3PASA

Crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
b'MRQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFYYVSDQVIDAALDSFSRGKDLREGLRRQWHTLFRIGLERPELFRYHETFTHSAWMTPEIQARNESRAANLLNAVDQGKQSGLIKPVPFPLLETFMFRPIYHLVQRCLQGSFEGTDEHIELAFNMAWDAVADR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family transcription regulator
publication title Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution
rcsb
source organism Marinobacter aquaeolei
molecule tags Transcription regulator
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pasA00
3QQAA 2UXPA 5GPCA 1UI6A 4GFKA 4MXMA 2FJ1A 5F1JA 3FK7A 2FX0A 1U9OA 5AQCA 1JTYA 4I76A 3EGQA 2W53A 5CXGA 4D7NA 3HTAA 5K7HA 3G1OA 4X1EA 2JK3A 3TP0A 2VKVA 5J1RA 3BR6A 5D18A 3C2BA 5GPAA 3SFIA 3ON2A 3T6NA 3BTJA 4UDSA 2IU5A 2D6YA 3VPRA 5H9TA 2OPTA 3VVYA 5F04A 2G0EA 2PZ9A 1JUMA 1JUPA 5EFYA 2RAEA 2OERA 5IOYA 5IPAA 3QPLA 2HYTA 3BT9A 2ZOZA 3FIWA 2NP5A 3HTHA 3ANPA 3VOXA 3VUQA 3G56A 4M3DA 2YVEA 2QWTA 5FKOA 4M3GA 5EZHA 3HIMA 2WV1A 3LJLA 4D5FA 1RKWA 3QBMA 4KWAA 1A6IA 4HKUA 3MVPA 2V57A 2VPRA 3CCYA 5F0FA 5J3LA 2XPUA 2NX4A 3KZ9A 2XRLA 2HXIA 2Y30A 3MNLA 5GP9A 2ZOYA 2FBQA 4MO7A 5HAWA 3ZQIA 2XDNA 2G7GA 3O60A 3NNRA 2ZCMA 2F07A 3GZIA 3IH2A 2G3BA 3G1LA 3O8HA 3Q3SA 4B1RA 4V2GA 3CJDA 5IOZA 2GUHA 2Y31A 3CDLA 3WHBA 3HGGA 1QVTA 3EUPA 4PXIA 1VI0A 3F0CA 3LWJA 3ZQGA 3ZQFA 2PBXA 2X9DA 3BCGA 5FKKA 2I10A 3QPSA 2XPWA 3NRGA 3ON4A 3C07A 2WUIA 2UXUA 3VP5A 5EYRA 5D19A 2XGCA 3LSRA 2NS7A 1JUSA 1Z77A 5F0HA 2RASA 1QVUA 5HBUA 3VW1A 1RPWA 2G7SA 4L62A 4I6ZA 3KKDA 2GFNA 5D1RA 3RD3A 5F08A 5K7FA 2IEKA 3NPIA 5HSZA 3S5RA 2HXOA 3PPBA 4CGRA 4W1UA 3HGYA 5C4YA 3BTLA 2O7OA 3VW2A 3O8GA 2UXHA 3IH4A 5CXIA 2OF7A 2DG8A 1Z0XA 3E7QA 3BHQA 3HTIA 1JTXA 3BR3A 5K58A 2ID3A 3VW0A 2FD5A 3NI7A 1ORKA 2HYJA 3BNIA 3HE0A 1ZKGA 4W97A 1T33A 3BRUA 5F27A 2Q24A 2TCTA 3SDGA 4M3EA 2QCOA 2HQ5A 4G12A 5J1UA 2ID6A 4AUXA 5K7ZA 2O7TA 2YVHA 3IUVA 3COLA 4DW6A 2XGEA 5FKLA 2DTZA 3FRQA 2UXOA 4NN1A 4ME9A 5FGLA 2VKEA 3KNWA 5FHPA 4GCLA 1JT6A 3DPJA 4XK4A 3JSJA 1QPIA 3AQTA 3P9TA 3Q0WA 3V6GA 2JJ7A 4GCKA 2NP3A 2IAIA 3LHQA 1BJZA 3B81A 5CW8A 3TP3A 4NELA 5FKMA 4JNNA 3VIBA 2EH3A 3BR0A 2HKUA 4B3AA 3Q0VA 2ZCXA 3QKXA 4AC0A 5DAJA 3BR1A 4JYKA 5FKNA 3PM1A 3G1MA 2X6OA 3LOCA 