2IEKA

New crystal form of transcriptional regulator tm1030 from thermotoga maritima
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
LSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title New crystal form of transcriptional regulator tm1030 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 70
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2iekA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iekA02
1ZTRA 5IYDJ 3BR6A 3BTCA 2DA4A 4QSHA 2K40A 3VP5A 1MNMC 5DTDA 3SDGA 3HKZN 1RETA 4UUTA 1O4XA 3TW7A 5GPCA 1U9OA 4A3IJ 2EH3A 4A93J 3EUPA 3KZ9A 4JKZA 5E3LA 3JRIA 2ZCMA 1GDTA 2E19A 4BBRJ 1A5JA 2F07A 4A3LJ 3PO3J 3IV5A 5IYBJ 4X6AJ 2NOGA 2LVSA 2ZCNA 4JYKA 3G1OA 3GTQJ 2FD5A 4I6ZA 5K58A 3G1MA 3A01B 3S16J 3HTIA 5IOYA 3HGGA 3VW1A 2YUSA 3E7LA 4MIMA 4V2FA 1B72B 3JRCA 1P7IA 2DA3A 3TW6A 3NAUA 3WHCA 3ZOBA 5DS9A 1JKQC 3S17J 2UXPA 4DYQA 1ITYA 2YVHA 1RKWA 3MN2A 4L5EA 2MW8A 3BQZA 5K7HA 3C2BA 3UKGA 3CJDA 3OSGA 3RD3A 3NI7A 1HDPA 4QIWN 2DA7A 1D5YA 3C07A 4QTRA 1ETWA 2NS7A 1W0TA 2GUHA 2DMNA 3S1MJ 2XB5A 2QIBA 5C4XJ 2OPTA 2CJJA 5FKMA 3SJMA 1VFCA 4MLOA 3S14J 3VVZA 1TWFJ 3O8HA 2ZOZA 2RASA 1H89C 2M8GX 3BTJA 4GFLA 3QQAA 5JLWA 1U8BA 4FISA 4CGRA 4XRSG 2ZOYA 3FK7A 3T6NA 1S7EA 2JWTA 3NARA 5CXGA 3ANGA 2EZHA 3IH3A 2B63J 2NVTJ 1POGA 3A01A 5EG0B 3I4MJ 3GZIA 2JA8J 3HGYA 1JT6A 2K9NA 5EYRA 1B72A 4A3DJ 2DMPA 4AC0A 2DMUA 1T33A 3LSRA 5FLVA 1LFUP 5F1JA 3JRBA 5D19A 1MBFA 1MBEA 3PM1A 5IP7J 4IHWA 2FBQA 2Y31A 3KKDA 2NVXJ 1IDYA 2GFNA 3VPRA 2ELKA 2TCTA 5EEAA 2IBDA 1I50J 3JRGA 2LTPA 2Y30A 1LE8B 4A3CJ 4ME9A 2NS8A 3V78A 2CQXA 2EZLA 2LFBA 1K61A 3HOWJ 4LOCA 1XG1A 2UXIA 1JUSA 3HDDA 3HOYJ 4JX4A 5E3MA 2I10A 1FIPA 5FMPA 2W53A 1IG7A 1GT0C 3S1NJ 4ABZA 4B3AA 2DMTA 4J19A 5C3EJ 2O7OA 2ZCXA 1ETOA 5M3FJ 4GFKA 3BJBA 3BTIA 5EG0A 1BL0A 3PASA 1SANA 3RH2A 5HAWA 5FKNA 1NK2P 4Y52J 1FEXA 2XSDC 2XPWA 3K7AJ 3W6VA 4MK6A 3HTAA 4GCTA 1DU0A 4W97A 4XICA 2L7FP 2Y0SN 1IRZA 1G2HA 4RDUA 2E2HJ 3SFIA 4A3MJ 3FISA 2LR8A 4AF5A 5J1UA 2K9QA 1LE8A 3D1NI 5C4YA 2DA6A 2ME0A 1JJ8C 3S2HJ 4A3BJ 1HF0A 3ON2A 2R5ZB 1SFOJ 1GVDA 3ZQGA 1WI3A 3FKIJ 2HYTA 3BTLA 2JA5J 2IEKA 1JKRC 1ETVA 3BR0A 2G0EA 4MO7A 1JJ6C 1ZK8A 4UDSA 4M6VA 4A69C 3S1QJ 1WGXA 3NPIA 2DMQA 3BR2A 2X9DA 3CQZJ 4DZJA 4D7MA 2HOSA 2FJ1A 4A3FJ 3HOVJ 4UUSB 1VNDA 3ZQFA 2XB0X 3QKXA 5D1RA 1TWCJ 4GCKA 2R0QC 1IDZA 1UHSA 2XGCA 1UI6A 3COLA 3HB9A 3E7QA 3BNIA 2ME6A 2L7ZA 2LY9A 2QOPA 5AQCA 2QTQA 1GUUA 2QKOA 5F27A 2YU9J 4C2MJ 1TWHJ 4DYCA 1ETYA 4JNNA 1B8IB 4RBOA 2DG7A 5FJ8J 2OI8A 2X48A 1MBGA 3BHQA 3JSJA 2HYJA 3HEFA 5IP9J 3GTKJ 1MSFC 1YRNB 3BR5A 2R5ZA 1OJLA 3JRHA 3M4OJ 3MVPA 3JRDA 1RR7A 3AQSA 3JR9A 1H8AC 2HQ5A 4AYBN 1HCRA 3BQYA 2G3BA 3MKLA 4KWAA 3OSFA 1Q1VA 1ETKA 4W1UA 2M0CA 5EZHA 3ZQIA 4HKUA 2COBA 3BR1A 1UG2A 1RKTA 3A02A 3QPLA 4UUSA 2HXIA 3PPBA 1WH7A 3VW0A 2O9LA 3NRGA 3BCGA 2HOAA 1HDDC 2QCOA 3P9TA 2Q24A 2DA5A 1P7JA 4A3GJ 1K83J 1JUPA 1AHDP 2DG8A 4XIDA 1GV5A 3RZDJ 1W0UA 1ZR2A 4X1EA 3CDLA 3HE0A 4AC6A 3CWRA 4ACIA 3HTJA 3CCYA 1B8IA 1ZGWA 1OCTC 1BW6A 2XPVA 1NTCA 3IUVA 1X2NA 3LJLA 1JT0A 3S15J 3G7RA 1YRNA 1MBJA 2X6OA 4S0HB 3HBLA 3DCFA 3G56A 2XPUA 2CQQA 2DN0A 4JX5A 2MSYA 3Q0WA 5M3MJ 2VPRA 3K2AA 4D5CA 1BW5A 1APLC 4BKXA 2W48A 2JJ7A 1OCPA 2P81A 2UXUA 5J1YA 3GTJJ 3VIBA 3ZQLA 2DTZA 4FCYA 2CUEA 4GFBA 3FRQA 1U9NA 3CRJA 3RZOJ 2MGQA 3GBGA 4IEJA 2YVEA 1X2MA 2HXOA 2Y2ZA 3ZQCA 2NX4A 5EDNA 2YS9A 2JA6J 3GTOJ 5F04A 2LP0A 1ZQ3P 1U78A 4GCLA 2HOTA 2UXOA 5EGOB 2PBXA 1AU7A 2H8RA 2AHQA 3O8GA 2EZIA 3TP3A 4V2GA 2V57A 4D5FA 2VKVA 3S1RJ 5FHPA 3BT9A 3FIWA 2JK3A 4A3JJ 3CMYA 3LWJA 2H1KA 1SGMA 2M9HA 2UXHA 4BY1J 2JN6A 2QF7A 2Y9YA 2XGDA 4Y7NJ 1MBHA 2DJNA 3A03A 1A6IA 2CUFA 1AKHB 4NDLA 3DPJA 4ICHA 5JLXA 5HODA 3VUQA 5FKKA 2ZB9A 5EFYA 1VF9A 3WHBA 1LFBA 2EZKA 3MNLA 2PMZN 3GEUA 4EEFG 5K7ZA 5K7FA 1RPWA 3AQTA 1DU6A 3ANPA 1JGGA 3ON4A 1Y1VJ 1XS9A 9ANTA 1JTXA 2DA1A 4XRSA 2E2IJ 5F0FA 1ETXA 2O7TA 4FE4A 2QWTA 4MFDA 3RKQA 4C3IJ 5FKLA 3FK6A 2NVQJ 2R93J 1Z77A 4DYRA 1UI5A 3TP0A 2WUIA 2IU5A 2GM4A 5DAJA 4NELA 1F43A 2GLOA 5EGOA 1GV2A 5HBUA 1ETQA 1F36A 3I4NJ 3VVYA 3Q0UA 3S2DJ 2FQ4A 4M3FA 5IOZA 2L7MP 4MFEA 1WCMJ 3GTMJ 4MXMA 3QBMA 5E3OA 2DA2A 1IGNA 2WGBA 5IP6A 1I3QJ 2WV1A 1JKOC 1Z0XA 3VOXA 2TRTA 1AKHA 2VI6A 2L0KA 3LSGA 2ECBA 4IHXA 1ZKGA 2M2EA 2RAEA 2OERA 5M5WJ 1JKPC 3LHQA 1ORKA 5C4JJ 2R5YB 4NN1A 3O60A 5H9TA 2AO9A 2NP3A 1MH4A 2LK2A 4B4CA 1JUMA 3HOZJ 4BBSJ 5J3LA 3DEWA 4JX6A 1R9TJ 1BJZA 3VW2A 2M34A 4XRMA 4IHYA 1CQTA 5D18A 3ZQHA 1QVTA 5E3NA 2RHAA 2L9RA 2GENA 3KKCA 5F0HA 2EQRA 3Q3SA 3PO2J 1FTTA 2HKUA 3F1BA 3S5RA 1ZR4A 1IC8A 1QPIA 4BXXJ 4YZEA 3GTGJ 2OF7A 3JRAA 1ENHA 2KDZA 1MSEC 1TWAJ 5GPAA 3LNQA 5F08A 4B1RA 3QPSA 1HLVA 2LD5A 2NP5A 4G12A 1QRYA 2CRGA 2MG4A 4JP0A 1Y1WJ 4JL3A 5M5XJ 4D7NA 2N8GA 2VUMJ 2ID3A 3JREA 1FIAA 3EGQA 1WPKA 5FKOA 1UMQA 1EF4A 3HOXJ 2LLKA 3V6GA 4I76A 5EZGA 3M3YJ 1TC3C 1I6HJ 3OOUA 3IH2A 2Y9ZA 2WAQN 2R92J 2REKA 2HI3A 1X58A 3VOKA 2R5YA 5CXIA 3Q0VA 3G1LA 2ECCA 3OIOA 3B6CA 5FGLA 2CU7A 1T56A 2FX0A 2XGEA 2IAIA 2VKEA 5J1RA 4BY7J 1MH3A 4C3JJ 2XDNA 2LKXA 4CYCB 1E3OC 3KNWA 1HOMA 2WB1N 4M3EA 3B81A 2D6YA 3BG3A 1PUFB 1IV6A 1FTZA 3B6AA 1H88C 5CW8A 5C44J 2KT0A 3TEDA 3HM5A 2HDDA 4M3DA 3NNRA 2PZ9A 1XC5A 3BG5A 1TWGJ 5IPAA 4A3EJ 3BRUA 5BNGA 3JRFA 1BA5A 2XRLA 2JMWA 4C3HJ 5M5YJ 2G7SA 4FTHA 2E2JJ 5HSZA 1VI0A 3IH4A 1WH5A 2EBIA 2K9SA 2O8KA 1JTYA 3LSJA 4M3BA 2G7LA 2D5VA 4PXIA 3F0CA 1OFCX 3HIMA 4A3KJ 3NXCA 2JA7J 3H0GJ 4DW6A 2E1OA 4DZPA 4XK4A 3LOCA 1IJWC 3BR3A 5FLMJ 3H3VK 3HOUJ 2ID6A 5EF6A 3L1PA 1RESA 1FJLA 5GP9A 2NVYJ 4AUXA 2R7ZJ 1QVUA 4HNVA 4CYCA 4M3GA 5IYCJ 3LSPA 3GTLJ 3HTHA 3GTPJ 1IUFA 5F0CA 2GBYA 3RQIA 1PUFA 1NK3P 4IHVA 2G7GA 4L62A 3VVXA 3BG9A 4FE7A 1MBKA
chains in the Genus database with same CATH superfamily
1XTAA 4IJAA 1ZTRA 5CKTA 3HSRA 2VJ4A 4L0YB 3BTCA 3VP5A 2H94A 1QU3A 4PJLA 2A6TA 3BP8A 3UNGC 3OYIA 1R23A 3HKZN 2P6SA 4YFXF 2ZJRF 1R4NB 3VODA 3G71I 5GPCA 1IO2A 1FY7A 3EUPA 1ZGAA 2UUZA 3OOPA 3KZ9A 3JRIA 2IA0A 1Z7UA 2E19A 3K1PA 4IRHA 4P1WA 1OISA 3IV5A 4LIUA 2DU9A 4X6AJ 2ZCNA 4Y3OA 2V7FA 4KNYA 2MC3A 3WTVC 4KDPA 2FD5A 4ZDOA 5DD4A 1KU3A 2HEOA 2ELHA 5CVUA 1FNNA 5K58A 2JUCA 3S16J 2XGXA 5DCMA 5E8GA 3F8NA 2XAHA 2VE8A 3E7LA 3NEUA 4MIMA 3VW1A 1B72B 1J5YA 3RYRA 4I01A 2W84A 3TW6A 3MKYB 3WHCA 3ZOBA 2XDVA 4A0XA 4CYDA 3EDPA 1JKQC 3S17J 2UXPA 2IRFG 2F48A 2H27A 5TRDA 3RD3A 3BPVA 1IAWA 4G7ZF 1W7PD 4QTRA 2CMPA 3CUQB 1LPQA 3HTSB 2Z99A 2EV0A 1FOYA 5E17F 2VASA 4QLCU 1IV8A 1BOBA 3KLOA 4XMYA 2CJJA 2IJLA 2L4AA 2OZUA 3S32A 1SFKA 4XN0A 3S14J 3HPHA 2RASA 2LKSA 3BTJA 2PEXA 1L3LA 3X2QH 4G94A 1XCVA 4LGWA 1Z3YA 2K3FA 1Y6IA 4XRSG 2ZOYA 2NRAC 1S7EA 2JWTA 4MTEA 3NARA 1UHMA 3GMEA 2HYGD 3ANGA 4KN7X 2B63J 1ZN2A 3LAJA 3S8PA 3FHNA 2H6BA 4M74A 1OYYA 1JGSA 3V4GA 1B1BA 4HF0A 2DMUA 2X1CA 1LFUP 2LYCA 2QKLB 2STTA 3K1MA 3PM1A 5IP7J 2ESNA 2Y31A 3V7SA 1X1AA 2IBDA 3ASNH 4EJOA 2LTPA 1ONVA 4ME9A 2CQ7A 2X0LA 3LQRA 3IRRA 1TQMA 3ZMVA 2LFBA 3E97A 3RPUA 1MMDA 2M4KA 3D5LA 3MEXA 2KRHA 3HSFA 1D1BA 2VBZA 1LNWA 3KFWX 2XUBA 4XBFA 2W53A 2P5VA 1IG7A 1TNSA 4ABZA 3V8LA 4BH9A 2CSOA 2XAFA 2X1DA 4CUGA 1HA8A 3FZVA 5CLSA 2O7OA 2ZCXA 1ETOA 2FXAA 3GEZA 1MNDA 3AFHA 1SANA 4AVPA 5GTIC 5H20A 1OCCH 2LC2A 1TQPA 3PFYA 5KAFC 2BGCA 2IGNA 3L2QA 2GXBA 3P9CA 2ZY9A 2E7WA 3ZR8X 3KP4A 1B6AA 1DU0A 4W97A 3R61A 3ABUA 5BQTA 1V5FA 3I0TA 2Z3YA 2PLYA 1G2HA 4RDUA 5KK1A 2HPMA 3NWTA 5D5XB 3K2ZA 3BDDA 4A3MJ 1FYKA 1F1ZA 3VSKA 5J1UA 2K9QA 1LE8A 2DT7B 3ELKA 3HPGA 4A3BJ 2UV1A 5KAIC 4EV0A 1SFOJ 3TO6A 4P55A 4RGRA 3BZCA 4ZZDA 1N78A 3BTLA 2JA5J 1G3WA 2K85A 1ETVA 2F5EA 2Y48A 4KUMA 1X4OA 3EUAA 1RUOA 3BR0A 2G0EA 2K02A 1IRGA 5E1WA 3T8RA 4UDSA 3F6VA 3MCZA 4A69C 1KYWA 4BNCA 3S1QJ 2ZCWA 2FJI1 5EEGA 3BR2A 2X9DA 3CQZJ 3PSFA 3VFZA 4L5IA 1IUYA 1R22A 2YX7A 3C1DA 1KONA 3QP5A 5FD5A 3FHZA 1IDZA 1UHSA 2XGCA 1TW3A 1UI6A 3HB9A 1SVOA 3E7QA 2BZTA 3BNIA 2L7ZA 2LY9A 3H36A 4II2A 1GUUA 1V3FA 4PJJA 4A0YA 4C2MJ 5J47A 1SAXA 2FMYA 2DDBA 5D5VB 5GAEJ 3OYHA 4ZZLA 4IQJA 2M4GA 4JNNA 2DG7A 2ZMEB 4RBOA 1UZCA 2OI8A 4FHTA 1MBGA 2V26A 3BHQA 1FX7A 2MLKA 3OL3A 4J01A 1WJFA 3DU6A 5IP9J 5LGUA 3GTKJ 2VOOA 4RLFA 2LF8A 2R5ZA 3JAMZ 3GW2A 3JRHA 1O3QA 2MYSA 4CZZA 2K4JA 3C18A 2LREA 3GVAA 3JR9A 2LY1A 1H8AC 4IF4A 3KEOA 3HHGA 2QEXI 1XMKA 1Z6RA 4OOIA 4KWAA 1ULYA 3IAS2 1U5TC 5E1ZB 4W1UA 3JTGA 1UG2A 2HVSA 5B3SH 2FRHA 3EUHC 1J9IA 4UUSA 2HXIA 4L0ZB 4E7KA 2DI3A 1OKRA 3H3UA 3VW0A 3SHFA 2O9LA 2HOAA 1HDDC 2QCOA 2BOLA 4Y33A 4KICA 1KZHA 4HNUA 2DA5A 5J6XA 3A2KA 1X1BA 2VBXA 1BC8C 4B44A 4EMSA 4RMNA 1YYVA 4BEHA 1E17A 3OV8A 4X1EA 1ZR2A 1A6QA 3GCMA 2VKDA 1B8IA 2IS4A 4XM3A 1NTCA 1B59A 4EM2A 3WGIA 1HXDA 4UVCA 3HRMA 5FRNA 1QNTA 3S15J 1YRNA 1MBJA 3L2CA 3HBLA 4IHTA 1BN5A 2CQQA 3Q0WA 5M3MJ 2UWMA 3K2AA 4ZTJA 1LDJA 1APLC 4U7BA 2JJ7A 2DFHA 2P81A 5D8LB 2UXUA 3GTJJ 1FYMA 3ZQLA 2DTZA 2JRTA 4FCYA 1YS7A 2CUEA 3RTRA 1GXPA 3RZOJ 3GBGA 2RKHA 1W4MA 2EFWA 1KU7A 2NX4A 4C2TA 4KMFA 1XMAA 1J0RA 2FOWA 4G8XA 1U78A 2GA2A 4GCLA 2PBXA 3DKXA 1AU7A 3TQNA 2V57A 3TP3A 4V2GA 5JFRA 4D5FA 5CVRA 4YELA 2JK3A 1R4MB 1XCBA 3CMYA 2X1EA 3LWJA 2H1KA 3TGNA 1SGMA 3FKJA 4N9IA 1QZZA 3ZMSA 3AL0C 2QF7A 3DXJF 3TO9A 3J7AO 2Y9YA 2XGDA 1V55H 1TZLA 1D8KA 1D1CA 4ON0A 3D5SC 2HQRA 3RJPA 4DIQA 1SMYF 5JLXA 5HODA 2ISZA 1HW1A 2KDOA 1O3SA 1GHCA 3H0DA 1NG6A 2R3SA 4XKBA 2EZKA 3GEUA 3LFUA 4O6JA 1RPWA 2E1MB 2DA1A 2JQ7A 4XRSA 2QA4I 1E3HA 3QYEA 2QWTA 4MFDA 3RKQA 4C3IJ 3SWHA 2Z1DA 3TP0A 3WE2A 2L9VA 3QWLA 1G3SA 3V8KA 2R7DA 4L9NA 5E1XA 4C9YA 5EGOA 1GV2A 2JPCA 1ETQA 1S8NA 2RGVA 3M8EA 3HTUA 3Q0UA 2VE9A 3S2DJ 4M3FA 2HVQA 5ED4A 5L3EA 1P9QC 4P9FA 2ZO4A 4RB0A 4CCOA 2VOPA 5HDNA 3L2VA 3QBMA 3OWTA 3SZTA 2ZSHB 3FM5A 2A5WA 1I3QJ 2WV1A 1X4PA 4XLCA 1BIAA 1AKHA 2M2EA 2HS5A 5M5WJ 2XAGA 1JKPC 3LHQA 1I6XA 3P9KA 2R5YB 4NN1A 2CUZA 5H9TA 1MH4A 2LK2A 3HOZJ 