3HGGA

Crystal structure of cmer bound to cholic acid
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CmeR
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: Crystal structures of CmeR-bile acid complexes
rcsb
total genus 76
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hggA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hggA02
2LR8A 5H9TA 2EBIA 1WCMJ 2JK3A 2Y2ZA 3HE0A 1MBKA 4D5CA 5K7FA 4W97A 1WH7A 2DMNA 2XRLA 2D6YA 4PXIA 1ETYA 3T6NA 1ETKA 3IH3A 1PUFB 5CW8A 3G1OA 3RQIA 3GTPJ 3S1MJ 2TCTA 5FKNA 3OOUA 3VP5A 5EF6A 2HYTA 4MFDA 4LOCA 1IC8A 1ZKGA 2V57A 4AYBN 2L9RA 2NS7A 3G1LA 4AF5A 4CYCA 5BNGA 5EDNA 3PO3J 1B8IB 2ZB9A 3GZIA 2NVXJ 2PBXA 2QKOA 2EZHA 3HTHA 3QPSA 4NDLA 3VVYA 3RZOJ 2XGEA 3HOVJ 4NN1A 4A3GJ 3LSRA 1JT6A 3BJBA 3GTOJ 5FLVA 3ZQHA 3GTLJ 1DU0A 2ZCNA 3JRGA 3CMYA 4JNNA 1NTCA 4UUTA 5J1RA 3RKQA 1UMQA 2VKEA 2P81A 1GUUA 2AHQA 3VW1A 3FRQA 2FJ1A 2XB0X 4AC0A 4FE4A 3CWRA 2YVHA 2TRTA 4A3FJ 1RPWA 4DYCA 2G7LA 3FK6A 4XK4A 3JR9A 1ZTRA 2R92J 2LLKA 2RAEA 2HKUA 4XICA 1ETVA 1FIAA 1JKQC 3M4OJ 2M8GX 2GENA 3ON4A 5IYBJ 2RASA 3O60A 2WUIA 3GTKJ 5EGOB 4UUSB 5E3LA 2VUMJ 2FQ4A 3QBMA 4FCYA 1MBJA 3BG5A 3O8GA 1DU6A 3NAUA 2K9QA 3GTGJ 3I4MJ 2IU5A 2JA6J 4J19A 2WV1A 2HOTA 1ETOA 2Q24A 5M3MJ 2O7OA 4A3LJ 5GPAA 1ETQA 4MLOA 4ME9A 1APLC 2DA5A 4M3BA 2NVTJ 3HOYJ 3ANPA 2YUSA 1BL0A 2DA1A 3KZ9A 2ID3A 1IRZA 3RZDJ 3Q3SA 1BA5A 2KDZA 4L62A 2G3BA 3BNIA 5K7HA 4CYCB 2W53A 1MBEA 5HSZA 1S7EA 1IDYA 2N8GA 5JLXA 1LFUP 2HXOA 2M0CA 3JRIA 2O9LA 2XPVA 4A69C 5FKOA 3I4NJ 3HB9A 5IP9J 1LE8A 2CU7A 1U9OA 3DCFA 5EYRA 2XGDA 1FTTA 3QQAA 2VKVA 2E2JJ 2DJNA 2JA8J 2DTZA 3BRUA 5GPCA 4ICHA 5IPAA 3EGQA 1A6IA 5E3NA 5C3EJ 4X6AJ 2CRGA 2MGQA 1JJ8C 2JJ7A 4C3HJ 2LD5A 2K9SA 2JN6A 4M3DA 5FJ8J 5J3LA 2O7TA 2FX0A 2E19A 1NK2P 2X9DA 4C2MJ 3COLA 5FKMA 3CQZJ 3FIWA 1QVTA 4JYKA 1VFCA 1U9NA 1HOMA 4IHXA 5F0CA 1D5YA 3H3VK 2WGBA 2R7ZJ 4QTRA 2R5YA 4BBSJ 1IJWC 2F07A 2HI3A 1UHSA 1UI5A 3JRCA 2JA7J 3C07A 1VNDA 5EZGA 4IHYA 4IHVA 5IYCJ 3TW6A 3TW7A 1FJLA 4G12A 4GCLA 1AU7A 3JRBA 1RKTA 4C3JJ 3ZQIA 3S1RJ 4A3KJ 2M34A 4M3EA 2G7GA 3IUVA 2M9HA 4JP0A 3BG3A 3QPLA 2ID6A 2QF7A 3JRHA 1G2HA 4GFKA 3ZOBA 3Q0VA 2XDNA 3VIBA 1JKRC 2LY9A 3B6AA 4MIMA 4XRSA 1SFOJ 3H0GJ 5F08A 3GTQJ 1TWCJ 5F27A 3RH2A 3S2HJ 2NS8A 1MSFC 3OIOA 1ITYA 4YZEA 2HQ5A 1W0UA 2QCOA 1I6HJ 5IP6A 3NRGA 1BJZA 1LE8B 2XSDC 4GFBA 2OI8A 4I76A 4ABZA 4L5EA 3QKXA 3L1PA 1WGXA 2PMZN 1TC3C 1ETXA 3E7QA 3E7LA 3LJLA 1GDTA 1W0TA 2EZKA 1IDZA 5FKKA 2NOGA 4IEJA 1R9TJ 4A3DJ 3HKZN 3VW0A 2EH3A 1JT0A 3BT9A 2R5ZA 1JTXA 2QIBA 3FKIJ 3KNWA 3VOXA 4MFEA 3HGYA 2ZOZA 1LFBA 2ECBA 3SJMA 3A01A 3DEWA 4XRSG 2GBYA 2G0EA 5FMPA 2CUFA 3BR1A 3ZQLA 1NK3P 5D1RA 3HOZJ 3JSJA 4S0HB 3MN2A 1Q1VA 1RESA 2R0QC 2L7MP 3VOKA 2R5YB 2L0KA 1OCTC 3K2AA 5IP7J 4JX6A 3S5RA 1QRYA 3LSJA 4RDUA 3NPIA 3D1NI 1U78A 5J1YA 1GT0C 3RD3A 3BTCA 5FKLA 4B1RA 4RBOA 4BBRJ 1BW6A 3CRJA 1QVUA 2LVSA 3KKDA 3JRAA 2DA2A 1POGA 1JJ6C 1MBGA 4V2GA 3ON2A 1T33A 5M5XJ 2ELKA 2X48A 3OSGA 5J1UA 3HEFA 1IUFA 3NNRA 5E3MA 1MH4A 3VW2A 4DYRA 4HKUA 2JA5J 2CJJA 1GVDA 2W48A 3GTJJ 5FGLA 5HAWA 1WPKA 3ZQGA 5IOZA 5F04A 1P7IA 3ZQCA 3EUPA 4AC6A 1HCRA 2IAIA 2CQXA 4JX5A 3AQSA 1ORKA 1XS9A 1XG1A 2NP5A 1Z77A 4C3IJ 1B72A 3NI7A 2OF7A 4A3MJ 3Q0UA 4DYQA 2K40A 4DZPA 3DPJA 2PZ9A 2HXIA 1Y1VJ 2DA4A 4Y52J 3NXCA 1JUPA 1EF4A 2ZCMA 3UKGA 1RETA 3HDDA 3V78A 4QIWN 2R5ZB 1OFCX 5C4JJ 3GBGA 2WB1N 5E3OA 1BW5A 1ZK8A 4A3EJ 5K7ZA 4D7MA 5EG0A 4BXXJ 3TP0A 1VI0A 2JMWA 5C4XJ 5DAJA 2NVQJ 1SGMA 3S1NJ 3JRFA 3CJDA 1TWAJ 3LSGA 1K83J 2X6OA 4A3CJ 1FEXA 4A3BJ 2DA7A 4MK6A 2H8RA 1CQTA 3HTAA 1ETWA 1QPIA 4X1EA 2H1KA 3LWJA 2YVEA 5DTDA 3B6CA 2E2IJ 1ZR2A 3BQZA 5EEAA 5EFYA 2EZLA 2D5VA 4MXMA 4FTHA 4FISA 2ZOYA 1OCPA 4BKXA 3VVXA 1JGGA 2XB5A 2DA6A 5HODA 2NP3A 1MBFA 1TWGJ 5EZHA 3WHCA 2LFBA 3F0CA 4A93J 1F36A 4A3JJ 5CXGA 2COBA 1OJLA 4AUXA 1AKHA 3G56A 2GUHA 4QSHA 4IHWA 3W6VA 4XRMA 4DZJA 3NARA 1AHDP 4GFLA 2ME0A 3M3YJ 3VVZA 3LSPA 5HBUA 4M6VA 1GV2A 4KWAA 3A02A 3MNLA 1B72B 2YS9A 1TWHJ 5F1JA 3BG9A 2MG4A 3KKCA 1HLVA 3TEDA 5M3FJ 3G7RA 2I10A 2XPWA 3K7AJ 1IG7A 3JREA 3HIMA 2CQQA 2UXUA 3LHQA 4B4CA 3LOCA 5JLWA 2R93J 2Y30A 3TP3A 1U8BA 4A3IJ 1Y1WJ 5K58A 2UXIA 3HBLA 4D5FA 3F1BA 2DMPA 5EG0B 2LKXA 3BR2A 2ZCXA 4XIDA 3CCYA 2LTPA 3IV5A 3SDGA 2WAQN 2MW8A 5IOYA 1JKOC 1JUMA 2M2EA 3WHBA 5M5YJ 3LNQA 2E2HJ 1UG2A 1HF0A 1VF9A 2L7ZA 4DW6A 4HNVA 1I3QJ 2XGCA 2NVYJ 3VPRA 3BR3A 3HM5A 3AQTA 2GLOA 1ZQ3P 3FISA 4W1UA 1YRNA 4ACIA 1MNMC 5FHPA 2OPTA 3ZQFA 3PO2J 2ECCA 4MO7A 4B3AA 1H89C 2YU9J 5C44J 4UDSA 2DN0A 2RHAA 3SFIA 3HOXJ 1JTYA 2L7FP 3CDLA 1X2NA 1IV6A 2DA3A 2HYJA 5CXIA 1H8AC 2UXPA 5D18A 5M5WJ 1AKHB 3BCGA 1ZR4A 2ME6A 4I6ZA 1IGNA 2QWTA 2QOPA 2GFNA 1RR7A 1ZGWA 1UI6A 3HOWJ 2DMQA 1MH3A 1F43A 4V2FA 1HDDC 2G7SA 1P7JA 3MKLA 1WH5A 1X58A 3S2DJ 1FTZA 3JRDA 9ANTA 2DG8A 3GEUA 1WI3A 1X2MA 3BR0A 1K61A 3PM1A 2XPUA 2Y9YA 4BY7J 1PUFA 2UXOA 5IYDJ 4D7NA 3HTJA 3P9TA 3VUQA 1RKWA 1I50J 5GP9A 4JKZA 3ANGA 1FIPA 3BTLA 2EZIA 3C2BA 3A01B 3FK7A 1MSEC 3S1QJ 4GCKA 2KT0A 2E1OA 2HDDA 2DG7A 5AQCA 1B8IA 1XC5A 2Y0SN 4EEFG 1O4XA 2Y9ZA 4JX4A 5F0HA 1H88C 2VPRA 3HOUJ 3BTIA 3PASA 4BY1J 3A03A 5F0FA 3BHQA 1JUSA 4FE7A 5FLMJ 4M3GA 3BTJA 2CUEA 3IH4A 2EQRA 5C4YA 2DMTA 2FBQA 3HTIA 1T56A 2OERA 2O8KA 2GM4A 5D19A 3V6GA 5DS9A 1Z0XA 3BR6A 1GV5A 1E3OC 1YRNB 1HDPA 3BQYA 2REKA 3PPBA 2MSYA 2IBDA 3IH2A 3BR5A 2B63J 2FD5A 2AO9A 2K9NA 2Y31A 4CGRA 2HOAA 4JL3A 1JKPC 2JWTA 3S17J 1A5JA 2VI6A 2DMUA 2IEKA 4NELA 2LK2A 3S16J 3O8HA 4GCTA 2NX4A 3S14J 2LP0A 3G1MA 1MBHA 3GTMJ 3S15J 2UXHA 1SANA 1TWFJ 4Y7NJ 2QTQA 3HGGA 3Q0WA 3B81A 5EGOA 4M3FA 4UUSA 2HOSA 3OSFA 1ENHA 3MVPA
chains in the Genus database with same CATH superfamily
2A6HF 2Y2ZA 3IC7A 1WH7A 4FETA 2IJLA 2XRLA 3DV8A 1ETYA 2GAUA 4GO1A 5KK1A 3DKYA 1XX5A 2QKMB 2B3WA 1FBSA 5DEQA 3H92A 5J8CA 3OOUA 1T6SA 1W5TA 4B43A 1LEBA 1IC8A 1R36A 2DT5A 3CP2A 3ZPLA 3V7SA 1OCZH 4XR6A 4AYBN 3G1LA 4CYCA 2JVHA 2FOKA 3HHGA 2CW0F 2Z5UA 2ZB9A 1Y39A 2NVXJ 2ZJPF 1QNTA 2QKOA 1RUNA 4ETSA 2X6YA 2DT6A 4NDLA 2W85A 3VVYA 4UNOA 1OYIA 3RZOJ 2XGEA 3HOVJ 3BJBA 5FLVA 3ZQHA 2ZCNA 4JNNA 2XRNA 1R4NB 3OR1C 1MNDA 3HYIA 2PI0A 2LKPA 3KP7A 1R00A 4RS8A 4FE4A 2D1HA 2EV6A 4LITA 2YVHA 4NC6A 2G7LA 4HSTA 4U9LA 4WF2A 4DGWB 3GYHX 3JSOA 3M4OJ 2GENA 3LSKA 1Z21A 2KPMA 2CH0A 2H09A 1D0XA 2VJ5A 2ZXIA 2A5WA 5E3LA 2FQ4A 2GOMA 5FRMA 5LRRA 1X1BA 3BG5A 2K9LA 4S05A 1DU6A 1S7OA 3NAUA 5J4VA 2ZC2A 2V26A 5B66C 1SAUA 2QSHX 5D5VB 4PFPA 3L9FA 1ETQA 2HVRA 2M4GA 4PFOA 2WAQA 3OYNA 1A36A 3FXRA 3N4MA 2OTJI 2A2FX 2YUSA 5E1WA 2FRHA 2GIVA 3F72A 2W00A 3BJOA 3L2WA 2E5ZA 4E7KA 1IRZA 3RZDJ 3Q3SA 2O0YA 4II3A 4DJAA 2KDZA 2QYOA 4H0EA 1G59A 4L0YB 3NS4A 4L62A 1P6RA 4E7HA 5HSZA 1MBEA 2XC7A 1YW7A 2VC0A 2MABA 2X85A 1K78B 2M7AA 1L0OC 2M0CA 3HUGB 2O9LA 1GHCA 2VE9A 3BCBA 2NVUB 5IP9J 1LE8A 3ISPA 2E7XA 3TKYA 5KVRA 2EIJH 2VONA 2VKVA 3FX3A 5JI6A 2DJNA 2JA8J 1ZHFA 2DAOA 5GPCA 3BRUA 2HKXA 2PFBA 3DKWA 3HXLA 4WX9A 1UZCA 3PJRA 4CXFA 2K9SA 3HTUA 2JN6A 2XHKA 5FJ8J 1HBXG 2FX0A 3I3LA 3QPHA 1E0EA 4U0YA 3CUQA 4IL6C 4CICA 1ZREA 5FKMA 3CQZJ 1U5TA 5ICEA 2DOEA 3DF8A 3HG9A 2R7RA 2VODA 1FY7A 1XMKA 2GQQA 5HNHA 3HRMA 4U7BA 2HI3A 2VQLA 1LDJA 1QZYA 3K2ZA 2IA1A 3C07A 5EZGA 1I27A 4FHTA 3G73A 4ENKA 1LB2A 4CHUA 3QOPA 4G12A 1BN5A 3JRBA 1ACIA 3DTKA 2UWMA 4KN4X 2XROA 2L9SA 4RAZA 3S1RJ 4M3EA 2G7GA 1PUEE 4KDPA 4JP0A 4B47A 3BG3A 2QF7A 2EFQA 1YW9A 1KZHA 3QU3A 2LBFA 5E8GA 5LEKA 1ZRDA 3BG6A 3B6AA 2ZFUA 4XOTA 1SFOJ 1S29A 3S3OA 5FD6A 2W1OA 3S2HJ 1P92A 3OIOA 4E7LA 2BOLA 2VL8A 4YZEA 3VOEA 3CDIA 2ZCWA 1BJZA 4IQ4A 3U21A 1WZ2A 4L5EA 3TMOA 4AVZA 3OYDA 4LMYA 4RAYA 1IN7A 5IT3A 4P55A 5FRNA 1IDZA 1R9TJ 1OMIA 4CA0A 2VOOA 5LBQA 1M1EB 2EH3A 4KISA 2QIBA 2IS4A 2ADUA 2R7XA 1R23A 3HGYA 4A2UA 3SJMA 3A01A 3DEWA 3KP3A 4F93B 2WAEA 2CUFA 5D1RA 3HOZJ 2FXAA 4S0HB 1K6YA 2L7MP 1KONA 1Z6RA 4EGZA 3A4CA 1OCTC 2HVSA 5HS8A 3LQRA 3BP8A 2Q2EB 3NPIA 2E35A 3ECOA 4E7ZA 1OYWA 3D1NI 1X1AA 3F6VA 3FXQA 3G2BA 3BC8A 4BBRJ 1GXPA 1FYKA 3REOA 2KISA 3LA3A 1JXSA 2JUGA 3PNYA 5J8FA 3MQ0A 1POGA 1R71A 2XSJC 2LNBA 3H3UA 1T33A 3LSIA 3PSIA 4FX0A 4RB0A 3VYUB 5L3FA 3OSGA 1RI7A 2PFVA 3J7AY 1YOVB 1OLTA 2L3DA 2LDUA 1MH4A 3VW2A 5HLHA 2L5QA 1GVDA 4Z2YA 3HPHA 3S2WA 4QLCU 5F04A 1P7IA 3ZQCA 3T8RA 2K7LA 3F23A 2IS2A 2KKOA 1ORKA 2YX7A 5E17F 2QSFX 2C6YA 1Z77A 4MEXF 4EJTA 2E1NA 2K40A 1W7PA 2PZ9A 1D1AA 4Y52J 3NXCA 1JUPA 3HDDA 3V78A 2M4KA 4OWRB 3Q5FA 3CO7C 1S7AA 4BXFA 2WB1N 2MFZA 2Z16A 1DQUA 4M9XA 1BW5A 2QGUA 3J80Z 3IKVA 5K7ZA 4D7MA 3J81Z 1V4RA 2OCEA 1QPMA 1FBUA 4IRGA 1HKQA 3LQQA 3DBLB 4HEA2 3HIFA 5AIPA 2NVQJ 1SGMA 1B4AA 1TNSA 1RC9A 3CJDA 1ZH5A 1LVAA 1S8NA 3LSGA 4A3CJ 3HRTA 2FF4A 2OC6A 5L3CA 4A3BJ 2W4SA 5DD8A 3CCUI 3CC4I 