3WHCA 3BQYA 3CRJA 2GENA 3V78A 4JL3A 3F1BA 4ICHA 3LSJA 5FMPA 3BQZA 2XPVA 2TRTA 3ANGA 3Q0UA 2G7LA 1JT0A 4D5CA 2NS8A 5EZGA 2IBDA 4JKZA 3RH2A 2OI8A 1UI5A 3ZQLA 2REKA 2QTQA 3PASA 2QIBA 3CWRA 3AQSA 4D7MA 3B6AA 4V2FA 3G7RA 3BTIA 1ZK8A 3VVZA 2QOPA 3GEUA 4M3BA 1SGMA 4GFLA 2Y2ZA 3FK6A 3VVXA 3ZQHA 4ACIA 2XGDA 2DG7A 4GCTA 2WGBA 2QKOA 2RHAA 3DCFA 3B6CA 2FQ4A 4M3FA 4AF5A 4YZEA 5J1YA 5F0CA 3IH3A 3VOKA 2GBYA 4ABZA 3KKCA 3BJBA 2ZCNA 5IP6A 3DEWA 3BR5A 4MK6A 2ZB9A 1T56A 3HTJA 3LSPA 1U9NA 2UXIA 3NXCA 3BR2A 1RKTA 4AC6A 2XB5A 3BTCA
chains in the Genus database with same CATH superfamily
3QQAA 2UXPA 5GPCA 2R7XA 1UI6A 2A2FX 3SWHA 4GFKA 4MXMA 2R7VA 2FJ1A 5F1JA 3FK7A 3KYLA 2FX0A 1U9OA 5AQCA 1JTYA 4I76A 3EGQA 2W53A 5CXGA 4D7NA 3HTAA 5K7HA 3G1OA 4X1EA 2JK3A 3TP0A 2VKVA 5J1RA 2R7WA 3BR6A 5D18A 3C2BA 5GPAA 3SFIA 3ON2A 3T6NA 3BTJA 4UDSA 2IU5A 2D6YA 3VPRA 5H9TA 2OPTA 3VVYA 5F04A 2G0EA 2PZ9A 1JUMA 1JUPA 5EFYA 2RAEA 2OERA 5IOYA 5IPAA 3QPLA 2HYTA 3BT9A 2ZOZA 3VTIA 3FIWA 2NP5A 3HTHA 3ANPA 3VOXA 3VUQA 3G56A 4M3DA 2YVEA 2QWTA 5FKOA 4M3GA 3DU6A 5EZHA 3HIMA 2WV1A 3LJLA 4D5FA 1RKWA 3QBMA 4KWAA 1A6IA 4HKUA 2R7OA 3MVPA 2V57A 2VPRA 3CCYA 5F0FA 5J3LA 2XPUA 2NX4A 3KZ9A 2XRLA 2HXIA 2Y30A 3MNLA 5GP9A 2ZOYA 2FBQA 4MO7A 4U9LA 5HAWA 3ZQIA 2XDNA 2G7GA 3O60A 3NNRA 2ZCMA 2F07A 3GZIA 3IH2A 2G3BA 3G1LA 3O8HA 3Q3SA 4B1RA 4V2GA 3CJDA 4WIBA 5IOZA 2GUHA 2Y31A 3CDLA 3WHBA 3HGGA 1QVTA 3EUPA 2YVXA 1VI0A 4PXIA 3F0CA 3LWJA 5CQGA 3ZQGA 3ZQFA 2PBXA 2X9DA 3BCGA 5FKKA 2I10A 3QPSA 2XPWA 3NRGA 3ON4A 3C07A 2WUIA 2R7QA 4OD4A 2UXUA 3VP5A 5EYRA 5D19A 2XGCA 3LSRA 2NS7A 4OD5A 1JUSA 2R7RA 1Z77A 5F0HA 4U9NA 2RASA 1QVUA 4IRVA 5HBUA 3VW1A 1RPWA 2G7SA 4L62A 4I6ZA 3KKDA 4C2MA 2GFNA 3K8PC 5D1RA 3RD3A 5F08A 5K7FA 2IEKA 3NPIA 5HSZA 3S5RA 2HXOA 3PPBA 2R7SA 4CGRA 4W1UA 3HGYA 5C4YA 3BTLA 2O7OA 3VW2A 3O8GA 2ZY9A 2UXHA 3IH4A 5CXIA 2OF7A 2DG8A 1Z0XA 3E7QA 3BHQA 3HTIA 1JTXA 3BR3A 5K58A 2ID3A 3VW0A 2FD5A 3NI7A 1ORKA 2HYJA 3BNIA 3HE0A 1ZKGA 4W97A 1T33A 3BRUA 5F27A 2Q24A 2PFVA 2TCTA 3FHNA 3SDGA 4M3EA 2QCOA 2HQ5A 4G12A 5J1UA 2ID6A 4AUXA 2R7TA 5K7ZA 2O7TA 2YVHA 3IUVA 3COLA 4DW6A 2XGEA 5FKLA 2DTZA 3FRQA 2UXOA 4NN1A 4ME9A 5FGLA 2VKEA 3KNWA 5FHPA 4GCLA 1JT6A 2B1EA 3DPJA 4XK4A 3JSJA 1QPIA 3AQTA 3P9TA 3Q0WA 