2M8G X;  4UUS B;  1HF0 A;  3G1L A;  5J1U A;  4D7M A;  3NRG A;  1QVT A;  3CDL A;  5FKL A;  1MBH A;  5DAJ A;  2HOA A;  3MVP A;  4QIW N;  1TC3 C;  2DA5 A;  1DU0 A;  3NPI A;  1GVD A;  3M3Y J;  3NI7 A;  3HBL A;  2YVH A;  3GTO J;  1ETY A;  2DMP A;  2JJ7 A;  1DU6 A;  4M3E A;  4NDL A;  4BY7 J;  1VF9 A;  4GFK A;  3BJB A;  1ETW A;  3ZOB A;  3ON4 A;  1WI3 A;  2R5Y B;  1ZKG A;  9ANT A;  4A3M J;  1X2M A;  1K83 J;  5E3L A;  1APL C;  1HDP A;  4AUX A;  1I6H J;  2JWT A;  5IP9 J;  1SGM A;  3AQT A;  5D18 A;  5D1R A;  4ICH A;  3ANG A;  2ZOZ A;  2ID3 A;  2VUM J;  2B63 J;  2G0E A;  3JRF A;  2K9N A;  3E7Q A;  4HKU A;  3LSJ A;  4JL3 A;  2R5Z A;  2FD5 A;  4DW6 A;  1MBJ A;  2WUI A;  2Y9Z A;  5F0F A;  3ON2 A;  2EH3 A;  5HBU A;  2AO9 A;  1JKQ C;  4XID A;  2DMU A;  1K61 A;  3LHQ A;  1ETK A;  5EG0 B;  4XRS A;  1IG7 A;  2X6O A;  2I10 A;  4BBR J;  4LOC A;  4A3L J;  3GBG A;  3B81 A;  2YS9 A;  3G1O A;  2FBQ A;  3PAS A;  5EEA A;  4IHX A;  5FMP A;  3RZO J;  5CXG A;  3VVY A;  2HXO A;  1VND A;  2CQQ A;  3BR3 A;  1W0U A;  1MSE C;  3WHB A;  2EQR A;  3HKZ N;  2JA8 J;  1I50 J;  3HOW J;  2IBD A;  2JMW A;  4IHW A;  1BJZ A;  1RPW A;  4C2M J;  1JUM A;  3CCY A;  4V2F A;  5DS9 A;  1ZK8 A;  3RZD J;  1Z0X A;  2CUE A;  4G12 A;  1UHS A;  5J1Y A;  3HOU J;  4DZP A;  4Y52 J;  1ITY A;  1PUF B;  3ANP A;  5E3M A;  3H3V K;  2D6Y A;  2MGQ A;  3JRI A;  2R7Z J;  3BTJ A;  2LKX A;  2WV1 A;  5K7Z A;  4UDS A;  4B3A A;  2NVT J;  3F1B A;  2L7M P;  1MNM C;  5D19 A;  4RBO A;  2HDD A;  3F0C A;  3O8H A;  4UUS A;  5C4X J;  5EDN A;  2UXI A;  3HDD A;  2LR8 A;  2HOT A;  3IUV A;  2JN6 A;  1RES A;  4GCK A;  1QRY A;  1RKT A;  2EZL A;  1R9T J;  3RKQ A;  2Y2Z A;  4D7N A;  3SJM A;  4PXI A;  1AKH A;  1POG A;  2EZH A;  2L7Z A;  4A3E J;  4B4C A;  2YUS A;  4DYC A;  1TWH J;  3IH2 A;  1ETQ A;  1B8I B;  5EYR A;  5CW8 A;  4GCT A;  4CYC A;  2NS8 A;  2XGC A;  2HYJ A;  2XGD A;  3RH2 A;  1LE8 B;  3S1M J;  2QWT A;  2OPT A;  2RAE A;  2R0Q C;  3HOY J;  5C3E J;  4JYK A;  1HCR A;  2E1O A;  2ELK A;  2M34 A;  4MXM A;  5J3L A;  5CXI A;  1XC5 A;  1FIA A;  3K2A A;  2M9H A;  2P81 A;  4J19 A;  4JX4 A;  1UI6 A;  3VUQ A;  2LFB A;  2HXI A;  2HYT A;  4W97 A;  1Z77 A;  5IOZ A;  4XRS G;  4X6A J;  3VPR A;  2JA6 J;  2VPR A;  4DYR A;  2G7S A;  3BTL A;  1QVU A;  4MFE A;  1OFC X;  3OIO A;  3OOU A;  3GTQ J;  2VI6 A;  2PBX A;  2E2J J;  4M3G A;  5EF6 A;  3IV5 A;  4B1R A;  1ENH A;  2E2I J;  2GUH A;  3BR5 A;  3NNR A;  2CJJ A;  1U9N A;  2E19 A;  2Y31 A;  3VW0 A;  4FIS A;  3PO2 J;  2QKO A;  2TCT A;  4XRM A;  3CQZ J;  3JRE A;  4A3D J;  3BG3 A;  4XIC A;  2RAS A;  4M3F A;  1Q1V A;  1IGN A;  1B72 A;  5F0C A;  5IYD J;  2DG7 A;  4MFD A;  5HOD A;  1T33 A;  2WGB A;  3VVZ A;  4D5F A;  2EZK A;  3GTK J;  1IDY A;  1HDD C;  2OI8 A;  3BTI A;  2DTZ A;  5HSZ A;  5IYC J;  4M3B A;  5M3F J;  2QIB A;  1HLV A;  2K9Q A;  3I4N J;  2IEK A;  1QPI A;  1H8A C;  3V6G A;  3DEW A;  5F27 A;  2L7F P;  5FGL A;  4S0H B;  1WH5 A;  1GV2 A;  4ACI A;  2LTP A;  5IP7 J;  1JGG A;  2DA3 A;  3GTG J;  3GZI A;  3HTJ A;  2UXO A;  3HTA A;  3CRJ A;  3Q0V A;  3S17 J;  2NS7 A;  3HEF A;  1F43 A;  3HM5 A;  4BBS J;  2IU5 A;  3BQY A;  3LNQ A;  2H1K A;  5FKN A;  1MBF A;  3RQI A;  1RKW A;  2DJN A;  3FIW A;  5F04 A;  3OSF A;  3G56 A;  3NAR A;  4MIM A;  3TW7 A;  1LFU P;  1O4X A;  4EEF G;  3MNL A;  4A3K J;  2MG4 A;  3AQS A;  3S1Q J;  5EZG A;  1YRN A;  3T6N A;  1VI0 A;  2DA6 A;  5C44 J;  3GTP J;  2DN0 A;  2XPV A;  1GV5 A;  4A3I J;  1ORK A;  1ZGW A;  2TRT A; 
#chains in the Genus database with same CATH topology
 1OYI A;  2OC6 A;  3CJD A;  4II3 A;  1TLH B;  2BY1 A;  4U0Y A;  3LSH A;  5C4J J;  4RDU A;  3MKZ A;  2FF4 A;  2M7A A;  1LVA A;  3VIB A;  3ZN0 A;  1YHQ I;  1SMY F;  2A6T A;  4CCJ A;  5J1R A;  4KNY A;  2QEN A;  5H2F C;  2LDU A;  2BHZ A;  4ME9 A;  2JK3 A;  2M2E A;  1KZH A;  3G71 I;  1T8I A;  1JTX A;  2GXG A;  3DF8 A;  3FXO A;  4ZZL A;  2QEX I;  1WVR A;  2OUM A;  4XLA A;  3I5U A;  3QPL A;  5K1Y A;  4YIR X;  3HRU A;  5HDG A;  3BJA A;  1CF7 A;  2V57 A;  3OY9 A;  1A04 A;  2F5V A;  3T1B A;  1A6Q A;  1RR8 C;  5DD8 A;  3FKI J;  2DA4 A;  3I56 I;  4I76 A;  3CO6 C;  2IS1 A;  2ZBK A;  2O8X A;  3F8B A;  1X4O A;  1BI2 A;  3I3L A;  2LRD A;  4PUS A;  2HOS A;  2YX4 A;  3E6D A;  3DPJ A;  1D5V A;  3KLO A;  2KRH A;  4QWQ A;  1Z67 A;  1E2X A;  3K4J A;  1F4K A;  1TW3 A;  3PQJ A;  4DNC A;  2D1V A;  1HKT A;  4XLF A;  2CRG A;  4XK4 A;  4ZDP A;  3SZT A;  3T8T A;  2X0L A;  2OBP A;  4XRF A;  1LNW A;  4CUG A;  4DGW B;  3IUO A;  5BMZ A;  1OCT C;  3WTW C;  4WCG A;  2XAQ A;  4M73 A;  2ECC A;  3H0G J;  2DPD A;  5K58 A;  5CQE A;  1XS9 A;  1Z91 A;  3CWR A;  1P7I A;  2XGE A;  3QP5 A;  5HS7 A;  2ECB A;  3TP3 A;  1FLI A;  1EJ9 A;  1R36 A;  3IAM 2;  3LA2 A;  3HGG A;  3W2W A;  1IRZ A;  2HOE A;  1OR7 C;  2K4B A;  2DG8 A;  4RA2 A;  5HS9 A;  2E1C A;  1WFX A;  3HIF A;  1AWC A;  3DV8 A;  1EH8 A;  3LOC A;  4N9H A;  2L54 A;  2LH9 A;  1FP1 D;  2NYX A;  3QOP A;  1NTC A;  3WU1 B;  2XRO A;  5EFY A;  5H20 A;  4PSX A;  3ZQI A;  2K86 A;  3LFK A;  1MIJ A;  2OF7 A;  4M6V A;  3A02 A;  3CZ6 A;  3HB9 A;  2A69 F;  3VB2 A;  4L9N A;  3DCF A;  5EZH A;  3HSE A;  5E3N A;  3ZQL A;  4GGG A;  3N97 A;  