3PASA

Crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
MRQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFYYVSDQVIDAALDSFSRGKDLREGLRRQWHTLFRIGLERPELFRYHETFTHSAWMTPEIQARNESRAANLLNAVDQGKQSGLIKPVPFPLLETFMFRPIYHLVQRCLQGSFEGTDEHIELAFNMAWDAVADR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family transcription regulator
publication title Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution
rcsb
source organism Marinobacter aquaeolei
molecule tags Transcription regulator
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pasA00
3EGQA 3ZQHA 2HYTA 4W1UA 2WUIA 3BT9A 3VW2A 3TP0A 3VVYA 2JK3A 2HYJA 5HSZA 3BTJA 3VP5A 4AC0A 3VOXA 2QTQA 2G7LA 3BTCA 4AF5A 2TCTA 4I76A 3VUQA 1SGMA 4B3AA 1UI6A 2Y31A 5F0FA 5FKOA 2QIBA 3G1MA 4PXIA 5EYRA 2RHAA 1RPWA 2VPRA 1U9OA 1JT6A 4JKZA 5FMPA 2FX0A 3HTAA 3VPRA 3VVXA 2IBDA 4ACIA 2HQ5A 3DCFA 4V2FA 1ORKA 1VI0A 2QKOA 5FGLA 5IOZA 2HXIA 5D18A 2EH3A 3CWRA 3SDGA 2NS8A 3TP3A 5F27A 3B81A 5J1RA 3LWJA 3V78A 2OPTA 3ANGA 2IEKA 3KKCA 2NS7A 4D7MA 3CRJA 2XPWA 3JSJA 3HGYA 2TRTA 3BTIA 5GPAA 2ZOZA 5J3LA 2UXPA 2RAEA 3O8GA 5C4YA 2OF7A 4M3GA 4XK4A 3GZIA 4NN1A 2O7TA 4GCTA 2GFNA 2VKEA 1ZK8A 3AQTA 5FKLA 5K58A 5F08A 4YZEA 3NRGA 2XB5A 4AC6A 2WV1A 1JUPA 2XPVA 3FK6A 3VVZA 3BJBA 5FHPA 3IUVA 3F0CA 3HIMA 2G3BA 2JJ7A 2QCOA 1JUMA 2O7OA 2GBYA 1RKTA 3BNIA 5EFYA 3BRUA 5CW8A 1U9NA 2PZ9A 3RD3A 4D7NA 2ID6A 4JL3A 3G1LA 3IH2A 2XDNA 3F1BA 1BJZA 3SFIA 2RASA 5FKNA 2I10A 2REKA 2Y30A 3BQZA 5GP9A 5FKKA 5EZGA 2FBQA 1T56A 2ZB9A 3WHBA 1Z0XA 2UXUA 3G56A 2FD5A 3BTLA 2OERA 1JTXA 4MO7A 3CJDA 2YVEA 1JT0A 2FQ4A 3ZQGA 4M3EA 3O60A 4M3FA 2NX4A 4MXMA 5D19A 3Q0WA 3BR5A 3V6GA 2NP5A 3C2BA 3NPIA 5J1YA 5F1JA 5F04A 5H9TA 5HAWA 4NELA 2VKVA 3FRQA 2UXOA 3PPBA 4GCKA 1A6IA 3G7RA 3T6NA 3MVPA 5IP6A 3O8HA 3HE0A 3IH4A 1QVUA 4D5FA 3BQYA 3G1OA 1RKWA 2X6OA 3MNLA 2G7SA 4D5CA 5CXIA 3ANPA 2D6YA 2XGCA 4CGRA 2F07A 3LJLA 3LSPA 5AQCA 3BHQA 5K7FA 2WGBA 2HXOA 2NP3A 4V2GA 1JTYA 3Q3SA 3E7QA 5IOYA 3COLA 3QPSA 2IU5A 3ZQLA 4GFKA 2DTZA 3VW1A 2G7GA 2XGEA 4W97A 3ZQIA 5F0HA 5HBUA 3QQAA 3EUPA 3KNWA 3DEWA 2PBXA 5J1UA 3LOCA 3GEUA 5GPCA 2XPUA 1ZKGA 4ICHA 2Y2ZA 3FK7A 4I6ZA 1UI5A 4MK6A 3BR2A 3NNRA 2X9DA 3IH3A 3AQSA 5K7ZA 4DW6A 3WHCA 3Q0UA 3B6CA 3ON2A 3B6AA 2G0EA 3CCYA 