3V6GA 2JJ7A 2R7UA 2B3WA 4GCKA 2NP3A 2IAIA 3LHQA 1BJZA 3B81A 5CW8A 3TP3A 4NELA 5FKMA 4JNNA 3VIBA 2EH3A 3BR0A 2HKUA 4B3AA 3Q0VA 2ZCXA 3QKXA 4AC0A 5DAJA 3BR1A 4JYKA 5FKNA 3PM1A 3G1MA 2X6OA 3LOCA 3WHCA 3BQYA 3CRJA 2GENA 3V78A 4JL3A 3F1BA 4ICHA 3LSJA 5FMPA 3BQZA 2XPVA 2TRTA 3ANGA 3Q0UA 2G7LA 1JT0A 4D5CA 2NS8A 5EZGA 2IBDA 4JKZA 3RH2A 2OI8A 1UI5A 3ZQLA 2REKA 2QTQA 3PASA 2QIBA 3CWRA 3AQSA 4D7MA 3B6AA 4V2FA 3G7RA 3BTIA 3NS4A 1ZK8A 3DU5A 3VVZA 2QOPA 3GEUA 4M3BA 1SGMA 4GFLA 2Y2ZA 3FK6A 3VVXA 3ZQHA 4ACIA 2XGDA 2DG7A 4GCTA 2WGBA 2QKOA 2RHAA 3DCFA 3B6CA 2FQ4A 4M3FA 4AF5A 4YZEA 4DVYP 5J1YA 5F0CA 3IH3A 3VOKA 2GBYA 4ABZA 3KKCA 3BJBA 2ZCNA 5IP6A 3DEWA 3BR5A 4MK6A 2ZB9A 1T56A 3HTJA 2FJI1 3LSPA 1U9NA 2UXIA 3NXCA 3BR2A 1RKTA 4AC6A 2XB5A 3BTCA
chains in the Genus database with same CATH topology
3QQAA 2UXPA 5GPCA 1UI6A 4GFKA 4MXMA 2FJ1A 5F1JA 3FK7A 2FX0A 1U9OA 5AQCA 1JTYA 4I76A 3EGQA 2W53A 5CXGA 4D7NA 3HTAA 5K7HA 3G1OA 4X1EA 2JK3A 3TP0A 2VKVA 5J1RA 3BR6A 5D18A 3C2BA 5GPAA 3SFIA 3ON2A 3T6NA 3BTJA 4UDSA 2IU5A 2D6YA 3VPRA 5H9TA 2OPTA 3VVYA 5F04A 2G0EA 2PZ9A 1JUMA 1JUPA 5EFYA 2RAEA 2OERA 5IOYA 5IPAA 3QPLA 2HYTA 3BT9A 2ZOZA 3FIWA 2NP5A 3HTHA 3ANPA 3VOXA 3VUQA 3G56A 4M3DA 2YVEA 2QWTA 5FKOA 4M3GA 5EZHA 3HIMA 2WV1A 3LJLA 4D5FA 1RKWA 3QBMA 4KWAA 1A6IA 4HKUA 3MVPA 2V57A 2VPRA 3CCYA 5F0FA 5J3LA 2XPUA 2NX4A 3KZ9A 2XRLA 2HXIA 2Y30A 3MNLA 5GP9A 2ZOYA 2FBQA 4MO7A 5HAWA 3ZQIA 2XDNA 2G7GA 3O60A 3NNRA 2ZCMA 2F07A 3GZIA 3IH2A 2G3BA 3G1LA 3O8HA 3Q3SA 4B1RA 4V2GA 3CJDA 5IOZA 2GUHA 2Y31A 3CDLA 3WHBA 3HGGA 1QVTA 3EUPA 4PXIA 1VI0A 3F0CA 3LWJA 3ZQGA 3ZQFA 2PBXA 2X9DA 3BCGA 5FKKA 2I10A 3QPSA 2XPWA 3NRGA 3ON4A 3C07A 2WUIA 2UXUA 3VP5A 5EYRA 5D19A 2XGCA 3LSRA 2NS7A 1JUSA 1Z77A 5F0HA 2RASA 1QVUA 5HBUA 3VW1A 1RPWA 2G7SA 4L62A 4I6ZA 3KKDA 2GFNA 5D1RA 3RD3A 5F08A 5K7FA 2IEKA 3NPIA 5HSZA 3S5RA 2HXOA 3PPBA 4CGRA 4W1UA 3HGYA 5C4YA 3BTLA 2O7OA 3VW2A 3O8GA 2UXHA 3IH4A 5CXIA 2OF7A 2DG8A 1Z0XA 3E7QA 3BHQA 3HTIA 1JTXA 3BR3A 5K58A 2ID3A 3VW0A 2FD5A 3NI7A 1ORKA 2HYJA 3BNIA 3HE0A 1ZKGA 4W97A 1T33A 3BRUA 5F27A 2Q24A 2TCTA 3SDGA 4M3EA 2QCOA 2HQ5A 4G12A 5J1UA 2ID6A 4AUXA 5K7ZA 2O7TA 2YVHA 3IUVA 3COLA 4DW6A 2XGEA 5FKLA 2DTZA 3FRQA 2UXOA 4NN1A 4ME9A 5FGLA 2VKEA 3KNWA 5FHPA 