2G0EA

Structure of qacr multidrug transcriptional regulator bound to trivalent and bivalent diamidine drugs
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
rcsb
source organism Staphylococcus haemolyticus
molecule tags Transcription
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2g0eA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2g0eA02
3SFIA 3ON4A 1QVUA 4CYCB 3GTGJ 2G7GA 2E2IJ 4IEJA 1JTXA 1T33A 1ETOA 1WCMJ 3WHBA 3CRJA 3BTCA 3B81A 4BBSJ 1OCPA 3F0CA 3NNRA 3ZQIA 1ZGWA 4B3AA 1RR7A 2VUMJ 5FGLA 1POGA 4BY1J 3FRQA 1G2HA 2EZIA 3MVPA 3GTLJ 3E7LA 5E3MA 2XB0X 5D18A 2ECBA 1UI6A 3BG3A 3BR0A 3HIMA 4C3JJ 2CRGA 4QIWN 1NK2P 2D6YA 3K7AJ 1RKWA 3LNQA 2ME6A 1WGXA 5K7FA 2F07A 5FMPA 4RBOA 4NDLA 2NVYJ 3QBMA 5M5XJ 4BY7J 1BW5A 1CQTA 1JUPA 1A5JA 5FHPA 5EYRA 3HGGA 3CCYA 2R5ZB 2JA8J 3BTLA 3HOVJ 3PO3J 3IH2A 3RKQA 1H89C 3GTJJ 3JREA 2DMNA 1XS9A 5FJ8J 2DA7A 5C4JJ 1ZQ3P 2Y2ZA 3Q0WA 5FKOA 4GFLA 4FISA 3B6AA 1YRNB 1S7EA 3HOYJ 5EDNA 1O4XA 3GTQJ 1E3OC 2H1KA 3S2HJ 4A3KJ 3HOZJ 3IH3A 5FLVA 3KKCA 3S1QJ 4Y52J 1OJLA 3FKIJ 2LK2A 3PM1A 1F43A 3G1MA 3VIBA 2L7FP 3DEWA 4X6AJ 5F08A 5K7HA 3EGQA 1NK3P 5D1RA 1HDDC 2CJJA 2IAIA 3A02A 2JMWA 5DS9A 2TRTA 1LFBA 3VOXA 1DU6A 3VVXA 3GTPJ 3O8HA 2L7MP 3Q3SA 5J3LA 3V6GA 1SANA 4DYRA 1AHDP 1JT6A 1XC5A 1U9NA 2M0CA 4LOCA 1F36A 3RD3A 1P7IA 1LE8B 1OFCX 2CQXA 5IOZA 2L0KA 2YU9J 2LVSA 2JA5J 5GP9A 5D19A 2ELKA 3WHCA 3ZQHA 2R92J 3UKGA 1JUSA 4A3MJ 4Y7NJ 1ITYA 4AUXA 1IGNA 2IU5A 2LLKA 5EZHA 3RQIA 2AHQA 1ETQA 1HLVA 4GCTA 2LP0A 3ANGA 3VW1A 5F04A 3Q0VA 4QTRA 3GEUA 4DYCA 3EUPA 2XDNA 4I76A 5M3FJ 2DG7A 2VKEA 5FLMJ 2ID3A 3TEDA 1TWHJ 3NARA 1JGGA 1I3QJ 1JKQC 5EG0B 5K7ZA 4AC6A 1H88C 3A03A 1MNMC 1ZTRA 1B72B 2FD5A 3QPSA 5M5YJ 2K9NA 2GFNA 5CW8A 2PMZN 4JX4A 2R5YB 2PBXA 3BQZA 1UI5A 2M8GX 3HGYA 2G7LA 3C07A 4M3FA 2KT0A 3I4NJ 3VUQA 5E3NA 4JX5A 3JRAA 3CJDA 2EZHA 2QF7A 5CXGA 2DA4A 2OF7A 2UXOA 3HTJA 1MSFC 1IRZA 2ECCA 4MXMA 5F0HA 5F27A 2QCOA 2QOPA 4XK4A 1UHSA 3OSGA 2O9LA 3GZIA 1MBKA 4CGRA 3JRHA 3COLA 3MNLA 1X58A 3GBGA 3CMYA 1TWFJ 5IYBJ 1Q1VA 3BG5A 2AO9A 1JTYA 1JKRC 1I6HJ 3FK7A 2FQ4A 2DMPA 3BR3A 2GM4A 4FCYA 2K9QA 3QQAA 1QRYA 1VNDA 4KWAA 1Z0XA 2OI8A 2ZB9A 2NS8A 4IHYA 1TWCJ 1ZKGA 4NN1A 3VVYA 3SJMA 1RESA 1A6IA 4GFBA 5J1YA 2GENA 2WAQN 2DA1A 3C2BA 2VPRA 3G56A 2CUEA 5F0FA 4BXXJ 5IPAA 1FIAA 2DN0A 3NPIA 3PO2J 3HTHA 2JWTA 2HYTA 2YUSA 2HOAA 3ZQFA 3ZOBA 2RHAA 4JP0A 1I50J 4FTHA 1U78A 3GTOJ 2JK3A 1QPIA 3SDGA 4M3BA 3TP0A 5E3OA 1BJZA 3BR6A 5HAWA 2Y30A 1W0TA 4NELA 2VKVA 4A3LJ 3HE0A 4JKZA 2YS9A 3LSGA 4AC0A 3VW2A 2DA3A 1QVTA 2DA5A 5JLWA 3LSRA 5H9TA 1D5YA 3BNIA 4A3CJ 2E2JJ 1FEXA 4QSHA 2M9HA 3LWJA 4YZEA 4FE4A 3BJBA 1RETA 4M6VA 4I6ZA 3OIOA 1PUFA 3HOWJ 3FIWA 3DCFA 3S1RJ 1R9TJ 1IG7A 5EGOB 3F1BA 4DZPA 1JKPC 2B63J 2JA6J 1ENHA 2N8GA 2O7OA 3CWRA 2HXOA 5FKLA 2YVEA 2LKXA 4DW6A 3RZDJ 2XRLA 4ICHA 3RZOJ 4M3GA 1T56A 4JYKA 4BBRJ 5C4XJ 4W1UA 1X2MA 5EZGA 3HB9A 3I4MJ 1ETVA 2GBYA 3MKLA 4C2MJ 3JRDA 1UG2A 1SGMA 4MLOA 5F1JA 3BTIA 1Y1VJ 1B8IA 3JRBA 2Y9ZA 1JJ8C 1AKHB 5EEAA 3LSPA 3HOUJ 2GUHA 4ABZA 4S0HB 2RASA 3KNWA 5FKMA 1HDPA 3D1NI 3L1PA 2EZLA 1JUMA 5EFYA 1GT0C 1GV2A 2XB5A 1Z77A 2WB1N 3BT9A 3O8GA 2X48A 1JT0A 1HOMA 4XICA 1MBGA 3TW7A 2NP3A 1MBFA 4C3HJ 1TWAJ 3G7RA 2LFBA 1GV5A 2JJ7A 1WI3A 1MSEC 5CXIA 1LFUP 3RH2A 1WH5A 3S5RA 2NVTJ 1TC3C 1ZK8A 4HNVA 2H8RA 2G3BA 3Q0UA 2G7SA 3NI7A 4ACIA 2M34A 4XRSG 3V78A 5IP9J 3BQYA 3JSJA 2DJNA 1LE8A 3HKZN 3JRGA 3M3YJ 4UUTA 5HSZA 4A3DJ 2KDZA 1Y1WJ 2FJ1A 1MBHA 1FJLA 1GDTA 2EH3A 4AF5A 4L62A 1FIPA 2HDDA 2ZOYA 3A01A 1IJWC 5JLXA 5DAJA 3B6CA 2UXPA 4G12A 4HKUA 4GCKA 1MH3A 3E7QA 3LHQA 3QPLA 2IBDA 2R0QC 1AU7A 1WH7A 2V57A 2NOGA 3S15J 1ORKA 5EG0A 2COBA 2E1OA 4JX6A 4MFDA 3S14J 2DA6A 3FK6A 3JRCA 2R5YA 4GFKA 1IUFA 4X1EA 2Y0SN 1K61A 3JRFA 2QKOA 4JNNA 2OERA 1FTTA 3QKXA 4L5EA 2NVXJ 3ANPA 2HXIA 4XRSA 1MBEA 1VFCA 2E2HJ 5GPAA 1HF0A 1VF9A 1W0UA 3VW0A 4D5FA 1P7JA 3CDLA 4UUSA 3JR9A 5DTDA 2O7TA 1BW6A 2HKUA 3O60A 2GLOA 4AYBN 3HEFA 4EEFG 1IC8A 5C4YA 2DMQA 3VVZA 3ZQCA 3NXCA 4JL3A 9ANTA 1H8AC 1ZR4A 3HDDA 3G1LA 5C44J 4A3IJ 2DMUA 5FKNA 3GTMJ 3OOUA 2MW8A 4W97A 3ZQGA 4CYCA 1PUFB 4UDSA 4IHVA 4A3FJ 2X6OA 3TW6A 3DPJA 2CUFA 4XRMA 4A69C 2XSDC 2WUIA 2UXHA 3KKDA 5HODA 4GCLA 3AQTA 3CQZJ 3GTKJ 2HOSA 5M5WJ 1GVDA 3H3VK 2Q24A 3IUVA 2DMTA 3LOCA 5IYDJ 1TWGJ 4FE7A 1IV6A 2ZOZA 5HBUA 2E19A 2X9DA 2NP5A 2D5VA 3K2AA 1ETWA 1HCRA 2NX4A 4B1RA 2OPTA 2WV1A 3H0GJ 2DA2A 1B8IB 2PZ9A 3PPBA 2NVQJ 4V2FA 5E3LA 5GPCA 4RDUA 4PXIA 5BNGA 2MG4A 2YVHA 2ZCNA 4MFEA 1MH4A 4DZJA 2UXIA 5J1UA 1JKOC 3JRIA 2DTZA 3P9TA 5IP6A 3IH4A 1BA5A 2I10A 4ME9A 2ZCMA 3LSJA 2FX0A 2R5ZA 2Y9YA 3BR5A 1SFOJ 1ETYA 2HQ5A 4C3IJ 3VOKA 2ME0A 3S1MJ 2XGCA 2QWTA 1IDZA 5EF6A 4MO7A 1YRNA 1APLC 2FBQA 3HBLA 2O8KA 2XGEA 2R7ZJ 3IV5A 1U8BA 2LD5A 3VPRA 1U9OA 3NAUA 2P81A 1ETKA 2K9SA 3BR2A 5F0CA 3VP5A 2CU7A 4MK6A 2W48A 5IYCJ 3A01B 2W53A 3HM5A 5EGOA 2QIBA 1X2NA 4J19A 3S2DJ 3PASA 2LTPA 4M3EA 2EBIA 4B4CA 3M4OJ 3BRUA 5AQCA 1JJ6C 2JA7J 3KZ9A 2DG8A 4IHWA 3OSFA 2VI6A 3NRGA 4D5CA 2XGDA 1ZR2A 3S17J 3T6NA 4A93J 4M3DA 4D7NA 1MBJA 2RAEA 3FISA 2CQQA 2MSYA 2HYJA 3TP3A 4DYQA 4A3EJ 1BL0A 1RKTA 3BR1A 4A3BJ 2HOTA 2LY9A 1AKHA 2XPVA 2L9RA 5C3EJ 3HOXJ 3G1OA 4D7MA 2MGQA 1FTZA 4MIMA 2UXUA 2REKA 1NTCA 3BHQA 2Y31A 5M3MJ 2K40A 3ZQLA 1UMQA 2ID6A 2G0EA 2EZKA 1DU0A 3HTAA 4A3GJ 2EQRA 5IOYA 3MN2A 3AQSA 1XG1A 5K58A 4BKXA 1K83J 1ETXA 1WPKA 2NS7A 1B72A 2R93J 3S1NJ 1EF4A 1VI0A 4V2GA 3ON2A 4IHXA 2LR8A 2IEKA 2HI3A 4UUSB 3S16J 3HTIA 3BCGA 2M2EA 4A3JJ 1IDYA 2L7ZA 1OCTC 1GUUA 2XPUA 5FKKA 4XIDA 2JN6A 2XPWA 3BTJA 5J1RA 5IP7J 2QTQA 3W6VA 3BG9A 1RPWA 2TCTA 2ZCXA 2WGBA 3LJLA
chains in the Genus database with same CATH superfamily
3TDZC 3WGHA 4U7BA 4CYCB 5HS7A 1J09A 2TDXA 5H20A 3GTGJ 1T33A 3UNGC 1SFEA 2CG4A 3E97A 1WFXA 2QKMB 4RGXA 2V9PA 3CRJA 3F0CA 5DD4A 3ZQIA 3L9FA 5FGLA 3BC8A 4E7SA 2XV4S 2M1BA 3FRQA 3MVPA 2ZC2A 2WAFA 3TBIA 4BJ5C 3VYUB 2JPCA 2Z16A 2NAZA 3BR0A 5LHHA 3HIMA 2G7HA 2CRGA 4BS9A 3VEPA 1NK2P 2D6YA 1HQCA 3A0HC 4M74A 3LNQA 2ME6A 5L3EA 1WGXA 5K7FA 1D8KA 4Y4RA 4NDLA 3F9KA 3QBMA 4GDFA 1W5TA 1YW8A 1S6LA 2E60A 1BW5A 4I0BA 5ILVA 1G4DA 2H6BA 4E7IA 5EYRA 1TQIA 3HGGA 2FA5A 2Y0MA 4WK8F 4S05A 5FJ8J 4XN3A 1EH7A 2PBIA 1IXRC 5C4JJ 2Y2ZA 2CV1A 5FKOA 2HVSA 2P0WA 2KKOA 2UXXA 1S7EA 4R8HA 3HOYJ 3S2HJ 1E3OC 2BV6A 2V1UA 1O3RA 1T98A 3HOZJ 1SFKA 3MEXA 3PM1A 2VKHA 1F43A 4EV0A 3GF2A 2J5OA 4FETA 4KA4A 3VIBA 3SHFA 5F08A 3HRTA 5K7HA 2D2WA 3EGQA 5A2QZ 3ZN0A 4B8XA 2CJJA 3A02A 5DS9A 2JMWA 3HTSB 3EQLF 1YTYA 1QGPA 2WC2A 3O8HA 3V6GA 5J3LA 2H27A 4OD5A 5E1ZB 4KITB 1XC5A 1U9NA 4LOCA 3HHHA 3RD3A 2CQXA 2V26A 2L0KA 2JA5J 4RB1A 4BU2A 1YO5C 5D19A 3ZQHA 1GHCA 4CCJA 2DDBA 3MKYB 2B3WA 2OUMA 4Y7NJ 1ITYA 4AUXA 2IU5A 2E1CA 5A2QK 1USTA 4XKWA 4XN0A 4OIOF 5DYMA 5EZHA 3RQIA 1RC9A 3HG9A 5E8GA 1OYYA 3VW1A 2JTVA 3DFGA 4KIBA 3F8NA 1O3TA 5HLIA 4WCGA 2HVRA 4ZZLA 4NUBA 2VJJA 2XDNA 2X51A 4LIVA 1V55H 4XLAA 3KZIC 3HSRA 4A0YA 3CMEI 3OL4A 1JGGA 1JKQC 3CO7C 4AC6A 3OYJA 3RIRA 1LKXA 2BY2A 2FD5A 1RRJA 2GXAA 3HHGA 3M07A 4JX4A 2R5YB 2Q0OA 4E4HA 2HVQA 3DTEA 3OL3A 3SZPA 4M3FA 3RKYA 3ABMH 1WVRA 3DEEA 2EA2A 2MBFA 1YHQI 2HPMA 2DA4A 1MMDA 2JPBA 2D1VA 1T95A 3CP8A 3HTJA 4LFUA 2M7AA 1U6GA 2LREA 2IGKA 3FXQA 4GCVA 3T5XA 3P7NA 1ZAOA 3HUGA 4A5NA 1VQ4I 5AONA 4BHPA 1G6NA 2EV5A 2Q2EB 4U0VA 3ZN1A 1FYLA 4KDPA 2EB7A 3RYRA 1XMAA 1IN6A 1T2KA 3QODA 2GOXB 2V9KA 3G2BA 1R71A 3OS2A 5ICCA 1J5YA 4LLLA 3GCMA 1R5GA 2OV7A 3CMYA 2IS1A 3BP8A 1HA8A 5CJ9A 4BXFA 1OCCH 2AO9A 2QQ8A 4KN7X 5KK1A 1B9NA 4HSTA 4KMUX 1Q1HA 5L3GA 3FK7A 2EINH 1JKRC 3BJ6A 2JVHA 5D5WB 3QYEA 4IHTA 2IS6A 4IOCF 4E7HA 2DPDA 3BR3A 2L9NA 2JT1A 2WADA 4KWAA 3VODA 2A69F 1V5GA 2ZB9A 4G6TB 4MQ9F 3CCQI 3CLQA 4IHYA 2HZTA 1U8RA 2ELJA 2R7UA 3CUQA 4OMYA 4PSWA 3CJTB 2VE9A 5HVQC 3KIOA 2RKHA 1REPC 3WU0A 1D1BA 1BIBA 2EFNA 4B47A 2WAQN 3VYTB 1YJNI 1YYVA 4P5OA 3BPXA 5FD6A 1Z1DA 3L2VA 5F0FA 1SC7A 3ERED 4RGRA 5KHDA 1FIAA 5FRNA 2ISYA 1B4AA 3ABLH 3HTHA 1F9NA 1WJEA 2FNAA 2HOAA 3ZQFA 5LD2C 3I59A 3IAS2 2QBYA 4HV5A 3SDGA 2VBZA 3ZMDA 2A6EF 5E3OA 1BJZA 2NVUB 1Y39A 2BY3A 4NELA 5CVRA 3HPHA 1R5ID 2CFOA 2VKVA 3V7SA 4A3LJ 1FBUA 3PNYA 2YS9A 3KEOA 2DA5A 5B1AH 1FYMA 3VYSB 5CVJA 1VQMI 1TW2A 5E17F 3QAHA 2BW3B 1X3UA 5KAFC 3LWJA 2RNGA 4FE4A 3D5SC 3HOWJ 1OPCA 4CO8A 3KFWX 1JKPC 4CSWA 2EIMH 1XSXA 2X6YA 1HXDA 4M9ZA 1ENHA 2LY2A 1QZYA 4F55A 2XC7A 2CSOA 2LC2A 2YVEA 2CUZA 3DPUA 2LKXA 3LQQA 4DW6A 4XM3A 2XRLA 1PUEE 3PJRA 2E34A 3DEUA 2Z5UA 3KP5A 1X2MA 1ZGJA 3KEQA 1XPXA 4ZYDA 1UG2A 1HSTA 4EM1A 5F1JA 1AKHB 3JRBA 2PLYA 1WKMA 3LSPA 3ELKA 3K4NA 1YG2A 4YIIA 4EM0B 4S0HB 4CGZA 3KNWA 2LOOA 1S7OA 3K1MA 4XKCA 3BWGA 2A5YB 3L1PA 3I71A 1X1CA 3GW2A 1JUMA 5BPDA 5IT9Z 5EFYA 3K1NA 3S32A 3IHUA 3ABTA 1GT0C 1MMNA 2ZXHA 1NH3A 3BT9A 3R4KA 2LF8A 3DWLE 4C3HJ 2CV0A 1TWAJ 3OIQA 1L0OC 1TNTA 1YW7A 1A04A 3H35A 2ZCWA 5D5XB 4B48A 2JJ7A 4NQWB 3M1EA 4HF0A 4WWCA 1WH5A 3FHNA 1DP7P 3S5RA 2NVTJ 3W2VA 3JSPA 3Q0UA 2F5CA 2HQAA 3JSJA 3HKZN 1G3SA 5IT9K 4RB3C 4UUTA 4A3DJ 2KDZA 2IPQX 2L4AA 2O3FA 5TISC 1MKMA 3L7WA 2W4SA 3RKXA 2QGUA 1G3WA 2KRHA 2V6EA 4AF5A 3WU2C 2KZVA 4LG3A 1IJWC 1R49A 1Z6TA 5FB2A 1UCRA 2LRDA 1MH3A 3KYDB 4PJLA 2Z33A 2IBDA 5B1BH 2W85A 5GAHJ 4HSRA 4BXUA 3IRRA 2E1MB 5J4YA 1WI9A 4OINF 3PUBA 1NG7A 2XVCA 5F1RA 2G7UA 2DA6A 4GFKA 1FYKA 1F5TA 3HC7A 1KU9A 2ZFWA 1UELB 2F6CA 3JRFA 1IRGA 2RV8A 2OERA 2RC4A 3TO9A 4PZJA 1FLIA 2A3SA 2OU2A 3PSFA 3JW4A 1VQ8I 5CQGA 1XMXA 1EV7A 2JUGA 4YEJA 4YFKF 3MKWB 1W0UA 4CCNA 4XLHA 4UUSA 4EJUA 4G7HF 1EKEA 2VXDA 1FSHA 3HEFA 1JHHA 4EEFG 1IC8A 4KIFA 4A5MA 1Y8QB 1TQMA 4HNTA 3W2WA 4RS8A 5DUIA 3OOUA 1V54H 1IZ1A 1E3PA 4CYCA 3OYEA 4IHVA 1PP8F 3RDIA 4IJAA 2EV6A 2O5RA 4AVZA 3DLAA 3OYFA 1LJ9A 4LLNA 1K78B 2XSDC 3W3CA 1BR1A 3GTKJ 3E6MA 1SVOA 3F8FA 3H3VK 1SAXA 3IUVA 1VQ5I 1ZRCA 