3HGGA

Crystal structure of cmer bound to cholic acid
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
202
Chain Sequence
b'TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: Crystal structures of CmeR-bile acid complexes
rcsb
molecule tags Transcription
total genus 76
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hggA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hggA02
2FJ1A 3GTPJ 5F1JA 3IV5A 2IAIA 4ME9A 2R7ZJ 4V2FA 1JKPC 5FGLA 2LR8A 3LWJA 4NN1A 3MNLA 2DA3A 2HYJA 2JA5J 3HBLA 4DZPA 5EGOB 1X2NA 3ZQGA 2VI6A 3S5RA 2YVHA 1TC3C 4RDUA 1IGNA 2UXOA 1F36A 4MFDA 4D7MA 2XB0X 2HOTA 2M2EA 2VKEA 1A5JA 3ON4A 3HTJA 5EYRA 2KT0A 5FJ8J 5FKLA 3G7RA 5C4XJ 3BHQA 5D18A 1LFBA 1ETYA 4IHXA 4L5EA 2IEKA 5IP9J 1VI0A 1LFUP 5CXIA 3IUVA 4MLOA 2CUEA 3BT9A 3BCGA 1GUUA 2G7LA 3RKQA 5CXGA 1F43A 3SFIA 1ORKA 2XSDC 5IOZA 1XC5A 1LE8A 2WGBA 2Y9ZA 3OSGA 5IOYA 1JJ6C 1UMQA 2EZKA 2X48A 3MVPA 3BTCA 3VIBA 4GCLA 3ZQLA 2ZCNA 4A3IJ 2AO9A 1S7EA 4GFLA 3VVYA 3JRHA 3I4MJ 3QQAA 1Z0XA 2HOSA 4FISA 2QWTA 1PUFA 4M3GA 4M6VA 5M5YJ 2QTQA 2ZCMA 1ITYA 2E2JJ 3RH2A 4QIWN 3FK6A 5IPAA 2HYTA 5C4YA 4CGRA 5EG0B 5EFYA 2ZB9A 4MIMA 4D5FA 1TWFJ 5DS9A 2XGEA 3HTAA 3A01A 2IBDA 4DW6A 3HIMA 1NK2P 2ZOYA 3IH4A 1VFCA 3QKXA 2ID3A 1VF9A 2R0QC 3QPLA 1NTCA 3EUPA 1UI6A 2AHQA 5AQCA 1U78A 2RHAA 2VPRA 1O4XA 4BY1J 2NVTJ 5FMPA 1GDTA 4GCTA 2PBXA 3LHQA 2XPVA 1EF4A 5J1UA 1X58A 5K58A 1IDZA 1K83J 1SANA 9ANTA 1ETKA 3HTIA 2DA4A 2FX0A 2FQ4A 2QKOA 5BNGA 1QRYA 1ZGWA 2GM4A 2EBIA 1R9TJ 4BKXA 1BL0A 2V57A 3O60A 1Q1VA 1U9OA 3ON2A 4FE7A 3O8HA 1MBHA 3BR0A 3CMYA 5E3LA 1K61A 1AU7A 3FRQA 1MBEA 4J19A 3QBMA 3RZDJ 4GCKA 5E3MA 3B6AA 3Q3SA 1POGA 3K2AA 5F04A 3VP5A 1XG1A 2LLKA 4NDLA 5FHPA 2FBQA 2DN0A 4M3DA 4HKUA 1ETXA 5C44J 2LTPA 2ID6A 3GBGA 3G1MA 3VW0A 5IYBJ 2XGDA 5IP7J 3JRGA 3HGYA 2E2IJ 1FTTA 3PASA 3CCYA 2WB1N 2MSYA 2K9SA 2H1KA 4JKZA 3K7AJ 5F27A 1ZKGA 3KNWA 1IUFA 1FIPA 1JTYA 2L9RA 5FKKA 3WHBA 3CJDA 4BXXJ 2M9HA 3IH2A 5JLXA 1GVDA 4PXIA 1JUPA 3BR1A 3PO3J 1QVTA 4MXMA 1T33A 2R5YA 5HAWA 2DMNA 3OOUA 1AKHA 4D7NA 1RESA 4AC0A 5F0HA 2K40A 3Q0VA 1HDDC 3S1QJ 3MKLA 2WV1A 4JYKA 4MK6A 3HKZN 1DU6A 1BA5A 3KZ9A 3BTJA 1WPKA 2VUMJ 3T6NA 2DA5A 1ZK8A 5FKNA 2E1OA 3VPRA 1JKRC 3C07A 1Y1VJ 5FKOA 2XDNA 2CRGA 3FISA 3WHCA 3HOZJ 2JA6J 3E7QA 2REKA 5D1RA 4L62A 3S14J 2VKVA 2X9DA 4ABZA 3GTKJ 3HOVJ 4BBSJ 3L1PA 2MG4A 5IYCJ 3FIWA 2CQXA 1OCTC 2KDZA 3A02A 2JN6A 1IC8A 5DAJA 1HLVA 1FIAA 3BG5A 3ZOBA 3B6CA 1TWAJ 4G12A 1APLC 2TCTA 4A3KJ 4I76A 2M8GX 3DEWA 2COBA 3BG9A 4DYQA 1SGMA 4B3AA 2P81A 2DA6A 4FE4A 4ICHA 4JL3A 1ZR2A 2DMPA 3O8GA 1GT0C 4BBRJ 4JX5A 4GFKA 3NNRA 3LNQA 4JP0A 2DA2A 2ZCXA 3BR3A 1I50J 3BTIA 4MFEA 4ACIA 4I6ZA 4IEJA 1W0TA 3NARA 2ME0A 3VW2A 1VNDA 2DG8A 1H8AC 1FTZA 2LD5A 3V78A 3NXCA 1ZR4A 3HOWJ 3VW1A 4YZEA 3F0CA 2NOGA 2IU5A 2LP0A 3NI7A 3HB9A 5FLVA 2K9QA 3TEDA 4DYCA 1MBFA 3DPJA 3BR2A 1A6IA 1MNMC 3A01B 2LY9A 3ZQCA 2RAEA 3W6VA 1MSEC 2GBYA 2GUHA 4CYCB 3E7LA 5JLWA 3GTMJ 1GV2A 3ANGA 2UXPA 1IJWC 3S15J 4GFBA 1YRNA 3OSFA 3BR6A 5DTDA 2X6OA 4QTRA 2QOPA 4V2GA 3JR9A 1B72A 4W97A 5J1RA 2Y0SN 2Y2ZA 3NAUA 2MW8A 3RQIA 2R5ZB 2NP3A 4A3FJ 2EQRA 5M5WJ 3BQYA 3TW7A 1AHDP 3LSPA 1H89C 1RKTA 1IRZA 3IH3A 4JNNA 3PM1A 2EH3A 1UG2A 1P7IA 5GP9A 2LKXA 3NPIA 1JT0A 1WCMJ 2CU7A 2NS7A 2D6YA 2OPTA 1MSFC 1B8IA 1BW5A 1UHSA 5FKMA 2XGCA 2NVXJ 1TWCJ 2HQ5A 2DG7A 1MBJA 1OCPA 2ME6A 4M3EA 4X1EA 4B1RA 5EEAA 2LK2A 2GFNA 2R5YB 1AKHB 2MGQA 1BW6A 1TWGJ 5EG0A 3D1NI 2JWTA 2W48A 2DTZA 4XK4A 2FD5A 1I3QJ 1GV5A 1OFCX 2QIBA 4UUTA 2OF7A 3EGQA 1U8BA 5EZHA 3ZQHA 4UUSB 4RBOA 4IHYA 4AC6A 2G0EA 4S0HB 3NRGA 3LSJA 4A3EJ 3GTJJ 4JX4A 2CQQA 1WH7A 2R93J 2HKUA 1U9NA 2JK3A 4AF5A 3JRCA 2XRLA 1WH5A 3VOKA 3Q0WA 2XPUA 3GZIA 1JUSA 3JRAA 2GENA 2W53A 1HF0A 4FCYA 3FKIJ 2Y31A 1ETQA 3HEFA 5J3LA 3VOXA 1Z77A 2M0CA 1T56A 4XRMA 1FJLA 1JKOC 1JT6A 3JSJA 3MN2A 2JMWA 3BRUA 4MO7A 3S2HJ 5EZGA 2TRTA 2E2HJ 5C3EJ 1IDYA 2O7OA 4M3BA 5EF6A 2QF7A 2ELKA 2DMTA 3C2BA 5K7ZA 2NVQJ 1UI5A 2RASA 5J1YA 2I10A 3S17J 2OERA 2YS9A 3JRDA 2JJ7A 1JJ8C 3SJMA 2CJJA 4B4CA 2HDDA 3HDDA 1RETA 2EZIA 2D5VA 3TP0A 1RPWA 3BNIA 5H9TA 3KKCA 4XRSG 2WUIA 3HOYJ 1LE8B 4A3CJ 1H88C 2UXUA 3TP3A 3GEUA 3HE0A 3GTLJ 1X2MA 2M34A 4HNVA 1RKWA 2DA1A 3QPSA 3S1MJ 5C4JJ 3JRIA 2LFBA 4AYBN 3ANPA 1JGGA 3KKDA 1OJLA 3GTGJ 3RZOJ 2L7MP 3F1BA 5F0CA 5HBUA 3CWRA 3JREA 3SDGA 1HDPA 1PUFB 4C3JJ 3HOUJ 3CDLA 4AUXA 4IHVA 1YRNB 2G7SA 2EZHA 4XRSA 2HXOA 1MBGA 2NVYJ 3GTQJ 1I6HJ 2NX4A 2NP5A 5EGOA 3I4NJ 1ENHA 1B72B 1NK3P 2PZ9A 2L7ZA 3BR5A 2O9LA 5K7HA 2O8KA 2R92J 4A3GJ 3LJLA 3ZQIA 1JTXA 4XIDA 4EEFG 1G2HA 3LOCA 1MH3A 3PO2J 4Y52J 3M3YJ 3S2DJ 3BJBA 3HTHA 3G56A 2G3BA 5FLMJ 1B8IB 1ZTRA 5F08A 4DYRA 1CQTA 1QPIA 5E3NA 2EZLA 3G1LA 4A3JJ 2N8GA 2YUSA 2JA8J 4FTHA 2G7GA 2ECCA 3BG3A 3JRFA 3RD3A 3H0GJ 3LSRA 3OIOA 3BQZA 2QCOA 3PPBA 1WGXA 2K9NA 3VVZA 1DU0A 3DCFA 5GPAA 3COLA 2DMUA 1D5YA 1ZQ3P 3S1NJ 4XICA 2CUFA 4CYCA 3CQZJ 2B63J 2ECBA 3Q0UA 2OI8A 2WAQN 4A3MJ 5K7FA 2O7TA 2HOAA 1IV6A 3V6GA 4A93J 5M3FJ 2DA7A 2YVEA 2YU9J 4C2MJ 1XS9A 1HOMA 5F0FA 1JUMA 4M3FA 2HI3A 1JKQC 5GPCA 3S16J 1SFOJ 4A3LJ 2R5ZA 3AQTA 2XB5A 4W1UA 2XPWA 5IYDJ 2L0KA 3GTOJ 2E19A 1ETVA 3CRJA 4JX6A 2NS8A 4DZJA 4C3IJ 4Y7NJ 2Y30A 1P7JA 5M5XJ 5E3OA 4D5CA 5D19A 5HSZA 2DMQA 4A69C 3UKGA 3AQSA 5IP6A 2Q24A 1MBKA 1FEXA 1WI3A 4C3HJ 2UXHA 5CW8A 3ZQFA 1ETWA 2GLOA 1MH4A 3HM5A 3A03A 3H3VK 3BTLA 3M4OJ 2DJNA 4LOCA 5HODA 3G1OA 3B81A 1ETOA 5M3MJ 4QSHA 4X6AJ 1BJZA 2H8RA 1HCRA 1Y1WJ 2ZOZA 3VVXA 4A3BJ 3HOXJ 4NELA 3LSGA 3HGGA 1W0UA 3VUQA 3JRBA 1RR7A 1E3OC 2L7FP 3TW6A 4IHWA 2F07A 4UUSA 1TWHJ 2Y9YA 3FK7A 2JA7J 3S1RJ 3P9TA 2UXIA 1QVUA 2HXIA 4UDSA 4KWAA 4BY7J 2PMZN 4A3DJ 1IG7A 5EDNA 2LVSA
chains in the Genus database with same CATH superfamily
2DDBA 5JI6A 1MNEA 1W5CC 2R7ZJ 2DYSH 5ILVA 4V2FA 2VE9A 1T39A 1JKPC 5FGLA 1WJAA 1Z7LA 3LWJA 2BBYA 4UY8I 4HNTA 2CGPA 2GXGA 2K5CA 1WRJA 5DCMA 1FOKA 1FC3A 4BE0A 1SFXA 5CVRA 1FOYA 2VI6A 2J5OA 2YVHA 2QSGX 2PMUA 2XROA 2V6EA 1IGNA 2EWNA 4RGXA 3VOEA 2XAHA 2XB0X 3DU6A 2BXZA 4U0VA 5GADJ 1MJ9A 5EYRA 2GOXB 5FJ8J 1W7PA 5FKLA 1XCVA 3G7RA 5C4XJ 3I56I 4LG0A 1LFUP 1UHMA 3IAM2 1GUUA 3TDUC 2FMYA 2HQNA 3NWTA 4EM1A 2G7LA 3OYLA 4ASNA 1A36A 2IVMA 1QGPA 5IOZA 4NQWA 1FMWA 2Y9ZA 1ON2A 3WTSC 4I7HA 2JZYA 3MVPA 4EGZA 3VIBA 1UHWA 3TDZC 2BY3A 2K9LA 1Y6IA 2IA2A 2LY1A 2X0LA 4ZZLA 2AO9A 2JSCA 2GOMA 3V8LA 1S7EA 2OTJI 4GFLA 1I27A 3VVYA 3JRHA 3QQAA 1Y56A 4CO8A 4KT5C 4FETA 2QWTA 2QTQA 2L9NA 5GAHJ 1XGOA 3J7AY 3RH2A 2ZXIA 3ERMA 5EFYA 3BP8A 5DS9A 2IBDA 2QQBA 3BG6A 3IH4A 4GYIA 3KP4A 3SZTA 2AHQA 2KRCA 1YQAA 3IAS2 2KRHA 4LMYA 5HLHA 1U78A 2V1UA 3OV8A 4BY1J 4GCTA 2XPVA 2JUCA 3T5XA 1EF4A 4NB5A 5FGMA 5LGUA 2DW4A 3JCUC 3MKYB 3HRMA 3L2WA 1IN5A 2FQ4A 2QKOA 4LIUA 3OYKA 2EBIA 2ZMEB 5DD4A 1R9TJ 3O60A 1TL8A 4XOPA 3ON2A 3J80K 2VJ4A 1ODDA 4GCKA 5IT9K 4ENKA 2ZXJA 2ZC2A 1POGA 1FNNA 1R4MB 3EUKL 3VEPA 1XG1A 2KPMA 5FHPA 1UELB 3AG3H 3HRSA 2XAQA 3WE3A 2KKOA 2MD0A 2RN7A 4CCLA 2I5UA 5IP7J 3JRGA 1D1BA 1VQLI 1YS7A 4ZYDA 4J00A 4RGUA 2MSYA 3R0AA 3KYDB 5F27A 1NHAA 3H3UA 2L9RA 5FKKA 3WHBA 2DQRA 4ZTJA 1ZRFA 3KNWA 2AQFA 3DV8A 1SD5A 3BR1A 3JTHA 4MXMA 2DI3A 3PSIA 3OYMA 1TTYA 2Y75A 2QWWA 1X1DA 4AC0A 1HDDC 5F0HA 3Q0VA 3RQ4A 4HDUA 1EKEA 3HKZN 1FBQA 3FMRA 3K9TA 1UJ8A 1WPKA 3MMYB 4IJAA 2VUMJ 1SD7A 1ZK8A 2DFIA 2E1OA 2F5DA 3VPRA 1JKRC 1R23A 4BE1A 3E7QA 2L9SA 3OYNA 3ZQ7A 3DPUA 4MTDA 3S14J 2X9DA 4R1HA 4ABZA 2E71A 2JPBA 2BVMA 3HIFA 4EVIA 3FIWA 5GTIC 1VQKI 4UNOA 1OCTC 4ZDPA 3U2RA 3A02A 1XSVA 2BGCA 1G3TA 3KEQA 4HAMA 2LBFB 1FIAA 3EUHA 5LRSA 1YX5A 1FSHA 3CDHA 2CUJA 3B6CA 3LFUA 5D6EA 3REOA 4C2MA 3GZ5A 1MJBA 3TMOA 4EV0A 2EV0A 1R1TA 4BAYA 2H27A 4I76A 2WAEA 4DYQA 3BG9A 1SGMA 3CCUI 2UUZA 1J59A 2P81A 1HC8A 2DA6A 4ESJA 2RC4A 3BJ6A 3LSIA 3GCMA 2CUZA 4FASD 3O8GA 1GT0C 4BBRJ 4JX5A 1OISA 4BYYA 3HRUA 2HTJA 2DPUA 3HYIA 4S04A 3OYJA 1I50J 2LKSA 3OR1C 4N4NB 5GTHC 4MFEA 2CV0A 3HOTA 1IW7F 3ESWB 2EK5A 3ML6A 4IRVA 3F8NA 4A12A 2DG8A 2Z5UA 3G73A 2D45A 3NXCA 3CLQA 5HLTA 1YW9A 2M0MA 2R7TA 3F0CA 3IRRA 2NOGA 1OYYA 2I8DA 2P6SA 2AS5F 2PBIA 4YELA 3HB9A 2E1CA 1B59A 2K9QA 4DYCA 5FRMA 3BR2A 2HU9A 4HW0A 4XMYA 2NVUB 3E7LA 5L3BA 3IHUA 4P9UA 3COAC 5JLWA 2BZTA 2V7FA 3F9KA 4RS8A 4XKVA 5LEJA 3KP5A 4WXHA 4HPQA 2A05A 3TGNA 1W1WE 3QYEA 4NC8A 4OWRB 5E8IA 3H1CA 2VBXA 5DTDA 3PIOF 2X6OA 4F92B 2VPLA 3JR9A 2IXSA 3LSMA 2Y0SN 4KMFA 1HXDA 1WI9A 2QSFX 3BDDA 3BROA 3RQIA 4KDPA 3DP7A 1FWZA 3E6MA 3CO7C 1T0FA 3DTEA 3H9QA 3IH3A 4DBQA 3M1CA 4DVYP 1NH3A 3I9V2 1GVJA 5BOXA 3CCEI 3FXMA 5HLIA 1JT0A 3LA7A 1WHUA 1SFUA 2M4GA 4Z6YA 3S8PA 2ME6A 2IGMA 1N77A 4M3EA 5B5EC 4B1RA 5F6FA 4F3QA 4RB2C 2ESHA 2GFNA 2BEOA 1BC7C 3CMEI 1LDJA 1BW6A 4Q48A 5EJCA 2LMDA 3RKYA 2L2OA 4AWXB 2NNYA 5E17F 4PJJA 2WAFA 5KAIC 2HEOA 2VKHA 2LH9A 2FD5A 4C2UA 2QIBA 1XPXA 3KLOA 2VE8A 4RBOA 2M4KA 4PGGA 3CC7I 4AC6A 4A3EJ 3OYEA 3GTJJ 4OU0A 2CQQA 4IPAA 3TBIA 5D5VB 2DQLA 1RUNA 3PJRA 1WH5A 1H9GA 4BXUA 2HFHA 1OCRH 3VOKA 2BXYA 4Q47A 1Y8RB 5E20A 2IS1A 4YFXF 5B66C 2M5WA 3GZIA 3R61A 1JUSA 1SMYF 2BW3B 3JRAA 3A4CA 1ZG1A 2W53A 4V19K 3OYHA 2L01A 3F22A 4FCYA 4EM0B 1BI2A 3FKIJ 4GYGA 5J3LA 3VOXA 2HZTA 1Z77A 1IAWA 1T56A 1FJLA 1FYLA 2VXZA 3RSNA 2KIFA 2WC2A 4II2A 3NS4A 1S7OA 4MO7A 4LLLA 3HPGA 4D1QA 4UV9A 1VQ5I 2PFBA 2K27A 4E7HA 1BR4A 4Y33A 1F1ZA 1YI2I 1Z3XA 4M3BA 3VYRB 1UI5A 4UVAA 1IRFA 1D5VA 3ABUA 3WTZA 3S17J 2WB1A 3JRDA 1WJ5A 5CJ9A 3OL4A 2VXDA 4IVNA 4OAYA 3SJMA 2HDDA 3HDDA 2DO7A 3TP0A 4XLNF 4UVCA 3KKCA 3KE2A 4NNJA 2DAOA 3GEUA 1GLNA 3GTLJ 1X2MA 5KVRA 2K4JA 3I59A 2ZBKA 2DA1A 3AG1H 2QVOA 5C4JJ 3JRIA 1DQUA 4AYBN 2KJCA 3F1BA 3EETA 4Q5SF 4IRGA 3VYTB 3U21A 1PUFB 3M8JA 4C3JJ 3HOUJ 4A2UA 2G7SA 4XRSA 5IT9Z 4H4KC 3ZMSA 4HG2A 2NX4A 2NP5A 2XASA 5EGOA 4M74A 3CP2A 1B72B 3L2CA 3BR5A 4IHTA 1N75A 4YIFA 1OCZH 3CJRB 4JOMA 4HX7A 4E7ZA 1KU9A 