3PASA

Crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
MRQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFYYVSDQVIDAALDSFSRGKDLREGLRRQWHTLFRIGLERPELFRYHETFTHSAWMTPEIQARNESRAANLLNAVDQGKQSGLIKPVPFPLLETFMFRPIYHLVQRCLQGSFEGTDEHIELAFNMAWDAVADR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family transcription regulator
publication title Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution
rcsb
source organism Marinobacter aquaeolei
molecule tags Transcription regulator
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pasA00
2X6OA 4YZEA 4ME9A 2RAEA 5J1UA 1T33A 3F0CA 5FKLA 3EGQA 3LJLA 3HGYA 1UI5A 2ID6A 3G1OA 3FRQA 3JSJA 3ZQFA 5K7HA 1QPIA 2G0EA 1JUPA 2WUIA 2PBXA 3KNWA 2GUHA 2ZCMA 3Q0UA 3WHCA 2DG7A 5F0FA 2NS8A 1JT0A 4GFLA 3BR1A 5GP9A 3T6NA 1SGMA 3VOXA 3TP0A 2Q24A 5K7ZA 5K58A 4B1RA 2WGBA 2FQ4A 2QTQA 4GCKA 3G56A 1BJZA 2RASA 2FBQA 3PM1A 2YVEA 5F0CA 3Q3SA 5H9TA 3BR0A 4ACIA 2OI8A 4ICHA 2Y31A 3BR5A 4XK4A 4W1UA 4M3FA 3G1LA 3V6GA 5F08A 3HIMA 3FK6A 3QQAA 3ZQHA 2XGEA 3HGGA 3BTIA 2NP3A 3TP3A 2F07A 3LHQA 3BR2A 3E7QA 1U9OA 3BCGA 2O7TA 2X9DA 3B6AA 2G7GA 2Y30A 4JNNA 4MO7A 3HTJA 2V57A 4M3GA 3ANGA 2ID3A 4M3DA 5EZGA 3QPSA 2NS7A 3ZQLA 2D6YA 5F1JA 2XB5A 2HXOA 2G7SA 4ABZA 2XPVA 3C2BA 4M3EA 4DW6A 3LOCA 3GZIA 3LSJA 5FKOA 5K7FA 2OPTA 2FJ1A 2VKEA 5IOZA 4I76A 5EYRA 3ZQGA 3QPLA 3BQYA 1Z77A 3CRJA 5AQCA 5D1RA 5GPAA 3NNRA 5FMPA 2I10A 3HTIA 4W97A 3VUQA 1JT6A 3IUVA 2RHAA 5J1YA 2IEKA 1QVTA 2HXIA 2O7OA 2FX0A 2UXUA 4UDSA 2JJ7A 2JK3A 2XGDA 2QWTA 3B6CA 2TRTA 2PZ9A 2QCOA 5DAJA 2QOPA 5CXGA 2IU5A 3SFIA 2ZCNA 3C07A 4GCLA 1JUMA 3BNIA 2HYTA 5HAWA 3NI7A 2TCTA 2UXHA 3VW0A 3KZ9A 1ORKA 3P9TA 4X1EA 3CDLA 3BTLA 4D7NA 3AQTA 3Q0VA 3MNLA 4AC6A 1T56A 4GCTA 3IH4A 1A6IA 3G1MA 3BQZA 4PXIA 3BR6A 4JYKA 3DEWA 4KWAA 2G7LA 3NRGA 5GPCA 3WHBA 3ANPA 2ZB9A 4JKZA 5D19A 2XPUA 3QBMA 5J3LA 2VPRA 3RH2A 5IPAA 2VKVA 3BRUA 2W53A 3VP5A 3VOKA 3RD3A 3HE0A 3COLA 5C4YA 2ZOYA 4G12A 5F04A 5HBUA 3BTCA 4HKUA 2IAIA 5FGLA 1JUSA 1RKTA 3BR3A 2G3BA 3NPIA 4NELA 3DPJA 1UI6A 5F27A 3QKXA 2YVHA 4B3AA 2GFNA 4MXMA 3CJDA 2HYJA 3HTHA 5J1RA 2NP5A 2QIBA 1JTXA 4JL3A 3FK7A 4V2GA 2HKUA 5EZHA 3PPBA 2REKA 3NXCA 3VPRA 3AQSA 3VVZA 2XDNA 3CWRA 3DCFA 2WV1A 3IH2A 2OF7A 1U9NA 2XPWA 3VW1A 4D7MA 