2Y30A

Simocyclinone d8 bound form of tetr-like repressor simr
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
242
structure length
227
Chain Sequence
EPVSIWMLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
molecule tags Transcription
molecule keywords PUTATIVE REPRESSOR SIMREG2
total genus 85
structure length 227
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y30A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y30A02
2DMQA 2UXOA 1UHSA 1IJWC 2DMTA 3T6NA 4UUSA 3TW7A 2Y30A 2ECBA 3LNQA 3RQIA 4D5CA 4J19A 2DTZA 3JRBA 1FJLA 3HGGA 5DAJA 5K58A 4FE4A 2HYTA 3BR5A 1E3OC 3JRCA 5EZGA 5FLMJ 3ZQGA 1TWAJ 2G7GA 3KKCA 1B8IA 2WAQN 1H89C 2XB5A 2Q24A 2OPTA 2CQXA 4DW6A 1LE8A 5J1YA 1Y1WJ 4BXXJ 1QPIA 4AC6A 1MBJA 2EZLA 4LOCA 4IHYA 2XB0X 4L5EA 2JA6J 3H3VK 1F43A 1WGXA 2HXIA 4JNNA 1ZR2A 1Z0XA 3BTLA 2QCOA 4DZPA 2HXOA 1ZK8A 3HTIA 4D7MA 3NPIA 4C2MJ 4A3MJ 3JRIA 4M6VA 2DMPA 3E7QA 3CRJA 3UKGA 1TWHJ 3MVPA 3F0CA 1ZR4A 1IRZA 2RASA 1VF9A 4XRMA 2XDNA 4X6AJ 3ANPA 4W1UA 1QRYA 2WB1N 3TEDA 3C07A 5IYDJ 3G7RA 5HODA 1ETQA 4XICA 5HBUA 4BBRJ 1ZKGA 1B72B 3DEWA 3GTPJ 5F08A 2VKVA 2VKEA 1ETKA 4MO7A 5EG0A 1ZGWA 1XC5A 2G3BA 3FK6A 4C3IJ 2UXIA 3HIMA 3PM1A 2XRLA 2ECCA 1DU6A 1NTCA 3TW6A 1Q1VA 3ZQLA 3C2BA 3FISA 4S0HB 2CRGA 3A01A 4A3FJ 1WCMJ 5F04A 2WV1A 1QVTA 4AC0A 4A3EJ 3HTHA 1MSEC 2X48A 3BR3A 3BTIA 3BTCA 1SANA 2LKXA 3Q3SA 1HDDC 2COBA 2L7FP 2OI8A 2JA5J 2L9RA 2NVXJ 3L1PA 3PPBA 4MFDA 1A6IA 2NOGA 3EGQA 5F27A 2X9DA 4XRSG 2EZIA 3BG9A 2HOAA 1RR7A 3FKIJ 4NDLA 5IP7J 3BR0A 2CU7A 2K9SA 5E3LA 1RPWA 3HEFA 3BRUA 2WGBA 3KNWA 2DN0A 1MSFC 3BT9A 3BG3A 3BG5A 1TWFJ 5EZHA 4M3BA 1BL0A 3OOUA 1JKRC 2E2JJ 3HOUJ 2UXUA 2NX4A 5M3FJ 2JN6A 2LFBA 4HNVA 3B6CA 1JUMA 1OCPA 3O8GA 1JKPC 4PXIA 3VVYA 4C3JJ 5EG0B 2UXPA 3VW1A 1WPKA 3JRAA 5D19A 2AHQA 3SFIA 2Y9ZA 3Q0UA 4UDSA 2B63J 2Y2ZA 1CQTA 3Q0VA 2HOSA 2EH3A 5C4JJ 3LSPA 1PUFA 3VIBA 4FTHA 3H0GJ 1JJ6C 2NP3A 5F0HA 3FIWA 3KZ9A 2EBIA 2MG4A 2G7SA 4B1RA 1IG7A 3CMYA 1JTXA 3P9TA 3S1NJ 4NN1A 2LLKA 2LK2A 1DU0A 4I76A 4FCYA 2IAIA 3AQSA 3HTJA 1W0TA 1NK3P 5FHPA 3ON2A 5FKNA 1LE8B 2OERA 3A03A 3TP3A 3JRFA 3SJMA 5E3MA 3LOCA 4JL3A 2HOTA 1TWCJ 2DA2A 2K9NA 2NVYJ 4ACIA 1QVUA 4C3HJ 2VUMJ 2R92J 2PMZN 2NVTJ 5IYCJ 5F1JA 1JT0A 2O9LA 5FLVA 2QOPA 3VVZA 5IYBJ 4JX4A 5IOZA 1VFCA 3HOWJ 3BNIA 2XGEA 5M5WJ 3V78A 1ETYA 3LSRA 2RHAA 3COLA 3K7AJ 2P81A 1TWGJ 3O8HA 4I6ZA 3NRGA 2ZCMA 5H9TA 2JK3A 4GCKA 3ZQFA 4DYCA 1BW6A 2Y0SN 4MFEA 1JT6A 1IC8A 1SGMA 2I10A 3E7LA 3LSGA 3JRHA 3EUPA 5F0CA 1UI6A 1XS9A 3BR6A 5K7FA 2H8RA 4AUXA 1ETXA 2DA6A 2DA3A 3QPSA 1R9TJ 3S15J 3A02A 3CJDA 3G1OA 1S7EA 3IUVA 4JX5A 4A3IJ 1K83J 5E3OA 2LP0A 5EDNA 3GTOJ 1HCRA 3SDGA 2EZHA 3S2HJ 1GV2A 2NP5A 1B72A 2FX0A 2LTPA 2VI6A 3LHQA 3S2DJ 2CJJA 4JX6A 3QPLA 2ZCNA 2E2IJ 1MBGA 4UUSB 4ME9A 2NS7A 2D5VA 2M8GX 4XRSA 2R93J 2M2EA 4RDUA 3HGYA 3CQZJ 4B3AA 4MIMA 5IOYA 5EEAA 4IEJA 1VNDA 4M3FA 2JWTA 1JTYA 2R5YA 4M3DA 3W6VA 1H8AC 1ORKA 1XG1A 2MSYA 2LVSA 5D18A 5FKMA 2IEKA 4Y7NJ 3QBMA 3WHCA 1RESA 1RKWA 3CDLA 1GVDA 3S5RA 3OSFA 2L7MP 4B4CA 4BBSJ 1FTZA 1IGNA 1HLVA 2V57A 1MBHA 5K7HA 2XGCA 3S1RJ 3VOKA 3HDDA 5EFYA 1WH5A 5M3MJ 2IU5A 3O60A 1ETVA 3GBGA 4X1EA 3GTGJ 2E1OA 3HKZN 4BY7J 2LY9A 3JR9A 5FGLA 1X2MA 4AYBN 3GZIA 1PUFB 2ME6A 3G1MA 3HOXJ 2R0QC 2JA8J 4DZJA 5JLWA 1JUPA 2DA4A 3PO2J 3IV5A 4YZEA 2X6OA 3MKLA 2QWTA 1BW5A 4A3CJ 4A3JJ 1IV6A 2MW8A 2QIBA 1Z77A 1UI5A 5J3LA 3TP0A 3RZOJ 3S16J 4MK6A 2YVHA 4CGRA 3LJLA 3QKXA 4M3GA 1T33A 1U78A 1BJZA 2XSDC 3Q0WA 1UMQA 1APLC 3VUQA 1JGGA 1MBKA 2MGQA 3ANGA 3RZDJ 3MN2A 1HF0A 5HAWA 2PBXA 4HKUA 5C4XJ 1UG2A 3RH2A 3BTJA 1WH7A 1P7IA 4A69C 3ZQIA 4A3GJ 2FQ4A 3HOZJ 1VI0A 3M3YJ 2CUEA 2CUFA 4FE7A 3OSGA 5E3NA 1I6HJ 2HI3A 2NS8A 1ZQ3P 3BQYA 5K7ZA 5M5YJ 5FKLA 2JJ7A 3CWRA 2LD5A 1GT0C 3VVXA 2NVQJ 4UUTA 5F0FA 3RKQA 2DMNA 4DYRA 4Y52J 1G2HA 4JYKA 4A3LJ 2FJ1A 3B6AA 5IP6A 3PASA 3NARA 1WI3A 1IDZA 1HDPA 3VP5A 2JMWA 2XPUA 2DA5A 3HBLA 2W53A 3GEUA 3AQTA 4KWAA 2PZ9A 2L7ZA 4NELA 1ENHA 5FMPA 9ANTA 2RAEA 1ZTRA 3S17J 2QF7A 3HB9A 1JKQC 1D5YA 3QQAA 5DS9A 2GBYA 2W48A 3JREA 3PO3J 2DJNA 3A01B 2HYJA 4A93J 2HKUA 3ZOBA 2GM4A 5AQCA 1A5JA 1MH4A 4EEFG 3NAUA 2QTQA 1ETOA 3LWJA 2Y9YA 2TCTA 5J1RA 1K61A 1JUSA 2F07A 3GTLJ 3S1MJ 3JSJA 4L62A 1W0UA 3GTKJ 2REKA 1MBFA 3BJBA 1X2NA 4CYCB 2H1KA 4MLOA 4BKXA 5C3EJ 1JJ8C 4GFLA 2E19A 2XGDA 2K40A 3HM5A 3NXCA 4ICHA 4V2GA 2D6YA 5JLXA 5GPCA 2R5ZA 1F36A 1FTTA 1NK2P 3FRQA 5CXGA 2O7TA 3JRGA 1H88C 1HOMA 1MH3A 1I50J 2G7LA 4IHXA 3VW2A 4XK4A 1FIAA 3VPRA 2GFNA 1T56A 2O8KA 2EQRA 2DMUA 3K2AA 3NI7A 4A3DJ 1Y1VJ 2ZOYA 4GCLA 4V2FA 3I4MJ 1GDTA 1B8IB 1I3QJ 1BA5A 2QKOA 4W97A 2N8GA 4GCTA 1P7JA 1TC3C 5CXIA 1U9OA 2DG7A 2FBQA 3HTAA 3V6GA 4DYQA 5C4YA 3GTQJ 2ME0A 3B81A 5IP9J 3G1LA 4MXMA 2K9QA 2ELKA 2L0KA 2M34A 3OIOA 1AHDP 3KKDA 3GTMJ 1OCTC 1YRNB 1FEXA 3RD3A 1ETWA 2HQ5A 5EGOB 1IUFA 5D1RA 2ID3A 4FISA 3I4NJ 4QIWN 3S14J 3MNLA 5FKOA 1RETA 3FK7A 4JKZA 3S1QJ 4G12A 4RBOA 3DCFA 5BNGA 1IDYA 2ZB9A 2ZOZA 3BQZA 3LSJA 2YVEA 1SFOJ 2O7OA 2XPWA 2DG8A 3F1BA 1FIPA 2R5ZB 2DA1A 3GTJJ 1AKHA 1AKHB 2JA7J 1MNMC 5FJ8J 5CW8A 4M3EA 5C44J 4BY1J 2YU9J 1X58A 1O4XA 2YUSA 4QTRA 5FKKA 5GP9A 2E2HJ 2DA7A 3BR2A 1GUUA 2OF7A 5EYRA 5EF6A 3D1NI 2ZCXA 2ID6A 1U8BA 2R5YB 4IHWA 4A3KJ 2IBDA 2TRTA 5EGOA 2WUIA 3ON4A 2GUHA 1POGA 1LFBA 5DTDA 3IH2A 2M9HA 3HE0A 3VOXA 2EZKA 4QSHA 3IH4A 4GFKA 4CYCA 2GENA 2FD5A 3HOYJ 2AO9A 2VPRA 5HSZA 1RKTA 3M4OJ 1EF4A 1OFCX 2HDDA 4A3BJ 3HOVJ 2CQQA 1ITYA 3VW0A 5IPAA 1LFUP 2M0CA 4IHVA 2UXHA 2LR8A 2KT0A 3BCGA 1JKOC 3JRDA 3BHQA 5M5XJ 2G0EA 3IH3A 1OJLA 4JP0A 1YRNA 1MBEA 5J1UA 2KDZA 2Y31A 3CCYA 4ABZA 4D7NA 4AF5A 5GPAA 2GLOA 2XPVA 3DPJA 3NNRA 2R7ZJ 4D5FA 1GV5A 3BR1A 3ZQHA 1AU7A 4GFBA 1U9NA 3ZQCA 2YS9A 3G56A 4XIDA 3WHBA
chains in the Genus database with same CATH superfamily
2UXOA 3KP2A 1BI1A 4MTDA 1MMAA 4UUSA 2FF4A 3RTRA 2W7NA 2RQPA 3I59A 1VQKI 2HZDA 2HYTA 3DLAA 3SZPA 1Z9CA 2DO7A 5FLMJ 1T8IA 2MLKA 5JR3A 3K4MA 2OPTA 3L00A 2EIMH 3HSFA 3I53A 4Q48A 2VN2A 3PUFA 4HLXA 2P7VB 2EZLA 2LOOA 2R7RA 2UXXA 5DD8A 1WJFA 4E7HA 2JA6J 1ZREA 1F43A 1W1WE 1WGXA 2DCEA 2HXIA 3SEZA 3FHNA 3BTLA 1ZK8A 4OMZA 2WAFA 4YEJA 3DKXA 3TO9A 4C2MJ 2F5FA 1RNLA 2KMUA 3JRIA 4A3MJ 1BIBA 3E7QA 2ZNYA 3CRJA 2CYYA 3MVPA 3F0CA 1VF9A 5AIQA 4HLYA 2HPMA 3CLQA 3ANPA 1QRYA 3C07A 1QHGA 3AL0B 2E7WA 4L0ZB 1X1PA 4NQWA 1ETQA 4E7LA 3R0AA 5HBUA 3DF8A 2V1UA 3ZR8X 3GTPJ 5F08A 2VKEA 1O57A 4XMYA 1XC5A 3OYAA 2L2OA 4PJLA 3OYBA 1DU6A 3DBRB 5KAIC 1NTCA 3ZQLA 3M8FA 2LKSA 3C2BA 1MZBA 4G7ZF 4PDKA 1O3SA 1WCMJ 2WV1A 4IOCF 1USSA 2X48A 3BR3A 2P6SA 2VE9A 1FC3A 3Q3SA 2COBA 3IRRA 2GXGA 2G7UA 2L9RA 3PPBA 4U88A 1WHUA 2BY2A 4CO8A 3TDUC 3ESWB 3WU1B 2EZIA 2DFEA 4FHTA 3FKIJ 3BR0A 1S29A 2K5CA 3LA7A 4E7ZA 5E3LA 2KQRA 5E17F 2X51A 2DN0A 1MSFC 1G59A 1BI0A 3BG5A 4BHCA 4M3BA 1QGPA 4EJOA 2E2JJ 1ZRDA 3DKYA 2NX4A 3K8PC 5M3FJ 2B3WA 1D0YA 3CCEI 3B6CA 3DXJF 2BGCA 3O8GA 5JVTA 4DGWB 3K4LA 5EG0B 2UXPA 1A31A 2ZXHA 3HZJA 4KA4A 1MMDA 2STTA 4XLAA 1WPKA 2BY3A 4B09A 1TL8A 2BHYA 4AM3A 3CC4I 4S04A 5HDGA 2VOOA 1T2KA 2B63J 3Q0VA 2HOSA 1WJAA 5C4JJ 3LSPA 1PUFA 2B1EA 2F5CA 1QBJA 1LJ9A 1JJ6C 1U6GA 2L01A 1OCOH 1VTNC 1FSHA 3H92A 2JT1A 5DCFA 3ZMSA 5GAGJ 5LRRA 4BJ5C 1FY7A 4F92B 2LLKA 2LK2A 2BW3A 2MC4A 1D0XA 2ZXWH 4FCYA 3AQSA 5FHPA 3ZGKA 1NK3P 1D1AA 2IA2A 4O6JA 5FKNA 3JAMK 1LE8B 2BYVE 2PX9A 4OOIA 2LSOA 2HQAA 3ERED 4HV5A 3TP3A 2Y0SA 4U7DA 4BGDA 3C7JA 5E3MA 4HX8A 2LH9A 4PJNA 2QBYB 2K9NA 4ACIA 1QVUA 2A6TA 4XR6A 5IYCJ 1EV7A 3WODF 3K4CA 5FLVA 4PSWA 1WRJA 4GYGA 1G3YA 3QYBA 3CUOA 3L2WA 4DBRA 5CYVA 5M5WJ 1P92A 3LSRA 2P81A 1SD6A 1YI2I 4BE1A 3BZKA 1SAUA 3TL4X 3AG3H 3R60A 1OLTA 3ERMA 3ZQFA 3ZRGA 2K27A 4MFEA 2DI3A 3BG7A 4HDVA 4B3XA 2PFVA 3DLLF 2O8XA 2JRMA 4OWRB 3JRHA 2OA4A 3TGNA 5F0CA 1UI6A 2ZFUA 5K7FA 4AUXA 1ETXA 2DA3A 3QPSA 4QLCU 3S15J 1HKSA 1YE9A 4BEHA 3FKJA 4A3IJ 3OYLA 3U1KA 2RQQA 4RB0A 4TV7A 2LP0A 4R79A 2HZTA 5F64A 1MMNA 2NOJB 5CQGA 1OMIA 3N4MA 1B72A 3P5JA 4GGGA 2LTPA 4RGSA 2JTVA 1WI9A 2VT3A 4JX6A 3HHGA 4M73A 1IAWA 2ZCNA 4UUSB 1W5CC 1XD7A 2NS7A 2D5VA 3RKXA 1F9NA 2L4AA 4BJTA 2ZMEA 3CQZJ 3NWSA 1ODDA 3ECHA 4MIMA 4B3AA 5EEAA 2HKXA 4UB6C 2JWTA 2X1DA 2ISYA 2PEXA 3GFIA 4OIOF 3WU2C 3IP4B 2YR2A 5FKMA 1UJ8A 4QPOA 4DBQA 1I1SA 4BBSJ 2V57A 1HKQA 5K7HA 1OCCH 2QUFA 2HU9A 3VOKA 2GQQA 1WH5A 3DPUA 5JI6A 2IU5A 5H20A 4Q47A 2E1OA 3HKZN 3R6SA 1OISA 2WV0A 5LRSA 1Q1HA 2DQLA 2LMDA 2VJJA 3GZIA 2ME6A 2XRNA 5JLWA 2DA4A 3PO2J 3G6EI 1IXCA 1Y6IA 1IV6A 1R7JA 1V3FA 1P4AA 2YPRA 2GZWA 3S16J 3FXRA 4BU2A 4M3GA 3OYMA 2MABA 4LITA 3MZHA 3OS1A 4KT6A 1TW2A 5BQTA 3QU6A 4HF0A 2L3DA 3PNYA 4Y4RA 3QOPA 2WY8Q 3IWFA 1P4XA 3MN2A 3HKZA 1SFUA 4HKUA 3IAM2 4ZZLA 2M4GA 3CC2I 3NQOA 1VQPI 1ZELA 5BOXA 1LKXA 3PNTA 5ERIA 1U5TA 2BBYA 1XDUA 4KIFA 2CUFA 1I6HJ 4P9UA 5BMZA 1YLFA 3FDYA 4MHGA 2XGXA 2ZSHB 4I98B 3V8KA 3K4NA 3C2GA 3OYHA 4E70A 1RUOA 5CKTA 2LBFA 5FKLA 4LK0F 3CJRB 2F6CA 4KMFA 4U0WA 5GTIC 3E6MA 2H27A 4XLHA 4JYKA 5LEJA 4XORA 3JTGA 4WIBA 5IP6A 3CCUI 3LSIA 1TZLA 3NARA 3RDIA 3TO6A 2HGCA 4ANJA 2GAUA 2DA5A 3CLOA 3FZVA 2K4JA 2KJCA 2EA4A 2ELJA 3ZMVA 2KRHA 3H36A 3H5RA 2QF7A 3HB9A 1T0FC 4A6DA 3QQAA 2W4SA 2A5WA 2KIFA 4QPQA 1HW1A 1LDJA 3ZOBA 3KYLA 2BOLA 5AQCA 1JGSA 5DCMA 1MH4A 1DPRA 5TRDA 1ETOA 3L9FA 1W36D 2TCTA 4K2EA 2QWWA 3G3ZA 3VTIA 2XAUA 3GTLJ 3S1MJ 1R4MB 3HJEA 2REKA 3BJBA 3DTKA 3CC7I 2HNHA 4MLOA 5EJCA 5C3EJ 1PDNC 2E19A 2XGDA 3NXCA 1IZ1A 2P0WA 2L02A 4B48A 4WXCA 1Z7LA 1FTTA 3SZTA 4P1WA 5E8IA 4XM3A 1H88C 2EWNA 1MH3A 4RGRA 2LYCA 1SD5A 4RB2C 4EJWA 3D5SC 1XCBA 4EMSA 3VW2A 1HQCA 1I39A 2EIKH 2DMUA 5DUIA 2ZFWA 3LSHA 2Y0MA 3ABTA 2F4IA 1I27A 2XAGA 1BA5A 2Q2EA 2IT0A 4W97A 3OYKA 2MH9A 4GCTA 4OAYA 1P7JA 3TBIA 3FXOA 3V6GA 4IOAF 3TOBA 4LFUA 4ZTFA 1ON1A 3B81A 4Y17A 3G1LA 4MXMA 1WSUA 3OIOA 3R61A 2HTSA 2QVOA 1TTYA 5HDKA 1FEXA 1XGNA 5EGOB 5D1RA 