2IEKA

New crystal form of transcriptional regulator tm1030 from thermotoga maritima
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
LSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
publication title New crystal form of transcriptional regulator tm1030 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
total genus 70
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2iekA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iekA02
3EGQA 1RPWA 2DJNA 3HOYJ 4UDSA 1O4XA 2LP0A 4BY1J 2LK2A 1CQTA 5EG0B 2M2EA 4B4CA 1HLVA 1Q1VA 2K40A 3OOUA 2DTZA 1JTXA 4JP0A 2E2HJ 3LSRA 2DN0A 2X48A 3PPBA 3TW6A 1DU6A 1K83J 2N8GA 2Y9ZA 2CU7A 1YRNB 4FCYA 3GTKJ 3QPSA 1MBGA 2OF7A 3BTLA 2ME6A 5K7FA 5J1RA 2TCTA 1Z0XA 4AYBN 3JRAA 4A3KJ 1B72B 3KKDA 5FHPA 4NELA 4FE7A 3GTJJ 2CQQA 1P7IA 2ZOYA 2M8GX 2Y30A 4MFDA 2FD5A 4Y7NJ 4A3JJ 1JKRC 2E2IJ 3LSJA 4AF5A 2LR8A 2G7LA 1JT6A 1I3QJ 2E1OA 2WAQN 4M3FA 5C4YA 2COBA 1AU7A 1S7EA 4FISA 3JRBA 5EZHA 4FE4A 3GTOJ 3M3YJ 3ZQLA 2KDZA 2LVSA 3GTMJ 4L62A 1OCPA 2CRGA 3PO3J 1TC3C 4MXMA 1HCRA 1UHSA 4AUXA 1VFCA 1ETQA 1JUPA 4W97A 2G0EA 3GTGJ 5IOYA 3HEFA 2GUHA 3AQSA 3SJMA 1IV6A 3D1NI 3M4OJ 4DYRA 3RQIA 3S1QJ 3HGGA 3BR0A 1Y1VJ 1WH7A 3V6GA 3W6VA 3GZIA 1LFBA 1U8BA 3BRUA 1POGA 4D7MA 3KNWA 3HM5A 2HI3A 2JA8J 4B1RA 5J1UA 1LE8A 2DA5A 1FJLA 3PM1A 4M3DA 1GV5A 4IHVA 3HE0A 3JRIA 4DYQA 3JRHA 5FJ8J 1IGNA 1MH4A 2R7ZJ 3HTHA 3ZQCA 1IRZA 3B81A 3Q0WA 2NP3A 1GDTA 1RKTA 3QPLA 2EZKA 1IDYA 3BT9A 4UUTA 2X9DA 4IHYA 1OFCX 3HGYA 1ENHA 5F0CA 2H8RA 4I6ZA 1TWCJ 5F27A 3ZQGA 3S1RJ 2EH3A 2JN6A 3S1MJ 5IYDJ 1R9TJ 2ID3A 1LE8B 2UXOA 2YVHA 4RDUA 5FGLA 3F0CA 2M9HA 3VUQA 2R5ZA 3K2AA 4NDLA 4J19A 3Q0UA 2E19A 2EZLA 3GTLJ 1ITYA 2IBDA 3BQZA 2FX0A 3K7AJ 3BCGA 3GTPJ 4GFBA 4GCTA 3LOCA 3FKIJ 2RASA 2Y2ZA 2JA5J 3IV5A 3PO2J 5DTDA 2JWTA 2FJ1A 1HDPA 1U9NA 3RZDJ 1HDDC 4JKZA 4MFEA 2DA7A 3F1BA 4XRSG 4JX5A 5F0HA 1X58A 1JTYA 2R5ZB 3A01A 2D5VA 3BNIA 5JLXA 2LKXA 2DMQA 2DMPA 3BR5A 2QIBA 3FIWA 1VNDA 5C4XJ 3IH4A 2YVEA 3JRDA 3LHQA 2XDNA 5CXGA 3BR2A 1X2NA 2DMUA 3VPRA 1MBHA 3TP0A 1EF4A 5HSZA 5F08A 3CQZJ 3UKGA 4A3CJ 2JMWA 3O8GA 1WGXA 2OI8A 1NTCA 3DEWA 1JKQC 1NK2P 3VW1A 1ZQ3P 3HIMA 4QIWN 2WUIA 2WV1A 3A01B 2MG4A 5D19A 1ETKA 3A02A 4JX4A 2E2JJ 2UXPA 5IP7J 3VW2A 3HBLA 2REKA 1WI3A 1A5JA 3I4NJ 3G1MA 2MSYA 3JRFA 2NS8A 5GPCA 3CMYA 2YU9J 1T33A 3COLA 3S2HJ 1IUFA 1TWAJ 3KZ9A 1MBFA 1WH5A 1TWHJ 2JJ7A 3GBGA 2CUFA 2DA3A 2GBYA 3HOWJ 2OERA 3AQTA 2XRLA 4EEFG 3S17J 2PBXA 1SANA 2M34A 4JX6A 5C4JJ 4X6AJ 1IDZA 1E3OC 3VP5A 1JKPC 2XGEA 5J3LA 5IYBJ 1FTZA 3HOVJ 4M3GA 2R0QC 2ZB9A 2H1KA 2X6OA 3B6AA 3FISA 2LTPA 4M3EA 4V2GA 1QPIA 3RZOJ 2F07A 3QBMA 4A3BJ 3FK6A 2O7OA 5E3LA 4X1EA 3HOUJ 1BW5A 1VF9A 2IAIA 2UXIA 2NVTJ 3HB9A 2R92J 3HTJA 3IH2A 5GPAA 1ZGWA 3P9TA 1MBEA 4JL3A 2IU5A 4ACIA 4D5CA 4DZJA 5K7HA 2G7GA 2EQRA 1U78A 1AHDP 4G12A 1RR7A 4BBSJ 1DU0A 1WPKA 3BG5A 2DMNA 4A3IJ 1JUMA 1X2MA 3S16J 2VUMJ 3BR3A 5EYRA 4BXXJ 3E7QA 3JR9A 2ME0A 1G2HA 3G56A 3RD3A 2CQXA 5M5WJ 4A3MJ 5EFYA 1A6IA 2GM4A 2K9QA 2RAEA 5FKOA 2O9LA 3H0GJ 3HTAA 2IEKA 2P81A 2VKVA 4A3DJ 2QWTA 4AC0A 3S5RA 5IP6A 5F0FA 2UXUA 2DMTA 2W48A 2B63J 5M3MJ 4DW6A 2VI6A 5K58A 4AC6A 3HTIA 1SFOJ 4CGRA 1RESA 3RKQA 1MSFC 3HOZJ 4BKXA 2HDDA 5IP9J 2GLOA 9ANTA 3G7RA 3G1LA 4M6VA 2GFNA 4HKUA 2LY9A 1BA5A 4GCLA 3OSGA 5EDNA 3L1PA 1XC5A 2MW8A 1ORKA 4C3JJ 1IJWC 2R5YA 3FRQA 3BJBA 2G7SA 2JA7J 1APLC 3S15J 3TW7A 1UI5A 2RHAA 2Q24A 5HODA 1AKHA 2QKOA 5JLWA 3BG3A 5CW8A 2EZHA 3VVXA 1ZR2A 3BR6A 2K9NA 1UG2A 3MKLA 5EZGA 3HDDA 3HKZN 5E3NA 1F43A 1JUSA 1Z77A 4BY7J 2L7MP 2R5YB 3CWRA 3VOXA 2L0KA 2M0CA 1BJZA 3NPIA 4S0HB 3NAUA 3IH3A 3BQYA 2K9SA 3ON2A 2ID6A 1QVTA 2XB5A 1VI0A 2AHQA 5F04A 4A3EJ 5IOZA 3KKCA 3OIOA 2XSDC 1I6HJ 4PXIA 2XPVA 3BR1A 3VW0A 2UXHA 5FKLA 2ZCNA 3ANGA 4NN1A 1GVDA 3A03A 5IPAA 5K7ZA 4MK6A 3DCFA 2XB0X 3PASA 2GENA 2O7TA 3JSJA 4KWAA 3G1OA 4A69C 5DAJA 3RH2A 3JRCA 4XICA 3Q0VA 4M3BA 1ZTRA 3C2BA 3O8HA 4DYCA 4B3AA 2DA1A 1T56A 2D6YA 5FMPA 2HYJA 3VOKA 4V2FA 1FEXA 2FBQA 4W1UA 1MSEC 2QCOA 3H3VK 3TEDA 3T6NA 4GFLA 1MH3A 1B8IA 5BNGA 2OPTA 5FLMJ 3V78A 1ZR4A 1HF0A 3ZQIA 2LLKA 4I76A 5F1JA 3CDLA 2NX4A 3EUPA 1BL0A 5C3EJ 2HQ5A 4D5FA 1U9OA 1RKWA 2YS9A 1ZK8A 4ICHA 5J1YA 2NOGA 5E3MA 3MNLA 1MBKA 2LD5A 3CJDA 5H9TA 2NVYJ 4JNNA 2WGBA 1Y1WJ 2DG7A 4QTRA 2QF7A 4ME9A 1B8IB 1MNMC 2KT0A 3ZQFA 2EZIA 2HXIA 5FLVA 3S2DJ 3NNRA 2ECBA 1D5YA 2Y31A 5EGOA 1GT0C 4C3IJ 5EEAA 5FKNA 1ETXA 2G3BA 2JA6J 2XGDA 2ZCXA 2ZOZA 1BW6A 1JJ8C 1I50J 4XIDA 2I10A 3LNQA 2NS7A 4BBRJ 5DS9A 1W0UA 4CYCA 3E7LA 5EF6A 3LSGA 3S14J 3JRGA 4DZPA 3TP3A 3O60A 2HOAA 2R93J 4FTHA 2VPRA 2FQ4A 2NVQJ 3NXCA 1WCMJ 3MN2A 1FIPA 5EGOB 2XPWA 4MLOA 4QSHA 1TWGJ 1MBJA 2HKUA 5HBUA 4CYCB 1SGMA 4YZEA 4A3LJ 1RETA 3BG9A 3LJLA 3ZQHA 1K61A 3DPJA 4C2MJ 5GP9A 5FKMA 4D7NA 1ETVA 2XPUA 1XG1A 2DA4A 4C3HJ 1UMQA 4MO7A 1GV2A 4UUSA 3ZOBA 2CJJA 5FKKA 1IG7A 4GCKA 1QRYA 1H89C 3VVZA 3CCYA 1TWFJ 2LFBA 1ETOA 2EBIA 3GEUA 4A3FJ 2NVXJ 4IHXA 2O8KA 2Y9YA 3ON4A 3ANPA 3VVYA 3FK7A 3CRJA 2JK3A 2ECCA 1IC8A 2HOSA 3WHBA 1P7JA 2NP5A 2VKEA 3OSFA 5D1RA 1LFUP 3B6CA 4IEJA 2MGQA 1JJ6C 4XRSA 4UUSB 5D18A 1W0TA 2V57A 2XGCA 4ABZA 1OCTC 1JGGA 2ELKA 2TRTA 4GFKA 3C07A 1H8AC 2DA2A 3Q3SA 2DG8A 3S1NJ 2YUSA 2HXOA 3WHCA 5C44J 2AO9A 3HOXJ 2DA6A 1AKHB 3MVPA 2CUEA 3NI7A 1FTTA 2HYTA 2L7ZA 3I4MJ 3BTJA 1ETWA 4LOCA 3LWJA 1OJLA 4A93J 1HOMA 2WB1N 2W53A 3QQAA 3BTIA 2PZ9A 1NK3P 2Y0SN 4HNVA 5M3FJ 1PUFA 4XRMA 2ZCMA 3JREA 4A3GJ 3IUVA 3NRGA 1UI6A 5HAWA 4IHWA 1XS9A 2L7FP 2QOPA 2L9RA 3NARA 1F36A 1FIAA 3SDGA 1ZKGA 4L5EA 4RBOA 5AQCA 2HOTA 1ETYA 3QKXA 1JKOC 1QVUA 3BTCA 5EG0A 3LSPA 3BHQA 1JT0A 1GUUA 4Y52J 5E3OA 5M5XJ 1PUFB 1YRNA 4JYKA 5M5YJ 3GTQJ 1B72A 5IYCJ 1H88C 2QTQA 4XK4A 3SFIA 4MIMA 3VIBA 5CXIA 2PMZN
chains in the Genus database with same CATH superfamily
4MTEA 4BHCA 3EUAA 4B8XA 1D0ZA 1Y8QB 4XRFA 1WI9A 1Z3XA 3PNVA 3CP2A 1XD7A 3K1NA 2PFBA 2M2EA 2QQBA 3S93A 5EG0B 2V6CA 4G6QA 5TGTA 2DTZA 3SZPA 3W2WA 3O3KA 2XAGA 2DN0A 2X48A 1K83J 2Y9ZA 3PQJA 1YRNB 1J2XA 4FCYA 3E6BA 2ADUA 2PJPA 5L3GA 1Z0XA 3HC7A 4NELA 2HKOA 2CQQA 4IZZA 2DOFA 2JT1A 1SEUA 1GHCA 2F2EA 5D4SA 1SFKA 4XNFA 2FD5A 4MEYF 4Z2YA 2QBYB 3LSJA 2ZJPF 1YI2I 2WAQN 4GYGA 4MTDA 5C4YA 4Y15A 2JVHA 1A04A 2FMLA 5E17F 4F7ZA 5DD8A 3PO3J 3IKTA 1IF1A 2X1EA 5B5EC 1DPRA 3BPVA 4E7SA 1UHSA 2FNPA 4L9JA 2VT2A 1ETQA 2G0EA 5F1RA 2L5QA 1KQ8A 3SQNA 1Y0UA 3HEFA 2GUHA 3AQSA 3SJMA 3M8JA 3C3WA 3S8PA 3VYRB 1U0JA 2X6YA 1K79A 4LK1F 3HGGA 3MAJA 3QOEA 3BR0A 3S1QJ 3V6GA 3HOTA 2L4MA 4Y33A 1N77A 2FSWA 3VYTB 4ZTFA 2W00A 4P9UA 3HM5A 2LOOA 5FD6A 3DLLF 5AONA 2W7NA 4CO8A 1FJLA 4NUBA 4ESBA 4AD9A 3LSTA 3BCBA 5D5WB 5FJ8J 1MH4A 4CCMA 4EMSA 3HTHA 2XUBA 3ZQCA 1Z6RA 1IRGA 3E6MA 1WJDA 2EZKA 1E0EA 1SVMA 1R71A 4KN7X 2OCCH 1R6RA 1OFCX 2DI3A 3QAHA 3SZTA 3QYFA 1V5EA 2DQLA 2EIJH 1Y8RB 3S1MJ 3ZR8X 4OOIA 3HL2A 3KE2A 4RDUA 5J40A 2AQEA 2KZVA 2M9HA 4CXFA 4HA8A 1B9MA 1X1CA 3QWLA 4YG2F 5CVIA 1KU7A 4XKWA 3GTLJ 1R4NB 2HVSA 4U0WA 3F8MA 3QYBA 4GFBA 3RSNA 2IA0A 5D5VB 5HLHA 2Y2ZA 2W85A 3IV5A 3PO2J 3CF2A 2FJ1A 3FXQA 4OMZA 2E1CA 1T8IA 1HDDC 4PJNA 2LRDA 4XRSG 2M4GA 4WXCA 2P5LC 1MJBA 5HLTA 4ZYDA 1BR1A 3A01A 2D5VA 4B09A 3BNIA 2LKXA 3BR5A 1IV8A 2QIBA 3ZMSA 3K4NA 4DNCA 5C4XJ 1BOBA 4ZZDA 5CXGA 3BR2A 4II3A 4BQAA 1D8JA 3OS1A 1J09A 3CCUI 4XLHA 2KIMA 2LNBA 2HPIA 2X1DA 2OI8A 1ON2A 1NK2P 3VW1A 2J5PA 3MEXA 2B0LA 2D1VA 1ZQ3P 1FNNA 1IN6A 3RKYA 2VONA 1U5TB 3V8LA 2VIXA 4OD4A 1OKRA 4KT6A 4JX4A 3KEYA 4UB8C 4ZYEA 2E2JJ 2Z3YA 2VPLA 5TJJA 1P2FA 2EFPA 5GPCA 4HQMA 2NYXA 2HDWA 4AIJA 1BR4A 2IS1A 1TWAJ 2Z9OA 1TWHJ 4EGYA 2CUFA 4WXDA 4UVAA 2OERA 1SFUA 2DW4A 2ZNZA 4PUSA 1YYVA 2KIFA 3VP5A 3I4PA 2HWVA 3P9IA 3RPUD 1JKPC 1QZYA 4Y3OA 5J3LA 5IYBJ 1HSJA 2FA5A 2ZB9A 2H1KA 3FISA 1YOVB 2F5CA 3ZP5A 2HU9A 2QA4I 2O7OA 2Y0SA 2IGNA 1T0FA 3VOEA 3HB9A 4F55A 2XROA 3LAJA 4M9SA 3IWZA 1ZGWA 2LKPA 4D0PA 1MBEA 2HKXA 3F8NA 5GAEJ 2Y48A 4ACIA 3TQNA 4DZJA 5K7HA 2G7GA 3FXMA 2JSPA 3IL2A 1RR7A 2ISYA 3NWSA 4C2TA 4CDGA 4PZJA 2DMNA 3GFJA 1X2MA 1F4KA 3F8CA 2PI0A 2VKDA 1OYIA 1SVOA 3MZ8A 4G7ZF 3WODF 4U9LA 2K9QA 2RAEA 1D3YA 3BP8A 2UWMA 3HTAA 5DDGA 2MA3A 2ZJRF 4XSZF 4EM2A 4A3DJ 3S5RA 1ZLKA 5IP6A 1IXRC 4DW6A 3L9FA 1UHMA 2ZC2A 3HOZJ 2VE9A 1JHHA 1R1VA 3KLNA 4O6JA 2CWEA 1AA7A 2A6TA 2OQGA 2VQGA 3SHFA 4M6VA 1ZLJA 4DQ2A 1BA5A 5EDNA 3UR3C 1XC5A 1FY7A 1ORKA 2DFHA 5E79C 1MD0A 2E5NA 2F5FA 4XLEA 2A07F 2DFEA 5CYVA 2JA7J 1FLIA 3I59A 1APLC 3ZMTA 2W57A 1L0OC 4PJLA 1WZ2A 3RIRA 5F6FA 1W7PA 4YELA 1RNLA 2VB6A 1R23A 2QKOA 3BG3A 4HX7A 1P4AA 2MD0A 3PIPF 3HRUA 4LLGF 1UG2A 5JVTA 3MKLA 3FHNA 4I02A 4CCJA 2MLGA 3BJ6A 1F43A 1OCZH 3V42A 1ONVA 4OIOF 2L7MP 3CWRA 1FP2A 3DPUA 3CCVI 2XF7A 4HX8A 1G4DA 2V1DA 4GXOA 3FBIB 4HV5A 3NAUA 3VWBA 5H6QA 3BQYA 1T38A 4A3EJ 2XB5A 4XKCA 2L2OA 4XKVA 1LDDA 5IOZA 2BHYA 3KKCA 2XSDC 1E3HA 2W25A 4HRIA 3FM3A 1P4WA 1SVLA 2KFDA 3BR1A 3VW0A 4UVBA 2V7FA 2R7VA 3CC4I 1CF7B 5K7ZA 3L2QA 5IPAA 4MK6A 4NN1A 1R00A 3DCFA 2XB0X 5D6EA 3FBNB 4P1WA 2P4WA 2VBYA 4XICA 3KYCB 4L9NA 3F9KA 4A0ZA 3ABUA 2R7UA 1X1DA 1XCBA 3C2BA 3ECHA 2R7QA 2BE5F 1IN4A 1T56A 2D6YA 4XM3A 4L5IA 4ASNA 3K8PC 5FMPA 2UXNA 2CUJA 2G7HA 2M4KA 2FBKA 4PJ0C 1ACIA 4EATA 4IL6C 2G9WA 1D1AA 1R7JA 3V78A 1BI3A 2BW3B 1ZR4A 5D5XB 4HX4A 2LLKA 2P5KA 3CCLI 1T2KA 4IRVA 4L9TA 2GOXB 4NC8A 3J7YJ 3MWMA 2IT0A 4CCNA 1IN7A 1OR7C 3V7CA 2PMHA 2KDOA 5ED4A 4OIPF 2YS9A 1YTYA 5GAHJ 2XSJC 3FHZA 4ICHA 5J6XA 3K2ZA 5E3MA 4NNJA 2PN6A 3RI4A 1E17A 3CJDA 1BJAA 3ISPA 4UVCA 4RAZA 1DQUA 1S6LA 2WGBA 4QTRA 1SC7A 2R7DA 4HAMA 3J7AO 2CG4A 2GWRA 2MC3A 4Q48A 2FEZA 2D1HA 2XRNA 2ZJ2A 3GXOA 3K1PA 3S3OA 3AKZA 4O5VA 4EM0B 5ILUA 1GT0C 1TNTA 3HRMA 3M1CA 2ZCXA 1FBQA 1QZEA 3CCRI 3F6VA 1SD6A 4XIDA 3CUQB 2BXZA 4DVYP 3KP3A 2F48A 1TQIA 3LSGA 2LBFB 1PP7U 3S14J 3AG4H 4DZPA 4M6XA 1NH3A 1BM9A 5E1WA 2VPRA 4L9VA 1XGMA 4B48A 