3DPUA 2H8RA 4MHGA 2VQCA 1IRFA 1SEUA 4X1EA 1O3TA 2H1KA 3LWJA 1TT5B 3AG1H 5EEAA 1P9QC 2D1VA 4UXNA 2UUZA 1LVKA 2RQQA 2D5VA 5EFYA 4FTHA 3MKWB 3ELKA 3KLNA 1IUYA 3LL7A 1R1TA 4KT6A 5H20A 5K5OA 2X1CA 4LG3A 5HODA 3ABLH 4U7DA 3KYDB 5EZHA 1JHFA 1K79A 4ZJZA 2KQRA 2VBWA 1J0RA 3AKZA 2O61A 3E97A 5D4RA 3U9GA 2MYSA 2JSCA 2VQGA 3W6VA 1KYZA 5EEGA 3ESWB 1AHDP 1ZLJA 2H8WA 2IS6A 3LSPA 5HBUA 3H3ZA 3A02A 2DDBA 3CTAA 4HNUA 2VBXA 3KIOA 3FXLA 1TWHJ 1ULYA 4P9UA 1T38A 5FLXK 3BG9A 2MG4A 3KKCA 1YQAA 3CCJI 2GXBA 3BLYA 2OAZA 2M1BA 4DOZA 3K7AJ 2GXAA 1IG7A 2LMDA 2VN2A 4GXOA 3K1NA 3MEXA 4HSRA 2DXIA 5JLWA 3K4CA 4IHTA 3SHFA 1P4AA 2Y30A 4LJZF 5K58A 4LGWA 3MWMA 1BR2A 4KT5C 1U5TB 3FXUA 5HOOA 4XSXF 2E60A 2E2HJ 2M2EA 3TGNA 4G7HF 2E1CA 2YVXA 4MQVA 1FOWA 5DM7F 1W36D 4FQGA 2L7ZA 3OR2C 3R0AA 5LFAA 2XGCA 3BZKA 1H9TA 4IOAF 3HM5A 2JT1A 3OV8A 3CCEI 3DXJF 1XB4A 1MNMC 4EGYA 2OPTA 1ODDA 3PO2J 2K02A 4B3AA 1H89C 2LH9A 5C44J 4A5NA 1ONVA 3L2QA 3GFJA 3HOXJ 1KQ8A 2FNAA 1X1PA 3CDLA 3PFIA 2PMZA 5CXIA 1H8AC 2ZJQF 2GZWA 4CH7A 2L02A 4PGGA 1AKHB 4G6QA 3QYFA 2QWTA 5CVVA 2GFNA 3VYTB 1UI6A 1G8XA 3L2CA 2DMQA 1USTA 3K4JA 1P4WA 3F8NA 4XOPA 1F43A 2PN6A 1QA6A 2M45A 1N75A 2CV1A 1D8KA 3AFHA 1J09A 4M6YA 3DKXA 9ANTA 1FTZA 4EQQA 2DG8A 1WI3A 3BR0A 4C2TA 2R7FA 2XPUA 4KMUX 2QLZA 4BY7J 2VT2A 3E5QA 3DBHB 3LAPA 2UXOA 3WE2A 4WXHA 3P9TA 3VUQA 1ZG3A 5FGMA 1FIPA 2RNJA 4Y13A 3I59B 3SZPA 2HTJA 4AIDA 3ZN1A 3A01B 1MSEC 2KZGA 2FA5A 5K1YA 3OS1A 2AQEA 1YE9A 4G9YA 4EEFG 1WSUA 1HW2A 5FD5A 5FFXA 4I2OA 1G3SA 5E1ZB 1XSVA 4FE7A 3KETA 3FBNB 4M3GA 2V9VA 4IXAA 4UV8A 1IZ1A 2EQRA 2VOPA 2DMTA 2VT3A 2J5OA 4JK1X 5HLIA 3SZTA 3NQOA 3HTIA 1ZELA 1T56A 4LIVA 2O8KA 1GV5A 1VZ0A 3F3XA 4ZYEA 4ESFA 5ILUA 3BY6A 3ABTA 1HA8A 3IH2A 2AO9A 2Y31A 4L0ZB 4CGRA 2HOAA 3VEPA 4JL3A 2A3SA 2JWTA 4ITVA 1CF7A 1BIAA 2ZKZA 4NELA 2QA4I 3QAHA 2ELJA 5F1RA 1I5ZA 3IRRA 1IAWA 3QWLA 3G1MA 2RC4A 3RSNA 1TQPA 2UXHA 2X4HA 4Y7NJ 1UHWA 2QTQA 3RPUA 1UCRA 3OSFA 2LR8A 3KE2A 1WCMJ 1YHQI 2WBMA 3WTZA 2XGXA 3FXJA 3HRSA 3KZZA 4LLGF 1FPQA 1LQ1A 3QPTA 4TV7A 4BAYA 1I1GA 2XKOA 1ETKA 1WKMA 2LYCA 4WWCA 2DPDA 2HPIA 3I71A 2GIZA 3M9AA 1D0YA 1D0ZA 3RQIA 3G3ZA 2M0MA 2ZXJA 4U0VA 5CVIA 2QZ8A 3GTPJ 2TCTA 5FKNA 2Q8KA 2HYTA 1Z7UA 5E79C 1ZKGA 2NXNB 3DU5A 2V57A 2L9RA 2NS7A 2H94A 4AF5A 3PO3J 1ON1A 4JBAA 4PJMA 1B8IB 3WTUC 1BR1A 3K8PC 1K78A 2X6XA 1LPQA 4F55A 3HUGA 1SFKA 1FMVA 5JVTA 2NRAC 2VJ4A 3AL0B 2PEXA 2OQGA 4OIRF 4ON0A 1JI8A 2XIGA 2KMUA 1HW5A 1DU0A 3JRGA 1NTCA 5J1RA 2Y75A 4E7JA 2VKEA 1GUUA 3VW1A 4BU2A 4C30A 3FRQA 2XB0X 4AC0A 1VQ4I 2UXXA 1FSHA 2XAUA 1RPWA 4DYCA 2LC2A 2P6TA 2MBFA 3Q9VA 2LLKA 4KIGA 2RAEA 2PLYA 1FIAA 2M8GX 1I39A 3D5RC 4PJJA 4BQQA 5HLTA 4IRIA 2RASA 3O60A 2UXNA 3DEUA 5HDGA 2VUMJ 1YYVA 1WWXA 3EQLF 4FCYA 3O8GA 4R1HA 2E71A 2F4MB 3QP5A 2IU5A 1MMSA 2DO7A 1ETOA 2XDVA 2CQ7A 4EM0B 1ZLKA 2Q24A 4RGSA 4HLXA 5GPAA 3I53A 1RZ4A 2L9NA 5IY5H 4OU0A 5EEHA 3EUAA 1APLC 1V5FA 2DA5A 1FOKA 1VQLI 1SMYF 1OPCA 4M3BA 3GZ6A 2HDCA 4Y3OA 3ANPA 2DA1A 2EA4A 3BDDA 3EYIA 5IT9K 1D1CA 2ID3A 1B1BA 1YO5C 1W36C 3RYRA 5JFRA 3S8PA 3QU6A 5JLXA 1K4SA 2QQ8A 2HXOA 2GXGA 4OIPF 2UZKA 4Y17A 2XPVA 4KMFA 4A69C 4OIQF 3I4NJ 5LHIA 3ZQ7A 1SVLA 5HNFA 4NQWB 1YS7A 1FTTA 3QQAA 2V1XA 4J00A 2DTZA 2L01A 4ICHA 2JRMA 5IPAA 3EGQA 1E17A 4XN0A 1SD5A 5C3EJ 1SFXA 1YS6A 3DBRB 2LD5A 1BI2A 4M3DA 1SD6A 5J40A 4HX4A 1NK2P 2QQBA 3L7WA 2Z9OA 3PUBA 1U0JA 2IXSA 4PUSA 3FIWA 3PNTA 2LKSA 3RQ4A 4AIJA 1VFCA 5GAHJ 2QUFA 5F0CA 5J4YA 1D5YA 1A35A 4XKBA 5H6QA 2WGBA 3H35A 4QTRA 5KAFC 3J7YJ 2HPMA 2IP2A 1Z05A 2V6EA 2F07A 3GMEA 3PIPF 4LK1F 3HOSA 3A0BC 3CMMA 4XLPF 4MQ9F 3WODF 2Q2EA 3JAMK 5D6FA 3ABKH 4B3XA 1VNDA 4IHYA 2LY2A 4IHVA 3TW6A 3M8EA 2KHMA 1FYMA 1FJLA 4BS9A 3W2WA 4GCLA 1X3ZB 3U1KA 4IOCF 3TQNA 4CZCA 3E5UA 3I55I 3CF2A 3M8JA 4E4HA 4EJUA 4XKCA 1QGPA 1WVRA 1BC7C 4G94A 3VWBA 5E8IA 3P9CA 2IW5A 3ZOBA 1O3RA 2OTLI 3Q0VA 3GZNB 1WJDA 2XDNA 3K4LA 3WGIA 2QQAA 4XRSA 3H0GJ 2LOOA 4EJOA 2NS8A 2OU2A 1MSFC 3GF2A 3F8BA 2HQ5A 1W0UA 4BL0B 2OCCH 3K1PA 1TQMA 4A0XA 4XLFA 2AXLA 5ERIA 4ANJA 2OI8A 4ABZA 3RPUD 4GRIA 4M74A 2L4MA 3E7QA 4XLCA 5CJ9A 3Q9SA 4DIQA 1FC3A 4MEYF 4A3DJ 4XBFA 1YJ9I 1I6XA 2DPUA 3D5SC 3W6JB 3VW0A 3I64A 2L4AA 1JTXA 3PFYA 2DODA 3KNWA 3VOXA 3CDHA 1MKMA 1LFBA 3OIQA 3FKJA 2ZOZA 1EJ9A 2R4GA 3E0JB 3K9TA 1CF7B 3ZQLA 4L18B 4Q47A 3KZIC 2BW3B 3VSLA 1Q1VA 3KYLA 1RESA 3AL0C 4Q48A 4XLNF 3ZRGA 1DPUA 3VOKA 4L9JA 2L0KA 2MLKA 3K2AA 5IP7J 1WQ2A 3B02A 2RREA 2W7NA 4CCKA 3OYEA 4JX6A 2DW4A 2A69F 3NWTA 4O5VA 4CCLA 2VXZA 3H5RA 1TW2A 5L3EA 3CCQI 1IXRC 3RD3A 2HOSA 2R7QA 5LEJA 1BW6A 3CRJA 4WIBA 2LVSA 3OYGA 3OY9A 3LFUA 3T5XA 3ZP5A 3KEQA 4PCQA 1S6LA 3KEOA 1IXCA 3HEFA 2Z33A 4IQJA 2HGCA 2HU9A 3NNRA 5E3MA 2JA5J 2CJJA 2YR2A 5FGLA 3IHUA 1A04A 1H0MA 3OS0A 2ZBKA 2TDXA 1ZYRF 3EUPA 1WHUA 5KHDA 1UFMA 3DFGA 4UB6C 2CQXA 3GWZA 4G6DA 4CO8A 4YFKF 3OYLA 1JE8A 1WJ5A 1SVOA 2IGNA 2OF7A 2CW8A 4IRHA 4A3MJ 4BNCA 3ROUA 4DYQA 3ZMDA 2CV0A 4DZPA 4HRIA 3DPJA 2WTEA 4NNJA 3F9KA 2OJED 4WXCA 3B73A 3E3VA 4AVPA 3RKYA 4QIWN 2XAQA 2R5ZB 1OFCX 5D6EA 2W82A 5C4JJ 3C18A 4HDUA 5GADJ 3VFZA 2R7TA 2FNPA 3ZMSA 1Z6TA 3T8TA 2DOFA 4RM3A 5A2QK 3IKTA 4OD5A 3TP0A 1VI0A 2JMWA 4CCJA 5C4XJ 2CYYA 1WJAA 5DAJA 2BXYA 3S1NJ 2XF7A 1WI9A 1TWAJ 4MNUA 1J7KA 2CFOA 5TISC 3K1MA 1FEXA 3C3WA 4RAGA 2E36A 4CYDA 2E7WA 1X1CA 3KP5A 3ZMVA 3MAJA 1BI3A 3UR3C 1MZBA 1S5LC 1X3UA 2DA7A 1TTYA 1ETWA 2K4JA 3ONQA 1OCCH 1XCVA 5DTDA 4ENMA 1ZR2A 3BQZA 2DFHA 3GVAA 3RYPA 3PUFA 5D4SA 2HQNA 2XAHA 3KYCB 5J6XA 1VTNC 1U2WA 4OIOF 2NP3A 2LRDA 2STWA 4P5OA 4YIIA 2P5KA 2F4IA 5CXGA 1OJLA 3TL4X 1AKHA 2ZJRF 2VXDA 3LA7A 3IAS2 2ESNA 2GUHA 3G56A 5CVJA 1C0WA 4DZJA 1V3FA 2MD0A 2ME0A 3VVZA 5JVGF 3H9JA 3MNLA 3GFLA 3T0YA 4N9IA 3LSTA 2ZSIB 3K6GA 4EJWA 2M87A 2O3FA 3FM3A 3K4MA 4KJZA 4XONA 1V54H 1PP7U 3O2PE 2EIKH 3G7RA 4HW0A 2HYGD 5CKTA 1ZN2A 2BXZA 2Z99A 2LY1A 3HIMA 2HYFA 4YFXF 4PSWA 5ILVA 3OYFA 4XLEA 2KIFA 2P7CB 1R4MB 3IL2A 2R93J 1U8BA 2DLLA 3TP3A 1J2XA 1LKXA 3I59A 2E1MB 2V79A 3CESA 4J01A 2UXIA 1QHGA 2PMHA 3HBLA 3WU0A 2HS5A 5HS7A 3R6SA 1K6OA 4IHSA 2P5VA 3IV5A 1P2FA 2EFWA 4Y4RA 3OWTA 2WAQN 2DFIA 2MD5A 3V8LA 2W84A 2A6EF 2JZYA 3CCVI 1HF0A 1FX7A 3PIOF 1VF9A 1ZRFA 2R7WA 3VTIA 4HNVA 1I3QJ 4WCGA 2GLOA 5DDGA 1REPC 5FHPA 2ECCA 4UDSA 2CG4A 3KZYA 1DUXC 4KYWA 4PGHA 2RHAA 1IRGA 3SFIA 1AOYA 2G9WA 2L7FP 1R5HA 1R6RA 1Z3XA 4EJVA 2DA3A 2P8TA 2ETHA 2F5EA 2CFXA 2ZSHB 3CUOA 1IW7F 1Z67A 1LUJB 1ZR4A 1IGNA 2ZXWH 3EETA 2QOPA 3HKZA 2PQ8A 3ZQQA 3WU2C 4HV6A 2GA1A 3FMRA 3WU1B 3NWSA 2KIQA 2FBIA 1T95A 3VDXA 2XV4S 5HS9A 4D9JA 4IO9F 1IN6A 1T0FC 4Y33A 1WJEA 5K5QA 4R8HA 3DTEA 4DQ2A 4D7NA 4L5IA 4OOIA 3E1SA 2DJIA 1MMAA 1I50J 4JKZA 2EZIA 5BPDA 2EWNA 3C2BA 4ZC3A 4ZYDA 2E1OA 4HAMA 4BQNA 1J5YA 2BVLA 3BOQA 1B8IA 2HDDA 2DG7A 1TZLA 1Z91A 2H6CA 1H88C 2VPRA 3FDYA 4LIUA 4BY1J 3A03A 3PASA 2ICWG 4YEJA 4L9TA 3BTJA 1YFHA 4NB5A 3RIRA 1YITI 2OERA 3ML6A 5DS9A 3AAFA 3BR6A 3BQYA 2REKA 2DQRA 2IBDA 3GCMA 1VQ9I 4ZZLA 2HTSA 2Z3YA 1JKPC 3R60A 5L3GA 1MJBA 2ACJA 2IEKA 2ISZA 4BH9A 1STZA 5DM6F 4B09A 2NX4A 4HF1A 1T08B 1MBHA 4I0AA 4YIFA 3CJNA 5B5EC 1IN8A 3B81A 3RTRA 3HGGA 3QOEA 2YX4A 3DTIA 1FZPB 3CJTB 2LF8A 1MGTA 2EBIA 2K5CA 5B3SH 1MBKA 3F8FA 4D5CA 4II2A 3HE0A 2DMNA 2PJPA 3HSEA 1KU2A 3L00A 1JGSA 4B8XA 3T6NA 3M8FA 3ZR8X 1L3LA 1R5ID 3KPHA 2WADA 4HQMA 1ZAOA 1PUFB 4MTDA 5CW8A 4BHBA 3LMMA 4AD9A 1QO0D 4A0ZA 3GEZA 3S1MJ 2V6CA 2CUZA 2W25A 3VP5A 4RA2A 4HYEA 3HSFA 5EF6A 4MFDA 2UV1A 4N9HA 5D8LB 1Y0UA 4F92B 1DGWY 2Y69H 4O6JA 3H5NA 4OMYA 2R7OA 1YIOA 5BNGA 2I5UA 3GZIA 3MFKA 3GZ5A 2EZHA 4HV5A 5D5UB 3HTHA 3QPSA 3OYJA 3PL8A 4KNYA 3K69A 1OKRA 4N4OB 2ZNYA 1FLIA 2P7VB 5LRSA 3ERMA 2PBIA 3LSRA 4NQWA 3GTOJ 3GTLJ 2ZJ2A 4ZH4F 5DCMA 1UMQA 1YJNI 2AHQA 5TGTA 2E1MC 3KX2A 4HG2A 2RVCA 2FJ1A 2DOAA 3V7CA 1SVMA 5TRDA 4GYIA 4A3FJ 1S9HA 4PSXA 4XK4A 4H4KC 2IVMA 2HKUA 1ETVA 3H9QA 1GLNA 2VQHA 1V5EA 3JAMZ 2KRHA 5IYBJ 1IF1A 2G7HA 1EKEA 4UUSB 2NOJB 1R5GA 4PJLA 4IF4A 3I4MJ 3I58A 4J19A 1XSDA 1Z3YA 3PNVA 1R7JA 3COAC 2DK5A 4MGRA 5M3MJ 4A3LJ 3F8MA 4MLOA 1EH8A 3H0DA 3FXOA 3BCAA 2NVTJ 3HOYJ 4C9YA 2H1LA 2VPLA 5ICGA 2KRCA 2BHZA 4HF2A 3KZ9A 3RI4A 3K10A 4GDFA 2V1UA 1WRJA 5EJCA 2G3BA 5K7HA 1K4TA 1LFPA 3R4KA 5CQGA 3CCMI 1FMWA 2XAFA 2OQRA 4XKWA 3JCUC 4BJTA 1LFUP 3E6BA 1OCRH 4UVAA 1YJWI 2K3PA 5FKOA 3HB9A 3EDPA 1YIJI 2DI3A 2H6BA 1U8RA 1U9OA 3DCFA 2EA2A 3CC2I 3VB2A 3M1EA 3BG7A 3SYTA 3PSFA 3VSKA 3TDUC 1HXDA 4RGUA 2DBBA 2WY8Q 4GGGA 2IRFG 3OYMA 1YTYA 2OD5A 3P7NA 1A6IA 5E3NA 1Y56A 3ERED 1AWCA 4X6AJ 2CRGA 1JJ8C 2JJ7A 4XN3A 4ZDPA 3EYYA 2AS5F 5CQEA 2V4JC 4JQFA 4O3MA 2Y48A 2E19A 2X9DA 4C2MJ 3COLA 2XVCA 2LSOA 1XGSA 1QVTA 4JYKA 1U9NA 1MIJA 3RJPA 2BW3A 3KEYA 4B44A 1HOMA 2IGKA 3H3VK 2EK5A 1BI1A 