4GCLA 1JT6A 3DPJA 4XK4A 3JSJA 1QPIA 3AQTA 3P9TA 3Q0WA 3V6GA 2JJ7A 4GCKA 2NP3A 2IAIA 3LHQA 1BJZA 3B81A 5CW8A 3TP3A 4NELA 5FKMA 4JNNA 3VIBA 2EH3A 3BR0A 2HKUA 4B3AA 3Q0VA 2ZCXA 3QKXA 4AC0A 5DAJA 3BR1A 4JYKA 5FKNA 3PM1A 3G1MA 2X6OA 3LOCA 3WHCA 3BQYA 3CRJA 2GENA 3V78A 4JL3A 3F1BA 4ICHA 3LSJA 5FMPA 3BQZA 2XPVA 2TRTA 3ANGA 3Q0UA 2G7LA 1JT0A 4D5CA 2NS8A 5EZGA 2IBDA 4JKZA 3RH2A 2OI8A 1UI5A 3ZQLA 2REKA 2QTQA 3PASA 2QIBA 3CWRA 3AQSA 4D7MA 3B6AA 4V2FA 3G7RA 3BTIA 1ZK8A 3VVZA 2QOPA 3GEUA 4M3BA 1SGMA 4GFLA 2Y2ZA 3FK6A 3VVXA 3ZQHA 4ACIA 2XGDA 2DG7A 4GCTA 2WGBA 2QKOA 2RHAA 3DCFA 3B6CA 2FQ4A 4M3FA 4AF5A 4YZEA 5J1YA 5F0CA 3IH3A 3VOKA 2GBYA 4ABZA 3KKCA 3BJBA 2ZCNA 5IP6A 3DEWA 3BR5A 4MK6A 2ZB9A 1T56A 3HTJA 3LSPA 1U9NA 2UXIA 3NXCA 3BR2A 1RKTA 4AC6A 2XB5A 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  2UXP A;  5GPC A;  1UI6 A;  4GFK A;  4MXM A;  2FJ1 A;  5F1J A;  3FK7 A;  2FX0 A;  1U9O A;  5AQC A;  1JTY A;  4I76 A;  3EGQ A;  2W53 A;  5CXG A;  4D7N A;  3HTA A;  5K7H A;  3G1O A;  4X1E A;  2JK3 A;  3TP0 A;  2VKV A;  5J1R A;  3BR6 A;  5D18 A;  3C2B A;  5GPA A;  3SFI A;  3ON2 A;  3T6N A;  3BTJ A;  4UDS A;  2IU5 A;  2D6Y A;  3VPR A;  5H9T A;  2OPT A;  3VVY A;  5F04 A;  2G0E A;  2PZ9 A;  1JUM A;  1JUP A;  5EFY A;  2RAE A;  2OER A;  5IOY A;  5IPA A;  3QPL A;  2HYT A;  3BT9 A;  2ZOZ A;  3FIW A;  2NP5 A;  3HTH A;  3ANP A;  3VOX A;  3VUQ A;  3G56 A;  4M3D A;  2YVE A;  2QWT A;  5FKO A;  4M3G A;  5EZH A;  3HIM A;  2WV1 A;  3LJL A;  4D5F A;  1RKW A;  3QBM A;  4KWA A;  1A6I A;  4HKU A;  3MVP A;  2V57 A;  2VPR A;  3CCY A;  5F0F A;  5J3L A;  2XPU A;  2NX4 A;  3KZ9 A;  2XRL A;  2HXI A;  2Y30 A;  3MNL A;  5GP9 A;  2ZOY A;  2FBQ A;  4MO7 A;  5HAW A;  3ZQI A;  2XDN A;  2G7G A;  3O60 A;  3NNR A;  2ZCM A;  2F07 A;  3GZI A;  3IH2 A;  2G3B A;  3G1L A;  3O8H A;  3Q3S A;  4B1R A;  4V2G A;  3CJD A;  5IOZ A;  2GUH A;  2Y31 A;  3CDL A;  3WHB A;  3HGG A;  1QVT A;  3EUP A;  4PXI A;  1VI0 A;  3F0C A;  3LWJ A;  3ZQG A;  3ZQF A;  2PBX A;  2X9D A;  3BCG A;  5FKK A;  2I10 A;  3QPS A;  2XPW A;  3NRG A;  3ON4 A;  3C07 A;  2WUI A;  2UXU A;  3VP5 A;  5EYR A;  5D19 A;  2XGC A;  3LSR A;  2NS7 A;  1JUS A;  1Z77 A;  5F0H A;  2RAS A;  1QVU A;  5HBU A;  3VW1 A;  1RPW