3WG7H 5J4VA 1MJAA 2E19A 3OOPA 4RA2A 2B1EA 4C2TA 2WAQA 2HDCA 1ETWA 4LIUA 2NX4A 2K5CA 4UB8C 3I0TA 3H0GJ 4N4OB 1B8IB 1BI1A 2PZ9A 2F5VA 2BOLA 1BOAA 4V2FA 5E3LA 4RDUA 3NEUA 4ZDLA 2ZCNA 4MFEA 3RTRA 1MH4A 1ODDA 4CA0A 2DOEA 2DTZA 1S5LC 3VFZA 5DCMA 1BA5A 3V8LA 3RKWA 5H6QA 1Y0NA 2CFXA 4DOZA 4XLEA 1OKRA 4C3IJ 5DD8A 1PP7U 4BQOA 2QWTA 1YS7A 4XKBA 4LMYA 4TV7A 2ELHA 3BY6A 4P9FA 1APLC 4I0AA 4XMYA 4BEHB 1ON2A 3HBLA 5IT3A 2X0LA 3WTXC 3IV5A 4JQFA 5DEQA 2DK8A 4DNCA 4LB6B 2JZYA 2HPIA 2HKOA 4UVAA 4DJAA 5D5VB 3NAUA 1LEBA 1ETKA 2EK5A 1DDNA 5F0CA 4EJWA 3KP3A 2CU7A 2E7XA 3L09A 3TO7A 2JVGA 3CJRB 5EGOA 4O3MA 2QIBA 4XSXF 4L5IA 2P6TA 2VE8A 2IXSA 2EBIA 3BRUA 1FNNA 2PN6A 2JA7J 3BOQA 5JVGF 1PYVA 4D5CA 1ZR2A 3DU6A 1N78A 3T6NA 1Z05A 2M5WA 4E7JA 2CQQA 2HDWA 2HYJA 4DYQA 3RQ4A 4ENNA 5BMZA 3F6OA 4QPQA 2ZJQF 1RKTA 3BR1A 4I99C 4AIHA 3GLXA 2LY9A 1X1PA 3HOXJ 3SZGA 5D5UB 4E7LA 4PJMA 2UV1A 1V5EA 1DGRM 3CUQC 2K40A 1FSEA 2F5DA 3CUQB 3HTAA 3CMMA 3QU3A 4CYDA 1UFMA 1XG1A 3A0BC 4KFCA 1WPKA 3ON2A 3S1NJ 4IHXA 3W6JB 2QA4I 3KP6A 5CVVA 3HTIA 4KMFA 4Q47A 2M2EA 4A3JJ 3BCGA 1OCTC 1GUUA 4EATA 5FROA 2CUJA 1R4MB 4GGGA 2L5QA 1DPRA 5J1RA 4QWQA 1RPWA 3L00A 2QBYB 4NBQA 3LJLA 3SFIA 2CH0A 2D45A 1JTXA 1ETOA 1FOYA 3WHBA 2Q2EA 3J80Z 1EH8A 1D1CA 3TKYA 1OCPA 3HXLA 3T0YA 4B3AA 2VUMJ 5D4SA 2PMUA 3QWLA 1QU3A 3B73A 2EZIA 1W7PB 3TO6A 4ZH4F 3HSEA 5E3MA 2XB0X 3HRSA 3F23A 5F6FA 4KJZA 3CD6I 4C3JJ 3BCBA 2MD0A 1RKWA 2OQRA 2F07A 5FMPA 4RBOA 2H6CA 5FD5A 4ZYEA 5J6XA 3IL2A 3K2ZA 3OY9A 3J80K 3EDPA 1GXPA 4FX0A 2M4GA 5M5XJ 5L3CA 1S9HA 4BY7J 4EJTA 4PJNA 2OTJI 4PCQA 5FGMA 2W84A 3CCYA 4HAMA 4I01A 3PO3J 4ESFA 2VODA 2VIXA 3SZTA 3JREA 2DMNA 5E79C 1H89C 3I54A 2O0YA 2IS4A 2K02A 2BE5F 3Q0WA 4A12A 4IRIA 2K7LA 3AL0C 1AOYA 4FISA 2R7FA 2VN2A 3VDXA 2DLLA 4Q4ZF 3AL0B 2H1KA 2BVLA 4G6DA 3IH3A 1OISA 2IA0A 5LGTA 4Y52J 3GYHX 3FKIJ 2VOPA 2PG4A 1SVMA 3MMYB 1QZEA 2AXLA 2BXZA 4F3QA 5D1RA 1HDDC 2OBPA 4P96A 3CC4I 1X3ZB 2FSWA 1VZ0A 2IAIA 4BDZA 2TRTA 1WJ5A 3VOXA 3F21A 3AG4H 3C2GA 3T8RA 3VVXA 3Q3SA 1LQ1A 2DAOA 1SANA 3R0AA 4EGYA 1E17A 1PJRA 2M0CA 1F36A 4KYWA 2QLZA 3H3UA 3KX2A 4N9IA 2LVSA 2M3AA 1Z91A 2BW3A 3O3KA 3ULQB 1SMYF 4U7DA 1O57A 2Q8KA 3HL2A 4LITA 5HNFA 5JHUA 1LPQA 2LLKA 1XB4A 1FBSA 2AHQA 2DU9A 2R7RA 4HDVA 4GCTA 1IF1A 4B43A 3H5RA 3GEUA 4DYCA 1WJCA 4I76A 2BHYA 3LAJA 3E5XA 4CCKA 4AU7A 2OZ6A 3CJNA 3A03A 1P4AA 1VQOI 1B72B 3FBIB 1QHGA 3QPSA 1RIOH 2B0LA 2ZXJA 2PMZN 2GWRA 2VT2A 4II2A 4F7ZA 2OZUA 3EYYA 3BQZA 2AS5F 5FRMA 3M1CA 4PJJA 3C07A 2KT0A 1D3YA 3VUQA 5E3NA 4RB0A 2DBBA 1S7AA 2BYVE 2P8TA 1D0XA 5DDGA 4E7KA 4U87A 1X1BA 2K3PA 2XGXA 2ISZA 3CCRI 2GOMA 1HW2A 5K1YA 4FQGA 3VSLA 4NQWA 4H0EA 2QCOA 1R7JA 4XK4A 1T0FC 2O9LA 2ZBKA 2FEZA 2V4JC 1JI8A 3LA7A 2WY8Q 1MBKA 1OCOH 1WJFA 1KQ8A 2RQPA 4GYGA 1W7PD 4CGRA 3MNLA 1LUJB 3K4LA 2VKDA 3GBGA 5L3FA 1TWFJ 2Y69H 2YU3A 4L0ZB 1JTYA 3M9AA 1SEUA 2VQLA 2YPRA 3C7JA 2V79A 1XDUA 2G9WA 4GO1A 1TBXA 4H4KC 4M73A 4FCYA 2K9QA 1QRYA 1VNDA 2X85A 2OI8A 3AAFA 4FT8A 1P92A 1W5SA 1LEAA 4NN1A 4B09A 3K6GA 4HX7A 3SJMA 3VVYA 2VBYA 1A6IA 2ZSIB 4NNJA 2Z3YA 2ZKZA 1AWCA 4RGUA 3IKVA 1LDJA 4CCLA 2DQLA 3ZMVA 4GFBA 2FOWA 1RR8C 2GENA 3C2BA 2DTRA 3G56A 4S04A 3OWTA 2CUEA 3NPIA 5JI6A 5E20A 3D5LA 3DKYA 4M72A 4IRVA 2DFFA 2JWTA 2HYTA 2YUSA 3CDHA 1R1TA 1W5CC 5DCMB 2RHAA 1IW7F 4JP0A 5DM7F 3GTOJ 4CZCA 4HQMA 3EUAA 3KZZA 1YS6A 5CVUA 3CC7I 1K79A 2R3SA 4MHGA 3I9V2 2WTEA 2Y30A 4AYBA 3X2QH 1HW5A 5FO5A 5LEKA 4A2UA 3L2QA 1WJAA 3HE0A 4P1WA 3VW2A 2IA1A 5GADJ 1K4TA 2DA3A 2KRFA 3LSRA 4LK0F 1JXSA 2ZSHB 2E2JJ 4ESBA 3ZP5A 2FJI1 1B6AA 2X6WA 3EUHC 3FMQA 3GZNB 3NRVA 4M6VA 4I6ZA 2DXIA 1MNDA 3SEQA 1G59A 1C0WA 2H8WA 1IUYA 1XMKA 4OD4A 1V5FA 1IG7A 4L9VA 5D4RA 5EGOB 4IVNA 4N4NB 4AIJA 2CW7A 2B63J 4DBRA 3BZCA 1SVLA 3IWFA 1K78A 2HQRA 2XAGA 3DTIA 1OCZH 4NC8A 1ZG1A 5H6RA 4OWRB 4M6YA 5E18F 1B1BA 3WTYC 3LFUA 3RZDJ 2B9SA 2XIGA 1LDDA 4CDGA 5HDNA 3TMOA 1LFPA 1SGMA 4OAYA 3BTIA 1B8IA 2Y9ZA 1KU7A 5EEAA 3H92A 2BY1A 2RASA 4ZDOA 3MCZA 1HDPA 2LBFB 3BZ6A 2DO7A 4UXNA 3DKWA 2NP3A 4XICA 1MBGA 5GTHC 1MBFA 3F8BA 3R60A 3G7RA 2FRHA 3J81Z 2F48A 3WTVC 3V7CA 3AG3H 3HYIA 1BBYA 3OYNA 5CXIA 4ZDPA 4HEA2 3CCSI 2XKPA 2M45A 3GFMA 4BEHA 1YJ9I 2VOOA 2H8RA 2G3BA 4ACIA 2M34A 1TNSA 4XRSG 3C18A 3V78A 2R7TA 3BQYA 4LGWA 2K3FA 4NB5A 3M3YJ 1VQ9I 1K6YA 5HSZA 5TGTA 5D8KB 3E6BA 2FJ1A 5LHGA 3K4CA 3VB2A 4HV6A 3OYLA 3D0SA 2DYRH 1SD6A 3J81K 5ICFA 1KYZA 4DVYP 3LHQA 1YLFA 2ICWG 1X3WB 2MH2A 3QRFF 3PIPF 1P2FA 1Y0UA 2CQKA 3E5QA 1AU7A 1JGSA 3LA2A 3S15J 2E1OA 3VTIA 4WIBA 1W4MA 1IXCA 3GWZA 3GFIA 3E1SA 2M87A 3FK6A 5EEGA 3DKXA 1BR2A 1FMWA 3LSKA 1IUFA 4L18B 2HFHA 1R6RA 2VJIA 4HW0A 3TL4X 4CICA 2QKOA 4JNNA 5GAGJ 3FXKA 3QKXA 1RI7A 4L5EA 1ZRDA 3CO6C 5K5QA 2HXIA 5GPAA 1S72I 3VW0A 2FBKA 2ZXWH 2W82A 1P7JA 4D5FA 2P7VB 3CCUI 5DTDA 3K4MA 4KT5C 3HIFA 1XDSA 1BW6A 5C4YA 4YIRX 3ZQCA 2P5VA 3CJQB 3NXCA 4JL3A 1FZPB 2XROA 5DCFA 1H8AC 4BNCA 2DMUA 1E0EA 5FKNA 2Z2SB 1O3QA 1KONA 2MW8A 1DPUA 2QQAA 5JVTA 4A3FJ 3MD2A 4Q48A 4HBLA 5J47A 1HKTA 4XRMA 1ACIA 3KKDA 2UXHA 1BC8C 3SFZA 1U5TC 4R1HA 5E1WA 2HOSA 3OYKA 4C2MA 1GVDA 2XAHA 1U5TB 1W7PA 2Q24A 2DMTA 1KU3A 4FE7A 1IV6A 1OYWA 1MJBA 3Q5FA 2ZOZA 4R79A 3HOTA 3K2AA 1K6OA 1FOXA 4B1RA 1HW1A 2XAQA 4I02A 2DA2A 5GPCA 4PXIA 4K2EA 1J9IA 4DZJA 2L9SA 5HLHA 4B3XA 5J1UA 1JKOC 3H9GA 3PSIA 4HLXA 4XSZF 1PVEA 4XL9A 5IP6A 2X1CA 2A68F 2O6GE 1IXSB 4M6XA 3LSJA 2FX0A 5F64A 1ETYA 2M0MA 4PFOA 1VQ7I 3P9CA 1IRXA 4PUSA 3J7AY 5CKTA 4BJ6C 5EF6A 3P5JA 2CS3A 1ZGAA 4XLCA 2GIZA 2STTA 2QVOA 4XOTA 2IGMA 2XGEA 3WTWC 3N05A 1U8BA 3GFJA 2KIQA 3E0JB 3AKZA 4AD9A 2P81A 3BR2A 2OCEA 2M30A 3AFHA 1IAWA 4MK6A 1R22A 2XAUA 5H2FC 5IYCJ 3OS0A 1X2NA 1Z7UA 2OJED 3S2DJ 2IS2A 1TQPA 4NHJA 2FBHA 2KJCA 5AQCA 2F2EA 2VASA 2P4WA 4A0XA 4BGDA 1HKQA 5DUKA 4KN4X 2XGDA 2FXAA 3KE2A 1TTYA 3ECOA 3FISA 1Z67A 2ZO4A 1J0RA 4A3BJ 2LYCA 2HOTA 3V8JA 5C3EJ 2L9RA 4ZTFA 4D7MA 1YIOA 2A2FX 2BEOA 1NTCA 3BHQA 5M3MJ 4QPOA 4PGGA 3ZQLA 2G0EA 2EZKA 3PNVA 4BUPA 2CMPA 2EQRA 1ZH5A 5IOYA 5BQTA 3P9IA 4BKXA 3H9QA 1ETXA 1B72A 3MZ8A 3SEZA 2F4MB 1USSA 3GEZA 4J00A 2LR8A 1MMSA 2IGOA 2IEKA 2HI3A 2BVMA 3S16J 3F6VA 4BAYA 1DQUA 3MFKA 3AG2H 2JSCA 2XPUA 3FXRA 2XPWA 1TT0A 1QO0D 2LY1A 1J75A 2QTQA 3A1YA 3BG9A 4UV9A 2ZCXA 2WGBA 3ON4A 2WY7Q 3ZXSA 1ZG5A 4CH7A 5CPRB 4IO9F 1T39A 2GZWA 2E2IJ 3LQRA 1ZN2A 2XUBA 3ZCOA 2Z1DA 3RPQA 1WCMJ 3BTCA 3SYTA 3B81A 1XCVA 4BBSJ 3NNRA 1RR7A 4IOAF 1POGA 2XAJA 4BY1J 1T0FA 1ZG3A 4CUGA 1YE9A 4OIPF 3DPLC 3C1DA 3PQJA 3E7LA 3ISPA 1XGSA 3GZ5A 3QP5A 5D18A 1R58A 2ECBA 3K1PA 3S3OA 1BI0A 2CGPA 1BI3A 1UI6A 4WXHA 4QIWN 2DK5A 5J8CA 4JK1X 1Z6RA 1YIJI 3NQOA 3GX4X 3K7AJ 2EFWA 4LG0B 4XLFA 1HBXG 4HX8A 2R7SA 1Y56A 3LA3A 1UHWA 2QENA 3KP4A 3HZJA 2X4HA 4L9TA 3KEYA 3UR3C 1JUPA 1LNWA 1CQTA 4XNFA 5FHPA 3COAC 1IN7A 2R5ZB 2JA8J 3H1CA 3IH2A 1XS9A 1R1UA 2EFPA 3CUOA 1OMIA 2MYSA 3I3LA 3KYLA 4KIGA 4BE1A 1ZQ3P 1MMAA 3K4KA 1YRNB 3T8TA 2MLGA 3K0LA 5EDNA 2QSFX 3CP2A 5E1XA 1N75A 2QSHX 2WV0A 1SFXA 1F1ZA 3S1QJ 3KKCA 1OJLA 2FQ3A 3JAMZ 2QUFA 3FXUA 3WTTC 3G1MA 3FXMA 2IW5A 2L7FP 1BR4A 1FBQA 1N77A 4X6AJ 2O8XA 2BGCA 5K5OA 4MGRA 1LFBA 1ZLJA 2HR3A 2V9VA 1DU6A 3GTPJ 2A5WA 2L7MP 4NC7A 2IA2A 4UUVA 5HDKA 3VOEA 2VXZA 4HX4A 3FMSA 3QOPA 1P7IA 2IP2A 1OFCX 5IOZA 1A6QA 3HOSA 2YU9J 3R6SA 3C2HA 3CTAA 3JAMK 2ELKA 4ENMA 5ERIA 3UKGA 4A3MJ 3LL7A 1RUOA 1IGNA 3BPVA 5JHFA 3EUHA 3OYMA 1PDNC 2DFHA 1HLVA 2LSOA 4Z6YA 3WGGA 3V4GA 4HG2A 1VQLI 3IC7A 4QTRA 3EUPA 1X1AA 4RM3A 4ZC3A 5M3FJ 2DG7A 4Y13A 2DI3A 3NARA 4YFXF 3Q9SA 2LKPA 5K7ZA 2ADUA 5KVRA 5M5YJ 2K9NA 1IN4A 3GLLA 2FNPA 1FMVA 4FASD 1UI5A 1YX3A 4RLQA 3TOBA 4LB5A 1FOKA 2ESHA 3J7ZI 2VQHA 4JX5A 1BI2A 4BYYA 2A05A 3CJDA 2LBFA 1UZCA 2EZHA 4E7ZA 4O6JA 4RLFA 3N97A 2IT0A 5CXGA 5LRRA 2UXOA 3R61A 1X4OA 5CLSA 4G6QA 1MSFC 1IRZA 3G3ZA 4MXMA 5F0HA 2CYYA 2EPFA 1MMGA 2CQNA 5J40A 1FX7A 3PFIA 3WE3A 2R7QA 3WTUC 3GZIA 5TJJA 2ZJPF 3H36A 3HKZA 4XR6A 5HS9A 3JRHA 3COLA 1I1GA 1X58A 2P6SA 2QKLB 3KLOA 3ZMZA 1JE8A 3J7AO 1Q1VA 1I6HJ 4PFPA 3DBRB 1CF7B 3QPHA 3IAM2 4RAGA 2E1NA 3QQAA 4LLGF 5BOXA 2HQNA 4YG2F 2CWEA 3GZ6A 5FFZA 2HKXA 4MEXF 1ON1A 1WJBA 3FHZA 1YITI 5J1YA 1YQAA 3QU6A 1UG0A 2VPRA 1FT9A 1QQIA 2WBMA 3CESA 4D0PA 3WGIA 1UAAA 2DN0A 4IPAA 3OYHA 2PI0A 2OA4A 5B5EC 3K70C 5D6EA 2K9LA 2XKOA 2DOAA 4FTHA 3VSKA 2BXYA 5ED4A 4M3BA 2UUZA 3BR6A 4UHTA 4XLPF 3ZQQA 1W0TA 2IJLA 4U88A 3KZYA 2Y75A 4F91B 2FE3A 3ZMUA 4QLCU 5J8FA 4UNOA 5DV5A 4JKZA 4IKFA 3BDDA 4YELA 3H0DA 2LMDA 1ZELA 1QVTA 1TW3A 5JLWA 5H9TA 5KCMA 3GO5A 1WRJA 3BNIA 4A3CJ 1FEXA 2MFZA 2M9HA 4HOBA 2L3DA 2R7OA 3HJEA 3F3XA 3PFYA 2IRFG 2V7FA 3OYGA 5BPIA 4BQAA 1YX5A 3BJBA 1RETA 2KZGA 3M8JA 3U1KA 2KIUA 3ZQ7A 4XONA 4MTEA 3S1RJ 4G8XA 3RPUD 4DZPA 2DDAA 2VBWA 3C3WA 3CWRA 2HXOA 2MH9A 2EIJH 5FKLA 2Z9OA 1U0JA 4JOMA 1U5TA 3ESWB 4ICHA 4OU0A 4ZJZA 4KT6A 1ZYRF 1ULYA 3HRMA 4I7HA 2GBYA 3MKLA 4C2MJ 3JRDA 3GUDA 2EV0A 1JJ8C 3H3ZA 2GUHA 1I5ZA 2M7BA 4I98B 1X19A 1EJ9A 2EZLA 1R5HA 1SAUA 3CCJI 1GV2A 2XB5A 2WB1N 2X48A 1ONVA 4HRIA 1HOMA 2FMLA 3OMYA 3TW7A 3DXJF 3U21A 2LFBA 4EJOA 1GV5A 4PSXA 4HF2A 2O03A 4N0BA 3ZGKA 4M9XA 1KGSA 4UVBA 1EA3A 1LFUP 2A61A 2R7DA 3DF8A 2EILH 4AVPA 1W36C 1TC3C 2HWVA 2HOEA 4HNVA 2NOJB 3NI7A 2HYFA 2DODA 3NS4A 2PQ8A 1LE8A 3MAJA 2H94A 3I58A 3WG9A 5E8IA 2PJRA 1MBHA 1FJLA 4L62A 1FIPA 1G8XA 1Z7LA 2CO5A 4YRVA 5DAJA 3B6CA 3VYRB 2UXPA 2DW4A 4G12A 4GCKA 3ONQA 4IX7A 3QPLA 1KQ0A 1OR7C 4E70A 2K27A 1T08B 5LGUA 3ASNH 2AQFA 2XAFA 4DBQA 2V57A 3LAPA 2NOGA 3QOEA 5EG0A 3MZHA 2COBA 3EYIA 2A6HF 1OQYA 2FUG2 4MFDA 3S3NA 4C30A 1S29A 3PQKA 3RYPA 3JRCA 1SD5A 1ZREA 1T8IA 4BQQA 1XN7A 4X1EA 4XOPA 4IRGA 2OCCH 5LHIA 2Y0SN 2ZMEC 4BL0B 3HPGA 1K61A 2ACJA 5B66C 3CLOA 2ZMEB 2NNYA 1FTTA 4CZZA 2LNBA 3JSOA 3K8PC 4CCMA 3K9TA 2E2HJ 1VF9A 2RNJA 2W7NA 3FX3A 2XSJC 3CDLA 2PFBA 3JR9A 1RZ4A 4HF1A 4IZZA 