1R1TA 2YSRA 1JHHA 1YW8A 3ABKH 3KIOA 2IS2A 3TDZC 4G12A 2KRFA 3ELKA 2W84A 4AIJA 2ZB9A 4HNTA 1ZARA 1U3EM 1X3UA 2PMZA 2PJPA 3F1BA 3SXYA 1FIPA 2R5ZB 2DLLA 1A6QA 4M74A 3GTJJ 2L54A 2ZNZA 4EM0B 2HDWA 1QQIA 3K1MA 4P55A 3CF2A 1U0JA 3BR2A 2E1MB 5LHHA 3OYEA 1S8NA 3GO5A 1G3TA 1SVOA 3MAJA 2WB1A 2ZCXA 2R5YB 4IHWA 5D5UB 4Z6YA 2GUHA 3M1EA 1LFBA 2P4WA 2DK8A 5DTDA 3GLLA 3J7ZI 3VOXA 4AWXB 4GFKA 1SFEA 4L5JA 2FD5A 2AO9A 5HSZA 1RKTA 2A05A 2ZSIB 2F2EA 3K6GA 1ITYA 2KZVA 5FD5A 4IHVA 2LR8A 5TISC 1WJDA 1WWXA 4CCMA 1Z6RA 1BC7C 4FETA 4BEHB 4KITB 5M5XJ 3J7YJ 1I1GA 3IH3A 1IW7F 3I5UA 1MBEA 3JCUC 5E79C 3CMAI 2Y31A 3CCYA 1XGMA 3EDPA 2EV6A 5GPAA 2XPVA 3DPJA 3F8MA 4I7HA 3B73A 5J8CA 3ZPLA 4I2OA 4F93B 1SFKA 3ZQHA 1VQLI 2VASA 2ZJPF 1V54H 4Q5SF 4M71A 2OCCH 2DMTA 2NYXA 3HIFA 1FOKA 2Y30A 2ECBA 4D5CA 2OV7A 5B3SH 2OZ6A 4F3QA 5K58A 4FE4A 2H8WA 4G94A 1ZG3A 3GFMA 4YFNF 1K6YA 3Q5FA 3ZQGA 5DDGA 1IRXA 3GUDA 3CP8A 3A4CA 3DEEA 2XB5A 1H89C 5D6FA 3LAPA 1B8IA 2IRFG 4DW6A 5J1YA 1HSTA 1Y1WJ 3LSMA 2X4HA 4NB5A 4YIRX 1QPIA 1MBJA 5J4YA 4NHJA 4UUVA 1W7PB 4IHYA 5ICEA 5A2QZ 1XGSA 2QCOA 4DZPA 2HXOA 3BROA 3LA2A 1VQ5I 4M6YA 3K69A 2KIMA 2IS6A 4OD5A 2Q0OA 4M6VA 1ZR4A 1TWHJ 1XTAA 2FEZA 1IRZA 2RASA 2ZXIA 4XRMA 2XDNA 4X6AJ 1Z6TA 3TEDA 1WZ2A 2IS4A 5HODA 3I71A 1YFHA 1R4NB 3WTXC 4ON0A 1ZKGA 3L2VA 4RLFA 2G3BA 2Z3YA 4II3A 3BJAA 4MO7A 3RPQA 3VSLA 4EATA 3FM5A 3F3XA 1V5FA 3L2RA 5JHFA 1X1BA 1Q1VA 4RM3A 1YIOA 3VSKA 4L9VA 1IN6A 2W24A 3MMYB 1NG6A 2DT6A 1QVTA 2LDUA 5F04A 4AC0A 3FMRA 3GWZA 1HA8A 3BTIA 2HKOA 2DK5A 3KEQA 1S9HA 2GXBA 3OOPA 2BY0A 4P9FA 2JA5J 4BYYA 3BG9A 3F8CA 4N4NB 5BPIA 4LD5A 2CV1A 1Z05A 2K9SA 2A07F 3P9CA 4ENNA 3HEFA 1KQ8A 2CH0A 4Q4ZF 3KP3A 2WGBA 3BT9A 2VQGA 1Z67A 4O3MA 3OOUA 1JKRC 4CDGA 2RC4A 2JPBA 2HQNA 4HQMA 4WXDA 2LFBA 2MD5A 1JUMA 1OCPA 3LAJA 5HVQC 1VQ9I 4XBFA 2LBFB 2QM3A 4RGUA 2V26A 3JRAA 1GXPA 1N78A 2MLGA 4HEA2 4PSXA 1FYMA 5FROA 3H0DA 2DOEA 5KAFC 2K9MA 1B9MA 2EBIA 2MG4A 3VWBA 3CMYA 2P6TA 3P9TA 2EFNA 3A0BC 3W3CA 2H6CA 1QU3A 1DU0A 1TW3A 3HTJA 3ON2A 3BCBA 4KIBA 2L4MA 1TQPA 1WJCA 5J6XA 4HW0A 3SJMA 3LOCA 2HOTA 1TWCJ 1W5TA 2NVYJ 3HYIA 3QYFA 2M0MA 4E4HA 4HV6A 1LPQA 2JPCA 2R92J 5F1JA 5LFAA 2VC1A 2LC2A 2V9KA 3AG1H 5IYBJ 4IHTA 4JX4A 5CLSA 1VFCA 3HOWJ 4A5MA 2XGEA 4GXOA 3HPGA 5E20A 3M07A 4RB3C 3COLA 3SWHA 4XLCA 3EPZA 4I6ZA 1KU9A 1WJBA 5CVIA 4LB6B 2JK3A 1MGTA 4DYCA 1YJWI 2XV4S 2M8EA 4UV8A 5FRNA 3HRTA 2AQEA 2GOXB 1JT6A 2X0LA 2ZXJA 1ZH5A 1BC8C 4U9LA 1L0OC 2V79A 4E7KA 1SGMA 3EUPA 1VQ4I 2MA3A 3BR6A 5FB2A 2UXNA 3CJDA 4BS9A 4LIVA 4WF2A 2X6XA 3G1OA 1IN4A 1S7EA 4JX5A 3J81K 1FLIA 2RVCA 5KHDA 2YX4A 4IQJA 2DFHA 2Z1DA 5EDNA 3GTOJ 1FP2A 2ZJQF 3S2HJ 2HQRA 5LEKA 1S6LA 2K7LA 4KMUX 3SYTA 3UR3C 1OKRA 3S2DJ 1LEAA 3I4PA 2HYGD 3KYCB 2E2IJ 1MBGA 1DUXC 2UZKA 2QQBA 2JSCA 1P4WA 3EQLF 3GVAA 3HGYA 3H9GA 3BWGA 4UVBA 4M3FA 1QNTA 2R5YA 4H4KC 3C1DA 1ORKA 1GXQA 1AWCA 1E3HA 1D1BA 2LVSA 4NBQA 1GHCA 1FX7A 3QBMA 1K78B 1K4TA 2WBMA 1K6OA 4OIPF 2FNAA 3S5RA 3JAMZ 1FTZA 1HBXG 1OYIA 4DIQA 1MBHA 2A2FX 4YIIA 4LLLA 2MD0A 1WVRA 2KISA 4CHUA 1ETVA 3OWTA 3GBGA 2VXDA 3WGGA 3GTGJ 1CGPA 1QHHD 1SFXA 2M4KA 4BJ6C 2EFPA 4BY7J 5DD4A 3JR9A 4YFXF 4AYBN 2H94A 3BC8A 4RM2A 4ITVA 2R0QC 2JA8J 2VC0A 4DZJA 2R7FA 3IV5A 2FA5A 3MKLA 2WAEA 4O5VA 2CS3A 2QQ9A 2QIBA 4FASD 3CUQC 3TP0A 2QKLB 3F21A 1YHQI 2ICWG 3K2ZA 1KZHA 3O3KA 1UFMA 2CMPA 2YVHA 3QAHA 4CGRA 2BZTA 3TMOA 1J09A 1BR4A 4A0XA 3WTVC 3RYPA 4XLFA 2X6WA 2XSDC 4GO1A 4ASNA 3S3OA 4FT8A 1PYVA 3I9V2 3VUQA 2FBKA 5J8FA 5CJ9A 3F72A 3CO6C 1MBKA 3KZIC 4EQQA 3VFZA 2ISZA 4RAFA 1LVAA 3ABMH 3ANGA 3RZDJ 3KFWX 2RV8A 4U9NA 2G7HA 3FMQA 1UCRA 4KIGA 2TDXA 3RH2A 3BTJA 4DQ2A 4HDUA 2M7BA 1P7IA 5LGTA 1T38A 3A2KA 1XSXA 1NG7A 1XB4A 2FQ4A 5L3GA 3FXQA 3PFIA 1W36C 5E3NA 3G73A 4KFCA 2LY1A 3HHHA 1QZEA 2ZCWA 1ZQ3P 2CUZA 2IVMA 1OQYA 3BQYA 2L5QA 3KZYA 2VONA 1DGWY 1ZHFA 3OR2C 2JJ7A 1WQ2A 4KT5C 3FBNB 2LD5A 3VVXA 3OR1C 4UUTA 3OIQA 1BOBA 2LY2A 1P9QC 1V4RA 3N97A 4RA2A 2HVRA 1BN5A 2O3FA 2DMNA 1CF7A 2CW0F 3X2QH 2XIGA 2DTRA 2O5RA 3M1CA 3B6AA 1USTA 2GA2A 2W57A 3RQ4A 3V4GA 2QEXI 1DQUA 1GVJA 2CW7A 3PSFA 2VLAA 4E7IA 2VKHA 1QA6A 4UNOA 1IDZA 5K1YA 1Z91A 2XPUA 1EH8A 1KQ0A 4BQNA 3WGHA 1K4SA 1LB2A 2W53A 2RAEA 1ZTRA 3EYYA 4L18B 5B1AH 1JKQC 1D5YA 2DPDA 3ASOH 4NUBA 3PJRA 4KN4X 4CA0A 1MDMA 1JI8A 4N9HA 3AG4H 2GIVA 3JREA 3PO3J 2XKOA 4A93J 1R58A 3DFGA 3PNVA 2QBYA 1A5JA 2OJED 5LHGA 3BPVA 3COAC 1DDNA 2FXAA 2Y9YA 3QP5A 4LK1F 1R49A 3W2AA 2F07A 3CCSI 1LDKB 3JTHA 4L62A 2QKMB 2I5UA 3JSPA 1DP3A 5D5XB 1YITI 4PZJA 4WWCA 3IHUA 1ON2A 2KRCA 4ICHA 5J47A 1XDSA 5JLXA 5GPCA 2FOWA 1F36A 1T98A 3LQQA 1HSJA 1S7OA 3FXKA 5FGMA 2O7TA 3I64A 2G7LA 4D0PA 1UAAA 3OIPA 2XAJA 2GFNA 3KCCA 2RDPA 1OR7C 4XOPA 2P5VA 2EQRA 3K2AA 1IN8A 3V8LA 1RUNA 5IY5H 2ZOYA 1ZGJA 3HRSA 4IXAA 1XPXA 3K1PA 3IAS2 1F4KA 1GDTA 3I4MJ 2GIZA 1U5TC 4ZJZA 1I3QJ 1YTYA 3CUQA 1OCRH 3QU3A 4DJAA 4XLEA 1EH6A 4HYEA 4XNFA 5CXIA 2K4BA 3G71I 1ZYRF 2FBQA 2OBPA 3HC7A 3JW4A 5C4YA 5IP9J 5LD2C 2E1MC 4KYWA 3GFJA 4YG2F 2ELKA 4YFKF 3KP6A 1AHDP 2OZUA 3H5NA 4WCGA 1YRNB 1ETWA 2HQ5A 3F6VA 1H9TA 4PJMA 2GWRA 2ID3A 1HXDA 1X4OA 1J2XA 3D0SA 4FISA 3E97A 4QIWN 2BXYA 3FK7A 1N25A 2OC6A 4PK4A 2D2WA 3S1QJ 2XROA 4RBOA 1FOXA 2L9VA 3DCFA 2ZOZA 3BQZA 1W7PA 2M1BA 1SFOJ 2DG8A 1EJ9A 3LSTA 2VOPA 3CF5F 1AKHB 1AKHA 3PFYA 5FJ8J 4IRIA 1W5SA 4BY1J 1R1UA 3K4BA 2R7DA 1IF1A 1X58A 2DBBA 5FKKA 2P5LC 4RS8A 5HLGA 3OS2A 3D1NI 1FT9A 1D8KA 2ID6A 4A3KJ 2TRTA 1POGA 3MEXA 4QSHA 2E35A 2GENA 4CCNA 3FBIB 3HOYJ 2Z16A 3BOQA 2YX7A 2VE8A 3M4OJ 1BI3A 4A0ZA 1OFCX 1EF4A 2HDDA 2CGPA 4XN0A 3JSOA 3HOVJ 1QO0D 1R6RA 1ZRFA 2QGUA 3CO7C 1DPUA 5DEQA 2M0CA 2Q8KA 1LFUP 1YQAA 2UXHA 2P5KA 3GW2A 4AIKA 4IRVA 3L09A 1JKOC 4A5NA 3JRDA 2HOEA 1UG0A 2MFZA 4IJAA 4PUSA 2Z33A 2G0EA 3QWLA 2OQRA 3C18A 4WK8F 4BUPA 3P9KA 5J1UA 2L7KA 3BJOA 2DODA 3K9TA 5D5WB 1YO5C 4ABZA 3SQNA 2EV5A 4AF5A 1ERDA 1LQ1A 1VZ0A 4M9ZA 1X1CA 3S2WA 1KQ9A 5LHIA 4IO9F 4D5FA 2R7SA 1O3TA 4L0YB 3GLXA 4GFBA 2EK5A 1U9NA 3DP7A 3GMEA 3J80Z 2R7WA 2OD5A 4MNUA 3WHBA 3JRFA 2DMQA 1YX3A 5E8GA 2A68F 1UHSA 4BXUA 1IJWC 3RIRA 3T6NA 2GA1A 4ZYGA 4UHTA 2RNJA 3RQIA 2DTZA 6PAXA 4OIRF 1FJLA 1A04A 1OYWA 5BS6A 3BR5A 3S32A 1GLNA 3JRCA 1MD0A 2CSOA 2WAQN 2H1LA 2Q24A 2PQ8A 4II2A 3VYSB 3OL3A 1LE8A 1E0EA 4BXXJ 1J75A 2XASA 1YOVB 2KHMA 4B43A 4HX7A 1U8RA 1J7KA 4LOCA 4HZFA 4BQQA 1QZZA 4L5EA 1W7PD 5K5RA 4V19K 3H3VK 4JNNA 1X3ZB 3BPXA 5IT9K 2B7EA 3ZP5A 3G2BA 3AG2H 2FE3A 3FWEA 2XUBA 5E1WA 4IZZA 2CQNA 5H6RA 2KZGA 2LF8A 1TP4A 2AXTC 4PJ0C 4W1UA 5IYDJ 3ABUA 3CDIA 2Z2SB 4XICA 2OUMA 3HSEA 4IF4A 4OMYA 5KVRA 5HLHA 1R00A 1B72B 1BIAA 5HS7A 3H35A 4N0BA 5EG0A 1ZGWA 2BHZA 2K86A 3LFKA 3FK6A 4C3IJ 5L3EA 4BE0A 1G4DA 3HIMA 2EV0A 2AXLA 1DGRM 1SMTA 3OYFA 3M7GA 3CCJI 2BV6A 3KP5A 2IGNA 4G7HF 3A01A 2YVEA 2M45A 4A3EJ 3WTSC 1R5GA 3BTCA 4HA8A 2LKXA 3T8TA 2J5PA 1HDDC 3CCMI 2BVLA 1UZCA 2OI8A 3T8RA 3L1PA 5ILVA 4MFDA 1MJ9A 1TT0A 1T0FA 2NOGA 2X9DA 5F27A 4XRSG 4ZYHA 1C0WA 2HOAA 2KJBA 1YW9A 2E36A 2OQGA 4NDLA 2M5WA 5IP7J 3GCMA 1WFXA 4AIDA 1G8XA 3HUGB 1PUEE 2F5VA 5B66C 1RPWA 2CUJA 3RKWA 2QYOA 3SHFA 3A0HC 3KYDB 3U1DA 3SZGA 1TWFJ 3BZCA 3EUHC 3QODA 3HOUJ 2UV1A 4CCKA 2UXUA 2X1EA 1JKPC 4XLNF 4C3JJ 1O3RA 4ZTJA 3MQ0A 4IX7A 3F22A 3QRFF 3VW1A 2ZBKA 2HYFA 3T1BA 3ZN1A 2AHQA 3SFIA 2F48A 2Y9ZA 4JK1X 3Q0UA 3RCOA 4UDSA 2HEOA 3P9IA 1CQTA 2DU9A 2EH3A 3OYIA 4FTHA 3H0GJ 1K78A 5F0HA 3FIWA 3E3VA 3GZ5A 4KICA 2DXIA 1K7AA 4B1RA 1IG7A 2G7SA 1JTXA 3S1NJ 2W25A 4UV9A 4AVPA 2JRTA 1H0MA 3J7AY 1R22A 3NEUA 2IAIA 3ZMTA 1WKMA 3G4SI 1UB9A 2XVCA 3A03A 2KLOA 2IPQX 2Y75A 4JL3A 3VB2A 2AQFA 3L2UA 5CQEA 3Q9SA 4B44A 3LMMA 2VBXA 4PFPA 4C3HJ 1LVKA 3RPUD 5FO5A 2VUMJ 4HPQA 2R3SA 3SEQA 2NVTJ 3K70D 1RR8C 2ESNA 1PJRA 3VVZA 5IOZA 2BEOA 5H2FC 5HDNA 3W2VA 1KA8A 4ESFA 1B6AA 2HVSA 3TOAA 3DWLE 3K7AJ 4C2UA 1TWGJ 1Z21A 2EILH 3O8HA 3NRGA 2ZCMA 3KLOA 1STZA 1Y39A 4GCKA 4EGYA 5L3CA 1B4AA 2YU3A 1FBSA 3M9AA 1BW6A 2PI0A 2DOFA 1B9NA 3L2QA 1J59A 5B5EC 3E7LA 2UUZA 1F1ZA 3T0YA 3PIOF 4NNJA 1FOWA 2QENA 2DA6A 1Y0UA 1R9TJ 3A02A 4I09A 4MTEA 3IUVA 1ZRCA 1K83J 5DM6F 1PVEA 2DJIA 4XONA 3P7NA 3HOTA 1HCRA 3CDHA 3K70C 2EZHA 1GV2A 2QQAA 1NH3A 2UWMA 2NP5A 1MJBA 2FX0A 1R5HA 2VI6A 2VJ5A 3LHQA 2CJJA 2O03A 4ME9A 5HS9A 4HBLA 1RIOH 2KL4A 2M8GX 3I3LA 2EB7A 1F5TA 2STWA 2E60A 2M2EA 3K1NA 3K0LA 4RDUA 2WY7Q 4PCQA 5IOYA 2L9NA 4GDFA 1VNDA 1LUJB 2BY1A 3W6VA 3FX3A 1H8AC 5BPDA 4ZYDA 3GEZA 5D18A 1Y0NA 2IEKA 2K85A 1RI7A 5D8KB 3WTUC 3WHCA 3HPHA 2HTJA 4XOTA 1RKWA 4DVYP 3CDLA 2COMA 3OSFA 2FBIA 2L7MP 2XC7A 2KPMA 3BJ6A 1K79A 1IGNA 1HLVA 2LG4A 2VXZA 2XAHA 3N05A 4XSZF 3RI4A 4C2MA 4AYBA 2JQ7A 4RAZA 2EPFA 2XSJC 4M72A 1MJAA 3O60A 4FQGA 5EFYA 2CQKA 4BHPA 3REOA 5FFZA 4OD4A 2VQCA 2DDBA 3KPHA 1PUFB 1XMXA 3G1MA 3HOXJ 1HW5A 3ASNH 1Y8QB 2ADUA 1FWZA 4RLQA 1BW5A 2QWTA 4EJUA 3WTYC 3RZOJ 3DV8A 3S8PA 3BCAA 2VB6A 4KDPA 3QKXA 2CV0A 1U78A 1BJZA 1R36A 2JZYA 1APLC 5KCMA 3GX4X 4HG2A 1JGGA 1RC9A 1SMYF 3U9GA 3EUAA 2MGQA 3FMSA 3CCRI 1LNWA 3HOSA 3M8JA 1HF0A 5HAWA 2V9PA 3S3NA 2KP6A 2RN7A 2E5ZA 4HSTA 1S7AA 5D5VB 2HFHA 5J4VA 3QOEA 1WH7A 3K10A 3IRQA 1FMWA 1TNSA 2E7XA 3ZQIA 4HX4A 1VI0A 4PJJA 2K9LA 1VQMI 3M3YJ 3OSGA 4C2TA 4A12A 3VYRB 2HPIA 3ZXSA 1REPC 3CCLI 2FMLA 3MCZA 1J0RA 3WE3A 4QWQA 4IRGA 1SD7A 4EJVA 1NHAA 4EGZA 5K7ZA 1WJ5A 2IA1A 1BM9A 1MIJA 3QP6A 1G3WA 4P5OA 3WG7H 1GT0C 4I99C 2OAZA 5KNLA 2E1NA 5F0FA 3RKQA 3DTIA 5FLXK 2CFOA 4A3LJ 3CP2A 2FJ1A 2NVUB 1P2FA 3PASA 4DOZA 3LL7A 2P7CB 1WI3A 1HDPA 4JQFA 3VP5A 5LGNA 2JMWA 1HKTA 1AA7A 1QZYA 3GEUA 2MBFA 4AD9A 5K5OA 2Z5UA 4KWAA 4M9SA 4NELA 1ENHA 3ISPA 1ULYA 2CWEA 2GBYA 1YYVA 3K4JA 3D5RC 2K02A 4ETSA 1TQMA 3OYJA 2GM4A 2HKUA 1X3WB 4G9YA 3OV8A 2Z9OA 3W6JB 2RKHA 3NAUA 2QTQA 5TGTA 3GZNB 2VIXA 1KYZA 5J1RA 1ZG5A 1JUSA 1R71A 1KU7A 3RYRA 3JSJA 2VJIA 1G3SA 1SEUA 2QSGX 2ZC2A 3GTKJ 1MBFA 5LGUA 