2G0EA

Structure of qacr multidrug transcriptional regulator bound to trivalent and bivalent diamidine drugs
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
rcsb
source organism Staphylococcus haemolyticus
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2g0eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2g0eA02
5F27A 2GENA 4Y7NJ 1BW6A 2EZIA 4XRSA 2FD5A 2M9HA 2WV1A 3NRGA 2Y9YA 4FTHA 1RR7A 1MBJA 4XIDA 4FCYA 4CGRA 2R5YB 1FIPA 2XGEA 2DG8A 3V6GA 4A3FJ 2REKA 3P9TA 2O8KA 2LD5A 4HKUA 3CDLA 4A3CJ 4L5EA 3BTIA 4C3IJ 2EZKA 4A69C 1ZQ3P 3SFIA 1JUSA 4BY7J 3SJMA 4G12A 1RKWA 1XG1A 2IU5A 4I76A 4XRMA 1JJ6C 1BW5A 1GUUA 1POGA 2M34A 4D5FA 1YRNB 3S14J 2RHAA 3RD3A 4M6VA 1IV6A 2ELKA 2GBYA 5J3LA 3Q0WA 3S5RA 1ETYA 1MNMC 1HF0A 3VW2A 4I6ZA 1H88C 4UUSB 4A3LJ 1Z0XA 5D1RA 3HTIA 4W1UA 4Y52J 2R5ZA 2E2JJ 1FTTA 3JR9A 1WGXA 3BTLA 3MKLA 2VI6A 1P7IA 3T6NA 2Y2ZA 3RH2A 1MBKA 1IDYA 2DJNA 3BQZA 1S7EA 3A01B 2HOSA 4MO7A 3M4OJ 5CXGA 5FKOA 1VI0A 3IV5A 2QKOA 3E7LA 3G1MA 4B3AA 5FLVA 2LFBA 1QVUA 4AYBN 4AF5A 5K7FA 5D18A 2JWTA 1W0UA 5FKKA 1HDDC 2DA6A 1UI6A 2AHQA 4M3EA 3LOCA 2DA1A 3A02A 5M5WJ 3VVXA 5E3NA 4J19A 2DA5A 2EH3A 2KDZA 2COBA 1NTCA 2JN6A 1BJZA 1TWCJ 1WCMJ 1TWGJ 2L7FP 4A3IJ 2XRLA 3ON2A 3JREA 1Q1VA 2HYJA 1JJ8C 5E3LA 3NXCA 4A3KJ 1W0TA 3BRUA 1I3QJ 1OCPA 1ETKA 4JYKA 4GFKA 2DTZA 5GPAA 2HKUA 1IC8A 4KWAA 5J1RA 4B1RA 1O4XA 1SANA 1Y1WJ 3EUPA 4D5CA 2JA7J 2ME6A 2LKXA 2FQ4A 3IH3A 3ZQGA 5F08A 5IYCJ 5EZGA 1ORKA 4X6AJ 4DW6A 4EEFG 2UXPA 3ZQIA 2O9LA 1TWAJ 4W97A 1APLC 3GTKJ 3BTJA 3RQIA 2ZOYA 3COLA 1SGMA 2XPWA 1CQTA 2MGQA 2D5VA 5F04A 3HOYJ 3VVZA 2UXIA 3HIMA 3B6AA 3CQZJ 3L1PA 1JKQC 2VUMJ 4FE7A 3M3YJ 1AHDP 3MVPA 2YU9J 2HXIA 1JT6A 2NS7A 3TP3A 2EZHA 2XB0X 3BR1A 2O7OA 3IUVA 3SDGA 3CCYA 3NNRA 3QQAA 3O8GA 4MLOA 5E3MA 4LOCA 4IHYA 3G56A 3HOZJ 3S16J 3ZQLA 3KKCA 3HGGA 1OFCX 5M5YJ 3NARA 2LLKA 3GTPJ 1ZGWA 2K9SA 1F36A 3LNQA 3VIBA 3DCFA 5IP9J 1JTXA 4A93J 5M3FJ 2L9RA 3BTCA 3G7RA 4BBSJ 1B72B 4RDUA 1VFCA 2L7MP 3QPLA 1H89C 2M8GX 3PPBA 1X2MA 3O60A 3WHCA 1TWFJ 3PM1A 2OPTA 3S15J 4RBOA 2K9NA 2FJ1A 4C3JJ 5EEAA 4IEJA 4V2GA 2HI3A 1U78A 3MNLA 2X6OA 3LSGA 4UDSA 4GCKA 3ZQFA 3OSFA 2HYTA 5K58A 1RKTA 3BG5A 4D7NA 3HE0A 5EG0A 5EGOA 1ZKGA 5FLMJ 1F43A 1XS9A 2LP0A 1G2HA 1VF9A 3HKZN 4JX6A 3K7AJ 1GVDA 2QCOA 5EF6A 2N8GA 3BG3A 3UKGA 1JGGA 3FKIJ 3FISA 3HGYA 3TEDA 5EFYA 2VKVA 4IHXA 2XGCA 5FKMA 2JA8J 4JKZA 5M3MJ 3BR5A 1AKHB 3W6VA 4L62A 3VW0A 1LFBA 1ENHA 4A3EJ 3HTAA 3ZQCA 2H1KA 1B8IA 1JKRC 2WB1N 3VOXA 4M3FA 4C3HJ 1R9TJ 1JT0A 2OF7A 5FMPA 1HOMA 3IH4A 2DMUA 5IYBJ 1P7JA 2DA7A 4IHWA 3VP5A 1WPKA 5HODA 3HEFA 5IP7J 4XICA 3OIOA 3NAUA 2MW8A 3GTOJ 1GDTA 3QBMA 2NP3A 3GZIA 2GM4A 2G7SA 2NP5A 3C07A 3OSGA 5IPAA 2ID3A 1D5YA 4MIMA 5HBUA 2HDDA 5HSZA 2NVYJ 2R92J 2R5YA 2CQQA 2K9QA 1DU6A 4JNNA 3FK6A 1ZTRA 3S2HJ 2M0CA 3BR2A 4JX4A 4M3GA 3O8HA 4MFDA 5GPCA 3JSJA 4PXIA 1ETQA 1LE8B 1GV2A 3JRAA 2EBIA 3GTGJ 4NDLA 2Y30A 3GBGA 3H3VK 1AU7A 5EZHA 2HQ5A 2DA4A 2WAQN 1YRNA 5H9TA 3HOUJ 1ETWA 3HOXJ 2L0KA 3V78A 5C4XJ 3G1LA 3IH2A 4JX5A 1BL0A 2DA2A 2K40A 3PO2J 2DMQA 1MBGA 2MSYA 4QSHA 3GTLJ 3RZOJ 3ZOBA 4UUSA 2PZ9A 1FEXA 5HAWA 3HOWJ 3S1MJ 1T33A 3OOUA 1MSEC 4S0HB 4A3DJ 1DU0A 2QWTA 3TW7A 2GLOA 3BR0A 2M2EA 5FKNA 3G1OA 2DMNA 3C2BA 1PUFB 3AQSA 3JRGA 3A01A 1ZR4A 2QIBA 4MK6A 1IGNA 3PASA 2JMWA 4QIWN 1I6HJ 3GTQJ 2B63J 1ZK8A 2D6YA 5FJ8J 4ACIA 1RETA 1FTZA 3JRFA 4M3DA 1QPIA 2TCTA 5IOZA 5EDNA 3BT9A 3FRQA 1HDPA 2O7TA 3AQTA 3S17J 2IAIA 5C4JJ 2G7GA 2R7ZJ 1SFOJ 1IG7A 3I4MJ 2WUIA 1QRYA 5BNGA 2OERA 5CW8A 2DMTA 2L7ZA 2ZCMA 1JTYA 2ZOZA 1JKOC 3CWRA 2Y0SN 4CYCB 3LJLA 5IOYA 2FX0A 5F1JA 2G3BA 2LR8A 3Q0UA 2R93J 5EYRA 3TW6A 5IYDJ 2CJJA 5GP9A 1IDZA 2DA3A 5K7HA 2QTQA 2OI8A 5JLXA 4GFBA 2E2IJ 4IHVA 3Q0VA 1MSFC 1X2NA 3BJBA 3JRCA 3JRIA 2GUHA 4NELA 1GV5A 2PMZN 3FIWA 1IUFA 2RAEA 3ANPA 3F0CA 5K7ZA 3E7QA 1X58A 4MFEA 2DN0A 3B6CA 3BQYA 1T56A 2EQRA 2NVQJ 3K2AA 4A3MJ 2XPUA 1U9NA 1LFUP 5M5XJ 1IRZA 3DEWA 3D1NI 2R0QC 2GFNA 2ZCNA 1WH7A 2VPRA 1NK3P 2Y31A 3PO3J 2YUSA 3QPSA 2NS8A 3S1QJ 2R5ZB 2HOAA 3BCGA 1K61A 1WI3A 1ETVA 2NVTJ 5J1UA 1UI5A 3RKQA 1OJLA 1FJLA 2KT0A 4BY1J 3S2DJ 2RASA 5C4YA 1UHSA 2NX4A 1Y1VJ 1JUMA 3JRHA 3VW1A 2JK3A 2FBQA 2CU7A 2MG4A 1MBEA 4BBRJ 1BA5A 2IBDA 4A3BJ 2ZCXA 1U9OA 3NI7A 2UXOA 3HBLA 2W53A 2YVHA 3GTJJ 4FE4A 1B72A 4AUXA 4YZEA 5F0HA 2P81A 1NK2P 2CUEA 5AQCA 1Z77A 1ZR2A 2DMPA 1UG2A 1ETOA 2EZLA 4B4CA 1EF4A 4MXMA 4BKXA 2VKEA 2WGBA 3LWJA 1JUPA 3ON4A 1HLVA 4AC6A 2Q24A 5FGLA 1ETXA 1MBFA 4A3GJ 3HM5A 1VNDA 2I10A 4X1EA 4XRSG 3TP0A 3LSPA 4DZJA 4FISA 3BHQA 3Q3SA 4C2MJ 4XK4A 1AKHA 2XB5A 3H0GJ 4ME9A 1MH4A 3BR3A 2JJ7A 3F1BA 2CRGA 5IP6A 5FHPA 2H8RA 4ICHA 1MBHA 2X9DA 1OCTC 5DAJA 1JKPC 3KZ9A 1IJWC 4NN1A 2HOTA 2F07A 2XDNA 4GCLA 2LY9A 2Y9ZA 3BR6A 3GTMJ 2E19A 4DYRA 5C44J 2NVXJ 2E1OA 2ZB9A 5C3EJ 3S1RJ 4QTRA 3KKDA 3KNWA 5F0FA 2CUFA 1E3OC 3HTHA 2ECCA 4BXXJ 2V57A 3ANGA 1GT0C 1TC3C 2HXOA 1RESA 1LE8A 2JA5J 1U8BA 4V2FA 3HOVJ 3LSJA 3WHBA 2ID6A 3A03A 5F0CA 1UMQA 3VOKA 2XPVA 4DZPA 1MH3A 5DS9A 1HCRA 2ME0A 5DTDA 2E2HJ 5J1YA 1K83J 3S1NJ 2XSDC 2UXHA 1A6IA 3QKXA 2W48A 2UXUA 5CXIA 3CMYA 2NOGA 4JL3A 3MN2A 1WH5A 3GEUA 3LSRA 4M3BA 4UUTA 5E3OA 2QF7A 1XC5A 2YVEA 3CJDA 2LTPA 4GFLA 2LK2A 1PUFA 3HB9A 1H8AC 1ITYA 2G0EA 5EG0B 3VPRA 5EGOB 9ANTA 3B81A 4GCTA 2CQXA 2X48A 3BG9A 5JLWA 3DPJA 4JP0A 3EGQA 3NPIA 3JRBA 3HTJA 2XGDA 4DYQA 4HNVA 5D19A 4A3JJ 3VUQA 2PBXA 3FK7A 2TRTA 3RZDJ 3ZQHA 2JA6J 2DG7A 2YS9A 2IEKA 2LVSA 1FIAA 3BNIA 2ECBA 4D7MA 3LHQA 1I50J 2QOPA 1RPWA 3VVYA 3JRDA 5FKLA 1B8IB 1A5JA 1QVTA 2G7LA 3HDDA 4ABZA 1TWHJ 3I4NJ 4CYCA 3CRJA 4DYCA 4AC0A 2AO9A
chains in the Genus database with same CATH superfamily
2V1UA 2GENA 2WV1A 2F2EA 3ABTA 5E79C 1X1PA 1IV8A 1RR7A 1MBJA 4CGRA 3SHFA 2LBFB 3V6GA 2R7OA 2LD5A 1X3UA 4A3CJ 1SFKA 4IQJA 2GWRA 2XRNA 2YX4A 4C3IJ 4A69C 4BS9A 4H4KC 2K9LA 2JVGA 3ZN1A 3IHUA 2BVMA 5KVRA 3SJMA 1XG1A 2DT5A 2VKHA 2XIGA 4M9SA 2OV7A 3B73A 3ZCOA 1YRNB 2GZWA 2DW4A 1FP2A 4G94A 3E97A 3PSIA 3K70D 3PQJA 1L3LA 3CDIA 3RJPA 3VW2A 3RKYA 2AXLA 3HHHA 2ETHA 2XAHA 5D1RA 4W1UA 4FHTA 2ZNZA 1G4DA 1FTTA 1WGXA 1L0OC 4P9FA 3IC7A 2P5LC 4WXHA 2L9SA 4KNYA 4IX7A 5LBQA 1WZ2A 2VI6A 2RV8A 3T6NA 1V54H 3CLQA 2YX7A 1F9NA 2Y2ZA 3RH2A 5HLIA 3OR2C 1IDYA 4EJTA 1YG2A 1IRFA 3A01B 2DQLA 4MO7A 3M4OJ 2IS2A 1LKXA 2FMYA 4BHBA 4BEHA 1MDMB 4HV6A 4IXAA 1R36A 3G1MA 2LFBA 2BGCA 4LMYA 4HDVA 1VQ9I 1X4PA 2JWTA 5D18A 2V9PA 4KFCA 1ZRFA 3OL3A 1WI9A 5ERIA 3RCOA 2AHQA 3K4KA 3LOCA 2IGMA 5H2FC 5E3NA 3H3ZA 2VKDA 4XKBA 3CF5F 2EV0A 2JUGA 2JN6A 1YX3A 2IXSA 1TWCJ 2KIMA 1J75A 2L7FP 2A6HF 3BC8A 4N0BA 1IN6A 1SMYF 3CCQI 3AG1H 5E3LA 4A3KJ 2NVUB 3BRUA 2HOEA 4KMFA 5L3GA 3LAJA 3EUPA 1MZBA 3I0TA 4PJMA 1F4KA 2EA4A 2LKXA 2FQ4A 4I02A 2PBIA 4P55A 3RPUD 2O5RA 3TOAA 3CC7I 4OMYA 4EMSA 4EVIA 1XGNA 1XCVA 4MQ9F 3RKXA 3IKTA 2E36A 2XPWA 2LNBA 2FA5A 3AAFA 3AFHA 5F04A 1ERDA 3QPHA 3VVZA 1U0JA 3CJNA 4UVCA 3RDIA 2VUMJ 1BOBA 2E34A 3CQZJ 3L1PA 1YOVB 4XR6A 1Y56A 2OZUA 4C30A 1AHDP 2WC2A 1R71A 2HXIA 4HRIA 2FBKA 3TP3A 1YO5C 3BR1A 2QBYA 2OAZA 3DEUA 4DBRA 3O8GA 3SZGA 3LWFA 3OIPA 1K6OA 4LOCA 4DNCA 2XASA 3S16J 3ZQLA 3KKCA 2OD5A 1USSA 3TGNA 1OFCX 3NARA 3GTPJ 3J81K 2CUZA 1X4OA 4CCJA 4RM3A 1ZGAA 1HA8A 2ZJPF 1JTXA 2MD5A 4I99C 5CQEA 5M3FJ 4KN7X 3CC2I 3M07A 1B72B 2FBHA 1V3FA 2L7MP 3KZZA 3NWTA 3JAMZ 5DCFA 1X2MA 1R58A 2YR2A 3N97A 3WHCA 2R7UA 1P2FA 2H94A 2G7HA 3GEZA 3MNLA 4IEJA 4V2GA 3M8EA 1QBJA 1ZARA 3GFJA 3LSGA 3UR3C 4UDSA 5K58A 4U87A 2HYTA 2XUBA 1ZKGA 3L09A 5EGOA 1D3YA 3MFKA 2LP0A 4A0XA 1VF9A 2VBYA 4LGWA 4JX6A 2JQ7A 3K7AJ 1GVDA 2K9MA 3REOA 2N8GA 1XSVA 3UKGA 5J6XA 3KPHA 1JGGA 2DYSH 2Q2EB 1TTYA 2VKVA 2K3FA 5FKMA 4IZZA 3CMMA 4IF4A 3AG3H 3WG9A 4IHSA 5M3MJ 4JKZA 2HU9A 4L62A 3TOBA 5JFRA 1ENHA 3V7SA 4PJ0C 1R5ID 3ZQCA 4Y33A 3K69A 3T0YA 1X19A 2CW0F 2KRCA 1WJEA 5FMPA 2FXAA 3KP5A 1WPKA 1Y39A 5F64A 1FBSA 1H9TA 5LHGA 2ESNA 4NB5A 3JTGA 1GDTA 3VYRB 1T95A 3MEXA 4LLGF 2NP3A 2NP5A 1HKSA 3GZIA 4KIBA 3OSGA 1TT5B 2K02A 3FXUA 2JUCA 1LDKB 3VB2A 5HNHA 2VL8A 2CQNA 1B6AA 2VIXA 4XKVA 3L2RA 1K4TA 2ZJ2A 2CQQA 2LBFA 1DU6A 1ZTRA 2P7VB 3JSJA 3O8HA 4A0ZA 4OWRB 1DPUA 3K8PC 2Q0OA 4PXIA 1ETQA 2V1NA 1LE8B 1GV2A 2E7XA 2EBIA 4BQQA 5JI6A 1XX5A 1AU7A 4RLFA 3IL2A 2BW3B 3FXLA 1YRNA 2J5PA 3TL4X 4UV9A 1N75A 3HOUJ 5H9TA 4HSRA 5C4XJ 3KEQA 5GAGJ 1SFXA 2E1CA 2IW5A 2K40A 4LD5A 3PO2J 4BU2A 4O6JA 1OPCA 1BI3A 3HRUA 2QUFA 1FEXA 4OD5A 4XL9A 1A36A 3ULQB 1T33A 3R4KA 3FKJA 1N77A 4S0HB 2QSGX 4A3DJ 2CG4A 1DU0A 4XKWA 3BR0A 1I6XA 2A5YB 1XMXA 5GAEJ 2M2EA 4LFUA 3PFIA 2V26A 3R6SA 4BUPA 3GUDA 1AA7A 1ZRCA 2HPIA 4FX0A 3A01A 3ONQA 4ENMA 4FASD 1IN5A 2A5WA 5FFXA 3ZP5A 3PASA 2JMWA 1MDMA 1Z1DA 1I1GA 1RETA 5D5XB 1FTZA 3CP8A 1MKMA 2CYYA 2JRMA 3CO7C 1QQIA 4IOCF 1A31A 2DFIA 2O7TA 4LJZF 4HLYA 3AQTA 4HLXA 3S17J 3Q9VA 4HF0A 5C4JJ 1BBYA 3DBLB 1K6YA 2ISYA 2CWEA 3E6MA 1JTYA 1S5LC 1JHHA 1JKOC 3K10A 2BOLA 3P9IA 2IT0A 3HZJA 4CYCB 5FO5A 3HSEA 3KETA 3I59B 3SDBA 2A6EF 1VQ6I 3TW6A 2VT3A 3WE2A 4IPAA 4CZZA 3KLNA 2DA3A 3GVAA 3KYDB 4EV0A 3RPUA 3FHNA 3HL2A 5JLXA 3M9AA 3K4LA 4IHVA 3BLYA 1MSFC 3JRIA 3GLXA 4NELA 3D5RC 1GV5A 4RB3C 2PMZN 3A0BC 3FIWA 3ANPA 3H92A 3KZYA 5K7ZA 3D5SC 3E7QA 1Q1HA 2DN0A 2X85A 2YU3A 2QEXI 5DDGA 3TO9A 2XHKA 3C2GA 4HG2A 3RYRA 2ISZA 1WRJA 4XORA 5M5XJ 1IRZA 2BY1A 3D1NI 1G3YA 1WH7A 2VPRA 2HEOA 3ZMSA 4DJAA 2A69F 3BCGA 2QGUA 3OYJA 1K61A 1EKEA 1FC3A 4WX9A 4I01A 1M1EB 2CS3A 4HAMA 1FOKA 1UI5A 1FX7A 1T0FA 4N9HA 1OJLA 1YJNI 1W36D 3HRSA 1RUOA 1FP1D 5LEKA 1JUMA 1BI2A 1UFMA 1R5GA 1A6QA 2JK3A 4K2EA 1MMAA 5LLQA 5ED4A 2FBQA 1PP8F 2RQQA 3HRTA 2KFDA 5ILVA 3NI7A 3KYLA 2LKSA 2Z2SB 2QZ8A 3C3WA 2W53A 3ISPA 3LA2A 4HX8A 2V6EA 2KDOA 1B72A 3M8JA 3CJQB 2YPRA 4H0EA 3MAJA 1R1VA 2QKLB 1ZR2A 2A2FX 1UHMA 1O3SA 2BXYA 1DPRA 1EF4A 2D1VA 2Q1ZB 4AC6A 2Q24A 4CXFA 1ETXA 4A3GJ 