3SXYA 3ABUA 3O60A 4EM2A 3G73A 2GLOA 3CMAI 2MLKA 1OCRH 5DM6F 4UB6C 3FM3A 4IQJA 3VVZA 1M1EB 2JSPA 1ZR4A 3HDDA 4RM2A 4A3IJ 2JQ7A 3GTMJ 2NS0A 2P7CB 4W97A 3K4BA 3ZQGA 1PUFB 1VQNI 2X6OA 3TW6A 4DGWB 2D1HA 1MNEA 3DP7A 1MW7A 3IKTA 2NRAC 4D9JA 3AQTA 3F8MA 3NWTA 3OYBA 3TQNA 2H1LA 2PFVA 1E2XA 2M8EA 3L2CA 3LOCA 1MZBA 1TWGJ 3ERMA 3T1BA 3BG7A 2VT3A 1OLTA 4PDKA 5L3DA 2CQ7A 1KA8A 4J01A 2OPTA 2WV1A 3LWFA 4LG0A 2CV2A 3CZ6A 3PPBA 3JCUC 5BNGA 4Y3OA 3G4SI 2YVHA 2DCEA 1XGOA 2X6XA 5LLQA 5EEHA 4BJTA 2NNNA 2KRCA 4WX9A 3IH4A 5FLXZ 4ME9A 2BBYA 2X1EA 2R5ZA 3BR5A 2IVMA 1SFOJ 4PGHA 4IQ4A 2HQ5A 3VOKA 2ME0A 1Z3YA 2ESNA 3S1MJ 3IP4B 3M7GA 3OV8A 2OAZA 1L3LA 1LDKB 4OOIA 3CCEI 1I3AA 1YRNA 1KU2A 3U1DA 4HZFA 1TP4A 3I55I 4IF4A 1D0YA 2GXBA 2O8KA 2HYGD 3TGNA 2R4GA 3PNTA 4G94A 1W36D 1YOVB 2R7ZJ 3V42A 4RAYA 2LD5A 1VTNC 1YFHA 2DPUA 5HS8A 2BY0A 3W2AA 1U9OA 2UXNA 2W24A 1ZARA 5FLXK 3FXLA 3HSFA 5EJCA 2F4IA 3ZRGA 3ZMSA 1O7LA 3VP5A 3J7YJ 1J7KA 3A01B 4IRHA 5GAEJ 1V4RA 2XRNA 2HS5A 4U0YA 4RAZA 4ZYAA 4J19A 3PASA 4F93B 5HLGA 2E35A 2UZKA 3M4OJ 1JJ6C 3KZ9A 2PX9A 3FDYA 4DQ2A 3CCLI 3OSFA 4IHWA 4I2OA 4M3DA 2RAEA 1MBJA 2MSYA 4A0ZA 3TP3A 4KNYA 1SD4A 2Q1ZB 4UVCA 2KL4A 5LGNA 4G7ZF 2VQGA 2K86A 3KETA 2V1XA 1H9GA 3RPUA 5BS6A 5D6FA 3DBLB 2GAUA 2MC4A 2UXUA 3G71I 4HQEA 1Y6IA 2Y31A 2WB1A 1SD7A 1HC8A 4F52A 2K4JA 4EGZA 1WZ2A 3PIOF 1DU0A 4A3GJ 4BE2A 2EA4A 2PMZA 5K58A 2R93J 1K83J 3ASOH 2G7GA 2NS7A 1EF4A 2E5NA 1VI0A 2H09A 4LD5A 2JUCA 4XQFA 1XSVA 4IHSA 2P5LC 2E36A 2ZJ2A 3S93A 1IDYA 3FKJA 1VQ6I 2F4OB 5HDGA 5FKKA 4AWXB 4XIDA 2JN6A 2EFQA 4AM3A 1BIAA 5IP7J 3BROA 3W6VA 4OMZA 4YIFA 4E6KG 1FY7A 1QVUA 1X4PA 4IEJA 4BQNA 1P4XA 2VC1A 3S2WA 1E3HA 2ZJRF 1QHHD 1ZGWA 3L2WA 2MABA 3H5AA 1H0MA 1R00A 1G2HA 1MDMA 3GTLJ 2E5ZA 3WODF 2I5UA 4L5JA 3FF5A 1FOWA 3BG3A 2P5KA 1K4SA 3LSTA 4IL6C 2R7WA 1CF7A 2Y0SA 1I39A 1KQ9A 2XF6A 2GA2A 2KDOA 1GLNA 1Z3XA 2NVYJ 2RQQA 4OAZA 1UHMA 2QWWA 2XF7A 4ENJA 2X1DA 1A5JA 4A6EA 2EJRA 4UV8A 2V1DA 3HOVJ 1DUXC 3BTLA 3HTUA 3WU1B 1B9MA 1R23A 2W1OA 3RKQA 3GTJJ 4FHTA 4MTDA 2W57A 4HDUA 2DA7A 1AA7A 2OQGA 4GFLA 1STZA 2FBIA 3B6AA 2ZNZA 2VJ5A 4A6DA 2QM3A 1O4XA 3GTQJ 2GA1A 4A3KJ 3OIPA 2YSRA 1U2WA 5FLVA 2K85A 2RVCA 2LK2A 1J59A 2XF5A 2GIVA 1W1WE 1XTAA 2NXNB 4C9YA 2KLOA 1RNLA 3DEWA 1I6XA 2A6TA 1NK3P 4L0YB 2KQRA 3DTKA 1FPQA 3OR2C 2OTLI 2HZDA 5LBQA 3E5UA 1VQPI 2WWYA 4DYRA 1AHDP 1JT6A 2CW0F 4KUMA 1LE8B 2C6YA 2HTSA 2R7VA 4XLNF 5GP9A 2EWNA 2ZNYA 4WXCA 3WHCA 2PJRB 2R92J 1S8NA 3ML6A 1JUSA 5D8LB 2RN7A 2GXGA 3FM5A 1XGMA 4HLYA 2PMHA 3FZVA 1ETQA 6PAXA 2E7WA 2LP0A 3ANGA 3ZMTA 3REOA 4BE0A 5F04A 1QA6A 3Q0VA 2J5PA 2LH9A 3ROUA 5JFRA 1IN5A 2VKEA 4JBAA 2COMA 2ID3A 1TWHJ 5FLMJ 4GYIA 3TEDA 1I3QJ 2K9MA 3F72A 5EG0B 1FWZA 2ETHA 1H88C 1MNMC 5HLTA 1ZTRA 2LDUA 3DBHB 4G9YA 3OYAA 4UY8I 1TL8A 2GFNA 4OIQF 5CW8A 2DT7B 4HA8A 4ZZDA 3A2KA 2PBXA 3MZYA 3DU5A 4KICA 1ERDA 2M8GX 3FMRA 3HGYA 2G7LA 3I4NJ 1XX5A 3JRAA 3BCAA 1HSJA 2RREA 2QF7A 2OF7A 1GXQA 4Y15A 4PK4A 1DGWY 3L2RA 2ECCA 2O61A 4V19K 4ZYGA 5F27A 3HRUA 4Y33A 2QOPA 4P9UA 1UHSA 2F5FA 2VBXA 3GVAA 3OSGA 3DLLF 4BH9A 3RI4A 2AQEA 4ASNA 4HNUA 2FOKA 1A31A 3G6EI 3FBNB 3OYCA 2JRMA 2E1MC 2F5EA 3LFKA 2HGCA 5IYBJ 3FXJA 2VPLA 3BG5A 3A4CA 2OC6A 1VQKI 1FP1D 1Z9CA 2PJPA 1A35A 4Q5SF 4EVIA 2FQ4A 1MGTA 2DMPA 3LSHA 5CQEA 1WWXA 2GM4A 2LF7A 1P9QC 4M71A 2IGNA 5GTIC 2DYSH 3U9GA 3TDUC 2FU4A 1TLHB 1Z0XA 1FP2A 2NS8A 3SDBA 1TWCJ 3BG6A 2HTJA 1ZKGA 2K4BA 1R36A 3I5UA 4B44A 1S3JA 2VJ4A 4X0GA 2XASA 2VQCA 2R7XA 1OR7A 1RESA 3CCVI 3JTHA 3GMEA 3E3VA 1KZHA 2DA1A 1MJ9A 4RAFA 2I8DA 5AIQA 2B7EA 4BXXJ 4OIRF 4II3A 5IPAA 2PEXA 2QQ9A 3TOAA 3PO2J 4RMNA 2DT5A 4LJZF 2ZMEA 4Y17A 3ZOBA 1I50J 1R4NB 3S8PA 1U78A 2JK3A 1WJDA 5CYVA 1QPIA 4U9LA 3K69A 4I09A 4EQQA 4L9JA 2KMUA 3TP0A 5HAWA 1TT5B 2QZ8A 3KYCB 3IUOA 2YX7A 3I4PA 1OYIA 1WQ2A 1IO2A 3LSGA 4L9NA 2KIMA 4AC0A 1G3YA 3EPZA 1QPMA 2GQQA 3QYFA 1D5YA 4EMSA 4QSHA 3OYIA 1R1VA 1UB9A 2DFEA 1O3SA 2Y48A 4GRIA 3K10A 4YZEA 3ZPLA 3SQNA 2L01A 3CF2A 3OIOA 1PUFA 3FIWA 1LVAA 3DCFA 1JHFA 2MD5A 1R9TJ 2HEOA 3F1BA 2E71A 4XORA 1YI2I 2JA6J 2YVXA 2N8GA 4YFNF 2O7OA 2WAEA 1NHAA 2L7KA 4ESJA 1BN5A 2KPMA 2XDVA 1CGPA 3RZOJ 4M3GA 1T56A 4JYKA 3Q9VA 4BBRJ 5C4XJ 4W1UA 3H5NA 3HB9A 5EZGA 1U3EM 3I4MJ 2ZFUA 1ETVA 4EJVA 3SWHA 3F8CA 2QSGX 1QZZA 4MLOA 5ICGA 1XGNA 3P9KA 1Y1VJ 3JTGA 2DJIA 3GFLA 3IWZA 3HOUJ 1XSDA 4ABZA 3I64A 4XBFA 5FKMA 3D1NI 4CCOA 1ZRFA 2BZTA 3LSIA 1T38A 3CCMI 1Z77A 2W00A 3ABKH 2RDPA 3O8GA 1JT0A 4XRFA 3S3MA 3HUGB 3R0JA 3IRQA 4F92B 1O7FA 1WI3A 1MSEC 4IXAA 3RH2A 1ZLKA 3LSMA 1UJ8A 1ZK8A 2G7SA 4CXFA 2V1NA 3O6BB 5IP9J 2DOFA 1D5VA 2KJBA 2DJNA 1I1SA 1KYWA 2OD5A 3JRGA 2KIFA 2JA2A 2KP6A 3ECHA 1IV8A 2LG4A 1Y1WJ 5KNLA 2MC3A 2YR2A 5TRDA 3RJPA 1GDTA 2EH3A 3BZKA 4LK1F 2HDDA 2KISA 4ENKA 2ZOYA 3A01A 3I53A 2QEXI 2XHKA 2LKSA 4GXOA 5JLXA 3CC2I 4HKUA 4U9NA 3E7QA 2VLAA 2R0QC 1MDMB 2VL8A 4WXDA 5ICEA 1P6RA 1WH7A 3AG1H 3N4MA 1ORKA 2FF4A 4JX6A 3S14J 3RSNA 2R5YA 2L2OA 4P55A 5AIPA 2M4KA 1D0ZA 1Y8RB 1WHUA 1YJWI 3MWMA 1FC3A 4MQVA 3WTSC 4ZYHA 3I59B 1MIJA 2WA0A 2NVXJ 3ANPA 4CHUA 4XRSA 1MBEA 1VFCA 5L3BA 4PJ0C 1HF0A 5CVIA 4WF2A 3WTZA 1T6SA 5ILUA 4ANJA 2O7TA 2HKUA 4AYBN 5LRSA 3LMMA 4XKVA 2DMQA 1EH6A 3EUKL 5LFAA 4NC6A 9ANTA 1F4KA 3G1LA 5C44J 4MEYF 3OS1A 2EIKH 3EETA 4BHBA 5ILSA 3GXOA 4N9HA 4UDSA 3O2PE 4ON0A 3B02A 2NYXA 3DPJA 5KAIC 3CDIA 2CUFA 4A69C 2WUIA 1I27A 3CF5F 3ZR8X 5HODA 4GCLA 3CQZJ 1SFUA 5M5WJ 5JR3A 3KLNA 5B3SH 4G7OF 4AIKA 3KCCA 5IYDJ 1D8JA 1MD0A 2JRTA 5HBUA 3BJAA 2X9DA 4M9SA 2NP5A 2D5VA 3M8FA 4RGSA 2W25A 4ZTJA 1HCRA 4C2UA 3E6DA 3OYDA 1BM9A 3K4JA 1BC7C 2VONA 2NVQJ 2MG4A 2ZXIA 2UXIA 3OR1C 3KP7A 1HKSA 3JRIA 2YX4A 2L9VA 3P9TA 2MA3A 3L2UA 2I10A 2L02A 2V6CA 2ZCMA 2Y9YA 1QBJA 2KFDA 4HPQA 1X1DA 2BHZA 2XGCA 2VC0A 1XD7A 1IDZA 1N25A 3FXOA 4MO7A 2FBQA 5IY5H 4O5VA 4RB2C 3MKZA 5HOOA 2QYOA 1XCBA 3V7RA 2Z99A 3BLYA 1NG6A 1LB2A 3PUFA 3VPRA 1J2XA 1DP3A 1WSUA 4ETSA 2STWA 4Z2YA 2K9SA 3H9JA 3M8EA 2VB6A 3QP6A 3U2RA 2W48A 2W53A 3HM5A 4ITVA 3VWBA 1TZLA 4D1QA 5FFXA 2A07F 1ZHFA 2LTPA 1IN8A 4M3EA 4B4CA 1BJAA 2UWMA 1A36A 2DG8A 4BACA 2VI6A 3NRGA 3V8KA 3MQ0A 4FX4A 3F22A 3S17J 4A93J 2L54A 1IRFA 2CW8A 4D7NA 2QQBA 2HNHA 4AIDA 1BL0A 4A3EJ 1QNTA 1LVKA 2DFIA 1K7AA 2FMYA 3E6CC 1AKHA 2XPVA 1Z21A 3DV8A 3G1OA 3D5RC 2MGQA 3WE2A 2HU9A 2DT6A 4MIMA 2AXTC 4HYEA 1FTZA 2REKA 3DPTA 5HNHA 1UMQA 2ID6A 1H9TA 3DQVC 3PL8A 3MN2A 3AQSA 1G3TA 3NWSA 4V2GA 3QYBA 4BHCA 3KP2A 4MNUA 5K5RA 4UUSB 2EFOA 1D1AA 3BJOA 1RUNA 1P4WA 2DQRA 2L7ZA 2L4MA 1SMTA 4U0WA 4DIQA 3RCOA 4KISA 3FWEA 5LEJA 1YW9A 2KHMA 3BTJA 3KPHA 3W6KB 3I56I 4BDYA 2RGVA 1GVJA 1V3FA 2ZY9A 2TCTA 3K70D 1BOBA 1B59A 3QPTA
chains in the Genus database with same CATH topology
3SFIA 3ON4A 1QVUA 4CYCB 3GTGJ 2G7GA 2E2IJ 4IEJA 1JTXA 1T33A 1ETOA 1WCMJ 3WHBA 3CRJA 3BTCA 3B81A 4BBSJ 1OCPA 3F0CA 3NNRA 3ZQIA 1ZGWA 4B3AA 1RR7A 2VUMJ 5FGLA 1POGA 4BY1J 3FRQA 1G2HA 2EZIA 3MVPA 3GTLJ 3E7LA 5E3MA 2XB0X 5D18A 2ECBA 1UI6A 3BG3A 3BR0A 3HIMA 4C3JJ 2CRGA 4QIWN 1NK2P 2D6YA 3K7AJ 1RKWA 3LNQA 2ME6A 1WGXA 5K7FA 2F07A 5FMPA 4RBOA 4NDLA 2NVYJ 3QBMA 5M5XJ 4BY7J 1BW5A 1CQTA 1JUPA 1A5JA 5FHPA 5EYRA 3HGGA 3CCYA 2R5ZB 2JA8J 3BTLA 3HOVJ 3PO3J 3IH2A 3RKQA 1H89C 3GTJJ 3JREA 2DMNA 1XS9A 5FJ8J 2DA7A 5C4JJ 1ZQ3P 2Y2ZA 3Q0WA 5FKOA 4GFLA 4FISA 3B6AA 1YRNB 1S7EA 3HOYJ 5EDNA 1O4XA 3GTQJ 1E3OC 2H1KA 3S2HJ 4A3KJ 3HOZJ 3IH3A 5FLVA 3KKCA 3S1QJ 4Y52J 1OJLA 3FKIJ 2LK2A 3PM1A 1F43A 3G1MA 3VIBA 2L7FP 3DEWA 4X6AJ 5F08A 5K7HA 3EGQA 1NK3P 5D1RA 1HDDC 2CJJA 2IAIA 3A02A 2JMWA 5DS9A 2TRTA 1LFBA 3VOXA 1DU6A 3VVXA 3GTPJ 3O8HA 2L7MP 3Q3SA 5J3LA 3V6GA 1SANA 4DYRA 1AHDP 1JT6A 1XC5A 1U9NA 2M0CA 4LOCA 1F36A 3RD3A 1P7IA 1LE8B 1OFCX 2CQXA 5IOZA 2L0KA 2YU9J 2LVSA 2JA5J 5GP9A 5D19A 2ELKA 3WHCA 3ZQHA 2R92J 3UKGA 1JUSA 4A3MJ 4Y7NJ 1ITYA 4AUXA 1IGNA 2IU5A 2LLKA 5EZHA 3RQIA 2AHQA 1ETQA 1HLVA 4GCTA 2LP0A 3ANGA 3VW1A 5F04A 3Q0VA 4QTRA 3GEUA 4DYCA 3EUPA 2XDNA 4I76A 5M3FJ 2DG7A 2VKEA 5FLMJ 2ID3A 3TEDA 1TWHJ 3NARA 1JGGA 1I3QJ 1JKQC 5EG0B 5K7ZA 4AC6A 1H88C 3A03A 1MNMC 1ZTRA 1B72B 2FD5A 3QPSA 5M5YJ 2K9NA 2GFNA 5CW8A 2PMZN 4JX4A 2R5YB 2PBXA 3BQZA 1UI5A 2M8GX 3HGYA 2G7LA 3C07A 4M3FA 2KT0A 3I4NJ 3VUQA 5E3NA 4JX5A 3JRAA 3CJDA 2EZHA 2QF7A 5CXGA 2DA4A 2OF7A 2UXOA 3HTJA 1MSFC 1IRZA 2ECCA 4MXMA 5F0HA 5F27A 2QCOA 2QOPA 4XK4A 1UHSA 3OSGA 2O9LA 3GZIA 1MBKA 4CGRA 3JRHA 3COLA 3MNLA 1X58A 3GBGA 3CMYA 1TWFJ 5IYBJ 1Q1VA 3BG5A 2AO9A 1JTYA 1JKRC 1I6HJ 3FK7A 2FQ4A 2DMPA 3BR3A 2GM4A 4FCYA 2K9QA 3QQAA 1QRYA 1VNDA 4KWAA 1Z0XA 2OI8A 2ZB9A 2NS8A 4IHYA 1TWCJ 1ZKGA 4NN1A 3VVYA 3SJMA 1RESA 1A6IA 4GFBA 5J1YA 2GENA 2WAQN 2DA1A 3C2BA 2VPRA 3G56A 2CUEA 5F0FA 4BXXJ 5IPAA 1FIAA 2DN0A 3NPIA 3PO2J 3HTHA 2JWTA 2HYTA 2YUSA 2HOAA 3ZQFA 3ZOBA 2RHAA 4JP0A 1I50J 4FTHA 1U78A 3GTOJ 2JK3A 1QPIA 3SDGA 4M3BA 3TP0A 5E3OA 1BJZA 3BR6A 5HAWA 2Y30A 1W0TA 4NELA 2VKVA 4A3LJ 3HE0A 4JKZA 2YS9A 3LSGA 4AC0A 3VW2A 2DA3A 1QVTA 2DA5A 5JLWA 3LSRA 5H9TA 1D5YA 3BNIA 4A3CJ 2E2JJ 1FEXA 4QSHA 2M9HA 3LWJA 4YZEA 4FE4A 3BJBA 1RETA 4M6VA 4I6ZA 3OIOA 1PUFA 3HOWJ 3FIWA 3DCFA 3S1RJ 1R9TJ 1IG7A 5EGOB 3F1BA 4DZPA 1JKPC 2B63J 2JA6J 1ENHA 2N8GA 2O7OA 3CWRA 2HXOA 5FKLA 2YVEA 2LKXA 4DW6A 3RZDJ 2XRLA 4ICHA 3RZOJ 4M3GA 1T56A 4JYKA 4BBRJ 5C4XJ 4W1UA 1X2MA 5EZGA 3HB9A 3I4MJ 1ETVA 2GBYA 3MKLA 4C2MJ 3JRDA 1UG2A 1SGMA 4MLOA 5F1JA 3BTIA 1Y1VJ 1B8IA 3JRBA 2Y9ZA 1JJ8C 1AKHB 5EEAA 3LSPA 3HOUJ 2GUHA 4ABZA 4S0HB 2RASA 3KNWA 5FKMA 1HDPA 3D1NI 3L1PA 2EZLA 1JUMA 5EFYA 1GT0C 1GV2A 2XB5A 1Z77A 2WB1N 3BT9A 3O8GA 2X48A 1JT0A 1HOMA 4XICA 1MBGA 3TW7A 2NP3A 1MBFA 4C3HJ 1TWAJ 3G7RA 2LFBA 1GV5A 2JJ7A 1WI3A 1MSEC 5CXIA 1LFUP 3RH2A 1WH5A 3S5RA 2NVTJ 1TC3C 1ZK8A 4HNVA 2H8RA 2G3BA 3Q0UA 2G7SA 3NI7A 4ACIA 2M34A 4XRSG 3V78A 5IP9J 3BQYA 3JSJA 2DJNA 1LE8A 3HKZN 3JRGA 3M3YJ 4UUTA 5HSZA 