1RKWA 5IOYA 5CXIA 4I6ZA 4CGRA 3KKDA 3ON4A 1QVUA 2UXPA 4M3BA 4GFKA 1Z0XA 2HQ5A 5EFYA 1VI0A 2QKOA 3HTAA 3O8GA 4V2FA 5FKKA 3F1BA 3LSRA 1ZK8A 3VIBA 4D5CA 3EUPA 2Y2ZA 3LWJA 3VVYA 3SDGA 2EH3A 2ZOZA 5F0HA 3B81A 2DTZA 4AF5A 3G7RA 3VVXA 3O60A 3BT9A 2DG8A 2NX4A 5FKMA 1ZKGA 2OERA 2UXOA 3IH3A 3MVPA 3FIWA 5D18A 4D5FA 2GENA 3ON2A 2FD5A 1JTYA 4MK6A 3V78A 3BJBA 2IBDA 3GEUA 5HSZA 2GBYA 3PASA 3Q0WA 5CW8A 5FKNA 3BHQA 3VW2A 3LSPA 3BTJA 3KKCA 2XGCA 4AUXA 2XRLA 2ZCXA 4L62A 5FHPA 3O8HA 3CCYA 5IP6A 4AC0A 3S5RA 1RPWA 2UXIA 4NN1A 3ZQIA
chains in the Genus database with same CATH superfamily
2X6OA 4YZEA 4ME9A 2RAEA 5J1UA 1T33A 3F0CA 5FKLA 3EGQA 3LJLA 3HGYA 1UI5A 2ID6A 3G1OA 3FRQA 3JSJA 3ZQFA 5K7HA 1QPIA 2G0EA 4OD4A 1JUPA 2WUIA 2PBXA 3K8PC 3KNWA 2GUHA 2ZCMA 3Q0UA 3WHCA 2DG7A 5F0FA 2NS8A 1JT0A 4GFLA 3BR1A 3NS4A 5GP9A 3T6NA 1SGMA 3VOXA 4C2MA 3TP0A 5CQGA 2Q24A 5K7ZA 5K58A 4B1RA 2A2FX 2FQ4A 2WGBA 2QTQA 4GCKA 3G56A 1BJZA 2RASA 2FBQA 3PM1A 2YVEA 5F0CA 3Q3SA 5H9TA 3BR0A 4ACIA 2OI8A 4ICHA 2Y31A 3BR5A 2ZY9A 4XK4A 4W1UA 4M3FA 4U9LA 3G1LA 3V6GA 5F08A 3HIMA 3FK6A 3QQAA 3ZQHA 2XGEA 3HGGA 3BTIA 2NP3A 4OD5A 3TP3A 2F07A 3LHQA 3BR2A 3E7QA 1U9OA 3BCGA 2O7TA 2R7XA 2X9DA 3B6AA 2G7GA 2Y30A 4JNNA 4MO7A 3HTJA 2V57A 4M3GA 3ANGA 2ID3A 4M3DA 5EZGA 3QPSA 2NS7A 3ZQLA 2D6YA 5F1JA 2XB5A 2HXOA 2G7SA 4ABZA 2XPVA 3C2BA 4M3EA 4DW6A 3LOCA 2R7QA 3GZIA 3LSJA 5FKOA 5K7FA 2R7TA 2OPTA 2FJ1A 2VKEA 2R7SA 5IOZA 4I76A 5EYRA 3ZQGA 3QPLA 3BQYA 1Z77A 3CRJA 5AQCA 5D1RA 5GPAA 3NNRA 5FMPA 2I10A 3HTIA 4W97A 3VUQA 1JT6A 3IUVA 2RHAA 5J1YA 2IEKA 1QVTA 2R7WA 2HXIA 2O7OA 2FX0A 2UXUA 4UDSA 2JJ7A 2JK3A 2XGDA 2QWTA 3B6CA 2TRTA 2PZ9A 2QCOA 5DAJA 2QOPA 5CXGA 2IU5A 3SFIA 2ZCNA 3C07A 4GCLA 1JUMA 3BNIA 2HYTA 5HAWA 2R7OA 3NI7A 2TCTA 2UXHA 3VW0A 3KZ9A 1ORKA 3P9TA 2R7UA 4X1EA 3CDLA 3DU6A 2B1EA 3BTLA 4D7NA 3AQTA 3Q0VA 3MNLA 4AC6A 1T56A 4GCTA 3IH4A 1A6IA 3G1MA 3BQZA 4PXIA 3BR6A 4JYKA 3FHNA 3DEWA 4KWAA 2G7LA 3NRGA 5GPCA 2B3WA 3WHBA 3ANPA 2ZB9A 4JKZA 5D19A 2XPUA 3QBMA 5J3LA 2VPRA 3RH2A 5IPAA 2VKVA 3BRUA 2W53A 3VP5A 3VOKA 3RD3A 3HE0A 3COLA 5C4YA 2YVXA 2ZOYA 4G12A 5F04A 5HBUA 3BTCA 4HKUA 2IAIA 5FGLA 1JUSA 1RKTA 3BR3A 2G3BA 3NPIA 4NELA 3DPJA 1UI6A 5F27A 3QKXA 2YVHA 4B3AA 4IRVA 2GFNA 4MXMA 3CJDA 4U9NA 2HYJA 