4KYWA 1CF7B 4OIPF 2Y0SA 2FEZA 2ISYA 1FMWA 4EQQA 2M34A 2VC0A 3CTAA 4XRMA 4GYGA 4IHYA 1CQTA 5D18A 5L3FA 2LNBA 5E3NA 4OINF 1SD4A 2EPFA 2DPUA 1U5TA 1W7PB 2K27A 3ZN0A 2HDWA 1E3PA 2EQRA 2GAUA 2HKUA 5ICEA 2YVXA 3F1BA 2Q1ZB 3S5RA 3EUHA 3TO7A 5B66C 1IC8A 1QPIA 4YZEA 2V9PA 1TQIA 3BLYA 3QPTA 3KP2A 2OF7A 3JRAA 4LLNA 3GTGJ 3QAHA 2D2WA 3L7WA 2EV5A 2PJRA 4BJTA 3LNQA 3KP7A 3P9IA 4B1RA 3W6KB 2LD5A 4G12A 2A05A 1QRYA 5A2QZ 2CRGA 3E6DA 2CW8A 3SDBA 2CQKA 3SZGA 3JAMK 2ZJQF 3K4MA 1HC8A 4CGZA 4HF1A 1EF4A 2I5UA 4LLGF 3PNYA 2EFOA 2NOJB 3M3YJ 3OOUA 2DFIA 2WAQN 2HI3A 1X58A 2H1LA 5J8CA 3G1LA 1XGSA 2Z9OA 1GXQA 4K2EA 1T56A 3F22A 2KZGA 2HTSA 2XGEA 2VKEA 2Z16A 3MD2A 4EJVA 4C3JJ 5E79C 4BE2A 4CYCB 4KFCA 5HLIA 4ITVA 2E34A 4G7HF 3BG3A 1IV6A 3B6AA 1H88C 4NUBA 4AIHA 1KU9A 2VJ5A 3CUQC 2HDDA 2VQCA 4AYBA 4AM3A 3NNRA 1MMGA 3BG5A 1TWGJ 3VSLA 3JRFA 1QZEA 4PJNA 3K4CA 1IZ1A 2XRLA 2JMWA 1XD7A 3B73A 3BZ6A 4FTHA 4HZFA 4F93B 5HSZA 1VI0A 3OYGA 1XGMA 5H6QA 1Z6TA 1WH5A 2O8KA 3LSJA 2NNYA 3F0CA 2RC4A 4LIVA 2VJIA 1VQ7I 2FSWA 4CCLA 3CF5F 3BWGA 3G4SI 4DZPA 4U7DA 3DEUA 3H3VK 5HS9A 3I55I 2Q8KA 2VKHA 2X6XA 5EF6A 4Q4ZF 1MMSA 1UG0A 2UZKA 4E7LA 4AUXA 1QGPA 2R7ZJ 1QVUA 3E5XA 4M3GA 1IUFA 3KYDB 2D1VA 2XAJA 3HHHA 3KZYA 1PUFA 4PDKA 3RKWA 4L62A 1OPCA 3I4PA 2IW5A 2ZBKA 3BG9A 2Q2EB 2KL4A 1MNEA 5FGMA 1RUNA 5FFZA 5IYDJ 2COMA 2XSJC 2DA4A 3MZHA 2FF4A 3HSEA 1SVMA 2HR3A 2RREA 3P5JA 3F8CA 4XRFA 2BEOA 1YIJI 2L7KA 3ZMZA 1R6RA 3TOAA 2W00A 3OYFA 3OYKA 3GYHX 4JKZA 2EIKH 5E3LA 1Y0UA 2V1DA 1P4AA 2QUFA 5F64A 2ZCMA 4CO8A 1MIJA 2DOFA 2JVHA 3EETA 3PO3J 4A3LJ 1E2XA 1R7JA 5IYBJ 3G73A 5K1YA 2NOGA 2LVSA 3V42A 5IT3A 2LSOA 4JYKA 2V4JC 3HRTA 3G1OA 3D5RC 4HQMA 2HKOA 4OIOF 3HOTA 4I6ZA 3GFIA 1ZLKA 1KQ9A 3HTIA 5IOYA 3FX3A 1I39A 3CCVI 2DK8A 3HGGA 1N75A 2YUSA 1IW7F 1RI7A 4UY8I 2DA3A 1KQ0A 1YIOA 1JHHA 5DS9A 3UR3C 4OAZA 2JPBA 4EJWA 1BC7C 1ITYA 4PJ0C 2YVHA 1D0XA 1WSUA 1RKWA 4L9JA 1IXCA 3ONQA 4U88A 2LY2A 4R79A 3C07A 1D1AA 1FZPB 3HC7A 2DOAA 1Z3XA 4IKFA 1FBQA 4BQQA 2W4SA 3DPTA 5C4XJ 5FKMA 2M8EA 3WTUC 4MLOA 3L2RA 1PP7U 1K79A 3O8HA 1XSDA 4E7ZA 1YS6A 1XGNA 2BW3B 3K4NA 4DQ2A 3QQAA 3IAM2 3OYLA 4F92B 2L9SA 3F21A 3T6NA 4BJ6C 5GAGJ 3PUFA 1WJCA 5CXGA 2MH2A 3IH3A 1HQCA 3ERED 1EJ9A 2W1OA 5EG0B 2OTJI 1JT6A 2K9NA 4MEXF 4HX8A 1B72A 4A3DJ 4UB6C 3FWEA 3CP2A 3J7AY 3CCSI 2RQQA 3LSRA 2ZMEC 2W24A 2J5OA 5F1JA 5D19A 1VQKI 1MBEA 4U0YA 4XR6A 4IHWA 2FBQA 2NVXJ 3CUQA 1K78B 2GFNA 3I54A 3VPRA 1QQIA 5H2FC 3IRQA 1I50J 2K7LA 4A3CJ 5FFXA 3WGGA 4RB1A 3V78A 1KA8A 2OJED 1T39A 4FT8A 1J75A 2IT0A 1OR7C 1SEUA 2CFXA 3O3KA 2CFOA 4HW0A 2GXAA 3I71A 2HQAA 3VB2A 3HOWJ 3EYIA 3HDDA 1DP3A 5E18F 3BJOA 2CH0A 1Y8RB 4O5VA 3W2VA 3L2UA 1GT0C 3S1NJ 4CSWA 5JVGF 4IX7A 2DMTA 1NG7A 4J19A 2DDAA 1TW2A 1WFXA 2ZSIB 2F5FA 4GFKA 3BJBA 3BTIA 2JTVA 1TLHB 1JHFA 3U9GA 3PASA 2BVLA 5HAWA 2DQLA 4DOZA 2XSDC 4LFUA 4F91B 4MK6A 4G6DA 4HV6A 5KHDA 3RSNA 4GCTA 2XIGA 3PIOF 4YFKF 4BYYA 4XICA 1DUXC 1P4XA 2MABA 2O3FA 1UCRA 3LMMA 4GXOA 1G4DA 2VONA 2CWEA 3FISA 3BZKA 5JI6A 3D1NI 2DA6A 1JJ8C 3S2HJ 3WODF 3CCEI 3CO7C 2ZKZA 3WTTC 1GVDA 4PUSA 1FP1D 2EA2A 4QWQA 3ZQGA 2CYYA 4ENKA 2CV1A 5LGNA 3DP7A 4HNTA 1M1EB 2VT3A 4MO7A 1JJ6C 3FDYA 1LFPA 3GFLA 1ZELA 3BC8A 2HOSA 2M87A 2BHYA 2EFPA 3F8FA 3HIFA 1L0OC 3CCQI 4B09A 3RIRA 2CO5A 2RN7A 3H92A 2WWYA 3FXUA 1IF1A 1FP2A 3WTWC 2CG4A 5AQCA 2QOPA 2VBWA 1LB2A 1S9HA 3M1CA 2QKOA 2QSGX 2P7CB 2RQPA 1BR4A 3TMOA 1K6OA 3F9KA 1OCZH 1TWHJ 4IXAA 4L9VA 1HKSA 4OMZA 1X3UA 3HEFA 1YW7A 4XQFA 3OIPA 3QU6A 2P6TA 3CMMA 3HYIA 4HG2A 1BOAA 3C2GA 1I1SA 4PGHA 4N0BA 1G59A 1AOYA 1B4AA 3JW4A 3MVPA 3CMEI 1RR7A 2VT2A 5HNFA 2E1MC 2HQ5A 3ECOA 3BQYA 3ZXSA 2FOKA 3MKLA 1Q1VA 2PFBA 3ABTA 2YX4A 1FYLA 1OCOH 3GF2A 2M0CA 1VQMI 2VQLA 3HKZA 3ZQIA 1BI2A 2COBA 3BR1A 3VOEA 1RKTA 3QPLA 1TTYA 2X4HA 4HLXA 3ZN1A 3HUGB 3PSIA 2M0MA 2FBKA 4HOBA 4CZCA 1WH7A 4ENJA 2A6HF 2Q24A 5DM6F 2DFEA 1SD5A 2MH9A 2OCEA 5F1RA 4BE0A 3ROUA 2CS3A 2K9LA 2LF7A 2VPLA 4MHGA 3WU2C 1EKEA 3HE0A 3RZDJ 2OUMA 3Q9SA 4RB2C 4KITB 2P5KA 4ACIA 5HLHA 2XROA 2ZMEA 1ZGWA 1OCTC 1BW6A 4IO9F 4EATA 1U6GA 1YI2I 3LJLA 2AQEA 1Y8QB 3PNVA 2QVOA 3ERMA 3G56A 3DCFA 2H09A 4RGSA 1P2FA 4JX5A 3PFIA 3K0LA 4P5OA 1OR7A 1QZYA 5DEQA 3JSPA 1BW5A 5IT9Z 3WTXC 4LG3A 4BKXA 1WJBA 1SVLA 2FNPA 3DF8A 2LOOA 1VTNC 3S93A 1S7OA 3KP3A 5LHGA 4ENNA 1IXRC 3FRQA 2L2OA 3CRJA 3DTKA 2XF5A 2PX9A 1IRXA 2OCCH 2HXOA 1WJ5A 2VJJA 4A12A 2OV7A 3DKWA 5IY5H 5EDNA 2YS9A 2OZ6A 3G6EI 5L3BA 2YPRA 1J7KA 3WU0A 2F4MB 3O8GA 2HZTA 2VKVA 1FMVA 2X85A 3BT9A 4NBQA 4NQWB 3HOSA 4Y7NJ 4WX9A 2O03A 1YJ9I 2DJNA 2E1NA 4FQGA 1VQ9I 5L3GA 1A6IA 4CHUA 1S7AA 3I58A 4R8HA 3DPJA 4HQEA 4BQOA 1WHUA 3VUQA 5EFYA 2BV6A 2FA5A 1VQNI 3E5UA 2PMZN 2A5YB 4EEFG 5K7ZA 1XSXA 5K7FA 3RPQA 1USSA 1DU6A 1JGGA 3OR1C 2ZXHA 4IRVA 1S29A 2DOEA 1U8RA 4KMUX 4D1QA 3I59B 4DNCA 3DLLF 4UB8C 3ECHA 2NVQJ 4DYRA 2R93J 4DGWB 1UI5A 2WUIA 3T0YA 2GM4A 2TDXA 1QO0D 4BL0B 1F43A 3MZYA 2GLOA 3J7YJ 2FNAA 3K4BA 2K5CA 5ILUA 2LG4A 2V1XA 5HBUA 1F36A 2J5PA 2O8XA 4LK1F 1I1GA 2AXTC 4RS8A 4WIBA 2V9VA 5J4VA 1ZG5A 3GTMJ 3L09A 1IN8A 2LH9A 2F4IA 2RNGA 4HSRA 1IXSB 1X1DA 2BHZA 5IP6A 2O5RA 5LHHA 3VOXA 2TRTA 1W36D 3CZ6A 4IHXA 3NS4A 3TL4X 2FQ3A 2ZFWA 1ZRDA 3LSKA 1ORKA 3F23A 1WQ2A 3O60A 1WJAA 2WAEA 2NP3A 3AG4H 1JUMA 4HLYA 2R7FA 1F5TA 1Z7LA 2QLZA 4BHBA 1KU2A 1OMIA 3KYCB 2OC6A 2KRFA 3BPXA 3C3WA 3Q3SA 1FTTA 3ZMDA 4ASNA 4S04A 2EINH 4F3QA 4U9NA 3K6GA 2KISA 2C6YA 1ENHA 5BPIA 3SQNA 2KDZA 1VQ4I 2JSPA 5FD6A 2GZWA 1TWAJ 2BXYA 3CCLI 3CESA 4UVBA 3QPSA 3H9JA 1JE8A 2OQGA 2IPQX 2MG4A 4M6XA 2CGPA 2HU9A 2JZYA 4ZYEA 3MKWB 5BMZA 2N8GA 4RGXA 3Q5FA 4BQAA 1FBSA 3ZQQA 2CW7A 3JREA 2PFVA 2DCEA 1WPKA 4M72A 3OY9A 1YLFA 5FKOA 4OIRF 4I76A 5EZGA 2M7AA 2V79A 3KZIC 1W1WE 1FOWA 3VOKA 1K6YA 2D1HA 2R5YA 3Q0VA 1S5LC 2VIXA 3OIOA 4M71A 5K5OA 3GZ6A 2P7VB 1CF7A 1XDUA 3S3MA 3EYYA 2IAIA 2B1EA 1HW5A 4BY7J 3H5RA 3EPZA 4YFNF 2KIFA 2LKXA 2XDNA 1HOMA 2WB1N 4Q5SF 1W7PA 4Z2YA 4CDGA 2O6GE 1VZ0A 3OYBA 3GLLA 4M3DA 4HX4A 1XC5A 1O3TA 1IN7A 1BR2A 1ZRFA 2G7UA 4E7SA 1U0JA 1BA5A 4J00A 5M5YJ 1UFMA 1VQPI 1Z67A 3OYJA 3PQJA 2EBIA 2G7LA 4M3BA 3J81Z 1ZYRF 4N9HA 3OYMA 5J40A 4NC8A 1MW7A 3CC2I 4A3KJ 2FBHA 3OR2C 1WI9A 3H0GJ 5FRMA 2BXZA 4XLPF 1ZHFA 3BR3A 5IT9K 5J8FA 3HOUJ 4CCJA 4BAYA 1RESA 1R1VA 5DDGA 1FJLA 2LDUA 3CMAI 2PG4A 2A3SA 4CYCA 2ZNYA 3DBRB 2EFNA 2ZXIA 3R6SA 2GBYA 4IRIA 4IHVA 3JSOA 1SFXA 1MDMB 3L00A 1MBKA 5HS8A 2QKMB 1G3TA 1YX5A 3I56I 4QSHA 2K40A 1X19A 1MNMC 1A36A 2FUG2 3MKZA 5B5EC 1D3YA 2WY8Q 3SYTA 1RETA 2ZXWH 1O4XA 4A3IJ 1O7LA 1EV7A 2HYFA 4A93J 4EGYA 3H35A 3GZ5A 4YIRX 3SEQA 5CVJA 2X51A 1A5JA 4O3MA 3ZGKA 3IUOA 5B1BH 4Y13A 4B43A 4B8XA 5K5RA 3BG7A 5FO5A 2Z2SB 2BY0A 1QHHD 2YU3A 3Q9VA 1ZARA 3LQQA 2JVGA 1N77A 2OA4A 3S3OA 3A01B 4MGRA 1K4TA 2M45A 4H4KC 4V2FA 5ICCA 2XAQA 3LA7A 3JRCA 3P7NA 1XN7A 2XF6A 4B47A 2KRCA 1AWCA 5HDKA 4XN3A 4DYQA 5DUIA 2Q2EA 4WXHA 3UKGA 3BQZA 3QOPA 3F72A 5K7HA 3C2BA 3CJDA 3OSGA 3NI7A 4DBQA 4ZYGA 4P9UA 5F6FA 1ETWA 3A4CA 5ILVA 1W0TA 4ENMA 2DMNA 3S1MJ 4KN4X 3WE3A 5FROA 1K7AA 2HTJA 1DGRM 3KP6A 2I8DA 3U2RA 4LG0B 4EJTA 2LMDA 5FLXZ 3ZMTA 1Y56A 4LJZF 5JLWA 1U8BA 4HRIA 5TISC 2B3WA 4FISA 4GFLA 1OQYA 3DV8A 3FK7A 4II3A 4IHSA 3DTEA 4M6YA 4EJUA 3L9FA 3PNTA 5AONA 3BCBA 5EJCA 2R7SA 1LEBA 3VYUB 4ZDLA 5CJ9A 3CO6C 2B9SA 3I4MJ 3GZIA 4TV7A 5EYRA 4HDUA 1BR1A 3CDHA 3ZRGA 1RRJA 2WADA 5J4YA 1DGWY 3KZZA 3R0JA 2KLOA 5D5UB 3ZQ7A 1W5TA 3WG9A 3KKDA 2XKOA 1ON1A 1IDYA 2DXIA 3KIOA 2TCTA 1ZGJA 4ZYHA 3JRGA 1J2XA 1MMNA 4CCNA 2CQXA 3K1NA 4LMYA 1FBUA 4UXNA 3U21A 3QRFF 3O2PE 2UXIA 3AG1H 3CJNA 2IS6A 3ABLH 2BW3A 5FMPA 5CYVA 3LAPA 5KNLA 2HGCA 4B3AA 5ERIA 4ZTFA 5CVIA 3F8MA 5C3EJ 2VQGA 3A0BC 3WGHA 2HNHA 5M3FJ 2EWNA 5EG0A 1BL0A 4PFOA 1NK2P 1V54H 4C2MA 2M5WA 3K7AJ 3W6VA 2H6CA 2WAQA 3PL8A 1LVAA 2XV4S 4I09A 1BI1A 4WK8F 1XB4A 2OQRA 3H9QA 3BJAA 1HKQA 1IRZA 3IWFA 1K78A 1LDDA 3SFIA 4MTDA 3J81K 4CCKA 5HOOA 2W57A 1W5SA 2VC1A 5C4YA 1HF0A 2EK5A 1HBXG 1WI3A 3SFZA 3SXYA 1JKRC 4HF2A 1T95A 4G7OF 4D9JA 1PP8F 2KIQA 3U1DA 2HFHA 4M6VA 3ZPLA 5H6RA 1WGXA 3K9TA 2BE5F 4DZJA 2IGOA 2QZ8A 2FJ1A 1MGTA 1SD7A 3HOVJ 3D0SA 3U1KA 2BY2A 1UELB 2WY7Q 5GAHJ 2Y0MA 5LFAA 4E7HA 1Q1HA 2WV0A 3W2WA 1ZH5A 3V7CA 5D4RA 2GWRA 1T38A 3COLA 1IN5A 4IQ4A 3HL2A 1FSHA 2IP2A 2F5CA 5BPDA 3OIQA 4OMYA 4L18B 3FXJA 2YU9J 2DODA 4DYCA 4HX7A 4RLQA 3ESWB 5FJ8J 4A5NA 2HYJA 3W6JB 1R5HA 1ZG3A 2KIUA 3BR5A 2V9KA 4NC6A 4NB5A 2R7RA 2NNNA 2R7QA 3JRDA 3AQSA 1X3ZB 5GADJ 2L01A 1U2WA 4XONA 1WKMA 1T2KA 4A0ZA 3OSFA 1GVJA 1BM9A 1ETKA 4HKUA 3S3NA 4MQVA 3RPUD 4LD5A 4XKWA 2VB6A 1ON2A 3QYBA 2NVUB 3PPBA 1NH3A 3NRGA 3K8PC 3P9TA 3C7JA 3KLNA 2YSRA 2QM3A 3K70D 4A3GJ 2W82A 1K83J 1JUPA 2IVMA 4IRGA 3V7RA 1FLIA 1AHDP 4GGGA 5AIPA 2DJIA 2DG8A 4XIDA 2EFQA 3SEZA 1YX3A 4U9LA 3S2WA 4OAYA 1LVKA 2E35A 2IXSA 1G6NA 4EGZA 3CCYA 3OYNA 1DDNA 1S3JA 4FETA 2VODA 3TBIA 2P0WA 5A2QK 1FT9A 4I99C 1RR8C 3ML6A 2Z5UA 3ABMH 4YIFA 1O3RA 2JUGA 2DT5A 2BY1A 2RNJA 4XKCA 5KVRA 5D8KB 1BJAA 5FLXK 4MQ9F 1UAAA 1A04A 1T0FC 2XVCA 1D0YA 2VPRA 4D5CA 3GXOA 4Y17A 3E6MA 3M07A 4YEJA 1NHAA 4FASD 1OYIA 3VIBA 4F52A 3W2AA 3VTIA 3HUGA 4IEJA 1OLTA 4ZJZA 3I53A 1LQ1A 2QQBA 4ZC3A 1R5ID 3DLAA 3HTHA 3K4JA 1DQUA 1H0MA 2JA6J 5F04A 2LP0A 3GTOJ 2XF7A 4KT6A 1TBXA 3N05A 5TJJA 2DT6A 1VQOI 2EZIA 3KPHA 4RGUA 5TGTA 2B0LA 1XX5A 3S1RJ 3CJRB 3VYTB 3R0AA 3ULQB 4A3JJ 4ANJA 2XC7A 2M9HA 2XASA 4A5MA 5HLTA 3DWLE 2HVRA 4BY1J 1MBHA 3K70C 3PJRA 1VQ6I 3A0HC 4IZZA 2CUFA 3RYPA 2QWWA 4ESBA 1ZG1A 2ZB9A 2PMHA 3BCAA 1VF9A 1MJBA 3WHBA 3CC4I 2F6CA 4NNJA 1SFEA 3CLOA 5LBQA 2VBYA 2EILH 4GRIA 2KZVA 4XLEA 3ANPA 2GA1A 1Y1VJ 1P6RA 2XAUA 4ZYAA 3MAJA 1XS9A 1FC3A 1S6LA 2A61A 5DV5A 4XOTA 2OU2A 1ETXA 2O7TA 2CQNA 4FE4A 4NC7A 3H5AA 5FKLA 3FK6A 1Z77A 1WJDA 4PJMA 2IU5A 2R7WA 5DAJA 4RM3A 3FMRA 5B1AH 3F3XA 4ESJA 1KYZA 3JTHA 3QODA 4HYEA 4E4HA 