4A3DJ 2KDZA 1Y1WJ 2FJ1A 1MBHA 1FJLA 1GDTA 2EH3A 4AF5A 4L62A 1FIPA 2HDDA 2ZOYA 3A01A 1IJWC 5JLXA 5DAJA 3B6CA 2UXPA 4G12A 4HKUA 4GCKA 1MH3A 3E7QA 3LHQA 3QPLA 2IBDA 2R0QC 1AU7A 1WH7A 2V57A 2NOGA 3S15J 1ORKA 5EG0A 2COBA 2E1OA 4JX6A 4MFDA 3S14J 2DA6A 3FK6A 3JRCA 2R5YA 4GFKA 1IUFA 4X1EA 2Y0SN 1K61A 3JRFA 2QKOA 4JNNA 2OERA 1FTTA 3QKXA 4L5EA 2NVXJ 3ANPA 2HXIA 4XRSA 1MBEA 1VFCA 2E2HJ 5GPAA 1HF0A 1VF9A 1W0UA 3VW0A 4D5FA 1P7JA 3CDLA 4UUSA 3JR9A 5DTDA 2O7TA 1BW6A 2HKUA 3O60A 2GLOA 4AYBN 3HEFA 4EEFG 1IC8A 5C4YA 2DMQA 3VVZA 3ZQCA 3NXCA 4JL3A 9ANTA 1H8AC 1ZR4A 3HDDA 3G1LA 5C44J 4A3IJ 2DMUA 5FKNA 3GTMJ 3OOUA 2MW8A 4W97A 3ZQGA 4CYCA 1PUFB 4UDSA 4IHVA 4A3FJ 2X6OA 3TW6A 3DPJA 2CUFA 4XRMA 4A69C 2XSDC 2WUIA 2UXHA 3KKDA 5HODA 4GCLA 3AQTA 3CQZJ 3GTKJ 2HOSA 5M5WJ 1GVDA 3H3VK 2Q24A 3IUVA 2DMTA 3LOCA 5IYDJ 1TWGJ 4FE7A 1IV6A 2ZOZA 5HBUA 2E19A 2X9DA 2NP5A 2D5VA 3K2AA 1ETWA 1HCRA 2NX4A 4B1RA 2OPTA 2WV1A 3H0GJ 2DA2A 1B8IB 2PZ9A 3PPBA 2NVQJ 4V2FA 5E3LA 5GPCA 4RDUA 4PXIA 5BNGA 2MG4A 2YVHA 2ZCNA 4MFEA 1MH4A 4DZJA 2UXIA 5J1UA 1JKOC 3JRIA 2DTZA 3P9TA 5IP6A 3IH4A 1BA5A 2I10A 4ME9A 2ZCMA 3LSJA 2FX0A 2R5ZA 2Y9YA 3BR5A 1SFOJ 1ETYA 2HQ5A 4C3IJ 3VOKA 2ME0A 3S1MJ 2XGCA 2QWTA 1IDZA 5EF6A 4MO7A 1YRNA 1APLC 2FBQA 3HBLA 2O8KA 2XGEA 2R7ZJ 3IV5A 1U8BA 2LD5A 3VPRA 1U9OA 3NAUA 2P81A 1ETKA 2K9SA 3BR2A 5F0CA 3VP5A 2CU7A 4MK6A 2W48A 5IYCJ 3A01B 2W53A 3HM5A 5EGOA 2QIBA 1X2NA 4J19A 3S2DJ 3PASA 2LTPA 4M3EA 2EBIA 4B4CA 3M4OJ 3BRUA 5AQCA 1JJ6C 2JA7J 3KZ9A 2DG8A 4IHWA 3OSFA 2VI6A 3NRGA 4D5CA 2XGDA 1ZR2A 3S17J 3T6NA 4A93J 4M3DA 4D7NA 1MBJA 2RAEA 3FISA 2CQQA 2MSYA 2HYJA 3TP3A 4DYQA 4A3EJ 1BL0A 1RKTA 3BR1A 4A3BJ 2HOTA 2LY9A 1AKHA 2XPVA 2L9RA 5C3EJ 3HOXJ 3G1OA 4D7MA 2MGQA 1FTZA 4MIMA 2UXUA 2REKA 1NTCA 3BHQA 2Y31A 5M3MJ 2K40A 3ZQLA 1UMQA 2ID6A 2G0EA 2EZKA 1DU0A 3HTAA 4A3GJ 2EQRA 5IOYA 3MN2A 3AQSA 1XG1A 5K58A 4BKXA 1K83J 1ETXA 1WPKA 2NS7A 1B72A 2R93J 3S1NJ 1EF4A 1VI0A 4V2GA 3ON2A 4IHXA 2LR8A 2IEKA 2HI3A 4UUSB 3S16J 3HTIA 3BCGA 2M2EA 4A3JJ 1IDYA 2L7ZA 1OCTC 1GUUA 2XPUA 5FKKA 4XIDA 2JN6A 2XPWA 3BTJA 5J1RA 5IP7J 2QTQA 3W6VA 3BG9A 1RPWA 2TCTA 2ZCXA 2WGBA 3LJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFI A;  3ON4 A;  1QVU A;  4CYC B;  3GTG J;  2G7G A;  2E2I J;  4IEJ A;  1JTX A;  1T33 A;  1ETO A;  1WCM J;  3WHB A;  3CRJ A;  3BTC A;  3B81 A;  4BBS J;  1OCP A;  3F0C A;  3NNR A;  3ZQI A;  1ZGW A;  4B3A A;  1RR7 A;  2VUM J;  5FGL A;  1POG A;  4BY1 J;  3FRQ A;  1G2H A;  2EZI A;  3MVP A;  3GTL J;  3E7L A;  5E3M A;  2XB0 X;  5D18 A;  2ECB A;  1UI6 A;  3BG3 A;  3BR0 A;  3HIM A;  4C3J J;  2CRG A;  4QIW N;  1NK2 P;  2D6Y A;  3K7A J;  1RKW A;  3LNQ A;  2ME6 A;  1WGX A;  5K7F A;  2F07 A;  5FMP A;  4RBO A;  4NDL A;  2NVY J;  3QBM A;  5M5X J;  4BY7 J;  1BW5 A;  1CQT A;  1JUP A;  1A5J A;  5FHP A;  5EYR A;  3HGG A;  3CCY A;  2R5Z B;  2JA8 J;  3BTL A;  3HOV J;  3PO3 J;  3IH2 A;  3RKQ A;  1H89 C;  3GTJ J;  3JRE A;  2DMN A;  1XS9 A;  5FJ8 J;  2DA7 A;  5C4J J;  1ZQ3 P;  2Y2Z A;  3Q0W A;  5FKO A;  4GFL A;  4FIS A;  3B6A A;  1YRN B;  1S7E A;  3HOY J;  5EDN A;  1O4X A;  3GTQ J;  1E3O C;  2H1K A;  3S2H J;  4A3K J;  3HOZ J;  3IH3 A;  5FLV A;  3KKC A;  3S1Q J;  4Y52 J;  1OJL A;  3FKI J;  2LK2 A;  3PM1 A;  1F43 A;  3G1M A;  3VIB A;  2L7F P;  3DEW A;  4X6A J;  5F08 A;  5K7H A;  3EGQ A;  1NK3 P;  5D1R A;  1HDD C;  2CJJ A;  2IAI A;  3A02 A;  2JMW A;  5DS9 A;  2TRT A;  1LFB A;  3VOX A;  1DU6 A;  3VVX A;  3GTP J;  3O8H A;  2L7M P;  3Q3S A;  5J3L A;  3V6G A;  1SAN A;  4DYR A;  1AHD P;  1JT6 A;  1XC5 A;  1U9N A;  2M0C A;  4LOC A;  1F36 A;  3RD3 A;  1P7I A;  1LE8 B;  1OFC X;  2CQX A;  5IOZ A;  2L0K A;  2YU9 J;  2LVS A;  2JA5 J;  5GP9 A;  5D19 A;  2ELK A;  3WHC A;  3ZQH A;  2R92 J;  3UKG A;  1JUS A;  4A3M J;  4Y7N J;  1ITY A;  4AUX A;  1IGN A;  2IU5 A;  2LLK A;  5EZH A;  3RQI A;  2AHQ A;  1ETQ A;  1HLV A;  4GCT A;  2LP0 A;  3ANG A;  3VW1 A;  5F04 A;  3Q0V A;  4QTR A;  3GEU A;  4DYC A;  3EUP A;  2XDN A;  4I76 A;  5M3F J;  2DG7 A;  2VKE A;  5FLM J;  2ID3 A;  3TED A;  1TWH J;  3NAR A;  1JGG A;  1I3Q J;  1JKQ C;  5EG0 B;  5K7Z A;  4AC6 A;  1H88 C;  3A03 A;  1MNM C;  1ZTR A;  1B72 B;  2FD5 A;  3QPS A;  5M5Y J;  2K9N A;  2GFN A;  5CW8 A;  2PMZ N;  4JX4 A;  2R5Y B;  2PBX A;  3BQZ A;  1UI5 A;  2M8G X;  3HGY A;  2G7L A;  3C07 A;  4M3F A;  2KT0 A;  3I4N J;  3VUQ A;  5E3N A;  4JX5 A;  3JRA A;  3CJD A;  2EZH A;  2QF7 A;  5CXG A;  2DA4 A;  2OF7 A;  2UXO A;  3HTJ A;  1MSF C;  1IRZ A;  2ECC A;  4MXM A;  5F0H A;  5F27 A;  2QCO A;  2QOP A;  4XK4 A;  1UHS A;  3OSG A;  2O9L A;  3GZI A;  1MBK A;  4CGR A;  3JRH A;  3COL A;  3MNL A;  1X58 A;  3GBG A;  3CMY A;  1TWF J;  5IYB J;  1Q1V A;  3BG5 A;  2AO9 A;  1JTY A;  1JKR C;  1I6H J;  3FK7 A;  2FQ4 A;  2DMP A;  3BR3 A;  2GM4 A;  4FCY A;  2K9Q A;  3QQA A;  1QRY A;  1VND A;  4KWA A;  1Z0X A;  2OI8 A;  2ZB9 A;  2NS8 A;  4IHY A;  1TWC J;  1ZKG A;  4NN1 A;  3VVY A;  3SJM A;  1RES A;  1A6I A;  4GFB A;  5J1Y A;  2GEN A;  2WAQ N;  2DA1 A;  3C2B A;  2VPR A;  3G56 A;  2CUE A;  5F0F A;  4BXX J;  5IPA A;  1FIA A;  2DN0 A;  3NPI A;  3PO2 J;  3HTH A;  2JWT A;  2HYT A;  2YUS A;  2HOA A;  3ZQF A;  3ZOB A;  2RHA A;  4JP0 A;  1I50 J;  4FTH A;  1U78 A;  3GTO J;  2JK3 A;  1QPI A;  3SDG A;  4M3B A;  3TP0 A;  5E3O A;  1BJZ A;  3BR6 A;  5HAW A;  2Y30 A;  1W0T A;  4NEL A;  2VKV A;  4A3L J;  3HE0 A;  4JKZ A;  2YS9 A;  3LSG A;  4AC0 A;  3VW2 A;  2DA3 A;  1QVT A;  2DA5 A;  5JLW A;  3LSR A;  5H9T A;  1D5Y A;  3BNI A;  4A3C J;  2E2J J;  1FEX A;  4QSH A;  2M9H A;  3LWJ A;  4YZE A;  4FE4 A;  3BJB A;  1RET A;  4M6V A;  4I6Z A;  3OIO A;  1PUF A;  3HOW J;  3FIW A;  3DCF A;  3S1R J;  1R9T J;  1IG7 A;  5EGO B;  3F1B A;  4DZP A;  1JKP C;  2B63 J;  2JA6 J;  1ENH A;  2N8G A;  2O7O A;  3CWR A;  2HXO A;  5FKL A;  2YVE A;  2LKX A;  4DW6 A;  3RZD J;  2XRL A;  4ICH A;  3RZO J;  4M3G A;  1T56 A;  4JYK A;  4BBR J;  5C4X J;  4W1U A;  1X2M A;  5EZG A;  3HB9 A;  3I4M J;  1ETV A;  2GBY A;  3MKL A;  4C2M J;  3JRD A;  1UG2 A;  1SGM A;  4MLO A;  5F1J A;  3BTI A;  1Y1V J;  1B8I A;  3JRB A;  2Y9Z A;  1JJ8 C;  1AKH B;  5EEA A;  3LSP A;  3HOU J;  2GUH A;  4ABZ A;  4S0H B;  2RAS A;  3KNW A;  5FKM A;  1HDP A;  3D1N I;  3L1P A;  2EZL A;  1JUM A;  5EFY A;  1GT0 C;  1GV2 A;  2XB5 A;  1Z77 A;  2WB1 N;  3BT9 A;  3O8G A;  2X48 A;  1JT0 A;  1HOM A;  4XIC A;  1MBG A;  3TW7 A;  2NP3 A;  1MBF A;  4C3H J;  1TWA J;  3G7R A;  2LFB A;  1GV5 A;  2JJ7 A;  1WI3 A;  1MSE C;  5CXI A;  1LFU P;  3RH2 A;  1WH5 A;  3S5R A;  2NVT J;  1TC3 C;  1ZK8 A;  4HNV A;  2H8R A;  2G3B A;  3Q0U A;  2G7S A;  3NI7 A;  4ACI A;  2M34 A;  4XRS G;  3V78 A;  5IP9 J;  3BQY A;  3JSJ A;  2DJN A;  1LE8 A;  3HKZ N;  3JRG A;  3M3Y J;  4UUT A;  5HSZ A;  4A3D J;  2KDZ A;  1Y1W J;  2FJ1 A;  1MBH A;  1FJL A;  1GDT A;  2EH3 A;  4AF5 A;  4L62 A;  1FIP A;  2HDD A;  2ZOY A;  3A01 A;  1IJW C;  5JLX A;  5DAJ A;  3B6C A;  2UXP A;  4G12 A;  4HKU A;  4GCK A;  1MH3 A;  3E7Q A;  3LHQ A;  3QPL A;  2IBD A;  2R0Q C;  1AU7 A;  1WH7 A;  2V57 A;  2NOG A;  3S15 J;  1ORK A;  5EG0 A;  2COB A;  2E1O A;  4JX6 A;  4MFD A;  3S14 J;  2DA6 A;  3FK6 A;  3JRC A;  2R5Y A;  4GFK A;  1IUF A;  4X1E A;  2Y0S N;  1K61 A;  3JRF A;  2QKO A;  4JNN A;  2OER A;  1FTT A;  3QKX A;  4L5E A;  2NVX J;  3ANP A;  2HXI A;  4XRS A;  1MBE A;  1VFC A;  2E2H J;  5GPA A;  1HF0 A;  1VF9 A;  1W0U A;  3VW0 A;  4D5F A;  1P7J A;  3CDL A;  4UUS A;  3JR9 A;  5DTD A;  2O7T A;  1BW6 A;  2HKU A;  3O60 A;  2GLO A;  4AYB N;  3HEF A;  4EEF G;  1IC8 A;  5C4Y A;  2DMQ A;  3VVZ A;  3ZQC A;  3NXC A;  4JL3 A;  9ANT A;  1H8A C;  1ZR4 A;  3HDD A;  3G1L A;  5C44 J;  4A3I J;  2DMU A;  5FKN A;  3GTM J;  3OOU A;  2MW8 A;  4W97 A;  3ZQG A;  4CYC A;  1PUF B;  4UDS A;  4IHV A;  4A3F J;  2X6O A;  3TW6 A;  3DPJ A;  2CUF A;  4XRM A;  4A69 C;  2XSD C;  2WUI A;  2UXH A;  3KKD A;  5HOD A;  4GCL A;  3AQT A;  3CQZ J;  3GTK J;  2HOS A;  5M5W J;  1GVD A;  3H3V K;  2Q24 A;  3IUV A;  2DMT A;  3LOC A;  5IYD J;  1TWG J;  4FE7 A;  1IV6 A;  2ZOZ A;  5HBU A;  2E19 A;  2X9D A;  2NP5 A;  2D5V A;  3K2A A;  1ETW A;  1HCR A;  2NX4 A;  4B1R A;  2OPT A;  2WV1 A;  3H0G J;  2DA2 A;  1B8I B;  2PZ9 A;  3PPB A;  2NVQ J;  4V2F A;  5E3L A;  5GPC A;  4RDU A;  4PXI A;  5BNG A;  2MG4 A;  2YVH A;  2ZCN A;  4MFE A;  1MH4 A;  4DZJ A;  2UXI A;  5J1U A;  1JKO C;  3JRI A;  2DTZ A;  3P9T A;  5IP6 A;  3IH4 A;  1BA5 A;  2I10 A;  4ME9 A;  2ZCM A;  3LSJ A;  2FX0 A;  2R5Z A;  2Y9Y A;  3BR5 A;  1SFO J;  1ETY A;  2HQ5 A;  4C3I J;  3VOK A;  2ME0 A;  3S1M J;  2XGC A;  2QWT A;  1IDZ A;  5EF6 A;  4MO7 A;  1YRN A;  1APL C;  2FBQ A;  3HBL A;  2O8K A;  2XGE A;  2R7Z J;  3IV5 A;  1U8B A;  2LD5 A;  3VPR A;  1U9O A;  3NAU A;  2P81 A;  1ETK A;  2K9S A;  3BR2 A;  5F0C A;  3VP5 A;  2CU7 A;  4MK6 A;  2W48 A;  5IYC J;  3A01 B;  2W53 A;  3HM5 A;  5EGO A;  2QIB A;  1X2N A;  4J19 A;  3S2D J;  3PAS A;  2LTP A;  4M3E A;  2EBI A;  4B4C A;  3M4O J;  3BRU A;  5AQC A;  1JJ6 C;  2JA7 J;  3KZ9 A;  2DG8 A;  4IHW A;  3OSF A;  2VI6 A;  3NRG A;  4D5C A;  2XGD A;  1ZR2 A;  3S17 J;  3T6N A;  4A93 J;  4M3D A;  4D7N A;  1MBJ A;  2RAE A;  3FIS A;  2CQQ A;  2MSY A;  2HYJ A;  3TP3 A;  4DYQ A;  4A3E J;  1BL0 A;  1RKT A;  3BR1 A;  4A3B J;  2HOT A;  2LY9 A;  1AKH A;  2XPV A;  2L9R A;  5C3E J;  3HOX J;  3G1O A;  4D7M A;  2MGQ A;  1FTZ A;  4MIM A;  2UXU A;  2REK A;  1NTC A;  3BHQ A;  2Y31 A;  5M3M J;  2K40 A;  3ZQL A;  1UMQ A;  2ID6 A;  2G0E A;  2EZK A;  1DU0 A;  3HTA A;  4A3G J;  2EQR A;  5IOY A;  3MN2 A;  3AQS A;  1XG1 A;  5K58 A;  4BKX A;  1K83 J;  1ETX A;  1WPK A;  2NS7 A;  1B72 A;  2R93 J;  3S1N J;  1EF4 A;  1VI0 A;  4V2G A;  3ON2 A;  4IHX A;  2LR8 A;  2IEK A;  2HI3 A;  4UUS B;  3S16 J;  3HTI A;  3BCG A;  2M2E A;  4A3J J;  1IDY A;  2L7Z A;  1OCT C;  1GUU A;  2XPU A;  5FKK A;  4XID A;  2JN6 A;  2XPW A;  3BTJ A;  5J1R A;  5IP7 J;  2QTQ A;  3W6V A;  3BG9 A;  1RPW A;  2TCT A;  2ZCX A;  2WGB A;  3LJL A; 
