2IEKA

New crystal form of transcriptional regulator tm1030 from thermotoga maritima
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
199
structure length
199
Chain Sequence
b'LSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title New crystal form of transcriptional regulator tm1030 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 70
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2iekA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2iekA02
2NVQJ 3GEUA 1K83J 3OIOA 5F27A 5FKMA 4QIWN 3COLA 3VVYA 2R7ZJ 3OSFA 3NI7A 3A01B 4A3IJ 2K9SA 2ME6A 2Y30A 4DYQA 1ETOA 3HIMA 1TWAJ 4B4CA 2X48A 4UDSA 3HTHA 1VFCA 4IHVA 2ZB9A 4KWAA 3VVZA 3EGQA 2HXIA 4MXMA 4A93J 1EF4A 1HLVA 3BQZA 5IP9J 4C3HJ 2GM4A 2K40A 3IUVA 3CMYA 2I10A 2GLOA 3WHCA 1VI0A 3G1OA 5EGOA 3NNRA 4NELA 2R5ZB 2FX0A 1IJWC 2XSDC 1ENHA 2G7GA 1Z77A 2LLKA 1MBFA 2DA6A 1GDTA 4B1RA 3GTMJ 4MK6A 4D7MA 3ON2A 4JX6A 4DW6A 4V2GA 3A01A 5D18A 3B6CA 1H88C 2O9LA 3BR0A 4AC6A 3ZQFA 2KT0A 3GZIA 2RHAA 2QF7A 2HKUA 1JUPA 5IP6A 2P81A 4DYRA 2QIBA 1BJZA 5K58A 2HI3A 1ETYA 2HYTA 2CJJA 2HOSA 2ME0A 2DA3A 5E3NA 3S17J 3LSRA 3V6GA 4AF5A 2R5ZA 3HB9A 2JA8J 1WGXA 4XRSA 2HXOA 5EEAA 3DPJA 1DU0A 3E7QA 4BBSJ 3VIBA 2HOAA 4BXXJ 4A3CJ 2HDDA 3F0CA 3FISA 4MFEA 3LOCA 2DMUA 5M5WJ 2DMPA 2TCTA 3MVPA 1HF0A 2V57A 1QRYA 3HDDA 1MH3A 2ZOYA 1ETVA 1RPWA 2MGQA 1MBGA 4GFBA 1QVTA 2GENA 3PPBA 1FIAA 5HODA 3CRJA 5FHPA 3LWJA 1GVDA 1RKTA 3DEWA 1FTZA 3HGYA 4DZJA 5M5XJ 5CW8A 4X6AJ 3NPIA 4DZPA 3NXCA 1U9OA 2FD5A 2VKEA 3Q0UA 4A3GJ 5EG0B 2DN0A 1LE8B 2OI8A 3SFIA 3DCFA 3H3VK 5IOZA 2G3BA 2B63J 3RKQA 3ANPA 5CXGA 3Q3SA 1TC3C 1MBHA 4C2MJ 3Q0VA 4JYKA 3BNIA 3VW2A 2GFNA 2XGDA 2ECBA 3AQSA 1P7JA 1H89C 1ETKA 5FKKA 4D5FA 1JTXA 1XC5A 3BT9A 3HKZN 2DG8A 5EZHA 2XPWA 3ON4A 3VW0A 1CQTA 2WB1N 2DA4A 2E1OA 2OF7A 2LR8A 5DTDA 2R92J 2KDZA 4JX5A 1FIPA 4AYBN 1MBJA 2EQRA 2LFBA 2H8RA 2IBDA 1JTYA 1FTTA 2UXUA 1H8AC 3LHQA 1IGNA 1WH5A 3QQAA 5EG0A 1LE8A 1ETQA 1ZKGA 3UKGA 4RDUA 1P7IA 5BNGA 4C3IJ 5FKNA 3CCYA 1VF9A 2L7ZA 3D1NI 1OJLA 5IPAA 3HOZJ 4M3BA 3B6AA 1O4XA 2DG7A 4XICA 5HSZA 2NS7A 2K9QA 2NOGA 2M0CA 1QVUA 4A3DJ 3HOWJ 5C44J 4V2FA 4M3FA 3H0GJ 4EEFG 3AQTA 5C4YA 3S1NJ 2R0QC 2ZCNA 1IDYA 3HOVJ 1F36A 3TW7A 3K7AJ 1JUMA 2UXIA 1Y1WJ 3MKLA 4AUXA 1MSFC 2EZHA 1Y1VJ 2M2EA 3I4NJ 3L1PA 5JLXA 1F43A 1FJLA 3JSJA 2DMQA 2E19A 3O8GA 3KKCA 3JREA 1SANA 3GTKJ 5CXIA 4JX4A 5J3LA 2QOPA 4JNNA 4AC0A 2YVEA 3QPSA 1UI5A 3Q0WA 2NX4A 5EFYA 2FJ1A 3BR6A 3TW6A 4L62A 5DS9A 3KNWA 1WCMJ 2M9HA 4BBRJ 3LNQA 4GFKA 5JLWA 3HM5A 3BCGA 2TRTA 4C3JJ 2OERA 3M4OJ 5IOYA 1ZR4A 5K7ZA 3BTLA 1UHSA 4A3MJ 2JA5J 2DTZA 4JP0A 4W1UA 2EZKA 2XPUA 2Y9YA 5D19A 4M3EA 2NVXJ 5F0CA 2G7SA 3TP3A 5FLMJ 2DJNA 2JJ7A 4XK4A 5M5YJ 5FGLA 4X1EA 4IHWA 3BG5A 3NAUA 5J1UA 1B72B 2LD5A 4MFDA 3BR1A 9ANTA 4YZEA 3ZQLA 2MG4A 1HCRA 3F1BA 3CQZJ 1TWFJ 2M34A 1JKQC 3FIWA 4BY1J 2Y2ZA 5IYDJ 4JL3A 2JN6A 3HTJA 2H1KA 5F1JA 4LOCA 4XRSG 3BR2A 2LVSA 1JT0A 3BG9A 3HEFA 3OSGA 3EUPA 4GCTA 1JJ6C 1BW5A 3RD3A 2NS8A 1POGA 4HNVA 1TWGJ 3RZOJ 1IC8A 2CRGA 4S0HB 3IH3A 5EZGA 3CWRA 3ZQIA 3T6NA 1RR7A 3KZ9A 4FE7A 2LTPA 5C4JJ 4A3JJ 1B72A 3BG3A 3ZOBA 1HOMA 2PMZN 2QTQA 3VPRA 1ITYA 2WV1A 1YRNB 5FLVA 1AHDP 4L5EA 1U8BA 3M3YJ 3PM1A 2PZ9A 3VUQA 4MO7A 5E3LA 5E3OA 1GT0C 3PO2J 4IHXA 2EZLA 3GTPJ 4HKUA 2DA7A 3JRDA 2IEKA 1X2NA 1SFOJ 2WGBA 1AU7A 1AKHB 1ETXA 4M6VA 1E3OC 1XS9A 1OCPA 4BKXA 5DAJA 2JA6J 2COBA 3JRGA 3GTOJ 2CQQA 2R5YB 3GTQJ 1ZR2A 1BA5A 2RASA 4QSHA 2UXHA 3BQYA 3E7LA 3TEDA 2QWTA 1NK3P 2W53A 2MW8A 5AQCA 2EBIA 1JUSA 2QKOA 2VUMJ 1OFCX 4XIDA 4BY7J 5IYCJ 1X2MA 2LY9A 3ANGA 3W6VA 5FKOA 3S15J 4CYCB 1NTCA 2R93J 3VOXA 1YRNA 3JRHA 1TWHJ 1IG7A 2UXPA 3JRIA 3BR3A 3HGGA 1JKRC 1S7EA 2L0KA 4FE4A 3B81A 2HYJA 3ZQCA 3O60A 5J1YA 2NVYJ 3BHQA 3S1QJ 3CJDA 1AKHA 2YVHA 3G7RA 2NP5A 2IAIA 1GV5A 4FISA 5GPAA 3JRAA 1BW6A 3MN2A 1FEXA 2R5YA 3QPLA 4IHYA 3HBLA 1IDZA 2O7TA 1ZK8A 2G7LA 2EZIA 2L7FP 1JKPC 3RH2A 1MH4A 3OOUA 5GP9A 2E2HJ 3BRUA 1RETA 1IRZA 2CU7A 2QCOA 2GUHA 4A3EJ 2WAQN 3MNLA 3V78A 1WPKA 2CUEA 4B3AA 4CYCA 1UG2A 1ZGWA 4I76A 2O7OA 4UUTA 5EF6A 3LJLA 3FKIJ 1IV6A 3VVXA 4NDLA 1WH7A 3CDLA 2W48A 2NVTJ 3BTJA 1JT6A 3S14J 3HOXJ 1B8IB 2OPTA 3NARA 3ZQGA 2REKA 5IYBJ 2GBYA 2XGCA 3GTJJ 1K61A 3SDGA 3FRQA 5HBUA 2XRLA 2EH3A 3QBMA 2ID3A 4ICHA 5EDNA 2MSYA 2AHQA 4I6ZA 5C3EJ 2Q24A 2YUSA 3ZQHA 5HAWA 1X58A 4FTHA 1W0UA 3BJBA 4MIMA 1UMQA 4D7NA 1HDPA 1ORKA 5FJ8J 3PASA 1BL0A 4GCKA 4D5CA 4JKZA 3S1MJ 2LKXA 5E3MA 5F0HA 5K7HA 3G1LA 2NP3A 5K7FA 3IV5A 3JRCA 1B8IA 2HOTA 4CGRA 2L7MP 5F04A 1T56A 1I3QJ 2JA7J 2CQXA 1DU6A 3S5RA 2AO9A 3I4MJ 3O8HA 1VNDA 1R9TJ 1A5JA 2O8KA 4G12A 4RBOA 3C2BA 1TWCJ 3HTAA 4A3KJ 3K2AA 2CUFA 1HDDC 2XDNA 2XB0X 3LSGA 1W0TA 3LSPA 1LFUP 2D6YA 5M3MJ 1U78A 3GBGA 2LP0A 1JKOC 4A3LJ 3HTIA 2Y0SN 3HOUJ 3S1RJ 3HE0A 2D5VA 2XPVA 4ABZA 3GTLJ 3C07A 5F08A 2G0EA 2L9RA 2XB5A 2DA1A 2X9DA 2PBXA 2YU9J 3RQIA 2N8GA 4ACIA 2ECCA 2ID6A 1PUFB 3LSJA 4FCYA 5H9TA 1I50J 1T33A 3BTIA 4NN1A 3S2HJ 3BR5A 1RESA 3PO3J 2FBQA 1U9NA 2VI6A 1D5YA 2IU5A 3P9TA 1GV2A 1A6IA 1UI6A 3JRBA 4XRMA 2JMWA 1XG1A 1G2HA 2JK3A 4UUSB 1GUUA 5F0FA 3A03A 3IH4A 3FK6A 4PXIA 1ZQ3P 2XGEA 3TP0A 4DYCA 5D1RA 2LK2A 1MNMC 1Q1VA 2K9NA 5EYRA 1RKWA 1QPIA 3G1MA 4Y7NJ 2HQ5A 1JGGA 2DMTA 2YS9A 3GTGJ 5M3FJ 1Z0XA 5FKLA 4Y52J 1PUFA 3S2DJ 1ZTRA 2RAEA 4ME9A 1JJ8C 1MBKA 2F07A 2E2JJ 3VP5A 1APLC 3A02A 4M3DA 1NK2P 3BTCA 2WUIA 1OCTC 3JRFA 3HOYJ 4M3GA 3QKXA 4QTRA 2DA5A 1ETWA 3IH2A 5J1RA 2Y31A 3NRGA 2Y9ZA 4GFLA 5FMPA 4UUSA 2ELKA 4GCLA 3JR9A 1IUFA 2M8GX 3KKDA 2X6OA 4W97A 3G56A 3VOKA 1LFBA 4J19A 2UXOA 5GPCA 4IEJA 3SJMA 4A69C 2ZCMA 2ZCXA 2DMNA 2ZOZA 1WI3A 1MSEC 5IP7J 2FQ4A 2DA2A 4A3BJ 1I6HJ 3RZDJ 3VW1A 5EGOB 5C4XJ 4A3FJ 2E2IJ 3S16J 4MLOA 2VKVA 3WHBA 2VPRA 3FK7A 1MBEA 1SGMA 2JWTA
chains in the Genus database with same CATH superfamily
4UUVA 4I09A 3OIOA 3QOPA 4QIWN 2R7XA 3NI7A 3A01B 2V9PA 3S3MA 2YPRA 4HG2A 2ME6A 4IRGA 3H3UA 1BC8C 1FP1D 1ETOA 3HIMA 1MMAA 4B4CA 4PCQA 2X48A 4UDSA 4S05A 3SWHA 2BHYA 1QZEA 1R5GA 4LJZF 2ZB9A 1KU3A 3VVZA 4HF0A 3MWMA 3ERED 1J2XA 4U7DA 4Y3OA 4MXMA 4A93J 2VC1A 3GFIA 4S04A 1IXCA 4AVZA 3TMOA 3K1MA 3PL8A 4HAMA 3E6BA 3NNRA 1S9HA 1X1DA 2WBMA 1IJWC 2L3DA 3W2AA 2QYOA 3GZ5A 2XSDC 1ZREA 2F4MB 3ZMSA 1ENHA 2ZMEA 1Z21A 4MK6A 3AG4H 3ON2A 3PIOF 3LQRA 4OAYA 4XL9A 4DW6A 3I5UA 2VBZA 1RZ4A 2RVCA 5D18A 5FB2A 3VEPA 1SFXA 2KT0A 3GZIA 1KONA 1FPQA 2OTJI 1IN5A 4DYRA 1BJZA 3CLQA 4MTEA 1ETYA 4D0PA 1QZYA 2KZGA 3FX3A 4MQVA 2BBYA 1I1GA 2AXTC 3S17J 2VL8A 3HB9A 4U0WA 2GXBA 4XRSA 1J5YA 2HXOA 1P6RA 1TQMA 1RNLA 4QWQA 1HA8A 1TNSA 2PMHA 4MFEA 3LOCA 2V57A 1Z1DA 4HNTA 1LEBA 4A2UA 1MW7A 4HW0A 1MH3A 1Z3YA 2MGQA 1MBGA 1QVTA 4IOAF 2GENA 2JPBA 2RNGA 4XOPA 1B6AA 1HKTA 2W1OA 2VJ4A 4LIVA 4PJJA 3DEWA 3BOQA 4ENKA 3AG3H 3I56I 2Z5UA 3CTAA 4ZYGA 2M5WA 2BYVE 3NXCA 3Q0UA 1LE8B 4RM3A 2G3BA 4CO8A 1XCBA 2B63J 3LSKA 3KP2A 4F55A 5CXGA 3IRQA 1MBHA 2E7XA 2LMDA 4JYKA 1ZHFA 3QYEA 5TISC 3VW2A 4PFOA 3JTHA 4GYIA 2ECBA 4BJ5C 3AQSA 2LREA 5DCMA 1OMIA 3K4NA 4B44A 2CW0F 4K2EA 2HZTA 2HYGD 3KFWX 5HS9A 2A3SA 2XPWA 3ON4A 2X6XA 2OU2A 3R4KA 1CQTA 5DV5A 2DA4A 2YX4A 5ICFA 4X0GA 5DTDA 4OIQF 5E8GA 5JVTA 1FIPA 1KQ8A 4BACA 1JTYA 3MKZA 1PP8F 1H8AC 2VASA 3D5SC 4N0BA 2IS1A 2CSOA 2LG4A 2P5KA 4ZDPA 2DQRA 3IAS2 2DYSH 1ZYRF 5BNGA 1VF9A 2V79A 3I53A 2L7ZA 4ZC3A 3HOZJ 3WGIA 3HHGA 3K70C 2DG7A 4IF4A 3WGGA 3E6CC 1T8IA 2HTJA 3V8LA 2E60A 2O3FA 2M0CA 2B9SA 1JHFA 4HQEA 4A3DJ 3WTSC 3HRTA 4EEFG 3AQTA 4LLLA 1BC7C 1VQNI 2FF4A 2ZCNA 1XCVA 2R0QC 4MEXF 1X1AA 1A6QA 2ZXWH 3J80Z 3NQOA 2LBFA 4KMFA 5CPRB 3DP7A 1Y0NA 2KIMA 4ZJZA 2WY7Q 2UXIA 1Y1WJ 1ULYA 2DT6A 3MKLA 1TQIA 1MSFC 1Y1VJ 2XAQA 2P6TA 3BPXA 3GZ6A 1FJLA 2DMQA 1S7AA 1YI2I 4OMYA 2E19A 3QU3A 2LY2A 3E5XA 3JREA 2VBWA 3F6OA 3LSIA 3OYAA 3FBNB 4JNNA 2XKPA 1OQYA 2RN7A 3Q0WA 4RMNA 3BR6A 2A05A 1WCMJ 3SHFA 4BBRJ 4GFKA 4BE2A 3BCGA 4XKBA 3ABLH 3VSKA 1J0RA 5IOYA 1ZR4A 3OYFA 2QBYA 3M4OJ 1RUNA 4AIHA 2DOEA 2VIXA 2DTZA 2JA5J 4W1UA 2XPUA 3EUKL 4M3EA 3B73A 3T8RA 2PN6A 4XK4A 4D1QA 2K3PA 1H9GA 3W6JB 1ZG3A 2I8DA 2VLAA 4IHWA 5J1UA 1B72B 1Z67A 1WJAA 2X6WA 3BR1A 3S32A 2F5EA 3F1BA 3CQZJ 4WXCA 2FBIA 4QPOA 5CYVA 4U7BA 4NQWB 2CFOA 2BY2A 5CLSA 4XRSG 4O6JA 1WRJA 2M3AA 1DDNA 1WKMA 3DKXA 2BZTA 2B3WA 3HUGA 2RREA 3RD3A 2XUBA 2HYFA 4P1WA 4TV7A 2JPCA 3DFGA 1IF1A 2Q2EB 3DKWA 5BS6A 4CUGA 2IRFG 3IH3A 4HX7A 4B47A 2V1DA 3CWRA 3T6NA 2MFZA 3QYFA 1RR7A 3CJNA 1DUXC 3CCVI 4UV9A 2LTPA 2A2FX 4I99C 1Z3XA 3DTKA 5LD2C 1TTYA 3RKXA 1IV8A 3WTYC 4GGGA 1ITYA 1F4KA 2M7BA 1AHDP 4L5EA 4U87A 4XN0A 3E3VA 3PM1A 4MO7A 5E3LA 5E3OA 4HKUA 3JRDA 2IEKA 5GAGJ 4F3QA 5F6FA 2HDWA 1XS9A 4C2MA 5HDGA 1RR8C 2JA6J 1B59A 3GO5A 2MD5A 3WU2C 3GTOJ 2R5YB 1ZR2A 1OR7C 2A68F 2IGNA 4N4OB 5ICGA 3BQYA 2CUJA 2HKXA 4KDPA 4U0VA 1UG0A 4RGUA 5FO5A 2V6EA 3L2VA 1JUSA 1YIOA 3CCJI 2LOOA 1X4PA 2KP6A 3GX4X 3L9FA 2PLYA 3T5XA 2V7FA 4BY7J 1B4AA 2VPLA 2E1NA 1TW2A 1MDMB 2V1XA 3S15J 5LBQA 3ZMVA 1YRNA 3JRHA 1IG7A 2J5PA 2XAGA 3RCOA 3UNGC 3JRIA 4OD5A 1S7EA 2XV4S 2EFPA 2L0KA 2VQLA 3B81A 4UHTA 4IX7A 3ZQCA 2VXDA 5J8CA 4G7ZF 2NVYJ 4CYDA 3BHQA 2XASA 4L9VA 3HOSA 2XGXA 2A69F 3G2BA 1FX7A 4N4NB 4KMUX 4BU2A 1U6GA 4HA8A 2BXYA 2FU4A 5E17F 1XDSA 5GPAA 3LAPA 1FEXA 2LH9A 1IDZA 3HBLA 2G7LA 3V7SA 2L7FP 3PNTA 4RB0A 1KQ9A 1MH4A 4EGZA 3RH2A 2BE5F 4PGHA 4PSWA 2ZJ2A 2CU7A 4BJTA 1U5TC 3VB2A 4NNJA 5EEGA 5FLXZ 2HWVA 3L2CA 3HC7A 3G6EI 4CYCA 1O3QA 1MIJA 1IW7F 5JHFA 4I76A 3DLAA 1IAWA 5EF6A 3EYIA 3HL2A 5DD8A 1FOKA 1WHUA 3BTJA 2Z3YA 2BHZA 3S14J 2VXZA 2MC4A 2REKA 5IYBJ 3GTJJ 3M8EA 3SDGA 3FRQA 2KIQA 1D3YA 4L9TA 2ID3A 4ICHA 2PJRB 3R60A 2AHQA 5TRDA 3TOBA 2O6GE 2YUSA 5HAWA 3OV8A 1X58A 3HZJA 4LG0A 3F8CA 3NEUA 1P9QC 1WJEA 2E36A 2HPIA 2XHKA 4XONA 3MCZA 4GCKA 4D5CA 4FHTA 3S1MJ 3QU6A 1NH3A 4IVNA 3G1LA 2NP3A 3U9GA 5LRSA 1M1EB 4NC6A 3JRCA 4IO9F 2EA4A 2HR3A 1SVMA 