3Q0VA

Ethr from mycobacterium tuberculosis in complex with compound bdm31369
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
193
structure length
188
Chain Sequence
b'GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Design, synthesis and optimization of new EthR inhibitors. A new alternative approach to fight tuberculosis by boosting ethionamide
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/transcription inhibitor
total genus 82
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3q0vA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3q0vA02
1DU0A 2DMQA 3PASA 4AC6A 3NRGA 2GBYA 2UXUA 2XDNA 2ZCNA 3C07A 3TW7A 1OCTC 2XRLA 1VF9A 2CUEA 5EZGA 5M3FJ 2QWTA 2FJ1A 3S1RJ 2GM4A 2DG8A 2DMPA 3A01A 3JRFA 3HTAA 2M8GX 3QKXA 3HIMA 4DYRA 2XGEA 1WGXA 4A3IJ 3Q0VA 2DA6A 4DW6A 4JNNA 3HOVJ 4X6AJ 4MIMA 3LSGA 3V6GA 2P81A 3S17J 1Q1VA 4XICA 2ME0A 2R5ZB 3HE0A 4JKZA 3IV5A 1X2MA 1TWHJ 1P7JA 3MKLA 5IOYA 3BQZA 3EUPA 4X1EA 5HSZA 1MBGA 1MBEA 3GTGJ 4DZPA 1OJLA 5F0FA 1BL0A 3HOUJ 3GTKJ 4GCLA 1ETQA 1ZGWA 1POGA 2H1KA 2ECCA 2R0QC 1PUFA 5FKKA 3HDDA 5EYRA 2XGCA 1D5YA 2G3BA 3RZOJ 2JWTA 2NS7A 1GDTA 4A3MJ 4A3EJ 4Y52J 3BTIA 1UMQA 4DYQA 5M5YJ 3OSFA 3S14J 3S2HJ 3ZQFA 4XK4A 3BRUA 5CW8A 1U78A 3KKDA 1P7IA 5K7ZA 4CYCB 2AO9A 2NVTJ 2NP3A 4C3JJ 2G7LA 2NOGA 2JA8J 1CQTA 3JRGA 4AUXA 2E2IJ 1HCRA 2JA7J 5IOZA 3M3YJ 5FGLA 2AHQA 3RH2A 2DN0A 2NX4A 3G7RA 3B81A 3FISA 1W0UA 1ETYA 3HGYA 2Y9ZA 2TRTA 2HI3A 5F04A 3A02A 4MLOA 4LOCA 1UI5A 3FRQA 3QQAA 5J3LA 3W6VA 1JKPC 4W1UA 2E2JJ 4YZEA 3LNQA 3MNLA 5EGOA 3HB9A 2R5ZA 1FTZA 4PXIA 2G0EA 2CU7A 3LJLA 3PPBA 1VI0A 3JRDA 4BY7J 1MSEC 1F36A 1JJ8C 3JRHA 1MBJA 3LSRA 2IEKA 3P9TA 3NXCA 4D7MA 2WUIA 2OERA 5FLVA 3BHQA 3F1BA 4NN1A 1QPIA 2JJ7A 3PO2J 2MSYA 5C3EJ 4A3CJ 2L7ZA 3LSJA 5F0HA 3H3VK 3CMYA 1HLVA 3GTOJ 1B8IB 3BR3A 4IHYA 3ON2A 3B6AA 2XPWA 1GV5A 2WGBA 2W48A 1JTYA 1RKTA 4FE4A 1TWAJ 3DCFA 5K58A 1WH7A 4JX6A 4QSHA 2HOSA 5J1RA 3VVZA 3LSPA 5FKMA 3A03A 4FTHA 3CQZJ 2VUMJ 3WHBA 1Z0XA 2G7GA 1WH5A 3VVXA 2ZCXA 1O4XA 4HKUA 1FIAA 2EH3A 1IDYA 2LP0A 3HBLA 2L9RA 5K7HA 4XRMA 3E7QA 3KKCA 5IYCJ 1ORKA 5EG0A 2DA5A 1ZK8A 3GTLJ 3JREA 4D5CA 4MK6A 3TP0A 3BR5A 2XB5A 2ID3A 4MXMA 4C3IJ 4A3BJ 3PO3J 1Y1VJ 3IH2A 3HTJA 5K7FA 1G2HA 3RD3A 3VVYA 2JMWA 5BNGA 3LHQA 1IC8A 3DPJA 1U9NA 3JR9A 1K83J 4MFEA 1AKHB 2LVSA 2HOTA 4A3LJ 1AU7A 4JL3A 3VW0A 5F1JA 2EZHA 1TWFJ 2VKVA 3NARA 2X6OA 2EZIA 2KT0A 2MGQA 9ANTA 4JP0A 3BG9A 5F27A 3FIWA 2V57A 5FKOA 3ZQCA 3S1NJ 4ICHA 4FCYA 2IU5A 5EGOB 2DA3A 2FX0A 1A6IA 3ZQLA 1E3OC 5F0CA 5IP7J 1GUUA 1B8IA 2L7FP 5EEAA 2XPUA 1JTXA 2CUFA 1ETKA 1ZR4A 2Y31A 1XG1A 2OPTA 4RDUA 4NELA 3QBMA 2FQ4A 3VOXA 3NAUA 2CJJA 2DJNA 3O8HA 4M6VA 1IV6A 3OSGA 2WAQN 1JUSA 4M3FA 3M4OJ 3Q0UA 3OIOA 1GT0C 3S1MJ 2YVEA 5EZHA 1OCPA 1RR7A 5E3LA 1IG7A 2GFNA 3HOYJ 2ECBA 5E3NA 2O7TA 3IUVA 5EFYA 4JYKA 1R9TJ 2YU9J 2QIBA 1ZQ3P 2EZLA 2QOPA 1MH3A 1WCMJ 2KDZA 5M3MJ 1T33A 3I4NJ 1RPWA 1IRZA 1XC5A 4XRSA 1ENHA 3C2BA 5CXGA 2HOAA 2NVQJ 3JSJA 1JUMA 2JN6A 1IDZA 1OFCX 4I76A 4HNVA 2QCOA 2E2HJ 4GFBA 3AQSA 2HXOA 2YS9A 2LR8A 2VKEA 3FK7A 3Q3SA 2F07A 2HKUA 5D19A 3BR6A 1AKHA 3BT9A 2E19A 2WB1N 5EG0B 1ZTRA 3OOUA 3BR2A 3RQIA 4AYBN 5M5XJ 3IH4A 4G12A 2EQRA 2IAIA 1NK2P 2OF7A 3JRIA 2D6YA 3O60A 2M9HA 1WPKA 3HEFA 3HOZJ 1UI6A 5J1UA 3S16J 1ETOA 4BY1J 4J19A 1H8AC 2PMZN 2PZ9A 1EF4A 4IEJA 2XSDC 3O8GA 3LOCA 4JX4A 4BBRJ 1H88C 4UUSA 3GTPJ 2M0CA 2O7OA 5FJ8J 2NVYJ 4V2FA 1QVTA 3G56A 2EZKA 1X58A 3SFIA 2DTZA 5FMPA 1VNDA 3S15J 2DA1A 2K9SA 1LFUP 2QKOA 5D1RA 3SJMA 4GCKA 2RAEA 1HOMA 5CXIA 2ZOZA 3BTCA 4B3AA 1DU6A 2X9DA 4Y7NJ 1IGNA 2Y30A 3TW6A 1ETXA 2R5YA 1SFOJ 4IHVA 2R92J 3S5RA 2K40A 4UDSA 2M2EA 3FKIJ 5HODA 5FHPA 1ETVA 2E1OA 1JT6A 2XB0X 4M3EA 1A5JA 2QTQA 4RBOA 4DYCA 3HOWJ 4BBSJ 2DA7A 2UXOA 1JKOC 5DS9A 4ABZA 2D5VA 2NVXJ 1ITYA 4A3KJ 3JRAA 5IYBJ 4D5FA 2HXIA 3BG3A 4D7NA 5J1YA 1BW5A 5M5WJ 4AC0A 2CRGA 1MBKA 5HBUA 4L5EA 4A3FJ 1HDDC 2ME6A 3RKQA 3MN2A 3VW1A 1MBFA 3NI7A 3L1PA 3ZOBA 2EBIA 5GPCA 2O8KA 2I10A 1Y1WJ 1TWGJ 3G1MA 1SANA 2OI8A 2LLKA 3BCGA 1XS9A 1MNMC 2ZOYA 1MSFC 2DMUA 5DAJA 3VW2A 2HYJA 2LY9A 5HAWA 3FK6A 4B1RA 3GZIA 2PBXA 4BXXJ 2UXPA 4I6ZA 2HDDA 2DMTA 3KZ9A 3ON4A 2R93J 1UHSA 3T6NA 1TWCJ 2DMNA 2ZB9A 1APLC 5AQCA 3BNIA 2O9LA 2JA5J 2YVHA 2WV1A 5E3MA 2K9NA 2H8RA 1HDPA 4QTRA 1JGGA 2NP5A 1B72B 4IHXA 1BJZA 1TC3C 2RHAA 2VI6A 1X2NA 1QRYA 4UUSB 4KWAA 2COBA 1NK3P 3K7AJ 3VUQA 4V2GA 3CWRA 3K2AA 1I3QJ 3DEWA 1LE8B 3HKZN 5EF6A 1ZR2A 4FISA 4BKXA 2K9QA 3KNWA 3QPLA 1I6HJ 1QVUA 1VFCA 1S7EA 2LKXA 2JK3A 3VPRA 2JA6J 3VIBA 4M3BA 2R5YB 2NS8A 2TCTA 3RZDJ 3MVPA 4L62A 3PM1A 3VOKA 4GFLA 5E3OA 3GEUA 2DG7A 2FD5A 1YRNA 2ZCMA 3HM5A 3LWJA 2B63J 1JKQC 2LFBA 4NDLA 3HTIA 1W0TA 2L0KA 5GPAA 3ZQHA 3HOXJ 1IJWC 2ELKA 2Y2ZA 3S1QJ 3GTJJ 3TEDA 4AF5A 3QPSA 1ZKGA 1JKRC 2W53A 1SGMA 3F0CA 3HGGA 2Q24A 4C3HJ 5C44J 1BA5A 1MBHA 3I4MJ 3TP3A 5IYDJ 3BG5A 3UKGA 5C4YA 3E7LA 3CDLA 3ANGA 5FLMJ 2LK2A 2CQQA 3D1NI 2M34A 1IUFA 5IP6A 3BTLA 1RETA 1B72A 3CCYA 4S0HB 1NTCA 1ETWA 2DA2A 4A69C 3WHCA 2LTPA 2R7ZJ 4GFKA 2MG4A 5JLXA 2Y9YA 3BR1A 2DA4A 3COLA 2HYTA 2LD5A 3BJBA 1UG2A 3ZQGA 3GTQJ 4GCTA 1LE8A 1RKWA 2REKA 3GTMJ 4A93J 2L7MP 1WI3A 3IH3A 1U8BA 2CQXA 4B4CA 2GUHA 4W97A 3ZQIA 1I50J 4ME9A 4EEFG 1GV2A 4XRSG 3B6CA 5IP9J 3JRBA 1K61A 2UXIA 5H9TA 1GVDA 4XIDA 4UUTA 3NNRA 1HF0A 3V78A 1Z77A 1JT0A 5C4JJ 2YUSA 4MFDA 3A01B 3GBGA 1MH4A 4QIWN 1H89C 1AHDP 2QF7A 3S2DJ 4A3DJ 5F08A 3CRJA 2VPRA 3G1LA 5FKNA 1LFBA 4IHWA 5DTDA 3HTHA 1U9OA 1F43A 5C4XJ 4A3GJ 2UXHA 3NPIA 2MW8A 1FJLA 4C2MJ 2HQ5A 4M3GA 5IPAA 1FTTA 3AQTA 4FE7A 2XPVA 2GLOA 2X48A 1FEXA 5JLWA 4MO7A 1YRNB 3BTJA 3JRCA 4CGRA 3BQYA 3CJDA 5FKLA 1FIPA 2IBDA 3G1OA 2XGDA 1T56A 3H0GJ 4DZJA 5EDNA 2GENA 1PUFB 5GP9A 3ANPA 4CYCA 4JX5A 3SDGA 4A3JJ 1JJ6C 5D18A 3EGQA 2G7SA 3VP5A 2RASA 3Q0WA 2N8GA 2Y0SN 2FBQA 1JUPA 1RESA 1BW6A 4ACIA 2ID6A 4M3DA 3BR0A
chains in the Genus database with same CATH superfamily
1KONA 3WTWC 5DM7F 1FZPB 3C18A 3NRGA 2GBYA 1EH6A 2L9SA 3FZVA 3FXRA 3H5AA 3TW7A 2DK5A 2CUEA 2STWA 4IHSA 3GFMA 3V7SA 5E1ZB 3A01A 1V5FA 3JRFA 4WXHA 5BQTA 3QKXA 1MMDA 3HOSA 1I39A 4DYRA 2E5NA 1AOYA 4U7DA 2Q0OA 1WGXA 2XGEA 2KQRA 1TL8A 4MIMA 3OYMA 5LBQA 3OS2A 4HV6A 4HG2A 4Y4RA 1PJRA 3L2RA 2LMDA 3FM5A 5CVUA 1UZCA 3MKLA 1FYKA 3QP5A 1IUYA 1STZA 3BZ6A 1MBGA 4HLYA 5HSZA 5F0FA 1FX7A 2W84A 4XNFA 3FXOA 3GTKJ 1T39A 1ETQA 3OR2C 1ZGWA 3A0HC 1POGA 2EFQA 4ASNA 2IXSA 2R7OA 5DUIA 2DU9A 2ZJQF 1I6XA 4HOBA 3HDDA 1Q1HA 2G3BA 3RZOJ 2JWTA 4U87A 4A3MJ 4TV7A 4Y52J 3BTIA 4DVYP 5E8GA 4KIFA 2CUJA 2FXAA 3E6BA 2ZSIB 3HRMA 1Z67A 4LD5A 5M5YJ 3OSFA 1VQKI 4U9LA 3T1BA 2X1EA 2Z9OA 4XK4A 3BRUA 1E2XA 3H92A 3T8TA 4F93B 5K7ZA 5DCFA 2AO9A 4C3JJ 2G7LA 2OQGA 2JA8J 3FXMA 1CQTA 2R7VA 3M3YJ 5HDGA 3PJRA 2DO7A 2F48A 2PEXA 4HF0A 4IHTA 5J4YA 1TLHB 1TTYA 4PDKA 2CQ7A 2VPLA 2FBHA 3FRQA 2HI3A 3SEQA 3A02A 3ZRGA 1UCRA 3ZP5A 2Y48A 4M71A 3GZNB 1JKPC 4W1UA 5CJ9A 3F8MA 1RNLA 3RI4A 1H9TA 3BDDA 2WTEA 3LNQA 3ERMA 3WTZA 3MNLA 1I5ZA 2IT0A 4RGSA 4PFOA 1JE8A 3E3VA 2WV0A 3WG7H 3KLOA 1JJ8C 2YU3A 1JXSA 3LSRA 2VIXA 5F64A 2WAQA 1OISA 2WUIA 3DPUA 2XASA 3OOPA 2X1CA 3SYTA 5K1YA 4R1HA 4NN1A 2F4OB 2JJ7A 1QPIA 4UVAA 5FROA 4NNJA 1NG6A 4OIRF 3AFHA 1HLVA 2H6BA 5KCMA 1UJ8A 3GTOJ 4A6EA 1O3TA 3BR3A 4IHYA 4M74A 4ENMA 2OZ6A 2XPWA 4WCGA 1R1UA 3ERED 1VQ9I 4QSHA 1LPQA 4ZH4F 3VVZA 4XORA 5FKMA 2D1HA 3A03A 3KP2A 4GGGA 3OS1A 1VQ8I 4E7IA 4ANJA 2HQNA 3OWTA 5DM6F 2ESNA 2HKXA 3VVXA 4HYEA 4HKUA 5K5QA 4CGZA 4RM2A 3DQVC 2WB1A 1N77A 1EKEA 2LP0A 3GFJA 3HBLA 1XGSA 1RRJA 2DA5A 2V7FA 2L5QA 3FDYA 2BV6A 4D5CA 3CCEI 2VJJA 2XF7A 3GO5A 4MTEA 4EGZA 2K85A 2XB5A 5CLSA 1MDMB 2ID3A 2PMZA 2RGVA 1RZ4A 3W2AA 1H9GA 3DP7A 3PO3J 2L9VA 1Y1VJ 4EV0A 3PNYA 1DGRM 4LITA 3ZCOA 4LK0F 2PBIA 3OY9A 1IC8A 2HTJA 2M4GA 1U9NA 1YYVA 2WY8Q 3JR9A 2X1DA 4MFEA 1VQPI 2B0LA 1X1PA 5ERIA 5F1JA 1E0EA 2YX7A 1OCCH 1E17A 1RUNA 2V1UA 1BR4A 4JP0A 3BG9A 1OQYA 3FBIB 4RGXA 9ANTA 2ZKZA 3K0LA 2VODA 2V57A 3WGGA 2VC1A 4G8XA 3QYEA 1WJEA 5EGOB 1T38A 1IF1A 2OCCH 3JTHA 3SFZA 3TMOA 1E3OC 1SFKA 2EB7A 5IP7J 3NS4A 5F1RA 1OPCA 5ICFA 2L7FP 3VOEA 1N78A 1QZYA 3WGIA 2OPTA 1VQ6I 4NELA 2XF6A 3VOXA 5ICCA 1K78B 1FBQA 4DBRA 4M6VA 4IRVA 3ASNH 3OSGA 2NXNB 3TO7A 4M3FA 1ZELA 3M4OJ 1HC8A 4RB1A 3OIOA 1TP4A 3L7WA 1WVRA 4MTDA 1OCPA 1RR7A 3HOYJ 5E3NA 3CF2A 1R58A 2O8XA 2O61A 4IJAA 2VE8A 5LEJA 2MLKA 2YU9J 4LIUA 4IX7A 1TT0A 1ZQ3P 2STTA 2EZLA 3MKZA 2FMLA 3BPXA 2QA4I 1LQ1A 2KDZA 1SVLA 3U2RA 5M3MJ 4N0BA 2ZJ2A 3I4NJ 4IPAA 2EK5A 3OL4A 4XRSA 1ENHA 2NVQJ 2R7RA 3JSJA 3ONQA 1IDZA 2ZXIA 1PYVA 4I76A 4GFBA 2QCOA 3VYUB 4L0YB 3AQSA 2YS9A 3Q3SA 3KPHA 2QKLB 3CDHA 5D19A 3BC8A 3BR6A 2G9WA 3BT9A 3PQKA 4G6QA 4G9YA 4F3QA 1L0OC 4HPQA 1ZTRA 3OOUA 1UHWA 4BHPA 3BR2A 4AYBN 1MMAA 4UB6C 4G12A 5LGTA 4LB6B 3HOTA 2OAZA 4B47A 1NK2P 3V42A 5E79C 4F52A 3Q5FA 2M9HA 1WPKA 3HEFA 4LK1F 1UI6A 5J1UA 3S16J 1ETOA 3BJOA 5DCMB 3J7ZI 4Q5SF 4OD5A 4IEJA 4RAGA 4BGDA 5CPRB 3WTYC 4JX4A 4BBRJ 3DLAA 2EIMH 1WJ5A 5J40A 2FE3A 1TBXA 4V2FA 3K70C 3R60A 4Z2YA 5HNFA 1QA6A 1ZH5A 3P9CA 4FASD 4XBFA 1YOVB 2A5YB 3T0YA 1T08B 2QQBA 1VNDA 1IW7F 2K9SA 4QPQA 2QKOA 5A2QZ 4GCKA 2RAEA 1DU6A 2X9DA 2QQ9A 4ITVA 4KN7X 2Y30A 1IGNA 1ETXA 1SFOJ 1V4RA 2DLLA 2K40A 5KHDA 4HNUA 1ETVA 2E1OA 3ELKA 1A5JA 5D4RA 3ZMZA 4M6YA 1A6QA 2OD5A 2RQQA 3VSLA 2QM3A 5CVJA 2NOJB 4EM0B 5DS9A 5D5VB 4O3MA 2VJ5A 5FFZA 1IXSB 2FJI1 2E1MB 4CCLA 4JK1X 3J7AY 4D7NA 4ZYDA 2V6EA 1BW5A 4AC0A 1MBKA 3KEYA 4UVCA 5LHIA 2EFNA 3MN2A 3VW1A 1S5LC 3M8FA 1SMYF 1ZRFA 1OYWA 3LSIA 3ZOBA 2K9MA 3EUHA 3CJTB 2O8KA 5LLQA 5JVGF 2OI8A 1PVEA 3BCGA 1MNMC 2CS3A 1MSFC 2BXZA 3TDUC 3W3CA 5L3BA 2HYJA 1EV7A 1GXPA 2BXYA 3FMRA 4RB3C 4G7ZF 3GZIA 1E3HA 1TNTA 3ON4A 1S72I 3T6NA 1WWXA 5AQCA 4OWRB 3ZGKA 3BNIA 3F72A 1BIAA 2YSRA 4HNTA 3EPZA 1X1BA 2K9NA 2A61A 5HDNA 2AS5F 3OYNA 2JRMA 1BJZA 2Z3YA 4OAYA 2DFHA 