2Y30A

Simocyclinone d8 bound form of tetr-like repressor simr
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
242
structure length
227
Chain Sequence
b'EPVSIWMLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
total genus 85
structure length 227
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y30A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y30A02
2DMPA 3VIBA 4C3HJ 2GLOA 2PMZN 2L7FP 1H88C 5C3EJ 5FGLA 3BG9A 4UUSA 3MN2A 1GDTA 2GENA 1DU0A 4M3DA 3O60A 2I10A 3TEDA 1VF9A 5K7HA 2H1KA 3VVYA 1WPKA 5FLMJ 1QPIA 3P9TA 2LK2A 1FTTA 5K58A 3COLA 3ON2A 3H0GJ 4XK4A 3G7RA 1ORKA 3S15J 4IHXA 2EZHA 3BR1A 2WUIA 3SFIA 3NRGA 2LVSA 2FX0A 5E3NA 2UXHA 4A3LJ 5C4YA 2XRLA 3EGQA 1VFCA 2PBXA 3Q0WA 4A3JJ 1RKWA 2K9QA 4IHWA 1UG2A 5IYCJ 1ENHA 5IYBJ 3BNIA 5J3LA 4A3KJ 5FLVA 3WHCA 2K9SA 3HB9A 4MIMA 3JSJA 1HLVA 3LOCA 4XRMA 2NP3A 3BR3A 3BR5A 3S1RJ 2HOTA 3S17J 3S1MJ 2UXUA 4M3FA 2R5YB 2UXPA 5M5XJ 3VUQA 2XB0X 3PM1A 4RBOA 3LWJA 4XRSG 1IC8A 3BHQA 2HKUA 2IBDA 4GCKA 3LJLA 2D5VA 2ECBA 5BNGA 3VOKA 2KT0A 3HDDA 3G1OA 4L62A 1UI5A 3BJBA 2E2IJ 2G3BA 5HSZA 2EZLA 1F43A 2XPUA 5C4JJ 3KKDA 2K9NA 2HOSA 2Y9YA 2LP0A 4ICHA 2LLKA 1HCRA 5GPAA 4A3IJ 3BTJA 2CUFA 2O7TA 1WH7A 4D5FA 1HOMA 4IEJA 5K7FA 2WV1A 1RKTA 1IDZA 1SANA 1I50J 1AU7A 2ME6A 2F07A 1GT0C 3AQTA 3NI7A 2NVXJ 4QIWN 2GFNA 2XPWA 4MO7A 4C3IJ 1T33A 4BKXA 1Y1WJ 4UDSA 4W97A 1APLC 4FTHA 5EG0B 1FIAA 3HOZJ 4GFLA 3FKIJ 5F08A 3ZQIA 1FJLA 1Q1VA 2NOGA 1NK3P 1MBJA 4B1RA 3CJDA 2NVQJ 5JLWA 2ZOZA 2DMTA 3MVPA 2ZCMA 1IGNA 1Z0XA 3LHQA 4CGRA 3UKGA 1MSFC 1MBKA 2QCOA 3JR9A 4D7NA 1SFOJ 2QKOA 3VW0A 3EUPA 2E19A 1O4XA 5E3MA 4NDLA 2LR8A 5J1YA 3CQZJ 2LY9A 3GTQJ 3ON4A 1X2NA 2R92J 2HI3A 3VVXA 5EYRA 5F04A 4D5CA 2AHQA 1UHSA 1TC3C 3PASA 5M5YJ 1IUFA 1Y1VJ 2RHAA 5M3MJ 5IP7J 2GUHA 1IDYA 3HM5A 3VPRA 2R5ZA 3S2DJ 2VKVA 3BG3A 2HYTA 1I6HJ 2M2EA 2JWTA 1RR7A 3BTIA 1B8IA 2ZOYA 3HEFA 5IYDJ 4RDUA 3CCYA 3QKXA 1H8AC 5HAWA 4HKUA 1LE8B 3JRFA 1WCMJ 1PUFB 3HTAA 3A01A 2V57A 1WI3A 4MFDA 1B72B 5DTDA 2DJNA 2P81A 1ETVA 5M5WJ 5EGOA 2CQXA 2LKXA 3GTOJ 5JLXA 3V78A 5IP9J 3HOWJ 2X6OA 3BR6A 3FRQA 2MW8A 3K2AA 5F0FA 2IU5A 3LSGA 3TP0A 2M34A 3BTCA 2DMNA 4FISA 3VOXA 3I4MJ 2G0EA 2NS8A 5E3LA 5J1UA 2JMWA 3H3VK 3HOXJ 2JA5J 1JKOC 2L7ZA 3CDLA 3Q0UA 3AQSA 3BT9A 3HOYJ 3IH2A 3PO2J 1JKQC 5D1RA 1A5JA 2TCTA 2L0KA 3FK7A 4EEFG 3NAUA 4MXMA 2VPRA 2VKEA 4Y7NJ 4QSHA 3JRAA 2D6YA 5D19A 3Q3SA 3O8GA 1AHDP 1ZK8A 2HQ5A 2DA6A 1GUUA 4FCYA 1BL0A 1ZKGA 4AC0A 1VNDA 1G2HA 2R7ZJ 3ZQFA 1PUFA 3L1PA 4A3EJ 1IV6A 1OCTC 3I4NJ 1WH5A 3G1LA 2ME0A 1OJLA 1Z77A 4JX6A 5GP9A 1JGGA 2R0QC 3RQIA 2CRGA 5F1JA 1HDDC 4BBRJ 5D18A 1BW6A 1ZTRA 2EH3A 4DZJA 1W0TA 1LFUP 2X9DA 3ZOBA 1FEXA 1GV5A 4AF5A 4MLOA 5EF6A 2O7OA 1IG7A 1GVDA 2XGDA 5C44J 3BRUA 4HNVA 1POGA 5IPAA 3GTKJ 1JUMA 3F0CA 3VP5A 4DW6A 3TP3A 4I6ZA 4NELA 1ETXA 3OSGA 2Y31A 2OF7A 1MBEA 5IP6A 1JTYA 1WGXA 2RASA 1XG1A 3WHBA 3QQAA 2MG4A 3CRJA 2IAIA 4GFBA 3HGGA 3O8HA 2CU7A 1TWAJ 3OOUA 3CWRA 2COBA 2R5YA 4GFKA 1U9NA 2E2JJ 4A3CJ 2CJJA 2REKA 4I76A 4A3GJ 1EF4A 3PPBA 3VW2A 5F0CA 4G12A 4L5EA 3S14J 4A93J 3QBMA 4M6VA 2QF7A 3GTGJ 1YRNB 2NX4A 5M3FJ 3ANPA 4JYKA 3KNWA 2JA6J 4X1EA 4D7MA 1JJ8C 2FBQA 2QOPA 2NP5A 2OI8A 5CXGA 3JRGA 2Y30A 3B6AA 3GTLJ 4GCTA 3C2BA 1FIPA 4AYBN 3TW7A 4M3EA 1ETQA 3B6CA 3S2HJ 2NVTJ 2WGBA 3HOUJ 3KKCA 2G7LA 2XGEA 3MNLA 4UUSB 1MBGA 5CXIA 1JTXA 4X6AJ 2LTPA 1IRZA 2DA4A 1U78A 1ITYA 1MSEC 2W53A 1X2MA 4M3BA 3JRBA 1NK2P 1TWHJ 2EZKA 2NVYJ 4A3FJ 4GCLA 3IUVA 1QVUA 1X58A 4CYCB 3MKLA 3BR2A 1ETWA 1I3QJ 2XPVA 3FK6A 3HOVJ 3C07A 4FE4A 4XRSA 2DA3A 3SJMA 2OERA 1UI6A 1S7EA 1TWGJ 2E1OA 2DMQA 2CQQA 5H9TA 1U8BA 5EFYA 1H89C 5EG0A 2L7MP 2MGQA 2W48A 3S16J 9ANTA 2HYJA 4JX5A 4XICA 2EZIA 2ZCXA 3NPIA 4YZEA 3A02A 3RKQA 3RD3A 1JUPA 2GBYA 1ETOA 4A3DJ 4KWAA 1FTZA 4UUTA 3OIOA 2HDDA 3OSFA 3DPJA 3NXCA 4A3BJ 5F0HA 4LOCA 1E3OC 3F1BA 2FJ1A 4J19A 3BQYA 2KDZA 1JJ6C 3HGYA 5HODA 2XSDC 1UMQA 2ID3A 4FE7A 3PO3J 3S1QJ 2EQRA 5IOYA 3VW1A 2YVHA 1XC5A 4V2FA 3HE0A 5FJ8J 3CMYA 3B81A 2O8KA 2DG7A 4NN1A 3GEUA 2AO9A 4DYRA 5EDNA 2DA1A 2JN6A 4CYCA 1AKHB 1BA5A 3Q0VA 2G7SA 1OCPA 3S1NJ 2YS9A 2YVEA 1XS9A 2L9RA 4DYQA 3NNRA 4IHYA 2JA8J 1LE8A 2HXIA 5EZGA 2GM4A 4BXXJ 1RETA 4JKZA 5GPCA 3A03A 2JK3A 1F36A 1B72A 3RZOJ 5FMPA 5FHPA 2M0CA 2Y9ZA 3HKZN 2QWTA 2XDNA 3NARA 3G56A 2VUMJ 2DMUA 2DG8A 2ELKA 3E7QA 3IH3A 3DCFA 1MBFA 5FKOA 5K7ZA 3BG5A 2JA7J 3RZDJ 2LD5A 3ANGA 3QPSA 3E7LA 4JX4A 4BY1J 2NS7A 2TRTA 3LSPA 2LFBA 4A69C 2M8GX 3FISA 3JRDA 1TWFJ 1JUSA 2XGCA 2K40A 4ACIA 5EEAA 1HDPA 2WB1N 2B63J 3GZIA 3BQZA 4DYCA 4B3AA 4AC6A 2WAQN 2Q24A 5CW8A 2DTZA 2ECCA 1GV2A 2DA2A 2FQ4A 3G1MA 4JNNA 2YU9J 2MSYA 2OPTA 2UXIA 4PXIA 2Y0SN 1AKHA 3BTLA 1RPWA 1HF0A 3QPLA 4A3MJ 2X48A 3M4OJ 4ABZA 1ZGWA 2R5ZB 3KZ9A 1P7IA 1W0UA 5AQCA 1QRYA 2R93J 3GTJJ 3JRCA 1B8IB 3JREA 5FKNA 1P7JA 4C3JJ 3JRHA 4C2MJ 3BCGA 4MFEA 3V6GA 3IH4A 2G7GA 4QTRA 2N8GA 3LSRA 1A6IA 2PZ9A 1SGMA 2QTQA 3RH2A 1K83J 1BJZA 3ZQHA 3M3YJ 3A01B 4B4CA 3IV5A 1QVTA 1ETYA 2ZB9A 1LFBA 1R9TJ 2O9LA 1JKRC 1BW5A 2QIBA 5EGOB 1T56A 2EBIA 1IJWC 2VI6A 5E3OA 2HOAA 5DS9A 1ETKA 4W1UA 3S5RA 1OFCX 2RAEA 5DAJA 5FKKA 4XIDA 2CUEA 3W6VA 2M9HA 2HXOA 4MK6A 5IOZA 1NTCA 3ZQLA 2Y2ZA 5HBUA 1MNMC 3HTJA 4ME9A 4IHVA 1MBHA 4M3GA 1JT0A 5EZHA 3ZQGA 2DA5A 3LNQA 5C4XJ 2FD5A 1ZQ3P 3GBGA 5FKLA 3SDGA 4DZPA 3ZQCA 1RESA 1U9OA 1CQTA 1D5YA 3GTPJ 4Y52J 3HBLA 3TW6A 3VVZA 3D1NI 2DA7A 3BR0A 1ZR4A 3JRIA 1JKPC 1ZR2A 5J1RA 2H8RA 3LSJA 4JP0A 2ZCNA 3T6NA 4V2GA 5FKMA 2E2HJ 2YUSA 2UXOA 1TWCJ 5F27A 3DEWA 4BY7J 2JJ7A 4AUXA 1MH4A 3HIMA 1MH3A 1DU6A 3GTMJ 2XB5A 3K7AJ 1YRNA 4JL3A 4BBSJ 3HTIA 1K61A 3HTHA 1JT6A 2ID6A 2IEKA 4S0HB 2DN0A 3FIWA 1VI0A
chains in the Genus database with same CATH superfamily
4L9VA 2DK8A 3HPGA 4IPAA 3FF5A 1BI2A 5ICCA 3E5UA 2WWYA 1VF9A 2OTJI 3VVYA 3D5LA 5EEHA 2QQ9A 3GZNB 4L9JA 1QPIA 2LK2A 2JUGA 2E71A 2DW4A 2EFQA 1SAUA 3L00A 1XSXA 1QO0D 3BR1A 2FX0A 2UXHA 1SFXA 3F8NA 5C4YA 3EGQA 1VFCA 2I5UA 4A5NA 2KLOA 2X4HA 3AG2H 1TQIA 2BY1A 4IHWA 2BY0A 2K9LA 3W2VA 2OQGA 5IYCJ 2QSHX 5IYBJ 3BNIA 2DAOA 5JHUA 5FLVA 4B43A 2EV5A 1TTYA 2BW3A 5FFZA 4ZYGA 4XM3A 4OAYA 2D1HA 2ZXIA 1VQNI 2X51A 2VQGA 3L2VA 1IRGA 2Z3YA 3BR5A 3OOPA 3LQQA 3S1RJ 3BWGA 2PJRA 3S17J 1USSA 2OC6A 1K6YA 2M5WA 4QPOA 2PMHA 2M1BA 2MD0A 4RBOA 4J00A 1IC8A 3PSFA 3VYRB 2HKOA 1IW7F 2HOEA 1R5GA 2CW0F 2IBDA 4GCKA 3B73A 2ECBA 5BNGA 3CLQA 4ZZLA 5KAFC 4LJZF 1K78B 2DYRH 2G3BA 3E6MA 2XPUA 3RYPA 3P7NA 4U0WA 2W85A 4EM2A 1TBXA 2OA4A 1XDSA 3DU6A 3KKDA 2K9NA 3GO5A 2DQLA 2Y9YA 2HOSA 4N9HA 3CF5F 1QBJA 2LLKA 5JHFA 4ICHA 1W5SA 3O2PE 2JQ7A 3I58A 1Y0NA 1MW7A 4NC6A 2WV1A 1MJ9A 1RKTA 1ZGJA 1P4WA 1I50J 4L5IA 3T8TA 1Z7UA 3EETA 1AU7A 1NHAA 3NI7A 4KITB 2XPWA 1X1PA 2R7VA 4BXUA 1HKSA 3H5RA 1LVAA 3OYFA 1OYWA 3PJRA 1WFXA 1APLC 3HOZJ 2OCEA 4A5MA 5JVTA 5F08A 3IRQA 5HS9A 2OUMA 2A6HF 5LGTA 1WJBA 1NK3P 1YG2A 3CJDA 2NVQJ 1R5HA 1ULYA 5JLWA 1IZ1A 2DI3A 1IGNA 1NH3A 3LHQA 1MSFC 4D0PA 3GFMA 2QKOA 1R36A 1D5VA 1I5ZA 2L9SA 3FKJA 1O4XA 3AFHA 1MD0A 2LY9A 1IXSB 5J4VA 1X2NA 5GTIC 4CDGA 2R92J 1YE9A 2GIVA 2LKSA 2M8EA 2Y0MA 4D5CA 5LEKA 3S93A 2LNBA 4RM2A 2A68F 1S7AA 3NRVA 5M5YJ 3NQOA 2RHAA 3GCMA 3LSMA 2EA2A 5IP7J 5HS8A 1IDYA 5FB2A 3MKZA 1W7PB 2KHMA 4O5VA 1X3ZB 2R5ZA 1LDDA 3K69A 2HYTA 1I6HJ 2M2EA 1B8IA 2XROA 1T39A 5IYDJ 3CCEI 2WAQA 1QGPA 2RDPA 5E8GA 1VQ4I 3CCMI 1H9GA 1PJRA 2XHKA 5LEJA 4HKUA 3L2WA 3JRFA 1WCMJ 1PUFB 3CC4I 3CLOA 3HTAA 1WI3A 5M5WJ 1FMVA 2CQXA 4TV7A 4RB2C 1T0FC 2UZKA 1SFKA 1Z1DA 3V78A 1MNDA 4LB6B 4WX9A 2X6OA 3FRQA 2COMA 2QYOA 3K2AA 2HNHA 3M07A 4KMUX 3TP0A 2BVMA 2XC7A 3BTCA 2DMNA 5HLIA 4G6QA 2DT6A 2STTA 1E3PA 2JMWA 3H3VK 1CF7B 2V26A 1BR2A 2UUZA 6PAXA 3CDLA 1R1VA 3FXKA 3AQSA 2Y75A 3ZN1A 5ILUA 1HKTA 4UB8C 1A5JA 4U7DA 4ETSA 4HF2A 4EEFG 5LHHA 4AIKA 3NAUA 4KYWA 3CESA 4MHGA 2VKEA 1IXCA 2ISYA 2QQAA 2XRNA 2P6TA 5D19A 1XX5A 3BZ6A 2D2WA 2VJIA 3UR3C 5LGUA 4GRIA 4AC0A 2KJBA 1FYKA 1K7AA 3G6EI 5B3SH 1QU3A 1QNTA 3H3ZA 4L5JA 1P6RA 3ZQFA 3DP7A 4PFOA 1XGMA 4P9FA 1IV6A 1IRFA 3G1LA 3D5SC 1VTNC 1FP1D 4ZYDA 1E17A 3H1CA 1OJLA 3JW4A 2B7EA 3GWZA 4BBRJ 2MC4A 5D18A 4DQ2A 1H0MA 2LYCA 4BACA 3LSKA 1W5TA 4BHCA 1BC8C 1KQ0A 4MLOA 1J59A 4XOTA 3QU6A 3MWMA 1MGTA 1MKMA 2XGDA 5C44J 1Z05A 4ITVA 2KIUA 2X6YA 4HNVA 5IPAA 3QYFA 3FM3A 2VKDA 3I0TA 3F0CA 3LFUA 4ZZDA 3VP5A 1WJAA 3OR1C 4R1HA 3TP3A 4I6ZA 2PMZA 3ZMVA 3QU3A 2Y31A 2F5VA 2FOKA 2OF7A 5IP6A 1D1AA 1JTYA 1WGXA 2GXBA 2O61A 3F22A 3WHBA 3QQAA 3CRJA 1FX7A 2L02A 2W00A 3K4CA 2Z99A 4KN4X 1OLTA 3BC8A 2K86A 3IRRA 2EILH 2LG4A 3EUHC 3E6BA 3DEEA 1DP7P 2ETHA 4GFKA 4U0YA 3KP4A 2VOPA 4KN7X 2QGUA 2XSJC 3L09A 3V4GA 1GXQA 4AU7A 2ZJPF 1EF4A 1NG7A 3PPBA 4A93J 3ZQ7A 5D5VB 3QBMA 1CGPA 1QHHD 5DUIA 1YX5A 4XLEA 1X4PA 4X1EA 2P5KA 1JJ8C 2A3SA 5CXGA 1VQ7I 1YHQI 1I6XA 1STZA 3JRGA 2NP5A 2OI8A 3MQ0A 4E7LA 3GTLJ 3C2BA 1ETQA 3B6CA 3TO9A 3HOUJ 2G7LA 4D1QA 2H6CA 1JTXA 1WHUA 2LTPA 1MIJA 1SD5A 2QENA 1X2MA 3JRBA 3EUKL 2R7SA 5IT3A 1SVOA 3FWEA 2XDVA 5K1YA 1X58A 4WF2A 4CYCB 4U7BA 2QEXI 3MKLA 3WODF 2CV1A 1ETWA 2WAEA 2XPVA 3HOVJ 4WK8F 3H9JA 1FPQA 5LRSA 1LQ1A 2GA1A 3OMYA 1FP2A 2XVCA 2JRTA 1E2XA 1ONVA 5FFXA 1IRXA 1N75A 2LY2A 1KA8A 1HSJA 1UZCA 2DOEA 2QWWA 5KAIC 2MYSA 4CSWA 3S16J 4JX5A 4MNUA 2IA2A 3NPIA 4YZEA 3A02A 3RD3A 2NS0A 2GBYA 3SZGA 4BGDA 5CJ9A 4LG0B 3KEOA 3GZ6A 1N25A 2L9NA 2H09A 2HDDA 3OSFA 1USTA 1D8KA 2KRHA 3GVAA 2QM3A 4LOCA 2OZUA 4J19A 3VYUB 3ABKH 5HODA 3DWLE 3AAFA 1I39A 2LBFA 4RLFA 2HQNA 4YFKF 3HZJA 4QPQA 3HE0A 1UFMA 5DCMB 1AKHB 3S1NJ 4PJNA 1TNTA 3COAC 4OIOF 2JA8J 2EFOA 4BXXJ 3IWFA 3TMOA 5BQTA 1AOYA 3PUFA 4PCQA 3VFZA 3UNGC 1OCCH 1A35A 4IJAA 2VL8A 2JVGA 4HF0A 1WQ2A 3E7QA 2RQQA 3DCFA 4B8XA 3BJAA 2JA7J 2LD5A 4JX4A 3E7LA 1LVKA 2A05A 4XN0A 2ZKZA 2NS7A 1K6OA 2BY2A 2ISZA 2LFBA 3H5AA 2M8GX 2A2FX 3FISA 3QOEA 1JHHA 5TGTA 4HF1A 3DBHB 1V5GA 3H35A 