5DAJA 3ZQFA 2ZCMA 2FJ1A 4HKUA 3BR0A 3VIBA 2GUHA 5CXGA 4ME9A 3HTIA 4GFLA 1QPIA 4UDSA 5FKMA 4KWAA 3FIWA 3NI7A 3HTJA 3BR1A 3Q0VA 4G12A 3QKXA 5D1RA 3QPLA 3DPJA 2ZCNA 1Z77A 2IAIA 2YVHA 3LSRA 4M3BA 2W53A 3VOKA 4JYKA 2DG8A 3S5RA 3QBMA 3BR6A 3HTHA 2UXIA 2DG7A 1JUSA 3PASA 3KZ9A 1QVTA 2ZCXA 2ZOYA 3LSJA 2OI8A 3ON4A 4L62A 3BR3A 2QOPA 4ABZA 4B1RA 3KKDA 4M3DA 3P9TA 3LHQA 4JNNA 3PM1A 5IPAA 2Q24A 3RH2A 5K7HA 4AUXA 2V57A 3HGGA 2GENA 2HKUA 5EZHA 2XGDA 2QWTA 5F0CA 4GCLA 2UXHA 3C07A 2XRLA 3VW0A 2ID3A 4X1EA 3BCGA 1T33A 3CDLA 3NXCA
chains in the Genus database with same CATH superfamily
3EGQA 3ZQHA 2HYTA 4W1UA 2WUIA 3BT9A 3VW2A 3TP0A 3VVYA 2JK3A 2HYJA 5HSZA 3BTJA 3VP5A 4AC0A 3VOXA 3K8PC 2QTQA 2G7LA 3BTCA 4AF5A 2TCTA 4I76A 3VUQA 1SGMA 4B3AA 1UI6A 2Y31A 5F0FA 5FKOA 2QIBA 3G1MA 4DVYP 5EYRA 4PXIA 2RHAA 1RPWA 2VPRA 1U9OA 1JT6A 4JKZA 5FMPA 2FX0A 3HTAA 2B3WA 3VPRA 3VVXA 2IBDA 4ACIA 2HQ5A 3DCFA 4V2FA 1ORKA 1VI0A 2B1EA 2QKOA 5FGLA 5IOZA 2HXIA 5D18A 2EH3A 3CWRA 3SDGA 2NS8A 3TP3A 5F27A 3B81A 5J1RA 3LWJA 3V78A 2OPTA 3ANGA 2IEKA 3KKCA 2NS7A 4D7MA 3CRJA 2XPWA 3JSJA 3HGYA 3VTIA 2TRTA 3BTIA 5GPAA 2ZOZA 5J3LA 2UXPA 2RAEA 3O8GA 5C4YA 2OF7A 4M3GA 4XK4A 3GZIA 4NN1A 2O7TA 4GCTA 2GFNA 2VKEA 1ZK8A 3AQTA 5FKLA 5K58A 5CQGA 5F08A 4YZEA 3NRGA 2XB5A 4AC6A 2WV1A 1JUPA 2XPVA 2R7WA 3FK6A 3VVZA 3BJBA 5FHPA 3IUVA 3F0CA 3HIMA 2G3BA 2JJ7A 2QCOA 1JUMA 2O7OA 2GBYA 1RKTA 3BNIA 5EFYA 3BRUA 5CW8A 1U9NA 2PZ9A 3RD3A 4D7NA 2ID6A 4JL3A 3G1LA 3IH2A 3NS4A 2XDNA 3F1BA 1BJZA 3SFIA 2RASA 5FKNA 2I10A 2REKA 2Y30A 3BQZA 5GP9A 2R7OA 5FKKA 5EZGA 2FBQA 1T56A 2ZB9A 3WHBA 1Z0XA 2UXUA 3G56A 2FD5A 3BTLA 2OERA 1JTXA 4MO7A 3CJDA 2YVEA 1JT0A 2FQ4A 4M3EA 3O60A 4M3FA 3ZQGA 2NX4A 4MXMA 5D19A 3Q0WA 3BR5A 2ZY9A 3V6GA 4WIBA 2NP5A 3C2BA 3NPIA 5J1YA 5F1JA 5F04A 5H9TA 5HAWA 4NELA 2VKVA 3FRQA 2UXOA 3PPBA 4GCKA 1A6IA 2R7VA 3G7RA 3T6NA 3MVPA 5IP6A 3O8HA 3HE0A 3IH4A 1QVUA 4D5FA 3BQYA 3G1OA 1RKWA 2X6OA 3MNLA 4U9LA 2G7SA 4IRVA 4D5CA 5CXIA 3ANPA 2D6YA 3KYLA 2XGCA 4OD4A 4CGRA 2F07A 3LJLA 3LSPA 5AQCA 3BHQA 5K7FA 2WGBA 2HXOA 2NP3A 3SWHA 2PFVA 4V2GA 1JTYA 3Q3SA 3E7QA 5IOYA 3COLA 3QPSA 2IU5A 3ZQLA 4GFKA 2DTZA 3VW1A 2G7GA 2XGEA 2R7XA 4W97A 3ZQIA 5F0HA 5HBUA 3QQAA 3EUPA 3KNWA 3DEWA 2PBXA 5J1UA 3LOCA 3GEUA 5GPCA 