2DU9A 3H5AA 1KU9A 3MZHA 1R49A 1F4KA 3SEZA 1XSXA 2L9VA 1UHSA 2Z1DA 1FYLA 1FT9A 4A5MA 1HKSA 1S72I 3LSHA 5BPIA 3TO6A 2L7KA 1YI2I 3TW7A 2FMYA 4LFUA 1AU7A 3OMYA 3GXOA 2JSPA 4C3JJ 3ZQIA 2DK8A 5H6RA 4A3KJ 1FSEA 2M34A 5D5WB 2Y0SA 2K3FA 1MDMB 5LGTA 1B9NA 5GTHC 1G2HA 1TW3A 3BPVA 1IN4A 4M73A 3JRHA 4G7ZF 3CCRI 2BZTA 1T0FA 2XKPA 1JKRC 2LY9A 1ON2A 3RH2A 5F27A 2KRFA 1ITYA 3GFIA 4RLQA 2KP6A 1QZZA 4NC8A 2Q0OA 2QQ9A 1YX3A 1TT0A 2ZMEC 2HDWA 2F5FA 4PDKA 1KA8A 3JTGA 2JQ7A 4I76A 2ZFWA 3QKXA 3ZGKA 1J9IA 2PMZN 1ETXA 3HZJA 3E7LA 3NEUA 2FOWA 2HR3A 5LHGA 3LJLA 1W0TA 3TDZC 5GAGJ 5FKKA 2NOGA 4IEJA 2QEXI 3U2RA 1YX5A 2PX9A 3E6MA 4EV0A 1G6NA 2D2WA 2R5ZA 2XF6A 1Z9CA 3DP7A 4ZTFA 4GCVA 3HTSB 2HQRA 3FZVA 2ECBA 2RGVA 4XRSG 2GBYA 3QP6A 1VQ8I 3JSJA 3MN2A 1U3EM 2F2EA 3J80K 3BZ6A 2R0QC 4EM2A 3TBIA 2R5YB 1O3QA 3S5RA 1QRYA 4RDUA 3LFKA 3FMQA 3JTHA 4K2EA 3IWZA 4HQEA 1U78A 5J1YA 4KA4A 1GT0C 4B1RA 4AYBA 3FHZA 3FWEA 3KKDA 4PJ0C 2YPRA 4RM2A 3JRAA 2KIUA 3FBIB 1A6QA 2DA2A 4X0GA 1BOBA 2B9SA 1MBGA 3IAM2 1JJ6C 5M5XJ 3SDBA 4HDVA 1MMDA 5J1UA 2OUMA 4A12A 3LWFA 1IUFA 3SQNA 5GAEJ 2BV6A 5B1BH 2QM3A 4RGRA 1IV8A 5CVRA 1E3HA 1XGOA 5HAWA 5IOZA 1Z1DA 3K70D 1XGNA 4AC6A 2IPQX 5FO5A 3ZCOA 3AQSA 5E20A 4A0YA 1T2KA 2JPCA 1KU7A 1XS9A 1XG1A 2STTA 2NP5A 4C3IJ 1G3YA 3EPZA 2F6CA 4BYYA 1XDSA 3V42A 1TBXA 2HXIA 5CPRB 1Y1VJ 5LGNA 2ZCMA 3UKGA 1RETA 1HKTA 3DLAA 1SC7A 4BJ5C 5DCMB 1PDNC 3C2HA 1J59A 2BY1A 3KP2A 1FNNA 2WAFA 3CLOA 3O6BB 1AA7A 1Z7LA 4MTEA 2P0WA 1USSA 3QRFF 4G7OF 1LJ9A 4G8XA 1ZK8A 1EH7A 4I98B 1IO2A 3A1YA 4LLLA 3KP6A 3VYRB 2PMUA 2VBZA 1WJCA 3TOBA 3MCZA 2WY7Q 3I56I 3JRFA 1TQIA 1VQOI 2CV2A 1K83J 4PK4A 4AWXB 3HTAA 4V19K 1QPIA 2PJRA 3MZ8A 2HZTA 2YVEA 3ON2A 2E2IJ 1VQNI 1W5CC 4MXMA 1O3SA 5HDNA 3HOTA 2A68F 4Y15A 1DGRM 2JVGA 4BKXA 4PZJA 3RPQA 2XB5A 2JRTA 3CD6I 3WHCA 2QKLB 3CP8A 2CQNA 1F36A 4A3JJ 3BJ6A 2COBA 1SD4A 3K0LA 5GTIC 3ZMZA 2DFEA 5JHUA 1RIOH 3DPTA 4AIHA 3M07A 4IHWA 3NARA 4GFLA 2KFDA 3M7GA 4L9NA 1X1DA 4M6VA 1GV2A 2KLOA 1VQ5I 4KUMA 4QPQA 2EB7A 2F48A 1B72B 2EV0A 4ZYHA 2YS9A 3FMSA 5F1JA 2QENA 4BDZA 5JR3A 4N4NB 1HLVA 2FBHA 4ZDLA 1SAXA 3CF5F 2V1NA 1LDDA 2XPWA 5FROA 4ESJA 2IGOA 2NNNA 3JREA 4BEHB 3LHQA 2UXUA 4P9FA 5ICFA 1OR7C 2GA2A 1VQKI 1TLHB 2R7UA 4A3IJ 5KNLA 1Y1WJ 2CMPA 4KN7X 2DMPA 5D8KB 5EG0B 1GXQA 1F5TA 3BR2A 2RDPA 4XIDA 2LTPA 1WFXA 2B0LA 4CUGA 1JKOC 1BBYA 1W1WE 3LNQA 5M5YJ 2EFNA 2PG4A 2O5RA 3OL4A 4I99C 3VODA 2A6TA 2RNGA 4DW6A 1BOAA 2K27A 3SEQA 3BR3A 4GYGA 3ULQB 2EV5A 2BHYA 3ASNH 3FISA 1I1SA 1W5SA 5AIQA 3F8CA 4IZZA 4HLYA 3ZQFA 4MO7A 1VQ6I 3EUHC 3M1CA 2DN0A 3DPLC 1XD7A 3HL2A 3ZN0A 1JTYA 2CWEA 1IV6A 4IPAA 1N25A 2R3SA 2HYJA 1PJRA 3C1DA 3TOAA 2IA0A 2UXPA 3OYAA 5D18A 2DDAA 5M5WJ 3BCGA 1WJBA 2X6WA 1RRJA 1CGPA 4UY8I 2VLAA 1RR7A 3HOWJ 1ZARA 3T1BA 2O03A 1MH3A 1BM9A 4V2FA 1KYWA 1P7JA 1EA3A 5FLXZ 3MKLA 1SFUA 3S2DJ 3H1CA 1PP8F 4CGZA 2VIXA 2ZMEA 2OZUA 2IGMA 1MW7A 1BR4A 1K61A 1R1UA 2MH2A 5CVUA 1PUFA 5D5XB 3A2KA 3WTXC 3MKYB 3BWGA 3HTJA 2Q1ZB 3CLQA 4KIBA 1MMGA 2M3AA 3BPXA 2IS1A 2F4OB 4I0BA 4I7HA 2QBYB 3W2VA 4UUVA 3GW2A 4L9VA 2KT0A 3LAJA 5F64A 5AQCA 2LG4A 1X3WB 3TO9A 3KP4A 2VJJA 4U9NA 1UHMA 3LSMA 3BTIA 1NH3A 5F0FA 2HFHA 4L5JA 4XORA 2CQKA 5FLMJ 2CUEA 4UV9A 3E6DA 3IH4A 4CSWA 3JW4A 2FBQA 3KLOA 5JHFA 2GM4A 3OYHA 4DBQA 1Z0XA 4IX7A 2FUG2 3EUKL 4RB1A 1E3OC 1OQYA 1YRNB 1HDPA 2MSYA 3MKZA 4LK0F 2B63J 2BVMA 1ZRCA 3K70C 1A5JA 4E7SA 4UVBA 3GFMA 1WJFA 2DMUA 1XGMA 2VASA 2LK2A 3S32A 3S16J 3O8HA 4A6DA 3S14J 2FBKA 4BGDA 2DYRH 2AXTC 2LP0A 2LF7A 4ZZDA 4CCNA 3L2VA 3I9V2 2O6GE 4N0BA 2Y0MA 1TP4A 4F3QA 4UUSA 2ISYA 3H36A 4LG0B 1ENHA 3H9GA 3E6CC 5H9TA 4EATA 2JK3A 5K7FA 1SD7A 4W97A 3WTVC 2WB1A 2QSGX 2FE3A 2VE8A 1A31A 3ABMH 2F5DA 2D6YA 4PXIA 3F22A 2CS3A 4F52A 3IH3A 4XRFA 3G1OA 1T98A 1X4OA 1HW1A 3D0SA 4M9ZA 4LOCA 2E34A 6PAXA 5EDNA 1MNEA 1D1BA 5BOXA 2HKOA 1B9MA 1F9NA 2VC1A 2PBXA 4OMZA 2HEOA 4JOMA 3FM5A 1BI0A 3DWLE 3CC7I 1DP3A 3N97A 1LEAA 4NN1A 3HHHA 4U87A 4A3GJ 1YW8A 1JT6A 2RQPA 4RAFA 3OYBA 2JA2A 2OV7A 4C2UA 3CMYA 3P9KA 4UUTA 3RKQA 2K9MA 2P81A 4FASD 1EH6A 4DBRA 2PJRB 2D45A 2CW7A 4HZFA 3CWRA 2YSRA 2TRTA 4B48A 4LB6B 3KFWX 3FK6A 2R7SA 5DUKA 3JR9A 3PQKA 1ZTRA 2R92J 3WTSC 4XICA 4IJAA 4UVCA 1JKQC 2K86A 3WG9A 3ON4A 1N78A 1ZG1A 2WUIA 1PVEA 2HQAA 5EGOB 3GTKJ 1QHHD 3WE3A 1N77A 4HA8A 4XMYA 4E70A 3I4PA 2ZNZA 2FEZA 3QBMA 2BE5F 1MBJA 3S93A 3JSPA 1DDNA 1EV7A 4QWQA 2K9QA 3GTGJ 4KIFA 2OA4A 2JA6J 2WV1A 2HWVA 2HOTA 3BJAA 5CLSA 2O7OA 3WTYC 4ME9A 5DD4A 2F5VA 3MD2A 3QYBA 1O7FA 4ZTJA 4YFNF 1MDMA 4AU7A 3A0HC 2BEOA 1BL0A 2M5WA 4I02A 4BDYA 4DNCA 1BA5A 4RMNA 3HPGA 3BNIA 5DCFA 1G3TA 4CYCB 4E7IA 3E5XA 5ICCA 1S7EA 2W53A 1IDYA 2N8GA 1ZG5A 1OR7A 1IN5A 1W4MA 3GLLA 3WG7H 2E5NA 3SWHA 2DFFA 3RCOA 3JRIA 5B1AH 2CU7A 1XN7A 5EYRA 2XGDA 3SZGA 2M30A 3GUDA 2F5CA 2E2JJ 4RB2C 1UJ8A 1BC8C 2FU4A 4R79A 4LB5A 2P5LC 1ERDA 1KGSA 2MGQA 2RKHA 4C3HJ 3BROA 5J47A 3ABUA 1HQCA 1G3WA 1H9GA 2JUCA 5J3LA 2O7TA 1Y8QB 2X51A 2CGPA 4HF0A 2EFPA 3EUHA 3R0JA 2VKDA 4BJ6C 3SFZA 1S3JA 4IHXA 4F91B 3AG4H 1HC8A 3W6KB 2R5YA 4M71A 2R7ZJ 4XSZF 1IJWC 4BBSJ 4ESBA 4OAZA 1R1VA 2A61A 1UI5A 3JRCA 3RKXA 2JA7J 2ZXHA 4U0WA 1VQ7I 2P6SA 5IYCJ 3SXYA 4M9SA 2HOEA 1RR8C 4FX4A 1RKTA 5AONA 2FQ3A 3RKWA 2ZMEB 4BHCA 3AG2H 3CJRB 4G6TB 3I54A 4P1WA 3IUVA 2DQLA 2M9HA 1Q1HA 5IT9Z 3QPLA 2ID6A 2CUJA 4BE0A 4GFKA 3VIBA 4HOBA 4MIMA 2B1EA 3W2AA 3K4NA 2KL4A 5F08A 1G4DA 1TWCJ 5L3BA 3GTQJ 3QYEA 2X1EA 2QCOA 1I6HJ 5IP6A 3NRGA 4I09A 3TO7A 1OYYA 2QVOA 1LE8B 2XSDC 4Z6YA 4GFBA 2CO5A 3L1PA 1WGXA 2HNHA 1TC3C 2L54A 4UB8C 1DPRA 3HSRA 3D5LA 4XLHA 3FF5A 3P9IA 1GDTA 2M7BA 3RDIA 4YRVA 1UELB 2EZKA 2OZ6A 3UNGC 5K5RA 3CCLI 1O7LA 1R58A 1UB9A 3HKZN 3IUOA 1GVJA 1MMNA 3K4KA 1JT0A 3KCCA 3BT9A 4BE1A 2QWWA 3DQVC 3ECHA 1IXSB 3FKIJ 5ILSA 4MFEA 3G4SI 2MC3A 3DLLF 4KICA 3CUQB 2IA2A 2JPBA 2G0EA 5FMPA 3BR1A 1NK3P 2VB6A 3ZXSA 3FXMA 2I8DA 2A07F 1V55H 2R7VA 4BE2A 2RN7A 4IRVA 4KITB 1UAAA 5DYMA 4BACA 5ED4A 3U1DA 1KQ0A 1IRXA 1MJ9A 4P96A 3WGHA 2DCEA 4AIKA 1UG0A 3J7AO 4WXDA 2V7FA 3LSJA 5KAIC 1Y6IA 3R61A 4ZYAA 4LD5A 2CSOA 5H2FC 2M8EA 3BTCA 2XUBA 5FKLA 4Q4ZF 4RBOA 2IT0A 1D8JA 2H27A 2R7DA 1QVUA 4PJNA 5LLQA 4WK8F 4RB3C 4V2GA 2ELKA 2X48A 4OINF 3WTWC 4LLNA 5KCMA 4U88A 2LBFB 2XAGA 4S04A 3QODA 1Y0NA 3OIPA 4DYRA 4HKUA 4E6KG 2W48A 3GTJJ 1O57A 3V8JA 1WPKA 2GWRA 4NC7A 3ZQGA 4ZDOA 2EFOA 1XDUA 2VJIA 1HCRA 2IAIA 4JX5A 1DP7P 2FJI1 1JHHA 2ELHA 2KIMA 3BZCA 4YELA 1B72A 3NI7A 4ASNA 1T39A 1F1ZA 1YLFA 4RLFA 2XF5A 2V1DA 2KJBA 4KFCA 3N05A 3Q0UA 3F6OA 2HVQA 4CZZA 3PQJA 3MZYA 2DA4A 2GOXB 3CMAI 5F6FA 1EF4A 1XPXA 2EILH 2V9KA 4I01A 2L2OA 3OOPA 2HZDA 3GBGA 4BEHA 3ZMTA 4UHTA 1X19A 5E3OA 1XMAA 1QQIA 4A3EJ 4XQFA 5EG0A 3L2RA 1B6AA 3CZ6A 4BXXJ 3GLXA 1K7AA 1LNWA 1XCBA 5TJJA 3OYCA 5HLGA 4EVIA 4DVYP 2X6OA 2LREA 2O8XA 1KU3A 1BJAA 4MK6A 1P4XA 1W7PD 3C7JA 1CQTA 3OS2A 3CO6C 1OCOH 4IVNA 3IRQA 5L3DA 3V8KA 3B6CA 4OAYA 2W24A 2EZLA 1X4PA 3CCSI 4YG2F 4FISA 2ZOYA 1KQ9A 1OCPA 3FXKA 3ZMUA 4A6EA 2YU3A 3VVXA 1JGGA 3V7RA 3IP4B 2NNYA 2DA6A 2EJRA 2WV0A 1MBFA 1TWGJ 2BBYA 2LFBA 1MD0A 2EIMH 1I3AA 2EPFA 3F0CA 4HPQA 5FFZA 2P4WA 1B59A 4AUXA 4A93J 4CCOA 1D5VA 1SFEA 1NG7A 4QSHA 4M6XA 4XRMA 4XNFA 3GX4X 3M3YJ 2AQFA 1HSTA 1ZGAA 2XAJA 4KWAA 5DUIA 2Z2SB 2ZO4A 3C2GA 2MLGA 1W7PB 2KDOA 1V5GA 2BGCA 3LA2A 4D1QA 1HSJA 1FP2A 3G71I 5M3FJ 3TEDA 2I10A 3W3CA 4CDGA 4NUBA 2EINH 1LDKB 2MC4A 1FWZA 2CQQA 1NHAA 3O3KA 4HX8A 5LD2C 4B4CA 3LOCA 4XLAA 3S3MA 2KZVA 2OBPA 2QBYA 5BMZA 4RGXA 5A2QZ 2V9PA 4D5FA 1NG6A 3F1BA 3P5JA 5DV5A 3VYSB 4BXUA 2LKXA 3AG3H 4OD4A 2ZCXA 1ZGJA 1SMTA 2G7UA 1BIBA 3CCYA 3SDGA 5LGUA 2MA3A 2MW8A 1RNLA 1JUMA 2WC2A 3DEEA 3WHBA 4CCMA 5IOYA 1UG2A 2COMA 3J81K 1XTAA 2JTVA 4YIRX 3WTTC 4Q5SF 1E2XA 2NS0A 2NVYJ 3I0TA 3VPRA 1R22A 4BQAA 1FOYA 3AQTA 1ZQ3P 4W1UA 1TNTA 3CUQC 1YRNA 4NHJA 4ACIA 2FSWA 2ESHA 1U5TC 4HBLA 1QU3A 2YU9J 5FB2A 3F21A 2BYVE 2NYXA 3S3NA 1X2NA 5E18F 3V4GA 2VBYA 4XKVA 4M72A 4C2MA 2X0LA 3K4BA 3G6EI 1OISA 4ENJA 1FBQA 3HJEA 2B7EA 4XL9A 2ME6A 4I6ZA 2DYSH 4D0PA 5E1XA 1QZEA 1ZGWA 5HDKA 1XMXA 3OYIA 4LG0A 1D3YA 1VQMI 1Y8RB 1HDDC 2G7SA 3FHNA 1E3PA 1WH5A 1X58A 3JRDA 5LHHA 2MH9A 1FP1D 4XM3A 3GEUA 1X2MA 3PM1A 3X2QH 4BUPA 4BHPA 2W57A 1VQPI 2Y9YA 3IWFA 2BY0A 2VKHA 4ENNA 3DU6A 5IYDJ 1RUOA 1QBJA 1RKWA 5GP9A 3ANGA 1YG2A 3BTLA 3MMYB 3CJQB 1MJAA 2BY3A 3FK7A 3ASOH 2X1DA 4HNTA 4GCKA 4BQOA 3S1QJ 3WGGA 3L09A 1XC5A 2Y0SN 3OL3A 4HX7A 1O4XA 2ZY9A 2Y9ZA 4JX4A 4ZYGA 5F0HA 3CMEI 3HOUJ 2WWYA 2K85A 3BHQA 1JUSA 1FOXA 1PYVA 5C4YA 5HVQC 4QPOA 4IKFA 2RV8A 1T8IA 5D19A 3V6GA 2J5PA 3HC7A 4FT8A 2A05A 1J75A 3GO5A 3PPBA 4EMSA 3BR5A 2FD5A 2FMLA 2K9NA 3I5UA 1TL8A 2KJCA 2K4BA 2DTRA 5CYVA 5BQTA 3S17J 2VI6A 4AM3A 3HRUA 3NRVA 3L2UA 2DT7B 2WA0A 4GCTA 4EM1A 2XASA 3OYKA 3GTMJ 3S15J 2A5YB 5BS6A 4NBQA 1SANA 1TWFJ 3Q0WA 4F7ZA 2BY2A 5EGOA 2NAZA 4M3FA 3J7ZI 1U6GA 3MVPA