3FXQA 4UV9A 3JW4A 4ZTJA 5DDGA 4XKWA 2K02A 1ACIA 4OIQF 2IGMA 4CCJA 3QPHA 2XAFA 2XF5A 3VUQA 1LE8B 2O6GE 4RAYA 1UB9A 2KP6A 2L2OA 4FISA 3WTXC 3KNWA 1A04A 1QVUA 4AWXB 3LA3A 3TQNA 3F8BA 4CYDA 1Z6TA 2CWEA 3P9IA 3RYRA 3VIBA 1WSUA 2NS8A 1FC3A 2QENA 3I53A 3PM1A 1WJDA 4UHTA 5E3OA 3GEUA 5HOOA 2DG7A 3NQOA 2ZCMA 4DIQA 2MYSA 1OYYA 2B63J 2EWNA 2DFIA 1WZ2A 1IJWC 2ELKA 3I58A 3TEDA 3FWEA 2KIFA 3FHNA 4MQVA 2GXGA 4HLXA 1G4DA 3E97A 3F0CA 3HGGA 2Q24A 1ZHFA 3G3ZA 3K1PA 3BLYA 1FYMA 1TQIA 3CUQB 5B1AH 2OV7A 3I4MJ 4ESFA 2B3WA 2Y69H 2ACJA 3ISPA 2XGXA 2IS1A 5IYDJ 1Y6IA 2JA2A 2W25A 2LK2A 2JVHA 2MBFA 4CDGA 1BM9A 2DCEA 2P5KA 2DYRH 4D9JA 5FLXK 2DA2A 4A69C 2QWWA 1SD7A 2MH2A 4LG0A 2P8TA 2R7ZJ 4F92B 2V26A 5JLXA 2DA4A 3VTIA 2HYTA 2LD5A 3ZQGA 5HDKA 4II2A 2L54A 1LE8A 1J09A 1RKWA 2ZXJA 1USTA 4F91B 3GTMJ 1HKSA 4A93J 1E3PA 3GWZA 2GUHA 3ZQIA 4ME9A 3SZPA 2NNYA 5JHUA 5E20A 3RTRA 2FF4A 2UXIA 1P4AA 3ABUA 3AG2H 4P55A 3NNRA 1HF0A 2LKPA 4Q47A 2VE9A 1D1CA 4N9HA 1QU3A 1S7AA 4BU2A 1FBUA 4RS8A 4QIWN 1H89C 5HS8A 2QF7A 3QODA 3BG6A 4P96A 4A3DJ 5TRDA 1ZG3A 2E60A 4U0YA 1P4XA 2QQAA 2XROA 5DTDA 2PFBA 3HTHA 3ZMVA 5C4XJ 3VODA 4A3GJ 3LQRA 3OYFA 1PP7U 3HSEA 1QGPA 2DXIA 1FTTA 3T5XA 3AQTA 1J75A 1OCZH 3CUQA 1VQ5I 1CF7B 2GWRA 4FE7A 2JQ7A 2X48A 3CC2I 1IRXA 1XCBA 3BTJA 3L2WA 3JAMZ 4CHUA 2RREA 3IC7A 1W7PD 2IBDA 3DWLE 3H0GJ 1PUFB 1XDSA 1U5TA 4P1WA 1ON2A 2C6YA 1R5HA 2D1VA 2H6CA 5D18A 3RKYA 2DOAA 4Y13A 3DU5A 3V8KA 3Q0WA 3CCVI 1K6YA 3IAM2 2COMA 1M1EB 2Y0SN 3I55I 1K6OA 2FBQA 1S29A 1RESA 1BR1A 1BW6A 4XR6A 3CRJA 2X6YA 3W2VA 4AC6A 3FXUA 2Q2EA 3VEPA 2VOOA 4UY8I 2UXUA 1I3AA 2ZCNA 1D5VA 1Z7UA 1OCTC 1BR2A 1VF9A 4DOZA 4XONA 1FY7A 2QWTA 2Z5UA 4RLFA 2WAFA 1Y39A 2BE5F 4E7ZA 1HW2A 5H6QA 1YS6A 1Y56A 2JPCA 4A0XA 2FBIA 2M8GX 3K4CA 3BPVA 3VYRB 1O3QA 3Q0VA 3LSGA 2R7QA 3V6GA 2P81A 2ME0A 3V8LA 2R5ZB 3M9AA 3ABMH 3WTSC 3GZ5A 4JKZA 2OC6A 2B1EA 2IS2A 3U9GA 4Y15A 3ABLH 3LA2A 2RVCA 4X1EA 1MBEA 1OJLA 2DAOA 1CF7A 3I5UA 3H3ZA 3WTVC 3HOUJ 1FOKA 4GCLA 4PGGA 2FNPA 2R7WA 2BY3A 2M3AA 1PUFA 5FKKA 3CJRB 5E1XA 5EYRA 1GDTA 2L4MA 2TDXA 2F5FA 1UMQA 2CFOA 2HWVA 2FMYA 1T98A 4IQ4A 3PSIA 3FXJA 2HPMA 3OYLA 2LBFB 5ICEA 3S14J 1R7JA 4DBQA 4CCMA 5FGMA 3S2HJ 2LG4A 2XAGA 2R4GA 4CYCB 2NP3A 2ZCWA 1YFHA 2JUGA 2XUBA 2BHZA 3G73A 3C7JA 1IXCA 1GVJA 1SFEA 1V3FA 2KDOA 3RH2A 2DN0A 3B81A 3EUAA 4ZJZA 2Y9ZA 5CVRA 3DBHB 1X1DA 1YW8A 4YEJA 4MLOA 4LOCA 3J81Z 5J3LA 3W6VA 2IS6A 1FMWA 2XRNA 4XL9A 3ZMUA 3HB9A 2HZTA 2R5ZA 3I59B 4PXIA 5IT9K 3LJLA 2LDUA 4Z6YA 1NH3A 3CCSI 2DQLA 2CH0A 1MSEC 2VJ4A 5DD4A 2WBMA 3P9TA 3NXCA 3S93A 1G8XA 2OERA 3BCBA 3E6DA 3BHQA 3IRRA 1G3SA 2UUZA 3PO2J 1XX5A 2L7ZA 4S04A 5H2FC 5F0HA 3H0DA 4XLAA 2K4BA 1B8IB 3WE2A 1O7FA 1MJAA 1R6RA 1K4TA 2LYCA 1YQAA 2VOPA 4FE4A 3BOQA 1WH7A 4OMYA 4U7BA 3SDBA 1IRGA 3CCUI 4FTHA 1LFPA 1QHHD 3OYGA 3CQZJ 1W7PA 5ED4A 3GYHX 2ZJPF 2JVGA 3F8CA 3BCAA 3DEUA 1O4XA 4IF4A 4NBQA 3Q9VA 4AIHA 4OIPF 2A6TA 3BJ6A 4AYBA 3JAMK 5IYCJ 1YJ9I 3PUBA 1U3EM 5F6FA 3JREA 2I5UA 4B09A 4M72A 1VQMI 3BR5A 4MXMA 4C3IJ 2A2FX 3VVYA 3I59A 3KP5A 2CV1A 2E1MC 5BNGA 3LHQA 1O3RA 3DPJA 4FQGA 1K83J 3M07A 1AKHB 2LVSA 4JL3A 2PQ8A 1Z91A 1O3SA 1KYZA 3KFWX 1ON1A 1VTNC 2XAJA 3VW0A 3DKWA 2VQCA 1TWFJ 2VKVA 1ZLKA 3WODF 2KT0A 3V7RA 2XC7A 3K4MA 2A3SA 2JPBA 5FKOA 5B66C 1K79A 2VBWA 2VKDA 2HKOA 3GLXA 3F9KA 2FX0A 3ZQLA 4DQ2A 4B3XA 5F0CA 1PDNC 3VYSB 1B8IA 4FHTA 2HDCA 3KE2A 5JI6A 5EEAA 1WKMA 1JTXA 2CUFA 2LNBA 3E6MA 3GLLA 3BZCA 1ETKA 1Z3YA 2Y31A 2WAEA 4RDUA 1QZEA 2NVUB 3QBMA 4N4NB 2RNGA 3L2UA 3O8HA 3E5UA 5K5RA 1KQ9A 1KU3A 5ILSA 3D0SA 1S7OA 5HLHA 2FBKA 3DEEA 3S1MJ 2YVEA 1G6NA 5L3CA 2JZYA 5EZHA 1KU9A 5E3LA 2ZC2A 2O7TA 3IUVA 4AU7A 2HVSA 2CG4A 3L09A 1X4PA 3KZZA 2QOPA 4KMFA 1T95A 4A0ZA 2Z2SB 3FHZA 1QPMA 2IGOA 1XC5A 3C2BA 3I64A 2M30A 1A31A 1MJ9A 4HV5A 2FOWA 2HZDA 2J5OA 2ZMEC 4HNVA 3QOPA 3CCRI 2VKEA 2IPQX 4RAZA 1AKHA 1IZ1A 4PSWA 2FRHA 2PMHA 4E7KA 4XLEA 3F6VA 3K10A 3IH4A 3L2VA 2UZKA 4II3A 2EV6A 2OF7A 2HFHA 4KT6A 3ZXSA 4J19A 3QRFF 3GZ6A 1EF4A 1IN8A 3O8GA 2R7FA 5BMZA 2A6EF 3PFIA 2EILH 3N05A 3TO6A 2NVYJ 4XRFA 5FJ8J 1QVTA 3CMAI 2EZKA 1XTAA 3PSFA 1X58A 1MD0A 2DTZA 2PJPA 2DA1A 2QSFX 3SJMA 2ELJA 3DBLB 2VASA 2OZUA 5CXIA 1G59A 3E6CC 2ZOZA 4LLGF 2OA4A 3OIPA 2XAQA 3CLOA 3L2CA 1BC7C 1Z7LA 4MNUA 2K7LA 2R92J 3S5RA 4BL0B 1A35A 1FSEA 3FKIJ 5HODA 5FHPA 2HTSA 2XB0X 5HS9A 1XSVA 4DYCA 4QLCU 3HOWJ 5K5OA 2RNJA 1T0FA 1UELB 4AIKA 1ITYA 2VQLA 4ABZA 1NHAA 2NVXJ 1SD5A 3QWLA 2X4HA 2Y0MA 4KISA 1HKTA 3JRAA 5IYBJ 1BBYA 4D5FA 3BG3A 5KNLA 5M5WJ 3E1SA 4PJJA 2KIUA 3RSNA 5AONA 2CRGA 3DBRB 2CW8A 4ZZLA 3KP7A 2BEOA 2E1NA 2HPIA 1MBFA 3U1DA 2H27A 2M4KA 2I10A 4PGHA 1Z05A 4HRIA 2LLKA 2RKHA 2ZSHB 2NYXA 4NQWB 3ULQB 2R7XA 1RI7A 1VQ4I 2PBXA 4L9TA 3VYTB 2HDDA 2ZY9A 2G7UA 5LEKA 1Z9CA 4I2OA 2R93J 1EH7A 1UHSA 3B02A 1APLC 4UB8C 4Q48A 2EA4A 2O9LA 2JA5J 3OIQA 5E3MA 4HSRA 3U21A 2EV5A 1X19A 1HDPA 4QTRA 3HHHA 4KICA 3DFGA 2NP5A 2KKOA 1B72B 3NWSA 3LQQA 4HZFA 2V1XA 5LFAA 1TC3C 3RYPA 2P6TA 4FT8A 1OYIA 2DT5A 3CCQI 2RHAA 3IRQA 1X2NA 1QRYA 2NAZA 2P5VA 3CC4I 1KQ0A 2GQQA 1ZLJA 2HU9A 1NK3P 3K7AJ 4XKVA 3K2AA 4JOMA 1YIJI 2CO5A 3ECOA 5EF6A 4XN3A 3P9KA 6PAXA 1C0WA 4KITB 1VFCA 2P6SA 1ZRCA 2X85A 5TISC 2LKXA 3TGNA 4ENKA 4A5MA 2O5RA 3RZDJ 3PQJA 3KX2A 1I1SA 4GFLA 3MWMA 5FFXA 4IO9F 5GADJ 3WTTC 1HSTA 4WX9A 3HM5A 4G94A 4YELA 1FT9A 3D5SC 4NDLA 1W0TA 4CZCA 4NQWA 3HOXJ 2Y2ZA 4BDYA 3SXYA 1P4WA 3QPSA 2DI3A 2M7BA 2XHKA 1JKRC 4HX8A 1I27A 2Z1DA 1SD4A 2L7KA 4RGRA 1R4NB 5D5UB 1BI3A 2Y0SA 5C44J 1LDKB 1HSJA 1I1GA 3GX4X 1ZARA 3BG5A 4WK8F 1R36A 3CDLA 4YG2F 3ANGA 1WRJA 1BOAA 2M34A 1IUFA 2M8EA 3I71A 1BI2A 5IP6A 3HRSA 3BTLA 1BI1A 1YTYA 1B72A 5J4VA 3CCYA 4HF2A 2P5LC 4S0HB 1ETWA 4E70A 2IW5A 3JCUC 3WHCA 2M87A 2Y9YA 3BR1A 3KEOA 4OINF 2KIQA 1MZBA 2FEZA 3HXLA 2DDAA 1KU7A 4RGUA 2IP2A 5KK1A 2DDBA 1XD7A 2L7MP 1MKMA 1WI3A 3RCOA 2CQXA 1MNDA 4EEFG 1GV2A 1R49A 3B6CA 4PK4A 3RIRA 4A6DA 4HBLA 1B9NA 4L9VA 1MGTA 2F4IA 3V78A 1XGNA 1LDJA 5C4JJ 4WWCA 1JT0A 4U0VA 3GBGA 4UXNA 1UFMA 1N75A 3HRTA 4NC8A 4BHBA 4FX4A 3HIFA 5F08A 1RC9A 4XMYA 2VPRA 1OKRA 3F21A 1OR7C 5FKNA 1U9OA 1F43A 3FX3A 3I4PA 2CQNA 1U8RA 1DDNA 2F5DA 4IRIA 1QO0D 4C30A 2QLZA 1TW3A 2M7AA 3IHUA 2DJIA 5LHHA 4CZZA 2XPVA 1B6AA 4MO7A 1WFXA 3BQYA 3F3XA 2XAHA 5EEHA 3CJDA 4GCVA 2EJRA 4IRHA 5D5WB 1T56A 2KPMA 5EDNA 3HG9A 5GP9A 5JFRA 2VBZA 1LUJB 4JX5A 2QBYA 2OJED 5H20A 2F5EA 2WY7Q 1SAUA 2Q8KA 1W1WE 4E7JA 1JJ6C 2F5VA 2YR2A 3MZ8A 2RASA 1G3YA 3VP5A 2QVOA 4GYIA 1IO2A 4MQ9F 5J47A 4EGYA 3CLQA 3GEZA 4M3DA 3BR0A 1YI2I 2DMQA 1R22A 1MNEA 1FSHA 3K9TA 2WADA 2ELHA 4UUVA 2XDNA 1B9MA 3DTIA 4ZDOA 2EV0A 4YIRX 1DP3A 1TNSA 4LG0B 4IXAA 5EZGA 5M3FJ 2V6CA 3HTUA 3S1RJ 4JBAA 2AXLA 4RMNA 2R7DA 3O2PE 2ISYA 2DG8A 2DMPA 4IOAF 4PJNA 2VBYA 4B8XA 3HIMA 1YHQI 2VT3A 4B44A 4A3IJ 5FD5A 2DA6A 3FXKA 4DW6A 3HOVJ 4X6AJ 4P9FA 1T2KA 1SD6A 3S32A 1Q1VA 4U88A 3HE0A 3SQNA 3MAJA 2UV1A 2ZXHA 3P7NA 1P7JA 1JI8A 5ICGA 4R8HA 5IOYA 3EUPA 5IT3A 4H4KC 3GTGJ 3AL0B 4YFKF 2OCEA 3ZPLA 3LSHA 4BDZA 1XMXA 2KFDA 1H0MA 5LRSA 2M0MA 2ECCA 2R0QC 4BE2A 3TOBA 2HEOA 1D5YA 4HDUA 3GUDA 3K4JA 3K4BA 4EMSA 3CMEI 3EQLF 5LD2C 4DYQA 2K27A 2QSGX 5JHFA 2EFOA 4I99C 4CO8A 4WXDA 4YIFA 1TQMA 3RDIA 3CZ6A 2BGCA 2QGUA 1U78A 1P7IA 2Y75A 5CVVA 1U5TB 1X1AA 3IP4B 1MMNA 2NOGA 5B3SH 1U6GA 1YO5C 1S6LA 2E2IJ 2ZO4A 1SVMA 2EIJH 3K8PC 5FGLA 3VSKA 1P2FA 5D6FA 5J8CA 4M9XA 2NX4A 3G7RA 1ZGJA 3FISA 3K1MA 4EJTA 3HGYA 4I0BA 2RN7A 2TRTA 3H9JA 5F04A 1FOWA 2KZVA 4Y17A 3ZN0A 3QQAA 3GF2A 4A12A 1ZG1A 1Y8QB 1EH8A 2E2JJ 2Q2EB 3RPUD 2VJIA 3WU0A 3OMYA 1W5CC 1ZREA 1FTZA 4G6DA 4GO1A 3BY6A 1VI0A 3I9V2 3W2WA 2B9SA 4N9IA 4BY7J 1F36A 4KN4X 2FOKA 2XSJC 1MBJA 2HVQA 5A2QK 3HKZA 2IEKA 2H94A 2ZBKA 1U2WA 4D7MA 2LY1A 1HKQA 2DYSH 3QAHA 3O3KA 4CSWA 1W36C 2FQ3A 2VC0A 2V9KA 2LRDA 4K2EA 3VFZA 2MSYA 4A3CJ 3RPQA 3LSJA 3H3VK 2L9NA 1WJCA 4ESJA 1LVAA 1D1BA 5CYVA 3LAPA 3ON2A 1SEUA 5BS6A 1GV5A 2W48A 1JTYA 4BAYA 3LAJA 4E7HA 2HYFA 2DT7B 2D2WA 4JX6A 1XN7A 3CMMA 3GVAA 5J1RA 3LSPA 2LKSA 1L3LA 4AD9A 2VUMJ 4CA0A 4HA8A 3WHBA 4UNOA 1Z0XA 2G7GA 3CP2A 3CC7I 5HLGA 5L3GA 4LGWA 2ZCXA 1YIOA 2W4SA 2PI0A 3DTEA 5DV5A 1FIAA 4U9NA 2EH3A 2H8WA 3ESWB 3MEXA 3K70D 4KIGA 4U0WA 2K3PA 4XRMA 2G7HA 4LIVA 3KKCA 3HUGB 3PIPF 1ORKA 1J59A 3QU6A 3VDXA 5EG0A 3RJPA 4MK6A 4LG3A 3TP0A 2K5CA 2R3SA 4BJ5C 3A4CA 3H1CA 4ENNA 4BH9A 1KA8A 1DPUA 1G2HA 3FBNB 2FA5A 4G7OF 2M5WA 2HOTA 5E1WA 3JSOA 1LVKA 1GHCA 2EZHA 4L9NA 5E8IA 2QZ8A 2DFEA 3NARA 4CXFA 4HF1A 1QQIA 2X6OA 2EZIA 4ZTFA 1XGOA 4WF2A 4RM3A 3FIWA 3S1NJ 2A68F 2Z99A 4FCYA 4KFCA 2DA3A 4OU0A 3ZN1A 2CW7A 3ABKH 1GUUA 4QWQA 1BI0A 4LFUA 4WXCA 5TJJA 2KMUA 4G6TB 1Z3XA 4KT5C 2CSOA 2XPUA 3LSMA 3VWBA 1ZR4A 1IV8A 4E7LA 3M8EA 3NAUA 3G2BA 2KJCA 2XVCA 2I8DA 5LHGA 1IV6A 2EA2A 4XM3A 2CFXA 2DOEA 5B5EC 1WJFA 5FO5A 3AG3H 4J00A 2VXDA 2K86A 2ESHA 4L5IA 1O7LA 1IG7A 4G7HF 2GXBA 5E17F 4LJZF 5EFYA 2VLAA 2IGKA 4JYKA 4PCQA 3HUGA 3M7GA 2XKOA 4XOPA 1MH3A 3QYFA 1WCMJ 1IN6A 2IVMA 1HXDA 2MLGA 3LMMA 1W7PB 1T33A 3G4SI 1KYWA 1RPWA 4RLQA 3VB2A 4CUGA 1QHGA 1JUMA 2JN6A 4C2MA 4R79A 1SC7A 2QEXI 2HXOA 4MHGA 2LR8A 2IS4A 3FK7A 2HKUA 5DYMA 3S3MA 4H0EA 3IAS2 4M9ZA 5M5XJ 4MEXF 2EQRA 3HL2A 1GLNA 4DGWB 2KRHA 4RB0A 2D6YA 1WI9A 2QQ8A 3PNVA 2KZGA 4BY1J 1YLFA 3RPUA 1XB4A 2PZ9A 5KAFC 4ETSA 2PMUA 2LF8A 3S3NA 4UUSA 1DQUA 1QBJA 2M0CA 4AIDA 1X1CA 3M8JA 1TZLA 1UHMA 2BZTA 3MKWB 2GOMA 2GA2A 3SFIA 1ONVA 5GAHJ 5FB2A 3GFIA 3EDPA 3EUHC 5FMPA 3DPLC 4M73A 1LFUP 4L18B 4BQOA 4HDVA 1HOMA 3GXOA 1Z1DA 4V19K 1LB2A 2R7TA 2VB6A 4DNCA 2K4JA 4Y7NJ 3J80Z 3WE3A 1ZYRF 4HX7A 1ZGAA 2R5YA 3FMSA 2VQGA 2M2EA 3SZTA 2QTQA 2IA1A 4RBOA 3MZHA 4CICA 1SVOA 1JKOC 2D5VA 3WU2C 3ROUA 2GIZA 2XIGA 3SEZA 4IQJA 2EIKH 4C2TA 4M6XA 4A3FJ 1HDDC 2ME6A 3HZJA 3NI7A 4I98B 3L1PA 3OL3A 2EBIA 3SZGA 1P6RA 4CCNA 4LLLA 1V5GA 2R7SA 2IGNA 1XS9A 3A0BC 2DMUA 4CCKA 5DAJA 