3PASA

Crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
MRQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFYYVSDQVIDAALDSFSRGKDLREGLRRQWHTLFRIGLERPELFRYHETFTHSAWMTPEIQARNESRAANLLNAVDQGKQSGLIKPVPFPLLETFMFRPIYHLVQRCLQGSFEGTDEHIELAFNMAWDAVADR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords TetR family transcription regulator
publication title Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution
rcsb
source organism Marinobacter aquaeolei
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pasA00
5GP9A 1U9OA 2DG7A 3RH2A 2XPVA 5DAJA 4D7MA 3IH2A 4M3BA 3CWRA 2EH3A 2WGBA 5F1JA 3QKXA 3HTIA 1JUSA 3EUPA 2IBDA 3IH3A 4GCLA 3QPSA 5K7FA 4D5CA 4HKUA 2PZ9A 2F07A 3KNWA 5C4YA 3BR3A 3CCYA 3VOKA 2WV1A 2Q24A 2ZCNA 4M3EA 5EFYA 5CXGA 3VPRA 2FX0A 3E7QA 4ABZA 3JSJA 2W53A 2QOPA 4JYKA 3FIWA 5GPAA 3CDLA 3B6CA 5H9TA 3BR6A 4ACIA 3V78A 3WHCA 3QBMA 2VPRA 3Q0VA 4XK4A 3RD3A 4D5FA 2ID6A 2DG8A 3F1BA 3VIBA 3PM1A 4KWAA 3BNIA 3HTHA 5K7HA 3FK7A 4MO7A 3Q0UA 3VW1A 5EYRA 4M3GA 4JKZA 2FQ4A 3HTJA 3LJLA 4M3FA 5IP6A 3BTCA 1T33A 4X1EA 4B1RA 4G12A 5FMPA 3VOXA 5J1RA 2HYJA 3TP0A 2QTQA 5FHPA 2GENA 3DCFA 3LSPA 2XB5A 2QWTA 3G1LA 4GFKA 3G1OA 4L62A 3KKCA 3SFIA 3WHBA 3BTLA 2UXHA 2OI8A 1ZKGA 3BT9A 4UDSA 5CW8A 2G7SA 2HKUA 3BJBA 3LSJA 4V2FA 5F04A 1Z77A 4DW6A 4W97A 4AF5A 2VKVA 2G7GA 3BRUA 3VVYA 2I10A 3GZIA 3MNLA 3ZQHA 3ANPA 4CGRA 1ZK8A 5EZGA 4MK6A 5EZHA 5D1RA 5FKOA 2UXPA 3HE0A 3LHQA 1A6IA 2RAEA 2PBXA 4D7NA 5F08A 3O8HA 2UXOA 3ZQLA 4I76A 2JJ7A 1U9NA 3P9TA 2HQ5A 2XGCA 5AQCA 5GPCA 1JT0A 2FD5A 5K7ZA 2ZOYA 2RASA 2D6YA 3TP3A 2TCTA 2HXIA 3B6AA 5FKNA 4YZEA 2OPTA 5F0CA 2QCOA 3EGQA 4M3DA 3ZQGA 3KZ9A 5K58A 2ID3A 3Q0WA 3BR2A 3NPIA 3VVXA 2UXUA 3QQAA 2O7OA 5FGLA 2G0EA 3IUVA 2G3BA 1JTYA 2GFNA 4NELA 3F0CA 2NS8A 1UI5A 3VP5A 2FJ1A 3FK6A 1JT6A 2XPWA 5IOYA 3CRJA 3T6NA 1RKTA 5J3LA 2GBYA 5IPAA 2QKOA 5IOZA 2NX4A 2UXIA 4PXIA 4GFLA 2OF7A 3ZQFA 3HTAA 2X6OA 3ZQIA 3DEWA 2NS7A 2GUHA 2XDNA 1UI6A 2HYTA 4JL3A 3B81A 3G56A 5F0FA 1QVUA 3BR5A 3IH4A 3FRQA 4I6ZA 3V6GA 3BTJA 3NNRA 3AQSA 3G7RA 3S5RA 5J1YA 2Y31A 3DPJA 1Z0XA 4ICHA 2TRTA 2ZCMA 3Q3SA 3VW2A 3COLA 2REKA 4V2GA 3QPLA 2XGDA 2ZB9A 3KKDA 2YVEA 3ON4A 3PASA 5HBUA 5F27A 3LSRA 3VW0A 5CXIA 1QPIA 4AUXA 1RKWA 3MVPA 3BR0A 3C07A 