3Q0VA

Ethr from mycobacterium tuberculosis in complex with compound bdm31369
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
193
structure length
188
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis and optimization of new EthR inhibitors. A new alternative approach to fight tuberculosis by boosting ethionamide
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/transcription inhibitor
molecule keywords HTH-type transcriptional regulator EthR
total genus 82
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3q0vA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3q0vA02
3ZQLA 1JKOC 5CW8A 2FJ1A 4QSHA 3ZQGA 1SGMA 5HSZA 5K7FA 3QKXA 1POGA 1XG1A 4M6VA 1T56A 5FKNA 2G3BA 3O8GA 3G1MA 4C3IJ 1MBJA 3GTOJ 3CQZJ 2WV1A 3OSFA 2VPRA 3BG3A 2CUEA 4D7NA 4DZJA 2GLOA 4IHWA 2ZCMA 1TWFJ 2YS9A 2Q24A 2I10A 2RAEA 2HXOA 9ANTA 1NK2P 5FKOA 4XIDA 3A01A 2B63J 2EQRA 2O7TA 1WH7A 3OOUA 3BQYA 1MBKA 3S14J 4A3BJ 5IP7J 1F43A 2XPWA 3KKCA 5EDNA 2JA6J 4XRSA 2K9NA 2NS7A 2CU7A 4L62A 2CJJA 3S17J 3LWJA 3T6NA 3JRIA 3VIBA 1GV5A 2HDDA 3JRBA 4MK6A 1QVUA 1GT0C 4MO7A 2R93J 1X2MA 3LSGA 3FK6A 5FJ8J 3COLA 4RDUA 2W53A 3ANGA 3E7QA 3WHCA 3HGGA 4MFEA 1OCTC 4AYBN 2UXOA 1AKHA 3BR0A 3BR3A 2DG7A 5IOZA 5EG0A 4A3MJ 4D7MA 3S15J 2HOSA 1H8AC 2M8GX 4GFBA 3CWRA 4A69C 2DA2A 3Q0VA 2M0CA 2DA7A 3S16J 3HOYJ 1GUUA 1JKQC 3PM1A 1RESA 1ETXA 2E2IJ 1IV6A 5M3MJ 3HTJA 2VKEA 2DG8A 3MNLA 1TWGJ 3ANPA 3GTPJ 3HIMA 3NRGA 4A3KJ 2O9LA 2XPVA 3IH2A 5K58A 2G7GA 2L7ZA 4S0HB 4D5CA 1MSFC 1IUFA 5EF6A 3DPJA 2GM4A 3UKGA 4D5FA 1ZKGA 2L0KA 5FLMJ 1FIAA 1W0TA 5E3OA 5EZGA 3A01B 1ZGWA 3HOXJ 1HLVA 2QOPA 1YRNA 2ZB9A 3D1NI 4ICHA 3LSRA 4J19A 3FK7A 2G7LA 2L7MP 3ZOBA 4A3IJ 1FTZA 5EZHA 1A5JA 2QTQA 1MH3A 3BTCA 2DA1A 3S5RA 2DJNA 2DTZA 2CQXA 3RQIA 3TEDA 3BR5A 5F0CA 1OFCX 3G7RA 1WGXA 1X58A 4JX4A 3S1QJ 1OJLA 1ZTRA 4BKXA 3S1NJ 5AQCA 2KDZA 1K61A 2IBDA 3BG9A 2HKUA 3BR1A 3GTGJ 5EYRA 4GFKA 4X1EA 4W97A 3ZQCA 2H1KA 4C3JJ 1Z0XA 2M34A 5F27A 3QBMA 3RZDJ 1UG2A 2YVEA 1MBGA 2JWTA 3HKZN 2NVYJ 5HODA 1MH4A 4A3LJ 1YRNB 3VVXA 1B8IA 4GFLA 4A3JJ 2Y30A 2K40A 1O4XA 2CQQA 5J1RA 2DA5A 1TWAJ 2LR8A 2JJ7A 2ECCA 2KT0A 2QKOA 3SJMA 3TW7A 2NOGA 4DYCA 5IP9J 2YU9J 3BT9A 5M5YJ 3C07A 2TRTA 3B6CA 3I4MJ 2D6YA 4BXXJ 2M2EA 3JRAA 5F04A 3HB9A 4M3EA 4M3BA 4ACIA 4MXMA 2P81A 3KZ9A 3CCYA 4MIMA 2FQ4A 1B72B 2F07A 4JP0A 5E3LA 2E19A 1JUSA 4JX6A 2EH3A 2NVTJ 2R7ZJ 2PMZN 3BRUA 1IRZA 3HOWJ 4GCTA 2REKA 5JLXA 2R5YA 2HOAA 4NDLA 4DYQA 3PASA 3B81A 1TWHJ 1BA5A 2DMPA 3PPBA 1B8IB 5DTDA 5F0HA 1P7IA 1Q1VA 3NPIA 2XGCA 3HM5A 4DZPA 3GTMJ 5FGLA 4A3EJ 5E3NA 2YUSA 1LE8A 1FJLA 2CRGA 2AO9A 4FISA 1BW5A 3ON2A 2E1OA 4JYKA 2XPUA 5FKMA 2R0QC 3FRQA 2WAQN 3LSJA 2MG4A 1F36A 1JUPA 3HOUJ 5C3EJ 4GCLA 1JKRC 2MSYA 5FKKA 2XGDA 3QQAA 3G1LA 3C2BA 3WHBA 2R5ZA 2NS8A 4UDSA 1T33A 4LOCA 2QF7A 1Y1VJ 1WCMJ 2LFBA 5K7HA 3NARA 3GZIA 1ZQ3P 2G7SA 2OERA 3A03A 4A3CJ 5IYDJ 2DA4A 3G1OA 4V2FA 4A3DJ 1ETOA 2XSDC 2K9QA 1U9OA 2R5YB 5CXIA 2MGQA 1GVDA 4FE7A 3IV5A 1JKPC 1E3OC 4PXIA 3HOZJ 2DA3A 2E2HJ 1TWCJ 3MVPA 2GFNA 2YVHA 4I6ZA 1H88C 2X6OA 4A3GJ 3DEWA 1MSEC 2N8GA 4CYCA 5M5WJ 1IJWC 2O7OA 3Q0UA 3BTIA 2ECBA 1U8BA 5GP9A 5J1YA 1MBHA 3RD3A 3ZQFA 2OI8A 5D1RA 3JSJA 3VOKA 3VVZA 3RKQA 4M3FA 2RHAA 1K83J 3HTAA 1AHDP 1HDPA 5GPAA 4JL3A 2UXUA 3VW0A 4FE4A 1SANA 2JA5J 3HTIA 2LY9A 3BQZA 3GTKJ 2ID3A 2V57A 2LD5A 3NI7A 3GTJJ 1HCRA 1FTTA 4G12A 3P9TA 2JK3A 1RPWA 2AHQA 1IGNA 3HOVJ 1ORKA 1WPKA 3F1BA 5FLVA 2X48A 2IEKA 4NELA 2Y0SN 4UUSB 2ME0A 1ZR2A 1MNMC 2XDNA 5M3FJ 5EG0B 1UMQA 3HEFA 5CXGA 2DMTA 5DS9A 1PUFA 4IHXA 4CYCB 2HI3A 4QTRA 2GBYA 1EF4A 1XC5A 1RETA 1ZR4A 2HOTA 1BL0A 4Y52J 2PBXA 2ZCXA 1APLC 2FX0A 2DA6A 3FKIJ 4A93J 3LJLA 1IC8A 3MKLA 1W0UA 1U9NA 1SFOJ 3GTQJ 3RH2A 4RBOA 1OCPA 4W1UA 3V6GA 5IP6A 2ELKA 1AU7A 4KWAA 4XRSG 4IHYA 2EBIA 5F08A 2OPTA 4M3DA 3K2AA 1JTXA 2QWTA 3HE0A 4EEFG 1JJ6C 1LFBA 5HBUA 1VF9A 3HBLA 1Z77A 2LTPA 2UXPA 4B1RA 5EGOB 2JA8J 3ON4A 5D18A 3VUQA 4DW6A 4Y7NJ 2LKXA 1XS9A 5EEAA 2OF7A 3CDLA 1AKHB 3S2HJ 2QIBA 5IPAA 2HQ5A 5IOYA 1GDTA 2LLKA 1H89C 1Y1WJ 1A6IA 3TP0A 3BJBA 3BG5A 3K7AJ 1S7EA 3QPLA 3SDGA 3IH4A 4B3AA 4ME9A 2XB5A 4JKZA 3ZQHA 2RASA 3BTLA 3BHQA 1ZK8A 2ZOZA 3JRCA 3SFIA 1JT0A 2NP5A 2LVSA 3HDDA 2JN6A 2TCTA 5F0FA 3ZQIA 1FIPA 2COBA 1GV2A 1NTCA 1X2NA 2CUFA 2W48A 5M5XJ 3L1PA 2GENA 1MBEA 1R9TJ 5J3LA 3I4NJ 3LNQA 1G2HA 2FD5A 4UUSA 3AQSA 4IEJA 3O60A 3V78A 2L7FP 4BBSJ 2H8RA 2ME6A 1ETKA 4ABZA 5F1JA 3BNIA 5D19A 1JT6A 1D5YA 1JGGA 2K9SA 1UI6A 4UUTA 3BTJA 3Q0WA 2NX4A 3JRHA 2JMWA 3VW1A 4AC6A 3H0GJ 3Q3SA 2ZCNA 3E7LA 3NAUA 5H9TA 1CQTA 1VFCA 1U78A 4V2GA 1IDZA 3LHQA 4X6AJ 3G56A 1UI5A 1NK3P 3NNRA 2XGEA 3LOCA 5GPCA 5EGOA 1JJ8C 1UHSA 3JRFA 1HF0A 1I6HJ 5K7ZA 1JUMA 4HNVA 1LE8B 4BY1J 1FEXA 3IH3A 1JTYA 1QRYA 1RKWA 1ITYA 2IU5A 4CGRA 1RKTA 2FBQA 2EZKA 1QVTA 5E3MA 3KNWA 3MN2A 4FTHA 1WH5A 4I76A 3M3YJ 3VP5A 1ETYA 2Y9YA 3PO2J 4B4CA 3S1RJ 4AF5A 1ETWA 3S2DJ 3HGYA 2HYJA 2QCOA 3DCFA 2HXIA 1IDYA 2UXIA 4JX5A 4BY7J 3OIOA 1VNDA 3EUPA 1LFUP 5BNGA 3VVYA 4DYRA 3TP3A 2D5VA 2JA7J 3W6VA 1I3QJ 3BR6A 2PZ9A 4QIWN 2DMUA 3O8HA 2DN0A 5FKLA 3CMYA 3HTHA 1TC3C 2ZOYA 1HDDC 5C4JJ 4YZEA 2IAIA 2Y31A 3NXCA 3GEUA 3TW6A 5FMPA 5DAJA 3VPRA 2O8KA 3AQTA 1B72A 2VUMJ 3BCGA 4GCKA 2NVQJ 1VI0A 2EZIA 4C3HJ 2M9HA 2HYTA 4XICA 2NVXJ 2EZHA 2ID6A 4XRMA 2G0EA 1DU6A 2VKVA 5JLWA 3VW2A 5HAWA 1P7JA 2L9RA 2WGBA 1BJZA 3PO3J 4JNNA 5IYBJ 3IUVA 1ETQA 2XB0X 5J1UA 5C44J 2WUIA 5C4XJ 3JRGA 1PUFB 5EFYA 1HOMA 4XK4A 2LK2A 1MBFA 1I50J 2E2JJ 3LSPA 2VI6A 2DMQA 2XRLA 3JREA 3GTLJ 1QPIA 3FIWA 1WI3A 3CJDA 3QPSA 2R5ZB 2R92J 2NP3A 3CRJA 3RZOJ 1BW6A 2WB1N 1DU0A 1IG7A 4AUXA 5IYCJ 3A02A 1ETVA 3B6AA 3H3VK 2Y2ZA 4BBRJ 1RR7A 3EGQA 2EZLA 2X9DA 1ENHA 4MFDA 3JR9A 4NN1A 2GUHA 4MLOA 4HKUA 2LP0A 3FISA 3JRDA 3M4OJ 3KKDA 3OSGA 3F0CA 4IHVA 4AC0A 3GBGA 4L5EA 4M3GA 2Y9ZA 2DMNA 5C4YA 3VOXA 3BR2A 3S1MJ 4C2MJ 4A3FJ 2UXHA 4FCYA 5FHPA 2MW8A
chains in the Genus database with same CATH superfamily
1JKOC 1SGMA 5K7FA 1R22A 4Q5SF 2EIKH 2TDXA 1YO5C 1KQ8A 4YFXF 2LY2A 3O8GA 2B3WA 3C2GA 2K27A 3KCCA 3QU3A 4LB6B 2ZJRF 2QWWA 1MZBA 1QZZA 2VPRA 4DZJA 2GLOA 2CYYA 4L9VA 2OU2A 3IWFA 3PUBA 3CCJI 2HXOA 3E0JB 3KFWX 3H9JA 2YX4A 2R7SA 2AQEA 2DFEA 2ZJQF 1WH7A 3OOUA 2MLKA 3BCAA 2H27A 2O03A 2M4GA 4YELA 2MH2A 3S14J 2DPUA 4A3BJ 3MZ8A 1F43A 2ZSIB 2DAOA 3KKCA 4MTEA 2JA6J 2L9NA 2R7RA 2FSWA 2DK5A 3K4BA 4HSRA 3WE3A 2VJ5A 3GX4X 1BJAA 2CU7A 4WCGA 2BVLA 1U2WA 4QWQA 2LDUA 2E36A 1O3TA 3T6NA 3E1SA 3PFYA 3WGGA 4CCJA 3K70C 2L7KA 3H5NA 3QWLA 1GV5A 3C18A 4LIUA 2ETHA 2CW0F 3H3UA 3OYMA 3ZN1A 3QPTA 1Z21A 3WU0A 1GT0C 1GHCA 3EDPA 2JPBA 4IZZA 3L9FA 2Y69H 4Y15A 3RKXA 1G3WA 1WJAA 3HGGA 1WI9A 4HF1A 1R49A 4MFEA 3ZMDA 1OCTC 2UXOA 3S3MA 4PJLA 3BR3A 5IOZA 2QQ9A 4A3MJ 3WTWC 3I3LA 2CV0A 2H6CA 4GFBA 4A69C 3Q0VA 3UNGC 2PG4A 4AVPA 5B1BH 1GUUA 4A5MA 1JKQC 4U0YA 3ZN0A 2FBIA 3P9IA 3FHNA 1ETXA 3N05A 5ILVA 3FXLA 5M3MJ 1PYVA 1I27A 3O6BB 3MNLA 4PFPA 3HIMA 1GLNA 4IRVA 1LKXA 2IGKA 5K58A 2RKHA 5CPRB 3H3ZA 3WG9A 3OS0A 4S0HB 3CLOA 1IUFA 2GM4A 2V9PA 1E2XA 4D5FA 1T38A 4LK1F 5EZGA 2LMDA 1ZGWA 1HLVA 1YRNA 3ASNH 5B66C 2OD5A 1YJNI 1R5ID 3KYDB 2L7MP 4HV5A 2QTQA 3BTCA 1OCCH 4PJMA 2DJNA 1XB4A 2DTZA 2CQXA 4Q48A 3QU6A 3TEDA 2VT3A 1OFCX 2W57A 3BG6A 3GFIA 1WGXA 3QYFA 1X58A 1SD5A 1R1UA 3ECHA 2DYSH 5BOXA 3MKWB 2BXYA 1SMTA 2M5WA 2KDZA 2HKUA 4BJTA 3GTGJ 1WKMA 2W7NA 4KITB 2VJ4A 2B1EA 1U6GA 4PCQA 2H1KA 4HX8A 1W5CC 1EH6A 2MYSA 5F27A 3QBMA 3VODA 3LMMA 5KNLA 5D4RA 1P2FA 2YVEA 1OCZH 3DBRB 3RJPA 5HODA 2O6GE 4M9SA 2E1NA 2XAJA 3ZCOA 1O4XA 2P7CB 1JHHA 3V8LA 3CDIA 2VBWA 2A68F 3R60A 4M6YA 4DQ2A 2ECCA 1JI8A 3HPHA 3SJMA 3M9AA 5IP9J 2YU9J 3I4MJ 1F1ZA 5F04A 4BAYA 4M3EA 3FMRA 1KYWA 4ACIA 1LUJB 1R1TA 4MXMA 3CCYA 4I0AA 2ZMEC 1UFMA 2R7WA 4JX6A 4P96A 2R7ZJ 2PMZN 1K4TA 4Y3OA 3VDXA 2R5YA 3U1DA 2HOAA 4NDLA 3I58A 1FNNA 4DYQA 4EJUA 1FYLA 2BXZA 5CLSA 2VBZA 3I0TA 3K69A 1B8IB 2L9VA 2KFDA 3CC7I 4KN7X 1P7IA 1Q1VA 3F8MA 3IAS2 1JE8A 2AS5F 4KIFA 4CCOA 2CV2A 3BROA 1ERDA 3DV8A 4CH7A 4M71A 2WBMA 2AO9A 1A6QA 3ON2A 1IAWA 4CCMA 1MMAA 2GOXB 2PMZA 5J4YA 1SFXA 4HLYA 3SEQA 3FBIB 3CCEI 2DT7B 2Z99A 2NS8A 3OIPA 1N78A 4UDSA 4LOCA 2EJRA 1YJ9I 3OYKA 2LFBA 4XKWA 3K1PA 5K7HA 3NARA 3GZIA 2EINH 2H1LA 1Z9CA 4NBQA 3A03A 2DA4A 4V2FA 3S8PA 3HIFA 3ABLH 4PJNA 3P7NA 5CXIA 4FE7A 4UV9A 1JKPC 4F91B 3BZ6A 3OYLA 2JSCA 2E2HJ 3K1NA 4RAGA 1PJRA 4I6ZA 1H88C 4XOPA 4A3GJ 2FU4A 2HFHA 3DEWA 1MSEC 1XMKA 4R1HA 1OISA 3WTVC 4AWXB 1N77A 2OI8A 2KKOA 4C2TA 3LAPA 5D1RA 4BHPA 1Y39A 3KZIC 4TV7A 2F4MB 4M3FA 2DFFA 1T39A 2RHAA 3HTAA 1HSTA 4E7KA 1HDPA 5GPAA 4JL3A 2UXUA 3HZJA 3KIOA 3HTIA 4E4HA 3VOEA 5E1XA 2PBIA 3NI7A 1DGRM 4EGZA 4L5JA 3F1BA 5F1RA 4BQAA 2OCEA 5FLVA 2WB1A 2ZXIA 3CESA 2V7FA 4XONA 5M3FJ 2Z16A 5KAFC 1KYZA 5D8LB 2XGXA 2DMTA 4CO8A 5DS9A 2D45A 4CYCB 2NVUB 2HI3A 4QTRA 1G3YA 1TQPA 3P9CA 2GBYA 1NH3A 4IRGA 3I55I 1PP8F 3HRUA 2PBXA 4Y52J 4Q4ZF 2ZCXA 3OYEA 3FKIJ 2CGPA 4XLCA 4IQJA 3BP8A 2I5UA 1TT0A 3CF5F 1LDJA 2ZXJA 2HVRA 2F5CA 5ED4A 3DEUA 4IHYA 3H5AA 3DWLE 2BGCA 2JTVA 4P5OA 3O3KA 4U9NA 2X4HA 3OYJA 2OQRA 3GF2A 4FETA 1B4AA 1VF9A 1Z77A 4N0BA 5HBUA 1ZLKA 2MFZA 5D18A 4IKFA 3FXMA 3K4NA 3D0SA 2ZJPF 2LKXA 4RM2A 4ZYAA 2LBFB 2L2OA 2XAUA 3A4CA 3R0JA 1VQ6I 3CDLA 3TOAA 1HBXG 1OYYA 3S2HJ 3A1YA 3FMSA 1OLTA 1GDTA 3JTHA 4Y13A 1V4RA 2QBYA 2W85A 5L3EA 2K02A 3V7RA 1Z1DA 2A5YB 2ZC2A 1E3PA 2VJIA 4A0YA 2XB5A 2XKOA 3DEEA 4Z6YA 2RASA 4OAYA 4NNJA 3WODF 3KYCB 3SFIA 4ZZDA 1JT0A 2NP5A 2LVSA 1QHHD 3HDDA 3DTIA 4YRVA 3DBHB 3ZQIA 5JHUA 2UUZA 4KJZA 2COBA 1NTCA 2CUFA 2W48A 4OD4A 2VXDA 5J3LA 2DYRH 3X2QH 3SZPA 5JFRA 1G59A 1V54H 2E34A 2FD5A 2ZXHA 3HUGA 1A31A 1NHAA 2XUBA 3BPXA 3AQSA 2P7VB 2LF7A 2V4JC 2H8RA 5FO5A 1P4AA 4G7ZF 3HSFA 1GVJA 4EM1A 2XASA 1YIJI 1BOBA 3BZCA 5D19A 4U7DA 4AIKA 3K4KA 2K9SA 2QA4I 4UUTA 1UI6A 1JHFA 1WJEA 2XF5A 1MDMA 3QOEA 