3VW2A 4BXFA 2D45A 1O57A 3H36A 2UXPA 2QUFA 4I6ZA 2DMTA 1XGMA 3CUOA 3KZ9A 2P7CB 3ZMTA 2CYYA 1FP1D 4ZYGA 1TWCJ 1MIJA 2DMNA 1XMAA 2E36A 2EINH 1YJNI 3GMEA 3NWTA 4I01A 2AXTC 3I3LA 1JGGA 4F55A 3OYEA 4IHXA 2F5CA 4ZYEA 5L3DA 2OBPA 2L4AA 3LFUA 3AG4H 1FWZA 4EJVA 4XLCA 4KWAA 3OR1C 1W5SA 4L9JA 3ML6A 4BEHB 4BQQA 4EQQA 3DEWA 3MFKA 2R7UA 1R00A 3H35A 1K4SA 3HKZN 4XLHA 4BQNA 1ZR2A 5FRNA 4BKXA 2K9QA 5GTIC 1I6HJ 5E18F 3LSTA 1F5TA 1S7EA 2DBBA 2E1CA 2JA6J 3F8NA 2ZFUA 1GXQA 3DKXA 3DU6A 4M3BA 2O03A 3DTKA 5AIQA 3MVPA 3VOKA 4O6JA 2FD5A 1YRNA 1IN7A 3L00A 3LWJA 1EA3A 3HYIA 1JKQC 1LDDA 4D1QA 2LH9A 2L0KA 3ZQHA 2F2EA 1S3JA 1YE9A 2HQAA 2LC2A 3C2HA 4OIOF 3M1EA 3GTJJ 4AF5A 4EJUA 2DT6A 3GW2A 4HQEA 1ZKGA 4GRIA 2LOOA 2IA2A 4OOIA 2IA0A 4KA4A 1HW5A 3CCMI 5DEQA 2W00A 3HSRA 2HVRA 2BW3A 2MD5A 3TP3A 3AL0C 1XPXA 3W6JB 4PUSA 2K3FA 3UKGA 2O0YA 3E7LA 1X3ZB 2VL8A 5FLMJ 2DODA 3IL2A 3NRVA 4RA2A 3GFLA 1NTCA 2XDVA 2MG4A 4I7HA 3KZYA 3R6SA 3J81K 1UG2A 3BJBA 3CUQC 4E6KG 4BEHA 5HS7A 1R5ID 2REKA 3CO7C 3PUFA 3EETA 1YG2A 4NC7A 4UVBA 2MC3A 1U8BA 3LA7A 4W97A 1I50J 3ZMDA 1LEBA 1U5TC 1HA8A 4XRSG 3KP4A 5H9TA 4A5NA 3H3UA 4UUTA 1J7KA 2W85A 4XIDA 2WC2A 1VZ0A 3C3WA 1F9NA 4MFDA 2V1NA 4BE1A 1AHDP 3S2DJ 3H9QA 5D5XB 1LFBA 3J80K 2VXZA 3F8FA 2BHYA 1JHHA 3AAFA 2OTLI 2UXHA 4X0GA 2MW8A 2DQRA 3EUKL 1FJLA 3OYIA 4C2MJ 3MZYA 4M3GA 1REPC 5ILVA 3CD6I 2GLOA 1FEXA 4PJ0C 1X3WB 3RKXA 2VONA 4PFPA 3FMQA 4BNCA 1B4AA 2HNHA 2GXAA 2VKHA 5FKLA 2JSCA 2XV4S 2XGDA 4DZJA 2GENA 3ANPA 1BJAA 2F4MB 2QSHX 3IWFA 4A3JJ 1MJBA 2KJBA 4B48A 3EGQA 3IWZA 3CDIA 4LLNA 3HJEA 2GOXB 1DU0A 3PASA 4XSZF 1IRFA 4I0AA 1UAAA 3J7YJ 2BOLA 1D0ZA 1OCOH 3O6BB 2A07F 3C07A 2XRLA 2NS0A 4Y33A 1XSXA 1F4KA 5CQGA 2DK8A 2FJ1A 2GM4A 4YRVA 2RV8A 3LSKA 1IN5A 1FLIA 3UR3C 3DPTA 3K4LA 3HC7A 3HTAA 4QPOA 1AWCA 3CESA 1T8IA 4JNNA 5DUKA 2BBYA 5TGTA 3S17J 4XICA 3DV8A 3IV5A 1DGWY 1A36A 5CQEA 1Y0UA 1X2MA 1TWHJ 4KMUX 1P9QC 4YIIA 2HS5A 3BQZA 4RB2C 4DZPA 5JR3A 1XMKA 2JTVA 3R61A 1BL0A 2W57A 2P7VB 2JUCA 2WWYA 3I54A 2H1KA 3PNTA 2KIMA 2E71A 4EJOA 2EPFA 1KGSA 3B73A 5KAIC 2XGCA 1VQLI 3G71I 4ZYHA 2NS7A 1FP2A 3KP6A 2CGPA 4A3EJ 4F7ZA 1WQ2A 1KZHA 3LL7A 4E7SA 2CW0F 2L01A 5GAEJ 3ZQFA 5CW8A 3HRUA 4OAZA 4E4HA 1RUOA 1RIOH 1MDMA 3KKDA 4GYGA 2NVTJ 2QBYB 3HHGA 3QOEA 3JRGA 1QNTA 4AUXA 1HCRA 2JA7J 5IOZA 1JHFA 1PUEE 2W24A 2AHQA 3KCCA 3W6KB 5FLXZ 2EFPA 3TO9A 1W0UA 4XSXF 1ETYA 3OS0A 2MH9A 3T8RA 2OTJI 1Z21A 3E5QA 3UNGC 1UI5A 4IVNA 3K6GA 3PIOF 2HQRA 2UXNA 3CCLI 3C1DA 4YZEA 2BVLA 5EGOA 2F6CA 5GAGJ 4KUMA 2G0EA 2CU7A 1D0YA 3PPBA 2EFWA 2YX4A 3JRDA 3MQ0A 2CV0A 2ZNZA 3L9FA 3JRHA 1K7AA 2ZFWA 3S3OA 3DF8A 1K78A 4OD4A 2MA3A 2CV2A 3PFYA 2ISZA 5FLVA 1J9IA 1ERDA 3S8PA 3F1BA 2W82A 2PG4A 5C3EJ 4HQMA 4XLNF 2CMPA 1V54H 2ZXWH 3CMYA 3BWGA 2DPDA 4XLPF 3L2QA 3B6AA 1ZAOA 2WGBA 1RKTA 1FPQA 1TWAJ 3DCFA 4PJLA 5K58A 4XQFA 4IKFA 2UWMA 3KYCB 4HAMA 4BS9A 1P92A 2HOSA 2YPRA 3KYLA 2X0LA 4HSTA 2KRFA 3MCZA 3CTAA 1G3WA 3RQ4A 3QP6A 1WH5A 3DLLF 2BY0A 5ILUA 3NEUA 5EEGA 1TT5B 3N97A 1Y8RB 1IDYA 1KQ8A 1D8KA 3HSFA 2L9RA 5K7HA 3E7QA 1CGPA 1ZK8A 3MMYB 3GTLJ 1S9HA 4NUBA 3J7AO 4BUPA 5CVIA 3GCMA 3QPTA 4IOCF 3ABTA 1V55H 4A3BJ 2CQKA 3IH2A 3ZMSA 5K7FA 3HTJA 3RD3A 4IL6C 5DCMA 2JT1A 2PFVA 4KIBA 2JMWA 1OLTA 1HBXG 2E35A 3IKVA 4A3LJ 1AU7A 3V8JA 1W5TA 2FU4A 1R1VA 1R5GA 2LSOA 3AKZA 3KLNA 4XKBA 2ZNYA 3MD2A 1FNNA 3N4MA 2MGQA 1J2XA 2V1DA 5F27A 3CCJI 1RR8C 3ZQCA 3F6OA 4ICHA 2IU5A 4C9YA 5D8LB 4EJWA 1A6IA 1WJAA 1FBSA 2ZJRF 3FKJA 2KHMA 3K4NA 5HNHA 3IUOA 3TKYA 1SFXA 1XG1A 4HEA2 3HTSB 3V7CA 2FQ4A 2CJJA 2DJNA 3OYDA 2HOEA 2WAQN 1JUSA 3KYDB 3Q0UA 1S8NA 1T6SA 1GT0C 2DPUA 3CJNA 2ZMEB 4KNYA 1YW9A 2NNNA 1LJ9A 3S2WA 2GFNA 2ECBA 2MC4A 1USSA 5FD6A 4Q4ZF 1ULYA 4FETA 1R9TJ 2QIBA 3DXJF 2A5WA 2KISA 4O5VA 1FOXA 2DFFA 1B59A 2FUG2 1W4MA 2DOFA 4BACA 4HW0A 2L02A 2QYOA 1VQ7I 1R1TA 1IRZA 3I0TA 5J8FA 2OU2A 5CXGA 2KL4A 2HOAA 3JTGA 4KDPA 2A69F 3D5RC 2VT2A 3CP8A 5L3EA 1OFCX 3CJQB 2B7EA 2V9VA 2E2HJ 1DUXC 4WIBA 4YFXF 2F07A 3A1YA 4EVIA 2E19A 2WB1N 3K1NA 1WHUA 5EG0B 4ZDPA 1YX5A 2QKMB 3RQIA 2W1OA 4KYWA 3PL8A 2O3FA 3H5NA 1KU2A 1XCVA 2IAIA 3JRIA 4ESBA 3O60A 5DD8A 3D5LA 1T0FC 3HOZJ 1Z6RA 4AVZA 2Z16A 3P5JA 1H8AC 4XKCA 1LEAA 1R23A 2PMZN 3R0JA 4AVPA 4YFNF 2XKPA 1D1AA 3DKYA 2XSDC 3LOCA 1G3TA 1H88C 5FRMA 3GTPJ 5IT9Z 2O7OA 5HLIA 3G56A 2MFZA 1IXRC 4HX4A 5H6RA 3S15J 4FX0A 5HVQC 4EM1A 5D1RA 3OV8A 2P4WA 2RC4A 4BJTA 2ZMEA 3BTCA 2DTRA 4B3AA 5D8KB 2HR3A 1LKXA 4XLFA 2HDWA 3F23A 3QYBA 4ZYAA 2GA1A 4GXOA 3TW6A 5AIPA 2KRCA 2BVMA 4IHVA 1SMTA 1YS7A 4UDSA 3OYCA 1JT6A 4M3EA 2W7NA 2UXXA 4BBSJ 2E7XA 2DA7A 1NG7A 2UXOA 2HYGD 1ZG5A 4BJ6C 4DJAA 3HPGA 4MEYF 4A3KJ 3SHFA 3ZQQA 3WU1B 3HPHA 2VN2A 3EYIA 2HXIA 4ON0A 5J1YA 5GTHC 4BE0A 1YW7A 3KP3A 4LB5A 5HBUA 1X4OA 2V4JC 4L5EA 3RKQA 3TL4X 4ZZDA 4L0ZB 3BJAA 2JRTA 1QZZA 5LGNA 2VQHA 4N4OB 5GPCA 4NHJA 1Y1WJ 1B1BA 4KJZA 1TWGJ 3G1MA 1SANA 2AQFA 2DW4A 3EYYA 4JQFA 5JVTA 3A2KA 1YITI 1UG0A 2ZOYA 4A0YA 1R71A 4CH7A 2LY9A 5HAWA 4AM3A 2BYVE 1AA7A 3ZQ7A 3FK6A 1Y0NA 4B1RA 5IY5H 3H9GA 4BXXJ 4M9SA 3E0JB 1TQPA 5EJCA 3JSPA 2K9LA 2ZB9A 4GDFA 4EM2A 2YVHA 2WV1A 3C2GA 2IRFG 5BOXA 3BZKA 4XN0A 1ZN2A 2H8RA 2IJLA 3SWHA 2LY2A 2V79A 4RAFA 1J0RA 2PJRB 2BY1A 5L3FA 2VI6A 4S05A 2ICWG 4UUSB 1X3UA 2COBA 3TBIA 1LNWA 2E5ZA 2PN6A 3LFKA 4V2GA 3CWRA 1I3QJ 5D6EA 1FYLA 3QPLA 2X51A 5LRRA 3REOA 4A2UA 5BPIA 4Y3OA 3TOAA 3WGHA 4ENJA 2JK3A 3MKYB 3G6EI 1FOYA 3K2ZA 3VPRA 1VQOI 4D0PA 1MW7A 2VBXA 2R5YB 3I56I 2TCTA 1J5YA 1IN4A 3OYBA 4L62A 2WA0A 3K4KA 1ZRDA 1TW2A 1N25A 2H1LA 3FM3A 5BPDA 4UV8A 2LFBA 1HW1A 3ECHA 3HTIA 1MMGA 1D0XA 5GPAA 1YX3A 1BIBA 3LWFA 3BG7A 3S1QJ 2MABA 1IAWA 2W53A 2Q1ZB 1SGMA 4BYYA 4C3HJ 1BA5A 1D3YA 3RKWA 3IKTA 4I09A 1MBHA 2M45A 5C4YA 2X6XA 1BOBA 2NRAC 1ODDA 3WG9A 4CCOA 4AIJA 2CQQA 3OYJA 3D1NI 1SAXA 1F1ZA 4B43A 2ETHA 3BROA 1EJ9A 3X2QH 2YVXA 1D8JA 1RETA 2PJRA 1DP7P 3ZR8X 1XSDA 4J01A 5B1BH 2LTPA 4GFKA 3KZIC 3COLA 5D4SA 1YJWI 2XAUA 3KIOA 1MMSA 3QU3A 3CF5F 3GTQJ 4BHCA 4GCTA 2LREA 1FMVA 3H5RA 2RDPA 2OUMA 3OYKA 4PJMA 3IH3A 1BN5A 3Q9SA 2L3DA 4B4CA 4PZJA 2LF7A 2OQRA 3M1CA 5KVRA 1HQCA 4OMZA 5IP9J 3JRBA 2GAUA 1OCRH 1K61A 2ADUA 4PSXA 1GVDA 1SFUA 2KLOA 3WTUC 4NB5A 4BQAA 4P5OA 1Z77A 2M1BA 5CKTA 2FNAA 1WJBA 2YUSA 3V4GA 2GIVA 3A01B 2H09A 1V5EA 1U0JA 1MH4A 2PX9A 2X6WA 3COAC 4XOTA 3K69A 1PP8F 2HGCA 3G1LA 4L5JA 4EATA 4IHWA 1JGSA 1OMIA 2P0WA 4I02A 2PLYA 2A6HF 2V9PA 3KETA 3NPIA 4NC6A 2AQEA 2HQ5A 5LGUA 3OYAA 4MGRA 5IPAA 4IZZA 3CO6C 1VQNI 3KEQA 1BC8C 2LBFA 3R4KA 5JLWA 1YRNB 3JRCA 2MD0A 4CGRA 1R4MB 2RQPA 1DPRA 1FIPA 2CUZA 3G1OA 3R0AA 4CYCA 3AG1H 4ZC3A 2GZWA 3SDGA 2E34A 4P9UA 4IRGA 3ASOH 3FF5A 3FXLA 2E7WA 4ZDLA 3TDZC 2BY2A 2G7SA 3U1KA 4C2UA 1XDUA 2BW3B 2FSWA 2N8GA 2Z33A 5J6XA 1JUPA 5HLTA 3OYHA 2J5PA 2A05A 1W36D 4LMYA 2JSPA 3BP8A 4ACIA 2ID6A 4BXUA 1OR7A 3E5XA 3F22A
chains in the Genus database with same CATH topology
1DU0A 2DMQA 3PASA 4AC6A 3NRGA 2GBYA 2UXUA 2XDNA 2ZCNA 3C07A 3TW7A 1OCTC 2XRLA 1VF9A 2CUEA 5EZGA 5M3FJ 2QWTA 2FJ1A 3S1RJ 2GM4A 2DG8A 2DMPA 3A01A 3JRFA 3HTAA 2M8GX 3QKXA 3HIMA 4DYRA 2XGEA 1WGXA 4A3IJ 3Q0VA 2DA6A 4DW6A 4JNNA 3HOVJ 4X6AJ 4MIMA 3LSGA 3V6GA 2P81A 3S17J 1Q1VA 4XICA 2ME0A 2R5ZB 3HE0A 4JKZA 3IV5A 1X2MA 1TWHJ 1P7JA 3MKLA 5IOYA 3BQZA 3EUPA 4X1EA 5HSZA 1MBGA 1MBEA 3GTGJ 4DZPA 1OJLA 5F0FA 1BL0A 3HOUJ 3GTKJ 4GCLA 1ETQA 1ZGWA 1POGA 2H1KA 2ECCA 2R0QC 1PUFA 5FKKA 3HDDA 5EYRA 2XGCA 1D5YA 2G3BA 3RZOJ 2JWTA 2NS7A 1GDTA 4A3MJ 4A3EJ 4Y52J 3BTIA 1UMQA 4DYQA 5M5YJ 3OSFA 3S14J 3S2HJ 3ZQFA 4XK4A 3BRUA 5CW8A 1U78A 3KKDA 1P7IA 5K7ZA 4CYCB 2AO9A 2NVTJ 2NP3A 4C3JJ 2G7LA 2NOGA 2JA8J 1CQTA 3JRGA 4AUXA 2E2IJ 1HCRA 2JA7J 5IOZA 3M3YJ 5FGLA 2AHQA 3RH2A 2DN0A 2NX4A 3G7RA 3B81A 3FISA 1W0UA 1ETYA 3HGYA 2Y9ZA 2TRTA 2HI3A 5F04A 3A02A 4MLOA 4LOCA 1UI5A 3FRQA 3QQAA 5J3LA 3W6VA 1JKPC 4W1UA 2E2JJ 4YZEA 3LNQA 3MNLA 5EGOA 3HB9A 2R5ZA 1FTZA 4PXIA 2G0EA 2CU7A 3LJLA 3PPBA 1VI0A 3JRDA 4BY7J 1MSEC 1F36A 1JJ8C 3JRHA 1MBJA 3LSRA 2IEKA 3P9TA 3NXCA 4D7MA 2WUIA 2OERA 5FLVA 3BHQA 3F1BA 4NN1A 1QPIA 2JJ7A 3PO2J 2MSYA 5C3EJ 4A3CJ 2L7ZA 3LSJA 5F0HA 3H3VK 3CMYA 1HLVA 3GTOJ 1B8IB 3BR3A 4IHYA 3ON2A 3B6AA 2XPWA 1GV5A 2WGBA 2W48A 1JTYA 1RKTA 4FE4A 1TWAJ 3DCFA 5K58A 1WH7A 4JX6A 4QSHA 2HOSA 5J1RA 3VVZA 3LSPA 5FKMA 3A03A 4FTHA 3CQZJ 2VUMJ 3WHBA 1Z0XA 2G7GA 1WH5A 3VVXA 2ZCXA 1O4XA 4HKUA 1FIAA 2EH3A 1IDYA 2LP0A 3HBLA 2L9RA 5K7HA 4XRMA 3E7QA 3KKCA 5IYCJ 1ORKA 5EG0A 2DA5A 1ZK8A 3GTLJ 3JREA 4D5CA 4MK6A 3TP0A 3BR5A 2XB5A 2ID3A 4MXMA 4C3IJ 4A3BJ 3PO3J 1Y1VJ 3IH2A 3HTJA 5K7FA 1G2HA 3RD3A 3VVYA 2JMWA 5BNGA 3LHQA 1IC8A 3DPJA 1U9NA 3JR9A 1K83J 4MFEA 1AKHB 2LVSA 2HOTA 4A3LJ 1AU7A 4JL3A 3VW0A 5F1JA 2EZHA 1TWFJ 2VKVA 3NARA 2X6OA 2EZIA 2KT0A 2MGQA 9ANTA 4JP0A 3BG9A 5F27A 3FIWA 2V57A 5FKOA 3ZQCA 3S1NJ 4ICHA 4FCYA 2IU5A 5EGOB 2DA3A 2FX0A 1A6IA 3ZQLA 1E3OC 5F0CA 5IP7J 1GUUA 1B8IA 2L7FP 5EEAA 2XPUA 1JTXA 2CUFA 1ETKA 1ZR4A 2Y31A 1XG1A 2OPTA 4RDUA 4NELA 3QBMA 2FQ4A 3VOXA 3NAUA 2CJJA 2DJNA 3O8HA 4M6VA 1IV6A 3OSGA 2WAQN 1JUSA 4M3FA 3M4OJ 3Q0UA 3OIOA 1GT0C 3S1MJ 2YVEA 5EZHA 1OCPA 1RR7A 5E3LA 1IG7A 2GFNA 3HOYJ 2ECBA 5E3NA 2O7TA 3IUVA 5EFYA 4JYKA 1R9TJ 2YU9J 2QIBA 1ZQ3P 2EZLA 2QOPA 1MH3A 1WCMJ 2KDZA 5M3MJ 1T33A 3I4NJ 1RPWA 1IRZA 1XC5A 4XRSA 1ENHA 3C2BA 5CXGA 2HOAA 2NVQJ 3JSJA 1JUMA 2JN6A 1IDZA 1OFCX 4I76A 4HNVA 2QCOA 2E2HJ 4GFBA 3AQSA 2HXOA 2YS9A 2LR8A 2VKEA 3FK7A 3Q3SA 2F07A 2HKUA 5D19A 3BR6A 1AKHA 3BT9A 2E19A 2WB1N 5EG0B 1ZTRA 3OOUA 3BR2A 3RQIA 4AYBN 5M5XJ 3IH4A 4G12A 2EQRA 2IAIA 1NK2P 2OF7A 3JRIA 2D6YA 3O60A 2M9HA 1WPKA 3HEFA 3HOZJ 1UI6A 5J1UA 3S16J 1ETOA 4BY1J 4J19A 1H8AC 2PMZN 2PZ9A 1EF4A 4IEJA 2XSDC 3O8GA 3LOCA 4JX4A 4BBRJ 1H88C 4UUSA 3GTPJ 2M0CA 2O7OA 5FJ8J 2NVYJ 4V2FA 1QVTA 3G56A 2EZKA 1X58A 3SFIA 2DTZA 5FMPA 1VNDA 3S15J 2DA1A 2K9SA 1LFUP 2QKOA 5D1RA 3SJMA 4GCKA 2RAEA 