3Q0VA

Ethr from mycobacterium tuberculosis in complex with compound bdm31369
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
193
structure length
188
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords HTH-type transcriptional regulator EthR
publication title Design, synthesis and optimization of new EthR inhibitors. A new alternative approach to fight tuberculosis by boosting ethionamide
rcsb
source organism Mycobacterium tuberculosis
total genus 82
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3q0vA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3q0vA02
1HDDC 1H89C 1ORKA 3HOUJ 4HNVA 3CQZJ 3I4NJ 4L62A 2DN0A 2HOSA 1F43A 1K61A 4D7NA 1MBFA 3LHQA 2IBDA 2LLKA 1ZGWA 1BL0A 1RPWA 3S17J 1BW5A 3QBMA 1JTYA 5CW8A 2PMZN 4M6VA 3PO3J 2Y31A 3NAUA 1MH3A 3DEWA 4XRMA 3LSGA 5FJ8J 2XGDA 1Z0XA 3FRQA 1GV2A 3S14J 5F0FA 4CYCA 3G56A 3QPSA 4JP0A 2O7OA 2COBA 1HOMA 9ANTA 1FTTA 1IC8A 1GDTA 1SFOJ 2EZLA 1TWAJ 3TW7A 5IOYA 1ZK8A 2DJNA 4MO7A 1TWGJ 4D5CA 4W97A 4A3CJ 1ETWA 3ZQFA 1VF9A 3QQAA 1A6IA 2DG8A 4UUTA 3O8GA 3BTLA 4QTRA 3JRBA 3HB9A 2O8KA 2ID6A 3HEFA 5F0HA 1GT0C 1P7JA 1H88C 5F0CA 1U9NA 1BW6A 2WGBA 2M2EA 1NTCA 3NNRA 4Y52J 5C3EJ 2LVSA 2QOPA 3AQSA 5CXGA 2L7FP 2K9NA 3GBGA 5K7HA 4AUXA 2XGCA 1MNMC 4X6AJ 1ETVA 1JJ6C 3M4OJ 1JJ8C 3JRHA 1WPKA 2LY9A 1UHSA 2DMNA 4JL3A 4NELA 4AYBN 3D1NI 2CQXA 2VI6A 2R5YB 2W53A 1UI5A 5F04A 5H9TA 2CU7A 2Y30A 4BBSJ 4AC0A 4A3FJ 3WHCA 3MN2A 5AQCA 2XB5A 2NS8A 1F36A 2G3BA 4UDSA 2YU9J 1NK2P 2AHQA 4PXIA 5M5YJ 5C4XJ 4XICA 3VVZA 1O4XA 3E7LA 3PM1A 5JLXA 1R9TJ 4XIDA 1LFBA 4S0HB 4UUSB 3HOYJ 3TP3A 3UKGA 2JMWA 4ME9A 5E3NA 1TWFJ 4QSHA 2Q24A 3VW0A 2O7TA 3VIBA 2KDZA 4JX6A 5IOZA 3LSPA 3O60A 4NN1A 2V57A 3HTAA 3C07A 3NXCA 3CWRA 1SGMA 3Q3SA 4GCTA 4V2FA 2WB1N 2ZB9A 1T56A 5C4YA 5FKKA 3ANGA 4YZEA 3B6CA 3A01A 3NI7A 4FISA 5M3MJ 3ZQHA 1UG2A 2FX0A 3BTCA 4A3EJ 1WH7A 2OPTA 5D18A 1TWCJ 3AQTA 1MBEA 1D5YA 5FGLA 5DTDA 5IP6A 2LR8A 4A3BJ 2R5ZB 3HTJA 2LP0A 2DMUA 1MSFC 1SANA 2GBYA 4BKXA 1QVTA 4I6ZA 1BJZA 1AKHB 2IU5A 4MIMA 1K83J 4C3IJ 1MH4A 1VI0A 3FIWA 4BY7J 5HODA 3JRGA 2DA2A 4LOCA 3Q0VA 3FKIJ 2UXOA 2EH3A 2NVTJ 5EG0B 1IJWC 2X9DA 3JRIA 1VFCA 1IDYA 4FE4A 1B72A 3HDDA 1U8BA 4XK4A 2LD5A 1BA5A 3MKLA 3BT9A 2UXUA 4G12A 3BQZA 5HBUA 4JX5A 3ZOBA 5CXIA 2WV1A 1XC5A 1UMQA 1HDPA 2AO9A 3PO2J 3GEUA 3HTIA 1Y1WJ 2QIBA 2Y2ZA 3VVXA 2VKVA 1IRZA 1HF0A 2UXPA 5K7FA 1ZR2A 2Y9YA 5F1JA 1QRYA 3C2BA 2GFNA 1YRNB 2HXIA 1PUFA 1B8IB 1OCTC 2HI3A 2Y9ZA 2HOTA 1W0TA 2O9LA 3COLA 5K58A 4ABZA 4C3JJ 4M3GA 2GM4A 4JNNA 4GFBA 1I50J 3RZOJ 4J19A 5F08A 1POGA 2JJ7A 2QKOA 3GTQJ 3NPIA 2VPRA 4GFLA 3GTJJ 1FIAA 2DG7A 2YVHA 1Q1VA 1VNDA 2GENA 2ECCA 1JKQC 2HOAA 3CRJA 2DMTA 2R7ZJ 5FLMJ 1P7IA 5J3LA 1JKPC 2E2HJ 2HYTA 2R92J 2XPVA 1GV5A 1I6HJ 3LJLA 2ZCNA 3BR2A 2CQQA 2CRGA 1MBJA 4ACIA 4IHYA 3JRCA 1AHDP 5D19A 2Y0SN 5HSZA 2CUEA 3HKZN 2P81A 4BXXJ 2G0EA 1S7EA 5IPAA 1ETXA 1JGGA 1ENHA 2DA6A 2DA5A 1IGNA 3S2DJ 4MXMA 2NP5A 3F0CA 3S1QJ 2WUIA 4DZPA 1ZQ3P 4A3LJ 2HYJA 3WHBA 5GP9A 4CYCB 3BR5A 3GTLJ 2PBXA 2RHAA 1LFUP 2M0CA 5DS9A 3T6NA 4CGRA 2HKUA 2K40A 5F27A 4GCLA 1WGXA 1G2HA 2QWTA 4GFKA 2YUSA 3P9TA 5EYRA 1I3QJ 3GTKJ 1X2NA 1ITYA 1DU0A 1WCMJ 1LE8A 3G1OA 2WAQN 3CDLA 1ZR4A 4JX4A 3BCGA 2W48A 5FKMA 1A5JA 1JUPA 1EF4A 3EGQA 3OIOA 4AF5A 1ZKGA 3BR1A 2IEKA 2FJ1A 2LFBA 5M3FJ 1ETQA 3K7AJ 2NP3A 1IDZA 2B63J 4BBRJ 2JA5J 5E3OA 2ZOYA 5IYBJ 3LOCA 1DU6A 1FJLA 5BNGA 3OOUA 1Z77A 3G7RA 1U78A 2JWTA 2G7SA 1XG1A 5IP9J 3ON4A 4FE7A 4NDLA 3HOWJ 4D7MA 1X58A 4MFEA 3HOZJ 4IEJA 3JR9A 3TEDA 4IHVA 2K9QA 3ON2A 4RBOA 2HXOA 3RZDJ 3S1MJ 3SDGA 3LWJA 2D6YA 3HGGA 2ME6A 2ME0A 4MLOA 1H8AC 1ZTRA 2QF7A 1RETA 5IYDJ 4I76A 3IUVA 4A93J 3G1MA 2JA6J 3HBLA 1W0UA 5EZGA 1APLC 5GPAA 3I4MJ 3RQIA 3TW6A 2KT0A 3BNIA 3DCFA 3ZQIA 2GUHA 3V78A 1RKWA 2NVYJ 2D5VA 3VVYA 3O8HA 3BTJA 2IAIA 2E1OA 3QPLA 3FK7A 3HE0A 3KKDA 2R93J 2N8GA 3BTIA 4C2MJ 4IHXA 4M3FA 2G7GA 1GUUA 3IH3A 3IH4A 4A3MJ 5D1RA 1OFCX 2EZKA 2JA8J 2DMQA 3BG9A 5EGOB 2NVQJ 2VUMJ 3BR0A 2ZCXA 1TC3C 5J1UA 5M5XJ 1MSEC 2DTZA 2LK2A 3VPRA 1WI3A 2RASA 3HOVJ 2YVEA 1IG7A 5EFYA 1XS9A 2OERA 2DA4A 3VW1A 3M3YJ 1JTXA 2EQRA 2XDNA 2K9SA 2MG4A 3KNWA 2H8RA 1JKOC 3RH2A 2L0KA 5FMPA 3BG3A 3OSGA 1TWHJ 4GCKA 3G1LA 1E3OC 1MBKA 4A69C 3LSJA 4JKZA 1HLVA 2FBQA 3LNQA 2GLOA 2JK3A 2ECBA 3IV5A 5HAWA 4B1RA 5EDNA 4A3GJ 4FCYA 2UXHA 2TRTA 1QVUA 3BJBA 3VOXA 3IH2A 4KWAA 2VKEA 2EZHA 3F1BA 3BQYA 3FISA 4M3EA 3HIMA 4D5FA 1IUFA 1ETYA 1OCPA 1CQTA 5E3LA 2UXIA 2LKXA 1ETKA 4QIWN 3LSRA 2JA7J 3PASA 5K7ZA 5C4JJ 2R5YA 4XRSG 4DW6A 1NK3P 3GTGJ 5FKNA 2ID3A 1QPIA 2PZ9A 3Q0UA 4Y7NJ 3FK6A 4M3DA 4DZJA 1B72B 5FLVA 3S1NJ 2DA7A 4IHWA 1UI6A 3PPBA 5FHPA 3E7QA 3HOXJ 5JLWA 2DA1A 3ZQCA 1FEXA 2G7LA 3HM5A 3S15J 2FQ4A 1RESA 3B6AA 4UUSA 4RDUA 4AC6A 3L1PA 2R0QC 3GTPJ 2ELKA 1PUFB 1OJLA 2DA3A 2NVXJ 2MSYA 2RAEA 3H0GJ 4M3BA 2X48A 3QKXA 3GTMJ 1FTZA 3S1RJ 3KKCA 3V6GA 5EF6A 5IYCJ 5E3MA 3JRAA 3BRUA 2MW8A 5FKLA 1AU7A 1JUMA 1Y1VJ 2XPWA 4L5EA 3H3VK 2XRLA 5EZHA 3JRFA 4A3IJ 3S5RA 2XGEA 4XRSA 1JT0A 4ICHA 3BR6A 3EUPA 3KZ9A 2REKA 1GVDA 2L7MP 2EBIA 2NS7A 4W1UA 2DMPA 1MBHA 2E2JJ 4DYCA 4JYKA 1JT6A 5M5WJ 3JREA 2JN6A 2R5ZA 1RKTA 2CUFA 4DYQA 2TCTA 2L7ZA 1AKHA 1FIPA 4HKUA 3MNLA 3W6VA 3JRDA 3RKQA 5J1RA 3VOKA 4V2GA 3CMYA 2HDDA 3CJDA 3GZIA 3MVPA 3VP5A 4X1EA 2XB0X 1WH5A 3NARA 5EG0A 3A02A 5EGOA 2OI8A 3OSFA 2NOGA 5EEAA 2HQ5A 5DAJA 4MFDA 1IV6A 2EZIA 4BY1J 3JSJA 3NRGA 5IP7J 2M9HA 3ZQLA 3GTOJ 2M8GX 3S2HJ 5GPCA 4DYRA 1JUSA 3ZQGA 3K2AA 1X2MA 1LE8B 3B81A 1HCRA 3HTHA 3ANPA 3VUQA 1ETOA 1U9OA 2E2IJ 2ZOZA 1MBGA 3BG5A 2YS9A 1YRNA 2ZCMA 1B8IA 1RR7A 3RD3A 2E19A 3SFIA 3SJMA 2QCOA 2XPUA 4FTHA 4C3HJ 2LTPA 4B3AA 3DPJA 2H1KA 4A3DJ 1JKRC 4B4CA 2QTQA 4MK6A 2X6OA 3A03A 2XSDC 3HGYA 5C44J 2F07A 4A3JJ 2CJJA 2I10A 2OF7A 2M34A 3CCYA 3BHQA 5FKOA 4EEFG 2MGQA 2L9RA 1T33A 3VW2A 3BR3A 4A3KJ 3Q0WA 5J1YA 2NX4A 3TP0A 3A01B 3S16J 2FD5A
chains in the Genus database with same CATH superfamily
3CQZJ 1Y8QB 4D7NA 3CC2I 1MBFA 3W6KB 3LHQA 2WAFA 3T8TA 5JI6A 4PJLA 2GIVA 3C2HA 4MTEA 2ETHA 2ICWG 2HU9A 1BW5A 3QBMA 2P6SA 1XGOA 2LREA 3CC4I 2OZ6A 5DD8A 3I71A 3EDPA 2HPMA 2E60A 1TW3A 4RAYA 2V9PA 3DEWA 2X1DA 2ZFUA 3K2ZA 3S14J 2UXXA 3G56A 3QPSA 5H6RA 2W00A 4G6TB 4CCNA 1VQMI 2O7OA 2COBA 9ANTA 4XOPA 4ZJZA 1ZARA 4CZCA 3COAC 2XKPA 1J2XA 1TW2A 2RQQA 2EZLA 3T1BA 3LFUA 4CSWA 4E4HA 4HX8A 3IKTA 1N77A 3T8RA 3KCCA 4KIBA 2K7LA 1FOKA 1HW1A 2WADA 3ZQFA 1O7FA 1R22A 3WTWC 2LC2A 3H35A 1YTYA 4NNJA 3VYUB 2F2EA 1T98A 2KDOA 1T8IA 5DM6F 3JRBA 3H3ZA 1IUYA 4DJAA 2CV0A 1B9NA 4RGSA 2V79A 2O8KA 2V1DA 2YSRA 5F0HA 1R4MB 3RI4A 5F0CA 4GRIA 2BHYA 3F9KA 5D8LB 1BW6A 2QKLB 2M2EA 2WGBA 1Y0NA 3HYIA 5CXGA 3WU1B 2QOPA 2A5YB 5ILVA 2A05A 3GFLA 4A2UA 4XKBA 2XGCA 3PQJA 3KE2A 2F4MB 3IWZA 2W57A 3HSFA 4IPAA 3IL2A 3F6VA 2DMNA 4I99C 3HG9A 4Q48A 3D1NI 2W53A 3R0JA 5B1BH 2NNNA 3FM5A 4ZYAA 3WHCA 2Z99A 3MN2A 2VC1A 2G3BA 3WGGA 3F6OA 4LG3A 1O7LA 1NK2P 2AHQA 2DFHA 1FSHA 2HDCA 4M9SA 1O4XA 5JLXA 3S93A 1R9TJ 2CUJA 3HOYJ 1MMDA 2DU9A 5HS9A 1TWFJ 2Q24A 3VW0A 2O7TA 2CQKA 4UVCA 2OCCH 3CP2A 2IW5A 4RB2C 1SVOA 3LSPA 3JSPA 2JVHA 3EYYA 1Y39A 2HZDA 1BC8C 3LSTA 2F6CA 2VQGA 5B1AH 2H6BA 2KIUA 4HA8A 5KCMA 2VBZA 3BLYA 3CCQI 3REOA 1A04A 3ECHA 1I5ZA 2MABA 2ACJA 2FX0A 1R5ID 3L00A 1WH7A 2OPTA 1BOAA 5D18A 1L3LA 2JSCA 1MBEA 5FGLA 3KP5A 5LRSA 5DTDA 3HRTA 2LR8A 5IP6A 4FETA 3S3OA 3HTJA 1YE9A 3BCBA 1U8RA 2DFFA 2FNAA 1S9HA 4RB3C 3WG7H 4FX0A 1JE8A 1K78A 3E5UA 2NVUB 2KHMA 2DOAA 3FIWA 3JRGA 2KL4A 3E0JB 3JAMK 3Q0VA 4E7ZA 2E71A 1X1AA 2UXOA 2FOKA 3KYDB 4I02A 1OMIA 2A6TA 2BBYA 2GAUA 3HUGA 3IWFA 2X9DA 2CW7A 4EM0B 1ZHFA 1STZA 2D2WA 4RMNA 4XK4A 2UXUA 3M8FA 1Q1HA 1WVRA 3ZOBA 2Q0OA 5CVRA 1UMQA 1HDPA 2AO9A 4CZZA 4DQ2A 3N05A 3GEUA 3HTIA 3HRSA 1BR2A 1IV8A 1ZRDA 4MEYF 1BI1A 3LSMA 3WTTC 4M72A 1QRYA 2GIZA 3FXKA 3C2GA 2EK5A 4G8XA 2DI3A 2HKOA 1IO2A 1OCTC 2HI3A 2Y9ZA 2XAQA 3IHUA 3S3MA 3FMQA 3J7YJ 5K58A 4ABZA 4C3JJ 4M3GA 2Z33A 1I50J 3CO7C 1G3TA 4IRGA 3RZOJ 2CSOA 2QKOA 3GTQJ 3KZIC 5JVGF 4LG0B 4IOCF 1FYKA 3QU3A 2DG7A 5D6FA 2KZGA 3R61A 2K3FA 1VNDA 2K3PA 2HOAA 3CRJA 2R7ZJ 3ZMZA 3IP4B 3SEQA 4HBLA 3C1DA 3OS0A 4E70A 2BHZA 4IXAA 2HVRA 4EMSA 3CUQA 2E36A 1Y0UA 2QA4I 4XLEA 4IHYA 3BG6A 4ACIA 2GXBA 5HSZA 4AIHA 3RIRA 1FYMA 2VQLA 1S7EA 2V1XA 3PSIA 3DKXA 4L9VA 4IQ4A 2EPFA 3U1DA 2DA6A 2DA5A 2W85A 3S2DJ 2A69F 2WUIA 2BYVE 4L0YB 1KU9A 3HZJA 1XCBA 3M9AA 4XSXF 1QZEA 4HV5A 1FOYA 1XMAA 2DOFA 3VYRB 2XV4S 4R1HA 3FBIB 3ZMVA 4UUVA 1U2WA 2HYFA 2LG4A 3T6NA 1LDJA 2A6HF 4GCLA 2QWTA 4HZFA 2EFWA 2YUSA 5EYRA 5AIQA 2E1MB 1GHCA 1WI9A 1ULYA 3S32A 1LE8A 2V9VA 3K10A 4XOTA 3VDXA 3GXOA 4AVZA 4G94A 5E8IA 1ZR4A 2H27A 3J7AY 3BCGA 1FC3A 5AIPA 1JUPA 2HDWA 4XLPF 2BV6A 2XF6A 1XMKA 1VQPI 1SAXA 1JI8A 2IEKA 2LFBA 2ZSHB 3K7AJ 1R6RA 3H0DA 3H9QA 1RC9A 5IT3A 1R1UA 4AWXB 2Q2EA 5E3OA 2F4OB 3LOCA 4MGRA 1IN4A 1FJLA 4BEHB 3BCAA 1ON1A 3Q9SA 2G7SA 5F6FA 3PQKA 1YJNI 3E6BA 3HOWJ 4D7MA 4MFEA 3HOZJ 3KP3A 5HS8A 1MKMA 4RBOA 3RZDJ 4PFPA 3S1MJ 1R5GA 3LWJA 2E5ZA 2D6YA 3HGGA 2ME6A 4BHPA 4MLOA 2BE5F 1H8AC 3F8MA 1RETA 2XAJA 3S2WA 4A93J 1KU3A 1A36A 5AQCA 1VQNI 1LUJB 4PDKA 1ZRFA 5GPAA 1HA8A 2EWNA 3KEQA 3V78A 2FA5A 1B59A 2FNPA 3DCFA 3ZQIA 4LFUA 5ILUA 2GUHA 2NVYJ 4M6YA 2Z5UA 2X85A 1T39A 1DPUA 2IA2A 3E6MA 3BTJA 4UB6C 3BJOA 2E1OA 3QPLA 2R93J 2FE3A 2AXTC 3BTIA 4RAGA 4M3FA 4XLNF 1GUUA 3P9KA 1JHHA 3MMYB 3BG9A 2VT2A 5EGOB 2DQLA 2VJ5A 3OYNA 4HF2A 1V5GA 2R7QA 5J1UA 2ZJPF 5BPDA 1WSUA 2VPLA 1SD6A 3EYIA 3HOVJ 2YVEA 4WXCA 1OR7A 2Y75A 4FASD 3GFIA 2DA4A 3GCMA 3TO6A 4KFCA 1JTXA 1TBXA 3DLLF 5EEGA 4YIIA 1KQ0A 3K9TA 2H8RA 4OIPF 1YS7A 3FX3A 2L0KA 3BG3A 4IVNA 3OSGA 4I09A 1MBKA 4A69C 3LSJA 4QPOA 3KX2A 3T0YA 4JKZA 1X3WB 2ECBA 2X4HA 5AONA 3IV5A 1VQ6I 1R58A 4B1RA 4A3GJ 3DPUA 2W4SA 3VOXA 4B8XA 2EZHA 1KZHA 3FMSA 1S3JA 1IRXA 2PMUA 3S8PA 3I9V2 5K5RA 3BQYA 3SYTA 4M3EA 