2Y30A

Simocyclinone d8 bound form of tetr-like repressor simr
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
242
structure length
227
Chain Sequence
EPVSIWMLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PUTATIVE REPRESSOR SIMREG2
publication title Structures of the Tetr-Like Simocyclinone Efflux Pump Repressor, Simr, and the Mechanism of Ligand-Mediated Derepression.
pubmed doi rcsb
source organism Streptomyces antibioticus
total genus 85
structure length 227
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y30A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2y30A02
2R5YA 1MSEC 3DCFA 3IV5A 2WB1N 1VNDA 3FISA 3NPIA 4A3KJ 2XSDC 1TWCJ 1LE8A 4CYCB 3HOYJ 1HOMA 4ICHA 4JP0A 1JGGA 4IHYA 1LFBA 2FD5A 2VPRA 3T6NA 4AC0A 1Y1WJ 3MVPA 4FISA 3L1PA 1UHSA 3QKXA 1ETXA 5IP9J 3VOKA 4JL3A 3LSGA 1DU6A 2K9SA 3JSJA 3G7RA 4AF5A 2EZIA 2MG4A 4XICA 5FMPA 4BBRJ 4D7NA 5EYRA 3NRGA 5E3MA 3ZQFA 4MIMA 2CQQA 2NX4A 3F0CA 2EQRA 3HOUJ 2GLOA 2ME0A 3BR1A 1AHDP 3EGQA 1AKHB 2IEKA 2EZKA 4ABZA 5CW8A 3JREA 3BR5A 2AO9A 2HI3A 3G1MA 5IYBJ 1B8IB 1QPIA 2JWTA 1IV6A 2OERA 1YRNA 4A3MJ 4DYRA 5EG0B 1JKQC 1OCPA 4XRSG 4M3DA 4DW6A 5E3NA 5D1RA 2OPTA 5J1YA 2JJ7A 4BY1J 1AU7A 1W0TA 3BR6A 4G12A 2YU9J 2QTQA 2K40A 1TWAJ 2I10A 4C3JJ 2QOPA 3CRJA 5FLVA 4Y52J 3W6VA 3S15J 2D6YA 2WUIA 1MBEA 1GV5A 3B6AA 2UXHA 1MBFA 2FQ4A 4GCTA 2NP3A 3CDLA 4W1UA 1VF9A 1HF0A 2NVTJ 2WAQN 4HNVA 2Y0SN 4D5CA 5EDNA 1JUMA 2XRLA 3GBGA 3KZ9A 3VW1A 3VW0A 2JA6J 4DYCA 1GDTA 3BNIA 3KKCA 1IC8A 4L62A 3JRIA 4FE7A 3O8GA 5M3FJ 2E2JJ 3RKQA 3RQIA 2RHAA 2GM4A 3NARA 4YZEA 2K9QA 4RBOA 3ZQLA 2LD5A 1FTZA 2L7FP 2HDDA 4UUTA 1JJ6C 2O7TA 3D1NI 1NK3P 3TP3A 2LP0A 4DZPA 3A02A 1BW6A 1UMQA 2EZHA 4QTRA 3LOCA 2R92J 9ANTA 2DA2A 3JRCA 2DJNA 1TC3C 4A3IJ 3FIWA 1FTTA 1UI6A 3HIMA 4XRMA 5HSZA 1E3OC 3BTJA 1A5JA 2ZB9A 4XK4A 2HKUA 3C07A 1T56A 5H9TA 2K9NA 1ETOA 4DYQA 5F08A 3UKGA 4BXXJ 1WI3A 1ZGWA 1MH4A 1WH7A 4M6VA 5HBUA 5J1UA 2Y9ZA 4Y7NJ 3GTPJ 3RZOJ 2R5ZA 3SFIA 2XPVA 4MXMA 4A3FJ 1ITYA 1JTYA 5GP9A 2JK3A 2XGEA 4GCLA 4FTHA 5FKNA 1ETQA 5F27A 2KDZA 1PUFB 2NVQJ 3VP5A 3LSPA 3HOVJ 4MK6A 2P81A 2ID6A 4AC6A 2DMQA 1MBJA 2MSYA 3GZIA 1O4XA 1ZKGA 1ETWA 1U9OA 5CXIA 3BR2A 4FCYA 5M5XJ 4JX5A 5EZGA 3I4MJ 3LSJA 3CJDA 2E2IJ 4LOCA 3NAUA 4BKXA 2DA5A 3BTCA 4B1RA 3HE0A 4MFEA 2LVSA 1I3QJ 1JT0A 1ZR4A 2M0CA 4EEFG 3JRDA 3OOUA 3VVXA 1P7JA 1OJLA 2Y31A 1SANA 3NI7A 1QVTA 1VI0A 4B3AA 3VW2A 2R5ZB 1GT0C 2R7ZJ 4IHWA 3BCGA 3KNWA 1FIPA 1QVUA 4L5EA 3EUPA 3HDDA 3HM5A 2YVEA 3FRQA 1RESA 3NNRA 1MSFC 5D19A 1K61A 4B4CA 1IUFA 2R0QC 5CXGA 3F1BA 1U78A 3PM1A 2ECBA 4GFLA 2QWTA 2O7OA 1MBGA 1X2MA 3TW6A 1ZR2A 3A03A 4IHXA 2DA4A 2XB5A 3QQAA 4NN1A 3AQSA 2N8GA 1XS9A 2FBQA 3QBMA 3GTGJ 2EBIA 4M3GA 5E3LA 3BJBA 3GEUA 2L7MP 3WHBA 3BRUA 2CJJA 4C2MJ 5IOZA 3FKIJ 3VVZA 1HDPA 1UI5A 3VVYA 3HOZJ 3FK7A 2HXOA 2WGBA 2GUHA 2XDNA 2R5YB 3LWJA 3HBLA 2ZOYA 1F36A 2Y2ZA 4UUSA 2FX0A 1K83J 1TWFJ 5EEAA 2QKOA 4JNNA 3RD3A 1Z77A 3AQTA 3HTIA 3S1RJ 3PPBA 3CMYA 1LE8B 2M34A 2HOTA 3A01A 2DTZA 3KKDA 4KWAA 2DA6A 2ME6A 4IHVA 5FLMJ 2HYTA 3ZQCA 2YUSA 3GTMJ 4A3BJ 3GTKJ 2NS7A 3BT9A 1D5YA 4M3EA 1B72A 4I76A 1G2HA 5DS9A 2G7SA 3VPRA 2M9HA 2YS9A 4NDLA 3ANGA 2TRTA 2X9DA 1GVDA 1OCTC 4X6AJ 1H88C 1UG2A 5EGOA 5E3OA 2DMPA 4A3GJ 3WHCA 5F0FA 1YRNB 5JLWA 4A3JJ 1Z0XA 3S17J 1BW5A 2H1KA 2TCTA 2CUFA 3Q3SA 1SGMA 2FJ1A 3MKLA 1MBHA 2X6OA 3QPLA 1JJ8C 4FE4A 4GFKA 2ZCMA 1RPWA 5IP7J 2CQXA 4XRSA 5K58A 2LFBA 2XGDA 2W48A 2DMTA 1ORKA 5FJ8J 5C4YA 5C44J 2CUEA 5FKKA 3TW7A 3HKZN 3HTAA 2CRGA 5F04A 2E2HJ 4A3EJ 1QRYA 5EFYA 1U9NA 2ZCNA 2OF7A 4A3LJ 2JA5J 3GTJJ 3G1LA 3S1QJ 1IDZA 1W0UA 3S2HJ 3DEWA 4MFDA 2PBXA 3JRFA 2PZ9A 2MW8A 1CQTA 2LK2A 2VUMJ 2X48A 1JKPC 3SJMA 2ELKA 5IYCJ 3OSFA 2JA8J 2NOGA 3ZQGA 3HTHA 3H3VK 1JUPA 5FGLA 1HCRA 3HOXJ 5DAJA 3COLA 2QCOA 4C3HJ 2DMNA 2ECCA 2LTPA 3RZDJ 4GFBA 3C2BA 5FHPA 2GBYA 1MBKA 3GTQJ 2PMZN 2JN6A 2G3BA 3VIBA 4MLOA 4A93J 5M3MJ 2DG8A 2Y9YA 2EH3A 3ZQIA 3S2DJ 2DA1A 4JX4A 2IBDA 5M5WJ 4HKUA 1GV2A 4CYCA 1JKOC 1JKRC 3K2AA 3E7QA 1RR7A 2HOAA 5K7FA 2UXOA 2E1OA 5HAWA 3BQYA 4M3FA 3BTLA 1IGNA 2Q24A 2UXUA 1OFCX 2ID3A 5C3EJ 1APLC 3ON4A 4A3CJ 1WCMJ 5JLXA 1H89C 2NVXJ 1ZK8A 1X2NA 4RDUA 3LNQA 3I4NJ 4UDSA 2YVHA 3BR0A 2QF7A 1XC5A 2UXPA 3RH2A 2UXIA 3S1NJ 1ETKA 4QSHA 3HGYA 5IOYA 5C4XJ 4C3IJ 2COBA 2E19A 2HXIA 3CCYA 3FK6A 3IH2A 1B8IA 2DA7A 4XIDA 3ON2A 2HYJA 1VFCA 4BBSJ 2ZOZA 5EG0A 2W53A 5IPAA 1ZTRA 3JRBA 3K7AJ 2ZCXA 4D7MA 3HGGA 4JKZA 2M2EA 1HLVA 5K7HA 1NK2P 5IP6A 4BY7J 2GFNA 3PASA 5IYDJ 2IU5A 2NS8A 1TWHJ 1S7EA 3JRAA 2WV1A 4J19A 4D5FA 2OI8A 2XGCA 3BG9A 1ZQ3P 3S5RA 1BA5A 3BG3A 1MNMC 1LFUP 1XG1A 3BTIA 3G1OA 4AUXA 1IJWC 2REKA 3IUVA 2V57A 4S0HB 2L9RA 5FKMA 4ACIA 2MGQA 4IEJA 2L0KA 2HOSA 5F0CA 2XPUA 3JR9A 3LJLA 4QIWN 3BG5A 3JRGA 3O8HA 4JX6A 3BQZA 1X58A 1H8AC 1WPKA 1IDYA 5GPCA 4DZJA 5AQCA 2DN0A 3E7LA 1HDDC 1Q1VA 1IG7A 2Y30A 2D5VA 2RAEA 3B6CA 2LKXA 4MO7A 2F07A 1MH3A 4UUSB 1R9TJ 5GPAA 1T33A 2VKEA 5HODA 3S16J 3IH4A 3P9TA 2G7GA 4A3DJ 2L7ZA 4PXIA 2HQ5A 3A01B 1RETA 2O9LA 4V2GA 3DPJA 2M8GX 1WH5A 3GTOJ 3S14J 1RKWA 3S1MJ 5FKOA 2QIBA 1FIAA 2NP5A 3ZQHA 2XB0X 3Q0VA 1B72B 3HEFA 2XPWA 3TEDA 3SDGA 3HB9A 3QPSA 3NXCA 3GTLJ 3TP0A 3B81A 2G7LA 1GUUA 1I50J 5J3LA 3ANPA 5EGOB 2IAIA 4CGRA 2O8KA 1BL0A 3G56A 1PUFA 3IH3A 5J1RA 5K7ZA 2DA3A 2EZLA 4ME9A 2JMWA 1NTCA 1POGA 5BNGA 3HTJA 3V6GA 1TWGJ 5F0HA 2LY9A 3VUQA 1RKTA 2VKVA 2GENA 1P7IA 5F1JA 3M3YJ 3VOXA 1JTXA 3Q0WA 3OSGA 2B63J 2LR8A 1DU0A 4I6ZA 3CWRA 1JUSA 1Y1VJ 1IRZA 5M5YJ 1SFOJ 1BJZA 1ETYA 3CQZJ 3BHQA 3LSRA 5EZHA 1ENHA 3PO3J 2DG7A 4V2FA 1EF4A 2DMUA 1ETVA 4AYBN 2R93J 3BR3A 5DTDA 4NELA 1JT6A 1FJLA 3M4OJ 2AHQA 2LLKA 3PO2J 5EF6A 2KT0A 3Q0UA 3ZOBA 1WGXA 2H8RA 3LHQA 1I6HJ 3MN2A 4JYKA 1F43A 1A6IA 2G0EA 1FEXA 2RASA 3MNLA 5C4JJ 4M3BA 2CU7A 4X1EA 2VI6A 3O60A 3OIOA 4A69C 4GCKA 3H0GJ 4W97A 3JRHA 3V78A 5D18A 2JA7J 1AKHA 3HOWJ 1U8BA 5FKLA 2NVYJ
chains in the Genus database with same CATH superfamily
4DQ2A 1W4MA 1ULYA 3ELKA 1TTYA 5E18F 1BR1A 2UZKA 5BMZA 3FBIB 3FISA 4A3KJ 5JFRA 1XMAA 1L0OC 1HOMA 4CH7A 2VQHA 2BY0A 3HRSA 4AC0A 1Y1WJ 3MVPA 2FOKA 4FISA 1UHSA 2E7XA 2K86A 3GUDA 5DD4A 2OTJI 1W7PA 4HX4A 5HVQC 4KISA 2MG4A 5IT3A 4H4KC 4XICA 3EQLF 4BBRJ 1IRGA 4Y4RA 5CJ9A 5HLHA 1U5TC 2A2FX 2NX4A 2UV1A 1Z1DA 3F0CA 1SMYF 4M9XA 2GLOA 4IRVA 2ME0A 2ZNYA 4E6KG 4EGYA 2EFWA 2EZKA 5CW8A 2WY7Q 2HI3A 3M8FA 1FOWA 2CW7A 3A4CA 1QPIA 2JWTA 1IV6A 3T0YA 2C6YA 1JKQC 4DW6A 4C2TA 3EUAA 4AIJA 5B5EC 4ASNA 2EWNA 4LLNA 1Y8RB 3CZ6A 2QTQA 3S2WA 4WF2A 2I10A 4C3JJ 1N25A 3F8MA 3CRJA 1D1AA 3BPXA 4Y52J 4II3A 1W7PD 2VBXA 3CF5F 4N9IA 4P1WA 5KAFC 2WUIA 2E34A 4UV8A 4UV9A 2UXHA 4EQQA 4GCTA 2MBFA 2BXZA 2GIZA 1PP7U 2EV6A 2NVTJ 1MGTA 4HNVA 4LK0F 4ESFA 4AIKA 1EH8A 1MJAA 4ON0A 2MLGA 4DYCA 2PQ8A 5DD8A 1GDTA 3VTIA 5CQEA 3KKCA 1IC8A 2BEOA 3J7AO 1I1GA 5M3FJ 2CQNA 1BR2A 2K85A 4RBOA 3DBLB 3RIRA 3BZKA 2QENA 2DFIA 3LL7A 1IN6A 4UUTA 2DLLA 3D1NI 2IRFG 2KIFA 2HTJA 2DDAA 4QTRA 3EGQA 1FTTA 1UHWA 2DJNA 1P6RA 3FIWA 1LJ9A 1VQ8I 4ZYEA 3K2ZA 3K4KA 1E3OC 1HKQA 5LEJA 1QPMA 4IL6C 3WTWC 4BE1A 3ZMVA 1ETOA 3MKZA 1V4RA 2IVMA 2W84A 4BEHB 2XF7A 3CMAI 1WI3A 1ZGWA 4RB2C 3I64A 3E6CC 3DF8A 1H0MA 4CUGA 2Y9ZA 4I09A 3K1PA 3OYJA 5JR3A 1R71A 1N78A 4MXMA 2ZC2A 2LMDA 4I01A 2E1MC 4K2EA 4GCLA 1GXQA 5JHUA 1IN4A 1KQ0A 3HOVJ 3J81K 2MSYA 2YR2A 3I58A 4G7HF 1B59A 1ETWA 4ZTFA 1O4XA 5CXIA 2QKLB 4PDKA 3I4MJ 4RLFA 2D45A 3P9KA 3ZN0A 2PJRA 1SD7A 4WXDA 1OCCH 4B1RA 1C0WA 3GFMA 4MFEA 1G59A 1YHQI 2FNAA 4AVZA 1S29A 5AONA 1VQPI 1OJLA 2FRHA 2CSOA 3GXOA 2DXIA 3VW2A 2R5ZB 1OPCA 4QLCU 1KZHA 4IHWA 4E7SA 3BCGA 4XOPA 3F23A 1QVUA 5KVRA 2HU9A 3OL4A 3EUPA 1I6XA 2LREA 3I59B 4KIGA 3QOPA 2M45A 1RESA 2XAGA 1CF7B 3OS0A 1MSFC 5DDGA 2YX4A 2X0LA 3OR2C 1D0YA 3OYFA 3PSFA 3PM1A 3MKWB 4LJZF 1D1BA 2O7OA 1R5HA 1DDNA 3MEXA 2G7UA 1ZR2A 4BACA 3DFGA 3A03A 4IHXA 2BV6A 2DA4A 1YS7A 2XB5A 3QQAA 5H6QA 1LEBA 1UB9A 2X1DA 1ZLKA 3V8LA 2AQEA 2FBQA 4M3GA 4L18B 2R7OA 2O5RA 4IRHA 3GEUA 1SAUA 2ZSHB 3EDPA 3WHBA 3KE2A 2QBYA 5IOZA 3FKIJ 3H92A 3COAC 3FK7A 2WGBA 3WTYC 3DU6A 1SEUA 2ZOYA 5EEAA 3HSRA 3VSLA 4JNNA 3K1NA 2WB1A 1GVJA 2JRMA 3S1RJ 3NWSA 2ZJQF 2M34A 2GA2A 1IW7F 3KKDA 4H0EA 4KWAA 2DA6A 2ME6A 3KEQA 1HW1A 5CVVA 5E79C 1Z91A 4Y15A 2KL4A 1FYMA 1PDNC 1XCVA 2ICWG 1SVOA 4CCMA 1HKTA 3MMYB 2CV0A 2PLYA 4ZJZA 3BT9A 2KKOA 1G2HA 2G7SA 5L3EA 3PQKA 2A07F 1QO0D 3ANGA 2X9DA 5LGTA 1GVDA 2BE5F 3HUGB 1U5TB 1SFEA 1H88C 4MEYF 4PCQA 1G8XA 1MJ9A 3FBNB 4A3GJ 3ZMZA 1YRNB 4HW0A 5JLWA 3PSIA 2XROA 1P92A 1R1TA 2WV0A 2YPRA 3IP4B 4KFCA 3JW4A 3FMSA 2H1KA 2TCTA 2CUFA 2OQRA 2EA2A 2CV2A 1YW7A 3QODA 4ESJA 3ZMDA 1HC8A 3VYTB 3V8KA 4EM0B 4YIIA 5FJ8J 3Q9SA 3T5XA 3CUQA 3G4SI 3B73A 2WAQA 5F04A 2XV4S 5EFYA 4ESBA 1W36C 3G1LA 3S1QJ 2DT7B 2DDBA 2Z16A 1R5ID 3DEWA 3CCQI 3RCOA 2PBXA 2RVCA 3IUOA 4HAMA 3JRFA 1CQTA 2GOMA 4P9FA 1YW9A 3H9JA 2X48A 1VQ7I 3SJMA 4U7BA 5IYCJ 1MNEA 2NOGA 4YG2F 3HTHA 3H3VK 1JUPA 3K8PC 5FGLA 3BLYA 1OMIA 3BJOA 1ZHFA 2QCOA 4B47A 3OYDA 2VE8A 3M1CA 1Y0UA 2W57A 2ZMEA 3F6OA 3LMMA 4A2UA 1EKEA 3GTQJ 5D5UB 4Y13A 3PUFA 2HNHA 3KEYA 3KYLA 2DG8A 2BGCA 2IBDA 5M5WJ 1HBXG 3C7JA 4KIFA 2CYYA 2W4SA 1E0EA 3BJ6A 4IF4A 5CVIA 1DGWY 1QNTA 4IXAA 1JKRC 5GAGJ 3QYBA 4ITVA 1LNWA 3OV8A 2HOAA 1E2XA 2G9WA 5K7FA 2UXOA 2E1OA 5J47A 4JQFA 5HAWA 1TT5B 3BQYA 4IKFA 1SFKA 2ISYA 4N0BA 5ILVA 1S6LA 2DYRH 2E1MB 4A6DA 2ID3A 3KZZA 4RM3A 2ZY9A 3AG2H 4OD4A 3RYRA 1ZK8A 2CW0F 1X2NA 1D0XA 4M9ZA 3H9QA 4HA8A 4NHJA 3I4NJ 4UVBA 2UXPA 2A69F 2P6SA 3CLQA 2DT5A 2QVOA 4KDPA 3BG7A 2ZNZA 2R7SA 5FRMA 3FXLA 5C4XJ 3IH2A 2HXIA 2KLOA 3FK6A 4J01A 4ZYDA 2ZBKA 4XIDA 2HYJA 3GFJA 1VFCA 3FKJA 5KAIC 1EJ9A 2KMUA 1FBQA 3K7AJ 1UFMA 3DKWA 3OMYA 4D7MA 1XMXA 1HLVA 5K7HA 1NK2P 4MNUA 5IP6A 3RDIA 3V7RA 4E7HA 2IU5A 3S32A 3HOTA 1JXSA 3MCZA 1TWHJ 1S7EA 3VB2A 1T08B 4PFPA 3D5LA 4R8HA 4M9SA 3JRAA 2P5LC 