2IEKA

New crystal form of transcriptional regulator tm1030 from thermotoga maritima
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
LSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title New crystal form of transcriptional regulator tm1030 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 70
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2iekA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iekA02
4GFBA 4IHWA 3VVZA 1AU7A 2CJJA 3SJMA 2L7FP 3LJLA 4BY7J 3K7AJ 2IBDA 2DMNA 2DN0A 1R9TJ 3Q0UA 1WI3A 5GPCA 1RPWA 2WAQN 5IP6A 2R5ZB 3FRQA 1MBJA 4B1RA 5FKNA 4C3JJ 2HDDA 4BBSJ 1DU6A 2G7SA 4D7NA 2ECCA 4DW6A 2DG8A 2Y9ZA 1K83J 3CMYA 2NVTJ 2EZLA 1A5JA 1UHSA 3GTQJ 1MBKA 3Q3SA 5K58A 1MBFA 3VPRA 3ZQIA 1IC8A 3ZQCA 1XS9A 1BW5A 2XDNA 3GBGA 2KT0A 4DYRA 1G2HA 3BTJA 3G1OA 1SGMA 3VIBA 1ETQA 3SFIA 3Q0VA 4BXXJ 1IDYA 2EZHA 3HB9A 1Y1WJ 5IP9J 1YRNB 1X58A 2JA8J 1HF0A 4UDSA 2VI6A 3GTPJ 2GBYA 2UXIA 3ON2A 3S5RA 3E7QA 2DJNA 2ECBA 3VVXA 3BNIA 4X1EA 3TW7A 3S1NJ 3NPIA 2QOPA 1IV6A 4NN1A 4A3CJ 4B3AA 2M8GX 5DAJA 2HXOA 3HOWJ 2H8RA 2TRTA 1XC5A 3IH2A 2R7ZJ 5FLVA 4J19A 4AYBN 2DMTA 2F07A 2TCTA 2JK3A 3BG3A 4RBOA 5IPAA 2MG4A 3WHBA 3S2HJ 3CQZJ 1XG1A 3FIWA 1OFCX 1I3QJ 2PZ9A 4LOCA 5DS9A 3IUVA 2DA6A 3S1RJ 3I4MJ 3M3YJ 4MFEA 1H89C 5FKLA 1ETKA 4FE4A 3B6CA 1EF4A 5JLXA 2Q24A 5F1JA 2EZIA 2DA5A 5F27A 2RHAA 1HDPA 2Y31A 5J1YA 2XGEA 5FGLA 2XB0X 1WCMJ 5J1UA 2QIBA 2W48A 3AQSA 2YVHA 1IGNA 4GFLA 5HAWA 3ZQFA 1A6IA 3EGQA 4A69C 1ETXA 2CUFA 3VVYA 1P7JA 2ZB9A 4S0HB 4PXIA 3B81A 5F0HA 2GLOA 3MVPA 3RZOJ 1BJZA 2R5YA 4JNNA 4AC0A 2DMUA 4ACIA 4FTHA 3HOUJ 2DMQA 1DU0A 2DA3A 4BKXA 5CXIA 4M3DA 1E3OC 1X2NA 1U9NA 5EEAA 4IHYA 2LLKA 2PMZN 2FBQA 3LSRA 4M6VA 1ORKA 2HQ5A 4BY1J 3A02A 1ZR2A 4FE7A 2LD5A 2EH3A 3BR3A 4XICA 4Y7NJ 5IYDJ 2NX4A 2XGCA 4D5CA 1W0UA 1IRZA 1NK3P 1PUFA 1TWCJ 3VOXA 5H9TA 3LHQA 2E19A 5M5WJ 3HOVJ 2H1KA 1LFUP 1Z0XA 2B63J 2Y2ZA 2O9LA 2QF7A 5AQCA 1RETA 3PPBA 5E3MA 3ZQGA 4UUTA 5K7HA 2JJ7A 3VW2A 1TWFJ 3PO2J 2HXIA 5M3FJ 3HGYA 4IEJA 2LY9A 2P81A 2YUSA 3BR6A 3JREA 3GTJJ 3HEFA 1POGA 5FJ8J 3COLA 1ENHA 2HOAA 2ID3A 3C2BA 2E1OA 1NK2P 3VUQA 2CQXA 3SDGA 1LE8A 3MNLA 1JTXA 2E2IJ 1OJLA 5FMPA 2M2EA 4A3JJ 1IDZA 1SANA 1RKTA 5GPAA 3TW6A 2G3BA 2VKEA 2REKA 3D1NI 4B4CA 4XRSA 3HTAA 2YU9J 2LFBA 4W1UA 3HKZN 4DZPA 1APLC 2PBXA 3G7RA 4JX4A 2LKXA 2GFNA 2HKUA 3O8GA 2D5VA 1UMQA 5M3MJ 2HOSA 4JKZA 2O8KA 3CRJA 4HNVA 4CYCA 2LK2A 3JRBA 5EYRA 1B72A 4D7MA 3GTMJ 3NI7A 3BT9A 5BNGA 3RD3A 2UXPA 3KKCA 1GDTA 2K40A 2JA5J 1FIPA 3LSPA 3O60A 2NOGA 2G7GA 3QBMA 1GT0C 2LVSA 1T33A 5C44J 2VUMJ 2QWTA 3FK7A 2M34A 3HOXJ 3WHCA 4A3KJ 4L62A 1MBGA 2DA1A 3HDDA 2G7LA 3HIMA 3IH3A 5F04A 4V2FA 2R93J 3VP5A 2ZOYA 2XB5A 4QTRA 3IV5A 2N8GA 3ZQHA 3LSJA 2L9RA 5FHPA 2UXOA 3BTCA 4M3FA 3K2AA 3F1BA 1FTZA 4GCLA 4A3EJ 3JRDA 1JKQC 4Y52J 1AKHA 3JRGA 1WGXA 1MSEC 2UXUA 3BTIA 2CRGA 2ME0A 4FISA 3CDLA 3HOYJ 1FTTA 1VFCA 5EG0A 4I6ZA 2CU7A 3JRCA 2MGQA 4KWAA 2DG7A 3UKGA 2FX0A 5EG0B 1TC3C 3JR9A 2K9SA 5C4JJ 4ABZA 1X2MA 3GEUA 3B6AA 4A3GJ 2L0KA 3BHQA 1OCPA 2HI3A 4W97A 3DCFA 2R0QC 4MFDA 4DYCA 1BW6A 2Y9YA 3IH4A 5C4YA 4UUSA 5M5YJ 4XRMA 1O4XA 9ANTA 4NELA 1FIAA 4UUSB 3HM5A 3LOCA 3ANPA 4C2MJ 1ZTRA 2JA7J 1U78A 2DA7A 3S1QJ 3KNWA 3TP0A 3RZDJ 2HYJA 2ME6A 1TWHJ 5IOYA 3HOZJ 3BJBA 4GCKA 2ID6A 3HTJA 2CUEA 3OOUA 2XPVA 4IHVA 5D1RA 4MO7A 5GP9A 2R5YB 1GV5A 3JRHA 2R92J 3G1LA 2DMPA 1H88C 3V78A 5IYBJ 2OF7A 4A3BJ 1NTCA 1ETVA 4M3BA 4DZJA 3GTOJ 3JRFA 2K9NA 3BCGA 4L5EA 4I76A 3BRUA 4GCTA 5EFYA 4JX5A 2NVYJ 5FKKA 2NP3A 5IP7J 1QPIA 2MW8A 3S17J 5F08A 1SFOJ 3FKIJ 3H0GJ 4BBRJ 4XRSG 3GTGJ 1PUFB 1HCRA 5HSZA 5E3OA 3M4OJ 3VOKA 2OPTA 1MBEA 2IAIA 2COBA 5EF6A 3OSFA 4IHXA 5D19A 3O8HA 1HDDC 5C3EJ 4A3IJ 3BR1A 1U8BA 2AHQA 2UXHA 4GFKA 4JP0A 2AO9A 3QQAA 2ZOZA 4JL3A 3QPLA 1MSFC 4FCYA 3PM1A 1BL0A 3TP3A 3LNQA 1B8IA 4RDUA 1D5YA 2EBIA 1K61A 1U9OA 4AC6A 1B8IB 1RR7A 3BG9A 2WB1N 2ZCXA 1Z77A 2JWTA 2NS7A 3OIOA 1LE8B 5IYCJ 5E3LA 5J1RA 4AF5A 5EZHA 2JN6A 1UI6A 2KDZA 2QKOA 2YVEA 2EQRA 1MNMC 1ZK8A 3A03A 4JYKA 3G56A 1F36A 2MSYA 3S14J 2ZCNA 2R5ZA 1ETOA 5JLWA 4V2GA 1ZR4A 1RKWA 1QVTA 4A3MJ 4G12A 3P9TA 3ZQLA 3DEWA 2OERA 4ME9A 2IU5A 2XGDA 4MIMA 3QKXA 3F0CA 5F0CA 3T6NA 2DA4A 1JTYA 4CYCB 2WUIA 1ZKGA 1B72B 5CXGA 3KKDA 5HBUA 1ZQ3P 3L1PA 1P7IA 4NDLA 3ZOBA 2NS8A 3Q0WA 2XRLA 4A3LJ 3RQIA 3JRIA 1Y1VJ 3LSGA 2VKVA 3HGGA 5J3LA 2JMWA 1Q1VA 3H3VK 1I6HJ 2ZCMA 2M0CA 3ANGA 3OSGA 2E2JJ 1WH5A 2E2HJ 4M3GA 1YRNA 1GVDA 3E7LA 3I4NJ 2X6OA 1UG2A 4ICHA 2FJ1A 2Y30A 4A93J 5EGOA 1JUMA 3BR5A 1W0TA 3W6VA 3MKLA 1FEXA 5EDNA 4MK6A 4C3IJ 5EGOB 2X48A 2K9QA 2I10A 2Y0SN 3MN2A 2OI8A 1VF9A 2M9HA 4MXMA 2HYTA 3HBLA 1AKHB 4MLOA 3DPJA 3S16J 1IUFA 3EUPA 1JJ6C 4YZEA 1TWGJ 1LFBA 1JT0A 1JKPC 2QTQA 5CW8A 1JGGA 1HLVA 1BA5A 3CWRA 4QSHA 5F0FA 2W53A 3NARA 1CQTA 5DTDA 2LP0A 3V6GA 4XK4A 3RH2A 1JUPA 2VPRA 1MBHA 3GTLJ 2GENA 2JA6J 1WPKA 5FLMJ 4QIWN 1JKRC 1JT6A 5FKMA 3CCYA 3JSJA 2CQQA 2IEKA 1QVUA 2L7ZA 5C4XJ 1F43A 1VNDA 1IG7A 2LR8A 1WH7A 1ETYA 4C3HJ 5K7ZA 2YS9A 4D5FA 3LWJA 4A3FJ 3NXCA 5E3NA 2XSDC 2FD5A 1TWAJ 3A01A 3S15J 3CJDA 2RAEA 2L7MP 3NNRA 3NRGA 1VI0A 3A01B 3BG5A 3GZIA 3HE0A 1MH4A 4A3DJ 1H8AC 2XPWA 2RASA 1IJWC 4XIDA 3ON4A 3BR0A 2NP5A 1RESA 1HOMA 1ZGWA 1S7EA 5M5XJ 4HKUA 2GM4A 3G1MA 3TEDA 2WV1A 4M3EA 4CGRA 5FKOA 1MH3A 2X9DA 1AHDP 1ITYA 1I50J 3BTLA 2WGBA 2NVQJ 2DTZA 4DYQA 2G0EA 2O7TA 3BR2A 5HODA 5K7FA 3S1MJ 1GV2A 2LTPA 3RKQA 5D18A 2NVXJ 3GTKJ 3HTHA 4X6AJ 2QCOA 4AUXA 1JUSA 5IOZA 3S2DJ 3HTIA 3KZ9A 1GUUA 3VW0A 1FJLA 2V57A 2EZKA 2FQ4A 3C07A 3PO3J 2GUHA 5EZGA 3NAUA 3VW1A 3AQTA 2ELKA 1QRYA 3JRAA 2D6YA 1UI5A 2HOTA 1JKOC 1ETWA 1T56A 4JX6A 1JJ8C 2XPUA 4EEFG 3FK6A 3QPSA 3FISA 3PASA 3BQYA 3BQZA 2O7OA 1OCTC 2DA2A
chains in the Genus database with same CATH superfamily
4L9TA 2GZWA 4IPAA 1K6YA 1AU7A 2WWYA 4JOMA 1X3UA 4CHUA 3R6SA 1SVLA 4BY7J 1WI9A 2DN0A 4IO9F 1YTYA 1WI3A 2R5ZB 4AD9A 2RNJA 4AU7A 3FRQA 1WRJA 4U0VA 4B1RA 5BPIA 1YO5C 4BNCA 2G7SA 2EA2A 2RREA 3OV8A 3M1CA 2WA0A 1EH7A 2EV0A 2E36A 2ZFWA 3RIRA 1I6XA 2EZLA 3VOEA 2YVXA 2EFPA 2HZTA 3ROUA 3VPRA 3HRTA 3K4BA 4UVCA 1U5TA 1IC8A 1RNLA 4HV6A 1RRJA 2GIZA 2G7UA 2HNHA 4O5VA 1LDKB 3FHZA 1YJWI 3IAM2 1BI1A 2EK5A 3LL7A 1G2HA 4GDFA 3EUHC 2ACJA 1BN5A 2EZHA 1S7AA 3HB9A 1HF0A 5IT9K 3E7QA 1MJBA 2ECBA 2HOEA 2VKHA 1E17A 2H09A 3EDPA 4X1EA 3S1NJ 3BCBA 4RAYA 3ONQA 2OZUA 2BOLA 2DO7A 2HXOA 4MEYF 1J59A 3HOWJ 2H8RA 2JRMA 2TRTA 2XAGA 4XONA 3A2KA 2IA2A 4J19A 2DMTA 3ZXSA 4NC6A 2F07A 4WF2A 2DPDA 5IPAA 2MG4A 2STTA 1Y0UA 4HOBA 1XG1A 3FIWA 1V54H 5DS9A 3H0DA 3K4KA 3HG9A 2MC4A 2ZC2A 1H89C 3LSRA 5L3EA 2Z9OA 3GFJA 1R23A 2HU9A 1EF4A 1MD0A 1QHHD 5JLXA 2X51A 3PSIA 2DA5A 2E1CA 1G6NA 4HZFA 2Y31A 2KIFA 3FMRA 2XB0X 2PX9A 2RQQA 3DPLC 3K4JA 2X0LA 4EJWA 1K4TA 5LGTA 4DVYP 2QIBA 3AQSA 4NBQA 2YVHA 1J7KA 1IGNA 2PFBA 2TDXA 1UELB 1FT9A 4RS8A 4HX4A 4A69C 4OIOF 1P7JA 2VBXA 4S0HB 2P7VB 3PJRA 5F0HA 4DIQA 5GAGJ 2XV4S 3GXOA 1FYLA 1BJZA 3KP2A 2B9SA 1S6LA 2DMUA 2ELJA 4M71A 4UY8I 1BJAA 3K1MA 2D1HA 1ZG3A 5CXIA 3KP4A 3ABTA 3COAC 2Y75A 4KISA 3H3ZA 1BOAA 5FROA 2CG4A 1CGPA 5EEAA 2BZTA 2JUCA 2Q1ZB 3F8MA 3NQOA 1DDNA 4IHYA 3VTIA 1BC8C 1T08B 5B1AH 1ORKA 3ZMZA 4BY1J 2BXZA 2R7DA 4XLNF 2DDBA 5DUIA 2P5KA 1ZR2A 1SEUA 3KYCB 3KPHA 2YR2A 5IYDJ 1J5YA 1GVJA 3QRFF 2NX4A 3U2RA 3GWZA 2XGCA 4I0BA 1D0XA 2ISYA 1Z91A 2WAEA 1FYKA 4PCQA 3C1DA 5H9TA 3HOVJ 4R79A 1LFUP 2H1KA 2LF8A 1WJFA 1LQ1A 2QF7A 2IP2A 3ELKA 3GZNB 1O3SA 2FF4A 1RETA 2M1BA 2OCEA 3M8FA 2DT6A 2GA1A 4IEJA 5LHGA 3JREA 2YUSA 4HV5A 4CCLA 3GTJJ 2CUZA 3HEFA 5FJ8J 4BQAA 3FKJA 2ID3A 3C2BA 4BXFA 1P4WA 1E3PA 3NWSA 2BVLA 1A36A 2P0WA 2ZJQF 5KVRA 3DLAA 4A3JJ 2B1EA 1ERDA 2X6YA 2REKA 3H92A 4KN4X 2EWNA 2FU4A 2L54A 2F4IA 2CH0A 4CZCA 3MZ8A 4CYDA 1E3HA 1APLC 2PFVA 3B73A 1GXQA 1UJ8A 2LKXA 3CUQA 3OYMA 5F6FA 3DLLF 5B1BH 2A3SA 4P55A 3I54A 3BJ6A 4HNVA 4CYCA 2VONA 1DPRA 5D5VB 1B72A 3QOEA 3HSEA 3TBIA 3F8FA 1V5GA 3BT9A 1BOBA 3KFWX 2K7LA 3O60A 4XKVA 1H9GA 3RCOA 3LSPA 4B3XA 3MFKA 3QYBA 1QPMA 1YLFA 4LLLA 3FX3A 2QBYA 3VWBA 3K0LA 2COMA 3LFUA 4L62A 1MBGA 1FP1D 3KZZA 1U2WA 3ISPA 2Q2EB 3AG2H 4E7SA 1MDMB 1K4SA 1WJBA 2XB5A 3AKZA 3JTHA 1LKXA 4XLEA 3K2AA 5KCMA 3HTSB 1R5GA 3E5UA 4GCLA 2HVQA 4A3EJ 2FMLA 1QBJA 1ON2A 2LF7A 2QENA 2UXUA 3CDLA 5DCFA 3HOYJ 5CVRA 1VFCA 3C3WA 4M9SA 4I6ZA 3SWHA 4Q5SF 2E7XA 1YIOA 4NB5A 2DG7A 4PJLA 2FX0A 2Y0SA 5EG0B 2MA3A 1MJAA 4II3A 5DUKA 3TOBA 5C4JJ 2M45A 3G4SI 2HYFA 2I5UA 5KAIC 4AIKA 2HI3A 3D5SC 2R0QC 2W7NA 3I56I 1ZG1A 4JK1X 4DYCA 3WE3A 4U7DA 1BW6A 1G8XA 5C4YA 2HKXA 5HS7A 4AYBA 3N97A 4IL6C 9ANTA 2BY2A 4NELA 4UUSB 1TTYA 2Y0MA 4EJUA 4E70A 1NG7A 4ZDLA 1QO0D 2ZJPF 2DA7A 3GYHX 1Y6IA 4PGHA 3LSTA 1TWHJ 2XASA 5CKTA 3SQNA 1HKQA 2ID6A 5CLSA 4F3QA 2WBMA 3HTJA 4HRIA 4KUMA 3M7GA 3VDXA 3WTVC 4RB0A 1ZREA 1XCVA 3SFZA 3JRHA 2O6GE 3G1LA 5LHHA 2CV1A 4KNYA 3CLQA 5IT3A 3CCLI 1USSA 5IYBJ 1NH3A 1A35A 4LFUA 4U0YA 4A3BJ 4LG0B 2ZJRF 4AVZA 3GVAA 4DZJA 1TT5B 4BEHB 2K9NA 3JRFA 4L5EA 2D45A 2XIGA 3LWFA 5D8KB 4N0BA 1MMAA 1SFXA 3HYIA 2NP3A 2V6CA 4R1HA 3S17J 3OYCA 3H0GJ 4BBRJ 3B02A 2PMHA 1PUFB 2VOPA 2JTVA 3HHHA 5HSZA 4HYEA 3FXKA 1K6OA 3VOKA 3LAJA 4EATA 2IAIA 1SMYF 1AOYA 1LUJB 1Z6TA 1VQLI 3OSFA 2HQAA 4IHXA 3CP2A 5D19A 3PUFA 3GLXA 1HDDC 1O7LA 3DWLE 1MMSA 1U8BA 3EUAA 1Y39A 3CC2I 3V42A 4JL3A 1XCBA 5AONA 1E2XA 1UFMA 4FCYA 2DI3A 2PMZA 3KIOA 1B8IA 2ZO4A 2OBPA 1K61A 2PJPA 1ULYA 2LBFA 2MLKA 3FF5A 1YJ9I 2HVSA 2NS7A 5IYCJ 1OLTA 5ICGA 5J1RA 5EZHA 2JN6A 2QKOA 3ZMVA 2EQRA 3M8EA 3F22A 1MNMC 1FWZA 2VJJA 2R3SA 3ZMTA 4FETA 3VEPA 3S14J 5D4RA 4HBLA 4ZYEA 2QVOA 2FRHA 1TQIA 1USTA 4Z6YA 2XGDA 4XKWA 5L3FA 4IRIA 4ME9A 1D1BA 4XL9A 3H5NA 4ANJA 5F0CA 3H9QA 4KIGA 4CZZA 2OA4A 3CCUI 3HSRA 1JTYA 3LA7A 5CXGA 2ADUA 2E35A 1LDDA 3GW2A 3L1PA 4HF0A 4NDLA 5D6FA 2NS8A 3Q0WA 2XRLA 3KX2A 1VQOI 3ABUA 2A6TA 3AG3H 1Q1VA 