2XPUA 1ZKGA 4ICHA 2Y2ZA 3FK7A 4I6ZA 1UI5A 4MK6A 3BR2A 3NNRA 2X9DA 3IH3A 3AQSA 5K7ZA 4DW6A 3WHCA 3Q0UA 3B6CA 3ON2A 3B6AA 2G0EA 2R7QA 3CCYA 2R7UA 5DAJA 3ZQFA 2ZCMA 2FJ1A 4HKUA 2R7RA 3BR0A 3VIBA 2GUHA 5CXGA 3DU5A 4ME9A 3HTIA 4GFLA 1QPIA 4UDSA 5FKMA 4KWAA 3FIWA 2A2FX 3NI7A 3HTJA 3DU6A 3BR1A 4OD5A 3Q0VA 4G12A 3QKXA 5D1RA 3QPLA 3DPJA 2ZCNA 1Z77A 2IAIA 2YVHA 3LSRA 4M3BA 2W53A 4U9NA 3VOKA 4JYKA 2DG8A 3S5RA 3QBMA 3BR6A 3HTHA 2UXIA 2R7TA 2DG7A 1JUSA 3PASA 3KZ9A 1QVTA 2ZCXA 2ZOYA 3LSJA 2OI8A 3ON4A 4L62A 2YVXA 3BR3A 2QOPA 4ABZA 4B1RA 3KKDA 4M3DA 3P9TA 3LHQA 4C2MA 4JNNA 3PM1A 5IPAA 2Q24A 3RH2A 5K7HA 4AUXA 2V57A 3HGGA 2GENA 2HKUA 5EZHA 2XGDA 3FHNA 2QWTA 5F0CA 2FJI1 4GCLA 2UXHA 3C07A 2XRLA 2R7SA 3VW0A 2ID3A 4X1EA 3BCGA 1T33A 3CDLA 3NXCA
chains in the Genus database with same CATH topology
3EGQA 3ZQHA 2HYTA 4W1UA 2WUIA 3BT9A 3VW2A 3TP0A 3VVYA 2JK3A 2HYJA 5HSZA 3BTJA 3VP5A 4AC0A 3VOXA 2QTQA 2G7LA 3BTCA 4AF5A 2TCTA 4I76A 3VUQA 1SGMA 4B3AA 1UI6A 2Y31A 5F0FA 5FKOA 2QIBA 3G1MA 4PXIA 5EYRA 2RHAA 1RPWA 2VPRA 1U9OA 1JT6A 4JKZA 5FMPA 2FX0A 3HTAA 3VPRA 3VVXA 2IBDA 4ACIA 2HQ5A 3DCFA 4V2FA 1ORKA 1VI0A 2QKOA 5FGLA 5IOZA 2HXIA 5D18A 2EH3A 3CWRA 3SDGA 2NS8A 3TP3A 5F27A 3B81A 5J1RA 3LWJA 3V78A 2OPTA 3ANGA 2IEKA 3KKCA 2NS7A 4D7MA 3CRJA 2XPWA 3JSJA 3HGYA 2TRTA 3BTIA 5GPAA 2ZOZA 5J3LA 2UXPA 2RAEA 3O8GA 5C4YA 2OF7A 4M3GA 4XK4A 3GZIA 4NN1A 2O7TA 4GCTA 2GFNA 2VKEA 1ZK8A 3AQTA 5FKLA 5K58A 5F08A 4YZEA 3NRGA 2XB5A 4AC6A 2WV1A 1JUPA 2XPVA 3FK6A 3VVZA 3BJBA 5FHPA 3IUVA 3F0CA 3HIMA 2G3BA 2JJ7A 2QCOA 1JUMA 2O7OA 2GBYA 1RKTA 3BNIA 5EFYA 3BRUA 5CW8A 1U9NA 2PZ9A 3RD3A 4D7NA 2ID6A 4JL3A 3G1LA 3IH2A 2XDNA 3F1BA 1BJZA 3SFIA 2RASA 5FKNA 2I10A 2REKA 2Y30A 3BQZA 5GP9A 5FKKA 5EZGA 2FBQA 1T56A 2ZB9A 3WHBA 1Z0XA 2UXUA 3G56A 2FD5A 3BTLA 2OERA 1JTXA 4MO7A 3CJDA 2YVEA 1JT0A 2FQ4A 3ZQGA 4M3EA 3O60A 4M3FA 2NX4A 4MXMA 5D19A 3Q0WA 3BR5A 3V6GA 2NP5A 3C2BA 3NPIA 5J1YA 5F1JA 5F04A 5H9TA 5HAWA 4NELA 2VKVA 3FRQA 2UXOA 3PPBA 4GCKA 1A6IA 3G7RA 3T6NA 3MVPA 5IP6A 3O8HA 3HE0A 3IH4A 1QVUA 4D5FA 3BQYA 3G1OA 1RKWA 2X6OA 3MNLA 2G7SA 4D5CA 5CXIA 3ANPA 2D6YA 2XGCA 4CGRA 2F07A 3LJLA 3LSPA 5AQCA 3BHQA 5K7FA 2WGBA 2HXOA 2NP3A 4V2GA 1JTYA 3Q3SA 3E7QA 5IOYA 3COLA 3QPSA 2IU5A 3ZQLA 4GFKA 2DTZA 