2G0EA

Structure of qacr multidrug transcriptional regulator bound to trivalent and bivalent diamidine drugs
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
rcsb
source organism Staphylococcus haemolyticus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2g0eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2g0eA02
4AC6A 5K7ZA 3I4NJ 3FISA 2R5ZA 3HEFA 4GFKA 4YZEA 1TWCJ 1JUSA 3VVYA 3BTLA 3LWJA 4M3DA 1Z0XA 4NN1A 4M6VA 2HYTA 1UG2A 2R93J 4M3EA 5E3NA 2NP5A 2HOAA 2YU9J 2M0CA 1WH7A 2M8GX 2X6OA 4FE7A 2VPRA 3JRBA 1MBEA 3BQYA 4EEFG 2G7LA 3O60A 3VW2A 4DZPA 2DA2A 4FTHA 1NTCA 1IUFA 4CYCB 2Q24A 1LFUP 3L1PA 1AU7A 4IHVA 5CXIA 2DA7A 2L0KA 1TC3C 1EF4A 2WUIA 3JRCA 1ETYA 1U9OA 1Y1VJ 2LY9A 3VUQA 2GENA 1BW6A 3LOCA 2MSYA 1ENHA 1YRNA 2FJ1A 4UUSA 4DZJA 2JN6A 2O8KA 3BTIA 5IOZA 4W1UA 5J1YA 1MSEC 1MH3A 5FLVA 2DG8A 2OF7A 4JX4A 2DMUA 2NS7A 1XS9A 5D1RA 3S17J 1ZQ3P 4M3GA 4MIMA 4JYKA 5HAWA 3T6NA 1D5YA 3AQSA 5F0HA 3VW0A 1U8BA 1Z77A 2NVTJ 1GDTA 1RKTA 1H89C 1YRNB 4C3JJ 2RASA 1K83J 2R5ZB 4ICHA 4X1EA 2V57A 5E3MA 3VOXA 2NVXJ 2QIBA 3NNRA 3FIWA 4A3JJ 1HLVA 4RDUA 4QTRA 1A5JA 5IYCJ 2EQRA 1JTXA 2DJNA 3VPRA 3TP0A 2H1KA 2TRTA 4JP0A 3DEWA 4DW6A 1GVDA 2GFNA 3HE0A 4GFBA 3LSRA 1ETWA 9ANTA 2CJJA 2K40A 2UXIA 3IH3A 2LKXA 5CW8A 3QKXA 2HXOA 1HDDC 3ANGA 3QBMA 3JREA 2JWTA 2DMQA 3S2HJ 2L7ZA 4L5EA 3BR6A 2JA5J 4XK4A 1TWFJ 3IV5A 3ON4A 5IOYA 2GM4A 3H3VK 2LFBA 4MO7A 2HOTA 3COLA 4S0HB 5FLMJ 1BA5A 1GV2A 3BG5A 1IDYA 3BTJA 5HODA 1AKHA 2R7ZJ 3RQIA 4IEJA 3KZ9A 3VVXA 3FRQA 1H88C 2P81A 2VUMJ 4ME9A 4UDSA 3RH2A 1W0UA 2NX4A 5M5XJ 3OOUA 1UHSA 5IYBJ 4MFEA 2FBQA 4GFLA 3B6AA 4CYCA 2I10A 3S14J 2LVSA 2IBDA 2VKEA 2OI8A 1POGA 2K9NA 2R0QC 5K58A 4W97A 2DMPA 1HCRA 2UXPA 3OSFA 4BY1J 5FKOA 2R5YA 4L62A 1VNDA 4NDLA 2NP3A 3G1OA 4A3FJ 5C4XJ 4A3EJ 5FHPA 2QWTA 1O4XA 1B8IB 3GBGA 1AHDP 3PO2J 3A02A 2GUHA 1GV5A 4V2GA 1I50J 1JT0A 1BW5A 1Y1WJ 3VOKA 2FQ4A 5GPAA 1ETVA 4A3DJ 5F1JA 1TWAJ 2XB0X 3MKLA 2ZB9A 2DMTA 1T33A 5IYDJ 1TWHJ 2W53A 2ECBA 5FKKA 1WGXA 4UUSB 1IGNA 2UXUA 2G0EA 1WPKA 4AF5A 3NAUA 4DYQA 1K61A 1BL0A 1XG1A 5DAJA 4A3KJ 3PPBA 2REKA 4ACIA 1U78A 4UUTA 3RZDJ 3VW1A 5C3EJ 1JTYA 2X9DA 3HGYA 4B1RA 2NVQJ 4QIWN 3CJDA 3CWRA 5D18A 5IPAA 5D19A 1LE8A 1JGGA 3O8GA 4MLOA 1HF0A 2JJ7A 3HM5A 2HYJA 5K7FA 4JL3A 5EZGA 1I3QJ 3GTPJ 3HGGA 3SDGA 4MXMA 3ZQLA 1A6IA 1LE8B 3P9TA 1QVTA 1ORKA 3HKZN 2GLOA 4D7NA 2YS9A 4Y52J 5BNGA 1QPIA 5EF6A 3BR3A 4IHWA 3S2DJ 1HOMA 3O8HA 1GUUA 2ZOZA 5EFYA 3E7LA 5IP9J 2XGDA 3PM1A 5HSZA 4A3LJ 2IAIA 5DS9A 1Q1VA 1CQTA 4M3FA 4G12A 3HTAA 3HOZJ 2M9HA 2D6YA 1MBFA 2N8GA 3F0CA 3W6VA 3S1MJ 3AQTA 5F08A 2HKUA 3KKCA 1FIAA 2EH3A 4XRSG 4J19A 3F1BA 2CRGA 3BTCA 2WB1N 1ZR4A 2XPWA 2TCTA 2W48A 3H0GJ 4FISA 1IV6A 2JA8J 3HB9A 4X6AJ 2CUEA 4AUXA 1UI6A 3Q0UA 3E7QA 3LSPA 2MW8A 4BY7J 4C3IJ 2G3BA 1JJ6C 1F43A 3HBLA 5AQCA 4GCLA 3DCFA 2XRLA 4M3BA 2PZ9A 4A3MJ 3GTOJ 1JUMA 1IDZA 3HOXJ 2UXOA 3Q0WA 3SFIA 2VKVA 3BNIA 3ON2A 4GCTA 2JMWA 1ETOA 3TW7A 1TWGJ 5EG0B 2LR8A 2CUFA 1B72A 3S1NJ 2DN0A 1JKQC 2HDDA 3LSGA 5FKNA 5EGOB 5EGOA 2XB5A 1VFCA 1RESA 1LFBA 3BHQA 4AC0A 1NK3P 3GTGJ 5EG0A 1B72B 3IUVA 3V78A 3TEDA 4C3HJ 2E2JJ 5H9TA 1ETXA 3A03A 2DA1A 2XDNA 1R9TJ 2EZLA 5FKMA 5IP6A 2IEKA 1P7IA 3LSJA 4MFDA 5M3MJ 2Y9ZA 1I6HJ 4CGRA 4IHXA 1NK2P 1WI3A 2IU5A 3NARA 1RPWA 3FK6A 5J1UA 4KWAA 4B4CA 3CDLA 1ZKGA 2Y2ZA 1JKOC 2O7OA 1VF9A 3JRGA 2LLKA 2ID6A 3GTMJ 5JLXA 3C07A 5GPCA 4RBOA 2FD5A 3ZQIA 3BR0A 3ANPA 4DYCA 1VI0A 5F27A 3K7AJ 2WAQN 3S1QJ 2QOPA 3ZQCA 5M5WJ 1SGMA 4PXIA 1ITYA 3BRUA 3MNLA 3VP5A 1FJLA 3S5RA 3MN2A 5F0FA 3TP3A 5EEAA 2KDZA 3ZQHA 2ZCMA 1MBKA 2GBYA 2XGCA 4JX6A 3S15J 3SJMA 2M2EA 1HDPA 3MVPA 1B8IA 1ZK8A 2ECCA 2X48A 3FK7A 4JNNA 3CQZJ 2JA7J 2M34A 3OIOA 1H8AC 3HOVJ 1UI5A 5HBUA 5FMPA 3FKIJ 3WHCA 3TW6A 4MK6A 5EDNA 3OSGA 2LD5A 1X58A 1RKWA 3IH2A 4I6ZA 3GTLJ 3HTJA 3HOWJ 4GCKA 1ETKA 2XGEA 5EZHA 5M5YJ 2H8RA 5E3LA 5FKLA 5E3OA 2WV1A 3G1MA 2YUSA 3RKQA 4JX5A 5IP7J 2YVHA 5FGLA 2DG7A 4BKXA 3HDDA 4BBRJ 3M4OJ 2EZIA 5K7HA 2Y0SN 2QKOA 2XPVA 3BG3A 4D7MA 5DTDA 2NVYJ 5J1RA 2LP0A 5F04A 2HXIA 2DMNA 3ZQGA 3Q3SA 3GTQJ 3V6GA 2E19A 2JA6J 2ME6A 3QPSA 3JR9A 2UXHA 2L9RA 1GT0C 4A69C 1P7JA 4JKZA 2RAEA 1QVUA 3QQAA 2OERA 3HTIA 5CXGA 2XSDC 3BCGA 2G7SA 2ZCNA 4XRSA 3BJBA 3PASA 1UMQA 1DU6A 2YVEA 2LK2A 1AKHB 3G56A 3NRGA 4Y7NJ 2KT0A 1APLC 2ID3A 2HQ5A 4LOCA 2PBXA 3HIMA 1OFCX 1X2NA 2MG4A 1MH4A 1IG7A 3HOYJ 1ZR2A 5C4JJ 1XC5A 2Y30A 1JKRC 3KNWA 3NXCA 3A01A 4AYBN 3S16J 1FTZA 5GP9A 2COBA 1F36A 1MBGA 3BT9A 2L7MP 2ELKA 3UKGA 3HTHA 3K2AA 3S1RJ 3GTKJ 3JSJA 3C2BA 5C44J 5JLWA 4A3IJ 3LJLA 2FX0A 2R92J 2AHQA 1ZTRA 3GTJJ 1MNMC 3DPJA 5F0CA 4IHYA 3RZOJ 2DA3A 2EBIA 2K9QA 3CCYA 3CMYA 2QCOA 1PUFB 1IC8A 1MBJA 1MSFC 4XRMA 3B81A 4BXXJ 1E3OC 2ZOYA 3GEUA 4C2MJ 3IH4A 1U9NA 2WGBA 3BR1A 2NOGA 1WH5A 2XPUA 2R5YB 2CQQA 3CRJA 3D1NI 3PO3J 3EUPA 2PMZN 3JRIA 3VVZA 4D5FA 1OJLA 1WCMJ 2LTPA 4FE4A 1IRZA 2EZHA 2D5VA 2CQXA 3JRAA 1FTTA 2OPTA 4A3CJ 4BBSJ 2RHAA 2DA5A 1X2MA 3WHBA 4A3GJ 2Y31A 3B6CA 4QSHA 3RD3A 2K9SA 3LHQA 1S7EA 3GZIA 5M3FJ 2O9LA 4HNVA 3JRDA 4DYRA 4XIDA 2E2HJ 3NI7A 3BR5A 5J3LA 1SFOJ 2E1OA 4FCYA 1ZGWA 1OCTC 3NPIA 3G7RA 2HOSA 2B63J 1BJZA 1IJWC 3BQZA 2HI3A 1JUPA 2EZKA 5C4YA 1G2HA 1MBHA 2VI6A 5EYRA 3ZQFA 2G7GA 4A3BJ 4ABZA 3Q0VA 1QRYA 3EGQA 1ETQA 3JRHA 1FEXA 2QTQA 4A93J 4D5CA 4NELA 1RR7A 1RETA 2JK3A 2ZCXA 2Y9YA 2F07A 3BR2A 1JT6A 1PUFA 2NS8A 3M3YJ 4HKUA 2AO9A 3QPLA 1FIPA 2L7FP 5FJ8J 2ME0A 1JJ8C 3JRFA 4XICA 2CU7A 3ZOBA 3BG9A 4B3AA 2DA6A 4I76A 3HOUJ 1JKPC 1DU0A 2QF7A 2DTZA 1OCPA 3I4MJ 2O7TA 3KKDA 2MGQA 3VIBA 3LNQA 1SANA 2DA4A 1T56A 3G1LA 3A01B 1W0TA 2E2IJ 4V2FA
chains in the Genus database with same CATH superfamily
2E5NA 2B7EA 2XGXA 4HQMA 4AC6A 1UZCA 1D0YA 2IVMA 4GGGA 4B09A 2B1EA 4XLEA 2AXTC 4YZEA 3DBRB 1N75A 4HG2A 5B66C 3VVYA 1LVKA 3BTLA 3LWJA 2ZXHA 3FM3A 2R7UA 5JR3A 4M3EA 1SVLA 4HNTA 4C2MA 4R1HA 1WH7A 5LGTA 2X6OA 1KQ0A 2IA1A 2JSCA 1LDDA 2XAFA 3DLAA 4KICA 2G7LA 2YU3A 1IN6A 3O60A 1NTCA 2PN6A 4XM3A 3Q9SA 2Q24A 3GLXA 5CXIA 3LSTA 4BQAA 2DA7A 1MJ9A 3KP3A 3JRCA 1XPXA 4ZTFA 3VUQA 2GENA 1GHCA 1BW6A 3TO9A 3F8CA 1G3SA 2DI3A 2FNAA 3RIRA 4DZJA 4CUGA 4RM2A 4AM3A 3K4BA 5E79C 5IOZA 2DG8A 2A6HF 2VODA 4B44A 2NS7A 3C1DA 2DT7B 4AVZA 1XS9A 3WTWC 3DPUA 3S17J 1ZQ3P 2LG4A 1E0EA 3H5AA 1D5YA 4IHTA 5F0HA 3WGGA 2RGVA 1SAUA 2KJCA 1OQYA 1TW2A 1ON2A 3ERED 1U8BA 3VW0A 2B0LA 4F93B 3QPHA 4AD9A 5D4RA 2KQRA 4ICHA 2RASA 4ETSA 4O5VA 4X1EA 2NVXJ 3W6JB 4ZTJA 2ZY9A 2OTLI 2STWA 3HC7A 4OAYA 3FIWA 4DQ2A 1HLVA 4RDUA 5E8GA 1A5JA 5EEHA 1IV8A 3LSKA 1JTXA 2FNPA 4MNUA 3CO7C 1RR8C 1VQ7I 2H1KA 1S3JA 4GFBA 3ML6A 3M8FA 1ETWA 3FXKA 5LEJA 2CJJA 2UXIA 2CV2A 2XAJA 3OIQA 3QKXA 2HXOA 1DP3A 3S3OA 1A04A 4YIIA 3ANGA 3JREA 2JWTA 1Y39A 4L5EA 2ZFUA 3BR6A 2JA5J 4XK4A 4XOPA 1BM9A 1WJDA 1ZAOA 5IOYA 2EINH 3T5XA 1Z21A 2GM4A 2LFBA 2V1DA 4N9HA 5GADJ 2WAFA 2ESHA 5FLMJ 1PUEE 4HRIA 1BA5A 1RIOH 3ZMSA 5LHGA 3H5NA 4E7SA 2H6BA 1GLNA 2WC2A 3FRQA 5J8FA 3FKJA 3K69A 2VUMJ 3SEQA 4BAYA 4HA8A 1A36A 1UHSA 4MFEA 2EB7A 3BROA 4GFLA 1ZYRF 4EVIA 3B73A 4IRVA 5L3GA 4G6QA 1K6OA 1I6XA 3QP5A 5LHHA 2OI8A 3OL3A 2BHZA 4BH9A 4BXUA 1IXCA 3BLYA 5E1ZB 3F22A 2WA0A 5AIPA 2R5YA 4ON0A 1V4RA 4L62A 1VNDA 2NP3A 4A3FJ 2XAUA 2P7CB 4A3EJ 2V6EA 3K10A 5FHPA 5J40A 2QWTA 1B8IB 3PO2J 5B1BH 1MMAA 4BS9A 5HOOA 4EGZA 1IRFA 2CQ7A 2GUHA 2IGNA 2PBIA 4LMYA 1U5TB 2VOPA 4V2GA 1I50J 1SVOA 2ZMEC 1BW5A 2EFQA 4PJNA 1Y1WJ 2FQ4A 4H4KC 4BJTA 1R49A 2EWNA 4A3DJ 5F1JA 4CXFA 2HVSA 5IYDJ 1R5ID 2V1XA 2ECBA 2KPMA 2Q2EB 4UUSB 2UXUA 2X51A 1T08B 3P7NA 4A5MA 1FZPB 1BL0A 5DAJA 2J5OA 4A3KJ 3PPBA 3IWFA 3H9GA 3I58A 3K4NA 5J47A 1JTYA 2X9DA 4B1RA 2NVQJ 1H0MA 3CWRA 5D18A 4G8XA 1ZARA 3FXJA 1DGWY 2LOOA 1JGGA 3CUQC 2BY2A 3M9AA 2JJ7A 2NYXA 4L5JA 4XLAA 1T38A 5HNFA 3T8TA 4JL3A 1KU9A 2MLGA 1I3QJ 1X1CA 3EUHA 4PDKA 3SDGA 2HR3A 3T0YA 1LEBA 4MXMA 2MA3A 1WWXA 1ORKA 3J7YJ 2DDAA 2FJI1 3CUOA 3WE2A 4NC6A 4CICA 4IHWA 1S6LA 4O3MA 5LRSA 1EH8A 1I5ZA 4OOIA 3OYCA 2ZJ2A 1CQTA 5DS9A 4EJVA 4G12A 4ZYGA 3GVAA 4G7HF 3HOZJ 3WG7H 3FXQA 1IXRC 4EJTA 2HKUA 1FYMA 2QBYA 4XRSG 2OD5A 3O3KA 4JQFA 1G3YA 2DPDA 2NNYA 4XNFA 2TCTA 2W48A 2DXIA 2M7AA 3HXLA 1IV6A 2BE5F 2A6TA 2HVQA 4HF2A 1UI6A 1F9NA 1YS6A 2Y69H 2QM3A 1X19A 3T8RA 3LAJA 3NS4A 4PCQA 4IF4A 1JJ6C 1IRGA 2IP2A 3HBLA 5AQCA 2VN2A 3KP6A 2XHKA 2P7VB 4RLFA 2JQ7A 3A4CA 3GTOJ 1IDZA 2F5EA 2VKVA 3RYPA 1ETOA 3TW7A 3KYLA 1MZBA 3MZHA 4HSRA 4UHTA 2FBHA 2K86A 5GAEJ 3S1NJ 2DN0A 3K4JA 3J7AY 4M72A 1R23A 5FKNA 5EGOB 4ZC3A 5EGOA 1UFMA 2IGKA 3CJNA 3WGIA 3CCMI 4AC0A 2EILH 2ZCWA 1NK3P 1B72B 3RYRA 3CDHA 3V78A 3RKWA 1ETXA 3A03A 3V7CA 2HDWA 2XDNA 3W6KB 5FKMA 3R60A 3BZKA 2IEKA 2PI0A 2FU4A 3CCJI 1T39A 3LA3A 4UV9A 3I0TA 4IXAA 4IRGA 2Y9ZA 1USTA 3I71A 1NK2P 1WI3A 2Z5UA 3VYSB 3OYKA 2A3SA 1V5GA 1R58A 2CFXA 2NVUB 1N77A 3CDLA 3PSFA 1ZKGA 2MC3A 4CDGA 2LLKA 5JLXA 3C07A 3G3ZA 2L4AA 3ZQIA 3BR0A 1EKEA 3FHZA 3TGNA 4ENMA 5FFXA 3S1QJ 1SFKA 3ZQCA 1HW2A 1ITYA 5CKTA 2DJIA 3U1DA 5F0FA 5EEAA 4E7IA 2ZCMA 4PJJA 1H9GA 1KU2A 3SJMA 4EJUA 2XAHA 2M2EA 4XONA 1B8IA 2ZXWH 5GTHC 2EIJH 2IS4A 3CQZJ 2E34A 2JA7J 3A0HC 2VJIA 1H8AC 2BW3A 1VTNC 2L9NA 5HBUA 3WHCA 3PQKA 1Y0NA 4EV0A 4MK6A 2DFIA 5EDNA 2GOXB 1I39A 1ZLJA 1TZLA 3GFLA 1Z67A 5M5YJ 2H8RA 5HLGA 5E3OA 1QGPA 5JHUA 3I3LA 2YUSA 1L3LA 1VQ4I 1HW5A 2Q1ZB 1E2XA 5FGLA 3M07A 3HDDA 4K2EA 3QYEA 1SFXA 3ZRGA 5K7HA 2Y0SN 1MMDA 2FXAA 2DFFA 2X1CA 2P4WA 3B02A 1D5VA 2VXDA 2ZKZA 3OYLA 1LQ1A 2ISYA 4GYIA 1XSDA 5FD6A 2EFNA 2HZTA 4C2TA 2TDXA 2E19A 5E20A 2CFOA 1XCBA 1LDJA 2UXHA 4BDYA 4II2A 2BZTA 1HQCA 3DU5A 3K70D 2Y0SA 3DBLB 1P7JA 5HS9A 1GT0C 1KYWA 4BYYA 1S29A 2HYFA 1FOXA 2GOMA 1UG0A 1QVUA 4JK1X 3HTIA 4KT6A 4KIFA 5ICFA 3CF5F 4Y4RA 1R4NB 4XRSA 3PASA 1UMQA 3DKXA 2LK2A 2H8WA 2CUJA 4I02A 2HQ5A 5AONA 1R00A 2PBXA 3HIMA 2M0MA 4GRIA 1X2NA 4RB0A 2W57A 3I59B 