2R92J 4E7KA 1JTXA 3OOPA 4EEFG 1G2HA 3LOCA 1MH3A 4P96A 1LVAA 1V5EA 3AAFA 3E6BA 3S2DJ 2M45A 4EM2A 3G56A 1FSEA 3KLNA 2FUG2 1T38A 1R22A 3S32A 3N97A 1P4AA 3K4LA 5E3NA 1VZ0A 1T2KA 4IQJA 3G1LA 3CD6I 2N8GA 2JA8J 2Q2EB 5H6QA 4U88A 3HL2A 1A6QA 5FB2A 1IN7A 2FQ3A 3DKXA 3J81Z 3BQZA 4O3MA 1VQPI 3PPBA 1XSDA 1DU0A 3OYCA 4KIBA 3KEOA 3QP5A 5JR3A 3FMSA 4CYCA 3CQZJ 2B63J 3I4PA 2KFDA 2Q0OA 3FMQA 3L09A 2WAQN 2OI8A 2O7TA 2F2EA 2O8XA 3E3VA 3V6GA 2V4JC 3KZYA 3TOAA 3KFWX 2E35A 2DA7A 3I71A 5FD5A 3DBRB 2A07F 2FA5A 2YU9J 4C2MJ 2YVEA 4IRIA 4P9FA 4BACA 1FT9A 3U9GA 3TOBA 1HOMA 1IV8A 3C2GA 2QENA 4EMSA 5KAFC 4UHTA 5E8GA 5FRNA 1XCBA 2XB5A 4W1UA 5IYDJ 2CYYA 1PYVA 1DGRM 4XBFA 4A6DA 2E19A 3WTTC 2P8TA 1SEUA 1KZHA 4F93B 3HTSB 4UB6C 4C3IJ 1QO0D 4H0EA 1P7JA 5M5XJ 3RJPA 2DMQA 4A69C 3IP4B 3UKGA 3AQSA 5IP6A 3LL7A 3MEXA 2Q24A 4HLYA 2K3FA 2WA0A 3ZQFA 2LNBA 1YFHA 1MH4A 3M7GA 3DPTA 3DPLC 2QYOA 2HVRA 3ZN0A 5HS8A 2DT6A 2Q1ZB 3FXOA 4QPOA 5BPDA 4X6AJ 2OUMA 4E7JA 2MC4A 1Y1WJ 4ON0A 3VVXA 1Y39A 4YG2F 5A2QZ 4PSXA 4IKFA 3OYBA 3HGGA 4XKWA 5B1BH 2F5EA 2QGUA 3KCCA 1YJ9I 2VIXA 3TW6A 4FHTA 1J5YA 4UUSA 2FRHA 2Y9YA 3H5AA 3CDIA 4A0ZA 1OPCA 1P4XA 3S1RJ 2FSWA 3F8BA 5AONA 4OMZA 4OINF 1A35A 2FNPA 3V8JA 1IG7A 2LVSA 3PFIA 3ECOA 4G9YA 3CTAA 5F1JA 2IAIA 4L0ZB 2JPCA 4ESFA 5D5UB 4BL0B 5JFRA 2ZJRF 3MNLA 2DA3A 4BEHB 2HYJA 4ZDLA 3HPHA 1HSJA 4RLFA 4DZPA 3P9IA 5LLQA 3IWZA 5TJJA 1X2NA 3ZQGA 2FF4A 1O3QA 1U0JA 5J47A 3GZ6A 4AIKA 3BZKA 3RCOA 1TC3C 2F5VA 5B3SH 1WFXA 3R0JA 4G6QA 4YFNF 2M2EA 3TKYA 2VKEA 3K4KA 1A5JA 4PJ0C 1ZREA 3HTJA 3A1YA 3WE2A 1MW7A 4HRIA 1LFBA 1EA3A 1ETYA 3NQOA 3TO7A 4IHXA 2IEKA 1VI0A 4M9XA 4NHJA 2CUEA 3BCGA 4J01A 2FJI1 1J09A 5IT3A 3AKZA 5CYVA 4LB5A 4L5JA 1IRXA 1SFEA 1XC5A 2WGBA 3I53A 2HQRA 4A5MA 3ZP5A 3GZNB 5CVVA 1VQOI 3BTCA 3IUOA 3IC7A 2M8EA 3ZQLA 2PJRA 2COMA 1G3SA 1TZLA 2V79A 3K70C 1L3LA 1ZLKA 4FISA 2Z3YA 1S6LA 4LFUA 3QODA 2FXAA 3SZPA 2ZCMA 3HSEA 1LEBA 3I55I 1ITYA 2E2JJ 1I6XA 4Y3OA 3KPHA 4A0YA 1MDMB 2HYTA 5EG0B 4D5FA 1TWFJ 2JA2A 2A3SA 5DYMA 3NEUA 1RIOH 4CHUA 2HYFA 4KMUX 2P6TA 1XDUA 2VBYA 3F72A 1VFCA 2ZOYA 2R0QC 2MFZA 1Y8QB 3EUPA 5L3CA 1BOBA 2VPRA 4I98B 4CDGA 4BHPA 2XSJC 3LHQA 4ZH4F 4MNUA 1K83J 2BY2A 5GAEJ 9ANTA 1ETKA 2DJIA 3HTIA 1QRYA 1ULYA 2W57A 2HVSA 2GM4A 4BKXA 2V57A 3H3ZA 1U9OA 1X19A 3CCSI 2GXBA 1T08B 1V54H 5ICGA 3BR0A 3CMYA 5E3LA 2Y0MA 1A31A 3FRQA 1W36C 3PNVA 4G6TB 3B6AA 3Q3SA 2EIKH 1EJ9A 4KFCA 2NYXA 5CQGA 5EEHA 1R5ID 2LLKA 4HYEA 4NDLA 2QBYB 3FWEA 1V3FA 3GFIA 1ETXA 2O61A 3DEUA 3GLLA 5C44J 4GDFA 2LTPA 1E17A 1QNTA 4XL9A 3WGIA 3VW0A 4ENJA 4CCOA 3HGYA 3PASA 4EJVA 3CCYA 4N9IA 4MTEA 2K9SA 3TO6A 4B48A 3CUQB 1STZA 3CJDA 4BXXJ 2M9HA 3IH2A 5JLXA 3DLAA 1JUPA 3W2AA 1TQMA 2DT5A 2ADUA 2R5YA 5HAWA 3E5QA 3FXLA 3OOUA 1AKHA 2IS4A 4D7NA 1RESA 2K3PA 3P7NA 2K40A 3LA3A 2R7XA 3S1QJ 3MKLA 2WV1A 5TGTA 4MK6A 2P0WA 1BA5A 4CCJA 2OC6A 1BJAA 1Y0UA 3A2KA 3T6NA 3WG7H 3R4KA 3C07A 2DOAA 1OYWA 1Y1VJ 2XDNA 4XONA 5DCMB 3FX3A 3EYYA 3WHCA 4OIPF 3SZGA 2GIVA 3K4CA 1FLIA 3SDBA 3HOVJ 1KQ8A 5IYCJ 1K78A 1FBSA 2E1NA 2LOOA 5F1RA 3MAJA 4II3A 1IC8A 2X1CA 1HLVA 2K85A 4IQ4A 1R00A 1RUOA 3ZMDA 1BBYA 4CZZA 3WG9A 1D3YA 4C9YA 1LDDA 1X3WB 4G12A 2IJLA 1APLC 1W7PB 2YX7A 2M8GX 3DEWA 5CQEA 1X3ZB 5D4RA 1U5TC 4LG0B 4FE4A 1BM9A 2AXTC 4ICHA 1OQYA 3X2QH 1ZR2A 3KP2A 3PSFA 2VJ5A 3H36A 4KITB 5LRRA 2HZDA 1BR2A 3RTRA 3K2ZA 2DA2A 3BR3A 3DTKA 4NQWB 1V5FA 1LKXA 4LITA 4TV7A 4Y13A 5HOOA 2MH9A 4HBLA 4FX0A 1KU2A 4I6ZA 4ACIA 2UV1A 1W0TA 3NARA 4A0XA 1VNDA 4U0YA 2FBIA 1UAAA 1U3EM 3FXQA 5D8KB 1FTZA 3IKVA 3IL2A 2L9VA 3M07A 2FNAA 2LREA 2PMZA 2LP0A 4MGRA 4XQFA 4ZYGA 3OYFA 1MBFA 2EFNA 3DU5A 1G8XA 1JI8A 3FZVA 3MZYA 1G4DA 4LK0F 3ZQCA 1YW8A 5DV5A 3T0YA 1Z21A 2EV5A 2HDWA 4BQAA 3ANGA 2UXPA 2HR3A 4JQFA 4GFBA 1YRNA 1MJAA 2MABA 4MHGA 3PIPF 3BR6A 2CFOA 4CCMA 2QOPA 5DD8A 2QM3A 4XLEA 1U2WA 3FDYA 5J1RA 1DP3A 1Z9CA 3NAUA 4XORA 3HZJA 3HSFA 2MW8A 4MQVA 2X4HA 3A0BC 4A3FJ 4ZC3A 5M5WJ 2C6YA 3BQYA 3DEEA 3LSPA 1RKTA 3K8PC 2DBBA 4JK1X 1VQ4I 3Q9SA 3NPIA 3E5UA 3OIPA 3RYPA 2DT7B 2XV4S 4L9VA 3W2WA 3DLLF 3DFGA 5LHIA 5FKMA 4ZYEA 3I0TA 4AU7A 1X1BA 1O7FA 1MBJA 2HQ5A 2KZVA 3WGGA 4RB1A 4KJZA 4BQQA 3MQ0A 5JVTA 4ESBA 3CCQI 1TT5B 3GEZA 2PMHA 2K9MA 2X1EA 1LEAA 3D1NI 1QZYA 4Q4ZF 3CUOA 4AIDA 3LWFA 2DTZA 2QKMB 1OYIA 2VB6A 3O2PE 1GV5A 1OFCX 1FZPB 4GCVA 1RC9A 1D0ZA 1LPQA 5EZHA 3ZQHA 4DOZA 4IHSA 2QUFA 1KQ0A 4BJTA 2R93J 2HDCA 3K4BA 3WTXC 3CO6C 3F8CA 1QZEA 1USSA 2LG4A 4BHBA 3ABMH 2KMUA 4MEXF 3ZN1A 2VQLA 4CGZA 2EA2A 4D0PA 1HF0A 2EV6A 3LQRA 3HEFA 1H0MA 1LB2A 1J2XA 4CUGA 1V55H 3D5RC 3S2WA 2DK8A 1O3SA 3M8EA 3PQKA 2OD5A 1GHCA 5HVQC 3FXUA 2OJED 4OOIA 2EIMH 1WQ2A 3DTIA 1IDYA 4C2TA 2O7OA 2NVQJ 2DMTA 3HG9A 1UZCA 2R4GA 3MCZA 4CCKA 1YJWI 2X6XA 1VQ6I 1BI0A 4GO1A 2I10A 1MMDA 2BHZA 5J1YA 3HUGB 1YIJI 2F6CA 4L5IA 2JJ7A 5CVUA 2JSPA 1FPQA 2MA3A 4F91B 5TISC 4R8HA 5EEGA 2KIUA 2EZIA 2D5VA 3QP6A 1RPWA 4BU2A 1IRGA 4BQNA 3BNIA 4XRSG 2RDPA 1LE8B 3DXJF 1D0XA 4DGWB 3HKZA 4CICA 1AA7A 4HNVA 1BN5A 3KX2A 4IX7A 1X4PA 3MD2A 5J40A 2LFBA 5HLGA 1OJLA 3RZOJ 3V8KA 2L7MP 5HBUA 2IGKA 1IN8A 1HDPA 4BXFA 3S3NA 2QLZA 1XDSA 3FBIB 3CDLA 3CCLI 3K69A 2EZHA 2P5VA 1MBGA 5CKTA 1JE8A 2RVCA 4GXOA 1I6HJ 4LK1F 3ABLH 1WVRA 1ENHA 4E6KG 2RV8A 2PZ9A 4I0AA 2CMPA 5K7HA 2BY1A 3DKWA 3GMEA 1HW2A 3LJLA 1MMNA 3VDXA 3O6BB 4LG3A 4DJAA 5J4YA 3GX4X 1HW1A 2P5LC 2ZJ2A 2CW0F 2B9SA 3J7AO 2XGXA 5E79C 2ZO4A 3M3YJ 3C3WA 3BJBA 1YW7A 2VLAA 5FLMJ 1OR7A 4PFOA 4E70A 1YG2A 5F08A 4DYRA 4NBQA 2EZLA 4FTHA 3BG3A 1XD7A 2ZNZA 4E4HA 3JRFA 4EGYA 5JVGF 3H0GJ 2F4MB 3IRQA 3OIOA 2DPDA 2VBWA 2DK5A 1K7AA 3VVZA 2O3FA 2Z1DA 4PJMA 2HPIA 2VQCA 4C30A 5J6XA 3TQNA 1YLFA 1ZQ3P 2GWRA 2ECBA 3Q0UA 3ZR8X 4BUPA 1WKMA 4B44A 2CQ7A 1VQ7I 4KUMA 3GW2A 4L0YB 3JAMK 1SVLA 2ZMEC 1XS9A 2X6WA 3Q5FA 3CJQB 1W5TA 2L4AA 4LLNA 1JKQC 1V5GA 1B1BA 5ICCA 4G94A 1WJCA 2LF8A 1OMIA 2IT0A 3GTOJ 3GXOA 4PUSA 2Y0SA 2A6HF 3BG7A 3NRVA 4Y7NJ 2Y30A 5BPIA 5E3OA 2A69F 4D5CA 5D19A 2KDOA 5HSZA 2F4OB 2YSRA 4U9NA 3KZIC 3V7RA 2VC1A 3MZ8A 1RNLA 2MC3A 4Y4RA 1YITI 1YX3A 2BY0A 1E3HA 2VN2A 5HODA 3G1OA 2ETHA 1MMGA 2UXNA 1LFPA 2E5NA 1FYMA 1CF7A 4QSHA 2CO5A 5L3DA 3H5NA 3ZMTA 1BJZA 3T8TA 1HCRA 1IXCA 5H6RA 3ZRGA 3OWTA 4BDYA 4L18B 1YOVB 2ZOZA 1R49A 4A3BJ 3HOXJ 1O3RA 3LSGA 1Z91A 1Y0NA 2B1EA 2M7AA 3JRBA 2HKOA 1E3OC 4WF2A 3OS1A 4RAFA 2F07A 2M30A 4EJUA 3I59B 2EB7A 2QEXI 4IOCF 2TDXA 2ZKZA 3SYTA 4WK8F 3FK7A 4G6DA 4WCGA 4KWAA 4BY7J 1VQNI 3B02A 2VQGA 5EDNA 2EA4A 1E3PA 2FJ1A 3GTPJ 2OU2A 2Z2SB 3IV5A 3PL8A 1R5GA 4P1WA 1PDNC 4BNCA 2D1HA 4U7BA 3K4JA 3KP3A 3J7ZI 2LDUA 4KN7X 4I01A 2JA5J 3O3KA 5EGOB 1SD4A 5FROA 3L7WA 4M9ZA 1VQ9I 3QOEA 1JHHA 3ZMVA 1OLTA 4HX4A 4RAGA 2R7RA 4RDUA 2CG4A 4MFDA 3J80Z 1UFMA 3ELKA 2HQAA 1S3JA 2VC0A 3ON4A 2WADA 2KT0A 4HOBA 5FLXK 1MGTA 5DCFA 4XN3A 5D18A 1ZELA 2FE3A 5IP9J 5CXIA 3IUVA 5DDGA 2VJJA 1G6NA 3L2QA 3BT9A 4NUBA 3G6EI 3AFHA 1IF1A 3K70D 3M1EA 2UZKA 1F43A 1WJFA 4LIVA 4PCQA 1ORKA 5LGTA 2XSDC 2W84A 1B4AA 1I3AA 3RDIA 4IO9F 1D1AA 2VODA 3E97A 2KLOA 4HDVA 1UMQA 4L9JA 2EZKA 1ON1A 2L02A 2DFEA 2ZCNA 4NC6A 5B1AH 3EDPA 3I4MJ 1LJ9A 2JUGA 4AYBA 4M3GA 2F48A 3EQLF 4M6VA 3V7SA 5M5YJ 1PUFA 2X51A 3Q9VA 4QIWN 3FK6A 5IPAA 2CSOA 4HLXA 1R1VA 5C4YA 2ZB9A 4MIMA 1ZLJA 2L54A 4PK4A 2XGEA 1R71A 3HTAA 3D0SA 3A01A 3HIMA 3GFLA 3R60A 4UB8C 3LAPA 2MH2A 1X3UA 1VF9A 2WTEA 3BC8A 1K6YA 1AWCA 1MNDA 2O6GE 2NVTJ 2RHAA 5FMPA 2Y69H 2IS6A 2PBXA 2XKPA 1W36D 5J1UA 1X58A 4XLHA 2VQHA 3G4SI 1SANA 1B6AA 2DA4A 2FX0A 4FQGA 2OZ6A 5BNGA 1ZGWA 1BL0A 2GAUA 1XGNA 2PI0A 3O8HA 2X1DA 1P6RA 4J19A 3RZDJ 1DPUA 4XLFA 5E3MA 5F04A 3K2AA 3OYDA 1HKQA 2RQPA 4EATA 2A5WA 3FM5A 3VP5A 3CP8A 4N4OB 4HKUA 5HDNA 1TT0A 4P55A 4F55A 4HV5A 4XM3A 2O03A 1T98A 2ID6A 1IXSB 4KIFA 2CW8A 4OD5A 2A6TA 3T8RA 3I5UA 3DKYA 4FT8A 2H1KA 1B9NA 2J5PA 3K7AJ 4ZYHA 2VOPA 1ZKGA 1FIPA 6PAXA 1HSTA 2PFVA 2DOFA 5IY5H 1GVDA 2G9WA 3PO3J 2W1OA 1T33A 3E6DA 1RI7A 2DMNA 2FEZA 4HQMA 2WAQA 4PDKA 5LEKA 4XNFA 1FOXA 1DU6A 1OCOH 1WJEA 1BR1A 3KZ9A 3BWGA 4BGDA 5FKNA 2ACJA 5LD2C 1MKMA 1TW2A 3K4NA 2EFOA 3ONQA 1MIJA 2W00A 4YIRX 3HOZJ 2JA6J 4ZDOA 4B8XA 2VKVA 1X1PA 2PEXA 1WJBA 2MG4A 1X4OA 4G7HF 3OYIA 2GIZA 2JN6A 2JTVA 3ABKH 3DBHB 1SAUA 3BG5A 3KZZA 3ZCOA 3SEQA 3ZOBA 3OMYA 1G3WA 5DEQA 4LD5A 3BLYA 1SVOA 5ERIA 5BS6A 4A3KJ 4OD4A 1RRJA 2COBA 2LY2A 4B3AA 1XB4A 2ZCWA 3BPVA 4RAZA 2YVXA 2EIJH 2ELJA 4JL3A 1USTA 1M1EB 2LSOA 2RNJA 3TO9A 1OCCH 2R7UA 1KA8A 2DYRH 2E7WA 1LUJB 4KICA 3BTIA 1R1UA 3H92A 4WXCA 4IEJA 4BS9A 2ME0A 3VW2A 3AG4H 1H8AC 2LD5A 3V78A 1U5TA 5FFXA 1ZR4A 4I0BA 3HOWJ 3VW1A 3QOPA 3VYSB 2WY7Q 4YZEA 2ZFWA 3CC4I 1OKRA 2JVGA 2VT2A 3ZGKA 4CA0A 2Q8KA 3GYHX 3CCVI 3NI7A 3TEDA 4Z2YA 3BZ6A 3WTVC 1MNMC 3EPZA 4B43A 2LY9A 2RAEA 3W6VA 1XMAA 4OAZA 2E1MB 4K2EA 3OS0A 2GUHA 3ULQB 3HTUA 4XLCA 3JSOA 1Z1DA 4ZZDA 3GTMJ 1GV2A 1HQCA 2A2FX 2A68F 3OL3A 3V42A 1QZZA 1FY7A 3S15J 4IXAA 3W2VA 3I54A 3OSFA 1T8IA 5HS9A 4L9TA 3RPUD 4QTRA 4V2GA 1DP7P 3UNGC 4ETSA 2Y2ZA 5F64A 3QU3A 2R5ZB 3F8FA 2NP3A 2LYCA 4M6YA 3CF2A 1TNSA 1H89C 3LAJA 1QPMA 5E1WA 2EH3A 3DF8A 2D2WA 2JRTA 5GP9A 4HQEA 4BJ6C 1P9QC 4X0GA 1W5SA 2NS7A 5CLSA 1ZN2A 2VOOA 2D6YA 2OPTA 1KYZA 3KIOA 4XKBA 1UHSA 1WWXA 1VTNC 1B8IA 2XGCA 1T6SA 1BW5A 1S29A 2NVXJ 3C1DA 3FXKA 2F5CA 1OCPA 2JT1A 2Z99A 1K79A 1Z3YA 3LSKA 3QU6A 1KONA 4CSWA 3ZPLA 5L3GA 5EEAA 1EH8A 2LK2A 4XSXF 4XSZF 2R5YB 1P2FA 2JRMA 4I99C 1AKHB 3GUDA 3T1BA 1TWGJ 5EG0A 3RPUA 2W48A 1R5HA 3C7JA 4XK4A 3GFMA 1I3QJ 3EGQA 4UUTA 2OF7A 2ZFUA 3BCBA 2HPMA 4PFPA 3RIRA 4IHYA 2G0EA 2K7LA 3SHFA 4S0HB 3SXYA 3D5LA 1WH7A 3H5RA 4E7IA 1VQMI 2ZXWH 2OCEA 3JRCA 1YJNI 2XRLA 4OMYA 4EQQA 3I58A 3Q0WA 3DQVC 2GENA 4UUVA 4KNYA 3E0JB 2V6CA 2VASA 2Y31A 1ETQA 3ZQQA 1XTAA 5FO5A 2QBYA 1I1GA 3JSJA 3MN2A 2BV6A 4YRVA 2JMWA 5L3EA 3BRUA 3S2HJ 2TRTA 2DU9A 2YX4A 2LKPA 1E0EA 3WU0A 1ZYRF 2E2HJ 2CH0A 