2M5WA 5HOOA 4S05A 3ZMDA 4BJTA 5FGMA 2EFOA 2P0WA 2Q2EA 3MMYB 4FISA 4KT5C 3CUQB 1YLFA 3F9KA 3H5RA 2MLKA 2XB5A 4NQWB 3K6GA 1RNLA 2WY8Q 3BR3A 4IHTA 3ZMTA 2JJ7A 4PJJA 2CRGA 4F52A 5IP6A 2H8RA 1U3EM 4ICHA 2VASA 3K4MA 2FRHA 1YW7A 2X9DA 1YS6A 4HX7A 2X0LA 1XB4A 1HSJA 1U5TB 3KCCA 4NNJA 2MBFA 2HOTA 4PFPA 4EM2A 5ILSA 4ZDOA 4GCLA 3RPQA 2Y9ZA 2E19A 1KYWA 1YIOA 2ZB9A 2XGXA 2JTVA 3KKDA 2NYXA 1S29A 2DOAA 3NQOA 1IRGA 3KNWA 2CUFA 3HTHA 3NEUA 2ECCA 3DXJF 2VJIA 3M1CA 1VQLI 1RESA 1LE8A 4Y17A 4HYEA 2ZXWH 4V2FA 1XPXA 3Q5FA 4L18B 3FBIB 1OLTA 3A03A 2VLAA 5F0CA 2BW3A 2CQKA 2IGNA 4ZZDA 1VQ8I 2V9KA 2XPVA 1R6RA 5DS9A 1HCRA 1OCRH 2ME0A 2UXHA 3HTSB 3VYTB 4AIJA 3QKXA 2IA0A 1E3HA 3E5QA 3E6CC 3ZQQA 2BY0A 5H6RA 2O8XA 2DT6A 3DWLE 1W7PD 2LK2A 2DLLA 2WAEA 4F92B 1D8KA 3OYBA 4BYYA 1TT0A 2FE3A 4L5IA 3U2RA 4CH7A 1YX5A 4IRHA 3EGQA 2D45A 2DOEA 3BP8A 3HTJA 2A07F 1R1UA 4ZYGA 4HNVA 3CCVI 1A04A 3FK7A 2TRTA 3R0AA 2X6WA 1FIAA 3BNIA 3HTUA 3WODF 4D7MA 2QOPA 3RQ4A 3JRDA 4RB1A 2LOOA 2I8DA 3DEEA 2FF4A 5FKLA 3GYHX 1B8IB 1A5JA 5CVVA 4XM3A 3T5XA 1TWHJ 2HVSA 3I4NJ 3BCBA 4CYCA 3CCRI 2R7FA 2W00A 5HNFA 3NWSA 3AL0C 1DGWY 3I59A 2MA3A 1E17A 1WKMA 2CFOA 5J47A 2VXDA 2J5OA 4Y7NJ 1BW6A 1O7LA 2FD5A 1J5YA 2M9HA 2WB1A 1R7JA 3I4PA 4YG2F 1FIPA 2XGEA 2JRTA 1MJAA 3F8FA 4HW0A 3S3NA 4HKUA 3CDLA 1CGPA 3BG7A 5J4YA 4AD9A 1TP4A 2EZKA 3OV8A 2DCEA 3R61A 5JVGF 1O3RA 2H8WA 2IU5A 1JJ6C 4UVBA 2LG4A 5D6EA 4OINF 3RD3A 3CP2A 2ELKA 4R1HA 1MNMC 5LGTA 1VQ7I 3SEZA 3GZNB 2DPUA 3HTIA 3IRQA 4Y52J 1FOWA 5B66C 4BACA 3KP6A 2WAQA 4RAZA 4PK4A 5TISC 2LH9A 5KNLA 1T2KA 2NXNB 2VJ5A 4FETA 5FROA 1EH6A 3MKLA 1XN7A 1VQOI 5F6FA 2KMUA 2H09A 4Y13A 4UY8I 5FB2A 1LJ9A 3E1SA 5GAHJ 4BQAA 1VI0A 1SEUA 4WIBA 4ZDPA 5BQTA 1C0WA 1FSHA 3IV5A 2BBYA 3E7LA 3DKWA 4B3AA 5FLVA 4R79A 4ZTFA 1J0RA 3L2CA 2ZJQF 2GIVA 5FKKA 1HDDC 3JCUC 1QU3A 3F8CA 1VQ4I 1R22A 2DA5A 3ZGKA 1LVAA 2CV2A 3JSOA 1YQAA 4EJVA 2O3FA 3HOSA 1TWGJ 2K5CA 4OIRF 2P7CB 4A3IJ 2L3DA 2HWVA 1S72I 1NG7A 1JJ8C 2PLYA 1W0TA 1I3QJ 5KHDA 1ETKA 4PGGA 1W4MA 5GPAA 2HKUA 4KWAA 3DPLC 3CUQA 3EUHA 3SEQA 4B1RA 4XLPF 4D5CA 2DYRH 1ZHFA 1WHUA 2JA7J 4NQWA 2VB6A 3IH3A 3E6DA 3ML6A 1ORKA 2RNJA 1ZG1A 3W2AA 4X6AJ 3DPUA 2UXPA 3QOPA 3FXKA 2O9LA 1TWAJ 2LY1A 2EV6A 3WU1B 3GMEA 3BROA 4YFNF 3F6OA 2MGQA 4B3XA 2D5VA 3KZIC 1U5TA 3KE2A 4E6KG 4MHGA 1IAWA 4CYDA 2QSHX 4DBQA 2XVCA 1NHAA 1IW7F 2DDAA 1JT6A 2EZHA 3WE3A 2O7OA 3ZPLA 2VJJA 2XKOA 3BWGA 4MLOA 1JI8A 3HOZJ 1OQYA 1ZYRF 3HGGA 4AVZA 4RS8A 1N25A 3CF2A 2BZTA 2K9SA 3LNQA 3ZMZA 2X6YA 4G6DA 4GXOA 1IN8A 3BJOA 4ANJA 3DCFA 1OYYA 4BNCA 2ZFWA 5IT9K 1RIOH 3K70C 1KA8A 3SZTA 3BTCA 1JHFA 3FMQA 3G7RA 4CUGA 1K78B 2X1EA 2M8GX 1TWFJ 2OPTA 3DTEA 3LQRA 4RBOA 2K9NA 3DBHB 4C3JJ 1TLHB 3IWFA 4GCKA 4O5VA 3LFKA 3KP2A 1RKTA 1MW7A 3PL8A 2GA2A 2KHMA 2F6CA 1F43A 3HPGA 1G2HA 4ZYAA 4CHUA 1TQMA 4UUVA 3EYYA 4LK0F 4F55A 3WGIA 2QCOA 4DVYP 3BG3A 2D2WA 3NRVA 1S3JA 3FISA 3OYIA 3TEDA 5EFYA 4X0GA 2HDCA 4IHXA 4RA2A 3K4JA 3F3XA 1QHGA 2QLZA 3PFYA 2JA8J 4XONA 2O03A 1IXSB 1AKHB 5HLTA 3WTSC 3RSNA 3VW0A 3EUKL 1AOYA 2EB7A 3HTAA 3K4BA 2H1KA 4LIVA 1B8IA 1JKRC 1JXSA 3TQNA 5LD2C 2HNHA 2BHZA 3CUOA 4M3FA 5ICCA 4L9NA 4RB2C 1R9TJ 3QYFA 2XAFA 5KCMA 2QM3A 1VQ5I 3IH4A 4IHWA 1UZCA 1OR7A 3W6JB 2V9VA 4E4HA 2FMLA 2CW7A 4CO8A 4KYWA 3QAHA 2QENA 3OIOA 3I58A 3E6BA 2ZNYA 2MW8A 3MKZA 3GTOJ 2PG4A 2G7SA 3C07A 5IPAA 2ID3A 4MIMA 2DI3A 1BIAA 3OYEA 2R92J 1D0XA 3CTAA 4CCMA 2Y48A 3FK6A 1Y0NA 1LPQA 3FXRA 2CV1A 5IT3A 2M0CA 3A0HC 1T38A 3H5AA 4EM1A 1KGSA 3I9V2 3FM3A 3EPZA 1SC7A 4NDLA 1FYLA 3GBGA 1B1BA 1GVJA 4BHCA 2M87A 3H3VK 2HQ5A 1G59A 3LA7A 4MTDA 5IY5H 3DLAA 1ETWA 4XOPA 2HYFA 4L0ZB 1D5VA 1ACIA 3IH2A 1BL0A 4HF1A 2DA2A 1X1CA 4ENKA 3RZOJ 3WTZA 2ZFUA 2X1CA 4PSWA 3S1MJ 2RREA 2W84A 1Z05A 4HQEA 1ODDA 2VJ4A 2QWTA 2VQLA 3E0JB 1QO0D 3WGHA 5BMZA 4EM0B 2GLOA 1IRXA 1ON1A 4LLNA 4PUSA 4HEA2 1FWZA 4RM2A 3OYMA 1PUFB 2PN6A 2VN2A 4WK8F 3JRGA 4A6EA 4ZYDA 4MK6A 2NRAC 3DU5A 2LF8A 2LY2A 3HJEA 1TL8A 3PNVA 2XKPA 1K4SA 4ACIA 5H6QA 3W3CA 1ZK8A 2QSFX 5HDGA 5FJ8J 3GTQJ 3VTIA 1V5EA 4M3DA 1QPIA 2TCTA 1H9GA 1HBXG 3BT9A 3FRQA 3V4GA 1HDPA 2L4MA 3DU6A 3GFLA 3K1MA 2VOOA 1T0FC 4GDFA 1VQPI 5K1YA 2G7GA 1YFHA 1SD6A 2R7ZJ 4EGYA 1SFOJ 2UWMA 5BNGA 1Y0UA 2HQAA 4RLQA 2W85A 2DMTA 2EIJH 3VODA 4Q4ZF 2ZCMA 4P96A 2ZOZA 3ROUA 3HXLA 5IOYA 3SXYA 5F1JA 1E0EA 4E7SA 1BI1A 3Q0UA 5EYRA 3ECHA 5IYDJ 2PFBA 2NS0A 1IDZA 2DO7A 2X4HA 1LFPA 1QA6A 2BVLA 2OQGA 2FJI1 2E2IJ 1X2NA 3JRCA 1K7AA 4L9JA 4IOAF 3JSPA 1IUFA 4U88A 2A3SA 1SMTA 4BHPA 3F0CA 4CGZA 2DXIA 2B1EA 1P4XA 1X58A 4MFEA 2K3PA 4CSWA 4AIDA 1QGPA 5K5OA 2NVQJ 5D5WB 1VTNC 1FY7A 1J59A 4II3A 2HDWA 1U9NA 1T98A 1MD0A 3KEOA 4YIIA 3T8RA 3U1KA 1PUEE 4G6QA 3CDHA 2ZCNA 4BJ5C 4D9JA 3F72A 1LEAA 1KZHA 3P9CA 3PSFA 3WU0A 5L3FA 1X1BA 3WTXC 2NS8A 1YJWI 3F22A 3S1QJ 4B8XA 2BHYA 3BCAA 1QZZA 2MH2A 1ON2A 1WVRA 5J1UA 3EQLF 2V7FA 2OU2A 2X1DA 3QPTA 3S2DJ 4OAYA 2RASA 2NX4A 1O7FA 1TNSA 1X1DA 5JR3A 3V8KA 2R7WA 3GFMA 1IF1A 3H9JA 4A3BJ 4B43A 2ZCXA 3WTTC 2UXOA 2PI0A 3GTJJ 4O3MA 4AUXA 1K78A 4YZEA 3HUGB 4M71A 4MNUA 3FHZA 3CMEI 2CUEA 4KMUX 2GA1A 3A2KA 5AQCA 2AQFA 4HDUA 2XV4S 1TZLA 1UG2A 1KYZA 1G3TA 1XDSA 1Z21A 2EZLA 2GIZA 3DBRB 3VWBA 3DTKA 1N78A 4C2TA 2E1MC 4MEXF 4AYBA 2WADA 3LWJA 2W1OA 1JUPA 2HR3A 3EDPA 3CCSI 2OC6A 4C2MA 1MBFA 4U0VA 1ZAOA 2H27A 3HM5A 1VNDA 2KJBA 2KQRA 4GYGA 4CZCA 4XKCA 1I5ZA 5E17F 1KONA 1R49A 4ITVA 4DZJA 4ZTJA 2EFWA 1H0MA 1HW2A 3BHQA 1QZYA 4XK4A 1AKHA 4J01A 1VQMI 3H0GJ 3FDYA 3C18A 3HSRA 3ECOA 5B3SH 3U9GA 2VC0A 2M8EA 2NAZA 4IVNA 3MCZA 4WWCA 3N05A 3GF2A 4HNUA 2O61A 5TJJA 1XSXA 1OCTC 1JGSA 5AIQA 3H3UA 3K9TA 1S9HA 4N4NB 4BDYA 1IJWC 4HOBA 4NN1A 2VOPA 5L3DA 3IP4B 2XDNA 1MMNA 5J8FA 2QQAA 4DYRA 5C44J 3CCEI 3GX4X 2E1OA 5C3EJ 1J7KA 2EILH 3S1RJ 1P9QC 4U7DA 5F0FA 4BXFA 4BXXJ 3ANGA 3V7RA 1KQ8A 1TC3C 1SAXA 4L5JA 1WSUA 3BPVA 2DFHA 2VONA 3ASNH 2ACJA 1U8BA 3OMYA 4LK1F 2VODA 3WHBA 2B9SA 1R00A 1ULYA 5EEGA 1LDDA 1SD4A 3KIOA 1MH3A 1RZ4A 1SAUA 3DKXA 4M72A 4M74A 5DM6F 4D1QA 5DTDA 2E2HJ 2ZKZA 5K5QA 2L54A 2RDPA 3PUFA 4WXCA 4OD4A 2IGKA 3MN2A 2M3AA 3ERED 3V7CA 4AM3A 1WH5A 4NUBA 3GEUA 4PSXA 4UUTA 2F5FA 2QF7A 2YVEA 3CZ6A 1I1SA 3F8BA 3CJDA 4CCOA 1PUFA 5HS8A 3HB9A 3LAPA 5LEJA 2LMDA 1H8AC 2E7WA 2ZJRF 2PMZA 3VYUB 3BDDA 2VBWA 4LG0B 5JLWA 2IPQX 5D4RA 1CF7B 3DPJA 3KYCB 2IS4A 3NPIA 3JRBA 4LB6B 2OA4A 4DYQA 5D19A 2DTRA 3J80Z 2JA6J 3G71I 3ZQHA 1OCOH 2DU9A 2YS9A 2Z1DA 2DG7A 2F48A 2LVSA 1Z7LA 1XGSA 3K4CA 2F4IA 3VVYA 2G7LA 2DFFA 2MLGA 2ZO4A 2MD0A 2KLOA 3F6VA 2H1LA 4AC0A 3PNYA 2AO9A 1G6NA 3KEYA 1RI7A 4RGSA 5F27A 2EZIA 4XSXF 5BS6A 4PDKA 1PDNC 3ABMH 3NRGA 2Y9YA 3BZKA 2LKPA 4XIDA 1SVOA 4FCYA 4PJLA 2R5YB 5CYVA 2DG8A 2YVXA 4A3FJ 2PEXA 4R8HA 3ELKA 4UNOA 4L5EA 4ZYHA 4A12A 2E60A 3BTIA 3M7GA 4OAZA 5E20A 3SFIA 1JUSA 4BY7J 4G12A 3LSIA 1D1CA 2A68F 2HPMA 4I76A 4XRMA 4IKFA 1GUUA 1POGA 1FNNA 1FOYA 1PVEA 3OYDA 4M6VA 5J3LA 1DQUA 3Q0WA 4EJUA 3W2VA 3S5RA 1XSDA 2HTJA 3CUQC 1ZGJA 1HF0A 3S8PA 4QWQA 4I6ZA 1HKTA 3DLLF 1FBUA 4LIUA 1YIJI 4UUSB 4A3LJ 1Z0XA 3DTIA 5E1XA 4IRIA 3VEPA 2E2JJ 1BI0A 2K4BA 4AIHA 3QU6A 1FMVA 1IN4A 1Z3YA 1AWCA 2CFXA 4JQFA 3QP6A 1T08B 1OCCH 3OY9A 5IT9Z 3G73A 4HA8A 3GLLA 1IXCA 3M8FA 3SFZA 4ASNA 1U5TC 1SFEA 2DJNA 4M6XA 2FBIA 3K0LA 2QKOA 4Q48A 4Y4RA 1QVUA 5AONA 4NBQA 4S04A 1WJAA 2XROA 3L2VA 3HUGA 2JA2A 3EYIA 4HV5A 2KP6A 4M3EA 4GGGA 1RUNA 3VVXA 4IL6C 4J19A 2KDZA 3TDZC 3TO7A 2B7EA 1NTCA 1T6SA 5FFZA 4ZZLA 4I98B 2VBXA 3U1DA 1WCMJ 2XRLA 3ON2A 2DQRA 2IRFG 1FSEA 2HYJA 3NXCA 4JYKA 2M0MA 1LUJB 2DTZA 3KLOA 2OUMA 1Z67A 1ZLJA 4II2A 1IC8A 5J1RA 2GOMA 3F8MA 5FD5A 2VQCA 3PIPF 1O4XA 2LSOA 2KZGA 2ME6A 3AKZA 3ZQGA 3JAMK 2VE9A 2E5ZA 4NC8A 4EEFG 4OIQF 1T39A 3HG9A 3KP3A 4W97A 2KRFA 1APLC 3I54A 3C7JA 3GTKJ 2Z33A 3RQIA 2ELJA 3BY6A 2HKXA 3T1BA 4A0YA 2JZYA 4E7IA 2ZOYA 3CO6C 3H0DA 2VQHA 3HOYJ 5DM7F 2L01A 1X3WB 2RGVA 1XDUA 3HIMA 1WJFA 4FE7A 3M3YJ 2ZXIA 3DKYA 3MVPA 4ENNA 5J40A 4Q47A 2NS7A 2ZSHB 1D8JA 2NNYA 3IUVA 1YI2I 3SDGA 3CCYA 3I71A 4BH9A 4DQ2A 5HLHA 2VC1A 1OR7C 3B02A 3I64A 5BPDA 3G56A 2V1DA 2EJRA 1BJAA 1I27A 2BY3A 2NOJB 3GCMA 2LLKA 4B47A 1ZGWA 2XF5A 3LSMA 1XD7A 4Y3OA 5LRRA 1R4NB 3I55I 3CC4I 5IP9J 1MMSA 2DBBA 2L9RA 3P5JA 4BBSJ 3CESA 3QWLA 5GADJ 1DP3A 5BOXA 1EA3A 3PM1A 1U78A 2FUG2 2HI3A 5DD4A 2X6OA 2ZXJA 4AU7A 2CQ7A 3ZQFA 3OSFA 2KZVA 4G9YA 2M4KA 1BC7C 5FLMJ 1Z3XA 4KA4A 1REPC 4F7ZA 4LG0A 1FPQA 3HKZN 1CF7A 2IS6A 4A5NA 5LFAA 2V79A 3HGYA 3U21A 1V5FA 2XGCA 1DP7P 4LITA 5CQGA 1TBXA 1I3AA 4YEJA 3BR5A 3MKWB 5CVUA 2QYOA 1LFBA 3PIOF 4A3EJ 5FLXK 3GFIA 4EJOA 2WB1N 4G7ZF 1J2XA 1MIJA 2CUJA 3VOXA 2QA4I 3J81Z 1XCBA 1TQPA 3IAS2 3AL0B 3SWHA 2FSWA 2ZCWA 5DUKA 5KAFC 1WJ5A 4XN3A 3VP5A 5E1WA 4CCNA 4U0YA 3HEFA 2MC4A 3HC7A 3NAUA 2RN7A 1IUYA 1EV7A 3FXQA 2Z99A 3QBMA 2GM4A 4YFXF 3NS4A 4XLAA 2M30A 1S7OA 2K27A 3GO5A 5HS7A 5HBUA 1PJRA 2NVYJ 5HSZA 2R5YA 2ZMEB 2K9QA 2STTA 3CCLI 2VPLA 4JNNA 2FEZA 3OYLA 3HIFA 3BR2A 5GPCA 2H6CA 2HFHA 2Y0MA 4IJAA 2HVQA 3JRAA 3GTGJ 5L3CA 5EZHA 2HQNA 4RAGA 4RGXA 2DA4A 2WAQN 4XNFA 2P6TA 2FQ3A 3E5XA 1LEBA 1Z6RA 2L0KA 2BYVE 1QNTA 3G1LA 4JX5A 3ABKH 3V42A 3GTLJ 5H20A 4UUSA 5HAWA 4ZYEA 2X51A 2F4OB 3PUBA 2VE8A 4IRVA 4HX4A 4HQMA 5CPRB 4L0YB 2L02A 3S3MA 1YYVA 3H36A 2EIMH 3G1OA 4I7HA 2XF6A 1Z7UA 5KAIC 3AQSA 4NC7A 1ZR4A 2QIBA 4ETSA 3FMRA 4I09A 5EEHA 4U0WA 5J8CA 4IO9F 2OQRA 2B3WA 3RI4A 5BPIA 2P6SA 2D6YA 3JRFA 5IOZA 4ZJZA 3PQKA 1OCZH 1QPMA 4HSTA 1MJBA 3QYBA 1OYIA 5K5RA 3OYGA 1KU7A 4KISA 1P4AA 2KRHA 3OWTA 3T8TA 5CW8A 2L7ZA 5A2QK 1VQKI 3JW4A 3CLOA 3CWRA 2Y0SN 3LJLA 1IN7A 4CCKA 2R7RA 2FOWA 1W5TA 2LR8A 3LA3A 1G3SA 1BM9A 2R7QA 3S2WA 1HC8A 4QLCU 3HSFA 5K7HA 5L3EA 2OI8A 2XSJC 4MEYF 3QODA 2F5DA 3W6KB 4CICA 2OCEA 2GUHA 3ESWB 1FYMA 1GXQA 2RAEA 1SFUA 2HVRA 1BR4A 1HXDA 4YFKF 3SQNA 4UB8C 3IRRA 1TQIA 1FZPB 4CA0A 3BQYA 3OL4A 1ZLKA 4EATA 