1S72I 2D1VA 4IQ4A 4BKXA 1JJ8C 4BDZA 1ZG1A 5H6QA 3TO7A 3HM5A 2M30A 3HG9A 3IKVA 5ICCA 2D6YA 5CXGA 5LLQA 3FRQA 1Y56A 3ROUA 1YIJI 1FYKA 4N4OB 3V7CA 1I50J 4PFOA 1IXRC 3LFUA 4IHXA 2LREA 1IRFA 2Y69H 3H5AA 4X0GA 1FIAA 1T56A 2CG4A 2O8KA 4CXFA 2I8DA 2XAFA 2DYSH 5ILSA 1Y1VJ 1UHMA 5HOOA 1XSDA 4V2FA 3HXLA 5L3DA 4L9JA 1B8IB 1HC8A 2QKOA 4XKBA 3KEOA 1ZGAA 4MEYF 4RMNA 3KE2A 4I0AA 3DU5A 1TC3C 3WE2A 1U9OA 4Y3OA 2DG7A 3HTAA 4OU0A 2ME0A 4KUMA 2FSWA 3U21A 4I02A 1YG2A 4UVAA 1BOAA 2JUGA 3DPLC 2HDCA 5E18F 2K9QA 2ZKZA 2M34A 3KKDA 4HRIA 3RJPA 4OINF 1OCTC 1IXSB 1RRJA 3RD3A 2VBYA 3ZQQA 1FPQA 4YIFA 1VQNI 4HF1A 4G6QA 5CVRA 3AL0C 3MNLA 1BR1A 1S5LC 3E1SA 2IJLA 4NC8A 4I01A 2O7OA 2XPWA 4LG0B 3DTEA 4Y13A 2NNNA 3ULQB 4EV0A 1YX5A 1I3AA 3RSNA 2QZ8A 2FRHA 1MNMC 2C6YA 2JA7J 2OU2A 5C44J 2YU9J 4G8XA 3C3WA 1O4XA 4QTRA 5GP9A 3DPTA 2DA7A 1YJNI 2OF7A 2PJRA 3W2WA 5EYRA 1UELB 4A6EA 2O6GE 4JOMA 3ON4A 3DKWA 2EJRA 4U7BA 1IN7A 2Z99A 1JE8A 2EFWA 4WX9A 4Y15A 4LG0A 3HE0A 1YW7A 2EZKA 2Q2EB 4M9XA 4HNUA 3IH4A 2A69F 4XKWA 4G6DA 4UB8C 2FBHA 5B1BH 2IP2A 2QA4I 1Z1DA 4ZDOA 1TT5B 4A3BJ 1G6NA 2GOMA 3ONQA 4BAYA 2CQQA 3IWZA 2EFQA 3E5QA 2KT0A 2HWVA 1IRGA 3R0JA 1TLHB 2ZJ2A 3FHZA 3CCVI 4L5IA 3BY6A 1N75A 4XN3A 2IGKA 2DQRA 2KDOA 2KFDA 5DUKA 1OJLA 1YRNA 1KGSA 1XMKA 2LF7A 4PGHA 2IGOA 4H0EA 4CYDA 3NNRA 5EEGA 2R7ZJ 3E6CC 4CCLA 1KONA 1JHFA 4ENJA 3HSRA 3ZQCA 3E5XA 5DCMB 4CZCA 1Z3XA 3CMEI 3G56A 3H3ZA 4XIDA 3FXUA 2KIQA 4J01A 1LDDA 3TW7A 1EKEA 3LNQA 4AIHA 4U0YA 4J19A 3JRBA 4IKFA 3HGGA 1YS7A 5DAJA 1SAXA 2WAQA 2JUCA 2W00A 1E3OC 5EZGA 1TWAJ 2P8TA 2G7GA 3KKCA 1U5TB 2VQLA 4LGWA 1EA3A 3MD2A 2CQXA 3R4KA 1SC7A 4HAMA 2XF5A 2Y48A 3E0JB 2W1OA 2WWYA 2W85A 2BXZA 4EVIA 4AC6A 2ZJRF 2XB0X 3O6BB 3IKTA 2OTJI 2RGVA 4KNYA 3L2CA 1ZR2A 1Z0XA 5DV5A 3V7RA 1XX5A 2ACJA 3HTIA 3E6BA 4LMYA 1PP7U 5E1XA 3LQRA 4A0YA 4D7MA 1YJ9I 3NPIA 1OCZH 2DMPA 3U2RA 3UKGA 4E7SA 2WB1N 1X19A 4F55A 3G7RA 2H6BA 4LG3A 4BBRJ 1ZN2A 2IXSA 3VYTB 3DEWA 2VKVA 1ACIA 1ETKA 2KKOA 2F5EA 2UXIA 2ESHA 2DAOA 3PM1A 2MC3A 2XRLA 2ZMEB 2ECCA 1XGOA 3TW6A 3KP7A 3CTAA 3LA3A 3FISA 4S0HB 4A3FJ 2CRGA 3GF2A 2PFBA 1CF7B 3HTHA 1MSEC 4CSWA 4LLGF 1SANA 2XHKA 1D1CA 5L3BA 3F23A 2L7FP 3GXOA 2FU4A 2NVXJ 4NC6A 1A6IA 3EGQA 1KU3A 4UVCA 3J80K 1ZLKA 2FUG2 4LB5A 4ZYAA 1RR7A 5FFXA 1MDMB 2V7FA 4CCOA 2CU7A 2PMUA 3B02A 2KIUA 1QPMA 4GRIA 3ZCOA 3BRUA 1A36A 3E6DA 3KNWA 1TQIA 4M6XA 3BG3A 1U2WA 4HSRA 5EZHA 1BL0A 1W4MA 2NXNB 3NWTA 1I6XA 4LJZF 3KETA 2JN6A 4HNVA 5FD6A 2ETHA 3CJNA 4CGZA 4PXIA 2V9VA 3VVYA 5J40A 1ONVA 3J7AO 2A61A 4F52A 5D19A 4KN7X 2A6HF 3HTSB 4CH7A 2JVHA 3CZ6A 2XF7A 4ZH4F 2FQ3A 2Y2ZA 5D6EA 1IUYA 1YS6A 3VIBA 4L9NA 2NP3A 2D45A 3Q9VA 5D8LB 3KZ9A 5JVGF 1D5VA 1X1AA 2ZY9A 1LFPA 3FM3A 3CMMA 2QQ8A 4NN1A 3H9QA 3I56I 4ENMA 3H3UA 3BP8A 1O7FA 3F8NA 3VOEA 5ED4A 4I76A 2DFIA 5CVUA 4BE2A 2HVQA 2F4MB 2ZMEC 1W0TA 2ELHA 4RB1A 2QSHX 2LKPA 1X4PA 3TKYA 1FZPB 2OERA 2YVXA 2K3PA 5GAHJ 2IS1A 3T5XA 2CQ7A 2HR3A 2CV2A 1UHWA 5JHUA 2DA2A 4CICA 1BI2A 2DW4A 1KYWA 4BH9A 4S05A 2PMZN 2BVMA 3FXLA 1JT0A 2O9LA 2LNBA 2QOPA 1R23A 4U87A 4BDYA 2VL8A 2EA2A 2L9SA 4CCJA 3BNIA 2RREA 2XF6A 5CVJA 2VODA 1FBUA 3V78A 2BW3B 1ETYA 1VQ6I 2RHAA 4LIUA 5F6FA 2PG4A 5H9TA 2RNGA 2DOAA 1OYYA 4DNCA 2EINH 1R1VA 2Y0SN 3LWFA 1VQ7I 2DFFA 1ZLJA 3FF5A 1IC8A 2ZO4A 3KZZA 3CJQB 2I10A 2W82A 3K4KA 3LSGA 5HNFA 4KISA 4WXHA 4UY8I 1XS9A 2H8RA 3MZYA 3F6OA 2E34A 5DYMA 3UNGC 4JBAA 5AIPA 5E3OA 3M8EA 2R7XA 4XKVA 1PP8F 3SDGA 1N77A 4EM1A 1E2XA 3OMYA 3IUOA 3OS0A 2GXAA 4N9IA 5L3FA 5F1RA 4XQFA 3QPLA 1XMAA 5JFRA 4G6TB 4NC7A 3BG6A 3PUBA 1FNNA 4C30A 4AVZA 4XRSA 2X6YA 2R93J 2PBIA 3MWMA 2LRDA 4BL0B 2B0LA 4IEJA 1HW2A 2CO5A 1JTYA 3MZ8A 4M3DA 5HLTA 1FOYA 1XG1A 2MSYA 4Y7NJ 1JXSA 2XKPA 1RESA 3ZQ7A 1GVDA 3H9JA 2AS5F 2G9WA 4B4CA 1FBQA 2EFOA 2V1NA 3GFLA 3J81Z 3WU0A 5GADJ 4E7JA 2EIJH 2XDVA 2XGCA 3S1RJ 2VBZA 4HOBA 3OY9A 1MW7A 1B59A 5M3MJ 3HDDA 4X1EA 2WADA 4MQ9F 1WJEA 4KJZA 4C9YA 2LY9A 5FGLA 1X2MA 3IL2A 2R7VA 2IGMA 2CW8A 3HRMA 3VYUB 1A35A 1JUPA 3QPTA 4YZEA 3ECOA 3ZMDA 3WTTC 2X6OA 3OYGA 4A3CJ 3AFHA 4A3JJ 2MW8A 1Z77A 1UI5A 5J3LA 2J5OA 1T39A 3EYIA 4MEXF 1TNTA 1MMGA 1OR7A 3VEPA 4MK6A 1SVMA 5ICGA 2M3AA 3LJLA 1V55H 2D1HA 1T33A 4IRHA 4XSXF 2V6EA 2FOKA 2BE5F 3W6KB 3Q0WA 3EUHA 1UMQA 4BQAA 2OCEA 4LLNA 1L3LA 3S93A 3OYDA 3MKZA 3H1CA 5CVVA 5KK1A 1XN7A 3I58A 3V8JA 4RGXA 2PBXA 4PGGA 1Y8RB 5C4XJ 1VQ8I 1T6SA 1SD4A 1UG2A 5AONA 3I54A 1O7LA 2XAQA 3CJTB 4XLPF 2VPLA 4A69C 2IW5A 4A3GJ 3E5UA 3HOZJ 2CUEA 1TBXA 4UXNA 4FE7A 2HI3A 5IT3A 1LEBA 3DBLB 3V42A 2M87A 5LBQA 2NS8A 4ZDPA 3KLNA 2A3SA 3HRUA 3BDDA 2VKDA 5M5YJ 1VQOI 2DPUA 2VBWA 2X85A 1I5ZA 2NNYA 4ZYEA 3CWRA 4R1HA 2NVQJ 1FSEA 4BNCA 3TQNA 3L7WA 1FYLA 4DYRA 2O61A 1D3YA 4Y52J 1G2HA 1H9GA 1FP1D 4XKCA 3I59B 2QLZA 3KEYA 3PL8A 2FNPA 3HBLA 4B47A 2V4JC 3AQTA 4MQVA 1SVLA 2FJI1 4FX0A 2PZ9A 5FRMA 2L7ZA 5FMPA 9ANTA 3KX2A 3S17J 4BXFA 2PMHA 3PSIA 4AU7A 4YELA 3RKYA 5DS9A 3CD6I 3EUKL 2W48A 1IO2A 2DJNA 3A01B 3GYHX 2HYJA 2VT2A 1XCVA 4EEFG 1ZAOA 3WTWC 4MGRA 3LWJA 3ZMUA 4CZZA 3PQJA 1K61A 5E1ZB 1BR2A 4GCVA 2MYSA 4ZDLA 4EM2A 1W0UA 3DQVC 3WGIA 2DYRH 2IA0A 1X2NA 3QYEA 3FXMA 2WA0A 1Z3YA 2DDAA 1IN5A 4XL9A 4CYCB 5CPRB 2H1KA 3I55I 4IVNA 3KP4A 4GFLA 4Y33A 3SDBA 2K40A 3HUGA 1MNDA 5ILUA 2V1DA 4V2GA 2R5ZA 4ZZDA 1NK2P 4IHSA 3JRGA 4P96A 3FXJA 2QSFX 4IL6C 1HOMA 4E6KG 1R5ID 2VJ4A 5HNHA 3QPHA 3MKWB 4OAZA 5K5QA 4XK4A 1E3PA 3VPRA 2M7AA 4XRFA 3DU6A 2CFXA 1D0ZA 3EETA 4HF2A 4GYIA 3NI7A 3ZN0A 4A3DJ 3NS4A 4GCLA 4IPAA 3ML6A 3F8BA 1M1EB 1XSVA 2N8GA 1P6RA 1S3JA 4D1QA 4J00A 4U0VA 2VQHA 2JVGA 4ESJA 3VODA 3WTZA 4OIQF 4DYQA 3GTQJ 1J9IA 1E17A 2X1CA 2E71A 5FLXZ 5GAEJ 2F5DA 2NAZA 2L0KA 2R7OA 1DP7P 1OPCA 3GTMJ 1MMSA 4F7ZA 1AOYA 5EEHA 1IUFA 3BLYA 1V5EA 3WG9A 3PIPF 3I4NJ 3F9KA 3S14J 1B1BA 5FKOA 1RETA 2H09A 3C2HA 4JKZA 2MH2A 1T08B 2R7UA 5ICFA 5BNGA 1IDYA 3MKYB 1MNEA 5D4RA 2R7TA 3LSJA 2Q1ZB 2FMYA 3D5LA 2DA1A 5TJJA 1BJAA 3MFKA 3CESA 2R4GA 4M3EA 3I0TA 1O3QA 5HS8A 5CW8A 3ABLH 1RZ4A 2YUSA 3VDXA 3HL2A 3S3MA 2E2HJ 3OYCA 1EH7A 1GUUA 1KU2A 4Z2YA 2F4OB 3CCQI 5EF6A 4FX4A 2K3FA 5A2QK 1U8BA 2WUIA 4CUGA 2DT5A 2IBDA 4BHBA 3F8FA 2V6CA 3BZ6A 5EGOA 2E5NA 3NRVA 3IH2A 5GTHC 4HQEA 2M9HA 3CUQB 4NQWB 4I0BA 4CYCA 3V7SA 3SFZA 3ZMZA 4B8XA 2VPRA 2NS0A 2OTLI 3GZ6A 2PN6A 4BACA 4ENKA 3AKZA 2V1XA 5DM7F 1V5GA 5HLIA 2JA2A 2WC2A 5D4SA 3DBHB 4F91B 4R8HA 5IPAA 3VW0A 3PQKA 1J5YA 3HTUA 4RAYA 3BCGA 3DEUA 4EJTA 3BHQA 2A5YB 3LSKA 1D8JA 4JP0A 3OL4A 2DT7B 1Z7UA 2WTEA 4RAGA 3A1YA 4L9TA 4ESBA 2KDZA 2JSPA 1BBYA 2PJRB 1IV8A 4G7OF 2HS5A 3O2PE 4D7NA 2E1CA 1MKMA 3AAFA 2GLOA 2NRAC 4YRVA 4BQOA 2PLYA 2O0YA 3RPUA 4A2UA 2B9SA 2A6EF 4ZC3A 4D9JA 3IC7A 1X1DA 1GV5A 3BR1A 3OYNA 5IT9Z 1AU7A 2YS9A 1T95A 1FMVA 2R7QA
chains in the Genus database with same CATH topology
2DMQA 2UXOA 1UHSA 1IJWC 2DMTA 3T6NA 4UUSA 3TW7A 2Y30A 2ECBA 3LNQA 3RQIA 4D5CA 4J19A 2DTZA 3JRBA 1FJLA 3HGGA 5DAJA 5K58A 4FE4A 2HYTA 3BR5A 1E3OC 3JRCA 5EZGA 5FLMJ 3ZQGA 1TWAJ 2G7GA 3KKCA 1B8IA 2WAQN 1H89C 2XB5A 2Q24A 2OPTA 2CQXA 4DW6A 1LE8A 5J1YA 1Y1WJ 4BXXJ 1QPIA 4AC6A 1MBJA 2EZLA 4LOCA 4IHYA 2XB0X 4L5EA 2JA6J 3H3VK 1F43A 1WGXA 2HXIA 4JNNA 1ZR2A 1Z0XA 3BTLA 2QCOA 4DZPA 2HXOA 1ZK8A 3HTIA 4D7MA 3NPIA 4C2MJ 4A3MJ 3JRIA 4M6VA 2DMPA 3E7QA 3CRJA 3UKGA 1TWHJ 3MVPA 3F0CA 1ZR4A 1IRZA 2RASA 1VF9A 4XRMA 2XDNA 4X6AJ 3ANPA 4W1UA 1QRYA 2WB1N 3TEDA 3C07A 5IYDJ 3G7RA 5HODA 1ETQA 4XICA 5HBUA 4BBRJ 1ZKGA 1B72B 3DEWA 3GTPJ 5F08A 2VKVA 2VKEA 1ETKA 4MO7A 5EG0A 1ZGWA 1XC5A 2G3BA 3FK6A 4C3IJ 2UXIA 3HIMA 3PM1A 2XRLA 2ECCA 1DU6A 1NTCA 3TW6A 1Q1VA 3ZQLA 3C2BA 3FISA 4S0HB 2CRGA 3A01A 4A3FJ 1WCMJ 5F04A 2WV1A 1QVTA 4AC0A 4A3EJ 3HTHA 1MSEC 2X48A 3BR3A 3BTIA 3BTCA 1SANA 2LKXA 3Q3SA 1HDDC 2COBA 2L7FP 2OI8A 2JA5J 2L9RA 2NVXJ 3L1PA 3PPBA 4MFDA 1A6IA 2NOGA 3EGQA 5F27A 2X9DA 4XRSG 2EZIA 3BG9A 2HOAA 1RR7A 3FKIJ 4NDLA 5IP7J 3BR0A 2CU7A 2K9SA 5E3LA 1RPWA 3HEFA 3BRUA 2WGBA 3KNWA 2DN0A 1MSFC 3BT9A 3BG3A 3BG5A 1TWFJ 5EZHA 4M3BA 1BL0A 3OOUA 1JKRC 2E2JJ 3HOUJ 2UXUA 2NX4A 5M3FJ 2JN6A 2LFBA 4HNVA 3B6CA 1JUMA 1OCPA 3O8GA 1JKPC 4PXIA 3VVYA 4C3JJ 5EG0B 2UXPA 3VW1A 1WPKA 3JRAA 5D19A 2AHQA 3SFIA 2Y9ZA 3Q0UA 4UDSA 2B63J 2Y2ZA 1CQTA 3Q0VA 2HOSA 2EH3A 5C4JJ 3LSPA 1PUFA 3VIBA 4FTHA 3H0GJ 1JJ6C 2NP3A 5F0HA 3FIWA 3KZ9A 2EBIA 2MG4A 2G7SA 4B1RA 1IG7A 3CMYA 1JTXA 3P9TA 3S1NJ 4NN1A 2LLKA 2LK2A 1DU0A 4I76A 4FCYA 2IAIA 3AQSA 3HTJA 1W0TA 1NK3P 5FHPA 3ON2A 5FKNA 1LE8B 2OERA 3A03A 3TP3A 3JRFA 3SJMA 5E3MA 3LOCA 4JL3A 2HOTA 1TWCJ 2DA2A 2K9NA 2NVYJ 4ACIA 1QVUA 4C3HJ 2VUMJ 2R92J 2PMZN 2NVTJ 5IYCJ 5F1JA 1JT0A 2O9LA 5FLVA 2QOPA 3VVZA 5IYBJ 4JX4A 5IOZA 1VFCA 3HOWJ 3BNIA 2XGEA 5M5WJ 3V78A 1ETYA 3LSRA 2RHAA 3COLA 3K7AJ 2P81A 1TWGJ 3O8HA 4I6ZA 3NRGA 2ZCMA 5H9TA 2JK3A 4GCKA 3ZQFA 4DYCA 1BW6A 2Y0SN 4MFEA 1JT6A 1IC8A 1SGMA 2I10A 3E7LA 3LSGA 3JRHA 3EUPA 5F0CA 1UI6A 1XS9A 3BR6A 5K7FA 2H8RA 4AUXA 1ETXA 2DA6A 2DA3A 3QPSA 1R9TJ 3S15J 3A02A 3CJDA 3G1OA 1S7EA 3IUVA 4JX5A 4A3IJ 1K83J 5E3OA 2LP0A 5EDNA 3GTOJ 1HCRA 3SDGA 2EZHA 3S2HJ 1GV2A 2NP5A 1B72A 2FX0A 2LTPA 2VI6A 3LHQA 3S2DJ 2CJJA 4JX6A 3QPLA 2ZCNA 2E2IJ 1MBGA 4UUSB 4ME9A 2NS7A 2D5VA 2M8GX 4XRSA 2R93J 2M2EA 4RDUA 3HGYA 3CQZJ 4B3AA 4MIMA 5IOYA 5EEAA 4IEJA 1VNDA 4M3FA 2JWTA 1JTYA 2R5YA 4M3DA 3W6VA 1H8AC 1ORKA 1XG1A 2MSYA 2LVSA 5D18A 5FKMA 2IEKA 4Y7NJ 3QBMA 3WHCA 1RESA 1RKWA 3CDLA 1GVDA 3S5RA 3OSFA 2L7MP 4B4CA 4BBSJ 1FTZA 1IGNA 1HLVA 2V57A 1MBHA 5K7HA 2XGCA 3S1RJ 3VOKA 3HDDA 5EFYA 1WH5A 5M3MJ 2IU5A 3O60A 1ETVA 3GBGA 4X1EA 3GTGJ 2E1OA 3HKZN 4BY7J 2LY9A 3JR9A 5FGLA 1X2MA 4AYBN 3GZIA 1PUFB 2ME6A 3G1MA 3HOXJ 2R0QC 2JA8J 4DZJA 5JLWA 1JUPA 2DA4A 3PO2J 3IV5A 4YZEA 2X6OA 3MKLA 2QWTA 1BW5A 4A3CJ 4A3JJ 1IV6A 2MW8A 2QIBA 1Z77A 1UI5A 5J3LA 3TP0A 3RZOJ 3S16J 4MK6A 2YVHA 4CGRA 3LJLA 3QKXA 4M3GA 1T33A 1U78A 1BJZA 2XSDC 3Q0WA 