1XSXA 4BHCA 2VONA 4AVPA 3C2BA 2ELKA 2B0LA 5K7ZA 2ZSIB 5LGNA 2XKOA 1IN6A 2YS9A 2STTA 2BVLA 3K6GA 4CYDA 1F9NA 2CJJA 4B4CA 5FD6A 3U1DA 5CPRB 3CLOA 5J8FA 5H9TA 2QQAA 4CXFA 2WUIA 1ZH5A 1S5LC 1YHQI 3K0LA 4A3CJ 2UXUA 3HE0A 2M34A 1C0WA 1RKWA 2L3DA 3FXJA 3K1MA 4KN4X 3S1MJ 3FKJA 3ANPA 2V9KA 1JGGA 1SMTA 3GTGJ 1QQIA 1RZ4A 4YIIA 5F0CA 2IA0A 1A04A 4YFKF 4F52A 2HKXA 2O5RA 4P5OA 4AUXA 1G59A 1YRNB 4IHVA 1ERDA 4IRHA 2ISYA 4F7ZA 3R6SA 1JXSA 4XLPF 1Z6RA 3RPQA 3CMAI 3I4NJ 4OIRF 2ZJQF 1NK3P 3ECHA 2O9LA 2BOLA 4ENNA 1IZ1A 1REPC 3ROUA 4XIDA 4HF1A 1TQPA 1XX5A 1FP1D 3PO2J 5LBQA 2HGCA 3HTHA 3G71I 2G3BA 3SQNA 2E1MC 3K10A 4LB6B 1UG0A 3H35A 2ICWG 3ASNH 4BQOA 1SFKA 4QLCU 3ABTA 2YUSA 3VFZA 2G7GA 3HSRA 3LSTA 4PSWA 1BC8C 2R7VA 3MKWB 1D0YA 3LSRA 1BIAA 2DDAA 2VKDA 3KETA 4HNUA 2R7OA 3PNYA 3SFZA 2QCOA 3BY6A 4UXNA 4N9HA 2PN6A 3BPXA 3I3LA 3ISPA 3VSKA 3WTWC 1NG7A 3F21A 3WTUC 3RI4A 5GPAA 2ESNA 3GFJA 1J0RA 3S1NJ 4XICA 3BZCA 2P5KA 4I09A 1D1CA 1E2XA 1BOAA 4A3MJ 3CF5F 1PP8F 3LSHA 3PNTA 3LQQA 2XAUA 2NOJB 3BCAA 1TLHB 2HOAA 1FX7A 3D5SC 4A93J 5M3FJ 1HW5A 3FBNB 2KP6A 5F0FA 5JHUA 4PJLA 4M3FA 2HI3A 5GPCA 3U1KA 4HF2A 2STWA 3AQTA 2G7HA 2XPWA 2MLKA 3HOSA 4WXDA 2NS0A 1XGSA 3RKWA 4JX6A 4GRIA 3JW4A 1R58A 2ELHA 1GXPA 1MBKA 1FEXA 2UXHA 1JGSA 5CW8A 2Y48A 2ZMEA 3V4GA 2L4MA 3OS2A 1ETWA 4IF4A 3CUQC 4M72A 1YO5C 2UWMA 1S8NA 3BTLA 3M4OJ 2DJNA 4EJTA 3IWFA 4S05A 3EUAA 5HS7A 2ZJPF 3TL4X 5M3MJ 3VSLA 2DLLA 1PJRA 4R79A 1T95A 4N0BA 4IL6C 2H8RA 2R7WA 5HDKA 2IPQX 5J4VA 4E7LA 2W85A 3KYLA 3QPTA 2YPRA 1YYVA 4NELA 1TP4A 3DWLE 1J9IA 3CJTB 1EH7A 1KU3A 1XMKA 3M9AA 4IHWA 3QRFF 2B7EA 3S93A 1TWHJ 3J81K 2M3AA 3C18A 1ZG5A 4BH9A 2RQQA 1BI1A 3P9TA 1QVUA 2R7DA 4UDSA 3L2UA 4A3DJ 3K1NA 2YR2A 3GLXA 4ME9A 1ZG3A 3CESA 3LA2A 2NAZA 3UR3C 3MZHA 2LR8A 1IUYA 4NN1A 1UCRA 3HBLA 4AIHA 5K5OA 4ITVA 2KIMA 3S5RA 2AXLA 1IO2A 4DIQA 1YS6A 2OZUA 2UXOA 1S72I 1F36A 2LBFA 2PG4A 4D7MA 3F23A 3H9JA 2QQ9A 2HOTA 2FBKA 2O0YA 2CS3A 5AIQA 2IP2A 5JHFA 2K4BA 3N4MA 4HX8A 3BHQA 1Q1HA 3CJNA 2W24A 4L5EA 3HUGA 1S9HA 3K4MA 1ZGAA 4MLOA 2DFHA 3VYUB 2CV2A 3RKQA 2VBZA 2EPFA 3G3ZA 5CXGA 3SFIA 2E34A 2MLGA 1LE8A 3HRTA 1YE9A 2L7KA 2KQRA 3OSGA 3BOQA 5IOYA 1JJ6C 2BE5F 2X48A 1QBJA 5A2QK 1XMXA 4GCLA 3F6VA 4A3IJ 2M1BA 1X1AA 5ILUA 1Z0XA 2HOSA 4O6JA 2L5QA 2E60A 2DXIA 5LHGA 3MFKA 4RM3A 4CGRA 2PX9A 2GZWA 3NWSA 2IRFG 4DW6A 5ILSA 1NK2P 1O57A 3QKXA 2W82A 4I02A 3GWZA 2ID3A 5AQCA 3QPLA 1NTCA 2XAGA 3CMMA 3E1SA 5ICFA 1UI6A 5E1ZB 1O4XA 1GDTA 2HVQA 1P92A 2XVCA 3QWLA 2KHMA 3P9CA 4Y17A 5K58A 1IDZA 2WY8Q 3OR2C 5CVJA 3E5XA 4BJ5C 5K5QA 2Z16A 4PGHA 3CCMI 2ZSHB 1Q1VA 2E7XA 1IN4A 4FE7A 4DNCA 1MBHA 2OAZA 1AU7A 1K61A 1MBEA 3QBMA 1XGMA 1I1SA 2E5ZA 4CZCA 1CF7B 1N78A 1TBXA 2LC2A 2FBQA 2DN0A 4M3DA 2Z33A 3EYIA 4GGGA 3FM3A 3GBGA 5J8CA 3G1MA 1KU7A 5IYBJ 2XGDA 1LQ1A 1FTTA 1B9MA 2E2IJ 1TNTA 3PUBA 2KRFA 2KL4A 2WB1N 1YTYA 4JKZA 4HSRA 1J7KA 1IUFA 1JTYA 5H20A 4HA8A 3ZMUA 4KYWA 2K86A 4PXIA 1QVTA 4DBRA 4AD9A 1W4MA 1XN7A 2RKHA 4PZJA 1BI3A 4OIQF 4YEJA 1ZAOA 2NNNA 3EUHC 4CCNA 3IKTA 2OTLI 4JYKA 4A6EA 4KT6A 3WU1B 2GA2A 3BTJA 4LLGF 5K1YA 2DA5A 3VODA 2A6EF 1Z7UA 2OV7A 1U6GA 2FMLA 2QSHX 5FKOA 2F4IA 3CZ6A 4XN0A 1UB9A 2CRGA 3FISA 2H6BA 2REKA 5D1RA 4L62A 4RGSA 3GTKJ 4A5NA 4BBSJ 3L1PA 4MQ9F 2CQXA 2R7SA 2HYGD 5KK1A 2KDZA 3M8FA 2CW7A 3CCRI 5DAJA 1FBUA 4KIGA 2XDVA 2BW3A 3I64A 2IW5A 3SWHA 1TWAJ 2EJRA 3S3MA 2TCTA 4L9NA 1K6OA 4DQ2A 1I5ZA 4AM3A 3OYAA 5D6FA 2DMPA 2WV0A 4RB0A 2JVHA 3MWMA 2H09A 4GFKA 3NNRA 3LNQA 2CFXA 4JP0A 2ZCXA 5HNHA 5DM6F 4QPQA 1Z6TA 3ZXSA 5KCMA 4XLAA 1ZGJA 2HNHA 2DODA 2M7BA 1ZRDA 3V7CA 2EFPA 2XIGA 2RREA 1TW3A 2V9PA 4U7DA 2IU5A 1QU3A 3KP6A 3L9FA 4O5VA 5FLVA 5D4SA 1OR7C 3DPJA 2K02A 2UXXA 1A6IA 3J7YJ 2XF5A 5DUIA 3A01B 1MSEC 2GBYA 1FP2A 1T0FC 4CYCB 4WX9A 2DCEA 2V1NA 1SAXA 2BYVE 5E1XA 3E6CC 4IZZA 1V4RA 2XF6A 1IJWC 3KYCB 1FYKA 2MYSA 4OIOF 4G7OF 3HHHA 2X6YA 5DM7F 2H1LA 3KEYA 1LVKA 1O7LA 3LMMA 1CGPA 4U9LA 2V1DA 4ENMA 1B72A 4W97A 1SD6A 2GXAA 3AG2H 3HJEA 1D8KA 3C2HA 1JHFA 1R36A 4RA2A 3AL0B 2EQRA 3TW7A 1AHDP 1WJDA 1IRZA 4JNNA 3PM1A 1UG2A 2DFFA 1P7IA 1MD0A 2V26A 2LKXA 2RGVA 2OQRA 4HEA2 2LF7A 3WGHA 1WCMJ 2CV1A 2CU7A 4RLQA 2NRAC 4BDZA 1MSFC 4CH7A 1PP7U 3WTYC 1TWCJ 2M87A 1QHGA 1MMAA 2DG7A 4NC7A 1RR8C 4XR6A 5LFAA 2XHKA 4LGWA 2Q2EA 3PFYA 5FFZA 5D5XB 4X1EA 3OIQA 1QHHD 4B09A 1R6RA 3QPHA 2QQ8A 4ZJZA 3H9GA 2MGQA 1HKSA 4ANJA 4RM2A 2JWTA 4RGRA 1SC7A 2EILH 1LNWA 2X85A 2KIQA 1FOWA 2MBFA 2G7UA 1Z05A 4UUSB 1U8BA 2NXNB 2IA1A 5AIPA 2FU4A 3NRGA 4JBAA 3LSJA 3RYRA 4JX4A 2PQ8A 1U9NA 2JK3A 2OA4A 1DGWY 3ERED 3CC2I 2HKUA 2XAFA 4AF5A 3VTIA 3F8MA 3PUFA 3OYGA 3FXRA 4ZTFA 3KP7A 4XRFA 1KGSA 2RNGA 2XPUA 4Y15A 3K1PA 1BIBA 3LFKA 2HWVA 3GF2A 1VQ8I 1WSUA 1S7AA 3GVAA 1GXQA 3FHZA 2M0CA 4XRMA 1Z67A 5HDGA 2P4WA 3CCJI 3A0HC 2XC7A 1JKOC 2VJIA 1JT6A 4M9SA 4EJWA 3JSPA 1PUEE 1IXRC 3HC7A 3HXLA 1D8JA 4HV6A 5EZGA 2CQNA 4UVBA 2QA4I 3HHGA 5L3FA 2XUBA 3BJOA 1NG6A 4XOTA 4EJOA 5C3EJ 1DUXC 1SVMA 4HF0A 4D9JA 1N25A 5EF6A 1ZARA 2QF7A 2VL8A 1K4TA 2RASA 3B73A 2OERA 2AQEA 3P5JA 4PJNA 2H8WA 2VT3A 4KA4A 2IGOA 5CVIA 1ZHFA 1KQ9A 1JJ8C 1PVEA 1U5TB 1RETA 4XKCA 3FF5A 2FOWA 2GA1A 3WU2C 2BHYA 5KHDA 3HOYJ 4AVZA 1H88C 3TP3A 5ICEA 2W7NA 4IOAF 1FMVA 2GQQA 3QPSA 3JAMZ 3L2VA 2PJRB 4KISA 2OQGA 1R7JA 2KISA 3F6OA 3KKDA 3OY9A 1H9TA 3W6KB 1K4SA 1I39A 3CWRA 3JREA 2A61A 4M6XA 1X1CA 3SDGA 2WBMA 4BE2A 1ZRCA 1O3TA 2HXOA 4BEHA 1TQIA 2E36A 2NVYJ 4M71A 5GAGJ 3GTQJ 2A5YB 4QWQA 2WWYA 2HOEA 3F3XA 5BMZA 1MMSA 3FHNA 2H6CA 2IGNA 2L7ZA 3QYFA 2O8KA 5H2FC 4A3GJ 2PJPA 3QYBA 3ZQIA 3JTGA 2CQKA 3VWBA 2DTRA 2XRNA 4Y52J 2XAJA 4RMNA 4U87A 4UV8A 2KZGA 1G3YA 1B8IB 2XF7A 1ZTRA 1HBXG 1CQTA 1QPIA 3VB2A 3S3OA 2F5FA 4A3JJ 3H0DA 4G8XA 1HKTA 1P4WA 2YU3A 4MEYF 1HA8A 2ECCA 3G2BA 4B3XA 4WIBA 3RD3A 5TRDA 3RKXA 2W4SA 4HZFA 1QA6A 4M73A 1WGXA 2K9NA 2EFWA 2EFQA 2P7VB 3DCFA 3COLA 2DMUA 1DDNA 1D5YA 3AL0C 5D8LB 5LHHA 1DPRA 2CUFA 2V9VA 2ZXHA 2PLYA 1KYWA 2HTSA 4WWCA 2HS5A 5K7FA 2FBHA 2KJBA 1ACIA 3L00A 1IV6A 4AIJA 1MDMA 3W6JB 4I2OA 4ZYAA 1JUMA 2MD5A 1J75A 5ED4A 2V1XA 2R7FA 2CWEA 3P9KA 5E18F 2JQ7A 1SFOJ 3S16J 1R4NB 4A3LJ 2R5ZA 3BJAA 4RAYA 2L0KA 4HSTA 2OCCH 3WODF 1ETVA 4LJZF 1U8RA 5KNLA 2NS8A 4RB3C 1EH6A 2P7CB 4DZJA 3CRJA 1ONVA 2R7QA 1YIOA 5FLXZ 3ASOH 1K78B 3DBLB 1MZBA 5D5WB 2EINH 1WI3A 4C3HJ 5BQTA 2QKLB 1LDKB 3L2RA 2GLOA 2W25A 3HM5A 3A03A 4G7ZF 1F4KA 2DOEA 3H3VK 2OBPA 2ZY9A 4LOCA 3MKZA 2QZ8A 3B81A 1ETOA 2ISZA 4E7SA 2LRDA 4FX4A 2IS2A 4U0WA 3SEZA 3W3CA 2H94A 3PQJA 2R3SA 5DUKA 1W0UA 3VUQA 1EV7A 1RR7A 5HNFA 3ZMZA 2L7FP 4B47A 3N05A 1W7PD 1L0OC 3CUQA 2ZNYA 3QAHA 2B3WA 2D1VA 5K5RA 1WZ2A 2JA7J 2UXIA 2FOKA 2HXIA 3GO5A 2PMZN 1F5TA 1AOYA 2Z9OA
chains in the Genus database with same CATH topology
2FJ1A 3GTPJ 5F1JA 3IV5A 2IAIA 4ME9A 2R7ZJ 4V2FA 1JKPC 5FGLA 2LR8A 3LWJA 4NN1A 3MNLA 2DA3A 2HYJA 2JA5J 3HBLA 4DZPA 5EGOB 1X2NA 3ZQGA 2VI6A 3S5RA 2YVHA 1TC3C 4RDUA 1IGNA 2UXOA 1F36A 4MFDA 4D7MA 2XB0X 2HOTA 2M2EA 2VKEA 1A5JA 3ON4A 3HTJA 5EYRA 2KT0A 5FJ8J 5FKLA 3G7RA 5C4XJ 3BHQA 5D18A 1LFBA 1ETYA 4IHXA 4L5EA 2IEKA 5IP9J 1VI0A 1LFUP 5CXIA 3IUVA 4MLOA 2CUEA 3BT9A 3BCGA 1GUUA 2G7LA 3RKQA 5CXGA 1F43A 3SFIA 1ORKA 2XSDC 5IOZA 1XC5A 1LE8A 2WGBA 2Y9ZA 3OSGA 5IOYA 1JJ6C 1UMQA 2EZKA 2X48A 3MVPA 3BTCA 3VIBA 4GCLA 3ZQLA 2ZCNA 4A3IJ 2AO9A 1S7EA 4GFLA 3VVYA 3JRHA 3I4MJ 3QQAA 1Z0XA 2HOSA 4FISA 2QWTA 1PUFA 4M3GA 4M6VA 5M5YJ 2QTQA 2ZCMA 1ITYA 2E2JJ 3RH2A 4QIWN 3FK6A 5IPAA 2HYTA 5C4YA 4CGRA 5EG0B 5EFYA 2ZB9A 4MIMA 4D5FA 1TWFJ 5DS9A 2XGEA 3HTAA 3A01A 2IBDA 4DW6A 3HIMA 1NK2P 2ZOYA 3IH4A 1VFCA 3QKXA 2ID3A 1VF9A 2R0QC 3QPLA 1NTCA 3EUPA 1UI6A 2AHQA 5AQCA 1U78A 2RHAA 2VPRA 1O4XA 4BY1J 2NVTJ 5FMPA 1GDTA 4GCTA 2PBXA 3LHQA 2XPVA 1EF4A 5J1UA 1X58A 5K58A 1IDZA 1K83J 1SANA 9ANTA 1ETKA 3HTIA 2DA4A 2FX0A 2FQ4A 2QKOA 5BNGA 1QRYA 1ZGWA 2GM4A 2EBIA 1R9TJ 4BKXA 1BL0A 2V57A 3O60A 1Q1VA 1U9OA 3ON2A 4FE7A 3O8HA 1MBHA 3BR0A 3CMYA 5E3LA 1K61A 1AU7A 3FRQA 1MBEA 4J19A 3QBMA 3RZDJ 4GCKA 5E3MA 3B6AA 3Q3SA 1POGA 3K2AA 5F04A 3VP5A 1XG1A 2LLKA 4NDLA 5FHPA 2FBQA 2DN0A 4M3DA 4HKUA 1ETXA 5C44J 2LTPA 2ID6A 3GBGA 3G1MA 3VW0A 5IYBJ 2XGDA 5IP7J 3JRGA 3HGYA 2E2IJ 1FTTA 3PASA 3CCYA 2WB1N 2MSYA 2K9SA 2H1KA 4JKZA 3K7AJ 5F27A 1ZKGA 3KNWA 1IUFA 1FIPA 1JTYA 2L9RA 5FKKA 3WHBA 3CJDA 4BXXJ 2M9HA 3IH2A 5JLXA 1GVDA 4PXIA 1JUPA 3BR1A 3PO3J 1QVTA 4MXMA 1T33A 2R5YA 5HAWA 2DMNA 3OOUA 1AKHA 4D7NA 1RESA 4AC0A 5F0HA 2K40A 3Q0VA 1HDDC 3S1QJ 3MKLA 2WV1A 4JYKA 4MK6A 3HKZN 1DU6A 1BA5A 3KZ9A 3BTJA 1WPKA 2VUMJ 3T6NA 2DA5A 1ZK8A 5FKNA 2E1OA 3VPRA 1JKRC 3C07A 1Y1VJ 5FKOA 2XDNA 2CRGA 3FISA 3WHCA 3HOZJ 2JA6J 3E7QA 2REKA 5D1RA 4L62A 3S14J 2VKVA 2X9DA 4ABZA 3GTKJ 3HOVJ 4BBSJ 3L1PA 2MG4A 5IYCJ 3FIWA 2CQXA 1OCTC 2KDZA 3A02A 2JN6A 1IC8A 5DAJA 1HLVA 1FIAA 3BG5A 3ZOBA 3B6CA 1TWAJ 4G12A 1APLC 2TCTA 4A3KJ 4I76A 2M8GX 3DEWA 2COBA 3BG9A 4DYQA 1SGMA 4B3AA 2P81A 2DA6A 4FE4A 4ICHA 4JL3A 1ZR2A 2DMPA 3O8GA 1GT0C 4BBRJ 4JX5A 4GFKA 3NNRA 3LNQA 4JP0A 2DA2A 2ZCXA 3BR3A 1I50J 3BTIA 4MFEA 4ACIA 4I6ZA 4IEJA 1W0TA 3NARA 2ME0A 3VW2A 1VNDA 2DG8A 1H8AC 1FTZA 2LD5A 3V78A 3NXCA 1ZR4A 3HOWJ 3VW1A 4YZEA 3F0CA 2NOGA 2IU5A 2LP0A 3NI7A 3HB9A 5FLVA 2K9QA 3TEDA 4DYCA 1MBFA 3DPJA 3BR2A 1A6IA 1MNMC 3A01B 2LY9A 3ZQCA 2RAEA 3W6VA 1MSEC 2GBYA 2GUHA 4CYCB 3E7LA 5JLWA 3GTMJ 1GV2A 3ANGA 2UXPA 1IJWC 3S15J 4GFBA 1YRNA 3OSFA 3BR6A 5DTDA 2X6OA 4QTRA 2QOPA 4V2GA 3JR9A 1B72A 4W97A 5J1RA 2Y0SN 2Y2ZA 3NAUA 2MW8A 3RQIA 2R5ZB 2NP3A 4A3FJ 2EQRA 5M5WJ 3BQYA 3TW7A 1AHDP 3LSPA 1H89C 1RKTA 1IRZA 3IH3A 4JNNA 3PM1A 2EH3A 1UG2A 1P7IA 5GP9A 2LKXA 3NPIA 1JT0A 1WCMJ 2CU7A 2NS7A 2D6YA 2OPTA 1MSFC 1B8IA 1BW5A 1UHSA 5FKMA 2XGCA 2NVXJ 1TWCJ 2HQ5A 2DG7A 1MBJA 1OCPA 2ME6A 4M3EA 4X1EA 4B1RA 5EEAA 2LK2A 2GFNA 2R5YB 1AKHB 2MGQA 1BW6A 1TWGJ 5EG0A 3D1NI 2JWTA 2W48A 