1YJNI 3VVYA 3I4NJ 3GFMA 2EJRA 5IOZA 2FMLA 2MD0A 4BS9A 2L7MP 3KCCA 3OMYA 3CCRI 4ETSA 1TP4A 4NQWA 5LGTA 2WA0A 2WGBA 1JKOC 3I9V2 2QBYB 2VI6A 2ECBA 1ZKGA 2Y75A 4N4NB 2L54A 5HDGA 5ILSA 1R49A 1CGPA 2QQ8A 2OBPA 5LRRA 1QHGA 1FWZA 5C4JJ 2E5ZA 2LBFB 4ZYDA 1YHQI 1WZ2A 2AO9A 3FF5A 5J3LA 4JX6A 2O0YA 1BJZA 3LA3A 4PFPA 2R7OA 4YG2F 1QVTA 3WTSC 2E36A 3I59A 4A6DA 2FE3A 2RHAA 2GENA 1G8XA 4DVYP 2GQQA 2QSFX 1F9NA 1J59A 1RIOH 1ZR4A 1YW8A 2K9MA 2E5NA 3FXRA 4KIBA 3J80Z 5GPAA 4I7HA 1VQ5I 1JXSA 5L3CA 1YFHA 1Z91A 1XSVA 1Y1WJ 4JL3A 3EUKL 5M5XJ 4BHCA 4OIQF 5LLQA 2VUMJ 3LSMA 1MZBA 1ZAOA 2XHKA 3BY6A 4M73A 4R1HA 3TDZC 2A69F 3K69A 3H5NA 2R92J 3F8BA 1BBYA 1HKTA 5CXIA 4GO1A 2CV2A 3B6CA 5FGLA 4C2UA 3GFJA 1T98A 2A2FX 3FMQA 1T0FA 5J1RA 1XMXA 4BXFA 6PAXA 1W5CC 1T8IA 2BY3A 3KNWA 1LEAA 4EM1A 3GZNB 2F4OB 2IGMA 2M30A 2DTRA 4M3EA 2IGKA 5D4SA 3B81A 5K5QA 2X6YA 2IS1A 5CW8A 5C44J 2KT0A 3TEDA 3ABKH 3T8TA 1MJAA 1O7FA 2KJBA 1J09A 2M1BA 1I3AA 5IPAA 3BRUA 2MD5A 3RQ4A 2KPMA 3QPHA 4YIIA 3PIPF 3KYLA 2JRMA 1ERDA 2HKXA 1YG2A 3WU1B 3FBIB 2H8WA 2G7SA 2E2JJ 3I5UA 4RAZA 2X6WA 3IH4A 1ZREA 4V19K 3MMYB 1JTYA 1EH8A 2ESHA 2D5VA 4PXIA 2JSCA 3HIMA 2A6EF 4RAYA 3LL7A 4IPAA 4HEA2 4DW6A 1WVRA 3CJTB 3LOCA 1XPXA 5ICFA 2ID6A 3E5QA 1PUEE 3BROA 3IP4B 4EVIA 2DW4A 4BQNA 3L1PA 5LHIA 5GP9A 1Z05A 2FU4A 3BJ6A 4U0WA 2A07F 4HNVA 5DCMB 3FXLA 4L5JA 5IYCJ 4WCGA 3LFKA 3LSPA 4RM2A 1TT0A 4RAGA 4WXDA 4IOCF 2CUJA 2E1CA 2UXNA 3VDXA 2HZDA 3BR6A 1R00A 3FMSA 1Z9CA 2YR2A 4U87A 3GWZA 5DTDA 4Q48A 3SDGA 1PJRA 1PYVA 2PMUA 3QP6A 1IRFA 4UUTA 3KETA 3KX2A 2L9NA 3TW7A 1MD0A 1U9OA 4ESFA 2EH3A 4BHPA 4UNOA 3W3CA 4AU7A 1GDTA 1QPMA 4BBRJ 2F07A 2VXZA 4Z6YA 1P4WA 2WTEA 4Y4RA 2PJPA 4X0GA 1Z21A 4F7ZA 2ZXJA 5D5WB 4OU0A 3HXLA 1YOVB 2RVCA 3SZPA 3LA2A 3GTQJ 2ACJA 5DUKA 2K86A 1FOKA 3G1MA 3OS0A 2EV6A 3KE2A 1P7IA 4N4OB 2W7NA 1U3EM 4XORA 3NAUA 1R71A 1X1CA 1R5GA 1MDMA 2MC4A 2MW8A 2PMZA 3MN2A 4L5EA 4ZH4F 2ETHA 3RDIA 1HDPA 4QIWN 2DA7A 3PQKA 4BU2A 1STZA 2L4MA 1D5YA 4AD9A 3FBNB 4WF2A 1X3WB 2NS7A 2Q0OA 2WBMA 3IHUA 3OYDA 5DD8A 2GUHA 3OYAA 2XB5A 4BDYA 2QIBA 2LKPA 2OPTA 3AG2H 3OS2A 3SJMA 1VFCA 1FOXA 2NXNB 4A2UA 1D5VA 4AIJA 1TWFJ 3VVZA 2ZOZA 4LITA 1RZ4A 3GLXA 3RKXA 2M8GX 5E8IA 3CCMI 1H89C 4A6EA 5DCFA 3NRVA 4CGRA 2HPIA 1D8JA 4F55A 2M7BA 3DBLB 4KISA 2EZHA 5FB2A 2V1NA 5JHUA 2NVTJ 1POGA 3LSIA 3A01A 2RV8A 1EH7A 2DPDA 2JA8J 3HGYA 1KQ8A 1W36C 3E6BA 2W85A 2MBFA 1O57A 5CQEA 4UV8A 3JCUC 4L9TA 2DMPA 2R7UA 1R1UA 4AC0A 1T33A 1Y0NA 5FLVA 2XRNA 3MQ0A 5BS6A 3M1EA 3J80K 3JRBA 1SC7A 2DBBA 2P4WA 1KGSA 1MBFA 4M9SA 4XLAA 4OD4A 3IKTA 3QU3A 2GXGA 4E6KG 1ACIA 2DK5A 4AIKA 2ELKA 3BOQA 5EEAA 2Y30A 1LE8B 4PZJA 3CJQB 2NS8A 3RI4A 1D0ZA 1YE9A 2EZLA 4QPQA 4XLNF 1K61A 2V1UA 4LOCA 1XG1A 1JUSA 4LG0A 3M8FA 4U0VA 4CICA 4HSTA 3HOYJ 4JX4A 5E3MA 3COAC 2I10A 1FIPA 1UB9A 4BDZA 2R7VA 4KA4A 2ZNZA 1ODDA 1R36A 3IC7A 2GOXB 5D6EA 3K4LA 2IA1A 2KJCA 2DAOA 1ZLJA 3RH2A 4KIGA 4HBLA 5FKNA 2KIMA 4Y52J 1FEXA 2XPWA 1JI8A 5EEHA 2KQRA 3HTAA 2EIMH 3FXMA 2LRDA 2GIZA 3CD6I 1UJ8A 4E7JA 2L7FP 3FXOA 2Y0SN 2IS2A 3KP5A 2E2HJ 4CA0A 2LR8A 1R58A 3DPUA 4RAFA 4AF5A 2WB1A 2ME0A 4M9XA 2QGUA 1F4KA 1BI3A 3ON2A 2ADUA 2R5ZB 2D45A 3ZMUA 2M3AA 3FKIJ 4WXCA 4BUPA 4XKVA 2IEKA 1ZRCA 4C30A 2HYTA 1EA3A 3OS1A 2CV0A 1ZK8A 4LB5A 3VWBA 2DMQA 1A31A 3NPIA 3REOA 5BOXA 2ICWG 4D7MA 1K4SA 1IN4A 3QOEA 4A3FJ 4UUSB 1VNDA 2WAFA 2XB0X 3ZQFA 3H3ZA 3CCUI 4XOPA 3QKXA 3VEPA 5D1RA 3GO5A 3AAFA 1TWCJ 3CF2A 4HAMA 5AIQA 4GCKA 2R0QC 1BIBA 1SMTA 3NWSA 5DYMA 2W25A 2DLLA 4CH7A 2ME6A 5LRSA 2QTQA 3DEEA 4PSXA 3CC7I 3A1YA 3F6OA 3MWMA 5F27A 1REPC 4PCQA 3M7GA 3WTZA 2ZJPF 4BEHB 3TOBA 3G3ZA 2QQ9A 1B9MA 1ETYA 2MLGA 1B8IB 2OAZA 2X48A 3JSJA 4IL6C 1C0WA 3DQVC 4GYIA 4UUVA 1X1PA 1MSFC 1YRNB 4D0PA 1OJLA 3I64A 3M4OJ 5JHFA 2GIVA 1N25A 4LK0F 1G3YA 1OCRH 4BACA 1YO5C 2V6CA 2HDCA 4FX4A 3ASOH 4AYBN 1HCRA 2G3BA 1LUJB 1TL8A 2QYOA 3FXQA 5GTHC 1DPRA 4XLHA 5EZHA 4UVAA 3R4KA 1H9TA 2BBYA 3A02A 3ZP5A 1Y39A 3HRSA 2G9WA 2VXDA 3K10A 4RB3C 1RNLA 3K4KA 4IOAF 5LD2C 4I0BA 3BCGA 3KEYA 2KMUA 2AS5F 2DQRA 3CDIA 1P7JA 1FPQA 1MKMA 2F5VA 3VYSB 3VYRB 1SFUA 4RA2A 3WTYC 3OYEA 1GV5A 1W0UA 4AC6A 4CCMA 3CDLA 3CWRA 4HV5A 3HTJA 4BE1A 4PK4A 5D6FA 3J7ZI 2XPVA 1H9GA 1LJ9A 2KKOA 3CUOA 5CPRB 3IUVA 1X2NA 1JT0A 2FBIA 1E0EA 3G7RA 2OTLI 3H9GA 2X6OA 5KCMA 4S0HB 4EM0B 2XPUA 4Q47A 2DN0A 5HS7A 1DP7P 1USTA 2MSYA 3R60A 4S05A 4BXUA 2W48A 3CLQA 1YJWI 1OCPA 3CP8A 5J1YA 4YRVA 2PI0A 2KFDA 1UHWA 4XNFA 4E70A 4GFBA 1U9NA 1T6SA 2Z33A 1LKXA 1PVEA 2MGQA 4LB6B 2YVEA 4H0EA 1S72I 4PSWA 1X2MA 4IVNA 1PDNC 3IWZA 4MNUA 4GDFA 2Y2ZA 2ZJ2A 3ZQCA 2BVMA 4OD5A 3HZJA 4JQFA 1ZQ3P 2HOTA 2UXOA 2E71A 5EGOB 5JVTA 2H8RA 2AHQA 1V5EA 4XL9A 5FHPA 1YW9A 3FIWA 3DKYA 3NQOA 3V8JA 5HVQC 2UXHA 2DYSH 2JN6A 2GOMA 3DU5A 3HG9A 2JA2A 3A03A 3OL4A 4B3XA 1AKHB 4NDLA 4ICHA 2AXLA 3GUDA 2O61A 5FKKA 1XDSA 4I98B 1LFBA 3MNLA 1R1TA 2VQHA 4DBRA 4XLFA 3AQTA 3ON4A 4WWCA 1HSJA 2L5QA 3ISPA 9ANTA 1JTXA 3G2BA 2PQ8A 4G6QA 2E2IJ 5F0FA 4G6TB 2DO7A 2P5LC 1U5TB 4AIDA 2L3DA 3M8JA 3E0JB 4B48A 4Y15A 3DPLC 4DJAA 4NELA 1MJ9A 3LWFA 2E60A 3TDUC 2E7XA 4HA8A 2PJRB 3CCJI 3N4MA 3DTIA 2FQ4A 2QSHX 4G9YA 1IN6A 2B7EA 4MFEA 1WCMJ 1V5GA 2XKPA 4MXMA 2Y69H 2R7TA 5HLGA 5E3OA 1HSTA 2DA2A 3FXKA 1IGNA 3E6CC 3T5XA 1WRJA 3GX4X 2EB7A 1Z0XA 3ZCOA 4GCVA 3AKZA 2L0KA 3LSGA 2RAEA 3RCOA 2R4GA 2OERA 2BYVE 4XSXF 4PGGA 1TNTA 1HW2A 2OD5A 4AWXB 3C2HA 2AQFA 2NYXA 2VL8A 5LEKA 1A35A 2DYRH 3MFKA 5LEJA 4B4CA 2NS0A 1VQ8I 5JR3A 2HOEA 4KIFA 4BBSJ 3BG6A 3DEWA 3PUBA 5L3DA 1R9TJ 3VW2A 5CQGA 2IA2A 4KT5C 3L2WA 4FX0A 3ZQHA 2RDPA 2PN6A 3AG3H 2L9RA 1WWXA 2P8TA 1DPUA 3KKCA 5F0HA 2V6EA 3PO2J 3LSTA 5CVVA 5DM7F 4BXXJ 1SD6A 1QBJA 2F5DA 3HJEA 4LLLA 3TKYA 1MSEC 3B02A 3RKYA 2QENA 5F08A 1VQLI 1Z1DA 2F2EA 5HNHA 1HLVA 1LDKB 3QYFA 2NP5A 2L02A 1QA6A 2ZC2A 4JP0A 2ELJA 4I02A 4ZDPA 3HRUA 4I0AA 4D7NA 2ID3A 3DBHB 1FIAA 3EGQA 3E1SA 2EA4A 1UMQA 2DFFA 4BJ5C 2QBYA 3AL0B 3HOXJ 2LLKA 3V6GA 2STWA 1TC3C 1I6HJ 2Y9ZA 3IH2A 2REKA 1I5ZA 1V4RA 2QQAA 1P92A 2LBFA 3O6BB 2ECCA 2CW0F 1WJEA 2CU7A 2FX0A 2A68F 2VLAA 2HQNA 4HDVA 3WG7H 3KEQA 1XGOA 1MH3A 1I27A 2KP6A 1E3OC 3H1CA 1BI0A 4QPOA 1MMAA 4UHTA 1RC9A 1EH6A 1SAUA 2D6YA 4MEYF 2K3PA 3FM3A 1PUFB 2EIJH 1FTZA 1YTYA 3HM5A 4JBAA 4XSZF 4BGDA 3DFGA 4JK1X 2PZ9A 3N97A 4A3EJ 3IL2A 5BNGA 1YQAA 3LSHA 2PBIA 4UV9A 5E20A 4C3HJ 4OWRB 1TT5B 2K4BA 3IKVA 2NAZA 2K9SA 2R7XA 3MZ8A 3I3LA 4HPQA 1OFCX 1B9NA 2UXXA 3EQLF 1FSEA 4KJZA 1YITI 3NXCA 1OYWA 2JA7J 4JOMA 4I2OA 2WC2A 2E1OA 4XK4A 4AVZA 3M9AA 4E7IA 2JT1A 1IJWC 2HWVA 5FLMJ 4CXFA 2MFZA 2ZFUA 4M9ZA 1T08B 4NHJA 2NVYJ 3OYCA 1AA7A 5ICGA 3GTLJ 1GLNA 2KHMA 3GTPJ 3E3VA 5F0CA 2G7HA 3RQIA 2G7GA 1NK3P 3T1BA 3VVXA 4FE7A 4P96A 2MA3A 2VN2A
chains in the Genus database with same CATH topology
1ZTRA 5IYDJ 3BR6A 3BTCA 2DA4A 4QSHA 2K40A 3VP5A 1MNMC 5DTDA 3SDGA 3HKZN 1RETA 4UUTA 1O4XA 3TW7A 5GPCA 1U9OA 4A3IJ 2EH3A 4A93J 3EUPA 3KZ9A 4JKZA 5E3LA 3JRIA 2ZCMA 1GDTA 2E19A 4BBRJ 1A5JA 2F07A 4A3LJ 3PO3J 3IV5A 5IYBJ 4X6AJ 2NOGA 2LVSA 2ZCNA 4JYKA 3G1OA 3GTQJ 2FD5A 4I6ZA 5K58A 3G1MA 3A01B 3S16J 3HTIA 5IOYA 3HGGA 3VW1A 2YUSA 3E7LA 4MIMA 4V2FA 1B72B 3JRCA 1P7IA 2DA3A 3TW6A 3NAUA 3WHCA 3ZOBA 5DS9A 1JKQC 3S17J 2UXPA 4DYQA 1ITYA 2YVHA 1RKWA 3MN2A 4L5EA 2MW8A 3BQZA 5K7HA 3C2BA 3UKGA 3CJDA 3OSGA 3RD3A 3NI7A 1HDPA 4QIWN 2DA7A 1D5YA 3C07A 4QTRA 1ETWA 2NS7A 1W0TA 2GUHA 2DMNA 3S1MJ 2XB5A 2QIBA 5C4XJ 2OPTA 2CJJA 5FKMA 3SJMA 1VFCA 4MLOA 3S14J 3VVZA 1TWFJ 3O8HA 2ZOZA 2RASA 1H89C 2M8GX 3BTJA 4GFLA 3QQAA 5JLWA 1U8BA 4FISA 4CGRA 4XRSG 2ZOYA 3FK7A 3T6NA 1S7EA 2JWTA 3NARA 5CXGA 3ANGA 2EZHA 3IH3A 2B63J 2NVTJ 1POGA 3A01A 5EG0B 3I4MJ 3GZIA 2JA8J 3HGYA 1JT6A 2K9NA 5EYRA 1B72A 4A3DJ 2DMPA 4AC0A 2DMUA 1T33A 3LSRA 5FLVA 1LFUP 5F1JA 3JRBA 5D19A 1MBFA 1MBEA 3PM1A 5IP7J 4IHWA 2FBQA 2Y31A 3KKDA 2NVXJ 1IDYA 2GFNA 3VPRA 2ELKA 2TCTA 5EEAA 2IBDA 1I50J 3JRGA 2LTPA 2Y30A 1LE8B 4A3CJ 4ME9A 2NS8A 3V78A 2CQXA 2EZLA 2LFBA 1K61A 3HOWJ 4LOCA 1XG1A 2UXIA 1JUSA 3HDDA 3HOYJ 4JX4A 5E3MA 2I10A 1FIPA 5FMPA 2W53A 1IG7A 1GT0C 3S1NJ 4ABZA 4B3AA 2DMTA 4J19A 5C3EJ 2O7OA 2ZCXA 1ETOA 5M3FJ 4GFKA 3BJBA 3BTIA 5EG0A 1BL0A 3PASA 1SANA 3RH2A 5HAWA 5FKNA 1NK2P 4Y52J 1FEXA 2XSDC 2XPWA 3K7AJ 3W6VA 4MK6A 3HTAA 4GCTA 1DU0A 4W97A 4XICA 2L7FP 2Y0SN 1IRZA 1G2HA 4RDUA 2E2HJ 3SFIA 4A3MJ 3FISA 2LR8A 4AF5A 5J1UA 2K9QA 1LE8A 3D1NI 5C4YA 2DA6A 2ME0A 1JJ8C 3S2HJ 4A3BJ 1HF0A 3ON2A 2R5ZB 1SFOJ 1GVDA 3ZQGA 1WI3A 3FKIJ 2HYTA 3BTLA 2JA5J 2IEKA 1JKRC 1ETVA 3BR0A 2G0EA 4MO7A 1JJ6C 1ZK8A 4UDSA 4M6VA 4A69C 3S1QJ 1WGXA 3NPIA 2DMQA 3BR2A 2X9DA 3CQZJ 4DZJA 4D7MA 2HOSA 2FJ1A 4A3FJ 3HOVJ 4UUSB 1VNDA 3ZQFA 2XB0X 3QKXA 5D1RA 1TWCJ 4GCKA 2R0QC 1IDZA 1UHSA 2XGCA 1UI6A 3COLA 3HB9A 3E7QA 3BNIA 2ME6A 2L7ZA 2LY9A 2QOPA 5AQCA 2QTQA 1GUUA 2QKOA 5F27A 2YU9J 4C2MJ 1TWHJ 4DYCA 1ETYA 4JNNA 1B8IB 4RBOA 2DG7A 5FJ8J 2OI8A 2X48A 1MBGA 3BHQA 3JSJA 2HYJA 3HEFA 5IP9J 3GTKJ 1MSFC 1YRNB 3BR5A 2R5ZA 1OJLA 3JRHA 3M4OJ 3MVPA 3JRDA 1RR7A 3AQSA 3JR9A 1H8AC 2HQ5A 4AYBN 1HCRA 3BQYA 2G3BA 3MKLA 4KWAA 3OSFA 1Q1VA 1ETKA 4W1UA 2M0CA 5EZHA 3ZQIA 4HKUA 2COBA 3BR1A 1UG2A 1RKTA 3A02A 3QPLA 4UUSA 2HXIA 3PPBA 1WH7A 3VW0A 2O9LA 3NRGA 3BCGA 2HOAA 1HDDC 2QCOA 3P9TA 2Q24A 2DA5A 1P7JA 4A3GJ 1K83J 1JUPA 1AHDP 2DG8A 4XIDA 1GV5A 3RZDJ 1W0UA 1ZR2A 4X1EA 3CDLA 3HE0A 4AC6A 3CWRA 4ACIA 3HTJA 3CCYA 1B8IA 1ZGWA 1OCTC 1BW6A 2XPVA 1NTCA 3IUVA 1X2NA 3LJLA 1JT0A 3S15J 3G7RA 1YRNA 1MBJA 2X6OA 4S0HB 3HBLA 3DCFA 3G56A 2XPUA 2CQQA 2DN0A 4JX5A 2MSYA 3Q0WA 5M3MJ 2VPRA 3K2AA 4D5CA 1BW5A 1APLC 4BKXA 2W48A 2JJ7A 1OCPA 2P81A 2UXUA 5J1YA 3GTJJ 3VIBA 3ZQLA 2DTZA 4FCYA 2CUEA 4GFBA 3FRQA 1U9NA 3CRJA 3RZOJ 2MGQA 3GBGA 4IEJA 2YVEA 1X2MA 2HXOA 2Y2ZA 3ZQCA 2NX4A 5EDNA 2YS9A 2JA6J 3GTOJ 5F04A 2LP0A 1ZQ3P 1U78A 4GCLA 2HOTA 2UXOA 5EGOB 2PBXA 1AU7A 2H8RA 