4J19A 2OI8A 2XGCA 5HOOA 1V5EA 4HOBA 1BOBA 1LFUP 1XG1A 4AUXA 1MNMC 1FBSA 1Y8QB 4BHPA 2L01A 5E8IA 2ZXJA 2HOSA 1ZH5A 1JHHA 2FSWA 1BN5A 3C1DA 5F0CA 1WJDA 1T6SA 2OJED 3DBHB 3BQZA 3LQRA 3SEZA 1LUJB 3BCAA 2MABA 4L9JA 4BXUA 4EJWA 1HDDC 4ENNA 2L5QA 2KRFA 2D5VA 1UG0A 2RAEA 3BROA 1MH3A 1R9TJ 3OYGA 4EM1A 2FBKA 3ABTA 2VKEA 2OA4A 3ABMH 3SHFA 2X85A 3FXRA 5E1ZB 1UJ8A 4PXIA 3A01B 2O9LA 1I1SA 2HTSA 1OQYA 2ZJ2A 3S1MJ 4QPOA 2PBIA 5J4VA 3ZQHA 3RKYA 4BEHA 1UAAA 1D0ZA 2XUBA 5A2QZ 1B72B 2XPWA 5H2FC 2R7RA 3ZN1A 3TEDA 4KYWA 2ELJA 3HB9A 2EA4A 5BPDA 2FBHA 3NXCA 2QWWA 4UVCA 4F55A 3B81A 2G7LA 3W2VA 5J3LA 3VODA 2OC6A 1TQPA 3CJRB 4N9HA 2V9VA 5EGOB 1Z7LA 2O8KA 4CGRA 3HRUA 2MD5A 5J1RA 3V7CA 5HDNA 1YITI 3K69A 3H5RA 4M6YA 4DIQA 3LSIA 3TGNA 4NQWB 1RKTA 3R6SA 1FWZA 3WU0A 1DUXC 1IV8A 3WODF 4YFXF 4HYEA 2VONA 1HA8A 4HF1A 2B9SA 3OSGA 4G6QA 2NNYA 3QAHA 3CWRA 3P7NA 4CA0A 3GFLA 2IGMA 1U2WA 2KZVA 5DYMA 1OYYA 2CH0A 4F93B 2IGOA 4A5MA 1RIOH 3HTSB 1AA7A 3V42A 1OISA 2IA0A 3OIQA 1VQLI 3CCEI 3L2UA 2EIJH 1HXDA 5FRNA 2QZ8A 1MMSA 3S8PA 3I59A 3I71A 3ASNH 1R58A 1CF7A 3I5UA 5DTDA 2ZJPF 3IC7A 4NELA 4EVIA 2QSGX 5EF6A 2KT0A 1X1BA 3GZNB 1TW3A 3ZOBA 1YG2A 2XGXA 3SDBA 2B7EA 4JYKA 1F43A 2G0EA 1FEXA 1K4SA 4M3BA 2F5CA 2FA5A 2XAQA 4GYIA 3O60A 1R49A 2FEZA 2M4GA 2CUZA 4GCKA 4W97A 3BDDA 3ERMA 4PZJA 3JRHA 5D18A 2JA7J 3D0SA 5FKLA 2HZTA 5L3DA 1TNTA 2PMZA 3KP5A 1YS6A 3DCFA 1XN7A 2WB1N 3IV5A 2DQRA 1MSEC 2VBZA 3EYYA 3OL3A 4AYBA 3FMRA 1XPXA 3DWLE 3GVAA 1BOAA 1X3UA 4XLAA 4DGWB 3CCSI 3ZPLA 3HOYJ 4ICHA 5F1RA 4IHYA 2VPRA 4G6TB 2L4MA 5HNHA 3WU1B 1YI2I 1ETXA 5IP9J 3LSGA 3VEPA 3O3KA 2A61A 3FMQA 2EZIA 3V7SA 5FMPA 4A6EA 4D7NA 4OWRB 5EYRA 3FXJA 2DFHA 3BZ6A 2CQQA 3HUGA 1U5TA 3BP8A 2H8WA 2IEKA 4LMYA 3OWTA 3PNVA 3TO7A 1WVRA 4ABZA 3JREA 1S7AA 4UUVA 3JTGA 2OERA 1Z9CA 3SQNA 1YRNA 1F9NA 4XNFA 3ZQQA 4DYRA 1QU3A 3LAJA 4XRSG 5D8KB 2OPTA 2XASA 1JI8A 2JJ7A 1W5TA 2GWRA 2YU9J 2VODA 1ZG3A 4CICA 2NXNB 4BAYA 4KN4X 3CO6C 2RNGA 2CO5A 3QOEA 5HS8A 4IQ4A 5FLVA 2D6YA 1MBEA 2MH9A 4EJOA 1MBFA 3DEUA 5K5QA 1EV7A 2NP3A 3CDLA 4CXFA 2WAQN 2VXDA 4BE2A 4D5CA 2E35A 2V9KA 1JUMA 4HQMA 2RQPA 4XLNF 1GXPA 1U0JA 4A0YA 4IO9F 3BY6A 4ETSA 3BNIA 4ZYGA 3QYEA 1XGNA 4FE7A 5LRSA 1X19A 3RQIA 3NARA 2K5CA 4MHGA 2IT0A 2LD5A 3RQ4A 1FTZA 1SD6A 2L7FP 2YVXA 4BGDA 4LB6B 3TP3A 3GLXA 4DZPA 1A04A 3A02A 2XAFA 1BW6A 1PVEA 1DQUA 4IHTA 3LOCA 2OQGA 2DA2A 5GTIC 4Z6YA 2OAZA 3HIMA 4XRMA 3K4CA 1A5JA 2W25A 1T95A 2NS0A 3P9CA 1WJEA 3L9FA 5F08A 4FX4A 3IL2A 4E7JA 4BXXJ 3E5UA 5J1UA 2FF4A 4RM2A 2PMUA 4XLCA 5CVUA 3GYHX 4F92B 1LEAA 4PJNA 4JOMA 4U0WA 2JK3A 2XGEA 4R79A 4FTHA 1FOXA 5FKNA 5FFZA 3T1BA 3I55I 4MEXF 4GDFA 5CPRB 1PUFB 2CUJA 3ZCOA 2ID6A 3CC7I 5LEKA 5E1WA 1MDMB 4AC6A 2DMQA 2VQGA 3N05A 2R7XA 1D5VA 3ESWB 2OU2A 1ON2A 4G9YA 2JA2A 5IY5H 3BR2A 3GW2A 4JX5A 3M8JA 5L3BA 3TOBA 4HLYA 3LSJA 1XSDA 2E2IJ 5TISC 1O3TA 3DKXA 3NAUA 4BQAA 2VB6A 3E3VA 2VOPA 2LVSA 1XSXA 2JUGA 1I3QJ 2ZO4A 1JT0A 1SFXA 2RNJA 3LA2A 1ZR4A 4Q48A 5BPIA 3OOUA 1J5YA 4C30A 1LDJA 1VI0A 1ZELA 2Z99A 2L2OA 4I0BA 2MH2A 1GT0C 2L02A 5LLQA 2VBWA 2KZGA 4PFOA 1SFUA 1JHFA 2DOEA 4LLLA 2BZTA 3OYCA 3FRQA 3JAMZ 4RGSA 2W24A 1PYVA 4ZZLA 1FYLA 2ECBA 2QWTA 2IGKA 1WRJA 2NNNA 4IRGA 3GX4X 1F4KA 2EV5A 3GFIA 3TW6A 2Z33A 3FXUA 2JVGA 4NN1A 3DPUA 1RUOA 2VXZA 3QBMA 1X1AA 3K1MA 2BHZA 4FHTA 3BJBA 3ASOH 3CMEI 5L3FA 4BL0B 4DBQA 2H6CA 2CJJA 1KU3A 1IO2A 2IJLA 5HNFA 2HGCA 4HPQA 1HDPA 3VVZA 3VVYA 2I5UA 3R61A 4WX9A 5D1RA 2XDNA 2R5YB 3HBLA 3ECHA 2FX0A 2LH9A 1TWFJ 2VIXA 3NS4A 4QWQA 3AQTA 3RD3A 1HKSA 4I0AA 1V5GA 4KT5C 2HOTA 3A01A 1TBXA 2JTVA 4OIQF 2DTZA 2HWVA 4RA2A 3R0AA 4B43A 5FLMJ 3ZQCA 4KT6A 5LHHA 2AQFA 2P7CB 1QZYA 2STWA 1XGOA 4PGGA 2NS7A 1BC7C 3L2VA 2GA1A 1B72A 1F1ZA 4LG3A 2M9HA 4DVYP 2YS9A 3ABLH 4NDLA 2TRTA 1SAXA 2RQQA 1OCTC 4X6AJ 4HG2A 4E7LA 3K0LA 5EGOA 1O57A 2V7FA 2CQKA 1DP3A 4D1QA 4WWCA 4HF2A 2K3PA 4LGWA 1TQIA 1HW2A 3S17J 1TT0A 2XKPA 4NQWA 2KQRA 2VOOA 2IP2A 1OCZH 2Q1ZB 1O3SA 1OYWA 1ZLJA 1KYZA 2FJ1A 1KGSA 1WHUA 1AOYA 2QSFX 2ZCMA 2F5DA 3AKZA 4RLQA 2HR3A 1YX5A 4CZCA 4LIUA 2LFBA 3JSPA 2XGDA 4HLXA 1ORKA 1IXCA 5JVGF 5C4YA 5C44J 2CUEA 5FKKA 2R7TA 4GYGA 3HTAA 2CRGA 3AL0C 2VJ4A 3L2QA 3WU2C 1U9NA 1QA6A 2ZCNA 4A3LJ 4UVAA 3H0DA 3KCCA 3GTJJ 4ZDOA 1WI9A 2V9PA 4MFDA 2JPCA 2DK8A 1PUEE 2PZ9A 3GLLA 2V6CA 1D1CA 2LK2A 2OD5A 3H1CA 4IRIA 3ECOA 3OSFA 4YEJA 3E5XA 3HPHA 3TO6A 3HOXJ 3QRFF 3N4MA 3COLA 4C3HJ 2DMNA 1I39A 2F4OB 2ECCA 4GFBA 2QQBA 5HDKA 3GEZA 2E1CA 1MBKA 2PMZN 4RGXA 1X4PA 2JN6A 3F8CA 5FO5A 3JSOA 2G3BA 4HF0A 1ON1A 2EH3A 3WTTC 4XKCA 2DA1A 4JX4A 3VYRB 1W36D 2K7LA 3CUOA 3GZ6A 1YIOA 1TL8A 2HVQA 2E1NA 4LG0B 1X1DA 1V55H 2BW3B 3I53A 2ELHA 2WAEA 1H9TA 2F2EA 1P4WA 2PMHA 2HQNA 1IRFA 1IGNA 1SMTA 3H36A 2UXUA 4I2OA 1YJ9I 2X4HA 1R1VA 5EJCA 5C3EJ 5F6FA 2NVUB 4A3CJ 1WCMJ 5JLXA 1USSA 1X1CA 1XD7A 4G6DA 3LAPA 1R1UA 1Y0NA 2K27A 4WIBA 3LNQA 2P6TA 2P8TA 1ETKA 2O0YA 3F3XA 4QSHA 5BQTA 5IOYA 2V1NA 2Y75A 2R7DA 2UXNA 3D5SC 3BWGA 2MC4A 2ZOZA 2VC1A 3A0BC 4L9TA 3SZTA 1S8NA 2VN2A 2WC2A 3JAMK 2M2EA 4EV0A 3CCJI 3OR1C 1QZZA 4N4OB 2QLZA 2VPLA 2NS8A 1AWCA 2ADUA 2FMYA 2BYVE 3ROUA 4A12A 3M7GA 3TMOA 2HPIA 2DFEA 4O6JA 5J40A 3G1OA 3QP5A 1FY7A 1MMNA 3IUVA 2PN6A 2E36A 5BS6A 2X6YA 2ZSIB 3GO5A 2IS6A 3QPTA 1JGSA 2L9RA 2VQCA 3NWTA 3RI4A 2JVHA 4ACIA 2MGQA 3VFZA 1QHHD 1O3QA 3JR9A 2VASA 3VOEA 4HDVA 4JX6A 1OLTA 4LFUA 3QWLA 2V26A 1DGRM 5GPCA 5AQCA 2DN0A 3E7LA 1IG7A 1FBUA 4LITA 3B6CA 4BQNA 4YELA 4E7ZA 4UUSB 1ZG5A 3LSKA 3FM5A 5GPAA 5TRDA 3P9TA 3J7YJ 4KA4A 2L7ZA 1BM9A 1XGSA 4RGUA 2HQ5A 4XORA 2F48A 2LY1A 4V2GA 2QEXI 2M8GX 3LWFA 1WH5A 3GTOJ 3S14J 4X0GA 3E6BA 5FKOA 2QIBA 1J2XA 3PIPF 3FDYA 2O3FA 1V3FA 1LVAA 2EV0A 2XB0X 2O6GE 3Q0VA 3N97A 3W2WA 5E20A 3G6EI 3SDGA 3MZHA 2VJJA 3KP3A 3EUHC 2A5YB 4F7ZA 2CG4A 1I50J 3K70C 2G7HA 3H9GA 1BL0A 1ODDA 1WJ5A 3SYTA 2VQLA 5L3CA 5D5VB 3CTAA 1PUFA 3G56A 3VDXA 2KFDA 2DA3A 2EZLA 2JUCA 1MDMA 1POGA 5BNGA 3HHHA 1TWGJ 4B48A 3A2KA 2P5KA 3RPQA 2LY9A 4BDZA 4HRIA 3VUQA 1XSVA 2LBFB 3CLOA 2VKVA 2M87A 4EJVA 2FE3A 3PL8A 1OCOH 3M3YJ 3IRRA 3VOXA 1QHGA 2KIUA 3BZCA 2LR8A 3IRQA 4ENKA 5CLSA 4HNTA 2EFOA 1Y1VJ 4I6ZA 3OS2A 1DU0A 4KNYA 3PQJA 1IRZA 1FZPB 5K1YA 1BJZA 2QKMB 2E71A 1WJBA 2E7WA 2K4JA 5F64A 3BHQA 5EZHA 4AWXB 2DG7A 4V2FA 1UELB 1U3EM 3HKZA 5J8FA 2BY2A 2DMUA 2PEXA 2RGVA 3KZYA 3AL0B 1ZAOA 4QPQA 3FWEA 2HEOA 3TL4X 2AHQA 2LLKA 3FX3A 2LNBA 2XAHA 3TOAA 1VQMI 1S3JA 3MZYA 2H8RA 3KYCB 3DTIA 1E3HA 5D6EA 3T8TA 1R5GA 1R4NB 1A6IA 4PGHA 4GCVA 4XLEA 3MNLA 3WGIA 5C4JJ 2KDOA 2VI6A 2NOJB 3H0GJ 2O61A 4P96A 2W1OA 4KIBA 4NBQA 3F9KA 1FMVA 3FHNA 2NVYJ 2D1HA 2R5YA 1I5ZA 4GO1A 1R6RA 1BI0A 3VWBA 2HVSA 2GAUA 2VJ5A 2DOFA 1H9GA 1VNDA 4HX8A 3G3ZA 3NPIA 2V6EA 4CYCB 2KHMA 1MD0A 4JP0A 2EJRA 1JGGA 3TO9A 2FD5A 3ZMTA 2M4KA 4JL3A 3W6KB 4LD5A 2M8EA 1DU6A 2KRHA 5J4YA 3JSJA 3G7RA 3OYIA 4AF5A 1Z21A 1VQ6I 1G3YA 4UY8I 3E5QA 4XOTA 1SD5A 1A6QA 1LVKA 2WBMA 5E3MA 3ZQFA 4MIMA 2QM3A 2F6CA 2ZKZA 3HOUJ 3BR1A 3QPHA 3PIOF 1AKHB 4XMYA 5GTHC 2AO9A 3G1MA 3RJPA 2CFXA 3WGGA 1OCPA 2EK5A 4M3DA 4XQFA 1U6GA 2VC0A 5E3NA 3L7WA 1RUNA 1R36A 1Y6IA 5J1YA 3W2AA 1W0TA 3MZ8A 2DBBA 2K40A 2KJCA 1HQCA 1TWAJ 4HSTA 3F72A 2QOPA 3ONQA 2DPDA 2GXBA 3LSTA 2K4BA 5H6RA 4PJJA 2EFQA 1FC3A 1X3ZB 3B6AA 1MJBA 1W1WE 2LC2A 3C3WA 4U87A 2FQ4A 4XSZF 2GXAA 4W1UA 1VF9A 2DQLA 1HF0A 3CC4I 4L9VA 4UNOA 5EDNA 4OAYA 3GBGA 5B1BH 2BHYA 3KZ9A 1G6NA 3IAM2 4M6XA 5GAHJ 3VW0A 2EIKH 4L62A 3JRIA 2GM4A 2L9VA 2FUG2 3ZQ7A 1T0FC 2O7TA 1NK3P 2LP0A 1EA3A 4M71A 1T8IA 1P4XA 1UMQA 1MMGA 2EZHA 5D6FA 2R92J 3A0HC 9ANTA 4CCNA 3R0JA 4A3IJ 1KQ9A 1HW5A 3OYMA 5EEHA 5HSZA 2EFPA 4CGZA 1MMAA 1TW2A 2Y48A 2MYSA 4XK4A 2RN7A 4C2MA 3C07A 1T56A 2M7AA 3AG3H 1ZRCA 1K6YA 4CDGA 1YLFA 4DYQA 2OBPA 4BH9A 1R22A 2KP6A 1MH4A 4GXOA 1ZGJA 1WH7A 5HBUA 4LG0A 5FD5A 4YFKF 2R5ZA 3O6BB 5LHIA 1VQKI 4A3FJ 1ITYA 3MAJA 1JTYA 4Q47A 5HLIA 2IPQX 3BC8A 2KDZA 2VL8A 4MK6A 2P81A 4BYYA 4BHCA 3JCUC 1KA8A 4FQGA 1U9OA 4XN3A 5GADJ 5H20A 2KPMA 3NRVA 5M5XJ 1ZREA 2P7VB 1G3WA 3IKVA 4YIFA 2IS2A 3CJDA 4LLGF 2KJBA 2TDXA 4LOCA 4BKXA 1VQ5I 4E70A 4MGRA 1X1PA 3HE0A 3BTCA 1J9IA 2F5FA 5KNLA 3M07A 1BC8C 1DPUA 2M0CA 3JRDA 1P7JA 2Y31A 2OCEA 3NI7A 1QVTA 5J6XA 3NEUA 4B3AA 3KIOA 1E17A 2L9NA 2ZXIA 2K9MA 3KNWA 2DCEA 4L5EA 2RDPA 1SVLA 1BI2A 1LKXA 1QZEA 3VYSB 3QYFA 1WSUA 3D5RC 1K61A 5D19A 4B4CA 1IUFA 2R0QC 4P9UA 1U78A 2PI0A 3F1BA 2V79A 2JT1A 4JBAA 2ZXHA 3RKWA 2M1BA 2N8GA 5BOXA 5HLGA 2WTEA 1S9HA 5J8CA 3CCUI 2EBIA 2GZWA 2IW5A 2BVMA 3KP4A 1YJWI 4MTEA 5E3LA 5TJJA 1KYWA 2P5VA 4FASD 3S3NA 4C2MJ 2W7NA 1O7FA 3HOZJ 2LF8A 2HXOA 5LBQA 5FROA 3K4BA 1FP2A 4XLHA 4UUSA 3ERED 1K83J 3DTEA 2KISA 2QKOA 1FX7A 2IS4A 1Z77A 1N75A 3HTIA 1WQ2A 1EH6A 1LE8B 1YYVA 1QGPA 3AG1H 1YX3A 2BY3A 3DU5A 3KZIC 2YUSA 2W00A 5ILUA 3GTMJ 2W82A 4MTDA 4ENMA 3CD6I 1D5YA 4M3EA 3HRMA 4I76A 5DS9A 5ICGA 3EPZA 3VPRA 4NUBA 5HLTA 2JSCA 5AIQA 2NYXA 5DCMB 4GRIA 5IT9Z 2QBYB 4UHTA 4U0YA 3GWZA 1F5TA 2Q0OA 1OCRH 4KN7X 3RPUA 1LPQA 3KYDB 2WY8Q 3ZP5A 1FLIA 4RB1A 2FNPA 1MNDA 3VSKA 1MIJA 1Z0XA 1TZLA 2LBFA 5FFXA 4E7KA 3DV8A 3Q3SA 2R7VA 3MKLA 2GXGA 1SGMA 2DOAA 5DUKA 1FOKA 3W3CA 3QPLA 1JJ8C 3ISPA 4HDUA 4GFKA 2VJIA 1RPWA 5IP7J 5TGTA 1VQ4I 1FSEA 2X6WA 4V19K 3SZPA 4OIPF 2DMTA 2MLKA 3LA3A 5A2QK 4G94A 3L2CA 3DKYA 3DLAA 3HKZN 3ZMSA 3KEOA 2E2HJ 1BR4A 2Y0SA 4Y3OA 1QRYA 1Z67A 4P5OA 3OYHA 4A3EJ 3RTRA 3RPUD 3O2PE 2HDCA 1BI3A 2JA5J 3QU6A 4BQOA 5EEGA 1W0UA 5ED4A 1J0RA 2AXLA 2MW8A 1UCRA 5FGMA 4Y33A 1WWXA 1LDKB 3ZMUA 1M1EB 4L0ZB 3SZGA 1B1BA 2RKHA 4L9NA 3Q9VA 4HZFA 3S3MA 2JQ7A 3HHGA 2P4WA 3K10A 5DAJA 1DP7P 2P0WA 1KU2A 4U88A 4ANJA 3RZDJ 3C2BA 3FHZA 2RV8A 5FHPA 4KMFA 3E0JB 4IOAF 2A68F 3VIBA 4MLOA 4A93J 5M3MJ 1STZA 4KUMA 3ZQIA 3S2DJ 4HKUA 2ZFWA 3ULQB 1X4OA 2O03A 5CYVA 4CYCA 1JKOC 2K02A 2K3FA 1LDDA 2CQ7A 3ZR8X 1FSHA 2UWMA 2BXYA 3HZJA 3I54A 3EETA 5FLXZ 2XHKA 4KMUX 