2EQRA 1BR1A 3IKVA 2XPUA 1LFUP 2DK5A 1S6LA 2M4GA 3E3VA 2R0QC 2F5VA 2XF7A 2GFNA 3S3OA 2LC2A 4HBLA 1NK3P 4BE2A 2R7XA 3PO3J 2YUSA 3QPSA 2R5ZB 2HOAA 1Z6TA 3H1CA 2ESHA 3IUOA 2L7KA 1ETVA 5FRNA 1SD7A 3TMOA 1ZREA 2KT0A 2ZSIB 4BY1J 5C4YA 1UHSA 3R60A 1Y1VJ 5AIPA 2Z9OA 4E7ZA 1YW8A 2X6XA 2XAJA 2CMPA 5DUIA 4LB5A 2IA1A 1BA5A 2IBDA 3HYIA 4U7BA 2XC7A 1KU9A 2OBPA 4F91B 2JVHA 2M7BA 3G4SI 3WGGA 2GXAA 2DFEA 4FE4A 3OYHA 2IJLA 5F0HA 5F1RA 2O0YA 6PAXA 2L9VA 2P81A 4YELA 3CD6I 1Z77A 5ILUA 1SVLA 2DMPA 2KIUA 1ETOA 4ON0A 4B4CA 4MXMA 1E2XA 5DEQA 3AG4H 3H9GA 4BKXA 4KICA 2M45A 4L9TA 1E3PA 1V55H 2OTLI 4XRSG 3PJRA 2C6YA 5JHUA 3TP0A 1P92A 5FD6A 4A5MA 3Q3SA 4C2MJ 5E8IA 2FOKA 4ZC3A 2JSPA 3X2QH 4BQOA 2PJRB 3J7YJ 1W5CC 5D5VB 1MH4A 1LQ1A 4C9YA 3F1BA 2KIQA 5FHPA 3C1DA 1NH3A 2PMUA 3GW2A 4AWXB 4E7HA 2B0LA 5DAJA 1JKPC 4KIGA 4PCQA 5D8KB 1UELB 2W24A 3FX3A 1R5HA 2KJCA 3H9QA 4GO1A 3BG6A 1LNWA 2F07A 5D5UB 2LY9A 3VSLA 3GTMJ 1MNDA 2NVXJ 2ZY9A 4HPQA 2ZMEA 3BJAA 1XGOA 3ZN0A 5HVQC 4ESBA 3OYKA 2V57A 2ICWG 1KU3A 2HXOA 3CCMI 5CVRA 4OIPF 4XLCA 2JA5J 4KDPA 4Z6YA 1KU2A 3LSJA 4OU0A 4LLLA 3ZRGA 1I39A 4HZFA 1UMQA 1BOAA 4BXUA 4DZPA 4A2UA 3KP4A 3HOTA 4M9ZA 1MMDA 4C2UA 1IZ1A 5J1YA 2XSDC 1U6GA 1XMAA 2HZTA 3OIQA 3WU2C 2UXUA 4YIRX 3FXMA 2OZ6A 2GAUA 2LDUA 3CJTB 4P5OA 4F3QA 3I5UA 2HZDA 4M3BA 2KIFA 2YSRA 5E3OA 2EK5A 2LTPA 4GFLA 2LYCA 5EG0B 4RAFA 3VPRA 3B81A 1FYKA 3F23A 3BG9A 1EH7A 3ZXSA 4JP0A 4U9NA 2WWYA 3F21A 3MZYA 3K1NA 4UVAA 3WTYC 4A3JJ 3RZDJ 4KJZA 2JPBA 1B9MA 1U8RA 2IEKA 3BOQA 1I50J 2EFNA 3HHGA 5FRMA 1RPWA 2FU4A 2XAUA 2KPMA 4I0AA 1BR2A 1QVTA 4DGWB 1TW3A 3O2PE 1O3TA 2MFZA 3HDDA 5B1BH 3CRJA 3A4CA 3QOEA 4DYCA 2LRDA 3MZHA 1DGRM 2RVCA 3RYPA 2VQGA 1USTA 1B9NA 2LF7A 2RC4A 4XRSA 2PFVA 4MQVA 2EWNA 4FTHA 1YS7A 5HDKA 4OIOF 4P1WA 1NG6A 2NNNA 5JVTA 2REKA 3P9TA 2O8KA 3VFZA 3FXJA 2EFQA 4WCGA 3OS0A 1W5SA 4Y15A 1UHWA 2DT7B 4I0BA 1HQCA 3AG2H 1ZQ3P 2OTJI 1P6RA 1MMGA 1RKWA 2DPDA 4NHJA 3P7NA 2ZBKA 2JT1A 1BW5A 3ABUA 2M34A 4D5FA 4IQ4A 2UUZA 3S14J 2RHAA 3FM5A 1IV6A 2GBYA 1ETYA 4BJ6C 2IVMA 1H88C 1F1ZA 4HNTA 2R5ZA 2EFPA 1X1AA 3JR9A 2L2OA 3BTLA 2CV0A 2E71A 3MQ0A 5LRSA 2LREA 1RRJA 3GXOA 1P7IA 1VZ0A 2QQ9A 3M1EA 1MBKA 4XLFA 4CCLA 3BQZA 1S7EA 1KQ9A 1P4WA 4PZJA 5TRDA 2HOSA 4M73A 2O6GE 3K4NA 5CXGA 5GTIC 5FKOA 4HF2A 2ZXHA 3EETA 3ASOH 2WY7Q 4AYBN 2V6CA 4AF5A 3VSKA 5K7FA 2Z3YA 2UZKA 1W0UA 4RAYA 2KISA 4E7KA 2DA6A 2W7NA 1UI6A 3R0JA 2DA1A 3A02A 5M5WJ 4P9UA 2QVOA 4XOTA 3WTWC 2EH3A 1OMIA 2M1BA 2E1MB 4Q5SF 2COBA 2F5EA 4UHTA 2STWA 4FT8A 3TKYA 1T8IA 5CKTA 1PP7U 3GZ5A 5FLXZ 1BJZA 2PMHA 1UCRA 3FZVA 3JREA 4XLHA 4Z2YA 1Q1VA 2DOFA 4BAYA 1YITI 4GFKA 4JBAA 1OCPA 2IP2A 2VT2A 2GQQA 3LFUA 3G2BA 4FQGA 1SANA 1Y1WJ 2PJRA 5DCMB 5CLSA 5F08A 5IYCJ 5EZGA 4E7JA 4MGRA 4GYIA 3ZQ7A 4DW6A 4BDZA 3ZQIA 3KP7A 5D6FA 4NC6A 1BN5A 2I5UA 4MTEA 3BTJA 5ICFA 4AVPA 5B5EC 4ESJA 3COLA 2E5NA 1SGMA 4YIFA 1CQTA 3DP7A 3DF8A 1D0ZA 1A35A 2UXIA 1WJCA 3K1PA 3F8NA 5LGNA 4E7LA 1ONVA 3B6AA 1JKQC 2KKOA 3FMSA 3QRFF 2YU9J 4PJNA 4RGRA 1W36C 2XB0X 1J09A 2AXTC 5E8GA 3NNRA 3DV8A 3PNTA 2R7VA 3QQAA 2R7TA 4XQFA 5E3MA 4IHYA 2IS1A 1J9IA 4KITB 2IGOA 4M9XA 5M5YJ 3S32A 2VXZA 4KN4X 5DD8A 1F36A 4RB0A 4UV8A 2MC3A 2R4GA 1IO2A 3VIBA 5CVIA 1OKRA 1OISA 4A93J 4XBFA 4RDUA 1VFCA 3O6BB 3QPLA 1H89C 3PPBA 3O60A 2JPCA 2DAOA 4GRIA 4EQQA 3S15J 1LVKA 2Y69H 2FJ1A 4DOZA 5EEAA 2GOXB 1D1AA 3J7ZI 1HSTA 2DK8A 3BG5A 4D7NA 3HE0A 2UV1A 3MWMA 5EG0A 1WJBA 3LQQA 3BPXA 1RR8C 1XS9A 1ZG5A 1TNTA 2EINH 4UB6C 3KFWX 1QHHD 5EF6A 5A2QZ 2ADUA 1DUXC 2HS5A 3IAM2 4G6TB 3FKIJ 4OOIA 3L2WA 1FT9A 3L2QA 1R23A 3K2ZA 3EUHC 5EJCA 3W6VA 5LGUA 4BE0A 4QPOA 3ZMUA 4C3HJ 1JT0A 2R7SA 2OF7A 4PFOA 4UXNA 1HOMA 1YJ9I 2DMUA 5IYBJ 1P7JA 2DA7A 5HODA 3OYCA 3LMMA 5IP7J 4XICA 3H5NA 1KQ0A 1D5YA 4A6DA 2HDDA 1BC8C 1MNEA 3OS1A 3VOEA 3S2HJ 4GCVA 5E18F 4JX4A 4M3GA 4MFDA 1RC9A 3CJRB 1R1TA 2EV5A 2G7UA 4V19K 5GTHC 3D5LA 3BJ6A 4KIFA 2Y30A 2WBMA 4N9IA 4ENJA 3A1YA 1V4RA 4B44A 3HOXJ 1YE9A 5TGTA 5ICGA 3V78A 3COAC 5KK1A 3DQVC 5LHHA 1V5GA 2DMQA 1MBGA 2MSYA 4QSHA 3RIRA 3ZOBA 2PZ9A 1YTYA 1WWXA 4G7HF 3V8JA 3HOWJ 2H6BA 2UXNA 2XDVA 2BY2A 3DFGA 3OOUA 1MSEC 2IA2A 1LB2A 3TW7A 2HQRA 1TW2A 2AS5F 5FKNA 1HW5A 1WJDA 3WTUC 1YW9A 2W82A 3ZMVA 2DMNA 3IWZA 2AQEA 3C2BA 4BE1A 1B59A 3BZ6A 1Y8QB 2TDXA 3H35A 4N4OB 1IGNA 3C2HA 2DJIA 1F5TA 3FF5A 4QIWN 1I6HJ 2B63J 4G8XA 2W4SA 4J00A 5EDNA 3J7AO 5DV5A 1U2WA 2IAIA 1O3QA 1O57A 2PQ8A 5CJ9A 1X3ZB 4XN0A 4ZDLA 1IG7A 2GXBA 3I4MJ 1FMWA 1R4MB 1SD5A 2WUIA 1QRYA 1STZA 4KT6A 4B48A 2OERA 2CH0A 3SZPA 2UXXA 3QP5A 4E70A 4BQNA 1W7PB 4JK1X 3MKYB 2FX0A 2RKHA 3CCJI 2WAFA 2G3BA 2JSCA 2R93J 4ZH4F 3MZ8A 1XGMA 2EIKH 2CGPA 2CJJA 1HKQA 5GP9A 5D8LB 3LSKA 2QTQA 2RQPA 4GFBA 3RTRA 2QQ8A 1Z91A 3Q0VA 3BJBA 3G6EI 2QKMB 5DCMA 3OYNA 2A05A 2P8TA 3FBNB 5L3BA 4PGHA 2K7LA 3N4MA 1HW1A 3S93A 2E35A 3WG7H 1ZH5A 1ZG3A 3Q9SA 2F4MB 3B6CA 3VDXA 1T56A 3MD2A 3LSHA 2BEOA 3K2AA 2E1NA 4A3MJ 3CCUI 2CO5A 4B09A 2HGCA 3DEWA 2K86A 3HKZA 1S7AA 4XMYA 3TBIA 2Y31A 4RGUA 4JOMA 3ZR8X 1XTAA 1JE8A 1WI3A 3HRMA 1UJ8A 3OYFA 3OYAA 2NVTJ 3RKWA 3RKQA 4XLEA 1FJLA 1UB9A 3VW1A 3JRHA 2BE5F 1EH8A 3HPHA 3OOPA 3W2WA 2CU7A 2MG4A 1MBEA 3G3ZA 4BBRJ 4BL0B 2ZMEC 2P4WA 4BEHB 5HDNA 2OCCH 1U9OA 4D0PA 3HBLA 2YVHA 2WTEA 1D0YA 1S8NA 1Y6IA 2K85A 2BXZA 1NK2P 2Q8KA 2PX9A 2QWWA 1ZN2A 5JHFA 2M7AA 1WFXA 5HS9A 2Z16A 3CMAI 4KUMA 2HYGD 1W1WE 2VKEA 2WGBA 3ON4A 2COMA 1HLVA 5FGLA 3BZCA 3GWZA 2Y75A 2L4AA 2L5QA 4YRVA 4WF2A 2I10A 4X1EA 1UAAA 2XAQA 2Z5UA 4XLNF 1GHCA 3LSPA 2R3SA 4OMZA 3D0SA 2R7DA 1UG0A 1WQ2A 3TDUC 2HKOA 2MH9A 3QU3A 1YHQI 2ELHA 4ME9A 2V4JC 2WV0A 2EPFA 2V1XA 4FX4A 5ICEA 1QZEA 1GXPA 1FLIA 5B1AH 1EJ9A 1G8XA 1MBHA 1DDNA 2WA0A 2A6TA 5E1ZB 3J7AY 3KZ9A 2BV6A 3JTHA 2ZC2A 3DPTA 3I53A 1BIBA 4M6YA 3BR6A 3ABLH 2CW8A 2A61A 2XAGA 3LL7A 3LSTA 5HLGA 4EGZA 2RNGA 4U9LA 4QTRA 2MYSA 2KL4A 1E3OC 5CVJA 1Z9CA 2DODA 2QBYB 3J80K 1GT0C 2FNPA 3VYSB 1PYVA 3HOVJ 2FNAA 1GLNA 2ID6A 2W25A 1K79A 3QYEA 3ERMA 3VOKA 1OYWA 2G9WA 2P5VA 3UNGC 3V8LA 3L9FA 2Y0SA 4WXDA 1FBQA 4IRGA 1K83J 3S1NJ 3O3KA 3I56I 1A6IA 3L7WA 2W48A 3FWEA 5CXIA 1Y8RB 4I2OA 2P5KA 3CMYA 2NOGA 4JL3A 4TV7A 2W57A 2HTSA 2K4JA 4XSZF 3LSRA 1XMKA 2EA2A 1XC5A 4BGDA 3GZ6A 2D1HA 1FOXA 2PJPA 1ITYA 2G0EA 5EGOB 4GCTA 9ANTA 2CQXA 2X48A 3I3LA 1G3WA 4XRFA 1ZELA 3FXOA 2L9NA 1MGTA 1LDJA 2GXGA 1MJ9A 1VQNI 2MABA 4G7OF 4AIKA 3SYTA 4ESFA 2XGDA 3WTVC 3VUQA 3TO6A 2F5CA 3E5UA 5D4SA 3L2UA 2PBXA 1SVMA 1B4AA 3KX2A 4RMNA 3L00A 4EJWA 1D1BA 2ECBA 2DDBA 3LHQA 3P9KA 4LG3A 1IXRC 4CDGA 2CSOA 3OS2A 2VBZA 4ABZA 1ZRDA 5DYMA 5LHIA 3EUAA 4F93B 4L9VA 4DIQA 5J4VA 1W7PA 4QPQA 2OJED 2QQBA 3OR1C
chains in the Genus database with same CATH topology
5F27A 2GENA 4Y7NJ 1BW6A 2EZIA 4XRSA 2FD5A 2M9HA 2WV1A 3NRGA 2Y9YA 4FTHA 1RR7A 1MBJA 4XIDA 4FCYA 4CGRA 2R5YB 1FIPA 2XGEA 2DG8A 3V6GA 4A3FJ 2REKA 3P9TA 2O8KA 2LD5A 4HKUA 3CDLA 4A3CJ 4L5EA 3BTIA 4C3IJ 2EZKA 4A69C 1ZQ3P 3SFIA 1JUSA 4BY7J 3SJMA 4G12A 1RKWA 1XG1A 2IU5A 4I76A 4XRMA 1JJ6C 1BW5A 1GUUA 1POGA 2M34A 4D5FA 1YRNB 3S14J 2RHAA 3RD3A 4M6VA 1IV6A 2ELKA 2GBYA 5J3LA 3Q0WA 3S5RA 1ETYA 1MNMC 1HF0A 3VW2A 4I6ZA 1H88C 4UUSB 4A3LJ 1Z0XA 5D1RA 3HTIA 4W1UA 4Y52J 2R5ZA 2E2JJ 1FTTA 3JR9A 1WGXA 3BTLA 3MKLA 2VI6A 1P7IA 3T6NA 2Y2ZA 3RH2A 1MBKA 1IDYA 2DJNA 3BQZA 1S7EA 3A01B 2HOSA 4MO7A 3M4OJ 5CXGA 5FKOA 1VI0A 3IV5A 2QKOA 3E7LA 3G1MA 4B3AA 5FLVA 2LFBA 1QVUA 4AYBN 4AF5A 5K7FA 5D18A 2JWTA 1W0UA 5FKKA 1HDDC 2DA6A 1UI6A 2AHQA 4M3EA 3LOCA 2DA1A 3A02A 5M5WJ 3VVXA 5E3NA 4J19A 2DA5A 2EH3A 2KDZA 2COBA 1NTCA 2JN6A 1BJZA 1TWCJ 1WCMJ 1TWGJ 2L7FP 4A3IJ 2XRLA 3ON2A 3JREA 1Q1VA 2HYJA 1JJ8C 5E3LA 3NXCA 4A3KJ 1W0TA 3BRUA 1I3QJ 1OCPA 1ETKA 4JYKA 4GFKA 2DTZA 5GPAA 2HKUA 1IC8A 4KWAA 5J1RA 4B1RA 1O4XA 1SANA 1Y1WJ 3EUPA 4D5CA 2JA7J 2ME6A 2LKXA 2FQ4A 3IH3A 3ZQGA 5F08A 5IYCJ 5EZGA 1ORKA 4X6AJ 4DW6A 4EEFG 2UXPA 3ZQIA 2O9LA 1TWAJ 4W97A 1APLC 3GTKJ 3BTJA 3RQIA 2ZOYA 3COLA 1SGMA 2XPWA 1CQTA 2MGQA 2D5VA 5F04A 3HOYJ 3VVZA 2UXIA 3HIMA 3B6AA 3CQZJ 3L1PA 1JKQC 2VUMJ 4FE7A 3M3YJ 1AHDP 3MVPA 2YU9J 2HXIA 1JT6A 2NS7A 3TP3A 2EZHA 2XB0X 3BR1A 2O7OA 3IUVA 3SDGA 3CCYA 3NNRA 3QQAA 3O8GA 4MLOA 5E3MA 4LOCA 4IHYA 3G56A 3HOZJ 3S16J 3ZQLA 3KKCA 3HGGA 1OFCX 5M5YJ 3NARA 2LLKA 3GTPJ 1ZGWA 2K9SA 1F36A 3LNQA 3VIBA 3DCFA 5IP9J 1JTXA 4A93J 5M3FJ 2L9RA 3BTCA 3G7RA 4BBSJ 1B72B 4RDUA 1VFCA 2L7MP 3QPLA 1H89C 2M8GX 3PPBA 1X2MA 3O60A 3WHCA 1TWFJ 3PM1A 2OPTA 3S15J 4RBOA 2K9NA 2FJ1A 4C3JJ 5EEAA 4IEJA 4V2GA 2HI3A 1U78A 3MNLA 2X6OA 3LSGA 4UDSA 4GCKA 3ZQFA 3OSFA 2HYTA 5K58A 1RKTA 3BG5A 4D7NA 3HE0A 5EG0A 5EGOA 1ZKGA 5FLMJ 1F43A 1XS9A 2LP0A 1G2HA 1VF9A 3HKZN 4JX6A 3K7AJ 1GVDA 2QCOA 5EF6A 2N8GA 3BG3A 3UKGA 1JGGA 3FKIJ 3FISA 3HGYA 3TEDA 5EFYA 2VKVA 4IHXA 2XGCA 5FKMA 2JA8J 4JKZA 5M3MJ 3BR5A 1AKHB 3W6VA 4L62A 3VW0A 1LFBA 1ENHA 4A3EJ 3HTAA 3ZQCA 2H1KA 1B8IA 1JKRC 2WB1N 3VOXA 4M3FA 4C3HJ 1R9TJ 1JT0A 2OF7A 5FMPA 1HOMA 3IH4A 2DMUA 5IYBJ 1P7JA 2DA7A 4IHWA 3VP5A 1WPKA 5HODA 3HEFA 5IP7J 4XICA 3OIOA 3NAUA 2MW8A 3GTOJ 1GDTA 3QBMA 2NP3A 3GZIA 2GM4A 2G7SA 2NP5A 3C07A 3OSGA 5IPAA 2ID3A 1D5YA 4MIMA 5HBUA 2HDDA 5HSZA 2NVYJ 2R92J 2R5YA 2CQQA 2K9QA 1DU6A 4JNNA 3FK6A 1ZTRA 3S2HJ 2M0CA 3BR2A 4JX4A 4M3GA 3O8HA 4MFDA 5GPCA 3JSJA 4PXIA 1ETQA 1LE8B 1GV2A 3JRAA 2EBIA 3GTGJ 4NDLA 2Y30A 3GBGA 3H3VK 1AU7A 5EZHA 2HQ5A 2DA4A 2WAQN 1YRNA 5H9TA 3HOUJ 1ETWA 3HOXJ 2L0KA 3V78A 5C4XJ 3G1LA 3IH2A 4JX5A 1BL0A 2DA2A 2K40A 3PO2J 2DMQA 1MBGA 2MSYA 4QSHA 3GTLJ 3RZOJ 3ZOBA 4UUSA 2PZ9A 1FEXA 5HAWA 3HOWJ 3S1MJ 1T33A 3OOUA 1MSEC 4S0HB 4A3DJ 1DU0A 2QWTA 3TW7A 2GLOA 3BR0A 2M2EA 5FKNA 3G1OA 2DMNA 3C2BA 1PUFB 3AQSA 3JRGA 3A01A 1ZR4A 2QIBA 4MK6A 1IGNA 3PASA 2JMWA 4QIWN 1I6HJ 3GTQJ 2B63J 1ZK8A 2D6YA 5FJ8J 4ACIA 1RETA 1FTZA 3JRFA 4M3DA 1QPIA 2TCTA 5IOZA 5EDNA 3BT9A 3FRQA 1HDPA 2O7TA 3AQTA 