3PASA

Crystal structure of a tetr family transcription regulator (maqu_1417) from marinobacter aquaeolei vt8 at 1.90 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
MRQRDDSKRIAFLEATVREVADHGFSATSVGKIAKAAGLSPATLYIYYEDKEQLLLATFYYVSDQVIDAALDSFSRGKDLREGLRRQWHTLFRIGLERPELFRYHETFTHSAWMTPEIQARNESRAANLLNAVDQGKQSGLIKPVPFPLLETFMFRPIYHLVQRCLQGSFEGTDEHIELAFNMAWDAVADR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution
rcsb
source organism Marinobacter aquaeolei
molecule tags Transcription regulator
molecule keywords TetR family transcription regulator
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3pasA00
2NS7A 3CRJA 2EH3A 3E7QA 2IBDA 2XPVA 4GCTA 3FRQA 2VKEA 3Q0UA 3BCGA 3VP5A 5EZGA 1JUSA 2XPUA 2PBXA 4MO7A 3COLA 3PPBA 2W53A 2Y2ZA 5IOZA 3LSRA 3NI7A 3BR2A 2VPRA 3GZIA 4DW6A 5AQCA 2ID3A 4AF5A 4W1UA 5D19A 3VVZA 3LSJA 4MXMA 2XDNA 3LWJA 3AQTA 1QVTA 3EUPA 4X1EA 3KZ9A 1QPIA 3VIBA 2JJ7A 4AC6A 2Q24A 3V6GA 2QWTA 3MNLA 2YVHA 1U9OA 5FKLA 2RASA 1JUMA 2QOPA 2IEKA 3HTJA 1RKWA 4AC0A 3BR6A 3BR0A 4W97A 3AQSA 2G7LA 2O7TA 3O60A 4V2FA 3WHCA 4JYKA 4D5CA 2OI8A 1ZKGA 5IP6A 3ANPA 3ZQLA 2ZOZA 5D1RA 5FKNA 3VPRA 4AUXA 3BR1A 5CW8A 2GFNA 2JK3A 3VOXA 2OPTA 1QVUA 3ON2A 3S5RA 1SGMA 3QKXA 3DEWA 4V2GA 3QQAA 4MK6A 1Z77A 4M3DA 1U9NA 1JT0A 5K7ZA 4JKZA 2D6YA 4I76A 3CWRA 2HKUA 3IUVA 4GFLA 2HXIA 2X9DA 4CGRA 2UXIA 3HTHA 2UXHA 3B6AA 2O7OA 3VW1A 4I6ZA 3CDLA 4YZEA 3G1OA 5F1JA 3HIMA 2PZ9A 2HYJA 4M3EA 4JNNA 3LHQA 5FMPA 5EYRA 5F08A 1UI5A 3V78A 1ORKA 4HKUA 5CXGA 3BRUA 2NP3A 4GCLA 3CJDA 5HAWA 5D18A 2RAEA 3VVYA 3HTIA 2HXOA 5FKOA 3HGYA 3BR3A 3HGGA 3KNWA 5FKKA 3C2BA 3BTJA 1JUPA 2QKOA 2REKA 3TP0A 3O8GA 4D7MA 5FGLA 5HSZA 2QIBA 2Y30A 3BTCA 1UI6A 3PM1A 3RD3A 1BJZA 4ICHA 1JTXA 4UDSA 5F0HA 3Q0VA 2XRLA 2WV1A 4NN1A 2ID6A 2GBYA 2GUHA 2X6OA 3QBMA 2FJ1A 2HQ5A 3BR5A 3GEUA 5J1UA 3DCFA 2NS8A 5J3LA 2QTQA 1JTYA 3P9TA 2IAIA 5FKMA 3QPSA 2FQ4A 2FD5A 3B81A 3IH2A 2DTZA 3HTAA 3ON4A 4B3AA 1T56A 2UXUA 3KKDA 2QCOA 2I10A 3PASA 3NRGA 5F04A 3VW0A 3BQYA 3LOCA 1T33A 5C4YA 2VKVA 5IPAA 3C07A 3MVPA 4ME9A 4G12A 3LJLA 5F0CA 1RKTA 3IH3A 2Y31A 5DAJA 2NP5A 3G1MA 3IH4A 2OF7A 3RH2A 4PXIA 2TCTA 2UXOA 3ZQGA 3ANGA 3BTIA 2G3BA 2ZB9A 5EZHA 4M3BA 4ACIA 3G1LA 3HE0A 2V57A 2F07A 5K7FA 3Q3SA 3NPIA 5GPAA 3BTLA 3VVXA 