1HOMA 5CXIA 2ZOZA 3BTCA 4B3AA 1DU6A 2X9DA 4Y7NJ 1IGNA 2Y30A 3TW6A 1ETXA 2R5YA 1SFOJ 4IHVA 2R92J 3S5RA 2K40A 4UDSA 2M2EA 3FKIJ 5HODA 5FHPA 1ETVA 2E1OA 1JT6A 2XB0X 4M3EA 1A5JA 2QTQA 4RBOA 4DYCA 3HOWJ 4BBSJ 2DA7A 2UXOA 1JKOC 5DS9A 4ABZA 2D5VA 2NVXJ 1ITYA 4A3KJ 3JRAA 5IYBJ 4D5FA 2HXIA 3BG3A 4D7NA 5J1YA 1BW5A 5M5WJ 4AC0A 2CRGA 1MBKA 5HBUA 4L5EA 4A3FJ 1HDDC 2ME6A 3RKQA 3MN2A 3VW1A 1MBFA 3NI7A 3L1PA 3ZOBA 2EBIA 5GPCA 2O8KA 2I10A 1Y1WJ 1TWGJ 3G1MA 1SANA 2OI8A 2LLKA 3BCGA 1XS9A 1MNMC 2ZOYA 1MSFC 2DMUA 5DAJA 3VW2A 2HYJA 2LY9A 5HAWA 3FK6A 4B1RA 3GZIA 2PBXA 4BXXJ 2UXPA 4I6ZA 2HDDA 2DMTA 3KZ9A 3ON4A 2R93J 1UHSA 3T6NA 1TWCJ 2DMNA 2ZB9A 1APLC 5AQCA 3BNIA 2O9LA 2JA5J 2YVHA 2WV1A 5E3MA 2K9NA 2H8RA 1HDPA 4QTRA 1JGGA 2NP5A 1B72B 4IHXA 1BJZA 1TC3C 2RHAA 2VI6A 1X2NA 1QRYA 4UUSB 4KWAA 2COBA 1NK3P 3K7AJ 3VUQA 4V2GA 3CWRA 3K2AA 1I3QJ 3DEWA 1LE8B 3HKZN 5EF6A 1ZR2A 4FISA 4BKXA 2K9QA 3KNWA 3QPLA 1I6HJ 1QVUA 1VFCA 1S7EA 2LKXA 2JK3A 3VPRA 2JA6J 3VIBA 4M3BA 2R5YB 2NS8A 2TCTA 3RZDJ 3MVPA 4L62A 3PM1A 3VOKA 4GFLA 5E3OA 3GEUA 2DG7A 2FD5A 1YRNA 2ZCMA 3HM5A 3LWJA 2B63J 1JKQC 2LFBA 4NDLA 3HTIA 1W0TA 2L0KA 5GPAA 3ZQHA 3HOXJ 1IJWC 2ELKA 2Y2ZA 3S1QJ 3GTJJ 3TEDA 4AF5A 3QPSA 1ZKGA 1JKRC 2W53A 1SGMA 3F0CA 3HGGA 2Q24A 4C3HJ 5C44J 1BA5A 1MBHA 3I4MJ 3TP3A 5IYDJ 3BG5A 3UKGA 5C4YA 3E7LA 3CDLA 3ANGA 5FLMJ 2LK2A 2CQQA 3D1NI 2M34A 1IUFA 5IP6A 3BTLA 1RETA 1B72A 3CCYA 4S0HB 1NTCA 1ETWA 2DA2A 4A69C 3WHCA 2LTPA 2R7ZJ 4GFKA 2MG4A 5JLXA 2Y9YA 3BR1A 2DA4A 3COLA 2HYTA 2LD5A 3BJBA 1UG2A 3ZQGA 3GTQJ 4GCTA 1LE8A 1RKWA 2REKA 3GTMJ 4A93J 2L7MP 1WI3A 3IH3A 1U8BA 2CQXA 4B4CA 2GUHA 4W97A 3ZQIA 1I50J 4ME9A 4EEFG 1GV2A 4XRSG 3B6CA 5IP9J 3JRBA 1K61A 2UXIA 5H9TA 1GVDA 4XIDA 4UUTA 3NNRA 1HF0A 3V78A 1Z77A 1JT0A 5C4JJ 2YUSA 4MFDA 3A01B 3GBGA 1MH4A 4QIWN 1H89C 1AHDP 2QF7A 3S2DJ 4A3DJ 5F08A 3CRJA 2VPRA 3G1LA 5FKNA 1LFBA 4IHWA 5DTDA 3HTHA 1U9OA 1F43A 5C4XJ 4A3GJ 2UXHA 3NPIA 2MW8A 1FJLA 4C2MJ 2HQ5A 4M3GA 5IPAA 1FTTA 3AQTA 4FE7A 2XPVA 2GLOA 2X48A 1FEXA 5JLWA 4MO7A 1YRNB 3BTJA 3JRCA 4CGRA 3BQYA 3CJDA 5FKLA 1FIPA 2IBDA 3G1OA 2XGDA 1T56A 3H0GJ 4DZJA 5EDNA 2GENA 1PUFB 5GP9A 3ANPA 4CYCA 4JX5A 3SDGA 4A3JJ 1JJ6C 5D18A 3EGQA 2G7SA 3VP5A 2RASA 3Q0WA 2N8GA 2Y0SN 2FBQA 1JUPA 1RESA 1BW6A 4ACIA 2ID6A 4M3DA 3BR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU0 A;  2DMQ A;  3PAS A;  4AC6 A;  3NRG A;  2GBY A;  2UXU A;  2XDN A;  2ZCN A;  3C07 A;  3TW7 A;  1OCT C;  2XRL A;  1VF9 A;  2CUE A;  5EZG A;  5M3F J;  2QWT A;  2FJ1 A;  3S1R J;  2GM4 A;  2DG8 A;  2DMP A;  3A01 A;  3JRF A;  3HTA A;  2M8G X;  3QKX A;  3HIM A;  4DYR A;  2XGE A;  1WGX A;  4A3I J;  3Q0V A;  2DA6 A;  4DW6 A;  4JNN A;  3HOV J;  4X6A J;  4MIM A;  3LSG A;  3V6G A;  2P81 A;  3S17 J;  1Q1V A;  4XIC A;  2ME0 A;  2R5Z B;  3HE0 A;  4JKZ A;  3IV5 A;  1X2M A;  1TWH J;  1P7J A;  3MKL A;  5IOY A;  3BQZ A;  3EUP A;  4X1E A;  5HSZ A;  1MBG A;  1MBE A;  3GTG J;  4DZP A;  1OJL A;  5F0F A;  1BL0 A;  3HOU J;  3GTK J;  4GCL A;  1ETQ A;  1ZGW A;  1POG A;  2H1K A;  2ECC A;  2R0Q C;  1PUF A;  5FKK A;  3HDD A;  5EYR A;  2XGC A;  1D5Y A;  2G3B A;  3RZO J;  2JWT A;  2NS7 A;  1GDT A;  4A3M J;  4A3E J;  4Y52 J;  3BTI A;  1UMQ A;  4DYQ A;  5M5Y J;  3OSF A;  3S14 J;  3S2H J;  3ZQF A;  4XK4 A;  3BRU A;  5CW8 A;  1U78 A;  3KKD A;  1P7I A;  5K7Z A;  4CYC B;  2AO9 A;  2NVT J;  2NP3 A;  4C3J J;  2G7L A;  2NOG A;  2JA8 J;  1CQT A;  3JRG A;  4AUX A;  2E2I J;  1HCR A;  2JA7 J;  5IOZ A;  3M3Y J;  5FGL A;  2AHQ A;  3RH2 A;  2DN0 A;  2NX4 A;  3G7R A;  3B81 A;  3FIS A;  1W0U A;  1ETY A;  3HGY A;  2Y9Z A;  2TRT A;  2HI3 A;  5F04 A;  3A02 A;  4MLO A;  4LOC A;  1UI5 A;  3FRQ A;  3QQA A;  5J3L A;  3W6V A;  1JKP C;  4W1U A;  2E2J J;  4YZE A;  3LNQ A;  3MNL A;  5EGO A;  3HB9 A;  2R5Z A;  1FTZ A;  4PXI A;  2G0E A;  2CU7 A;  3LJL A;  3PPB A;  1VI0 A;  3JRD A;  4BY7 J;  1MSE C;  1F36 A;  1JJ8 C;  3JRH A;  1MBJ A;  3LSR A;  2IEK A;  3P9T A;  3NXC A;  4D7M A;  2WUI A;  2OER A;  5FLV A;  3BHQ A;  3F1B A;  4NN1 A;  1QPI A;  2JJ7 A;  3PO2 J;  2MSY A;  5C3E J;  4A3C J;  2L7Z A;  3LSJ A;  5F0H A;  3H3V K;  3CMY A;  1HLV A;  3GTO J;  1B8I B;  3BR3 A;  4IHY A;  3ON2 A;  3B6A A;  2XPW A;  1GV5 A;  2WGB A;  2W48 A;  1JTY A;  1RKT A;  4FE4 A;  1TWA J;  3DCF A;  5K58 A;  1WH7 A;  4JX6 A;  4QSH A;  2HOS A;  5J1R A;  3VVZ A;  3LSP A;  5FKM A;  3A03 A;  4FTH A;  3CQZ J;  2VUM J;  3WHB A;  1Z0X A;  2G7G A;  1WH5 A;  3VVX A;  2ZCX A;  1O4X A;  4HKU A;  1FIA A;  2EH3 A;  1IDY A;  2LP0 A;  3HBL A;  2L9R A;  5K7H A;  4XRM A;  3E7Q A;  3KKC A;  5IYC J;  1ORK A;  5EG0 A;  2DA5 A;  1ZK8 A;  3GTL J;  3JRE A;  4D5C A;  4MK6 A;  3TP0 A;  3BR5 A;  2XB5 A;  2ID3 A;  4MXM A;  4C3I J;  4A3B J;  3PO3 J;  1Y1V J;  3IH2 A;  3HTJ A;  5K7F A;  1G2H A;  3RD3 A;  3VVY A;  2JMW A;  5BNG A;  3LHQ A;  1IC8 A;  3DPJ A;  1U9N A;  3JR9 A;  1K83 J;  4MFE A;  1AKH B;  2LVS A;  2HOT A;  4A3L J;  1AU7 A;  4JL3 A;  3VW0 A;  5F1J A;  2EZH A;  1TWF J;  2VKV A;  3NAR A;  2X6O A;  2EZI A;  2KT0 A;  2MGQ A;  9ANT A;  4JP0 A;  3BG9 A;  5F27 A;  3FIW A;  2V57 A;  5FKO A;  3ZQC A;  3S1N J;  4ICH A;  4FCY A;  2IU5 A;  5EGO B;  2DA3 A;  2FX0 A;  1A6I A;  3ZQL A;  1E3O C;  5F0C A;  5IP7 J;  1GUU A;  1B8I A;  2L7F P;  5EEA A;  2XPU A;  1JTX A;  2CUF A;  1ETK A;  1ZR4 A;  2Y31 A;  1XG1 A;  2OPT A;  4RDU A;  4NEL A;  3QBM A;  2FQ4 A;  3VOX A;  3NAU A;  2CJJ A;  2DJN A;  3O8H A;  4M6V A;  1IV6 A;  3OSG A;  2WAQ N;  1JUS A;  4M3F A;  3M4O J;  3Q0U A;  3OIO A;  1GT0 C;  3S1M J;  2YVE A;  5EZH A;  1OCP A;  1RR7 A;  5E3L A;  1IG7 A;  2GFN A;  3HOY J;  2ECB A;  5E3N A;  2O7T A;  3IUV A;  5EFY A;  4JYK A;  1R9T J;  2YU9 J;  2QIB A;  1ZQ3 P;  2EZL A;  2QOP A;  1MH3 A;  1WCM J;  2KDZ A;  5M3M J;  1T33 A;  3I4N J;  1RPW A;  1IRZ A;  1XC5 A;  4XRS A;  1ENH A;  3C2B A;  5CXG A;  2HOA A;  2NVQ J;  3JSJ A;  1JUM A;  2JN6 A;  1IDZ A;  1OFC X;  4I76 A;  4HNV A;  2QCO A;  2E2H J;  4GFB A;  3AQS A;  2HXO A;  2YS9 A;  2LR8 A;  2VKE A;  3FK7 A;  3Q3S A;  2F07 A;  2HKU A;  5D19 A;  3BR6 A;  1AKH A;  3BT9 A;  2E19 A;  2WB1 N;  5EG0 B;  1ZTR A;  3OOU A;  3BR2 A;  3RQI A;  4AYB N;  5M5X J;  3IH4 A;  4G12 A;  2EQR A;  2IAI A;  1NK2 P;  2OF7 A;  3JRI A;  2D6Y A;  3O60 A;  2M9H A;  1WPK A;  3HEF A;  3HOZ J;  1UI6 A;  5J1U A;  3S16 J;  1ETO A;  4BY1 J;  4J19 A;  1H8A C;  2PMZ N;  2PZ9 A;  1EF4 A;  4IEJ A;  2XSD C;  3O8G A;  3LOC A;  4JX4 A;  4BBR J;  1H88 C;  4UUS A;  3GTP J;  2M0C A;  2O7O A;  5FJ8 J;  2NVY J;  4V2F A;  1QVT A;  3G56 A;  2EZK A;  1X58 A;  3SFI A;  2DTZ A;  5FMP A;  1VND A;  3S15 J;  2DA1 A;  2K9S A;  1LFU P;  2QKO A;  5D1R A;  3SJM A;  4GCK A;  2RAE A;  1HOM A;  5CXI A;  2ZOZ A;  3BTC A;  4B3A A;  1DU6 A;  2X9D A;  4Y7N J;  1IGN A;  2Y30 A;  3TW6 A;  1ETX A;  2R5Y A;  1SFO J;  4IHV A;  2R92 J;  3S5R A;  2K40 A;  4UDS A;  2M2E A;  3FKI J;  5HOD A;  5FHP A;  1ETV A;  2E1O A;  1JT6 A;  2XB0 X;  4M3E A;  1A5J A;  2QTQ A;  4RBO A;  4DYC A;  3HOW J;  4BBS J;  2DA7 A;  2UXO A;  1JKO C;  5DS9 A;  4ABZ A;  2D5V A;  2NVX J;  1ITY A;  4A3K J;  3JRA A;  5IYB J;  4D5F A;  2HXI A;  3BG3 A;  4D7N A;  5J1Y A;  1BW5 A;  5M5W J;  4AC0 A;  2CRG A;  1MBK A;  5HBU A;  4L5E A;  4A3F J;  1HDD C;  2ME6 A;  3RKQ A;  3MN2 A;  3VW1 A;  1MBF A;  3NI7 A;  3L1P A;  3ZOB A;  2EBI A;  5GPC A;  2O8K A;  2I10 A;  1Y1W J;  1TWG J;  3G1M A;  1SAN A;  2OI8 A;  2LLK A;  3BCG A;  1XS9 A;  1MNM C;  2ZOY A;  1MSF C;  2DMU A;  5DAJ A;  3VW2 A;  2HYJ A;  2LY9 A;  5HAW A;  3FK6 A;  4B1R A;  3GZI A;  2PBX A;  4BXX J;  2UXP A;  4I6Z A;  2HDD A;  2DMT A;  3KZ9 A;  3ON4 A;  2R93 J;  1UHS A;  3T6N A;  1TWC J;  2DMN A;  2ZB9 A;  1APL C;  5AQC A;  3BNI A;  2O9L A;  2JA5 J;  2YVH A;  2WV1 A;  5E3M A;  2K9N A;  2H8R A;  1HDP A;  4QTR A;  1JGG A;  2NP5 A;  1B72 B;  4IHX A;  1BJZ A;  1TC3 C;  2RHA A;  2VI6 A;  1X2N A;  1QRY A;  4UUS B;  4KWA A;  2COB A;  1NK3 P;  3K7A J;  3VUQ A;  4V2G A;  3CWR A;  3K2A A;  1I3Q J;  3DEW A;  1LE8 B;  3HKZ N;  5EF6 A;  1ZR2 A;  4FIS A;  4BKX A;  2K9Q A;  3KNW A;  3QPL A;  1I6H J;  1QVU A;  1VFC A;  1S7E A;  2LKX A;  2JK3 A;  3VPR A;  2JA6 J;  3VIB A;  4M3B A;  2R5Y B;  2NS8 A;  2TCT A;  3RZD J;  3MVP A;  4L62 A;  3PM1 A;  3VOK A;  4GFL A;  5E3O A;  3GEU A;  2DG7 A;  2FD5 A;  1YRN A;  2ZCM A;  3HM5 A;  3LWJ A;  2B63 J;  1JKQ C;  2LFB A;  4NDL A;  3HTI A;  1W0T A;  2L0K A;  5GPA A;  3ZQH A;  3HOX J;  1IJW C;  2ELK A;  2Y2Z A;  3S1Q J;  3GTJ J;  3TED A;  4AF5 A;  3QPS A;  1ZKG A;  1JKR C;  2W53 A;  1SGM A;  3F0C A;  3HGG A;  2Q24 A;  4C3H J;  5C44 J;  1BA5 A;  1MBH A;  3I4M J;  3TP3 A;  5IYD J;  3BG5 A;  3UKG A;  5C4Y A;  3E7L A;  3CDL A;  3ANG A;  5FLM J;  2LK2 A;  2CQQ A;  3D1N I;  2M34 A;  1IUF A;  5IP6 A;  3BTL A;  1RET A;  1B72 A;  3CCY A;  4S0H B;  1NTC A;  1ETW A;  2DA2 A;  4A69 C;  3WHC A;  2LTP A;  2R7Z J;  4GFK A;  2MG4 A;  5JLX A;  2Y9Y A;  3BR1 A;  2DA4 A;  3COL A;  2HYT A;  2LD5 A;  3BJB A;  1UG2 A;  3ZQG A;  3GTQ J;  4GCT A;  1LE8 A;  1RKW A;  2REK A;  3GTM J;  4A93 J;  2L7M P;  1WI3 A;  3IH3 A;  1U8B A;  2CQX A;  4B4C A;  2GUH A;  4W97 A;  3ZQI A;  1I50 J;  4ME9 A;  4EEF G;  1GV2 A;  4XRS G;  3B6C A;  5IP9 J;  3JRB A;  1K61 A;  2UXI A;  5H9T A;  1GVD A;  4XID A;  4UUT A;  3NNR A;  1HF0 A;  3V78 A;  1Z77 A;  1JT0 A;  5C4J J;  2YUS A;  4MFD A;  3A01 B;  3GBG A;  1MH4 A;  4QIW N;  1H89 C;  1AHD P;  2QF7 A;  3S2D J;  4A3D J;  5F08 A;  3CRJ A;  2VPR A;  3G1L A;  5FKN A;  1LFB A;  4IHW A;  5DTD A;  3HTH A;  1U9O A;  1F43 A;  5C4X J;  4A3G J;  2UXH A;  3NPI A;  2MW8 A;  1FJL A;  4C2M J;  2HQ5 A;  4M3G A;  5IPA A;  1FTT A;  3AQT A;  4FE7 A;  2XPV A;  2GLO A;  2X48 A;  1FEX A;  5JLW A;  4MO7 A;  1YRN B;  3BTJ A;  3JRC A;  4CGR A;  3BQY A;  3CJD A;  5FKL A;  1FIP A;  2IBD A;  3G1O A;  2XGD A;  1T56 A;  3H0G J;  4DZJ A;  5EDN A;  2GEN A;  1PUF B;  5GP9 A;  3ANP A;  4CYC A;  4JX5 A;  3SDG A;  4A3J J;  1JJ6 C;  5D18 A;  3EGQ A;  2G7S A;  3VP5 A;  2RAS A;  3Q0W A;  2N8G A;  2Y0S N;  2FBQ A;  1JUP A;  1RES A;  1BW6 A;  4ACI A;  2ID6 A;  4M3D A;  3BR0 A; 
