2G0EA

Structure of qacr multidrug transcriptional regulator bound to trivalent and bivalent diamidine drugs
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
rcsb
source organism Staphylococcus haemolyticus
molecule tags Transcription
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2g0eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2g0eA02
2EZKA 2FX0A 1FIAA 3QPSA 4CYCB 1I50J 5J1RA 5E3OA 4AC0A 1K83J 1JGGA 2F07A 3TW7A 3BR0A 1BW6A 3F1BA 1LFBA 5JLXA 1JJ8C 2G7SA 1ETXA 3CQZJ 3S14J 4C3HJ 1LE8B 2IAIA 3ZQLA 2ID6A 3SFIA 5IYBJ 4MXMA 3JRFA 1WH5A 2K9NA 3KKDA 3LSGA 3VW2A 2GM4A 2D5VA 1SFOJ 2PMZN 4S0HB 1B8IA 1UI5A 4A3FJ 2UXUA 3JRGA 1B72B 2ME0A 2JA7J 4B1RA 1UHSA 3S1QJ 2E1OA 1JUSA 2DTZA 3NRGA 4JKZA 1X2MA 4D5CA 1UG2A 2M8GX 5FMPA 2JWTA 2FJ1A 4JX5A 2Y0SN 3O8GA 3IV5A 3BTLA 2JA8J 4MO7A 4GFKA 4ME9A 2HXIA 1K61A 2WB1N 2X9DA 3HOYJ 1I3QJ 5F27A 4IEJA 2NVYJ 3PPBA 3GZIA 5E3LA 1A5JA 1A6IA 2Y9ZA 1MH4A 3EGQA 2MGQA 1S7EA 3WHBA 4I76A 3LNQA 4AYBN 4HNVA 4AC6A 4IHXA 3KZ9A 5IOYA 4L62A 3T6NA 2ECCA 3CMYA 5FHPA 1G2HA 3HE0A 3BRUA 1ETQA 3FK6A 2L9RA 2VPRA 4D7MA 1DU6A 5CXIA 4CGRA 1QPIA 1TWCJ 3BTCA 3VIBA 3P9TA 4V2GA 4QSHA 2LLKA 3NARA 2LD5A 3JRHA 1U9NA 3S15J 2UXOA 4BY1J 1OJLA 3LSRA 5K7FA 2ZCMA 4V2FA 1WPKA 2NOGA 3B6AA 2ZOZA 2PZ9A 3GTLJ 2E2IJ 2GENA 5IYCJ 3JREA 4JP0A 2B63J 3RQIA 3VW0A 3VVYA 3VP5A 4XRMA 2FBQA 4A3KJ 2QCOA 1EF4A 4EEFG 3NPIA 5C4YA 3VVXA 2KT0A 2NP3A 1RPWA 1TC3C 4DW6A 3O60A 1MBHA 5FGLA 1OFCX 2JMWA 2LFBA 4X6AJ 2XGDA 4A3MJ 1P7JA 3ON4A 2ELKA 2R92J 1MNMC 3G7RA 3FK7A 4B3AA 3RZDJ 4ACIA 3FKIJ 3TW6A 3IH2A 2P81A 1PUFA 3GTPJ 3G1LA 5FLMJ 1HCRA 5IPAA 2QTQA 1B8IB 2ZB9A 3M3YJ 3FISA 2ID3A 1JKRC 1IGNA 2REKA 1HLVA 3HOXJ 3BQYA 2NX4A 2TCTA 5D1RA 2JK3A 2E19A 4UUSB 2G7LA 4FE7A 5F0CA 3GTKJ 5H9TA 1MSFC 2WUIA 2ME6A 2HDDA 3G1MA 2K40A 2X6OA 1JUPA 4FCYA 1FTZA 2IBDA 2YVEA 1HDDC 3H0GJ 1RKTA 1W0TA 4ABZA 1CQTA 2QF7A 2PBXA 3ZQHA 1APLC 3PO3J 1MBKA 3PO2J 5J3LA 1D5YA 1H8AC 5CXGA 1E3OC 4XK4A 1JKQC 2IEKA 2O9LA 1NTCA 2K9SA 1X58A 2HYTA 1W0UA 3RD3A 4QIWN 2GBYA 5K7ZA 3NXCA 5EFYA 4DYCA 3BR2A 3K2AA 1ORKA 1UMQA 2Y31A 4W97A 2DMQA 2EZLA 2YS9A 2IU5A 4MFDA 3HTAA 2M0CA 3JSJA 5J1UA 4JL3A 2QOPA 1FTTA 1BL0A 2ZCNA 4XICA 4DZJA 3ZQFA 3BR1A 4B4CA 2V57A 1YRNA 4D5FA 3CWRA 3I4NJ 1Y1VJ 4AF5A 2UXHA 1MBJA 5IOZA 2WV1A 3BR5A 1MBFA 4M3BA 1ZKGA 1IV6A 1U9OA 5BNGA 3OIOA 3C07A 4GCTA 5FKLA 4AUXA 4A3CJ 1GV5A 9ANTA 4XRSA 1WCMJ 3B6CA 4L5EA 3EUPA 1GV2A 1TWHJ 4GCLA 3CDLA 2M2EA 4XIDA 2AHQA 4GFBA 1VF9A 2RHAA 2R5ZA 2R5YA 2QWTA 2LY9A 1IDYA 2HOSA 4C3JJ 1XS9A 1PUFB 3HOVJ 5GPAA 5IP9J 2VKVA 1RETA 2COBA 2NS8A 4M3GA 1VNDA 5AQCA 3S2HJ 2Y2ZA 2LP0A 3HGGA 1SGMA 3VVZA 1JTXA 5HAWA 3VUQA 5C3EJ 2JA6J 4BY7J 2TRTA 1GT0C 3JRCA 2HXOA 2XPUA 3A01A 2K9QA 1OCPA 3L1PA 4JYKA 2CRGA 2X48A 1IC8A 1JKOC 1JTYA 1U8BA 3Q0WA 2I10A 3JRIA 1F43A 3MN2A 2LK2A 1ITYA 3VOXA 5FKMA 1ETYA 5IP7J 1Q1VA 2NS7A 1IG7A 4IHWA 2L7ZA 1IDZA 3GTOJ 3S1RJ 3HDDA 3BJBA 1JT6A 1SANA 5EYRA 2HI3A 3GEUA 1QVUA 2HOAA 1GDTA 3S1NJ 2RAEA 4DYRA 1Z0XA 2DA2A 3BR6A 1UI6A 3LJLA 1RKWA 3HEFA 2CUEA 4LOCA 4C2MJ 4GCKA 5EZHA 5D18A 3LSPA 3GTQJ 4M3FA 3H3VK 3OSGA 3WHCA 3BG5A 3TP3A 1GUUA 4A3DJ 2OI8A 2CUFA 3PM1A 4M3EA 4MLOA 3GTMJ 3ANGA 4IHYA 3ZOBA 5F0HA 3D1NI 2EBIA 1H89C 2OERA 1MH3A 1ENHA 2DA1A 5IYDJ 2L7MP 1BA5A 2GFNA 2E2HJ 4HKUA 1B72A 5DTDA 4FISA 5M5XJ 1MBGA 2EQRA 2O7TA 2DMPA 4UDSA 3BR3A 5HSZA 2DA4A 1XG1A 2LTPA 1F36A 5JLWA 2MSYA 4YZEA 3DPJA 2XPVA 2R5ZB 3IH4A 2NVXJ 5EZGA 2DA6A 2LKXA 3GTGJ 5M3MJ 3OSFA 3HOWJ 3M4OJ 1ZR4A 3COLA 4MFEA 3BG3A 4A3JJ 1DU0A 4BKXA 1Y1WJ 2VI6A 4DYQA 3K7AJ 3ON2A 1I6HJ 2R0QC 3V6GA 2EZHA 2CJJA 3CCYA 3AQSA 5EG0A 2OPTA 4A3EJ 3RZOJ 2VUMJ 2W48A 2L7FP 2G0EA 3TP0A 1WI3A 5EDNA 4JX4A 3BNIA 2JA5J 1ETOA 1OCTC 2ZCXA 2KDZA 1FEXA 2DA3A 3MVPA 4IHVA 4M3DA 1ETVA 5M5YJ 3HOUJ 2R7ZJ 1P7IA 3BTJA 3FIWA 2UXPA 2XSDC 5EGOA 3HIMA 1AKHA 4ICHA 5M5WJ 2WGBA 1GVDA 5FKNA 5EF6A 3BG9A 2DG8A 1TWFJ 1HDPA 4BBSJ 3VW1A 4QTRA 4M6VA 3CRJA 5GPCA 5C4XJ 4JX6A 3S16J 3VOKA 1ZTRA 2LVSA 2Y9YA 3QPLA 5FJ8J 3FRQA 1JT0A 4Y52J 5F1JA 1JUMA 1ZR2A 3Q0UA 1ZGWA 3LOCA 1ZQ3P 5IP6A 1NK2P 1ETKA 2H8RA 2XGEA 3CJDA 2YU9J 1POGA 2XGCA 2HOTA 1VI0A 2QKOA 2XPWA 1FJLA 5FKKA 2DMUA 3GBGA 4Y7NJ 1H88C 3NAUA 1JJ6C 4NDLA 2O7OA 4A93J 1ZK8A 2YVHA 2N8GA 3S5RA 4A3IJ 3IUVA 2NVTJ 4FTHA 3NI7A 1BW5A 5C4JJ 4UUSA 2EZIA 4NN1A 2DN0A 2CU7A 1T56A 2ECBA 4UUTA 2XRLA 2CQQA 3BQZA 3MKLA 5FLVA 2RASA 2G3BA 3BCGA 3G56A 4RDUA 3AQTA 1TWGJ 2NVQJ 3G1OA 2EH3A 3HOZJ 5E3MA 5GP9A 4G12A 4X1EA 4NELA 2O8KA 4RBOA 3HBLA 2HYJA 2FD5A 2H1KA 1AHDP 2CQXA 1JKPC 3SDGA 3HM5A 1BJZA 5K58A 1LFUP 1HF0A 4FE4A 5EG0B 2HKUA 3ZQCA 5DS9A 1QVTA 4J19A 2W53A 4C3IJ 3ZQGA 2FQ4A 1WGXA 1MSEC 4CYCA 3BT9A 4A3GJ 2AO9A 3E7LA 5E3NA 2QIBA 3S2DJ 3TEDA 3BTIA 3JRBA 3LSJA 5DAJA 1O4XA 5EGOB 3Q0VA 5C44J 1X2NA 3UKGA 1AKHB 1FIPA 2JN6A 2Q24A 3C2BA 3ZQIA 1LE8A 3E7QA 2GUHA 3NNRA 3PASA 4MIMA 3QKXA 2L0KA 5K7HA 1NK3P 3Q3SA 3DEWA 2MW8A 3I4MJ 5F0FA 2D6YA 1YRNB 2E2JJ 3A02A 4A3BJ 5CW8A 1IRZA 5FKOA 3LHQA 2HQ5A 5J1YA 4KWAA 3HTJA 3QBMA 4W1UA 1WH7A 3RKQA 5D19A 2MG4A 3GTJJ 1IJWC 5EEAA 3IH3A 3V78A 5F08A 2YUSA 1U78A 2LR8A 3JRAA 1TWAJ 4BXXJ 2NP5A 3S1MJ 3BHQA 5HODA 4DZPA 3HB9A 2XB5A 2R5YB 4XRSG 3MNLA 3JRDA 1RR7A 3S17J 2R93J 3W6VA 2GLOA 1AU7A 2OF7A 2ZOYA 1MBEA 1ETWA 2WAQN 2DMNA 3HKZN 4PXIA 1Z77A 3KNWA 4A69C 3HTHA 3ANPA 3QQAA 1R9TJ 3KKCA 4A3LJ 4GFLA 1IUFA 2Y30A 2UXIA 4JNNA 2DA7A 4BBRJ 3JR9A 4MK6A 4I6ZA 1HOMA 5HBUA 3VPRA 3RH2A 3A01B 2DA5A 3HGYA 1QRYA 3O8HA 3SJMA 1RESA 3F0CA 4D7NA 5M3FJ 3HTIA 5F04A 2DMTA 1XC5A 2M34A 1T33A 2G7GA 2XDNA 3LWJA 2XB0X 3DCFA 2DJNA 2DG7A 2VKEA 3B81A 3OOUA 2JJ7A 1VFCA 3A03A 2M9HA
chains in the Genus database with same CATH superfamily
3QPSA 3CF5F 2E1MB 4DVYP 4G7HF 3V8KA 1FNNA 1B9NA 4EJUA 1G6NA 4EM1A 4B43A 1LE8B 4HYEA 3RYRA 2PBIA 4G7OF 2HKOA 3JRFA 3KKDA 2MLGA 3R60A 1LDKB 3M1EA 3C18A 4AU7A 5BQTA 3E5UA 3S3OA 2KRFA 1B8IA 1XMAA 2M3AA 1YLFA 1ZG3A 3TO7A 3ONQA 1D1CA 3DEEA 3W3CA 3ASOH 2ME0A 4A6DA 2JA7J 1UHSA 3S1QJ 1ON2A 1MMAA 3TO9A 4D5CA 4YIRX 1UG2A 2M8GX 1MMGA 2FJ1A 2GOMA 3RKYA 2BZTA 3CESA 3FX3A 4AVPA 3IV5A 3BTLA 4UVBA 5FD5A 4OIPF 2IA1A 3O6BB 3S3MA 4PJMA 2RQPA 2W82A 4HQMA 1VQMI 1S5LC 5E3LA 1A6IA 3BC8A 3LA2A 4TV7A 4YIFA 4HNUA 3I71A 3WHBA 3CUQA 4AIJA 2LH9A 1R36A 4HNVA 1R5GA 1G59A 4IHXA 2MH2A 1Z3YA 1G2HA 3BRUA 1ETQA 4N9HA 3ZN0A 2VPRA 4XLNF 1DU6A 5J6XA 1TZLA 2A69F 2X4HA 5CVIA 1S7AA 1TWCJ 1O7FA 2UXXA 3VIBA 4V2GA 2XAFA 2UXOA 3JRHA 4JOMA 1TQIA 5IT3A 2VBWA 2W7NA 4LIUA 3CJTB 2PMHA 4L9NA 1WJAA 4FT8A 3JCUC 5K7FA 1Y56A 2X6XA 2GIZA 1WPKA 2PZ9A 3GTLJ 3CCVI 2E2IJ 2F4MB 3A0HC 2RNJA 5CPRB 3RPQA 3W2VA 5IYCJ 1D0XA 4D1QA 2LREA 2B63J 3K0LA 2CV0A 3VW0A 2NOJB 1ZYRF 3IC7A 5H2FC 2Z1DA 2QCOA 1SVMA 5DD8A 4E4HA 3ABUA 4LK0F 2P5LC 4EEFG 3E6DA 2NP3A 3J80Z 5FGLA 3EUAA 2LFBA 2JQ7A 2PJPA 1VQ7I 4IRHA 2XGDA 2DODA 2ELKA 2R92J 4F3QA 2V26A 3CDHA 1REPC 2FMLA 1VQ9I 2EV5A 3WTXC 5HS9A 1SFXA 3C1DA 3M3YJ 3M9AA 4C2TA 1U5TA 3K4JA 5HDNA 2NX4A 3FKJA 2E1NA 1T38A 3SXYA 2DQRA 1R49A 2L7KA 2M30A 3JW4A 3NWSA 5ILSA 2DFFA 5DD4A 3D5LA 2HDDA 4ZDOA 3OS2A 3CCUI 1CF7B 2IBDA 5J8CA 2QWWA 4ENMA 4XNFA 1HDDC 4XLHA 1IV8A 1RKTA 3QPHA 1W0TA 4ABZA 5DCFA 2QF7A 3NEUA 1BN5A 2Z9OA 3WTTC 1H8AC 3BG6A 2E1MC 2ZFUA 4XK4A 2LBFB 2K5CA 1JKQC 1NTCA 2MD0A 2HYTA 3HJEA 3RD3A 4ESBA 5LHHA 5EFYA 1J59A 3K2AA 1ORKA 1UMQA 3C2HA 2BV6A 4UB8C 2YX4A 3G2BA 2X6WA 4W97A 1W36C 2YS9A 5IT9K 1A04A 3I59B 2OZ6A 3HTAA 2P6TA 4A5MA 3Q5FA 3R6SA 1YJNI 2STTA 5E1XA 3L7WA 3JSJA 3GZ5A 1DDNA 3LSHA 2B7EA 1BL0A 4BXUA 4DZJA 5LFAA 1JE8A 1QPMA 3BR1A 1YG2A 2MFZA 2M8EA 2JSCA 3I4NJ 1Y1VJ 3CWRA 1MBJA 2X0LA 2WV1A 3BPXA 2D45A 1MBFA 3CCLI 2R7UA 3V8JA 4XKWA 4ZTJA 3OIOA 2CUZA 2MC3A 4GCTA 4AUXA 3B6CA 2DOFA 2JVGA 2MYSA 2XKOA 3AG1H 4BEHB 2ZBKA 1TWHJ 2R7DA 1W36D 2M2EA 2VBXA 2DOEA 1VF9A 1J0RA 2R5ZA 2R5YA 1QHHD 2QWTA 3V7RA 1FP2A 2HTJA 2LNBA 3AG4H 2QKMB 4HLXA 1EKEA 2VKVA 1RETA 3GX4X 3HTSB 5FRMA 4XKVA 4M3GA 1P92A 1HW5A 3DWLE 4K2EA 1Z7UA 3FWEA 5D6FA 5DYMA 4BJTA 5HAWA 3VUQA 2WY7Q 1FSHA 1Q1HA 5HLGA 2JA6J 4BY7J 1O3TA 3CC7I 3LAJA 4HLYA 3JRCA 4LD5A 1R00A 1VQKI 1X4PA 3I53A 2K9QA 2X48A 2CRGA 1XN7A 3GFLA 1JKOC 1JTYA 1S72I 1ACIA 2XIGA 2BBYA 3DKYA 3O2PE 1OPCA 2BHYA 5JR3A 2E5NA 1SD7A 4IOCF 2I10A 3H36A 1BI1A 2HYFA 3MN2A 3QU6A 2LK2A 3VSKA 1LNWA 4II2A 1T08B 3VOXA 1ETYA 5IP7J 3GEZA 3GTOJ 3HDDA 5J4YA 3GEUA 2V1NA 2ZO4A 1LKXA 4L9JA 4FX4A 3WTYC 1ZGJA 5H20A 1MNEA 2VN2A 4DYRA 2DA2A 3LJLA 2CUEA 4LOCA 4C2MJ 1Z91A 3OYDA 1V5EA 4F52A 1G3SA 5D18A 2CS3A 4GYIA 2Q2EA 1LUJB 5D4SA 3IAM2 4A3DJ 4BQQA 2EWNA 2QUFA 3EYIA 3D1NI 4G6QA 3GZ6A 2V1UA 2L01A 1ENHA 1X1CA 5IYDJ 3CP2A 1BA5A 4FISA 4BHBA 5M5XJ 5FLXZ 2O7TA 3GUDA 1E17A 2BXZA 3BR3A 2DA4A 2LTPA 4N0BA 1XDUA 4YZEA 3H9QA 3VYTB 2K7LA 2DPUA 1HQCA 2W24A 2XPVA 5J47A 3DPJA 2KMUA 2DA6A 3CP8A 4G6DA 4NQWA 5M3MJ 3M4OJ 3HOWJ 1ZR4A 1I3AA 4EVIA 2CH0A 4A3JJ 4EQQA 3FM5A 2ELHA 1K6OA 2R0QC 4E7KA 1ZN2A 2J5PA 2W25A 5LEKA 2XASA 2OPTA 5LD2C 5FRNA 3RZOJ 2W48A 3DTEA 4HPQA 3TP0A 3MAJA 3O3KA 4G7ZF 1V4RA 1OCTC 2KDZA 1FEXA 3MVPA 4M3DA 2EINH 1N77A 1LJ9A 3DPUA 3KEOA 3VODA 2UXPA 3BTJA 1G8XA 2XSDC 1OR7C 1KZHA 1OISA 4IO9F 1GVDA 1ZGAA 3GFJA 4DJAA 5EF6A 3DLLF 4J00A 1YFHA 2K4BA 1HDPA 5KAIC 3VW1A 4KIBA 2RNGA 1STZA 4LMYA 1KQ9A 1YIOA 3OYCA 2KKOA 4PDKA 3WODF 4Y13A 2LF8A 4JX6A 3MKWB 2O6GE 3S16J 3VOKA 5B1AH 2MA3A 3QPLA 3FRQA 1ON1A 1UHMA 1VQ5I 3LOCA 3DLAA 4EATA 4Y3OA 4KN7X 2DT5A 1NK2P 1ETKA 2H8RA 3DU5A 2VOOA 1T98A 4XM3A 5FKKA 5J40A 2DMUA 3FMRA 4J01A 4HG2A 3OYFA 2ESHA 4RGSA 2HZTA 3ZN1A 2BY3A 4NDLA 4PJ0C 3EUHC 4XL9A 4CCLA 3MKZA 1PP8F 4A3IJ 3H9GA 3IUVA 1Z3XA 2ACJA 1X19A 1K4SA 4BDYA 4UUSA 1VQOI 4MEXF 4P1WA 1RR8C 1I6XA 3ZMUA 3P9KA 2KPMA 4UUTA 5JVGF 3TKYA 2G3BA 1W7PB 1TWGJ 1E0EA 4ENNA 5E3MA 4XLPF 4G12A 1Y0UA 4X1EA 4ZZLA 4I09A 2O8KA 4RBOA 3HBLA 2ZCWA 2FD5A 