chains in the Genus database with same CATH topology
2LR8A 5H9TA 2EBIA 1WCMJ 2JK3A 2Y2ZA 3HE0A 1MBKA 4D5CA 5K7FA 4W97A 1WH7A 2DMNA 2XRLA 2D6YA 4PXIA 1ETYA 3T6NA 1ETKA 3IH3A 1PUFB 5CW8A 3G1OA 3RQIA 3GTPJ 3S1MJ 2TCTA 5FKNA 3OOUA 3VP5A 5EF6A 2HYTA 4MFDA 4LOCA 1IC8A 1ZKGA 2V57A 4AYBN 2L9RA 2NS7A 3G1LA 4AF5A 4CYCA 5BNGA 5EDNA 3PO3J 1B8IB 2ZB9A 3GZIA 2NVXJ 2PBXA 2QKOA 2EZHA 3HTHA 3QPSA 4NDLA 3VVYA 3RZOJ 2XGEA 3HOVJ 4NN1A 4A3GJ 3LSRA 1JT6A 3BJBA 3GTOJ 5FLVA 3ZQHA 3GTLJ 1DU0A 2ZCNA 3JRGA 3CMYA 4JNNA 1NTCA 4UUTA 5J1RA 3RKQA 1UMQA 2VKEA 2P81A 1GUUA 2AHQA 3VW1A 3FRQA 2FJ1A 2XB0X 4AC0A 4FE4A 3CWRA 2YVHA 2TRTA 4A3FJ 1RPWA 4DYCA 2G7LA 3FK6A 4XK4A 3JR9A 1ZTRA 2R92J 2LLKA 2RAEA 2HKUA 4XICA 1ETVA 1FIAA 1JKQC 3M4OJ 2M8GX 2GENA 3ON4A 5IYBJ 2RASA 3O60A 2WUIA 3GTKJ 5EGOB 4UUSB 5E3LA 2VUMJ 2FQ4A 3QBMA 4FCYA 1MBJA 3BG5A 3O8GA 1DU6A 3NAUA 2K9QA 3GTGJ 3I4MJ 2IU5A 2JA6J 4J19A 2WV1A 2HOTA 1ETOA 2Q24A 5M3MJ 2O7OA 4A3LJ 5GPAA 1ETQA 4MLOA 4ME9A 1APLC 2DA5A 4M3BA 2NVTJ 3HOYJ 3ANPA 2YUSA 1BL0A 2DA1A 3KZ9A 2ID3A 1IRZA 3RZDJ 3Q3SA 1BA5A 2KDZA 4L62A 2G3BA 3BNIA 5K7HA 4CYCB 2W53A 1MBEA 5HSZA 1S7EA 1IDYA 2N8GA 5JLXA 1LFUP 2HXOA 2M0CA 3JRIA 2O9LA 2XPVA 4A69C 5FKOA 3I4NJ 3HB9A 5IP9J 1LE8A 2CU7A 1U9OA 3DCFA 5EYRA 2XGDA 1FTTA 3QQAA 2VKVA 2E2JJ 2DJNA 2JA8J 2DTZA 3BRUA 5GPCA 4ICHA 5IPAA 3EGQA 1A6IA 5E3NA 5C3EJ 4X6AJ 2CRGA 2MGQA 1JJ8C 2JJ7A 4C3HJ 2LD5A 2K9SA 2JN6A 4M3DA 5FJ8J 5J3LA 2O7TA 2FX0A 2E19A 1NK2P 2X9DA 4C2MJ 3COLA 5FKMA 3CQZJ 3FIWA 1QVTA 4JYKA 1VFCA 1U9NA 1HOMA 4IHXA 5F0CA 1D5YA 3H3VK 2WGBA 2R7ZJ 4QTRA 2R5YA 4BBSJ 1IJWC 2F07A 2HI3A 1UHSA 1UI5A 3JRCA 2JA7J 3C07A 1VNDA 5EZGA 4IHYA 4IHVA 5IYCJ 3TW6A 3TW7A 1FJLA 4G12A 4GCLA 1AU7A 3JRBA 1RKTA 4C3JJ 3ZQIA 3S1RJ 4A3KJ 2M34A 4M3EA 2G7GA 3IUVA 2M9HA 4JP0A 3BG3A 3QPLA 2ID6A 2QF7A 3JRHA 1G2HA 4GFKA 3ZOBA 3Q0VA 2XDNA 3VIBA 1JKRC 2LY9A 3B6AA 4MIMA 4XRSA 1SFOJ 3H0GJ 5F08A 3GTQJ 1TWCJ 5F27A 3RH2A 3S2HJ 2NS8A 1MSFC 3OIOA 1ITYA 4YZEA 2HQ5A 1W0UA 2QCOA 1I6HJ 5IP6A 3NRGA 1BJZA 1LE8B 2XSDC 4GFBA 2OI8A 4I76A 4ABZA 4L5EA 3QKXA 3L1PA 1WGXA 2PMZN 1TC3C 1ETXA 3E7QA 3E7LA 3LJLA 1GDTA 1W0TA 2EZKA 1IDZA 5FKKA 2NOGA 4IEJA 1R9TJ 4A3DJ 3HKZN 3VW0A 2EH3A 1JT0A 3BT9A 2R5ZA 1JTXA 2QIBA 3FKIJ 3KNWA 3VOXA 4MFEA 3HGYA 2ZOZA 1LFBA 2ECBA 3SJMA 3A01A 3DEWA 4XRSG 2GBYA 2G0EA 5FMPA 2CUFA 3BR1A 3ZQLA 1NK3P 5D1RA 3HOZJ 3JSJA 4S0HB 3MN2A 1Q1VA 1RESA 2R0QC 2L7MP 3VOKA 2R5YB 2L0KA 1OCTC 3K2AA 5IP7J 4JX6A 3S5RA 1QRYA 3LSJA 4RDUA 3NPIA 3D1NI 1U78A 5J1YA 1GT0C 3RD3A 3BTCA 5FKLA 4B1RA 4RBOA 4BBRJ 1BW6A 3CRJA 1QVUA 2LVSA 3KKDA 3JRAA 2DA2A 1POGA 1JJ6C 1MBGA 4V2GA 3ON2A 1T33A 5M5XJ 2ELKA 2X48A 3OSGA 5J1UA 3HEFA 1IUFA 3NNRA 5E3MA 1MH4A 3VW2A 4DYRA 4HKUA 2JA5J 2CJJA 1GVDA 2W48A 3GTJJ 5FGLA 5HAWA 1WPKA 3ZQGA 5IOZA 5F04A 1P7IA 3ZQCA 3EUPA 4AC6A 1HCRA 2IAIA 2CQXA 4JX5A 3AQSA 1ORKA 1XS9A 1XG1A 2NP5A 1Z77A 4C3IJ 1B72A 3NI7A 2OF7A 4A3MJ 3Q0UA 4DYQA 2K40A 4DZPA 3DPJA 2PZ9A 2HXIA 1Y1VJ 2DA4A 4Y52J 3NXCA 1JUPA 1EF4A 2ZCMA 3UKGA 1RETA 3HDDA 3V78A 4QIWN 2R5ZB 1OFCX 5C4JJ 3GBGA 2WB1N 5E3OA 1BW5A 1ZK8A 4A3EJ 5K7ZA 4D7MA 5EG0A 4BXXJ 3TP0A 1VI0A 2JMWA 5C4XJ 5DAJA 2NVQJ 1SGMA 3S1NJ 3JRFA 3CJDA 1TWAJ 3LSGA 1K83J 2X6OA 4A3CJ 1FEXA 4A3BJ 2DA7A 4MK6A 2H8RA 1CQTA 3HTAA 1ETWA 1QPIA 4X1EA 2H1KA 3LWJA 2YVEA 5DTDA 3B6CA 2E2IJ 1ZR2A 3BQZA 5EEAA 5EFYA 2EZLA 2D5VA 4MXMA 4FTHA 4FISA 2ZOYA 1OCPA 4BKXA 3VVXA 1JGGA 2XB5A 2DA6A 5HODA 2NP3A 1MBFA 1TWGJ 5EZHA 3WHCA 2LFBA 3F0CA 4A93J 1F36A 4A3JJ 5CXGA 2COBA 1OJLA 4AUXA 1AKHA 3G56A 2GUHA 4QSHA 4IHWA 3W6VA 4XRMA 4DZJA 3NARA 1AHDP 4GFLA 2ME0A 3M3YJ 3VVZA 3LSPA 5HBUA 4M6VA 1GV2A 4KWAA 3A02A 3MNLA 1B72B 2YS9A 1TWHJ 5F1JA 3BG9A 2MG4A 3KKCA 1HLVA 3TEDA 5M3FJ 3G7RA 2I10A 2XPWA 3K7AJ 1IG7A 3JREA 3HIMA 2CQQA 2UXUA 3LHQA 4B4CA 3LOCA 5JLWA 2R93J 2Y30A 3TP3A 1U8BA 4A3IJ 1Y1WJ 5K58A 2UXIA 3HBLA 4D5FA 3F1BA 2DMPA 5EG0B 2LKXA 3BR2A 2ZCXA 4XIDA 3CCYA 2LTPA 3IV5A 3SDGA 2WAQN 2MW8A 5IOYA 1JKOC 1JUMA 2M2EA 3WHBA 5M5YJ 3LNQA 2E2HJ 1UG2A 1HF0A 1VF9A 2L7ZA 4DW6A 4HNVA 1I3QJ 2XGCA 2NVYJ 3VPRA 3BR3A 3HM5A 3AQTA 2GLOA 1ZQ3P 3FISA 4W1UA 1YRNA 4ACIA 1MNMC 5FHPA 2OPTA 3ZQFA 3PO2J 2ECCA 4MO7A 4B3AA 1H89C 2YU9J 5C44J 4UDSA 2DN0A 2RHAA 3SFIA 3HOXJ 1JTYA 2L7FP 3CDLA 1X2NA 1IV6A 2DA3A 2HYJA 5CXIA 1H8AC 2UXPA 5D18A 5M5WJ 1AKHB 3BCGA 1ZR4A 2ME6A 4I6ZA 1IGNA 2QWTA 2QOPA 2GFNA 1RR7A 1ZGWA 1UI6A 3HOWJ 2DMQA 1MH3A 1F43A 4V2FA 1HDDC 2G7SA 1P7JA 3MKLA 1WH5A 1X58A 3S2DJ 1FTZA 3JRDA 9ANTA 2DG8A 3GEUA 1WI3A 1X2MA 3BR0A 1K61A 3PM1A 2XPUA 2Y9YA 4BY7J 1PUFA 2UXOA 5IYDJ 4D7NA 3HTJA 3P9TA 3VUQA 1RKWA 1I50J 5GP9A 4JKZA 3ANGA 1FIPA 3BTLA 2EZIA 3C2BA 3A01B 3FK7A 1MSEC 3S1QJ 4GCKA 2KT0A 2E1OA 2HDDA 2DG7A 5AQCA 1B8IA 1XC5A 2Y0SN 4EEFG 1O4XA 2Y9ZA 4JX4A 5F0HA 1H88C 2VPRA 3HOUJ 3BTIA 3PASA 4BY1J 3A03A 5F0FA 3BHQA 1JUSA 4FE7A 5FLMJ 4M3GA 3BTJA 2CUEA 3IH4A 2EQRA 5C4YA 2DMTA 2FBQA 3HTIA 1T56A 2OERA 2O8KA 2GM4A 5D19A 3V6GA 5DS9A 1Z0XA 3BR6A 1GV5A 1E3OC 1YRNB 1HDPA 3BQYA 2REKA 3PPBA 2MSYA 2IBDA 3IH2A 3BR5A 2B63J 2FD5A 2AO9A 2K9NA 2Y31A 4CGRA 2HOAA 4JL3A 1JKPC 2JWTA 3S17J 1A5JA 2VI6A 2DMUA 2IEKA 4NELA 2LK2A 3S16J 3O8HA 4GCTA 2NX4A 3S14J 2LP0A 3G1MA 1MBHA 3GTMJ 3S15J 2UXHA 1SANA 1TWFJ 4Y7NJ 2QTQA 3HGGA 3Q0WA 3B81A 5EGOA 4M3FA 4UUSA 2HOSA 3OSFA 1ENHA 3MVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LR8 A;  5H9T A;  2EBI A;  1WCM J;  2JK3 A;  2Y2Z A;  3HE0 A;  1MBK A;  4D5C A;  5K7F A;  4W97 A;  1WH7 A;  2DMN A;  2XRL A;  2D6Y A;  4PXI A;  1ETY A;  3T6N A;  1ETK A;  3IH3 A;  1PUF B;  5CW8 A;  3G1O A;  3RQI A;  3GTP J;  3S1M J;  2TCT A;  5FKN A;  3OOU A;  3VP5 A;  5EF6 A;  2HYT A;  4MFD A;  4LOC A;  1IC8 A;  1ZKG A;  2V57 A;  4AYB N;  2L9R A;  2NS7 A;  3G1L A;  4AF5 A;  4CYC A;  5BNG A;  5EDN A;  3PO3 J;  1B8I B;  2ZB9 A;  3GZI A;  2NVX J;  2PBX A;  2QKO A;  2EZH A;  3HTH A;  3QPS A;  4NDL A;  3VVY A;  3RZO J;  2XGE A;  3HOV J;  4NN1 A;  4A3G J;  3LSR A;  1JT6 A;  3BJB A;  3GTO J;  5FLV A;  3ZQH A;  3GTL J;  1DU0 A;  2ZCN A;  3JRG A;  3CMY A;  4JNN A;  1NTC A;  4UUT A;  5J1R A;  3RKQ A;  1UMQ A;  2VKE A;  2P81 A;  1GUU A;  2AHQ A;  3VW1 A;  3FRQ A;  2FJ1 A;  2XB0 X;  4AC0 A;  4FE4 A;  3CWR A;  2YVH A;  2TRT A;  4A3F J;  1RPW A;  4DYC A;  2G7L A;  3FK6 A;  4XK4 A;  3JR9 A;  1ZTR A;  2R92 J;  2LLK A;  2RAE A;  2HKU A;  4XIC A;  1ETV A;  1FIA A;  1JKQ C;  3M4O J;  2M8G X;  2GEN A;  3ON4 A;  5IYB J;  2RAS A;  3O60 A;  2WUI A;  3GTK J;  5EGO B;  4UUS B;  5E3L A;  2VUM J;  2FQ4 A;  3QBM A;  4FCY A;  1MBJ A;  3BG5 A;  3O8G A;  1DU6 A;  3NAU A;  2K9Q A;  3GTG J;  3I4M J;  2IU5 A;  2JA6 J;  4J19 A;  2WV1 A;  2HOT A;  1ETO A;  2Q24 A;  5M3M J;  2O7O A;  4A3L J;  5GPA A;  1ETQ A;  4MLO A;  4ME9 A;  1APL C;  2DA5 A;  4M3B A;  2NVT J;  3HOY J;  3ANP A;  2YUS A;  1BL0 A;  2DA1 A;  3KZ9 A;  2ID3 A;  1IRZ A;  3RZD J;  3Q3S A;  1BA5 A;  2KDZ A;  4L62 A;  2G3B A;  3BNI A;  5K7H A;  4CYC B;  2W53 A;  1MBE A;  5HSZ A;  1S7E A;  1IDY A;  2N8G A;  5JLX A;  1LFU P;  2HXO A;  2M0C A;  3JRI A;  2O9L A;  2XPV A;  4A69 C;  5FKO A;  3I4N J;  3HB9 A;  5IP9 J;  1LE8 A;  2CU7 A;  1U9O A;  3DCF A;  5EYR A;  2XGD A;  1FTT A;  3QQA A;  2VKV A;  2E2J J;  2DJN A;  2JA8 J;  2DTZ A;  3BRU A;  5GPC A;  4ICH A;  5IPA A;  3EGQ A;  1A6I A;  5E3N A;  5C3E J;  4X6A J;  2CRG A;  2MGQ A;  1JJ8 C;  2JJ7 A;  4C3H J;  2LD5 A;  2K9S A;  2JN6 A;  4M3D A;  5FJ8 J;  5J3L A;  2O7T A;  2FX0 A;  2E19 A;  1NK2 P;  2X9D A;  4C2M J;  3COL A;  5FKM A;  3CQZ J;  3FIW A;  1QVT A;  4JYK A;  1VFC A;  1U9N A;  1HOM A;  4IHX A;  5F0C A;  1D5Y A;  3H3V K;  2WGB A;  2R7Z J;  4QTR A;  2R5Y A;  4BBS J;  1IJW C;  2F07 A;  2HI3 A;  1UHS A;  1UI5 A;  3JRC A;  2JA7 J;  3C07 A;  1VND A;  5EZG A;  4IHY A;  4IHV A;  5IYC J;  3TW6 A;  3TW7 A;  1FJL A;  4G12 A;  4GCL A;  1AU7 A;  3JRB A;  1RKT A;  4C3J J;  3ZQI A;  3S1R J;  4A3K J;  2M34 A;  4M3E A;  2G7G A;  3IUV A;  2M9H A;  4JP0 A;  3BG3 A;  3QPL A;  2ID6 A;  2QF7 A;  3JRH A;  1G2H A;  4GFK A;  3ZOB A;  3Q0V A;  2XDN A;  3VIB A;  1JKR C;  2LY9 A;  3B6A A;  4MIM A;  4XRS A;  1SFO J;  3H0G J;  5F08 A;  3GTQ J;  1TWC J;  5F27 A;  3RH2 A;  3S2H J;  2NS8 A;  1MSF C;  3OIO A;  1ITY A;  4YZE A;  2HQ5 A;  1W0U A;  2QCO A;  1I6H J;  5IP6 A;  3NRG A;  1BJZ A;  1LE8 B;  2XSD C;  4GFB A;  2OI8 A;  4I76 A;  4ABZ A;  4L5E A;  3QKX A;  3L1P A;  1WGX A;  2PMZ N;  1TC3 C;  1ETX A;  3E7Q A;  3E7L A;  3LJL A;  1GDT A;  1W0T A;  2EZK A;  1IDZ A;  5FKK A;  2NOG A;  4IEJ A;  