#chains in the Genus database with same CATH topology
 1KON A;  3WTW C;  5DM7 F;  1FZP B;  3C18 A;  3NRG A;  2GBY A;  1EH6 A;  2L9S A;  3FZV A;  3FXR A;  3H5A A;  3TW7 A;  2DK5 A;  2CUE A;  2STW A;  4IHS A;  3GFM A;  3V7S A;  5E1Z B;  3A01 A;  1V5F A;  3JRF A;  4WXH A;  5BQT A;  3QKX A;  1MMD A;  3HOS A;  1I39 A;  4DYR A;  2E5N A;  1AOY A;  4U7D A;  2Q0O A;  1WGX A;  2XGE A;  2KQR A;  1TL8 A;  4MIM A;  3OYM A;  5LBQ A;  3OS2 A;  4HV6 A;  4HG2 A;  4Y4R A;  1PJR A;  3L2R A;  2LMD A;  3FM5 A;  5CVU A;  1UZC A;  3MKL A;  1FYK A;  3QP5 A;  1IUY A;  1STZ A;  3BZ6 A;  1MBG A;  4HLY A;  5HSZ A;  5F0F A;  1FX7 A;  2W84 A;  4XNF A;  3FXO A;  3GTK J;  1T39 A;  1ETQ A;  3OR2 C;  1ZGW A;  3A0H C;  1POG A;  2EFQ A;  4ASN A;  2IXS A;  2R7O A;  5DUI A;  2DU9 A;  2ZJQ F;  1I6X A;  4HOB A;  3HDD A;  1Q1H A;  2G3B A;  3RZO J;  2JWT A;  4U87 A;  4A3M J;  4TV7 A;  4Y52 J;  3BTI A;  4DVY P;  5E8G A;  4KIF A;  2CUJ A;  2FXA A;  3E6B A;  2ZSI B;  3HRM A;  1Z67 A;  4LD5 A;  5M5Y J;  3OSF A;  1VQK I;  4U9L A;  3T1B A;  2X1E A;  2Z9O A;  4XK4 A;  3BRU A;  1E2X A;  3H92 A;  3T8T A;  4F93 B;  5K7Z A;  5DCF A;  2AO9 A;  4C3J J;  2G7L A;  2OQG A;  2JA8 J;  3FXM A;  1CQT A;  2R7V A;  3M3Y J;  5HDG A;  3PJR A;  2DO7 A;  2F48 A;  2PEX A;  4HF0 A;  4IHT A;  5J4Y A;  1TLH B;  1TTY A;  4PDK A;  2CQ7 A;  2VPL A;  2FBH A;  3FRQ A;  2HI3 A;  3SEQ A;  3A02 A;  3ZRG A;  1UCR A;  3ZP5 A;  2Y48 A;  4M71 A;  3GZN B;  1JKP C;  4W1U A;  5CJ9 A;  3F8M A;  1RNL A;  3RI4 A;  1H9T A;  3BDD A;  2WTE A;  3LNQ A;  3ERM A;  3WTZ A;  3MNL A;  1I5Z A;  2IT0 A;  4RGS A;  4PFO A;  1JE8 A;  3E3V A;  2WV0 A;  3WG7 H;  3KLO A;  1JJ8 C;  2YU3 A;  1JXS A;  3LSR A;  2VIX A;  5F64 A;  2WAQ A;  1OIS A;  2WUI A;  3DPU A;  2XAS A;  3OOP A;  2X1C A;  3SYT A;  5K1Y A;  4R1H A;  4NN1 A;  2F4O B;  2JJ7 A;  1QPI A;  4UVA A;  5FRO A;  4NNJ A;  1NG6 A;  4OIR F;  3AFH A;  1HLV A;  2H6B A;  5KCM A;  1UJ8 A;  3GTO J;  4A6E A;  1O3T A;  3BR3 A;  4IHY A;  4M74 A;  4ENM A;  2OZ6 A;  2XPW A;  4WCG A;  1R1U A;  3ERE D;  1VQ9 I;  4QSH A;  1LPQ A;  4ZH4 F;  3VVZ A;  4XOR A;  5FKM A;  2D1H A;  3A03 A;  3KP2 A;  4GGG A;  3OS1 A;  1VQ8 I;  4E7I A;  4ANJ A;  2HQN A;  3OWT A;  5DM6 F;  2ESN A;  2HKX A;  3VVX A;  4HYE A;  4HKU A;  5K5Q A;  4CGZ A;  4RM2 A;  3DQV C;  2WB1 A;  1N77 A;  1EKE A;  2LP0 A;  3GFJ A;  3HBL A;  1XGS A;  1RRJ A;  2DA5 A;  2V7F A;  2L5Q A;  3FDY A;  2BV6 A;  4D5C A;  3CCE I;  2VJJ A;  2XF7 A;  3GO5 A;  4MTE A;  4EGZ A;  2K85 A;  2XB5 A;  5CLS A;  1MDM B;  2ID3 A;  2PMZ A;  2RGV A;  1RZ4 A;  3W2A A;  1H9G A;  3DP7 A;  3PO3 J;  2L9V A;  1Y1V J;  4EV0 A;  3PNY A;  1DGR M;  4LIT A;  3ZCO A;  4LK0 F;  2PBI A;  3OY9 A;  1IC8 A;  2HTJ A;  2M4G A;  1U9N A;  1YYV A;  2WY8 Q;  3JR9 A;  2X1D A;  4MFE A;  1VQP I;  2B0L A;  1X1P A;  5ERI A;  5F1J A;  1E0E A;  2YX7 A;  1OCC H;  1E17 A;  1RUN A;  2V1U A;  1BR4 A;  4JP0 A;  3BG9 A;  1OQY A;  3FBI B;  4RGX A;  9ANT A;  2ZKZ A;  3K0L A;  2VOD A;  2V57 A;  3WGG A;  2VC1 A;  4G8X A;  3QYE A;  1WJE A;  5EGO B;  1T38 A;  1IF1 A;  2OCC H;  3JTH A;  3SFZ A;  3TMO A;  1E3O C;  1SFK A;  2EB7 A;  5IP7 J;  3NS4 A;  5F1R A;  1OPC A;  5ICF A;  2L7F P;  3VOE A;  1N78 A;  1QZY A;  3WGI A;  2OPT A;  1VQ6 I;  4NEL A;  2XF6 A;  3VOX A;  5ICC A;  1K78 B;  1FBQ A;  4DBR A;  4M6V A;  4IRV A;  3ASN H;  3OSG A;  2NXN B;  3TO7 A;  4M3F A;  1ZEL A;  3M4O J;  1HC8 A;  4RB1 A;  3OIO A;  1TP4 A;  3L7W A;  1WVR A;  4MTD A;  1OCP A;  1RR7 A;  3HOY J;  5E3N A;  3CF2 A;  1R58 A;  2O8X A;  2O61 A;  4IJA A;  2VE8 A;  5LEJ A;  2MLK A;  2YU9 J;  4LIU A;  4IX7 A;  1TT0 A;  1ZQ3 P;  2STT A;  2EZL A;  3MKZ A;  2FML A;  3BPX A;  2QA4 I;  1LQ1 A;  2KDZ A;  1SVL A;  3U2R A;  5M3M J;  4N0B A;  2ZJ2 A;  3I4N J;  4IPA A;  2EK5 A;  3OL4 A;  4XRS A;  1ENH A;  2NVQ J;  2R7R A;  3JSJ A;  3ONQ A;  1IDZ A;  2ZXI A;  1PYV A;  4I76 A;  4GFB A;  2QCO A;  3VYU B;  4L0Y B;  3AQS A;  2YS9 A;  3Q3S A;  3KPH A;  2QKL B;  3CDH A;  5D19 A;  3BC8 A;  3BR6 A;  2G9W A;  3BT9 A;  3PQK A;  4G6Q A;  4G9Y A;  4F3Q A;  1L0O C;  4HPQ A;  1ZTR A;  3OOU A;  1UHW A;  4BHP A;  3BR2 A;  4AYB N;  1MMA A;  4UB6 C;  4G12 A;  5LGT A;  4LB6 B;  3HOT A;  2OAZ A;  4B47 A;  1NK2 P;  3V42 A;  5E79 C;  4F52 A;  3Q5F A;  2M9H A;  1WPK A;  3HEF A;  4LK1 F;  1UI6 A;  5J1U A;  3S16 J;  1ETO A;  3BJO A;  5DCM B;  3J7Z I;  4Q5S F;  4OD5 A;  4IEJ A;  4RAG A;  4BGD A;  5CPR B;  3WTY C;  4JX4 A;  4BBR J;  3DLA A;  2EIM H;  1WJ5 A;  5J40 A;  2FE3 A;  1TBX A;  4V2F A;  3K70 C;  3R60 A;  4Z2Y A;  5HNF A;  1QA6 A;  1ZH5 A;  3P9C A;  4FAS D;  4XBF A;  1YOV B;  2A5Y B;  3T0Y A;  1T08 B;  2QQB A;  1VND A;  1IW7 F;  2K9S A;  4QPQ A;  2QKO A;  5A2Q Z;  4GCK A;  2RAE A;  1DU6 A;  2X9D A;  2QQ9 A;  4ITV A;  4KN7 X;  2Y30 A;  1IGN A;  1ETX A;  1SFO J;  1V4R A;  2DLL A;  2K40 A;  5KHD A;  4HNU A;  1ETV A;  2E1O A;  3ELK A;  1A5J A;  5D4R A;  3ZMZ A;  4M6Y A;  1A6Q A;  2OD5 A;  2RQQ A;  3VSL A;  2QM3 A;  5CVJ A;  2NOJ B;  4EM0 B;  5DS9 A;  5D5V B;  4O3M A;  2VJ5 A;  5FFZ A;  1IXS B;  2FJI 1;  2E1M B;  4CCL A;  4JK1 X;  3J7A Y;  4D7N A;  4ZYD A;  2V6E A;  1BW5 A;  4AC0 A;  1MBK A;  3KEY A;  4UVC A;  5LHI A;  2EFN A;  3MN2 A;  3VW1 A;  1S5L C;  3M8F A;  1SMY F;  1ZRF A;  1OYW A;  3LSI A;  3ZOB A;  2K9M A;  3EUH A;  3CJT B;  2O8K A;  5LLQ A;  5JVG F;  2OI8 A;  1PVE A;  3BCG A;  1MNM C;  2CS3 A;  1MSF C;  2BXZ A;  3TDU C;  3W3C A;  5L3B A;  2HYJ A;  1EV7 A;  1GXP A;  2BXY A;  3FMR A;  4RB3 C;  4G7Z F;  3GZI A;  1E3H A;  1TNT A;  3ON4 A;  1S72 I;  3T6N A;  1WWX A;  5AQC A;  4OWR B;  3ZGK A;  3BNI A;  3F72 A;  1BIA A;  2YSR A;  4HNT A;  3EPZ A;  1X1B A;  2K9N A;  2A61 A;  5HDN A;  2AS5 F;  3OYN A;  2JRM A;  1BJZ A;  2Z3Y A;  4OAY A;  2DFH A;  3FXQ A;  4UV9 A;  3JW4 A;  4ZTJ A;  5DDG A;  4XKW A;  2K02 A;  1ACI A;  4OIQ F;  2IGM A;  4CCJ A;  3QPH A;  2XAF A;  2XF5 A;  3VUQ A;  1LE8 B;  2O6G E;  4RAY A;  1UB9 A;  2KP6 A;  2L2O A;  4FIS A;  3WTX C;  3KNW A;  1A04 A;  1QVU A;  4AWX B;  3LA3 A;  3TQN A;  3F8B A;  4CYD A;  1Z6T A;  2CWE A;  3P9I A;  3RYR A;  3VIB A;  1WSU A;  2NS8 A;  1FC3 A;  2QEN A;  3I53 A;  3PM1 A;  1WJD A;  4UHT A;  5E3O A;  3GEU A;  5HOO A;  2DG7 A;  3NQO A;  2ZCM A;  4DIQ A;  2MYS A;  1OYY A;  2B63 J;  2EWN A;  2DFI A;  1WZ2 A;  1IJW C;  2ELK A;  3I58 A;  3TED A;  3FWE A;  2KIF A;  3FHN A;  4MQV A;  2GXG A;  4HLX A;  1G4D A;  3E97 A;  3F0C A;  3HGG A;  2Q24 A;  1ZHF A;  3G3Z A;  3K1P A;  3BLY A;  1FYM A;  1TQI A;  3CUQ B;  5B1A H;  2OV7 A;  3I4M J;  4ESF A;  2B3W A;  2Y69 H;  2ACJ A;  3ISP A;  2XGX A;  2IS1 A;  5IYD J;  1Y6I A;  2JA2 A;  2W25 A;  2LK2 A;  2JVH A;  2MBF A;  4CDG A;  1BM9 A;  2DCE A;  2P5K A;  2DYR H;  4D9J A;  5FLX K;  2DA2 A;  4A69 C;  2QWW A;  1SD7 A;  2MH2 A;  4LG0 A;  2P8T A;  2R7Z J;  4F92 B;  2V26 A;  5JLX A;  2DA4 A;  3VTI A;  2HYT A;  2LD5 A;  3ZQG A;  5HDK A;  4II2 A;  2L54 A;  1LE8 A;  1J09 A;  1RKW A;  2ZXJ A;  1UST A;  4F91 B;  3GTM J;  1HKS A;  4A93 J;  1E3P A;  3GWZ A;  2GUH A;  3ZQI A;  4ME9 A;  3SZP A;  2NNY A;  5JHU A;  5E20 A;  3RTR A;  2FF4 A;  2UXI A;  1P4A A;  3ABU A;  3AG2 H;  4P55 A;  3NNR A;  1HF0 A;  2LKP A;  4Q47 A;  2VE9 A;  1D1C A;  4N9H A;  1QU3 A;  1S7A A;  4BU2 A;  1FBU A;  4RS8 A;  4QIW N;  1H89 C;  5HS8 A;  2QF7 A;  3QOD A;  3BG6 A;  4P96 A;  4A3D J;  5TRD A;  1ZG3 A;  2E60 A;  4U0Y A;  1P4X A;  2QQA A;  2XRO A;  5DTD A;  2PFB A;  3HTH A;  3ZMV A;  5C4X J;  3VOD A;  4A3G J;  3LQR A;  3OYF A;  1PP7 U;  3HSE A;  1QGP A;  2DXI A;  1FTT A;  3T5X A;  3AQT A;  1J75 A;  1OCZ H;  3CUQ A;  1VQ5 I;  1CF7 B;  2GWR A;  4FE7 A;  2JQ7 A;  2X48 A;  3CC2 I;  1IRX A;  1XCB A;  3BTJ A;  3L2W A;  3JAM Z;  4CHU A;  2RRE A;  3IC7 A;  1W7P D;  2IBD A;  3DWL E;  3H0G J;  1PUF B;  1XDS A;  1U5T A;  4P1W A;  1ON2 A;  2C6Y A;  1R5H A;  2D1V A;  2H6C A;  5D18 A;  3RKY A;  2DOA A;  4Y13 A;  3DU5 A;  3V8K A;  3Q0W A;  3CCV I;  1K6Y A;  3IAM 2;  2COM A;  1M1E B;  2Y0S N;  3I55 I;  1K6O A;  2FBQ A;  1S29 A;  1RES A;  1BR1 A;  1BW6 A;  4XR6 A;  3CRJ A;  2X6Y A;  3W2V A;  4AC6 A;  3FXU A;  2Q2E A;  3VEP A;  2VOO A;  4UY8 I;  2UXU A;  1I3A A;  2ZCN A;  1D5V A;  1Z7U A;  1OCT C;  1BR2 A;  1VF9 A;  4DOZ A;  4XON A;  1FY7 A;  2QWT A;  2Z5U A;  4RLF A;  2WAF A;  1Y39 A;  2BE5 F;  4E7Z A;  1HW2 A;  5H6Q A;  1YS6 A;  1Y56 A;  2JPC A;  4A0X A;  2FBI A;  2M8G X;  3K4C A;  3BPV A;  3VYR B;  1O3Q A;  3Q0V A;  3LSG A;  2R7Q A;  3V6G A;  2P81 A;  2ME0 A;  3V8L A;  2R5Z B;  3M9A A;  3ABM H;  3WTS C;  3GZ5 A;  4JKZ A;  2OC6 A;  2B1E A;  2IS2 A;  3U9G A;  4Y15 A;  3ABL H;  3LA2 A;  2RVC A;  4X1E A;  1MBE A;  1OJL A;  2DAO A;  1CF7 A;  3I5U A;  3H3Z A;  3WTV C;  3HOU J;  1FOK A;  4GCL A;  4PGG A;  2FNP A;  2R7W A;  2BY3 A;  2M3A A;  1PUF A;  5FKK A;  3CJR B;  5E1X A;  5EYR A;  1GDT A;  2L4M A;  2TDX A;  2F5F A;  1UMQ A;  2CFO A;  2HWV A;  2FMY A;  1T98 A;  4IQ4 A;  3PSI A;  3FXJ A;  2HPM A;  3OYL A;  2LBF B;  5ICE A;  3S14 J;  1R7J A;  4DBQ A;  4CCM A;  5FGM A;  3S2H J;  2LG4 A;  2XAG A;  2R4G A;  4CYC B;  2NP3 A;  2ZCW A;  1YFH A;  2JUG A;  2XUB A;  2BHZ A;  3G73 A;  3C7J A;  1IXC A;  1GVJ A;  1SFE A;  1V3F A;  2KDO A;  3RH2 