3MKWB 3BLYA 5CLSA 1HDPA 3SQNA 3OYMA 1LFPA 1YQAA 2B63J 2HVQA 3GZIA 4DYCA 2W82A 4KIBA 5H6RA 1X1BA 5DUKA 3TBIA 1RR8C 4HSTA 4KUMA 3CMAI 5CKTA 2KDOA 3OYDA 3F6OA 4JNNA 1HSTA 1IN6A 2DA2A 5IT9Z 5L3FA 1DGRM 4G6DA 1S5LC 2FUG2 1AWCA 2X48A 3CCUI 2OD5A 2DJIA 4F3QA 1Y6IA 1W0UA 3KZ9A 3GTJJ 3FMSA 2IPQX 3K4BA 3QOPA 3JREA 3V6GA 4MFEA 2J5PA 2JUCA 2PZ9A 1ZH5A 2H6BA 3KE2A 1JHFA 4UVAA 3A4CA 3LAJA 1WJEA 1U0JA 3DEUA 3WTSC 4WCGA 1ETYA 1A6QA 1R9TJ 1OYIA 4PSWA 4BE1A 4ENKA 2IS2A 2EBIA 4LFUA 3U1DA 4LK1F 4KNYA 4B48A 3FHNA 1OFCX 1S3JA 1BBYA 2R3SA 5DAJA 1ZREA 2PMUA 2KISA 1I27A 2Y48A 3ZXSA 3QP6A 4XQFA 2X85A 2ZNZA 1G4DA 3I54A 3FXUA 4Q5SF 5HBUA 2R7UA 4RGSA 4ESBA 3VSLA 4HG2A 4ENNA 2ZBKA 5EZHA 5C4XJ 1FOKA 1EH6A 1ZQ3P 2FNPA 3SDGA 3ASNH 3ZQCA 4FETA 1U9OA 2QQBA 1UAAA 1XGSA 3D1NI 1OCZH 3HRUA 1BR4A 3GFIA 1O3QA 1ZG5A 4BDZA 4IRIA 2E2HJ 2YUSA 2V1DA 1MH4A 1DGWY 2EINH 3HIMA 1C0WA 1DU6A 3F3XA 4ZTFA 3AKZA 2RKHA 3DBLB 3HTHA 1JT6A 3HTIA 1G3SA 5DYMA 4S05A 2JRMA 2J5OA 4M74A 3JSPA 2KP6A 4BQAA 4C30A 5CYVA 2ZSIB 4KFCA 3F23A 5LHGA 5BMZA 1BOBA 2L7FP 5C3EJ 1JI8A 4UUSA 1I1SA 3MN2A 4BJTA 2GENA 4DGWB 4N4NB 5K5QA 3K2ZA 4M3DA 4NUBA 2RC4A 2VQLA 1Z7LA 3TEDA 5K7HA 4M6YA 1WPKA 5FLMJ 1BN5A 1BR1A 4UHTA 5JFRA 3E3VA 1FTTA 3PUBA 3COLA 3H0GJ 3W2WA 3TO6A 2DXIA 4IHXA 4G94A 3SFIA 5E3NA 3K0LA 3SDBA 5HLGA 2MBFA 2XRLA 3Q0WA 1R23A 2K9QA 5J3LA 3BPVA 2O5RA 3WHCA 2K9SA 3HB9A 2GAUA 5TRDA 4ZC3A 4A2UA 2R7QA 2O6GE 3ZGKA 4IQJA 1YITI 3G3ZA 1IN8A 3LL7A 2ZXHA 1MJAA 1KYWA 4NBQA 2HOTA 3ERMA 4M3FA 2XUBA 5ERIA 1QA6A 3VUQA 3S3MA 2F4IA 4CHUA 1HW1A 1R49A 2HR3A 3HUGA 1Z21A 2MLKA 3M7GA 3R4KA 4XRSG 3H0DA 1FNNA 2DO7A 2HKUA 1G3WA 2E1NA 4XLCA 1BC7C 2E7XA 4PSXA 1YJNI 2KIQA 3VOKA 3HDDA 3CCLI 4P96A 3HRMA 3BJBA 2V9VA 4M6XA 4Y17A 1MNEA 4ANJA 1J5YA 1R22A 5FD6A 1R4NB 1OCRH 2LP0A 4AIHA 4XORA 3TDZC 5GPAA 2O7TA 4RMNA 1VQ6I 2V1XA 3CF2A 2XAJA 4D5FA 2IRFG 2OQRA 5ED4A 1TQMA 3KLOA 3E97A 2PX9A 3G71I 1MDMA 2R7XA 3K4KA 2AS5F 3AG1H 3K4JA 5LRRA 2LOOA 1OCOH 4MO7A 3PL8A 2G9WA 1BJAA 4I98B 4XSZF 3DF8A 2BBYA 3F72A 4W97A 1IAWA 2X1EA 4GFLA 3T1BA 3FKIJ 5GAGJ 5J40A 2GXGA 1MBJA 2ADUA 4B1RA 1RC9A 1HC8A 2GQQA 4IRGA 4AIDA 4E7SA 3DBRB 2NVUB 4E7HA 5B66C 3OYCA 3UKGA 3FMRA 2OZ6A 3HRTA 2CH0A 4D7NA 5D5UB 2VQHA 3KCCA 3JR9A 4B44A 1G6NA 4E4HA 1O7LA 2VT2A 5ILVA 5E3MA 2EIKH 1K78A 3AL0C 2XAUA 3M1CA 5J1YA 2CW8A 1D3YA 2HI3A 4I0BA 5EYRA 3MMYB 2FQ3A 3BCBA 1O3RA 3BJOA 4F91B 1XCVA 5M3MJ 4HOBA 1RUNA 2GUHA 3CJNA 2FXAA 1RRJA 1MMDA 1TLHB 1ZLJA 2IA1A 4IOCF 3S8PA 5AONA 3S2DJ 4JK1X 1O3TA 2JWTA 4GYGA 2WB1A 4LK0F 3TO7A 3JCUC 4XLPF 2VIXA 4GO1A 5HAWA 4BL0B 3CDIA 2OJED 1KU3A 3P5JA 3FXOA 5LFAA 1ON1A 3LSHA 2V57A 2ZMEA 3DKWA 1TW2A 4MFDA 1B72B 2DJNA 4D9JA 1ETVA 5EGOA 5F6FA 2MD5A 5JLXA 4MGRA 5IP9J 4E7KA 3BR6A 3J7AY 2MW8A 2IU5A 4B3XA 5L3DA 5JVGF 3DPUA 3RPUA 2M34A 3BCAA 3VOXA 2G0EA 2NS8A 1X4OA 5J1UA 4CCKA 2ZXJA 4HNTA 2CYYA 3HOXJ 2XKPA 2L7ZA 2VLAA 3Q0UA 1Y8QB 3JAMZ 2JPCA 5K5RA 4YELA 2XF6A 2D45A 2TCTA 2VE8A 5A2QZ 1QQIA 1IF1A 2VPRA 2FSWA 4BEHB 2GOMA 2P6SA 2F4OB 2VBYA 4G7OF 4PJJA 3B02A 1AHDP 4KA4A 1ZK8A 2HQ5A 1YJWI 3SEQA 2K02A 2A69F 1DDNA 1Y0UA 1U3EM 1T98A 1PUFA 2WADA 4A3EJ 3ABTA 3CCSI 3ONQA 2PBIA 2ZJ2A 5HNFA 5GP9A 2VBZA 2NYXA 2R0QC 1W0TA 1LFUP 3ZPLA 1GV5A 4EJWA 4G9YA 4K2EA 2Q2EB 1FBSA 2O7OA 4YRVA 5BPDA 5E17F 4U9NA 4ENJA 2M7BA 3FX3A 3LSTA 1A36A 2IGOA 1POGA 3GTKJ 1JUMA 2H94A 1CF7A 3C2HA 4G8XA 3WTUC 4DW6A 2ZO4A 3OSGA 1KQ8A 3QWLA 3RJPA 1XG1A 5FROA 2IAIA 1V55H 1ZLKA 1TP4A 4HEA2 3V42A 3O8HA 1YLFA 3FDYA 1FOWA 2V4JC 2Z33A 4HSRA 1R4MB 5CVJA 2R5YA 3HHHA 1U9NA 3HG9A 2EFPA 4A3CJ 2CO5A 2CJJA 4Y3OA 2KIFA 3S14J 4M6VA 1XSDA 1YRNB 2QSFX 1NG6A 2FEZA 2E5NA 4JYKA 4II2A 1ZRFA 1EJ9A 3KNWA 2B1EA 2QOPA 2ESHA 4L0ZB 1UELB 5E8IA 4IO9F 2UXNA 1F5TA 3V8LA 4IRHA 1J7KA 4AYBN 2H1LA 4M3EA 3J80K 2FOWA 2HKXA 3CJQB 1YX3A 4XKBA 4ENMA 1U78A 1ITYA 4M72A 2V6CA 4RM3A 2NOJB 2NVYJ 4FHTA 4A3FJ 3IUVA 2MH2A 4Z2YA 4XN3A 2HPMA 3I71A 2DYSH 4OD4A 3EYIA 5KK1A 2OV7A 3LA2A 3NWSA 4I0AA 3SJMA 2EV0A 1S72I 3EDPA 3MZ8A 1UI6A 4EATA 3V8KA 1X19A 4AM3A 2DU9A 1TWGJ 2DMQA 5H9TA 2GA2A 5EFYA 4OOIA 3RIRA 3ABLH 1ZHFA 2DODA 2IA0A 5EG0A 1N77A 2BW3B 3GZ5A 1RI7A 2MGQA 2FU4A 4ZDLA 2W48A 3KFWX 4RGUA 3CTAA 2L9VA 3PQKA 3FXLA 3CCJI 3M8FA 1LNWA 9ANTA 2PJRB 2HYJA 1FSEA 3E0JB 3PNYA 2ZCXA 4F92B 5F1RA 1FLIA 3HSEA 1U5TA 4KWAA 4NQWA 3MAJA 3BOQA 3OIOA 4IXAA 3DPJA 4P55A 4CICA 5CVRA 3KIOA 4CCOA 5F0HA 2CV2A 1E3OC 2HZTA 3CCQI 5D4RA 4OMZA 4XRFA 5D6FA 2XSDC 3PO3J 2DOAA 3KZYA 3S1QJ 2PFBA 2RN7A 2O03A 3VW1A 1XC5A 4V2FA 3B81A 5HNHA 4NN1A 4LGWA 3GEUA 4HX4A 4DYRA 3I9V2 1WJDA 2X1CA 4CYCA 4XBFA 1BA5A 1WKMA 1FEXA 3OYLA 1OCPA 2YS9A 4UXNA 4AYBA 1XMKA 4PDKA 1VQLI 2P8TA 3OWTA 4IHYA 1LE8A 4PGGA 4UNOA 3HL2A 3RI4A 1X1DA 2BHZA 2YX7A 1RETA 2K85A 2TDXA 5TISC 5GPCA 3JAMK 2L7KA 1XMXA 2W57A 1F36A 2JK3A 1BI3A 5FMPA 3HXLA 5CVVA 2M0CA 2Y9ZA 1WWXA 2P0WA 4UV9A 2R7WA 1N78A 4CZZA 2DG8A 2ELKA 1XN7A 3IUOA 2ACJA 3OL4A 2WA0A 2Z16A 3GLXA 3BZKA 1Y8RB 5K7ZA 4KISA 1OR7A 4HAMA 3RZDJ 2IGKA 3ANGA 1MJBA 3K1PA 4BY1J 3OY9A 2BYVE 2TRTA 2W25A 3ECHA 4CGZA 3K6GA 2L2OA 4OU0A 5E1XA 1YW8A 4RAZA 3ZMUA 1TWFJ 1JUSA 2JVHA 1XMAA 5EEAA 3K70D 4RAYA 3CO6C 1T08B 4AC6A 2Q24A 1YIOA 3ZMDA 3CC2I 2XF7A 1KYZA 4OWRB 4DOZA 1FT9A 1DQUA 3H3UA 3F8BA 4YIRX 4ESJA 5TJJA 2E1MC 2Y0SN 2NNYA 1AKHA 4XL9A 3QPLA 3FXRA 2LH9A 3M4OJ 1ZGWA 3NWTA 3HOSA 2R5ZB 4BUPA 2R7TA 5AQCA 2R93J 3LWFA 2LF8A 1B8IB 2P7CB 3BCGA 4C3JJ 4E7JA 3Q5FA 4C2MJ 4HPQA 1R6RA 1XGNA 2JZYA 4QTRA 1VQ5I 2G7GA 2RQPA 5DV5A 2UXXA 3W2AA 1SGMA 1BJZA 1K83J 3ZQHA 4Y33A 5KNLA 2ZB9A 3ZN0A 2DT5A 2EK5A 4XKWA 5D4SA 3FXQA 2HOAA 5E3OA 1ETKA 3S5RA 2JA2A 2RAEA 5GAHJ 5ICFA 5GAEJ 5FKKA 2O0YA 4XIDA 4NNJA 1S9HA 3NEUA 4ZH4F 4M73A 4IL6C 2Y2ZA 3RPUD 4IOAF 3I59B 2OU2A 5ICGA 1J2XA 3ISPA 1UG0A 5ICEA 3LNQA 2L54A 3O6BB 1RESA 3GW2A 4Y52J 3HBLA 1QZEA 1ZN2A 4CCMA 2DFEA 4OIQF 3BR0A 1ZR4A 3OYHA 3JRIA 1JKPC 2H8RA 2BXYA 3Q9SA 3AL0B 1PVEA 3WU0A 2P5LC 1QZYA 2AXLA 2JJ7A 4AUXA 4GGGA 3IWZA 1RIOH 3ZRGA 2XB5A 2VPLA 4Q48A 1IUYA 2M30A 4CYDA 3V8JA 4R79A 2BEOA 2LY1A 3OYAA 2OTLI 1VI0A 4WXCA 2DMPA 4C3HJ 2BHYA 5DM7F 1H88C 5FGLA 4LG3A 2E5ZA 3PIPF 3VDXA 2HS5A 4U87A 4EGYA 1FWZA 2EIMH 2I10A 3L2RA 3RSNA 2MA3A 5F64A 4FX0A 3CUOA 3FBNB 4IQ4A 2H1KA 4MEYF 2M4GA 3E6CC 3R0JA 4RGXA 1WJCA 4ZDOA 4P1WA 1EV7A 1Z6TA 5E79C 3ON2A 3FZVA 5K58A 3MKYB 5D6EA 4DBQA 2BOLA 2V6EA 3G7RA 2VXDA 3HC7A 2EZHA 4BHBA 3QODA 4RAGA 4U88A 3NRGA 4A3LJ 2BXZA 2PBXA 4A3JJ 2XV4S 4AVPA 2W84A 1ENHA 1X1CA 3HJEA 4GCVA 3DTEA 1X1AA 4J01A 3TL4X 3ZMTA 2VXZA 3LOCA 2LMDA 4XNFA 4XRMA 4NC8A 4JQFA 1Q1HA 2CMPA 3R61A 2QKMB 4MTDA 2H27A 3S1MJ 2PN6A 3ABMH 2UXPA 5M5XJ 4RA2A 3WTTC 2EIJH 3K70C 3PM1A 2DCEA 3SEZA 5L3EA 2LSOA 4EMSA 1BM9A 2CQ7A 2XKOA 3BHQA 2K9MA 1FZPB 2O3FA 1B9NA 4HW0A 5JR3A 3L2UA 2D5VA 4PZJA 2CSOA 3EQLF 2KT0A 3G1OA 4L62A 1EH8A 4M9SA 5HSZA 3K4NA 4C2TA 2EZLA 3F9KA 2V1NA 2F5CA 1P92A 1B6AA 1F1ZA 5C4JJ 3DLLF 4BHPA 1OPCA 3DU5A 3L2CA 4WIBA 2RGVA 2YVXA 1WH7A 4A0YA 1ZG1A 1HOMA 4IZZA 2CFXA 4EGZA 1XCBA 2JT1A 1SANA 3HHGA 3RDIA 2E1CA 1ACIA 2ME6A 2F07A 4XSXF 3HOTA 2Y69H 1U6GA 2ZMEC 3AQTA 3WTYC 2NVXJ 4QIWN 2GFNA 4HBLA 2HVSA 4ZYEA 3DTKA 1Y1WJ 5HOOA 4EQQA 3K9TA 1VQOI 2DQRA 4C9YA 4MTEA 3ZQIA 1Q1VA 2NOGA 4BS9A 2K4BA 5FD5A 1KU7A 4RLQA 2QBYB 2DMTA 3MVPA 3CP2A 2ZCWA 4QWQA 1XB4A 1TT5B 3PSIA 3DKYA 2CQKA 4XONA 1SFOJ 3VW0A 2CUZA 4ZYHA 2E19A 5GTHC 4S04A 3CUQA 3VODA 4NDLA 2LR8A 3ON4A 4I09A 3GTQJ 1WI9A 1SD6A 3I64A 2VJJA 5D5WB 2QUFA 4DIQA 5F04A 5LD2C 3VVXA 4CXFA 2LBFB 2JPBA 1DP3A 1UHSA 3GX4X 4KIFA 3GFJA 3GF2A 3PASA 3W6KB 1IUFA 3R60A 4JBAA 4CZCA 4IKFA 1FYMA 4YFNF 2NAZA 1S29A 3HM5A 1H9TA 3VPRA 2Z9OA 1XSVA 2KQRA 2NXNB 3SZTA 3K8PC 3H9GA 1ODDA 1RR7A 3BTIA 3G4SI 2ZOYA 1D0ZA 3HEFA 1EH7A 4PK4A 4RDUA 3CCYA 3GEZA 1RNLA 4IF4A 4IHTA 1H8AC 3U1KA 2BGCA 2QKLB 2YR2A 4ON0A 5FRMA 3A01A 3M8JA 4I01A 4BQQA 1J09A 5DTDA 2P81A 1T6SA 2KL4A 2Z5UA 3GTOJ 3LQRA 1Y39A 4C2MA 2WY8Q 3L2QA 2C6YA 3C18A 3OYEA 1O3SA 3LSGA 3ZQQA 3MZHA 2VONA 3OYBA 4O3MA 3J81Z 3I4MJ 5E3LA 1LUJB 2F5FA 2KIMA 5K5OA 1E0EA 2M87A 3DFGA 1MMAA 3MEXA 2VKHA 3BT9A 2YU3A 4RB0A 5J4YA 5EEGA 2X6WA 5D1RA 2IS1A 1D0YA 5DDGA 4PUSA 3CMMA 2OAZA 5L3BA 4MXMA 3F8FA 1R1TA 3FXJA 3V7RA 3JRAA 5D8KB 3OYGA 1TL8A 1IN5A 2D6YA 3Q3SA 4NB5A 3O8GA 1OMIA 5HDGA 2VOOA 4L0YB 2DA6A 3LSIA 1GUUA 4FCYA 1ZKGA 2ELHA 2FE3A 2E7WA 2KKOA 4UVBA 5L3CA 2K7LA 3PNTA 2O8XA 2KFDA 3KZZA 2R7ZJ 1D8JA 3QYBA 1G2HA 3L1PA 3U21A 2LKPA 3RTRA 2R7RA 1OCTC 3EPZA 3F8MA 3LFKA 2IJLA 5E1ZB 2K4JA 2ME0A 4Y15A 2QA4I 2DFFA 1Z77A 1MZBA 2FBIA 4BE2A 2FA5A 4KIGA 5F1JA 4E7IA 1JGGA 1IV8A 3U2RA 1BW6A 3H36A 1ZTRA 2EH3A 3K4MA 1OKRA 4F55A 1LDJA 5EF6A 3MZYA 1IG7A 1GVDA 2NRAC 5ILSA 4LB5A 2W4SA 4KT5C 2CW7A 3WU1B 1K4TA 5IY5H 1V4RA 2FMYA 4Z6YA 2EFWA 1ETXA 1YW7A 3WG7H 2RASA 3HTSB 1ZGAA 2XAHA 5CVIA 3G2BA 4EVIA 4LIVA 2DBBA 1G59A 2CU7A 2EFNA 3ABUA 1WRJA 3OOUA 1R1UA 1U5TC 1LDKB 5IT9K 2QLZA 4PJ0C 2E2JJ 2WTEA 2P5VA 2REKA 2Q8KA 2RVCA 1YS6A 4RGRA 4G12A 5F0CA 2QF7A 3PFYA 3VYSB 3KX2A 4OAZA 2FBKA 2EA4A 2JA6J 4D7MA 2FBQA 4HX7A 4FASD 2Y30A 2VJ4A 1LEAA 1ZRCA 4GCTA 4E70A 4HNUA 3JTGA 3TW7A 4YEJA 1S6LA 2A5WA 2CS3A 3Q9VA 1R71A 2WGBA 3QPHA 3MNLA 4UUSB 5CXIA 1IXRC 2IT0A 2W53A 3VEPA 2DA4A 2EV6A 1MSEC 4M3BA 4ZYAA 4HZFA 1NK2P 4Y13A 2EZKA 2XGXA 4GCLA 1T95A 4II3A 1HKQA 3DLAA 4YFXF 5H2FC 2BZTA 3BR2A 4F7ZA 2K27A 3FK6A 3C07A 2QVOA 4XRSA 1A04A 4OMYA 4HDVA 1ERDA 3SFZA 4HV6A 2QQ8A 1LPQA 2OBPA 2ZFUA 2A6EF 1U8BA 4U9LA 1LEBA 2ELJA 1H89C 2L7MP 1TT0A 5KHDA 3D0SA 2Q1ZB 1OR7C 1YTYA 2VC0A 3HYIA 4I7HA 4RAFA 3VTIA 4XR6A 2GZWA 2V9PA 4LMYA 2L3DA 2EZIA 5LHIA 4G7HF 1Z67A 1GXPA 4A3DJ 2RREA 3A0HC 3MFKA 1FTZA 2FJI1 1XPXA 2A5YB 3HPHA 1ZARA 2BVLA 3HUGB 2DDAA 4A3BJ 1D1BA 3FMQA 3ZCOA 3F1BA 2FJ1A 5CVUA 2DFHA 3VOEA 4EJVA 2KDZA 3HGYA 1UMQA 1TQPA 4HLXA 4FE7A 2EQRA 3FBIB 2YVHA 