2HDC A;  1X1B A;  4MLO A;  2BHY A;  4KUM A;  5HDK A;  5HLG A;  2R7O A;  3V42 A;  5FKK A;  2BZT A;  1T38 A;  1FTT A;  3LAJ A;  2VKH A;  2KRF A;  3BG5 A;  3IC7 A;  2ELH A;  2NVX J;  1U78 A;  4ENK A;  3MKL A;  5KHD A;  2LMD A;  1WH7 A;  1T0F C;  1X58 A;  3ABL H;  3TOB A;  2BY2 A;  2XIG A;  2IGK A;  2ME0 A;  3TO9 A;  3LAP A;  2QCO A;  2X48 A;  3L2Q A;  2OV7 A;  3GVA A;  2Z9O A;  3FHN A;  2Y30 A;  3VYU B;  1TQP A;  1IZ1 A;  1Z6T A;  3ZR8 X;  2N8G A;  4XMY A;  3SEZ A;  4G7H F;  1SAX A;  2CV2 A;  2VKE A;  4LLN A;  1UHW A;  2KIS A;  1ZG5 A;  5L3G A;  1YJN I;  1LE8 A;  1Z1D A;  1YIO A;  3CES A;  5D8K B;  4IRV A;  3CF2 A;  2Z1D A;  4Q4Z F;  3RSN A;  2NNY A;  2OQG A;  3G73 A;  2X1C A;  3FBI B;  2G9W A;  2JT1 A;  4ENM A;  3ASO H;  4XSZ F;  3K4L A;  3GXO A;  3F23 A;  3EUA A;  1FOX A;  1P4A A;  3QYE A;  4OWR B;  1T6S A;  2PEX A;  2E35 A;  2EBI A;  5CKT A;  3CUO A;  4BHP A;  5FRN A;  3C2G A;  5A2Q Z;  3CC2 I;  4CCO A;  1VQM I;  4AIK A;  4YZE A;  2VC0 A;  3CJQ B;  3TQN A;  5KCM A;  2WY7 Q;  1SEU A;  3DPT A;  1D5Y A;  2JA7 J;  2O8K A;  1GLN A;  2OD5 A;  4Q48 A;  3ZQC A;  3J80 Z;  3DLA A;  2ZCN A;  1H9G A;  4HDV A;  5LGT A;  3J7Y J;  3QOD A;  3QAH A;  1VQ8 I;  4A3G J;  3KKC A;  3O2P E;  1TWC J;  1IJW C;  4Q47 A;  2Y0S N;  4ZC3 A;  5IT3 A;  2L0K A;  2DYR H;  1WJD A;  3HG9 A;  4XLN F;  2E71 A;  4XN3 A;  2E36 A;  3HYI A;  1JT6 A;  3VYT B;  5BPI A;  3BPX A;  3PJR A;  1H0M A;  2XUB A;  4A69 C;  1W7P B;  1S7O A;  3JTH A;  1YYV A;  3VDX A;  4I09 A;  3JR9 A;  4O3M A;  3FX3 A;  1ZEL A;  2ZNY A;  2FA5 A;  2L7K A;  3K4K A;  4AIJ A;  1L3L A;  2A61 A;  3CCU I;  3B02 A;  1K6O A;  5LEK A;  2X6Y A;  1TP4 A;  2DA7 A;  2GXA A;  3JRB A;  2EZI A;  4L18 B;  3K4M A;  3RKY A;  2VT2 A;  2R7W A;  1G3W A;  3W6J B;  3DKX A;  4DJA A;  1A6I A;  3BLY A;  1XMK A;  2FBH A;  2K4J A;  5GP9 A;  4Z2Y A;  4OIN F;  3VVX A;  3TOA A;  5KAF C;  4KMF A;  4BHC A;  3G4S I;  4P96 A;  3V7S A;  2YVE A;  1HW5 A;  4AWX B;  4FQG A;  3F3X A;  2ID6 A;  4LG0 B;  1XCB A;  2O5R A;  1R23 A;  1PP7 U;  1ETO A;  1UG2 A;  4G9Y A;  1N77 A;  2WY8 Q;  1ZRE A;  3CCV I;  2REK A;  4P9U A;  5E79 C;  1KU7 A;  1ZR4 A;  1E3P A;  2FQ4 A;  1YOV B;  1MBE A;  2XRL A;  1KQ8 A;  1S8N A;  3HTH A;  5FLM J;  2F6C A;  2KKO A;  3COA C;  4ZYD A;  4C2M A;  1FYM A;  3LL7 A;  1TTY A;  3PQK A;  1YW7 A;  4YRV A;  3CMA I;  1X19 A;  3BT9 A;  2RNJ A;  3ZQ7 A;  1JE8 A;  2A2F X;  3RJP A;  3A0H C;  4OU0 A;  5FD6 A;  3FXM A;  4QTR A;  5GAH J;  3AG2 H;  3BNI A;  2ME6 A;  1FOW A;  2V79 A;  3DPU A;  3E6C C;  2Q24 A;  2EIK H;  4EQQ A;  1PDN C;  4CGR A;  1I39 A;  3CC7 I;  5FLX K;  1C0W A;  2FXA A;  3MD2 A;  2L3D A;  1MH3 A;  1DPU A;  3BR0 A;  1Y1V J;  2HQN A;  3GZ6 A;  3HHG A;  3R60 A;  2HNH A;  2XB0 X;  1D0Z A;  3IKT A;  3E6M A;  1K7A A;  3TGN A;  4NNJ A;  1CF7 B;  3EYY A;  1RR7 A;  1F9N A;  2A5W A;  3D5R C;  1FOK A;  3KEO A;  4OAZ A;  1MGT A;  4FT8 A;  2QYO A;  3NRG A;  1IRX A;  3WTY C;  3VWB A;  5DAJ A;  4UVB A;  2EA2 A;  3LST A;  4QIW N;  2DA5 A;  2WB1 A;  1Z9C A;  1W5C C;  1FBQ A;  3REO A;  3N05 A;  2E1M C;  3M3Y J;  4AM3 A;  3NI7 A;  2CFX A;  3SHF A;  3CD6 I;  1V54 H;  1ZKG A;  9ANT A;  1E17 A;  3DTK A;  2H6C A;  4ZYE A;  2K85 A;  1SGM A;  1KU3 A;  2ZOZ A;  2ID3 A;  2O61 A;  2VUM J;  2K9N A;  1N25 A;  2QQA A;  1P6R A;  2F5C A;  2A6H F;  3K4B A;  1QNT A;  2QUF A;  4ZH4 F;  1ZG1 A;  5FFX A;  1G59 A;  4CGZ A;  3ZMZ A;  2IS2 A;  3GLL A;  2GA2 A;  1K61 A;  1ETK A;  4XRS A;  2VQL A;  3TO7 A;  4A3L J;  3DBH B;  1JGS A;  2FUG 2;  3LQR A;  5EEA A;  2Q1Z B;  2WAE A;  4IHX A;  3RZO J;  2HXO A;  4HX8 A;  5D6F A;  1VND A;  4ETS A;  1W0U A;  1MSE C;  2HQA A;  5FFZ A;  5CVI A;  3WOD F;  3HOW J;  2ESH A;  2JMW A;  1WQ2 A;  4DVY P;  3F21 A;  1BJZ A;  3AG1 H;  3GFL A;  5DS9 A;  1Z0X A;  2EIL H;  4CZZ A;  1QGP A;  4MQV A;  2RVC A;  3SFZ A;  3OOP A;  1HBX G;  5D5V B;  1G3S A;  2MGQ A;  3BZ6 A;  3BTJ A;  1VQ7 I;  3PNT A;  2KL4 A;  3W6K B;  5K7Z A;  2XVC A;  4E7K A;  2L7M P;  5D19 A;  2HDD A;  3GWZ A;  5L3B A;  5EDN A;  1K79 A;  3HDD A;  2LR8 A;  4HRI A;  3IUV A;  1RES A;  4GCK A;  1Q1H A;  2JQ7 A;  3RPU D;  2ZSI B;  4KT5 C;  1SD6 A;  1AKH A;  4RAY A;  4LGW A;  4A3E J;  1FP2 A;  1W4M A;  4B4C A;  1IXS B;  3O6B B;  1XSD A;  3T5X A;  1V4R A;  4GCT A;  4CYC A;  1OYW A;  3ABU A;  3MKY B;  1LE8 B;  1ACI A;  2E1O A;  4A0X A;  2H09 A;  4MXM A;  5J3L A;  4OIQ F;  4YEL A;  2HVS A;  3BOQ A;  1O3Q A;  3KP6 A;  4B09 A;  1VQ5 I;  3VUQ A;  2Z2S B;  4DQ2 A;  2VOD A;  4XRS G;  4HV5 A;  5B1A H;  1QVU A;  5CQG A;  2VI6 A;  2QLZ A;  3MZ8 A;  4Y13 A;  4M3G A;  4NQW A;  1P92 A;  2JA2 A;  4A0Z A;  1WHU A;  2W24 A;  1ENH A;  2DT5 A;  3MQ0 A;  1BR1 A;  1ZRF A;  3BR5 A;  3NNR A;  2Y0M A;  2CJJ A;  4EJU A;  1U9N A;  1X1A A;  1BR2 A;  3DU6 A;  4U87 A;  3PO2 J;  4KT6 A;  4XRM A;  2QKO A;  3HXL A;  1OIS A;  3JRE A;  1SAU A;  4EM1 A;  3K70 C;  2PLY A;  1LEA A;  2P4W A;  3BC8 A;  1D8K A;  3BG3 A;  3G3Z A;  3RIR A;  1TT5 B;  5F0C A;  4MFD A;  5HOD A;  2K27 A;  1BR4 A;  1HW1 A;  2WGB A;  3OIP A;  3VVZ A;  2EZK A;  5LBQ A;  4PK4 A;  3CCQ I;  1SVL A;  2O03 A;  4F52 A;  3ML6 A;  5IYC J;  3HC7 A;  3QPT A;  1V5G A;  1HLV A;  