2XGEA 1VI0A 1JUPA 2Y2ZA 2X9DA 3NRGA 3GEUA 1JUMA 3BR1A 4GCTA 2HXOA 4W1UA 2NP5A 3G1MA 5D19A 1T56A 5HSZA 3AQTA 2OERA 3SDGA 2YVHA 2IEKA 3LOCA 2IU5A 3HGYA 4ME9A 2JK3A 1ORKA 3BQZA 2NP3A 2ZCXA 5J1UA 2FBQA 3HGGA 4MXMA 3PPBA 2O7TA 3LWJA 3ANGA 2VKEA 3C2BA 5D18A 4AC0A 5F0HA 3BCGA 3VVZA 4AC6A 2Y30A 1SGMA 3ON2A 2XPUA 4JNNA 2QIBA 5HAWA 5FKKA 1RPWA 3CJDA 2IAIA 3O60A 5FKMA 3NXCA 1QVTA 3BQYA 2ZOZA 3O8GA 1BJZA 4GCKA 1JTXA 3NI7A 3BTIA 2G7LA 2WUIA 3HIMA 5FKLA 2DTZA 3VUQA 2XRLA 2RHAA 4NN1A 3BHQA 2V57A 4B3AA
chains in the Genus database with same CATH superfamily
5GP9A 1U9OA 2DG7A 3RH2A 2XPVA 5DAJA 4D7MA 3IH2A 4M3BA 3CWRA 2EH3A 2WGBA 5F1JA 3QKXA 3HTIA 1JUSA 3EUPA 2IBDA 3IH3A 4GCLA 3QPSA 5K7FA 4D5CA 4HKUA 2PZ9A 2F07A 2ZY9A 3KNWA 5C4YA 3BR3A 3CCYA 3VOKA 2WV1A 2Q24A 2ZCNA 4M3EA 5EFYA 5CXGA 3VPRA 2FX0A 3E7QA 4ABZA 2R7RA 3JSJA 2W53A 2QOPA 4JYKA 3FIWA 4OD4A 5GPAA 2R7OA 3CDLA 3B6CA 5H9TA 3BR6A 4ACIA 3V78A 3WHCA 3QBMA 2VPRA 3Q0VA 4XK4A 3RD3A 3DU6A 4D5FA 2ID6A 2DG8A 3F1BA 3VIBA 3PM1A 4KWAA 3BNIA 3HTHA 5K7HA 3FK7A 3FHNA 4MO7A 5CQGA 3Q0UA 3VW1A 5EYRA 4M3GA 4JKZA 2FQ4A 3HTJA 2B1EA 3LJLA 4M3FA 5IP6A 3BTCA 1T33A 4X1EA 4B1RA 4C2MA 4G12A 5FMPA 3VOXA 5J1RA 2HYJA 3TP0A 2QTQA 5FHPA 2GENA 3DCFA 2R7UA 3LSPA 2XB5A 2QWTA 3G1LA 4GFKA 3G1OA 4L62A 4IRVA 3KKCA 3SFIA 3WHBA 3BTLA 4OD5A 2UXHA 2OI8A 1ZKGA 3BT9A 4UDSA 5CW8A 4U9NA 2R7SA 2G7SA 2HKUA 3BJBA 3LSJA 4V2FA 5F04A 1Z77A 4DW6A 4W97A 4AF5A 2VKVA 2G7GA 3BRUA 3VVYA 2I10A 3GZIA 3MNLA 3ZQHA 3ANPA 4CGRA 1ZK8A 5EZGA 4MK6A 5EZHA 5D1RA 5FKOA 2UXPA 3HE0A 3LHQA 1A6IA 2RAEA 2PBXA 4D7NA 3NS4A 5F08A 3O8HA 2UXOA 3ZQLA 4I76A 2JJ7A 1U9NA 2PFVA 3P9TA 2HQ5A 2XGCA 5AQCA 5GPCA 1JT0A 2FD5A 5K7ZA 2ZOYA 2RASA 2D6YA 3TP3A 2TCTA 2B3WA 2HXIA 3B6AA 5FKNA 4YZEA 2OPTA 5F0CA 2QCOA 3EGQA 4M3DA 3ZQGA 3KZ9A 5K58A 2ID3A 3Q0WA 3VTIA 2R7XA 3BR2A 3NPIA 3VVXA 2UXUA 3QQAA 2O7OA 5FGLA 2G0EA 3IUVA 2G3BA 1JTYA 2GFNA 4NELA 3F0CA 2NS8A 1UI5A 3VP5A 3SWHA 2FJ1A 3FK6A 1JT6A 2XPWA 5IOYA 3CRJA 3T6NA 1RKTA 5J3LA 2GBYA 5IPAA 2QKOA 5IOZA 2NX4A 2UXIA 4PXIA 4GFLA 2OF7A 3ZQFA 3HTAA 2X6OA 3ZQIA 3DEWA 2NS7A 2GUHA 2XDNA 1UI6A 2HYTA 4JL3A 3B81A 3G56A 5F0FA 1QVUA 2R7QA 2A2FX 3BR5A 3IH4A 3FRQA 4I6ZA 3V6GA 3BTJA 2R7TA 3NNRA 3AQSA 3G7RA 3S5RA 5J1YA 2Y31A 3DPJA 1Z0XA 