2DOEA 2ZCWA 3FBNB 1UHWA 1ZYRF 3NRVA 3K70C 1YRNA 3T8RA 4N4OB 4E7KA 2L02A 3WTXC 2NYXA 2PEXA 2FJ1A 2STWA 2EA4A 5EGOA 2ICWG 1X1DA 3G3ZA 1VQ6I 4U87A 4RGXA 3KEQA 4BQNA 4M6YA 1PP7U 2ZXWH 2I10A 2DYSH 2Y0SN 2OI8A 2VJIA 5DEQA 2Z3YA 4ZDPA 1YG2A 3W2WA 3OYKA 2HYTA 1AKHB 1BI0A 2E7WA 1IAWA 3X2QH 4MLOA 5HLHA 3DPJA 4KT5C 2QLZA 1JJ6C 1TWGJ 1HXDA 2OJED 3CJNA 1RI7A 4E7LA 2QTQA 4A6EA 4KIFA 5CW8A 3KEOA 5DM6F 3J7YJ 1HLVA 4XLFA 3RPUA 4RB1A 5F0FA 2E71A 2W53A 3QP5A 3RH2A 1MBHA 1FMVA 4XLCA 3VP5A 1JT6A 4HA8A 3BJAA 4G7OF 4G9YA 1T39A 2W84A 2CQQA 2Z1DA 2F5VA 1Z7LA 5C4XJ 1IG7A 2MFZA 1WH7A 1ETYA 5JVGF 2M5WA 1T6SA 2HKOA 4A3FJ 2PJRB 2KLOA 2E60A 2XSDC 2B3WA 4U7BA 3A01A 3T0YA 1S72I 1VQKI 3OYEA 3NNRA 1VI0A 2EFQA 4PFPA 3SEQA 2ZSHB 3ERMA 3ON4A 1FNNA 1XX5A 2OD5A 2GA2A 1BC7C 1HOMA 2GM4A 3UR3C 3OYHA 3G71I 1TL8A 2VC1A 1JI8A 2V6EA 2X9DA 4NQWA 3BTLA 4LGWA 1EKEA 1S3JA 3F72A 2DTZA 4KIBA 1W1WE 2LH9A 3BR2A 5K7FA 1BR4A 2VBWA 2VQGA 5D18A 2R7XA 3PNTA 3N4MA 4UVBA 1MMNA 4LB5A 2DCEA 5LRRA 2V1DA 2C6YA 4X6AJ 1YQAA 4ENJA 4EV0A 1GUUA 1HW1A 2QGUA 1FJLA 2V57A 3C07A 2JVHA 4G6QA 4IXAA 5E20A 4ZYDA 1YYVA 5E1WA 4A0YA 3PO3J 3T8TA 1YS7A 3K9TA 2PBIA 2BHYA 3GZ6A 4M74A 3J81Z 4WWCA 1LDJA 2HPMA 2HOTA 1JKOC 1ETWA 1WHUA 3E0JB 2GXAA 2HDCA 2L7MP 2O7OA 2V9KA 1D0ZA 3E5QA 3ABMH 4IHWA 4EMSA 3VVZA 4UXNA 2NNYA 2YX4A 3LJLA 3V7CA 2BY3A 4MGRA 2IS1A 5ILUA 4WX9A 2IBDA 3DV8A 1RPWA 5LHIA 4ZZLA 1D1CA 4ZYGA 1JHHA 3QPTA 1J75A 1Y8RB 2CFXA 4C3JJ 3R4KA 4BBSJ 1FSHA 2ECCA 1XGNA 4HX8A 4CCNA 2Y9ZA 1PDNC 2MBFA 2NNNA 1W5CC 2PQ8A 1OYIA 3RDIA 3V8JA 4EJOA 4ZYHA 2NVTJ 2F5EA 5HS9A 3G6EI 4L5IA 2A5WA 3HTUA 1MBKA 1YITI 3L00A 3Q3SA 1WQ2A 3MQ0A 1MBFA 2BVMA 1F9NA 5B66C 4I01A 4HDUA 1XS9A 1XTAA 1XD7A 3V7RA 2BXYA 4XLPF 2FXAA 3GBGA 1BW5A 3W6JB 4DYRA 3HXLA 1UHMA 4BDYA 1U0JA 4H4KC 1ETQA 4CO8A 3KYDB 4P96A 1BIBA 1G4DA 4ZYAA 5IP9J 1W36D 4UDSA 2VI6A 1FOKA 2NAZA 2KKOA 3S5RA 2ZKZA 2H8WA 1Z21A 2DJNA 4RB2C 2ISZA 1SMTA 3VVXA 1S8NA 1IV6A 4NN1A 4LMYA 4B3AA 4I98B 2VE9A 5FLXZ 1XB4A 3DEEA 2L01A 4I09A 1XC5A 2DOAA 5CQGA 5FLVA 2KIQA 3VYRB 2TCTA 2JK3A 4RBOA 3G73A 3WHBA 2CGPA 3I53A 1T98A 1OFCX 1I3QJ 1KGSA 4XRFA 4LOCA 2DQLA 1HW2A 4CCOA 2ESHA 3K10A 4CGZA 2RV8A 3I4MJ 4IRVA 2LYCA 2VBZA 3M3YJ 1WJ5A 4GGGA 5GTHC 3F6OA 2A69F 4M6XA 4AIJA 2K4JA 2L7KA 5FRNA 2Q24A 2H6CA 2ZXJA 5JHFA 2RHAA 1GLNA 5B3SH 3LSKA 3CP8A 4BYYA 2E5ZA 2JVGA 1SD5A 1OR7A 1SD4A 5J1UA 2KP6A 3IL2A 1G3SA 2EFWA 2W48A 3TO7A 1TQPA 2M87A 1A6IA 4PFOA 3IAS2 1ZARA 2B7EA 5A2QK 4IQ4A 2CUFA 3IKTA 3VVYA 4EGYA 3ESWB 4OOIA 4E7IA 1V4RA 1WJDA 3BDDA 3H35A 3PNVA 3WG7H 1TW3A 4EM1A 4F93B 4JNNA 1P92A 2DJIA 1HC8A 4BU2A 2BY1A 2GWRA 2VXDA 4FTHA 1N77A 5CVVA 5D4SA 1MJ9A 3TQNA 4BKXA 2CYYA 2VQHA 3HHGA 4OAYA 3AAFA 1X2NA 1VQ7I 2CW0F 4HNUA 1X3ZB 4IZZA 3DTEA 1EH8A 3E3VA 3FZVA 1YHQI 2M4GA 2MD0A 2UXXA 2EH3A 4B43A 4Y7NJ 3OYFA 2MYSA 3MMYB 3OOPA 4BH9A 1IRZA 2CSOA 3F9KA 1IRGA 3QU3A 2WADA 2E19A 2W00A 5M5WJ 3A4CA 1Z0XA 3OYAA 3NWTA 2R7WA 3PPBA 3VW2A 2V1UA 1TWFJ 2XHKA 3QODA 3HGYA 2V9PA 2WV0A 3COLA 3JTGA 1ENHA 1RUNA 1IXCA 3UNGC 3WG9A 5ED4A 4YIFA 4S05A 5DV5A 3TDZC 2W4SA 1LE8A 3C18A 4HQEA 3I59A 1OJLA 3KETA 5FMPA 1WJAA 3BROA 1RKTA 2FOWA 2P8TA 2X1EA 4B4CA 4UV8A 3HTAA 2YU9J 2LFBA 3HKZN 1ZGJA 1LFPA 3G7RA 1FSEA 1F4KA 4XN0A 2JSCA 5JI6A 2WTEA 3O8GA 3QPHA 1TP4A 4CCMA 2HOSA 2R7VA 5GAEJ 2IT0A 3JRBA 2WAQA 4PZJA 5EYRA 1K7AA 1YOVB 4IRGA 4LIVA 4IHSA 3GTMJ 3RD3A 4N4NB 3ABKH 2UXPA 1GDTA 3VB2A 2LY1A 4XQFA 3QBMA 4U88A 3CDHA 1MNEA 1MGTA 2J5PA 2VUMJ 3F21A 1G3TA 4KJZA 2M34A 4C2UA 2RVCA 3HOXJ 2K02A 2FBHA 2QUFA 2VQCA 3K70D 4BDZA 4A3KJ 1UZCA 2QBYB 3SYTA 4ZDOA 1MZBA 2IA1A 3K4MA 3HDDA 1QZEA 2X6XA 4V2FA 3H5AA 5DD4A 2KDOA 2XRNA 2ZMEB 4U0WA 4ESFA 5LGUA 4I2OA 2ZOYA 2CW8A 2N8GA 4C30A 3ZQHA 5FHPA 3BTCA 4H0EA 1D8KA 3RI4A 2GLOA 3ZRGA 1FTZA 1P2FA 2DK8A 1JKQC 1MSEC 4F92B 4NC8A 2QA4I 1A04A 2ME0A 4FISA 3L9FA 3RKWA 1FTTA 4II2A 4DJAA 3IRQA 3JRCA 3DPUA 3UKGA 1UCRA 1FOXA 4BJTA 1KU7A 4Y4RA 1TC3C 3JR9A 4KMFA 1SD7A 4ABZA 2L0KA 2ZMEC 3ZMSA 1OCPA 1I27A 3MKZA 5B5EC 4MFDA 5E8IA 3W2AA 2Y9YA 1BI2A 4XRMA 1O4XA 1FIAA 4XKBA 4HLXA 3LOCA 3CMAI 4A12A 1S5LC 4IOAF 4C2MJ 2IGNA 3JSOA 1ZTRA 3S1QJ 4HF1A 2HYJA 2ME6A 5BQTA 3HOZJ 1V3FA 2CUEA 3VSLA 3DEUA 4MO7A 5GP9A 2R5YB 1WZ2A 3A1YA 3DBHB 3L2QA 5LLQA 2DMPA 3BZKA 1KU9A 1XDSA 2GAUA 2X85A 4AVPA 3V78A 3V4GA 2CQ7A 4A0XA 3RTRA 2XROA 3DU5A 2HPIA 4CSWA 4KT6A 2KHMA 1TT0A 4I76A 3BRUA 3BG7A 2BHZA 1NG6A 1XDUA 1QPIA 3HUGB 1SFOJ 2H94A 4XRSG 5ILSA 1HCRA 1J9IA 3E6DA 4GYGA 2BBYA 2OPTA 1MBEA 3CCVI 2HVRA 1ZH5A 2JZYA 2WC2A 5JVTA 4A3IJ 1A31A 2AHQA 3S3MA 4V19K 2UXHA 3QQAA 2ZOZA 3QPLA 2FUG2 4RMNA 2ELHA 5HLGA 2DQRA 2F4MB 5TJJA 3RJPA 1K79A 3TP3A 1K78A 4RDUA 2YPRA 1D5YA 1REPC 5K5QA 1B8IB 3BG9A 3EQLF 3KEYA 1T0FC 1EJ9A 2KJBA 1F36A 4HSRA 3R60A 4C2TA 2ZCNA 3EUHA 2R5ZA 1U8RA 1LVKA 1IN5A 3DKWA 1PVEA 3DPTA 1B9NA 5EEGA 2B0LA 1RKWA 1TQMA 1BI3A 1QVTA 1XMXA 4QPOA 4G12A 1Z3XA 5LEJA 2KRFA 2M30A 3DEWA 3PL8A 4M73A 2FBKA 3R0JA 1QGPA 3F0CA 1ZRCA 1VQ8I 1W36C 3T6NA 4BGDA 2RGVA 3OL3A 2VJ4A 2J5OA 3KKDA 1ZLKA 1P7IA 2WY8Q 4A3LJ 1R6RA 2R7QA 3RQIA 4MTDA 3V7SA 1Y1VJ 2KIUA 3HGGA 5H20A 3H3VK 4WIBA 1I6HJ 2KZVA 1RUOA 2ZCMA 4N9HA 4WXDA 2E2JJ 1WH5A 4EJVA 4M3GA 1VZ0A 2E2HJ 3AG4H 3ASOH 5K5OA 1Z3YA 4BE0A 1W0TA 3W6VA 3MKLA 1FEXA 5EDNA 5EGOB 4EGZA 3M1EA 3RYRA 2K5CA 4XKCA 2QKLB 3WTTC 3JAMZ 5GADJ 4NHJA 1LJ9A 1VF9A 1U6GA 3SEZA 3SZGA 2ZFUA 1VQMI 3BPVA 1IUFA 4BHBA 3EUPA 1IRXA 4Q47A 5H2FC 4LITA 2HTSA 1JGGA 5ICCA 1BA5A 3CWRA 1YX5A 4QSHA 3CF5F 2EPFA 3OYNA 5HOOA 1F1ZA 5DTDA 2LP0A 3GTLJ 3BLYA 1V5FA 1WPKA 1JKRC 4RM3A 5E79C 4MNUA 5FKMA 4KDPA 2H27A 4G6TB 2VJ5A 4DQ2A 1DP7P 1YIJI 5BMZA 1QVUA 2L7ZA 1R1VA 3ULQB 3J7AO 1RZ4A 5HNHA 4C3HJ 4E4HA 5K7ZA 2IJLA 3CO7C 2BV6A 2EV5A 2YS9A 4CA0A 4U9LA 4LJZF 4OD4A 2FQ3A 2VODA 1STZA 1TWAJ 4IQJA 3S15J 4BAYA 1UB9A 4OU0A 3A01B 3BG5A 5FO5A 4C9YA 4A3DJ 1HKTA 4XIDA 2Z33A 3LQRA 1ONVA 3H1CA 4XSXF 1TW2A 3TEDA 1MH3A 2DAOA 1AHDP 1ITYA 1I50J 1T95A 1KYZA 2JSPA 4NNJA 5LD2C 5DM7F 5HODA 2XKOA 2QQ9A 2GXGA 5KAFC 2QM3A 1D3YA 2R4GA 2NVXJ 3KZYA 3PNYA 3J80Z 3HTHA 2CQNA 3R61A 1XMAA 2QCOA 3HTIA 1JUSA 3S2DJ 1X1CA 3REOA 3KZ9A 3K6GA 4RAGA 4CCKA 1Z67A 3VW0A 2EZKA 2XUBA 4BACA 3HOSA 3PQKA 4PDKA 3GFIA 3VW1A 2ELKA 2ZXHA 1VQNI 3JRAA 2L4MA 2D6YA 2KL4A 3CC7I 4JX6A 1R4MB 2GIVA 3FK6A 3QPSA 3FISA 3PASA 3RZDJ 1Y56A 1YW9A 2OU2A 2FMYA 3I55I 4XLAA 1O3QA 3TO6A 2LC2A 2L7FP 1N25A 3HRSA 2JQ7A 1IN6A 2XGXA 2DMNA 2NRAC 5E1ZB 5IP6A 3TL4X 1MBJA 4DGWB 2X6WA 5FKNA 2UWMA 4D7NA 4DW6A 2DG8A 3KE2A 1G3YA 1FOYA 1K83J 3HC7A 4CUGA 1QQIA 5LRSA 6PAXA 1EA3A 1CF7B 4K2EA 3BP8A 2KRCA 5HVQC 3AL0B 3GTQJ 3CCRI 2QQBA 3QU6A 5K58A 1FYMA 2IA0A 3ZN1A 3T1BA 1S29A 5GAHJ 1IN8A 2R7TA 3HRUA 3HOTA 4BQQA 3SFIA 3Q0VA 3WTUC 2A2FX 4BXXJ 1IDYA 3KP5A 1SFKA 1Y1WJ 4HPQA 1X58A 2PG4A 2JA8J 1X3WB 2DFFA 2GBYA 2L4AA 3P9IA 4LK0F 2UXIA 3ON2A 2HYGD 2K9LA 4AIDA 2HEOA 3TW7A 4G6DA 4Q48A 1KU2A 2IW5A 3PQJA 4B47A 4A3CJ 2VC0A 4ZZDA 3WODF 2A05A 5L3GA 2Q2EA 1MDMA 1G59A 1E0EA 4XOPA 2LDUA 4AYBN 4E6KG 3BG3A 4WK8F 4HX7A 2JT1A 4AM3A 1W5SA 4JQFA 3S2HJ 3CQZJ 2VE8A 4PSXA 1IN4A 2PZ9A 4GXOA 4OIRF 4UNOA 5L3DA 3IUVA 3S1RJ 4MFEA 4E7ZA 3WGIA 3H9GA 2XC7A 3B6CA 1HSJA 3TGNA 1JXSA 1SC7A 2EZIA 2K9MA 5AIPA 5F27A 1H0MA 1HDPA 5J1YA 2IS4A 5FGLA 3VYSB 3MZYA 4ENMA 3ABLH 2HQRA 2CO5A 3O2PE 1WCMJ 5FFXA 4ENNA 5DCMB 4P9UA 1PUEE 3EETA 4GFLA 3ZQFA 2OCCH 1R1TA 4UB6C 5ICFA 4M9ZA 5ICEA 4GCVA 2JUGA 1IXRC 2XAUA 4XOTA 4PXIA 3IWFA 3B81A 5J4YA 1B9MA 4EM0B 3TO9A 3QYEA 2DDAA 1OISA 3MCZA 2L9SA 4ACIA 1PJRA 4KN7X 1N78A 3MD2A 1DU0A 1HKSA 2DA3A 3PUBA 4KYWA 3FXLA 2GXBA 3CCJI 4M3DA 4F7ZA 1E3OC 3G2BA 4LG0A 1RR8C 4L18B 4AWXB 1XGSA 1W7PB 2LLKA 2HS5A 2PMZN 2W82A 3DBRB 4TV7A 3GMEA 1OCOH 4M6VA 4BEHA 1V55H 3A02A 2LKPA 4FE7A 4R8HA 2LD5A 4XICA 2DW4A 2VKDA 5HNFA 4IF4A 2KRHA 4D5CA 2RKHA 1I3AA 3PIPF 4Z2YA 1W0UA 3OYDA 1PUFA 1TWCJ 3DQVC 5BS6A 1J2XA 2IS6A 1KONA 1HBXG 3V8LA 4L0ZB 3LHQA 2VB6A 2Y2ZA 3TMOA 5CJ9A 5AQCA 4Y3OA 5CVIA 5E3MA 2BW3B 3ZQGA 4UUTA 5J8CA 2JJ7A 2OTJI 1MMGA 1ACIA 3OWTA 1ZRDA 3PO2J 2PMUA 2HXIA 2QWWA 3OYGA 2LY9A 2P81A 2R7FA 3BR6A 3H9JA 3OL4A 3LFKA 1WSUA 1POGA 1PYVA 2HOAA 4ASNA 3S93A 3CCQI 4BXUA 3PFYA 2RC4A 3FXQA 2W1OA 2E1OA 4BJ5C 1NK2P 2CQXA 1JTXA 2E2IJ 4A5NA 2FEZA 1IDZA 2R7RA 2G3BA 2VKEA 4OIQF 1B1BA 1FC3A 1R71A 2Y69H 4JBAA 4W1UA 3ZQ7A 4XMYA 2XF7A 3OS0A 1U5TB 1QZZA 5DDGA 2PBXA 4JX4A 2K86A 1N75A 5E8GA 3I0TA 5TISC 4RGRA 2HKUA 4B09A 4J00A 5M3MJ 3C2HA 4JKZA 4G94A 2OV7A 2YU3A 1Z6RA 5IY5H 2EIJH 1UAAA 2O8KA 2X1CA 2ZXIA 3IUOA 2LK2A 3RYPA 4D7MA 3DBLB 3WGGA 3CF2A 3NI7A 4RGUA 4ZTJA 4DBQA 3KKCA 2JA5J 4FQGA 1GHCA 2NOGA 1GT0C 1T33A 1ZLJA 5C44J 2LMDA 2MD5A 1U5TC 3FK7A 5AIQA 2ZY9A 1TBXA 1WKMA 3DXJF 1QZYA 2F5FA 5D8LB 3ERED 4I0AA 2XAQA 3F3XA 4LD5A 5F04A 2VN2A 4ZTFA 3CJQB 3DFGA 4QTRA 2CUJA 1SFEA 3IV5A 2OZ6A 2L9RA 1ZN2A 3DP7A 2UXOA 4M3FA 4MQ9F 1DQUA 1B59A 1L3LA 1O3TA 1P9QC 4Y52J 4FT8A 4ESBA 3JRGA 1WGXA 1AKHA 5IT9Z 3BTIA 3HE0A 4IVNA 4MEXF 3I5UA 2YX7A 2CU7A 5BPDA 2FJI1 4KWAA 3H5RA 1HW5A 3J7ZI 1WJCA 2DXIA 2K9SA 2HTJA 4XBFA 3ZR8X 3S2WA 4LK1F 3GEUA 2A6EF 2K3FA 2EFNA 3B6AA 3I64A 3SZPA 1LPQA 4W97A 3DCFA 5H6QA 3D5RC 5KK1A 1IW7F 3FHNA 3TOAA 5ERIA 3WU0A 2E1MB 2DT7B 1X19A 5HLTA 5FD6A 2AXTC 4DNCA 1YW8A 3LA2A 4B8XA 3S3OA 2JA7J 1U78A 1KZHA 4Y33A 1OCRH 2V4JC 2W24A 5H6RA 3TP0A 5IOYA 2E5NA 5HDKA 2PJRA 3BJBA 1FMWA 2M0MA 1J09A 1DGWY 4HEA2 2V1XA 2LG4A 3ZCOA 4EQQA 3OR2C 4IHVA 5D1RA 1GV5A 5ILVA 2R92J 2V79A 3RPUD 2DFHA 4AIHA 4O6JA 3DKYA 1BIAA 3A0HC 1TNSA 1WJEA 2E1MC 2FOKA 3HJEA 5L3BA 3QWLA 2ZSIB 3HZJA 4NUBA 2M4KA 2V7FA 1NTCA 3RKXA 1ETVA 3BCGA 3J81K 2GOXB 5FRMA 2LREA 2KZGA 5EFYA 4JX5A 2NVYJ 3K8PC 5KHDA 5IP7J 4CICA 2MW8A 1KU3A 2EIKH 5F08A 2AQEA 4S04A 1IF1A 2DYRH 3GTGJ 3AFHA 1ODDA 3M4OJ 2M7AA 3LMMA 3I4PA 1MIJA 1BR2A 3I58A 4HSTA 2COBA 2LRDA 4G7HF 2OTLI 