3SDGA 3HM5A 3PFIA 1BJZA 2TDXA 1F5TA 1SMYF 1TT5B 3MNLA 5K58A 3OYLA 3NWTA 4KICA 4FE4A 2WWYA 1FYKA 2XVCA 5EG0B 3J7AY 4ZYAA 3ZQCA 4J19A 4FETA 1HKSA 4C3IJ 1QNTA 1MMNA 1WJFA 3OYMA 1MSEC 3BT9A 4A3GJ 4KIFA 4OMYA 1LB2A 2QIBA 3GFIA 2NS0A 1R5HA 3IAS2 5EGOB 1EJ9A 4E70A 2OA4A 3NNRA 3L2RA 4OOIA 3ZQIA 2GUHA 4C30A 1E3HA 2FSWA 3WU1B 2BY1A 1FMWA 2PMZA 5CYVA 1YTYA 1EH8A 3DEWA 3I4MJ 3IWZA 5F0FA 5HDKA 2EA4A 1DP3A 1YRNB 2E2JJ 3A02A 3U21A 4EJVA 5IT9Z 1U0JA 4HX8A 3CJQB 1WFXA 2HQ5A 4KWAA 2A6TA 3HTJA 1WH7A 1AA7A 2QQ9A 3QAHA 3ZQQA 2BE5F 1DPRA 5B66C 2VT3A 3GTJJ 2AQEA 3K8PC 4PJLA 3KEYA 5F08A 1MNDA 2LR8A 5A2QK 4XONA 2HTSA 3JRAA 3M07A 3QP6A 3S1MJ 2NP5A 4PJJA 1M1EB 2WB1A 3ZMVA 2W57A 2XB5A 3L9FA 1OCOH 2DQLA 4XRSG 1K6YA 1HBXG 1XMXA 1RR7A 2X51A 3PNTA 4KMUX 4HF2A 4HSTA 2R93J 2ESNA 3S17J 1BOAA 2CSOA 3KZIC 1FOKA 3IRQA 2OF7A 4N4OB 1P6RA 3M8FA 2V4JC 4KIGA 1MBEA 4RB3C 2DMNA 2L4MA 4PXIA 3F8MA 1Z77A 2R7FA 2QYOA 4XR6A 3IRRA 3HTHA 5LLQA 2FRHA 3KKCA 1R9TJ 1IUFA 3VOEA 1T39A 2ZMEB 3QODA 4BBRJ 1T2KA 3FHNA 4BACA 5HBUA 3VPRA 3RH2A 3A01B 4ZYEA 3HGYA 4HV5A 4H4KC 1FLIA 1RESA 4HOBA 3BLYA 4PFPA 4R1HA 1Z1DA 1XC5A 2M34A 1B59A 3VEPA 1UELB 4BU2A 5DCMB 1J7KA 1OMIA 3B73A 2DJNA 2QSFX 2E35A 2QSGX 2VKEA 1R5ID 5LGUA 3N4MA 3OOUA 2E71A 4QPOA 3CC4I 3M7GA 3RI4A 3A03A 2M9HA 2FX0A 2IGKA 3VSLA 2Q0OA 3CCMI 5E3OA 1XDSA 4AC0A 2QM3A 3I4PA 3BR0A 1BW6A 3A4CA 5EEGA 1RUNA 1LFBA 3LFUA 1T6SA 1JJ8C 4RAYA 2FU4A 1OYIA 2G7SA 3BDDA 3CQZJ 3ZMSA 2XAGA 3S14J 3N97A 3I9V2 1Z6TA 2E7WA 3ECOA 4ZDPA 3SFIA 1SVLA 1WH5A 2K9NA 3CMAI 3VW2A 2A5YB 1OCZH 2M7AA 5BS6A 2D5VA 3CJNA 1UI5A 4E7SA 2ZJ2A 3I5UA 3VYUB 2VL8A 3GZNB 4IHTA 1ULYA 1U8RA 1JUSA 2OTLI 3P9CA 5FMPA 2JWTA 5HOOA 5GTIC 1DPUA 3MMYB 4YG2F 2RN7A 2AXLA 3I3LA 4GFKA 1K61A 3CO6C 5K5RA 2PFBA 1IO2A 4OIQF 3GZIA 3JAMK 1MH4A 2KHMA 1YS7A 4A6EA 4I76A 5GAEJ 1W7PD 4AC6A 4L62A 3GMEA 1ZLJA 4RGRA 5ED4A 1NHAA 1I1GA 2YSRA 4RAZA 1RUOA 4M71A 5FHPA 2HQAA 4AM3A 3FM3A 4KDPA 3FK6A 2L9RA 3F8FA 4D7MA 3QWLA 2EIMH 1FX7A 3TL4X 3HSFA 3BTCA 3K9TA 1PUEE 4Q5SF 2E7XA 3MZ8A 4QSHA 4YIIA 3K70C 1U9NA 4BY1J 2VJIA 4XLCA 3K69A 3BJOA 2CV1A 3RJPA 3KP3A 2NOGA 1TTYA 2ICWG 2HS5A 2LKPA 3DBHB 3JREA 4JP0A 1VQNI 2OC6A 3ROUA 4UXNA 2RGVA 4KT5C 4KFCA 3OR2C 3VP5A 2EB7A 5ERIA 1HC8A 2FBQA 5F64A 1HSTA 1V55H 1KU3A 3EQLF 5DV5A 1EF4A 5C4YA 2EK5A 2KFDA 3GLLA 3VVXA 1RPWA 1TC3C 5ICEA 4DW6A 3K70D 1F4KA 2JMWA 3H5RA 4L0YB 2OQGA 3ZMZA 3LL7A 2QSHX 2A2FX 4A3MJ 1IN4A 1C0WA 3G7RA 2ISZA 4B3AA 4ACIA 3DU6A 3TW6A 3CF2A 2P81A 3REOA 3WGGA 3G1LA 1HCRA 2QTQA 2OCCH 1B8IB 5ILUA 2WAEA 3FISA 3HC7A 2XV4S 1JKRC 1HLVA 3E1SA 2P7CB 4LG3A 4FE7A 5F0CA 2O3FA 3UNGC 1OQYA 4PGHA 1ZRDA 4UVCA 1G3WA 1XCVA 1P4XA 2ZJPF 2LMDA 4L18B 2YVEA 3HPHA 2OCEA 1D0YA 3HSRA 4IRVA 1PYVA 3K2ZA 3NQOA 4QPQA 3ZQHA 3QP5A 3PO2J 1MBKA 3WE2A 5F1RA 1TT0A 2OV7A 4DGWB 3PQKA 2VONA 5E18F 6PAXA 2H94A 4AD9A 3MKYB 2FE3A 2GBYA 5K7ZA 1BC8C 3BR2A 4PCQA 4BJ5C 1ZRCA 3H5AA 4N9IA 3CLOA 3KLOA 2BVMA 2EZLA 5FFZA 1WWXA 3SHFA 2P5VA 4MFDA 3QOPA 2XROA 2UUZA 2RDPA 3PUBA 5J1UA 4JL3A 2I5UA 2M4GA 1FTTA 3OL4A 2ZCNA 4JBAA 3HG9A 3SDBA 2V57A 1DP7P 4DQ2A 1L3LA 3F21A 4IQ4A 1FBUA 4RM2A 4M3BA 5E1WA 2W00A 1EH6A 1U9OA 1R7JA 4P96A 3C07A 3VWBA 1LEAA 2IT0A 5D5XB 4XRSA 1GV2A 4LG0A 4N4NB 1VQ8I 4M9SA 4I01A 2AHQA 3BWGA 4KNYA 3OMYA 4NC7A 2Q8KA 1R1TA 2LY9A 4E7IA 1IDYA 4U88A 1D5VA 3ABLH 4C3JJ 3U1DA 1TBXA 4ESJA 1P2FA 5HS8A 1YW9A 4GRIA 5IP9J 3HUGA 3DXJF 3KCCA 5A2QZ 4WIBA 2COBA 2JUCA 1U5TB 2CGPA 2IRFG 2WV0A 3AG3H 1VNDA 1R23A 1PP7U 3HGGA 5L3DA 1SGMA 1JTXA 3MCZA 3TOBA 1Y0NA 4F91B 2VT2A 4ZYGA 2PEXA 1GHCA 5TRDA 1A6QA 2CMPA 4C2UA 2E60A 4C9YA 4Y15A 2QBYA 1FMVA 3PIPF 2CW0F 3R0AA 1HA8A 3VTIA 3FXUA 5FO5A 4ZTFA 2RKHA 4RGXA 4RS8A 4AWXB 3ZQ7A 3RPUD 4UV8A 2NS7A 2CYYA 2WAFA 4KA4A 1UFMA 2GA2A 4CCOA 3ERED 4IHWA 1O57A 1MJAA 2L9SA 3S1RJ 1IDZA 3BJBA 1SANA 5EYRA 3F23A 2HI3A 4HQEA 2LF7A 1W4MA 3T5XA 4CH7A 1WJBA 3S1NJ 2RAEA 3BR6A 2DXIA 3PSIA 1UI6A 1RKWA 1U3EM 3HEFA 4GCKA 3J7AO 2QQBA 2LC2A 4F7ZA 5EZHA 1GLNA 3FXJA 2QQ8A 2JPBA 4ESFA 3RCOA 1WHUA 3BG5A 2IPQX 1GUUA 3E6MA 3LSIA 2CUFA 3PM1A 3TP3A 3ZMDA 4DBQA 2B1EA 4IHYA 3ZOBA 2OERA 1H89C 1WQ2A 1QZYA 4IX7A 2F5FA 4E7JA 2YR2A 2E2HJ 5DTDA 2B3WA 2EIKH 4LFUA 5LBQA 4OINF 1R58A 1R6RA 1PVEA 1TW2A 1WRJA 2EA2A 3BP8A 4L5IA 2VKHA 3ML6A 1FZPB 2X1DA 1GVJA 4OU0A 2CO5A 1RC9A 5JLWA 4CZCA 3HTUA 2FF4A 1HW2A 1NG6A 4BQNA 3OYGA 5BMZA 1IXRC 1KONA 2R5ZB 1G4DA 1QU3A 1KYWA 1A31A 2FOKA 3WGHA 1X1DA 2CQNA 5D8LB 1BM9A 2UWMA 2VI6A 4DYQA 4AIHA 3K7AJ 2JSPA 2V1XA 1KU9A 3S2WA 3EETA 4I0AA 1I6HJ 3G6EI 2IGOA 2HDWA 3CCYA 5D4RA 4ANJA 1F9NA 1I5ZA 4IRGA 2R7SA 4A3EJ 3VB2A 2VUMJ 1ZHFA 3LAPA 2L7FP 4LLNA 1WI3A 2WBMA 3K10A 1ETOA 3JAMZ 3CMMA 2FXAA 2LDUA 1SVOA 5E79C 4IHVA 1KA8A 3HOUJ 2XC7A 2NYXA 4H0EA 2OTJI 1P7IA 4P55A 3FIWA 2XHKA 3FXKA 5FD6A 3HIMA 2OJED 1H9TA 3GVAA 4EGZA 4OMZA 3BG9A 2DG8A 2QLZA 3VYSB 1TWFJ 2ELJA 2PJRA 4PSXA 3CO7C 2CG4A 4M6VA 3SQNA 3CRJA 2DYRH 2XF5A 3BG7A 3ZP5A 4ENKA 2KZVA 1J5YA 3PJRA 5D5WB 3DKWA 4EJOA 2P5KA 2Z5UA 3DBLB 4Y52J 1J2XA 4EV0A 3J81K 3CCSI 2XDVA 1ZR2A 3F6VA 1SAUA 4GGGA 2IS1A 2DK5A 4O3MA 2V6CA 1BBYA 4CHUA 1LEBA 1B1BA 3TGNA 2XGCA 3OY9A 1ZG5A 5CVVA 2CQ7A 2F48A 1H88C 3NAUA 2WAQA 3HKZA 4GCVA 1ZK8A 3OIPA 2N8GA 3K4KA 4ITVA 3S5RA 4FTHA 3CZ6A 1BW5A 1RIOH 2BYVE 1BIBA 3F72A 2HOEA 1EV7A 2GXBA 2XF7A 2XRLA 1KQ0A 4HW0A 3SEZA 4RDUA 4IPAA 2DTRA 2A6EF 2NVQJ 2VJ5A 3L2CA 3QYBA 4YELA 2VXZA 4NELA 1MW7A 2OBPA 1ZREA 2KQRA 4LB6B 4O6JA 4XLAA 1R22A 2K86A 2B0LA 5LRSA 1X1BA 2Z2SB 2LBFA 5H6RA 4WX9A 1LFUP 1HF0A 2ZC2A 4XBFA 4MTEA 3DPTA 5DS9A 1QVTA 2W53A 2M45A 2HNHA 1BOBA 3LSMA 2FQ4A 3D5SC 1N75A 4CYCA 1KU7A 3PQJA 1KU2A 2BGCA 4B48A 4BS9A 3E7LA 3WG7H 3MZHA 3S2DJ 3N05A 3TEDA 2PLYA 3BTIA 4M72A 3LSJA 3FBIB 2Q24A 4ME9A 1X2NA 2JN6A 3C2BA 5LRRA 3E7QA 1BIAA 3PASA 1R1VA 5LHGA 5HNHA 2PQ8A 4F92B 1XSDA 2ZXJA 1BI0A 2IP2A 1O3QA 1NK3P 1MKMA 2MW8A 1YS6A 2D6YA 3H35A 4YRVA 4A3BJ 1S9HA 1OCRH 2A5WA 5E20A 3H3UA 3UR3C 4EGYA 5FKOA 1Z9CA 3ABMH 1SMTA 1XSXA 3T8RA 4EJTA 2W84A 4B09A 3RKQA 2IS6A 1OYYA 3H9JA 1LDDA 4IRIA 2XF6A 1U78A 3A0BC 2Y0SA 4BXXJ 3GFMA 2ISYA 1X3UA 4O5VA 4WWCA 5HODA 4DZPA 3HB9A 3T0YA 4HDUA 2A07F 2X1CA 2BW3B 2PI0A 2RQQA 1BR1A 1N78A 4G8XA 1VQ4I 2M87A 4EM0B 2R7QA 1AU7A 3HXLA 4AYBA 2ZOYA 1D8KA 1YJ9I 1ETWA 3VYRB 5D6EA 1IZ1A 3ZXSA 3BJAA 2JPCA 3EUHA 2V9KA 2Y30A 2M1BA 3SWHA 4NHJA 1HKTA 1XGMA 4MK6A 4ZYDA 3TBIA 2HQRA 2ZXHA 1HOMA 4OWRB 4XKBA 1AOYA 2XKPA 3U9GA 5LEJA 2EILH 1QRYA 1JHFA 3O8HA 4DIQA 2XSJC 5K1YA 4EMSA 3F0CA 2KDOA 3OYHA 3KP5A 5M3FJ 4HAMA 3HTIA 5F04A 5CQEA 4CCJA 2M5WA 3ISPA 2G7GA 4ZC3A 4I99C 4LJZF 4E6KG 3BZCA 3DCFA 2Y0MA 3HSEA 3EPZA 2P6SA 3B81A 1JXSA 2Z99A 2V79A 2JJ7A 4CICA 1IN5A 1I50J 4GDFA 1I39A 1JGGA 2F07A 1FYLA 2K9LA 3TW7A 1W1WE 3F1BA 1XX5A 5JLXA 1SFEA 3RIRA 5LGTA 1B6AA 4F55A 1ETXA 2IAIA 3OOPA 3ZQLA 2ID6A 1S29A 5IYBJ 4XLFA 4MXMA 4Q47A 4XOTA 3LSGA 4XN3A 3HL2A 1FOYA 3DPLC 3BPVA 4UHTA 2PMZN 3OYBA 4S0HB 4HDVA 2RVCA 3VFZA 1SFOJ 2HVRA 2GQQA 5CVJA 1IW7F 4P9FA 2Z3YA 1B72B 5KNLA 4IXAA 4B1RA 2FQ3A 4U7BA 2E1OA 3ULQB 2DTZA 3KYLA 3IP4B 3NRGA 1WKMA 3OYNA 3H3ZA 1FY7A 3LMMA 5CJ9A 5KK1A 4JX5A 4HF1A 5EEHA 2PX9A 3O8GA 2JA8J 4UV9A 2EFWA 2WB1N 2X9DA 4RMNA 1I3QJ 2XUBA 3HOYJ 4IEJA 1MMSA 4CCKA 1UAAA 2NVYJ 4U87A 2CUJA 2WADA 4PFOA 5AONA 1ODDA 1S7EA 1FWZA 2DO7A 3FZVA 1HXDA 2D1VA 2V1DA 3PUFA 1BI2A 3HE0A 1DGRM 2FOWA 2H6BA 2F6CA 2KZGA 2KL4A 3K1MA 3LFKA 4CGRA 4Z2YA 2DT7B 1VQPI 2LLKA 3JTHA 5FB2A 3S15J 2L54A 1OJLA 3LSRA 3DV8A 2UZKA 4CXFA 4XSXF 3V8LA 1A36A 3B6AA 2MH9A 3WTZA 5D5UB 5FFXA 2L3DA 1FPQA 4S05A 4G9YA 3PIOF 4ZZDA 3OYAA 4E7ZA 2C6YA 4KJZA 4XRMA 3GXOA 2EFOA 1GXPA 1MJBA 2YVXA 3NPIA 1T95A 5L3CA 1TL8A 2NXNB 2DT6A 2H09A 4IVNA 1MBHA 4IOAF 1OFCX 4X6AJ 3CLQA 5D5VB 1VTNC 3ECHA 2JA2A 1YITI 1ZLKA 1P7JA 1MDMB 2R7XA 3FK7A 3RZDJ 3FKIJ 3J81Z 3J7ZI 1WSUA 1PUFA 3GTPJ 5IPAA 4Y4RA 4BDZA 1LVAA 2ZB9A 5TGTA 2ZFWA 2F4IA 2VKDA 3CD6I 2REKA 4U0VA 3HOXJ 3FMQA 4PZJA 4OIRF 4U7DA 1T8IA 1YW8A 3GTKJ 1YYVA 5H9TA 1MSFC 2DK8A 2ME6A 3HOSA 1R4NB 3G1MA 3KP4A 2K40A 1W7PA 2X6OA 4D0PA 4FCYA 1FTZA 4M6XA 5GAHJ 3LA3A 4RAGA 1K78B 1XCBA 3RKXA 2QZ8A 3CTAA 3KLNA 3OS0A 3PO3J 5GADJ 5J3LA 2GIVA 2RREA 5CXGA 1OLTA 4PJNA 4IQJA 2L4AA 3WTVC 3DF8A 2IGMA 1O3RA 2IEKA 4NC8A 2K9SA 3H5NA 3OR1C 5HLHA 1PDNC 3KETA 5B3SH 4P9UA 2HPIA 4V19K 3KX2A 3ERMA 1XSVA 4DYCA 1UHWA 1K4TA 1L0OC 5BOXA 1MGTA 3ZRGA 2DMQA 1UG0A 4HV6A 2IU5A 2VJ4A 2M0CA 3ZPLA 2PFVA 4XKCA 5L3GA 4CGZA 2HWVA 3IWFA 3ZQFA 3PNYA 1D8JA 5B5EC 2OU2A 3K4NA 3J80K 1YRNA 3L2VA 3E0JB 3BR5A 3BZ6A 3QRFF 1ZKGA 3AL0B 2FEZA 3BOQA 3DKXA 1SD5A 4RB0A 5BNGA 2Z33A 1WJDA 4A3CJ 9ANTA 2A3SA 1WCMJ 3CCRI 4L5EA 3W2WA 4ASNA 3S3NA 3CDLA 1SAXA 5DEQA 1X1AA 2RHAA 5HNFA 3HRTA 1TNTA 2YX7A 4B44A 2IW5A 2G9WA 2IGNA 1IF1A 1B4AA 4CSWA 4CUGA 4LB5A 4B47A 1SD6A 4M9XA 2HYGD 1P4WA 4UB6C 4Y33A 2R3SA 1I1SA 5AQCA 2V7FA 2K85A 2Y2ZA 2LP0A 3S2HJ 3VVZA 3KEQA 1P4AA 2AXTC 1BR2A 3ASNH 1T0FC 2OAZA 4MQVA 5C3EJ 2HEOA 2TRTA 1GT0C 2HVQA 1XMKA 1FC3A 3K6GA 3KYCB 5AIQA 4KITB 2P0WA 3A01A 2M7BA 3KZYA 4JYKA 2FJI1 1IRXA 4AIKA 1U8BA 1USTA 2VLAA 4WF2A 3ZMTA 4I2OA 3WG9A 3SEQA 5JFRA 3HZJA 2XAUA 3JRIA 2FBKA 3M1CA 5DCMA 2QA4I 2L2OA 2MLKA 3FXRA 3BJ6A 2V9PA 2JZYA 1ZRFA 1H0MA 1ITYA 4ZDLA 1Q1VA 4LIVA 4XLEA 2L7ZA 1YX5A 1JT6A 3CUOA 4FQGA 3TO6A 2HOAA 1BI3A 1JHHA 4YFKF 1Z0XA 4NC6A 5D8KB 4M6YA 2MABA 1XD7A 4CYDA 3ZCOA 2ADUA 2DYSH 1J09A 2QGUA 2CWEA 2ZXWH 1A35A 1AWCA 3H0DA 4BL0B 3GTQJ 4M3FA 3L2WA 3OSGA 1KGSA 2DCEA 3WHCA 2DOAA 3H3VK 1FOWA 2OI8A 4MLOA 3GTMJ 1V5GA 2Q1ZB 3F8BA 2ZMEC 5F0HA 2EBIA 3A2KA 5CVUA 1SC7A 1MH3A 2DA1A 4HX7A 2QVOA 3TMOA 4LLGF 2VE9A 1MJ9A 2EQRA 3PSFA 1N25A 2DDAA 2DMPA 2KIUA 2ZSHB 1VQ6I 4UDSA 4YFNF 4C2MA 3KP6A 1XG1A 1FBSA 4BHPA 4BXFA 2KISA 4WCGA 4HSRA 2NVXJ 2VOPA 2IJLA 2LKXA 5DM6F 1S8NA 4DBRA 2MBFA 4UY8I 3CUQB 5KAFC 2DFIA 