3VW1A 2G7GA 2XGEA 4W97A 3ZQIA 5F0HA 5HBUA 3QQAA 3EUPA 3KNWA 3DEWA 2PBXA 5J1UA 3LOCA 3GEUA 5GPCA 2XPUA 1ZKGA 4ICHA 2Y2ZA 3FK7A 4I6ZA 1UI5A 4MK6A 3BR2A 3NNRA 2X9DA 3IH3A 3AQSA 5K7ZA 4DW6A 3WHCA 3Q0UA 3B6CA 3ON2A 3B6AA 2G0EA 3CCYA 5DAJA 3ZQFA 2ZCMA 2FJ1A 4HKUA 3BR0A 3VIBA 2GUHA 5CXGA 4ME9A 3HTIA 4GFLA 1QPIA 4UDSA 5FKMA 4KWAA 3FIWA 3NI7A 3HTJA 3BR1A 3Q0VA 4G12A 3QKXA 5D1RA 3QPLA 3DPJA 2ZCNA 1Z77A 2IAIA 2YVHA 3LSRA 4M3BA 2W53A 3VOKA 4JYKA 2DG8A 3S5RA 3QBMA 3BR6A 3HTHA 2UXIA 2DG7A 1JUSA 3PASA 3KZ9A 1QVTA 2ZCXA 2ZOYA 3LSJA 2OI8A 3ON4A 4L62A 3BR3A 2QOPA 4ABZA 4B1RA 3KKDA 4M3DA 3P9TA 3LHQA 4JNNA 3PM1A 5IPAA 2Q24A 3RH2A 5K7HA 4AUXA 2V57A 3HGGA 2GENA 2HKUA 5EZHA 2XGDA 2QWTA 5F0CA 4GCLA 2UXHA 3C07A 2XRLA 3VW0A 2ID3A 4X1EA 3BCGA 1T33A 3CDLA 3NXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGQ A;  3ZQH A;  2HYT A;  4W1U A;  2WUI A;  3BT9 A;  3VW2 A;  3TP0 A;  3VVY A;  2JK3 A;  2HYJ A;  5HSZ A;  3BTJ A;  3VP5 A;  4AC0 A;  3VOX A;  2QTQ A;  2G7L A;  3BTC A;  4AF5 A;  2TCT A;  4I76 A;  3VUQ A;  1SGM A;  4B3A A;  1UI6 A;  2Y31 A;  5F0F A;  5FKO A;  2QIB A;  3G1M A;  4PXI A;  5EYR A;  2RHA A;  1RPW A;  2VPR A;  1U9O A;  1JT6 A;  4JKZ A;  5FMP A;  2FX0 A;  3HTA A;  3VPR A;  3VVX A;  2IBD A;  4ACI A;  2HQ5 A;  3DCF A;  4V2F A;  1ORK A;  1VI0 A;  2QKO A;  5FGL A;  5IOZ A;  2HXI A;  5D18 A;  2EH3 A;  3CWR A;  3SDG A;  2NS8 A;  3TP3 A;  5F27 A;  3B81 A;  5J1R A;  3LWJ A;  3V78 A;  2OPT A;  3ANG A;  2IEK A;  3KKC A;  2NS7 A;  4D7M A;  3CRJ A;  2XPW A;  3JSJ A;  3HGY A;  2TRT A;  3BTI A;  5GPA A;  2ZOZ A;  5J3L A;  2UXP A;  2RAE A;  3O8G A;  5C4Y A;  2OF7 A;  4M3G A;  4XK4 A;  3GZI A;  4NN1 A;  2O7T A;  4GCT A;  2GFN A;  2VKE A;  1ZK8 A;  3AQT A;  5FKL A;  5K58 A;  5F08 A;  4YZE A;  3NRG A;  2XB5 A;  4AC6 A;  2WV1 A;  1JUP A;  2XPV A;  3FK6 A;  3VVZ A;  3BJB A;  5FHP A;  3IUV A;  3F0C A;  3HIM A;  2G3B A;  2JJ7 A;  2QCO A;  1JUM A;  2O7O A;  2GBY A;  1RKT A;  3BNI A;  5EFY A;  3BRU A;  5CW8 A;  1U9N A;  2PZ9 A;  3RD3 A;  4D7N A;  2ID6 A;  4JL3 A;  3G1L A;  3IH2 A;  2XDN A;  3F1B A;  1BJZ A;  3SFI A;  2RAS A;  5FKN A;  2I10 A;  2REK A;  2Y30 A;  3BQZ A;  5GP9 A;  5FKK A;  5EZG A;  2FBQ A;  1T56 A;  2ZB9 A;  3WHB A;  1Z0X A;  2UXU