3BHQA 4D5FA 2DG8A 2ZCXA 4B1RA 1RPWA 3BT9A 4L62A 3VW2A 3FK6A 2HYTA 5H9TA 5HBUA 2XPWA 3EGQA 2TRTA 3B6CA 2WUIA 3QPLA 4D7NA 5J1RA 1A6IA 3Q0WA 3G56A 5EFYA 5F27A 3LSPA 3VUQA 2ZOYA 4XK4A 3FIWA 3ZQFA 1VI0A 3BJBA 3BNIA 4JL3A 4GCKA 3F0CA 2G7SA 5FHPA 5J1YA 4M3GA 1Z0XA 3CCYA 3SDGA 5GP9A 3NXCA 2FX0A 2WGBA 2XGDA 5F0FA 2OERA 5K58A 2NX4A 4GFKA 3SFIA 3DPJA 2DG7A 3ZQHA 5K7HA 2YVEA 3TP3A 5GPCA 2XGEA 2FBQA 2GENA 3ZQIA 3G7RA 3JSJA 4M3FA 2G7GA 2XB5A 3F1BA 3T6NA 2G0EA 3NNRA 3KKCA 3VOKA 5IOYA 1ZK8A 2IU5A 1JT6A 2ZCMA 4NELA 5CXIA 4KWAA 2ZCNA 3WHBA 2RHAA 3O8HA 2UXPA 3FK7A 2XGCA 3BQZA 4ABZA
chains in the Genus database with same CATH superfamily
2NS7A 3CRJA 3K8PC 2EH3A 3E7QA 2IBDA 2XPVA 2A2FX 4GCTA 3FRQA 2VKEA 3Q0UA 3BCGA 3VP5A 5EZGA 1JUSA 2XPUA 2PBXA 4MO7A 3COLA 3PPBA 2W53A 2Y2ZA 5IOZA 3LSRA 3NI7A 4OD5A 3BR2A 2R7SA 2VPRA 3GZIA 3SWHA 4DW6A 5AQCA 2ID3A 4AF5A 4W1UA 5D19A 3VVZA 3LSJA 4MXMA 2XDNA 3LWJA 2B3WA 3AQTA 1QVTA 3EUPA 4X1EA 3KZ9A 1QPIA 3VIBA 2JJ7A 5CQGA 4AC6A 2Q24A 3V6GA 2QWTA 3MNLA 2YVHA 1U9OA 5FKLA 2RASA 1JUMA 2QOPA 2IEKA 3HTJA 1RKWA 2R7TA 4AC0A 2FJI1 3BR6A 3BR0A 4W97A 3AQSA 2G7LA 2O7TA 3O60A 4V2FA 3WHCA 4JYKA 4OD4A 4D5CA 2OI8A 1ZKGA 5IP6A 3ANPA 3ZQLA 2ZOZA 5D1RA 2R7WA 5FKNA 3VPRA 4AUXA 3BR1A 5CW8A 2GFNA 2JK3A 3VOXA 2OPTA 1QVUA 3ON2A 3S5RA 1SGMA 3QKXA 3DEWA 4V2GA 3QQAA 4MK6A 2R7RA 1Z77A 4M3DA 1U9NA 2ZY9A 1JT0A 5K7ZA 4JKZA 2D6YA 4I76A 3CWRA 2HKUA 3IUVA 4GFLA 2HXIA 2X9DA 4CGRA 2UXIA 3HTHA 2UXHA 3B6AA 2O7OA 3VW1A 4I6ZA 3CDLA 2R7OA 4YZEA 3G1OA 5F1JA 3HIMA 2PZ9A 2HYJA 4M3EA 4JNNA 4C2MA 3LHQA 5FMPA 5EYRA 5F08A 1UI5A 3V78A 1ORKA 4HKUA 5CXGA 3BRUA 4U9NA 2NP3A 2YVXA 4GCLA 3CJDA 5HAWA 5D18A 2RAEA 3VVYA 3HTIA 2HXOA 5FKOA 3HGYA 3BR3A 3HGGA 3KNWA 5FKKA 3C2BA 3BTJA 1JUPA 2QKOA 2REKA 3TP0A 3O8GA 4D7MA 5FGLA 5HSZA 2QIBA 2Y30A 3BTCA 2R7VA 1UI6A 3PM1A 3RD3A 1BJZA 4ICHA 1JTXA 4UDSA 3NS4A 5F0HA 3Q0VA 2XRLA 2WV1A 4NN1A 2R7QA 2R7UA 2ID6A 2GBYA 2GUHA 2X6OA 3QBMA 2FJ1A 2HQ5A 3BR5A 3GEUA 5J1UA 3DCFA 2NS8A 5J3LA 2QTQA 1JTYA 3P9TA 2IAIA 5FKMA 3QPSA 2FQ4A 2FD5A 4IRVA 3B81A 3IH2A 2DTZA 3HTAA 3ON4A 4B3AA 1T56A 2UXUA 3KKDA 2QCOA 2I10A 3PASA 3NRGA 5F04A 3VW0A 3BQYA 3LOCA 1T33A 5C4YA 2VKVA 5IPAA 3C07A 3MVPA 4ME9A 4G12A 3LJLA 3KYLA 5F0CA 1RKTA 4U9LA 3IH3A 2Y31A 5DAJA 