A;  2DN0 A;  3B81 A;  3EUA A;  4ZJZ A;  2Y9Z A;  5CVR A;  3DBH B;  1X1D A;  1YW8 A;  4YEJ A;  4MLO A;  4LOC A;  3J81 Z;  5J3L A;  3W6V A;  2IS6 A;  1FMW A;  2XRN A;  4XL9 A;  3ZMU A;  3HB9 A;  2HZT A;  2R5Z A;  3I59 B;  4PXI A;  5IT9 K;  3LJL A;  2LDU A;  4Z6Y A;  1NH3 A;  3CCS I;  2DQL A;  2CH0 A;  1MSE C;  2VJ4 A;  5DD4 A;  2WBM A;  3P9T A;  3NXC A;  3S93 A;  1G8X A;  2OER A;  3BCB A;  3E6D A;  3BHQ A;  3IRR A;  1G3S A;  2UUZ A;  3PO2 J;  1XX5 A;  2L7Z A;  4S04 A;  5H2F C;  5F0H A;  3H0D A;  4XLA A;  2K4B A;  1B8I B;  3WE2 A;  1O7F A;  1MJA A;  1R6R A;  1K4T A;  2LYC A;  1YQA A;  2VOP A;  4FE4 A;  3BOQ A;  1WH7 A;  4OMY A;  4U7B A;  3SDB A;  1IRG A;  3CCU I;  4FTH A;  1LFP A;  1QHH D;  3OYG A;  3CQZ J;  1W7P A;  5ED4 A;  3GYH X;  2ZJP F;  2JVG A;  3F8C A;  3BCA A;  3DEU A;  1O4X A;  4IF4 A;  4NBQ A;  3Q9V A;  4AIH A;  4OIP F;  2A6T A;  3BJ6 A;  4AYB A;  3JAM K;  5IYC J;  1YJ9 I;  3PUB A;  1U3E M;  5F6F A;  3JRE A;  2I5U A;  4B09 A;  4M72 A;  1VQM I;  3BR5 A;  4MXM A;  4C3I J;  2A2F X;  3VVY A;  3I59 A;  3KP5 A;  2CV1 A;  2E1M C;  5BNG A;  3LHQ A;  1O3R A;  3DPJ A;  4FQG A;  1K83 J;  3M07 A;  1AKH B;  2LVS A;  4JL3 A;  2PQ8 A;  1Z91 A;  1O3S A;  1KYZ A;  3KFW X;  1ON1 A;  1VTN C;  2XAJ A;  3VW0 A;  3DKW A;  2VQC A;  1TWF J;  2VKV A;  1ZLK A;  3WOD F;  2KT0 A;  3V7R A;  2XC7 A;  3K4M A;  2A3S A;  2JPB A;  5FKO A;  5B66 C;  1K79 A;  2VBW A;  2VKD A;  2HKO A;  3GLX A;  3F9K A;  2FX0 A;  3ZQL A;  4DQ2 A;  4B3X A;  5F0C A;  1PDN C;  3VYS B;  1B8I A;  4FHT A;  2HDC A;  3KE2 A;  5JI6 A;  5EEA A;  1WKM A;  1JTX A;  2CUF A;  2LNB A;  3E6M A;  3GLL A;  3BZC A;  1ETK A;  1Z3Y A;  2Y31 A;  2WAE A;  4RDU A;  1QZE A;  2NVU B;  3QBM A;  4N4N B;  2RNG A;  3L2U A;  3O8H A;  3E5U A;  5K5R A;  1KQ9 A;  1KU3 A;  5ILS A;  3D0S A;  1S7O A;  5HLH A;  2FBK A;  3DEE A;  3S1M J;  2YVE A;  1G6N A;  5L3C A;  2JZY A;  5EZH A;  1KU9 A;  5E3L A;  2ZC2 A;  2O7T A;  3IUV A;  4AU7 A;  2HVS A;  2CG4 A;  3L09 A;  1X4P A;  3KZZ A;  2QOP A;  4KMF A;  1T95 A;  4A0Z A;  2Z2S B;  3FHZ A;  1QPM A;  2IGO A;  1XC5 A;  3C2B A;  3I64 A;  2M30 A;  1A31 A;  1MJ9 A;  4HV5 A;  2FOW A;  2HZD A;  2J5O A;  2ZME C;  4HNV A;  3QOP A;  3CCR I;  2VKE A;  2IPQ X;  4RAZ A;  1AKH A;  1IZ1 A;  4PSW A;  2FRH A;  2PMH A;  4E7K A;  4XLE A;  3F6V A;  3K10 A;  3IH4 A;  3L2V A;  2UZK A;  4II3 A;  2EV6 A;  2OF7 A;  2HFH A;  4KT6 A;  3ZXS A;  4J19 A;  3QRF F;  3GZ6 A;  1EF4 A;  1IN8 A;  3O8G A;  2R7F A;  5BMZ A;  2A6E F;  3PFI A;  2EIL H;  3N05 A;  3TO6 A;  2NVY J;  4XRF A;  5FJ8 J;  1QVT A;  3CMA I;  2EZK A;  1XTA A;  3PSF A;  1X58 A;  1MD0 A;  2DTZ A;  2PJP A;  2DA1 A;  2QSF X;  3SJM A;  2ELJ A;  3DBL B;  2VAS A;  2OZU A;  5CXI A;  1G59 A;  3E6C C;  2ZOZ A;  4LLG F;  2OA4 A;  3OIP A;  2XAQ A;  3CLO A;  3L2C A;  1BC7 C;  1Z7L A;  4MNU A;  2K7L A;  2R92 J;  3S5R A;  4BL0 B;  1A35 A;  1FSE A;  3FKI J;  5HOD A;  5FHP A;  2HTS A;  2XB0 X;  5HS9 A;  1XSV A;  4DYC A;  4QLC U;  3HOW J;  5K5O A;  2RNJ A;  1T0F A;  1UEL B;  4AIK A;  1ITY A;  2VQL A;  4ABZ A;  1NHA A;  2NVX J;  1SD5 A;  3QWL A;  2X4H A;  2Y0M A;  4KIS A;  1HKT A;  3JRA A;  5IYB J;  1BBY A;  4D5F A;  3BG3 A;  5KNL A;  5M5W J;  3E1S A;  4PJJ A;  2KIU A;  3RSN A;  5AON A;  2CRG A;  3DBR B;  2CW8 A;  4ZZL A;  3KP7 A;  2BEO A;  2E1N A;  2HPI A;  1MBF A;  3U1D A;  2H27 A;  2M4K A;  2I10 A;  4PGH A;  1Z05 A;  4HRI A;  2LLK A;  2RKH A;  2ZSH B;  2NYX A;  4NQW B;  3ULQ B;  2R7X A;  1RI7 A;  1VQ4 I;  2PBX A;  4L9T A;  3VYT B;  2HDD A;  2ZY9 A;  2G7U A;  5LEK A;  1Z9C A;  4I2O A;  2R93 J;  1EH7 A;  1UHS A;  3B02 A;  1APL C;  4UB8 C;  4Q48 A;  2EA4 A;  2O9L A;  2JA5 J;  3OIQ A;  5E3M A;  4HSR A;  3U21 A;  2EV5 A;  1X19 A;  1HDP A;  4QTR A;  3HHH A;  4KIC A;  3DFG A;  2NP5 A;  2KKO A;  1B72 B;  3NWS A;  3LQQ A;  4HZF A;  2V1X A;  5LFA A;  1TC3 C;  3RYP A;  2P6T A;  4FT8 A;  1OYI A;  2DT5 A;  3CCQ I;  2RHA A;  3IRQ A;  1X2N A;  1QRY A;  2NAZ A;  2P5V A;  3CC4 I;  1KQ0 A;  2GQQ A;  1ZLJ A;  2HU9 A;  1NK3 P;  3K7A J;  4XKV A;  3K2A A;  4JOM A;  1YIJ I;  2CO5 A;  3ECO A;  5EF6 A;  4XN3 A;  3P9K A;  6PAX A;  1C0W A;  4KIT B;  1VFC A;  2P6S A;  1ZRC A;  2X85 A;  5TIS C;  2LKX A;  3TGN A;  4ENK A;  4A5M A;  2O5R A;  3RZD J;  3PQJ A;  3KX2 A;  1I1S A;  4GFL A;  3MWM A;  5FFX A;  4IO9 F;  5GAD J;  3WTT C;  1HST A;  4WX9 A;  3HM5 A;  4G94 A;  4YEL A;  1FT9 A;  3D5S C;  4NDL A;  1W0T A;  4CZC A;  4NQW A;  3HOX J;  2Y2Z A;  4BDY A;  3SXY A;  1P4W A;  3QPS A;  2DI3 A;  2M7B A;  2XHK A;  1JKR C;  4HX8 A;  1I27 A;  2Z1D A;  1SD4 A;  2L7K A;  4RGR A;  1R4N B;  5D5U B;  1BI3 A;  2Y0S A;  5C44 J;  1LDK B;  1HSJ A;  1I1G A;  3GX4 X;  1ZAR A;  3BG5 A;  4WK8 F;  1R36 A;  3CDL A;  4YG2 F;  3ANG A;  1WRJ A;  1BOA A;  2M34 A;  1IUF A;  2M8E A;  3I71 A;  1BI2 A;  5IP6 A;  3HRS A;  3BTL A;  1BI1 A;  1YTY A;  1B72 A;  5J4V A;  3CCY A;  4HF2 A;  2P5L C;  4S0H B;  1ETW A;  4E70 A;  2IW5 A;  3JCU C;  3WHC A;  2M87 A;  2Y9Y A;  3BR1 A;  3KEO A;  4OIN F;  2KIQ A;  1MZB A;  2FEZ A;  3HXL A;  2DDA A;  1KU7 A;  4RGU A;  2IP2 A;  5KK1 A;  2DDB A;  1XD7 A;  2L7M P;  1MKM A;  1WI3 A;  3RCO A;  2CQX A;  1MND A;  4EEF G;  1GV2 A;  1R49 A;  3B6C A;  4PK4 A;  3RIR A;  4A6D A;  4HBL A;  1B9N A;  4L9V A;  1MGT A;  2F4I A;  3V78 A;  1XGN A;  1LDJ A;  5C4J J;  4WWC A;  1JT0 A;  4U0V A;  3GBG A;  4UXN A;  1UFM A;  1N75 A;  3HRT A;  4NC8 A;  4BHB A;  4FX4 A;  3HIF A;  5F08 A;  1RC9 A;  4XMY A;  2VPR A;  1OKR A;  3F21 A;  1OR7 C;  5FKN A;  1U9O A;  1F43 A;  3FX3 A;  3I4P A;  2CQN A;  1U8R A;  1DDN A;  2F5D A;  4IRI A;  1QO0 D;  4C30 A;  2QLZ A;  1TW3 A;  2M7A A;  3IHU A;  2DJI A;  5LHH A;  4CZZ A;  2XPV A;  1B6A A;  4MO7 A;  1WFX A;  3BQY A;  3F3X A;  2XAH A;  5EEH A;  3CJD A;  4GCV A;  2EJR A;  4IRH A;  5D5W B;  1T56 A;  2KPM A;  5EDN A;  3HG9 A;  5GP9 A;  5JFR A;  2VBZ A;  1LUJ B;  4JX5 A;  2QBY A;  2OJE D;  5H20 A;  2F5E A;  2WY7 Q;  1SAU A;  2Q8K A;  1W1W E;  4E7J A;  1JJ6 C;  2F5V A;  2YR2 A;  3MZ8 A;  2RAS A;  1G3Y A;  3VP5 A;  2QVO A;  4GYI A;  1IO2 A;  4MQ9 F;  5J47 A;  4EGY A;  3CLQ A;  3GEZ A;  4M3D A;  3BR0 A;  1YI2 I;  2DMQ A;  1R22 A;  1MNE A;  1FSH A;  3K9T A;  2WAD A;  2ELH A;  4UUV A;  2XDN A;  1B9M A;  3DTI A;  4ZDO A;  2EV0 A;  4YIR X;  1DP3 A;  1TNS A;  4LG0 B;  4IXA A;  5EZG A;  5M3F J;  2V6C A;  3HTU A;  3S1R J;  4JBA A;  2AXL A;  4RMN A;  2R7D A;  3O2P E;  2ISY A;  2DG8 A;  2DMP A;  4IOA F;  4PJN A;  2VBY A;  4B8X A;  3HIM A;  1YHQ I;  2VT3 A;  4B44 A;  4A3I J;  5FD5 A;  2DA6 A;  3FXK A;  4DW6 A;  3HOV J;  4X6A J;  4P9F A;  1T2K A;  1SD6 A;  3S32 A;  1Q1V A;  4U88 A;  3HE0 A;  3SQN A;  3MAJ A;  2UV1 A;  2ZXH A;  3P7N A;  1P7J A;  1JI8 A;  5ICG A;  4R8H A;  5IOY A;  3EUP A;  5IT3 A;  4H4K C;  3GTG J;  3AL0 B;  4YFK F;  2OCE A;  3ZPL A;  3LSH A;  4BDZ A;  1XMX A;  2KFD A;  1H0M A;  5LRS A;  2M0M A;  2ECC A;  2R0Q C;  4BE2 A;  3TOB A;  2HEO A;  1D5Y A;  4HDU A;  3GUD A;  3K4J A;  3K4B A;  4EMS A;  3CME I;  3EQL F;  5LD2 C;  4DYQ A;  2K27 A;  2QSG X;  5JHF A;  2EFO A;  4I99 C;  4CO8 A;  4WXD A;  4YIF A;  1TQM A;  3RDI A;  3CZ6 A;  2BGC A;  2QGU A;  1U78 A;  1P7I A;  2Y75 A;  5CVV A;  1U5T B;  1X1A A;  3IP4 B;  1MMN A;  2NOG A;  5B3S H;  1U6G A;  1YO5 C;  1S6L A;  2E2I J;  2ZO4 A;  1SVM A;  2EIJ H;  3K8P C;  5FGL A;  3VSK A;  1P2F A;  5D6F A;  5J8C A;  4M9X A;  2NX4 A;  3G7R A;  1ZGJ A;  3FIS A;  3K1M A;  4EJT A;  3HGY A;  4I0B A;  2RN7 A;  2TRT A;  3H9J A;  5F04 A;  1FOW A;  2KZV A;  4Y17 A;  3ZN0 A;  3QQA A;  3GF2 A;  4A12 A;  1ZG1 A;  1Y8Q B;  1EH8 A;  2E2J J;  2Q2E B;  3RPU D;  2VJI A;  3WU0 A;  3OMY A;  1W5C C;  1ZRE A;  1FTZ A;  4G6D A;  4GO1 A;  3BY6 A;  1VI0 A;  3I9V 2;  3W2W A;  2B9S A;  4N9I A;  4BY7 J;  1F36 A;  4KN4 X;  2FOK A;  2XSJ C;  1MBJ A;  2HVQ A;  5A2Q K;  3HKZ A;  2IEK A;  2H94 A;  2ZBK A;  1U2W A;  4D7M A;  2LY1 A;  1HKQ A;  2DYS H;  3QAH A;  3O3K A;  4CSW A;  1W36 C;  2FQ3 A;  2VC0 A;  2V9K A;  2LRD A;  4K2E A;  3VFZ A;  2MSY A;  4A3C J;  3RPQ A;  3LSJ A;  3H3V K;  2L9N A;  1WJC A;  4ESJ A;  1LVA A;  1D1B A;  5CYV A;  3LAP A;  3ON2 A;  1SEU A;  5BS6 A;  1GV5 A;  2W48 A;  1JTY A;  4BAY A;  3LAJ A;  4E7H A;  2HYF A;  2DT7 B;  2D2W A;  4JX6 A;  1XN7 A;  3CMM A;  3GVA A;  5J1R A;  3LSP A;  2LKS A;  1L3L A;  4AD9 A;  2VUM J;  4CA0 A;  4HA8 A;  3WHB A;  4UNO A;  1Z0X A;  2G7G A;  3CP2 A;  3CC7 I;  5HLG A;  5L3G A;  4LGW A;  2ZCX A;  1YIO A;  2W4S A;  2PI0 A;  3DTE A;  5DV5 A;  1FIA A;  4U9N A;  2EH3 A;  2H8W A;  3ESW B;  3MEX A;  3K70 D;  4KIG A;  4U0W A;  2K3P A;  4XRM A;  2G7H A;  4LIV A;  3KKC A;  3HUG B;  3PIP F;  1ORK A;  1J59 A;  3QU6 A;  3VDX A;  5EG0 A;  3RJP A;  4MK6 A;  4LG3 A;  3TP0 A;  2K5C A;  2R3S A;  4BJ5 C;  3A4C A;  3H1C A;  4ENN A;  4BH9 A;  1KA8 A;  1DPU A;  1G2H A;  3FBN B;  2FA5 A;  4G7O F;  2M5W A;  2HOT A;  5E1W A;  3JSO A;  1LVK A;  1GHC A;  2EZH A;  4L9N A;  5E8I A;  2QZ8 A;  2DFE A;  3NAR A;  4CXF A;  4HF1 A;  1QQI A;  2X6O A;  2EZI A;  4ZTF A;  1XGO A;  4WF2 A;  4RM3 A;  3FIW A;  3S1N J;  2A68 F;  2Z99 A;  4FCY A;  4KFC A;  2DA3 A;  4OU0 A;  3ZN1 A;  2CW7 A;  3ABK H;  1GUU A;  4QWQ A;  1BI0 A;  4LFU A;  4WXC A;  5TJJ A;  2KMU A;  4G6T B;  1Z3X A;  4KT5 C;  2CSO A;  2XPU A;  3LSM A;  3VWB A;  1ZR4 A;  1IV8 A;  4E7L A;  3M8E A;  3NAU A;  3G2B A;  2KJC A;  2XVC A;  2I8D A;  5LHG A;  1IV6 A;  2EA2 A;  4XM3 A;  2CFX A;  2DOE A;  5B5E C;  1WJF A;  5FO5 A;  3AG3 H;  4J00 A;  2VXD A;  2K86 A;  2ESH A;  4L5I A;  1O7L A;  1IG7 A;  4G7H F;  2GXB A;  5E17 F;  4LJZ F;  5EFY A;  2VLA A;  2IGK A;  4JYK A;  4PCQ A;  