2W84A 2R7RA 2L9VA 3HHHA 1JKRC 2XIGA 3KNWA 1JHFA 3OYDA 3BT9A 1MBGA 1FOWA 2L7MP 2X0LA 3A1YA 3FF5A 2EA4A 2W24A 5KVRA 2VBZA 4PGHA 1WJEA 1U8RA 3C2BA 3GTKJ 5D4SA 5C44J 2YSRA 2VJ5A 3KLNA 4OIOF 1A31A 2R92J 2AHQA 2JTVA 5HNHA 1VQMI 2FF4A 3BG6A 2QKLB 5CLSA 1PDNC 3RZOJ 2DA3A 2QCOA 5BS6A 4A5NA 1TBXA 2IGOA 5FB2A 4M6XA 4XRMA 1IC8A 1MSFC 2A5YB 4Y33A 2F6CA 3AL0B 4BXXJ 1P6RA 2GIVA 1U9NA 2GA1A 3E3VA 3WTZA 1IN8A 3H5RA 2NOGA 2V79A 2F4IA 2MH9A 1XGMA 3PO3J 2PMZN 4LK1F 1WCMJ 1YE9A 1FMWA 5IT9Z 3V8KA 3H0DA 4KIGA 5TGTA 2FE3A 4DBQA 2BOLA 3HPGA 1Y8QB 3KEYA 4BEHA 3JRAA 1K6YA 1LVAA 4BBSJ 1K7AA 3G6EI 3QU3A 1IN5A 4CZZA 4AYBA 4A3GJ 3B6CA 2MC4A 4HPQA 2V9KA 4CCJA 4PSWA 2ICWG 2DT6A 4KMFA 1BI1A 4XIDA 3BR5A 5J3LA 1SFOJ 2E1OA 1E3PA 5DD4A 3MCZA 1ZH5A 3HSFA 3BZCA 2B63J 3BQZA 2HI3A 2O3FA 3J7AO 2CW7A 3DFGA 4M9XA 2E7WA 4XLPF 2W1OA 2HDCA 1G2HA 5EYRA 4ABZA 3Q0VA 4D0PA 1WQ2A 4GDFA 3I64A 3JRHA 1FBSA 4HZFA 1TTYA 2HWVA 2ZCXA 3ZPLA 2HFHA 1NH3A 4ZDPA 4XKBA 1ODDA 3BR2A 1JT6A 1XDSA 1PUFA 5GTIC 2DYRH 2L7FP 4RAYA 3M8JA 3CC4I 2PMUA 2FUG2 5K5OA 4BXFA 1QHHD 4UVBA 2QF7A 3WODF 1JKPC 2ZSHB 4HOBA 4P96A 4ITVA 1D0ZA 2AXLA 5A2QK 2AQEA 1HSTA 2HOEA 2DA4A 2K9MA 4LG0A 3H35A 3G1LA 3KIOA 2QQ9A 3BG7A 3FXOA 3A01B 1BOAA 1X1DA 4IHSA 2WAQA 2DYSH 4HLYA 3I4NJ 1FC3A 2F5CA 4KN7X 4Z6YA 2R5ZA 3HEFA 2A07F 1R6RA 1TWCJ 3HOTA 1XSVA 2Z2SB 1JUSA 1YJNI 1U5TC 3F21A 4M3DA 1Z0XA 3UR3C 2D1VA 2KRHA 4HLXA 4NBQA 2KP6A 1LDKB 4LLNA 1MBEA 3CP2A 3IRQA 3BQYA 4IZZA 3TO6A 3GX4X 4LJZF 4O6JA 2KDOA 4NC7A 1IAWA 5DD8A 2IJLA 1XCVA 4EQQA 2DU9A 3L1PA 5D5WB 2COMA 2XVCA 3KPHA 1ZGAA 1ETYA 4XSZF 1U9OA 5E17F 3E0JB 3LOCA 4KFCA 4KMUX 2E35A 1ENHA 3DWLE 5FLXK 1TLHB 2OAZA 2JN6A 4Q4ZF 2O8KA 5KK1A 5J1YA 5FLVA 1EV7A 1FOYA 2OF7A 4JX4A 2O5RA 2GZWA 3FXLA 2BW3B 5CVVA 4BNCA 1WI9A 5D1RA 5J6XA 5B3SH 4KISA 4MIMA 5FD5A 3TMOA 4LB5A 3U2RA 1I1GA 3AQSA 2KIQA 2ADUA 3ULQB 4UUVA 1MGTA 3CUQB 2STTA 1I27A 3CCVI 1H89C 4PJMA 4RM3A 2FRHA 2V57A 1CF7A 3NNRA 1LNWA 1AOYA 4A3JJ 4XSXF 5IYCJ 2HKXA 3DEUA 2EQRA 4NNJA 3FBNB 2DJNA 3AG4H 4YG2F 3VPRA 3DLLF 4JP0A 2PEXA 3DEWA 4DW6A 1GVDA 2GFNA 3HYIA 1MNDA 3HE0A 3DTEA 3LSRA 9ANTA 3EYIA 1YQAA 1ZGJA 1VQ6I 3S2HJ 3KLOA 2H94A 2L7ZA 1D1AA 4B3XA 2OA4A 2JRMA 1HKTA 2V9PA 1BBYA 2V1NA 2BY0A 2BXZA 2OC6A 4S0HB 1GV2A 4Q48A 2HS5A 4XN0A 4CSWA 5HODA 4EATA 2R7ZJ 4IEJA 3KZ9A 2NNNA 1XTAA 2JUCA 2W4SA 4YIFA 4XRFA 1W0UA 2NX4A 1ZRDA 4IO9F 3Q9VA 1VQ9I 3ISPA 4E70A 1MIJA 3ASNH 1FNNA 5HS7A 4C30A 5DM6F 3ZP5A 5ED4A 5E8IA 1D1BA 1W7PB 2BY3A 3EYYA 2OQRA 1N25A 2VKEA 3VDXA 1POGA 1XGNA 3K8PC 1DGRM 3A2KA 3I53A 3TDUC 4FHTA 3AAFA 1T8IA 2UXPA 2V6CA 3M1CA 4PZJA 3G1OA 5C4XJ 4WXHA 2HGCA 2VB6A 2K4JA 5E1XA 2VBYA 4B47A 4OIQF 1AHDP 2H09A 3MZYA 3OY9A 1TT0A 3OOPA 4L0ZB 3A02A 1GV5A 4FQGA 2EIKH 1JT0A 4G6TB 3SHFA 2OUMA 3MD2A 1Y8RB 2F5FA 3HRUA 1LB2A 3MKLA 1ZRCA 4BEHB 2DMTA 1T33A 1GVJA 3HRSA 2ELHA 2LF8A 4QWQA 1IGNA 3K4CA 2G0EA 3QOEA 3QYFA 3TOAA 4G94A 3W2VA 4DYQA 3V7RA 4F3QA 3E5XA 3H9JA 1K61A 3DP7A 2REKA 4ACIA 3V8LA 1F5TA 4HF0A 3T1BA 5C3EJ 3PFIA 1DP7P 3E1SA 3HGYA 4EJWA 4QIWN 2Z9OA 5D8LB 5IPAA 2EV6A 4HDVA 1HF0A 3IWZA 3VEPA 2KRCA 4PJLA 3OS2A 2VE8A 3OYFA 1AA7A 3GW2A 3H92A 2D45A 2M3AA 3ZQLA 1LUJB 2ZMEA 2WTEA 5K1YA 1QVTA 3QRFF 4Z2YA 1R1UA 3HKZN 1KZHA 2F5VA 3HTUA 4D7NA 2V9VA 5BNGA 2CGPA 3C2GA 3ZMUA 5KHDA 2B3WA 2ZOZA 3E7LA 1STZA 1J2XA 3GWZA 2R4GA 1J9IA 2XGDA 3PM1A 3PL8A 4CCNA 4EM0B 2IAIA 4FX0A 1Q1VA 4M3FA 2VJ4A 1W36D 2M87A 1LPQA 3GO5A 1MKMA 2XRNA 3F0CA 3F72A 3AQTA 3KFWX 1IO2A 1FX7A 4UB6C 2VPLA 2EH3A 4J19A 3CUQA 3IKTA 3CCEI 3SWHA 4BE2A 4F7ZA 4XOTA 2WB1N 2XUBA 3MQ0A 2JA8J 4X6AJ 3HB9A 4D9JA 1Z91A 5D6FA 5LLQA 2FOWA 2K27A 2QQ8A 3CD6I 1J09A 5B5EC 2G3BA 4WCGA 3BJAA 3IP4B 1V5EA 3GZNB 5DUIA 4M3BA 1V54H 1JUMA 3HRMA 3HOXJ 3F8MA 3Q0WA 3SFIA 2P5KA 4GCTA 4DBRA 3ON2A 4KUMA 4M9ZA 1TWGJ 4BACA 2WY8Q 2O6GE 2L01A 2LR8A 2CUFA 4IOAF 4BU2A 3LSGA 3F8BA 1YIJI 2XB5A 1RESA 1P4XA 1KU3A 2ZBKA 2LRDA 1RZ4A 3K4KA 4E7LA 1VQLI 5H9TA 1ZLKA 3SEZA 2DA1A 3Q5FA 4I01A 4OIPF 4WK8F 1OKRA 4LGWA 5IP6A 1D0XA 3K4LA 2QEXI 3RI4A 4MEXF 4CCLA 2KIFA 2K5CA 1HSJA 1XD7A 3FDYA 3LSJA 4MFDA 4XLNF 5M3MJ 3R0JA 4CGRA 1SD6A 3OYBA 2F4OB 4IKFA 1HC8A 3DBHB 3W2WA 3F23A 1BI0A 2OU2A 2P6TA 3JTHA 2HQAA 2VT3A 3KP7A 1USSA 2VE9A 4RBOA 2O61A 1X1AA 5F27A 3HTSB 2W00A 4PXIA 2OTJI 2A05A 3BRUA 4OD5A 3S5RA 3HZJA 2E60A 4RLQA 2E5ZA 5LGUA 3LQQA 2VQCA 4JX6A 2XKOA 1W5TA 1HDPA 3KCCA 3W2AA 2XDVA 3ABTA 3OIOA 4U0WA 4IL6C 3HOVJ 4ZYEA 5FMPA 1X1BA 3OV8A 2P8TA 3P5JA 2LC2A 4RAFA 3GUDA 5ILSA 3TW6A 2XAQA 3PNYA 3OSGA 2D1HA 2LD5A 1X58A 1RRJA 3K4MA 2M8EA 5EZHA 3WTUC 3IL2A 5E3LA 1Z3YA 2LY1A 3KEOA 2KMUA 2LYCA 1Z7LA 2HNHA 2WV1A 4F92B 1QPMA 1XGSA 2QBYB 2WWYA 2DG7A 4V19K 3ZXSA 2A61A 4BKXA 2EZIA 4P9UA 3EUAA 2QKOA 4JOMA 5CVUA 2LP0A 4NQWB 2DMNA 5HDGA 2KKOA 2P5LC 1TNSA 2X6YA 2JA6J 1EJ9A 2IA0A 4RS8A 3LSHA 4NHJA 1YITI 3JSPA 3R4KA 4HAMA 1XSXA 1J7KA 2RAEA 2OERA 1W1WE 5DYMA 5KNLA 3BP8A 2XSDC 2XROA 2JVHA 3M7GA 2RC4A 1X3ZB 1SFUA 1DPRA 1DU6A 1Z6TA 2IS6A 3HG9A 3PQJA 1AKHB 3G56A 2E1MB 1Y56A 2WAEA 2Z3YA 2R7SA 2ID3A 2V4JC 2PJRB 1OFCX 2MG4A 3E6BA 1UB9A 1U2WA 1MH4A 5GAHJ 1IG7A 1ZR2A 2LF7A 5C4JJ 2Y30A 4L9NA 5JVTA 3W3CA 4GXOA 4YFNF 1YTYA 1JE8A 1F36A 1P92A 2Y48A 3CC7I 2CSOA 5H20A 3K2AA 1OR7C 3WU2C 3HTHA 1KYZA 3JSJA 4JBAA 2JUGA 2FX0A 2XF6A 3GTJJ 2BV6A 3ZMDA 3E97A 1MNMC 3DPJA 5F0CA 1U5TA 3V7SA 4HDUA 4XKCA 2R7WA 5BOXA 2PJRA 3DPTA 2K9QA 3CCYA 4A2UA 4ZYHA 1VQNI 1WKMA 3K2ZA 2ZOYA 3GEUA 1MJBA 4C2MJ 2QKMB 2NRAC 1SFEA 4FX4A 4L9TA 2XPUA 2R5YB 3CRJA 4RAZA 3OMYA 3EUPA 4OMYA 3L00A 5B1AH 5D6EA 4LD5A 4DJAA 5KAIC 2PMHA 2RNGA 4IPAA 5F64A 2CS3A 2RHAA 4PFOA 1X2MA 2DQRA 4BHCA 2DLLA 3RD3A 3BY6A 3VB2A 3ABKH 2VONA 3GZIA 2O9LA 3HJEA 2E2HJ 5F1RA 3NI7A 1TQMA 2M7BA 4HF1A 2FSWA 3DV8A 3GCMA 4F52A 2NXNB 3F6VA 2ZJRF 1BJZA 1OYIA 3JAMZ 4U9NA 1ZREA 2G7GA 4U0YA 4A3BJ 3CCLI 4LIUA 3HKZA 4BHPA 1ETQA 1FEXA 4A93J 1MW7A 4WXCA 4A0ZA 3EDPA 1RR7A 1RETA 5CPRB 3OYAA 3CMMA 2CH0A 2Y9YA 1FY7A 1YJ9I 1OYYA 2FMLA 2NS8A 1K4TA 2BXYA 1XMKA 1A6QA 1JJ8C 2CU7A 5JVGF 4B3AA 2HPIA 4I76A 3RTRA 1QU3A 1DU0A 4QPOA 2W25A 3KZZA 3WTSC 1QHGA 3KYCB 3FHNA 1YFHA 4C9YA 3I4MJ 3F8NA 2Q8KA 1F4KA 4V2FA 1YX5A 2ISZA 2LREA 5CVIA 1BI3A 4ZH4F 5L3BA 3ABMH 2Z33A 4CYDA 3IC7A 2DBBA 3FZVA 1WJFA 4NN1A 3RDIA 2HYTA 3K9TA 1LEAA 2CO5A 2YU9J 5H6QA 1X4PA 4L5IA 3JRBA 1QZZA 2K3FA 4IX7A 4EEFG 3OYHA 2M1BA 3KP2A 4DZPA 4YRVA 2QSFX 6PAXA 1IUFA 1FP1D 2RVCA 1ZRFA 3D5SC 1R36A 2AQFA 3A0BC 4P1WA 1B59A 2M45A 2FMYA 2VT2A 3N97A 1LFUP 1AU7A 1TC3C 2WUIA 1EF4A 3K70C 3ECHA 4Y17A 2VLAA 2LY2A 1JI8A 1MD0A 3I4PA 2MSYA 3OYNA 1KQ8A 4ZZLA 2Q2EA 2KZGA 4UUSA 3JTGA 1IF1A 2UUZA 2BVLA 3D0SA 3AG3H 4W1UA 1MSEC 4RGRA 2FBIA 4YIRX 1MDMB 4KDPA 2R7OA 5BPDA 3T6NA 3BC8A 3LA2A 3MZ8A 3CLQA 2IA2A 3EETA 2HQNA 1MMNA 1OCOH 2NVTJ 1GDTA 1RKTA 3AG1H 1KQ9A 3WTTC 4QPQA 2A69F 1TT5B 4J00A 1K83J 2R5ZB 4RB1A 1T2KA 2X85A 2A5WA 4IVNA 5CVJA 2ZXIA 2QIBA 4GYGA 1S5LC 5GAGJ 4D1QA 2ZNZA 3ECOA 4P55A 1WFXA 1V55H 4QTRA 1QBJA 2W85A 3F9KA 1VQPI 1I3AA 3RQ4A 1XMXA 2JPCA 2VQLA 4HW0A 1Z3XA 1YIOA 3BPXA 3HUGB 3ERMA 4PK4A 3J7ZI 3C7JA 4BL0B 5CW8A 2WADA 3BCAA 1HDDC 2GWRA 1YW7A 5K5RA 2DMQA 4DNCA 5HVQC 3VSKA 2ZJPF 1G3TA 1TWFJ 2PLYA 4C2UA 2QZ8A 3ON4A 4G7OF 4Y13A 3ZQQA 2JVGA 3H3VK 1IUYA 4MO7A 2Y0MA 3COLA 1NG6A 3JW4A 1AKHA 5LBQA 1WJ5A 3RQIA 1D3YA 3VVXA 1Z1DA 4ME9A 4UDSA 2CUZA 3RH2A 4BUPA 4HBLA 5HDKA 4P9FA 1HKQA 2QENA 1OLTA 1BIBA 1D8JA 2FBQA 2QQAA 5CVRA 3B6AA 4CYCA 1H9TA 2QSHX 1O7LA 2VQGA 3GEZA 2E36A 5L3EA 2LVSA 3R0AA 2IBDA 1MNEA 4XKWA 3QOPA 5ERIA 3TBIA 4KNYA 1WJAA 2K9NA 3O2PE 3AKZA 4R8HA 1HA8A 3CMEI 2DMPA 1ZN2A 5K58A 1WJCA 4MQ9F 5DM7F 1HCRA 3EQLF 4ZYAA 3K6GA 4BY1J 5FKOA 2JZYA 4NDLA 1WSUA 3ABUA 3N4MA 4BGDA 2ZNYA 1UJ8A 3MAJA 4LK0F 3V8JA 2DOAA 4ZZDA 2L54A 5BPIA 1W4MA 3HSEA 2KLOA 3NQOA 3OYGA 3VOKA 1EH7A 2XB0X 4WWCA 2CW0F 2HU9A 1BR1A 2V7FA 1JXSA 4RGSA 1JGSA 3DKWA 5IT9K 5FKKA 1WGXA 3L09A 3R6SA 5HLIA 4AF5A 5DCFA 3AFHA 2K4BA 2PMZA 4R79A 5ILUA 3P9CA 2HEOA 2BY1A 2IPQX 1U78A 4UUTA 1BR2A 2DQLA 1ZELA 1PYVA 1PP7U 2Z1DA 3HL2A 3ABLH 2MABA 1LE8A 2EA2A 4MLOA 2JPBA 3GFIA 4BE1A 3HM5A 2HYJA 2JT1A 5K7FA 5EZGA 3GTPJ 2UWMA 1SD4A 2WV0A 5H6RA 2Y75A 3OR2C 1A6IA 3P9TA 3L2RA 1S72I 3OYMA 2VL8A 2CQKA 4HX4A 2QQBA 1TP4A 1VQKI 3J80Z 3CCRI 1L0OC 5EF6A 3BR3A 4MTEA 4YFKF 1GUUA 1BIAA 1IZ1A 1DPUA 2XAGA 1D1CA 1SEUA 1K4SA 5IP9J 2PG4A 5HSZA 1YYVA 3PUFA 1UELB 3HTAA 1CF7B 2XF7A 3BZ6A 2M9HA 2D6YA 4BJ5C 2N8GA 3S1MJ 2Z99A 3KKCA 1FIAA 2V26A 2DFHA 4XORA 2CRGA 4CZCA 2HQRA 1ZR4A 2HTSA 2XPWA 3H0GJ 3L2WA 4FISA 1BI2A 4OINF 3COAC 4H0EA 2CUEA 2ACJA 3E6CC 3Q0UA 4E4HA 1WRJA 2HKOA 3LSPA 2MW8A 2VIXA 1REPC 4BY7J 2H27A 1F43A 4KT5C 5J4YA 5D5VB 4LG3A 2CW8A 5KCMA 3WTVC 3P9IA 2VJJA 2JMWA 5DV5A 2J5PA 4AIDA 5EG0B 2LBFA 2OBPA 4E7HA 1FOKA 2R7XA 2XF5A 3OYEA 4E6KG 2Q0OA 5A2QZ 2NS0A 3U1KA 3DTKA 1VFCA 1FMVA 2O03A 1R1VA 4L9JA 3IUVA 1SC7A 3GXOA 2CWEA 4C3HJ 3BJOA 4AIHA 3TEDA 4UXNA 2E2JJ 1GXPA 4Q47A 2EZLA 4BHBA 1SMTA 4AIKA 4XLCA 5L3FA 3LAPA 1O57A 1P7IA 2BGCA 2YR2A 3FBIB 5FGMA 3HUGA 2BVMA 3GZ5A 3L2UA 1I6HJ 3HHGA 2MD0A 2L5QA 1RPWA 2ZMEB 3FK6A 1O3TA 5CQEA 3QU6A 4B4CA 3HOSA 4KWAA 4Y3OA 2K3PA 4AU7A 1FBUA 1T6SA 2KL4A 3IKVA 4A6EA 5GPCA 2H6CA 3E5QA 1VI0A 2QOPA 4KA4A 5M5WJ 1O3QA 4KIBA 3MNLA 3VP5A 3MN2A 2JA2A 3ZQ7A 3TP3A 3GLLA 2KDZA 1OPCA 3ZQHA 5FLXZ 2XC7A 1OISA 3DTIA 2VC1A 3S15J 4HSTA 4KN4X 2VC0A 3RKXA 4GO1A 1BC7C 1ZK8A 2RV8A 2ECCA 2X48A 3FK7A 4JNNA 3SZGA 1G6NA 1RI7A 2M34A 1XN7A 3FKIJ 2FBKA 1NG7A 2KZVA 4N4OB 5KAFC 3I54A 1R7JA 4YELA 5DCMB 1J5YA 2GA2A 3VOEA 3RKYA 1RKWA 1BOBA 3IH2A 4OWRB 3GTLJ 2DW4A 2HPMA 3S32A 1ETKA 2PX9A 3VSLA 5FKLA 2W82A 1O7FA 3G1MA 3RKQA 5L3DA 4JX5A 2L2OA 1O3RA 2H1LA 3M4OJ 1PVEA 4NUBA 3RCOA 4D7MA 2EPFA 3H36A 1Y0UA 4LLGF 2OZUA 2VASA 5J1RA 3FM5A 5J4VA 5F04A 2HXIA 1BJAA 3CO6C 3ZQGA 3SYTA 3Q3SA 4U9LA 