2DODA 1FIPA 1J0RA 2HGCA 2L9NA 4BHBA 3GZ6A 1H9GA 3OYNA 2KIQA 4XORA 4M9ZA 2HKUA 5HBUA 1B6AA 2PX9A 3W6KB 4EJWA 2E7WA 4UNOA 2R7SA 1SGMA 4YZEA 1XMXA 3LJLA 3ZQHA 1FBUA 2ZMEA 3HG9A 4J00A 3HOSA 2M3AA 2DA4A 3TGNA 1UAAA 4F92B 3WTZA 3RYPA 3ABMH 1XSVA 1AOYA 1G3TA 1BR2A 4DOZA 2DDBA 4EM1A 5ILVA 5FKKA 4GCKA 1H89C 1VQ8I 3C7JA 3IP4B 5J8CA 3WG9A 3WU0A 3HXLA 3OYDA 2V26A 1LDKB 3L2VA 3M8FA 3NWTA 4RB3C 2NVXJ 2CQNA 3ON4A 4C2MA 1QGPA 5ICEA 3CRJA 1DGRM 1LEAA 3DKXA 2ECCA 1IC8A 3WHBA 3GX4X 2NP5A 3EUHC 3OSFA 3ERED 2VN2A 4IPAA 4IX7A 2MGQA 2MABA 4XRSA 1O7FA 3GZ5A 3KX2A 4HSRA 4M74A 2NRAC 3WHCA 5C44J 4YIRX 3H5RA 2AO9A 2DYRH 3H5NA 5CVJA 3VDXA 2DA6A 3HOXJ 2FMYA 4E7HA 1O3SA 1G8XA 4OU0A 2E36A 1FTTA 5CPRB 2HYTA 2FQ3A 4V19K 4XLPF 5FLXK 3ZXSA 4EGZA 1TP4A 3GUDA 3BTIA 3H92A 2Y0SN 5M3FJ 1R1UA 2ZFWA 4HDUA 1L3LA 1FC3A 1EJ9A 3JREA 2O6GE 2EB7A 3E5UA 5LEJA 3IUVA 1J75A 5HAWA 1KGSA 1FYMA 5GAGJ 3LL7A 1F36A 1FIAA 4FQGA 1ZKGA 3KIOA 4F52A 3FXRA 3JTHA 4N4NB 4I7HA 2PJRB 2VOOA 4UXNA 1WHUA 5E3OA 2I5UA 3ONQA 5M5YJ 2OTJI 4IOCF 1SD5A 4NQWB 5FROA 5IYCJ 1H88C 3T8RA 1DUXC 4P96A 2HNHA 3VIBA 3LA2A 4CZCA 5CXIA 2RNGA 2K4JA 2LF7A 1V4RA 3MMYB 4G7HF 5D6FA 2XC7A 2LP0A 3ABKH 2ISZA 4MGRA 1CQTA 4B4CA 1HLVA 2VBWA 3OOUA 1VQ5I 1I3AA 3HPGA 1BIBA 2R3SA 3LSRA 3LA3A 3R4KA 3OYFA 2N8GA 4RA2A 2STWA 2CU7A 3L2UA 3QPSA 1MBGA 4BDZA 2TCTA 3L2RA 5FHPA 2DK8A 4FASD 1S3JA 3C18A 4WX9A 3GTJJ 2XKOA 2DPUA 1P7IA 2ZOYA 4MFDA 4CYDA 2JUGA 1DDNA 2EV6A 4Y7NJ 3X2QH 2A6EF 4AF5A 3K1MA 2G7LA 4OAZA 5KHDA 3W2VA 2HQAA 3GLXA 4M3FA 3HTSB 1ERDA 2RC4A 3FMSA 3JRBA 5EZHA 3GTOJ 2KRFA 3M3YJ 3M8EA 4U9NA 4XLNF 3BPXA 2LVSA 4A5MA 3JW4A 2K3FA 4L62A 1OCPA 1ZRFA 3GEZA 5B3SH 2JPCA 4ZDLA 2OCEA 1JUPA 2UXXA 3TDZC 4ESJA 2O3FA 3W2AA 3M4OJ 3D1NI 4KJZA 4BEHB 4DYRA 5KCMA 1N78A 3E6CC 2WY7Q 4KFCA 1Y1VJ 1O3TA 2M7BA 1WH7A 4XKBA 1R5HA 4A6EA 2H09A 4D7MA 2RN7A 4ZYHA 2HI3A 4BGDA 2CW7A 4B1RA 2MD5A 1WFXA 1LE8A 3S3NA 3KYDB 1T39A 2M45A 3DWLE 3CF5F 1GV5A 3HE0A 3JRIA 2X1CA 2X85A 1IRZA 5D8KB 2DBBA 1W5CC 2LSOA 2XAHA 4KIFA 4WXHA 1FT9A 4XONA 3TDUC 4P5OA 1KU9A 1J9IA 3BT9A 4UUTA 2WWYA 3HGYA 5F0CA 3KZZA 4PSWA 4I6ZA 2L3DA 1YW9A 2LY1A 4X0GA 2X6XA 1VQOI 3S1RJ 1V54H 2J5OA 1R9TJ 5L3BA 5FGLA 2H6BA 1VQPI 3F0CA 3H9JA 3IAM2 1UB9A 5ICFA 2R5ZA 4NDLA 2HQNA 3GZNB 1EA3A 2EZLA 3T5XA 4DIQA 3BQZA 2FX0A 1D5VA 5L3EA 1ZARA 5HDGA 4BQQA 3PNTA 4AIKA 3GTPJ 1LJ9A 2RNJA 3E0JB 1FSEA 4BE2A 4GCTA 4RB2C 3U1DA 4ENKA 3LSMA 3OWTA 2JZYA 3MZHA 1U9NA 1UCRA 1CF7A 4BHPA 1BI0A 2K9LA 3F1BA 1WKMA 2MFZA 2XGXA 3I53A 2W82A 5F0HA 1X58A 2R7FA 3WE2A 1JTYA 4C2UA 2QKMB 5JLXA 1ZRCA 1R49A 2DMPA 4NHJA 3IH4A 4U0VA 2XDNA 2EA4A 2DYSH 2VQLA 2O5RA 2FF4A 2Y0MA 3SEZA 5HDKA 3I58A 1MBHA 2VJIA 5F08A 4BU2A 3CQZJ 3UKGA 4A3CJ 2JMWA 3KETA 3LMMA 2HDCA 1X19A 1WGXA 5JVGF 3E6DA 1VQ6I 4HW0A 4KICA 5A2QK 2QSGX 2CV2A 5D19A 3PSFA 3AL0C 2UXPA 3VW2A 1WI3A 2DAOA 2ZXJA 1IXCA 3G1MA 1UELB 3N05A 3JRFA 4P55A 3CMYA 2YU9J 1BI2A 3MD2A 2L01A 4BE1A 4BUPA 1USTA 3COLA 4KNYA 3CO7C 3BY6A 3DV8A 4XQFA 3D5SC 1MBFA 3SDBA 1TT0A 2FU4A 1IN8A 1D0XA 2JJ7A 2DA3A 3U21A 1O3QA 3TKYA 1OMIA 2IS4A 2PBXA 1SANA 4JX6A 1IDZA 2R4GA 1F1ZA 1E3OC 2XGEA 3DEEA 3CUQA 1FTZA 4M3GA 2ZXWH 2ETHA 2XAUA 3B6AA 2LBFA 2LTPA 4I01A 3WG7H 2F07A 1QPIA 3QBMA 3FK6A 1YLFA 2XVCA 3HOUJ 4XLCA 1VF9A 2IAIA 4UUVA 3HTJA 1GVJA 3P9TA 5B1AH 1PP8F 2HPMA 2OBPA 5LHGA 1XGSA 4RB0A 2EQRA 1U78A 1AHDP 2CW0F 5J47A 1VZ0A 1MW7A 4IO9F 1GLNA 3BG5A 2CGPA 5D8LB 2WC2A 1JUMA 2V1NA 5DUIA 3B02A 1WSUA 3S16J 3C2HA 5BS6A 3FMRA 4LITA 2VUMJ 2P7VB 3JR9A 4FX0A 4LB6B 5M5WJ 2XAFA 4A3MJ 1A6IA 1S9HA 2Q8KA 2O9LA 1OYYA 4FT8A 2R7XA 2PMZA 4KYWA 2BEOA 2QKLB 3NEUA 1FX7A 3O2PE 1VQ4I 2B9SA 5J4VA 5K58A 4AC6A 1IN5A 1MDMB 1MSFC 2HDDA 5IP9J 3RYRA 3CP8A 2GLOA 9ANTA 3MKZA 1F5TA 2GFNA 2BY2A 2LY9A 3EYYA 3L1PA 2BXYA 3DBHB 3OYEA 4C3JJ 1MMAA 4AYBA 2QSFX 2ZXIA 2ZY9A 3CJNA 2BBYA 2VE8A 3F21A 2BYVE 1UI5A 3H3UA 3C2GA 5DCMB 3DP7A 1JGSA 4RM3A 3CLQA 2EZHA 1T98A 3VVXA 4LLNA 2KP6A 4ZTJA 1BOAA 2B7EA 3HDDA 1ZH5A 4CCKA 2L9SA 3CC7I 2B3WA 1JUSA 1Z77A 2R5YB 1HW1A 1Z7UA 2F4IA 2CSOA 4ENJA 4XN3A 2BV6A 3NPIA 1ZG3A 4G94A 2E34A 3I71A 4IKFA 1RIOH 3IH3A 3RQ4A 1S5LC 1YO5C 3OIOA 2ESNA 4II2A 3ELKA 2M0MA 4JQFA 2LF8A 2XPVA 1RI7A 3JSOA 5LBQA 1GVDA 4F91B 2L7KA 5FFXA 1SAXA 3HSFA 2CYYA 2MH2A 5HLIA 4XBFA 2O7TA 4RAGA 4KWAA 1SMTA 3VEPA 4A69C 4AWXB 4M3BA 2X0LA 3J80K 1MKMA 2DA1A 2M87A 5LEKA 2QQ9A 3PFIA 2HYJA 3VOKA 2EPFA 4V2FA 4QLCU 4W1UA 2ICWG 2PBIA 5HNFA 3TEDA 3GYHX 3L7WA 1T6SA 3OYJA 1MH3A 1Z67A 5FLMJ 6PAXA 1I39A 1HF0A 4I76A 2HEOA 2M5WA 3ZCOA 3CDLA 2BY0A 4PCQA 5TISC 4BE0A 1BL0A 5CQEA 4LG0A 4D5FA 4KA4A 1U9OA 4E7JA 4NBQA 4RGXA 3KEQA 2FE3A 4B47A 5GTIC 3AL0B 3WTSC 1K4SA 3I0TA 4LK0F 1Z05A 5JI6A 3MNLA 3WGHA 2V9VA 2WTEA 2NVYJ 3DQVC 4JNNA 2OJED 1QQIA 2PEXA 1B8IB 1O3RA 1I1GA 4BJ6C 2EZIA 3EYIA 2KPMA 1T95A 5ICCA 2A3SA 2P8TA 4NC6A 3D5RC 1XSDA 3HRSA 2Y31A 5EGOA 2G3BA 2DOAA 1ETXA 5FKNA 2IGOA 1USSA 4UY8I 2Q2EB 3CD6I 2R7WA 1X4OA 4EQQA 4YFKF 1IW7F 1YW8A 2V9KA 3CJQB 2BOLA 2PQ8A 5JFRA 3LNQA 4RB1A 4BEHA 3VSLA 4CYCA 3TOAA 1QHGA 4UV9A 2NS0A 5JHFA 2YR2A 3K4BA 3TP3A 1QZZA 2CQKA 2QENA 2FOKA 3I54A 2VKHA 3NXCA 1NHAA 3T1BA 2PFVA 3MN2A 4M72A 2GAUA 4MLOA 2ZXHA 5E1XA 4QSHA 2V1UA 5CQGA 1D1BA 3MQ0A 3CCJI 4BAYA 3BLYA 3BG9A 3ZPLA 2W24A 1RUOA 3RJPA 5GP9A 1ETVA 3QRFF 1TT5B 3K4LA 4Q4ZF 4KITB 4BDYA 2O61A 1HKQA 2LY2A 4LLLA 3EQLF 3PSIA 3RTRA 3DBRB 1YW7A 4CHUA 3ZRGA 4KDPA 4ITVA 4CZZA 1TWFJ 4CGZA 1QPMA 3PFYA 3ZMDA 1MMNA 1WJFA 2EFQA 5CVVA 3COAC 4A3FJ 2Y9YA 2O8KA 1B1BA 4Y13A 4GDFA 3HYIA 5HS9A 3HUGB 1G3SA 3FK7A 1OCCH 4PGHA 3GVAA 2HOSA 4L18B 3RKXA 2ZJQF 2DO7A 1FOYA 5CVUA 3LSKA 2HVQA 1LFUP 5D1RA 4IEJA 5D18A 2IP2A 2P6SA 4UUSB 2XGCA 1VTNC 2ELKA 2TRTA 1MJ9A 3C07A 1H8AC 3K4CA 3Q3SA 1QNTA 2DG8A 2YUSA 2HXOA 3VFZA 2HQRA 2K9MA 3QPHA 1K78A 3GFIA 1R58A 2M7AA 1P92A 4LOCA 5CLSA 1OJLA 3L2CA 3QQAA 2WADA 2PZ9A 2IRFG 2CMPA 1PUFA 4XRMA 3E97A 3LQRA 3R0AA 3CCQI 4A3GJ 5H6RA 1UI6A 5D4RA 5FD5A 3CMAI 5AIPA 1J5YA 1LPQA 2L7FP 2QOPA 1D0YA 3NARA 3SDGA 2O03A 3OS2A 1IRXA 1ZGJA 3QKXA 1JKOC 5EG0A 4A0YA 2KJBA 2OU2A 4OIQF 1HW2A 1ODDA 2GQQA 4BL0B 1YRNA 2K86A 4B3XA 3M1EA 4N0BA 4YEJA 4MIMA 1O57A 2W4SA 1W5SA 5BOXA 2PMZN 1OYWA 4FETA 3ULQB 2VOPA 1RPWA 2DJNA 3DU6A 2JUCA 2GIZA 3HOYJ 3OYLA 2QBYA 1MNDA 4IVNA 3E5QA 1YJ9I 3WTVC 5H2FC 2AS5F 1EH7A 3PUFA 4G6DA 3HKZA 1JTXA 4JP0A 1YITI 2E2HJ 3PPBA 3TW6A 4M73A 2K85A 3GTKJ 2EILH 1HQCA 3IHUA 2XIGA 1KU2A 2OF7A 3BTLA 4TV7A 5K7FA 5K5OA 5J1RA 1B72B 4IQJA 4AYBN 3JRAA 3KKDA 2ELHA 4FE7A 3IC7A 5FFZA 4B43A 2TDXA 4HLXA 5HS7A 2KRCA 1VQLI 2JA2A 3GO5A 2Y30A 4N4OB 4KIGA 1EH6A 2E5ZA 2E2IJ 3CCEI 3MCZA 1I3QJ 2WB1A 4Y17A 3BOQA 1FOWA 1OQYA 3OV8A 4KMUX 1BC8C 3L00A 4FE4A 1KONA 2ZCWA 1WJCA 4ESFA 1T0FC 3ZQLA 5ILSA 3GTMJ 3G3ZA 2XASA 2CRGA 2A69F 1TC3C 3GCMA 4LMYA 5HVQC 2VASA 3H5AA 4WK8F 1VFCA 3JAMK 2IS6A 2HR3A 2KJCA 3ECOA 5TRDA 1MMSA 1IV6A 1ZGAA 2OA4A 2PG4A 2GIVA 1YHQI 3RPQA 3J81K 3W6VA 4HF0A 3GZIA 1LFBA 3BRUA 3F22A 3TO7A 2K3PA 2LREA 4M9XA 4DBQA 2JA8J 4YFNF 1JXSA 4IRHA 2RQQA 1ZG5A 4HNTA 2DA5A 2WAFA 2RDPA 4YRVA 3JRHA 1IGNA 3BZ6A 4R1HA 4HG2A 1G6NA 2GA2A 3SEQA 3Q0WA 2OC6A 1GDTA 4QPOA 1YQAA 3QPLA 2NAZA 4R8HA 1HW5A 1DGWY 2X9DA 1ENHA 1ZG1A 1TWCJ 1ULYA 3SFZA 3ZQGA 4N9HA 3RPUA 5IYDJ 2ID3A 4BJTA 4L0ZB 4PDKA 2VODA 1BIAA 1ZN2A 2WAEA 2C6YA 4XSXF 2JVGA 3K2AA 3ZMUA 3K6GA 4J19A 3Q5FA 2HOEA 2E19A 3G2BA 3H9QA 1ITYA 2A2FX 2F5EA 2IBDA 2VBXA 5LGNA 3WTUC 1MIJA 2CV1A 3P5JA 5KVRA 3K7AJ 4A2UA 3ROUA 5L3CA 3LOCA 2QEXI 5L3FA 1ZHFA 1KYWA 2DK5A 3GFLA 3DBLB 2BGCA 4JKZA 2K4BA 5K1YA 3BG6A 4CH7A 3J7ZI 2DA7A 3V8KA 4U0YA 3W3CA 2GZWA 1U5TA 2M30A 2DMQA 3A1YA 4C30A 3ASOH 1VNDA 2PMUA 5FRNA 2W1OA 3LHQA 1LKXA 2OD5A 2XKPA 2A61A 1C0WA 1H9TA 5AIQA 2DMUA 3MZYA 3CCMI 1ZREA 1YX3A 3CC2I 3TP0A 5HSZA 3SXYA 4M6YA 4R79A 3TO9A 4BXUA 1GXPA 1NTCA 2F4MB 1FMWA 1JKQC 1XTAA 4Q5SF 3HIMA 4QIWN 4E7KA 3I56I 2WV1A 3A01B 4I2OA 1XSXA 4ZH4F 3H9GA 1ETKA 2ZSHB 4XLFA 3S2WA 1SFXA 5IP7J 3HBLA 3WTWC 2REKA 5JR3A 1TBXA 1I5ZA 1MJAA 1A5JA 3BCAA 2MSYA 3P9KA 2K7LA 1UFMA 3OYIA 2KRHA 3KP5A 3NQOA 3S2HJ 1OCOH 2CS3A 4YFXF 2X4HA 2LH9A 3ML6A 1Z91A 3GBGA 3MKWB 4Y4RA 1FYKA 3Q9SA 2GBYA 3HOWJ 1U6GA 3AQTA 2XRLA 3S17J 4MQVA 4ZDOA 4E4HA 4ZZLA 3DTIA 1U3EM 3VSKA 1WRJA 3HOVJ 2IGMA 3CMEI 2DOEA 5B66C 2A5WA 3RZOJ 3I9V2 1E2XA 3HIFA 2VJ5A 4HEA2 1KZHA 5KK1A 1P9QC 5E3LA 3IWFA 2BVLA 2H94A 2UXIA 2R92J 4DGWB 1MZBA 4MHGA 3IH2A 4UV8A 5GPAA 2V6EA 1R5ID 3A0BC 4CCOA 2ESHA 3BDDA 3GF2A 2HYGD 4EJOA 4G7OF 2IU5A 1RZ4A 5LRRA 3HHHA 1Z7LA 2KL4A 3U1KA 4G12A 3FXOA 2V79A 5E20A 2LMDA 1DU0A 4UHTA 4ANJA 3DKWA 1FPQA 4EJUA 3H1CA 3ZN0A 3HJEA 3E7QA 3BR3A 5EYRA 2VLAA 3OYHA 2JTVA 5DEQA 1FSHA 3R0JA 4MQ9F 5FKOA 3H0GJ 1R22A 2IEKA 2JRTA 2P81A 4ZJZA 5F0FA 4KT5C 2A05A 2W48A 2LYCA 3OYCA 3JCUC 4L5JA 2RGVA 3FXKA 5KAIC 3HTIA 3I3LA 5FLXZ 1V5FA 2V4JC 3RKQA 1K4TA 5CKTA 3GMEA 5J4YA 4HV6A 2MH9A 1VQNI 4HF1A 2DJIA 3HUGA 2ZMEC 1PJRA 3I5UA 4U7DA 3G1LA 1Y0NA 3G73A 3WE3A 5ICGA 2MW8A 1IJWC 3FRQA 1YJWI 3BJBA 2G7SA 5IT9K 1M1EB 1HKSA 3FX3A 3S15J 4UB6C 1J59A 2RHAA 3FM5A 4C9YA 5JLWA 4HLYA 1S7AA 1LQ1A 1Z3YA 2K9NA 3FZVA 3U2RA 3BJAA 3HKZN 5E3NA 1TW2A 1SMYF 3R60A 4BY7J 1G59A 5J8FA 2VQHA 2H8WA 3FKJA 3PNYA 3VOXA 1H0MA 3I59B 5F64A 4IHSA 1XGNA 3L09A 2KIUA 1GXQA 2K9SA 4G6TB 1W7PB 2LC2A 2ID6A 1QVTA 4U87A 4HOBA 5F04A 3OYMA 1I1SA 1NG7A 2FXAA 5DUKA 1MNEA 1FOKA 2EV0A 3KP7A 4RAYA 1I6HJ 2IXSA 2RV8A 1R36A 3EETA 4I09A 4ZYAA 4OD5A 4PXIA 5FKLA 2ZCNA 4XLAA 1WJBA 4IQ4A 4PGGA 2KMUA 3A03A 2E1NA 3UNGC 4WWCA 1KA8A 2FBIA 2ZNYA 2BW3A 2DFFA 2QQAA 1NG6A 2MC4A 2GENA 2Y75A 3G1OA 1IRFA 2KQRA 1ZTRA 4S04A 1R1TA 3O8HA 4DYCA 1LVKA 5BQTA 3OL3A 1FEXA 2FBQA 5ERIA 3TBIA 1PVEA 2QCOA 1VQ9I 3RCOA 1K6YA 3VODA 4GFLA 5BNGA 3JSPA 1X1PA 3D0SA 4HSTA 4IJAA 2XDVA 2FNAA 3F8FA 2ZKZA 3ZQIA 1XDSA 5F1JA 2NX4A 3IRQA 3EUPA 5DM7F 5EEGA 4ZYGA 