2DTZA 4XK4A 2FD5A 1I3QJ 1GV5A 1OFCX 2QIBA 4UUTA 2OF7A 3EGQA 1U8BA 5EZHA 3ZQHA 4UUSB 4RBOA 4IHYA 4AC6A 2G0EA 4S0HB 3NRGA 3LSJA 4A3EJ 3GTJJ 4JX4A 2CQQA 1WH7A 2R93J 2HKUA 1U9NA 2JK3A 4AF5A 3JRCA 2XRLA 1WH5A 3VOKA 3Q0WA 2XPUA 3GZIA 1JUSA 3JRAA 2GENA 2W53A 1HF0A 4FCYA 3FKIJ 2Y31A 1ETQA 3HEFA 5J3LA 3VOXA 1Z77A 2M0CA 1T56A 4XRMA 1FJLA 1JKOC 1JT6A 3JSJA 3MN2A 2JMWA 3BRUA 4MO7A 3S2HJ 5EZGA 2TRTA 2E2HJ 5C3EJ 1IDYA 2O7OA 4M3BA 5EF6A 2QF7A 2ELKA 2DMTA 3C2BA 5K7ZA 2NVQJ 1UI5A 2RASA 5J1YA 2I10A 3S17J 2OERA 2YS9A 3JRDA 2JJ7A 1JJ8C 3SJMA 2CJJA 4B4CA 2HDDA 3HDDA 1RETA 2EZIA 2D5VA 3TP0A 1RPWA 3BNIA 5H9TA 3KKCA 4XRSG 2WUIA 3HOYJ 1LE8B 4A3CJ 1H88C 2UXUA 3TP3A 3GEUA 3HE0A 3GTLJ 1X2MA 2M34A 4HNVA 1RKWA 2DA1A 3QPSA 3S1MJ 5C4JJ 3JRIA 2LFBA 4AYBN 3ANPA 1JGGA 3KKDA 1OJLA 3GTGJ 3RZOJ 2L7MP 3F1BA 5F0CA 5HBUA 3CWRA 3JREA 3SDGA 1HDPA 1PUFB 4C3JJ 3HOUJ 3CDLA 4AUXA 4IHVA 1YRNB 2G7SA 2EZHA 4XRSA 2HXOA 1MBGA 2NVYJ 3GTQJ 1I6HJ 2NX4A 2NP5A 5EGOA 3I4NJ 1ENHA 1B72B 1NK3P 2PZ9A 2L7ZA 3BR5A 2O9LA 5K7HA 2O8KA 2R92J 4A3GJ 3LJLA 3ZQIA 1JTXA 4XIDA 4EEFG 1G2HA 3LOCA 1MH3A 3PO2J 4Y52J 3M3YJ 3S2DJ 3BJBA 3HTHA 3G56A 2G3BA 5FLMJ 1B8IB 1ZTRA 5F08A 4DYRA 1CQTA 1QPIA 5E3NA 2EZLA 3G1LA 4A3JJ 2N8GA 2YUSA 2JA8J 4FTHA 2G7GA 2ECCA 3BG3A 3JRFA 3RD3A 3H0GJ 3LSRA 3OIOA 3BQZA 2QCOA 3PPBA 1WGXA 2K9NA 3VVZA 1DU0A 3DCFA 5GPAA 3COLA 2DMUA 1D5YA 1ZQ3P 3S1NJ 4XICA 2CUFA 4CYCA 3CQZJ 2B63J 2ECBA 3Q0UA 2OI8A 2WAQN 4A3MJ 5K7FA 2O7TA 2HOAA 1IV6A 3V6GA 4A93J 5M3FJ 2DA7A 2YVEA 2YU9J 4C2MJ 1XS9A 1HOMA 5F0FA 1JUMA 4M3FA 2HI3A 1JKQC 5GPCA 3S16J 1SFOJ 4A3LJ 2R5ZA 3AQTA 2XB5A 4W1UA 2XPWA 5IYDJ 2L0KA 3GTOJ 2E19A 1ETVA 3CRJA 4JX6A 2NS8A 4DZJA 4C3IJ 4Y7NJ 2Y30A 1P7JA 5M5XJ 5E3OA 4D5CA 5D19A 5HSZA 2DMQA 4A69C 3UKGA 3AQSA 5IP6A 2Q24A 1MBKA 1FEXA 1WI3A 4C3HJ 2UXHA 5CW8A 3ZQFA 1ETWA 2GLOA 1MH4A 3HM5A 3A03A 3H3VK 3BTLA 3M4OJ 2DJNA 4LOCA 5HODA 3G1OA 3B81A 1ETOA 5M3MJ 4QSHA 4X6AJ 1BJZA 2H8RA 1HCRA 1Y1WJ 2ZOZA 3VVXA 4A3BJ 3HOXJ 4NELA 3LSGA 3HGGA 1W0UA 3VUQA 3JRBA 1RR7A 1E3OC 2L7FP 3TW6A 4IHWA 2F07A 4UUSA 1TWHJ 2Y9YA 3FK7A 2JA7J 3S1RJ 3P9TA 2UXIA 1QVUA 2HXIA 4UDSA 4KWAA 4BY7J 2PMZN 4A3DJ 1IG7A 5EDNA 2LVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ1 A;  3GTP J;  5F1J A;  3IV5 A;  2IAI A;  4ME9 A;  2R7Z J;  4V2F A;  1JKP C;  5FGL A;  2LR8 A;  3LWJ A;  4NN1 A;  3MNL A;  2DA3 A;  2HYJ A;  2JA5 J;  3HBL A;  4DZP A;  5EGO B;  1X2N A;  3ZQG A;  2VI6 A;  3S5R A;  2YVH A;  1TC3 C;  4RDU A;  1IGN A;  2UXO A;  1F36 A;  4MFD A;  4D7M A;  2XB0 X;  2HOT A;  2M2E A;  2VKE A;  1A5J A;  3ON4 A;  3HTJ A;  5EYR A;  2KT0 A;  5FJ8 J;  5FKL A;  3G7R A;  5C4X J;  3BHQ A;  5D18 A;  1LFB A;  1ETY A;  4IHX A;  4L5E A;  2IEK A;  5IP9 J;  1VI0 A;  1LFU P;  5CXI A;  3IUV A;  4MLO A;  2CUE A;  3BT9 A;  3BCG A;  1GUU A;  2G7L A;  3RKQ A;  5CXG A;  1F43 A;  3SFI A;  1ORK A;  2XSD C;  5IOZ A;  1XC5 A;  1LE8 A;  2WGB A;  2Y9Z A;  3OSG A;  5IOY A;  1JJ6 C;  1UMQ A;  2EZK A;  2X48 A;  3MVP A;  3BTC A;  3VIB A;  4GCL A;  3ZQL A;  2ZCN A;  4A3I J;  2AO9 A;  1S7E A;  4GFL A;  3VVY A;  3JRH A;  3I4M J;  3QQA A;  1Z0X A;  2HOS A;  4FIS A;  2QWT A;  1PUF A;  4M3G A;  4M6V A;  5M5Y J;  2QTQ A;  2ZCM A;  1ITY A;  2E2J J;  3RH2 A;  4QIW N;  3FK6 A;  5IPA A;  2HYT A;  5C4Y A;  4CGR A;  5EG0 B;  5EFY A;  2ZB9 A;  4MIM A;  4D5F A;  1TWF J;  5DS9 A;  2XGE A;  3HTA A;  3A01 A;  2IBD A;  4DW6 A;  3HIM A;  1NK2 P;  2ZOY A;  3IH4 A;  1VFC A;  3QKX A;  2ID3 A;  1VF9 A;  2R0Q C;  3QPL A;  1NTC A;  3EUP A;  1UI6 A;  2AHQ A;  5AQC A;  1U78 A;  2RHA A;  2VPR A;  1O4X A;  4BY1 J;  2NVT J;  5FMP A;  1GDT A;  4GCT A;  2PBX A;  3LHQ A;  2XPV A;  1EF4 A;  5J1U A;  1X58 A;  5K58 A;  1IDZ A;  1K83 J;  1SAN A;  9ANT A;  1ETK A;  3HTI A;  2DA4 A;  2FX0 A;  2FQ4 A;  2QKO A;  5BNG A;  1QRY A;  1ZGW A;  2GM4 A;  2EBI A;  1R9T J;  4BKX A;  1BL0 A;  2V57 A;  3O60 A;  1Q1V A;  1U9O A;  3ON2 A;  4FE7 A;  3O8H A;  1MBH A;  3BR0 A;  3CMY A;  5E3L A;  1K61 A;  1AU7 A;  3FRQ A;  1MBE A;  4J19 A;  3QBM A;  3RZD J;  4GCK A;  5E3M A;  3B6A A;  3Q3S A;  1POG A;  3K2A A;  5F04 A;  3VP5 A;  1XG1 A;  2LLK A;  4NDL A;  5FHP A;  2FBQ A;  2DN0 A;  4M3D A;  4HKU A;  1ETX A;  5C44 J;  2LTP A;  2ID6 A;  3GBG A;  3G1M A;  3VW0 A;  5IYB J;  2XGD A;  5IP7 J;  3JRG A;  3HGY A;  2E2I J;  1FTT A;  3PAS A;  3CCY A;  2WB1 N;  2MSY A;  2K9S A;  2H1K A;  4JKZ A;  3K7A J;  5F27 A;  1ZKG A;  3KNW A;  1IUF A;  1FIP A;  1JTY A;  2L9R A;  5FKK A;  3WHB A;  3CJD A;  4BXX J;  2M9H A;  3IH2 A;  5JLX A;  1GVD A;  4PXI A;  1JUP A;  3BR1 A;  3PO3 J;  1QVT A;  4MXM A;  1T33 A;  2R5Y A;  5HAW A;  2DMN A;  3OOU A;  1AKH A;  4D7N A;  1RES A;  4AC0 A;  5F0H A;  2K40 A;  3Q0V A;  1HDD C;  3S1Q J;  3MKL A;  2WV1 A;  4JYK A;  4MK6 A;  3HKZ N;  1DU6 A;  1BA5 A;  3KZ9 A;  3BTJ A;  1WPK A;  2VUM J;  3T6N A;  2DA5 A;  1ZK8 A;  5FKN A;  2E1O A;  3VPR A;  1JKR C;  3C07 A;  1Y1V J;  5FKO A;  2XDN A;  2CRG A;  3FIS A;  3WHC A;  3HOZ J;  2JA6 J;  3E7Q A;  2REK A;  5D1R A;  4L62 A;  3S14 J;  2VKV A;  2X9D A;  4ABZ A;  3GTK J;  3HOV J;  4BBS J;  3L1P A;  2MG4 A;  5IYC J;  3FIW A;  2CQX A;  1OCT C;  2KDZ A;  3A02 A;  2JN6 A;  1IC8 A;  5DAJ A;  1HLV A;  1FIA A;  3BG5 A;  3ZOB A;  3B6C A;  1TWA J;  4G12 A;  1APL C;  2TCT A;  4A3K J;  4I76 A;  2M8G X;  3DEW A;  2COB A;  3BG9 A;  4DYQ A;  1SGM A;  4B3A A;  2P81 A;  2DA6 A;  4FE4 A;  4ICH A;  4JL3 A;  1ZR2 A;  2DMP A;  3O8G A;  1GT0 C;  4BBR J;  4JX5 A;  4GFK A;  3NNR A;  3LNQ A;  4JP0 A;  2DA2 A;  2ZCX A;  3BR3 A;  1I50 J;  3BTI A;  4MFE A;  4ACI A;  4I6Z A;  4IEJ A;  1W0T A;  3NAR A;  2ME0 A;  3VW2 A;  1VND A;  2DG8 A;  1H8A C;  1FTZ A;  2LD5 A;  3V78 A;  3NXC A;  1ZR4 A;  3HOW J;  3VW1 A;  4YZE A;  3F0C A;  2NOG A;  2IU5 A;  2LP0 A;  3NI7 A;  3HB9 A;  5FLV A;  2K9Q A;  3TED A;  4DYC A;  1MBF A;  3DPJ A;  3BR2 A;  1A6I A;  1MNM C;  3A01 B;  2LY9 A;  3ZQC A;  2RAE A;  3W6V A;  1MSE C;  2GBY A;  2GUH A;  4CYC B;  3E7L A;  5JLW A;  3GTM J;  1GV2 A;  3ANG A;  2UXP A;  1IJW C;  3S15 J;  4GFB A;  1YRN A;  3OSF A;  3BR6 A;  5DTD A;  2X6O A;  4QTR A;  2QOP A;  4V2G A;  3JR9 A;  1B72 A;  4W97 A;  5J1R A;  2Y0S N;  2Y2Z A;  3NAU A;  2MW8 A;  3RQI A;  2R5Z B;  2NP3 A;  4A3F J;  2EQR A;  5M5W J;  3BQY A;  3TW7 A;  1AHD P;  3LSP A;  1H89 C;  1RKT A;  1IRZ A;  3IH3 A;  4JNN A;  3PM1 A;  2EH3 A;  1UG2 A;  1P7I A;  5GP9 A;  2LKX A;  3NPI A;  1JT0 A;  1WCM J;  2CU7 A;  2NS7 A;  2D6Y A;  2OPT A;  1MSF C;  1B8I A;  1BW5 A;  1UHS A;  5FKM A;  2XGC A;  2NVX J;  1TWC J;  2HQ5 A;  2DG7 A;  1MBJ A;  1OCP A;  2ME6 A;  4M3E A;  4X1E A;  4B1R A;  5EEA A;  2LK2 A;  2GFN A;  2R5Y B;  1AKH B;  2MGQ A;  1BW6 A;  1TWG J;  5EG0 A;  3D1N I;  2JWT A;  2W48 A;  2DTZ A;  4XK4 A;  2FD5 A;  1I3Q J;  1GV5 A;  1OFC X;  2QIB A;  4UUT A;  2OF7 A;  3EGQ A;  1U8B A;  5EZH A;  3ZQH A;  4UUS B;  4RBO A;  4IHY A;  4AC6 A;  2G0E A;  4S0H B;  3NRG A;  3LSJ A;  4A3E J;  3GTJ J;  4JX4 A;  2CQQ A;  1WH7 A;  2R93 J;  2HKU A;  1U9N A;  2JK3 A;  4AF5 A;  3JRC A;  2XRL A;  1WH5 A;  3VOK A;  3Q0W A;  2XPU A;  3GZI A;  1JUS A;  3JRA A;  2GEN A;  2W53 A;  1HF0 A;  4FCY A;  3FKI J;  2Y31 A;  1ETQ A;  3HEF A;  5J3L A;  3VOX A;  1Z77 A;  2M0C A;  1T56 A;  4XRM A;  1FJL A;  1JKO C;  1JT6 A;  3JSJ A;  3MN2 A;  2JMW A;  3BRU A;  4MO7 A;  3S2H J;  5EZG A;  2TRT A;  2E2H J;  5C3E J;  1IDY A;  2O7O A;  4M3B A;  5EF6 A;  2QF7 A;  2ELK A;  2DMT A;  3C2B A;  5K7Z A;  2NVQ J;  1UI5 A;  2RAS A;  5J1Y A;  2I10 A;  3S17 J;  2OER A;  2YS9 A;  3JRD A;  2JJ7 A;  1JJ8 C;  3SJM A;  2CJJ A;  4B4C A;  2HDD A;  3HDD A;  1RET A;  2EZI A;  2D5V A;  3TP0 A;  1RPW A;  3BNI A;  5H9T A;  3KKC A;  4XRS G;  2WUI A;  3HOY J;  1LE8 B;  4A3C J;  1H88 C;  2UXU A;  3TP3 A;  3GEU A;  3HE0 A;  3GTL J;  1X2M A;  2M34 A;  4HNV A;  1RKW A;  2DA1 A;  3QPS A;  3S1M J;  5C4J J;  3JRI A;  2LFB A;  4AYB N;  3ANP A;  1JGG A;  3KKD A;  1OJL A;  3GTG J;  3RZO J;  2L7M P;  3F1B A;  5F0C A;  5HBU A;  3CWR A;  3JRE A;  3SDG A;  1HDP A;  1PUF B;  4C3J J;  3HOU J;  3CDL A;  4AUX A;  4IHV A;  1YRN B;  2G7S A;  2EZH A;  4XRS A;  2HXO A;  1MBG A;  2NVY J;  3GTQ J;  1I6H J;  2NX4 A;  2NP5 A;  5EGO A;  3I4N J;  1ENH A;  1B72 B;  1NK3 P;  2PZ9 A;  2L7Z A;  3BR5 A;  2O9L A;  5K7H A;  2O8K A;  2R92 J;  4A3G J;  3LJL A;  3ZQI A;  1JTX A;  4XID A;  4EEF G;  1G2H A;  3LOC A;  1MH3 A;  3PO2 J;  4Y52 J;  3M3Y J;  3S2D J;  3BJB A;  3HTH A;  3G56 A;  2G3B A;  5FLM J;  1B8I B;  1ZTR A;  5F08 A;  4DYR A;  1CQT A;  1QPI A;  5E3N A;  2EZL A;  3G1L A;  4A3J J;  2N8G A;  2YUS A;  2JA8 J;  4FTH A;  2G7G A;  2ECC A;  3BG3 A;  3JRF A;  3RD3 A;  3H0G J;  3LSR A;  3OIO A;  3BQZ A;  2QCO A;  3PPB A;  1WGX A;  2K9N A;  3VVZ A;  1DU0 A;  3DCF A;  5GPA A;  3COL A;  2DMU A;  1D5Y A;  1ZQ3 P;  3S1N J;  4XIC A;  2CUF A;  4CYC A;  3CQZ J;  2B63 J;  2ECB A;  3Q0U A;  2OI8 A;  2WAQ N;  4A3M J;  5K7F A;  2O7T A;  2HOA A;  1IV6 A;  3V6G A;  4A93 J;  5M3F J;  2DA7 A;  2YVE A;  2YU9 J;  4C2M J;  1XS9 A;  1HOM A;  5F0F A;  1JUM A;  4M3F A;  2HI3 A;  1JKQ C;  5GPC A;  3S16 J;  1SFO J;  4A3L J;  2R5Z A;  3AQT A;  2XB5 A;  4W1U A;  2XPW A;  5IYD J;  2L0K A;  3GTO J;  2E19 A;  1ETV A;  3CRJ A;  4JX6 A;  2NS8 A;  4DZJ A;  4C3I J;  4Y7N J;  2Y30 A;  1P7J A;  5M5X J;  5E3O A;  4D5C A;  5D19 A;  5HSZ A;  2DMQ A;  4A69 C;  3UKG A;  3AQS A;  5IP6 A;  2Q24 A;  1MBK A;  1FEX A;  1WI3 A;  4C3H J;  2UXH A;  5CW8 A;  3ZQF A;  1ETW A;  2GLO A;  1MH4 A;  3HM5 A;  3A03 A;  3H3V K;  3BTL A;  3M4O J;  2DJN A;  4LOC A;  5HOD A;  3G1O A;  3B81 A;  1ETO A;  5M3M J;  4QSH A;  4X6A J;  1BJZ A;  2H8R A;  1HCR A;  1Y1W J;  2ZOZ A;  3VVX A;  4A3B J;  3HOX J;  4NEL A;  3LSG A;  3HGG A;  1W0U A;  3VUQ A;  3JRB A;  1RR7 A;  1E3O C;  2L7F P;  3TW6 A;  4IHW A;  2F07 A;  4UUS A;  1TWH J;  2Y9Y A;  3FK7 A;  2JA7 J;  3S1R J;  3P9T A;  2UXI A;  1QVU A;  2HXI A;  4UDS A;  4KWA A;  4BY7 J;  2PMZ N;  4A3D J;  1IG7 A;  5EDN A;  2LVS A; 