4D5FA 1IUFA 1ETYA 3E97A 2IVMA 2W25A 4C30A 1ETKA 2JA7J 3LSRA 2QSFX 5C4JJ 4HV6A 4DW6A 2K4JA 1IXRC 2ID3A 1QPIA 1ZG3A 2PZ9A 3KZYA 1JGSA 3TMOA 3FK6A 2COMA 3B02A 4DZJA 2M7AA 3PPBA 3BZKA 5ED4A 3HOXJ 5DCMB 3ZQCA 2M5WA 3HM5A 4A6EA 3I3LA 3KEYA 4HF0A 3OYFA 5FRMA 4AC6A 3MCZA 2WWYA 3L1PA 5E79C 4L18B 3FDYA 3RPUA 4RGXA 4KIFA 2ELKA 4MNUA 2MSYA 4F7ZA 4BU2A 1RIOH 2DYRH 4M9ZA 3HPHA 4MTDA 3V6GA 3ESWB 2RQPA 5EF6A 2K9MA 2EV0A 3JRAA 1S72I 3CC7I 3BRUA 2F5VA 1SFUA 2ZY9A 1Y1VJ 3DQVC 1T95A 3HRMA 1BBYA 4I01A 3GZ6A 1JT0A 3KZ9A 2REKA 2R4GA 1WWXA 1GVDA 1QO0D 4W1UA 3LWFA 5CKTA 1LEBA 1LFPA 3KIOA 4JYKA 2Y48A 3LA7A 1JT6A 3FXMA 4AYBA 3ZGKA 2BY2A 2XF5A 1OCOH 2FMLA 2W1OA 3CZ6A 3W6VA 1Z21A 3RKQA 3T5XA 5J1RA 4V2GA 2D45A 2B1EA 3CUOA 2DODA 2DQRA 2QWWA 5LHHA 1H0MA 1LQ1A 3CMMA 3W2AA 4KNYA 2G9WA 4KMUX 1SEUA 3HHHA 3OSFA 2XC7A 4RGRA 5EEAA 1XDSA 4YEJA 1IV6A 1HW2A 3C18A 2ZXJA 3MWMA 1SD5A 4HYEA 1JUSA 4GGGA 3QP5A 3VUQA 3HTHA 1J0RA 1MBGA 4RGUA 1MDMB 1C0WA 5KAIC 2ZCMA 1P4AA 2ZCWA 3RPUD 4Y17A 4ZC3A 1PDNC 3KFWX 2W84A 4OINF 1X1PA 1QPMA 4Z2YA 3D5SC 1N25A 1YW7A 4LG0A 1EH7A 3BPXA 2JQ7A 4MK6A 3RYRA 2XSDC 4NC6A 2KRCA 1NH3A 4QWQA 3PFIA 2F07A 3QOEA 2I10A 4F92B 4F52A 4P9FA 2HEOA 4CICA 1QA6A 2Z9OA 4FHTA 1UJ8A 4A3KJ 2NX4A 1X3UA 1HDDC 2DXIA 4WWCA 3I4NJ 4L62A 2XDVA 4HSTA 3OYAA 2HOSA 2PLYA 1F43A 4LB5A 4DIQA 2IBDA 4BH9A 1ZGWA 4BNCA 3SHFA 1ZGJA 2PJPA 1P9QC 1T6SA 1FP2A 2XAFA 3C3WA 3U2RA 3PO3J 2V7FA 4E7JA 1MH3A 2IA1A 3S3NA 4HAMA 1KGSA 2P0WA 2XGDA 3L2WA 1G3SA 2KJBA 2O3FA 3H3UA 3MQ0A 2IGKA 3FXUA 3ZXSA 4JP0A 3OYBA 2ZC2A 2LY2A 1HOMA 1FWZA 1XSDA 3WTXC 1HKSA 2FJI1 2EFNA 4IOAF 4XLCA 1SFOJ 1W7PB 5D4RA 3M8JA 4LIUA 4X0GA 2KFDA 2ZXWH 3LSKA 2IGOA 2OC6A 4ANJA 1E2XA 3VEPA 4BL0B 5IOYA 4D5CA 3N97A 5BMZA 1XGNA 1E3HA 1VF9A 2FSWA 2ELHA 3PSFA 2D1VA 2VBXA 3R60A 4QTRA 4Y4RA 3GUDA 2MYSA 3HB9A 2VONA 2XGXA 4CHUA 5CVJA 5DEQA 1H88C 1P7JA 3NQOA 4BEHA 4RM2A 3L09A 1U9NA 3DTEA 1IRGA 3WGHA 1HW5A 2HQAA 5C3EJ 3AQSA 2MC3A 2L7FP 2K9NA 4PUSA 3RDIA 3HKZA 4AUXA 5K7HA 2DDAA 1ETVA 2J5OA 1JJ6C 3M4OJ 1A6QA 1KYZA 1JJ8C 1WPKA 2LY9A 4MQ9F 2ADUA 1UHSA 1SFXA 2DYSH 5LLQA 3E6CC 1R71A 2CQXA 1W5TA 1ODDA 2VI6A 2R5YB 3OYCA 4N9IA 3F3XA 5H9TA 2HR3A 1V3FA 2UXNA 4PZJA 1AWCA 4AC0A 5J8FA 2NS8A 1F36A 4PJJA 3JTGA 2YU9J 4UDSA 4ZTFA 3G73A 4PXIA 2VQCA 2CW8A 3CESA 2KRFA 3QU6A 5C4XJ 4XICA 3HHGA 1J75A 1U5TB 2XASA 3HTUA 3PM1A 3WG9A 4KISA 2H1LA 1LFBA 4S0HB 4HX4A 1T2KA 5J6XA 3TP3A 3UKGA 4K2EA 2WAQA 5E3NA 3IUOA 3BPVA 5BPIA 2PFVA 3DBLB 2YX4A 3O60A 3AL0C 2V9KA 2XHKA 3EUHC 5GAGJ 3A2KA 1SD7A 2QVOA 1G4DA 2CV2A 3OYDA 5D8KB 4GCTA 3Q3SA 1XSXA 1YI2I 2WB1N 1PJRA 1T56A 2M87A 5FKKA 3ANGA 4YZEA 5DD4A 3B6CA 1GXQA 4NBQA 3A01A 3MEXA 3K4KA 2E35A 5HLIA 1A35A 2PJRB 2QENA 4KN7X 4F55A 1TQIA 1XCVA 1Z3XA 2EA4A 1RUOA 2Z16A 1V4RA 5CVVA 4UHTA 4C2TA 2DMUA 3AFHA 1SANA 2BXYA 3CJNA 3FZVA 5IY5H 1K83J 4C3IJ 4KMFA 1TTYA 1MH4A 3WU0A 5HODA 3L2VA 2DA2A 2BW3B 2PBIA 4OD5A 5DM7F 5EG0B 1KU7A 1KQ8A 3HRUA 4IRIA 2J5PA 5FLXZ 2VKDA 2ZXIA 3BT9A 2Z2SB 3BQZA 4G12A 5HBUA 4JX5A 4BUPA 4IHSA 5DCMA 3Q9VA 3MZHA 4LLGF 2CFOA 2QEXI 3VYSB 3PO2J 2IS6A 1W36D 3HTSB 2CFXA 4BDYA 1RI7A 2VKVA 4XLHA 1ZR2A 1MMAA 2Y9YA 3VYTB 3OYLA 3C2BA 4XN3A 2XAUA 1YRNB 1F5TA 1FY7A 1B8IB 5E1ZB 1W0TA 1R49A 3COLA 3E1SA 3PUFA 1UAAA 1FP1D 1Y56A 1YS6A 1IAWA 5LGNA 4ESFA 2F5DA 1Q1VA 3ONQA 4TV7A 3AG3H 1ZLKA 3FMRA 4EGZA 1JKQC 2DMTA 1P7IA 2WC2A 1EKEA 2ZJRF 3LA2A 4IX7A 5FD5A 3ZR8X 1WJEA 2R92J 1Z3YA 2DOEA 2CQQA 2A07F 2VASA 3JRCA 4EJVA 1AHDP 2RVCA 3FXOA 5IPAA 5CQGA 1ETXA 1JGGA 2R7WA 3K4MA 4MXMA 4G7OF 3KZZA 3F0CA 1D0YA 3DWLE 4CCKA 4DZPA 5HDNA 4LMYA 4A3LJ 3WHBA 1Y8RB 2RNGA 1YJWI 1VQ4I 5GP9A 1WJCA 4CCJA 4CYCB 3BR5A 4PK4A 2PBXA 2IS4A 3H1CA 1YLFA 3WTSC 5DS9A 2L9SA 2K40A 4WX9A 3M1CA 2HGCA 3P9TA 3P7NA 2OBPA 3GTKJ 3PNTA 1QZYA 3OYGA 1O3QA 1DU0A 2G7HA 3G6EI 3G1OA 4S04A 2XROA 1MDMA 4JX4A 3EGQA 5KVRA 1ZKGA 3K0LA 4ENKA 5M3FJ 3TO9A 2NP3A 1X1DA 1V55H 1P2FA 4HQEA 1IDZA 3D0SA 1XTAA 4EJWA 2JA5J 4N4OB 4U88A 2DFEA 4BJTA 1KQ9A 2IXSA 5BNGA 3OOUA 1Z77A 2ZKZA 3CO6C 2A6EF 5FROA 2R7OA 4OAYA 2MD0A 2PMHA 5IP9J 3ON4A 2RV8A 1TT5B 4CA0A 3ABUA 1P4WA 3JR9A 1LDKB 3TEDA 3FXJA 3CCEI 3SDGA 1P92A 3A0BC 1G59A 2STWA 2ME0A 5J40A 1ZTRA 2QF7A 2O03A 1MGTA 4I76A 2KIFA 3K69A 3IUVA 1TQPA 3FM3A 1W0UA 3PNVA 3RJPA 5TJJA 2IJLA 3TW6A 2KT0A 2EV6A 2L3DA 3WTYC 2D5VA 2VBWA 5JHFA 3BZ6A 2ZNZA 3QWLA 3V7CA 1MMSA 3FK7A 4IHTA 1G8XA 5H6QA 3ZMTA 2N8GA 3VB2A 4A5NA 4C2MJ 4IHXA 1K6OA 1S7AA 3FXRA 2EZKA 5CJ9A 4E6KG 2DMQA 4BHCA 1J5YA 2VUMJ 4IO9F 1W7PA 1TC3C 5M5XJ 2ZSIB 2D1HA 4EJUA 2KLOA 5J8CA 3H9JA 1UG0A 3VW1A 2FU4A 4AIKA 2ZMEB 3A4CA 5J47A 2V26A 3RH2A 2AQFA 4GXOA 1E3OC 4AIDA 5L3EA 1J59A 2M4KA 3I54A 3NS4A 1HLVA 4YELA 2JK3A 3K6GA 4A0YA 1ONVA 4CCLA 3BJBA 1QVUA 1V5EA 2O0YA 3CDHA 3IH2A 4KWAA 2PI0A 1Z7UA 4NUBA 3P9CA 2PG4A 4YIRX 3F1BA 4NC8A 3FISA 3HIMA 1S29A 2RGVA 1OCPA 1CQTA 2UXIA 2PMZA 1KU2A 3F8CA 3TGNA 3WGIA 2LKXA 5HDGA 3PASA 1QBJA 2R5YA 4XRSG 3TOAA 1DUXC 5CPRB 3A0HC 5JFRA 2EA2A 1B72B 1G3YA 3S1NJ 1R5HA 5FLVA 1VQLI 2DA1A 3ABMH 4YFNF 1U3EM 2JUCA 1FEXA 2FOWA 4EVIA 1U5TA 3WTZA 4CO8A 3B6AA 4RDUA 5K5OA 1QHGA 1R00A 2X6XA 4LITA 1X1CA 4AVPA 3I53A 4EJOA 1W5CC 2CS3A 4QPQA 3CF5F 1OJLA 2KKOA 4XL9A 3ZQQA 1W7PD 2RAEA 1LPQA 2FBKA 4M3BA 1Z05A 1ZG1A 4ZH4F 1FTZA 3KKCA 3KETA 3BOQA 5LRRA 4XN0A 3QP6A 5FKLA 1AU7A 1JUMA 2JVGA 2VIXA 2XPWA 1YYVA 3FXQA 4L5EA 2NS0A 5EZHA 4A3IJ 4XRSA 1WRJA 4ICHA 2NAZA 4UV9A 1XDUA 2KISA 3IKVA 2NRAC 3G3ZA 5ICEA 4J01A 2NS7A 3MZ8A 2VOOA 1I1GA 2PJRA 2DMPA 2OUMA 1H9TA 1MBHA 2A68F 3L7WA 4DYCA 4OMYA 2OAZA 2XRNA 3WE2A 3I64A 2L54A 2X6WA 4OD4A 5E1WA 4KT6A 1RUNA 2E1NA 2V4JC 1FBQA 2GZWA 4DYQA 1K6YA 2TCTA 5JHUA 2V6EA 4YG2F 1IN6A 5GTIC 2UWMA 2R7XA 2P5LC 4HKUA 3JRDA 1S7OA 2CMPA 1KYWA 4B43A 3VOKA 2QSGX 4V19K 1HSJA 2HDDA 3D5RC 3GZIA 2AQEA 2BW3A 2ZO4A 2XB0X 2WY8Q 3CUQC 3CLOA 3NRVA 4M6XA 1WH5A 5EG0A 1VQ8I 3A02A 5LFAA 3ZPLA 4O5VA 4L0ZB 2BY0A 3DU6A 2NOGA 3F21A 4AIJA 2HQ5A 3GFJA 5DAJA 1B4AA 4EQQA 2EZIA 4WCGA 3NRGA 5JR3A 3NWTA 5HLGA 3FKJA 4Y13A 1KA8A 3GFMA 1MMNA 4Q47A 1LEAA 3RTRA 4L5IA 3ANPA 1ETOA 2ZOZA 3ASNH 2JA2A 2FRHA 3CCJI 1YRNA 4L9JA 1B8IA 4B3XA 5LEJA 2M3AA 2E19A 3KLOA 1S8NA 1OCCH 4HW0A 4N9HA 4FTHA 4KICA 2LF7A 3OY9A 5E17F 3DXJF 3NWSA 4B3AA 4CCOA 2PX9A 2V1NA 1JKRC 4N4NB 1U6GA 3TDUC 3RKYA 3PJRA 5FFZA 4A3JJ 1QU3A 2M34A 5E8GA 3FF5A 3BHQA 3DF8A 1HXDA 2MGQA 2HQRA 1T33A 4RAZA 3KP6A 3FBNB 3TP0A 5J1YA 3A01B 3HOTA 1H89C 1ORKA 3BJAA 4OOIA 2KP6A 3L9FA 4HEA2 3G4SI 3WE3A 2GOXB 3GF2A 1MW7A 4PJNA 2LLKA 1W4MA 2JPBA 3GZ5A 4B48A 3S17J 2Z3YA 3LSHA 5ERIA 4HQMA 5F64A 1JTYA 3ZQ7A 2E1CA 2IS1A 2LRDA 1OKRA 2M1BA 2LDUA 1T0FA 2MD5A 3NAUA 2IT0A 4A6DA 3LSGA 5FJ8J 4NQWB 1Z0XA 5LEKA 1GV2A 1AOYA 3R0AA 5F0FA 3TDZC 5GTHC 4CYCA 3L2QA 2KZVA 3VTIA 4DVYP 3DKYA 4XM3A 1TNTA 3AG2H 4M73A 3M1EA 1YJ9I 1FT9A 2HVSA 3GLLA 1TWAJ 3BDDA 4JQFA 2RN7A 5E20A 2YVXA 2DJNA 2PQ8A 4MO7A 4W97A 4Y15A 1ETWA 3C7JA 4G6DA 2MBFA 2EB7A 3LQQA 1A6IA 3QQAA 2DG8A 3E3VA 1O3TA 3O8GA 4IQJA 2K85A 3BTLA 1USTA 2MA3A 3LSIA 1HKTA 1UHMA 1Z7LA 4NHJA 3WTVC 2OCEA 3HEFA 3CD6I 5D5VB 2CH0A 3GYHX 4G7HF 3CJTB 2BZTA 2R7UA 4LD5A 3HOSA 3KYCB 4A5MA 1I39A 1OR7C 1TZLA 3V8LA 2VJJA 4HLYA 5CYVA 1FX7A 4X6AJ 1BI2A 3CCMI 1U0JA 3GLXA 2O6GE 3HJEA 3MAJA 1NG6A 4XR6A 2YU3A 1D0XA 3SZTA 1I1SA 4NELA 5D5XB 4AYBN 3DTKA 4C9YA 1UI5A 5F04A 4D1QA 5LGUA 1VQ9I 4OWRB 2EFOA 2CU7A 3H36A 1V54H 2Y30A 4A3FJ 1CGPA 2VL8A 3RQ4A 3ECOA 3DBHB 2ZBKA 1YFHA 1MD0A 3FHNA 1BIAA 4ON0A 3BROA 5M5YJ 1FOXA 2OTLI 2EV5A 1XPXA 4PJMA 5GAHJ 4OMZA 5DYMA 4PFOA 4DBQA 1K4SA 2JMWA 4ME9A 1YQAA 2HPIA 3QODA 2XAHA 2EFPA 3ZN1A 2KDZA 1TL8A 2X0LA 5IOZA 4KN4X 1FLIA 3GVAA 5H2FC 1DQUA 5KAFC 4NN1A 4MHGA 5BS6A 4BE2A 2LF8A 3AG4H 3DPTA 2VKHA 2JTVA 3EUKL 3ZMDA 3C07A 2E5NA 1I6XA 3KEOA 5HLTA 3I59B 4WIBA 2F5FA 1SGMA 2DFIA 2ZMEA 5C4YA 5K1YA 4U0YA 4H4KC 2GA1A 3E5QA 1O3RA 3QAHA 5M3MJ 3ZQHA 2DLLA 1UG2A 3RKXA 2F5CA 3CCVI 4RS8A 3J80Z 3AQTA 3GMEA 2WV0A 1JHFA 2HZTA 3H5AA 5D4SA 4A3BJ 3M07A 4M74A 3PIOF 2R5ZB 2LP0A 4LLNA 1D3YA 2LY1A 1WJBA 1MSFC 1WKMA 4BKXA 4I6ZA 1QVTA 1BJZA 3JSOA 2K86A 1WHUA 2P7VB 4CCMA 2B9SA 2L01A 5B3SH 2EH3A 2WAEA 2X1EA 3K1MA 4II3A 2A5WA 3QPTA 1IDYA 4A12A 4FE4A 1WJAA 4P1WA 1B72A 1BA5A 2CG4A 2H94A 2R7FA 1XC5A 2XF7A 2ZXHA 4P5OA 2CWEA 2QIBA 2PFBA 2E7XA 2CV1A 3VVXA 4HNTA 4GYIA 5K7FA 2UXPA 4HG2A 3HC7A 2GFNA 2OTJI 1F1ZA 4U9NA 2HOTA 1VQOI 2AS5F 2O9LA 2GM4A 4JNNA 4GFBA 3ZCOA 1DDNA 4HF1A 1FYLA 4H0EA 4J19A 3NPIA 2JJ7A 3RPQA 2HKXA 2VPRA 2MH9A 3GTJJ 1YHQI 2DPDA 1FIAA 2QQ9A 2X1CA 4KIGA 4HLXA 4XBFA 4BE1A 5BQTA 3H5NA 5FLMJ 1JKPC 4U7BA 2XPVA 1GV5A 2H6CA 1I6HJ 3LJLA 2ZCNA 1LNWA 1BOBA 2LSOA 1B1BA 3CCUI 2RKHA 5D19A 2Y0SN 3HKZN 3QOPA 2P81A 4BHBA 1MMGA 4BXXJ 3CMEI 2DCEA 1ENHA 2DDBA 4B44A 2Y0SA 3VODA 2NP5A 3S1QJ 4ESBA 3HL2A 4KDPA 2BOLA 1TP4A 2HYJA 3FWEA 3D5LA 4RM3A 1YX5A 4O6JA 2ESNA 2P8TA 2VQHA 2RHAA 2GOMA 2M0CA 4CGRA 4ZYEA 5F27A 1WGXA 1G2HA 2LH9A 2O61A 4IJAA 1OCZH 2FF4A 1ITYA 1SC7A 1WCMJ 3TOBA 1EH8A 2QQBA 2WAQN 2OQRA 2PEXA 2QYOA 5FKMA 1A5JA 2LKPA 3OIOA 4XNFA 1HQCA 1R4NB 3BR1A 4EM1A 4E7IA 5KNLA 1P6RA 1V5FA 1SVMA 2JZYA 3LMMA 3PUBA 2O8XA 2DO7A 3OL3A 3WTUC 2B63J 4WF2A 4OIQF 4BBRJ 2ZOYA 3DKWA 4AD9A 4J00A 3OIPA 1OLTA 1QNTA 4BQNA 2E1MC 3VWBA 3LL7A 5LHIA 4IRHA 5HS7A 1RR8C 1WJ5A 4FE7A 4NDLA 1FZPB 2VE8A 1UHWA 1XD7A 3W2WA 6PAXA 4IEJA 4E7KA 1A31A 4IHVA 4ZYHA 3V8JA 3QYBA 3GX4X 4C2UA 3V4GA 2WY7Q 3NEUA 1OISA 3G1MA 2OA4A 4XMYA 3BZCA 4YRVA 5EZGA 1D1BA 4I2OA 3I4MJ 3RQIA 3V8KA 1RKWA 3V7SA 1R1TA 3VVYA 3FHZA 3O8HA 4BXFA 4CDGA 5HDKA 1ON2A 1UELB 4KA4A 2IAIA 4CUGA 2OZUA 3HE0A 4NQWA 4XORA 1MNEA 3JTHA 4UB8C 4AU7A 3DV8A 3IH4A 5J4YA 4A3MJ 1OFCX 2JA8J 3OS2A 1B6AA 1DGWY 4UNOA 3BR0A 4XLAA 2DTZA 5KK1A 5DDGA 4HPQA 2RASA 5LHGA 5L3GA 1W36C 3P5JA 2XVCA 1RZ4A 3U1KA 5EFYA 1EA3A 1XS9A 2OERA 5E18F 2R7SA 3M3YJ 2Y0MA 3N4MA 2WBMA 5DUKA 