A;  3G56 A;  2FD5 A;  3BTL A;  2OER A;  1JTX A;  4MO7 A;  3CJD A;  2YVE A;  1JT0 A;  2FQ4 A;  3ZQG A;  4M3E A;  3O60 A;  4M3F A;  2NX4 A;  4MXM A;  5D19 A;  3Q0W A;  3BR5 A;  3V6G A;  2NP5 A;  3C2B A;  3NPI A;  5J1Y A;  5F1J A;  5F04 A;  5H9T A;  5HAW A;  4NEL A;  2VKV A;  3FRQ A;  2UXO A;  3PPB A;  4GCK A;  1A6I A;  3G7R A;  3T6N A;  3MVP A;  5IP6 A;  3O8H A;  3HE0 A;  3IH4 A;  1QVU A;  4D5F A;  3BQY A;  3G1O A;  1RKW A;  2X6O A;  3MNL A;  2G7S A;  4D5C A;  5CXI A;  3ANP A;  2D6Y A;  2XGC A;  4CGR A;  2F07 A;  3LJL A;  3LSP A;  5AQC A;  3BHQ A;  5K7F A;  2WGB A;  2HXO A;  2NP3 A;  4V2G A;  1JTY A;  3Q3S A;  3E7Q A;  5IOY A;  3COL A;  3QPS A;  2IU5 A;  3ZQL A;  4GFK A;  2DTZ A;  3VW1 A;  2G7G A;  2XGE A;  4W97 A;  3ZQI A;  5F0H A;  5HBU A;  3QQA A;  3EUP A;  3KNW A;  3DEW A;  2PBX A;  5J1U A;  3LOC A;  3GEU A;  5GPC A;  2XPU A;  1ZKG A;  4ICH A;  2Y2Z A;  3FK7 A;  4I6Z A;  1UI5 A;  4MK6 A;  3BR2 A;  3NNR A;  2X9D A;  3IH3 A;  3AQS A;  5K7Z A;  4DW6 A;  3WHC A;  3Q0U A;  3B6C A;  3ON2 A;  3B6A A;  2G0E A;  3CCY A;  5DAJ A;  3ZQF A;  2ZCM A;  2FJ1 A;  4HKU A;  3BR0 A;  3VIB A;  2GUH A;  5CXG A;  4ME9 A;  3HTI A;  4GFL A;  1QPI A;  4UDS A;  5FKM A;  4KWA A;  3FIW A;  3NI7 A;  3HTJ A;  3BR1 A;  3Q0V A;  4G12 A;  3QKX A;  5D1R A;  3QPL A;  3DPJ A;  2ZCN A;  1Z77 A;  2IAI A;  2YVH A;  3LSR A;  4M3B A;  2W53 A;  3VOK A;  4JYK A;  2DG8 A;  3S5R A;  3QBM A;  3BR6 A;  3HTH A;  2UXI A;  2DG7 A;  1JUS A;  3PAS A;  3KZ9 A;  1QVT A;  2ZCX A;  2ZOY A;  3LSJ A;  2OI8 A;  3ON4 A;  4L62 A;  3BR3 A;  2QOP A;  4ABZ A;  4B1R A;  3KKD A;  4M3D A;  3P9T A;  3LHQ A;  4JNN A;  3PM1 A;  5IPA A;  2Q24 A;  3RH2 A;  5K7H A;  4AUX A;  2V57 A;  3HGG A;  2GEN A;  2HKU A;  5EZH A;  2XGD A;  2QWT A;  5F0C A;  4GCL A;  2UXH A;  3C07 A;  2XRL A;  3VW0 A;  2ID3 A;  4X1E A;  3BCG A;  1T33 A;  3CDL A;  3NXC A; 
#chains in the Genus database with same CATH topology