2ME6A 3OS1A 3KP5A 2A2FX 3JR9A 4WF2A 2YX7A 4TV7A 4MQVA 3F8FA 5H2FC 4JKZA 4BJ6C 5FRMA 4E7JA 5JFRA 1G3WA 1UHMA 5CXGA 2YPRA 3BCGA 1TW3A 2EK5A 4A0YA 1QO0D 2LDUA 5HLHA 3SZPA 4DVYP 4Y7NJ 4ZDOA 2QWWA 2P5VA 2KT0A 4LOCA 1B6AA 3HRTA 4A6DA 3BWGA 4IRIA 1X4OA 2KRFA 4CH7A 3OS0A 4B48A 3HOYJ 1ZHFA 1FYKA 1XC5A 2IXSA 1K78A 1W7PD 3NXCA 1QZEA 1OCRH 2IGMA 1ZG5A 4RB3C 4AYBN 3ZR8X 2ZO4A 5D5UB 1FTZA 3UKGA 3D5RC 1HXDA 2YX4A 1U0JA 1BN5A 3S1RJ 1KONA 3TL4X 2F2EA 3DQVC 2WY7Q 4RGXA 5E1WA 5JLWA 4A3IJ 3L2CA 1ONVA 4OMZA 2HZDA 4HX8A 4EM1A 1ZTRA 4IOCF 2VQHA 2L02A 1VQ8I 2R7QA 2KISA 3VTIA 4KJZA 4IHYA 3G73A 4PFPA 2MLKA 5ICGA 2R7FA 3B81A 4UY8I 3J81Z 1YLFA 4UB8C 3BR1A 1G4DA 1WH5A 2QLZA 2QGUA 3EPZA 3PSIA 4U0VA 3C2HA 4EJOA 3JRIA 4NC8A 1XX5A 2OZ6A 1PJRA 3J81K 4FE4A 1IRZA 1W36C 2ESNA 2EZHA 2D5VA 4XLFA 2BEOA 4F55A 1RNLA 2XKPA 1QNTA 1UHWA 4U7DA 4A3CJ 5ILVA 2C6YA 3ASOH 1MJAA 3ZN0A 4NB5A 4I98B 3WHBA 2IS2A 4QSHA 1S8NA 1T0FC 2VBWA 4ZJZA 4N4NB 1S7EA 2QVOA 1FWZA 4BQQA 3WE3A 4HNVA 2VBXA 1Z6RA 3PNTA 3CJTB 1U3EM 4FCYA 3BOQA 2HVRA 4II3A 1OCTC 1TQPA 3RPQA 2KHMA 4U88A 4HV5A 4I0AA 1FPQA 2MYSA 5FO5A 1IJWC 2QUFA 3E5UA 1RUNA 1JUPA 2E1CA 1R4MB 1MBHA 2VI6A 4Q5SF 2B9SA 2GXAA 1QRYA 4DGWB 3AG2H 3EGQA 1Z05A 2OCEA 1T95A 2CYYA 2QTQA 4U7BA 3ESWB 2JK3A 5D8KB 2F07A 3IUOA 3EUHC 3M3YJ 4HKUA 3QPLA 3PIPF 3M1EA 1FIPA 1FP2A 2M4GA 3TQNA 2ME0A 1G59A 3JRFA 4XICA 4QLCU 1TL8A 4AWXB 2GIZA 3PJRA 2DCEA 1FLIA 4OD4A 4IQ4A 1RUOA 1ZG1A 3FMRA 5LD2C 3NRVA 2FOKA 3RPUD 2R7DA 4EMSA 2O7TA 2MGQA 4PGGA 1XMAA 3VYUB 3LNQA 1YHQI 1SANA 1W0TA 5HLTA 4KYWA 1FSEA 2EIMH 5HDNA 3VYTB 1VZ0A 5K7ZA 3FISA 1A35A 2EJRA 4GFKA 3OWTA 1WJBA 5ICCA 4AVPA 1BC8C 5CQGA 4UVCA 2MD5A 2ZSIB 3BDDA 4M6VA 1WHUA 2X1DA 3ZN1A 1UG2A 2R93J 2NP5A 4OU0A 4G9YA 2HOAA 3CJRB 5E3NA 4BDZA 1SVMA 1U6GA 2M0CA 2M8GX 4U87A 4FE7A 5LEKA 2VPRA 1M1EB 3NWSA 1CGPA 3RSNA 3ZMVA 3VW2A 4FTHA 2DA2A 1R5HA 4HX7A 2F5DA 3BJ6A 4IQJA 4CYCB 2EFPA 4XKVA 2E71A 1FBQA 1Z7UA 4P5OA 4IHVA 2L0KA 3L2QA 1Y1VJ 2LY9A 4HQEA 4UNOA 1AWCA 3F3XA 4M73A 4E7KA 5D5XB 1YO5C 1YRNA 1X3UA 2FJ1A 4G7ZF 3WG9A 2EFWA 3BTIA 1ULYA 2DODA 3RJPA 5IY5H 1MH3A 4XN3A 2DMUA 3HIFA 3IHUA 3MWMA 2DTRA 1VQOI 3K1MA 4M3GA 4JYKA 5HAWA 2UXNA 3WU1B 4L0YB 4FT8A 4YFXF 5JHFA 2OCCH 3G4SI 2OJED 2LH9A 2XV4S 4UVAA 5DCMA 2ZFWA 4MEYF 3GMEA 3P9KA 3S2WA 2OQGA 1Z77A 2F48A 2MFZA 2O8XA 5DDGA 3CDIA 4CCKA 3LFKA 4RAGA 3JCUC 4C3JJ 1P9QC 1YRNB 3VOXA 5E3MA 3TDZC 5L3CA 3CCQI 3MKZA 1N78A 3R61A 3H9QA 1J75A 3DKYA 4I0BA 3WU0A 2CG4A 1K79A 3OR1C 3TP0A 2TRTA 3LMMA 5LRRA 1BR4A 4S05A 2ELJA 2R3SA 1V5FA 2K40A 3IH3A 4ENNA 2LKXA 3GZ6A 3QBMA 1R1TA 2IT0A 4XQFA 3DXJF 3H1CA 4LIVA 3SQNA 3S8PA 3IAS2 4GCVA 3SFZA 1R5GA 2P6SA 1B9MA 3IV5A 1V3FA 4OAZA 2UV1A 4KITB 1FT9A 2HOTA 1P2FA 1IW7F 3BG5A 1IDYA 3BTJA 3NWTA 3MFKA 2IS1A 3EUKL 2R7VA 1R22A 5TJJA 2M4KA 5DEQA 1H88C 2P81A 1OR7A 3ONQA 1KU7A 4B43A 2ETHA 3CC2I 5M5XJ 3OOUA 1G8XA 3FMQA 3V42A 3QYBA 2VKHA 5IYBJ 2VOOA 1GXQA 2DOFA 3KP4A 1UAAA 3MMYB 1T0FA 1S9HA 2ZC2A 1YG2A 4MGRA 5BQTA 2I10A 2LBFB 3S14J 3D5LA 2I8DA 3I5UA 4HNUA 4MTDA 1JHHA 4XR6A 2UZKA 2GQQA 2R0QC 4W97A 1R71A 2GXBA 2JSPA 3OSFA 3DF8A 4WXDA 1SMYF 5FRNA 4LB6B 3VWBA 4ESBA 5TISC 1ON1A 3KZIC 3CJQB 3E6DA 2DOEA 1IN7A 1O4XA 1KGSA 3GBGA 1XGOA 3PFYA 3QPTA 3MEXA 1XB4A 4L18B 4L9VA 1ZG3A 3REOA 2DT5A 1WVRA 3SDBA 4CA0A 3CESA 1YI2I 4ENKA 1DDNA 5GPAA 1ETVA 4RB2C 1D8KA 1TWAJ 3CLOA 5IT3A 2ZB9A 2I5UA 2KIUA 1TWHJ 2W53A 3DPLC 4DIQA 1YOVB 4XMYA 3LL7A 2PQ8A 1WPKA 3N05A 3NAUA 1XG1A 2K02A 3FX3A 1X1PA 5EJCA 3VW1A 3RZDJ 3CJDA 2F4MB 5BMZA 2RN7A 5D19A 4PSXA 4G6DA 2KJBA 1B9NA 3O8GA 2X4HA 3BCBA 2PFBA 5LFAA 3GFJA 3PIOF 1S7OA 3HGGA 1LKXA 3CP8A 3QODA 4F91B 3I59A 2QSGX 4XL9A 2LMDA 1LE8B 2X6XA 3LSMA 1YW9A 3LWFA 3VODA 2GLOA 4Y52J 2YS9A 3DU6A 1QPIA 2DPUA 4IRHA 3S2DJ 1HOMA 3O8HA 5FFZA 1SAXA 5JI6A 5EFYA 4M74A 2RKHA 4ANJA 2MBFA 4M6YA 1I1SA 1Z9CA 3LA7A 4IJAA 4A3LJ 4WX9A 1DQUA 3LQRA 4ASNA 3I56I 4RMNA 3SZTA 3CCUI 1MBFA 3U21A 3W6VA 5F08A 1Y6IA 3PUBA 3ZCOA 2RDPA 4M71A 2VKDA 3I55I 3F1BA 2RREA 4HV6A 2CQNA 3OYIA 3BTCA 1YX3A 2DDBA 4YEJA 5LGNA 4ENJA 2CMPA 2GAUA 2KFDA 3KYDB 4AUXA 3E7QA 4CCMA 4HYEA 3OIPA 4C3IJ 1MMGA 1QZYA 4GCLA 3DCFA 5F6FA 2XRLA 2PZ9A 4A3MJ 3LFUA 3IAM2 2UXOA 3IRRA 2G7UA 2OV7A 4DOZA 1HW1A 3BNIA 3C3WA 1SD7A 2DK8A 1X3WB 1B72A 5J8CA 1JKQC 1OYWA 1W7PA 4A12A 2HDDA 3KE2A 1TQIA 4PUSA 1WZ2A 1P4AA 2QYOA 3K0LA 3CMAI 3CZ6A 5ICEA 1LFBA 3BHQA 2MH2A 4ESJA 2AS5F 5EG0A 3GTGJ 2A68F 2EV5A 3ZMTA 1E17A 1QQIA 1R9TJ 3S93A 3JSOA 2FEZA 4M9SA 2CV0A 1C0WA 4N9IA 4RA2A 1LFPA 4EM2A 3ROUA 4IHXA 2P0WA 1SD5A 3HPHA 3ELKA 3WTXC 2IU5A 3CTAA 3KETA 3NARA 1ACIA 3LSIA 5EEGA 4CO8A 1KA8A 5J1UA 5HS8A 3C18A 3MKYB 2Y2ZA 2M30A 2K9LA 1JKOC 2O7OA 1VF9A 1OCZH 2X6WA 2ID6A 5E18F 3JRGA 3GTMJ 2ZJQF 2FD5A 2NAZA 2VXZA 4I99C 4EGYA 3ANPA 4DYCA 2D2WA 2IW5A 3K7AJ 2WAQN 4XLHA 4PJ0C 1P4WA 1SGMA 1W5SA 4A0XA 2HYGD 1FJLA 4I7HA 1IRXA 3E6MA 3FXUA 2E1MC 1MBKA 2GBYA 2XGCA 3RPUA 2G7HA 4LITA 4LG0B 4FASD 3FMSA 3MVPA 2R7TA 4BE0A 2IRFG 2EV0A 2KIMA 4I09A 2UXXA 4LLLA 1YW8A 1ERDA 1UI5A 2LNBA 4CCOA 2ZXJA 2GXGA 2FQ3A 1DUXC 2L7KA 4I6ZA 3HTJA 3HOWJ 2CV1A 4GCKA 2XGEA 1IXSB 1HKSA 5K5QA 2O0YA 3NEUA 3G71I 4MHGA 1UCRA 4E7ZA 5IP7J 2NOJB 2YVHA 3PNVA 3JAMK 5AIQA 4BBRJ 2E7XA 2DK5A 2V1UA 2QA4I 2XPVA 3BG3A 4WIBA 1QA6A 2G9WA 1B4AA 3GF2A 5DTDA 2NVYJ 5LHIA 2BYVE 1S7AA 3FWEA 4J01A 3GTQJ 3V6GA 4ZYDA 1MMSA 2DO7A 2K85A 2XSJC 3QPSA 3WTYC 1EH6A 2L9RA 3MKWB 4A69C 2LSOA 1OCCH 2LKSA 3QQAA 4NQWA 2K7LA 3S3MA 1YS7A 3CF2A 2G7SA 2WBMA 3AL0C 3VFZA 2ZCNA 3BJBA 2RNJA 2YVEA 4B8XA 3NRGA 3K1PA 3OL4A 4S04A 1J59A 3KZYA 5FROA 1TNTA 2JRTA 3FXRA 1APLC 4AIJA 2BHYA 1YJWI 3L2VA 4CHUA 4CGZA 2LKPA 1NHAA 3G2BA 1J0RA 1FYLA 1F1ZA 3A01A 3S16J 3KX2A 5GP9A 2COBA 3KEQA 3OYJA 3CCSI 1W5CC 2ELKA 1IN4A 2XASA 2EFOA 4UV8A 4HEA2 1T98A 2RQQA 3LJLA 3H3UA 5CYVA 1XDUA 1RC9A 3V4GA 3VYRB 1O3SA 2YVXA 3DEEA 4ESFA 3UNGC 2EBIA 3CMYA 5TRDA 3ZGKA 1PUFB 2PJPA 1MBJA 1HBXG 3BPVA 1E3OC 2DAOA 2WGBA 3IH4A 2L3DA 3I9V2 2CQQA 2HTJA 3D1NI 1VQ5I 4X0GA 5CJ9A 4ZDLA 3VVZA 2RQPA 4D5FA 1OJLA 2E1NA 2LTPA 3GFMA 4XBFA 3L7WA 4LFUA 2CQXA 1MDMA 1LJ9A 4OIRF 1FTTA 2M5WA 2OPTA 2BBYA 2DA5A 2PFVA 2Z16A 2Y31A 1FSHA 1EA3A 3SXYA 2K9SA 3HSRA 3L9FA 3LHQA 2L9SA 5M3FJ 3JRDA 2WB1A 2X1EA 4DYRA 3QWLA 4RGUA 4FETA 3WGHA 3GYHX 1ZGWA 1PP8F 3NPIA 3X2QH 3G7RA 2W7NA 2HOSA 3M8EA 2EZKA 1B1BA 1OMIA 5C4YA 4I2OA 3ZQFA 2FA5A 3H3ZA 4BQOA 3U9GA 3J80K 4D5CA 3F6OA 3QAHA 5DUKA 4NELA 3TOBA 3O6BB 2AO9A 3K1NA 2L4MA 2A6EF 1E3HA 3TO7A 5FJ8J 4Y15A 3ZOBA 3S3NA 3BG9A 2DA6A 3HOUJ 3FXMA 3TKYA 2DFEA 2DTZA 1OCPA 3QP6A 3KKDA 4N0BA 3VIBA 1T56A 1K78B 2E2IJ 1Q1HA 3ZMZA 4BQNA
chains in the Genus database with same CATH topology
4AC6A 5K7ZA 3I4NJ 3FISA 2R5ZA 3HEFA 4GFKA 4YZEA 1TWCJ 1JUSA 3VVYA 3BTLA 3LWJA 4M3DA 1Z0XA 4NN1A 4M6VA 2HYTA 1UG2A 2R93J 4M3EA 5E3NA 2NP5A 2HOAA 2YU9J 2M0CA 1WH7A 2M8GX 2X6OA 4FE7A 2VPRA 3JRBA 1MBEA 3BQYA 4EEFG 2G7LA 3O60A 3VW2A 4DZPA 2DA2A 4FTHA 1NTCA 1IUFA 4CYCB 2Q24A 1LFUP 3L1PA 1AU7A 4IHVA 5CXIA 2DA7A 2L0KA 1TC3C 1EF4A 2WUIA 3JRCA 1ETYA 1U9OA 1Y1VJ 2LY9A 3VUQA 2GENA 1BW6A 3LOCA 2MSYA 1ENHA 1YRNA 2FJ1A 4UUSA 4DZJA 2JN6A 2O8KA 3BTIA 5IOZA 4W1UA 5J1YA 1MSEC 1MH3A 5FLVA 2DG8A 2OF7A 4JX4A 2DMUA 2NS7A 1XS9A 5D1RA 3S17J 1ZQ3P 4M3GA 4MIMA 4JYKA 5HAWA 3T6NA 1D5YA 3AQSA 5F0HA 3VW0A 1U8BA 1Z77A 2NVTJ 1GDTA 1RKTA 1H89C 1YRNB 4C3JJ 2RASA 1K83J 2R5ZB 4ICHA 4X1EA 2V57A 5E3MA 3VOXA 2NVXJ 2QIBA 3NNRA 3FIWA 4A3JJ 1HLVA 4RDUA 4QTRA 1A5JA 5IYCJ 2EQRA 1JTXA 2DJNA 3VPRA 3TP0A 2H1KA 2TRTA 4JP0A 3DEWA 4DW6A 1GVDA 2GFNA 3HE0A 4GFBA 3LSRA 1ETWA 9ANTA 2CJJA 2K40A 2UXIA 3IH3A 2LKXA 5CW8A 3QKXA 2HXOA 1HDDC 3ANGA 3QBMA 3JREA 2JWTA 2DMQA 3S2HJ 2L7ZA 4L5EA 3BR6A 2JA5J 4XK4A 1TWFJ 3IV5A 3ON4A 5IOYA 2GM4A 3H3VK 2LFBA 4MO7A 2HOTA 3COLA 4S0HB 5FLMJ 1BA5A 1GV2A 3BG5A 1IDYA 3BTJA 5HODA 1AKHA 2R7ZJ 3RQIA 4IEJA 3KZ9A 3VVXA 3FRQA 1H88C 2P81A 2VUMJ 4ME9A 4UDSA 3RH2A 1W0UA 2NX4A 5M5XJ 3OOUA 1UHSA 5IYBJ 4MFEA 2FBQA 4GFLA 3B6AA 4CYCA 2I10A 3S14J 2LVSA 2IBDA 2VKEA 2OI8A 1POGA 2K9NA 2R0QC 5K58A 4W97A 2DMPA 1HCRA 2UXPA 3OSFA 4BY1J 5FKOA 2R5YA 4L62A 1VNDA 4NDLA 2NP3A 3G1OA 4A3FJ 5C4XJ 4A3EJ 5FHPA 2QWTA 1O4XA 1B8IB 3GBGA 1AHDP 3PO2J 3A02A 2GUHA 1GV5A 4V2GA 1I50J 1JT0A 1BW5A 1Y1WJ 3VOKA 2FQ4A 5GPAA 1ETVA 4A3DJ 5F1JA 1TWAJ 2XB0X 3MKLA 2ZB9A 2DMTA 1T33A 5IYDJ 1TWHJ 2W53A 2ECBA 5FKKA 1WGXA 4UUSB 1IGNA 2UXUA 2G0EA 1WPKA 4AF5A 3NAUA 4DYQA 1K61A 1BL0A 1XG1A 5DAJA 4A3KJ 3PPBA 2REKA 4ACIA 1U78A 4UUTA 3RZDJ 3VW1A 5C3EJ 1JTYA 2X9DA 3HGYA 4B1RA 2NVQJ 4QIWN 3CJDA 3CWRA 5D18A 5IPAA 5D19A 1LE8A 1JGGA 3O8GA 4MLOA 1HF0A 2JJ7A 3HM5A 2HYJA 5K7FA 4JL3A 5EZGA 1I3QJ 3GTPJ 3HGGA 3SDGA 4MXMA 3ZQLA 1A6IA 1LE8B 3P9TA 1QVTA 1ORKA 3HKZN 2GLOA 4D7NA 2YS9A 4Y52J 5BNGA 1QPIA 5EF6A 3BR3A 4IHWA 3S2DJ 1HOMA 3O8HA 1GUUA 2ZOZA 5EFYA 3E7LA 5IP9J 2XGDA 3PM1A 5HSZA 4A3LJ 2IAIA 5DS9A 1Q1VA 1CQTA 4M3FA 4G12A 3HTAA 3HOZJ 2M9HA 2D6YA 1MBFA 2N8GA 3F0CA 3W6VA 3S1MJ 3AQTA 5F08A 2HKUA 3KKCA 1FIAA 2EH3A 4XRSG 4J19A 3F1BA 2CRGA 3BTCA 2WB1N 1ZR4A 2XPWA 2TCTA 2W48A 3H0GJ 4FISA 1IV6A 2JA8J 3HB9A 4X6AJ 2CUEA 4AUXA 1UI6A 3Q0UA 3E7QA 3LSPA 2MW8A 4BY7J 4C3IJ 2G3BA 1JJ6C 1F43A 3HBLA 5AQCA 4GCLA 3DCFA 2XRLA 4M3BA 2PZ9A 4A3MJ 3GTOJ 1JUMA 1IDZA 3HOXJ 2UXOA 3Q0WA 3SFIA 2VKVA 3BNIA 3ON2A 4GCTA 2JMWA 1ETOA 3TW7A 1TWGJ 5EG0B 2LR8A 2CUFA 1B72A 3S1NJ 2DN0A 1JKQC 2HDDA 3LSGA 5FKNA 5EGOB 5EGOA 2XB5A 1VFCA 1RESA 1LFBA 3BHQA 4AC0A 1NK3P 3GTGJ 5EG0A 1B72B 3IUVA 3V78A 3TEDA 4C3HJ 2E2JJ 5H9TA 1ETXA 3A03A 2DA1A 2XDNA 1R9TJ 2EZLA 5FKMA 5IP6A 2IEKA 1P7IA 3LSJA 4MFDA 5M3MJ 2Y9ZA 1I6HJ 4CGRA 4IHXA 1NK2P 1WI3A 2IU5A 3NARA 1RPWA 3FK6A 5J1UA 4KWAA 4B4CA 3CDLA 1ZKGA 2Y2ZA 1JKOC 2O7OA 1VF9A 3JRGA 2LLKA 2ID6A 3GTMJ 5JLXA 3C07A 5GPCA 4RBOA 2FD5A 3ZQIA 3BR0A 3ANPA 4DYCA 1VI0A 5F27A 