1R9T J;  4A3D J;  3HKZ N;  3VW0 A;  2EH3 A;  1JT0 A;  3BT9 A;  2R5Z A;  1JTX A;  2QIB A;  3FKI J;  3KNW A;  3VOX A;  4MFE A;  3HGY A;  2ZOZ A;  1LFB A;  2ECB A;  3SJM A;  3A01 A;  3DEW A;  4XRS G;  2GBY A;  2G0E A;  5FMP A;  2CUF A;  3BR1 A;  3ZQL A;  1NK3 P;  5D1R A;  3HOZ J;  3JSJ A;  4S0H B;  3MN2 A;  1Q1V A;  1RES A;  2R0Q C;  2L7M P;  3VOK A;  2R5Y B;  2L0K A;  1OCT C;  3K2A A;  5IP7 J;  4JX6 A;  3S5R A;  1QRY A;  3LSJ A;  4RDU A;  3NPI A;  3D1N I;  1U78 A;  5J1Y A;  1GT0 C;  3RD3 A;  3BTC A;  5FKL A;  4B1R A;  4RBO A;  4BBR J;  1BW6 A;  3CRJ A;  1QVU A;  2LVS A;  3KKD A;  3JRA A;  2DA2 A;  1POG A;  1JJ6 C;  1MBG A;  4V2G A;  3ON2 A;  1T33 A;  5M5X J;  2ELK A;  2X48 A;  3OSG A;  5J1U A;  3HEF A;  1IUF A;  3NNR A;  5E3M A;  1MH4 A;  3VW2 A;  4DYR A;  4HKU A;  2JA5 J;  2CJJ A;  1GVD A;  2W48 A;  3GTJ J;  5FGL A;  5HAW A;  1WPK A;  3ZQG A;  5IOZ A;  5F04 A;  1P7I A;  3ZQC A;  3EUP A;  4AC6 A;  1HCR A;  2IAI A;  2CQX A;  4JX5 A;  3AQS A;  1ORK A;  1XS9 A;  1XG1 A;  2NP5 A;  1Z77 A;  4C3I J;  1B72 A;  3NI7 A;  2OF7 A;  4A3M J;  3Q0U A;  4DYQ A;  2K40 A;  4DZP A;  3DPJ A;  2PZ9 A;  2HXI A;  1Y1V J;  2DA4 A;  4Y52 J;  3NXC A;  1JUP A;  1EF4 A;  2ZCM A;  3UKG A;  1RET A;  3HDD A;  3V78 A;  4QIW N;  2R5Z B;  1OFC X;  5C4J J;  3GBG A;  2WB1 N;  5E3O A;  1BW5 A;  1ZK8 A;  4A3E J;  5K7Z A;  4D7M A;  5EG0 A;  4BXX J;  3TP0 A;  1VI0 A;  2JMW A;  5C4X J;  5DAJ A;  2NVQ J;  1SGM A;  3S1N J;  3JRF A;  3CJD A;  1TWA J;  3LSG A;  1K83 J;  2X6O A;  4A3C J;  1FEX A;  4A3B J;  2DA7 A;  4MK6 A;  2H8R A;  1CQT A;  3HTA A;  1ETW A;  1QPI A;  4X1E A;  2H1K A;  3LWJ A;  2YVE A;  5DTD A;  3B6C A;  2E2I J;  1ZR2 A;  3BQZ A;  5EEA A;  5EFY A;  2EZL A;  2D5V A;  4MXM A;  4FTH A;  4FIS A;  2ZOY A;  1OCP A;  4BKX A;  3VVX A;  1JGG A;  2XB5 A;  2DA6 A;  5HOD A;  2NP3 A;  1MBF A;  1TWG J;  5EZH A;  3WHC A;  2LFB A;  3F0C A;  4A93 J;  1F36 A;  4A3J J;  5CXG A;  2COB A;  1OJL A;  4AUX A;  1AKH A;  3G56 A;  2GUH A;  4QSH A;  4IHW A;  3W6V A;  4XRM A;  4DZJ A;  3NAR A;  1AHD P;  4GFL A;  2ME0 A;  3M3Y J;  3VVZ A;  3LSP A;  5HBU A;  4M6V A;  1GV2 A;  4KWA A;  3A02 A;  3MNL A;  1B72 B;  2YS9 A;  1TWH J;  5F1J A;  3BG9 A;  2MG4 A;  3KKC A;  1HLV A;  3TED A;  5M3F J;  3G7R A;  2I10 A;  2XPW A;  3K7A J;  1IG7 A;  3JRE A;  3HIM A;  2CQQ A;  2UXU A;  3LHQ A;  4B4C A;  3LOC A;  5JLW A;  2R93 J;  2Y30 A;  3TP3 A;  1U8B A;  4A3I J;  1Y1W J;  5K58 A;  2UXI A;  3HBL A;  4D5F A;  3F1B A;  2DMP A;  5EG0 B;  2LKX A;  3BR2 A;  2ZCX A;  4XID A;  3CCY A;  2LTP A;  3IV5 A;  3SDG A;  2WAQ N;  2MW8 A;  5IOY A;  1JKO C;  1JUM A;  2M2E A;  3WHB A;  5M5Y J;  3LNQ A;  2E2H J;  1UG2 A;  1HF0 A;  1VF9 A;  2L7Z A;  4DW6 A;  4HNV A;  1I3Q J;  2XGC A;  2NVY J;  3VPR A;  3BR3 A;  3HM5 A;  3AQT A;  2GLO A;  1ZQ3 P;  3FIS A;  4W1U A;  1YRN A;  4ACI A;  1MNM C;  5FHP A;  2OPT A;  3ZQF A;  3PO2 J;  2ECC A;  4MO7 A;  4B3A A;  1H89 C;  2YU9 J;  5C44 J;  4UDS A;  2DN0 A;  2RHA A;  3SFI A;  3HOX J;  1JTY A;  2L7F P;  3CDL A;  1X2N A;  1IV6 A;  2DA3 A;  2HYJ A;  5CXI A;  1H8A C;  2UXP A;  5D18 A;  5M5W J;  1AKH B;  3BCG A;  1ZR4 A;  2ME6 A;  4I6Z A;  1IGN A;  2QWT A;  2QOP A;  2GFN A;  1RR7 A;  1ZGW A;  1UI6 A;  3HOW J;  2DMQ A;  1MH3 A;  1F43 A;  4V2F A;  1HDD C;  2G7S A;  1P7J A;  3MKL A;  1WH5 A;  1X58 A;  3S2D J;  1FTZ A;  3JRD A;  9ANT A;  2DG8 A;  3GEU A;  1WI3 A;  1X2M A;  3BR0 A;  1K61 A;  3PM1 A;  2XPU A;  2Y9Y A;  4BY7 J;  1PUF A;  2UXO A;  5IYD J;  4D7N A;  3HTJ A;  3P9T A;  3VUQ A;  1RKW A;  1I50 J;  5GP9 A;  4JKZ A;  3ANG A;  1FIP A;  3BTL A;  2EZI A;  3C2B A;  3A01 B;  3FK7 A;  1MSE C;  3S1Q J;  4GCK A;  2KT0 A;  2E1O A;  2HDD A;  2DG7 A;  5AQC A;  1B8I A;  1XC5 A;  2Y0S N;  4EEF G;  1O4X A;  2Y9Z A;  4JX4 A;  5F0H A;  1H88 C;  2VPR A;  3HOU J;  3BTI A;  3PAS A;  4BY1 J;  3A03 A;  5F0F A;  3BHQ A;  1JUS A;  4FE7 A;  5FLM J;  4M3G A;  3BTJ A;  2CUE A;  3IH4 A;  2EQR A;  5C4Y A;  2DMT A;  2FBQ A;  3HTI A;  1T56 A;  2OER A;  2O8K A;  2GM4 A;  5D19 A;  3V6G A;  5DS9 A;  1Z0X A;  3BR6 A;  1GV5 A;  1E3O C;  1YRN B;  1HDP A;  3BQY A;  2REK A;  3PPB A;  2MSY A;  2IBD A;  3IH2 A;  3BR5 A;  2B63 J;  2FD5 A;  2AO9 A;  2K9N A;  2Y31 A;  4CGR A;  2HOA A;  4JL3 A;  1JKP C;  2JWT A;  3S17 J;  1A5J A;  2VI6 A;  2DMU A;  2IEK A;  4NEL A;  2LK2 A;  3S16 J;  3O8H A;  4GCT A;  2NX4 A;  3S14 J;  2LP0 A;  3G1M A;  1MBH A;  3GTM J;  3S15 J;  2UXH A;  1SAN A;  1TWF J;  4Y7N J;  2QTQ A;  3HGG A;  3Q0W A;  3B81 A;  5EGO A;  4M3F A;  4UUS A;  2HOS A;  3OSF A;  1ENH A;  3MVP A; 
#chains in the Genus database with same CATH topology
 2A6H F;  2Y2Z A;  3IC7 A;  1WH7 A;  4FET A;  2IJL A;  2XRL A;  3DV8 A;  1ETY A;  2GAU A;  4GO1 A;  5KK1 A;  3DKY A;  1XX5 A;  2QKM B;  2B3W A;  1FBS A;  5DEQ A;  3H92 A;  5J8C A;  3OOU A;  1T6S A;  1W5T A;  4B43 A;  1LEB A;  1IC8 A;  1R36 A;  2DT5 A;  3CP2 A;  3ZPL A;  3V7S A;  1OCZ H;  4XR6 A;  4AYB N;  3G1L A;  4CYC A;  2JVH A;  2FOK A;  3HHG A;  2CW0 F;  2Z5U A;  2ZB9 A;  1Y39 A;  2NVX J;  2ZJP F;  1QNT A;  2QKO A;  1RUN A;  4ETS A;  2X6Y A;  2DT6 A;  4NDL A;  2W85 A;  3VVY A;  4UNO A;  1OYI A;  3RZO J;  2XGE A;  3HOV J;  3BJB A;  5FLV A;  3ZQH A;  2ZCN A;  4JNN A;  2XRN A;  1R4N B;  3OR1 C;  1MND A;  3HYI A;  2PI0 A;  2LKP A;  3KP7 A;  1R00 A;  4RS8 A;  4FE4 A;  2D1H A;  2EV6 A;  4LIT A;  2YVH A;  4NC6 A;  2G7L A;  4HST A;  4U9L A;  4WF2 A;  4DGW B;  3GYH X;  3JSO A;  3M4O J;  2GEN A;  3LSK A;  1Z21 A;  2KPM A;  2CH0 A;  2H09 A;  1D0X A;  2VJ5 A;  2ZXI A;  2A5W A;  5E3L A;  2FQ4 A;  2GOM A;  5FRM A;  5LRR A;  1X1B A;  3BG5 A;  2K9L A;  4S05 A;  1DU6 A;  1S7O A;  3NAU A;  5J4V A;  2ZC2 A;  2V26 A;  5B66 C;  1SAU A;  2QSH X;  5D5V B;  4PFP A;  3L9F A;  1ETQ A;  2HVR A;  2M4G A;  4PFO A;  2WAQ A;  3OYN A;  1A36 A;  3FXR A;  3N4M A;  2OTJ I;  2A2F X;  2YUS A;  5E1W A;  2FRH A;  2GIV A;  3F72 A;  2W00 A;  3BJO A;  3L2W A;  2E5Z A;  4E7K A;  1IRZ A;  3RZD J;  3Q3S A;  2O0Y A;  4II3 A;  4DJA A;  2KDZ A;  2QYO A;  4H0E A;  1G59 A;  4L0Y B;  3NS4 A;  4L62 A;  1P6R A;  4E7H A;  5HSZ A;  1MBE A;  2XC7 A;  1YW7 A;  2VC0 A;  2MAB A;  2X85 A;  1K78 B;  2M7A A;  1L0O C;  2M0C A;  3HUG B;  2O9L A;  1GHC A;  2VE9 A;  3BCB A;  2NVU B;  5IP9 J;  1LE8 A;  3ISP A;  2E7X A;  3TKY A;  5KVR A;  2EIJ H;  2VON A;  2VKV A;  3FX3 A;  5JI6 A;  2DJN A;  2JA8 J;  1ZHF A;  2DAO A;  5GPC A;  3BRU A;  2HKX A;  2PFB A;  3DKW A;  3HXL A;  4WX9 A;  1UZC A;  3PJR A;  4CXF A;  2K9S A;  3HTU A;  2JN6 A;  2XHK A;  5FJ8 J;  1HBX G;  2FX0 A;  3I3L A;  3QPH A;  1E0E A;  4U0Y A;  3CUQ A;  4IL6 C;  4CIC A;  1ZRE A;  5FKM A;  3CQZ J;  1U5T A;  5ICE A;  2DOE A;  3DF8 A;  3HG9 A;  2R7R A;  2VOD A;  1FY7 A;  1XMK A;  2GQQ A;  5HNH A;  3HRM A;  4U7B A;  2HI3 A;  2VQL A;  1LDJ A;  1QZY A;  3K2Z A;  2IA1 A;  3C07 A;  5EZG A;  1I27 A;  4FHT A;  3G73 A;  4ENK A;  1LB2 A;  4CHU A;  3QOP A;  4G12 A;  1BN5 A;  3JRB A;  1ACI A;  3DTK A;  2UWM A;  4KN4 X;  2XRO A;  2L9S A;  4RAZ A;  3S1R J;  4M3E A;  2G7G A;  1PUE E;  4KDP A;  4JP0 A;  4B47 A;  3BG3 A;  2QF7 A;  2EFQ A;  1YW9 A;  1KZH A;  3QU3 A;  2LBF A;  5E8G A;  5LEK A;  1ZRD A;  3BG6 A;  3B6A A;  2ZFU A;  4XOT A;  1SFO J;  1S29 A;  3S3O A;  5FD6 A;  2W1O A;  3S2H J;  1P92 A;  3OIO A;  4E7L A;  2BOL A;  2VL8 A;  4YZE A;  3VOE A;  3CDI A;  2ZCW A;  1BJZ A;  4IQ4 A;  3U21 A;  1WZ2 A;  4L5E A;  3TMO A;  4AVZ A;  3OYD A;  4LMY A;  4RAY A;  1IN7 A;  5IT3 A;  4P55 A;  5FRN A;  1IDZ A;  1R9T J;  1OMI A;  4CA0 A;  2VOO A;  5LBQ A;  1M1E B;  2EH3 A;  4KIS A;  2QIB A;  2IS4 A;  2ADU A;  2R7X A;  1R23 A;  3HGY A;  4A2U A;  3SJM A;  3A01 A;  3DEW A;  3KP3 A;  4F93 B;  2WAE A;  2CUF A;  5D1R A;  3HOZ J;  2FXA A;  4S0H B;  1K6Y A;  2L7M P;  1KON A;  1Z6R A;  4EGZ A;  3A4C A;  1OCT C;  2HVS A;  5HS8 A;  3LQR A;  3BP8 A;  2Q2E B;  3NPI A;  2E35 A;  3ECO A;  4E7Z A;  1OYW A;  3D1N I;  1X1A A;  3F6V A;  3FXQ A;  3G2B A;  3BC8 A;  4BBR J;  1GXP A;  1FYK A;  3REO A;  2KIS A;  3LA3 A;  1JXS A;  2JUG A;  3PNY A;  5J8F A;  3MQ0 A;  1POG A;  1R71 A;  2XSJ C;  2LNB A;  3H3U A;  1T33 A;  3LSI A;  3PSI A;  4FX0 A;  4RB0 A;  3VYU B;  5L3F A;  3OSG A;  1RI7 A;  2PFV A;  3J7A Y;  1YOV B;  1OLT A;  2L3D A;  2LDU A;  1MH4 A;  3VW2 A;  5HLH A;  2L5Q A;  1GVD A;  4Z2Y A;  3HPH A;  3S2W A;  4QLC U;  5F04 A;  1P7I A;  3ZQC A;  3T8R A;  2K7L A;  3F23 A;  2IS2 A;  2KKO A;  1ORK A;  2YX7 A;  5E17 F;  2QSF X;  2C6Y A;  1Z77 A;  4MEX F;  4EJT A;  2E1N A;  2K40 A;  