2AHQA 3O8GA 2EZIA 3TP3A 4V2GA 2V57A 4D5FA 2VKVA 3S1RJ 5FHPA 3BT9A 3FIWA 2JK3A 4A3JJ 3CMYA 3LWJA 2H1KA 1SGMA 2M9HA 2UXHA 4BY1J 2JN6A 2QF7A 2Y9YA 2XGDA 4Y7NJ 1MBHA 2DJNA 3A03A 1A6IA 2CUFA 1AKHB 4NDLA 3DPJA 4ICHA 5JLXA 5HODA 3VUQA 5FKKA 2ZB9A 5EFYA 1VF9A 3WHBA 1LFBA 2EZKA 3MNLA 2PMZN 3GEUA 4EEFG 5K7ZA 5K7FA 1RPWA 3AQTA 1DU6A 3ANPA 1JGGA 3ON4A 1Y1VJ 1XS9A 9ANTA 1JTXA 2DA1A 4XRSA 2E2IJ 5F0FA 1ETXA 2O7TA 4FE4A 2QWTA 4MFDA 3RKQA 4C3IJ 5FKLA 3FK6A 2NVQJ 2R93J 1Z77A 4DYRA 1UI5A 3TP0A 2WUIA 2IU5A 2GM4A 5DAJA 4NELA 1F43A 2GLOA 5EGOA 1GV2A 5HBUA 1ETQA 1F36A 3I4NJ 3VVYA 3Q0UA 3S2DJ 2FQ4A 4M3FA 5IOZA 2L7MP 4MFEA 1WCMJ 3GTMJ 4MXMA 3QBMA 5E3OA 2DA2A 1IGNA 2WGBA 5IP6A 1I3QJ 2WV1A 1JKOC 1Z0XA 3VOXA 2TRTA 1AKHA 2VI6A 2L0KA 3LSGA 2ECBA 4IHXA 1ZKGA 2M2EA 2RAEA 2OERA 5M5WJ 1JKPC 3LHQA 1ORKA 5C4JJ 2R5YB 4NN1A 3O60A 5H9TA 2AO9A 2NP3A 1MH4A 2LK2A 4B4CA 1JUMA 3HOZJ 4BBSJ 5J3LA 3DEWA 4JX6A 1R9TJ 1BJZA 3VW2A 2M34A 4XRMA 4IHYA 1CQTA 5D18A 3ZQHA 1QVTA 5E3NA 2RHAA 2L9RA 2GENA 3KKCA 5F0HA 2EQRA 3Q3SA 3PO2J 1FTTA 2HKUA 3F1BA 3S5RA 1ZR4A 1IC8A 1QPIA 4BXXJ 4YZEA 3GTGJ 2OF7A 3JRAA 1ENHA 2KDZA 1MSEC 1TWAJ 5GPAA 3LNQA 5F08A 4B1RA 3QPSA 1HLVA 2LD5A 2NP5A 4G12A 1QRYA 2CRGA 2MG4A 4JP0A 1Y1WJ 4JL3A 5M5XJ 4D7NA 2N8GA 2VUMJ 2ID3A 3JREA 1FIAA 3EGQA 1WPKA 5FKOA 1UMQA 1EF4A 3HOXJ 2LLKA 3V6GA 4I76A 5EZGA 3M3YJ 1TC3C 1I6HJ 3OOUA 3IH2A 2Y9ZA 2WAQN 2R92J 2REKA 2HI3A 1X58A 3VOKA 2R5YA 5CXIA 3Q0VA 3G1LA 2ECCA 3OIOA 3B6CA 5FGLA 2CU7A 1T56A 2FX0A 2XGEA 2IAIA 2VKEA 5J1RA 4BY7J 1MH3A 4C3JJ 2XDNA 2LKXA 4CYCB 1E3OC 3KNWA 1HOMA 2WB1N 4M3EA 3B81A 2D6YA 3BG3A 1PUFB 1IV6A 1FTZA 3B6AA 1H88C 5CW8A 5C44J 2KT0A 3TEDA 3HM5A 2HDDA 4M3DA 3NNRA 2PZ9A 1XC5A 3BG5A 1TWGJ 5IPAA 4A3EJ 3BRUA 5BNGA 3JRFA 1BA5A 2XRLA 2JMWA 4C3HJ 5M5YJ 2G7SA 4FTHA 2E2JJ 5HSZA 1VI0A 3IH4A 1WH5A 2EBIA 2K9SA 2O8KA 1JTYA 3LSJA 4M3BA 2G7LA 2D5VA 4PXIA 3F0CA 1OFCX 3HIMA 4A3KJ 3NXCA 2JA7J 3H0GJ 4DW6A 2E1OA 4DZPA 4XK4A 3LOCA 1IJWC 3BR3A 5FLMJ 3H3VK 3HOUJ 2ID6A 5EF6A 3L1PA 1RESA 1FJLA 5GP9A 2NVYJ 4AUXA 2R7ZJ 1QVUA 4HNVA 4CYCA 4M3GA 5IYCJ 3LSPA 3GTLJ 3HTHA 3GTPJ 1IUFA 5F0CA 2GBYA 3RQIA 1PUFA 1NK3P 4IHVA 2G7GA 4L62A 3VVXA 3BG9A 4FE7A 1MBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTR A;  5IYD J;  3BR6 A;  3BTC A;  2DA4 A;  4QSH A;  2K40 A;  3VP5 A;  1MNM C;  5DTD A;  3SDG A;  3HKZ N;  1RET A;  4UUT A;  1O4X A;  3TW7 A;  5GPC A;  1U9O A;  4A3I J;  2EH3 A;  4A93 J;  3EUP A;  3KZ9 A;  4JKZ A;  5E3L A;  3JRI A;  2ZCM A;  1GDT A;  2E19 A;  4BBR J;  1A5J A;  2F07 A;  4A3L J;  3PO3 J;  3IV5 A;  5IYB J;  4X6A J;  2NOG A;  2LVS A;  2ZCN A;  4JYK A;  3G1O A;  3GTQ J;  2FD5 A;  4I6Z A;  5K58 A;  3G1M A;  3A01 B;  3S16 J;  3HTI A;  5IOY A;  3HGG A;  3VW1 A;  2YUS A;  3E7L A;  4MIM A;  4V2F A;  1B72 B;  3JRC A;  1P7I A;  2DA3 A;  3TW6 A;  3NAU A;  3WHC A;  3ZOB A;  5DS9 A;  1JKQ C;  3S17 J;  2UXP A;  4DYQ A;  1ITY A;  2YVH A;  1RKW A;  3MN2 A;  4L5E A;  2MW8 A;  3BQZ A;  5K7H A;  3C2B A;  3UKG A;  3CJD A;  3OSG A;  3RD3 A;  3NI7 A;  1HDP A;  4QIW N;  2DA7 A;  1D5Y A;  3C07 A;  4QTR A;  1ETW A;  2NS7 A;  1W0T A;  2GUH A;  2DMN A;  3S1M J;  2XB5 A;  2QIB A;  5C4X J;  2OPT A;  2CJJ A;  5FKM A;  3SJM A;  1VFC A;  4MLO A;  3S14 J;  3VVZ A;  1TWF J;  3O8H A;  2ZOZ A;  2RAS A;  1H89 C;  2M8G X;  3BTJ A;  4GFL A;  3QQA A;  5JLW A;  1U8B A;  4FIS A;  4CGR A;  4XRS G;  2ZOY A;  3FK7 A;  3T6N A;  1S7E A;  2JWT A;  3NAR A;  5CXG A;  3ANG A;  2EZH A;  3IH3 A;  2B63 J;  2NVT J;  1POG A;  3A01 A;  5EG0 B;  3I4M J;  3GZI A;  2JA8 J;  3HGY A;  1JT6 A;  2K9N A;  5EYR A;  1B72 A;  4A3D J;  2DMP A;  4AC0 A;  2DMU A;  1T33 A;  3LSR A;  5FLV A;  1LFU P;  5F1J A;  3JRB A;  5D19 A;  1MBF A;  1MBE A;  3PM1 A;  5IP7 J;  4IHW A;  2FBQ A;  2Y31 A;  3KKD A;  2NVX J;  1IDY A;  2GFN A;  3VPR A;  2ELK A;  2TCT A;  5EEA A;  2IBD A;  1I50 J;  3JRG A;  2LTP A;  2Y30 A;  1LE8 B;  4A3C J;  4ME9 A;  2NS8 A;  3V78 A;  2CQX A;  2EZL A;  2LFB A;  1K61 A;  3HOW J;  4LOC A;  1XG1 A;  2UXI A;  1JUS A;  3HDD A;  3HOY J;  4JX4 A;  5E3M A;  2I10 A;  1FIP A;  5FMP A;  2W53 A;  1IG7 A;  1GT0 C;  3S1N J;  4ABZ A;  4B3A A;  2DMT A;  4J19 A;  5C3E J;  2O7O A;  2ZCX A;  1ETO A;  5M3F J;  4GFK A;  3BJB A;  3BTI A;  5EG0 A;  1BL0 A;  3PAS A;  1SAN A;  3RH2 A;  5HAW A;  5FKN A;  1NK2 P;  4Y52 J;  1FEX A;  2XSD C;  2XPW A;  3K7A J;  3W6V A;  4MK6 A;  3HTA A;  4GCT A;  1DU0 A;  4W97 A;  4XIC A;  2L7F P;  2Y0S N;  1IRZ A;  1G2H A;  4RDU A;  2E2H J;  3SFI A;  4A3M J;  3FIS A;  2LR8 A;  4AF5 A;  5J1U A;  2K9Q A;  1LE8 A;  3D1N I;  5C4Y A;  2DA6 A;  2ME0 A;  1JJ8 C;  3S2H J;  4A3B J;  1HF0 A;  3ON2 A;  2R5Z B;  1SFO J;  1GVD A;  3ZQG A;  1WI3 A;  3FKI J;  2HYT A;  3BTL A;  2JA5 J;  2IEK A;  1JKR C;  1ETV A;  3BR0 A;  2G0E A;  4MO7 A;  1JJ6 C;  1ZK8 A;  4UDS A;  4M6V A;  4A69 C;  3S1Q J;  1WGX A;  3NPI A;  2DMQ A;  3BR2 A;  2X9D A;  3CQZ J;  4DZJ A;  4D7M A;  2HOS A;  2FJ1 A;  4A3F J;  3HOV J;  4UUS B;  1VND A;  3ZQF A;  2XB0 X;  3QKX A;  5D1R A;  1TWC J;  4GCK A;  2R0Q C;  1IDZ A;  1UHS A;  2XGC A;  1UI6 A;  3COL A;  3HB9 A;  3E7Q A;  3BNI A;  2ME6 A;  2L7Z A;  2LY9 A;  2QOP A;  5AQC A;  2QTQ A;  1GUU A;  2QKO A;  5F27 A;  2YU9 J;  4C2M J;  1TWH J;  4DYC A;  1ETY A;  4JNN A;  1B8I B;  4RBO A;  2DG7 A;  5FJ8 J;  2OI8 A;  2X48 A;  1MBG A;  3BHQ A;  3JSJ A;  2HYJ A;  3HEF A;  5IP9 J;  3GTK J;  1MSF C;  1YRN B;  3BR5 A;  2R5Z A;  1OJL A;  3JRH A;  3M4O J;  3MVP A;  3JRD A;  1RR7 A;  3AQS A;  3JR9 A;  1H8A C;  2HQ5 A;  4AYB N;  1HCR A;  3BQY A;  2G3B A;  3MKL A;  4KWA A;  3OSF A;  1Q1V A;  1ETK A;  4W1U A;  2M0C A;  5EZH A;  3ZQI A;  4HKU A;  2COB A;  3BR1 A;  1UG2 A;  1RKT A;  3A02 A;  3QPL A;  4UUS A;  2HXI A;  3PPB A;  1WH7 A;  3VW0 A;  2O9L A;  3NRG A;  3BCG A;  2HOA A;  1HDD C;  2QCO A;  3P9T A;  2Q24 A;  2DA5 A;  1P7J A;  4A3G J;  1K83 J;  1JUP A;  1AHD P;  2DG8 A;  4XID A;  1GV5 A;  3RZD J;  1W0U A;  1ZR2 A;  4X1E A;  3CDL A;  3HE0 A;  4AC6 A;  3CWR A;  4ACI A;  3HTJ A;  3CCY A;  1B8I A;  1ZGW A;  1OCT C;  1BW6 A;  2XPV A;  1NTC A;  3IUV A;  1X2N A;  3LJL A;  1JT0 A;  3S15 J;  3G7R A;  1YRN A;  1MBJ A;  2X6O A;  4S0H B;  3HBL A;  3DCF A;  3G56 A;  2XPU A;  2CQQ A;  2DN0 A;  4JX5 A;  2MSY A;  3Q0W A;  5M3M J;  2VPR A;  3K2A A;  4D5C A;  1BW5 A;  1APL C;  4BKX A;  2W48 A;  2JJ7 A;  1OCP A;  2P81 A;  2UXU A;  5J1Y A;  3GTJ J;  3VIB A;  3ZQL A;  2DTZ A;  4FCY A;  2CUE A;  4GFB A;  3FRQ A;  1U9N A;  3CRJ A;  3RZO J;  2MGQ A;  3GBG A;  4IEJ A;  2YVE A;  1X2M A;  2HXO A;  2Y2Z A;  3ZQC A;  2NX4 A;  5EDN A;  2YS9 A;  2JA6 J;  3GTO J;  5F04 A;  2LP0 A;  1ZQ3 P;  1U78 A;  4GCL A;  2HOT A;  2UXO A;  5EGO B;  2PBX A;  1AU7 A;  2H8R A;  2AHQ A;  3O8G A;  2EZI A;  3TP3 A;  4V2G A;  2V57 A;  4D5F A;  2VKV A;  3S1R J;  5FHP A;  3BT9 A;  3FIW A;  2JK3 A;  4A3J J;  3CMY A;  3LWJ A;  2H1K A;  1SGM A;  2M9H A;  2UXH A;  4BY1 J;  2JN6 A;  2QF7 A;  2Y9Y A;  2XGD A;  4Y7N J;  1MBH A;  2DJN A;  3A03 A;  1A6I A;  2CUF A;  1AKH B;  4NDL A;  3DPJ A;  4ICH A;  5JLX A;  5HOD A;  3VUQ A;  5FKK A;  2ZB9 A;  5EFY A;  1VF9 A;  3WHB A;  1LFB A;  2EZK A;  3MNL A;  2PMZ N;  3GEU A;  4EEF G;  5K7Z A;  5K7F A;  1RPW A;  3AQT A;  1DU6 A;  3ANP A;  1JGG A;  3ON4 A;  1Y1V J;  1XS9 A;  9ANT A;  1JTX A;  2DA1 A;  4XRS A;  2E2I J;  5F0F A;  1ETX A;  2O7T A;  4FE4 A;  2QWT A;  4MFD A;  3RKQ A;  4C3I J;  5FKL A;  3FK6 A;  2NVQ J;  2R93 J;  1Z77 A;  4DYR A;  1UI5 A;  3TP0 A;  2WUI A;  2IU5 A;  2GM4 A;  5DAJ A;  4NEL A;  1F43 A;  2GLO A;  5EGO A;  1GV2 A;  5HBU A;  1ETQ A;  1F36 A;  3I4N J;  3VVY A;  3Q0U A;  3S2D J;  2FQ4 A;  4M3F A;  5IOZ A;  2L7M P;  4MFE A;  1WCM J;  3GTM J;  4MXM A;  3QBM A;  5E3O A;  2DA2 A;  1IGN A;  2WGB A;  5IP6 A;  1I3Q J;  2WV1 A;  1JKO C;  1Z0X A;  3VOX A;  2TRT A;  1AKH A;  2VI6 A;  2L0K A;  3LSG A;  2ECB A;  4IHX A;  1ZKG A;  2M2E A;  2RAE A;  2OER A;  5M5W J;  1JKP C;  3LHQ A;  1ORK A;  5C4J J;  2R5Y B;  4NN1 A;  3O60 A;  5H9T A;  2AO9 A;  2NP3 A;  1MH4 A;  2LK2 A;  4B4C A;  1JUM A;  3HOZ J;  4BBS J;  5J3L A;  3DEW A;  4JX6 A;  1R9T J;  1BJZ A;  3VW2 A;  2M34 A;  4XRM A;  4IHY A;  1CQT A;  5D18 A;  3ZQH A;  1QVT A;  5E3N A;  2RHA A;  2L9R A;  2GEN A;  3KKC A;  5F0H A;  2EQR A;  3Q3S A;  3PO2 J;  1FTT A;  2HKU A;  3F1B A;  3S5R A;  1ZR4 A;  1IC8 A;  1QPI A;  4BXX J;  4YZE A;  3GTG J;  2OF7 A;  3JRA A;  1ENH A;  2KDZ A;  1MSE C;  1TWA J;  5GPA A;  3LNQ A;  5F08 A;  4B1R A;  3QPS A;  1HLV A;  2LD5 A;  2NP5 A;  4G12 A;  1QRY A;  2CRG A;  2MG4 A;  4JP0 A;  1Y1W J;  4JL3 A;  5M5X J;  4D7N A;  2N8G A;  2VUM J;  2ID3 A;  3JRE A;  1FIA A;  3EGQ A;  1WPK A;  5FKO A;  1UMQ A;  1EF4 A;  3HOX J;  2LLK A;  3V6G A;  4I76 A;  5EZG A;  3M3Y J;  1TC3 C;  1I6H J;  3OOU A;  3IH2 A;  2Y9Z A;  2WAQ N;  2R92 J;  2REK A;  2HI3 A;  1X58 A;  3VOK A;  2R5Y A;  5CXI A;  3Q0V A;  3G1L A;  2ECC A;  3OIO A;  3B6C A;  5FGL A;  2CU7 A;  1T56 A;  2FX0 A;  2XGE A;  2IAI A;  2VKE A;  5J1R A;  4BY7 J;  1MH3 A;  4C3J J;  2XDN A;  2LKX A;  4CYC B;  1E3O C;  3KNW A;  1HOM A;  2WB1 N;  4M3E A;  3B81 A;  2D6Y A;  3BG3 A;  1PUF B;  1IV6 A;  1FTZ A;  3B6A A;  1H88 C;  5CW8 A;  5C44 J;  2KT0 A;  3TED A;  3HM5 A;  2HDD A;  4M3D A;  3NNR A;  2PZ9 A;  1XC5 A;  3BG5 A;  1TWG J;  5IPA A;  4A3E J;  3BRU A;  5BNG A;  3JRF A;  1BA5 A;  2XRL A;  2JMW A;  4C3H J;  5M5Y J;  2G7S A;  4FTH A;  2E2J J;  5HSZ A;  1VI0 A;  3IH4 A;  1WH5 A;  2EBI A;  2K9S A;  2O8K A;  1JTY A;  3LSJ A;  4M3B A;  2G7L A;  2D5V A;  4PXI A;  3F0C A;  1OFC X;  3HIM A;  4A3K J;  3NXC A;  2JA7 J;  3H0G J;  4DW6 A;  2E1O A;  4DZP A;  4XK4 A;  3LOC A;  1IJW C;  3BR3 A;  5FLM J;  3H3V K;  3HOU J;  2ID6 A;  5EF6 A;  3L1P A;  1RES A;  1FJL A;  5GP9 A;  2NVY J;  4AUX A;  2R7Z J;  1QVU A;  4HNV A;  4CYC A;  4M3G A;  5IYC J;  3LSP A;  3GTL J;  3HTH A;  3GTP J;  1IUF A;  5F0C A;  2GBY A;  3RQI A;  1PUF A;  1NK3 P;  4IHV A;  2G7G A;  4L62 A;  3VVX A;  3BG9 A;  4FE7 A;  1MBK A; 