4F3QA 2EQRA 2MC4A 3LAJA 2XDNA 2K9SA 4CH7A 2VN2A 3ZMUA 4Z6YA 4HRIA 2YR2A 1TWHJ 4XONA 3G1LA 2K5CA 4ZDLA 1R7JA 1IW7F 2FBHA 2LOOA 1IXCA 2CQ7A 4WK8F 3LNQA 2RREA 4G7ZF 1ZYRF 2FBQA 4BS9A 2UXHA 3ABTA 5HVQC 4FCYA 1WQ2A 3G2BA 1OCRH 1Z9CA 1WJDA 2VKEA 1J7KA 3ABLH 3E5XA 1REPC 1D0ZA 1T08B 1XB4A 1IXSB 4KITB 1Z1DA 3DEEA 2ZJQF 3WODF 3HXLA 5LD2C 2HOEA 3RYPA 4ZTJA 4HSRA 1BI3A 1OYYA 4QIWN 4XKWA 3GTGJ 2CUZA 1NHAA 3JCUC 2DW4A 4Y7NJ 1ZG5A 1BI0A 4WXHA 5EEHA 5FHPA 2VXDA 2A61A 2DA7A 2JRTA 1YW8A 2QQ8A 3ULQB 3MKYB 4IHWA 3E7QA 2JSPA 2XSJC 2HNHA 4OU0A 2G7LA 3BC8A 3KLNA 5FFXA 1MNDA 3S15J 3OYMA 2RNJA 5L3CA 1OYWA 1PP8F 1K4TA 1VQKI 3LFKA 2GA2A 3MD2A 1NG7A 2CW0F 4PSWA 1Z67A 3CF2A 2R0QC 2IRFG 1PUFB 3IC7A 3SZPA 3HSEA 3ZN0A 3H0GJ 1S5LC 5CQEA 2X48A 3QKXA 3GTMJ 3S1RJ 5E3MA 2GQQA 3I59A 5H20A 2QKMB 3JRFA 4IKFA 3BR6A 2ZJ2A 3W2VA 2L7MP 1Z91A 2EBIA 3VOEA 1L0OC 2HWVA 3OOPA 4O3MA 2IS2A 2JN6A 4LB6B 2R5ZA 2CUFA 4ZYGA 2OQGA 1XGMA 1MJ9A 1O57A 2IP2A 3VFZA 2CGPA 2L7ZA 2BVLA 3U9GA 3DBRB 3LAPA 1UFMA 4MEXF 1YIOA 3CMYA 4XSZF 5FGMA 1YW9A 4A0ZA 4P9UA 2P5VA 1X19A 3LA3A 3MVPA 3VP5A 4X1EA 3V7RA 2UUZA 2EINH 3NARA 2OI8A 4NB5A 5A2QZ 1WJFA 2TDXA 3OWTA 2QBYB 1BC7C 4KYWA 2VOPA 3X2QH 3JSJA 1QHHD 3I58A 4UV8A 2M9HA 4YIFA 5IP7J 3ZQLA 1VZ0A 3GTOJ 2KRHA 4A0XA 3S2HJ 5GPCA 2V6CA 1TLHB 4G6QA 4IZZA 2LBFB 1IN7A 2Z1DA 4ENMA 5HLHA 3QPHA 5IT9Z 4BGDA 3B81A 5L3DA 1E3PA 1PUEE 3DFGA 4LGWA 3R6SA 4E7SA 4BAYA 1RR7A 4D0PA 3RD3A 2VJ4A 3SFIA 3SJMA 2W24A 3ZRGA 3J80K 4Q5SF 2L5QA 2XPUA 1K7AA 4C3HJ 4GDFA 2MLGA 2LMDA 3ERED 2L4AA 2QTQA 4G9YA 2X6OA 1ZRCA 3HGYA 4OIRF 5C44J 5GAEJ 1BR1A 3CCYA 4UVAA 4II2A 2XAGA 4I0BA 1Z6RA 3BR3A 2K4BA 5CVIA 2H1KA 3S16J 3HOUJ 1MJAA 4HNVA 4IF4A 5TISC 2DN0A 4DGWB 1K61A 1X4OA 4IL6C 5ICGA 1BL0A 2AXLA 2DPUA 3JW4A 1RPWA 1Z6TA 4WXDA 5CW8A 2PMZN 4M6VA 4D9JA 1ZGAA 2STTA 3I55I 4DBRA 4DOZA 4UY8I 4ZDOA 2Y31A 5TRDA 2HTSA 3SEZA 4XRMA 1X3ZB 2KIQA 2NYXA 3W3CA 2UZKA 3FRQA 4NC7A 1ERDA 5D6EA 2ISZA 1X1BA 2L9NA 2KPMA 2XKOA 3DTIA 3SDBA 3OYJA 2DT6A 3QRFF 1FTTA 1IC8A 1FBUA 1GDTA 3PFYA 3ZP5A 1ZAOA 4Y3OA 3TW7A 3KPHA 1FMWA 1GVJA 1ZK8A 1P4XA 3CLQA 2OV7A 4XRFA 1TWGJ 3AAFA 1RNLA 1MZBA 4A3CJ 2GXAA 5ILSA 4UUTA 4PGGA 1QGPA 3TL4X 3AG1H 4E7LA 3GEZA 3HPGA 1VQ7I 4HX7A 4PJ0C 4U9LA 5DCFA 3FXLA 1VQ5I 2ID6A 1GT0C 2NXNB 1VTNC 3AKZA 2RDPA 2M0MA 2X51A 3VSLA 1YO5C 2OU2A 2BXZA 2YX7A 4B09A 3NNRA 1NTCA 4Y52J 2LVSA 1D8JA 3O6BB 3GBGA 1SMYF 3L2RA 4L9NA 4EJTA 1MNMC 2P4WA 3K1NA 2QZ8A 2QQAA 2JT1A 3SFZA 4CXFA 5F1RA 3HIFA 3JRHA 2E7WA 1R23A 3OS1A 4JL3A 1WFXA 3F8NA 4RLFA 5HNHA 4R79A 1LVAA 2Y69H 4PCQA 1OPCA 2IPQX 3F23A 1FOWA 4BBSJ 3K4JA 1PVEA 4BYYA 4Q4ZF 3BG7A 1YOVB 2XB5A 1OQYA 4LK0F 4XLFA 4YFKF 2Q1ZB 4EGYA 1G6NA 2E34A 5BOXA 1F9NA 3AL0B 2ISYA 4U0WA 2K9LA 3GW2A 2FQ3A 2V1UA 3VVZA 3E7LA 2MFZA 3VSKA 1D5VA 3ERMA 4XIDA 1N78A 4UUSB 1SFKA 3J81Z 2QM3A 1J09A 4GYGA 4LIVA 3O2PE 4QSHA 1R36A 3G71I 5D5UB 2B3WA 3VIBA 4C2MA 2R7TA 4JX6A 1EJ9A 2A2FX 3BY6A 4P96A 2DTRA 2R7DA 2BVMA 5LBQA 2DJIA 2V57A 3HTAA 2VC0A 2FBIA 1U5TC 4KT5C 1XN7A 3CWRA 3NXCA 1ZLJA 3V42A 2B7EA 2GWRA 1GLNA 2BY1A 4V2FA 1PYVA 2ZB9A 3EPZA 2NOJB 3H9GA 3NI7A 4HDUA 4FISA 1SD4A 3BTCA 4A3EJ 2VODA 1SAUA 1TWCJ 3LQRA 3I0TA 2LNBA 3BP8A 1G3WA 1D5YA 3OR2C 2KQRA 4U87A 5ICCA 1WZ2A 3Q5FA 5ICFA 5B66C 3OYHA 3ABKH 1HBXG 5EJCA 3UR3C 2GBYA 1AKHB 3ML6A 2IU5A 1M1EB 4MIMA 4JOMA 1ZREA 1XMXA 1VI0A 4BY7J 3QYEA 5FO5A 1I3AA 2LYCA 4LOCA 2A3SA 3SXYA 3FKIJ 2VJIA 3HSRA 4E7HA 2W82A 3CCLI 2NVTJ 1IJWC 3JRIA 1VFCA 2NNYA 1QQIA 3M8EA 3HDDA 5FLXK 4RLQA 5E1XA 1U8BA 1ZN2A 1I27A 4BDZA 3MKLA 2LD5A 1YIJI 2L7KA 4ZZLA 4XKVA 3L2CA 2M30A 2VT3A 5CXIA 1B9MA 2WV1A 1Y1WJ 3OYKA 2Y2ZA 2ELJA 1IRZA 4P55A 1HF0A 4LJZF 5F1JA 4BACA 1FBSA 4EV0A 1EV7A 2HXIA 1FMVA 2VB6A 1PUFA 1HC8A 3DEUA 3SZGA 2B0LA 3ISPA 2CO5A 3PNYA 4Y33A 5F08A 1POGA 4ETSA 2L02A 1R1VA 3OIQA 2G7UA 4GFLA 1HKQA 2WA0A 3K1PA 4PSXA 4KJZA 1SFEA 3DP7A 5GADJ 2YVHA 2DT7B 2IGMA 1IRFA 4AM3A 3PL8A 3MKZA 3CP8A 2GENA 2ECCA 1T38A 4OIOF 1YG2A 2PN6A 2F4IA 5J3LA 1CF7B 2E2HJ 3GO5A 2HYTA 1ACIA 3UNGC 1AA7A 5J4VA 3BR2A 2CRGA 3O3KA 3K4BA 1MBJA 2K27A 2QLZA 2CUEA 2CYYA 2G0EA 4BQOA 3EETA 1IGNA 2EFQA 1TQMA 5FD6A 2M4GA 2R3SA 1ZQ3P 1DP3A 3K8PC 2EJRA 3K4CA 4M71A 3U21A 3CMAI 4ESJA 1UCRA 2O5RA 4B47A 3IRQA 1ZH5A 3F72A 4U7DA 1XSVA 3GTLJ 3KP4A 1LFUP 2F48A 2QBYA 2P7CB 1D1AA 2HKUA 1D1CA 3ASOH 2KJCA 4GFKA 2HFHA 3SWHA 5DV5A 3DU5A 1I3QJ 4R8HA 4BJ5C 2LBFA 1LKXA 1X2NA 5L3FA 3OL4A 1T0FC 4F93B 3CDLA 2L9VA 2R7VA 2W48A 1DP7P 1EF4A 4AF5A 3I56I 2QSHX 4BQAA 2FJ1A 1W5SA 1ETQA 4N0BA 2IGNA 5D5WB 2HS5A 2JPCA 5IYBJ 4U0VA 1DU6A 3OYEA 2M8EA 2WTEA 3W6JB 4JK1X 2VBYA 3G7RA 1U78A 1YX3A 1USSA 1DGRM 2JWTA 3F8BA 1XG1A 1MIJA 1Y6IA 2ESHA 1IN5A 1X58A 5LGTA 4S05A 3CCSI 1BN5A 2K9QA 3ON2A 2HXOA 1SVLA 4LK1F 3M7GA 1HSTA 1RRJA 5IYDJ 5A2QK 1FSEA 3CCRI 2JA6J 3HBLA 2HQNA 2I5UA 1APLC 2BY3A 3BNIA 2P5KA 1IN8A 2BEOA 4ASNA 4CYDA 3KYLA 4I98B 1IF1A 2F5EA 3F8FA 5IT9K 5K5QA 3KKDA 4ENNA 4L5JA 4BJ6C 2G7GA 3TO7A 2RC4A 4L9TA 2L4MA 3JAMZ 3IH3A 3MKWB 5D1RA 1LJ9A 1FNNA 3IRRA 5JVTA 2NVQJ 4RA2A 4EM2A 2ZCXA 1MSEC 3A1YA 2LK2A 3VPRA 1WI3A 1XX5A 5L3BA 1EH6A 1IG7A 1E17A 5FB2A 2BGCA 2FUG2 2DAOA 3CTAA 3GZNB 2XIGA 1UZCA 2W7NA 1TT0A 3ROUA 2H09A 1TNSA 1KONA 1QZZA 2MG4A 3TBIA 1J9IA 1XGSA 3KNWA 1JKOC 5FMPA 2KIMA 1N75A 4YFXF 5HNFA 3K70C 4GCKA 2P6TA 2QGUA 3K70D 3BWGA 2Q8KA 3RSNA 3DPLC 2GLOA 5CLSA 3OYIA 3DLAA 1O3SA 4HOBA 5HAWA 5EDNA 2FMYA 2TRTA 3PIPF 4BQQA 4ZZDA 1X4PA 3OMYA 2ZMEC 5E3LA 5TGTA 1K78B 2L2OA 5K7ZA 1NK3P 5FKNA 2LKSA 4PGHA 3Q0UA 3HUGB 4FQGA 2OD5A 4XQFA 4ITVA 3H92A 2FEZA 2DK8A 2YPRA 4M3DA 3I5UA 3KP2A 1UI6A 3EUHA 3QYFA 1GXPA 5JLWA 2EIKH 1IZ1A 2IA0A 3P9IA 3SQNA 2FQ4A 1RESA 4I7HA 1OYIA 2HYGD 4HNUA 4UUSA 4BE0A 4IRVA 1BJAA 1SMTA 1K79A 2R7RA 4UXNA 1PP7U 2GXGA 3GTPJ 2JRMA 3CJQB 4F91B 1D8KA 2DA3A 4MQVA 1UB9A 4RB1A 4ZYDA 2NVXJ 4ZDPA 4OAZA 2EIJH 2FXAA 3EQLF 5B5EC 4FT8A 2C6YA 3ELKA 1BR4A 1F4KA 3B73A 3CDIA 4DNCA 5IYCJ 4BXUA 2VXZA 4KUMA 1BM9A 2MW8A 4JBAA 3R4KA 4RAFA 2DT5A 3H3VK 2XRLA 2EILH 4CGZA 3S5RA 2XGEA 1BIBA 2JUGA 3EUPA 2UV1A 3OR1C 1S6LA 1YITI 2VE9A 3K4LA 2E2JJ 2M45A 3CUQB 3GWZA 5M5WJ 3JREA 2I8DA 4EATA 1E0EA 1RKTA 2QUFA 2X6YA 2XUBA 3WU2C 1AKHA 1FIPA 2DK5A 3MNLA 1LVKA 3OV8A 1MJBA 1LB2A 3E6DA 1H9GA 2ZFWA 2DBBA 3CJDA 1DPRA 3L2UA 2KMUA 4GCVA 4QLCU 3J81K 2H8WA 2OJED 5EGOA 4M9XA 4LLLA 4GO1A 3F22A 4ENJA 1LDDA 4MFDA 4BY1J 2ZNYA 3I4PA 2M8GX 3MFKA 4FX4A 3H5RA 4DYRA 3ZQGA 3K2AA 1X2MA 3BJ6A 1LE8B 2EIMH 1HCRA 1U9OA 4RB0A 2E2IJ 3BG5A 2YS9A 1JXSA 4I0AA 3RKWA 2WB1A 1W1WE 2HTJA 3EUAA 5CVUA 3ZMSA 2QCOA 3KP7A 2HVQA 3J7ZI 2LTPA 2Q2EB 5DUIA 3DPJA 2K02A 1ZELA 3IAS2 3MZYA 4A3DJ 3RCOA 3TQNA 4B4CA 3A03A 2CQNA 5HOOA 4HDVA 5KHDA 3IAM2 2CJJA 2M7BA 3K4NA 2OF7A 3CJRB 2MLKA 2VLAA 5FKOA 4EEFG 1CF7A 2MH2A 2L9RA 3TKYA 3VW2A 4XKCA 3Q0WA 3J7AO 1FPQA 4UVBA 5FRNA 2FD5A
chains in the Genus database with same CATH topology
1HDDC 1H89C 1ORKA 3HOUJ 4HNVA 3CQZJ 3I4NJ 4L62A 2DN0A 2HOSA 1F43A 1K61A 4D7NA 1MBFA 3LHQA 2IBDA 2LLKA 1ZGWA 1BL0A 1RPWA 3S17J 1BW5A 3QBMA 1JTYA 5CW8A 2PMZN 4M6VA 3PO3J 2Y31A 3NAUA 1MH3A 3DEWA 4XRMA 3LSGA 5FJ8J 2XGDA 1Z0XA 3FRQA 1GV2A 3S14J 5F0FA 4CYCA 3G56A 3QPSA 4JP0A 2O7OA 2COBA 1HOMA 9ANTA 1FTTA 1IC8A 1GDTA 1SFOJ 2EZLA 1TWAJ 3TW7A 5IOYA 1ZK8A 2DJNA 4MO7A 1TWGJ 4D5CA 4W97A 4A3CJ 1ETWA 3ZQFA 1VF9A 3QQAA 1A6IA 2DG8A 4UUTA 3O8GA 3BTLA 4QTRA 3JRBA 3HB9A 2O8KA 2ID6A 3HEFA 5F0HA 1GT0C 1P7JA 1H88C 5F0CA 1U9NA 1BW6A 2WGBA 2M2EA 1NTCA 3NNRA 4Y52J 5C3EJ 2LVSA 2QOPA 3AQSA 5CXGA 2L7FP 2K9NA 3GBGA 5K7HA 4AUXA 2XGCA 1MNMC 4X6AJ 1ETVA 1JJ6C 3M4OJ 1JJ8C 3JRHA 1WPKA 2LY9A 1UHSA 2DMNA 4JL3A 4NELA 4AYBN 3D1NI 2CQXA 2VI6A 2R5YB 2W53A 1UI5A 5F04A 5H9TA 2CU7A 2Y30A 4BBSJ 4AC0A 4A3FJ 3WHCA 3MN2A 5AQCA 2XB5A 2NS8A 1F36A 2G3BA 4UDSA 2YU9J 1NK2P 2AHQA 4PXIA 5M5YJ 5C4XJ 4XICA 3VVZA 1O4XA 3E7LA 3PM1A 5JLXA 1R9TJ 4XIDA 1LFBA 4S0HB 4UUSB 3HOYJ 3TP3A 3UKGA 2JMWA 4ME9A 5E3NA 1TWFJ 4QSHA 2Q24A 3VW0A 2O7TA 3VIBA 2KDZA 4JX6A 5IOZA 3LSPA 3O60A 4NN1A 2V57A 3HTAA 3C07A 3NXCA 3CWRA 1SGMA 3Q3SA 4GCTA 4V2FA 2WB1N 2ZB9A 1T56A 5C4YA 5FKKA 3ANGA 4YZEA 3B6CA 3A01A 3NI7A 4FISA 5M3MJ 3ZQHA 1UG2A 2FX0A 3BTCA 4A3EJ 1WH7A 2OPTA 5D18A 1TWCJ 3AQTA 1MBEA 1D5YA 5FGLA 5DTDA 5IP6A 2LR8A 4A3BJ 2R5ZB 3HTJA 2LP0A 2DMUA 1MSFC 1SANA 2GBYA 4BKXA 1QVTA 4I6ZA 1BJZA 1AKHB 2IU5A 4MIMA 1K83J 4C3IJ 1MH4A 1VI0A 3FIWA 4BY7J 5HODA 3JRGA 2DA2A 4LOCA 3Q0VA 3FKIJ 2UXOA 2EH3A 2NVTJ 5EG0B 1IJWC 2X9DA 3JRIA 1VFCA 1IDYA 4FE4A 1B72A 3HDDA 1U8BA 4XK4A 2LD5A 1BA5A 3MKLA 3BT9A 2UXUA 4G12A 3BQZA 5HBUA 4JX5A 3ZOBA 5CXIA 2WV1A 1XC5A 1UMQA 1HDPA 2AO9A 3PO2J 3GEUA 3HTIA 1Y1WJ 2QIBA 2Y2ZA 3VVXA 2VKVA 1IRZA 1HF0A 2UXPA 5K7FA 1ZR2A 2Y9YA 5F1JA 1QRYA 3C2BA 2GFNA 1YRNB 2HXIA 1PUFA 1B8IB 1OCTC 2HI3A 2Y9ZA 2HOTA 1W0TA 2O9LA 3COLA 5K58A 4ABZA 4C3JJ 4M3GA 2GM4A 4JNNA 4GFBA 1I50J 3RZOJ 4J19A 5F08A 1POGA 2JJ7A 2QKOA 3GTQJ 3NPIA 2VPRA 4GFLA 3GTJJ 1FIAA 2DG7A 2YVHA 1Q1VA 1VNDA 2GENA 2ECCA 1JKQC 2HOAA 3CRJA 2DMTA 2R7ZJ 5FLMJ 1P7IA 5J3LA 1JKPC 2E2HJ 2HYTA 2R92J 2XPVA 1GV5A 1I6HJ 3LJLA 2ZCNA 3BR2A 2CQQA 2CRGA 1MBJA 4ACIA 4IHYA 3JRCA 1AHDP 5D19A 2Y0SN 5HSZA 2CUEA 3HKZN 2P81A 4BXXJ 2G0EA 1S7EA 5IPAA 1ETXA 1JGGA 1ENHA 2DA6A 2DA5A 1IGNA 3S2DJ 4MXMA 2NP5A 3F0CA 3S1QJ 2WUIA 4DZPA 1ZQ3P 4A3LJ 2HYJA 3WHBA 5GP9A 4CYCB 3BR5A 3GTLJ 2PBXA 2RHAA 1LFUP 2M0CA 5DS9A 3T6NA 4CGRA 2HKUA 2K40A 5F27A 4GCLA 1WGXA 1G2HA 2QWTA 4GFKA 2YUSA 3P9TA 5EYRA 1I3QJ 3GTKJ 1X2NA 1ITYA 1DU0A 1WCMJ 1LE8A 3G1OA 2WAQN 3CDLA 1ZR4A 4JX4A 3BCGA 2W48A 5FKMA 1A5JA 1JUPA 1EF4A 3EGQA 3OIOA 4AF5A 1ZKGA 3BR1A 2IEKA 2FJ1A 2LFBA 5M3FJ 1ETQA 3K7AJ 2NP3A 1IDZA 2B63J 4BBRJ 2JA5J 5E3OA 2ZOYA 5IYBJ 3LOCA 1DU6A 1FJLA 5BNGA 3OOUA 1Z77A 3G7RA 1U78A 2JWTA 2G7SA 1XG1A 5IP9J 3ON4A 4FE7A 4NDLA 3HOWJ 4D7MA 1X58A 4MFEA 3HOZJ 4IEJA 3JR9A 3TEDA 4IHVA 2K9QA 