3HTHA 5J1RA 2NP5A 2QIBA 1JTXA 4WIBA 4JL3A 3FK7A 4V2GA 2HKUA 5EZHA 3PPBA 2R7VA 2REKA 3NXCA 3VPRA 3AQSA 3VVZA 2XDNA 3CWRA 3DCFA 2WV1A 3IH2A 2OF7A 1U9NA 2XPWA 3VW1A 4D7MA 1RKWA 5IOYA 5CXIA 4DVYP 4I6ZA 4CGRA 3KKDA 3ON4A 1QVUA 2UXPA 4M3BA 4GFKA 1Z0XA 3KYLA 2HQ5A 5EFYA 1VI0A 2QKOA 3HTAA 3O8GA 4V2FA 5FKKA 3F1BA 3LSRA 1ZK8A 3VIBA 4D5CA 3EUPA 2Y2ZA 3LWJA 3VVYA 3SDGA 2EH3A 2ZOZA 5F0HA 3B81A 2DTZA 4AF5A 3G7RA 3VVXA 3O60A 3BT9A 2DG8A 2NX4A 5FKMA 1ZKGA 2OERA 2UXOA 3IH3A 3SWHA 3MVPA 3FIWA 5D18A 4D5FA 2GENA 3ON2A 2FD5A 1JTYA 4MK6A 3V78A 3BJBA 3VTIA 2IBDA 3GEUA 5HSZA 2GBYA 3PASA 3Q0WA 5CW8A 5FKNA 3BHQA 2PFVA 3VW2A 3LSPA 3BTJA 3KKCA 2XGCA 4AUXA 2R7RA 2XRLA 2ZCXA 4L62A 5FHPA 3O8HA 3CCYA 5IP6A 3DU5A 4AC0A 3S5RA 1RPWA 2UXIA 4NN1A 2FJI1 3ZQIA
chains in the Genus database with same CATH topology
2X6OA 4YZEA 4ME9A 2RAEA 5J1UA 1T33A 3F0CA 5FKLA 3EGQA 3LJLA 3HGYA 1UI5A 2ID6A 3G1OA 3FRQA 3JSJA 3ZQFA 5K7HA 1QPIA 2G0EA 1JUPA 2WUIA 2PBXA 3KNWA 2GUHA 2ZCMA 3Q0UA 3WHCA 2DG7A 5F0FA 2NS8A 1JT0A 4GFLA 3BR1A 5GP9A 3T6NA 1SGMA 3VOXA 3TP0A 2Q24A 5K7ZA 5K58A 4B1RA 2WGBA 2FQ4A 2QTQA 4GCKA 3G56A 1BJZA 2RASA 2FBQA 3PM1A 2YVEA 5F0CA 3Q3SA 5H9TA 3BR0A 4ACIA 2OI8A 4ICHA 2Y31A 3BR5A 4XK4A 4W1UA 4M3FA 3G1LA 3V6GA 5F08A 3HIMA 3FK6A 3QQAA 3ZQHA 2XGEA 3HGGA 3BTIA 2NP3A 3TP3A 2F07A 3LHQA 3BR2A 3E7QA 1U9OA 3BCGA 2O7TA 2X9DA 3B6AA 2G7GA 2Y30A 4JNNA 4MO7A 3HTJA 2V57A 4M3GA 3ANGA 2ID3A 4M3DA 5EZGA 3QPSA 2NS7A 3ZQLA 2D6YA 5F1JA 2XB5A 2HXOA 2G7SA 4ABZA 2XPVA 3C2BA 4M3EA 4DW6A 3LOCA 3GZIA 3LSJA 5FKOA 5K7FA 2OPTA 2FJ1A 2VKEA 5IOZA 4I76A 5EYRA 3ZQGA 3QPLA 3BQYA 1Z77A 3CRJA 5AQCA 5D1RA 5GPAA 3NNRA 5FMPA 2I10A 3HTIA 4W97A 3VUQA 1JT6A 3IUVA 2RHAA 5J1YA 2IEKA 1QVTA 2HXIA 2O7OA 2FX0A 2UXUA 4UDSA 2JJ7A 2JK3A 2XGDA 2QWTA 3B6CA 2TRTA 2PZ9A 2QCOA 5DAJA 2QOPA 5CXGA 2IU5A 3SFIA 2ZCNA 3C07A 4GCLA 1JUMA 3BNIA 2HYTA 5HAWA 3NI7A 2TCTA 2UXHA 3VW0A 3KZ9A 1ORKA 3P9TA 4X1EA 3CDLA 3BTLA 4D7NA 3AQTA 3Q0VA 3MNLA 4AC6A 1T56A 4GCTA 3IH4A 1A6IA 3G1MA 3BQZA 4PXIA 3BR6A 4JYKA 3DEWA 4KWAA 2G7LA 3NRGA 5GPCA 3WHBA 3ANPA 2ZB9A 4JKZA 5D19A 2XPUA 3QBMA 5J3LA 2VPRA 3RH2A 5IPAA 2VKVA 3BRUA 2W53A 3VP5A 3VOKA 3RD3A 3HE0A 3COLA 5C4YA 2ZOYA 4G12A 5F04A 5HBUA 3BTCA 4HKUA 2IAIA 5FGLA 1JUSA 1RKTA 3BR3A 2G3BA 