4U9NA 3GFJA 2L7MP 5F04A 4BUPA 5LHHA 2CQXA 2DI3A 1G4DA 3IRRA 1DU6A 1QHHD 2AO9A 2WAEA 2LYCA 3O8HA 1VNDA 1W7PA 5ILUA 3C2HA 2E71A 3HTAA 4A0YA 2ZMEC 1HDDC 4R1HA 3ABMH 1L3LA 3SZTA 1JKOC 4AVPA 2VE8A 4A3LJ 3DPLC 3TL4X 3HOUJ 2MC3A 1Z9CA 4YIRX 2HZDA 1Y8QB 3S1RJ 2D5VA 4ENMA 1FZPB 2P5LC 2X6YA 2RKHA 2X9DA 2DXIA 3OYCA 3I9V2 5AIQA 3RQIA 4ACIA 2ID6A 2LRDA 2XC7A 3CUQA 2NNNA 5HNFA 3S2HJ 2D1VA 4YFKF 1C0WA 3PUFA 1U5TB 2FBQA 1D5YA 2PFBA 3QYBA 5HOOA 4WX9A 4M71A 1IO2A 2JMWA 2JTVA 4UUSB 1GUUA 4MQ9F 3OYKA 2WB1A 2K4BA 3EDPA 4LIUA 1ZQ3P 2G9WA 1LVKA 2DO7A 4H4KC 1RKWA 2H6BA 2P5VA 2V1NA 2L01A 4Y7NJ 2DMTA 3L2QA 3LWFA 5FD5A 4Z2YA 1RRJA 2QQBA 3CC4I 3GTGJ 5FLXK 5ERIA 3D5RC 1ZTRA 4ME9A 1WFXA 2X1EA 4E7JA 1XN7A 1XSVA 2XVCA 2B1EA 1Y39A 3A02A 3BTCA 1OCTC 2RDPA 3VFZA 3HOYJ 3HPGA 5AONA 3GW2A 2UXXA 3MZHA 3TO9A 5GTHC 2OV7A 3NRGA 4GFLA 2KQRA 5D4SA 2Y9ZA 5B5EC 4IJAA 2BVMA 4C9YA 2CQNA 4EJVA 4GCLA 2KRCA 4YFXF 3RKWA 1WSUA 2AQEA 2P7VB 4RLFA 4M9SA 1R4NB 2IGOA 5ILSA 4IRHA 1VTNC 3V8JA 5HDKA 5GPCA 3BY6A 3TOAA 4A69C 3V42A 1WI3A 4JQFA 1I6HJ 2NAZA 2OZUA 1I5ZA 3RZDJ 4A3FJ 1H0MA 2E2IJ 3S16J 1TT5B 1TZLA 2ISYA 1SD6A 2OCEA 4XLNF 2VPRA 3E0JB 4M6XA 2JVGA 2ZMEB 1Z7LA 2CW8A 2O61A 2VJIA 2H94A 3U1DA 1D8KA 3I3LA 1R58A 2MBFA 4QLCU 5FD6A 2VE9A 1BR1A 3MKYB 3ZQQA 3KP5A 4DYQA 3J81Z 2UZKA 4KFCA 3G3ZA 2LKSA 3I55I 3KP6A 1VFCA 2WTEA 3MAJA 4E6KG 1R5ID 3J7AO 2QKLB 3M8JA 5IP9J 2GM4A 2K40A 3CMYA 4BHBA 3X2QH 3G1OA 3JW4A 4NELA 3U21A 4RB1A 3ZMZA 3C18A 3DBRB 4PFPA 2QWWA 3PIPF 3K2ZA 2JUCA 1VQKI 1Z77A 2LLKA 3DEUA 1USSA 3IC7A 3GTMJ 4Y4RA 3JAMK 3ULQB 4FT8A 4P9FA 5E1XA 4V2GA 4NBQA 5D8KB 1NG7A 2O9LA 2DCEA 1G8XA 4ZYDA 5HLHA 2QF7A 1RC9A 3F8MA 2HKUA 1JUPA 1W5CC 3KYCB 3M1EA 3WTZA 3NRVA 5K58A 2HI3A 3FBIB 2HGCA 3K0LA 2HYTA 2HOSA 3I54A 1W1WE 2ME0A 3ABTA 1DP7P 1IN6A 2R5ZA 1R4MB 4EVIA 3BG6A 1VQ7I 5IT9Z 5EEAA 3HRSA 3V4GA 1DU0A 4J01A 4BBSJ 2DTRA 2HOAA 4M73A 4BXXJ 4KN7X 4MEYF 2HDDA 2XIGA 4A3CJ 4PZJA 1PJRA 3K6GA 1GXPA 2DMUA 5DCMB 1ZH5A 1UELB 2GAUA 1QRYA 1JE8A 3HDDA 1ODDA 1Z6RA 1DGRM 1ETVA 1RPWA 1R23A 4GFBA 2FMYA 2L9VA 3CRJA 1GXQA 4HSRA 1R7JA 4BNCA 1T95A 2FBKA 1GVDA 1RKTA 4M6YA 3HGYA 5KCMA 4DZJA 3JSPA 4X6AJ 4MHGA 4RGRA 2YX7A 1U9OA 2FD5A 2VKEA 4A3GJ 3NS4A 3RJPA 1QA6A 3DCFA 1MMSA 1CF7A 2M45A 1X4OA 1Z05A 2VBXA 3D5LA 3VODA 1V55H 1P2FA 1TC3C 1PP7U 1XPXA 3Q0VA 3GF2A 3BNIA 2NVUB 1SFEA 1P7JA 3H5RA 4M74A 4U9LA 5FKKA 5KAIC 3F9KA 3OYDA 2NS0A 1JTXA 2V26A 3OYMA 4QPQA 1SVLA 4KICA 3HSRA 1N77A 1MNEA 2WB1N 1RI7A 2OF7A 1E3PA 2LBFB 2W4SA 1WJ5A 2KFDA 5DM7F 2EQRA 1YIJI 2H8RA 2IBDA 1FTTA 1XMKA 2UXUA 2IA2A 1T2KA 3J81K 2XF5A 3LHQA 5HLTA 3AG1H 5AIPA 5EG0A 1MJBA 3OYEA 2FQ3A 1YTYA 1OJLA 1T0FA 3A0HC 2OQRA 3B6AA 1O4XA 4XICA 2QSGX 3BG7A 5HSZA 2NS7A 3CESA 3OR1C 4CICA 4L9JA 4I98B 2K7LA 3VYSB 5L3FA 5C4YA 5D6FA 4ANJA 3KYLA 2QBYB 4HOBA 3CZ6A 3TW7A 3K7AJ 1FBUA 2QZ8A 4E7SA 1JGSA 3I58A 3IHUA 4L0YB 4Z6YA 2L7KA 4RB3C 2EINH 3E6MA 2EZHA 4RS8A 2EIMH 5HNHA 4G94A 2DBBA 2L54A 3IP4B 4O3MA 1LQ1A 2YVXA 3O8GA 2R7WA 4CCMA 2VJJA 3GTKJ 4JX4A 5J3LA 4ENNA 4AC0A 1T6SA 2NX4A 4IQ4A 3QP6A 3OYNA 5EFYA 2M9HA 4KA4A 3HUGB 5IT9K 1G59A 1K6YA 2EILH 3IKTA 1T38A 2Z2SB 5K7ZA 4BGDA 4WF2A 4JP0A 3VOEA 4AWXB 2Y9YA 5D19A 1X3UA 2VODA 4UB8C 1ONVA 4RAGA 5F0CA 3TP3A 5FLMJ 2DJNA 5M5YJ 5FGLA 1U0JA 3KP3A 2A6EF 3NAUA 1XSXA 2LD5A 2CV1A 1G6NA 3TGNA 1JKQC 5L3GA 3GXOA 3OYHA 2XF6A 3PSFA 4XRFA 2IVMA 2QQ8A 4M9XA 1LFPA 2H1KA 2VOOA 4NC7A 2EJRA 2LVSA 2WY8Q 4A12A 4NHJA 3RKYA 4HDUA 1LJ9A 5D5WB 2DFEA 3SXYA 2QQAA 3OSGA 3EUPA 4UVBA 4XLFA 5HVQC 3LFKA 4DQ2A 2DT5A 2M87A 1AOYA 1TWGJ 4YEJA 3CMMA 5ICEA 2CRGA 4S0HB 1X3ZB 3KP7A 5EZGA 3ZQIA 2XAHA 3E1SA 4LITA 3HOTA 2ZFWA 1LDDA 2P8TA 2BEOA 1TQPA 3KZ9A 4DBQA 4L18B 4FE7A 5C4JJ 1ZARA 2P7CB 2HOEA 3BG3A 2OA4A 3E5UA 3WU1B 2P4WA 5FROA 1NHAA 4IRIA 3VPRA 4A0ZA 2QSHX 2WV1A 4OINF 1YRNB 1JXSA 3M9AA 1Z6TA 4GCVA 1EH8A 3F22A 1P4XA 1GT0C 2EWNA 2M4GA 3F23A 4WXHA 2NRAC 2WGBA 1X2NA 1YQAA 3K9TA 1ETXA 4M6VA 4CH7A 5H20A 2F5CA 1OKRA 1OCPA 4BKXA 3DPTA 3H5NA 2CQQA 4ZZDA 2FMLA 4AU7A 5D5XB 3ONQA 1BR2A 1R49A 3MFKA 4QSHA 2DPUA 4BE1A 3TEDA 2UXHA 2FOKA 3LAJA 2X0LA 2EBIA 3CUQC 4EM2A 2QKOA 2CYYA 2OD5A 4XIDA 3FMRA 3K4BA 2DAOA 3FXKA 1U8RA 3KCCA 1MMNA 2ICWG 4UVAA 4CYCB 3HG9A 4GDFA 2GXGA 4PK4A 3E6DA 2HVRA 1BR4A 3ELKA 1EKEA 4MGRA 3ZR8X 5J1YA 4ESFA 4HZFA 2BGCA 5D5UB 2XAFA 1AKHA 5E1ZB 4RB2C 2O03A 3HIFA 2CV2A 3CUOA 2Z9OA 4FISA 1BW6A 3CCUI 3DBHB 3CO6C 4HYEA 4IHYA 4JBAA 2LC2A 1ZK8A 3WE3A 5J47A 2O7TA 2W84A 3DKYA 5CVRA 3OOUA 4LG0B 2GA1A 3BRUA 2V9KA 2V4JC 1S7OA 3Q9SA 2MA3A 5CQGA 1FYLA 2GUHA 4A3EJ 3FXLA 4B3AA 1ZG5A 1QPMA 2PI0A 1W7PD 2O7OA 5CVVA 1YS7A 3E97A 3IKVA 3LJLA 3FKIJ 1A31A 3G4SI 2R7VA 1S5LC 4NDLA 2H6CA 3DWLE 2NVTJ 1KYWA 3OIQA 5DM6F 3HOXJ 2BVLA 3PSIA 4PJLA 2GIZA 1VQ9I 3FHZA 1TL8A 4CA0A 1Z7UA 3H9JA 3A0BC 1OYIA 2GZWA 2LY1A 3I71A 5BOXA 1BN5A 1SFKA 1ACIA 1ON1A 3S3NA 3RI4A 4XLHA 5EDNA 1W7PB 2MSYA 3H35A 2G7UA 3CJTB 5CKTA 5JI6A 2LF7A 3LSTA 4FETA 1W0UA 1FLIA 2IS2A 3F21A 2ZXHA 4ITVA 4MIMA 5KK1A 2CGPA 1HDPA 3GLLA 4E4HA 3BPVA 3BLYA 4YIIA 2KMUA 2YSRA 4UXNA 1A35A 4XNFA 4OOIA 2LKXA 3HXLA 5BPDA 3CJQB 5E79C 4A6EA 3IV5A 5L3DA 2XAUA 2JQ7A 1UHWA 3CUQB 2JA2A 4OMZA 2FRHA 2FBHA 1P4WA 4WIBA 3S5RA 1XMAA 5GAEJ 1R9TJ 1A5JA 2ETHA 2BY3A 2GQQA 4I7HA 2CQ7A 3C2BA 3I4PA 2QQ9A 4A3KJ 2VJ5A 1HKQA 1PVEA 1SAXA 3PFYA 4B48A 3LSPA 5ED4A 5M3MJ 3DU6A 3GBGA 1IZ1A 1U78A 3TO7A 5DUIA 3KX2A 2KPMA 4KJZA 2P0WA 5EJCA 4CCOA 3RTRA 3EUHA 3HE0A 2PX9A 1HSTA 4LMYA 4ABZA 5JR3A 5A2QZ 1J75A 2Z99A 4PUSA 3ERMA 1I50J 4OIOF 3EUAA 3H1CA 4NN1A 4LG3A 3BR5A 1A36A 1KA8A 2JT1A 3HPHA 4LB5A 3PO3J 3CMEI 2Q0OA 2IU5A 1GV2A 4OD4A 3L7WA 1A6IA 4E7KA 3JRBA 4XRMA 4L9NA 3BZKA 1K78A 3BDDA 1G2HA 4ON0A 2K9MA 2FSWA 1O7LA 3IH4A 2L4MA 2DPDA 4PXIA 1KU2A 3DBLB 5B1BH 4UNOA 2EA2A 2KRFA 2HFHA 1FYKA 4HPQA 1W5SA 5D1RA 1W5TA 1MNMC 5EYRA 2R7TA 3KEQA 2XROA 4Y15A 3J80K 5DD4A 4XN3A 2C6YA 4DIQA 1SD4A 1XB4A 5FKLA 1PUFA 3R61A 4G7OF 2F07A 4PSXA 4M72A 3VP5A 1IN8A 2HVQA 4XOTA 2QM3A 2W00A 4B3XA 4CCKA 4M3DA 1GHCA 3JRFA 3CCMI 3QKXA 4QTRA 5J1RA 3IH2A 3WTTC 1E17A 3TBIA 3AG2H 1R1UA 2IXSA 3SEZA 1OISA 4CCJA 1IUFA 1D1CA 5L3BA 1FMWA 1VQ5I 5FRNA 3VOKA 4HV6A 1PUEE 2CW7A 1QQIA 3PQJA 4C2UA 5KHDA 2UXOA 4IEJA 1ZGJA 3MQ0A 3GYHX 1D5VA 4KYWA 3U1KA 1MSEC 5IP7J 4A3BJ 2B7EA 3FXMA 3TDUC 2IGMA 3OMYA 1WVRA 2W7NA 1O7FA 5K5QA 5KNLA 1MJ9A 1MBEA 3PFIA 3LQQA 4IXAA 2GXAA 4OIRF 3BP8A 4P9UA 3GEUA 2IW5A 1FMVA 3COLA 5F27A 3VVYA 2E5NA 2Q8KA 4CCNA 2R7ZJ 1WQ2A 4A3IJ 1T0FC 1VQLI 3SFZA 2Y30A 4E7HA 2EV5A 4U0YA 2VT2A 2W24A 4HLYA 3I59A 3SQNA 2NXNB 3M1CA 4KWAA 5K5RA 3W2WA 2F48A 3K4KA 2ISZA 2H1LA 1YITI 2DDAA 5BPIA 2GOMA 1L0OC 1SMYF 3VYUB 5EGOA 1VI0A 5D6EA 2R5ZB 2VBYA 2X85A 1GLNA 2FX0A 3KEOA 3RYRA 1ZRFA 3BCAA 4HSTA 2G7GA 3CCSI 5JFRA 2DA6A 2ZJQF 2ELJA 4B1RA 4D7MA 3F6VA 3VDXA 4HV5A 4JX6A 3O6BB 4KUMA 3OYIA 1V3FA 3B6CA 2F6CA 3F3XA 4RAZA 4EGYA 1Y0UA 4JK1X 3VYTB 2P81A 2DK8A 3AFHA 3LSHA 2QIBA 3ABUA 3K4LA 3FM3A 4PJNA 1Y6IA 4ESBA 2CJJA 4L5IA 4GXOA 2OTLI 2PMZA 1S8NA 1CF7B 2FNPA 4YRVA 1WGXA 2W57A 3DPJA 1I3AA 4PJ0C 6PAXA 2TCTA 3MVPA 5FFZA 1H9TA 2PEXA 2Y75A 3BC8A 3QP5A 2ZOYA 2DODA 5LRRA 1S29A 4G6TB 1XGMA 2KDOA 4I02A 1QZZA 3RPUD 3S2WA 3SEQA 1UFMA 3PPBA 1A04A 5FHPA 3KZYA 4HLXA 1EV7A 2VT3A 3OS0A 4KITB 4EQQA 4XBFA 2K85A 5GAHJ 2EFOA 2DN0A 5EG0B 3HHHA 3SFIA 3N4MA 1X1CA 1B9MA 2GIVA 4IPAA 3O2PE 4C2MJ 2ACJA 2RQQA 2LSOA 2M8EA 4LGWA 1D0YA 4D5FA 1XC5A 3BT9A 1X3WB 2DOAA 1SD5A 2DU9A 3FZVA 2F4IA 1FSEA 1TW3A 3FWEA 4JOMA 1ZLJA 5EZHA 4ZTJA 2DG8A 1ZLKA 1UCRA 4IZZA 2DK5A 2K02A 2R7RA 2AQFA 2E1OA 2LR8A 2KDZA 2PG4A 1YJNI 3FF5A 3KPHA 4JX5A 5B1AH 1MBJA 1QGPA 2LFBA 3DTEA 5H2FC 2R4GA 2QLZA 1IGNA 1HQCA 1WH5A 3H36A 1XSDA 1ZKGA 3LA3A 4A5NA 1N25A 2WAQA 5E18F 1ZG1A 2E1CA 5F1RA 3FMSA 4RDUA 2CV0A 2HVSA 3K69A 1P7IA 1Q1HA 5EEHA 5FKNA 4C3IJ 1V54H 3Q9VA 3D1NI 3FXJA 5IPAA 2CQKA 3LA2A 3LMMA 4M3BA 1IRGA 1R1VA 1UJ8A 2JVHA 3F8NA 1UAAA 4C30A 1FSHA 2OUMA 5KAFC 3ESWB 2IGKA 2K9QA 4V19K 2G7HA 2NOGA 1HSJA 2DFIA 1QVUA 4BE0A 3HOWJ 5C44J 4M3FA 1BI1A 5B3SH 3K4MA 2EFWA 3KLOA 2D1HA 3R0AA 2UUZA 1JUMA 4LK0F 3KETA 4WWCA 1B1BA 3H3ZA 3WE2A 4G9YA 5J4VA 3CCQI 2R7SA 1FOXA 2Z16A 2R7UA 4AUXA 3EPZA 1I1SA 3I4NJ 5JLXA 3JSJA 2A5YB 1FNNA 3KKCA 2NOJB 1SANA 3M8FA 1YJWI 4HBLA 2QOPA 4DVYP 2IPQX 2EFQA 3QPSA 2TDXA 5D8LB 1DPUA 2CWEA 4ZYAA 2YVEA 4P55A 5DS9A 3HJEA 3H0DA 4XKCA 2ZO4A 2ZCWA 2ZSHB 5BQTA 3F72A 1FBSA 2TRTA 2BW3A 3OS1A 3BTLA 2X1CA 4A3MJ 3ISPA 2VQHA 2EZKA 2H09A 3SZGA 2JJ7A 3S93A 5K5OA 4HRIA 2K3FA 2OZ6A 4XLPF 2V9VA 4MFDA 3MZ8A 1X1PA 1N75A 2X51A 1HCRA 3QOEA 3RYPA 1IN7A 2M34A 4CXFA 3FIWA 4PGGA 2DDBA 2Y0SA 5H6RA 4AD9A 3F8FA 2JN6A 1KZHA 4LOCA 5F1JA 4BEHA 2COMA 1LNWA 2F5VA 2HQAA 2Z1DA 1J09A 3OOPA 4A0XA 3BG9A 3HEFA 1REPC 2KLOA 1JJ6C 1BW5A 3W6KB 4WK8F 1POGA 3AAFA 2Y69H 1EH6A 2A61A 4E7ZA 2DJIA 1BI3A 3WTWC 1WJBA 4KIBA 5HS7A 4FX0A 5IY5H 2RV8A 3SDBA 1F9NA 3DV8A 3JCUC 2PMZN 2QTQA 3BJOA 2STTA 2KKOA 3ZN0A 1W36D 3DEEA 2EPFA 2H27A 5E1WA 3OL4A 4G6QA 1FBQA 1LPQA 3PO2J 3HRMA 4IHXA 3FDYA 2DA7A 1SFOJ 4IKFA 2KIUA 3CF5F 3CDIA 1AU7A 1AKHB 3FMQA 3G71I 1E3OC 4BXUA 3EUHC 3W2VA 2ZNYA 5DAJA 2COBA 5TGTA 2L5QA 2F2EA 2RASA 4KT6A 2QWTA 3C7JA 1IN4A 3WODF 2W53A 2MW8A 5ICCA 3T0YA 3OR2C 2PBIA 2VUMJ 1OFCX 3OYLA 3TQNA 4IL6C 1VQ8I 5IYCJ 4RM2A 3ANGA 2FA5A 1TBXA 1Y8RB 4GRIA 2R93J 2Y0MA 4R8HA 3ABKH 3MKWB 3GEZA 2QGUA 4FE4A 2KHMA 3U2RA 1G3WA 1HW1A 1J9IA 4EJWA 4H0EA 4CGZA 5L3EA 4LLGF 3WG7H 3GZNB 3RPUA 3G7RA 1BM9A 4XLEA 3I64A 3JSOA 1GV5A 2BY0A 5J8FA 3JRAA 1IXSB 3KYDB 2EZIA 1YW7A 1LDKB 2XAJA 1JKPC 3R6SA 5GP9A 2E2HJ 1X1BA 2IA0A 1CGPA 1IRZA 1YO5C 5D5VB 1HXDA 2YU3A 1AA7A 2WAQN 3MNLA 1WPKA 2ZY9A 4XLCA 1S6LA 1UG2A 1ZELA 5L3CA 4UUTA 2KJCA 3CP2A 4LK1F 1IV6A 3VVXA 4B43A 3CCRI 1WH7A 3MMYB 5B66C 2OPTA 3NARA 2XGCA 1I27A 5J40A 3WTUC 4CSWA 5HBUA 4N9IA 3NWSA 2RGVA 