A;  2G7S A;  4L62 A;  4I6Z A;  3KKD A;  2GFN A;  5D1R A;  3RD3 A;  5F08 A;  5K7F A;  2IEK A;  3NPI A;  5HSZ A;  3S5R A;  2HXO A;  3PPB A;  4CGR A;  4W1U A;  3HGY A;  5C4Y A;  3BTL A;  2O7O A;  3VW2 A;  3O8G A;  2UXH A;  3IH4 A;  5CXI A;  2OF7 A;  2DG8 A;  1Z0X A;  3E7Q A;  3BHQ A;  3HTI A;  1JTX A;  3BR3 A;  5K58 A;  2ID3 A;  3VW0 A;  2FD5 A;  3NI7 A;  1ORK A;  2HYJ A;  3BNI A;  3HE0 A;  1ZKG A;  4W97 A;  1T33 A;  3BRU A;  5F27 A;  2Q24 A;  2TCT A;  3SDG A;  4M3E A;  2QCO A;  2HQ5 A;  4G12 A;  5J1U A;  2ID6 A;  4AUX A;  5K7Z A;  2O7T A;  2YVH A;  3IUV A;  3COL A;  4DW6 A;  2XGE A;  5FKL A;  2DTZ A;  3FRQ A;  2UXO A;  4NN1 A;  4ME9 A;  5FGL A;  2VKE A;  3KNW A;  5FHP A;  4GCL A;  1JT6 A;  3DPJ A;  4XK4 A;  3JSJ A;  1QPI A;  3AQT A;  3P9T A;  3Q0W A;  3V6G A;  2JJ7 A;  4GCK A;  2NP3 A;  2IAI A;  3LHQ A;  1BJZ A;  3B81 A;  5CW8 A;  3TP3 A;  4NEL A;  5FKM A;  4JNN A;  3VIB A;  2EH3 A;  3BR0 A;  2HKU A;  4B3A A;  3Q0V A;  2ZCX A;  3QKX A;  4AC0 A;  5DAJ A;  3BR1 A;  4JYK A;  5FKN A;  3PM1 A;  3G1M A;  2X6O A;  3LOC A;  3WHC A;  3BQY A;  3CRJ A;  2GEN A;  3V78 A;  4JL3 A;  3F1B A;  4ICH A;  3LSJ A;  5FMP A;  3BQZ A;  2XPV A;  2TRT A;  3ANG A;  3Q0U A;  2G7L A;  1JT0 A;  4D5C A;  2NS8 A;  5EZG A;  2IBD A;  4JKZ A;  3RH2 A;  2OI8 A;  1UI5 A;  3ZQL A;  2REK A;  2QTQ A;  3PAS A;  2QIB A;  3CWR A;  3AQS A;  4D7M A;  3B6A A;  4V2F A;  3G7R A;  3BTI A;  1ZK8 A;  3VVZ A;  2QOP A;  3GEU A;  4M3B A;  1SGM A;  4GFL A;  2Y2Z A;  3FK6 A;  3VVX A;  3ZQH A;  4ACI A;  2XGD A;  2DG7 A;  4GCT A;  2WGB A;  2QKO A;  2RHA A;  3DCF A;  3B6C A;  2FQ4 A;  4M3F A;  4AF5 A;  4YZE A;  5J1Y A;  5F0C A;  3IH3 A;  3VOK A;  2GBY A;  4ABZ A;  3KKC A;  3BJB A;  2ZCN A;  5IP6 A;  3DEW A;  3BR5 A;  4MK6 A;  2ZB9 A;  1T56 A;  3HTJ A;  3LSP A;  1U9N A;  2UXI A;  3NXC A;  3BR2 A;  1RKT A;  4AC6 A;  2XB5 A;  3BTC A; 
#chains in the Genus database with same CATH topology