3NPIA 4NELA 3DPJA 1UI6A 5F27A 3QKXA 2YVHA 4B3AA 2GFNA 4MXMA 3CJDA 2HYJA 3HTHA 5J1RA 2NP5A 2QIBA 1JTXA 4JL3A 3FK7A 4V2GA 2HKUA 5EZHA 3PPBA 2REKA 3NXCA 3VPRA 3AQSA 3VVZA 2XDNA 3CWRA 3DCFA 2WV1A 3IH2A 2OF7A 1U9NA 2XPWA 3VW1A 4D7MA 1RKWA 5IOYA 5CXIA 4I6ZA 4CGRA 3KKDA 3ON4A 1QVUA 2UXPA 4M3BA 4GFKA 1Z0XA 2HQ5A 5EFYA 1VI0A 2QKOA 3HTAA 3O8GA 4V2FA 5FKKA 3F1BA 3LSRA 1ZK8A 3VIBA 4D5CA 3EUPA 2Y2ZA 3LWJA 3VVYA 3SDGA 2EH3A 2ZOZA 5F0HA 3B81A 2DTZA 4AF5A 3G7RA 3VVXA 3O60A 3BT9A 2DG8A 2NX4A 5FKMA 1ZKGA 2OERA 2UXOA 3IH3A 3MVPA 3FIWA 5D18A 4D5FA 2GENA 3ON2A 2FD5A 1JTYA 4MK6A 3V78A 3BJBA 2IBDA 3GEUA 5HSZA 2GBYA 3PASA 3Q0WA 5CW8A 5FKNA 3BHQA 3VW2A 3LSPA 3BTJA 3KKCA 2XGCA 4AUXA 2XRLA 2ZCXA 4L62A 5FHPA 3O8HA 3CCYA 5IP6A 4AC0A 3S5RA 1RPWA 2UXIA 4NN1A 3ZQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6O A;  4YZE A;  4ME9 A;  2RAE A;  5J1U A;  1T33 A;  3F0C A;  5FKL A;  3EGQ A;  3LJL A;  3HGY A;  1UI5 A;  2ID6 A;  3G1O A;  3FRQ A;  3JSJ A;  3ZQF A;  5K7H A;  1QPI A;  2G0E A;  1JUP A;  2WUI A;  2PBX A;  3KNW A;  2GUH A;  2ZCM A;  3Q0U A;  3WHC A;  2DG7 A;  5F0F A;  2NS8 A;  1JT0 A;  4GFL A;  3BR1 A;  5GP9 A;  3T6N A;  1SGM A;  3VOX A;  3TP0 A;  2Q24 A;  5K7Z A;  5K58 A;  4B1R A;  2WGB A;  2FQ4 A;  2QTQ A;  4GCK A;  3G56 A;  1BJZ A;  2RAS A;  2FBQ A;  3PM1 A;  2YVE A;  5F0C A;  3Q3S A;  5H9T A;  3BR0 A;  4ACI A;  2OI8 A;  4ICH A;  2Y31 A;  3BR5 A;  4XK4 A;  4W1U A;  4M3F A;  3G1L A;  3V6G A;  5F08 A;  3HIM A;  3FK6 A;  3QQA A;  3ZQH A;  2XGE A;  3HGG A;  3BTI A;  2NP3 A;  3TP3 A;  2F07 A;  3LHQ A;  3BR2 A;  3E7Q A;  1U9O A;  3BCG A;  2O7T A;  2X9D A;  3B6A A;  2G7G A;  2Y30 A;  4JNN A;  4MO7 A;  3HTJ A;  2V57 A;  4M3G A;  3ANG A;  2ID3 A;  4M3D A;  5EZG A;  3QPS A;  2NS7 A;  3ZQL A;  2D6Y A;  5F1J A;  2XB5 A;  2HXO A;  2G7S A;  4ABZ A;  2XPV A;  3C2B A;  4M3E A;  4DW6 A;  3LOC A;  3GZI A;  3LSJ A;  5FKO A;  5K7F A;  2OPT A;  2FJ1 A;  2VKE A;  5IOZ A;  4I76 A;  5EYR A;  3ZQG A;  3QPL A;  3BQY A;  1Z77 A;  3CRJ A;  5AQC A;  5D1R A;  5GPA A;  3NNR A;  5FMP A;  2I10 A;  3HTI A;  4W97 A;  3VUQ A;  1JT6 A;  3IUV A;  2RHA A;  5J1Y A;  2IEK A;  1QVT A;  2HXI A;  2O7O A;  2FX0 A;  2UXU A;  4UDS A;  2JJ7 A;  2JK3 A;  2XGD A;  2QWT A;  3B6C