2NP5A 3G1MA 3IH4A 2OF7A 3RH2A 4PXIA 2TCTA 2UXOA 3ZQGA 3ANGA 3BTIA 2G3BA 2ZB9A 5EZHA 4M3BA 4ACIA 2B1EA 3G1LA 3HE0A 2V57A 2F07A 5K7FA 3Q3SA 3NPIA 5GPAA 3BTLA 3VVXA 2PFVA 3BHQA 4D5FA 2DG8A 2ZCXA 4B1RA 1RPWA 3BT9A 4L62A 3VW2A 3FK6A 2HYTA 5H9TA 5HBUA 2XPWA 3EGQA 2TRTA 3B6CA 2WUIA 3QPLA 4D7NA 5J1RA 1A6IA 3Q0WA 3G56A 5EFYA 5F27A 3LSPA 3VUQA 2ZOYA 4XK4A 2R7XA 3FIWA 3ZQFA 1VI0A 3BJBA 3BNIA 4JL3A 4GCKA 3F0CA 2G7SA 4DVYP 5FHPA 5J1YA 4M3GA 1Z0XA 3CCYA 3SDGA 5GP9A 3NXCA 2FX0A 2WGBA 2XGDA 5F0FA 2OERA 5K58A 2NX4A 4GFKA 3SFIA 3DPJA 3DU5A 4WIBA 2DG7A 3ZQHA 5K7HA 2YVEA 3TP3A 5GPCA 2XGEA 2FBQA 2GENA 3ZQIA 3DU6A 3FHNA 3VTIA 3G7RA 3JSJA 4M3FA 2G7GA 2XB5A 3F1BA 3T6NA 2G0EA 3NNRA 3KKCA 3VOKA 5IOYA 1ZK8A 2IU5A 1JT6A 2ZCMA 4NELA 5CXIA 4KWAA 2ZCNA 3WHBA 2RHAA 3O8HA 2UXPA 3FK7A 2XGCA 3BQZA 4ABZA
chains in the Genus database with same CATH topology
2NS7A 3CRJA 2EH3A 3E7QA 2IBDA 2XPVA 4GCTA 3FRQA 2VKEA 3Q0UA 3BCGA 3VP5A 5EZGA 1JUSA 2XPUA 2PBXA 4MO7A 3COLA 3PPBA 2W53A 2Y2ZA 5IOZA 3LSRA 3NI7A 3BR2A 2VPRA 3GZIA 4DW6A 5AQCA 2ID3A 4AF5A 4W1UA 5D19A 3VVZA 3LSJA 4MXMA 2XDNA 3LWJA 3AQTA 1QVTA 3EUPA 4X1EA 3KZ9A 1QPIA 3VIBA 2JJ7A 4AC6A 2Q24A 3V6GA 2QWTA 3MNLA 2YVHA 1U9OA 5FKLA 2RASA 1JUMA 2QOPA 2IEKA 3HTJA 1RKWA 4AC0A 3BR6A 3BR0A 4W97A 3AQSA 2G7LA 2O7TA 3O60A 4V2FA 3WHCA 4JYKA 4D5CA 2OI8A 1ZKGA 5IP6A 3ANPA 3ZQLA 2ZOZA 5D1RA 5FKNA 3VPRA 4AUXA 3BR1A 5CW8A 2GFNA 2JK3A 3VOXA 2OPTA 1QVUA 3ON2A 3S5RA 1SGMA 3QKXA 3DEWA 4V2GA 3QQAA 4MK6A 1Z77A 4M3DA 1U9NA 1JT0A 5K7ZA 4JKZA 2D6YA 4I76A 3CWRA 2HKUA 3IUVA 4GFLA 2HXIA 2X9DA 4CGRA 2UXIA 3HTHA 2UXHA 3B6AA 2O7OA 3VW1A 4I6ZA 3CDLA 4YZEA 3G1OA 5F1JA 3HIMA 2PZ9A 2HYJA 4M3EA 4JNNA 3LHQA 5FMPA 5EYRA 5F08A 1UI5A 3V78A 1ORKA 4HKUA 5CXGA 3BRUA 2NP3A 4GCLA 3CJDA 5HAWA 5D18A 2RAEA 3VVYA 3HTIA 2HXOA 5FKOA 3HGYA 3BR3A 3HGGA 3KNWA 5FKKA 3C2BA 3BTJA 1JUPA 2QKOA 2REKA 3TP0A 3O8GA 4D7MA 5FGLA 5HSZA 2QIBA 2Y30A 3BTCA 1UI6A 3PM1A 3RD3A 1BJZA 4ICHA 1JTXA 4UDSA 5F0HA 3Q0VA 2XRLA 2WV1A 4NN1A 2ID6A 2GBYA 2GUHA 2X6OA 3QBMA 2FJ1A 2HQ5A 3BR5A 3GEUA 5J1UA 3DCFA 2NS8A 5J3LA 2QTQA 1JTYA 3P9TA 2IAIA 5FKMA 3QPSA 2FQ4A 2FD5A 3B81A 3IH2A 2DTZA 3HTAA 3ON4A 4B3AA 1T56A 2UXUA 3KKDA 2QCOA 2I10A 3PASA 3NRGA 5F04A 3VW0A 3BQYA 3LOCA 1T33A 5C4YA 2VKVA 5IPAA 