3ON2A 4RBOA 2HXOA 3RZDJ 3S1MJ 3SDGA 3LWJA 2D6YA 3HGGA 2ME6A 2ME0A 4MLOA 1H8AC 1ZTRA 2QF7A 1RETA 5IYDJ 4I76A 3IUVA 4A93J 3G1MA 2JA6J 3HBLA 1W0UA 5EZGA 1APLC 5GPAA 3I4MJ 3RQIA 3TW6A 2KT0A 3BNIA 3DCFA 3ZQIA 2GUHA 3V78A 1RKWA 2NVYJ 2D5VA 3VVYA 3O8HA 3BTJA 2IAIA 2E1OA 3QPLA 3FK7A 3HE0A 3KKDA 2R93J 2N8GA 3BTIA 4C2MJ 4IHXA 4M3FA 2G7GA 1GUUA 3IH3A 3IH4A 4A3MJ 5D1RA 1OFCX 2EZKA 2JA8J 2DMQA 3BG9A 5EGOB 2NVQJ 2VUMJ 3BR0A 2ZCXA 1TC3C 5J1UA 5M5XJ 1MSEC 2DTZA 2LK2A 3VPRA 1WI3A 2RASA 3HOVJ 2YVEA 1IG7A 5EFYA 1XS9A 2OERA 2DA4A 3VW1A 3M3YJ 1JTXA 2EQRA 2XDNA 2K9SA 2MG4A 3KNWA 2H8RA 1JKOC 3RH2A 2L0KA 5FMPA 3BG3A 3OSGA 1TWHJ 4GCKA 3G1LA 1E3OC 1MBKA 4A69C 3LSJA 4JKZA 1HLVA 2FBQA 3LNQA 2GLOA 2JK3A 2ECBA 3IV5A 5HAWA 4B1RA 5EDNA 4A3GJ 4FCYA 2UXHA 2TRTA 1QVUA 3BJBA 3VOXA 3IH2A 4KWAA 2VKEA 2EZHA 3F1BA 3BQYA 3FISA 4M3EA 3HIMA 4D5FA 1IUFA 1ETYA 1OCPA 1CQTA 5E3LA 2UXIA 2LKXA 1ETKA 4QIWN 3LSRA 2JA7J 3PASA 5K7ZA 5C4JJ 2R5YA 4XRSG 4DW6A 1NK3P 3GTGJ 5FKNA 2ID3A 1QPIA 2PZ9A 3Q0UA 4Y7NJ 3FK6A 4M3DA 4DZJA 1B72B 5FLVA 3S1NJ 2DA7A 4IHWA 1UI6A 3PPBA 5FHPA 3E7QA 3HOXJ 5JLWA 2DA1A 3ZQCA 1FEXA 2G7LA 3HM5A 3S15J 2FQ4A 1RESA 3B6AA 4UUSA 4RDUA 4AC6A 3L1PA 2R0QC 3GTPJ 2ELKA 1PUFB 1OJLA 2DA3A 2NVXJ 2MSYA 2RAEA 3H0GJ 4M3BA 2X48A 3QKXA 3GTMJ 1FTZA 3S1RJ 3KKCA 3V6GA 5EF6A 5IYCJ 5E3MA 3JRAA 3BRUA 2MW8A 5FKLA 1AU7A 1JUMA 1Y1VJ 2XPWA 4L5EA 3H3VK 2XRLA 5EZHA 3JRFA 4A3IJ 3S5RA 2XGEA 4XRSA 1JT0A 4ICHA 3BR6A 3EUPA 3KZ9A 2REKA 1GVDA 2L7MP 2EBIA 2NS7A 4W1UA 2DMPA 1MBHA 2E2JJ 4DYCA 4JYKA 1JT6A 5M5WJ 3JREA 2JN6A 2R5ZA 1RKTA 2CUFA 4DYQA 2TCTA 2L7ZA 1AKHA 1FIPA 4HKUA 3MNLA 3W6VA 3JRDA 3RKQA 5J1RA 3VOKA 4V2GA 3CMYA 2HDDA 3CJDA 3GZIA 3MVPA 3VP5A 4X1EA 2XB0X 1WH5A 3NARA 5EG0A 3A02A 5EGOA 2OI8A 3OSFA 2NOGA 5EEAA 2HQ5A 5DAJA 4MFDA 1IV6A 2EZIA 4BY1J 3JSJA 3NRGA 5IP7J 2M9HA 3ZQLA 3GTOJ 2M8GX 3S2HJ 5GPCA 4DYRA 1JUSA 3ZQGA 3K2AA 1X2MA 1LE8B 3B81A 1HCRA 3HTHA 3ANPA 3VUQA 1ETOA 1U9OA 2E2IJ 2ZOZA 1MBGA 3BG5A 2YS9A 1YRNA 2ZCMA 1B8IA 1RR7A 3RD3A 2E19A 3SFIA 3SJMA 2QCOA 2XPUA 4FTHA 4C3HJ 2LTPA 4B3AA 3DPJA 2H1KA 4A3DJ 1JKRC 4B4CA 2QTQA 4MK6A 2X6OA 3A03A 2XSDC 3HGYA 5C44J 2F07A 4A3JJ 2CJJA 2I10A 2OF7A 2M34A 3CCYA 3BHQA 5FKOA 4EEFG 2MGQA 2L9RA 1T33A 3VW2A 3BR3A 4A3KJ 3Q0WA 5J1YA 2NX4A 3TP0A 3A01B 3S16J 2FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDD C;  1H89 C;  1ORK A;  3HOU J;  4HNV A;  3CQZ J;  3I4N J;  4L62 A;  2DN0 A;  2HOS A;  1F43 A;  1K61 A;  4D7N A;  1MBF A;  3LHQ A;  2IBD A;  2LLK A;  1ZGW A;  1BL0 A;  1RPW A;  3S17 J;  1BW5 A;  3QBM A;  1JTY A;  5CW8 A;  2PMZ N;  4M6V A;  3PO3 J;  2Y31 A;  3NAU A;  1MH3 A;  3DEW A;  4XRM A;  3LSG A;  5FJ8 J;  2XGD A;  1Z0X A;  3FRQ A;  1GV2 A;  3S14 J;  5F0F A;  4CYC A;  3G56 A;  3QPS A;  4JP0 A;  2O7O A;  2COB A;  1HOM A;  9ANT A;  1FTT A;  1IC8 A;  1GDT A;  1SFO J;  2EZL A;  1TWA J;  3TW7 A;  5IOY A;  1ZK8 A;  2DJN A;  4MO7 A;  1TWG J;  4D5C A;  4W97 A;  4A3C J;  1ETW A;  3ZQF A;  1VF9 A;  3QQA A;  1A6I A;  2DG8 A;  4UUT A;  3O8G A;  3BTL A;  4QTR A;  3JRB A;  3HB9 A;  2O8K A;  2ID6 A;  3HEF A;  5F0H A;  1GT0 C;  1P7J A;  1H88 C;  5F0C A;  1U9N A;  1BW6 A;  2WGB A;  2M2E A;  1NTC A;  3NNR A;  4Y52 J;  5C3E J;  2LVS A;  2QOP A;  3AQS A;  5CXG A;  2L7F P;  2K9N A;  3GBG A;  5K7H A;  4AUX A;  2XGC A;  1MNM C;  4X6A J;  1ETV A;  1JJ6 C;  3M4O J;  1JJ8 C;  3JRH A;  1WPK A;  2LY9 A;  1UHS A;  2DMN A;  4JL3 A;  4NEL A;  4AYB N;  3D1N I;  2CQX A;  2VI6 A;  2R5Y B;  2W53 A;  1UI5 A;  5F04 A;  5H9T A;  2CU7 A;  2Y30 A;  4BBS J;  4AC0 A;  4A3F J;  3WHC A;  3MN2 A;  5AQC A;  2XB5 A;  2NS8 A;  1F36 A;  2G3B A;  4UDS A;  2YU9 J;  1NK2 P;  2AHQ A;  4PXI A;  5M5Y J;  5C4X J;  4XIC A;  3VVZ A;  1O4X A;  3E7L A;  3PM1 A;  5JLX A;  1R9T J;  4XID A;  1LFB A;  4S0H B;  4UUS B;  3HOY J;  3TP3 A;  3UKG A;  2JMW A;  4ME9 A;  5E3N A;  1TWF J;  4QSH A;  2Q24 A;  3VW0 A;  2O7T A;  3VIB A;  2KDZ A;  4JX6 A;  5IOZ A;  3LSP A;  3O60 A;  4NN1 A;  2V57 A;  3HTA A;  3C07 A;  3NXC A;  3CWR A;  1SGM A;  3Q3S A;  4GCT A;  4V2F A;  2WB1 N;  2ZB9 A;  1T56 A;  5C4Y A;  5FKK A;  3ANG A;  4YZE A;  3B6C A;  3A01 A;  3NI7 A;  4FIS A;  5M3M J;  3ZQH A;  1UG2 A;  2FX0 A;  3BTC A;  4A3E J;  1WH7 A;  2OPT A;  5D18 A;  1TWC J;  3AQT A;  1MBE A;  1D5Y A;  5FGL A;  5DTD A;  5IP6 A;  2LR8 A;  4A3B J;  2R5Z B;  3HTJ A;  2LP0 A;  2DMU A;  1MSF C;  1SAN A;  2GBY A;  4BKX A;  1QVT A;  4I6Z A;  1BJZ A;  1AKH B;  2IU5 A;  4MIM A;  1K83 J;  4C3I J;  1MH4 A;  1VI0 A;  3FIW A;  4BY7 J;  5HOD A;  3JRG A;  2DA2 A;  4LOC A;  3Q0V A;  3FKI J;  2UXO A;  2EH3 A;  2NVT J;  5EG0 B;  1IJW C;  2X9D A;  3JRI A;  1VFC A;  1IDY A;  4FE4 A;  1B72 A;  3HDD A;  1U8B A;  4XK4 A;  2LD5 A;  1BA5 A;  3MKL A;  3BT9 A;  2UXU A;  4G12 A;  3BQZ A;  5HBU A;  4JX5 A;  3ZOB A;  5CXI A;  2WV1 A;  1XC5 A;  1UMQ A;  1HDP A;  2AO9 A;  3PO2 J;  3GEU A;  3HTI A;  1Y1W J;  2QIB A;  2Y2Z A;  3VVX A;  2VKV A;  1IRZ A;  1HF0 A;  2UXP A;  5K7F A;  1ZR2 A;  2Y9Y A;  5F1J A;  1QRY A;  3C2B A;  2GFN A;  1YRN B;  2HXI A;  1PUF A;  1B8I B;  1OCT C;  2HI3 A;  2Y9Z A;  2HOT A;  1W0T A;  2O9L A;  3COL A;  5K58 A;  4ABZ A;  4C3J J;  4M3G A;  2GM4 A;  4JNN A;  4GFB A;  1I50 J;  3RZO J;  4J19 A;  5F08 A;  1POG A;  2JJ7 A;  2QKO A;  3GTQ J;  3NPI A;  2VPR A;  4GFL A;  3GTJ J;  1FIA A;  2DG7 A;  2YVH A;  1Q1V A;  1VND A;  2GEN A;  2ECC A;  1JKQ C;  2HOA A;  3CRJ A;  2DMT A;  2R7Z J;  5FLM J;  1P7I A;  5J3L A;  1JKP C;  2E2H J;  2HYT A;  2R92 J;  2XPV A;  1GV5 A;  1I6H J;  3LJL A;  2ZCN A;  3BR2 A;  2CQQ A;  2CRG A;  1MBJ A;  4ACI A;  4IHY A;  3JRC A;  1AHD P;  5D19 A;  2Y0S N;  5HSZ A;  2CUE A;  3HKZ N;  2P81 A;  4BXX J;  2G0E A;  1S7E A;  5IPA A;  1ETX A;  1JGG A;  1ENH A;  2DA6 A;  2DA5 A;  1IGN A;  3S2D J;  4MXM A;  2NP5 A;  3F0C A;  3S1Q J;  2WUI A;  4DZP A;  1ZQ3 P;  4A3L J;  2HYJ A;  3WHB A;  5GP9 A;  4CYC B;  3BR5 A;  3GTL J;  2PBX A;  2RHA A;  1LFU P;  2M0C A;  5DS9 A;  3T6N A;  4CGR A;  2HKU A;  2K40 A;  5F27 A;  4GCL A;  1WGX A;  1G2H A;  2QWT A;  4GFK A;  2YUS A;  3P9T A;  5EYR A;  1I3Q J;  3GTK J;  1X2N A;  1ITY A;  1DU0 A;  1WCM J;  1LE8 A;  3G1O A;  2WAQ N;  3CDL A;  1ZR4 A;  4JX4 A;  3BCG A;  2W48 A;  5FKM A;  1A5J A;  1JUP A;  1EF4 A;  3EGQ A;  3OIO A;  4AF5 A;  1ZKG A;  3BR1 A;  2IEK A;  2FJ1 A;  2LFB A;  5M3F J;  1ETQ A;  3K7A J;  2NP3 A;  1IDZ A;  2B63 J;  4BBR J;  2JA5 J;  5E3O A;  2ZOY A;  5IYB J;  3LOC A;  1DU6 A;  1FJL A;  5BNG A;  3OOU A;  1Z77 A;  3G7R A;  1U78 A;  2JWT A;  2G7S A;  1XG1 A;  5IP9 J;  3ON4 A;  4FE7 A;  4NDL A;  3HOW J;  4D7M A;  1X58 A;  4MFE A;  3HOZ J;  4IEJ A;  3JR9 A;  3TED A;  4IHV A;  2K9Q A;  3ON2 A;  4RBO A;  2HXO A;  3RZD J;  3S1M J;  3SDG A;  3LWJ A;  2D6Y A;  3HGG A;  2ME6 A;  2ME0 A;  4MLO A;  1H8A C;  1ZTR A;  2QF7 A;  1RET A;  5IYD J;  4I76 A;  3IUV A;  4A93 J;  3G1M A;  2JA6 J;  3HBL A;  1W0U A;  5EZG A;  1APL C;  5GPA A;  3I4M J;  3RQI A;  3TW6 A;  2KT0 A;  3BNI A;  3DCF A;  3ZQI A;  2GUH A;  3V78 A;  1RKW A;  2NVY J;  2D5V A;  3VVY A;  3O8H A;  3BTJ A;  2IAI A;  2E1O A;  3QPL A;  3FK7 A;  3HE0 A;  3KKD A;  2R93 J;  2N8G A;  3BTI A;  4C2M J;  4IHX A;  4M3F A;  2G7G A;  1GUU A;  3IH3 A;  3IH4 A;  4A3M J;  5D1R A;  1OFC X;  2EZK A;  2JA8 J;  2DMQ A;  3BG9 A;  5EGO B;  2NVQ J;  2VUM J;  3BR0 A;  2ZCX A;  1TC3 C;  5J1U A;  5M5X J;  1MSE C;  2DTZ A;  2LK2 A;  3VPR A;  1WI3 A;  2RAS A;  3HOV J;  2YVE A;  1IG7 A;  5EFY A;  1XS9 A;  2OER A;  2DA4 A;  3VW1 A;  3M3Y J;  1JTX A;  2EQR A;  2XDN A;  2K9S A;  2MG4 A;  3KNW A;  2H8R A;  1JKO C;  3RH2 A;  2L0K A;  5FMP A;  3BG3 A;  3OSG A;  1TWH J;  4GCK A;  3G1L A;  1E3O C;  1MBK A;  4A69 C;  3LSJ A;  4JKZ A;  1HLV A;  2FBQ A;  3LNQ A;  2GLO A;  2JK3 A;  2ECB A;  3IV5 A;  5HAW A;  4B1R A;  5EDN A;  4A3G J;  4FCY A;  2UXH A;  2TRT A;  1QVU A;  3BJB A;  3VOX A;  3IH2 A;  4KWA A;  2VKE A;  2EZH A;  3F1B A;  3BQY A;  3FIS A;  4M3E A;  3HIM A;  4D5F A;  1IUF A;  1ETY A;  1OCP A;  1CQT A;  5E3L A;  2UXI A;  2LKX A;  1ETK A;  4QIW N;  3LSR A;  2JA7 J;  3PAS A;  5K7Z A;  5C4J J;  2R5Y A;  4XRS G;  4DW6 A;  1NK3 P;  3GTG J;  5FKN A;  2ID3 A;  1QPI A;  2PZ9 A;  3Q0U A;  4Y7N J;  3FK6 A;  4M3D A;  4DZJ A;  1B72 B;  5FLV A;  3S1N J;  2DA7 A;  4IHW A;  1UI6 A;  3PPB A;  5FHP A;  3E7Q A;  3HOX J;  5JLW A;  2DA1 A;  3ZQC A;  1FEX A;  2G7L A;  3HM5 A;  3S15 J;  2FQ4 A;  1RES A;  3B6A A;  4UUS A;  4RDU A;  4AC6 A;  3L1P A;  2R0Q C;  3GTP J;  2ELK A;  1PUF B;  1OJL A;  2DA3 A;  2NVX J;  2MSY A;  2RAE A;  3H0G J;  4M3B A;  2X48 A;  3QKX A;  3GTM J;  1FTZ A;  3S1R J;  3KKC A;  3V6G A;  5EF6 A;  5IYC J;  5E3M A;  3JRA A;  3BRU A;  2MW8 A;  5FKL A;  1AU7 A;  1JUM A;  1Y1V J;  2XPW A;  4L5E A;  3H3V K;  2XRL A;  5EZH A;  3JRF A;  4A3I J;  3S5R A;  2XGE A;  4XRS A;  1JT0 A;  4ICH A;  3BR6 A;  3EUP A;  3KZ9 A;  2REK A;  1GVD A;  2L7M P;  2EBI A;  2NS7 A;  4W1U A;  2DMP A;  1MBH A;  2E2J J;  4DYC A;  4JYK A;  1JT6 A;  5M5W J;  3JRE A;  2JN6 A;  2R5Z A;  1RKT A;  2CUF A;  4DYQ A;  2TCT A;  2L7Z A;  1AKH A;  1FIP A;  4HKU A;  3MNL A;  3W6V A;  3JRD A;  3RKQ A;  5J1R A;  3VOK A;  4V2G A;  3CMY A;  2HDD A;  3CJD A;  3GZI A;  3MVP A;  3VP5 A;  4X1E A;  2XB0 X;  1WH5 A;  3NAR A;  5EG0 A;  3A02 A;  5EGO A;  2OI8 A;  3OSF A;  2NOG A;  5EEA A;  2HQ5 A;  5DAJ A;  4MFD A;  1IV6 A;  2EZI A;  4BY1 J;  3JSJ A;  3NRG A;  5IP7 J;  2M9H A;  3ZQL A;  3GTO J;  2M8G X;  3S2H J;  5GPC A;  4DYR A;  1JUS A;  3ZQG A;  3K2A A;  1X2M A;  1LE8 B;  3B81 A;  1HCR A;  3HTH A;  3ANP A;  3VUQ A;  1ETO A;  1U9O A;  2E2I J;  2ZOZ A;  1MBG A;  3BG5 A;  2YS9 A;  1YRN A;  2ZCM A;  1B8I A;  1RR7 A;  3RD3 A;  2E19 A;  3SFI A;  3SJM A;  2QCO A;  2XPU A;  4FTH A;  4C3H J;  2LTP A;  4B3A A;  3DPJ A;  2H1K A;  4A3D J;  1JKR C;  4B4C A;  2QTQ A;  4MK6 A;  2X6O A;  3A03 A;  2XSD C;  3HGY A;  5C44 J;  2F07 A;  4A3J J;  2CJJ A;  2I10 A;  2OF7 A;  2M34 A;  3CCY A;  3BHQ A;  5FKO A;  4EEF G;  2MGQ A;  2L9R A;  1T33 A;  3VW2 A;  3BR3 A;  4A3K J;  3Q0W A;  5J1Y A;  2NX4 A;  3TP0 A;  3A01 B;  3S16 J;  2FD5 A; 