4XLHA 4HLYA 2LREA 4DNCA 5FJ8J 3CMYA 1K79A 2L4MA 4EM1A 1W7PA 5J47A 5DCFA 2AO9A 2H8WA 5CPRB 5EDNA 3KYLA 1PP8F 4IRVA 2DA1A 2JN6A 3Q0VA 3J81K 2FRHA 1PP7U 2YVEA 1XS9A 2L9RA 4O6JA 2HQRA 2HXIA 5EJCA 1MDMB 2CUJA 1FOYA 3A03A 3BY6A 3WTVC 1REPC 2DPDA 1SD4A 1P2FA 3OS2A 4WWCA 3HKZN 3G56A 3E5QA 4A0XA 1ZAOA 1VQ8I 3WTXC 1HW5A 4EJUA 1EKEA 4N0BA 3N05A 1MBFA 3E5XA 3OV8A 2DOFA 1G3TA 3E1SA 4M9ZA 4ASNA 3LSPA 1D0XA 4HYEA 2K5CA 3ZMSA 3AG4H 3K4LA 4A69C 4X0GA 3SWHA 2X1DA 1VQ9I 2PFVA 1SFEA 2W1OA 4BXFA 3GMEA 1W4MA 3RKYA 3BQZA 2WC2A 2WAQN 1P9QC 4AWXB 1UJ8A 1QZZA 2WBMA 2YX4A 2DTZA 1S7OA 2VODA 1HA8A 4FQGA 1Y56A 2ECCA 1GV2A 5FGMA 5J8CA 2YU9J 3D5RC 2MSYA 4PXIA 3BTLA 4H0EA 4B09A 4ABZA 2P4WA 3WU2C 3CP8A 2Z1DA 5B5EC 1QRYA 3JRCA 3KEQA 4NELA 4IVNA 1P7JA 5FKNA 3TQNA 2MLGA 3LSRA 3QPTA 3OYNA 3DPTA 2QTQA 2M4KA 4KICA 4N9IA 1ZRDA 3BPXA 2ZMEB 1UHMA 1LFBA 2O9LA 1S8NA 2K3FA 4CUGA 2QIBA 5CQGA 4Q47A 5EGOB 3PIOF 1FY7A 1T56A 1KONA 2I8DA 4ZJZA 2PG4A 1TZLA 3FXMA 4U0VA 3VSKA 2EPFA 2CUEA 3JSOA 1BIAA 2M9HA 2CGPA 3W6VA 4GDFA 2R7OA 5IOZA 2ZFWA 2P7VB 1NTCA 3ZQLA 2R4GA 3ZR8X 3HKZA 1MNMC 3BZCA 1V3FA 4C2UA 2VN2A 2XF5A 4L9TA 4M3GA 4MQ9F 4IHVA 3A2KA 1K4SA 1R58A 3DXJF 3P9CA 3GBGA 5FKLA 1D5YA 4DZPA 1YI2I 1Z6RA 1Z91A 3GFLA 4MQVA 1IN4A 3TW6A 4XKCA 1VQKI 3C3WA 2DA7A 4UY8I 2F5DA 2HYFA 3S2WA 3S3NA 1ZR2A 5J1RA 4ZTJA 5FO5A 4DBRA 2FNAA 4JP0A 2ZCNA 3R6SA 1RUOA 2IVMA 5FKMA 5DD4A 2UXOA 5F27A 1UHWA 3CJRB 1XD7A 2HEOA 1L3LA 1JGSA 4JL3A 3M1EA 4H4KC 1T8IA 1B1BA 1I1GA 2CV0A 5B1AH 4QLCU 2DN0A 2ZSHB 1SAXA 4A0ZA 3FIWA 2KZGA 1SD7A 3LMMA 2DTRA 2VE9A 1KGSA 3VIBA 2GLOA 4IHSA 1DPRA 2PMZN 3BG9A 1F9NA 3ELKA 4FX4A 3J7ZI 1HXDA 1B59A 2M7AA 3A0BC 1DU0A 1GDTA 1A31A 3O60A 4WXHA 2RNGA 3OYKA 2L01A 3P9TA 5HDKA 1VQMI 2DT7B 3KETA 3ULQB 3ZP5A 4XK4A 2HPIA 3I59A 1ORKA 3S15J 2WUIA 2LVSA 2FMLA 3MD2A 4PGHA 3BDDA 1YOVB 3WTZA 4BYYA 1JE8A 3DV8A 4YG2F 2UV1A 2PI0A 1RKWA 1SFUA 1GVJA 2M0MA 3RCOA 1UG2A 3QAHA 4BJ6C 1ZELA 4A3KJ 4YIIA 4MIMA 5A2QK 3JSJA 5KCMA 1HLVA 3V7SA 4CCNA 3DTIA 4CCLA 4PFPA 4BAYA 2NP3A 3H9QA 2QSGX 3BR3A 4A12A 1L0OC 2UXUA 2FBHA 3OIQA 4YIFA 2BV6A 2R5YB 1V5EA 1HW2A 2XB0X 3IP4B 4LG0A 2A07F 1DPUA 3LWJA 1ON2A 2ZJRF 2ZJQF 4RS8A 2B3WA 3CUQC 3KP6A 1XDUA 2V7FA 4IX7A 4V19K 3TDUC 4MEXF 2IP2A 3LJLA 1AA7A 1LJ9A 3HRSA 1O7FA 1WSUA 2ZXWH 1UI5A 3WGIA 3S32A 3WE3A 3G73A 4DJAA 2E2IJ 3CD6I 1F43A 3ML6A 3ESWB 3HSFA 1T38A 5H20A 2IS6A 3PQJA 2HTSA 5DCMA 1HCRA 3H5NA 2F2EA 3IAM2 3BTJA 2CUFA 1Z3YA 4A3IJ 3PNVA 5JI6A 3OYIA 2RV8A 4IEJA 5K7FA 2V9KA 3IKVA 1IDZA 2G7HA 3WTWC 2GOXB 5D8LB 1GT0C 2JSCA 5AIQA 4HQMA 2HGCA 1B4AA 4C3IJ 1T33A 4BKXA 4UDSA 2CFOA 2NNNA 4OINF 4FTHA 2WY7Q 5HLHA 1FIAA 5EG0B 5LGNA 3VWBA 1X3WB 1J9IA 4A6EA 3KYCB 3EUAA 1FJLA 3P9KA 3WG9A 2PQ8A 3I56I 2YSRA 3KZIC 3BROA 2ZOZA 3F21A 3QRFF 1U8RA 2ZCMA 1Z0XA 4AIJA 1U5TB 5BOXA 3CCVI 4NQWB 4CGRA 2Q0OA 1X3UA 2B0LA 1MBKA 2QCOA 2XASA 3OIPA 3EUPA 1OYYA 4KJZA 3CC7I 3CQZJ 1B9MA 4P9UA 1BIBA 2ESNA 3DPLC 2AHQA 1TC3C 1YW9A 4LLGF 1Y1VJ 3CJTB 3GUDA 3TGNA 2BY3A 3I5UA 3M9AA 4HX8A 4ESFA 1YO5C 1IN7A 2KRCA 4F93B 1W7PD 4OD5A 2VKVA 5CQEA 3BG3A 4AD9A 1W1WE 3SZPA 1VQPI 1Z3XA 2K3PA 3QKXA 1YS7A 1MMGA 1LE8B 4BNCA 4LD5A 4UV8A 1SC7A 2F5EA 3IHUA 5HLTA 5FRNA 2Y0SA 1SEUA 2MH9A 4XKVA 4G7ZF 3IC7A 3DQVC 1V54H 2LKXA 1LKXA 1R00A 2IXSA 2A61A 1EA3A 3HOWJ 1GHCA 2QBYA 3V7CA 3KP3A 2KRFA 5F0FA 3RPQA 2OCCH 2E36A 4FISA 5L3GA 2PJPA 4EJTA 3N97A 1HQCA 2F4MB 2JA5J 1JKOC 3DKXA 2LF7A 3BP8A 4RB3C 3HOYJ 3C2GA 2IGMA 2VQCA 3IH2A 2MFZA 3PO2J 2IS4A 1JKQC 4BH9A 2L0KA 2VBWA 3FM5A 3FK7A 4M9XA 4I99C 3M8EA 1SVLA 2DFIA 4Y7NJ 1F4KA 4QSHA 3HIFA 2CWEA 3KP7A 3L7WA 4GXOA 3SXYA 4B47A 3S3OA 3ASOH 5B1BH 2WAFA 2IW5A 2HVRA 4BE0A 1BL0A 3SYTA 4XOPA 1KQ9A 2KMUA 5DD8A 2HU9A 1VNDA 4OIRF 4UUVA 2KJCA 4L18B 4AVZA 1QPMA 3K1NA 3I4NJ 1WH5A 4BU2A 2YPRA 1KZHA 4JX6A 2HDWA 1G8XA 2CRGA 3RQIA 1HDDC 1FYLA 2EB7A 1P4AA 2CG4A 4DZJA 3K1MA 2X9DA 4L9NA 2JTVA 2WV0A 3ZOBA 2L5QA 2LC2A 5E18F 4AF5A 3AG3H 2HFHA 1XGOA 3E6DA 3KLNA 2KZVA 3KP5A 1T0FA 4FT8A 3OS0A 3BRUA 2MC3A 5H6QA 2VC1A 1R5ID 2R7DA 4UVCA 5LLQA 5GADJ 3CO7C 1J75A 1MBEA 3WGGA 3I4PA 1G3YA 3TKYA 2EWNA 2HTJA 3ECOA 4RB1A 2MG4A 5E1WA 1RZ4A 4GFBA 3HGGA 3KEYA 5FLXZ 5KVRA 1OISA 1TWAJ 1PUEE 5HDNA 3I3LA 1I3AA 2VT3A 3J7AO 2F6CA 3CWRA 4I2OA 2COBA 5J8FA 2AQFA 4XLFA 4GYIA 3C7JA 3SHFA 2XAFA 1DUXC 4I76A 4A3GJ 3VW2A 1YIJI 4L5EA 2IGNA 2MABA 3GTGJ 2NX4A 5M3FJ 3ANPA 3GLLA 1E3HA 3LA3A 2GIZA 2XIGA 4Y4RA 2Z2SB 1SMYF 2E60A 2L4AA 2XAQA 3B6AA 1FIPA 1KU2A 2VB6A 4EJOA 2W7NA 3KP2A 5BPIA 3S2HJ 2NVTJ 5E20A 3KKCA 2BE5F 2XGEA 1MBGA 2B9SA 4X6AJ 4KDPA 2XAGA 1IRZA 3A1YA 4M71A 4LLLA 3JTHA 1KU9A 1SMTA 1TWHJ 2ZNYA 1FBUA 2E34A 1QVUA 2DLLA 3P9IA 2AQEA 3VYTB 1I3QJ 2STWA 4FE4A 3GYHX 2DA3A 1JXSA 2V1UA 2FF4A 2RNJA 1VZ0A 1FMWA 2OERA 1HBXG 2HWVA 1S7EA 2E1OA 2CQQA 2PEXA 2GWRA 3RYRA 3NS4A 3C1DA 5DEQA 4HA8A 4XICA 4XLAA 3RKQA 2HYGD 2X0LA 3EUHA 1JUPA 4BQOA 1BI0A 1ETOA 3CMEI 1O57A 4UUTA 3OR2C 4BJ5C 3W6JB 4LLNA 3NXCA 2R7FA 2LDUA 3U9GA 1QHGA 1R7JA 3BQYA 2KPMA 1W36D 1JJ6C 5J6XA 3PFIA 1BOAA 4ZDPA 1ZYRF 2ID3A 5LBQA 4HDUA 3BJ6A 5IOYA 3O3KA 4CA0A 3GXOA 4KT6A 3FHZA 2A6TA 3OS1A 1P4XA 2O8KA 1MMNA 3IKTA 1LB2A 2DG7A 3IL2A 1UCRA 2AXTC 4E6KG 4NHJA 4NC7A 4BDYA 4HQEA 3QP5A 4Q4ZF 1FSHA 2G7SA 4DYQA 3NNRA 3KYDB 1SVMA 3T5XA 5EZGA 2GM4A 3K10A 5HS7A 2DDBA 1WJFA 4JKZA 3I55I 3KPHA 1ZG3A 3BG7A 1B72A 4HV5A 3RZOJ 4A6DA 3T0YA 5FHPA 2QWTA 2M45A 2XDNA 3NARA 4E7ZA 3L9FA 2VUMJ 4JOMA 2DMUA 3MCZA 3IH3A 1WJ5A 4LIUA 5FKOA 3BG5A 2CQNA 3WE2A 3QPSA 5D5XB 3JRDA 2ICWG 4PJMA 2XGCA 2G7UA 4WXDA 2LRDA 2K40A 4I02A 4EM0B 4ACIA 3CUQB 2WB1N 3OL3A 3ZMZA 4B3AA 3W3CA 1YFHA 1BI1A 4BEHA 3LAPA 5CW8A 3VB2A 3RKXA 1M1EB 3I53A 2FQ4A 3G1MA 4UB6C 1FOXA 3F6VA 3WGHA 2OPTA 2UXIA 1RPWA 1HF0A 1FBQA 4A3MJ 4R8HA 1Z9CA 1P7IA 1UB9A 2M3AA 1TNSA 1IO2A 3JRHA 4KMFA 2E1MB 3IH4A 2PLYA 3ERED 2N8GA 2D1VA 3J7YJ 1A6IA 3CZ6A 1T2KA 2GXAA 3RH2A 3M3YJ 3CDHA 3A01B 4B4CA 3IV5A 3J80Z 1QVTA 5FLXK 4XLNF 1XTAA 4EV0A 1JKRC 1BW5A 3CCRI 3BG6A 1IJWC 2Q2EA 2VI6A 1OQYA 4LITA 3REOA 5BS6A 2QZ8A 4W1UA 2X6XA 2VJ5A 5DS9A 1GLNA 3HTUA 1PYVA 2F48A 1W5CC 4CO8A 2HXOA 2HDCA 4MK6A 2HZDA 2DK5A 1J0RA 1D1CA 1U2WA 3T8RA 3EYYA 3HTJA 4ME9A 1MBHA 3IAS2 1MMSA 4CH7A 1JT0A 1YJ9I 1TW3A 3ZQGA 2DA5A 4PJLA 1V5FA 2FD5A 1CQTA 5AIPA 2V79A 2W24A 4DVYP 3GTPJ 3RQ4A 3ROUA 4BQNA 3VVZA 2E35A 2EJRA 3H92A 4P5OA 3TOBA 1PDNC 3HSRA 3F8CA 1YYVA 2ZY9A 4CCJA 3R0AA 3X2QH 4HRIA 4XMYA 3LSJA 4OIPF 4V2GA 2DPUA 4F52A 3T6NA 3OYJA 1TWCJ 1W36C 3DEWA 4BY7J 2ZC2A 3N4MA 2HQAA 2JSPA 4N4OB 2VBXA 3RKWA 5DM6F 1MH3A 3GTMJ 3K7AJ 1YRNA 4G6TB 3QYEA 3LA7A 2UWMA 5HVQC 4BBSJ 1K61A 2ID6A 1WVRA 2IEKA 1WZ2A 4S0HB 1FC3A 3TOAA 2VASA
chains in the Genus database with same CATH topology
2DMPA 3VIBA 4C3HJ 2GLOA 2PMZN 2L7FP 1H88C 5C3EJ 5FGLA 3BG9A 4UUSA 3MN2A 1GDTA 2GENA 1DU0A 4M3DA 3O60A 2I10A 3TEDA 1VF9A 5K7HA 2H1KA 3VVYA 1WPKA 5FLMJ 1QPIA 3P9TA 2LK2A 1FTTA 5K58A 3COLA 3ON2A 3H0GJ 4XK4A 3G7RA 1ORKA 3S15J 4IHXA 2EZHA 3BR1A 2WUIA 3SFIA 3NRGA 2LVSA 2FX0A 5E3NA 2UXHA 4A3LJ 5C4YA 2XRLA 3EGQA 1VFCA 2PBXA 3Q0WA 4A3JJ 1RKWA 2K9QA 4IHWA 1UG2A 5IYCJ 1ENHA 5IYBJ 3BNIA 5J3LA 4A3KJ 5FLVA 3WHCA 2K9SA 3HB9A 4MIMA 3JSJA 1HLVA 3LOCA 4XRMA 2NP3A 3BR3A 3BR5A 3S1RJ 2HOTA 3S17J 3S1MJ 2UXUA 4M3FA 2R5YB 2UXPA 5M5XJ 3VUQA 2XB0X 3PM1A 4RBOA 3LWJA 4XRSG 1IC8A 3BHQA 2HKUA 2IBDA 4GCKA 3LJLA 2D5VA 2ECBA 5BNGA 3VOKA 2KT0A 3HDDA 3G1OA 4L62A 1UI5A 3BJBA 2E2IJ 2G3BA 5HSZA 2EZLA 1F43A 2XPUA 5C4JJ 3KKDA 2K9NA 2HOSA 2Y9YA 2LP0A 4ICHA 2LLKA 1HCRA 5GPAA 4A3IJ 3BTJA 2CUFA 2O7TA 1WH7A 4D5FA 1HOMA 4IEJA 5K7FA 2WV1A 1RKTA 1IDZA 1SANA 1I50J 1AU7A 2ME6A 2F07A 1GT0C 3AQTA 3NI7A 2NVXJ 4QIWN 2GFNA 2XPWA 4MO7A 4C3IJ 1T33A 4BKXA 1Y1WJ 4UDSA 4W97A 1APLC 4FTHA 5EG0B 1FIAA 3HOZJ 4GFLA 3FKIJ 5F08A 3ZQIA 1FJLA 1Q1VA 2NOGA 1NK3P 1MBJA 4B1RA 3CJDA 2NVQJ 5JLWA 2ZOZA 2DMTA 3MVPA 2ZCMA 1IGNA 1Z0XA 3LHQA 4CGRA 3UKGA 1MSFC 1MBKA 2QCOA 3JR9A 4D7NA 1SFOJ 2QKOA 3VW0A 3EUPA 2E19A 1O4XA 5E3MA 4NDLA 2LR8A 5J1YA 3CQZJ 2LY9A 3GTQJ 3ON4A 1X2NA 2R92J 2HI3A 3VVXA 5EYRA 5F04A 4D5CA 2AHQA 1UHSA 1TC3C 3PASA 5M5YJ 1IUFA 1Y1VJ 2RHAA 5M3MJ 5IP7J 2GUHA 1IDYA 3HM5A 3VPRA 2R5ZA 3S2DJ 2VKVA 3BG3A 2HYTA 1I6HJ 2M2EA 2JWTA 1RR7A 3BTIA 1B8IA 2ZOYA 3HEFA 5IYDJ 4RDUA 3CCYA 3QKXA 1H8AC 5HAWA 4HKUA 1LE8B 3JRFA 1WCMJ 1PUFB 3HTAA 3A01A 2V57A 1WI3A 4MFDA 1B72B 5DTDA 2DJNA 2P81A 1ETVA 5M5WJ 5EGOA 2CQXA 2LKXA 3GTOJ 5JLXA 3V78A 5IP9J 3HOWJ 2X6OA 3BR6A 3FRQA 2MW8A 3K2AA 5F0FA 2IU5A 3LSGA 3TP0A 2M34A 3BTCA 2DMNA 4FISA 3VOXA 3I4MJ 2G0EA 2NS8A 5E3LA 5J1UA 2JMWA 3H3VK 3HOXJ 2JA5J 1JKOC 2L7ZA 3CDLA 3Q0UA 3AQSA 3BT9A 3HOYJ 3IH2A 3PO2J 1JKQC 5D1RA 1A5JA 2TCTA 2L0KA 3FK7A 4EEFG 3NAUA 4MXMA 2VPRA 2VKEA 4Y7NJ 4QSHA 3JRAA 2D6YA 5D19A 3Q3SA 3O8GA 1AHDP 1ZK8A 2HQ5A 2DA6A 1GUUA 4FCYA 1BL0A 1ZKGA 4AC0A 1VNDA 1G2HA 2R7ZJ 3ZQFA 1PUFA 3L1PA 4A3EJ 1IV6A 1OCTC 3I4NJ 1WH5A 3G1LA 2ME0A 1OJLA 1Z77A 4JX6A 5GP9A 1JGGA 2R0QC 3RQIA 2CRGA 5F1JA 1HDDC 4BBRJ 5D18A 1BW6A 1ZTRA 2EH3A 4DZJA 1W0TA 1LFUP 2X9DA 3ZOBA 1FEXA 1GV5A 4AF5A 4MLOA 5EF6A 2O7OA 1IG7A 1GVDA 2XGDA 5C44J 3BRUA 4HNVA 1POGA 5IPAA 3GTKJ 1JUMA 3F0CA 3VP5A 4DW6A 3TP3A 4I6ZA 4NELA 1ETXA 3OSGA 2Y31A 2OF7A 1MBEA 5IP6A 1JTYA 1WGXA 2RASA 1XG1A 3WHBA 3QQAA 2MG4A 3CRJA 2IAIA 4GFBA 3HGGA 3O8HA 2CU7A 1TWAJ 3OOUA 3CWRA 2COBA 2R5YA 4GFKA 1U9NA 2E2JJ 4A3CJ 2CJJA 2REKA 4I76A 4A3GJ 1EF4A 3PPBA 3VW2A 5F0CA 4G12A 4L5EA 3S14J 4A93J 3QBMA 4M6VA 2QF7A 3GTGJ 1YRNB 2NX4A 5M3FJ 3ANPA 4JYKA 3KNWA 2JA6J 4X1EA 4D7MA 1JJ8C 2FBQA 2QOPA 2NP5A 2OI8A 5CXGA 3JRGA 2Y30A 3B6AA 3GTLJ 4GCTA 3C2BA 1FIPA 4AYBN 3TW7A 4M3EA 1ETQA 3B6CA 3S2HJ 2NVTJ 2WGBA 3HOUJ 3KKCA 2G7LA 2XGEA 3MNLA 4UUSB 1MBGA 5CXIA 1JTXA 4X6AJ 2LTPA 1IRZA 2DA4A 1U78A 1ITYA 1MSEC 2W53A 1X2MA 4M3BA 3JRBA 1NK2P 1TWHJ 2EZKA 2NVYJ 4A3FJ 4GCLA 