#chains in the Genus database with same CATH topology
 3TDZ C;  3WGH A;  4U7B A;  4CYC B;  5HS7 A;  1J09 A;  2TDX A;  5H20 A;  3GTG J;  1T33 A;  3UNG C;  1SFE A;  2CG4 A;  3E97 A;  1WFX A;  2QKM B;  4RGX A;  2V9P A;  3CRJ A;  3F0C A;  5DD4 A;  3ZQI A;  3L9F A;  5FGL A;  3BC8 A;  4E7S A;  2XV4 S;  2M1B A;  3FRQ A;  3MVP A;  2ZC2 A;  2WAF A;  3TBI A;  4BJ5 C;  3VYU B;  2JPC A;  2Z16 A;  2NAZ A;  3BR0 A;  5LHH A;  3HIM A;  2G7H A;  2CRG A;  4BS9 A;  3VEP A;  1NK2 P;  2D6Y A;  1HQC A;  3A0H C;  4M74 A;  3LNQ A;  2ME6 A;  5L3E A;  1WGX A;  5K7F A;  1D8K A;  4Y4R A;  4NDL A;  3F9K A;  3QBM A;  4GDF A;  1W5T A;  1YW8 A;  1S6L A;  2E60 A;  1BW5 A;  4I0B A;  5ILV A;  1G4D A;  2H6B A;  4E7I A;  5EYR A;  1TQI A;  3HGG A;  2FA5 A;  2Y0M A;  4WK8 F;  4S05 A;  5FJ8 J;  4XN3 A;  1EH7 A;  2PBI A;  1IXR C;  5C4J J;  2Y2Z A;  2CV1 A;  5FKO A;  2HVS A;  2P0W A;  2KKO A;  2UXX A;  1S7E A;  4R8H A;  3HOY J;  3S2H J;  1E3O C;  2BV6 A;  2V1U A;  1O3R A;  1T98 A;  3HOZ J;  1SFK A;  3MEX A;  3PM1 A;  2VKH A;  1F43 A;  4EV0 A;  3GF2 A;  2J5O A;  4FET A;  4KA4 A;  3VIB A;  3SHF A;  5F08 A;  3HRT A;  5K7H A;  2D2W A;  3EGQ A;  5A2Q Z;  3ZN0 A;  4B8X A;  2CJJ A;  3A02 A;  5DS9 A;  2JMW A;  3HTS B;  3EQL F;  1YTY A;  1QGP A;  2WC2 A;  3O8H A;  3V6G A;  5J3L A;  2H27 A;  4OD5 A;  5E1Z B;  4KIT B;  1XC5 A;  1U9N A;  4LOC A;  3HHH A;  3RD3 A;  2CQX A;  2V26 A;  2L0K A;  2JA5 J;  4RB1 A;  4BU2 A;  1YO5 C;  5D19 A;  3ZQH A;  1GHC A;  4CCJ A;  2DDB A;  3MKY B;  2B3W A;  2OUM A;  4Y7N J;  1ITY A;  4AUX A;  2IU5 A;  2E1C A;  5A2Q K;  1UST A;  4XKW A;  4XN0 A;  4OIO F;  5DYM A;  5EZH A;  3RQI A;  1RC9 A;  3HG9 A;  5E8G A;  1OYY A;  3VW1 A;  2JTV A;  3DFG A;  4KIB A;  3F8N A;  1O3T A;  5HLI A;  4WCG A;  2HVR A;  4ZZL A;  4NUB A;  2VJJ A;  2XDN A;  2X51 A;  4LIV A;  1V55 H;  4XLA A;  3KZI C;  3HSR A;  4A0Y A;  3CME I;  3OL4 A;  1JGG A;  1JKQ C;  3CO7 C;  4AC6 A;  3OYJ A;  3RIR A;  1LKX A;  2BY2 A;  2FD5 A;  1RRJ A;  2GXA A;  3HHG A;  3M07 A;  4JX4 A;  2R5Y B;  2Q0O A;  4E4H A;  2HVQ A;  3DTE A;  3OL3 A;  3SZP A;  4M3F A;  3RKY A;  3ABM H;  1WVR A;  3DEE A;  2EA2 A;  2MBF A;  1YHQ I;  2HPM A;  2DA4 A;  1MMD A;  2JPB A;  2D1V A;  1T95 A;  3CP8 A;  3HTJ A;  4LFU A;  2M7A A;  1U6G A;  2LRE A;  2IGK A;  3FXQ A;  4GCV A;  3T5X A;  3P7N A;  1ZAO A;  3HUG A;  4A5N A;  1VQ4 I;  5AON A;  4BHP A;  1G6N A;  2EV5 A;  2Q2E B;  4U0V A;  3ZN1 A;  1FYL A;  4KDP A;  2EB7 A;  3RYR A;  1XMA A;  1IN6 A;  1T2K A;  3QOD A;  2GOX B;  2V9K A;  3G2B A;  1R71 A;  3OS2 A;  5ICC A;  1J5Y A;  4LLL A;  3GCM A;  1R5G A;  2OV7 A;  3CMY A;  2IS1 A;  3BP8 A;  1HA8 A;  5CJ9 A;  4BXF A;  1OCC H;  2AO9 A;  2QQ8 A;  4KN7 X;  5KK1 A;  1B9N A;  4HST A;  4KMU X;  1Q1H A;  5L3G A;  3FK7 A;  2EIN H;  1JKR C;  3BJ6 A;  2JVH A;  5D5W B;  3QYE A;  4IHT A;  2IS6 A;  4IOC F;  4E7H A;  2DPD A;  3BR3 A;  2L9N A;  2JT1 A;  2WAD A;  4KWA A;  3VOD A;  2A69 F;  1V5G A;  2ZB9 A;  4G6T B;  4MQ9 F;  3CCQ I;  3CLQ A;  4IHY A;  2HZT A;  1U8R A;  2ELJ A;  2R7U A;  3CUQ A;  4OMY A;  4PSW A;  3CJT B;  2VE9 A;  5HVQ C;  3KIO A;  2RKH A;  1REP C;  3WU0 A;  1D1B A;  1BIB A;  2EFN A;  4B47 A;  2WAQ N;  3VYT B;  1YJN I;  1YYV A;  4P5O A;  3BPX A;  5FD6 A;  1Z1D A;  3L2V A;  5F0F A;  1SC7 A;  3ERE D;  4RGR A;  5KHD A;  1FIA A;  5FRN A;  2ISY A;  1B4A A;  3ABL H;  3HTH A;  1F9N A;  1WJE A;  2FNA A;  2HOA A;  3ZQF A;  5LD2 C;  3I59 A;  3IAS 2;  2QBY A;  4HV5 A;  3SDG A;  2VBZ A;  3ZMD A;  2A6E F;  5E3O A;  1BJZ A;  2NVU B;  1Y39 A;  2BY3 A;  4NEL A;  5CVR A;  3HPH A;  1R5I D;  2CFO A;  2VKV A;  3V7S A;  4A3L J;  1FBU A;  3PNY A;  2YS9 A;  3KEO A;  2DA5 A;  5B1A H;  1FYM A;  3VYS B;  5CVJ A;  1VQM I;  1TW2 A;  5E17 F;  3QAH A;  2BW3 B;  1X3U A;  5KAF C;  3LWJ A;  2RNG A;  4FE4 A;  3D5S C;  3HOW J;  1OPC A;  4CO8 A;  3KFW X;  1JKP C;  4CSW A;  2EIM H;  1XSX A;  2X6Y A;  1HXD A;  4M9Z A;  1ENH A;  2LY2 A;  1QZY A;  4F55 A;  2XC7 A;  2CSO A;  2LC2 A;  2YVE A;  2CUZ A;  3DPU A;  2LKX A;  3LQQ A;  4DW6 A;  4XM3 A;  2XRL A;  1PUE E;  3PJR A;  2E34 A;  3DEU A;  2Z5U A;  3KP5 A;  1X2M A;  1ZGJ A;  3KEQ A;  1XPX A;  4ZYD A;  1UG2 A;  1HST A;  4EM1 A;  5F1J A;  1AKH B;  3JRB A;  2PLY A;  1WKM A;  3LSP A;  3ELK A;  3K4N A;  1YG2 A;  4YII A;  4EM0 B;  4S0H B;  4CGZ A;  3KNW A;  2LOO A;  1S7O A;  3K1M A;  4XKC A;  3BWG A;  2A5Y B;  3L1P A;  3I71 A;  1X1C A;  3GW2 A;  1JUM A;  5BPD A;  5IT9 Z;  5EFY A;  3K1N A;  3S32 A;  3IHU A;  3ABT A;  1GT0 C;  1MMN A;  2ZXH A;  1NH3 A;  3BT9 A;  3R4K A;  2LF8 A;  3DWL E;  4C3H J;  2CV0 A;  1TWA J;  3OIQ A;  1L0O C;  1TNT A;  1YW7 A;  1A04 A;  3H35 A;  2ZCW A;  5D5X B;  4B48 A;  2JJ7 A;  4NQW B;  3M1E A;  4HF0 A;  4WWC A;  1WH5 A;  3FHN A;  1DP7 P;  3S5R A;  2NVT J;  3W2V A;  3JSP A;  3Q0U A;  2F5C A;  2HQA A;  3JSJ A;  3HKZ N;  1G3S A;  5IT9 K;  4RB3 C;  4UUT A;  4A3D J;  2KDZ A;  2IPQ X;  2L4A A;  2O3F A;  5TIS C;  1MKM A;  3L7W A;  2W4S A;  3RKX A;  2QGU A;  1G3W A;  2KRH A;  2V6E A;  4AF5 A;  3WU2 C;  2KZV A;  4LG3 A;  1IJW C;  1R49 A;  1Z6T A;  5FB2 A;  1UCR A;  2LRD A;  1MH3 A;  3KYD B;  4PJL A;  2Z33 A;  2IBD A;  5B1B H;  2W85 A;  5GAH J;  4HSR A;  4BXU A;  3IRR A;  2E1M B;  5J4Y A;  1WI9 A;  4OIN F;  3PUB A;  1NG7 A;  2XVC A;  5F1R A;  2G7U A;  2DA6 A;  4GFK A;  1FYK A;  1F5T A;  3HC7 A;  1KU9 A;  2ZFW A;  1UEL B;  2F6C A;  3JRF A;  1IRG A;  2RV8 A;  2OER A;  2RC4 A;  3TO9 A;  4PZJ A;  1FLI A;  2A3S A;  2OU2 A;  3PSF A;  3JW4 A;  1VQ8 I;  5CQG A;  1XMX A;  1EV7 A;  2JUG A;  4YEJ A;  4YFK F;  3MKW B;  1W0U A;  4CCN A;  4XLH A;  4UUS A;  4EJU A;  4G7H F;  1EKE A;  2VXD A;  1FSH A;  3HEF A;  1JHH A;  4EEF G;  1IC8 A;  4KIF A;  4A5M A;  1Y8Q B;  1TQM A;  4HNT A;  3W2W A;  4RS8 A;  5DUI A;  3OOU A;  1V54 H;  1IZ1 A;  1E3P A;  4CYC A;  3OYE A;  4IHV A;  1PP8 F;  3RDI A;  4IJA A;  2EV6 A;  2O5R A;  4AVZ A;  3DLA A;  3OYF A;  1LJ9 A;  4LLN A;  1K78 B;  2XSD C;  3W3C A;  1BR1 A;  3GTK J;  3E6M A;  1SVO A;  3F8F A;  3H3V K;  1SAX A;  3IUV A;  1VQ5 I;  1ZRC A;  3WG7 H;  5J4V A;  1MJA A;  2E19 A;  3OOP A;  4RA2 A;  2B1E A;  4C2T A;  2WAQ A;  2HDC A;  1ETW A;  4LIU A;  2NX4 A;  2K5C A;  4UB8 C;  3I0T A;  3H0G J;  4N4O B;  1B8I B;  1BI1 A;  2PZ9 A;  2F5V A;  2BOL A;  1BOA A;  4V2F A;  5E3L A;  4RDU A;  3NEU A;  4ZDL A;  2ZCN A;  4MFE A;  3RTR A;  1MH4 A;  1ODD A;  4CA0 A;  2DOE A;  2DTZ A;  1S5L C;  3VFZ A;  5DCM A;  1BA5 A;  3V8L A;  3RKW A;  5H6Q A;  1Y0N A;  2CFX A;  4DOZ A;  4XLE A;  1OKR A;  4C3I J;  5DD8 A;  1PP7 U;  4BQO A;  2QWT A;  1YS7 A;  4XKB A;  4LMY A;  4TV7 A;  2ELH A;  3BY6 A;  4P9F A;  1APL C;  4I0A A;  4XMY A;  4BEH B;  1ON2 A;  3HBL A;  5IT3 A;  2X0L A;  3WTX C;  3IV5 A;  4JQF A;  5DEQ A;  2DK8 A;  4DNC A;  4LB6 B;  2JZY A;  2HPI A;  2HKO A;  4UVA A;  4DJA A;  5D5V B;  3NAU A;  1LEB A;  1ETK A;  2EK5 A;  1DDN A;  5F0C A;  4EJW A;  3KP3 A;  2CU7 A;  2E7X A;  3L09 A;  3TO7 A;  2JVG A;  3CJR B;  5EGO A;  4O3M A;  2QIB A;  4XSX F;  4L5I A;  2P6T A;  2VE8 A;  2IXS A;  2EBI A;  3BRU A;  1FNN A;  2PN6 A;  2JA7 J;  3BOQ A;  5JVG F;  1PYV A;  4D5C A;  1ZR2 A;  3DU6 A;  1N78 A;  3T6N A;  1Z05 A;  2M5W A;  4E7J A;  2CQQ A;  2HDW A;  2HYJ A;  4DYQ A;  3RQ4 A;  4ENN A;  5BMZ A;  3F6O A;  4QPQ A;  2ZJQ F;  1RKT A;  3BR1 A;  4I99 C;  4AIH A;  3GLX A;  2LY9 A;  1X1P A;  3HOX J;  3SZG A;  5D5U B;  4E7L A;  4PJM A;  2UV1 A;  1V5E A;  1DGR M;  3CUQ C;  2K40 A;  1FSE A;  2F5D A;  3CUQ B;  3HTA A;  3CMM A;  3QU3 A;  4CYD A;  1UFM A;  1XG1 A;  3A0B C;  4KFC A;  1WPK A;  3ON2 A;  3S1N J;  4IHX A;  3W6J B;  2QA4 I;  3KP6 A;  5CVV A;  3HTI A;  4KMF A;  4Q47 A;  2M2E A;  4A3J J;  3BCG A;  1OCT C;  1GUU A;  4EAT A;  5FRO A;  2CUJ A;  1R4M B;  4GGG A;  2L5Q A;  1DPR A;  5J1R A;  4QWQ A;  1RPW A;  3L00 A;  2QBY B;  4NBQ A;  3LJL A;  3SFI A;  2CH0 A;  2D45 A;  1JTX A;  1ETO A;  1FOY A;  3WHB A;  2Q2E A;  3J80 Z;  1EH8 A;  1D1C A;  3TKY A;  1OCP A;  3HXL A;  3T0Y A;  4B3A A;  2VUM J;  5D4S A;  2PMU A;  3QWL A;  1QU3 A;  3B73 A;  2EZI A;  1W7P B;  3TO6 A;  4ZH4 F;  3HSE A;  5E3M A;  2XB0 X;  3HRS A;  3F23 A;  5F6F A;  4KJZ A;  3CD6 I;  4C3J J;  3BCB A;  2MD0 A;  1RKW A;  2OQR A;  2F07 A;  5FMP A;  4RBO A;  2H6C A;  5FD5 A;  4ZYE A;  5J6X A;  3IL2 A;  3K2Z A;  3OY9 A;  3J80 K;  3EDP A;  1GXP A;  4FX0 A;  2M4G A;  5M5X J;  5L3C A;  1S9H A;  4BY7 J;  4EJT A;  4PJN A;  2OTJ I;  4PCQ A;  5FGM A;  2W84 A;  3CCY A;  4HAM A;  4I01 A;  3PO3 J;  4ESF A;  2VOD A;  2VIX A;  3SZT A;  3JRE A;  2DMN A;  5E79 C;  1H89 C;  3I54 A;  2O0Y A;  2IS4 A;  2K02 A;  2BE5 F;  3Q0W A;  4A12 A;  4IRI A;  2K7L A;  3AL0 C;  1AOY A;  4FIS A;  2R7F A;  2VN2 A;  3VDX A;  2DLL A;  4Q4Z F;  3AL0 B;  2H1K A;  2BVL A;  4G6D A;  3IH3 A;  1OIS A;  2IA0 A;  5LGT A;  4Y52 J;  3GYH X;  3FKI J;  2VOP A;  2PG4 A;  1SVM A;  3MMY B;  1QZE A;  2AXL A;  2BXZ A;  4F3Q A;  5D1R A;  1HDD C;  2OBP A;  4P96 A;  3CC4 I;  1X3Z B;  2FSW A;  1VZ0 A;  2IAI A;  4BDZ A;  2TRT A;  1WJ5 A;  3VOX A;  3F21 A;  3AG4 H;  3C2G A;  3T8R A;  3VVX A;  3Q3S A;  1LQ1 A;  2DAO A;  1SAN A;  3R0A A;  4EGY A;  1E17 A;  1PJR A;  2M0C A;  1F36 A;  4KYW A;  2QLZ A;  3H3U A;  3KX2 A;  4N9I A;  2LVS A;  2M3A A;  1Z91 A;  2BW3 A;  3O3K A;  3ULQ B;  1SMY F;  4U7D