 3EGQ A;  3ZQH A;  2HYT A;  4W1U A;  2WUI A;  3BT9 A;  3VW2 A;  3TP0 A;  3VVY A;  2JK3 A;  2HYJ A;  5HSZ A;  3BTJ A;  3VP5 A;  4AC0 A;  3VOX A;  3K8P C;  2QTQ A;  2G7L A;  3BTC A;  4AF5 A;  2TCT A;  4I76 A;  3VUQ A;  1SGM A;  4B3A A;  1UI6 A;  2Y31 A;  5F0F A;  5FKO A;  2QIB A;  3G1M A;  4DVY P;  5EYR A;  4PXI A;  2RHA A;  1RPW A;  2VPR A;  1U9O A;  1JT6 A;  4JKZ A;  5FMP A;  2FX0 A;  3HTA A;  2B3W A;  3VPR A;  3VVX A;  2IBD A;  4ACI A;  2HQ5 A;  3DCF A;  4V2F A;  1ORK A;  1VI0 A;  2B1E A;  2QKO A;  5FGL A;  5IOZ A;  2HXI A;  5D18 A;  2EH3 A;  3CWR A;  3SDG A;  2NS8 A;  3TP3 A;  5F27 A;  3B81 A;  5J1R A;  3LWJ A;  3V78 A;  2OPT A;  3ANG A;  2IEK A;  3KKC A;  2NS7 A;  4D7M A;  3CRJ A;  2XPW A;  3JSJ A;  3HGY A;  3VTI A;  2TRT A;  3BTI A;  5GPA A;  2ZOZ A;  5J3L A;  2UXP A;  2RAE A;  3O8G A;  5C4Y A;  2OF7 A;  4M3G A;  4XK4 A;  3GZI A;  4NN1 A;  2O7T A;  4GCT A;  2GFN A;  2VKE A;  1ZK8 A;  3AQT A;  5FKL A;  5K58 A;  5CQG A;  5F08 A;  4YZE A;  3NRG A;  2XB5 A;  4AC6 A;  2WV1 A;  1JUP A;  2XPV A;  2R7W A;  3FK6 A;  3VVZ A;  3BJB A;  5FHP A;  3IUV A;  3F0C A;  3HIM A;  2G3B A;  2JJ7 A;  2QCO A;  1JUM A;  2O7O A;  2GBY A;  1RKT A;  3BNI A;  5EFY A;  3BRU A;  5CW8 A;  1U9N A;  2PZ9 A;  3RD3 A;  4D7N A;  2ID6 A;  4JL3 A;  3G1L A;  3IH2 A;  3NS4 A;  2XDN A;  3F1B A;  1BJZ A;  3SFI A;  2RAS A;  5FKN A;  2I10 A;  2REK A;  2Y30 A;  3BQZ A;  5GP9 A;  2R7O A;  5FKK A;  5EZG A;  2FBQ A;  1T56 A;  2ZB9 A;  3WHB A;  1Z0X A;  2UXU A;  3G56 A;  2FD5 A;  3BTL A;  2OER A;  1JTX A;  4MO7 A;  3CJD A;  2YVE A;  1JT0 A;  2FQ4 A;  4M3E A;  3O60 A;  4M3F A;  3ZQG A;  2NX4 A;  4MXM A;  5D19 A;  3Q0W A;  3BR5 A;  2ZY9 A;  3V6G A;  4WIB A;  2NP5 A;  3C2B A;  3NPI A;  5J1Y A;  5F1J A;  5F04 A;  5H9T A;  5HAW A;  4NEL A;  2VKV A;  3FRQ A;  2UXO A;  3PPB A;  4GCK A;  1A6I A;  2R7V A;  3G7R A;  3T6N A;  3MVP A;  5IP6 A;  3O8H A;  3HE0 A;  3IH4 A;  1QVU A;  4D5F A;  3BQY A;  3G1O A;  1RKW A;  2X6O A;  3MNL A;  4U9L A;  2G7S A;  4IRV A;  4D5C A;  5CXI A;  3ANP A;  2D6Y A;  3KYL A;  2XGC A;  4OD4 A;  4CGR A;  2F07 A;  3LJL A;  3LSP A;  5AQC A;  3BHQ A;  5K7F A;  2WGB A;  2HXO A;  2NP3 A;  3SWH A;  2PFV A;  4V2G A;  1JTY A;  3Q3S A;  3E7Q A;  5IOY A;  3COL A;  3QPS A;  2IU5 A;  3ZQL A;  4GFK A;  2DTZ A;  3VW1 A;  2G7G A;  2XGE A;  2R7X A;  4W97 A;  3ZQI A;  5F0H A;  5HBU A;  3QQA A;  3EUP A;  3KNW A;  3DEW A;  2PBX A;  5J1U A;  3LOC A;  3GEU A;  5GPC A;  2XPU A;  1ZKG A;  4ICH A;  2Y2Z A;  3FK7 A;  4I6Z A;  1UI5 A;  4MK6 A;  