1UMQA 1APLC 3VUQA 1JGGA 1MBKA 2MGQA 3ANGA 3RZDJ 3MN2A 1HF0A 5HAWA 2PBXA 4HKUA 5C4XJ 1UG2A 3RH2A 3BTJA 1WH7A 1P7IA 4A69C 3ZQIA 4A3GJ 2FQ4A 3HOZJ 1VI0A 3M3YJ 2CUEA 2CUFA 4FE7A 3OSGA 5E3NA 1I6HJ 2HI3A 2NS8A 1ZQ3P 3BQYA 5K7ZA 5M5YJ 5FKLA 2JJ7A 3CWRA 2LD5A 1GT0C 3VVXA 2NVQJ 4UUTA 5F0FA 3RKQA 2DMNA 4DYRA 4Y52J 1G2HA 4JYKA 4A3LJ 2FJ1A 3B6AA 5IP6A 3PASA 3NARA 1WI3A 1IDZA 1HDPA 3VP5A 2JMWA 2XPUA 2DA5A 3HBLA 2W53A 3GEUA 3AQTA 4KWAA 2PZ9A 2L7ZA 4NELA 1ENHA 5FMPA 9ANTA 2RAEA 1ZTRA 3S17J 2QF7A 3HB9A 1JKQC 1D5YA 3QQAA 5DS9A 2GBYA 2W48A 3JREA 3PO3J 2DJNA 3A01B 2HYJA 4A93J 2HKUA 3ZOBA 2GM4A 5AQCA 1A5JA 1MH4A 4EEFG 3NAUA 2QTQA 1ETOA 3LWJA 2Y9YA 2TCTA 5J1RA 1K61A 1JUSA 2F07A 3GTLJ 3S1MJ 3JSJA 4L62A 1W0UA 3GTKJ 2REKA 1MBFA 3BJBA 1X2NA 4CYCB 2H1KA 4MLOA 4BKXA 5C3EJ 1JJ8C 4GFLA 2E19A 2XGDA 2K40A 3HM5A 3NXCA 4ICHA 4V2GA 2D6YA 5JLXA 5GPCA 2R5ZA 1F36A 1FTTA 1NK2P 3FRQA 5CXGA 2O7TA 3JRGA 1H88C 1HOMA 1MH3A 1I50J 2G7LA 4IHXA 3VW2A 4XK4A 1FIAA 3VPRA 2GFNA 1T56A 2O8KA 2EQRA 2DMUA 3K2AA 3NI7A 4A3DJ 1Y1VJ 2ZOYA 4GCLA 4V2FA 3I4MJ 1GDTA 1B8IB 1I3QJ 1BA5A 2QKOA 4W97A 2N8GA 4GCTA 1P7JA 1TC3C 5CXIA 1U9OA 2DG7A 2FBQA 3HTAA 3V6GA 4DYQA 5C4YA 3GTQJ 2ME0A 3B81A 5IP9J 3G1LA 4MXMA 2K9QA 2ELKA 2L0KA 2M34A 3OIOA 1AHDP 3KKDA 3GTMJ 1OCTC 1YRNB 1FEXA 3RD3A 1ETWA 2HQ5A 5EGOB 1IUFA 5D1RA 2ID3A 4FISA 3I4NJ 4QIWN 3S14J 3MNLA 5FKOA 1RETA 3FK7A 4JKZA 3S1QJ 4G12A 4RBOA 3DCFA 5BNGA 1IDYA 2ZB9A 2ZOZA 3BQZA 3LSJA 2YVEA 1SFOJ 2O7OA 2XPWA 2DG8A 3F1BA 1FIPA 2R5ZB 2DA1A 3GTJJ 1AKHA 1AKHB 2JA7J 1MNMC 5FJ8J 5CW8A 4M3EA 5C44J 4BY1J 2YU9J 1X58A 1O4XA 2YUSA 4QTRA 5FKKA 5GP9A 2E2HJ 2DA7A 3BR2A 1GUUA 2OF7A 5EYRA 5EF6A 3D1NI 2ZCXA 2ID6A 1U8BA 2R5YB 4IHWA 4A3KJ 2IBDA 2TRTA 5EGOA 2WUIA 3ON4A 2GUHA 1POGA 1LFBA 5DTDA 3IH2A 2M9HA 3HE0A 3VOXA 2EZKA 4QSHA 3IH4A 4GFKA 4CYCA 2GENA 2FD5A 3HOYJ 2AO9A 2VPRA 5HSZA 1RKTA 3M4OJ 1EF4A 1OFCX 2HDDA 4A3BJ 3HOVJ 2CQQA 1ITYA 3VW0A 5IPAA 1LFUP 2M0CA 4IHVA 2UXHA 2LR8A 2KT0A 3BCGA 1JKOC 3JRDA 3BHQA 5M5XJ 2G0EA 3IH3A 1OJLA 4JP0A 1YRNA 1MBEA 5J1UA 2KDZA 2Y31A 3CCYA 4ABZA 4D7NA 4AF5A 5GPAA 2GLOA 2XPVA 3DPJA 3NNRA 2R7ZJ 4D5FA 1GV5A 3BR1A 3ZQHA 1AU7A 4GFBA 1U9NA 3ZQCA 2YS9A 3G56A 4XIDA 3WHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMQ A;  2UXO A;  1UHS A;  1IJW C;  2DMT A;  3T6N A;  4UUS A;  3TW7 A;  2Y30 A;  2ECB A;  3LNQ A;  3RQI A;  4D5C A;  4J19 A;  2DTZ A;  3JRB A;  1FJL A;  3HGG A;  5DAJ A;  5K58 A;  4FE4 A;  2HYT A;  3BR5 A;  1E3O C;  3JRC A;  5EZG A;  5FLM J;  3ZQG A;  1TWA J;  2G7G A;  3KKC A;  1B8I A;  2WAQ N;  1H89 C;  2XB5 A;  2Q24 A;  2OPT A;  2CQX A;  4DW6 A;  1LE8 A;  5J1Y A;  1Y1W J;  4BXX J;  1QPI A;  4AC6 A;  1MBJ A;  2EZL A;  4LOC A;  4IHY A;  2XB0 X;  4L5E A;  2JA6 J;  3H3V K;  1F43 A;  1WGX A;  2HXI A;  4JNN A;  1ZR2 A;  1Z0X A;  3BTL A;  2QCO A;  4DZP A;  2HXO A;  1ZK8 A;  3HTI A;  4D7M A;  3NPI A;  4C2M J;  4A3M J;  3JRI A;  4M6V A;  2DMP A;  3E7Q A;  3CRJ A;  3UKG A;  1TWH J;  3MVP A;  3F0C A;  1ZR4 A;  1IRZ A;  2RAS A;  1VF9 A;  4XRM A;  2XDN A;  4X6A J;  3ANP A;  4W1U A;  1QRY A;  2WB1 N;  3TED A;  3C07 A;  5IYD J;  3G7R A;  5HOD A;  1ETQ A;  4XIC A;  5HBU A;  4BBR J;  1ZKG A;  1B72 B;  3DEW A;  3GTP J;  5F08 A;  2VKV A;  2VKE A;  1ETK A;  4MO7 A;  5EG0 A;  1ZGW A;  1XC5 A;  2G3B A;  3FK6 A;  4C3I J;  2UXI A;  3HIM A;  3PM1 A;  2XRL A;  2ECC A;  1DU6 A;  1NTC A;  3TW6 A;  1Q1V A;  3ZQL A;  3C2B A;  3FIS A;  4S0H B;  2CRG A;  3A01 A;  4A3F J;  1WCM J;  5F04 A;  2WV1 A;  1QVT A;  4AC0 A;  4A3E J;  3HTH A;  1MSE C;  2X48 A;  3BR3 A;  3BTI A;  3BTC A;  1SAN A;  2LKX A;  3Q3S A;  1HDD C;  2COB A;  2L7F P;  2OI8 A;  2JA5 J;  2L9R A;  2NVX J;  3L1P A;  3PPB A;  4MFD A;  1A6I A;  2NOG A;  3EGQ A;  5F27 A;  2X9D A;  4XRS G;  2EZI A;  3BG9 A;  2HOA A;  1RR7 A;  3FKI J;  4NDL A;  5IP7 J;  3BR0 A;  2CU7 A;  2K9S A;  5E3L A;  1RPW A;  3HEF A;  3BRU A;  2WGB A;  3KNW A;  2DN0 A;  1MSF C;  3BT9 A;  3BG3 A;  3BG5 A;  1TWF J;  5EZH A;  4M3B A;  1BL0 A;  3OOU A;  1JKR C;  2E2J J;  3HOU J;  2UXU A;  2NX4 A;  5M3F J;  2JN6 A;  2LFB A;  4HNV A;  3B6C A;  1JUM A;  1OCP A;  3O8G A;  1JKP C;  4PXI A;  3VVY A;  4C3J J;  5EG0 B;  2UXP A;  3VW1 A;  1WPK A;  3JRA A;  5D19 A;  2AHQ A;  3SFI A;  2Y9Z A;  3Q0U A;  4UDS A;  2B63 J;  2Y2Z A;  1CQT A;  3Q0V A;  2HOS A;  2EH3 A;  5C4J J;  3LSP A;  1PUF A;  3VIB A;  4FTH A;  3H0G J;  1JJ6 C;  2NP3 A;  5F0H A;  3FIW A;  3KZ9 A;  2EBI A;  2MG4 A;  2G7S A;  4B1R A;  1IG7 A;  3CMY A;  1JTX A;  3P9T A;  3S1N J;  4NN1 A;  2LLK A;  2LK2 A;  1DU0 A;  4I76 A;  4FCY A;  2IAI A;  3AQS A;  3HTJ A;  1W0T A;  1NK3 P;  5FHP A;  3ON2 A;  5FKN A;  1LE8 B;  2OER A;  3A03 A;  3TP3 A;  3JRF A;  3SJM A;  5E3M A;  3LOC A;  4JL3 A;  2HOT A;  1TWC J;  2DA2 A;  2K9N A;  2NVY J;  4ACI A;  1QVU A;  4C3H J;  2VUM J;  2R92 J;  2PMZ N;  2NVT J;  5IYC J;  5F1J A;  1JT0 A;  2O9L A;  5FLV A;  2QOP A;  3VVZ A;  5IYB J;  4JX4 A;  5IOZ A;  1VFC A;  3HOW J;  3BNI A;  2XGE A;  5M5W J;  3V78 A;  1ETY A;  3LSR A;  2RHA A;  3COL A;  3K7A J;  2P81 A;  1TWG J;  3O8H A;  4I6Z A;  3NRG A;  2ZCM A;  5H9T A;  2JK3 A;  4GCK A;  3ZQF A;  4DYC A;  1BW6 A;  2Y0S N;  4MFE A;  1JT6 A;  1IC8 A;  1SGM A;  2I10 A;  3E7L A;  3LSG A;  3JRH A;  3EUP A;  5F0C A;  1UI6 A;  1XS9 A;  3BR6 A;  5K7F A;  2H8R A;  4AUX A;  1ETX A;  2DA6 A;  2DA3 A;  3QPS A;  1R9T J;  3S15 J;  3A02 A;  3CJD A;  3G1O A;  1S7E A;  3IUV A;  4JX5 A;  4A3I J;  1K83 J;  5E3O A;  2LP0 A;  5EDN A;  3GTO J;  1HCR A;  3SDG A;  2EZH A;  3S2H J;  1GV2 A;  2NP5 A;  1B72 A;  2FX0 A;  2LTP A;  2VI6 A;  3LHQ A;  3S2D J;  2CJJ A;  4JX6 A;  3QPL A;  2ZCN A;  2E2I J;  1MBG A;  4UUS B;  4ME9 A;  2NS7 A;  2D5V A;  2M8G X;  4XRS A;  2R93 J;  2M2E A;  4RDU A;  3HGY A;  3CQZ J;  4B3A A;  4MIM A;  5IOY A;  5EEA A;  4IEJ A;  1VND A;  4M3F A;  2JWT A;  1JTY A;  2R5Y A;  4M3D A;  3W6V A;  1H8A C;  1ORK A;  1XG1 A;  2MSY A;  2LVS A;  5D18 A;  5FKM A;  2IEK A;  4Y7N J;  3QBM A;  3WHC A;  1RES A;  1RKW A;  3CDL A;  1GVD A;  3S5R A;  3OSF A;  2L7M P;  4B4C A;  4BBS J;  1FTZ A;  1IGN A;  1HLV A;  2V57 A;  1MBH A;  5K7H A;  2XGC A;  3S1R J;  3VOK A;  3HDD A;  5EFY A;  1WH5 A;  5M3M J;  2IU5 A;  3O60 A;  1ETV A;  3GBG A;  4X1E A;  3GTG J;  2E1O A;  3HKZ N;  4BY7 J;  2LY9 A;  3JR9 A;  5FGL A;  1X2M A;  4AYB N;  3GZI A;  1PUF B;  2ME6 A;  3G1M A;  3HOX J;  2R0Q C;  2JA8 J;  4DZJ A;  5JLW A;  1JUP A;  2DA4 A;  3PO2 J;  3IV5 A;  4YZE A;  2X6O A;  3MKL A;  2QWT A;  1BW5 A;  4A3C J;  4A3J J;  1IV6 A;  2MW8 A;  2QIB A;  1Z77 A;  1UI5 A;  5J3L A;  3TP0 A;  3RZO J;  3S16 J;  4MK6 A;  2YVH A;  4CGR A;  3LJL A;  3QKX A;  4M3G A;  1T33 A;  1U78 A;  1BJZ A;  2XSD C;  3Q0W A;  1UMQ A;  1APL C;  3VUQ A;  1JGG A;  1MBK A;  2MGQ A;  3ANG A;  3RZD J;  3MN2 A;  1HF0 A;  5HAW A;  2PBX A;  4HKU A;  5C4X J;  1UG2 A;  3RH2 A;  3BTJ A;  1WH7 A;  1P7I A;  4A69 C;  3ZQI A;  4A3G J;  2FQ4 A;  3HOZ J;  1VI0 A;  3M3Y J;  2CUE A;  2CUF A;  4FE7 A;  3OSG A;  5E3N A;  1I6H J;  2HI3 A;  2NS8 A;  1ZQ3 P;  3BQY A;  5K7Z A;  5M5Y J;  5FKL A;  2JJ7 A;  3CWR A;  2LD5 A;  1GT0 C;  3VVX A;  2NVQ J;  4UUT A;  5F0F A;  3RKQ A;  2DMN A;  4DYR A;  4Y52 J;  1G2H A;  4JYK A;  4A3L J;  2FJ1 A;  3B6A A;  5IP6 A;  3PAS A;  3NAR A;  1WI3 A;  1IDZ A;  1HDP A;  3VP5 A;  2JMW A;  2XPU A;  2DA5 A;  3HBL A;  2W53 A;  3GEU A;  3AQT A;  4KWA A;  2PZ9 A;  2L7Z A;  4NEL A;  1ENH A;  5FMP A;  9ANT A;  2RAE A;  1ZTR A;  3S17 J;  2QF7 A;  3HB9 A;  1JKQ C;  1D5Y A;  3QQA A;  5DS9 A;  2GBY A;  2W48 A;  3JRE A;  3PO3 J;  2DJN A;  3A01 B;  2HYJ A;  4A93 J;  2HKU A;  3ZOB A;  2GM4 A;  5AQC A;  1A5J A;  1MH4 A;  4EEF G;  3NAU A;  2QTQ A;  1ETO A;  3LWJ A;  2Y9Y A;  2TCT A;  5J1R A;  1K61 A;  1JUS A;  2F07 A;  3GTL J;  3S1M J;  3JSJ A;  4L62 A;  1W0U A;  3GTK J;  2REK A;  1MBF A;  3BJB A;  1X2N A;  4CYC B;  2H1K A;  4MLO A;  4BKX A;  5C3E J;  1JJ8 C;  4GFL A;  2E19 A;  2XGD A;  2K40 A;  3HM5 A;  3NXC A;  4ICH A;  4V2G A;  2D6Y A;  5JLX A;  5GPC A;  2R5Z A;  1F36 A;  1FTT A;  1NK2 P;  3FRQ A;  5CXG A;  2O7T A;  3JRG A;  1H88 C;  1HOM A;  1MH3 A;  1I50 J;  2G7L A;  4IHX A;  3VW2 A;  4XK4 A;  1FIA A;  3VPR A;  2GFN A;  1T56 A;  2O8K A;  2EQR A;  2DMU A;  3K2A A;  3NI7 A;  4A3D J;  1Y1V J;  2ZOY A;  4GCL A;  4V2F A;  3I4M J;  1GDT A;  1B8I B;  1I3Q J;  1BA5 A;  2QKO A;  4W97 A;  2N8G A;  4GCT A;  1P7J A;  1TC3 C;  5CXI A;  1U9O A;  2DG7 A;  2FBQ A;  3HTA A;  3V6G A;  4DYQ A;  5C4Y A;  3GTQ J;  2ME0 A;  3B81 A;  5IP9 J;  3G1L A;  4MXM A;  2K9Q A;  2ELK A;  2L0K A;  2M34 A;  3OIO A;  1AHD P;  3KKD A;  3GTM J;  1OCT C;  1YRN B;  1FEX A;  3RD3 A;  1ETW A;  2HQ5 A;  5EGO B;  1IUF A;  5D1R A;  2ID3 A;  4FIS A;  3I4N J;  4QIW N;  3S14 J;  3MNL A;  5FKO A;  1RET A;  3FK7 A;  4JKZ A;  3S1Q J;  4G12 A;  4RBO A;  3DCF A;  5BNG A;  1IDY A;  2ZB9 A;  2ZOZ A;  3BQZ A;  3LSJ A;  2YVE A;  1SFO J;  2O7O A;  2XPW A;  2DG8 A;  3F1B A;  1FIP A;  2R5Z B;  2DA1 A;  3GTJ J;  1AKH A;  1AKH B;  2JA7 J;  1MNM C;  5FJ8 J;  5CW8 A;  4M3E A;  5C44 J;  4BY1 J;  2YU9 J;  1X58 A;  1O4X A;  2YUS A;  4QTR A;  5FKK A;  5GP9 A;  2E2H J;  2DA7 A;  3BR2 A;  1GUU A;  2OF7 A;  5EYR A;  5EF6 A;  3D1N I;  2ZCX A;  2ID6 A;  1U8B A;  2R5Y B;  4IHW A;  4A3K J;  2IBD A;  2TRT A;  5EGO A;  2WUI A;  3ON4 A;  2GUH A;  1POG A;  1LFB A;  5DTD A;  3IH2 A;  2M9H A;  3HE0 A;  3VOX A;  2EZK A;  4QSH A;  3IH4 A;  4GFK A;  4CYC A;  2GEN A;  2FD5 A;  3HOY J;  2AO9 A;  2VPR A;  5HSZ A;  1RKT A;  3M4O J;  1EF4 A;  1OFC X;  2HDD A;  4A3B J;  3HOV J;  2CQQ A;  1ITY A;  3VW0 A;  5IPA A;  1LFU P;  2M0C A;  4IHV A;  2UXH A;  2LR8 A;  2KT0 A;  3BCG A;  1JKO C;  3JRD A;  3BHQ A;  5M5X J;  2G0E A;  3IH3 A;  1OJL A;  4JP0 A;  1YRN A;  1MBE A;  5J1U A;  2KDZ A;  2Y31 A;  3CCY A;  4ABZ A;  4D7N A;  4AF5 A;  5GPA A;  2GLO A;  2XPV A;  3DPJ A;  3NNR A;  2R7Z J;  4D5F A;  1GV5 A;  3BR1 A;  3ZQH A;  1AU7 A;  4GFB A;  1U9N A;  3ZQC A;  2YS9 A;  3G56 A;  4XID A;  3WHB A; 