3K8PC 4ICHA 2TRTA 2ZCMA 3Q3SA 3VW2A 3COLA 2R7VA 2REKA 4V2GA 3QPLA 2XGDA 2ZB9A 3KKDA 2YVXA 2YVEA 3ON4A 3PASA 5HBUA 5F27A 3LSRA 3VW0A 5CXIA 1QPIA 4AUXA 1RKWA 3MVPA 3BR0A 3C07A 2XGEA 1VI0A 2FJI1 1JUPA 2Y2ZA 2X9DA 3NRGA 3GEUA 1JUMA 3BR1A 4GCTA 2HXOA 4W1UA 2NP5A 3G1MA 5D19A 1T56A 4WIBA 3AQTA 2OERA 5HSZA 3SDGA 2YVHA 2IEKA 3LOCA 2IU5A 4U9LA 3HGYA 4ME9A 2JK3A 1ORKA 3BQZA 2NP3A 2ZCXA 4DVYP 5J1UA 2FBQA 3HGGA 4MXMA 3PPBA 2O7TA 3LWJA 3ANGA 2R7WA 2VKEA 3C2BA 5D18A 4AC0A 5F0HA 3BCGA 3VVZA 4AC6A 2Y30A 1SGMA 3ON2A 2XPUA 4JNNA 2QIBA 3KYLA 3DU5A 5HAWA 5FKKA 1RPWA 3CJDA 2IAIA 3O60A 5FKMA 3NXCA 1QVTA 3BQYA 2ZOZA 3O8GA 1BJZA 4GCKA 1JTXA 3NI7A 3BTIA 2G7LA 2WUIA 3HIMA 5FKLA 2DTZA 3VUQA 2XRLA 2RHAA 4NN1A 3BHQA 2V57A 4B3AA
chains in the Genus database with same CATH topology
5GP9A 1U9OA 2DG7A 3RH2A 2XPVA 5DAJA 4D7MA 3IH2A 4M3BA 3CWRA 2EH3A 2WGBA 5F1JA 3QKXA 3HTIA 1JUSA 3EUPA 2IBDA 3IH3A 4GCLA 3QPSA 5K7FA 4D5CA 4HKUA 2PZ9A 2F07A 3KNWA 5C4YA 3BR3A 3CCYA 3VOKA 2WV1A 2Q24A 2ZCNA 4M3EA 5EFYA 5CXGA 3VPRA 2FX0A 3E7QA 4ABZA 3JSJA 2W53A 2QOPA 4JYKA 3FIWA 5GPAA 3CDLA 3B6CA 5H9TA 3BR6A 4ACIA 3V78A 3WHCA 3QBMA 2VPRA 3Q0VA 4XK4A 3RD3A 4D5FA 2ID6A 2DG8A 3F1BA 3VIBA 3PM1A 4KWAA 3BNIA 3HTHA 5K7HA 3FK7A 4MO7A 3Q0UA 3VW1A 5EYRA 4M3GA 4JKZA 2FQ4A 3HTJA 3LJLA 4M3FA 5IP6A 3BTCA 1T33A 4X1EA 4B1RA 4G12A 5FMPA 3VOXA 5J1RA 2HYJA 3TP0A 2QTQA 5FHPA 2GENA 3DCFA 3LSPA 2XB5A 2QWTA 3G1LA 4GFKA 3G1OA 4L62A 3KKCA 3SFIA 3WHBA 3BTLA 2UXHA 2OI8A 1ZKGA 3BT9A 4UDSA 5CW8A 2G7SA 2HKUA 3BJBA 3LSJA 4V2FA 5F04A 1Z77A 4DW6A 4W97A 4AF5A 2VKVA 2G7GA 3BRUA 3VVYA 2I10A 3GZIA 3MNLA 3ZQHA 3ANPA 4CGRA 1ZK8A 5EZGA 4MK6A 5EZHA 5D1RA 5FKOA 2UXPA 3HE0A 3LHQA 1A6IA 2RAEA 2PBXA 4D7NA 5F08A 3O8HA 2UXOA 3ZQLA 4I76A 2JJ7A 1U9NA 3P9TA 2HQ5A 2XGCA 5AQCA 5GPCA 1JT0A 2FD5A 5K7ZA 2ZOYA 2RASA 2D6YA 3TP3A 2TCTA 2HXIA 3B6AA 5FKNA 4YZEA 2OPTA 5F0CA 2QCOA 3EGQA 4M3DA 3ZQGA 3KZ9A 5K58A 2ID3A 3Q0WA 3BR2A 3NPIA 3VVXA 2UXUA 3QQAA 2O7OA 5FGLA 2G0EA 3IUVA 2G3BA 1JTYA 2GFNA 4NELA 3F0CA 2NS8A 1UI5A 3VP5A 2FJ1A 3FK6A 1JT6A 2XPWA 5IOYA 3CRJA 3T6NA 1RKTA 5J3LA 2GBYA 5IPAA 2QKOA 5IOZA 2NX4A 2UXIA 4PXIA 4GFLA 2OF7A 3ZQFA 3HTAA 2X6OA 3ZQIA 3DEWA 2NS7A 2GUHA 2XDNA 1UI6A 2HYTA 4JL3A 3B81A 3G56A 5F0FA 1QVUA 3BR5A 