3HUG A;  3M7G A;  2XKO A;  4XOP A;  1MH3 A;  3QYF A;  1WCM J;  1IN6 A;  2IVM A;  1HXD A;  2MLG A;  3LMM A;  1W7P B;  1T33 A;  3G4S I;  1KYW A;  1RPW A;  4RLQ A;  3VB2 A;  4CUG A;  1QHG A;  1JUM A;  2JN6 A;  4C2M A;  4R79 A;  1SC7 A;  2QEX I;  2HXO A;  4MHG A;  2LR8 A;  2IS4 A;  3FK7 A;  2HKU A;  5DYM A;  3S3M A;  4H0E A;  3IAS 2;  4M9Z A;  5M5X J;  4MEX F;  2EQR A;  3HL2 A;  1GLN A;  4DGW B;  2KRH A;  4RB0 A;  2D6Y A;  1WI9 A;  2QQ8 A;  3PNV A;  2KZG A;  4BY1 J;  1YLF A;  3RPU A;  1XB4 A;  2PZ9 A;  5KAF C;  4ETS A;  2PMU A;  2LF8 A;  3S3N A;  4UUS A;  1DQU A;  1QBJ A;  2M0C A;  4AID A;  1X1C A;  3M8J A;  1TZL A;  1UHM A;  2BZT A;  3MKW B;  2GOM A;  2GA2 A;  3SFI A;  1ONV A;  5GAH J;  5FB2 A;  3GFI A;  3EDP A;  3EUH C;  5FMP A;  3DPL C;  4M73 A;  1LFU P;  4L18 B;  4BQO A;  4HDV A;  1HOM A;  3GXO A;  1Z1D A;  4V19 K;  1LB2 A;  2R7T A;  2VB6 A;  4DNC A;  2K4J A;  4Y7N J;  3J80 Z;  3WE3 A;  1ZYR F;  4HX7 A;  1ZGA A;  2R5Y A;  3FMS A;  2VQG A;  2M2E A;  3SZT A;  2QTQ A;  2IA1 A;  4RBO A;  3MZH A;  4CIC A;  1SVO A;  1JKO C;  2D5V A;  3WU2 C;  3ROU A;  2GIZ A;  2XIG A;  3SEZ A;  4IQJ A;  2EIK H;  4C2T A;  4M6X A;  4A3F J;  1HDD C;  2ME6 A;  3HZJ A;  3NI7 A;  4I98 B;  3L1P A;  3OL3 A;  2EBI A;  3SZG A;  1P6R A;  4CCN A;  4LLL A;  1V5G A;  2R7S A;  2IGN A;  1XS9 A;  3A0B C;  2DMU A;  4CCK A;  5DAJ A;  3VW2 A;  4BXF A;  2D45 A;  1O57 A;  3H36 A;  2UXP A;  2QUF A;  4I6Z A;  2DMT A;  1XGM A;  3CUO A;  3KZ9 A;  2P7C B;  3ZMT A;  2CYY A;  1FP1 D;  4ZYG A;  1TWC J;  1MIJ A;  2DMN A;  1XMA A;  2E36 A;  2EIN H;  1YJN I;  3GME A;  3NWT A;  4I01 A;  2AXT C;  3I3L A;  1JGG A;  4F55 A;  3OYE A;  4IHX A;  2F5C A;  4ZYE A;  5L3D A;  2OBP A;  2L4A A;  3LFU A;  3AG4 H;  1FWZ A;  4EJV A;  4XLC A;  4KWA A;  3OR1 C;  1W5S A;  4L9J A;  3ML6 A;  4BEH B;  4BQQ A;  4EQQ A;  3DEW A;  3MFK A;  2R7U A;  1R00 A;  3H35 A;  1K4S A;  3HKZ N;  4XLH A;  4BQN A;  1ZR2 A;  5FRN A;  4BKX A;  2K9Q A;  5GTI C;  1I6H J;  5E18 F;  3LST A;  1F5T A;  1S7E A;  2DBB A;  2E1C A;  2JA6 J;  3F8N A;  2ZFU A;  1GXQ A;  3DKX A;  3DU6 A;  4M3B A;  2O03 A;  3DTK A;  5AIQ A;  3MVP A;  3VOK A;  4O6J A;  2FD5 A;  1YRN A;  1IN7 A;  3L00 A;  3LWJ A;  1EA3 A;  3HYI A;  1JKQ C;  1LDD A;  4D1Q A;  2LH9 A;  2L0K A;  3ZQH A;  2F2E A;  1S3J A;  1YE9 A;  2HQA A;  2LC2 A;  3C2H A;  4OIO F;  3M1E A;  3GTJ J;  4AF5 A;  4EJU A;  2DT6 A;  3GW2 A;  4HQE A;  1ZKG A;  4GRI A;  2LOO A;  2IA2 A;  4OOI A;  2IA0 A;  4KA4 A;  1HW5 A;  3CCM I;  5DEQ A;  2W00 A;  3HSR A;  2HVR A;  2BW3 A;  2MD5 A;  3TP3 A;  3AL0 C;  1XPX A;  3W6J B;  4PUS A;  2K3F A;  3UKG A;  2O0Y A;  3E7L A;  1X3Z B;  2VL8 A;  5FLM J;  2DOD A;  3IL2 A;  3NRV A;  4RA2 A;  3GFL A;  1NTC A;  2XDV A;  2MG4 A;  4I7H A;  3KZY A;  3R6S A;  3J81 K;  1UG2 A;  3BJB A;  3CUQ C;  4E6K G;  4BEH A;  5HS7 A;  1R5I D;  2REK A;  3CO7 C;  3PUF A;  3EET A;  1YG2 A;  4NC7 A;  4UVB A;  2MC3 A;  1U8B A;  3LA7 A;  4W97 A;  1I50 J;  3ZMD A;  1LEB A;  1U5T C;  1HA8 A;  4XRS G;  3KP4 A;  5H9T A;  4A5N A;  3H3U A;  4UUT A;  1J7K A;  2W85 A;  4XID A;  2WC2 A;  1VZ0 A;  3C3W A;  1F9N A;  4MFD A;  2V1N A;  4BE1 A;  1AHD P;  3S2D J;  3H9Q A;  5D5X B;  1LFB A;  3J80 K;  2VXZ A;  3F8F A;  2BHY A;  1JHH A;  3AAF A;  2OTL I;  2UXH A;  4X0G A;  2MW8 A;  2DQR A;  3EUK L;  1FJL A;  3OYI A;  4C2M J;  3MZY A;  4M3G A;  1REP C;  5ILV A;  3CD6 I;  2GLO A;  1FEX A;  4PJ0 C;  1X3W B;  3RKX A;  2VON A;  4PFP A;  3FMQ A;  4BNC A;  1B4A A;  2HNH A;  2GXA A;  2VKH A;  5FKL A;  2JSC A;  2XV4 S;  2XGD A;  4DZJ A;  2GEN A;  3ANP A;  1BJA A;  2F4M B;  2QSH X;  3IWF A;  4A3J J;  1MJB A;  2KJB A;  4B48 A;  3EGQ A;  3IWZ A;  3CDI A;  4LLN A;  3HJE A;  2GOX B;  1DU0 A;  3PAS A;  4XSZ F;  1IRF A;  4I0A A;  1UAA A;  3J7Y J;  2BOL A;  1D0Z A;  1OCO H;  3O6B B;  2A07 F;  3C07 A;  2XRL A;  2NS0 A;  4Y33 A;  1XSX A;  1F4K A;  5CQG A;  2DK8 A;  2FJ1 A;  2GM4 A;  4YRV A;  2RV8 A;  3LSK A;  1IN5 A;  1FLI A;  3UR3 C;  3DPT A;  3K4L A;  3HC7 A;  3HTA A;  4QPO A;  1AWC A;  3CES A;  1T8I A;  4JNN A;  5DUK A;  2BBY A;  5TGT A;  3S17 J;  4XIC A;  3DV8 A;  3IV5 A;  1DGW Y;  1A36 A;  5CQE A;  1Y0U A;  1X2M A;  1TWH J;  4KMU X;  1P9Q C;  4YII A;  2HS5 A;  3BQZ A;  4RB2 C;  4DZP A;  5JR3 A;  1XMK A;  2JTV A;  3R61 A;  1BL0 A;  2W57 A;  2P7V B;  2JUC A;  2WWY A;  3I54 A;  2H1K A;  3PNT A;  2KIM A;  2E71 A;  4EJO A;  2EPF A;  1KGS A;  3B73 A;  5KAI C;  2XGC A;  1VQL I;  3G71 I;  4ZYH A;  2NS7 A;  1FP2 A;  3KP6 A;  2CGP A;  4A3E J;  4F7Z A;  1WQ2 A;  1KZH A;  3LL7 A;  4E7S A;  2CW0 F;  2L01 A;  5GAE J;  3ZQF A;  5CW8 A;  3HRU A;  4OAZ A;  4E4H A;  1RUO A;  1RIO H;  1MDM A;  3KKD A;  4GYG A;  2NVT J;  2QBY B;  3HHG A;  3QOE A;  3JRG A;  1QNT A;  4AUX A;  1HCR A;  2JA7 J;  5IOZ A;  1JHF A;  1PUE E;  2W24 A;  2AHQ A;  3KCC A;  3W6K B;  5FLX Z;  2EFP A;  3TO9 A;  1W0U A;  4XSX F;  1ETY A;  3OS0 A;  2MH9 A;  3T8R A;  2OTJ I;  1Z21 A;  3E5Q A;  3UNG C;  1UI5 A;  4IVN A;  3K6G A;  3PIO F;  2HQR A;  2UXN A;  3CCL I;  3C1D A;  4YZE A;  2BVL A;  5EGO A;  2F6C A;  5GAG J;  4KUM A;  2G0E A;  2CU7 A;  1D0Y A;  3PPB A;  2EFW A;  2YX4 A;  3JRD A;  3MQ0 A;  2CV0 A;  2ZNZ A;  3L9F A;  3JRH A;  1K7A A;  2ZFW A;  3S3O A;  3DF8 A;  1K78 A;  4OD4 A;  2MA3 A;  2CV2 A;  3PFY A;  2ISZ A;  5FLV A;  1J9I A;  1ERD A;  3S8P A;  3F1B A;  2W82 A;  2PG4 A;  5C3E J;  4HQM A;  4XLN F;  2CMP A;  1V54 H;  2ZXW H;  3CMY A;  3BWG A;  2DPD A;  4XLP F;  3L2Q A;  3B6A A;  1ZAO A;  2WGB A;  1RKT A;  1FPQ A;  1TWA J;  3DCF A;  4PJL A;  5K58 A;  4XQF A;  4IKF A;  2UWM A;  3KYC B;  4HAM A;  4BS9 A;  1P92 A;  2HOS A;  2YPR A;  3KYL A;  2X0L A;  4HST A;  2KRF A;  3MCZ A;  3CTA A;  1G3W A;  3RQ4 A;  3QP6 A;  1WH5 A;  3DLL F;  2BY0 A;  5ILU A;  3NEU A;  5EEG A;  1TT5 B;  3N97 A;  1Y8R B;  1IDY A;  1KQ8 A;  1D8K A;  3HSF A;  2L9R A;  5K7H A;  3E7Q A;  1CGP A;  1ZK8 A;  3MMY B;  3GTL J;  1S9H A;  4NUB A;  3J7A O;  4BUP A;  5CVI A;  3GCM A;  3QPT A;  4IOC F;  3ABT A;  1V55 H;  4A3B J;  2CQK A;  3IH2 A;  3ZMS A;  5K7F A;  3HTJ A;  3RD3 A;  4IL6 C;  5DCM A;  2JT1 A;  2PFV A;  4KIB A;  2JMW A;  1OLT A;  1HBX G;  2E35 A;  3IKV A;  4A3L J;  1AU7 A;  3V8J A;  1W5T A;  2FU4 A;  1R1V A;  1R5G A;  2LSO A;  3AKZ A;  3KLN A;  4XKB A;  2ZNY A;  3MD2 A;  1FNN A;  3N4M A;  2MGQ A;  1J2X A;  2V1D A;  5F27 A;  3CCJ I;  1RR8 C;  3ZQC A;  3F6O A;  4ICH A;  2IU5 A;  4C9Y A;  5D8L B;  4EJW A;  1A6I A;  1WJA A;  1FBS A;  2ZJR F;  3FKJ A;  2KHM A;  3K4N A;  5HNH A;  3IUO A;  3TKY A;  1SFX A;  1XG1 A;  4HEA 2;  3HTS B;  3V7C A;  2FQ4 A;  2CJJ A;  2DJN A;  3OYD A;  2HOE A;  2WAQ N;  1JUS A;  3KYD B;  3Q0U A;  1S8N A;  1T6S A;  1GT0 C;  2DPU A;  3CJN A;  2ZME B;  4KNY A;  1YW9 A;  2NNN A;  1LJ9 A;  3S2W A;  2GFN A;  2ECB A;  2MC4 A;  1USS A;  5FD6 A;  4Q4Z F;  1ULY A;  4FET A;  1R9T J;  2QIB A;  3DXJ F;  2A5W A;  2KIS A;  4O5V A;  1FOX A;  2DFF A;  1B59 A;  2FUG 2;  1W4M A;  2DOF A;  4BAC A;  4HW0 A;  2L02 A;  2QYO A;  1VQ7 I;  1R1T A;  1IRZ A;  3I0T A;  5J8F A;  2OU2 A;  5CXG A;  2KL4 A;  2HOA A;  3JTG A;  4KDP A;  2A69 F;  3D5R C;  2VT2 A;  3CP8 A;  5L3E A;  1OFC X;  3CJQ B;  2B7E A;  2V9V A;  2E2H J;  1DUX C;  4WIB A;  4YFX F;  2F07 A;  3A1Y A;  4EVI A;  2E19 A;  2WB1 N;  3K1N A;  1WHU A;  5EG0 B;  4ZDP A;  1YX5 A;  2QKM B;  3RQI A;  2W1O A;  4KYW A;  3PL8 A;  2O3F A;  3H5N A;  1KU2 A;  1XCV A;  2IAI A;  3JRI A;  4ESB A;  3O60 A;  5DD8 A;  3D5L A;  1T0F C;  3HOZ J;  1Z6R A;  4AVZ A;  2Z16 A;  3P5J A;  1H8A C;  4XKC A;  1LEA A;  1R23 A;  2PMZ N;  3R0J A;  4AVP A;  4YFN F;  2XKP A;  1D1A A;  3DKY A;  2XSD C;  3LOC A;  1G3T A;  1H88 C;  5FRM A;  3GTP J;  5IT9 Z;  2O7O A;  5HLI A;  3G56 A;  2MFZ A;  1IXR C;  4HX4 A;  5H6R A;  3S15 J;  4FX0 A;  5HVQ C;  4EM1 A;  5D1R A;  3OV8 A;  2P4W A;  2RC4 A;  4BJT A;  2ZME A;  3BTC A;  2DTR A;  4B3A A;  5D8K B;  2HR3 A;  1LKX A;  4XLF A;  2HDW A;  3F23 A;  3QYB A;  4ZYA A;  2GA1 A;  4GXO A;  3TW6 A;  5AIP A;  2KRC A;  2BVM A;  4IHV A;  1SMT A;  1YS7 A;  4UDS A;  3OYC A;  1JT6 A;  4M3E A;  2W7N A;  2UXX A;  4BBS J;  2E7X A;  2DA7 A;  1NG7 A;  2UXO A;  2HYG D;  1ZG5 A;  4BJ6 C;  4DJA A;  3HPG A;  4MEY F;  4A3K J;  3SHF A;  3ZQQ A;  3WU1 B;  3HPH A;  2VN2 A;  3EYI A;  2HXI A;  4ON0 A;  5J1Y A;  5GTH C;  4BE0 A;  1YW7 A;  3KP3 A;  4LB5 A;  5HBU A;  1X4O A;  2V4J C;  4L5E A;  3RKQ A;  3TL4 X;  4ZZD A;  4L0Z B;  3BJA A;  2JRT A;  1QZZ A;  5LGN A;  2VQH A;  4N4O B;  5GPC A;  4NHJ A;  1Y1W J;  1B1B A;  4KJZ A;  1TWG J;  3G1M A;  1SAN A;  2AQF A;  2DW4 A;  3EYY A;  4JQF A;  5JVT A;  3A2K A;  1YIT I;  1UG0 A;  2ZOY A;  4A0Y A;  1R71 A;  4CH7 A;  2LY9 A;  5HAW A;  4AM3 A;  2BYV E;  1AA7 A;  3ZQ7 A;  3FK6 A;  1Y0N A;  4B1R A;  5IY5 H;  3H9G A;  4BXX J;  4M9S A;  3E0J B;  1TQP A;  5EJC A;  3JSP A;  2K9L A;  2ZB9 A;  4GDF A;  4EM2 A;  2YVH A;  2WV1 A;  3C2G A;  2IRF G;  5BOX A;  3BZK A;  4XN0 A;  1ZN2 A;  2H8R A;  2IJL A;  3SWH A;  2LY2 A;  2V79 A;  4RAF A;  1J0R A;  2PJR B;  2BY1 A;  5L3F A;  2VI6 A;  4S05 A;  2ICW G;  4UUS B;  1X3U A;  2COB A;  3TBI A;  1LNW A;  2E5Z A;  2PN6 A;  3LFK A;  4V2G A;  3CWR A;  1I3Q J;  5D6E A;  1FYL A;  3QPL A;  2X51 A;  5LRR A;  3REO A;  4A2U A;  5BPI A;  4Y3O A;  3TOA A;  3WGH A;  4ENJ A;  2JK3 A;  3MKY B;  3G6E I;  1FOY A;  3K2Z A;  3VPR A;  1VQO I;  4D0P A;  1MW7 A;  2VBX A;  2R5Y B;  3I56 I;  2TCT A;  1J5Y A;  1IN4 A;  3OYB A;  4L62 A;  2WA0 A;  3K4K A;  1ZRD A;  1TW2 A;  1N25 A;  2H1L A;  3FM3 A;  5BPD A;  4UV8 A;  2LFB A;  1HW1 A;  3ECH A;  3HTI A;  1MMG A;  1D0X A;  5GPA A;  1YX3 A;  1BIB A;  