#chains in the Genus database with same CATH topology
 2UXO A;  3KP2 A;  1BI1 A;  4MTD A;  1MMA A;  4UUS A;  2FF4 A;  3RTR A;  2W7N A;  2RQP A;  3I59 A;  1VQK I;  2HZD A;  2HYT A;  3DLA A;  3SZP A;  1Z9C A;  2DO7 A;  5FLM J;  1T8I A;  2MLK A;  5JR3 A;  3K4M A;  2OPT A;  3L00 A;  2EIM H;  3HSF A;  3I53 A;  4Q48 A;  2VN2 A;  3PUF A;  4HLX A;  2P7V B;  2EZL A;  2LOO A;  2R7R A;  2UXX A;  5DD8 A;  1WJF A;  4E7H A;  2JA6 J;  1ZRE A;  1F43 A;  1W1W E;  1WGX A;  2DCE A;  2HXI A;  3SEZ A;  3FHN A;  3BTL A;  1ZK8 A;  4OMZ A;  2WAF A;  4YEJ A;  3DKX A;  3TO9 A;  4C2M J;  2F5F A;  1RNL A;  2KMU A;  3JRI A;  4A3M J;  1BIB A;  3E7Q A;  2ZNY A;  3CRJ A;  2CYY A;  3MVP A;  3F0C A;  1VF9 A;  5AIQ A;  4HLY A;  2HPM A;  3CLQ A;  3ANP A;  1QRY A;  3C07 A;  1QHG A;  3AL0 B;  2E7W A;  4L0Z B;  1X1P A;  4NQW A;  1ETQ A;  4E7L A;  3R0A A;  5HBU A;  3DF8 A;  2V1U A;  3ZR8 X;  3GTP J;  5F08 A;  2VKE A;  1O57 A;  4XMY A;  1XC5 A;  3OYA A;  2L2O A;  4PJL A;  3OYB A;  1DU6 A;  3DBR B;  5KAI C;  1NTC A;  3ZQL A;  3M8F A;  2LKS A;  3C2B A;  1MZB A;  4G7Z F;  4PDK A;  1O3S A;  1WCM J;  2WV1 A;  4IOC F;  1USS A;  2X48 A;  3BR3 A;  2P6S A;  2VE9 A;  1FC3 A;  3Q3S A;  2COB A;  3IRR A;  2GXG A;  2G7U A;  2L9R A;  3PPB A;  4U88 A;  1WHU A;  2BY2 A;  4CO8 A;  3TDU C;  3ESW B;  3WU1 B;  2EZI A;  2DFE A;  4FHT A;  3FKI J;  3BR0 A;  1S29 A;  2K5C A;  3LA7 A;  4E7Z A;  5E3L A;  2KQR A;  5E17 F;  2X51 A;  2DN0 A;  1MSF C;  1G59 A;  1BI0 A;  3BG5 A;  4BHC A;  4M3B A;  1QGP A;  4EJO A;  2E2J J;  1ZRD A;  3DKY A;  2NX4 A;  3K8P C;  5M3F J;  2B3W A;  1D0Y A;  3CCE I;  3B6C A;  3DXJ F;  2BGC A;  3O8G A;  5JVT A;  4DGW B;  3K4L A;  5EG0 B;  2UXP A;  1A31 A;  2ZXH A;  3HZJ A;  4KA4 A;  1MMD A;  2STT A;  4XLA A;  1WPK A;  2BY3 A;  4B09 A;  1TL8 A;  2BHY A;  4AM3 A;  3CC4 I;  4S04 A;  5HDG A;  2VOO A;  1T2K A;  2B63 J;  3Q0V A;  2HOS A;  1WJA A;  5C4J J;  3LSP A;  1PUF A;  2B1E A;  2F5C A;  1QBJ A;  1LJ9 A;  1JJ6 C;  1U6G A;  2L01 A;  1OCO H;  1VTN C;  1FSH A;  3H92 A;  2JT1 A;  5DCF A;  3ZMS A;  5GAG J;  5LRR A;  4BJ5 C;  1FY7 A;  4F92 B;  2LLK A;  2LK2 A;  2BW3 A;  2MC4 A;  1D0X A;  2ZXW H;  4FCY A;  3AQS A;  5FHP A;  3ZGK A;  1NK3 P;  1D1A A;  2IA2 A;  4O6J A;  5FKN A;  3JAM K;  1LE8 B;  2BYV E;  2PX9 A;  4OOI A;  2LSO A;  2HQA A;  3ERE D;  4HV5 A;  3TP3 A;  2Y0S A;  4U7D A;  4BGD A;  3C7J A;  5E3M A;  4HX8 A;  2LH9 A;  4PJN A;  2QBY B;  2K9N A;  4ACI A;  1QVU A;  2A6T A;  4XR6 A;  5IYC J;  1EV7 A;  3WOD F;  3K4C A;  5FLV A;  4PSW A;  1WRJ A;  4GYG A;  1G3Y A;  3QYB A;  3CUO A;  3L2W A;  4DBR A;  5CYV A;  5M5W J;  1P92 A;  3LSR A;  2P81 A;  1SD6 A;  1YI2 I;  4BE1 A;  3BZK A;  1SAU A;  3TL4 X;  3AG3 H;  3R60 A;  1OLT A;  3ERM A;  3ZQF A;  3ZRG A;  2K27 A;  4MFE A;  2DI3 A;  3BG7 A;  4HDV A;  4B3X A;  2PFV A;  3DLL F;  2O8X A;  2JRM A;  4OWR B;  3JRH A;  2OA4 A;  3TGN A;  5F0C A;  1UI6 A;  2ZFU A;  5K7F A;  4AUX A;  1ETX A;  2DA3 A;  3QPS A;  4QLC U;  3S15 J;  1HKS A;  1YE9 A;  4BEH A;  3FKJ A;  4A3I J;  3OYL A;  3U1K A;  2RQQ A;  4RB0 A;  4TV7 A;  2LP0 A;  4R79 A;  2HZT A;  5F64 A;  1MMN A;  2NOJ B;  5CQG A;  1OMI A;  3N4M A;  1B72 A;  3P5J A;  4GGG A;  2LTP A;  4RGS A;  2JTV A;  1WI9 A;  2VT3 A;  4JX6 A;  3HHG A;  4M73 A;  1IAW A;  2ZCN A;  4UUS B;  1W5C C;  1XD7 A;  2NS7 A;  2D5V A;  3RKX A;  1F9N A;  2L4A A;  4BJT A;  2ZME A;  3CQZ J;  3NWS A;  1ODD A;  3ECH A;  4MIM A;  4B3A A;  5EEA A;  2HKX A;  4UB6 C;  2JWT A;  2X1D A;  2ISY A;  2PEX A;  3GFI A;  4OIO F;  3WU2 C;  3IP4 B;  2YR2 A;  5FKM A;  1UJ8 A;  4QPO A;  4DBQ A;  1I1S A;  4BBS J;  2V57 A;  1HKQ A;  5K7H A;  1OCC H;  2QUF A;  2HU9 A;  3VOK A;  2GQQ A;  1WH5 A;  3DPU A;  5JI6 A;  2IU5 A;  5H20 A;  4Q47 A;  2E1O A;  3HKZ N;  3R6S A;  1OIS A;  2WV0 A;  5LRS A;  1Q1H A;  2DQL A;  2LMD A;  2VJJ A;  3GZI A;  2ME6 A;  2XRN A;  5JLW A;  2DA4 A;  3PO2 J;  3G6E I;  1IXC A;  1Y6I A;  1IV6 A;  1R7J A;  1V3F A;  1P4A A;  2YPR A;  2GZW A;  3S16 J;  3FXR A;  4BU2 A;  4M3G A;  3OYM A;  2MAB A;  4LIT A;  3MZH A;  3OS1 A;  4KT6 A;  1TW2 A;  5BQT A;  3QU6 A;  4HF0 A;  2L3D A;  3PNY A;  4Y4R A;  3QOP A;  2WY8 Q;  3IWF A;  1P4X A;  3MN2 A;  3HKZ A;  1SFU A;  4HKU A;  3IAM 2;  4ZZL A;  2M4G A;  3CC2 I;  3NQO A;  1VQP I;  1ZEL A;  5BOX A;  1LKX A;  3PNT A;  5ERI A;  1U5T A;  2BBY A;  1XDU A;  4KIF A;  2CUF A;  1I6H J;  4P9U A;  5BMZ A;  1YLF A;  3FDY A;  4MHG A;  2XGX A;  2ZSH B;  4I98 B;  3V8K A;  3K4N A;  3C2G A;  3OYH A;  4E70 A;  1RUO A;  5CKT A;  2LBF A;  5FKL A;  4LK0 F;  3CJR B;  2F6C A;  4KMF A;  4U0W A;  5GTI C;  3E6M A;  2H27 A;  4XLH A;  4JYK A;  5LEJ A;  4XOR A;  3JTG A;  4WIB A;  5IP6 A;  3CCU I;  3LSI A;  1TZL A;  3NAR A;  3RDI A;  3TO6 A;  2HGC A;  4ANJ A;  2GAU A;  2DA5 A;  3CLO A;  3FZV A;  2K4J A;  2KJC A;  2EA4 A;  2ELJ A;  3ZMV A;  2KRH A;  3H36 A;  3H5R A;  2QF7 A;  3HB9 A;  1T0F C;  4A6D A;  3QQA A;  2W4S A;  2A5W A;  2KIF A;  4QPQ A;  1HW1 A;  1LDJ A;  3ZOB A;  3KYL A;  2BOL A;  5AQC A;  1JGS A;  5DCM A;  1MH4 A;  1DPR A;  5TRD A;  1ETO A;  3L9F A;  1W36 D;  2TCT A;  4K2E A;  2QWW A;  3G3Z A;  3VTI A;  2XAU A;  3GTL J;  3S1M J;  1R4M B;  3HJE A;  2REK A;  3BJB A;  3DTK A;  3CC7 I;  2HNH A;  4MLO A;  5EJC A;  5C3E J;  1PDN C;  2E19 A;  2XGD A;  3NXC A;  1IZ1 A;  2P0W A;  2L02 A;  4B48 A;  4WXC A;  1Z7L A;  1FTT A;  3SZT A;  4P1W A;  5E8I A;  4XM3 A;  1H88 C;  2EWN A;  1MH3 A;  4RGR A;  2LYC A;  1SD5 A;  4RB2 C;  4EJW A;  3D5S C;  1XCB A;  4EMS A;  3VW2 A;  1HQC A;  1I39 A;  2EIK H;  2DMU A;  5DUI A;  2ZFW A;  3LSH A;  2Y0M A;  3ABT A;  2F4I A;  1I27 A;  2XAG A;  1BA5 A;  2Q2E A;  2IT0 A;  4W97 A;  3OYK A;  2MH9 A;  4GCT A;  4OAY A;  1P7J A;  3TBI A;  3FXO A;  3V6G A;  4IOA F;  3TOB A;  4LFU A;  4ZTF A;  1ON1 A;  3B81 A;  4Y17 A;  3G1L A;  4MXM A;  1WSU A;  3OIO A;  3R61 A;  2HTS A;  2QVO A;  1TTY A;  5HDK A;  1FEX A;  1XGN A;  5EGO B;  5D1R A;  1R1T A;  2YSR A;  1JHH A;  1YW8 A;  3ABK H;  3KIO A;  2IS2 A;  3TDZ C;  4G12 A;  2KRF A;  3ELK A;  2W84 A;  4AIJ A;  2ZB9 A;  4HNT A;  1ZAR A;  1U3E M;  1X3U A;  2PMZ A;  2PJP A;  3F1B A;  3SXY A;  1FIP A;  2R5Z B;  2DLL A;  1A6Q A;  4M74 A;  3GTJ J;  2L54 A;  2ZNZ A;  4EM0 B;  2HDW A;  1QQI A;  3K1M A;  4P55 A;  3CF2 A;  1U0J A;  3BR2 A;  2E1M B;  5LHH A;  3OYE A;  1S8N A;  3GO5 A;  1G3T A;  1SVO A;  3MAJ A;  2WB1 A;  2ZCX A;  2R5Y B;  4IHW A;  5D5U B;  4Z6Y A;  2GUH A;  3M1E A;  1LFB A;  2P4W A;  2DK8 A;  5DTD A;  3GLL A;  3J7Z I;  3VOX A;  4AWX B;  4GFK A;  1SFE A;  4L5J A;  2FD5 A;  2AO9 A;  5HSZ A;  1RKT A;  2A05 A;  2ZSI B;  2F2E A;  3K6G A;  1ITY A;  2KZV A;  5FD5 A;  4IHV A;  2LR8 A;  5TIS C;  1WJD A;  1WWX A;  4CCM A;  1Z6R A;  1BC7 C;  4FET A;  4BEH B;  4KIT B;  5M5X J;  3J7Y J;  1I1G A;  3IH3 A;  1IW7 F;  3I5U A;  1MBE A;  3JCU C;  5E79 C;  3CMA I;  2Y31 A;  3CCY A;  1XGM A;  3EDP A;  2EV6 A;  5GPA A;  2XPV A;  3DPJ A;  3F8M A;  4I7H A;  3B73 A;  5J8C A;  3ZPL A;  4I2O A;  4F93 B;  1SFK A;  3ZQH A;  1VQL I;  2VAS A;  2ZJP F;  1V54 H;  4Q5S F;  4M71 A;  2OCC H;  2DMT A;  2NYX A;  3HIF A;  1FOK A;  2Y30 A;  2ECB A;  4D5C A;  2OV7 A;  5B3S H;  2OZ6 A;  4F3Q A;  5K58 A;  4FE4 A;  2H8W A;  4G94 A;  1ZG3 A;  3GFM A;  4YFN F;  1K6Y A;  3Q5F A;  3ZQG A;  5DDG A;  1IRX A;  3GUD A;  3CP8 A;  3A4C A;  3DEE A;  2XB5 A;  1H89 C;  5D6F A;  3LAP A;  1B8I A;  2IRF G;  4DW6 A;  5J1Y A;  1HST A;  1Y1W J;  3LSM A;  2X4H A;  4NB5 A;  4YIR X;  1QPI A;  1MBJ A;  5J4Y A;  4NHJ A;  4UUV A;  1W7P B;  4IHY A;  5ICE A;  5A2Q Z;  1XGS A;  2QCO A;  4DZP A;  2HXO A;  3BRO A;  3LA2 A;  1VQ5 I;  4M6Y A;  3K69 A;  2KIM A;  2IS6 A;  4OD5 A;  2Q0O A;  4M6V A;  1ZR4 A;  1TWH J;  1XTA A;  2FEZ A;  1IRZ A;  2RAS A;  2ZXI A;  4XRM A;  2XDN A;  4X6A J;  1Z6T A;  3TED A;  1WZ2 A;  2IS4 A;  5HOD A;  3I71 A;  1YFH A;  1R4N B;  3WTX C;  4ON0 A;  1ZKG A;  3L2V A;  4RLF A;  2G3B A;  2Z3Y A;  4II3 A;  3BJA A;  4MO7 A;  3RPQ A;  3VSL A;  4EAT A;  3FM5 A;  3F3X A;  1V5F A;  3L2R A;  5JHF A;  1X1B A;  1Q1V A;  4RM3 A;  1YIO A;  3VSK A;  4L9V A;  1IN6 A;  2W24 A;  3MMY B;  1NG6 A;  2DT6 A;  1QVT A;  2LDU A;  5F04 A;  4AC0 A;  3FMR A;  3GWZ A;  1HA8 A;  3BTI A;  2HKO A;  2DK5 A;  3KEQ A;  1S9H A;  2GXB A;  3OOP A;  2BY0 A;  4P9F A;  2JA5 J;  4BYY A;  3BG9 A;  3F8C A;  4N4N B;  5BPI A;  4LD5 A;  2CV1 A;  1Z05 A;  2K9S A;  2A07 F;  3P9C A;  4ENN A;  3HEF A;  1KQ8 A;  2CH0 A;  4Q4Z F;  3KP3 A;  2WGB A;  3BT9 A;  2VQG A;  1Z67 A;  4O3M A;  3OOU A;  1JKR C;  4CDG A;  2RC4 A;  2JPB A;  2HQN A;  4HQM A;  4WXD A;  2LFB A;  2MD5 A;  1JUM A;  1OCP A;  3LAJ A;  5HVQ C;  1VQ9 I;  4XBF A;  2LBF B;  2QM3 A;  4RGU A;  2V26 A;  3JRA A;  1GXP A;  1N78 A;  2MLG A;  4HEA 2;  4PSX A;  1FYM A;  5FRO A;  3H0D A;  2DOE A;  5KAF C;  2K9M A;  1B9M A;  2EBI A;  2MG4 A;  3VWB A;  3CMY A;  2P6T A;  3P9T A;  2EFN A;  3A0B C;  3W3C A;  2H6C A;  1QU3 A;  1DU0 A;  1TW3 A;  3HTJ A;  3ON2 A;  3BCB A;  4KIB A;  2L4M A;  1TQP A;  1WJC A;  5J6X A;  4HW0 A;  3SJM A;  3LOC A;  2HOT A;  1TWC J;  1W5T A;  2NVY J;  3HYI A;  3QYF A;  2M0M A;  4E4H A;  4HV6 A;  1LPQ A;  2JPC A;  2R92 J;  5F1J A;  5LFA A;  2VC1 A;  2LC2 A;  2V9K A;  3AG1 H;  5IYB J;  4IHT A;  4JX4 A;  5CLS A;  