3HGGA

Crystal structure of cmer bound to cholic acid
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: Crystal structures of CmeR-bile acid complexes
rcsb
molecule tags Transcription
total genus 76
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hggA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hggA02
4J19A 3S2DJ 1QPIA 3NRGA 4AYBN 4LOCA 4BBRJ 4D7MA 3RKQA 4DW6A 5FHPA 4S0HB 1TWCJ 1VFCA 1QVTA 2HYTA 3MNLA 1U9OA 2LTPA 2NVQJ 1MSFC 1VNDA 5M3FJ 5EGOA 1T33A 2DA2A 4GCTA 3CMYA 3QPLA 2NP3A 2NOGA 2CJJA 5EEAA 2RASA 2W53A 3HOXJ 4IHWA 2Y9ZA 5JLWA 2JA6J 1BW6A 2G3BA 2OPTA 1JT6A 1ENHA 3V6GA 3ZQGA 3NXCA 4L5EA 3E7QA 2JN6A 4XRSG 4ABZA 3GBGA 5M3MJ 4JKZA 4FTHA 3FK7A 2O7TA 4KWAA 2GM4A 2CUFA 4MK6A 3CDLA 4CGRA 3PPBA 1VF9A 3GTMJ 2MSYA 1MBJA 2HI3A 3SJMA 4QIWN 3BQZA 2R5YA 4YZEA 3BR1A 4BY7J 3TEDA 1ZQ3P 4BBSJ 3H0GJ 3BRUA 4ME9A 3BR2A 1OCPA 1T56A 1Z0XA 1XC5A 3HE0A 3KNWA 2XSDC 1SGMA 2EZIA 2TCTA 2FBQA 5FGLA 4Y7NJ 2R5YB 5C4YA 4UUTA 2G7LA 2HOTA 2WGBA 5IP9J 2O8KA 3F1BA 4IHXA 3VUQA 1LE8A 5FLMJ 4C3JJ 5GPCA 1UI6A 4XRMA 1TWGJ 2UXHA 2EZKA 4B3AA 4IEJA 3QKXA 1LE8B 1AU7A 1U9NA 3BHQA 4A3DJ 2Y31A 1W0UA 5HAWA 4XICA 2JMWA 2DJNA 1H8AC 1TWHJ 2L0KA 4NDLA 2CU7A 9ANTA 4X6AJ 1ETOA 1BJZA 1LFUP 1IC8A 4A3FJ 2X48A 2E1OA 1NTCA 1JUSA 3RD3A 2KDZA 2XDNA 1CQTA 1QVUA 4FCYA 1GT0C 3BTJA 1B8IA 1W0TA 3CJDA 5DAJA 3BG9A 2QF7A 5IP7J 3NARA 2HQ5A 5FJ8J 2NX4A 3ANGA 2Q24A 5F1JA 1TWFJ 1ETQA 2DA4A 1B8IB 3S1QJ 3L1PA 4L62A 4XK4A 2JWTA 1NK2P 3ANPA 3HOVJ 3ZQCA 4AC6A 4A3KJ 4IHVA 1UI5A 2ZOZA 3LJLA 4M3DA 2HOSA 5JLXA 4GFLA 2LD5A 5DTDA 3H3VK 1ETXA 2N8GA 2F07A 1Q1VA 1IG7A 2JA7J 2XPUA 5IYBJ 3RZDJ 2FD5A 5F27A 2UXUA 1POGA 5C3EJ 4IHYA 3GTOJ 2P81A 4M3BA 1RESA 2IEKA 3HKZN 2LFBA 4AF5A 1S7EA 1MH3A 4D5FA 2LP0A 3WHCA 4FE4A 1A6IA 1WH7A 3RQIA 4C2MJ 4V2FA 4A69C 1PUFB 3CWRA 1JGGA 3BJBA 4JYKA 5M5WJ 1FJLA 3HDDA 2NVTJ 3AQSA 3HGGA 2FQ4A 1XS9A 2R5ZA 3ZOBA 5C4JJ 1MH4A 3HEFA 3DCFA 5C4XJ 2DMUA 4DYCA 2HXOA 2MGQA 4GFBA 1RR7A 3D1NI 2XPVA 1ZTRA 1HOMA 2GENA 5M5XJ 3CRJA 5EZHA 4D7NA 2R5ZB 4A3JJ 2QTQA 4HKUA 2K40A 2WUIA 3BTIA 3MKLA 3B6CA 1MNMC 2E2HJ 1GVDA 2WV1A 3A01A 1APLC 3CCYA 5EG0B 2ZCNA 5IYDJ 2ZB9A 3OSGA 3PO3J 2L9RA 3BT9A 1UHSA 2LR8A 2YVEA 5E3MA 1OJLA 2QCOA 3Q3SA 3IH4A 2QWTA 3LSGA 3A01B 1ZR2A 5EFYA 4G12A 2H8RA 3S14J 2CQXA 3UKGA 4JL3A 3ZQFA 4M3GA 2PBXA 5J1UA 1F36A 3WHBA 2ZCXA 2DMTA 3QPSA 5EDNA 5K7ZA 2OERA 4EEFG 2Y0SN 3GTJJ 3ON2A 5BNGA 1D5YA 2QIBA 3LHQA 3ZQHA 5GP9A 3IUVA 2LY9A 4UDSA 5J1YA 1Y1WJ 2M34A 2DA5A 4I6ZA 5M5YJ 5E3OA 2PZ9A 1F43A 1GV2A 1ZR4A 2H1KA 1ETWA 5D18A 2AHQA 3BQYA 1TWAJ 3O60A 5IOZA 5FKOA 4MIMA 2ID6A 3HOWJ 3VVZA 2EQRA 1K61A 2WB1N 2ME0A 2B63J 3GEUA 3F0CA 1AKHA 2W48A 2GLOA 2R0QC 1JJ6C 2IU5A 3MVPA 5E3NA 2LK2A 4GCLA 5EYRA 5EZGA 1MBGA 3JRIA 5D19A 5IP6A 1AKHB 3EUPA 1ZK8A 1IUFA 1IV6A 1QRYA 3S5RA 2K9QA 2ME6A 4NN1A 1I50J 4BXXJ 5IOYA 3HTJA 3HBLA 3DPJA 3NNRA 3LSRA 3M4OJ 5FLVA 4M3FA 3FRQA 2ELKA 3O8GA 3A03A 1HDDC 1VI0A 2V57A 2REKA 3FKIJ 5C44J 1FEXA 1MBEA 4CYCA 3VW2A 3S15J 3S2HJ 3G1MA 5F0CA 2CUEA 3JSJA 1RKTA 5IPAA 4GCKA 3LSPA 5K7HA 3BG3A 4ICHA 1JUPA 2DA1A 3LWJA 2O7OA 4CYCB 3IH3A 2VUMJ 4A3MJ 4JX4A 3NI7A 3VIBA 2UXIA 4V2GA 3B81A 2COBA 5FKNA 1RPWA 3Q0WA 2GFNA 3PASA 4JNNA 2G7GA 5FKMA 1JKQC 2X9DA 2M9HA 2DMPA 4W97A 1BL0A 3FK6A 1O4XA 1EF4A 3BNIA 3G1LA 2RHAA 4X1EA 2MG4A 4C3HJ 2RAEA 2D5VA 3GTGJ 2WAQN 3VOXA 2XGEA 3VOKA 4A3EJ 4A93J 2DTZA 2M2EA 3BR0A 1PUFA 3PM1A 4XIDA 3CQZJ 1P7IA 5IYCJ 3IV5A 2DA7A 2AO9A 2NS7A 1HCRA 2EH3A 2Y9YA 5FKLA 1DU0A 4FISA 2XB5A 1JKOC 3V78A 4HNVA 4UUSA 1A5JA 2JJ7A 2IBDA 3HOZJ 2X6OA 2XRLA 2EZHA 3SFIA 4D5CA 2LKXA 4PXIA 3AQTA 4MO7A 5D1RA 4A3GJ 5EG0A 2ZOYA 2L7ZA 5J1RA 4QSHA 4UUSB 3JRDA 3JRBA 2HDDA 3KZ9A 2QKOA 3GTQJ 2DG8A 1LFBA 2FJ1A 3DEWA 1SANA 2NP5A 3COLA 5J3LA 3BTCA 2GUHA 2M8GX 3K7AJ 5F0HA 2VI6A 1H88C 3BTLA 5AQCA 3TW7A 2VKEA 1MBHA 2TRTA 1I3QJ 1FTTA 3G56A 3SDGA 2R7ZJ 3TP3A 4A3CJ 2HXIA 3FIWA 2E2JJ 1WH5A 2KT0A 2EBIA 3HOYJ 2HKUA 2OI8A 1GV5A 5HODA 1HLVA 3M3YJ 4Y52J 3HM5A 2JA8J 1ETKA 3VW1A 5CXIA 5K58A 3JREA 4M3EA 3TP0A 4AUXA 3HTIA 4C3IJ 4MLOA 5F08A 1FIPA 2OF7A 5DS9A 4A3LJ 1IDZA 1OCTC 1JJ8C 1U78A 2XGDA 2UXOA 4XRSA 2K9SA 2EZLA 2CRGA 3P9TA 1IRZA 3EGQA 3K2AA 3JRFA 4DYQA 3S17J 1UG2A 1ZKGA 3ON4A 5FKKA 1JKRC 2XGCA 3LNQA 4JX6A 2YU9J 2YS9A 4QTRA 5EGOB 3S16J 3C07A 3VVYA 1H89C 3VPRA 2NVYJ 2L7MP 3W6VA 1B72A 1JUMA 2M0CA 1WI3A 2E2IJ 1WGXA 2R92J 3Q0UA 4GFKA 1XG1A 3S1RJ 3GTPJ 3HTHA 4RDUA 1IGNA 4NELA 1B72B 3E7LA 1X2MA 2GBYA 2Y30A 3GTLJ 1R9TJ 3TW6A 5HBUA 4ACIA 1BA5A 2DA6A 2Y2ZA 1YRNA 1AHDP 1WCMJ 3BR5A 4B4CA 3ZQLA 1E3OC 3G7RA 3KKCA 1ETVA 5HSZA 3OSFA 2HOAA 4W1UA 1IDYA 3Q0VA 5F0FA 3JRAA 1YRNB 2VPRA 1JTYA 1X2NA 1IJWC 3I4MJ 3S1NJ 3JRHA 2PMZN 1HDPA 3I4NJ 2ECCA 3NAUA 1SFOJ 2YUSA 3FISA 1HF0A 2LLKA 4JP0A 5CXGA 3JRGA 1ZGWA 3NPIA 2VKVA 2K9NA 2XB0X 3B6AA 4A3IJ 4DYRA 1BW5A 3MN2A 4M6VA 3RZOJ 5FMPA 5H9TA 1JT0A 1U8BA 4FE7A 1I6HJ 3BCGA 2R93J 3T6NA 1DU6A 1NK3P 2O9LA 2L7FP 1X58A 3O8HA 3HIMA 3VVXA 1MSEC 3S1MJ 3JRCA 1ITYA 2YVHA 1FIAA 2MW8A 4B1RA 1ORKA 1MBFA 4A3BJ 1MBKA 5EF6A 2DG7A 4RBOA 2DN0A 2FX0A 3BR6A 1RKWA 5F04A 1OFCX 1GDTA 2G0EA 3VW0A 3HOUJ 2G7SA 3RH2A 1WPKA 2HYJA 2DA3A 2IAIA 1K83J 1TC3C 3VP5A 3ZQIA 5E3LA 1Z77A 1RETA 1P7JA 2JK3A 4BY1J 2ECBA 2LVSA 3BR3A 3BG5A 4MXMA 3HTAA 1Y1VJ 1JKPC 3GTKJ 5CW8A 1UMQA 3G1OA 1GUUA 4BKXA 4MFDA 1FTZA 2DMQA 1ETYA 2XPWA 4DZJA 2DMNA 3IH2A 4AC0A 2D6YA 3HB9A 3C2BA 3OOUA 5GPAA 2E19A 1JTXA 2QOPA 4I76A 4DZPA 2JA5J 3GZIA 2ID3A 1G2HA 4MFEA 3PO2J 3OIOA 3KKDA 3QBMA 3A02A 3HGYA 2UXPA 2NVXJ 3JR9A 3LSJA 2ZCMA 2I10A 3LOCA 2CQQA 4JX5A 5K7FA 3QQAA 2NS8A
chains in the Genus database with same CATH superfamily
3H92A 1QPIA 5GAEJ 2Q0OA 4RAGA 2Y75A 4S0HB 3LAPA 1QVTA 4A12A 3DKXA 1VQ9I 3JSOA 5KAFC 4E7IA 1KONA 1UELB 3L2CA 1FWZA 2NVQJ 3WGHA 2DA2A 2HTJA 3GXOA 3SDBA 2V9PA 1UG0A 2CJJA 1XX5A 4EM1A 3O6BB 1R49A 4I7HA 3QYEA 2OPTA 2FBIA 1E3HA 5ILUA 1LDJA 1XDSA 5H2FC 4ABZA 3FXUA 1TQPA 4RGRA 2QQAA 3WE3A 2W24A 4ON0A 4FTHA 1ZG1A 1IRXA 3JCUC 2GM4A 2BZTA 2MSYA 1IXCA 2M1BA 4E70A 2L54A 4ME9A 3H0GJ 2HFHA 2KIQA 1LNWA 2LH9A 1T56A 2KRHA 3BR2A 2OJED 3I3LA 4WXHA 3U9GA 1ZRDA 1U5TC 3F23A 3CJNA 4B44A 1UCRA 2VB6A 4UVAA 2DT6A 4YIIA 2VQCA 5ERIA 4L0ZB 3OYGA 2O0YA 2M30A 2VBWA 1FT9A 3MZ8A 1F9NA 1O3RA 1F1ZA 3TGNA 4CYDA 4IVNA 3VYTB 1VQOI 2C6YA 4F3QA 4ZDLA 4A3DJ 1I3AA 2L2OA 1FC3A 1W0UA 2QENA 1LFPA 4NDLA 1KYWA 1XTAA 1LFUP 1BJZA 2E1OA 1Y0NA 5CKTA 2Y0MA 1GXPA 1AA7A 2JUGA 3F8FA 2LRDA 1J5YA 1S5LC 5DAJA 1JGSA 4XKCA 2CGPA 3PIOF 5IP7J 4KT6A 3D5SC 3IAS2 5FJ8J 2NX4A 5DV5A 1EV7A 2OUMA 3KZYA 3MKZA 3HKZA 1B8IB 2STWA 2ZFWA 2HPIA 1QHGA 2KIFA 2JWTA 1X19A 1HC8A 4HRIA 1U5TA 4F91B 2XIGA 4M3DA 5DD4A 2Q2EA 1R5ID 2LD5A 2WAFA 3H3VK 2N8GA 1N75A 5F27A 1POGA 3M8JA 5C3EJ 2HVQA 1R4MB 1ZRFA 1DPRA 4L5IA 3OYFA 4AF5A 2FEZA 1W1WE 4D5FA 2A68F 3RQIA 3HSEA 3ERED 1VQ7I 3QPHA 2B0LA 1JGGA 2FRHA 4JYKA 1FJLA 1Z1DA 3AQSA 4DQ2A 1UJ8A 2FQ4A 1XS9A 2PI0A 2R5ZA 3ZOBA 2KIUA 3CDIA 3N97A 3HEFA 2Q8KA 3G71I 1O57A 4BJ6C 2XPVA 5L3FA 5M5XJ 4YIRX 1HW1A 3P9KA 4D7NA 5E20A 2J5OA 2WUIA 2QA4I 1MNMC 2A6EF 3B6CA 1ON1A 4BEHA 2QYOA 3A01A 1VQ6I 2MABA 1LEAA 4TV7A 2ZB9A 2A6TA 3PO3J 1PDNC 3CO6C 1UHSA 2HNHA 3M07A 1OJLA 3IC7A 3Q3SA 6PAXA 2RDPA 2H8RA 4E7SA 2F4MB 3UKGA 3RTRA 3ZQFA 4M3GA 3KEOA 3CTAA 1F36A 2L3DA 4NB5A 2DJIA 4IO9F 2ZCXA 3QPSA 4RA2A 4GYIA 4KISA 1S72I 1RRJA 4CCOA 4RB0A 4EEFG 1SFUA 1BJAA 3RDIA 3ON2A 1D5YA 2QIBA 3LHQA 1ZARA 3ZQHA 5HDGA 2B9SA 4UDSA 2CV0A 2M34A 4RGUA 1HBXG 1FYMA 1F5TA 5M5YJ 5E3OA 2VBXA 4HAMA 1GV2A 2KKOA 1GHCA 1VQ4I 4C2MA 2AHQA 5FFZA 3WU0A 5EEHA 4NC7A 4IOAF 3OY9A 4N4OB 2ID6A 2FMLA 3CJTB 1U3EM 3GO5A 4BXUA 1X3ZB 1SFKA 2B63J 3F3XA 3GEUA 4DVYP 4XLFA 3IKVA 3CCVI 2DYRH 3MVPA 4GCLA 5EZGA 1MBGA 1IN8A 1KQ0A 2LF7A 1Y8RB 2JPBA 4CSWA 4U0YA 2CW7A 3EUPA 1IV6A 3MZYA 3P7NA 5LHHA 3S5RA 4B09A 1P4AA 2ME6A 2BW3B 5IOYA 3HTJA 3HBLA 3B02A 2QSFX 2CH0A 3ELKA 3KP3A 4HX7A 5FROA 2ELKA 3O8GA 2FJI1 3CLOA 1IF1A 3EYIA 4OD4A 4EGYA 1FEXA 3VW2A 1MBEA 4CYCA 4RS8A 3DEUA 2FE3A 1BM9A 4A0XA 1QZEA 2WWYA 1R4NB 1K4TA 4JBAA 1C0WA 1ULYA 3CZ6A 3H3ZA 4A3MJ 4JX4A 1X1AA 4PJJA 3E6DA 3TO9A 2DFHA 4ASNA 2G7GA 1JKQC 4OIOF 2DMPA 1LB2A 2OCCH 1P92A 4E6KG 1O4XA 3G1LA 2CWEA 4WIBA 1WQ2A 2BY0A 1BI2A 1RZ4A 2DOFA 4Q4ZF 2K5CA 1RC9A 4Y13A 2D5VA 2M4KA 4Y17A 1OISA 3ZPLA 2XGEA 3DPTA 1YW7A 5B5EC 3HRTA 1SMYF 3VOXA 2M2EA 3J81Z 1PUFA 4OINF 4NBQA 3E3VA 3CQZJ 3CC4I 2DLLA 2NS7A 3TMOA 2LBFA 4PFOA 4UUSA 4CZZA 1MDMA 1A5JA 2EV6A 4RAFA 2XRLA 4O5VA 2W85A 2LKXA 2M45A 2DT7B 3L2QA 3AQTA 5D1RA 3IUOA 4BNCA 4DNCA 3I59B 4U88A 4PJ0C 4PGHA 4CA0A 4DBRA 3K4NA 4AU7A 3KZ9A 3C3WA 2QKOA 2QKMB 5LRSA 2DG8A 1LFBA 3WU1B 1T95A 3LA3A 3MAJA 3PL8A 5J3LA 3K7AJ 3NWSA 5F0HA 2VI6A 5AQCA 3GFMA 3TW7A 1R1TA 1Z3YA 3E97A 4EVIA 2MFZA 3G56A 4IX7A 4M9XA 4CCKA 2HU9A 3ZMZA 4EATA 1WH5A 2KT0A 2EBIA 3ZR8X 3UR3C 4YFNF 1HLVA 1S7OA 1SVMA 1WJFA 1WJDA 3I55I 1ETKA 2IS6A 3GZ6A 1FSHA 2R3SA 3CDHA 3HSRA 2WA0A 3T8TA 3WTVC 1BIBA 3HRMA 3JREA 3TP0A 3K70C 1QGPA 3QP6A 1HKQA 5HNHA 4A3LJ 1FLIA 3H0DA 3U1KA 2XGDA 4PK4A 2LY1A 3MZHA 3PNVA 2H8WA 2JUCA 4LFUA 2EINH 2HKXA 2IA1A 2E34A 1EKEA 5GAGJ 2F5VA 1FOXA 3C07A 1H89C 1EH8A 2YU3A 4LLGF 4OWRB 1B72A 1FNNA 4U0VA 1BBYA 3FXRA 1SD4A 1D3YA 2STTA 2CV2A 2Z2SB 1L3LA 2HDWA 3OIPA 2MBFA 3OS0A 4NELA 1U6GA 2MLGA 2HZTA 2OQRA 1X2MA 2GBYA 2W25A 2Y30A 3GTLJ 4ACIA 1BA5A 4MNUA 1R22A 1YRNA 2K3FA 1AHDP 2X1DA 3VYSB 1WCMJ 4WK8F 1ZN2A 3CJRB 4A6EA 3ZQLA 1XGSA 4YG2F 1ETVA 1UZCA 3QRFF 1VQ5I 2E1NA 2VQLA 4HDUA 1DDNA 3FBIB 2MD5A 2HOAA 2R7RA 4JK1X 3CC2I 1IDYA 3JRAA 3J80K 2PJPA 1IJWC 3I4MJ 1LPQA 2PMZN 4CGZA 2B3WA 1J7KA 5DCMA 1HW2A 1WFXA 4KN7X 3M1CA 4P55A 1SFOJ 1HF0A 3QP5A 1OMIA 1R1UA 2P0WA 2ZSHB 1S3JA 4PGGA 3JAMK 4DYRA 2Q1ZB 4HW0A 2GA1A 4BHPA 3MN2A 3LFKA 4M6VA 5ILSA 4BUPA 4EJUA 1BC7C 2V1XA 2CQNA 4LLLA 