2ZXWH 4IX7A 1APLC 5CQGA 4WCGA 5D4RA 3GZ5A 3ABUA 1H89C 2NVXJ 4BXFA 3F22A 2VT2A 4RDUA 1VQOI 3CC2I 1V54H 3P9IA 4UDSA 4FT8A 2QF7A 1XC5A 3RYPA 4ZYHA 5JHFA 2FMLA 5CVRA 3S1NJ 1YO5C 2UXIA 4OD5A 3HGYA 3CJQB 4F52A 2COBA 2E19A 2X1EA 2L3DA 3FXMA 1IUYA 3ON2A 4BBSJ 2CW8A 1WJFA 2W53A 5IPAA 1ZTRA 3PFYA 2Y69H 2VLAA 4AD9A 2B3WA 1N77A 2O8XA 2PX9A 3HGGA 3KP2A 4E7IA 2QSHX 2UUZA 1ZRFA 2GFNA 5GAEJ 4L0YB 2DPUA 1OYIA 1USTA 4IJAA 4M72A 3FXKA 3IWFA 2DU9A 3G71I 3G73A 2WV1A 3S3OA 2M30A 3GCMA 3HPGA 3BG9A 4D5FA 1K78B 3PJRA 5LGUA 2DAOA 3EYIA 3B02A 2V57A 4F3QA 4IEJA 2L0KA 4NNJA 2XPUA 3K6GA 3JRGA 4DJAA 3O8HA 3ZRGA 4U9LA 2ETHA 3K4MA 2Z5UA 3LQQA 1IDYA 4WK8F 1YE9A 4S04A 2JSPA 2FQ3A 2K9LA 2FBIA 1TNSA 3TDZC 4IOCF 1TQMA 2DT6A 3DXJF 2LKXA 1LQ1A 4MO7A 3ABKH 1IXRC 4ZDLA 5HODA 3VYUB 3IKTA 3IH4A 3M9AA 2ESHA 4AU7A 3DQVC 4L5IA 4HEA2 1RETA 4XLFA 2Z9OA 5LHGA 2NP5A 5IT9K 3G2BA 3WG9A 2HOEA 3E6DA 3HEFA 3UNGC 3CJTB 4XRFA 4ZYAA 2VT3A 2CMPA 3QPSA 3IWZA 4AM3A 1TLHB 2DI3A 1B6AA 3ML6A 2OTLI 3EUHA 2L9SA 3HRTA 3H3ZA 3PFIA 4XONA 3IHUA 4EJUA 4MQVA 2IXSA 2F5VA 4C9YA 4ME9A 2JMWA 1NTCA 3HTJA 2F4IA 1IN8A 5HS9A 2X51A 2OV7A 2GENA 4PSXA 3WTUC 1P7IA 5F1JA 4RGRA 3KETA 2DODA 3CP2A 1JTXA 2R3SA 3Q0WA 2B63J 5HDGA 1JUSA 2R7WA 3K9TA 1WKMA 3KP6A 4DBRA 1UHMA 2QQ9A 2OUMA 4PUSA 2Z2SB 3CQZJ 4KITB 3RSNA 2PJPA 3LSRA 4RS8A 4CCKA 3CO7C 3PO3J 2J5OA 3KP7A 2YU3A 4UB6C 1ETVA 3LSHA 1J7KA 4RB0A 4AYBN 3K70D 1D8KA 2R93J 2DJIA 2I8DA 1Y56A 2HQAA 5D5WB 2HVRA 4HBLA 5KCMA 3BCBA 2QYOA 1FJLA 3M4OJ 1YW8A 1QQIA 2XC7A 3TDUC 2DTRA 4EM2A 4DNCA 1T2KA 5LGNA 3LHQA 3LFKA 1OR7C 4CCOA 1G3TA 1I6HJ 3RH2A 2FU4A 4X1EA 4II2A 3F8FA 2OCCH 4HV6A 3OOPA 2DW4A 4A69C 5D8LB 2HDWA 1K7AA 5FB2A 3A1YA 1S72I 3IAS2 1G3SA 2H1LA 2M5WA 4MQ9F 2BVLA 1T39A 4ZZDA 1OKRA 1R4MB 3C2HA 4A0XA 4BJ5C 4G7ZF 1CGPA 4WXCA 3I56I 2XSDC 1TWCJ 2BOLA 1LE8A 5FLXK 3T6NA 4UB8C 1LFBA 4P55A 1Q1HA 1RNLA 1MMDA 3L1PA 3QKXA 3VOKA 3MKYB 2Q2EB 3WTXC 2K9SA 2XSJC 5JVTA 2GIVA 2D2WA 3I9V2 3NRGA 3AG4H 5DCMA 2V1XA 4EMSA 1DPRA 2EQRA 2VE9A 4R1HA 3NQOA 4RAZA 2XAJA 1AHDP 4AVPA 3DP7A 1ACIA 3DEEA 3L09A 2L4AA 3X2QH 3BR5A 4BS9A 5IYBJ 2QA4I 1RR8C 1WJCA 3OYLA 1B8IB 4A3MJ 1K6OA 5EG0B 2JPBA 4BY1J 5D4SA 1AU7A 3BR6A 4G12A 5CVJA 3E97A 1NG7A 1L3LA 4RMNA 4BJ6C 5ICCA 3W6VA 3S15J 1FNNA 2E5NA 1GV5A 3I3LA 3LFUA 5E8GA 3WE3A 3PNYA 3F8NA 5ICEA 2EILH 2EINH 3J80Z 3SWHA 3CCLI 2Y0SN 5HS7A 4E4HA 3U2RA 2XRLA 3QU3A 1A31A 3VW1A 3AFHA 2H6BA 2JA6J 2COMA 4J00A 1ZN2A 3O8GA 4PJMA 3TBIA 3RKQA 4XR6A 2E2JJ 2RHAA 3S93A 4YZEA 2K9QA 4CO8A 3ZQLA 2HDDA 1JJ6C 3M8EA 1O7LA 4B8XA 1T0FA 4I7HA 1YQAA 4YRVA 1ZGAA 3JRCA 1ONVA 1TC3C 4RAFA 1UI6A 3H5AA 4XKWA 5D5XB 3H35A 3BTJA 3K4NA 3F6VA 2ZB9A 3DLLF 3DTKA 3FF5A 2FJI1 2HKUA 1Z05A 1NG6A 5H9TA 2K9NA 3CMMA 4O5VA 4XM3A 1JE8A 1MW7A 4IZZA 3UKGA 3FXQA 2LY2A 1J75A 4JK1X 4M6VA 1P4AA 3SFZA 4CCJA 4Y7NJ 3GTPJ 3RZOJ 5E1XA 3SFIA 2XPVA 5B1AH 3HTUA 2RREA 1R7JA 5GP9A 2KIQA 1BBYA 1ETQA 4O3MA 5F27A 1IN7A 2QQ8A 2NVQJ 2PFVA 3VP5A 2IA2A 3LSPA 2LG4A 3WG7H 1MBJA 3GZIA 2ZFUA 4NC8A 1ZKGA 1WZ2A 5ILSA 4FCYA 2WADA 5AIPA 2Z3YA 5EZGA 1XGMA 2FOWA 2XKOA 4OMYA 2R7QA 4IQJA 1FMWA 2DYSH 2V4JC 2HZDA 2DA5A 4IHSA 1LFPA 3OYNA 4OIOF 2AXTC 4CYDA 2E5ZA 2UXXA 3HSFA 4EEFG 3VVXA 1KONA 5FD6A 6PAXA 2XAUA 1SANA 3K4LA 3ZGKA 3REOA 1MZBA 2R7ZJ 4ZH4F 1FIPA 3HDDA 3HM5A 3CP8A 2YVEA 1FOYA 3NNRA 4Q4ZF 2JRTA 2YSRA 1BIAA 1T98A 2XF6A 1FYKA 1K78A 4M73A 5CXGA 2CFOA 4U7DA 3OYKA 4GFLA 3R4KA 1MBGA 1XDUA 4OAZA 1X2MA 3HSEA 2EFNA 4L5JA 1SC7A 1SD4A 3AQSA 1XS9A 4PSWA 2HS5A 4UXNA 3GTGJ 2NAZA 2H09A 3L2WA 3F21A 2VBYA 3OIPA 1IZ1A 1R00A 1VTNC 4OU0A 4NC7A 2L7MP 2QQAA 3BRUA 2HQRA 4HX7A 4LIVA 1UI5A 2XIGA 3BPVA 2XDVA 4NB5A 2GUHA 5DCFA 4N4NB 3SEQA 3LWJA 2LOOA 1F36A 2Y2ZA 1R23A 4IVNA 3BJAA 3CDIA 4XBFA 4CHUA 3PPBA 3CMYA 3GMEA 3U21A 1K4TA 5ICFA 2HPMA 4D9JA 4IHVA 2NRAC 2HYTA 1X3WB 1XCBA 3TKYA 3OYAA 2CS3A 1P2FA 4A3BJ 3GTKJ 1W7PB 1RZ4A 3SXYA 3MWMA 1D8JA 3J7ZI 3KX2A 4ZDPA 2IGNA 1UG2A 3HJEA 3MQ0A 2LF7A 5E3OA 1ERDA 4OINF 1T38A 2DMPA 4LK1F 3WHCA 5F0FA 1A36A 4A3JJ 2HYFA 1BW5A 3U1KA 3DBRB 1UZCA 1EH7A 1NH3A 2WAFA 1MBHA 2X6OA 2LSOA 3HL2A 4FE4A 5CKTA 3J80K 1YFHA 4RAGA 2KRCA 4D0PA 4ENJA 2CQXA 4XRSA 5K58A 5DEQA 1QBJA 2W48A 4F91B 2PFBA 1G4DA 5B3SH 1IF1A 3CUQC 2LKSA 2XF5A 2R7FA 4U0VA 4XL9A 4LB5A 3TW7A 1IXSB 3UR3C 1U8RA 2Y0MA 4AIHA 1A35A 1XB4A 3H3UA 4BUPA 4EJTA 4XKBA 2OF7A 5DM6F 2LYCA 4BE0A 2F5EA 4BU2A 4BDYA 1Z6TA 1IN5A 2L7KA 1IDZA 2BW3A 3K4JA 1I3AA 3S2HJ 1XDSA 2EIMH 1HSJA 4G8XA 2KIMA 2VUMJ 3GF2A 4IPAA 2HKXA 2IS1A 1JKPC 3MD2A 5DM7F 2ELKA 3EUKL 3ZQGA 1ZARA 2JA8J 4G7OF 4OMZA 3FZVA 1HCRA 2GOXB 4U9NA 2LKPA 1PJRA 2ZMEC 3DPLC 1Z3XA 2H27A 2LTPA 2VKHA 2GBYA 5LD2C 4HSRA 4NC6A 1KU9A 1LB2A 1FP1D 2OZUA 2DK5A 4I02A 2Y9YA 3WTSC 2HKOA 1GV2A 3Q5FA 4HV5A 2DO7A 3ZXSA 1VZ0A 3CCRI 4B3XA 3K2AA 3E7QA 1RR7A 3KFWX 2Q2EA 1P9QC 5L3GA 4HNUA 5LRRA 4M3FA 3L2RA 3BTLA 2Q24A 1BJAA 1YJNI 5B66C 1OFCX 3CCMI 4OOIA 3LSMA 4HQEA 4GGGA 5KHDA 3ON4A 2R4GA 2ZJRF 5KK1A 4OIRF 2YVHA 1RC9A 1FPQA 2EPFA 3BR0A 2L54A 3KLNA 4XKVA 1XMKA 2WWYA 4Y17A 4C3IJ 2PJRB 3CCYA 4FETA 2BY1A 4I98B 4B44A 2XRNA 2DA7A 3WTZA 1B8IA 1VQNI 5EG0A 4I99C 5K5OA 3JRBA 3FM3A 2ZCWA 1MKMA 3PUBA 2ZCXA 4JKZA 3C18A 2AS5F 2W85A 4WXHA 2XVCA 4BY7J 3J7AY 3CF2A 3L00A 4ZC3A 4CCLA 1IRXA 3PASA 5IYDJ 2VKDA 3LA7A 1YIJI 1RRJA 2CV1A 1BIBA 3M1EA 1J59A 2JZYA 2M3AA 1Z3YA 1BI1A 3V4GA 1PP8F 1ZQ3P 3S5RA 3HXLA 1BA5A 2V1UA 3BG3A 1NHAA 3C2GA 2Q8KA 1IJWC 3BTIA 4Q5SF 2REKA 2ISZA 2A6HF 4S0HB 5FKMA 3WGHA 5DUIA 2ACJA 2LRDA 2M7BA 2MC3A 2R7UA 2A6TA 2MD0A 3RKXA 2DFFA 1Y39A 3LJLA 4QIWN 3BG5A 3WTVC 1B4AA 2A5WA 1X58A 1H8AC 1WPKA 4BQQA 3MFKA 4M74A 4YFNF 1IAWA 4KJZA 4DZJA 2A3SA 1Q1VA 1W5CC 2Y30A 1J09A 2B1EA 2Z1DA 2HFHA 1VQ9I 3E1SA 2F07A 1ZG1A 1T33A 4EGZA 3S16J 3BG6A 2G7GA 2CGPA 4A3DJ 3OYBA 1YTYA 4C2UA 4BHBA 2F4MB 1Z7UA 4XN0A 4A0ZA 1YOVB 2M0MA 3DPJA 3KPHA 2PG4A 1FT9A 1RKWA 5ERIA 4TV7A 4BNCA 2ESNA 1FIAA 2MFZA 5E17F 2WA0A 1E3PA 1Z6RA 4KICA 1KU7A 3JTHA 1SVMA 2QUFA 4B09A 3HYIA 1ZRDA 4A5NA 3GTLJ 3TP0A 1S7OA 2J5PA 1GUUA 4YIRX 1W5SA 3ANPA 2QGUA 2IAIA 3H5NA 2B0LA 4CZZA 2BBYA 2E60A 3IH3A 5K7ZA 1GHCA 3V6GA 2D1VA 2IA1A 5K5RA 5F0HA 3WE2A 2A6EF 3OY9A 3U9GA 4AIDA 3HIFA 2OZ6A 3I4PA 4XLPF 1XX5A 3OYEA 4XSXF 3FXOA 3OS1A 1WJAA 3PNTA 5LFAA 3J81Z 5M5YJ 1SFOJ 4PK4A 4RAYA 3V8JA 1ETYA 4ZTJA 1GLNA 2GQQA 3KLOA 4PJ0C 4CSWA 4EATA 2STTA 3DPTA 4S05A 1TP4A 3CCVI 2X1CA 3CUQB 3HOSA 1ENHA 3P5JA 2CWEA 1B9NA 4Z2YA 2V1DA 3CESA 1EF4A 1S5LC 3CDHA 3BR3A 2X6XA 3U1DA 2RC4A 3E6MA 3I0TA 2EB7A 4PJLA 1JT6A 1XTAA 3PO2J 1V5FA 5JI6A 3AAFA 3Q0UA 1K79A 1I27A 4DOZA 3F8BA 1REPC 3T8RA 1WGXA 1D3YA 4RB3C 3QP6A 5DV5A 3MN2A 2YX7A 2LDUA 1OR7A 2HYGD 3R60A 1O3RA 2RASA 2MA3A 3HC7A 2A05A 2CU7A 1B9MA 3TQNA 3OIOA 1KQ8A 1HSTA 3BOQA 4FX0A 3W6JB 2H94A 3V78A 2FXAA 1AKHA 3HOWJ 1WFXA 2ZMEB 3CJNA 1U8BA 3HG9A 1RI7A 4BJTA 1ZYRF
chains in the Genus database with same CATH topology
2R5YA 1MSEC 3DCFA 3IV5A 2WB1N 1VNDA 3FISA 3NPIA 4A3KJ 2XSDC 1TWCJ 1LE8A 4CYCB 3HOYJ 1HOMA 4ICHA 4JP0A 1JGGA 4IHYA 1LFBA 2FD5A 2VPRA 3T6NA 4AC0A 1Y1WJ 3MVPA 4FISA 3L1PA 1UHSA 3QKXA 1ETXA 5IP9J 3VOKA 4JL3A 3LSGA 1DU6A 2K9SA 3JSJA 3G7RA 4AF5A 2EZIA 2MG4A 4XICA 5FMPA 4BBRJ 4D7NA 5EYRA 3NRGA 5E3MA 3ZQFA 4MIMA 2CQQA 2NX4A 3F0CA 2EQRA 3HOUJ 2GLOA 2ME0A 3BR1A 1AHDP 3EGQA 1AKHB 2IEKA 2EZKA 4ABZA 5CW8A 3JREA 3BR5A 2AO9A 2HI3A 3G1MA 5IYBJ 1B8IB 1QPIA 2JWTA 1IV6A 2OERA 1YRNA 4A3MJ 4DYRA 5EG0B 1JKQC 1OCPA 4XRSG 4M3DA 4DW6A 5E3NA 5D1RA 2OPTA 5J1YA 2JJ7A 4BY1J 1AU7A 1W0TA 3BR6A 4G12A 2YU9J 2QTQA 2K40A 1TWAJ 2I10A 4C3JJ 2QOPA 3CRJA 5FLVA 4Y52J 3W6VA 3S15J 2D6YA 2WUIA 1MBEA 1GV5A 3B6AA 2UXHA 1MBFA 2FQ4A 4GCTA 2NP3A 3CDLA 4W1UA 1VF9A 1HF0A 2NVTJ 2WAQN 4HNVA 2Y0SN 4D5CA 5EDNA 1JUMA 2XRLA 3GBGA 3KZ9A 3VW1A 3VW0A 2JA6J 4DYCA 1GDTA 3BNIA 3KKCA 1IC8A 4L62A 3JRIA 4FE7A 3O8GA 5M3FJ 2E2JJ 3RKQA 3RQIA 2RHAA 2GM4A 3NARA 4YZEA 2K9QA 4RBOA 3ZQLA 2LD5A 1FTZA 2L7FP 2HDDA 4UUTA 1JJ6C 2O7TA 3D1NI 1NK3P 3TP3A 2LP0A 4DZPA 3A02A 1BW6A 1UMQA 2EZHA 4QTRA 3LOCA 2R92J 9ANTA 2DA2A 3JRCA 2DJNA 1TC3C 4A3IJ 3FIWA 1FTTA 1UI6A 3HIMA 4XRMA 5HSZA 1E3OC 3BTJA 1A5JA 2ZB9A 4XK4A 2HKUA 3C07A 1T56A 5H9TA 2K9NA 1ETOA 4DYQA 5F08A 3UKGA 4BXXJ 1WI3A 1ZGWA 1MH4A 1WH7A 4M6VA 5HBUA 5J1UA 2Y9ZA 4Y7NJ 3GTPJ 3RZOJ 2R5ZA 3SFIA 2XPVA 4MXMA 4A3FJ 1ITYA 1JTYA 5GP9A 2JK3A 2XGEA 4GCLA 4FTHA 5FKNA 1ETQA 5F27A 2KDZA 1PUFB 2NVQJ 3VP5A 3LSPA 3HOVJ 4MK6A 2P81A 2ID6A 4AC6A 2DMQA 1MBJA 2MSYA 3GZIA 1O4XA 1ZKGA 1ETWA 1U9OA 5CXIA 3BR2A 4FCYA 5M5XJ 4JX5A 5EZGA 3I4MJ 3LSJA 3CJDA 2E2IJ 4LOCA 3NAUA 4BKXA 2DA5A 3BTCA 4B1RA 3HE0A 4MFEA 2LVSA 1I3QJ 1JT0A 1ZR4A 2M0CA 4EEFG 3JRDA 3OOUA 3VVXA 1P7JA 1OJLA 2Y31A 1SANA 3NI7A 1QVTA 1VI0A 4B3AA 3VW2A 2R5ZB 1GT0C 2R7ZJ 4IHWA 3BCGA 3KNWA 1FIPA 1QVUA 4L5EA 3EUPA 3HDDA 3HM5A 2YVEA 3FRQA 1RESA 3NNRA 1MSFC 5D19A 1K61A 4B4CA 1IUFA 2R0QC 5CXGA 3F1BA 1U78A 3PM1A 2ECBA 4GFLA 2QWTA 2O7OA 1MBGA 1X2MA 3TW6A 1ZR2A 3A03A 4IHXA 2DA4A 2XB5A 3QQAA 4NN1A 3AQSA 2N8GA 1XS9A 2FBQA 3QBMA 3GTGJ 2EBIA 4M3GA 5E3LA 3BJBA 3GEUA 2L7MP 3WHBA 3BRUA 2CJJA 4C2MJ 5IOZA 3FKIJ 3VVZA 1HDPA 1UI5A 3VVYA 3HOZJ 3FK7A 2HXOA 2WGBA 2GUHA 2XDNA 2R5YB 3LWJA 3HBLA 2ZOYA 1F36A 2Y2ZA 4UUSA 2FX0A 1K83J 1TWFJ 5EEAA 2QKOA 4JNNA 3RD3A 1Z77A 3AQTA 3HTIA 3S1RJ 3PPBA 3CMYA 1LE8B 2M34A 2HOTA 3A01A 2DTZA 3KKDA 4KWAA 2DA6A 2ME6A 4IHVA 5FLMJ 2HYTA 3ZQCA 2YUSA 3GTMJ 4A3BJ 3GTKJ 2NS7A 3BT9A 1D5YA 4M3EA 1B72A 4I76A 1G2HA 5DS9A 2G7SA 3VPRA 2M9HA 2YS9A 4NDLA 3ANGA 2TRTA 2X9DA 1GVDA 1OCTC 4X6AJ 1H88C 1UG2A 5EGOA 5E3OA 2DMPA 4A3GJ 3WHCA 5F0FA 1YRNB 5JLWA 4A3JJ 1Z0XA 3S17J 1BW5A 2H1KA 2TCTA 2CUFA 3Q3SA 1SGMA 2FJ1A 3MKLA 1MBHA 2X6OA 3QPLA 1JJ8C 4FE4A 4GFKA 2ZCMA 1RPWA 5IP7J 2CQXA 4XRSA 5K58A 2LFBA 2XGDA 2W48A 2DMTA 1ORKA 5FJ8J 5C4YA 5C44J 2CUEA 5FKKA 3TW7A 3HKZN 3HTAA 2CRGA 5F04A 2E2HJ 4A3EJ 1QRYA 