1UG0A 1O3SA 3LSTA 1L0OC 3E7LA 3TMOA 3C7JA 1U78A 3U9GA 2VT2A 4X6AJ 3G56A 4KICA 1UI5A 2FMYA 1NK3P 4E70A 1FC3A 2WAQA 4RLQA 3NNRA 3LOCA 2DI3A 4ZYDA 5GPCA 1JJ8C 3JRFA 1I6HJ 2FF4A 2FNPA 2XAHA 3SYTA 1I3AA 5K7ZA 4BEHB 4BY1J 4ZYGA 1FEXA 1QRYA 2IU5A 2Z5UA 3QRFF 4E7ZA 2QSFX 4CZCA 4OU0A 3AKZA 3HRMA 4FTHA 1WH5A 1RZ4A 1ZHFA 2K3PA 1UHWA 4I09A 3M3YJ 1RR8C 1G3SA 1J9IA 1R5HA 1WQ2A 4B4CA 4KDPA 1OCOH 2KZVA 3S1RJ 4RS8A 3DP7A 3HGYA 1R7JA 2P5KA 1FP2A 2HXIA 1IDYA 3HHHA 4BY7J 3OIOA 1SVLA 3EUPA 4UV8A 1LFUP 3O2PE 5BNGA 1YHQI 3VVYA 4UXNA 1YS6A 3KEOA 4ZTFA 2DDAA 5KVRA 2PZ9A 5ILUA 2VN2A 1TC3C 4BS9A 2ZMEB 2NNYA 4YZEA 1X1AA 1DPRA 1EA3A 1MMDA 2X1DA 1EKEA 2MD5A 2Y31A 4EJTA 2O8XA 3TW6A 1X1BA 4XKBA 3IKTA 3NS4A 5TISC 4L0ZB 5L3FA 3AQTA 1W7PA 1B59A 2F4OB 1AWCA 2M7AA 3VTIA 2NVQJ 1VI0A 2O5RA 1AA7A 2UZKA 1TW2A 4XRMA 2AQFA 2IJLA 5BPIA 3ROUA 1P7JA 4PGHA 2WGBA 1Z05A 1WWXA 1YX5A 1D3YA 2EA2A 1D1BA 5IYBJ 3IUVA 2LREA 2OCCH 2ZNZA 4CZZA 3W6KB 1KA8A 3PSFA 1VQMI 1IRGA 5C4XJ 4IQ4A 1I5ZA 2FEZA 3JRGA 3S3NA 4MGRA 4CUGA 1MBFA 1I50J 2JZYA 5DM7F 2E2JJ 4NUBA 2VI6A 2XRLA 3JREA 4XLFA 3FM5A 1M1EB 2HTJA 1VZ0A 4LLGF 1J75A 2X6WA 4F92B 5HNHA 2BYVE 2RDPA 2R92J 3CRJA 3ZQQA 1DU0A 3QYEA 1TTYA 2YVXA 2ZKZA 4AUXA 1YTYA 3HL2A 1FX7A 2LRDA 3A02A 4WK8F 3OY9A 1SAUA 2X9DA 4MFDA 1LVKA 2A05A 2A61A 1D8JA 3CO7C 3H0DA 3JRDA 5FFXA 5HLTA 3OS2A 2P4WA 1S72I 4BHCA 4M3GA 3KP7A 3MFKA 1YG2A 3SFZA 4BE0A 3VOXA 1EH7A 2PFBA 2OQGA 3LA3A 3S1MJ 3IUOA 4A3FJ 2UXHA 4B47A 2AXTC 3CCMI 2FJ1A 2EA4A 2KL4A 5BS6A 3QKXA 3Q5FA 1FZPB 3MWMA 4M6VA 4N9IA 5DD8A 3LAJA 4HAMA 3G1MA 1MBJA 3F23A 3W2VA 4MQVA 4HQEA 3BG3A 2CUEA 4D7NA 4IHWA 4JQFA 1RUNA 2YS9A 2Q24A 4GXOA 4RGRA 2RAEA 3CUQC 1NG7A 2F48A 2YSRA 4HDVA 2GIZA 1NK2P 5FKOA 4L18B 2EQRA 1X1PA 3BQYA 2W1OA 5L3BA 4N4OB 5LEKA 1MMGA 5IP7J 1LFPA 4OINF 3HC7A 4XRSA 4ETSA 1QGPA 4L62A 2CJJA 5J4VA 5E1ZB 4ENMA 3J7AY 1X3UA 2QYOA 1IN7A 1I39A 1Z91A 2IGMA 3QP5A 3JRIA 3OYAA 2KZGA 3CCRI 1TZLA 2K3FA 3IWZA 3CC2I 1Z7LA 3JRBA 4MK6A 2AXLA 4G6DA 4MO7A 2XIGA 4WX9A 1X2MA 1REPC 2HPMA 3CUOA 3OYNA 2GAUA 4O6JA 3COLA 4RDUA 1T8IA 1RI7A 1HKSA 1KU9A 1O57A 3OR1C 3L09A 1BIBA 3E6MA 3VYTB 3IHUA 3S15J 1D5VA 4BEHA 2NXNB 1H8AC 1XGMA 2XAGA 4KN4X 2M8GX 3QPHA 2QEXI 1WFXA 4HF2A 1J0RA 2LYCA 3RTRA 2DA7A 1R36A 2MC3A 3PM1A 5HDNA 4CHUA 2M1BA 1FSEA 3HTJA 2OC6A 1TWGJ 3HJEA 1D8KA 1XD7A 4KISA 3K9TA 3R6SA 3VSLA 2E5ZA 2XPVA 2BVMA 3GVAA 5A2QK 3RDIA 3F8FA 2G7GA 2R7TA 4D5CA 2ELHA 2K86A 4IJAA 5CQGA 1S7AA 1J5YA 1WJFA 3CJRB 4Y33A 5FLMJ 1FIAA 1ON2A 3HOXJ 2ZB9A 1F4KA 3F6OA 4UB6C 3ULQB 1MGTA 2G7LA 4I98B 1TNTA 5H6QA 1A5JA 2QSGX 3ZXSA 3CCUI 1TW3A 1FSHA 2E60A 3PUFA 1R4MB 2KIMA 4CYDA 4IOCF 2D1VA 4JX4A 1BI0A 3C3WA 2VE8A 5AQCA 3BR1A 1YW9A 2EV0A 1MW7A 2L5QA 1FOXA 1BR2A 4GFKA 5TGTA 1LDKB 4X1EA 2E1MC 3ZQCA 3DKXA 3HSEA 1Z0XA 2R7UA 3HRTA 2WTEA 3RZDJ 1UG2A 4G6QA 3D5LA 3PNTA 2JWTA 4XORA 2NVYJ 2HEOA 3KZZA 5ILSA 4GFLA 1U8RA 3PFIA 2K40A 2WADA 3OMYA 2NYXA 5F6FA 2CQQA 2G7HA 4YIRX 1TWAJ 2Z33A 2JJ7A 2OAZA 1P6RA 1TQIA 1WJDA 4DYCA 5CKTA 3BT9A 1D1CA 3C07A 3HB9A 3U1KA 4M3BA 4BE2A 1R23A 1U0JA 4MIMA 1W36C 1X4OA 1MJ9A 2CWEA 1WZ2A 2NVTJ 5LHGA 5TRDA 3MQ0A 2X1CA 4HW0A 2REKA 3A0HC 4BDZA 3R0AA 1BC7C 3FKJA 1TWHJ 4GGGA 2ZJ2A 5H2FC 1VQ5I 3PPBA 5DTDA 2O3FA 1N75A 5F0HA 4ZDPA 2XGCA 1ZGAA 4LMYA 3Q9VA 4DZPA 3JAMK 5FGLA 4O5VA 4RAFA 3CDHA 2YUSA 3EQLF 3HKZA 3PNVA 1ZELA 1L3LA 3ONQA 2KRFA 1DP7P 2MC4A 1FJLA 3ABUA 4KFCA 2RREA 4RMNA 3ERMA 2E1OA 5LHIA 2XPUA 2JUGA 5FKMA 3FRQA 2WAQN 2MG4A 1F36A 3E5XA 4M74A 1ON1A 1OR7A 4NQWB 2NOJB 3NWSA 3G1LA 1BR1A 2G9WA 3C2BA 1YE9A 4UVCA 4RGSA 2QF7A 4S05A 2EB7A 3NRVA 1WCMJ 3IP4B 4ZH4F 3N97A 1FYMA 2E7WA 1T0FC 2OERA 4A3CJ 1J09A 3G1OA 4A3DJ 3JTGA 5IYDJ 1ETOA 3LA2A 3WU2C 3IV5A 1T6SA 5KK1A 3EYIA 5JVGF 3IRQA 1VQKI 1ONVA 3K70D 2N8GA 4PJJA 1IF1A 3BTIA 3CP2A 4WF2A 1U8BA 2HQRA 4R79A 3ZQFA 4E7LA 3E5UA 4I99C 3VVZA 4XKVA 4DNCA 3ISPA 2V6CA 1K83J 2CFOA 4FE4A 1PP7U 3VW0A 2VBXA 2BE5F 3BQZA 1LB2A 2DPDA 3F9KA 5H6RA 3COAC 3H1CA 4G12A 3P9TA 2BBYA 2JK3A 2QSHX 1IGNA 3HOVJ 1ORKA 2X48A 2IEKA 4NELA 4MEXF 1BR4A 2Y0SN 2ME0A 4UUSB 1QU3A 1P9QC 3HEFA 2OTJI 4HF0A 1U5TA 5CXGA 5FRMA 4IHXA 2OJED 3GZ6A 2CQKA 4XRFA 3PJRA 2Y0SA 4XOTA 2EFPA 3F72A 5K1YA 3FHZA 1APLC 1IC8A 3MKLA 3M07A 4HRIA 1VQOI 1W0UA 2HNHA 5GAGJ 3A0BC 3RH2A 3CP8A 5IP6A 2ELKA 2RV8A 4YEJA 5DM6F 2DQLA 3ABKH 3JCUC 3MZYA 2IGNA 3K2AA 3HOTA 3HXLA 3K4CA 1JTXA 4KIBA 1LFBA 1JJ6C 1MIJA 4G94A 1QPMA 3HG9A 2LTPA 2UXPA 3ON4A 3VUQA 2ZXWH 2VC1A 2X51A 1IXRC 1W36D 2EK5A 2A07F 1AKHB 5DDGA 2EWNA 1A6IA 3TP0A 4IRHA 3FM3A 2Z2SB 2ELJA 3BG5A 3K7AJ 1F5TA 3ELKA 1HXDA 3I71A 1IXCA 3SDGA 4D9JA 5HLGA 3FWEA 4JKZA 4IF4A 1IRFA 3ZQHA 4H0EA 3U21A 4XLNF 2ZOZA 4X0GA 4ENKA 1HC8A 1XDSA 2MH9A 3BG7A 2JN6A 2IP2A 4PFOA 2TCTA 5F0FA 4AVZA 1FIPA 3BJOA 2KJCA 1GV2A 3J81Z 3L1PA 4AU7A 1HSJA 3GLLA 1OR7C 2KJBA 3ZPLA 2BOLA 1G2HA 4XM3A 1W5SA 2DOAA 2LH9A 5LRRA 4HPQA 5IT9K 2OBPA 4AIJA 3V78A 1ZH5A 1YX3A 1IZ1A 1D0YA 4BBSJ 1Y56A 3ML6A 3ZR8X 4HOBA 3I4PA 3CLQA 1OKRA 1UAAA 4ABZA 5E79C 5F1JA 3CJQB 5FRNA 5JVTA 2WC2A 3I53A 5KCMA 3Q0WA 3JW4A 2VLAA 1X3WB 2EFNA 4XN0A 4CDGA 2Y75A 3GZNB 2NX4A 4G7OF 2JMWA 2NS0A 2NRAC 3Q3SA 2ZCNA 5KHDA 3WTUC 2HGCA 1CQTA 3DPTA 3LHQA 4EJWA 2IA1A 1BN5A 1O3QA 4L9TA 2XGEA 1R4NB 4DBQA 4LIVA 1ZGJA 5CJ9A 3L2WA 4J00A 1H0MA 2UV1A 1HF0A 4CSWA 3VB2A 3MD2A 2HYGD 4K2EA 2DOEA 5H20A 1ITYA 4BYYA 1RKTA 1G6NA 2EIMH 1USTA 4HV6A 2ISYA 4RB3C 1QVTA 2HOEA 1QO0D 2CW8A 3QYBA 2XV4S 4I76A 3VP5A 2D2WA 2QBYB 2ZO4A 1R6RA 2EPFA 2LNBA 2Y9YA 1OQYA 3I54A 4ZDLA 3T0YA 2XROA 4AF5A 1ETWA 3S2DJ 2HYJA 3E97A 3L2CA 4JX5A 3CMAI 1ZRCA 1JGSA 1VNDA 4EJOA 4II3A 4HLXA 1FWZA 4DYRA 3KETA 3BR6A 4A0ZA 4RA2A 3VYSB 4QIWN 3JSOA 2DN0A 5FKLA 3K4MA 2WAFA 5LBQA 2ZOYA 1S9HA 2KP6A 1TT5B 5BMZA 2F5FA 4E6KG 3NXCA 1UELB 1W1WE 3GEUA 3DU6A 3RKWA 3VPRA 4I02A 3F3XA 3G6EI 2HVSA 4GCKA 2F4IA 1K78B 4BACA 3TO7A 1IUYA 3B02A 3HTSB 1Y8RB 1STZA 4KUMA 2HYTA 4XICA 1XSXA 4PDKA 3ABMH 2VKVA 4A5NA 2L9RA 3KLNA 4JK1X 4JNNA 2KHMA 4LG0A 1HKTA 3NQOA 4WXCA 2WUIA 3UR3C 2L9SA 2GXGA 2W00A 4CCLA 4OIPF 5EFYA 3RKYA 4XK4A 1VTNC 1K4SA 3GZ5A 3ESWB 2JVHA 2QQ8A 4N9HA 3LSPA 3GTLJ 2JRMA 4LJZF 3OL3A 2XDVA 3FIWA 4U0WA 2BW3A 3HHGA 1XSVA 3F8BA 2P6TA 2QZ8A 1VQ8I 5CVVA 3RZOJ 4IXAA 1IG7A 5IYCJ 4BE1A 1ETVA 4DGWB 1VQLI 1XCBA 3C1DA 3H3VK 3EGQA 1RR7A 2V9KA 1S5LC 2JT1A 3L2UA 3S2WA 4ASNA 1VQNI 4NN1A 3OYGA 2GUHA 4MLOA 1BI1A 2CQNA 3TKYA 3FISA 4KMFA 3M4OJ 3KKDA 5A2QZ 4IHVA 2XC7A 4AC0A 3GBGA 1XMXA 4L5EA 1FMWA 2Y9ZA 1XGOA 2BHYA 2DMNA 2W84A 4Z2YA 2JPCA 5C4YA 1IN8A 3EUAA 4A6EA 5J6XA 2JVGA 4MQ9F 4FCYA 4MTDA 3FXUA 4XSXF 5B1AH 3OYDA 1D0XA 2HR3A 5E8GA 5HS9A 3LSKA 3ZQGA 3LSHA 2VIXA 3DPLC 1ULYA 2PFVA 1POGA 1XG1A 2UXNA 4A12A 5FKNA 2G3BA 4JBAA 4C3IJ 3GTOJ 2FUG2 2L54A 2PMHA 2WV1A 4A0XA 4GO1A 3F6VA 3DKYA 1X3ZB 5EEGA 4XIDA 3A01A 4HNTA 2B63J 1DPUA 1D1AA 2QKLB 1QA6A 1MBKA 3VSKA 4BHBA 3AL0C 3TO9A 5D5UB 5EDNA 2QM3A 3PIPF 2NS7A 2ZBKA 2R3SA 2ZNYA 4HYEA 2WAEA 3LWJA 5DD4A 2A6TA 2EFOA 4HA8A 2GXAA 1KU3A 3G4SI 2FA5A 1O7LA 1V3FA 1QVUA 4C2MA 2MLGA 5IT3A 4FT8A 2R93J 1BC8C 4XSZF 3FK6A 3R61A 2B7EA 5K5OA 2JQ7A 2CO5A 3I5UA 2HS5A 3ANGA 2ZSHB 3WHCA 3WG7H 3CMMA 3RYRA 3BCBA 2E35A 4AYBN 3DU5A 1AKHA 4RAZA 1T2KA 5EG0A 3RYPA 4D7MA 4AD9A 5GTHC 2QQBA 3JAMZ 3VWBA 1X19A 3SXYA 4H4KC 3CWRA 4ZZLA 2Y0MA 2BY2A 4JOMA 2M0CA 3OYIA 3HOYJ 1ZN2A 4XMYA 2XF6A 4GRIA 4ZC3A 1RESA 1SD4A 4E7IA 1U3EM 2E2IJ 1IV6A 3OYCA 2VE9A 4G8XA 2QQAA 1IN6A 3ANPA 3GUDA 2KPMA 2HDCA 4GCVA 3NRGA 2VODA 1FBUA 4UY8I 3IH2A 1A36A 3ABTA 1Y8QB 2M30A 2KIQA 2L7ZA 2VKHA 4A2UA 2VQLA 2FQ3A 3DF8A 5EF6A 3UKGA 2P8TA 1ZKGA 3OR2C 1W0TA 4CA0A 3ASOH 2QOPA 4EGYA 1FT9A 4ICHA 2VB6A 3CCSI 1QQIA 1V5EA 2FNAA 4BNCA 3ZOBA 4A3IJ 3ZP5A 5EZHA 3BZKA 2VC0A 4IX7A 2F5DA 1MH3A 1LQ1A 4FHTA 2BZTA 3RQIA 4EM2A 5HLHA 5LRSA 3OYHA 3BR5A 3JSPA 4NB5A 1IW7F 1HW2A 3S1QJ 1YLFA 1OJLA 3S93A 4BKXA 2UXXA 1LVAA 3BG9A 1FPQA 5B5EC 1XPXA 1K61A 2BY0A 5HNFA 4BXFA 2GA1A 4W97A 2Z1DA 4MEYF 2L4MA 2JUCA 4LG0B 1MNDA 2W4SA 2ICWG 1MBGA 3HKZN 1QBJA 4UVBA 1MH4A 2F6CA 3FXJA 4XLPF 1YRNB 3H92A 4I7HA 1B8IA 3VVXA 4A3JJ 3KEYA 3J7AO 2VQGA 1YFHA 3WGHA 2KT0A 2XSJC 2NOGA 2Y48A 2FXAA 2IVMA 4BQQA 5AONA 4S04A 2D6YA 1MJBA 2M2EA 3CZ6A 5J8FA 4E7HA 2FOWA 3LA7A 1KONA 2H6BA 2JSPA 2P81A 2YU3A 1O7FA 4L9JA 2HZDA 2YX7A 3REOA 2FQ4A 1B72B 4LITA 5E3LA 1FYKA 2Q8KA 2J5OA 5CYVA 3BRUA 1IRZA 2P6SA 1OCRH 5JLXA 3KE2A 3PASA 3B81A 4B48A 1ODDA 3AG3H 2IT0A 1A04A 1I1SA 4DVYP 2E1CA 2VOPA 2VKDA 3GTMJ 3H9GA 4A3EJ 2LKSA 1KU7A 1S29A 4ZDOA 2DT6A 1LE8A 4FISA 4RB2C 1K78A 1HW1A 3LSJA 1JUPA 2V1NA 1JKRC 1E0EA 2MSYA 5FKKA 2XGDA 2R5ZA 2M8EA 2V6EA 1T33A 3CJNA 1Y1VJ 2IPQX 1WRJA 1ZQ3P 3F8NA 5ICFA 1TQMA 3K4LA 4KIGA 2K9QA 4BQNA 1U9OA 2R5YB 2V9VA 3IL2A 4XNFA 3P9KA 1E3OC 3J81K 3HOZJ 5JI6A 1YQAA 5D6FA 3K4JA 4I01A 1TWCJ 3MVPA 3CMEI 4RM3A 4OMZA 2X6OA 4YG2F 1UCRA 2EFQA 5DEQA 2RN7A 4CYCA 5M5WJ 1IJWC 2O7OA 4E7SA 1X1DA 4NHJA 5FD5A 5GP9A 5IT9Z 4UB8C 2E7XA 3LSMA 1MBHA 2V1DA 3RD3A 2GOMA 2CQ7A 3JSJA 1HKQA 3VOKA 3QAHA 3OIQA 3D5SC 4IOAF 4NC6A 5J47A 2JA5J 2LY9A 3E6CC 4EVIA 1B6AA 3FDYA 1V55H 5E1WA 5B3SH 2LD5A 1PVEA 2MBFA 1IV8A 2FMLA 2K4BA 1FTTA 1MKMA 1RPWA 2AHQA 2HTSA 4ZYHA 3IC7A 1R58A 4FX4A 1FOKA 2RNJA 2OA4A 1R1VA 3RSNA 2OTLI 3BC8A 5FLXK 4PK4A 2JRTA 4AIDA 2A69F 2A6HF 1ZR2A 1MNMC 2XDNA 3DTEA 5EG0B 2ADUA 1HW5A 1LDDA 2LBFA 2X6XA 3R4KA 3OL4A 2CMPA 2K4JA 1E17A 5DUKA 1G4DA 3GXOA 1EF4A 1MD0A 1Y0UA 1RETA 3J7YJ 1ZR4A 2PX9A 3MCZA 2FX0A 2DA6A 4A93J 1XGNA 1SFOJ 4CGZA 3AAFA 1V5GA 3GTQJ 1SVOA 4RBOA 1OCPA 4W1UA 3D5RC 3V8KA 4YFKF 2GA2A 4RB1A 3NWTA 5K5RA 4KWAA 2F2EA 3NEUA 4XRSG 1VQ4I 4B3XA 4II2A 4OD5A 4M3DA 5HDKA 2W24A 5D6EA 5CVRA 3CCQI 2GWRA 1K7AA 3LWFA 1YITI 1MJAA 2CS3A 4B1RA 2QUFA 5EGOB 3OYBA 1DQUA 4DW6A 3L2QA 4D1QA 4Y7NJ 3KP4A 3GFMA 4QPOA 1S7OA 1XS9A 3FXRA 5EEAA 3HUGB 3M8EA 2DOFA 3F8CA 1TBXA 4PZJA 2K7LA 