3CESA 3KP6A 5E17F 1R49A 5CPRB 2BEOA 2AO9A 2PLYA 3M8JA 2V9VA 1EH6A 1SD6A 1BL0A 2QQAA 3F8BA 2LKSA 4GCKA 1X1AA 1IRFA 2EBIA 3IP4B 3O6BB 3P5JA 5FGMA 4AC6A 1RR7A 2ZCXA 2DT5A 3CD6I 2JWTA 2CV0A 3NEUA 4UB8C 3Q9SA 1Q1HA 3F6VA 4BHPA 2ETHA 2YVEA 1ZK8A 1P4AA 1KQ9A 2QKMB 3GLLA 2FBIA 4JYKA 4OINF 1HA8A 3G56A 3F8NA 2MSYA 2Q0OA 2A5YB 3O3KA 1J0RA 5JLWA 1MNDA 4GYIA 4A3MJ 1MKMA 2CQKA 5GTIC 2PI0A 3P9TA 3ZQLA 3CUQB 3FDYA 2IU5A 4MIMA 3QKXA 3VODA 2EILH 1I5ZA 1P4XA 3CJTB 4BJ6C 1DUXC 4CYCB 2F5DA 1ZKGA 4PJ0C 1R7JA 5HDNA 4YFXF 1B72B 5FLXK 3FWEA 2BGCA 2DBBA 4A0ZA 5EEHA 1Y8QB 2CW7A 2KISA 2DTRA 3LSGA 1LNWA 2L5QA 1R4NB 3ML6A 5E1XA 2O61A 3OSGA 3KLOA 3CCSI 1GVDA 2X6OA 1UG2A 3CUQC 1NHAA 4ICHA 2Y30A 3BR5A 3PFIA 4OIPF 3LAPA 2G7HA 3CLOA 4HQMA 4PGGA 4M9XA 4ZJZA 4NC7A 2O03A 2K9QA 3VSKA 4MQVA 3FMQA 4KICA 1IO2A 3MN2A 4BQOA 5CVJA 2HWVA 3S3NA 3W2VA 2F48A 3ZMDA 1LB2A 1FZPB 3JCUC 3BZCA 1JKPC 2P6SA 3MEXA 4RA2A 2OUMA 5EJCA 1XSDA 2O0YA 3BPXA 3RPQA 3CCEI 3U21A 3OY9A 3V6GA 1JUPA 2VPRA 1YFHA 2GENA 1X4OA 2JA6J 2K27A 1XPXA 2IVMA 3EUKL 2MC3A 3HPGA 2A6HF 4IX7A 2NXNB 3EYIA 4C2MA 1FBUA 2IEKA 2XAFA 4WCGA 4FX0A 1VNDA 4G8XA 2LR8A 2QSGX 2CS3A 3IC7A 3NXCA 5E3NA 2VIXA 3CMEI 2FD5A 2HQNA 1OKRA 4YG2F 1OCZH 3CJDA 2RAEA 2L2OA 3NRGA 2ZBKA 1VQ4I 3GZIA 4UV9A 1SAUA 2RASA 3HIFA 4F55A 1IJWC 4HG2A 1BM9A 3BR0A 2NP5A 4YEJA 1ZGWA 1S7EA 5M5XJ 3P7NA 1T8IA 2KFDA 2WV1A 4M3EA 2XAJA 1QA6A 3E6MA 1W4MA 2WGBA 1HQCA 4DYQA 2G0EA 2O7TA 1GV2A 4IKFA 3RSNA 4Q4ZF 3RKQA 2CMPA 3CUOA 1ZAOA 3GTKJ 5CQEA 2W57A 4AUXA 5IOZA 2L9NA 3EPZA 2VL8A 4ETSA 2H1LA 2FQ4A 4KMUX 4Y17A 2EV6A 2GUHA 2JPCA 5EZGA 5LEKA 2F4OB 5FD5A 3ECOA 2QSFX 3OYLA 2F2EA 2EJRA 2XKPA 3VYUB 3K69A 1QRYA 1JHFA 2FA5A 4XSZF 5K5RA 4EEFG 3KZIC 5J40A 4BUPA 3K4CA 3V8KA 3BQZA 4XN3A 2LBFB 1OCTC 1FX7A 1W7PD 2A68F 3KYLA 4GRIA 4GFBA 4LG3A 4XLHA 2CJJA 3Q9VA 3SJMA 1IN7A 2RQPA 4A6DA 4ESJA 3K7AJ 1S7OA 1VQ9I 1R9TJ 3Q0UA 5GPCA 2WAQN 1XGMA 2HDDA 1DU6A 3MZHA 3U1KA 2UZKA 2ZJ2A 3JSPA 1ZHFA 2IGOA 1OMIA 3S8PA 3CMYA 4D1QA 1A5JA 1UHSA 1I1SA 1WVRA 3IKVA 4B48A 3FBIB 2LY2A 3J7AY 4F91B 1KQ0A 2FSWA 3ZQIA 1W5TA 3ZQCA 1AWCA 2UUZA 2XDNA 2KJCA 2KT0A 1DPUA 2I8DA 3BTJA 4IHTA 3G1OA 2KMUA 1SGMA 3VIBA 2IXSA 2O8XA 4CH7A 3GFMA 3Q5FA 3SXYA 3OS1A 3IWZA 1BR1A 3MKYB 1YRNB 1I1GA 3GZ5A 2K85A 3GTPJ 4E7JA 3GCMA 3KP3A 4P1WA 4OMYA 1RIOH 3BNIA 5J4VA 5LBQA 2VT3A 2QOPA 3NPIA 3TDUC 1G3WA 5JR3A 2M8GX 3L2VA 2VBYA 3FXOA 1UG0A 3H36A 1R36A 3P9CA 4L0YB 3BZ6A 2NVUB 4CDGA 5DAJA 2IRFG 4HNTA 3C2GA 4IRHA 3RKYA 3ZN0A 3WU2C 1ZG5A 2CWEA 3IH2A 2ZMEA 2R7ZJ 1D1AA 1X1PA 3K4LA 2XF5A 2FNPA 4D0PA 3EYYA 3W3CA 3L2RA 3WU1B 1R00A 1H9TA 1YE9A 2DA6A 3C7JA 4PJMA 4IOCF 4LB6B 1XMKA 4KFCA 4CXFA 5FKLA 5LGNA 1ETKA 4FE4A 4O3MA 2UXNA 4EJTA 2Z2SB 3QOPA 5F1JA 2IGKA 1YW7A 4G7ZF 2XGEA 1IUYA 1O7FA 1OYYA 2R7SA 1KA8A 3ECHA 3L09A 5K1YA 3L2CA 4OMZA 2M3AA 4UUVA 3BCAA 5HAWA 1R5ID 3DU6A 3EGQA 1QU3A 2HR3A 1ETXA 2MABA 4BE2A 2ZB9A 2EINH 1XGOA 4RAZA 3MVPA 3RZOJ 2R5YA 4HF2A 4AC0A 2QSHX 4NQWB 3ZQQA 2NS0A 4YRVA 3HOUJ 2DMQA 3K1PA 1VQ5I 2OQRA 4PUSA 4XNFA 1DP3A 2LOOA 2VPLA 1U9NA 2DU9A 4FX4A 3WE2A 4D9JA 2FBQA 3FXUA 5JHUA 2O3FA 1U3EM 2HQ5A 3BY6A 1XN7A 3CMMA 4WXCA 3BR3A 3MKWB 2O5RA 3HUGA 1NK3P 1AA7A 4I99C 3ZPLA 3VOXA 2OC6A 4OD5A 1X1BA 3QP6A 2BE5F 1WWXA 1Z1DA 2B63J 1T0FA 2O9LA 4BL0B 2P5VA 3SZTA 4P5OA 5K7HA 4HAMA 3MAJA 3DTKA 5M3FJ 2FE3A 4BHCA 3F8CA 4FASD 2DODA 2ZNYA 4PK4A 4KITB 3LSMA 4OWRB 3VUQA 3SDGA 4RM2A 3GO5A 3MNLA 1RC9A 2M2EA 1D5VA 1SANA 2RDPA 5GPAA 3TW6A 3FXMA 3F23A 3DTIA 3D1NI 5LFAA 3R0AA 1IV8A 4XRSA 3FM3A 3OYJA 2WB1A 4IJAA 4HW0A 3CJRB 3BG6A 3L2WA 4DZPA 1O3RA 2WAFA 2Z5UA 2D2WA 4X0GA 4E7HA 2XDVA 4RLQA 2JRTA 4HDVA 4LLNA 2D5VA 2GFNA 1UMQA 4PSWA 4ON0A 3WTZA 1FBQA 2DK5A 3CRJA 1YS6A 2BY0A 3HSFA 3L7WA 5FB2A 3E6CC 3JAMK 1TNTA 2W25A 1A6QA 3AL0C 1KYWA 4YFNF 5BNGA 4ZC3A 2IGMA 2K40A 1FIPA 3OS2A 2G7GA 3GX4X 2P5LC 2LVSA 2AS5F 1TZLA 4YELA 2QWTA 1EV7A 3OIPA 3WHCA 3MWMA 3I9V2 3HL2A 5HLIA 3U1DA 2DA1A 2G7LA 5L3CA 3HIMA 3IH3A 4QWQA 2R93J 4EVIA 1R22A 1LVAA 2V26A 3LSJA 5D5WB 3F1BA 2CFOA 5E18F 3RQ4A 4YIIA 5J8FA 3JRDA 1O57A 3LQQA 3OYBA 2H6BA 5CYVA 3E97A 3FXJA 2CRGA 3WTWC 3SHFA 4F52A 5D5UB 5EG0A 3E1SA 4ZH4F 2MGQA 1QHGA 1FP2A 2M7BA 3SDBA 1OQYA 1VQPI 4M72A 1SAXA 1X2MA 4A3GJ 3BHQA 1XSXA 4BS9A 1JE8A 3KLNA 3GUDA 1QNTA 1D8JA 1IXSB 3IH4A 4WXHA 2W85A 4UUSA 3H3UA 5M5YJ 2MH9A 2E34A 4B44A 1WFXA 3CZ6A 4XORA 1GXPA 1FLIA 2R7UA 3HM5A 1ON1A 3TKYA 3ANPA 4A2UA 2XSJC 2P7CB 1XSVA 3KNWA 2E1NA 4L9VA 3OOUA 2XPVA 4LLGF 3J80K 3BOQA 2P6TA 1SVMA 4I02A 5KNLA 4UHTA 4EM2A 1FY7A 2D1VA 3K4NA 1F5TA 1OR7C 1H88C 2FNAA 3CO6C 5TGTA 2ZNZA 3IRRA 5D6EA 4L5JA 2OF7A 2HGCA 3N05A 4M3BA 3T5XA 5FFZA 3QAHA 5HS8A 3GTOJ 2GQQA 4QPQA 2WY7Q 2JPBA 4GCTA 5FKKA 5A2QZ 1Z9CA 2L3DA 4OAZA 4N9IA 1VTNC 3FKIJ 3M9AA 3K1NA 5E3OA 5F1RA 1R5HA 1MW7A 3CDIA 4XM3A 4FHTA 5EF6A 4RB3C 3BJOA 2QZ8A 3LSHA 3O8HA 5C3EJ 1FBSA 3BR1A 1ZRFA 4GFKA 4JP0A 2GOMA 2RN7A 1MSFC 3A0BC 2DFEA 3DF8A 3PM1A 4ENKA 2DOFA 3LNQA 4P9FA 1C0WA 1U9OA 5CVUA 2LSOA 2WB1N 3W6KB 1Z77A 3OIOA 1LE8B 1B4AA 4PJNA 5E3LA 1HSTA 4AF5A 1UI6A 3I59B 2KDZA 4UVAA 2Z99A 3A03A 4U9NA 3CC4I 1T2KA 2Y48A 3OYIA 3HRMA 2M8EA 1ETOA 4V2GA 2XVCA 2AQFA 4MTEA 1ZR4A 1YI2I 2OAZA 2G9WA 3CCMI 4KA4A 2EFOA 3KP7A 4DBRA 3OIQA 4YFKF 5TRDA 5BOXA 2OERA 4HLYA 3P9KA 3IHUA 2DA4A 5J47A 5DYMA 1OPCA 2WUIA 2HDWA 5HBUA 1ZQ3P 4J01A 2V1NA 4XR6A 1JGSA 3VFZA 3ZOBA 3JRIA 5J3LA 2VKVA 1R1UA 2JMWA 2M0CA 3FM5A 3ANGA 2VLAA 1X4PA 2MH2A 3E7LA 3HPHA 1M1EB 3I4NJ 3HKZA 2OQGA 4A93J 1JUMA 2P4WA 2VOOA 3U9GA 4MK6A 4C3IJ 5D5XB 3JW4A 3VYTB 2EB7A 2X48A 4ITVA 1YX3A 3PSFA 3NS4A 2AXLA 1T38A 2UV1A 2M9HA 2VQLA 2EIMH 2F6CA 2HZDA 4MXMA 1ZGAA 3QYFA 3HBLA 3LSIA 1Z05A 3GFLA 3S16J 4Y15A 5F64A 1FPQA 4YZEA 1LFBA 1JT0A 1SVOA 3KCCA 1OYWA 1DGRM 1R58A 2ESNA 4MHGA 3E5XA 2A61A 3I71A 3NARA 1CQTA 3WTYC 2XAHA 4XK4A 2KPMA 3D5LA 2DLLA 2Q8KA 2VT2A 1Z7UA 2JA2A 2KQRA 4QIWN 5FLMJ 2DFIA 2MLGA 2Z16A 4RAFA 2RNGA 3ZP5A 2PN6A 2VXZA 3CCYA 1V5EA 3LA3A 4BE1A 1YJNI 3JSJA 1Y0NA 4PJJA 1F43A 4RGSA 2LNBA 4DOZA 2A07F 4D5FA 3PIOF 3LWJA 3CTAA 5DCMA 2BYVE 4LIUA 2X4HA 3OR1C 5JFRA 2VASA 4L9JA 1S9HA 5DD8A 1MH4A 2K4BA 3ASNH 1LEBA 2F5CA 2XPWA 2K3PA 3BWGA 2KIMA 5HDGA 3WTSC 1H8AC 3OMYA 3M07A 5J6XA 4GO1A 1RESA 2QQ8A 4Y13A 3G1MA 3I3LA 4CCJA 4HKUA 1MMDA 4CGRA 5FKOA 2R7OA 2XF6A 2QYOA 1L0OC 2NVQJ 3WGHA 1D0YA 3DKXA 3D0SA 3S32A 1P6RA 3S1MJ 2QEXI 3K2ZA 1KQ8A 2LTPA 4YIRX 4L9NA 1OCCH 3ZMUA 3ZGKA 4RLFA 1W7PA 1CF7A 1B6AA 3E6BA 4A5MA 3GF2A 1IZ1A 1PP8F 2X1DA 1ZELA 2HFHA 1FOWA 2IS2A 2DPUA 1SFUA 1BBYA 1I39A 3BC8A 2CV2A 4QLCU 3L2UA 2L9VA 1TLHB 3NAUA 3AQTA 3AG1H 3FXRA 3GEZA 1UI5A 1K78B 1T56A 1JJ8C 2XPUA 2NOJB 2BW3A 2IPQX 2YSRA 4I7HA 1LEAA 3BQYA 3FMSA 2DA2A
chains in the Genus database with same CATH topology
4GFBA 4IHWA 3VVZA 1AU7A 2CJJA 3SJMA 2L7FP 3LJLA 4BY7J 3K7AJ 2IBDA 2DMNA 2DN0A 1R9TJ 3Q0UA 1WI3A 5GPCA 1RPWA 2WAQN 5IP6A 2R5ZB 3FRQA 1MBJA 4B1RA 5FKNA 4C3JJ 2HDDA 4BBSJ 1DU6A 2G7SA 4D7NA 2ECCA 4DW6A 2DG8A 2Y9ZA 1K83J 3CMYA 2NVTJ 2EZLA 1A5JA 1UHSA 3GTQJ 1MBKA 3Q3SA 5K58A 1MBFA 3VPRA 3ZQIA 1IC8A 3ZQCA 1XS9A 1BW5A 2XDNA 3GBGA 2KT0A 4DYRA 1G2HA 3BTJA 3G1OA 1SGMA 3VIBA 1ETQA 3SFIA 3Q0VA 4BXXJ 1IDYA 2EZHA 3HB9A 1Y1WJ 5IP9J 1YRNB 1X58A 2JA8J 1HF0A 4UDSA 2VI6A 3GTPJ 2GBYA 2UXIA 3ON2A 3S5RA 3E7QA 2DJNA 2ECBA 3VVXA 3BNIA 4X1EA 3TW7A 3S1NJ 3NPIA 2QOPA 1IV6A 4NN1A 4A3CJ 4B3AA 2M8GX 5DAJA 2HXOA 3HOWJ 2H8RA 2TRTA 1XC5A 3IH2A 2R7ZJ 5FLVA 4J19A 4AYBN 2DMTA 2F07A 2TCTA 2JK3A 3BG3A 4RBOA 5IPAA 2MG4A 3WHBA 3S2HJ 3CQZJ 1XG1A 3FIWA 1OFCX 1I3QJ 2PZ9A 4LOCA 5DS9A 3IUVA 2DA6A 3S1RJ 3I4MJ 3M3YJ 4MFEA 1H89C 5FKLA 1ETKA 4FE4A 3B6CA 1EF4A 5JLXA 2Q24A 5F1JA 2EZIA 2DA5A 5F27A 2RHAA 1HDPA 2Y31A 5J1YA 2XGEA 5FGLA 2XB0X 1WCMJ 5J1UA 2QIBA 2W48A 3AQSA 2YVHA 1IGNA 4GFLA 5HAWA 3ZQFA 1A6IA 3EGQA 4A69C 1ETXA 2CUFA 3VVYA 1P7JA 2ZB9A 4S0HB 4PXIA 3B81A 5F0HA 2GLOA 3MVPA 3RZOJ 1BJZA 2R5YA 4JNNA 4AC0A 2DMUA 4ACIA 4FTHA 3HOUJ 2DMQA 1DU0A 2DA3A 4BKXA 5CXIA 4M3DA 1E3OC 1X2NA 1U9NA 5EEAA 4IHYA 2LLKA 2PMZN 2FBQA 3LSRA 4M6VA 1ORKA 2HQ5A 4BY1J 3A02A 1ZR2A 4FE7A 2LD5A 2EH3A 3BR3A 4XICA 4Y7NJ 5IYDJ 2NX4A 2XGCA 4D5CA 1W0UA 1IRZA 1NK3P 1PUFA 1TWCJ 3VOXA 5H9TA 3LHQA 2E19A 5M5WJ 3HOVJ 2H1KA 1LFUP 1Z0XA 2B63J 2Y2ZA 2O9LA 2QF7A 5AQCA 1RETA 3PPBA 5E3MA 3ZQGA 4UUTA 5K7HA 2JJ7A 3VW2A 1TWFJ 3PO2J 2HXIA 5M3FJ 3HGYA 4IEJA 2LY9A 2P81A 2YUSA 3BR6A 3JREA 3GTJJ 3HEFA 1POGA 5FJ8J 3COLA 1ENHA 2HOAA 2ID3A 3C2BA 2E1OA 1NK2P 3VUQA 2CQXA 3SDGA 1LE8A 3MNLA 1JTXA 2E2IJ 1OJLA 5FMPA 2M2EA 4A3JJ 1IDZA 1SANA 1RKTA 5GPAA 3TW6A 2G3BA 2VKEA 2REKA 3D1NI 4B4CA 4XRSA 3HTAA 2YU9J 2LFBA 4W1UA 3HKZN 4DZPA 1APLC 2PBXA 3G7RA 4JX4A 2LKXA 2GFNA 2HKUA 3O8GA 2D5VA 1UMQA 5M3MJ 2HOSA 4JKZA 2O8KA 3CRJA 4HNVA 4CYCA 2LK2A 3JRBA 5EYRA 1B72A 4D7MA 3GTMJ 3NI7A 3BT9A 5BNGA 3RD3A 2UXPA 3KKCA 1GDTA 2K40A 2JA5J 1FIPA 3LSPA 3O60A 2NOGA 2G7GA 3QBMA 1GT0C 2LVSA 1T33A 5C44J 2VUMJ 2QWTA 3FK7A 2M34A 3HOXJ 3WHCA 4A3KJ 4L62A 1MBGA 2DA1A 3HDDA 2G7LA 3HIMA 3IH3A 5F04A 4V2FA 2R93J 3VP5A 2ZOYA 2XB5A 4QTRA 3IV5A 2N8GA 3ZQHA 3LSJA 2L9RA 5FHPA 2UXOA 3BTCA 4M3FA 3K2AA 3F1BA 1FTZA 4GCLA 4A3EJ 3JRDA 1JKQC 4Y52J 1AKHA 3JRGA 1WGXA 1MSEC 2UXUA 3BTIA 2CRGA 2ME0A 4FISA 3CDLA 3HOYJ 1FTTA 1VFCA 5EG0A 4I6ZA 2CU7A 3JRCA 2MGQA 4KWAA 2DG7A 3UKGA 2FX0A 5EG0B 1TC3C 3JR9A 2K9SA 5C4JJ 4ABZA 1X2MA 3GEUA 3B6AA 4A3GJ 2L0KA 3BHQA 1OCPA 2HI3A 4W97A 3DCFA 2R0QC 4MFDA 4DYCA 1BW6A 2Y9YA 3IH4A 5C4YA 4UUSA 5M5YJ 4XRMA 1O4XA 9ANTA 4NELA 1FIAA 4UUSB 3HM5A 3LOCA 3ANPA 4C2MJ 1ZTRA 2JA7J 1U78A 2DA7A 3S1QJ 3KNWA 3TP0A 3RZDJ 2HYJA 2ME6A 1TWHJ 5IOYA 3HOZJ 3BJBA 4GCKA 2ID6A 3HTJA 2CUEA 3OOUA 2XPVA 4IHVA 5D1RA 4MO7A 5GP9A 2R5YB 1GV5A 3JRHA 2R92J 3G1LA 2DMPA 1H88C 3V78A 5IYBJ 2OF7A 4A3BJ 1NTCA 1ETVA 4M3BA 4DZJA 3GTOJ 3JRFA 2K9NA 3BCGA 4L5EA 4I76A 