5EFYA 1U9NA 2ZCNA 2OF7A 4A3LJ 2JA5J 3GTJJ 3G1LA 3S1QJ 1IDZA 1W0UA 3S2HJ 3DEWA 4MFDA 2PBXA 3JRFA 2PZ9A 2MW8A 1CQTA 2LK2A 2VUMJ 2X48A 1JKPC 3SJMA 2ELKA 5IYCJ 3OSFA 2JA8J 2NOGA 3ZQGA 3HTHA 3H3VK 1JUPA 5FGLA 1HCRA 3HOXJ 5DAJA 3COLA 2QCOA 4C3HJ 2DMNA 2ECCA 2LTPA 3RZDJ 4GFBA 3C2BA 5FHPA 2GBYA 1MBKA 3GTQJ 2PMZN 2JN6A 2G3BA 3VIBA 4MLOA 4A93J 5M3MJ 2DG8A 2Y9YA 2EH3A 3ZQIA 3S2DJ 2DA1A 4JX4A 2IBDA 5M5WJ 4HKUA 1GV2A 4CYCA 1JKOC 1JKRC 3K2AA 3E7QA 1RR7A 2HOAA 5K7FA 2UXOA 2E1OA 5HAWA 3BQYA 4M3FA 3BTLA 1IGNA 2Q24A 2UXUA 1OFCX 2ID3A 5C3EJ 1APLC 3ON4A 4A3CJ 1WCMJ 5JLXA 1H89C 2NVXJ 1ZK8A 1X2NA 4RDUA 3LNQA 3I4NJ 4UDSA 2YVHA 3BR0A 2QF7A 1XC5A 2UXPA 3RH2A 2UXIA 3S1NJ 1ETKA 4QSHA 3HGYA 5IOYA 5C4XJ 4C3IJ 2COBA 2E19A 2HXIA 3CCYA 3FK6A 3IH2A 1B8IA 2DA7A 4XIDA 3ON2A 2HYJA 1VFCA 4BBSJ 2ZOZA 5EG0A 2W53A 5IPAA 1ZTRA 3JRBA 3K7AJ 2ZCXA 4D7MA 3HGGA 4JKZA 2M2EA 1HLVA 5K7HA 1NK2P 5IP6A 4BY7J 2GFNA 3PASA 5IYDJ 2IU5A 2NS8A 1TWHJ 1S7EA 3JRAA 2WV1A 4J19A 4D5FA 2OI8A 2XGCA 3BG9A 1ZQ3P 3S5RA 1BA5A 3BG3A 1MNMC 1LFUP 1XG1A 3BTIA 3G1OA 4AUXA 1IJWC 2REKA 3IUVA 2V57A 4S0HB 2L9RA 5FKMA 4ACIA 2MGQA 4IEJA 2L0KA 2HOSA 5F0CA 2XPUA 3JR9A 3LJLA 4QIWN 3BG5A 3JRGA 3O8HA 4JX6A 3BQZA 1X58A 1H8AC 1WPKA 1IDYA 5GPCA 4DZJA 5AQCA 2DN0A 3E7LA 1HDDC 1Q1VA 1IG7A 2Y30A 2D5VA 2RAEA 3B6CA 2LKXA 4MO7A 2F07A 1MH3A 4UUSB 1R9TJ 5GPAA 1T33A 2VKEA 5HODA 3S16J 3IH4A 3P9TA 2G7GA 4A3DJ 2L7ZA 4PXIA 2HQ5A 3A01B 1RETA 2O9LA 4V2GA 3DPJA 2M8GX 1WH5A 3GTOJ 3S14J 1RKWA 3S1MJ 5FKOA 2QIBA 1FIAA 2NP5A 3ZQHA 2XB0X 3Q0VA 1B72B 3HEFA 2XPWA 3TEDA 3SDGA 3HB9A 3QPSA 3NXCA 3GTLJ 3TP0A 3B81A 2G7LA 1GUUA 1I50J 5J3LA 3ANPA 5EGOB 2IAIA 4CGRA 2O8KA 1BL0A 3G56A 1PUFA 3IH3A 5J1RA 5K7ZA 2DA3A 2EZLA 4ME9A 2JMWA 1NTCA 1POGA 5BNGA 3HTJA 3V6GA 1TWGJ 5F0HA 2LY9A 3VUQA 1RKTA 2VKVA 2GENA 1P7IA 5F1JA 3M3YJ 3VOXA 1JTXA 3Q0WA 3OSGA 2B63J 2LR8A 1DU0A 4I6ZA 3CWRA 1JUSA 1Y1VJ 1IRZA 5M5YJ 1SFOJ 1BJZA 1ETYA 3CQZJ 3BHQA 3LSRA 5EZHA 1ENHA 3PO3J 2DG7A 4V2FA 1EF4A 2DMUA 1ETVA 4AYBN 2R93J 3BR3A 5DTDA 4NELA 1JT6A 1FJLA 3M4OJ 2AHQA 2LLKA 3PO2J 5EF6A 2KT0A 3Q0UA 3ZOBA 1WGXA 2H8RA 3LHQA 1I6HJ 3MN2A 4JYKA 1F43A 1A6IA 2G0EA 1FEXA 2RASA 3MNLA 5C4JJ 4M3BA 2CU7A 4X1EA 2VI6A 3O60A 3OIOA 4A69C 4GCKA 3H0GJ 4W97A 3JRHA 3V78A 5D18A 2JA7J 1AKHA 3HOWJ 1U8BA 5FKLA 2NVYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Y A;  1MSE C;  3DCF A;  3IV5 A;  2WB1 N;  1VND A;  3FIS A;  3NPI A;  4A3K J;  2XSD C;  1TWC J;  1LE8 A;  4CYC B;  3HOY J;  1HOM A;  4ICH A;  4JP0 A;  1JGG A;  4IHY A;  1LFB A;  2FD5 A;  2VPR A;  3T6N A;  4AC0 A;  1Y1W J;  3MVP A;  4FIS A;  3L1P A;  1UHS A;  3QKX A;  1ETX A;  5IP9 J;  3VOK A;  4JL3 A;  3LSG A;  1DU6 A;  2K9S A;  3JSJ A;  3G7R A;  4AF5 A;  2EZI A;  2MG4 A;  4XIC A;  5FMP A;  4BBR J;  4D7N A;  5EYR A;  3NRG A;  5E3M A;  3ZQF A;  4MIM A;  2CQQ A;  2NX4 A;  3F0C A;  2EQR A;  3HOU J;  2GLO A;  2ME0 A;  3BR1 A;  1AHD P;  3EGQ A;  1AKH B;  2IEK A;  2EZK A;  4ABZ A;  5CW8 A;  3JRE A;  3BR5 A;  2AO9 A;  2HI3 A;  3G1M A;  5IYB J;  1B8I B;  1QPI A;  2JWT A;  1IV6 A;  2OER A;  1YRN A;  4A3M J;  4DYR A;  5EG0 B;  1JKQ C;  1OCP A;  4XRS G;  4M3D A;  4DW6 A;  5E3N A;  5D1R A;  2OPT A;  5J1Y A;  2JJ7 A;  4BY1 J;  1AU7 A;  1W0T A;  3BR6 A;  4G12 A;  2YU9 J;  2QTQ A;  2K40 A;  1TWA J;  2I10 A;  4C3J J;  2QOP A;  3CRJ A;  5FLV A;  4Y52 J;  3W6V A;  3S15 J;  2D6Y A;  2WUI A;  1MBE A;  1GV5 A;  3B6A A;  2UXH A;  1MBF A;  2FQ4 A;  4GCT A;  2NP3 A;  3CDL A;  4W1U A;  1VF9 A;  1HF0 A;  2NVT J;  2WAQ N;  4HNV A;  2Y0S N;  4D5C A;  5EDN A;  1JUM A;  2XRL A;  3GBG A;  3KZ9 A;  3VW1 A;  3VW0 A;  2JA6 J;  4DYC A;  1GDT A;  3BNI A;  3KKC A;  1IC8 A;  4L62 A;  3JRI A;  4FE7 A;  3O8G A;  5M3F J;  2E2J J;  3RKQ A;  3RQI A;  2RHA A;  2GM4 A;  3NAR A;  4YZE A;  2K9Q A;  4RBO A;  3ZQL A;  2LD5 A;  1FTZ A;  2L7F P;  2HDD A;  4UUT A;  1JJ6 C;  2O7T A;  3D1N I;  1NK3 P;  3TP3 A;  2LP0 A;  4DZP A;  3A02 A;  1BW6 A;  1UMQ A;  2EZH A;  4QTR A;  3LOC A;  2R92 J;  9ANT A;  2DA2 A;  3JRC A;  2DJN A;  1TC3 C;  4A3I J;  3FIW A;  1FTT A;  1UI6 A;  3HIM A;  4XRM A;  5HSZ A;  1E3O C;  3BTJ A;  1A5J A;  2ZB9 A;  4XK4 A;  2HKU A;  3C07 A;  1T56 A;  5H9T A;  2K9N A;  1ETO A;  4DYQ A;  5F08 A;  3UKG A;  4BXX J;  1WI3 A;  1ZGW A;  1MH4 A;  1WH7 A;  4M6V A;  5HBU A;  5J1U A;  2Y9Z A;  4Y7N J;  3GTP J;  3RZO J;  2R5Z A;  3SFI A;  2XPV A;  4MXM A;  4A3F J;  1ITY A;  1JTY A;  5GP9 A;  2JK3 A;  2XGE A;  4GCL A;  4FTH A;  5FKN A;  1ETQ A;  5F27 A;  2KDZ A;  1PUF B;  2NVQ J;  3VP5 A;  3LSP A;  3HOV J;  4MK6 A;  2P81 A;  2ID6 A;  4AC6 A;  2DMQ A;  1MBJ A;  2MSY A;  3GZI A;  1O4X A;  1ZKG A;  1ETW A;  1U9O A;  5CXI A;  3BR2 A;  4FCY A;  5M5X J;  4JX5 A;  5EZG A;  3I4M J;  3LSJ A;  3CJD A;  2E2I J;  4LOC A;  3NAU A;  4BKX A;  2DA5 A;  3BTC A;  4B1R A;  3HE0 A;  4MFE A;  2LVS A;  1I3Q J;  1JT0 A;  1ZR4 A;  2M0C A;  4EEF G;  3JRD A;  3OOU A;  3VVX A;  1P7J A;  1OJL A;  2Y31 A;  1SAN A;  3NI7 A;  1QVT A;  1VI0 A;  4B3A A;  3VW2 A;  2R5Z B;  1GT0 C;  2R7Z J;  4IHW A;  3BCG A;  3KNW A;  1FIP A;  1QVU A;  4L5E A;  3EUP A;  3HDD A;  3HM5 A;  2YVE A;  3FRQ A;  1RES A;  3NNR A;  1MSF C;  5D19 A;  1K61 A;  4B4C A;  1IUF A;  2R0Q C;  5CXG A;  3F1B A;  1U78 A;  3PM1 A;  2ECB A;  4GFL A;  2QWT A;  2O7O A;  1MBG A;  1X2M A;  3TW6 A;  1ZR2 A;  3A03 A;  4IHX A;  2DA4 A;  2XB5 A;  3QQA A;  4NN1 A;  3AQS A;  2N8G A;  1XS9 A;  2FBQ A;  3QBM A;  3GTG J;  2EBI A;  4M3G A;  5E3L A;  3BJB A;  3GEU A;  2L7M P;  3WHB A;  3BRU A;  2CJJ A;  4C2M J;  5IOZ A;  3FKI J;  3VVZ A;  1HDP A;  1UI5 A;  3VVY A;  3HOZ J;  3FK7 A;  2HXO A;  2WGB A;  2GUH A;  2XDN A;  2R5Y B;  3LWJ A;  3HBL A;  2ZOY A;  1F36 A;  2Y2Z A;  4UUS A;  2FX0 A;  1K83 J;  1TWF J;  5EEA A;  2QKO A;  4JNN A;  3RD3 A;  1Z77 A;  3AQT A;  3HTI A;  3S1R J;  3PPB A;  3CMY A;  1LE8 B;  2M34 A;  2HOT A;  3A01 A;  2DTZ A;  3KKD A;  4KWA A;  2DA6 A;  2ME6 A;  4IHV A;  5FLM J;  2HYT A;  3ZQC A;  2YUS A;  3GTM J;  4A3B J;  3GTK J;  2NS7 A;  3BT9 A;  1D5Y A;  4M3E A;  1B72 A;  4I76 A;  1G2H A;  5DS9 A;  2G7S A;  3VPR A;  2M9H A;  2YS9 A;  4NDL A;  3ANG A;  2TRT A;  2X9D A;  1GVD A;  1OCT C;  4X6A J;  1H88 C;  1UG2 A;  5EGO A;  5E3O A;  2DMP A;  4A3G J;  3WHC A;  5F0F A;  1YRN B;  5JLW A;  4A3J J;  1Z0X A;  3S17 J;  1BW5 A;  2H1K A;  2TCT A;  2CUF A;  3Q3S A;  1SGM A;  2FJ1 A;  3MKL A;  1MBH A;  2X6O A;  3QPL A;  1JJ8 C;  4FE4 A;  4GFK A;  2ZCM A;  1RPW A;  5IP7 J;  2CQX A;  4XRS A;  5K58 A;  2LFB A;  2XGD A;  2W48 A;  2DMT A;  1ORK A;  5FJ8 J;  5C4Y A;  5C44 J;  2CUE A;  5FKK A;  3TW7 A;  3HKZ N;  3HTA A;  2CRG A;  5F04 A;  2E2H J;  4A3E J;  1QRY A;  5EFY A;  1U9N A;  2ZCN A;  2OF7 A;  4A3L J;  2JA5 J;  3GTJ J;  3G1L A;  3S1Q J;  1IDZ A;  1W0U A;  3S2H J;  3DEW A;  4MFD A;  2PBX A;  3JRF A;  2PZ9 A;  2MW8 A;  1CQT A;  2LK2 A;  2VUM J;  2X48 A;  1JKP C;  3SJM A;  2ELK A;  5IYC J;  3OSF A;  2JA8 J;  2NOG A;  3ZQG A;  3HTH A;  3H3V K;  1JUP A;  5FGL A;  1HCR A;  3HOX J;  5DAJ A;  3COL A;  2QCO A;  4C3H J;  2DMN A;  2ECC A;  2LTP A;  3RZD J;  4GFB A;  3C2B A;  5FHP A;  2GBY A;  1MBK A;  3GTQ J;  2PMZ N;  2JN6 A;  2G3B A;  3VIB A;  4MLO A;  4A93 J;  5M3M J;  2DG8 A;  2Y9Y A;  2EH3 A;  3ZQI A;  3S2D J;  2DA1 A;  4JX4 A;  2IBD A;  5M5W J;  4HKU A;  1GV2 A;  4CYC A;  1JKO C;  1JKR C;  3K2A A;  3E7Q A;  1RR7 A;  2HOA A;  5K7F A;  2UXO A;  2E1O A;  5HAW A;  3BQY A;  4M3F A;  3BTL A;  1IGN A;  2Q24 A;  2UXU A;  1OFC X;  2ID3 A;  5C3E J;  1APL C;  3ON4 A;  4A3C J;  1WCM J;  5JLX A;  1H89 C;  2NVX J;  1ZK8 A;  1X2N A;  4RDU A;  3LNQ A;  3I4N J;  4UDS A;  2YVH A;  3BR0 A;  2QF7 A;  1XC5 A;  2UXP A;  3RH2 A;  2UXI A;  3S1N J;  1ETK A;  4QSH A;  3HGY A;  5IOY A;  5C4X J;  4C3I J;  2COB A;  2E19 A;  2HXI A;  3CCY A;  3FK6 A;  3IH2 A;  1B8I A;  2DA7 A;  4XID A;  3ON2 A;  2HYJ A;  1VFC A;  4BBS J;  2ZOZ A;  5EG0 A;  2W53 A;  5IPA A;  1ZTR A;  3JRB A;  3K7A J;  2ZCX A;  4D7M A;  3HGG A;  4JKZ A;  2M2E A;  1HLV A;  5K7H A;  1NK2 P;  5IP6 A;  4BY7 J;  2GFN A;  3PAS A;  5IYD J;  2IU5 A;  2NS8 A;  1TWH J;  1S7E A;  3JRA A;  2WV1 A;  4J19 A;  4D5F A;  2OI8 A;  2XGC A;  3BG9 A;  1ZQ3 P;  3S5R A;  1BA5 A;  3BG3 A;  1MNM C;  1LFU P;  1XG1 A;  3BTI A;  3G1O A;  4AUX A;  1IJW C;  2REK A;  3IUV A;  2V57 A;  4S0H B;  2L9R A;  5FKM A;  4ACI A;  2MGQ A;  4IEJ A;  2L0K A;  2HOS A;  5F0C A;  2XPU A;  3JR9 A;  3LJL A;  4QIW N;  3BG5 A;  3JRG A;  3O8H A;  4JX6 A;  3BQZ A;  1X58 A;  1H8A C;  1WPK A;  1IDY A;  5GPC A;  4DZJ A;  5AQC A;  2DN0 A;  3E7L A;  1HDD C;  1Q1V A;  1IG7 A;  2Y30 A;  2D5V A;  2RAE A;  3B6C A;  2LKX A;  4MO7 A;  2F07 A;  1MH3 A;  4UUS B;  1R9T J;  5GPA A;  1T33 A;  2VKE A;  5HOD A;  3S16 J;  3IH4 A;  3P9T A;  2G7G A;  4A3D J;  2L7Z A;  4PXI A;  2HQ5 A;  3A01 B;  1RET A;  2O9L A;  4V2G A;  3DPJ A;  2M8G X;  1WH5 A;  3GTO J;  3S14 J;  1RKW A;  3S1M J;  5FKO A;  2QIB A;  1FIA A;  2NP5 A;  3ZQH A;  2XB0 X;  3Q0V A;  1B72 B;  3HEF A;  2XPW A;  3TED A;  3SDG A;  3HB9 A;  3QPS A;  3NXC A;  3GTL J;  3TP0 A;  3B81 A;  2G7L A;  1GUU A;  1I50 J;  5J3L A;  3ANP A;  5EGO B;  2IAI A;  4CGR A;  2O8K A;  1BL0 A;  3G56 A;  1PUF A;  3IH3 A;  5J1R A;  5K7Z A;  2DA3 A;  2EZL A;  4ME9 A;  2JMW A;  1NTC A;  1POG A;  5BNG A;  3HTJ A;  3V6G A;  1TWG J;  5F0H A;  2LY9 A;  3VUQ A;  1RKT A;  2VKV A;  2GEN A;  1P7I A;  5F1J A;  3M3Y J;  3VOX A;  1JTX A;  3Q0W A;  3OSG A;  2B63 J;  2LR8 A;  1DU0 A;  4I6Z A;  3CWR A;  1JUS A;  1Y1V J;  1IRZ A;  5M5Y J;  1SFO J;  1BJZ A;  1ETY A;  3CQZ J;  3BHQ A;  3LSR A;  5EZH A;  1ENH A;  3PO3 J;  2DG7 A;  4V2F A;  1EF4 A;  2DMU A;  1ETV A;  4AYB N;  2R93 J;  3BR3 A;  5DTD A;  4NEL A;  1JT6 A;  1FJL A;  3M4O J;  2AHQ A;  2LLK A;  3PO2 J;  5EF6 A;  2KT0 A;  3Q0U A;  3ZOB A;  1WGX A;  2H8R A;  3LHQ A;  1I6H J;  3MN2 A;  4JYK A;  1F43 A;  1A6I A;  2G0E A;  1FEX A;  2RAS A;  3MNL A;  5C4J J;  4M3B A;  2CU7 A;  4X1E A;  2VI6 A;  3O60 A;  3OIO A;  4A69 C;  4GCK A;  3H0G J;  4W97 A;  3JRH A;  3V78 A;  5D18 A;  2JA7 J;  1AKH A;  3HOW J;  1U8B A;  5FKL A;  2NVY J; 