1W7P A;  2PZ9 A;  1D1A A;  4Y52 J;  3NXC A;  1JUP A;  3HDD A;  3V78 A;  2M4K A;  4OWR B;  3Q5F A;  3CO7 C;  1S7A A;  4BXF A;  2WB1 N;  2MFZ A;  2Z16 A;  1DQU A;  4M9X A;  1BW5 A;  2QGU A;  3J80 Z;  3IKV A;  5K7Z A;  4D7M A;  3J81 Z;  1V4R A;  2OCE A;  1QPM A;  1FBU A;  4IRG A;  1HKQ A;  3LQQ A;  3DBL B;  4HEA 2;  3HIF A;  5AIP A;  2NVQ J;  1SGM A;  1B4A A;  1TNS A;  1RC9 A;  3CJD A;  1ZH5 A;  1LVA A;  1S8N A;  3LSG A;  4A3C J;  3HRT A;  2FF4 A;  2OC6 A;  5L3C A;  4A3B J;  2W4S A;  5DD8 A;  3CCU I;  3CC4 I;  3DPU A;  2H8R A;  4MHG A;  2VQC A;  1IRF A;  1SEU A;  4X1E A;  1O3T A;  2H1K A;  3LWJ A;  1TT5 B;  3AG1 H;  5EEA A;  1P9Q C;  2D1V A;  4UXN A;  2UUZ A;  1LVK A;  2RQQ A;  2D5V A;  5EFY A;  4FTH A;  3MKW B;  3ELK A;  3KLN A;  1IUY A;  3LL7 A;  1R1T A;  4KT6 A;  5H20 A;  5K5O A;  2X1C A;  4LG3 A;  5HOD A;  3ABL H;  4U7D A;  3KYD B;  5EZH A;  1JHF A;  1K79 A;  4ZJZ A;  2KQR A;  2VBW A;  1J0R A;  3AKZ A;  2O61 A;  3E97 A;  5D4R A;  3U9G A;  2MYS A;  2JSC A;  2VQG A;  3W6V A;  1KYZ A;  5EEG A;  3ESW B;  1AHD P;  1ZLJ A;  2H8W A;  2IS6 A;  3LSP A;  5HBU A;  3H3Z A;  3A02 A;  2DDB A;  3CTA A;  4HNU A;  2VBX A;  3KIO A;  3FXL A;  1TWH J;  1ULY A;  4P9U A;  1T38 A;  5FLX K;  3BG9 A;  2MG4 A;  3KKC A;  1YQA A;  3CCJ I;  2GXB A;  3BLY A;  2OAZ A;  2M1B A;  4DOZ A;  3K7A J;  2GXA A;  1IG7 A;  2LMD A;  2VN2 A;  4GXO A;  3K1N A;  3MEX A;  4HSR A;  2DXI A;  5JLW A;  3K4C A;  4IHT A;  3SHF A;  1P4A A;  2Y30 A;  4LJZ F;  5K58 A;  4LGW A;  3MWM A;  1BR2 A;  4KT5 C;  1U5T B;  3FXU A;  5HOO A;  4XSX F;  2E60 A;  2E2H J;  2M2E A;  3TGN A;  4G7H F;  2E1C A;  2YVX A;  4MQV A;  1FOW A;  5DM7 F;  1W36 D;  4FQG A;  2L7Z A;  3OR2 C;  3R0A A;  5LFA A;  2XGC A;  3BZK A;  1H9T A;  4IOA F;  3HM5 A;  2JT1 A;  3OV8 A;  3CCE I;  3DXJ F;  1XB4 A;  1MNM C;  4EGY A;  2OPT A;  1ODD A;  3PO2 J;  2K02 A;  4B3A A;  1H89 C;  2LH9 A;  5C44 J;  4A5N A;  1ONV A;  3L2Q A;  3GFJ A;  3HOX J;  1KQ8 A;  2FNA A;  1X1P A;  3CDL A;  3PFI A;  2PMZ A;  5CXI A;  1H8A C;  2ZJQ F;  2GZW A;  4CH7 A;  2L02 A;  4PGG A;  1AKH B;  4G6Q A;  3QYF A;  2QWT A;  5CVV A;  2GFN A;  3VYT B;  1UI6 A;  1G8X A;  3L2C A;  2DMQ A;  1UST A;  3K4J A;  1P4W A;  3F8N A;  4XOP A;  1F43 A;  2PN6 A;  1QA6 A;  2M45 A;  1N75 A;  2CV1 A;  1D8K A;  3AFH A;  1J09 A;  4M6Y A;  3DKX A;  9ANT A;  1FTZ A;  4EQQ A;  2DG8 A;  1WI3 A;  3BR0 A;  4C2T A;  2R7F A;  2XPU A;  4KMU X;  2QLZ A;  4BY7 J;  2VT2 A;  3E5Q A;  3DBH B;  3LAP A;  2UXO A;  3WE2 A;  4WXH A;  3P9T A;  3VUQ A;  1ZG3 A;  5FGM A;  1FIP A;  2RNJ A;  4Y13 A;  3I59 B;  3SZP A;  2HTJ A;  4AID A;  3ZN1 A;  3A01 B;  1MSE C;  2KZG A;  2FA5 A;  5K1Y A;  3OS1 A;  2AQE A;  1YE9 A;  4G9Y A;  4EEF G;  1WSU A;  1HW2 A;  5FD5 A;  5FFX A;  4I2O A;  1G3S A;  5E1Z B;  1XSV A;  4FE7 A;  3KET A;  3FBN B;  4M3G A;  2V9V A;  4IXA A;  4UV8 A;  1IZ1 A;  2EQR A;  2VOP A;  2DMT A;  2VT3 A;  2J5O A;  4JK1 X;  5HLI A;  3SZT A;  3NQO A;  3HTI A;  1ZEL A;  1T56 A;  4LIV A;  2O8K A;  1GV5 A;  1VZ0 A;  3F3X A;  4ZYE A;  4ESF A;  5ILU A;  3BY6 A;  3ABT A;  1HA8 A;  3IH2 A;  2AO9 A;  2Y31 A;  4L0Z B;  4CGR A;  2HOA A;  3VEP A;  4JL3 A;  2A3S A;  2JWT A;  4ITV A;  1CF7 A;  1BIA A;  2ZKZ A;  4NEL A;  2QA4 I;  3QAH A;  2ELJ A;  5F1R A;  1I5Z A;  3IRR A;  1IAW A;  3QWL A;  3G1M A;  2RC4 A;  3RSN A;  1TQP A;  2UXH A;  2X4H A;  4Y7N J;  1UHW A;  2QTQ A;  3RPU A;  1UCR A;  3OSF A;  2LR8 A;  3KE2 A;  1WCM J;  1YHQ I;  2WBM A;  3WTZ A;  2XGX A;  3FXJ A;  3HRS A;  3KZZ A;  4LLG F;  1FPQ A;  1LQ1 A;  3QPT A;  4TV7 A;  4BAY A;  1I1G A;  2XKO A;  1ETK A;  1WKM A;  2LYC A;  4WWC A;  2DPD A;  2HPI A;  3I71 A;  2GIZ A;  3M9A A;  1D0Y A;  1D0Z A;  3RQI A;  3G3Z A;  2M0M A;  2ZXJ A;  4U0V A;  5CVI A;  2QZ8 A;  3GTP J;  2TCT A;  5FKN A;  2Q8K A;  2HYT A;  1Z7U A;  5E79 C;  1ZKG A;  2NXN B;  3DU5 A;  2V57 A;  2L9R A;  2NS7 A;  2H94 A;  4AF5 A;  3PO3 J;  1ON1 A;  4JBA A;  4PJM A;  1B8I B;  3WTU C;  1BR1 A;  3K8P C;  1K78 A;  2X6X A;  1LPQ A;  4F55 A;  3HUG A;  1SFK A;  1FMV A;  5JVT A;  2NRA C;  2VJ4 A;  3AL0 B;  2PEX A;  2OQG A;  4OIR F;  4ON0 A;  1JI8 A;  2XIG A;  2KMU A;  1HW5 A;  1DU0 A;  3JRG A;  1NTC A;  5J1R A;  2Y75 A;  4E7J A;  2VKE A;  1GUU A;  3VW1 A;  4BU2 A;  4C30 A;  3FRQ A;  2XB0 X;  4AC0 A;  1VQ4 I;  2UXX A;  1FSH A;  2XAU A;  1RPW A;  4DYC A;  2LC2 A;  2P6T A;  2MBF A;  3Q9V A;  2LLK A;  4KIG A;  2RAE A;  2PLY A;  1FIA A;  2M8G X;  1I39 A;  3D5R C;  4PJJ A;  4BQQ A;  5HLT A;  4IRI A;  2RAS A;  3O60 A;  2UXN A;  3DEU A;  5HDG A;  2VUM J;  1YYV A;  1WWX A;  3EQL F;  4FCY A;  3O8G A;  4R1H A;  2E71 A;  2F4M B;  3QP5 A;  2IU5 A;  1MMS A;  2DO7 A;  1ETO A;  2XDV A;  2CQ7 A;  4EM0 B;  1ZLK A;  2Q24 A;  4RGS A;  4HLX A;  5GPA A;  3I53 A;  1RZ4 A;  2L9N A;  5IY5 H;  4OU0 A;  5EEH A;  3EUA A;  1APL C;  1V5F A;  2DA5 A;  1FOK A;  1VQL I;  1SMY F;  1OPC A;  4M3B A;  3GZ6 A;  2HDC A;  4Y3O A;  3ANP A;  2DA1 A;  2EA4 A;  3BDD A;  3EYI A;  5IT9 K;  1D1C A;  2ID3 A;  1B1B A;  1YO5 C;  1W36 C;  3RYR A;  5JFR A;  3S8P A;  3QU6 A;  5JLX A;  1K4S A;  2QQ8 A;  2HXO A;  2GXG A;  4OIP F;  2UZK A;  4Y17 A;  2XPV A;  4KMF A;  4A69 C;  4OIQ F;  3I4N J;  5LHI A;  3ZQ7 A;  1SVL A;  5HNF A;  4NQW B;  1YS7 A;  1FTT A;  3QQA A;  2V1X A;  4J00 A;  2DTZ A;  2L01 A;  4ICH A;  2JRM A;  5IPA A;  3EGQ A;  1E17 A;  4XN0 A;  1SD5 A;  5C3E J;  1SFX A;  1YS6 A;  3DBR B;  2LD5 A;  1BI2 A;  4M3D A;  1SD6 A;  5J40 A;  4HX4 A;  1NK2 P;  2QQB A;  3L7W A;  2Z9O A;  3PUB A;  1U0J A;  2IXS A;  4PUS A;  3FIW A;  3PNT A;  2LKS A;  3RQ4 A;  4AIJ A;  1VFC A;  5GAH J;  2QUF A;  5F0C A;  5J4Y A;  1D5Y A;  1A35 A;  4XKB A;  5H6Q A;  2WGB A;  3H35 A;  4QTR A;  5KAF C;  3J7Y J;  2HPM A;  2IP2 A;  1Z05 A;  2V6E A;  2F07 A;  3GME A;  3PIP F;  4LK1 F;  3HOS A;  3A0B C;  3CMM A;  4XLP F;  4MQ9 F;  3WOD F;  2Q2E A;  3JAM K;  5D6F A;  3ABK H;  4B3X A;  1VND A;  4IHY A;  2LY2 A;  4IHV A;  3TW6 A;  3M8E A;  2KHM A;  1FYM A;  1FJL A;  4BS9 A;  3W2W A;  4GCL A;  1X3Z B;  3U1K A;  4IOC F;  3TQN A;  4CZC A;  3E5U A;  3I55 I;  3CF2 A;  3M8J A;  4E4H A;  4EJU A;  4XKC A;  1QGP A;  1WVR A;  1BC7 C;  4G94 A;  3VWB A;  5E8I A;  3P9C A;  2IW5 A;  3ZOB A;  1O3R A;  2OTL I;  3Q0V A;  3GZN B;  1WJD A;  2XDN A;  3K4L A;  3WGI A;  2QQA A;  4XRS A;  3H0G J;  2LOO A;  4EJO A;  2NS8 A;  2OU2 A;  1MSF C;  3GF2 A;  3F8B A;  2HQ5 A;  1W0U A;  4BL0 B;  2OCC H;  3K1P A;  1TQM A;  4A0X A;  4XLF A;  2AXL A;  5ERI A;  4ANJ A;  2OI8 A;  4ABZ A;  3RPU D;  4GRI A;  4M74 A;  2L4M A;  3E7Q A;  4XLC A;  5CJ9 A;  3Q9S A;  4DIQ A;  1FC3 A;  4MEY F;  4A3D J;  4XBF A;  1YJ9 I;  1I6X A;  2DPU A;  3D5S C;  3W6J B;  3VW0 A;  3I64 A;  2L4A A;  1JTX A;  3PFY A;  2DOD A;  3KNW A;  3VOX A;  3CDH A;  1MKM A;  1LFB A;  3OIQ A;  3FKJ A;  2ZOZ A;  1EJ9 A;  2R4G A;  3E0J B;  3K9T A;  1CF7 B;  3ZQL A;  4L18 B;  4Q47 A;  3KZI C;  2BW3 B;  3VSL A;  1Q1V A;  3KYL A;  1RES A;  3AL0 C;  4Q48 A;  4XLN F;  3ZRG A;  1DPU A;  3VOK A;  4L9J A;  2L0K A;  2MLK A;  3K2A A;  5IP7 J;  1WQ2 A;  3B02 A;  2RRE A;  2W7N A;  4CCK A;  3OYE A;  4JX6 A;  2DW4 A;  2A69 F;  3NWT A;  4O5V A;  4CCL A;  2VXZ A;  3H5R A;  1TW2 A;  5L3E A;  3CCQ I;  1IXR C;  3RD3 A;  2HOS A;  2R7Q A;  5LEJ A;  1BW6 A;  3CRJ A;  4WIB A;  2LVS A;  3OYG A;  3OY9 A;  3LFU A;  3T5X A;  3ZP5 A;  3KEQ A;  4PCQ A;  1S6L A;  3KEO A;  1IXC A;  3HEF A;  2Z33 A;  4IQJ A;  2HGC A;  2HU9 A;  3NNR A;  5E3M A;  2JA5 J;  2CJJ A;  2YR2 A;  5FGL A;  3IHU A;  1A04 A;  1H0M A;  3OS0 A;  2ZBK A;  2TDX A;  1ZYR F;  3EUP A;  1WHU A;  5KHD A;  1UFM A;  3DFG A;  4UB6 C;  2CQX A;  3GWZ A;  4G6D A;  4CO8 A;  4YFK F;  3OYL A;  1JE8 A;  1WJ5 A;  1SVO A;  2IGN A;  2OF7 A;  2CW8 A;  4IRH A;  4A3M J;  4BNC A;  3ROU A;  4DYQ A;  3ZMD A;  2CV0 A;  4DZP A;  4HRI A;  3DPJ A;  2WTE A;  4NNJ A;  3F9K A;  2OJE D;  4WXC A;  3B73 A;  3E3V A;  4AVP A;  3RKY A;  4QIW N;  2XAQ A;  2R5Z B;  1OFC X;  5D6E A;  2W82 A;  5C4J J;  3C18 A;  4HDU A;  5GAD J;  3VFZ A;  2R7T A;  2FNP A;  3ZMS A;  1Z6T A;  3T8T A;  2DOF A;  4RM3 A;  5A2Q K;  3IKT A;  4OD5 A;  3TP0 A;  1VI0 A;  2JMW A;  4CCJ A;  5C4X J;  2CYY A;  1WJA A;  5DAJ A;  2BXY A;  3S1N J;  2XF7 A;  1WI9 A;  1TWA J;  4MNU A;  1J7K A;  2CFO A;  5TIS C;  3K1M A;  1FEX A;  3C3W A;  4RAG A;  2E36 A;  4CYD A;  2E7W A;  1X1C A;  3KP5 A;  3ZMV A;  3MAJ A;  1BI3 A;  3UR3 C;  1MZB A;  1S5L C;  1X3U A;  2DA7 A;  1TTY A;  1ETW A;  2K4J A;  3ONQ A;  1OCC H;  1XCV A;  5DTD A;  4ENM A;  1ZR2 A;  