3C07A 3MVPA 4ME9A 4G12A 3LJLA 5F0CA 1RKTA 3IH3A 2Y31A 5DAJA 2NP5A 3G1MA 3IH4A 2OF7A 3RH2A 4PXIA 2TCTA 2UXOA 3ZQGA 3ANGA 3BTIA 2G3BA 2ZB9A 5EZHA 4M3BA 4ACIA 3G1LA 3HE0A 2V57A 2F07A 5K7FA 3Q3SA 3NPIA 5GPAA 3BTLA 3VVXA 3BHQA 4D5FA 2DG8A 2ZCXA 4B1RA 1RPWA 3BT9A 4L62A 3VW2A 3FK6A 2HYTA 5H9TA 5HBUA 2XPWA 3EGQA 2TRTA 3B6CA 2WUIA 3QPLA 4D7NA 5J1RA 1A6IA 3Q0WA 3G56A 5EFYA 5F27A 3LSPA 3VUQA 2ZOYA 4XK4A 3FIWA 3ZQFA 1VI0A 3BJBA 3BNIA 4JL3A 4GCKA 3F0CA 2G7SA 5FHPA 5J1YA 4M3GA 1Z0XA 3CCYA 3SDGA 5GP9A 3NXCA 2FX0A 2WGBA 2XGDA 5F0FA 2OERA 5K58A 2NX4A 4GFKA 3SFIA 3DPJA 2DG7A 3ZQHA 5K7HA 2YVEA 3TP3A 5GPCA 2XGEA 2FBQA 2GENA 3ZQIA 3G7RA 3JSJA 4M3FA 2G7GA 2XB5A 3F1BA 3T6NA 2G0EA 3NNRA 3KKCA 3VOKA 5IOYA 1ZK8A 2IU5A 1JT6A 2ZCMA 4NELA 5CXIA 4KWAA 2ZCNA 3WHBA 2RHAA 3O8HA 2UXPA 3FK7A 2XGCA 3BQZA 4ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS7 A;  3CRJ A;  2EH3 A;  3E7Q A;  2IBD A;  2XPV A;  4GCT A;  3FRQ A;  2VKE A;  3Q0U A;  3BCG A;  3VP5 A;  5EZG A;  1JUS A;  2XPU A;  2PBX A;  4MO7 A;  3COL A;  3PPB A;  2W53 A;  2Y2Z A;  5IOZ A;  3LSR A;  3NI7 A;  3BR2 A;  2VPR A;  3GZI A;  4DW6 A;  5AQC A;  2ID3 A;  4AF5 A;  4W1U A;  5D19 A;  3VVZ A;  3LSJ A;  4MXM A;  2XDN A;  3LWJ A;  3AQT A;  1QVT A;  3EUP A;  4X1E A;  3KZ9 A;  1QPI A;  3VIB A;  2JJ7 A;  4AC6 A;  2Q24 A;  3V6G A;  2QWT A;  3MNL A;  2YVH A;  1U9O A;  5FKL A;  2RAS A;  1JUM A;  2QOP A;  2IEK A;  3HTJ A;  1RKW A;  4AC0 A;  3BR6 A;  3BR0 A;  4W97 A;  3AQS A;  2G7L A;  2O7T A;  3O60 A;  4V2F A;  3WHC A;  4JYK A;  4D5C A;  2OI8 A;  1ZKG A;  5IP6 A;  3ANP A;  3ZQL A;  2ZOZ A;  5D1R A;  5FKN A;  3VPR A;  4AUX A;  3BR1 A;  5CW8 A;  2GFN A;  2JK3 A;  3VOX A;  2OPT A;  1QVU A;  3ON2 A;  3S5R A;  1SGM A;  3QKX A;  3DEW A;  4V2G A;  3QQA A;  4MK6 A;  1Z77 A;  4M3D A;  1U9N A;  1JT0 A;  5K7Z A;  4JKZ A;  2D6Y A;  4I76 A;  3CWR A;  2HKU A;  3IUV A;  4GFL A;  2HXI A;  2X9D A;  4CGR A;  2UXI A;  3HTH A;  2UXH A;  3B6A A;  2O7O A;  3VW1 A;  4I6Z A;  3CDL A;  4YZE A;  3G1O A;  5F1J A;  3HIM A;  2PZ9 A;  2HYJ A;  4M3E A;  4JNN A;  3LHQ A;  5FMP A;  5EYR A;  5F08 A;  1UI5 A;  3V78 A;  1ORK A;  4HKU A;  5CXG A;  3BRU A;  2NP3 A;  4GCL A;  3CJD A;  5HAW A;  5D18 A;  2RAE A;  3VVY A;  3HTI A;  2HXO