#chains in the Genus database with same CATH topology
 2DDB A;  5JI6 A;  1MNE A;  1W5C C;  2R7Z J;  2DYS H;  5ILV A;  4V2F A;  2VE9 A;  1T39 A;  1JKP C;  5FGL A;  1WJA A;  1Z7L A;  3LWJ A;  2BBY A;  4UY8 I;  4HNT A;  2CGP A;  2GXG A;  2K5C A;  1WRJ A;  5DCM A;  1FOK A;  1FC3 A;  4BE0 A;  1SFX A;  5CVR A;  1FOY A;  2VI6 A;  2J5O A;  2YVH A;  2QSG X;  2PMU A;  2XRO A;  2V6E A;  1IGN A;  2EWN A;  4RGX A;  3VOE A;  2XAH A;  2XB0 X;  3DU6 A;  2BXZ A;  4U0V A;  5GAD J;  1MJ9 A;  5EYR A;  2GOX B;  5FJ8 J;  1W7P A;  5FKL A;  1XCV A;  3G7R A;  5C4X J;  3I56 I;  4LG0 A;  1LFU P;  1UHM A;  3IAM 2;  1GUU A;  3TDU C;  2FMY A;  2HQN A;  3NWT A;  4EM1 A;  2G7L A;  3OYL A;  4ASN A;  1A36 A;  2IVM A;  1QGP A;  5IOZ A;  4NQW A;  1FMW A;  2Y9Z A;  1ON2 A;  3WTS C;  4I7H A;  2JZY A;  3MVP A;  4EGZ A;  3VIB A;  1UHW A;  3TDZ C;  2BY3 A;  2K9L A;  1Y6I A;  2IA2 A;  2LY1 A;  2X0L A;  4ZZL A;  2AO9 A;  2JSC A;  2GOM A;  3V8L A;  1S7E A;  2OTJ I;  4GFL A;  1I27 A;  3VVY A;  3JRH A;  3QQA A;  1Y56 A;  4CO8 A;  4KT5 C;  4FET A;  2QWT A;  2QTQ A;  2L9N A;  5GAH J;  1XGO A;  3J7A Y;  3RH2 A;  2ZXI A;  3ERM A;  5EFY A;  3BP8 A;  5DS9 A;  2IBD A;  2QQB A;  3BG6 A;  3IH4 A;  4GYI A;  3KP4 A;  3SZT A;  2AHQ A;  2KRC A;  1YQA A;  3IAS 2;  2KRH A;  4LMY A;  5HLH A;  1U78 A;  2V1U A;  3OV8 A;  4BY1 J;  4GCT A;  2XPV A;  2JUC A;  3T5X A;  1EF4 A;  4NB5 A;  5FGM A;  5LGU A;  2DW4 A;  3JCU C;  3MKY B;  3HRM A;  3L2W A;  1IN5 A;  2FQ4 A;  2QKO A;  4LIU A;  3OYK A;  2EBI A;  2ZME B;  5DD4 A;  1R9T J;  3O60 A;  1TL8 A;  4XOP A;  3ON2 A;  3J80 K;  2VJ4 A;  1ODD A;  4GCK A;  5IT9 K;  4ENK A;  2ZXJ A;  2ZC2 A;  1POG A;  1FNN A;  1R4M B;  3EUK L;  3VEP A;  1XG1 A;  2KPM A;  5FHP A;  1UEL B;  3AG3 H;  3HRS A;  2XAQ A;  3WE3 A;  2KKO A;  2MD0 A;  2RN7 A;  4CCL A;  2I5U A;  5IP7 J;  3JRG A;  1D1B A;  1VQL I;  1YS7 A;  4ZYD A;  4J00 A;  4RGU A;  2MSY A;  3R0A A;  3KYD B;  5F27 A;  1NHA A;  3H3U A;  2L9R A;  5FKK A;  3WHB A;  2DQR A;  4ZTJ A;  1ZRF A;  3KNW A;  2AQF A;  3DV8 A;  1SD5 A;  3BR1 A;  3JTH A;  4MXM A;  2DI3 A;  3PSI A;  3OYM A;  1TTY A;  2Y75 A;  2QWW A;  1X1D A;  4AC0 A;  1HDD C;  5F0H A;  3Q0V A;  3RQ4 A;  4HDU A;  1EKE A;  3HKZ N;  1FBQ A;  3FMR A;  3K9T A;  1UJ8 A;  1WPK A;  3MMY B;  4IJA A;  2VUM J;  1SD7 A;  1ZK8 A;  2DFI A;  2E1O A;  2F5D A;  3VPR A;  1JKR C;  1R23 A;  4BE1 A;  3E7Q A;  2L9S A;  3OYN A;  3ZQ7 A;  3DPU A;  4MTD A;  3S14 J;  2X9D A;  4R1H A;  4ABZ A;  2E71 A;  2JPB A;  2BVM A;  3HIF A;  4EVI A;  3FIW A;  5GTI C;  1VQK I;  4UNO A;  1OCT C;  4ZDP A;  3U2R A;  3A02 A;  1XSV A;  2BGC A;  1G3T A;  3KEQ A;  4HAM A;  2LBF B;  1FIA A;  3EUH A;  5LRS A;  1YX5 A;  1FSH A;  3CDH A;  2CUJ A;  3B6C A;  3LFU A;  5D6E A;  3REO A;  4C2M A;  3GZ5 A;  1MJB A;  3TMO A;  4EV0 A;  2EV0 A;  1R1T A;  4BAY A;  2H27 A;  4I76 A;  2WAE A;  4DYQ A;  3BG9 A;  1SGM A;  3CCU I;  2UUZ A;  1J59 A;  2P81 A;  1HC8 A;  2DA6 A;  4ESJ A;  2RC4 A;  3BJ6 A;  3LSI A;  3GCM A;  2CUZ A;  4FAS D;  3O8G A;  1GT0 C;  4BBR J;  4JX5 A;  1OIS A;  4BYY A;  3HRU A;  2HTJ A;  2DPU A;  3HYI A;  4S04 A;  3OYJ A;  1I50 J;  2LKS A;  3OR1 C;  4N4N B;  5GTH C;  4MFE A;  2CV0 A;  3HOT A;  1IW7 F;  3ESW B;  2EK5 A;  3ML6 A;  4IRV A;  3F8N A;  4A12 A;  2DG8 A;  2Z5U A;  3G73 A;  2D45 A;  3NXC A;  3CLQ A;  5HLT A;  1YW9 A;  2M0M A;  2R7T A;  3F0C A;  3IRR A;  2NOG A;  1OYY A;  2I8D A;  2P6S A;  2AS5 F;  2PBI A;  4YEL A;  3HB9 A;  2E1C A;  1B59 A;  2K9Q A;  4DYC A;  5FRM A;  3BR2 A;  2HU9 A;  4HW0 A;  4XMY A;  2NVU B;  3E7L A;  5L3B A;  3IHU A;  4P9U A;  3COA C;  5JLW A;  2BZT A;  2V7F A;  3F9K A;  4RS8 A;  4XKV A;  5LEJ A;  3KP5 A;  4WXH A;  4HPQ A;  2A05 A;  3TGN A;  1W1W E;  3QYE A;  4NC8 A;  4OWR B;  5E8I A;  3H1C A;  2VBX A;  5DTD A;  3PIO F;  2X6O A;  4F92 B;  2VPL A;  3JR9 A;  2IXS A;  3LSM A;  2Y0S N;  4KMF A;  1HXD A;  1WI9 A;  2QSF X;  3BDD A;  3BRO A;  3RQI A;  4KDP A;  3DP7 A;  1FWZ A;  3E6M A;  3CO7 C;  1T0F A;  3DTE A;  3H9Q A;  3IH3 A;  4DBQ A;  3M1C A;  4DVY P;  1NH3 A;  3I9V 2;  1GVJ A;  5BOX A;  3CCE I;  3FXM A;  5HLI A;  1JT0 A;  3LA7 A;  1WHU A;  1SFU A;  2M4G A;  4Z6Y A;  3S8P A;  2ME6 A;  2IGM A;  1N77 A;  4M3E A;  5B5E C;  4B1R A;  5F6F A;  4F3Q A;  4RB2 C;  2ESH A;  2GFN A;  2BEO A;  1BC7 C;  3CME I;  1LDJ A;  1BW6 A;  4Q48 A;  5EJC A;  2LMD A;  3RKY A;  2L2O A;  4AWX B;  2NNY A;  5E17 F;  4PJJ A;  2WAF A;  5KAI C;  2HEO A;  2VKH A;  2LH9 A;  2FD5 A;  4C2U A;  2QIB A;  1XPX A;  3KLO A;  2VE8 A;  4RBO A;  2M4K A;  4PGG A;  3CC7 I;  4AC6 A;  4A3E J;  3OYE A;  3GTJ J;  4OU0 A;  2CQQ A;  4IPA A;  3TBI A;  5D5V B;  2DQL A;  1RUN A;  3PJR A;  1WH5 A;  1H9G A;  4BXU A;  2HFH A;  1OCR H;  3VOK A;  2BXY A;  4Q47 A;  1Y8R B;  5E20 A;  2IS1 A;  4YFX F;  5B66 C;  2M5W A;  3GZI A;  3R61 A;  1JUS A;  1SMY F;  2BW3 B;  3JRA A;  3A4C A;  1ZG1 A;  2W53 A;  4V19 K;  3OYH A;  2L01 A;  3F22 A;  4FCY A;  4EM0 B;  1BI2 A;  3FKI J;  4GYG A;  5J3L A;  3VOX A;  2HZT A;  1Z77 A;  1IAW A;  1T56 A;  1FJL A;  1FYL A;  2VXZ A;  3RSN A;  2KIF A;  2WC2 A;  4II2 A;  3NS4 A;  1S7O A;  4MO7 A;  4LLL A;  3HPG A;  4D1Q A;  4UV9 A;  1VQ5 I;  2PFB A;  2K27 A;  4E7H A;  1BR4 A;  4Y33 A;  1F1Z A;  1YI2 I;  1Z3X A;  4M3B A;  3VYR B;  1UI5 A;  4UVA A;  1IRF A;  1D5V A;  3ABU A;  3WTZ A;  3S17 J;  2WB1 A;  3JRD A;  1WJ5 A;  5CJ9 A;  3OL4 A;  2VXD A;  4IVN A;  4OAY A;  3SJM A;  2HDD A;  3HDD A;  2DO7 A;  3TP0 A;  4XLN F;  4UVC A;  3KKC A;  3KE2 A;  4NNJ A;  2DAO A;  3GEU A;  1GLN A;  3GTL J;  1X2M A;  5KVR A;  2K4J A;  3I59 A;  2ZBK A;  2DA1 A;  3AG1 H;  2QVO A;  5C4J J;  3JRI A;  1DQU A;  4AYB N;  2KJC A;  3F1B A;  3EET A;  4Q5S F;  4IRG A;  3VYT B;  3U21 A;  1PUF B;  3M8J A;  4C3J J;  3HOU J;  4A2U A;  2G7S A;  4XRS A;  5IT9 Z;  4H4K C;  3ZMS A;  4HG2 A;  2NX4 A;  2NP5 A;  2XAS A;  5EGO A;  4M74 A;  3CP2 A;  1B72 B;  3L2C A;  3BR5 A;  4IHT A;  1N75 A;  4YIF A;  1OCZ H;  3CJR B;  4JOM A;  4HX7 A;  4E7Z A;  1KU9 A;  2R92 J;  4E7K A;  1JTX A;  3OOP A;  4EEF G;  1G2H A;  3LOC A;  1MH3 A;  4P96 A;  1LVA A;  1V5E A;  3AAF A;  3E6B A;  3S2D J;  2M45 A;  4EM2 A;  3G56 A;  1FSE A;  3KLN A;  2FUG 2;  1T38 A;  1R22 A;  3S32 A;  3N97 A;  1P4A A;  3K4L A;  5E3N A;  1VZ0 A;  1T2K A;  4IQJ A;  3G1L A;  3CD6 I;  2N8G A;  2JA8 J;  2Q2E B;  5H6Q A;  4U88 A;  3HL2 A;  1A6Q A;  5FB2 A;  1IN7 A;  2FQ3 A;  3DKX A;  3J81 Z;  3BQZ A;  4O3M A;  1VQP I;  3PPB A;  1XSD A;  1DU0 A;  3OYC A;  4KIB A;  3KEO A;  3QP5 A;  5JR3 A;  3FMS A;  4CYC A;  3CQZ J;  2B63 J;  3I4P A;  2KFD A;  2Q0O A;  3FMQ A;  3L09 A;  2WAQ N;  2OI8 A;  2O7T A;  2F2E A;  2O8X A;  3E3V A;  3V6G A;  2V4J C;  3KZY A;  3TOA A;  3KFW X;  2E35 A;  2DA7 A;  3I71 A;  5FD5 A;  3DBR B;  2A07 F;  2FA5 A;  2YU9 J;  4C2M J;  2YVE A;  4IRI A;  4P9F A;  4BAC A;  1FT9 A;  3U9G A;  3TOB A;  1HOM A;  1IV8 A;  3C2G A;  2QEN A;  4EMS A;  5KAF C;  4UHT A;  5E8G A;  5FRN A;  1XCB A;  2XB5 A;  4W1U A;  5IYD J;  2CYY A;  1PYV A;  1DGR M;  4XBF A;  4A6D A;  2E19 A;  3WTT C;  2P8T A;  1SEU A;  1KZH A;  4F93 B;  3HTS B;  4UB6 C;  4C3I J;  1QO0 D;  4H0E A;  1P7J A;  5M5X J;  3RJP A;  2DMQ A;  4A69 C;  3IP4 B;  3UKG A;  3AQS A;  5IP6 A;  3LL7 A;  3MEX A;  2Q24 A;  4HLY A;  2K3F A;  2WA0 A;  3ZQF A;  2LNB A;  1YFH A;  1MH4 A;  3M7G A;  3DPT A;  3DPL C;  2QYO A;  2HVR A;  3ZN0 A;  5HS8 A;  2DT6 A;  2Q1Z B;  3FXO A;  4QPO A;  5BPD A;  4X6A J;  2OUM A;  4E7J A;  2MC4 A;  1Y1W J;  4ON0 A;  3VVX A;  1Y39 A;  4YG2 F;  5A2Q Z;  4PSX A;  4IKF A;  3OYB A;  3HGG A;  4XKW A;  5B1B H;  2F5E A;  2QGU A;  3KCC A;  1YJ9 I;  2VIX A;  3TW6 A;  4FHT A;  1J5Y A;  4UUS A;  2FRH A;  2Y9Y A;  3H5A A;  3CDI A;  4A0Z A;  1OPC A;  1P4X A;  3S1R J;  2FSW A;  3F8B A;  5AON A;  4OMZ A;  4OIN F;  1A35 A;  2FNP A;  3V8J A;  1IG7 A;  2LVS A;  3PFI A;  3ECO A;  4G9Y A;  3CTA A;  5F1J A;  2IAI A;  4L0Z B;  2JPC A;  4ESF A;  5D5U B;  4BL0 B;  5JFR A;  2ZJR F;  3MNL A;  2DA3 A;  4BEH B;  2HYJ A;  4ZDL A;  3HPH A;  1HSJ A;  4RLF A;  4DZP A;  3P9I A;  5LLQ A;  3IWZ A;  5TJJ A;  1X2N A;  3ZQG A;  2FF4 A;  1O3Q A;  1U0J A;  5J47 A;  3GZ6 A;  4AIK A;  3BZK A;  3RCO A;  1TC3 C;  2F5V A;  5B3S H;  1WFX A;  3R0J A;  4G6Q A;  4YFN F;  2M2E A;  3TKY A;  2VKE A;  3K4K A;  1A5J A;  4PJ0 C;  1ZRE A;  3HTJ A;  3A1Y A;  3WE2 A;  1MW7 A;  4HRI A;  1LFB A;  1EA3 A;  1ETY A;  3NQO A;  3TO7 A;  4IHX A;  2IEK A;  1VI0 A;  4M9X A;  4NHJ A;  2CUE A;  3BCG A;  4J01 A;  2FJI 1;  1J09 A;  5IT3 A;  3AKZ A;  5CYV A;  4LB5 A;  4L5J A;  1IRX A;  1SFE A;  1XC5 A;  2WGB A;  3I53 A;  2HQR A;  4A5M A;  3ZP5 A;  3GZN B;  5CVV A;  1VQO I;  3BTC A;  3IUO A;  3IC7 A;  2M8E A;  3ZQL A;  2PJR A;  2COM A;  1G3S A;  1TZL A;  2V79 A;  3K70 C;  1L3L A;  1ZLK A;  4FIS A;  2Z3Y A;  1S6L A;  4LFU A;  3QOD A;  2FXA A;  3SZP A;  2ZCM A;  3HSE A;  1LEB A;  3I55 I;  1ITY A;  2E2J J;  1I6X A;  4Y3O A;  3KPH A;  4A0Y A;  1MDM B;  2HYT A;  5EG0 B;  4D5F A;  1TWF J;  2JA2 A;  2A3S A;  5DYM A;  3NEU A;  1RIO H;  4CHU A;  2HYF A;  4KMU X;  2P6T A;  1XDU A;  2VBY A;  3F72 A;  1VFC A;  2ZOY A;  2R0Q C;  2MFZ A;  1Y8Q B;  3EUP A;  5L3C A;  1BOB A;  2VPR A;  4I98 B;  4CDG A;  4BHP A;  2XSJ C;  3LHQ A;  4ZH4 F;  4MNU A;  1K83 J;  2BY2 A;  