1VFC A;  3HOW J;  4A5M A;  2XGE A;  4GXO A;  3HPG A;  5E20 A;  3M07 A;  4RB3 C;  3COL A;  3SWH A;  4XLC A;  3EPZ A;  4I6Z A;  1KU9 A;  1WJB A;  5CVI A;  4LB6 B;  2JK3 A;  1MGT A;  4DYC A;  1YJW I;  2XV4 S;  2M8E A;  4UV8 A;  5FRN A;  3HRT A;  2AQE A;  2GOX B;  1JT6 A;  2X0L A;  2ZXJ A;  1ZH5 A;  1BC8 C;  4U9L A;  1L0O C;  2V79 A;  4E7K A;  1SGM A;  3EUP A;  1VQ4 I;  2MA3 A;  3BR6 A;  5FB2 A;  2UXN A;  3CJD A;  4BS9 A;  4LIV A;  4WF2 A;  2X6X A;  3G1O A;  1IN4 A;  1S7E A;  4JX5 A;  3J81 K;  1FLI A;  2RVC A;  5KHD A;  2YX4 A;  4IQJ A;  2DFH A;  2Z1D A;  5EDN A;  3GTO J;  1FP2 A;  2ZJQ F;  3S2H J;  2HQR A;  5LEK A;  1S6L A;  2K7L A;  4KMU X;  3SYT A;  3UR3 C;  1OKR A;  3S2D J;  1LEA A;  3I4P A;  2HYG D;  3KYC B;  2E2I J;  1MBG A;  1DUX C;  2UZK A;  2QQB A;  2JSC A;  1P4W A;  3EQL F;  3GVA A;  3HGY A;  3H9G A;  3BWG A;  4UVB A;  4M3F A;  1QNT A;  2R5Y A;  4H4K C;  3C1D A;  1ORK A;  1GXQ A;  1AWC A;  1E3H A;  1D1B A;  2LVS A;  4NBQ A;  1GHC A;  1FX7 A;  3QBM A;  1K78 B;  1K4T A;  2WBM A;  1K6O A;  4OIP F;  2FNA A;  3S5R A;  3JAM Z;  1FTZ A;  1HBX G;  1OYI A;  4DIQ A;  1MBH A;  2A2F X;  4YII A;  4LLL A;  2MD0 A;  1WVR A;  2KIS A;  4CHU A;  1ETV A;  3OWT A;  3GBG A;  2VXD A;  3WGG A;  3GTG J;  1CGP A;  1QHH D;  1SFX A;  2M4K A;  4BJ6 C;  2EFP A;  4BY7 J;  5DD4 A;  3JR9 A;  4YFX F;  4AYB N;  2H94 A;  3BC8 A;  4RM2 A;  4ITV A;  2R0Q C;  2JA8 J;  2VC0 A;  4DZJ A;  2R7F A;  3IV5 A;  2FA5 A;  3MKL A;  2WAE A;  4O5V A;  2CS3 A;  2QQ9 A;  2QIB A;  4FAS D;  3CUQ C;  3TP0 A;  2QKL B;  3F21 A;  1YHQ I;  2ICW G;  3K2Z A;  1KZH A;  3O3K A;  1UFM A;  2CMP A;  2YVH A;  3QAH A;  4CGR A;  2BZT A;  3TMO A;  1J09 A;  1BR4 A;  4A0X A;  3WTV C;  3RYP A;  4XLF A;  2X6W A;  2XSD C;  4GO1 A;  4ASN A;  3S3O A;  4FT8 A;  1PYV A;  3I9V 2;  3VUQ A;  2FBK A;  5J8F A;  5CJ9 A;  3F72 A;  3CO6 C;  1MBK A;  3KZI C;  4EQQ A;  3VFZ A;  2ISZ A;  4RAF A;  1LVA A;  3ABM H;  3ANG A;  3RZD J;  3KFW X;  2RV8 A;  4U9N A;  2G7H A;  3FMQ A;  1UCR A;  4KIG A;  2TDX A;  3RH2 A;  3BTJ A;  4DQ2 A;  4HDU A;  2M7B A;  1P7I A;  5LGT A;  1T38 A;  3A2K A;  1XSX A;  1NG7 A;  1XB4 A;  2FQ4 A;  5L3G A;  3FXQ A;  3PFI A;  1W36 C;  5E3N A;  3G73 A;  4KFC A;  2LY1 A;  3HHH A;  1QZE A;  2ZCW A;  1ZQ3 P;  2CUZ A;  2IVM A;  1OQY A;  3BQY A;  2L5Q A;  3KZY A;  2VON A;  1DGW Y;  1ZHF A;  3OR2 C;  2JJ7 A;  1WQ2 A;  4KT5 C;  3FBN B;  2LD5 A;  3VVX A;  3OR1 C;  4UUT A;  3OIQ A;  1BOB A;  2LY2 A;  1P9Q C;  1V4R A;  3N97 A;  4RA2 A;  2HVR A;  1BN5 A;  2O3F A;  2DMN A;  1CF7 A;  2CW0 F;  3X2Q H;  2XIG A;  2DTR A;  2O5R A;  3M1C A;  3B6A A;  1UST A;  2GA2 A;  2W57 A;  3RQ4 A;  3V4G A;  2QEX I;  1DQU A;  1GVJ A;  2CW7 A;  3PSF A;  2VLA A;  4E7I A;  2VKH A;  1QA6 A;  4UNO A;  1IDZ A;  5K1Y A;  1Z91 A;  2XPU A;  1EH8 A;  1KQ0 A;  4BQN A;  3WGH A;  1K4S A;  1LB2 A;  2W53 A;  2RAE A;  1ZTR A;  3EYY A;  4L18 B;  5B1A H;  1JKQ C;  1D5Y A;  2DPD A;  3ASO H;  4NUB A;  3PJR A;  4KN4 X;  4CA0 A;  1MDM A;  1JI8 A;  4N9H A;  3AG4 H;  2GIV A;  3JRE A;  3PO3 J;  2XKO A;  4A93 J;  1R58 A;  3DFG A;  3PNV A;  2QBY A;  1A5J A;  2OJE D;  5LHG A;  3BPV A;  3COA C;  1DDN A;  2FXA A;  2Y9Y A;  3QP5 A;  4LK1 F;  1R49 A;  3W2A A;  2F07 A;  3CCS I;  1LDK B;  3JTH A;  4L62 A;  2QKM B;  2I5U A;  3JSP A;  1DP3 A;  5D5X B;  1YIT I;  4PZJ A;  4WWC A;  3IHU A;  1ON2 A;  2KRC A;  4ICH A;  5J47 A;  1XDS A;  5JLX A;  5GPC A;  2FOW A;  1F36 A;  1T98 A;  3LQQ A;  1HSJ A;  1S7O A;  3FXK A;  5FGM A;  2O7T A;  3I64 A;  2G7L A;  4D0P A;  1UAA A;  3OIP A;  2XAJ A;  2GFN A;  3KCC A;  2RDP A;  1OR7 C;  4XOP A;  2P5V A;  2EQR A;  3K2A A;  1IN8 A;  3V8L A;  1RUN A;  5IY5 H;  2ZOY A;  1ZGJ A;  3HRS A;  4IXA A;  1XPX A;  3K1P A;  3IAS 2;  1F4K A;  1GDT A;  3I4M J;  2GIZ A;  1U5T C;  4ZJZ A;  1I3Q J;  1YTY A;  3CUQ A;  1OCR H;  3QU3 A;  4DJA A;  4XLE A;  1EH6 A;  4HYE A;  4XNF A;  5CXI A;  2K4B A;  3G71 I;  1ZYR F;  2FBQ A;  2OBP A;  3HC7 A;  3JW4 A;  5C4Y A;  5IP9 J;  5LD2 C;  2E1M C;  4KYW A;  3GFJ A;  4YG2 F;  2ELK A;  4YFK F;  3KP6 A;  1AHD P;  2OZU A;  3H5N A;  4WCG A;  1YRN B;  1ETW A;  2HQ5 A;  3F6V A;  1H9T A;  4PJM A;  2GWR A;  2ID3 A;  1HXD A;  1X4O A;  1J2X A;  3D0S A;  4FIS A;  3E97 A;  4QIW N;  2BXY A;  3FK7 A;  1N25 A;  2OC6 A;  4PK4 A;  2D2W A;  3S1Q J;  2XRO A;  4RBO A;  1FOX A;  2L9V A;  3DCF A;  2ZOZ A;  3BQZ A;  1W7P A;  2M1B A;  1SFO J;  2DG8 A;  1EJ9 A;  3LST A;  2VOP A;  3CF5 F;  1AKH B;  1AKH A;  3PFY A;  5FJ8 J;  4IRI A;  1W5S A;  4BY1 J;  1R1U A;  3K4B A;  2R7D A;  1IF1 A;  1X58 A;  2DBB A;  5FKK A;  2P5L C;  4RS8 A;  5HLG A;  3OS2 A;  3D1N I;  1FT9 A;  1D8K A;  2ID6 A;  4A3K J;  2TRT A;  1POG A;  3MEX A;  4QSH A;  2E35 A;  2GEN A;  4CCN A;  3FBI B;  3HOY J;  2Z16 A;  3BOQ A;  2YX7 A;  2VE8 A;  3M4O J;  1BI3 A;  4A0Z A;  1OFC X;  1EF4 A;  2HDD A;  2CGP A;  4XN0 A;  3JSO A;  3HOV J;  1QO0 D;  1R6R A;  1ZRF A;  2QGU A;  3CO7 C;  1DPU A;  5DEQ A;  2M0C A;  2Q8K A;  1LFU P;  1YQA A;  2UXH A;  2P5K A;  3GW2 A;  4AIK A;  4IRV A;  3L09 A;  1JKO C;  4A5N A;  3JRD A;  2HOE A;  1UG0 A;  2MFZ A;  4IJA A;  4PUS A;  2Z33 A;  2G0E A;  3QWL A;  2OQR A;  3C18 A;  4WK8 F;  4BUP A;  3P9K A;  5J1U A;  2L7K A;  3BJO A;  2DOD A;  3K9T A;  5D5W B;  1YO5 C;  4ABZ A;  3SQN A;  2EV5 A;  4AF5 A;  1ERD A;  1LQ1 A;  1VZ0 A;  4M9Z A;  1X1C A;  3S2W A;  1KQ9 A;  5LHI A;  4IO9 F;  4D5F A;  2R7S A;  1O3T A;  4L0Y B;  3GLX A;  4GFB A;  2EK5 A;  1U9N A;  3DP7 A;  3GME A;  3J80 Z;  2R7W A;  2OD5 A;  4MNU A;  3WHB A;  3JRF A;  2DMQ A;  1YX3 A;  5E8G A;  2A68 F;  1UHS A;  4BXU A;  1IJW C;  3RIR A;  3T6N A;  2GA1 A;  4ZYG A;  4UHT A;  2RNJ A;  3RQI A;  2DTZ A;  6PAX A;  4OIR F;  1FJL A;  1A04 A;  1OYW A;  5BS6 A;  3BR5 A;  3S32 A;  1GLN A;  3JRC A;  1MD0 A;  2CSO A;  2WAQ N;  2H1L A;  2Q24 A;  2PQ8 A;  4II2 A;  3VYS B;  3OL3 A;  1LE8 A;  1E0E A;  4BXX J;  1J75 A;  2XAS A;  1YOV B;  2KHM A;  4B43 A;  4HX7 A;  1U8R A;  1J7K A;  4LOC A;  4HZF A;  4BQQ A;  1QZZ A;  4L5E A;  1W7P D;  5K5R A;  4V19 K;  3H3V K;  4JNN A;  1X3Z B;  3BPX A;  5IT9 K;  2B7E A;  3ZP5 A;  3G2B A;  3AG2 H;  2FE3 A;  3FWE A;  2XUB A;  5E1W A;  4IZZ A;  2CQN A;  5H6R A;  2KZG A;  2LF8 A;  1TP4 A;  2AXT C;  4PJ0 C;  4W1U A;  5IYD J;  3ABU A;  3CDI A;  2Z2S B;  4XIC A;  2OUM A;  3HSE A;  4IF4 A;  4OMY A;  5KVR A;  5HLH A;  1R00 A;  1B72 B;  1BIA A;  5HS7 A;  3H35 A;  4N0B A;  5EG0 A;  1ZGW A;  2BHZ A;  2K86 A;  3LFK A;  3FK6 A;  4C3I J;  5L3E A;  4BE0 A;  1G4D A;  3HIM A;  2EV0 A;  2AXL A;  1DGR M;  1SMT A;  3OYF A;  3M7G A;  3CCJ I;  2BV6 A;  3KP5 A;  2IGN A;  4G7H F;  3A01 A;  2YVE A;  2M45 A;  4A3E J;  3WTS C;  1R5G A;  3BTC A;  4HA8 A;  2LKX A;  3T8T A;  2J5P A;  1HDD C;  3CCM I;  2BVL A;  1UZC A;  2OI8 A;  3T8R A;  3L1P A;  5ILV A;  4MFD A;  1MJ9 A;  1TT0 A;  1T0F A;  2NOG A;  2X9D A;  5F27 A;  4XRS G;  4ZYH A;  1C0W A;  2HOA A;  2KJB A;  1YW9 A;  2E36 A;  2OQG A;  4NDL A;  2M5W A;  5IP7 J;  3GCM A;  1WFX A;  4AID A;  1G8X A;  3HUG B;  1PUE E;  2F5V A;  5B66 C;  1RPW A;  2CUJ A;  3RKW A;  2QYO A;  3SHF A;  3A0H C;  3KYD B;  3U1D A;  3SZG A;  1TWF J;  3BZC A;  3EUH C;  3QOD A;  3HOU J;  2UV1 A;  4CCK A;  2UXU A;  2X1E A;  1JKP C;  4XLN F;  4C3J J;  1O3R A;  4ZTJ A;  3MQ0 A;  4IX7 A;  3F22 A;  3QRF F;  3VW1 A;  2ZBK A;  2HYF A;  3T1B A;  3ZN1 A;  2AHQ A;  3SFI A;  2F48 A;  2Y9Z A;  4JK1 X;  3Q0U A;  3RCO A;  4UDS A;  2HEO A;  3P9I A;  1CQT A;  2DU9 A;  2EH3 A;  3OYI A;  4FTH A;  3H0G J;  1K78 A;  5F0H A;  3FIW A;  3E3V A;  3GZ5 A;  4KIC A;  2DXI A;  1K7A A;  4B1R A;  1IG7 A;  2G7S A;  1JTX A;  3S1N J;  2W25 A;  4UV9 A;  4AVP A;  2JRT A;  1H0M A;  3J7A Y;  1R22 A;  3NEU A;  2IAI A;  3ZMT A;  1WKM A;  3G4S I;  1UB9 A;  2XVC A;  3A03 A;  2KLO A;  2IPQ X;  2Y75 A;  4JL3 A;  3VB2 A;  2AQF A;  3L2U A;  5CQE A;  3Q9S A;  4B44 A;  3LMM A;  2VBX A;  4PFP A;  4C3H J;  1LVK A;  3RPU D;  5FO5 A;  2VUM J;  4HPQ A;  2R3S A;  3SEQ A;  2NVT J;  3K70 D;  1RR8 C;  2ESN A;  1PJR A;  3VVZ A;  5IOZ A;  2BEO A;  5H2F C;  5HDN A;  3W2V A;  1KA8 A;  4ESF A;  1B6A A;  2HVS A;  3TOA A;  3DWL E;  3K7A J;  4C2U A;  1TWG J;  1Z21 A;  2EIL H;  3O8H A;  3NRG A;  2ZCM A;  3KLO A;  1STZ A;  1Y39 A;  4GCK A;  4EGY A;  5L3C A;  1B4A A;  2YU3 A;  1FBS A;  3M9A A;  1BW6 A;  2PI0 A;  2DOF A;  1B9N A;  3L2Q A;  1J59 A;  5B5E C;  3E7L A;  2UUZ A;  1F1Z A;  3T0Y A;  3PIO F;  4NNJ A;  1FOW A;  2QEN A;  2DA6 A;  1Y0U A;  1R9T J;  3A02 A;  4I09 A;  4MTE A;  3IUV A;  1ZRC A;  1K83 J;  5DM6 F;  1PVE A;  2DJI A;  4XON A;  3P7N A;  3HOT A;  1HCR A;  3CDH A;  3K70 C;  2EZH A;  1GV2 A;  2QQA A;  1NH3 A;  2UWM A;  2NP5 A;  1MJB A;  2FX0 A;  1R5H A;  2VI6 A;  2VJ5 A;  3LHQ A;  2CJJ A;  2O03 A;  4ME9 A;  5HS9 A;  4HBL A;  1RIO H;  2KL4 A;  2M8G X;  3I3L A;  2EB7 A;  1F5T A;  2STW A;  2E60 A;  2M2E A;  3K1N A;  3K0L A;  4RDU A;  2WY7 Q;  4PCQ A;  5IOY A;  2L9N A;  4GDF A;  1VND A;  1LUJ B;  2BY1 A;  3W6V A;  3FX3 A;  1H8A C;  5BPD A;  4ZYD A;  3GEZ A;  5D18 A;  1Y0N A;  2IEK A;  2K85 A;  1RI7 A;  5D8K B;  3WTU C;  3WHC A;  3HPH A;  2HTJ A;  4XOT A;  1RKW A;  4DVY P;  3CDL A;  2COM A;  3OSF A;  2FBI A;  2L7M P;  2XC7 A;  2KPM A;  3BJ6 A;  1K79 A;  1IGN A;  1HLV A;  2LG4 A;  2VXZ A;  2XAH A;  3N05 A;  4XSZ F;  3RI4 A;  4C2M A;  4AYB A;  2JQ7 A;  4RAZ A;  2EPF A;  2XSJ C;  4M72 A;  1MJA A;  3O60 A;  4FQG A;  5EFY A;  2CQK A;  4BHP A;  3REO A;  5FFZ A;  4OD4 A;  2VQC A;  2DDB A;  3KPH A;  1PUF B;  1XMX A;  3G1M A;  3HOX J;  1HW5 A;  3ASN H;  1Y8Q B;  2ADU A;  1FWZ A;  4RLQ A;  1BW5 A;  2QWT A;  4EJU