A;  5FKO A;  3HGY A;  3BR3 A;  3HGG A;  3KNW A;  5FKK A;  3C2B A;  3BTJ A;  1JUP A;  2QKO A;  2REK A;  3TP0 A;  3O8G A;  4D7M A;  5FGL A;  5HSZ A;  2QIB A;  2Y30 A;  3BTC A;  1UI6 A;  3PM1 A;  3RD3 A;  1BJZ A;  4ICH A;  1JTX A;  4UDS A;  5F0H A;  3Q0V A;  2XRL A;  2WV1 A;  4NN1 A;  2ID6 A;  2GBY A;  2GUH A;  2X6O A;  3QBM A;  2FJ1 A;  2HQ5 A;  3BR5 A;  3GEU A;  5J1U A;  3DCF A;  2NS8 A;  5J3L A;  2QTQ A;  1JTY A;  3P9T A;  2IAI A;  5FKM A;  3QPS A;  2FQ4 A;  2FD5 A;  3B81 A;  3IH2 A;  2DTZ A;  3HTA A;  3ON4 A;  4B3A A;  1T56 A;  2UXU A;  3KKD A;  2QCO A;  2I10 A;  3PAS A;  3NRG A;  5F04 A;  3VW0 A;  3BQY A;  3LOC A;  1T33 A;  5C4Y A;  2VKV A;  5IPA A;  3C07 A;  3MVP A;  4ME9 A;  4G12 A;  3LJL A;  5F0C A;  1RKT A;  3IH3 A;  2Y31 A;  5DAJ A;  2NP5 A;  3G1M A;  3IH4 A;  2OF7 A;  3RH2 A;  4PXI A;  2TCT A;  2UXO A;  3ZQG A;  3ANG A;  3BTI A;  2G3B A;  2ZB9 A;  5EZH A;  4M3B A;  4ACI A;  3G1L A;  3HE0 A;  2V57 A;  2F07 A;  5K7F A;  3Q3S A;  3NPI A;  5GPA A;  3BTL A;  3VVX A;  3BHQ A;  4D5F A;  2DG8 A;  2ZCX A;  4B1R A;  1RPW A;  3BT9 A;  4L62 A;  3VW2 A;  3FK6 A;  2HYT A;  5H9T A;  5HBU A;  2XPW A;  3EGQ A;  2TRT A;  3B6C A;  2WUI A;  3QPL A;  4D7N A;  5J1R A;  1A6I A;  3Q0W A;  3G56 A;  5EFY A;  5F27 A;  3LSP A;  3VUQ A;  2ZOY A;  4XK4 A;  3FIW A;  3ZQF A;  1VI0 A;  3BJB A;  3BNI A;  4JL3 A;  4GCK A;  3F0C A;  2G7S A;  5FHP A;  5J1Y A;  4M3G A;  1Z0X A;  3CCY A;  3SDG A;  5GP9 A;  3NXC A;  2FX0 A;  2WGB A;  2XGD A;  5F0F A;  2OER A;  5K58 A;  2NX4 A;  4GFK A;  3SFI A;  3DPJ A;  2DG7 A;  3ZQH A;  5K7H A;  2YVE A;  3TP3 A;  5GPC A;  2XGE A;  2FBQ A;  2GEN A;  3ZQI A;  3G7R A;  3JSJ A;  4M3F A;  2G7G A;  2XB5 A;  3F1B A;  3T6N A;  2G0E A;  3NNR A;  3KKC A;  3VOK A;  5IOY A;  1ZK8 A;  2IU5 A;  1JT6 A;  2ZCM A;  4NEL A;  5CXI A;  4KWA A;  2ZCN A;  3WHB A;  2RHA A;  3O8H A;  2UXP A;  3FK7 A;  2XGC A;  3BQZ A;  4ABZ A; 
#chains in the Genus database with same CATH topology