1ON2A 2D2WA 3P5JA 5KVRA 2QUFA 1DQUA 3ZQHA 5C3EJ 1LB2A 4FTHA 5F64A 2O5RA 1STZA 1G3SA 4D7NA 1ORKA 2CG4A 1XMXA 3KLNA 1WZ2A 5CVJA 2RC4A 4BL0B 3M07A 3TO6A 3ECHA 3C2GA 4WXDA 4F92B 3EYYA 5K7FA 5J6XA 1IRXA 3K1NA 1O3SA 1B8IA 2JRTA 1T98A 1UB9A 2ELHA 3H9QA 3SZPA 3N97A 2JA7J 5HLGA 2OC6A 3CC2I 3S8PA 4N9HA 3ML6A 3QODA 4A6DA 4XSXF 4BAYA 5LGNA 3WTVC 4G12A 4RBOA 2AXLA 3K2AA 4XQFA 5DCFA 3LSGA 4XLAA 2D45A 1W0TA 2XSJC 1K78B 1LFUP 2D6YA 2DLLA 5K1YA 2JUGA 2L4AA 4BYYA 4AM3A 4P5OA 4EM1A 2Y0SN 3C3WA 2ZJPF 5J4YA 3DXJF 2AS5F 1YOVB 2XPVA 3GTLJ 3ZGKA 3C07A 4CHUA 2OCCH 2L9RA 2XB5A 3LSMA 3OWTA 1PUFB 4FCYA 4KNYA 3WGHA 1FWZA 2B0LA 1BJAA 3DF8A 2IA1A 1R00A 3A4CA 3HTSB 2MYSA 2IS6A 1RESA 1U9NA 1R5HA 4BQOA 2OBPA 1KU7A 3P9TA 4ASNA 3BWGA 1S3JA 4KIGA 3HKZA 4OU0A 1MNDA 4EJOA 2A6HF 3A03A 3RDIA 1QHGA 1OYYA 3FK6A 3GFLA 4HEA2 2BOLA 4Y33A 3TP0A 4AYBA 3KP4A 2EV6A 3G1MA 1JGGA 2HQ5A 2VKDA 3ZXSA 4YFNF 4UB6C 4CZZA 4ENJA 2WAFA 3S2DJ 2O0YA 3V8KA 2K27A 1ZRCA 5HS8A 4I01A 2OAZA 5HDNA 4RAYA 1APLC 2VQCA 4F93B 4IRVA 4M3GA 1MKMA 3CP8A 4G7HF 4ZDLA 3CCLI 1SEUA 2Y31A 2ZC2A 1T08B 4BQNA 3JTGA 1YJ9I 1JHHA 2RNJA 3IWZA 2ELKA 1G3TA 3FXQA 3I59B 3N05A 2A6TA 1MD0A 1D1BA 3L2WA 4ESJA 4W97A 3L00A 4DJAA 2ADUA 1LKXA 1I39A 2P6SA 2NNYA 3SJMA 2ZCMA 2ZCXA 3WG9A 3VW1A 2FQ4A 2DA2A 5EGOB 5C4XJ 3OIPA 3L2RA 1SFUA 4IHTA 2VKVA 1UHMA 1KQ0A 1MBFA 3FM5A 3FK7A 1SGMA 3G56A 2NVQJ 1YW9A 3FKJA 1K83J 5FKMA 1HW2A 1D0XA 5CVUA 3AL0C 1LDJA 3OSFA 1HC8A 3ZRGA 2QA4I 4J00A 3IAM2 3P9CA 2K9SA 3F8BA 2UV1A 1TWAJ 3C1DA 4NC8A 4BH9A 1QBJA 2E1MC 3COAC 3HTHA 1OYWA 3VYRB 1SAUA 4IHVA 3EGQA 4HNUA 5LEJA 2HXIA 1EF4A 1BBYA 1HLVA 3BQZA 2MABA 2CFXA 2QSFX 2UXNA 4C3HJ 3T1BA 3IUVA 4XM3A 2FEZA 2BY1A 2I10A 2GLOA 3WHCA 2GOXB 1BIAA 2KRHA 3RPQA 1XTAA 1KGSA 5TJJA 2CS3A 1OLTA 3ZMTA 2DOFA 3R0JA 3HSFA 4L0ZB 4E7IA 1GDTA 2M30A 3DLLF 1YW8A 3FXOA 2ESHA 3A01A 4E70A 1H88C 2IP2A 3BR0A 3B02A 1XD7A 4R79A 4AC6A 2HPMA 3ZQFA 4BDZA 2PMUA 1QNTA 1K79A 2RHAA 3ASNH 1YE9A 4I0AA 5IP6A 2STWA 2ZNZA 3FXUA 1YS6A 4FASD 4L5JA 2HS5A 3S3OA 1YYVA 4EATA 1XGNA 1OCZH 3VWBA 2EB7A 2DA3A 1SMTA 5E3NA 2JRMA 3LSRA 3V6GA 4AF5A 2JA8J 2IJLA 1K6OA 3D0SA 4MNUA 4AIKA 4XKVA 3K8PC 3NWTA 3K70D 3E7QA 3VIBA 3CJRB 1V4RA 2XF7A 2LNBA 1XDUA 2IT0A 3F0CA 1LEAA 1D1AA 3FISA 1I6XA 4LB6B 2L9NA 5M5WJ 2DMPA 2QVOA 3GUDA 1FYMA 1HF0A 4BS9A 1G3YA 1TLHB 4UY8I 2IS4A 3HYIA 2GWRA 1SVOA 2JZYA 5DYMA 3K4JA 1XX5A 1OCOH 1FIAA 1MJAA 5HODA 3E5QA 1VQMI 2HU9A 2VQGA 2CO5A 3LWJA 1LVAA 1D0ZA 3H5AA 5CW8A 4CCLA 2DYRH 5M5XJ 1FTZA 2ZXJA 2MH2A 3NPIA 4DZPA 2OI8A 3H3VK 5IOZA 3KE2A 2OJED 2WV0A 5CVIA 4EMSA 3RKQA 3ANPA 2L9SA 3Q3SA 3AL0B 2XDVA 4RLQA 1D8JA 3GVAA 4BJ6C 2GFNA 2XGDA 1V5GA 1WI9A 2E1MB 1H89C 1ETKA 3DTIA 4RGSA 3HKZN 3A1YA 2BV6A 4ETSA 5IT3A 2A5WA 5LGUA 3VW0A 5FGMA 1QU3A 2R92J 1TT0A 2JSCA 4GO1A 5LHGA 2HQNA 4AYBN 3HRUA 4HF1A 2J5OA 2KZVA 3QQAA 1LE8A 3CDHA 1ETQA 3UKGA 3M7GA 3Q5FA 1KU9A 2ZXIA 3KIOA 3CCYA 3T8TA 4BHPA 4II2A 2KISA 4Q47A 3BROA 5LLQA 1QO0D 1R36A 5HLIA 1F5TA 1P4AA 4LFUA 4PDKA 1MGTA 2E34A 2BW3B 3GMEA 3I0TA 4V2FA 3H0GJ 3UR3C 4DOZA 4ZYHA 2HQRA 1U3EM 3S1NJ 2FE3A 1IDYA 1FT9A 3HOVJ 4BQQA 1F36A 2ZFUA 5GADJ 5DDGA 3MD2A 3RSNA 1T39A 3MEXA 3HTUA 1BI0A 1O3TA 1WJCA 2DFFA 2M2EA 2DQLA 4CDGA 3CLOA 3L1PA 4C2TA 1F43A 2CMPA 2F4OB 4U88A 4XSZF 1PYVA 3ZP5A 5CXIA 3KZIC 2L02A 3AKZA 3CD6I 4GYGA 4BEHB 4HF2A 1UI5A 2EFNA 2DT7B 2FJ1A 1UZCA 3TW6A 4L62A 4WCGA 3KNWA 5CQEA 4ZZLA 3LNQA 1ZRDA 5JLWA 3HM5A 3EETA 4C3JJ 2OERA 2XKOA 3BZ6A 3CF2A 5A2QK 4XMYA 1UHSA 4ZYEA 2MD0A 2FXAA 1AWCA 2M0MA 1J7KA 2O8XA 2BXZA 2NVXJ 2G7SA 1FOYA 4FX4A 2VONA 2ZJRF 4P96A 3TKYA 4X1EA 1DP3A 1DGWY 3BG5A 1HKSA 4AIJA 1R71A 9ANTA 4YZEA 4LD5A 3OYGA 3ZQLA 2MG4A 1YX5A 1TWFJ 3L2UA 2NYXA 5CJ9A 4BY1J 2HEOA 3OL3A 2Y2ZA 4BDYA 5IYDJ 3PQKA 4JL3A 3HTJA 1W4MA 1WJDA 3ZQ7A 3QPTA 3BR2A 1P92A 1V5EA 1WJFA 3OYBA 3RQ4A 5ILVA 1JT0A 1MZBA 2WA0A 4GCTA 3RIRA 2NS8A 2FUG2 3QAHA 2HDCA 4RA2A 4RAFA 4OIPF 4HNVA 2EIJH 3FXRA 3RZOJ 1IC8A 4G6DA 2YR2A 1E3HA 4XKWA 3IL2A 3GFMA 3DQVC 3A2KA 3GLXA 3LFUA 4A3JJ 1B72A 3ZOBA 3WU0A 4ZH4F 3ZMDA 1HOMA 2VKHA 1B9NA 3JAMZ 5FLVA 3VUQA 1U8BA 4NQWA 3M3YJ 2PZ9A 3SYTA 2EZLA 3GTPJ 3QWLA 1Y56A 2VOPA 2Q1ZB 1U2WA 2JSPA 4HDVA 1EA3A 1TP4A 2CH0A 1IRFA 3JRGA 1TNTA 2PFVA 1PDNC 2H8WA 3GTQJ 1BA5A 3J7YJ 4F91B 2HKOA 2Q2EA 4I0BA 3E7LA 2MH9A 1NK3P 5AQCA 5D4RA 2CUZA 4B8XA 2DW4A 3HSEA 5JHUA 3ROUA 3QRFF 3PJRA 1X2MA 2LY9A 5JVGF 1JI8A 3ZCOA 3W6VA 5FKOA 1NTCA 2WC2A 3VOXA 2UXPA 1TWHJ 2EIKH 2ZSIB 2GA2A 3BR3A 3HGGA 1JKRC 1RUOA 5LFAA 2KL4A 2HYJA 3K10A 2LF8A 4E7LA 2Z33A 3O60A 3REOA 3J7ZI 3O3KA 3CJDA 3S1QJ 2V1UA 1VQ4I 2VN2A 2ZBKA 3P7NA 5FRMA 1J59A 2A07F 1VQOI 2YVHA 3J7AY 4ZDOA 4UVCA 2NP5A 1FY7A 2W25A 2IAIA 2FJI1 3MN2A 2R5YA 3QPLA 3L09A 2EK5A 2LDUA 4A5MA 3BJAA 4KISA 1ZN2A 2E35A 1YX3A 1USTA 2F5DA 2R3SA 2M4KA 1ERDA 4Q5SF 3PUBA 3KEYA 1RETA 4IHSA 1OCRH 2LKPA 5E20A 4Q4ZF 2QCOA 2ZKZA 4I2OA 4AIDA 3CC7I 3V78A 1MDMA 1R22A 1KYZA 3ECOA 2CUEA 1S72I 1BI2A 3P9KA 1ZGWA 1K4SA 1HBXG 4EM0B 1W36C 1WWXA 4XORA 1GVJA 3CDLA 2W48A 1JT6A 2WADA 1B8IB 2OQGA 1X19A 1FOWA 3ZQGA 3VTIA 3ZMUA 2GBYA 2M7AA 3OY9A 1FP2A 1K61A 4YIFA 2R7DA 2KJBA 3GWZA 2XRLA 2EH3A 3QBMA 3OYJA 4IOCF 1O3RA 4XR6A 4I6ZA 3K4CA 4BHCA 4HQMA 4YELA 3CMAI 3P9IA 1IUYA 2Q24A 3MZYA 2ESNA 1BOAA 4RGXA 4NB5A 3OS2A 2R7FA 1K7AA 4NUBA 2PJPA 1SD7A 4DGWB 3TDZC 3BJBA 2M1BA 1UMQA 4DBRA 3K1PA 2V6CA 5FJ8J 1BL0A 3PASA 1EH7A 4YG2F 2MLKA 2FOWA 4KT5C 1ZAOA 4KIFA 2UWMA 3LA7A 2QEXI 1BOBA 1E2XA 4MTDA 4JKZA 4F7ZA 5E3MA 3ZN1A 5F0HA 5K7HA 4HX8A 1HW5A 2R7OA 2HOTA 4CGRA 2HTSA 1DPRA 3ASOH 5DUKA 1T56A 1I3QJ 1V5FA 3I4MJ 3IWFA 2PJRA 2DFHA 2HNHA 3V7CA 3BJ6A 4Q48A 2O8KA 2W85A 1TWCJ 3IUOA 4II3A 2CUFA 1MMDA 3H9GA 2QKMB 1YLFA 5E8IA 4BXFA 2XB0X 4UV8A 2F5FA 2XDNA 1R6RA 2XRNA 3FHNA 2LP0A 3CCEI 3W3CA 1OCCH 2E5ZA 3BZCA 1IXRC 2E7WA 3HTIA 1O57A 1YFHA 5GTIC 3CO7C 4DNCA 1FC3A 5F08A 1R1TA 2G0EA 4HX4A 4OWRB 2DA1A 2PBXA 1OR7A 2MLGA 2YU9J 2N8GA 1XGSA 2ECCA 1OPCA 3LSJA 4LLNA 3PNVA 5H9TA 1T33A 3BTIA 3VSLA 4FQGA 5LEKA 3WTXC 1VQ6I 4Y13A 4CZCA 5FFXA 2I5UA 3QPHA 2VI6A 2K9LA 1VZ0A 3DU5A 2VB6A 4PJMA 3ZPLA 1UI6A 3BCBA 4M9ZA 1XG1A 4D9JA 2JK3A 4KN4X 4Y17A 5F0FA 2K86A 2R7QA 4O5VA 3EQLF 2WWYA 5DEQA 2FNAA 5BMZA 2XGEA 5LHIA 3KZZA 1SC7A 4DYCA 2RQPA 5H6QA 2LK2A 2Y48A 1Q1VA 2K9NA 4OAZA 1LUJB 1QPIA 2K5CA 3H92A 5LGTA 4BQAA 3G73A 1YHQI 2YS9A 3LL7A 4ZTFA 5M3FJ 1Z0XA 2EV0A 4Y52J 4F52A 1VQPI 2RAEA 1Z91A 1MBKA 4EV0A 1JJ8C 2W82A 2E2JJ 2K4JA 1E0EA 4G8XA 3DPUA 1U5TA 1NK2P 4EJTA 1YG2A 2WUIA 1XGOA 1MMGA 1ZGAA 2DA5A 1ETWA 5FMPA 4EJUA 2X4HA 1RIOH 4UUSA 1K4TA 3JR9A 3GCMA 3KKDA 2M8GX 2X6OA 1EJ9A 1F1ZA 1LFBA 2KIFA 4J19A 2ZOZA 2PQ8A 1NG6A 2DMNA 3V7RA 4IQJA 2X1DA 2QENA 4MLOA 4B09A 2L2OA 2VC0A 3PNYA 1BIBA 3WHBA 1N78A 2JWTA
chains in the Genus database with same CATH topology
2NVQJ 3GEUA 1K83J 3OIOA 5F27A 5FKMA 4QIWN 3COLA 3VVYA 2R7ZJ 3OSFA 3NI7A 3A01B 4A3IJ 2K9SA 2ME6A 2Y30A 4DYQA 1ETOA 3HIMA 1TWAJ 4B4CA 2X48A 4UDSA 3HTHA 1VFCA 4IHVA 2ZB9A 4KWAA 3VVZA 3EGQA 2HXIA 4MXMA 4A93J 1EF4A 1HLVA 3BQZA 5IP9J 4C3HJ 2GM4A 2K40A 3IUVA 3CMYA 2I10A 2GLOA 3WHCA 1VI0A 3G1OA 5EGOA 3NNRA 4NELA 2R5ZB 2FX0A 1IJWC 2XSDC 1ENHA 2G7GA 1Z77A 2LLKA 1MBFA 2DA6A 1GDTA 4B1RA 3GTMJ 4MK6A 4D7MA 3ON2A 4JX6A 4DW6A 4V2GA 3A01A 5D18A 3B6CA 1H88C 2O9LA 3BR0A 4AC6A 3ZQFA 2KT0A 3GZIA 2RHAA 2QF7A 2HKUA 1JUPA 5IP6A 2P81A 4DYRA 2QIBA 1BJZA 5K58A 2HI3A 1ETYA 2HYTA 2CJJA 2HOSA 2ME0A 2DA3A 5E3NA 3S17J 3LSRA 3V6GA 4AF5A 2R5ZA 3HB9A 2JA8J 1WGXA 4XRSA 2HXOA 5EEAA 3DPJA 1DU0A 3E7QA 4BBSJ 3VIBA 2HOAA 4BXXJ 4A3CJ 2HDDA 3F0CA 3FISA 4MFEA 3LOCA 2DMUA 5M5WJ 2DMPA 2TCTA 3MVPA 1HF0A 2V57A 1QRYA 3HDDA 1MH3A 2ZOYA 1ETVA 1RPWA 2MGQA 1MBGA 4GFBA 1QVTA 2GENA 3PPBA 1FIAA 5HODA 3CRJA 5FHPA 3LWJA 1GVDA 1RKTA 3DEWA 1FTZA 3HGYA 4DZJA 5M5XJ 5CW8A 4X6AJ 3NPIA 4DZPA 3NXCA 1U9OA 2FD5A 2VKEA 3Q0UA 4A3GJ 5EG0B 2DN0A 1LE8B 2OI8A 3SFIA 3DCFA 3H3VK 5IOZA 2G3BA 2B63J 3RKQA 3ANPA 5CXGA 3Q3SA 1TC3C 1MBHA 4C2MJ 3Q0VA 4JYKA 3BNIA 3VW2A 2GFNA 2XGDA 2ECBA 3AQSA 1P7JA 1H89C 1ETKA 5FKKA 4D5FA 1JTXA 1XC5A 3BT9A 3HKZN 2DG8A 5EZHA 2XPWA 3ON4A 3VW0A 1CQTA 2WB1N 2DA4A 2E1OA 2OF7A 2LR8A 5DTDA 2R92J 2KDZA 4JX5A 1FIPA 4AYBN 1MBJA 2EQRA 2LFBA 2H8RA 2IBDA 1JTYA 1FTTA 2UXUA 1H8AC 3LHQA 1IGNA 1WH5A 3QQAA 5EG0A 1LE8A 1ETQA 1ZKGA 3UKGA 4RDUA 1P7IA 5BNGA 4C3IJ 5FKNA 3CCYA 1VF9A 2L7ZA 3D1NI 1OJLA 5IPAA 3HOZJ 4M3BA 3B6AA 1O4XA 2DG7A 4XICA 5HSZA 2NS7A 2K9QA 2NOGA 2M0CA 1QVUA 4A3DJ 3HOWJ 5C44J 4V2FA 4M3FA 3H0GJ 4EEFG 3AQTA 5C4YA 3S1NJ 2R0QC 2ZCNA 1IDYA 3HOVJ 1F36A 3TW7A 3K7AJ 1JUMA 2UXIA 1Y1WJ 3MKLA 4AUXA 1MSFC 2EZHA 1Y1VJ 2M2EA 3I4NJ 3L1PA 5JLXA 1F43A 1FJLA 3JSJA 2DMQA 2E19A 3O8GA 3KKCA 3JREA 1SANA 3GTKJ 5CXIA 4JX4A 5J3LA 2QOPA 4JNNA 4AC0A 2YVEA 3QPSA 1UI5A 3Q0WA 2NX4A 5EFYA 2FJ1A 3BR6A 3TW6A 4L62A 5DS9A 3KNWA 1WCMJ 2M9HA 4BBRJ 3LNQA 4GFKA 5JLWA 3HM5A 3BCGA 2TRTA 4C3JJ 2OERA 3M4OJ 5IOYA 1ZR4A 5K7ZA 3BTLA 1UHSA 4A3MJ 2JA5J 2DTZA 4JP0A 4W1UA 2EZKA 2XPUA 2Y9YA 5D19A 4M3EA 2NVXJ 5F0CA 2G7SA 3TP3A 5FLMJ 2DJNA 2JJ7A 4XK4A 5M5YJ 5FGLA 4X1EA 4IHWA 3BG5A 3NAUA 5J1UA 1B72B 2LD5A 4MFDA 3BR1A 9ANTA 4YZEA 3ZQLA 2MG4A 1HCRA 3F1BA 3CQZJ 1TWFJ 2M34A 1JKQC 3FIWA 4BY1J 2Y2ZA 5IYDJ 4JL3A 2JN6A 3HTJA 2H1KA 5F1JA 4LOCA 4XRSG 3BR2A 2LVSA 1JT0A 3BG9A 3HEFA 3OSGA 3EUPA 4GCTA 1JJ6C 1BW5A 3RD3A 2NS8A 1POGA 4HNVA 1TWGJ 3RZOJ 1IC8A 2CRGA 4S0HB 3IH3A 5EZGA 3CWRA 3ZQIA 3T6NA 1RR7A 3KZ9A 4FE7A 2LTPA 5C4JJ 4A3JJ 1B72A 3BG3A 3ZOBA 1HOMA 2PMZN 2QTQA 3VPRA 1ITYA 2WV1A 1YRNB 5FLVA 1AHDP 4L5EA 1U8BA 3M3YJ 3PM1A 2PZ9A 3VUQA 4MO7A 5E3LA 5E3OA 1GT0C 3PO2J 4IHXA 2EZLA 3GTPJ 4HKUA 2DA7A 3JRDA 2IEKA 1X2NA 1SFOJ 2WGBA 1AU7A 1AKHB 1ETXA 4M6VA 1E3OC 1XS9A 1OCPA 4BKXA 5DAJA 2JA6J 2COBA 3JRGA 3GTOJ 2CQQA 2R5YB 3GTQJ 1ZR2A 1BA5A 2RASA 4QSHA 2UXHA 3BQYA 3E7LA 3TEDA 2QWTA 1NK3P 2W53A 