3IH4A 3FRQA 4I6ZA 3V6GA 3BTJA 3NNRA 3AQSA 3G7RA 3S5RA 5J1YA 2Y31A 3DPJA 1Z0XA 4ICHA 2TRTA 2ZCMA 3Q3SA 3VW2A 3COLA 2REKA 4V2GA 3QPLA 2XGDA 2ZB9A 3KKDA 2YVEA 3ON4A 3PASA 5HBUA 5F27A 3LSRA 3VW0A 5CXIA 1QPIA 4AUXA 1RKWA 3MVPA 3BR0A 3C07A 2XGEA 1VI0A 1JUPA 2Y2ZA 2X9DA 3NRGA 3GEUA 1JUMA 3BR1A 4GCTA 2HXOA 4W1UA 2NP5A 3G1MA 5D19A 1T56A 5HSZA 3AQTA 2OERA 3SDGA 2YVHA 2IEKA 3LOCA 2IU5A 3HGYA 4ME9A 2JK3A 1ORKA 3BQZA 2NP3A 2ZCXA 5J1UA 2FBQA 3HGGA 4MXMA 3PPBA 2O7TA 3LWJA 3ANGA 2VKEA 3C2BA 5D18A 4AC0A 5F0HA 3BCGA 3VVZA 4AC6A 2Y30A 1SGMA 3ON2A 2XPUA 4JNNA 2QIBA 5HAWA 5FKKA 1RPWA 3CJDA 2IAIA 3O60A 5FKMA 3NXCA 1QVTA 3BQYA 2ZOZA 3O8GA 1BJZA 4GCKA 1JTXA 3NI7A 3BTIA 2G7LA 2WUIA 3HIMA 5FKLA 2DTZA 3VUQA 2XRLA 2RHAA 4NN1A 3BHQA 2V57A 4B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GP9 A;  1U9O A;  2DG7 A;  3RH2 A;  2XPV A;  5DAJ A;  4D7M A;  3IH2 A;  4M3B A;  3CWR A;  2EH3 A;  2WGB A;  5F1J A;  3QKX A;  3HTI A;  1JUS A;  3EUP A;  2IBD A;  3IH3 A;  4GCL A;  3QPS A;  5K7F A;  4D5C A;  4HKU A;  2PZ9 A;  2F07 A;  3KNW A;  5C4Y A;  3BR3 A;  3CCY A;  3VOK A;  2WV1 A;  2Q24 A;  2ZCN A;  4M3E A;  5EFY A;  5CXG A;  3VPR A;  2FX0 A;  3E7Q A;  4ABZ A;  3JSJ A;  2W53 A;  2QOP A;  4JYK A;  3FIW A;  5GPA A;  3CDL A;  3B6C A;  5H9T A;  3BR6 A;  4ACI A;  3V78 A;  3WHC A;  3QBM A;  2VPR A;  3Q0V A;  4XK4 A;  3RD3 A;  4D5F A;  2ID6 A;  2DG8 A;  3F1B A;  3VIB A;  3PM1 A;  4KWA A;  3BNI A;  3HTH A;  5K7H A;  3FK7 A;  4MO7 A;  3Q0U A;  3VW1 A;  5EYR A;  4M3G A;  4JKZ A;  2FQ4 A;  3HTJ A;  3LJL A;  4M3F A;  5IP6 A;  3BTC A;  1T33 A;  4X1E A;  4B1R A;  4G12 A;  5FMP A;  3VOX A;  5J1R A;  2HYJ A;  3TP0 A;  2QTQ A;  5FHP A;  2GEN A;  3DCF A;  3LSP A;  2XB5 A;  2QWT A;  3G1L A;  4GFK A;  3G1O A;  4L62 A;  3KKC A;  3SFI A;  3WHB A;  3BTL A;  2UXH A;  2OI8 A;  1ZKG A;  3BT9 A;  4UDS A;  5CW8 A;  2G7S A;  2HKU A;  3BJB A;  3LSJ A;  4V2F A;  5F04 A;  1Z77 A;  4DW6 A;  4W97 A;  4AF5 A;  2VKV A;  2G7G A;  3BRU A;  3VVY A;  2I10 A;  3GZI A;  3MNL A;  3ZQH A;  3ANP A;  4CGR A;  1ZK8 A;  5EZG A;  4MK6 A;  5EZH A;  5D1R A;  5FKO A;  2UXP A;  3HE0 A;  3LHQ A;  1A6I A;  2RAE A;  2PBX A;  4D7N A;  5F08 A;  3O8H A;  2UXO A;  3ZQL A;  4I76 A;  2JJ7 A;  1U9N A;  