3S17J 2IAIA 5C4JJ 2G7GA 2R7ZJ 1SFOJ 1IG7A 3I4MJ 2WUIA 1QRYA 5BNGA 2OERA 5CW8A 2DMTA 2L7ZA 2ZCMA 1JTYA 2ZOZA 1JKOC 3CWRA 2Y0SN 4CYCB 3LJLA 5IOYA 2FX0A 5F1JA 2G3BA 2LR8A 3Q0UA 2R93J 5EYRA 3TW6A 5IYDJ 2CJJA 5GP9A 1IDZA 2DA3A 5K7HA 2QTQA 2OI8A 5JLXA 4GFBA 2E2IJ 4IHVA 3Q0VA 1MSFC 1X2NA 3BJBA 3JRCA 3JRIA 2GUHA 4NELA 1GV5A 2PMZN 3FIWA 1IUFA 2RAEA 3ANPA 3F0CA 5K7ZA 3E7QA 1X58A 4MFEA 2DN0A 3B6CA 3BQYA 1T56A 2EQRA 2NVQJ 3K2AA 4A3MJ 2XPUA 1U9NA 1LFUP 5M5XJ 1IRZA 3DEWA 3D1NI 2R0QC 2GFNA 2ZCNA 1WH7A 2VPRA 1NK3P 2Y31A 3PO3J 2YUSA 3QPSA 2NS8A 3S1QJ 2R5ZB 2HOAA 3BCGA 1K61A 1WI3A 1ETVA 2NVTJ 5J1UA 1UI5A 3RKQA 1OJLA 1FJLA 2KT0A 4BY1J 3S2DJ 2RASA 5C4YA 1UHSA 2NX4A 1Y1VJ 1JUMA 3JRHA 3VW1A 2JK3A 2FBQA 2CU7A 2MG4A 1MBEA 4BBRJ 1BA5A 2IBDA 4A3BJ 2ZCXA 1U9OA 3NI7A 2UXOA 3HBLA 2W53A 2YVHA 3GTJJ 4FE4A 1B72A 4AUXA 4YZEA 5F0HA 2P81A 1NK2P 2CUEA 5AQCA 1Z77A 1ZR2A 2DMPA 1UG2A 1ETOA 2EZLA 4B4CA 1EF4A 4MXMA 4BKXA 2VKEA 2WGBA 3LWJA 1JUPA 3ON4A 1HLVA 4AC6A 2Q24A 5FGLA 1ETXA 1MBFA 4A3GJ 3HM5A 1VNDA 2I10A 4X1EA 4XRSG 3TP0A 3LSPA 4DZJA 4FISA 3BHQA 3Q3SA 4C2MJ 4XK4A 1AKHA 2XB5A 3H0GJ 4ME9A 1MH4A 3BR3A 2JJ7A 3F1BA 2CRGA 5IP6A 5FHPA 2H8RA 4ICHA 1MBHA 2X9DA 1OCTC 5DAJA 1JKPC 3KZ9A 1IJWC 4NN1A 2HOTA 2F07A 2XDNA 4GCLA 2LY9A 2Y9ZA 3BR6A 3GTMJ 2E19A 4DYRA 5C44J 2NVXJ 2E1OA 2ZB9A 5C3EJ 3S1RJ 4QTRA 3KKDA 3KNWA 5F0FA 2CUFA 1E3OC 3HTHA 2ECCA 4BXXJ 2V57A 3ANGA 1GT0C 1TC3C 2HXOA 1RESA 1LE8A 2JA5J 1U8BA 4V2FA 3HOVJ 3LSJA 3WHBA 2ID6A 3A03A 5F0CA 1UMQA 3VOKA 2XPVA 4DZPA 1MH3A 5DS9A 1HCRA 2ME0A 5DTDA 2E2HJ 5J1YA 1K83J 3S1NJ 2XSDC 2UXHA 1A6IA 3QKXA 2W48A 2UXUA 5CXIA 3CMYA 2NOGA 4JL3A 3MN2A 1WH5A 3GEUA 3LSRA 4M3BA 4UUTA 5E3OA 2QF7A 1XC5A 2YVEA 3CJDA 2LTPA 4GFLA 2LK2A 1PUFA 3HB9A 1H8AC 1ITYA 2G0EA 5EG0B 3VPRA 5EGOB 9ANTA 3B81A 4GCTA 2CQXA 2X48A 3BG9A 5JLWA 3DPJA 4JP0A 3EGQA 3NPIA 3JRBA 3HTJA 2XGDA 4DYQA 4HNVA 5D19A 4A3JJ 3VUQA 2PBXA 3FK7A 2TRTA 3RZDJ 3ZQHA 2JA6J 2DG7A 2YS9A 2IEKA 2LVSA 1FIAA 3BNIA 2ECBA 4D7MA 3LHQA 1I50J 2QOPA 1RPWA 3VVYA 3JRDA 5FKLA 1B8IB 1A5JA 1QVTA 2G7LA 3HDDA 4ABZA 1TWHJ 3I4NJ 4CYCA 3CRJA 4DYCA 4AC0A 2AO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F27 A;  2GEN A;  4Y7N J;  1BW6 A;  2EZI A;  4XRS A;  2FD5 A;  2M9H A;  2WV1 A;  3NRG A;  2Y9Y A;  4FTH A;  1RR7 A;  1MBJ A;  4XID A;  4FCY A;  4CGR A;  2R5Y B;  1FIP A;  2XGE A;  2DG8 A;  3V6G A;  4A3F J;  2REK A;  3P9T A;  2O8K A;  2LD5 A;  4HKU A;  3CDL A;  4A3C J;  4L5E A;  3BTI A;  4C3I J;  2EZK A;  4A69 C;  1ZQ3 P;  3SFI A;  1JUS A;  4BY7 J;  3SJM A;  4G12 A;  1RKW A;  1XG1 A;  2IU5 A;  4I76 A;  4XRM A;  1JJ6 C;  1BW5 A;  1GUU A;  1POG A;  2M34 A;  4D5F A;  1YRN B;  3S14 J;  2RHA A;  3RD3 A;  4M6V A;  1IV6 A;  2ELK A;  2GBY A;  5J3L A;  3Q0W A;  3S5R A;  1ETY A;  1MNM C;  1HF0 A;  3VW2 A;  4I6Z A;  1H88 C;  4UUS B;  4A3L J;  1Z0X A;  5D1R A;  3HTI A;  4W1U A;  4Y52 J;  2R5Z A;  2E2J J;  1FTT A;  3JR9 A;  1WGX A;  3BTL A;  3MKL A;  2VI6 A;  1P7I A;  3T6N A;  2Y2Z A;  3RH2 A;  1MBK A;  1IDY A;  2DJN A;  3BQZ A;  1S7E A;  3A01 B;  2HOS A;  4MO7 A;  3M4O J;  5CXG A;  5FKO A;  1VI0 A;  3IV5 A;  2QKO A;  3E7L A;  3G1M A;  4B3A A;  5FLV A;  2LFB A;  1QVU A;  4AYB N;  4AF5 A;  5K7F A;  5D18 A;  2JWT A;  1W0U A;  5FKK A;  1HDD C;  2DA6 A;  1UI6 A;  2AHQ A;  4M3E A;  3LOC A;  2DA1 A;  3A02 A;  5M5W J;  3VVX A;  5E3N A;  4J19 A;  2DA5 A;  2EH3 A;  2KDZ A;  2COB A;  1NTC A;  2JN6 A;  1BJZ A;  1TWC J;  1WCM J;  1TWG J;  2L7F P;  4A3I J;  2XRL A;  3ON2 A;  3JRE A;  1Q1V A;  2HYJ A;  1JJ8 C;  5E3L A;  3NXC A;  4A3K J;  1W0T A;  3BRU A;  1I3Q J;  1OCP A;  1ETK A;  4JYK A;  4GFK A;  2DTZ A;  5GPA A;  2HKU A;  1IC8 A;  4KWA A;  5J1R A;  4B1R A;  1O4X A;  1SAN A;  1Y1W J;  3EUP A;  4D5C A;  2JA7 J;  2ME6 A;  2LKX A;  2FQ4 A;  3IH3 A;  3ZQG A;  5F08 A;  5IYC J;  5EZG A;  1ORK A;  4X6A J;  4DW6 A;  4EEF G;  2UXP A;  3ZQI A;  2O9L A;  1TWA J;  4W97 A;  1APL C;  3GTK J;  3BTJ A;  3RQI A;  2ZOY A;  3COL A;  1SGM A;  2XPW A;  1CQT A;  2MGQ A;  2D5V A;  5F04 A;  3HOY J;  3VVZ A;  2UXI A;  3HIM A;  3B6A A;  3CQZ J;  3L1P A;  1JKQ C;  2VUM J;  4FE7 A;  3M3Y J;  1AHD P;  3MVP A;  2YU9 J;  2HXI A;  1JT6 A;  2NS7 A;  3TP3 A;  2EZH A;  2XB0 X;  3BR1 A;  2O7O A;  3IUV A;  3SDG A;  3CCY A;  3NNR A;  3QQA A;  3O8G A;  4MLO A;  5E3M A;  4LOC A;  4IHY A;  3G56 A;  3HOZ J;  3S16 J;  3ZQL A;  3KKC A;  3HGG A;  1OFC X;  5M5Y J;  3NAR A;  2LLK A;  3GTP J;  1ZGW A;  2K9S A;  1F36 A;  3LNQ A;  3VIB A;  3DCF A;  5IP9 J;  1JTX A;  4A93 J;  5M3F J;  2L9R A;  3BTC A;  3G7R A;  4BBS J;  1B72 B;  4RDU A;  1VFC A;  2L7M P;  3QPL A;  1H89 C;  2M8G X;  3PPB A;  1X2M A;  3O60 A;  3WHC A;  1TWF J;  3PM1 A;  2OPT A;  3S15 J;  4RBO A;  2K9N A;  2FJ1 A;  4C3J J;  5EEA A;  4IEJ A;  4V2G A;  2HI3 A;  1U78 A;  3MNL A;  2X6O A;  3LSG A;  4UDS A;  4GCK A;  3ZQF A;  3OSF A;  2HYT A;  5K58 A;  1RKT A;  3BG5 A;  4D7N A;  3HE0 A;  5EG0 A;  5EGO A;  1ZKG A;  5FLM J;  1F43 A;  1XS9 A;  2LP0 A;  1G2H A;  1VF9 A;  3HKZ N;  4JX6 A;  3K7A J;  1GVD A;  2QCO A;  5EF6 A;  2N8G A;  3BG3 A;  3UKG A;  1JGG A;  3FKI J;  3FIS A;  3HGY A;  3TED A;  5EFY A;  2VKV A;  4IHX A;  2XGC A;  5FKM A;  2JA8 J;  4JKZ A;  5M3M J;  3BR5 A;  1AKH B;  3W6V A;  4L62 A;  3VW0 A;  1LFB A;  1ENH A;  4A3E J;  3HTA A;  3ZQC A;  2H1K A;  1B8I A;  1JKR C;  2WB1 N;  3VOX A;  4M3F A;  4C3H J;  1R9T J;  1JT0 A;  2OF7 A;  5FMP A;  1HOM A;  3IH4 A;  2DMU A;  5IYB J;  1P7J A;  2DA7 A;  4IHW A;  3VP5 A;  1WPK A;  5HOD A;  3HEF A;  5IP7 J;  4XIC A;  3OIO A;  3NAU A;  2MW8 A;  3GTO J;  1GDT A;  3QBM A;  2NP3 A;  3GZI A;  2GM4 A;  2G7S A;  2NP5 A;  3C07 A;  3OSG A;  5IPA A;  2ID3 A;  1D5Y A;  4MIM A;  5HBU A;  2HDD A;  5HSZ A;  2NVY J;  2R92 J;  2R5Y A;  2CQQ A;  2K9Q A;  1DU6 A;  4JNN A;  3FK6 A;  1ZTR A;  3S2H J;  2M0C A;  3BR2 A;  4JX4 A;  4M3G A;  3O8H A;  4MFD A;  5GPC A;  3JSJ A;  4PXI A;  1ETQ A;  1LE8 B;  1GV2 A;  3JRA A;  2EBI A;  3GTG J;  4NDL A;  2Y30 A;  3GBG A;  3H3V K;  1AU7 A;  5EZH A;  2HQ5 A;  2DA4 A;  2WAQ N;  1YRN A;  5H9T A;  3HOU J;  1ETW A;  3HOX J;  2L0K A;  3V78 A;  5C4X J;  3G1L A;  3IH2 A;  4JX5 A;  1BL0 A;  2DA2 A;  2K40 A;  3PO2 J;  2DMQ A;  1MBG A;  2MSY A;  4QSH A;  3GTL J;  3RZO J;  3ZOB A;  4UUS A;  2PZ9 A;  1FEX A;  5HAW A;  3HOW J;  3S1M J;  1T33 A;  3OOU A;  1MSE C;  4S0H B;  4A3D J;  1DU0 A;  2QWT A;  3TW7 A;  2GLO A;  3BR0 A;  2M2E A;  5FKN A;  3G1O A;  2DMN A;  3C2B A;  1PUF B;  3AQS A;  3JRG A;  3A01 A;  1ZR4 A;  2QIB A;  4MK6 A;  1IGN A;  3PAS A;  2JMW A;  4QIW N;  1I6H J;  3GTQ J;  2B63 J;  1ZK8 A;  2D6Y A;  5FJ8 J;  4ACI A;  1RET A;  1FTZ A;  3JRF A;  4M3D A;  1QPI A;  2TCT A;  5IOZ A;  5EDN A;  3BT9 A;  3FRQ A;  1HDP A;  2O7T A;  3AQT A;  3S17 J;  2IAI A;  5C4J J;  2G7G A;  2R7Z J;  1SFO J;  1IG7 A;  3I4M J;  2WUI A;  1QRY A;  5BNG A;  2OER A;  5CW8 A;  2DMT A;  2L7Z A;  2ZCM A;  1JTY A;  2ZOZ A;  1JKO C;  3CWR A;  2Y0S N;  4CYC B;  3LJL A;  5IOY A;  2FX0 A;  5F1J A;  2G3B A;  2LR8 A;  3Q0U A;  2R93 J;  5EYR A;  3TW6 A;  5IYD J;  2CJJ A;  5GP9 A;  1IDZ A;  2DA3 A;  5K7H A;  2QTQ A;  2OI8 A;  5JLX A;  4GFB A;  2E2I J;  4IHV A;  3Q0V A;  1MSF C;  1X2N A;  3BJB A;  3JRC A;  3JRI A;  2GUH A;  4NEL A;  1GV5 A;  2PMZ N;  3FIW A;  1IUF A;  2RAE A;  3ANP A;  3F0C A;  5K7Z A;  3E7Q A;  1X58 A;  4MFE A;  2DN0 A;  3B6C A;  3BQY A;  1T56 A;  2EQR A;  2NVQ J;  3K2A A;  4A3M J;  2XPU A;  1U9N A;  1LFU P;  5M5X J;  1IRZ A;  3DEW A;  3D1N I;  2R0Q C;  2GFN A;  2ZCN A;  1WH7 A;  2VPR A;  1NK3 P;  2Y31 A;  3PO3 J;  2YUS A;  3QPS A;  2NS8 A;  3S1Q J;  2R5Z B;  2HOA A;  3BCG A;  1K61 A;  1WI3 A;  1ETV A;  2NVT J;  5J1U A;  1UI5 A;  3RKQ A;  1OJL A;  1FJL A;  2KT0 A;  4BY1 J;  3S2D J;  2RAS A;  5C4Y A;  1UHS A;  2NX4 A;  1Y1V J;  1JUM A;  3JRH A;  3VW1 A;  2JK3 A;  2FBQ A;  2CU7 A;  2MG4 A;  1MBE A;  4BBR J;  1BA5 A;  2IBD A;  4A3B J;  2ZCX A;  1U9O A;  3NI7 A;  2UXO A;  3HBL A;  2W53 A;  2YVH A;  3GTJ J;  4FE4 A;  1B72 A;  4AUX A;  4YZE A;  5F0H A;  2P81 A;  1NK2 P;  2CUE A;  5AQC A;  1Z77 A;  1ZR2 A;  2DMP A;  1UG2 A;  1ETO A;  2EZL A;  4B4C A;  1EF4 A;  4MXM A;  4BKX A;  2VKE A;  2WGB A;  3LWJ A;  1JUP A;  3ON4 A;  1HLV A;  4AC6 A;  2Q24 A;  5FGL A;  1ETX A;  1MBF A;  4A3G J;  3HM5 A;  1VND A;  2I10 A;  4X1E A;  4XRS G;  3TP0 A;  3LSP A;  4DZJ A;  4FIS A;  3BHQ A;  3Q3S A;  4C2M J;  4XK4 A;  1AKH A;  2XB5 A;  3H0G J;  4ME9 A;  1MH4 A;  3BR3 A;  2JJ7 A;  3F1B A;  2CRG A;  5IP6 A;  5FHP A;  2H8R A;  4ICH A;  1MBH A;  2X9D A;  1OCT C;  5DAJ A;  1JKP C;  3KZ9 A;  1IJW C;  4NN1 A;  2HOT A;  2F07 A;  2XDN A;  4GCL A;  2LY9 A;  2Y9Z A;  3BR6 A;  3GTM J;  2E19 A;  4DYR A;  5C44 J;  2NVX J;  2E1O A;  2ZB9 A;  5C3E J;  3S1R J;  4QTR A;  3KKD A;  3KNW A;  5F0F A;  2CUF A;  1E3O C;  3HTH A;  2ECC A;  4BXX J;  2V57 A;  3ANG A;  1GT0 C;  1TC3 C;  2HXO A;  1RES A;  1LE8 A;  2JA5 J;  1U8B A;  4V2F A;  3HOV J;  3LSJ A;  3WHB A;  2ID6 A;  3A03 A;  5F0C A;  1UMQ A;  3VOK A;  2XPV A;  4DZP A;  1MH3 A;  5DS9 A;  1HCR A;  2ME0 A;  5DTD A;  2E2H J;  5J1Y A;  1K83 J;  3S1N J;  2XSD C;  2UXH A;  1A6I A;  3QKX A;  2W48 A;  2UXU A;  5CXI A;  3CMY A;  2NOG A;  4JL3 A;  3MN2 A;  1WH5 A;  3GEU A;  3LSR A;  4M3B A;  4UUT A;  5E3O A;  2QF7 A;  1XC5 A;  2YVE A;  3CJD A;  2LTP A;  4GFL A;  2LK2 A;  1PUF A;  3HB9 A;  1H8A C;  1ITY A;  2G0E A;  5EG0 B;  3VPR A;  5EGO B;  9ANT A;  3B81 A;  4GCT A;  2CQX A;  2X48 A;  3BG9 A;  5JLW A;  3DPJ A;  4JP0 A;  3EGQ A;  3NPI A;  3JRB A;  3HTJ A;  2XGD A;  4DYQ A;  4HNV A;  5D19 A;  4A3J J;  3VUQ A;  2PBX A;  3FK7 A;  2TRT A;  3RZD J;  3ZQH A;  2JA6 J;  2DG7 A;  2YS9 A;  2IEK A;  2LVS A;  1FIA A;  3BNI A;  2ECB A;  4D7M A;  3LHQ A;  1I50 J;  2QOP A;  1RPW A;  3VVY A;  3JRD A;  5FKL A;  1B8I B;  1A5J A;  1QVT A;  2G7L A;  3HDD A;  4ABZ A;  1TWH J;  3I4N J;  4CYC A;  3CRJ A;  4DYC A;  4AC0 A;  2AO9 A; 