5GAE J;  9ANT A;  1ETK A;  2DJI A;  3HTI A;  1QRY A;  1ULY A;  2W57 A;  2HVS A;  2GM4 A;  4BKX A;  2V57 A;  3H3Z A;  1U9O A;  1X19 A;  3CCS I;  2GXB A;  1T08 B;  1V54 H;  5ICG A;  3BR0 A;  3CMY A;  5E3L A;  2Y0M A;  1A31 A;  3FRQ A;  1W36 C;  3PNV A;  4G6T B;  3B6A A;  3Q3S A;  2EIK H;  1EJ9 A;  4KFC A;  2NYX A;  5CQG A;  5EEH A;  1R5I D;  2LLK A;  4HYE A;  4NDL A;  2QBY B;  3FWE A;  1V3F A;  3GFI A;  1ETX A;  2O61 A;  3DEU A;  3GLL A;  5C44 J;  4GDF A;  2LTP A;  1E17 A;  1QNT A;  4XL9 A;  3WGI A;  3VW0 A;  4ENJ A;  4CCO A;  3HGY A;  3PAS A;  4EJV A;  3CCY A;  4N9I A;  4MTE A;  2K9S A;  3TO6 A;  4B48 A;  3CUQ B;  1STZ A;  3CJD A;  4BXX J;  2M9H A;  3IH2 A;  5JLX A;  3DLA A;  1JUP A;  3W2A A;  1TQM A;  2DT5 A;  2ADU A;  2R5Y A;  5HAW A;  3E5Q A;  3FXL A;  3OOU A;  1AKH A;  2IS4 A;  4D7N A;  1RES A;  2K3P A;  3P7N A;  2K40 A;  3LA3 A;  2R7X A;  3S1Q J;  3MKL A;  2WV1 A;  5TGT A;  4MK6 A;  2P0W A;  1BA5 A;  4CCJ A;  2OC6 A;  1BJA A;  1Y0U A;  3A2K A;  3T6N A;  3WG7 H;  3R4K A;  3C07 A;  2DOA A;  1OYW A;  1Y1V J;  2XDN A;  4XON A;  5DCM B;  3FX3 A;  3EYY A;  3WHC A;  4OIP F;  3SZG A;  2GIV A;  3K4C A;  1FLI A;  3SDB A;  3HOV J;  1KQ8 A;  5IYC J;  1K78 A;  1FBS A;  2E1N A;  2LOO A;  5F1R A;  3MAJ A;  4II3 A;  1IC8 A;  2X1C A;  1HLV A;  2K85 A;  4IQ4 A;  1R00 A;  1RUO A;  3ZMD A;  1BBY A;  4CZZ A;  3WG9 A;  1D3Y A;  4C9Y A;  1LDD A;  1X3W B;  4G12 A;  2IJL A;  1APL C;  1W7P B;  2YX7 A;  2M8G X;  3DEW A;  5CQE A;  1X3Z B;  5D4R A;  1U5T C;  4LG0 B;  4FE4 A;  1BM9 A;  2AXT C;  4ICH A;  1OQY A;  3X2Q H;  1ZR2 A;  3KP2 A;  3PSF A;  2VJ5 A;  3H36 A;  4KIT B;  5LRR A;  2HZD A;  1BR2 A;  3RTR A;  3K2Z A;  2DA2 A;  3BR3 A;  3DTK A;  4NQW B;  1V5F A;  1LKX A;  4LIT A;  4TV7 A;  4Y13 A;  5HOO A;  2MH9 A;  4HBL A;  4FX0 A;  1KU2 A;  4I6Z A;  4ACI A;  2UV1 A;  1W0T A;  3NAR A;  4A0X A;  1VND A;  4U0Y A;  2FBI A;  1UAA A;  1U3E M;  3FXQ A;  5D8K B;  1FTZ A;  3IKV A;  3IL2 A;  2L9V A;  3M07 A;  2FNA A;  2LRE A;  2PMZ A;  2LP0 A;  4MGR A;  4XQF A;  4ZYG A;  3OYF A;  1MBF A;  2EFN A;  3DU5 A;  1G8X A;  1JI8 A;  3FZV A;  3MZY A;  1G4D A;  4LK0 F;  3ZQC A;  1YW8 A;  5DV5 A;  3T0Y A;  1Z21 A;  2EV5 A;  2HDW A;  4BQA A;  3ANG A;  2UXP A;  2HR3 A;  4JQF A;  4GFB A;  1YRN A;  1MJA A;  2MAB A;  4MHG A;  3PIP F;  3BR6 A;  2CFO A;  4CCM A;  2QOP A;  5DD8 A;  2QM3 A;  4XLE A;  1U2W A;  3FDY A;  5J1R A;  1DP3 A;  1Z9C A;  3NAU A;  4XOR A;  3HZJ A;  3HSF A;  2MW8 A;  4MQV A;  2X4H A;  3A0B C;  4A3F J;  4ZC3 A;  5M5W J;  2C6Y A;  3BQY A;  3DEE A;  3LSP A;  1RKT A;  3K8P C;  2DBB A;  4JK1 X;  1VQ4 I;  3Q9S A;  3NPI A;  3E5U A;  3OIP A;  3RYP A;  2DT7 B;  2XV4 S;  4L9V A;  3W2W A;  3DLL F;  3DFG A;  5LHI A;  5FKM A;  4ZYE A;  3I0T A;  4AU7 A;  1X1B A;  1O7F A;  1MBJ A;  2HQ5 A;  2KZV A;  3WGG A;  4RB1 A;  4KJZ A;  4BQQ A;  3MQ0 A;  5JVT A;  4ESB A;  3CCQ I;  1TT5 B;  3GEZ A;  2PMH A;  2K9M A;  2X1E A;  1LEA A;  3D1N I;  1QZY A;  4Q4Z F;  3CUO A;  4AID A;  3LWF A;  2DTZ A;  2QKM B;  1OYI A;  2VB6 A;  3O2P E;  1GV5 A;  1OFC X;  1FZP B;  4GCV A;  1RC9 A;  1D0Z A;  1LPQ A;  5EZH A;  3ZQH A;  4DOZ A;  4IHS A;  2QUF A;  1KQ0 A;  4BJT A;  2R93 J;  2HDC A;  3K4B A;  3WTX C;  3CO6 C;  3F8C A;  1QZE A;  1USS A;  2LG4 A;  4BHB A;  3ABM H;  2KMU A;  4MEX F;  3ZN1 A;  2VQL A;  4CGZ A;  2EA2 A;  4D0P A;  1HF0 A;  2EV6 A;  3LQR A;  3HEF A;  1H0M A;  1LB2 A;  1J2X A;  4CUG A;  1V55 H;  3D5R C;  3S2W A;  2DK8 A;  1O3S A;  3M8E A;  3PQK A;  2OD5 A;  1GHC A;  5HVQ C;  3FXU A;  2OJE D;  4OOI A;  2EIM H;  1WQ2 A;  3DTI A;  1IDY A;  4C2T A;  2O7O A;  2NVQ J;  2DMT A;  3HG9 A;  1UZC A;  2R4G A;  3MCZ A;  4CCK A;  1YJW I;  2X6X A;  1VQ6 I;  1BI0 A;  4GO1 A;  2I10 A;  1MMD A;  2BHZ A;  5J1Y A;  3HUG B;  1YIJ I;  2F6C A;  4L5I A;  2JJ7 A;  5CVU A;  2JSP A;  1FPQ A;  2MA3 A;  4F91 B;  5TIS C;  4R8H A;  5EEG A;  2KIU A;  2EZI A;  2D5V A;  3QP6 A;  1RPW A;  4BU2 A;  1IRG A;  4BQN A;  3BNI A;  4XRS G;  2RDP A;  1LE8 B;  3DXJ F;  1D0X A;  4DGW B;  3HKZ A;  4CIC A;  1AA7 A;  4HNV A;  1BN5 A;  3KX2 A;  4IX7 A;  1X4P A;  3MD2 A;  5J40 A;  2LFB A;  5HLG A;  1OJL A;  3RZO J;  3V8K A;  2L7M P;  5HBU A;  2IGK A;  1IN8 A;  1HDP A;  4BXF A;  3S3N A;  2QLZ A;  1XDS A;  3FBI B;  3CDL A;  3CCL I;  3K69 A;  2EZH A;  2P5V A;  1MBG A;  5CKT A;  1JE8 A;  2RVC A;  4GXO A;  1I6H J;  4LK1 F;  3ABL H;  1WVR A;  1ENH A;  4E6K G;  2RV8 A;  2PZ9 A;  4I0A A;  2CMP A;  5K7H A;  2BY1 A;  3DKW A;  3GME A;  1HW2 A;  3LJL A;  1MMN A;  3VDX A;  3O6B B;  4LG3 A;  4DJA A;  5J4Y A;  3GX4 X;  1HW1 A;  2P5L C;  2ZJ2 A;  2CW0 F;  2B9S A;  3J7A O;  2XGX A;  5E79 C;  2ZO4 A;  3M3Y J;  3C3W A;  3BJB A;  1YW7 A;  2VLA A;  5FLM J;  1OR7 A;  4PFO A;  4E70 A;  1YG2 A;  5F08 A;  4DYR A;  4NBQ A;  2EZL A;  4FTH A;  3BG3 A;  1XD7 A;  2ZNZ A;  4E4H A;  3JRF A;  4EGY A;  5JVG F;  3H0G J;  2F4M B;  3IRQ A;  3OIO A;  2DPD A;  2VBW A;  2DK5 A;  1K7A A;  3VVZ A;  2O3F A;  2Z1D A;  4PJM A;  2HPI A;  2VQC A;  4C30 A;  5J6X A;  3TQN A;  1YLF A;  1ZQ3 P;  2GWR A;  2ECB A;  3Q0U A;  3ZR8 X;  4BUP A;  1WKM A;  4B44 A;  2CQ7 A;  1VQ7 I;  4KUM A;  3GW2 A;  4L0Y B;  3JAM K;  1SVL A;  2ZME C;  1XS9 A;  2X6W A;  3Q5F A;  3CJQ B;  1W5T A;  2L4A A;  4LLN A;  1JKQ C;  1V5G A;  1B1B A;  5ICC A;  4G94 A;  1WJC A;  2LF8 A;  1OMI A;  2IT0 A;  3GTO J;  3GXO A;  4PUS A;  2Y0S A;  2A6H F;  3BG7 A;  3NRV A;  4Y7N J;  2Y30 A;  5BPI A;  5E3O A;  2A69 F;  4D5C A;  5D19 A;  2KDO A;  5HSZ A;  2F4O B;  2YSR A;  4U9N A;  3KZI C;  3V7R A;  2VC1 A;  3MZ8 A;  1RNL A;  2MC3 A;  4Y4R A;  1YIT I;  1YX3 A;  2BY0 A;  1E3H A;  2VN2 A;  5HOD A;  3G1O A;  2ETH A;  1MMG A;  2UXN A;  1LFP A;  2E5N A;  1FYM A;  1CF7 A;  4QSH A;  2CO5 A;  5L3D A;  3H5N A;  3ZMT A;  1BJZ A;  3T8T A;  1HCR A;  1IXC A;  5H6R A;  3ZRG A;  3OWT A;  4BDY A;  4L18 B;  1YOV B;  2ZOZ A;  1R49 A;  4A3B J;  3HOX J;  1O3R A;  3LSG A;  1Z91 A;  1Y0N A;  2B1E A;  2M7A A;  3JRB A;  2HKO A;  1E3O C;  4WF2 A;  3OS1 A;  4RAF A;  2F07 A;  2M30 A;  4EJU A;  3I59 B;  2EB7 A;  2QEX I;  4IOC F;  2TDX A;  2ZKZ A;  3SYT A;  4WK8 F;  3FK7 A;  4G6D A;  4WCG A;  4KWA A;  4BY7 J;  1VQN I;  3B02 A;  2VQG A;  5EDN A;  2EA4 A;  1E3P A;  2FJ1 A;  3GTP J;  2OU2 A;  2Z2S B;  3IV5 A;  3PL8 A;  1R5G A;  4P1W A;  1PDN C;  4BNC A;  2D1H A;  4U7B A;  3K4J A;  3KP3 A;  3J7Z I;  2LDU A;  4KN7 X;  4I01 A;  2JA5 J;  3O3K A;  5EGO B;  1SD4 A;  5FRO A;  3L7W A;  4M9Z A;  1VQ9 I;  3QOE A;  1JHH A;  3ZMV A;  1OLT A;  4HX4 A;  4RAG A;  2R7R A;  4RDU A;  2CG4 A;  4MFD A;  3J80 Z;  1UFM A;  3ELK A;  2HQA A;  1S3J A;  2VC0 A;  3ON4 A;  2WAD A;  2KT0 A;  4HOB A;  5FLX K;  1MGT A;  5DCF A;  4XN3 A;  5D18 A;  1ZEL A;  2FE3 A;  5IP9 J;  5CXI A;  3IUV A;  5DDG A;  2VJJ A;  1G6N A;  3L2Q A;  3BT9 A;  4NUB A;  3G6E I;  3AFH A;  1IF1 A;  3K70 D;  3M1E A;  2UZK A;  1F43 A;  1WJF A;  4LIV A;  4PCQ A;  1ORK A;  5LGT A;  2XSD C;  2W84 A;  1B4A A;  1I3A A;  3RDI A;  4IO9 F;  1D1A A;  2VOD A;  3E97 A;  2KLO A;  4HDV A;  1UMQ A;  4L9J A;  2EZK A;  1ON1 A;  2L02 A;  2DFE A;  2ZCN A;  4NC6 A;  5B1A H;  3EDP A;  3I4M J;  1LJ9 A;  2JUG A;  4AYB A;  4M3G A;  2F48 A;  3EQL F;  4M6V A;  3V7S A;  5M5Y J;  1PUF A;  2X51 A;  3Q9V A;  4QIW N;  3FK6 A;  5IPA A;  2CSO A;  4HLX A;  1R1V A;  5C4Y A;  2ZB9 A;  4MIM A;  1ZLJ A;  2L54 A;  4PK4 A;  2XGE A;  1R71 A;  3HTA A;  3D0S A;  3A01 A;  3HIM A;  3GFL A;  3R60 A;  4UB8 C;  3LAP A;  2MH2 A;  1X3U A;  1VF9 A;  2WTE A;  3BC8 A;  1K6Y A;  1AWC A;  1MND A;  2O6G E;  2NVT J;  2RHA A;  5FMP A;  2Y69 H;  2IS6 A;  2PBX A;  2XKP A;  1W36 D;  5J1U A;  1X58 A;  4XLH A;  2VQH A;  3G4S I;  1SAN A;  1B6A A;  2DA4 A;  2FX0 A;  4FQG A;  2OZ6 A;  5BNG A;  1ZGW A;  1BL0 A;  2GAU A;  1XGN A;  2PI0 A;  3O8H A;  2X1D A;  1P6R A;  4J19 A;  3RZD J;  1DPU A;  4XLF A;  5E3M A;  5F04 A;  3K2A A;  3OYD A;  1HKQ A;  2RQP A;  4EAT A;  2A5W A;  3FM5 A;  3VP5 A;  3CP8 A;  4N4O B;  4HKU A;  5HDN A;  1TT0 A;  4P55 A;  4F55 A;  4HV5 A;  4XM3 A;  2O03 A;  1T98 A;  2ID6 A;  1IXS B;  4KIF A;  2CW8 A;  4OD5 A;  2A6T A;  3T8R A;  3I5U A;  3DKY A;  4FT8 A;  2H1K A;  1B9N A;  2J5P A;  3K7A J;  4ZYH A;  2VOP A;  1ZKG A;  1FIP A;  6PAX A;  1HST A;  2PFV A;  2DOF A;  5IY5 H;  1GVD A;  2G9W A;  3PO3 J;  2W1O A;  1T33 A;  3E6D A;  1RI7 A;  2DMN A;  2FEZ A;  4HQM A;  2WAQ A;  4PDK A;  5LEK A;  4XNF A;  1FOX A;  1DU6 A;  1OCO H;  1WJE A;  1BR1 A;  3KZ9 A;  3BWG A;  4BGD A;  5FKN A;  2ACJ A;  5LD2 C;  1MKM A;  1TW2 A;  3K4N A;  2EFO A;  3ONQ A;  1MIJ A;  2W00 A;  4YIR X;  3HOZ J;  2JA6 J;  4ZDO A;  4B8X A;  2VKV A;  1X1P A;  2PEX A;  1WJB A;  2MG4 A;  1X4O A;  4G7H F;  3OYI A;  2GIZ A;  2JN6 A;  2JTV A;  3ABK H;  3DBH B;  1SAU A;  3BG5 A;  3KZZ A;  3ZCO A;  3SEQ A;  3ZOB A;  3OMY A;  1G3W A;  5DEQ A;  4LD5 A;  3BLY A;  1SVO A;  5ERI A;  5BS6 A;  4A3K J;  4OD4 A;  1RRJ A;  2COB A;  2LY2 A;  4B3A A;  1XB4 A;  2ZCW A;  3BPV A;  4RAZ A;  2YVX A;  2EIJ H;  2ELJ A;  4JL3 A;  1UST A;  1M1E B;  2LSO A;  2RNJ A;  3TO9 A;  1OCC H;  2R7U A;  1KA8 A;  2DYR H;  2E7W A;  1LUJ B;  4KIC A;  3BTI A;  1R1U A;  3H92 A;  4WXC A;  4IEJ A;  4BS9 A;  2ME0 A;  3VW2 A;  3AG4 H;  1H8A C;  2LD5 A;  3V78 A;  1U5T A;  5FFX A;  1ZR4 A;  4I0B A;  3HOW J;  3VW1 A;  3QOP A;  3VYS B;  2WY7 Q;  4YZE A;  2ZFW A;  3CC4 I;  1OKR A;  2JVG A;  2VT2 A;  3ZGK A;  4CA0 A;  2Q8K A;  3GYH X;  3CCV I;  3NI7 A;  3TED A;  4Z2Y A;  3BZ6 A;  3WTV C;  1MNM C;  3EPZ A;  4B43 A;  2LY9 A;  2RAE A;  3W6V A;  1XMA A;  4OAZ A;  2E1M B;  4K2E A;  3OS0 A;  2GUH A;  3ULQ B;  3HTU