2QLZA 4FE7A 4Z2YA 3T6NA 3JTHA 3T0YA 3KP4A 1NK3P 2BHYA 2O9LA 1ZRCA 3ROUA 2X85A 4KA4A 3G73A 4L18B 2CS3A 3OYEA 3FMQA 1YW9A 1FIAA 3MKYB 3PNYA 2L9VA 2ZXHA 4RBOA 3OS2A 4PSXA 3ZMUA 4R1HA 2LG4A 5D6EA 3BR6A 4I01A 1RKWA 4I09A 2ZMEB 4LK1F 2AQFA 2HYJA 1MMNA 5HLHA 3ZQIA 2Y48A 4ENKA 2DK8A 1FOWA 2MC4A 1P7JA 4MXMA 4HDVA 3OYCA 3OYIA 1Y1VJ 4EMSA 4BKXA 5JR3A 2LYCA 1FTZA 1ETYA 1BR2A 1D1AA 3D0SA 2MC3A 3QU3A 2VJ5A 1R5HA 2DDAA 2P5VA 4DZPA 4D9JA 1MIJA 3FXJA 2G9WA 2QZ8A 4CCNA 1N77A 4BS9A 2NVXJ 3CO7C 3JR9A 2HS5A 2PJRB 2ZCMA 3LOCA 2E7XA 3QQAA 2NS8A 3S2DJ 3ECHA 5BPDA 2KRCA 4AYBN 1E3PA 4D7MA 3RKQA 5FHPA 2I5UA 4R79A 1VFCA 3OOPA 3JSPA 2PFBA 3LSTA 4HNTA 3MNLA 2HQRA 4OAYA 4KICA 2YX4A 2IA0A 1X1CA 1Y56A 1VNDA 4BQQA 2F5FA 2QWWA 4U0WA 1T8IA 2R7VA 2NP3A 2ZXJA 5EEAA 2ICWG 2X1EA 4UNOA 5JLWA 2ESHA 2M3AA 2EIMH 3BCAA 3L2RA 2JA6J 3FWEA 2CQKA 1Z3XA 1IW7F 3DTKA 2YSRA 1LEBA 1ENHA 2FA5A 3V6GA 5FD6A 4P9UA 2WY7Q 3ZQGA 3NXCA 3T8RA 5CVIA 5LRRA 5M3MJ 4JKZA 3PJRA 2E1CA 1OCRH 4X0GA 2A69F 5LGTA 1T08B 3H5NA 4V19K 3PPBA 1I5ZA 3LFUA 4MEYF 3K69A 1R5GA 5D8LB 4YZEA 3BR1A 4XKVA 4BY7J 2X6WA 1LQ1A 1YQAA 4UHTA 2VASA 3IP4B 2R7XA 2FBQA 3BZCA 4Y7NJ 3HPHA 2XDVA 4F93B 2EIKH 2G7LA 2V6EA 1S29A 2P4WA 2W82A 2O8KA 4DBQA 2QQBA 5ICGA 1E0EA 3I71A 5FLMJ 4C3JJ 4XSXF 1I27A 5GPCA 1UI6A 3SYTA 5K5QA 2EZKA 5J4YA 2DOAA 3ZXSA 5HNFA 3QKXA 4IEJA 3ABUA 3KYLA 1QO0D 2COMA 1LE8B 1Z9CA 1U9NA 5KNLA 3WG7H 5HAWA 2BY1A 2ZJQF 4HEA2 1H8AC 2DJNA 3TBIA 2CU7A 4AM3A 3HTSB 9ANTA 3CP2A 3KE2A 4F55A 3DTIA 4A3FJ 2X48A 1PUEE 2IS2A 1NTCA 2VJ4A 2XVCA 2ZCWA 3RD3A 4AVZA 2P7VB 2XDNA 1P9QC 5AIQA 4FCYA 1GT0C 3BTJA 1B8IA 4A2UA 2EILH 3CJDA 3K4KA 1T39A 1QU3A 4IKFA 1MD0A 4P9FA 2HQ5A 3ULQB 4BHCA 3CCJI 3LSMA 2R7TA 2CFOA 2BXZA 1OKRA 4HF2A 1X1DA 4BACA 3L1PA 4L62A 3VSLA 5A2QZ 1W4MA 1FBUA 2ZXIA 2DQRA 4AC6A 1MJBA 4AIDA 4A3KJ 4BQAA 4IHVA 4BL0B 4BXFA 2ZOZA 3GLLA 3IL2A 3LJLA 2K7LA 3M8FA 4XN0A 5F1RA 5DTDA 1ETXA 1P2FA 3M7GA 3CD6I 3GCMA 3QOEA 4O3MA 3PUFA 1RNLA 5IYBJ 5IY5H 3RZDJ 1ZGAA 2FD5A 1WJAA 2GQQA 5FD5A 2LC2A 2LKPA 3CUQC 2LP0A 3WHCA 4FE4A 1A6IA 4C2MJ 1J09A 4V2FA 2EK5A 5M5WJ 3HDDA 3I53A 3OYDA 3HGGA 3K70D 1HA8A 4FT8A 2DMUA 3DP7A 4DYCA 1ZG5A 3PQKA 4GFBA 3R61A 3ABLH 1RR7A 4BU2A 4MGRA 1T2KA 2ESNA 1HKSA 1V3FA 5EZHA 3SZTA 5DCFA 4ESBA 1XGOA 2ZO4A 3LSKA 5CPRB 4A3JJ 1XCVA 2VJIA 4PJLA 2IVMA 1W5SA 2E2HJ 2VC0A 2EV5A 1FYKA 4L0YB 3CCYA 5EG0B 2V9VA 4OOIA 4EJTA 3HUGB 3A0BC 4OMZA 1A04A 4L5JA 3BT9A 3BJ6A 2LR8A 2MLKA 4B43A 4YFKF 1Z67A 1YW8A 1HQCA 2XF6A 3IH4A 2QWTA 5EFYA 1RI7A 2RV8A 4G12A 1IN6A 3GF2A 4XKWA 3S14J 2CUJA 2P6TA 3DU5A 2HR3A 5CQGA 4II2A 3I4PA 2PBXA 1U2WA 3WHBA 2M7AA 3PSFA 4M73A 1D0YA 3K4JA 2OERA 2WAEA 2WB1A 5LEKA 3GTJJ 2IA2A 5BNGA 4NC6A 3GUDA 3I54A 2LY9A 1Y1WJ 1YITI 2DA5A 3GZNB 3GVAA 3SHFA 4LG0B 4UV8A 1F43A 1E2XA 3HL2A 2O5RA 1SD6A 3CUQA 3EETA 2H1KA 4MEXF 4LITA 3BQYA 2L4MA 3O60A 2YX7A 3CLQA 2OZ6A 4I02A 4HX8A 2P5KA 1ZYRF 1GLNA 4MIMA 3HC7A 2O61A 2EQRA 1SC7A 1K61A 4ZYGA 3RSNA 3KZZA 2W48A 3JAMZ 3VYRB 1HXDA 2R0QC 4EM2A 2IU5A 2VBZA 3AG3H 3ASOH 2BW3A 3HHGA 2LK2A 5E3NA 4FX0A 4HQMA 4XLCA 1W5CC 5IP6A 2VN2A 4F92B 2V9KA 2VT2A 3A0HC 4BDZA 3TDZC 4FHTA 4KMUX 5KCMA 3HRSA 1I50J 4BXXJ 3QYFA 4RGXA 4U7DA 2CV1A 3NNRA 5HS9A 2DODA 3DTEA 5FLVA 2HYFA 3K1MA 5HS7A 1VI0A 1M1EB 2DT5A 2UUZA 2REKA 3G1MA 1VQKI 2CUEA 1RKTA 5IPAA 4CXFA 2VXDA 5K7HA 4XM3A 3BG3A 4ICHA 2E1MC 4G7ZF 1BN5A 3OYNA 5BS6A 2V7FA 1JUPA 2WAQA 2DBBA 2OD5A 3B73A 3LWJA 3IH3A 3DXJF 2JT1A 1MNDA 3VIBA 3H1CA 5B3SH 5JHFA 4BH9A 3A4CA 5LEJA 2BE5F 5FKNA 3Q0WA 4KIGA 1WI9A 1T98A 5FKMA 2M0MA 2M9HA 4KITB 2AXTC 4EM0B 1P4WA 3MEXA 3E5UA 1X1PA 1BL0A 1JXSA 5H6QA 5IT9K 2RHAA 1PP8F 2NRAC 2DFFA 2XAUA 4X1EA 3IKTA 5LBQA 3V42A 5E1XA 1DP3A 1QZZA 4M71A 3VDXA 1KGSA 3G6EI 4A3EJ 4WCGA 2X6YA 3HXLA 1G3YA 2DFIA 4XIDA 1YO5C 4P5OA 1P7IA 2NVUB 2GIVA 1VQNI 3IV5A 4P96A 2DA7A 2PQ8A 2XF7A 3DBRB 4CCMA 1CF7B 1HSTA 5FKLA 2Z99A 4N4NB 3I59A 4HV5A 1DU0A 2JZYA 2FBKA 1JKOC 5DEQA 3V78A 3M8EA 3EQLF 4G8XA 2JJ7A 2MA3A 2X6OA 3TO7A 3SFIA 1ONVA 3RIRA 1N78A 1WVRA 2ZOYA 5J1RA 5CVVA 4GYGA 3JRDA 3K9TA 4AYBA 3Q9SA 4ZYDA 4RMNA 3OL3A 3MMYB 4ITVA 1W36D 2CUZA 3COLA 3H5RA 3P5JA 3IWFA 3BTCA 4AIJA 2PX9A 1BR1A 1V5GA 4HBLA 2ZJ2A 2VKEA 3EPZA 4KIFA 1MBHA 1I3QJ 3SDGA 1K6OA 1DUXC 4A3CJ 2P5LC 5D4SA 1IO2A 2A3SA 3HOYJ 1IUYA 3E6MA 1WSUA 1STZA 4UXNA 1DGWY 2X4HA 3VW1A 3D5LA 5J40A 2K27A 4CICA 5CXIA 1OQYA 3FZVA 1MMSA 4AUXA 4C2UA 3R0AA 3HTIA 4C3IJ 2YR2A 2UXXA 2KL4A 1OYIA 3QU6A 2F5DA 1IN7A 1X3WB 2CRGA 4FASD 1IRZA 3SWHA 2EIJH 1XB4A 3V4GA 2PMUA 1K4SA 2JQ7A 4LGWA 4MTDA 5FKKA 3ZGKA 4XLNF 2RQPA 4JX6A 2YU9J 1PP7U 3S16J 2ADUA 3VVYA 3W6VA 5DM6F 3C7JA 2BOLA 4RB3C 3CF2A 4H0EA 2WBMA 2E2IJ 3QOPA 1QBJA 1WGXA 3Q0UA 2XGXA 1DPUA 1MMDA 1ZELA 1V4RA 3DFGA 4A0YA 3FM5A 2DW4A 4U9LA 2FXAA 2H27A 5HBUA 1R9TJ 2DA6A 5ILVA 4B4CA 1E3OC 3G7RA 3BZKA 3BOQA 4LB5A 5HSZA 5FRNA 4L9JA 1WWXA 3SFZA 2XF5A 3FMRA 3Q0VA 1FY7A 2Z33A 4BE2A 3ZMVA 4M72A 4OIQF 5FO5A 1KU3A 1X2NA 2IS1A 3C2GA 3S1NJ 3FF5A 2E36A 3SQNA 1G6NA 3LWFA 1WKMA 5ED4A 2HWVA 2VPLA 1I39A 3FISA 3GX4X 1R23A 1WJ5A 4PJNA 4D0PA 4NQWB 1ZGWA 4E7JA 3CUOA 2XB0X 3NPIA 4ZTFA 1ODDA 3TL4X 3COAC 3HHHA 1OCZH 4HLXA 3BJOA 2LREA 1SEUA 3IRQA 4I0AA 3UNGC 2HYGD 4QWQA 3KYCB 1ZLKA 1JT0A 4G6QA 1R71A 3O3KA 3OL4A 1TQMA 3BCGA 2JPCA 3GWZA 4WXCA 3VVXA 4CZCA 1EA3A 3OV8A 3JRCA 1ITYA 2MW8A 3BROA 1ORKA 3RQ4A 4B1RA 1MBKA 5EF6A 4A3BJ 4XSZF 1MW7A 4XKBA 5GTIC 4XLHA 2FX0A 4KNYA 4KT5C 1FBSA 5BMZA 2L7KA 1OFCX 5F04A 1GDTA 2G0EA 3VW0A 3GFJA 1S9HA 3RH2A 4CUGA 2VJJA 1WPKA 1K6YA 2DA3A 1KU2A 1K83J 4Y3OA 3VP5A 5IT3A 2KJBA 5E3LA 2F6CA 1Z77A 3H3UA 4PJMA 1XD7A 5BOXA 2BV6A 3HTAA 1UMQA 2DOEA 3DBHB 3K4MA 4UVBA 5DUKA 2NYXA 3A2KA 1BI0A 2OU2A 1CGPA 2DMNA 3IH2A 3PNTA 4AC0A 3AKZA 3QYBA 2PJRA 3ZQQA 3C2BA 1G4DA 4IHSA 1Y0UA 3CESA 4FQGA 2QOPA 2HZDA 1QA6A 3OR2C 3HSFA 1G2HA 1XMXA 2E71A 4KN4X 2Z1DA 5JVTA 3LSJA 2UZKA 2I10A 2CQQA 3Q5FA 1RUNA 4J19A 3W6JB 3WGGA 1BI1A 3NRGA 4F7ZA 1IAWA 4RB2C 1Y6IA 1YS7A 2CYYA 2D1VA 2HYTA 2DK5A 3ESWB 1U9OA 1SD7A 1DP7P 3BJAA 3KCCA 1MSFC 5M3FJ 5EGOA 4GCTA 1ZH5A 2IGMA 4DJAA 1USTA 3KP5A 1QPMA 1QZYA 4LB6B 3CMYA 2ZFUA 4UB8C 3HOXJ 2Y9ZA 3U2RA 3WTSC 2ISYA 2KFDA 1BW6A 2LDUA 3WTYC 2G3BA 5K5OA 1JT6A 1XPXA 4BDYA 2KDOA 1R7JA 2BHZA 4L5EA 3E7QA 2KPMA 3GBGA 3WTZA 1K79A 2KHMA 3KFWX 3FK7A 2O7TA 1BI3A 4MK6A 3CDLA 1TL8A 3GTMJ 1MBJA 2K4BA 2HI3A 1J0RA 2NNYA 1TW2A 3BQZA 1VZ0A 3TEDA 1Z7LA 4XLEA 1AWCA 4BBSJ 2IGOA 4XOTA 1K78B 2XSDC 5TISC 4C9YA 4IQJA 3KP2A 2E5ZA 2EZIA 2TCTA 5KAIC 1SGMA 5FGLA 3KEYA 2XAFA 1T0FC 2R5YB 5C4YA 4UUTA 2QBYB 2HOTA 3F8MA 3CCRI 2M4GA 3VUQA 1LE8A 3HIFA 3LL7A 2X0LA 4FETA 4KFCA 4BJ5C 1TWGJ 2KQRA 4XRMA 3TO6A 2W00A 3DV8A 3ZQ7A 1OCOH 1ZREA 2P8TA 5IT9Z 4B3AA 1W7PB 2DO7A 1AU7A 3ZN1A 3KETA 1HSJA 3F22A 2W1OA 2RQQA 2M5WA 4A5MA 1L0OC 3KP7A 2JMWA 3AG4H 1TWHJ 2FOKA 3F8CA 4U7BA 4GGGA 2ELHA 1FZPB 1ETOA 1IC8A 4RLFA 1JHHA 2QQ9A 2ZKZA 3BWGA 3FX3A 2PLYA 1JUSA 2CSOA 3OWTA 3L7WA 3WTTC 1YHQI 2KDZA 4WXDA 3R60A 2L01A 1FSEA 1XSXA 2A05A 5E79C 4IPAA 3BG9A 2ELJA 1SD5A 2QF7A 3FXKA 2FQ3A 3AFHA 5FGMA 2FNAA 3ANGA 4LJZF 3HOTA 4PZJA 3VB2A 2Q24A 3SZGA 1WHUA 1TWFJ 2DA4A 2CFXA 2O3FA 3S1QJ 3A1YA 4L9NA 3V7CA 4MQ9F 1RUOA 1NK2P 3ANPA 4ZH4F 3HOVJ 3W2WA 2QSHX 3L9FA 1LDKB 1R1VA 4DGWB 5J8CA 1R36A 2K85A 2NOJB 4G94A 1T0FA 3AG2H 2HOSA 5JLXA 5JHUA 3K1PA 4GFLA 4WWCA 1XMAA 3HTUA 4HSRA 2XC7A 2F07A 2D2WA 1IG7A 2VXZA 2XPUA 4YFXF 2PN6A 5DM7F 2W7NA 1OYYA 3PSIA 3GTOJ 3FXQA 4IF4A 1RESA 2IEKA 3HKZN 2LFBA 3LQRA 2H6CA 1WH7A 1YFHA 4HG2A 3VWBA 5L3BA 1AOYA 3BLYA 1PUFB 4UVCA 3KLNA 3BJBA 5D8KB 4OMYA 2RN7A 3P9CA 3DCFA 3KPHA 1OPCA 3RCOA 1YX3A 5D5XB 4AWXB 2VKDA 3N4MA 2ZNYA 3D1NI 4XQFA 1D8KA 2LNBA 2F2EA 1J75A 3FXOA 3HUGA 3VFZA 3K2ZA 4G7HF 2GAUA 2BY2A 1FOYA 2FNPA 2KZVA 1MDMB 4KYWA 1FOKA 4HKUA 4I0BA 2VT3A 3IWZA 2XAQA 3E6CC 1GVDA 4G6DA 2KJCA 1APLC 2ZCNA 2V1DA 4JQFA 3OSGA 1V5EA 2K9MA 1IRFA 3H9GA 2L9RA 2YVEA 2QCOA 3LSGA 2OV7A 1A31A 3M9AA 5CVJA 2CQXA 4I99C 4JL3A 3AAFA 4IZZA 1W36C 5J1UA 2FUG2 2EFQA 3HRUA 2QM3A 4IRHA 1IN4A 5K7ZA 2L9NA 4LG0A 3W3CA 2Y0SN 2A6HF 4BQNA 3L09A 3J7AY 4G6TB 5GP9A 3IUVA 4Y15A 4N0BA 5J1YA 1D1BA 1D1CA 4IOCF 4NUBA 5FRMA 4I6ZA 2V1UA 2RREA 3ZN0A 2PZ9A 4NC8A 4OIRF 2PBIA 5KHDA 4NNJA 4KMFA 1XCBA 2I8DA 5GADJ 3NWTA 1BR4A 1MZBA 2NS0A 3V8KA 3V7SA 1SVOA 4IRGA 5EJCA 2ME0A 5DYMA 4ENMA 4MTEA 2CMPA 2QUFA 5BPIA 2XKOA 1KU9A 5EYRA 2M87A 3JRIA 5D19A 3F9KA 2F5EA 3DWLE 4UB6C 3PFYA 1IN5A 2KISA 1P4XA 1AKHB 5KK1A 2NXNB 1IUFA 1QRYA 2K9QA 2XAHA 2F5CA 3VYUB 1YX5A 5L3DA 4YRVA 5J4VA 3DPJA 5LHGA 3EYYA 3LSRA 1P6RA 2FF4A 3W2VA 2RNJA 4JOMA 2JSPA 3FKIJ 1SFEA 2HTSA 1YIJI 3Q9VA 1VQPI 3JSJA 3U21A 5LLQA 1FX7A 1TLHB 3S93A 2IT0A 3G2BA 4XBFA 1UHMA 3GLXA 4BQOA 3BZ6A 2DA1A 3DLAA 2O7OA 5LGNA 2VUMJ 5AONA 2L9SA 2MH2A 4EV0A 2UXIA 1YTYA 4V2GA 1RR8C 5LFAA 4OAZA 2COBA 2G7UA 4YIFA 3TOBA 3S8PA 4W97A 3FK6A 1EF4A 1BOBA 2XHKA 1WJEA 2VL8A 4ZTJA 1NH3A 4C3HJ 3BCBA 4S04A 2YVXA 3JW4A 3T5XA 4HF1A 1CF7A 2DTZA 3BR0A 3PM1A 2HVRA 2IW5A 1MKMA 2OZUA 3H9QA 3PIPF 2H1LA 2FMYA 1OR7A 2AO9A 2EH3A 2Y9YA 2IP2A 1IRGA 4FISA 4HNVA 2K9LA 4HLYA 2IBDA 4PXIA 3HPGA 3K6GA 2L7ZA 3E5XA 4BGDA 4AIKA 3QWLA 3HJEA 2KZGA 5E8GA 4ZZLA 3LSHA 2EA4A 4EGZA 3T1BA 5E18F 1LVAA 1SANA 2KLOA 1FMWA 3CF5F 3TKYA 1VQLI 2GUHA 1XSVA 2M8GX 1H88C 1TW3A 2IXSA 4RM3A 2OQGA 3WTXC 2AXLA 3PUBA 3KX2A 2R7ZJ 3TP3A 2QGUA 3RYPA 2E2JJ 4QPQA 2OI8A 4AD9A 3M3YJ 3ERMA 3LQQA 2JA8J 1D0ZA 1X3UA 3G4SI 2L4AA 1D0XA 3GEZA 2WY8Q 2QQ8A 2F48A 3BG7A 2OF7A 3ZP5A 4UV9A 3WODF 2L02A 2PFVA 2V4JC 4A6DA 1EH6A 5D5VB 2VOPA 3I56I 5HLTA 1U78A 1ACIA 2UXOA 3J80Z 2K9SA 4B48A 3P9IA 4ZJZA 4IRIA 1HKTA 3P9TA 1R6RA 4CDGA 3DKWA 2HQNA 1PJRA 1O3SA 1ZKGA 4E7LA 2QVOA 1JKRC 3LNQA 2X1CA 4S05A 3F8NA 4CCLA 2L7MP 2VC1A 2UV1A 2W57A 4DIQA 1JUMA 5F64A 1WI3A 2R92J 3L2WA 2OTLI 3QODA 2H94A 