3TL4 X;  5HLI A;  3VSK A;  2X85 A;  4LIT A;  4NHJ A;  5DUI A;  1GXQ A;  3H3U A;  3V6G A;  1WJ5 A;  4BS9 A;  3DEW A;  2BE5 F;  4ZYA A;  4S0H B;  4HX4 A;  4DBQ A;  4ACI A;  3QU3 A;  4KIB A;  2BYV E;  5IP7 J;  1RI7 A;  1JGG A;  5AIQ A;  3OWT A;  4EJT A;  3AKZ A;  1KYW A;  3FBN B;  3CRJ A;  1STZ A;  2B3W A;  2NS7 A;  3E3V A;  3KCC A;  1YO5 C;  2X1E A;  3SDB A;  4GCV A;  1B4A A;  2FBK A;  1BIB A;  1RKW A;  2DJN A;  4I0B A;  4EMS A;  4ZYG A;  4MIM A;  4EEF G;  2PI0 A;  2DI3 A;  3MNL A;  5ED4 A;  1YRN A;  3T6N A;  1VI0 A;  5C44 J;  3D5S C;  2KZV A;  2QQB A;  1DP7 P;  2XPV A;  2EV0 A;  2LKP A;  2W1O A;  2G7H A;  4A3I J;  5GAG J;  2MH2 A;  4I6Z A;  2HS5 A;  3L9F A;  3JAM Z;  4HF0 A;  1I27 A;  3RDI A;  5E18 F;  4JKZ A;  2P7C B;  3OYG A;  2ZOY A;  1ZTR A;  2XSD C;  5ICC A;  4BNC A;  2K40 A;  1ETV A;  1UHM A;  4B47 A;  4OAY A;  2Q2E A;  2YPR A;  1XD7 A;  3J81 Z;  2K5C A;  2ZC2 A;  1VQ9 I;  2VKV A;  3FK7 A;  3KZZ A;  2DMT A;  3LFU A;  3F9K A;  4LK1 F;  2NVY J;  2R7U A;  4UHT A;  1SVO A;  2CQN A;  2DA2 A;  3F6V A;  3WHC A;  4HF1 A;  2O7O A;  3SDG A;  1LB2 A;  4L0Z B;  3VOK A;  3JSO A;  2HPM A;  3AG3 H;  4HAM A;  3SQN A;  1LJ9 A;  4R79 A;  3GCM A;  2CUZ A;  1S6L A;  4LFU A;  4P1W A;  2L4A A;  2ELJ A;  2R5Y A;  3U2R A;  5ILV A;  2V6C A;  3NAU A;  2MC4 A;  4AC6 A;  3ZMT A;  1P2F A;  2VOP A;  1G3Y A;  1LDJ A;  3S15 J;  3COL A;  5DTD A;  2Z3Y A;  4CHU A;  4L9T A;  4WWC A;  2V7F A;  3V7C A;  1E0E A;  2M0C A;  2ZXW H;  3KLN A;  3M9A A;  1SD4 A;  3HGY A;  3DLL F;  2FNP A;  4L9V A;  2WAQ N;  3OL3 A;  2WBM A;  3IH3 A;  2IP2 A;  2HEO A;  4WXC A;  1JUS A;  1R1U A;  3V8J A;  2LBF B;  3EUP A;  2P6T A;  2E34 A;  1MDM B;  2CV0 A;  2R3S A;  3HSF A;  3R6S A;  2UZK A;  1X3U A;  3BG9 A;  1GXP A;  4MK6 A;  3M1C A;  2VQG A;  3GX4 X;  2PMZ N;  4CCL A;  2W7N A;  1VQ4 I;  2VAS A;  2UV1 A;  3LWF A;  5AON A;  1BOA A;  5FGM A;  1TWF J;  2MFZ A;  4W1U A;  1OPC A;  4GFB A;  2IXS A;  2DA1 A;  4KA4 A;  2DDA A;  1SAN A;  4FAS D;  4EJV A;  3LWJ A;  2FRH A;  2Q0O A;  2DQR A;  2NS0 A;  1ZG3 A;  2XAG A;  1WJE A;  3OYC A;  2P5K A;  2QSF X;  3Q0W A;  5AQC A;  4FX0 A;  2LVS A;  1HQC A;  1T56 A;  4E7S A;  2IT0 A;  3VP5 A;  2LK2 A;  1NK3 P;  1KA8 A;  5K7H A;  4DYQ A;  1VQP I;  4K2E A;  2FSW A;  3GZN B;  3S16 J;  3HE0 A;  2W25 A;  4AD9 A;  4IVN A;  3DP7 A;  2ZNZ A;  3JRH A;  2XF6 A;  4L9J A;  2R92 J;  1TQI A;  4U9N A;  3TDU C;  1DGW Y;  2A68 F;  3EGQ A;  4L5J A;  2ISY A;  1NK2 P;  1Z05 A;  2MBF A;  2ESN A;  3DXJ F;  5IPA A;  4C3J J;  2CW7 A;  2M4K A;  5C4Y A;  2HWV A;  3HJE A;  4XOP A;  4UB6 C;  4M9X A;  4IHV A;  1FT9 A;  3ISP A;  2ZKZ A;  5JFR A;  1MBK A;  1JT0 A;  2LG4 A;  1AKH B;  4JP0 A;  5IY5 H;  3QYB A;  4BH9 A;  1UAA A;  1R00 A;  2UXX A;  3KEY A;  5BNG A;  2NX4 A;  2HTS A;  4CYC B;  2L9R A;  3BR2 A;  3NRV A;  1W0T A;  2FJ1 A;  4HSR A;  4BAC A;  4BQN A;  1OCR H;  2L9V A;  4XR6 A;  4BJ5 C;  1H9T A;  1IW7 F;  1NG6 A;  1IDZ A;  3BCG A;  1OKR A;  3H9Q A;  5IYB J;  3ZMS A;  4U9L A;  5M5Y J;  3M1E A;  3DFG A;  2XKO A;  4UUT A;  3G7R A;  2IS6 A;  1OJL A;  1QZY A;  1REP C;  1USS A;  3MN2 A;  2KDZ A;  2F4M B;  2M5W A;  1UMQ A;  2GLO A;  1JXS A;  4RAZ A;  2O9L A;  3VW1 A;  1IC8 A;  4ABZ A;  2QKL B;  4A6D A;  3JRC A;  4JX5 A;  4RAG A;  2WV0 A;  4G8X A;  4HQE A;  4CCK A;  1B1B A;  4NB5 A;  5K7F A;  3H1C A;  1VTN C;  1S7E A;  3IAS 2;  1UZC A;  4BKX A;  3G1M A;  4F3Q A;  4A3C J;  1BA5 A;  5HAW A;  3KEQ A;  4UB8 C;  2OQR A;  2L5Q A;  4YIF A;  5F1R A;  3OS1 A;  3A01 B;  1B6A A;  1WPK A;  1P9Q C;  4AYB N;  1MMS A;  2EA4 A;  2X9D A;  4HA8 A;  1TNT A;  3HSR A;  4PZJ A;  3QKX A;  1WJF A;  3IL2 A;  3HIM A;  3W3C A;  3CJN A;  1T95 A;  3KP2 A;  5F0H A;  2EIN H;  4JX6 A;  1MJA A;  4QPQ A;  3P9T A;  1KU9 A;  3KX2 A;  2ISZ A;  3TW6 A;  1IXC A;  2GA1 A;  1R5I D;  2LLK A;  3I64 A;  4AIH A;  1SMT A;  2VJJ A;  1SFK A;  1X2N A;  4UVC A;  4AVP A;  2FJI 1;  4XKW A;  2D1H A;  1S5L C;  3BRO A;  1PVE A;  1J5Y A;  2NVQ J;  1BI1 A;  2MC3 A;  2R7X A;  4BDZ A;  2AXL A;  2Y48 A;  3R4K A;  5M3M J;  4CH7 A;  1LPQ A;  2GEN A;  2Y69 H;  1HKS A;  2STT A;  1WJA A;  3R0A A;  2Y75 A;  2STW A;  2RNG A;  3KZY A;  5FLV A;  3TMO A;  1W7P D;  1H88 C;  3P9I A;  1IRG A;  1MMG A;  2R7F A;  1MMN A;  5FKO A;  1VQO I;  1Y39 A;  1CGP A;  2F2E A;  1YRN B;  1NG7 A;  3ZQF A;  2K3F A;  4IZZ A;  2QM3 A;  5CLS A;  1RUO A;  1VZ0 A;  2RGV A;  2MYS A;  5CJ9 A;  3GW2 A;  5CPR B;  2MW8 A;  5ICG A;  3WTS C;  1J9I A;  3DEE A;  3E5X A;  1KON A;  2ZB9 A;  4IJA A;  4UNO A;  5GTI C;  1SFO J;  4XLE A;  4BYY A;  1FOY A;  2NP3 A;  5JLW A;  4HV6 A;  1ODD A;  3DQV C;  3C07 A;  3OR1 C;  2ZFW A;  3FMR A;  5L3E A;  4MEY F;  3VYR B;  2R93 J;  3LSR A;  2M8G X;  1X4P A;  1IN7 A;  4OD5 A;  3R61 A;  3SEQ A;  3CDL A;  2P5L C;  3BG6 A;  4XBF A;  3L2C A;  1T98 A;  4Y17 A;  1TC3 C;  2W4S A;  1DU0 A;  3CTA A;  3NPI A;  1GVD A;  3NQO A;  3H3Z A;  3HBL A;  2XDV A;  2HU9 A;  3GTO J;  2WAD A;  3FZV A;  4RGX A;  4Z6Y A;  4GFK A;  2HFH A;  1Y0U A;  1IV8 A;  1UFM A;  1WI3 A;  3PUF A;  3ZOB A;  3CCE I;  2R5Y B;  3H5A A;  2BGC A;  1K83 J;  4XLH A;  1I5Z A;  1ZHF A;  1APL C;  1I6H J;  3X2Q H;  5IP9 J;  5D18 A;  