3P9T A;  2HQ5 A;  2XGC A;  5AQC A;  5GPC A;  1JT0 A;  2FD5 A;  5K7Z A;  2ZOY A;  2RAS A;  2D6Y A;  3TP3 A;  2TCT A;  2HXI A;  3B6A A;  5FKN A;  4YZE A;  2OPT A;  5F0C A;  2QCO A;  3EGQ A;  4M3D A;  3ZQG A;  3KZ9 A;  5K58 A;  2ID3 A;  3Q0W A;  3BR2 A;  3NPI A;  3VVX A;  2UXU A;  3QQA A;  2O7O A;  5FGL A;  2G0E A;  3IUV A;  2G3B A;  1JTY A;  2GFN A;  4NEL A;  3F0C A;  2NS8 A;  1UI5 A;  3VP5 A;  2FJ1 A;  3FK6 A;  1JT6 A;  2XPW A;  5IOY A;  3CRJ A;  3T6N A;  1RKT A;  5J3L A;  2GBY A;  5IPA A;  2QKO A;  5IOZ A;  2NX4 A;  2UXI A;  4PXI A;  4GFL A;  2OF7 A;  3ZQF A;  3HTA A;  2X6O A;  3ZQI A;  3DEW A;  2NS7 A;  2GUH A;  2XDN A;  1UI6 A;  2HYT A;  4JL3 A;  3B81 A;  3G56 A;  5F0F A;  1QVU A;  3BR5 A;  3IH4 A;  3FRQ A;  4I6Z A;  3V6G A;  3BTJ A;  3NNR A;  3AQS A;  3G7R A;  3S5R A;  5J1Y A;  2Y31 A;  3DPJ A;  1Z0X A;  4ICH A;  2TRT A;  2ZCM A;  3Q3S A;  3VW2 A;  3COL A;  2REK A;  4V2G A;  3QPL A;  2XGD A;  2ZB9 A;  3KKD A;  2YVE A;  3ON4 A;  3PAS A;  5HBU A;  5F27 A;  3LSR A;  3VW0 A;  5CXI A;  1QPI A;  4AUX A;  1RKW A;  3MVP A;  3BR0 A;  3C07 A;  2XGE A;  1VI0 A;  1JUP A;  2Y2Z A;  2X9D A;  3NRG A;  3GEU A;  1JUM A;  3BR1 A;  4GCT A;  2HXO A;  4W1U A;  2NP5 A;  3G1M A;  5D19 A;  1T56 A;  5HSZ A;  3AQT A;  2OER A;  3SDG A;  2YVH A;  2IEK A;  3LOC A;  2IU5 A;  3HGY A;  4ME9 A;  2JK3 A;  1ORK A;  3BQZ A;  2NP3 A;  2ZCX A;  5J1U A;  2FBQ A;  3HGG A;  4MXM A;  3PPB A;  2O7T A;  3LWJ A;  3ANG A;  2VKE A;  3C2B A;  5D18 A;  4AC0 A;  5F0H A;  3BCG A;  3VVZ A;  4AC6 A;  2Y30 A;  1SGM A;  3ON2 A;  2XPU A;  4JNN A;  2QIB A;  5HAW A;  5FKK A;  1RPW A;  3CJD A;  2IAI A;  3O60 A;  5FKM A;  3NXC A;  1QVT A;  3BQY A;  2ZOZ A;  3O8G A;  1BJZ A;  4GCK A;  1JTX A;  3NI7 A;  3BTI A;  2G7L A;  2WUI A;  3HIM A;  5FKL A;  2DTZ A;  3VUQ A;  2XRL A;  2RHA A;  4NN1 A;  3BHQ A;  2V57 A;  4B3A A; 
#chains in the Genus database with same CATH topology