#chains in the Genus database with same CATH topology
 3CQZ J;  1Y8Q B;  4D7N A;  3CC2 I;  1MBF A;  3W6K B;  3LHQ A;  2WAF A;  3T8T A;  5JI6 A;  4PJL A;  2GIV A;  3C2H A;  4MTE A;  2ETH A;  2ICW G;  2HU9 A;  1BW5 A;  3QBM A;  2P6S A;  1XGO A;  2LRE A;  3CC4 I;  2OZ6 A;  5DD8 A;  3I71 A;  3EDP A;  2HPM A;  2E60 A;  1TW3 A;  4RAY A;  2V9P A;  3DEW A;  2X1D A;  2ZFU A;  3K2Z A;  3S14 J;  2UXX A;  3G56 A;  3QPS A;  5H6R A;  2W00 A;  4G6T B;  4CCN A;  1VQM I;  2O7O A;  2COB A;  9ANT A;  4XOP A;  4ZJZ A;  1ZAR A;  4CZC A;  3COA C;  2XKP A;  1J2X A;  1TW2 A;  2RQQ A;  2EZL A;  3T1B A;  3LFU A;  4CSW A;  4E4H A;  4HX8 A;  3IKT A;  1N77 A;  3T8R A;  3KCC A;  4KIB A;  2K7L A;  1FOK A;  1HW1 A;  2WAD A;  3ZQF A;  1O7F A;  1R22 A;  3WTW C;  2LC2 A;  3H35 A;  1YTY A;  4NNJ A;  3VYU B;  2F2E A;  1T98 A;  2KDO A;  1T8I A;  5DM6 F;  3JRB A;  3H3Z A;  1IUY A;  4DJA A;  2CV0 A;  1B9N A;  4RGS A;  2V79 A;  2O8K A;  2V1D A;  2YSR A;  5F0H A;  1R4M B;  3RI4 A;  5F0C A;  4GRI A;  2BHY A;  3F9K A;  5D8L B;  1BW6 A;  2QKL B;  2M2E A;  2WGB A;  1Y0N A;  3HYI A;  5CXG A;  3WU1 B;  2QOP A;  2A5Y B;  5ILV A;  2A05 A;  3GFL A;  4A2U A;  4XKB A;  2XGC A;  3PQJ A;  3KE2 A;  2F4M B;  3IWZ A;  2W57 A;  3HSF A;  4IPA A;  3IL2 A;  3F6V A;  2DMN A;  4I99 C;  3HG9 A;  4Q48 A;  3D1N I;  2W53 A;  3R0J A;  5B1B H;  2NNN A;  3FM5 A;  4ZYA A;  3WHC A;  2Z99 A;  3MN2 A;  2VC1 A;  2G3B A;  3WGG A;  3F6O A;  4LG3 A;  1O7L A;  1NK2 P;  2AHQ A;  2DFH A;  1FSH A;  2HDC A;  4M9S A;  1O4X A;  5JLX A;  3S93 A;  1R9T J;  2CUJ A;  3HOY J;  1MMD A;  2DU9 A;  5HS9 A;  1TWF J;  2Q24 A;  3VW0 A;  2O7T A;  2CQK A;  4UVC A;  2OCC H;  3CP2 A;  2IW5 A;  4RB2 C;  1SVO A;  3LSP A;  3JSP A;  2JVH A;  3EYY A;  1Y39 A;  2HZD A;  1BC8 C;  3LST A;  2F6C A;  2VQG A;  5B1A H;  2H6B A;  2KIU A;  4HA8 A;  5KCM A;  2VBZ A;  3BLY A;  3CCQ I;  3REO A;  1A04 A;  3ECH A;  1I5Z A;  2MAB A;  2ACJ A;  2FX0 A;  1R5I D;  3L00 A;  1WH7 A;  2OPT A;  1BOA A;  5D18 A;  1L3L A;  2JSC A;  1MBE A;  5FGL A;  3KP5 A;  5LRS A;  5DTD A;  3HRT A;  2LR8 A;  5IP6 A;  4FET A;  3S3O A;  3HTJ A;  1YE9 A;  3BCB A;  1U8R A;  2DFF A;  2FNA A;  1S9H A;  4RB3 C;  3WG7 H;  4FX0 A;  1JE8 A;  1K78 A;  3E5U A;  2NVU B;  2KHM A;  2DOA A;  3FIW A;  3JRG A;  2KL4 A;  3E0J B;  3JAM K;  3Q0V A;  4E7Z A;  2E71 A;  1X1A A;  2UXO A;  2FOK A;  3KYD B;  4I02 A;  1OMI A;  2A6T A;  2BBY A;  2GAU A;  3HUG A;  3IWF A;  2X9D A;  2CW7 A;  4EM0 B;  1ZHF A;  1STZ A;  2D2W A;  4RMN A;  4XK4 A;  2UXU A;  3M8F A;  1Q1H A;  1WVR A;  3ZOB A;  2Q0O A;  5CVR A;  1UMQ A;  1HDP A;  2AO9 A;  4CZZ A;  4DQ2 A;  3N05 A;  3GEU A;  3HTI A;  3HRS A;  1BR2 A;  1IV8 A;  1ZRD A;  4MEY F;  1BI1 A;  3LSM A;  3WTT C;  4M72 A;  1QRY A;  2GIZ A;  3FXK A;  3C2G A;  2EK5 A;  4G8X A;  2DI3 A;  2HKO A;  1IO2 A;  1OCT C;  2HI3 A;  2Y9Z A;  2XAQ A;  3IHU A;  3S3M A;  3FMQ A;  3J7Y J;  5K58 A;  4ABZ A;  4C3J J;  4M3G A;  2Z33 A;  1I50 J;  3CO7 C;  1G3T A;  4IRG A;  3RZO J;  2CSO A;  2QKO A;  3GTQ J;  3KZI C;  5JVG F;  4LG0 B;  4IOC F;  1FYK A;  3QU3 A;  2DG7 A;  5D6F A;  2KZG A;  3R61 A;  2K3F A;  1VND A;  2K3P A;  2HOA A;  3CRJ A;  2R7Z J;  3ZMZ A;  3IP4 B;  3SEQ A;  4HBL A;  3C1D A;  3OS0 A;  4E70 A;  2BHZ A;  4IXA A;  2HVR A;  4EMS A;  3CUQ A;  2E36 A;  1Y0U A;  2QA4 I;  4XLE A;  4IHY A;  3BG6 A;  4ACI A;  2GXB A;  5HSZ A;  4AIH A;  3RIR A;  1FYM A;  2VQL A;  1S7E A;  2V1X A;  3PSI A;  3DKX A;  4L9V A;  4IQ4 A;  2EPF A;  3U1D A;  2DA6 A;  2DA5 A;  2W85 A;  3S2D J;  2A69 F;  2WUI A;  2BYV E;  4L0Y B;  1KU9 A;  3HZJ A;  1XCB A;  3M9A A;  4XSX F;  1QZE A;  4HV5 A;  1FOY A;  1XMA A;  2DOF A;  3VYR B;  2XV4 S;  4R1H A;  3FBI B;  3ZMV A;  4UUV A;  1U2W A;  2HYF A;  2LG4 A;  3T6N A;  1LDJ A;  2A6H F;  4GCL A;  2QWT A;  4HZF A;  2EFW A;  2YUS A;  5EYR A;  5AIQ A;  2E1M B;  1GHC A;  1WI9 A;  1ULY A;  3S32 A;  1LE8 A;  2V9V A;  3K10 A;  4XOT A;  3VDX A;  3GXO A;  4AVZ A;  4G94 A;  5E8I A;  1ZR4 A;  2H27 A;  3J7A Y;  3BCG A;  1FC3 A;  5AIP A;  1JUP A;  2HDW A;  4XLP F;  2BV6 A;  2XF6 A;  1XMK A;  1VQP I;  1SAX A;  1JI8 A;  2IEK A;  2LFB A;  2ZSH B;  3K7A J;  1R6R A;  3H0D A;  3H9Q A;  1RC9 A;  5IT3 A;  1R1U A;  4AWX B;  2Q2E A;  5E3O A;  2F4O B;  3LOC A;  4MGR A;  1IN4 A;  1FJL A;  4BEH B;  3BCA A;  1ON1 A;  3Q9S A;  2G7S A;  5F6F A;  3PQK A;  1YJN I;  3E6B A;  3HOW J;  4D7M A;  4MFE A;  3HOZ J;  3KP3 A;  5HS8 A;  1MKM A;  4RBO A;  3RZD J;  4PFP A;  3S1M J;  1R5G A;  3LWJ A;  2E5Z A;  2D6Y A;  3HGG A;  2ME6 A;  4BHP A;  4MLO A;  2BE5 F;  1H8A C;  3F8M A;  1RET A;  2XAJ A;  3S2W A;  4A93 J;  1KU3 A;  1A36 A;  5AQC A;  1VQN I;  1LUJ B;  4PDK A;  1ZRF A;  5GPA A;  1HA8 A;  2EWN A;  3KEQ A;  3V78 A;  2FA5 A;  1B59 A;  2FNP A;  3DCF A;  3ZQI A;  4LFU A;  5ILU A;  2GUH A;  2NVY J;  4M6Y A;  2Z5U A;  2X85 A;  1T39 A;  1DPU A;  2IA2 A;  3E6M A;  3BTJ A;  4UB6 C;  3BJO A;  2E1O A;  3QPL A;  2R93 J;  2FE3 A;  2AXT C;  3BTI A;  4RAG A;  4M3F A;  4XLN F;  1GUU A;  3P9K A;  1JHH A;  3MMY B;  3BG9 A;  2VT2 A;  5EGO B;  2DQL A;  2VJ5 A;  3OYN A;  4HF2 A;  1V5G A;  2R7Q A;  5J1U A;  2ZJP F;  5BPD A;  1WSU A;  2VPL A;  1SD6 A;  3EYI A;  3HOV J;  2YVE A;  4WXC A;  1OR7 A;  2Y75 A;  4FAS D;  3GFI A;  2DA4 A;  3GCM A;  3TO6 A;  4KFC A;  1JTX A;  1TBX A;  3DLL F;  5EEG A;  4YII A;  1KQ0 A;  3K9T A;  2H8R A;  4OIP F;  1YS7 A;  3FX3 A;  2L0K A;  3BG3 A;  4IVN A;  3OSG A;  4I09 A;  1MBK A;  4A69 C;  3LSJ A;  4QPO A;  3KX2 A;  3T0Y A;  4JKZ A;  1X3W B;  2ECB A;  2X4H A;  5AON A;  3IV5 A;  1VQ6 I;  1R58 A;  4B1R A;  4A3G J;  3DPU A;  2W4S A;  3VOX A;  4B8X A;  2EZH A;  1KZH A;  3FMS A;  1S3J A;  1IRX A;  2PMU A;  3S8P A;  3I9V 2;  5K5R A;  3BQY A;  3SYT A;  4M3E A;  4D5F A;  1IUF A;  1ETY A;  3E97 A;  2IVM A;  2W25 A;  4C30 A;  1ETK A;  2JA7 J;  3LSR A;  2QSF X;  5C4J J;  4HV6 A;  4DW6 A;  2K4J A;  1IXR C;  2ID3 A;  1QPI A;  1ZG3 A;  2PZ9 A;  3KZY A;  1JGS A;  3TMO A;  3FK6 A;  2COM A;  3B02 A;  4DZJ A;  2M7A A;  3PPB A;  3BZK A;  5ED4 A;  3HOX J;  5DCM B;  3ZQC A;  2M5W A;  3HM5 A;  4A6E A;  3I3L A;  3KEY A;  4HF0 A;  3OYF A;  5FRM A;  4AC6 A;  3MCZ A;  2WWY A;  3L1P A;  5E79 C;  4L18 B;  3FDY A;  3RPU A;  4RGX A;  4KIF A;  2ELK A;  4MNU A;  2MSY A;  4F7Z A;  4BU2 A;  1RIO H;  2DYR H;  4M9Z A;  3HPH A;  4MTD A;  3V6G A;  3ESW B;  2RQP A;  5EF6 A;  2K9M A;  2EV0 A;  3JRA A;  1S72 I;  3CC7 I;  3BRU A;  2F5V A;  1SFU A;  2ZY9 A;  1Y1V J;  3DQV C;  1T95 A;  3HRM A;  1BBY A;  4I01 A;  3GZ6 A;  1JT0 A;  3KZ9 A;  2REK A;  2R4G A;  1WWX A;  1GVD A;  1QO0 D;  4W1U A;  3LWF A;  5CKT A;  1LEB A;  1LFP A;  3KIO A;  4JYK A;  2Y48 A;  3LA7 A;  1JT6 A;  3FXM A;  4AYB A;  3ZGK A;  2BY2 A;  2XF5 A;  1OCO H;  2FML A;  2W1O A;  3CZ6 A;  3W6V A;  1Z21 A;  3RKQ A;  3T5X A;  5J1R A;  4V2G A;  2D45 A;  2B1E A;  3CUO A;  2DOD A;  2DQR A;  2QWW A;  5LHH A;  1H0M A;  1LQ1 A;  3CMM A;  3W2A A;  4KNY A;  2G9W A;  4KMU X;  1SEU A;  3HHH A;  3OSF A;  2XC7 A;  4RGR A;  5EEA A;  1XDS A;  4YEJ A;  1IV6 A;  1HW2 A;  3C18 A;  2ZXJ A;  3MWM A;  1SD5 A;  4HYE A;  1JUS A;  4GGG A;  3QP5 A;  3VUQ A;  3HTH A;  1J0R A;  1MBG A;  4RGU A;  1MDM B;  1C0W A;  5KAI C;  2ZCM A;  1P4A A;  2ZCW A;  3RPU D;  4Y17 A;  4ZC3 A;  1PDN C;  3KFW X;  2W84 A;  4OIN F;  1X1P A;  1QPM A;  4Z2Y A;  3D5S C;  1N25 A;  1YW7 A;  4LG0 A;  1EH7 A;  3BPX A;  2JQ7 A;  4MK6 A;  3RYR A;  2XSD C;  4NC6 A;  2KRC A;  1NH3 A;  4QWQ A;  3PFI A;  2F07 A;  3QOE A;  2I10 A;  4F92 B;  4F52 A;  4P9F A;  2HEO A;  4CIC A;  1QA6 A;  2Z9O A;  4FHT A;  1UJ8 A;  4A3K J;  2NX4 A;  1X3U A;  1HDD C;  2DXI A;  4WWC A;  3I4N J;  4L62 A;  2XDV A;  4HST A;  3OYA A;  2HOS A;  2PLY A;  1F43 A;  4LB5 A;  4DIQ A;  2IBD A;  4BH9 A;  1ZGW A;  4BNC A;  3SHF A;  1ZGJ A;  2PJP A;  1P9Q C;  1T6S A;  1FP2 A;  2XAF A;  3C3W A;  3U2R A;  3PO3 J;  2V7F A;  4E7J A;  1MH3 A;  2IA1 A;  3S3N A;  4HAM A;  1KGS A;  2P0W A;  2XGD A;  3L2W A;  1G3S A;  2KJB A;  2O3F A;  3H3U A;  3MQ0 A;  2IGK A;  3FXU A;  3ZXS A;  4JP0 A;  3OYB A;  2ZC2 A;  2LY2 A;  1HOM A;  1FWZ A;  1XSD A;  3WTX C;  1HKS A;  2FJI 1;  2EFN A;  4IOA F;  4XLC A;  1SFO J;  1W7P B;  5D4R A;  3M8J A;  4LIU A;  4X0G A;  2KFD A;  2ZXW H;  3LSK A;  2IGO A;  2OC6 A;  4ANJ A;  1E2X A;  3VEP A;  4BL0 B;  5IOY A;  4D5C A;  3N97 A;  5BMZ A;  1XGN A;  1E3H A;  1VF9 A;  2FSW A;  2ELH A;  3PSF A;  2D1V A;  2VBX A;  3R60 A;  4QTR A;  4Y4R A;  3GUD A;  2MYS A;  3HB9 A;  2VON A;  2XGX A;  4CHU A;  5CVJ A;  5DEQ A;  1H88 C;  1P7J A;  3NQO A;  4BEH A;  4RM2 A;  3L09 A;  1U9N A;  3DTE A;  1IRG A;  3WGH A;  1HW5 A;  2HQA A;  5C3E J;  3AQS A;  2MC3 A;  2L7F P;  2K9N A;  4PUS A;  3RDI A;  3HKZ A;  4AUX A;  5K7H A;  2DDA A;  1ETV A;  2J5O A;  1JJ6 C;  3M4O J;  1A6Q A;  1KYZ A;  1JJ8 C;  1WPK A;  2LY9 A;  4MQ9 F;  2ADU A;  1UHS A;  1SFX A;  2DYS H;  5LLQ A;  3E6C C;  1R71 A;  2CQX A;  1W5T A;  1ODD A;  2VI6 A;  2R5Y B;  3OYC A;  4N9I A;  3F3X A;  5H9T A;  2HR3 A;  1V3F A;  2UXN A;  4PZJ A;  1AWC A;  4AC0 A;  5J8F A;  2NS8 A;  1F36 A;  4PJJ A;  3JTG A;  2YU9 J;  4UDS A;  4ZTF A;  3G73 A;  4PXI A;  2VQC A;  2CW8 A;  3CES A;  2KRF A;  3QU6 A;  5C4X J;  