2HQ5A 5IPAA 5IOYA 2QIBA 3QODA 2DLLA 2M3AA 2LLKA 3J7ZI 5CQEA 3F21A 4ENJA 3K2ZA 1H89C 4B09A 3GMEA 1MMNA 3BJBA 3FF5A 3OS1A 2LOOA 1S7EA 3QPLA 5L3DA 4NC7A 3IH4A 4B3AA 4ME9A 1P92A 5F64A 2DT5A 2DTRA 2GZWA 3BTLA 3BHQA 1ZK8A 2L3DA 3JRCA 2QVOA 2X6YA 5GAEJ 1FOYA 4CCKA 2ZFUA 1R71A 3CD6I 3L00A 2ZY9A 2KIFA 1GXQA 5M5XJ 2LF8A 1X2NA 3QP6A 4M73A 2RQQA 4ENNA 2GENA 1MBEA 2QGUA 2F5EA 1R9TJ 5J40A 2NNNA 1W4MA 3LNQA 4HBLA 4UUSA 3HYIA 4CCNA 4Q47A 4IEJA 4XBFA 2CW7A 3O60A 3W2AA 4U9LA 2VOOA 1X4PA 2DDBA 1AOYA 3OWTA 4UHTA 1ETKA 3EUHC 5BQTA 2YPRA 3MZHA 1IRXA 2XVCA 3PSIA 3BNIA 1D5YA 1FMVA 3EPZA 4YIIA 3BTJA 2DCEA 5D5VB 1SFEA 3P5JA 2FBHA 1FLIA 3TDZC 3DFGA 2DODA 5HOOA 3VW1A 4AC6A 3H0GJ 4AYBA 4YIFA 3WTSC 5E17F 1VFCA 4V2GA 1VQPI 3QOPA 2R7DA 3A2KA 2BEOA 3VFZA 2IGOA 2CH0A 1UHSA 4BH9A 4BXUA 1G3TA 4F55A 1QHGA 4HNVA 1LE8B 3GLXA 1SC7A 2O61A 4U88A 4IVNA 1JTYA 4CGRA 4XL9A 2EZKA 3KP6A 3G73A 3KNWA 3FXQA 3G3ZA 3BLYA 2XAFA 3BJ6A 3AG1H 1LEAA 4B44A 4LD5A 2LKPA 3KEQA 3DLLF 2M45A 5BPDA 1MDMB 3WTZA 1A35A 1T98A 1EJ9A 2QCOA 3DCFA 1D0ZA 1UHMA 5JR3A 3KLOA 2VQHA 4NC8A 4EJVA 4WXHA 2L4AA 1ZG5A 2D5VA 2JA7J 3W6VA 1I3QJ 2PLYA 4BL0B 2KISA 1S3JA 1Z3YA 2VASA 3HRSA 3O8HA 2IA0A 3CMYA 3HTHA 5ICCA 4IRIA 2A6EF 1RUOA 2E1MB 2HPIA 4V19K 1Y0NA 1USSA 5DAJA 4F52A 2O8KA 2WA0A 5JHFA 3E3VA 1ZAOA 2MABA 1B72A 2ACJA 2VUMJ 3BCGA 1WJBA 3I56I 1Z6RA 1LNWA 1FBQA 5HLIA 2EZIA 4C3HJ 1J2XA 4P1WA 1KQ9A 3AG2H 2NVXJ 2EZHA 2G0EA 1DU6A 5JLWA 4FX0A 1MNEA 3PIOF 3RQ4A 4BDYA 4PSWA 4RGUA 5HDGA 3PO3J 2V26A 1ZG3A 1F9NA 2XB0X 4IHTA 3BWGA 3T8RA 1ZARA 4B43A 2XF7A 2ESNA 4IPAA 2HVQA 2CUZA 2ZMEA 1X1CA 3K6GA 2DMQA 3K0LA 2W82A 1SEUA 1TNSA 1FBSA 1S6LA 1QPIA 1XCVA 3FXOA 2I8DA 3QPSA 2R5ZB 2IW5A 1W7PB 1RRJA 2NP3A 3BJAA 3WE2A 3M8FA 3ZQ7A 3KPHA 3B6AA 1RIOH 4PSXA 2Y2ZA 5FGMA 3TBIA 4BBRJ 3WTXC 2XKPA 3GFLA 4KA4A 3CJTB 4LG3A 2K85A 2IS2A 2VONA 2LP0A 3E6DA 3OSGA 1TLHB 3PQKA 1G8XA 2BY3A 4OAZA 3SZGA 3BR2A 2V1XA 3DLAA 1Q1HA 5FHPA 1PUEE 3ZQLA 5CW8A 4QSHA 4KMUX 2H94A 2LSOA 5HSZA 1E3HA 2IXSA 2QENA 2KMUA 3T5XA 4M9ZA 1T56A 4WWCA 3CCVI 2KRCA 4RAYA 4ESFA 3CQZJ 4EV0A 3OSFA 3VYUB 1ZRDA 2ZCMA 1OMIA 1K6YA 2DFHA 1TWFJ 2OZUA 2K5CA 2I10A 4KT5C 9ANTA 2DO7A 3SQNA 3M1EA 1YJWI 2O7TA 1V5FA 3ZMTA 2PI0A 2LG4A 1Z67A 1GXPA 2KLOA 2KQRA 4XLHA 2XPWA 3FMQA 4A6DA 1J7KA 4OWRB 2K9NA 3FXKA 4LGWA 4HG2A 3MMYB 3S17J 4GDFA 2DJIA 4HSTA 3VIBA 2HDDA 3K1MA 3I59A 4WXDA 2W25A 2X1EA 5DYMA 2Q1ZB 4IL6C 3V4GA 5FD6A 4OIRF 3LSGA 4OIQF 1BM9A 1YS7A 5AIQA 4LLLA 2M7BA 2DK8A 4EMSA 4LB5A 3L7WA 5FJ8J 1J59A 1UB9A 2XAQA 2L02A 4F3QA 3J80Z 2Q0OA 2W53A 3E7QA 1KGSA 3LFKA 4IO9F 4RB0A 3RPUD 2WY8Q 1O3RA 2HKOA 3BR0A 2NAZA 2DG7A 3K10A 5ICGA 3T8TA 3MEXA 2HOSA 1CF7A 4M9XA 5D5XB 1NG6A 5DCMA 4L0YB 2DA2A 4HQMA 4ANJA 1XTAA 3TO6A 2P0WA 5GADJ 4FASD 2ZFWA 1N25A 3ZMVA 4HDUA 3S16J 1XX5A 2PJRA 2VKEA 2DG8A 4BGDA 2Z9OA 2BHZA 3GTPJ 1IXSB 3CCLI 3S3OA 4A3KJ 1I6XA 2O9LA 3TQNA 5D4SA 1K79A 3ZMSA 1BI3A 1FY7A 5D8KB 4M72A 2WY7Q 1MSFC 3W6JB 4ESJA 5FB2A 3DPJA 4F7ZA 2L0KA 5E3OA 3A01B 1FP1D 4U87A 3D1NI 2DQRA 3LSRA 4J19A 3FK7A 5D5WB 2G7UA 3E6BA 1FTZA 4B8XA 4QPQA 4PJ0C 2DA1A 3S5RA 2A2FX 1YW8A 2XHKA 4RGXA 3V42A 5F0CA 3G7RA 1ZTRA 3M1CA 3S1NJ 1B9MA 2IBDA 5CVJA 1ZREA 4MHGA 2M0MA 5EYRA 5LFAA 2FRHA 2DBBA 1OYWA 1VQ7I 5E18F 4C3JJ 2M34A 4R8HA 2MA3A 4KNYA 2V79A 4LLNA 3ECOA 1SFUA 5FLXZ 4A3LJ 3K8PC 4PGGA 3ERED 4EQQA 2Y30A 1YOVB 1VQ9I 2XRNA 5DUIA 4KT6A 4LK0F 5J1RA 2DA5A 1MMSA 2QLZA 2LR8A 1Y6IA 3AG4H 1KZHA 2OV7A 5HVQC 5LGUA 2QKOA 3TW7A 2VBYA 3AFHA 3WTTC 5M5YJ 2OUMA 2PJPA 2TRTA 3B6CA 5LLQA 4BXXJ 2YR2A 2P5LC 3JRAA 2M4KA 4KYWA 4OIOF 3WTYC 1RC9A 5LGTA 5IY5H 3KZ9A 2F07A 1T08B 3GEZA 5L3CA 4JP0A 1OPCA 3FX3A 2C6YA 2E19A 3GFJA 1RNLA 3GCMA 1JUSA 2FJI1 2EH3A 4HX7A 3HOWJ 4YFNF 4GCTA 2PQ8A 4C9YA 2OZ6A 3ZGKA 4AIHA 3E5QA 2DMPA 2Z3YA 3BDDA 1BA5A 3N4MA 3KP5A 4F93B 3HPGA 3W3CA 4L9NA 4PUSA 4EM0B 3NPIA 1SMYF 3HM5A 5EEHA 5E3NA 4FQGA 5K5QA 3KZYA 1H9GA 1TP4A 4ZYEA 2CRGA 1BW5A 3DXJF 4JYKA 2R0QC 4GCLA 3HOUJ 2Q2EB 5C3EJ 2EIJH 3TOBA 3QQAA 3DPUA 3H9QA 3WHBA 1H9TA 3GWZA 1WJCA 3Q9SA 2A5WA 3SZTA 2IA2A 2DXIA 3CO6C 2FBKA 2G7SA 4GYIA 1QZEA 1S8NA 2A3SA 2R7FA 3IKVA 2MD0A 3TGNA 4BUPA 2XSDC 5LD2C 4DOZA 2MGQA 1GVDA 5LEJA 5GAHJ 2H8WA 4PXIA 5AIPA 2DA3A 2D1HA 4CICA 2GFNA 4IHSA 3MAJA 2YVHA 5LGNA 3C2HA 3CF2A 2LY1A 3Q0UA 1P4XA 2ECBA 2VQCA 2ISZA 5J1YA 1TL8A 4LFUA 3CUQA 3IRRA 4NQWA 3RKQA 3VYRB 2BY1A 3I9V2 3I59B 3TDUC 1XSDA 1AHDP 5HS7A 4XN3A 3RCOA 1SANA 3GTKJ 2ID3A 2V57A 3KYLA 1DDNA 1BI2A 2DW4A 1ZYRF 2EFWA 3GTJJ 2X85A 2HDWA 1HCRA 3EYYA 3H36A 4C30A 2R7VA 3RPQA 4O3MA 2EV5A 1WPKA 1P4WA 3MKZA 3W2WA 5E20A 2CFXA 1UMQA 1SAXA 1PUFA 5DCMB 1QNTA 4P55A 1XC5A 4EATA 2HOTA 3SEZA 1BL0A 2H09A 2RGVA 4Y4RA 5DV5A 3G71I 4CXFA 1HQCA 3LJLA 1CGPA 1U9NA 1XN7A 4BJ6C 1QZYA 3BOQA 2DFIA 4HZFA 1UJ8A 3DKWA 3V6GA 3SWHA 1KQ0A 2HKXA 1AU7A 2WWYA 1R5GA 2STWA 2EBIA 3VEPA 5F08A 2OPTA 1ACIA 2IS4A 1W7PD 2PN6A 1WVRA 2V1UA 4J01A 1SD6A 2QWTA 3HE0A 4EEFG 3CTAA 2B0LA 3T1BA 1PDNC 4AM3A 3HBLA 2EV6A 4HNUA 4HX4A 4DIQA 2JA8J 5ERIA 2X0LA 1W5TA 2COMA 4P9UA 3KX2A 1U5TB 2WV0A 4HEA2 4ESBA 4ZTJA 2R7OA 4N4NB 3OYFA 2OF7A 3BY6A 2M87A 4OMYA 1JXSA 1BBYA 3B73A 4ZJZA 1EV7A 1Y1WJ 1WJ5A 2RQPA 4ON0A 2E71A 1YW7A 1ZLJA 2RVCA 3EETA 3LQQA 5LHHA 2RNGA 1WHUA 2VXZA 3SDBA 3EUKL 2EILH 2QKMB 2VJJA 1DUXC 2RC4A 3RIRA 3ZMZA 3OV8A 2B9SA 2VL8A 4XLAA 4UUVA 2CV1A 4I0BA 3EUHA 3V8JA 3DBLB 3HSRA 3SHFA 3I4NJ 1CF7B 2LC2A 1SFKA 3H5RA 1R00A 3U2RA 1T0FA 2PJRB 2L7FP 2PMUA 2ZCWA 2IS1A 1Z3XA 4D0PA 1UZCA 3V7SA 3ZRGA 2ME6A 1XDUA 3G2BA 3DTKA 2L01A 2FOKA 4G7HF 1IN4A 5FROA 1JT6A 1JGGA 3PNYA 2JA2A 2GXBA 3JRHA 1IO2A 3F22A 2HYFA 6PAXA 3WGIA 3GO5A 3NAUA 3L2VA 2J5PA 1LPQA 1C0WA 5H9TA 2GQQA 2GIVA 1IDZA 4G9YA 1IN5A 3RI4A 2KDOA 1SVMA 2HQNA 5EGOA 5L3GA 2K9LA 2P5VA 3DQVC 2R7QA 1JUMA 2KIUA 4XR6A 3IH3A 1WSUA 2R7XA 1RKWA 4RLFA 2FBQA 1LJ9A 4WIBA 3TL4X 5E3MA 3MN2A 2F5VA 1ETYA 3IAM2 3FBNB 5E8IA 3PO2J 5DCFA 5HS8A 4QLCU 1ZG1A 3GW2A 2K9MA 2KRHA 2VPLA 3AL0B 2UXIA 2CUJA 3WU1B 2ESHA 1YI2I 3MKYB 3TP3A 4DBRA 4XQFA 3RPUA 2CSOA 1T95A 1BOAA 2DMUA 2HZTA 3LFUA 4UNOA 3KP3A 4BQOA 2PEXA 1HDDC 5C4JJ 4OOIA 1LEBA 3CUQB 1ZRFA 2IAIA 2UWMA 5FMPA 3I64A 1U5TC 3OOPA 5CVIA 2BW3B 5TJJA 3HOSA 4BU2A 5FFZA 4ITVA 4XLEA 3M7GA 2STTA 3ZMUA 4MNUA 3BPVA 5J8CA 2M9HA 4M6XA 2ID6A 3VW2A 5HAWA 4UVAA 1XGSA 1BJZA 2E5NA 2HU9A 3LL7A 1ETQA 3J80K 1XMAA 5J1UA 5EJCA 1Z7UA 5C44J 4U0VA 5CVUA 1PUFB 4E7JA 2R4GA 1BIAA 1SD7A 3V7CA 2CG4A 2HWVA 2IRFG 1HOMA 2LK2A 1B1BA 1I1GA 5GTIC 1DP3A 4U7BA 3CC4I 3LQRA 2FE3A 3CJDA 1WI3A 2Q2EA 2O0YA 4C2UA 1BW6A 1DGWY 2WB1N 3HTUA 3LSIA 2IS6A 2DU9A 4Y17A 4BJ5C 1B9NA 4XKCA 4I2OA 4L5IA 3H35A 3FZVA 2EZLA 1ENHA 3JR9A 3KP2A 5KAIC 5ICEA 3S32A 4DJAA 1YIOA 4HKUA 1Z6TA 1HA8A 3L2RA 2BV6A 1YYVA 3F0CA 1OYIA 4G6TB 1FOWA 1KU2A 3M8JA 4GYGA 3GYHX 2HQAA 3PL8A 4P9FA 1K6OA 4C2MJ 1EH8A 2MW8A 3PQJA
chains in the Genus database with same CATH topology
3ZQLA 1JKOC 5CW8A 2FJ1A 4QSHA 3ZQGA 1SGMA 5HSZA 5K7FA 3QKXA 1POGA 1XG1A 4M6VA 1T56A 5FKNA 2G3BA 3O8GA 3G1MA 4C3IJ 1MBJA 3GTOJ 3CQZJ 2WV1A 3OSFA 2VPRA 3BG3A 2CUEA 4D7NA 4DZJA 2GLOA 4IHWA 2ZCMA 1TWFJ 2YS9A 2Q24A 2I10A 2RAEA 2HXOA 9ANTA 1NK2P 5FKOA 4XIDA 3A01A 2B63J 2EQRA 2O7TA 1WH7A 3OOUA 3BQYA 1MBKA 3S14J 4A3BJ 5IP7J 1F43A 2XPWA 3KKCA 5EDNA 2JA6J 4XRSA 2K9NA 2NS7A 2CU7A 4L62A 2CJJA 3S17J 3LWJA 3T6NA 3JRIA 3VIBA 1GV5A 2HDDA 3JRBA 4MK6A 1QVUA 1GT0C 4MO7A 2R93J 1X2MA 3LSGA 3FK6A 5FJ8J 3COLA 4RDUA 2W53A 3ANGA 3E7QA 3WHCA 3HGGA 4MFEA 1OCTC 4AYBN 2UXOA 1AKHA 3BR0A 3BR3A 2DG7A 5IOZA 5EG0A 4A3MJ 4D7MA 3S15J 2HOSA 1H8AC 2M8GX 4GFBA 3CWRA 4A69C 2DA2A 3Q0VA 2M0CA 2DA7A 3S16J 3HOYJ 1GUUA 1JKQC 3PM1A 1RESA 1ETXA 2E2IJ 1IV6A 5M3MJ 3HTJA 2VKEA 2DG8A 3MNLA 1TWGJ 3ANPA 3GTPJ 3HIMA 3NRGA 4A3KJ 2O9LA 2XPVA 3IH2A 5K58A 2G7GA 2L7ZA 4S0HB 4D5CA 1MSFC 1IUFA 5EF6A 3DPJA 2GM4A 3UKGA 4D5FA 1ZKGA 2L0KA 5FLMJ 1FIAA 1W0TA 5E3OA 5EZGA 3A01B 1ZGWA 3HOXJ 1HLVA 2QOPA 1YRNA 2ZB9A 3D1NI 4ICHA 3LSRA 4J19A 3FK7A 2G7LA 2L7MP 3ZOBA 4A3IJ 1FTZA 5EZHA 1A5JA 2QTQA 1MH3A 3BTCA 2DA1A 3S5RA 2DJNA 2DTZA 2CQXA 3RQIA 3TEDA 3BR5A 5F0CA 1OFCX 3G7RA 1WGXA 1X58A 4JX4A 3S1QJ 1OJLA 1ZTRA 4BKXA 3S1NJ 5AQCA 2KDZA 1K61A 2IBDA 3BG9A 2HKUA 3BR1A 3GTGJ 5EYRA 4GFKA 4X1EA 4W97A 3ZQCA 2H1KA 4C3JJ 1Z0XA 2M34A 5F27A 3QBMA 3RZDJ 1UG2A 2YVEA 1MBGA 2JWTA 3HKZN 2NVYJ 5HODA 1MH4A 4A3LJ 1YRNB 3VVXA 1B8IA 4GFLA 4A3JJ 2Y30A 2K40A 1O4XA 2CQQA 5J1RA 2DA5A 1TWAJ 2LR8A 2JJ7A 2ECCA 2KT0A 2QKOA 3SJMA 3TW7A 2NOGA 4DYCA 5IP9J 2YU9J 3BT9A 5M5YJ 3C07A 2TRTA 3B6CA 3I4MJ 2D6YA 4BXXJ 2M2EA 3JRAA 5F04A 3HB9A 4M3EA 4M3BA 4ACIA 4MXMA 2P81A 3KZ9A 3CCYA 4MIMA 2FQ4A 1B72B 2F07A 4JP0A 5E3LA 2E19A 1JUSA 4JX6A 2EH3A 2NVTJ 2R7ZJ 2PMZN 3BRUA 1IRZA 3HOWJ 4GCTA 2REKA 5JLXA 2R5YA 2HOAA 4NDLA 4DYQA 3PASA 3B81A 1TWHJ 1BA5A 2DMPA 3PPBA 1B8IB 5DTDA 5F0HA 1P7IA 1Q1VA 3NPIA 2XGCA 3HM5A 4DZPA 3GTMJ 5FGLA 4A3EJ 5E3NA 2YUSA 1LE8A 1FJLA 2CRGA 2AO9A 4FISA 1BW5A 3ON2A 2E1OA 4JYKA 2XPUA 5FKMA 2R0QC 3FRQA 2WAQN 3LSJA 2MG4A 1F36A 1JUPA 3HOUJ 5C3EJ 4GCLA 1JKRC 2MSYA 5FKKA 2XGDA 3QQAA 3G1LA 3C2BA 3WHBA 2R5ZA 2NS8A 4UDSA 1T33A 4LOCA 2QF7A 1Y1VJ 1WCMJ 2LFBA 5K7HA 3NARA 3GZIA 1ZQ3P 2G7SA 2OERA 3A03A 4A3CJ 5IYDJ 2DA4A 3G1OA 4V2FA 4A3DJ 1ETOA 2XSDC 2K9QA 1U9OA 2R5YB 5CXIA 2MGQA 1GVDA 4FE7A 3IV5A 1JKPC 1E3OC 4PXIA 3HOZJ 2DA3A 2E2HJ 1TWCJ 3MVPA 2GFNA 2YVHA 4I6ZA 1H88C 2X6OA 4A3GJ 3DEWA 1MSEC 2N8GA 4CYCA 5M5WJ 1IJWC 2O7OA 3Q0UA 3BTIA 2ECBA 1U8BA 5GP9A 5J1YA 1MBHA 3RD3A 3ZQFA 2OI8A 5D1RA 3JSJA 3VOKA 3VVZA 3RKQA 4M3FA 2RHAA 1K83J 3HTAA 1AHDP 1HDPA 5GPAA 4JL3A 2UXUA 3VW0A 4FE4A 1SANA 2JA5J 3HTIA 2LY9A 3BQZA 3GTKJ 2ID3A 2V57A 2LD5A 3NI7A 3GTJJ 1HCRA 1FTTA 4G12A 3P9TA 2JK3A 1RPWA 2AHQA 1IGNA 3HOVJ 1ORKA 1WPKA 3F1BA 5FLVA 2X48A 2IEKA 4NELA 2Y0SN 4UUSB 2ME0A 1ZR2A 1MNMC 2XDNA 5M3FJ 5EG0B 1UMQA 3HEFA 5CXGA 2DMTA 5DS9A 