1R58A 2PMZA 3VSKA 1YLFA 1S6LA 2L5QA 3QPTA 3HTHA 3TDUC 5DD8A 3E7LA 3O2PE 3WG9A 1VTNC 2Y2ZA 3C2HA 4CH7A 4Y33A 2H09A 3BR5A 3KKCA 2QKLB 2F4OB 3FHZA 5L3GA 4BHBA 2HDCA 2LF8A 4LIUA 5F0FA 5LD2C 3DPUA 1E17A 2DFEA 3S3MA 4ZYHA 1HW5A 1JTYA 2EB7A 3R0JA 3LSIA 4NQWA 5LHIA 1S7AA 1HDPA 4KUMA 2H6BA 5JI6A 1Y39A 2B7EA 5K5RA 2YUSA 1YS6A 4KIBA 3OYMA 5CXGA 3JRGA 2DAOA 1B59A 2OAZA 2VKVA 1IZ1A 2K9NA 3H5AA 4Q5SF 2EPFA 1O7FA 3FM3A 4G9YA 2OC6A 1QNTA 2VKHA 1YJWI 1T38A 4XOPA 2VQGA 1USSA 1Y8QB 5H9TA 1I1GA 3IAM2 1U8BA 1H9GA 2Y69H 1LDDA 4MHGA 1I6HJ 2R93J 1B4AA 3E1SA 4II3A 3EDPA 3VODA 1X58A 1TQIA 3O8HA 2LKSA 3VTIA 5J47A 2JRMA 4BJTA 5CJ9A 5HDKA 2JVHA 3AL0B 4HV6A 1MBFA 2DG7A 2DN0A 2FOWA 5B1AH 2P6SA 1Z7UA 2GXBA 4L9TA 4WF2A 1KZHA 2HKOA 5AIPA 2R4GA 1B6AA 2ETHA 3HOUJ 4HZFA 1X1BA 3HZJA 3NQOA 2OBPA 2RVCA 1IXRC 3KP6A 4CO8A 2IAIA 5JVGF 1QHHD 4WX9A 3ZRGA 1Z21A 2X6XA 4E4HA 4E7HA 4HYEA 1RETA 2JK3A 2CO5A 2LVSA 2PG4A 3BG5A 1PYVA 2NNNA 4RGSA 1JKPC 5CYVA 5CW8A 1GUUA 5L3CA 2XPWA 4GO1A 4DZJA 1T6SA 3M1EA 2D6YA 3DF8A 3NRVA 3HB9A 4M6YA 4F52A 1J9IA 4ZDOA 2E19A 2FSWA 5D5UB 1JTXA 1Z91A 2E5NA 5J6XA 1UAAA 2ID3A 4RM2A 3GZIA 3H9JA 4U87A 5ICCA 3PO2J 2OA4A 3OIOA 3WGIA 3OYBA 1NG7A 3A02A 3HGYA 3OYKA 3L2VA 1Z6RA 3QBMA 1FMVA 3ONQA 4ETSA 5K7FA 3ABMH 2CG4A 1OLTA 2VQHA 3S2WA 4RLQA 4LOCA 4BBRJ 3LA7A 2GOXB 4DW6A 5D4RA 1TWCJ 5TJJA 2Y0SA 2GXAA 2Z9OA 2LTPA 4ESJA 2R7FA 1U8RA 4D1QA 3BPXA 1W5TA 2VIXA 1T33A 4C2TA 3KZIC 3I0TA 3QPLA 2RASA 2NOGA 2W53A 4IHWA 2JA2A 1MJAA 3WU2C 3U1DA 2BY3A 2A2FX 1UFMA 2JSCA 3I9V2 4ENJA 1F4KA 2UXNA 2V6CA 3E0JB 2JN6A 4XRSG 2KP6A 1ZG3A 2LMDA 1TP4A 2ZMEC 1K78A 4KWAA 2CUFA 4CGRA 4K2EA 3OYLA 1VF9A 2IJLA 5BQTA 3SJMA 4QIWN 2R5YA 2WV0A 3ZCOA 3VVZA 1ZQ3P 2QBYA 2PEXA 1H9TA 1OCPA 5K1YA 1Z0XA 1XC5A 3HE0A 3KNWA 3ZMSA 2B1EA 2UWMA 2FBHA 4HA8A 1OYWA 5H20A 3W6KB 2GA2A 3RKYA 3RPQA 3RYRA 4XL9A 3K4LA 3ABTA 5IP9J 3CUQB 2WGBA 3F1BA 1TZLA 1XDUA 1W7PA 1WJBA 2Z5UA 3F72A 4IHXA 2A61A 1KYZA 3K10A 2DDBA 3EUHC 2IRFG 1WRJA 4P1WA 4XMYA 2UXHA 3GW2A 3K4CA 2BVMA 4XLAA 3CCSI 3HOSA 3S3NA 3CCLI 2HPMA 2QSGX 3I64A 3N05A 4IXAA 3BHQA 4GDFA 2Y31A 1TTYA 5D5WB 2A5YB 4FX4A 3FBNB 3IHUA 4XICA 1YI2I 1G3SA 2XAGA 2L0KA 5E1ZB 4X6AJ 3DKYA 3H36A 2BYVE 2EA2A 4M6XA 4B8XA 4IHTA 5E17F 2EWNA 5JFRA 3KYDB 1CQTA 3RKXA 2TDXA 1QVUA 3KEQA 1ON2A 1KQ9A 1W0TA 3FXLA 1A35A 2DPUA 1G3WA 2ZC2A 4IRVA 1RIOH 1A36A 3NARA 2ZMEA 3EUAA 2EFWA 5FLXK 5F1JA 1ETQA 1ERDA 1MNEA 4XK4A 4HSTA 1SVLA 2XAJA 4XR6A 2XROA 2LSOA 4B47A 4EJOA 3ZQCA 4UUVA 1J2XA 3H35A 2P7CB 1UI5A 3VEPA 1UB9A 3S32A 2KMUA 3OIQA 4I98B 2RKHA 3HG9A 1Q1VA 3TQNA 2JA7J 5HOOA 1U5TB 4OIPF 1BC8C 1YYVA 1FP2A 3EUHA 5GTHC 2O8XA 4IHYA 2UXUA 4C30A 2P81A 4M3BA 4PFPA 2ZJPF 1S7EA 1XN7A 1MH3A 2Q2EB 4PDKA 2E60A 1TT5B 3RPUA 3VOEA 1JE8A 2LOOA 3ML6A 3LMMA 5TGTA 3IRRA 4A69C 3CWRA 1B1BA 2NVTJ 3FHNA 3C18A 3ZMTA 1IV8A 2G7HA 5C4JJ 1MH4A 5C4XJ 3V8LA 5CQEA 2HXOA 2K3PA 2MGQA 1HOMA 1ZTRA 2M8EA 2GENA 3CRJA 2AQEA 2VE9A 2O03A 2R5ZB 5A2QK 2QTQA 1LVKA 2ISZA 2K40A 2KRFA 3BTIA 3MKLA 2WV1A 2MH9A 3CCQI 5IYDJ 2E35A 3X2QH 3K4BA 1O3TA 2HQAA 5E3MA 2ZBKA 2E1MB 4BEHB 4DOZA 3A01B 1ZR2A 5HLGA 4EJVA 1YE9A 3DPLC 3BDDA 4LMYA 2XUBA 3J7AO 3RI4A 1ZGJA 2JVGA 2E7WA 4O6JA 4XLPF 4HQEA 2ZSIB 4AVPA 2DMTA 2K4JA 4XONA 4RAZA 5EDNA 4J00A 1NHAA 2WADA 2JTVA 3ABKH 4RAYA 2R7SA 1SAUA 4IJAA 1YIOA 1LJ9A 3CCEI 3CMAI 4BE0A 3SEZA 4Q48A 1ZR4A 1Z6TA 1ETWA 5DUIA 5LGUA 4ZYAA 4ESFA 5D18A 2VLAA 3BP8A 1TWAJ 5TRDA 2K02A 4E7KA 5IOZA 5FKOA 1XMKA 3R4KA 1K7AA 3HOWJ 1B9NA 3MD2A 2WB1N 5ICFA 4EJWA 3F0CA 1AKHA 1MGTA 2R7QA 2GLOA 2JRTA 1JJ6C 4HOBA 3OR1C 2YPRA 5CVUA 2EV0A 3G3ZA 3E6BA 2VOOA 2ZXWH 3FMSA 4N9HA 1ZK8A 1EH7A 1G8XA 2HVSA 1SAXA 3J7YJ 4YELA 4NN1A 2MD0A 2DU9A 2BXYA 2V1NA 4G7OF 3BRUA 1BIAA 3M4OJ 1PVEA 2BGCA 4BE1A 4M3FA 4KDPA 3FRQA 1FYLA 3A03A 1HDDC 4CHUA 1N25A 2CW8A 2V57A 5C44J 1ZHFA 2CQ7A 2EFNA 2WTEA 3S15J 3S2HJ 5F0CA 2OTJI 4GCKA 3LSPA 1TNSA 3I5UA 3E5QA 4IQ4A 1BOAA 1QQIA 2GXGA 1I1SA 1G3TA 4ZC3A 3ISPA 4Y4RA 4CCJA 4CYCB 1YG2A 1SFXA 4Z6YA 3NI7A 4EQQA 3AG1H 2V26A 4PCQA 1WJCA 2GFNA 3B81A 1RPWA 3PASA 3CMMA 4JNNA 3FKJA 3I58A 4NHJA 3F6VA 4HNUA 3F21A 2X9DA 4M9SA 1TNTA 2OCEA 3BNIA 3QAHA 1LUJB 3KLOA 2MG4A 4YEJA 5KVRA 3K8PC 5GAHJ 4GRIA 2RAEA 3RJPA 3GTGJ 2WAQN 2XASA 3VOKA 1SMTA 1Q1HA 4A93J 3BG6A 1X4OA 4IL6C 1W7PD 1FPQA 2DTRA 5IYCJ 4N9IA 1TT0A 1XGNA 5FB2A 1HCRA 2IGKA 3GYHX 3NEUA 4OD5A 2X51A 2XRNA 2XB5A 1FP1D 4B3XA 3HOZJ 2EZHA 2ZY9A 1XGMA 4PUSA 4D5CA 4XNFA 2NAZA 3PFIA 3K0LA 3CP8A 4MQVA 3ZMDA 4MO7A 3GFIA 4A3GJ 5EG0A 2LBFB 4U9NA 4PSWA 4QSHA 4UUSB 3JRBA 2EFOA 3GMEA 5HS8A 2HDDA 2CW0F 4LG3A 3GTQJ 2BBYA 2FJ1A 1KA8A 4Q47A 3DEWA 1FBQA 3NS4A 1DGRM 2NP5A 2PMHA 2J5PA 1I6XA 3TOAA 2R7DA 4KJZA 3BTLA 1REPC 3MQ0A 1MMGA 1GVJA 2ZNZA 1UHWA 2GIZA 3FXMA 1D8JA 2TRTA 1FTTA 1J59A 1X4PA 3V7RA 4ENNA 2HXIA 3FIWA 2R7OA 4AIHA 2HKUA 1O7LA 1GV5A 5HODA 1G59A 3KIOA 4Y52J 3HM5A 1DQUA 2A07F 2GWRA 5K58A 1NG6A 1V54H 2DQLA 3ASNH 3F6OA 3BC8A 1V5FA 2WC2A 3BY6A 4M3EA 2DCEA 2DYSH 4MLOA 5F08A 1FIPA 5DS9A 1D5VA 1IDZA 5HLIA 1OCTC 4H4KC 4J01A 1KU7A 4HPQA 3MFKA 1JJ8C 4RB1A 4XRFA 1EJ9A 4XRSA 2EZLA 5J8FA 1B9MA 3EGQA 3K2AA 3JRFA 1R00A 4DYQA 3MWMA 2Z16A 3S17J 1VQ8I 1UG2A 2M7BA 3ON4A 1ZAOA 3DBLB 4XN3A 4HF0A 5CVRA 3RPUD 2XGCA 3AL0C 5D6FA 2YS9A 4QTRA 5EGOB 2VONA 3VPRA 3MCZA 2LY2A 2NVYJ 4LD5A 2M0CA 2HEOA 2BEOA 3SXYA 3OS1A 2GOMA 4I2OA 4R8HA 2AS5F 2VODA 3GFLA 3GZ5A 4GFKA 1MMAA 1XG1A 3S1RJ 3R6SA 3GTPJ 2V79A 4RDUA 2D45A 1IGNA 2HGCA 1B72B 1OR7C 1XSDA 4QPOA 3TW6A 4BYYA 3LAJA 2A5WA 1V55H 2BVLA 5H6RA 4GCVA 2RGVA 4LLNA 3WTWC 3S3OA 2VBYA 3CCMI 1JI8A 3OSFA 4M9ZA 4ANJA 4W1UA 4LIVA 5FLXZ 1YRNB 3BPVA 1YJNI 1MJ9A 2IS4A 2VPRA 3SZPA 2R7UA 3LA2A 4ZYEA 3JRHA 4QLCU 5E8IA 1KQ8A 4UY8I 3DLLF 3CC7I 3I4NJ 2ACJA 2D1HA 3F8BA 2ECCA 3NAUA 4XORA 3L00A 2LLKA 3OMYA 4JP0A 2EJRA 3ECOA 3CMEI 3B6AA 4A3IJ 5DCMB 2IGNA 2W84A 1O3QA 5ICEA 1BW5A 3SEQA 5EEGA 1ZLJA 2VE8A 4HX4A 1A6QA 2MYSA 3RZOJ 5FMPA 3DEEA 2RNGA 1YJ9I 2GZWA 1DU6A 3EUKL 4E7ZA 5B66C 2L7FP 5HVQC 1U0JA 2O6GE 2DXIA 3HIMA 1MSEC 2R7WA 3S1MJ 3OYAA 3K1NA 2YVHA 5E1WA 3CJQB 5L3EA 3WE2A 1GXQA 2XKPA 3JTGA 1Z05A 3MKWB 1TBXA 2IPQX 4LK0F 3C1DA 5HDNA 3D5RC 2RC4A 2F4IA 2G7SA 2FU4A 3FDYA 4OU0A 2XSJC 5CLSA 2DPDA 3PQJA 1H0MA 5F6FA 3W2AA 1TC3C 3DU6A 1YOVB 2Z3YA 2KIMA 1IXSB 2DI3A 4BY1J 3BR3A 2ECBA 2EFPA 4A0ZA 3CCUI 1VQMI 2W4SA 3GTKJ 3G1OA 4A5NA 1OCCH 4M74A 4MFDA 2DMQA 3J7ZI 3WTUC 3HYIA 3V8JA 3RKWA 3DQVC 2HOEA 3OOUA 5GPAA 4GXOA 1JHFA 1LKXA 2XV4S 2K86A 5FFXA 4I76A 3REOA 2JA5J 4MFEA 4ZZDA 3KKDA 2QEXI 5DDGA 5B1BH 4ZDPA 3L2UA 2UXPA 2ZJRF 3J81K 3OYJA 1WZ2A 1S8NA 4L9VA 4BAYA 4JX5A 3OYHA
chains in the Genus database with same CATH topology
4J19A 3S2DJ 1QPIA 3NRGA 4AYBN 4LOCA 4BBRJ 4D7MA 3RKQA 4DW6A 5FHPA 4S0HB 1TWCJ 1VFCA 1QVTA 2HYTA 3MNLA 1U9OA 2LTPA 2NVQJ 1MSFC 1VNDA 5M3FJ 5EGOA 1T33A 2DA2A 4GCTA 3CMYA 3QPLA 2NP3A 2NOGA 2CJJA 5EEAA 2RASA 2W53A 3HOXJ 4IHWA 2Y9ZA 5JLWA 2JA6J 1BW6A 2G3BA 2OPTA 1JT6A 1ENHA 3V6GA 3ZQGA 3NXCA 4L5EA 3E7QA 2JN6A 4XRSG 4ABZA 3GBGA 5M3MJ 4JKZA 4FTHA 3FK7A 2O7TA 4KWAA 2GM4A 2CUFA 4MK6A 3CDLA 4CGRA 3PPBA 1VF9A 3GTMJ 2MSYA 1MBJA 2HI3A 3SJMA 4QIWN 3BQZA 2R5YA 4YZEA 3BR1A 4BY7J 3TEDA 1ZQ3P 4BBSJ 3H0GJ 3BRUA 4ME9A 3BR2A 1OCPA 1T56A 1Z0XA 1XC5A 3HE0A 3KNWA 2XSDC 1SGMA 2EZIA 2TCTA 2FBQA 5FGLA 4Y7NJ 2R5YB 5C4YA 4UUTA 2G7LA 2HOTA 2WGBA 5IP9J 2O8KA 3F1BA 4IHXA 3VUQA 1LE8A 5FLMJ 4C3JJ 5GPCA 1UI6A 4XRMA 1TWGJ 2UXHA 2EZKA 4B3AA 4IEJA 3QKXA 1LE8B 1AU7A 1U9NA 3BHQA 4A3DJ 2Y31A 1W0UA 5HAWA 4XICA 2JMWA 2DJNA 1H8AC 1TWHJ 2L0KA 4NDLA 2CU7A 9ANTA 4X6AJ 1ETOA 1BJZA 1LFUP 1IC8A 4A3FJ 2X48A 2E1OA 1NTCA 1JUSA 3RD3A 2KDZA 2XDNA 1CQTA 1QVUA 4FCYA 1GT0C 3BTJA 1B8IA 1W0TA 3CJDA 5DAJA 3BG9A 2QF7A 5IP7J 3NARA 2HQ5A 5FJ8J 2NX4A 3ANGA 2Q24A 5F1JA 1TWFJ 1ETQA 2DA4A 1B8IB 3S1QJ 3L1PA 4L62A 4XK4A 2JWTA 1NK2P 3ANPA 3HOVJ 3ZQCA 4AC6A 4A3KJ 4IHVA 1UI5A 2ZOZA 3LJLA 4M3DA 2HOSA 5JLXA 4GFLA 2LD5A 5DTDA 3H3VK 1ETXA 2N8GA 2F07A 1Q1VA 1IG7A 2JA7J 2XPUA 5IYBJ 3RZDJ 2FD5A 5F27A 2UXUA 1POGA 5C3EJ 4IHYA 3GTOJ 2P81A 4M3BA 1RESA 2IEKA 3HKZN 2LFBA 4AF5A 1S7EA 1MH3A 4D5FA 2LP0A 3WHCA 4FE4A 1A6IA 1WH7A 3RQIA 4C2MJ 4V2FA 4A69C 1PUFB 3CWRA 1JGGA 3BJBA 4JYKA 5M5WJ 1FJLA 3HDDA 2NVTJ 3AQSA 3HGGA 2FQ4A 1XS9A 2R5ZA 3ZOBA 5C4JJ 1MH4A 3HEFA 3DCFA 5C4XJ 2DMUA 4DYCA 2HXOA 2MGQA 4GFBA 1RR7A 3D1NI 2XPVA 1ZTRA 1HOMA 2GENA 5M5XJ 3CRJA 5EZHA 4D7NA 2R5ZB 4A3JJ 2QTQA 4HKUA 2K40A 2WUIA 3BTIA 3MKLA 3B6CA 1MNMC 2E2HJ 1GVDA 2WV1A 3A01A 1APLC 3CCYA 5EG0B 2ZCNA 5IYDJ 2ZB9A 3OSGA 3PO3J 2L9RA 3BT9A 1UHSA 2LR8A 2YVEA 5E3MA 1OJLA 2QCOA 3Q3SA 3IH4A 2QWTA 3LSGA 3A01B 1ZR2A 5EFYA 4G12A 2H8RA 3S14J 2CQXA 3UKGA 4JL3A 3ZQFA 4M3GA 2PBXA 5J1UA 1F36A 3WHBA 2ZCXA 2DMTA 3QPSA 5EDNA 5K7ZA 2OERA 4EEFG 2Y0SN 3GTJJ 3ON2A 5BNGA 1D5YA 2QIBA 3LHQA 3ZQHA 5GP9A 3IUVA 2LY9A 4UDSA 5J1YA 1Y1WJ 2M34A 2DA5A 4I6ZA 5M5YJ 5E3OA 2PZ9A 1F43A 1GV2A 1ZR4A 2H1KA 1ETWA 5D18A 2AHQA 3BQYA 1TWAJ 3O60A 5IOZA 5FKOA 4MIMA 2ID6A 3HOWJ 3VVZA 2EQRA 1K61A 2WB1N 2ME0A 2B63J 3GEUA 3F0CA 1AKHA 2W48A 2GLOA 2R0QC 1JJ6C 2IU5A 3MVPA 5E3NA 2LK2A 4GCLA 5EYRA 5EZGA 1MBGA 3JRIA 5D19A 5IP6A 1AKHB 3EUPA 1ZK8A 1IUFA 1IV6A 1QRYA 3S5RA 2K9QA 2ME6A 4NN1A 1I50J 4BXXJ 5IOYA 3HTJA 3HBLA 3DPJA 3NNRA 3LSRA 3M4OJ 5FLVA 4M3FA 3FRQA 2ELKA 3O8GA 3A03A 1HDDC 1VI0A 2V57A 2REKA 3FKIJ 5C44J 1FEXA 1MBEA 4CYCA 3VW2A 3S15J 3S2HJ 3G1MA 5F0CA 2CUEA 3JSJA 1RKTA 5IPAA 4GCKA 3LSPA 5K7HA 3BG3A 4ICHA 1JUPA 2DA1A 3LWJA 2O7OA 4CYCB 3IH3A 2VUMJ 4A3MJ 4JX4A 3NI7A 3VIBA 2UXIA 4V2GA 3B81A 2COBA 5FKNA 1RPWA 3Q0WA 2GFNA 3PASA 4JNNA 2G7GA 5FKMA 1JKQC 2X9DA 2M9HA 2DMPA 4W97A 1BL0A 3FK6A 1O4XA 1EF4A 3BNIA 3G1LA 2RHAA 4X1EA 2MG4A 4C3HJ 2RAEA 2D5VA 3GTGJ 2WAQN 3VOXA 2XGEA 3VOKA 4A3EJ 4A93J 2DTZA 2M2EA 3BR0A 1PUFA 3PM1A 4XIDA 3CQZJ 1P7IA 