A;  4XLC A;  3JSO A;  1Z1D A;  4ZZD A;  3GTM J;  1GV2 A;  1HQC A;  2A2F X;  2A68 F;  3OL3 A;  3V42 A;  1QZZ A;  1FY7 A;  3S15 J;  4IXA A;  3W2V A;  3I54 A;  3OSF A;  1T8I A;  5HS9 A;  4L9T A;  3RPU D;  4QTR A;  4V2G A;  1DP7 P;  3UNG C;  4ETS A;  2Y2Z A;  5F64 A;  3QU3 A;  2R5Z B;  3F8F A;  2NP3 A;  2LYC A;  4M6Y A;  3CF2 A;  1TNS A;  1H89 C;  3LAJ A;  1QPM A;  5E1W A;  2EH3 A;  3DF8 A;  2D2W A;  2JRT A;  5GP9 A;  4HQE A;  4BJ6 C;  1P9Q C;  4X0G A;  1W5S A;  2NS7 A;  5CLS A;  1ZN2 A;  2VOO A;  2D6Y A;  2OPT A;  1KYZ A;  3KIO A;  4XKB A;  1UHS A;  1WWX A;  1VTN C;  1B8I A;  2XGC A;  1T6S A;  1BW5 A;  1S29 A;  2NVX J;  3C1D A;  3FXK A;  2F5C A;  1OCP A;  2JT1 A;  2Z99 A;  1K79 A;  1Z3Y A;  3LSK A;  3QU6 A;  1KON A;  4CSW A;  3ZPL A;  5L3G A;  5EEA A;  1EH8 A;  2LK2 A;  4XSX F;  4XSZ F;  2R5Y B;  1P2F A;  2JRM A;  4I99 C;  1AKH B;  3GUD A;  3T1B A;  1TWG J;  5EG0 A;  3RPU A;  2W48 A;  1R5H A;  3C7J A;  4XK4 A;  3GFM A;  1I3Q J;  3EGQ A;  4UUT A;  2OF7 A;  2ZFU A;  3BCB A;  2HPM A;  4PFP A;  3RIR A;  4IHY A;  2G0E A;  2K7L A;  3SHF A;  4S0H B;  3SXY A;  3D5L A;  1WH7 A;  3H5R A;  4E7I A;  1VQM I;  2ZXW H;  2OCE A;  3JRC A;  1YJN I;  2XRL A;  4OMY A;  4EQQ A;  3I58 A;  3Q0W A;  3DQV C;  2GEN A;  4UUV A;  4KNY A;  3E0J B;  2V6C A;  2VAS A;  2Y31 A;  1ETQ A;  3ZQQ A;  1XTA A;  5FO5 A;  2QBY A;  1I1G A;  3JSJ A;  3MN2 A;  2BV6 A;  4YRV A;  2JMW A;  5L3E A;  3BRU A;  3S2H J;  2TRT A;  2DU9 A;  2YX4 A;  2LKP A;  1E0E A;  3WU0 A;  1ZYR F;  2E2H J;  2CH0 A;  1XSX A;  4BHC A;  2VON A;  4AVP A;  3C2B A;  2ELK A;  2B0L A;  5K7Z A;  2ZSI B;  5LGN A;  2XKO A;  1IN6 A;  2YS9 A;  2STT A;  2BVL A;  3K6G A;  4CYD A;  1F9N A;  2CJJ A;  4B4C A;  5FD6 A;  3U1D A;  5CPR B;  3CLO A;  5J8F A;  5H9T A;  2QQA A;  4CXF A;  2WUI A;  1ZH5 A;  1S5L C;  1YHQ I;  3K0L A;  4A3C J;  2UXU A;  3HE0 A;  2M34 A;  1C0W A;  1RKW A;  2L3D A;  3FXJ A;  3K1M A;  4KN4 X;  3S1M J;  3FKJ A;  3ANP A;  2V9K A;  1JGG A;  1SMT A;  3GTG J;  1QQI A;  1RZ4 A;  4YII A;  5F0C A;  2IA0 A;  1A04 A;  4YFK F;  4F52 A;  2HKX A;  2O5R A;  4P5O A;  4AUX A;  1G59 A;  1YRN B;  4IHV A;  1ERD A;  4IRH A;  2ISY A;  4F7Z A;  3R6S A;  1JXS A;  4XLP F;  1Z6R A;  3RPQ A;  3CMA I;  3I4N J;  4OIR F;  2ZJQ F;  1NK3 P;  3ECH A;  2O9L A;  2BOL A;  4ENN A;  1IZ1 A;  1REP C;  3ROU A;  4XID A;  4HF1 A;  1TQP A;  1XX5 A;  1FP1 D;  3PO2 J;  5LBQ A;  2HGC A;  3HTH A;  3G71 I;  2G3B A;  3SQN A;  2E1M C;  3K10 A;  4LB6 B;  1UG0 A;  3H35 A;  2ICW G;  3ASN H;  4BQO A;  1SFK A;  4QLC U;  3ABT A;  2YUS A;  3VFZ A;  2G7G A;  3HSR A;  3LST A;  4PSW A;  1BC8 C;  2R7V A;  3MKW B;  1D0Y A;  3LSR A;  1BIA A;  2DDA A;  2VKD A;  3KET A;  4HNU A;  2R7O A;  3PNY A;  3SFZ A;  2QCO A;  3BY6 A;  4UXN A;  4N9H A;  2PN6 A;  3BPX A;  3I3L A;  3ISP A;  3VSK A;  3WTW C;  1NG7 A;  3F21 A;  3WTU C;  3RI4 A;  5GPA A;  2ESN A;  3GFJ A;  1J0R A;  3S1N J;  4XIC A;  3BZC A;  2P5K A;  4I09 A;  1D1C A;  1E2X A;  1BOA A;  4A3M J;  3CF5 F;  1PP8 F;  3LSH A;  3PNT A;  3LQQ A;  2XAU A;  2NOJ B;  3BCA A;  1TLH B;  2HOA A;  1FX7 A;  3D5S C;  4A93 J;  5M3F J;  1HW5 A;  3FBN B;  2KP6 A;  5F0F A;  5JHU A;  4PJL A;  4M3F A;  2HI3 A;  5GPC A;  3U1K A;  4HF2 A;  2STW A;  3AQT A;  2G7H A;  2XPW A;  2MLK A;  3HOS A;  4WXD A;  2NS0 A;  1XGS A;  3RKW A;  4JX6 A;  4GRI A;  3JW4 A;  1R58 A;  2ELH A;  1GXP A;  1MBK A;  1FEX A;  2UXH A;  1JGS A;  5CW8 A;  2Y48 A;  2ZME A;  3V4G A;  2L4M A;  3OS2 A;  1ETW A;  4IF4 A;  3CUQ C;  4M72 A;  1YO5 C;  2UWM A;  1S8N A;  3BTL A;  3M4O J;  2DJN A;  4EJT A;  3IWF A;  4S05 A;  3EUA A;  5HS7 A;  2ZJP F;  3TL4 X;  5M3M J;  3VSL A;  2DLL A;  1PJR A;  4R79 A;  1T95 A;  4N0B A;  4IL6 C;  2H8R A;  2R7W A;  5HDK A;  2IPQ X;  5J4V A;  4E7L A;  2W85 A;  3KYL A;  3QPT A;  2YPR A;  1YYV A;  4NEL A;  1TP4 A;  3DWL E;  1J9I A;  3CJT B;  1EH7 A;  1KU3 A;  1XMK A;  3M9A A;  4IHW A;  3QRF F;  2B7E A;  3S93 A;  1TWH J;  3J81 K;  2M3A A;  3C18 A;  1ZG5 A;  4BH9 A;  2RQQ A;  1BI1 A;  3P9T A;  1QVU A;  2R7D A;  4UDS A;  3L2U A;  4A3D J;  3K1N A;  2YR2 A;  3GLX A;  4ME9 A;  1ZG3 A;  3CES A;  3LA2 A;  2NAZ A;  3UR3 C;  3MZH A;  2LR8 A;  1IUY A;  4NN1 A;  1UCR A;  3HBL A;  4AIH A;  5K5O A;  4ITV A;  2KIM A;  3S5R A;  2AXL A;  1IO2 A;  4DIQ A;  1YS6 A;  2OZU A;  2UXO A;  1S72 I;  1F36 A;  2LBF A;  2PG4 A;  4D7M A;  3F23 A;  3H9J A;  2QQ9 A;  2HOT A;  2FBK A;  2O0Y A;  2CS3 A;  5AIQ A;  2IP2 A;  5JHF A;  2K4B A;  3N4M A;  4HX8 A;  3BHQ A;  1Q1H A;  3CJN A;  2W24 A;  4L5E A;  3HUG A;  1S9H A;  3K4M A;  1ZGA A;  4MLO A;  2DFH A;  3VYU B;  2CV2 A;  3RKQ A;  2VBZ A;  2EPF A;  3G3Z A;  5CXG A;  3SFI A;  2E34 A;  2MLG A;  1LE8 A;  3HRT A;  1YE9 A;  2L7K A;  2KQR A;  3OSG A;  3BOQ A;  5IOY A;  1JJ6 C;  2BE5 F;  2X48 A;  1QBJ A;  5A2Q K;  1XMX A;  4GCL A;  3F6V A;  4A3I J;  2M1B A;  1X1A A;  5ILU A;  1Z0X A;  2HOS A;  4O6J A;  2L5Q A;  2E60 A;  2DXI A;  5LHG A;  3MFK A;  4RM3 A;  4CGR A;  2PX9 A;  2GZW A;  3NWS A;  2IRF G;  4DW6 A;  5ILS A;  1NK2 P;  1O57 A;  3QKX A;  2W82 A;  4I02 A;  3GWZ A;  2ID3 A;  5AQC A;  3QPL A;  1NTC A;  2XAG A;  3CMM A;  3E1S A;  5ICF A;  1UI6 A;  5E1Z B;  1O4X A;  1GDT A;  2HVQ A;  1P92 A;  2XVC A;  3QWL A;  2KHM A;  3P9C A;  4Y17 A;  5K58 A;  1IDZ A;  2WY8 Q;  3OR2 C;  5CVJ A;  3E5X A;  4BJ5 C;  5K5Q A;  2Z16 A;  4PGH A;  3CCM I;  2ZSH B;  1Q1V A;  2E7X A;  1IN4 A;  4FE7 A;  4DNC A;  1MBH A;  2OAZ A;  1AU7 A;  1K61 A;  1MBE A;  3QBM A;  1XGM A;  1I1S A;  2E5Z A;  4CZC A;  1CF7 B;  1N78 A;  1TBX A;  2LC2 A;  2FBQ A;  2DN0 A;  4M3D A;  2Z33 A;  3EYI A;  4GGG A;  3FM3 A;  3GBG A;  5J8C A;  3G1M A;  1KU7 A;  5IYB J;  2XGD A;  1LQ1 A;  1FTT A;  1B9M A;  2E2I J;  1TNT A;  3PUB A;  2KRF A;  2KL4 A;  2WB1 N;  1YTY A;  4JKZ A;  4HSR A;  1J7K A;  1IUF A;  1JTY A;  5H20 A;  4HA8 A;  3ZMU A;  4KYW A;  2K86 A;  4PXI A;  1QVT A;  4DBR A;  4AD9 A;  1W4M A;  1XN7 A;  2RKH A;  4PZJ A;  1BI3 A;  4OIQ F;  4YEJ A;  1ZAO A;  2NNN A;  3EUH C;  4CCN A;  3IKT A;  2OTL I;  4JYK A;  4A6E A;  4KT6 A;  3WU1 B;  2GA2 A;  3BTJ A;  4LLG F;  5K1Y A;  2DA5 A;  3VOD A;  2A6E F;  1Z7U A;  2OV7 A;  1U6G A;  2FML A;  2QSH X;  5FKO A;  2F4I A;  3CZ6 A;  4XN0 A;  1UB9 A;  2CRG A;  3FIS A;  2H6B A;  2REK A;  5D1R A;  4L62 A;  4RGS A;  3GTK J;  4A5N A;  4BBS J;  3L1P A;  4MQ9 F;  2CQX A;  2R7S A;  2HYG D;  5KK1 A;  2KDZ A;  3M8F A;  2CW7 A;  3CCR I;  5DAJ A;  1FBU A;  4KIG A;  2XDV A;  2BW3 A;  3I64 A;  2IW5 A;  3SWH A;  1TWA J;  2EJR A;  3S3M A;  2TCT A;  4L9N A;  1K6O A;  4DQ2 A;  1I5Z A;  4AM3 A;  3OYA A;  5D6F A;  2DMP A;  2WV0 A;  4RB0 A;  2JVH A;  3MWM A;  2H09 A;  4GFK A;  3NNR A;  3LNQ A;  2CFX A;  4JP0 A;  2ZCX A;  5HNH A;  5DM6 F;  4QPQ A;  1Z6T A;  3ZXS A;  5KCM A;  4XLA A;  1ZGJ A;  2HNH A;  2DOD A;  2M7B A;  1ZRD A;  3V7C A;  2EFP A;  2XIG A;  2RRE A;  1TW3 A;  2V9P A;  4U7D A;  2IU5 A;  1QU3 A;  3KP6 A;  3L9F A;  4O5V A;  5FLV A;  5D4S A;  1OR7 C;  3DPJ A;  2K02 A;  2UXX A;  1A6I A;  3J7Y J;  2XF5 A;  5DUI A;  3A01 B;  1MSE C;  2GBY A;  1FP2 A;  1T0F C;  4CYC B;  4WX9 A;  2DCE A;  2V1N A;  1SAX A;  2BYV E;  5E1X A;  3E6C C;  4IZZ A;  1V4R A;  2XF6 A;  1IJW C;  3KYC B;  1FYK A;  2MYS A;  4OIO F;  4G7O F;  3HHH A;  2X6Y A;  5DM7 F;  2H1L A;  3KEY A;  1LVK A;  1O7L A;  3LMM A;  1CGP A;  4U9L A;  2V1D A;  4ENM A;  1B72 A;  4W97 A;  1SD6 A;  2GXA A;  3AG2 H;  3HJE A;  1D8K A;  3C2H A;  1JHF A;  1R36 A;  4RA2 A;  3AL0 B;  2EQR A;  3TW7 A;  1AHD P;  1WJD A;  1IRZ A;  4JNN A;  3PM1 A;  1UG2 A;  2DFF A;  1P7I A;  1MD0 A;  2V26 A;  2LKX A;  2RGV A;  2OQR A;  4HEA 2;  2LF7 A;  3WGH A;  1WCM J;  2CV1 A;  2CU7 A;  4RLQ A;  2NRA C;  4BDZ A;  1MSF C;  4CH7 A;  1PP7 U;  3WTY C;  1TWC J;  2M87 A;  1QHG A;  1MMA A;  2DG7 A;  4NC7 A;  1RR8 C;  4XR6 A;  5LFA A;  2XHK A;  4LGW A;  2Q2E A;  3PFY A;  5FFZ A;  5D5X B;  4X1E A;  3OIQ A;  1QHH D;  4B09 A;  1R6R A;  3QPH A;  2QQ8 A;  4ZJZ A;  3H9G A;  2MGQ A;  1HKS A;  4ANJ A;  4RM2 A;  2JWT A;  4RGR A;  1SC7 A;  2EIL H;  1LNW A;  2X85 A;  2KIQ A;  1FOW A;  2MBF A;  2G7U A;  1Z05 A;  4UUS B;  1U8B A;  2NXN B;  2IA1 A;  5AIP A;  2FU4 A;  3NRG A;  4JBA A;  3LSJ A;  3RYR A;  4JX4 A;  2PQ8 A;  1U9N A;  2JK3 A;  2OA4 A;  1DGW Y;  3ERE D;  3CC2 I;  2HKU A;  2XAF A;  4AF5 A;  3VTI A;  3F8M A;  3PUF A;  3OYG A;  3FXR A;  4ZTF A;  3KP7 A;  4XRF A;  1KGS A;  2RNG A;  2XPU A;  4Y15 A;  3K1P A;  1BIB A;  3LFK A;  2HWV A;  3GF2 A;  1VQ8 I;  1WSU A;  1S7A A;  3GVA A;  1GXQ A;  3FHZ A;  2M0C A;  4XRM A;  1Z67 A;  5HDG A;  2P4W A;  3CCJ I;  3A0H C;  2XC7 A;  1JKO C;  2VJI A;  1JT6 A;  4M9S A;  4EJW A;  3JSP A;  1PUE E;  1IXR C;  3HC7 A;  3HXL A;  1D8J A;  4HV6 A;  5EZG A;  2CQN A;  4UVB A;  2QA4 I;  3HHG A;  5L3F A;  2XUB A;  3BJO A;  1NG6 A;  4XOT A;  4EJO A;  5C3E J;  1DUX C;  1SVM A;  4HF0 A;  4D9J A;  1N25 A;  5EF6 A;  1ZAR A;  2QF7 A;  2VL8 A;  1K4T A;  2RAS A;  3B73 A;  2OER A;  2AQE A;  3P5J A;  4PJN A;  2H8W A;  2VT3 A;  4KA4 A;  2IGO A;  5CVI A;  1ZHF A;  1KQ9 A;  1JJ8 C;  1PVE A;  1U5T B;  1RET A;  4XKC A;  3FF5 A;  2FOW A;  2GA1 A;  3WU2 C;  2BHY A;  5KHD A;  3HOY J;  4AVZ A;  1H88 C;  3TP3 A;  5ICE A;  2W7N A;  4IOA F;  1FMV A;  2GQQ A;  3QPS A;  3JAM Z;  3L2V A;  2PJR B;  4KIS A;  2OQG A;  1R7J A;  2KIS A;  3F6O A;  3KKD A;  3OY9 A;  1H9T A;  3W6K B;  1K4S A;  1I39 A;  3CWR A;  3JRE A;  2A61 A;  4M6X A;  1X1C A;  3SDG A;  2WBM A;  4BE2 A;  1ZRC A;  1O3T A;  2HXO A;  4BEH A;  1TQI A;  2E36 A;  2NVY J;  4M71 A;  5GAG J;  3GTQ J;  2A5Y B;  4QWQ A;  2WWY A;  2HOE A;  3F3X A;  5BMZ A;  1MMS A;  3FHN A;  2H6C A;  2IGN A;  2L7Z A;  3QYF A;  2O8K A;  5H2F C;  4A3G J;  2PJP A;  3QYB A;  3ZQI A;  3JTG A;  2CQK A;  3VWB A;  2DTR A;  2XRN A;  4Y52 J;  2XAJ A;  4RMN A;  4U87 A;  4UV8 A;  2KZG A;  1G3Y A;  1B8I B;  2XF7 A;  1ZTR A;  1HBX G;  1CQT A;  1QPI A;  3VB2 A;  3S3O A;  2F5F A;  4A3J J;  3H0D A;  4G8X A;  1HKT A;  1P4W A;  2YU3 A;  4MEY F;  1HA8 A;  2ECC A;  3G2B A;  4B3X A;  4WIB A;  3RD3 A;  5TRD A;  3RKX A;  2W4S A;  4HZF A;  1QA6 A;  4M73 A;  1WGX A;  2K9N A;  2EFW A;  2EFQ A;  2P7V B;  3DCF A;  3COL A;  2DMU A;  1DDN A;  1D5Y A;  3AL0 C;  5D8L B;  5LHH A;  1DPR A;  2CUF A;  2V9V A;  2ZXH A;  2PLY A;  1KYW A;  2HTS A;  4WWC A;  2HS5 A;  5K7F A;  2FBH A;  2KJB A;  1ACI A;  3L00 A;  1IV6 A;  4AIJ A;  1MDM A;  3W6J B;  4I2O A;  4ZYA A;  1JUM A;  2MD5 A;  1J75 A;  5ED4 A;  2V1X A;  2R7F A;  2CWE A;  3P9K A;  5E18 F;  2JQ7 A;  1SFO J;  3S16 J;  1R4N B;  4A3L J;  2R5Z A;  3BJA A;  4RAY A;  2L0K A;  4HST A;  2OCC H;  3WOD F;  1ETV A;  4LJZ F;  1U8R A;  5KNL A;  2NS8 A;  4RB3 C;  1EH6 A;  2P7C B;  4DZJ A;  3CRJ A;  1ONV A;  2R7Q A;  1YIO A;  5FLX Z;  3ASO H;  1K78 B;  3DBL B;  1MZB A;  5D5W B;  2EIN H;  1WI3 A;  4C3H J;  5BQT A;  2QKL B;  1LDK B;  3L2R A;  2GLO A;  2W25 A;  3HM5 A;  3A03 A;  4G7Z F;  1F4K A;  2DOE A;  3H3V K;  2OBP A;  2ZY9 A;  4LOC A;  3MKZ A;  2QZ8 A;  3B81 A;  1ETO A;  2ISZ A;  4E7S A;  2LRD A;  4FX4 A;  2IS2 A;  4U0W A;  3SEZ A;  3W3C A;  2H94 A;  3PQJ A;  2R3S A;  5DUK A;  1W0U A;  3VUQ A;  1EV7 A;  1RR7 A;  5HNF A;  3ZMZ A;  2L7F P;  4B47 A;  3N05 A;  1W7P D;  1L0O C;  3CUQ A;  2ZNY A;  3QAH A;  2B3W A;  2D1V A;  5K5R A;  1WZ2 A;  2JA7 J;  2UXI A;  2FOK A;  2HXI A;  3GO5 A;  2PMZ N;  1F5T A;  1AOY A;  2Z9O A; 
#chains in the Genus database with same CATH homology
 2FJ1 A;  3GTP J;  5F1J A;  3IV5 A;  2IAI A;  4ME9 A;  2R7Z J;  4V2F A;  1JKP C;  5FGL A;  2LR8 A;  3LWJ A;  4NN1 A;  3MNL A;  2DA3 A;  2HYJ A;  2JA5 J;  3HBL A;  4DZP A;  5EGO B;  1X2N A;  3ZQG A;  2VI6 A;  3S5R A;  2YVH A;  1TC3 C;  4RDU A;  1IGN A;  2UXO A;  1F36 A;  4MFD A;  4D7M A;  2XB0 X;  2HOT A;  2M2E A;  2VKE A;  1A5J A;  3ON4 A;  3HTJ A;  5EYR A;  2KT0 A;  5FJ8 J;  5FKL A;  3G7R A;  5C4X J;  3BHQ A;  5D18 A;  1LFB A;  1ETY A;  4IHX A;  4L5E A;  2IEK A;  5IP9 J;  1VI0 A;  1LFU P;  5CXI A;  3IUV A;  4MLO A;  2CUE A;  3BT9 A;  3BCG A;  1GUU A;  2G7L A;  3RKQ A;  5CXG A;  1F43 A;  3SFI A;  1ORK A;  2XSD C;  5IOZ A;  1XC5 A;  1LE8 A;  2WGB A;  2Y9Z A;  3OSG A;  5IOY A;  1JJ6 C;  1UMQ A;  2EZK A;  2X48 A;  3MVP A;  3BTC A;  3VIB A;  4GCL A;  3ZQL A;  2ZCN A;  4A3I J;  2AO9 A;  1S7E A;  4GFL A;  3VVY A;  3JRH A;  3I4M J;  3QQA A;  1Z0X A;  2HOS A;  4FIS A;  2QWT A;  1PUF A;  4M3G A;  4M6V A;  5M5Y J;  2QTQ A;  2ZCM A;  1ITY A;  2E2J J;  3RH2 A;  4QIW N;  3FK6 A;  5IPA A;  2HYT A;  5C4Y A;  4CGR A;  5EG0 B;  5EFY A;  2ZB9 A;  4MIM A;  4D5F A;  1TWF J;  5DS9 A;  2XGE A;  3HTA A;  3A01 A;  2IBD A;  4DW6 A;  3HIM A;  1NK2 P;  2ZOY A;  3IH4 A;  1VFC A;  3QKX A;  2ID3 A;  1VF9 A;  2R0Q C;  3QPL A;  1NTC A;  3EUP A;  1UI6 A;  2AHQ A;  5AQC A;  1U78 A;  2RHA A;  2VPR A;  1O4X A;  4BY1 J;  2NVT J;  5FMP A;  1GDT A;  4GCT A;  2PBX A;  3LHQ A;  2XPV A;  1EF4 A;  5J1U A;  1X58 A;  5K58 A;  1IDZ A;  1K83 J;  1SAN A;  9ANT A;  1ETK A;  3HTI A;  2DA4 A;  2FX0 A;  2FQ4 A;  2QKO A;  5BNG A;  1QRY A;  1ZGW A;  2GM4 A;  2EBI A;  1R9T J;  4BKX A;  1BL0 A;  2V57 A;  3O60 A;  1Q1V A;  1U9O A;  3ON2 A;  4FE7 A;  3O8H A;  1MBH A;  3BR0 A;  3CMY A;  5E3L A;  1K61 A;  1AU7 A;  3FRQ A;  1MBE A;  4J19 A;  3QBM A;  3RZD J;  4GCK A;  5E3M A;  3B6A A;  3Q3S A;  1POG A;  3K2A A;  5F04 A;  3VP5 A;  1XG1 A;  2LLK A;  4NDL A;  5FHP A;  2FBQ A;  2DN0 A;  4M3D A;  4HKU A;  1ETX A;  5C44 J;  2LTP A;  2ID6 A;  3GBG A;  3G1M A;  3VW0 A;  5IYB J;  2XGD A;  5IP7 J;  3JRG A;  3HGY A;  2E2I J;  1FTT A;  3PAS A;  3CCY A;  2WB1 N;  2MSY A;  2K9S A;  2H1K A;  4JKZ A;  3K7A J;  5F27 A;  1ZKG A;  3KNW A;  1IUF A;  1FIP A;  1JTY A;  2L9R A;  5FKK A;  3WHB A;  3CJD A;  4BXX J;  2M9H A;  3IH2 A;  5JLX A;  1GVD A;  4PXI A;  1JUP A;  3BR1 A;  3PO3 J;  1QVT A;  4MXM A;  1T33 A;  2R5Y A;  5HAW A;  2DMN A;  3OOU A;  1AKH A;  4D7N A;  1RES A;  4AC0 A;  5F0H A;  2K40 A;  3Q0V A;  1HDD C;  3S1Q J;  3MKL A;  2WV1 A;  4JYK A;  4MK6 A;  3HKZ N;  1DU6 A;  1BA5 A;  3KZ9 A;  3BTJ A;  1WPK A;  2VUM J;  3T6N A;  2DA5 A;  1ZK8 A;  5FKN A;  2E1O A;  3VPR A;  1JKR C;  3C07 A;  1Y1V J;  5FKO A;  2XDN A;  2CRG A;  3FIS A;  3WHC A;  3HOZ J;  2JA6 J;  3E7Q A;  2REK A;  5D1R A;  4L62 A;  3S14 J;  2VKV A;  2X9D A;  4ABZ A;  3GTK J;  3HOV J;  4BBS J;  3L1P A;  2MG4 A;  5IYC J;  3FIW A;  2CQX A;  1OCT C;  2KDZ A;  3A02 A;  2JN6 A;  1IC8 A;  5DAJ A;  1HLV A;  1FIA A;  3BG5 A;  3ZOB A;  3B6C A;  1TWA J;  4G12 A;  1APL C;  2TCT A;  4A3K J;  4I76 A;  2M8G X;  3DEW A;  2COB A;  3BG9 A;  4DYQ A;  1SGM A;  4B3A A;  2P81 A;  2DA6 A;  4FE4 A;  4ICH A;  4JL3 A;  1ZR2 A;  2DMP A;  3O8G A;  1GT0 C;  4BBR J;  4JX5 A;  4GFK A;  3NNR A;  3LNQ A;  4JP0 A;  2DA2 A;  2ZCX A;  3BR3 A;  1I50 J;  3BTI A;  4MFE A;  4ACI A;  4I6Z A;  4IEJ A;  1W0T A;  3NAR A;  2ME0 A;  3VW2 A;  1VND A;  2DG8 A;  1H8A C;  1FTZ A;  2LD5 A;  3V78 A;  3NXC A;  1ZR4 A;  3HOW J;  3VW1 A;  4YZE A;  3F0C A;  2NOG A;  2IU5 A;  2LP0 A;  3NI7 A;  3HB9 A;  5FLV A;  2K9Q A;  3TED A;  4DYC A;  1MBF A;  3DPJ A;  3BR2 A;  1A6I A;  1MNM C;  3A01 B;  2LY9 A;  3ZQC A;  2RAE A;  3W6V A;  1MSE C;  2GBY A;  2GUH A;  4CYC B;  3E7L A;  5JLW A;  3GTM J;  1GV2 A;  3ANG A;  2UXP A;  1IJW C;  3S15 J;  4GFB A;  1YRN A;  3OSF A;  3BR6 A;  5DTD A;  2X6O A;  4QTR A;  2QOP A;  4V2G A;  3JR9 A;  1B72 A;  4W97 A;  5J1R A;  2Y0S N;  2Y2Z A;  3NAU A;  2MW8 A;  3RQI A;  2R5Z B;  2NP3 A;  4A3F J;  2EQR A;  5M5W J;  3BQY A;  3TW7 A;  1AHD P;  3LSP A;  1H89 C;  1RKT A;  1IRZ A;  3IH3 A;  4JNN A;  3PM1 A;  2EH3 A;  1UG2 A;  1P7I A;  5GP9 A;  2LKX A;  3NPI A;  1JT0 A;  1WCM J;  2CU7 A;  2NS7 A;  2D6Y A;  2OPT A;  1MSF C;  1B8I A;  1BW5 A;  1UHS A;  5FKM A;  2XGC A;  2NVX J;  1TWC J;  2HQ5 A;  2DG7 A;  1MBJ A;  1OCP A;  2ME6 A;  4M3E A;  4X1E A;  4B1R A;  5EEA A;  2LK2 A;  2GFN A;  2R5Y B;  1AKH B;  2MGQ A;  1BW6 A;  1TWG J;  5EG0 A;  3D1N I;  2JWT A;  2W48 A;  2DTZ A;  4XK4 A;  2FD5 A;  1I3Q J;  1GV5 A;  1OFC X;  2QIB A;  4UUT A;  2OF7 A;  3EGQ A;  1U8B A;  5EZH A;  3ZQH A;  4UUS B;  4RBO A;  4IHY A;  4AC6 A;  2G0E A;  4S0H B;  3NRG A;  3LSJ A;  4A3E J;  3GTJ J;  4JX4 A;  2CQQ A;  1WH7 A;  2R93 J;  2HKU A;  1U9N A;  2JK3 A;  4AF5 A;  3JRC A;  2XRL A;  1WH5 A;  3VOK A;  3Q0W A;  2XPU A;  3GZI A;  1JUS A;  3JRA A;  2GEN A;  2W53 A;  1HF0 A;  4FCY A;  3FKI J;  2Y31 A;  1ETQ A;  3HEF A;  5J3L A;  3VOX A;  1Z77 A;  2M0C A;  1T56 A;  4XRM A;  1FJL A;  1JKO C;  1JT6 A;  3JSJ A;  3MN2 A;  2JMW A;  3BRU A;  4MO7 A;  3S2H J;  5EZG A;  2TRT A;  2E2H J;  5C3E J;  1IDY A;  2O7O A;  4M3B A;  5EF6 A;  2QF7 A;  2ELK A;  2DMT A;  3C2B A;  5K7Z A;  2NVQ J;  1UI5 A;  2RAS A;  5J1Y A;  2I10 A;  3S17 J;  2OER A;  2YS9 A;  3JRD A;  2JJ7 A;  1JJ8 C;  3SJM A;  2CJJ A;  4B4C A;  2HDD A;  3HDD A;  1RET A;  2EZI A;  2D5V A;  3TP0 A;  1RPW A;  3BNI A;  5H9T A;  3KKC A;  4XRS G;  2WUI A;  3HOY J;  1LE8 B;  4A3C J;  1H88 C;  2UXU A;  3TP3 A;  3GEU A;  3HE0 A;  3GTL J;  1X2M A;  2M34 A;  4HNV A;  1RKW A;  2DA1 A;  3QPS A;  3S1M J;  5C4J J;  3JRI A;  2LFB A;  4AYB N;  3ANP A;  1JGG A;  3KKD A;  1OJL A;  3GTG J;  3RZO J;  2L7M P;  3F1B A;  5F0C A;  5HBU A;  3CWR A;  3JRE A;  3SDG A;  1HDP A;  1PUF B;  4C3J J;  3HOU J;  3CDL A;  4AUX A;  4IHV A;  1YRN B;  2G7S A;  2EZH A;  4XRS A;  2HXO A;  1MBG A;  2NVY J;  3GTQ J;  1I6H J;  2NX4 A;  2NP5 A;  5EGO A;  3I4N J;  1ENH A;  1B72 B;  1NK3 P;  2PZ9 A;  2L7Z A;  3BR5 A;  2O9L A;  5K7H A;  2O8K A;  2R92 J;  4A3G J;  3LJL A;  3ZQI A;  1JTX A;  4XID A;  4EEF G;  1G2H A;  3LOC A;  1MH3 A;  3PO2 J;  4Y52 J;  3M3Y J;  3S2D J;  3BJB A;  3HTH A;  3G56 A;  2G3B A;  5FLM J;  1B8I B;  1ZTR A;  5F08 A;  4DYR A;  1CQT A;  1QPI A;  5E3N A;  2EZL A;  3G1L A;  4A3J J;  2N8G A;  2YUS A;  2JA8 J;  4FTH A;  2G7G A;  2ECC A;  3BG3 A;  3JRF A;  3RD3 A;  3H0G J;  3LSR A;  3OIO A;  3BQZ A;  2QCO A;  3PPB A;  1WGX A;  2K9N A;  3VVZ A;  1DU0 A;  3DCF A;  5GPA A;  3COL A;  2DMU A;  1D5Y A;  1ZQ3 P;  3S1N J;  4XIC A;  2CUF A;  4CYC A;  3CQZ J;  2B63 J;  2ECB A;  3Q0U A;  2OI8 A;  2WAQ N;  4A3M J;  5K7F A;  2O7T A;  2HOA A;  1IV6 A;  3V6G A;  4A93 J;  5M3F J;  2DA7 A;  2YVE A;  2YU9 J;  4C2M J;  1XS9 A;  1HOM A;  5F0F A;  1JUM A;  4M3F A;  2HI3 A;  1JKQ C;  5GPC A;  3S16 J;  1SFO J;  4A3L J;  2R5Z A;  3AQT A;  2XB5 A;  4W1U A;  2XPW A;  5IYD J;  2L0K A;  3GTO J;  2E19 A;  1ETV A;  3CRJ A;  4JX6 A;  2NS8 A;  4DZJ A;  4C3I J;  4Y7N J;  2Y30 A;  1P7J A;  5M5X J;  5E3O A;  4D5C A;  5D19 A;  5HSZ A;  2DMQ A;  4A69 C;  3UKG A;  3AQS A;  5IP6 A;  2Q24 A;  1MBK A;  1FEX A;  1WI3 A;  4C3H J;  2UXH A;  5CW8 A;  3ZQF A;  1ETW A;  2GLO A;  1MH4 A;  3HM5 A;  3A03 A;  3H3V K;  3BTL A;  3M4O J;  2DJN A;  4LOC A;  5HOD A;  3G1O A;  3B81 A;  1ETO A;  5M3M J;  4QSH A;  4X6A J;  1BJZ A;  2H8R A;  1HCR A;  1Y1W J;  2ZOZ A;  3VVX A;  4A3B J;  3HOX J;  4NEL A;  3LSG A;  3HGG A;  1W0U A;  3VUQ A;  3JRB A;  1RR7 A;  1E3O C;  2L7F P;  3TW6 A;  4IHW A;  2F07 A;  4UUS A;  1TWH J;  2Y9Y A;  3FK7 A;  2JA7 J;  3S1R J;  3P9T A;  2UXI A;  1QVU A;  2HXI A;  4UDS A;  4KWA A;  4BY7 J;  2PMZ N;  4A3D J;  1IG7 A;  5EDN A;  2LVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...