A;  1O57 A;  2Q8K A;  3HL2 A;  4LIT A;  5HNF A;  5JHU A;  1LPQ A;  2LLK A;  1XB4 A;  1FBS A;  2AHQ A;  2DU9 A;  2R7R A;  4HDV A;  4GCT A;  1IF1 A;  4B43 A;  3H5R A;  3GEU A;  4DYC A;  1WJC A;  4I76 A;  2BHY A;  3LAJ A;  3E5X A;  4CCK A;  4AU7 A;  2OZ6 A;  3CJN A;  3A03 A;  1P4A A;  1VQO I;  1B72 B;  3FBI B;  1QHG A;  3QPS A;  1RIO H;  2B0L A;  2ZXJ A;  2PMZ N;  2GWR A;  2VT2 A;  4II2 A;  4F7Z A;  2OZU A;  3EYY A;  3BQZ A;  2AS5 F;  5FRM A;  3M1C A;  4PJJ A;  3C07 A;  2KT0 A;  1D3Y A;  3VUQ A;  5E3N A;  4RB0 A;  2DBB A;  1S7A A;  2BYV E;  2P8T A;  1D0X A;  5DDG A;  4E7K A;  4U87 A;  1X1B A;  2K3P A;  2XGX A;  2ISZ A;  3CCR I;  2GOM A;  1HW2 A;  5K1Y A;  4FQG A;  3VSL A;  4NQW A;  4H0E A;  2QCO A;  1R7J A;  4XK4 A;  1T0F C;  2O9L A;  2ZBK A;  2FEZ A;  2V4J C;  1JI8 A;  3LA7 A;  2WY8 Q;  1MBK A;  1OCO H;  1WJF A;  1KQ8 A;  2RQP A;  4GYG A;  1W7P D;  4CGR A;  3MNL A;  1LUJ B;  3K4L A;  2VKD A;  3GBG A;  5L3F A;  1TWF J;  2Y69 H;  2YU3 A;  4L0Z B;  1JTY A;  3M9A A;  1SEU A;  2VQL A;  2YPR A;  3C7J A;  2V79 A;  1XDU A;  2G9W A;  4GO1 A;  1TBX A;  4H4K C;  4M73 A;  4FCY A;  2K9Q A;  1QRY A;  1VND A;  2X85 A;  2OI8 A;  3AAF A;  4FT8 A;  1P92 A;  1W5S A;  1LEA A;  4NN1 A;  4B09 A;  3K6G A;  4HX7 A;  3SJM A;  3VVY A;  2VBY A;  1A6I A;  2ZSI B;  4NNJ A;  2Z3Y A;  2ZKZ A;  1AWC A;  4RGU A;  3IKV A;  1LDJ A;  4CCL A;  2DQL A;  3ZMV A;  4GFB A;  2FOW A;  1RR8 C;  2GEN A;  3C2B A;  2DTR A;  3G56 A;  4S04 A;  3OWT A;  2CUE A;  3NPI A;  5JI6 A;  5E20 A;  3D5L A;  3DKY A;  4M72 A;  4IRV A;  2DFF A;  2JWT A;  2HYT A;  2YUS A;  3CDH A;  1R1T A;  1W5C C;  5DCM B;  2RHA A;  1IW7 F;  4JP0 A;  5DM7 F;  3GTO J;  4CZC A;  4HQM A;  3EUA A;  3KZZ A;  1YS6 A;  5CVU A;  3CC7 I;  1K79 A;  2R3S A;  4MHG A;  3I9V 2;  2WTE A;  2Y30 A;  4AYB A;  3X2Q H;  1HW5 A;  5FO5 A;  5LEK A;  4A2U A;  3L2Q A;  1WJA A;  3HE0 A;  4P1W A;  3VW2 A;  2IA1 A;  5GAD J;  1K4T A;  2DA3 A;  2KRF A;  3LSR A;  4LK0 F;  1JXS A;  2ZSH B;  2E2J J;  4ESB A;  3ZP5 A;  2FJI 1;  1B6A A;  2X6W A;  3EUH C;  3FMQ A;  3GZN B;  3NRV A;  4M6V A;  4I6Z A;  2DXI A;  1MND A;  3SEQ A;  1G59 A;  1C0W A;  2H8W A;  1IUY A;  1XMK A;  4OD4 A;  1V5F A;  1IG7 A;  4L9V A;  5D4R A;  5EGO B;  4IVN A;  4N4N B;  4AIJ A;  2CW7 A;  2B63 J;  4DBR A;  3BZC A;  1SVL A;  3IWF A;  1K78 A;  2HQR A;  2XAG A;  3DTI A;  1OCZ H;  4NC8 A;  1ZG1 A;  5H6R A;  4OWR B;  4M6Y A;  5E18 F;  1B1B A;  3WTY C;  3LFU A;  3RZD J;  2B9S A;  2XIG A;  1LDD A;  4CDG A;  5HDN A;  3TMO A;  1LFP A;  1SGM A;  4OAY A;  3BTI A;  1B8I A;  2Y9Z A;  1KU7 A;  5EEA A;  3H92 A;  2BY1 A;  2RAS A;  4ZDO A;  3MCZ A;  1HDP A;  2LBF B;  3BZ6 A;  2DO7 A;  4UXN A;  3DKW A;  2NP3 A;  4XIC A;  1MBG A;  5GTH C;  1MBF A;  3F8B A;  3R60 A;  3G7R A;  2FRH A;  3J81 Z;  2F48 A;  3WTV C;  3V7C A;  3AG3 H;  3HYI A;  1BBY A;  3OYN A;  5CXI A;  4ZDP A;  4HEA 2;  3CCS I;  2XKP A;  2M45 A;  3GFM A;  4BEH A;  1YJ9 I;  2VOO A;  2H8R A;  2G3B A;  4ACI A;  2M34 A;  1TNS A;  4XRS G;  3C18 A;  3V78 A;  2R7T A;  3BQY A;  4LGW A;  2K3F A;  4NB5 A;  3M3Y J;  1VQ9 I;  1K6Y A;  5HSZ A;  5TGT A;  5D8K B;  3E6B A;  2FJ1 A;  5LHG A;  3K4C A;  3VB2 A;  4HV6 A;  3OYL A;  3D0S A;  2DYR H;  1SD6 A;  3J81 K;  5ICF A;  1KYZ A;  4DVY P;  3LHQ A;  1YLF A;  2ICW G;  1X3W B;  2MH2 A;  3QRF F;  3PIP F;  1P2F A;  1Y0U A;  2CQK A;  3E5Q A;  1AU7 A;  1JGS A;  3LA2 A;  3S15 J;  2E1O A;  3VTI A;  4WIB A;  1W4M A;  1IXC A;  3GWZ A;  3GFI A;  3E1S A;  2M87 A;  3FK6 A;  5EEG A;  3DKX A;  1BR2 A;  1FMW A;  3LSK A;  1IUF A;  4L18 B;  2HFH A;  1R6R A;  2VJI A;  4HW0 A;  3TL4 X;  4CIC A;  2QKO A;  4JNN A;  5GAG J;  3FXK A;  3QKX A;  1RI7 A;  4L5E A;  1ZRD A;  3CO6 C;  5K5Q A;  2HXI A;  5GPA A;  1S72 I;  3VW0 A;  2FBK A;  2ZXW H;  2W82 A;  1P7J A;  4D5F A;  2P7V B;  3CCU I;  5DTD A;  3K4M A;  4KT5 C;  3HIF A;  1XDS A;  1BW6 A;  5C4Y A;  4YIR X;  3ZQC A;  2P5V A;  3CJQ B;  3NXC A;  4JL3 A;  1FZP B;  2XRO A;  5DCF A;  1H8A C;  4BNC A;  2DMU A;  1E0E A;  5FKN A;  2Z2S B;  1O3Q A;  1KON A;  2MW8 A;  1DPU A;  2QQA A;  5JVT A;  4A3F J;  3MD2 A;  4Q48 A;  4HBL A;  5J47 A;  1HKT A;  4XRM A;  1ACI A;  3KKD A;  2UXH A;  1BC8 C;  3SFZ A;  1U5T C;  4R1H A;  5E1W A;  2HOS A;  3OYK A;  4C2M A;  1GVD A;  2XAH A;  1U5T B;  1W7P A;  2Q24 A;  2DMT A;  1KU3 A;  4FE7 A;  1IV6 A;  1OYW A;  1MJB A;  3Q5F A;  2ZOZ A;  4R79 A;  3HOT A;  3K2A A;  1K6O A;  1FOX A;  4B1R A;  1HW1 A;  2XAQ A;  4I02 A;  2DA2 A;  5GPC A;  4PXI A;  4K2E A;  1J9I A;  4DZJ A;  2L9S A;  5HLH A;  4B3X A;  5J1U A;  1JKO C;  3H9G A;  3PSI A;  4HLX A;  4XSZ F;  1PVE A;  4XL9 A;  5IP6 A;  2X1C A;  2A68 F;  2O6G E;  1IXS B;  4M6X A;  3LSJ A;  2FX0 A;  5F64 A;  1ETY A;  2M0M A;  4PFO A;  1VQ7 I;  3P9C A;  1IRX A;  4PUS A;  3J7A Y;  5CKT A;  4BJ6 C;  5EF6 A;  3P5J A;  2CS3 A;  1ZGA A;  4XLC A;  2GIZ A;  2STT A;  2QVO A;  4XOT A;  2IGM A;  2XGE A;  3WTW C;  3N05 A;  1U8B A;  3GFJ A;  2KIQ A;  3E0J B;  3AKZ A;  4AD9 A;  2P81 A;  3BR2 A;  2OCE A;  2M30 A;  3AFH A;  1IAW A;  4MK6 A;  1R22 A;  2XAU A;  5H2F C;  5IYC J;  3OS0 A;  1X2N A;  1Z7U A;  2OJE D;  3S2D J;  2IS2 A;  1TQP A;  4NHJ A;  2FBH A;  2KJC A;  5AQC A;  2F2E A;  2VAS A;  2P4W A;  4A0X A;  4BGD A;  1HKQ A;  5DUK A;  4KN4 X;  2XGD A;  2FXA A;  3KE2 A;  1TTY A;  3ECO A;  3FIS A;  1Z67 A;  2ZO4 A;  1J0R A;  4A3B J;  2LYC A;  2HOT A;  3V8J A;  5C3E J;  2L9R A;  4ZTF A;  4D7M A;  1YIO A;  2A2F X;  2BEO A;  1NTC A;  3BHQ A;  5M3M J;  4QPO A;  4PGG A;  3ZQL A;  2G0E A;  2EZK A;  3PNV A;  4BUP A;  2CMP A;  2EQR A;  1ZH5 A;  5IOY A;  5BQT A;  3P9I A;  4BKX A;  3H9Q A;  1ETX A;  1B72 A;  3MZ8 A;  3SEZ A;  2F4M B;  1USS A;  3GEZ A;  4J00 A;  2LR8 A;  1MMS A;  2IGO A;  2IEK A;  2HI3 A;  2BVM A;  3S16 J;  3F6V A;  4BAY A;  1DQU A;  3MFK A;  3AG2 H;  2JSC A;  2XPU A;  3FXR A;  2XPW A;  1TT0 A;  1QO0 D;  2LY1 A;  1J75 A;  2QTQ A;  3A1Y A;  3BG9 A;  4UV9 A;  2ZCX A;  2WGB A;  3ON4 A;  2WY7 Q;  3ZXS A;  1ZG5 A;  4CH7 A;  5CPR B;  4IO9 F;  1T39 A;  2GZW A;  2E2I J;  3LQR A;  1ZN2 A;  2XUB A;  3ZCO A;  2Z1D A;  3RPQ A;  1WCM J;  3BTC A;  3SYT A;  3B81 A;  1XCV A;  4BBS J;  3NNR A;  1RR7 A;  4IOA F;  1POG A;  2XAJ A;  4BY1 J;  1T0F A;  1ZG3 A;  4CUG A;  1YE9 A;  4OIP F;  3DPL C;  3C1D A;  3PQJ A;  3E7L A;  3ISP A;  1XGS A;  3GZ5 A;  3QP5 A;  5D18 A;  1R58 A;  2ECB A;  3K1P A;  3S3O A;  1BI0 A;  2CGP A;  1BI3 A;  1UI6 A;  4WXH A;  4QIW N;  2DK5 A;  5J8C A;  4JK1 X;  1Z6R A;  1YIJ I;  3NQO A;  3GX4 X;  3K7A J;  2EFW A;  4LG0 B;  4XLF A;  1HBX G;  4HX8 A;  2R7S A;  1Y56 A;  3LA3 A;  1UHW A;  2QEN A;  3KP4 A;  3HZJ A;  2X4H A;  4L9T A;  3KEY A;  3UR3 C;  1JUP A;  1LNW A;  1CQT A;  4XNF A;  5FHP A;  3COA C;  1IN7 A;  2R5Z B;  2JA8 J;  3H1C A;  3IH2 A;  1XS9 A;  1R1U A;  2EFP A;  3CUO A;  1OMI A;  2MYS A;  3I3L A;  3KYL A;  4KIG A;  4BE1 A;  1ZQ3 P;  1MMA A;  3K4K A;  1YRN B;  3T8T A;  2MLG A;  3K0L A;  5EDN A;  2QSF X;  3CP2 A;  5E1X A;  1N75 A;  2QSH X;  2WV0 A;  1SFX A;  1F1Z A;  3S1Q J;  3KKC A;  1OJL A;  2FQ3 A;  3JAM Z;  2QUF A;  3FXU A;  3WTT C;  3G1M A;  3FXM A;  2IW5 A;  2L7F P;  1BR4 A;  1FBQ A;  1N77 A;  4X6A J;  2O8X A;  2BGC A;  5K5O A;  4MGR A;  1LFB A;  1ZLJ A;  2HR3 A;  2V9V A;  1DU6 A;  3GTP J;  2A5W A;  2L7M P;  4NC7 A;  2IA2 A;  4UUV A;  5HDK A;  3VOE A;  2VXZ A;  4HX4 A;  3FMS A;  3QOP A;  1P7I A;  2IP2 A;  1OFC X;  5IOZ A;  1A6Q A;  3HOS A;  2YU9 J;  3R6S A;  3C2H A;  3CTA A;  3JAM K;  2ELK A;  4ENM A;  5ERI A;  3UKG A;  4A3M J;  3LL7 A;  1RUO A;  1IGN A;  3BPV A;  5JHF A;  3EUH A;  3OYM A;  1PDN C;  2DFH A;  1HLV A;  2LSO A;  4Z6Y A;  3WGG A;  3V4G A;  4HG2 A;  1VQL I;  3IC7 A;  4QTR A;  3EUP A;  1X1A A;  4RM3 A;  4ZC3 A;  5M3F J;  2DG7 A;  4Y13 A;  2DI3 A;  3NAR A;  4YFX F;  3Q9S A;  2LKP A;  5K7Z A;  2ADU A;  5KVR A;  5M5Y J;  2K9N A;  1IN4 A;  3GLL A;  2FNP A;  1FMV A;  4FAS D;  1UI5 A;  1YX3 A;  4RLQ A;  3TOB A;  4LB5 A;  1FOK A;  2ESH A;  3J7Z I;  2VQH A;  4JX5 A;  1BI2 A;  4BYY A;  2A05 A;  3CJD A;  2LBF A;  1UZC A;  2EZH A;  4E7Z A;  4O6J A;  4RLF A;  3N97 A;  2IT0 A;  5CXG A;  5LRR A;  2UXO A;  3R61 A;  1X4O A;  5CLS A;  4G6Q A;  1MSF C;  1IRZ A;  3G3Z A;  4MXM A;  5F0H A;  2CYY A;  2EPF A;  1MMG A;  2CQN A;  5J40 A;  1FX7 A;  3PFI A;  3WE3 A;  2R7Q A;  3WTU C;  3GZI A;  5TJJ A;  2ZJP F;  3H36 A;  3HKZ A;  4XR6 A;  5HS9 A;  3JRH A;  3COL A;  1I1G A;  1X58 A;  2P6S A;  2QKL B;  3KLO A;  3ZMZ A;  1JE8 A;  3J7A O;  1Q1V A;  1I6H J;  4PFP A;  3DBR B;  1CF7 B;  3QPH A;  3IAM 2;  4RAG A;  2E1N A;  3QQA A;  4LLG F;  5BOX A;  2HQN A;  4YG2 F;  2CWE A;  3GZ6 A;  5FFZ A;  2HKX A;  4MEX F;  1ON1 A;  1WJB A;  3FHZ A;  1YIT I;  5J1Y A;  1YQA A;  3QU6 A;  1UG0 A;  2VPR A;  1FT9 A;  1QQI A;  2WBM A;  3CES A;  4D0P A;  3WGI A;  1UAA A;  2DN0 A;  4IPA A;  3OYH A;  2PI0 A;  2OA4 A;  5B5E C;  3K70 C;  5D6E A;  2K9L A;  2XKO A;  2DOA A;  4FTH A;  3VSK A;  2BXY A;  5ED4 A;  4M3B A;  2UUZ A;  3BR6 A;  4UHT A;  4XLP F;  3ZQQ A;  1W0T A;  2IJL A;  4U88 A;  3KZY A;  2Y75 A;  4F91 B;  2FE3 A;  3ZMU A;  4QLC U;  5J8F A;  4UNO A;  5DV5 A;  4JKZ A;  4IKF A;  3BDD A;  4YEL A;  3H0D A;  2LMD A;  1ZEL A;  1QVT A;  1TW3 A;  5JLW A;  5H9T A;  5KCM A;  3GO5 A;  1WRJ A;  3BNI A;  4A3C J;  1FEX A;  2MFZ A;  2M9H A;  4HOB A;  2L3D A;  2R7O A;  3HJE A;  3F3X A;  3PFY A;  2IRF G;  2V7F A;  3OYG A;  5BPI A;  4BQA A;  1YX5 A;  3BJB A;  1RET A;  2KZG A;  3M8J A;  3U1K A;  2KIU A;  3ZQ7 A;  4XON A;  4MTE A;  3S1R J;  4G8X A;  3RPU D;  4DZP A;  2DDA A;  2VBW A;  3C3W A;  3CWR A;  2HXO A;  