#chains in the Genus database with same CATH topology
 1XTA A;  4IJA A;  1ZTR A;  5CKT A;  3HSR A;  2VJ4 A;  4L0Y B;  3BTC A;  3VP5 A;  2H94 A;  1QU3 A;  4PJL A;  2A6T A;  3BP8 A;  3UNG C;  3OYI A;  1R23 A;  3HKZ N;  2P6S A;  4YFX F;  2ZJR F;  1R4N B;  3VOD A;  3G71 I;  5GPC A;  1IO2 A;  1FY7 A;  3EUP A;  1ZGA A;  2UUZ A;  3OOP A;  3KZ9 A;  3JRI A;  2IA0 A;  1Z7U A;  2E19 A;  3K1P A;  4IRH A;  4P1W A;  1OIS A;  3IV5 A;  4LIU A;  2DU9 A;  4X6A J;  2ZCN A;  4Y3O A;  2V7F A;  4KNY A;  2MC3 A;  3WTV C;  4KDP A;  2FD5 A;  4ZDO A;  5DD4 A;  1KU3 A;  2HEO A;  2ELH A;  5CVU A;  1FNN A;  5K58 A;  2JUC A;  3S16 J;  2XGX A;  5DCM A;  5E8G A;  3F8N A;  2XAH A;  2VE8 A;  3E7L A;  3NEU A;  4MIM A;  3VW1 A;  1B72 B;  1J5Y A;  3RYR A;  4I01 A;  2W84 A;  3TW6 A;  3MKY B;  3WHC A;  3ZOB A;  2XDV A;  4A0X A;  4CYD A;  3EDP A;  1JKQ C;  3S17 J;  2UXP A;  2IRF G;  2F48 A;  2H27 A;  5TRD A;  3RD3 A;  3BPV A;  1IAW A;  4G7Z F;  1W7P D;  4QTR A;  2CMP A;  3CUQ B;  1LPQ A;  3HTS B;  2Z99 A;  2EV0 A;  1FOY A;  5E17 F;  2VAS A;  4QLC U;  1IV8 A;  1BOB A;  3KLO A;  4XMY A;  2CJJ A;  2IJL A;  2L4A A;  2OZU A;  3S32 A;  1SFK A;  4XN0 A;  3S14 J;  3HPH A;  2RAS A;  2LKS A;  3BTJ A;  2PEX A;  1L3L A;  3X2Q H;  4G94 A;  1XCV A;  4LGW A;  1Z3Y A;  2K3F A;  1Y6I A;  4XRS G;  2ZOY A;  2NRA C;  1S7E A;  2JWT A;  4MTE A;  3NAR A;  1UHM A;  3GME A;  2HYG D;  3ANG A;  4KN7 X;  2B63 J;  1ZN2 A;  3LAJ A;  3S8P A;  3FHN A;  2H6B A;  4M74 A;  1OYY A;  1JGS A;  3V4G A;  1B1B A;  4HF0 A;  2DMU A;  2X1C A;  1LFU P;  2LYC A;  2QKL B;  2STT A;  3K1M A;  3PM1 A;  5IP7 J;  2ESN A;  2Y31 A;  3V7S A;  1X1A A;  2IBD A;  3ASN H;  4EJO A;  2LTP A;  1ONV A;  4ME9 A;  2CQ7 A;  2X0L A;  3LQR A;  3IRR A;  1TQM A;  3ZMV A;  2LFB A;  3E97 A;  3RPU A;  1MMD A;  2M4K A;  3D5L A;  3MEX A;  2KRH A;  3HSF A;  1D1B A;  2VBZ A;  1LNW A;  3KFW X;  2XUB A;  4XBF A;  2W53 A;  2P5V A;  1IG7 A;  1TNS A;  4ABZ A;  3V8L A;  4BH9 A;  2CSO A;  2XAF A;  2X1D A;  4CUG A;  1HA8 A;  3FZV A;  5CLS A;  2O7O A;  2ZCX A;  1ETO A;  2FXA A;  3GEZ A;  1MND A;  3AFH A;  1SAN A;  4AVP A;  5GTI C;  5H20 A;  1OCC H;  2LC2 A;  1TQP A;  3PFY A;  5KAF C;  2BGC A;  2IGN A;  3L2Q A;  2GXB A;  3P9C A;  2ZY9 A;  2E7W A;  3ZR8 X;  3KP4 A;  1B6A A;  1DU0 A;  4W97 A;  3R61 A;  3ABU A;  5BQT A;  1V5F A;  3I0T A;  2Z3Y A;  2PLY A;  1G2H A;  4RDU A;  5KK1 A;  2HPM A;  3NWT A;  5D5X B;  3K2Z A;  3BDD A;  4A3M J;  1FYK A;  1F1Z A;  3VSK A;  5J1U A;  2K9Q A;  1LE8 A;  2DT7 B;  3ELK A;  3HPG A;  4A3B J;  2UV1 A;  5KAI C;  4EV0 A;  1SFO J;  3TO6 A;  4P55 A;  4RGR A;  3BZC A;  4ZZD A;  1N78 A;  3BTL A;  2JA5 J;  1G3W A;  2K85 A;  1ETV A;  2F5E A;  2Y48 A;  4KUM A;  1X4O A;  3EUA A;  1RUO A;  3BR0 A;  2G0E A;  2K02 A;  1IRG A;  5E1W A;  3T8R A;  4UDS A;  3F6V A;  3MCZ A;  4A69 C;  1KYW A;  4BNC A;  3S1Q J;  2ZCW A;  2FJI 1;  5EEG A;  3BR2 A;  2X9D A;  3CQZ J;  3PSF A;  3VFZ A;  4L5I A;  1IUY A;  1R22 A;  2YX7 A;  3C1D A;  1KON A;  3QP5 A;  5FD5 A;  3FHZ A;  1IDZ A;  1UHS A;  2XGC A;  1TW3 A;  1UI6 A;  3HB9 A;  1SVO A;  3E7Q A;  2BZT A;  3BNI A;  2L7Z A;  2LY9 A;  3H36 A;  4II2 A;  1GUU A;  1V3F A;  4PJJ A;  4A0Y A;  4C2M J;  5J47 A;  1SAX A;  2FMY A;  2DDB A;  5D5V B;  5GAE J;  3OYH A;  4ZZL A;  4IQJ A;  2M4G A;  4JNN A;  2DG7 A;  2ZME B;  4RBO A;  1UZC A;  2OI8 A;  4FHT A;  1MBG A;  2V26 A;  3BHQ A;  1FX7 A;  2MLK A;  3OL3 A;  4J01 A;  1WJF A;  3DU6 A;  5IP9 J;  5LGU A;  3GTK J;  2VOO A;  4RLF A;  2LF8 A;  2R5Z A;  3JAM Z;  3GW2 A;  3JRH A;  1O3Q A;  2MYS A;  4CZZ A;  2K4J A;  3C18 A;  2LRE A;  3GVA A;  3JR9 A;  2LY1 A;  1H8A C;  4IF4 A;  3KEO A;  3HHG A;  2QEX I;  1XMK A;  1Z6R A;  4OOI A;  4KWA A;  1ULY A;  3IAS 2;  1U5T C;  5E1Z B;  4W1U A;  3JTG A;  1UG2 A;  2HVS A;  5B3S H;  2FRH A;  3EUH C;  1J9I A;  4UUS A;  2HXI A;  4L0Z B;  4E7K A;  2DI3 A;  1OKR A;  3H3U A;  3VW0 A;  3SHF A;  2O9L A;  2HOA A;  1HDD C;  2QCO A;  2BOL A;  4Y33 A;  4KIC A;  1KZH A;  4HNU A;  2DA5 A;  5J6X A;  3A2K A;  1X1B A;  2VBX A;  1BC8 C;  4B44 A;  4EMS A;  4RMN A;  1YYV A;  4BEH A;  1E17 A;  3OV8 A;  4X1E A;  1ZR2 A;  1A6Q A;  3GCM A;  2VKD A;  1B8I A;  2IS4 A;  4XM3 A;  1NTC A;  1B59 A;  4EM2 A;  3WGI A;  1HXD A;  4UVC A;  3HRM A;  5FRN A;  1QNT A;  3S15 J;  1YRN A;  1MBJ A;  3L2C A;  3HBL A;  4IHT A;  1BN5 A;  2CQQ A;  3Q0W A;  5M3M J;  2UWM A;  3K2A A;  4ZTJ A;  1LDJ A;  1APL C;  4U7B A;  2JJ7 A;  2DFH A;  2P81 A;  5D8L B;  2UXU A;  3GTJ J;  1FYM A;  3ZQL A;  2DTZ A;  2JRT A;  4FCY A;  1YS7 A;  2CUE A;  3RTR A;  1GXP A;  3RZO J;  3GBG A;  2RKH A;  1W4M A;  2EFW A;  1KU7 A;  2NX4 A;  4C2T A;  4KMF A;  1XMA A;  1J0R A;  2FOW A;  4G8X A;  1U78 A;  2GA2 A;  4GCL A;  2PBX A;  3DKX A;  1AU7 A;  3TQN A;  2V57 A;  3TP3 A;  4V2G A;  5JFR A;  4D5F A;  5CVR A;  4YEL A;  2JK3 A;  1R4M B;  1XCB A;  3CMY A;  2X1E A;  3LWJ A;  2H1K A;  3TGN A;  1SGM A;  3FKJ A;  4N9I A;  1QZZ A;  3ZMS A;  3AL0 C;  2QF7 A;  3DXJ F;  3TO9 A;  3J7A O;  2Y9Y A;  2XGD A;  1V55 H;  1TZL A;  1D8K A;  1D1C A;  4ON0 A;  3D5S C;  2HQR A;  3RJP A;  4DIQ A;  1SMY F;  5JLX A;  5HOD A;  2ISZ A;  1HW1 A;  2KDO A;  1O3S A;  1GHC A;  3H0D A;  1NG6 A;  2R3S A;  4XKB A;  2EZK A;  3GEU A;  3LFU A;  4O6J A;  1RPW A;  2E1M B;  2DA1 A;  2JQ7 A;  4XRS A;  2QA4 I;  1E3H A;  3QYE A;  2QWT A;  4MFD A;  3RKQ A;  4C3I J;  3SWH A;  2Z1D A;  3TP0 A;  3WE2 A;  2L9V A;  3QWL A;  1G3S A;  3V8K A;  2R7D A;  4L9N A;  5E1X A;  4C9Y A;  5EGO A;  1GV2 A;  2JPC A;  1ETQ A;  1S8N A;  2RGV A;  3M8E A;  3HTU A;  3Q0U A;  2VE9 A;  3S2D J;  4M3F A;  2HVQ A;  5ED4 A;  5L3E A;  1P9Q C;  4P9F A;  2ZO4 A;  4RB0 A;  4CCO A;  2VOP A;  5HDN A;  3L2V A;  3QBM A;  3OWT A;  3SZT A;  2ZSH B;  3FM5 A;  2A5W A;  1I3Q J;  2WV1 A;  1X4P A;  4XLC A;  1BIA A;  1AKH A;  2M2E A;  2HS5 A;  5M5W J;  2XAG A;  1JKP C;  3LHQ A;  1I6X A;  3P9K A;  2R5Y B;  4NN1 A;  2CUZ A;  5H9T A;  1MH4 A;  2LK2 A;  3HOZ J;  4KYW A;  1CF7 B;  4OIP F;  2Y0S A;  2FEZ A;  2ISY A;  1FMW A;  4EQQ A;  2M34 A;  2VC0 A;  3CTA A;  4XRM A;  4GYG A;  4IHY A;  1CQT A;  5D18 A;  5L3F A;  2LNB A;  5E3N A;  4OIN F;  1SD4 A;  2EPF A;  2DPU A;  1U5T A;  1W7P B;  2K27 A;  3ZN0 A;  2HDW A;  1E3P A;  2EQR A;  2GAU A;  2HKU A;  5ICE A;  2YVX A;  3F1B A;  2Q1Z B;  3S5R A;  3EUH A;  3TO7 A;  5B66 C;  1IC8 A;  1QPI A;  4YZE A;  2V9P A;  1TQI A;  3BLY A;  3QPT A;  3KP2 A;  2OF7 A;  3JRA A;  4LLN A;  3GTG J;  3QAH A;  2D2W A;  3L7W A;  2EV5 A;  2PJR A;  4BJT A;  3LNQ A;  3KP7 A;  3P9I A;  4B1R A;  3W6K B;  2LD5 A;  4G12 A;  2A05 A;  1QRY A;  5A2Q Z;  2CRG A;  3E6D A;  2CW8 A;  3SDB A;  2CQK A;  3SZG A;  3JAM K;  2ZJQ F;  3K4M A;  1HC8 A;  4CGZ A;  4HF1 A;  1EF4 A;  2I5U A;  4LLG F;  3PNY A;  2EFO A;  2NOJ B;  3M3Y J;  3OOU A;  2DFI A;  2WAQ N;  2HI3 A;  1X58 A;  2H1L A;  5J8C A;  3G1L A;  1XGS A;  2Z9O A;  1GXQ A;  4K2E A;  1T56 A;  3F22 A;  2KZG A;  2HTS A;  2XGE A;  2VKE A;  2Z16 A;  3MD2 A;  4EJV A;  4C3J J;  5E79 C;  4BE2 A;  4CYC B;  4KFC A;  5HLI A;  4ITV A;  2E34 A;  4G7H F;  3BG3 A;  1IV6 A;  3B6A A;  1H88 C;  4NUB A;  4AIH A;  1KU9 A;  2VJ5 A;  3CUQ C;  2HDD A;  2VQC A;  4AYB A;  4AM3 A;  3NNR A;  1MMG A;  3BG5 A;  1TWG J;  3VSL A;  3JRF A;  1QZE A;  4PJN A;  3K4C A;  1IZ1 A;  2XRL A;  2JMW A;  1XD7 A;  3B73 A;  3BZ6 A;  4FTH A;  4HZF A;  4F93 B;  5HSZ A;  1VI0 A;  3OYG A;  1XGM A;  5H6Q A;  1Z6T A;  1WH5 A;  2O8K A;  3LSJ A;  2NNY A;  3F0C A;  2RC4 A;  4LIV A;  2VJI A;  1VQ7 I;  2FSW A;  4CCL A;  3CF5 F;  3BWG A;  3G4S I;  4DZP A;  4U7D A;  3DEU A;  3H3V K;  5HS9 A;  3I55 I;  2Q8K A;  2VKH A;  2X6X A;  5EF6 A;  4Q4Z F;  1MMS A;  1UG0 A;  2UZK A;  4E7L A;  4AUX A;  1QGP A;  2R7Z J;  1QVU A;  3E5X A;  4M3G A;  1IUF A;  3KYD B;  2D1V A;  2XAJ A;  3HHH A;  3KZY A;  1PUF A;  4PDK A;  3RKW A;  4L62 A;  1OPC A;  3I4P A;  2IW5 A;  2ZBK A;  3BG9 A;  2Q2E B;  2KL4 A;  1MNE A;  5FGM A;  1RUN A;  5FFZ A;  5IYD J;  2COM A;  2XSJ C;  2DA4 A;  3MZH A;  2FF4 A;  3HSE A;  1SVM A;  2HR3 A;  2RRE A;  3P5J A;  3F8C A;  4XRF A;  2BEO A;  1YIJ I;  2L7K A;  3ZMZ A;  1R6R A;  3TOA A;  2W00 A;  3OYF A;  3OYK A;  3GYH X;  4JKZ A;  2EIK H;  5E3L A;  1Y0U A;  2V1D A;  1P4A A;  2QUF A;  5F64 A;  2ZCM A;  4CO8 A;  1MIJ A;  2DOF A;  2JVH A;  3EET A;  3PO3 J;  4A3L J;  1E2X A;  1R7J A;  5IYB J;  3G73 A;  5K1Y A;  2NOG A;  2LVS A;  3V42 A;  5IT3 A;  2LSO A;  4JYK A;  2V4J C;  3HRT A;  3G1O A;  3D5R C;  4HQM A;  2HKO A;  4OIO F;  3HOT A;  4I6Z A;  3GFI A;  1ZLK A;  1KQ9 A;  3HTI A;  5IOY A;  3FX3 A;  1I39 A;  3CCV I;  2DK8 A;  3HGG A;  1N75 A;  2YUS A;  1IW7 F;  1RI7 A;  4UY8 I;  2DA3 A;  1KQ0 A;  1YIO A;  1JHH A;  5DS9 A;  3UR3 C;  4OAZ A;  2JPB A;  4EJW A;  1BC7 C;  1ITY A;  4PJ0 C;  2YVH A;  1D0X A;  1WSU A;  1RKW A;  4L9J A;  1IXC A;  3ONQ A;  4U88 A;  2LY2 A;  4R79 A;  3C07 A;  1D1A A;  1FZP B;  3HC7 A;  2DOA A;  1Z3X A;  4IKF A;  1FBQ A;  4BQQ A;  2W4S A;  3DPT A;  5C4X J;  5FKM A;  2M8E A;  3WTU C;  4MLO A;  3L2R A;  1PP7 U;  1K79 A;  3O8H A;  1XSD A;  4E7Z A;  1YS6 A;  1XGN A;  2BW3 B;  3K4N A;  4DQ2 A;  3QQA A;  3IAM 2;  3OYL A;  4F92 B;  2L9S A;  3F21 A;  3T6N A;  4BJ6 C;  5GAG J;  3PUF A;  1WJC A;  5CXG A;  2MH2 A;  3IH3 A;  1HQC