 5GP9 A;  1U9O A;  2DG7 A;  3RH2 A;  2XPV A;  5DAJ A;  4D7M A;  3IH2 A;  4M3B A;  3CWR A;  2EH3 A;  2WGB A;  5F1J A;  3QKX A;  3HTI A;  1JUS A;  3EUP A;  2IBD A;  3IH3 A;  4GCL A;  3QPS A;  5K7F A;  4D5C A;  4HKU A;  2PZ9 A;  2F07 A;  2ZY9 A;  3KNW A;  5C4Y A;  3BR3 A;  3CCY A;  3VOK A;  2WV1 A;  2Q24 A;  2ZCN A;  4M3E A;  5EFY A;  5CXG A;  3VPR A;  2FX0 A;  3E7Q A;  4ABZ A;  2R7R A;  3JSJ A;  2W53 A;  2QOP A;  4JYK A;  3FIW A;  4OD4 A;  5GPA A;  2R7O A;  3CDL A;  3B6C A;  5H9T A;  3BR6 A;  4ACI A;  3V78 A;  3WHC A;  3QBM A;  2VPR A;  3Q0V A;  4XK4 A;  3RD3 A;  3DU6 A;  4D5F A;  2ID6 A;  2DG8 A;  3F1B A;  3VIB A;  3PM1 A;  4KWA A;  3BNI A;  3HTH A;  5K7H A;  3FK7 A;  3FHN A;  4MO7 A;  5CQG A;  3Q0U A;  3VW1 A;  5EYR A;  4M3G A;  4JKZ A;  2FQ4 A;  3HTJ A;  2B1E A;  3LJL A;  4M3F A;  5IP6 A;  3BTC A;  1T33 A;  4X1E A;  4B1R A;  4C2M A;  4G12 A;  5FMP A;  3VOX A;  5J1R A;  2HYJ A;  3TP0 A;  2QTQ A;  5FHP A;  2GEN A;  3DCF A;  2R7U A;  3LSP A;  2XB5 A;  2QWT A;  3G1L A;  4GFK A;  3G1O A;  4L62 A;  4IRV A;  3KKC A;  3SFI A;  3WHB A;  3BTL A;  4OD5 A;  2UXH A;  2OI8 A;  1ZKG A;  3BT9 A;  4UDS A;  5CW8 A;  4U9N A;  2R7S A;  2G7S A;  2HKU A;  3BJB A;  3LSJ A;  4V2F A;  5F04 A;  1Z77 A;  4DW6 A;  4W97 A;  4AF5 A;  2VKV A;  2G7G A;  3BRU A;  3VVY A;  2I10 A;  3GZI A;  3MNL A;  3ZQH A;  3ANP A;  4CGR A;  1ZK8 A;  5EZG A;  4MK6 A;  5EZH A;  5D1R A;  5FKO A;  2UXP A;  3HE0 A;  3LHQ A;  1A6I A;  2RAE A;  2PBX A;  4D7N A;  3NS4 A;  5F08 A;  3O8H A;  2UXO A;  3ZQL A;  4I76 A;  2JJ7 A;  1U9N A;  2PFV A;  3P9T A;  2HQ5 A;  2XGC A;  5AQC A;  5GPC A;  1JT0 A;  2FD5 A;  5K7Z A;  2ZOY A;  2RAS A;  2D6Y A;  3TP3 A;  2TCT A;  2B3W A;  2HXI A;  3B6A A;  5FKN A;  4YZE A;  2OPT A;  5F0C A;  2QCO A;  3EGQ A;  4M3D A;  3ZQG A;  3KZ9 A;  5K58 A;  2ID3 A;  3Q0W A;  3VTI A;  2R7X A;  3BR2 A;  3NPI A;  3VVX A;  2UXU A;  3QQA A;  2O7O A;  5FGL A;  2G0E A;  3IUV A;  2G3B A;  1JTY A;  2GFN A;  4NEL A;  3F0C A;  2NS8 A;  1UI5 A;  3VP5 A;  3SWH A;  2FJ1 A;  3FK6 A;  1JT6 A;  2XPW A;  5IOY A;  3CRJ A;  3T6N A;  1RKT A;  5J3L A;  2GBY A;  5IPA A;  2QKO A;  5IOZ A;  2NX4 A;  2UXI A;  4PXI A;  4GFL A;  2OF7 A;  3ZQF A;  3HTA A;  2X6O A;  3ZQI A;  3DEW A;  2NS7 A;  2GUH A;  2XDN A;  1UI6 A;  2HYT A;  4JL3 A;  3B81 A;  3G56 A;  5F0F A;  1QVU A;  2R7Q A;  2A2F X;  3BR5 A;  3IH4 A;  3FRQ A;  4I6Z A;  3V6G A;  3BTJ A;  2R7T A;  3NNR A;  3AQS A;  3G7R A;  3S5R A;  5J1Y A;  2Y31 A;  3DPJ A;  1Z0X A;  3K8P C;  4ICH A;  2TRT A;  2ZCM A;  3Q3S