 2NS7 A;  3CRJ A;  3K8P C;  2EH3 A;  3E7Q A;  2IBD A;  2XPV A;  2A2F X;  4GCT A;  3FRQ A;  2VKE A;  3Q0U A;  3BCG A;  3VP5 A;  5EZG A;  1JUS A;  2XPU A;  2PBX A;  4MO7 A;  3COL A;  3PPB A;  2W53 A;  2Y2Z A;  5IOZ A;  3LSR A;  3NI7 A;  4OD5 A;  3BR2 A;  2R7S A;  2VPR A;  3GZI A;  3SWH A;  4DW6 A;  5AQC A;  2ID3 A;  4AF5 A;  4W1U A;  5D19 A;  3VVZ A;  3LSJ A;  4MXM A;  2XDN A;  3LWJ A;  2B3W A;  3AQT A;  1QVT A;  3EUP A;  4X1E A;  3KZ9 A;  1QPI A;  3VIB A;  2JJ7 A;  5CQG A;  4AC6 A;  2Q24 A;  3V6G A;  2QWT A;  3MNL A;  2YVH A;  1U9O A;  5FKL A;  2RAS A;  1JUM A;  2QOP A;  2IEK A;  3HTJ A;  1RKW A;  2R7T A;  4AC0 A;  2FJI 1;  3BR6 A;  3BR0 A;  4W97 A;  3AQS A;  2G7L A;  2O7T A;  3O60 A;  4V2F A;  3WHC A;  4JYK A;  4OD4 A;  4D5C A;  2OI8 A;  1ZKG A;  5IP6 A;  3ANP A;  3ZQL A;  2ZOZ A;  5D1R A;  2R7W A;  5FKN A;  3VPR A;  4AUX A;  3BR1 A;  5CW8 A;  2GFN A;  2JK3 A;  3VOX A;  2OPT A;  1QVU A;  3ON2 A;  3S5R A;  1SGM A;  3QKX A;  3DEW A;  4V2G A;  3QQA A;  4MK6 A;  2R7R A;  1Z77 A;  4M3D A;  1U9N A;  2ZY9 A;  1JT0 A;  5K7Z A;  4JKZ A;  2D6Y A;  4I76 A;  3CWR A;  2HKU A;  3IUV A;  4GFL A;  2HXI A;  2X9D A;  4CGR A;  2UXI A;  3HTH A;  2UXH A;  3B6A A;  2O7O A;  3VW1 A;  4I6Z A;  3CDL A;  2R7O A;  4YZE A;  3G1O A;  5F1J A;  3HIM A;  2PZ9 A;  2HYJ A;  4M3E A;  4JNN A;  4C2M A;  3LHQ A;  5FMP A;  5EYR A;  5F08 A;  1UI5 A;  3V78 A;  1ORK A;  4HKU A;  5CXG A;  3BRU A;  4U9N A;  2NP3 A;  2YVX A;  4GCL A;  3CJD A;  5HAW A;  5D18 A;  2RAE A;  3VVY A;  3HTI A;  2HXO A;  5FKO A;  3HGY A;  3BR3 A;  3HGG A;  3KNW A;  5FKK A;  3C2B A;  3BTJ A;  1JUP A;  2QKO A;  2REK A;  3TP0 A;  3O8G A;  4D7M A;  5FGL A;  5HSZ A;  2QIB A;  2Y30 A;  3BTC A;  2R7V A;  1UI6 A;  3PM1 A;  3RD3 A;  1BJZ A;  4ICH A;  1JTX A;  4UDS A;  3NS4 A;  5F0H A;  3Q0V A;  2XRL A;  2WV1 A;  4NN1 A;  2R7Q A;  2R7U A;  2ID6 A;  2GBY A;  2GUH A;  2X6O A;  3QBM A;  2FJ1 A;  2HQ5 A;  3BR5 A;  3GEU A;  5J1U A;  3DCF A;  2NS8 A;  5J3L A;  2QTQ A;  1JTY A;  3P9T A;  2IAI A;  5FKM A;  3QPS A;  2FQ4 A;  2FD5 A;  4IRV A;  3B81 A;  3IH2 A;  2DTZ A;  3HTA A;  3ON4 A;  4B3A A;  1T56 A;  2UXU A;  3KKD A;  2QCO A;  2I10 A;  3PAS A;  3NRG A;  5F04 A;  3VW0 A;  3BQY A;  3LOC A;  1T33 A;  5C4Y A;  2VKV A;  5IPA A;  3C07 A;  3MVP A;  4ME9 A;  4G12 A;  3LJL A;  3KYL A;  5F0C A;  1RKT A;  4U9L A;  3IH3 A;  2Y31 A;  5DAJ A;  2NP5 A;  3G1M A;  3IH4 A;  2OF7 A;  3RH2 A;  4PXI A;  2TCT A;  2UXO A;  3ZQG A;  3ANG A;  3BTI A;  2G3B A;  2ZB9 A;  5EZH A;  