4B44 A;  4HYE A;  3JRF A;  3E7Q A;  3J7Z I;  2RC4 A;  3LSJ A;  3KYC B;  2R5Z A;  2R7Q A;  3P9K A;  2VJ4 A;  2XAJ A;  4DW6 A;  4D1Q A;  5F0F A;  4EV0 A;  1KYZ A;  2AO9 A;  1JKQ C;  3WG7 H;  4XID A;  3M8F A;  4RGS A;  3EQL F;  5TJJ A;  4N0B A;  1FNN A;  5JI6 A;  2I10 A;  4XQF A;  2AXT C;  2EK5 A;  4LOC A;  2DXI A;  4AID A;  2BV6 A;  4BQA A;  5KK1 A;  2QQ8 A;  1HXD A;  4BHB A;  2FBQ A;  2OU2 A;  5FMP A;  2F4O B;  5CXG A;  1R5G A;  3F6O A;  2R4G A;  3RKW A;  2CQQ A;  3BR3 A;  3WTZ A;  2EQR A;  2Z16 A;  1FX7 A;  3HKZ N;  3G6E I;  3RI4 A;  2UWM A;  5EEG A;  4E6K G;  3OL4 A;  1I50 J;  2DTR A;  2FOK A;  2E1N A;  2IBD A;  3H92 A;  3GZ5 A;  4KN7 X;  5BQT A;  2OTL I;  4JBA A;  1UJ8 A;  3I54 A;  2COM A;  4HNT A;  1ZGA A;  1ZK8 A;  2HZT A;  3HOU J;  1U2W A;  1Z3Y A;  1ZAO A;  1N78 A;  4WIB A;  2CH0 A;  2XV4 S;  2QWW A;  4RB0 A;  3ZN1 A;  3JRI A;  2R7Z J;  2RDP A;  3K1P A;  4PJL A;  1FY7 A;  4DIQ A;  1RUN A;  4YFK F;  4HF2 A;  3P9C A;  2GZW A;  1I1G A;  1MNM C;  3OYJ A;  1RIO H;  4UUS A;  3O8H A;  3ZGK A;  3BWG A;  3GF2 A;  2ZSH B;  2J5P A;  2QQ9 A;  3OIQ A;  5LRR A;  2M30 A;  2OCE A;  3KE2 A;  4HW0 A;  3OS2 A;  3IRQ A;  4OD4 A;  3LA3 A;  3K2Z A;  5DCM A;  1ZGJ A;  4TV7 A;  2LNB A;  2L7Z A;  1TBX A;  3V8L A;  2YUS A;  4F55 A;  2M45 A;  2FE3 A;  5IT9 Z;  5CW8 A;  4UY8 I;  2NS8 A;  2QWT A;  2R0Q C;  1P4W A;  4BAY A;  3CMM A;  4PDK A;  4XL9 A;  5FB2 A;  1HCR A;  2XKP A;  1BI0 A;  2ELK A;  4LMY A;  1B9N A;  1XC5 A;  1FIA A;  3PFI A;  3L2R A;  2M9H A;  2P81 A;  4J19 A;  3PSI A;  1UI6 A;  1OLT A;  2LFB A;  2JUG A;  2HXI A;  4IOA F;  1MD0 A;  1Z77 A;  3RKX A;  3EDP A;  5IOZ A;  3L2V A;  3CCR I;  1HW2 A;  3DBR B;  4DYR A;  1OFC X;  4ZYH A;  3HOS A;  3RPU A;  5K5R A;  1Z7L A;  2VL8 A;  3MKW B;  1T39 A;  1F5T A;  2E2J J;  1IN8 A;  1MKM A;  3P5J A;  2DOD A;  4ZJZ A;  1WKM A;  4B1R A;  5HOO A;  1EV7 A;  3LMM A;  4IO9 F;  2E2I J;  4HDU A;  1N75 A;  2ETH A;  2UUZ A;  2HVQ A;  2Y31 A;  5E8I A;  1ULY A;  2A3S A;  5ICE A;  3GFJ A;  2EJR A;  2E1M B;  4F7Z A;  1S72 I;  2MH9 A;  4I02 A;  4A3D J;  4UVA A;  2PQ8 A;  4LB6 B;  5J8C A;  3GYH X;  1TL8 A;  4UUV A;  3BTI A;  2DTZ A;  2V26 A;  4BU2 A;  6PAX A;  3VEP A;  4EJW A;  2QIB A;  4ENN A;  4IRG A;  2IPQ X;  4CIC A;  2ZJR F;  4D0P A;  3K70 D;  1YX3 A;  3I55 I;  3PUB A;  4L0Y B;  5CYV A;  4YII A;  1GV2 A;  2EFQ A;  1FC3 A;  4NC8 A;  2H27 A;  3HPG A;  3WTV C;  2K7L A;  2YX7 A;  2DFI A;  1ERD A;  1ONV A;  4M72 A;  4NC6 A;  2P5V A;  2EFO A;  2UXO A;  3HTJ A;  2EB7 A;  3D0S A;  3HEF A;  4P9F A;  1U8R A;  5KNL A;  1ZRD A;  3LNQ A;  1MBF A;  3GLX A;  3VYS B;  2ACJ A;  1D1B A;  3EPZ A;  5D6E A;  3LSI A;  2L01 A;  3TW7 A;  1LFU P;  3I58 A;  2IGO A;  3K0L A;  4EGY A;  3AFH A;  2B7E A;  5DYM A;  3WG9 A;  1FZP B;  2DA6 A;  1D8J A;  3HPH A;  3VSL A;  4E7Z A;  3L09 A;  2LF8 A;  1HSJ A;  4BGD A;  3E5U A;  3MCZ A;  2BVM A;  2DU9 A;  2TRT A;  3HOT A;  2A05 A;  3HOX J;  2LKS A;  3S8P A;  5BS6 A;  3DEU A;  2ICW G;  1YE9 A;  5LRS A;  3C7J A;  5FKM A;  3HL2 A;  2GFN A;  1XGN A;  2MD0 A;  5DCF A;  2KZG A;  1UCR A;  4U7D A;  4E7H A;  1W5S A;  4X1E A;  1WGX A;  1ZLJ A;  1IV6 A;  1MZB A;  4L62 A;  2HDW A;  1S7A A;  3CUQ A;  1HA8 A;  3TED A;  1QHH D;  2ZY9 A;  2V9K A;  3CMY A;  2NRA C;  2UXH A;  5JLX A;  2BEO A;  3ZRG A;  2DFF A;  2ZJ2 A;  2GOX B;  3BTC A;  2QA4 I;  2F48 A;  3E0J B;  1J2X A;  5DEQ A;  3S3N A;  1H89 C;  4IL6 C;  3U21 A;  4CO8 A;  3SFI A;  1K4S A;  2UXU A;  2XDN A;  2BBY A;  1XDU A;  2LOO A;  4KIS A;  3Q3S A;  1VQ6 I;  4XON A;  3NEU A;  3TKY A;  5E3O A;  2R7R A;  1QZE A;  2KQR A;  4RM2 A;  1WWX A;  3FIS A;  3KZ9 A;  1R1V A;  4HPQ A;  2KT0 A;  3B73 A;  3PNY A;  2E2H J;  3VW2 A;  2EPF A;  1D1A A;  3TDZ C;  4BE2 A;  1E3O C;  2M8E A;  3S1N J;  2XAH A;  4UV8 A;  2LD5 A;  1R1T A;  2WTE A;  3GEZ A;  3RQ4 A;  4EM0 B;  1MBG A;  4EM2 A;  3QPS A;  5GPA A;  5LD2 C;  3QU6 A;  2KHM A;  2PN6 A;  5EG0 A;  3KP4 A;  1X3Z B;  3BQZ A;  2VLA A;  3LSM A;  2HGC A;  2BY3 A;  2K9S A;  3V8K A;  4WK8 F;  3QQA A;  4AF5 A;  1SFX A;  1ON2 A;  2WC2 A;  1JKO C;  2VE9 A;  2E60 A;  3PO3 J;  4M9S A;  1V5F A;  2QF7 A;  2JSP A;  5M5X J;  2R5Z B;  3SWH A;  3U1K A;  2NOJ B;  5H6Q A;  3IKV A;  4KJZ A;  3KZI C;  1MW7 A;  1LVK A;  3C2B A;  2F4I A;  4HBL A;  2DPU A;  3QBM A;  2JRM A;  3LA7 A;  3LSP A;  3V78 A;  1DUX C;  2NAZ A;  3Q5F A;  3FXK A;  2QBY A;  3JW4 A;  3RYP A;  2H6B A;  3E7L A;  3RTR A;  1PUF A;  2X4H A;  3OYB A;  2DOA A;  4G94 A;  3KET A;  2VPL A;  5GAD J;  2OA4 A;  1QA6 A;  1U3E M;  5D5W B;  2J5O A;  4M74 A;  4QSH A;  1OCO H;  2FML A;  4U0V A;  3QRF F;  2ZJP F;  1OCP A;  4M71 A;  4BXX J;  1V55 H;  5J40 A;  2FNA A;  2YU9 J;  1YS6 A;  3VOD A;  3GEU A;  3ASN H;  4UV9 A;  3HTI A;  2H94 A;  5E8G A;  1J09 A;  4BEH A;  4FET A;  2HQ5 A;  4A3B J;  3K8P C;  4MQ9 F;  2CMP A;  3O3K A;  5BOX A;  4BXU A;  3O60 A;  4XN0 A;  5ERI A;  1YQA A;  4F92 B;  4C2U A;  1FSH A;  2RN7 A;  4RB2 C;  4I98 B;  2OER A;  5F08 A;  4BJT A;  4QPO A;  1U9O A;  4P5O A;  4PJM A;  2DFE A;  4AC0 A;  2GOM A;  1ETX A;  2BXZ A;  3ECO A;  4ITV A;  4Q5S F;  1TT0 A;  2VT3 A;  1BIA A;  3CME I;  5DCM B;  3NWT A;  1JKR C;  1WCM