A;  3VW2 A;  3COL A;  2R7V A;  2REK A;  4V2G A;  3QPL A;  2XGD A;  2ZB9 A;  3KKD A;  2YVX A;  2YVE A;  3ON4 A;  3PAS A;  5HBU A;  5F27 A;  3LSR A;  3VW0 A;  5CXI A;  1QPI A;  4AUX A;  1RKW A;  3MVP A;  3BR0 A;  3C07 A;  2XGE A;  1VI0 A;  2FJI 1;  1JUP A;  2Y2Z A;  2X9D A;  3NRG A;  3GEU A;  1JUM A;  3BR1 A;  4GCT A;  2HXO A;  4W1U A;  2NP5 A;  3G1M A;  5D19 A;  1T56 A;  4WIB A;  3AQT A;  2OER A;  5HSZ A;  3SDG A;  2YVH A;  2IEK A;  3LOC A;  2IU5 A;  4U9L A;  3HGY A;  4ME9 A;  2JK3 A;  1ORK A;  3BQZ A;  2NP3 A;  2ZCX A;  4DVY P;  5J1U A;  2FBQ A;  3HGG A;  4MXM A;  3PPB A;  2O7T A;  3LWJ A;  3ANG A;  2R7W A;  2VKE A;  3C2B A;  5D18 A;  4AC0 A;  5F0H A;  3BCG A;  3VVZ A;  4AC6 A;  2Y30 A;  1SGM A;  3ON2 A;  2XPU A;  4JNN A;  2QIB A;  3KYL A;  3DU5 A;  5HAW A;  5FKK A;  1RPW A;  3CJD A;  2IAI A;  3O60 A;  5FKM A;  3NXC A;  1QVT A;  3BQY A;  2ZOZ A;  3O8G A;  1BJZ A;  4GCK A;  1JTX A;  3NI7 A;  3BTI A;  2G7L A;  2WUI A;  3HIM A;  5FKL A;  2DTZ A;  3VUQ A;  2XRL A;  2RHA A;  4NN1 A;  3BHQ A;  2V57 A;  4B3A A; 
#chains in the Genus database with same CATH homology
 5GP9 A;  1U9O A;  2DG7 A;  3RH2 A;  2XPV A;  5DAJ A;  4D7M A;  3IH2 A;  4M3B A;  3CWR A;  2EH3 A;  2WGB A;  5F1J A;  3QKX A;  3HTI A;  1JUS A;  3EUP A;  2IBD A;  3IH3 A;  4GCL A;  3QPS A;  5K7F A;  4D5C A;  4HKU A;  2PZ9 A;  2F07 A;  3KNW A;  5C4Y A;  3BR3 A;  3CCY A;  3VOK A;  2WV1 A;  2Q24 A;  2ZCN A;  4M3E A;  5EFY A;  5CXG A;  3VPR A;  2FX0 A;  3E7Q A;  4ABZ A;  3JSJ A;  2W53 A;  2QOP A;  4JYK A;  3FIW A;  5GPA A;  3CDL A;  3B6C A;  5H9T A;  3BR6 A;  4ACI A;  3V78 A;  3WHC A;  3QBM A;  2VPR A;  3Q0V A;  4XK4 A;  3RD3 A;  4D5F A;  2ID6 A;  2DG8 A;  3F1B A;  3VIB A;  3PM1 A;  4KWA A;  3BNI A;  3HTH A;  5K7H A;  3FK7 A;  4MO7 A;  3Q0U A;  3VW1 A;  5EYR A;  4M3G A;  4JKZ A;  2FQ4 A;  3HTJ A;  3LJL A;  4M3F A;  5IP6 A;  3BTC A;  1T33 A;  4X1E A;  4B1R A;  4G12 A;  5FMP A;  3VOX A;  5J1R A;  2HYJ A;  3TP0 A;  2QTQ A;  5FHP A;  2GEN A;  3DCF A;  3LSP A;  2XB5 A;  2QWT A;  3G1L A;  4GFK A;  3G1O A;  4L62 A;  3KKC A;  3SFI A;  3WHB A;  3BTL A;  2UXH A;  2OI8 A;  1ZKG A;  3BT9 A;  4UDS A;  5CW8 A;  2G7S A;  2HKU A;  3BJB A;  3LSJ A;  4V2F A;  5F04 A;  1Z77 