5IYCJ 3IV5A 2DA7A 2AO9A 2NS7A 1HCRA 2EH3A 2Y9YA 5FKLA 1DU0A 4FISA 2XB5A 1JKOC 3V78A 4HNVA 4UUSA 1A5JA 2JJ7A 2IBDA 3HOZJ 2X6OA 2XRLA 2EZHA 3SFIA 4D5CA 2LKXA 4PXIA 3AQTA 4MO7A 5D1RA 4A3GJ 5EG0A 2ZOYA 2L7ZA 5J1RA 4QSHA 4UUSB 3JRDA 3JRBA 2HDDA 3KZ9A 2QKOA 3GTQJ 2DG8A 1LFBA 2FJ1A 3DEWA 1SANA 2NP5A 3COLA 5J3LA 3BTCA 2GUHA 2M8GX 3K7AJ 5F0HA 2VI6A 1H88C 3BTLA 5AQCA 3TW7A 2VKEA 1MBHA 2TRTA 1I3QJ 1FTTA 3G56A 3SDGA 2R7ZJ 3TP3A 4A3CJ 2HXIA 3FIWA 2E2JJ 1WH5A 2KT0A 2EBIA 3HOYJ 2HKUA 2OI8A 1GV5A 5HODA 1HLVA 3M3YJ 4Y52J 3HM5A 2JA8J 1ETKA 3VW1A 5CXIA 5K58A 3JREA 4M3EA 3TP0A 4AUXA 3HTIA 4C3IJ 4MLOA 5F08A 1FIPA 2OF7A 5DS9A 4A3LJ 1IDZA 1OCTC 1JJ8C 1U78A 2XGDA 2UXOA 4XRSA 2K9SA 2EZLA 2CRGA 3P9TA 1IRZA 3EGQA 3K2AA 3JRFA 4DYQA 3S17J 1UG2A 1ZKGA 3ON4A 5FKKA 1JKRC 2XGCA 3LNQA 4JX6A 2YU9J 2YS9A 4QTRA 5EGOB 3S16J 3C07A 3VVYA 1H89C 3VPRA 2NVYJ 2L7MP 3W6VA 1B72A 1JUMA 2M0CA 1WI3A 2E2IJ 1WGXA 2R92J 3Q0UA 4GFKA 1XG1A 3S1RJ 3GTPJ 3HTHA 4RDUA 1IGNA 4NELA 1B72B 3E7LA 1X2MA 2GBYA 2Y30A 3GTLJ 1R9TJ 3TW6A 5HBUA 4ACIA 1BA5A 2DA6A 2Y2ZA 1YRNA 1AHDP 1WCMJ 3BR5A 4B4CA 3ZQLA 1E3OC 3G7RA 3KKCA 1ETVA 5HSZA 3OSFA 2HOAA 4W1UA 1IDYA 3Q0VA 5F0FA 3JRAA 1YRNB 2VPRA 1JTYA 1X2NA 1IJWC 3I4MJ 3S1NJ 3JRHA 2PMZN 1HDPA 3I4NJ 2ECCA 3NAUA 1SFOJ 2YUSA 3FISA 1HF0A 2LLKA 4JP0A 5CXGA 3JRGA 1ZGWA 3NPIA 2VKVA 2K9NA 2XB0X 3B6AA 4A3IJ 4DYRA 1BW5A 3MN2A 4M6VA 3RZOJ 5FMPA 5H9TA 1JT0A 1U8BA 4FE7A 1I6HJ 3BCGA 2R93J 3T6NA 1DU6A 1NK3P 2O9LA 2L7FP 1X58A 3O8HA 3HIMA 3VVXA 1MSEC 3S1MJ 3JRCA 1ITYA 2YVHA 1FIAA 2MW8A 4B1RA 1ORKA 1MBFA 4A3BJ 1MBKA 5EF6A 2DG7A 4RBOA 2DN0A 2FX0A 3BR6A 1RKWA 5F04A 1OFCX 1GDTA 2G0EA 3VW0A 3HOUJ 2G7SA 3RH2A 1WPKA 2HYJA 2DA3A 2IAIA 1K83J 1TC3C 3VP5A 3ZQIA 5E3LA 1Z77A 1RETA 1P7JA 2JK3A 4BY1J 2ECBA 2LVSA 3BR3A 3BG5A 4MXMA 3HTAA 1Y1VJ 1JKPC 3GTKJ 5CW8A 1UMQA 3G1OA 1GUUA 4BKXA 4MFDA 1FTZA 2DMQA 1ETYA 2XPWA 4DZJA 2DMNA 3IH2A 4AC0A 2D6YA 3HB9A 3C2BA 3OOUA 5GPAA 2E19A 1JTXA 2QOPA 4I76A 4DZPA 2JA5J 3GZIA 2ID3A 1G2HA 4MFEA 3PO2J 3OIOA 3KKDA 3QBMA 3A02A 3HGYA 2UXPA 2NVXJ 3JR9A 3LSJA 2ZCMA 2I10A 3LOCA 2CQQA 4JX5A 5K7FA 3QQAA 2NS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J19 A;  3S2D J;  1QPI A;  3NRG A;  4AYB N;  4LOC A;  4BBR J;  4D7M A;  3RKQ A;  4DW6 A;  5FHP A;  4S0H B;  1TWC J;  1VFC A;  1QVT A;  2HYT A;  3MNL A;  1U9O A;  2LTP A;  2NVQ J;  1MSF C;  1VND A;  5M3F J;  5EGO A;  1T33 A;  2DA2 A;  4GCT A;  3CMY A;  3QPL A;  2NP3 A;  2NOG A;  2CJJ A;  5EEA A;  2RAS A;  2W53 A;  3HOX J;  4IHW A;  2Y9Z A;  5JLW A;  2JA6 J;  1BW6 A;  2G3B A;  2OPT A;  1JT6 A;  1ENH A;  3V6G A;  3ZQG A;  3NXC A;  4L5E A;  3E7Q A;  2JN6 A;  4XRS G;  4ABZ A;  3GBG A;  5M3M J;  4JKZ A;  4FTH A;  3FK7 A;  2O7T A;  4KWA A;  2GM4 A;  2CUF A;  4MK6 A;  3CDL A;  4CGR A;  3PPB A;  1VF9 A;  3GTM J;  2MSY A;  1MBJ A;  2HI3 A;  3SJM A;  4QIW N;  3BQZ A;  2R5Y A;  4YZE A;  3BR1 A;  4BY7 J;  3TED A;  1ZQ3 P;  4BBS J;  3H0G J;  3BRU A;  4ME9 A;  3BR2 A;  1OCP A;  1T56 A;  1Z0X A;  1XC5 A;  3HE0 A;  3KNW A;  2XSD C;  1SGM A;  2EZI A;  2TCT A;  2FBQ A;  5FGL A;  4Y7N J;  2R5Y B;  5C4Y A;  4UUT A;  2G7L A;  2HOT A;  2WGB A;  5IP9 J;  2O8K A;  3F1B A;  4IHX A;  3VUQ A;  1LE8 A;  5FLM J;  4C3J J;  5GPC A;  1UI6 A;  4XRM A;  1TWG J;  2UXH A;  2EZK A;  4B3A A;  4IEJ A;  3QKX A;  1LE8 B;  1AU7 A;  1U9N A;  3BHQ A;  4A3D J;  2Y31 A;  1W0U A;  5HAW A;  4XIC A;  2JMW A;  2DJN A;  1H8A C;  1TWH J;  2L0K A;  4NDL A;  2CU7 A;  9ANT A;  4X6A J;  1ETO A;  1BJZ A;  1LFU P;  1IC8 A;  4A3F J;  2X48 A;  2E1O A;  1NTC A;  1JUS A;  3RD3 A;  2KDZ A;  2XDN A;  1CQT A;  1QVU A;  4FCY A;  1GT0 C;  3BTJ A;  1B8I A;  1W0T A;  3CJD A;  5DAJ A;  3BG9 A;  2QF7 A;  5IP7 J;  3NAR A;  2HQ5 A;  5FJ8 J;  2NX4 A;  3ANG A;  2Q24 A;  5F1J A;  1TWF J;  1ETQ A;  2DA4 A;  1B8I B;  3S1Q J;  3L1P A;  4L62 A;  4XK4 A;  2JWT A;  1NK2 P;  3ANP A;  3HOV J;  3ZQC A;  4AC6 A;  4A3K J;  4IHV A;  1UI5 A;  2ZOZ A;  3LJL A;  4M3D A;  2HOS A;  5JLX A;  4GFL A;  2LD5 A;  5DTD A;  3H3V K;  1ETX A;  2N8G A;  2F07 A;  1Q1V A;  1IG7 A;  2JA7 J;  2XPU A;  5IYB J;  3RZD J;  2FD5 A;  5F27 A;  2UXU A;  1POG A;  5C3E J;  4IHY A;  3GTO J;  2P81 A;  4M3B A;  1RES A;  2IEK A;  3HKZ N;  2LFB A;  4AF5 A;  1S7E A;  1MH3 A;  4D5F A;  2LP0 A;  3WHC A;  4FE4 A;  1A6I A;  1WH7 A;  3RQI A;  4C2M J;  4V2F A;  4A69 C;  1PUF B;  3CWR A;  1JGG A;  3BJB A;  4JYK A;  5M5W J;  1FJL A;  3HDD A;  2NVT J;  3AQS A;  3HGG A;  2FQ4 A;  1XS9 A;  2R5Z A;  3ZOB A;  5C4J J;  1MH4 A;  3HEF A;  3DCF A;  5C4X J;  2DMU A;  4DYC A;  2HXO A;  2MGQ A;  4GFB A;  1RR7 A;  3D1N I;  2XPV A;  1ZTR A;  1HOM A;  2GEN A;  5M5X J;  3CRJ A;  5EZH A;  4D7N A;  2R5Z B;  4A3J J;  2QTQ A;  4HKU A;  2K40 A;  2WUI A;  3BTI A;  3MKL A;  3B6C A;  1MNM C;  2E2H J;  1GVD A;  2WV1 A;  3A01 A;  1APL C;  3CCY A;  5EG0 B;  2ZCN A;  5IYD J;  2ZB9 A;  3OSG A;  3PO3 J;  2L9R A;  3BT9 A;  1UHS A;  2LR8 A;  2YVE A;  5E3M A;  1OJL A;  2QCO A;  3Q3S A;  3IH4 A;  2QWT A;  3LSG A;  3A01 B;  1ZR2 A;  5EFY A;  4G12 A;  2H8R A;  3S14 J;  2CQX A;  3UKG A;  4JL3 A;  3ZQF A;  4M3G A;  2PBX A;  5J1U A;  1F36 A;  3WHB A;  2ZCX A;  2DMT A;  3QPS A;  5EDN A;  5K7Z A;  2OER A;  4EEF G;  2Y0S N;  3GTJ J;  3ON2 A;  5BNG A;  1D5Y A;  2QIB A;  3LHQ A;  3ZQH A;  5GP9 A;  3IUV A;  2LY9 A;  4UDS A;  5J1Y A;  1Y1W J;  2M34 A;  2DA5 A;  4I6Z A;  5M5Y J;  5E3O A;  2PZ9 A;  1F43 A;  1GV2 A;  1ZR4 A;  2H1K A;  1ETW A;  5D18 A;  2AHQ A;  3BQY A;  1TWA J;  3O60 A;  5IOZ A;  5FKO A;  4MIM A;  2ID6 A;  3HOW J;  3VVZ A;  2EQR A;  1K61 A;  2WB1 N;  2ME0 A;  2B63 J;  3GEU A;  3F0C A;  1AKH A;  2W48 A;  2GLO A;  2R0Q C;  1JJ6 C;  2IU5 A;  3MVP A;  5E3N A;  2LK2 A;  4GCL A;  5EYR A;  5EZG A;  1MBG A;  3JRI A;  5D19 A;  5IP6 A;  1AKH B;  3EUP A;  1ZK8 A;  1IUF A;  1IV6 A;  1QRY A;  3S5R A;  2K9Q A;  2ME6 A;  4NN1 A;  1I50 J;  4BXX J;  5IOY A;  3HTJ A;  3HBL A;  3DPJ A;  3NNR A;  3LSR A;  3M4O J;  5FLV A;  4M3F A;  3FRQ A;  2ELK A;  3O8G A;  3A03 A;  1HDD C;  1VI0 A;  2V57 A;  2REK A;  3FKI J;  5C44 J;  1FEX A;  1MBE A;  4CYC A;  3VW2 A;  3S15 J;  3S2H J;  3G1M A;  5F0C A;  2CUE A;  3JSJ A;  1RKT A;  5IPA A;  4GCK A;  3LSP A;  5K7H A;  3BG3 A;  4ICH A;  1JUP A;  2DA1 A;  3LWJ A;  2O7O A;  4CYC B;  3IH3 A;  2VUM J;  4A3M J;  4JX4 A;  3NI7 A;  3VIB A;  2UXI A;  4V2G A;  3B81 A;  2COB A;  5FKN A;  1RPW A;  3Q0W A;  2GFN A;  3PAS A;  4JNN A;  2G7G A;  5FKM A;  1JKQ C;  2X9D A;  2M9H A;  2DMP A;  4W97 A;  1BL0 A;  3FK6 A;  1O4X A;  1EF4 A;  3BNI A;  3G1L A;  2RHA A;  4X1E A;  2MG4 A;  4C3H J;  2RAE A;  2D5V A;  3GTG J;  2WAQ N;  3VOX A;  2XGE A;  3VOK A;  4A3E J;  4A93 J;  2DTZ A;  2M2E A;  3BR0 A;  1PUF A;  3PM1 A;  4XID A;  3CQZ J;  1P7I A;  5IYC J;  3IV5 A;  2DA7 A;  2AO9 A;  2NS7 A;  1HCR A;  2EH3 A;  2Y9Y A;  5FKL A;  1DU0 A;  4FIS A;  2XB5 A;  1JKO C;  3V78 A;  4HNV A;  4UUS A;  1A5J A;  2JJ7 A;  2IBD A;  3HOZ J;  2X6O A;  2XRL A;  2EZH A;  3SFI A;  4D5C A;  2LKX A;  4PXI A;  3AQT A;  4MO7 A;  5D1R A;  4A3G J;  5EG0 A;  2ZOY A;  2L7Z A;  5J1R A;  4QSH A;  4UUS B;  3JRD A;  3JRB A;  2HDD A;  3KZ9 A;  2QKO A;  3GTQ J;  2DG8 A;  1LFB A;  2FJ1 A;  3DEW A;  1SAN A;  2NP5 A;  3COL A;  5J3L A;  3BTC A;  2GUH A;  2M8G X;  3K7A J;  5F0H A;  2VI6 A;  1H88 C;  3BTL A;  5AQC A;  3TW7 A;  2VKE A;  1MBH A;  2TRT A;  1I3Q J;  1FTT A;  3G56 A;  3SDG A;  2R7Z J;  3TP3 A;  4A3C J;  2HXI A;  3FIW A;  2E2J J;  1WH5 A;  2KT0 A;  2EBI A;  3HOY J;  2HKU A;  2OI8 A;  1GV5 A;  5HOD A;  1HLV A;  3M3Y J;  4Y52 J;  3HM5 A;  2JA8 J;  1ETK A;  3VW1 A;  5CXI A;  5K58 A;  3JRE A;  4M3E A;  3TP0 A;  4AUX A;  3HTI A;  4C3I J;  4MLO A;  5F08 A;  1FIP A;  2OF7 A;  5DS9 A;  4A3L J;  1IDZ A;  1OCT C;  1JJ8 C;  1U78 A;  2XGD A;  2UXO A;  4XRS A;  2K9S A;  2EZL A;  2CRG A;  3P9T A;  1IRZ A;  3EGQ A;  3K2A A;  3JRF A;  4DYQ A;  3S17 J;  1UG2 A;  1ZKG A;  3ON4 A;  5FKK A;  1JKR C;  2XGC A;  3LNQ A;  4JX6 A;  2YU9 J;  2YS9 A;  4QTR A;  5EGO B;  3S16 J;  3C07 A;  3VVY A;  1H89 C;  3VPR A;  2NVY J;  2L7M P;  3W6V A;  1B72 A;  1JUM A;  2M0C A;  1WI3 A;  2E2I J;  1WGX A;  2R92 J;  3Q0U A;  4GFK A;  1XG1 A;  3S1R J;  3GTP J;  3HTH A;  4RDU A;  1IGN A;  4NEL A;  1B72 B;  3E7L A;  1X2M A;  2GBY A;  2Y30 A;  3GTL J;  1R9T J;  3TW6 A;  5HBU A;  4ACI A;  1BA5 A;  2DA6 A;  2Y2Z A;  1YRN A;  1AHD P;  1WCM J;  3BR5 A;  4B4C A;  3ZQL A;  1E3O C;  3G7R A;  3KKC A;  1ETV A;  5HSZ A;  3OSF A;  2HOA A;  4W1U A;  1IDY A;  3Q0V A;  5F0F A;  3JRA A;  1YRN B;  2VPR A;  1JTY A;  1X2N A;  1IJW C;  3I4M J;  3S1N J;  3JRH A;  2PMZ N;  1HDP A;  3I4N J;  2ECC A;  3NAU A;  1SFO J;  2YUS A;  3FIS A;  1HF0 A;  2LLK A;  4JP0 A;  5CXG A;  3JRG A;  1ZGW A;  3NPI A;  2VKV A;  2K9N A;  2XB0 X;  3B6A A;  4A3I J;  4DYR A;  1BW5 A;  3MN2 A;  4M6V A;  3RZO J;  5FMP A;  5H9T A;  1JT0 A;  1U8B A;  4FE7 A;  1I6H J;  3BCG A;  2R93 J;  3T6N A;  1DU6 A;  1NK3 P;  2O9L A;  2L7F P;  1X58 A;  3O8H A;  3HIM A;  3VVX A;  1MSE C;  3S1M J;  3JRC A;  1ITY A;  2YVH A;  1FIA A;  2MW8 A;  4B1R A;  1ORK A;  1MBF A;  4A3B J;  1MBK A;  5EF6 A;  2DG7 A;  4RBO A;  2DN0 A;  2FX0 A;  3BR6 A;  1RKW A;  5F04 A;  1OFC X;  1GDT A;  2G0E A;  3VW0 A;  3HOU J;  2G7S A;  3RH2 A;  1WPK A;  2HYJ A;  2DA3 A;  2IAI A;  1K83 J;  1TC3 C;  3VP5 A;  3ZQI A;  5E3L A;  1Z77 A;  1RET A;  1P7J A;  2JK3 A;  4BY1 J;  2ECB A;  2LVS A;  3BR3 A;  3BG5 A;  4MXM A;  3HTA A;  1Y1V J;  1JKP C;  3GTK J;  5CW8 A;  1UMQ A;  3G1O A;  1GUU A;  4BKX A;  4MFD A;  1FTZ A;  2DMQ A;  1ETY A;  2XPW A;  4DZJ A;  2DMN A;  3IH2 A;  4AC0 A;  2D6Y A;  3HB9 A;  3C2B A;  3OOU A;  5GPA A;  2E19 A;  1JTX A;  2QOP A;  4I76 A;  4DZP A;  2JA5 J;  3GZI A;  2ID3 A;  1G2H A;  4MFE A;  3PO2 J;  3OIO A;  3KKD A;  3QBM A;  3A02 A;  3HGY A;  2UXP A;  2NVX J;  3JR9 A;  3LSJ A;  2ZCM A;  2I10 A;  3LOC A;  2CQQ A;  4JX5 A;  5K7F A;  3QQA A;  2NS8 A; 