J;  4RLF A;  2PJR A;  4C30 A;  3DTI A;  2XC7 A;  4KYW A;  2DMN A;  3W2A A;  3FXR A;  3ERM A;  3RYR A;  4XLP F;  4M6X A;  3PNV A;  4MHG A;  4IQJ A;  3S1R J;  2VOO A;  3CP8 A;  2XPU A;  4CCM A;  4CZC A;  4I2O A;  2A07 F;  3W6V A;  4N4O B;  1MND A;  2IAI A;  3I9V 2;  3ZMV A;  3FRQ A;  1ZR2 A;  1E3H A;  3WU0 A;  3EYI A;  4D9J A;  1A35 A;  3JSJ A;  4D5C A;  5FLX Z;  1LDK B;  4Y33 A;  3QWL A;  3IP4 B;  1XMX A;  3HOV J;  2HZD A;  4N4N B;  1FJL A;  4I0A A;  4RGR A;  1G8X A;  3GUD A;  1W36 D;  5JVT A;  4DBR A;  4C3I J;  3IHU A;  2ZCX A;  4MTD A;  2H8R A;  2Y9Y A;  2PFB A;  3ONQ A;  3CLO A;  3BHQ A;  3TP0 A;  2QTQ A;  2KIQ A;  4IHS A;  2W53 A;  5GAE J;  3FXJ A;  4IKF A;  4L5E A;  4YFN F;  2IA1 A;  4YEJ A;  3D5L A;  4GFL A;  4LD5 A;  2PMU A;  4BY1 J;  1X3W B;  2CS3 A;  1OQY A;  4G7Z F;  2E7W A;  5HLH A;  2W85 A;  4BDY A;  1DGR M;  3CO7 C;  2VXZ A;  5F1J A;  4G6D A;  3H5N A;  3CCS I;  3S5R A;  5B3S H;  2EV6 A;  4V19 K;  3V4G A;  3O8G A;  2L9N A;  5L3D A;  4KIT B;  3ABK H;  2CU7 A;  1GDT A;  3I59 A;  2X1D A;  4OIR F;  1JJ6 C;  2QVO A;  1FYK A;  1XG1 A;  2QKM B;  3QP6 A;  3AL0 C;  4EVI A;  2W48 A;  4FE7 A;  4JNN A;  1QO0 D;  3NWS A;  4E7J A;  2CQX A;  1Y8R B;  1GT0 C;  5AIP A;  2X6X A;  1ZQ3 P;  3I71 A;  2QSG X;  3KP5 A;  1EH7 A;  1U6G A;  3KPH A;  1IO2 A;  3DWL E;  3L00 A;  5H6R A;  1Z3X A;  2WAQ A;  3LJL A;  2CQ7 A;  3S2D J;  4CSW A;  5B1B H;  2QGU A;  3FXU A;  1MSF C;  4KN4 X;  2D2W A;  2RQQ A;  2VE8 A;  4HEA 2;  3Q0U A;  5J6X A;  3A2K A;  5ICF A;  3I4M J;  3NS4 A;  2XRN A;  2FX0 A;  2JPC A;  2PMZ A;  3FDY A;  3A03 A;  4FCY A;  4C3H J;  3E97 A;  4O5V A;  5LHG A;  3GME A;  2L02 A;  2MSY A;  2RHA A;  2BY0 A;  3N4M A;  3BR6 A;  3ZMU A;  2DQL A;  3F8N A;  5ILU A;  2O3F A;  4WX9 A;  4MEX F;  4BQO A;  3M8E A;  3WU2 C;  4M3D A;  4CDG A;  2UXN A;  3C2H A;  3HRM A;  5CVR A;  3MEX A;  1SD7 A;  2PZ9 A;  4E7L A;  2B0L A;  2QOP A;  3RD3 A;  3JRA A;  5M5W J;  3MMY B;  1RET A;  2LRE A;  1IN5 A;  2XB5 A;  1LQ1 A;  4NEL A;  1QPM A;  5A2Q K;  1VQK I;  1MMD A;  1XGO A;  1JUP A;  3FXQ A;  4ZTJ A;  4EAT A;  4ASN A;  4IQ4 A;  4A12 A;  3J7A Y;  2DBB A;  1W7P A;  3CUQ B;  1F36 A;  2L2O A;  4HLX A;  3UNG C;  4FX4 A;  3J80 K;  3GTJ J;  4EJO A;  2BOL A;  1IUF A;  1AA7 A;  1HF0 A;  5FRM A;  3F72 A;  1OCZ H;  3G1L A;  5J1U A;  4LJZ F;  2OZU A;  5FKL A;  2HQR A;  1MBH A;  2P8T A;  3K4C A;  2HOA A;  4XKB A;  2VB6 A;  3H9G A;  3HRS A;  1U5T A;  4QLC U;  1QZZ A;  4J00 A;  3CUQ C;  1DQU A;  1ETY A;  2DMP A;  4M3E A;  1W1W E;  4F91 B;  3OYF A;  3M07 A;  3BJB A;  1ETW A;  2G7U A;  1X2M A;  3R0J A;  2IGM A;  5E3L A;  1F1Z A;  1HDP A;  3BJO A;  3WGI A;  2JWT A;  1R6R A;  1BOB A;  2D45 A;  4HLY A;  3SXY A;  5D1R A;  2VBZ A;  2NVU B;  1S9H A;  1I1S A;  2EV5 A;  3ANG A;  3I53 A;  2MAB A;  4IF4 A;  3ZCO A;  4JL3 A;  2ADU A;  3JTG A;  1K78 A;  2WUI A;  3ON2 A;  1EA3 A;  2EH3 A;  4DOZ A;  1M1E B;  3LHQ A;  2HPI A;  5EG0 B;  3CJR B;  2X6O A;  4I99 C;  1BJA A;  2ZO4 A;  4BBR J;  1YTY A;  2YS9 A;  3G1O A;  3SYT A;  5LHH A;  3VVY A;  3AAF A;  2OJE D;  4NQW B;  3WHB A;  1YJ9 I;  1UG0 A;  3K9T A;  3F8C A;  1B9M A;  2JTV A;  2AS5 F;  2P6S A;  2K02 A;  2V1D A;  4RAF A;  1R4N B;  3BZC A;  4GRI A;  3EUK L;  3CCY A;  2QBY B;  4PJ0 C;  1ZRC A;  3RZD J;  2CUE A;  3K1M A;  5HVQ C;  4DZP A;  4GDF A;  3PIO F;  4LG3 A;  1ITY A;  1RRJ A;  1PUF B;  3ANP A;  2R7V A;  5E3M A;  2D6Y A;  4ESF A;  4AYB A;  3WGH A;  3DKW A;  4E7I A;  1R22 A;  1KU2 A;  2L9S A;  1XB4 A;  2LKX A;  5TRD A;  3F8F A;  4Y3O A;  4UDS A;  2NVT J;  3QOE A;  3S32 A;  4RBO A;  2CQK A;  3F0C A;  1V5E A;  3WTT C;  3OYD A;  2HOT A;  2JN6 A;  4BEH B;  5L3F A;  1QRY A;  1ZN2 A;  1RKT A;  2VN2 A;  1WJB A;  2EZL A;  2VJI A;  1R9T J;  1SFE A;  2CSO A;  2Y2Z A;  4D7N A;  2CW0 F;  1POG A;  2IA2 A;  2EZH A;  3HTU A;  4HZF A;  3E1S A;  5ILS A;  4BQQ A;  2VKD A;  5LLQ A;  3ESW B;  3CC4 I;  5EYR A;  3FF5 A;  5BPD A;  2XGD A;  4XOR A;  4MTE A;  3ULQ B;  4HX7 A;  2LYC A;  4JYK A;  1P4X A;  1SC7 A;  2XHK A;  2FQ3 A;  2PJR B;  2VON A;  1J7K A;  2DK8 A;  2WAF A;  3K2A A;  1XDS A;  4OOI A;  3CCM I;  3SZG A;  4U0W A;  2GIV A;  2MLK A;  5JR3 A;  5K5O A;  3CF5 F;  4W97 A;  3GFI A;  2DOE A;  2VBX A;  5D4R A;  4X6A J;  4G6Q A;  2VPR A;  4B3X A;  2G7S A;  4MFE A;  3IRR A;  3OIO A;  2KIM A;  2B9S A;  2X51 A;  3GTQ J;  2P7V B;  5B5E C;  2V6E A;  5E1W A;  3ROU A;  3L7W A;  2QZ8 A;  1PUE E;  1S29 A;  4WXH A;  2GUH A;  3Q9V A;  1L0O C;  2CGP A;  3VW0 A;  2Q2E B;  5TIS C;  5JHF A;  2VIX A;  2Z5U A;  3BZK A;  2ZXJ A;  1R4M B;  1GVJ A;  1YIJ I;  4L5I A;  4ESB A;  2Z33 A;  4XIC A;  3E5Q A;  4M3F A;  1IUY A;  1Q1V A;  1IGN A;  1B72 A;  2DO7 A;  2DG7 A;  1T33 A;  3K6G A;  3GTK J;  1IDY A;  5KAI C;  1HDD C;  3BG7 A;  4RLQ A;  4ZDO A;  1KQ9 A;  3GFM A;  1RNL A;  5HSZ A;  1JHF A;  1YW9 A;  2AQF A;  2K9Q A;  3KYD B;  3F8M A;  3I4N J;  3ECH A;  4LLG F;  1R7J A;  1IAW A;  2W82 A;  1K6Y A;  4YG2 F;  1QPI A;  3H5R A;  1I3A A;  1LFP A;  2DJI A;  2IJL A;  1H8A C;  1TNS A;  5KVR A;  5FGL A;  1WH5 A;  4UXN A;  3A1Y A;  3PFY A;  2LTP A;  2RQP A;  3KYL A;  4II2 A;  2DA3 A;  3I59 B;  3GZI A;  3VTI A;  1I6X A;  3HTA