#chains in the Genus database with same CATH topology
 4DQ2 A;  1W4M A;  1ULY A;  3ELK A;  1TTY A;  5E18 F;  1BR1 A;  2UZK A;  5BMZ A;  3FBI B;  3FIS A;  4A3K J;  5JFR A;  1XMA A;  1L0O C;  1HOM A;  4CH7 A;  2VQH A;  2BY0 A;  3HRS A;  4AC0 A;  1Y1W J;  3MVP A;  2FOK A;  4FIS A;  1UHS A;  2E7X A;  2K86 A;  3GUD A;  5DD4 A;  2OTJ I;  1W7P A;  4HX4 A;  5HVQ C;  4KIS A;  2MG4 A;  5IT3 A;  4H4K C;  4XIC A;  3EQL F;  4BBR J;  1IRG A;  4Y4R A;  5CJ9 A;  5HLH A;  1U5T C;  2A2F X;  2NX4 A;  2UV1 A;  1Z1D A;  3F0C A;  1SMY F;  4M9X A;  2GLO A;  4IRV A;  2ME0 A;  2ZNY A;  4E6K G;  4EGY A;  2EFW A;  2EZK A;  5CW8 A;  2WY7 Q;  2HI3 A;  3M8F A;  1FOW A;  2CW7 A;  3A4C A;  1QPI A;  2JWT A;  1IV6 A;  3T0Y A;  2C6Y A;  1JKQ C;  4DW6 A;  4C2T A;  3EUA A;  4AIJ A;  5B5E C;  4ASN A;  2EWN A;  4LLN A;  1Y8R B;  3CZ6 A;  2QTQ A;  3S2W A;  4WF2 A;  2I10 A;  4C3J J;  1N25 A;  3F8M A;  3CRJ A;  1D1A A;  3BPX A;  4Y52 J;  4II3 A;  1W7P D;  2VBX A;  3CF5 F;  4N9I A;  4P1W A;  5KAF C;  2WUI A;  2E34 A;  4UV8 A;  4UV9 A;  2UXH A;  4EQQ A;  4GCT A;  2MBF A;  2BXZ A;  2GIZ A;  1PP7 U;  2EV6 A;  2NVT J;  1MGT A;  4HNV A;  4LK0 F;  4ESF A;  4AIK A;  1EH8 A;  1MJA A;  4ON0 A;  2MLG A;  4DYC A;  2PQ8 A;  5DD8 A;  1GDT A;  3VTI A;  5CQE A;  3KKC A;  1IC8 A;  2BEO A;  3J7A O;  1I1G A;  5M3F J;  2CQN A;  1BR2 A;  2K85 A;  4RBO A;  3DBL B;  3RIR A;  3BZK A;  2QEN A;  2DFI A;  3LL7 A;  1IN6 A;  4UUT A;  2DLL A;  3D1N I;  2IRF G;  2KIF A;  2HTJ A;  2DDA A;  4QTR A;  3EGQ A;  1FTT A;  1UHW A;  2DJN A;  1P6R A;  3FIW A;  1LJ9 A;  1VQ8 I;  4ZYE A;  3K2Z A;  3K4K A;  1E3O C;  1HKQ A;  5LEJ A;  1QPM A;  4IL6 C;  3WTW C;  4BE1 A;  3ZMV A;  1ETO A;  3MKZ A;  1V4R A;  2IVM A;  2W84 A;  4BEH B;  2XF7 A;  3CMA I;  1WI3 A;  1ZGW A;  4RB2 C;  3I64 A;  3E6C C;  3DF8 A;  1H0M A;  4CUG A;  2Y9Z A;  4I09 A;  3K1P A;  3OYJ A;  5JR3 A;  1R71 A;  1N78 A;  4MXM A;  2ZC2 A;  2LMD A;  4I01 A;  2E1M C;  4K2E A;  4GCL A;  1GXQ A;  5JHU A;  1IN4 A;  1KQ0 A;  3HOV J;  3J81 K;  2MSY A;  2YR2 A;  3I58 A;  4G7H F;  1B59 A;  1ETW A;  4ZTF A;  1O4X A;  5CXI A;  2QKL B;  4PDK A;  3I4M J;  4RLF A;  2D45 A;  3P9K A;  3ZN0 A;  2PJR A;  1SD7 A;  4WXD A;  1OCC H;  4B1R A;  1C0W A;  3GFM A;  4MFE A;  1G59 A;  1YHQ I;  2FNA A;  4AVZ A;  1S29 A;  5AON A;  1VQP I;  1OJL A;  2FRH A;  2CSO A;  3GXO A;  2DXI A;  3VW2 A;  2R5Z B;  1OPC A;  4QLC U;  1KZH A;  4IHW A;  4E7S A;  3BCG A;  4XOP A;  3F23 A;  1QVU A;  5KVR A;  2HU9 A;  3OL4 A;  3EUP A;  1I6X A;  2LRE A;  3I59 B;  4KIG A;  3QOP A;  2M45 A;  1RES A;  2XAG A;  1CF7 B;  3OS0 A;  1MSF C;  5DDG A;  2YX4 A;  2X0L A;  3OR2 C;  1D0Y A;  3OYF A;  3PSF A;  3PM1 A;  3MKW B;  4LJZ F;  1D1B A;  2O7O A;  1R5H A;  1DDN A;  3MEX A;  2G7U A;  1ZR2 A;  4BAC A;  3DFG A;  3A03 A;  4IHX A;  2BV6 A;  2DA4 A;  1YS7 A;  2XB5 A;  3QQA A;  5H6Q A;  1LEB A;  1UB9 A;  2X1D A;  1ZLK A;  3V8L A;  2AQE A;  2FBQ A;  4M3G A;  4L18 B;  2R7O A;  2O5R A;  4IRH A;  3GEU A;  1SAU A;  2ZSH B;  3EDP A;  3WHB A;  3KE2 A;  2QBY A;  5IOZ A;  3FKI J;  3H92 A;  3COA C;  3FK7 A;  2WGB A;  3WTY C;  3DU6 A;  1SEU A;  2ZOY A;  5EEA A;  3HSR A;  3VSL A;  4JNN A;  3K1N A;  2WB1 A;  1GVJ A;  2JRM A;  3S1R J;  3NWS A;  2ZJQ F;  2M34 A;  2GA2 A;  1IW7 F;  3KKD A;  4H0E A;  4KWA A;  2DA6 A;  2ME6 A;  3KEQ A;  1HW1 A;  5CVV A;  5E79 C;  1Z91 A;  4Y15 A;  2KL4 A;  1FYM A;  1PDN C;  1XCV A;  2ICW G;  1SVO A;  4CCM A;  1HKT A;  3MMY B;  2CV0 A;  2PLY A;  4ZJZ A;  3BT9 A;  2KKO A;  1G2H A;  2G7S A;  5L3E A;  3PQK A;  2A07 F;  1QO0 D;  3ANG A;  2X9D A;  5LGT A;  1GVD A;  2BE5 F;  3HUG B;  1U5T B;  1SFE A;  1H88 C;  4MEY F;  4PCQ A;  1G8X A;  1MJ9 A;  3FBN B;  4A3G J;  3ZMZ A;  1YRN B;  4HW0 A;  5JLW A;  3PSI A;  2XRO A;  1P92 A;  1R1T A;  2WV0 A;  2YPR A;  3IP4 B;  4KFC A;  3JW4 A;  3FMS A;  2H1K A;  2TCT A;  2CUF A;  2OQR A;  2EA2 A;  2CV2 A;  1YW7 A;  3QOD A;  4ESJ A;  3ZMD A;  1HC8 A;  3VYT B;  3V8K A;  4EM0 B;  4YII A;  5FJ8 J;  3Q9S A;  3T5X A;  3CUQ A;  3G4S I;  3B73 A;  2WAQ A;  5F04 A;  2XV4 S;  5EFY A;  4ESB A;  1W36 C;  3G1L A;  3S1Q J;  2DT7 B;  2DDB A;  2Z16 A;  1R5I D;  3DEW A;  3CCQ I;  3RCO A;  2PBX A;  2RVC A;  3IUO A;  4HAM A;  3JRF A;  1CQT A;  2GOM A;  4P9F A;  1YW9 A;  3H9J A;  2X48 A;  1VQ7 I;  3SJM A;  4U7B A;  5IYC J;  1MNE A;  2NOG A;  4YG2 F;  3HTH A;  3H3V K;  1JUP A;  3K8P C;  5FGL A;  3BLY A;  1OMI A;  3BJO A;  1ZHF A;  2QCO A;  4B47 A;  3OYD A;  2VE8 A;  3M1C A;  1Y0U A;  2W57 A;  2ZME A;  3F6O A;  3LMM A;  4A2U A;  1EKE A;  3GTQ J;  5D5U B;  4Y13 A;  3PUF A;  2HNH A;  3KEY A;  3KYL A;  2DG8 A;  2BGC A;  2IBD A;  5M5W J;  1HBX G;  3C7J A;  4KIF A;  2CYY A;  2W4S A;  1E0E A;  3BJ6 A;  4IF4 A;  5CVI A;  1DGW Y;  1QNT A;  4IXA A;  1JKR C;  5GAG J;  3QYB A;  4ITV A;  1LNW A;  3OV8 A;  2HOA A;  1E2X A;  2G9W A;  5K7F A;  2UXO A;  2E1O A;  5J47 A;  4JQF A;  5HAW A;  1TT5 B;  3BQY A;  4IKF A;  1SFK A;  2ISY A;  4N0B A;  5ILV A;  1S6L A;  2DYR H;  2E1M B;  4A6D A;  2ID3 A;  3KZZ A;  4RM3 A;  2ZY9 A;  3AG2 H;  4OD4 A;  3RYR A;  1ZK8 A;  2CW0 F;  1X2N A;  1D0X A;  4M9Z A;  3H9Q A;  4HA8 A;  4NHJ A;  3I4N J;  4UVB A;  2UXP A;  2A69 F;  2P6S A;  3CLQ A;  2DT5 A;  2QVO A;  4KDP A;  3BG7 A;  2ZNZ A;  2R7S A;  5FRM A;  3FXL A;  5C4X J;  3IH2 A;  2HXI A;  2KLO A;  3FK6 A;  4J01 A;  4ZYD A;  2ZBK A;  4XID A;  2HYJ A;  3GFJ A;  1VFC A;  3FKJ A;  5KAI C;  1EJ9 A;  2KMU A;  1FBQ A;  3K7A J;  1UFM A;  3DKW A;  3OMY A;  4D7M A;  1XMX A;  1HLV A;  5K7H A;  1NK2 P;  4MNU A;  5IP6 A;  3RDI A;  3V7R A;  4E7H A;  2IU5 A;  3S32 A;  3HOT A;  1JXS A;  3MCZ A;  1TWH J;  1S7E A;  3VB2 A;  1T08 B;  4PFP A;  3D5L A;  4R8H A;  4M9S A;  3JRA A;  2P5L C;  4J19 A;  2OI8 A;  2XGC A;  5HOO A;  1V5E A;  4HOB A;  1BOB A;  1LFU P;  1XG1 A;  4AUX A;  1MNM C;  1FBS A;  1Y8Q B;  4BHP A;  2L01 A;  5E8I A;  2ZXJ A;  2HOS A;  1ZH5 A;  1JHH A;  2FSW A;  1BN5 A;  3C1D A;  5F0C A;  1WJD A;  1T6S A;  2OJE D;  3DBH B;  3BQZ A;  3LQR A;  3SEZ A;  1LUJ B;  3BCA A;  2MAB A;  4L9J A;  4BXU A;  4EJW A;  1HDD C;  4ENN A;  2L5Q A;  2KRF A;  2D5V A;  1UG0 A;  2RAE A;  3BRO A;  1MH3 A;  1R9T J;  3OYG A;  4EM1 A;  2FBK A;  3ABT A;  2VKE A;  2OA4 A;  3ABM H;  3SHF A;  2X85 A;  3FXR A;  5E1Z B;  1UJ8 A;  4PXI A;  3A01 B;  2O9L A;  1I1S A;  2HTS A;  1OQY A;  2ZJ2 A;  3S1M J;  4QPO A;  2PBI A;  5J4V A;  3ZQH A;  3RKY A;  4BEH A;  1UAA A;  1D0Z A;  2XUB A;  5A2Q Z;  1B72 B;  2XPW A;  5H2F C;  2R7R A;  3ZN1 A;  3TED A;  4KYW A;  2ELJ A;  3HB9 A;  2EA4 A;  5BPD A;  2FBH A;  3NXC A;  2QWW A;  4UVC A;  4F55 A;  3B81 A;  2G7L A;  3W2V A;  5J3L A;  3VOD A;  2OC6 A;  1TQP A;  3CJR B;  4N9H A;  2V9V A;  5EGO B;  1Z7L A;  2O8K A;  4CGR A;  3HRU A;  2MD5 A;  5J1R A;  3V7C A;  5HDN A;  1YIT I;  3K69 A;  3H5R A;  4M6Y A;  4DIQ A;  3LSI A;  3TGN A;  4NQW B;  1RKT A;  3R6S A;  1FWZ A;  3WU0 A;  1DUX C;  1IV8 A;  3WOD F;  4YFX F;  4HYE A;  2VON A;  1HA8 A;  4HF1 A;  2B9S A;  3OSG A;  4G6Q A;  2NNY A;  3QAH A;  3CWR A;  3P7N A;  4CA0 A;  3GFL A;  2IGM A;  1U2W A;  2KZV A;  5DYM A;  1OYY A;  2CH0 A;  4F93 B;  2IGO A;  4A5M A;  1RIO H;  3HTS B;  1AA7 A;  3V42 A;  1OIS A;  2IA0 A;  3OIQ A;  1VQL I;  3CCE I;  3L2U A;  2EIJ H;  1HXD A;  5FRN A;  2QZ8 A;  1MMS A;  3S8P A;  3I59 A;  3I71 A;  3ASN H;  1R58 A;  1CF7 A;  3I5U A;  5DTD A;  2ZJP F;  3IC7 A;  4NEL A;  4EVI A;  2QSG X;  5EF6 A;  2KT0 A;  1X1B A;  3GZN B;  1TW3 A;  3ZOB A;  1YG2 A;  2XGX A;  3SDB A;  2B7E A;  4JYK A;  1F43 A;  2G0E A;  1FEX A;  1K4S A;  4M3B A;  2F5C A;  2FA5 A;  2XAQ A;  4GYI A;  3O60 A;  1R49 A;  2FEZ A;  2M4G A;  2CUZ A;  4GCK A;  4W97 A;  3BDD A;  3ERM A;  4PZJ A;  3JRH A;  5D18 A;  2JA7 J;  3D0S A;  5FKL A;  2HZT A;  5L3D A;  1TNT A;  2PMZ A;  3KP5 A;  1YS6 A;  3DCF A;  1XN7 A;  2WB1 N;  3IV5 A;  2DQR A;  1MSE C;  2VBZ A;  3EYY A;  3OL3 A;  4AYB A;  3FMR A;  1XPX A;  3DWL E;  3GVA A;  1BOA A;  1X3U A;  4XLA A;  4DGW B;  3CCS I;  3ZPL A;  3HOY J;  4ICH A;  5F1R A;  4IHY A;  2VPR A;  4G6T B;  2L4M A;  5HNH A;  3WU1 B;  1YI2 I;  1ETX A;  5IP9 J;  3LSG A;  3VEP A;  3O3K A;  2A61 A;  3FMQ A;  2EZI A;  3V7S A;  5FMP A;  4A6E A;  4D7N A;  4OWR B;  5EYR A;  3FXJ A;  2DFH A;  3BZ6 A;  2CQQ A;  3HUG A;  1U5T A;  3BP8 A;  2H8W A;  2IEK A;  4LMY A;  3OWT A;  3PNV A;  3TO7 A;  1WVR A;  4ABZ A;  3JRE A;  1S7A A;  4UUV A;  3JTG A;  2OER A;  1Z9C A;  3SQN A;  1YRN A;  1F9N A;  4XNF A;  3ZQQ A;  4DYR A;  1QU3 A;  3LAJ A;  4XRS G;  5D8K B;  2OPT A;  2XAS A;  1JI8 A;  2JJ7 A;  1W5T A;  2GWR A;  2YU9 J;  2VOD A;  1ZG3 A;  4CIC A;  2NXN B;  4BAY A;  4KN4 X;  3CO6 C;  2RNG A;  2CO5 A;  3QOE A;  5HS8 A;  4IQ4 A;  5FLV A;  2D6Y A;  1MBE A;  2MH9 A;  4EJO A;  1MBF A;  3DEU A;  5K5Q A;  1EV7 A;  2NP3 A;  3CDL A;  4CXF A;  2WAQ N;  2VXD A;  4BE2 A;  4D5C A;  2E35 A;  2V9K A;  1JUM A;  4HQM A;  2RQP A;  4XLN F;  1GXP A;  1U0J A;  4A0Y A;  4IO9 F;  3BY6 A;  4ETS A;  3BNI A;  4ZYG A;  3QYE A;  1XGN A;  4FE7 A;  5LRS A;  1X19 A;  3RQI A;  3NAR A;  2K5C A;  4MHG A;  2IT0 A;  2LD5 A;  3RQ4 A;  1FTZ A;  1SD6 A;  2L7F P;  2YVX A;  4BGD A;  4LB6 B;  3TP3 A;  3GLX A;  4DZP A;  1A04 A;  3A02 