3IUVA 1QVUA 1X58A 4CYCB 3MKLA 3BR2A 1ETWA 1I3QJ 2XPVA 3FK6A 3HOVJ 3C07A 4FE4A 4XRSA 2DA3A 3SJMA 2OERA 1UI6A 1S7EA 1TWGJ 2E1OA 2DMQA 2CQQA 5H9TA 1U8BA 5EFYA 1H89C 5EG0A 2L7MP 2MGQA 2W48A 3S16J 9ANTA 2HYJA 4JX5A 4XICA 2EZIA 2ZCXA 3NPIA 4YZEA 3A02A 3RKQA 3RD3A 1JUPA 2GBYA 1ETOA 4A3DJ 4KWAA 1FTZA 4UUTA 3OIOA 2HDDA 3OSFA 3DPJA 3NXCA 4A3BJ 5F0HA 4LOCA 1E3OC 3F1BA 2FJ1A 4J19A 3BQYA 2KDZA 1JJ6C 3HGYA 5HODA 2XSDC 1UMQA 2ID3A 4FE7A 3PO3J 3S1QJ 2EQRA 5IOYA 3VW1A 2YVHA 1XC5A 4V2FA 3HE0A 5FJ8J 3CMYA 3B81A 2O8KA 2DG7A 4NN1A 3GEUA 2AO9A 4DYRA 5EDNA 2DA1A 2JN6A 4CYCA 1AKHB 1BA5A 3Q0VA 2G7SA 1OCPA 3S1NJ 2YS9A 2YVEA 1XS9A 2L9RA 4DYQA 3NNRA 4IHYA 2JA8J 1LE8A 2HXIA 5EZGA 2GM4A 4BXXJ 1RETA 4JKZA 5GPCA 3A03A 2JK3A 1F36A 1B72A 3RZOJ 5FMPA 5FHPA 2M0CA 2Y9ZA 3HKZN 2QWTA 2XDNA 3NARA 3G56A 2VUMJ 2DMUA 2DG8A 2ELKA 3E7QA 3IH3A 3DCFA 1MBFA 5FKOA 5K7ZA 3BG5A 2JA7J 3RZDJ 2LD5A 3ANGA 3QPSA 3E7LA 4JX4A 4BY1J 2NS7A 2TRTA 3LSPA 2LFBA 4A69C 2M8GX 3FISA 3JRDA 1TWFJ 1JUSA 2XGCA 2K40A 4ACIA 5EEAA 1HDPA 2WB1N 2B63J 3GZIA 3BQZA 4DYCA 4B3AA 4AC6A 2WAQN 2Q24A 5CW8A 2DTZA 2ECCA 1GV2A 2DA2A 2FQ4A 3G1MA 4JNNA 2YU9J 2MSYA 2OPTA 2UXIA 4PXIA 2Y0SN 1AKHA 3BTLA 1RPWA 1HF0A 3QPLA 4A3MJ 2X48A 3M4OJ 4ABZA 1ZGWA 2R5ZB 3KZ9A 1P7IA 1W0UA 5AQCA 1QRYA 2R93J 3GTJJ 3JRCA 1B8IB 3JREA 5FKNA 1P7JA 4C3JJ 3JRHA 4C2MJ 3BCGA 4MFEA 3V6GA 3IH4A 2G7GA 4QTRA 2N8GA 3LSRA 1A6IA 2PZ9A 1SGMA 2QTQA 3RH2A 1K83J 1BJZA 3ZQHA 3M3YJ 3A01B 4B4CA 3IV5A 1QVTA 1ETYA 2ZB9A 1LFBA 1R9TJ 2O9LA 1JKRC 1BW5A 2QIBA 5EGOB 1T56A 2EBIA 1IJWC 2VI6A 5E3OA 2HOAA 5DS9A 1ETKA 4W1UA 3S5RA 1OFCX 2RAEA 5DAJA 5FKKA 4XIDA 2CUEA 3W6VA 2M9HA 2HXOA 4MK6A 5IOZA 1NTCA 3ZQLA 2Y2ZA 5HBUA 1MNMC 3HTJA 4ME9A 4IHVA 1MBHA 4M3GA 1JT0A 5EZHA 3ZQGA 2DA5A 3LNQA 5C4XJ 2FD5A 1ZQ3P 3GBGA 5FKLA 3SDGA 4DZPA 3ZQCA 1RESA 1U9OA 1CQTA 1D5YA 3GTPJ 4Y52J 3HBLA 3TW6A 3VVZA 3D1NI 2DA7A 3BR0A 1ZR4A 3JRIA 1JKPC 1ZR2A 5J1RA 2H8RA 3LSJA 4JP0A 2ZCNA 3T6NA 4V2GA 5FKMA 2E2HJ 2YUSA 2UXOA 1TWCJ 5F27A 3DEWA 4BY7J 2JJ7A 4AUXA 1MH4A 3HIMA 1MH3A 1DU6A 3GTMJ 2XB5A 3K7AJ 1YRNA 4JL3A 4BBSJ 3HTIA 1K61A 3HTHA 1JT6A 2ID6A 2IEKA 4S0HB 2DN0A 3FIWA 1VI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMP A;  3VIB A;  4C3H J;  2GLO A;  2PMZ N;  2L7F P;  1H88 C;  5C3E J;  5FGL A;  3BG9 A;  4UUS A;  3MN2 A;  1GDT A;  2GEN A;  1DU0 A;  4M3D A;  3O60 A;  2I10 A;  3TED A;  1VF9 A;  5K7H A;  2H1K A;  3VVY A;  1WPK A;  5FLM J;  1QPI A;  3P9T A;  2LK2 A;  1FTT A;  5K58 A;  3COL A;  3ON2 A;  3H0G J;  4XK4 A;  3G7R A;  1ORK A;  3S15 J;  4IHX A;  2EZH A;  3BR1 A;  2WUI A;  3SFI A;  3NRG A;  2LVS A;  2FX0 A;  5E3N A;  2UXH A;  4A3L J;  5C4Y A;  2XRL A;  3EGQ A;  1VFC A;  2PBX A;  3Q0W A;  4A3J J;  1RKW A;  2K9Q A;  4IHW A;  1UG2 A;  5IYC J;  1ENH A;  5IYB J;  3BNI A;  5J3L A;  4A3K J;  5FLV A;  3WHC A;  2K9S A;  3HB9 A;  4MIM A;  3JSJ A;  1HLV A;  3LOC A;  4XRM A;  2NP3 A;  3BR3 A;  3BR5 A;  3S1R J;  2HOT A;  3S17 J;  3S1M J;  2UXU A;  4M3F A;  2R5Y B;  2UXP A;  5M5X J;  3VUQ A;  2XB0 X;  3PM1 A;  4RBO A;  3LWJ A;  4XRS G;  1IC8 A;  3BHQ A;  2HKU A;  2IBD A;  4GCK A;  3LJL A;  2D5V A;  2ECB A;  5BNG A;  3VOK A;  2KT0 A;  3HDD A;  3G1O A;  4L62 A;  1UI5 A;  3BJB A;  2E2I J;  2G3B A;  5HSZ A;  2EZL A;  1F43 A;  2XPU A;  5C4J J;  3KKD A;  2K9N A;  2HOS A;  2Y9Y A;  2LP0 A;  4ICH A;  2LLK A;  1HCR A;  5GPA A;  4A3I J;  3BTJ A;  2CUF A;  2O7T A;  1WH7 A;  4D5F A;  1HOM A;  4IEJ A;  5K7F A;  2WV1 A;  1RKT A;  1IDZ A;  1SAN A;  1I50 J;  1AU7 A;  2ME6 A;  2F07 A;  1GT0 C;  3AQT A;  3NI7 A;  2NVX J;  4QIW N;  2GFN A;  2XPW A;  4MO7 A;  4C3I J;  1T33 A;  4BKX A;  1Y1W J;  4UDS A;  4W97 A;  1APL C;  4FTH A;  5EG0 B;  1FIA A;  3HOZ J;  4GFL A;  3FKI J;  5F08 A;  3ZQI A;  1FJL A;  1Q1V A;  2NOG A;  1NK3 P;  1MBJ A;  4B1R A;  3CJD A;  2NVQ J;  5JLW A;  2ZOZ A;  2DMT A;  3MVP A;  2ZCM A;  1IGN A;  1Z0X A;  3LHQ A;  4CGR A;  3UKG A;  1MSF C;  1MBK A;  2QCO A;  3JR9 A;  4D7N A;  1SFO J;  2QKO A;  3VW0 A;  3EUP A;  2E19 A;  1O4X A;  5E3M A;  4NDL A;  2LR8 A;  5J1Y A;  3CQZ J;  2LY9 A;  3GTQ J;  3ON4 A;  1X2N A;  2R92 J;  2HI3 A;  3VVX A;  5EYR A;  5F04 A;  4D5C A;  2AHQ A;  1UHS A;  1TC3 C;  3PAS A;  5M5Y J;  1IUF A;  1Y1V J;  2RHA A;  5M3M J;  5IP7 J;  2GUH A;  1IDY A;  3HM5 A;  3VPR A;  2R5Z A;  3S2D J;  2VKV A;  3BG3 A;  2HYT A;  1I6H J;  2M2E A;  2JWT A;  1RR7 A;  3BTI A;  1B8I A;  2ZOY A;  3HEF A;  5IYD J;  4RDU A;  3CCY A;  3QKX A;  1H8A C;  5HAW A;  4HKU A;  1LE8 B;  3JRF A;  1WCM J;  1PUF B;  3HTA A;  3A01 A;  2V57 A;  1WI3 A;  4MFD A;  1B72 B;  5DTD A;  2DJN A;  2P81 A;  1ETV A;  5M5W J;  5EGO A;  2CQX A;  2LKX A;  3GTO J;  5JLX A;  3V78 A;  5IP9 J;  3HOW J;  2X6O A;  3BR6 A;  3FRQ A;  2MW8 A;  3K2A A;  5F0F A;  2IU5 A;  3LSG A;  3TP0 A;  2M34 A;  3BTC A;  2DMN A;  4FIS A;  3VOX A;  3I4M J;  2G0E A;  2NS8 A;  5E3L A;  5J1U A;  2JMW A;  3H3V K;  3HOX J;  2JA5 J;  1JKO C;  2L7Z A;  3CDL A;  3Q0U A;  3AQS A;  3BT9 A;  3HOY J;  3IH2 A;  3PO2 J;  1JKQ C;  5D1R A;  1A5J A;  2TCT A;  2L0K A;  3FK7 A;  4EEF G;  3NAU A;  4MXM A;  2VPR A;  2VKE A;  4Y7N J;  4QSH A;  3JRA A;  2D6Y A;  5D19 A;  3Q3S A;  3O8G A;  1AHD P;  1ZK8 A;  2HQ5 A;  2DA6 A;  1GUU A;  4FCY A;  1BL0 A;  1ZKG A;  4AC0 A;  1VND A;  1G2H A;  2R7Z J;  3ZQF A;  1PUF A;  3L1P A;  4A3E J;  1IV6 A;  1OCT C;  3I4N J;  1WH5 A;  3G1L A;  2ME0 A;  1OJL A;  1Z77 A;  4JX6 A;  5GP9 A;  1JGG A;  2R0Q C;  3RQI A;  2CRG A;  5F1J A;  1HDD C;  4BBR J;  5D18 A;  1BW6 A;  1ZTR A;  2EH3 A;  4DZJ A;  1W0T A;  1LFU P;  2X9D A;  3ZOB A;  1FEX A;  1GV5 A;  4AF5 A;  4MLO A;  5EF6 A;  2O7O A;  1IG7 A;  1GVD A;  2XGD A;  5C44 J;  3BRU A;  4HNV A;  1POG A;  5IPA A;  3GTK J;  1JUM A;  3F0C A;  3VP5 A;  4DW6 A;  3TP3 A;  4I6Z A;  4NEL A;  1ETX A;  3OSG A;  2Y31 A;  2OF7 A;  1MBE A;  5IP6 A;  1JTY A;  1WGX A;  2RAS A;  1XG1 A;  3WHB A;  3QQA A;  2MG4 A;  3CRJ A;  2IAI A;  4GFB A;  3HGG A;  3O8H A;  2CU7 A;  1TWA J;  3OOU A;  3CWR A;  2COB A;  2R5Y A;  4GFK A;  1U9N A;  2E2J J;  4A3C J;  2CJJ A;  2REK A;  4I76 A;  4A3G J;  1EF4 A;  3PPB A;  3VW2 A;  5F0C A;  4G12 A;  4L5E A;  3S14 J;  4A93 J;  3QBM A;  4M6V A;  2QF7 A;  3GTG J;  1YRN B;  2NX4 A;  5M3F J;  3ANP A;  4JYK A;  3KNW A;  2JA6 J;  4X1E A;  4D7M A;  1JJ8 C;  2FBQ A;  2QOP A;  2NP5 A;  2OI8 A;  5CXG A;  3JRG A;  2Y30 A;  3B6A A;  3GTL J;  4GCT A;  3C2B A;  1FIP A;  4AYB N;  3TW7 A;  4M3E A;  1ETQ A;  3B6C A;  3S2H J;  2NVT J;  2WGB A;  3HOU J;  3KKC A;  2G7L A;  2XGE A;  3MNL A;  4UUS B;  1MBG A;  5CXI A;  1JTX A;  4X6A J;  2LTP A;  1IRZ A;  2DA4 A;  1U78 A;  1ITY A;  1MSE C;  2W53 A;  1X2M A;  4M3B A;  3JRB A;  1NK2 P;  1TWH J;  2EZK A;  2NVY J;  4A3F J;  4GCL A;  3IUV A;  1QVU A;  1X58 A;  4CYC B;  3MKL A;  3BR2 A;  1ETW A;  1I3Q J;  2XPV A;  3FK6 A;  3HOV J;  3C07 A;  4FE4 A;  4XRS A;  2DA3 A;  3SJM A;  2OER A;  1UI6 A;  1S7E A;  1TWG J;  2E1O A;  2DMQ A;  2CQQ A;  5H9T A;  1U8B A;  5EFY A;  1H89 C;  5EG0 A;  2L7M P;  2MGQ A;  2W48 A;  3S16 J;  9ANT A;  2HYJ A;  4JX5 A;  4XIC A;  2EZI A;  2ZCX A;  3NPI A;  4YZE A;  3A02 A;  3RKQ A;  3RD3 A;  1JUP A;  2GBY A;  1ETO A;  4A3D J;  4KWA A;  1FTZ A;  4UUT A;  3OIO A;  2HDD A;  3OSF A;  3DPJ A;  3NXC A;  4A3B J;  5F0H A;  4LOC A;  1E3O C;  3F1B A;  2FJ1 A;  4J19 A;  3BQY A;  2KDZ A;  1JJ6 C;  3HGY A;  5HOD A;  2XSD C;  1UMQ A;  2ID3 A;  4FE7 A;  3PO3 J;  3S1Q J;  2EQR A;  5IOY A;  3VW1 A;  2YVH A;  1XC5 A;  4V2F A;  3HE0 A;  5FJ8 J;  3CMY A;  3B81 A;  2O8K A;  2DG7 A;  4NN1 A;  3GEU A;  2AO9 A;  4DYR A;  5EDN A;  2DA1 A;  2JN6 A;  4CYC A;  1AKH B;  1BA5 A;  3Q0V A;  2G7S A;  1OCP A;  3S1N J;  2YS9 A;  2YVE A;  1XS9 A;  2L9R A;  4DYQ A;  3NNR A;  4IHY A;  2JA8 J;  1LE8 A;  2HXI A;  5EZG A;  2GM4 A;  4BXX J;  1RET A;  4JKZ A;  5GPC A;  3A03 A;  2JK3 A;  1F36 A;  1B72 A;  3RZO J;  5FMP A;  5FHP A;  2M0C A;  2Y9Z A;  3HKZ N;  2QWT A;  2XDN A;  3NAR A;  3G56 A;  2VUM J;  2DMU A;  2DG8 A;  2ELK A;  3E7Q A;  3IH3 A;  3DCF A;  1MBF A;  5FKO A;  5K7Z A;  3BG5 A;  2JA7 J;  3RZD J;  2LD5 A;  3ANG A;  3QPS A;  3E7L A;  4JX4 A;  4BY1 J;  2NS7 A;  2TRT A;  3LSP A;  2LFB A;  4A69 C;  2M8G X;  3FIS A;  3JRD A;  1TWF J;  1JUS A;  2XGC A;  2K40 A;  4ACI A;  5EEA A;  1HDP A;  2WB1 N;  2B63 J;  3GZI A;  3BQZ A;  4DYC A;  4B3A A;  4AC6 A;  2WAQ N;  2Q24 A;  5CW8 A;  2DTZ A;  2ECC A;  1GV2 A;  2DA2 A;  2FQ4 A;  3G1M A;  4JNN A;  2YU9 J;  2MSY A;  2OPT A;  2UXI A;  4PXI A;  2Y0S N;  1AKH A;  3BTL A;  1RPW A;  1HF0 A;  3QPL A;  4A3M J;  2X48 A;  3M4O J;  4ABZ A;  1ZGW A;  2R5Z B;  3KZ9 A;  1P7I A;  1W0U A;  5AQC A;  1QRY A;  2R93 J;  3GTJ J;  3JRC A;  1B8I B;  3JRE A;  5FKN A;  1P7J A;  4C3J J;  3JRH A;  4C2M J;  3BCG A;  4MFE A;  3V6G A;  3IH4 A;  2G7G A;  4QTR A;  2N8G A;  3LSR A;  1A6I A;  2PZ9 A;  1SGM A;  2QTQ A;  3RH2 A;  1K83 J;  1BJZ A;  3ZQH A;  3M3Y J;  3A01 B;  4B4C A;  3IV5 A;  1QVT A;  1ETY A;  2ZB9 A;  1LFB A;  1R9T J;  2O9L A;  1JKR C;  1BW5 A;  2QIB A;  5EGO B;  1T56 A;  2EBI A;  1IJW C;  2VI6 A;  5E3O A;  2HOA A;  5DS9 A;  1ETK A;  4W1U A;  3S5R A;  1OFC X;  2RAE A;  5DAJ A;  5FKK A;  4XID A;  2CUE A;  3W6V A;  2M9H A;  2HXO A;  4MK6 A;  5IOZ A;  1NTC A;  3ZQL A;  2Y2Z A;  5HBU A;  1MNM C;  3HTJ A;  4ME9 A;  4IHV A;  1MBH A;  4M3G A;  1JT0 A;  5EZH A;  3ZQG A;  2DA5 A;  3LNQ A;  5C4X J;  2FD5 A;  1ZQ3 P;  3GBG A;  5FKL A;  3SDG A;  4DZP A;  3ZQC A;  1RES A;  1U9O A;  1CQT A;  1D5Y A;  3GTP J;  4Y52 J;  3HBL A;  3TW6 A;  3VVZ A;  3D1N I;  2DA7 A;  3BR0 A;  1ZR4 A;  3JRI A;  1JKP C;  1ZR2 A;  5J1R A;  2H8R A;  3LSJ A;  4JP0 A;  2ZCN A;  3T6N A;  4V2G A;  5FKM A;  2E2H J;  2YUS A;  2UXO A;  1TWC J;  5F27 A;  3DEW A;  4BY7 J;  2JJ7 A;  4AUX A;  1MH4 A;  3HIM A;  1MH3 A;  1DU6 A;  3GTM J;  2XB5 A;  3K7A J;  1YRN A;  4JL3 A;  4BBS J;  3HTI A;  1K61 A;  3HTH A;  1JT6 A;  2ID6 A;  2IEK A;  4S0H B;  2DN0 A;  3FIW A;  1VI0 A; 