1PUFA 4IHXA 4CYCB 2HI3A 4QTRA 2GBYA 1EF4A 1XC5A 1RETA 1ZR4A 2HOTA 1BL0A 4Y52J 2PBXA 2ZCXA 1APLC 2FX0A 2DA6A 3FKIJ 4A93J 3LJLA 1IC8A 3MKLA 1W0UA 1U9NA 1SFOJ 3GTQJ 3RH2A 4RBOA 1OCPA 4W1UA 3V6GA 5IP6A 2ELKA 1AU7A 4KWAA 4XRSG 4IHYA 2EBIA 5F08A 2OPTA 4M3DA 3K2AA 1JTXA 2QWTA 3HE0A 4EEFG 1JJ6C 1LFBA 5HBUA 1VF9A 3HBLA 1Z77A 2LTPA 2UXPA 4B1RA 5EGOB 2JA8J 3ON4A 5D18A 3VUQA 4DW6A 4Y7NJ 2LKXA 1XS9A 5EEAA 2OF7A 3CDLA 1AKHB 3S2HJ 2QIBA 5IPAA 2HQ5A 5IOYA 1GDTA 2LLKA 1H89C 1Y1WJ 1A6IA 3TP0A 3BJBA 3BG5A 3K7AJ 1S7EA 3QPLA 3SDGA 3IH4A 4B3AA 4ME9A 2XB5A 4JKZA 3ZQHA 2RASA 3BTLA 3BHQA 1ZK8A 2ZOZA 3JRCA 3SFIA 1JT0A 2NP5A 2LVSA 3HDDA 2JN6A 2TCTA 5F0FA 3ZQIA 1FIPA 2COBA 1GV2A 1NTCA 1X2NA 2CUFA 2W48A 5M5XJ 3L1PA 2GENA 1MBEA 1R9TJ 5J3LA 3I4NJ 3LNQA 1G2HA 2FD5A 4UUSA 3AQSA 4IEJA 3O60A 3V78A 2L7FP 4BBSJ 2H8RA 2ME6A 1ETKA 4ABZA 5F1JA 3BNIA 5D19A 1JT6A 1D5YA 1JGGA 2K9SA 1UI6A 4UUTA 3BTJA 3Q0WA 2NX4A 3JRHA 2JMWA 3VW1A 4AC6A 3H0GJ 3Q3SA 2ZCNA 3E7LA 3NAUA 5H9TA 1CQTA 1VFCA 1U78A 4V2GA 1IDZA 3LHQA 4X6AJ 3G56A 1UI5A 1NK3P 3NNRA 2XGEA 3LOCA 5GPCA 5EGOA 1JJ8C 1UHSA 3JRFA 1HF0A 1I6HJ 5K7ZA 1JUMA 4HNVA 1LE8B 4BY1J 1FEXA 3IH3A 1JTYA 1QRYA 1RKWA 1ITYA 2IU5A 4CGRA 1RKTA 2FBQA 2EZKA 1QVTA 5E3MA 3KNWA 3MN2A 4FTHA 1WH5A 4I76A 3M3YJ 3VP5A 1ETYA 2Y9YA 3PO2J 4B4CA 3S1RJ 4AF5A 1ETWA 3S2DJ 3HGYA 2HYJA 2QCOA 3DCFA 2HXIA 1IDYA 2UXIA 4JX5A 4BY7J 3OIOA 1VNDA 3EUPA 1LFUP 5BNGA 3VVYA 4DYRA 3TP3A 2D5VA 2JA7J 3W6VA 1I3QJ 3BR6A 2PZ9A 4QIWN 2DMUA 3O8HA 2DN0A 5FKLA 3CMYA 3HTHA 1TC3C 2ZOYA 1HDDC 5C4JJ 4YZEA 2IAIA 2Y31A 3NXCA 3GEUA 3TW6A 5FMPA 5DAJA 3VPRA 2O8KA 3AQTA 1B72A 2VUMJ 3BCGA 4GCKA 2NVQJ 1VI0A 2EZIA 4C3HJ 2M9HA 2HYTA 4XICA 2NVXJ 2EZHA 2ID6A 4XRMA 2G0EA 1DU6A 2VKVA 5JLWA 3VW2A 5HAWA 1P7JA 2L9RA 2WGBA 1BJZA 3PO3J 4JNNA 5IYBJ 3IUVA 1ETQA 2XB0X 5J1UA 5C44J 2WUIA 5C4XJ 3JRGA 1PUFB 5EFYA 1HOMA 4XK4A 2LK2A 1MBFA 1I50J 2E2JJ 3LSPA 2VI6A 2DMQA 2XRLA 3JREA 3GTLJ 1QPIA 3FIWA 1WI3A 3CJDA 3QPSA 2R5ZB 2R92J 2NP3A 3CRJA 3RZOJ 1BW6A 2WB1N 1DU0A 1IG7A 4AUXA 5IYCJ 3A02A 1ETVA 3B6AA 3H3VK 2Y2ZA 4BBRJ 1RR7A 3EGQA 2EZLA 2X9DA 1ENHA 4MFDA 3JR9A 4NN1A 2GUHA 4MLOA 4HKUA 2LP0A 3FISA 3JRDA 3M4OJ 3KKDA 3OSGA 3F0CA 4IHVA 4AC0A 3GBGA 4L5EA 4M3GA 2Y9ZA 2DMNA 5C4YA 3VOXA 3BR2A 3S1MJ 4C2MJ 4A3FJ 2UXHA 4FCYA 5FHPA 2MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQL A;  1JKO C;  5CW8 A;  2FJ1 A;  4QSH A;  3ZQG A;  1SGM A;  5HSZ A;  5K7F A;  3QKX A;  1POG A;  1XG1 A;  4M6V A;  1T56 A;  5FKN A;  2G3B A;  3O8G A;  3G1M A;  4C3I J;  1MBJ A;  3GTO J;  3CQZ J;  2WV1 A;  3OSF A;  2VPR A;  3BG3 A;  2CUE A;  4D7N A;  4DZJ A;  2GLO A;  4IHW A;  2ZCM A;  1TWF J;  2YS9 A;  2Q24 A;  2I10 A;  2RAE A;  2HXO A;  9ANT A;  1NK2 P;  5FKO A;  4XID A;  3A01 A;  2B63 J;  2EQR A;  2O7T A;  1WH7 A;  3OOU A;  3BQY A;  1MBK A;  3S14 J;  4A3B J;  5IP7 J;  1F43 A;  2XPW A;  3KKC A;  5EDN A;  2JA6 J;  4XRS A;  2K9N A;  2NS7 A;  2CU7 A;  4L62 A;  2CJJ A;  3S17 J;  3LWJ A;  3T6N A;  3JRI A;  3VIB A;  1GV5 A;  2HDD A;  3JRB A;  4MK6 A;  1QVU A;  1GT0 C;  4MO7 A;  2R93 J;  1X2M A;  3LSG A;  3FK6 A;  5FJ8 J;  3COL A;  4RDU A;  2W53 A;  3ANG A;  3E7Q A;  3WHC A;  3HGG A;  4MFE A;  1OCT C;  4AYB N;  2UXO A;  1AKH A;  3BR0 A;  3BR3 A;  2DG7 A;  5IOZ A;  5EG0 A;  4A3M J;  4D7M A;  3S15 J;  2HOS A;  1H8A C;  2M8G X;  4GFB A;  3CWR A;  4A69 C;  2DA2 A;  3Q0V A;  2M0C A;  2DA7 A;  3S16 J;  3HOY J;  1GUU A;  1JKQ C;  3PM1 A;  1RES A;  1ETX A;  2E2I J;  1IV6 A;  5M3M J;  3HTJ A;  2VKE A;  2DG8 A;  3MNL A;  1TWG J;  3ANP A;  3GTP J;  3HIM A;  3NRG A;  4A3K J;  2O9L A;  2XPV A;  3IH2 A;  5K58 A;  2G7G A;  2L7Z A;  4S0H B;  4D5C A;  1MSF C;  1IUF A;  5EF6 A;  3DPJ A;  2GM4 A;  3UKG A;  4D5F A;  1ZKG A;  2L0K A;  5FLM J;  1FIA A;  1W0T A;  5E3O A;  5EZG A;  3A01 B;  1ZGW A;  3HOX J;  1HLV A;  2QOP A;  1YRN A;  2ZB9 A;  3D1N I;  4ICH A;  3LSR A;  4J19 A;  3FK7 A;  2G7L A;  2L7M P;  3ZOB A;  4A3I J;  1FTZ A;  5EZH A;  1A5J A;  2QTQ A;  1MH3 A;  3BTC A;  2DA1 A;  3S5R A;  2DJN A;  2DTZ A;  2CQX A;  3RQI A;  3TED A;  3BR5 A;  5F0C A;  1OFC X;  3G7R A;  1WGX A;  1X58 A;  4JX4 A;  3S1Q J;  1OJL A;  1ZTR A;  4BKX A;  3S1N J;  5AQC A;  2KDZ A;  1K61 A;  2IBD A;  3BG9 A;  2HKU A;  3BR1 A;  3GTG J;  5EYR A;  4GFK A;  4X1E A;  4W97 A;  3ZQC A;  2H1K A;  4C3J J;  1Z0X A;  2M34 A;  5F27 A;  3QBM A;  3RZD J;  1UG2 A;  2YVE A;  1MBG A;  2JWT A;  3HKZ N;  2NVY J;  5HOD A;  1MH4 A;  4A3L J;  1YRN B;  3VVX A;  1B8I A;  4GFL A;  4A3J J;  2Y30 A;  2K40 A;  1O4X A;  2CQQ A;  5J1R A;  2DA5 A;  1TWA J;  2LR8 A;  2JJ7 A;  2ECC A;  2KT0 A;  2QKO A;  3SJM A;  3TW7 A;  2NOG A;  4DYC A;  5IP9 J;  2YU9 J;  3BT9 A;  5M5Y J;  3C07 A;  2TRT A;  3B6C A;  3I4M J;  2D6Y A;  4BXX J;  2M2E A;  3JRA A;  5F04 A;  3HB9 A;  4M3E A;  4M3B A;  4ACI A;  4MXM A;  2P81 A;  3KZ9 A;  3CCY A;  4MIM A;  2FQ4 A;  1B72 B;  2F07 A;  4JP0 A;  5E3L A;  2E19 A;  1JUS A;  4JX6 A;  2EH3 A;  2NVT J;  2R7Z J;  2PMZ N;  3BRU A;  1IRZ A;  3HOW J;  4GCT A;  2REK A;  5JLX A;  2R5Y A;  2HOA A;  4NDL A;  4DYQ A;  3PAS A;  3B81 A;  1TWH J;  1BA5 A;  2DMP A;  3PPB A;  1B8I B;  5DTD A;  5F0H A;  1P7I A;  1Q1V A;  3NPI A;  2XGC A;  3HM5 A;  4DZP A;  3GTM J;  5FGL A;  4A3E J;  5E3N A;  2YUS A;  1LE8 A;  1FJL A;  2CRG A;  2AO9 A;  4FIS A;  1BW5 A;  3ON2 A;  2E1O A;  4JYK A;  2XPU A;  5FKM A;  2R0Q C;  3FRQ A;  2WAQ N;  3LSJ A;  2MG4 A;  1F36 A;  1JUP A;  3HOU J;  5C3E J;  4GCL A;  1JKR C;  2MSY A;  5FKK A;  2XGD A;  3QQA A;  3G1L A;  3C2B A;  3WHB A;  2R5Z A;  2NS8 A;  4UDS A;  1T33 A;  4LOC A;  2QF7 A;  1Y1V J;  1WCM J;  2LFB A;  5K7H A;  3NAR A;  3GZI A;  1ZQ3 P;  2G7S A;  2OER A;  3A03 A;  4A3C J;  5IYD J;  2DA4 A;  3G1O A;  4V2F A;  4A3D J;  1ETO A;  2XSD C;  2K9Q A;  1U9O A;  2R5Y B;  5CXI A;  2MGQ A;  1GVD A;  4FE7 A;  3IV5 A;  1JKP C;  1E3O C;  4PXI A;  3HOZ J;  2DA3 A;  2E2H J;  1TWC J;  3MVP A;  2GFN A;  2YVH A;  4I6Z A;  1H88 C;  2X6O A;  4A3G J;  3DEW A;  1MSE C;  2N8G A;  4CYC A;  5M5W J;  1IJW C;  2O7O A;  3Q0U A;  3BTI A;  2ECB A;  1U8B A;  5GP9 A;  5J1Y A;  1MBH A;  3RD3 A;  3ZQF A;  2OI8 A;  5D1R A;  3JSJ A;  3VOK A;  3VVZ A;  3RKQ A;  4M3F A;  2RHA A;  1K83 J;  3HTA A;  1AHD P;  1HDP A;  5GPA A;  4JL3 A;  2UXU A;  3VW0 A;  4FE4 A;  1SAN A;  2JA5 J;  3HTI A;  2LY9 A;  3BQZ A;  3GTK J;  2ID3 A;  2V57 A;  2LD5 A;  3NI7 A;  3GTJ J;  1HCR A;  1FTT A;  4G12 A;  3P9T A;  2JK3 A;  1RPW A;  2AHQ A;  1IGN A;  3HOV J;  1ORK A;  1WPK A;  3F1B A;  5FLV A;  2X48 A;  2IEK A;  4NEL A;  2Y0S N;  4UUS B;  2ME0 A;  1ZR2 A;  1MNM C;  2XDN A;  5M3F J;  5EG0 B;  1UMQ A;  3HEF A;  5CXG A;  2DMT A;  5DS9 A;  1PUF A;  4IHX A;  4CYC B;  2HI3 A;  4QTR A;  2GBY A;  1EF4 A;  1XC5 A;  1RET A;  1ZR4 A;  2HOT A;  1BL0 A;  4Y52 J;  2PBX A;  2ZCX A;  1APL C;  2FX0 A;  2DA6 A;  3FKI J;  4A93 J;  3LJL A;  1IC8 A;  3MKL A;  1W0U A;  1U9N A;  1SFO J;  3GTQ J;  3RH2 A;  4RBO A;  1OCP A;  4W1U A;  3V6G A;  5IP6 A;  2ELK A;  1AU7 A;  4KWA A;  4XRS G;  4IHY A;  2EBI A;  5F08 A;  2OPT A;  4M3D A;  3K2A A;  1JTX A;  2QWT A;  3HE0 A;  4EEF G;  1JJ6 C;  1LFB A;  5HBU A;  1VF9 A;  3HBL A;  1Z77 A;  2LTP A;  2UXP A;  4B1R A;  5EGO B;  2JA8 J;  3ON4 A;  5D18 A;  3VUQ A;  4DW6 A;  4Y7N J;  2LKX A;  1XS9 A;  5EEA A;  2OF7 A;  3CDL A;  1AKH B;  3S2H J;  2QIB A;  5IPA A;  2HQ5 A;  5IOY A;  1GDT A;  2LLK A;  1H89 C;  1Y1W J;  1A6I A;  3TP0 A;  3BJB A;  3BG5 A;  3K7A J;  1S7E A;  3QPL A;  3SDG A;  3IH4 A;  4B3A A;  4ME9 A;  2XB5 A;  4JKZ A;  3ZQH A;  2RAS A;  3BTL A;  3BHQ A;  1ZK8 A;  2ZOZ A;  3JRC A;  3SFI A;  1JT0 A;  2NP5 A;  2LVS A;  3HDD A;  2JN6 A;  2TCT A;  5F0F A;  3ZQI A;  1FIP A;  2COB A;  1GV2 A;  1NTC A;  1X2N A;  2CUF A;  2W48 A;  5M5X J;  3L1P A;  2GEN A;  1MBE A;  1R9T J;  5J3L A;  3I4N J;  3LNQ A;  1G2H A;  2FD5 A;  4UUS A;  3AQS A;  4IEJ A;  3O60 A;  3V78 A;  2L7F P;  4BBS J;  2H8R A;  2ME6 A;  1ETK A;  4ABZ A;  5F1J A;  3BNI A;  5D19 A;  1JT6 A;  1D5Y A;  1JGG A;  2K9S A;  1UI6 A;  4UUT A;  3BTJ A;  3Q0W A;  2NX4 A;  3JRH A;  2JMW A;  3VW1 A;  4AC6 A;  3H0G J;  3Q3S A;  2ZCN A;  3E7L A;  3NAU A;  5H9T A;  1CQT A;  1VFC A;  1U78 A;  4V2G A;  1IDZ A;  3LHQ A;  4X6A J;  3G56 A;  1UI5 A;  1NK3 P;  3NNR A;  2XGE A;  3LOC A;  5GPC A;  5EGO A;  1JJ8 C;  1UHS A;  3JRF A;  1HF0 A;  1I6H J;  5K7Z A;  1JUM A;  4HNV A;  1LE8 B;  4BY1 J;  1FEX A;  3IH3 A;  1JTY A;  1QRY A;  1RKW A;  1ITY A;  2IU5 A;  4CGR A;  1RKT A;  2FBQ A;  2EZK A;  1QVT A;  5E3M A;  3KNW A;  3MN2 A;  4FTH A;  1WH5 A;  4I76 A;  3M3Y J;  3VP5 A;  1ETY A;  2Y9Y A;  3PO2 J;  4B4C A;  3S1R J;  4AF5 A;  1ETW A;  3S2D J;  3HGY A;  2HYJ A;  2QCO A;  3DCF A;  2HXI A;  1IDY A;  2UXI A;  4JX5 A;  4BY7 J;  3OIO A;  1VND A;  3EUP A;  1LFU P;  5BNG A;  3VVY A;  4DYR A;  3TP3 A;  2D5V A;  2JA7 J;  3W6V A;  1I3Q J;  3BR6 A;  2PZ9 A;  4QIW N;  2DMU A;  3O8H A;  2DN0 A;  5FKL A;  3CMY A;  3HTH A;  1TC3 C;  2ZOY A;  1HDD C;  5C4J J;  4YZE A;  2IAI A;  2Y31 A;  3NXC A;  3GEU A;  3TW6 A;  5FMP A;  5DAJ A;  3VPR A;  2O8K A;  3AQT A;  1B72 A;  2VUM J;  3BCG A;  4GCK A;  2NVQ J;  1VI0 A;  2EZI A;  4C3H J;  2M9H A;  2HYT A;  4XIC A;  2NVX J;  2EZH A;  2ID6 A;  4XRM A;  2G0E A;  1DU6 A;  2VKV A;  5JLW A;  3VW2 A;  5HAW A;  1P7J A;  2L9R A;  2WGB A;  1BJZ A;  3PO3 J;  4JNN A;  5IYB J;  3IUV A;  1ETQ A;  2XB0 X;  5J1U A;  5C44 J;  2WUI A;  5C4X J;  3JRG A;  1PUF B;  5EFY A;  1HOM A;  4XK4 A;  2LK2 A;  1MBF A;  1I50 J;  2E2J J;  3LSP A;  2VI6 A;  2DMQ A;  2XRL A;  3JRE A;  3GTL J;  1QPI A;  3FIW A;  1WI3 A;  3CJD A;  3QPS A;  2R5Z B;  2R92 J;  2NP3 A;  3CRJ A;  3RZO J;  1BW6 A;  2WB1 N;  1DU0 A;  1IG7 A;  4AUX A;  5IYC J;  3A02 A;  1ETV A;  3B6A A;  3H3V K;  2Y2Z A;  4BBR J;  1RR7 A;  3EGQ A;  2EZL A;  2X9D A;  1ENH A;  4MFD A;  3JR9 A;  4NN1 A;  2GUH A;  4MLO A;  4HKU A;  2LP0 A;  3FIS A;  3JRD A;  3M4O J;  3KKD A;  3OSG A;  3F0C A;  4IHV A;  4AC0 A;  3GBG A;  4L5E A;  4M3G A;  2Y9Z A;  2DMN A;  5C4Y A;  3VOX A;  3BR2 A;  3S1M J;  4C2M J;  4A3F J;  2UXH A;  4FCY A;  5FHP A;  2MW8 A; 