2MW8A 5AQCA 2EBIA 1JUSA 2QKOA 2VUMJ 1OFCX 4XIDA 4BY7J 5IYCJ 1X2MA 2LY9A 3ANGA 3W6VA 5FKOA 3S15J 4CYCB 1NTCA 2R93J 3VOXA 1YRNA 3JRHA 1TWHJ 1IG7A 2UXPA 3JRIA 3BR3A 3HGGA 1JKRC 1S7EA 2L0KA 4FE4A 3B81A 2HYJA 3ZQCA 3O60A 5J1YA 2NVYJ 3BHQA 3S1QJ 3CJDA 1AKHA 2YVHA 3G7RA 2NP5A 2IAIA 1GV5A 4FISA 5GPAA 3JRAA 1BW6A 3MN2A 1FEXA 2R5YA 3QPLA 4IHYA 3HBLA 1IDZA 2O7TA 1ZK8A 2G7LA 2EZIA 2L7FP 1JKPC 3RH2A 1MH4A 3OOUA 5GP9A 2E2HJ 3BRUA 1RETA 1IRZA 2CU7A 2QCOA 2GUHA 4A3EJ 2WAQN 3MNLA 3V78A 1WPKA 2CUEA 4B3AA 4CYCA 1UG2A 1ZGWA 4I76A 2O7OA 4UUTA 5EF6A 3LJLA 3FKIJ 1IV6A 3VVXA 4NDLA 1WH7A 3CDLA 2W48A 2NVTJ 3BTJA 1JT6A 3S14J 3HOXJ 1B8IB 2OPTA 3NARA 3ZQGA 2REKA 5IYBJ 2GBYA 2XGCA 3GTJJ 1K61A 3SDGA 3FRQA 5HBUA 2XRLA 2EH3A 3QBMA 2ID3A 4ICHA 5EDNA 2MSYA 2AHQA 4I6ZA 5C3EJ 2Q24A 2YUSA 3ZQHA 5HAWA 1X58A 4FTHA 1W0UA 3BJBA 4MIMA 1UMQA 4D7NA 1HDPA 1ORKA 5FJ8J 3PASA 1BL0A 4GCKA 4D5CA 4JKZA 3S1MJ 2LKXA 5E3MA 5F0HA 5K7HA 3G1LA 2NP3A 5K7FA 3IV5A 3JRCA 1B8IA 2HOTA 4CGRA 2L7MP 5F04A 1T56A 1I3QJ 2JA7J 2CQXA 1DU6A 3S5RA 2AO9A 3I4MJ 3O8HA 1VNDA 1R9TJ 1A5JA 2O8KA 4G12A 4RBOA 3C2BA 1TWCJ 3HTAA 4A3KJ 3K2AA 2CUFA 1HDDC 2XDNA 2XB0X 3LSGA 1W0TA 3LSPA 1LFUP 2D6YA 5M3MJ 1U78A 3GBGA 2LP0A 1JKOC 4A3LJ 3HTIA 2Y0SN 3HOUJ 3S1RJ 3HE0A 2D5VA 2XPVA 4ABZA 3GTLJ 3C07A 5F08A 2G0EA 2L9RA 2XB5A 2DA1A 2X9DA 2PBXA 2YU9J 3RQIA 2N8GA 4ACIA 2ECCA 2ID6A 1PUFB 3LSJA 4FCYA 5H9TA 1I50J 1T33A 3BTIA 4NN1A 3S2HJ 3BR5A 1RESA 3PO3J 2FBQA 1U9NA 2VI6A 1D5YA 2IU5A 3P9TA 1GV2A 1A6IA 1UI6A 3JRBA 4XRMA 2JMWA 1XG1A 1G2HA 2JK3A 4UUSB 1GUUA 5F0FA 3A03A 3IH4A 3FK6A 4PXIA 1ZQ3P 2XGEA 3TP0A 4DYCA 5D1RA 2LK2A 1MNMC 1Q1VA 2K9NA 5EYRA 1RKWA 1QPIA 3G1MA 4Y7NJ 2HQ5A 1JGGA 2DMTA 2YS9A 3GTGJ 5M3FJ 1Z0XA 5FKLA 4Y52J 1PUFA 3S2DJ 1ZTRA 2RAEA 4ME9A 1JJ8C 1MBKA 2F07A 2E2JJ 3VP5A 1APLC 3A02A 4M3DA 1NK2P 3BTCA 2WUIA 1OCTC 3JRFA 3HOYJ 4M3GA 3QKXA 4QTRA 2DA5A 1ETWA 3IH2A 5J1RA 2Y31A 3NRGA 2Y9ZA 4GFLA 5FMPA 4UUSA 2ELKA 4GCLA 3JR9A 1IUFA 2M8GX 3KKDA 2X6OA 4W97A 3G56A 3VOKA 1LFBA 4J19A 2UXOA 5GPCA 4IEJA 3SJMA 4A69C 2ZCMA 2ZCXA 2DMNA 2ZOZA 1WI3A 1MSEC 5IP7J 2FQ4A 2DA2A 4A3BJ 1I6HJ 3RZDJ 3VW1A 5EGOB 5C4XJ 4A3FJ 2E2IJ 3S16J 4MLOA 2VKVA 3WHBA 2VPRA 3FK7A 1MBEA 1SGMA 2JWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ J;  3GEU A;  1K83 J;  3OIO A;  5F27 A;  5FKM A;  4QIW N;  3COL A;  3VVY A;  2R7Z J;  3OSF A;  3NI7 A;  3A01 B;  4A3I J;  2K9S A;  2ME6 A;  2Y30 A;  4DYQ A;  1ETO A;  3HIM A;  1TWA J;  4B4C A;  2X48 A;  4UDS A;  3HTH A;  1VFC A;  4IHV A;  2ZB9 A;  4KWA A;  3VVZ A;  3EGQ A;  2HXI A;  4MXM A;  4A93 J;  1EF4 A;  1HLV A;  3BQZ A;  5IP9 J;  4C3H J;  2GM4 A;  2K40 A;  3IUV A;  3CMY A;  2I10 A;  2GLO A;  3WHC A;  1VI0 A;  3G1O A;  5EGO A;  3NNR A;  4NEL A;  2R5Z B;  2FX0 A;  1IJW C;  2XSD C;  1ENH A;  2G7G A;  1Z77 A;  2LLK A;  1MBF A;  2DA6 A;  1GDT A;  4B1R A;  3GTM J;  4MK6 A;  4D7M A;  3ON2 A;  4JX6 A;  4DW6 A;  4V2G A;  3A01 A;  5D18 A;  3B6C A;  1H88 C;  2O9L A;  3BR0 A;  4AC6 A;  3ZQF A;  2KT0 A;  3GZI A;  2RHA A;  2QF7 A;  2HKU A;  1JUP A;  5IP6 A;  2P81 A;  4DYR A;  2QIB A;  1BJZ A;  5K58 A;  2HI3 A;  1ETY A;  2HYT A;  2CJJ A;  2HOS A;  2ME0 A;  2DA3 A;  5E3N A;  3S17 J;  3LSR A;  3V6G A;  4AF5 A;  2R5Z A;  3HB9 A;  2JA8 J;  1WGX A;  4XRS A;  2HXO A;  5EEA A;  3DPJ A;  1DU0 A;  3E7Q A;  4BBS J;  3VIB A;  2HOA A;  4BXX J;  4A3C J;  2HDD A;  3F0C A;  3FIS A;  4MFE A;  3LOC A;  2DMU A;  5M5W J;  2DMP A;  2TCT A;  3MVP A;  1HF0 A;  2V57 A;  1QRY A;  3HDD A;  1MH3 A;  2ZOY A;  1ETV A;  1RPW A;  2MGQ A;  1MBG A;  4GFB A;  1QVT A;  2GEN A;  3PPB A;  1FIA A;  5HOD A;  3CRJ A;  5FHP A;  3LWJ A;  1GVD A;  1RKT A;  3DEW A;  1FTZ A;  3HGY A;  4DZJ A;  5M5X J;  5CW8 A;  4X6A J;  3NPI A;  4DZP A;  3NXC A;  1U9O A;  2FD5 A;  2VKE A;  3Q0U A;  4A3G J;  5EG0 B;  2DN0 A;  1LE8 B;  2OI8 A;  3SFI A;  3DCF A;  3H3V K;  5IOZ A;  2G3B A;  2B63 J;  3RKQ A;  3ANP A;  5CXG A;  3Q3S A;  1TC3 C;  1MBH A;  4C2M J;  3Q0V A;  4JYK A;  3BNI A;  3VW2 A;  2GFN A;  2XGD A;  2ECB A;  3AQS A;  1P7J A;  1H89 C;  1ETK A;  5FKK A;  4D5F A;  1JTX A;  1XC5 A;  3BT9 A;  3HKZ N;  2DG8 A;  5EZH A;  2XPW A;  3ON4 A;  3VW0 A;  1CQT A;  2WB1 N;  2DA4 A;  2E1O A;  2OF7 A;  2LR8 A;  5DTD A;  2R92 J;  2KDZ A;  4JX5 A;  1FIP A;  4AYB N;  1MBJ A;  2EQR A;  2LFB A;  2H8R A;  2IBD A;  1JTY A;  1FTT A;  2UXU A;  1H8A C;  3LHQ A;  1IGN A;  1WH5 A;  3QQA A;  5EG0 A;  1LE8 A;  1ETQ A;  1ZKG A;  3UKG A;  4RDU A;  1P7I A;  5BNG A;  4C3I J;  5FKN A;  3CCY A;  1VF9 A;  2L7Z A;  3D1N I;  1OJL A;  5IPA A;  3HOZ J;  4M3B A;  3B6A A;  1O4X A;  2DG7 A;  4XIC A;  5HSZ A;  2NS7 A;  2K9Q A;  2NOG A;  2M0C A;  1QVU A;  4A3D J;  3HOW J;  5C44 J;  4V2F A;  4M3F A;  3H0G J;  4EEF G;  3AQT A;  5C4Y A;  3S1N J;  2R0Q C;  2ZCN A;  1IDY A;  3HOV J;  1F36 A;  3TW7 A;  3K7A J;  1JUM A;  2UXI A;  1Y1W J;  3MKL A;  4AUX A;  1MSF C;  2EZH A;  1Y1V J;  2M2E A;  3I4N J;  3L1P A;  5JLX A;  1F43 A;  1FJL A;  3JSJ A;  2DMQ A;  2E19 A;  3O8G A;  3KKC A;  3JRE A;  1SAN A;  3GTK J;  5CXI A;  4JX4 A;  5J3L A;  2QOP A;  4JNN A;  4AC0 A;  2YVE A;  3QPS A;  1UI5 A;  3Q0W A;  2NX4 A;  5EFY A;  2FJ1 A;  3BR6 A;  3TW6 A;  4L62 A;  5DS9 A;  3KNW A;  1WCM J;  2M9H A;  4BBR J;  3LNQ A;  4GFK A;  5JLW A;  3HM5 A;  3BCG A;  2TRT A;  4C3J J;  2OER A;  3M4O J;  5IOY A;  1ZR4 A;  5K7Z A;  3BTL A;  1UHS A;  4A3M J;  2JA5 J;  2DTZ A;  4JP0 A;  4W1U A;  2EZK A;  2XPU A;  2Y9Y A;  5D19 A;  4M3E A;  2NVX J;  5F0C A;  2G7S A;  3TP3 A;  5FLM J;  2DJN A;  2JJ7 A;  4XK4 A;  5M5Y J;  5FGL A;  4X1E A;  4IHW A;  3BG5 A;  3NAU A;  5J1U A;  1B72 B;  2LD5 A;  4MFD A;  3BR1 A;  9ANT A;  4YZE A;  3ZQL A;  2MG4 A;  1HCR A;  3F1B A;  3CQZ J;  1TWF J;  2M34 A;  1JKQ C;  3FIW A;  4BY1 J;  2Y2Z A;  5IYD J;  4JL3 A;  2JN6 A;  3HTJ A;  2H1K A;  5F1J A;  4LOC A;  4XRS G;  3BR2 A;  2LVS A;  1JT0 A;  3BG9 A;  3HEF A;  3OSG A;  3EUP A;  4GCT A;  1JJ6 C;  1BW5 A;  3RD3 A;  2NS8 A;  1POG A;  4HNV A;  1TWG J;  3RZO J;  1IC8 A;  2CRG A;  4S0H B;  3IH3 A;  5EZG A;  3CWR A;  3ZQI A;  3T6N A;  1RR7 A;  3KZ9 A;  4FE7 A;  2LTP A;  5C4J J;  4A3J J;  1B72 A;  3BG3 A;  3ZOB A;  1HOM A;  2PMZ N;  2QTQ A;  3VPR A;  1ITY A;  2WV1 A;  1YRN B;  5FLV A;  1AHD P;  4L5E A;  1U8B A;  3M3Y J;  3PM1 A;  2PZ9 A;  3VUQ A;  4MO7 A;  5E3L A;  5E3O A;  1GT0 C;  3PO2 J;  4IHX A;  2EZL A;  3GTP J;  4HKU A;  2DA7 A;  3JRD A;  2IEK A;  1X2N A;  1SFO J;  2WGB A;  1AU7 A;  1AKH B;  1ETX A;  4M6V A;  1E3O C;  1XS9 A;  1OCP A;  4BKX A;  5DAJ A;  2JA6 J;  2COB A;  3JRG A;  3GTO J;  2CQQ A;  2R5Y B;  3GTQ J;  1ZR2 A;  1BA5 A;  2RAS A;  4QSH A;  2UXH A;  3BQY A;  3E7L A;  3TED A;  2QWT A;  1NK3 P;  2W53 A;  2MW8 A;  5AQC A;  2EBI A;  1JUS A;  2QKO A;  2VUM J;  1OFC X;  4XID A;  4BY7 J;  5IYC J;  1X2M A;  2LY9 A;  3ANG A;  3W6V A;  5FKO A;  3S15 J;  4CYC B;  1NTC A;  2R93 J;  3VOX A;  1YRN A;  3JRH A;  1TWH J;  1IG7 A;  2UXP A;  3JRI A;  3BR3 A;  3HGG A;  1JKR C;  1S7E A;  2L0K A;  4FE4 A;  3B81 A;  2HYJ A;  3ZQC A;  3O60 A;  5J1Y A;  2NVY J;  3BHQ A;  3S1Q J;  3CJD A;  1AKH A;  2YVH A;  3G7R A;  2NP5 A;  2IAI A;  1GV5 A;  4FIS A;  5GPA A;  3JRA A;  1BW6 A;  3MN2 A;  1FEX A;  2R5Y A;  3QPL A;  4IHY A;  3HBL A;  1IDZ A;  2O7T A;  1ZK8 A;  2G7L A;  2EZI A;  2L7F P;  1JKP C;  3RH2 A;  1MH4 A;  3OOU A;  5GP9 A;  2E2H J;  3BRU A;  1RET A;  1IRZ A;  2CU7 A;  2QCO A;  2GUH A;  4A3E J;  2WAQ N;  3MNL A;  3V78 A;  1WPK A;  2CUE A;  4B3A A;  4CYC A;  1UG2 A;  1ZGW A;  4I76 A;  2O7O A;  4UUT A;  5EF6 A;  3LJL A;  3FKI J;  1IV6 A;  3VVX A;  4NDL A;  1WH7 A;  3CDL A;  2W48 A;  2NVT J;  3BTJ A;  1JT6 A;  3S14 J;  3HOX J;  1B8I B;  2OPT A;  3NAR A;  3ZQG A;  2REK A;  5IYB J;  2GBY A;  2XGC A;  3GTJ J;  1K61 A;  3SDG A;  3FRQ A;  5HBU A;  2XRL A;  2EH3 A;  3QBM A;  2ID3 A;  4ICH A;  5EDN A;  2MSY A;  2AHQ A;  4I6Z A;  5C3E J;  2Q24 A;  2YUS A;  3ZQH A;  5HAW A;  1X58 A;  4FTH A;  1W0U A;  3BJB A;  4MIM A;  1UMQ A;  4D7N A;  1HDP A;  1ORK A;  5FJ8 J;  3PAS A;  1BL0 A;  4GCK A;  4D5C A;  4JKZ A;  3S1M J;  2LKX A;  5E3M A;  5F0H A;  5K7H A;  3G1L A;  2NP3 A;  5K7F A;  3IV5 A;  3JRC A;  1B8I A;  2HOT A;  4CGR A;  2L7M P;  5F04 A;  1T56 A;  1I3Q J;  2JA7 J;  2CQX A;  1DU6 A;  3S5R A;  2AO9 A;  3I4M J;  3O8H A;  1VND A;  1R9T J;  1A5J A;  2O8K A;  4G12 A;  4RBO A;  3C2B A;  1TWC J;  3HTA A;  4A3K J;  3K2A A;  2CUF A;  1HDD C;  2XDN A;  2XB0 X;  3LSG A;  1W0T A;  3LSP A;  1LFU P;  2D6Y A;  5M3M J;  1U78 A;  3GBG A;  2LP0 A;  1JKO C;  4A3L J;  3HTI A;  2Y0S N;  3HOU J;  3S1R J;  3HE0 A;  2D5V A;  2XPV A;  4ABZ A;  3GTL J;  3C07 A;  5F08 A;  2G0E A;  2L9R A;  2XB5 A;  2DA1 A;  2X9D A;  2PBX A;  2YU9 J;  3RQI A;  2N8G A;  4ACI A;  2ECC A;  2ID6 A;  1PUF B;  3LSJ A;  4FCY A;  5H9T A;  1I50 J;  1T33 A;  3BTI A;  4NN1 A;  3S2H J;  3BR5 A;  1RES A;  3PO3 J;  2FBQ A;  1U9N A;  2VI6 A;  1D5Y A;  2IU5 A;  3P9T A;  1GV2 A;  1A6I A;  1UI6 A;  3JRB A;  4XRM A;  2JMW A;  1XG1 A;  1G2H A;  2JK3 A;  4UUS B;  1GUU A;  5F0F A;  3A03 A;  3IH4 A;  3FK6 A;  4PXI A;  1ZQ3 P;  2XGE A;  3TP0 A;  4DYC A;  5D1R A;  2LK2 A;  1MNM C;  1Q1V A;  2K9N A;  5EYR A;  1RKW A;  1QPI A;  3G1M A;  4Y7N J;  2HQ5 A;  1JGG A;  2DMT A;  2YS9 A;  3GTG J;  5M3F J;  1Z0X A;  5FKL A;  4Y52 J;  1PUF A;  3S2D J;  1ZTR A;  2RAE A;  4ME9 A;  1JJ8 C;  1MBK A;  2F07 A;  2E2J J;  3VP5 A;  1APL C;  3A02 A;  4M3D A;  1NK2 P;  3BTC A;  2WUI A;  1OCT C;  3JRF A;  3HOY J;  4M3G A;  3QKX A;  4QTR A;  2DA5 A;  1ETW A;  3IH2 A;  5J1R A;  2Y31 A;  3NRG A;  2Y9Z A;  4GFL A;  5FMP A;  4UUS A;  2ELK A;  4GCL A;  3JR9 A;  1IUF A;  2M8G X;  3KKD A;  2X6O A;  4W97 A;  3G56 A;  3VOK A;  1LFB A;  4J19 A;  2UXO A;  5GPC A;  4IEJ A;  3SJM A;  4A69 C;  2ZCM A;  2ZCX A;  2DMN A;  2ZOZ A;  1WI3 A;  1MSE C;  5IP7 J;  2FQ4 A;  2DA2 A;  4A3B J;  1I6H J;  3RZD J;  3VW1 A;  5EGO B;  5C4X J;  4A3F J;  2E2I J;  3S16 J;  4MLO A;  2VKV A;  3WHB A;  2VPR A;  3FK7 A;  1MBE A;  1SGM A;  2JWT A; 