3K7AJ 2WAQN 3S1QJ 2QOPA 3ZQCA 5M5WJ 1SGMA 4PXIA 1ITYA 3BRUA 3MNLA 3VP5A 1FJLA 3S5RA 3MN2A 5F0FA 3TP3A 5EEAA 2KDZA 3ZQHA 2ZCMA 1MBKA 2GBYA 2XGCA 4JX6A 3S15J 3SJMA 2M2EA 1HDPA 3MVPA 1B8IA 1ZK8A 2ECCA 2X48A 3FK7A 4JNNA 3CQZJ 2JA7J 2M34A 3OIOA 1H8AC 3HOVJ 1UI5A 5HBUA 5FMPA 3FKIJ 3WHCA 3TW6A 4MK6A 5EDNA 3OSGA 2LD5A 1X58A 1RKWA 3IH2A 4I6ZA 3GTLJ 3HTJA 3HOWJ 4GCKA 1ETKA 2XGEA 5EZHA 5M5YJ 2H8RA 5E3LA 5FKLA 5E3OA 2WV1A 3G1MA 2YUSA 3RKQA 4JX5A 5IP7J 2YVHA 5FGLA 2DG7A 4BKXA 3HDDA 4BBRJ 3M4OJ 2EZIA 5K7HA 2Y0SN 2QKOA 2XPVA 3BG3A 4D7MA 5DTDA 2NVYJ 5J1RA 2LP0A 5F04A 2HXIA 2DMNA 3ZQGA 3Q3SA 3GTQJ 3V6GA 2E19A 2JA6J 2ME6A 3QPSA 3JR9A 2UXHA 2L9RA 1GT0C 4A69C 1P7JA 4JKZA 2RAEA 1QVUA 3QQAA 2OERA 3HTIA 5CXGA 2XSDC 3BCGA 2G7SA 2ZCNA 4XRSA 3BJBA 3PASA 1UMQA 1DU6A 2YVEA 2LK2A 1AKHB 3G56A 3NRGA 4Y7NJ 2KT0A 1APLC 2ID3A 2HQ5A 4LOCA 2PBXA 3HIMA 1OFCX 1X2NA 2MG4A 1MH4A 1IG7A 3HOYJ 1ZR2A 5C4JJ 1XC5A 2Y30A 1JKRC 3KNWA 3NXCA 3A01A 4AYBN 3S16J 1FTZA 5GP9A 2COBA 1F36A 1MBGA 3BT9A 2L7MP 2ELKA 3UKGA 3HTHA 3K2AA 3S1RJ 3GTKJ 3JSJA 3C2BA 5C44J 5JLWA 4A3IJ 3LJLA 2FX0A 2R92J 2AHQA 1ZTRA 3GTJJ 1MNMC 3DPJA 5F0CA 4IHYA 3RZOJ 2DA3A 2EBIA 2K9QA 3CCYA 3CMYA 2QCOA 1PUFB 1IC8A 1MBJA 1MSFC 4XRMA 3B81A 4BXXJ 1E3OC 2ZOYA 3GEUA 4C2MJ 3IH4A 1U9NA 2WGBA 3BR1A 2NOGA 1WH5A 2XPUA 2R5YB 2CQQA 3CRJA 3D1NI 3PO3J 3EUPA 2PMZN 3JRIA 3VVZA 4D5FA 1OJLA 1WCMJ 2LTPA 4FE4A 1IRZA 2EZHA 2D5VA 2CQXA 3JRAA 1FTTA 2OPTA 4A3CJ 4BBSJ 2RHAA 2DA5A 1X2MA 3WHBA 4A3GJ 2Y31A 3B6CA 4QSHA 3RD3A 2K9SA 3LHQA 1S7EA 3GZIA 5M3FJ 2O9LA 4HNVA 3JRDA 4DYRA 4XIDA 2E2HJ 3NI7A 3BR5A 5J3LA 1SFOJ 2E1OA 4FCYA 1ZGWA 1OCTC 3NPIA 3G7RA 2HOSA 2B63J 1BJZA 1IJWC 3BQZA 2HI3A 1JUPA 2EZKA 5C4YA 1G2HA 1MBHA 2VI6A 5EYRA 3ZQFA 2G7GA 4A3BJ 4ABZA 3Q0VA 1QRYA 3EGQA 1ETQA 3JRHA 1FEXA 2QTQA 4A93J 4D5CA 4NELA 1RR7A 1RETA 2JK3A 2ZCXA 2Y9YA 2F07A 3BR2A 1JT6A 1PUFA 2NS8A 3M3YJ 4HKUA 2AO9A 3QPLA 1FIPA 2L7FP 5FJ8J 2ME0A 1JJ8C 3JRFA 4XICA 2CU7A 3ZOBA 3BG9A 4B3AA 2DA6A 4I76A 3HOUJ 1JKPC 1DU0A 2QF7A 2DTZA 1OCPA 3I4MJ 2O7TA 3KKDA 2MGQA 3VIBA 3LNQA 1SANA 2DA4A 1T56A 3G1LA 3A01B 1W0TA 2E2IJ 4V2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC6 A;  5K7Z A;  3I4N J;  3FIS A;  2R5Z A;  3HEF A;  4GFK A;  4YZE A;  1TWC J;  1JUS A;  3VVY A;  3BTL A;  3LWJ A;  4M3D A;  1Z0X A;  4NN1 A;  4M6V A;  2HYT A;  1UG2 A;  2R93 J;  4M3E A;  5E3N A;  2NP5 A;  2HOA A;  2YU9 J;  2M0C A;  1WH7 A;  2M8G X;  2X6O A;  4FE7 A;  2VPR A;  3JRB A;  1MBE A;  3BQY A;  4EEF G;  2G7L A;  3O60 A;  3VW2 A;  4DZP A;  2DA2 A;  4FTH A;  1NTC A;  1IUF A;  4CYC B;  2Q24 A;  1LFU P;  3L1P A;  1AU7 A;  4IHV A;  5CXI A;  2DA7 A;  2L0K A;  1TC3 C;  1EF4 A;  2WUI A;  3JRC A;  1ETY A;  1U9O A;  1Y1V J;  2LY9 A;  3VUQ A;  2GEN A;  1BW6 A;  3LOC A;  2MSY A;  1ENH A;  1YRN A;  2FJ1 A;  4UUS A;  4DZJ A;  2JN6 A;  2O8K A;  3BTI A;  5IOZ A;  4W1U A;  5J1Y A;  1MSE C;  1MH3 A;  5FLV A;  2DG8 A;  2OF7 A;  4JX4 A;  2DMU A;  2NS7 A;  1XS9 A;  5D1R A;  3S17 J;  1ZQ3 P;  4M3G A;  4MIM A;  4JYK A;  5HAW A;  3T6N A;  1D5Y A;  3AQS A;  5F0H A;  3VW0 A;  1U8B A;  1Z77 A;  2NVT J;  1GDT A;  1RKT A;  1H89 C;  1YRN B;  4C3J J;  2RAS A;  1K83 J;  2R5Z B;  4ICH A;  4X1E A;  2V57 A;  5E3M A;  3VOX A;  2NVX J;  2QIB A;  3NNR A;  3FIW A;  4A3J J;  1HLV A;  4RDU A;  4QTR A;  1A5J A;  5IYC J;  2EQR A;  1JTX A;  2DJN A;  3VPR A;  3TP0 A;  2H1K A;  2TRT A;  4JP0 A;  3DEW A;  4DW6 A;  1GVD A;  2GFN A;  3HE0 A;  4GFB A;  3LSR A;  1ETW A;  9ANT A;  2CJJ A;  2K40 A;  2UXI A;  3IH3 A;  2LKX A;  5CW8 A;  3QKX A;  2HXO A;  1HDD C;  3ANG A;  3QBM A;  3JRE A;  2JWT A;  2DMQ A;  3S2H J;  2L7Z A;  4L5E A;  3BR6 A;  2JA5 J;  4XK4 A;  1TWF J;  3IV5 A;  3ON4 A;  5IOY A;  2GM4 A;  3H3V K;  2LFB A;  4MO7 A;  2HOT A;  3COL A;  4S0H B;  5FLM J;  1BA5 A;  1GV2 A;  3BG5 A;  1IDY A;  3BTJ A;  5HOD A;  1AKH A;  2R7Z J;  3RQI A;  4IEJ A;  3KZ9 A;  3VVX A;  3FRQ A;  1H88 C;  2P81 A;  2VUM J;  4ME9 A;  4UDS A;  3RH2 A;  1W0U A;  2NX4 A;  5M5X J;  3OOU A;  1UHS A;  5IYB J;  4MFE A;  2FBQ A;  4GFL A;  3B6A A;  4CYC A;  2I10 A;  3S14 J;  2LVS A;  2IBD A;  2VKE A;  2OI8 A;  1POG A;  2K9N A;  2R0Q C;  5K58 A;  4W97 A;  2DMP A;  1HCR A;  2UXP A;  3OSF A;  4BY1 J;  5FKO A;  2R5Y A;  4L62 A;  1VND A;  4NDL A;  2NP3 A;  3G1O A;  4A3F J;  5C4X J;  4A3E J;  5FHP A;  2QWT A;  1O4X A;  1B8I B;  3GBG A;  1AHD P;  3PO2 J;  3A02 A;  2GUH A;  1GV5 A;  4V2G A;  1I50 J;  1JT0 A;  1BW5 A;  1Y1W J;  3VOK A;  2FQ4 A;  5GPA A;  1ETV A;  4A3D J;  5F1J A;  1TWA J;  2XB0 X;  3MKL A;  2ZB9 A;  2DMT A;  1T33 A;  5IYD J;  1TWH J;  2W53 A;  2ECB A;  5FKK A;  1WGX A;  4UUS B;  1IGN A;  2UXU A;  2G0E A;  1WPK A;  4AF5 A;  3NAU A;  4DYQ A;  1K61 A;  1BL0 A;  1XG1 A;  5DAJ A;  4A3K J;  3PPB A;  2REK A;  4ACI A;  1U78 A;  4UUT A;  3RZD J;  3VW1 A;  5C3E J;  1JTY A;  2X9D A;  3HGY A;  4B1R A;  2NVQ J;  4QIW N;  3CJD A;  3CWR A;  5D18 A;  5IPA A;  5D19 A;  1LE8 A;  1JGG A;  3O8G A;  4MLO A;  1HF0 A;  2JJ7 A;  3HM5 A;  2HYJ A;  5K7F A;  4JL3 A;  5EZG A;  1I3Q J;  3GTP J;  3HGG A;  3SDG A;  4MXM A;  3ZQL A;  1A6I A;  1LE8 B;  3P9T A;  1QVT A;  1ORK A;  3HKZ N;  2GLO A;  4D7N A;  2YS9 A;  4Y52 J;  5BNG A;  1QPI A;  5EF6 A;  3BR3 A;  4IHW A;  3S2D J;  1HOM A;  3O8H A;  1GUU A;  2ZOZ A;  5EFY A;  3E7L A;  5IP9 J;  2XGD A;  3PM1 A;  5HSZ A;  4A3L J;  2IAI A;  5DS9 A;  1Q1V A;  1CQT A;  4M3F A;  4G12 A;  3HTA A;  3HOZ J;  2M9H A;  2D6Y A;  1MBF A;  2N8G A;  3F0C A;  3W6V A;  3S1M J;  3AQT A;  5F08 A;  2HKU A;  3KKC A;  1FIA A;  2EH3 A;  4XRS G;  4J19 A;  3F1B A;  2CRG A;  3BTC A;  2WB1 N;  1ZR4 A;  2XPW A;  2TCT A;  2W48 A;  3H0G J;  4FIS A;  1IV6 A;  2JA8 J;  3HB9 A;  4X6A J;  2CUE A;  4AUX A;  1UI6 A;  3Q0U A;  3E7Q A;  3LSP A;  2MW8 A;  4BY7 J;  4C3I J;  2G3B A;  1JJ6 C;  1F43 A;  3HBL A;  5AQC A;  4GCL A;  3DCF A;  2XRL A;  4M3B A;  2PZ9 A;  4A3M J;  3GTO J;  1JUM A;  1IDZ A;  3HOX J;  2UXO A;  3Q0W A;  3SFI A;  2VKV A;  3BNI A;  3ON2 A;  4GCT A;  2JMW A;  1ETO A;  3TW7 A;  1TWG J;  5EG0 B;  2LR8 A;  2CUF A;  1B72 A;  3S1N J;  2DN0 A;  1JKQ C;  2HDD A;  3LSG A;  5FKN A;  5EGO B;  5EGO A;  2XB5 A;  1VFC A;  1RES A;  1LFB A;  3BHQ A;  4AC0 A;  1NK3 P;  3GTG J;  5EG0 A;  1B72 B;  3IUV A;  3V78 A;  3TED A;  4C3H J;  2E2J J;  5H9T A;  1ETX A;  3A03 A;  2DA1 A;  2XDN A;  1R9T J;  2EZL A;  5FKM A;  5IP6 A;  2IEK A;  1P7I A;  3LSJ A;  4MFD A;  5M3M J;  2Y9Z A;  1I6H J;  4CGR A;  4IHX A;  1NK2 P;  1WI3 A;  2IU5 A;  3NAR A;  1RPW A;  3FK6 A;  5J1U A;  4KWA A;  4B4C A;  3CDL A;  1ZKG A;  2Y2Z A;  1JKO C;  2O7O A;  1VF9 A;  3JRG A;  2LLK A;  2ID6 A;  3GTM J;  5JLX A;  3C07 A;  5GPC A;  4RBO A;  2FD5 A;  3ZQI A;  3BR0 A;  3ANP A;  4DYC A;  1VI0 A;  5F27 A;  3K7A J;  2WAQ N;  3S1Q J;  2QOP A;  3ZQC A;  5M5W J;  1SGM A;  4PXI A;  1ITY A;  3BRU A;  3MNL A;  3VP5 A;  1FJL A;  3S5R A;  3MN2 A;  5F0F A;  3TP3 A;  5EEA A;  2KDZ A;  3ZQH A;  2ZCM A;  1MBK A;  2GBY A;  2XGC A;  4JX6 A;  3S15 J;  3SJM A;  2M2E A;  1HDP A;  3MVP A;  1B8I A;  1ZK8 A;  2ECC A;  2X48 A;  3FK7 A;  4JNN A;  3CQZ J;  2JA7 J;  2M34 A;  3OIO A;  1H8A C;  3HOV J;  1UI5 A;  5HBU A;  5FMP A;  3FKI J;  3WHC A;  3TW6 A;  4MK6 A;  5EDN A;  3OSG A;  2LD5 A;  1X58 A;  1RKW A;  3IH2 A;  4I6Z A;  3GTL J;  3HTJ A;  3HOW J;  4GCK A;  1ETK A;  2XGE A;  5EZH A;  5M5Y J;  2H8R A;  5E3L A;  5FKL A;  5E3O A;  2WV1 A;  3G1M A;  2YUS A;  3RKQ A;  4JX5 A;  5IP7 J;  2YVH A;  5FGL A;  2DG7 A;  4BKX A;  3HDD A;  4BBR J;  3M4O J;  2EZI A;  5K7H A;  2Y0S N;  2QKO A;  2XPV A;  3BG3 A;  4D7M A;  5DTD A;  2NVY J;  5J1R A;  2LP0 A;  5F04 A;  2HXI A;  2DMN A;  3ZQG A;  3Q3S A;  3GTQ J;  3V6G A;  2E19 A;  2JA6 J;  2ME6 A;  3QPS A;  3JR9 A;  2UXH A;  2L9R A;  1GT0 C;  4A69 C;  1P7J A;  4JKZ A;  2RAE A;  1QVU A;  3QQA A;  2OER A;  3HTI A;  5CXG A;  2XSD C;  3BCG A;  2G7S A;  2ZCN A;  4XRS A;  3BJB A;  3PAS A;  1UMQ A;  1DU6 A;  2YVE A;  2LK2 A;  1AKH B;  3G56 A;  3NRG A;  4Y7N J;  2KT0 A;  1APL C;  2ID3 A;  2HQ5 A;  4LOC A;  2PBX A;  3HIM A;  1OFC X;  1X2N A;  2MG4 A;  1MH4 A;  1IG7 A;  3HOY J;  1ZR2 A;  5C4J J;  1XC5 A;  2Y30 A;  1JKR C;  3KNW A;  3NXC A;  3A01 A;  4AYB N;  3S16 J;  1FTZ A;  5GP9 A;  2COB A;  1F36 A;  1MBG A;  3BT9 A;  2L7M P;  2ELK A;  3UKG A;  3HTH A;  3K2A A;  3S1R J;  3GTK J;  3JSJ A;  3C2B A;  5C44 J;  5JLW A;  4A3I J;  3LJL A;  2FX0 A;  2R92 J;  2AHQ A;  1ZTR A;  3GTJ J;  1MNM C;  3DPJ A;  5F0C A;  4IHY A;  3RZO J;  2DA3 A;  2EBI A;  2K9Q A;  3CCY A;  3CMY A;  2QCO A;  1PUF B;  1IC8 A;  1MBJ A;  1MSF C;  4XRM A;  3B81 A;  4BXX J;  1E3O C;  2ZOY A;  3GEU A;  4C2M J;  3IH4 A;  1U9N A;  2WGB A;  3BR1 A;  2NOG A;  1WH5 A;  2XPU A;  2R5Y B;  2CQQ A;  3CRJ A;  3D1N I;  3PO3 J;  3EUP A;  2PMZ N;  3JRI A;  3VVZ A;  4D5F A;  1OJL A;  1WCM J;  2LTP A;  4FE4 A;  1IRZ A;  2EZH A;  2D5V A;  2CQX A;  3JRA A;  1FTT A;  2OPT A;  4A3C J;  4BBS J;  2RHA A;  2DA5 A;  1X2M A;  3WHB A;  4A3G J;  2Y31 A;  3B6C A;  4QSH A;  3RD3 A;  2K9S A;  3LHQ A;  1S7E A;  3GZI A;  5M3F J;  2O9L A;  4HNV A;  3JRD A;  4DYR A;  4XID A;  2E2H J;  3NI7 A;  3BR5 A;  5J3L A;  1SFO J;  2E1O A;  4FCY A;  1ZGW A;  1OCT C;  3NPI A;  3G7R A;  2HOS A;  2B63 J;  1BJZ A;  1IJW C;  3BQZ A;  2HI3 A;  1JUP A;  2EZK A;  5C4Y A;  1G2H A;  1MBH A;  2VI6 A;  5EYR A;  3ZQF A;  2G7G A;  4A3B J;  4ABZ A;  3Q0V A;  1QRY A;  3EGQ A;  1ETQ A;  3JRH A;  1FEX A;  2QTQ A;  4A93 J;  4D5C A;  4NEL A;  1RR7 A;  1RET A;  2JK3 A;  2ZCX A;  2Y9Y A;  2F07 A;  3BR2 A;  1JT6 A;  1PUF A;  2NS8 A;  3M3Y J;  4HKU A;  2AO9 A;  3QPL A;  1FIP A;  2L7F P;  5FJ8 J;  2ME0 A;  1JJ8 C;  3JRF A;  4XIC A;  2CU7 A;  3ZOB A;  3BG9 A;  4B3A A;  2DA6 A;  4I76 A;  3HOU J;  1JKP C;  1DU0 A;  2QF7 A;  2DTZ A;  1OCP A;  3I4M J;  2O7T A;  3KKD A;  2MGQ A;  3VIB A;  3LNQ A;  1SAN A;  2DA4 A;  1T56 A;  3G1L A;  3A01 B;  1W0T A;  2E2I J;  4V2F A; 