3BR2 A;  3NNR A;  2X9D A;  3IH3 A;  3AQS A;  5K7Z A;  4DW6 A;  3WHC A;  3Q0U A;  3B6C A;  3ON2 A;  3B6A A;  2G0E A;  2R7Q A;  3CCY A;  2R7U A;  5DAJ A;  3ZQF A;  2ZCM A;  2FJ1 A;  4HKU A;  2R7R A;  3BR0 A;  3VIB A;  2GUH A;  5CXG A;  3DU5 A;  4ME9 A;  3HTI A;  4GFL A;  1QPI A;  4UDS A;  5FKM A;  4KWA A;  3FIW A;  2A2F X;  3NI7 A;  3HTJ A;  3DU6 A;  3BR1 A;  4OD5 A;  3Q0V A;  4G12 A;  3QKX A;  5D1R A;  3QPL A;  3DPJ A;  2ZCN A;  1Z77 A;  2IAI A;  2YVH A;  3LSR A;  4M3B A;  2W53 A;  4U9N A;  3VOK A;  4JYK A;  2DG8 A;  3S5R A;  3QBM A;  3BR6 A;  3HTH A;  2UXI A;  2R7T A;  2DG7 A;  1JUS A;  3PAS A;  3KZ9 A;  1QVT A;  2ZCX A;  2ZOY A;  3LSJ A;  2OI8 A;  3ON4 A;  4L62 A;  2YVX A;  3BR3 A;  2QOP A;  4ABZ A;  4B1R A;  3KKD A;  4M3D A;  3P9T A;  3LHQ A;  4C2M A;  4JNN A;  3PM1 A;  5IPA A;  2Q24 A;  3RH2 A;  5K7H A;  4AUX A;  2V57 A;  3HGG A;  2GEN A;  2HKU A;  5EZH A;  2XGD A;  3FHN A;  2QWT A;  5F0C A;  2FJI 1;  4GCL A;  2UXH A;  3C07 A;  2XRL A;  2R7S A;  3VW0 A;  2ID3 A;  4X1E A;  3BCG A;  1T33 A;  3CDL A;  3NXC A; 
#chains in the Genus database with same CATH homology
 3EGQ A;  3ZQH A;  2HYT A;  4W1U A;  2WUI A;  3BT9 A;  3VW2 A;  3TP0 A;  3VVY A;  2JK3 A;  2HYJ A;  5HSZ A;  3BTJ A;  3VP5 A;  4AC0 A;  3VOX A;  2QTQ A;  2G7L A;  3BTC A;  4AF5 A;  2TCT A;  4I76 A;  3VUQ A;  1SGM A;  4B3A A;  1UI6 A;  2Y31 A;  5F0F A;  5FKO A;  2QIB A;  3G1M A;  4PXI A;  5EYR A;  2RHA A;  1RPW A;  2VPR A;  1U9O A;  1JT6 A;  4JKZ A;  5FMP A;  2FX0 A;  3HTA A;  3VPR A;  3VVX A;  2IBD A;  4ACI A;  2HQ5 A;  3DCF A;  4V2F A;  1ORK A;  1VI0 A;  2QKO A;  5FGL A;  5IOZ A;  2HXI A;  5D18 A;  2EH3 A;  3CWR A;  3SDG A;  2NS8 A;  3TP3 A;  5F27 A;  3B81 A;  5J1R A;  3LWJ A;  3V78 A;  2OPT A;  3ANG A;  2IEK A;  3KKC A;  2NS7 A;  4D7M A;  3CRJ A;  2XPW A;  3JSJ A;  3HGY A;  2TRT A;  3BTI A;  5GPA A;  2ZOZ A;  5J3L A;  2UXP A;  2RAE A;  3O8G A;  5C4Y A;  2OF7 A;  4M3G A;  4XK4 A;  3GZI A;  4NN1 A;  2O7T A;  4GCT A;  2GFN A;  2VKE A;  1ZK8 A;  3AQT A;  5FKL A;  5K58 A;  5F08 A;  4YZE A;  3NRG A;  2XB5 A;  4AC6 A;  2WV1 A;  1JUP A;  2XPV A;  3FK6 A;  3VVZ A;  3BJB A;  5FHP A;  3IUV A;  3F0C A;  3HIM A;  2G3B A;  2JJ7 A;  2QCO A;  1JUM A;  2O7O A;  