#chains in the Genus database with same CATH topology
 4UUV A;  4I09 A;  3OIO A;  3QOP A;  4QIW N;  2R7X A;  3NI7 A;  3A01 B;  2V9P A;  3S3M A;  2YPR A;  4HG2 A;  2ME6 A;  4IRG A;  3H3U A;  1BC8 C;  1FP1 D;  1ETO A;  3HIM A;  1MMA A;  4B4C A;  4PCQ A;  2X48 A;  4UDS A;  4S05 A;  3SWH A;  2BHY A;  1QZE A;  1R5G A;  4LJZ F;  2ZB9 A;  1KU3 A;  3VVZ A;  4HF0 A;  3MWM A;  3ERE D;  1J2X A;  4U7D A;  4Y3O A;  4MXM A;  4A93 J;  2VC1 A;  3GFI A;  4S04 A;  1IXC A;  4AVZ A;  3TMO A;  3K1M A;  3PL8 A;  4HAM A;  3E6B A;  3NNR A;  1S9H A;  1X1D A;  2WBM A;  1IJW C;  2L3D A;  3W2A A;  2QYO A;  3GZ5 A;  2XSD C;  1ZRE A;  2F4M B;  3ZMS A;  1ENH A;  2ZME A;  1Z21 A;  4MK6 A;  3AG4 H;  3ON2 A;  3PIO F;  3LQR A;  4OAY A;  4XL9 A;  4DW6 A;  3I5U A;  2VBZ A;  1RZ4 A;  2RVC A;  5D18 A;  5FB2 A;  3VEP A;  1SFX A;  2KT0 A;  3GZI A;  1KON A;  1FPQ A;  2OTJ I;  1IN5 A;  4DYR A;  1BJZ A;  3CLQ A;  4MTE A;  1ETY A;  4D0P A;  1QZY A;  2KZG A;  3FX3 A;  4MQV A;  2BBY A;  1I1G A;  2AXT C;  3S17 J;  2VL8 A;  3HB9 A;  4U0W A;  2GXB A;  4XRS A;  1J5Y A;  2HXO A;  1P6R A;  1TQM A;  1RNL A;  4QWQ A;  1HA8 A;  1TNS A;  2PMH A;  4MFE A;  3LOC A;  2V57 A;  1Z1D A;  4HNT A;  1LEB A;  4A2U A;  1MW7 A;  4HW0 A;  1MH3 A;  1Z3Y A;  2MGQ A;  1MBG A;  1QVT A;  4IOA F;  2GEN A;  2JPB A;  2RNG A;  4XOP A;  1B6A A;  1HKT A;  2W1O A;  2VJ4 A;  4LIV A;  4PJJ A;  3DEW A;  3BOQ A;  4ENK A;  3AG3 H;  3I56 I;  2Z5U A;  3CTA A;  4ZYG A;  2M5W A;  2BYV E;  3NXC A;  3Q0U A;  1LE8 B;  4RM3 A;  2G3B A;  4CO8 A;  1XCB A;  2B63 J;  3LSK A;  3KP2 A;  4F55 A;  5CXG A;  3IRQ A;  1MBH A;  2E7X A;  2LMD A;  4JYK A;  1ZHF A;  3QYE A;  5TIS C;  3VW2 A;  4PFO A;  3JTH A;  4GYI A;  2ECB A;  4BJ5 C;  3AQS A;  2LRE A;  5DCM A;  1OMI A;  3K4N A;  4B44 A;  2CW0 F;  4K2E A;  2HZT A;  2HYG D;  3KFW X;  5HS9 A;  2A3S A;  2XPW A;  3ON4 A;  2X6X A;  2OU2 A;  3R4K A;  1CQT A;  5DV5 A;  2DA4 A;  2YX4 A;  5ICF A;  4X0G A;  5DTD A;  4OIQ F;  5E8G A;  5JVT A;  1FIP A;  1KQ8 A;  4BAC A;  1JTY A;  3MKZ A;  1PP8 F;  1H8A C;  2VAS A;  3D5S C;  4N0B A;  2IS1 A;  2CSO A;  2LG4 A;  2P5K A;  4ZDP A;  2DQR A;  3IAS 2;  2DYS H;  1ZYR F;  5BNG A;  1VF9 A;  2V79 A;  3I53 A;  2L7Z A;  4ZC3 A;  3HOZ J;  3WGI A;  3HHG A;  3K70 C;  2DG7 A;  4IF4 A;  3WGG A;  3E6C C;  1T8I A;  2HTJ A;  3V8L A;  2E60 A;  2O3F A;  2M0C A;  2B9S A;  1JHF A;  4HQE A;  4A3D J;  3WTS C;  3HRT A;  4EEF G;  3AQT A;  4LLL A;  1BC7 C;  1VQN I;  2FF4 A;  2ZCN A;  1XCV A;  2R0Q C;  4MEX F;  1X1A A;  1A6Q A;  2ZXW H;  3J80 Z;  3NQO A;  2LBF A;  4KMF A;  5CPR B;  3DP7 A;  1Y0N A;  2KIM A;  4ZJZ A;  2WY7 Q;  2UXI A;  1Y1W J;  1ULY A;  2DT6 A;  3MKL A;  1TQI A;  1MSF C;  1Y1V J;  2XAQ A;  2P6T A;  3BPX A;  3GZ6 A;  1FJL A;  2DMQ A;  1S7A A;  1YI2 I;  4OMY A;  2E19 A;  3QU3 A;  2LY2 A;  3E5X A;  3JRE A;  2VBW A;  3F6O A;  3LSI A;  3OYA A;  3FBN B;  4JNN A;  2XKP A;  1OQY A;  2RN7 A;  3Q0W A;  4RMN A;  3BR6 A;  2A05 A;  1WCM J;  3SHF A;  4BBR J;  4GFK A;  4BE2 A;  3BCG A;  4XKB A;  3ABL H;  3VSK A;  1J0R A;  5IOY A;  1ZR4 A;  3OYF A;  2QBY A;  3M4O J;  1RUN A;  4AIH A;  2DOE A;  2VIX A;  2DTZ A;  2JA5 J;  4W1U A;  2XPU A;  3EUK L;  4M3E A;  3B73 A;  3T8R A;  2PN6 A;  4XK4 A;  4D1Q A;  2K3P A;  1H9G A;  3W6J B;  1ZG3 A;  2I8D A;  2VLA A;  4IHW A;  5J1U A;  1B72 B;  1Z67 A;  1WJA A;  2X6W A;  3BR1 A;  3S32 A;  2F5E A;  3F1B A;  3CQZ J;  4WXC A;  2FBI A;  4QPO A;  5CYV A;  4U7B A;  4NQW B;  2CFO A;  2BY2 A;  5CLS A;  4XRS G;  4O6J A;  1WRJ A;  2M3A A;  1DDN A;  1WKM A;  3DKX A;  2BZT A;  2B3W A;  3HUG A;  2RRE A;  3RD3 A;  2XUB A;  2HYF A;  4P1W A;  4TV7 A;  2JPC A;  3DFG A;  1IF1 A;  2Q2E B;  3DKW A;  5BS6 A;  4CUG A;  2IRF G;  3IH3 A;  4HX7 A;  4B47 A;  2V1D A;  3CWR A;  3T6N A;  2MFZ A;  3QYF A;  1RR7 A;  3CJN A;  1DUX C;  3CCV I;  4UV9 A;  2LTP A;  2A2F X;  4I99 C;  1Z3X A;  3DTK A;  5LD2 C;  1TTY A;  3RKX A;  1IV8 A;  3WTY C;  4GGG A;  1ITY A;  1F4K A;  2M7B A;  1AHD P;  4L5E A;  4U87 A;  4XN0 A;  3E3V A;  3PM1 A;  4MO7 A;  5E3L A;  5E3O A;  4HKU A;  3JRD A;  2IEK A;  5GAG J;  4F3Q A;  5F6F A;  2HDW A;  1XS9 A;  4C2M A;  5HDG A;  1RR8 C;  2JA6 J;  1B59 A;  3GO5 A;  2MD5 A;  3WU2 C;  3GTO J;  2R5Y B;  1ZR2 A;  1OR7 C;  2A68 F;  2IGN A;  4N4O B;  5ICG A;  3BQY A;  2CUJ A;  2HKX A;  4KDP A;  4U0V A;  1UG0 A;  4RGU A;  5FO5 A;  2V6E A;  3L2V A;  1JUS A;  1YIO A;  3CCJ I;  2LOO A;  1X4P A;  2KP6 A;  3GX4 X;  3L9F A;  2PLY A;  3T5X A;  2V7F A;  4BY7 J;  1B4A A;  2VPL A;  2E1N A;  1TW2 A;  1MDM B;  2V1X A;  3S15 J;  5LBQ A;  3ZMV A;  1YRN A;  3JRH A;  1IG7 A;  2J5P A;  2XAG A;  3RCO A;  3UNG C;  3JRI A;  4OD5 A;  1S7E A;  2XV4 S;  2EFP A;  2L0K A;  2VQL A;  3B81 A;  4UHT A;  4IX7 A;  3ZQC A;  2VXD A;  5J8C A;  4G7Z F;  2NVY J;  4CYD A;  3BHQ A;  2XAS A;  4L9V A;  3HOS A;  2XGX A;  2A69 F;  3G2B A;  1FX7 A;  4N4N B;  4KMU X;  4BU2 A;  1U6G A;  4HA8 A;  2BXY A;  2FU4 A;  5E17 F;  1XDS A;  5GPA A;  3LAP A;  1FEX A;  2LH9 A;  1IDZ A;  3HBL A;  2G7L A;  3V7S A;  2L7F P;  3PNT A;  4RB0 A;  1KQ9 A;  1MH4 A;  4EGZ A;  3RH2 A;  2BE5 F;  4PGH A;  4PSW A;  2ZJ2 A;  2CU7 A;  4BJT A;  1U5T C;  3VB2 A;  4NNJ A;  5EEG A;  5FLX Z;  2HWV A;  3L2C A;  3HC7 A;  3G6E I;  4CYC A;  1O3Q A;  1MIJ A;  1IW7 F;  5JHF A;  4I76 A;  3DLA A;  1IAW A;  5EF6 A;  3EYI A;  3HL2 A;  5DD8 A;  1FOK A;  1WHU A;  3BTJ A;  2Z3Y A;  2BHZ A;  3S14 J;  2VXZ A;  2MC4 A;  2REK A;  5IYB J;  3GTJ J;  3M8E A;  3SDG A;  3FRQ A;  2KIQ A;  1D3Y A;  4L9T A;  2ID3 A;  4ICH A;  2PJR B;  3R60 A;  2AHQ A;  5TRD A;  3TOB A;  2O6G E;  2YUS A;  5HAW A;  3OV8 A;  1X58 A;  3HZJ A;  4LG0 A;  3F8C A;  3NEU A;  1P9Q C;  1WJE A;  2E36 A;  2HPI A;  2XHK A;  4XON A;  3MCZ A;  4GCK A;  4D5C A;  4FHT A;  3S1M J;  3QU6 A;  1NH3 A;  4IVN A;  3G1L A;  2NP3 A;  3U9G A;  5LRS A;  1M1E B;  4NC6 A;  3JRC A;  4IO9 F;  2EA4 A;  2HR3 A;  1SVM A;  4U9N A;  3GFJ A;  2L7M P;  5F04 A;  4BUP A;  5LHH A;  2CQX A;  2DI3 A;  1G4D A;  3IRR A;  1DU6 A;  1QHH D;  2AO9 A;  2WAE A;  2LYC A;  3O8H A;  1VND A;  1W7P A;  5ILU A;  3C2H A;  2E71 A;  3HTA A;  4A0Y A;  2ZME C;  1HDD C;  4R1H A;  3ABM H;  1L3L A;  3SZT A;  1JKO C;  4AVP A;  2VE8 A;  4A3L J;  3DPL C;  3TL4 X;  3HOU J;  2MC3 A;  1Z9C A;  4YIR X;  2HZD A;  1Y8Q B;  3S1R J;  2D5V A;  4ENM A;  1FZP B;  2P5L C;  2X6Y A;  2RKH A;  2X9D A;  2DXI A;  3OYC A;  3I9V 2;  5AIQ A;  3RQI A;  4ACI A;  2ID6 A;  2LRD A;  2XC7 A;  3CUQ A;  2NNN A;  5HNF A;  3S2H J;  2D1V A;  4YFK F;  1C0W A;  3PUF A;  1U5T B;  2FBQ A;  1D5Y A;  2PFB A;  3QYB A;  5HOO A;  4WX9 A;  4M71 A;  1IO2 A;  2JMW A;  2JTV A;  4UUS B;  1GUU A;  4MQ9 F;  3OYK A;  2WB1 A;  2K4B A;  3EDP A;  4LIU A;  1ZQ3 P;  2G9W A;  1LVK A;  2DO7 A;  4H4K C;  1RKW A;  2H6B A;  2P5V A;  2V1N A;  2L01 A;  4Y7N J;  2DMT A;  3L2Q A;  3LWF A;  5FD5 A;  4Z2Y A;  1RRJ A;  2QQB A;  3CC4 I;  3GTG J;  5FLX K;  5ERI A;  3D5R C;  1ZTR A;  4ME9 A;  1WFX A;  2X1E A;  4E7J A;  1XN7 A;  1XSV A;  2XVC A;  2B1E A;  1Y39 A;  3A02 A;  3BTC A;  1OCT C;  2RDP A;  3VFZ A;  3HOY J;  3HPG A;  5AON A;  3GW2 A;  2UXX A;  3MZH A;  3TO9 A;  5GTH C;  2OV7 A;  3NRG A;  4GFL A;  2KQR A;  5D4S A;  2Y9Z A;  5B5E C;  4IJA A;  2BVM A;  4C9Y A;  2CQN A;  4EJV A;  4GCL A;  2KRC A;  4YFX F;  3RKW A;  1WSU A;  2AQE A;  2P7V B;  4RLF A;  4M9S A;  1R4N B;  2IGO A;  5ILS A;  4IRH A;  1VTN C;  3V8J A;  5HDK A;  5GPC A;  3BY6 A;  3TOA A;  4A69 C;  3V42 A;  1WI3 A;  4JQF A;  1I6H J;  2NAZ A;  2OZU A;  1I5Z A;  3RZD J;  4A3F J;  1H0M A;  2E2I J;  3S16 J;  1TT5 B;  1TZL A;  2ISY A;  1SD6 A;  2OCE A;  4XLN F;  2VPR A;  3E0J B;  4M6X A;  2JVG A;  2ZME B;  1Z7L A;  2CW8 A;  2O61 A;  2VJI A;  2H94 A;  3U1D A;  1D8K A;  3I3L A;  1R58 A;  2MBF A;  4QLC U;  5FD6 A;  2VE9 A;  1BR1 A;  3MKY B;  3ZQQ A;  3KP5 A;  4DYQ A;  3J81 Z;  2UZK A;  4KFC A;  3G3Z A;  2LKS A;  3I55 I;  3KP6 A;  1VFC A;  2WTE A;  3MAJ A;  4E6K G;  1R5I D;  3J7A O;  2QKL B;  3M8J A;  5IP9 J;  2GM4 A;  2K40 A;  3CMY A;  4BHB A;  3X2Q H;  3G1O A;  3JW4 A;  4NEL A;  3U21 A;  4RB1 A;  3ZMZ A;  3C18 A;  3DBR B;  4PFP A;  2QWW A;  3PIP F;  3K2Z A;  2JUC A;  1VQK I;  1Z77 A;  2LLK A;  3DEU A;  1USS A;  3IC7 A;  3GTM J;  4Y4R A;  3JAM K;  3ULQ B;  4FT8 A;  4P9F A;  5E1X A;  4V2G A;  4NBQ A;  5D8K B;  1NG7 A;  2O9L A;  2DCE A;  1G8X A;  4ZYD A;  5HLH A;  2QF7 A;  1RC9 A;  3F8M A;  2HKU A;  1JUP A;  1W5C C;  3KYC B;  3M1E A;  3WTZ A;  3NRV A;  5K58 A;  2HI3 A;  3FBI B;  2HGC A;  3K0L A;  2HYT A;  2HOS A;  3I54 A;  1W1W E;  2ME0 A;  3ABT A;  1DP7 P;  1IN6 A;  2R5Z A;  1R4M B;  4EVI A;  3BG6 A;  1VQ7 I;  5IT9 Z;  5EEA A;  3HRS A;  3V4G A;  1DU0 A;  4J01 A;  4BBS J;  2DTR A;  2HOA A;  4M73 A;  4BXX J;  4KN7 X;  4MEY F;  2HDD A;  2XIG A;  4A3C J;  4PZJ A;  1PJR A;  3K6G A;  1GXP A;  2DMU A;  5DCM B;  1ZH5 A;  1UEL B;  2GAU A;  1QRY A;  1JE8 A;  3HDD A;  1ODD A;  1Z6R A;  1DGR M;  1ETV A;  1RPW A;  1R23 A;  4GFB A;  2FMY A;  2L9V A;  3CRJ A;  1GXQ A;  4HSR A;  1R7J A;  4BNC A;  1T95 A;  2FBK A;  1GVD A;  1RKT A;  4M6Y A;  3HGY A;  5KCM A;  4DZJ A;  3JSP A;  4X6A J;  4MHG A;  4RGR A;  2YX7 A;  1U9O A;  2FD5 A;  2VKE A;  4A3G J;  3NS4 A;  3RJP A;  1QA6 A;  3DCF A;  1MMS A;  