3V6GA 4CZZA 2CJJA 5J8FA 3QU3A 2G0EA 1K79A 1YHQI 3BNIA 4NBQA 4JK1X 2KP6A 3R0JA 1ZH5A 2ZCXA 3KP2A 3RPUA 1ETVA 3W6JB 3I58A 5M5YJ 2QBYB 2K3PA 2R7ZJ 3SZTA 3I55I 1Y8QB 3PNVA 4HBLA 1AKHA 2ETHA 5M5WJ 2WGBA 5FKNA 2L02A 2PN6A 3AL0C 2DBBA 1EA3A 1FBQA 2MC4A 2ZKZA 4QTRA 4L9VA 2FA5A 2HZDA 3V7CA 2A61A 2OUMA 4I0BA 1XGNA 1G3TA 5GPCA 4OAYA 1OYWA 2IA2A 1I27A 4QLCU 1XGSA 2IXSA 2LVSA 5FJ8J 2HPMA 3OL3A 4M73A 3TDUC 1JUMA 3PFYA 3M8EA 2OD5A 3Q0UA 1ZGWA 4IHSA 2D2WA 1UCRA 5HS7A 3CJDA 1POGA 2HOTA 1NG7A 5FLXK 3P7NA 3GBGA 4Y7NJ 1P9QC 1IN6A 1MIJA 1JJ6C 2O7OA 2YU3A 4RB2C 3DBRB 4A93J 2YVHA 2D1HA 3HRSA 4LK1F 1HKQA 2O8XA 3DEUA 2NVTJ 2K3FA 1QQIA 3NI7A 2KIQA 5C4JJ 3AKZA 4WK8F 2EZIA 3CCQI 3COAC 3LWFA 1XTAA 2JRMA 2UV1A 3MKLA 1WZ2A 3BCGA 1S7OA 2KJCA 2OZUA 2NRAC 3G56A 3MFKA 4XMYA 4IJAA 3S93A 3SYTA 3G1OA 1QGPA 2EH3A 2VQLA 3HOZJ 5L3FA 1W5CC 2EJRA 5GP9A 2DJIA 3K1NA 4Z6YA 2HGCA 3DTIA 3CCJI 5CKTA 3T8TA 1AHDP 3QYFA 1JKPC 2H1KA 2HDCA 1ERDA 2DPDA 1NH3A 3IL2A 2A05A 4CA0A 1MZBA 1QO0D 4BE2A 1IXSB 1H9GA 4G94A 4LITA 2DU9A 2X6YA 3ZQGA 1WGXA 2VQGA 1DQUA 2LY2A 3BY6A 4X0GA 5DAJA 3IKTA 1O4XA 4L9TA 2MD5A 2Z16A 5CVRA 5JHFA 1LE8A 2XGXA 2M4KA 3D0SA 5B1BH 4BNCA 4KN4X 5K7HA 2E1CA 2PJRB 3Q3SA 3RSNA 4ZH4F 3C3WA 3F8CA 4BQOA 4EM2A 3Q9SA 2P8TA 1IRZA 4RB1A 4IZZA 1WJCA 5J1YA 3LHQA 4HZFA 3QBMA 2QENA 2VBYA 2MG4A 4IF4A 3A1YA 3OYKA 2O5RA 1IUYA 1XGOA 3IH3A 3E3VA 2YUSA 3H92A 3HRUA 3KP7A 1XPXA 4BUPA 2E34A 3MD2A 1WJEA 2R5YB 3CUQC 2W85A 3J7YJ 2VJJA 2GLOA 2GZWA 4G6TB 4KT6A 4HRIA 2HQNA 3SFZA 2WAQN 1MD0A 4NNJA 3HKZN 3T1BA 2OQRA 3FF5A 3KNWA 2FBIA 2IS2A 3ANPA 3QQAA 4A3LJ 4GFLA 5ICCA 2UXIA 1SD4A 1S3JA 4JNNA 2DA7A 1D0ZA 3V4GA 3F6OA 2I8DA 2VXDA 4L0ZB 2DI3A 4ZYHA 3CCEI 3L00A 4IL6C 1W5TA 3SJMA 2R4GA 4D7NA 3HRMA 2KIFA 3LSKA 2JT1A 3RTRA 3AG2H 3VDXA 2DMTA 2UXNA 3MWMA 1X3WB 3C2GA 2ZNZA 3S32A 2JRTA 3Q9VA 2WA0A 3HIFA 1VFCA 2FMYA 2EZKA 1BR4A 1FIAA 2GXGA 4CYCB 5J1RA 1SEUA 4KUMA 1K83J 4QWQA 2K4JA 1S6LA 1X4OA 4C3HJ 1PJRA 1TQMA 1U5TC 3OWTA 1D3YA 3KIOA 3V7SA 4BQAA 4I98B 2FUG2 2GM4A 2Q2EB 2W1OA 2O03A 3RQ4A 4A3FJ 5K5QA 2ZJQF 4DOZA 5KCMA 4ETSA 1LFPA 1V5FA 2UXUA 3MEXA 4ON0A 2ZNYA 3JRGA 3ELKA 4HNTA 1E2XA 2COMA 4YFXF 4A0XA 1X2MA 5ICGA 4JKZA 1YQAA 4M74A 2QEXI 3QPTA 3FXLA 5JHUA 3C7JA 3G4SI 1JGSA 2Y0SN 1CF7A 4EJWA 4OIOF 3BCAA 4MO7A 1D1AA 4A2UA 2HXIA 3TOAA 4RLFA 2ZJRF 4NQWB 3E6BA 5F27A 2VC1A 3IUOA 3PPBA 3ABTA 3U2RA 1A5JA 1TNSA 2EFPA 2Y9ZA 2VBZA 3EGQA 2MGQA 1F1ZA 3LNQA 4AYBN 1J75A 3KZ9A 2VIXA 5IOYA 2ZXIA 3T6NA 2ECCA 3K4CA 3CMYA 1RNLA 3E97A 3G3ZA 1IAWA 3GLXA 2R7VA 4ZJZA 5CXIA 3OV8A 1Y39A 1LVKA 2H6CA 1QPIA 2DFHA 3L09A 3P9TA 4PGGA 2LD5A 3NARA 3I59A 4M9ZA 3HYIA 5IY5H 3OS1A 2H8WA 3FDYA 2L9VA 2P4WA 2LRDA 2BY0A 2E5ZA 2ZCMA 5BPIA 1WI9A 4V2FA 5ILVA 2ZOZA 2PMUA 3GO5A 3W6KB 4CDGA 2KRHA 2P7VB 4BH9A 1YX3A 1OR7A 2GENA 4AVZA 4PK4A 3RQIA 1UB9A 5J4VA 1DUXC 3VVYA 3JTGA 1TW3A 4A3KJ 5DM7F 3IKVA 4LLLA 1DGWY 2KT0A 4BEHA 5DUIA 3JSOA 3O60A 2VC0A 2XAJA 2BY2A 2E36A 4FHTA 3ON4A 4XOPA 1MNMC 4D9JA 5LGNA 2EV0A 4PSWA 2WY8Q 3RDIA 3IH2A 2CFOA 5FLMJ 1RRJA 4U9NA 2GA1A 3K4LA 2IS4A 5JVTA 2ID3A 1IGNA 2YPRA 4R79A 1SFKA 1E3PA 2F5VA 2VASA 3BQYA 2A6HF 4Q48A 2TCTA 5D1RA 2JK3A 2E19A 4UUVA 4UUSB 2G7LA 2CQKA 3WU2C 2J5OA 4LGWA 2WUIA 4U0YA 5HDGA 4XORA 3TDZC 1JUPA 2LSOA 2AQFA 3H0GJ 3FHZA 3CDIA 1CQTA 2DW4A 3B02A 3FBNB 2QQAA 3KYDB 4XN0A 2PBXA 2H27A 2JUGA 3EYYA 1APLC 5FGMA 1D5YA 4IKFA 4B3XA 1E3OC 2CW8A 4HA8A 2BXYA 1Z05A 2O9LA 4A5NA 1X58A 5EJCA 1FYMA 4BYYA 1W0UA 4QIWN 2HFHA 2FNPA 3NXCA 1QZEA 3GW2A 2VQCA 2Y31A 4MNUA 3WU0A 4KMFA 3WGIA 4MEYF 1YOVB 2QKLB 3TQNA 2QOPA 2EPFA 5CQGA 4MQ9F 4XICA 1IN8A 4UNOA 4B4CA 3F8NA 4BHCA 4D5FA 2GWRA 4AF5A 4NUBA 1YE9A 5IOZA 3JSPA 2UXHA 2K27A 3LQRA 4CCNA 1IV6A 3FXOA 5FKLA 2CW7A 1GV5A 5GAGJ 4RGUA 2HU9A 3E6CC 1MMDA 3EUPA 4GCLA 4F93B 4XIDA 4GFBA 2BW3A 3FMSA 3NRVA 2HOSA 1XS9A 1PUFB 3HOVJ 5GPAA 1U2WA 4OAZA 5GTHC 3LA7A 3P9IA 2GAUA 2NS8A 2XAHA 4JQFA 1R71A 5E8IA 2Y69H 3L2UA 2F5DA 5E1ZB 4II3A 3F22A 3BROA 3BZKA 3ZR8X 2F5EA 2HXOA 1X1PA 2XPUA 4I7HA 1OCPA 3L1PA 1IC8A 3PL8A 3IHUA 3HPGA 4AIDA 3Q0WA 2NNNA 4HF0A 1QZZA 4Y17A 2M0MA 4Q4ZF 2DDBA 1F43A 3I54A 1ZELA 3HOTA 5FKMA 2G7HA 1Z6RA 1IG7A 4GO1A 4WXCA 3AFHA 3ESWB 2GXAA 3WTWC 1LDJA 1ONVA 1QVUA 3BCBA 1GDTA 5TJJA 2R7RA 2VQHA 3DP7A 1KQ8A 1FP1D 2V9VA 4MTDA 2KJBA 2VPLA 2JVHA 4L5JA 2RV8A 2WC2A 2IVMA 3LSPA 5JI6A 1O3SA 1TQPA 3ABKH 4M3EA 2CFXA 3KZZA 3ANGA 2HVSA 4BGDA 5CLSA 3U1KA 2GFNA 2L7MP 1UZCA 2KRCA 4HKUA 1B72A 3OIQA 1D1BA 1Y8RB 3QOEA 5BPDA 1MBGA 3LSTA 1RI7A 1USSA 1SFUA 1IXCA 5HSZA 1F36A 5E8GA 3MZYA 3WTUC 2LY1A 2MSYA 3RYPA 1YO5C 4I02A 3QYEA 1QA6A 1G3YA 3KPHA 3GCMA 2NAZA 3DQVC 2X1EA 3IH4A 5KVRA 3SZGA 4E7HA 5EZGA 1LPQA 3W2AA 1TP4A 1R1UA 2R7OA 2W4SA 3GTGJ 3R4KA 2KIMA 3OSFA 3COLA 5AIPA 4MFEA 2JTVA 3BG3A 1DU0A 4BKXA 1Y1WJ 3CJRB 2V6EA 3AAFA 1ZARA 3GF2A 3ON2A 3D5RC 2FNAA 1Z21A 2EZHA 3K4MA 4DNCA 2LKSA 5EG0A 2H1LA 2XRNA 3K1PA 1BJAA 5EDNA 4JX4A 2JA5J 2DA3A 1WJ5A 1WVRA 4MHGA 3P5JA 4FASD 3KE2A 1T0FA 1ZAOA 5EGOA 2AS5F 5F6FA 3E5QA 5KHDA 4ICHA 4WXDA 4PUSA 2O0YA 2A68F 3RKWA 4BBSJ 4RAFA 1X3ZB 3OYJA 1YW7A 2F5CA 1IRFA 2DAOA 2GOXB 3FXMA 5TISC 5C4XJ 3M8JA 1J9IA 2Y48A 3ZGKA 1ZTRA 2Y9YA 2KLOA 4OD5A 1JT0A 3NS4A 1V3FA 5F1JA 1R4MB 4KISA 2EV6A 1HW1A 2LOOA 1LQ1A 4MGRA 4NB5A 3OYIA 2IA0A 2R7TA 1ZQ3P 2BVLA 2Y75A 5IP6A 3OYEA 4R8HA 2XGEA 2YU9J 2XAQA 2L5QA 3I0TA 1VI0A 1ZG1A 1EH7A 2XPWA 1Z67A 5LHIA 1MDMA 1FJLA 2QKOA 2PG4A 1RZ4A 4KYWA 2B9SA 4RM3A 4BE0A 2K9MA 5HLTA 1Z7LA 2O61A 2CV2A 4NN1A 4BAYA 2DN0A 1T56A 2CU7A 2ECBA 2ZMEA 3BQZA 2CQQA 1W5SA 2EFQA 5FLVA 2RASA 4WXHA 1YJWI 1QBJA 3AQTA 3DTKA 4GXOA 4ENJA 2VB6A 3L2QA 5L3EA 3S8PA 4A12A 1K78A 1K7AA 2BOLA 1JI8A 2HYJA 4S04A 2CQXA 1Y6IA 2G7UA 4OD4A 4CCMA 1XB4A 2RC4A 2NNYA 2STWA 1B9MA 1V54H 1YIJI 3G73A 4U0WA 3EDPA 2HKUA 4XSZF 1CGPA 5HVQC 3GWZA 5E17F 3V42A 1FSEA 2AO9A 2F4OB 5E3NA 3K4BA 3JRBA 1HSJA 3Q0VA 5C44J 3UKGA 1AKHB 1FIPA 1O7LA 4MIMA 2F2EA 3QKXA 4A0ZA 2L0KA 5L3BA 3G71I 1YI2I 2ZY9A 3WTSC 3EUKL 3F3XA 4FX0A 3I64A 2DLLA 1IRGA 5CW8A 4XQFA 3WE3A 3E5XA 4YEJA 4BJ6C 4HX4A 5FROA 1BC7C 3R61A 4GYGA 5DDGA 4W1UA 2VODA 5D19A 4XRFA 5H6QA 3GYHX 1OKRA 3HHHA 3MQ0A 1IJWC 2R7WA 5EEAA 3V78A 1TLHB 2NVUB 4HEA2 4A0YA 1TWAJ 4LG0B 5ICFA 3BHQA 1IN7A 2L9NA 2VE8A 1OCCH 3SZPA 3JRDA 3W6VA 2WTEA 1KYZA 4CO8A 2HKXA 3HUGB 2LG4A 3DFGA 2DFEA 4A69C 2BEOA 2EIJH 4BE1A 2FBHA 3X2QH 4P5OA 1QHGA 3KFWX 3JR9A 4I6ZA 3F9KA 2LYCA 5K5OA 1FOXA 2EFNA 1U6GA 3CMEI 3FXQA 1GXQA 1VZ0A 2DA5A 4UVAA 5HLIA 2X85A 3HHGA 1VQLI 2ZSIB 1T33A 4RLQA 3CC2I 4B8XA 2XDNA 3LWJA 1UJ8A 2XB0X 4RA2A 2HR3A 5DUKA 3I56I 2K02A 2DG7A 2BHZA 4U9LA 1FT9A 3H1CA 4E7LA 3LQQA 3AQSA
chains in the Genus database with same CATH topology
2EZKA 2FX0A 1FIAA 3QPSA 4CYCB 1I50J 5J1RA 5E3OA 4AC0A 1K83J 1JGGA 2F07A 3TW7A 3BR0A 1BW6A 3F1BA 1LFBA 5JLXA 1JJ8C 2G7SA 1ETXA 3CQZJ 3S14J 4C3HJ 1LE8B 2IAIA 3ZQLA 2ID6A 3SFIA 5IYBJ 4MXMA 3JRFA 1WH5A 2K9NA 3KKDA 3LSGA 3VW2A 2GM4A 2D5VA 1SFOJ 2PMZN 4S0HB 1B8IA 1UI5A 4A3FJ 2UXUA 3JRGA 1B72B 2ME0A 2JA7J 4B1RA 1UHSA 3S1QJ 2E1OA 1JUSA 2DTZA 3NRGA 4JKZA 1X2MA 4D5CA 1UG2A 2M8GX 5FMPA 2JWTA 2FJ1A 4JX5A 2Y0SN 3O8GA 3IV5A 3BTLA 2JA8J 4MO7A 4GFKA 4ME9A 2HXIA 1K61A 2WB1N 2X9DA 3HOYJ 1I3QJ 5F27A 4IEJA 2NVYJ 3PPBA 3GZIA 5E3LA 1A5JA 1A6IA 2Y9ZA 1MH4A 3EGQA 2MGQA 1S7EA 3WHBA 4I76A 3LNQA 4AYBN 4HNVA 4AC6A 4IHXA 3KZ9A 5IOYA 4L62A 3T6NA 2ECCA 3CMYA 5FHPA 1G2HA 3HE0A 3BRUA 1ETQA 3FK6A 2L9RA 2VPRA 4D7MA 1DU6A 5CXIA 4CGRA 1QPIA 1TWCJ 3BTCA 3VIBA 3P9TA 4V2GA 4QSHA 2LLKA 3NARA 2LD5A 3JRHA 1U9NA 3S15J 2UXOA 4BY1J 1OJLA 3LSRA 5K7FA 2ZCMA 4V2FA 1WPKA 2NOGA 3B6AA 2ZOZA 2PZ9A 3GTLJ 2E2IJ 2GENA 5IYCJ 3JREA 4JP0A 2B63J 3RQIA 3VW0A 3VVYA 3VP5A 4XRMA 2FBQA 4A3KJ 2QCOA 1EF4A 4EEFG 3NPIA 5C4YA 3VVXA 2KT0A 2NP3A 1RPWA 1TC3C 4DW6A 3O60A 1MBHA 5FGLA 1OFCX 2JMWA 2LFBA 4X6AJ 2XGDA 4A3MJ 1P7JA 3ON4A 2ELKA 2R92J 1MNMC 3G7RA 3FK7A 4B3AA 3RZDJ 4ACIA 3FKIJ 3TW6A 3IH2A 2P81A 1PUFA 3GTPJ 3G1LA 5FLMJ 1HCRA 5IPAA 2QTQA 1B8IB 2ZB9A 3M3YJ 3FISA 2ID3A 1JKRC 1IGNA 2REKA 1HLVA 3HOXJ 3BQYA 2NX4A 2TCTA 5D1RA 2JK3A 2E19A 4UUSB 2G7LA 4FE7A 5F0CA 3GTKJ 5H9TA 1MSFC 2WUIA 2ME6A 2HDDA 3G1MA 2K40A 2X6OA 1JUPA 4FCYA 1FTZA 2IBDA 2YVEA 1HDDC 3H0GJ 1RKTA 1W0TA 4ABZA 1CQTA 2QF7A 2PBXA 3ZQHA 1APLC 3PO3J 1MBKA 3PO2J 5J3LA 1D5YA 1H8AC 5CXGA 1E3OC 4XK4A 1JKQC 2IEKA 2O9LA 1NTCA 2K9SA 1X58A 2HYTA 1W0UA 3RD3A 4QIWN 2GBYA 5K7ZA 3NXCA 5EFYA 4DYCA 3BR2A 3K2AA 1ORKA 1UMQA 2Y31A 4W97A 2DMQA 2EZLA 2YS9A 2IU5A 4MFDA 3HTAA 2M0CA 3JSJA 5J1UA 4JL3A 2QOPA 1FTTA 1BL0A 2ZCNA 4XICA 4DZJA 3ZQFA 3BR1A 4B4CA 2V57A 1YRNA 4D5FA 3CWRA 3I4NJ 1Y1VJ 4AF5A 2UXHA 1MBJA 5IOZA 2WV1A 3BR5A 1MBFA 4M3BA 1ZKGA 1IV6A 1U9OA 5BNGA 3OIOA 3C07A 4GCTA 5FKLA 4AUXA 4A3CJ 1GV5A 9ANTA 4XRSA 1WCMJ 3B6CA 4L5EA 3EUPA 1GV2A 1TWHJ 4GCLA 3CDLA 2M2EA 4XIDA 2AHQA 4GFBA 1VF9A 2RHAA 2R5ZA 2R5YA 2QWTA 2LY9A 1IDYA 2HOSA 4C3JJ 1XS9A 1PUFB 3HOVJ 5GPAA 5IP9J 2VKVA 1RETA 2COBA 2NS8A 4M3GA 1VNDA 5AQCA 3S2HJ 2Y2ZA 2LP0A 3HGGA 1SGMA 3VVZA 1JTXA 5HAWA 3VUQA 5C3EJ 2JA6J 4BY7J 2TRTA 1GT0C 3JRCA 2HXOA 2XPUA 3A01A 2K9QA 1OCPA 3L1PA 4JYKA 2CRGA 2X48A 1IC8A 1JKOC 1JTYA 1U8BA 3Q0WA 2I10A 3JRIA 1F43A 3MN2A 2LK2A 1ITYA 3VOXA 5FKMA 1ETYA 5IP7J 1Q1VA 2NS7A 1IG7A 4IHWA 2L7ZA 1IDZA 3GTOJ 3S1RJ 3HDDA 3BJBA 1JT6A 1SANA 5EYRA 2HI3A 3GEUA 1QVUA 2HOAA 1GDTA 3S1NJ 2RAEA 4DYRA 1Z0XA 2DA2A 3BR6A 1UI6A 3LJLA 1RKWA 3HEFA 2CUEA 4LOCA 4C2MJ 4GCKA 5EZHA 5D18A 3LSPA 3GTQJ 4M3FA 3H3VK 3OSGA 3WHCA 3BG5A 3TP3A 1GUUA 4A3DJ 2OI8A 2CUFA 3PM1A 4M3EA 4MLOA 3GTMJ 3ANGA 4IHYA 3ZOBA 5F0HA 3D1NI 2EBIA 1H89C 2OERA 1MH3A 1ENHA 2DA1A 5IYDJ 2L7MP 1BA5A 2GFNA 2E2HJ 4HKUA 1B72A 5DTDA 4FISA 5M5XJ 1MBGA 2EQRA 2O7TA 2DMPA 4UDSA 3BR3A 5HSZA 2DA4A 1XG1A 2LTPA 1F36A 5JLWA 2MSYA 4YZEA 3DPJA 2XPVA 2R5ZB 3IH4A 2NVXJ 5EZGA 