#chains in the Genus database with same CATH topology
 2V1U A;  2GEN A;  2WV1 A;  2F2E A;  3ABT A;  5E79 C;  1X1P A;  1IV8 A;  1RR7 A;  1MBJ A;  4CGR A;  3SHF A;  2LBF B;  3V6G A;  2R7O A;  2LD5 A;  1X3U A;  4A3C J;  1SFK A;  4IQJ A;  2GWR A;  2XRN A;  2YX4 A;  4C3I J;  4A69 C;  4BS9 A;  4H4K C;  2K9L A;  2JVG A;  3ZN1 A;  3IHU A;  2BVM A;  5KVR A;  3SJM A;  1XG1 A;  2DT5 A;  2VKH A;  2XIG A;  4M9S A;  2OV7 A;  3B73 A;  3ZCO A;  1YRN B;  2GZW A;  2DW4 A;  1FP2 A;  4G94 A;  3E97 A;  3PSI A;  3K70 D;  3PQJ A;  1L3L A;  3CDI A;  3RJP A;  3VW2 A;  3RKY A;  2AXL A;  3HHH A;  2ETH A;  2XAH A;  5D1R A;  4W1U A;  4FHT A;  2ZNZ A;  1G4D A;  1FTT A;  1WGX A;  1L0O C;  4P9F A;  3IC7 A;  2P5L C;  4WXH A;  2L9S A;  4KNY A;  4IX7 A;  5LBQ A;  1WZ2 A;  2VI6 A;  2RV8 A;  3T6N A;  1V54 H;  3CLQ A;  2YX7 A;  1F9N A;  2Y2Z A;  3RH2 A;  5HLI A;  3OR2 C;  1IDY A;  4EJT A;  1YG2 A;  1IRF A;  3A01 B;  2DQL A;  4MO7 A;  3M4O J;  2IS2 A;  1LKX A;  2FMY A;  4BHB A;  4BEH A;  1MDM B;  4HV6 A;  4IXA A;  1R36 A;  3G1M A;  2LFB A;  2BGC A;  4LMY A;  4HDV A;  1VQ9 I;  1X4P A;  2JWT A;  5D18 A;  2V9P A;  4KFC A;  1ZRF A;  3OL3 A;  1WI9 A;  5ERI A;  3RCO A;  2AHQ A;  3K4K A;  3LOC A;  2IGM A;  5H2F C;  5E3N A;  3H3Z A;  2VKD A;  4XKB A;  3CF5 F;  2EV0 A;  2JUG A;  2JN6 A;  1YX3 A;  2IXS A;  1TWC J;  2KIM A;  1J75 A;  2L7F P;  2A6H F;  3BC8 A;  4N0B A;  1IN6 A;  1SMY F;  3CCQ I;  3AG1 H;  5E3L A;  4A3K J;  2NVU B;  3BRU A;  2HOE A;  4KMF A;  5L3G A;  3LAJ A;  3EUP A;  1MZB A;  3I0T A;  4PJM A;  1F4K A;  2EA4 A;  2LKX A;  2FQ4 A;  4I02 A;  2PBI A;  4P55 A;  3RPU D;  2O5R A;  3TOA A;  3CC7 I;  4OMY A;  4EMS A;  4EVI A;  1XGN A;  1XCV A;  4MQ9 F;  3RKX A;  3IKT A;  2E36 A;  2XPW A;  2LNB A;  2FA5 A;  3AAF A;  3AFH A;  5F04 A;  1ERD A;  3QPH A;  3VVZ A;  1U0J A;  3CJN A;  4UVC A;  3RDI A;  2VUM J;  1BOB A;  2E34 A;  3CQZ J;  3L1P A;  1YOV B;  4XR6 A;  1Y56 A;  2OZU A;  4C30 A;  1AHD P;  2WC2 A;  1R71 A;  2HXI A;  4HRI A;  2FBK A;  3TP3 A;  1YO5 C;  3BR1 A;  2QBY A;  2OAZ A;  3DEU A;  4DBR A;  3O8G A;  3SZG A;  3LWF A;  3OIP A;  1K6O A;  4LOC A;  4DNC A;  2XAS A;  3S16 J;  3ZQL A;  3KKC A;  2OD5 A;  1USS A;  3TGN A;  1OFC X;  3NAR A;  3GTP J;  3J81 K;  2CUZ A;  1X4O A;  4CCJ A;  4RM3 A;  1ZGA A;  1HA8 A;  2ZJP F;  1JTX A;  2MD5 A;  4I99 C;  5CQE A;  5M3F J;  4KN7 X;  3CC2 I;  3M07 A;  1B72 B;  2FBH A;  1V3F A;  2L7M P;  3KZZ A;  3NWT A;  3JAM Z;  5DCF A;  1X2M A;  1R58 A;  2YR2 A;  3N97 A;  3WHC A;  2R7U A;  1P2F A;  2H94 A;  2G7H A;  3GEZ A;  3MNL A;  4IEJ A;  4V2G A;  3M8E A;  1QBJ A;  1ZAR A;  3GFJ A;  3LSG A;  3UR3 C;  4UDS A;  5K58 A;  4U87 A;  2HYT A;  2XUB A;  1ZKG A;  3L09 A;  5EGO A;  1D3Y A;  3MFK A;  2LP0 A;  4A0X A;  1VF9 A;  2VBY A;  4LGW A;  4JX6 A;  2JQ7 A;  3K7A J;  1GVD A;  2K9M A;  3REO A;  2N8G A;  1XSV A;  3UKG A;  5J6X A;  3KPH A;  1JGG A;  2DYS H;  2Q2E B;  1TTY A;  2VKV A;  2K3F A;  5FKM A;  4IZZ A;  3CMM A;  4IF4 A;  3AG3 H;  3WG9 A;  4IHS A;  5M3M J;  4JKZ A;  2HU9 A;  4L62 A;  3TOB A;  5JFR A;  1ENH A;  3V7S A;  4PJ0 C;  1R5I D;  3ZQC A;  4Y33 A;  3K69 A;  3T0Y A;  1X19 A;  2CW0 F;  2KRC A;  1WJE A;  5FMP A;  2FXA A;  3KP5 A;  1WPK A;  1Y39 A;  5F64 A;  1FBS A;  1H9T A;  5LHG A;  2ESN A;  4NB5 A;  3JTG A;  1GDT A;  3VYR B;  1T95 A;  3MEX A;  4LLG F;  2NP3 A;  2NP5 A;  1HKS A;  3GZI A;  4KIB A;  3OSG A;  1TT5 B;  2K02 A;  3FXU A;  2JUC A;  1LDK B;  3VB2 A;  5HNH A;  2VL8 A;  2CQN A;  1B6A A;  2VIX A;  4XKV A;  3L2R A;  1K4T A;  2ZJ2 A;  2CQQ A;  2LBF A;  1DU6 A;  1ZTR A;  2P7V B;  3JSJ A;  3O8H A;  4A0Z A;  4OWR B;  1DPU A;  3K8P C;  2Q0O A;  4PXI A;  1ETQ A;  2V1N A;  1LE8 B;  1GV2 A;  2E7X A;  2EBI A;  4BQQ A;  5JI6 A;  1XX5 A;  1AU7 A;  4RLF A;  3IL2 A;  2BW3 B;  3FXL A;  1YRN A;  2J5P A;  3TL4 X;  4UV9 A;  1N75 A;  3HOU J;  5H9T A;  4HSR A;  5C4X J;  3KEQ A;  5GAG J;  1SFX A;  2E1C A;  2IW5 A;  2K40 A;  4LD5 A;  3PO2 J;  4BU2 A;  4O6J A;  1OPC A;  1BI3 A;  3HRU A;  2QUF A;  1FEX A;  4OD5 A;  4XL9 A;  1A36 A;  3ULQ B;  1T33 A;  3R4K A;  3FKJ A;  1N77 A;  4S0H B;  2QSG X;  4A3D J;  2CG4 A;  1DU0 A;  4XKW A;  3BR0 A;  1I6X A;  2A5Y B;  1XMX A;  5GAE J;  2M2E A;  4LFU A;  3PFI A;  2V26 A;  3R6S A;  4BUP A;  3GUD A;  1AA7 A;  1ZRC A;  2HPI A;  4FX0 A;  3A01 A;  3ONQ A;  4ENM A;  4FAS D;  1IN5 A;  2A5W A;  5FFX A;  3ZP5 A;  3PAS A;  2JMW A;  1MDM A;  1Z1D A;  1I1G A;  1RET A;  5D5X B;  1FTZ A;  3CP8 A;  1MKM A;  2CYY A;  2JRM A;  3CO7 C;  1QQI A;  4IOC F;  1A31 A;  2DFI A;  2O7T A;  4LJZ F;  4HLY A;  3AQT A;  4HLX A;  3S17 J;  3Q9V A;  4HF0 A;  5C4J J;  1BBY A;  3DBL B;  1K6Y A;  2ISY A;  2CWE A;  3E6M A;  1JTY A;  1S5L C;  1JHH A;  1JKO C;  3K10 A;  2BOL A;  3P9I A;  2IT0 A;  3HZJ A;  4CYC B;  5FO5 A;  3HSE A;  3KET A;  3I59 B;  3SDB A;  2A6E F;  1VQ6 I;  3TW6 A;  2VT3 A;  3WE2 A;  4IPA A;  4CZZ A;  3KLN A;  2DA3 A;  3GVA A;  3KYD B;  4EV0 A;  3RPU A;  3FHN A;  3HL2 A;  5JLX A;  3M9A A;  3K4L A;  4IHV A;  3BLY A;  1MSF C;  3JRI A;  3GLX A;  4NEL A;  3D5R C;  1GV5 A;  4RB3 C;  2PMZ N;  3A0B C;  3FIW A;  3ANP A;  3H92 A;  3KZY A;  5K7Z A;  3D5S C;  3E7Q A;  1Q1H A;  2DN0 A;  2X85 A;  2YU3 A;  2QEX I;  5DDG A;  3TO9 A;  2XHK A;  3C2G A;  4HG2 A;  3RYR A;  2ISZ A;  1WRJ A;  4XOR A;  5M5X J;  1IRZ A;  2BY1 A;  3D1N I;  1G3Y A;  1WH7 A;  2VPR A;  2HEO A;  3ZMS A;  4DJA A;  2A69 F;  3BCG A;  2QGU A;  3OYJ A;  1K61 A;  1EKE A;  1FC3 A;  4WX9 A;  4I01 A;  1M1E B;  2CS3 A;  4HAM A;  1FOK A;  1UI5 A;  1FX7 A;  1T0F A;  4N9H A;  1OJL A;  1YJN I;  1W36 D;  3HRS A;  1RUO A;  1FP1 D;  5LEK A;  1JUM A;  1BI2 A;  1UFM A;  1R5G A;  1A6Q A;  2JK3 A;  4K2E A;  1MMA A;  5LLQ A;  5ED4 A;  2FBQ A;  1PP8 F;  2RQQ A;  3HRT A;  2KFD A;  5ILV A;  3NI7 A;  3KYL A;  2LKS A;  2Z2S B;  2QZ8 A;  3C3W A;  2W53 A;  3ISP A;  3LA2 A;  4HX8 A;  2V6E A;  2KDO A;  1B72 A;  3M8J A;  3CJQ B;  2YPR A;  4H0E A;  3MAJ A;  1R1V A;  2QKL B;  1ZR2 A;  2A2F X;  1UHM A;  1O3S A;  2BXY A;  1DPR A;  1EF4 A;  2D1V A;  2Q1Z B;  4AC6 A;  2Q24 A;  4CXF A;  1ETX A;  4A3G J;  2M5W A;  5HOO A;  4S05 A;  3ZMD A;  4BJT A;  5FGM A;  2EFO A;  2P0W A;  2Q2E A;  3MMY B;  4FIS A;  4KT5 C;  3CUQ B;  1YLF A;  3F9K A;  3H5R A;  2MLK A;  2XB5 A;  4NQW B;  3K6G A;  1RNL A;  2WY8 Q;  3BR3 A;  4IHT A;  3ZMT A;  2JJ7 A;  4PJJ A;  2CRG A;  4F52 A;  5IP6 A;  2H8R A;  1U3E M;  4ICH A;  2VAS A;  3K4M A;  2FRH A;  1YW7 A;  2X9D A;  1YS6 A;  4HX7 A;  2X0L A;  1XB4 A;  1HSJ A;  1U5T B;  3KCC A;  4NNJ A;  2MBF A;  2HOT A;  4PFP A;  4EM2 A;  5ILS A;  4ZDO A;  4GCL A;  3RPQ A;  2Y9Z A;  2E19 A;  1KYW A;  1YIO A;  2ZB9 A;  2XGX A;  2JTV A;  3KKD A;  2NYX A;  1S29 A;  2DOA A;  3NQO A;  1IRG A;  3KNW A;  2CUF A;  3HTH A;  3NEU A;  2ECC A;  3DXJ F;  2VJI A;  3M1C A;  1VQL I;  1RES A;  1LE8 A;  4Y17 A;  4HYE A;  2ZXW H;  4V2F A;  1XPX A;  3Q5F A;  4L18 B;  3FBI B;  1OLT A;  3A03 A;  2VLA A;  5F0C A;  2BW3 A;  2CQK A;  2IGN A;  4ZZD A;  1VQ8 I;  2V9K A;  2XPV A;  1R6R A;  5DS9 A;  1HCR A;  1OCR H;  2ME0 A;  2UXH A;  3HTS B;  3VYT B;  4AIJ A;  3QKX A;  2IA0 A;  1E3H A;  3E5Q A;  3E6C C;  3ZQQ A;  2BY0 A;  5H6R A;  2O8X A;  2DT6 A;  3DWL E;  1W7P D;  2LK2 A;  2DLL A;  2WAE A;  4F92 B;  1D8K A;  3OYB A;  4BYY A;  1TT0 A;  2FE3 A;  4L5I A;  3U2R A;  4CH7 A;  1YX5 A;  4IRH A;  3EGQ A;  2D45 A;  2DOE A;  3BP8 A;  3HTJ A;  2A07 F;  1R1U A;  4ZYG A;  4HNV A;  3CCV I;  1A04 A;  3FK7 A;  2TRT A;  3R0A A;  2X6W A;  1FIA A;  3BNI A;  3HTU A;  3WOD F;  4D7M A;  2QOP A;  3RQ4 A;  3JRD A;  4RB1 A;  2LOO A;  2I8D A;  3DEE A;  2FF4 A;  5FKL A;  3GYH X;  1B8I B;  1A5J A;  5CVV A;  4XM3 A;  3T5X A;  1TWH J;  2HVS A;  3I4N J;  3BCB A;  4CYC A;  3CCR I;  2R7F A;  2W00 A;  5HNF A;  3NWS A;  3AL0 C;  1DGW Y;  3I59 A;  2MA3 A;  1E17 A;  1WKM A;  2CFO A;  5J47 A;  2VXD A;  2J5O A;  4Y7N J;  1BW6 A;  1O7L A;  2FD5 A;  1J5Y A;  2M9H A;  2WB1 A;  1R7J A;  3I4P A;  4YG2 F;  1FIP A;  2XGE A;  2JRT A;  1MJA A;  3F8F A;  4HW0 A;  3S3N A;  4HKU A;  3CDL A;  1CGP A;  3BG7 A;  5J4Y A;  4AD9 A;  1TP4 A;  2EZK A;  3OV8 A;  2DCE A;  3R61 A;  5JVG F;  1O3R A;  2H8W A;  2IU5 A;  1JJ6 C;  4UVB A;  2LG4 A;  5D6E A;  4OIN F;  3RD3 A;  3CP2 A;  2ELK A;  4R1H A;  1MNM C;  5LGT A;  1VQ7 I;  3SEZ A;  3GZN B;  2DPU A;  3HTI A;  3IRQ A;  4Y52 J;  1FOW A;  5B66 C;  4BAC A;  3KP6 A;  2WAQ A;  4RAZ A;  4PK4 A;  5TIS C;  2LH9 A;  5KNL A;  1T2K A;  2NXN B;  2VJ5 A;  4FET A;  5FRO A;  1EH6 A;  3MKL A;  1XN7 A;  1VQO I;  5F6F A;  2KMU A;  2H09 A;  4Y13 A;  4UY8 I;  5FB2 A;  1LJ9 A;  3E1S A;  5GAH J;  4BQA A;  1VI0 A;  1SEU A;  4WIB A;  4ZDP A;  5BQT A;  1C0W A;  1FSH A;  3IV5 A;  2BBY A;  3E7L A;  3DKW A;  4B3A A;  5FLV A;  4R79 A;  4ZTF A;  1J0R A;  3L2C A;  2ZJQ F;  2GIV A;  5FKK A;  1HDD C;  3JCU C;  1QU3 A;  3F8C A;  1VQ4 I;  1R22 A;  2DA5 A;  3ZGK A;  1LVA A;  2CV2 A;  3JSO A;  1YQA A;  4EJV A;  2O3F A;  3HOS A;  1TWG J;  2K5C A;  4OIR F;  2P7C B;  4A3I J;  2L3D A;  2HWV A;  1S72 I;  1NG7 A;  1JJ8 C;  2PLY A;  1W0T A;  1I3Q J;  5KHD A;  1ETK A;  4PGG A;  1W4M A;  5GPA A;  2HKU A;  4KWA A;  3DPL C;  3CUQ A;  3EUH A;  3SEQ A;  4B1R A;  4XLP F;  4D5C A;  2DYR H;  1ZHF A;  1WHU A;  2JA7 J;  4NQW A;  2VB6 A;  3IH3 A;  3E6D A;  3ML6 A;  1ORK