#chains in the Genus database with same CATH topology
 3H92 A;  1QPI A;  5GAE J;  2Q0O A;  4RAG A;  2Y75 A;  4S0H B;  3LAP A;  1QVT A;  4A12 A;  3DKX A;  1VQ9 I;  3JSO A;  5KAF C;  4E7I A;  1KON A;  1UEL B;  3L2C A;  1FWZ A;  2NVQ J;  3WGH A;  2DA2 A;  2HTJ A;  3GXO A;  3SDB A;  2V9P A;  1UG0 A;  2CJJ A;  1XX5 A;  4EM1 A;  3O6B B;  1R49 A;  4I7H A;  3QYE A;  2OPT A;  2FBI A;  1E3H A;  5ILU A;  1LDJ A;  1XDS A;  5H2F C;  4ABZ A;  3FXU A;  1TQP A;  4RGR A;  2QQA A;  3WE3 A;  2W24 A;  4ON0 A;  4FTH A;  1ZG1 A;  1IRX A;  3JCU C;  2GM4 A;  2BZT A;  2MSY A;  1IXC A;  2M1B A;  4E70 A;  2L54 A;  4ME9 A;  3H0G J;  2HFH A;  2KIQ A;  1LNW A;  2LH9 A;  1T56 A;  2KRH A;  3BR2 A;  2OJE D;  3I3L A;  4WXH A;  3U9G A;  1ZRD A;  1U5T C;  3F23 A;  3CJN A;  4B44 A;  1UCR A;  2VB6 A;  4UVA A;  2DT6 A;  4YII A;  2VQC A;  5ERI A;  4L0Z B;  3OYG A;  2O0Y A;  2M30 A;  2VBW A;  1FT9 A;  3MZ8 A;  1F9N A;  1O3R A;  1F1Z A;  3TGN A;  4CYD A;  4IVN A;  3VYT B;  1VQO I;  2C6Y A;  4F3Q A;  4ZDL A;  4A3D J;  1I3A A;  2L2O A;  1FC3 A;  1W0U A;  2QEN A;  1LFP A;  4NDL A;  1KYW A;  1XTA A;  1LFU P;  1BJZ A;  2E1O A;  1Y0N A;  5CKT A;  2Y0M A;  1GXP A;  1AA7 A;  2JUG A;  3F8F A;  2LRD A;  1J5Y A;  1S5L C;  5DAJ A;  1JGS A;  4XKC A;  2CGP A;  3PIO F;  5IP7 J;  4KT6 A;  3D5S C;  3IAS 2;  5FJ8 J;  2NX4 A;  5DV5 A;  1EV7 A;  2OUM A;  3KZY A;  3MKZ A;  3HKZ A;  1B8I B;  2STW A;  2ZFW A;  2HPI A;  1QHG A;  2KIF A;  2JWT A;  1X19 A;  1HC8 A;  4HRI A;  1U5T A;  4F91 B;  2XIG A;  4M3D A;  5DD4 A;  2Q2E A;  1R5I D;  2LD5 A;  2WAF A;  3H3V K;  2N8G A;  1N75 A;  5F27 A;  1POG A;  3M8J A;  5C3E J;  2HVQ A;  1R4M B;  1ZRF A;  1DPR A;  4L5I A;  3OYF A;  4AF5 A;  2FEZ A;  1W1W E;  4D5F A;  2A68 F;  3RQI A;  3HSE A;  3ERE D;  1VQ7 I;  3QPH A;  2B0L A;  1JGG A;  2FRH A;  4JYK A;  1FJL A;  1Z1D A;  3AQS A;  4DQ2 A;  1UJ8 A;  2FQ4 A;  1XS9 A;  2PI0 A;  2R5Z A;  3ZOB A;  2KIU A;  3CDI A;  3N97 A;  3HEF A;  2Q8K A;  3G71 I;  1O57 A;  4BJ6 C;  2XPV A;  5L3F A;  5M5X J;  4YIR X;  1HW1 A;  3P9K A;  4D7N A;  5E20 A;  2J5O A;  2WUI A;  2QA4 I;  1MNM C;  2A6E F;  3B6C A;  1ON1 A;  4BEH A;  2QYO A;  3A01 A;  1VQ6 I;  2MAB A;  1LEA A;  4TV7 A;  2ZB9 A;  2A6T A;  3PO3 J;  1PDN C;  3CO6 C;  1UHS A;  2HNH A;  3M07 A;  1OJL A;  3IC7 A;  3Q3S A;  6PAX A;  2RDP A;  2H8R A;  4E7S A;  2F4M B;  3UKG A;  3RTR A;  3ZQF A;  4M3G A;  3KEO A;  3CTA A;  1F36 A;  2L3D A;  4NB5 A;  2DJI A;  4IO9 F;  2ZCX A;  3QPS A;  4RA2 A;  4GYI A;  4KIS A;  1S72 I;  1RRJ A;  4CCO A;  4RB0 A;  4EEF G;  1SFU A;  1BJA A;  3RDI A;  3ON2 A;  1D5Y A;  2QIB A;  3LHQ A;  1ZAR A;  3ZQH A;  5HDG A;  2B9S A;  4UDS A;  2CV0 A;  2M34 A;  4RGU A;  1HBX G;  1FYM A;  1F5T A;  5M5Y J;  5E3O A;  2VBX A;  4HAM A;  1GV2 A;  2KKO A;  1GHC A;  1VQ4 I;  4C2M A;  2AHQ A;  5FFZ A;  3WU0 A;  5EEH A;  4NC7 A;  4IOA F;  3OY9 A;  4N4O B;  2ID6 A;  2FML A;  3CJT B;  1U3E M;  3GO5 A;  4BXU A;  1X3Z B;  1SFK A;  2B63 J;  3F3X A;  3GEU A;  4DVY P;  4XLF A;  3IKV A;  3CCV I;  2DYR H;  3MVP A;  4GCL A;  5EZG A;  1MBG A;  1IN8 A;  1KQ0 A;  2LF7 A;  1Y8R B;  2JPB A;  4CSW A;  4U0Y A;  2CW7 A;  3EUP A;  1IV6 A;  3MZY A;  3P7N A;  5LHH A;  3S5R A;  4B09 A;  1P4A A;  2ME6 A;  2BW3 B;  5IOY A;  3HTJ A;  3HBL A;  3B02 A;  2QSF X;  2CH0 A;  3ELK A;  3KP3 A;  4HX7 A;  5FRO A;  2ELK A;  3O8G A;  2FJI 1;  3CLO A;  1IF1 A;  3EYI A;  4OD4 A;  4EGY A;  1FEX A;  3VW2 A;  1MBE A;  4CYC A;  4RS8 A;  3DEU A;  2FE3 A;  1BM9 A;  4A0X A;  1QZE A;  2WWY A;  1R4N B;  1K4T A;  4JBA A;  1C0W A;  1ULY A;  3CZ6 A;  3H3Z A;  4A3M J;  4JX4 A;  1X1A A;  4PJJ A;  3E6D A;  3TO9 A;  2DFH A;  4ASN A;  2G7G A;  1JKQ C;  4OIO F;  2DMP A;  1LB2 A;  2OCC H;  1P92 A;  4E6K G;  1O4X A;  3G1L A;  2CWE A;  4WIB A;  1WQ2 A;  2BY0 A;  1BI2 A;  1RZ4 A;  2DOF A;  4Q4Z F;  2K5C A;  1RC9 A;  4Y13 A;  2D5V A;  2M4K A;  4Y17 A;  1OIS A;  3ZPL A;  2XGE A;  3DPT A;  1YW7 A;  5B5E C;  3HRT A;  1SMY F;  3VOX A;  2M2E A;  3J81 Z;  1PUF A;  4OIN F;  4NBQ A;  3E3V A;  3CQZ J;  3CC4 I;  2DLL A;  2NS7 A;  3TMO A;  2LBF A;  4PFO A;  4UUS A;  4CZZ A;  1MDM A;  1A5J A;  2EV6 A;  4RAF A;  2XRL A;  4O5V A;  2W85 A;  2LKX A;  2M45 A;  2DT7 B;  3L2Q A;  3AQT A;  5D1R A;  3IUO A;  4BNC A;  4DNC A;  3I59 B;  4U88 A;  4PJ0 C;  4PGH A;  4CA0 A;  4DBR A;  3K4N A;  4AU7 A;  3KZ9 A;  3C3W A;  2QKO A;  2QKM B;  5LRS A;  2DG8 A;  1LFB A;  3WU1 B;  1T95 A;  3LA3 A;  3MAJ A;  3PL8 A;  5J3L A;  3K7A J;  3NWS A;  5F0H A;  2VI6 A;  5AQC A;  3GFM A;  3TW7 A;  1R1T A;  1Z3Y A;  3E97 A;  4EVI A;  2MFZ A;  3G56 A;  4IX7 A;  4M9X A;  4CCK A;  2HU9 A;  3ZMZ A;  4EAT A;  1WH5 A;  2KT0 A;  2EBI A;  3ZR8 X;  3UR3 C;  4YFN F;  1HLV A;  1S7O A;  1SVM A;  1WJF A;  1WJD A;  3I55 I;  1ETK A;  2IS6 A;  3GZ6 A;  1FSH A;  2R3S A;  3CDH A;  3HSR A;  2WA0 A;  3T8T A;  3WTV C;  1BIB A;  3HRM A;  3JRE A;  3TP0 A;  3K70 C;  1QGP A;  3QP6 A;  1HKQ A;  5HNH A;  4A3L J;  1FLI A;  3H0D A;  3U1K A;  2XGD A;  4PK4 A;  2LY1 A;  3MZH A;  3PNV A;  2H8W A;  2JUC A;  4LFU A;  2EIN H;  2HKX A;  2IA1 A;  2E34 A;  1EKE A;  5GAG J;  2F5V A;  1FOX A;  3C07 A;  1H89 C;  1EH8 A;  2YU3 A;  4LLG F;  4OWR B;  1B72 A;  1FNN A;  4U0V A;  1BBY A;  3FXR A;  1SD4 A;  1D3Y A;  2STT A;  2CV2 A;  2Z2S B;  1L3L A;  2HDW A;  3OIP A;  2MBF A;  3OS0 A;  4NEL A;  1U6G A;  2MLG A;  2HZT A;  2OQR A;  1X2M A;  2GBY A;  2W25 A;  2Y30 A;  3GTL J;  4ACI A;  1BA5 A;  4MNU A;  1R22 A;  1YRN A;  2K3F A;  1AHD P;  2X1D A;  3VYS B;  1WCM J;  4WK8 F;  1ZN2 A;  3CJR B;  4A6E A;  3ZQL A;  1XGS A;  4YG2 F;  1ETV A;  1UZC A;  3QRF F;  1VQ5 I;  2E1N A;  2VQL A;  4HDU A;  1DDN A;  3FBI B;  2MD5 A;  2HOA A;  2R7R A;  4JK1 X;  3CC2 I;  1IDY A;  3JRA A;  3J80 K;  2PJP A;  1IJW C;  3I4M J;  1LPQ A;  2PMZ N;  4CGZ A;  2B3W A;  1J7K A;  5DCM A;  1HW2 A;  1WFX A;  4KN7 X;  3M1C A;  4P55 A;  1SFO J;  1HF0 A;  3QP5 A;  1OMI A;  1R1U A;  2P0W A;  2ZSH B;  1S3J A;  4PGG A;  3JAM K;  4DYR A;  2Q1Z B;  4HW0 A;  2GA1 A;  4BHP A;  3MN2 A;  3LFK A;  4M6V A;  5ILS A;  4BUP A;  4EJU A;  1BC7 C;  2V1X A;  2CQN A;  4LLL A;  2QLZ A;  4FE7 A;  4Z2Y A;  3T6N A;  3JTH A;  3T0Y A;  3KP4 A;  1NK3 P;  2BHY A;  2O9L A;  1ZRC A;  3ROU A;  2X85 A;  4KA4 A;  3G73 A;  4L18 B;  2CS3 A;  3OYE A;  3FMQ A;  1YW9 A;  1FIA A;  3MKY B;  3PNY A;  2L9V A;  2ZXH A;  4RBO A;  3OS2 A;  4PSX A;  3ZMU A;  4R1H A;  2LG4 A;  5D6E A;  3BR6 A;  4I01 A;  1RKW A;  4I09 A;  2ZME B;  4LK1 F;  2AQF A;  2HYJ A;  1MMN A;  5HLH A;  3ZQI A;  2Y48 A;  4ENK A;  2DK8 A;  1FOW A;  2MC4 A;  1P7J A;  4MXM A;  4HDV A;  3OYC A;  3OYI A;  1Y1V J;  4EMS A;  4BKX A;  5JR3 A;  2LYC A;  1FTZ A;  1ETY A;  1BR2 A;  1D1A A;  3D0S A;  2MC3 A;  3QU3 A;  2VJ5 A;  1R5H A;  2DDA A;  2P5V A;  4DZP A;  4D9J A;  1MIJ A;  3FXJ A;  2G9W A;  2QZ8 A;  4CCN A;  1N77 A;  4BS9 A;  2NVX J;  3CO7 C;  3JR9 A;  2HS5 A;  2PJR B;  2ZCM A;  3LOC A;  2E7X A;  3QQA A;  2NS8 A;  3S2D J;  3ECH A;  5BPD A;  2KRC A;  4AYB N;  1E3P A;  4D7M A;  3RKQ A;  5FHP A;  2I5U A;  4R79 A;  1VFC A;  3OOP A;  3JSP A;  2PFB A;  3LST A;  4HNT A;  3MNL A;  2HQR A;  4OAY A;  4KIC A;  2YX4 A;  2IA0 A;  1X1C A;  1Y56 A;  1VND A;  4BQQ A;  2F5F A;  2QWW A;  4U0W A;  1T8I A;  2R7V A;  2NP3 A;  2ZXJ A;  5EEA A;  2ICW G;  2X1E A;  4UNO A;  5JLW A;  2ESH A;  2M3A A;  2EIM H;  3BCA A;  3L2R A;  2JA6 J;  3FWE A;  2CQK A;  1Z3X A;  1IW7 F;  3DTK A;  2YSR A;  1LEB A;  1ENH A;  2FA5 A;  3V6G A;  5FD6 A;  4P9U A;  2WY7 Q;  3ZQG A;  3NXC A;  3T8R A;  5CVI A;  5LRR A;  5M3M J;  4JKZ A;  3PJR A;  2E1C A;  1OCR H;  4X0G A;  2A69 F;  5LGT A;  1T08 B;  3H5N A;  4V19 K;  3PPB A;  1I5Z A;  3LFU A;  4MEY F;  3K69 A;  1R5G A;  5D8L B;  4YZE A;  3BR1 A;  4XKV A;  4BY7 J;  2X6W A;  1LQ1 A;  1YQA A;  4UHT A;  2VAS A;  3IP4 B;  2R7X A;  2FBQ A;  3BZC A;  4Y7N J;  3HPH A;  2XDV A;  4F93 B;  2EIK H;  2G7L A;  2V6E A;  1S29 A;  2P4W A;  2W82 A;  2O8K A;  4DBQ A;  2QQB A;  5ICG A;  1E0E A;  3I71 A;  5FLM J;  4C3J J;  4XSX F;  1I27 A;  5GPC A;  1UI6 A;  3SYT A;  5K5Q A;  2EZK A;  5J4Y A;  2DOA A;  3ZXS A;  5HNF A;  3QKX A;  4IEJ A;  3ABU A;  3KYL A;  1QO0 D;  2COM A;  1LE8 B;  1Z9C A;  1U9N A;  5KNL A;  3WG7 H;  5HAW A;  2BY1 A;  2ZJQ F;  4HEA 2;  1H8A C;  2DJN A;  3TBI A;  2CU7 A;  4AM3 A;  3HTS B;  9ANT A;  3CP2 A;  3KE2 A;  4F55 A;  3DTI A;  4A3F J;  2X48 A;  1PUE E;  2IS2 A;  1NTC A;  2VJ4 A;  2XVC A;  2ZCW A;  3RD3 A;  4AVZ A;  2P7V B;  2XDN A;  1P9Q C;  5AIQ A;  4FCY A;  1GT0 C;  3BTJ A;  1B8I A;  4A2U A;  2EIL H;  3CJD A;  3K4K A;  1T39 A;  1QU3 A;  4IKF A;  1MD0 A;  4P9F A;  2HQ5 A;  3ULQ B;  4BHC A;  3CCJ I;  3LSM A;  2R7T A;  2CFO A;  2BXZ A;  1OKR A;  4HF2 A;  1X1D A;  4BAC A;  3L1P A;  4L62 A;  3VSL A;  5A2Q Z;  1W4M A;  1FBU A;  2ZXI A;  2DQR A;  4AC6 A;  1MJB A;  4AID A;  4A3K J;  4BQA A;  4IHV A;  4BL0 B;  4BXF A;  2ZOZ A;  3GLL A;  3IL2 A;  3LJL A;  2K7L A;  3M8F A;  4XN0 A;  5F1R A;  5DTD A;  1ETX A;  1P2F A;  3M7G A;  3CD6 I;  3GCM A;  3QOE A;  4O3M A;  3PUF A;  1RNL A;  5IYB J;  5IY5 H;  3RZD J;  1ZGA A;  2FD5 A;  1WJA A;  2GQQ A;  5FD5 A;  2LC2 A;  2LKP A;  3CUQ C;  2LP0 A;  3WHC A;  4FE4 A;  1A6I A;  4C2M J;  1J09 A;  4V2F A;  2EK5 A;  5M5W J;  3HDD A;  3I53 A;  3OYD A;  3HGG A;  3K70 D;  1HA8 A;  