#chains in the Genus database with same CATH topology
 2E5N A;  2B7E A;  2XGX A;  4HQM A;  4AC6 A;  1UZC A;  1D0Y A;  2IVM A;  4GGG A;  4B09 A;  2B1E A;  4XLE A;  2AXT C;  4YZE A;  3DBR B;  1N75 A;  4HG2 A;  5B66 C;  3VVY A;  1LVK A;  3BTL A;  3LWJ A;  2ZXH A;  3FM3 A;  2R7U A;  5JR3 A;  4M3E A;  1SVL A;  4HNT A;  4C2M A;  4R1H A;  1WH7 A;  5LGT A;  2X6O A;  1KQ0 A;  2IA1 A;  2JSC A;  1LDD A;  2XAF A;  3DLA A;  4KIC A;  2G7L A;  2YU3 A;  1IN6 A;  3O60 A;  1NTC A;  2PN6 A;  4XM3 A;  3Q9S A;  2Q24 A;  3GLX A;  5CXI A;  3LST A;  4BQA A;  2DA7 A;  1MJ9 A;  3KP3 A;  3JRC A;  1XPX A;  4ZTF A;  3VUQ A;  2GEN A;  1GHC A;  1BW6 A;  3TO9 A;  3F8C A;  1G3S A;  2DI3 A;  2FNA A;  3RIR A;  4DZJ A;  4CUG A;  4RM2 A;  4AM3 A;  3K4B A;  5E79 C;  5IOZ A;  2DG8 A;  2A6H F;  2VOD A;  4B44 A;  2NS7 A;  3C1D A;  2DT7 B;  4AVZ A;  1XS9 A;  3WTW C;  3DPU A;  3S17 J;  1ZQ3 P;  2LG4 A;  1E0E A;  3H5A A;  1D5Y A;  4IHT A;  5F0H A;  3WGG A;  2RGV A;  1SAU A;  2KJC A;  1OQY A;  1TW2 A;  1ON2 A;  3ERE D;  1U8B A;  3VW0 A;  2B0L A;  4F93 B;  3QPH A;  4AD9 A;  5D4R A;  2KQR A;  4ICH A;  2RAS A;  4ETS A;  4O5V A;  4X1E A;  2NVX J;  3W6J B;  4ZTJ A;  2ZY9 A;  2OTL I;  2STW A;  3HC7 A;  4OAY A;  3FIW A;  4DQ2 A;  1HLV A;  4RDU A;  5E8G A;  1A5J A;  5EEH A;  1IV8 A;  3LSK A;  1JTX A;  2FNP A;  4MNU A;  3CO7 C;  1RR8 C;  1VQ7 I;  2H1K A;  1S3J A;  4GFB A;  3ML6 A;  3M8F A;  1ETW A;  3FXK A;  5LEJ A;  2CJJ A;  2UXI A;  2CV2 A;  2XAJ A;  3OIQ A;  3QKX A;  2HXO A;  1DP3 A;  3S3O A;  1A04 A;  4YII A;  3ANG A;  3JRE A;  2JWT A;  1Y39 A;  4L5E A;  2ZFU A;  3BR6 A;  2JA5 J;  4XK4 A;  4XOP A;  1BM9 A;  1WJD A;  1ZAO A;  5IOY A;  2EIN H;  3T5X A;  1Z21 A;  2GM4 A;  2LFB A;  2V1D A;  4N9H A;  5GAD J;  2WAF A;  2ESH A;  5FLM J;  1PUE E;  4HRI A;  1BA5 A;  1RIO H;  3ZMS A;  5LHG A;  3H5N A;  4E7S A;  2H6B A;  1GLN A;  2WC2 A;  3FRQ A;  5J8F A;  3FKJ A;  3K69 A;  2VUM J;  3SEQ A;  4BAY A;  4HA8 A;  1A36 A;  1UHS A;  4MFE A;  2EB7 A;  3BRO A;  4GFL A;  1ZYR F;  4EVI A;  3B73 A;  4IRV A;  5L3G A;  4G6Q A;  1K6O A;  1I6X A;  3QP5 A;  5LHH A;  2OI8 A;  3OL3 A;  2BHZ A;  4BH9 A;  4BXU A;  1IXC A;  3BLY A;  5E1Z B;  3F22 A;  2WA0 A;  5AIP A;  2R5Y A;  4ON0 A;  1V4R A;  4L62 A;  1VND A;  2NP3 A;  4A3F J;  2XAU A;  2P7C B;  4A3E J;  2V6E A;  3K10 A;  5FHP A;  5J40 A;  2QWT A;  1B8I B;  3PO2 J;  5B1B H;  1MMA A;  4BS9 A;  5HOO A;  4EGZ A;  1IRF A;  2CQ7 A;  2GUH A;  2IGN A;  2PBI A;  4LMY A;  1U5T B;  2VOP A;  4V2G A;  1I50 J;  1SVO A;  2ZME C;  1BW5 A;  2EFQ A;  4PJN A;  1Y1W J;  2FQ4 A;  4H4K C;  4BJT A;  1R49 A;  2EWN A;  4A3D J;  5F1J A;  4CXF A;  2HVS A;  5IYD J;  1R5I D;  2V1X A;  2ECB A;  2KPM A;  2Q2E B;  4UUS B;  2UXU A;  2X51 A;  1T08 B;  3P7N A;  4A5M A;  1FZP B;  1BL0 A;  5DAJ A;  2J5O A;  4A3K J;  3PPB A;  3IWF A;  3H9G A;  3I58 A;  3K4N A;  5J47 A;  1JTY A;  2X9D A;  4B1R A;  2NVQ J;  1H0M A;  3CWR A;  5D18 A;  4G8X A;  1ZAR A;  3FXJ A;  1DGW Y;  2LOO A;  1JGG A;  3CUQ C;  2BY2 A;  3M9A A;  2JJ7 A;  2NYX A;  4L5J A;  4XLA A;  1T38 A;  5HNF A;  3T8T A;  4JL3 A;  1KU9 A;  2MLG A;  1I3Q J;  1X1C A;  3EUH A;  4PDK A;  3SDG A;  2HR3 A;  3T0Y A;  1LEB A;  4MXM A;  2MA3 A;  1WWX A;  1ORK A;  3J7Y J;  2DDA A;  2FJI 1;  3CUO A;  3WE2 A;  4NC6 A;  4CIC A;  4IHW A;  1S6L A;  4O3M A;  5LRS A;  1EH8 A;  1I5Z A;  4OOI A;  3OYC A;  2ZJ2 A;  1CQT A;  5DS9 A;  4EJV A;  4G12 A;  4ZYG A;  3GVA A;  4G7H F;  3HOZ J;  3WG7 H;  3FXQ A;  1IXR C;  4EJT A;  2HKU A;  1FYM A;  2QBY A;  4XRS G;  2OD5 A;  3O3K A;  4JQF A;  1G3Y A;  2DPD A;  2NNY A;  4XNF A;  2TCT A;  2W48 A;  2DXI A;  2M7A A;  3HXL A;  1IV6 A;  2BE5 F;  2A6T A;  2HVQ A;  4HF2 A;  1UI6 A;  1F9N A;  1YS6 A;  2Y69 H;  2QM3 A;  1X19 A;  3T8R A;  3LAJ A;  3NS4 A;  4PCQ A;  4IF4 A;  1JJ6 C;  1IRG A;  2IP2 A;  3HBL A;  5AQC A;  2VN2 A;  3KP6 A;  2XHK A;  2P7V B;  4RLF A;  2JQ7 A;  3A4C A;  3GTO J;  1IDZ A;  2F5E A;  2VKV A;  3RYP A;  1ETO A;  3TW7 A;  3KYL A;  1MZB A;  3MZH A;  4HSR A;  4UHT A;  2FBH A;  2K86 A;  5GAE J;  3S1N J;  2DN0 A;  3K4J A;  3J7A Y;  4M72 A;  1R23 A;  5FKN A;  5EGO B;  4ZC3 A;  5EGO A;  1UFM A;  2IGK A;  3CJN A;  3WGI A;  3CCM I;  4AC0 A;  2EIL H;  2ZCW A;  1NK3 P;  1B72 B;  3RYR A;  3CDH A;  3V78 A;  3RKW A;  1ETX A;  3A03 A;  3V7C A;  2HDW A;  2XDN A;  3W6K B;  5FKM A;  3R60 A;  3BZK A;  2IEK A;  2PI0 A;  2FU4 A;  3CCJ I;  1T39 A;  3LA3 A;  4UV9 A;  3I0T A;  4IXA A;  4IRG A;  2Y9Z A;  1UST A;  3I71 A;  1NK2 P;  1WI3 A;  2Z5U A;  3VYS B;  3OYK A;  2A3S A;  1V5G A;  1R58 A;  2CFX A;  2NVU B;  1N77 A;  3CDL A;  3PSF A;  1ZKG A;  2MC3 A;  4CDG A;  2LLK A;  5JLX A;  3C07 A;  3G3Z A;  2L4A A;  3ZQI A;  3BR0 A;  1EKE A;  3FHZ A;  3TGN A;  4ENM A;  5FFX A;  3S1Q J;  1SFK A;  3ZQC A;  1HW2 A;  1ITY A;  5CKT A;  2DJI A;  3U1D A;  5F0F A;  5EEA A;  4E7I A;  2ZCM A;  4PJJ A;  1H9G A;  1KU2 A;  3SJM A;  4EJU A;  2XAH A;  2M2E A;  4XON A;  1B8I A;  2ZXW H;  5GTH C;  2EIJ H;  2IS4 A;  3CQZ J;  2E34 A;  2JA7 J;  3A0H C;  2VJI A;  1H8A C;  2BW3 A;  1VTN C;  2L9N A;  5HBU A;  3WHC A;  3PQK A;  1Y0N A;  4EV0 A;  4MK6 A;  2DFI A;  5EDN A;  2GOX B;  1I39 A;  1ZLJ A;  1TZL A;  3GFL A;  1Z67 A;  5M5Y J;  2H8R A;  5HLG A;  5E3O A;  1QGP A;  5JHU A;  3I3L A;  2YUS A;  1L3L A;  1VQ4 I;  1HW5 A;  2Q1Z B;  1E2X A;  5FGL A;  3M07 A;  3HDD A;  4K2E A;  3QYE A;  1SFX A;  3ZRG A;  5K7H A;  2Y0S N;  1MMD A;  2FXA A;  2DFF A;  2X1C A;  2P4W A;  3B02 A;  1D5V A;  2VXD A;  2ZKZ A;  3OYL A;  1LQ1 A;  2ISY A;  4GYI A;  1XSD A;  5FD6 A;  2EFN A;  2HZT A;  4C2T A;  2TDX A;  2E19 A;  5E20 A;  2CFO A;  1XCB A;  1LDJ A;  2UXH A;  4BDY A;  4II2 A;  2BZT A;  1HQC A;  3DU5 A;  3K70 D;  2Y0S A;  3DBL B;  1P7J A;  5HS9 A;  1GT0 C;  1KYW A;  4BYY A;  1S29 A;  2HYF A;  1FOX A;  2GOM A;  1UG0 A;  1QVU A;  4JK1 X;  3HTI A;  4KT6 A;  4KIF A;  5ICF A;  3CF5 F;  4Y4R A;  1R4N B;  4XRS A;  3PAS A;  1UMQ A;  3DKX A;  2LK2 A;  2H8W A;  2CUJ A;  4I02 A;  2HQ5 A;  5AON A;  1R00 A;  2PBX A;  3HIM A;  2M0M A;  4GRI A;  1X2N A;  4RB0 A;  2W57 A;  3I59 B;  2W84 A;  2R7R A;  2L9V A;  3HHH A;  1JKR C;  2XIG A;  3KNW A;  1JHF A;  3OYD A;  3BT9 A;  1MBG A;  1FOW A;  2L7M P;  2X0L A;  3A1Y A;  3FF5 A;  2EA4 A;  2W24 A;  5KVR A;  2VBZ A;  4PGH A;  1WJE A;  1U8R A;  3C2B A;  3GTK J;  5D4S A;  5C44 J;  2YSR A;  2VJ5 A;  3KLN A;  4OIO F;  1A31 A;  2R92 J;  2AHQ A;  2JTV A;  5HNH A;  1VQM I;  2FF4 A;  3BG6 A;  2QKL B;  5CLS A;  1PDN C;  3RZO J;  2DA3 A;  2QCO A;  5BS6 A;  4A5N A;  1TBX A;  2IGO A;  5FB2 A;  4M6X A;  4XRM A;  1IC8 A;  1MSF C;  2A5Y B;  4Y33 A;  2F6C A;  3AL0 B;  4BXX J;  1P6R A;  2GIV A;  1U9N A;  2GA1 A;  3E3V A;  3WTZ A;  1IN8 A;  3H5R A;  2NOG A;  2V79 A;  2F4I A;  2MH9 A;  1XGM A;  3PO3 J;  2PMZ N;  4LK1 F;  1WCM J;  1YE9 A;  1FMW A;  5IT9 Z;  3V8K A;  3H0D A;  4KIG A;  5TGT A;  2FE3 A;  4DBQ A;  2BOL A;  3HPG A;  1Y8Q B;  3KEY A;  4BEH A;  3JRA A;  1K6Y A;  1LVA A;  4BBS J;  1K7A A;  3G6E I;  3QU3 A;  1IN5 A;  4CZZ A;  4AYB A;  4A3G J;  3B6C A;  2MC4 A;  4HPQ A;  2V9K A;  4CCJ A;  4PSW A;  2ICW G;  2DT6 A;  4KMF A;  1BI1 A;  4XID A;  3BR5 A;  5J3L A;  1SFO J;  2E1O A;  1E3P A;  5DD4 A;  3MCZ A;  1ZH5 A;  3HSF A;  3BZC A;  2B63 J;  3BQZ A;  2HI3 A;  2O3F A;  3J7A O;  2CW7 A;  3DFG A;  4M9X A;  2E7W A;  4XLP F;  2W1O A;  2HDC A;  1G2H A;  5EYR A;  4ABZ A;  3Q0V A;  4D0P A;  1WQ2 A;  4GDF A;  3I64 A;  3JRH A;  1FBS A;  4HZF A;  1TTY A;  2HWV A;  2ZCX A;  3ZPL A;  2HFH A;  1NH3 A;  4ZDP A;  4XKB A;  1ODD A;  3BR2 A;  1JT6 A;  1XDS A;  1PUF A;  5GTI C;  2DYR H;  2L7F P;  4RAY A;  3M8J A;  3CC4 I;  2PMU A;  2FUG 2;  5K5O A;  4BXF A;  1QHH D;  4UVB A;  2QF7 A;  3WOD F;  1JKP C;  2ZSH B;  4HOB A;  4P96 A;  4ITV A;  1D0Z A;  2AXL A;  5A2Q K;  2AQE A;  1HST A;  2HOE A;  2DA4 A;  2K9M A;  4LG0 A;  3H35 A;  3G1L A;  3KIO A;  2QQ9 A;  3BG7 A;  3FXO A;  3A01 B;  1BOA A;  1X1D A;  4IHS A;  2WAQ A;  2DYS H;  4HLY A;  3I4N J;  1FC3 A;  2F5C A;  4KN7 X;  4Z6Y A;  2R5Z A;  3HEF A;  2A07 F;  1R6R A;  1TWC J;  3HOT A;  1XSV A;  2Z2S B;  1JUS A;  1YJN I;  1U5T C;  3F21 A;  4M3D A;  1Z0X A;  3UR3 C;  2D1V A;  2KRH A;  4HLX A;  4NBQ A;  2KP6 A;  1LDK B;  4LLN A;  1MBE A;  3CP2 A;  3IRQ A;  3BQY A;  4IZZ A;  3TO6 A;  3GX4 X;  4LJZ F;  4O6J A;  2KDO A;  4NC7 A;  1IAW A;  5DD8 A;  2IJL A;  1XCV A;  4EQQ A;  2DU9 A;  3L1P A;  5D5W B;  2COM A;  2XVC A;  3KPH A;  1ZGA A;  1ETY A;  4XSZ F;  1U9O A;  5E17 F;  3E0J B;  3LOC A;  4KFC A;  4KMU X;  2E35 A;  1ENH A;  3DWL E;  5FLX K;  1TLH B;  2OAZ A;  2JN6 A;  4Q4Z F;  2O8K A;  5KK1 A;  5J1Y A;  5FLV A;  1EV7 A;  1FOY A;  2OF7 A;  4JX4 A;  2O5R A;  2GZW A;  3FXL A;  2BW3 B;  5CVV A;  4BNC A;  1WI9 A;  5D1R A;  5J6X A;  5B3S H;  4KIS A;  4MIM A;  5FD5 A;  3TMO A;  4LB5 A;  3U2R A;  1I1G A;  3AQS A;  2KIQ A;  2ADU A;  3ULQ B;  4UUV A;  1MGT A;  3CUQ B;  2STT A;  1I27 A;  3CCV I;  1H89 C;  4PJM A;  4RM3 A;  2FRH A;  2V57 A;  1CF7 A;  3NNR A;  1LNW A;  1AOY A;  4A3J J;  4XSX F;  5IYC J;  2HKX A;  3DEU A;  2EQR A;  4NNJ A;  3FBN B;  2DJN A;  3AG4 H;  4YG2 F;  3VPR A;  3DLL F;  4JP0 A;  2PEX A;  3DEW A;  4DW6 A;  1GVD A;  2GFN A;  3HYI A;  1MND A;  3HE0 A;  3DTE A;  3LSR A;  9ANT A;  3EYI A;  1YQA A;  1ZGJ A;  1VQ6 I;  3S2H J;  3KLO A;  2H94 A;  2L7Z A;  1D1A A;  4B3X A;  2OA4 A;  2JRM A;  1HKT A;  2V9P A;  1BBY A;  2V1N A;  2BY0 A;  2BXZ A;  2OC6 A;  4S0H B;  1GV2 A;  4Q48 A;  2HS5 A;  4XN0 A;  4CSW A;  5HOD A;  4EAT A;  2R7Z J;  4IEJ A;  3KZ9 A;  2NNN A;  1XTA A;  2JUC A;  2W4S A;  4YIF A;  4XRF A;  1W0U A;  2NX4 A;  1ZRD A;  4IO9 F;  3Q9V A;  1VQ9 I;  3ISP A;  4E70 A;  1MIJ A;  3ASN H;  1FNN A;  5HS7 A;  4C30 A;  5DM6 F;  3ZP5 A;  5ED4 A;  5E8I A;  1D1B A;  1W7P B;  2BY3 A;  3EYY A;  2OQR A;  1N25 A;  2VKE A;  3VDX A;  1POG A;  1XGN A;  3K8P C;  1DGR M;  3A2K A;  3I53 A;  3TDU C;  4FHT A;  3AAF A;  1T8I A;  2UXP A;  2V6C A;  3M1C A;  4PZJ A;  3G1O A;  5C4X J;  4WXH A;  2HGC A;  2VB6 A;  2K4J A;  5E1X A;  2VBY A;  4B47 A;  4OIQ F;  1AHD P;  2H09 A;  3MZY A;  3OY9 A;  1TT0 A;  3OOP A;  4L0Z B;  3A02 A;  1GV5 A;  4FQG A;  2EIK H;  1JT0 A;  4G6T B;  3SHF A;  2OUM A;  3MD2 A;  1Y8R B;  2F5F A;  3HRU A;  1LB2 A;  3MKL A;  1ZRC A;  4BEH B;  2DMT A;  1T33 A;  1GVJ A;  3HRS A;  2ELH A;  2LF8 A;  4QWQ A;  1IGN A;  3K4C A;  2G0E A;  3QOE A;  3QYF A;  3TOA A;  4G94 A;  3W2V A;  4DYQ A;  3V7R A;  4F3Q A;  3E5X A;  3H9J A;  1K61 A;  3DP7 A;  2REK A;  4ACI A;  3V8L A;  1F5T A;  4HF0 A;  3T1B A;  5C3E J;  3PFI A;  1DP7 P;  3E1S A;  3HGY A;  4EJW A;  4QIW N;  2Z9O A;  5D8L B;  5IPA A;  2EV6 A;  4HDV A;  1HF0 A;  3IWZ A;  3VEP A;  2KRC A;  4PJL A;  3OS2 A;  2VE8 A;  3OYF A;  1AA7 A;  3GW2 A;  3H92 A;  2D45 A;  2M3A A;  3ZQL A;  1LUJ B;  2ZME A;  2WTE A;  5K1Y A;  1QVT A;  3QRF F;  4Z2Y A;  1R1U A;  3HKZ N;  1KZH A;  2F5V A;  3HTU A;  4D7N A;  2V9V A;  5BNG A;  2CGP A;  3C2G A;  3ZMU A;  5KHD A;  2B3W A;  2ZOZ A;  3E7L A;  1STZ A;  1J2X A;  3GWZ A;  2R4G A;  1J9I A;  2XGD A;  3PM1 A;  3PL8 A;  4CCN A;  4EM0 B;  2IAI A;  4FX0 A;  1Q1V A;  4M3F A;  2VJ4 A;  1W36 D;  2M87 A;  1LPQ A;  3GO5 A;  1MKM A;  2XRN A;  3F0C A;  3F72 A;  3AQT A;  3KFW X;  1IO2 A;  1FX7 A;  4UB6 C;  2VPL A;  2EH3 A;  4J19 A;  3CUQ A;  3IKT A;  3CCE I;  3SWH A;  4BE2 A;  4F7Z A;  4XOT A;  2WB1 N;  2XUB A;  3MQ0 A;  2JA8 J;  4X6A J;  3HB9 A;  4D9J A;  1Z91 A;  5D6F A;  5LLQ A;  2FOW A;  2K27 A;  2QQ8 A;  3CD6 I;  1J09 A;  5B5E C;  2G3B A;  4WCG A;  3BJA A;  3IP4 B;  1V5E A;  3GZN B;  5DUI A;  4M3B A;  1V54 H;  1JUM A;  3HRM A;  3HOX J;  3F8M A;  3Q0W A;  3SFI A;  2P5K A;  4GCT A;  4DBR A;  3ON2 A;  4KUM A;  4M9Z A;  1TWG J;  4BAC A;  2WY8 Q;  2O6G E;  2L01 A;  2LR8 A;  2CUF A;  4IOA F;  4BU2 A;  3LSG A;  3F8B A;  1YIJ I;  2XB5 A;  1RES A;  1P4X A;  1KU3 A;  2ZBK A;  2LRD A;  1RZ4 A;  3K4K A;  4E7L A;  1VQL I;  5H9T A;  1ZLK A;  3SEZ A;  2DA1 A;  3Q5F A;  4I01 A;  4OIP F;  4WK8 F;  1OKR A;  4LGW A;  5IP6 A;  1D0X A;  3K4L A;  2QEX I;  3RI4 A;  4MEX F;  4CCL A;  2KIF A;  2K5C A;  1HSJ A;  1XD7 A;  3FDY A;  3LSJ A;  4MFD A;  4XLN F;  5M3M J;  3R0J A;  4CGR A;  1SD6 A;  3OYB A;  2F4O B;  4IKF A;  1HC8 A;  3DBH B;  3W2W A;  3F23 A;  1BI0 A;  2OU2 A;  2P6T A;  3JTH A;  2HQA A;  2VT3 A;  3KP7 A;  1USS A;  2VE9 A;  4RBO A;  2O61 A;  1X1A A;  5F27 A;  3HTS B;  2W00 A;  4PXI A;  2OTJ I;  2A05 A;  3BRU A;  4OD5 A;  3S5R A;  3HZJ A;  2E60 A;  4RLQ A;  2E5Z A;  5LGU A;  3LQQ A;  2VQC A;  4JX6 A;  2XKO A;  1W5T A;  1HDP A;  3KCC A;  3W2A A;  2XDV A;  3ABT A;  3OIO A;  4U0W A;  4IL6 C;  3HOV J;  4ZYE A;  5FMP A;  1X1B A;  3OV8 A;  2P8T A;  3P5J A;  2LC2 A;  4RAF A;  3GUD A;  5ILS A;  3TW6 A;  2XAQ A;  3PNY A;  3OSG A;  2D1H A;  2LD5 A;  1X58 A;  1RRJ A;  3K4M A;  2M8E A;  5EZH A;  3WTU C;  3IL2 A;  5E3L A;  1Z3Y A;  2LY1 A;  3KEO A;  2KMU A;  2LYC A;  1Z7L A;  2HNH A;  2WV1 A;  4F92 B;  1QPM A;  1XGS A;  2QBY B;  2WWY A;  2DG7 A;  4V19 K;  3ZXS A;  2A61 A;  4BKX A;  2EZI A;  4P9U A;  3EUA A;  2QKO A;  4JOM A;  5CVU A;  2LP0 A;  4NQW B;  2DMN A;  5HDG A;  2KKO A;  2P5L C;  1TNS A;  2X6Y A;  2JA6 J;  1EJ9 A;  2IA0 A;  4RS8 A;  3LSH A;  4NHJ A;  1YIT I;  3JSP A;  3R4K A;  4HAM A;  1XSX A;  1J7K A;  2RAE A;  2OER A;  1W1W E;  5DYM A;  5KNL A;  3BP8 A;  2XSD C;  2XRO A;  2JVH A;  3M7G A;  2RC4 A;  1X3Z B;  1SFU A;  1DPR A;  1DU6 A;  1Z6T A;  2IS6 A;  3HG9 A;  3PQJ A;  1AKH B;  3G56 A;  2E1M B;  1Y56 A;  2WAE A;  2Z3Y A;  2R7S A;  2ID3 A;  2V4J C;  2PJR B;  1OFC X;  2MG4 A;  3E6B A;  1UB9 A;  1U2W A;  1MH4 A;  5GAH J;  1IG7 A;  1ZR2 A;  2LF7 A;  5C4J J;  2Y30 A;  4L9N A;  5JVT A;  3W3C A;  4GXO A;  4YFN F;  1YTY A;  1JE8 A;  1F36 A;  1P92 A;  2Y48 A;  3CC7 I;  2CSO A;  5H20 A;  3K2A A;  1OR7 C;  3WU2 C;  3HTH A;  1KYZ A;  3JSJ A;  4JBA A;  2JUG A;  2FX0 A;  2XF6 A;  3GTJ J;  2BV6 A;  3ZMD A;  3E97 A;  1MNM C;  3DPJ A;  5F0C A;  1U5T A;  3V7S A;  4HDU A;  4XKC A;  2R7W A;  5BOX A;  2PJR A;  3DPT A;  2K9Q A;  3CCY A;  4A2U A;  4ZYH A;  1VQN I;  1WKM A;  3K2Z A;  2ZOY A;  3GEU A;  1MJB A;  4C2M J;  2QKM B;  2NRA C;  1SFE A;  4FX4 A;  4L9T A;  2XPU A;  2R5Y B;  3CRJ A;  4RAZ A;  3OMY A;  3EUP A;  4OMY A;  3L00 A;  5B1A H;  5D6E A;  4LD5 A;  4DJA A;  5KAI C;  2PMH A;  2RNG A;  4IPA A;  5F64 A;  2CS3 A;  2RHA A;  4PFO A;  1X2M A;  2DQR A;  4BHC A;  2DLL A;  3RD3 A;  3BY6 A;  3VB2 A;  3ABK H;  2VON A;  3GZI A;  2O9L A;  3HJE A;  2E2H J;  5F1R A;  3NI7 A;  1TQM A;  2M7B A;  4HF1 A;  2FSW A;  3DV8 A;  3GCM A;  4F52 A;  2NXN B;  3F6V A;  2ZJR F;  1BJZ A;  1OYI A;  3JAM Z;  4U9N A;  1ZRE A;  2G7G A;  4U0Y A;  4A3B J;  3CCL I;  4LIU A;  3HKZ A;  4BHP A;  1ETQ A;  1FEX A;  4A93 J;  1MW7 A;  4WXC A;  4A0Z A;  3EDP A;  1RR7 A;  1RET A;  5CPR B;  3OYA A;  3CMM A;  2CH0 A;  2Y9Y A;  1FY7 A;  1YJ9 I;  1OYY A;  2FML A;  2NS8 A;  1K4T A;  2BXY A;  1XMK A;  1A6Q A;  1JJ8 C;  2CU7 A;  5JVG F;  4B3A A;  2HPI A;  4I76 A;  3RTR A;  1QU3 A;  1DU0 A;  4QPO A;  2W25 A;  3KZZ A;  3WTS C;  1QHG A;  3KYC B;  3FHN A;  1YFH A;  4C9Y A;  3I4M J;  3F8N A;  2Q8K A;  1F4K A;  4V2F A;  1YX5 A;  2ISZ A;  2LRE A;  5CVI A;  1BI3 A;  4ZH4 F;  5L3B A;  3ABM H;  2Z33 A;  4CYD A;  3IC7 A;  2DBB A;  3FZV A;  1WJF A;  4NN1 A;  3RDI A;  2HYT A;  3K9T A;  1LEA A;  2CO5 A;  2YU9 J;  5H6Q A;  1X4P A;  4L5I A;  3JRB A;  1QZZ A;  2K3F A;  4IX7 A;  4EEF G;  3OYH A;  2M1B A;  3KP2 A;  4DZP A;  4YRV A;  2QSF X;  6PAX A;  1IUF A;  1FP1 D;  2RVC A;  1ZRF A;  3D5S C;  1R36 A;  2AQF A;  3A0B C;  4P1W A;  1B59 A;  2M45 A;  2FMY A;  2VT2 A;  3N97 A;  1LFU P;  1AU7 A;  1TC3 C;  2WUI A;  1EF4 A;  3K70 C;  3ECH A;  4Y17 A;  2VLA A;  2LY2 A;  1JI8 A;  1MD0 A;  3I4P A;  2MSY A;  3OYN A;  1KQ8 A;  4ZZL A;  2Q2E A;  2KZG A;  4UUS A;  3JTG A;  1IF1 A;  2UUZ A;  2BVL A;  3D0S A;  3AG3 H;  4W1U A;  1MSE C;  4RGR A;  2FBI A;  4YIR X;  1MDM B;  4KDP A;  2R7O A;  5BPD A;  3T6N A;  3BC8 A;  3LA2 A;  3MZ8 A;  3CLQ A;  2IA2 A;  3EET A;  2HQN A;  1MMN A;  1OCO H;  2NVT J;  1GDT A;  1RKT A;  3AG1 H;  1KQ9 A;  3WTT C;  4QPQ A;  2A69 F;  1TT5 B;  4J00 A;  1K83 J;  2R5Z B;  4RB1 A;  1T2K A;  2X85 A;  2A5W A;  4IVN A;  5CVJ A;  2ZXI A;  2QIB A;  4GYG A;  1S5L C;  5GAG J;  4D1Q A;  2ZNZ A;  3ECO A;  4P55 A;  1WFX A;  1V55 H;  4QTR A;  1QBJ A;  2W85 A;  3F9K A;  1VQP I;  1I3A A;  3RQ4 A;  1XMX A;  2JPC A;  2VQL A;  4HW0 A;  1Z3X A;  1YIO A;  3BPX A;  3HUG B;  3ERM A;  4PK4 A;  3J7Z I;  3C7J A;  4BL0 B;  5CW8 A;  2WAD A;  3BCA A;  1HDD C;  2GWR A;  1YW7 A;  5K5R A;  2DMQ A;  4DNC A;  5HVQ C;  3VSK A;  2ZJP F;  1G3T A;  1TWF J;  2PLY A;  4C2U A;  2QZ8 A;  3ON4 A;  4G7O F;  4Y13 A;  3ZQQ A;  2JVG A;  3H3V K;  1IUY A;  4MO7 A;  2Y0M A;  3COL A;  1NG6 A;  3JW4 A;  1AKH A;  5LBQ A;  1WJ5 A;  3RQI A;  1D3Y A;  3VVX A;  1Z1D A;  4ME9 A;  4UDS A;  2CUZ A;  3RH2 A;  4BUP A;  4HBL A;  5HDK A;  4P9F A;  1HKQ A;  2QEN A;  1OLT A;  1BIB A;  1D8J A;  2FBQ A;  2QQA A;  5CVR A;  3B6A A;  4CYC A;  1H9T A;  2QSH X;  1O7L A;  2VQG A;  3GEZ A;  2E36 A;  5L3E A;  2LVS A;  3R0A A;  2IBD A;  1MNE A;  4XKW A;  3QOP A;  5ERI A;  3TBI A;  4KNY A;  1WJA A;  2K9N A;  3O2P E;  3AKZ A;  4R8H A;  1HA8 A;  3CME I;  2DMP A;  1ZN2 A;  5K58 A;  1WJC A;  4MQ9 F;  5DM7 F;  1HCR A;  3EQL F;  4ZYA A;  3K6G A;  4BY1 J;  5FKO A;  2JZY A;  4NDL A;  1WSU A;  3ABU A;  3N4M A;  4BGD A;  2ZNY A;  1UJ8 A;  3MAJ A;  4LK0 F;  3V8J A;  2DOA A;  4ZZD A;  2L54 A;  5BPI A;  1W4M A;  3HSE A;  2KLO A;  3NQO A;  3OYG A;  3VOK A;  1EH7 A;  2XB0 X;  4WWC A;  2CW0 F;  2HU9 A;  1BR1 A;  2V7F A;  1JXS A;  4RGS A;  1JGS A;  3DKW A;  5IT9 K;  5FKK A;  1WGX A;  3L09 A;  3R6S A;  5HLI A;  4AF5 A;  5DCF A;  3AFH A;  2K4B A;  2PMZ A;  4R79 A;  5ILU A;  3P9C A;  2HEO A;  2BY1 A;  2IPQ X;  1U78 A;  4UUT A;  1BR2 A;  2DQL A;  1ZEL A;  1PYV A;  1PP7 U;  2Z1D A;  3HL2 A;  3ABL H;  2MAB A;  1LE8 A;  2EA2 A;  4MLO A;  2JPB A;  3GFI A;  4BE1 A;  3HM5 A;  2HYJ A;  2JT1 A;  5K7F A;  5EZG A;  3GTP J;  2UWM A;  1SD4 A;  2WV0 A;  5H6R A;  2Y75 A;  3OR2 C;  1A6I A;  3P9T A;  3L2R A;  1S72 I;  3OYM A;  2VL8 A;  2CQK A;  4HX4 A;  2QQB A;  1TP4 A;  1VQK I;  3J80 Z;  3CCR I;  1L0O C;  5EF6 A;  3BR3 A;  4MTE A;  4YFK F;  1GUU A;  1BIA A;  1IZ1 A;  1DPU A;  2XAG A;  1D1C A;  1SEU A;  1K4S A;  5IP9 J;  2PG4 A;  5HSZ A;  1YYV A;  3PUF A;  1UEL B;  3HTA A;  1CF7 B;  2XF7 A;  3BZ6 A;  2M9H A;  2D6Y A;  4BJ5 C;  2N8G A;  3S1M J;  2Z99 A;  3KKC A;  1FIA A;  2V26 A;  2DFH A;  4XOR A;  2CRG A;  4CZC A;  2HQR A;  1ZR4 A;  2HTS A;  2XPW A;  3H0G J;  3L2W A;  4FIS A;  1BI2 A;  4OIN F;  3COA C;  4H0E A;  2CUE A;  2ACJ A;  3E6C C;  3Q0U A;  4E4H A;  1WRJ A;  2HKO A;  3LSP A;  2MW8 A;  2VIX A;  1REP C;  4BY7 J;  2H27 A;  1F43 A;  4KT5 C;  5J4Y A;  5D5V B;  4LG3 A;  2CW8 A;  5KCM A;  3WTV C;  3P9I A;  2VJJ A;  2JMW A;  5DV5 