A;  4DW6 A;  4W97 A;  4AF5 A;  2VKV A;  2G7G A;  3BRU A;  3VVY A;  2I10 A;  3GZI A;  3MNL A;  3ZQH A;  3ANP A;  4CGR A;  1ZK8 A;  5EZG A;  4MK6 A;  5EZH A;  5D1R A;  5FKO A;  2UXP A;  3HE0 A;  3LHQ A;  1A6I A;  2RAE A;  2PBX A;  4D7N A;  5F08 A;  3O8H A;  2UXO A;  3ZQL A;  4I76 A;  2JJ7 A;  1U9N A;  3P9T A;  2HQ5 A;  2XGC A;  5AQC A;  5GPC A;  1JT0 A;  2FD5 A;  5K7Z A;  2ZOY A;  2RAS A;  2D6Y A;  3TP3 A;  2TCT A;  2HXI A;  3B6A A;  5FKN A;  4YZE A;  2OPT A;  5F0C A;  2QCO A;  3EGQ A;  4M3D A;  3ZQG A;  3KZ9 A;  5K58 A;  2ID3 A;  3Q0W A;  3BR2 A;  3NPI A;  3VVX A;  2UXU A;  3QQA A;  2O7O A;  5FGL A;  2G0E A;  3IUV A;  2G3B A;  1JTY A;  2GFN A;  4NEL A;  3F0C A;  2NS8 A;  1UI5 A;  3VP5 A;  2FJ1 A;  3FK6 A;  1JT6 A;  2XPW A;  5IOY A;  3CRJ A;  3T6N A;  1RKT A;  5J3L A;  2GBY A;  5IPA A;  2QKO A;  5IOZ A;  2NX4 A;  2UXI A;  4PXI A;  4GFL A;  2OF7 A;  3ZQF A;  3HTA A;  2X6O A;  3ZQI A;  3DEW A;  2NS7 A;  2GUH A;  2XDN A;  1UI6 A;  2HYT A;  4JL3 A;  3B81 A;  3G56 A;  5F0F A;  1QVU A;  3BR5 A;  3IH4 A;  3FRQ A;  4I6Z A;  3V6G A;  3BTJ A;  3NNR A;  3AQS A;  3G7R A;  3S5R A;  5J1Y A;  2Y31 A;  3DPJ A;  1Z0X A;  4ICH A;  2TRT A;  2ZCM A;  3Q3S A;  3VW2 A;  3COL A;  2REK A;  4V2G A;  3QPL A;  2XGD A;  2ZB9 A;  3KKD A;  2YVE A;  3ON4 A;  3PAS A;  5HBU A;  5F27 A;  3LSR A;  3VW0 A;  5CXI A;  1QPI A;  4AUX A;  1RKW A;  3MVP A;  3BR0 A;  3C07 A;  2XGE A;  1VI0 A;  1JUP A;  2Y2Z A;  2X9D A;  3NRG A;  3GEU A;  1JUM A;  3BR1 A;  4GCT A;  2HXO A;  4W1U A;  2NP5 A;  3G1M A;  5D19 A;  1T56 A;  5HSZ A;  3AQT A;  2OER A;  3SDG A;  2YVH A;  2IEK A;  3LOC A;  2IU5 A;  3HGY A;  4ME9 A;  2JK3 A;  1ORK A;  3BQZ A;  2NP3 A;  2ZCX A;  5J1U A;  2FBQ A;  3HGG A;  4MXM A;  3PPB A;  2O7T A;  3LWJ A;  3ANG A;  2VKE A;  3C2B A;  5D18 A;  4AC0 A;  5F0H A;  3BCG A;  3VVZ A;  4AC6 A;  2Y30 A;  1SGM A;  3ON2 A;  2XPU A;  4JNN A;  2QIB A;  5HAW A;  5FKK A;  1RPW A;  3CJD A;  2IAI A;  3O60 A;  5FKM A;  3NXC A;  1QVT A;  3BQY A;  2ZOZ A;  3O8G A;  1BJZ A;  4GCK A;  1JTX A;  3NI7 A;  3BTI A;  2G7L A;  2WUI A;  3HIM A;  5FKL A;  2DTZ A;  3VUQ A;  2XRL A;  2RHA A;  4NN1 A;  3BHQ A;  2V57 A;  4B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...