#chains in the Genus database with same CATH topology
 4L9V A;  2DK8 A;  3HPG A;  4IPA A;  3FF5 A;  1BI2 A;  5ICC A;  3E5U A;  2WWY A;  1VF9 A;  2OTJ I;  3VVY A;  3D5L A;  5EEH A;  2QQ9 A;  3GZN B;  4L9J A;  1QPI A;  2LK2 A;  2JUG A;  2E71 A;  2DW4 A;  2EFQ A;  1SAU A;  3L00 A;  1XSX A;  1QO0 D;  3BR1 A;  2FX0 A;  2UXH A;  1SFX A;  3F8N A;  5C4Y A;  3EGQ A;  1VFC A;  2I5U A;  4A5N A;  2KLO A;  2X4H A;  3AG2 H;  1TQI A;  2BY1 A;  4IHW A;  2BY0 A;  2K9L A;  3W2V A;  2OQG A;  5IYC J;  2QSH X;  5IYB J;  3BNI A;  2DAO A;  5JHU A;  5FLV A;  4B43 A;  2EV5 A;  1TTY A;  2BW3 A;  5FFZ A;  4ZYG A;  4XM3 A;  4OAY A;  2D1H A;  2ZXI A;  1VQN I;  2X51 A;  2VQG A;  3L2V A;  1IRG A;  2Z3Y A;  3BR5 A;  3OOP A;  3LQQ A;  3S1R J;  3BWG A;  2PJR A;  3S17 J;  1USS A;  2OC6 A;  1K6Y A;  2M5W A;  4QPO A;  2PMH A;  2M1B A;  2MD0 A;  4RBO A;  4J00 A;  1IC8 A;  3PSF A;  3VYR B;  2HKO A;  1IW7 F;  2HOE A;  1R5G A;  2CW0 F;  2IBD A;  4GCK A;  3B73 A;  2ECB A;  5BNG A;  3CLQ A;  4ZZL A;  5KAF C;  4LJZ F;  1K78 B;  2DYR H;  2G3B A;  3E6M A;  2XPU A;  3RYP A;  3P7N A;  4U0W A;  2W85 A;  4EM2 A;  1TBX A;  2OA4 A;  1XDS A;  3DU6 A;  3KKD A;  2K9N A;  3GO5 A;  2DQL A;  2Y9Y A;  2HOS A;  4N9H A;  3CF5 F;  1QBJ A;  2LLK A;  5JHF A;  4ICH A;  1W5S A;  3O2P E;  2JQ7 A;  3I58 A;  1Y0N A;  1MW7 A;  4NC6 A;  2WV1 A;  1MJ9 A;  1RKT A;  1ZGJ A;  1P4W A;  1I50 J;  4L5I A;  3T8T A;  1Z7U A;  3EET A;  1AU7 A;  1NHA A;  3NI7 A;  4KIT B;  2XPW A;  1X1P A;  2R7V A;  4BXU A;  1HKS A;  3H5R A;  1LVA A;  3OYF A;  1OYW A;  3PJR A;  1WFX A;  1APL C;  3HOZ J;  2OCE A;  4A5M A;  5JVT A;  5F08 A;  3IRQ A;  5HS9 A;  2OUM A;  2A6H F;  5LGT A;  1WJB A;  1NK3 P;  1YG2 A;  3CJD A;  2NVQ J;  1R5H A;  1ULY A;  5JLW A;  1IZ1 A;  2DI3 A;  1IGN A;  1NH3 A;  3LHQ A;  1MSF C;  4D0P A;  3GFM A;  2QKO A;  1R36 A;  1D5V A;  1I5Z A;  2L9S A;  3FKJ A;  1O4X A;  3AFH A;  1MD0 A;  2LY9 A;  1IXS B;  5J4V A;  1X2N A;  5GTI C;  4CDG A;  2R92 J;  1YE9 A;  2GIV A;  2LKS A;  2M8E A;  2Y0M A;  4D5C A;  5LEK A;  3S93 A;  2LNB A;  4RM2 A;  2A68 F;  1S7A A;  3NRV A;  5M5Y J;  3NQO A;  2RHA A;  3GCM A;  3LSM A;  2EA2 A;  5IP7 J;  5HS8 A;  1IDY A;  5FB2 A;  3MKZ A;  1W7P B;  2KHM A;  4O5V A;  1X3Z B;  2R5Z A;  1LDD A;  3K69 A;  2HYT A;  1I6H J;  2M2E A;  1B8I A;  2XRO A;  1T39 A;  5IYD J;  3CCE I;  2WAQ A;  1QGP A;  2RDP A;  5E8G A;  1VQ4 I;  3CCM I;  1H9G A;  1PJR A;  2XHK A;  5LEJ A;  4HKU A;  3L2W A;  3JRF A;  1WCM J;  1PUF B;  3CC4 I;  3CLO A;  3HTA A;  1WI3 A;  5M5W J;  1FMV A;  2CQX A;  4TV7 A;  4RB2 C;  1T0F C;  2UZK A;  1SFK A;  1Z1D A;  3V78 A;  1MND A;  4LB6 B;  4WX9 A;  2X6O A;  3FRQ A;  2COM A;  2QYO A;  3K2A A;  2HNH A;  3M07 A;  4KMU X;  3TP0 A;  2BVM A;  2XC7 A;  3BTC A;  2DMN A;  5HLI A;  4G6Q A;  2DT6 A;  2STT A;  1E3P A;  2JMW A;  3H3V K;  1CF7 B;  2V26 A;  1BR2 A;  2UUZ A;  6PAX A;  3CDL A;  1R1V A;  3FXK A;  3AQS A;  2Y75 A;  3ZN1 A;  5ILU A;  1HKT A;  4UB8 C;  1A5J A;  4U7D A;  4ETS A;  4HF2 A;  4EEF G;  5LHH A;  4AIK A;  3NAU A;  4KYW A;  3CES A;  4MHG A;  2VKE A;  1IXC A;  2ISY A;  2QQA A;  2XRN A;  2P6T A;  5D19 A;  1XX5 A;  3BZ6 A;  2D2W A;  2VJI A;  3UR3 C;  5LGU A;  4GRI A;  4AC0 A;  2KJB A;  1FYK A;  1K7A A;  3G6E I;  5B3S H;  1QU3 A;  1QNT A;  3H3Z A;  4L5J A;  1P6R A;  3ZQF A;  3DP7 A;  4PFO A;  1XGM A;  4P9F A;  1IV6 A;  1IRF A;  3G1L A;  3D5S C;  1VTN C;  1FP1 D;  4ZYD A;  1E17 A;  3H1C A;  1OJL A;  3JW4 A;  2B7E A;  3GWZ A;  4BBR J;  2MC4 A;  5D18 A;  4DQ2 A;  1H0M A;  2LYC A;  4BAC A;  3LSK A;  1W5T A;  4BHC A;  1BC8 C;  1KQ0 A;  4MLO A;  1J59 A;  4XOT A;  3QU6 A;  3MWM A;  1MGT A;  1MKM A;  2XGD A;  5C44 J;  1Z05 A;  4ITV A;  2KIU A;  2X6Y A;  4HNV A;  5IPA A;  3QYF A;  3FM3 A;  2VKD A;  3I0T A;  3F0C A;  3LFU A;  4ZZD A;  3VP5 A;  1WJA A;  3OR1 C;  4R1H A;  3TP3 A;  4I6Z A;  2PMZ A;  3ZMV A;  3QU3 A;  2Y31 A;  2F5V A;  2FOK A;  2OF7 A;  5IP6 A;  1D1A A;  1JTY A;  1WGX A;  2GXB A;  2O61 A;  3F22 A;  3WHB A;  3QQA A;  3CRJ A;  1FX7 A;  2L02 A;  2W00 A;  3K4C A;  2Z99 A;  4KN4 X;  1OLT A;  3BC8 A;  2K86 A;  3IRR A;  2EIL H;  2LG4 A;  3EUH C;  3E6B A;  3DEE A;  1DP7 P;  2ETH A;  4GFK A;  4U0Y A;  3KP4 A;  2VOP A;  4KN7 X;  2QGU A;  2XSJ C;  3L09 A;  3V4G A;  1GXQ A;  4AU7 A;  2ZJP F;  1EF4 A;  1NG7 A;  3PPB A;  4A93 J;  3ZQ7 A;  5D5V B;  3QBM A;  1CGP A;  1QHH D;  5DUI A;  1YX5 A;  4XLE A;  1X4P A;  4X1E A;  2P5K A;  1JJ8 C;  2A3S A;  5CXG A;  1VQ7 I;  1YHQ I;  1I6X A;  1STZ A;  3JRG A;  2NP5 A;  2OI8 A;  3MQ0 A;  4E7L A;  3GTL J;  3C2B A;  1ETQ A;  3B6C A;  3TO9 A;  3HOU J;  2G7L A;  4D1Q A;  2H6C A;  1JTX A;  1WHU A;  2LTP A;  1MIJ A;  1SD5 A;  2QEN A;  1X2M A;  3JRB A;  3EUK L;  2R7S A;  5IT3 A;  1SVO A;  3FWE A;  2XDV A;  5K1Y A;  1X58 A;  4WF2 A;  4CYC B;  4U7B A;  2QEX I;  3MKL A;  3WOD F;  2CV1 A;  1ETW A;  2WAE A;  2XPV A;  3HOV J;  4WK8 F;  3H9J A;  1FPQ A;  5LRS A;  1LQ1 A;  2GA1 A;  3OMY A;  1FP2 A;  2XVC A;  2JRT A;  1E2X A;  1ONV A;  5FFX A;  1IRX A;  1N75 A;  2LY2 A;  1KA8 A;  1HSJ A;  1UZC A;  2DOE A;  2QWW A;  5KAI C;  2MYS A;  4CSW A;  3S16 J;  4JX5 A;  4MNU A;  2IA2 A;  3NPI A;  4YZE A;  3A02 A;  3RD3 A;  2NS0 A;  2GBY A;  3SZG A;  4BGD A;  5CJ9 A;  4LG0 B;  3KEO A;  3GZ6 A;  1N25 A;  2L9N A;  2H09 A;  2HDD A;  3OSF A;  1UST A;  1D8K A;  2KRH A;  3GVA A;  2QM3 A;  4LOC A;  2OZU A;  4J19 A;  3VYU B;  3ABK H;  5HOD A;  3DWL E;  3AAF A;  1I39 A;  2LBF A;  4RLF A;  2HQN A;  4YFK F;  3HZJ A;  4QPQ A;  3HE0 A;  1UFM A;  5DCM B;  1AKH B;  3S1N J;  4PJN A;  1TNT A;  3COA C;  4OIO F;  2JA8 J;  2EFO A;  4BXX J;  3IWF A;  3TMO A;  5BQT A;  1AOY A;  3PUF A;  4PCQ A;  3VFZ A;  3UNG C;  1OCC H;  1A35 A;  4IJA A;  2VL8 A;  2JVG A;  4HF0 A;  1WQ2 A;  3E7Q A;  2RQQ A;  3DCF A;  4B8X A;  3BJA A;  2JA7 J;  2LD5 A;  4JX4 A;  3E7L A;  1LVK A;  2A05 A;  4XN0 A;  2ZKZ A;  2NS7 A;  1K6O A;  2BY2 A;  2ISZ A;  2LFB A;  3H5A A;  2M8G X;  2A2F X;  3FIS A;  3QOE A;  1JHH A;  5TGT A;  4HF1 A;  3DBH B;  1V5G A;  3H35 A;  3MKW B;  3BLY A;  5CLS A;  1HDP A;  3SQN A;  3OYM A;  1LFP A;  1YQA A;  2B63 J;  2HVQ A;  3GZI A;  4DYC A;  2W82 A;  4KIB A;  5H6R A;  1X1B A;  5DUK A;  3TBI A;  1RR8 C;  4HST A;  4KUM A;  3CMA I;  5CKT A;  2KDO A;  3OYD A;  3F6O A;  4JNN A;  1HST A;  1IN6 A;  2DA2 A;  5IT9 Z;  5L3F A;  1DGR M;  4G6D A;  1S5L C;  2FUG 2;  1AWC A;  2X48 A;  3CCU I;  2OD5 A;  2DJI A;  4F3Q A;  1Y6I A;  1W0U A;  3KZ9 A;  3GTJ J;  3FMS A;  2IPQ X;  3K4B A;  3QOP A;  3JRE A;  3V6G A;  4MFE A;  2J5P A;  2JUC A;  2PZ9 A;  1ZH5 A;  2H6B A;  3KE2 A;  1JHF A;  4UVA A;  3A4C A;  3LAJ A;  1WJE A;  1U0J A;  3DEU A;  3WTS C;  4WCG A;  1ETY A;  1A6Q A;  1R9T J;  1OYI A;  4PSW A;  4BE1 A;  4ENK A;  2IS2 A;  2EBI A;  4LFU A;  3U1D A;  4LK1 F;  4KNY A;  4B48 A;  3FHN A;  1OFC X;  1S3J A;  1BBY A;  2R3S A;  5DAJ A;  1ZRE A;  2PMU A;  2KIS A;  1I27 A;  2Y48 A;  3ZXS A;  3QP6 A;  4XQF A;  2X85 A;  2ZNZ A;  1G4D A;  3I54 A;  3FXU A;  4Q5S F;  5HBU A;  2R7U A;  4RGS A;  4ESB A;  3VSL A;  4HG2 A;  4ENN A;  2ZBK A;  5EZH A;  5C4X J;  1FOK A;  1EH6 A;  1ZQ3 P;  2FNP A;  3SDG A;  3ASN H;  3ZQC A;  4FET A;  1U9O A;  2QQB A;  1UAA A;  1XGS A;  3D1N I;  1OCZ H;  3HRU A;  1BR4 A;  3GFI A;  1O3Q A;  1ZG5 A;  4BDZ A;  4IRI A;  2E2H J;  2YUS A;  2V1D A;  1MH4 A;  1DGW Y;  2EIN H;  3HIM A;  1C0W A;  1DU6 A;  3F3X A;  4ZTF A;  3AKZ A;  2RKH A;  3DBL B;  3HTH A;  1JT6 A;  3HTI A;  1G3S A;  5DYM A;  4S05 A;  2JRM A;  2J5O A;  4M74 A;  3JSP A;  2KP6 A;  4BQA A;  4C30 A;  5CYV A;  2ZSI B;  4KFC A;  3F23 A;  5LHG A;  5BMZ A;  1BOB A;  2L7F P;  5C3E J;  1JI8 A;  4UUS A;  1I1S A;  3MN2 A;  4BJT A;  2GEN A;  4DGW B;  4N4N B;  5K5Q A;  3K2Z A;  4M3D A;  4NUB A;  2RC4 A;  2VQL A;  1Z7L A;  3TED A;  5K7H A;  4M6Y A;  1WPK A;  5FLM J;  1BN5 A;  1BR1 A;  4UHT A;  5JFR A;  3E3V A;  1FTT A;  3PUB A;  3COL A;  3H0G J;  3W2W A;  3TO6 A;  2DXI A;  4IHX A;  4G94 A;  3SFI A;  5E3N A;  3K0L A;  3SDB A;  5HLG A;  2MBF A;  2XRL A;  3Q0W A;  1R23 A;  2K9Q A;  5J3L A;  3BPV A;  2O5R A;  3WHC A;  2K9S A;  3HB9 A;  2GAU A;  5TRD A;  4ZC3 A;  4A2U A;  2R7Q A;  2O6G E;  3ZGK A;  4IQJ A;  1YIT I;  3G3Z A;  1IN8 A;  3LL7 A;  2ZXH A;  1MJA A;  1KYW A;  4NBQ A;  2HOT A;  3ERM A;  4M3F A;  2XUB A;  5ERI A;  1QA6 A;  3VUQ A;  3S3M A;  2F4I A;  4CHU A;  1HW1 A;  1R49 A;  2HR3 A;  3HUG A;  1Z21 A;  2MLK A;  3M7G A;  3R4K A;  4XRS G;  3H0D A;  1FNN A;  2DO7 A;  2HKU A;  1G3W A;  2E1N A;  4XLC A;  1BC7 C;  2E7X A;  4PSX A;  1YJN I;  2KIQ A;  3VOK A;  3HDD A;  3CCL I;  4P96 A;  3HRM A;  3BJB A;  2V9V A;  4M6X A;  4Y17 A;  1MNE A;  4ANJ A;  1J5Y A;  1R22 A;  5FD6 A;  1R4N B;  1OCR H;  2LP0 A;  4AIH A;  4XOR A;  3TDZ C;  5GPA A;  2O7T A;  4RMN A;  1VQ6 I;  2V1X A;  3CF2 A;  2XAJ A;  4D5F A;  2IRF G;  2OQR A;  5ED4 A;  1TQM A;  3KLO A;  3E97 A;  2PX9 A;  3G71 I;  1MDM A;  2R7X A;  3K4K A;  2AS5 F;  3AG1 H;  3K4J A;  5LRR A;  2LOO A;  1OCO H;  4MO7 A;  3PL8 A;  2G9W A;  1BJA A;  4I98 B;  4XSZ F;  3DF8 A;  2BBY A;  3F72 A;  4W97 A;  1IAW A;  2X1E A;  4GFL A;  3T1B A;  3FKI J;  5GAG J;  5J40 A;  2GXG A;  1MBJ A;  2ADU A;  4B1R A;  1RC9 A;  1HC8 A;  2GQQ A;  4IRG A;  4AID A;  4E7S A;  3DBR B;  2NVU B;  4E7H A;  5B66 