2DA6A 2LKXA 3GTGJ 5M3MJ 3OSFA 3HOWJ 3M4OJ 1ZR4A 3COLA 4MFEA 3BG3A 4A3JJ 1DU0A 4BKXA 1Y1WJ 2VI6A 4DYQA 3K7AJ 3ON2A 1I6HJ 2R0QC 3V6GA 2EZHA 2CJJA 3CCYA 3AQSA 5EG0A 2OPTA 4A3EJ 3RZOJ 2VUMJ 2W48A 2L7FP 2G0EA 3TP0A 1WI3A 5EDNA 4JX4A 3BNIA 2JA5J 1ETOA 1OCTC 2ZCXA 2KDZA 1FEXA 2DA3A 3MVPA 4IHVA 4M3DA 1ETVA 5M5YJ 3HOUJ 2R7ZJ 1P7IA 3BTJA 3FIWA 2UXPA 2XSDC 5EGOA 3HIMA 1AKHA 4ICHA 5M5WJ 2WGBA 1GVDA 5FKNA 5EF6A 3BG9A 2DG8A 1TWFJ 1HDPA 4BBSJ 3VW1A 4QTRA 4M6VA 3CRJA 5GPCA 5C4XJ 4JX6A 3S16J 3VOKA 1ZTRA 2LVSA 2Y9YA 3QPLA 5FJ8J 3FRQA 1JT0A 4Y52J 5F1JA 1JUMA 1ZR2A 3Q0UA 1ZGWA 3LOCA 1ZQ3P 5IP6A 1NK2P 1ETKA 2H8RA 2XGEA 3CJDA 2YU9J 1POGA 2XGCA 2HOTA 1VI0A 2QKOA 2XPWA 1FJLA 5FKKA 2DMUA 3GBGA 4Y7NJ 1H88C 3NAUA 1JJ6C 4NDLA 2O7OA 4A93J 1ZK8A 2YVHA 2N8GA 3S5RA 4A3IJ 3IUVA 2NVTJ 4FTHA 3NI7A 1BW5A 5C4JJ 4UUSA 2EZIA 4NN1A 2DN0A 2CU7A 1T56A 2ECBA 4UUTA 2XRLA 2CQQA 3BQZA 3MKLA 5FLVA 2RASA 2G3BA 3BCGA 3G56A 4RDUA 3AQTA 1TWGJ 2NVQJ 3G1OA 2EH3A 3HOZJ 5E3MA 5GP9A 4G12A 4X1EA 4NELA 2O8KA 4RBOA 3HBLA 2HYJA 2FD5A 2H1KA 1AHDP 2CQXA 1JKPC 3SDGA 3HM5A 1BJZA 5K58A 1LFUP 1HF0A 4FE4A 5EG0B 2HKUA 3ZQCA 5DS9A 1QVTA 4J19A 2W53A 4C3IJ 3ZQGA 2FQ4A 1WGXA 1MSEC 4CYCA 3BT9A 4A3GJ 2AO9A 3E7LA 5E3NA 2QIBA 3S2DJ 3TEDA 3BTIA 3JRBA 3LSJA 5DAJA 1O4XA 5EGOB 3Q0VA 5C44J 1X2NA 3UKGA 1AKHB 1FIPA 2JN6A 2Q24A 3C2BA 3ZQIA 1LE8A 3E7QA 2GUHA 3NNRA 3PASA 4MIMA 3QKXA 2L0KA 5K7HA 1NK3P 3Q3SA 3DEWA 2MW8A 3I4MJ 5F0FA 2D6YA 1YRNB 2E2JJ 3A02A 4A3BJ 5CW8A 1IRZA 5FKOA 3LHQA 2HQ5A 5J1YA 4KWAA 3HTJA 3QBMA 4W1UA 1WH7A 3RKQA 5D19A 2MG4A 3GTJJ 1IJWC 5EEAA 3IH3A 3V78A 5F08A 2YUSA 1U78A 2LR8A 3JRAA 1TWAJ 4BXXJ 2NP5A 3S1MJ 3BHQA 5HODA 4DZPA 3HB9A 2XB5A 2R5YB 4XRSG 3MNLA 3JRDA 1RR7A 3S17J 2R93J 3W6VA 2GLOA 1AU7A 2OF7A 2ZOYA 1MBEA 1ETWA 2WAQN 2DMNA 3HKZN 4PXIA 1Z77A 3KNWA 4A69C 3HTHA 3ANPA 3QQAA 1R9TJ 3KKCA 4A3LJ 4GFLA 1IUFA 2Y30A 2UXIA 4JNNA 2DA7A 4BBRJ 3JR9A 4MK6A 4I6ZA 1HOMA 5HBUA 3VPRA 3RH2A 3A01B 2DA5A 3HGYA 1QRYA 3O8HA 3SJMA 1RESA 3F0CA 4D7NA 5M3FJ 3HTIA 5F04A 2DMTA 1XC5A 2M34A 1T33A 2G7GA 2XDNA 3LWJA 2XB0X 3DCFA 2DJNA 2DG7A 2VKEA 3B81A 3OOUA 2JJ7A 1VFCA 3A03A 2M9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZK A;  2FX0 A;  1FIA A;  3QPS A;  4CYC B;  1I50 J;  5J1R A;  5E3O A;  4AC0 A;  1K83 J;  1JGG A;  2F07 A;  3TW7 A;  3BR0 A;  1BW6 A;  3F1B A;  1LFB A;  5JLX A;  1JJ8 C;  2G7S A;  1ETX A;  3CQZ J;  3S14 J;  4C3H J;  1LE8 B;  2IAI A;  3ZQL A;  2ID6 A;  3SFI A;  5IYB J;  4MXM A;  3JRF A;  1WH5 A;  2K9N A;  3KKD A;  3LSG A;  3VW2 A;  2GM4 A;  2D5V A;  1SFO J;  2PMZ N;  4S0H B;  1B8I A;  1UI5 A;  4A3F J;  2UXU A;  3JRG A;  1B72 B;  2ME0 A;  2JA7 J;  4B1R A;  1UHS A;  3S1Q J;  2E1O A;  1JUS A;  2DTZ A;  3NRG A;  4JKZ A;  1X2M A;  4D5C A;  1UG2 A;  2M8G X;  5FMP A;  2JWT A;  2FJ1 A;  4JX5 A;  2Y0S N;  3O8G A;  3IV5 A;  3BTL A;  2JA8 J;  4MO7 A;  4GFK A;  4ME9 A;  2HXI A;  1K61 A;  2WB1 N;  2X9D A;  3HOY J;  1I3Q J;  5F27 A;  4IEJ A;  2NVY J;  3PPB A;  3GZI A;  5E3L A;  1A5J A;  1A6I A;  2Y9Z A;  1MH4 A;  3EGQ A;  2MGQ A;  1S7E A;  3WHB A;  4I76 A;  3LNQ A;  4AYB N;  4HNV A;  4AC6 A;  4IHX A;  3KZ9 A;  5IOY A;  4L62 A;  3T6N A;  2ECC A;  3CMY A;  5FHP A;  1G2H A;  3HE0 A;  3BRU A;  1ETQ A;  3FK6 A;  2L9R A;  2VPR A;  4D7M A;  1DU6 A;  5CXI A;  4CGR A;  1QPI A;  1TWC J;  3BTC A;  3VIB A;  3P9T A;  4V2G A;  4QSH A;  2LLK A;  3NAR A;  2LD5 A;  3JRH A;  1U9N A;  3S15 J;  2UXO A;  4BY1 J;  1OJL A;  3LSR A;  5K7F A;  2ZCM A;  4V2F A;  1WPK A;  2NOG A;  3B6A A;  2ZOZ A;  2PZ9 A;  3GTL J;  2E2I J;  2GEN A;  5IYC J;  3JRE A;  4JP0 A;  2B63 J;  3RQI A;  3VW0 A;  3VVY A;  3VP5 A;  4XRM A;  2FBQ A;  4A3K J;  2QCO A;  1EF4 A;  4EEF G;  3NPI A;  5C4Y A;  3VVX A;  2KT0 A;  2NP3 A;  1RPW A;  1TC3 C;  4DW6 A;  3O60 A;  1MBH A;  5FGL A;  1OFC X;  2JMW A;  2LFB A;  4X6A J;  2XGD A;  4A3M J;  1P7J A;  3ON4 A;  2ELK A;  2R92 J;  1MNM C;  3G7R A;  3FK7 A;  4B3A A;  3RZD J;  4ACI A;  3FKI J;  3TW6 A;  3IH2 A;  2P81 A;  1PUF A;  3GTP J;  3G1L A;  5FLM J;  1HCR A;  5IPA A;  2QTQ A;  1B8I B;  2ZB9 A;  3M3Y J;  3FIS A;  2ID3 A;  1JKR C;  1IGN A;  2REK A;  1HLV A;  3HOX J;  3BQY A;  2NX4 A;  2TCT A;  5D1R A;  2JK3 A;  2E19 A;  4UUS B;  2G7L A;  4FE7 A;  5F0C A;  3GTK J;  5H9T A;  1MSF C;  2WUI A;  2ME6 A;  2HDD A;  3G1M A;  2K40 A;  2X6O A;  1JUP A;  4FCY A;  1FTZ A;  2IBD A;  2YVE A;  1HDD C;  3H0G J;  1RKT A;  1W0T A;  4ABZ A;  1CQT A;  2QF7 A;  2PBX A;  3ZQH A;  1APL C;  3PO3 J;  1MBK A;  3PO2 J;  5J3L A;  1D5Y A;  1H8A C;  5CXG A;  1E3O C;  4XK4 A;  1JKQ C;  2IEK A;  2O9L A;  1NTC A;  2K9S A;  1X58 A;  2HYT A;  1W0U A;  3RD3 A;  4QIW N;  2GBY A;  5K7Z A;  3NXC A;  5EFY A;  4DYC A;  3BR2 A;  3K2A A;  1ORK A;  1UMQ A;  2Y31 A;  4W97 A;  2DMQ A;  2EZL A;  2YS9 A;  2IU5 A;  4MFD A;  3HTA A;  2M0C A;  3JSJ A;  5J1U A;  4JL3 A;  2QOP A;  1FTT A;  1BL0 A;  2ZCN A;  4XIC A;  4DZJ A;  3ZQF A;  3BR1 A;  4B4C A;  2V57 A;  1YRN A;  4D5F A;  3CWR A;  3I4N J;  1Y1V J;  4AF5 A;  2UXH A;  1MBJ A;  5IOZ A;  2WV1 A;  3BR5 A;  1MBF A;  4M3B A;  1ZKG A;  1IV6 A;  1U9O A;  5BNG A;  3OIO A;  3C07 A;  4GCT A;  5FKL A;  4AUX A;  4A3C J;  1GV5 A;  9ANT A;  4XRS A;  1WCM J;  3B6C A;  4L5E A;  3EUP A;  1GV2 A;  1TWH J;  4GCL A;  3CDL A;  2M2E A;  4XID A;  2AHQ A;  4GFB A;  1VF9 A;  2RHA A;  2R5Z A;  2R5Y A;  2QWT A;  2LY9 A;  1IDY A;  2HOS A;  4C3J J;  1XS9 A;  1PUF B;  3HOV J;  5GPA A;  5IP9 J;  2VKV A;  1RET A;  2COB A;  2NS8 A;  4M3G A;  1VND A;  5AQC A;  3S2H J;  2Y2Z A;  2LP0 A;  3HGG A;  1SGM A;  3VVZ A;  1JTX A;  5HAW A;  3VUQ A;  5C3E J;  2JA6 J;  4BY7 J;  2TRT A;  1GT0 C;  3JRC A;  2HXO A;  2XPU A;  3A01 A;  2K9Q A;  1OCP A;  3L1P A;  4JYK A;  2CRG A;  2X48 A;  1IC8 A;  1JKO C;  1JTY A;  1U8B A;  3Q0W A;  2I10 A;  3JRI A;  1F43 A;  3MN2 A;  2LK2 A;  1ITY A;  3VOX A;  5FKM A;  1ETY A;  5IP7 J;  1Q1V A;  2NS7 A;  1IG7 A;  4IHW A;  2L7Z A;  1IDZ A;  3GTO J;  3S1R J;  3HDD A;  3BJB A;  1JT6 A;  1SAN A;  5EYR A;  2HI3 A;  3GEU A;  1QVU A;  2HOA A;  1GDT A;  3S1N J;  2RAE A;  4DYR A;  1Z0X A;  2DA2 A;  3BR6 A;  1UI6 A;  3LJL A;  1RKW A;  3HEF A;  2CUE A;  4LOC A;  4C2M J;  4GCK A;  5EZH A;  5D18 A;  3LSP A;  3GTQ J;  4M3F A;  3H3V K;  3OSG A;  3WHC A;  3BG5 A;  3TP3 A;  1GUU A;  4A3D J;  2OI8 A;  2CUF A;  3PM1 A;  4M3E A;  4MLO A;  3GTM J;  3ANG A;  4IHY A;  3ZOB A;  5F0H A;  3D1N I;  2EBI A;  1H89 C;  2OER A;  1MH3 A;  1ENH A;  2DA1 A;  5IYD J;  2L7M P;  1BA5 A;  2GFN A;  2E2H J;  4HKU A;  1B72 A;  5DTD A;  4FIS A;  5M5X J;  1MBG A;  2EQR A;  2O7T A;  2DMP A;  4UDS A;  3BR3 A;  5HSZ A;  2DA4 A;  1XG1 A;  2LTP A;  1F36 A;  5JLW A;  2MSY A;  4YZE A;  3DPJ A;  2XPV A;  2R5Z B;  3IH4 A;  2NVX J;  5EZG A;  2DA6 A;  2LKX A;  3GTG J;  5M3M J;  3OSF A;  3HOW J;  3M4O J;  1ZR4 A;  3COL A;  4MFE A;  3BG3 A;  4A3J J;  1DU0 A;  4BKX A;  1Y1W J;  2VI6 A;  4DYQ A;  3K7A J;  3ON2 A;  1I6H J;  2R0Q C;  3V6G A;  2EZH A;  2CJJ A;  3CCY A;  3AQS A;  5EG0 A;  2OPT A;  4A3E J;  3RZO J;  2VUM J;  2W48 A;  2L7F P;  2G0E A;  3TP0 A;  1WI3 A;  5EDN A;  4JX4 A;  3BNI A;  2JA5 J;  1ETO A;  1OCT C;  2ZCX A;  2KDZ A;  1FEX A;  2DA3 A;  3MVP A;  4IHV A;  4M3D A;  1ETV A;  5M5Y J;  3HOU J;  2R7Z J;  1P7I A;  3BTJ A;  3FIW A;  2UXP A;  2XSD C;  5EGO A;  3HIM A;  1AKH A;  4ICH A;  5M5W J;  2WGB A;  1GVD A;  5FKN A;  5EF6 A;  3BG9 A;  2DG8 A;  1TWF J;  1HDP A;  4BBS J;  3VW1 A;  4QTR A;  4M6V A;  3CRJ A;  5GPC A;  5C4X J;  4JX6 A;  3S16 J;  3VOK A;  1ZTR A;  2LVS A;  2Y9Y A;  3QPL A;  5FJ8 J;  3FRQ A;  1JT0 A;  4Y52 J;  5F1J A;  1JUM A;  1ZR2 A;  3Q0U A;  1ZGW A;  3LOC A;  1ZQ3 P;  5IP6 A;  1NK2 P;  1ETK A;  2H8R A;  2XGE A;  3CJD A;  2YU9 J;  1POG A;  2XGC A;  2HOT A;  1VI0 A;  2QKO A;  2XPW A;  1FJL A;  5FKK A;  2DMU A;  3GBG A;  4Y7N J;  1H88 C;  3NAU A;  1JJ6 C;  4NDL A;  2O7O A;  4A93 J;  1ZK8 A;  2YVH A;  2N8G A;  3S5R A;  4A3I J;  3IUV A;  2NVT J;  4FTH A;  3NI7 A;  1BW5 A;  5C4J J;  4UUS A;  2EZI A;  4NN1 A;  2DN0 A;  2CU7 A;  1T56 A;  2ECB A;  4UUT A;  2XRL A;  2CQQ A;  3BQZ A;  3MKL A;  5FLV A;  2RAS A;  2G3B A;  3BCG A;  3G56 A;  4RDU A;  3AQT A;  1TWG J;  2NVQ J;  3G1O A;  2EH3 A;  3HOZ J;  5E3M A;  5GP9 A;  4G12 A;  4X1E A;  4NEL A;  2O8K A;  4RBO A;  3HBL A;  2HYJ A;  2FD5 A;  2H1K A;  1AHD P;  2CQX A;  1JKP C;  3SDG A;  3HM5 A;  1BJZ A;  5K58 A;  1LFU P;  1HF0 A;  4FE4 A;  5EG0 B;  2HKU A;  3ZQC A;  5DS9 A;  1QVT A;  4J19 A;  2W53 A;  4C3I J;  3ZQG A;  2FQ4 A;  1WGX A;  1MSE C;  4CYC A;  3BT9 A;  4A3G J;  2AO9 A;  3E7L A;  5E3N A;  2QIB A;  3S2D J;  3TED A;  3BTI A;  3JRB A;  3LSJ A;  5DAJ A;  1O4X A;  5EGO B;  3Q0V A;  5C44 J;  1X2N A;  3UKG A;  1AKH B;  1FIP A;  2JN6 A;  2Q24 A;  3C2B A;  3ZQI A;  1LE8 A;  3E7Q A;  2GUH A;  3NNR A;  3PAS A;  4MIM A;  3QKX A;  2L0K A;  5K7H A;  1NK3 P;  3Q3S A;  3DEW A;  2MW8 A;  3I4M J;  5F0F A;  2D6Y A;  1YRN B;  2E2J J;  3A02 A;  4A3B J;  5CW8 A;  1IRZ A;  5FKO A;  3LHQ A;  2HQ5 A;  5J1Y A;  4KWA A;  3HTJ A;  3QBM A;  4W1U A;  1WH7 A;  3RKQ A;  5D19 A;  2MG4 A;  3GTJ J;  1IJW C;  5EEA A;  3IH3 A;  3V78 A;  5F08 A;  2YUS A;  1U78 A;  2LR8 A;  3JRA A;  1TWA J;  4BXX J;  2NP5 A;  3S1M J;  3BHQ A;  5HOD A;  4DZP A;  3HB9 A;  2XB5 A;  2R5Y B;  4XRS G;  3MNL A;  3JRD A;  1RR7 A;  3S17 J;  2R93 J;  3W6V A;  2GLO A;  1AU7 A;  2OF7 A;  2ZOY A;  1MBE A;  1ETW A;  2WAQ N;  2DMN A;  3HKZ N;  4PXI A;  1Z77 A;  3KNW A;  4A69 C;  3HTH A;  3ANP A;  3QQA A;  1R9T J;  3KKC A;  4A3L J;  4GFL A;  1IUF A;  2Y30 A;  2UXI A;  4JNN A;  2DA7 A;  4BBR J;  3JR9 A;  4MK6 A;  4I6Z A;  1HOM A;  5HBU A;  3VPR A;  3RH2 A;  3A01 B;  2DA5 A;  3HGY A;  1QRY A;  3O8H A;  3SJM A;  1RES A;  3F0C A;  4D7N A;  5M3F J;  3HTI A;  5F04 A;  2DMT A;  1XC5 A;  2M34 A;  1T33 A;  2G7G A;  2XDN A;  3LWJ A;  2XB0 X;  3DCF A;  2DJN A;  2DG7 A;  2VKE A;  3B81 A;  3OOU A;  2JJ7 A;  1VFC A;  3A03 A;  2M9H A; 