3BRUA 4GCTA 5EFYA 4JX5A 2NVYJ 5FKKA 2NP3A 5IP7J 1QPIA 2MW8A 3S17J 5F08A 1SFOJ 3FKIJ 3H0GJ 4BBRJ 4XRSG 3GTGJ 1PUFB 1HCRA 5HSZA 5E3OA 3M4OJ 3VOKA 2OPTA 1MBEA 2IAIA 2COBA 5EF6A 3OSFA 4IHXA 5D19A 3O8HA 1HDDC 5C3EJ 4A3IJ 3BR1A 1U8BA 2AHQA 2UXHA 4GFKA 4JP0A 2AO9A 3QQAA 2ZOZA 4JL3A 3QPLA 1MSFC 4FCYA 3PM1A 1BL0A 3TP3A 3LNQA 1B8IA 4RDUA 1D5YA 2EBIA 1K61A 1U9OA 4AC6A 1B8IB 1RR7A 3BG9A 2WB1N 2ZCXA 1Z77A 2JWTA 2NS7A 3OIOA 1LE8B 5IYCJ 5E3LA 5J1RA 4AF5A 5EZHA 2JN6A 1UI6A 2KDZA 2QKOA 2YVEA 2EQRA 1MNMC 1ZK8A 3A03A 4JYKA 3G56A 1F36A 2MSYA 3S14J 2ZCNA 2R5ZA 1ETOA 5JLWA 4V2GA 1ZR4A 1RKWA 1QVTA 4A3MJ 4G12A 3P9TA 3ZQLA 3DEWA 2OERA 4ME9A 2IU5A 2XGDA 4MIMA 3QKXA 3F0CA 5F0CA 3T6NA 2DA4A 1JTYA 4CYCB 2WUIA 1ZKGA 1B72B 5CXGA 3KKDA 5HBUA 1ZQ3P 3L1PA 1P7IA 4NDLA 3ZOBA 2NS8A 3Q0WA 2XRLA 4A3LJ 3RQIA 3JRIA 1Y1VJ 3LSGA 2VKVA 3HGGA 5J3LA 2JMWA 1Q1VA 3H3VK 1I6HJ 2ZCMA 2M0CA 3ANGA 3OSGA 2E2JJ 1WH5A 2E2HJ 4M3GA 1YRNA 1GVDA 3E7LA 3I4NJ 2X6OA 1UG2A 4ICHA 2FJ1A 2Y30A 4A93J 5EGOA 1JUMA 3BR5A 1W0TA 3W6VA 3MKLA 1FEXA 5EDNA 4MK6A 4C3IJ 5EGOB 2X48A 2K9QA 2I10A 2Y0SN 3MN2A 2OI8A 1VF9A 2M9HA 4MXMA 2HYTA 3HBLA 1AKHB 4MLOA 3DPJA 3S16J 1IUFA 3EUPA 1JJ6C 4YZEA 1TWGJ 1LFBA 1JT0A 1JKPC 2QTQA 5CW8A 1JGGA 1HLVA 1BA5A 3CWRA 4QSHA 5F0FA 2W53A 3NARA 1CQTA 5DTDA 2LP0A 3V6GA 4XK4A 3RH2A 1JUPA 2VPRA 1MBHA 3GTLJ 2GENA 2JA6J 1WPKA 5FLMJ 4QIWN 1JKRC 1JT6A 5FKMA 3CCYA 3JSJA 2CQQA 2IEKA 1QVUA 2L7ZA 5C4XJ 1F43A 1VNDA 1IG7A 2LR8A 1WH7A 1ETYA 4C3HJ 5K7ZA 2YS9A 4D5FA 3LWJA 4A3FJ 3NXCA 5E3NA 2XSDC 2FD5A 1TWAJ 3A01A 3S15J 3CJDA 2RAEA 2L7MP 3NNRA 3NRGA 1VI0A 3A01B 3BG5A 3GZIA 3HE0A 1MH4A 4A3DJ 1H8AC 2XPWA 2RASA 1IJWC 4XIDA 3ON4A 3BR0A 2NP5A 1RESA 1HOMA 1ZGWA 1S7EA 5M5XJ 4HKUA 2GM4A 3G1MA 3TEDA 2WV1A 4M3EA 4CGRA 5FKOA 1MH3A 2X9DA 1AHDP 1ITYA 1I50J 3BTLA 2WGBA 2NVQJ 2DTZA 4DYQA 2G0EA 2O7TA 3BR2A 5HODA 5K7FA 3S1MJ 1GV2A 2LTPA 3RKQA 5D18A 2NVXJ 3GTKJ 3HTHA 4X6AJ 2QCOA 4AUXA 1JUSA 5IOZA 3S2DJ 3HTIA 3KZ9A 1GUUA 3VW0A 1FJLA 2V57A 2EZKA 2FQ4A 3C07A 3PO3J 2GUHA 5EZGA 3NAUA 3VW1A 3AQTA 2ELKA 1QRYA 3JRAA 2D6YA 1UI5A 2HOTA 1JKOC 1ETWA 1T56A 4JX6A 1JJ8C 2XPUA 4EEFG 3FK6A 3QPSA 3FISA 3PASA 3BQYA 3BQZA 2O7OA 1OCTC 2DA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFB A;  4IHW A;  3VVZ A;  1AU7 A;  2CJJ A;  3SJM A;  2L7F P;  3LJL A;  4BY7 J;  3K7A J;  2IBD A;  2DMN A;  2DN0 A;  1R9T J;  3Q0U A;  1WI3 A;  5GPC A;  1RPW A;  2WAQ N;  5IP6 A;  2R5Z B;  3FRQ A;  1MBJ A;  4B1R A;  5FKN A;  4C3J J;  2HDD A;  4BBS J;  1DU6 A;  2G7S A;  4D7N A;  2ECC A;  4DW6 A;  2DG8 A;  2Y9Z A;  1K83 J;  3CMY A;  2NVT J;  2EZL A;  1A5J A;  1UHS A;  3GTQ J;  1MBK A;  3Q3S A;  5K58 A;  1MBF A;  3VPR A;  3ZQI A;  1IC8 A;  3ZQC A;  1XS9 A;  1BW5 A;  2XDN A;  3GBG A;  2KT0 A;  4DYR A;  1G2H A;  3BTJ A;  3G1O A;  1SGM A;  3VIB A;  1ETQ A;  3SFI A;  3Q0V A;  4BXX J;  1IDY A;  2EZH A;  3HB9 A;  1Y1W J;  5IP9 J;  1YRN B;  1X58 A;  2JA8 J;  1HF0 A;  4UDS A;  2VI6 A;  3GTP J;  2GBY A;  2UXI A;  3ON2 A;  3S5R A;  3E7Q A;  2DJN A;  2ECB A;  3VVX A;  3BNI A;  4X1E A;  3TW7 A;  3S1N J;  3NPI A;  2QOP A;  1IV6 A;  4NN1 A;  4A3C J;  4B3A A;  2M8G X;  5DAJ A;  2HXO A;  3HOW J;  2H8R A;  2TRT A;  1XC5 A;  3IH2 A;  2R7Z J;  5FLV A;  4J19 A;  4AYB N;  2DMT A;  2F07 A;  2TCT A;  2JK3 A;  3BG3 A;  4RBO A;  5IPA A;  2MG4 A;  3WHB A;  3S2H J;  3CQZ J;  1XG1 A;  3FIW A;  1OFC X;  1I3Q J;  2PZ9 A;  4LOC A;  5DS9 A;  3IUV A;  2DA6 A;  3S1R J;  3I4M J;  3M3Y J;  4MFE A;  1H89 C;  5FKL A;  1ETK A;  4FE4 A;  3B6C A;  1EF4 A;  5JLX A;  2Q24 A;  5F1J A;  2EZI A;  2DA5 A;  5F27 A;  2RHA A;  1HDP A;  2Y31 A;  5J1Y A;  2XGE A;  5FGL A;  2XB0 X;  1WCM J;  5J1U A;  2QIB A;  2W48 A;  3AQS A;  2YVH A;  1IGN A;  4GFL A;  5HAW A;  3ZQF A;  1A6I A;  3EGQ A;  4A69 C;  1ETX A;  2CUF A;  3VVY A;  1P7J A;  2ZB9 A;  4S0H B;  4PXI A;  3B81 A;  5F0H A;  2GLO A;  3MVP A;  3RZO J;  1BJZ A;  2R5Y A;  4JNN A;  4AC0 A;  2DMU A;  4ACI A;  4FTH A;  3HOU J;  2DMQ A;  1DU0 A;  2DA3 A;  4BKX A;  5CXI A;  4M3D A;  1E3O C;  1X2N A;  1U9N A;  5EEA A;  4IHY A;  2LLK A;  2PMZ N;  2FBQ A;  3LSR A;  4M6V A;  1ORK A;  2HQ5 A;  4BY1 J;  3A02 A;  1ZR2 A;  4FE7 A;  2LD5 A;  2EH3 A;  3BR3 A;  4XIC A;  4Y7N J;  5IYD J;  2NX4 A;  2XGC A;  4D5C A;  1W0U A;  1IRZ A;  1NK3 P;  1PUF A;  1TWC J;  3VOX A;  5H9T A;  3LHQ A;  2E19 A;  5M5W J;  3HOV J;  2H1K A;  1LFU P;  1Z0X A;  2B63 J;  2Y2Z A;  2O9L A;  2QF7 A;  5AQC A;  1RET A;  3PPB A;  5E3M A;  3ZQG A;  4UUT A;  5K7H A;  2JJ7 A;  3VW2 A;  1TWF J;  3PO2 J;  2HXI A;  5M3F J;  3HGY A;  4IEJ A;  2LY9 A;  2P81 A;  2YUS A;  3BR6 A;  3JRE A;  3GTJ J;  3HEF A;  1POG A;  5FJ8 J;  3COL A;  1ENH A;  2HOA A;  2ID3 A;  3C2B A;  2E1O A;  1NK2 P;  3VUQ A;  2CQX A;  3SDG A;  1LE8 A;  3MNL A;  1JTX A;  2E2I J;  1OJL A;  5FMP A;  2M2E A;  4A3J J;  1IDZ A;  1SAN A;  1RKT A;  5GPA A;  3TW6 A;  2G3B A;  2VKE A;  2REK A;  3D1N I;  4B4C A;  4XRS A;  3HTA A;  2YU9 J;  2LFB A;  4W1U A;  3HKZ N;  4DZP A;  1APL C;  2PBX A;  3G7R A;  4JX4 A;  2LKX A;  2GFN A;  2HKU A;  3O8G A;  2D5V A;  1UMQ A;  5M3M J;  2HOS A;  4JKZ A;  2O8K A;  3CRJ A;  4HNV A;  4CYC A;  2LK2 A;  3JRB A;  5EYR A;  1B72 A;  4D7M A;  3GTM J;  3NI7 A;  3BT9 A;  5BNG A;  3RD3 A;  2UXP A;  3KKC A;  1GDT A;  2K40 A;  2JA5 J;  1FIP A;  3LSP A;  3O60 A;  2NOG A;  2G7G A;  3QBM A;  1GT0 C;  2LVS A;  1T33 A;  5C44 J;  2VUM J;  2QWT A;  3FK7 A;  2M34 A;  3HOX J;  3WHC A;  4A3K J;  4L62 A;  1MBG A;  2DA1 A;  3HDD A;  2G7L A;  3HIM A;  3IH3 A;  5F04 A;  4V2F A;  2R93 J;  3VP5 A;  2ZOY A;  2XB5 A;  4QTR A;  3IV5 A;  2N8G A;  3ZQH A;  3LSJ A;  2L9R A;  5FHP A;  2UXO A;  3BTC A;  4M3F A;  3K2A A;  3F1B A;  1FTZ A;  4GCL A;  4A3E J;  3JRD A;  1JKQ C;  4Y52 J;  1AKH A;  3JRG A;  1WGX A;  1MSE C;  2UXU A;  3BTI A;  2CRG A;  2ME0 A;  4FIS A;  3CDL A;  3HOY J;  1FTT A;  1VFC A;  5EG0 A;  4I6Z A;  2CU7 A;  3JRC A;  2MGQ A;  4KWA A;  2DG7 A;  3UKG A;  2FX0 A;  5EG0 B;  1TC3 C;  3JR9 A;  2K9S A;  5C4J J;  4ABZ A;  1X2M A;  3GEU A;  3B6A A;  4A3G J;  2L0K A;  3BHQ A;  1OCP A;  2HI3 A;  4W97 A;  3DCF A;  2R0Q C;  4MFD A;  4DYC A;  1BW6 A;  2Y9Y A;  3IH4 A;  5C4Y A;  4UUS A;  5M5Y J;  4XRM A;  1O4X A;  9ANT A;  4NEL A;  1FIA A;  4UUS B;  3HM5 A;  3LOC A;  3ANP A;  4C2M J;  1ZTR A;  2JA7 J;  1U78 A;  2DA7 A;  3S1Q J;  3KNW A;  3TP0 A;  3RZD J;  2HYJ A;  2ME6 A;  1TWH J;  5IOY A;  3HOZ J;  3BJB A;  4GCK A;  2ID6 A;  3HTJ A;  2CUE A;  3OOU A;  2XPV A;  4IHV A;  5D1R A;  4MO7 A;  5GP9 A;  2R5Y B;  1GV5 A;  3JRH A;  2R92 J;  3G1L A;  2DMP A;  1H88 C;  3V78 A;  5IYB J;  2OF7 A;  4A3B J;  1NTC A;  1ETV A;  4M3B A;  4DZJ A;  3GTO J;  3JRF A;  2K9N A;  3BCG A;  4L5E A;  4I76 A;  3BRU A;  4GCT A;  5EFY A;  4JX5 A;  2NVY J;  5FKK A;  2NP3 A;  5IP7 J;  1QPI A;  2MW8 A;  3S17 J;  5F08 A;  1SFO J;  3FKI J;  3H0G J;  4BBR J;  4XRS G;  3GTG J;  1PUF B;  1HCR A;  5HSZ A;  5E3O A;  3M4O J;  3VOK A;  2OPT A;  1MBE A;  2IAI A;  2COB A;  5EF6 A;  3OSF A;  4IHX A;  5D19 A;  3O8H A;  1HDD C;  5C3E J;  4A3I J;  3BR1 A;  1U8B A;  2AHQ A;  2UXH A;  4GFK A;  4JP0 A;  2AO9 A;  3QQA A;  2ZOZ A;  4JL3 A;  3QPL A;  1MSF C;  4FCY A;  3PM1 A;  1BL0 A;  3TP3 A;  3LNQ A;  1B8I A;  4RDU A;  1D5Y A;  2EBI A;  1K61 A;  1U9O A;  4AC6 A;  1B8I B;  1RR7 A;  3BG9 A;  2WB1 N;  2ZCX A;  1Z77 A;  2JWT A;  2NS7 A;  3OIO A;  1LE8 B;  5IYC J;  5E3L A;  5J1R A;  4AF5 A;  5EZH A;  2JN6 A;  1UI6 A;  2KDZ A;  2QKO A;  2YVE A;  2EQR A;  1MNM C;  1ZK8 A;  3A03 A;  4JYK A;  3G56 A;  1F36 A;  2MSY A;  3S14 J;  2ZCN A;  2R5Z A;  1ETO A;  5JLW A;  4V2G A;  1ZR4 A;  1RKW A;  1QVT A;  4A3M J;  4G12 A;  3P9T A;  3ZQL A;  3DEW A;  2OER A;  4ME9 A;  2IU5 A;  2XGD A;  4MIM A;  3QKX A;  3F0C A;  5F0C A;  3T6N A;  2DA4 A;  1JTY A;  4CYC B;  2WUI A;  1ZKG A;  1B72 B;  5CXG A;  3KKD A;  5HBU A;  1ZQ3 P;  3L1P A;  1P7I A;  4NDL A;  3ZOB A;  2NS8 A;  3Q0W A;  2XRL A;  4A3L J;  3RQI A;  3JRI A;  1Y1V J;  3LSG A;  2VKV A;  3HGG A;  5J3L A;  2JMW A;  1Q1V A;  3H3V K;  1I6H J;  2ZCM A;  2M0C A;  3ANG A;  3OSG A;  2E2J J;  1WH5 A;  2E2H J;  4M3G A;  1YRN A;  1GVD A;  3E7L A;  3I4N J;  2X6O A;  1UG2 A;  4ICH A;  2FJ1 A;  2Y30 A;  4A93 J;  5EGO A;  1JUM A;  3BR5 A;  1W0T A;  3W6V A;  3MKL A;  1FEX A;  5EDN A;  4MK6 A;  4C3I J;  5EGO B;  2X48 A;  2K9Q A;  2I10 A;  2Y0S N;  3MN2 A;  2OI8 A;  1VF9 A;  2M9H A;  4MXM A;  2HYT A;  3HBL A;  1AKH B;  4MLO A;  3DPJ A;  3S16 J;  1IUF A;  3EUP A;  1JJ6 C;  4YZE A;  1TWG J;  1LFB A;  1JT0 A;  1JKP C;  2QTQ A;  5CW8 A;  1JGG A;  1HLV A;  1BA5 A;  3CWR A;  4QSH A;  5F0F A;  2W53 A;  3NAR A;  1CQT A;  5DTD A;  2LP0 A;  3V6G A;  4XK4 A;  3RH2 A;  1JUP A;  2VPR A;  1MBH A;  3GTL J;  2GEN A;  2JA6 J;  1WPK A;  5FLM J;  4QIW N;  1JKR C;  1JT6 A;  5FKM A;  3CCY A;  3JSJ A;  2CQQ A;  2IEK A;  1QVU A;  2L7Z A;  5C4X J;  1F43 A;  1VND A;  1IG7 A;  2LR8 A;  1WH7 A;  1ETY A;  4C3H J;  5K7Z A;  2YS9 A;  4D5F A;  3LWJ A;  4A3F J;  3NXC A;  5E3N A;  2XSD C;  2FD5 A;  1TWA J;  3A01 A;  3S15 J;  3CJD A;  2RAE A;  2L7M P;  3NNR A;  3NRG A;  1VI0 A;  3A01 B;  3BG5 A;  3GZI A;  3HE0 A;  1MH4 A;  4A3D J;  1H8A C;  2XPW A;  2RAS A;  1IJW C;  4XID A;  3ON4 A;  3BR0 A;  2NP5 A;  1RES A;  1HOM A;  1ZGW A;  1S7E A;  5M5X J;  4HKU A;  2GM4 A;  3G1M A;  3TED A;  2WV1 A;  4M3E A;  4CGR A;  5FKO A;  1MH3 A;  2X9D A;  1AHD P;  1ITY A;  1I50 J;  3BTL A;  2WGB A;  2NVQ J;  2DTZ A;  4DYQ A;  2G0E A;  2O7T A;  3BR2 A;  5HOD A;  5K7F A;  3S1M J;  1GV2 A;  2LTP A;  3RKQ A;  5D18 A;  2NVX J;  3GTK J;  3HTH A;  4X6A J;  2QCO A;  4AUX A;  1JUS A;  5IOZ A;  3S2D J;  3HTI A;  3KZ9 A;  1GUU A;  3VW0 A;  1FJL A;  2V57 A;  2EZK A;  2FQ4 A;  3C07 A;  3PO3 J;  2GUH A;  5EZG A;  3NAU A;  3VW1 A;  3AQT A;  2ELK A;  1QRY A;  3JRA A;  2D6Y A;  1UI5 A;  2HOT A;  1JKO C;  1ETW A;  1T56 A;  4JX6 A;  1JJ8 C;  2XPU A;  4EEF G;  3FK6 A;  3QPS A;  3FIS A;  3PAS A;  3BQY A;  3BQZ A;  2O7O A;  1OCT C;  2DA2 A; 