1FOXA 5C3EJ 2DXIA 3J7AY 1TNSA 5DD4A 3SYTA 2KLOA 2QWWA 5H9TA 1N25A 4KUMA 1JHFA 2DG7A 2H1LA 4ME9A 2VQCA 3KZYA 3ZQFA 1W7PD 1HC8A 4IRGA 1LFPA 2HXIA 4ON0A 3S2DJ 4AM3A 1WVRA 3ABLH 3AG2H 3NNRA 3AG1H 1JI8A 4H0EA 3REOA 4C3IJ 1I27A 3FXJA 2Z1DA 2XGDA 2ZOZA 1BW6A 3WU2C 3CJRB 1Z1DA 2NS7A 2P5VA 4BBRJ 5DS9A 3E7LA 5EF6A 3EUKL 1ZAOA 3JRGA 4OIRF 1W36C 1DP7P 5IT9Z 4RAFA 2FUG2 4Q47A 2STTA 2FQ4A 2QZ8A 5HDNA 2NVQJ 1X1BA 4N9IA 2D2WA 4AIHA 1LEBA 2HTJA 1YFHA 1MBJA 3N97A 5FO5A 2R7OA 1EV7A 1IXSB 2DFIA 1RETA 4OWRB 5GADJ 3WTTC 4LB5A 4A3LJ 1K61A 5EEHA 4ENMA 3DPJA 2E1MC 2XPUA 1BI1A 1XG1A 4FHTA 2EIKH 4C3HJ 3MFKA 2A6HF 2ACJA 4FX4A 4MO7A 4L0YB 1GV2A 2CV0A 3ZOBA 2HFHA 1QRYA 4NB5A 2JSCA 2EFOA 3VYUB 1QU3A 2RREA 3OYKA 4ZDPA 2EBIA 5BPIA 4IHXA 2IJLA 2QVOA 3ANPA 3KP6A 3VVYA 2ZMEB 4A6DA 2JK3A 4E7IA 2X6WA 3K69A 2HZDA 4WIBA 1RR8C 4GCVA 5DYMA 4OAYA 1P7JA 4PFOA 5A2QZ 2HYFA 1WWXA 2VKEA 1OLTA 3B6CA 1JJ6C 4I98B 2DU9A 1OCTC 4GFKA 3GFMA 2WBMA 2P6TA 1HA8A 3E3VA 5HLGA 2DA2A 4GGGA 2L02A 2DCEA 3S1NJ 2L54A 3LWFA 4LJZF 2F4OB 3QU6A 3QODA 4RGUA 2QM3A 1AKHB 3WGGA 2EFWA 2VBZA 2VXZA 3V8JA 3OOPA 5K5QA 3OYBA 1BN5A 2L7ZA 3P7NA 3K4KA 1ETWA 2PJRA 3LWJA 4A93J 2VL8A 2W53A 4RGRA 1TQMA 3BC8A 2R7TA 1HBXG 4HNVA 3DFGA 4CA0A 4QWQA 2FJI1 2ZCMA 2EIMH 3ZQQA 5KAFC 1UHWA 3L2WA 1W1WE 2YX7A 4NQWA 4KISA 3NRGA 5E1ZB 4BACA 1QBJA 3A2KA 3DTEA 1TTYA 2UUZA 3MKYB 5AQCA 1ETYA 1QVUA 1Y56A 4RLFA 1JT0A 1ZELA 4Y52J 3H35A 2F6CA 5M5XJ 1A31A 4CSWA 5IY5H 1PDNC 1YIOA 4JYKA 3HTUA 4XR6A 3GTQJ 3IUOA 2QTQA 4XK4A 3SFIA 1OR7A 4RMNA 3KYLA 1VQKI 3EGQA 3OL4A 1TLHB 1X4PA 4UDSA 5D5UB 1P4XA 1YX5A 1O4XA 4BY1J 3GWZA 2YVXA 1XGOA 2LK2A 4WF2A 3WTXC 1E3PA 4JK1X 4BJ5C 2QYOA 2W84A 1U8RA 2P7CB 1Q1VA 2K40A 1UZCA 3GW2A 5LGUA 2M8EA 4KIBA 2Q1ZB 5GTHC 1LDJA 3IKVA 5FRMA 3M7GA 4A5NA 3ZN1A 1DU6A 3CDIA 4EVIA 1S29A 4DJAA 2ME6A 4A3KJ 1PUEE 4RM2A 2AXLA 4E7LA 4S05A 3F8BA 2NXNB 2M8GX 4A3JJ 1JKRC 3CUQC 3OY9A 4ENNA 2LR8A 2Z33A 1JT6A 2E1OA 2COBA 2FOWA 1D1CA 1AU7A 1S7EA 4FISA 3K0LA 1WJEA 5E8GA 3P9CA 4BXFA 2KDZA 4LFUA 1XMKA 2WA0A 4MXMA 2YPRA 1Y39A 1HCRA 3OMYA 4AUXA 4RLQA 2OAZA 1S72I 2HS5A 3F72A 4W97A 3GTGJ 3OS0A 2O0YA 5IOYA 1UJ8A 3C1DA 3H3ZA 3LSIA 3ZMZA 2EA2A 1JE8A 3RQIA 4CCLA 3R61A 4HDVA 4GO1A 1OISA 2K02A 1U8BA 3W6JB 4AIDA 1XPXA 4DBRA 1POGA 4XL9A 3KNWA 3H0DA 2BY1A 2QLZA 4XN0A 3TMOA 5J1UA 2OTLI 2V1XA 3PM1A 4M3DA 4IHTA 2P0WA 3F6OA 4IHVA 4DYQA 3K70C 3FWEA 2R7ZJ 3KCCA 2FBHA 3R6SA 4D9JA 3B81A 4NC7A 3BROA 2NP3A 1RKTA 3BWGA 1IDYA 2E1MB 1STZA 2OZ6A 3F3XA 1SD7A 4IHYA 3CMMA 2H8RA 2IVMA 4LG3A 5F27A 3EUHA 2G7UA 2EH3A 2JN6A 5HNHA 1FP1D 3J80Z 1LE8B 2UXOA 2YVHA 3DKYA 3VUQA 2Z16A 4BYYA 3I64A 3Q0UA 3VB2A 2HZTA 1Y6IA 4BS9A 3BCGA 4QPQA 1YS7A 4OMYA 4H4KC 1FYLA 3FKIJ 2RASA 4E6KG 2JA5J 4IXAA 3ON2A 5CJ9A 2IW5A 1WJAA 2JWTA 5DTDA 1HDPA 3QP6A 4I0BA 3RZDJ 5BPDA 2Q0OA 2BY3A 1LVAA 4MFEA 2OUMA 3DPTA 1X3WB 3E1SA 2AXTC 4WCGA 4JX5A 2R5ZB 3PUBA 3BZCA 1UG0A 2RQPA 1W36D 1DPUA 2CFOA 3FIWA 2YVEA 3JRDA 2DQRA 1X2NA 3VPRA 1EF4A 4BNCA 3O8GA 2OQRA 3OIPA 1PYVA 3ESWB 2GXBA 2DDAA 2IS2A 2QUFA 3DEWA 3CDHA 3IRRA 5EJCA 3K10A 3EPZA 2HTSA 1KQ9A 3H36A 3HSRA 2WUIA 5LFAA 2Z2SB 3O6BB 2CO5A 3N4MA 2MG4A 4P9FA 4RGSA 3CESA 3A02A 2YU3A 4JBAA 1Z6TA 3QYEA 4HZFA 2QQ8A 2VT3A 3I4NJ 2VJJA 4PK4A 2NS8A 3WGIA 1RUNA 3CJTB 3LAPA 1T33A 2EINH 3DU5A 3TO6A 4B44A 3SWHA 3CO6C 1TW3A 1IUFA 3NRVA 3KLOA 4M71A 3WU1B 3KZ9A 1WH5A 3M9AA 1IZ1A 1MMGA 2YX4A 1A6QA 2NNNA 3GLLA 3AG3H 2ZFUA 4EEFG 2CW8A 2M34A 5C4JJ 1S8NA 4X6AJ 2E7XA 2KKOA 2VJ4A 3OYAA 3KEOA 4JOMA 1Q1HA 1G3WA 2MBFA 1XX5A 1VQ7I 3HZJA 2R0QC 5HOOA 1W5TA 3QU3A 2X6OA 3ASNH 4MEXF 1OPCA 4M3EA 4V2GA 4A3BJ 1OCRH 4X1EA 1BW5A 1Z9CA 1U2WA 2NVTJ 1XN7A 1IAWA 5E8IA 3A4CA 3CLOA 2KISA 1R5GA 2CUZA 4JL3A 4D5CA 1P6RA 4BBSJ 1LB2A 3PJRA 1FWZA 1WPKA 1MDMA 2DTRA 1TL8A 4YIFA 4A3IJ 3F23A 2ZSIB 2NOJB 4BXXJ 1G2HA 2ME0A 3RD3A 3G56A 1G3YA 2CQXA 2E60A 4D1QA 2LG4A 5EFYA 2GM4A 2DLLA 2H27A 2VKVA 4KMFA 2QWTA 2BZTA 4AC0A 5DM6F 1S7OA 4AVPA 2UXUA 4OINF 2DMTA 2B63J 1LNWA 1K7AA 5M3MJ 5LGTA 3ERMA 2VI6A 5DCMA 1YIJI 1IUYA 1SFOJ 4CGRA 4G9YA 1RESA 3S3MA 4BKXA 2KZGA 2E71A 3G6EI 3G7RA 4HKUA 4BH9A 4GCLA 3OSGA 1YG2A 3V7SA 2R5YA 1ON1A 1K6OA 4CUGA 3Q9VA 3TW7A 5HS8A 1YS6A 4EV0A 1A36A 2IGKA 4YIIA 3PIOF 2DT5A 5LLQA 2XHKA 3EDPA 2JRMA 3CUOA 3TOBA 2QSHX 1YJNI 4PSXA 2Q24A 5HODA 1AKHA 1YE9A 2WAQA 4E70A 2GA1A 5CW8A 3BG7A 2EK5A 1Z21A 3OR2C 1ZR2A 3BR6A 4A0XA 2EWNA 2JPBA 5EZGA 2I8DA 3DLAA 1W4MA 3FXUA 3M07A 1EH8A 1IO2A 2L0KA 2M0CA 3FF5A 1BJZA 2OV7A 4S0HB 4U7BA 4Z6YA 5IT3A 2Z5UA 1HSTA 3I55I 1VI0A 2AHQA 3FDYA 1SAUA 2COMA 2D45A 1FMVA 2CFXA 2JQ7A 3FXLA 3RDIA 3KPHA 3PL8A 1F9NA 3WTYC 2XF6A 2UXHA 3ANGA 1R4MB 2R7RA 4HF2A 2A5YB 1MMDA 5H20A 1AWCA 4RS8A 1J7KA 3PASA 3JSJA 5DAJA 3RH2A 3JRCA 2GXGA 3Q0VA 1VQMI 1ZYRF 3OR1C 3AFHA 3T8TA 1I6XA 1QA6A 2K27A 3IAS2 4B3AA 4KN4X 3V7RA 1QHHD 4HYEA 3DF8A 1MSEC 5LHIA 3H3VK 3K70D 3T6NA 3DXJF 1B8IA 2OPTA 4AVZA 1XDUA 3HRTA 3G4SI 2OZUA 1MGTA 3S32A 3JAMZ 2IA2A 4A12A 4XMYA 5LHHA 1HXDA 5B1BH 5BMZA 2HQ5A 3D5LA 1RKWA 1DP3A 2Q2EA 3A0HC 3OYGA 3RKWA 2DT7B 3CZ6A 1ZK8A 5KNLA 3J81Z 1X3UA 2EV5A 2ZBKA 5J1YA 2NOGA 4E7ZA 1MBKA 2LD5A 2GOMA 2F5VA 2E35A 1Y1WJ 1TQPA 2QF7A 3LFKA 1MNMC 2L9VA 2KT0A 4XOPA 2MLKA 5FLVA 1B9NA 3DPLC 5E18F 3K9TA 1V55H 2VC0A 2ECBA 1D5YA 2L4AA 2K5CA 2XV4S 2ZO4A 5EEAA 4LG0B 1CGPA 2JA6J 1JJ8C 1I50J 3E5XA 3LFUA 2UV1A 1KU3A 2I10A 3SZGA 4AU7A 3ABTA 1D8KA 1WJ5A 2MYSA 1X3ZB 1W0UA 5FGMA 4J01A 2DPDA 4IOAF 3LSHA 3G71I 3HPHA 5DV5A 4CICA 3O60A 3PQKA 2X51A 3HSEA 2HOAA 1QO0D 3KZIC 1SD4A 4FTHA 2R93J 5LD2C 3U9GA 1WCMJ 4IF4A 2EFNA 4LIUA 2A68F 1B59A 5EGOB 2XPWA 2QGUA 3CTAA 3OIQA 4LD5A 2M1BA 4HPQA 1TWGJ 3VYSB 1KYZA 2WY8Q 5JHUA 2NNYA 3AAFA 5K5RA 4F3QA 2CQ7A 4ZC3A 4CYCB 4BQOA 1REPC 4I0AA 4C2MJ 2ELJA 5FKMA 1RRJA 4D7NA 3DTKA 3QP5A 2UZKA 1N75A 1XCVA 4O3MA 2KHMA 4MNUA 1UMQA 1V3FA 1A35A 4I99C 2RKHA 4UUSA 2PLYA 2CJJA 1IG7A 4PJMA 3VVZA 3CCYA 3K4JA 1BBYA 1V5GA 2LFBA 2IA1A 1ETOA 2GXAA 3QOPA 3GEUA 1KQ0A 1O7LA 2EJRA 2F5DA 3KP2A 2NVUB 4IRIA 4LIVA 3NS4A 2XAQA 5L3DA 2LKSA 2VXDA 2WV0A 4HQEA 2XAJA 2VC1A 5FB2A 3ZMVA 3DEUA 4ETSA 3V4GA 1W0TA 2V57A 4ABZA 1JGGA 4HNUA 3ZQ7A 1WQ2A 3HHGA 2HVRA 4PFPA 2YSRA 1B4AA 2BVMA 4K2EA 1T08B 3VTIA 4GYIA 1X1AA 3TL4X 2DT6A 2FRHA 2CUEA 3MVPA 3NI7A 2CH0A 2Z99A 1EKEA 2RVCA 5DCFA 1TZLA 3CCSI 3I4MJ 3BTJA 1BC7C 2H6CA 1HOMA 2LDUA 2WB1N 4PJJA 4G8XA 2IPQX 3BZKA 3K4MA 1NK3P 4EJVA 1XMAA 3JTGA 1FZPB 2Y69H 2V9PA 3KFWX 4XOTA 3FMQA 4IHWA 1U5TC 1XS9A 1FBSA 2L9RA 4GRIA 4L5EA 1K78B 3T0YA 4RBOA 4HBLA 2HOTA 5LRSA 3BTCA 3LSPA 1ZRDA 4U88A 3BHQA 1SFEA 2XF5A 3QPTA 4LGWA 3LQQA 2AQFA 5CVRA 1GUUA 2B1EA 1XB4A 1PUFB 3KP4A 1HKTA 3B73A 3BJOA 3ZGKA 1RC9A 3LA7A 4BQNA 2O8XA 1B72A 4EJTA 1LUJB 4F93B 2BHZA
chains in the Genus database with same CATH topology
3EGQA 1RPWA 2DJNA 3HOYJ 4UDSA 1O4XA 2LP0A 4BY1J 2LK2A 1CQTA 5EG0B 2M2EA 4B4CA 1HLVA 1Q1VA 2K40A 3OOUA 2DTZA 1JTXA 4JP0A 2E2HJ 3LSRA 2DN0A 2X48A 3PPBA 3TW6A 1DU6A 1K83J 2N8GA 2Y9ZA 2CU7A 1YRNB 4FCYA 3GTKJ 3QPSA 1MBGA 2OF7A 3BTLA 2ME6A 5K7FA 5J1RA 2TCTA 1Z0XA 4AYBN 3JRAA 4A3KJ 1B72B 3KKDA 5FHPA 4NELA 4FE7A 3GTJJ 2CQQA 1P7IA 2ZOYA 2M8GX 2Y30A 4MFDA 2FD5A 4Y7NJ 4A3JJ 1JKRC 2E2IJ 3LSJA 4AF5A 2LR8A 2G7LA 1JT6A 1I3QJ 2E1OA 2WAQN 4M3FA 5C4YA 2COBA 1AU7A 1S7EA 4FISA 3JRBA 5EZHA 4FE4A 3GTOJ 3M3YJ 3ZQLA 2KDZA 2LVSA 3GTMJ 4L62A 1OCPA 2CRGA 3PO3J 1TC3C 4MXMA 1HCRA 1UHSA 4AUXA 1VFCA 1ETQA 1JUPA 4W97A 2G0EA 3GTGJ 5IOYA 3HEFA 2GUHA 3AQSA 3SJMA 1IV6A 3D1NI 3M4OJ 4DYRA 3RQIA 3S1QJ 3HGGA 3BR0A 1Y1VJ 1WH7A 3V6GA 3W6VA 3GZIA 1LFBA 1U8BA 3BRUA 1POGA 4D7MA 3KNWA 3HM5A 2HI3A 2JA8J 4B1RA 5J1UA 1LE8A 2DA5A 1FJLA 3PM1A 4M3DA 1GV5A 4IHVA 3HE0A 3JRIA 4DYQA 3JRHA 5FJ8J 1IGNA 1MH4A 2R7ZJ 3HTHA 3ZQCA 1IRZA 3B81A 3Q0WA 2NP3A 1GDTA 1RKTA 3QPLA 2EZKA 1IDYA 3BT9A 4UUTA 2X9DA 4IHYA 1OFCX 3HGYA 1ENHA 5F0CA 2H8RA 4I6ZA 1TWCJ 5F27A 3ZQGA 3S1RJ 2EH3A 2JN6A 3S1MJ 5IYDJ 1R9TJ 2ID3A 1LE8B 2UXOA 2YVHA 4RDUA 5FGLA 3F0CA 2M9HA 3VUQA 2R5ZA 3K2AA 4NDLA 4J19A 3Q0UA 2E19A 2EZLA 3GTLJ 1ITYA 2IBDA 3BQZA 2FX0A 3K7AJ 3BCGA 3GTPJ 4GFBA 4GCTA 3LOCA 3FKIJ 2RASA 2Y2ZA 2JA5J 3IV5A 3PO2J 5DTDA 2JWTA 2FJ1A 1HDPA 1U9NA 3RZDJ 1HDDC 4JKZA 4MFEA 2DA7A 3F1BA 4XRSG 4JX5A 5F0HA 1X58A 1JTYA 2R5ZB 3A01A 2D5VA 3BNIA 5JLXA 2LKXA 2DMQA 2DMPA 3BR5A 2QIBA 3FIWA 1VNDA 5C4XJ 3IH4A 2YVEA 3JRDA 3LHQA 2XDNA 5CXGA 3BR2A 1X2NA 2DMUA 3VPRA 1MBHA 3TP0A 1EF4A 5HSZA 5F08A 3CQZJ 3UKGA 4A3CJ 2JMWA 3O8GA 1WGXA 2OI8A 1NTCA 3DEWA 1JKQC 1NK2P 3VW1A 1ZQ3P 3HIMA 4QIWN 2WUIA 2WV1A 3A01B 2MG4A 5D19A 1ETKA 3A02A 4JX4A 2E2JJ 2UXPA 5IP7J 3VW2A 3HBLA 2REKA 1WI3A 1A5JA 3I4NJ 3G1MA 2MSYA 3JRFA 2NS8A 5GPCA 3CMYA 2YU9J 1T33A 3COLA 3S2HJ 1IUFA 1TWAJ 3KZ9A 1MBFA 1WH5A 1TWHJ 2JJ7A 3GBGA 2CUFA 2DA3A 2GBYA 3HOWJ 2OERA 3AQTA 2XRLA 4EEFG 3S17J 2PBXA 1SANA 2M34A 4JX6A 5C4JJ 4X6AJ 1IDZA 1E3OC 3VP5A 1JKPC 2XGEA 5J3LA 5IYBJ 1FTZA 3HOVJ 4M3GA 2R0QC 2ZB9A 2H1KA 2X6OA 3B6AA 3FISA 2LTPA 4M3EA 4V2GA 1QPIA 3RZOJ 2F07A 3QBMA 4A3BJ 3FK6A 2O7OA 5E3LA 4X1EA 3HOUJ 1BW5A 1VF9A 2IAIA 2UXIA 2NVTJ 3HB9A 2R92J 3HTJA 3IH2A 5GPAA 1ZGWA 3P9TA 1MBEA 4JL3A 2IU5A 4ACIA 4D5CA 4DZJA 5K7HA 2G7GA 2EQRA 1U78A 1AHDP 4G12A 1RR7A 4BBSJ 1DU0A 1WPKA 3BG5A 2DMNA 4A3IJ 1JUMA 1X2MA 3S16J 2VUMJ 3BR3A 5EYRA 4BXXJ 3E7QA 3JR9A 2ME0A 1G2HA 3G56A 3RD3A 2CQXA 5M5WJ 4A3MJ 5EFYA 1A6IA 2GM4A 2K9QA 2RAEA 5FKOA 2O9LA 3H0GJ 3HTAA 2IEKA 2P81A 2VKVA 4A3DJ 2QWTA 4AC0A 3S5RA 5IP6A 5F0FA 2UXUA 2DMTA 2W48A 2B63J 5M3MJ 4DW6A 2VI6A 5K58A 4AC6A 3HTIA 1SFOJ 4CGRA 1RESA 3RKQA 1MSFC 3HOZJ 4BKXA 2HDDA 5IP9J 2GLOA 9ANTA 3G7RA 3G1LA 4M6VA 2GFNA 4HKUA 2LY9A 1BA5A 4GCLA 3OSGA 5EDNA 3L1PA 1XC5A 2MW8A 1ORKA 4C3JJ 1IJWC 2R5YA 3FRQA 3BJBA 2G7SA 2JA7J 1APLC 3S15J 3TW7A 1UI5A 2RHAA 2Q24A 5HODA 1AKHA 2QKOA 5JLWA 3BG3A 5CW8A 2EZHA 3VVXA 1ZR2A 3BR6A 2K9NA 1UG2A 