4XIC A;  3HHG A;  1J75 A;  1U5T B;  2XAS A;  3HTU A;  3PM1 A;  3WG9 A;  4KIS A;  2H1L A;  1LFB A;  4S0H B;  4HX4 A;  1T2K A;  5J6X A;  3TP3 A;  3UKG A;  4K2E A;  2WAQ A;  5E3N A;  3IUO A;  3BPV A;  5BPI A;  2PFV A;  3DBL B;  2YX4 A;  3O60 A;  3AL0 C;  2V9K A;  2XHK A;  3EUH C;  5GAG J;  3A2K A;  1SD7 A;  2QVO A;  1G4D A;  2CV2 A;  3OYD A;  5D8K B;  4GCT A;  3Q3S A;  1XSX A;  1YI2 I;  2WB1 N;  1PJR A;  1T56 A;  2M87 A;  5FKK A;  3ANG A;  4YZE A;  5DD4 A;  3B6C A;  1GXQ A;  4NBQ A;  3A01 A;  3MEX A;  3K4K A;  2E35 A;  5HLI A;  1A35 A;  2PJR B;  2QEN A;  4KN7 X;  4F55 A;  1TQI A;  1XCV A;  1Z3X A;  2EA4 A;  1RUO A;  2Z16 A;  1V4R A;  5CVV A;  4UHT A;  4C2T A;  2DMU A;  3AFH A;  1SAN A;  2BXY A;  3CJN A;  3FZV A;  5IY5 H;  1K83 J;  4C3I J;  4KMF A;  1TTY A;  1MH4 A;  3WU0 A;  5HOD A;  3L2V A;  2DA2 A;  2BW3 B;  2PBI A;  4OD5 A;  5DM7 F;  5EG0 B;  1KU7 A;  1KQ8 A;  3HRU A;  4IRI A;  2J5P A;  5FLX Z;  2VKD A;  2ZXI A;  3BT9 A;  2Z2S B;  3BQZ A;  4G12 A;  5HBU A;  4JX5 A;  4BUP A;  4IHS A;  5DCM A;  3Q9V A;  3MZH A;  4LLG F;  2CFO A;  2QEX I;  3VYS B;  3PO2 J;  2IS6 A;  1W36 D;  3HTS B;  2CFX A;  4BDY A;  1RI7 A;  2VKV A;  4XLH A;  1ZR2 A;  1MMA A;  2Y9Y A;  3VYT B;  3OYL A;  3C2B A;  4XN3 A;  2XAU A;  1YRN B;  1F5T A;  1FY7 A;  1B8I B;  5E1Z B;  1W0T A;  1R49 A;  3COL A;  3E1S A;  3PUF A;  1UAA A;  1FP1 D;  1Y56 A;  1YS6 A;  1IAW A;  5LGN A;  4ESF A;  2F5D A;  1Q1V A;  3ONQ A;  4TV7 A;  3AG3 H;  1ZLK A;  3FMR A;  4EGZ A;  1JKQ C;  2DMT A;  1P7I A;  2WC2 A;  1EKE A;  2ZJR F;  3LA2 A;  4IX7 A;  5FD5 A;  3ZR8 X;  1WJE A;  2R92 J;  1Z3Y A;  2DOE A;  2CQQ A;  2A07 F;  2VAS A;  3JRC A;  4EJV A;  1AHD P;  2RVC A;  3FXO A;  5IPA A;  5CQG A;  1ETX A;  1JGG A;  2R7W A;  3K4M A;  4MXM A;  4G7O F;  3KZZ A;  3F0C A;  1D0Y A;  3DWL E;  4CCK A;  4DZP A;  5HDN A;  4LMY A;  4A3L J;  3WHB A;  1Y8R B;  2RNG A;  1YJW I;  1VQ4 I;  5GP9 A;  1WJC A;  4CCJ A;  4CYC B;  3BR5 A;  4PK4 A;  2PBX A;  2IS4 A;  3H1C A;  1YLF A;  3WTS C;  5DS9 A;  2L9S A;  2K40 A;  4WX9 A;  3M1C A;  2HGC A;  3P9T A;  3P7N A;  2OBP A;  3GTK J;  3PNT A;  1QZY A;  3OYG A;  1O3Q A;  1DU0 A;  2G7H A;  3G6E I;  3G1O A;  4S04 A;  2XRO A;  1MDM A;  4JX4 A;  3EGQ A;  5KVR A;  1ZKG A;  3K0L A;  4ENK A;  5M3F J;  3TO9 A;  2NP3 A;  1X1D A;  1V55 H;  1P2F A;  4HQE A;  1IDZ A;  3D0S A;  1XTA A;  4EJW A;  2JA5 J;  4N4O B;  4U88 A;  2DFE A;  4BJT A;  1KQ9 A;  2IXS A;  5BNG A;  3OOU A;  1Z77 A;  2ZKZ A;  3CO6 C;  2A6E F;  5FRO A;  2R7O A;  4OAY A;  2MD0 A;  2PMH A;  5IP9 J;  3ON4 A;  2RV8 A;  1TT5 B;  4CA0 A;  3ABU A;  1P4W A;  3JR9 A;  1LDK B;  3TED A;  3FXJ A;  3CCE I;  3SDG A;  1P92 A;  3A0B C;  1G59 A;  2STW A;  2ME0 A;  5J40 A;  1ZTR A;  2QF7 A;  2O03 A;  1MGT A;  4I76 A;  2KIF A;  3K69 A;  3IUV A;  1TQP A;  3FM3 A;  1W0U A;  3PNV A;  3RJP A;  5TJJ A;  2IJL A;  3TW6 A;  2KT0 A;  2EV6 A;  2L3D A;  3WTY C;  2D5V A;  2VBW A;  5JHF A;  3BZ6 A;  2ZNZ A;  3QWL A;  3V7C A;  1MMS A;  3FK7 A;  4IHT A;  1G8X A;  5H6Q A;  3ZMT A;  2N8G A;  3VB2 A;  4A5N A;  4C2M J;  4IHX A;  1K6O A;  1S7A A;  3FXR A;  2EZK A;  5CJ9 A;  4E6K G;  2DMQ A;  4BHC A;  1J5Y A;  2VUM J;  4IO9 F;  1W7P A;  1TC3 C;  5M5X J;  2ZSI B;  2D1H A;  4EJU A;  2KLO A;  5J8C A;  3H9J A;  1UG0 A;  3VW1 A;  2FU4 A;  4AIK A;  2ZME B;  3A4C A;  5J47 A;  2V26 A;  3RH2 A;  2AQF A;  4GXO A;  1E3O C;  4AID A;  5L3E A;  1J59 A;  2M4K A;  3I54 A;  3NS4 A;  1HLV A;  4YEL A;  2JK3 A;  3K6G A;  4A0Y A;  1ONV A;  4CCL A;  3BJB A;  1QVU A;  1V5E A;  2O0Y A;  3CDH A;  3IH2 A;  4KWA A;  2PI0 A;  1Z7U A;  4NUB A;  3P9C A;  2PG4 A;  4YIR X;  3F1B A;  4NC8 A;  3FIS A;  3HIM A;  1S29 A;  2RGV A;  1OCP A;  1CQT A;  2UXI A;  2PMZ A;  1KU2 A;  3F8C A;  3TGN A;  3WGI A;  2LKX A;  5HDG A;  3PAS A;  1QBJ A;  2R5Y A;  4XRS G;  3TOA A;  1DUX C;  5CPR B;  3A0H C;  5JFR A;  2EA2 A;  1B72 B;  1G3Y A;  3S1N J;  1R5H A;  5FLV A;  1VQL I;  2DA1 A;  3ABM H;  4YFN F;  1U3E M;  2JUC A;  1FEX A;  2FOW A;  4EVI A;  1U5T A;  3WTZ A;  4CO8 A;  3B6A A;  4RDU A;  5K5O A;  1QHG A;  1R00 A;  2X6X A;  4LIT A;  1X1C A;  4AVP A;  3I53 A;  4EJO A;  1W5C C;  2CS3 A;  4QPQ A;  3CF5 F;  1OJL A;  2KKO A;  4XL9 A;  3ZQQ A;  1W7P D;  2RAE A;  1LPQ A;  2FBK A;  4M3B A;  1Z05 A;  1ZG1 A;  4ZH4 F;  1FTZ A;  3KKC A;  3KET A;  3BOQ A;  5LRR A;  4XN0 A;  3QP6 A;  5FKL A;  1AU7 A;  1JUM A;  2JVG A;  2VIX A;  2XPW A;  1YYV A;  3FXQ A;  4L5E A;  2NS0 A;  5EZH A;  4A3I J;  4XRS A;  1WRJ A;  4ICH A;  2NAZ A;  4UV9 A;  1XDU A;  2KIS A;  3IKV A;  2NRA C;  3G3Z A;  5ICE A;  4J01 A;  2NS7 A;  3MZ8 A;  2VOO A;  1I1G A;  2PJR A;  2DMP A;  2OUM A;  1H9T A;  1MBH A;  2A68 F;  3L7W A;  4DYC A;  4OMY A;  2OAZ A;  2XRN A;  3WE2 A;  3I64 A;  2L54 A;  2X6W A;  4OD4 A;  5E1W A;  4KT6 A;  1RUN A;  2E1N A;  2V4J C;  1FBQ A;  2GZW A;  4DYQ A;  1K6Y A;  2TCT A;  5JHU A;  2V6E A;  4YG2 F;  1IN6 A;  5GTI C;  2UWM A;  2R7X A;  2P5L C;  4HKU A;  3JRD A;  1S7O A;  2CMP A;  1KYW A;  4B43 A;  3VOK A;  2QSG X;  4V19 K;  1HSJ A;  2HDD A;  3D5R C;  3GZI A;  2AQE A;  2BW3 A;  2ZO4 A;  2XB0 X;  2WY8 Q;  3CUQ C;  3CLO A;  3NRV A;  4M6X A;  1WH5 A;  5EG0 A;  1VQ8 I;  3A02 A;  5LFA A;  3ZPL A;  4O5V A;  4L0Z B;  2BY0 A;  3DU6 A;  2NOG A;  3F21 A;  4AIJ A;  2HQ5 A;  3GFJ A;  5DAJ A;  1B4A A;  4EQQ A;  2EZI A;  4WCG A;  3NRG A;  5JR3 A;  3NWT A;  5HLG A;  3FKJ A;  4Y13 A;  1KA8 A;  3GFM A;  1MMN A;  4Q47 A;  1LEA A;  3RTR A;  4L5I A;  3ANP A;  1ETO A;  2ZOZ A;  3ASN H;  2JA2 A;  2FRH A;  3CCJ I;  1YRN A;  4L9J A;  1B8I A;  4B3X A;  5LEJ A;  2M3A A;  2E19 A;  3KLO A;  1S8N A;  1OCC H;  4HW0 A;  4N9H A;  4FTH A;  4KIC A;  2LF7 A;  3OY9 A;  5E17 F;  3DXJ F;  3NWS A;  4B3A A;  4CCO A;  2PX9 A;  2V1N A;  1JKR C;  4N4N B;  1U6G A;  3TDU C;  3RKY A;  3PJR A;  5FFZ A;  4A3J J;  1QU3 A;  2M34 A;  5E8G A;  3FF5 A;  3BHQ A;  3DF8 A;  1HXD A;  2MGQ A;  2HQR A;  1T33 A;  4RAZ A;  3KP6 A;  3FBN B;  3TP0 A;  5J1Y A;  3A01 B;  3HOT A;  1H89 C;  1ORK A;  3BJA A;  4OOI A;  2KP6 A;  3L9F A;  4HEA 2;  3G4S I;  3WE3 A;  2GOX B;  3GF2 A;  1MW7 A;  4PJN A;  2LLK A;  1W4M A;  2JPB A;  3GZ5 A;  4B48 A;  3S17 J;  2Z3Y A;  3LSH A;  5ERI A;  4HQM A;  5F64 A;  1JTY A;  3ZQ7 A;  2E1C A;  2IS1 A;  2LRD A;  1OKR A;  2M1B A;  2LDU A;  1T0F A;  2MD5 A;  3NAU A;  2IT0 A;  4A6D A;  3LSG A;  5FJ8 J;  4NQW B;  1Z0X A;  5LEK A;  1GV2 A;  1AOY A;  3R0A A;  5F0F A;  3TDZ C;  5GTH C;  4CYC A;  3L2Q A;  2KZV A;  3VTI A;  4DVY P;  3DKY A;  4XM3 A;  1TNT A;  3AG2 H;  4M73 A;  3M1E A;  1YJ9 I;  1FT9 A;  2HVS A;  3GLL A;  1TWA J;  3BDD A;  4JQF A;  2RN7 A;  5E20 A;  2YVX A;  2DJN A;  2PQ8 A;  4MO7 A;  4W97 A;  4Y15 A;  1ETW A;  3C7J A;  4G6D A;  2MBF A;  2EB7 A;  3LQQ A;  1A6I A;  3QQA A;  2DG8 A;  3E3V A;  1O3T A;  3O8G A;  4IQJ A;  2K85 A;  3BTL A;  1UST A;  2MA3 A;  3LSI A;  1HKT A;  1UHM A;  1Z7L A;  4NHJ A;  3WTV C;  2OCE A;  3HEF A;  3CD6 I;  5D5V B;  2CH0 A;  3GYH X;  4G7H F;  3CJT B;  2BZT A;  2R7U A;  4LD5 A;  3HOS A;  3KYC B;  4A5M A;  1I39 A;  1OR7 C;  1TZL A;  3V8L A;  2VJJ A;  4HLY A;  5CYV A;  1FX7 A;  4X6A J;  1BI2 A;  3CCM I;  1U0J A;  3GLX A;  2O6G E;  3HJE A;  3MAJ A;  1NG6 A;  4XR6 A;  2YU3 A;  1D0X A;  3SZT A;  1I1S A;  4NEL A;  5D5X B;  4AYB N;  3DTK A;  4C9Y A;  1UI5 A;  5F04 A;  4D1Q A;  5LGU A;  1VQ9 I;  4OWR B;  2EFO A;  2CU7 A;  3H36 A;  1V54 H;  2Y30 A;  4A3F J;  1CGP A;  2VL8 A;  3RQ4 A;  3ECO A;  3DBH B;  2ZBK A;  1YFH A;  1MD0 A;  3FHN A;  1BIA A;  4ON0 A;  3BRO A;  5M5Y J;  1FOX A;  2OTL I;  2EV5 A;  1XPX A;  4PJM A;  5GAH J;  4OMZ A;  5DYM A;  4PFO A;  4DBQ A;  1K4S A;  2JMW A;  4ME9 A;  1YQA A;  2HPI A;  3QOD A;  2XAH A;  2EFP A;  3ZN1 A;  2KDZ A;  1TL8 A;  2X0L A;  5IOZ A;  4KN4 X;  1FLI A;  3GVA A;  5H2F C;  1DQU A;  5KAF C;  4NN1 A;  4MHG A;  5BS6 A;  4BE2 A;  2LF8 A;  3AG4 H;  3DPT A;  2VKH A;  2JTV A;  3EUK L;  3ZMD A;  3C07 A;  2E5N A;  1I6X A;  3KEO A;  5HLT A;  3I59 B;  4WIB A;  2F5F A;  1SGM A;  2DFI A;  2ZME A;  5C4Y A;  5K1Y A;  4U0Y A;  4H4K C;  2GA1 A;  3E5Q A;  1O3R A;  3QAH A;  5M3M J;  3ZQH A;  2DLL A;  1UG2 A;  3RKX A;  2F5C A;  3CCV I;  4RS8 A;  3J80 Z;  3AQT A;  3GME A;  2WV0 A;  1JHF A;  2HZT A;  3H5A A;  5D4S A;  4A3B J;  3M07 A;  4M74 A;  3PIO F;  2R5Z B;  2LP0 A;  4LLN A;  1D3Y A;  2LY1 A;  1WJB A;  1MSF C;  1WKM A;  4BKX A;  4I6Z A;  1QVT A;  1BJZ A;  3JSO A;  2K86 A;  1WHU A;  2P7V B;  4CCM A;  2B9S A;  2L01 A;  5B3S H;  2EH3 A;  2WAE A;  2X1E A;  3K1M A;  4II3 A;  2A5W A;  3QPT A;  1IDY A;  4A12 A;  4FE4 A;  1WJA A;  4P1W A;  1B72 A;  1BA5 A;  2CG4 A;  2H94 A;  2R7F A;  1XC5 A;  2XF7 A;  2ZXH A;  4P5O A;  2CWE A;  2QIB A;  2PFB A;  2E7X A;  2CV1 A;  3VVX A;  4HNT A;  4GYI A;  5K7F A;  2UXP A;  4HG2 A;  3HC7 A;  2GFN A;  2OTJ I;  1F1Z A;  4U9N A;  2HOT A;  1VQO I;  2AS5 F;  2O9L A;  2GM4 A;  4JNN A;  4GFB A;  3ZCO A;  1DDN A;  4HF1 A;  1FYL A;  4H0E A;  4J19 A;  3NPI A;  2JJ7 A;  3RPQ A;  2HKX A;  2VPR A;  2MH9 A;  3GTJ J;  1YHQ I;  2DPD A;  1FIA A;  2QQ9 A;  2X1C A;  4KIG A;  4HLX A;  4XBF A;  4BE1 A;  5BQT A;  3H5N A;  5FLM J;  1JKP C;  4U7B A;  2XPV A;  1GV5 A;  2H6C A;  1I6H J;  3LJL A;  2ZCN A;  1LNW A;  1BOB A;  2LSO A;  1B1B A;  3CCU I;  2RKH A;  5D19 A;  2Y0S N;  3HKZ N;  3QOP A;  2P81 A;  4BHB A;  1MMG A;  4BXX J;  3CME I;  2DCE A;  1ENH A;  2DDB A;  4B44 A;  2Y0S A;  3VOD A;  2NP5 A;  3S1Q J;  4ESB A;  3HL2 A;  4KDP A;  2BOL A;  1TP4 A;  2HYJ A;  3FWE A;  3D5L A;  4RM3 A;  1YX5 A;  4O6J A;  2ESN A;  2P8T A;  2VQH A;  2RHA A;  2GOM A;  2M0C A;  4CGR A;  4ZYE A;  5F27 A;  1WGX A;  1G2H