#chains in the Genus database with same CATH topology
 3QPS A;  3CF5 F;  2E1M B;  4DVY P;  4G7H F;  3V8K A;  1FNN A;  1B9N A;  4EJU A;  1G6N A;  4EM1 A;  4B43 A;  1LE8 B;  4HYE A;  3RYR A;  2PBI A;  4G7O F;  2HKO A;  3JRF A;  3KKD A;  2MLG A;  3R60 A;  1LDK B;  3M1E A;  3C18 A;  4AU7 A;  5BQT A;  3E5U A;  3S3O A;  2KRF A;  1B8I A;  1XMA A;  2M3A A;  1YLF A;  1ZG3 A;  3TO7 A;  3ONQ A;  1D1C A;  3DEE A;  3W3C A;  3ASO H;  2ME0 A;  4A6D A;  2JA7 J;  1UHS A;  3S1Q J;  1ON2 A;  1MMA A;  3TO9 A;  4D5C A;  4YIR X;  1UG2 A;  2M8G X;  1MMG A;  2FJ1 A;  2GOM A;  3RKY A;  2BZT A;  3CES A;  3FX3 A;  4AVP A;  3IV5 A;  3BTL A;  4UVB A;  5FD5 A;  4OIP F;  2IA1 A;  3O6B B;  3S3M A;  4PJM A;  2RQP A;  2W82 A;  4HQM A;  1VQM I;  1S5L C;  5E3L A;  1A6I A;  3BC8 A;  3LA2 A;  4TV7 A;  4YIF A;  4HNU A;  3I71 A;  3WHB A;  3CUQ A;  4AIJ A;  2LH9 A;  1R36 A;  4HNV A;  1R5G A;  1G59 A;  4IHX A;  2MH2 A;  1Z3Y A;  1G2H A;  3BRU A;  1ETQ A;  4N9H A;  3ZN0 A;  2VPR A;  4XLN F;  1DU6 A;  5J6X A;  1TZL A;  2A69 F;  2X4H A;  5CVI A;  1S7A A;  1TWC J;  1O7F A;  2UXX A;  3VIB A;  4V2G A;  2XAF A;  2UXO A;  3JRH A;  4JOM A;  1TQI A;  5IT3 A;  2VBW A;  2W7N A;  4LIU A;  3CJT B;  2PMH A;  4L9N A;  1WJA A;  4FT8 A;  3JCU C;  5K7F A;  1Y56 A;  2X6X A;  2GIZ A;  1WPK A;  2PZ9 A;  3GTL J;  3CCV I;  2E2I J;  2F4M B;  3A0H C;  2RNJ A;  5CPR B;  3RPQ A;  3W2V A;  5IYC J;  1D0X A;  4D1Q A;  2LRE A;  2B63 J;  3K0L A;  2CV0 A;  3VW0 A;  2NOJ B;  1ZYR F;  3IC7 A;  5H2F C;  2Z1D A;  2QCO A;  1SVM A;  5DD8 A;  4E4H A;  3ABU A;  4LK0 F;  2P5L C;  4EEF G;  3E6D A;  2NP3 A;  3J80 Z;  5FGL A;  3EUA A;  2LFB A;  2JQ7 A;  2PJP A;  1VQ7 I;  4IRH A;  2XGD A;  2DOD A;  2ELK A;  2R92 J;  4F3Q A;  2V26 A;  3CDH A;  1REP C;  2FML A;  1VQ9 I;  2EV5 A;  3WTX C;  5HS9 A;  1SFX A;  3C1D A;  3M3Y J;  3M9A A;  4C2T A;  1U5T A;  3K4J A;  5HDN A;  2NX4 A;  3FKJ A;  2E1N A;  1T38 A;  3SXY A;  2DQR A;  1R49 A;  2L7K A;  2M30 A;  3JW4 A;  3NWS A;  5ILS A;  2DFF A;  5DD4 A;  3D5L A;  2HDD A;  4ZDO A;  3OS2 A;  3CCU I;  1CF7 B;  2IBD A;  5J8C A;  2QWW A;  4ENM A;  4XNF A;  1HDD C;  4XLH A;  1IV8 A;  1RKT A;  3QPH A;  1W0T A;  4ABZ A;  5DCF A;  2QF7 A;  3NEU A;  1BN5 A;  2Z9O A;  3WTT C;  1H8A C;  3BG6 A;  2E1M C;  2ZFU A;  4XK4 A;  2LBF B;  2K5C A;  1JKQ C;  1NTC A;  2MD0 A;  2HYT A;  3HJE A;  3RD3 A;  4ESB A;  5LHH A;  5EFY A;  1J59 A;  3K2A A;  1ORK A;  1UMQ A;  3C2H A;  2BV6 A;  4UB8 C;  2YX4 A;  3G2B A;  2X6W A;  4W97 A;  1W36 C;  2YS9 A;  5IT9 K;  1A04 A;  3I59 B;  2OZ6 A;  3HTA A;  2P6T A;  4A5M A;  3Q5F A;  3R6S A;  1YJN I;  2STT A;  5E1X A;  3L7W A;  3JSJ A;  3GZ5 A;  1DDN A;  3LSH A;  2B7E A;  1BL0 A;  4BXU A;  4DZJ A;  5LFA A;  1JE8 A;  1QPM A;  3BR1 A;  1YG2 A;  2MFZ A;  2M8E A;  2JSC A;  3I4N J;  1Y1V J;  3CWR A;  1MBJ A;  2X0L A;  2WV1 A;  3BPX A;  2D45 A;  1MBF A;  3CCL I;  2R7U A;  3V8J A;  4XKW A;  4ZTJ A;  3OIO A;  2CUZ A;  2MC3 A;  4GCT A;  4AUX A;  3B6C A;  2DOF A;  2JVG A;  2MYS A;  2XKO A;  3AG1 H;  4BEH B;  2ZBK A;  1TWH J;  2R7D A;  1W36 D;  2M2E A;  2VBX A;  2DOE A;  1VF9 A;  1J0R A;  2R5Z A;  2R5Y A;  1QHH D;  2QWT A;  3V7R A;  1FP2 A;  2HTJ A;  2LNB A;  3AG4 H;  2QKM B;  4HLX A;  1EKE A;  2VKV A;  1RET A;  3GX4 X;  3HTS B;  5FRM A;  4XKV A;  4M3G A;  1P92 A;  1HW5 A;  3DWL E;  4K2E A;  1Z7U A;  3FWE A;  5D6F A;  5DYM A;  4BJT A;  5HAW A;  3VUQ A;  2WY7 Q;  1FSH A;  1Q1H A;  5HLG A;  2JA6 J;  4BY7 J;  1O3T A;  3CC7 I;  3LAJ A;  4HLY A;  3JRC A;  4LD5 A;  1R00 A;  1VQK I;  1X4P A;  3I53 A;  2K9Q A;  2X48 A;  2CRG A;  1XN7 A;  3GFL A;  1JKO C;  1JTY A;  1S72 I;  1ACI A;  2XIG A;  2BBY A;  3DKY A;  3O2P E;  1OPC A;  2BHY A;  5JR3 A;  2E5N A;  1SD7 A;  4IOC F;  2I10 A;  3H36 A;  1BI1 A;  2HYF A;  3MN2 A;  3QU6 A;  2LK2 A;  3VSK A;  1LNW A;  4II2 A;  1T08 B;  3VOX A;  1ETY A;  5IP7 J;  3GEZ A;  3GTO J;  3HDD A;  5J4Y A;  3GEU A;  2V1N A;  2ZO4 A;  1LKX A;  4L9J A;  4FX4 A;  3WTY C;  1ZGJ A;  5H20 A;  1MNE A;  2VN2 A;  4DYR A;  2DA2 A;  3LJL A;  2CUE A;  4LOC A;  4C2M J;  1Z91 A;  3OYD A;  1V5E A;  4F52 A;  1G3S A;  5D18 A;  2CS3 A;  4GYI A;  2Q2E A;  1LUJ B;  5D4S A;  3IAM 2;  4A3D J;  4BQQ A;  2EWN A;  2QUF A;  3EYI A;  3D1N I;  4G6Q A;  3GZ6 A;  2V1U A;  2L01 A;  1ENH A;  1X1C A;  5IYD J;  3CP2 A;  1BA5 A;  4FIS A;  4BHB A;  5M5X J;  5FLX Z;  2O7T A;  3GUD A;  1E17 A;  2BXZ A;  3BR3 A;  2DA4 A;  2LTP A;  4N0B A;  1XDU A;  4YZE A;  3H9Q A;  3VYT B;  2K7L A;  2DPU A;  1HQC A;  2W24 A;  2XPV A;  5J47 A;  3DPJ A;  2KMU A;  2DA6 A;  3CP8 A;  4G6D A;  4NQW A;  5M3M J;  3M4O J;  3HOW J;  1ZR4 A;  1I3A A;  4EVI A;  2CH0 A;  4A3J J;  4EQQ A;  3FM5 A;  2ELH A;  1K6O A;  2R0Q C;  4E7K A;  1ZN2 A;  2J5P A;  2W25 A;  5LEK A;  2XAS A;  2OPT A;  5LD2 C;  5FRN A;  3RZO J;  2W48 A;  3DTE A;  4HPQ A;  3TP0 A;  3MAJ A;  3O3K A;  4G7Z F;  1V4R A;  1OCT C;  2KDZ A;  1FEX A;  3MVP A;  4M3D A;  2EIN H;  1N77 A;  1LJ9 A;  3DPU A;  3KEO A;  3VOD A;  2UXP A;  3BTJ A;  1G8X A;  2XSD C;  1OR7 C;  1KZH A;  1OIS A;  4IO9 F;  1GVD A;  1ZGA A;  3GFJ A;  4DJA A;  5EF6 A;  3DLL F;  4J00 A;  1YFH A;  2K4B A;  1HDP A;  5KAI C;  3VW1 A;  4KIB A;  2RNG A;  1STZ A;  4LMY A;  1KQ9 A;  1YIO A;  3OYC A;  2KKO A;  4PDK A;  3WOD F;  4Y13 A;  2LF8 A;  4JX6 A;  3MKW B;  2O6G E;  3S16 J;  3VOK A;  5B1A H;  2MA3 A;  3QPL A;  3FRQ A;  1ON1 A;  1UHM A;  1VQ5 I;  3LOC A;  3DLA A;  4EAT A;  4Y3O A;  4KN7 X;  2DT5 A;  1NK2 P;  1ETK A;  2H8R A;  3DU5 A;  2VOO A;  1T98 A;  4XM3 A;  5FKK A;  5J40 A;  2DMU A;  3FMR A;  4J01 A;  4HG2 A;  3OYF A;  2ESH A;  4RGS A;  2HZT A;  3ZN1 A;  2BY3 A;  4NDL A;  4PJ0 C;  3EUH C;  4XL9 A;  4CCL A;  3MKZ A;  1PP8 F;  4A3I J;  3H9G A;  3IUV A;  1Z3X A;  2ACJ A;  1X19 A;  1K4S A;  4BDY A;  4UUS A;  1VQO I;  4MEX F;  4P1W A;  1RR8 C;  1I6X A;  3ZMU A;  3P9K A;  2KPM A;  4UUT A;  5JVG F;  3TKY A;  2G3B A;  1W7P B;  1TWG J;  1E0E A;  4ENN A;  5E3M A;  4XLP F;  4G12 A;  1Y0U A;  4X1E A;  4ZZL A;  4I09 A;  2O8K A;  4RBO A;  3HBL A;  2ZCW A;  2FD5 A;  3SDG A;  3HM5 A;  3PFI A;  1BJZ A;  2TDX A;  1F5T A;  1SMY F;  1TT5 B;  3MNL A;  5K58 A;  3OYL A;  3NWT A;  4KIC A;  4FE4 A;  2WWY A;  1FYK A;  2XVC A;  5EG0 B;  3J7A Y;  4ZYA A;  3ZQC A;  4J19 A;  4FET A;  1HKS A;  4C3I J;  1QNT A;  1MMN A;  1WJF A;  3OYM A;  1MSE C;  3BT9 A;  4A3G J;  4KIF A;  4OMY A;  1LB2 A;  2QIB A;  3GFI A;  2NS0 A;  1R5H A;  3IAS 2;  5EGO B;  1EJ9 A;  4E70 A;  2OA4 A;  3NNR A;  3L2R A;  4OOI A;  3ZQI A;  2GUH A;  4C30 A;  1E3H A;  2FSW A;  3WU1 B;  2BY1 A;  1FMW A;  2PMZ A;  5CYV A;  1YTY A;  1EH8 A;  3DEW A;  3I4M J;  3IWZ A;  5F0F A;  5HDK A;  2EA4 A;  1DP3 A;  1YRN B;  2E2J J;  3A02 A;  3U21 A;  4EJV A;  5IT9 Z;  1U0J A;  4HX8 A;  3CJQ B;  1WFX A;  2HQ5 A;  4KWA A;  2A6T A;  3HTJ A;  1WH7 A;  1AA7 A;  2QQ9 A;  3QAH A;  3ZQQ A;  2BE5 F;  1DPR A;  5B66 C;  2VT3 A;  3GTJ J;  2AQE A;  3K8P C;  4PJL A;  3KEY A;  5F08 A;  1MND A;  2LR8 A;  5A2Q K;  4XON A;  2HTS A;  3JRA A;  3M07 A;  3QP6 A;  3S1M J;  2NP5 A;  4PJJ A;  1M1E B;  2WB1 A;  3ZMV A;  2W57 A;  2XB5 A;  3L9F A;  1OCO H;  2DQL A;  4XRS G;  1K6Y A;  1HBX G;  1XMX A;  1RR7 A;  2X51 A;  3PNT A;  4KMU X;  4HF2 A;  4HST A;  2R93 J;  2ESN A;  3S17 J;  1BOA A;  2CSO A;  3KZI C;  1FOK A;  3IRQ A;  2OF7 A;  4N4O B;  1P6R A;  3M8F A;  2V4J C;  4KIG A;  1MBE A;  4RB3 C;  2DMN A;  2L4M A;  4PXI A;  3F8M A;  1Z77 A;  2R7F A;  2QYO A;  4XR6 A;  3IRR A;  3HTH A;  5LLQ A;  2FRH A;  3KKC A;  1R9T J;  1IUF A;  3VOE A;  1T39 A;  2ZME B;  3QOD A;  4BBR J;  1T2K A;  3FHN A;  4BAC A;  5HBU A;  3VPR A;  3RH2 A;  3A01 B;  4ZYE A;  3HGY A;  4HV5 A;  4H4K C;  1FLI A;  1RES A;  4HOB A;  3BLY A;  4PFP A;  4R1H A;  1Z1D A;  1XC5 A;  2M34 A;  1B59 A;  3VEP A;  1UEL B;  4BU2 A;  5DCM B;  1J7K A;  1OMI A;  3B73 A;  2DJN A;  2QSF X;  2E35 A;  2QSG X;  2VKE A;  1R5I D;  5LGU A;  3N4M A;  3OOU A;  2E71 A;  4QPO A;  3CC4 I;  3M7G A;  3RI4 A;  3A03 A;  2M9H A;  2FX0 A;  2IGK A;  3VSL A;  2Q0O A;  3CCM I;  5E3O A;  1XDS A;  4AC0 A;  2QM3 A;  3I4P A;  3BR0 A;  1BW6 A;  3A4C A;  5EEG A;  1RUN A;  1LFB A;  3LFU A;  1T6S A;  1JJ8 C;  4RAY A;  2FU4 A;  1OYI A;  2G7S A;  3BDD A;  3CQZ J;  3ZMS A;  2XAG A;  3S14 J;  3N97 A;  3I9V 2;  1Z6T A;  2E7W A;  3ECO A;  4ZDP A;  3SFI A;  1SVL A;  1WH5 A;  2K9N A;  3CMA I;  3VW2 A;  2A5Y B;  1OCZ H;  2M7A A;  5BS6 A;  2D5V A;  3CJN A;  1UI5 A;  4E7S A;  2ZJ2 A;  3I5U A;  3VYU B;  2VL8 A;  3GZN B;  4IHT A;  1ULY A;  1U8R A;  1JUS A;  2OTL I;  3P9C A;  5FMP A;  2JWT A;  5HOO A;  5GTI C;  1DPU A;  3MMY B;  4YG2 F;  2RN7 A;  2AXL A;  3I3L A;  4GFK A;  1K61 A;  3CO6 C;  5K5R A;  2PFB A;  1IO2 A;  4OIQ F;  3GZI A;  3JAM K;  1MH4 A;  2KHM A;  1YS7 A;  4A6E A;  4I76 A;  5GAE J;  1W7P D;  4AC6 A;  4L62 A;  3GME A;  1ZLJ A;  4RGR A;  5ED4 A;  1NHA A;  1I1G A;  2YSR A;  4RAZ A;  1RUO A;  4M71 A;  5FHP A;  2HQA A;  4AM3 A;  3FM3 A;  4KDP A;  3FK6 A;  2L9R A;  3F8F A;  4D7M A;  3QWL A;  2EIM H;  1FX7 A;  3TL4 X;  3HSF A;  3BTC A;  3K9T A;  1PUE E;  4Q5S F;  2E7X A;  3MZ8 A;  4QSH A;  4YII A;  3K70 C;  1U9N A;  4BY1 J;  2VJI A;  4XLC A;  3K69 A;  3BJO A;  2CV1 A;  3RJP A;  3KP3 A;  2NOG A;  1TTY A;  2ICW G;  2HS5 A;  2LKP A;  3DBH B;  3JRE A;  4JP0 