#chains in the Genus database with same CATH topology
 1JKO C;  1SGM A;  5K7F A;  1R22 A;  4Q5S F;  2EIK H;  2TDX A;  1YO5 C;  1KQ8 A;  4YFX F;  2LY2 A;  3O8G A;  2B3W A;  3C2G A;  2K27 A;  3KCC A;  3QU3 A;  4LB6 B;  2ZJR F;  2QWW A;  1MZB A;  1QZZ A;  2VPR A;  4DZJ A;  2GLO A;  2CYY A;  4L9V A;  2OU2 A;  3IWF A;  3PUB A;  3CCJ I;  2HXO A;  3E0J B;  3KFW X;  3H9J A;  2YX4 A;  2R7S A;  2AQE A;  2DFE A;  2ZJQ F;  1WH7 A;  3OOU A;  2MLK A;  3BCA A;  2H27 A;  2O03 A;  2M4G A;  4YEL A;  2MH2 A;  3S14 J;  2DPU A;  4A3B J;  3MZ8 A;  1F43 A;  2ZSI B;  2DAO A;  3KKC A;  4MTE A;  2JA6 J;  2L9N A;  2R7R A;  2FSW A;  2DK5 A;  3K4B A;  4HSR A;  3WE3 A;  2VJ5 A;  3GX4 X;  1BJA A;  2CU7 A;  4WCG A;  2BVL A;  1U2W A;  4QWQ A;  2LDU A;  2E36 A;  1O3T A;  3T6N A;  3E1S A;  3PFY A;  3WGG A;  4CCJ A;  3K70 C;  2L7K A;  3H5N A;  3QWL A;  1GV5 A;  3C18 A;  4LIU A;  2ETH A;  2CW0 F;  3H3U A;  3OYM A;  3ZN1 A;  3QPT A;  1Z21 A;  3WU0 A;  1GT0 C;  1GHC A;  3EDP A;  2JPB A;  4IZZ A;  3L9F A;  2Y69 H;  4Y15 A;  3RKX A;  1G3W A;  1WJA A;  3HGG A;  1WI9 A;  4HF1 A;  1R49 A;  4MFE A;  3ZMD A;  1OCT C;  2UXO A;  3S3M A;  4PJL A;  3BR3 A;  5IOZ A;  2QQ9 A;  4A3M J;  3WTW C;  3I3L A;  2CV0 A;  2H6C A;  4GFB A;  4A69 C;  3Q0V A;  3UNG C;  2PG4 A;  4AVP A;  5B1B H;  1GUU A;  4A5M A;  1JKQ C;  4U0Y A;  3ZN0 A;  2FBI A;  3P9I A;  3FHN A;  1ETX A;  3N05 A;  5ILV A;  3FXL A;  5M3M J;  1PYV A;  1I27 A;  3O6B B;  3MNL A;  4PFP A;  3HIM A;  1GLN A;  4IRV A;  1LKX A;  2IGK A;  5K58 A;  2RKH A;  5CPR B;  3H3Z A;  3WG9 A;  3OS0 A;  4S0H B;  3CLO A;  1IUF A;  2GM4 A;  2V9P A;  1E2X A;  4D5F A;  1T38 A;  4LK1 F;  5EZG A;  2LMD A;  1ZGW A;  1HLV A;  1YRN A;  3ASN H;  5B66 C;  2OD5 A;  1YJN I;  1R5I D;  3KYD B;  2L7M P;  4HV5 A;  2QTQ A;  3BTC A;  1OCC H;  4PJM A;  2DJN A;  1XB4 A;  2DTZ A;  2CQX A;  4Q48 A;  3QU6 A;  3TED A;  2VT3 A;  1OFC X;  2W57 A;  3BG6 A;  3GFI A;  1WGX A;  3QYF A;  1X58 A;  1SD5 A;  1R1U A;  3ECH A;  2DYS H;  5BOX A;  3MKW B;  2BXY A;  1SMT A;  2M5W A;  2KDZ A;  2HKU A;  4BJT A;  3GTG J;  1WKM A;  2W7N A;  4KIT B;  2VJ4 A;  2B1E A;  1U6G A;  4PCQ A;  2H1K A;  4HX8 A;  1W5C C;  1EH6 A;  2MYS A;  5F27 A;  3QBM A;  3VOD A;  3LMM A;  5KNL A;  5D4R A;  1P2F A;  2YVE A;  1OCZ H;  3DBR B;  3RJP A;  5HOD A;  2O6G E;  4M9S A;  2E1N A;  2XAJ A;  3ZCO A;  1O4X A;  2P7C B;  1JHH A;  3V8L A;  3CDI A;  2VBW A;  2A68 F;  3R60 A;  4M6Y A;  4DQ2 A;  2ECC A;  1JI8 A;  3HPH A;  3SJM A;  3M9A A;  5IP9 J;  2YU9 J;  3I4M J;  1F1Z A;  5F04 A;  4BAY A;  4M3E A;  3FMR A;  1KYW A;  4ACI A;  1LUJ B;  1R1T A;  4MXM A;  3CCY A;  4I0A A;  2ZME C;  1UFM A;  2R7W A;  4JX6 A;  4P96 A;  2R7Z J;  2PMZ N;  1K4T A;  4Y3O A;  3VDX A;  2R5Y A;  3U1D A;  2HOA A;  4NDL A;  3I58 A;  1FNN A;  4DYQ A;  4EJU A;  1FYL A;  2BXZ A;  5CLS A;  2VBZ A;  3I0T A;  3K69 A;  1B8I B;  2L9V A;  2KFD A;  3CC7 I;  4KN7 X;  1P7I A;  1Q1V A;  3F8M A;  3IAS 2;  1JE8 A;  2AS5 F;  4KIF A;  4CCO A;  2CV2 A;  3BRO A;  1ERD A;  3DV8 A;  4CH7 A;  4M71 A;  2WBM A;  2AO9 A;  1A6Q A;  3ON2 A;  1IAW A;  4CCM A;  1MMA A;  2GOX B;  2PMZ A;  5J4Y A;  1SFX A;  4HLY A;  3SEQ A;  3FBI B;  3CCE I;  2DT7 B;  2Z99 A;  2NS8 A;  3OIP A;  1N78 A;  4UDS A;  4LOC A;  2EJR A;  1YJ9 I;  3OYK A;  2LFB A;  4XKW A;  3K1P A;  5K7H A;  3NAR A;  3GZI A;  2EIN H;  2H1L A;  1Z9C A;  4NBQ A;  3A03 A;  2DA4 A;  4V2F A;  3S8P A;  3HIF A;  3ABL H;  4PJN A;  3P7N A;  5CXI A;  4FE7 A;  4UV9 A;  1JKP C;  4F91 B;  3BZ6 A;  3OYL A;  2JSC A;  2E2H J;  3K1N A;  4RAG A;  1PJR A;  4I6Z A;  1H88 C;  4XOP A;  4A3G J;  2FU4 A;  2HFH A;  3DEW A;  1MSE C;  1XMK A;  4R1H A;  1OIS A;  3WTV C;  4AWX B;  1N77 A;  2OI8 A;  2KKO A;  4C2T A;  3LAP A;  5D1R A;  4BHP A;  1Y39 A;  3KZI C;  4TV7 A;  2F4M B;  4M3F A;  2DFF A;  1T39 A;  2RHA A;  3HTA A;  1HST A;  4E7K A;  1HDP A;  5GPA A;  4JL3 A;  2UXU A;  3HZJ A;  3KIO A;  3HTI A;  4E4H A;  3VOE A;  5E1X A;  2PBI A;  3NI7 A;  1DGR M;  4EGZ A;  4L5J A;  3F1B A;  5F1R A;  4BQA A;  2OCE A;  5FLV A;  2WB1 A;  2ZXI A;  3CES A;  2V7F A;  4XON A;  5M3F J;  2Z16 A;  5KAF C;  1KYZ A;  5D8L B;  2XGX A;  2DMT A;  4CO8 A;  5DS9 A;  2D45 A;  4CYC B;  2NVU B;  2HI3 A;  4QTR A;  1G3Y A;  1TQP A;  3P9C A;  2GBY A;  1NH3 A;  4IRG A;  3I55 I;  1PP8 F;  3HRU A;  2PBX A;  4Y52 J;  4Q4Z F;  2ZCX A;  3OYE A;  3FKI J;  2CGP A;  4XLC A;  4IQJ A;  3BP8 A;  2I5U A;  1TT0 A;  3CF5 F;  1LDJ A;  2ZXJ A;  2HVR A;  2F5C A;  5ED4 A;  3DEU A;  4IHY A;  3H5A A;  3DWL E;  2BGC A;  2JTV A;  4P5O A;  3O3K A;  4U9N A;  2X4H A;  3OYJ A;  2OQR A;  3GF2 A;  4FET A;  1B4A A;  1VF9 A;  1Z77 A;  4N0B A;  5HBU A;  1ZLK A;  2MFZ A;  5D18 A;  4IKF A;  3FXM A;  3K4N A;  3D0S A;  2ZJP F;  2LKX A;  4RM2 A;  4ZYA A;  2LBF B;  2L2O A;  2XAU A;  3A4C A;  3R0J A;  1VQ6 I;  3CDL A;  3TOA A;  1HBX G;  1OYY A;  3S2H J;  3A1Y A;  3FMS A;  1OLT A;  1GDT A;  3JTH A;  4Y13 A;  1V4R A;  2QBY A;  2W85 A;  5L3E A;  2K02 A;  3V7R A;  1Z1D A;  2A5Y B;  2ZC2 A;  1E3P A;  2VJI A;  4A0Y A;  2XB5 A;  2XKO A;  3DEE A;  4Z6Y A;  2RAS A;  4OAY A;  4NNJ A;  3WOD F;  3KYC B;  3SFI A;  4ZZD A;  1JT0 A;  2NP5 A;  2LVS A;  1QHH D;  3HDD A;  3DTI A;  4YRV A;  3DBH B;  3ZQI A;  5JHU A;  2UUZ A;  4KJZ A;  2COB A;  1NTC A;  2CUF A;  2W48 A;  4OD4 A;  2VXD A;  5J3L A;  2DYR H;  3X2Q H;  3SZP A;  5JFR A;  1G59 A;  1V54 H;  2E34 A;  2FD5 A;  2ZXH A;  3HUG A;  1A31 A;  1NHA A;  2XUB A;  3BPX A;  3AQS A;  2P7V B;  2LF7 A;  2V4J C;  2H8R A;  5FO5 A;  1P4A A;  4G7Z F;  3HSF A;  1GVJ A;  4EM1 A;  2XAS A;  1YIJ I;  1BOB A;  3BZC A;  5D19 A;  4U7D A;  4AIK A;  3K4K A;  2K9S A;  2QA4 I;  4UUT A;  1UI6 A;  1JHF A;  1WJE A;  2XF5 A;  1MDM A;  3QOE A;  1UG0 A;  1O3S A;  3LST A;  1L0O C;  3E7L A;  3TMO A;  3C7J A;  1U78 A;  3U9G A;  2VT2 A;  4X6A J;  3G56 A;  4KIC A;  1UI5 A;  2FMY A;  1NK3 P;  4E70 A;  1FC3 A;  2WAQ A;  4RLQ A;  3NNR A;  3LOC A;  2DI3 A;  4ZYD A;  5GPC A;  1JJ8 C;  3JRF A;  1I6H J;  2FF4 A;  2FNP A;  2XAH A;  3SYT A;  1I3A A;  5K7Z A;  4BEH B;  4BY1 J;  4ZYG A;  1FEX A;  1QRY A;  2IU5 A;  2Z5U A;  3QRF F;  4E7Z A;  2QSF X;  4CZC A;  4OU0 A;  3AKZ A;  3HRM A;  4FTH A;  1WH5 A;  1RZ4 A;  1ZHF A;  2K3P A;  1UHW A;  4I09 A;  3M3Y J;  1RR8 C;  1G3S A;  1J9I A;  1R5H A;  1WQ2 A;  4B4C A;  4KDP A;  1OCO H;  2KZV A;  3S1R J;  4RS8 A;  3DP7 A;  3HGY A;  1R7J A;  2P5K A;  1FP2 A;  2HXI A;  1IDY A;  3HHH A;  4BY7 J;  3OIO A;  1SVL A;  3EUP A;  4UV8 A;  1LFU P;  3O2P E;  5BNG A;  1YHQ I;  3VVY A;  4UXN A;  1YS6 A;  3KEO A;  4ZTF A;  2DDA A;  5KVR A;  2PZ9 A;  5ILU A;  2VN2 A;  1TC3 C;  4BS9 A;  2ZME B;  2NNY A;  4YZE A;  1X1A A;  1DPR A;  1EA3 A;  1MMD A;  2X1D A;  1EKE A;  2MD5 A;  2Y31 A;  4EJT A;  2O8X A;  3TW6 A;  1X1B A;  4XKB A;  3IKT A;  3NS4 A;  5TIS C;  4L0Z B;  5L3F A;  3AQT A;  1W7P A;  1B59 A;  2F4O B;  1AWC A;  2M7A A;  3VTI A;  2NVQ J;  1VI0 A;  2O5R A;  1AA7 A;  2UZK A;  1TW2 A;  4XRM A;  2AQF A;  2IJL A;  5BPI A;  3ROU A;  1P7J A;  4PGH A;  2WGB A;  1Z05 A;  1WWX A;  1YX5 A;  1D3Y A;  2EA2 A;  1D1B A;  5IYB J;  3IUV A;  2LRE A;  2OCC H;  2ZNZ A;  4CZZ A;  3W6K B;  1KA8 A;  3PSF A;  1VQM I;  1IRG A;  5C4X J;  4IQ4 A;  1I5Z A;  2FEZ A;  3JRG A;  3S3N A;  4MGR A;  4CUG A;  1MBF A;  1I50 J;  2JZY A;  5DM7 F;  2E2J J;  4NUB A;  2VI6 A;  2XRL A;  3JRE A;  4XLF A;  3FM5 A;  1M1E B;  2HTJ A;  1VZ0 A;  4LLG F;  1J75 A;  2X6W A;  4F92 B;  5HNH A;  2BYV E;  2RDP A;  2R92 J;  3CRJ A;  3ZQQ A;  1DU0 A;  3QYE A;  1TTY A;  2YVX A;  2ZKZ A;  4AUX A;  1YTY A;  3HL2 A;  1FX7 A;  2LRD A;  3A02 A;  4WK8 F;  3OY9 A;  1SAU A;  2X9D A;  4MFD A;  1LVK A;  2A05 A;  2A61 A;  1D8J A;  3CO7 C;  3H0D A;  3JRD A;  5FFX A;  5HLT A;  3OS2 A;  2P4W A;  1S72 I;  4BHC A;  4M3G A;  3KP7 A;  3MFK A;  1YG2 A;  3SFZ A;  4BE0 A;  3VOX A;  1EH7 A;  2PFB A;  2OQG A;  3LA3 A;  3S1M J;  3IUO A;  4A3F J;  2UXH A;  4B47 A;  2AXT C;  3CCM I;  2FJ1 A;  2EA4 A;  2KL4 A;  5BS6 A;  3QKX A;  3Q5F A;  1FZP B;  3MWM A;  4M6V A;  4N9I A;  5DD8 A;  3LAJ A;  4HAM A;  3G1M A;  1MBJ A;  3F23 A;  3W2V A;  4MQV A;  4HQE A;  3BG3 A;  2CUE A;  4D7N A;  4IHW A;  4JQF A;  1RUN A;  2YS9 A;  2Q24 A;  4GXO A;  4RGR A;  2RAE A;  3CUQ C;  1NG7 A;  2F48 A;  2YSR A;  4HDV A;  2GIZ A;  1NK2 P;  5FKO A;  4L18 B;  2EQR A;  1X1P A;  3BQY A;  2W1O A;  5L3B A;  4N4O B;  5LEK A;  1MMG A;  5IP7 J;  1LFP A;  4OIN F;  3HC7 A;  4XRS A;  4ETS A;  1QGP A;  4L62 A;  2CJJ A;  5J4V A;  5E1Z B;  4ENM A;  3J7A Y;  1X3U A;  2QYO A;  1IN7 A;  1I39 A;  1Z91 A;  2IGM A;  3QP5 A;  3JRI A;  3OYA A;  2KZG A;  3CCR I;  1TZL A;  2K3F A;  3IWZ A;  3CC2 I;  1Z7L A;  3JRB A;  4MK6 A;  2AXL A;  4G6D A;  4MO7 A;  2XIG A;  4WX9 A;  1X2M A;  1REP C;  2HPM A;  3CUO A;  3OYN A;  2GAU A;  4O6J A;  3COL A;  4RDU A;  1T8I A;  1RI7 A;  1HKS A;  1KU9 A;  1O57 A;  3OR1 C;  3L09 A;  1BIB A;  3E6M A;  3VYT B;  3IHU A;  3S15 J;  1D5V A;  4BEH A;  2NXN B;  1H8A C;  1XGM A;  2XAG A;  4KN4 X;  2M8G X;  3QPH A;  2QEX I;  1WFX A;  4HF2 A;  1J0R A;  2LYC A;  3RTR A;  2DA7 A;  1R36 A;  2MC3 A;  3PM1 A;  5HDN A;  4CHU A;  2M1B A;  1FSE A;  3HTJ A;  2OC6 A;  1TWG J;  3HJE A;  1D8K