A;  3Q0V A;  2L4M A;  2KJC A;  1F43 A;  1YG2 A;  2RV8 A;  3HM5 A;  2R7D A;  4BBS J;  2IU5 A;  1IN4 A;  5FKN A;  2DDB A;  2V1U A;  1HST A;  2H8W A;  4JOM A;  3RQI A;  2KFD A;  5F04 A;  3OSF A;  3NAR A;  1G4D A;  3G56 A;  4A5M A;  4M9Z A;  3CLQ A;  4A3K J;  2MG4 A;  3AQS A;  3S1Q J;  5EZG A;  5J8F A;  4PSW A;  3GTP J;  2DN0 A;  1GV5 A;  3FXL A;  3DU5 A;  4PCQ A;  1ZGW A;  4ESJ A;  2V4J C;  3HKZ A;  1AU7 A;  5LEJ A;  5IP6 A;  2O7T A;  2Y0S A;  5EGO A;  5K5Q A;  1FMW A;  2KPM A;  2E5Z A;  3ZQG A;  3CDH A;  2NP5 A;  1Y8Q B;  2CYY A;  1SD5 A;  4BUP A;  2P0W A;  1D1C A;  4O6J A;  4B8X A;  2DMQ A;  3KIO A;  2KJB A;  5DD4 A;  3FK6 A;  3D1N I;  2PJP A;  2V1X A;  2XF5 A;  4JQF A;  1ZAR A;  4Y4R A;  3JRG A;  1G2H A;  4RB3 C;  4A3J J;  3C3W A;  2ZXH A;  2KRC A;  2DK5 A;  4PFP A;  2GBY A;  3GO5 A;  2IS4 A;  2LSO A;  3FM5 A;  4KFC A;  1JKP C;  3HTS B;  3RCO A;  4U7B A;  3EUH A;  5F64 A;  1FSE A;  3GTM J;  1VQL I;  3ZP5 A;  3BCA A;  3DPL C;  4LLL A;  3CCJ I;  3S14 J;  1NHA A;  1Z7U A;  2W00 A;  4V2G A;  1LKX A;  2PG4 A;  4OMZ A;  5DDG A;  2V1N A;  3U9G A;  1R49 A;  5E20 A;  2FOW A;  2JSC A;  4DZJ A;  4IRI A;  1G6N A;  4KIG A;  3B6C A;  1U5T B;  2FBI A;  3TBI A;  3OV8 A;  1W5T A;  1WSU A;  1XSX A;  4CXF A;  5FHP A;  1QU3 A;  4HOB A;  2M3A A;  1JHH A;  3C1D A;  3K10 A;  3LQQ A;  4XKV A;  1Y0N A;  5J4V A;  2VBY A;  1YI2 I;  1YW8 A;  4XSX F;  1R71 A;  2MLG A;  1TWA J;  1OCC H;  1YX5 A;  5HLT A;  4AVZ A;  4E4H A;  2CG4 A;  4HG2 A;  1U5T C;  2E5N A;  1PYV A;  2IVM A;  3OSG A;  1A5J A;  1K78 B;  3BRU A;  3JRD A;  1CQT A;  2XGX A;  3PPB A;  2GQQ A;  2LY9 A;  5DM6 F;  5LFA A;  3S93 A;  1O57 A;  1AHD P;  2HR3 A;  2A5Y B;  3WGG A;  4HNU A;  2H1L A;  4PFO A;  1HC8 A;  1TW2 A;  3OYM A;  3WTX C;  4A93 J;  3FMQ A;  3H36 A;  3OS0 A;  4RGU A;  2KLO A;  2M7B A;  3BDD A;  1FBU A;  1UB9 A;  2BW3 A;  2DW4 A;  3M7G A;  3OR2 C;  4KMU X;  4I7H A;  1YLF A;  3JAM K;  2R7S A;  2E7X A;  1R58 A;  2HKO A;  2JA5 J;  1YS7 A;  1EF4 A;  1JTY A;  3KKD A;  5GTH C;  4HQM A;  5DUK A;  1UEL B;  1LDD A;  3IH4 A;  4LK0 F;  2GIZ A;  2OCC H;  3L1P A;  3H0D A;  2CW8 A;  4ZDL A;  3J81 K;  2HVR A;  3ZMD A;  5E1X A;  1MJ9 A;  2HI3 A;  3B6A A;  3BR1 A;  1U0J A;  2I5U A;  1TWG J;  1RC9 A;  1B8I A;  5JVG F;  2UXP A;  4IPA A;  3HOZ J;  4IHY A;  1YIT I;  2NOG A;  2JZY A;  2EIM H;  2JUC A;  3A0B C;  2WB1 N;  4PJN A;  3ZQH A;  4E70 A;  3BCB A;  4WF2 A;  3HUG A;  1FIP A;  5EJC A;  1FMV A;  3U1D A;  3FMS A;  2OTJ I;  3PM1 A;  2IA0 A;  1FWZ A;  1MJB A;  5LHI A;  1ZLK A;  1JJ8 C;  2RKH A;  1BW5 A;  2CUJ A;  2LBF A;  1J0R A;  5IOY A;  5DM7 F;  2LY1 A;  1MDM A;  2ZCM A;  3Q9S A;  1Z6R A;  2AQE A;  4IX7 A;  4MO7 A;  1Z21 A;  3OYN A;  3L2W A;  2GAU A;  4PGH A;  4A2U A;  3OMY A;  1X1D A;  2I8D A;  1U8B A;  3K69 A;  3T8R A;  4A3F J;  3M4O J;  1VFC A;  5HS8 A;  4FE4 A;  2O0Y A;  2DCE A;  3S2H J;  3NXC A;  1MMA A;  2F07 A;  4A6E A;  4AU7 A;  3OYI A;  2G7G A;  5CVU A;  3T0Y A;  5GPC A;  4U88 A;  4GCL A;  2CUF A;  3UKG A;  1QBJ A;  1GUU A;  3BY6 A;  3KP7 A;  5HNF A;  2DT7 B;  1KGS A;  1AOY A;  4ANJ A;  4BXF A;  5LGU A;  1UI5 A;  1EKE A;  3F22 A;  5FJ8 J;  4RS8 A;  2RRE A;  2PX9 A;  4XM3 A;  1BN5 A;  2ZME A;  1DDN A;  4NN1 A;  2PBI A;  4I01 A;  4G7O F;  3HRT A;  4IXA A;  4NBQ A;  4LB5 A;  4N9I A;  4C9Y A;  2G3B A;  3K7A J;  4RB1 A;  4JK1 X;  1B72 B;  2LF7 A;  5F6F A;  2XAF A;  2PMH A;  2IRF G;  2B1E A;  5D4S A;  2VJ5 A;  3H9J A;  4GO1 A;  4J01 A;  4M6Y A;  4FTH A;  2MA3 A;  4R1H A;  2CFO A;  2JVH A;  3IWF A;  3K4N A;  1JI8 A;  3PSF A;  2HKU A;  3PL8 A;  4ENJ A;  2KP6 A;  4PJJ A;  3KFW X;  1I3Q J;  2V9P A;  2AHQ A;  2JVG A;  2F5D A;  3E6B A;  4HNV A;  5H9T A;  4GXO A;  3VOE A;  5JHU A;  5EEH A;  3OYH A;  1XTA A;  2K9M A;  3ELK A;  1LUJ B;  2GWR A;  4XNF A;  1LFB A;  1J75 A;  1OYY A;  3I0T A;  2K9L A;  1RZ4 A;  5D5U B;  1WRJ A;  1HOM A;  3LSG A;  4H4K C;  4B48 A;  5TGT A;  1BW6 A;  2C6Y A;  4CYD A;  4KWA A;  1J59 A;  3L2U A;  3MZH A;  1A36 A;  3W2V A;  4IEJ A;  4G6T B;  2ZCW A;  3S2W A;  5CVV A;  2LP0 A;  3SZP A;  1T08 B;  3UR3 C;  1EH6 A;  1FEX A;  3RPQ A;  4XOT A;  1MH4 A;  4H0E A;  2YU3 A;  4RMN A;  2CWE A;  1PP8 F;  2D5V A;  1WI9 A;  1BL0 A;  2CV1 A;  1VQN I;  3KNW A;  2XPW A;  1S3J A;  5FRO A;  4Y7N J;  2COB A;  5D8L B;  2G7L A;  2KIF A;  2Z99 A;  5EGO B;  2YVX A;  1FPQ A;  1OMI A;  3OYK A;  1A31 A;  2DT6 A;  5DV5 A;  3VOX A;  4GYI A;  2F5F A;  1Y1W J;  3LSK A;  3WE3 A;  2GM4 A;  1XN7 A;  2DLL A;  5HDN A;  1FTZ A;  1XMA A;  1BI3 A;  3A01 A;  2HTJ A;  3S3M A;  3A4C A;  1XX5 A;  2M4G A;  5J4Y A;  1SVM A;  2JRT A;  1K4T A;  3GTL J;  1P7J A;  4P55 A;  4UUS B;  3HZJ A;  4IHT A;  4FHT A;  4D7M A;  2FU4 A;  1XPX A;  1QVT A;  3TO6 A;  3DTE A;  3MVP A;  4ZTF A;  5HNH A;  1Y56 A;  2YSR A;  4LIV A;  4HST A;  2YVH A;  2DAO A;  2NXN B;  1OR7 A;  1HKQ A;  5FD5 A;  2JJ7 A;  1DU6 A;  4NDL A;  1FYL A;  4BY7 J;  1VF9 A;  2VXD A;  3ON4 A;  1GHC A;  1O7F A;  2OZ6 A;  4YFX F;  4C2T A;  4CCN A;  4A3M J;  3ZPL A;  4AUX A;  3AQT A;  5E1Z B;  1KQ0 A;  2ZXI A;  4ICH A;  3S3O A;  2B63 J;  5CVJ A;  2G0E A;  2XAU A;  4B43 A;  2VQH A;  2M1B A;  3MWM A;  3EUH C;  4HKU A;  4F93 B;  2FD5 A;  3G2B A;  3IWZ A;  1MBJ A;  3FHZ A;  2Y9Z A;  2JPB A;  3AG4 H;  5HBU A;  3ABM H;  2EFN A;  2DMU A;  1QHG A;  4R8H A;  3J7A O;  1IG7 A;  1O3R A;  2DOF A;  2EFW A;  3GBG A;  3B81 A;  4LIU A;  4OIP F;  3PAS A;  1TQM A;  2DFH A;  3QYF A;  1T0F A;  2IW5 A;  3WE2 A;  4A5N A;  1WJC A;  2VBW A;  4OMY A;  3VFZ A;  1O3T A;  4RM3 A;  2F5E A;  4KIC A;  1IF1 A;  2JA8 J;  4BE0 A;  3ERE D;  4IHW A;  3P7N A;  1RPW A;  1XGM A;  1JUM A;  2YR2 A;  4KIF A;  4C2M J;  5FO5 A;  4S04 A;  4V2F A;  4OIO F;  1IRF A;  4G12 A;  2W57 A;  1UHS A;  3AL0 B;  5J1Y A;  2XF7 A;  5L3C A;  3OYE A;  3V7R A;  4Y52 J;  2PFV A;  3OYA A;  3H3V K;  1MNE A;  5LGN A;  1T2K A;  3CP2 A;  2DYS H;  4Y15 A;  2KDO A;  3MZY A;  2WA0 A;  1XGS A;  2W84 A;  2BW3 B;  3WTU C;  4BE1 A;  2WV1 A;  4B3A A;  3F1B A;  1XCV A;  2K3P A;  1BM9 A;  3KP3 A;  5C4X J;  2UXI A;  1D3Y A;  1DPR A;  3FM3 A;  3MAJ A;  2KIU A;  3RKQ A;  1B59 A;  4EGZ A;  3SJM A;  4PXI A;  4S05 A;  3ZQQ A;  1NH3 A;  1YFH A;  1R5H A;  2IGN A;  4ON0 A;  2LY2 A;  4GYG A;  4DYC A;  1TWH J;  3PIP F;  3IH2 A;  1ETQ A;  1FBS A;  2ZJQ F;  1B8I B;  2XGC A;  2HYJ A;  2HYG D;  3RH2 A;  3S1M J;  3DBL B;  2OPT A;  2RAE A;  4BJ6 C;  2FMY A;  3HOY J;  5C3E J;  1D0Y A;  4A0Y A;  2M34 A;  2HYF A;  3HUG B;  2Q8K A;  5CXI A;  2KMU A;  1PJR A;  4CA0 A;  2M87 A;  1G3T A;  3QPH A;  4JX4 A;  3K1N A;  3BPV A;  2OAZ A;  1V3F A;  2HYT A;  1BBY A;  1O3S A;  3VPR A;  2JA6 J;  1XSV A;  3BTL A;  4MNU A;  2A6E F;  3OOU A;  1QQI A;  5E17 F;  2PBX A;  1ZH5 A;  5EF6 A;  1UST A;  3IV5 A;  4IRH A;  2O6G E;  2LC2 A;  1TZL A;  4NC7 A;  2FEZ A;  2E19 A;  5B66 C;  4FIS A;  2TCT A;  3EET A;  3CQZ J;  1DP3 A;  3DKY A;  3CDI A;  2RAS A;  1O7L A;  5D5X B;  3JSP A;  5IYD J;  3FWE A;  4NUB A;  1Y6I A;  4D5F A;  2EIJ H;  2OI8 A;  3BJ6 A;  2X6W A;  1IN6 A;  4M3B A;  2ZME B;  4XKC A;  5M3F J;  2GXB A;  4MGR A;  3H35 A;  3C18 A;  2BXY A;  2M0M A;  2XSJ C;  2ZFU A;  4BL0 B;  2IEK A;  2EFP A;  2R7T A;  4X0G A;  5F27 A;  2BVL A;  1LEB A;  2L7F P;  4ZZD A;  3JCU C;  1BC7 C;  3GTG J;  2ZME C;  3M8J A;  1WZ2 A;  4LG0 A;  3I4P A;  4IOC F;  3S17 J;  1X1C A;  3CJT B;  2NNN A;  3BQY A;  2H1K A;  1YJW I;  3MFK A;  3FIW A;  5J47 A;  3CCL I;  4KDP A;  1ZYR F;  1O4X A;  1ON1 A;  2HKX A;  2TDX A;  3OYL A;  3BP8 A;  2VQC A;  3HHH A;  1IXR C;  4XLC A;  1BC8 C;  3FKJ A;  1X1P A;  4PGG A;  1W36 C;  1SFU A;  2WWY A;  5IT9 K;  1D0X A;  4WXD A;  2VC1 A;  1ORK A;  2V9V A;  3ZXS A;  2EWN A;  2QSH X;  3ABT A;  2MD5 A;  2CO5 A;  2XAS A; 
#chains in the Genus database with same CATH homology
 4I6Z A;  3HOX J;  1AU7 A;  3CJD A;  5IP6 A;  2O7T A;  5EGO A;  4JKZ A;  5C4J J;  4RDU A;  2ZOY A;  1ZTR A;  5FKM A;  2XSD C;  3VIB A;  3ZQG A;  2NP5 A;  2GFN A;  5J1R A;  2K40 A;  1ETV A;  2DMQ A;  4ME9 A;  2JK3 A;  2M2E A;  2VKV A;  1JTX A;  3FK7 A;  1WGX A;  4X1E A;  2DMT A;  1IV6 A;  3FK6 A;  3D1N I;  4L62 A;  3TED A;  3QPL A;  2NVY J;  3JRG A;  3CMY A;  1G2H A;  4A3J J;  2UXH A;  2V57 A;  2DA2 A;  5JLX A;  2GBY A;  3FKI J;  3WHC A;  2DA4 A;  2O7O A;  4I76 A;  3BTC A;  3SDG A;  1JKP C;  3VOK A;  1H89 C;  2HOS A;  2UXU A;  3SFI A;  3GTM J;  2XDN A;  3DPJ A;  3Q3S A;  3S14 J;  5E3O A;  2R5Y A;  4V2G A;  3NAU A;  3FIS A;  4AC6 A;  3KZ9 A;  3S15 J;  2KT0 A;  3COL A;  4DZJ A;  2CRG A;  4XK4 A;  5DTD A;  2E2H J;  3VW2 A;  3B6C A;  1E3O C;  3S1N J;  2M0C A;  5FHP A;  2LD5 A;  1OCT C;  3HGY A;  2WAQ N;  1MBG A;  3QPS A;  5GPA A;  3IH3 A;  2ECC A;  3H0G J;  5EG0 A;  1JUS A;  5K58 A;  3BQZ A;  1XS9 A;  2K9S A;  3EUP A;  3QQA A;  1P7I A;  3CWR A;  2XGE A;  4AF5 A;  1TWA J;  2ECB A;  1JKO C;  3TP3 A;  3PO3 J;  3BG9 A;  3HGG A;  2QF7 A;  5M5X J;  4MK6 A;  1A5J A;  2R5Z B;  3OSG A;  1IRZ A;  3BRU A;  2PMZ N;  3JRD A;  1CQT A;  3PPB A;  2LY9 A;  2DG8 A;  3C2B A;  3V78 A;  3QBM A;  3LOC A;  3LSP A;  1TWF J;  4W1U A;  1NTC A;  4GFB A;  1AHD P;  2DA1 A;  5EFY A;  3ZQI A;  2OF7 A;  4M6V A;  1SAN A;  3A02 A;  3E7L A;  3HB9 A;  1PUF A;  4A93 J;  3LWJ A;  3DCF A;  5EZH A;  3ZQL A;  5E3N A;  3Q0W A;  4MLO A;  4QSH A;  5AQC A;  2JA5 J;  5FKK A;  1FTT A;  1OCP A;  2LVS A;  1T56 A;  4BXX J;  3BG5 A;  1EF4 A;  1JTY A;  2LK2 A;  1NK3 P;  3VP5 A;  3KKD A;  5K7H A;  4DYQ A;  2NVX J;  1U78 A;  2YU9 J;  3MKL A;  3IH4 A;  3GEU A;  1WH7 A;  3S16 J;  3L1P A;  1X58 A;  3HE0 A;  3HTI A;  2HQ5 A;  4A3B J;  2ME0 A;  3JRH A;  2R92 J;  2HI3 A;  3B6A A;  3BR1 A;  2QCO A;  2X48 A;  3O60 A;  2Y30 A;  3EGQ A;  1TWG J;  2N8G A;  1NK2 P;  5IPA A;  4C3J J;  1B8I A;  2UXP A;  2VKE A;  3HOZ J;  5C4Y A;  4IHY A;  5F08 A;  2OER A;  2NOG A;  1U9O A;  4AC0 A;  1LE8 A;  4IHV A;  2WB1 N;  1ETX A;  3ZQH A;  1MBK A;  1JT0 A;  1AKH B;  4JP0 A;  1JKR C;  1WCM J;  1FIP A;  2DMN A;  3PM1 A;  5BNG A;  2NX4 A;  1JJ8 C;  1BW5 A;  4CYC B;  2L9R A;  5IOY A;  3BR2 A;  3S1R J;  2ZCM A;  2XPU A;  1W0T A;  2FJ1 A;  4MO7 A;  3W6V A;  2IAI A;  3FRQ A;  1ZR2 A;  1U8B A;  1IDZ A;  3BCG A;  2EBI A;  5IYB J;  4A3F J;  3JSJ A;  4D5C A;  5M5Y J;  1VFC A;  3M4O J;  4UUT A;  4FE4 A;  3G7R A;  3HOV J;  1OJL A;  3S2H J;  3NXC A;  1FJL A;  3MN2 A;  4YZE A;  2KDZ A;  2F07 A;  1UMQ A;  4C3I J;  1D5Y