A;  3WTY C;  3RZO J;  3DV8 A;  3S8P A;  3BCA A;  2VB6 A;  4KDP A;  3QKX A;  2CV0 A;  1U78 A;  1BJZ A;  1R36 A;  2JZY A;  1APL C;  5KCM A;  3GX4 X;  4HG2 A;  1JGG A;  1RC9 A;  1SMY F;  3U9G A;  3EUA A;  2MGQ A;  3FMS A;  3CCR I;  1LNW A;  3HOS A;  3M8J A;  1HF0 A;  5HAW A;  2V9P A;  3S3N A;  2KP6 A;  2RN7 A;  2E5Z A;  4HST A;  1S7A A;  5D5V B;  2HFH A;  5J4V A;  3QOE A;  1WH7 A;  3K10 A;  3IRQ A;  1FMW A;  1TNS A;  2E7X A;  3ZQI A;  4HX4 A;  1VI0 A;  4PJJ A;  2K9L A;  1VQM I;  3M3Y J;  3OSG A;  4C2T A;  4A12 A;  3VYR B;  2HPI A;  3ZXS A;  1REP C;  3CCL I;  2FML A;  3MCZ A;  1J0R A;  3WE3 A;  4QWQ A;  4IRG A;  1SD7 A;  4EJV A;  1NHA A;  4EGZ A;  5K7Z A;  1WJ5 A;  2IA1 A;  1BM9 A;  1MIJ A;  3QP6 A;  1G3W A;  4P5O A;  3WG7 H;  1GT0 C;  4I99 C;  2OAZ A;  5KNL A;  2E1N A;  5F0F A;  3RKQ A;  3DTI A;  5FLX K;  2CFO A;  4A3L J;  3CP2 A;  2FJ1 A;  2NVU B;  1P2F A;  3PAS A;  4DOZ A;  3LL7 A;  2P7C B;  1WI3 A;  1HDP A;  4JQF A;  3VP5 A;  5LGN A;  2JMW A;  1HKT A;  1AA7 A;  1QZY A;  3GEU A;  2MBF A;  4AD9 A;  5K5O A;  2Z5U A;  4KWA A;  4M9S A;  4NEL A;  1ENH A;  3ISP A;  1ULY A;  2CWE A;  2GBY A;  1YYV A;  3K4J A;  3D5R C;  2K02 A;  4ETS A;  1TQM A;  3OYJ A;  2GM4 A;  2HKU A;  1X3W B;  4G9Y A;  3OV8 A;  2Z9O A;  3W6J B;  2RKH A;  3NAU A;  2QTQ A;  5TGT A;  3GZN B;  2VIX A;  1KYZ A;  5J1R A;  1ZG5 A;  1JUS A;  1R71 A;  1KU7 A;  3RYR A;  3JSJ A;  2VJI A;  1G3S A;  1SEU A;  2QSG X;  2ZC2 A;  3GTK J;  1MBF A;  5LGU A;  1S72 I;  2D1V A;  4IQ4 A;  4BKX A;  1JJ8 C;  4BDZ A;  1ZG1 A;  5H6Q A;  3TO7 A;  3HM5 A;  2M30 A;  3HG9 A;  3IKV A;  5ICC A;  2D6Y A;  5CXG A;  5LLQ A;  3FRQ A;  1Y56 A;  3ROU A;  1YIJ I;  1FYK A;  4N4O B;  3V7C A;  1I50 J;  4PFO A;  1IXR C;  3LFU A;  4IHX A;  2LRE A;  1IRF A;  2Y69 H;  3H5A A;  4X0G A;  1FIA A;  1T56 A;  2CG4 A;  2O8K A;  4CXF A;  2I8D A;  2XAF A;  2DYS H;  5ILS A;  1Y1V J;  1UHM A;  5HOO A;  1XSD A;  4V2F A;  3HXL A;  5L3D A;  4L9J A;  1B8I B;  1HC8 A;  2QKO A;  4XKB A;  3KEO A;  1ZGA A;  4MEY F;  4RMN A;  3KE2 A;  4I0A A;  3DU5 A;  1TC3 C;  3WE2 A;  1U9O A;  4Y3O A;  2DG7 A;  3HTA A;  4OU0 A;  2ME0 A;  4KUM A;  2FSW A;  3U21 A;  4I02 A;  1YG2 A;  4UVA A;  1BOA A;  2JUG A;  3DPL C;  2HDC A;  5E18 F;  2K9Q A;  2ZKZ A;  2M34 A;  3KKD A;  4HRI A;  3RJP A;  4OIN F;  1OCT C;  1IXS B;  1RRJ A;  3RD3 A;  2VBY A;  3ZQQ A;  1FPQ A;  4YIF A;  1VQN I;  4HF1 A;  4G6Q A;  5CVR A;  3AL0 C;  3MNL A;  1BR1 A;  1S5L C;  3E1S A;  2IJL A;  4NC8 A;  4I01 A;  2O7O A;  2XPW A;  4LG0 B;  3DTE A;  4Y13 A;  2NNN A;  3ULQ B;  4EV0 A;  1YX5 A;  1I3A A;  3RSN A;  2QZ8 A;  2FRH A;  1MNM C;  2C6Y A;  2JA7 J;  2OU2 A;  5C44 J;  2YU9 J;  4G8X A;  3C3W A;  1O4X A;  4QTR A;  5GP9 A;  3DPT A;  2DA7 A;  1YJN I;  2OF7 A;  2PJR A;  3W2W A;  5EYR A;  1UEL B;  4A6E A;  2O6G E;  4JOM A;  3ON4 A;  3DKW A;  2EJR A;  4U7B A;  1IN7 A;  2Z99 A;  1JE8 A;  2EFW A;  4WX9 A;  4Y15 A;  4LG0 A;  3HE0 A;  1YW7 A;  2EZK A;  2Q2E B;  4M9X A;  4HNU A;  3IH4 A;  2A69 F;  4XKW A;  4G6D A;  4UB8 C;  2FBH A;  5B1B H;  2IP2 A;  2QA4 I;  1Z1D A;  4ZDO A;  1TT5 B;  4A3B J;  1G6N A;  2GOM A;  3ONQ A;  4BAY A;  2CQQ A;  3IWZ A;  2EFQ A;  3E5Q A;  2KT0 A;  2HWV A;  1IRG A;  3R0J A;  1TLH B;  2ZJ2 A;  3FHZ A;  3CCV I;  4L5I A;  3BY6 A;  1N75 A;  4XN3 A;  2IGK A;  2DQR A;  2KDO A;  2KFD A;  5DUK A;  1OJL A;  1YRN A;  1KGS A;  1XMK A;  2LF7 A;  4PGH A;  2IGO A;  4H0E A;  4CYD A;  3NNR A;  5EEG A;  2R7Z J;  3E6C C;  4CCL A;  1KON A;  1JHF A;  4ENJ A;  3HSR A;  3ZQC A;  3E5X A;  5DCM B;  4CZC A;  1Z3X A;  3CME I;  3G56 A;  3H3Z A;  4XID A;  3FXU A;  2KIQ A;  4J01 A;  1LDD A;  3TW7 A;  1EKE A;  3LNQ A;  4AIH A;  4U0Y A;  4J19 A;  3JRB A;  4IKF A;  3HGG A;  1YS7 A;  5DAJ A;  1SAX A;  2WAQ A;  2JUC A;  2W00 A;  1E3O C;  5EZG A;  1TWA J;  2P8T A;  2G7G A;  3KKC A;  1U5T B;  2VQL A;  4LGW A;  1EA3 A;  3MD2 A;  2CQX A;  3R4K A;  1SC7 A;  4HAM A;  2XF5 A;  2Y48 A;  3E0J B;  2W1O A;  2WWY A;  2W85 A;  2BXZ A;  4EVI A;  4AC6 A;  2ZJR F;  2XB0 X;  3O6B B;  3IKT A;  2OTJ I;  2RGV A;  4KNY A;  3L2C A;  1ZR2 A;  1Z0X A;  5DV5 A;  3V7R A;  1XX5 A;  2ACJ A;  3HTI A;  3E6B A;  4LMY A;  1PP7 U;  5E1X A;  3LQR A;  4A0Y A;  4D7M A;  1YJ9 I;  3NPI A;  1OCZ H;  2DMP A;  3U2R A;  3UKG A;  4E7S A;  2WB1 N;  1X19 A;  4F55 A;  3G7R A;  2H6B A;  4LG3 A;  4BBR J;  1ZN2 A;  2IXS A;  3VYT B;  3DEW A;  2VKV A;  1ACI A;  1ETK A;  2KKO A;  2F5E A;  2UXI A;  2ESH A;  2DAO A;  3PM1 A;  2MC3 A;  2XRL A;  2ZME B;  2ECC A;  1XGO A;  3TW6 A;  3KP7 A;  3CTA A;  3LA3 A;  3FIS A;  4S0H B;  4A3F J;  2CRG A;  3GF2 A;  2PFB A;  1CF7 B;  3HTH A;  1MSE C;  4CSW A;  4LLG F;  1SAN A;  2XHK A;  1D1C A;  5L3B A;  3F23 A;  2L7F P;  3GXO A;  2FU4 A;  2NVX J;  4NC6 A;  1A6I A;  3EGQ A;  1KU3 A;  4UVC A;  3J80 K;  1ZLK A;  2FUG 2;  4LB5 A;  4ZYA A;  1RR7 A;  5FFX A;  1MDM B;  2V7F A;  4CCO A;  2CU7 A;  2PMU A;  3B02 A;  2KIU A;  1QPM A;  4GRI A;  3ZCO A;  3BRU A;  1A36 A;  3E6D A;  3KNW A;  1TQI A;  4M6X A;  3BG3 A;  1U2W A;  4HSR A;  5EZH A;  1BL0 A;  1W4M A;  2NXN B;  3NWT A;  1I6X A;  4LJZ F;  3KET A;  2JN6 A;  4HNV A;  5FD6 A;  2ETH A;  3CJN A;  4CGZ A;  4PXI A;  2V9V A;  3VVY A;  5J40 A;  1ONV A;  3J7A O;  2A61 A;  4F52 A;  5D19 A;  4KN7 X;  2A6H F;  3HTS B;  4CH7 A;  2JVH A;  3CZ6 A;  2XF7 A;  4ZH4 F;  2FQ3 A;  2Y2Z A;  5D6E A;  1IUY A;  1YS6 A;  3VIB A;  4L9N A;  2NP3 A;  2D45 A;  3Q9V A;  5D8L B;  3KZ9 A;  5JVG F;  1D5V A;  1X1A A;  2ZY9 A;  1LFP A;  3FM3 A;  3CMM A;  2QQ8 A;  4NN1 A;  3H9Q A;  3I56 I;  4ENM A;  3H3U A;  3BP8 A;  1O7F A;  3F8N A;  3VOE A;  5ED4 A;  4I76 A;  2DFI A;  5CVU A;  4BE2 A;  2HVQ A;  2F4M B;  2ZME C;  1W0T A;  2ELH A;  4RB1 A;  2QSH X;  2LKP A;  1X4P A;  3TKY A;  1FZP B;  2OER A;  2YVX A;  2K3P A;  5GAH J;  2IS1 A;  3T5X A;  2CQ7 A;  2HR3 A;  2CV2 A;  1UHW A;  5JHU A;  2DA2 A;  4CIC A;  1BI2 A;  2DW4 A;  1KYW A;  4BH9 A;  4S05 A;  2PMZ N;  2BVM A;  3FXL A;  1JT0 A;  2O9L A;  2LNB A;  2QOP A;  1R23 A;  4U87 A;  4BDY A;  2VL8 A;  2EA2 A;  2L9S A;  4CCJ A;  3BNI A;  2RRE A;  2XF6 A;  5CVJ A;  2VOD A;  1FBU A;  3V78 A;  2BW3 B;  1ETY A;  1VQ6 I;  2RHA A;  4LIU A;  5F6F A;  2PG4 A;  5H9T A;  2RNG A;  2DOA A;  1OYY A;  4DNC A;  2EIN H;  1R1V A;  2Y0S N;  3LWF A;  1VQ7 I;  2DFF A;  1ZLJ A;  3FF5 A;  1IC8 A;  2ZO4 A;  3KZZ A;  3CJQ B;  2I10 A;  2W82 A;  3K4K A;  3LSG A;  5HNF A;  4KIS A;  4WXH A;  4UY8 I;  1XS9 A;  2H8R A;  3MZY A;  3F6O A;  2E34 A;  5DYM A;  3UNG C;  4JBA A;  5AIP A;  5E3O A;  3M8E A;  2R7X A;  4XKV A;  1PP8 F;  3SDG A;  1N77 A;  4EM1 A;  1E2X A;  3OMY A;  3IUO A;  3OS0 A;  2GXA A;  4N9I A;  5L3F A;  5F1R A;  4XQF A;  3QPL A;  1XMA A;  5JFR A;  4G6T B;  4NC7 A;  3BG6 A;  3PUB A;  1FNN A;  4C30 A;  4AVZ A;  4XRS A;  2X6Y A;  2R93 J;  2PBI A;  3MWM A;  2LRD A;  4BL0 B;  2B0L A;  4IEJ A;  1HW2 A;  2CO5 A;  1JTY A;  3MZ8 A;  4M3D A;  5HLT A;  1FOY A;  1XG1 A;  2MSY A;  4Y7N J;  1JXS A;  2XKP A;  1RES A;  3ZQ7 A;  1GVD A;  3H9J A;  2AS5 F;  2G9W A;  4B4C A;  1FBQ A;  2EFO A;  2V1N A;  3GFL A;  3J81 Z;  3WU0 A;  5GAD J;  4E7J A;  2EIJ H;  2XDV A;  2XGC A;  3S1R J;  2VBZ A;  4HOB A;  3OY9 A;  1MW7 A;  1B59 A;  5M3M J;  3HDD A;  4X1E A;  2WAD A;  4MQ9 F;  1WJE A;  4KJZ A;  4C9Y A;  2LY9 A;  5FGL A;  1X2M A;  3IL2 A;  2R7V A;  2IGM A;  2CW8 A;  3HRM A;  3VYU B;  1A35 A;  1JUP A;  3QPT A;  4YZE A;  3ECO A;  3ZMD A;  3WTT C;  2X6O A;  3OYG A;  4A3C J;  3AFH A;  4A3J J;  2MW8 A;  1Z77 A;  1UI5 A;  5J3L A;  2J5O A;  1T39 A;  3EYI A;  4MEX F;  1TNT A;  1MMG A;  1OR7 A;  3VEP A;  4MK6 A;  1SVM A;  5ICG A;  2M3A A;  3LJL A;  1V55 H;  2D1H A;  1T33 A;  4IRH A;  4XSX F;  2V6E A;  2FOK A;  2BE5 F;  3W6K B;  3Q0W A;  3EUH A;  1UMQ A;  4BQA A;  2OCE A;  4LLN A;  1L3L A;  3S93 A;  3OYD A;  3MKZ A;  3H1C A;  5CVV A;  5KK1 A;  1XN7 A;  3I58 A;  3V8J A;  4RGX A;  2PBX A;  4PGG A;  1Y8R B;  5C4X J;  1VQ8 I;  1T6S A;  1SD4 A;  1UG2 A;  5AON A;  3I54 A;  1O7L A;  2XAQ A;  3CJT B;  4XLP F;  2VPL A;  4A69 C;  2IW5 A;  4A3G J;  3E5U A;  3HOZ J;  2CUE A;  1TBX A;  4UXN A;  4FE7 A;  2HI3 A;  5IT3 A;  1LEB A;  3DBL B;  3V42 A;  2M87 A;  5LBQ A;  2NS8 A;  4ZDP A;  3KLN A;  2A3S A;  3HRU A;  3BDD A;  2VKD A;  5M5Y J;  1VQO I;  2DPU A;  2VBW A;  2X85 A;  1I5Z A;  2NNY A;  4ZYE A;  3CWR A;  4R1H A;  2NVQ J;  1FSE A;  4BNC A;  3TQN A;  3L7W A;  1FYL A;  4DYR A;  2O61 A;  1D3Y A;  4Y52 J;  1G2H A;  1H9G A;  1FP1 D;  4XKC A;  3I59 B;  2QLZ A;  3KEY A;  3PL8 A;  2FNP A;  3HBL A;  4B47 A;  2V4J C;  3AQT A;  4MQV A;  1SVL A;  2FJI 1;  4FX0 A;  2PZ9 A;  5FRM A;  2L7Z A;  5FMP A;  9ANT A;  3KX2 A;  3S17 J;  4BXF A;  2PMH A;  3PSI A;  4AU7 A;  4YEL A;  3RKY A;  5DS9 A;  3CD6 I;  3EUK L;  2W48 A;  1IO2 A;  2DJN A;  3A01 B;  3GYH X;  2HYJ A;  2VT2 A;  1XCV A;  4EEF G;  1ZAO A;  3WTW C;  4MGR A;  3LWJ A;  3ZMU A;  4CZZ A;  3PQJ A;  1K61 A;  5E1Z B;  1BR2 A;  4GCV A;  2MYS A;  4ZDL A;  4EM2 A;  1W0U A;  3DQV C;  3WGI A;  2DYR H;  2IA0 A;  1X2N A;  3QYE A;  3FXM A;  2WA0 A;  1Z3Y A;  2DDA A;  1IN5 A;  4XL9 A;  4CYC B;  5CPR B;  2H1K A;  3I55 I;  4IVN A;  3KP4 A;  4GFL A;  4Y33 A;  3SDB A;  2K40 A;  3HUG A;  1MND A;  5ILU A;  2V1D A;  4V2G A;  2R5Z A;  4ZZD A;  1NK2 P;  4IHS A;  3JRG A;  4P96 A;  3FXJ A;  2QSF X;  4IL6 C;  1HOM A;  4E6K G;  1R5I D;  2VJ4 A;  5HNH A;  3QPH A;  3MKW B;  4OAZ A;  5K5Q A;  4XK4 A;  1E3P A;  3VPR A;  2M7A A;  4XRF A;  3DU6 A;  2CFX A;  1D0Z A;  3EET A;  4HF2 A;  4GYI A;  3NI7 A;  3ZN0 A;  4A3D J;  3NS4 A;  4GCL A;  4IPA A;  3ML6 A;  3F8B A;  1M1E B;  1XSV A;  