A;  2TRT A;  2PZ9 A;  2QCO A;  5DAJ A;  2QOP A;  5CXG A;  2IU5 A;  3SFI A;  2ZCN A;  3C07 A;  4GCL A;  1JUM A;  3BNI A;  2HYT A;  5HAW A;  3NI7 A;  2TCT A;  2UXH A;  3VW0 A;  3KZ9 A;  1ORK A;  3P9T A;  4X1E A;  3CDL A;  3BTL A;  4D7N A;  3AQT A;  3Q0V A;  3MNL A;  4AC6 A;  1T56 A;  4GCT A;  3IH4 A;  1A6I A;  3G1M A;  3BQZ A;  4PXI A;  3BR6 A;  4JYK A;  3DEW A;  4KWA A;  2G7L A;  3NRG A;  5GPC A;  3WHB A;  3ANP A;  2ZB9 A;  4JKZ A;  5D19 A;  2XPU A;  3QBM A;  5J3L A;  2VPR A;  3RH2 A;  5IPA A;  2VKV A;  3BRU A;  2W53 A;  3VP5 A;  3VOK A;  3RD3 A;  3HE0 A;  3COL A;  5C4Y A;  2ZOY A;  4G12 A;  5F04 A;  5HBU A;  3BTC A;  4HKU A;  2IAI A;  5FGL A;  1JUS A;  1RKT A;  3BR3 A;  2G3B A;  3NPI A;  4NEL A;  3DPJ A;  1UI6 A;  5F27 A;  3QKX A;  2YVH A;  4B3A A;  2GFN A;  4MXM A;  3CJD A;  2HYJ A;  3HTH A;  5J1R A;  2NP5 A;  2QIB A;  1JTX A;  4JL3 A;  3FK7 A;  4V2G A;  2HKU A;  5EZH A;  3PPB A;  2REK A;  3NXC A;  3VPR A;  3AQS A;  3VVZ A;  2XDN A;  3CWR A;  3DCF A;  2WV1 A;  3IH2 A;  2OF7 A;  1U9N A;  2XPW A;  3VW1 A;  4D7M A;  1RKW A;  5IOY A;  5CXI A;  4I6Z A;  4CGR A;  3KKD A;  3ON4 A;  1QVU A;  2UXP A;  4M3B A;  4GFK A;  1Z0X A;  2HQ5 A;  5EFY A;  1VI0 A;  2QKO A;  3HTA A;  3O8G A;  4V2F A;  5FKK A;  3F1B A;  3LSR A;  1ZK8 A;  3VIB A;  4D5C A;  3EUP A;  2Y2Z A;  3LWJ A;  3VVY A;  3SDG A;  2EH3 A;  2ZOZ A;  5F0H A;  3B81 A;  2DTZ A;  4AF5 A;  3G7R A;  3VVX A;  3O60 A;  3BT9 A;  2DG8 A;  2NX4 A;  5FKM A;  1ZKG A;  2OER A;  2UXO A;  3IH3 A;  3MVP A;  3FIW A;  5D18 A;  4D5F A;  2GEN A;  3ON2 A;  2FD5 A;  1JTY A;  4MK6 A;  3V78 A;  3BJB A;  2IBD A;  3GEU A;  5HSZ A;  2GBY A;  3PAS A;  3Q0W A;  5CW8 A;  5FKN A;  3BHQ A;  3VW2 A;  3LSP A;  3BTJ A;  3KKC A;  2XGC A;  4AUX A;  2XRL A;  2ZCX A;  4L62 A;  5FHP A;  3O8H A;  3CCY A;  5IP6 A;  4AC0 A;  3S5R A;  1RPW A;  2UXI A;  4NN1 A;  3ZQI A; 
#chains in the Genus database with same CATH topology