4FT8 A;  2DMU A;  3DP7 A;  4DYC A;  1ZG5 A;  3PQK A;  4GFB A;  3R61 A;  3ABL H;  1RR7 A;  4BU2 A;  4MGR A;  1T2K A;  2ESN A;  1HKS A;  1V3F A;  5EZH A;  3SZT A;  5DCF A;  4ESB A;  1XGO A;  2ZO4 A;  3LSK A;  5CPR B;  4A3J J;  1XCV A;  2VJI A;  4PJL A;  2IVM A;  1W5S A;  2E2H J;  2VC0 A;  2EV5 A;  1FYK A;  4L0Y B;  3CCY A;  5EG0 B;  2V9V A;  4OOI A;  4EJT A;  3HUG B;  3A0B C;  4OMZ A;  1A04 A;  4L5J A;  3BT9 A;  3BJ6 A;  2LR8 A;  2MLK A;  4B43 A;  4YFK F;  1Z67 A;  1YW8 A;  1HQC A;  2XF6 A;  3IH4 A;  2QWT A;  5EFY A;  1RI7 A;  2RV8 A;  4G12 A;  1IN6 A;  3GF2 A;  4XKW A;  3S14 J;  2CUJ A;  2P6T A;  3DU5 A;  2HR3 A;  5CQG A;  4II2 A;  3I4P A;  2PBX A;  1U2W A;  3WHB A;  2M7A A;  3PSF A;  4M73 A;  1D0Y A;  3K4J A;  2OER A;  2WAE A;  2WB1 A;  5LEK A;  3GTJ J;  2IA2 A;  5BNG A;  4NC6 A;  3GUD A;  3I54 A;  2LY9 A;  1Y1W J;  1YIT I;  2DA5 A;  3GZN B;  3GVA A;  3SHF A;  4LG0 B;  4UV8 A;  1F43 A;  1E2X A;  3HL2 A;  2O5R A;  1SD6 A;  3CUQ A;  3EET A;  2H1K A;  4MEX F;  4LIT A;  3BQY A;  2L4M A;  3O60 A;  2YX7 A;  3CLQ A;  2OZ6 A;  4I02 A;  4HX8 A;  2P5K A;  1ZYR F;  1GLN A;  4MIM A;  3HC7 A;  2O61 A;  2EQR A;  1SC7 A;  1K61 A;  4ZYG A;  3RSN A;  3KZZ A;  2W48 A;  3JAM Z;  3VYR B;  1HXD A;  2R0Q C;  4EM2 A;  2IU5 A;  2VBZ A;  3AG3 H;  3ASO H;  2BW3 A;  3HHG A;  2LK2 A;  5E3N A;  4FX0 A;  4HQM A;  4XLC A;  1W5C C;  5IP6 A;  2VN2 A;  4F92 B;  2V9K A;  2VT2 A;  3A0H C;  4BDZ A;  3TDZ C;  4FHT A;  4KMU X;  5KCM A;  3HRS A;  1I50 J;  4BXX J;  3QYF A;  4RGX A;  4U7D A;  2CV1 A;  3NNR A;  5HS9 A;  2DOD A;  3DTE A;  5FLV A;  2HYF A;  3K1M A;  5HS7 A;  1VI0 A;  1M1E B;  2DT5 A;  2UUZ A;  2REK A;  3G1M A;  1VQK I;  2CUE A;  1RKT A;  5IPA A;  4CXF A;  2VXD A;  5K7H A;  4XM3 A;  3BG3 A;  4ICH A;  2E1M C;  4G7Z F;  1BN5 A;  3OYN A;  5BS6 A;  2V7F A;  1JUP A;  2WAQ A;  2DBB A;  2OD5 A;  3B73 A;  3LWJ A;  3IH3 A;  3DXJ F;  2JT1 A;  1MND A;  3VIB A;  3H1C A;  5B3S H;  5JHF A;  4BH9 A;  3A4C A;  5LEJ A;  2BE5 F;  5FKN A;  3Q0W A;  4KIG A;  1WI9 A;  1T98 A;  5FKM A;  2M0M A;  2M9H A;  4KIT B;  2AXT C;  4EM0 B;  1P4W A;  3MEX A;  3E5U A;  1X1P A;  1BL0 A;  1JXS A;  5H6Q A;  5IT9 K;  2RHA A;  1PP8 F;  2NRA C;  2DFF A;  2XAU A;  4X1E A;  3IKT A;  5LBQ A;  3V42 A;  5E1X A;  1DP3 A;  1QZZ A;  4M71 A;  3VDX A;  1KGS A;  3G6E I;  4A3E J;  4WCG A;  2X6Y A;  3HXL A;  1G3Y A;  2DFI A;  4XID A;  1YO5 C;  4P5O A;  1P7I A;  2NVU B;  2GIV A;  1VQN I;  3IV5 A;  4P96 A;  2DA7 A;  2PQ8 A;  2XF7 A;  3DBR B;  4CCM A;  1CF7 B;  1HST A;  5FKL A;  2Z99 A;  4N4N B;  3I59 A;  4HV5 A;  1DU0 A;  2JZY A;  2FBK A;  1JKO C;  5DEQ A;  3V78 A;  3M8E A;  3EQL F;  4G8X A;  2JJ7 A;  2MA3 A;  2X6O A;  3TO7 A;  3SFI A;  1ONV A;  3RIR A;  1N78 A;  1WVR A;  2ZOY A;  5J1R A;  5CVV A;  4GYG A;  3JRD A;  3K9T A;  4AYB A;  3Q9S A;  4ZYD A;  4RMN A;  3OL3 A;  3MMY B;  4ITV A;  1W36 D;  2CUZ A;  3COL A;  3H5R A;  3P5J A;  3IWF A;  3BTC A;  4AIJ A;  2PX9 A;  1BR1 A;  1V5G A;  4HBL A;  2ZJ2 A;  2VKE A;  3EPZ A;  4KIF A;  1MBH A;  1I3Q J;  3SDG A;  1K6O A;  1DUX C;  4A3C J;  2P5L C;  5D4S A;  1IO2 A;  2A3S A;  3HOY J;  1IUY A;  3E6M A;  1WSU A;  1STZ A;  4UXN A;  1DGW Y;  2X4H A;  3VW1 A;  3D5L A;  5J40 A;  2K27 A;  4CIC A;  5CXI A;  1OQY A;  3FZV A;  1MMS A;  4AUX A;  4C2U A;  3R0A A;  3HTI A;  4C3I J;  2YR2 A;  2UXX A;  2KL4 A;  1OYI A;  3QU6 A;  2F5D A;  1IN7 A;  1X3W B;  2CRG A;  4FAS D;  1IRZ A;  3SWH A;  2EIJ H;  1XB4 A;  3V4G A;  2PMU A;  1K4S A;  2JQ7 A;  4LGW A;  4MTD A;  5FKK A;  3ZGK A;  4XLN F;  2RQP A;  4JX6 A;  2YU9 J;  1PP7 U;  3S16 J;  2ADU A;  3VVY A;  3W6V A;  5DM6 F;  3C7J A;  2BOL A;  4RB3 C;  3CF2 A;  4H0E A;  2WBM A;  2E2I J;  3QOP A;  1QBJ A;  1WGX A;  3Q0U A;  2XGX A;  1DPU A;  1MMD A;  1ZEL A;  1V4R A;  3DFG A;  4A0Y A;  3FM5 A;  2DW4 A;  4U9L A;  2FXA A;  2H27 A;  5HBU A;  1R9T J;  2DA6 A;  5ILV A;  4B4C A;  1E3O C;  3G7R A;  3BZK A;  3BOQ A;  4LB5 A;  5HSZ A;  5FRN A;  4L9J A;  1WWX A;  3SFZ A;  2XF5 A;  3FMR A;  3Q0V A;  1FY7 A;  2Z33 A;  4BE2 A;  3ZMV A;  4M72 A;  4OIQ F;  5FO5 A;  1KU3 A;  1X2N A;  2IS1 A;  3C2G A;  3S1N J;  3FF5 A;  2E36 A;  3SQN A;  1G6N A;  3LWF A;  1WKM A;  5ED4 A;  2HWV A;  2VPL A;  1I39 A;  3FIS A;  3GX4 X;  1R23 A;  1WJ5 A;  4PJN A;  4D0P A;  4NQW B;  1ZGW A;  4E7J A;  3CUO A;  2XB0 X;  3NPI A;  4ZTF A;  1ODD A;  3TL4 X;  3COA C;  3HHH A;  1OCZ H;  4HLX A;  3BJO A;  2LRE A;  1SEU A;  3IRQ A;  4I0A A;  3UNG C;  2HYG D;  4QWQ A;  3KYC B;  1ZLK A;  1JT0 A;  4G6Q A;  1R71 A;  3O3K A;  3OL4 A;  1TQM A;  3BCG A;  2JPC A;  3GWZ A;  4WXC A;  3VVX A;  4CZC A;  1EA3 A;  3OV8 A;  3JRC A;  1ITY A;  2MW8 A;  3BRO A;  1ORK A;  3RQ4 A;  4B1R A;  1MBK A;  5EF6 A;  4A3B J;  4XSZ F;  1MW7 A;  4XKB A;  5GTI C;  4XLH A;  2FX0 A;  4KNY A;  4KT5 C;  1FBS A;  5BMZ A;  2L7K A;  1OFC X;  5F04 A;  1GDT A;  2G0E A;  3VW0 A;  3GFJ A;  1S9H A;  3RH2 A;  4CUG A;  2VJJ A;  1WPK A;  1K6Y A;  2DA3 A;  1KU2 A;  1K83 J;  4Y3O A;  3VP5 A;  5IT3 A;  2KJB A;  5E3L A;  2F6C A;  1Z77 A;  3H3U A;  4PJM A;  1XD7 A;  5BOX A;  2BV6 A;  3HTA A;  1UMQ A;  2DOE A;  3DBH B;  3K4M A;  4UVB A;  5DUK A;  2NYX A;  3A2K A;  1BI0 A;  2OU2 A;  1CGP A;  2DMN A;  3IH2 A;  3PNT A;  4AC0 A;  3AKZ A;  3QYB A;  2PJR A;  3ZQQ A;  3C2B A;  1G4D A;  4IHS A;  1Y0U A;  3CES A;  4FQG A;  2QOP A;  2HZD A;  1QA6 A;  3OR2 C;  3HSF A;  1G2H A;  1XMX A;  2E71 A;  4KN4 X;  2Z1D A;  5JVT A;  3LSJ A;  2UZK A;  2I10 A;  2CQQ A;  3Q5F A;  1RUN A;  4J19 A;  3W6J B;  3WGG A;  1BI1 A;  3NRG A;  4F7Z A;  1IAW A;  4RB2 C;  1Y6I A;  1YS7 A;  2CYY A;  2D1V A;  2HYT A;  2DK5 A;  3ESW B;  1U9O A;  1SD7 A;  1DP7 P;  3BJA A;  3KCC A;  1MSF C;  5M3F J;  5EGO A;  4GCT A;  1ZH5 A;  2IGM A;  4DJA A;  1UST A;  3KP5 A;  1QPM A;  1QZY A;  4LB6 B;  3CMY A;  2ZFU A;  4UB8 C;  3HOX J;  2Y9Z A;  3U2R A;  3WTS C;  2ISY A;  2KFD A;  1BW6 A;  2LDU A;  3WTY C;  2G3B A;  5K5O A;  1JT6 A;  1XPX A;  4BDY A;  2KDO A;  1R7J A;  2BHZ A;  4L5E A;  3E7Q A;  2KPM A;  3GBG A;  3WTZ A;  1K79 A;  2KHM A;  3KFW X;  3FK7 A;  2O7T A;  1BI3 A;  4MK6 A;  3CDL A;  1TL8 A;  3GTM J;  1MBJ A;  2K4B A;  2HI3 A;  1J0R A;  2NNY A;  1TW2 A;  3BQZ A;  1VZ0 A;  3TED A;  1Z7L A;  4XLE A;  1AWC A;  4BBS J;  2IGO A;  4XOT A;  1K78 B;  2XSD C;  5TIS C;  4C9Y A;  4IQJ A;  3KP2 A;  2E5Z A;  2EZI A;  2TCT A;  5KAI C;  1SGM A;  5FGL A;  3KEY A;  2XAF A;  1T0F C;  2R5Y B;  5C4Y A;  4UUT A;  2QBY B;  2HOT A;  3F8M A;  3CCR I;  2M4G A;  3VUQ A;  1LE8 A;  3HIF A;  3LL7 A;  2X0L A;  4FET A;  4KFC A;  4BJ5 C;  1TWG J;  2KQR A;  4XRM A;  3TO6 A;  2W00 A;  3DV8 A;  3ZQ7 A;  1OCO H;  1ZRE A;  2P8T A;  5IT9 Z;  4B3A A;  1W7P B;  2DO7 A;  1AU7 A;  3ZN1 A;  3KET A;  1HSJ A;  3F22 A;  2W1O A;  2RQQ A;  2M5W A;  4A5M A;  1L0O C;  3KP7 A;  2JMW A;  3AG4 H;  1TWH J;  2FOK A;  3F8C A;  4U7B A;  4GGG A;  2ELH A;  1FZP B;  1ETO A;  1IC8 A;  4RLF A;  1JHH A;  2QQ9 A;  2ZKZ A;  3BWG A;  3FX3 A;  2PLY A;  1JUS A;  2CSO A;  3OWT A;  3L7W A;  3WTT C;  1YHQ I;  2KDZ A;  4WXD A;  3R60 A;  2L01 A;  1FSE A;  1XSX A;  2A05 A;  5E79 C;  4IPA A;  3BG9 A;  2ELJ A;  1SD5 A;  2QF7 A;  3FXK A;  2FQ3 A;  3AFH A;  5FGM A;  2FNA A;  3ANG A;  4LJZ F;  3HOT A;  4PZJ A;  3VB2 A;  2Q24 A;  3SZG A;  1WHU A;  1TWF J;  2DA4 A;  2CFX A;  2O3F A;  3S1Q J;  3A1Y A;  4L9N A;  3V7C A;  4MQ9 F;  1RUO A;  1NK2 P;  3ANP A;  4ZH4 F;  3HOV J;  3W2W A;  2QSH X;  3L9F A;  1LDK B;  1R1V A;  4DGW B;  5J8C A;  1R36 A;  2K85 A;  2NOJ B;  4G94 A;  1T0F A;  3AG2 H;  2HOS A;  5JLX A;  5JHU A;  3K1P A;  4GFL A;  4WWC A;  1XMA A;  3HTU A;  4HSR A;  2XC7 A;  2F07 A;  2D2W A;  1IG7 A;  2VXZ A;  2XPU A;  4YFX F;  2PN6 A;  5DM7 F;  2W7N A;  1OYY A;  3PSI A;  3GTO J;  3FXQ A;  4IF4 A;  1RES A;  2IEK A;  3HKZ N;  2LFB A;  3LQR A;  2H6C A;  1WH7 A;  1YFH A;  4HG2 A;  3VWB A;  5L3B A;  1AOY A;  3BLY A;  1PUF B;  4UVC A;  3KLN A;  3BJB A;  5D8K B;  4OMY A;  2RN7 A;  3P9C A;  3DCF A;  3KPH A;  1OPC A;  3RCO A;  1YX3 A;  5D5X B;  4AWX B;  2VKD A;  3N4M A;  2ZNY A;  3D1N I;  4XQF A;  1D8K A;  2LNB A;  2F2E A;  1J75 A;  3FXO A;  3HUG A;  3VFZ A;  3K2Z A;  4G7H F;  2GAU A;  2BY2 A;  1FOY A;  2FNP A;  2KZV A;  1MDM B;  4KYW A;  1FOK A;  4HKU A;  4I0B A;  2VT3 A;  3IWZ A;  2XAQ A;  3E6C C;  1GVD A;  4G6D A;  2KJC A;  1APL C;  2ZCN A;  2V1D A;  4JQF A;  3OSG A;  1V5E A;  2K9M A;  1IRF A;  3H9G A;  2L9R A;  2YVE A;  2QCO A;  3LSG A;  2OV7 A;  1A31 A;  3M9A A;  5CVJ A;  2CQX A;  4I99 C;  4JL3 A;  3AAF A;  4IZZ A;  1W36 C;  5J1U A;  2FUG 2;  2EFQ A;  3HRU A;  2QM3 A;  4IRH A;  1IN4 A;  5K7Z A;  2L9N A;  4LG0 A;  3W3C A;  2Y0S N;  2A6H F;  4BQN A;  3L09 A;  3J7A Y;  4G6T B;  5GP9 A;  3IUV A;  4Y15 A;  4N0B A;  5J1Y A;  1D1B A;  1D1C A;  4IOC F;  4NUB A;  5FRM A;  4I6Z A;  2V1U A;  2RRE A;  3ZN0 A;  2PZ9 A;  4NC8 A;  4OIR F;  2PBI A;  5KHD A;  4NNJ A;  4KMF A;  1XCB A;  2I8D A;  5GAD J;  3NWT A;  1BR4 A;  1MZB A;  2NS0 A;  3V8K A;  3V7S A;  1SVO A;  4IRG A;  5EJC A;  2ME0 A;  5DYM A;  4ENM A;  4MTE A;  2CMP A;  2QUF A;  5BPI A;  2XKO A;  1KU9 A;  5EYR A;  2M87 A;  3JRI A;  5D19 A;  3F9K A;  2F5E A;  3DWL E;  4UB6 C;  3PFY A;  1IN5 A;  2KIS A;  1P4X A;  1AKH B;  5KK1 A;  2NXN B;  1IUF A;  1QRY A;  2K9Q A;  2XAH A;  2F5C A;  3VYU B;  1YX5 A;  5L3D A;  4YRV A;  5J4V A;  3DPJ A;  5LHG A;  3EYY A;  3LSR A;  1P6R A;  2FF4 A;  3W2V A;  2RNJ A;  4JOM A;  2JSP A;  3FKI J;  1SFE A;  2HTS A;  1YIJ I;  3Q9V A;  1VQP I;  3JSJ A;  3U21 A;  5LLQ A;  1FX7 A;  1TLH B;  3S93 A;  2IT0 A;  3G2B A;  4XBF A;  1UHM A;  3GLX A;  