A;  1XD7 A;  4KIS A;  3K9T A;  3R6S A;  3VSL A;  2E5Z A;  2XPV A;  2BVM A;  3GVA A;  5A2Q K;  3RDI A;  3F8F A;  2G7G A;  2R7T A;  4D5C A;  2ELH A;  2K86 A;  4IJA A;  5CQG A;  1S7A A;  1J5Y A;  1WJF A;  3CJR B;  4Y33 A;  5FLM J;  1FIA A;  1ON2 A;  3HOX J;  2ZB9 A;  1F4K A;  3F6O A;  4UB6 C;  3ULQ B;  1MGT A;  2G7L A;  4I98 B;  1TNT A;  5H6Q A;  1A5J A;  2QSG X;  3ZXS A;  3CCU I;  1TW3 A;  1FSH A;  2E60 A;  3PUF A;  1R4M B;  2KIM A;  4CYD A;  4IOC F;  2D1V A;  4JX4 A;  1BI0 A;  3C3W A;  2VE8 A;  5AQC A;  3BR1 A;  1YW9 A;  2EV0 A;  1MW7 A;  2L5Q A;  1FOX A;  1BR2 A;  4GFK A;  5TGT A;  1LDK B;  4X1E A;  2E1M C;  3ZQC A;  3DKX A;  3HSE A;  1Z0X A;  2R7U A;  3HRT A;  2WTE A;  3RZD J;  1UG2 A;  4G6Q A;  3D5L A;  3PNT A;  2JWT A;  4XOR A;  2NVY J;  2HEO A;  3KZZ A;  5ILS A;  4GFL A;  1U8R A;  3PFI A;  2K40 A;  2WAD A;  3OMY A;  2NYX A;  5F6F A;  2CQQ A;  2G7H A;  4YIR X;  1TWA J;  2Z33 A;  2JJ7 A;  2OAZ A;  1P6R A;  1TQI A;  1WJD A;  4DYC A;  5CKT A;  3BT9 A;  1D1C A;  3C07 A;  3HB9 A;  3U1K A;  4M3B A;  4BE2 A;  1R23 A;  1U0J A;  4MIM A;  1W36 C;  1X4O A;  1MJ9 A;  2CWE A;  1WZ2 A;  2NVT J;  5LHG A;  5TRD A;  3MQ0 A;  2X1C A;  4HW0 A;  2REK A;  3A0H C;  4BDZ A;  3R0A A;  1BC7 C;  3FKJ A;  1TWH J;  4GGG A;  2ZJ2 A;  5H2F C;  1VQ5 I;  3PPB A;  5DTD A;  2O3F A;  1N75 A;  5F0H A;  4ZDP A;  2XGC A;  1ZGA A;  4LMY A;  3Q9V A;  4DZP A;  3JAM K;  5FGL A;  4O5V A;  4RAF A;  3CDH A;  2YUS A;  3EQL F;  3HKZ A;  3PNV A;  1ZEL A;  1L3L A;  3ONQ A;  2KRF A;  1DP7 P;  2MC4 A;  1FJL A;  3ABU A;  4KFC A;  2RRE A;  4RMN A;  3ERM A;  2E1O A;  5LHI A;  2XPU A;  2JUG A;  5FKM A;  3FRQ A;  2WAQ N;  2MG4 A;  1F36 A;  3E5X A;  4M74 A;  1ON1 A;  1OR7 A;  4NQW B;  2NOJ B;  3NWS A;  3G1L A;  1BR1 A;  2G9W A;  3C2B A;  1YE9 A;  4UVC A;  4RGS A;  2QF7 A;  4S05 A;  2EB7 A;  3NRV A;  1WCM J;  3IP4 B;  4ZH4 F;  3N97 A;  1FYM A;  2E7W A;  1T0F C;  2OER A;  4A3C J;  1J09 A;  3G1O A;  4A3D J;  3JTG A;  5IYD J;  1ETO A;  3LA2 A;  3WU2 C;  3IV5 A;  1T6S A;  5KK1 A;  3EYI A;  5JVG F;  3IRQ A;  1VQK I;  1ONV A;  3K70 D;  2N8G A;  4PJJ A;  1IF1 A;  3BTI A;  3CP2 A;  4WF2 A;  1U8B A;  2HQR A;  4R79 A;  3ZQF A;  4E7L A;  3E5U A;  4I99 C;  3VVZ A;  4XKV A;  4DNC A;  3ISP A;  2V6C A;  1K83 J;  2CFO A;  4FE4 A;  1PP7 U;  3VW0 A;  2VBX A;  2BE5 F;  3BQZ A;  1LB2 A;  2DPD A;  3F9K A;  5H6R A;  3COA C;  3H1C A;  4G12 A;  3P9T A;  2BBY A;  2JK3 A;  2QSH X;  1IGN A;  3HOV J;  1ORK A;  2X48 A;  2IEK A;  4NEL A;  4MEX F;  1BR4 A;  2Y0S N;  2ME0 A;  4UUS B;  1QU3 A;  1P9Q C;  3HEF A;  2OTJ I;  4HF0 A;  1U5T A;  5CXG A;  5FRM A;  4IHX A;  2OJE D;  3GZ6 A;  2CQK A;  4XRF A;  3PJR A;  2Y0S A;  4XOT A;  2EFP A;  3F72 A;  5K1Y A;  3FHZ A;  1APL C;  1IC8 A;  3MKL A;  3M07 A;  4HRI A;  1VQO I;  1W0U A;  2HNH A;  5GAG J;  3A0B C;  3RH2 A;  3CP8 A;  5IP6 A;  2ELK A;  2RV8 A;  4YEJ A;  5DM6 F;  2DQL A;  3ABK H;  3JCU C;  3MZY A;  2IGN A;  3K2A A;  3HOT A;  3HXL A;  3K4C A;  1JTX A;  4KIB A;  1LFB A;  1JJ6 C;  1MIJ A;  4G94 A;  1QPM A;  3HG9 A;  2LTP A;  2UXP A;  3ON4 A;  3VUQ A;  2ZXW H;  2VC1 A;  2X51 A;  1IXR C;  1W36 D;  2EK5 A;  2A07 F;  1AKH B;  5DDG A;  2EWN A;  1A6I A;  3TP0 A;  4IRH A;  3FM3 A;  2Z2S B;  2ELJ A;  3BG5 A;  3K7A J;  1F5T A;  3ELK A;  1HXD A;  3I71 A;  1IXC A;  3SDG A;  4D9J A;  5HLG A;  3FWE A;  4JKZ A;  4IF4 A;  1IRF A;  3ZQH A;  4H0E A;  3U21 A;  4XLN F;  2ZOZ A;  4X0G A;  4ENK A;  1HC8 A;  1XDS A;  2MH9 A;  3BG7 A;  2JN6 A;  2IP2 A;  4PFO A;  2TCT A;  5F0F A;  4AVZ A;  1FIP A;  3BJO A;  2KJC A;  1GV2 A;  3J81 Z;  3L1P A;  4AU7 A;  1HSJ A;  3GLL A;  1OR7 C;  2KJB A;  3ZPL A;  2BOL A;  1G2H A;  4XM3 A;  1W5S A;  2DOA A;  2LH9 A;  5LRR A;  4HPQ A;  5IT9 K;  2OBP A;  4AIJ A;  3V78 A;  1ZH5 A;  1YX3 A;  1IZ1 A;  1D0Y A;  4BBS J;  1Y56 A;  3ML6 A;  3ZR8 X;  4HOB A;  3I4P A;  3CLQ A;  1OKR A;  1UAA A;  4ABZ A;  5E79 C;  5F1J A;  3CJQ B;  5FRN A;  5JVT A;  2WC2 A;  3I53 A;  5KCM A;  3Q0W A;  3JW4 A;  2VLA A;  1X3W B;  2EFN A;  4XN0 A;  4CDG A;  2Y75 A;  3GZN B;  2NX4 A;  4G7O F;  2JMW A;  2NS0 A;  2NRA C;  3Q3S A;  2ZCN A;  5KHD A;  3WTU C;  2HGC A;  1CQT A;  3DPT A;  3LHQ A;  4EJW A;  2IA1 A;  1BN5 A;  1O3Q A;  4L9T A;  2XGE A;  1R4N B;  4DBQ A;  4LIV A;  1ZGJ A;  5CJ9 A;  3L2W A;  4J00 A;  1H0M A;  2UV1 A;  1HF0 A;  4CSW A;  3VB2 A;  3MD2 A;  2HYG D;  4K2E A;  2DOE A;  5H20 A;  1ITY A;  4BYY A;  1RKT A;  1G6N A;  2EIM H;  1UST A;  4HV6 A;  2ISY A;  4RB3 C;  1QVT A;  2HOE A;  1QO0 D;  2CW8 A;  3QYB A;  2XV4 S;  4I76 A;  3VP5 A;  2D2W A;  2QBY B;  2ZO4 A;  1R6R A;  2EPF A;  2LNB A;  2Y9Y A;  1OQY A;  3I54 A;  4ZDL A;  3T0Y A;  2XRO A;  4AF5 A;  1ETW A;  3S2D J;  2HYJ A;  3E97 A;  3L2C A;  4JX5 A;  3CMA I;  1ZRC A;  1JGS A;  1VND A;  4EJO A;  4II3 A;  4HLX A;  1FWZ A;  4DYR A;  3KET A;  3BR6 A;  4A0Z A;  4RA2 A;  3VYS B;  4QIW N;  3JSO A;  2DN0 A;  5FKL A;  3K4M A;  2WAF A;  5LBQ A;  2ZOY A;  1S9H A;  2KP6 A;  1TT5 B;  5BMZ A;  2F5F A;  4E6K G;  3NXC A;  1UEL B;  1W1W E;  3GEU A;  3DU6 A;  3RKW A;  3VPR A;  4I02 A;  3F3X A;  3G6E I;  2HVS A;  4GCK A;  2F4I A;  1K78 B;  4BAC A;  3TO7 A;  1IUY A;  3B02 A;  3HTS B;  1Y8R B;  1STZ A;  4KUM A;  2HYT A;  4XIC A;  1XSX A;  4PDK A;  3ABM H;  2VKV A;  4A5N A;  2L9R A;  3KLN A;  4JK1 X;  4JNN A;  2KHM A;  4LG0 A;  1HKT A;  3NQO A;  4WXC A;  2WUI A;  3UR3 C;  2L9S A;  2GXG A;  2W00 A;  4CCL A;  4OIP F;  5EFY A;  3RKY A;  4XK4 A;  1VTN C;  1K4S A;  3GZ5 A;  3ESW B;  2JVH A;  2QQ8 A;  4N9H A;  3LSP A;  3GTL J;  2JRM A;  4LJZ F;  3OL3 A;  2XDV A;  3FIW A;  4U0W A;  2BW3 A;  3HHG A;  1XSV A;  3F8B A;  2P6T A;  2QZ8 A;  1VQ8 I;  5CVV A;  3RZO J;  4IXA A;  1IG7 A;  5IYC J;  4BE1 A;  1ETV A;  4DGW B;  1VQL I;  1XCB A;  3C1D A;  3H3V K;  3EGQ A;  1RR7 A;  2V9K A;  1S5L C;  2JT1 A;  3L2U A;  3S2W A;  4ASN A;  1VQN I;  4NN1 A;  3OYG A;  2GUH A;  4MLO A;  1BI1 A;  2CQN A;  3TKY A;  3FIS A;  4KMF A;  3M4O J;  3KKD A;  5A2Q Z;  4IHV A;  2XC7 A;  4AC0 A;  3GBG A;  1XMX A;  4L5E A;  1FMW A;  2Y9Z A;  1XGO A;  2BHY A;  2DMN A;  2W84 A;  4Z2Y A;  2JPC A;  5C4Y A;  1IN8 A;  3EUA A;  4A6E A;  5J6X A;  2JVG A;  4MQ9 F;  4FCY A;  4MTD A;  3FXU A;  4XSX F;  5B1A H;  3OYD A;  1D0X A;  2HR3 A;  5E8G A;  5HS9 A;  3LSK A;  3ZQG A;  3LSH A;  2VIX A;  3DPL C;  1ULY A;  2PFV A;  1POG A;  1XG1 A;  2UXN A;  4A12 A;  5FKN A;  2G3B A;  4JBA A;  4C3I J;  3GTO J;  2FUG 2;  2L54 A;  2PMH A;  2WV1 A;  4A0X A;  4GO1 A;  3F6V A;  3DKY A;  1X3Z B;  5EEG A;  4XID A;  3A01 A;  4HNT A;  2B63 J;  1DPU A;  1D1A A;  2QKL B;  1QA6 A;  1MBK A;  3VSK A;  4BHB A;  3AL0 C;  3TO9 A;  5D5U B;  5EDN A;  2QM3 A;  3PIP F;  2NS7 A;  2ZBK A;  2R3S A;  2ZNY A;  4HYE A;  2WAE A;  3LWJ A;  5DD4 A;  2A6T A;  2EFO A;  4HA8 A;  2GXA A;  1KU3 A;  3G4S I;  2FA5 A;  1O7L A;  1V3F A;  1QVU A;  4C2M A;  2MLG A;  5IT3 A;  4FT8 A;  2R93 J;  1BC8 C;  4XSZ F;  3FK6 A;  3R61 A;  2B7E A;  5K5O A;  2JQ7 A;  2CO5 A;  3I5U A;  2HS5 A;  3ANG A;  2ZSH B;  3WHC A;  3WG7 H;  3CMM A;  3RYR A;  3BCB A;  2E35 A;  4AYB N;  3DU5 A;  1AKH A;  4RAZ A;  1T2K A;  5EG0 A;  3RYP A;  4D7M A;  4AD9 A;  5GTH C;  2QQB A;  3JAM Z;  3VWB A;  1X19 A;  3SXY A;  4H4K C;  3CWR A;  4ZZL A;  2Y0M A;  2BY2 A;  4JOM A;  2M0C A;  3OYI A;  3HOY J;  1ZN2 A;  4XMY A;  2XF6 A;  4GRI A;  4ZC3 A;  1RES A;  1SD4 A;  4E7I A;  1U3E M;  2E2I J;  1IV6 A;  3OYC A;  2VE9 A;  4G8X A;  2QQA A;  1IN6 A;  3ANP A;  3GUD A;  2KPM A;  2HDC A;  4GCV A;  3NRG A;  2VOD A;  1FBU A;  4UY8 I;  3IH2 A;  1A36 A;  3ABT A;  1Y8Q B;  2M30 A;  2KIQ A;  2L7Z A;  2VKH A;  4A2U A;  2VQL A;  2FQ3 A;  3DF8 A;  5EF6 A;  3UKG A;  2P8T A;  1ZKG A;  3OR2 C;  1W0T A;  4CA0 A;  3ASO H;  2QOP A;  4EGY A;  1FT9 A;  4ICH A;  2VB6 A;  3CCS I;  1QQI A;  1V5E A;  2FNA A;  4BNC A;  3ZOB A;  4A3I J;  3ZP5 A;  5EZH A;  3BZK A;  2VC0 A;  4IX7 A;  2F5D A;  1MH3 A;  1LQ1 A;  4FHT A;  2BZT A;  3RQI A;  4EM2 A;  5HLH A;  5LRS A;  3OYH A;  3BR5 A;  3JSP A;  4NB5 A;  1IW7 F;  1HW2 A;  3S1Q J;  1YLF A;  1OJL A;  3S93 A;  4BKX A;  2UXX A;  1LVA A;  3BG9 A;  1FPQ A;  5B5E C;  1XPX A;  1K61 A;  2BY0 A;  5HNF A;  4BXF A;  2GA1 A;  4W97 A;  2Z1D A;  4MEY F;  2L4M A;  2JUC A;  4LG0 B;  1MND A;  2W4S A;  2ICW G;  1MBG A;  3HKZ N;  1QBJ A;  4UVB A;  1MH4 A;  2F6C A;  3FXJ A;  4XLP F;  1YRN B;  3H92 A;  4I7H A;  1B8I A;  3VVX A;  4A3J J;  3KEY A;  3J7A O;  2VQG A;  1YFH A;  3WGH A;  2KT0 A;  2XSJ C;  2NOG A;  2Y48 A;  2FXA A;  2IVM A;  4BQQ A;  5AON A;  4S04 A;  2D6Y A;  1MJB A;  2M2E A;  3CZ6 A;  5J8F A;  4E7H A;  2FOW A;  3LA7 A;  1KON A;  2H6B A;  2JSP A;  2P81 A;  2YU3 A;  1O7F A;  4L9J A;  2HZD A;  2YX7 A;  3REO A;  2FQ4 A;  1B72 B;  4LIT A;  5E3L A;  1FYK A;  2Q8K A;  2J5O A;  5CYV A;  3BRU A;  1IRZ A;  2P6S A;  1OCR H;  5JLX A;  3KE2 A;  3PAS A;  3B81 A;  4B48 A;  1ODD A;  3AG3 H;  2IT0 A;  1A04 A;  1I1S A;  4DVY P;  2E1C A;  2VOP A;  2VKD A;  3GTM J;  3H9G A;  4A3E J;  2LKS A;  1KU7 A;  1S29 A;  4ZDO A;  2DT6 A;  1LE8 A;  4FIS A;  4RB2 C;  1K78 A;  1HW1 A;  3LSJ A;  1JUP A;  2V1N A;  1JKR C;  1E0E A;  2MSY A;  5FKK A;  2XGD A;  2R5Z A;  2M8E A;  2V6E A;  1T33 A;  3CJN A;  1Y1V J;  2IPQ X;  1WRJ A;  1ZQ3 P;  3F8N A;  5ICF A;  1TQM A;  3K4L A;  4KIG A;  2K9Q A;  4BQN A;  1U9O A;  2R5Y B;  2V9V A;  3IL2 A;  4XNF A;  3P9K A;  1E3O C;  3J81 K;  3HOZ J;  5JI6 A;  1YQA A;  5D6F A;  3K4J A;  4I01 A;  1TWC J;  3MVP A;  3CME I;  4RM3 A;  4OMZ A;  2X6O A;  4YG2 F;  1UCR A;  2EFQ A;  5DEQ A;  2RN7 A;  4CYC A;  5M5W J;  1IJW C;  2O7O A;  4E7S A;  1X1D A;  4NHJ A;  5FD5 A;  5GP9 A;  