A;  2RNJ A;  1ZG1 A;  3W2A A;  4X6A J;  3DPU A;  2UXP A;  3QOP A;  3FXK A;  2O9L A;  1TWA J;  2LY1 A;  2EV6 A;  3WU1 B;  3GME A;  3BRO A;  4YFN F;  3F6O A;  2MGQ A;  4B3X A;  2D5V A;  3KZI C;  1U5T A;  3KE2 A;  4E6K G;  4MHG A;  1IAW A;  4CYD A;  2QSH X;  4DBQ A;  2XVC A;  1NHA A;  1IW7 F;  2DDA A;  1JT6 A;  2EZH A;  3WE3 A;  2O7O A;  3ZPL A;  2VJJ A;  2XKO A;  3BWG A;  4MLO A;  1JI8 A;  3HOZ J;  1OQY A;  1ZYR F;  3HGG A;  4AVZ A;  4RS8 A;  1N25 A;  3CF2 A;  2BZT A;  2K9S A;  3LNQ A;  3ZMZ A;  2X6Y A;  4G6D A;  4GXO A;  1IN8 A;  3BJO A;  4ANJ A;  3DCF A;  1OYY A;  4BNC A;  2ZFW A;  5IT9 K;  1RIO H;  3K70 C;  1KA8 A;  3SZT A;  3BTC A;  1JHF A;  3FMQ A;  3G7R A;  4CUG A;  1K78 B;  2X1E A;  2M8G X;  1TWF J;  2OPT A;  3DTE A;  3LQR A;  4RBO A;  2K9N A;  3DBH B;  4C3J J;  1TLH B;  3IWF A;  4GCK A;  4O5V A;  3LFK A;  3KP2 A;  1RKT A;  1MW7 A;  3PL8 A;  2GA2 A;  2KHM A;  2F6C A;  1F43 A;  3HPG A;  1G2H A;  4ZYA A;  4CHU A;  1TQM A;  4UUV A;  3EYY A;  4LK0 F;  4F55 A;  3WGI A;  2QCO A;  4DVY P;  3BG3 A;  2D2W A;  3NRV A;  1S3J A;  3FIS A;  3OYI A;  3TED A;  5EFY A;  4X0G A;  2HDC A;  4IHX A;  4RA2 A;  3K4J A;  3F3X A;  1QHG A;  2QLZ A;  3PFY A;  2JA8 J;  4XON A;  2O03 A;  1IXS B;  1AKH B;  5HLT A;  3WTS C;  3RSN A;  3VW0 A;  3EUK L;  1AOY A;  2EB7 A;  3HTA A;  3K4B A;  2H1K A;  4LIV A;  1B8I A;  1JKR C;  1JXS A;  3TQN A;  5LD2 C;  2HNH A;  2BHZ A;  3CUO A;  4M3F A;  5ICC A;  4L9N A;  4RB2 C;  1R9T J;  3QYF A;  2XAF A;  5KCM A;  2QM3 A;  1VQ5 I;  3IH4 A;  4IHW A;  1UZC A;  1OR7 A;  3W6J B;  2V9V A;  4E4H A;  2FML A;  2CW7 A;  4CO8 A;  4KYW A;  3QAH A;  2QEN A;  3OIO A;  3I58 A;  3E6B A;  2ZNY A;  2MW8 A;  3MKZ A;  3GTO J;  2PG4 A;  2G7S A;  3C07 A;  5IPA A;  2ID3 A;  4MIM A;  2DI3 A;  1BIA A;  3OYE A;  2R92 J;  1D0X A;  3CTA A;  4CCM A;  2Y48 A;  3FK6 A;  1Y0N A;  1LPQ A;  3FXR A;  2CV1 A;  5IT3 A;  2M0C A;  3A0H C;  1T38 A;  3H5A A;  4EM1 A;  1KGS A;  3I9V 2;  3FM3 A;  3EPZ A;  1SC7 A;  4NDL A;  1FYL A;  3GBG A;  1B1B A;  1GVJ A;  4BHC A;  2M87 A;  3H3V K;  2HQ5 A;  1G59 A;  3LA7 A;  4MTD A;  5IY5 H;  3DLA A;  1ETW A;  4XOP A;  2HYF A;  4L0Z B;  1D5V A;  1ACI A;  3IH2 A;  1BL0 A;  4HF1 A;  2DA2 A;  1X1C A;  4ENK A;  3RZO J;  3WTZ A;  2ZFU A;  2X1C A;  4PSW A;  3S1M J;  2RRE A;  2W84 A;  1Z05 A;  4HQE A;  1ODD A;  2VJ4 A;  2QWT A;  2VQL A;  3E0J B;  1QO0 D;  3WGH A;  5BMZ A;  4EM0 B;  2GLO A;  1IRX A;  1ON1 A;  4LLN A;  4PUS A;  4HEA 2;  1FWZ A;  4RM2 A;  3OYM A;  1PUF B;  2PN6 A;  2VN2 A;  4WK8 F;  3JRG A;  4A6E A;  4ZYD A;  4MK6 A;  2NRA C;  3DU5 A;  2LF8 A;  2LY2 A;  3HJE A;  1TL8 A;  3PNV A;  2XKP A;  1K4S A;  4ACI A;  5H6Q A;  3W3C A;  1ZK8 A;  2QSF X;  5HDG A;  5FJ8 J;  3GTQ J;  3VTI A;  1V5E A;  4M3D A;  1QPI A;  2TCT A;  1H9G A;  1HBX G;  3BT9 A;  3FRQ A;  3V4G A;  1HDP A;  2L4M A;  3DU6 A;  3GFL A;  3K1M A;  2VOO A;  1T0F C;  4GDF A;  1VQP I;  5K1Y A;  2G7G A;  1YFH A;  1SD6 A;  2R7Z J;  4EGY A;  1SFO J;  2UWM A;  5BNG A;  1Y0U A;  2HQA A;  4RLQ A;  2W85 A;  2DMT A;  2EIJ H;  3VOD A;  4Q4Z F;  2ZCM A;  4P96 A;  2ZOZ A;  3ROU A;  3HXL A;  5IOY A;  3SXY A;  5F1J A;  1E0E A;  4E7S A;  1BI1 A;  3Q0U A;  5EYR A;  3ECH A;  5IYD J;  2PFB A;  2NS0 A;  1IDZ A;  2DO7 A;  2X4H A;  1LFP A;  1QA6 A;  2BVL A;  2OQG A;  2FJI 1;  2E2I J;  1X2N A;  3JRC A;  1K7A A;  4L9J A;  4IOA F;  3JSP A;  1IUF A;  4U88 A;  2A3S A;  1SMT A;  4BHP A;  3F0C A;  4CGZ A;  2DXI A;  2B1E A;  1P4X A;  1X58 A;  4MFE A;  2K3P A;  4CSW A;  4AID A;  1QGP A;  5K5O A;  2NVQ J;  5D5W B;  1VTN C;  1FY7 A;  1J59 A;  4II3 A;  2HDW A;  1U9N A;  1T98 A;  1MD0 A;  3KEO A;  4YII A;  3T8R A;  3U1K A;  1PUE E;  4G6Q A;  3CDH A;  2ZCN A;  4BJ5 C;  4D9J A;  3F72 A;  1LEA A;  1KZH A;  3P9C A;  3PSF A;  3WU0 A;  5L3F A;  1X1B A;  3WTX C;  2NS8 A;  1YJW I;  3F22 A;  3S1Q J;  4B8X A;  2BHY A;  3BCA A;  1QZZ A;  2MH2 A;  1ON2 A;  1WVR A;  5J1U A;  3EQL F;  2V7F A;  2OU2 A;  2X1D A;  3QPT A;  3S2D J;  4OAY A;  2RAS A;  2NX4 A;  1O7F A;  1TNS A;  1X1D A;  5JR3 A;  3V8K A;  2R7W A;  3GFM A;  1IF1 A;  3H9J A;  4A3B J;  4B43 A;  2ZCX A;  3WTT C;  2UXO A;  2PI0 A;  3GTJ J;  4O3M A;  4AUX A;  1K78 A;  4YZE A;  3HUG B;  4M71 A;  4MNU A;  3FHZ A;  3CME I;  2CUE A;  4KMU X;  2GA1 A;  3A2K A;  5AQC A;  2AQF A;  4HDU A;  2XV4 S;  1TZL A;  1UG2 A;  1KYZ A;  1G3T A;  1XDS A;  1Z21 A;  2EZL A;  2GIZ A;  3DBR B;  3VWB A;  3DTK A;  1N78 A;  4C2T A;  2E1M C;  4MEX F;  4AYB A;  2WAD A;  3LWJ A;  2W1O A;  1JUP A;  2HR3 A;  3EDP A;  3CCS I;  2OC6 A;  4C2M A;  1MBF A;  4U0V A;  1ZAO A;  2H27 A;  3HM5 A;  1VND A;  2KJB A;  2KQR A;  4GYG A;  4CZC A;  4XKC A;  1I5Z A;  5E17 F;  1KON A;  1R49 A;  4ITV A;  4DZJ A;  4ZTJ A;  2EFW A;  1H0M A;  1HW2 A;  3BHQ A;  1QZY A;  4XK4 A;  1AKH A;  4J01 A;  1VQM I;  3H0G J;  3FDY A;  3C18 A;  3HSR A;  3ECO A;  5B3S H;  3U9G A;  2VC0 A;  2M8E A;  2NAZ A;  4IVN A;  3MCZ A;  4WWC A;  3N05 A;  3GF2 A;  4HNU A;  2O61 A;  5TJJ A;  1XSX A;  1OCT C;  1JGS A;  5AIQ A;  3H3U A;  3K9T A;  1S9H A;  4N4N B;  4BDY A;  1IJW C;  4HOB A;  4NN1 A;  2VOP A;  5L3D A;  3IP4 B;  2XDN A;  1MMN A;  5J8F A;  2QQA A;  4DYR A;  5C44 J;  3CCE I;  3GX4 X;  2E1O A;  5C3E J;  1J7K A;  2EIL H;  3S1R J;  1P9Q C;  4U7D A;  5F0F A;  4BXF A;  4BXX J;  3ANG A;  3V7R A;  1KQ8 A;  1TC3 C;  1SAX A;  4L5J A;  1WSU A;  3BPV A;  2DFH A;  2VON A;  3ASN H;  2ACJ A;  1U8B A;  3OMY A;  4LK1 F;  2VOD A;  3WHB A;  2B9S A;  1R00 A;  1ULY A;  5EEG A;  1LDD A;  1SD4 A;  3KIO A;  1MH3 A;  1RZ4 A;  1SAU A;  3DKX A;  4M72 A;  4M74 A;  5DM6 F;  4D1Q A;  5DTD A;  2E2H J;  2ZKZ A;  5K5Q A;  2L54 A;  2RDP A;  3PUF A;  4WXC A;  4OD4 A;  2IGK A;  3MN2 A;  2M3A A;  3ERE D;  3V7C A;  4AM3 A;  1WH5 A;  4NUB A;  3GEU A;  4PSX A;  4UUT A;  2F5F A;  2QF7 A;  2YVE A;  3CZ6 A;  1I1S A;  3F8B A;  3CJD A;  4CCO A;  1PUF A;  5HS8 A;  3HB9 A;  3LAP A;  5LEJ A;  2LMD A;  1H8A C;  2E7W A;  2ZJR F;  2PMZ A;  3VYU B;  3BDD A;  2VBW A;  4LG0 B;  5JLW A;  2IPQ X;  5D4R A;  1CF7 B;  3DPJ A;  3KYC B;  2IS4 A;  3NPI A;  3JRB A;  4LB6 B;  2OA4 A;  4DYQ A;  5D19 A;  2DTR A;  3J80 Z;  2JA6 J;  3G71 I;  3ZQH A;  1OCO H;  2DU9 A;  2YS9 A;  2Z1D A;  2DG7 A;  2F48 A;  2LVS A;  1Z7L A;  1XGS A;  3K4C A;  2F4I A;  3VVY A;  2G7L A;  2DFF A;  2MLG A;  2ZO4 A;  2MD0 A;  2KLO A;  3F6V A;  2H1L A;  4AC0 A;  3PNY A;  2AO9 A;  1G6N A;  3KEY A;  1RI7 A;  4RGS A;  5F27 A;  2EZI A;  4XSX F;  5BS6 A;  4PDK A;  1PDN C;  3ABM H;  3NRG A;  2Y9Y A;  3BZK A;  2LKP A;  4XID A;  1SVO A;  4FCY A;  4PJL A;  2R5Y B;  5CYV A;  2DG8 A;  2YVX A;  4A3F J;  2PEX A;  4R8H A;  3ELK A;  4UNO A;  4L5E A;  4ZYH A;  4A12 A;  2E60 A;  3BTI A;  3M7G A;  4OAZ A;  5E20 A;  3SFI A;  1JUS A;  4BY7 J;  4G12 A;  3LSI A;  1D1C A;  2A68 F;  2HPM A;  4I76 A;  4XRM A;  4IKF A;  1GUU A;  1POG A;  1FNN A;  1FOY A;  1PVE A;  3OYD A;  4M6V A;  5J3L A;  1DQU A;  3Q0W A;  4EJU A;  3W2V A;  3S5R A;  1XSD A;  2HTJ A;  3CUQ C;  1ZGJ A;  1HF0 A;  3S8P A;  4QWQ A;  4I6Z A;  1HKT A;  3DLL F;  1FBU A;  4LIU A;  1YIJ I;  4UUS B;  4A3L J;  1Z0X A;  3DTI A;  5E1X A;  4IRI A;  3VEP A;  2E2J J;  1BI0 A;  2K4B A;  4AIH A;  3QU6 A;  1FMV A;  1IN4 A;  1Z3Y A;  1AWC A;  2CFX A;  4JQF A;  3QP6 A;  1T08 B;  1OCC H;  3OY9 A;  5IT9 Z;  3G73 A;  4HA8 A;  3GLL A;  1IXC A;  3M8F A;  3SFZ A;  4ASN A;  1U5T C;  1SFE A;  2DJN A;  4M6X A;  2FBI A;  3K0L A;  2QKO A;  4Q48 A;  4Y4R A;  1QVU A;  5AON A;  4NBQ A;  4S04 A;  1WJA A;  2XRO A;  3L2V A;  3HUG A;  2JA2 A;  3EYI A;  4HV5 A;  2KP6 A;  4M3E A;  4GGG A;  1RUN A;  3VVX A;  4IL6 C;  4J19 A;  2KDZ A;  3TDZ C;  3TO7 A;  2B7E A;  1NTC A;  1T6S A;  5FFZ A;  4ZZL A;  4I98 B;  2VBX A;  3U1D A;  1WCM J;  2XRL A;  3ON2 A;  2DQR A;  2IRF G;  1FSE A;  2HYJ A;  3NXC A;  4JYK A;  2M0M A;  1LUJ B;  2DTZ A;  3KLO A;  2OUM A;  1Z67 A;  1ZLJ A;  4II2 A;  1IC8 A;  5J1R A;  2GOM A;  3F8M A;  5FD5 A;  2VQC A;  3PIP F;  1O4X A;  2LSO A;  2KZG A;  2ME6 A;  3AKZ A;  3ZQG A;  3JAM K;  2VE9 A;  2E5Z A;  4NC8 A;  4EEF G;  4OIQ F;  1T39 A;  3HG9 A;  3KP3 A;  4W97 A;  2KRF A;  1APL C;  3I54 A;  3C7J A;  3GTK J;  2Z33 A;  3RQI A;  2ELJ A;  3BY6 A;  2HKX A;  3T1B A;  4A0Y A;  2JZY A;  4E7I A;  2ZOY A;  3CO6 C;  3H0D A;  2VQH A;  3HOY J;  5DM7 F;  2L01 A;  1X3W B;  2RGV A;  1XDU A;  3HIM A;  1WJF A;  4FE7 A;  3M3Y J;  2ZXI A;  3DKY A;  3MVP A;  4ENN A;  5J40 A;  4Q47 A;  2NS7 A;  2ZSH B;  1D8J A;  2NNY A;  3IUV A;  1YI2 I;  3SDG A;  3CCY A;  3I71 A;  4BH9 A;  4DQ2 A;  5HLH A;  2VC1 A;  1OR7 C;  3B02 A;  3I64 A;  5BPD A;  3G56 A;  2V1D A;  2EJR A;  1BJA A;  1I27 A;  2BY3 A;  2NOJ B;  3GCM A;  2LLK A;  4B47 A;  1ZGW A;  2XF5 A;  3LSM A;  1XD7 A;  4Y3O A;  5LRR A;  1R4N B;  3I55 I;  3CC4 I;  5IP9 J;  1MMS A;  2DBB A;  2L9R A;  3P5J A;  4BBS J;  3CES A;  3QWL A;  5GAD J;  1DP3 A;  5BOX A;  1EA3 A;  3PM1 A;  1U78 A;  2FUG 2;  2HI3 A;  5DD4 A;  2X6O A;  2ZXJ A;  4AU7 A;  2CQ7 A;  3ZQF A;  3OSF A;  2KZV A;  4G9Y A;  2M4K A;  1BC7 C;  5FLM J;  1Z3X A;  4KA4 A;  1REP C;  4F7Z A;  4LG0 A;  1FPQ A;  3HKZ N;  1CF7 A;  2IS6 A;  4A5N A;  5LFA A;  2V79 A;  3HGY A;  3U21 A;  1V5F A;  2XGC A;  1DP7 P;  4LIT A;  5CQG A;  1TBX A;  1I3A A;  4YEJ A;  3BR5 A;  3MKW B;  5CVU A;  2QYO A;  1LFB A;  3PIO F;  4A3E J;  5FLX K;  3GFI A;  4EJO A;  2WB1 N;  4G7Z F;  1J2X A;  1MIJ A;  2CUJ A;  3VOX A;  2QA4 I;  3J81 Z;  1XCB A;  1TQP A;  3IAS 2;  3AL0 B;  3SWH A;  2FSW A;  2ZCW A;  5DUK A;  5KAF C;  1WJ5 A;  4XN3 A;  3VP5 A;  5E1W A;  4CCN A;  4U0Y A;  3HEF A;  2MC4 A;  3HC7 A;  3NAU