1CF7 A;  2M45 A;  1X4O A;  1Z05 A;  2VBX A;  3D5L A;  3VOD A;  1V55 H;  1P2F A;  1TC3 C;  1PP7 U;  1XPX A;  3Q0V A;  3GF2 A;  3BNI A;  2NVU B;  1SFE A;  1P7J A;  3H5R A;  4M74 A;  4U9L A;  5FKK A;  5KAI C;  3F9K A;  3OYD A;  2NS0 A;  1JTX A;  2V26 A;  3OYM A;  4QPQ A;  1SVL A;  4KIC A;  3HSR A;  1N77 A;  1MNE A;  2WB1 N;  1RI7 A;  2OF7 A;  1E3P A;  2LBF B;  2W4S A;  1WJ5 A;  2KFD A;  5DM7 F;  2EQR A;  1YIJ I;  2H8R A;  2IBD A;  1FTT A;  1XMK A;  2UXU A;  2IA2 A;  1T2K A;  3J81 K;  2XF5 A;  3LHQ A;  5HLT A;  3AG1 H;  5AIP A;  5EG0 A;  1MJB A;  3OYE A;  2FQ3 A;  1YTY A;  1OJL A;  1T0F A;  3A0H C;  2OQR A;  3B6A A;  1O4X A;  4XIC A;  2QSG X;  3BG7 A;  5HSZ A;  2NS7 A;  3CES A;  3OR1 C;  4CIC A;  4L9J A;  4I98 B;  2K7L A;  3VYS B;  5L3F A;  5C4Y A;  5D6F A;  4ANJ A;  3KYL A;  2QBY B;  4HOB A;  3CZ6 A;  3TW7 A;  3K7A J;  1FBU A;  2QZ8 A;  4E7S A;  1JGS A;  3I58 A;  3IHU A;  4L0Y B;  4Z6Y A;  2L7K A;  4RB3 C;  2EIN H;  3E6M A;  2EZH A;  4RS8 A;  2EIM H;  5HNH A;  4G94 A;  2DBB A;  2L54 A;  3IP4 B;  4O3M A;  1LQ1 A;  2YVX A;  3O8G A;  2R7W A;  4CCM A;  2VJJ A;  3GTK J;  4JX4 A;  5J3L A;  4ENN A;  4AC0 A;  1T6S A;  2NX4 A;  4IQ4 A;  3QP6 A;  3OYN A;  5EFY A;  2M9H A;  4KA4 A;  3HUG B;  5IT9 K;  1G59 A;  1K6Y A;  2EIL H;  3IKT A;  1T38 A;  2Z2S B;  5K7Z A;  4BGD A;  4WF2 A;  4JP0 A;  3VOE A;  4AWX B;  2Y9Y A;  5D19 A;  1X3U A;  2VOD A;  4UB8 C;  1ONV A;  4RAG A;  5F0C A;  3TP3 A;  5FLM J;  2DJN A;  5M5Y J;  5FGL A;  1U0J A;  3KP3 A;  2A6E F;  3NAU A;  1XSX A;  2LD5 A;  2CV1 A;  1G6N A;  3TGN A;  1JKQ C;  5L3G A;  3GXO A;  3OYH A;  2XF6 A;  3PSF A;  4XRF A;  2IVM A;  2QQ8 A;  4M9X A;  1LFP A;  2H1K A;  2VOO A;  4NC7 A;  2EJR A;  2LVS A;  2WY8 Q;  4A12 A;  4NHJ A;  3RKY A;  4HDU A;  1LJ9 A;  5D5W B;  2DFE A;  3SXY A;  2QQA A;  3OSG A;  3EUP A;  4UVB A;  4XLF A;  5HVQ C;  3LFK A;  4DQ2 A;  2DT5 A;  2M87 A;  1AOY A;  1TWG J;  4YEJ A;  3CMM A;  5ICE A;  2CRG A;  4S0H B;  1X3Z B;  3KP7 A;  5EZG A;  3ZQI A;  2XAH A;  3E1S A;  4LIT A;  3HOT A;  2ZFW A;  1LDD A;  2P8T A;  2BEO A;  1TQP A;  3KZ9 A;  4DBQ A;  4L18 B;  4FE7 A;  5C4J J;  1ZAR A;  2P7C B;  2HOE A;  3BG3 A;  2OA4 A;  3E5U A;  3WU1 B;  2P4W A;  5FRO A;  1NHA A;  4IRI A;  3VPR A;  4A0Z A;  2QSH X;  2WV1 A;  4OIN F;  1YRN B;  1JXS A;  3M9A A;  1Z6T A;  4GCV A;  1EH8 A;  3F22 A;  1P4X A;  1GT0 C;  2EWN A;  2M4G A;  3F23 A;  4WXH A;  2NRA C;  2WGB A;  1X2N A;  1YQA A;  3K9T A;  1ETX A;  4M6V A;  4CH7 A;  5H20 A;  2F5C A;  1OKR A;  1OCP A;  4BKX A;  3DPT A;  3H5N A;  2CQQ A;  4ZZD A;  2FML A;  4AU7 A;  5D5X B;  3ONQ A;  1BR2 A;  1R49 A;  3MFK A;  4QSH A;  2DPU A;  4BE1 A;  3TED A;  2UXH A;  2FOK A;  3LAJ A;  2X0L A;  2EBI A;  3CUQ C;  4EM2 A;  2QKO A;  2CYY A;  2OD5 A;  4XID A;  3FMR A;  3K4B A;  2DAO A;  3FXK A;  1U8R A;  3KCC A;  1MMN A;  2ICW G;  4UVA A;  4CYC B;  3HG9 A;  4GDF A;  2GXG A;  4PK4 A;  3E6D A;  2HVR A;  1BR4 A;  3ELK A;  1EKE A;  4MGR A;  3ZR8 X;  5J1Y A;  4ESF A;  4HZF A;  2BGC A;  5D5U B;  2XAF A;  1AKH A;  5E1Z B;  4RB2 C;  2O03 A;  3HIF A;  2CV2 A;  3CUO A;  2Z9O A;  4FIS A;  1BW6 A;  3CCU I;  3DBH B;  3CO6 C;  4HYE A;  4IHY A;  4JBA A;  2LC2 A;  1ZK8 A;  3WE3 A;  5J47 A;  2O7T A;  2W84 A;  3DKY A;  5CVR A;  3OOU A;  4LG0 B;  2GA1 A;  3BRU A;  2V9K A;  2V4J C;  1S7O A;  3Q9S A;  2MA3 A;  5CQG A;  1FYL A;  2GUH A;  4A3E J;  3FXL A;  4B3A A;  1ZG5 A;  1QPM A;  2PI0 A;  1W7P D;  2O7O A;  5CVV A;  1YS7 A;  3E97 A;  3IKV A;  3LJL A;  3FKI J;  1A31 A;  3G4S I;  2R7V A;  1S5L C;  4NDL A;  2H6C A;  3DWL E;  2NVT J;  1KYW A;  3OIQ A;  5DM6 F;  3HOX J;  2BVL A;  3PSI A;  4PJL A;  2GIZ A;  1VQ9 I;  3FHZ A;  1TL8 A;  4CA0 A;  1Z7U A;  3H9J A;  3A0B C;  1OYI A;  2GZW A;  2LY1 A;  3I71 A;  5BOX A;  1BN5 A;  1SFK A;  1ACI A;  1ON1 A;  3S3N A;  3RI4 A;  4XLH A;  5EDN A;  1W7P B;  2MSY A;  3H35 A;  2G7U A;  3CJT B;  5CKT A;  5JI6 A;  2LF7 A;  3LST A;  4FET A;  1W0U A;  1FLI A;  2IS2 A;  3F21 A;  2ZXH A;  4ITV A;  4MIM A;  5KK1 A;  2CGP A;  1HDP A;  3GLL A;  4E4H A;  3BPV A;  3BLY A;  4YII A;  2KMU A;  2YSR A;  4UXN A;  1A35 A;  4XNF A;  4OOI A;  2LKX A;  3HXL A;  5BPD A;  3CJQ B;  5E79 C;  4A6E A;  3IV5 A;  5L3D A;  2XAU A;  2JQ7 A;  1UHW A;  3CUQ B;  2JA2 A;  4OMZ A;  2FRH A;  2FBH A;  1P4W A;  4WIB A;  3S5R A;  1XMA A;  5GAE J;  1R9T J;  1A5J A;  2ETH A;  2BY3 A;  2GQQ A;  4I7H A;  2CQ7 A;  3C2B A;  3I4P A;  2QQ9 A;  4A3K J;  2VJ5 A;  1HKQ A;  1PVE A;  1SAX A;  3PFY A;  4B48 A;  3LSP A;  5ED4 A;  5M3M J;  3DU6 A;  3GBG A;  1IZ1 A;  1U78 A;  3TO7 A;  5DUI A;  3KX2 A;  2KPM A;  4KJZ A;  2P0W A;  5EJC A;  4CCO A;  3RTR A;  3EUH A;  3HE0 A;  2PX9 A;  1HST A;  4LMY A;  4ABZ A;  5JR3 A;  5A2Q Z;  1J75 A;  2Z99 A;  4PUS A;  3ERM A;  1I50 J;  4OIO F;  3EUA A;  3H1C A;  4NN1 A;  4LG3 A;  3BR5 A;  1A36 A;  1KA8 A;  2JT1 A;  3HPH A;  4LB5 A;  3PO3 J;  3CME I;  2Q0O A;  2IU5 A;  1GV2 A;  4OD4 A;  3L7W A;  1A6I A;  4E7K A;  3JRB A;  4XRM A;  4L9N A;  3BZK A;  1K78 A;  3BDD A;  1G2H A;  4ON0 A;  2K9M A;  2FSW A;  1O7L A;  3IH4 A;  2L4M A;  2DPD A;  4PXI A;  1KU2 A;  3DBL B;  5B1B H;  4UNO A;  2EA2 A;  2KRF A;  2HFH A;  1FYK A;  4HPQ A;  1W5S A;  5D1R A;  1W5T A;  1MNM C;  5EYR A;  2R7T A;  3KEQ A;  2XRO A;  4Y15 A;  3J80 K;  5DD4 A;  4XN3 A;  2C6Y A;  4DIQ A;  1SD4 A;  1XB4 A;  5FKL A;  1PUF A;  3R61 A;  4G7O F;  2F07 A;  4PSX A;  4M72 A;  3VP5 A;  1IN8 A;  2HVQ A;  4XOT A;  2QM3 A;  2W00 A;  4B3X A;  4CCK A;  4M3D A;  1GHC A;  3JRF A;  3CCM I;  3QKX A;  4QTR A;  5J1R A;  3IH2 A;  3WTT C;  1E17 A;  3TBI A;  3AG2 H;  1R1U A;  2IXS A;  3SEZ A;  1OIS A;  4CCJ A;  1IUF A;  1D1C A;  5L3B A;  1FMW A;  1VQ5 I;  5FRN A;  3VOK A;  4HV6 A;  1PUE E;  2CW7 A;  1QQI A;  3PQJ A;  4C2U A;  5KHD A;  2UXO A;  4IEJ A;  1ZGJ A;  3MQ0 A;  3GYH X;  1D5V A;  4KYW A;  3U1K A;  1MSE C;  5IP7 J;  4A3B J;  2B7E A;  3FXM A;  3TDU C;  2IGM A;  3OMY A;  1WVR A;  2W7N A;  1O7F A;  5K5Q A;  5KNL A;  1MJ9 A;  1MBE A;  3PFI A;  3LQQ A;  4IXA A;  2GXA A;  4OIR F;  3BP8 A;  4P9U A;  3GEU A;  2IW5 A;  1FMV A;  3COL A;  5F27 A;  3VVY A;  2E5N A;  2Q8K A;  4CCN A;  2R7Z J;  1WQ2 A;  4A3I J;  1T0F C;  1VQL I;  3SFZ A;  2Y30 A;  4E7H A;  2EV5 A;  4U0Y A;  2VT2 A;  2W24 A;  4HLY A;  3I59 A;  3SQN A;  2NXN B;  3M1C A;  4KWA A;  5K5R A;  3W2W A;  2F48 A;  3K4K A;  2ISZ A;  2H1L A;  1YIT I;  2DDA A;  5BPI A;  2GOM A;  1L0O C;  1SMY F;  3VYU B;  5EGO A;  1VI0 A;  5D6E A;  2R5Z B;  2VBY A;  2X85 A;  1GLN A;  2FX0 A;  3KEO A;  3RYR A;  1ZRF A;  3BCA A;  4HST A;  2G7G A;  3CCS I;  5JFR A;  2DA6 A;  2ZJQ F;  2ELJ A;  4B1R A;  4D7M A;  3F6V A;  3VDX A;  4HV5 A;  4JX6 A;  3O6B B;  4KUM A;  3OYI A;  1V3F A;  3B6C A;  2F6C A;  3F3X A;  4RAZ A;  4EGY A;  1Y0U A;  4JK1 X;  3VYT B;  2P81 A;  2DK8 A;  3AFH A;  3LSH A;  2QIB A;  3ABU A;  3K4L A;  3FM3 A;  4PJN A;  1Y6I A;  4ESB A;  2CJJ A;  4L5I A;  4GXO A;  2OTL I;  2PMZ A;  1S8N A;  1CF7 B;  2FNP A;  4YRV A;  1WGX A;  2W57 A;  3DPJ A;  1I3A A;  4PJ0 C;  6PAX A;  2TCT A;  3MVP A;  5FFZ A;  1H9T A;  2PEX A;  2Y75 A;  3BC8 A;  3QP5 A;  2ZOY A;  2DOD A;  5LRR A;  1S29 A;  4G6T B;  1XGM A;  2KDO A;  4I02 A;  1QZZ A;  3RPU D;  3S2W A;  3SEQ A;  1UFM A;  3PPB A;  1A04 A;  5FHP A;  3KZY A;  4HLX A;  1EV7 A;  2VT3 A;  3OS0 A;  4KIT B;  4EQQ A;  4XBF A;  2K85 A;  5GAH J;  2EFO A;  2DN0 A;  5EG0 B;  3HHH A;  3SFI A;  3N4M A;  1X1C A;  1B9M A;  2GIV A;  4IPA A;  3O2P E;  4C2M J;  2ACJ A;  2RQQ A;  2LSO A;  2M8E A;  4LGW A;  1D0Y A;  4D5F A;  1XC5 A;  3BT9 A;  1X3W B;  2DOA A;  1SD5 A;  2DU9 A;  3FZV A;  2F4I A;  1FSE A;  1TW3 A;  3FWE A;  4JOM A;  1ZLJ A;  5EZH A;  4ZTJ A;  2DG8 A;  1ZLK A;  1UCR A;  4IZZ A;  2DK5 A;  2K02 A;  2R7R A;  2AQF A;  2E1O A;  2LR8 A;  2KDZ A;  2PG4 A;  1YJN I;  3FF5 A;  3KPH A;  4JX5 A;  5B1A H;  1MBJ A;  1QGP A;  2LFB A;  3DTE A;  5H2F C;  2R4G A;  2QLZ A;  1IGN A;  1HQC A;  1WH5 A;  3H36 A;  1XSD A;  1ZKG A;  3LA3 A;  4A5N A;  1N25 A;  2WAQ A;  5E18 F;  1ZG1 A;  2E1C A;  5F1R A;  3FMS A;  4RDU A;  2CV0 A;  2HVS A;  3K69 A;  1P7I A;  1Q1H A;  5EEH A;  5FKN A;  4C3I J;  1V54 H;  3Q9V A;  3D1N I;  3FXJ A;  5IPA A;  2CQK A;  3LA2 A;  3LMM A;  4M3B A;  1IRG A;  1R1V A;  1UJ8 A;  2JVH A;  3F8N A;  1UAA A;  4C30 A;  1FSH A;  2OUM A;  5KAF C;  3ESW B;  2IGK A;  2K9Q A;  4V19 K;  2G7H A;  2NOG A;  1HSJ A;  2DFI A;  1QVU A;  4BE0 A;  3HOW J;  5C44 J;  4M3F A;  1BI1 A;  5B3S H;  3K4M A;  2EFW A;  3KLO A;  2D1H A;  3R0A A;  2UUZ A;  1JUM A;  4LK0 F;  3KET A;  4WWC A;  1B1B A;  3H3Z A;  3WE2 A;  4G9Y A;  5J4V A;  3CCQ I;  2R7S A;  1FOX A;  2Z16 A;  2R7U A;  4AUX A;  3EPZ A;  1I1S A;  3I4N J;  5JLX A;  3JSJ A;  2A5Y B;  1FNN A;  3KKC A;  2NOJ B;  1SAN A;  3M8F A;  1YJW I;  4HBL A;  2QOP A;  4DVY P;  2IPQ X;  2EFQ A;  3QPS A;  2TDX A;  5D8L B;  1DPU A;  2CWE A;  4ZYA A;  2YVE A;  4P55 A;  5DS9 A;  3HJE A;  3H0D A;  4XKC A;  2ZO4 A;  2ZCW A;  2ZSH B;  5BQT A;  3F72 A;  1FBS A;  2TRT A;  2BW3 A;  3OS1 A;  3BTL A;  2X1C A;  4A3M J;  3ISP A;  2VQH A;  2EZK A;  2H09 A;  3SZG A;  2JJ7 A;  3S93 A;  5K5O A;  4HRI A;  2K3F A;  2OZ6 A;  4XLP F;  2V9V A;  4MFD A;  3MZ8 A;  1X1P A;  1N75 A;  2X51 A;  1HCR A;  3QOE A;  3RYP A;  1IN7 A;  2M34 A;  4CXF A;  3FIW A;  4PGG A;  2DDB A;  2Y0S A;  5H6R A;  4AD9 A;  3F8F A;  2JN6 A;  1KZH A;  4LOC A;  5F1J A;  4BEH A;  2COM A;  1LNW A;  2F5V A;  2HQA A;  2Z1D A;  1J09 A;  3OOP A;  4A0X A;  3BG9 A;  3HEF A;  1REP C;  2KLO A;  1JJ6 C;  1BW5 A;  3W6K B;  4WK8 F;  1POG A;  3AAF A;  2Y69 H;  1EH6 A;  2A61 A;  4E7Z A;  2DJI