3MKLA 5EZGA 3HDDA 3HKZN 5E3NA 1F43A 1JUSA 1Z77A 4BY7J 2L7MP 2R5YB 3CWRA 3VOXA 2L0KA 2M0CA 1BJZA 3NPIA 4S0HB 3NAUA 3IH3A 3BQYA 2K9SA 3ON2A 2ID6A 1QVTA 2XB5A 1VI0A 2AHQA 5F04A 4A3EJ 5IOZA 3KKCA 3OIOA 2XSDC 1I6HJ 4PXIA 2XPVA 3BR1A 3VW0A 2UXHA 5FKLA 2ZCNA 3ANGA 4NN1A 1GVDA 3A03A 5IPAA 5K7ZA 4MK6A 3DCFA 2XB0X 3PASA 2GENA 2O7TA 3JSJA 4KWAA 3G1OA 4A69C 5DAJA 3RH2A 3JRCA 4XICA 3Q0VA 4M3BA 1ZTRA 3C2BA 3O8HA 4DYCA 4B3AA 2DA1A 1T56A 2D6YA 5FMPA 2HYJA 3VOKA 4V2FA 1FEXA 2FBQA 4W1UA 1MSEC 2QCOA 3H3VK 3TEDA 3T6NA 4GFLA 1MH3A 1B8IA 5BNGA 2OPTA 5FLMJ 3V78A 1ZR4A 1HF0A 3ZQIA 2LLKA 4I76A 5F1JA 3CDLA 2NX4A 3EUPA 1BL0A 5C3EJ 2HQ5A 4D5FA 1U9OA 1RKWA 2YS9A 1ZK8A 4ICHA 5J1YA 2NOGA 5E3MA 3MNLA 1MBKA 2LD5A 3CJDA 5H9TA 2NVYJ 4JNNA 2WGBA 1Y1WJ 2DG7A 4QTRA 2QF7A 4ME9A 1B8IB 1MNMC 2KT0A 3ZQFA 2EZIA 2HXIA 5FLVA 3S2DJ 3NNRA 2ECBA 1D5YA 2Y31A 5EGOA 1GT0C 4C3IJ 5EEAA 5FKNA 1ETXA 2G3BA 2JA6J 2XGDA 2ZCXA 2ZOZA 1BW6A 1JJ8C 1I50J 4XIDA 2I10A 3LNQA 2NS7A 4BBRJ 5DS9A 1W0UA 4CYCA 3E7LA 5EF6A 3LSGA 3S14J 3JRGA 4DZPA 3TP3A 3O60A 2HOAA 2R93J 4FTHA 2VPRA 2FQ4A 2NVQJ 3NXCA 1WCMJ 3MN2A 1FIPA 5EGOB 2XPWA 4MLOA 4QSHA 1TWGJ 1MBJA 2HKUA 5HBUA 4CYCB 1SGMA 4YZEA 4A3LJ 1RETA 3BG9A 3LJLA 3ZQHA 1K61A 3DPJA 4C2MJ 5GP9A 5FKMA 4D7NA 1ETVA 2XPUA 1XG1A 2DA4A 4C3HJ 1UMQA 4MO7A 1GV2A 4UUSA 3ZOBA 2CJJA 5FKKA 1IG7A 4GCKA 1QRYA 1H89C 3VVZA 3CCYA 1TWFJ 2LFBA 1ETOA 2EBIA 3GEUA 4A3FJ 2NVXJ 4IHXA 2O8KA 2Y9YA 3ON4A 3ANPA 3VVYA 3FK7A 3CRJA 2JK3A 2ECCA 1IC8A 2HOSA 3WHBA 1P7JA 2NP5A 2VKEA 3OSFA 5D1RA 1LFUP 3B6CA 4IEJA 2MGQA 1JJ6C 4XRSA 4UUSB 5D18A 1W0TA 2V57A 2XGCA 4ABZA 1OCTC 1JGGA 2ELKA 2TRTA 4GFKA 3C07A 1H8AC 2DA2A 3Q3SA 2DG8A 3S1NJ 2YUSA 2HXOA 3WHCA 5C44J 2AO9A 3HOXJ 2DA6A 1AKHB 3MVPA 2CUEA 3NI7A 1FTTA 2HYTA 2L7ZA 3I4MJ 3BTJA 1ETWA 4LOCA 3LWJA 1OJLA 4A93J 1HOMA 2WB1N 2W53A 3QQAA 3BTIA 2PZ9A 1NK3P 2Y0SN 4HNVA 5M3FJ 1PUFA 4XRMA 2ZCMA 3JREA 4A3GJ 3IUVA 3NRGA 1UI6A 5HAWA 4IHWA 1XS9A 2L7FP 2QOPA 2L9RA 3NARA 1F36A 1FIAA 3SDGA 1ZKGA 4L5EA 4RBOA 5AQCA 2HOTA 1ETYA 3QKXA 1JKOC 1QVUA 3BTCA 5EG0A 3LSPA 3BHQA 1JT0A 1GUUA 4Y52J 5E3OA 5M5XJ 1PUFB 1YRNA 4JYKA 5M5YJ 3GTQJ 1B72A 5IYCJ 1H88C 2QTQA 4XK4A 3SFIA 4MIMA 3VIBA 5CXIA 2PMZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGQ A;  1RPW A;  2DJN A;  3HOY J;  4UDS A;  1O4X A;  2LP0 A;  4BY1 J;  2LK2 A;  1CQT A;  5EG0 B;  2M2E A;  4B4C A;  1HLV A;  1Q1V A;  2K40 A;  3OOU A;  2DTZ A;  1JTX A;  4JP0 A;  2E2H J;  3LSR A;  2DN0 A;  2X48 A;  3PPB A;  3TW6 A;  1DU6 A;  1K83 J;  2N8G A;  2Y9Z A;  2CU7 A;  1YRN B;  4FCY A;  3GTK J;  3QPS A;  1MBG A;  2OF7 A;  3BTL A;  2ME6 A;  5K7F A;  5J1R A;  2TCT A;  1Z0X A;  4AYB N;  3JRA A;  4A3K J;  1B72 B;  3KKD A;  5FHP A;  4NEL A;  4FE7 A;  3GTJ J;  2CQQ A;  1P7I A;  2ZOY A;  2M8G X;  2Y30 A;  4MFD A;  2FD5 A;  4Y7N J;  4A3J J;  1JKR C;  2E2I J;  3LSJ A;  4AF5 A;  2LR8 A;  2G7L A;  1JT6 A;  1I3Q J;  2E1O A;  2WAQ N;  4M3F A;  5C4Y A;  2COB A;  1AU7 A;  1S7E A;  4FIS A;  3JRB A;  5EZH A;  4FE4 A;  3GTO J;  3M3Y J;  3ZQL A;  2KDZ A;  2LVS A;  3GTM J;  4L62 A;  1OCP A;  2CRG A;  3PO3 J;  1TC3 C;  4MXM A;  1HCR A;  1UHS A;  4AUX A;  1VFC A;  1ETQ A;  1JUP A;  4W97 A;  2G0E A;  3GTG J;  5IOY A;  3HEF A;  2GUH A;  3AQS A;  3SJM A;  1IV6 A;  3D1N I;  3M4O J;  4DYR A;  3RQI A;  3S1Q J;  3HGG A;  3BR0 A;  1Y1V J;  1WH7 A;  3V6G A;  3W6V A;  3GZI A;  1LFB A;  1U8B A;  3BRU A;  1POG A;  4D7M A;  3KNW A;  3HM5 A;  2HI3 A;  2JA8 J;  4B1R A;  5J1U A;  1LE8 A;  2DA5 A;  1FJL A;  3PM1 A;  4M3D A;  1GV5 A;  4IHV A;  3HE0 A;  3JRI A;  4DYQ A;  3JRH A;  5FJ8 J;  1IGN A;  1MH4 A;  2R7Z J;  3HTH A;  3ZQC A;  1IRZ A;  3B81 A;  3Q0W A;  2NP3 A;  1GDT A;  1RKT A;  3QPL A;  2EZK A;  1IDY A;  3BT9 A;  4UUT A;  2X9D A;  4IHY A;  1OFC X;  3HGY A;  1ENH A;  5F0C A;  2H8R A;  4I6Z A;  1TWC J;  5F27 A;  3ZQG A;  3S1R J;  2EH3 A;  2JN6 A;  3S1M J;  5IYD J;  1R9T J;  2ID3 A;  1LE8 B;  2UXO A;  2YVH A;  4RDU A;  5FGL A;  3F0C A;  2M9H A;  3VUQ A;  2R5Z A;  3K2A A;  4NDL A;  4J19 A;  3Q0U A;  2E19 A;  2EZL A;  3GTL J;  1ITY A;  2IBD A;  3BQZ A;  2FX0 A;  3K7A J;  3BCG A;  3GTP J;  4GFB A;  4GCT A;  3LOC A;  3FKI J;  2RAS A;  2Y2Z A;  2JA5 J;  3IV5 A;  3PO2 J;  5DTD A;  2JWT A;  2FJ1 A;  1HDP A;  1U9N A;  3RZD J;  1HDD C;  4JKZ A;  4MFE A;  2DA7 A;  3F1B A;  4XRS G;  4JX5 A;  5F0H A;  1X58 A;  1JTY A;  2R5Z B;  3A01 A;  2D5V A;  3BNI A;  5JLX A;  2LKX A;  2DMQ A;  2DMP A;  3BR5 A;  2QIB A;  3FIW A;  1VND A;  5C4X J;  3IH4 A;  2YVE A;  3JRD A;  3LHQ A;  2XDN A;  5CXG A;  3BR2 A;  1X2N A;  2DMU A;  3VPR A;  1MBH A;  3TP0 A;  1EF4 A;  5HSZ A;  5F08 A;  3CQZ J;  3UKG A;  4A3C J;  2JMW A;  3O8G A;  1WGX A;  2OI8 A;  1NTC A;  3DEW A;  1JKQ C;  1NK2 P;  3VW1 A;  1ZQ3 P;  3HIM A;  4QIW N;  2WUI A;  2WV1 A;  3A01 B;  2MG4 A;  5D19 A;  1ETK A;  3A02 A;  4JX4 A;  2E2J J;  2UXP A;  5IP7 J;  3VW2 A;  3HBL A;  2REK A;  1WI3 A;  1A5J A;  3I4N J;  3G1M A;  2MSY A;  3JRF A;  2NS8 A;  5GPC A;  3CMY A;  2YU9 J;  1T33 A;  3COL A;  3S2H J;  1IUF A;  1TWA J;  3KZ9 A;  1MBF A;  1WH5 A;  1TWH J;  2JJ7 A;  3GBG A;  2CUF A;  2DA3 A;  2GBY A;  3HOW J;  2OER A;  3AQT A;  2XRL A;  4EEF G;  3S17 J;  2PBX A;  1SAN A;  2M34 A;  4JX6 A;  5C4J J;  4X6A J;  1IDZ A;  1E3O C;  3VP5 A;  1JKP C;  2XGE A;  5J3L A;  5IYB J;  1FTZ A;  3HOV J;  4M3G A;  2R0Q C;  2ZB9 A;  2H1K A;  2X6O A;  3B6A A;  3FIS A;  2LTP A;  4M3E A;  4V2G A;  1QPI A;  3RZO J;  2F07 A;  3QBM A;  4A3B J;  3FK6 A;  2O7O A;  5E3L A;  4X1E A;  3HOU J;  1BW5 A;  1VF9 A;  2IAI A;  2UXI A;  2NVT J;  3HB9 A;  2R92 J;  3HTJ A;  3IH2 A;  5GPA A;  1ZGW A;  3P9T A;  1MBE A;  4JL3 A;  2IU5 A;  4ACI A;  4D5C A;  4DZJ A;  5K7H A;  2G7G A;  2EQR A;  1U78 A;  1AHD P;  4G12 A;  1RR7 A;  4BBS J;  1DU0 A;  1WPK A;  3BG5 A;  2DMN A;  4A3I J;  1JUM A;  1X2M A;  3S16 J;  2VUM J;  3BR3 A;  5EYR A;  4BXX J;  3E7Q A;  3JR9 A;  2ME0 A;  1G2H A;  3G56 A;  3RD3 A;  2CQX A;  5M5W J;  4A3M J;  5EFY A;  1A6I A;  2GM4 A;  2K9Q A;  2RAE A;  5FKO A;  2O9L A;  3H0G J;  3HTA A;  2IEK A;  2P81 A;  2VKV A;  4A3D J;  2QWT A;  4AC0 A;  3S5R A;  5IP6 A;  5F0F A;  2UXU A;  2DMT A;  2W48 A;  2B63 J;  5M3M J;  4DW6 A;  2VI6 A;  5K58 A;  4AC6 A;  3HTI A;  1SFO J;  4CGR A;  1RES A;  3RKQ A;  1MSF C;  3HOZ J;  4BKX A;  2HDD A;  5IP9 J;  2GLO A;  9ANT A;  3G7R A;  3G1L A;  4M6V A;  2GFN A;  4HKU A;  2LY9 A;  1BA5 A;  4GCL A;  3OSG A;  5EDN A;  3L1P A;  1XC5 A;  2MW8 A;  1ORK A;  4C3J J;  1IJW C;  2R5Y A;  3FRQ A;  3BJB A;  2G7S A;  2JA7 J;  1APL C;  3S15 J;  3TW7 A;  1UI5 A;  2RHA A;  2Q24 A;  5HOD A;  1AKH A;  2QKO A;  5JLW A;  3BG3 A;  5CW8 A;  2EZH A;  3VVX A;  1ZR2 A;  3BR6 A;  2K9N A;  1UG2 A;  3MKL A;  5EZG A;  3HDD A;  3HKZ N;  5E3N A;  1F43 A;  1JUS A;  1Z77 A;  4BY7 J;  2L7M P;  2R5Y B;  3CWR A;  3VOX A;  2L0K A;  2M0C A;  1BJZ A;  3NPI A;  4S0H B;  3NAU A;  3IH3 A;  3BQY A;  2K9S A;  3ON2 A;  2ID6 A;  1QVT A;  2XB5 A;  1VI0 A;  2AHQ A;  5F04 A;  4A3E J;  5IOZ A;  3KKC A;  3OIO A;  2XSD C;  1I6H J;  4PXI A;  2XPV A;  3BR1 A;  3VW0 A;  2UXH A;  5FKL A;  2ZCN A;  3ANG A;  4NN1 A;  1GVD A;  3A03 A;  5IPA A;  5K7Z A;  4MK6 A;  3DCF A;  2XB0 X;  3PAS A;  2GEN A;  2O7T A;  3JSJ A;  4KWA A;  3G1O A;  4A69 C;  5DAJ A;  3RH2 A;  3JRC A;  4XIC A;  3Q0V A;  4M3B A;  1ZTR A;  3C2B A;  3O8H A;  4DYC A;  4B3A A;  2DA1 A;  1T56 A;  2D6Y A;  5FMP A;  2HYJ A;  3VOK A;  4V2F A;  1FEX A;  2FBQ A;  4W1U A;  1MSE C;  2QCO A;  3H3V K;  3TED A;  3T6N A;  4GFL A;  1MH3 A;  1B8I A;  5BNG A;  2OPT A;  5FLM J;  3V78 A;  1ZR4 A;  1HF0 A;  3ZQI A;  2LLK A;  4I76 A;  5F1J A;  3CDL A;  2NX4 A;  3EUP A;  1BL0 A;  5C3E J;  2HQ5 A;  4D5F A;  1U9O A;  1RKW A;  2YS9 A;  1ZK8 A;  4ICH A;  5J1Y A;  2NOG A;  5E3M A;  3MNL A;  1MBK A;  2LD5 A;  3CJD A;  5H9T A;  2NVY J;  4JNN A;  2WGB A;  1Y1W J;  2DG7 A;  4QTR A;  2QF7 A;  4ME9 A;  1B8I B;  1MNM C;  2KT0 A;  3ZQF A;  2EZI A;  2HXI A;  5FLV A;  3S2D J;  3NNR A;  2ECB A;  1D5Y A;  2Y31 A;  5EGO A;  1GT0 C;  4C3I J;  5EEA A;  5FKN A;  1ETX A;  2G3B A;  2JA6 J;  2XGD A;  2ZCX A;  2ZOZ A;  1BW6 A;  1JJ8 C;  1I50 J;  4XID A;  2I10 A;  3LNQ A;  2NS7 A;  4BBR J;  5DS9 A;  1W0U A;  4CYC A;  3E7L A;  5EF6 A;  3LSG A;  3S14 J;  3JRG A;  4DZP A;  3TP3 A;  3O60 A;  2HOA A;  2R93 J;  4FTH A;  2VPR A;  2FQ4 A;  2NVQ J;  3NXC A;  1WCM J;  3MN2 A;  1FIP A;  5EGO B;  2XPW A;  4MLO A;  4QSH A;  1TWG J;  1MBJ A;  2HKU A;  5HBU A;  4CYC B;  1SGM A;  4YZE A;  4A3L J;  1RET A;  3BG9 A;  3LJL A;  3ZQH A;  1K61 A;  3DPJ A;  4C2M J;  5GP9 A;  5FKM A;  4D7N A;  1ETV A;  2XPU A;  1XG1 A;  2DA4 A;  4C3H J;  1UMQ A;  4MO7 A;  1GV2 A;  4UUS A;  3ZOB A;  2CJJ A;  5FKK A;  1IG7 A;  4GCK A;  1QRY A;  1H89 C;  3VVZ A;  3CCY A;  1TWF J;  2LFB A;  1ETO A;  2EBI A;  3GEU A;  4A3F J;  2NVX J;  4IHX A;  2O8K A;  2Y9Y A;  3ON4 A;  3ANP A;  3VVY A;  3FK7 A;  3CRJ A;  2JK3 A;  2ECC A;  1IC8 A;  2HOS A;  3WHB A;  1P7J A;  2NP5 A;  2VKE A;  3OSF A;  5D1R A;  1LFU P;  3B6C A;  4IEJ A;  2MGQ A;  1JJ6 C;  4XRS A;  4UUS B;  5D18 A;  1W0T A;  2V57 A;  2XGC A;  4ABZ A;  1OCT C;  1JGG A;  2ELK A;  2TRT A;  4GFK A;  3C07 A;  1H8A C;  2DA2 A;  3Q3S A;  2DG8 A;  3S1N J;  2YUS A;  2HXO A;  3WHC A;  5C44 J;  2AO9 A;  3HOX J;  2DA6 A;  1AKH B;  3MVP A;  2CUE A;  3NI7 A;  1FTT A;  2HYT A;  2L7Z A;  3I4M J;  3BTJ A;  1ETW A;  4LOC A;  3LWJ A;  1OJL A;  4A93 J;  1HOM A;  2WB1 N;  2W53 A;  3QQA A;  3BTI A;  2PZ9 A;  1NK3 P;  2Y0S N;  4HNV A;  5M3F J;  1PUF A;  4XRM A;  2ZCM A;  3JRE A;  4A3G J;  3IUV A;  3NRG A;  1UI6 A;  5HAW A;  4IHW A;  1XS9 A;  2L7F P;  2QOP A;  2L9R A;  3NAR A;  1F36 A;  1FIA A;  3SDG A;  1ZKG A;  4L5E A;  4RBO A;  5AQC A;  2HOT A;  1ETY A;  3QKX A;  1JKO C;  1QVU A;  3BTC A;  5EG0 A;  3LSP A;  3BHQ A;  1JT0 A;  1GUU A;  4Y52 J;  5E3O A;  5M5X J;  1PUF B;  1YRN A;  4JYK A;  5M5Y J;  3GTQ J;  1B72 A;  5IYC J;  1H88 C;  2QTQ A;  4XK4 A;  3SFI A;  4MIM A;  3VIB A;  5CXI A;  2PMZ N; 