A;  2RN7 A;  1IUY A;  1EV7 A;  3FXQ A;  2Z99 A;  3QBM A;  2GM4 A;  4YFX F;  3NS4 A;  4XLA A;  2M30 A;  1S7O A;  2K27 A;  3GO5 A;  5HS7 A;  5HBU A;  1PJR A;  2NVY J;  5HSZ A;  2R5Y A;  2ZME B;  2K9Q A;  2STT A;  3CCL I;  2VPL A;  4JNN A;  2FEZ A;  3OYL A;  3HIF A;  3BR2 A;  5GPC A;  2H6C A;  2HFH A;  2Y0M A;  4IJA A;  2HVQ A;  3JRA A;  3GTG J;  5L3C A;  5EZH A;  2HQN A;  4RAG A;  4RGX A;  2DA4 A;  2WAQ N;  4XNF A;  2P6T A;  2FQ3 A;  3E5X A;  1LEB A;  1Z6R A;  2L0K A;  2BYV E;  1QNT A;  3G1L A;  4JX5 A;  3ABK H;  3V42 A;  3GTL J;  5H20 A;  4UUS A;  5HAW A;  4ZYE A;  2X51 A;  2F4O B;  3PUB A;  2VE8 A;  4IRV A;  4HX4 A;  4HQM A;  5CPR B;  4L0Y B;  2L02 A;  3S3M A;  1YYV A;  3H36 A;  2EIM H;  3G1O A;  4I7H A;  2XF6 A;  1Z7U A;  5KAI C;  3AQS A;  4NC7 A;  1ZR4 A;  2QIB A;  4ETS A;  3FMR A;  4I09 A;  5EEH A;  4U0W A;  5J8C A;  4IO9 F;  2OQR A;  2B3W A;  3RI4 A;  5BPI A;  2P6S A;  2D6Y A;  3JRF A;  5IOZ A;  4ZJZ A;  3PQK A;  1OCZ H;  1QPM A;  4HST A;  1MJB A;  3QYB A;  1OYI A;  5K5R A;  3OYG A;  1KU7 A;  4KIS A;  1P4A A;  2KRH A;  3OWT A;  3T8T A;  5CW8 A;  2L7Z A;  5A2Q K;  1VQK I;  3JW4 A;  3CLO A;  3CWR A;  2Y0S N;  3LJL A;  1IN7 A;  4CCK A;  2R7R A;  2FOW A;  1W5T A;  2LR8 A;  3LA3 A;  1G3S A;  1BM9 A;  2R7Q A;  3S2W A;  1HC8 A;  4QLC U;  3HSF A;  5K7H A;  5L3E A;  2OI8 A;  2XSJ C;  4MEY F;  3QOD A;  2F5D A;  3W6K B;  4CIC A;  2OCE A;  2GUH A;  3ESW B;  1FYM A;  1GXQ A;  2RAE A;  1SFU A;  2HVR A;  1BR4 A;  1HXD A;  4YFK F;  3SQN A;  4UB8 C;  3IRR A;  1TQI A;  1FZP B;  4CA0 A;  3BQY A;  3OL4 A;  1ZLK A;  4EAT A;  2EQR A;  1BR1 A;  3IKV A;  2XPU A;  1LFU P;  2DK5 A;  1S6L A;  2M4G A;  3E3V A;  2R0Q C;  2F5V A;  2XF7 A;  2GFN A;  3S3O A;  2LC2 A;  4HBL A;  1NK3 P;  4BE2 A;  2R7X A;  3PO3 J;  2YUS A;  3QPS A;  2R5Z B;  2HOA A;  1Z6T A;  3H1C A;  2ESH A;  3IUO A;  2L7K A;  1ETV A;  5FRN A;  1SD7 A;  3TMO A;  1ZRE A;  2KT0 A;  2ZSI B;  4BY1 J;  5C4Y A;  1UHS A;  3R60 A;  1Y1V J;  5AIP A;  2Z9O A;  4E7Z A;  1YW8 A;  2X6X A;  2XAJ A;  2CMP A;  5DUI A;  4LB5 A;  2IA1 A;  1BA5 A;  2IBD A;  3HYI A;  4U7B A;  2XC7 A;  1KU9 A;  2OBP A;  4F91 B;  2JVH A;  2M7B A;  3G4S I;  3WGG A;  2GXA A;  2DFE A;  4FE4 A;  3OYH A;  2IJL A;  5F0H A;  5F1R A;  2O0Y A;  6PAX A;  2L9V A;  2P81 A;  4YEL A;  3CD6 I;  1Z77 A;  5ILU A;  1SVL A;  2DMP A;  2KIU A;  1ETO A;  4ON0 A;  4B4C A;  4MXM A;  1E2X A;  5DEQ A;  3AG4 H;  3H9G A;  4BKX A;  4KIC A;  2M45 A;  4L9T A;  1E3P A;  1V55 H;  2OTL I;  4XRS G;  3PJR A;  2C6Y A;  5JHU A;  3TP0 A;  1P92 A;  5FD6 A;  4A5M A;  3Q3S A;  4C2M J;  5E8I A;  2FOK A;  4ZC3 A;  2JSP A;  3X2Q H;  4BQO A;  2PJR B;  3J7Y J;  1W5C C;  5D5V B;  1MH4 A;  1LQ1 A;  4C9Y A;  3F1B A;  2KIQ A;  5FHP A;  3C1D A;  1NH3 A;  2PMU A;  3GW2 A;  4AWX B;  4E7H A;  2B0L A;  5DAJ A;  1JKP C;  4KIG A;  4PCQ A;  5D8K B;  1UEL B;  2W24 A;  3FX3 A;  1R5H A;  2KJC A;  3H9Q A;  4GO1 A;  3BG6 A;  1LNW A;  2F07 A;  5D5U B;  2LY9 A;  3VSL A;  3GTM J;  1MND A;  2NVX J;  2ZY9 A;  4HPQ A;  2ZME A;  3BJA A;  1XGO A;  3ZN0 A;  5HVQ C;  4ESB A;  3OYK A;  2V57 A;  2ICW G;  1KU3 A;  2HXO A;  3CCM I;  5CVR A;  4OIP F;  4XLC A;  2JA5 J;  4KDP A;  4Z6Y A;  1KU2 A;  3LSJ A;  4OU0 A;  4LLL A;  3ZRG A;  1I39 A;  4HZF A;  1UMQ A;  1BOA A;  4BXU A;  4DZP A;  4A2U A;  3KP4 A;  3HOT A;  4M9Z A;  1MMD A;  4C2U A;  1IZ1 A;  5J1Y A;  2XSD C;  1U6G A;  1XMA A;  2HZT A;  3OIQ A;  3WU2 C;  2UXU A;  4YIR X;  3FXM A;  2OZ6 A;  2GAU A;  2LDU A;  3CJT B;  4P5O A;  4F3Q A;  3I5U A;  2HZD A;  4M3B A;  2KIF A;  2YSR A;  5E3O A;  2EK5 A;  2LTP A;  4GFL A;  2LYC A;  5EG0 B;  4RAF A;  3VPR A;  3B81 A;  1FYK A;  3F23 A;  3BG9 A;  1EH7 A;  3ZXS A;  4JP0 A;  4U9N A;  2WWY A;  3F21 A;  3MZY A;  3K1N A;  4UVA A;  3WTY C;  4A3J J;  3RZD J;  4KJZ A;  2JPB A;  1B9M A;  1U8R A;  2IEK A;  3BOQ A;  1I50 J;  2EFN A;  3HHG A;  5FRM A;  1RPW A;  2FU4 A;  2XAU A;  2KPM A;  4I0A A;  1BR2 A;  1QVT A;  4DGW B;  1TW3 A;  3O2P E;  1O3T A;  2MFZ A;  3HDD A;  5B1B H;  3CRJ A;  3A4C A;  3QOE A;  4DYC A;  2LRD A;  3MZH A;  1DGR M;  2RVC A;  3RYP A;  2VQG A;  1UST A;  1B9N A;  2LF7 A;  2RC4 A;  4XRS A;  2PFV A;  4MQV A;  2EWN A;  4FTH A;  1YS7 A;  5HDK A;  4OIO F;  4P1W A;  1NG6 A;  2NNN A;  5JVT A;  2REK A;  3P9T A;  2O8K A;  3VFZ A;  3FXJ A;  2EFQ A;  4WCG A;  3OS0 A;  1W5S A;  4Y15 A;  1UHW A;  2DT7 B;  4I0B A;  1HQC A;  3AG2 H;  1ZQ3 P;  2OTJ I;  1P6R A;  1MMG A;  1RKW A;  2DPD A;  4NHJ A;  3P7N A;  2ZBK A;  2JT1 A;  1BW5 A;  3ABU A;  2M34 A;  4D5F A;  4IQ4 A;  2UUZ A;  3S14 J;  2RHA A;  3FM5 A;  1IV6 A;  2GBY A;  1ETY A;  4BJ6 C;  2IVM A;  1H88 C;  1F1Z A;  4HNT A;  2R5Z A;  2EFP A;  1X1A A;  3JR9 A;  2L2O A;  3BTL A;  2CV0 A;  2E71 A;  3MQ0 A;  5LRS A;  2LRE A;  1RRJ A;  3GXO A;  1P7I A;  1VZ0 A;  2QQ9 A;  3M1E A;  1MBK A;  4XLF A;  4CCL A;  3BQZ A;  1S7E A;  1KQ9 A;  1P4W A;  4PZJ A;  5TRD A;  2HOS A;  4M73 A;  2O6G E;  3K4N A;  5CXG A;  5GTI C;  5FKO A;  4HF2 A;  2ZXH A;  3EET A;  3ASO H;  2WY7 Q;  4AYB N;  2V6C A;  4AF5 A;  3VSK A;  5K7F A;  2Z3Y A;  2UZK A;  1W0U A;  4RAY A;  2KIS A;  4E7K A;  2DA6 A;  2W7N A;  1UI6 A;  3R0J A;  2DA1 A;  3A02 A;  5M5W J;  4P9U A;  2QVO A;  4XOT A;  3WTW C;  2EH3 A;  1OMI A;  2M1B A;  2E1M B;  4Q5S F;  2COB A;  2F5E A;  4UHT A;  2STW A;  4FT8 A;  3TKY A;  1T8I A;  5CKT A;  1PP7 U;  3GZ5 A;  5FLX Z;  1BJZ A;  2PMH A;  1UCR A;  3FZV A;  3JRE A;  4XLH A;  4Z2Y A;  1Q1V A;  2DOF A;  4BAY A;  1YIT I;  4GFK A;  4JBA A;  1OCP A;  2IP2 A;  2VT2 A;  2GQQ A;  3LFU A;  3G2B A;  4FQG A;  1SAN A;  1Y1W J;  2PJR A;  5DCM B;  5CLS A;  5F08 A;  5IYC J;  5EZG A;  4E7J A;  4MGR A;  4GYI A;  3ZQ7 A;  4DW6 A;  4BDZ A;  3ZQI A;  3KP7 A;  5D6F A;  4NC6 A;  1BN5 A;  2I5U A;  4MTE A;  3BTJ A;  5ICF A;  4AVP A;  5B5E C;  4ESJ A;  3COL A;  2E5N A;  1SGM A;  4YIF A;  1CQT A;  3DP7 A;  3DF8 A;  1D0Z A;  1A35 A;  2UXI A;  1WJC A;  3K1P A;  3F8N A;  5LGN A;  4E7L A;  1ONV A;  3B6A A;  1JKQ C;  2KKO A;  3FMS A;  3QRF F;  2YU9 J;  4PJN A;  4RGR A;  1W36 C;  2XB0 X;  1J09 A;  2AXT C;  5E8G A;  3NNR A;  3DV8 A;  3PNT A;  2R7V A;  3QQA A;  2R7T A;  4XQF A;  5E3M A;  4IHY A;  2IS1 A;  1J9I A;  4KIT B;  2IGO A;  4M9X A;  5M5Y J;  3S32 A;  2VXZ A;  4KN4 X;  5DD8 A;  1F36 A;  4RB0 A;  4UV8 A;  2MC3 A;  2R4G A;  1IO2 A;  3VIB A;  5CVI A;  1OKR A;  1OIS A;  4A93 J;  4XBF A;  4RDU A;  1VFC A;  3O6B B;  3QPL A;  1H89 C;  3PPB A;  3O60 A;  2JPC A;  2DAO A;  4GRI A;  4EQQ A;  3S15 J;  1LVK A;  2Y69 H;  2FJ1 A;  4DOZ A;  5EEA A;  2GOX B;  1D1A A;  3J7Z I;  1HST A;  2DK8 A;  3BG5 A;  4D7N A;  3HE0 A;  2UV1 A;  3MWM A;  5EG0 A;  1WJB A;  3LQQ A;  3BPX A;  1RR8 C;  1XS9 A;  1ZG5 A;  1TNT A;  2EIN H;  4UB6 C;  3KFW X;  1QHH D;  5EF6 A;  5A2Q Z;  2ADU A;  1DUX C;  2HS5 A;  3IAM 2;  4G6T B;  3FKI J;  4OOI A;  3L2W A;  1FT9 A;  3L2Q A;  1R23 A;  3K2Z A;  3EUH C;  5EJC A;  3W6V A;  5LGU A;  4BE0 A;  4QPO A;  3ZMU A;  4C3H J;  1JT0 A;  2R7S A;  2OF7 A;  4PFO A;  4UXN A;  1HOM A;  1YJ9 I;  2DMU A;  5IYB J;  1P7J A;  2DA7 A;  5HOD A;  3OYC A;  3LMM A;  5IP7 J;  4XIC A;  3H5N A;  1KQ0 A;  1D5Y A;  4A6D A;  2HDD A;  1BC8 C;  1MNE A;  3OS1 A;  3VOE A;  3S2H J;  4GCV A;  5E18 F;  4JX4 A;  4M3G A;  4MFD A;  1RC9 A;  3CJR B;  1R1T A;  2EV5 A;  2G7U A;  4V19 K;  5GTH C;  3D5L A;  3BJ6 A;  4KIF A;  2Y30 A;  2WBM A;  4N9I A;  4ENJ A;  3A1Y A;  1V4R A;  4B44 A;  3HOX J;  1YE9 A;  5TGT A;  5ICG A;  3V78 A;  3COA C;  5KK1 A;  3DQV C;  5LHH A;  1V5G A;  2DMQ A;  1MBG A;  2MSY A;  4QSH A;  3RIR A;  3ZOB A;  2PZ9 A;  1YTY A;  1WWX A;  4G7H F;  3V8J A;  3HOW J;  2H6B A;  2UXN A;  2XDV A;  2BY2 A;  3DFG A;  3OOU A;  1MSE C;  2IA2 A;  1LB2 A;  3TW7 A;  2HQR A;  1TW2 A;  2AS5 F;  5FKN A;  1HW5 A;  1WJD A;  3WTU C;  1YW9 A;  2W82 A;  3ZMV A;  2DMN A;  3IWZ A;  2AQE A;  3C2B A;  4BE1 A;  1B59 A;  3BZ6 A;  1Y8Q B;  2TDX A;  3H35 A;  4N4O B;  1IGN A;  3C2H A;  2DJI A;  1F5T A;  3FF5 A;  4QIW N;  1I6H J;  2B63 J;  4G8X A;  2W4S A;  4J00 A;  5EDN A;  3J7A O;  5DV5 A;  1U2W A;  2IAI A;  1O3Q A;  1O57 A;  2PQ8 A;  5CJ9 A;  1X3Z B;  4XN0 A;  4ZDL A;  1IG7 A;  2GXB A;  3I4M J;  1FMW A;  1R4M B;  1SD5 A;  2WUI A;  1QRY A;  1STZ A;  4KT6 A;  4B48 A;  2OER A;  2CH0 A;  3SZP A;  2UXX A;  3QP5 A;  4E70 A;  4BQN A;  1W7P B;  4JK1 X;  3MKY B;  2FX0 A;  2RKH A;  3CCJ I;  2WAF A;  2G3B A;  2JSC A;  2R93 J;  4ZH4 F;  3MZ8 A;  1XGM A;  2EIK H;  2CGP A;  2CJJ A;  1HKQ A;  5GP9 A;  5D8L B;  3LSK A;  2QTQ A;  2RQP A;  4GFB A;  3RTR A;  2QQ8 A;  1Z91 A;  3Q0V A;  3BJB A;  3G6E I;  2QKM B;  5DCM A;  3OYN A;  2A05 A;  2P8T A;  3FBN B;  5L3B A;  4PGH A;  2K7L A;  3N4M A;  1HW1 A;  3S93 A;  2E35 A;  3WG7 H;  1ZH5 A;  1ZG3 A;  3Q9S A;  2F4M B;  3B6C A;  3VDX A;  1T56 A;  3MD2 A;  3LSH A;  2BEO A;  3K2A A;  2E1N A;  4A3M J;  3CCU I;  2CO5 A;  4B09 A;  2HGC A;  3DEW A;  2K86 A;  3HKZ A;  1S7A A;  4XMY A;  3TBI A;  2Y31 A;  4RGU A;  4JOM A;  3ZR8 X;  1XTA A;  1JE8 A;  1WI3 A;  3HRM A;  1UJ8 A;  3OYF A;  3OYA A;  2NVT J;  3RKW A;  3RKQ A;  4XLE A;  1FJL A;  1UB9 A;  3VW1 A;  3JRH A;  2BE5 F;  1EH8 A;  3HPH A;  3OOP A;  3W2W A;  2CU7 A;  2MG4 A;  1MBE A;  3G3Z A;  4BBR J;  4BL0 B;  2ZME C;  2P4W A;  4BEH B;  5HDN A;  2OCC H;  1U9O A;  4D0P A;  3HBL A;  2YVH A;  2WTE A;  1D0Y A;  1S8N A;  1Y6I A;  2K85 A;  2BXZ A;  1NK2 P;  2Q8K A;  2PX9 A;  2QWW A;  1ZN2 A;  5JHF A;  2M7A A;  1WFX A;  5HS9 A;  2Z16 A;  3CMA I;  4KUM A;  2HYG D;  1W1W E;  2VKE A;  2WGB A;  3ON4 A;  2COM A;  1HLV A;  5FGL A;  3BZC A;  3GWZ A;  2Y75 A;  2L4A