A;  2J5P A;  4AID A;  5EG0 B;  2LBF A;  2OBP A;  4E7H A;  1FOK A;  2R7X A;  2XF5 A;  3OYE A;  4E6K G;  2Q0O A;  5A2Q Z;  2NS0 A;  3U1K A;  3DTK A;  1VFC A;  1FMV A;  2O03 A;  1R1V A;  4L9J A;  3IUV A;  1SC7 A;  3GXO A;  2CWE A;  4C3H J;  3BJO A;  4AIH A;  3TED A;  4UXN A;  2E2J J;  1GXP A;  4Q47 A;  2EZL A;  4BHB A;  1SMT A;  4AIK A;  4XLC A;  5L3F A;  3LAP A;  1O57 A;  1P7I A;  2BGC A;  2YR2 A;  3FBI B;  5FGM A;  3HUG A;  2BVM A;  3GZ5 A;  3L2U A;  1I6H J;  3HHG A;  2MD0 A;  2L5Q A;  1RPW A;  2ZME B;  3FK6 A;  1O3T A;  5CQE A;  3QU6 A;  4B4C A;  3HOS A;  4KWA A;  4Y3O A;  2K3P A;  4AU7 A;  1FBU A;  1T6S A;  2KL4 A;  3IKV A;  4A6E A;  5GPC A;  2H6C A;  3E5Q A;  1VI0 A;  2QOP A;  4KA4 A;  5M5W J;  1O3Q A;  4KIB A;  3MNL A;  3VP5 A;  3MN2 A;  2JA2 A;  3ZQ7 A;  3TP3 A;  3GLL A;  2KDZ A;  1OPC A;  3ZQH A;  5FLX Z;  2XC7 A;  1OIS A;  3DTI A;  2VC1 A;  3S15 J;  4HST A;  4KN4 X;  2VC0 A;  3RKX A;  4GO1 A;  1BC7 C;  1ZK8 A;  2RV8 A;  2ECC A;  2X48 A;  3FK7 A;  4JNN A;  3SZG A;  1G6N A;  1RI7 A;  2M34 A;  1XN7 A;  3FKI J;  2FBK A;  1NG7 A;  2KZV A;  4N4O B;  5KAF C;  3I54 A;  1R7J A;  4YEL A;  5DCM B;  1J5Y A;  2GA2 A;  3VOE A;  3RKY A;  1RKW A;  1BOB A;  3IH2 A;  4OWR B;  3GTL J;  2DW4 A;  2HPM A;  3S32 A;  1ETK A;  2PX9 A;  3VSL A;  5FKL A;  2W82 A;  1O7F A;  3G1M A;  3RKQ A;  5L3D A;  4JX5 A;  2L2O A;  1O3R A;  2H1L A;  3M4O J;  1PVE A;  4NUB A;  3RCO A;  4D7M A;  2EPF A;  3H36 A;  1Y0U A;  4LLG F;  2OZU A;  2VAS A;  5J1R A;  3FM5 A;  5J4V A;  5F04 A;  2HXI A;  1BJA A;  3CO6 C;  3ZQG A;  3SYT A;  3Q3S A;  4U9L A;  2ME6 A;  3OS1 A;  3KP5 A;  2A2F X;  3JR9 A;  4WF2 A;  2YX7 A;  4TV7 A;  4MQV A;  3F8F A;  5H2F C;  4JKZ A;  4BJ6 C;  5FRM A;  4E7J A;  5JFR A;  1G3W A;  1UHM A;  5CXG A;  2YPR A;  3BCG A;  1TW3 A;  2EK5 A;  4A0Y A;  1QO0 D;  2LDU A;  5HLH A;  3SZP A;  4DVY P;  4Y7N J;  4ZDO A;  2QWW A;  2P5V A;  2KT0 A;  4LOC A;  1B6A A;  3HRT A;  4A6D A;  3BWG A;  4IRI A;  1X4O A;  2KRF A;  4CH7 A;  3OS0 A;  4B48 A;  3HOY J;  1ZHF A;  1FYK A;  1XC5 A;  2IXS A;  1K78 A;  1W7P D;  3NXC A;  1QZE A;  1OCR H;  2IGM A;  1ZG5 A;  4RB3 C;  4AYB N;  3ZR8 X;  2ZO4 A;  5D5U B;  1FTZ A;  3UKG A;  3D5R C;  1HXD A;  2YX4 A;  1U0J A;  1BN5 A;  3S1R J;  1KON A;  3TL4 X;  2F2E A;  3DQV C;  2WY7 Q;  4RGX A;  5E1W A;  5JLW A;  4A3I J;  3L2C A;  1ONV A;  4OMZ A;  2HZD A;  4HX8 A;  4EM1 A;  1ZTR A;  4IOC F;  2VQH A;  2L02 A;  1VQ8 I;  2R7Q A;  2KIS A;  3VTI A;  4KJZ A;  4IHY A;  3G73 A;  4PFP A;  2MLK A;  5ICG A;  2R7F A;  3B81 A;  4UY8 I;  3J81 Z;  1YLF A;  4UB8 C;  3BR1 A;  1G4D A;  1WH5 A;  2QLZ A;  2QGU A;  3EPZ A;  3PSI A;  4U0V A;  3C2H A;  4EJO A;  3JRI A;  4NC8 A;  1XX5 A;  2OZ6 A;  1PJR A;  3J81 K;  4FE4 A;  1IRZ A;  1W36 C;  2ESN A;  2EZH A;  2D5V A;  4XLF A;  2BEO A;  4F55 A;  1RNL A;  2XKP A;  1QNT A;  1UHW A;  4U7D A;  4A3C J;  5ILV A;  2C6Y A;  3ASO H;  1MJA A;  3ZN0 A;  4NB5 A;  4I98 B;  3WHB A;  2IS2 A;  4QSH A;  1S8N A;  1T0F C;  2VBW A;  4ZJZ A;  4N4N B;  1S7E A;  2QVO A;  1FWZ A;  4BQQ A;  3WE3 A;  4HNV A;  2VBX A;  1Z6R A;  3PNT A;  3CJT B;  1U3E M;  4FCY A;  3BOQ A;  2HVR A;  4II3 A;  1OCT C;  1TQP A;  3RPQ A;  2KHM A;  4U88 A;  4HV5 A;  4I0A A;  1FPQ A;  2MYS A;  5FO5 A;  1IJW C;  2QUF A;  3E5U A;  1RUN A;  1JUP A;  2E1C A;  1R4M B;  1MBH A;  2VI6 A;  4Q5S F;  2B9S A;  2GXA A;  1QRY A;  4DGW B;  3AG2 H;  3EGQ A;  1Z05 A;  2OCE A;  1T95 A;  2CYY A;  2QTQ A;  4U7B A;  3ESW B;  2JK3 A;  5D8K B;  2F07 A;  3IUO A;  3EUH C;  3M3Y J;  4HKU A;  3QPL A;  3PIP F;  3M1E A;  1FIP A;  1FP2 A;  2M4G A;  3TQN A;  2ME0 A;  1G59 A;  3JRF A;  4XIC A;  4QLC U;  1TL8 A;  4AWX B;  2GIZ A;  3PJR A;  2DCE A;  1FLI A;  4OD4 A;  4IQ4 A;  1RUO A;  1ZG1 A;  3FMR A;  5LD2 C;  3NRV A;  2FOK A;  3RPU D;  2R7D A;  4EMS A;  2O7T A;  2MGQ A;  4PGG A;  1XMA A;  3VYU B;  3LNQ A;  1YHQ I;  1SAN A;  1W0T A;  5HLT A;  4KYW A;  1FSE A;  2EIM H;  5HDN A;  3VYT B;  1VZ0 A;  5K7Z A;  3FIS A;  1A35 A;  2EJR A;  4GFK A;  3OWT A;  1WJB A;  5ICC A;  4AVP A;  1BC8 C;  5CQG A;  4UVC A;  2MD5 A;  2ZSI B;  3BDD A;  4M6V A;  1WHU A;  2X1D A;  3ZN1 A;  1UG2 A;  2R93 J;  2NP5 A;  4OU0 A;  4G9Y A;  2HOA A;  3CJR B;  5E3N A;  4BDZ A;  1SVM A;  1U6G A;  2M0C A;  2M8G X;  4U87 A;  4FE7 A;  5LEK A;  2VPR A;  1M1E B;  3NWS A;  1CGP A;  3RSN A;  3ZMV A;  3VW2 A;  4FTH A;  2DA2 A;  1R5H A;  4HX7 A;  2F5D A;  3BJ6 A;  4IQJ A;  4CYC B;  2EFP A;  4XKV A;  2E71 A;  1FBQ A;  1Z7U A;  4P5O A;  4IHV A;  2L0K A;  3L2Q A;  1Y1V J;  2LY9 A;  4HQE A;  4UNO A;  1AWC A;  3F3X A;  4M73 A;  4E7K A;  5D5X B;  1YO5 C;  1YRN A;  1X3U A;  2FJ1 A;  4G7Z F;  3WG9 A;  2EFW A;  3BTI A;  1ULY A;  2DOD A;  3RJP A;  5IY5 H;  1MH3 A;  4XN3 A;  2DMU A;  3HIF A;  3IHU A;  3MWM A;  2DTR A;  1VQO I;  3K1M A;  4M3G A;  4JYK A;  5HAW A;  2UXN A;  3WU1 B;  4L0Y B;  4FT8 A;  4YFX F;  5JHF A;  2OCC H;  3G4S I;  2OJE D;  2LH9 A;  2XV4 S;  4UVA A;  5DCM A;  2ZFW A;  4MEY F;  3GME A;  3P9K A;  3S2W A;  2OQG A;  1Z77 A;  2F48 A;  2MFZ A;  2O8X A;  5DDG A;  3CDI A;  4CCK A;  3LFK A;  4RAG A;  3JCU C;  4C3J J;  1P9Q C;  1YRN B;  3VOX A;  5E3M A;  3TDZ C;  5L3C A;  3CCQ I;  3MKZ A;  1N78 A;  3R61 A;  3H9Q A;  1J75 A;  3DKY A;  4I0B A;  3WU0 A;  2CG4 A;  1K79 A;  3OR1 C;  3TP0 A;  2TRT A;  3LMM A;  5LRR A;  1BR4 A;  4S05 A;  2ELJ A;  2R3S A;  1V5F A;  2K40 A;  3IH3 A;  4ENN A;  2LKX A;  3GZ6 A;  3QBM A;  1R1T A;  2IT0 A;  4XQF A;  3DXJ F;  3H1C A;  4LIV A;  3SQN A;  3S8P A;  3IAS 2;  4GCV A;  3SFZ A;  1R5G A;  2P6S A;  1B9M A;  3IV5 A;  1V3F A;  4OAZ A;  2UV1 A;  4KIT B;  1FT9 A;  2HOT A;  1P2F A;  1IW7 F;  3BG5 A;  1IDY A;  3BTJ A;  3NWT A;  3MFK A;  2IS1 A;  3EUK L;  2R7V A;  1R22 A;  5TJJ A;  2M4K A;  5DEQ A;  1H88 C;  2P81 A;  1OR7 A;  3ONQ A;  1KU7 A;  4B43 A;  2ETH A;  3CC2 I;  5M5X J;  3OOU A;  1G8X A;  3FMQ A;  3V42 A;  3QYB A;  2VKH A;  5IYB J;  2VOO A;  1GXQ A;  2DOF A;  3KP4 A;  1UAA A;  3MMY B;  1T0F A;  1S9H A;  2ZC2 A;  1YG2 A;  4MGR A;  5BQT A;  2I10 A;  2LBF B;  3S14 J;  3D5L A;  2I8D A;  3I5U A;  4HNU A;  4MTD A;  1JHH A;  4XR6 A;  2UZK A;  2GQQ A;  2R0Q C;  4W97 A;  1R71 A;  2GXB A;  2JSP A;  3OSF A;  3DF8 A;  4WXD A;  1SMY F;  5FRN A;  4LB6 B;  3VWB A;  4ESB A;  5TIS C;  1ON1 A;  3KZI C;  3CJQ B;  3E6D A;  2DOE A;  1IN7 A;  1O4X A;  1KGS A;  3GBG A;  1XGO A;  3PFY A;  3QPT A;  3MEX A;  1XB4 A;  4L18 B;  4L9V A;  1ZG3 A;  3REO A;  2DT5 A;  1WVR A;  3SDB A;  4CA0 A;  3CES A;  1YI2 I;  4ENK A;  1DDN A;  5GPA A;  1ETV A;  4RB2 C;  1D8K A;  1TWA J;  3CLO A;  5IT3 A;  2ZB9 A;  2I5U A;  2KIU A;  1TWH J;  2W53 A;  3DPL C;  4DIQ A;  1YOV B;  4XMY A;  3LL7 A;  2PQ8 A;  1WPK A;  3N05 A;  3NAU A;  1XG1 A;  2K02 A;  3FX3 A;  1X1P A;  5EJC A;  3VW1 A;  3RZD J;  3CJD A;  2F4M B;  5BMZ A;  2RN7 A;  5D19 A;  4PSX A;  4G6D A;  2KJB A;  1B9N A;  3O8G A;  2X4H A;  3BCB A;  2PFB A;  5LFA A;  3GFJ A;  3PIO F;  1S7O A;  3HGG A;  1LKX A;  3CP8 A;  3QOD A;  4F91 B;  3I59 A;  2QSG X;  4XL9 A;  2LMD A;  1LE8 B;  2X6X A;  3LSM A;  1YW9 A;  3LWF A;  3VOD A;  2GLO A;  4Y52 J;  2YS9 A;  3DU6 A;  1QPI A;  2DPU A;  4IRH A;  3S2D J;  1HOM A;  3O8H A;  5FFZ A;  1SAX A;  5JI6 A;  5EFY A;  4M74 A;  2RKH A;  4ANJ A;  2MBF A;  4M6Y A;  1I1S A;  1Z9C A;  3LA7 A;  4IJA A;  4A3L J;  4WX9 A;  1DQU A;  3LQR A;  4ASN A;  3I56 I;  4RMN A;  3SZT A;  3CCU I;  1MBF A;  3U21 A;  3W6V A;  5F08 A;  1Y6I A;  3PUB A;  3ZCO A;  2RDP A;  4M71 A;  2VKD A;  3I55 I;  3F1B A;  2RRE A;  4HV6 A;  2CQN A;  3OYI A;  3BTC A;  1YX3 A;  2DDB A;  4YEJ A;  5LGN A;  4ENJ A;  2CMP A;  2GAU A;  2KFD A;  3KYD B;  4AUX A;  3E7Q A;  4CCM A;  4HYE A;  3OIP A;  4C3I J;  1MMG A;  1QZY A;  4GCL A;  3DCF A;  5F6F A;  2XRL A;  2PZ9 A;  4A3M J;  3LFU A;  3IAM 2;  2UXO A;  3IRR A;  2G7U A;  2OV7 A;  4DOZ A;  1HW1 A;  3BNI A;  3C3W A;  1SD7 A;  2DK8 A;  1X3W B;  1B72 A;  5J8C A;  1JKQ C;  1OYW A;  1W7P A;  4A12 A;  2HDD A;  3KE2 A;  1TQI A;  4PUS A;  1WZ2 A;  1P4A A;  2QYO A;  3K0L A;  3CMA I;  3CZ6 A;  5ICE A;  1LFB A;  3BHQ A;  2MH2 A;  4ESJ A;  2AS5 F;  5EG0 A;  3GTG J;  2A68 F;  2EV5 A;  3ZMT A;  1E17 A;  1QQI A;  1R9T J;  3S93 A;  3JSO A;  2FEZ A;  4M9S A;  2CV0 A;  1C0W A;  4N9I A;  4RA2 A;  1LFP A;  4EM2 A;  3ROU A;  4IHX A;  2P0W A;  1SD5 A;  3HPH A;  3ELK A;  3WTX C;  2IU5 A;  3CTA A;  3KET A;  3NAR A;  1ACI A;  3LSI A;  5EEG A;  4CO8 A;  1KA8 A;  5J1U A;  5HS8 A;  3C18 A;  3MKY B;  2Y2Z A;  2M30 A;  2K9L A;  1JKO C;  2O7O A;  1VF9 A;  1OCZ H;  2X6W A;  2ID6 A;  5E18 F;  3JRG A;  3GTM J;  2ZJQ F;  2FD5 A;  2NAZ A;  2VXZ A;  4I99 C;  4EGY A;  3ANP A;  4DYC A;  2D2W A;  2IW5 A;  3K7A J;  2WAQ N;  4XLH A;  4PJ0 C;  1P4W A;  1SGM A;  1W5S A;  4A0X A;  2HYG D;  1FJL A;  4I7H A;  1IRX A;  3E6M A;  3FXU A;  2E1M C;  1MBK A;  2GBY A;  2XGC A;  3RPU A;  2G7H A;  4LIT A;  4LG0 B;  4FAS D;  3FMS A;  3MVP A;  2R7T A;  4BE0 A;  2IRF G;  2EV0 A;  2KIM A;  4I09 A;  2UXX A;  4LLL A;  1YW8 A;  1ERD A;  1UI5 A;  2LNB A;  4CCO A;  2ZXJ A;  2GXG A;  2FQ3 A;  1DUX C;  2L7K A;  4I6Z A;  3HTJ A;  3HOW J;  2CV1 A;  4GCK A;  2XGE A;  1IXS B;  1HKS A;  5K5Q A;  2O0Y A;  3NEU A;  3G71 I;  4MHG A;  1UCR A;  4E7Z A;  5IP7 J;  2NOJ B;  2YVH A;  3PNV A;  3JAM K;  5AIQ A;  4BBR J;  2E7X A;  2DK5 A;  2V1U A;  2QA4 I;  2XPV A;  3BG3 A;  4WIB A;  1QA6 A;  2G9W A;  1B4A A;  3GF2 A;  5DTD A;  2NVY J;  5LHI A;  2BYV E;  1S7A A;  3FWE A;  4J01 A;  3GTQ J;  3V6G A;  4ZYD A;  1MMS A;  2DO7 A;  2K85 A;  2XSJ C;  3QPS A;  3WTY C;  1EH6 A;  2L9R A;  3MKW B;  4A69 C;  2LSO