4M3B A;  4ACI A;  2B1E A;  3G1L A;  3HE0 A;  2V57 A;  2F07 A;  5K7F A;  3Q3S A;  3NPI A;  5GPA A;  3BTL A;  3VVX A;  2PFV A;  3BHQ A;  4D5F A;  2DG8 A;  2ZCX A;  4B1R A;  1RPW A;  3BT9 A;  4L62 A;  3VW2 A;  3FK6 A;  2HYT A;  5H9T A;  5HBU A;  2XPW A;  3EGQ A;  2TRT A;  3B6C A;  2WUI A;  3QPL A;  4D7N A;  5J1R A;  1A6I A;  3Q0W A;  3G56 A;  5EFY A;  5F27 A;  3LSP A;  3VUQ A;  2ZOY A;  4XK4 A;  2R7X A;  3FIW A;  3ZQF A;  1VI0 A;  3BJB A;  3BNI A;  4JL3 A;  4GCK A;  3F0C A;  2G7S A;  4DVY P;  5FHP A;  5J1Y A;  4M3G A;  1Z0X A;  3CCY A;  3SDG A;  5GP9 A;  3NXC A;  2FX0 A;  2WGB A;  2XGD A;  5F0F A;  2OER A;  5K58 A;  2NX4 A;  4GFK A;  3SFI A;  3DPJ A;  3DU5 A;  4WIB A;  2DG7 A;  3ZQH A;  5K7H A;  2YVE A;  3TP3 A;  5GPC A;  2XGE A;  2FBQ A;  2GEN A;  3ZQI A;  3DU6 A;  3FHN A;  3VTI A;  3G7R A;  3JSJ A;  4M3F A;  2G7G A;  2XB5 A;  3F1B A;  3T6N A;  2G0E A;  3NNR A;  3KKC A;  3VOK A;  5IOY A;  1ZK8 A;  2IU5 A;  1JT6 A;  2ZCM A;  4NEL A;  5CXI A;  4KWA A;  2ZCN A;  3WHB A;  2RHA A;  3O8H A;  2UXP A;  3FK7 A;  2XGC A;  3BQZ A;  4ABZ A; 
#chains in the Genus database with same CATH homology
 2NS7 A;  3CRJ A;  2EH3 A;  3E7Q A;  2IBD A;  2XPV A;  4GCT A;  3FRQ A;  2VKE A;  3Q0U A;  3BCG A;  3VP5 A;  5EZG A;  1JUS A;  2XPU A;  2PBX A;  4MO7 A;  3COL A;  3PPB A;  2W53 A;  2Y2Z A;  5IOZ A;  3LSR A;  3NI7 A;  3BR2 A;  2VPR A;  3GZI A;  4DW6 A;  5AQC A;  2ID3 A;  4AF5 A;  4W1U A;  5D19 A;  3VVZ A;  3LSJ A;  4MXM A;  2XDN A;  3LWJ A;  3AQT A;  1QVT A;  3EUP A;  4X1E A;  3KZ9 A;  1QPI A;  3VIB A;  2JJ7 A;  4AC6 A;  2Q24 A;  3V6G A;  2QWT A;  3MNL A;  2YVH A;  1U9O A;  5FKL A;  2RAS A;  1JUM A;  2QOP A;  2IEK A;  3HTJ A;  1RKW A;  4AC0 A;  3BR6 A;  3BR0 A;  4W97 A;  3AQS A;  2G7L A;  2O7T A;  3O60 A;  4V2F A;  3WHC A;  4JYK A;  4D5C A;  2OI8 A;  1ZKG A;  5IP6 A;  3ANP A;  3ZQL A;  2ZOZ A;  5D1R A;  5FKN A;  3VPR A;  4AUX A;  3BR1 A;  5CW8 A;  2GFN A;  2JK3 A;  3VOX A;  2OPT A;  1QVU A;  3ON2 A;  3S5R A;  1SGM A;  3QKX A;  3DEW A;  4V2G A;  3QQA A;  4MK6 A;  1Z77 A;  4M3D A;  1U9N A;  1JT0 A;  5K7Z A;  4JKZ A;  2D6Y A;  4I76 A;  3CWR A;  2HKU A;  3IUV A;  4GFL A;  2HXI A;  2X9D A;  4CGR A;  2UXI A;  3HTH A;  2UXH A;  3B6A A;  2O7O A;  