A;  2XAF A;  1BW6 A;  1PVE A;  1DQU A;  4IHT A;  3LOC A;  2OQG A;  2DA2 A;  5GTI C;  4Z6Y A;  2OAZ A;  3HIM A;  4XRM A;  3K4C A;  1A5J A;  2W25 A;  1T95 A;  2NS0 A;  3P9C A;  1WJE A;  3L9F A;  5F08 A;  4FX4 A;  3IL2 A;  4E7J A;  4BXX J;  3E5U A;  5J1U A;  2FF4 A;  4RM2 A;  2PMU A;  4XLC A;  5CVU A;  3GYH X;  4F92 B;  1LEA A;  4PJN A;  4JOM A;  4U0W A;  2JK3 A;  2XGE A;  4R79 A;  4FTH A;  1FOX A;  5FKN A;  5FFZ A;  3T1B A;  3I55 I;  4MEX F;  4GDF A;  5CPR B;  1PUF B;  2CUJ A;  3ZCO A;  2ID6 A;  3CC7 I;  5LEK A;  5E1W A;  1MDM B;  4AC6 A;  2DMQ A;  2VQG A;  3N05 A;  2R7X A;  1D5V A;  3ESW B;  2OU2 A;  1ON2 A;  4G9Y A;  2JA2 A;  5IY5 H;  3BR2 A;  3GW2 A;  4JX5 A;  3M8J A;  5L3B A;  3TOB A;  4HLY A;  3LSJ A;  1XSD A;  2E2I J;  5TIS C;  1O3T A;  3DKX A;  3NAU A;  4BQA A;  2VB6 A;  3E3V A;  2VOP A;  2LVS A;  1XSX A;  2JUG A;  1I3Q J;  2ZO4 A;  1JT0 A;  1SFX A;  2RNJ A;  3LA2 A;  1ZR4 A;  4Q48 A;  5BPI A;  3OOU A;  1J5Y A;  4C30 A;  1LDJ A;  1VI0 A;  1ZEL A;  2Z99 A;  2L2O A;  4I0B A;  2MH2 A;  1GT0 C;  2L02 A;  5LLQ A;  2VBW A;  2KZG A;  4PFO A;  1SFU A;  1JHF A;  2DOE A;  4LLL A;  2BZT A;  3OYC A;  3FRQ A;  3JAM Z;  4RGS A;  2W24 A;  1PYV A;  4ZZL A;  1FYL A;  2ECB A;  2QWT A;  2IGK A;  1WRJ A;  2NNN A;  4IRG A;  3GX4 X;  1F4K A;  2EV5 A;  3GFI A;  3TW6 A;  2Z33 A;  3FXU A;  2JVG A;  4NN1 A;  3DPU A;  1RUO A;  2VXZ A;  3QBM A;  1X1A A;  3K1M A;  2BHZ A;  4FHT A;  3BJB A;  3ASO H;  3CME I;  5L3F A;  4BL0 B;  4DBQ A;  2H6C A;  2CJJ A;  1KU3 A;  1IO2 A;  2IJL A;  5HNF A;  2HGC A;  4HPQ A;  1HDP A;  3VVZ A;  3VVY A;  2I5U A;  3R61 A;  4WX9 A;  5D1R A;  2XDN A;  2R5Y B;  3HBL A;  3ECH A;  2FX0 A;  2LH9 A;  1TWF J;  2VIX A;  3NS4 A;  4QWQ A;  3AQT A;  3RD3 A;  1HKS A;  4I0A A;  1V5G A;  4KT5 C;  2HOT A;  3A01 A;  1TBX A;  2JTV A;  4OIQ F;  2DTZ A;  2HWV A;  4RA2 A;  3R0A A;  4B43 A;  5FLM J;  3ZQC A;  4KT6 A;  5LHH A;  2AQF A;  2P7C B;  1QZY A;  2STW A;  1XGO A;  4PGG A;  2NS7 A;  1BC7 C;  3L2V A;  2GA1 A;  1B72 A;  1F1Z A;  4LG3 A;  2M9H A;  4DVY P;  2YS9 A;  3ABL H;  4NDL A;  2TRT A;  1SAX A;  2RQQ A;  1OCT C;  4X6A J;  4HG2 A;  4E7L A;  3K0L A;  5EGO A;  1O57 A;  2V7F A;  2CQK A;  1DP3 A;  4D1Q A;  4WWC A;  4HF2 A;  2K3P A;  4LGW A;  1TQI A;  1HW2 A;  3S17 J;  1TT0 A;  2XKP A;  4NQW A;  2KQR A;  2VOO A;  2IP2 A;  1OCZ H;  2Q1Z B;  1O3S A;  1OYW A;  1ZLJ A;  1KYZ A;  2FJ1 A;  1KGS A;  1WHU A;  1AOY A;  2QSF X;  2ZCM A;  2F5D A;  3AKZ A;  4RLQ A;  2HR3 A;  1YX5 A;  4CZC A;  4LIU A;  2LFB A;  3JSP A;  2XGD A;  4HLX A;  1ORK A;  1IXC A;  5JVG F;  5C4Y A;  5C44 J;  2CUE A;  5FKK A;  2R7T A;  4GYG A;  3HTA A;  2CRG A;  3AL0 C;  2VJ4 A;  3L2Q A;  3WU2 C;  1U9N A;  1QA6 A;  2ZCN A;  4A3L J;  4UVA A;  3H0D A;  3KCC A;  3GTJ J;  4ZDO A;  1WI9 A;  2V9P A;  4MFD A;  2JPC A;  2DK8 A;  1PUE E;  2PZ9 A;  3GLL A;  2V6C A;  1D1C A;  2LK2 A;  2OD5 A;  3H1C A;  4IRI A;  3ECO A;  3OSF A;  4YEJ A;  3E5X A;  3HPH A;  3TO6 A;  3HOX J;  3QRF F;  3N4M A;  3COL A;  4C3H J;  2DMN A;  1I39 A;  2F4O B;  2ECC A;  4GFB A;  2QQB A;  5HDK A;  3GEZ A;  2E1C A;  1MBK A;  2PMZ N;  4RGX A;  1X4P A;  2JN6 A;  3F8C A;  5FO5 A;  3JSO A;  2G3B A;  4HF0 A;  1ON1 A;  2EH3 A;  3WTT C;  4XKC A;  2DA1 A;  4JX4 A;  3VYR B;  1W36 D;  2K7L A;  3CUO A;  3GZ6 A;  1YIO A;  1TL8 A;  2HVQ A;  2E1N A;  4LG0 B;  1X1D A;  1V55 H;  2BW3 B;  3I53 A;  2ELH A;  2WAE A;  1H9T A;  2F2E A;  1P4W A;  2PMH A;  2HQN A;  1IRF A;  1IGN A;  1SMT A;  3H36 A;  2UXU A;  4I2O A;  1YJ9 I;  2X4H A;  1R1V A;  5EJC A;  5C3E J;  5F6F A;  2NVU B;  4A3C J;  1WCM J;  5JLX A;  1USS A;  1X1C A;  1XD7 A;  4G6D A;  3LAP A;  1R1U A;  1Y0N A;  2K27 A;  4WIB A;  3LNQ A;  2P6T A;  2P8T A;  1ETK A;  2O0Y A;  3F3X A;  4QSH A;  5BQT A;  5IOY A;  2V1N A;  2Y75 A;  2R7D A;  2UXN A;  3D5S C;  3BWG A;  2MC4 A;  2ZOZ A;  2VC1 A;  3A0B C;  4L9T A;  3SZT A;  1S8N A;  2VN2 A;  2WC2 A;  3JAM K;  2M2E A;  4EV0 A;  3CCJ I;  3OR1 C;  1QZZ A;  4N4O B;  2QLZ A;  2VPL A;  2NS8 A;  1AWC A;  2ADU A;  2FMY A;  2BYV E;  3ROU A;  4A12 A;  3M7G A;  3TMO A;  2HPI A;  2DFE A;  4O6J A;  5J40 A;  3G1O A;  3QP5 A;  1FY7 A;  1MMN A;  3IUV A;  2PN6 A;  2E36 A;  5BS6 A;  2X6Y A;  2ZSI B;  3GO5 A;  2IS6 A;  3QPT A;  1JGS A;  2L9R A;  2VQC A;  3NWT A;  3RI4 A;  2JVH A;  4ACI A;  2MGQ A;  3VFZ A;  1QHH D;  1O3Q A;  3JR9 A;  2VAS A;  3VOE A;  4HDV A;  4JX6 A;  1OLT A;  4LFU A;  3QWL A;  2V26 A;  1DGR M;  5GPC A;  5AQC A;  2DN0 A;  3E7L A;  1IG7 A;  1FBU A;  4LIT A;  3B6C A;  4BQN A;  4YEL A;  4E7Z A;  4UUS B;  1ZG5 A;  3LSK A;  3FM5 A;  5GPA A;  5TRD A;  3P9T A;  3J7Y J;  4KA4 A;  2L7Z A;  1BM9 A;  1XGS A;  4RGU A;  2HQ5 A;  4XOR A;  2F48 A;  2LY1 A;  4V2G A;  2QEX I;  2M8G X;  3LWF A;  1WH5 A;  3GTO J;  3S14 J;  4X0G A;  3E6B A;  5FKO A;  2QIB A;  1J2X A;  3PIP F;  3FDY A;  2O3F A;  1V3F A;  1LVA A;  2EV0 A;  2XB0 X;  2O6G E;  3Q0V A;  3N97 A;  3W2W A;  5E20 A;  3G6E I;  3SDG A;  3MZH A;  2VJJ A;  3KP3 A;  3EUH C;  2A5Y B;  4F7Z A;  2CG4 A;  1I50 J;  3K70 C;  2G7H A;  3H9G A;  1BL0 A;  1ODD A;  1WJ5 A;  3SYT A;  2VQL A;  5L3C A;  5D5V B;  3CTA A;  1PUF A;  3G56 A;  3VDX A;  2KFD A;  2DA3 A;  2EZL A;  2JUC A;  1MDM A;  1POG A;  5BNG A;  3HHH A;  1TWG J;  4B48 A;  3A2K A;  2P5K A;  3RPQ A;  2LY9 A;  4BDZ A;  4HRI A;  3VUQ A;  1XSV A;  2LBF B;  3CLO A;  2VKV A;  2M87 A;  4EJV A;  2FE3 A;  3PL8 A;  1OCO H;  3M3Y J;  3IRR A;  3VOX A;  1QHG A;  2KIU A;  3BZC A;  2LR8 A;  3IRQ A;  4ENK A;  5CLS A;  4HNT A;  2EFO A;  1Y1V J;  4I6Z A;  3OS2 A;  1DU0 A;  4KNY A;  3PQJ A;  1IRZ A;  1FZP B;  5K1Y A;  1BJZ A;  2QKM B;  2E71 A;  1WJB A;  2E7W A;  2K4J A;  5F64 A;  3BHQ A;  5EZH A;  4AWX B;  2DG7 A;  4V2F A;  1UEL B;  1U3E M;  3HKZ A;  5J8F A;  2BY2 A;  2DMU A;  2PEX A;  2RGV A;  3KZY A;  3AL0 B;  1ZAO A;  4QPQ A;  3FWE A;  2HEO A;  3TL4 X;  2AHQ A;  2LLK A;  3FX3 A;  2LNB A;  2XAH A;  3TOA A;  1VQM I;  1S3J A;  3MZY A;  2H8R A;  3KYC B;  3DTI A;  1E3H A;  5D6E A;  3T8T A;  1R5G A;  1R4N B;  1A6I A;  4PGH A;  4GCV A;  4XLE A;  3MNL A;  3WGI A;  5C4J J;  2KDO A;  2VI6 A;  2NOJ B;  3H0G J;  2O61 A;  4P96 A;  2W1O A;  4KIB A;  4NBQ A;  3F9K A;  1FMV A;  3FHN A;  2NVY J;  2D1H A;  2R5Y A;  1I5Z A;  4GO1 A;  1R6R A;  1BI0 A;  3VWB A;  2HVS A;  2GAU A;  2VJ5 A;  2DOF A;  1H9G A;  1VND A;  4HX8 A;  3G3Z A;  3NPI A;  2V6E A;  4CYC B;  2KHM A;  1MD0 A;  4JP0 A;  2EJR A;  1JGG A;  3TO9 A;  2FD5 A;  3ZMT A;  2M4K A;  4JL3 A;  3W6K B;  4LD5 A;  2M8E A;  1DU6 A;  2KRH A;  5J4Y A;  3JSJ A;  3G7R A;  3OYI A;  4AF5 A;  1Z21 A;  1VQ6 I;  1G3Y A;  4UY8 I;  3E5Q A;  4XOT A;  1SD5 A;  1A6Q A;  1LVK A;  2WBM A;  5E3M A;  3ZQF A;  4MIM A;  2QM3 A;  2F6C A;  2ZKZ A;  3HOU J;  3BR1 A;  3QPH A;  3PIO F;  1AKH B;  4XMY A;  5GTH C;  2AO9 A;  3G1M A;  3RJP A;  2CFX A;  3WGG A;  1OCP A;  2EK5 A;  4M3D A;  4XQF A;  1U6G A;  2VC0 A;  5E3N A;  3L7W A;  1RUN A;  1R36 A;  1Y6I A;  5J1Y A;  3W2A A;  1W0T A;  3MZ8 A;  2DBB A;  2K40 A;  2KJC A;  1HQC A;  1TWA J;  4HST A;  3F72 A;  2QOP A;  3ONQ A;  2DPD A;  2GXB A;  3LST A;  2K4B A;  5H6R A;  4PJJ A;  2EFQ A;  1FC3 A;  1X3Z B;  3B6A A;  1MJB A;  1W1W E;  2LC2 A;  3C3W A;  4U87 A;  2FQ4 A;  4XSZ F;  2GXA A;  4W1U A;  1VF9 A;  2DQL A;  1HF0 A;  3CC4 I;  4L9V A;  4UNO A;  5EDN A;  4OAY A;  3GBG A;  5B1B H;  2BHY A;  3KZ9 A;  1G6N A;  3IAM 2;  4M6X A;  5GAH J;  3VW0 A;  2EIK H;  4L62 A;  3JRI A;  2GM4 A;  2L9V A;  2FUG 2;  3ZQ7 A;  1T0F C;  2O7T A;  1NK3 P;  2LP0 A;  1EA3 A;  4M71 A;  1T8I A;  1P4X A;  1UMQ A;  1MMG A;  2EZH A;  5D6F A;  2R92 J;  3A0H C;  9ANT A;  4CCN A;  3R0J A;  4A3I J;  1KQ9 A;  1HW5 A;  3OYM A;  5EEH A;  5HSZ A;  2EFP A;  4CGZ A;  1MMA A;  1TW2 A;  2Y48 A;  2MYS A;  4XK4 A;  2RN7 A;  4C2M A;  3C07 A;  1T56 A;  2M7A A;  3AG3 H;  1ZRC A;  1K6Y A;  4CDG A;  1YLF A;  4DYQ A;  2OBP A;  4BH9 A;  1R22 A;  2KP6 A;  1MH4 A;  4GXO A;  1ZGJ A;  1WH7 A;  5HBU A;  4LG0 A;  5FD5 A;  4YFK F;  2R5Z A;  3O6B B;  5LHI A;  1VQK I;  4A3F J;  1ITY A;  3MAJ A;  1JTY A;  4Q47 A;  5HLI A;  2IPQ X;  3BC8 A;  2KDZ A;  2VL8 A;  4MK6 A;  2P81 A;  4BYY A;  4BHC A;  3JCU C;  1KA8 A;  4FQG A;  1U9O A;  4XN3 A;  5GAD J;  5H20 A;  2KPM A;  3NRV A;  5M5X J;  1ZRE A;  2P7V B;  1G3W A;  3IKV A;  4YIF A;  2IS2 A;  3CJD A;  4LLG F;  2KJB A;  2TDX A;  4LOC A;  4BKX A;  1VQ5 I;  4E70 A;  4MGR A;  1X1P A;  3HE0 A;  3BTC A;  1J9I A;  2F5F A;  5KNL A;  3M07 A;  1BC8 C;  1DPU A;  2M0C A;  3JRD A;  1P7J A;  2Y31 A;  2OCE A;  3NI7 A;  1QVT A;  5J6X A;  3NEU A;  4B3A A;  3KIO A;  1E17 A;  2L9N A;  2ZXI A;  2K9M A;  3KNW A;  2DCE A;  4L5E A;  2RDP A;  1SVL A;  1BI2 A;  1LKX A;  1QZE A;  3VYS B;  3QYF A;  1WSU A;  3D5R C;  1K61 A;  5D19 A;  4B4C A;  1IUF A;  2R0Q C;  4P9U A;  1U78 A;  2PI0 A;  3F1B A;  2V79 A;  2JT1 A;  4JBA A;  2ZXH A;  3RKW A;  2M1B A;  2N8G A;  5BOX A;  5HLG A;  2WTE A;  1S9H A;  5J8C A;  3CCU I;  2EBI A;  2GZW A;  2IW5 A;  2BVM A;  3KP4 A;  1YJW I;  4MTE A;  5E3L A;  5TJJ A;  1KYW A;  2P5V A;  4FAS D;  3S3N A;  4C2M J;  2W7N A;  1O7F A;  3HOZ J;  2LF8 A;  2HXO A;  5LBQ A;  5FRO A;  3K4B A;  1FP2 A;  4XLH A;  4UUS A;  3ERE D;  1K83 J;  3DTE A;  2KIS A;  2QKO A;  1FX7 A;  2IS4 A;  1Z77 A;  1N75 A;  3HTI A;  1WQ2 A;  1EH6 A;  1LE8 B;  1YYV A;  1QGP A;  3AG1 H;  1YX3 A;  2BY3 A;  3DU5 A;  3KZI C;  2YUS A;  2W00 A;  5ILU A;  3GTM J;  2W82 A;  4MTD A;  4ENM A;  3CD6 I;  1D5Y A;  4M3E A;  3HRM A;  4I76 A;  5DS9 A;  5ICG A;  3EPZ A;  3VPR A;  4NUB A;  5HLT A;  2JSC A;  5AIQ A;  2NYX A;  5DCM B;  4GRI A;  5IT9 Z;  2QBY B;  4UHT A;  4U0Y A;  