A;  1OCC H;  2LKS A;  3QQA A;  4NQW A;  2K7L A;  3S3M A;  1YS7 A;  3CF2 A;  2G7S A;  2WBM A;  3AL0 C;  3VFZ A;  2ZCN A;  3BJB A;  2RNJ A;  2YVE A;  4B8X A;  3NRG A;  3K1P A;  3OL4 A;  4S04 A;  1J59 A;  3KZY A;  5FRO A;  1TNT A;  2JRT A;  3FXR A;  1APL C;  4AIJ A;  2BHY A;  1YJW I;  3L2V A;  4CHU A;  4CGZ A;  2LKP A;  1NHA A;  3G2B A;  1J0R A;  1FYL A;  1F1Z A;  3A01 A;  3S16 J;  3KX2 A;  5GP9 A;  2COB A;  3KEQ A;  3OYJ A;  3CCS I;  1W5C C;  2ELK A;  1IN4 A;  2XAS A;  2EFO A;  4UV8 A;  4HEA 2;  1T98 A;  2RQQ A;  3LJL A;  3H3U A;  5CYV A;  1XDU A;  1RC9 A;  3V4G A;  3VYR B;  1O3S A;  2YVX A;  3DEE A;  4ESF A;  3UNG C;  2EBI A;  3CMY A;  5TRD A;  3ZGK A;  1PUF B;  2PJP A;  1MBJ A;  1HBX G;  3BPV A;  1E3O C;  2DAO A;  2WGB A;  3IH4 A;  2L3D A;  3I9V 2;  2CQQ A;  2HTJ A;  3D1N I;  1VQ5 I;  4X0G A;  5CJ9 A;  4ZDL A;  3VVZ A;  2RQP A;  4D5F A;  1OJL A;  2E1N A;  2LTP A;  3GFM A;  4XBF A;  3L7W A;  4LFU A;  2CQX A;  1MDM A;  1LJ9 A;  4OIR F;  1FTT A;  2M5W A;  2OPT A;  2BBY A;  2DA5 A;  2PFV A;  2Z16 A;  2Y31 A;  1FSH A;  1EA3 A;  3SXY A;  2K9S A;  3HSR A;  3L9F A;  3LHQ A;  2L9S A;  5M3F J;  3JRD A;  2WB1 A;  2X1E A;  4DYR A;  3QWL A;  4RGU A;  4FET A;  3WGH A;  3GYH X;  1ZGW A;  1PP8 F;  3NPI A;  3X2Q H;  3G7R A;  2W7N A;  2HOS A;  3M8E A;  2EZK A;  1B1B A;  1OMI A;  5C4Y A;  4I2O A;  3ZQF A;  2FA5 A;  3H3Z A;  4BQO A;  3U9G A;  3J80 K;  4D5C A;  3F6O A;  3QAH A;  5DUK A;  4NEL A;  3TOB A;  3O6B B;  2AO9 A;  3K1N A;  2L4M A;  2A6E F;  1E3H A;  3TO7 A;  5FJ8 J;  4Y15 A;  3ZOB A;  3S3N A;  3BG9 A;  2DA6 A;  3HOU J;  3FXM A;  3TKY A;  2DFE A;  2DTZ A;  1OCP A;  3QP6 A;  3KKD A;  4N0B A;  3VIB A;  1T56 A;  1K78 B;  2E2I J;  1Q1H A;  3ZMZ A;  4BQN A; 
#chains in the Genus database with same CATH homology
 4AC6 A;  5K7Z A;  3I4N J;  3FIS A;  2R5Z A;  3HEF A;  4GFK A;  4YZE A;  1TWC J;  1JUS A;  3VVY A;  3BTL A;  3LWJ A;  4M3D A;  1Z0X A;  4NN1 A;  4M6V A;  2HYT A;  1UG2 A;  2R93 J;  4M3E A;  5E3N A;  2NP5 A;  2HOA A;  2YU9 J;  2M0C A;  1WH7 A;  2M8G X;  2X6O A;  4FE7 A;  2VPR A;  3JRB A;  1MBE A;  3BQY A;  4EEF G;  2G7L A;  3O60 A;  3VW2 A;  4DZP A;  2DA2 A;  4FTH A;  1NTC A;  1IUF A;  4CYC B;  2Q24 A;  1LFU P;  3L1P A;  1AU7 A;  4IHV A;  5CXI A;  2DA7 A;  2L0K A;  1TC3 C;  1EF4 A;  2WUI A;  3JRC A;  1ETY A;  1U9O A;  1Y1V J;  2LY9 A;  3VUQ A;  2GEN A;  1BW6 A;  3LOC A;  2MSY A;  1ENH A;  1YRN A;  2FJ1 A;  4UUS A;  4DZJ A;  2JN6 A;  2O8K A;  3BTI A;  5IOZ A;  4W1U A;  5J1Y A;  1MSE C;  1MH3 A;  5FLV A;  2DG8 A;  2OF7 A;  4JX4 A;  2DMU A;  2NS7 A;  1XS9 A;  5D1R A;  3S17 J;  1ZQ3 P;  4M3G A;  4MIM A;  4JYK A;  5HAW A;  3T6N A;  1D5Y A;  3AQS A;  5F0H A;  3VW0 A;  1U8B A;  1Z77 A;  2NVT J;  1GDT A;  1RKT A;  1H89 C;  1YRN B;  4C3J J;  2RAS A;  1K83 J;  2R5Z B;  4ICH A;  4X1E A;  2V57 A;  5E3M A;  3VOX A;  2NVX J;  2QIB A;  3NNR A;  3FIW A;  4A3J J;  1HLV A;  4RDU A;  4QTR A;  1A5J A;  5IYC J;  2EQR A;  1JTX A;  2DJN A;  3VPR A;  3TP0 A;  2H1K A;  2TRT A;  4JP0 A;  3DEW A;  4DW6 A;  1GVD A;  2GFN A;  3HE0 A;  4GFB A;  3LSR A;  1ETW A;  9ANT A;  2CJJ A;  2K40 A;  2UXI A;  3IH3 A;  2LKX A;  5CW8 A;  3QKX A;  2HXO A;  1HDD C;  3ANG A;  3QBM A;  3JRE A;  2JWT A;  2DMQ A;  3S2H J;  2L7Z A;  4L5E A;  3BR6 A;  2JA5 J;  4XK4 A;  1TWF J;  3IV5 A;  3ON4 A;  5IOY A;  2GM4 A;  3H3V K;  2LFB A;  4MO7 A;  2HOT A;  3COL A;  4S0H B;  5FLM J;  1BA5 A;  1GV2 A;  3BG5 A;  1IDY A;  3BTJ A;  5HOD A;  1AKH A;  2R7Z J;  3RQI A;  4IEJ A;  3KZ9 A;  3VVX A;  3FRQ A;  1H88 C;  2P81 A;  2VUM J;  4ME9 A;  4UDS A;  3RH2 A;  1W0U A;  2NX4 A;  5M5X J;  3OOU A;  1UHS A;  5IYB J;  4MFE A;  2FBQ A;  4GFL A;  3B6A A;  4CYC A;  2I10 A;  3S14 J;  2LVS A;  2IBD A;  2VKE A;  2OI8 A;  1POG A;  2K9N A;  2R0Q C;  5K58 A;  4W97 A;  2DMP A;  1HCR A;  2UXP A;  3OSF A;  4BY1 J;  5FKO A;  2R5Y A;  4L62 A;  1VND A;  4NDL A;  2NP3 A;  3G1O A;  4A3F J;  5C4X J;  4A3E J;  5FHP A;  2QWT A;  1O4X A;  1B8I B;  3GBG A;  1AHD P;  3PO2 J;  3A02 A;  2GUH A;  1GV5 A;  4V2G A;  1I50 J;  1JT0 A;  1BW5 A;  1Y1W J;  3VOK A;  2FQ4 A;  5GPA A;  1ETV A;  4A3D J;  5F1J A;  1TWA J;  2XB0 X;  3MKL A;  2ZB9 A;  2DMT A;  1T33 A;  5IYD J;  1TWH J;  2W53 A;  2ECB A;  5FKK A;  1WGX A;  4UUS B;  1IGN A;  2UXU A;  2G0E A;  1WPK A;  4AF5 A;  3NAU A;  4DYQ A;  1K61 A;  1BL0 A;  1XG1 A;  5DAJ A;  4A3K J;  3PPB A;  2REK A;  4ACI A;  1U78 A;  4UUT A;  3RZD J;  3VW1 A;  5C3E J;  1JTY A;  2X9D A;  3HGY A;  4B1R A;  2NVQ J;  4QIW N;  3CJD A;  3CWR A;  5D18 A;  5IPA A;  5D19 A;  1LE8 A;  1JGG A;  3O8G A;  4MLO A;  1HF0 A;  2JJ7 A;  3HM5 A;  2HYJ A;  5K7F A;  4JL3 A;  5EZG A;  1I3Q J;  3GTP J;  3HGG A;  3SDG A;  4MXM A;  3ZQL A;  1A6I A;  1LE8 B;  3P9T A;  1QVT A;  1ORK A;  3HKZ N;  2GLO A;  4D7N A;  2YS9 A;  4Y52 J;  5BNG A;  1QPI A;  5EF6 A;  3BR3 A;  4IHW A;  3S2D J;  1HOM A;  3O8H A;  1GUU A;  2ZOZ A;  5EFY A;  3E7L A;  5IP9 J;  2XGD A;  3PM1 A;  5HSZ A;  4A3L J;  2IAI A;  5DS9 A;  1Q1V A;  1CQT A;  4M3F A;  4G12 A;  3HTA A;  3HOZ J;  2M9H A;  2D6Y A;  1MBF A;  2N8G A;  3F0C A;  3W6V A;  3S1M J;  3AQT A;  5F08 A;  2HKU A;  3KKC A;  1FIA A;  2EH3 A;  4XRS G;  4J19 A;  3F1B A;  2CRG A;  3BTC A;  2WB1 N;  1ZR4 A;  2XPW A;  2TCT A;  2W48 A;  3H0G J;  4FIS A;  1IV6 A;  2JA8 J;  3HB9 A;  4X6A J;  2CUE A;  4AUX A;  1UI6 A;  3Q0U A;  3E7Q A;  3LSP A;  2MW8 A;  4BY7 J;  4C3I J;  2G3B A;  1JJ6 C;  1F43 A;  3HBL A;  5AQC A;  4GCL A;  3DCF A;  2XRL A;  4M3B A;  2PZ9 A;  4A3M J;  3GTO J;  1JUM A;  1IDZ A;  3HOX J;  2UXO A;  3Q0W A;  3SFI A;  2VKV A;  3BNI A;  3ON2 A;  4GCT A;  2JMW A;  1ETO A;  3TW7 A;  1TWG J;  5EG0 B;  2LR8 A;  2CUF A;  1B72 A;  3S1N J;  2DN0 A;  1JKQ C;  2HDD A;  3LSG A;  5FKN A;  5EGO B;  5EGO A;  2XB5 A;  1VFC A;  1RES A;  1LFB A;  3BHQ A;  4AC0 A;  1NK3 P;  3GTG J;  5EG0 A;  1B72 B;  3IUV A;  3V78 A;  3TED A;  4C3H J;  2E2J J;  5H9T A;  1ETX A;  3A03 A;  2DA1 A;  2XDN A;  1R9T J;  2EZL A;  5FKM A;  5IP6 A;  2IEK A;  1P7I A;  3LSJ A;  4MFD A;  5M3M J;  2Y9Z A;  1I6H J;  4CGR A;  4IHX A;  1NK2 P;  1WI3 A;  2IU5 A;  3NAR A;  1RPW A;  3FK6 A;  5J1U A;  4KWA A;  4B4C A;  3CDL A;  1ZKG A;  2Y2Z A;  1JKO C;  2O7O A;  1VF9 A;  3JRG A;  2LLK A;  2ID6 A;  3GTM J;  5JLX A;  3C07 A;  5GPC A;  4RBO A;  2FD5 A;  3ZQI A;  3BR0 A;  3ANP A;  4DYC A;  1VI0 A;  5F27 A;  3K7A J;  2WAQ N;  3S1Q J;  2QOP A;  3ZQC A;  5M5W J;  1SGM A;  4PXI A;  1ITY A;  3BRU A;  3MNL A;  3VP5 A;  1FJL A;  3S5R A;  3MN2 A;  5F0F A;  3TP3 A;  5EEA A;  2KDZ A;  3ZQH A;  2ZCM A;  1MBK A;  2GBY A;  2XGC A;  4JX6 A;  3S15 J;  3SJM A;  2M2E A;  1HDP A;  3MVP A;  1B8I A;  1ZK8 A;  2ECC A;  2X48 A;  3FK7 A;  4JNN A;  3CQZ J;  2JA7 J;  2M34 A;  3OIO A;  1H8A C;  3HOV J;  1UI5 A;  5HBU A;  5FMP A;  3FKI J;  3WHC A;  3TW6 A;  4MK6 A;  5EDN A;  3OSG A;  2LD5 A;  1X58 A;  1RKW A;  3IH2 A;  4I6Z A;  3GTL J;  3HTJ A;  3HOW J;  4GCK A;  1ETK A;  2XGE A;  5EZH A;  5M5Y J;  2H8R A;  5E3L A;  5FKL A;  5E3O A;  2WV1 A;  3G1M A;  2YUS A;  3RKQ A;  4JX5 A;  5IP7 J;  2YVH A;  5FGL A;  2DG7 A;  4BKX A;  3HDD A;  4BBR J;  3M4O J;  2EZI A;  5K7H A;  2Y0S N;  2QKO A;  2XPV A;  3BG3 A;  4D7M A;  5DTD A;  2NVY J;  5J1R A;  2LP0 A;  5F04 A;  2HXI A;  2DMN A;  3ZQG A;  3Q3S A;  3GTQ J;  3V6G A;  2E19 A;  2JA6 J;  2ME6 A;  3QPS A;  3JR9 A;  2UXH A;  2L9R A;  1GT0 C;  4A69 C;  1P7J A;  4JKZ A;  2RAE A;  1QVU A;  3QQA A;  2OER A;  3HTI A;  5CXG A;  2XSD C;  3BCG A;  2G7S A;  2ZCN A;  4XRS A;  3BJB A;  3PAS A;  1UMQ A;  1DU6 A;  2YVE A;  2LK2 A;  1AKH B;  3G56 A;  3NRG A;  4Y7N J;  2KT0 A;  1APL C;  2ID3 A;  2HQ5 A;  4LOC A;  2PBX A;  3HIM A;  1OFC X;  1X2N A;  2MG4 A;  1MH4 A;  1IG7 A;  3HOY J;  1ZR2 A;  5C4J J;  1XC5 A;  2Y30 A;  1JKR C;  3KNW A;  3NXC A;  3A01 A;  4AYB N;  3S16 J;  1FTZ A;  5GP9 A;  2COB A;  1F36 A;  1MBG A;  3BT9 A;  2L7M P;  2ELK A;  3UKG A;  3HTH A;  3K2A A;  3S1R J;  3GTK J;  3JSJ A;  3C2B A;  5C44 J;  5JLW A;  4A3I J;  3LJL A;  2FX0 A;  2R92 J;  2AHQ A;  1ZTR A;  3GTJ J;  1MNM C;  3DPJ A;  5F0C A;  4IHY A;  3RZO J;  2DA3 A;  2EBI A;  2K9Q A;  3CCY A;  3CMY A;  2QCO A;  1PUF B;  1IC8 A;  1MBJ A;  1MSF C;  4XRM A;  3B81 A;  4BXX J;  1E3O C;  2ZOY A;  3GEU A;  4C2M J;  3IH4 A;  1U9N A;  2WGB A;  3BR1 A;  2NOG A;  1WH5 A;  2XPU A;  2R5Y B;  2CQQ A;  3CRJ A;  3D1N I;  3PO3 J;  3EUP A;  2PMZ N;  3JRI A;  3VVZ A;  4D5F A;  1OJL A;  1WCM J;  2LTP A;  4FE4 A;  1IRZ A;  2EZH A;  2D5V A;  2CQX A;  3JRA A;  1FTT A;  2OPT A;  4A3C J;  4BBS J;  2RHA A;  2DA5 A;  1X2M A;  3WHB A;  4A3G J;  2Y31 A;  3B6C A;  4QSH A;  3RD3 A;  2K9S A;  3LHQ A;  1S7E A;  3GZI A;  5M3F J;  2O9L A;  4HNV A;  3JRD A;  4DYR A;  4XID A;  2E2H J;  3NI7 A;  3BR5 A;  5J3L A;  1SFO J;  2E1O A;  4FCY A;  1ZGW A;  1OCT C;  3NPI A;  3G7R A;  2HOS A;  2B63 J;  1BJZ A;  1IJW C;  3BQZ A;  2HI3 A;  1JUP A;  2EZK A;  5C4Y A;  1G2H A;  1MBH A;  2VI6 A;  5EYR A;  3ZQF A;  2G7G A;  4A3B J;  4ABZ A;  3Q0V A;  1QRY A;  3EGQ A;  1ETQ A;  3JRH A;  1FEX A;  2QTQ A;  4A93 J;  4D5C A;  4NEL A;  1RR7 A;  1RET A;  2JK3 A;  2ZCX A;  2Y9Y A;  2F07 A;  3BR2 A;  1JT6 A;  1PUF A;  2NS8 A;  3M3Y J;  4HKU A;  2AO9 A;  3QPL A;  1FIP A;  2L7F P;  5FJ8 J;  2ME0 A;  1JJ8 C;  3JRF A;  4XIC A;  2CU7 A;  3ZOB A;  3BG9 A;  4B3A A;  2DA6 A;  4I76 A;  3HOU J;  1JKP C;  1DU0 A;  2QF7 A;  2DTZ A;  1OCP A;  3I4M J;  2O7T A;  3KKD A;  2MGQ A;  3VIB A;  3LNQ A;  1SAN A;  2DA4 A;  1T56 A;  3G1L A;  3A01 B;  1W0T A;  2E2I J;  4V2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...