#chains in the Genus database with same CATH topology
 4MTE A;  4BHC A;  3EUA A;  4B8X A;  1D0Z A;  1Y8Q B;  4XRF A;  1WI9 A;  1Z3X A;  3PNV A;  3CP2 A;  1XD7 A;  3K1N A;  2PFB A;  2M2E A;  2QQB A;  3S93 A;  5EG0 B;  2V6C A;  4G6Q A;  5TGT A;  2DTZ A;  3SZP A;  3W2W A;  3O3K A;  2XAG A;  2DN0 A;  2X48 A;  1K83 J;  2Y9Z A;  3PQJ A;  1YRN B;  1J2X A;  4FCY A;  3E6B A;  2ADU A;  2PJP A;  5L3G A;  1Z0X A;  3HC7 A;  4NEL A;  2HKO A;  2CQQ A;  4IZZ A;  2DOF A;  2JT1 A;  1SEU A;  1GHC A;  2F2E A;  5D4S A;  1SFK A;  4XNF A;  2FD5 A;  4MEY F;  4Z2Y A;  2QBY B;  3LSJ A;  2ZJP F;  1YI2 I;  2WAQ N;  4GYG A;  4MTD A;  5C4Y A;  4Y15 A;  2JVH A;  1A04 A;  2FML A;  5E17 F;  4F7Z A;  5DD8 A;  3PO3 J;  3IKT A;  1IF1 A;  2X1E A;  5B5E C;  1DPR A;  3BPV A;  4E7S A;  1UHS A;  2FNP A;  4L9J A;  2VT2 A;  1ETQ A;  2G0E A;  5F1R A;  2L5Q A;  1KQ8 A;  3SQN A;  1Y0U A;  3HEF A;  2GUH A;  3AQS A;  3SJM A;  3M8J A;  3C3W A;  3S8P A;  3VYR B;  1U0J A;  2X6Y A;  1K79 A;  4LK1 F;  3HGG A;  3MAJ A;  3QOE A;  3BR0 A;  3S1Q J;  3V6G A;  3HOT A;  2L4M A;  4Y33 A;  1N77 A;  2FSW A;  3VYT B;  4ZTF A;  2W00 A;  4P9U A;  3HM5 A;  2LOO A;  5FD6 A;  3DLL F;  5AON A;  2W7N A;  4CO8 A;  1FJL A;  4NUB A;  4ESB A;  4AD9 A;  3LST A;  3BCB A;  5D5W B;  5FJ8 J;  1MH4 A;  4CCM A;  4EMS A;  3HTH A;  2XUB A;  3ZQC A;  1Z6R A;  1IRG A;  3E6M A;  1WJD A;  2EZK A;  1E0E A;  1SVM A;  1R71 A;  4KN7 X;  2OCC H;  1R6R A;  1OFC X;  2DI3 A;  3QAH A;  3SZT A;  3QYF A;  1V5E A;  2DQL A;  2EIJ H;  1Y8R B;  3S1M J;  3ZR8 X;  4OOI A;  3HL2 A;  3KE2 A;  4RDU A;  5J40 A;  2AQE A;  2KZV A;  2M9H A;  4CXF A;  4HA8 A;  1B9M A;  1X1C A;  3QWL A;  4YG2 F;  5CVI A;  1KU7 A;  4XKW A;  3GTL J;  1R4N B;  2HVS A;  4U0W A;  3F8M A;  3QYB A;  4GFB A;  3RSN A;  2IA0 A;  5D5V B;  5HLH A;  2Y2Z A;  2W85 A;  3IV5 A;  3PO2 J;  3CF2 A;  2FJ1 A;  3FXQ A;  4OMZ A;  2E1C A;  1T8I A;  1HDD C;  4PJN A;  2LRD A;  4XRS G;  2M4G A;  4WXC A;  2P5L C;  1MJB A;  5HLT A;  4ZYD A;  1BR1 A;  3A01 A;  2D5V A;  4B09 A;  3BNI A;  2LKX A;  3BR5 A;  1IV8 A;  2QIB A;  3ZMS A;  3K4N A;  4DNC A;  5C4X J;  1BOB A;  4ZZD A;  5CXG A;  3BR2 A;  4II3 A;  4BQA A;  1D8J A;  3OS1 A;  1J09 A;  3CCU I;  4XLH A;  2KIM A;  2LNB A;  2HPI A;  2X1D A;  2OI8 A;  1ON2 A;  1NK2 P;  3VW1 A;  2J5P A;  3MEX A;  2B0L A;  2D1V A;  1ZQ3 P;  1FNN A;  1IN6 A;  3RKY A;  2VON A;  1U5T B;  3V8L A;  2VIX A;  4OD4 A;  1OKR A;  4KT6 A;  4JX4 A;  3KEY A;  4UB8 C;  4ZYE A;  2E2J J;  2Z3Y A;  2VPL A;  5TJJ A;  1P2F A;  2EFP A;  5GPC A;  4HQM A;  2NYX A;  2HDW A;  4AIJ A;  1BR4 A;  2IS1 A;  1TWA J;  2Z9O A;  1TWH J;  4EGY A;  2CUF A;  4WXD A;  4UVA A;  2OER A;  1SFU A;  2DW4 A;  2ZNZ A;  4PUS A;  1YYV A;  2KIF A;  3VP5 A;  3I4P A;  2HWV A;  3P9I A;  3RPU D;  1JKP C;  1QZY A;  4Y3O A;  5J3L A;  5IYB J;  1HSJ A;  2FA5 A;  2ZB9 A;  2H1K A;  3FIS A;  1YOV B;  2F5C A;  3ZP5 A;  2HU9 A;  2QA4 I;  2O7O A;  2Y0S A;  2IGN A;  1T0F A;  3VOE A;  3HB9 A;  4F55 A;  2XRO A;  3LAJ A;  4M9S A;  3IWZ A;  1ZGW A;  2LKP A;  4D0P A;  1MBE A;  2HKX A;  3F8N A;  5GAE J;  2Y48 A;  4ACI A;  3TQN A;  4DZJ A;  5K7H A;  2G7G A;  3FXM A;  2JSP A;  3IL2 A;  1RR7 A;  2ISY A;  3NWS A;  4C2T A;  4CDG A;  4PZJ A;  2DMN A;  3GFJ A;  1X2M A;  1F4K A;  3F8C A;  2PI0 A;  2VKD A;  1OYI A;  1SVO A;  3MZ8 A;  4G7Z F;  3WOD F;  4U9L A;  2K9Q A;  2RAE A;  1D3Y A;  3BP8 A;  2UWM A;  3HTA A;  5DDG A;  2MA3 A;  2ZJR F;  4XSZ F;  4EM2 A;  4A3D J;  3S5R A;  1ZLK A;  5IP6 A;  1IXR C;  4DW6 A;  3L9F A;  1UHM A;  2ZC2 A;  3HOZ J;  2VE9 A;  1JHH A;  1R1V A;  3KLN A;  4O6J A;  2CWE A;  1AA7 A;  2A6T A;  2OQG A;  2VQG A;  3SHF A;  4M6V A;  1ZLJ A;  4DQ2 A;  1BA5 A;  5EDN A;  3UR3 C;  1XC5 A;  1FY7 A;  1ORK A;  2DFH A;  5E79 C;  1MD0 A;  2E5N A;  2F5F A;  4XLE A;  2A07 F;  2DFE A;  5CYV A;  2JA7 J;  1FLI A;  3I59 A;  1APL C;  3ZMT A;  2W57 A;  1L0O C;  4PJL A;  1WZ2 A;  3RIR A;  5F6F A;  1W7P A;  4YEL A;  1RNL A;  2VB6 A;  1R23 A;  2QKO A;  3BG3 A;  4HX7 A;  1P4A A;  2MD0 A;  3PIP F;  3HRU A;  4LLG F;  1UG2 A;  5JVT A;  3MKL A;  3FHN A;  4I02 A;  4CCJ A;  2MLG A;  3BJ6 A;  1F43 A;  1OCZ H;  3V42 A;  1ONV A;  4OIO F;  2L7M P;  3CWR A;  1FP2 A;  3DPU A;  3CCV I;  2XF7 A;  4HX8 A;  1G4D A;  2V1D A;  4GXO A;  3FBI B;  4HV5 A;  3NAU A;  3VWB A;  5H6Q A;  3BQY A;  1T38 A;  4A3E J;  2XB5 A;  4XKC A;  2L2O A;  4XKV A;  1LDD A;  5IOZ A;  2BHY A;  3KKC A;  2XSD C;  1E3H A;  2W25 A;  4HRI A;  3FM3 A;  1P4W A;  1SVL A;  2KFD A;  3BR1 A;  3VW0 A;  4UVB A;  2V7F A;  2R7V A;  3CC4 I;  1CF7 B;  5K7Z A;  3L2Q A;  5IPA A;  4MK6 A;  4NN1 A;  1R00 A;  3DCF A;  2XB0 X;  5D6E A;  3FBN B;  4P1W A;  2P4W A;  2VBY A;  4XIC A;  3KYC B;  4L9N A;  3F9K A;  4A0Z A;  3ABU A;  2R7U A;  1X1D A;  1XCB A;  3C2B A;  3ECH A;  2R7Q A;  2BE5 F;  1IN4 A;  1T56 A;  2D6Y A;  4XM3 A;  4L5I A;  4ASN A;  3K8P C;  5FMP A;  2UXN A;  2CUJ A;  2G7H A;  2M4K A;  2FBK A;  4PJ0 C;  1ACI A;  4EAT A;  4IL6 C;  2G9W A;  1D1A A;  1R7J A;  3V78 A;  1BI3 A;  2BW3 B;  1ZR4 A;  5D5X B;  4HX4 A;  2LLK A;  2P5K A;  3CCL I;  1T2K A;  4IRV A;  4L9T A;  2GOX B;  4NC8 A;  3J7Y J;  3MWM A;  2IT0 A;  4CCN A;  1IN7 A;  1OR7 C;  3V7C A;  2PMH A;  2KDO A;  5ED4 A;  4OIP F;  2YS9 A;  1YTY A;  5GAH J;  2XSJ C;  3FHZ A;  4ICH A;  5J6X A;  3K2Z A;  5E3M A;  4NNJ A;  2PN6 A;  3RI4 A;  1E17 A;  3CJD A;  1BJA A;  3ISP A;  4UVC A;  4RAZ A;  1DQU A;  1S6L A;  2WGB A;  4QTR A;  1SC7 A;  2R7D A;  4HAM A;  3J7A O;  2CG4 A;  2GWR A;  2MC3 A;  4Q48 A;  2FEZ A;  2D1H A;  2XRN A;  2ZJ2 A;  3GXO A;  3K1P A;  3S3O A;  3AKZ A;  4O5V A;  4EM0 B;  5ILU A;  1GT0 C;  1TNT A;  3HRM A;  3M1C A;  2ZCX A;  1FBQ A;  1QZE A;  3CCR I;  3F6V A;  1SD6 A;  4XID A;  3CUQ B;  2BXZ A;  4DVY P;  3KP3 A;  2F48 A;  1TQI A;  3LSG A;  2LBF B;  1PP7 U;  3S14 J;  3AG4 H;  4DZP A;  4M6X A;  1NH3 A;  1BM9 A;  5E1W A;  2VPR A;  4L9V A;  1XGM A;  4B48 A;  2DOD A;  1FIP A;  1J0R A;  2HGC A;  2L9N A;  4BHB A;  3GZ6 A;  1H9G A;  3OYN A;  2KIQ A;  4XOR A;  4M9Z A;  2HKU A;  5HBU A;  1B6A A;  2PX9 A;  3W6K B;  4EJW A;  2E7W A;  4UNO A;  2R7S A;  1SGM A;  4YZE A;  1XMX A;  3LJL A;  3ZQH A;  1FBU A;  2ZME A;  3HG9 A;  4J00 A;  3HOS A;  2M3A A;  2DA4 A;  3TGN A;  1UAA A;  4F92 B;  3WTZ A;  3RYP A;  3ABM H;  1XSV A;  1AOY A;  1G3T A;  1BR2 A;  4DOZ A;  2DDB A;  4EM1 A;  5ILV A;  5FKK A;  4GCK A;  1H89 C;  1VQ8 I;  3C7J A;  3IP4 B;  5J8C A;  3WG9 A;  3WU0 A;  3HXL A;  3OYD A;  2V26 A;  1LDK B;  3L2V A;  3M8F A;  3NWT A;  4RB3 C;  2NVX J;  2CQN A;  3ON4 A;  4C2M A;  1QGP A;  5ICE A;  3CRJ A;  1DGR M;  1LEA A;  3DKX A;  2ECC A;  1IC8 A;  3WHB A;  3GX4 X;  2NP5 A;  3EUH C;  3OSF A;  3ERE D;  2VN2 A;  4IPA A;  4IX7 A;  2MGQ A;  2MAB A;  4XRS A;  1O7F A;  3GZ5 A;  3KX2 A;  4HSR A;  4M74 A;  2NRA C;  3WHC A;  5C44 J;  4YIR X;  3H5R A;  2AO9 A;  2DYR H;  3H5N A;  5CVJ A;  3VDX A;  2DA6 A;  3HOX J;  2FMY A;  4E7H A;  1O3S A;  1G8X A;  4OU0 A;  2E36 A;  1FTT A;  5CPR B;  2HYT A;  2FQ3 A;  4V19 K;  4XLP F;  5FLX K;  3ZXS A;  4EGZ A;  1TP4 A;  3GUD A;  3BTI A;  3H92 A;  2Y0S N;  5M3F J;  1R1U A;  2ZFW A;  4HDU A;  1L3L A;  1FC3 A;  1EJ9 A;  3JRE A;  2O6G E;  2EB7 A;  3E5U A;  5LEJ A;  3IUV A;  1J75 A;  5HAW A;  1KGS A;  1FYM A;  5GAG J;  3LL7 A;  1F36 A;  1FIA A;  4FQG A;  1ZKG A;  3KIO A;  4F52 A;  3FXR A;  3JTH A;  4N4N B;  4I7H A;  2PJR B;  2VOO A;  4UXN A;  1WHU A;  5E3O A;  2I5U A;  3ONQ A;  5M5Y J;  2OTJ I;  4IOC F;  1SD5 A;  4NQW B;  5FRO A;  5IYC J;  1H88 C;  3T8R A;  1DUX C;  4P96 A;  2HNH A;  3VIB A;  3LA2 A;  4CZC A;  5CXI A;  2RNG A;  2K4J A;  2LF7 A;  1V4R A;  3MMY B;  4G7H F;  5D6F A;  2XC7 A;  2LP0 A;  3ABK H;  2ISZ A;  4MGR A;  1CQT A;  4B4C A;  1HLV A;  2VBW A;  3OOU A;  1VQ5 I;  1I3A A;  3HPG A;  1BIB A;  2R3S A;  3LSR A;  3LA3 A;  3R4K A;  3OYF A;  2N8G A;  4RA2 A;  2STW A;  2CU7 A;  3L2U A;  3QPS A;  1MBG A;  4BDZ A;  2TCT A;  3L2R A;  5FHP A;  2DK8 A;  4FAS D;  1S3J A;  3C18 A;  4WX9 A;  3GTJ J;  2XKO A;  2DPU A;  1P7I A;  2ZOY A;  4MFD A;  4CYD A;  2JUG A;  1DDN A;  2EV6 A;  4Y7N J;  3X2Q H;  2A6E F;  4AF5 A;  3K1M A;  2G7L A;  4OAZ A;  5KHD A;  3W2V A;  2HQA A;  3GLX A;  4M3F A;  3HTS B;  1ERD A;  2RC4 A;  3FMS A;  3JRB A;  5EZH A;  3GTO J;  2KRF A;  3M3Y J;  3M8E A;  4U9N A;  4XLN F;  3BPX A;  2LVS A;  4A5M A;  3JW4 A;  2K3F A;  4L62 A;  1OCP A;  1ZRF A;  3GEZ A;  5B3S H;  2JPC A;  4ZDL A;  2OCE A;  1JUP A;  2UXX A;  3TDZ C;  4ESJ A;  2O3F A;  3W2A A;  3M4O J;  3D1N I;  4KJZ A;  4BEH B;  4DYR A;  5KCM A;  1N78 A;  3E6C C;  2WY7 Q;  4KFC A;  1Y1V J;  1O3T A;  2M7B A;  1WH7 A;  4XKB A;  1R5H A;  4A6E A;  2H09 A;  4D7M A;  2RN7 A;  4ZYH A;  2HI3 A;  4BGD A;  2CW7 A;  4B1R A;  2MD5 A;  1WFX A;  1LE8 A;  3S3N A;  3KYD B;  1T39 A;  2M45 A;  3DWL E;  3CF5 F;  1GV5 A;  3HE0 A;  3JRI A;  2X1C A;  2X85 A;  1IRZ A;  5D8K B;  2DBB A;  1W5C C;  2LSO A;  2XAH A;  4KIF A;  4WXH A;  1FT9 A;  4XON A;  3TDU C;  4P5O A;  1KU9 A;  1J9I A;  3BT9 A;  4UUT A;  2WWY A;  3HGY A;  5F0C A;  3KZZ A;  4PSW A;  4I6Z A;  2L3D A;  1YW9 A;  2LY1 A;  4X0G A;  2X6X A;  1VQO I;  3S1R J;  1V54 H;  2J5O A;  1R9T J;  5L3B A;  5FGL A;  2H6B A;  1VQP I;  3F0C A;  3H9J A;  3IAM 2;  1UB9 