C;  3OYC A;  3UKG A;  3FMR A;  2OZ6 A;  3HRT A;  2CH0 A;  4D7N A;  5D5U B;  2VQH A;  3KCC A;  3JR9 A;  4B44 A;  1G6N A;  4E4H A;  1O7L A;  2VT2 A;  5ILV A;  5E3M A;  2EIK H;  1K78 A;  3AL0 C;  2XAU A;  3M1C A;  5J1Y A;  2CW8 A;  1D3Y A;  2HI3 A;  4I0B A;  5EYR A;  3MMY B;  2FQ3 A;  3BCB A;  1O3R A;  3BJO A;  4F91 B;  1XCV A;  5M3M J;  4HOB A;  1RUN A;  2GUH A;  3CJN A;  2FXA A;  1RRJ A;  1MMD A;  1TLH B;  1ZLJ A;  2IA1 A;  4IOC F;  3S8P A;  5AON A;  3S2D J;  4JK1 X;  1O3T A;  2JWT A;  4GYG A;  2WB1 A;  4LK0 F;  3TO7 A;  3JCU C;  4XLP F;  2VIX A;  4GO1 A;  5HAW A;  4BL0 B;  3CDI A;  2OJE D;  1KU3 A;  3P5J A;  3FXO A;  5LFA A;  1ON1 A;  3LSH A;  2V57 A;  2ZME A;  3DKW A;  1TW2 A;  4MFD A;  1B72 B;  2DJN A;  4D9J A;  1ETV A;  5EGO A;  5F6F A;  2MD5 A;  5JLX A;  4MGR A;  5IP9 J;  4E7K A;  3BR6 A;  3J7A Y;  2MW8 A;  2IU5 A;  4B3X A;  5L3D A;  5JVG F;  3DPU A;  3RPU A;  2M34 A;  3BCA A;  3VOX A;  2G0E A;  2NS8 A;  1X4O A;  5J1U A;  4CCK A;  2ZXJ A;  4HNT A;  2CYY A;  3HOX J;  2XKP A;  2L7Z A;  2VLA A;  3Q0U A;  1Y8Q B;  3JAM Z;  2JPC A;  5K5R A;  4YEL A;  2XF6 A;  2D45 A;  2TCT A;  2VE8 A;  5A2Q Z;  1QQI A;  1IF1 A;  2VPR A;  2FSW A;  4BEH B;  2GOM A;  2P6S A;  2F4O B;  2VBY A;  4G7O F;  4PJJ A;  3B02 A;  1AHD P;  4KA4 A;  1ZK8 A;  2HQ5 A;  1YJW I;  3SEQ A;  2K02 A;  2A69 F;  1DDN A;  1Y0U A;  1U3E M;  1T98 A;  1PUF A;  2WAD A;  4A3E J;  3ABT A;  3CCS I;  3ONQ A;  2PBI A;  2ZJ2 A;  5HNF A;  5GP9 A;  2VBZ A;  2NYX A;  2R0Q C;  1W0T A;  1LFU P;  3ZPL A;  1GV5 A;  4EJW A;  4G9Y A;  4K2E A;  2Q2E B;  1FBS A;  2O7O A;  4YRV A;  5BPD A;  5E17 F;  4U9N A;  4ENJ A;  2M7B A;  3FX3 A;  3LST A;  1A36 A;  2IGO A;  1POG A;  3GTK J;  1JUM A;  2H94 A;  1CF7 A;  3C2H A;  4G8X A;  3WTU C;  4DW6 A;  2ZO4 A;  3OSG A;  1KQ8 A;  3QWL A;  3RJP A;  1XG1 A;  5FRO A;  2IAI A;  1V55 H;  1ZLK A;  1TP4 A;  4HEA 2;  3V42 A;  3O8H A;  1YLF A;  3FDY A;  1FOW A;  2V4J C;  2Z33 A;  4HSR A;  1R4M B;  5CVJ A;  2R5Y A;  3HHH A;  1U9N A;  3HG9 A;  2EFP A;  4A3C J;  2CO5 A;  2CJJ A;  4Y3O A;  2KIF A;  3S14 J;  4M6V A;  1XSD A;  1YRN B;  2QSF X;  1NG6 A;  2FEZ A;  2E5N A;  4JYK A;  4II2 A;  1ZRF A;  1EJ9 A;  3KNW A;  2B1E A;  2QOP A;  2ESH A;  4L0Z B;  1UEL B;  5E8I A;  4IO9 F;  2UXN A;  1F5T A;  3V8L A;  4IRH A;  1J7K A;  4AYB N;  2H1L A;  4M3E A;  3J80 K;  2FOW A;  2HKX A;  3CJQ B;  1YX3 A;  4XKB A;  4ENM A;  1U78 A;  1ITY A;  4M72 A;  2V6C A;  4RM3 A;  2NOJ B;  2NVY J;  4FHT A;  4A3F J;  3IUV A;  2MH2 A;  4Z2Y A;  4XN3 A;  2HPM A;  3I71 A;  2DYS H;  4OD4 A;  3EYI A;  5KK1 A;  2OV7 A;  3LA2 A;  3NWS A;  4I0A A;  3SJM A;  2EV0 A;  1S72 I;  3EDP A;  3MZ8 A;  1UI6 A;  4EAT A;  3V8K A;  1X19 A;  4AM3 A;  2DU9 A;  1TWG J;  2DMQ A;  5H9T A;  2GA2 A;  5EFY A;  4OOI A;  3RIR A;  3ABL H;  1ZHF A;  2DOD A;  2IA0 A;  5EG0 A;  1N77 A;  2BW3 B;  3GZ5 A;  1RI7 A;  2MGQ A;  2FU4 A;  4ZDL A;  2W48 A;  3KFW X;  4RGU A;  3CTA A;  2L9V A;  3PQK A;  3FXL A;  3CCJ I;  3M8F A;  1LNW A;  9ANT A;  2PJR B;  2HYJ A;  1FSE A;  3E0J B;  3PNY A;  2ZCX A;  4F92 B;  5F1R A;  1FLI A;  3HSE A;  1U5T A;  4KWA A;  4NQW A;  3MAJ A;  3BOQ A;  3OIO A;  4IXA A;  3DPJ A;  4P55 A;  4CIC A;  5CVR A;  3KIO A;  4CCO A;  5F0H A;  2CV2 A;  1E3O C;  2HZT A;  3CCQ I;  5D4R A;  4OMZ A;  4XRF A;  5D6F A;  2XSD C;  3PO3 J;  2DOA A;  3KZY A;  3S1Q J;  2PFB A;  2RN7 A;  2O03 A;  3VW1 A;  1XC5 A;  4V2F A;  3B81 A;  5HNH A;  4NN1 A;  4LGW A;  3GEU A;  4HX4 A;  4DYR A;  3I9V 2;  1WJD A;  2X1C A;  4CYC A;  4XBF A;  1BA5 A;  1WKM A;  1FEX A;  3OYL A;  1OCP A;  2YS9 A;  4UXN A;  4AYB A;  1XMK A;  4PDK A;  1VQL I;  2P8T A;  3OWT A;  4IHY A;  1LE8 A;  4PGG A;  4UNO A;  3HL2 A;  3RI4 A;  1X1D A;  2BHZ A;  2YX7 A;  1RET A;  2K85 A;  2TDX A;  5TIS C;  5GPC A;  3JAM K;  2L7K A;  1XMX A;  2W57 A;  1F36 A;  2JK3 A;  1BI3 A;  5FMP A;  3HXL A;  5CVV A;  2M0C A;  2Y9Z A;  1WWX A;  2P0W A;  4UV9 A;  2R7W A;  1N78 A;  4CZZ A;  2DG8 A;  2ELK A;  1XN7 A;  3IUO A;  2ACJ A;  3OL4 A;  2WA0 A;  2Z16 A;  3GLX A;  3BZK A;  1Y8R B;  5K7Z A;  4KIS A;  1OR7 A;  4HAM A;  3RZD J;  2IGK A;  3ANG A;  1MJB A;  3K1P A;  4BY1 J;  3OY9 A;  2BYV E;  2TRT A;  2W25 A;  3ECH A;  4CGZ A;  3K6G A;  2L2O A;  4OU0 A;  5E1X A;  1YW8 A;  4RAZ A;  3ZMU A;  1TWF J;  1JUS A;  2JVH A;  1XMA A;  5EEA A;  3K70 D;  4RAY A;  3CO6 C;  1T08 B;  4AC6 A;  2Q24 A;  1YIO A;  3ZMD A;  3CC2 I;  2XF7 A;  1KYZ A;  4OWR B;  4DOZ A;  1FT9 A;  1DQU A;  3H3U A;  3F8B A;  4YIR X;  4ESJ A;  5TJJ A;  2E1M C;  2Y0S N;  2NNY A;  1AKH A;  4XL9 A;  3QPL A;  3FXR A;  2LH9 A;  3M4O J;  1ZGW A;  3NWT A;  3HOS A;  2R5Z B;  4BUP A;  2R7T A;  5AQC A;  2R93 J;  3LWF A;  2LF8 A;  1B8I B;  2P7C B;  3BCG A;  4C3J J;  4E7J A;  3Q5F A;  4C2M J;  4HPQ A;  1R6R A;  1XGN A;  2JZY A;  4QTR A;  1VQ5 I;  2G7G A;  2RQP A;  5DV5 A;  2UXX A;  3W2A A;  1SGM A;  1BJZ A;  1K83 J;  3ZQH A;  4Y33 A;  5KNL A;  2ZB9 A;  3ZN0 A;  2DT5 A;  2EK5 A;  4XKW A;  5D4S A;  3FXQ A;  2HOA A;  5E3O A;  1ETK A;  3S5R A;  2JA2 A;  2RAE A;  5GAH J;  5ICF A;  5GAE J;  5FKK A;  2O0Y A;  4XID A;  4NNJ A;  1S9H A;  3NEU A;  4ZH4 F;  4M73 A;  4IL6 C;  2Y2Z A;  3RPU D;  4IOA F;  3I59 B;  2OU2 A;  5ICG A;  1J2X A;  3ISP A;  1UG0 A;  5ICE A;  3LNQ A;  2L54 A;  3O6B B;  1RES A;  3GW2 A;  4Y52 J;  3HBL A;  1QZE A;  1ZN2 A;  4CCM A;  2DFE A;  4OIQ F;  3BR0 A;  1ZR4 A;  3OYH A;  3JRI A;  1JKP C;  2H8R A;  2BXY A;  3Q9S A;  3AL0 B;  1PVE A;  3WU0 A;  2P5L C;  1QZY A;  2AXL A;  2JJ7 A;  4AUX A;  4GGG A;  3IWZ A;  1RIO H;  3ZRG A;  2XB5 A;  2VPL A;  4Q48 A;  1IUY A;  2M30 A;  4CYD A;  3V8J A;  4R79 A;  2BEO A;  2LY1 A;  3OYA A;  2OTL I;  1VI0 A;  4WXC A;  2DMP A;  4C3H J;  2BHY A;  5DM7 F;  1H88 C;  5FGL A;  4LG3 A;  2E5Z A;  3PIP F;  3VDX A;  2HS5 A;  4U87 A;  4EGY A;  1FWZ A;  2EIM H;  2I10 A;  3L2R A;  3RSN A;  2MA3 A;  5F64 A;  4FX0 A;  3CUO A;  3FBN B;  4IQ4 A;  2H1K A;  4MEY F;  2M4G A;  3E6C C;  3R0J A;  4RGX A;  1WJC A;  4ZDO A;  4P1W A;  1EV7 A;  1Z6T A;  5E79 C;  3ON2 A;  3FZV A;  5K58 A;  3MKY B;  5D6E A;  4DBQ A;  2BOL A;  2V6E A;  3G7R A;  2VXD A;  3HC7 A;  2EZH A;  4BHB A;  3QOD A;  4RAG A;  4U88 A;  3NRG A;  4A3L J;  2BXZ A;  2PBX A;  4A3J J;  2XV4 S;  4AVP A;  2W84 A;  1ENH A;  1X1C A;  3HJE A;  4GCV A;  3DTE A;  1X1A A;  4J01 A;  3TL4 X;  3ZMT A;  2VXZ A;  3LOC A;  2LMD A;  4XNF A;  4XRM A;  4NC8 A;  4JQF A;  1Q1H A;  2CMP A;  3R61 A;  2QKM B;  4MTD A;  2H27 A;  3S1M J;  2PN6 A;  3ABM H;  2UXP A;  5M5X J;  4RA2 A;  3WTT C;  2EIJ H;  3K70 C;  3PM1 A;  2DCE A;  3SEZ A;  5L3E A;  2LSO A;  4EMS A;  1BM9 A;  2CQ7 A;  2XKO A;  3BHQ A;  2K9M A;  1FZP B;  2O3F A;  1B9N A;  4HW0 A;  5JR3 A;  3L2U A;  2D5V A;  4PZJ A;  2CSO A;  3EQL F;  2KT0 A;  3G1O A;  4L62 A;  1EH8 A;  4M9S A;  5HSZ A;  3K4N A;  4C2T A;  2EZL A;  3F9K A;  2V1N A;  2F5C A;  1P92 A;  1B6A A;  1F1Z A;  5C4J J;  3DLL F;  4BHP A;  1OPC A;  3DU5 A;  3L2C A;  4WIB A;  2RGV A;  2YVX A;  1WH7 A;  4A0Y A;  1ZG1 A;  1HOM A;  4IZZ A;  2CFX A;  4EGZ A;  1XCB A;  2JT1 A;  1SAN A;  3HHG A;  3RDI A;  2E1C A;  1ACI A;  2ME6 A;  2F07 A;  4XSX F;  3HOT A;  2Y69 H;  1U6G A;  2ZME C;  3AQT A;  3WTY C;  2NVX J;  4QIW N;  2GFN A;  4HBL A;  2HVS A;  4ZYE A;  3DTK A;  1Y1W J;  5HOO A;  4EQQ A;  3K9T A;  1VQO I;  2DQR A;  4C9Y A;  4MTE A;  3ZQI A;  1Q1V A;  2NOG A;  4BS9 A;  2K4B A;  5FD5 A;  1KU7 A;  4RLQ A;  2QBY B;  2DMT A;  3MVP A;  3CP2 A;  2ZCW A;  4QWQ A;  1XB4 A;  1TT5 B;  3PSI A;  3DKY A;  2CQK A;  4XON A;  1SFO J;  3VW0 A;  2CUZ A;  4ZYH A;  2E19 A;  5GTH C;  4S04 A;  3CUQ A;  3VOD A;  4NDL A;  2LR8 A;  3ON4 A;  4I09 A;  3GTQ J;  1WI9 A;  1SD6 A;  3I64 A;  2VJJ A;  5D5W B;  2QUF A;  4DIQ A;  5F04 A;  5LD2 C;  3VVX A;  4CXF A;  2LBF B;  2JPB A;  1DP3 A;  1UHS A;  3GX4 X;  4KIF A;  3GFJ A;  3GF2 A;  3PAS A;  3W6K B;  1IUF A;  3R60 A;  4JBA A;  4CZC A;  4IKF A;  1FYM A;  4YFN F;  2NAZ A;  1S29 A;  3HM5 A;  1H9T A;  3VPR A;  2Z9O A;  1XSV A;  2KQR A;  2NXN B;  3SZT A;  3K8P C;  3H9G A;  1ODD A;  1RR7 A;  3BTI A;  3G4S I;  2ZOY A;  1D0Z A;  3HEF A;  1EH7 A;  4PK4 A;  4RDU A;  3CCY A;  3GEZ A;  1RNL A;  4IF4 A;  4IHT A;  1H8A C;  3U1K A;  2BGC A;  2QKL B;  2YR2 A;  4ON0 A;  5FRM A;  3A01 A;  3M8J A;  4I01 A;  4BQQ A;  1J09 A;  5DTD A;  2P81 A;  1T6S A;  2KL4 A;  2Z5U A;  3GTO J;  3LQR A;  1Y39 A;  4C2M A;  2WY8 Q;  3L2Q A;  2C6Y A;  3C18 A;  3OYE A;  1O3S A;  3LSG A;  3ZQQ A;  3MZH A;  2VON A;  3OYB A;  4O3M A;  3J81 Z;  3I4M J;  5E3L A;  1LUJ B;  2F5F A;  2KIM A;  5K5O A;  1E0E A;  2M87 A;  3DFG A;  1MMA A;  3MEX A;  2VKH A;  3BT9 A;  2YU3 A;  4RB0 A;  5J4Y A;  5EEG A;  2X6W A;  5D1R A;  2IS1 A;  1D0Y A;  5DDG A;  4PUS A;  3CMM A;  2OAZ A;  5L3B A;  4MXM A;  3F8F A;  1R1T A;  3FXJ A;  3V7R A;  3JRA A;  5D8K B;  3OYG A;  1TL8 A;  1IN5 A;  2D6Y A;  3Q3S A;  4NB5 A;  3O8G A;  1OMI A;  5HDG A;  2VOO A;  4L0Y B;  2DA6 A;  3LSI A;  1GUU A;  4FCY A;  1ZKG A;  2ELH A;  2FE3 A;  2E7W A;  2KKO A;  4UVB A;  5L3C A;  2K7L A;  3PNT A;  2O8X A;  2KFD A;  3KZZ A;  2R7Z J;  1D8J A;  3QYB A;  1G2H A;  3L1P A;  3U21 A;  2LKP A;  3RTR A;  2R7R A;  1OCT C;  3EPZ A;  3F8M A;  3LFK A;  2IJL A;  5E1Z B;  2K4J A;  2ME0 A;  4Y15 A;  2QA4 I;  2DFF A;  1Z77 A;  1MZB A;  2FBI A;  4BE2 A;  2FA5 A;  4KIG A;  5F1J A;  4E7I A;  1JGG A;  1IV8 A;  3U2R A;  1BW6 A;  3H36 A;  1ZTR A;  2EH3 A;  3K4M A;  1OKR A;  4F55 A;  1LDJ A;  5EF6 A;  3MZY A;  1IG7 A;  1GVD A;  2NRA C;  5ILS A;  4LB5 A;  2W4S A;  4KT5 C;  2CW7 A;  3WU1 B;  1K4T A;  5IY5 H;  1V4R A;  2FMY A;  4Z6Y A;  2EFW