A;  1VQN I;  2OC6 A;  3ROU A;  4UXN A;  2RGV A;  4KT5 C;  4KFC A;  3OR2 C;  3VP5 A;  2EB7 A;  5ERI A;  1HC8 A;  2FBQ A;  5F64 A;  1HST A;  1V55 H;  1KU3 A;  3EQL F;  5DV5 A;  1EF4 A;  5C4Y A;  2EK5 A;  2KFD A;  3GLL A;  3VVX A;  1RPW A;  1TC3 C;  5ICE A;  4DW6 A;  3K70 D;  1F4K A;  2JMW A;  3H5R A;  4L0Y B;  2OQG A;  3ZMZ A;  3LL7 A;  2QSH X;  2A2F X;  4A3M J;  1IN4 A;  1C0W A;  3G7R A;  2ISZ A;  4B3A A;  4ACI A;  3DU6 A;  3TW6 A;  3CF2 A;  2P81 A;  3REO A;  3WGG A;  3G1L A;  1HCR A;  2QTQ A;  2OCC H;  1B8I B;  5ILU A;  2WAE A;  3FIS A;  3HC7 A;  2XV4 S;  1JKR C;  1HLV A;  3E1S A;  2P7C B;  4LG3 A;  4FE7 A;  5F0C A;  2O3F A;  3UNG C;  1OQY A;  4PGH A;  1ZRD A;  4UVC A;  1G3W A;  1XCV A;  1P4X A;  2ZJP F;  2LMD A;  4L18 B;  2YVE A;  3HPH A;  2OCE A;  1D0Y A;  3HSR A;  4IRV A;  1PYV A;  3K2Z A;  3NQO A;  4QPQ A;  3ZQH A;  3QP5 A;  3PO2 J;  1MBK A;  3WE2 A;  5F1R A;  1TT0 A;  2OV7 A;  4DGW B;  3PQK A;  2VON A;  5E18 F;  6PAX A;  2H94 A;  4AD9 A;  3MKY B;  2FE3 A;  2GBY A;  5K7Z A;  1BC8 C;  3BR2 A;  4PCQ A;  4BJ5 C;  1ZRC A;  3H5A A;  4N9I A;  3CLO A;  3KLO A;  2BVM A;  2EZL A;  5FFZ A;  1WWX A;  3SHF A;  2P5V A;  4MFD A;  3QOP A;  2XRO A;  2UUZ A;  2RDP A;  3PUB A;  5J1U A;  4JL3 A;  2I5U A;  2M4G A;  1FTT A;  3OL4 A;  2ZCN A;  4JBA A;  3HG9 A;  3SDB A;  2V57 A;  1DP7 P;  4DQ2 A;  1L3L A;  3F21 A;  4IQ4 A;  1FBU A;  4RM2 A;  4M3B A;  5E1W A;  2W00 A;  1EH6 A;  1U9O A;  1R7J A;  4P96 A;  3C07 A;  3VWB A;  1LEA A;  2IT0 A;  5D5X B;  4XRS A;  1GV2 A;  4LG0 A;  4N4N B;  1VQ8 I;  4M9S A;  4I01 A;  2AHQ A;  3BWG A;  4KNY A;  3OMY A;  4NC7 A;  2Q8K A;  1R1T A;  2LY9 A;  4E7I A;  1IDY A;  4U88 A;  1D5V A;  3ABL H;  4C3J J;  3U1D A;  1TBX A;  4ESJ A;  1P2F A;  5HS8 A;  1YW9 A;  4GRI A;  5IP9 J;  3HUG A;  3DXJ F;  3KCC A;  5A2Q Z;  4WIB A;  2COB A;  2JUC A;  1U5T B;  2CGP A;  2IRF G;  2WV0 A;  3AG3 H;  1VND A;  1R23 A;  1PP7 U;  3HGG A;  5L3D A;  1SGM A;  1JTX A;  3MCZ A;  3TOB A;  1Y0N A;  4F91 B;  2VT2 A;  4ZYG A;  2PEX A;  1GHC A;  5TRD A;  1A6Q A;  2CMP A;  4C2U A;  2E60 A;  4C9Y A;  4Y15 A;  2QBY A;  1FMV A;  3PIP F;  2CW0 F;  3R0A A;  1HA8 A;  3VTI A;  3FXU A;  5FO5 A;  4ZTF A;  2RKH A;  4RGX A;  4RS8 A;  4AWX B;  3ZQ7 A;  3RPU D;  4UV8 A;  2NS7 A;  2CYY A;  2WAF A;  4KA4 A;  1UFM A;  2GA2 A;  4CCO A;  3ERE D;  4IHW A;  1O57 A;  1MJA A;  2L9S A;  3S1R J;  1IDZ A;  3BJB A;  1SAN A;  5EYR A;  3F23 A;  2HI3 A;  4HQE A;  2LF7 A;  1W4M A;  3T5X A;  4CH7 A;  1WJB A;  3S1N J;  2RAE A;  3BR6 A;  2DXI A;  3PSI A;  1UI6 A;  1RKW A;  1U3E M;  3HEF A;  4GCK A;  3J7A O;  2QQB A;  2LC2 A;  4F7Z A;  5EZH A;  1GLN A;  3FXJ A;  2QQ8 A;  2JPB A;  4ESF A;  3RCO A;  1WHU A;  3BG5 A;  2IPQ X;  1GUU A;  3E6M A;  3LSI A;  2CUF A;  3PM1 A;  3TP3 A;  3ZMD A;  4DBQ A;  2B1E A;  4IHY A;  3ZOB A;  2OER A;  1H89 C;  1WQ2 A;  1QZY A;  4IX7 A;  2F5F A;  4E7J A;  2YR2 A;  2E2H J;  5DTD A;  2B3W A;  2EIK H;  4LFU A;  5LBQ A;  4OIN F;  1R58 A;  1R6R A;  1PVE A;  1TW2 A;  1WRJ A;  2EA2 A;  3BP8 A;  4L5I A;  2VKH A;  3ML6 A;  1FZP B;  2X1D A;  1GVJ A;  4OU0 A;  2CO5 A;  1RC9 A;  5JLW A;  4CZC A;  3HTU A;  2FF4 A;  1HW2 A;  1NG6 A;  4BQN A;  3OYG A;  5BMZ A;  1IXR C;  1KON A;  2R5Z B;  1G4D A;  1QU3 A;  1KYW A;  1A31 A;  2FOK A;  3WGH A;  1X1D A;  2CQN A;  5D8L B;  1BM9 A;  2UWM A;  2VI6 A;  4DYQ A;  4AIH A;  3K7A J;  2JSP A;  2V1X A;  1KU9 A;  3S2W A;  3EET A;  4I0A A;  1I6H J;  3G6E I;  2IGO A;  2HDW A;  3CCY A;  5D4R A;  4ANJ A;  1F9N A;  1I5Z A;  4IRG A;  2R7S A;  4A3E J;  3VB2 A;  2VUM J;  1ZHF A;  3LAP A;  2L7F P;  4LLN A;  1WI3 A;  2WBM A;  3K10 A;  1ETO A;  3JAM Z;  3CMM A;  2FXA A;  2LDU A;  1SVO A;  5E79 C;  4IHV A;  1KA8 A;  3HOU J;  2XC7 A;  2NYX A;  4H0E A;  2OTJ I;  1P7I A;  4P55 A;  3FIW A;  2XHK A;  3FXK A;  5FD6 A;  3HIM A;  2OJE D;  1H9T A;  3GVA A;  4EGZ A;  4OMZ A;  3BG9 A;  2DG8 A;  2QLZ A;  3VYS B;  1TWF J;  2ELJ A;  2PJR A;  4PSX A;  3CO7 C;  2CG4 A;  4M6V A;  3SQN A;  3CRJ A;  2DYR H;  2XF5 A;  3BG7 A;  3ZP5 A;  4ENK A;  2KZV A;  1J5Y A;  3PJR A;  5D5W B;  3DKW A;  4EJO A;  2P5K A;  2Z5U A;  3DBL B;  4Y52 J;  1J2X A;  4EV0 A;  3J81 K;  3CCS I;  2XDV A;  1ZR2 A;  3F6V A;  1SAU A;  4GGG A;  2IS1 A;  2DK5 A;  4O3M A;  2V6C A;  1BBY A;  4CHU A;  1LEB A;  1B1B A;  3TGN A;  2XGC A;  3OY9 A;  1ZG5 A;  5CVV A;  2CQ7 A;  2F48 A;  1H88 C;  3NAU A;  2WAQ A;  3HKZ A;  4GCV A;  1ZK8 A;  3OIP A;  2N8G A;  3K4K A;  4ITV A;  3S5R A;  4FTH A;  3CZ6 A;  1BW5 A;  1RIO H;  2BYV E;  1BIB A;  3F72 A;  2HOE A;  1EV7 A;  2GXB A;  2XF7 A;  2XRL A;  1KQ0 A;  4HW0 A;  3SEZ A;  4RDU A;  4IPA A;  2DTR A;  2A6E F;  2NVQ J;  2VJ5 A;  3L2C A;  3QYB A;  4YEL A;  2VXZ A;  4NEL A;  1MW7 A;  2OBP A;  1ZRE A;  2KQR A;  4LB6 B;  4O6J A;  4XLA A;  1R22 A;  2K86 A;  2B0L A;  5LRS A;  1X1B A;  2Z2S B;  2LBF A;  5H6R A;  4WX9 A;  1LFU P;  1HF0 A;  2ZC2 A;  4XBF A;  4MTE A;  3DPT A;  5DS9 A;  1QVT A;  2W53 A;  2M45 A;  2HNH A;  1BOB A;  3LSM A;  2FQ4 A;  3D5S C;  1N75 A;  4CYC A;  1KU7 A;  3PQJ A;  1KU2 A;  2BGC A;  4B48 A;  4BS9 A;  3E7L A;  3WG7 H;  3MZH A;  3S2D J;  3N05 A;  3TED A;  2PLY A;  3BTI A;  4M72 A;  3LSJ A;  3FBI B;  2Q24 A;  4ME9 A;  1X2N A;  2JN6 A;  3C2B A;  5LRR A;  3E7Q A;  1BIA A;  3PAS A;  1R1V A;  5LHG A;  5HNH A;  2PQ8 A;  4F92 B;  1XSD A;  2ZXJ A;  1BI0 A;  2IP2 A;  1O3Q A;  1NK3 P;  1MKM A;  2MW8 A;  1YS6 A;  2D6Y A;  3H35 A;  4YRV A;  4A3B J;  1S9H A;  1OCR H;  2A5W A;  5E20 A;  3H3U A;  3UR3 C;  4EGY A;  5FKO A;  1Z9C A;  3ABM H;  1SMT A;  1XSX A;  3T8R A;  4EJT A;  2W84 A;  4B09 A;  3RKQ A;  2IS6 A;  1OYY A;  3H9J A;  1LDD A;  4IRI A;  2XF6 A;  1U78 A;  3A0B C;  2Y0S A;  4BXX J;  3GFM A;  2ISY A;  1X3U A;  4O5V A;  4WWC A;  5HOD A;  4DZP A;  3HB9 A;  3T0Y A;  4HDU A;  2A07 F;  2X1C A;  2BW3 B;  2PI0 A;  2RQQ A;  1BR1 A;  1N78 A;  4G8X A;  1VQ4 I;  2M87 A;  4EM0 B;  2R7Q A;  1AU7 A;  3HXL A;  4AYB A;  2ZOY A;  1D8K A;  1YJ9 I;  1ETW A;  3VYR B;  5D6E A;  1IZ1 A;  3ZXS A;  3BJA A;  2JPC A;  3EUH A;  2V9K A;  2Y30 A;  2M1B A;  3SWH A;  4NHJ A;  1HKT A;  1XGM A;  4MK6 A;  4ZYD A;  3TBI A;  2HQR A;  2ZXH A;  1HOM A;  4OWR B;  4XKB A;  1AOY A;  2XKP A;  3U9G A;  5LEJ A;  2EIL H;  1QRY A;  1JHF A;  3O8H A;  4DIQ A;  2XSJ C;  5K1Y A;  4EMS A;  3F0C A;  2KDO A;  3OYH A;  3KP5 A;  5M3F J;  4HAM A;  3HTI A;  5F04 A;  5CQE A;  4CCJ A;  2M5W A;  3ISP A;  2G7G A;  4ZC3 A;  4I99 C;  4LJZ F;  4E6K G;  3BZC A;  3DCF A;  2Y0M A;  3HSE A;  3EPZ A;  2P6S A;  3B81 A;  1JXS A;  2Z99 A;  2V79 A;  2JJ7 A;  4CIC A;  1IN5 A;  1I50 J;  4GDF A;  1I39 A;  1JGG A;  2F07 A;  1FYL A;  2K9L A;  3TW7 A;  1W1W E;  3F1B A;  1XX5 A;  5JLX A;  1SFE A;  3RIR A;  5LGT A;  1B6A A;  4F55 A;  1ETX A;  2IAI A;  3OOP A;  3ZQL A;  2ID6 A;  1S29 A;  5IYB J;  4XLF A;  4MXM A;  4Q47 A;  4XOT A;  3LSG A;  4XN3 A;  3HL2 A;  1FOY A;  3DPL C;  3BPV A;  4UHT A;  2PMZ N;  3OYB A;  4S0H B;  4HDV A;  2RVC A;  3VFZ A;  1SFO J;  2HVR A;  2GQQ A;  5CVJ A;  1IW7 F;  4P9F A;  2Z3Y A;  1B72 B;  5KNL A;  4IXA A;  4B1R A;  2FQ3 A;  4U7B A;  2E1O A;  3ULQ B;  2DTZ A;  3KYL A;  3IP4 B;  3NRG A;  1WKM A;  3OYN A;  3H3Z A;  1FY7 A;  3LMM A;  5CJ9 A;  5KK1 A;  4JX5 A;  4HF1 A;  5EEH A;  2PX9 A;  3O8G A;  2JA8 J;  4UV9 A;  2EFW A;  2WB1 N;  2X9D A;  4RMN A;  1I3Q J;  2XUB A;  3HOY J;  4IEJ A;  1MMS A;  4CCK A;  1UAA A;  2NVY J;  4U87 A;  2CUJ A;  2WAD A;  4PFO A;  5AON A;  1ODD A;  1S7E A;  1FWZ A;  2DO7 A;  3FZV A;  1HXD A;  2D1V A;  2V1D A;  3PUF A;  1BI2 A;  3HE0 A;  1DGR M;  2FOW A;  2H6B A;  2F6C A;  2KZG A;  2KL4 A;  3K1M A;  3LFK A;  4CGR A;  4Z2Y A;  2DT7 B;  1VQP I;  2LLK A;  3JTH A;  5FB2 A;  3S15 J;  2L54 A;  1OJL A;  3LSR A;  3DV8 A;  2UZK A;  4CXF A;  4XSX F;  3V8L A;  1A36 A;  3B6A A;  2MH9 A;  3WTZ A;  5D5U B;  5FFX A;  2L3D A;  1FPQ A;  4S05 A;  4G9Y A;  3PIO F;  4ZZD A;  3OYA A;  4E7Z A;  2C6Y A;  4KJZ A;  4XRM A;  3GXO A;  2EFO A;  1GXP A;  1MJB A;  2YVX A;  3NPI A;  1T95 A;  5L3C A;  1TL8 A;  2NXN B;  2DT6 A;  2H09 A;  4IVN A;  1MBH A;  4IOA F;  1OFC X;  4X6A J;  3CLQ A;  5D5V B;  1VTN C;  3ECH A;  2JA2 A;  1YIT I;  1ZLK A;  1P7J A;  1MDM B;  2R7X A;  3FK7 A;  3RZD J;  3FKI J;  3J81 Z;  3J7Z I;  1WSU A;  1PUF A;  3GTP J;  5IPA A;  4Y4R A;  4BDZ A;  1LVA A;  2ZB9 A;  5TGT A;  2ZFW A;  2F4I A;  2VKD A;  3CD6 I;  2REK A;  4U0V A;  3HOX J;  3FMQ A;  4PZJ A;  4OIR F;  4U7D A;  1T8I A;  1YW8 A;  3GTK J;  1YYV A;  5H9T A;  1MSF C;  2DK8 A;  2ME6 A;  3HOS A;  1R4N B;  3G1M A;  3KP4 A;  2K40 A;  1W7P A;  2X6O A;  4D0P A;  4FCY A;  1FTZ A;  4M6X A;  5GAH J;  3LA3 A;  4RAG A;  1K78 B;  1XCB A;  3RKX A;  2QZ8 A;  3CTA A;  3KLN A;  3OS0 A;  3PO3 J;  5GAD J;  5J3L A;  2GIV A;  2RRE A;  5CXG A;  1OLT A;  4PJN A;  4IQJ A;  2L4A A;  3WTV C;  3DF8 A;  2IGM A;  1O3R A;  2IEK A;  4NC8 A;  2K9S A;  3H5N A;  3OR1 C;  5HLH A;  1PDN C;  3KET A;  5B3S H;  4P9U A;  2HPI A;  4V19 K;  3KX2 A;  3ERM A;  1XSV A;  4DYC A;  1UHW A;  1K4T A;  1L0O C;  5BOX A;  1MGT A;  3ZRG A;  2DMQ A;  1UG0 A;  4HV6 A;  2IU5 A;  2VJ4 A;  2M0C A;  3ZPL A;  2PFV A;  4XKC A;  5L3G A;  4CGZ A;  2HWV A;  3IWF A;  3ZQF A;  3PNY A;  1D8J A;  5B5E C;  2OU2 A;  3K4N A;  3J80 K;  1YRN A;  3L2V A;  3E0J B;  3BR5 A;  3BZ6 A;  3QRF F;  1ZKG A;  3AL0 B;  2FEZ A;  3BOQ A;  3DKX A;  1SD5 A;  4RB0 A;  5BNG A;  2Z33 A;  1WJD A;  4A3C J;  9ANT A;  2A3S A;  1WCM J;  3CCR I;  4L5E A;  3W2W A;  4ASN A;  3S3N A;  3CDL A;  1SAX A;  5DEQ A;  1X1A A;  2RHA A;  5HNF A;  3HRT A;  1TNT A;  2YX7 A;  4B44 A;  2IW5 A;  2G9W A;  