 3QQA A;  2UXP A;  5GPC A;  2R7X A;  1UI6 A;  2A2F X;  3SWH A;  4GFK A;  4MXM A;  2R7V A;  2FJ1 A;  5F1J A;  3FK7 A;  3KYL A;  2FX0 A;  1U9O A;  5AQC A;  1JTY A;  4I76 A;  3EGQ A;  2W53 A;  5CXG A;  4D7N A;  3HTA A;  5K7H A;  3G1O A;  4X1E A;  2JK3 A;  3TP0 A;  2VKV A;  5J1R A;  2R7W A;  3BR6 A;  5D18 A;  3C2B A;  5GPA A;  3SFI A;  3ON2 A;  3T6N A;  3BTJ A;  4UDS A;  2IU5 A;  2D6Y A;  3VPR A;  5H9T A;  2OPT A;  3VVY A;  5F04 A;  2G0E A;  2PZ9 A;  1JUM A;  1JUP A;  5EFY A;  2RAE A;  2OER A;  5IOY A;  5IPA A;  3QPL A;  2HYT A;  3BT9 A;  2ZOZ A;  3VTI A;  3FIW A;  2NP5 A;  3HTH A;  3ANP A;  3VOX A;  3VUQ A;  3G56 A;  4M3D A;  2YVE A;  2QWT A;  5FKO A;  4M3G A;  3DU6 A;  5EZH A;  3HIM A;  2WV1 A;  3LJL A;  4D5F A;  1RKW A;  3QBM A;  4KWA A;  1A6I A;  4HKU A;  2R7O A;  3MVP A;  2V57 A;  2VPR A;  3CCY A;  5F0F A;  5J3L A;  2XPU A;  2NX4 A;  3KZ9 A;  2XRL A;  2HXI A;  2Y30 A;  3MNL A;  5GP9 A;  2ZOY A;  2FBQ A;  4MO7 A;  4U9L A;  5HAW A;  3ZQI A;  2XDN A;  2G7G A;  3O60 A;  3NNR A;  2ZCM A;  2F07 A;  3GZI A;  3IH2 A;  2G3B A;  3G1L A;  3O8H A;  3Q3S A;  4B1R A;  4V2G A;  3CJD A;  4WIB A;  5IOZ A;  2GUH A;  2Y31 A;  3CDL A;  3WHB A;  3HGG A;  1QVT A;  3EUP A;  2YVX A;  1VI0 A;  4PXI A;  3F0C A;  3LWJ A;  5CQG A;  3ZQG A;  3ZQF A;  2PBX A;  2X9D A;  3BCG A;  5FKK A;  2I10 A;  3QPS A;  2XPW A;  3NRG A;  3ON4 A;  3C07 A;  2WUI A;  2R7Q A;  4OD4 A;  2UXU A;  3VP5 A;  5EYR A;  5D19 A;  2XGC A;  3LSR A;  2NS7 A;  4OD5 A;  1JUS A;  2R7R A;  1Z77 A;  5F0H A;  4U9N A;  2RAS A;  1QVU A;  4IRV A;  5HBU A;  3VW1 A;  1RPW A;  2G7S A;  4L62 A;  4I6Z A;  3KKD A;  4C2M A;  2GFN A;  3K8P C;  5D1R A;  3RD3 A;  5F08 A;  5K7F A;  2IEK A;  3NPI A;  5HSZ A;  3S5R A;  2HXO A;  3PPB A;  2R7S A;  4CGR A;  4W1U A;  3HGY A;  5C4Y A;  3BTL A;  2O7O A;  3VW2 A;  3O8G A;  2ZY9 A;  2UXH A;  3IH4 A;  5CXI A;  2OF7 A;  2DG8 A;  1Z0X A;  3E7Q A;  3BHQ A;  3HTI A;  1JTX A;  3BR3 A;  5K58 A;  2ID3 A;  3VW0 A;  2FD5 A;  3NI7 A;  1ORK A;  2HYJ A;  3BNI A;  3HE0 A;  1ZKG A;  4W97 A;  1T33 A;  3BRU A;  5F27 A;  2Q24 A;  2PFV A;  2TCT A;  3FHN A;  3SDG A;  4M3E A;  2QCO A;  2HQ5 A;  4G12 A;  5J1U A;  2ID6 A;  4AUX A;  2R7T A;  5K7Z A;  2O7T A;  2YVH A;  3IUV A;  3COL A;  4DW6 A;  2XGE A;  5FKL A;  2DTZ A;  3FRQ A;  2UXO A;  4NN1 A;  4ME9 A;  5FGL A;  2VKE A;  3KNW A;  5FHP A;  4GCL A;  1JT6 A;  2B1E A;  3DPJ A;  4XK4 A;  3JSJ A;  1QPI A;  3AQT A;  3P9T A;  3Q0W A;  3V6G A;  2JJ7 A;  2R7U A;  2B3W A;  4GCK A;  2NP3 A;  2IAI A;  3LHQ A;  1BJZ A;  3B81 A;  5CW8 A;  3TP3 A;  4NEL A;  5FKM A;  4JNN A;  3VIB A;  2EH3 A;  3BR0 A;  2HKU A;  4B3A A;  3Q0V A;  2ZCX A;  3QKX A;  4AC0 A;  5DAJ A;  3BR1 A;  4JYK A;  5FKN A;  3PM1 A;  3G1M A;  2X6O A;  3LOC A;  3WHC A;  3BQY A;  3CRJ A;  2GEN A;  3V78 A;  4JL3 A;  3F1B A;  4ICH A;  3LSJ A;  5FMP A;  3BQZ A;  2XPV A;  2TRT A;  3ANG A;  3Q0U A;  2G7L A;  1JT0 A;  4D5C A;  2NS8 A;  5EZG A;  2IBD A;  4JKZ A;  3RH2 A;  2OI8 A;  1UI5 A;  3ZQL A;  2REK A;  2QTQ A;  3PAS A;  2QIB A;  3CWR A;  3AQS A;  4D7M A;  3B6A A;  4V2F A;  3G7R A;  3BTI A;  3NS4 A;  1ZK8 A;  3DU5 A;  3VVZ A;  2QOP A;  3GEU A;  4M3B A;  1SGM A;  4GFL A;  2Y2Z A;  3FK6 A;  3VVX A;  3ZQH A;  4ACI A;  2XGD A;  2DG7 A;  4GCT A;  2WGB A;  2QKO A;  2RHA A;  3DCF A;  3B6C A;  2FQ4 A;  4M3F A;  4AF5 A;  4YZE A;  4DVY P;  5J1Y A;  5F0C A;  3IH3 A;  3VOK A;  2GBY A;  4ABZ A;  3KKC A;  3BJB A;  2ZCN A;  5IP6 A;  3DEW A;  3BR5 A;  4MK6 A;  2ZB9 A;  1T56 A;  3HTJ A;  2FJI 1;  3LSP A;  1U9N A;  2UXI A;  3NXC A;  3BR2 A;  1RKT A;  4AC6 A;  2XB5 A;  3BTC A; 
#chains in the Genus database with same CATH homology
 3QQA A;  2UXP A;  5GPC A;  1UI6 A;  4GFK A;  4MXM A;  2FJ1 A;  5F1J A;  3FK7 A;  2FX0 A;  1U9O A;  5AQC A;  1JTY A;  4I76 A;  3EGQ A;  2W53 A;  5CXG A;  4D7N A;  3HTA A;  5K7H A;  3G1O A;  4X1E A;  2JK3 A;  3TP0 A;  2VKV A;  5J1R A;  3BR6 A;  5D18 A;  3C2B A;  5GPA A;  3SFI A;  3ON2 A;  3T6N A;  3BTJ A;  4UDS A;  2IU5 A;  2D6Y A;  3VPR A;  5H9T A;  2OPT A;  3VVY A;  5F04 A;  2G0E A;  2PZ9 A;  1JUM A;  1JUP A;  5EFY A;  2RAE A;  2OER A;  5IOY A;  5IPA A;  3QPL A;  2HYT A;  3BT9 A;  2ZOZ A;  3FIW A;  2NP5 A;  3HTH A;  3ANP A;  3VOX A;  3VUQ A;  3G56 A;  4M3D A;  2YVE A;  2QWT A;  5FKO A;  4M3G A;  5EZH A;  3HIM A;  2WV1 A;  3LJL A;  4D5F A;  1RKW A;  3QBM A;  4KWA A;  1A6I A;  4HKU A;  3MVP A;  2V57 A;  2VPR A;  3CCY A;  5F0F A;  5J3L A;  2XPU A;  2NX4 A;  3KZ9 A;  2XRL A;  2HXI A;  2Y30 A;  3MNL A;  5GP9 A;  2ZOY A;  2FBQ A;  4MO7 A;  5HAW A;  3ZQI A;  2XDN A;  2G7G A;  3O60 A;  3NNR A;  2ZCM A;  2F07 A;  3GZI A;  3IH2 A;  2G3B A;  3G1L A;  3O8H A;  3Q3S A;  4B1R A;  4V2G A;  3CJD A;  5IOZ A;  2GUH A;  2Y31 A;  3CDL A;  3WHB A;  3HGG A;  1QVT A;  