A;  1ETX A;  1YW7 A;  3WG7 H;  2RAS A;  3HTS B;  1ZGA A;  2XAH A;  5CVI A;  3G2B A;  4EVI A;  4LIV A;  2DBB A;  1G59 A;  2CU7 A;  2EFN A;  3ABU A;  1WRJ A;  3OOU A;  1R1U A;  1U5T C;  1LDK B;  5IT9 K;  2QLZ A;  4PJ0 C;  2E2J J;  2WTE A;  2P5V A;  2REK A;  2Q8K A;  2RVC A;  1YS6 A;  4RGR A;  4G12 A;  5F0C A;  2QF7 A;  3PFY A;  3VYS B;  3KX2 A;  4OAZ A;  2FBK A;  2EA4 A;  2JA6 J;  4D7M A;  2FBQ A;  4HX7 A;  4FAS D;  2Y30 A;  2VJ4 A;  1LEA A;  1ZRC A;  4GCT A;  4E70 A;  4HNU A;  3JTG A;  3TW7 A;  4YEJ A;  1S6L A;  2A5W A;  2CS3 A;  3Q9V A;  1R71 A;  2WGB A;  3QPH A;  3MNL A;  4UUS B;  5CXI A;  1IXR C;  2IT0 A;  2W53 A;  3VEP A;  2DA4 A;  2EV6 A;  1MSE C;  4M3B A;  4ZYA A;  4HZF A;  1NK2 P;  4Y13 A;  2EZK A;  2XGX A;  4GCL A;  1T95 A;  4II3 A;  1HKQ A;  3DLA A;  4YFX F;  5H2F C;  2BZT A;  3BR2 A;  4F7Z A;  2K27 A;  3FK6 A;  3C07 A;  2QVO A;  4XRS A;  1A04 A;  4OMY A;  4HDV A;  1ERD A;  3SFZ A;  4HV6 A;  2QQ8 A;  1LPQ A;  2OBP A;  2ZFU A;  2A6E F;  1U8B A;  4U9L A;  1LEB A;  2ELJ A;  1H89 C;  2L7M P;  1TT0 A;  5KHD A;  3D0S A;  2Q1Z B;  1OR7 C;  1YTY A;  2VC0 A;  3HYI A;  4I7H A;  4RAF A;  3VTI A;  4XR6 A;  2GZW A;  2V9P A;  4LMY A;  2L3D A;  2EZI A;  5LHI A;  4G7H F;  1Z67 A;  1GXP A;  4A3D J;  2RRE A;  3A0H C;  3MFK A;  1FTZ A;  2FJI 1;  1XPX A;  2A5Y B;  3HPH A;  1ZAR A;  2BVL A;  3HUG B;  2DDA A;  4A3B J;  1D1B A;  3FMQ A;  3ZCO A;  3F1B A;  2FJ1 A;  5CVU A;  2DFH A;  3VOE A;  4EJV A;  2KDZ A;  3HGY A;  1UMQ A;  1TQP A;  4HLX A;  4FE7 A;  2EQR A;  3FBI B;  2YVH A;  4XLH A;  4HLY A;  2LRE A;  4DNC A;  5FJ8 J;  3CMY A;  1K79 A;  2L4M A;  4EM1 A;  1W7P A;  5J47 A;  5DCF A;  2AO9 A;  2H8W A;  5CPR B;  5EDN A;  3KYL A;  1PP8 F;  4IRV A;  2DA1 A;  2JN6 A;  3Q0V A;  3J81 K;  2FRH A;  1PP7 U;  2YVE A;  1XS9 A;  2L9R A;  4O6J A;  2HQR A;  2HXI A;  5EJC A;  1MDM B;  2CUJ A;  1FOY A;  3A03 A;  3BY6 A;  3WTV C;  1REP C;  2DPD A;  1SD4 A;  1P2F A;  3OS2 A;  4WWC A;  3HKZ N;  3G56 A;  3E5Q A;  4A0X A;  1ZAO A;  1VQ8 I;  3WTX C;  1HW5 A;  4EJU A;  1EKE A;  4N0B A;  3N05 A;  1MBF A;  3E5X A;  3OV8 A;  2DOF A;  1G3T A;  3E1S A;  4M9Z A;  4ASN A;  3LSP A;  1D0X A;  4HYE A;  2K5C A;  3ZMS A;  3AG4 H;  3K4L A;  4A69 C;  4X0G A;  3SWH A;  2X1D A;  1VQ9 I;  2PFV A;  1SFE A;  2W1O A;  4BXF A;  3GME A;  1W4M A;  3RKY A;  3BQZ A;  2WC2 A;  2WAQ N;  1P9Q C;  4AWX B;  1UJ8 A;  1QZZ A;  2WBM A;  2YX4 A;  2DTZ A;  1S7O A;  2VOD A;  1HA8 A;  4FQG A;  1Y56 A;  2ECC A;  1GV2 A;  5FGM A;  5J8C A;  2YU9 J;  3D5R C;  2MSY A;  4PXI A;  3BTL A;  4H0E A;  4B09 A;  4ABZ A;  2P4W A;  3WU2 C;  3CP8 A;  2Z1D A;  5B5E C;  1QRY A;  3JRC A;  3KEQ A;  4NEL A;  4IVN A;  1P7J A;  5FKN A;  3TQN A;  2MLG A;  3LSR A;  3QPT A;  3OYN A;  3DPT A;  2QTQ A;  2M4K A;  4KIC A;  4N9I A;  1ZRD A;  3BPX A;  2ZME B;  1UHM A;  1LFB A;  2O9L A;  1S8N A;  2K3F A;  4CUG A;  2QIB A;  5CQG A;  4Q47 A;  5EGO B;  3PIO F;  1FY7 A;  1T56 A;  1KON A;  2I8D A;  4ZJZ A;  2PG4 A;  1TZL A;  3FXM A;  4U0V A;  3VSK A;  2EPF A;  2CUE A;  3JSO A;  1BIA A;  2M9H A;  2CGP A;  3W6V A;  4GDF A;  2R7O A;  5IOZ A;  2ZFW A;  2P7V B;  1NTC A;  3ZQL A;  2R4G A;  3ZR8 X;  3HKZ A;  1MNM C;  3BZC A;  1V3F A;  4C2U A;  2VN2 A;  2XF5 A;  4L9T A;  4M3G A;  4MQ9 F;  4IHV A;  3A2K A;  1K4S A;  1R58 A;  3DXJ F;  3P9C A;  3GBG A;  5FKL A;  1D5Y A;  4DZP A;  1YI2 I;  1Z6R A;  1Z91 A;  3GFL A;  4MQV A;  1IN4 A;  3TW6 A;  4XKC A;  1VQK I;  3C3W A;  2DA7 A;  4UY8 I;  2F5D A;  2HYF A;  3S2W A;  3S3N A;  1ZR2 A;  5J1R A;  4ZTJ A;  5FO5 A;  4DBR A;  2FNA A;  4JP0 A;  2ZCN A;  3R6S A;  1RUO A;  2IVM A;  5FKM A;  5DD4 A;  2UXO A;  5F27 A;  1UHW A;  3CJR B;  1XD7 A;  2HEO A;  1L3L A;  1JGS A;  4JL3 A;  3M1E A;  4H4K C;  1T8I A;  1B1B A;  1I1G A;  2CV0 A;  5B1A H;  4QLC U;  2DN0 A;  2ZSH B;  1SAX A;  4A0Z A;  3FIW A;  2KZG A;  1SD7 A;  3LMM A;  2DTR A;  2VE9 A;  1KGS A;  3VIB A;  2GLO A;  4IHS A;  1DPR A;  2PMZ N;  3BG9 A;  1F9N A;  3ELK A;  4FX4 A;  3J7Z I;  1HXD A;  1B59 A;  2M7A A;  3A0B C;  1DU0 A;  1GDT A;  1A31 A;  3O60 A;  4WXH A;  2RNG A;  3OYK A;  2L01 A;  3P9T A;  5HDK A;  1VQM I;  2DT7 B;  3KET A;  3ULQ B;  3ZP5 A;  4XK4 A;  2HPI A;  3I59 A;  1ORK A;  3S15 J;  2WUI A;  2LVS A;  2FML A;  3MD2 A;  4PGH A;  3BDD A;  1YOV B;  3WTZ A;  4BYY A;  1JE8 A;  3DV8 A;  4YG2 F;  2UV1 A;  2PI0 A;  1RKW A;  1SFU A;  1GVJ A;  2M0M A;  3RCO A;  1UG2 A;  3QAH A;  4BJ6 C;  1ZEL A;  4A3K J;  4YII A;  4MIM A;  5A2Q K;  3JSJ A;  5KCM A;  1HLV A;  3V7S A;  4CCN A;  3DTI A;  4CCL A;  4PFP A;  4BAY A;  2NP3 A;  3H9Q A;  2QSG X;  3BR3 A;  4A12 A;  1L0O C;  2UXU A;  2FBH A;  3OIQ A;  4YIF A;  2BV6 A;  2R5Y B;  1V5E A;  1HW2 A;  2XB0 X;  3IP4 B;  4LG0 A;  2A07 F;  1DPU A;  3LWJ A;  1ON2 A;  2ZJR F;  2ZJQ F;  4RS8 A;  2B3W A;  3CUQ C;  3KP6 A;  1XDU A;  2V7F A;  4IX7 A;  4V19 K;  3TDU C;  4MEX F;  2IP2 A;  3LJL A;  1AA7 A;  1LJ9 A;  3HRS A;  1O7F A;  1WSU A;  2ZXW H;  1UI5 A;  3WGI A;  3S32 A;  3WE3 A;  3G73 A;  4DJA A;  2E2I J;  3CD6 I;  1F43 A;  3ML6 A;  3ESW B;  3HSF A;  1T38 A;  5H20 A;  2IS6 A;  3PQJ A;  2HTS A;  5DCM A;  1HCR A;  3H5N A;  2F2E A;  3IAM 2;  3BTJ A;  2CUF A;  1Z3Y A;  4A3I J;  3PNV A;  5JI6 A;  3OYI A;  2RV8 A;  4IEJ A;  5K7F A;  2V9K A;  3IKV A;  1IDZ A;  2G7H A;  3WTW C;  2GOX B;  5D8L B;  1GT0 C;  2JSC A;  5AIQ A;  4HQM A;  2HGC A;  1B4A A;  4C3I J;  1T33 A;  4BKX A;  4UDS A;  2CFO A;  2NNN A;  4OIN F;  4FTH A;  2WY7 Q;  5HLH A;  1FIA A;  5EG0 B;  5LGN A;  3VWB A;  1X3W B;  1J9I A;  4A6E A;  3KYC B;  3EUA A;  1FJL A;  3P9K A;  3WG9 A;  2PQ8 A;  3I56 I;  2YSR A;  3KZI C;  3BRO A;  2ZOZ A;  3F21 A;  3QRF F;  1U8R A;  2ZCM A;  1Z0X A;  4AIJ A;  1U5T B;  5BOX A;  3CCV I;  4NQW B;  4CGR A;  2Q0O A;  1X3U A;  2B0L A;  1MBK A;  2QCO A;  2XAS A;  3OIP A;  3EUP A;  1OYY A;  4KJZ A;  3CC7 I;  3CQZ J;  1B9M A;  4P9U A;  1BIB A;  2ESN A;  3DPL C;  2AHQ A;  1TC3 C;  1YW9 A;  4LLG F;  1Y1V J;  3CJT B;  3GUD A;  3TGN A;  2BY3 A;  3I5U A;  3M9A A;  4HX8 A;  4ESF A;  1YO5 C;  1IN7 A;  2KRC A;  4F93 B;  1W7P D;  4OD5 A;  2VKV A;  5CQE A;  3BG3 A;  4AD9 A;  1W1W E;  3SZP A;  1VQP I;  1Z3X A;  2K3P A;  3QKX A;  1YS7 A;  1MMG A;  1LE8 B;  4BNC A;  4LD5 A;  4UV8 A;  1SC7 A;  2F5E A;  3IHU A;  5HLT A;  5FRN A;  2Y0S A;  1SEU A;  2MH9 A;  4XKV A;  4G7Z F;  3IC7 A;  3DQV C;  1V54 H;  2LKX A;  1LKX A;  1R00 A;  2IXS A;  2A61 A;  1EA3 A;  3HOW J;  1GHC A;  2QBY A;  3V7C A;  3KP3 A;  2KRF A;  5F0F A;  3RPQ A;  2OCC H;  2E36 A;  4FIS A;  5L3G A;  2PJP A;  4EJT A;  3N97 A;  1HQC A;  2F4M B;  2JA5 J;  1JKO C;  3DKX A;  2LF7 A;  3BP8 A;  4RB3 C;  3HOY J;  3C2G A;  2IGM A;  2VQC A;  3IH2 A;  2MFZ A;  3PO2 J;  2IS4 A;  1JKQ C;  4BH9 A;  2L0K A;  2VBW A;  3FM5 A;  3FK7 A;  4M9X A;  4I99 C;  3M8E A;  1SVL A;  2DFI A;  4Y7N J;  1F4K A;  4QSH A;  3HIF A;  2CWE A;  3KP7 A;  3L7W A;  4GXO A;  3SXY A;  4B47 A;  3S3O A;  3ASO H;  5B1B H;  2WAF A;  2IW5 A;  2HVR A;  4BE0 A;  1BL0 A;  3SYT A;  4XOP A;  1KQ9 A;  2KMU A;  5DD8 A;  2HU9 A;  1VND A;  4OIR F;  4UUV A;  2KJC A;  4L18 B;  4AVZ A;  1QPM A;  3K1N A;  3I4N J;  1WH5 A;  4BU2 A;  2YPR A;  1KZH A;  4JX6 A;  2HDW A;  1G8X A;  2CRG A;  3RQI A;  1HDD C;  1FYL A;  2EB7 A;  1P4A A;  2CG4 A;  4DZJ A;  3K1M A;  2X9D A;  4L9N A;  2JTV A;  2WV0 A;  3ZOB A;  2L5Q A;  2LC2 A;  5E18 F;  4AF5 A;  3AG3 H;  2HFH A;  1XGO A;  3E6D A;  3KLN A;  2KZV A;  3KP5 A;  1T0F A;  4FT8 A;  3OS0 A;  3BRU A;  2MC3 A;  5H6Q A;  2VC1 A;  1R5I D;  2R7D A;  4UVC A;  5LLQ A;  5GAD J;  3CO7 C;  1J75 A;  1MBE A;  3WGG A;  3I4P A;  1G3Y A;  3TKY A;  2EWN A;  2HTJ A;  3ECO A;  4RB1 A;  2MG4 A;  5E1W A;  1RZ4 A;  4GFB A;  3HGG A;  3KEY A;  5FLX Z;  5KVR A;  1OIS A;  1TWA J;  1PUE E;  5HDN A;  3I3L A;  1I3A A;  2VT3 A;  3J7A O;  2F6C A;  3CWR A;  4I2O A;  2COB A;  5J8F A;  2AQF A;  4XLF A;  4GYI A;  3C7J A;  3SHF A;  2XAF A;  1DUX C;  4I76 A;  4A3G J;  3VW2 A;  1YIJ I;  4L5E A;  2IGN A;  2MAB A;  3GTG J;  2NX4 A;  5M3F J;  3ANP A;  3GLL A;  1E3H A;  3LA3 A;  2GIZ A;  2XIG A;  4Y4R A;  2Z2S B;  1SMY F;  2E60 A;  2L4A A;  2XAQ A;  3B6A A;  1FIP A;  1KU2 A;  2VB6 A;  4EJO A;  2W7N A;  3KP2 A;  5BPI A;  3S2H J;  2NVT J;  5E20 A;  3KKC A;  2BE5 F;  2XGE A;  1MBG A;  2B9S A;  4X6A J;  4KDP A;  2XAG A;  1IRZ A;  3A1Y A;  4M71 A;  4LLL A;  3JTH A;  1KU9 A;  1SMT A;  1TWH J;  2ZNY A;  1FBU A;  2E34 A;  1QVU A;  2DLL A;  3P9I A;  2AQE A;  3VYT B;  1I3Q J;  2STW A;  4FE4 A;  3GYH X;  2DA3 A;  1JXS A;  2V1U A;  2FF4 A;  2RNJ A;  1VZ0 A;  1FMW A;  2OER A;  1HBX G;  2HWV A;  1S7E A;  2E1O A;  2CQQ A;  2PEX A;  2GWR A;  3RYR A;  3NS4 A;  3C1D A;  5DEQ A;  4HA8 A;  4XIC A;  4XLA A;  3RKQ A;  2HYG D;  2X0L A;  3EUH A;  1JUP A;  4BQO A;  1BI0 A;  1ETO A;  3CME I;  1O57 A;  4UUT A;  3OR2 C;  4BJ5 C;  3W6J B;  4LLN A;  3NXC A;  2R7F A;  2LDU A;  3U9G A;  1QHG A;  1R7J A;  3BQY A;  2KPM A;  1W36 D;  1JJ6 C;  5J6X A;  3PFI A;  1BOA A;  4ZDP A;  1ZYR F;  2ID3 A;  5LBQ A;  4HDU A;  3BJ6 A;  5IOY A;  3O3K A;  4CA0 A;  3GXO A;  4KT6 A;  3FHZ A;  2A6T A;  3OS1 A;  1P4X A;  2O8K A;  1MMN A;  3IKT A;  1LB2 A;  2DG7 A;  3IL2 A;  1UCR A;  2AXT C;  4E6K G;  4NHJ A;  4NC7 A;  4BDY A;  4HQE A;  3QP5 A;  4Q4Z F;  1FSH A;  2G7S A;  4DYQ A;  3NNR A;  3KYD B;  1SVM A;  3T5X A;  5EZG A;  2GM4 A;  3K10 A;  5HS7 A;  2DDB A;  1WJF A;  4JKZ A;  3I55 I;  3KPH A;  1ZG3 A;  3BG7 A;  1B72 A;  4HV5 A;  3RZO J;  4A6D A;  3T0Y A;  5FHP A;  2QWT A;  2M45 A;  2XDN A;  3NAR A;  4E7Z A;  3L9F A;  2VUM J;  4JOM A;  2DMU A;  3MCZ A;  3IH3 A;  1WJ5 A;  