3VW1 A;  4I6Z A;  3CDL A;  4YZE A;  3G1O A;  5F1J A;  3HIM A;  2PZ9 A;  2HYJ A;  4M3E A;  4JNN A;  3LHQ A;  5FMP A;  5EYR A;  5F08 A;  1UI5 A;  3V78 A;  1ORK A;  4HKU A;  5CXG A;  3BRU A;  2NP3 A;  4GCL A;  3CJD A;  5HAW A;  5D18 A;  2RAE A;  3VVY A;  3HTI A;  2HXO A;  5FKO A;  3HGY A;  3BR3 A;  3HGG A;  3KNW A;  5FKK A;  3C2B A;  3BTJ A;  1JUP A;  2QKO A;  2REK A;  3TP0 A;  3O8G A;  4D7M A;  5FGL A;  5HSZ A;  2QIB A;  2Y30 A;  3BTC A;  1UI6 A;  3PM1 A;  3RD3 A;  1BJZ A;  4ICH A;  1JTX A;  4UDS A;  5F0H A;  3Q0V A;  2XRL A;  2WV1 A;  4NN1 A;  2ID6 A;  2GBY A;  2GUH A;  2X6O A;  3QBM A;  2FJ1 A;  2HQ5 A;  3BR5 A;  3GEU A;  5J1U A;  3DCF A;  2NS8 A;  5J3L A;  2QTQ A;  1JTY A;  3P9T A;  2IAI A;  5FKM A;  3QPS A;  2FQ4 A;  2FD5 A;  3B81 A;  3IH2 A;  2DTZ A;  3HTA A;  3ON4 A;  4B3A A;  1T56 A;  2UXU A;  3KKD A;  2QCO A;  2I10 A;  3PAS A;  3NRG A;  5F04 A;  3VW0 A;  3BQY A;  3LOC A;  1T33 A;  5C4Y A;  2VKV A;  5IPA A;  3C07 A;  3MVP A;  4ME9 A;  4G12 A;  3LJL A;  5F0C A;  1RKT A;  3IH3 A;  2Y31 A;  5DAJ A;  2NP5 A;  3G1M A;  3IH4 A;  2OF7 A;  3RH2 A;  4PXI A;  2TCT A;  2UXO A;  3ZQG A;  3ANG A;  3BTI A;  2G3B A;  2ZB9 A;  5EZH A;  4M3B A;  4ACI A;  3G1L A;  3HE0 A;  2V57 A;  2F07 A;  5K7F A;  3Q3S A;  3NPI A;  5GPA A;  3BTL A;  3VVX A;  3BHQ A;  4D5F A;  2DG8 A;  2ZCX A;  4B1R A;  1RPW A;  3BT9 A;  4L62 A;  3VW2 A;  3FK6 A;  2HYT A;  5H9T A;  5HBU A;  2XPW A;  3EGQ A;  2TRT A;  3B6C A;  2WUI A;  3QPL A;  4D7N A;  5J1R A;  1A6I A;  3Q0W A;  3G56 A;  5EFY A;  5F27 A;  3LSP A;  3VUQ A;  2ZOY A;  4XK4 A;  3FIW A;  3ZQF A;  1VI0 A;  3BJB A;  3BNI A;  4JL3 A;  4GCK A;  3F0C A;  2G7S A;  5FHP A;  5J1Y A;  4M3G A;  1Z0X A;  3CCY A;  3SDG A;  5GP9 A;  3NXC A;  2FX0 A;  2WGB A;  2XGD A;  5F0F A;  2OER A;  5K58 A;  2NX4 A;  4GFK A;  3SFI A;  3DPJ A;  2DG7 A;  3ZQH A;  5K7H A;  2YVE A;  3TP3 A;  5GPC A;  2XGE A;  2FBQ A;  2GEN A;  3ZQI A;  3G7R A;  3JSJ A;  4M3F A;  2G7G A;  2XB5 A;  3F1B A;  3T6N A;  2G0E A;  3NNR A;  3KKC A;  3VOK A;  5IOY A;  1ZK8 A;  2IU5 A;  1JT6 A;  2ZCM A;  4NEL A;  5CXI A;  4KWA A;  2ZCN A;  3WHB A;  2RHA A;  3O8H A;  2UXP A;  3FK7 A;  2XGC A;  3BQZ A;  4ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...