#chains in the Genus database with same CATH topology
 4L9T A;  2GZW A;  4IPA A;  1K6Y A;  1AU7 A;  2WWY A;  4JOM A;  1X3U A;  4CHU A;  3R6S A;  1SVL A;  4BY7 J;  1WI9 A;  2DN0 A;  4IO9 F;  1YTY A;  1WI3 A;  2R5Z B;  4AD9 A;  2RNJ A;  4AU7 A;  3FRQ A;  1WRJ A;  4U0V A;  4B1R A;  5BPI A;  1YO5 C;  4BNC A;  2G7S A;  2EA2 A;  2RRE A;  3OV8 A;  3M1C A;  2WA0 A;  1EH7 A;  2EV0 A;  2E36 A;  2ZFW A;  3RIR A;  1I6X A;  2EZL A;  3VOE A;  2YVX A;  2EFP A;  2HZT A;  3ROU A;  3VPR A;  3HRT A;  3K4B A;  4UVC A;  1U5T A;  1IC8 A;  1RNL A;  4HV6 A;  1RRJ A;  2GIZ A;  2G7U A;  2HNH A;  4O5V A;  1LDK B;  3FHZ A;  1YJW I;  3IAM 2;  1BI1 A;  2EK5 A;  3LL7 A;  1G2H A;  4GDF A;  3EUH C;  2ACJ A;  1BN5 A;  2EZH A;  1S7A A;  3HB9 A;  1HF0 A;  5IT9 K;  3E7Q A;  1MJB A;  2ECB A;  2HOE A;  2VKH A;  1E17 A;  2H09 A;  3EDP A;  4X1E A;  3S1N J;  3BCB A;  4RAY A;  3ONQ A;  2OZU A;  2BOL A;  2DO7 A;  2HXO A;  4MEY F;  1J59 A;  3HOW J;  2H8R A;  2JRM A;  2TRT A;  2XAG A;  4XON A;  3A2K A;  2IA2 A;  4J19 A;  2DMT A;  3ZXS A;  4NC6 A;  2F07 A;  4WF2 A;  2DPD A;  5IPA A;  2MG4 A;  2STT A;  1Y0U A;  4HOB A;  1XG1 A;  3FIW A;  1V54 H;  5DS9 A;  3H0D A;  3K4K A;  3HG9 A;  2MC4 A;  2ZC2 A;  1H89 C;  3LSR A;  5L3E A;  2Z9O A;  3GFJ A;  1R23 A;  2HU9 A;  1EF4 A;  1MD0 A;  1QHH D;  5JLX A;  2X51 A;  3PSI A;  2DA5 A;  2E1C A;  1G6N A;  4HZF A;  2Y31 A;  2KIF A;  3FMR A;  2XB0 X;  2PX9 A;  2RQQ A;  3DPL C;  3K4J A;  2X0L A;  4EJW A;  1K4T A;  5LGT A;  4DVY P;  2QIB A;  3AQS A;  4NBQ A;  2YVH A;  1J7K A;  1IGN A;  2PFB A;  2TDX A;  1UEL B;  1FT9 A;  4RS8 A;  4HX4 A;  4A69 C;  4OIO F;  1P7J A;  2VBX A;  4S0H B;  2P7V B;  3PJR A;  5F0H A;  4DIQ A;  5GAG J;  2XV4 S;  3GXO A;  1FYL A;  1BJZ A;  3KP2 A;  2B9S A;  1S6L A;  2DMU A;  2ELJ A;  4M71 A;  4UY8 I;  1BJA A;  3K1M A;  2D1H A;  1ZG3 A;  5CXI A;  3KP4 A;  3ABT A;  3COA C;  2Y75 A;  4KIS A;  3H3Z A;  1BOA A;  5FRO A;  2CG4 A;  1CGP A;  5EEA A;  2BZT A;  2JUC A;  2Q1Z B;  3F8M A;  3NQO A;  1DDN A;  4IHY A;  3VTI A;  1BC8 C;  1T08 B;  5B1A H;  1ORK A;  3ZMZ A;  4BY1 J;  2BXZ A;  2R7D A;  4XLN F;  2DDB A;  5DUI A;  2P5K A;  1ZR2 A;  1SEU A;  3KYC B;  3KPH A;  2YR2 A;  5IYD J;  1J5Y A;  1GVJ A;  3QRF F;  2NX4 A;  3U2R A;  3GWZ A;  2XGC A;  4I0B A;  1D0X A;  2ISY A;  1Z91 A;  2WAE A;  1FYK A;  4PCQ A;  3C1D A;  5H9T A;  3HOV J;  4R79 A;  1LFU P;  2H1K A;  2LF8 A;  1WJF A;  1LQ1 A;  2QF7 A;  2IP2 A;  3ELK A;  3GZN B;  1O3S A;  2FF4 A;  1RET A;  2M1B A;  2OCE A;  3M8F A;  2DT6 A;  2GA1 A;  4IEJ A;  5LHG A;  3JRE A;  2YUS A;  4HV5 A;  4CCL A;  3GTJ J;  2CUZ A;  3HEF A;  5FJ8 J;  4BQA A;  3FKJ A;  2ID3 A;  3C2B A;  4BXF A;  1P4W A;  1E3P A;  3NWS A;  2BVL A;  1A36 A;  2P0W A;  2ZJQ F;  5KVR A;  3DLA A;  4A3J J;  2B1E A;  1ERD A;  2X6Y A;  2REK A;  3H92 A;  4KN4 X;  2EWN A;  2FU4 A;  2L54 A;  2F4I A;  2CH0 A;  4CZC A;  3MZ8 A;  4CYD A;  1E3H A;  1APL C;  2PFV A;  3B73 A;  1GXQ A;  1UJ8 A;  2LKX A;  3CUQ A;  3OYM A;  5F6F A;  3DLL F;  5B1B H;  2A3S A;  4P55 A;  3I54 A;  3BJ6 A;  4HNV A;  4CYC A;  2VON A;  1DPR A;  5D5V B;  1B72 A;  3QOE A;  3HSE A;  3TBI A;  3F8F A;  1V5G A;  3BT9 A;  1BOB A;  3KFW X;  2K7L A;  3O60 A;  4XKV A;  1H9G A;  3RCO A;  3LSP A;  4B3X A;  3MFK A;  3QYB A;  1QPM A;  1YLF A;  4LLL A;  3FX3 A;  2QBY A;  3VWB A;  3K0L A;  2COM A;  3LFU A;  4L62 A;  1MBG A;  1FP1 D;  3KZZ A;  1U2W A;  3ISP A;  2Q2E B;  3AG2 H;  4E7S A;  1MDM B;  1K4S A;  1WJB A;  2XB5 A;  3AKZ A;  3JTH A;  1LKX A;  4XLE A;  3K2A A;  5KCM A;  3HTS B;  1R5G A;  3E5U A;  4GCL A;  2HVQ A;  4A3E J;  2FML A;  1QBJ A;  1ON2 A;  2LF7 A;  2QEN A;  2UXU A;  3CDL A;  5DCF A;  3HOY J;  5CVR A;  1VFC A;  3C3W A;  4M9S A;  4I6Z A;  3SWH A;  4Q5S F;  2E7X A;  1YIO A;  4NB5 A;  2DG7 A;  4PJL A;  2FX0 A;  2Y0S A;  5EG0 B;  2MA3 A;  1MJA A;  4II3 A;  5DUK A;  3TOB A;  5C4J J;  2M45 A;  3G4S I;  2HYF A;  2I5U A;  5KAI C;  4AIK A;  2HI3 A;  3D5S C;  2R0Q C;  2W7N A;  3I56 I;  1ZG1 A;  4JK1 X;  4DYC A;  3WE3 A;  4U7D A;  1BW6 A;  1G8X A;  5C4Y A;  2HKX A;  5HS7 A;  4AYB A;  3N97 A;  4IL6 C;  9ANT A;  2BY2 A;  4NEL A;  4UUS B;  1TTY A;  2Y0M A;  4EJU A;  4E70 A;  1NG7 A;  4ZDL A;  1QO0 D;  2ZJP F;  2DA7 A;  3GYH X;  1Y6I A;  4PGH A;  3LST A;  1TWH J;  2XAS A;  5CKT A;  3SQN A;  1HKQ A;  2ID6 A;  5CLS A;  4F3Q A;  2WBM A;  3HTJ A;  4HRI A;  4KUM A;  3M7G A;  3VDX A;  3WTV C;  4RB0 A;  1ZRE A;  1XCV A;  3SFZ A;  3JRH A;  2O6G E;  3G1L A;  5LHH A;  2CV1 A;  4KNY A;  3CLQ A;  5IT3 A;  3CCL I;  1USS A;  5IYB J;  1NH3 A;  1A35 A;  4LFU A;  4U0Y A;  4A3B J;  4LG0 B;  2ZJR F;  4AVZ A;  3GVA A;  4DZJ A;  1TT5 B;  4BEH B;  2K9N A;  3JRF A;  4L5E A;  2D45 A;  2XIG A;  3LWF A;  5D8K B;  4N0B A;  1MMA A;  1SFX A;  3HYI A;  2NP3 A;  2V6C A;  4R1H A;  3S17 J;  3OYC A;  3H0G J;  4BBR J;  3B02 A;  2PMH A;  1PUF B;  2VOP A;  2JTV A;  3HHH A;  5HSZ A;  4HYE A;  3FXK A;  1K6O A;  3VOK A;  3LAJ A;  4EAT A;  2IAI A;  1SMY F;  1AOY A;  1LUJ B;  1Z6T A;  1VQL I;  3OSF A;  2HQA A;  4IHX A;  3CP2 A;  5D19 A;  3PUF A;  3GLX A;  1HDD C;  1O7L A;  3DWL E;  1MMS A;  1U8B A;  3EUA A;  1Y39 A;  3CC2 I;  3V42 A;  4JL3 A;  1XCB A;  5AON A;  1E2X A;  1UFM A;  4FCY A;  2DI3 A;  2PMZ A;  3KIO A;  1B8I A;  2ZO4 A;  2OBP A;  1K61 A;  2PJP A;  1ULY A;  2LBF A;  2MLK A;  3FF5 A;  1YJ9 I;  2HVS A;  2NS7 A;  5IYC J;  1OLT A;  5ICG A;  5J1R A;  5EZH A;  2JN6 A;  2QKO A;  3ZMV A;  2EQR A;  3M8E A;  3F22 A;  1MNM C;  1FWZ A;  2VJJ A;  2R3S A;  3ZMT A;  4FET A;  3VEP A;  3S14 J;  5D4R A;  4HBL A;  4ZYE A;  2QVO A;  2FRH A;  1TQI A;  1UST A;  4Z6Y A;  2XGD A;  4XKW A;  5L3F A;  4IRI A;  4ME9 A;  1D1B A;  4XL9 A;  3H5N A;  4ANJ A;  5F0C A;  3H9Q A;  4KIG A;  4CZZ A;  2OA4 A;  3CCU I;  3HSR A;  1JTY A;  3LA7 A;  5CXG A;  2ADU A;  2E35 A;  1LDD A;  3GW2 A;  3L1P A;  4HF0 A;  4NDL A;  5D6F A;  2NS8 A;  3Q0W A;  2XRL A;  3KX2 A;  1VQO I;  3ABU A;  2A6T A;  3AG3 H;  1Q1V A;  2DOE A;  2ZCW A;  3FBN B;  1UHW A;  1ZYR F;  3NRV A;  3K70 C;  1YRN A;  3T8R A;  4N4O B;  4E7K A;  2L02 A;  3WTX C;  2NYX A;  2PEX A;  2FJ1 A;  2STW A;  2EA4 A;  5EGO A;  2ICW G;  1X1D A;  3G3Z A;  1VQ6 I;  4U87 A;  4RGX A;  3KEQ A;  4BQN A;  4M6Y A;  1PP7 U;  2ZXW H;  2I10 A;  2DYS H;  2Y0S N;  2OI8 A;  2VJI A;  5DEQ A;  2Z3Y A;  4ZDP A;  1YG2 A;  3W2W A;  3OYK A;  2HYT A;  1AKH B;  1BI0 A;  2E7W A;  1IAW A;  3X2Q H;  4MLO A;  5HLH A;  3DPJ A;  4KT5 C;  2QLZ A;  1JJ6 C;  1TWG J;  1HXD A;  2OJE D;  3CJN A;  1RI7 A;  4E7L A;  2QTQ A;  4A6E A;  4KIF A;  5CW8 A;  3KEO A;  5DM6 F;  3J7Y J;  1HLV A;  4XLF A;  3RPU A;  4RB1 A;  5F0F A;  2E71 A;  2W53 A;  3QP5 A;  3RH2 A;  1MBH A;  1FMV A;  4XLC A;  3VP5 A;  1JT6 A;  4HA8 A;  3BJA A;  4G7O F;  4G9Y A;  1T39 A;  2W84 A;  2CQQ A;  2Z1D A;  2F5V A;  1Z7L A;  5C4X J;  1IG7 A;  2MFZ A;  1WH7 A;  1ETY A;  5JVG F;  2M5W A;  1T6S A;  2HKO A;  4A3F J;  2PJR B;  2KLO A;  2E60 A;  2XSD C;  2B3W A;  4U7B A;  3A01 A;  3T0Y A;  1S72 I;  1VQK I;  3OYE A;  3NNR A;  1VI0 A;  2EFQ A;  4PFP A;  3SEQ A;  2ZSH B;  3ERM A;  3ON4 A;  1FNN A;  1XX5 A;  2OD5 A;  2GA2 A;  1BC7 C;  1HOM A;  2GM4 A;  3UR3 C;  3OYH A;  3G71 I;  1TL8 A;  2VC1 A;  1JI8 A;  2V6E A;  2X9D A;  4NQW A;  3BTL A;  4LGW A;  1EKE A;  1S3J A;  3F72 A;  2DTZ A;  4KIB A;  1W1W E;  2LH9 A;  3BR2 A;  5K7F A;  1BR4 A;  2VBW A;  2VQG A;  5D18 A;  2R7X A;  3PNT A;  3N4M A;  4UVB A;  1MMN A;  4LB5 A;  2DCE A;  5LRR A;  2V1D A;  2C6Y A;  4X6A J;  1YQA A;  4ENJ A;  4EV0 A;  1GUU A;  1HW1 A;  2QGU A;  1FJL A;  2V57 A;  3C07 A;  2JVH A;  4G6Q A;  4IXA A;  5E20 A;  4ZYD A;  1YYV A;  5E1W A;  4A0Y A;  3PO3 J;  3T8T A;  1YS7 A;  3K9T A;  2PBI A;  2BHY A;  3GZ6 A;  4M74 A;  3J81 Z;  4WWC A;  1LDJ A;  2HPM A;  2HOT A;  1JKO C;  1ETW A;  1WHU A;  3E0J B;  2GXA A;  2HDC A;  2L7M P;  2O7O A;  2V9K A;  1D0Z A;  3E5Q A;  3ABM H;  4IHW A;  4EMS A;  3VVZ A;  4UXN A;  2NNY A;  2YX4 A;  3LJL A;  3V7C A;  2BY3 A;  4MGR A;  2IS1 A;  5ILU A;  4WX9 A;  2IBD A;  3DV8 A;  1RPW A;  5LHI A;  4ZZL A;  1D1C A;  4ZYG A;  1JHH A;  3QPT A;  1J75 A;  1Y8R B;  2CFX A;  4C3J J;  3R4K A;  4BBS J;  1FSH A;  2ECC A;  1XGN A;  4HX8 A;  4CCN A;  2Y9Z A;  1PDN C;  2MBF A;  2NNN A;  1W5C C;  2PQ8 A;  1OYI A;  3RDI A;  3V8J A;  4EJO A;  4ZYH A;  2NVT J;  2F5E A;  5HS9 A;  3G6E I;  4L5I A;  2A5W A;  3HTU A;  1MBK A;  1YIT I;  3L00 A;  3Q3S A;  1WQ2 A;  3MQ0 A;  1MBF A;  2BVM A;  1F9N A;  5B66 C;  4I01 A;  4HDU A;  1XS9 A;  1XTA A;  1XD7 A;  3V7R A;  2BXY A;  4XLP F;  2FXA A;  3GBG A;  1BW5 A;  3W6J B;  4DYR A;  3HXL A;  1UHM A;  4BDY A;  1U0J A;  4H4K C;  1ETQ A;  4CO8 A;  3KYD B;  4P96 A;  1BIB A;  1G4D A;  4ZYA A;  5IP9 J;  1W36 D;  4UDS A;  2VI6 A;  1FOK A;  2NAZ A;  2KKO A;  3S5R A;  2ZKZ A;  2H8W A;  1Z21 A;  2DJN A;  4RB2 C;  2ISZ A;  1SMT A;  3VVX A;  1S8N A;  1IV6 A;  4NN1 A;  4LMY A;  4B3A A;  4I98 B;  2VE9 A;  5FLX Z;  1XB4 A;  3DEE A;  2L01 A;  4I09 A;  1XC5 A;  2DOA A;  5CQG A;  5FLV A;  2KIQ A;  3VYR B;  2TCT A;  2JK3 A;  4RBO A;  3G73 A;  3WHB A;  2CGP A;  3I53 A;  1T98 A;  1OFC X;  1I3Q J;  1KGS A;  4XRF A;  4LOC A;  2DQL A;  1HW2 A;  4CCO A;  2ESH A;  3K10 A;  4CGZ A;  2RV8 A;  3I4M J;  4IRV A;  2LYC A;  2VBZ A;  3M3Y