 2X6O A;  4YZE A;  4ME9 A;  2RAE A;  5J1U A;  1T33 A;  3F0C A;  5FKL A;  3EGQ A;  3LJL A;  3HGY A;  1UI5 A;  2ID6 A;  3G1O A;  3FRQ A;  3JSJ A;  3ZQF A;  5K7H A;  1QPI A;  2G0E A;  4OD4 A;  1JUP A;  2WUI A;  2PBX A;  3K8P C;  3KNW A;  2GUH A;  2ZCM A;  3Q0U A;  3WHC A;  2DG7 A;  5F0F A;  2NS8 A;  1JT0 A;  4GFL A;  3BR1 A;  3NS4 A;  5GP9 A;  3T6N A;  1SGM A;  3VOX A;  4C2M A;  3TP0 A;  5CQG A;  2Q24 A;  5K7Z A;  5K58 A;  4B1R A;  2A2F X;  2FQ4 A;  2WGB A;  2QTQ A;  4GCK A;  3G56 A;  1BJZ A;  2RAS A;  2FBQ A;  3PM1 A;  2YVE A;  5F0C A;  3Q3S A;  5H9T A;  3BR0 A;  4ACI A;  2OI8 A;  4ICH A;  2Y31 A;  3BR5 A;  2ZY9 A;  4XK4 A;  4W1U A;  4M3F A;  4U9L A;  3G1L A;  3V6G A;  5F08 A;  3HIM A;  3FK6 A;  3QQA A;  3ZQH A;  2XGE A;  3HGG A;  3BTI A;  2NP3 A;  4OD5 A;  3TP3 A;  2F07 A;  3LHQ A;  3BR2 A;  3E7Q A;  1U9O A;  3BCG A;  2O7T A;  2R7X A;  2X9D A;  3B6A A;  2G7G A;  2Y30 A;  4JNN A;  4MO7 A;  3HTJ A;  2V57 A;  4M3G A;  3ANG A;  2ID3 A;  4M3D A;  5EZG A;  3QPS A;  2NS7 A;  3ZQL A;  2D6Y A;  5F1J A;  2XB5 A;  2HXO A;  2G7S A;  4ABZ A;  2XPV A;  3C2B A;  4M3E A;  4DW6 A;  3LOC A;  2R7Q A;  3GZI A;  3LSJ A;  5FKO A;  5K7F A;  2R7T A;  2OPT A;  2FJ1 A;  2VKE A;  2R7S A;  5IOZ A;  4I76 A;  5EYR A;  3ZQG A;  3QPL A;  3BQY A;  1Z77 A;  3CRJ A;  5AQC A;  5D1R A;  5GPA A;  3NNR A;  5FMP A;  2I10 A;  3HTI A;  4W97 A;  3VUQ A;  1JT6 A;  3IUV A;  2RHA A;  5J1Y A;  2IEK A;  1QVT A;  2R7W A;  2HXI A;  2O7O A;  2FX0 A;  2UXU A;  4UDS A;  2JJ7 A;  2JK3 A;  2XGD A;  2QWT A;  3B6C A;  2TRT A;  2PZ9 A;  2QCO A;  5DAJ A;  2QOP A;  5CXG A;  2IU5 A;  3SFI A;  2ZCN A;  3C07 A;  4GCL A;  1JUM A;  3BNI A;  2HYT A;  5HAW A;  2R7O A;  3NI7 A;  2TCT A;  2UXH A;  3VW0 A;  3KZ9 A;  1ORK A;  3P9T A;  2R7U A;  4X1E A;  3CDL A;  3DU6 A;  2B1E A;  3BTL A;  4D7N A;  3AQT A;  3Q0V A;  3MNL A;  4AC6 A;  1T56 A;  4GCT A;  3IH4 A;  1A6I A;  3G1M A;  3BQZ A;  4PXI A;  3BR6 A;  4JYK A;  3FHN A;  3DEW A;  4KWA A;  2G7L A;  3NRG A;  5GPC A;  2B3W A;  3WHB A;  3ANP A;  2ZB9 A;  4JKZ A;  5D19 A;  2XPU A;  3QBM A;  5J3L A;  2VPR A;  3RH2 A;  5IPA A;  2VKV A;  3BRU A;  2W53 A;  3VP5 A;  3VOK A;  3RD3 A;  3HE0 A;  3COL A;  5C4Y A;  2YVX A;  2ZOY A;  4G12 A;  5F04 A;  5HBU A;  3BTC A;  4HKU A;  2IAI A;  5FGL A;  1JUS A;  1RKT A;  3BR3 A;  2G3B A;  3NPI A;  4NEL A;  3DPJ A;  1UI6 A;  5F27 A;  3QKX A;  2YVH A;  4B3A A;  4IRV A;  2GFN A;  4MXM A;  3CJD A;  4U9N A;  2HYJ A;  3HTH A;  5J1R A;  2NP5 A;  2QIB A;  1JTX A;  4WIB A;  4JL3 A;  3FK7 A;  