3EUP A;  4PXI A;  1VI0 A;  3F0C A;  3LWJ A;  3ZQG A;  3ZQF A;  2PBX A;  2X9D A;  3BCG A;  5FKK A;  2I10 A;  3QPS A;  2XPW A;  3NRG A;  3ON4 A;  3C07 A;  2WUI A;  2UXU A;  3VP5 A;  5EYR A;  5D19 A;  2XGC A;  3LSR A;  2NS7 A;  1JUS A;  1Z77 A;  5F0H A;  2RAS A;  1QVU A;  5HBU A;  3VW1 A;  1RPW A;  2G7S A;  4L62 A;  4I6Z A;  3KKD A;  2GFN A;  5D1R A;  3RD3 A;  5F08 A;  5K7F A;  2IEK A;  3NPI A;  5HSZ A;  3S5R A;  2HXO A;  3PPB A;  4CGR A;  4W1U A;  3HGY A;  5C4Y A;  3BTL A;  2O7O A;  3VW2 A;  3O8G A;  2UXH A;  3IH4 A;  5CXI A;  2OF7 A;  2DG8 A;  1Z0X A;  3E7Q A;  3BHQ A;  3HTI A;  1JTX A;  3BR3 A;  5K58 A;  2ID3 A;  3VW0 A;  2FD5 A;  3NI7 A;  1ORK A;  2HYJ A;  3BNI A;  3HE0 A;  1ZKG A;  4W97 A;  1T33 A;  3BRU A;  5F27 A;  2Q24 A;  2TCT A;  3SDG A;  4M3E A;  2QCO A;  2HQ5 A;  4G12 A;  5J1U A;  2ID6 A;  4AUX A;  5K7Z A;  2O7T A;  2YVH A;  3IUV A;  3COL A;  4DW6 A;  2XGE A;  5FKL A;  2DTZ A;  3FRQ A;  2UXO A;  4NN1 A;  4ME9 A;  5FGL A;  2VKE A;  3KNW A;  5FHP A;  4GCL A;  1JT6 A;  3DPJ A;  4XK4 A;  3JSJ A;  1QPI A;  3AQT A;  3P9T A;  3Q0W A;  3V6G A;  2JJ7 A;  4GCK A;  2NP3 A;  2IAI A;  3LHQ A;  1BJZ A;  3B81 A;  5CW8 A;  3TP3 A;  4NEL A;  5FKM A;  4JNN A;  3VIB A;  2EH3 A;  3BR0 A;  2HKU A;  4B3A A;  3Q0V A;  2ZCX A;  3QKX A;  4AC0 A;  5DAJ A;  3BR1 A;  4JYK A;  5FKN A;  3PM1 A;  3G1M A;  2X6O A;  3LOC A;  3WHC A;  3BQY A;  3CRJ A;  2GEN A;  3V78 A;  4JL3 A;  3F1B A;  4ICH A;  3LSJ A;  5FMP A;  3BQZ A;  2XPV A;  2TRT A;  3ANG A;  3Q0U A;  2G7L A;  1JT0 A;  4D5C A;  2NS8 A;  5EZG A;  2IBD A;  4JKZ A;  3RH2 A;  2OI8 A;  1UI5 A;  3ZQL A;  2REK A;  2QTQ A;  3PAS A;  2QIB A;  3CWR A;  3AQS A;  4D7M A;  3B6A A;  4V2F A;  3G7R A;  3BTI A;  1ZK8 A;  3VVZ A;  2QOP A;  3GEU A;  4M3B A;  1SGM A;  4GFL A;  2Y2Z A;  3FK6 A;  3VVX A;  3ZQH A;  4ACI A;  2XGD A;  2DG7 A;  4GCT A;  2WGB A;  2QKO A;  2RHA A;  3DCF A;  3B6C A;  2FQ4 A;  4M3F A;  4AF5 A;  4YZE A;  5J1Y A;  5F0C A;  3IH3 A;  3VOK A;  2GBY A;  4ABZ A;  3KKC A;  3BJB A;  2ZCN A;  5IP6 A;  3DEW A;  3BR5 A;  4MK6 A;  2ZB9 A;  1T56 A;  3HTJ A;  3LSP A;  1U9N A;  2UXI A;  3NXC A;  3BR2 A;  1RKT A;  4AC6 A;  2XB5 A;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...