2MH9 A;  2EIJ H;  5FKL A;  2Z9O A;  1U0J A;  4JOM A;  1U5T A;  3ESW B;  4ICH A;  4OU0 A;  4ZJZ A;  4KT6 A;  1ZYR F;  1ULY A;  3HRM A;  4I7H A;  2GBY A;  3MKL A;  4C2M J;  3JRD A;  3GUD A;  2EV0 A;  1JJ8 C;  3H3Z A;  2GUH A;  1I5Z A;  2M7B A;  4I98 B;  1X19 A;  1EJ9 A;  2EZL A;  1R5H A;  1SAU A;  3CCJ I;  1GV2 A;  2XB5 A;  2WB1 N;  2X48 A;  1ONV A;  4HRI A;  1HOM A;  2FML A;  3OMY A;  3TW7 A;  3DXJ F;  3U21 A;  2LFB A;  4EJO A;  1GV5 A;  4PSX A;  4HF2 A;  2O03 A;  4N0B A;  3ZGK A;  4M9X A;  1KGS A;  4UVB A;  1EA3 A;  1LFU P;  2A61 A;  2R7D A;  3DF8 A;  2EIL H;  4AVP A;  1W36 C;  1TC3 C;  2HWV A;  2HOE A;  4HNV A;  2NOJ B;  3NI7 A;  2HYF A;  2DOD A;  3NS4 A;  2PQ8 A;  1LE8 A;  3MAJ A;  2H94 A;  3I58 A;  3WG9 A;  5E8I A;  2PJR A;  1MBH A;  1FJL A;  4L62 A;  1FIP A;  1G8X A;  1Z7L A;  2CO5 A;  4YRV A;  5DAJ A;  3B6C A;  3VYR B;  2UXP A;  2DW4 A;  4G12 A;  4GCK A;  3ONQ A;  4IX7 A;  3QPL A;  1KQ0 A;  1OR7 C;  4E70 A;  2K27 A;  1T08 B;  5LGU A;  3ASN H;  2AQF A;  2XAF A;  4DBQ A;  2V57 A;  3LAP A;  2NOG A;  3QOE A;  5EG0 A;  3MZH A;  2COB A;  3EYI A;  2A6H F;  1OQY A;  2FUG 2;  4MFD A;  3S3N A;  4C30 A;  1S29 A;  3PQK A;  3RYP A;  3JRC A;  1SD5 A;  1ZRE A;  1T8I A;  4BQQ A;  1XN7 A;  4X1E A;  4XOP A;  4IRG A;  2OCC H;  5LHI A;  2Y0S N;  2ZME C;  4BL0 B;  3HPG A;  1K61 A;  2ACJ A;  5B66 C;  3CLO A;  2ZME B;  2NNY A;  1FTT A;  4CZZ A;  2LNB A;  3JSO A;  3K8P C;  4CCM A;  3K9T A;  2E2H J;  1VF9 A;  2RNJ A;  2W7N A;  3FX3 A;  2XSJ C;  3CDL A;  2PFB A;  3JR9 A;  1RZ4 A;  4HF1 A;  4IZZ A;  3SXY A;  3ABU A;  3O60 A;  4EM2 A;  3G73 A;  2GLO A;  3CMA I;  2MLK A;  1OCR H;  5DM6 F;  4UB6 C;  3FM3 A;  4IQJ A;  3VVZ A;  1M1E B;  2JSP A;  1ZR4 A;  3HDD A;  4RM2 A;  4A3I J;  2JQ7 A;  3GTM J;  2NS0 A;  2P7C B;  4W97 A;  3K4B A;  3ZQG A;  1PUF B;  1VQN I;  2X6O A;  3TW6 A;  4DGW B;  2D1H A;  1MNE A;  3DP7 A;  1MW7 A;  3IKT A;  2NRA C;  4D9J A;  3AQT A;  3F8M A;  3NWT A;  3OYB A;  3TQN A;  2H1L A;  2PFV A;  1E2X A;  2M8E A;  3L2C A;  3LOC A;  1MZB A;  1TWG J;  3ERM A;  3T1B A;  3BG7 A;  2VT3 A;  1OLT A;  4PDK A;  5L3D A;  2CQ7 A;  1KA8 A;  4J01 A;  2OPT A;  2WV1 A;  3LWF A;  4LG0 A;  2CV2 A;  3CZ6 A;  3PPB A;  3JCU C;  5BNG A;  4Y3O A;  3G4S I;  2YVH A;  2DCE A;  1XGO A;  2X6X A;  5LLQ A;  5EEH A;  4BJT A;  2NNN A;  2KRC A;  4WX9 A;  3IH4 A;  5FLX Z;  4ME9 A;  2BBY A;  2X1E A;  2R5Z A;  3BR5 A;  2IVM A;  1SFO J;  4PGH A;  4IQ4 A;  2HQ5 A;  3VOK A;  2ME0 A;  1Z3Y A;  2ESN A;  3S1M J;  3IP4 B;  3M7G A;  3OV8 A;  2OAZ A;  1L3L A;  1LDK B;  4OOI A;  3CCE I;  1I3A A;  1YRN A;  1KU2 A;  3U1D A;  4HZF A;  1TP4 A;  3I55 I;  4IF4 A;  1D0Y A;  2GXB A;  2O8K A;  2HYG D;  3TGN A;  2R4G A;  3PNT A;  4G94 A;  1W36 D;  1YOV B;  2R7Z J;  3V42 A;  4RAY A;  2LD5 A;  1VTN C;  1YFH A;  2DPU A;  5HS8 A;  2BY0 A;  3W2A A;  1U9O A;  2UXN A;  2W24 A;  1ZAR A;  5FLX K;  3FXL A;  3HSF A;  5EJC A;  2F4I A;  3ZRG A;  3ZMS A;  1O7L A;  3VP5 A;  3J7Y J;  1J7K A;  3A01 B;  4IRH A;  5GAE J;  1V4R A;  2XRN A;  2HS5 A;  4U0Y A;  4RAZ A;  4ZYA A;  4J19 A;  3PAS A;  4F93 B;  5HLG A;  2E35 A;  2UZK A;  3M4O J;  1JJ6 C;  3KZ9 A;  2PX9 A;  3FDY A;  4DQ2 A;  3CCL I;  3OSF A;  4IHW A;  4I2O A;  4M3D A;  2RAE A;  1MBJ A;  2MSY A;  4A0Z A;  3TP3 A;  4KNY A;  1SD4 A;  2Q1Z B;  4UVC A;  2KL4 A;  5LGN A;  4G7Z F;  2VQG A;  2K86 A;  3KET A;  2V1X A;  1H9G A;  3RPU A;  5BS6 A;  5D6F A;  3DBL B;  2GAU A;  2MC4 A;  2UXU A;  3G71 I;  4HQE A;  1Y6I A;  2Y31 A;  2WB1 A;  1SD7 A;  1HC8 A;  4F52 A;  2K4J A;  4EGZ A;  1WZ2 A;  3PIO F;  1DU0 A;  4A3G J;  4BE2 A;  2EA4 A;  2PMZ A;  5K58 A;  2R93 J;  1K83 J;  3ASO H;  2G7G A;  2NS7 A;  1EF4 A;  2E5N A;  1VI0 A;  2H09 A;  4LD5 A;  2JUC A;  4XQF A;  1XSV A;  4IHS A;  2P5L C;  2E36 A;  2ZJ2 A;  3S93 A;  1IDY A;  3FKJ A;  1VQ6 I;  2F4O B;  5HDG A;  5FKK A;  4AWX B;  4XID A;  2JN6 A;  2EFQ A;  4AM3 A;  1BIA A;  5IP7 J;  3BRO A;  3W6V A;  4OMZ A;  4YIF A;  4E6K G;  1FY7 A;  1QVU A;  1X4P A;  4IEJ A;  4BQN A;  1P4X A;  2VC1 A;  3S2W A;  1E3H A;  2ZJR F;  1QHH D;  1ZGW A;  3L2W A;  2MAB A;  3H5A A;  1H0M A;  1R00 A;  1G2H A;  1MDM A;  3GTL J;  2E5Z A;  3WOD F;  2I5U A;  4L5J A;  3FF5 A;  1FOW A;  3BG3 A;  2P5K A;  1K4S A;  3LST A;  4IL6 C;  2R7W A;  1CF7 A;  2Y0S A;  1I39 A;  1KQ9 A;  2XF6 A;  2GA2 A;  2KDO A;  1GLN A;  1Z3X A;  2NVY J;  2RQQ A;  4OAZ A;  1UHM A;  2QWW A;  2XF7 A;  4ENJ A;  2X1D A;  1A5J A;  4A6E A;  2EJR A;  4UV8 A;  2V1D A;  3HOV J;  1DUX C;  3BTL A;  3HTU A;  3WU1 B;  1B9M A;  1R23 A;  2W1O A;  3RKQ A;  3GTJ J;  4FHT A;  4MTD A;  2W57 A;  4HDU A;  2DA7 A;  1AA7 A;  2OQG A;  4GFL A;  1STZ A;  2FBI A;  3B6A A;  2ZNZ A;  2VJ5 A;  4A6D A;  2QM3 A;  1O4X A;  3GTQ J;  2GA1 A;  4A3K J;  3OIP A;  2YSR A;  1U2W A;  5FLV A;  2K85 A;  2RVC A;  2LK2 A;  1J59 A;  2XF5 A;  2GIV A;  1W1W E;  1XTA A;  2NXN B;  4C9Y A;  2KLO A;  1RNL A;  3DEW A;  1I6X A;  2A6T A;  1NK3 P;  4L0Y B;  2KQR A;  3DTK A;  1FPQ A;  3OR2 C;  2OTL I;  2HZD A;  5LBQ A;  3E5U A;  1VQP I;  2WWY A;  4DYR A;  1AHD P;  1JT6 A;  2CW0 F;  4KUM A;  1LE8 B;  2C6Y A;  2HTS A;  2R7V A;  4XLN F;  5GP9 A;  2EWN A;  2ZNY A;  4WXC A;  3WHC A;  2PJR B;  2R92 J;  1S8N A;  3ML6 A;  1JUS A;  5D8L B;  2RN7 A;  2GXG A;  3FM5 A;  1XGM A;  4HLY A;  2PMH A;  3FZV A;  1ETQ A;  6PAX A;  2E7W A;  2LP0 A;  3ANG A;  3ZMT A;  3REO A;  4BE0 A;  5F04 A;  1QA6 A;  3Q0V A;  2J5P A;  2LH9 A;  3ROU A;  5JFR A;  1IN5 A;  2VKE A;  4JBA A;  2COM A;  2ID3 A;  1TWH J;  5FLM J;  4GYI A;  3TED A;  1I3Q J;  2K9M A;  3F72 A;  5EG0 B;  1FWZ A;  2ETH A;  1H88 C;  1MNM C;  5HLT A;  1ZTR A;  2LDU A;  3DBH B;  4G9Y A;  3OYA A;  4UY8 I;  1TL8 A;  2GFN A;  4OIQ F;  5CW8 A;  2DT7 B;  4HA8 A;  4ZZD A;  3A2K A;  2PBX A;  3MZY A;  3DU5 A;  4KIC A;  1ERD A;  2M8G X;  3FMR A;  3HGY A;  2G7L A;  3I4N J;  1XX5 A;  3JRA A;  3BCA A;  1HSJ A;  2RRE A;  2QF7 A;  2OF7 A;  1GXQ A;  4Y15 A;  4PK4 A;  1DGW Y;  3L2R A;  2ECC A;  2O61 A;  4V19 K;  4ZYG A;  5F27 A;  3HRU A;  4Y33 A;  2QOP A;  4P9U A;  1UHS A;  2F5F A;  2VBX A;  3GVA A;  3OSG A;  3DLL F;  4BH9 A;  3RI4 A;  2AQE A;  4ASN A;  4HNU A;  2FOK A;  1A31 A;  3G6E I;  3FBN B;  3OYC A;  2JRM A;  2E1M C;  2F5E A;  3LFK A;  2HGC A;  5IYB J;  3FXJ A;  2VPL A;  3BG5 A;  3A4C A;  2OC6 A;  1VQK I;  1FP1 D;  1Z9C A;  2PJP A;  1A35 A;  4Q5S F;  4EVI A;  2FQ4 A;  1MGT A;  2DMP A;  3LSH A;  5CQE A;  1WWX A;  2GM4 A;  2LF7 A;  1P9Q C;  4M71 A;  2IGN A;  5GTI C;  2DYS H;  3U9G A;  3TDU C;  2FU4 A;  1TLH B;  1Z0X A;  1FP2 A;  2NS8 A;  3SDB A;  1TWC J;  3BG6 A;  2HTJ A;  1ZKG A;  2K4B A;  1R36 A;  3I5U A;  4B44 A;  1S3J A;  2VJ4 A;  4X0G A;  2XAS A;  2VQC A;  2R7X A;  1OR7 A;  1RES A;  3CCV I;  3JTH A;  3GME A;  3E3V A;  1KZH A;  2DA1 A;  1MJ9 A;  4RAF A;  2I8D A;  5AIQ A;  2B7E A;  4BXX J;  4OIR F;  4II3 A;  5IPA A;  2PEX A;  2QQ9 A;  3TOA A;  3PO2 J;  4RMN A;  2DT5 A;  4LJZ F;  2ZME A;  4Y17 A;  3ZOB A;  1I50 J;  1R4N B;  3S8P A;  1U78 A;  2JK3 A;  1WJD A;  5CYV A;  1QPI A;  4U9L A;  3K69 A;  4I09 A;  4EQQ A;  4L9J A;  2KMU A;  3TP0 A;  5HAW A;  1TT5 B;  2QZ8 A;  3KYC B;  3IUO A;  2YX7 A;  3I4P A;  1OYI A;  1WQ2 A;  1IO2 A;  3LSG A;  4L9N A;  2KIM A;  4AC0 A;  1G3Y A;  3EPZ A;  1QPM A;  2GQQ A;  3QYF A;  1D5Y A;  4EMS A;  4QSH A;  3OYI A;  1R1V A;  1UB9 A;  2DFE A;  1O3S A;  2Y48 A;  4GRI A;  3K10 A;  4YZE A;  3ZPL A;  3SQN A;  2L01 A;  3CF2 A;  3OIO A;  1PUF A;  3FIW A;  1LVA A;  3DCF A;  1JHF A;  2MD5 A;  1R9T J;  2HEO A;  3F1B A;  2E71 A;  4XOR A;  1YI2 I;  2JA6 J;  2YVX A;  2N8G A;  4YFN F;  2O7O A;  2WAE A;  1NHA A;  2L7K A;  4ESJ A;  1BN5 A;  2KPM A;  2XDV A;  1CGP A;  3RZO J;  4M3G A;  1T56 A;  4JYK A;  3Q9V A;  4BBR J;  5C4X J;  4W1U A;  3H5N A;  3HB9 A;  5EZG A;  1U3E M;  3I4M J;  2ZFU A;  1ETV A;  4EJV A;  3SWH A;  3F8C A;  2QSG X;  1QZZ A;  4MLO A;  5ICG A;  1XGN A;  3P9K A;  1Y1V J;  3JTG A;  2DJI A;  3GFL A;  3IWZ A;  3HOU J;  1XSD A;  4ABZ A;  3I64 A;  4XBF A;  5FKM A;  3D1N I;  4CCO A;  1ZRF A;  2BZT A;  3LSI A;  1T38 A;  3CCM I;  1Z77 A;  2W00 A;  3ABK H;  2RDP A;  3O8G A;  1JT0 A;  4XRF A;  3S3M A;  3HUG B;  3R0J A;  3IRQ A;  4F92 B;  1O7F A;  1WI3 A;  1MSE C;  4IXA A;  3RH2 A;  1ZLK A;  3LSM A;  1UJ8 A;  1ZK8 A;  2G7S A;  4CXF A;  2V1N A;  3O6B B;  5IP9 J;  2DOF A;  1D5V A;  2KJB A;  2DJN A;  1I1S A;  1KYW A;  2OD5 A;  3JRG A;  2KIF A;  2JA2 A;  2KP6 A;  3ECH A;  1IV8 A;  2LG4 A;  1Y1W J;  5KNL A;  2MC3 A;  2YR2 A;  5TRD A;  3RJP A;  1GDT A;  2EH3 A;  3BZK A;  4LK1 F;  2HDD A;  2KIS A;  4ENK A;  2ZOY A;  3A01 A;  3I53 A;  2QEX I;  2XHK A;  2LKS A;  4GXO A;  5JLX A;  3CC2 I;  4HKU A;  4U9N A;  3E7Q A;  2VLA A;  2R0Q C;  1MDM B;  2VL8 A;  4WXD A;  5ICE A;  1P6R A;  1WH7 A;  3AG1 H;  3N4M A;  1ORK A;  2FF4 A;  4JX6 A;  3S14 J;  3RSN A;  2R5Y A;  2L2O A;  4P55 A;  5AIP A;  2M4K A;  1D0Z A;  1Y8R B;  1WHU A;  1YJW I;  3MWM A;  1FC3 A;  4MQV A;  3WTS C;  4ZYH A;  3I59 B;  1MIJ A;  2WA0 A;  2NVX J;  3ANP A;  4CHU A;  4XRS A;  1MBE A;  1VFC A;  5L3B A;  4PJ0 C;  1HF0 A;  5CVI A;  4WF2 A;  3WTZ A;  1T6S A;  5ILU A;  4ANJ A;  2O7T A;  2HKU A;  4AYB N;  5LRS A;  3LMM A;  4XKV A;  2DMQ A;  1EH6 A;  3EUK L;  5LFA A;  4NC6 A;  9ANT A;  1F4K A;  3G1L A;  5C44 J;  4MEY F;  3OS1 A;  2EIK H;  3EET A;  4BHB A;  5ILS A;  3GXO A;  4N9H A;  4UDS A;  3O2P E;  4ON0 A;  3B02 A;  2NYX A;  3DPJ A;  5KAI C;  3CDI A;  2CUF A;  4A69 C;  2WUI A;  1I27 A;  3CF5 F;  3ZR8 X;  5HOD A;  4GCL A;  3CQZ J;  1SFU A;  5M5W J;  5JR3 A;  3KLN A;  5B3S H;  4G7O F;  4AIK A;  