J;  1WJ5 A;  4GGG A;  5GTH C;  3F6O A;  2A69 F;  4M6X A;  4AIJ A;  2K4J A;  2L7K A;  5FRN A;  2Q24 A;  2H6C A;  2ZXJ A;  5JHF A;  2RHA A;  1GLN A;  5B3S H;  3LSK A;  3CP8 A;  4BYY A;  2E5Z A;  2JVG A;  1SD5 A;  1OR7 A;  1SD4 A;  5J1U A;  2KP6 A;  3IL2 A;  1G3S A;  2EFW A;  2W48 A;  3TO7 A;  1TQP A;  2M87 A;  1A6I A;  4PFO A;  3IAS 2;  1ZAR A;  2B7E A;  5A2Q K;  4IQ4 A;  2CUF A;  3IKT A;  3VVY A;  4EGY A;  3ESW B;  4OOI A;  4E7I A;  1V4R A;  1WJD A;  3BDD A;  3H35 A;  3PNV A;  3WG7 H;  1TW3 A;  4EM1 A;  4F93 B;  4JNN A;  1P92 A;  2DJI A;  1HC8 A;  4BU2 A;  2BY1 A;  2GWR A;  2VXD A;  4FTH A;  1N77 A;  5CVV A;  5D4S A;  1MJ9 A;  3TQN A;  4BKX A;  2CYY A;  2VQH A;  3HHG A;  4OAY A;  3AAF A;  1X2N A;  1VQ7 I;  2CW0 F;  4HNU A;  1X3Z B;  4IZZ A;  3DTE A;  1EH8 A;  3E3V A;  3FZV A;  1YHQ I;  2M4G A;  2MD0 A;  2UXX A;  2EH3 A;  4B43 A;  4Y7N J;  3OYF A;  2MYS A;  3MMY B;  3OOP A;  4BH9 A;  1IRZ A;  2CSO A;  3F9K A;  1IRG A;  3QU3 A;  2WAD A;  2E19 A;  2W00 A;  5M5W J;  3A4C A;  1Z0X A;  3OYA A;  3NWT A;  2R7W A;  3PPB A;  3VW2 A;  2V1U A;  1TWF J;  2XHK A;  3QOD A;  3HGY A;  2V9P A;  2WV0 A;  3COL A;  3JTG A;  1ENH A;  1RUN A;  1IXC A;  3UNG C;  3WG9 A;  5ED4 A;  4YIF A;  4S05 A;  5DV5 A;  3TDZ C;  2W4S A;  1LE8 A;  3C18 A;  4HQE A;  3I59 A;  1OJL A;  3KET A;  5FMP A;  1WJA A;  3BRO A;  1RKT A;  2FOW A;  2P8T A;  2X1E A;  4B4C A;  4UV8 A;  3HTA A;  2YU9 J;  2LFB A;  3HKZ N;  1ZGJ A;  1LFP A;  3G7R A;  1FSE A;  1F4K A;  4XN0 A;  2JSC A;  5JI6 A;  2WTE A;  3O8G A;  3QPH A;  1TP4 A;  4CCM A;  2HOS A;  2R7V A;  5GAE J;  2IT0 A;  3JRB A;  2WAQ A;  4PZJ A;  5EYR A;  1K7A A;  1YOV B;  4IRG A;  4LIV A;  4IHS A;  3GTM J;  3RD3 A;  4N4N B;  3ABK H;  2UXP A;  1GDT A;  3VB2 A;  2LY1 A;  4XQF A;  3QBM A;  4U88 A;  3CDH A;  1MNE A;  1MGT A;  2J5P A;  2VUM J;  3F21 A;  1G3T A;  4KJZ A;  2M34 A;  4C2U A;  2RVC A;  3HOX J;  2K02 A;  2FBH A;  2QUF A;  2VQC A;  3K70 D;  4BDZ A;  4A3K J;  1UZC A;  2QBY B;  3SYT A;  4ZDO A;  1MZB A;  2IA1 A;  3K4M A;  3HDD A;  1QZE A;  2X6X A;  4V2F A;  3H5A A;  5DD4 A;  2KDO A;  2XRN A;  2ZME B;  4U0W A;  4ESF A;  5LGU A;  4I2O A;  2ZOY A;  2CW8 A;  2N8G A;  4C30 A;  3ZQH A;  5FHP A;  3BTC A;  4H0E A;  1D8K A;  3RI4 A;  2GLO A;  3ZRG A;  1FTZ A;  1P2F A;  2DK8 A;  1JKQ C;  1MSE C;  4F92 B;  4NC8 A;  2QA4 I;  1A04 A;  2ME0 A;  4FIS A;  3L9F A;  3RKW A;  1FTT A;  4II2 A;  4DJA A;  3IRQ A;  3JRC A;  3DPU A;  3UKG A;  1UCR A;  1FOX A;  4BJT A;  1KU7 A;  4Y4R A;  1TC3 C;  3JR9 A;  4KMF A;  1SD7 A;  4ABZ A;  2L0K A;  2ZME C;  3ZMS A;  1OCP A;  1I27 A;  3MKZ A;  5B5E C;  4MFD A;  5E8I A;  3W2A A;  2Y9Y A;  1BI2 A;  4XRM A;  1O4X A;  1FIA A;  4XKB A;  4HLX A;  3LOC A;  3CMA I;  4A12 A;  1S5L C;  4IOA F;  4C2M J;  2IGN A;  3JSO A;  1ZTR A;  3S1Q J;  4HF1 A;  2HYJ A;  2ME6 A;  5BQT A;  3HOZ J;  1V3F A;  2CUE A;  3VSL A;  3DEU A;  4MO7 A;  5GP9 A;  2R5Y B;  1WZ2 A;  3A1Y A;  3DBH B;  3L2Q A;  5LLQ A;  2DMP A;  3BZK A;  1KU9 A;  1XDS A;  2GAU A;  2X85 A;  4AVP A;  3V78 A;  3V4G A;  2CQ7 A;  4A0X A;  3RTR A;  2XRO A;  3DU5 A;  2HPI A;  4CSW A;  4KT6 A;  2KHM A;  1TT0 A;  4I76 A;  3BRU A;  3BG7 A;  2BHZ A;  1NG6 A;  1XDU A;  1QPI A;  3HUG B;  1SFO J;  2H94 A;  4XRS G;  5ILS A;  1HCR A;  1J9I A;  3E6D A;  4GYG A;  2BBY A;  2OPT A;  1MBE A;  3CCV I;  2HVR A;  1ZH5 A;  2JZY A;  2WC2 A;  5JVT A;  4A3I J;  1A31 A;  2AHQ A;  3S3M A;  4V19 K;  2UXH A;  3QQA A;  2ZOZ A;  3QPL A;  2FUG 2;  4RMN A;  2ELH A;  5HLG A;  2DQR A;  2F4M B;  5TJJ A;  3RJP A;  1K79 A;  3TP3 A;  1K78 A;  4RDU A;  2YPR A;  1D5Y A;  1REP C;  5K5Q A;  1B8I B;  3BG9 A;  3EQL F;  3KEY A;  1T0F C;  1EJ9 A;  2KJB A;  1F36 A;  4HSR A;  3R60 A;  4C2T A;  2ZCN A;  3EUH A;  2R5Z A;  1U8R A;  1LVK A;  1IN5 A;  3DKW A;  1PVE A;  3DPT A;  1B9N A;  5EEG A;  2B0L A;  1RKW A;  1TQM A;  1BI3 A;  1QVT A;  1XMX A;  4QPO A;  4G12 A;  1Z3X A;  5LEJ A;  2KRF A;  2M30 A;  3DEW A;  3PL8 A;  4M73 A;  2FBK A;  3R0J A;  1QGP A;  3F0C A;  1ZRC A;  1VQ8 I;  1W36 C;  3T6N A;  4BGD A;  2RGV A;  3OL3 A;  2VJ4 A;  2J5O A;  3KKD A;  1ZLK A;  1P7I A;  2WY8 Q;  4A3L J;  1R6R A;  2R7Q A;  3RQI A;  4MTD A;  3V7S A;  1Y1V J;  2KIU A;  3HGG A;  5H20 A;  3H3V K;  4WIB A;  1I6H J;  2KZV A;  1RUO A;  2ZCM A;  4N9H A;  4WXD A;  2E2J J;  1WH5 A;  4EJV A;  4M3G A;  1VZ0 A;  2E2H J;  3AG4 H;  3ASO H;  5K5O A;  1Z3Y A;  4BE0 A;  1W0T A;  3W6V A;  3MKL A;  1FEX A;  5EDN A;  5EGO B;  4EGZ A;  3M1E A;  3RYR A;  2K5C A;  4XKC A;  2QKL B;  3WTT C;  3JAM Z;  5GAD J;  4NHJ A;  1LJ9 A;  1VF9 A;  1U6G A;  3SEZ A;  3SZG A;  2ZFU A;  1VQM I;  3BPV A;  1IUF A;  4BHB A;  3EUP A;  1IRX A;  4Q47 A;  5H2F C;  4LIT A;  2HTS A;  1JGG A;  5ICC A;  1BA5 A;  3CWR A;  1YX5 A;  4QSH A;  3CF5 F;  2EPF A;  3OYN A;  5HOO A;  1F1Z A;  5DTD A;  2LP0 A;  3GTL J;  3BLY A;  1V5F A;  1WPK A;  1JKR C;  4RM3 A;  5E79 C;  4MNU A;  5FKM A;  4KDP A;  2H27 A;  4G6T B;  2VJ5 A;  4DQ2 A;  1DP7 P;  1YIJ I;  5BMZ A;  1QVU A;  2L7Z A;  1R1V A;  3ULQ B;  3J7A O;  1RZ4 A;  5HNH A;  4C3H J;  4E4H A;  5K7Z A;  2IJL A;  3CO7 C;  2BV6 A;  2EV5 A;  2YS9 A;  4CA0 A;  4U9L A;  4LJZ F;  4OD4 A;  2FQ3 A;  2VOD A;  1STZ A;  1TWA J;  4IQJ A;  3S15 J;  4BAY A;  1UB9 A;  4OU0 A;  3A01 B;  3BG5 A;  5FO5 A;  4C9Y A;  4A3D J;  1HKT A;  4XID A;  2Z33 A;  3LQR A;  1ONV A;  3H1C A;  4XSX F;  1TW2 A;  3TED A;  1MH3 A;  2DAO A;  1AHD P;  1ITY A;  1I50 J;  1T95 A;  1KYZ A;  2JSP A;  4NNJ A;  5LD2 C;  5DM7 F;  5HOD A;  2XKO A;  2QQ9 A;  2GXG A;  5KAF C;  2QM3 A;  1D3Y A;  2R4G A;  2NVX J;  3KZY A;  3PNY A;  3J80 Z;  3HTH A;  2CQN A;  3R61 A;  1XMA A;  2QCO A;  3HTI A;  1JUS A;  3S2D J;  1X1C A;  3REO A;  3KZ9 A;  3K6G A;  4RAG A;  4CCK A;  1Z67 A;  3VW0 A;  2EZK A;  2XUB A;  4BAC A;  3HOS A;  3PQK A;  4PDK A;  3GFI A;  3VW1 A;  2ELK A;  2ZXH A;  1VQN I;  3JRA A;  2L4M A;  2D6Y A;  2KL4 A;  3CC7 I;  4JX6 A;  1R4M B;  2GIV A;  3FK6 A;  3QPS A;  3FIS A;  3PAS A;  3RZD J;  1Y56 A;  1YW9 A;  2OU2 A;  2FMY A;  3I55 I;  4XLA A;  1O3Q A;  3TO6 A;  2LC2 A;  2L7F P;  1N25 A;  3HRS A;  2JQ7 A;  1IN6 A;  2XGX A;  2DMN A;  2NRA C;  5E1Z B;  5IP6 A;  3TL4 X;  1MBJ A;  4DGW B;  2X6W A;  5FKN A;  2UWM A;  4D7N A;  4DW6 A;  2DG8 A;  3KE2 A;  1G3Y A;  1FOY A;  1K83 J;  3HC7 A;  4CUG A;  1QQI A;  5LRS A;  6PAX A;  1EA3 A;  1CF7 B;  4K2E A;  3BP8 A;  2KRC A;  5HVQ C;  3AL0 B;  3GTQ J;  3CCR I;  2QQB A;  3QU6 A;  5K58 A;  1FYM A;  2IA0 A;  3ZN1 A;  3T1B A;  1S29 A;  5GAH J;  1IN8 A;  2R7T A;  3HRU A;  3HOT A;  4BQQ A;  3SFI A;  3Q0V A;  3WTU C;  2A2F X;  4BXX J;  1IDY A;  3KP5 A;  1SFK A;  1Y1W J;  4HPQ A;  1X58 A;  2PG4 A;  2JA8 J;  1X3W B;  2DFF A;  2GBY A;  2L4A A;  3P9I A;  4LK0 F;  2UXI A;  3ON2 A;  2HYG D;  2K9L A;  4AID A;  2HEO A;  3TW7 A;  4G6D A;  4Q48 A;  1KU2 A;  2IW5 A;  3PQJ A;  4B47 A;  4A3C J;  2VC0 A;  4ZZD A;  3WOD F;  2A05 A;  5L3G A;  2Q2E A;  1MDM A;  1G59 A;  1E0E A;  4XOP A;  2LDU A;  4AYB N;  4E6K G;  3BG3 A;  4WK8 F;  4HX7 A;  2JT1 A;  4AM3 A;  1W5S A;  4JQF A;  3S2H J;  3CQZ J;  2VE8 A;  4PSX A;  1IN4 A;  2PZ9 A;  4GXO A;  4OIR F;  4UNO A;  5L3D A;  3IUV A;  3S1R J;  4MFE A;  4E7Z A;  3WGI A;  3H9G A;  2XC7 A;  3B6C A;  1HSJ A;  3TGN A;  1JXS A;  1SC7 A;  2EZI A;  2K9M A;  5AIP A;  5F27 A;  1H0M A;  1HDP A;  5J1Y A;  2IS4 A;  5FGL A;  3VYS B;  3MZY A;  4ENM A;  3ABL H;  2HQR A;  2CO5 A;  3O2P E;  1WCM J;  5FFX A;  4ENN A;  5DCM B;  4P9U A;  1PUE E;  3EET A;  4GFL A;  3ZQF A;  2OCC H;  1R1T A;  4UB6 C;  5ICF A;  4M9Z A;  5ICE A;  4GCV A;  2JUG A;  1IXR C;  2XAU A;  4XOT A;  4PXI A;  3IWF A;  3B81 A;  5J4Y A;  1B9M A;  4EM0 B;  3TO9 A;  3QYE A;  2DDA A;  1OIS A;  3MCZ A;  2L9S A;  4ACI A;  1PJR A;  4KN7 X;  1N78 A;  3MD2 A;  1DU0 A;  1HKS A;  2DA3 A;  3PUB A;  4KYW A;  3FXL A;  2GXB A;  3CCJ I;  4M3D A;  4F7Z A;  1E3O C;  3G2B A;  4LG0 A;  1RR8 C;  4L18 B;  4AWX B;  1XGS A;  1W7P B;  2LLK A;  2HS5 A;  2PMZ N;  2W82 A;  3DBR B;  4TV7 A;  3GME A;  1OCO H;  4M6V A;  4BEH A;  1V55 H;  3A02 A;  2LKP A;  4FE7 A;  4R8H A;  2LD5 A;  4XIC A;  2DW4 A;  2VKD A;  5HNF A;  4IF4 A;  2KRH A;  4D5C A;  2RKH A;  1I3A A;  3PIP F;  4Z2Y A;  1W0U A;  3OYD A;  1PUF A;  1TWC J;  3DQV C;  5BS6 A;  1J2X A;  2IS6 A;  1KON A;  1HBX G;  3V8L A;  4L0Z B;  3LHQ A;  2VB6 A;  2Y2Z A;  3TMO A;  5CJ9 A;  5AQC A;  4Y3O A;  5CVI A;  5E3M A;  2BW3 B;  3ZQG A;  4UUT A;  5J8C A;  2JJ7 A;  2OTJ I;  1MMG A;  1ACI A;  3OWT A;  1ZRD A;  3PO2 J;  2PMU A;  2HXI A;  2QWW A;  3OYG A;  2LY9 A;  2P81 A;  2R7F A;  3BR6 A;  3H9J A;  3OL4 A;  3LFK A;  1WSU A;  1POG A;  1PYV A;  2HOA A;  4ASN A;  3S93 A;  3CCQ I;  4BXU A;  3PFY A;  2RC4 A;  3FXQ A;  2W1O A;  2E1O A;  4BJ5 C;  1NK2 P;  2CQX A;  1JTX A;  2E2I J;  4A5N A;  2FEZ A;  1IDZ A;  2R7R A;  2G3B A;  2VKE A;  4OIQ F;  1B1B A;  1FC3 A;  1R71 A;  2Y69 H;  4JBA A;  4W1U A;  3ZQ7 A;  4XMY A;  2XF7 A;  3OS0 A;  1U5T B;  1QZZ A;  5DDG A;  2PBX A;  4JX4 A;  2K86 A;  1N75 A;  5E8G A;  3I0T A;  5TIS C;  4RGR A;  2HKU A;  4B09 A;  4J00 A;  5M3M J;  3C2H A;  4JKZ A;  4G94 A;  2OV7 A;  2YU3 A;  1Z6R A;  5IY5 H;  2EIJ H;  1UAA A;  2O8K A;  2X1C A;  2ZXI A;  3IUO A;  2LK2 A;  3RYP A;  4D7M A;  3DBL B;  3WGG A;  3CF2 A;  3NI7 A;  4RGU A;  4ZTJ A;  4DBQ A;  3KKC A;  2JA5 J;  4FQG A;  1GHC A;  2NOG A;  1GT0 C;  1T33 A;  1ZLJ A;  5C44 J;  2LMD A;  2MD5 A;  1U5T C;  3FK7 A;  5AIQ A;  2ZY9 A;  1TBX A;  1WKM A;  3DXJ F;  1QZY A;  2F5F A;  5D8L B;  3ERE D;  4I0A A;  2XAQ A;  3F3X A;  4LD5 A;  5F04 A;  2VN2 A;  4ZTF A;  3CJQ B;  3DFG A;  4QTR A;  