4V2G A;  2HKU A;  5EZH A;  3PPB A;  2R7V A;  2REK A;  3NXC A;  3VPR A;  3AQS A;  3VVZ A;  2XDN A;  3CWR A;  3DCF A;  2WV1 A;  3IH2 A;  2OF7 A;  1U9N A;  2XPW A;  3VW1 A;  4D7M A;  1RKW A;  5IOY A;  5CXI A;  4DVY P;  4I6Z A;  4CGR A;  3KKD A;  3ON4 A;  1QVU A;  2UXP A;  4M3B A;  4GFK A;  1Z0X A;  3KYL A;  2HQ5 A;  5EFY A;  1VI0 A;  2QKO A;  3HTA A;  3O8G A;  4V2F A;  5FKK A;  3F1B A;  3LSR A;  1ZK8 A;  3VIB A;  4D5C A;  3EUP A;  2Y2Z A;  3LWJ A;  3VVY A;  3SDG A;  2EH3 A;  2ZOZ A;  5F0H A;  3B81 A;  2DTZ A;  4AF5 A;  3G7R A;  3VVX A;  3O60 A;  3BT9 A;  2DG8 A;  2NX4 A;  5FKM A;  1ZKG A;  2OER A;  2UXO A;  3IH3 A;  3SWH A;  3MVP A;  3FIW A;  5D18 A;  4D5F A;  2GEN A;  3ON2 A;  2FD5 A;  1JTY A;  4MK6 A;  3V78 A;  3BJB A;  3VTI A;  2IBD A;  3GEU A;  5HSZ A;  2GBY A;  3PAS A;  3Q0W A;  5CW8 A;  5FKN A;  3BHQ A;  2PFV A;  3VW2 A;  3LSP A;  3BTJ A;  3KKC A;  2XGC A;  4AUX A;  2R7R A;  2XRL A;  2ZCX A;  4L62 A;  5FHP A;  3O8H A;  3CCY A;  5IP6 A;  3DU5 A;  4AC0 A;  3S5R A;  1RPW A;  2UXI A;  4NN1 A;  2FJI 1;  3ZQI A; 
#chains in the Genus database with same CATH homology
 2X6O A;  4YZE A;  4ME9 A;  2RAE A;  5J1U A;  1T33 A;  3F0C A;  5FKL A;  3EGQ A;  3LJL A;  3HGY A;  1UI5 A;  2ID6 A;  3G1O A;  3FRQ A;  3JSJ A;  3ZQF A;  5K7H A;  1QPI A;  2G0E A;  1JUP A;  2WUI A;  2PBX A;  3KNW A;  2GUH A;  2ZCM A;  3Q0U A;  3WHC A;  2DG7 A;  5F0F A;  2NS8 A;  1JT0 A;  4GFL A;  3BR1 A;  5GP9 A;  3T6N A;  1SGM A;  3VOX A;  3TP0 A;  2Q24 A;  5K7Z A;  5K58 A;  4B1R A;  2WGB A;  2FQ4 A;  2QTQ A;  4GCK A;  3G56 A;  1BJZ A;  2RAS A;  2FBQ A;  3PM1 A;  2YVE A;  5F0C A;  3Q3S A;  5H9T A;  3BR0 A;  4ACI A;  2OI8 A;  4ICH A;  2Y31 A;  3BR5 A;  4XK4 A;  4W1U A;  4M3F A;  3G1L A;  3V6G A;  5F08 A;  3HIM A;  3FK6 A;  3QQA A;  3ZQH A;  2XGE A;  3HGG A;  3BTI A;  2NP3 A;  3TP3 A;  2F07 A;  3LHQ A;  3BR2 A;  3E7Q A;  1U9O A;  3BCG A;  2O7T A;  2X9D A;  3B6A A;  2G7G A;  2Y30 A;  4JNN A;  4MO7 A;  3HTJ A;  2V57 A;  4M3G A;  3ANG A;  2ID3 A;  4M3D A;  5EZG A;  3QPS A;  2NS7 A;  3ZQL A;  2D6Y A;  5F1J A;  2XB5 A;  2HXO A;  2G7S A;  4ABZ A;  2XPV A;  3C2B A;  4M3E A;  4DW6 A;  3LOC A;  3GZI A;  3LSJ A;  5FKO A;  5K7F A;  2OPT A;  2FJ1 A;  2VKE A;  