4BQO A;  3BZ6 A;  2DA1 A;  3DLA A;  2O7O A;  5LGN A;  2VUM J;  5AON A;  2L9S A;  2MH2 A;  4EV0 A;  2UXI A;  1YTY A;  4V2G A;  1RR8 C;  5LFA A;  4OAZ A;  2COB A;  2G7U A;  4YIF A;  3TOB A;  3S8P A;  4W97 A;  3FK6 A;  1EF4 A;  1BOB A;  2XHK A;  1WJE A;  2VL8 A;  4ZTJ A;  1NH3 A;  4C3H J;  3BCB A;  4S04 A;  2YVX A;  3JW4 A;  3T5X A;  4HF1 A;  1CF7 A;  2DTZ A;  3BR0 A;  3PM1 A;  2HVR A;  2IW5 A;  1MKM A;  2OZU A;  3H9Q A;  3PIP F;  2H1L A;  2FMY A;  1OR7 A;  2AO9 A;  2EH3 A;  2Y9Y A;  2IP2 A;  1IRG A;  4FIS A;  4HNV A;  2K9L A;  4HLY A;  2IBD A;  4PXI A;  3HPG A;  3K6G A;  2L7Z A;  3E5X A;  4BGD A;  4AIK A;  3QWL A;  3HJE A;  2KZG A;  5E8G A;  4ZZL A;  3LSH A;  2EA4 A;  4EGZ A;  3T1B A;  5E18 F;  1LVA A;  1SAN A;  2KLO A;  1FMW A;  3CF5 F;  3TKY A;  1VQL I;  2GUH A;  1XSV A;  2M8G X;  1H88 C;  1TW3 A;  2IXS A;  4RM3 A;  2OQG A;  3WTX C;  2AXL A;  3PUB A;  3KX2 A;  2R7Z J;  3TP3 A;  2QGU A;  3RYP A;  2E2J J;  4QPQ A;  2OI8 A;  4AD9 A;  3M3Y J;  3ERM A;  3LQQ A;  2JA8 J;  1D0Z A;  1X3U A;  3G4S I;  2L4A A;  1D0X A;  3GEZ A;  2WY8 Q;  2QQ8 A;  2F48 A;  3BG7 A;  2OF7 A;  3ZP5 A;  4UV9 A;  3WOD F;  2L02 A;  2PFV A;  2V4J C;  4A6D A;  1EH6 A;  5D5V B;  2VOP A;  3I56 I;  5HLT A;  1U78 A;  1ACI A;  2UXO A;  3J80 Z;  2K9S A;  4B48 A;  3P9I A;  4ZJZ A;  4IRI A;  1HKT A;  3P9T A;  1R6R A;  4CDG A;  3DKW A;  2HQN A;  1PJR A;  1O3S A;  1ZKG A;  4E7L A;  2QVO A;  1JKR C;  3LNQ A;  2X1C A;  4S05 A;  3F8N A;  4CCL A;  2L7M P;  2VC1 A;  2UV1 A;  2W57 A;  4DIQ A;  1JUM A;  5F64 A;  1WI3 A;  2R92 J;  3L2W A;  2OTL I;  3QOD A;  2H94 A;  1R58 A;  2PMZ A;  3VSK A;  1YLF A;  1S6L A;  2L5Q A;  3QPT A;  3HTH A;  3TDU C;  5DD8 A;  3E7L A;  3O2P E;  3WG9 A;  1VTN C;  2Y2Z A;  3C2H A;  4CH7 A;  4Y33 A;  2H09 A;  3BR5 A;  3KKC A;  2QKL B;  2F4O B;  3FHZ A;  5L3G A;  4BHB A;  2HDC A;  2LF8 A;  4LIU A;  5F0F A;  5LD2 C;  3DPU A;  1E17 A;  2DFE A;  3S3M A;  4ZYH A;  1HW5 A;  1JTY A;  2EB7 A;  3R0J A;  3LSI A;  4NQW A;  5LHI A;  1S7A A;  1HDP A;  4KUM A;  2H6B A;  5JI6 A;  1Y39 A;  2B7E A;  5K5R A;  2YUS A;  1YS6 A;  4KIB A;  3OYM A;  5CXG A;  3JRG A;  2DAO A;  1B59 A;  2OAZ A;  2VKV A;  1IZ1 A;  2K9N A;  3H5A A;  4Q5S F;  2EPF A;  1O7F A;  3FM3 A;  4G9Y A;  2OC6 A;  1QNT A;  2VKH A;  1YJW I;  1T38 A;  4XOP A;  2VQG A;  1USS A;  1Y8Q B;  5H9T A;  1I1G A;  3IAM 2;  1U8B A;  1H9G A;  2Y69 H;  1LDD A;  4MHG A;  1I6H J;  2R93 J;  1B4A A;  3E1S A;  4II3 A;  3EDP A;  3VOD A;  1X58 A;  1TQI A;  3O8H A;  2LKS A;  3VTI A;  5J47 A;  2JRM A;  4BJT A;  5CJ9 A;  5HDK A;  2JVH A;  3AL0 B;  4HV6 A;  1MBF A;  2DG7 A;  2DN0 A;  2FOW A;  5B1A H;  2P6S A;  1Z7U A;  2GXB A;  4L9T A;  4WF2 A;  1KZH A;  2HKO A;  5AIP A;  2R4G A;  1B6A A;  2ETH A;  3HOU J;  4HZF A;  1X1B A;  3HZJ A;  3NQO A;  2OBP A;  2RVC A;  1IXR C;  3KP6 A;  4CO8 A;  2IAI A;  5JVG F;  1QHH D;  4WX9 A;  3ZRG A;  1Z21 A;  2X6X A;  4E4H A;  4E7H A;  4HYE A;  1RET A;  2JK3 A;  2CO5 A;  2LVS A;  2PG4 A;  3BG5 A;  1PYV A;  2NNN A;  4RGS A;  1JKP C;  5CYV A;  5CW8 A;  1GUU A;  5L3C A;  2XPW A;  4GO1 A;  4DZJ A;  1T6S A;  3M1E A;  2D6Y A;  3DF8 A;  3NRV A;  3HB9 A;  4M6Y A;  4F52 A;  1J9I A;  4ZDO A;  2E19 A;  2FSW A;  5D5U B;  1JTX A;  1Z91 A;  2E5N A;  5J6X A;  1UAA A;  2ID3 A;  4RM2 A;  3GZI A;  3H9J A;  4U87 A;  5ICC A;  3PO2 J;  2OA4 A;  3OIO A;  3WGI A;  3OYB A;  1NG7 A;  3A02 A;  3HGY A;  3OYK A;  3L2V A;  1Z6R A;  3QBM A;  1FMV A;  3ONQ A;  4ETS A;  5K7F A;  3ABM H;  2CG4 A;  1OLT A;  2VQH A;  3S2W A;  4RLQ A;  4LOC A;  4BBR J;  3LA7 A;  2GOX B;  4DW6 A;  5D4R A;  1TWC J;  5TJJ A;  2Y0S A;  2GXA A;  2Z9O A;  2LTP A;  4ESJ A;  2R7F A;  1U8R A;  4D1Q A;  3BPX A;  1W5T A;  2VIX A;  1T33 A;  4C2T A;  3KZI C;  3I0T A;  3QPL A;  2RAS A;  2NOG A;  2W53 A;  4IHW A;  2JA2 A;  1MJA A;  3WU2 C;  3U1D A;  2BY3 A;  2A2F X;  1UFM A;  2JSC A;  3I9V 2;  4ENJ A;  1F4K A;  2UXN A;  2V6C A;  3E0J B;  2JN6 A;  4XRS G;  2KP6 A;  1ZG3 A;  2LMD A;  1TP4 A;  2ZME C;  1K78 A;  4KWA A;  2CUF A;  4CGR A;  4K2E A;  3OYL A;  1VF9 A;  2IJL A;  5BQT A;  3SJM A;  4QIW N;  2R5Y A;  2WV0 A;  3ZCO A;  3VVZ A;  1ZQ3 P;  2QBY A;  2PEX A;  1H9T A;  1OCP A;  5K1Y A;  1Z0X A;  1XC5 A;  3HE0 A;  3KNW A;  3ZMS A;  2B1E A;  2UWM A;  2FBH A;  4HA8 A;  1OYW A;  5H20 A;  3W6K B;  2GA2 A;  3RKY A;  3RPQ A;  3RYR A;  4XL9 A;  3K4L A;  3ABT A;  5IP9 J;  3CUQ B;  2WGB A;  3F1B A;  1TZL A;  1XDU A;  1W7P A;  1WJB A;  2Z5U A;  3F72 A;  4IHX A;  2A61 A;  1KYZ A;  3K10 A;  2DDB A;  3EUH C;  2IRF G;  1WRJ A;  4P1W A;  4XMY A;  2UXH A;  3GW2 A;  3K4C A;  2BVM A;  4XLA A;  3CCS I;  3HOS A;  3S3N A;  3CCL I;  2HPM A;  2QSG X;  3I64 A;  3N05 A;  4IXA A;  3BHQ A;  4GDF A;  2Y31 A;  1TTY A;  5D5W B;  2A5Y B;  4FX4 A;  3FBN B;  3IHU A;  4XIC A;  1YI2 I;  1G3S A;  2XAG A;  2L0K A;  5E1Z B;  4X6A J;  3DKY A;  3H36 A;  2BYV E;  2EA2 A;  4M6X A;  4B8X A;  4IHT A;  5E17 F;  2EWN A;  5JFR A;  3KYD B;  1CQT A;  3RKX A;  2TDX A;  1QVU A;  3KEQ A;  1ON2 A;  1KQ9 A;  1W0T A;  3FXL A;  1A35 A;  2DPU A;  1G3W A;  2ZC2 A;  4IRV A;  1RIO H;  1A36 A;  3NAR A;  2ZME A;  3EUA A;  2EFW A;  5FLX K;  5F1J A;  1ETQ A;  1ERD A;  1MNE A;  4XK4 A;  4HST A;  1SVL A;  2XAJ A;  4XR6 A;  2XRO A;  2LSO A;  4B47 A;  4EJO A;  3ZQC A;  4UUV A;  1J2X A;  3H35 A;  2P7C B;  1UI5 A;  3VEP A;  1UB9 A;  3S32 A;  2KMU A;  3OIQ A;  4I98 B;  2RKH A;  3HG9 A;  1Q1V A;  3TQN A;  2JA7 J;  5HOO A;  1U5T B;  4OIP F;  1BC8 C;  1YYV A;  1FP2 A;  3EUH A;  5GTH C;  2O8X A;  4IHY A;  2UXU A;  4C30 A;  2P81 A;  4M3B A;  4PFP A;  2ZJP F;  1S7E A;  1XN7 A;  1MH3 A;  2Q2E B;  4PDK A;  2E60 A;  1TT5 B;  3RPU A;  3VOE A;  1JE8 A;  2LOO A;  3ML6 A;  3LMM A;  5TGT A;  3IRR A;  4A69 C;  3CWR A;  1B1B A;  2NVT J;  3FHN A;  3C18 A;  3ZMT A;  1IV8 A;  2G7H A;  5C4J J;  1MH4 A;  5C4X J;  3V8L A;  5CQE A;  2HXO A;  2K3P A;  2MGQ A;  1HOM A;  1ZTR A;  2M8E A;  2GEN A;  3CRJ A;  2AQE A;  2VE9 A;  2O03 A;  2R5Z B;  5A2Q K;  2QTQ A;  1LVK A;  2ISZ A;  2K40 A;  2KRF A;  3BTI A;  3MKL A;  2WV1 A;  2MH9 A;  3CCQ I;  5IYD J;  2E35 A;  3X2Q H;  3K4B A;  1O3T A;  2HQA A;  5E3M A;  2ZBK A;  2E1M B;  4BEH B;  4DOZ A;  3A01 B;  1ZR2 A;  5HLG A;  4EJV A;  1YE9 A;  3DPL C;  3BDD A;  4LMY A;  2XUB A;  3J7A O;  3RI4 A;  1ZGJ A;  2JVG A;  2E7W A;  4O6J A;  4XLP F;  4HQE A;  2ZSI B;  4AVP A;  2DMT A;  2K4J A;  4XON A;  4RAZ A;  5EDN A;  4J00 A;  1NHA A;  2WAD A;  2JTV A;  3ABK H;  4RAY A;  2R7S A;  1SAU A;  4IJA A;  1YIO A;  1LJ9 A;  3CCE I;  3CMA I;  4BE0 A;  3SEZ A;  4Q48 A;  1ZR4 A;  1Z6T A;  1ETW A;  5DUI A;  5LGU A;  4ZYA A;  4ESF A;  5D18 A;  2VLA A;  3BP8 A;  1TWA J;  5TRD A;  2K02 A;  4E7K A;  5IOZ A;  5FKO A;  1XMK A;  3R4K A;  1K7A A;  3HOW J;  1B9N A;  3MD2 A;  2WB1 N;  5ICF A;  4EJW A;  3F0C A;  1AKH A;  1MGT A;  2R7Q A;  2GLO A;  2JRT A;  1JJ6 C;  4HOB A;  3OR1 C;  2YPR A;  5CVU A;  2EV0 A;  3G3Z A;  3E6B A;  2VOO A;  2ZXW H;  3FMS A;  4N9H A;  1ZK8 A;  1EH7 A;  1G8X A;  2HVS A;  1SAX A;  3J7Y J;  4YEL A;  4NN1 A;  2MD0 A;  2DU9 A;  2BXY A;  2V1N A;  4G7O F;  3BRU A;  1BIA A;  3M4O J;  1PVE A;  2BGC A;  4BE1 A;  4M3F A;  4KDP A;  3FRQ A;  1FYL A;  3A03 A;  1HDD C;  4CHU A;  1N25 A;  2CW8 A;  2V57 A;  5C44 J;  1ZHF A;  2CQ7 A;  2EFN A;  2WTE A;  3S15 J;  3S2H J;  5F0C A;  2OTJ I;  4GCK A;  3LSP A;  1TNS A;  3I5U A;  3E5Q A;  4IQ4 A;  1BOA A;  1QQI A;  2GXG A;  1I1S A;  1G3T A;  4ZC3 A;  3ISP A;  4Y4R A;  4CCJ A;  4CYC B;  1YG2 A;  1SFX A;  4Z6Y A;  3NI7 A;  4EQQ A;  3AG1 H;  2V26 A;  4PCQ A;  1WJC A;  2GFN A;  3B81 A;  1RPW A;  3PAS A;  3CMM A;  4JNN A;  3FKJ A;  3I58 A;  4NHJ A;  3F6V A;  4HNU A;  3F21 A;  2X9D A;  4M9S A;  1TNT A;  2OCE A;  3BNI A;  3QAH A;  1LUJ B;  3KLO A;  2MG4 A;  4YEJ A;  5KVR A;  3K8P C;  5GAH J;  4GRI A;  2RAE A;  3RJP A;  3GTG J;  2WAQ N;  2XAS A;  3VOK A;  1SMT A;  1Q1H A;  4A93 J;  3BG6 A;  1X4O A;  4IL6 C;  1W7P D;  1FPQ A;  2DTR A;  5IYC J;  4N9I A;  1TT0 A;  1XGN A;  5FB2 A;  1HCR A;  2IGK A;  3GYH X;  3NEU A;  4OD5 A;  2X51 A;  2XRN A;  2XB5 A;  1FP1 D;  4B3X A;  3HOZ J;  2EZH A;  2ZY9 A;  1XGM A;  4PUS A;  4D5C A;  4XNF A;  2NAZ A;  3PFI A;  3K0L A;  3CP8 A;  4MQV A;  3ZMD A;  4MO7 A;  3GFI A;  4A3G J;  5EG0 A;  2LBF B;  4U9N A;  4PSW A;  4QSH A;  4UUS B;  3JRB A;  2EFO A;  3GME A;  5HS8 A;  2HDD A;  2CW0 F;  4LG3 A;  3GTQ J;  2BBY A;  2FJ1 A;  1KA8 A;  4Q47 A;  3DEW A;  1FBQ A;  3NS4 A;  1DGR M;  2NP5 A;  2PMH A;  2J5P A;  1I6X A;  3TOA A;  2R7D A;  4KJZ A;  3BTL A;  1REP C;  3MQ0 A;  1MMG A;  1GVJ A;  2ZNZ A;  1UHW A;  2GIZ A;  3FXM A;  1D8J A;  2TRT A;  1FTT A;  1J59 A;  1X4P A;  3V7R A;  4ENN A;  2HXI A;  3FIW A;  2R7O A;  4AIH A;  2HKU A;  1O7L A;  1GV5 A;  5HOD A;  1G59 A;  3KIO A;  4Y52 J;  3HM5 A;  1DQU A;  2A07 F;  2GWR A;  5K58 A;  1NG6 A;  1V54 H;  2DQL A;  3ASN H;  3F6O A;  3BC8 A;  1V5F A;  2WC2 A;  3BY6 A;  4M3E A;  2DCE A;  2DYS H;  4MLO A;  5F08 A;  1FIP A;  5DS9 A;  1D5V A;  1IDZ A;  5HLI A;  1OCT C;  4H4K C;  4J01 A;  1KU7 A;  4HPQ A;  3MFK A;  1JJ8 C;  4RB1 A;  4XRF A;  1EJ9 A;  4XRS A;  2EZL A;  5J8F A;  1B9M A;  3EGQ A;  3K2A A;  3JRF A;  1R00 A;  4DYQ A;  3MWM A;  2Z16 A;  3S17 J;  1VQ8 I;  1UG2 A;  2M7B A;  3ON4 A;  1ZAO A;  3DBL B;  4XN3 A;  4HF0 A;  5CVR A;  3RPU D;  2XGC A;  3AL0 C;  5D6F A;  2YS9 A;  4QTR A;  5EGO B;  2VON A;  3VPR A;  3MCZ A;  2LY2 A;  2NVY J;  4LD5 A;  2M0C A;  2HEO A;  2BEO A;  3SXY A;  3OS1 A;  2GOM A;  4I2O A;  4R8H A;  2AS5 F;  2VOD A;  3GFL A;  3GZ5 A;  4GFK A;  1MMA A;  1XG1 A;  3S1R J;  3R6S