2CUJ A;  1SFE A;  3IV5 A;  2OZ6 A;  2L9R A;  1ZN2 A;  3DP7 A;  2UXO A;  4M3F A;  4MQ9 F;  1DQU A;  1B59 A;  1L3L A;  1O3T A;  1P9Q C;  4Y52 J;  4FT8 A;  4ESB A;  3JRG A;  1WGX A;  1AKH A;  5IT9 Z;  3BTI A;  3HE0 A;  4IVN A;  4MEX F;  3I5U A;  2YX7 A;  2CU7 A;  5BPD A;  2FJI 1;  4KWA A;  3H5R A;  1HW5 A;  3J7Z I;  1WJC A;  2DXI A;  2K9S A;  2HTJ A;  4XBF A;  3ZR8 X;  3S2W A;  4LK1 F;  3GEU A;  2A6E F;  2K3F A;  2EFN A;  3B6A A;  3I64 A;  3SZP A;  1LPQ A;  4W97 A;  3DCF A;  5H6Q A;  3D5R C;  5KK1 A;  1IW7 F;  3FHN A;  3TOA A;  5ERI A;  3WU0 A;  2E1M B;  2DT7 B;  1X19 A;  5HLT A;  5FD6 A;  2AXT C;  4DNC A;  1YW8 A;  3LA2 A;  4B8X A;  3S3O A;  2JA7 J;  1U78 A;  1KZH A;  4Y33 A;  1OCR H;  2V4J C;  2W24 A;  5H6R A;  3TP0 A;  5IOY A;  2E5N A;  5HDK A;  2PJR A;  3BJB A;  1FMW A;  2M0M A;  1J09 A;  1DGW Y;  4HEA 2;  2V1X A;  2LG4 A;  3ZCO A;  4EQQ A;  3OR2 C;  4IHV A;  5D1R A;  1GV5 A;  5ILV A;  2R92 J;  2V79 A;  3RPU D;  2DFH A;  4AIH A;  4O6J A;  3DKY A;  1BIA A;  3A0H C;  1TNS A;  1WJE A;  2E1M C;  2FOK A;  3HJE A;  5L3B A;  3QWL A;  2ZSI B;  3HZJ A;  4NUB A;  2M4K A;  2V7F A;  1NTC A;  3RKX A;  1ETV A;  3BCG A;  3J81 K;  2GOX B;  5FRM A;  2LRE A;  2KZG A;  5EFY A;  4JX5 A;  2NVY J;  3K8P C;  5KHD A;  5IP7 J;  4CIC A;  2MW8 A;  1KU3 A;  2EIK H;  5F08 A;  2AQE A;  4S04 A;  1IF1 A;  2DYR H;  3GTG J;  3AFH A;  1ODD A;  3M4O J;  2M7A A;  3LMM A;  3I4P A;  1MIJ A;  1BR2 A;  3I58 A;  4HST A;  2COB A;  2LRD A;  4G7H F;  2OTL I;  3CES A;  3KP6 A;  5E17 F;  1R49 A;  5CPR B;  2BEO A;  2AO9 A;  2PLY A;  3M8J A;  2V9V A;  1EH6 A;  1SD6 A;  1BL0 A;  2QQA A;  3F8B A;  2LKS A;  4GCK A;  1X1A A;  1IRF A;  2EBI A;  3IP4 B;  3O6B B;  3P5J A;  5FGM A;  4AC6 A;  1RR7 A;  2ZCX A;  2DT5 A;  3CD6 I;  2JWT A;  2CV0 A;  3NEU A;  4UB8 C;  3Q9S A;  1Q1H A;  3F6V A;  4BHP A;  2ETH A;  2YVE A;  1ZK8 A;  1P4A A;  1KQ9 A;  2QKM B;  3GLL A;  2FBI A;  4JYK A;  4OIN F;  1HA8 A;  3G56 A;  3F8N A;  2MSY A;  2Q0O A;  2A5Y B;  3O3K A;  1J0R A;  5JLW A;  1MND A;  4GYI A;  4A3M J;  1MKM A;  2CQK A;  5GTI C;  2PI0 A;  3P9T A;  3ZQL A;  3CUQ B;  3FDY A;  2IU5 A;  4MIM A;  3QKX A;  3VOD A;  2EIL H;  1I5Z A;  1P4X A;  3CJT B;  4BJ6 C;  1DUX C;  4CYC B;  2F5D A;  1ZKG A;  4PJ0 C;  1R7J A;  5HDN A;  4YFX F;  1B72 B;  5FLX K;  3FWE A;  2BGC A;  2DBB A;  4A0Z A;  5EEH A;  1Y8Q B;  2CW7 A;  2KIS A;  2DTR A;  3LSG A;  1LNW A;  2L5Q A;  1R4N B;  3ML6 A;  5E1X A;  2O61 A;  3OSG A;  3KLO A;  3CCS I;  1GVD A;  2X6O A;  1UG2 A;  3CUQ C;  1NHA A;  4ICH A;  2Y30 A;  3BR5 A;  3PFI A;  4OIP F;  3LAP A;  2G7H A;  3CLO A;  4HQM A;  4PGG A;  4M9X A;  4ZJZ A;  4NC7 A;  2O03 A;  2K9Q A;  3VSK A;  4MQV A;  3FMQ A;  4KIC A;  1IO2 A;  3MN2 A;  4BQO A;  5CVJ A;  2HWV A;  3S3N A;  3W2V A;  2F48 A;  3ZMD A;  1LB2 A;  1FZP B;  3JCU C;  3BZC A;  1JKP C;  2P6S A;  3MEX A;  4RA2 A;  2OUM A;  5EJC A;  1XSD A;  2O0Y A;  3BPX A;  3RPQ A;  3CCE I;  3U21 A;  3OY9 A;  3V6G A;  1JUP A;  2VPR A;  1YFH A;  2GEN A;  1X4O A;  2JA6 J;  2K27 A;  1XPX A;  2IVM A;  3EUK L;  2MC3 A;  3HPG A;  2A6H F;  4IX7 A;  2NXN B;  3EYI A;  4C2M A;  1FBU A;  2IEK A;  2XAF A;  4WCG A;  4FX0 A;  1VND A;  4G8X A;  2LR8 A;  2QSG X;  2CS3 A;  3IC7 A;  3NXC A;  5E3N A;  2VIX A;  3CME I;  2FD5 A;  2HQN A;  1OKR A;  4YG2 F;  1OCZ H;  3CJD A;  2RAE A;  2L2O A;  3NRG A;  2ZBK A;  1VQ4 I;  3GZI A;  4UV9 A;  1SAU A;  2RAS A;  3HIF A;  4F55 A;  1IJW C;  4HG2 A;  1BM9 A;  3BR0 A;  2NP5 A;  4YEJ A;  1ZGW A;  1S7E A;  5M5X J;  3P7N A;  1T8I A;  2KFD A;  2WV1 A;  4M3E A;  2XAJ A;  1QA6 A;  3E6M A;  1W4M A;  2WGB A;  1HQC A;  4DYQ A;  2G0E A;  2O7T A;  1GV2 A;  4IKF A;  3RSN A;  4Q4Z F;  3RKQ A;  2CMP A;  3CUO A;  1ZAO A;  3GTK J;  5CQE A;  2W57 A;  4AUX A;  5IOZ A;  2L9N A;  3EPZ A;  2VL8 A;  4ETS A;  2H1L A;  2FQ4 A;  4KMU X;  4Y17 A;  2EV6 A;  2GUH A;  2JPC A;  5EZG A;  5LEK A;  2F4O B;  5FD5 A;  3ECO A;  2QSF X;  3OYL A;  2F2E A;  2EJR A;  2XKP A;  3VYU B;  3K69 A;  1QRY A;  1JHF A;  2FA5 A;  4XSZ F;  5K5R A;  4EEF G;  3KZI C;  5J40 A;  4BUP A;  3K4C A;  3V8K A;  3BQZ A;  4XN3 A;  2LBF B;  1OCT C;  1FX7 A;  1W7P D;  2A68 F;  3KYL A;  4GRI A;  4GFB A;  4LG3 A;  4XLH A;  2CJJ A;  3Q9V A;  3SJM A;  1IN7 A;  2RQP A;  4A6D A;  4ESJ A;  3K7A J;  1S7O A;  1VQ9 I;  1R9T J;  3Q0U A;  5GPC A;  2WAQ N;  1XGM A;  2HDD A;  1DU6 A;  3MZH A;  3U1K A;  2UZK A;  2ZJ2 A;  3JSP A;  1ZHF A;  2IGO A;  1OMI A;  3S8P A;  3CMY A;  4D1Q A;  1A5J A;  1UHS A;  1I1S A;  1WVR A;  3IKV A;  4B48 A;  3FBI B;  2LY2 A;  3J7A Y;  4F91 B;  1KQ0 A;  2FSW A;  3ZQI A;  1W5T A;  3ZQC A;  1AWC A;  2UUZ A;  2XDN A;  2KJC A;  2KT0 A;  1DPU A;  2I8D A;  3BTJ A;  4IHT A;  3G1O A;  2KMU A;  1SGM A;  3VIB A;  2IXS A;  2O8X A;  4CH7 A;  3GFM A;  3Q5F A;  3SXY A;  3OS1 A;  3IWZ A;  1BR1 A;  3MKY B;  1YRN B;  1I1G A;  3GZ5 A;  2K85 A;  3GTP J;  4E7J A;  3GCM A;  3KP3 A;  4P1W A;  4OMY A;  1RIO H;  3BNI A;  5J4V A;  5LBQ A;  2VT3 A;  2QOP A;  3NPI A;  3TDU C;  1G3W A;  5JR3 A;  2M8G X;  3L2V A;  2VBY A;  3FXO A;  1UG0 A;  3H36 A;  1R36 A;  3P9C A;  4L0Y B;  3BZ6 A;  2NVU B;  4CDG A;  5DAJ A;  2IRF G;  4HNT A;  3C2G A;  4IRH A;  3RKY A;  3ZN0 A;  3WU2 C;  1ZG5 A;  2CWE A;  3IH2 A;  2ZME A;  2R7Z J;  1D1A A;  1X1P A;  3K4L A;  2XF5 A;  2FNP A;  4D0P A;  3EYY A;  3W3C A;  3L2R A;  3WU1 B;  1R00 A;  1H9T A;  1YE9 A;  2DA6 A;  3C7J A;  4PJM A;  4IOC F;  4LB6 B;  1XMK A;  4KFC A;  4CXF A;  5FKL A;  5LGN A;  1ETK A;  4FE4 A;  4O3M A;  2UXN A;  4EJT A;  2Z2S B;  3QOP A;  5F1J A;  2IGK A;  1YW7 A;  4G7Z F;  2XGE A;  1IUY A;  1O7F A;  1OYY A;  2R7S A;  1KA8 A;  3ECH A;  3L09 A;  5K1Y A;  3L2C A;  4OMZ A;  2M3A A;  4UUV A;  3BCA A;  5HAW A;  1R5I D;  3DU6 A;  3EGQ A;  1QU3 A;  2HR3 A;  1ETX A;  2MAB A;  4BE2 A;  2ZB9 A;  2EIN H;  1XGO A;  4RAZ A;  3MVP A;  3RZO J;  2R5Y A;  4HF2 A;  4AC0 A;  2QSH X;  4NQW B;  3ZQQ A;  2NS0 A;  4YRV A;  3HOU J;  2DMQ A;  3K1P A;  1VQ5 I;  2OQR A;  4PUS A;  4XNF A;  1DP3 A;  2LOO A;  2VPL A;  1U9N A;  2DU9 A;  4FX4 A;  3WE2 A;  4D9J A;  2FBQ A;  3FXU A;  5JHU A;  2O3F A;  1U3E M;  2HQ5 A;  3BY6 A;  1XN7 A;  3CMM A;  4WXC A;  3BR3 A;  3MKW B;  2O5R A;  3HUG A;  1NK3 P;  1AA7 A;  4I99 C;  3ZPL A;  3VOX A;  2OC6 A;  4OD5 A;  1X1B A;  3QP6 A;  2BE5 F;  1WWX A;  1Z1D A;  2B63 J;  1T0F A;  2O9L A;  4BL0 B;  2P5V A;  3SZT A;  4P5O A;  5K7H A;  4HAM A;  3MAJ A;  3DTK A;  5M3F J;  2FE3 A;  4BHC A;  3F8C A;  4FAS D;  2DOD A;  2ZNY A;  4PK4 A;  4KIT B;  3LSM A;  4OWR B;  3VUQ A;  3SDG A;  4RM2 A;  3GO5 A;  3MNL A;  1RC9 A;  2M2E A;  1D5V A;  1SAN A;  2RDP A;  5GPA A;  3TW6 A;  3FXM A;  3F23 A;  3DTI A;  3D1N I;  5LFA A;  3R0A A;  1IV8 A;  4XRS A;  3FM3 A;  3OYJ A;  2WB1 A;  4IJA A;  4HW0 A;  3CJR B;  3BG6 A;  3L2W A;  4DZP A;  1O3R A;  2WAF A;  2Z5U A;  2D2W A;  4X0G A;  4E7H A;  2XDV A;  4RLQ A;  2JRT A;  4HDV A;  4LLN A;  2D5V A;  2GFN A;  1UMQ A;  4PSW A;  4ON0 A;  3WTZ A;  1FBQ A;  2DK5 A;  3CRJ A;  1YS6 A;  2BY0 A;  3HSF A;  3L7W A;  5FB2 A;  3E6C C;  3JAM K;  1TNT A;  2W25 A;  1A6Q A;  3AL0 C;  1KYW A;  4YFN F;  5BNG A;  4ZC3 A;  2IGM A;  2K40 A;  1FIP A;  3OS2 A;  2G7G A;  3GX4 X;  2P5L C;  2LVS A;  2AS5 F;  1TZL A;  4YEL A;  2QWT A;  1EV7 A;  3OIP A;  3WHC A;  3MWM A;  3I9V 2;  3HL2 A;  5HLI A;  3U1D A;  2DA1 A;  2G7L A;  5L3C A;  3HIM A;  3IH3 A;  4QWQ A;  2R93 J;  4EVI A;  1R22 A;  1LVA A;  2V26 A;  3LSJ A;  5D5W B;  3F1B A;  2CFO A;  5E18 F;  3RQ4 A;  4YII A;  5J8F A;  3JRD A;  1O57 A;  3LQQ A;  3OYB A;  2H6B A;  5CYV A;  3E97 A;  3FXJ A;  2CRG A;  3WTW C;  3SHF A;  4F52 A;  5D5U B;  5EG0 A;  3E1S A;  4ZH4 F;  2MGQ A;  1QHG A;  1FP2 A;  2M7B A;  3SDB A;  1OQY A;  1VQP I;  4M72 A;  1SAX A;  1X2M A;  4A3G J;  3BHQ A;  1XSX A;  4BS9 A;  1JE8 A;  3KLN A;  3GUD A;  1QNT A;  1D8J A;  1IXS B;  3IH4 A;  4WXH A;  2W85 A;  4UUS A;  3H3U A;  5M5Y J;  2MH9 A;  2E34 A;  4B44 A;  1WFX A;  3CZ6 A;  4XOR A;  1GXP A;  1FLI A;  2R7U A;  3HM5 A;  1ON1 A;  3TKY A;  3ANP A;  4A2U A;  2XSJ C;  2P7C B;  1XSV A;  3KNW A;  2E1N A;  4L9V A;  3OOU A;  2XPV A;  4LLG F;  3J80 K;  3BOQ A;  2P6T A;  1SVM A;  4I02 A;  5KNL A;  4UHT A;  4EM2 A;  1FY7 A;  2D1V A;  3K4N A;  1F5T A;  1OR7 C;  1H88 C;  2FNA A;  3CO6 C;  5TGT A;  2ZNZ A;  3IRR A;  5D6E A;  4L5J A;  2OF7 A;  2HGC A;  3N05 A;  4M3B A;  3T5X A;  5FFZ A;  3QAH A;  5HS8 A;  3GTO J;  2GQQ A;  4QPQ A;  2WY7 Q;  2JPB A;  4GCT A;  5FKK A;  5A2Q Z;  1Z9C A;  2L3D A;  4OAZ A;  4N9I A;  1VTN C;  3FKI J;  3M9A A;  3K1N A;  5E3O A;  5F1R A;  1R5H A;  1MW7 A;  3CDI A;  4XM3 A;  4FHT A;  5EF6 A;  4RB3 C;  3BJO A;  2QZ8 A;  3LSH A;  3O8H A;  5C3E J;  1FBS A;  3BR1 A;  1ZRF A;  4GFK A;  4JP0 A;  2GOM A;  2RN7 A;  1MSF C;  3A0B C;  2DFE A;  3DF8 A;  3PM1 A;  4ENK A;  2DOF A;  3LNQ A;  4P9F A;  1C0W A;  1U9O A;  5CVU A;  2LSO A;  2WB1 N;  3W6K B;  1Z77 A;  3OIO A;  1LE8 B;  1B4A A;  4PJN A;  5E3L A;  1HST A;  4AF5 A;  1UI6 A;  3I59 B;  2KDZ A;  4UVA A;  2Z99 A;  3A03 A;  4U9N A;  3CC4 I;  1T2K A;  2Y48 A;  3OYI A;  3HRM A;  2M8E A;  1ETO A;  4V2G A;  2XVC A;  2AQF A;  4MTE A;  1ZR4 A;  1YI2 I;  2OAZ A;  2G9W A;  3CCM I;  4KA4 A;  2EFO A;  3KP7 A;  4DBR A;  3OIQ A;  4YFK F;  5TRD A;  5BOX A;  2OER A;  4HLY A;  3P9K A;  3IHU A;  2DA4 A;  5J47 A;  5DYM A;  1OPC A;  2WUI A;  2HDW A;  5HBU A;  1ZQ3 P;  4J01 A;  2V1N A;  4XR6 A;  1JGS A;  3VFZ A;  3ZOB A;  3JRI A;  5J3L A;  2VKV A;  1R1U A;  2JMW A;  2M0C A;  3FM5 A;  3ANG A;  2VLA A;  1X4P A;  2MH2 A;  3E7L A;  3HPH A;  1M1E B;  3I4N J;  3HKZ A;  2OQG A;  4A93 J;  