2GBY A;  1RKT A;  3BNI A;  5EFY A;  3BRU A;  5CW8 A;  1U9N A;  2PZ9 A;  3RD3 A;  4D7N A;  2ID6 A;  4JL3 A;  3G1L A;  3IH2 A;  2XDN A;  3F1B A;  1BJZ A;  3SFI A;  2RAS A;  5FKN A;  2I10 A;  2REK A;  2Y30 A;  3BQZ A;  5GP9 A;  5FKK A;  5EZG A;  2FBQ A;  1T56 A;  2ZB9 A;  3WHB A;  1Z0X A;  2UXU A;  3G56 A;  2FD5 A;  3BTL A;  2OER A;  1JTX A;  4MO7 A;  3CJD A;  2YVE A;  1JT0 A;  2FQ4 A;  3ZQG A;  4M3E A;  3O60 A;  4M3F A;  2NX4 A;  4MXM A;  5D19 A;  3Q0W A;  3BR5 A;  3V6G A;  2NP5 A;  3C2B A;  3NPI A;  5J1Y A;  5F1J A;  5F04 A;  5H9T A;  5HAW A;  4NEL A;  2VKV A;  3FRQ A;  2UXO A;  3PPB A;  4GCK A;  1A6I A;  3G7R A;  3T6N A;  3MVP A;  5IP6 A;  3O8H A;  3HE0 A;  3IH4 A;  1QVU A;  4D5F A;  3BQY A;  3G1O A;  1RKW A;  2X6O A;  3MNL A;  2G7S A;  4D5C A;  5CXI A;  3ANP A;  2D6Y A;  2XGC A;  4CGR A;  2F07 A;  3LJL A;  3LSP A;  5AQC A;  3BHQ A;  5K7F A;  2WGB A;  2HXO A;  2NP3 A;  4V2G A;  1JTY A;  3Q3S A;  3E7Q A;  5IOY A;  3COL A;  3QPS A;  2IU5 A;  3ZQL A;  4GFK A;  2DTZ A;  3VW1 A;  2G7G A;  2XGE A;  4W97 A;  3ZQI A;  5F0H A;  5HBU A;  3QQA A;  3EUP A;  3KNW A;  3DEW A;  2PBX A;  5J1U A;  3LOC A;  3GEU A;  5GPC A;  2XPU A;  1ZKG A;  4ICH A;  2Y2Z A;  3FK7 A;  4I6Z A;  1UI5 A;  4MK6 A;  3BR2 A;  3NNR A;  2X9D A;  3IH3 A;  3AQS A;  5K7Z A;  4DW6 A;  3WHC A;  3Q0U A;  3B6C A;  3ON2 A;  3B6A A;  2G0E A;  3CCY A;  5DAJ A;  3ZQF A;  2ZCM A;  2FJ1 A;  4HKU A;  3BR0 A;  3VIB A;  2GUH A;  5CXG A;  4ME9 A;  3HTI A;  4GFL A;  1QPI A;  4UDS A;  5FKM A;  4KWA A;  3FIW A;  3NI7 A;  3HTJ A;  3BR1 A;  3Q0V A;  4G12 A;  3QKX A;  5D1R A;  3QPL A;  3DPJ A;  2ZCN A;  1Z77 A;  2IAI A;  2YVH A;  3LSR A;  4M3B A;  2W53 A;  3VOK A;  4JYK A;  2DG8 A;  3S5R A;  3QBM A;  3BR6 A;  3HTH A;  2UXI A;  2DG7 A;  1JUS A;  3PAS A;  3KZ9 A;  1QVT A;  2ZCX A;  2ZOY A;  3LSJ A;  2OI8 A;  3ON4 A;  4L62 A;  3BR3 A;  2QOP A;  4ABZ A;  4B1R A;  3KKD A;  4M3D A;  3P9T A;  3LHQ A;  4JNN A;  3PM1 A;  5IPA A;  2Q24 A;  3RH2 A;  5K7H A;  4AUX A;  2V57 A;  3HGG A;  2GEN A;  2HKU A;  5EZH A;  2XGD A;  2QWT A;  5F0C A;  4GCL A;  2UXH A;  3C07 A;  2XRL A;  3VW0 A;  2ID3 A;  4X1E A;  3BCG A;  1T33 A;  3CDL A;  3NXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...