4LIU A;  5FKO A;  3BG5 A;  2CQN A;  3WE2 A;  3QPS A;  5D5X B;  3JRD A;  2ICW G;  4PJM A;  2XGC A;  2G7U A;  4WXD A;  2LRD A;  2K40 A;  4I02 A;  4EM0 B;  4ACI A;  3CUQ B;  2WB1 N;  3OL3 A;  3ZMZ A;  4B3A A;  3W3C A;  1YFH A;  1BI1 A;  4BEH A;  3LAP A;  5CW8 A;  3VB2 A;  3RKX A;  1M1E B;  3I53 A;  2FQ4 A;  3G1M A;  4UB6 C;  1FOX A;  3F6V A;  3WGH A;  2OPT A;  2UXI A;  1RPW A;  1HF0 A;  1FBQ A;  4A3M J;  4R8H A;  1Z9C A;  1P7I A;  1UB9 A;  2M3A A;  1TNS A;  1IO2 A;  3JRH A;  4KMF A;  2E1M B;  3IH4 A;  2PLY A;  3ERE D;  2N8G A;  2D1V A;  3J7Y J;  1A6I A;  3CZ6 A;  1T2K A;  2GXA A;  3RH2 A;  3M3Y J;  3CDH A;  3A01 B;  4B4C A;  3IV5 A;  3J80 Z;  1QVT A;  5FLX K;  4XLN F;  1XTA A;  4EV0 A;  1JKR C;  1BW5 A;  3CCR I;  3BG6 A;  1IJW C;  2Q2E A;  2VI6 A;  1OQY A;  4LIT A;  3REO A;  5BS6 A;  2QZ8 A;  4W1U A;  2X6X A;  2VJ5 A;  5DS9 A;  1GLN A;  3HTU A;  1PYV A;  2F48 A;  1W5C C;  4CO8 A;  2HXO A;  2HDC A;  4MK6 A;  2HZD A;  2DK5 A;  1J0R A;  1D1C A;  1U2W A;  3T8R A;  3EYY A;  3HTJ A;  4ME9 A;  1MBH A;  3IAS 2;  1MMS A;  4CH7 A;  1JT0 A;  1YJ9 I;  1TW3 A;  3ZQG A;  2DA5 A;  4PJL A;  1V5F A;  2FD5 A;  1CQT A;  5AIP A;  2V79 A;  2W24 A;  4DVY P;  3GTP J;  3RQ4 A;  3ROU A;  4BQN A;  3VVZ A;  2E35 A;  2EJR A;  3H92 A;  4P5O A;  3TOB A;  1PDN C;  3HSR A;  3F8C A;  1YYV A;  2ZY9 A;  4CCJ A;  3R0A A;  3X2Q H;  4HRI A;  4XMY A;  3LSJ A;  4OIP F;  4V2G A;  2DPU A;  4F52 A;  3T6N A;  3OYJ A;  1TWC J;  1W36 C;  3DEW A;  4BY7 J;  2ZC2 A;  3N4M A;  2HQA A;  2JSP A;  4N4O B;  2VBX A;  3RKW A;  5DM6 F;  1MH3 A;  3GTM J;  3K7A J;  1YRN A;  4G6T B;  3QYE A;  3LA7 A;  2UWM A;  5HVQ C;  4BBS J;  1K61 A;  2ID6 A;  1WVR A;  2IEK A;  1WZ2 A;  4S0H B;  1FC3 A;  3TOA A;  2VAS A; 
#chains in the Genus database with same CATH homology
 2DMP A;  3VIB A;  4C3H J;  2GLO A;  2PMZ N;  2L7F P;  1H88 C;  5C3E J;  5FGL A;  3BG9 A;  4UUS A;  3MN2 A;  1GDT A;  2GEN A;  1DU0 A;  4M3D A;  3O60 A;  2I10 A;  3TED A;  1VF9 A;  5K7H A;  2H1K A;  3VVY A;  1WPK A;  5FLM J;  1QPI A;  3P9T A;  2LK2 A;  1FTT A;  5K58 A;  3COL A;  3ON2 A;  3H0G J;  4XK4 A;  3G7R A;  1ORK A;  3S15 J;  4IHX A;  2EZH A;  3BR1 A;  2WUI A;  3SFI A;  3NRG A;  2LVS A;  2FX0 A;  5E3N A;  2UXH A;  4A3L J;  5C4Y A;  2XRL A;  3EGQ A;  1VFC A;  2PBX A;  3Q0W A;  4A3J J;  1RKW A;  2K9Q A;  4IHW A;  1UG2 A;  5IYC J;  1ENH A;  5IYB J;  3BNI A;  5J3L A;  4A3K J;  5FLV A;  3WHC A;  2K9S A;  3HB9 A;  4MIM A;  3JSJ A;  1HLV A;  3LOC A;  4XRM A;  2NP3 A;  3BR3 A;  3BR5 A;  3S1R J;  2HOT A;  3S17 J;  3S1M J;  2UXU A;  4M3F A;  2R5Y B;  2UXP A;  5M5X J;  3VUQ A;  2XB0 X;  3PM1 A;  4RBO A;  3LWJ A;  4XRS G;  1IC8 A;  3BHQ A;  2HKU A;  2IBD A;  4GCK A;  3LJL A;  2D5V A;  2ECB A;  5BNG A;  3VOK A;  2KT0 A;  3HDD A;  3G1O A;  4L62 A;  1UI5 A;  3BJB A;  2E2I J;  2G3B A;  5HSZ A;  2EZL A;  1F43 A;  2XPU A;  5C4J J;  3KKD A;  2K9N A;  2HOS A;  2Y9Y A;  2LP0 A;  4ICH A;  2LLK A;  1HCR A;  5GPA A;  4A3I J;  3BTJ A;  2CUF A;  2O7T A;  1WH7 A;  4D5F A;  1HOM A;  4IEJ A;  5K7F A;  2WV1 A;  1RKT A;  1IDZ A;  1SAN A;  1I50 J;  1AU7 A;  2ME6 A;  2F07 A;  1GT0 C;  3AQT A;  3NI7 A;  2NVX J;  4QIW N;  2GFN A;  2XPW A;  4MO7 A;  4C3I J;  1T33 A;  4BKX A;  1Y1W J;  4UDS A;  4W97 A;  1APL C;  4FTH A;  5EG0 B;  1FIA A;  3HOZ J;  4GFL A;  3FKI J;  5F08 A;  3ZQI A;  1FJL A;  1Q1V A;  2NOG A;  1NK3 P;  1MBJ A;  4B1R A;  3CJD A;  2NVQ J;  5JLW A;  2ZOZ A;  2DMT A;  3MVP A;  2ZCM A;  1IGN A;  1Z0X A;  3LHQ A;  4CGR A;  3UKG A;  1MSF C;  1MBK A;  2QCO A;  3JR9 A;  4D7N A;  1SFO J;  2QKO A;  3VW0 A;  3EUP A;  2E19 A;  1O4X A;  5E3M A;  4NDL A;  2LR8 A;  5J1Y A;  3CQZ J;  2LY9 A;  3GTQ J;  3ON4 A;  1X2N A;  2R92 J;  2HI3 A;  3VVX A;  5EYR A;  5F04 A;  4D5C A;  2AHQ A;  1UHS A;  1TC3 C;  3PAS A;  5M5Y J;  1IUF A;  1Y1V J;  2RHA A;  5M3M J;  5IP7 J;  2GUH A;  1IDY A;  3HM5 A;  3VPR A;  2R5Z A;  3S2D J;  2VKV A;  3BG3 A;  2HYT A;  1I6H J;  2M2E A;  2JWT A;  1RR7 A;  3BTI A;  1B8I A;  2ZOY A;  3HEF A;  5IYD J;  4RDU A;  3CCY A;  3QKX A;  1H8A C;  5HAW A;  4HKU A;  1LE8 B;  3JRF A;  1WCM J;  1PUF B;  3HTA A;  3A01 A;  2V57 A;  1WI3 A;  4MFD A;  1B72 B;  5DTD A;  2DJN A;  2P81 A;  1ETV A;  5M5W J;  5EGO A;  2CQX A;  2LKX A;  3GTO J;  5JLX A;  3V78 A;  5IP9 J;  3HOW J;  2X6O A;  3BR6 A;  3FRQ A;  2MW8 A;  3K2A A;  5F0F A;  2IU5 A;  3LSG A;  3TP0 A;  2M34 A;  3BTC A;  2DMN A;  4FIS A;  3VOX A;  3I4M J;  2G0E A;  2NS8 A;  5E3L A;  5J1U A;  2JMW A;  3H3V K;  3HOX J;  2JA5 J;  1JKO C;  2L7Z A;  3CDL A;  3Q0U A;  3AQS A;  3BT9 A;  3HOY J;  3IH2 A;  3PO2 J;  1JKQ C;  5D1R A;  1A5J A;  2TCT A;  2L0K A;  3FK7 A;  4EEF G;  3NAU A;  4MXM A;  2VPR A;  2VKE A;  4Y7N J;  4QSH A;  3JRA A;  2D6Y A;  5D19 A;  3Q3S A;  3O8G A;  1AHD P;  1ZK8 A;  2HQ5 A;  2DA6 A;  1GUU A;  4FCY A;  1BL0 A;  1ZKG A;  4AC0 A;  1VND A;  1G2H A;  2R7Z J;  3ZQF A;  1PUF A;  3L1P A;  4A3E J;  1IV6 A;  1OCT C;  3I4N J;  1WH5 A;  3G1L A;  2ME0 A;  1OJL A;  1Z77 A;  4JX6 A;  5GP9 A;  1JGG A;  2R0Q C;  3RQI A;  2CRG A;  5F1J A;  1HDD C;  4BBR J;  5D18 A;  1BW6 A;  1ZTR A;  2EH3 A;  4DZJ A;  1W0T A;  1LFU P;  2X9D A;  3ZOB A;  1FEX A;  1GV5 A;  4AF5 A;  4MLO A;  5EF6 A;  2O7O A;  1IG7 A;  1GVD A;  2XGD A;  5C44 J;  3BRU A;  4HNV A;  1POG A;  5IPA A;  3GTK J;  1JUM A;  3F0C A;  3VP5 A;  4DW6 A;  3TP3 A;  4I6Z A;  4NEL A;  1ETX A;  3OSG A;  2Y31 A;  2OF7 A;  1MBE A;  5IP6 A;  1JTY A;  1WGX A;  2RAS A;  1XG1 A;  3WHB A;  3QQA A;  2MG4 A;  3CRJ A;  2IAI A;  4GFB A;  3HGG A;  3O8H A;  2CU7 A;  1TWA J;  3OOU A;  3CWR A;  2COB A;  2R5Y A;  4GFK A;  1U9N A;  2E2J J;  4A3C J;  2CJJ A;  2REK A;  4I76 A;  4A3G J;  1EF4 A;  3PPB A;  3VW2 A;  5F0C A;  4G12 A;  4L5E A;  3S14 J;  4A93 J;  3QBM A;  4M6V A;  2QF7 A;  3GTG J;  1YRN B;  2NX4 A;  5M3F J;  3ANP A;  4JYK A;  3KNW A;  2JA6 J;  4X1E A;  4D7M A;  1JJ8 C;  2FBQ A;  2QOP A;  2NP5 A;  2OI8 A;  5CXG A;  3JRG A;  2Y30 A;  3B6A A;  3GTL J;  4GCT A;  3C2B A;  1FIP A;  4AYB N;  3TW7 A;  4M3E A;  1ETQ A;  3B6C A;  3S2H J;  2NVT J;  2WGB A;  3HOU J;  3KKC A;  2G7L A;  2XGE A;  3MNL A;  4UUS B;  1MBG A;  5CXI A;  1JTX A;  4X6A J;  2LTP A;  1IRZ A;  2DA4 A;  1U78 A;  1ITY A;  1MSE C;  2W53 A;  1X2M A;  4M3B A;  3JRB A;  1NK2 P;  1TWH J;  2EZK A;  2NVY J;  4A3F J;  4GCL A;  3IUV A;  1QVU A;  1X58 A;  4CYC B;  3MKL A;  3BR2 A;  1ETW A;  1I3Q J;  2XPV A;  3FK6 A;  3HOV J;  3C07 A;  4FE4 A;  4XRS A;  2DA3 A;  3SJM A;  2OER A;  1UI6 A;  1S7E A;  1TWG J;  2E1O A;  2DMQ A;  2CQQ A;  5H9T A;  1U8B A;  5EFY A;  1H89 C;  5EG0 A;  2L7M P;  2MGQ A;  2W48 A;  3S16 J;  9ANT A;  2HYJ A;  4JX5 A;  4XIC A;  2EZI A;  2ZCX A;  3NPI A;  4YZE A;  3A02 A;  3RKQ A;  3RD3 A;  1JUP A;  2GBY A;  1ETO A;  4A3D J;  4KWA A;  1FTZ A;  4UUT A;  3OIO A;  2HDD A;  3OSF A;  3DPJ A;  3NXC A;  4A3B J;  5F0H A;  4LOC A;  1E3O C;  3F1B A;  2FJ1 A;  4J19 A;  3BQY A;  2KDZ A;  1JJ6 C;  3HGY A;  5HOD A;  2XSD C;  1UMQ A;  2ID3 A;  4FE7 A;  3PO3 J;  3S1Q J;  2EQR A;  5IOY A;  3VW1 A;  2YVH A;  1XC5 A;  4V2F A;  3HE0 A;  5FJ8 J;  3CMY A;  3B81 A;  2O8K A;  2DG7 A;  4NN1 A;  3GEU A;  2AO9 A;  4DYR A;  5EDN A;  2DA1 A;  2JN6 A;  4CYC A;  1AKH B;  1BA5 A;  3Q0V A;  2G7S A;  1OCP A;  3S1N J;  2YS9 A;  2YVE A;  1XS9 A;  2L9R A;  4DYQ A;  3NNR A;  4IHY A;  2JA8 J;  1LE8 A;  2HXI A;  5EZG A;  2GM4 A;  4BXX J;  1RET A;  4JKZ A;  5GPC A;  3A03 A;  2JK3 A;  1F36 A;  1B72 A;  3RZO J;  5FMP A;  5FHP A;  2M0C A;  2Y9Z A;  3HKZ N;  2QWT A;  2XDN A;  3NAR A;  3G56 A;  2VUM J;  2DMU A;  2DG8 A;  2ELK A;  3E7Q A;  3IH3 A;  3DCF A;  1MBF A;  5FKO A;  5K7Z A;  3BG5 A;  2JA7 J;  3RZD J;  2LD5 A;  3ANG A;  3QPS A;  3E7L A;  4JX4 A;  4BY1 J;  2NS7 A;  2TRT A;  3LSP A;  2LFB A;  4A69 C;  2M8G X;  3FIS A;  3JRD A;  1TWF J;  1JUS A;  2XGC A;  2K40 A;  4ACI A;  5EEA A;  1HDP A;  2WB1 N;  2B63 J;  3GZI A;  3BQZ A;  4DYC A;  4B3A A;  4AC6 A;  2WAQ N;  2Q24 A;  5CW8 A;  2DTZ A;  2ECC A;  1GV2 A;  2DA2 A;  2FQ4 A;  3G1M A;  4JNN A;  2YU9 J;  2MSY A;  2OPT A;  2UXI A;  4PXI A;  2Y0S N;  1AKH A;  3BTL A;  1RPW A;  1HF0 A;  3QPL A;  4A3M J;  2X48 A;  3M4O J;  4ABZ A;  1ZGW A;  2R5Z B;  3KZ9 A;  1P7I A;  1W0U A;  5AQC A;  1QRY A;  2R93 J;  3GTJ J;  3JRC A;  1B8I B;  3JRE A;  5FKN A;  1P7J A;  4C3J J;  3JRH A;  4C2M J;  3BCG A;  4MFE A;  3V6G A;  3IH4 A;  2G7G A;  4QTR A;  2N8G A;  3LSR A;  1A6I A;  2PZ9 A;  1SGM A;  2QTQ A;  3RH2 A;  1K83 J;  1BJZ A;  3ZQH A;  3M3Y J;  3A01 B;  4B4C A;  3IV5 A;  1QVT A;  1ETY A;  2ZB9 A;  1LFB A;  1R9T J;  2O9L A;  1JKR C;  1BW5 A;  2QIB A;  5EGO B;  1T56 A;  2EBI A;  1IJW C;  2VI6 A;  5E3O A;  2HOA A;  5DS9 A;  1ETK A;  4W1U A;  3S5R A;  1OFC X;  2RAE A;  5DAJ A;  5FKK A;  4XID A;  2CUE A;  3W6V A;  2M9H A;  2HXO A;  4MK6 A;  5IOZ A;  1NTC A;  3ZQL A;  2Y2Z A;  5HBU A;  1MNM C;  3HTJ A;  4ME9 A;  4IHV A;  1MBH A;  4M3G A;  1JT0 A;  5EZH A;  3ZQG A;  2DA5 A;  3LNQ A;  5C4X J;  2FD5 A;  1ZQ3 P;  3GBG A;  5FKL A;  3SDG A;  4DZP A;  3ZQC A;  1RES A;  1U9O A;  1CQT A;  1D5Y A;  3GTP J;  4Y52 J;  3HBL A;  3TW6 A;  3VVZ A;  3D1N I;  2DA7 A;  3BR0 A;  1ZR4 A;  3JRI A;  1JKP C;  1ZR2 A;  5J1R A;  2H8R A;  3LSJ A;  4JP0 A;  2ZCN A;  3T6N A;  4V2G A;  5FKM A;  2E2H J;  2YUS A;  2UXO A;  1TWC J;  5F27 A;  3DEW A;  4BY7 J;  2JJ7 A;  4AUX A;  1MH4 A;  3HIM A;  1MH3 A;  1DU6 A;  3GTM J;  2XB5 A;  3K7A J;  1YRN A;  4JL3 A;  4BBS J;  3HTI A;  1K61 A;  3HTH A;  1JT6 A;  2ID6 A;  2IEK A;  4S0H B;  2DN0 A;  3FIW A;  1VI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...