A;  1BI3 A;  3WTW C;  1WJB A;  4KIB A;  5HS7 A;  4FX0 A;  5IY5 H;  2RV8 A;  3SDB A;  1F9N A;  3DV8 A;  3JCU C;  2PMZ N;  2QTQ A;  3BJO A;  2STT A;  2KKO A;  3ZN0 A;  1W36 D;  3DEE A;  2EPF A;  2H27 A;  5E1W A;  3OL4 A;  4G6Q A;  1FBQ A;  1LPQ A;  3PO2 J;  3HRM A;  4IHX A;  3FDY A;  2DA7 A;  1SFO J;  4IKF A;  2KIU A;  3CF5 F;  3CDI A;  1AU7 A;  1AKH B;  3FMQ A;  3G71 I;  1E3O C;  4BXU A;  3EUH C;  3W2V A;  2ZNY A;  5DAJ A;  2COB A;  5TGT A;  2L5Q A;  2F2E A;  2RAS A;  4KT6 A;  2QWT A;  3C7J A;  1IN4 A;  3WOD F;  2W53 A;  2MW8 A;  5ICC A;  3T0Y A;  3OR2 C;  2PBI A;  2VUM J;  1OFC X;  3OYL A;  3TQN A;  4IL6 C;  1VQ8 I;  5IYC J;  4RM2 A;  3ANG A;  2FA5 A;  1TBX A;  1Y8R B;  4GRI A;  2R93 J;  2Y0M A;  4R8H A;  3ABK H;  3MKW B;  3GEZ A;  2QGU A;  4FE4 A;  2KHM A;  3U2R A;  1G3W A;  1HW1 A;  1J9I A;  4EJW A;  4H0E A;  4CGZ A;  5L3E A;  4LLG F;  3WG7 H;  3GZN B;  3RPU A;  3G7R A;  1BM9 A;  4XLE A;  3I64 A;  3JSO A;  1GV5 A;  2BY0 A;  5J8F A;  3JRA A;  1IXS B;  3KYD B;  2EZI A;  1YW7 A;  1LDK B;  2XAJ A;  1JKP C;  3R6S A;  5GP9 A;  2E2H J;  1X1B A;  2IA0 A;  1CGP A;  1IRZ A;  1YO5 C;  5D5V B;  1HXD A;  2YU3 A;  1AA7 A;  2WAQ N;  3MNL A;  1WPK A;  2ZY9 A;  4XLC A;  1S6L A;  1UG2 A;  1ZEL A;  5L3C A;  4UUT A;  2KJC A;  3CP2 A;  4LK1 F;  1IV6 A;  3VVX A;  4B43 A;  3CCR I;  1WH7 A;  3MMY B;  5B66 C;  2OPT A;  3NAR A;  2XGC A;  1I27 A;  5J40 A;  3WTU C;  4CSW A;  5HBU A;  4N9I A;  3NWS A;  2RGV A;  1ON2 A;  2D2W A;  3P5J A;  5KVR A;  2QUF A;  1DQU A;  3ZQH A;  5C3E J;  1LB2 A;  4FTH A;  5F64 A;  2O5R A;  1STZ A;  1G3S A;  4D7N A;  1ORK A;  2CG4 A;  1XMX A;  3KLN A;  1WZ2 A;  5CVJ A;  2RC4 A;  4BL0 B;  3M07 A;  3TO6 A;  3ECH A;  3C2G A;  4WXD A;  4F92 B;  3EYY A;  5K7F A;  5J6X A;  1IRX A;  3K1N A;  1O3S A;  1B8I A;  2JRT A;  1T98 A;  1UB9 A;  2ELH A;  3H9Q A;  3SZP A;  3N97 A;  2JA7 J;  5HLG A;  2OC6 A;  3CC2 I;  3S8P A;  4N9H A;  3ML6 A;  3QOD A;  4A6D A;  4XSX F;  4BAY A;  5LGN A;  3WTV C;  4G12 A;  4RBO A;  2AXL A;  3K2A A;  4XQF A;  5DCF A;  3LSG A;  4XLA A;  2D45 A;  1W0T A;  2XSJ C;  1K78 B;  1LFU P;  2D6Y A;  2DLL A;  5K1Y A;  2JUG A;  2L4A A;  4BYY A;  4AM3 A;  4P5O A;  4EM1 A;  2Y0S N;  3C3W A;  2ZJP F;  5J4Y A;  3DXJ F;  2AS5 F;  1YOV B;  2XPV A;  3GTL J;  3ZGK A;  3C07 A;  4CHU A;  2OCC H;  2L9R A;  2XB5 A;  3LSM A;  3OWT A;  1PUF B;  4FCY A;  4KNY A;  3WGH A;  1FWZ A;  2B0L A;  1BJA A;  3DF8 A;  2IA1 A;  1R00 A;  3A4C A;  3HTS B;  2MYS A;  2IS6 A;  1RES A;  1U9N A;  1R5H A;  4BQO A;  2OBP A;  1KU7 A;  3P9T A;  4ASN A;  3BWG A;  1S3J A;  4KIG A;  3HKZ A;  4OU0 A;  1MND A;  4EJO A;  2A6H F;  3A03 A;  3RDI A;  1QHG A;  1OYY A;  3FK6 A;  3GFL A;  4HEA 2;  2BOL A;  4Y33 A;  3TP0 A;  4AYB A;  3KP4 A;  2EV6 A;  3G1M A;  1JGG A;  2HQ5 A;  2VKD A;  3ZXS A;  4YFN F;  4UB6 C;  4CZZ A;  4ENJ A;  2WAF A;  3S2D J;  2O0Y A;  3V8K A;  2K27 A;  1ZRC A;  5HS8 A;  4I01 A;  2OAZ A;  5HDN A;  4RAY A;  1APL C;  2VQC A;  4F93 B;  4IRV A;  4M3G A;  1MKM A;  3CP8 A;  4G7H F;  4ZDL A;  3CCL I;  1SEU A;  2Y31 A;  2ZC2 A;  1T08 B;  4BQN A;  3JTG A;  1YJ9 I;  1JHH A;  2RNJ A;  3IWZ A;  2ELK A;  1G3T A;  3FXQ A;  3I59 B;  3N05 A;  2A6T A;  1MD0 A;  1D1B A;  3L2W A;  4ESJ A;  4W97 A;  3L00 A;  4DJA A;  2ADU A;  1LKX A;  1I39 A;  2P6S A;  2NNY A;  3SJM A;  2ZCM A;  2ZCX A;  3WG9 A;  3VW1 A;  2FQ4 A;  2DA2 A;  5EGO B;  5C4X J;  3OIP A;  3L2R A;  1SFU A;  4IHT A;  2VKV A;  1UHM A;  1KQ0 A;  1MBF A;  3FM5 A;  3FK7 A;  1SGM A;  3G56 A;  2NVQ J;  1YW9 A;  3FKJ A;  1K83 J;  5FKM A;  1HW2 A;  1D0X A;  5CVU A;  3AL0 C;  1LDJ A;  3OSF A;  1HC8 A;  3ZRG A;  2QA4 I;  4J00 A;  3IAM 2;  3P9C A;  2K9S A;  3F8B A;  2UV1 A;  1TWA J;  3C1D A;  4NC8 A;  4BH9 A;  1QBJ A;  2E1M C;  3COA C;  3HTH A;  1OYW A;  3VYR B;  1SAU A;  4IHV A;  3EGQ A;  4HNU A;  5LEJ A;  2HXI A;  1EF4 A;  1BBY A;  1HLV A;  3BQZ A;  2MAB A;  2CFX A;  2QSF X;  2UXN A;  4C3H J;  3T1B A;  3IUV A;  4XM3 A;  2FEZ A;  2BY1 A;  2I10 A;  2GLO A;  3WHC A;  2GOX B;  1BIA A;  2KRH A;  3RPQ A;  1XTA A;  1KGS A;  5TJJ A;  2CS3 A;  1OLT A;  3ZMT A;  2DOF A;  3R0J A;  3HSF A;  4L0Z B;  4E7I A;  1GDT A;  2M30 A;  3DLL F;  1YW8 A;  3FXO A;  2ESH A;  3A01 A;  4E70 A;  1H88 C;  2IP2 A;  3BR0 A;  3B02 A;  1XD7 A;  4R79 A;  4AC6 A;  2HPM A;  3ZQF A;  4BDZ A;  2PMU A;  1QNT A;  1K79 A;  2RHA A;  3ASN H;  1YE9 A;  4I0A A;  5IP6 A;  2STW A;  2ZNZ A;  3FXU A;  1YS6 A;  4FAS D;  4L5J A;  2HS5 A;  3S3O A;  1YYV A;  4EAT A;  1XGN A;  1OCZ H;  3VWB A;  2EB7 A;  2DA3 A;  1SMT A;  5E3N A;  2JRM A;  3LSR A;  3V6G A;  4AF5 A;  2JA8 J;  2IJL A;  1K6O A;  3D0S A;  4MNU A;  4AIK A;  4XKV A;  3K8P C;  3NWT A;  3K70 D;  3E7Q A;  3VIB A;  3CJR B;  1V4R A;  2XF7 A;  2LNB A;  1XDU A;  2IT0 A;  3F0C A;  1LEA A;  1D1A A;  3FIS A;  1I6X A;  4LB6 B;  2L9N A;  5M5W J;  2DMP A;  2QVO A;  3GUD A;  1FYM A;  1HF0 A;  4BS9 A;  1G3Y A;  1TLH B;  4UY8 I;  2IS4 A;  3HYI A;  2GWR A;  1SVO A;  2JZY A;  5DYM A;  3K4J A;  1XX5 A;  1OCO H;  1FIA A;  1MJA A;  5HOD A;  3E5Q A;  1VQM I;  2HU9 A;  2VQG A;  2CO5 A;  3LWJ A;  1LVA A;  1D0Z A;  3H5A A;  5CW8 A;  4CCL A;  2DYR H;  5M5X J;  1FTZ A;  2ZXJ A;  2MH2 A;  3NPI A;  4DZP A;  2OI8 A;  3H3V K;  5IOZ A;  3KE2 A;  2OJE D;  2WV0 A;  5CVI A;  4EMS A;  3RKQ A;  3ANP A;  2L9S A;  3Q3S A;  3AL0 B;  2XDV A;  4RLQ A;  1D8J A;  3GVA A;  4BJ6 C;  2GFN A;  2XGD A;  1V5G A;  1WI9 A;  2E1M B;  1H89 C;  1ETK A;  3DTI A;  4RGS A;  3HKZ N;  3A1Y A;  2BV6 A;  4ETS A;  5IT3 A;  2A5W A;  5LGU A;  3VW0 A;  5FGM A;  1QU3 A;  2R92 J;  1TT0 A;  2JSC A;  4GO1 A;  5LHG A;  2HQN A;  4AYB N;  3HRU A;  4HF1 A;  2J5O A;  2KZV A;  3QQA A;  1LE8 A;  3CDH A;  1ETQ A;  3UKG A;  3M7G A;  3Q5F A;  1KU9 A;  2ZXI A;  3KIO A;  3CCY A;  3T8T A;  4BHP A;  4II2 A;  2KIS A;  4Q47 A;  3BRO A;  5LLQ A;  1QO0 D;  1R36 A;  5HLI A;  1F5T A;  1P4A A;  4LFU A;  4PDK A;  1MGT A;  2E34 A;  2BW3 B;  3GME A;  3I0T A;  4V2F A;  3H0G J;  3UR3 C;  4DOZ A;  4ZYH A;  2HQR A;  1U3E M;  3S1N J;  2FE3 A;  1IDY A;  1FT9 A;  3HOV J;  4BQQ A;  1F36 A;  2ZFU A;  5GAD J;  5DDG A;  3MD2 A;  3RSN A;  1T39 A;  3MEX A;  3HTU A;  1BI0 A;  1O3T A;  1WJC A;  2DFF A;  2M2E A;  2DQL A;  4CDG A;  3CLO A;  3L1P A;  4C2T A;  1F43 A;  2CMP A;  2F4O B;  4U88 A;  4XSZ F;  1PYV A;  3ZP5 A;  5CXI A;  3KZI C;  2L02 A;  3AKZ A;  3CD6 I;  4GYG A;  4BEH B;  4HF2 A;  1UI5 A;  2EFN A;  2DT7 B;  2FJ1 A;  1UZC A;  3TW6 A;  4L62 A;  4WCG A;  3KNW A;  5CQE A;  4ZZL A;  3LNQ A;  1ZRD A;  5JLW A;  3HM5 A;  3EET A;  4C3J J;  2OER A;  2XKO A;  3BZ6 A;  3CF2 A;  5A2Q K;  4XMY A;  1UHS A;  4ZYE A;  2MD0 A;  2FXA A;  1AWC A;  2M0M A;  1J7K A;  2O8X A;  2BXZ A;  2NVX J;  2G7S A;  1FOY A;  4FX4 A;  2VON A;  2ZJR F;  4P96 A;  3TKY A;  4X1E A;  1DP3 A;  1DGW Y;  3BG5 A;  1HKS A;  4AIJ A;  1R71 A;  9ANT A;  4YZE A;  4LD5 A;  3OYG A;  3ZQL A;  2MG4 A;  1YX5 A;  1TWF J;  3L2U A;  2NYX A;  5CJ9 A;  4BY1 J;  2HEO A;  3OL3 A;  2Y2Z A;  4BDY A;  5IYD J;  3PQK A;  4JL3 A;  3HTJ A;  1W4M A;  1WJD A;  3ZQ7 A;  3QPT A;  3BR2 A;  1P92 A;  1V5E A;  1WJF A;  3OYB A;  3RQ4 A;  5ILV A;  1JT0 A;  1MZB A;  2WA0 A;  4GCT A;  3RIR A;  2NS8 A;  2FUG 2;  3QAH A;  2HDC A;  4RA2 A;  4RAF A;  4OIP F;  4HNV A;  2EIJ H;  3FXR A;  3RZO J;  1IC8 A;  4G6D A;  2YR2 A;  1E3H A;  4XKW A;  3IL2 A;  3GFM A;  3DQV C;  3A2K A;  3GLX A;  3LFU A;  4A3J J;  1B72 A;  3ZOB A;  3WU0 A;  4ZH4 F;  3ZMD A;  1HOM A;  2VKH A;  1B9N A;  3JAM Z;  5FLV A;  3VUQ A;  1U8B A;  4NQW A;  3M3Y J;  2PZ9 A;  3SYT A;  2EZL A;  3GTP J;  3QWL A;  1Y56 A;  2VOP A;  2Q1Z B;  1U2W A;  2JSP A;  4HDV A;  1EA3 A;  1TP4 A;  2CH0 A;  1IRF A;  3JRG A;  1TNT A;  2PFV A;  1PDN C;  2H8W A;  3GTQ J;  1BA5 A;  3J7Y J;  4F91 B;  2HKO A;  2Q2E A;  4I0B A;  3E7L A;  2MH9 A;  1NK3 P;  5AQC A;  5D4R A;  2CUZ A;  4B8X A;  2DW4 A;  3HSE A;  5JHU A;  3ROU A;  3QRF F;  3PJR A;  1X2M A;  2LY9 A;  5JVG F;  1JI8 A;  3ZCO A;  3W6V A;  5FKO A;  1NTC A;  2WC2 A;  3VOX A;  2UXP A;  1TWH J;  2EIK H;  2ZSI B;  2GA2 A;  3BR3 A;  3HGG A;  1JKR C;  1RUO A;  5LFA A;  2KL4 A;  2HYJ A;  3K10 A;  2LF8 A;  4E7L A;  2Z33 A;  3O60 A;  3REO A;  3J7Z I;  3O3K A;  3CJD A;  3S1Q J;  2V1U A;  1VQ4 I;  2VN2 A;  2ZBK A;  3P7N A;  5FRM A;  1J59 A;  2A07 F;  1VQO I;  2YVH A;  3J7A Y;  4ZDO A;  4UVC A;  2NP5 A;  1FY7 A;  2W25 A;  2IAI A;  2FJI 1;  3MN2 A;  2R5Y A;  3QPL A;  3L09 A;  2EK5 A;  2LDU A;  4A5M A;  3BJA A;  4KIS A;  1ZN2 A;  2E35 A;  1YX3 A;  1UST A;  2F5D A;  2R3S A;  2M4K A;  1ERD A;  4Q5S F;  3PUB A;  3KEY A;  1RET A;  4IHS A;  1OCR H;  2LKP A;  5E20 A;  4Q4Z F;  2QCO A;  2ZKZ A;  4I2O A;  4AID A;  3CC7 I;  3V78 A;  1MDM A;  1R22 A;  1KYZ A;  3ECO A;  2CUE A;  1S72 I;  1BI2 A;  3P9K A;  1ZGW A;  1K4S A;  1HBX G;  4EM0 B;  1W36 C;  1WWX A;  4XOR A;  1GVJ A;  3CDL A;  2W48 A;  1JT6 A;  2WAD A;  1B8I B;  2OQG A;  1X19 A;  1FOW A;  3ZQG A;  3VTI A;  3ZMU A;  2GBY A;  2M7A A;  3OY9 A;  1FP2 A;  1K61 A;  4YIF A;  2R7D A;  2KJB A;  3GWZ A;  2XRL A;  2EH3 A;  3QBM A;  3OYJ A;  4IOC F;  1O3R A;  4XR6 A;  4I6Z A;  3K4C A;  4BHC A;  4HQM A;  4YEL A;  3CMA I;  3P9I A;  1IUY A;  2Q24 A;  3MZY A;  2ESN A;  1BOA A;  4RGX A;  4NB5 A;  3OS2 A;  2R7F A;  1K7A A;  4NUB A;  2PJP A;  1SD7 A;  4DGW B;  3TDZ C;  3BJB A;  2M1B A;  1UMQ A;  4DBR A;  3K1P A;  2V6C A;  5FJ8 J;  1BL0 A;  3PAS A;  1EH7 A;  4YG2 F;  2MLK A;  2FOW A;  4KT5 C;  1ZAO A;  4KIF A;  2UWM A;  3LA7 A;  2QEX I;  1BOB A;  1E2X A;  4MTD A;  4JKZ A;  4F7Z A;  5E3M A;  3ZN1 A;  5F0H A;  5K7H A;  4HX8 A;  1HW5 A;  2R7O A;  2HOT