A;  5ICF A;  2R5Z A;  4NDL A;  2HQN A;  3GZN B;  1EA3 A;  2EZL A;  3T5X A;  4DIQ A;  3BQZ A;  2FX0 A;  1D5V A;  5L3E A;  1ZAR A;  5HDG A;  4BQQ A;  3PNT A;  4AIK A;  3GTP J;  1LJ9 A;  2RNJ A;  3E0J B;  1FSE A;  4BE2 A;  4GCT A;  4RB2 C;  3U1D A;  4ENK A;  3LSM A;  3OWT A;  2JZY A;  3MZH A;  1U9N A;  1UCR A;  1CF7 A;  4BHP A;  1BI0 A;  2K9L A;  3F1B A;  1WKM A;  2MFZ A;  2XGX A;  3I53 A;  2W82 A;  5F0H A;  1X58 A;  2R7F A;  3WE2 A;  1JTY A;  4C2U A;  2QKM B;  5JLX A;  1ZRC A;  1R49 A;  2DMP A;  4NHJ A;  3IH4 A;  4U0V A;  2XDN A;  2EA4 A;  2DYS H;  2VQL A;  2O5R A;  2FF4 A;  2Y0M A;  3SEZ A;  5HDK A;  3I58 A;  1MBH A;  2VJI A;  5F08 A;  4BU2 A;  3CQZ J;  3UKG A;  4A3C J;  2JMW A;  3KET A;  3LMM A;  2HDC A;  1X19 A;  1WGX A;  5JVG F;  3E6D A;  1VQ6 I;  4HW0 A;  4KIC A;  5A2Q K;  2QSG X;  2CV2 A;  5D19 A;  3PSF A;  3AL0 C;  2UXP A;  3VW2 A;  1WI3 A;  2DAO A;  2ZXJ A;  1IXC A;  3G1M A;  1UEL B;  3N05 A;  3JRF A;  4P55 A;  3CMY A;  2YU9 J;  1BI2 A;  3MD2 A;  2L01 A;  4BE1 A;  4BUP A;  1UST A;  3COL A;  4KNY A;  3CO7 C;  3BY6 A;  3DV8 A;  4XQF A;  3D5S C;  1MBF A;  3SDB A;  1TT0 A;  2FU4 A;  1IN8 A;  1D0X A;  2JJ7 A;  2DA3 A;  3U21 A;  1O3Q A;  3TKY A;  1OMI A;  2IS4 A;  2PBX A;  1SAN A;  4JX6 A;  1IDZ A;  2R4G A;  1F1Z A;  1E3O C;  2XGE A;  3DEE A;  3CUQ A;  1FTZ A;  4M3G A;  2ZXW H;  2ETH A;  2XAU A;  3B6A A;  2LBF A;  2LTP A;  4I01 A;  3WG7 H;  2F07 A;  1QPI A;  3QBM A;  3FK6 A;  1YLF A;  2XVC A;  3HOU J;  4XLC A;  1VF9 A;  2IAI A;  4UUV A;  3HTJ A;  1GVJ A;  3P9T A;  5B1A H;  1PP8 F;  2HPM A;  2OBP A;  5LHG A;  1XGS A;  4RB0 A;  2EQR A;  1U78 A;  1AHD P;  2CW0 F;  5J47 A;  1VZ0 A;  1MW7 A;  4IO9 F;  1GLN A;  3BG5 A;  2CGP A;  5D8L B;  2WC2 A;  1JUM A;  2V1N A;  5DUI A;  3B02 A;  1WSU A;  3S16 J;  3C2H A;  5BS6 A;  3FMR A;  4LIT A;  2VUM J;  2P7V B;  3JR9 A;  4FX0 A;  4LB6 B;  5M5W J;  2XAF A;  4A3M J;  1A6I A;  1S9H A;  2Q8K A;  2O9L A;  1OYY A;  4FT8 A;  2R7X A;  2PMZ A;  4KYW A;  2BEO A;  2QKL B;  3NEU A;  1FX7 A;  3O2P E;  1VQ4 I;  2B9S A;  5J4V A;  5K58 A;  4AC6 A;  1IN5 A;  1MDM B;  1MSF C;  2HDD A;  5IP9 J;  3RYR A;  3CP8 A;  2GLO A;  9ANT A;  3MKZ A;  1F5T A;  2GFN A;  2BY2 A;  2LY9 A;  3EYY A;  3L1P A;  2BXY A;  3DBH B;  3OYE A;  4C3J J;  1MMA A;  4AYB A;  2QSF X;  2ZXI A;  2ZY9 A;  3CJN A;  2BBY A;  2VE8 A;  3F21 A;  2BYV E;  1UI5 A;  3H3U A;  3C2G A;  5DCM B;  3DP7 A;  1JGS A;  4RM3 A;  3CLQ A;  2EZH A;  1T98 A;  3VVX A;  4LLN A;  2KP6 A;  4ZTJ A;  1BOA A;  2B7E A;  3HDD A;  1ZH5 A;  4CCK A;  2L9S A;  3CC7 I;  2B3W A;  1JUS A;  1Z77 A;  2R5Y B;  1HW1 A;  1Z7U A;  2F4I A;  2CSO A;  4ENJ A;  4XN3 A;  2BV6 A;  3NPI A;  1ZG3 A;  4G94 A;  2E34 A;  3I71 A;  4IKF A;  1RIO H;  3IH3 A;  3RQ4 A;  1S5L C;  1YO5 C;  3OIO A;  2ESN A;  4II2 A;  3ELK A;  2M0M A;  4JQF A;  2LF8 A;  2XPV A;  1RI7 A;  3JSO A;  5LBQ A;  1GVD A;  4F91 B;  2L7K A;  5FFX A;  1SAX A;  3HSF A;  2CYY A;  2MH2 A;  5HLI A;  4XBF A;  2O7T A;  4RAG A;  4KWA A;  1SMT A;  3VEP A;  4A69 C;  4AWX B;  4M3B A;  2X0L A;  3J80 K;  1MKM A;  2DA1 A;  2M87 A;  5LEK A;  2QQ9 A;  3PFI A;  2HYJ A;  3VOK A;  2EPF A;  4V2F A;  4QLC U;  4W1U A;  2ICW G;  2PBI A;  5HNF A;  3TED A;  3GYH X;  3L7W A;  1T6S A;  3OYJ A;  1MH3 A;  1Z67 A;  5FLM J;  6PAX A;  1I39 A;  1HF0 A;  4I76 A;  2HEO A;  2M5W A;  3ZCO A;  3CDL A;  2BY0 A;  4PCQ A;  5TIS C;  4BE0 A;  1BL0 A;  5CQE A;  4LG0 A;  4D5F A;  4KA4 A;  1U9O A;  4E7J A;  4NBQ A;  4RGX A;  3KEQ A;  2FE3 A;  4B47 A;  5GTI C;  3AL0 B;  3WTS C;  1K4S A;  3I0T A;  4LK0 F;  1Z05 A;  5JI6 A;  3MNL A;  3WGH A;  2V9V A;  2WTE A;  2NVY J;  3DQV C;  4JNN A;  2OJE D;  1QQI A;  2PEX A;  1B8I B;  1O3R A;  1I1G A;  4BJ6 C;  2EZI A;  3EYI A;  2KPM A;  1T95 A;  5ICC A;  2A3S A;  2P8T A;  4NC6 A;  3D5R C;  1XSD A;  3HRS A;  2Y31 A;  5EGO A;  2G3B A;  2DOA A;  1ETX A;  5FKN A;  2IGO A;  1USS A;  4UY8 I;  2Q2E B;  3CD6 I;  2R7W A;  1X4O A;  4EQQ A;  4YFK F;  1IW7 F;  1YW8 A;  2V9K A;  3CJQ B;  2BOL A;  2PQ8 A;  5JFR A;  3LNQ A;  4RB1 A;  4BEH A;  3VSL A;  4CYC A;  3TOA A;  1QHG A;  4UV9 A;  2NS0 A;  5JHF A;  2YR2 A;  3K4B A;  3TP3 A;  1QZZ A;  2CQK A;  2QEN A;  2FOK A;  3I54 A;  2VKH A;  3NXC A;  1NHA A;  3T1B A;  2PFV A;  3MN2 A;  4M72 A;  2GAU A;  4MLO A;  2ZXH A;  5E1X A;  4QSH A;  2V1U A;  5CQG A;  1D1B A;  3MQ0 A;  3CCJ I;  4BAY A;  3BLY A;  3BG9 A;  3ZPL A;  2W24 A;  1RUO A;  3RJP A;  5GP9 A;  1ETV A;  3QRF F;  1TT5 B;  3K4L A;  4Q4Z F;  4KIT B;  4BDY A;  2O61 A;  1HKQ A;  2LY2 A;  4LLL A;  3EQL F;  3PSI A;  3RTR A;  3DBR B;  1YW7 A;  4CHU A;  3ZRG A;  4KDP A;  4ITV A;  4CZZ A;  1TWF J;  4CGZ A;  1QPM A;  3PFY A;  3ZMD A;  1MMN A;  1WJF A;  2EFQ A;  5CVV A;  3COA C;  4A3F J;  2Y9Y A;  2O8K A;  1B1B A;  4Y13 A;  4GDF A;  3HYI A;  5HS9 A;  3HUG B;  1G3S A;  3FK7 A;  1OCC H;  4PGH A;  3GVA A;  2HOS A;  4L18 B;  3RKX A;  2ZJQ F;  2DO7 A;  1FOY A;  5CVU A;  3LSK A;  2HVQ A;  1LFU P;  5D1R A;  4IEJ A;  5D18 A;  2IP2 A;  2P6S A;  4UUS B;  2XGC A;  1VTN C;  2ELK A;  2TRT A;  1MJ9 A;  3C07 A;  1H8A C;  3K4C A;  3Q3S A;  1QNT A;  2DG8 A;  2YUS A;  2HXO A;  3VFZ A;  2HQR A;  2K9M A;  3QPH A;  1K78 A;  3GFI A;  1R58 A;  2M7A A;  1P92 A;  4LOC A;  5CLS A;  1OJL A;  3L2C A;  3QQA A;  2WAD A;  2PZ9 A;  2IRF G;  2CMP A;  1PUF A;  4XRM A;  3E97 A;  3LQR A;  3R0A A;  3CCQ I;  4A3G J;  5H6R A;  1UI6 A;  5D4R A;  5FD5 A;  3CMA I;  5AIP A;  1J5Y A;  1LPQ A;  2L7F P;  2QOP A;  1D0Y A;  3NAR A;  3SDG A;  2O03 A;  3OS2 A;  1IRX A;  1ZGJ A;  3QKX A;  1JKO C;  5EG0 A;  4A0Y A;  2KJB A;  2OU2 A;  4OIQ F;  1HW2 A;  1ODD A;  2GQQ A;  4BL0 B;  1YRN A;  2K86 A;  4B3X A;  3M1E A;  4N0B A;  4YEJ A;  4MIM A;  1O57 A;  2W4S A;  1W5S A;  5BOX A;  2PMZ N;  1OYW A;  4FET A;  3ULQ B;  2VOP A;  1RPW A;  2DJN A;  3DU6 A;  2JUC A;  2GIZ A;  3HOY J;  3OYL A;  2QBY A;  1MND A;  4IVN A;  3E5Q A;  1YJ9 I;  3WTV C;  5H2F C;  2AS5 F;  1EH7 A;  3PUF A;  4G6D A;  3HKZ A;  1JTX A;  4JP0 A;  1YIT I;  2E2H J;  3PPB A;  3TW6 A;  4M73 A;  2K85 A;  3GTK J;  2EIL H;  1HQC A;  3IHU A;  2XIG A;  1KU2 A;  2OF7 A;  3BTL A;  4TV7 A;  5K7F A;  5K5O A;  5J1R A;  1B72 B;  4IQJ A;  4AYB N;  3JRA A;  3KKD A;  2ELH A;  4FE7 A;  3IC7 A;  5FFZ A;  4B43 A;  2TDX A;  4HLX A;  5HS7 A;  2KRC A;  1VQL I;  2JA2 A;  3GO5 A;  2Y30 A;  4N4O B;  4KIG A;  1EH6 A;  2E5Z A;  2E2I J;  3CCE I;  3MCZ A;  1I3Q J;  2WB1 A;  4Y17 A;  3BOQ A;  1FOW A;  1OQY A;  3OV8 A;  4KMU X;  1BC8 C;  3L00 A;  4FE4 A;  1KON A;  2ZCW A;  1WJC A;  4ESF A;  1T0F C;  3ZQL A;  5ILS A;  3GTM J;  3G3Z A;  2XAS A;  2CRG A;  2A69 F;  1TC3 C;  3GCM A;  4LMY A;  5HVQ C;  2VAS A;  3H5A A;  4WK8 F;  1VFC A;  3JAM K;  2IS6 A;  2HR3 A;  2KJC A;  3ECO A;  5TRD A;  1MMS A;  1IV6 A;  1ZGA A;  2OA4 A;  2PG4 A;  2GIV A;  1YHQ I;  3RPQ A;  3J81 K;  3W6V A;  4HF0 A;  3GZI A;  1LFB A;  3BRU A;  3F22 A;  3TO7 A;  2K3P A;  2LRE A;  4M9X A;  4DBQ A;  2JA8 J;  4YFN F;  1JXS A;  4IRH A;  2RQQ A;  1ZG5 A;  4HNT A;  2DA5 A;  2WAF A;  2RDP A;  4YRV A;  3JRH A;  1IGN A;  3BZ6 A;  4R1H A;  4HG2 A;  1G6N A;  2GA2 A;  3SEQ A;  3Q0W A;  2OC6 A;  1GDT A;  4QPO A;  1YQA A;  3QPL A;  2NAZ A;  4R8H A;  1HW5 A;  1DGW Y;  2X9D A;  1ENH A;  1ZG1 A;  1TWC J;  1ULY A;  3SFZ A;  3ZQG A;  4N9H A;  3RPU A;  5IYD J;  2ID3 A;  4BJT A;  4L0Z B;  4PDK A;  2VOD A;  1BIA A;  1ZN2 A;  2WAE A;  2C6Y A;  4XSX F;  2JVG A;  3K2A A;  3ZMU A;  3K6G A;  4J19 A;  3Q5F A;  2HOE A;  2E19 A;  3G2B A;  3H9Q A;  1ITY A;  2A2F X;  2F5E A;  2IBD A;  2VBX A;  5LGN A;  3WTU C;  1MIJ A;  2CV1 A;  3P5J A;  5KVR A;  3K7A J;  4A2U A;  3ROU A;  5L3C A;  3LOC A;  2QEX I;  5L3F A;  1ZHF A;  1KYW A;  2DK5 A;  3GFL A;  3DBL B;  2BGC A;  4JKZ A;  2K4B A;  5K1Y A;  3BG6 A;  4CH7 A;  3J7Z I;  2DA7 A;  3V8K A;  4U0Y A;  3W3C A;  2GZW A;  1U5T A;  2M30 A;  2DMQ A;  3A1Y A;  4C30 A;  3ASO H;  1VND A;  2PMU A;  5FRN A;  2W1O A;  3LHQ A;  1LKX A;  2OD5 A;  2XKP A;  2A61 A;  1C0W A;  1H9T A;  5AIQ A;  2DMU A;  3MZY A;  3CCM I;  1ZRE A;  1YX3 A;  3CC2 I;  3TP0 A;  5HSZ A;  3SXY A;  4M6Y A;  4R79 A;  3TO9 A;  4BXU A;  1GXP A;  1NTC A;  2F4M B;  1FMW A;  1JKQ C;  1XTA A;  4Q5S F;  3HIM A;  4QIW N;  4E7K A;  3I56 I;  2WV1 A;  3A01 B;  4I2O A;  1XSX A;  4ZH4 F;  3H9G A;  1ETK A;  2ZSH B;  4XLF A;  3S2W A;  1SFX A;  5IP7 J;  3HBL A;  3WTW C;  2REK A;  5JR3 A;  1TBX A;  1I5Z A;  1MJA A;  1A5J A;  3BCA A;  2MSY A;  3P9K A;  2K7L A;  1UFM A;  3OYI A;  2KRH A;  3KP5 A;  3NQO A;  3S2H J;  1OCO H;  2CS3 A;  4YFX F;  2X4H A;  2LH9 A;  3ML6 A;  1Z91 A;  3GBG A;  3MKW B;  4Y4R A;  1FYK A;  3Q9S A;  2GBY A;  3HOW J;  1U6G A;  3AQT A;  2XRL A;  3S17 J;  4MQV A;  4ZDO A;  4E4H A;  4ZZL A;  3DTI A;  1U3E M;  3VSK A;  1WRJ A;  3HOV J;  2IGM A;  3CME I;  2DOE A;  5B66 C;  2A5W A;  3RZO J;  3I9V 2;  1E2X A;  3HIF A;  2VJ5 A;  4HEA 2;  1KZH A;  5KK1 A;  1P9Q C;  5E3L A;  3IWF A;  2BVL A;  2H94 A;  2UXI A;  2R92 J;  4DGW B;  1MZB A;  4MHG A;  3IH2 A;  4UV8 A;  5GPA A;  2V6E A;  1R5I D;  3A0B C;  4CCO A;  2ESH A;  3BDD A;  3GF2 A;  2HYG D;  4EJO A;  4G7O F;  2IU5 A;  1RZ4 A;  5LRR A;  3HHH A;  1Z7L A;  2KL4 A;  3U1K A;  4G12 A;  3FXO A;  2V79 A;  5E20 A;  2LMD A;  1DU0 A;  4UHT A;  4ANJ A;  3DKW A;  1FPQ A;  4EJU A;  3H1C A;  3ZN0 A;  3HJE A;  3E7Q A;  3BR3 A;  5EYR A;  2VLA A;  3OYH A;  2JTV A;  5DEQ A;  1FSH A;  3R0J A;  4MQ9 F;  5FKO A;  3H0G J;  1R22 A;  2IEK A;  2JRT A;  2P81 A;  4ZJZ A;  5F0F A;  4KT5 C;  2A05 A;  2W48 A;  2LYC A;  3OYC A;  3JCU C;  4L5J A;  2RGV A;  3FXK A;  5KAI C;  3HTI A;  3I3L A;  5FLX Z;  