5IOZ A;  4I76 A;  5EYR A;  3ZQG A;  3QPL A;  3BQY A;  1Z77 A;  3CRJ A;  5AQC A;  5D1R A;  5GPA A;  3NNR A;  5FMP A;  2I10 A;  3HTI A;  4W97 A;  3VUQ A;  1JT6 A;  3IUV A;  2RHA A;  5J1Y A;  2IEK A;  1QVT A;  2HXI A;  2O7O A;  2FX0 A;  2UXU A;  4UDS A;  2JJ7 A;  2JK3 A;  2XGD A;  2QWT A;  3B6C A;  2TRT A;  2PZ9 A;  2QCO A;  5DAJ A;  2QOP A;  5CXG A;  2IU5 A;  3SFI A;  2ZCN A;  3C07 A;  4GCL A;  1JUM A;  3BNI A;  2HYT A;  5HAW A;  3NI7 A;  2TCT A;  2UXH A;  3VW0 A;  3KZ9 A;  1ORK A;  3P9T A;  4X1E A;  3CDL A;  3BTL A;  4D7N A;  3AQT A;  3Q0V A;  3MNL A;  4AC6 A;  1T56 A;  4GCT A;  3IH4 A;  1A6I A;  3G1M A;  3BQZ A;  4PXI A;  3BR6 A;  4JYK A;  3DEW A;  4KWA A;  2G7L A;  3NRG A;  5GPC A;  3WHB A;  3ANP A;  2ZB9 A;  4JKZ A;  5D19 A;  2XPU A;  3QBM A;  5J3L A;  2VPR A;  3RH2 A;  5IPA A;  2VKV A;  3BRU A;  2W53 A;  3VP5 A;  3VOK A;  3RD3 A;  3HE0 A;  3COL A;  5C4Y A;  2ZOY A;  4G12 A;  5F04 A;  5HBU A;  3BTC A;  4HKU A;  2IAI A;  5FGL A;  1JUS A;  1RKT A;  3BR3 A;  2G3B A;  3NPI A;  4NEL A;  3DPJ A;  1UI6 A;  5F27 A;  3QKX A;  2YVH A;  4B3A A;  2GFN A;  4MXM A;  3CJD A;  2HYJ A;  3HTH A;  5J1R A;  2NP5 A;  2QIB A;  1JTX A;  4JL3 A;  3FK7 A;  4V2G A;  2HKU A;  5EZH A;  3PPB A;  2REK A;  3NXC A;  3VPR A;  3AQS A;  3VVZ A;  2XDN A;  3CWR A;  3DCF A;  2WV1 A;  3IH2 A;  2OF7 A;  1U9N A;  2XPW A;  3VW1 A;  4D7M A;  1RKW A;  5IOY A;  5CXI A;  4I6Z A;  4CGR A;  3KKD A;  3ON4 A;  1QVU A;  2UXP A;  4M3B A;  4GFK A;  1Z0X A;  2HQ5 A;  5EFY A;  1VI0 A;  2QKO A;  3HTA A;  3O8G A;  4V2F A;  5FKK A;  3F1B A;  3LSR A;  1ZK8 A;  3VIB A;  4D5C A;  3EUP A;  2Y2Z A;  3LWJ A;  3VVY A;  3SDG A;  2EH3 A;  2ZOZ A;  5F0H A;  3B81 A;  2DTZ A;  4AF5 A;  3G7R A;  3VVX A;  3O60 A;  3BT9 A;  2DG8 A;  2NX4 A;  5FKM A;  1ZKG A;  2OER A;  2UXO A;  3IH3 A;  3MVP A;  3FIW A;  5D18 A;  4D5F A;  2GEN A;  3ON2 A;  2FD5 A;  1JTY A;  4MK6 A;  3V78 A;  3BJB A;  2IBD A;  3GEU A;  5HSZ A;  2GBY A;  3PAS A;  3Q0W A;  5CW8 A;  5FKN A;  3BHQ A;  3VW2 A;  3LSP A;  3BTJ A;  3KKC A;  2XGC A;  4AUX A;  2XRL A;  2ZCX A;  4L62 A;  5FHP A;  3O8H A;  3CCY A;  5IP6 A;  4AC0 A;  3S5R A;  1RPW A;  2UXI A;  4NN1 A;  3ZQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...