2IGN A;  1IF1 A;  1B4A A;  4CSW A;  4CUG A;  4LB5 A;  4B47 A;  1SD6 A;  4M9X A;  2HYG D;  1P4W A;  4UB6 C;  4Y33 A;  2R3S A;  1I1S A;  5AQC A;  2V7F A;  2K85 A;  2Y2Z A;  2LP0 A;  3S2H J;  3VVZ A;  3KEQ A;  1P4A A;  2AXT C;  1BR2 A;  3ASN H;  1T0F C;  2OAZ A;  4MQV A;  5C3E J;  2HEO A;  2TRT A;  1GT0 C;  2HVQ A;  1XMK A;  1FC3 A;  3K6G A;  3KYC B;  5AIQ A;  4KIT B;  2P0W A;  3A01 A;  2M7B A;  3KZY A;  4JYK A;  2FJI 1;  1IRX A;  4AIK A;  1U8B A;  1UST A;  2VLA A;  4WF2 A;  3ZMT A;  4I2O A;  3WG9 A;  3SEQ A;  5JFR A;  3HZJ A;  2XAU A;  3JRI A;  2FBK A;  3M1C A;  5DCM A;  2QA4 I;  2L2O A;  2MLK A;  3FXR A;  3BJ6 A;  2V9P A;  2JZY A;  1ZRF A;  1H0M A;  1ITY A;  4ZDL A;  1Q1V A;  4LIV A;  4XLE A;  2L7Z A;  1YX5 A;  1JT6 A;  3CUO A;  4FQG A;  3TO6 A;  2HOA A;  1BI3 A;  1JHH A;  4YFK F;  1Z0X A;  4NC6 A;  5D8K B;  4M6Y A;  2MAB A;  1XD7 A;  4CYD A;  3ZCO A;  2ADU A;  2DYS H;  1J09 A;  2QGU A;  2CWE A;  2ZXW H;  1A35 A;  1AWC A;  3H0D A;  4BL0 B;  3GTQ J;  4M3F A;  3L2W A;  3OSG A;  1KGS A;  2DCE A;  3WHC A;  2DOA A;  3H3V K;  1FOW A;  2OI8 A;  4MLO A;  3GTM J;  1V5G A;  2Q1Z B;  3F8B A;  2ZME C;  5F0H A;  2EBI A;  3A2K A;  5CVU A;  1SC7 A;  1MH3 A;  2DA1 A;  4HX7 A;  2QVO A;  3TMO A;  4LLG F;  2VE9 A;  1MJ9 A;  2EQR A;  3PSF A;  1N25 A;  2DDA A;  2DMP A;  2KIU A;  2ZSH B;  1VQ6 I;  4UDS A;  4YFN F;  4C2M A;  3KP6 A;  1XG1 A;  1FBS A;  4BHP A;  4BXF A;  2KIS A;  4WCG A;  4HSR A;  2NVX J;  2VOP A;  2IJL A;  2LKX A;  5DM6 F;  1S8N A;  4DBR A;  2MBF A;  4UY8 I;  3CUQ B;  5KAF C;  2DFI A;  3V6G A;  4CZZ A;  2CJJ A;  5J8F A;  3QU3 A;  2G0E A;  1K79 A;  1YHQ I;  3BNI A;  4NBQ A;  4JK1 X;  2KP6 A;  3R0J A;  1ZH5 A;  2ZCX A;  3KP2 A;  3RPU A;  1ETV A;  3W6J B;  3I58 A;  5M5Y J;  2QBY B;  2K3P A;  2R7Z J;  3SZT A;  3I55 I;  1Y8Q B;  3PNV A;  4HBL A;  1AKH A;  2ETH A;  5M5W J;  2WGB A;  5FKN A;  2L02 A;  2PN6 A;  3AL0 C;  2DBB A;  1EA3 A;  1FBQ A;  2MC4 A;  2ZKZ A;  4QTR A;  4L9V A;  2FA5 A;  2HZD A;  3V7C A;  2A61 A;  2OUM A;  4I0B A;  1XGN A;  1G3T A;  5GPC A;  4OAY A;  1OYW A;  2IA2 A;  1I27 A;  4QLC U;  1XGS A;  2IXS A;  2LVS A;  5FJ8 J;  2HPM A;  3OL3 A;  4M73 A;  3TDU C;  1JUM A;  3PFY A;  3M8E A;  2OD5 A;  3Q0U A;  1ZGW A;  4IHS A;  2D2W A;  1UCR A;  5HS7 A;  3CJD A;  1POG A;  2HOT A;  1NG7 A;  5FLX K;  3P7N A;  3GBG A;  4Y7N J;  1P9Q C;  1IN6 A;  1MIJ A;  1JJ6 C;  2O7O A;  2YU3 A;  4RB2 C;  3DBR B;  4A93 J;  2YVH A;  2D1H A;  3HRS A;  4LK1 F;  1HKQ A;  2O8X A;  3DEU A;  2NVT J;  2K3F A;  1QQI A;  3NI7 A;  2KIQ A;  5C4J J;  3AKZ A;  4WK8 F;  2EZI A;  3CCQ I;  3COA C;  3LWF A;  1XTA A;  2JRM A;  2UV1 A;  3MKL A;  1WZ2 A;  3BCG A;  1S7O A;  2KJC A;  2OZU A;  2NRA C;  3G56 A;  3MFK A;  4XMY A;  4IJA A;  3S93 A;  3SYT A;  3G1O A;  1QGP A;  2EH3 A;  2VQL A;  3HOZ J;  5L3F A;  1W5C C;  2EJR A;  5GP9 A;  2DJI A;  3K1N A;  4Z6Y A;  2HGC A;  3DTI A;  3CCJ I;  5CKT A;  3T8T A;  1AHD P;  3QYF A;  1JKP C;  2H1K A;  2HDC A;  1ERD A;  2DPD A;  1NH3 A;  3IL2 A;  2A05 A;  4CA0 A;  1MZB A;  1QO0 D;  4BE2 A;  1IXS B;  1H9G A;  4G94 A;  4LIT A;  2DU9 A;  2X6Y A;  3ZQG A;  1WGX A;  2VQG A;  1DQU A;  2LY2 A;  3BY6 A;  4X0G A;  5DAJ A;  3IKT A;  1O4X A;  4L9T A;  2MD5 A;  2Z16 A;  5CVR A;  5JHF A;  1LE8 A;  2XGX A;  2M4K A;  3D0S A;  5B1B H;  4BNC A;  4KN4 X;  5K7H A;  2E1C A;  2PJR B;  3Q3S A;  3RSN A;  4ZH4 F;  3C3W A;  3F8C A;  4BQO A;  4EM2 A;  3Q9S A;  2P8T A;  1IRZ A;  4RB1 A;  4IZZ A;  1WJC A;  5J1Y A;  3LHQ A;  4HZF A;  3QBM A;  2QEN A;  2VBY A;  2MG4 A;  4IF4 A;  3A1Y A;  3OYK A;  2O5R A;  1IUY A;  1XGO A;  3IH3 A;  3E3V A;  2YUS A;  3H92 A;  3HRU A;  3KP7 A;  1XPX A;  4BUP A;  2E34 A;  3MD2 A;  1WJE A;  2R5Y B;  3CUQ C;  2W85 A;  3J7Y J;  2VJJ A;  2GLO A;  2GZW A;  4G6T B;  4KT6 A;  4HRI A;  2HQN A;  3SFZ A;  2WAQ N;  1MD0 A;  4NNJ A;  3HKZ N;  3T1B A;  2OQR A;  3FF5 A;  3KNW A;  2FBI A;  2IS2 A;  3ANP A;  3QQA A;  4A3L J;  4GFL A;  5ICC A;  2UXI A;  1SD4 A;  1S3J A;  4JNN A;  2DA7 A;  1D0Z A;  3V4G A;  3F6O A;  2I8D A;  2VXD A;  4L0Z B;  2DI3 A;  4ZYH A;  3CCE I;  3L00 A;  4IL6 C;  1W5T A;  3SJM A;  2R4G A;  4D7N A;  3HRM A;  2KIF A;  3LSK A;  2JT1 A;  3RTR A;  3AG2 H;  3VDX A;  2DMT A;  2UXN A;  3MWM A;  1X3W B;  3C2G A;  2ZNZ A;  3S32 A;  2JRT A;  3Q9V A;  2WA0 A;  3HIF A;  1VFC A;  2FMY A;  2EZK A;  1BR4 A;  1FIA A;  2GXG A;  4CYC B;  5J1R A;  1SEU A;  4KUM A;  1K83 J;  4QWQ A;  2K4J A;  1S6L A;  1X4O A;  4C3H J;  1PJR A;  1TQM A;  1U5T C;  3OWT A;  1D3Y A;  3KIO A;  3V7S A;  4BQA A;  4I98 B;  2FUG 2;  2GM4 A;  2Q2E B;  2W1O A;  2O03 A;  3RQ4 A;  4A3F J;  5K5Q A;  2ZJQ F;  4DOZ A;  5KCM A;  4ETS A;  1LFP A;  1V5F A;  2UXU A;  3MEX A;  4ON0 A;  2ZNY A;  3JRG A;  3ELK A;  4HNT A;  1E2X A;  2COM A;  4YFX F;  4A0X A;  1X2M A;  5ICG A;  4JKZ A;  1YQA A;  4M74 A;  2QEX I;  3QPT A;  3FXL A;  5JHU A;  3C7J A;  3G4S I;  1JGS A;  2Y0S N;  1CF7 A;  4EJW A;  4OIO F;  3BCA A;  4MO7 A;  1D1A A;  4A2U A;  2HXI A;  3TOA A;  4RLF A;  2ZJR F;  4NQW B;  3E6B A;  5F27 A;  2VC1 A;  3IUO A;  3PPB A;  3ABT A;  3U2R A;  1A5J A;  1TNS A;  2EFP A;  2Y9Z A;  2VBZ A;  3EGQ A;  2MGQ A;  1F1Z A;  3LNQ A;  4AYB N;  1J75 A;  3KZ9 A;  2VIX A;  5IOY A;  2ZXI A;  3T6N A;  2ECC A;  3K4C A;  3CMY A;  1RNL A;  3E97 A;  3G3Z A;  1IAW A;  3GLX A;  2R7V A;  4ZJZ A;  5CXI A;  3OV8 A;  1Y39 A;  1LVK A;  2H6C A;  1QPI A;  2DFH A;  3L09 A;  3P9T A;  4PGG A;  2LD5 A;  3NAR A;  3I59 A;  4M9Z A;  3HYI A;  5IY5 H;  3OS1 A;  2H8W A;  3FDY A;  2L9V A;  2P4W A;  2LRD A;  2BY0 A;  2E5Z A;  2ZCM A;  5BPI A;  1WI9 A;  4V2F A;  5ILV A;  2ZOZ A;  2PMU A;  3GO5 A;  3W6K B;  4CDG A;  2KRH A;  2P7V B;  4BH9 A;  1YX3 A;  1OR7 A;  2GEN A;  4AVZ A;  4PK4 A;  3RQI A;  1UB9 A;  5J4V A;  1DUX C;  3VVY A;  3JTG A;  1TW3 A;  4A3K J;  5DM7 F;  3IKV A;  4LLL A;  1DGW Y;  2KT0 A;  4BEH A;  5DUI A;  3JSO A;  3O60 A;  2VC0 A;  2XAJ A;  2BY2 A;  2E36 A;  4FHT A;  3ON4 A;  4XOP A;  1MNM C;  4D9J A;  5LGN A;  2EV0 A;  4PSW A;  2WY8 Q;  3RDI A;  3IH2 A;  2CFO A;  5FLM J;  1RRJ A;  4U9N A;  2GA1 A;  3K4L A;  2IS4 A;  5JVT A;  2ID3 A;  1IGN A;  2YPR A;  4R79 A;  1SFK A;  1E3P A;  2F5V A;  2VAS A;  3BQY A;  2A6H F;  4Q48 A;  2TCT A;  5D1R A;  2JK3 A;  2E19 A;  4UUV A;  4UUS B;  2G7L A;  2CQK A;  3WU2 C;  2J5O A;  4LGW A;  2WUI A;  4U0Y A;  5HDG A;  4XOR A;  3TDZ C;  1JUP A;  2LSO A;  2AQF A;  3H0G J;  3FHZ A;  3CDI A;  1CQT A;  2DW4 A;  3B02 A;  3FBN B;  2QQA A;  3KYD B;  4XN0 A;  2PBX A;  2H27 A;  2JUG A;  3EYY A;  1APL C;  5FGM A;  1D5Y A;  4IKF A;  4B3X A;  1E3O C;  2CW8 A;  4HA8 A;  2BXY A;  1Z05 A;  2O9L A;  4A5N A;  1X58 A;  5EJC A;  1FYM A;  4BYY A;  1W0U A;  4QIW N;  2HFH A;  2FNP A;  3NXC A;  1QZE A;  3GW2 A;  2VQC A;  2Y31 A;  4MNU A;  3WU0 A;  4KMF A;  3WGI A;  4MEY F;  1YOV B;  2QKL B;  3TQN A;  2QOP A;  2EPF A;  5CQG A;  4MQ9 F;  4XIC A;  1IN8 A;  4UNO A;  4B4C A;  3F8N A;  4BHC A;  4D5F A;  2GWR A;  4AF5 A;  4NUB A;  1YE9 A;  5IOZ A;  3JSP A;  2UXH A;  2K27 A;  3LQR A;  4CCN A;  1IV6 A;  3FXO A;  5FKL A;  2CW7 A;  1GV5 A;  5GAG J;  4RGU A;  2HU9 A;  3E6C C;  1MMD A;  3EUP A;  4GCL A;  4F93 B;  4XID A;  4GFB A;  2BW3 A;  3FMS A;  3NRV A;  2HOS A;  1XS9 A;  1PUF B;  3HOV J;  5GPA A;  1U2W A;  4OAZ A;  5GTH C;  3LA7 A;  3P9I A;  2GAU A;  2NS8 A;  2XAH A;  4JQF A;  1R71 A;  5E8I A;  2Y69 H;  3L2U A;  2F5D A;  5E1Z B;  4II3 A;  3F22 A;  3BRO A;  3BZK A;  3ZR8 X;  2F5E A;  2HXO A;  1X1P A;  2XPU A;  4I7H A;  1OCP A;  3L1P A;  1IC8 A;  3PL8 A;  3IHU A;  3HPG A;  4AID A;  3Q0W A;  2NNN A;  4HF0 A;  1QZZ A;  4Y17 A;  2M0M A;  4Q4Z F;  2DDB A;  1F43 A;  3I54 A;  1ZEL A;  3HOT A;  5FKM A;  2G7H A;  1Z6R A;  1IG7 A;  4GO1 A;  4WXC A;  3AFH A;  3ESW B;  2GXA A;  3WTW C;  1LDJ A;  1ONV A;  1QVU A;  3BCB A;  1GDT A;  5TJJ A;  2R7R A;  2VQH A;  3DP7 A;  1KQ8 A;  1FP1 D;  2V9V A;  4MTD A;  2KJB A;  2VPL A;  2JVH A;  4L5J A;  2RV8 A;  2WC2 A;  2IVM A;  3LSP A;  5JI6 A;  1O3S A;  1TQP A;  3ABK H;  4M3E A;  2CFX A;  3KZZ A;  3ANG A;  2HVS A;  4BGD A;  5CLS A;  3U1K A;  2GFN A;  2L7M P;  1UZC A;  2KRC A;  4HKU A;  1B72 A;  3OIQ A;  1D1B A;  1Y8R B;  3QOE A;  5BPD A;  1MBG A;  3LST A;  1RI7 A;  1USS A;  1SFU A;  1IXC A;  5HSZ A;  1F36 A;  5E8G A;  3MZY A;  3WTU C;  2LY1 A;  2MSY A;  3RYP A;  1YO5 C;  4I02 A;  3QYE A;  1QA6 A;  1G3Y A;  3KPH A;  3GCM A;  2NAZ A;  3DQV C;  2X1E A;  3IH4 A;  5KVR A;  3SZG A;  4E7H A;  5EZG A;  1LPQ A;  3W2A A;  1TP4 A;  1R1U A;  2R7O A;  2W4S A;  3GTG J;  3R4K A;  2KIM A;  3OSF A;  3COL A;  5AIP A;  4MFE A;  2JTV A;  3BG3 A;  1DU0 A;  4BKX A;  1Y1W J;  3CJR B;  2V6E A;  3AAF A;  1ZAR A;  3GF2 A;  3ON2 A;  3D5R C;  2FNA A;  1Z21 A;  2EZH A;  3K4M A;  4DNC A;  2LKS A;  5EG0 A;  2H1L A;  2XRN A;  3K1P A;  1BJA A;  5EDN A;  4JX4 A;  2JA5 J;  2DA3 A;  1WJ5 A;  1WVR A;  4MHG A;  3P5J A;  4FAS D;  3KE2 A;  1T0F A;  1ZAO A;  5EGO A;  2AS5 F;  5F6F A;  3E5Q A;  5KHD A;  4ICH A;  4WXD A;  4PUS A;  2O0Y A;  2A68 F;  3RKW A;  4BBS J;  4RAF A;  1X3Z B;  3OYJ A;  1YW7 A;  2F5C A;  1IRF A;  2DAO A;  2GOX B;  3FXM A;  5TIS C;  5C4X J;  3M8J A;  1J9I A;  2Y48 A;  3ZGK A;  1ZTR A;  2Y9Y A;  2KLO A;  4OD5 A;  1JT0 A;  3NS4 A;  1V3F A;  5F1J A;  1R4M B;  4KIS A;  2EV6 A;  1HW1 A;  2LOO A;  1LQ1 A;  4MGR A;  4NB5 A;  3OYI A;  2IA0 A;  2R7T A;  1ZQ3 P;  2BVL A;  2Y75 A;  5IP6 A;  3OYE A;  4R8H A;  2XGE A;  2YU9 J;  2XAQ A;  2L5Q A;  3I0T A;  1VI0 A;  1ZG1 A;  1EH7 A;  2XPW A;  1Z67 A;  5LHI A;  1MDM A;  1FJL A;  2QKO A;  2PG4 A;  1RZ4 A;  4KYW A;  2B9S A;  