1V5F A;  2V4J C;  3RKQ A;  1K4T A;  5CKT A;  3GME A;  5J4Y A;  4HV6 A;  2MH9 A;  1VQN I;  4HF1 A;  2DJI A;  3HUG A;  2ZME C;  1PJR A;  3I5U A;  4U7D A;  3G1L A;  1Y0N A;  3G73 A;  3WE3 A;  5ICG A;  2MW8 A;  1IJW C;  3FRQ A;  1YJW I;  3BJB A;  2G7S A;  5IT9 K;  1M1E B;  1HKS A;  3FX3 A;  3S15 J;  4UB6 C;  1J59 A;  2RHA A;  3FM5 A;  4C9Y A;  5JLW A;  4HLY A;  1S7A A;  1LQ1 A;  1Z3Y A;  2K9N A;  3FZV A;  3U2R A;  3BJA A;  3HKZ N;  5E3N A;  1TW2 A;  1SMY F;  3R60 A;  4BY7 J;  1G59 A;  5J8F A;  2VQH A;  2H8W A;  3FKJ A;  3PNY A;  3VOX A;  1H0M A;  3I59 B;  5F64 A;  4IHS A;  1XGN A;  3L09 A;  2KIU A;  1GXQ A;  2K9S A;  4G6T B;  1W7P B;  2LC2 A;  2ID6 A;  1QVT A;  4U87 A;  4HOB A;  5F04 A;  3OYM A;  1I1S A;  1NG7 A;  2FXA A;  5DUK A;  1MNE A;  1FOK A;  2EV0 A;  3KP7 A;  4RAY A;  1I6H J;  2IXS A;  2RV8 A;  1R36 A;  3EET A;  4I09 A;  4ZYA A;  4OD5 A;  4PXI A;  5FKL A;  2ZCN A;  4XLA A;  1WJB A;  4IQ4 A;  4PGG A;  2KMU A;  3A03 A;  2E1N A;  3UNG C;  4WWC A;  1KA8 A;  2FBI A;  2ZNY A;  2BW3 A;  2DFF A;  2QQA A;  1NG6 A;  2MC4 A;  2GEN A;  2Y75 A;  3G1O A;  1IRF A;  2KQR A;  1ZTR A;  4S04 A;  1R1T A;  3O8H A;  4DYC A;  1LVK A;  5BQT A;  3OL3 A;  1FEX A;  2FBQ A;  5ERI A;  3TBI A;  1PVE A;  2QCO A;  1VQ9 I;  3RCO A;  1K6Y A;  3VOD A;  4GFL A;  5BNG A;  3JSP A;  1X1P A;  3D0S A;  4HST A;  4IJA A;  2XDV A;  2FNA A;  3F8F A;  2ZKZ A;  3ZQI A;  1XDS A;  5F1J A;  2NX4 A;  3IRQ A;  3EUP A;  5DM7 F;  5EEG A;  4ZYG A;  1FOX A;  5C3E J;  2DXI A;  3J7A Y;  1TNS A;  5DD4 A;  3SYT A;  2KLO A;  2QWW A;  5H9T A;  1N25 A;  4KUM A;  1JHF A;  2DG7 A;  2H1L A;  4ME9 A;  2VQC A;  3KZY A;  3ZQF A;  1W7P D;  1HC8 A;  4IRG A;  1LFP A;  2HXI A;  4ON0 A;  3S2D J;  4AM3 A;  1WVR A;  3ABL H;  3AG2 H;  3NNR A;  3AG1 H;  1JI8 A;  4H0E A;  3REO A;  4C3I J;  1I27 A;  3FXJ A;  2Z1D A;  2XGD A;  2ZOZ A;  1BW6 A;  3WU2 C;  3CJR B;  1Z1D A;  2NS7 A;  2P5V A;  4BBR J;  5DS9 A;  3E7L A;  5EF6 A;  3EUK L;  1ZAO A;  3JRG A;  4OIR F;  1W36 C;  1DP7 P;  5IT9 Z;  4RAF A;  2FUG 2;  4Q47 A;  2STT A;  2FQ4 A;  2QZ8 A;  5HDN A;  2NVQ J;  1X1B A;  4N9I A;  2D2W A;  4AIH A;  1LEB A;  2HTJ A;  1YFH A;  1MBJ A;  3N97 A;  5FO5 A;  2R7O A;  1EV7 A;  1IXS B;  2DFI A;  1RET A;  4OWR B;  5GAD J;  3WTT C;  4LB5 A;  4A3L J;  1K61 A;  5EEH A;  4ENM A;  3DPJ A;  2E1M C;  2XPU A;  1BI1 A;  1XG1 A;  4FHT A;  2EIK H;  4C3H J;  3MFK A;  2A6H F;  2ACJ A;  4FX4 A;  4MO7 A;  4L0Y B;  1GV2 A;  2CV0 A;  3ZOB A;  2HFH A;  1QRY A;  4NB5 A;  2JSC A;  2EFO A;  3VYU B;  1QU3 A;  2RRE A;  3OYK A;  4ZDP A;  2EBI A;  5BPI A;  4IHX A;  2IJL A;  2QVO A;  3ANP A;  3KP6 A;  3VVY A;  2ZME B;  4A6D A;  2JK3 A;  4E7I A;  2X6W A;  3K69 A;  2HZD A;  4WIB A;  1RR8 C;  4GCV A;  5DYM A;  4OAY A;  1P7J A;  4PFO A;  5A2Q Z;  2HYF A;  1WWX A;  2VKE A;  1OLT A;  3B6C A;  1JJ6 C;  4I98 B;  2DU9 A;  1OCT C;  4GFK A;  3GFM A;  2WBM A;  2P6T A;  1HA8 A;  3E3V A;  5HLG A;  2DA2 A;  4GGG A;  2L02 A;  2DCE A;  3S1N J;  2L54 A;  3LWF A;  4LJZ F;  2F4O B;  3QU6 A;  3QOD A;  4RGU A;  2QM3 A;  1AKH B;  3WGG A;  2EFW A;  2VBZ A;  2VXZ A;  3V8J A;  3OOP A;  5K5Q A;  3OYB A;  1BN5 A;  2L7Z A;  3P7N A;  3K4K A;  1ETW A;  2PJR A;  3LWJ A;  4A93 J;  2VL8 A;  2W53 A;  4RGR A;  1TQM A;  3BC8 A;  2R7T A;  1HBX G;  4HNV A;  3DFG A;  4CA0 A;  4QWQ A;  2FJI 1;  2ZCM A;  2EIM H;  3ZQQ A;  5KAF C;  1UHW A;  3L2W A;  1W1W E;  2YX7 A;  4NQW A;  4KIS A;  3NRG A;  5E1Z B;  4BAC A;  1QBJ A;  3A2K A;  3DTE A;  1TTY A;  2UUZ A;  3MKY B;  5AQC A;  1ETY A;  1QVU A;  1Y56 A;  4RLF A;  1JT0 A;  1ZEL A;  4Y52 J;  3H35 A;  2F6C A;  5M5X J;  1A31 A;  4CSW A;  5IY5 H;  1PDN C;  1YIO A;  4JYK A;  3HTU A;  4XR6 A;  3GTQ J;  3IUO A;  2QTQ A;  4XK4 A;  3SFI A;  1OR7 A;  4RMN A;  3KYL A;  1VQK I;  3EGQ A;  3OL4 A;  1TLH B;  1X4P A;  4UDS A;  5D5U B;  1P4X A;  1YX5 A;  1O4X A;  4BY1 J;  3GWZ A;  2YVX A;  1XGO A;  2LK2 A;  4WF2 A;  3WTX C;  1E3P A;  4JK1 X;  4BJ5 C;  2QYO A;  2W84 A;  1U8R A;  2P7C B;  1Q1V A;  2K40 A;  1UZC A;  3GW2 A;  5LGU A;  2M8E A;  4KIB A;  2Q1Z B;  5GTH C;  1LDJ A;  3IKV A;  5FRM A;  3M7G A;  4A5N A;  3ZN1 A;  1DU6 A;  3CDI A;  4EVI A;  1S29 A;  4DJA A;  2ME6 A;  4A3K J;  1PUE E;  4RM2 A;  2AXL A;  4E7L A;  4S05 A;  3F8B A;  2NXN B;  2M8G X;  4A3J J;  1JKR C;  3CUQ C;  3OY9 A;  4ENN A;  2LR8 A;  2Z33 A;  1JT6 A;  2E1O A;  2COB A;  2FOW A;  1D1C A;  1AU7 A;  1S7E A;  4FIS A;  3K0L A;  1WJE A;  5E8G A;  3P9C A;  4BXF A;  2KDZ A;  4LFU A;  1XMK A;  2WA0 A;  4MXM A;  2YPR A;  1Y39 A;  1HCR A;  3OMY A;  4AUX A;  4RLQ A;  2OAZ A;  1S72 I;  2HS5 A;  3F72 A;  4W97 A;  3GTG J;  3OS0 A;  2O0Y A;  5IOY A;  1UJ8 A;  3C1D A;  3H3Z A;  3LSI A;  3ZMZ A;  2EA2 A;  1JE8 A;  3RQI A;  4CCL A;  3R61 A;  4HDV A;  4GO1 A;  1OIS A;  2K02 A;  1U8B A;  3W6J B;  4AID A;  1XPX A;  4DBR A;  1POG A;  4XL9 A;  3KNW A;  3H0D A;  2BY1 A;  2QLZ A;  4XN0 A;  3TMO A;  5J1U A;  2OTL I;  2V1X A;  3PM1 A;  4M3D A;  4IHT A;  2P0W A;  3F6O A;  4IHV A;  4DYQ A;  3K70 C;  3FWE A;  2R7Z J;  3KCC A;  2FBH A;  3R6S A;  4D9J A;  3B81 A;  4NC7 A;  3BRO A;  2NP3 A;  1RKT A;  3BWG A;  1IDY A;  2E1M B;  1STZ A;  2OZ6 A;  3F3X A;  1SD7 A;  4IHY A;  3CMM A;  2H8R A;  2IVM A;  4LG3 A;  5F27 A;  3EUH A;  2G7U A;  2EH3 A;  2JN6 A;  5HNH A;  1FP1 D;  3J80 Z;  1LE8 B;  2UXO A;  2YVH A;  3DKY A;  3VUQ A;  2Z16 A;  4BYY A;  3I64 A;  3Q0U A;  3VB2 A;  2HZT A;  1Y6I A;  4BS9 A;  3BCG A;  4QPQ A;  1YS7 A;  4OMY A;  4H4K C;  1FYL A;  3FKI J;  2RAS A;  4E6K G;  2JA5 J;  4IXA A;  3ON2 A;  5CJ9 A;  2IW5 A;  1WJA A;  2JWT A;  5DTD A;  1HDP A;  3QP6 A;  4I0B A;  3RZD J;  5BPD A;  2Q0O A;  2BY3 A;  1LVA A;  4MFE A;  2OUM A;  3DPT A;  1X3W B;  3E1S A;  2AXT C;  4WCG A;  4JX5 A;  2R5Z B;  3PUB A;  3BZC A;  1UG0 A;  2RQP A;  1W36 D;  1DPU A;  2CFO A;  3FIW A;  2YVE A;  3JRD A;  2DQR A;  1X2N A;  3VPR A;  1EF4 A;  4BNC A;  3O8G A;  2OQR A;  3OIP A;  1PYV A;  3ESW B;  2GXB A;  2DDA A;  2IS2 A;  2QUF A;  3DEW A;  3CDH A;  3IRR A;  5EJC A;  3K10 A;  3EPZ A;  2HTS A;  1KQ9 A;  3H36 A;  3HSR A;  2WUI A;  5LFA A;  2Z2S B;  3O6B B;  2CO5 A;  3N4M A;  2MG4 A;  4P9F A;  4RGS A;  3CES A;  3A02 A;  2YU3 A;  4JBA A;  1Z6T A;  3QYE A;  4HZF A;  2QQ8 A;  2VT3 A;  3I4N J;  2VJJ A;  4PK4 A;  2NS8 A;  3WGI A;  1RUN A;  3CJT B;  3LAP A;  1T33 A;  2EIN H;  3DU5 A;  3TO6 A;  4B44 A;  3SWH A;  3CO6 C;  1TW3 A;  1IUF A;  3NRV A;  3KLO A;  4M71 A;  3WU1 B;  3KZ9 A;  1WH5 A;  3M9A A;  1IZ1 A;  1MMG A;  2YX4 A;  1A6Q A;  2NNN A;  3GLL A;  3AG3 H;  2ZFU A;  4EEF G;  2CW8 A;  2M34 A;  5C4J J;  1S8N A;  4X6A J;  2E7X A;  2KKO A;  2VJ4 A;  3OYA A;  3KEO A;  4JOM A;  1Q1H A;  1G3W A;  2MBF A;  1XX5 A;  1VQ7 I;  3HZJ A;  2R0Q C;  5HOO A;  1W5T A;  3QU3 A;  2X6O A;  3ASN H;  4MEX F;  1OPC A;  4M3E A;  4V2G A;  4A3B J;  1OCR H;  4X1E A;  1BW5 A;  1Z9C A;  1U2W A;  2NVT J;  1XN7 A;  1IAW A;  5E8I A;  3A4C A;  3CLO A;  2KIS A;  1R5G A;  2CUZ A;  4JL3 A;  4D5C A;  1P6R A;  4BBS J;  1LB2 A;  3PJR A;  1FWZ A;  1WPK A;  1MDM A;  2DTR A;  1TL8 A;  4YIF A;  4A3I J;  3F23 A;  2ZSI B;  2NOJ B;  4BXX J;  1G2H A;  2ME0 A;  3RD3 A;  3G56 A;  1G3Y A;  2CQX A;  2E60 A;  4D1Q A;  2LG4 A;  5EFY A;  2GM4 A;  2DLL A;  2H27 A;  2VKV A;  4KMF A;  2QWT A;  2BZT A;  4AC0 A;  5DM6 F;  1S7O A;  4AVP A;  2UXU A;  4OIN F;  2DMT A;  2B63 J;  1LNW A;  1K7A A;  5M3M J;  5LGT A;  3ERM A;  2VI6 A;  5DCM A;  1YIJ I;  1IUY A;  1SFO J;  4CGR A;  4G9Y A;  1RES A;  3S3M A;  4BKX A;  2KZG A;  2E71 A;  3G6E I;  3G7R A;  4HKU A;  4BH9 A;  4GCL A;  3OSG A;  1YG2 A;  3V7S A;  2R5Y A;  1ON1 A;  1K6O A;  4CUG A;  3Q9V A;  3TW7 A;  5HS8 A;  1YS6 A;  4EV0 A;  1A36 A;  2IGK A;  4YII A;  3PIO F;  2DT5 A;  5LLQ A;  2XHK A;  3EDP A;  2JRM A;  3CUO A;  3TOB A;  2QSH X;  1YJN I;  4PSX A;  2Q24 A;  5HOD A;  1AKH A;  1YE9 A;  2WAQ A;  4E70 A;  2GA1 A;  5CW8 A;  3BG7 A;  2EK5 A;  1Z21 A;  3OR2 C;  1ZR2 A;  3BR6 A;  4A0X A;  2EWN A;  2JPB A;  5EZG A;  2I8D A;  3DLA A;  1W4M A;  3FXU A;  3M07 A;  1EH8 A;  1IO2 A;  2L0K A;  2M0C A;  3FF5 A;  1BJZ A;  2OV7 A;  4S0H B;  4U7B A;  4Z6Y A;  5IT3 A;  2Z5U A;  1HST A;  3I55 I;  1VI0 A;  2AHQ A;  3FDY A;  1SAU A;  2COM A;  2D45 A;  1FMV A;  2CFX A;  2JQ7 A;  3FXL A;  3RDI A;  3KPH A;  3PL8 A;  1F9N A;  3WTY C;  2XF6 A;  2UXH A;  3ANG A;  1R4M B;  2R7R A;  4HF2 A;  2A5Y B;  1MMD A;  5H20 A;  1AWC A;  4RS8 A;  1J7K A;  3PAS A;  3JSJ A;  5DAJ A;  3RH2 A;  3JRC A;  2GXG A;  3Q0V A;  1VQM I;  1ZYR F;  3OR1 C;  3AFH A;  3T8T A;  1I6X A;  1QA6 A;  2K27 A;  3IAS 2;  4B3A A;  4KN4 X;  3V7R A;  1QHH D;  4HYE A;  3DF8 A;  1MSE C;  5LHI A;  3H3V K;  3K70 D;  3T6N A;  3DXJ F;  1B8I A;  2OPT A;  4AVZ A;  1XDU A;  3HRT A;  3G4S I;  2OZU A;  1MGT A;  3S32 A;  3JAM Z;  2IA2 A;  4A12 A;  4XMY A;  5LHH A;  1HXD A;  5B1B H;  5BMZ A;  2HQ5 A;  3D5L A;  1RKW A;  1DP3 A;  2Q2E A;  3A0H C;  3OYG A;  3RKW A;  2DT7 B;  3CZ6 A;  1ZK8 A;  5KNL A;  3J81 Z;  1X3U A;  2EV5 A;  2ZBK A;  5J1Y A;  2NOG A;  4E7Z A;  1MBK A;  2LD5 A;  2GOM A;  2F5V A;  2E35 A;  1Y1W J;  1TQP A;  2QF7 A;  3LFK A;  1MNM C;  2L9V A;  2KT0 A;  4XOP A;  2MLK A;  5FLV A;  1B9N A;  3DPL C;  5E18 F;  3K9T A;  1V55 H;  2VC0 A;  2ECB A;  1D5Y A;  2L4A A;  2K5C A;  2XV4 S;  2ZO4 A;  5EEA A;  4LG0 B;  1CGP A;  2JA6 J;  1JJ8 C;  1I50 J;  3E5X A;  3LFU A;  2UV1 A;  1KU3 A;  2I10 A;  3SZG A;  4AU7 A;  3ABT A;  1D8K A;  1WJ5 A;  2MYS A;  1X3Z B;  1W0U A;  5FGM A;  4J01 A;  2DPD A;  4IOA F;  3LSH A;  3G71 I;  3HPH A;  5DV5 A;  4CIC A;  3O60 A;  3PQK A;  2X51 A;  3HSE A;  2HOA A;  1QO0 D;  