5IT9 Z;  4UB8 C;  2E7X A;  3LSM A;  1MBH A;  2V1D A;  3RD3 A;  2GOM A;  2CQ7 A;  3JSJ A;  1HKQ A;  3VOK A;  3QAH A;  3OIQ A;  3D5S C;  4IOA F;  4NC6 A;  5J47 A;  2JA5 J;  2LY9 A;  3E6C C;  4EVI A;  1B6A A;  3FDY A;  1V55 H;  5E1W A;  5B3S H;  2LD5 A;  1PVE A;  2MBF A;  1IV8 A;  2FML A;  2K4B A;  1FTT A;  1MKM A;  1RPW A;  2AHQ A;  2HTS A;  4ZYH A;  3IC7 A;  1R58 A;  4FX4 A;  1FOK A;  2RNJ A;  2OA4 A;  1R1V A;  3RSN A;  2OTL I;  3BC8 A;  5FLX K;  4PK4 A;  2JRT A;  4AID A;  2A69 F;  2A6H F;  1ZR2 A;  1MNM C;  2XDN A;  3DTE A;  5EG0 B;  2ADU A;  1HW5 A;  1LDD A;  2LBF A;  2X6X A;  3R4K A;  3OL4 A;  2CMP A;  2K4J A;  1E17 A;  5DUK A;  1G4D A;  3GXO A;  1EF4 A;  1MD0 A;  1Y0U A;  1RET A;  3J7Y J;  1ZR4 A;  2PX9 A;  3MCZ A;  2FX0 A;  2DA6 A;  4A93 J;  1XGN A;  1SFO J;  4CGZ A;  3AAF A;  1V5G A;  3GTQ J;  1SVO A;  4RBO A;  1OCP A;  4W1U A;  3D5R C;  3V8K A;  4YFK F;  2GA2 A;  4RB1 A;  3NWT A;  5K5R A;  4KWA A;  2F2E A;  3NEU A;  4XRS G;  1VQ4 I;  4B3X A;  4II2 A;  4OD5 A;  4M3D A;  5HDK A;  2W24 A;  5D6E A;  5CVR A;  3CCQ I;  2GWR A;  1K7A A;  3LWF A;  1YIT I;  1MJA A;  2CS3 A;  4B1R A;  2QUF A;  5EGO B;  3OYB A;  1DQU A;  4DW6 A;  3L2Q A;  4D1Q A;  4Y7N J;  3KP4 A;  3GFM A;  4QPO A;  1S7O A;  1XS9 A;  3FXR A;  5EEA A;  3HUG B;  3M8E A;  2DOF A;  3F8C A;  1TBX A;  4PZJ A;  2K7L A;  2HQ5 A;  5IPA A;  5IOY A;  2QIB A;  3QOD A;  2DLL A;  2M3A A;  2LLK A;  3J7Z I;  5CQE A;  3F21 A;  4ENJ A;  3K2Z A;  1H89 C;  4B09 A;  3GME A;  1MMN A;  3BJB A;  3FF5 A;  3OS1 A;  2LOO A;  1S7E A;  3QPL A;  5L3D A;  4NC7 A;  3IH4 A;  4B3A A;  4ME9 A;  1P92 A;  5F64 A;  2DT5 A;  2DTR A;  2GZW A;  3BTL A;  3BHQ A;  1ZK8 A;  2L3D A;  3JRC A;  2QVO A;  2X6Y A;  5GAE J;  1FOY A;  4CCK A;  2ZFU A;  1R71 A;  3CD6 I;  3L00 A;  2ZY9 A;  2KIF A;  1GXQ A;  5M5X J;  2LF8 A;  1X2N A;  3QP6 A;  4M73 A;  2RQQ A;  4ENN A;  2GEN A;  1MBE A;  2QGU A;  2F5E A;  1R9T J;  5J40 A;  2NNN A;  1W4M A;  3LNQ A;  4HBL A;  4UUS A;  3HYI A;  4CCN A;  4Q47 A;  4IEJ A;  4XBF A;  2CW7 A;  3O60 A;  3W2A A;  4U9L A;  2VOO A;  1X4P A;  2DDB A;  1AOY A;  3OWT A;  4UHT A;  1ETK A;  3EUH C;  5BQT A;  2YPR A;  3MZH A;  1IRX A;  2XVC A;  3PSI A;  3BNI A;  1D5Y A;  1FMV A;  3EPZ A;  4YII A;  3BTJ A;  2DCE A;  5D5V B;  1SFE A;  3P5J A;  2FBH A;  1FLI A;  3TDZ C;  3DFG A;  2DOD A;  5HOO A;  3VW1 A;  4AC6 A;  3H0G J;  4AYB A;  4YIF A;  3WTS C;  5E17 F;  1VFC A;  4V2G A;  1VQP I;  3QOP A;  2R7D A;  3A2K A;  2BEO A;  3VFZ A;  2IGO A;  2CH0 A;  1UHS A;  4BH9 A;  4BXU A;  1G3T A;  4F55 A;  1QHG A;  4HNV A;  1LE8 B;  3GLX A;  1SC7 A;  2O61 A;  4U88 A;  4IVN A;  1JTY A;  4CGR A;  4XL9 A;  2EZK A;  3KP6 A;  3G73 A;  3KNW A;  3FXQ A;  3G3Z A;  3BLY A;  2XAF A;  3BJ6 A;  3AG1 H;  1LEA A;  4B44 A;  4LD5 A;  2LKP A;  3KEQ A;  3DLL F;  2M45 A;  5BPD A;  1MDM B;  3WTZ A;  1A35 A;  1T98 A;  1EJ9 A;  2QCO A;  3DCF A;  1D0Z A;  1UHM A;  5JR3 A;  3KLO A;  2VQH A;  4NC8 A;  4EJV A;  4WXH A;  2L4A A;  1ZG5 A;  2D5V A;  2JA7 J;  3W6V A;  1I3Q J;  2PLY A;  4BL0 B;  2KIS A;  1S3J A;  1Z3Y A;  2VAS A;  3HRS A;  3O8H A;  2IA0 A;  3CMY A;  3HTH A;  5ICC A;  4IRI A;  2A6E F;  1RUO A;  2E1M B;  2HPI A;  4V19 K;  1Y0N A;  1USS A;  5DAJ A;  4F52 A;  2O8K A;  2WA0 A;  5JHF A;  3E3V A;  1ZAO A;  2MAB A;  1B72 A;  2ACJ A;  2VUM J;  3BCG A;  1WJB A;  3I56 I;  1Z6R A;  1LNW A;  1FBQ A;  5HLI A;  2EZI A;  4C3H J;  1J2X A;  4P1W A;  1KQ9 A;  3AG2 H;  2NVX J;  2EZH A;  2G0E A;  1DU6 A;  5JLW A;  4FX0 A;  1MNE A;  3PIO F;  3RQ4 A;  4BDY A;  4PSW A;  4RGU A;  5HDG A;  3PO3 J;  2V26 A;  1ZG3 A;  1F9N A;  2XB0 X;  4IHT A;  3BWG A;  3T8R A;  1ZAR A;  4B43 A;  2XF7 A;  2ESN A;  4IPA A;  2HVQ A;  2CUZ A;  2ZME A;  1X1C A;  3K6G A;  2DMQ A;  3K0L A;  2W82 A;  1SEU A;  1TNS A;  1FBS A;  1S6L A;  1QPI A;  1XCV A;  3FXO A;  2I8D A;  3QPS A;  2R5Z B;  2IW5 A;  1W7P B;  1RRJ A;  2NP3 A;  3BJA A;  3WE2 A;  3M8F A;  3ZQ7 A;  3KPH A;  3B6A A;  1RIO H;  4PSX A;  2Y2Z A;  5FGM A;  3TBI A;  4BBR J;  3WTX C;  2XKP A;  3GFL A;  4KA4 A;  3CJT B;  4LG3 A;  2K85 A;  2IS2 A;  2VON A;  2LP0 A;  3E6D A;  3OSG A;  1TLH B;  3PQK A;  1G8X A;  2BY3 A;  4OAZ A;  3SZG A;  3BR2 A;  2V1X A;  3DLA A;  1Q1H A;  5FHP A;  1PUE E;  3ZQL A;  5CW8 A;  4QSH A;  4KMU X;  2H94 A;  2LSO A;  5HSZ A;  1E3H A;  2IXS A;  2QEN A;  2KMU A;  3T5X A;  4M9Z A;  1T56 A;  4WWC A;  3CCV I;  2KRC A;  4RAY A;  4ESF A;  3CQZ J;  4EV0 A;  3OSF A;  3VYU B;  1ZRD A;  2ZCM A;  1OMI A;  1K6Y A;  2DFH A;  1TWF J;  2OZU A;  2K5C A;  2I10 A;  4KT5 C;  9ANT A;  2DO7 A;  3SQN A;  3M1E A;  1YJW I;  2O7T A;  1V5F A;  3ZMT A;  2PI0 A;  2LG4 A;  1Z67 A;  1GXP A;  2KLO A;  2KQR A;  4XLH A;  2XPW A;  3FMQ A;  4A6D A;  1J7K A;  4OWR B;  2K9N A;  3FXK A;  4LGW A;  4HG2 A;  3MMY B;  3S17 J;  4GDF A;  2DJI A;  4HST A;  3VIB A;  2HDD A;  3K1M A;  3I59 A;  4WXD A;  2W25 A;  2X1E A;  5DYM A;  2Q1Z B;  4IL6 C;  3V4G A;  5FD6 A;  4OIR F;  3LSG A;  4OIQ F;  1BM9 A;  1YS7 A;  5AIQ A;  4LLL A;  2M7B A;  2DK8 A;  4EMS A;  4LB5 A;  3L7W A;  5FJ8 J;  1J59 A;  1UB9 A;  2XAQ A;  2L02 A;  4F3Q A;  3J80 Z;  2Q0O A;  2W53 A;  3E7Q A;  1KGS A;  3LFK A;  4IO9 F;  4RB0 A;  3RPU D;  2WY8 Q;  1O3R A;  2HKO A;  3BR0 A;  2NAZ A;  2DG7 A;  3K10 A;  5ICG A;  3T8T A;  3MEX A;  2HOS A;  1CF7 A;  4M9X A;  5D5X B;  1NG6 A;  5DCM A;  4L0Y B;  2DA2 A;  4HQM A;  4ANJ A;  1XTA A;  3TO6 A;  2P0W A;  5GAD J;  4FAS D;  2ZFW A;  1N25 A;  3ZMV A;  4HDU A;  3S16 J;  1XX5 A;  2PJR A;  2VKE A;  2DG8 A;  4BGD A;  2Z9O A;  2BHZ A;  3GTP J;  1IXS B;  3CCL I;  3S3O A;  4A3K J;  1I6X A;  2O9L A;  3TQN A;  5D4S A;  1K79 A;  3ZMS A;  1BI3 A;  1FY7 A;  5D8K B;  4M72 A;  2WY7 Q;  1MSF C;  3W6J B;  4ESJ A;  5FB2 A;  3DPJ A;  4F7Z A;  2L0K A;  5E3O A;  3A01 B;  1FP1 D;  4U87 A;  3D1N I;  2DQR A;  3LSR A;  4J19 A;  3FK7 A;  5D5W B;  2G7U A;  3E6B A;  1FTZ A;  4B8X A;  4QPQ A;  4PJ0 C;  2DA1 A;  3S5R A;  2A2F X;  1YW8 A;  2XHK A;  4RGX A;  3V42 A;  5F0C A;  3G7R A;  1ZTR A;  3M1C A;  3S1N J;  1B9M A;  2IBD A;  5CVJ A;  1ZRE A;  4MHG A;  2M0M A;  5EYR A;  5LFA A;  2FRH A;  2DBB A;  1OYW A;  1VQ7 I;  5E18 F;  4C3J J;  2M34 A;  4R8H A;  2MA3 A;  4KNY A;  2V79 A;  4LLN A;  3ECO A;  1SFU A;  5FLX Z;  4A3L J;  3K8P C;  4PGG A;  3ERE D;  4EQQ A;  2Y30 A;  1YOV B;  1VQ9 I;  2XRN A;  5DUI A;  4KT6 A;  4LK0 F;  5J1R A;  2DA5 A;  1MMS A;  2QLZ A;  2LR8 A;  1Y6I A;  3AG4 H;  1KZH A;  2OV7 A;  5HVQ C;  5LGU A;  2QKO A;  3TW7 A;  2VBY A;  3AFH A;  3WTT C;  5M5Y J;  2OUM A;  2PJP A;  2TRT A;  3B6C A;  5LLQ A;  4BXX J;  2YR2 A;  2P5L C;  3JRA A;  2M4K A;  4KYW A;  4OIO F;  3WTY C;  1RC9 A;  5LGT A;  5IY5 H;  3KZ9 A;  2F07 A;  1T08 B;  3GEZ A;  5L3C A;  4JP0 A;  1OPC A;  3FX3 A;  2C6Y A;  2E19 A;  3GFJ A;  1RNL A;  3GCM A;  1JUS A;  2FJI 1;  2EH3 A;  4HX7 A;  3HOW J;  4YFN F;  4GCT A;  2PQ8 A;  4C9Y A;  2OZ6 A;  3ZGK A;  4AIH A;  3E5Q A;  2DMP A;  2Z3Y A;  3BDD A;  1BA5 A;  3N4M A;  3KP5 A;  4F93 B;  3HPG A;  3W3C A;  4L9N A;  4PUS A;  4EM0 B;  3NPI A;  1SMY F;  3HM5 A;  5EEH A;  5E3N A;  4FQG A;  5K5Q A;  3KZY A;  1H9G A;  1TP4 A;  4ZYE A;  2CRG A;  1BW5 A;  3DXJ F;  4JYK A;  2R0Q C;  4GCL A;  3HOU J;  2Q2E B;  5C3E J;  2EIJ H;  3TOB A;  3QQA A;  3DPU A;  3H9Q A;  3WHB A;  1H9T A;  3GWZ A;  1WJC A;  3Q9S A;  2A5W A;  3SZT A;  2IA2 A;  2DXI A;  3CO6 C;  2FBK A;  2G7S A;  4GYI A;  1QZE A;  1S8N A;  2A3S A;  2R7F A;  3IKV A;  2MD0 A;  3TGN A;  4BUP A;  2XSD C;  5LD2 C;  4DOZ A;  2MGQ A;  1GVD A;  5LEJ A;  5GAH J;  2H8W A;  4PXI A;  5AIP A;  2DA3 A;  2D1H A;  4CIC A;  2GFN A;  4IHS A;  3MAJ A;  2YVH A;  5LGN A;  3C2H A;  3CF2 A;  2LY1 A;  3Q0U A;  1P4X A;  2ECB A;  2VQC A;  2ISZ A;  5J1Y A;  1TL8 A;  4LFU A;  3CUQ A;  3IRR A;  4NQW A;  3RKQ A;  3VYR B;  2BY1 A;  3I9V 2;  3I59 B;  3TDU C;  1XSD A;  1AHD P;  5HS7 A;  4XN3 A;  3RCO A;  1SAN A;  3GTK J;  2ID3 A;  2V57 A;  3KYL A;  1DDN A;  1BI2 A;  2DW4 A;  1ZYR F;  2EFW A;  3GTJ J;  2X85 A;  2HDW A;  1HCR A;  3EYY A;  3H36 A;  4C30 A;  2R7V A;  3RPQ A;  4O3M A;  2EV5 A;  1WPK A;  1P4W A;  3MKZ A;  3W2W A;  5E20 A;  2CFX A;  1UMQ A;  1SAX A;  1PUF A;  5DCM B;  1QNT A;  4P55 A;  1XC5 A;  4EAT A;  2HOT A;  3SEZ A;  1BL0 A;  2H09 A;  2RGV A;  4Y4R A;  5DV5 A;  3G71 I;  4CXF A;  1HQC A;  3LJL A;  1CGP A;  1U9N A;  1XN7 A;  4BJ6 C;  1QZY A;  3BOQ A;  2DFI A;  4HZF A;  1UJ8 A;  3DKW A;  3V6G A;  3SWH A;  1KQ0 A;  2HKX A;  1AU7 A;  2WWY A;  1R5G A;  2STW A;  2EBI A;  3VEP A;  5F08 A;  2OPT A;  1ACI A;  2IS4 A;  1W7P D;  2PN6 A;  1WVR A;  2V1U A;  4J01 A;  1SD6 A;  2QWT A;  3HE0 A;  4EEF G;  3CTA A;  2B0L A;  3T1B A;  1PDN C;  4AM3 A;  3HBL A;  2EV6 A;  4HNU A;  4HX4 A;  4DIQ A;  2JA8 J;  5ERI A;  2X0L A;  1W5T A;  2COM A;  4P9U A;  3KX2 A;  1U5T B;  2WV0 A;  4HEA 2;  4ESB A;  4ZTJ A;  2R7O A;  4N4N B;  3OYF A;  2OF7 A;  3BY6 A;  2M87 A;  4OMY A;  1JXS A;  1BBY A;  3B73 A;  4ZJZ A;  1EV7 A;  1Y1W J;  1WJ5 A;  2RQP A;  4ON0 A;  2E71 A;  1YW7 A;  1ZLJ A;  2RVC A;  3EET A;  3LQQ A;  5LHH A;  2RNG A;  1WHU A;  2VXZ A;  3SDB A;  3EUK L;  2EIL H;  2QKM B;  2VJJ A;  1DUX C;  2RC4 A;  3RIR A;  3ZMZ A;  3OV8 A;  2B9S A;  2VL8 A;  4XLA A;  4UUV A;  2CV1 A;  4I0B A;  3EUH A;  3V8J A;  3DBL B;  3HSR A;  3SHF A;  3I4N J;  1CF7 B;  2LC2 A;  1SFK A;  3H5R A;  1R00 A;  3U2R A;  1T0F A;  2PJR B;  2L7F P;  2PMU A;  2ZCW A;  2IS1 A;  1Z3X A;  4D0P A;  1UZC A;  3V7S A;  3ZRG A;  2ME6 A;  1XDU A;  3G2B A;  3DTK A;  2L01 A;  2FOK A;  4G7H F;  1IN4 A;  5FRO A;  1JT6 A;  1JGG A;  3PNY A;  2JA2 A;  2GXB A;  3JRH A;  1IO2 A;  3F22 A;  2HYF A;  