3LWF A;  3BG7 A;  3S1Q J;  2MAB A;  1IAW A;  2W53 A;  2Q1Z B;  1SGM A;  4BYY A;  4C3H J;  1BA5 A;  1D3Y A;  3RKW A;  3IKT A;  4I09 A;  1MBH A;  2M45 A;  5C4Y A;  2X6X A;  1BOB A;  2NRA C;  1ODD A;  3WG9 A;  4CCO A;  4AIJ A;  2CQQ A;  3OYJ A;  3D1N I;  1SAX A;  1F1Z A;  4B43 A;  2ETH A;  3BRO A;  1EJ9 A;  3X2Q H;  2YVX A;  1D8J A;  1RET A;  2PJR A;  1DP7 P;  3ZR8 X;  1XSD A;  4J01 A;  5B1B H;  2LTP A;  4GFK A;  3KZI C;  3COL A;  5D4S A;  1YJW I;  2XAU A;  3KIO A;  1MMS A;  3QU3 A;  3CF5 F;  3GTQ J;  4BHC A;  4GCT A;  2LRE A;  1FMV A;  3H5R A;  2RDP A;  2OUM A;  3OYK A;  4PJM A;  3IH3 A;  1BN5 A;  3Q9S A;  2L3D A;  4B4C A;  4PZJ A;  2LF7 A;  2OQR A;  3M1C A;  5KVR A;  1HQC A;  4OMZ A;  5IP9 J;  3JRB A;  2GAU A;  1OCR H;  1K61 A;  2ADU A;  4PSX A;  1GVD A;  1SFU A;  2KLO A;  3WTU C;  4NB5 A;  4BQA A;  4P5O A;  1Z77 A;  2M1B A;  5CKT A;  2FNA A;  1WJB A;  2YUS A;  3V4G A;  2GIV A;  3A01 B;  2H09 A;  1V5E A;  1U0J A;  1MH4 A;  2PX9 A;  2X6W A;  3COA C;  4XOT A;  3K69 A;  1PP8 F;  2HGC A;  3G1L A;  4L5J A;  4EAT A;  4IHW A;  1JGS A;  1OMI A;  2P0W A;  4I02 A;  2PLY A;  2A6H F;  2V9P A;  3KET A;  3NPI A;  4NC6 A;  2AQE A;  2HQ5 A;  5LGU A;  3OYA A;  4MGR A;  5IPA A;  4IZZ A;  3CO6 C;  1VQN I;  3KEQ A;  1BC8 C;  2LBF A;  3R4K A;  5JLW A;  1YRN B;  3JRC A;  2MD0 A;  4CGR A;  1R4M B;  2RQP A;  1DPR A;  1FIP A;  2CUZ A;  3G1O A;  3R0A A;  4CYC A;  3AG1 H;  4ZC3 A;  2GZW A;  3SDG A;  2E34 A;  4P9U A;  4IRG A;  3ASO H;  3FF5 A;  3FXL A;  2E7W A;  4ZDL A;  3TDZ C;  2BY2 A;  2G7S A;  3U1K A;  4C2U A;  1XDU A;  2BW3 B;  2FSW A;  2N8G A;  2Z33 A;  5J6X A;  1JUP A;  5HLT A;  3OYH A;  2J5P A;  2A05 A;  1W36 D;  4LMY A;  2JSP A;  3BP8 A;  4ACI A;  2ID6 A;  4BXU A;  1OR7 A;  3E5X A;  3F22 A; 
#chains in the Genus database with same CATH homology
 1DU0 A;  2DMQ A;  3PAS A;  4AC6 A;  3NRG A;  2GBY A;  2UXU A;  2XDN A;  2ZCN A;  3C07 A;  3TW7 A;  1OCT C;  2XRL A;  1VF9 A;  2CUE A;  5EZG A;  5M3F J;  2QWT A;  2FJ1 A;  3S1R J;  2GM4 A;  2DG8 A;  2DMP A;  3A01 A;  3JRF A;  3HTA A;  2M8G X;  3QKX A;  3HIM A;  4DYR A;  2XGE A;  1WGX A;  4A3I J;  3Q0V A;  2DA6 A;  4DW6 A;  4JNN A;  3HOV J;  4X6A J;  4MIM A;  3LSG A;  3V6G A;  2P81 A;  3S17 J;  1Q1V A;  4XIC A;  2ME0 A;  2R5Z B;  3HE0 A;  4JKZ A;  3IV5 A;  1X2M A;  1TWH J;  1P7J A;  3MKL A;  5IOY A;  3BQZ A;  3EUP A;  4X1E A;  5HSZ A;  1MBG A;  1MBE A;  3GTG J;  4DZP A;  1OJL A;  5F0F A;  1BL0 A;  3HOU J;  3GTK J;  4GCL A;  1ETQ A;  1ZGW A;  1POG A;  2H1K A;  2ECC A;  2R0Q C;  1PUF A;  5FKK A;  3HDD A;  5EYR A;  2XGC A;  1D5Y A;  2G3B A;  3RZO J;  2JWT A;  2NS7 A;  1GDT A;  4A3M J;  4A3E J;  4Y52 J;  3BTI A;  1UMQ A;  4DYQ A;  5M5Y J;  3OSF A;  3S14 J;  3S2H J;  3ZQF A;  4XK4 A;  3BRU A;  5CW8 A;  1U78 A;  3KKD A;  1P7I A;  5K7Z A;  4CYC B;  2AO9 A;  2NVT J;  2NP3 A;  4C3J J;  2G7L A;  2NOG A;  2JA8 J;  1CQT A;  3JRG A;  4AUX A;  2E2I J;  1HCR A;  2JA7 J;  5IOZ A;  3M3Y J;  5FGL A;  2AHQ A;  3RH2 A;  2DN0 A;  2NX4 A;  3G7R A;  3B81 A;  3FIS A;  1W0U A;  1ETY A;  3HGY A;  2Y9Z A;  2TRT A;  2HI3 A;  5F04 A;  3A02 A;  4MLO A;  4LOC A;  1UI5 A;  3FRQ A;  3QQA A;  5J3L A;  3W6V A;  1JKP C;  4W1U A;  2E2J J;  4YZE A;  3LNQ A;  3MNL A;  5EGO A;  3HB9 A;  2R5Z A;  1FTZ A;  4PXI A;  2G0E A;  2CU7 A;  3LJL A;  3PPB A;  1VI0 A;  3JRD A;  4BY7 J;  1MSE C;  1F36 A;  1JJ8 C;  3JRH A;  1MBJ A;  3LSR A;  2IEK A;  3P9T A;  3NXC A;  4D7M A;  2WUI A;  2OER A;  5FLV A;  3BHQ A;  3F1B A;  4NN1 A;  1QPI A;  2JJ7 A;  3PO2 J;  2MSY A;  5C3E J;  4A3C J;  2L7Z A;  3LSJ A;  5F0H A;  3H3V K;  3CMY A;  1HLV A;  3GTO J;  1B8I B;  3BR3 A;  4IHY A;  3ON2 A;  3B6A A;  2XPW A;  1GV5 A;  2WGB A;  2W48 A;  1JTY A;  1RKT A;  4FE4 A;  1TWA J;  3DCF A;  5K58 A;  1WH7 A;  4JX6 A;  4QSH A;  2HOS A;  5J1R A;  3VVZ A;  3LSP A;  5FKM A;  3A03 A;  4FTH A;  3CQZ J;  2VUM J;  3WHB A;  1Z0X A;  2G7G A;  1WH5 A;  3VVX A;  2ZCX A;  1O4X A;  4HKU A;  1FIA A;  2EH3 A;  1IDY A;  2LP0 A;  3HBL A;  2L9R A;  5K7H A;  4XRM A;  3E7Q A;  3KKC A;  5IYC J;  1ORK A;  5EG0 A;  2DA5 A;  1ZK8 A;  3GTL J;  3JRE A;  4D5C A;  4MK6 A;  3TP0 A;  3BR5 A;  2XB5 A;  2ID3 A;  4MXM A;  4C3I J;  4A3B J;  3PO3 J;  1Y1V J;  3IH2 A;  3HTJ A;  5K7F A;  1G2H A;  3RD3 A;  3VVY A;  2JMW A;  5BNG A;  3LHQ A;  1IC8 A;  3DPJ A;  1U9N A;  3JR9 A;  1K83 J;  4MFE A;  1AKH B;  2LVS A;  2HOT A;  4A3L J;  1AU7 A;  4JL3 A;  3VW0 A;  5F1J A;  2EZH A;  1TWF J;  2VKV A;  3NAR A;  2X6O A;  2EZI A;  2KT0 A;  2MGQ A;  9ANT A;  4JP0 A;  3BG9 A;  5F27 A;  3FIW A;  2V57 A;  5FKO A;  3ZQC A;  3S1N J;  4ICH A;  4FCY A;  2IU5 A;  5EGO B;  2DA3 A;  2FX0 A;  1A6I A;  3ZQL A;  1E3O C;  5F0C A;  5IP7 J;  1GUU A;  1B8I A;  2L7F P;  5EEA A;  2XPU A;  1JTX A;  2CUF A;  1ETK A;  1ZR4 A;  2Y31 A;  1XG1 A;  2OPT A;  4RDU A;  4NEL A;  3QBM A;  2FQ4 A;  3VOX A;  3NAU A;  2CJJ A;  2DJN A;  3O8H A;  4M6V A;  1IV6 A;  3OSG A;  2WAQ N;  1JUS A;  4M3F A;  3M4O J;  3Q0U A;  3OIO A;  1GT0 C;  3S1M J;  2YVE A;  5EZH A;  1OCP A;  1RR7 A;  5E3L A;  1IG7 A;  2GFN A;  3HOY J;  2ECB A;  5E3N A;  2O7T A;  3IUV A;  5EFY A;  4JYK A;  1R9T J;  2YU9 J;  2QIB A;  1ZQ3 P;  2EZL A;  2QOP A;  1MH3 A;  1WCM J;  2KDZ A;  5M3M J;  1T33 A;  3I4N J;  1RPW A;  1IRZ A;  1XC5 A;  4XRS A;  1ENH A;  3C2B A;  5CXG A;  2HOA A;  2NVQ J;  3JSJ A;  1JUM A;  2JN6 A;  1IDZ A;  1OFC X;  4I76 A;  4HNV A;  2QCO A;  2E2H J;  4GFB A;  3AQS A;  2HXO A;  2YS9 A;  2LR8 A;  2VKE A;  3FK7 A;  3Q3S A;  2F07 A;  2HKU A;  5D19 A;  3BR6 A;  1AKH A;  3BT9 A;  2E19 A;  2WB1 N;  5EG0 B;  1ZTR A;  3OOU A;  3BR2 A;  3RQI A;  4AYB N;  5M5X J;  3IH4 A;  4G12 A;  2EQR A;  2IAI A;  1NK2 P;  2OF7 A;  3JRI A;  2D6Y A;  3O60 A;  2M9H A;  1WPK A;  3HEF A;  3HOZ J;  1UI6 A;  5J1U A;  3S16 J;  1ETO A;  4BY1 J;  4J19 A;  1H8A C;  2PMZ N;  2PZ9 A;  1EF4 A;  4IEJ A;  2XSD C;  3O8G A;  3LOC A;  4JX4 A;  4BBR J;  1H88 C;  4UUS A;  3GTP J;  2M0C A;  2O7O A;  5FJ8 J;  2NVY J;  4V2F A;  1QVT A;  3G56 A;  2EZK A;  1X58 A;  3SFI A;  2DTZ A;  5FMP A;  1VND A;  3S15 J;  2DA1 A;  2K9S A;  1LFU P;  2QKO A;  5D1R A;  3SJM A;  4GCK A;  2RAE A;  1HOM A;  5CXI A;  2ZOZ A;  3BTC A;  4B3A A;  1DU6 A;  2X9D A;  4Y7N J;  1IGN A;  2Y30 A;  3TW6 A;  1ETX A;  2R5Y A;  1SFO J;  4IHV A;  2R92 J;  3S5R A;  2K40 A;  4UDS A;  2M2E A;  3FKI J;  5HOD A;  5FHP A;  1ETV A;  2E1O A;  1JT6 A;  2XB0 X;  4M3E A;  1A5J A;  2QTQ A;  4RBO A;  4DYC A;  3HOW J;  4BBS J;  2DA7 A;  2UXO A;  1JKO C;  5DS9 A;  4ABZ A;  2D5V A;  2NVX J;  1ITY A;  4A3K J;  3JRA A;  5IYB J;  4D5F A;  2HXI A;  3BG3 A;  4D7N A;  5J1Y A;  1BW5 A;  5M5W J;  4AC0 A;  2CRG A;  1MBK A;  5HBU A;  4L5E A;  4A3F J;  1HDD C;  2ME6 A;  3RKQ A;  3MN2 A;  3VW1 A;  1MBF A;  3NI7 A;  3L1P A;  3ZOB A;  2EBI A;  5GPC A;  2O8K A;  2I10 A;  1Y1W J;  1TWG J;  3G1M A;  1SAN A;  2OI8 A;  2LLK A;  3BCG A;  1XS9 A;  1MNM C;  2ZOY A;  1MSF C;  2DMU A;  5DAJ A;  3VW2 A;  2HYJ A;  2LY9 A;  5HAW A;  3FK6 A;  4B1R A;  3GZI A;  2PBX A;  4BXX J;  2UXP A;  4I6Z A;  2HDD A;  2DMT A;  3KZ9 A;  3ON4 A;  2R93 J;  1UHS A;  3T6N A;  1TWC J;  2DMN A;  2ZB9 A;  1APL C;  5AQC A;  3BNI A;  2O9L A;  2JA5 J;  2YVH A;  2WV1 A;  5E3M A;  2K9N A;  2H8R A;  1HDP A;  4QTR A;  1JGG A;  2NP5 A;  1B72 B;  4IHX A;  1BJZ A;  1TC3 C;  2RHA A;  2VI6 A;  1X2N A;  1QRY A;  4UUS B;  4KWA A;  2COB A;  1NK3 P;  3K7A J;  3VUQ A;  4V2G A;  3CWR A;  3K2A A;  1I3Q J;  3DEW A;  1LE8 B;  3HKZ N;  5EF6 A;  1ZR2 A;  4FIS A;  4BKX A;  2K9Q A;  3KNW A;  3QPL A;  1I6H J;  1QVU A;  1VFC A;  1S7E A;  2LKX A;  2JK3 A;  3VPR A;  2JA6 J;  3VIB A;  4M3B A;  2R5Y B;  2NS8 A;  2TCT A;  3RZD J;  3MVP A;  4L62 A;  3PM1 A;  3VOK A;  4GFL A;  5E3O A;  3GEU A;  2DG7 A;  2FD5 A;  1YRN A;  2ZCM A;  3HM5 A;  3LWJ A;  2B63 J;  1JKQ C;  2LFB A;  4NDL A;  3HTI A;  1W0T A;  2L0K A;  5GPA A;  3ZQH A;  3HOX J;  1IJW C;  2ELK A;  2Y2Z A;  3S1Q J;  3GTJ J;  3TED A;  4AF5 A;  3QPS A;  1ZKG A;  1JKR C;  2W53 A;  1SGM A;  3F0C A;  3HGG A;  2Q24 A;  4C3H J;  5C44 J;  1BA5 A;  1MBH A;  3I4M J;  3TP3 A;  5IYD J;  3BG5 A;  3UKG A;  5C4Y A;  3E7L A;  3CDL A;  3ANG A;  5FLM J;  2LK2 A;  2CQQ A;  3D1N I;  2M34 A;  1IUF A;  5IP6 A;  3BTL A;  1RET A;  1B72 A;  3CCY A;  4S0H B;  1NTC A;  1ETW A;  2DA2 A;  4A69 C;  3WHC A;  2LTP A;  2R7Z J;  4GFK A;  2MG4 A;  5JLX A;  2Y9Y A;  3BR1 A;  2DA4 A;  3COL A;  2HYT A;  2LD5 A;  3BJB A;  1UG2 A;  3ZQG A;  3GTQ J;  4GCT A;  1LE8 A;  1RKW A;  2REK A;  3GTM J;  4A93 J;  2L7M P;  1WI3 A;  3IH3 A;  1U8B A;  2CQX A;  4B4C A;  2GUH A;  4W97 A;  3ZQI A;  1I50 J;  4ME9 A;  4EEF G;  1GV2 A;  4XRS G;  3B6C A;  5IP9 J;  3JRB A;  1K61 A;  2UXI A;  5H9T A;  1GVD A;  4XID A;  4UUT A;  3NNR A;  1HF0 A;  3V78 A;  1Z77 A;  1JT0 A;  5C4J J;  2YUS A;  4MFD A;  3A01 B;  3GBG A;  1MH4 A;  4QIW N;  1H89 C;  1AHD P;  2QF7 A;  3S2D J;  4A3D J;  5F08 A;  3CRJ A;  2VPR A;  3G1L A;  5FKN A;  1LFB A;  4IHW A;  5DTD A;  3HTH A;  1U9O A;  1F43 A;  5C4X J;  4A3G J;  2UXH A;  3NPI A;  2MW8 A;  1FJL A;  4C2M J;  2HQ5 A;  4M3G A;  5IPA A;  1FTT A;  3AQT A;  4FE7 A;  2XPV A;  2GLO A;  2X48 A;  1FEX A;  5JLW A;  4MO7 A;  1YRN B;  3BTJ A;  3JRC A;  4CGR A;  3BQY A;  3CJD A;  5FKL A;  1FIP A;  2IBD A;  3G1O A;  2XGD A;  1T56 A;  3H0G J;  4DZJ A;  5EDN A;  2GEN A;  1PUF B;  5GP9 A;  3ANP A;  4CYC A;  4JX5 A;  3SDG A;  4A3J J;  1JJ6 C;  5D18 A;  3EGQ A;  2G7S A;  3VP5 A;  2RAS A;  3Q0W A;  2N8G A;  2Y0S N;  2FBQ A;  1JUP A;  1RES A;  1BW6 A;  4ACI A;  2ID6 A;  4M3D A;  3BR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...