3BQZ A;  2DFH A;  3GVA A;  3RYP A;  3PUF A;  5D4S A;  2HQN A;  2XAH A;  3KYC B;  5J6X A;  1VTN C;  1U2W A;  4OIO F;  2NP3 A;  2LRD A;  2STW A;  4P5O A;  4YII A;  2P5K A;  2F4I A;  5CXG A;  1OJL A;  3TL4 X;  1AKH A;  2ZJR F;  2VXD A;  3LA7 A;  3IAS 2;  2ESN A;  2GUH A;  3G56 A;  5CVJ A;  1C0W A;  4DZJ A;  1V3F A;  2MD0 A;  2ME0 A;  3VVZ A;  5JVG F;  3H9J A;  3MNL A;  3GFL A;  3T0Y A;  4N9I A;  3LST A;  2ZSI B;  3K6G A;  4EJW A;  2M87 A;  2O3F A;  3FM3 A;  3K4M A;  4KJZ A;  4XON A;  1V54 H;  1PP7 U;  3O2P E;  2EIK H;  3G7R A;  4HW0 A;  2HYG D;  5CKT A;  1ZN2 A;  2BXZ A;  2Z99 A;  2LY1 A;  3HIM A;  2HYF A;  4YFX F;  4PSW A;  5ILV A;  3OYF A;  4XLE A;  2KIF A;  2P7C B;  1R4M B;  3IL2 A;  2R93 J;  1U8B A;  2DLL A;  3TP3 A;  1J2X A;  1LKX A;  3I59 A;  2E1M B;  2V79 A;  3CES A;  4J01 A;  2UXI A;  1QHG A;  2PMH A;  3HBL A;  3WU0 A;  2HS5 A;  5HS7 A;  3R6S A;  1K6O A;  4IHS A;  2P5V A;  3IV5 A;  1P2F A;  2EFW A;  4Y4R A;  3OWT A;  2WAQ N;  2DFI A;  2MD5 A;  3V8L A;  2W84 A;  2A6E F;  2JZY A;  3CCV I;  1HF0 A;  1FX7 A;  3PIO F;  1VF9 A;  1ZRF A;  2R7W A;  3VTI A;  4HNV A;  1I3Q J;  4WCG A;  2GLO A;  5DDG A;  1REP C;  5FHP A;  2ECC A;  4UDS A;  2CG4 A;  3KZY A;  1DUX C;  4KYW A;  4PGH A;  2RHA A;  1IRG A;  3SFI A;  1AOY A;  2G9W A;  2L7F P;  1R5H A;  1R6R A;  1Z3X A;  4EJV A;  2DA3 A;  2P8T A;  2ETH A;  2F5E A;  2CFX A;  2ZSH B;  3CUO A;  1IW7 F;  1Z67 A;  1LUJ B;  1ZR4 A;  1IGN A;  2ZXW H;  3EET A;  2QOP A;  3HKZ A;  2PQ8 A;  3ZQQ A;  3WU2 C;  4HV6 A;  2GA1 A;  3FMR A;  3WU1 B;  3NWS A;  2KIQ A;  2FBI A;  1T95 A;  3VDX A;  2XV4 S;  5HS9 A;  4D9J A;  4IO9 F;  1IN6 A;  1T0F C;  4Y33 A;  1WJE A;  5K5Q A;  4R8H A;  3DTE A;  4DQ2 A;  4D7N A;  4L5I A;  4OOI A;  3E1S A;  2DJI A;  1MMA A;  1I50 J;  4JKZ A;  2EZI A;  5BPD A;  2EWN A;  3C2B A;  4ZC3 A;  4ZYD A;  2E1O A;  4HAM A;  4BQN A;  1J5Y A;  2BVL A;  3BOQ A;  1B8I A;  2HDD A;  2DG7 A;  1TZL A;  1Z91 A;  2H6C A;  1H88 C;  2VPR A;  3FDY A;  4LIU A;  4BY1 J;  3A03 A;  3PAS A;  2ICW G;  4YEJ A;  4L9T A;  3BTJ A;  1YFH A;  4NB5 A;  3RIR A;  1YIT I;  2OER A;  3ML6 A;  5DS9 A;  3AAF A;  3BR6 A;  3BQY A;  2REK A;  2DQR A;  2IBD A;  3GCM A;  1VQ9 I;  4ZZL A;  2HTS A;  2Z3Y A;  1JKP C;  3R60 A;  5L3G A;  1MJB A;  2ACJ A;  2IEK A;  2ISZ A;  4BH9 A;  1STZ A;  5DM6 F;  4B09 A;  2NX4 A;  4HF1 A;  1T08 B;  1MBH A;  4I0A A;  4YIF A;  3CJN A;  5B5E C;  1IN8 A;  3B81 A;  3RTR A;  3HGG A;  3QOE A;  2YX4 A;  3DTI A;  1FZP B;  3CJT B;  2LF8 A;  1MGT A;  2EBI A;  2K5C A;  5B3S H;  1MBK A;  3F8F A;  4D5C A;  4II2 A;  3HE0 A;  2DMN A;  2PJP A;  3HSE A;  1KU2 A;  3L00 A;  1JGS A;  4B8X A;  3T6N A;  3M8F A;  3ZR8 X;  1L3L A;  1R5I D;  3KPH A;  2WAD A;  4HQM A;  1ZAO A;  1PUF B;  4MTD A;  5CW8 A;  4BHB A;  3LMM A;  4AD9 A;  1QO0 D;  4A0Z A;  3GEZ A;  3S1M J;  2V6C A;  2CUZ A;  2W25 A;  3VP5 A;  4RA2 A;  4HYE A;  3HSF A;  5EF6 A;  4MFD A;  2UV1 A;  4N9H A;  5D8L B;  1Y0U A;  4F92 B;  1DGW Y;  2Y69 H;  4O6J A;  3H5N A;  4OMY A;  2R7O A;  1YIO A;  5BNG A;  2I5U A;  3GZI A;  3MFK A;  3GZ5 A;  2EZH A;  4HV5 A;  5D5U B;  3HTH A;  3QPS A;  3OYJ A;  3PL8 A;  4KNY A;  3K69 A;  1OKR A;  4N4O B;  2ZNY A;  1FLI A;  2P7V B;  5LRS A;  3ERM A;  2PBI A;  3LSR A;  4NQW A;  3GTO J;  3GTL J;  2ZJ2 A;  4ZH4 F;  5DCM A;  1UMQ A;  1YJN I;  2AHQ A;  5TGT A;  2E1M C;  3KX2 A;  4HG2 A;  2RVC A;  2FJ1 A;  2DOA A;  3V7C A;  1SVM A;  5TRD A;  4GYI A;  4A3F J;  1S9H A;  4PSX A;  4XK4 A;  4H4K C;  2IVM A;  2HKU A;  1ETV A;  3H9Q A;  1GLN A;  2VQH A;  1V5E A;  3JAM Z;  2KRH A;  5IYB J;  1IF1 A;  2G7H A;  1EKE A;  4UUS B;  2NOJ B;  1R5G A;  4PJL A;  4IF4 A;  3I4M J;  3I58 A;  4J19 A;  1XSD A;  1Z3Y A;  3PNV A;  1R7J A;  3COA C;  2DK5 A;  4MGR A;  5M3M J;  4A3L J;  3F8M A;  4MLO A;  1EH8 A;  3H0D A;  3FXO A;  3BCA A;  2NVT J;  3HOY J;  4C9Y A;  2H1L A;  2VPL A;  5ICG A;  2KRC A;  2BHZ A;  4HF2 A;  3KZ9 A;  3RI4 A;  3K10 A;  4GDF A;  2V1U A;  1WRJ A;  5EJC A;  2G3B A;  5K7H A;  1K4T A;  1LFP A;  3R4K A;  5CQG A;  3CCM I;  1FMW A;  2XAF A;  2OQR A;  4XKW A;  3JCU C;  4BJT A;  1LFU P;  3E6B A;  1OCR H;  4UVA A;  1YJW I;  2K3P A;  5FKO A;  3HB9 A;  3EDP A;  1YIJ I;  2DI3 A;  2H6B A;  1U8R A;  1U9O A;  3DCF A;  2EA2 A;  3CC2 I;  3VB2 A;  3M1E A;  3BG7 A;  3SYT A;  3PSF A;  3VSK A;  3TDU C;  1HXD A;  4RGU A;  2DBB A;  2WY8 Q;  4GGG A;  2IRF G;  3OYM A;  1YTY A;  2OD5 A;  3P7N A;  1A6I A;  5E3N A;  1Y56 A;  3ERE D;  1AWC A;  4X6A J;  2CRG A;  1JJ8 C;  2JJ7 A;  4XN3 A;  4ZDP A;  3EYY A;  2AS5 F;  5CQE A;  2V4J C;  4JQF A;  4O3M A;  2Y48 A;  2E19 A;  2X9D A;  4C2M J;  3COL A;  2XVC A;  2LSO A;  1XGS A;  1QVT A;  4JYK A;  1U9N A;  1MIJ A;  3RJP A;  2BW3 A;  3KEY A;  4B44 A;  1HOM A;  2IGK A;  3H3V K;  2EK5 A;  1BI1 A;  2DU9 A;  3H5A A;  1KU9 A;  3MZH A;  1R49 A;  1F4K A;  3SEZ A;  1XSX A;  2L9V A;  1UHS A;  2Z1D A;  1FYL A;  1FT9 A;  4A5M A;  1HKS A;  1S72 I;  3LSH A;  5BPI A;  3TO6 A;  2L7K A;  1YI2 I;  3TW7 A;  2FMY A;  4LFU A;  1AU7 A;  3OMY A;  3GXO A;  2JSP A;  4C3J J;  3ZQI A;  2DK8 A;  5H6R A;  4A3K J;  1FSE A;  2M34 A;  5D5W B;  2Y0S A;  2K3F A;  1MDM B;  5LGT A;  1B9N A;  5GTH C;  1G2H A;  1TW3 A;  3BPV A;  1IN4 A;  4M73 A;  3JRH A;  4G7Z F;  3CCR I;  2BZT A;  1T0F A;  2XKP A;  1JKR C;  2LY9 A;  1ON2 A;  3RH2 A;  5F27 A;  2KRF A;  1ITY A;  3GFI A;  4RLQ A;  2KP6 A;  1QZZ A;  4NC8 A;  2Q0O A;  2QQ9 A;  1YX3 A;  1TT0 A;  2ZME C;  2HDW A;  2F5F A;  4PDK A;  1KA8 A;  3JTG A;  2JQ7 A;  4I76 A;  2ZFW A;  3QKX A;  3ZGK A;  1J9I A;  2PMZ N;  1ETX A;  3HZJ A;  3E7L A;  3NEU A;  2FOW A;  2HR3 A;  5LHG A;  3LJL A;  1W0T A;  3TDZ C;  5GAG J;  5FKK A;  2NOG A;  4IEJ A;  2QEX I;  3U2R A;  1YX5 A;  2PX9 A;  3E6M A;  4EV0 A;  1G6N A;  2D2W A;  2R5Z A;  2XF6 A;  1Z9C A;  3DP7 A;  4ZTF A;  4GCV A;  3HTS B;  2HQR A;  3FZV A;  2ECB A;  2RGV A;  4XRS G;  2GBY A;  3QP6 A;  1VQ8 I;  3JSJ A;  3MN2 A;  1U3E M;  2F2E A;  3J80 K;  3BZ6 A;  2R0Q C;  4EM2 A;  3TBI A;  2R5Y B;  1O3Q A;  3S5R A;  1QRY A;  4RDU A;  3LFK A;  3FMQ A;  3JTH A;  4K2E A;  3IWZ A;  4HQE A;  1U78 A;  5J1Y A;  4KA4 A;  1GT0 C;  4B1R A;  4AYB A;  3FHZ A;  3FWE A;  3KKD A;  4PJ0 C;  2YPR A;  4RM2 A;  3JRA A;  2KIU A;  3FBI B;  1A6Q A;  2DA2 A;  4X0G A;  1BOB A;  2B9S A;  1MBG A;  3IAM 2;  1JJ6 C;  5M5X J;  3SDB A;  4HDV A;  1MMD A;  5J1U A;  2OUM A;  4A12 A;  3LWF A;  1IUF A;  3SQN A;  5GAE J;  2BV6 A;  5B1B H;  2QM3 A;  4RGR A;  1IV8 A;  5CVR A;  1E3H A;  1XGO A;  5HAW A;  5IOZ A;  1Z1D A;  3K70 D;  1XGN A;  4AC6 A;  2IPQ X;  5FO5 A;  3ZCO A;  3AQS A;  5E20 A;  4A0Y A;  1T2K A;  2JPC A;  1KU7 A;  1XS9 A;  1XG1 A;  2STT A;  2NP5 A;  4C3I J;  1G3Y A;  3EPZ A;  2F6C A;  4BYY A;  1XDS A;  3V42 A;  1TBX A;  2HXI A;  5CPR B;  1Y1V J;  5LGN A;  2ZCM A;  3UKG A;  1RET A;  1HKT A;  3DLA A;  1SC7 A;  4BJ5 C;  5DCM B;  1PDN C;  3C2H A;  1J59 A;  2BY1 A;  3KP2 A;  1FNN A;  2WAF A;  3CLO A;  3O6B B;  1AA7 A;  1Z7L A;  4MTE A;  2P0W A;  1USS A;  3QRF F;  4G7O F;  1LJ9 A;  4G8X A;  1ZK8 A;  1EH7 A;  4I98 B;  1IO2 A;  3A1Y A;  4LLL A;  3KP6 A;  3VYR B;  2PMU A;  2VBZ A;  1WJC A;  3TOB A;  3MCZ A;  2WY7 Q;  3I56 I;  3JRF A;  1TQI A;  1VQO I;  2CV2 A;  1K83 J;  4PK4 A;  4AWX B;  3HTA A;  4V19 K;  1QPI A;  2PJR A;  3MZ8 A;  2HZT A;  2YVE A;  3ON2 A;  2E2I J;  1VQN I;  1W5C C;  4MXM A;  1O3S A;  5HDN A;  3HOT A;  2A68 F;  4Y15 A;  1DGR M;  2JVG A;  4BKX A;  4PZJ A;  3RPQ A;  2XB5 A;  2JRT A;  3CD6 I;  3WHC A;  2QKL B;  3CP8 A;  2CQN A;  1F36 A;  4A3J J;  3BJ6 A;  2COB A;  1SD4 A;  3K0L A;  5GTI C;  3ZMZ A;  2DFE A;  5JHU A;  1RIO H;  3DPT A;  4AIH A;  3M07 A;  4IHW A;  3NAR A;  4GFL A;  2KFD A;  3M7G A;  4L9N A;  1X1D A;  4M6V A;  1GV2 A;  2KLO A;  1VQ5 I;  4KUM A;  4QPQ A;  2EB7 A;  2F48 A;  1B72 B;  2EV0 A;  4ZYH A;  2YS9 A;  3FMS A;  5F1J A;  2QEN A;  4BDZ A;  5JR3 A;  4N4N B;  1HLV A;  2FBH A;  4ZDL A;  1SAX A;  3CF5 F;  2V1N A;  1LDD A;  2XPW A;  5FRO A;  4ESJ A;  2IGO A;  2NNN A;  3JRE A;  4BEH B;  3LHQ A;  2UXU A;  4P9F A;  5ICF A;  1OR7 C;  2GA2 A;  1VQK I;  1TLH B;  2R7U A;  4A3I J;  5KNL A;  1Y1W J;  2CMP A;  4KN7 X;  2DMP A;  5D8K B;  5EG0 B;  1GXQ A;  1F5T A;  3BR2 A;  2RDP A;  4XID A;  2LTP A;  1WFX A;  2B0L A;  4CUG A;  1JKO C;  1BBY A;  1W1W E;  3LNQ A;  5M5Y J;  2EFN A;  2PG4 A;  2O5R A;  3OL4 A;  4I99 C;  3VOD A;  2A6T A;  2RNG A;  4DW6 A;  1BOA A;  2K27 A;  3SEQ A;  3BR3 A;  4GYG A;  3ULQ B;  2EV5 A;  2BHY A;  3ASN H;  3FIS A;  1I1S A;  1W5S A;  