A;  2LH9 A;  2O61 A;  4IJA A;  1OCZ H;  2FF4 A;  1ITY A;  1SC7 A;  1WCM J;  3TOB A;  1EH8 A;  2QQB A;  2WAQ N;  2OQR A;  2PEX A;  2QYO A;  5FKM A;  1A5J A;  2LKP A;  3OIO A;  4XNF A;  1HQC A;  1R4N B;  3BR1 A;  4EM1 A;  4E7I A;  5KNL A;  1P6R A;  1V5F A;  1SVM A;  2JZY A;  3LMM A;  3PUB A;  2O8X A;  2DO7 A;  3OL3 A;  3WTU C;  2B63 J;  4WF2 A;  4OIQ F;  4BBR J;  2ZOY A;  3DKW A;  4AD9 A;  4J00 A;  3OIP A;  1OLT A;  1QNT A;  4BQN A;  2E1M C;  3VWB A;  3LL7 A;  5LHI A;  4IRH A;  5HS7 A;  1RR8 C;  1WJ5 A;  4FE7 A;  4NDL A;  1FZP B;  2VE8 A;  1UHW A;  1XD7 A;  3W2W A;  6PAX A;  4IEJ A;  4E7K A;  1A31 A;  4IHV A;  4ZYH A;  3V8J A;  3QYB A;  3GX4 X;  4C2U A;  3V4G A;  2WY7 Q;  3NEU A;  1OIS A;  3G1M A;  2OA4 A;  4XMY A;  3BZC A;  4YRV A;  5EZG A;  1D1B A;  4I2O A;  3I4M J;  3RQI A;  3V8K A;  1RKW A;  3V7S A;  1R1T A;  3VVY A;  3FHZ A;  3O8H A;  4BXF A;  4CDG A;  5HDK A;  1ON2 A;  1UEL B;  4KA4 A;  2IAI A;  4CUG A;  2OZU A;  3HE0 A;  4NQW A;  4XOR A;  1MNE A;  3JTH A;  4UB8 C;  4AU7 A;  3DV8 A;  3IH4 A;  5J4Y A;  4A3M J;  1OFC X;  2JA8 J;  3OS2 A;  1B6A A;  1DGW Y;  4UNO A;  3BR0 A;  4XLA A;  2DTZ A;  5KK1 A;  5DDG A;  4HPQ A;  2RAS A;  5LHG A;  5L3G A;  1W36 C;  3P5J A;  2XVC A;  1RZ4 A;  3U1K A;  5EFY A;  1EA3 A;  1XS9 A;  2OER A;  5E18 F;  2R7S A;  3M3Y J;  2Y0M A;  3N4M A;  2WBM A;  5DUK A;  4F3Q A;  2EQR A;  2MC4 A;  3LAJ A;  2XDN A;  2K9S A;  4CH7 A;  2VN2 A;  3ZMU A;  4Z6Y A;  4HRI A;  2YR2 A;  1TWH J;  4XON A;  3G1L A;  2K5C A;  4ZDL A;  1R7J A;  1IW7 F;  2FBH A;  2LOO A;  1IXC A;  2CQ7 A;  4WK8 F;  3LNQ A;  2RRE A;  4G7Z F;  1ZYR F;  2FBQ A;  4BS9 A;  2UXH A;  3ABT A;  5HVQ C;  4FCY A;  1WQ2 A;  3G2B A;  1OCR H;  1Z9C A;  1WJD A;  2VKE A;  1J7K A;  3ABL H;  3E5X A;  1REP C;  1D0Z A;  1T08 B;  1XB4 A;  1IXS B;  4KIT B;  1Z1D A;  3DEE A;  2ZJQ F;  3WOD F;  3HXL A;  5LD2 C;  2HOE A;  3RYP A;  4ZTJ A;  4HSR A;  1BI3 A;  1OYY A;  4QIW N;  4XKW A;  3GTG J;  2CUZ A;  1NHA A;  3JCU C;  2DW4 A;  4Y7N J;  1ZG5 A;  1BI0 A;  4WXH A;  5EEH A;  5FHP A;  2VXD A;  2A61 A;  2DA7 A;  2JRT A;  1YW8 A;  2QQ8 A;  3ULQ B;  3MKY B;  4IHW A;  3E7Q A;  2JSP A;  2XSJ C;  2HNH A;  4OU0 A;  2G7L A;  3BC8 A;  3KLN A;  5FFX A;  1MND A;  3S15 J;  3OYM A;  2RNJ A;  5L3C A;  1OYW A;  1PP8 F;  1K4T A;  1VQK I;  3LFK A;  2GA2 A;  3MD2 A;  1NG7 A;  2CW0 F;  4PSW A;  1Z67 A;  3CF2 A;  2R0Q C;  2IRF G;  1PUF B;  3IC7 A;  3SZP A;  3HSE A;  3ZN0 A;  3H0G J;  1S5L C;  5CQE A;  2X48 A;  3QKX A;  3GTM J;  3S1R J;  5E3M A;  2GQQ A;  3I59 A;  5H20 A;  2QKM B;  3JRF A;  4IKF A;  3BR6 A;  2ZJ2 A;  3W2V A;  2L7M P;  1Z91 A;  2EBI A;  3VOE A;  1L0O C;  2HWV A;  3OOP A;  4O3M A;  2IS2 A;  2JN6 A;  4LB6 B;  2R5Z A;  2CUF A;  4ZYG A;  2OQG A;  1XGM A;  1MJ9 A;  1O57 A;  2IP2 A;  3VFZ A;  2CGP A;  2L7Z A;  2BVL A;  3U9G A;  3DBR B;  3LAP A;  1UFM A;  4MEX F;  1YIO A;  3CMY A;  4XSZ F;  5FGM A;  1YW9 A;  4A0Z A;  4P9U A;  2P5V A;  1X19 A;  3LA3 A;  3MVP A;  3VP5 A;  4X1E A;  3V7R A;  2UUZ A;  2EIN H;  3NAR A;  2OI8 A;  4NB5 A;  5A2Q Z;  1WJF A;  2TDX A;  3OWT A;  2QBY B;  1BC7 C;  4KYW A;  2VOP A;  3X2Q H;  3JSJ A;  1QHH D;  3I58 A;  4UV8 A;  2M9H A;  4YIF A;  5IP7 J;  3ZQL A;  1VZ0 A;  3GTO J;  2KRH A;  4A0X A;  3S2H J;  5GPC A;  2V6C A;  1TLH B;  4G6Q A;  4IZZ A;  2LBF B;  1IN7 A;  2Z1D A;  4ENM A;  5HLH A;  3QPH A;  5IT9 Z;  4BGD A;  3B81 A;  5L3D A;  1E3P A;  1PUE E;  3DFG A;  4LGW A;  3R6S A;  4E7S A;  4BAY A;  1RR7 A;  4D0P A;  3RD3 A;  2VJ4 A;  3SFI A;  3SJM A;  2W24 A;  3ZRG A;  3J80 K;  4Q5S F;  2L5Q A;  2XPU A;  1K7A A;  4C3H J;  4GDF A;  2MLG A;  2LMD A;  3ERE D;  2L4A A;  2QTQ A;  4G9Y A;  2X6O A;  1ZRC A;  3HGY A;  4OIR F;  5C44 J;  5GAE J;  1BR1 A;  3CCY A;  4UVA A;  4II2 A;  2XAG A;  4I0B A;  1Z6R A;  3BR3 A;  2K4B A;  5CVI A;  2H1K A;  3S16 J;  3HOU J;  1MJA A;  4HNV A;  4IF4 A;  5TIS C;  2DN0 A;  4DGW B;  1K61 A;  1X4O A;  4IL6 C;  5ICG A;  1BL0 A;  2AXL A;  2DPU A;  3JW4 A;  1RPW A;  1Z6T A;  4WXD A;  5CW8 A;  2PMZ N;  4M6V A;  4D9J A;  1ZGA A;  2STT A;  3I55 I;  4DBR A;  4DOZ A;  4UY8 I;  4ZDO A;  2Y31 A;  5TRD A;  2HTS A;  3SEZ A;  4XRM A;  1X3Z B;  2KIQ A;  2NYX A;  3W3C A;  2UZK A;  3FRQ A;  4NC7 A;  1ERD A;  5D6E A;  2ISZ A;  1X1B A;  2L9N A;  2KPM A;  2XKO A;  3DTI A;  3SDB A;  3OYJ A;  2DT6 A;  3QRF F;  1FTT A;  1IC8 A;  1FBU A;  1GDT A;  3PFY A;  3ZP5 A;  1ZAO A;  4Y3O A;  3TW7 A;  3KPH A;  1FMW A;  1GVJ A;  1ZK8 A;  1P4X A;  3CLQ A;  2OV7 A;  4XRF A;  1TWG J;  3AAF A;  1RNL A;  1MZB A;  4A3C J;  2GXA A;  5ILS A;  4UUT A;  4PGG A;  1QGP A;  3TL4 X;  3AG1 H;  4E7L A;  3GEZ A;  3HPG A;  1VQ7 I;  4HX7 A;  4PJ0 C;  4U9L A;  5DCF A;  3FXL A;  1VQ5 I;  2ID6 A;  1GT0 C;  2NXN B;  1VTN C;  3AKZ A;  2RDP A;  2M0M A;  2X51 A;  3VSL A;  1YO5 C;  2OU2 A;  2BXZ A;  2YX7 A;  4B09 A;  3NNR A;  1NTC A;  4Y52 J;  2LVS A;  1D8J A;  3O6B B;  3GBG A;  1SMY F;  3L2R A;  4L9N A;  4EJT A;  1MNM C;  2P4W A;  3K1N A;  2QZ8 A;  2QQA A;  2JT1 A;  3SFZ A;  4CXF A;  5F1R A;  3HIF A;  3JRH A;  2E7W A;  1R23 A;  3OS1 A;  4JL3 A;  1WFX A;  3F8N A;  4RLF A;  5HNH A;  4R79 A;  1LVA A;  2Y69 H;  4PCQ A;  1OPC A;  2IPQ X;  3F23 A;  1FOW A;  4BBS J;  3K4J A;  1PVE A;  4BYY A;  4Q4Z F;  3BG7 A;  1YOV B;  2XB5 A;  1OQY A;  4LK0 F;  4XLF A;  4YFK F;  2Q1Z B;  4EGY A;  1G6N A;  2E34 A;  5BOX A;  1F9N A;  3AL0 B;  2ISY A;  4U0W A;  2K9L A;  3GW2 A;  2FQ3 A;  2V1U A;  3VVZ A;  3E7L A;  2MFZ A;  3VSK A;  1D5V A;  3ERM A;  4XID A;  1N78 A;  4UUS B;  1SFK A;  3J81 Z;  2QM3 A;  1J09 A;  4GYG A;  4LIV A;  3O2P E;  4QSH A;  1R36 A;  3G71 I;  5D5U B;  2B3W A;  3VIB A;  4C2M A;  2R7T A;  4JX6 A;  1EJ9 A;  2A2F X;  3BY6 A;  4P96 A;  2DTR A;  2R7D A;  2BVM A;  5LBQ A;  2DJI A;  2V57 A;  3HTA A;  2VC0 A;  2FBI A;  1U5T C;  4KT5 C;  1XN7 A;  3CWR A;  3NXC A;  1ZLJ A;  3V42 A;  2B7E A;  2GWR A;  1GLN A;  2BY1 A;  4V2F A;  1PYV A;  2ZB9 A;  3EPZ A;  2NOJ B;  3H9G A;  3NI7 A;  4HDU A;  4FIS A;  1SD4 A;  3BTC A;  4A3E J;  2VOD A;  1SAU A;  1TWC J;  3LQR A;  3I0T A;  2LNB A;  3BP8 A;  1G3W A;  1D5Y A;  3OR2 C;  2KQR A;  4U87 A;  5ICC A;  1WZ2 A;  3Q5F A;  5ICF A;  5B66 C;  3OYH A;  3ABK H;  1HBX G;  5EJC A;  3UR3 C;  2GBY A;  1AKH B;  3ML6 A;  2IU5 A;  1M1E B;  4MIM A;  4JOM A;  1ZRE A;  1XMX A;  1VI0 A;  4BY7 J;  3QYE A;  5FO5 A;  1I3A A;  2LYC A;  4LOC A;  2A3S A;  3SXY A;  3FKI J;  2VJI A;  3HSR A;  4E7H A;  2W82 A;  3CCL I;  2NVT J;  1IJW C;  3JRI A;  1VFC A;  2NNY A;  1QQI A;  3M8E A;  3HDD A;  5FLX K;  4RLQ A;  5E1X A;  1U8B A;  1ZN2 A;  1I27 A;  4BDZ A;  3MKL A;  2LD5 A;  1YIJ I;  2L7K A;  4ZZL A;  4XKV A;  3L2C A;  2M30 A;  2VT3 A;  5CXI A;  1B9M A;  2WV1 A;  1Y1W J;  3OYK A;  2Y2Z A;  2ELJ A;  1IRZ A;  4P55 A;  1HF0 A;  4LJZ F;  5F1J A;  4BAC A;  1FBS A;  4EV0 A;  1EV7 A;  2HXI A;  1FMV A;  2VB6 A;  1PUF A;  1HC8 A;  3DEU A;  3SZG A;  2B0L A;  3ISP A;  2CO5 A;  3PNY A;  4Y33 A;  5F08 A;  1POG A;  4ETS A;  2L02 A;  1R1V A;  3OIQ A;  2G7U A;  4GFL A;  1HKQ A;  2WA0 A;  3K1P A;  4PSX A;  4KJZ A;  1SFE A;  3DP7 A;  5GAD J;  2YVH A;  2DT7 B;  2IGM A;  1IRF A;  4AM3 A;  3PL8 A;  3MKZ A;  3CP8 A;  2GEN A;  2ECC A;  1T38 A;  4OIO F;  1YG2 A;  2PN6 A;  2F4I A;  5J3L A;  1CF7 B;  2E2H J;  3GO5 A;  2HYT A;  1ACI A;  3UNG C;  1AA7 A;  5J4V A;  3BR2 A;  2CRG A;  3O3K A;  3K4B A;  1MBJ A;  2K27 A;  2QLZ A;  2CUE A;  2CYY A;  2G0E A;  4BQO A;  3EET A;  1IGN A;  2EFQ A;  1TQM A;  5FD6 A;  2M4G A;  2R3S A;  1ZQ3 P;  1DP3 A;  3K8P C;  2EJR A;  3K4C A;  4M71 A;  3U21 A;  3CMA I;  4ESJ A;  1UCR A;  2O5R A;  4B47 A;  3IRQ A;  1ZH5 A;  3F72 A;  4U7D A;  1XSV A;  3GTL J;  3KP4 A;  1LFU P;  2F48 A;  2QBY A;  2P7C B;  1D1A A;  2HKU A;  1D1C A;  3ASO H;  2KJC A;  4GFK A;  2HFH A;  3SWH A;  5DV5 A;  3DU5 A;  1I3Q J;  4R8H A;  4BJ5 C;  2LBF A;  1LKX A;  1X2N A;  5L3F A;  3OL4 A;  1T0F C;  4F93 B;  3CDL A;  2L9V A;  2R7V A;  2W48 A;  1DP7 P;  1EF4 A;  4AF5 A;  3I56 I;  2QSH X;  4BQA A;  2FJ1 A;  1W5S A;  1ETQ A;  4N0B A;  2IGN A;  5D5W B;  2HS5 A;  2JPC A;  5IYB J;  4U0V A;  1DU6 A;  3OYE A;  2M8E A;  2WTE A;  3W6J B;  4JK1 X;  2VBY A;  3G7R A;  1U78 A;  1YX3 A;  1USS A;  1DGR M;  2JWT A;  3F8B A;  1XG1 A;  1MIJ A;  1Y6I A;  2ESH A;  1IN5 A;  1X58 A;  5LGT A;  4S05 A;  3CCS I;  1BN5 A;  2K9Q A;  3ON2 A;  2HXO A;  1SVL A;  4LK1 F;  3M7G A;  1HST A;  1RRJ A;  5IYD J;  5A2Q K;  1FSE A;  3CCR I;  2JA6 J;  3HBL A;  2HQN A;  2I5U A;  1APL C;  2BY3 A;  3BNI A;  2P5K A;  1IN8 A;  2BEO A;  4ASN A;  4CYD A;  3KYL A;  4I98 B;  1IF1 A;  2F5E A;  3F8F A;  5IT9 K;  5K5Q A;  3KKD A;  4ENN A;  4L5J A;  4BJ6 C;  2G7G A;  3TO7 A;  2RC4 A;  4L9T A;  2L4M A;  3JAM Z;  3IH3 A;  3MKW B;  5D1R A;  1LJ9 A;  1FNN A;  3IRR A;  5JVT A;  2NVQ J;  4RA2 A;  4EM2 A;  2ZCX A;  1MSE C;  3A1Y A;  2LK2 A;  3VPR A;  1WI3 A;  1XX5 A;  5L3B A;  1EH6 A;  1IG7 A;  1E17 A;  5FB2 A;  2BGC A;  2FUG 2;  2DAO A;  3CTA A;  3GZN B;  2XIG A;  1UZC A;  2W7N A;  1TT0 A;  3ROU A;  2H09 A;  1TNS A;  1KON A;  1QZZ A;  2MG4 A;  3TBI A;  1J9I A;  1XGS A;  3KNW A;  1JKO C;  5FMP A;  2KIM A;  1N75 A;  4YFX F;  5HNF A;  3K70 C;  4GCK A;  2P6T A;  2QGU A;  3K70 D;  3BWG A;  2Q8K A;  3RSN A;  3DPL C;  2GLO A;  5CLS A;  3OYI A;  3DLA A;  1O3S A;  4HOB A;  5HAW A;  5EDN A;  2FMY A;  2TRT A;  3PIP F;  4BQQ A;  4ZZD A;  1X4P A;  3OMY A;  2ZME C;  5E3L A;  5TGT A;  1K78 B;  2L2O A;  5K7Z A;  1NK3 P;  5FKN A;  2LKS A;  4PGH A;  3Q0U A;  3HUG B;  4FQG A;  2OD5 A;  4XQF A;  4ITV A;  3H92 A;  2FEZ A;  2DK8 A;  2YPR A;  4M3D A;  3I5U A;  3KP2 A;  1UI6 A;  3EUH A;  