A;  3ERE D;  1EJ9 A;  2W1O A;  5EG0 B;  2OTJ I;  1JT6 A;  2K9N A;  4MEX F;  4HX8 A;  1B72 A;  4A3D J;  4UB6 C;  3FWE A;  3CP2 A;  3J7A Y;  3CCS I;  2RQQ A;  3LSR A;  2ZME C;  2W24 A;  2J5O A;  5F1J A;  5D19 A;  1VQK I;  1MBE A;  4U0Y A;  4XR6 A;  4IHW A;  2FBQ A;  2NVX J;  3CUQ A;  1K78 B;  2GFN A;  3I54 A;  3VPR A;  1QQI A;  5H2F C;  3IRQ A;  1I50 J;  2K7L A;  4A3C J;  5FFX A;  3WGG A;  4RB1 A;  3V78 A;  1KA8 A;  2OJE D;  1T39 A;  4FT8 A;  1J75 A;  2IT0 A;  1OR7 C;  1SEU A;  2CFX A;  3O3K A;  2CFO A;  4HW0 A;  2GXA A;  3I71 A;  2HQA A;  3VB2 A;  3HOW J;  3EYI A;  3HDD A;  1DP3 A;  5E18 F;  3BJO A;  2CH0 A;  1Y8R B;  4O5V A;  3W2V A;  3L2U A;  1GT0 C;  3S1N J;  4CSW A;  5JVG F;  4IX7 A;  2DMT A;  1NG7 A;  4J19 A;  2DDA A;  1TW2 A;  1WFX A;  2ZSI B;  2F5F A;  4GFK A;  3BJB A;  3BTI A;  2JTV A;  1TLH B;  1JHF A;  3U9G A;  3PAS A;  2BVL A;  5HAW A;  2DQL A;  4DOZ A;  2XSD C;  4LFU A;  4F91 B;  4MK6 A;  4G6D A;  4HV6 A;  5KHD A;  3RSN A;  4GCT A;  2XIG A;  3PIO F;  4YFK F;  4BYY A;  4XIC A;  1DUX C;  1P4X A;  2MAB A;  2O3F A;  1UCR A;  3LMM A;  4GXO A;  1G4D A;  2VON A;  2CWE A;  3FIS A;  3BZK A;  5JI6 A;  3D1N I;  2DA6 A;  1JJ8 C;  3S2H J;  3WOD F;  3CCE I;  3CO7 C;  2ZKZ A;  3WTT C;  1GVD A;  4PUS A;  1FP1 D;  2EA2 A;  4QWQ A;  3ZQG A;  2CYY A;  4ENK A;  2CV1 A;  5LGN A;  3DP7 A;  4HNT A;  1M1E B;  2VT3 A;  4MO7 A;  1JJ6 C;  3FDY A;  1LFP A;  3GFL A;  1ZEL A;  3BC8 A;  2HOS A;  2M87 A;  2BHY A;  2EFP A;  3F8F A;  3HIF A;  1L0O C;  3CCQ I;  4B09 A;  3RIR A;  2CO5 A;  2RN7 A;  3H92 A;  2WWY A;  3FXU A;  1IF1 A;  1FP2 A;  3WTW C;  2CG4 A;  5AQC A;  2QOP A;  2VBW A;  1LB2 A;  1S9H A;  3M1C A;  2QKO A;  2QSG X;  2P7C B;  2RQP A;  1BR4 A;  3TMO A;  1K6O A;  3F9K A;  1OCZ H;  1TWH J;  4IXA A;  4L9V A;  1HKS A;  4OMZ A;  1X3U A;  3HEF A;  1YW7 A;  4XQF A;  3OIP A;  3QU6 A;  2P6T A;  3CMM A;  3HYI A;  4HG2 A;  1BOA A;  3C2G A;  1I1S A;  4PGH A;  4N0B A;  1G59 A;  1AOY A;  1B4A A;  3JW4 A;  3MVP A;  3CME I;  1RR7 A;  2VT2 A;  5HNF A;  2E1M C;  2HQ5 A;  3ECO A;  3BQY A;  3ZXS A;  2FOK A;  3MKL A;  1Q1V A;  2PFB A;  3ABT A;  2YX4 A;  1FYL A;  1OCO H;  3GF2 A;  2M0C A;  1VQM I;  2VQL A;  3HKZ A;  3ZQI A;  1BI2 A;  2COB A;  3BR1 A;  3VOE A;  1RKT A;  3QPL A;  1TTY A;  2X4H A;  4HLX A;  3ZN1 A;  3HUG B;  3PSI A;  2M0M A;  2FBK A;  4HOB A;  4CZC A;  1WH7 A;  4ENJ A;  2A6H F;  2Q24 A;  5DM6 F;  2DFE A;  1SD5 A;  2MH9 A;  2OCE A;  5F1R A;  4BE0 A;  3ROU A;  2CS3 A;  2K9L A;  2LF7 A;  2VPL A;  4MHG A;  3WU2 C;  1EKE A;  3HE0 A;  3RZD J;  2OUM A;  3Q9S A;  4RB2 C;  4KIT B;  2P5K A;  4ACI A;  5HLH A;  2XRO A;  2ZME A;  1ZGW A;  1OCT C;  1BW6 A;  4IO9 F;  4EAT A;  1U6G A;  1YI2 I;  3LJL A;  2AQE A;  1Y8Q B;  3PNV A;  2QVO A;  3ERM A;  3G56 A;  3DCF A;  2H09 A;  4RGS A;  1P2F A;  4JX5 A;  3PFI A;  3K0L A;  4P5O A;  1OR7 A;  1QZY A;  5DEQ A;  3JSP A;  1BW5 A;  5IT9 Z;  3WTX C;  4LG3 A;  4BKX A;  1WJB A;  1SVL A;  2FNP A;  3DF8 A;  2LOO A;  1VTN C;  3S93 A;  1S7O A;  3KP3 A;  5LHG A;  4ENN A;  1IXR C;  3FRQ A;  2L2O A;  3CRJ A;  3DTK A;  2XF5 A;  2PX9 A;  1IRX A;  2OCC H;  2HXO A;  1WJ5 A;  2VJJ A;  4A12 A;  2OV7 A;  3DKW A;  5IY5 H;  5EDN A;  2YS9 A;  2OZ6 A;  3G6E I;  5L3B A;  2YPR A;  1J7K A;  3WU0 A;  2F4M B;  3O8G A;  2HZT A;  2VKV A;  1FMV A;  2X85 A;  3BT9 A;  4NBQ A;  4NQW B;  3HOS A;  4Y7N J;  4WX9 A;  2O03 A;  1YJ9 I;  2DJN A;  2E1N A;  4FQG A;  1VQ9 I;  5L3G A;  1A6I A;  4CHU A;  1S7A A;  3I58 A;  4R8H A;  3DPJ A;  4HQE A;  4BQO A;  1WHU A;  3VUQ A;  5EFY A;  2BV6 A;  2FA5 A;  1VQN I;  3E5U A;  2PMZ N;  2A5Y B;  4EEF G;  5K7Z A;  1XSX A;  5K7F A;  3RPQ A;  1USS A;  1DU6 A;  1JGG A;  3OR1 C;  2ZXH A;  4IRV A;  1S29 A;  2DOE A;  1U8R A;  4KMU X;  4D1Q A;  3I59 B;  4DNC A;  3DLL F;  4UB8 C;  3ECH A;  2NVQ J;  4DYR A;  2R93 J;  4DGW B;  1UI5 A;  2WUI A;  3T0Y A;  2GM4 A;  2TDX A;  1QO0 D;  4BL0 B;  1F43 A;  3MZY A;  2GLO A;  3J7Y J;  2FNA A;  3K4B A;  2K5C A;  5ILU A;  2LG4 A;  2V1X A;  5HBU A;  1F36 A;  2J5P A;  2O8X A;  4LK1 F;  1I1G A;  2AXT C;  4RS8 A;  4WIB A;  2V9V A;  5J4V A;  1ZG5 A;  3GTM J;  3L09 A;  1IN8 A;  2LH9 A;  2F4I A;  2RNG A;  4HSR A;  1IXS B;  1X1D A;  2BHZ A;  5IP6 A;  2O5R A;  5LHH A;  3VOX A;  2TRT A;  1W36 D;  3CZ6 A;  4IHX A;  3NS4 A;  3TL4 X;  2FQ3 A;  2ZFW A;  1ZRD A;  3LSK A;  1ORK A;  3F23 A;  1WQ2 A;  3O60 A;  1WJA A;  2WAE A;  2NP3 A;  3AG4 H;  1JUM A;  4HLY A;  2R7F A;  1F5T A;  1Z7L A;  2QLZ A;  4BHB A;  1KU2 A;  1OMI A;  3KYC B;  2OC6 A;  2KRF A;  3BPX A;  3C3W A;  3Q3S A;  1FTT A;  3ZMD A;  4ASN A;  4S04 A;  2EIN H;  4F3Q A;  4U9N A;  3K6G A;  2KIS A;  2C6Y A;  1ENH A;  5BPI A;  3SQN A;  2KDZ A;  1VQ4 I;  2JSP A;  5FD6 A;  2GZW A;  1TWA J;  2BXY A;  3CCL I;  3CES A;  4UVB A;  3QPS A;  3H9J A;  1JE8 A;  2OQG A;  2IPQ X;  2MG4 A;  4M6X A;  2CGP A;  2HU9 A;  2JZY A;  4ZYE A;  3MKW B;  5BMZ A;  2N8G A;  4RGX A;  3Q5F A;  4BQA A;  1FBS A;  3ZQQ A;  2CW7 A;  3JRE A;  2PFV A;  2DCE A;  1WPK A;  4M72 A;  3OY9 A;  1YLF A;  5FKO A;  4OIR F;  4I76 A;  5EZG A;  2M7A A;  2V79 A;  3KZI C;  1W1W E;  1FOW A;  3VOK A;  1K6Y A;  2D1H A;  2R5Y A;  3Q0V A;  1S5L C;  2VIX A;  3OIO A;  4M71 A;  5K5O A;  3GZ6 A;  2P7V B;  1CF7 A;  1XDU A;  3S3M A;  3EYY A;  2IAI A;  2B1E A;  1HW5 A;  4BY7 J;  3H5R A;  3EPZ A;  4YFN F;  2KIF A;  2LKX A;  2XDN A;  1HOM A;  2WB1 N;  4Q5S F;  1W7P A;  4Z2Y A;  4CDG A;  2O6G E;  1VZ0 A;  3OYB A;  3GLL A;  4M3D A;  4HX4 A;  1XC5 A;  1O3T A;  1IN7 A;  1BR2 A;  1ZRF A;  2G7U A;  4E7S A;  1U0J A;  1BA5 A;  4J00 A;  5M5Y J;  1UFM A;  1VQP I;  1Z67 A;  3OYJ A;  3PQJ A;  2EBI A;  2G7L A;  4M3B A;  3J81 Z;  1ZYR F;  4N9H A;  3OYM A;  5J40 A;  4NC8 A;  1MW7 A;  3CC2 I;  4A3K J;  2FBH A;  3OR2 C;  1WI9 A;  3H0G J;  5FRM A;  2BXZ A;  4XLP F;  1ZHF A;  3BR3 A;  5IT9 K;  5J8F A;  3HOU J;  4CCJ A;  4BAY A;  1RES A;  1R1V A;  5DDG A;  1FJL A;  2LDU A;  3CMA I;  2PG4 A;  2A3S A;  4CYC A;  2ZNY A;  3DBR B;  2EFN A;  2ZXI A;  3R6S A;  2GBY A;  4IRI A;  4IHV A;  3JSO A;  1SFX A;  1MDM B;  3L00 A;  1MBK A;  5HS8 A;  2QKM B;  1G3T A;  1YX5 A;  3I56 I;  4QSH A;  2K40 A;  1X19 A;  1MNM C;  1A36 A;  2FUG 2;  3MKZ A;  5B5E C;  1D3Y A;  2WY8 Q;  3SYT A;  1RET A;  2ZXW H;  1O4X A;  4A3I J;  1O7L A;  1EV7 A;  2HYF A;  4A93 J;  4EGY A;  3H35 A;  3GZ5 A;  4YIR X;  3SEQ A;  5CVJ A;  2X51 A;  1A5J A;  4O3M A;  3ZGK A;  3IUO A;  5B1B H;  4Y13 A;  4B43 A;  4B8X A;  5K5R A;  3BG7 A;  5FO5 A;  2Z2S B;  2BY0 A;  1QHH D;  2YU3 A;  3Q9V A;  1ZAR A;  3LQQ A;  2JVG A;  1N77 A;  2OA4 A;  3S3O A;  3A01 B;  4MGR A;  1K4T A;  2M45 A;  4H4K C;  4V2F A;  5ICC A;  2XAQ A;  3LA7 A;  3JRC A;  3P7N A;  1XN7 A;  2XF6 A;  4B47 A;  2KRC A;  1AWC A;  5HDK A;  4XN3 A;  4DYQ A;  5DUI A;  2Q2E A;  4WXH A;  3UKG A;  3BQZ A;  3QOP A;  3F72 A;  5K7H A;  3C2B A;  3CJD A;  3OSG A;  3NI7 A;  4DBQ A;  4ZYG A;  4P9U A;  5F6F A;  1ETW A;  3A4C A;  5ILV A;  1W0T A;  4ENM A;  2DMN A;  3S1M J;  4KN4 X;  3WE3 A;  5FRO A;  1K7A A;  2HTJ A;  1DGR M;  3KP6 A;  2I8D A;  3U2R A;  4LG0 B;  4EJT A;  2LMD A;  5FLX Z;  3ZMT A;  1Y56 A;  4LJZ F;  5JLW A;  1U8B A;  4HRI A;  5TIS C;  2B3W A;  4FIS A;  4GFL A;  1OQY A;  3DV8 A;  3FK7 A;  4II3 A;  4IHS A;  3DTE A;  4M6Y A;  4EJU A;  3L9F A;  3PNT A;  5AON A;  3BCB A;  5EJC A;  2R7S A;  1LEB A;  3VYU B;  4ZDL A;  5CJ9 A;  3CO6 C;  2B9S A;  3I4M J;  3GZI A;  4TV7 A;  5EYR A;  4HDU A;  1BR1 A;  3CDH A;  3ZRG A;  1RRJ A;  2WAD A;  5J4Y A;  1DGW Y;  3KZZ A;  3R0J A;  2KLO A;  5D5U B;  3ZQ7 A;  1W5T A;  3WG9 A;  3KKD A;  2XKO A;  1ON1 A;  1IDY A;  2DXI A;  3KIO A;  2TCT A;  1ZGJ A;  4ZYH A;  3JRG A;  1J2X A;  1MMN A;  4CCN A;  2CQX A;  3K1N A;  4LMY A;  1FBU A;  4UXN A;  3U21 A;  3QRF F;  3O2P E;  2UXI A;  3AG1 H;  3CJN A;  2IS6 A;  3ABL H;  2BW3 A;  5FMP A;  5CYV A;  3LAP A;  5KNL A;  2HGC A;  4B3A A;  5ERI A;  4ZTF A;  5CVI A;  3F8M A;  5C3E J;  2VQG A;  3A0B C;  3WGH A;  2HNH A;  5M3F J;  2EWN A;  5EG0 A;  1BL0 A;  4PFO A;  1NK2 P;  1V54 H;  4C2M A;  2M5W A;  3K7A J;  3W6V A;  2H6C A;  2WAQ A;  3PL8 A;  1LVA A;  2XV4 S;  4I09 A;  1BI1 A;  4WK8 F;  1XB4 A;  2OQR A;  3H9Q A;  3BJA A;  1HKQ A;  1IRZ A;  3IWF A;  1K78 A;  1LDD A;  3SFI A;  4MTD A;  3J81 K;  4CCK A;  5HOO A;  2W57 A;  1W5S A;  2VC1 A;  5C4Y A;  1HF0 A;  2EK5 A;  1HBX G;  1WI3 A;  3SFZ A;  3SXY A;  1JKR C;  4HF2 A;  1T95 A;  4G7O F;  4D9J A;  1PP8 F;  2KIQ A;  3U1D A;  2HFH A;  4M6V A;  3ZPL A;  5H6R A;  1WGX A;  3K9T A;  2BE5 F;  4DZJ A;  2IGO A;  2QZ8 A;  2FJ1 A;  1MGT A;  1SD7 A;  3HOV J;  3D0S A;  3U1K A;  2BY2 A;  1UEL B;  2WY7 Q;  5GAH J;  2Y0M A;  5LFA A;  4E7H A;  1Q1H A;  2WV0 A;  3W2W A;  1ZH5 A;  3V7C A;  5D4R A;  2GWR A;  1T38 A;  3COL A;  1IN5 A;  4IQ4 A;  3HL2 A;  1FSH A;  2IP2 A;  2F5C A;  5BPD A;  3OIQ A;  4OMY A;  4L18 B;  3FXJ A;  2YU9 J;  2DOD A;  4DYC A;  4HX7 A;  4RLQ A;  3ESW B;  5FJ8 J;  4A5N A;  2HYJ A;  3W6J B;  1R5H A;  1ZG3 A;  2KIU A;  3BR5 A;  2V9K A;  4NC6 A;  4NB5 A;  2R7R A;  2NNN A;  2R7Q A;  3JRD A;  3AQS A;  1X3Z B;  5GAD J;  2L01 A;  1U2W A;  4XON A;  1WKM A;  1T2K A;  4A0Z A;  3OSF A;  1GVJ A;  1BM9 A;  1ETK A;  4HKU A;  3S3N A;  4MQV A;  3RPU D;  4LD5 A;  4XKW A;  2VB6 A;  1ON2 A;  3QYB A;  2NVU B;  3PPB A;  1NH3 A;  3NRG A;  3K8P C;  3P9T A;  3C7J A;  3KLN A;  2YSR A;  2QM3 A;  3K70 D;  4A3G J;  2W82 A;  1K83 J;  1JUP A;  2IVM A;  4IRG A;  3V7R A;  1FLI A;  1AHD P;  4GGG A;  5AIP A;  2DJI A;  2DG8 A;  4XID A;  2EFQ A;  3SEZ A;  1YX3 A;  4U9L A;  3S2W A;  4OAY A;  1LVK A;  2E35 A;  2IXS A;  