3GWZ A;  1F5T A;  2Q0O A;  1OCR H;  4KN7 X;  3RPU A;  1LPQ A;  3KYD B;  2WY8 Q;  3ZP5 A;  1FLI A;  4RB1 A;  2FNP A;  1MND A;  3VSK A;  1MIJ A;  1Z0X A;  1TZL A;  2LBF A;  5FFX A;  4E7K A;  3DV8 A;  3Q3S A;  2R7V A;  3MKL A;  2GXG A;  1SGM A;  2DOA A;  5DUK A;  1FOK A;  3W3C A;  3QPL A;  1JJ8 C;  3ISP A;  4HDU A;  4GFK A;  2VJI A;  1RPW A;  5IP7 J;  5TGT A;  1VQ4 I;  1FSE A;  2X6W A;  4V19 K;  3SZP A;  4OIP F;  2DMT A;  2MLK A;  3LA3 A;  5A2Q K;  4G94 A;  3L2C A;  3DKY A;  3DLA A;  3HKZ N;  3ZMS A;  3KEO A;  2E2H J;  1BR4 A;  2Y0S A;  4Y3O A;  1QRY A;  1Z67 A;  4P5O A;  3OYH A;  4A3E J;  3RTR A;  3RPU D;  3O2P E;  2HDC A;  1BI3 A;  2JA5 J;  3QU6 A;  4BQO A;  5EEG A;  1W0U A;  5ED4 A;  1J0R A;  2AXL A;  2MW8 A;  1UCR A;  5FGM A;  4Y33 A;  1WWX A;  1LDK B;  3ZMU A;  1M1E B;  4L0Z B;  3SZG A;  1B1B A;  2RKH A;  4L9N A;  3Q9V A;  4HZF A;  3S3M A;  2JQ7 A;  3HHG A;  2P4W A;  3K10 A;  5DAJ A;  1DP7 P;  2P0W A;  1KU2 A;  4U88 A;  4ANJ A;  3RZD J;  3C2B A;  3FHZ A;  2RV8 A;  5FHP A;  4KMF A;  3E0J B;  4IOA F;  2A68 F;  3VIB A;  4MLO A;  4A93 J;  5M3M J;  1STZ A;  4KUM A;  3ZQI A;  3S2D J;  4HKU A;  2ZFW A;  3ULQ B;  1X4O A;  2O03 A;  5CYV A;  4CYC A;  1JKO C;  2K02 A;  2K3F A;  1LDD A;  2CQ7 A;  3ZR8 X;  1FSH A;  2UWM A;  2BXY A;  3HZJ A;  3I54 A;  3EET A;  5FLX Z;  2XHK A;  4KMU X;  2ZXW H;  4IX7 A;  1APL C;  5CQG A;  4WCG A;  5D4R A;  3GZ5 A;  3ABU A;  1H89 C;  2NVX J;  4BXF A;  3F22 A;  2VT2 A;  4RDU A;  1VQO I;  3CC2 I;  1V54 H;  3P9I A;  4UDS A;  4FT8 A;  2QF7 A;  1XC5 A;  3RYP A;  4ZYH A;  5JHF A;  2FML A;  5CVR A;  3S1N J;  1YO5 C;  2UXI A;  4OD5 A;  3HGY A;  3CJQ B;  4F52 A;  2COB A;  2E19 A;  2X1E A;  2L3D A;  3FXM A;  1IUY A;  3ON2 A;  4BBS J;  2CW8 A;  1WJF A;  2W53 A;  5IPA A;  1ZTR A;  3PFY A;  2Y69 H;  2VLA A;  4AD9 A;  2B3W A;  1N77 A;  2O8X A;  2PX9 A;  3HGG A;  3KP2 A;  4E7I A;  2QSH X;  2UUZ A;  1ZRF A;  2GFN A;  5GAE J;  4L0Y B;  2DPU A;  1OYI A;  1UST A;  4IJA A;  4M72 A;  3FXK A;  3IWF A;  2DU9 A;  3G71 I;  3G73 A;  2WV1 A;  3S3O A;  2M30 A;  3GCM A;  3HPG A;  3BG9 A;  4D5F A;  1K78 B;  3PJR A;  5LGU A;  2DAO A;  3EYI A;  3B02 A;  2V57 A;  4F3Q A;  4IEJ A;  2L0K A;  4NNJ A;  2XPU A;  3K6G A;  3JRG A;  4DJA A;  3O8H A;  3ZRG A;  4U9L A;  2ETH A;  3K4M A;  2Z5U A;  3LQQ A;  1IDY A;  4WK8 F;  1YE9 A;  4S04 A;  2JSP A;  2FQ3 A;  2K9L A;  2FBI A;  1TNS A;  3TDZ C;  4IOC F;  1TQM A;  2DT6 A;  3DXJ F;  2LKX A;  1LQ1 A;  4MO7 A;  3ABK H;  1IXR C;  4ZDL A;  5HOD A;  3VYU B;  3IKT A;  3IH4 A;  3M9A A;  2ESH A;  4AU7 A;  3DQV C;  4L5I A;  4HEA 2;  1RET A;  4XLF A;  2Z9O A;  5LHG A;  2NP5 A;  5IT9 K;  3G2B A;  3WG9 A;  2HOE A;  3E6D A;  3HEF A;  3UNG C;  3CJT B;  4XRF A;  4ZYA A;  2VT3 A;  2CMP A;  3QPS A;  3IWZ A;  4AM3 A;  1TLH B;  2DI3 A;  1B6A A;  3ML6 A;  2OTL I;  3EUH A;  2L9S A;  3HRT A;  3H3Z A;  3PFI A;  4XON A;  3IHU A;  4EJU A;  4MQV A;  2IXS A;  2F5V A;  4C9Y A;  4ME9 A;  2JMW A;  1NTC A;  3HTJ A;  2F4I A;  1IN8 A;  5HS9 A;  2X51 A;  2OV7 A;  2GEN A;  4PSX A;  3WTU C;  1P7I A;  5F1J A;  4RGR A;  3KET A;  2DOD A;  3CP2 A;  1JTX A;  2R3S A;  3Q0W A;  2B63 J;  5HDG A;  1JUS A;  2R7W A;  3K9T A;  1WKM A;  3KP6 A;  4DBR A;  1UHM A;  2QQ9 A;  2OUM A;  4PUS A;  2Z2S B;  3CQZ J;  4KIT B;  3RSN A;  2PJP A;  3LSR A;  4RS8 A;  4CCK A;  3CO7 C;  3PO3 J;  2J5O A;  3KP7 A;  2YU3 A;  4UB6 C;  1ETV A;  3LSH A;  1J7K A;  4RB0 A;  4AYB N;  3K70 D;  1D8K A;  2R93 J;  2DJI A;  2I8D A;  1Y56 A;  2HQA A;  5D5W B;  2HVR A;  4HBL A;  5KCM A;  3BCB A;  2QYO A;  1FJL A;  3M4O J;  1YW8 A;  1QQI A;  2XC7 A;  3TDU C;  2DTR A;  4EM2 A;  4DNC A;  1T2K A;  5LGN A;  3LHQ A;  3LFK A;  1OR7 C;  4CCO A;  1G3T A;  1I6H J;  3RH2 A;  2FU4 A;  4X1E A;  4II2 A;  3F8F A;  2OCC H;  4HV6 A;  3OOP A;  2DW4 A;  4A69 C;  5D8L B;  2HDW A;  1K7A A;  5FB2 A;  3A1Y A;  1S72 I;  3IAS 2;  1G3S A;  2H1L A;  2M5W A;  4MQ9 F;  2BVL A;  1T39 A;  4ZZD A;  1OKR A;  1R4M B;  3C2H A;  4A0X A;  4BJ5 C;  4G7Z F;  1CGP A;  4WXC A;  3I56 I;  2XSD C;  1TWC J;  2BOL A;  1LE8 A;  5FLX K;  3T6N A;  4UB8 C;  1LFB A;  4P55 A;  1Q1H A;  1RNL A;  1MMD A;  3L1P A;  3QKX A;  3VOK A;  3MKY B;  2Q2E B;  3WTX C;  2K9S A;  2XSJ C;  5JVT A;  2GIV A;  2D2W A;  3I9V 2;  3NRG A;  3AG4 H;  5DCM A;  2V1X A;  4EMS A;  1DPR A;  2EQR A;  2VE9 A;  4R1H A;  3NQO A;  4RAZ A;  2XAJ A;  1AHD P;  4AVP A;  3DP7 A;  1ACI A;  3DEE A;  3L09 A;  2L4A A;  3X2Q H;  3BR5 A;  4BS9 A;  5IYB J;  2QA4 I;  1RR8 C;  1WJC A;  3OYL A;  1B8I B;  4A3M J;  1K6O A;  5EG0 B;  2JPB A;  4BY1 J;  5D4S A;  1AU7 A;  3BR6 A;  4G12 A;  5CVJ A;  3E97 A;  1NG7 A;  1L3L A;  4RMN A;  4BJ6 C;  5ICC A;  3W6V A;  3S15 J;  1FNN A;  2E5N A;  1GV5 A;  3I3L A;  3LFU A;  5E8G A;  3WE3 A;  3PNY A;  3F8N A;  5ICE A;  2EIL H;  2EIN H;  3J80 Z;  3SWH A;  3CCL I;  2Y0S N;  5HS7 A;  4E4H A;  3U2R A;  2XRL A;  3QU3 A;  1A31 A;  3VW1 A;  3AFH A;  2H6B A;  2JA6 J;  2COM A;  4J00 A;  1ZN2 A;  3O8G A;  4PJM A;  3TBI A;  3RKQ A;  4XR6 A;  2E2J J;  2RHA A;  3S93 A;  4YZE A;  2K9Q A;  4CO8 A;  3ZQL A;  2HDD A;  1JJ6 C;  3M8E A;  1O7L A;  4B8X A;  1T0F A;  4I7H A;  1YQA A;  4YRV A;  1ZGA A;  3JRC A;  1ONV A;  1TC3 C;  4RAF A;  1UI6 A;  3H5A A;  4XKW A;  5D5X B;  3H35 A;  3BTJ A;  3K4N A;  3F6V A;  2ZB9 A;  3DLL F;  3DTK A;  3FF5 A;  2FJI 1;  2HKU A;  1Z05 A;  1NG6 A;  5H9T A;  2K9N A;  3CMM A;  4O5V A;  4XM3 A;  1JE8 A;  1MW7 A;  4IZZ A;  3UKG A;  3FXQ A;  2LY2 A;  1J75 A;  4JK1 X;  4M6V A;  1P4A A;  3SFZ A;  4CCJ A;  4Y7N J;  3GTP J;  3RZO J;  5E1X A;  3SFI A;  2XPV A;  5B1A H;  3HTU A;  2RRE A;  1R7J A;  5GP9 A;  2KIQ A;  1BBY A;  1ETQ A;  4O3M A;  5F27 A;  1IN7 A;  2QQ8 A;  2NVQ J;  2PFV A;  3VP5 A;  2IA2 A;  3LSP A;  2LG4 A;  3WG7 H;  1MBJ A;  3GZI A;  2ZFU A;  4NC8 A;  1ZKG A;  1WZ2 A;  5ILS A;  4FCY A;  2WAD A;  5AIP A;  2Z3Y A;  5EZG A;  1XGM A;  2FOW A;  2XKO A;  4OMY A;  2R7Q A;  4IQJ A;  1FMW A;  2DYS H;  2V4J C;  2HZD A;  2DA5 A;  4IHS A;  1LFP A;  3OYN A;  4OIO F;  2AXT C;  4CYD A;  2E5Z A;  2UXX A;  3HSF A;  4EEF G;  3VVX A;  1KON A;  5FD6 A;  6PAX A;  2XAU A;  1SAN A;  3K4L A;  3ZGK A;  3REO A;  1MZB A;  2R7Z J;  4ZH4 F;  1FIP A;  3HDD A;  3HM5 A;  3CP8 A;  2YVE A;  1FOY A;  3NNR A;  4Q4Z F;  2JRT A;  2YSR A;  1BIA A;  1T98 A;  2XF6 A;  1FYK A;  1K78 A;  4M73 A;  5CXG A;  2CFO A;  4U7D A;  3OYK A;  4GFL A;  3R4K A;  1MBG A;  1XDU A;  4OAZ A;  1X2M A;  3HSE A;  2EFN A;  4L5J A;  1SC7 A;  1SD4 A;  3AQS A;  1XS9 A;  4PSW A;  2HS5 A;  4UXN A;  3GTG J;  2NAZ A;  2H09 A;  3L2W A;  3F21 A;  2VBY A;  3OIP A;  1IZ1 A;  1R00 A;  1VTN C;  4OU0 A;  4NC7 A;  2L7M P;  2QQA A;  3BRU A;  2HQR A;  4HX7 A;  4LIV A;  1UI5 A;  2XIG A;  3BPV A;  2XDV A;  4NB5 A;  2GUH A;  5DCF A;  4N4N B;  3SEQ A;  3LWJ A;  2LOO A;  1F36 A;  2Y2Z A;  1R23 A;  4IVN A;  3BJA A;  3CDI A;  4XBF A;  4CHU A;  3PPB A;  3CMY A;  3GME A;  3U21 A;  1K4T A;  5ICF A;  2HPM A;  4D9J A;  4IHV A;  2NRA C;  2HYT A;  1X3W B;  1XCB A;  3TKY A;  3OYA A;  2CS3 A;  1P2F A;  4A3B J;  3GTK J;  1W7P B;  1RZ4 A;  3SXY A;  3MWM A;  1D8J A;  3J7Z I;  3KX2 A;  4ZDP A;  2IGN A;  1UG2 A;  3HJE A;  3MQ0 A;  2LF7 A;  5E3O A;  1ERD A;  4OIN F;  1T38 A;  2DMP A;  4LK1 F;  3WHC A;  5F0F A;  1A36 A;  4A3J J;  2HYF A;  1BW5 A;  3U1K A;  3DBR B;  1UZC A;  1EH7 A;  1NH3 A;  2WAF A;  1MBH A;  2X6O A;  2LSO A;  3HL2 A;  4FE4 A;  5CKT A;  3J80 K;  1YFH A;  4RAG A;  2KRC A;  4D0P A;  4ENJ A;  2CQX A;  4XRS A;  5K58 A;  5DEQ A;  1QBJ A;  2W48 A;  4F91 B;  2PFB A;  1G4D A;  5B3S H;  1IF1 A;  3CUQ C;  2LKS A;  2XF5 A;  2R7F A;  4U0V A;  4XL9 A;  4LB5 A;  3TW7 A;  1IXS B;  3UR3 C;  1U8R A;  2Y0M A;  4AIH A;  1A35 A;  1XB4 A;  3H3U A;  4BUP A;  4EJT A;  4XKB A;  2OF7 A;  5DM6 F;  2LYC A;  4BE0 A;  2F5E A;  4BU2 A;  4BDY A;  1Z6T A;  1IN5 A;  2L7K A;  1IDZ A;  2BW3 A;  3K4J A;  1I3A A;  3S2H J;  1XDS A;  2EIM H;  1HSJ A;  4G8X A;  2KIM A;  2VUM J;  3GF2 A;  4IPA A;  2HKX A;  2IS1 A;  1JKP C;  3MD2 A;  5DM7 F;  2ELK A;  3EUK L;  3ZQG A;  1ZAR A;  2JA8 J;  4G7O F;  4OMZ A;  3FZV A;  1HCR A;  2GOX B;  4U9N A;  2LKP A;  1PJR A;  2ZME C;  3DPL C;  1Z3X A;  2H27 A;  2LTP A;  2VKH A;  2GBY A;  5LD2 C;  4HSR A;  4NC6 A;  1KU9 A;  1LB2 A;  1FP1 D;  2OZU A;  2DK5 A;  4I02 A;  2Y9Y A;  3WTS C;  2HKO A;  1GV2 A;  3Q5F A;  4HV5 A;  2DO7 A;  3ZXS A;  1VZ0 A;  3CCR I;  4B3X A;  3K2A A;  3E7Q A;  1RR7 A;  3KFW X;  2Q2E A;  1P9Q C;  5L3G A;  4HNU A;  5LRR A;  4M3F A;  3L2R A;  3BTL A;  2Q24 A;  1BJA A;  1YJN I;  5B66 C;  1OFC X;  3CCM I;  4OOI A;  3LSM A;  4HQE A;  4GGG A;  5KHD A;  3ON4 A;  2R4G A;  2ZJR F;  5KK1 A;  4OIR F;  2YVH A;  1RC9 A;  1FPQ A;  2EPF A;  3BR0 A;  2L54 A;  3KLN A;  4XKV A;  1XMK A;  2WWY A;  4Y17 A;  4C3I J;  2PJR B;  3CCY A;  4FET A;  2BY1 A;  4I98 B;  4B44 A;  2XRN A;  2DA7 A;  3WTZ A;  1B8I A;  1VQN I;  5EG0 A;  4I99 C;  5K5O A;  3JRB A;  3FM3 A;  2ZCW A;  1MKM A;  3PUB A;  2ZCX A;  4JKZ A;  3C18 A;  2AS5 F;  2W85 A;  4WXH A;  2XVC A;  4BY7 J;  3J7A Y;  3CF2 A;  3L00 A;  4ZC3 A;  4CCL A;  1IRX A;  3PAS A;  5IYD J;  2VKD A;  3LA7 A;  1YIJ I;  1RRJ A;  2CV1 A;  1BIB A;  3M1E A;  1J59 A;  2JZY A;  2M3A A;  1Z3Y A;  1BI1 A;  3V4G A;  1PP8 F;  1ZQ3 P;  3S5R A;  3HXL A;  1BA5 A;  2V1U A;  3BG3 A;  1NHA A;  3C2G A;  2Q8K A;  1IJW C;  3BTI A;  4Q5S F;  2REK A;  2ISZ A;  2A6H F;  4S0H B;  5FKM A;  3WGH A;  5DUI A;  2ACJ A;  2LRD A;  2M7B A;  2MC3 A;  2R7U A;  2A6T A;  2MD0 A;  3RKX A;  2DFF A;  1Y39 A;  3LJL A;  4QIW N;  3BG5 A;  3WTV C;  1B4A A;  2A5W A;  1X58 A;  1H8A C;  1WPK A;  4BQQ A;  3MFK A;  