A;  4CGR A;  2HTS A;  1DPR A;  3ASO H;  5DUK A;  1T56 A;  1I3Q J;  1V5F A;  3I4M J;  3IWF A;  2PJR A;  2DFH A;  2HNH A;  3V7C A;  3BJ6 A;  4Q48 A;  2O8K A;  2W85 A;  1TWC J;  3IUO A;  4II3 A;  2CUF A;  1MMD A;  3H9G A;  2QKM B;  1YLF A;  5E8I A;  4BXF A;  2XB0 X;  4UV8 A;  2F5F A;  2XDN A;  1R6R A;  2XRN A;  3FHN A;  2LP0 A;  3CCE I;  3W3C A;  1OCC H;  2E5Z A;  3BZC A;  1IXR C;  2E7W A;  3HTI A;  1O57 A;  1YFH A;  5GTI C;  3CO7 C;  4DNC A;  1FC3 A;  5F08 A;  1R1T A;  2G0E A;  4HX4 A;  4OWR B;  2DA1 A;  2PBX A;  1OR7 A;  2MLG A;  2YU9 J;  2N8G A;  1XGS A;  2ECC A;  1OPC A;  3LSJ A;  4LLN A;  3PNV A;  5H9T A;  1T33 A;  3BTI A;  3VSL A;  4FQG A;  5LEK A;  3WTX C;  1VQ6 I;  4Y13 A;  4CZC A;  5FFX A;  2I5U A;  3QPH A;  2VI6 A;  2K9L A;  1VZ0 A;  3DU5 A;  2VB6 A;  4PJM A;  3ZPL A;  1UI6 A;  3BCB A;  4M9Z A;  1XG1 A;  4D9J A;  2JK3 A;  4KN4 X;  4Y17 A;  5F0F A;  2K86 A;  2R7Q A;  4O5V A;  3EQL F;  2WWY A;  5DEQ A;  2FNA A;  5BMZ A;  2XGE A;  5LHI A;  3KZZ A;  1SC7 A;  4DYC A;  2RQP A;  5H6Q A;  2LK2 A;  2Y48 A;  1Q1V A;  2K9N A;  4OAZ A;  1LUJ B;  1QPI A;  2K5C A;  3H92 A;  5LGT A;  4BQA A;  3G73 A;  1YHQ I;  2YS9 A;  3LL7 A;  4ZTF A;  5M3F J;  1Z0X A;  2EV0 A;  4Y52 J;  4F52 A;  1VQP I;  2RAE A;  1Z91 A;  1MBK A;  4EV0 A;  1JJ8 C;  2W82 A;  2E2J J;  2K4J A;  1E0E A;  4G8X A;  3DPU A;  1U5T A;  1NK2 P;  4EJT A;  1YG2 A;  2WUI A;  1XGO A;  1MMG A;  1ZGA A;  2DA5 A;  1ETW A;  5FMP A;  4EJU A;  2X4H A;  1RIO H;  4UUS A;  1K4T A;  3JR9 A;  3GCM A;  3KKD A;  2M8G X;  2X6O A;  1EJ9 A;  1F1Z A;  1LFB A;  2KIF A;  4J19 A;  2ZOZ A;  2PQ8 A;  1NG6 A;  2DMN A;  3V7R A;  4IQJ A;  2X1D A;  2QEN A;  4MLO A;  4B09 A;  2L2O A;  2VC0 A;  3PNY A;  1BIB A;  3WHB A;  1N78 A;  2JWT A; 
#chains in the Genus database with same CATH homology
 2NVQ J;  3GEU A;  1K83 J;  3OIO A;  5F27 A;  5FKM A;  4QIW N;  3COL A;  3VVY A;  2R7Z J;  3OSF A;  3NI7 A;  3A01 B;  4A3I J;  2K9S A;  2ME6 A;  2Y30 A;  4DYQ A;  1ETO A;  3HIM A;  1TWA J;  4B4C A;  2X48 A;  4UDS A;  3HTH A;  1VFC A;  4IHV A;  2ZB9 A;  4KWA A;  3VVZ A;  3EGQ A;  2HXI A;  4MXM A;  4A93 J;  1EF4 A;  1HLV A;  3BQZ A;  5IP9 J;  4C3H J;  2GM4 A;  2K40 A;  3IUV A;  3CMY A;  2I10 A;  2GLO A;  3WHC A;  1VI0 A;  3G1O A;  5EGO A;  3NNR A;  4NEL A;  2R5Z B;  2FX0 A;  1IJW C;  2XSD C;  1ENH A;  2G7G A;  1Z77 A;  2LLK A;  1MBF A;  2DA6 A;  1GDT A;  4B1R A;  3GTM J;  4MK6 A;  4D7M A;  3ON2 A;  4JX6 A;  4DW6 A;  4V2G A;  3A01 A;  5D18 A;  3B6C A;  1H88 C;  2O9L A;  3BR0 A;  4AC6 A;  3ZQF A;  2KT0 A;  3GZI A;  2RHA A;  2QF7 A;  2HKU A;  1JUP A;  5IP6 A;  2P81 A;  4DYR A;  2QIB A;  1BJZ A;  5K58 A;  2HI3 A;  1ETY A;  2HYT A;  2CJJ A;  2HOS A;  2ME0 A;  2DA3 A;  5E3N A;  3S17 J;  3LSR A;  3V6G A;  4AF5 A;  2R5Z A;  3HB9 A;  2JA8 J;  1WGX A;  4XRS A;  2HXO A;  5EEA A;  3DPJ A;  1DU0 A;  3E7Q A;  4BBS J;  3VIB A;  2HOA A;  4BXX J;  4A3C J;  2HDD A;  3F0C A;  3FIS A;  4MFE A;  3LOC A;  2DMU A;  5M5W J;  2DMP A;  2TCT A;  3MVP A;  1HF0 A;  2V57 A;  1QRY A;  3HDD A;  1MH3 A;  2ZOY A;  1ETV A;  1RPW A;  2MGQ A;  1MBG A;  4GFB A;  1QVT A;  2GEN A;  3PPB A;  1FIA A;  5HOD A;  3CRJ A;  5FHP A;  3LWJ A;  1GVD A;  1RKT A;  3DEW A;  1FTZ A;  3HGY A;  4DZJ A;  5M5X J;  5CW8 A;  4X6A J;  3NPI A;  4DZP A;  3NXC A;  1U9O A;  2FD5 A;  2VKE A;  3Q0U A;  4A3G J;  5EG0 B;  2DN0 A;  1LE8 B;  2OI8 A;  3SFI A;  3DCF A;  3H3V K;  5IOZ A;  2G3B A;  2B63 J;  3RKQ A;  3ANP A;  5CXG A;  3Q3S A;  1TC3 C;  1MBH A;  4C2M J;  3Q0V A;  4JYK A;  3BNI A;  3VW2 A;  2GFN A;  2XGD A;  2ECB A;  3AQS A;  1P7J A;  1H89 C;  1ETK A;  5FKK A;  4D5F A;  1JTX A;  1XC5 A;  3BT9 A;  3HKZ N;  2DG8 A;  5EZH A;  2XPW A;  3ON4 A;  3VW0 A;  1CQT A;  2WB1 N;  2DA4 A;  2E1O A;  2OF7 A;  2LR8 A;  5DTD A;  2R92 J;  2KDZ A;  4JX5 A;  1FIP A;  4AYB N;  1MBJ A;  2EQR A;  2LFB A;  2H8R A;  2IBD A;  1JTY A;  1FTT A;  2UXU A;  1H8A C;  3LHQ A;  1IGN A;  1WH5 A;  3QQA A;  5EG0 A;  1LE8 A;  1ETQ A;  1ZKG A;  3UKG A;  4RDU A;  1P7I A;  5BNG A;  4C3I J;  5FKN A;  3CCY A;  1VF9 A;  2L7Z A;  3D1N I;  1OJL A;  5IPA A;  3HOZ J;  4M3B A;  3B6A A;  1O4X A;  2DG7 A;  4XIC A;  5HSZ A;  2NS7 A;  2K9Q A;  2NOG A;  2M0C A;  1QVU A;  4A3D J;  3HOW J;  5C44 J;  4V2F A;  4M3F A;  3H0G J;  4EEF G;  3AQT A;  5C4Y A;  3S1N J;  2R0Q C;  2ZCN A;  1IDY A;  3HOV J;  1F36 A;  3TW7 A;  3K7A J;  1JUM A;  2UXI A;  1Y1W J;  3MKL A;  4AUX A;  1MSF C;  2EZH A;  1Y1V J;  2M2E A;  3I4N J;  3L1P A;  5JLX A;  1F43 A;  1FJL A;  3JSJ A;  2DMQ A;  2E19 A;  3O8G A;  3KKC A;  3JRE A;  1SAN A;  3GTK J;  5CXI A;  4JX4 A;  5J3L A;  2QOP A;  4JNN A;  4AC0 A;  2YVE A;  3QPS A;  1UI5 A;  3Q0W A;  2NX4 A;  5EFY A;  2FJ1 A;  3BR6 A;  3TW6 A;  4L62 A;  5DS9 A;  3KNW A;  1WCM J;  2M9H A;  4BBR J;  3LNQ A;  4GFK A;  5JLW A;  3HM5 A;  3BCG A;  2TRT A;  4C3J J;  2OER A;  3M4O J;  5IOY A;  1ZR4 A;  5K7Z A;  3BTL A;  1UHS A;  4A3M J;  2JA5 J;  2DTZ A;  4JP0 A;  4W1U A;  2EZK A;  2XPU A;  2Y9Y A;  5D19 A;  4M3E A;  2NVX J;  5F0C A;  2G7S A;  3TP3 A;  5FLM J;  2DJN A;  2JJ7 A;  4XK4 A;  5M5Y J;  5FGL A;  4X1E A;  4IHW A;  3BG5 A;  3NAU A;  5J1U A;  1B72 B;  2LD5 A;  4MFD A;  3BR1 A;  9ANT A;  4YZE A;  3ZQL A;  2MG4 A;  1HCR A;  3F1B A;  3CQZ J;  1TWF J;  2M34 A;  1JKQ C;  3FIW A;  4BY1 J;  2Y2Z A;  5IYD J;  4JL3 A;  2JN6 A;  3HTJ A;  2H1K A;  5F1J A;  4LOC A;  4XRS G;  3BR2 A;  2LVS A;  1JT0 A;  3BG9 A;  3HEF A;  3OSG A;  3EUP A;  4GCT A;  1JJ6 C;  1BW5 A;  3RD3 A;  2NS8 A;  1POG A;  4HNV A;  1TWG J;  3RZO J;  1IC8 A;  2CRG A;  4S0H B;  3IH3 A;  5EZG A;  3CWR A;  3ZQI A;  3T6N A;  1RR7 A;  3KZ9 A;  4FE7 A;  2LTP A;  5C4J J;  4A3J J;  1B72 A;  3BG3 A;  3ZOB A;  1HOM A;  2PMZ N;  2QTQ A;  3VPR A;  1ITY A;  2WV1 A;  1YRN B;  5FLV A;  1AHD P;  4L5E A;  1U8B A;  3M3Y J;  3PM1 A;  2PZ9 A;  3VUQ A;  4MO7 A;  5E3L A;  5E3O A;  1GT0 C;  3PO2 J;  4IHX A;  2EZL A;  3GTP J;  4HKU A;  2DA7 A;  3JRD A;  2IEK A;  1X2N A;  1SFO J;  2WGB A;  1AU7 A;  1AKH B;  1ETX A;  4M6V A;  1E3O C;  1XS9 A;  1OCP A;  4BKX A;  5DAJ A;  2JA6 J;  2COB A;  3JRG A;  3GTO J;  2CQQ A;  2R5Y B;  3GTQ J;  1ZR2 A;  1BA5 A;  2RAS A;  4QSH A;  2UXH A;  3BQY A;  3E7L A;  3TED A;  2QWT A;  1NK3 P;  2W53 A;  2MW8 A;  5AQC A;  2EBI A;  1JUS A;  2QKO A;  2VUM J;  1OFC X;  4XID A;  4BY7 J;  5IYC J;  1X2M A;  2LY9 A;  3ANG A;  3W6V A;  5FKO A;  3S15 J;  4CYC B;  1NTC A;  2R93 J;  3VOX A;  1YRN A;  3JRH A;  1TWH J;  1IG7 A;  2UXP A;  3JRI A;  3BR3 A;  3HGG A;  1JKR C;  1S7E A;  2L0K A;  4FE4 A;  3B81 A;  2HYJ A;  3ZQC A;  3O60 A;  5J1Y A;  2NVY J;  3BHQ A;  3S1Q J;  3CJD A;  1AKH A;  2YVH A;  3G7R A;  2NP5 A;  2IAI A;  1GV5 A;  4FIS A;  5GPA A;  3JRA A;  1BW6 A;  3MN2 A;  1FEX A;  2R5Y A;  3QPL A;  4IHY A;  3HBL A;  1IDZ A;  2O7T A;  1ZK8 A;  2G7L A;  2EZI A;  2L7F P;  1JKP C;  3RH2 A;  1MH4 A;  3OOU A;  5GP9 A;  2E2H J;  3BRU A;  1RET A;  1IRZ A;  2CU7 A;  2QCO A;  2GUH A;  4A3E J;  2WAQ N;  3MNL A;  3V78 A;  1WPK A;  2CUE A;  4B3A A;  4CYC A;  1UG2 A;  1ZGW A;  4I76 A;  2O7O A;  4UUT A;  5EF6 A;  3LJL A;  3FKI J;  1IV6 A;  3VVX A;  4NDL A;  1WH7 A;  3CDL A;  2W48 A;  2NVT J;  3BTJ A;  1JT6 A;  3S14 J;  3HOX J;  1B8I B;  2OPT A;  3NAR A;  3ZQG A;  2REK A;  5IYB J;  2GBY A;  2XGC A;  3GTJ J;  1K61 A;  3SDG A;  3FRQ A;  5HBU A;  2XRL A;  2EH3 A;  3QBM A;  2ID3 A;  4ICH A;  5EDN A;  2MSY A;  2AHQ A;  4I6Z A;  5C3E J;  2Q24 A;  2YUS A;  3ZQH A;  5HAW A;  1X58 A;  4FTH A;  1W0U A;  3BJB A;  4MIM A;  1UMQ A;  4D7N A;  1HDP A;  1ORK A;  5FJ8 J;  3PAS A;  1BL0 A;  4GCK A;  4D5C A;  4JKZ A;  3S1M J;  2LKX A;  5E3M A;  5F0H A;  5K7H A;  3G1L A;  2NP3 A;  5K7F A;  3IV5 A;  3JRC A;  1B8I A;  2HOT A;  4CGR A;  2L7M P;  5F04 A;  1T56 A;  1I3Q J;  2JA7 J;  2CQX A;  1DU6 A;  3S5R A;  2AO9 A;  3I4M J;  3O8H A;  1VND A;  1R9T J;  1A5J A;  2O8K A;  4G12 A;  4RBO A;  3C2B A;  1TWC J;  3HTA A;  4A3K J;  3K2A A;  2CUF A;  1HDD C;  2XDN A;  2XB0 X;  3LSG A;  1W0T A;  3LSP A;  1LFU P;  2D6Y A;  5M3M J;  1U78 A;  3GBG A;  2LP0 A;  1JKO C;  4A3L J;  3HTI A;  2Y0S N;  3HOU J;  3S1R J;  3HE0 A;  2D5V A;  2XPV A;  4ABZ A;  3GTL J;  3C07 A;  5F08 A;  2G0E A;  2L9R A;  2XB5 A;  2DA1 A;  2X9D A;  2PBX A;  2YU9 J;  3RQI A;  2N8G A;  4ACI A;  2ECC A;  2ID6 A;  1PUF B;  3LSJ A;  4FCY A;  5H9T A;  1I50 J;  1T33 A;  3BTI A;  4NN1 A;  3S2H J;  3BR5 A;  1RES A;  3PO3 J;  2FBQ A;  1U9N A;  2VI6 A;  1D5Y A;  2IU5 A;  3P9T A;  1GV2 A;  1A6I A;  1UI6 A;  3JRB A;  4XRM A;  2JMW A;  1XG1 A;  1G2H A;  2JK3 A;  4UUS B;  1GUU A;  5F0F A;  3A03 A;  3IH4 A;  3FK6 A;  4PXI A;  1ZQ3 P;  2XGE A;  3TP0 A;  4DYC A;  5D1R A;  2LK2 A;  1MNM C;  1Q1V A;  2K9N A;  5EYR A;  1RKW A;  1QPI A;  3G1M A;  4Y7N J;  2HQ5 A;  1JGG A;  2DMT A;  2YS9 A;  3GTG J;  5M3F J;  1Z0X A;  5FKL A;  4Y52 J;  1PUF A;  3S2D J;  1ZTR A;  2RAE A;  4ME9 A;  1JJ8 C;  1MBK A;  2F07 A;  2E2J J;  3VP5 A;  1APL C;  3A02 A;  4M3D A;  1NK2 P;  3BTC A;  2WUI A;  1OCT C;  3JRF A;  3HOY J;  4M3G A;  3QKX A;  4QTR A;  2DA5 A;  1ETW A;  3IH2 A;  5J1R A;  2Y31 A;  3NRG A;  2Y9Z A;  4GFL A;  5FMP A;  4UUS A;  2ELK A;  4GCL A;  3JR9 A;  1IUF A;  2M8G X;  3KKD A;  2X6O A;  4W97 A;  3G56 A;  3VOK A;  1LFB A;  4J19 A;  2UXO A;  5GPC A;  4IEJ A;  3SJM A;  4A69 C;  2ZCM A;  2ZCX A;  2DMN A;  2ZOZ A;  1WI3 A;  1MSE C;  5IP7 J;  2FQ4 A;  2DA2 A;  4A3B J;  1I6H J;  3RZD J;  3VW1 A;  5EGO B;  5C4X J;  4A3F J;  2E2I J;  3S16 J;  4MLO A;  2VKV A;  3WHB A;  2VPR A;  3FK7 A;  1MBE A;  1SGM A;  2JWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...