A;  3GTP J;  2V79 A;  4RDU A;  2D45 A;  1IGN A;  2HGC A;  1B72 B;  1OR7 C;  1XSD A;  4QPO A;  3TW6 A;  4BYY A;  3LAJ A;  2A5W A;  1V55 H;  2BVL A;  5H6R A;  4GCV A;  2RGV A;  4LLN A;  3WTW C;  3S3O A;  2VBY A;  3CCM I;  1JI8 A;  3OSF A;  4M9Z A;  4ANJ A;  4W1U A;  4LIV A;  5FLX Z;  1YRN B;  3BPV A;  1YJN I;  1MJ9 A;  2IS4 A;  2VPR A;  3SZP A;  2R7U A;  3LA2 A;  4ZYE A;  3JRH A;  4QLC U;  5E8I A;  1KQ8 A;  4UY8 I;  3DLL F;  3CC7 I;  3I4N J;  2ACJ A;  2D1H A;  3F8B A;  2ECC A;  3NAU A;  4XOR A;  3L00 A;  2LLK A;  3OMY A;  4JP0 A;  2EJR A;  3ECO A;  3CME I;  3B6A A;  4A3I J;  5DCM B;  2IGN A;  2W84 A;  1O3Q A;  5ICE A;  1BW5 A;  3SEQ A;  5EEG A;  1ZLJ A;  2VE8 A;  4HX4 A;  1A6Q A;  2MYS A;  3RZO J;  5FMP A;  3DEE A;  2RNG A;  1YJ9 I;  2GZW A;  1DU6 A;  3EUK L;  4E7Z A;  5B66 C;  2L7F P;  5HVQ C;  1U0J A;  2O6G E;  2DXI A;  3HIM A;  1MSE C;  2R7W A;  3S1M J;  3OYA A;  3K1N A;  2YVH A;  5E1W A;  3CJQ B;  5L3E A;  3WE2 A;  1GXQ A;  2XKP A;  3JTG A;  1Z05 A;  3MKW B;  1TBX A;  2IPQ X;  4LK0 F;  3C1D A;  5HDN A;  3D5R C;  2RC4 A;  2F4I A;  2G7S A;  2FU4 A;  3FDY A;  4OU0 A;  2XSJ C;  5CLS A;  2DPD A;  3PQJ A;  1H0M A;  5F6F A;  3W2A A;  1TC3 C;  3DU6 A;  1YOV B;  2Z3Y A;  2KIM A;  1IXS B;  2DI3 A;  4BY1 J;  3BR3 A;  2ECB A;  2EFP A;  4A0Z A;  3CCU I;  1VQM I;  2W4S A;  3GTK J;  3G1O A;  4A5N A;  1OCC H;  4M74 A;  4MFD A;  2DMQ A;  3J7Z I;  3WTU C;  3HYI A;  3V8J A;  3RKW A;  3DQV C;  2HOE A;  3OOU A;  5GPA A;  4GXO A;  1JHF A;  1LKX A;  2XV4 S;  2K86 A;  5FFX A;  4I76 A;  3REO A;  2JA5 J;  4MFE A;  4ZZD A;  3KKD A;  2QEX I;  5DDG A;  5B1B H;  4ZDP A;  3L2U A;  2UXP A;  2ZJR F;  3J81 K;  3OYJ A;  1WZ2 A;  1S8N A;  4L9V A;  4BAY A;  4JX5 A;  3OYH A; 
#chains in the Genus database with same CATH homology
 4J19 A;  3S2D J;  1QPI A;  3NRG A;  4AYB N;  4LOC A;  4BBR J;  4D7M A;  3RKQ A;  4DW6 A;  5FHP A;  4S0H B;  1TWC J;  1VFC A;  1QVT A;  2HYT A;  3MNL A;  1U9O A;  2LTP A;  2NVQ J;  1MSF C;  1VND A;  5M3F J;  5EGO A;  1T33 A;  2DA2 A;  4GCT A;  3CMY A;  3QPL A;  2NP3 A;  2NOG A;  2CJJ A;  5EEA A;  2RAS A;  2W53 A;  3HOX J;  4IHW A;  2Y9Z A;  5JLW A;  2JA6 J;  1BW6 A;  2G3B A;  2OPT A;  1JT6 A;  1ENH A;  3V6G A;  3ZQG A;  3NXC A;  4L5E A;  3E7Q A;  2JN6 A;  4XRS G;  4ABZ A;  3GBG A;  5M3M J;  4JKZ A;  4FTH A;  3FK7 A;  2O7T A;  4KWA A;  2GM4 A;  2CUF A;  4MK6 A;  3CDL A;  4CGR A;  3PPB A;  1VF9 A;  3GTM J;  2MSY A;  1MBJ A;  2HI3 A;  3SJM A;  4QIW N;  3BQZ A;  2R5Y A;  4YZE A;  3BR1 A;  4BY7 J;  3TED A;  1ZQ3 P;  4BBS J;  3H0G J;  3BRU A;  4ME9 A;  3BR2 A;  1OCP A;  1T56 A;  1Z0X A;  1XC5 A;  3HE0 A;  3KNW A;  2XSD C;  1SGM A;  2EZI A;  2TCT A;  2FBQ A;  5FGL A;  4Y7N J;  2R5Y B;  5C4Y A;  4UUT A;  2G7L A;  2HOT A;  2WGB A;  5IP9 J;  2O8K A;  3F1B A;  4IHX A;  3VUQ A;  1LE8 A;  5FLM J;  4C3J J;  5GPC A;  1UI6 A;  4XRM A;  1TWG J;  2UXH A;  2EZK A;  4B3A A;  4IEJ A;  3QKX A;  1LE8 B;  1AU7 A;  1U9N A;  3BHQ A;  4A3D J;  2Y31 A;  1W0U A;  5HAW A;  4XIC A;  2JMW A;  2DJN A;  1H8A C;  1TWH J;  2L0K A;  4NDL A;  2CU7 A;  9ANT A;  4X6A J;  1ETO A;  1BJZ A;  1LFU P;  1IC8 A;  4A3F J;  2X48 A;  2E1O A;  1NTC A;  1JUS A;  3RD3 A;  2KDZ A;  2XDN A;  1CQT A;  1QVU A;  4FCY A;  1GT0 C;  3BTJ A;  1B8I A;  1W0T A;  3CJD A;  5DAJ A;  3BG9 A;  2QF7 A;  5IP7 J;  3NAR A;  2HQ5 A;  5FJ8 J;  2NX4 A;  3ANG A;  2Q24 A;  5F1J A;  1TWF J;  1ETQ A;  2DA4 A;  1B8I B;  3S1Q J;  3L1P A;  4L62 A;  4XK4 A;  2JWT A;  1NK2 P;  3ANP A;  3HOV J;  3ZQC A;  4AC6 A;  4A3K J;  4IHV A;  1UI5 A;  2ZOZ A;  3LJL A;  4M3D A;  2HOS A;  5JLX A;  4GFL A;  2LD5 A;  5DTD A;  3H3V K;  1ETX A;  2N8G A;  2F07 A;  1Q1V A;  1IG7 A;  2JA7 J;  2XPU A;  5IYB J;  3RZD J;  2FD5 A;  5F27 A;  2UXU A;  1POG A;  5C3E J;  4IHY A;  3GTO J;  2P81 A;  4M3B A;  1RES A;  2IEK A;  3HKZ N;  2LFB A;  4AF5 A;  1S7E A;  1MH3 A;  4D5F A;  2LP0 A;  3WHC A;  4FE4 A;  1A6I A;  1WH7 A;  3RQI A;  4C2M J;  4V2F A;  4A69 C;  1PUF B;  3CWR A;  1JGG A;  3BJB A;  4JYK A;  5M5W J;  1FJL A;  3HDD A;  2NVT J;  3AQS A;  3HGG A;  2FQ4 A;  1XS9 A;  2R5Z A;  3ZOB A;  5C4J J;  1MH4 A;  3HEF A;  3DCF A;  5C4X J;  2DMU A;  4DYC A;  2HXO A;  2MGQ A;  4GFB A;  1RR7 A;  3D1N I;  2XPV A;  1ZTR A;  1HOM A;  2GEN A;  5M5X J;  3CRJ A;  5EZH A;  4D7N A;  2R5Z B;  4A3J J;  2QTQ A;  4HKU A;  2K40 A;  2WUI A;  3BTI A;  3MKL A;  3B6C A;  1MNM C;  2E2H J;  1GVD A;  2WV1 A;  3A01 A;  1APL C;  3CCY A;  5EG0 B;  2ZCN A;  5IYD J;  2ZB9 A;  3OSG A;  3PO3 J;  2L9R A;  3BT9 A;  1UHS A;  2LR8 A;  2YVE A;  5E3M A;  1OJL A;  2QCO A;  3Q3S A;  3IH4 A;  2QWT A;  3LSG A;  3A01 B;  1ZR2 A;  5EFY A;  4G12 A;  2H8R A;  3S14 J;  2CQX A;  3UKG A;  4JL3 A;  3ZQF A;  4M3G A;  2PBX A;  5J1U A;  1F36 A;  3WHB A;  2ZCX A;  2DMT A;  3QPS A;  5EDN A;  5K7Z A;  2OER A;  4EEF G;  2Y0S N;  3GTJ J;  3ON2 A;  5BNG A;  1D5Y A;  2QIB A;  3LHQ A;  3ZQH A;  5GP9 A;  3IUV A;  2LY9 A;  4UDS A;  5J1Y A;  1Y1W J;  2M34 A;  2DA5 A;  4I6Z A;  5M5Y J;  5E3O A;  2PZ9 A;  1F43 A;  1GV2 A;  1ZR4 A;  2H1K A;  1ETW A;  5D18 A;  2AHQ A;  3BQY A;  1TWA J;  3O60 A;  5IOZ A;  5FKO A;  4MIM A;  2ID6 A;  3HOW J;  3VVZ A;  2EQR A;  1K61 A;  2WB1 N;  2ME0 A;  2B63 J;  3GEU A;  3F0C A;  1AKH A;  2W48 A;  2GLO A;  2R0Q C;  1JJ6 C;  2IU5 A;  3MVP A;  5E3N A;  2LK2 A;  4GCL A;  5EYR A;  5EZG A;  1MBG A;  3JRI A;  5D19 A;  5IP6 A;  1AKH B;  3EUP A;  1ZK8 A;  1IUF A;  1IV6 A;  1QRY A;  3S5R A;  2K9Q A;  2ME6 A;  4NN1 A;  1I50 J;  4BXX J;  5IOY A;  3HTJ A;  3HBL A;  3DPJ A;  3NNR A;  3LSR A;  3M4O J;  5FLV A;  4M3F A;  3FRQ A;  2ELK A;  3O8G A;  3A03 A;  1HDD C;  1VI0 A;  2V57 A;  2REK A;  3FKI J;  5C44 J;  1FEX A;  1MBE A;  4CYC A;  3VW2 A;  3S15 J;  3S2H J;  3G1M A;  5F0C A;  2CUE A;  3JSJ A;  1RKT A;  5IPA A;  4GCK A;  3LSP A;  5K7H A;  3BG3 A;  4ICH A;  1JUP A;  2DA1 A;  3LWJ A;  2O7O A;  4CYC B;  3IH3 A;  2VUM J;  4A3M J;  4JX4 A;  3NI7 A;  3VIB A;  2UXI A;  4V2G A;  3B81 A;  2COB A;  5FKN A;  1RPW A;  3Q0W A;  2GFN A;  3PAS A;  4JNN A;  2G7G A;  5FKM A;  1JKQ C;  2X9D A;  2M9H A;  2DMP A;  4W97 A;  1BL0 A;  3FK6 A;  1O4X A;  1EF4 A;  3BNI A;  3G1L A;  2RHA A;  4X1E A;  2MG4 A;  4C3H J;  2RAE A;  2D5V A;  3GTG J;  2WAQ N;  3VOX A;  2XGE A;  3VOK A;  4A3E J;  4A93 J;  2DTZ A;  2M2E A;  3BR0 A;  1PUF A;  3PM1 A;  4XID A;  3CQZ J;  1P7I A;  5IYC J;  3IV5 A;  2DA7 A;  2AO9 A;  2NS7 A;  1HCR A;  2EH3 A;  2Y9Y A;  5FKL A;  1DU0 A;  4FIS A;  2XB5 A;  1JKO C;  3V78 A;  4HNV A;  4UUS A;  1A5J A;  2JJ7 A;  2IBD A;  3HOZ J;  2X6O A;  2XRL A;  2EZH A;  3SFI A;  4D5C A;  2LKX A;  4PXI A;  3AQT A;  4MO7 A;  5D1R A;  4A3G J;  5EG0 A;  2ZOY A;  2L7Z A;  5J1R A;  4QSH A;  4UUS B;  3JRD A;  3JRB A;  2HDD A;  3KZ9 A;  2QKO A;  3GTQ J;  2DG8 A;  1LFB A;  2FJ1 A;  3DEW A;  1SAN A;  2NP5 A;  3COL A;  5J3L A;  3BTC A;  2GUH A;  2M8G X;  3K7A J;  5F0H A;  2VI6 A;  1H88 C;  3BTL A;  5AQC A;  3TW7 A;  2VKE A;  1MBH A;  2TRT A;  1I3Q J;  1FTT A;  3G56 A;  3SDG A;  2R7Z J;  3TP3 A;  4A3C J;  2HXI A;  3FIW A;  2E2J J;  1WH5 A;  2KT0 A;  2EBI A;  3HOY J;  2HKU A;  2OI8 A;  1GV5 A;  5HOD A;  1HLV A;  3M3Y J;  4Y52 J;  3HM5 A;  2JA8 J;  1ETK A;  3VW1 A;  5CXI A;  5K58 A;  3JRE A;  4M3E A;  3TP0 A;  4AUX A;  3HTI A;  4C3I J;  4MLO A;  5F08 A;  1FIP A;  2OF7 A;  5DS9 A;  4A3L J;  1IDZ A;  1OCT C;  1JJ8 C;  1U78 A;  2XGD A;  2UXO A;  4XRS A;  2K9S A;  2EZL A;  2CRG A;  3P9T A;  1IRZ A;  3EGQ A;  3K2A A;  3JRF A;  4DYQ A;  3S17 J;  1UG2 A;  1ZKG A;  3ON4 A;  5FKK A;  1JKR C;  2XGC A;  3LNQ A;  4JX6 A;  2YU9 J;  2YS9 A;  4QTR A;  5EGO B;  3S16 J;  3C07 A;  3VVY A;  1H89 C;  3VPR A;  2NVY J;  2L7M P;  3W6V A;  1B72 A;  1JUM A;  2M0C A;  1WI3 A;  2E2I J;  1WGX A;  2R92 J;  3Q0U A;  4GFK A;  1XG1 A;  3S1R J;  3GTP J;  3HTH A;  4RDU A;  1IGN A;  4NEL A;  1B72 B;  3E7L A;  1X2M A;  2GBY A;  2Y30 A;  3GTL J;  1R9T J;  3TW6 A;  5HBU A;  4ACI A;  1BA5 A;  2DA6 A;  2Y2Z A;  1YRN A;  1AHD P;  1WCM J;  3BR5 A;  4B4C A;  3ZQL A;  1E3O C;  3G7R A;  3KKC A;  1ETV A;  5HSZ A;  3OSF A;  2HOA A;  4W1U A;  1IDY A;  3Q0V A;  5F0F A;  3JRA A;  1YRN B;  2VPR A;  1JTY A;  1X2N A;  1IJW C;  3I4M J;  3S1N J;  3JRH A;  2PMZ N;  1HDP A;  3I4N J;  2ECC A;  3NAU A;  1SFO J;  2YUS A;  3FIS A;  1HF0 A;  2LLK A;  4JP0 A;  5CXG A;  3JRG A;  1ZGW A;  3NPI A;  2VKV A;  2K9N A;  2XB0 X;  3B6A A;  4A3I J;  4DYR A;  1BW5 A;  3MN2 A;  4M6V A;  3RZO J;  5FMP A;  5H9T A;  1JT0 A;  1U8B A;  4FE7 A;  1I6H J;  3BCG A;  2R93 J;  3T6N A;  1DU6 A;  1NK3 P;  2O9L A;  2L7F P;  1X58 A;  3O8H A;  3HIM A;  3VVX A;  1MSE C;  3S1M J;  3JRC A;  1ITY A;  2YVH A;  1FIA A;  2MW8 A;  4B1R A;  1ORK A;  1MBF A;  4A3B J;  1MBK A;  5EF6 A;  2DG7 A;  4RBO A;  2DN0 A;  2FX0 A;  3BR6 A;  1RKW A;  5F04 A;  1OFC X;  1GDT A;  2G0E A;  3VW0 A;  3HOU J;  2G7S A;  3RH2 A;  1WPK A;  2HYJ A;  2DA3 A;  2IAI A;  1K83 J;  1TC3 C;  3VP5 A;  3ZQI A;  5E3L A;  1Z77 A;  1RET A;  1P7J A;  2JK3 A;  4BY1 J;  2ECB A;  2LVS A;  3BR3 A;  3BG5 A;  4MXM A;  3HTA A;  1Y1V J;  1JKP C;  3GTK J;  5CW8 A;  1UMQ A;  3G1O A;  1GUU A;  4BKX A;  4MFD A;  1FTZ A;  2DMQ A;  1ETY A;  2XPW A;  4DZJ A;  2DMN A;  3IH2 A;  4AC0 A;  2D6Y A;  3HB9 A;  3C2B A;  3OOU A;  5GPA A;  2E19 A;  1JTX A;  2QOP A;  4I76 A;  4DZP A;  2JA5 J;  3GZI A;  2ID3 A;  1G2H A;  4MFE A;  3PO2 J;  3OIO A;  3KKD A;  3QBM A;  3A02 A;  3HGY A;  2UXP A;  2NVX J;  3JR9 A;  3LSJ A;  2ZCM A;  2I10 A;  3LOC A;  2CQQ A;  4JX5 A;  5K7F A;  3QQA A;  2NS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...