3KCC A;  5IYD J;  1D8J A;  1MD0 A;  2JRT A;  5HBU A;  3BJA A;  2X9D A;  4M9S A;  2NP5 A;  2D5V A;  3M8F A;  4RGS A;  2W25 A;  4ZTJ A;  1HCR A;  4C2U A;  3E6D A;  3OYD A;  1BM9 A;  3K4J A;  1BC7 C;  2VON A;  2NVQ J;  2MG4 A;  2ZXI A;  2UXI A;  3OR1 C;  3KP7 A;  1HKS A;  3JRI A;  2YX4 A;  2L9V A;  3P9T A;  2MA3 A;  3L2U A;  2I10 A;  2L02 A;  2V6C A;  2ZCM A;  2Y9Y A;  1QBJ A;  2KFD A;  4HPQ A;  1X1D A;  2BHZ A;  2XGC A;  2VC0 A;  1XD7 A;  1IDZ A;  1N25 A;  3FXO A;  4MO7 A;  2FBQ A;  5IY5 H;  4O5V A;  4RB2 C;  3MKZ A;  5HOO A;  2QYO A;  1XCB A;  3V7R A;  2Z99 A;  3BLY A;  1NG6 A;  1LB2 A;  3PUF A;  3VPR A;  1J2X A;  1DP3 A;  1WSU A;  4ETS A;  2STW A;  4Z2Y A;  2K9S A;  3H9J A;  3M8E A;  2VB6 A;  3QP6 A;  3U2R A;  2W48 A;  2W53 A;  3HM5 A;  4ITV A;  3VWB A;  1TZL A;  4D1Q A;  5FFX A;  2A07 F;  1ZHF A;  2LTP A;  1IN8 A;  4M3E A;  4B4C A;  1BJA A;  2UWM A;  1A36 A;  2DG8 A;  4BAC A;  2VI6 A;  3NRG A;  3V8K A;  3MQ0 A;  4FX4 A;  3F22 A;  3S17 J;  4A93 J;  2L54 A;  1IRF A;  2CW8 A;  4D7N A;  2QQB A;  2HNH A;  4AID A;  1BL0 A;  4A3E J;  1QNT A;  1LVK A;  2DFI A;  1K7A A;  2FMY A;  3E6C C;  1AKH A;  2XPV A;  1Z21 A;  3DV8 A;  3G1O A;  3D5R C;  2MGQ A;  3WE2 A;  2HU9 A;  2DT6 A;  4MIM A;  2AXT C;  4HYE A;  1FTZ A;  2REK A;  3DPT A;  5HNH A;  1UMQ A;  2ID6 A;  1H9T A;  3DQV C;  3PL8 A;  3MN2 A;  3AQS A;  1G3T A;  3NWS A;  4V2G A;  3QYB A;  4BHC A;  3KP2 A;  4MNU A;  5K5R A;  4UUS B;  2EFO A;  1D1A A;  3BJO A;  1RUN A;  1P4W A;  2DQR A;  2L7Z A;  2L4M A;  1SMT A;  4U0W A;  4DIQ A;  3RCO A;  4KIS A;  3FWE A;  5LEJ A;  1YW9 A;  2KHM A;  3BTJ A;  3KPH A;  3W6K B;  3I56 I;  4BDY A;  2RGV A;  1GVJ A;  1V3F A;  2ZY9 A;  2TCT A;  3K70 D;  1BOB A;  1B59 A;  3QPT A; 
#chains in the Genus database with same CATH homology
 3SFI A;  3ON4 A;  1QVU A;  4CYC B;  3GTG J;  2G7G A;  2E2I J;  4IEJ A;  1JTX A;  1T33 A;  1ETO A;  1WCM J;  3WHB A;  3CRJ A;  3BTC A;  3B81 A;  4BBS J;  1OCP A;  3F0C A;  3NNR A;  3ZQI A;  1ZGW A;  4B3A A;  1RR7 A;  2VUM J;  5FGL A;  1POG A;  4BY1 J;  3FRQ A;  1G2H A;  2EZI A;  3MVP A;  3GTL J;  3E7L A;  5E3M A;  2XB0 X;  5D18 A;  2ECB A;  1UI6 A;  3BG3 A;  3BR0 A;  3HIM A;  4C3J J;  2CRG A;  4QIW N;  1NK2 P;  2D6Y A;  3K7A J;  1RKW A;  3LNQ A;  2ME6 A;  1WGX A;  5K7F A;  2F07 A;  5FMP A;  4RBO A;  4NDL A;  2NVY J;  3QBM A;  5M5X J;  4BY7 J;  1BW5 A;  1CQT A;  1JUP A;  1A5J A;  5FHP A;  5EYR A;  3HGG A;  3CCY A;  2R5Z B;  2JA8 J;  3BTL A;  3HOV J;  3PO3 J;  3IH2 A;  3RKQ A;  1H89 C;  3GTJ J;  3JRE A;  2DMN A;  1XS9 A;  5FJ8 J;  2DA7 A;  5C4J J;  1ZQ3 P;  2Y2Z A;  3Q0W A;  5FKO A;  4GFL A;  4FIS A;  3B6A A;  1YRN B;  1S7E A;  3HOY J;  5EDN A;  1O4X A;  3GTQ J;  1E3O C;  2H1K A;  3S2H J;  4A3K J;  3HOZ J;  3IH3 A;  5FLV A;  3KKC A;  3S1Q J;  4Y52 J;  1OJL A;  3FKI J;  2LK2 A;  3PM1 A;  1F43 A;  3G1M A;  3VIB A;  2L7F P;  3DEW A;  4X6A J;  5F08 A;  5K7H A;  3EGQ A;  1NK3 P;  5D1R A;  1HDD C;  2CJJ A;  2IAI A;  3A02 A;  2JMW A;  5DS9 A;  2TRT A;  1LFB A;  3VOX A;  1DU6 A;  3VVX A;  3GTP J;  3O8H A;  2L7M P;  3Q3S A;  5J3L A;  3V6G A;  1SAN A;  4DYR A;  1AHD P;  1JT6 A;  1XC5 A;  1U9N A;  2M0C A;  4LOC A;  1F36 A;  3RD3 A;  1P7I A;  1LE8 B;  1OFC X;  2CQX A;  5IOZ A;  2L0K A;  2YU9 J;  2LVS A;  2JA5 J;  5GP9 A;  5D19 A;  2ELK A;  3WHC A;  3ZQH A;  2R92 J;  3UKG A;  1JUS A;  4A3M J;  4Y7N J;  1ITY A;  4AUX A;  1IGN A;  2IU5 A;  2LLK A;  5EZH A;  3RQI A;  2AHQ A;  1ETQ A;  1HLV A;  4GCT A;  2LP0 A;  3ANG A;  3VW1 A;  5F04 A;  3Q0V A;  4QTR A;  3GEU A;  4DYC A;  3EUP A;  2XDN A;  4I76 A;  5M3F J;  2DG7 A;  2VKE A;  5FLM J;  2ID3 A;  3TED A;  1TWH J;  3NAR A;  1JGG A;  1I3Q J;  1JKQ C;  5EG0 B;  5K7Z A;  4AC6 A;  1H88 C;  3A03 A;  1MNM C;  1ZTR A;  1B72 B;  2FD5 A;  3QPS A;  5M5Y J;  2K9N A;  2GFN A;  5CW8 A;  2PMZ N;  4JX4 A;  2R5Y B;  2PBX A;  3BQZ A;  1UI5 A;  2M8G X;  3HGY A;  2G7L A;  3C07 A;  4M3F A;  2KT0 A;  3I4N J;  3VUQ A;  5E3N A;  4JX5 A;  3JRA A;  3CJD A;  2EZH A;  2QF7 A;  5CXG A;  2DA4 A;  2OF7 A;  2UXO A;  3HTJ A;  1MSF C;  1IRZ A;  2ECC A;  4MXM A;  5F0H A;  5F27 A;  2QCO A;  2QOP A;  4XK4 A;  1UHS A;  3OSG A;  2O9L A;  3GZI A;  1MBK A;  4CGR A;  3JRH A;  3COL A;  3MNL A;  1X58 A;  3GBG A;  3CMY A;  1TWF J;  5IYB J;  1Q1V A;  3BG5 A;  2AO9 A;  1JTY A;  1JKR C;  1I6H J;  3FK7 A;  2FQ4 A;  2DMP A;  3BR3 A;  2GM4 A;  4FCY A;  2K9Q A;  3QQA A;  1QRY A;  1VND A;  4KWA A;  1Z0X A;  2OI8 A;  2ZB9 A;  2NS8 A;  4IHY A;  1TWC J;  1ZKG A;  4NN1 A;  3VVY A;  3SJM A;  1RES A;  1A6I A;  4GFB A;  5J1Y A;  2GEN A;  2WAQ N;  2DA1 A;  3C2B A;  2VPR A;  3G56 A;  2CUE A;  5F0F A;  4BXX J;  5IPA A;  1FIA A;  2DN0 A;  3NPI A;  3PO2 J;  3HTH A;  2JWT A;  2HYT A;  2YUS A;  2HOA A;  3ZQF A;  3ZOB A;  2RHA A;  4JP0 A;  1I50 J;  4FTH A;  1U78 A;  3GTO J;  2JK3 A;  1QPI A;  3SDG A;  4M3B A;  3TP0 A;  5E3O A;  1BJZ A;  3BR6 A;  5HAW A;  2Y30 A;  1W0T A;  4NEL A;  2VKV A;  4A3L J;  3HE0 A;  4JKZ A;  2YS9 A;  3LSG A;  4AC0 A;  3VW2 A;  2DA3 A;  1QVT A;  2DA5 A;  5JLW A;  3LSR A;  5H9T A;  1D5Y A;  3BNI A;  4A3C J;  2E2J J;  1FEX A;  4QSH A;  2M9H A;  3LWJ A;  4YZE A;  4FE4 A;  3BJB A;  1RET A;  4M6V A;  4I6Z A;  3OIO A;  1PUF A;  3HOW J;  3FIW A;  3DCF A;  3S1R J;  1R9T J;  1IG7 A;  5EGO B;  3F1B A;  4DZP A;  1JKP C;  2B63 J;  2JA6 J;  1ENH A;  2N8G A;  2O7O A;  3CWR A;  2HXO A;  5FKL A;  2YVE A;  2LKX A;  4DW6 A;  3RZD J;  2XRL A;  4ICH A;  3RZO J;  4M3G A;  1T56 A;  4JYK A;  4BBR J;  5C4X J;  4W1U A;  1X2M A;  5EZG A;  3HB9 A;  3I4M J;  1ETV A;  2GBY A;  3MKL A;  4C2M J;  3JRD A;  1UG2 A;  1SGM A;  4MLO A;  5F1J A;  3BTI A;  1Y1V J;  1B8I A;  3JRB A;  2Y9Z A;  1JJ8 C;  1AKH B;  5EEA A;  3LSP A;  3HOU J;  2GUH A;  4ABZ A;  4S0H B;  2RAS A;  3KNW A;  5FKM A;  1HDP A;  3D1N I;  3L1P A;  2EZL A;  1JUM A;  5EFY A;  1GT0 C;  1GV2 A;  2XB5 A;  1Z77 A;  2WB1 N;  3BT9 A;  3O8G A;  2X48 A;  1JT0 A;  1HOM A;  4XIC A;  1MBG A;  3TW7 A;  2NP3 A;  1MBF A;  4C3H J;  1TWA J;  3G7R A;  2LFB A;  1GV5 A;  2JJ7 A;  1WI3 A;  1MSE C;  5CXI A;  1LFU P;  3RH2 A;  1WH5 A;  3S5R A;  2NVT J;  1TC3 C;  1ZK8 A;  4HNV A;  2H8R A;  2G3B A;  3Q0U A;  2G7S A;  3NI7 A;  4ACI A;  2M34 A;  4XRS G;  3V78 A;  5IP9 J;  3BQY A;  3JSJ A;  2DJN A;  1LE8 A;  3HKZ N;  3JRG A;  3M3Y J;  4UUT A;  5HSZ A;  4A3D J;  2KDZ A;  1Y1W J;  2FJ1 A;  1MBH A;  1FJL A;  1GDT A;  2EH3 A;  4AF5 A;  4L62 A;  1FIP A;  2HDD A;  2ZOY A;  3A01 A;  1IJW C;  5JLX A;  5DAJ A;  3B6C A;  2UXP A;  4G12 A;  4HKU A;  4GCK A;  1MH3 A;  3E7Q A;  3LHQ A;  3QPL A;  2IBD A;  2R0Q C;  1AU7 A;  1WH7 A;  2V57 A;  2NOG A;  3S15 J;  1ORK A;  5EG0 A;  2COB A;  2E1O A;  4JX6 A;  4MFD A;  3S14 J;  2DA6 A;  3FK6 A;  3JRC A;  2R5Y A;  4GFK A;  1IUF A;  4X1E A;  2Y0S N;  1K61 A;  3JRF A;  2QKO A;  4JNN A;  2OER A;  1FTT A;  3QKX A;  4L5E A;  2NVX J;  3ANP A;  2HXI A;  4XRS A;  1MBE A;  1VFC A;  2E2H J;  5GPA A;  1HF0 A;  1VF9 A;  1W0U A;  3VW0 A;  4D5F A;  1P7J A;  3CDL A;  4UUS A;  3JR9 A;  5DTD A;  2O7T A;  1BW6 A;  2HKU A;  3O60 A;  2GLO A;  4AYB N;  3HEF A;  4EEF G;  1IC8 A;  5C4Y A;  2DMQ A;  3VVZ A;  3ZQC A;  3NXC A;  4JL3 A;  9ANT A;  1H8A C;  1ZR4 A;  3HDD A;  3G1L A;  5C44 J;  4A3I J;  2DMU A;  5FKN A;  3GTM J;  3OOU A;  2MW8 A;  4W97 A;  3ZQG A;  4CYC A;  1PUF B;  4UDS A;  4IHV A;  4A3F J;  2X6O A;  3TW6 A;  3DPJ A;  2CUF A;  4XRM A;  4A69 C;  2XSD C;  2WUI A;  2UXH A;  3KKD A;  5HOD A;  4GCL A;  3AQT A;  3CQZ J;  3GTK J;  2HOS A;  5M5W J;  1GVD A;  3H3V K;  2Q24 A;  3IUV A;  2DMT A;  3LOC A;  5IYD J;  1TWG J;  4FE7 A;  1IV6 A;  2ZOZ A;  5HBU A;  2E19 A;  2X9D A;  2NP5 A;  2D5V A;  3K2A A;  1ETW A;  1HCR A;  2NX4 A;  4B1R A;  2OPT A;  2WV1 A;  3H0G J;  2DA2 A;  1B8I B;  2PZ9 A;  3PPB A;  2NVQ J;  4V2F A;  5E3L A;  5GPC A;  4RDU A;  4PXI A;  5BNG A;  2MG4 A;  2YVH A;  2ZCN A;  4MFE A;  1MH4 A;  4DZJ A;  2UXI A;  5J1U A;  1JKO C;  3JRI A;  2DTZ A;  3P9T A;  5IP6 A;  3IH4 A;  1BA5 A;  2I10 A;  4ME9 A;  2ZCM A;  3LSJ A;  2FX0 A;  2R5Z A;  2Y9Y A;  3BR5 A;  1SFO J;  1ETY A;  2HQ5 A;  4C3I J;  3VOK A;  2ME0 A;  3S1M J;  2XGC A;  2QWT A;  1IDZ A;  5EF6 A;  4MO7 A;  1YRN A;  1APL C;  2FBQ A;  3HBL A;  2O8K A;  2XGE A;  2R7Z J;  3IV5 A;  1U8B A;  2LD5 A;  3VPR A;  1U9O A;  3NAU A;  2P81 A;  1ETK A;  2K9S A;  3BR2 A;  5F0C A;  3VP5 A;  2CU7 A;  4MK6 A;  2W48 A;  5IYC J;  3A01 B;  2W53 A;  3HM5 A;  5EGO A;  2QIB A;  1X2N A;  4J19 A;  3S2D J;  3PAS A;  2LTP A;  4M3E A;  2EBI A;  4B4C A;  3M4O J;  3BRU A;  5AQC A;  1JJ6 C;  2JA7 J;  3KZ9 A;  2DG8 A;  4IHW A;  3OSF A;  2VI6 A;  3NRG A;  4D5C A;  2XGD A;  1ZR2 A;  3S17 J;  3T6N A;  4A93 J;  4M3D A;  4D7N A;  1MBJ A;  2RAE A;  3FIS A;  2CQQ A;  2MSY A;  2HYJ A;  3TP3 A;  4DYQ A;  4A3E J;  1BL0 A;  1RKT A;  3BR1 A;  4A3B J;  2HOT A;  2LY9 A;  1AKH A;  2XPV A;  2L9R A;  5C3E J;  3HOX J;  3G1O A;  4D7M A;  2MGQ A;  1FTZ A;  4MIM A;  2UXU A;  2REK A;  1NTC A;  3BHQ A;  2Y31 A;  5M3M J;  2K40 A;  3ZQL A;  1UMQ A;  2ID6 A;  2G0E A;  2EZK A;  1DU0 A;  3HTA A;  4A3G J;  2EQR A;  5IOY A;  3MN2 A;  3AQS A;  1XG1 A;  5K58 A;  4BKX A;  1K83 J;  1ETX A;  1WPK A;  2NS7 A;  1B72 A;  2R93 J;  3S1N J;  1EF4 A;  1VI0 A;  4V2G A;  3ON2 A;  4IHX A;  2LR8 A;  2IEK A;  2HI3 A;  4UUS B;  3S16 J;  3HTI A;  3BCG A;  2M2E A;  4A3J J;  1IDY A;  2L7Z A;  1OCT C;  1GUU A;  2XPU A;  5FKK A;  4XID A;  2JN6 A;  2XPW A;  3BTJ A;  5J1R A;  5IP7 J;  2QTQ A;  3W6V A;  3BG9 A;  1RPW A;  2TCT A;  2ZCX A;  2WGB A;  3LJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...