A;  5GPC A;  2GLO A;  2O9L A;  2O8K A;  2JA7 J;  3ZQC A;  2G7G A;  2ZCX A;  3VW1 A;  4GCL A;  2CUF A;  2H8R A;  3UKG A;  1IC8 A;  1GUU A;  2Y9Y A;  4ABZ A;  2ZCN A;  3JRC A;  4A3G J;  4JX5 A;  3TP0 A;  3BHQ A;  2QTQ A;  3KKC A;  1TWC J;  1IJW C;  2W53 A;  2Y0S N;  4L5E A;  5K7F A;  1UI5 A;  1S7E A;  2L0K A;  4BKX A;  5FJ8 J;  3G1M A;  4A3C J;  1BA5 A;  4GFL A;  5HAW A;  4BY1 J;  4NN1 A;  1JT6 A;  4A69 C;  3A01 B;  2G3B A;  1WPK A;  3K7A J;  4AYB N;  5F1J A;  1B72 B;  3JR9 A;  2X9D A;  3S5R A;  3QKX A;  3HIM A;  3O8G A;  1GDT A;  2CU7 A;  5F0H A;  4JX6 A;  4FTH A;  1JJ6 C;  3P9T A;  1XG1 A;  2DA7 A;  3JRB A;  2EZI A;  2W48 A;  4FE7 A;  4JNN A;  3TW6 A;  2CQX A;  2HKU A;  1GT0 C;  2LLK A;  1A6I A;  1ZQ3 P;  1I3Q J;  5GP9 A;  1X2N A;  2AHQ A;  3VVX A;  3LJL A;  4HNV A;  3S2D J;  5H9T A;  2NVQ J;  2YVE A;  2ID6 A;  2GEN A;  5M3M J;  1MSF C;  1LFB A;  1ETO A;  1UG2 A;  2REK A;  3Q0U A;  3I4M J;  1ZR4 A;  1HOM A;  3LSG A;  2FQ4 A;  2FX0 A;  5FLV A;  3A03 A;  1MBE A;  1H88 C;  2XRL A;  3HTH A;  1BW6 A;  5FLM J;  4FCY A;  4KWA A;  5FKO A;  4C3H J;  4IEJ A;  1YRN B;  2MSY A;  2RHA A;  3ZQF A;  2LP0 A;  3BR6 A;  3BT9 A;  1FEX A;  1MH4 A;  2D5V A;  4M3D A;  1BL0 A;  3KNW A;  4QTR A;  2MW8 A;  2XPW A;  3BNI A;  2ME6 A;  4Y7N J;  2COB A;  2G7L A;  2ZB9 A;  2Q24 A;  5EGO B;  3RD3 A;  2PZ9 A;  2QOP A;  1SFO J;  3JRA A;  4CGR A;  5M5W J;  1RET A;  4NEL A;  2XB5 A;  2NP3 A;  1MH3 A;  3BR0 A;  1Y1V J;  3VOX A;  5JLW A;  1Y1W J;  1JUP A;  2GM4 A;  3C07 A;  2XB0 X;  1FTZ A;  1F36 A;  3A01 A;  3GTJ J;  2R93 J;  1RR7 A;  3LSR A;  3GTL J;  1P7J A;  1IUF A;  2M8G X;  4UUS B;  1HF0 A;  3G1L A;  5J1U A;  4D7M A;  3NRG A;  1QVT A;  3CDL A;  5FKL A;  1MBH A;  5DAJ A;  2HOA A;  3MVP A;  4QIW N;  1TC3 C;  2DA5 A;  1DU0 A;  3NPI A;  1GVD A;  3M3Y J;  3NI7 A;  3HBL A;  2YVH A;  3GTO J;  1ETY A;  2DMP A;  2JJ7 A;  1DU6 A;  4M3E A;  4NDL A;  4BY7 J;  1VF9 A;  4GFK A;  3BJB A;  1ETW A;  3ZOB A;  3ON4 A;  1WI3 A;  2R5Y B;  1ZKG A;  9ANT A;  4A3M J;  1X2M A;  1K83 J;  5E3L A;  1APL C;  1HDP A;  4AUX A;  1I6H J;  2JWT A;  5IP9 J;  1SGM A;  3AQT A;  5D18 A;  5D1R A;  4ICH A;  3ANG A;  2ZOZ A;  2ID3 A;  2VUM J;  2B63 J;  2G0E A;  3JRF A;  2K9N A;  3E7Q A;  4HKU A;  3LSJ A;  4JL3 A;  2R5Z A;  2FD5 A;  4DW6 A;  1MBJ A;  2WUI A;  2Y9Z A;  5F0F A;  3ON2 A;  2EH3 A;  5HBU A;  2AO9 A;  1JKQ C;  4XID A;  2DMU A;  1K61 A;  3LHQ A;  1ETK A;  5EG0 B;  4XRS A;  1IG7 A;  2X6O A;  2I10 A;  4BBR J;  4LOC A;  4A3L J;  3GBG A;  3B81 A;  2YS9 A;  3G1O A;  2FBQ A;  3PAS A;  5EEA A;  4IHX A;  5FMP A;  3RZO J;  5CXG A;  3VVY A;  2HXO A;  1VND A;  2CQQ A;  3BR3 A;  1W0U A;  1MSE C;  3WHB A;  2EQR A;  3HKZ N;  2JA8 J;  1I50 J;  3HOW J;  2IBD A;  2JMW A;  4IHW A;  1BJZ A;  1RPW A;  4C2M J;  1JUM A;  3CCY A;  4V2F A;  5DS9 A;  1ZK8 A;  3RZD J;  1Z0X A;  2CUE A;  4G12 A;  1UHS A;  5J1Y A;  3HOU J;  4DZP A;  4Y52 J;  1ITY A;  1PUF B;  3ANP A;  5E3M A;  3H3V K;  2D6Y A;  2MGQ A;  3JRI A;  2R7Z J;  3BTJ A;  2LKX A;  2WV1 A;  5K7Z A;  4UDS A;  4B3A A;  2NVT J;  3F1B A;  2L7M P;  1MNM C;  5D19 A;  4RBO A;  2HDD A;  3F0C A;  3O8H A;  4UUS A;  5C4X J;  5EDN A;  2UXI A;  3HDD A;  2LR8 A;  2HOT A;  3IUV A;  2JN6 A;  1RES A;  4GCK A;  1QRY A;  1RKT A;  2EZL A;  1R9T J;  3RKQ A;  2Y2Z A;  4D7N A;  3SJM A;  4PXI A;  1AKH A;  1POG A;  2EZH A;  2L7Z A;  4A3E J;  4B4C A;  2YUS A;  4DYC A;  1TWH J;  3IH2 A;  1ETQ A;  1B8I B;  5EYR A;  5CW8 A;  4GCT A;  4CYC A;  2NS8 A;  2XGC A;  2HYJ A;  2XGD A;  3RH2 A;  1LE8 B;  3S1M J;  2QWT A;  2OPT A;  2RAE A;  2R0Q C;  3HOY J;  5C3E J;  4JYK A;  1HCR A;  2E1O A;  2ELK A;  2M34 A;  4MXM A;  5J3L A;  5CXI A;  1XC5 A;  1FIA A;  3K2A A;  2M9H A;  2P81 A;  4J19 A;  4JX4 A;  1UI6 A;  3VUQ A;  2LFB A;  2HXI A;  2HYT A;  4W97 A;  1Z77 A;  5IOZ A;  4XRS G;  4X6A J;  3VPR A;  2JA6 J;  2VPR A;  4DYR A;  2G7S A;  3BTL A;  1QVU A;  4MFE A;  1OFC X;  3OIO A;  3OOU A;  3GTQ J;  2VI6 A;  2PBX A;  2E2J J;  4M3G A;  5EF6 A;  3IV5 A;  4B1R A;  1ENH A;  2E2I J;  2GUH A;  3BR5 A;  3NNR A;  2CJJ A;  1U9N A;  2E19 A;  2Y31 A;  3VW0 A;  4FIS A;  3PO2 J;  2QKO A;  2TCT A;  4XRM A;  3CQZ J;  3JRE A;  4A3D J;  3BG3 A;  4XIC A;  2RAS A;  4M3F A;  1Q1V A;  1IGN A;  1B72 A;  5F0C A;  5IYD J;  2DG7 A;  4MFD A;  5HOD A;  1T33 A;  2WGB A;  3VVZ A;  4D5F A;  2EZK A;  3GTK J;  1IDY A;  1HDD C;  2OI8 A;  3BTI A;  2DTZ A;  5HSZ A;  5IYC J;  4M3B A;  5M3F J;  2QIB A;  1HLV A;  2K9Q A;  3I4N J;  2IEK A;  1QPI A;  1H8A C;  3V6G A;  3DEW A;  5F27 A;  2L7F P;  5FGL A;  4S0H B;  1WH5 A;  1GV2 A;  4ACI A;  2LTP A;  5IP7 J;  1JGG A;  2DA3 A;  3GTG J;  3GZI A;  3HTJ A;  2UXO A;  3HTA A;  3CRJ A;  3Q0V A;  3S17 J;  2NS7 A;  3HEF A;  1F43 A;  3HM5 A;  4BBS J;  2IU5 A;  3BQY A;  3LNQ A;  2H1K A;  5FKN A;  1MBF A;  3RQI A;  1RKW A;  2DJN A;  3FIW A;  5F04 A;  3OSF A;  3G56 A;  3NAR A;  4MIM A;  3TW7 A;  1LFU P;  1O4X A;  4EEF G;  3MNL A;  4A3K J;  2MG4 A;  3AQS A;  3S1Q J;  5EZG A;  1YRN A;  3T6N A;  1VI0 A;  2DA6 A;  5C44 J;  3GTP J;  2DN0 A;  2XPV A;  1GV5 A;  4A3I J;  1ORK A;  1ZGW A;  2TRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...