2N8G A;  1P6R A;  1S3J A;  4D1Q A;  4J00 A;  4U0V A;  2VQH A;  2JVG A;  4ESJ A;  3VOD A;  3WTZ A;  4OIQ F;  4DYQ A;  3GTQ J;  1J9I A;  1E17 A;  2X1C A;  2E71 A;  5FLX Z;  5GAE J;  2F5D A;  2NAZ A;  2L0K A;  2R7O A;  1DP7 P;  1OPC A;  3GTM J;  1MMS A;  4F7Z A;  1AOY A;  5EEH A;  1IUF A;  3BLY A;  1V5E A;  3WG9 A;  3PIP F;  3I4N J;  3F9K A;  3S14 J;  1B1B A;  5FKO A;  1RET A;  2H09 A;  3C2H A;  4JKZ A;  2MH2 A;  1T08 B;  2R7U A;  5ICF A;  5BNG A;  1IDY A;  3MKY B;  1MNE A;  5D4R A;  2R7T A;  3LSJ A;  2Q1Z B;  2FMY A;  3D5L A;  2DA1 A;  5TJJ A;  1BJA A;  3MFK A;  3CES A;  2R4G A;  4M3E A;  3I0T A;  1O3Q A;  5HS8 A;  5CW8 A;  3ABL H;  1RZ4 A;  2YUS A;  3VDX A;  3HL2 A;  3S3M A;  2E2H J;  3OYC A;  1EH7 A;  1GUU A;  1KU2 A;  4Z2Y A;  2F4O B;  3CCQ I;  5EF6 A;  4FX4 A;  2K3F A;  5A2Q K;  1U8B A;  2WUI A;  4CUG A;  2DT5 A;  2IBD A;  4BHB A;  3F8F A;  2V6C A;  3BZ6 A;  5EGO A;  2E5N A;  3NRV A;  3IH2 A;  5GTH C;  4HQE A;  2M9H A;  3CUQ B;  4NQW B;  4I0B A;  4CYC A;  3V7S A;  3SFZ A;  3ZMZ A;  4B8X A;  2VPR A;  2NS0 A;  2OTL I;  3GZ6 A;  2PN6 A;  4BAC A;  4ENK A;  3AKZ A;  2V1X A;  5DM7 F;  1V5G A;  5HLI A;  2JA2 A;  2WC2 A;  5D4S A;  3DBH B;  4F91 B;  4R8H A;  5IPA A;  3VW0 A;  3PQK A;  1J5Y A;  3HTU A;  4RAY A;  3BCG A;  3DEU A;  4EJT A;  3BHQ A;  2A5Y B;  3LSK A;  1D8J A;  4JP0 A;  3OL4 A;  2DT7 B;  1Z7U A;  2WTE A;  4RAG A;  3A1Y A;  4L9T A;  4ESB A;  2KDZ A;  2JSP A;  1BBY A;  2PJR B;  1IV8 A;  4G7O F;  2HS5 A;  3O2P E;  4D7N A;  2E1C A;  1MKM A;  3AAF A;  2GLO A;  2NRA C;  4YRV A;  4BQO A;  2PLY A;  2O0Y A;  3RPU A;  4A2U A;  2B9S A;  2A6E F;  4ZC3 A;  4D9J A;  3IC7 A;  1X1D A;  1GV5 A;  3BR1 A;  3OYN A;  5IT9 Z;  1AU7 A;  2YS9 A;  1T95 A;  1FMV A;  2R7Q A; 
#chains in the Genus database with same CATH homology
 2DMQ A;  2UXO A;  1UHS A;  1IJW C;  2DMT A;  3T6N A;  4UUS A;  3TW7 A;  2Y30 A;  2ECB A;  3LNQ A;  3RQI A;  4D5C A;  4J19 A;  2DTZ A;  3JRB A;  1FJL A;  3HGG A;  5DAJ A;  5K58 A;  4FE4 A;  2HYT A;  3BR5 A;  1E3O C;  3JRC A;  5EZG A;  5FLM J;  3ZQG A;  1TWA J;  2G7G A;  3KKC A;  1B8I A;  2WAQ N;  1H89 C;  2XB5 A;  2Q24 A;  2OPT A;  2CQX A;  4DW6 A;  1LE8 A;  5J1Y A;  1Y1W J;  4BXX J;  1QPI A;  4AC6 A;  1MBJ A;  2EZL A;  4LOC A;  4IHY A;  2XB0 X;  4L5E A;  2JA6 J;  3H3V K;  1F43 A;  1WGX A;  2HXI A;  4JNN A;  1ZR2 A;  1Z0X A;  3BTL A;  2QCO A;  4DZP A;  2HXO A;  1ZK8 A;  3HTI A;  4D7M A;  3NPI A;  4C2M J;  4A3M J;  3JRI A;  4M6V A;  2DMP A;  3E7Q A;  3CRJ A;  3UKG A;  1TWH J;  3MVP A;  3F0C A;  1ZR4 A;  1IRZ A;  2RAS A;  1VF9 A;  4XRM A;  2XDN A;  4X6A J;  3ANP A;  4W1U A;  1QRY A;  2WB1 N;  3TED A;  3C07 A;  5IYD J;  3G7R A;  5HOD A;  1ETQ A;  4XIC A;  5HBU A;  4BBR J;  1ZKG A;  1B72 B;  3DEW A;  3GTP J;  5F08 A;  2VKV A;  2VKE A;  1ETK A;  4MO7 A;  5EG0 A;  1ZGW A;  1XC5 A;  2G3B A;  3FK6 A;  4C3I J;  2UXI A;  3HIM A;  3PM1 A;  2XRL A;  2ECC A;  1DU6 A;  1NTC A;  3TW6 A;  1Q1V A;  3ZQL A;  3C2B A;  3FIS A;  4S0H B;  2CRG A;  3A01 A;  4A3F J;  1WCM J;  5F04 A;  2WV1 A;  1QVT A;  4AC0 A;  4A3E J;  3HTH A;  1MSE C;  2X48 A;  3BR3 A;  3BTI A;  3BTC A;  1SAN A;  2LKX A;  3Q3S A;  1HDD C;  2COB A;  2L7F P;  2OI8 A;  2JA5 J;  2L9R A;  2NVX J;  3L1P A;  3PPB A;  4MFD A;  1A6I A;  2NOG A;  3EGQ A;  5F27 A;  2X9D A;  4XRS G;  2EZI A;  3BG9 A;  2HOA A;  1RR7 A;  3FKI J;  4NDL A;  5IP7 J;  3BR0 A;  2CU7 A;  2K9S A;  5E3L A;  1RPW A;  3HEF A;  3BRU A;  2WGB A;  3KNW A;  2DN0 A;  1MSF C;  3BT9 A;  3BG3 A;  3BG5 A;  1TWF J;  5EZH A;  4M3B A;  1BL0 A;  3OOU A;  1JKR C;  2E2J J;  3HOU J;  2UXU A;  2NX4 A;  5M3F J;  2JN6 A;  2LFB A;  4HNV A;  3B6C A;  1JUM A;  1OCP A;  3O8G A;  1JKP C;  4PXI A;  3VVY A;  4C3J J;  5EG0 B;  2UXP A;  3VW1 A;  1WPK A;  3JRA A;  5D19 A;  2AHQ A;  3SFI A;  2Y9Z A;  3Q0U A;  4UDS A;  2B63 J;  2Y2Z A;  1CQT A;  3Q0V A;  2HOS A;  2EH3 A;  5C4J J;  3LSP A;  1PUF A;  3VIB A;  4FTH A;  3H0G J;  1JJ6 C;  2NP3 A;  5F0H A;  3FIW A;  3KZ9 A;  2EBI A;  2MG4 A;  2G7S A;  4B1R A;  1IG7 A;  3CMY A;  1JTX A;  3P9T A;  3S1N J;  4NN1 A;  2LLK A;  2LK2 A;  1DU0 A;  4I76 A;  4FCY A;  2IAI A;  3AQS A;  3HTJ A;  1W0T A;  1NK3 P;  5FHP A;  3ON2 A;  5FKN A;  1LE8 B;  2OER A;  3A03 A;  3TP3 A;  3JRF A;  3SJM A;  5E3M A;  3LOC A;  4JL3 A;  2HOT A;  1TWC J;  2DA2 A;  2K9N A;  2NVY J;  4ACI A;  1QVU A;  4C3H J;  2VUM J;  2R92 J;  2PMZ N;  2NVT J;  5IYC J;  5F1J A;  1JT0 A;  2O9L A;  5FLV A;  2QOP A;  3VVZ A;  5IYB J;  4JX4 A;  5IOZ A;  1VFC A;  3HOW J;  3BNI A;  2XGE A;  5M5W J;  3V78 A;  1ETY A;  3LSR A;  2RHA A;  3COL A;  3K7A J;  2P81 A;  1TWG J;  3O8H A;  4I6Z A;  3NRG A;  2ZCM A;  5H9T A;  2JK3 A;  4GCK A;  3ZQF A;  4DYC A;  1BW6 A;  2Y0S N;  4MFE A;  1JT6 A;  1IC8 A;  1SGM A;  2I10 A;  3E7L A;  3LSG A;  3JRH A;  3EUP A;  5F0C A;  1UI6 A;  1XS9 A;  3BR6 A;  5K7F A;  2H8R A;  4AUX A;  1ETX A;  2DA6 A;  2DA3 A;  3QPS A;  1R9T J;  3S15 J;  3A02 A;  3CJD A;  3G1O A;  1S7E A;  3IUV A;  4JX5 A;  4A3I J;  1K83 J;  5E3O A;  2LP0 A;  5EDN A;  3GTO J;  1HCR A;  3SDG A;  2EZH A;  3S2H J;  1GV2 A;  2NP5 A;  1B72 A;  2FX0 A;  2LTP A;  2VI6 A;  3LHQ A;  3S2D J;  2CJJ A;  4JX6 A;  3QPL A;  2ZCN A;  2E2I J;  1MBG A;  4UUS B;  4ME9 A;  2NS7 A;  2D5V A;  2M8G X;  4XRS A;  2R93 J;  2M2E A;  4RDU A;  3HGY A;  3CQZ J;  4B3A A;  4MIM A;  5IOY A;  5EEA A;  4IEJ A;  1VND A;  4M3F A;  2JWT A;  1JTY A;  2R5Y A;  4M3D A;  3W6V A;  1H8A C;  1ORK A;  1XG1 A;  2MSY A;  2LVS A;  5D18 A;  5FKM A;  2IEK A;  4Y7N J;  3QBM A;  3WHC A;  1RES A;  1RKW A;  3CDL A;  1GVD A;  3S5R A;  3OSF A;  2L7M P;  4B4C A;  4BBS J;  1FTZ A;  1IGN A;  1HLV A;  2V57 A;  1MBH A;  5K7H A;  2XGC A;  3S1R J;  3VOK A;  3HDD A;  5EFY A;  1WH5 A;  5M3M J;  2IU5 A;  3O60 A;  1ETV A;  3GBG A;  4X1E A;  3GTG J;  2E1O A;  3HKZ N;  4BY7 J;  2LY9 A;  3JR9 A;  5FGL A;  1X2M A;  4AYB N;  3GZI A;  1PUF B;  2ME6 A;  3G1M A;  3HOX J;  2R0Q C;  2JA8 J;  4DZJ A;  5JLW A;  1JUP A;  2DA4 A;  3PO2 J;  3IV5 A;  4YZE A;  2X6O A;  3MKL A;  2QWT A;  1BW5 A;  4A3C J;  4A3J J;  1IV6 A;  2MW8 A;  2QIB A;  1Z77 A;  1UI5 A;  5J3L A;  3TP0 A;  3RZO J;  3S16 J;  4MK6 A;  2YVH A;  4CGR A;  3LJL A;  3QKX A;  4M3G A;  1T33 A;  1U78 A;  1BJZ A;  2XSD C;  3Q0W A;  1UMQ A;  1APL C;  3VUQ A;  1JGG A;  1MBK A;  2MGQ A;  3ANG A;  3RZD J;  3MN2 A;  1HF0 A;  5HAW A;  2PBX A;  4HKU A;  5C4X J;  1UG2 A;  3RH2 A;  3BTJ A;  1WH7 A;  1P7I A;  4A69 C;  3ZQI A;  4A3G J;  2FQ4 A;  3HOZ J;  1VI0 A;  3M3Y J;  2CUE A;  2CUF A;  4FE7 A;  3OSG A;  5E3N A;  1I6H J;  2HI3 A;  2NS8 A;  1ZQ3 P;  3BQY A;  5K7Z A;  5M5Y J;  5FKL A;  2JJ7 A;  3CWR A;  2LD5 A;  1GT0 C;  3VVX A;  2NVQ J;  4UUT A;  5F0F A;  3RKQ A;  2DMN A;  4DYR A;  4Y52 J;  1G2H A;  4JYK A;  4A3L J;  2FJ1 A;  3B6A A;  5IP6 A;  3PAS A;  3NAR A;  1WI3 A;  1IDZ A;  1HDP A;  3VP5 A;  2JMW A;  2XPU A;  2DA5 A;  3HBL A;  2W53 A;  3GEU A;  3AQT A;  4KWA A;  2PZ9 A;  2L7Z A;  4NEL A;  1ENH A;  5FMP A;  9ANT A;  2RAE A;  1ZTR A;  3S17 J;  2QF7 A;  3HB9 A;  1JKQ C;  1D5Y A;  3QQA A;  5DS9 A;  2GBY A;  2W48 A;  3JRE A;  3PO3 J;  2DJN A;  3A01 B;  2HYJ A;  4A93 J;  2HKU A;  3ZOB A;  2GM4 A;  5AQC A;  1A5J A;  1MH4 A;  4EEF G;  3NAU A;  2QTQ A;  1ETO A;  3LWJ A;  2Y9Y A;  2TCT A;  5J1R A;  1K61 A;  1JUS A;  2F07 A;  3GTL J;  3S1M J;  3JSJ A;  4L62 A;  1W0U A;  3GTK J;  2REK A;  1MBF A;  3BJB A;  1X2N A;  4CYC B;  2H1K A;  4MLO A;  4BKX A;  5C3E J;  1JJ8 C;  4GFL A;  2E19 A;  2XGD A;  2K40 A;  3HM5 A;  3NXC A;  4ICH A;  4V2G A;  2D6Y A;  5JLX A;  5GPC A;  2R5Z A;  1F36 A;  1FTT A;  1NK2 P;  3FRQ A;  5CXG A;  2O7T A;  3JRG A;  1H88 C;  1HOM A;  1MH3 A;  1I50 J;  2G7L A;  4IHX A;  3VW2 A;  4XK4 A;  1FIA A;  3VPR A;  2GFN A;  1T56 A;  2O8K A;  2EQR A;  2DMU A;  3K2A A;  3NI7 A;  4A3D J;  1Y1V J;  2ZOY A;  4GCL A;  4V2F A;  3I4M J;  1GDT A;  1B8I B;  1I3Q J;  1BA5 A;  2QKO A;  4W97 A;  2N8G A;  4GCT A;  1P7J A;  1TC3 C;  5CXI A;  1U9O A;  2DG7 A;  2FBQ A;  3HTA A;  3V6G A;  4DYQ A;  5C4Y A;  3GTQ J;  2ME0 A;  3B81 A;  5IP9 J;  3G1L A;  4MXM A;  2K9Q A;  2ELK A;  2L0K A;  2M34 A;  3OIO A;  1AHD P;  3KKD A;  3GTM J;  1OCT C;  1YRN B;  1FEX A;  3RD3 A;  1ETW A;  2HQ5 A;  5EGO B;  1IUF A;  5D1R A;  2ID3 A;  4FIS A;  3I4N J;  4QIW N;  3S14 J;  3MNL A;  5FKO A;  1RET A;  3FK7 A;  4JKZ A;  3S1Q J;  4G12 A;  4RBO A;  3DCF A;  5BNG A;  1IDY A;  2ZB9 A;  2ZOZ A;  3BQZ A;  3LSJ A;  2YVE A;  1SFO J;  2O7O A;  2XPW A;  2DG8 A;  3F1B A;  1FIP A;  2R5Z B;  2DA1 A;  3GTJ J;  1AKH A;  1AKH B;  2JA7 J;  1MNM C;  5FJ8 J;  5CW8 A;  4M3E A;  5C44 J;  4BY1 J;  2YU9 J;  1X58 A;  1O4X A;  2YUS A;  4QTR A;  5FKK A;  5GP9 A;  2E2H J;  2DA7 A;  3BR2 A;  1GUU A;  2OF7 A;  5EYR A;  5EF6 A;  3D1N I;  2ZCX A;  2ID6 A;  1U8B A;  2R5Y B;  4IHW A;  4A3K J;  2IBD A;  2TRT A;  5EGO A;  2WUI A;  3ON4 A;  2GUH A;  1POG A;  1LFB A;  5DTD A;  3IH2 A;  2M9H A;  3HE0 A;  3VOX A;  2EZK A;  4QSH A;  3IH4 A;  4GFK A;  4CYC A;  2GEN A;  2FD5 A;  3HOY J;  2AO9 A;  2VPR A;  5HSZ A;  1RKT A;  3M4O J;  1EF4 A;  1OFC X;  2HDD A;  4A3B J;  3HOV J;  2CQQ A;  1ITY A;  3VW0 A;  5IPA A;  1LFU P;  2M0C A;  4IHV A;  2UXH A;  2LR8 A;  2KT0 A;  3BCG A;  1JKO C;  3JRD A;  3BHQ A;  5M5X J;  2G0E A;  3IH3 A;  1OJL A;  4JP0 A;  1YRN A;  1MBE A;  5J1U A;  2KDZ A;  2Y31 A;  3CCY A;  4ABZ A;  4D7N A;  4AF5 A;  5GPA A;  2GLO A;  2XPV A;  3DPJ A;  3NNR A;  2R7Z J;  4D5F A;  1GV5 A;  3BR1 A;  3ZQH A;  1AU7 A;  4GFB A;  1U9N A;  3ZQC A;  2YS9 A;  3G56 A;  4XID A;  3WHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...