3KZI C;  1SD4 A;  4FTH A;  2R93 J;  5LD2 C;  3U9G A;  1WCM J;  4IF4 A;  2EFN A;  4LIU A;  2A68 F;  1B59 A;  5EGO B;  2XPW A;  2QGU A;  3CTA A;  3OIQ A;  4LD5 A;  2M1B A;  4HPQ A;  1TWG J;  3VYS B;  1KYZ A;  2WY8 Q;  5JHU A;  2NNY A;  3AAF A;  5K5R A;  4F3Q A;  2CQ7 A;  4ZC3 A;  4CYC B;  4BQO A;  1REP C;  4I0A A;  4C2M J;  2ELJ A;  5FKM A;  1RRJ A;  4D7N A;  3DTK A;  3QP5 A;  2UZK A;  1N75 A;  1XCV A;  4O3M A;  2KHM A;  4MNU A;  1UMQ A;  1V3F A;  1A35 A;  4I99 C;  2RKH A;  4UUS A;  2PLY A;  2CJJ A;  1IG7 A;  4PJM A;  3VVZ A;  3CCY A;  3K4J A;  1BBY A;  1V5G A;  2LFB A;  2IA1 A;  1ETO A;  2GXA A;  3QOP A;  3GEU A;  1KQ0 A;  1O7L A;  2EJR A;  2F5D A;  3KP2 A;  2NVU B;  4IRI A;  4LIV A;  3NS4 A;  2XAQ A;  5L3D A;  2LKS A;  2VXD A;  2WV0 A;  4HQE A;  2XAJ A;  2VC1 A;  5FB2 A;  3ZMV A;  3DEU A;  4ETS A;  3V4G A;  1W0T A;  2V57 A;  4ABZ A;  1JGG A;  4HNU A;  3ZQ7 A;  1WQ2 A;  3HHG A;  2HVR A;  4PFP A;  2YSR A;  1B4A A;  2BVM A;  4K2E A;  1T08 B;  3VTI A;  4GYI A;  1X1A A;  3TL4 X;  2DT6 A;  2FRH A;  2CUE A;  3MVP A;  3NI7 A;  2CH0 A;  2Z99 A;  1EKE A;  2RVC A;  5DCF A;  1TZL A;  3CCS I;  3I4M J;  3BTJ A;  1BC7 C;  2H6C A;  1HOM A;  2LDU A;  2WB1 N;  4PJJ A;  4G8X A;  2IPQ X;  3BZK A;  3K4M A;  1NK3 P;  4EJV A;  1XMA A;  3JTG A;  1FZP B;  2Y69 H;  2V9P A;  3KFW X;  4XOT A;  3FMQ A;  4IHW A;  1U5T C;  1XS9 A;  1FBS A;  2L9R A;  4GRI A;  4L5E A;  1K78 B;  3T0Y A;  4RBO A;  4HBL A;  2HOT A;  5LRS A;  3BTC A;  3LSP A;  1ZRD A;  4U88 A;  3BHQ A;  1SFE A;  2XF5 A;  3QPT A;  4LGW A;  3LQQ A;  2AQF A;  5CVR A;  1GUU A;  2B1E A;  1XB4 A;  1PUF B;  3KP4 A;  1HKT A;  3B73 A;  3BJO A;  3ZGK A;  1RC9 A;  3LA7 A;  4BQN A;  2O8X A;  1B72 A;  4EJT A;  1LUJ B;  4F93 B;  2BHZ A; 
#chains in the Genus database with same CATH homology
 3EGQ A;  1RPW A;  2DJN A;  3HOY J;  4UDS A;  1O4X A;  2LP0 A;  4BY1 J;  2LK2 A;  1CQT A;  5EG0 B;  2M2E A;  4B4C A;  1HLV A;  1Q1V A;  2K40 A;  3OOU A;  2DTZ A;  1JTX A;  4JP0 A;  2E2H J;  3LSR A;  2DN0 A;  2X48 A;  3PPB A;  3TW6 A;  1DU6 A;  1K83 J;  2N8G A;  2Y9Z A;  2CU7 A;  1YRN B;  4FCY A;  3GTK J;  3QPS A;  1MBG A;  2OF7 A;  3BTL A;  2ME6 A;  5K7F A;  5J1R A;  2TCT A;  1Z0X A;  4AYB N;  3JRA A;  4A3K J;  1B72 B;  3KKD A;  5FHP A;  4NEL A;  4FE7 A;  3GTJ J;  2CQQ A;  1P7I A;  2ZOY A;  2M8G X;  2Y30 A;  4MFD A;  2FD5 A;  4Y7N J;  4A3J J;  1JKR C;  2E2I J;  3LSJ A;  4AF5 A;  2LR8 A;  2G7L A;  1JT6 A;  1I3Q J;  2E1O A;  2WAQ N;  4M3F A;  5C4Y A;  2COB A;  1AU7 A;  1S7E A;  4FIS A;  3JRB A;  5EZH A;  4FE4 A;  3GTO J;  3M3Y J;  3ZQL A;  2KDZ A;  2LVS A;  3GTM J;  4L62 A;  1OCP A;  2CRG A;  3PO3 J;  1TC3 C;  4MXM A;  1HCR A;  1UHS A;  4AUX A;  1VFC A;  1ETQ A;  1JUP A;  4W97 A;  2G0E A;  3GTG J;  5IOY A;  3HEF A;  2GUH A;  3AQS A;  3SJM A;  1IV6 A;  3D1N I;  3M4O J;  4DYR A;  3RQI A;  3S1Q J;  3HGG A;  3BR0 A;  1Y1V J;  1WH7 A;  3V6G A;  3W6V A;  3GZI A;  1LFB A;  1U8B A;  3BRU A;  1POG A;  4D7M A;  3KNW A;  3HM5 A;  2HI3 A;  2JA8 J;  4B1R A;  5J1U A;  1LE8 A;  2DA5 A;  1FJL A;  3PM1 A;  4M3D A;  1GV5 A;  4IHV A;  3HE0 A;  3JRI A;  4DYQ A;  3JRH A;  5FJ8 J;  1IGN A;  1MH4 A;  2R7Z J;  3HTH A;  3ZQC A;  1IRZ A;  3B81 A;  3Q0W A;  2NP3 A;  1GDT A;  1RKT A;  3QPL A;  2EZK A;  1IDY A;  3BT9 A;  4UUT A;  2X9D A;  4IHY A;  1OFC X;  3HGY A;  1ENH A;  5F0C A;  2H8R A;  4I6Z A;  1TWC J;  5F27 A;  3ZQG A;  3S1R J;  2EH3 A;  2JN6 A;  3S1M J;  5IYD J;  1R9T J;  2ID3 A;  1LE8 B;  2UXO A;  2YVH A;  4RDU A;  5FGL A;  3F0C A;  2M9H A;  3VUQ A;  2R5Z A;  3K2A A;  4NDL A;  4J19 A;  3Q0U A;  2E19 A;  2EZL A;  3GTL J;  1ITY A;  2IBD A;  3BQZ A;  2FX0 A;  3K7A J;  3BCG A;  3GTP J;  4GFB A;  4GCT A;  3LOC A;  3FKI J;  2RAS A;  2Y2Z A;  2JA5 J;  3IV5 A;  3PO2 J;  5DTD A;  2JWT A;  2FJ1 A;  1HDP A;  1U9N A;  3RZD J;  1HDD C;  4JKZ A;  4MFE A;  2DA7 A;  3F1B A;  4XRS G;  4JX5 A;  5F0H A;  1X58 A;  1JTY A;  2R5Z B;  3A01 A;  2D5V A;  3BNI A;  5JLX A;  2LKX A;  2DMQ A;  2DMP A;  3BR5 A;  2QIB A;  3FIW A;  1VND A;  5C4X J;  3IH4 A;  2YVE A;  3JRD A;  3LHQ A;  2XDN A;  5CXG A;  3BR2 A;  1X2N A;  2DMU A;  3VPR A;  1MBH A;  3TP0 A;  1EF4 A;  5HSZ A;  5F08 A;  3CQZ J;  3UKG A;  4A3C J;  2JMW A;  3O8G A;  1WGX A;  2OI8 A;  1NTC A;  3DEW A;  1JKQ C;  1NK2 P;  3VW1 A;  1ZQ3 P;  3HIM A;  4QIW N;  2WUI A;  2WV1 A;  3A01 B;  2MG4 A;  5D19 A;  1ETK A;  3A02 A;  4JX4 A;  2E2J J;  2UXP A;  5IP7 J;  3VW2 A;  3HBL A;  2REK A;  1WI3 A;  1A5J A;  3I4N J;  3G1M A;  2MSY A;  3JRF A;  2NS8 A;  5GPC A;  3CMY A;  2YU9 J;  1T33 A;  3COL A;  3S2H J;  1IUF A;  1TWA J;  3KZ9 A;  1MBF A;  1WH5 A;  1TWH J;  2JJ7 A;  3GBG A;  2CUF A;  2DA3 A;  2GBY A;  3HOW J;  2OER A;  3AQT A;  2XRL A;  4EEF G;  3S17 J;  2PBX A;  1SAN A;  2M34 A;  4JX6 A;  5C4J J;  4X6A J;  1IDZ A;  1E3O C;  3VP5 A;  1JKP C;  2XGE A;  5J3L A;  5IYB J;  1FTZ A;  3HOV J;  4M3G A;  2R0Q C;  2ZB9 A;  2H1K A;  2X6O A;  3B6A A;  3FIS A;  2LTP A;  4M3E A;  4V2G A;  1QPI A;  3RZO J;  2F07 A;  3QBM A;  4A3B J;  3FK6 A;  2O7O A;  5E3L A;  4X1E A;  3HOU J;  1BW5 A;  1VF9 A;  2IAI A;  2UXI A;  2NVT J;  3HB9 A;  2R92 J;  3HTJ A;  3IH2 A;  5GPA A;  1ZGW A;  3P9T A;  1MBE A;  4JL3 A;  2IU5 A;  4ACI A;  4D5C A;  4DZJ A;  5K7H A;  2G7G A;  2EQR A;  1U78 A;  1AHD P;  4G12 A;  1RR7 A;  4BBS J;  1DU0 A;  1WPK A;  3BG5 A;  2DMN A;  4A3I J;  1JUM A;  1X2M A;  3S16 J;  2VUM J;  3BR3 A;  5EYR A;  4BXX J;  3E7Q A;  3JR9 A;  2ME0 A;  1G2H A;  3G56 A;  3RD3 A;  2CQX A;  5M5W J;  4A3M J;  5EFY A;  1A6I A;  2GM4 A;  2K9Q A;  2RAE A;  5FKO A;  2O9L A;  3H0G J;  3HTA A;  2IEK A;  2P81 A;  2VKV A;  4A3D J;  2QWT A;  4AC0 A;  3S5R A;  5IP6 A;  5F0F A;  2UXU A;  2DMT A;  2W48 A;  2B63 J;  5M3M J;  4DW6 A;  2VI6 A;  5K58 A;  4AC6 A;  3HTI A;  1SFO J;  4CGR A;  1RES A;  3RKQ A;  1MSF C;  3HOZ J;  4BKX A;  2HDD A;  5IP9 J;  2GLO A;  9ANT A;  3G7R A;  3G1L A;  4M6V A;  2GFN A;  4HKU A;  2LY9 A;  1BA5 A;  4GCL A;  3OSG A;  5EDN A;  3L1P A;  1XC5 A;  2MW8 A;  1ORK A;  4C3J J;  1IJW C;  2R5Y A;  3FRQ A;  3BJB A;  2G7S A;  2JA7 J;  1APL C;  3S15 J;  3TW7 A;  1UI5 A;  2RHA A;  2Q24 A;  5HOD A;  1AKH A;  2QKO A;  5JLW A;  3BG3 A;  5CW8 A;  2EZH A;  3VVX A;  1ZR2 A;  3BR6 A;  2K9N A;  1UG2 A;  3MKL A;  5EZG A;  3HDD A;  3HKZ N;  5E3N A;  1F43 A;  1JUS A;  1Z77 A;  4BY7 J;  2L7M P;  2R5Y B;  3CWR A;  3VOX A;  2L0K A;  2M0C A;  1BJZ A;  3NPI A;  4S0H B;  3NAU A;  3IH3 A;  3BQY A;  2K9S A;  3ON2 A;  2ID6 A;  1QVT A;  2XB5 A;  1VI0 A;  2AHQ A;  5F04 A;  4A3E J;  5IOZ A;  3KKC A;  3OIO A;  2XSD C;  1I6H J;  4PXI A;  2XPV A;  3BR1 A;  3VW0 A;  2UXH A;  5FKL A;  2ZCN A;  3ANG A;  4NN1 A;  1GVD A;  3A03 A;  5IPA A;  5K7Z A;  4MK6 A;  3DCF A;  2XB0 X;  3PAS A;  2GEN A;  2O7T A;  3JSJ A;  4KWA A;  3G1O A;  4A69 C;  5DAJ A;  3RH2 A;  3JRC A;  4XIC A;  3Q0V A;  4M3B A;  1ZTR A;  3C2B A;  3O8H A;  4DYC A;  4B3A A;  2DA1 A;  1T56 A;  2D6Y A;  5FMP A;  2HYJ A;  3VOK A;  4V2F A;  1FEX A;  2FBQ A;  4W1U A;  1MSE C;  2QCO A;  3H3V K;  3TED A;  3T6N A;  4GFL A;  1MH3 A;  1B8I A;  5BNG A;  2OPT A;  5FLM J;  3V78 A;  1ZR4 A;  1HF0 A;  3ZQI A;  2LLK A;  4I76 A;  5F1J A;  3CDL A;  2NX4 A;  3EUP A;  1BL0 A;  5C3E J;  2HQ5 A;  4D5F A;  1U9O A;  1RKW A;  2YS9 A;  1ZK8 A;  4ICH A;  5J1Y A;  2NOG A;  5E3M A;  3MNL A;  1MBK A;  2LD5 A;  3CJD A;  5H9T A;  2NVY J;  4JNN A;  2WGB A;  1Y1W J;  2DG7 A;  4QTR A;  2QF7 A;  4ME9 A;  1B8I B;  1MNM C;  2KT0 A;  3ZQF A;  2EZI A;  2HXI A;  5FLV A;  3S2D J;  3NNR A;  2ECB A;  1D5Y A;  2Y31 A;  5EGO A;  1GT0 C;  4C3I J;  5EEA A;  5FKN A;  1ETX A;  2G3B A;  2JA6 J;  2XGD A;  2ZCX A;  2ZOZ A;  1BW6 A;  1JJ8 C;  1I50 J;  4XID A;  2I10 A;  3LNQ A;  2NS7 A;  4BBR J;  5DS9 A;  1W0U A;  4CYC A;  3E7L A;  5EF6 A;  3LSG A;  3S14 J;  3JRG A;  4DZP A;  3TP3 A;  3O60 A;  2HOA A;  2R93 J;  4FTH A;  2VPR A;  2FQ4 A;  2NVQ J;  3NXC A;  1WCM J;  3MN2 A;  1FIP A;  5EGO B;  2XPW A;  4MLO A;  4QSH A;  1TWG J;  1MBJ A;  2HKU A;  5HBU A;  4CYC B;  1SGM A;  4YZE A;  4A3L J;  1RET A;  3BG9 A;  3LJL A;  3ZQH A;  1K61 A;  3DPJ A;  4C2M J;  5GP9 A;  5FKM A;  4D7N A;  1ETV A;  2XPU A;  1XG1 A;  2DA4 A;  4C3H J;  1UMQ A;  4MO7 A;  1GV2 A;  4UUS A;  3ZOB A;  2CJJ A;  5FKK A;  1IG7 A;  4GCK A;  1QRY A;  1H89 C;  3VVZ A;  3CCY A;  1TWF J;  2LFB A;  1ETO A;  2EBI A;  3GEU A;  4A3F J;  2NVX J;  4IHX A;  2O8K A;  2Y9Y A;  3ON4 A;  3ANP A;  3VVY A;  3FK7 A;  3CRJ A;  2JK3 A;  2ECC A;  1IC8 A;  2HOS A;  3WHB A;  1P7J A;  2NP5 A;  2VKE A;  3OSF A;  5D1R A;  1LFU P;  3B6C A;  4IEJ A;  2MGQ A;  1JJ6 C;  4XRS A;  4UUS B;  5D18 A;  1W0T A;  2V57 A;  2XGC A;  4ABZ A;  1OCT C;  1JGG A;  2ELK A;  2TRT A;  4GFK A;  3C07 A;  1H8A C;  2DA2 A;  3Q3S A;  2DG8 A;  3S1N J;  2YUS A;  2HXO A;  3WHC A;  5C44 J;  2AO9 A;  3HOX J;  2DA6 A;  1AKH B;  3MVP A;  2CUE A;  3NI7 A;  1FTT A;  2HYT A;  2L7Z A;  3I4M J;  3BTJ A;  1ETW A;  4LOC A;  3LWJ A;  1OJL A;  4A93 J;  1HOM A;  2WB1 N;  2W53 A;  3QQA A;  3BTI A;  2PZ9 A;  1NK3 P;  2Y0S N;  4HNV A;  5M3F J;  1PUF A;  4XRM A;  2ZCM A;  3JRE A;  4A3G J;  3IUV A;  3NRG A;  1UI6 A;  5HAW A;  4IHW A;  1XS9 A;  2L7F P;  2QOP A;  2L9R A;  3NAR A;  1F36 A;  1FIA A;  3SDG A;  1ZKG A;  4L5E A;  4RBO A;  5AQC A;  2HOT A;  1ETY A;  3QKX A;  1JKO C;  1QVU A;  3BTC A;  5EG0 A;  3LSP A;  3BHQ A;  1JT0 A;  1GUU A;  4Y52 J;  5E3O A;  5M5X J;  1PUF B;  1YRN A;  4JYK A;  5M5Y J;  3GTQ J;  1B72 A;  5IYC J;  1H88 C;  2QTQ A;  4XK4 A;  3SFI A;  4MIM A;  3VIB A;  5CXI A;  2PMZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...