4RM3 A;  4BE0 A;  2K9M A;  5HLT A;  1Z7L A;  2O61 A;  2CV2 A;  4NN1 A;  4BAY A;  2DN0 A;  1T56 A;  2CU7 A;  2ECB A;  2ZME A;  3BQZ A;  2CQQ A;  1W5S A;  2EFQ A;  5FLV A;  2RAS A;  4WXH A;  1YJW I;  1QBJ A;  3AQT A;  3DTK A;  4GXO A;  4ENJ A;  2VB6 A;  3L2Q A;  5L3E A;  3S8P A;  4A12 A;  1K78 A;  1K7A A;  2BOL A;  1JI8 A;  2HYJ A;  4S04 A;  2CQX A;  1Y6I A;  2G7U A;  4OD4 A;  4CCM A;  1XB4 A;  2RC4 A;  2NNY A;  2STW A;  1B9M A;  1V54 H;  1YIJ I;  3G73 A;  4U0W A;  3EDP A;  2HKU A;  4XSZ F;  1CGP A;  5HVQ C;  3GWZ A;  5E17 F;  3V42 A;  1FSE A;  2AO9 A;  2F4O B;  5E3N A;  3K4B A;  3JRB A;  1HSJ A;  3Q0V A;  5C44 J;  3UKG A;  1AKH B;  1FIP A;  1O7L A;  4MIM A;  2F2E A;  3QKX A;  4A0Z A;  2L0K A;  5L3B A;  3G71 I;  1YI2 I;  2ZY9 A;  3WTS C;  3EUK L;  3F3X A;  4FX0 A;  3I64 A;  2DLL A;  1IRG A;  5CW8 A;  4XQF A;  3WE3 A;  3E5X A;  4YEJ A;  4BJ6 C;  4HX4 A;  5FRO A;  1BC7 C;  3R61 A;  4GYG A;  5DDG A;  4W1U A;  2VOD A;  5D19 A;  4XRF A;  5H6Q A;  3GYH X;  1OKR A;  3HHH A;  3MQ0 A;  1IJW C;  2R7W A;  5EEA A;  3V78 A;  1TLH B;  2NVU B;  4HEA 2;  4A0Y A;  1TWA J;  4LG0 B;  5ICF A;  3BHQ A;  1IN7 A;  2L9N A;  2VE8 A;  1OCC H;  3SZP A;  3JRD A;  3W6V A;  2WTE A;  1KYZ A;  4CO8 A;  2HKX A;  3HUG B;  2LG4 A;  3DFG A;  2DFE A;  4A69 C;  2BEO A;  2EIJ H;  4BE1 A;  2FBH A;  3X2Q H;  4P5O A;  1QHG A;  3KFW X;  3JR9 A;  4I6Z A;  3F9K A;  2LYC A;  5K5O A;  1FOX A;  2EFN A;  1U6G A;  3CME I;  3FXQ A;  1GXQ A;  1VZ0 A;  2DA5 A;  4UVA A;  5HLI A;  2X85 A;  3HHG A;  1VQL I;  2ZSI B;  1T33 A;  4RLQ A;  3CC2 I;  4B8X A;  2XDN A;  3LWJ A;  1UJ8 A;  2XB0 X;  4RA2 A;  2HR3 A;  5DUK A;  3I56 I;  2K02 A;  2DG7 A;  2BHZ A;  4U9L A;  1FT9 A;  3H1C A;  4E7L A;  3LQQ A;  3AQS A; 
#chains in the Genus database with same CATH homology
 2EZK A;  2FX0 A;  1FIA A;  3QPS A;  4CYC B;  1I50 J;  5J1R A;  5E3O A;  4AC0 A;  1K83 J;  1JGG A;  2F07 A;  3TW7 A;  3BR0 A;  1BW6 A;  3F1B A;  1LFB A;  5JLX A;  1JJ8 C;  2G7S A;  1ETX A;  3CQZ J;  3S14 J;  4C3H J;  1LE8 B;  2IAI A;  3ZQL A;  2ID6 A;  3SFI A;  5IYB J;  4MXM A;  3JRF A;  1WH5 A;  2K9N A;  3KKD A;  3LSG A;  3VW2 A;  2GM4 A;  2D5V A;  1SFO J;  2PMZ N;  4S0H B;  1B8I A;  1UI5 A;  4A3F J;  2UXU A;  3JRG A;  1B72 B;  2ME0 A;  2JA7 J;  4B1R A;  1UHS A;  3S1Q J;  2E1O A;  1JUS A;  2DTZ A;  3NRG A;  4JKZ A;  1X2M A;  4D5C A;  1UG2 A;  2M8G X;  5FMP A;  2JWT A;  2FJ1 A;  4JX5 A;  2Y0S N;  3O8G A;  3IV5 A;  3BTL A;  2JA8 J;  4MO7 A;  4GFK A;  4ME9 A;  2HXI A;  1K61 A;  2WB1 N;  2X9D A;  3HOY J;  1I3Q J;  5F27 A;  4IEJ A;  2NVY J;  3PPB A;  3GZI A;  5E3L A;  1A5J A;  1A6I A;  2Y9Z A;  1MH4 A;  3EGQ A;  2MGQ A;  1S7E A;  3WHB A;  4I76 A;  3LNQ A;  4AYB N;  4HNV A;  4AC6 A;  4IHX A;  3KZ9 A;  5IOY A;  4L62 A;  3T6N A;  2ECC A;  3CMY A;  5FHP A;  1G2H A;  3HE0 A;  3BRU A;  1ETQ A;  3FK6 A;  2L9R A;  2VPR A;  4D7M A;  1DU6 A;  5CXI A;  4CGR A;  1QPI A;  1TWC J;  3BTC A;  3VIB A;  3P9T A;  4V2G A;  4QSH A;  2LLK A;  3NAR A;  2LD5 A;  3JRH A;  1U9N A;  3S15 J;  2UXO A;  4BY1 J;  1OJL A;  3LSR A;  5K7F A;  2ZCM A;  4V2F A;  1WPK A;  2NOG A;  3B6A A;  2ZOZ A;  2PZ9 A;  3GTL J;  2E2I J;  2GEN A;  5IYC J;  3JRE A;  4JP0 A;  2B63 J;  3RQI A;  3VW0 A;  3VVY A;  3VP5 A;  4XRM A;  2FBQ A;  4A3K J;  2QCO A;  1EF4 A;  4EEF G;  3NPI A;  5C4Y A;  3VVX A;  2KT0 A;  2NP3 A;  1RPW A;  1TC3 C;  4DW6 A;  3O60 A;  1MBH A;  5FGL A;  1OFC X;  2JMW A;  2LFB A;  4X6A J;  2XGD A;  4A3M J;  1P7J A;  3ON4 A;  2ELK A;  2R92 J;  1MNM C;  3G7R A;  3FK7 A;  4B3A A;  3RZD J;  4ACI A;  3FKI J;  3TW6 A;  3IH2 A;  2P81 A;  1PUF A;  3GTP J;  3G1L A;  5FLM J;  1HCR A;  5IPA A;  2QTQ A;  1B8I B;  2ZB9 A;  3M3Y J;  3FIS A;  2ID3 A;  1JKR C;  1IGN A;  2REK A;  1HLV A;  3HOX J;  3BQY A;  2NX4 A;  2TCT A;  5D1R A;  2JK3 A;  2E19 A;  4UUS B;  2G7L A;  4FE7 A;  5F0C A;  3GTK J;  5H9T A;  1MSF C;  2WUI A;  2ME6 A;  2HDD A;  3G1M A;  2K40 A;  2X6O A;  1JUP A;  4FCY A;  1FTZ A;  2IBD A;  2YVE A;  1HDD C;  3H0G J;  1RKT A;  1W0T A;  4ABZ A;  1CQT A;  2QF7 A;  2PBX A;  3ZQH A;  1APL C;  3PO3 J;  1MBK A;  3PO2 J;  5J3L A;  1D5Y A;  1H8A C;  5CXG A;  1E3O C;  4XK4 A;  1JKQ C;  2IEK A;  2O9L A;  1NTC A;  2K9S A;  1X58 A;  2HYT A;  1W0U A;  3RD3 A;  4QIW N;  2GBY A;  5K7Z A;  3NXC A;  5EFY A;  4DYC A;  3BR2 A;  3K2A A;  1ORK A;  1UMQ A;  2Y31 A;  4W97 A;  2DMQ A;  2EZL A;  2YS9 A;  2IU5 A;  4MFD A;  3HTA A;  2M0C A;  3JSJ A;  5J1U A;  4JL3 A;  2QOP A;  1FTT A;  1BL0 A;  2ZCN A;  4XIC A;  4DZJ A;  3ZQF A;  3BR1 A;  4B4C A;  2V57 A;  1YRN A;  4D5F A;  3CWR A;  3I4N J;  1Y1V J;  4AF5 A;  2UXH A;  1MBJ A;  5IOZ A;  2WV1 A;  3BR5 A;  1MBF A;  4M3B A;  1ZKG A;  1IV6 A;  1U9O A;  5BNG A;  3OIO A;  3C07 A;  4GCT A;  5FKL A;  4AUX A;  4A3C J;  1GV5 A;  9ANT A;  4XRS A;  1WCM J;  3B6C A;  4L5E A;  3EUP A;  1GV2 A;  1TWH J;  4GCL A;  3CDL A;  2M2E A;  4XID A;  2AHQ A;  4GFB A;  1VF9 A;  2RHA A;  2R5Z A;  2R5Y A;  2QWT A;  2LY9 A;  1IDY A;  2HOS A;  4C3J J;  1XS9 A;  1PUF B;  3HOV J;  5GPA A;  5IP9 J;  2VKV A;  1RET A;  2COB A;  2NS8 A;  4M3G A;  1VND A;  5AQC A;  3S2H J;  2Y2Z A;  2LP0 A;  3HGG A;  1SGM A;  3VVZ A;  1JTX A;  5HAW A;  3VUQ A;  5C3E J;  2JA6 J;  4BY7 J;  2TRT A;  1GT0 C;  3JRC A;  2HXO A;  2XPU A;  3A01 A;  2K9Q A;  1OCP A;  3L1P A;  4JYK A;  2CRG A;  2X48 A;  1IC8 A;  1JKO C;  1JTY A;  1U8B A;  3Q0W A;  2I10 A;  3JRI A;  1F43 A;  3MN2 A;  2LK2 A;  1ITY A;  3VOX A;  5FKM A;  1ETY A;  5IP7 J;  1Q1V A;  2NS7 A;  1IG7 A;  4IHW A;  2L7Z A;  1IDZ A;  3GTO J;  3S1R J;  3HDD A;  3BJB A;  1JT6 A;  1SAN A;  5EYR A;  2HI3 A;  3GEU A;  1QVU A;  2HOA A;  1GDT A;  3S1N J;  2RAE A;  4DYR A;  1Z0X A;  2DA2 A;  3BR6 A;  1UI6 A;  3LJL A;  1RKW A;  3HEF A;  2CUE A;  4LOC A;  4C2M J;  4GCK A;  5EZH A;  5D18 A;  3LSP A;  3GTQ J;  4M3F A;  3H3V K;  3OSG A;  3WHC A;  3BG5 A;  3TP3 A;  1GUU A;  4A3D J;  2OI8 A;  2CUF A;  3PM1 A;  4M3E A;  4MLO A;  3GTM J;  3ANG A;  4IHY A;  3ZOB A;  5F0H A;  3D1N I;  2EBI A;  1H89 C;  2OER A;  1MH3 A;  1ENH A;  2DA1 A;  5IYD J;  2L7M P;  1BA5 A;  2GFN A;  2E2H J;  4HKU A;  1B72 A;  5DTD A;  4FIS A;  5M5X J;  1MBG A;  2EQR A;  2O7T A;  2DMP A;  4UDS A;  3BR3 A;  5HSZ A;  2DA4 A;  1XG1 A;  2LTP A;  1F36 A;  5JLW A;  2MSY A;  4YZE A;  3DPJ A;  2XPV A;  2R5Z B;  3IH4 A;  2NVX J;  5EZG A;  2DA6 A;  2LKX A;  3GTG J;  5M3M J;  3OSF A;  3HOW J;  3M4O J;  1ZR4 A;  3COL A;  4MFE A;  3BG3 A;  4A3J J;  1DU0 A;  4BKX A;  1Y1W J;  2VI6 A;  4DYQ A;  3K7A J;  3ON2 A;  1I6H J;  2R0Q C;  3V6G A;  2EZH A;  2CJJ A;  3CCY A;  3AQS A;  5EG0 A;  2OPT A;  4A3E J;  3RZO J;  2VUM J;  2W48 A;  2L7F P;  2G0E A;  3TP0 A;  1WI3 A;  5EDN A;  4JX4 A;  3BNI A;  2JA5 J;  1ETO A;  1OCT C;  2ZCX A;  2KDZ A;  1FEX A;  2DA3 A;  3MVP A;  4IHV A;  4M3D A;  1ETV A;  5M5Y J;  3HOU J;  2R7Z J;  1P7I A;  3BTJ A;  3FIW A;  2UXP A;  2XSD C;  5EGO A;  3HIM A;  1AKH A;  4ICH A;  5M5W J;  2WGB A;  1GVD A;  5FKN A;  5EF6 A;  3BG9 A;  2DG8 A;  1TWF J;  1HDP A;  4BBS J;  3VW1 A;  4QTR A;  4M6V A;  3CRJ A;  5GPC A;  5C4X J;  4JX6 A;  3S16 J;  3VOK A;  1ZTR A;  2LVS A;  2Y9Y A;  3QPL A;  5FJ8 J;  3FRQ A;  1JT0 A;  4Y52 J;  5F1J A;  1JUM A;  1ZR2 A;  3Q0U A;  1ZGW A;  3LOC A;  1ZQ3 P;  5IP6 A;  1NK2 P;  1ETK A;  2H8R A;  2XGE A;  3CJD A;  2YU9 J;  1POG A;  2XGC A;  2HOT A;  1VI0 A;  2QKO A;  2XPW A;  1FJL A;  5FKK A;  2DMU A;  3GBG A;  4Y7N J;  1H88 C;  3NAU A;  1JJ6 C;  4NDL A;  2O7O A;  4A93 J;  1ZK8 A;  2YVH A;  2N8G A;  3S5R A;  4A3I J;  3IUV A;  2NVT J;  4FTH A;  3NI7 A;  1BW5 A;  5C4J J;  4UUS A;  2EZI A;  4NN1 A;  2DN0 A;  2CU7 A;  1T56 A;  2ECB A;  4UUT A;  2XRL A;  2CQQ A;  3BQZ A;  3MKL A;  5FLV A;  2RAS A;  2G3B A;  3BCG A;  3G56 A;  4RDU A;  3AQT A;  1TWG J;  2NVQ J;  3G1O A;  2EH3 A;  3HOZ J;  5E3M A;  5GP9 A;  4G12 A;  4X1E A;  4NEL A;  2O8K A;  4RBO A;  3HBL A;  2HYJ A;  2FD5 A;  2H1K A;  1AHD P;  2CQX A;  1JKP C;  3SDG A;  3HM5 A;  1BJZ A;  5K58 A;  1LFU P;  1HF0 A;  4FE4 A;  5EG0 B;  2HKU A;  3ZQC A;  5DS9 A;  1QVT A;  4J19 A;  2W53 A;  4C3I J;  3ZQG A;  2FQ4 A;  1WGX A;  1MSE C;  4CYC A;  3BT9 A;  4A3G J;  2AO9 A;  3E7L A;  5E3N A;  2QIB A;  3S2D J;  3TED A;  3BTI A;  3JRB A;  3LSJ A;  5DAJ A;  1O4X A;  5EGO B;  3Q0V A;  5C44 J;  1X2N A;  3UKG A;  1AKH B;  1FIP A;  2JN6 A;  2Q24 A;  3C2B A;  3ZQI A;  1LE8 A;  3E7Q A;  2GUH A;  3NNR A;  3PAS A;  4MIM A;  3QKX A;  2L0K A;  5K7H A;  1NK3 P;  3Q3S A;  3DEW A;  2MW8 A;  3I4M J;  5F0F A;  2D6Y A;  1YRN B;  2E2J J;  3A02 A;  4A3B J;  5CW8 A;  1IRZ A;  5FKO A;  3LHQ A;  2HQ5 A;  5J1Y A;  4KWA A;  3HTJ A;  3QBM A;  4W1U A;  1WH7 A;  3RKQ A;  5D19 A;  2MG4 A;  3GTJ J;  1IJW C;  5EEA A;  3IH3 A;  3V78 A;  5F08 A;  2YUS A;  1U78 A;  2LR8 A;  3JRA A;  1TWA J;  4BXX J;  2NP5 A;  3S1M J;  3BHQ A;  5HOD A;  4DZP A;  3HB9 A;  2XB5 A;  2R5Y B;  4XRS G;  3MNL A;  3JRD A;  1RR7 A;  3S17 J;  2R93 J;  3W6V A;  2GLO A;  1AU7 A;  2OF7 A;  2ZOY A;  1MBE A;  1ETW A;  2WAQ N;  2DMN A;  3HKZ N;  4PXI A;  1Z77 A;  3KNW A;  4A69 C;  3HTH A;  3ANP A;  3QQA A;  1R9T J;  3KKC A;  4A3L J;  4GFL A;  1IUF A;  2Y30 A;  2UXI A;  4JNN A;  2DA7 A;  4BBR J;  3JR9 A;  4MK6 A;  4I6Z A;  1HOM A;  5HBU A;  3VPR A;  3RH2 A;  3A01 B;  2DA5 A;  3HGY A;  1QRY A;  3O8H A;  3SJM A;  1RES A;  3F0C A;  4D7N A;  5M3F J;  3HTI A;  5F04 A;  2DMT A;  1XC5 A;  2M34 A;  1T33 A;  2G7G A;  2XDN A;  3LWJ A;  2XB0 X;  3DCF A;  2DJN A;  2DG7 A;  2VKE A;  3B81 A;  3OOU A;  2JJ7 A;  1VFC A;  3A03 A;  2M9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...