4M74 A;  4YFN F;  1IAW A;  4KJZ A;  4DZJ A;  2A3S A;  1Q1V A;  1W5C C;  2Y30 A;  1J09 A;  2B1E A;  2Z1D A;  2HFH A;  1VQ9 I;  3E1S A;  2F07 A;  1ZG1 A;  1T33 A;  4EGZ A;  3S16 J;  3BG6 A;  2G7G A;  2CGP A;  4A3D J;  3OYB A;  1YTY A;  4C2U A;  4BHB A;  2F4M B;  1Z7U A;  4XN0 A;  4A0Z A;  1YOV B;  2M0M A;  3DPJ A;  3KPH A;  2PG4 A;  1FT9 A;  1RKW A;  5ERI A;  4TV7 A;  4BNC A;  2ESN A;  1FIA A;  2MFZ A;  5E17 F;  2WA0 A;  1E3P A;  1Z6R A;  4KIC A;  1KU7 A;  3JTH A;  1SVM A;  2QUF A;  4B09 A;  3HYI A;  1ZRD A;  4A5N A;  3GTL J;  3TP0 A;  1S7O A;  2J5P A;  1GUU A;  4YIR X;  1W5S A;  3ANP A;  2QGU A;  2IAI A;  3H5N A;  2B0L A;  4CZZ A;  2BBY A;  2E60 A;  3IH3 A;  5K7Z A;  1GHC A;  3V6G A;  2D1V A;  2IA1 A;  5K5R A;  5F0H A;  3WE2 A;  2A6E F;  3OY9 A;  3U9G A;  4AID A;  3HIF A;  2OZ6 A;  3I4P A;  4XLP F;  1XX5 A;  3OYE A;  4XSX F;  3FXO A;  3OS1 A;  1WJA A;  3PNT A;  5LFA A;  3J81 Z;  5M5Y J;  1SFO J;  4PK4 A;  4RAY A;  3V8J A;  1ETY A;  4ZTJ A;  1GLN A;  2GQQ A;  3KLO A;  4PJ0 C;  4CSW A;  4EAT A;  2STT A;  3DPT A;  4S05 A;  1TP4 A;  3CCV I;  2X1C A;  3CUQ B;  3HOS A;  1ENH A;  3P5J A;  2CWE A;  1B9N A;  4Z2Y A;  2V1D A;  3CES A;  1EF4 A;  1S5L C;  3CDH A;  3BR3 A;  2X6X A;  3U1D A;  2RC4 A;  3E6M A;  3I0T A;  2EB7 A;  4PJL A;  1JT6 A;  1XTA A;  3PO2 J;  1V5F A;  5JI6 A;  3AAF A;  3Q0U A;  1K79 A;  1I27 A;  4DOZ A;  3F8B A;  1REP C;  3T8R A;  1WGX A;  1D3Y A;  4RB3 C;  3QP6 A;  5DV5 A;  3MN2 A;  2YX7 A;  2LDU A;  1OR7 A;  2HYG D;  3R60 A;  1O3R A;  2RAS A;  2MA3 A;  3HC7 A;  2A05 A;  2CU7 A;  1B9M A;  3TQN A;  3OIO A;  1KQ8 A;  1HST A;  3BOQ A;  4FX0 A;  3W6J B;  2H94 A;  3V78 A;  2FXA A;  1AKH A;  3HOW J;  1WFX A;  2ZME B;  3CJN A;  1U8B A;  3HG9 A;  1RI7 A;  4BJT A;  1ZYR F; 
#chains in the Genus database with same CATH homology
 2R5Y A;  1MSE C;  3DCF A;  3IV5 A;  2WB1 N;  1VND A;  3FIS A;  3NPI A;  4A3K J;  2XSD C;  1TWC J;  1LE8 A;  4CYC B;  3HOY J;  1HOM A;  4ICH A;  4JP0 A;  1JGG A;  4IHY A;  1LFB A;  2FD5 A;  2VPR A;  3T6N A;  4AC0 A;  1Y1W J;  3MVP A;  4FIS A;  3L1P A;  1UHS A;  3QKX A;  1ETX A;  5IP9 J;  3VOK A;  4JL3 A;  3LSG A;  1DU6 A;  2K9S A;  3JSJ A;  3G7R A;  4AF5 A;  2EZI A;  2MG4 A;  4XIC A;  5FMP A;  4BBR J;  4D7N A;  5EYR A;  3NRG A;  5E3M A;  3ZQF A;  4MIM A;  2CQQ A;  2NX4 A;  3F0C A;  2EQR A;  3HOU J;  2GLO A;  2ME0 A;  3BR1 A;  1AHD P;  3EGQ A;  1AKH B;  2IEK A;  2EZK A;  4ABZ A;  5CW8 A;  3JRE A;  3BR5 A;  2AO9 A;  2HI3 A;  3G1M A;  5IYB J;  1B8I B;  1QPI A;  2JWT A;  1IV6 A;  2OER A;  1YRN A;  4A3M J;  4DYR A;  5EG0 B;  1JKQ C;  1OCP A;  4XRS G;  4M3D A;  4DW6 A;  5E3N A;  5D1R A;  2OPT A;  5J1Y A;  2JJ7 A;  4BY1 J;  1AU7 A;  1W0T A;  3BR6 A;  4G12 A;  2YU9 J;  2QTQ A;  2K40 A;  1TWA J;  2I10 A;  4C3J J;  2QOP A;  3CRJ A;  5FLV A;  4Y52 J;  3W6V A;  3S15 J;  2D6Y A;  2WUI A;  1MBE A;  1GV5 A;  3B6A A;  2UXH A;  1MBF A;  2FQ4 A;  4GCT A;  2NP3 A;  3CDL A;  4W1U A;  1VF9 A;  1HF0 A;  2NVT J;  2WAQ N;  4HNV A;  2Y0S N;  4D5C A;  5EDN A;  1JUM A;  2XRL A;  3GBG A;  3KZ9 A;  3VW1 A;  3VW0 A;  2JA6 J;  4DYC A;  1GDT A;  3BNI A;  3KKC A;  1IC8 A;  4L62 A;  3JRI A;  4FE7 A;  3O8G A;  5M3F J;  2E2J J;  3RKQ A;  3RQI A;  2RHA A;  2GM4 A;  3NAR A;  4YZE A;  2K9Q A;  4RBO A;  3ZQL A;  2LD5 A;  1FTZ A;  2L7F P;  2HDD A;  4UUT A;  1JJ6 C;  2O7T A;  3D1N I;  1NK3 P;  3TP3 A;  2LP0 A;  4DZP A;  3A02 A;  1BW6 A;  1UMQ A;  2EZH A;  4QTR A;  3LOC A;  2R92 J;  9ANT A;  2DA2 A;  3JRC A;  2DJN A;  1TC3 C;  4A3I J;  3FIW A;  1FTT A;  1UI6 A;  3HIM A;  4XRM A;  5HSZ A;  1E3O C;  3BTJ A;  1A5J A;  2ZB9 A;  4XK4 A;  2HKU A;  3C07 A;  1T56 A;  5H9T A;  2K9N A;  1ETO A;  4DYQ A;  5F08 A;  3UKG A;  4BXX J;  1WI3 A;  1ZGW A;  1MH4 A;  1WH7 A;  4M6V A;  5HBU A;  5J1U A;  2Y9Z A;  4Y7N J;  3GTP J;  3RZO J;  2R5Z A;  3SFI A;  2XPV A;  4MXM A;  4A3F J;  1ITY A;  1JTY A;  5GP9 A;  2JK3 A;  2XGE A;  4GCL A;  4FTH A;  5FKN A;  1ETQ A;  5F27 A;  2KDZ A;  1PUF B;  2NVQ J;  3VP5 A;  3LSP A;  3HOV J;  4MK6 A;  2P81 A;  2ID6 A;  4AC6 A;  2DMQ A;  1MBJ A;  2MSY A;  3GZI A;  1O4X A;  1ZKG A;  1ETW A;  1U9O A;  5CXI A;  3BR2 A;  4FCY A;  5M5X J;  4JX5 A;  5EZG A;  3I4M J;  3LSJ A;  3CJD A;  2E2I J;  4LOC A;  3NAU A;  4BKX A;  2DA5 A;  3BTC A;  4B1R A;  3HE0 A;  4MFE A;  2LVS A;  1I3Q J;  1JT0 A;  1ZR4 A;  2M0C A;  4EEF G;  3JRD A;  3OOU A;  3VVX A;  1P7J A;  1OJL A;  2Y31 A;  1SAN A;  3NI7 A;  1QVT A;  1VI0 A;  4B3A A;  3VW2 A;  2R5Z B;  1GT0 C;  2R7Z J;  4IHW A;  3BCG A;  3KNW A;  1FIP A;  1QVU A;  4L5E A;  3EUP A;  3HDD A;  3HM5 A;  2YVE A;  3FRQ A;  1RES A;  3NNR A;  1MSF C;  5D19 A;  1K61 A;  4B4C A;  1IUF A;  2R0Q C;  5CXG A;  3F1B A;  1U78 A;  3PM1 A;  2ECB A;  4GFL A;  2QWT A;  2O7O A;  1MBG A;  1X2M A;  3TW6 A;  1ZR2 A;  3A03 A;  4IHX A;  2DA4 A;  2XB5 A;  3QQA A;  4NN1 A;  3AQS A;  2N8G A;  1XS9 A;  2FBQ A;  3QBM A;  3GTG J;  2EBI A;  4M3G A;  5E3L A;  3BJB A;  3GEU A;  2L7M P;  3WHB A;  3BRU A;  2CJJ A;  4C2M J;  5IOZ A;  3FKI J;  3VVZ A;  1HDP A;  1UI5 A;  3VVY A;  3HOZ J;  3FK7 A;  2HXO A;  2WGB A;  2GUH A;  2XDN A;  2R5Y B;  3LWJ A;  3HBL A;  2ZOY A;  1F36 A;  2Y2Z A;  4UUS A;  2FX0 A;  1K83 J;  1TWF J;  5EEA A;  2QKO A;  4JNN A;  3RD3 A;  1Z77 A;  3AQT A;  3HTI A;  3S1R J;  3PPB A;  3CMY A;  1LE8 B;  2M34 A;  2HOT A;  3A01 A;  2DTZ A;  3KKD A;  4KWA A;  2DA6 A;  2ME6 A;  4IHV A;  5FLM J;  2HYT A;  3ZQC A;  2YUS A;  3GTM J;  4A3B J;  3GTK J;  2NS7 A;  3BT9 A;  1D5Y A;  4M3E A;  1B72 A;  4I76 A;  1G2H A;  5DS9 A;  2G7S A;  3VPR A;  2M9H A;  2YS9 A;  4NDL A;  3ANG A;  2TRT A;  2X9D A;  1GVD A;  1OCT C;  4X6A J;  1H88 C;  1UG2 A;  5EGO A;  5E3O A;  2DMP A;  4A3G J;  3WHC A;  5F0F A;  1YRN B;  5JLW A;  4A3J J;  1Z0X A;  3S17 J;  1BW5 A;  2H1K A;  2TCT A;  2CUF A;  3Q3S A;  1SGM A;  2FJ1 A;  3MKL A;  1MBH A;  2X6O A;  3QPL A;  1JJ8 C;  4FE4 A;  4GFK A;  2ZCM A;  1RPW A;  5IP7 J;  2CQX A;  4XRS A;  5K58 A;  2LFB A;  2XGD A;  2W48 A;  2DMT A;  1ORK A;  5FJ8 J;  5C4Y A;  5C44 J;  2CUE A;  5FKK A;  3TW7 A;  3HKZ N;  3HTA A;  2CRG A;  5F04 A;  2E2H J;  4A3E J;  1QRY A;  5EFY A;  1U9N A;  2ZCN A;  2OF7 A;  4A3L J;  2JA5 J;  3GTJ J;  3G1L A;  3S1Q J;  1IDZ A;  1W0U A;  3S2H J;  3DEW A;  4MFD A;  2PBX A;  3JRF A;  2PZ9 A;  2MW8 A;  1CQT A;  2LK2 A;  2VUM J;  2X48 A;  1JKP C;  3SJM A;  2ELK A;  5IYC J;  3OSF A;  2JA8 J;  2NOG A;  3ZQG A;  3HTH A;  3H3V K;  1JUP A;  5FGL A;  1HCR A;  3HOX J;  5DAJ A;  3COL A;  2QCO A;  4C3H J;  2DMN A;  2ECC A;  2LTP A;  3RZD J;  4GFB A;  3C2B A;  5FHP A;  2GBY A;  1MBK A;  3GTQ J;  2PMZ N;  2JN6 A;  2G3B A;  3VIB A;  4MLO A;  4A93 J;  5M3M J;  2DG8 A;  2Y9Y A;  2EH3 A;  3ZQI A;  3S2D J;  2DA1 A;  4JX4 A;  2IBD A;  5M5W J;  4HKU A;  1GV2 A;  4CYC A;  1JKO C;  1JKR C;  3K2A A;  3E7Q A;  1RR7 A;  2HOA A;  5K7F A;  2UXO A;  2E1O A;  5HAW A;  3BQY A;  4M3F A;  3BTL A;  1IGN A;  2Q24 A;  2UXU A;  1OFC X;  2ID3 A;  5C3E J;  1APL C;  3ON4 A;  4A3C J;  1WCM J;  5JLX A;  1H89 C;  2NVX J;  1ZK8 A;  1X2N A;  4RDU A;  3LNQ A;  3I4N J;  4UDS A;  2YVH A;  3BR0 A;  2QF7 A;  1XC5 A;  2UXP A;  3RH2 A;  2UXI A;  3S1N J;  1ETK A;  4QSH A;  3HGY A;  5IOY A;  5C4X J;  4C3I J;  2COB A;  2E19 A;  2HXI A;  3CCY A;  3FK6 A;  3IH2 A;  1B8I A;  2DA7 A;  4XID A;  3ON2 A;  2HYJ A;  1VFC A;  4BBS J;  2ZOZ A;  5EG0 A;  2W53 A;  5IPA A;  1ZTR A;  3JRB A;  3K7A J;  2ZCX A;  4D7M A;  3HGG A;  4JKZ A;  2M2E A;  1HLV A;  5K7H A;  1NK2 P;  5IP6 A;  4BY7 J;  2GFN A;  3PAS A;  5IYD J;  2IU5 A;  2NS8 A;  1TWH J;  1S7E A;  3JRA A;  2WV1 A;  4J19 A;  4D5F A;  2OI8 A;  2XGC A;  3BG9 A;  1ZQ3 P;  3S5R A;  1BA5 A;  3BG3 A;  1MNM C;  1LFU P;  1XG1 A;  3BTI A;  3G1O A;  4AUX A;  1IJW C;  2REK A;  3IUV A;  2V57 A;  4S0H B;  2L9R A;  5FKM A;  4ACI A;  2MGQ A;  4IEJ A;  2L0K A;  2HOS A;  5F0C A;  2XPU A;  3JR9 A;  3LJL A;  4QIW N;  3BG5 A;  3JRG A;  3O8H A;  4JX6 A;  3BQZ A;  1X58 A;  1H8A C;  1WPK A;  1IDY A;  5GPC A;  4DZJ A;  5AQC A;  2DN0 A;  3E7L A;  1HDD C;  1Q1V A;  1IG7 A;  2Y30 A;  2D5V A;  2RAE A;  3B6C A;  2LKX A;  4MO7 A;  2F07 A;  1MH3 A;  4UUS B;  1R9T J;  5GPA A;  1T33 A;  2VKE A;  5HOD A;  3S16 J;  3IH4 A;  3P9T A;  2G7G A;  4A3D J;  2L7Z A;  4PXI A;  2HQ5 A;  3A01 B;  1RET A;  2O9L A;  4V2G A;  3DPJ A;  2M8G X;  1WH5 A;  3GTO J;  3S14 J;  1RKW A;  3S1M J;  5FKO A;  2QIB A;  1FIA A;  2NP5 A;  3ZQH A;  2XB0 X;  3Q0V A;  1B72 B;  3HEF A;  2XPW A;  3TED A;  3SDG A;  3HB9 A;  3QPS A;  3NXC A;  3GTL J;  3TP0 A;  3B81 A;  2G7L A;  1GUU A;  1I50 J;  5J3L A;  3ANP A;  5EGO B;  2IAI A;  4CGR A;  2O8K A;  1BL0 A;  3G56 A;  1PUF A;  3IH3 A;  5J1R A;  5K7Z A;  2DA3 A;  2EZL A;  4ME9 A;  2JMW A;  1NTC A;  1POG A;  5BNG A;  3HTJ A;  3V6G A;  1TWG J;  5F0H A;  2LY9 A;  3VUQ A;  1RKT A;  2VKV A;  2GEN A;  1P7I A;  5F1J A;  3M3Y J;  3VOX A;  1JTX A;  3Q0W A;  3OSG A;  2B63 J;  2LR8 A;  1DU0 A;  4I6Z A;  3CWR A;  1JUS A;  1Y1V J;  1IRZ A;  5M5Y J;  1SFO J;  1BJZ A;  1ETY A;  3CQZ J;  3BHQ A;  3LSR A;  5EZH A;  1ENH A;  3PO3 J;  2DG7 A;  4V2F A;  1EF4 A;  2DMU A;  1ETV A;  4AYB N;  2R93 J;  3BR3 A;  5DTD A;  4NEL A;  1JT6 A;  1FJL A;  3M4O J;  2AHQ A;  2LLK A;  3PO2 J;  5EF6 A;  2KT0 A;  3Q0U A;  3ZOB A;  1WGX A;  2H8R A;  3LHQ A;  1I6H J;  3MN2 A;  4JYK A;  1F43 A;  1A6I A;  2G0E A;  1FEX A;  2RAS A;  3MNL A;  5C4J J;  4M3B A;  2CU7 A;  4X1E A;  2VI6 A;  3O60 A;  3OIO A;  4A69 C;  4GCK A;  3H0G J;  4W97 A;  3JRH A;  3V78 A;  5D18 A;  2JA7 J;  1AKH A;  3HOW J;  1U8B A;  5FKL A;  2NVY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...