A;  2L5Q A;  4YRV A;  4WF2 A;  2I10 A;  4X1E A;  1UAA A;  2XAQ A;  2Z5U A;  4XLN F;  1GHC A;  3LSP A;  2R3S A;  4OMZ A;  3D0S A;  2R7D A;  1UG0 A;  1WQ2 A;  3TDU C;  2HKO A;  2MH9 A;  3QU3 A;  1YHQ I;  2ELH A;  4ME9 A;  2V4J C;  2WV0 A;  2EPF A;  2V1X A;  4FX4 A;  5ICE A;  1QZE A;  1GXP A;  1FLI A;  5B1A H;  1EJ9 A;  1G8X A;  1MBH A;  1DDN A;  2WA0 A;  2A6T A;  5E1Z B;  3J7A Y;  3KZ9 A;  2BV6 A;  3JTH A;  2ZC2 A;  3DPT A;  3I53 A;  1BIB A;  4M6Y A;  3BR6 A;  3ABL H;  2CW8 A;  2A61 A;  2XAG A;  3LL7 A;  3LST A;  5HLG A;  4EGZ A;  2RNG A;  4U9L A;  4QTR A;  2MYS A;  2KL4 A;  1E3O C;  5CVJ A;  1Z9C A;  2DOD A;  2QBY B;  3J80 K;  1GT0 C;  2FNP A;  3VYS B;  1PYV A;  3HOV J;  2FNA A;  1GLN A;  2ID6 A;  2W25 A;  1K79 A;  3QYE A;  3ERM A;  3VOK A;  1OYW A;  2G9W A;  2P5V A;  3UNG C;  3V8L A;  3L9F A;  2Y0S A;  4WXD A;  1FBQ A;  4IRG A;  1K83 J;  3S1N J;  3O3K A;  3I56 I;  1A6I A;  3L7W A;  2W48 A;  3FWE A;  5CXI A;  1Y8R B;  4I2O A;  2P5K A;  3CMY A;  2NOG A;  4JL3 A;  4TV7 A;  2W57 A;  2HTS A;  2K4J A;  4XSZ F;  3LSR A;  1XMK A;  2EA2 A;  1XC5 A;  4BGD A;  3GZ6 A;  2D1H A;  1FOX A;  2PJP A;  1ITY A;  2G0E A;  5EGO B;  4GCT A;  9ANT A;  2CQX A;  2X48 A;  3I3L A;  1G3W A;  4XRF A;  1ZEL A;  3FXO A;  2L9N A;  1MGT A;  1LDJ A;  2GXG A;  1MJ9 A;  1VQN I;  2MAB A;  4G7O F;  4AIK A;  3SYT A;  4ESF A;  2XGD A;  3WTV C;  3VUQ A;  3TO6 A;  2F5C A;  3E5U A;  5D4S A;  3L2U A;  2PBX A;  1SVM A;  1B4A A;  3KX2 A;  4RMN A;  3L00 A;  4EJW A;  1D1B A;  2ECB A;  2DDB A;  3LHQ A;  3P9K A;  4LG3 A;  1IXR C;  4CDG A;  2CSO A;  3OS2 A;  2VBZ A;  4ABZ A;  1ZRD A;  5DYM A;  5LHI A;  3EUA A;  4F93 B;  4L9V A;  4DIQ A;  5J4V A;  1W7P A;  4QPQ A;  2OJE D;  2QQB A;  3OR1 C; 
#chains in the Genus database with same CATH homology
 5F27 A;  2GEN A;  4Y7N J;  1BW6 A;  2EZI A;  4XRS A;  2FD5 A;  2M9H A;  2WV1 A;  3NRG A;  2Y9Y A;  4FTH A;  1RR7 A;  1MBJ A;  4XID A;  4FCY A;  4CGR A;  2R5Y B;  1FIP A;  2XGE A;  2DG8 A;  3V6G A;  4A3F J;  2REK A;  3P9T A;  2O8K A;  2LD5 A;  4HKU A;  3CDL A;  4A3C J;  4L5E A;  3BTI A;  4C3I J;  2EZK A;  4A69 C;  1ZQ3 P;  3SFI A;  1JUS A;  4BY7 J;  3SJM A;  4G12 A;  1RKW A;  1XG1 A;  2IU5 A;  4I76 A;  4XRM A;  1JJ6 C;  1BW5 A;  1GUU A;  1POG A;  2M34 A;  4D5F A;  1YRN B;  3S14 J;  2RHA A;  3RD3 A;  4M6V A;  1IV6 A;  2ELK A;  2GBY A;  5J3L A;  3Q0W A;  3S5R A;  1ETY A;  1MNM C;  1HF0 A;  3VW2 A;  4I6Z A;  1H88 C;  4UUS B;  4A3L J;  1Z0X A;  5D1R A;  3HTI A;  4W1U A;  4Y52 J;  2R5Z A;  2E2J J;  1FTT A;  3JR9 A;  1WGX A;  3BTL A;  3MKL A;  2VI6 A;  1P7I A;  3T6N A;  2Y2Z A;  3RH2 A;  1MBK A;  1IDY A;  2DJN A;  3BQZ A;  1S7E A;  3A01 B;  2HOS A;  4MO7 A;  3M4O J;  5CXG A;  5FKO A;  1VI0 A;  3IV5 A;  2QKO A;  3E7L A;  3G1M A;  4B3A A;  5FLV A;  2LFB A;  1QVU A;  4AYB N;  4AF5 A;  5K7F A;  5D18 A;  2JWT A;  1W0U A;  5FKK A;  1HDD C;  2DA6 A;  1UI6 A;  2AHQ A;  4M3E A;  3LOC A;  2DA1 A;  3A02 A;  5M5W J;  3VVX A;  5E3N A;  4J19 A;  2DA5 A;  2EH3 A;  2KDZ A;  2COB A;  1NTC A;  2JN6 A;  1BJZ A;  1TWC J;  1WCM J;  1TWG J;  2L7F P;  4A3I J;  2XRL A;  3ON2 A;  3JRE A;  1Q1V A;  2HYJ A;  1JJ8 C;  5E3L A;  3NXC A;  4A3K J;  1W0T A;  3BRU A;  1I3Q J;  1OCP A;  1ETK A;  4JYK A;  4GFK A;  2DTZ A;  5GPA A;  2HKU A;  1IC8 A;  4KWA A;  5J1R A;  4B1R A;  1O4X A;  1SAN A;  1Y1W J;  3EUP A;  4D5C A;  2JA7 J;  2ME6 A;  2LKX A;  2FQ4 A;  3IH3 A;  3ZQG A;  5F08 A;  5IYC J;  5EZG A;  1ORK A;  4X6A J;  4DW6 A;  4EEF G;  2UXP A;  3ZQI A;  2O9L A;  1TWA J;  4W97 A;  1APL C;  3GTK J;  3BTJ A;  3RQI A;  2ZOY A;  3COL A;  1SGM A;  2XPW A;  1CQT A;  2MGQ A;  2D5V A;  5F04 A;  3HOY J;  3VVZ A;  2UXI A;  3HIM A;  3B6A A;  3CQZ J;  3L1P A;  1JKQ C;  2VUM J;  4FE7 A;  3M3Y J;  1AHD P;  3MVP A;  2YU9 J;  2HXI A;  1JT6 A;  2NS7 A;  3TP3 A;  2EZH A;  2XB0 X;  3BR1 A;  2O7O A;  3IUV A;  3SDG A;  3CCY A;  3NNR A;  3QQA A;  3O8G A;  4MLO A;  5E3M A;  4LOC A;  4IHY A;  3G56 A;  3HOZ J;  3S16 J;  3ZQL A;  3KKC A;  3HGG A;  1OFC X;  5M5Y J;  3NAR A;  2LLK A;  3GTP J;  1ZGW A;  2K9S A;  1F36 A;  3LNQ A;  3VIB A;  3DCF A;  5IP9 J;  1JTX A;  4A93 J;  5M3F J;  2L9R A;  3BTC A;  3G7R A;  4BBS J;  1B72 B;  4RDU A;  1VFC A;  2L7M P;  3QPL A;  1H89 C;  2M8G X;  3PPB A;  1X2M A;  3O60 A;  3WHC A;  1TWF J;  3PM1 A;  2OPT A;  3S15 J;  4RBO A;  2K9N A;  2FJ1 A;  4C3J J;  5EEA A;  4IEJ A;  4V2G A;  2HI3 A;  1U78 A;  3MNL A;  2X6O A;  3LSG A;  4UDS A;  4GCK A;  3ZQF A;  3OSF A;  2HYT A;  5K58 A;  1RKT A;  3BG5 A;  4D7N A;  3HE0 A;  5EG0 A;  5EGO A;  1ZKG A;  5FLM J;  1F43 A;  1XS9 A;  2LP0 A;  1G2H A;  1VF9 A;  3HKZ N;  4JX6 A;  3K7A J;  1GVD A;  2QCO A;  5EF6 A;  2N8G A;  3BG3 A;  3UKG A;  1JGG A;  3FKI J;  3FIS A;  3HGY A;  3TED A;  5EFY A;  2VKV A;  4IHX A;  2XGC A;  5FKM A;  2JA8 J;  4JKZ A;  5M3M J;  3BR5 A;  1AKH B;  3W6V A;  4L62 A;  3VW0 A;  1LFB A;  1ENH A;  4A3E J;  3HTA A;  3ZQC A;  2H1K A;  1B8I A;  1JKR C;  2WB1 N;  3VOX A;  4M3F A;  4C3H J;  1R9T J;  1JT0 A;  2OF7 A;  5FMP A;  1HOM A;  3IH4 A;  2DMU A;  5IYB J;  1P7J A;  2DA7 A;  4IHW A;  3VP5 A;  1WPK A;  5HOD A;  3HEF A;  5IP7 J;  4XIC A;  3OIO A;  3NAU A;  2MW8 A;  3GTO J;  1GDT A;  3QBM A;  2NP3 A;  3GZI A;  2GM4 A;  2G7S A;  2NP5 A;  3C07 A;  3OSG A;  5IPA A;  2ID3 A;  1D5Y A;  4MIM A;  5HBU A;  2HDD A;  5HSZ A;  2NVY J;  2R92 J;  2R5Y A;  2CQQ A;  2K9Q A;  1DU6 A;  4JNN A;  3FK6 A;  1ZTR A;  3S2H J;  2M0C A;  3BR2 A;  4JX4 A;  4M3G A;  3O8H A;  4MFD A;  5GPC A;  3JSJ A;  4PXI A;  1ETQ A;  1LE8 B;  1GV2 A;  3JRA A;  2EBI A;  3GTG J;  4NDL A;  2Y30 A;  3GBG A;  3H3V K;  1AU7 A;  5EZH A;  2HQ5 A;  2DA4 A;  2WAQ N;  1YRN A;  5H9T A;  3HOU J;  1ETW A;  3HOX J;  2L0K A;  3V78 A;  5C4X J;  3G1L A;  3IH2 A;  4JX5 A;  1BL0 A;  2DA2 A;  2K40 A;  3PO2 J;  2DMQ A;  1MBG A;  2MSY A;  4QSH A;  3GTL J;  3RZO J;  3ZOB A;  4UUS A;  2PZ9 A;  1FEX A;  5HAW A;  3HOW J;  3S1M J;  1T33 A;  3OOU A;  1MSE C;  4S0H B;  4A3D J;  1DU0 A;  2QWT A;  3TW7 A;  2GLO A;  3BR0 A;  2M2E A;  5FKN A;  3G1O A;  2DMN A;  3C2B A;  1PUF B;  3AQS A;  3JRG A;  3A01 A;  1ZR4 A;  2QIB A;  4MK6 A;  1IGN A;  3PAS A;  2JMW A;  4QIW N;  1I6H J;  3GTQ J;  2B63 J;  1ZK8 A;  2D6Y A;  5FJ8 J;  4ACI A;  1RET A;  1FTZ A;  3JRF A;  4M3D A;  1QPI A;  2TCT A;  5IOZ A;  5EDN A;  3BT9 A;  3FRQ A;  1HDP A;  2O7T A;  3AQT A;  3S17 J;  2IAI A;  5C4J J;  2G7G A;  2R7Z J;  1SFO J;  1IG7 A;  3I4M J;  2WUI A;  1QRY A;  5BNG A;  2OER A;  5CW8 A;  2DMT A;  2L7Z A;  2ZCM A;  1JTY A;  2ZOZ A;  1JKO C;  3CWR A;  2Y0S N;  4CYC B;  3LJL A;  5IOY A;  2FX0 A;  5F1J A;  2G3B A;  2LR8 A;  3Q0U A;  2R93 J;  5EYR A;  3TW6 A;  5IYD J;  2CJJ A;  5GP9 A;  1IDZ A;  2DA3 A;  5K7H A;  2QTQ A;  2OI8 A;  5JLX A;  4GFB A;  2E2I J;  4IHV A;  3Q0V A;  1MSF C;  1X2N A;  3BJB A;  3JRC A;  3JRI A;  2GUH A;  4NEL A;  1GV5 A;  2PMZ N;  3FIW A;  1IUF A;  2RAE A;  3ANP A;  3F0C A;  5K7Z A;  3E7Q A;  1X58 A;  4MFE A;  2DN0 A;  3B6C A;  3BQY A;  1T56 A;  2EQR A;  2NVQ J;  3K2A A;  4A3M J;  2XPU A;  1U9N A;  1LFU P;  5M5X J;  1IRZ A;  3DEW A;  3D1N I;  2R0Q C;  2GFN A;  2ZCN A;  1WH7 A;  2VPR A;  1NK3 P;  2Y31 A;  3PO3 J;  2YUS A;  3QPS A;  2NS8 A;  3S1Q J;  2R5Z B;  2HOA A;  3BCG A;  1K61 A;  1WI3 A;  1ETV A;  2NVT J;  5J1U A;  1UI5 A;  3RKQ A;  1OJL A;  1FJL A;  2KT0 A;  4BY1 J;  3S2D J;  2RAS A;  5C4Y A;  1UHS A;  2NX4 A;  1Y1V J;  1JUM A;  3JRH A;  3VW1 A;  2JK3 A;  2FBQ A;  2CU7 A;  2MG4 A;  1MBE A;  4BBR J;  1BA5 A;  2IBD A;  4A3B J;  2ZCX A;  1U9O A;  3NI7 A;  2UXO A;  3HBL A;  2W53 A;  2YVH A;  3GTJ J;  4FE4 A;  1B72 A;  4AUX A;  4YZE A;  5F0H A;  2P81 A;  1NK2 P;  2CUE A;  5AQC A;  1Z77 A;  1ZR2 A;  2DMP A;  1UG2 A;  1ETO A;  2EZL A;  4B4C A;  1EF4 A;  4MXM A;  4BKX A;  2VKE A;  2WGB A;  3LWJ A;  1JUP A;  3ON4 A;  1HLV A;  4AC6 A;  2Q24 A;  5FGL A;  1ETX A;  1MBF A;  4A3G J;  3HM5 A;  1VND A;  2I10 A;  4X1E A;  4XRS G;  3TP0 A;  3LSP A;  4DZJ A;  4FIS A;  3BHQ A;  3Q3S A;  4C2M J;  4XK4 A;  1AKH A;  2XB5 A;  3H0G J;  4ME9 A;  1MH4 A;  3BR3 A;  2JJ7 A;  3F1B A;  2CRG A;  5IP6 A;  5FHP A;  2H8R A;  4ICH A;  1MBH A;  2X9D A;  1OCT C;  5DAJ A;  1JKP C;  3KZ9 A;  1IJW C;  4NN1 A;  2HOT A;  2F07 A;  2XDN A;  4GCL A;  2LY9 A;  2Y9Z A;  3BR6 A;  3GTM J;  2E19 A;  4DYR A;  5C44 J;  2NVX J;  2E1O A;  2ZB9 A;  5C3E J;  3S1R J;  4QTR A;  3KKD A;  3KNW A;  5F0F A;  2CUF A;  1E3O C;  3HTH A;  2ECC A;  4BXX J;  2V57 A;  3ANG A;  1GT0 C;  1TC3 C;  2HXO A;  1RES A;  1LE8 A;  2JA5 J;  1U8B A;  4V2F A;  3HOV J;  3LSJ A;  3WHB A;  2ID6 A;  3A03 A;  5F0C A;  1UMQ A;  3VOK A;  2XPV A;  4DZP A;  1MH3 A;  5DS9 A;  1HCR A;  2ME0 A;  5DTD A;  2E2H J;  5J1Y A;  1K83 J;  3S1N J;  2XSD C;  2UXH A;  1A6I A;  3QKX A;  2W48 A;  2UXU A;  5CXI A;  3CMY A;  2NOG A;  4JL3 A;  3MN2 A;  1WH5 A;  3GEU A;  3LSR A;  4M3B A;  4UUT A;  5E3O A;  2QF7 A;  1XC5 A;  2YVE A;  3CJD A;  2LTP A;  4GFL A;  2LK2 A;  1PUF A;  3HB9 A;  1H8A C;  1ITY A;  2G0E A;  5EG0 B;  3VPR A;  5EGO B;  9ANT A;  3B81 A;  4GCT A;  2CQX A;  2X48 A;  3BG9 A;  5JLW A;  3DPJ A;  4JP0 A;  3EGQ A;  3NPI A;  3JRB A;  3HTJ A;  2XGD A;  4DYQ A;  4HNV A;  5D19 A;  4A3J J;  3VUQ A;  2PBX A;  3FK7 A;  2TRT A;  3RZD J;  3ZQH A;  2JA6 J;  2DG7 A;  2YS9 A;  2IEK A;  2LVS A;  1FIA A;  3BNI A;  2ECB A;  4D7M A;  3LHQ A;  1I50 J;  2QOP A;  1RPW A;  3VVY A;  3JRD A;  5FKL A;  1B8I B;  1A5J A;  1QVT A;  2G7L A;  3HDD A;  4ABZ A;  1TWH J;  3I4N J;  4CYC A;  3CRJ A;  4DYC A;  4AC0 A;  2AO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...