1G6N A;  4EGZ A;  3CCY A;  3OYN A;  1DDN A;  1S3J A;  4FET A;  2VOD A;  3TBI A;  2P0W A;  5A2Q K;  1FT9 A;  4I99 C;  1RR8 C;  3ML6 A;  2Z5U A;  3ABM H;  4YIF A;  1O3R A;  2JUG A;  2DT5 A;  2BY1 A;  2RNJ A;  4XKC A;  5KVR A;  5D8K B;  1BJA A;  5FLX K;  4MQ9 F;  1UAA A;  1A04 A;  1T0F C;  2XVC A;  1D0Y A;  2VPR A;  4D5C A;  3GXO A;  4Y17 A;  3E6M A;  3M07 A;  4YEJ A;  1NHA A;  4FAS D;  1OYI A;  3VIB A;  4F52 A;  3W2A A;  3VTI A;  3HUG A;  4IEJ A;  1OLT A;  4ZJZ A;  3I53 A;  1LQ1 A;  2QQB A;  4ZC3 A;  1R5I D;  3DLA A;  3HTH A;  3K4J A;  1DQU A;  1H0M A;  2JA6 J;  5F04 A;  2LP0 A;  3GTO J;  2XF7 A;  4KT6 A;  1TBX A;  3N05 A;  5TJJ A;  2DT6 A;  1VQO I;  2EZI A;  3KPH A;  4RGU A;  5TGT A;  2B0L A;  1XX5 A;  3S1R J;  3CJR B;  3VYT B;  3R0A A;  3ULQ B;  4A3J J;  4ANJ A;  2XC7 A;  2M9H A;  2XAS A;  4A5M A;  5HLT A;  3DWL E;  2HVR A;  4BY1 J;  1MBH A;  3K70 C;  3PJR A;  1VQ6 I;  3A0H C;  4IZZ A;  2CUF A;  3RYP A;  2QWW A;  4ESB A;  1ZG1 A;  2ZB9 A;  2PMH A;  3BCA A;  1VF9 A;  1MJB A;  3WHB A;  3CC4 I;  2F6C A;  4NNJ A;  1SFE A;  3CLO A;  5LBQ A;  2VBY A;  2EIL H;  4GRI A;  2KZV A;  4XLE A;  3ANP A;  2GA1 A;  1Y1V J;  1P6R A;  2XAU A;  4ZYA A;  3MAJ A;  1XS9 A;  1FC3 A;  1S6L A;  2A61 A;  5DV5 A;  4XOT A;  2OU2 A;  1ETX A;  2O7T A;  2CQN A;  4FE4 A;  4NC7 A;  3H5A A;  5FKL A;  3FK6 A;  1Z77 A;  1WJD A;  4PJM A;  2IU5 A;  2R7W A;  5DAJ A;  4RM3 A;  3FMR A;  5B1A H;  3F3X A;  4ESJ A;  1KYZ A;  3JTH A;  3QOD A;  4HYE A;  4E4H A;  1YJN I;  3VVY A;  3I4N J;  3GFM A;  2EJR A;  5IOZ A;  2FML A;  2MD0 A;  4BS9 A;  2L7M P;  3KCC A;  3OMY A;  3CCR I;  4ETS A;  1TP4 A;  4NQW A;  5LGT A;  2WA0 A;  2WGB A;  1JKO C;  3I9V 2;  2QBY B;  2VI6 A;  2ECB A;  1ZKG A;  2Y75 A;  4N4N B;  2L54 A;  5HDG A;  5ILS A;  1R49 A;  1CGP A;  2QQ8 A;  2OBP A;  5LRR A;  1QHG A;  1FWZ A;  5C4J J;  2E5Z A;  2LBF B;  4ZYD A;  1YHQ I;  1WZ2 A;  2AO9 A;  3FF5 A;  5J3L A;  4JX6 A;  2O0Y A;  1BJZ A;  3LA3 A;  4PFP A;  2R7O A;  4YG2 F;  1QVT A;  3WTS C;  2E36 A;  3I59 A;  4A6D A;  2FE3 A;  2RHA A;  2GEN A;  1G8X A;  4DVY P;  2GQQ A;  2QSF X;  1F9N A;  1J59 A;  1RIO H;  1ZR4 A;  1YW8 A;  2K9M A;  2E5N A;  3FXR A;  4KIB A;  3J80 Z;  5GPA A;  4I7H A;  1VQ5 I;  1JXS A;  5L3C A;  1YFH A;  1Z91 A;  1XSV A;  1Y1W J;  4JL3 A;  3EUK L;  5M5X J;  4BHC A;  4OIQ F;  5LLQ A;  2VUM J;  3LSM A;  1MZB A;  1ZAO A;  2XHK A;  3BY6 A;  4M73 A;  4R1H A;  3TDZ C;  2A69 F;  3K69 A;  3H5N A;  2R92 J;  3F8B A;  1BBY A;  1HKT A;  5CXI A;  4GO1 A;  2CV2 A;  3B6C A;  5FGL A;  4C2U A;  3GFJ A;  1T98 A;  2A2F X;  3FMQ A;  1T0F A;  5J1R A;  1XMX A;  4BXF A;  6PAX A;  1W5C C;  1T8I A;  2BY3 A;  3KNW A;  1LEA A;  4EM1 A;  3GZN B;  2F4O B;  2IGM A;  2M30 A;  2DTR A;  4M3E A;  2IGK A;  5D4S A;  3B81 A;  5K5Q A;  2X6Y A;  2IS1 A;  5CW8 A;  5C44 J;  2KT0 A;  3TED A;  3ABK H;  3T8T A;  1MJA A;  1O7F A;  2KJB A;  1J09 A;  2M1B A;  1I3A A;  5IPA A;  3BRU A;  2MD5 A;  3RQ4 A;  2KPM A;  3QPH A;  4YII A;  3PIP F;  3KYL A;  2JRM A;  1ERD A;  2HKX A;  1YG2 A;  3WU1 B;  3FBI B;  2H8W A;  2G7S A;  2E2J J;  3I5U A;  4RAZ A;  2X6W A;  3IH4 A;  1ZRE A;  4V19 K;  3MMY B;  1JTY A;  1EH8 A;  2ESH A;  2D5V A;  4PXI A;  2JSC A;  3HIM A;  2A6E F;  4RAY A;  3LL7 A;  4IPA A;  4HEA 2;  4DW6 A;  1WVR A;  3CJT B;  3LOC A;  1XPX A;  5ICF A;  2ID6 A;  3E5Q A;  1PUE E;  3BRO A;  3IP4 B;  4EVI A;  2DW4 A;  4BQN A;  3L1P A;  5LHI A;  5GP9 A;  1Z05 A;  2FU4 A;  3BJ6 A;  4U0W A;  2A07 F;  4HNV A;  5DCM B;  3FXL A;  4L5J A;  5IYC J;  4WCG A;  3LFK A;  3LSP A;  4RM2 A;  1TT0 A;  4RAG A;  4WXD A;  4IOC F;  2CUJ A;  2E1C A;  2UXN A;  3VDX A;  2HZD A;  3BR6 A;  1R00 A;  3FMS A;  1Z9C A;  2YR2 A;  4U87 A;  3GWZ A;  5DTD A;  4Q48 A;  3SDG A;  1PJR A;  1PYV A;  2PMU A;  3QP6 A;  1IRF A;  4UUT A;  3KET A;  3KX2 A;  2L9N A;  3TW7 A;  1MD0 A;  1U9O A;  4ESF A;  2EH3 A;  4BHP A;  4UNO A;  3W3C A;  4AU7 A;  1GDT A;  1QPM A;  4BBR J;  2F07 A;  2VXZ A;  4Z6Y A;  1P4W A;  2WTE A;  4Y4R A;  2PJP A;  4X0G A;  1Z21 A;  4F7Z A;  2ZXJ A;  5D5W B;  4OU0 A;  3HXL A;  1YOV B;  2RVC A;  3SZP A;  3LA2 A;  3GTQ J;  2ACJ A;  5DUK A;  2K86 A;  1FOK A;  3G1M A;  3OS0 A;  2EV6 A;  3KE2 A;  1P7I A;  4N4O B;  2W7N A;  1U3E M;  4XOR A;  3NAU A;  1R71 A;  1X1C A;  1R5G A;  1MDM A;  2MC4 A;  2MW8 A;  2PMZ A;  3MN2 A;  4L5E A;  4ZH4 F;  2ETH A;  3RDI A;  1HDP A;  4QIW N;  2DA7 A;  3PQK A;  4BU2 A;  1STZ A;  2L4M A;  1D5Y A;  4AD9 A;  3FBN B;  4WF2 A;  1X3W B;  2NS7 A;  2Q0O A;  2WBM A;  3IHU A;  3OYD A;  5DD8 A;  2GUH A;  3OYA A;  2XB5 A;  4BDY A;  2QIB A;  2LKP A;  2OPT A;  3AG2 H;  3OS2 A;  3SJM A;  1VFC A;  1FOX A;  2NXN B;  4A2U A;  1D5V A;  4AIJ A;  1TWF J;  3VVZ A;  2ZOZ A;  4LIT A;  1RZ4 A;  3GLX A;  3RKX A;  2M8G X;  5E8I A;  3CCM I;  1H89 C;  4A6E A;  5DCF A;  3NRV A;  4CGR A;  2HPI A;  1D8J A;  4F55 A;  2M7B A;  3DBL B;  4KIS A;  2EZH A;  5FB2 A;  2V1N A;  5JHU A;  2NVT J;  1POG A;  3LSI A;  3A01 A;  2RV8 A;  1EH7 A;  2DPD A;  2JA8 J;  3HGY A;  1KQ8 A;  1W36 C;  3E6B A;  2W85 A;  2MBF A;  1O57 A;  5CQE A;  4UV8 A;  3JCU C;  4L9T A;  2DMP A;  2R7U A;  1R1U A;  4AC0 A;  1T33 A;  1Y0N A;  5FLV A;  2XRN A;  3MQ0 A;  5BS6 A;  3M1E A;  3J80 K;  3JRB A;  1SC7 A;  2DBB A;  2P4W A;  1KGS A;  1MBF A;  4M9S A;  4XLA A;  4OD4 A;  3IKT A;  3QU3 A;  2GXG A;  4E6K G;  1ACI A;  2DK5 A;  4AIK A;  2ELK A;  3BOQ A;  5EEA A;  2Y30 A;  1LE8 B;  4PZJ A;  3CJQ B;  2NS8 A;  3RI4 A;  1D0Z A;  1YE9 A;  2EZL A;  4QPQ A;  4XLN F;  1K61 A;  2V1U A;  4LOC A;  1XG1 A;  1JUS A;  4LG0 A;  3M8F A;  4U0V A;  4CIC A;  4HST A;  3HOY J;  4JX4 A;  5E3M A;  3COA C;  2I10 A;  1FIP A;  1UB9 A;  4BDZ A;  2R7V A;  4KA4 A;  2ZNZ A;  1ODD A;  1R36 A;  3IC7 A;  2GOX B;  5D6E A;  3K4L A;  2IA1 A;  2KJC A;  2DAO A;  1ZLJ A;  3RH2 A;  4KIG A;  4HBL A;  5FKN A;  2KIM A;  4Y52 J;  1FEX A;  2XPW A;  1JI8 A;  5EEH A;  2KQR A;  3HTA A;  2EIM H;  3FXM A;  2LRD A;  2GIZ A;  3CD6 I;  1UJ8 A;  4E7J A;  2L7F P;  3FXO A;  2Y0S N;  2IS2 A;  3KP5 A;  2E2H J;  4CA0 A;  2LR8 A;  1R58 A;  3DPU A;  4RAF A;  4AF5 A;  2WB1 A;  2ME0 A;  4M9X A;  2QGU A;  1F4K A;  1BI3 A;  3ON2 A;  2ADU A;  2R5Z B;  2D45 A;  3ZMU A;  2M3A A;  3FKI J;  4WXC A;  4BUP A;  4XKV A;  2IEK A;  1ZRC A;  4C30 A;  2HYT A;  1EA3 A;  3OS1 A;  2CV0 A;  1ZK8 A;  4LB5 A;  3VWB A;  2DMQ A;  1A31 A;  3NPI A;  3REO A;  5BOX A;  2ICW G;  4D7M A;  1K4S A;  1IN4 A;  3QOE A;  4A3F J;  4UUS B;  1VND A;  2WAF A;  2XB0 X;  3ZQF A;  3H3Z A;  3CCU I;  4XOP A;  3QKX A;  3VEP A;  5D1R A;  3GO5 A;  3AAF A;  1TWC J;  3CF2 A;  4HAM A;  5AIQ A;  4GCK A;  2R0Q C;  1BIB A;  1SMT A;  3NWS A;  5DYM A;  2W25 A;  2DLL A;  4CH7 A;  2ME6 A;  5LRS A;  2QTQ A;  3DEE A;  4PSX A;  3CC7 I;  3A1Y A;  3F6O A;  3MWM A;  5F27 A;  1REP C;  4PCQ A;  3M7G A;  3WTZ A;  2ZJP F;  4BEH B;  3TOB A;  3G3Z A;  2QQ9 A;  1B9M A;  1ETY A;  2MLG A;  1B8I B;  2OAZ A;  2X48 A;  3JSJ A;  4IL6 C;  1C0W A;  3DQV C;  4GYI A;  4UUV A;  1X1P A;  1MSF C;  1YRN B;  4D0P A;  1OJL A;  3I64 A;  3M4O J;  5JHF A;  2GIV A;  1N25 A;  4LK0 F;  1G3Y A;  1OCR H;  4BAC A;  1YO5 C;  2V6C A;  2HDC A;  4FX4 A;  3ASO H;  4AYB N;  1HCR A;  2G3B A;  1LUJ B;  1TL8 A;  2QYO A;  3FXQ A;  5GTH C;  1DPR A;  4XLH A;  5EZH A;  4UVA A;  3R4K A;  1H9T A;  2BBY A;  3A02 A;  3ZP5 A;  1Y39 A;  3HRS A;  2G9W A;  2VXD A;  3K10 A;  4RB3 C;  1RNL A;  3K4K A;  4IOA F;  5LD2 C;  4I0B A;  3BCG A;  3KEY A;  2KMU A;  2AS5 F;  2DQR A;  3CDI A;  1P7J A;  1FPQ A;  1MKM A;  2F5V A;  3VYS B;  3VYR B;  1SFU A;  4RA2 A;  3WTY C;  3OYE A;  1GV5 A;  1W0U A;  4AC6 A;  4CCM A;  3CDL A;  3CWR A;  4HV5 A;  3HTJ A;  4BE1 A;  4PK4 A;  5D6F A;  3J7Z I;  2XPV A;  1H9G A;  1LJ9 A;  2KKO A;  3CUO A;  5CPR B;  3IUV A;  1X2N A;  1JT0 A;  2FBI A;  1E0E A;  3G7R A;  2OTL I;  3H9G A;  2X6O A;  5KCM A;  4S0H B;  4EM0 B;  2XPU A;  4Q47 A;  2DN0 A;  5HS7 A;  1DP7 P;  1UST A;  2MSY A;  3R60 A;  4S05 A;  4BXU A;  2W48 A;  3CLQ A;  1YJW I;  1OCP A;  3CP8 A;  5J1Y A;  4YRV A;  2PI0 A;  2KFD A;  1UHW A;  4XNF A;  4E70 A;  4GFB A;  1U9N A;  1T6S A;  2Z33 A;  1LKX A;  1PVE A;  2MGQ A;  4LB6 B;  2YVE A;  4H0E A;  1S72 I;  4PSW A;  1X2M A;  4IVN A;  1PDN C;  3IWZ A;  4MNU A;  4GDF A;  2Y2Z A;  2ZJ2 A;  3ZQC A;  2BVM A;  4OD5 A;  3HZJ A;  4JQF A;  1ZQ3 P;  2HOT A;  2UXO A;  2E71 A;  5EGO B;  5JVT A;  2H8R A;  2AHQ A;  1V5E A;  4XL9 A;  5FHP A;  1YW9 A;  3FIW A;  3DKY A;  3NQO A;  3V8J A;  5HVQ C;  2UXH A;  2DYS H;  2JN6 A;  2GOM A;  3DU5 A;  3HG9 A;  2JA2 A;  3A03 A;  3OL4 A;  4B3X A;  1AKH B;  4NDL A;  4ICH A;  2AXL A;  3GUD A;  2O61 A;  5FKK A;  1XDS A;  4I98 B;  1LFB A;  3MNL A;  1R1T A;  2VQH A;  4DBR A;  4XLF A;  3AQT A;  3ON4 A;  4WWC A;  1HSJ A;  2L5Q A;  3ISP A;  9ANT A;  1JTX A;  3G2B A;  2PQ8 A;  4G6Q A;  2E2I J;  5F0F A;  4G6T B;  2DO7 A;  2P5L C;  1U5T B;  4AID A;  2L3D A;  3M8J A;  3E0J B;  4B48 A;  4Y15 A;  3DPL C;  4DJA A;  4NEL A;  1MJ9 A;  3LWF A;  2E60 A;  3TDU C;  2E7X A;  4HA8 A;  2PJR B;  3CCJ I;  3N4M A;  3DTI A;  2FQ4 A;  2QSH X;  4G9Y A;  1IN6 A;  2B7E A;  4MFE A;  1WCM J;  1V5G A;  2XKP A;  4MXM A;  2Y69 H;  2R7T A;  5HLG A;  5E3O A;  1HST A;  2DA2 A;  3FXK A;  1IGN A;  3E6C C;  3T5X A;  1WRJ A;  3GX4 X;  2EB7 A;  1Z0X A;  3ZCO A;  4GCV A;  3AKZ A;  2L0K A;  3LSG A;  2RAE A;  3RCO A;  2R4G A;  2OER A;  2BYV E;  4XSX F;  4PGG A;  1TNT A;  1HW2 A;  2OD5 A;  4AWX B;  3C2H A;  2AQF A;  2NYX A;  2VL8 A;  5LEK A;  1A35 A;  2DYR H;  3MFK A;  5LEJ A;  4B4C A;  2NS0 A;  1VQ8 I;  5JR3 A;  2HOE A;  4KIF A;  4BBS J;  3BG6 A;  3DEW A;  