3QYF A;  1GXP A;  5JLW A;  2EIK H;  1IZ1 A;  2IA0 A;  3P9I A;  3SQN A;  2FQ4 A;  1RES A;  4I7H A;  1OYI A;  2HYG D;  4HNU A;  4UUS A;  4BE0 A;  4IRV A;  1BJA A;  1SMT A;  1K79 A;  2R7R A;  4UXN A;  1PP7 U;  2GXG A;  3GTP J;  2JRM A;  3CJQ B;  4F91 B;  1D8K A;  2DA3 A;  4MQV A;  1UB9 A;  4RB1 A;  4ZYD A;  2NVX J;  4ZDP A;  4OAZ A;  2EIJ H;  2FXA A;  3EQL F;  5B5E C;  4FT8 A;  2C6Y A;  3ELK A;  1BR4 A;  1F4K A;  3B73 A;  3CDI A;  4DNC A;  5IYC J;  4BXU A;  2VXZ A;  4KUM A;  1BM9 A;  2MW8 A;  4JBA A;  3R4K A;  4RAF A;  2DT5 A;  3H3V K;  2XRL A;  2EIL H;  4CGZ A;  3S5R A;  2XGE A;  1BIB A;  2JUG A;  3EUP A;  2UV1 A;  3OR1 C;  1S6L A;  1YIT I;  2VE9 A;  3K4L A;  2E2J J;  2M45 A;  3CUQ B;  3GWZ A;  5M5W J;  3JRE A;  2I8D A;  4EAT A;  1E0E A;  1RKT A;  2QUF A;  2X6Y A;  2XUB A;  3WU2 C;  1AKH A;  1FIP A;  2DK5 A;  3MNL A;  1LVK A;  3OV8 A;  1MJB A;  1LB2 A;  3E6D A;  1H9G A;  2ZFW A;  2DBB A;  3CJD A;  1DPR A;  3L2U A;  2KMU A;  4GCV A;  4QLC U;  3J81 K;  2H8W A;  2OJE D;  5EGO A;  4M9X A;  4LLL A;  4GO1 A;  3F22 A;  4ENJ A;  1LDD A;  4MFD A;  4BY1 J;  2ZNY A;  3I4P A;  2M8G X;  3MFK A;  4FX4 A;  3H5R A;  4DYR A;  3ZQG A;  3K2A A;  1X2M A;  3BJ6 A;  1LE8 B;  2EIM H;  1HCR A;  1U9O A;  4RB0 A;  2E2I J;  3BG5 A;  2YS9 A;  1JXS A;  4I0A A;  3RKW A;  2WB1 A;  1W1W E;  2HTJ A;  3EUA A;  5CVU A;  3ZMS A;  2QCO A;  3KP7 A;  2HVQ A;  3J7Z I;  2LTP A;  2Q2E B;  5DUI A;  3DPJ A;  2K02 A;  1ZEL A;  3IAS 2;  3MZY A;  4A3D J;  3RCO A;  3TQN A;  4B4C A;  3A03 A;  2CQN A;  5HOO A;  4HDV A;  5KHD A;  3IAM 2;  2CJJ A;  2M7B A;  3K4N A;  2OF7 A;  3CJR B;  2MLK A;  2VLA A;  5FKO A;  4EEF G;  1CF7 A;  2MH2 A;  2L9R A;  3TKY A;  3VW2 A;  4XKC A;  3Q0W A;  3J7A O;  1FPQ A;  4UVB A;  5FRN A;  2FD5 A; 
#chains in the Genus database with same CATH homology
 1HDD C;  1H89 C;  1ORK A;  3HOU J;  4HNV A;  3CQZ J;  3I4N J;  4L62 A;  2DN0 A;  2HOS A;  1F43 A;  1K61 A;  4D7N A;  1MBF A;  3LHQ A;  2IBD A;  2LLK A;  1ZGW A;  1BL0 A;  1RPW A;  3S17 J;  1BW5 A;  3QBM A;  1JTY A;  5CW8 A;  2PMZ N;  4M6V A;  3PO3 J;  2Y31 A;  3NAU A;  1MH3 A;  3DEW A;  4XRM A;  3LSG A;  5FJ8 J;  2XGD A;  1Z0X A;  3FRQ A;  1GV2 A;  3S14 J;  5F0F A;  4CYC A;  3G56 A;  3QPS A;  4JP0 A;  2O7O A;  2COB A;  1HOM A;  9ANT A;  1FTT A;  1IC8 A;  1GDT A;  1SFO J;  2EZL A;  1TWA J;  3TW7 A;  5IOY A;  1ZK8 A;  2DJN A;  4MO7 A;  1TWG J;  4D5C A;  4W97 A;  4A3C J;  1ETW A;  3ZQF A;  1VF9 A;  3QQA A;  1A6I A;  2DG8 A;  4UUT A;  3O8G A;  3BTL A;  4QTR A;  3JRB A;  3HB9 A;  2O8K A;  2ID6 A;  3HEF A;  5F0H A;  1GT0 C;  1P7J A;  1H88 C;  5F0C A;  1U9N A;  1BW6 A;  2WGB A;  2M2E A;  1NTC A;  3NNR A;  4Y52 J;  5C3E J;  2LVS A;  2QOP A;  3AQS A;  5CXG A;  2L7F P;  2K9N A;  3GBG A;  5K7H A;  4AUX A;  2XGC A;  1MNM C;  4X6A J;  1ETV A;  1JJ6 C;  3M4O J;  1JJ8 C;  3JRH A;  1WPK A;  2LY9 A;  1UHS A;  2DMN A;  4JL3 A;  4NEL A;  4AYB N;  3D1N I;  2CQX A;  2VI6 A;  2R5Y B;  2W53 A;  1UI5 A;  5F04 A;  5H9T A;  2CU7 A;  2Y30 A;  4BBS J;  4AC0 A;  4A3F J;  3WHC A;  3MN2 A;  5AQC A;  2XB5 A;  2NS8 A;  1F36 A;  2G3B A;  4UDS A;  2YU9 J;  1NK2 P;  2AHQ A;  4PXI A;  5M5Y J;  5C4X J;  4XIC A;  3VVZ A;  1O4X A;  3E7L A;  3PM1 A;  5JLX A;  1R9T J;  4XID A;  1LFB A;  4S0H B;  4UUS B;  3HOY J;  3TP3 A;  3UKG A;  2JMW A;  4ME9 A;  5E3N A;  1TWF J;  4QSH A;  2Q24 A;  3VW0 A;  2O7T A;  3VIB A;  2KDZ A;  4JX6 A;  5IOZ A;  3LSP A;  3O60 A;  4NN1 A;  2V57 A;  3HTA A;  3C07 A;  3NXC A;  3CWR A;  1SGM A;  3Q3S A;  4GCT A;  4V2F A;  2WB1 N;  2ZB9 A;  1T56 A;  5C4Y A;  5FKK A;  3ANG A;  4YZE A;  3B6C A;  3A01 A;  3NI7 A;  4FIS A;  5M3M J;  3ZQH A;  1UG2 A;  2FX0 A;  3BTC A;  4A3E J;  1WH7 A;  2OPT A;  5D18 A;  1TWC J;  3AQT A;  1MBE A;  1D5Y A;  5FGL A;  5DTD A;  5IP6 A;  2LR8 A;  4A3B J;  2R5Z B;  3HTJ A;  2LP0 A;  2DMU A;  1MSF C;  1SAN A;  2GBY A;  4BKX A;  1QVT A;  4I6Z A;  1BJZ A;  1AKH B;  2IU5 A;  4MIM A;  1K83 J;  4C3I J;  1MH4 A;  1VI0 A;  3FIW A;  4BY7 J;  5HOD A;  3JRG A;  2DA2 A;  4LOC A;  3Q0V A;  3FKI J;  2UXO A;  2EH3 A;  2NVT J;  5EG0 B;  1IJW C;  2X9D A;  3JRI A;  1VFC A;  1IDY A;  4FE4 A;  1B72 A;  3HDD A;  1U8B A;  4XK4 A;  2LD5 A;  1BA5 A;  3MKL A;  3BT9 A;  2UXU A;  4G12 A;  3BQZ A;  5HBU A;  4JX5 A;  3ZOB A;  5CXI A;  2WV1 A;  1XC5 A;  1UMQ A;  1HDP A;  2AO9 A;  3PO2 J;  3GEU A;  3HTI A;  1Y1W J;  2QIB A;  2Y2Z A;  3VVX A;  2VKV A;  1IRZ A;  1HF0 A;  2UXP A;  5K7F A;  1ZR2 A;  2Y9Y A;  5F1J A;  1QRY A;  3C2B A;  2GFN A;  1YRN B;  2HXI A;  1PUF A;  1B8I B;  1OCT C;  2HI3 A;  2Y9Z A;  2HOT A;  1W0T A;  2O9L A;  3COL A;  5K58 A;  4ABZ A;  4C3J J;  4M3G A;  2GM4 A;  4JNN A;  4GFB A;  1I50 J;  3RZO J;  4J19 A;  5F08 A;  1POG A;  2JJ7 A;  2QKO A;  3GTQ J;  3NPI A;  2VPR A;  4GFL A;  3GTJ J;  1FIA A;  2DG7 A;  2YVH A;  1Q1V A;  1VND A;  2GEN A;  2ECC A;  1JKQ C;  2HOA A;  3CRJ A;  2DMT A;  2R7Z J;  5FLM J;  1P7I A;  5J3L A;  1JKP C;  2E2H J;  2HYT A;  2R92 J;  2XPV A;  1GV5 A;  1I6H J;  3LJL A;  2ZCN A;  3BR2 A;  2CQQ A;  2CRG A;  1MBJ A;  4ACI A;  4IHY A;  3JRC A;  1AHD P;  5D19 A;  2Y0S N;  5HSZ A;  2CUE A;  3HKZ N;  2P81 A;  4BXX J;  2G0E A;  1S7E A;  5IPA A;  1ETX A;  1JGG A;  1ENH A;  2DA6 A;  2DA5 A;  1IGN A;  3S2D J;  4MXM A;  2NP5 A;  3F0C A;  3S1Q J;  2WUI A;  4DZP A;  1ZQ3 P;  4A3L J;  2HYJ A;  3WHB A;  5GP9 A;  4CYC B;  3BR5 A;  3GTL J;  2PBX A;  2RHA A;  1LFU P;  2M0C A;  5DS9 A;  3T6N A;  4CGR A;  2HKU A;  2K40 A;  5F27 A;  4GCL A;  1WGX A;  1G2H A;  2QWT A;  4GFK A;  2YUS A;  3P9T A;  5EYR A;  1I3Q J;  3GTK J;  1X2N A;  1ITY A;  1DU0 A;  1WCM J;  1LE8 A;  3G1O A;  2WAQ N;  3CDL A;  1ZR4 A;  4JX4 A;  3BCG A;  2W48 A;  5FKM A;  1A5J A;  1JUP A;  1EF4 A;  3EGQ A;  3OIO A;  4AF5 A;  1ZKG A;  3BR1 A;  2IEK A;  2FJ1 A;  2LFB A;  5M3F J;  1ETQ A;  3K7A J;  2NP3 A;  1IDZ A;  2B63 J;  4BBR J;  2JA5 J;  5E3O A;  2ZOY A;  5IYB J;  3LOC A;  1DU6 A;  1FJL A;  5BNG A;  3OOU A;  1Z77 A;  3G7R A;  1U78 A;  2JWT A;  2G7S A;  1XG1 A;  5IP9 J;  3ON4 A;  4FE7 A;  4NDL A;  3HOW J;  4D7M A;  1X58 A;  4MFE A;  3HOZ J;  4IEJ A;  3JR9 A;  3TED A;  4IHV A;  2K9Q A;  3ON2 A;  4RBO A;  2HXO A;  3RZD J;  3S1M J;  3SDG A;  3LWJ A;  2D6Y A;  3HGG A;  2ME6 A;  2ME0 A;  4MLO A;  1H8A C;  1ZTR A;  2QF7 A;  1RET A;  5IYD J;  4I76 A;  3IUV A;  4A93 J;  3G1M A;  2JA6 J;  3HBL A;  1W0U A;  5EZG A;  1APL C;  5GPA A;  3I4M J;  3RQI A;  3TW6 A;  2KT0 A;  3BNI A;  3DCF A;  3ZQI A;  2GUH A;  3V78 A;  1RKW A;  2NVY J;  2D5V A;  3VVY A;  3O8H A;  3BTJ A;  2IAI A;  2E1O A;  3QPL A;  3FK7 A;  3HE0 A;  3KKD A;  2R93 J;  2N8G A;  3BTI A;  4C2M J;  4IHX A;  4M3F A;  2G7G A;  1GUU A;  3IH3 A;  3IH4 A;  4A3M J;  5D1R A;  1OFC X;  2EZK A;  2JA8 J;  2DMQ A;  3BG9 A;  5EGO B;  2NVQ J;  2VUM J;  3BR0 A;  2ZCX A;  1TC3 C;  5J1U A;  5M5X J;  1MSE C;  2DTZ A;  2LK2 A;  3VPR A;  1WI3 A;  2RAS A;  3HOV J;  2YVE A;  1IG7 A;  5EFY A;  1XS9 A;  2OER A;  2DA4 A;  3VW1 A;  3M3Y J;  1JTX A;  2EQR A;  2XDN A;  2K9S A;  2MG4 A;  3KNW A;  2H8R A;  1JKO C;  3RH2 A;  2L0K A;  5FMP A;  3BG3 A;  3OSG A;  1TWH J;  4GCK A;  3G1L A;  1E3O C;  1MBK A;  4A69 C;  3LSJ A;  4JKZ A;  1HLV A;  2FBQ A;  3LNQ A;  2GLO A;  2JK3 A;  2ECB A;  3IV5 A;  5HAW A;  4B1R A;  5EDN A;  4A3G J;  4FCY A;  2UXH A;  2TRT A;  1QVU A;  3BJB A;  3VOX A;  3IH2 A;  4KWA A;  2VKE A;  2EZH A;  3F1B A;  3BQY A;  3FIS A;  4M3E A;  3HIM A;  4D5F A;  1IUF A;  1ETY A;  1OCP A;  1CQT A;  5E3L A;  2UXI A;  2LKX A;  1ETK A;  4QIW N;  3LSR A;  2JA7 J;  3PAS A;  5K7Z A;  5C4J J;  2R5Y A;  4XRS G;  4DW6 A;  1NK3 P;  3GTG J;  5FKN A;  2ID3 A;  1QPI A;  2PZ9 A;  3Q0U A;  4Y7N J;  3FK6 A;  4M3D A;  4DZJ A;  1B72 B;  5FLV A;  3S1N J;  2DA7 A;  4IHW A;  1UI6 A;  3PPB A;  5FHP A;  3E7Q A;  3HOX J;  5JLW A;  2DA1 A;  3ZQC A;  1FEX A;  2G7L A;  3HM5 A;  3S15 J;  2FQ4 A;  1RES A;  3B6A A;  4UUS A;  4RDU A;  4AC6 A;  3L1P A;  2R0Q C;  3GTP J;  2ELK A;  1PUF B;  1OJL A;  2DA3 A;  2NVX J;  2MSY A;  2RAE A;  3H0G J;  4M3B A;  2X48 A;  3QKX A;  3GTM J;  1FTZ A;  3S1R J;  3KKC A;  3V6G A;  5EF6 A;  5IYC J;  5E3M A;  3JRA A;  3BRU A;  2MW8 A;  5FKL A;  1AU7 A;  1JUM A;  1Y1V J;  2XPW A;  4L5E A;  3H3V K;  2XRL A;  5EZH A;  3JRF A;  4A3I J;  3S5R A;  2XGE A;  4XRS A;  1JT0 A;  4ICH A;  3BR6 A;  3EUP A;  3KZ9 A;  2REK A;  1GVD A;  2L7M P;  2EBI A;  2NS7 A;  4W1U A;  2DMP A;  1MBH A;  2E2J J;  4DYC A;  4JYK A;  1JT6 A;  5M5W J;  3JRE A;  2JN6 A;  2R5Z A;  1RKT A;  2CUF A;  4DYQ A;  2TCT A;  2L7Z A;  1AKH A;  1FIP A;  4HKU A;  3MNL A;  3W6V A;  3JRD A;  3RKQ A;  5J1R A;  3VOK A;  4V2G A;  3CMY A;  2HDD A;  3CJD A;  3GZI A;  3MVP A;  3VP5 A;  4X1E A;  2XB0 X;  1WH5 A;  3NAR A;  5EG0 A;  3A02 A;  5EGO A;  2OI8 A;  3OSF A;  2NOG A;  5EEA A;  2HQ5 A;  5DAJ A;  4MFD A;  1IV6 A;  2EZI A;  4BY1 J;  3JSJ A;  3NRG A;  5IP7 J;  2M9H A;  3ZQL A;  3GTO J;  2M8G X;  3S2H J;  5GPC A;  4DYR A;  1JUS A;  3ZQG A;  3K2A A;  1X2M A;  1LE8 B;  3B81 A;  1HCR A;  3HTH A;  3ANP A;  3VUQ A;  1ETO A;  1U9O A;  2E2I J;  2ZOZ A;  1MBG A;  3BG5 A;  2YS9 A;  1YRN A;  2ZCM A;  1B8I A;  1RR7 A;  3RD3 A;  2E19 A;  3SFI A;  3SJM A;  2QCO A;  2XPU A;  4FTH A;  4C3H J;  2LTP A;  4B3A A;  3DPJ A;  2H1K A;  4A3D J;  1JKR C;  4B4C A;  2QTQ A;  4MK6 A;  2X6O A;  3A03 A;  2XSD C;  3HGY A;  5C44 J;  2F07 A;  4A3J J;  2CJJ A;  2I10 A;  2OF7 A;  2M34 A;  3CCY A;  3BHQ A;  5FKO A;  4EEF G;  2MGQ A;  2L9R A;  1T33 A;  3VW2 A;  3BR3 A;  4A3K J;  3Q0W A;  5J1Y A;  2NX4 A;  3TP0 A;  3A01 B;  3S16 J;  2FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...