6PAX A;  3WGI A;  3GO5 A;  3NAU A;  3L2V A;  2J5P A;  1LPQ A;  1C0W A;  5H9T A;  2GQQ A;  2GIV A;  1IDZ A;  4G9Y A;  1IN5 A;  3RI4 A;  2KDO A;  1SVM A;  2HQN A;  5EGO A;  5L3G A;  2K9L A;  2P5V A;  3DQV C;  2R7Q A;  1JUM A;  2KIU A;  4XR6 A;  3IH3 A;  1WSU A;  2R7X A;  1RKW A;  4RLF A;  2FBQ A;  1LJ9 A;  4WIB A;  3TL4 X;  5E3M A;  3MN2 A;  2F5V A;  1ETY A;  3IAM 2;  3FBN B;  5E8I A;  3PO2 J;  5DCF A;  5HS8 A;  4QLC U;  1ZG1 A;  3GW2 A;  2K9M A;  2KRH A;  2VPL A;  3AL0 B;  2UXI A;  2CUJ A;  3WU1 B;  2ESH A;  1YI2 I;  3MKY B;  3TP3 A;  4DBR A;  4XQF A;  3RPU A;  2CSO A;  1T95 A;  1BOA A;  2DMU A;  2HZT A;  3LFU A;  4UNO A;  3KP3 A;  4BQO A;  2PEX A;  1HDD C;  5C4J J;  4OOI A;  1LEB A;  3CUQ B;  1ZRF A;  2IAI A;  2UWM A;  5FMP A;  3I64 A;  1U5T C;  3OOP A;  5CVI A;  2BW3 B;  5TJJ A;  3HOS A;  4BU2 A;  5FFZ A;  4ITV A;  4XLE A;  3M7G A;  2STT A;  3ZMU A;  4MNU A;  3BPV A;  5J8C A;  2M9H A;  4M6X A;  2ID6 A;  3VW2 A;  5HAW A;  4UVA A;  1XGS A;  1BJZ A;  2E5N A;  2HU9 A;  3LL7 A;  1ETQ A;  3J80 K;  1XMA A;  5J1U A;  5EJC A;  1Z7U A;  5C44 J;  4U0V A;  5CVU A;  1PUF B;  4E7J A;  2R4G A;  1BIA A;  1SD7 A;  3V7C A;  2CG4 A;  2HWV A;  2IRF G;  1HOM A;  2LK2 A;  1B1B A;  1I1G A;  5GTI C;  1DP3 A;  4U7B A;  3CC4 I;  3LQR A;  2FE3 A;  3CJD A;  1WI3 A;  2Q2E A;  2O0Y A;  4C2U A;  1BW6 A;  1DGW Y;  2WB1 N;  3HTU A;  3LSI A;  2IS6 A;  2DU9 A;  4Y17 A;  4BJ5 C;  1B9N A;  4XKC A;  4I2O A;  4L5I A;  3H35 A;  3FZV A;  2EZL A;  1ENH A;  3JR9 A;  3KP2 A;  5KAI C;  5ICE A;  3S32 A;  4DJA A;  1YIO A;  4HKU A;  1Z6T A;  1HA8 A;  3L2R A;  2BV6 A;  1YYV A;  3F0C A;  1OYI A;  4G6T B;  1FOW A;  1KU2 A;  3M8J A;  4GYG A;  3GYH X;  2HQA A;  3PL8 A;  4P9F A;  1K6O A;  4C2M J;  1EH8 A;  2MW8 A;  3PQJ A; 
#chains in the Genus database with same CATH homology
 3ZQL A;  1JKO C;  5CW8 A;  2FJ1 A;  4QSH A;  3ZQG A;  1SGM A;  5HSZ A;  5K7F A;  3QKX A;  1POG A;  1XG1 A;  4M6V A;  1T56 A;  5FKN A;  2G3B A;  3O8G A;  3G1M A;  4C3I J;  1MBJ A;  3GTO J;  3CQZ J;  2WV1 A;  3OSF A;  2VPR A;  3BG3 A;  2CUE A;  4D7N A;  4DZJ A;  2GLO A;  4IHW A;  2ZCM A;  1TWF J;  2YS9 A;  2Q24 A;  2I10 A;  2RAE A;  2HXO A;  9ANT A;  1NK2 P;  5FKO A;  4XID A;  3A01 A;  2B63 J;  2EQR A;  2O7T A;  1WH7 A;  3OOU A;  3BQY A;  1MBK A;  3S14 J;  4A3B J;  5IP7 J;  1F43 A;  2XPW A;  3KKC A;  5EDN A;  2JA6 J;  4XRS A;  2K9N A;  2NS7 A;  2CU7 A;  4L62 A;  2CJJ A;  3S17 J;  3LWJ A;  3T6N A;  3JRI A;  3VIB A;  1GV5 A;  2HDD A;  3JRB A;  4MK6 A;  1QVU A;  1GT0 C;  4MO7 A;  2R93 J;  1X2M A;  3LSG A;  3FK6 A;  5FJ8 J;  3COL A;  4RDU A;  2W53 A;  3ANG A;  3E7Q A;  3WHC A;  3HGG A;  4MFE A;  1OCT C;  4AYB N;  2UXO A;  1AKH A;  3BR0 A;  3BR3 A;  2DG7 A;  5IOZ A;  5EG0 A;  4A3M J;  4D7M A;  3S15 J;  2HOS A;  1H8A C;  2M8G X;  4GFB A;  3CWR A;  4A69 C;  2DA2 A;  3Q0V A;  2M0C A;  2DA7 A;  3S16 J;  3HOY J;  1GUU A;  1JKQ C;  3PM1 A;  1RES A;  1ETX A;  2E2I J;  1IV6 A;  5M3M J;  3HTJ A;  2VKE A;  2DG8 A;  3MNL A;  1TWG J;  3ANP A;  3GTP J;  3HIM A;  3NRG A;  4A3K J;  2O9L A;  2XPV A;  3IH2 A;  5K58 A;  2G7G A;  2L7Z A;  4S0H B;  4D5C A;  1MSF C;  1IUF A;  5EF6 A;  3DPJ A;  2GM4 A;  3UKG A;  4D5F A;  1ZKG A;  2L0K A;  5FLM J;  1FIA A;  1W0T A;  5E3O A;  5EZG A;  3A01 B;  1ZGW A;  3HOX J;  1HLV A;  2QOP A;  1YRN A;  2ZB9 A;  3D1N I;  4ICH A;  3LSR A;  4J19 A;  3FK7 A;  2G7L A;  2L7M P;  3ZOB A;  4A3I J;  1FTZ A;  5EZH A;  1A5J A;  2QTQ A;  1MH3 A;  3BTC A;  2DA1 A;  3S5R A;  2DJN A;  2DTZ A;  2CQX A;  3RQI A;  3TED A;  3BR5 A;  5F0C A;  1OFC X;  3G7R A;  1WGX A;  1X58 A;  4JX4 A;  3S1Q J;  1OJL A;  1ZTR A;  4BKX A;  3S1N J;  5AQC A;  2KDZ A;  1K61 A;  2IBD A;  3BG9 A;  2HKU A;  3BR1 A;  3GTG J;  5EYR A;  4GFK A;  4X1E A;  4W97 A;  3ZQC A;  2H1K A;  4C3J J;  1Z0X A;  2M34 A;  5F27 A;  3QBM A;  3RZD J;  1UG2 A;  2YVE A;  1MBG A;  2JWT A;  3HKZ N;  2NVY J;  5HOD A;  1MH4 A;  4A3L J;  1YRN B;  3VVX A;  1B8I A;  4GFL A;  4A3J J;  2Y30 A;  2K40 A;  1O4X A;  2CQQ A;  5J1R A;  2DA5 A;  1TWA J;  2LR8 A;  2JJ7 A;  2ECC A;  2KT0 A;  2QKO A;  3SJM A;  3TW7 A;  2NOG A;  4DYC A;  5IP9 J;  2YU9 J;  3BT9 A;  5M5Y J;  3C07 A;  2TRT A;  3B6C A;  3I4M J;  2D6Y A;  4BXX J;  2M2E A;  3JRA A;  5F04 A;  3HB9 A;  4M3E A;  4M3B A;  4ACI A;  4MXM A;  2P81 A;  3KZ9 A;  3CCY A;  4MIM A;  2FQ4 A;  1B72 B;  2F07 A;  4JP0 A;  5E3L A;  2E19 A;  1JUS A;  4JX6 A;  2EH3 A;  2NVT J;  2R7Z J;  2PMZ N;  3BRU A;  1IRZ A;  3HOW J;  4GCT A;  2REK A;  5JLX A;  2R5Y A;  2HOA A;  4NDL A;  4DYQ A;  3PAS A;  3B81 A;  1TWH J;  1BA5 A;  2DMP A;  3PPB A;  1B8I B;  5DTD A;  5F0H A;  1P7I A;  1Q1V A;  3NPI A;  2XGC A;  3HM5 A;  4DZP A;  3GTM J;  5FGL A;  4A3E J;  5E3N A;  2YUS A;  1LE8 A;  1FJL A;  2CRG A;  2AO9 A;  4FIS A;  1BW5 A;  3ON2 A;  2E1O A;  4JYK A;  2XPU A;  5FKM A;  2R0Q C;  3FRQ A;  2WAQ N;  3LSJ A;  2MG4 A;  1F36 A;  1JUP A;  3HOU J;  5C3E J;  4GCL A;  1JKR C;  2MSY A;  5FKK A;  2XGD A;  3QQA A;  3G1L A;  3C2B A;  3WHB A;  2R5Z A;  2NS8 A;  4UDS A;  1T33 A;  4LOC A;  2QF7 A;  1Y1V J;  1WCM J;  2LFB A;  5K7H A;  3NAR A;  3GZI A;  1ZQ3 P;  2G7S A;  2OER A;  3A03 A;  4A3C J;  5IYD J;  2DA4 A;  3G1O A;  4V2F A;  4A3D J;  1ETO A;  2XSD C;  2K9Q A;  1U9O A;  2R5Y B;  5CXI A;  2MGQ A;  1GVD A;  4FE7 A;  3IV5 A;  1JKP C;  1E3O C;  4PXI A;  3HOZ J;  2DA3 A;  2E2H J;  1TWC J;  3MVP A;  2GFN A;  2YVH A;  4I6Z A;  1H88 C;  2X6O A;  4A3G J;  3DEW A;  1MSE C;  2N8G A;  4CYC A;  5M5W J;  1IJW C;  2O7O A;  3Q0U A;  3BTI A;  2ECB A;  1U8B A;  5GP9 A;  5J1Y A;  1MBH A;  3RD3 A;  3ZQF A;  2OI8 A;  5D1R A;  3JSJ A;  3VOK A;  3VVZ A;  3RKQ A;  4M3F A;  2RHA A;  1K83 J;  3HTA A;  1AHD P;  1HDP A;  5GPA A;  4JL3 A;  2UXU A;  3VW0 A;  4FE4 A;  1SAN A;  2JA5 J;  3HTI A;  2LY9 A;  3BQZ A;  3GTK J;  2ID3 A;  2V57 A;  2LD5 A;  3NI7 A;  3GTJ J;  1HCR A;  1FTT A;  4G12 A;  3P9T A;  2JK3 A;  1RPW A;  2AHQ A;  1IGN A;  3HOV J;  1ORK A;  1WPK A;  3F1B A;  5FLV A;  2X48 A;  2IEK A;  4NEL A;  2Y0S N;  4UUS B;  2ME0 A;  1ZR2 A;  1MNM C;  2XDN A;  5M3F J;  5EG0 B;  1UMQ A;  3HEF A;  5CXG A;  2DMT A;  5DS9 A;  1PUF A;  4IHX A;  4CYC B;  2HI3 A;  4QTR A;  2GBY A;  1EF4 A;  1XC5 A;  1RET A;  1ZR4 A;  2HOT A;  1BL0 A;  4Y52 J;  2PBX A;  2ZCX A;  1APL C;  2FX0 A;  2DA6 A;  3FKI J;  4A93 J;  3LJL A;  1IC8 A;  3MKL A;  1W0U A;  1U9N A;  1SFO J;  3GTQ J;  3RH2 A;  4RBO A;  1OCP A;  4W1U A;  3V6G A;  5IP6 A;  2ELK A;  1AU7 A;  4KWA A;  4XRS G;  4IHY A;  2EBI A;  5F08 A;  2OPT A;  4M3D A;  3K2A A;  1JTX A;  2QWT A;  3HE0 A;  4EEF G;  1JJ6 C;  1LFB A;  5HBU A;  1VF9 A;  3HBL A;  1Z77 A;  2LTP A;  2UXP A;  4B1R A;  5EGO B;  2JA8 J;  3ON4 A;  5D18 A;  3VUQ A;  4DW6 A;  4Y7N J;  2LKX A;  1XS9 A;  5EEA A;  2OF7 A;  3CDL A;  1AKH B;  3S2H J;  2QIB A;  5IPA A;  2HQ5 A;  5IOY A;  1GDT A;  2LLK A;  1H89 C;  1Y1W J;  1A6I A;  3TP0 A;  3BJB A;  3BG5 A;  3K7A J;  1S7E A;  3QPL A;  3SDG A;  3IH4 A;  4B3A A;  4ME9 A;  2XB5 A;  4JKZ A;  3ZQH A;  2RAS A;  3BTL A;  3BHQ A;  1ZK8 A;  2ZOZ A;  3JRC A;  3SFI A;  1JT0 A;  2NP5 A;  2LVS A;  3HDD A;  2JN6 A;  2TCT A;  5F0F A;  3ZQI A;  1FIP A;  2COB A;  1GV2 A;  1NTC A;  1X2N A;  2CUF A;  2W48 A;  5M5X J;  3L1P A;  2GEN A;  1MBE A;  1R9T J;  5J3L A;  3I4N J;  3LNQ A;  1G2H A;  2FD5 A;  4UUS A;  3AQS A;  4IEJ A;  3O60 A;  3V78 A;  2L7F P;  4BBS J;  2H8R A;  2ME6 A;  1ETK A;  4ABZ A;  5F1J A;  3BNI A;  5D19 A;  1JT6 A;  1D5Y A;  1JGG A;  2K9S A;  1UI6 A;  4UUT A;  3BTJ A;  3Q0W A;  2NX4 A;  3JRH A;  2JMW A;  3VW1 A;  4AC6 A;  3H0G J;  3Q3S A;  2ZCN A;  3E7L A;  3NAU A;  5H9T A;  1CQT A;  1VFC A;  1U78 A;  4V2G A;  1IDZ A;  3LHQ A;  4X6A J;  3G56 A;  1UI5 A;  1NK3 P;  3NNR A;  2XGE A;  3LOC A;  5GPC A;  5EGO A;  1JJ8 C;  1UHS A;  3JRF A;  1HF0 A;  1I6H J;  5K7Z A;  1JUM A;  4HNV A;  1LE8 B;  4BY1 J;  1FEX A;  3IH3 A;  1JTY A;  1QRY A;  1RKW A;  1ITY A;  2IU5 A;  4CGR A;  1RKT A;  2FBQ A;  2EZK A;  1QVT A;  5E3M A;  3KNW A;  3MN2 A;  4FTH A;  1WH5 A;  4I76 A;  3M3Y J;  3VP5 A;  1ETY A;  2Y9Y A;  3PO2 J;  4B4C A;  3S1R J;  4AF5 A;  1ETW A;  3S2D J;  3HGY A;  2HYJ A;  2QCO A;  3DCF A;  2HXI A;  1IDY A;  2UXI A;  4JX5 A;  4BY7 J;  3OIO A;  1VND A;  3EUP A;  1LFU P;  5BNG A;  3VVY A;  4DYR A;  3TP3 A;  2D5V A;  2JA7 J;  3W6V A;  1I3Q J;  3BR6 A;  2PZ9 A;  4QIW N;  2DMU A;  3O8H A;  2DN0 A;  5FKL A;  3CMY A;  3HTH A;  1TC3 C;  2ZOY A;  1HDD C;  5C4J J;  4YZE A;  2IAI A;  2Y31 A;  3NXC A;  3GEU A;  3TW6 A;  5FMP A;  5DAJ A;  3VPR A;  2O8K A;  3AQT A;  1B72 A;  2VUM J;  3BCG A;  4GCK A;  2NVQ J;  1VI0 A;  2EZI A;  4C3H J;  2M9H A;  2HYT A;  4XIC A;  2NVX J;  2EZH A;  2ID6 A;  4XRM A;  2G0E A;  1DU6 A;  2VKV A;  5JLW A;  3VW2 A;  5HAW A;  1P7J A;  2L9R A;  2WGB A;  1BJZ A;  3PO3 J;  4JNN A;  5IYB J;  3IUV A;  1ETQ A;  2XB0 X;  5J1U A;  5C44 J;  2WUI A;  5C4X J;  3JRG A;  1PUF B;  5EFY A;  1HOM A;  4XK4 A;  2LK2 A;  1MBF A;  1I50 J;  2E2J J;  3LSP A;  2VI6 A;  2DMQ A;  2XRL A;  3JRE A;  3GTL J;  1QPI A;  3FIW A;  1WI3 A;  3CJD A;  3QPS A;  2R5Z B;  2R92 J;  2NP3 A;  3CRJ A;  3RZO J;  1BW6 A;  2WB1 N;  1DU0 A;  1IG7 A;  4AUX A;  5IYC J;  3A02 A;  1ETV A;  3B6A A;  3H3V K;  2Y2Z A;  4BBR J;  1RR7 A;  3EGQ A;  2EZL A;  2X9D A;  1ENH A;  4MFD A;  3JR9 A;  4NN1 A;  2GUH A;  4MLO A;  4HKU A;  2LP0 A;  3FIS A;  3JRD A;  3M4O J;  3KKD A;  3OSG A;  3F0C A;  4IHV A;  4AC0 A;  3GBG A;  4L5E A;  4M3G A;  2Y9Z A;  2DMN A;  5C4Y A;  3VOX A;  3BR2 A;  3S1M J;  4C2M J;  4A3F J;  2UXH A;  4FCY A;  5FHP A;  2MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...