1JUM A;  2P4W A;  2VOO A;  3U9G A;  4MK6 A;  4C3I J;  5D5X B;  3JW4 A;  3VYT B;  2EB7 A;  2X48 A;  4ITV A;  1YX3 A;  3PSF A;  3NS4 A;  2AXL A;  1T38 A;  2UV1 A;  2M9H A;  2VQL A;  2EIM H;  2F6C A;  2HZD A;  4MXM A;  1ZGA A;  3QYF A;  3HBL A;  3LSI A;  1Z05 A;  3GFL A;  3S16 J;  4Y15 A;  5F64 A;  1FPQ A;  4YZE A;  1LFB A;  1JT0 A;  1SVO A;  3KCC A;  1OYW A;  1DGR M;  1R58 A;  2ESN A;  4MHG A;  3E5X A;  2A61 A;  3I71 A;  3NAR A;  1CQT A;  3WTY C;  2XAH A;  4XK4 A;  2KPM A;  3D5L A;  2DLL A;  2Q8K A;  2VT2 A;  1Z7U A;  2JA2 A;  2KQR A;  4QIW N;  5FLM J;  2DFI A;  2MLG A;  2Z16 A;  4RAF A;  2RNG A;  3ZP5 A;  2PN6 A;  2VXZ A;  3CCY A;  1V5E A;  3LA3 A;  4BE1 A;  1YJN I;  3JSJ A;  1Y0N A;  4PJJ A;  1F43 A;  4RGS A;  2LNB A;  4DOZ A;  2A07 F;  4D5F A;  3PIO F;  3LWJ A;  3CTA A;  5DCM A;  2BYV E;  4LIU A;  2X4H A;  3OR1 C;  5JFR A;  2VAS A;  4L9J A;  1S9H A;  5DD8 A;  1MH4 A;  2K4B A;  3ASN H;  1LEB A;  2F5C A;  2XPW A;  2K3P A;  3BWG A;  2KIM A;  5HDG A;  3WTS C;  1H8A C;  3OMY A;  3M07 A;  5J6X A;  4GO1 A;  1RES A;  2QQ8 A;  4Y13 A;  3G1M A;  3I3L A;  4CCJ A;  4HKU A;  1MMD A;  4CGR A;  5FKO A;  2R7O A;  2XF6 A;  2QYO A;  1L0O C;  2NVQ J;  3WGH A;  1D0Y A;  3DKX A;  3D0S A;  3S32 A;  1P6R A;  3S1M J;  2QEX I;  3K2Z A;  1KQ8 A;  2LTP A;  4YIR X;  4L9N A;  1OCC H;  3ZMU A;  3ZGK A;  4RLF A;  1W7P A;  1CF7 A;  1B6A A;  3E6B A;  4A5M A;  3GF2 A;  1IZ1 A;  1PP8 F;  2X1D A;  1ZEL A;  2HFH A;  1FOW A;  2IS2 A;  2DPU A;  1SFU A;  1BBY A;  1I39 A;  3BC8 A;  2CV2 A;  4QLC U;  3L2U A;  2L9V A;  1TLH B;  3NAU A;  3AQT A;  3AG1 H;  3FXR A;  3GEZ A;  1UI5 A;  1K78 B;  1T56 A;  1JJ8 C;  2XPU A;  2NOJ B;  2BW3 A;  2IPQ X;  2YSR A;  4I7H A;  1LEA A;  3BQY A;  3FMS A;  2DA2 A; 
#chains in the Genus database with same CATH homology
 4GFB A;  4IHW A;  3VVZ A;  1AU7 A;  2CJJ A;  3SJM A;  2L7F P;  3LJL A;  4BY7 J;  3K7A J;  2IBD A;  2DMN A;  2DN0 A;  1R9T J;  3Q0U A;  1WI3 A;  5GPC A;  1RPW A;  2WAQ N;  5IP6 A;  2R5Z B;  3FRQ A;  1MBJ A;  4B1R A;  5FKN A;  4C3J J;  2HDD A;  4BBS J;  1DU6 A;  2G7S A;  4D7N A;  2ECC A;  4DW6 A;  2DG8 A;  2Y9Z A;  1K83 J;  3CMY A;  2NVT J;  2EZL A;  1A5J A;  1UHS A;  3GTQ J;  1MBK A;  3Q3S A;  5K58 A;  1MBF A;  3VPR A;  3ZQI A;  1IC8 A;  3ZQC A;  1XS9 A;  1BW5 A;  2XDN A;  3GBG A;  2KT0 A;  4DYR A;  1G2H A;  3BTJ A;  3G1O A;  1SGM A;  3VIB A;  1ETQ A;  3SFI A;  3Q0V A;  4BXX J;  1IDY A;  2EZH A;  3HB9 A;  1Y1W J;  5IP9 J;  1YRN B;  1X58 A;  2JA8 J;  1HF0 A;  4UDS A;  2VI6 A;  3GTP J;  2GBY A;  2UXI A;  3ON2 A;  3S5R A;  3E7Q A;  2DJN A;  2ECB A;  3VVX A;  3BNI A;  4X1E A;  3TW7 A;  3S1N J;  3NPI A;  2QOP A;  1IV6 A;  4NN1 A;  4A3C J;  4B3A A;  2M8G X;  5DAJ A;  2HXO A;  3HOW J;  2H8R A;  2TRT A;  1XC5 A;  3IH2 A;  2R7Z J;  5FLV A;  4J19 A;  4AYB N;  2DMT A;  2F07 A;  2TCT A;  2JK3 A;  3BG3 A;  4RBO A;  5IPA A;  2MG4 A;  3WHB A;  3S2H J;  3CQZ J;  1XG1 A;  3FIW A;  1OFC X;  1I3Q J;  2PZ9 A;  4LOC A;  5DS9 A;  3IUV A;  2DA6 A;  3S1R J;  3I4M J;  3M3Y J;  4MFE A;  1H89 C;  5FKL A;  1ETK A;  4FE4 A;  3B6C A;  1EF4 A;  5JLX A;  2Q24 A;  5F1J A;  2EZI A;  2DA5 A;  5F27 A;  2RHA A;  1HDP A;  2Y31 A;  5J1Y A;  2XGE A;  5FGL A;  2XB0 X;  1WCM J;  5J1U A;  2QIB A;  2W48 A;  3AQS A;  2YVH A;  1IGN A;  4GFL A;  5HAW A;  3ZQF A;  1A6I A;  3EGQ A;  4A69 C;  1ETX A;  2CUF A;  3VVY A;  1P7J A;  2ZB9 A;  4S0H B;  4PXI A;  3B81 A;  5F0H A;  2GLO A;  3MVP A;  3RZO J;  1BJZ A;  2R5Y A;  4JNN A;  4AC0 A;  2DMU A;  4ACI A;  4FTH A;  3HOU J;  2DMQ A;  1DU0 A;  2DA3 A;  4BKX A;  5CXI A;  4M3D A;  1E3O C;  1X2N A;  1U9N A;  5EEA A;  4IHY A;  2LLK A;  2PMZ N;  2FBQ A;  3LSR A;  4M6V A;  1ORK A;  2HQ5 A;  4BY1 J;  3A02 A;  1ZR2 A;  4FE7 A;  2LD5 A;  2EH3 A;  3BR3 A;  4XIC A;  4Y7N J;  5IYD J;  2NX4 A;  2XGC A;  4D5C A;  1W0U A;  1IRZ A;  1NK3 P;  1PUF A;  1TWC J;  3VOX A;  5H9T A;  3LHQ A;  2E19 A;  5M5W J;  3HOV J;  2H1K A;  1LFU P;  1Z0X A;  2B63 J;  2Y2Z A;  2O9L A;  2QF7 A;  5AQC A;  1RET A;  3PPB A;  5E3M A;  3ZQG A;  4UUT A;  5K7H A;  2JJ7 A;  3VW2 A;  1TWF J;  3PO2 J;  2HXI A;  5M3F J;  3HGY A;  4IEJ A;  2LY9 A;  2P81 A;  2YUS A;  3BR6 A;  3JRE A;  3GTJ J;  3HEF A;  1POG A;  5FJ8 J;  3COL A;  1ENH A;  2HOA A;  2ID3 A;  3C2B A;  2E1O A;  1NK2 P;  3VUQ A;  2CQX A;  3SDG A;  1LE8 A;  3MNL A;  1JTX A;  2E2I J;  1OJL A;  5FMP A;  2M2E A;  4A3J J;  1IDZ A;  1SAN A;  1RKT A;  5GPA A;  3TW6 A;  2G3B A;  2VKE A;  2REK A;  3D1N I;  4B4C A;  4XRS A;  3HTA A;  2YU9 J;  2LFB A;  4W1U A;  3HKZ N;  4DZP A;  1APL C;  2PBX A;  3G7R A;  4JX4 A;  2LKX A;  2GFN A;  2HKU A;  3O8G A;  2D5V A;  1UMQ A;  5M3M J;  2HOS A;  4JKZ A;  2O8K A;  3CRJ A;  4HNV A;  4CYC A;  2LK2 A;  3JRB A;  5EYR A;  1B72 A;  4D7M A;  3GTM J;  3NI7 A;  3BT9 A;  5BNG A;  3RD3 A;  2UXP A;  3KKC A;  1GDT A;  2K40 A;  2JA5 J;  1FIP A;  3LSP A;  3O60 A;  2NOG A;  2G7G A;  3QBM A;  1GT0 C;  2LVS A;  1T33 A;  5C44 J;  2VUM J;  2QWT A;  3FK7 A;  2M34 A;  3HOX J;  3WHC A;  4A3K J;  4L62 A;  1MBG A;  2DA1 A;  3HDD A;  2G7L A;  3HIM A;  3IH3 A;  5F04 A;  4V2F A;  2R93 J;  3VP5 A;  2ZOY A;  2XB5 A;  4QTR A;  3IV5 A;  2N8G A;  3ZQH A;  3LSJ A;  2L9R A;  5FHP A;  2UXO A;  3BTC A;  4M3F A;  3K2A A;  3F1B A;  1FTZ A;  4GCL A;  4A3E J;  3JRD A;  1JKQ C;  4Y52 J;  1AKH A;  3JRG A;  1WGX A;  1MSE C;  2UXU A;  3BTI A;  2CRG A;  2ME0 A;  4FIS A;  3CDL A;  3HOY J;  1FTT A;  1VFC A;  5EG0 A;  4I6Z A;  2CU7 A;  3JRC A;  2MGQ A;  4KWA A;  2DG7 A;  3UKG A;  2FX0 A;  5EG0 B;  1TC3 C;  3JR9 A;  2K9S A;  5C4J J;  4ABZ A;  1X2M A;  3GEU A;  3B6A A;  4A3G J;  2L0K A;  3BHQ A;  1OCP A;  2HI3 A;  4W97 A;  3DCF A;  2R0Q C;  4MFD A;  4DYC A;  1BW6 A;  2Y9Y A;  3IH4 A;  5C4Y A;  4UUS A;  5M5Y J;  4XRM A;  1O4X A;  9ANT A;  4NEL A;  1FIA A;  4UUS B;  3HM5 A;  3LOC A;  3ANP A;  4C2M J;  1ZTR A;  2JA7 J;  1U78 A;  2DA7 A;  3S1Q J;  3KNW A;  3TP0 A;  3RZD J;  2HYJ A;  2ME6 A;  1TWH J;  5IOY A;  3HOZ J;  3BJB A;  4GCK A;  2ID6 A;  3HTJ A;  2CUE A;  3OOU A;  2XPV A;  4IHV A;  5D1R A;  4MO7 A;  5GP9 A;  2R5Y B;  1GV5 A;  3JRH A;  2R92 J;  3G1L A;  2DMP A;  1H88 C;  3V78 A;  5IYB J;  2OF7 A;  4A3B J;  1NTC A;  1ETV A;  4M3B A;  4DZJ A;  3GTO J;  3JRF A;  2K9N A;  3BCG A;  4L5E A;  4I76 A;  3BRU A;  4GCT A;  5EFY A;  4JX5 A;  2NVY J;  5FKK A;  2NP3 A;  5IP7 J;  1QPI A;  2MW8 A;  3S17 J;  5F08 A;  1SFO J;  3FKI J;  3H0G J;  4BBR J;  4XRS G;  3GTG J;  1PUF B;  1HCR A;  5HSZ A;  5E3O A;  3M4O J;  3VOK A;  2OPT A;  1MBE A;  2IAI A;  2COB A;  5EF6 A;  3OSF A;  4IHX A;  5D19 A;  3O8H A;  1HDD C;  5C3E J;  4A3I J;  3BR1 A;  1U8B A;  2AHQ A;  2UXH A;  4GFK A;  4JP0 A;  2AO9 A;  3QQA A;  2ZOZ A;  4JL3 A;  3QPL A;  1MSF C;  4FCY A;  3PM1 A;  1BL0 A;  3TP3 A;  3LNQ A;  1B8I A;  4RDU A;  1D5Y A;  2EBI A;  1K61 A;  1U9O A;  4AC6 A;  1B8I B;  1RR7 A;  3BG9 A;  2WB1 N;  2ZCX A;  1Z77 A;  2JWT A;  2NS7 A;  3OIO A;  1LE8 B;  5IYC J;  5E3L A;  5J1R A;  4AF5 A;  5EZH A;  2JN6 A;  1UI6 A;  2KDZ A;  2QKO A;  2YVE A;  2EQR A;  1MNM C;  1ZK8 A;  3A03 A;  4JYK A;  3G56 A;  1F36 A;  2MSY A;  3S14 J;  2ZCN A;  2R5Z A;  1ETO A;  5JLW A;  4V2G A;  1ZR4 A;  1RKW A;  1QVT A;  4A3M J;  4G12 A;  3P9T A;  3ZQL A;  3DEW A;  2OER A;  4ME9 A;  2IU5 A;  2XGD A;  4MIM A;  3QKX A;  3F0C A;  5F0C A;  3T6N A;  2DA4 A;  1JTY A;  4CYC B;  2WUI A;  1ZKG A;  1B72 B;  5CXG A;  3KKD A;  5HBU A;  1ZQ3 P;  3L1P A;  1P7I A;  4NDL A;  3ZOB A;  2NS8 A;  3Q0W A;  2XRL A;  4A3L J;  3RQI A;  3JRI A;  1Y1V J;  3LSG A;  2VKV A;  3HGG A;  5J3L A;  2JMW A;  1Q1V A;  3H3V K;  1I6H J;  2ZCM A;  2M0C A;  3ANG A;  3OSG A;  2E2J J;  1WH5 A;  2E2H J;  4M3G A;  1YRN A;  1GVD A;  3E7L A;  3I4N J;  2X6O A;  1UG2 A;  4ICH A;  2FJ1 A;  2Y30 A;  4A93 J;  5EGO A;  1JUM A;  3BR5 A;  1W0T A;  3W6V A;  3MKL A;  1FEX A;  5EDN A;  4MK6 A;  4C3I J;  5EGO B;  2X48 A;  2K9Q A;  2I10 A;  2Y0S N;  3MN2 A;  2OI8 A;  1VF9 A;  2M9H A;  4MXM A;  2HYT A;  3HBL A;  1AKH B;  4MLO A;  3DPJ A;  3S16 J;  1IUF A;  3EUP A;  1JJ6 C;  4YZE A;  1TWG J;  1LFB A;  1JT0 A;  1JKP C;  2QTQ A;  5CW8 A;  1JGG A;  1HLV A;  1BA5 A;  3CWR A;  4QSH A;  5F0F A;  2W53 A;  3NAR A;  1CQT A;  5DTD A;  2LP0 A;  3V6G A;  4XK4 A;  3RH2 A;  1JUP A;  2VPR A;  1MBH A;  3GTL J;  2GEN A;  2JA6 J;  1WPK A;  5FLM J;  4QIW N;  1JKR C;  1JT6 A;  5FKM A;  3CCY A;  3JSJ A;  2CQQ A;  2IEK A;  1QVU A;  2L7Z A;  5C4X J;  1F43 A;  1VND A;  1IG7 A;  2LR8 A;  1WH7 A;  1ETY A;  4C3H J;  5K7Z A;  2YS9 A;  4D5F A;  3LWJ A;  4A3F J;  3NXC A;  5E3N A;  2XSD C;  2FD5 A;  1TWA J;  3A01 A;  3S15 J;  3CJD A;  2RAE A;  2L7M P;  3NNR A;  3NRG A;  1VI0 A;  3A01 B;  3BG5 A;  3GZI A;  3HE0 A;  1MH4 A;  4A3D J;  1H8A C;  2XPW A;  2RAS A;  1IJW C;  4XID A;  3ON4 A;  3BR0 A;  2NP5 A;  1RES A;  1HOM A;  1ZGW A;  1S7E A;  5M5X J;  4HKU A;  2GM4 A;  3G1M A;  3TED A;  2WV1 A;  4M3E A;  4CGR A;  5FKO A;  1MH3 A;  2X9D A;  1AHD P;  1ITY A;  1I50 J;  3BTL A;  2WGB A;  2NVQ J;  2DTZ A;  4DYQ A;  2G0E A;  2O7T A;  3BR2 A;  5HOD A;  5K7F A;  3S1M J;  1GV2 A;  2LTP A;  3RKQ A;  5D18 A;  2NVX J;  3GTK J;  3HTH A;  4X6A J;  2QCO A;  4AUX A;  1JUS A;  5IOZ A;  3S2D J;  3HTI A;  3KZ9 A;  1GUU A;  3VW0 A;  1FJL A;  2V57 A;  2EZK A;  2FQ4 A;  3C07 A;  3PO3 J;  2GUH A;  5EZG A;  3NAU A;  3VW1 A;  3AQT A;  2ELK A;  1QRY A;  3JRA A;  2D6Y A;  1UI5 A;  2HOT A;  1JKO C;  1ETW A;  1T56 A;  4JX6 A;  1JJ8 C;  2XPU A;  4EEF G;  3FK6 A;  3QPS A;  3FIS A;  3PAS A;  3BQY A;  3BQZ A;  2O7O A;  1OCT C;  2DA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...