3PUB A;  5L3D A;  1R9T J;  3VW2 A;  5CQG A;  2IA2 A;  4KT5 C;  3L2W A;  4FX0 A;  3ZQH A;  2RDP A;  2PN6 A;  3AG3 H;  2L9R A;  1WWX A;  2P8T A;  1DPU A;  3KKC A;  5F0H A;  2V6E A;  3PO2 J;  3LST A;  5CVV A;  5DM7 F;  4BXX J;  1SD6 A;  1QBJ A;  2F5D A;  3HJE A;  4LLL A;  3TKY A;  1MSE C;  3B02 A;  3RKY A;  2QEN A;  5F08 A;  1VQL I;  1Z1D A;  2F2E A;  5HNH A;  1HLV A;  1LDK B;  3QYF A;  2NP5 A;  2L02 A;  1QA6 A;  2ZC2 A;  4JP0 A;  2ELJ A;  4I02 A;  4ZDP A;  3HRU A;  4I0A A;  4D7N A;  2ID3 A;  3DBH B;  1FIA A;  3EGQ A;  3E1S A;  2EA4 A;  1UMQ A;  2DFF A;  4BJ5 C;  2QBY A;  3AL0 B;  3HOX J;  2LLK A;  3V6G A;  2STW A;  1TC3 C;  1I6H J;  2Y9Z A;  3IH2 A;  2REK A;  1I5Z A;  1V4R A;  2QQA A;  1P92 A;  2LBF A;  3O6B B;  2ECC A;  2CW0 F;  1WJE A;  2CU7 A;  2FX0 A;  2A68 F;  2VLA A;  2HQN A;  4HDV A;  3WG7 H;  3KEQ A;  1XGO A;  1MH3 A;  1I27 A;  2KP6 A;  1E3O C;  3H1C A;  1BI0 A;  4QPO A;  1MMA A;  4UHT A;  1RC9 A;  1EH6 A;  1SAU A;  2D6Y A;  4MEY F;  2K3P A;  3FM3 A;  1PUF B;  2EIJ H;  1FTZ A;  1YTY A;  3HM5 A;  4JBA A;  4XSZ F;  4BGD A;  3DFG A;  4JK1 X;  2PZ9 A;  3N97 A;  4A3E J;  3IL2 A;  5BNG A;  1YQA A;  3LSH A;  2PBI A;  4UV9 A;  5E20 A;  4C3H J;  4OWR B;  1TT5 B;  2K4B A;  3IKV A;  2NAZ A;  2K9S A;  2R7X A;  3MZ8 A;  3I3L A;  4HPQ A;  1OFC X;  1B9N A;  2UXX A;  3EQL F;  1FSE A;  4KJZ A;  1YIT I;  3NXC A;  1OYW A;  2JA7 J;  4JOM A;  4I2O A;  2WC2 A;  2E1O A;  4XK4 A;  4AVZ A;  3M9A A;  4E7I A;  2JT1 A;  1IJW C;  2HWV A;  5FLM J;  4CXF A;  2MFZ A;  2ZFU A;  4M9Z A;  1T08 B;  4NHJ A;  2NVY J;  3OYC A;  1AA7 A;  5ICG A;  3GTL J;  1GLN A;  2KHM A;  3GTP J;  3E3V A;  5F0C A;  2G7H A;  3RQI A;  2G7G A;  1NK3 P;  3T1B A;  3VVX A;  4FE7 A;  4P96 A;  2MA3 A;  2VN2 A; 
#chains in the Genus database with same CATH homology
 1ZTR A;  5IYD J;  3BR6 A;  3BTC A;  2DA4 A;  4QSH A;  2K40 A;  3VP5 A;  1MNM C;  5DTD A;  3SDG A;  3HKZ N;  1RET A;  4UUT A;  1O4X A;  3TW7 A;  5GPC A;  1U9O A;  4A3I J;  2EH3 A;  4A93 J;  3EUP A;  3KZ9 A;  4JKZ A;  5E3L A;  3JRI A;  2ZCM A;  1GDT A;  2E19 A;  4BBR J;  1A5J A;  2F07 A;  4A3L J;  3PO3 J;  3IV5 A;  5IYB J;  4X6A J;  2NOG A;  2LVS A;  2ZCN A;  4JYK A;  3G1O A;  3GTQ J;  2FD5 A;  4I6Z A;  5K58 A;  3G1M A;  3A01 B;  3S16 J;  3HTI A;  5IOY A;  3HGG A;  3VW1 A;  2YUS A;  3E7L A;  4MIM A;  4V2F A;  1B72 B;  3JRC A;  1P7I A;  2DA3 A;  3TW6 A;  3NAU A;  3WHC A;  3ZOB A;  5DS9 A;  1JKQ C;  3S17 J;  2UXP A;  4DYQ A;  1ITY A;  2YVH A;  1RKW A;  3MN2 A;  4L5E A;  2MW8 A;  3BQZ A;  5K7H A;  3C2B A;  3UKG A;  3CJD A;  3OSG A;  3RD3 A;  3NI7 A;  1HDP A;  4QIW N;  2DA7 A;  1D5Y A;  3C07 A;  4QTR A;  1ETW A;  2NS7 A;  1W0T A;  2GUH A;  2DMN A;  3S1M J;  2XB5 A;  2QIB A;  5C4X J;  2OPT A;  2CJJ A;  5FKM A;  3SJM A;  1VFC A;  4MLO A;  3S14 J;  3VVZ A;  1TWF J;  3O8H A;  2ZOZ A;  2RAS A;  1H89 C;  2M8G X;  3BTJ A;  4GFL A;  3QQA A;  5JLW A;  1U8B A;  4FIS A;  4CGR A;  4XRS G;  2ZOY A;  3FK7 A;  3T6N A;  1S7E A;  2JWT A;  3NAR A;  5CXG A;  3ANG A;  2EZH A;  3IH3 A;  2B63 J;  2NVT J;  1POG A;  3A01 A;  5EG0 B;  3I4M J;  3GZI A;  2JA8 J;  3HGY A;  1JT6 A;  2K9N A;  5EYR A;  1B72 A;  4A3D J;  2DMP A;  4AC0 A;  2DMU A;  1T33 A;  3LSR A;  5FLV A;  1LFU P;  5F1J A;  3JRB A;  5D19 A;  1MBF A;  1MBE A;  3PM1 A;  5IP7 J;  4IHW A;  2FBQ A;  2Y31 A;  3KKD A;  2NVX J;  1IDY A;  2GFN A;  3VPR A;  2ELK A;  2TCT A;  5EEA A;  2IBD A;  1I50 J;  3JRG A;  2LTP A;  2Y30 A;  1LE8 B;  4A3C J;  4ME9 A;  2NS8 A;  3V78 A;  2CQX A;  2EZL A;  2LFB A;  1K61 A;  3HOW J;  4LOC A;  1XG1 A;  2UXI A;  1JUS A;  3HDD A;  3HOY J;  4JX4 A;  5E3M A;  2I10 A;  1FIP A;  5FMP A;  2W53 A;  1IG7 A;  1GT0 C;  3S1N J;  4ABZ A;  4B3A A;  2DMT A;  4J19 A;  5C3E J;  2O7O A;  2ZCX A;  1ETO A;  5M3F J;  4GFK A;  3BJB A;  3BTI A;  5EG0 A;  1BL0 A;  3PAS A;  1SAN A;  3RH2 A;  5HAW A;  5FKN A;  1NK2 P;  4Y52 J;  1FEX A;  2XSD C;  2XPW A;  3K7A J;  3W6V A;  4MK6 A;  3HTA A;  4GCT A;  1DU0 A;  4W97 A;  4XIC A;  2L7F P;  2Y0S N;  1IRZ A;  1G2H A;  4RDU A;  2E2H J;  3SFI A;  4A3M J;  3FIS A;  2LR8 A;  4AF5 A;  5J1U A;  2K9Q A;  1LE8 A;  3D1N I;  5C4Y A;  2DA6 A;  2ME0 A;  1JJ8 C;  3S2H J;  4A3B J;  1HF0 A;  3ON2 A;  2R5Z B;  1SFO J;  1GVD A;  3ZQG A;  1WI3 A;  3FKI J;  2HYT A;  3BTL A;  2JA5 J;  2IEK A;  1JKR C;  1ETV A;  3BR0 A;  2G0E A;  4MO7 A;  1JJ6 C;  1ZK8 A;  4UDS A;  4M6V A;  4A69 C;  3S1Q J;  1WGX A;  3NPI A;  2DMQ A;  3BR2 A;  2X9D A;  3CQZ J;  4DZJ A;  4D7M A;  2HOS A;  2FJ1 A;  4A3F J;  3HOV J;  4UUS B;  1VND A;  3ZQF A;  2XB0 X;  3QKX A;  5D1R A;  1TWC J;  4GCK A;  2R0Q C;  1IDZ A;  1UHS A;  2XGC A;  1UI6 A;  3COL A;  3HB9 A;  3E7Q A;  3BNI A;  2ME6 A;  2L7Z A;  2LY9 A;  2QOP A;  5AQC A;  2QTQ A;  1GUU A;  2QKO A;  5F27 A;  2YU9 J;  4C2M J;  1TWH J;  4DYC A;  1ETY A;  4JNN A;  1B8I B;  4RBO A;  2DG7 A;  5FJ8 J;  2OI8 A;  2X48 A;  1MBG A;  3BHQ A;  3JSJ A;  2HYJ A;  3HEF A;  5IP9 J;  3GTK J;  1MSF C;  1YRN B;  3BR5 A;  2R5Z A;  1OJL A;  3JRH A;  3M4O J;  3MVP A;  3JRD A;  1RR7 A;  3AQS A;  3JR9 A;  1H8A C;  2HQ5 A;  4AYB N;  1HCR A;  3BQY A;  2G3B A;  3MKL A;  4KWA A;  3OSF A;  1Q1V A;  1ETK A;  4W1U A;  2M0C A;  5EZH A;  3ZQI A;  4HKU A;  2COB A;  3BR1 A;  1UG2 A;  1RKT A;  3A02 A;  3QPL A;  4UUS A;  2HXI A;  3PPB A;  1WH7 A;  3VW0 A;  2O9L A;  3NRG A;  3BCG A;  2HOA A;  1HDD C;  2QCO A;  3P9T A;  2Q24 A;  2DA5 A;  1P7J A;  4A3G J;  1K83 J;  1JUP A;  1AHD P;  2DG8 A;  4XID A;  1GV5 A;  3RZD J;  1W0U A;  1ZR2 A;  4X1E A;  3CDL A;  3HE0 A;  4AC6 A;  3CWR A;  4ACI A;  3HTJ A;  3CCY A;  1B8I A;  1ZGW A;  1OCT C;  1BW6 A;  2XPV A;  1NTC A;  3IUV A;  1X2N A;  3LJL A;  1JT0 A;  3S15 J;  3G7R A;  1YRN A;  1MBJ A;  2X6O A;  4S0H B;  3HBL A;  3DCF A;  3G56 A;  2XPU A;  2CQQ A;  2DN0 A;  4JX5 A;  2MSY A;  3Q0W A;  5M3M J;  2VPR A;  3K2A A;  4D5C A;  1BW5 A;  1APL C;  4BKX A;  2W48 A;  2JJ7 A;  1OCP A;  2P81 A;  2UXU A;  5J1Y A;  3GTJ J;  3VIB A;  3ZQL A;  2DTZ A;  4FCY A;  2CUE A;  4GFB A;  3FRQ A;  1U9N A;  3CRJ A;  3RZO J;  2MGQ A;  3GBG A;  4IEJ A;  2YVE A;  1X2M A;  2HXO A;  2Y2Z A;  3ZQC A;  2NX4 A;  5EDN A;  2YS9 A;  2JA6 J;  3GTO J;  5F04 A;  2LP0 A;  1ZQ3 P;  1U78 A;  4GCL A;  2HOT A;  2UXO A;  5EGO B;  2PBX A;  1AU7 A;  2H8R A;  2AHQ A;  3O8G A;  2EZI A;  3TP3 A;  4V2G A;  2V57 A;  4D5F A;  2VKV A;  3S1R J;  5FHP A;  3BT9 A;  3FIW A;  2JK3 A;  4A3J J;  3CMY A;  3LWJ A;  2H1K A;  1SGM A;  2M9H A;  2UXH A;  4BY1 J;  2JN6 A;  2QF7 A;  2Y9Y A;  2XGD A;  4Y7N J;  1MBH A;  2DJN A;  3A03 A;  1A6I A;  2CUF A;  1AKH B;  4NDL A;  3DPJ A;  4ICH A;  5JLX A;  5HOD A;  3VUQ A;  5FKK A;  2ZB9 A;  5EFY A;  1VF9 A;  3WHB A;  1LFB A;  2EZK A;  3MNL A;  2PMZ N;  3GEU A;  4EEF G;  5K7Z A;  5K7F A;  1RPW A;  3AQT A;  1DU6 A;  3ANP A;  1JGG A;  3ON4 A;  1Y1V J;  1XS9 A;  9ANT A;  1JTX A;  2DA1 A;  4XRS A;  2E2I J;  5F0F A;  1ETX A;  2O7T A;  4FE4 A;  2QWT A;  4MFD A;  3RKQ A;  4C3I J;  5FKL A;  3FK6 A;  2NVQ J;  2R93 J;  1Z77 A;  4DYR A;  1UI5 A;  3TP0 A;  2WUI A;  2IU5 A;  2GM4 A;  5DAJ A;  4NEL A;  1F43 A;  2GLO A;  5EGO A;  1GV2 A;  5HBU A;  1ETQ A;  1F36 A;  3I4N J;  3VVY A;  3Q0U A;  3S2D J;  2FQ4 A;  4M3F A;  5IOZ A;  2L7M P;  4MFE A;  1WCM J;  3GTM J;  4MXM A;  3QBM A;  5E3O A;  2DA2 A;  1IGN A;  2WGB A;  5IP6 A;  1I3Q J;  2WV1 A;  1JKO C;  1Z0X A;  3VOX A;  2TRT A;  1AKH A;  2VI6 A;  2L0K A;  3LSG A;  2ECB A;  4IHX A;  1ZKG A;  2M2E A;  2RAE A;  2OER A;  5M5W J;  1JKP C;  3LHQ A;  1ORK A;  5C4J J;  2R5Y B;  4NN1 A;  3O60 A;  5H9T A;  2AO9 A;  2NP3 A;  1MH4 A;  2LK2 A;  4B4C A;  1JUM A;  3HOZ J;  4BBS J;  5J3L A;  3DEW A;  4JX6 A;  1R9T J;  1BJZ A;  3VW2 A;  2M34 A;  4XRM A;  4IHY A;  1CQT A;  5D18 A;  3ZQH A;  1QVT A;  5E3N A;  2RHA A;  2L9R A;  2GEN A;  3KKC A;  5F0H A;  2EQR A;  3Q3S A;  3PO2 J;  1FTT A;  2HKU A;  3F1B A;  3S5R A;  1ZR4 A;  1IC8 A;  1QPI A;  4BXX J;  4YZE A;  3GTG J;  2OF7 A;  3JRA A;  1ENH A;  2KDZ A;  1MSE C;  1TWA J;  5GPA A;  3LNQ A;  5F08 A;  4B1R A;  3QPS A;  1HLV A;  2LD5 A;  2NP5 A;  4G12 A;  1QRY A;  2CRG A;  2MG4 A;  4JP0 A;  1Y1W J;  4JL3 A;  5M5X J;  4D7N A;  2N8G A;  2VUM J;  2ID3 A;  3JRE A;  1FIA A;  3EGQ A;  1WPK A;  5FKO A;  1UMQ A;  1EF4 A;  3HOX J;  2LLK A;  3V6G A;  4I76 A;  5EZG A;  3M3Y J;  1TC3 C;  1I6H J;  3OOU A;  3IH2 A;  2Y9Z A;  2WAQ N;  2R92 J;  2REK A;  2HI3 A;  1X58 A;  3VOK A;  2R5Y A;  5CXI A;  3Q0V A;  3G1L A;  2ECC A;  3OIO A;  3B6C A;  5FGL A;  2CU7 A;  1T56 A;  2FX0 A;  2XGE A;  2IAI A;  2VKE A;  5J1R A;  4BY7 J;  1MH3 A;  4C3J J;  2XDN A;  2LKX A;  4CYC B;  1E3O C;  3KNW A;  1HOM A;  2WB1 N;  4M3E A;  3B81 A;  2D6Y A;  3BG3 A;  1PUF B;  1IV6 A;  1FTZ A;  3B6A A;  1H88 C;  5CW8 A;  5C44 J;  2KT0 A;  3TED A;  3HM5 A;  2HDD A;  4M3D A;  3NNR A;  2PZ9 A;  1XC5 A;  3BG5 A;  1TWG J;  5IPA A;  4A3E J;  3BRU A;  5BNG A;  3JRF A;  1BA5 A;  2XRL A;  2JMW A;  4C3H J;  5M5Y J;  2G7S A;  4FTH A;  2E2J J;  5HSZ A;  1VI0 A;  3IH4 A;  1WH5 A;  2EBI A;  2K9S A;  2O8K A;  1JTY A;  3LSJ A;  4M3B A;  2G7L A;  2D5V A;  4PXI A;  3F0C A;  1OFC X;  3HIM A;  4A3K J;  3NXC A;  2JA7 J;  3H0G J;  4DW6 A;  2E1O A;  4DZP A;  4XK4 A;  3LOC A;  1IJW C;  3BR3 A;  5FLM J;  3H3V K;  3HOU J;  2ID6 A;  5EF6 A;  3L1P A;  1RES A;  1FJL A;  5GP9 A;  2NVY J;  4AUX A;  2R7Z J;  1QVU A;  4HNV A;  4CYC A;  4M3G A;  5IYC J;  3LSP A;  3GTL J;  3HTH A;  3GTP J;  1IUF A;  5F0C A;  2GBY A;  3RQI A;  1PUF A;  1NK3 P;  4IHV A;  2G7G A;  4L62 A;  3VVX A;  3BG9 A;  4FE7 A;  1MBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...