5AIQ A;  3F8C A;  4IZZ A;  4HLY A;  3ZQF A;  4MO7 A;  1VQ6 I;  3EUH C;  3M1C A;  2DN0 A;  3DPL C;  1XD7 A;  3HL2 A;  3ZN0 A;  1JTY A;  2CWE A;  1IV6 A;  4IPA A;  1N25 A;  2R3S A;  2HYJ A;  1PJR A;  3C1D A;  3TOA A;  2IA0 A;  2UXP A;  3OYA A;  5D18 A;  2DDA A;  5M5W J;  3BCG A;  1WJB A;  2X6W A;  1RRJ A;  1CGP A;  4UY8 I;  2VLA A;  1RR7 A;  3HOW J;  1ZAR A;  3T1B A;  2O03 A;  1MH3 A;  1BM9 A;  4V2F A;  1KYW A;  1P7J A;  1EA3 A;  5FLX Z;  3MKL A;  1SFU A;  3S2D J;  3H1C A;  1PP8 F;  4CGZ A;  2VIX A;  2ZME A;  2OZU A;  2IGM A;  1MW7 A;  1BR4 A;  1K61 A;  1R1U A;  2MH2 A;  5CVU A;  1PUF A;  5D5X B;  3A2K A;  3WTX C;  3MKY B;  3BWG A;  3HTJ A;  2Q1Z B;  3CLQ A;  4KIB A;  1MMG A;  2M3A A;  3BPX A;  2IS1 A;  2F4O B;  4I0B A;  4I7H A;  2QBY B;  3W2V A;  4UUV A;  3GW2 A;  4L9V A;  2KT0 A;  3LAJ A;  5F64 A;  5AQC A;  2LG4 A;  1X3W B;  3TO9 A;  3KP4 A;  2VJJ A;  4U9N A;  1UHM A;  3LSM A;  3BTI A;  1NH3 A;  5F0F A;  2HFH A;  4L5J A;  4XOR A;  2CQK A;  5FLM J;  2CUE A;  4UV9 A;  3E6D A;  3IH4 A;  4CSW A;  3JW4 A;  2FBQ A;  3KLO A;  5JHF A;  2GM4 A;  3OYH A;  4DBQ A;  1Z0X A;  4IX7 A;  2FUG 2;  3EUK L;  4RB1 A;  1E3O C;  1OQY A;  1YRN B;  1HDP A;  2MSY A;  3MKZ A;  4LK0 F;  2B63 J;  2BVM A;  1ZRC A;  3K70 C;  1A5J A;  4E7S A;  4UVB A;  3GFM A;  1WJF A;  2DMU A;  1XGM A;  2VAS A;  2LK2 A;  3S32 A;  3S16 J;  3O8H A;  4A6D A;  3S14 J;  2FBK A;  4BGD A;  2DYR H;  2AXT C;  2LP0 A;  2LF7 A;  4ZZD A;  4CCN A;  3L2V A;  3I9V 2;  2O6G E;  4N0B A;  2Y0M A;  1TP4 A;  4F3Q A;  4UUS A;  2ISY A;  3H36 A;  4LG0 B;  1ENH A;  3H9G A;  3E6C C;  5H9T A;  4EAT A;  2JK3 A;  5K7F A;  1SD7 A;  4W97 A;  3WTV C;  2WB1 A;  2QSG X;  2FE3 A;  2VE8 A;  1A31 A;  3ABM H;  2F5D A;  2D6Y A;  4PXI A;  3F22 A;  2CS3 A;  4F52 A;  3IH3 A;  4XRF A;  3G1O A;  1T98 A;  1X4O A;  1HW1 A;  3D0S A;  4M9Z A;  4LOC A;  2E34 A;  6PAX A;  5EDN A;  1MNE A;  1D1B A;  5BOX A;  2HKO A;  1B9M A;  1F9N A;  2VC1 A;  2PBX A;  4OMZ A;  2HEO A;  4JOM A;  3FM5 A;  1BI0 A;  3DWL E;  3CC7 I;  1DP3 A;  3N97 A;  1LEA A;  4NN1 A;  3HHH A;  4U87 A;  4A3G J;  1YW8 A;  1JT6 A;  2RQP A;  4RAF A;  3OYB A;  2JA2 A;  2OV7 A;  4C2U A;  3CMY A;  3P9K A;  4UUT A;  3RKQ A;  2K9M A;  2P81 A;  4FAS D;  1EH6 A;  4DBR A;  2PJR B;  2D45 A;  2CW7 A;  4HZF A;  3CWR A;  2YSR A;  2TRT A;  4B48 A;  4LB6 B;  3KFW X;  3FK6 A;  2R7S A;  5DUK A;  3JR9 A;  3PQK A;  1ZTR A;  2R92 J;  3WTS C;  4XIC A;  4IJA A;  4UVC A;  1JKQ C;  2K86 A;  3WG9 A;  3ON4 A;  1N78 A;  1ZG1 A;  2WUI A;  1PVE A;  2HQA A;  5EGO B;  3GTK J;  1QHH D;  3WE3 A;  1N77 A;  4HA8 A;  4XMY A;  4E70 A;  3I4P A;  2ZNZ A;  2FEZ A;  3QBM A;  2BE5 F;  1MBJ A;  3S93 A;  3JSP A;  1DDN A;  1EV7 A;  4QWQ A;  2K9Q A;  3GTG J;  4KIF A;  2OA4 A;  2JA6 J;  2WV1 A;  2HWV A;  2HOT A;  3BJA A;  5CLS A;  2O7O A;  3WTY C;  4ME9 A;  5DD4 A;  2F5V A;  3MD2 A;  3QYB A;  1O7F A;  4ZTJ A;  4YFN F;  1MDM A;  4AU7 A;  3A0H C;  2BEO A;  1BL0 A;  2M5W A;  4I02 A;  4BDY A;  4DNC A;  1BA5 A;  4RMN A;  3HPG A;  3BNI A;  5DCF A;  1G3T A;  4CYC B;  4E7I A;  3E5X A;  5ICC A;  1S7E A;  2W53 A;  1IDY A;  2N8G A;  1ZG5 A;  1OR7 A;  1IN5 A;  1W4M A;  3GLL A;  3WG7 H;  2E5N A;  3SWH A;  2DFF A;  3RCO A;  3JRI A;  5B1A H;  2CU7 A;  1XN7 A;  5EYR A;  2XGD A;  3SZG A;  2M30 A;  3GUD A;  2F5C A;  2E2J J;  4RB2 C;  1UJ8 A;  1BC8 C;  2FU4 A;  4R79 A;  4LB5 A;  2P5L C;  1ERD A;  1KGS A;  2MGQ A;  2RKH A;  4C3H J;  3BRO A;  5J47 A;  3ABU A;  1HQC A;  1G3W A;  1H9G A;  2JUC A;  5J3L A;  2O7T A;  1Y8Q B;  2X51 A;  2CGP A;  4HF0 A;  2EFP A;  3EUH A;  3R0J A;  2VKD A;  4BJ6 C;  3SFZ A;  1S3J A;  4IHX A;  4F91 B;  3AG4 H;  1HC8 A;  3W6K B;  2R5Y A;  4M71 A;  2R7Z J;  4XSZ F;  1IJW C;  4BBS J;  4ESB A;  4OAZ A;  1R1V A;  2A61 A;  1UI5 A;  3JRC A;  3RKX A;  2JA7 J;  2ZXH A;  4U0W A;  1VQ7 I;  2P6S A;  5IYC J;  3SXY A;  4M9S A;  2HOE A;  1RR8 C;  4FX4 A;  1RKT A;  5AON A;  2FQ3 A;  3RKW A;  2ZME B;  4BHC A;  3AG2 H;  3CJR B;  4G6T B;  3I54 A;  4P1W A;  3IUV A;  2DQL A;  2M9H A;  1Q1H A;  5IT9 Z;  3QPL A;  2ID6 A;  2CUJ A;  4BE0 A;  4GFK A;  3VIB A;  4HOB A;  4MIM A;  2B1E A;  3W2A A;  3K4N A;  2KL4 A;  5F08 A;  1G4D A;  1TWC J;  5L3B A;  3GTQ J;  3QYE A;  2X1E A;  2QCO A;  1I6H J;  5IP6 A;  3NRG A;  4I09 A;  3TO7 A;  1OYY A;  2QVO A;  1LE8 B;  2XSD C;  4Z6Y A;  4GFB A;  2CO5 A;  3L1P A;  1WGX A;  2HNH A;  1TC3 C;  2L54 A;  4UB8 C;  1DPR A;  3HSR A;  3D5L A;  4XLH A;  3FF5 A;  3P9I A;  1GDT A;  2M7B A;  3RDI A;  4YRV A;  1UEL B;  2EZK A;  2OZ6 A;  3UNG C;  5K5R A;  3CCL I;  1O7L A;  1R58 A;  1UB9 A;  3HKZ N;  3IUO A;  1GVJ A;  1MMN A;  3K4K A;  1JT0 A;  3KCC A;  3BT9 A;  4BE1 A;  2QWW A;  3DQV C;  3ECH A;  1IXS B;  3FKI J;  5ILS A;  4MFE A;  3G4S I;  2MC3 A;  3DLL F;  4KIC A;  3CUQ B;  2IA2 A;  2JPB A;  2G0E A;  5FMP A;  3BR1 A;  1NK3 P;  2VB6 A;  3ZXS A;  3FXM A;  2I8D A;  2A07 F;  1V55 H;  2R7V A;  4BE2 A;  2RN7 A;  4IRV A;  4KIT B;  1UAA A;  5DYM A;  4BAC A;  5ED4 A;  3U1D A;  1KQ0 A;  1IRX A;  1MJ9 A;  4P96 A;  3WGH A;  2DCE A;  4AIK A;  1UG0 A;  3J7A O;  4WXD A;  2V7F A;  3LSJ A;  5KAI C;  1Y6I A;  3R61 A;  4ZYA A;  4LD5 A;  2CSO A;  5H2F C;  2M8E A;  3BTC A;  2XUB A;  5FKL A;  4Q4Z F;  4RBO A;  2IT0 A;  1D8J A;  2H27 A;  2R7D A;  1QVU A;  4PJN A;  5LLQ A;  4WK8 F;  4RB3 C;  4V2G A;  2ELK A;  2X48 A;  4OIN F;  3WTW C;  4LLN A;  5KCM A;  4U88 A;  2LBF B;  2XAG A;  4S04 A;  3QOD A;  1Y0N A;  3OIP A;  4DYR A;  4HKU A;  4E6K G;  2W48 A;  3GTJ J;  1O57 A;  3V8J A;  1WPK A;  2GWR A;  4NC7 A;  3ZQG A;  4ZDO A;  2EFO A;  1XDU A;  2VJI A;  1HCR A;  2IAI A;  4JX5 A;  1DP7 P;  2FJI 1;  1JHH A;  2ELH A;  2KIM A;  3BZC A;  4YEL A;  1B72 A;  3NI7 A;  4ASN A;  1T39 A;  1F1Z A;  1YLF A;  4RLF A;  2XF5 A;  2V1D A;  2KJB A;  4KFC A;  3N05 A;  3Q0U A;  3F6O A;  2HVQ A;  4CZZ A;  3PQJ A;  3MZY A;  2DA4 A;  2GOX B;  3CMA I;  5F6F A;  1EF4 A;  1XPX A;  2EIL H;  2V9K A;  4I01 A;  2L2O A;  3OOP A;  2HZD A;  3GBG A;  4BEH A;  3ZMT A;  4UHT A;  1X19 A;  5E3O A;  1XMA A;  1QQI A;  4A3E J;  4XQF A;  5EG0 A;  3L2R A;  1B6A A;  3CZ6 A;  4BXX J;  3GLX A;  1K7A A;  1LNW A;  1XCB A;  5TJJ A;  3OYC A;  5HLG A;  4EVI A;  4DVY P;  2X6O A;  2LRE A;  2O8X A;  1KU3 A;  1BJA A;  4MK6 A;  1P4X A;  1W7P D;  3C7J A;  1CQT A;  3OS2 A;  3CO6 C;  1OCO H;  4IVN A;  3IRQ A;  5L3D A;  3V8K A;  3B6C A;  4OAY A;  2W24 A;  2EZL A;  1X4P A;  3CCS I;  4YG2 F;  4FIS A;  2ZOY A;  1KQ9 A;  1OCP A;  3FXK A;  3ZMU A;  4A6E A;  2YU3 A;  3VVX A;  1JGG A;  3V7R A;  3IP4 B;  2NNY A;  2DA6 A;  2EJR A;  2WV0 A;  1MBF A;  1TWG J;  2BBY A;  2LFB A;  1MD0 A;  2EIM H;  1I3A A;  2EPF A;  3F0C A;  4HPQ A;  5FFZ A;  2P4W A;  1B59 A;  4AUX A;  4A93 J;  4CCO A;  1D5V A;  1SFE A;  1NG7 A;  4QSH A;  4M6X A;  4XRM A;  4XNF A;  3GX4 X;  3M3Y J;  2AQF A;  1HST A;  1ZGA A;  2XAJ A;  4KWA A;  5DUI A;  2Z2S B;  2ZO4 A;  3C2G A;  2MLG A;  1W7P B;  2KDO A;  1V5G A;  2BGC A;  3LA2 A;  4D1Q A;  1HSJ A;  1FP2 A;  3G71 I;  5M3F J;  3TED A;  2I10 A;  3W3C A;  4CDG A;  4NUB A;  2EIN H;  1LDK B;  2MC4 A;  1FWZ A;  2CQQ A;  1NHA A;  3O3K A;  4HX8 A;  5LD2 C;  4B4C A;  3LOC A;  4XLA A;  3S3M A;  2KZV A;  2OBP A;  2QBY A;  5BMZ A;  4RGX A;  5A2Q Z;  2V9P A;  4D5F A;  1NG6 A;  3F1B A;  3P5J A;  5DV5 A;  3VYS B;  4BXU A;  2LKX A;  3AG3 H;  4OD4 A;  2ZCX A;  1ZGJ A;  1SMT A;  2G7U A;  1BIB A;  3CCY A;  3SDG A;  5LGU A;  2MA3 A;  2MW8 A;  1RNL A;  1JUM A;  2WC2 A;  3DEE A;  3WHB A;  4CCM A;  5IOY A;  1UG2 A;  2COM A;  3J81 K;  1XTA A;  2JTV A;  4YIR X;  3WTT C;  4Q5S F;  1E2X A;  2NS0 A;  2NVY J;  3I0T A;  3VPR A;  1R22 A;  4BQA A;  1FOY A;  3AQT A;  1ZQ3 P;  4W1U A;  1TNT A;  3CUQ C;  1YRN A;  4NHJ A;  4ACI A;  2FSW A;  2ESH A;  1U5T C;  4HBL A;  1QU3 A;  2YU9 J;  5FB2 A;  3F21 A;  2BYV E;  2NYX A;  3S3N A;  1X2N A;  5E18 F;  3V4G A;  2VBY A;  4XKV A;  4M72 A;  4C2M A;  2X0L A;  3K4B A;  3G6E I;  1OIS A;  4ENJ A;  1FBQ A;  3HJE A;  2B7E A;  4XL9 A;  2ME6 A;  4I6Z A;  2DYS H;  4D0P A;  5E1X A;  1QZE A;  1ZGW A;  5HDK A;  1XMX A;  3OYI A;  4LG0 A;  1D3Y A;  1VQM I;  1Y8R B;  1HDD C;  2G7S A;  3FHN A;  1E3P A;  1WH5 A;  1X58 A;  3JRD A;  5LHH A;  2MH9 A;  1FP1 D;  4XM3 A;  3GEU A;  1X2M A;  3PM1 A;  3X2Q H;  4BUP A;  4BHP A;  2W57 A;  1VQP I;  2Y9Y A;  3IWF A;  2BY0 A;  2VKH A;  4ENN A;  3DU6 A;  5IYD J;  1RUO A;  1QBJ A;  1RKW A;  5GP9 A;  3ANG A;  1YG2 A;  3BTL A;  3MMY B;  3CJQ B;  1MJA A;  2BY3 A;  3FK7 A;  3ASO H;  2X1D A;  4HNT A;  4GCK A;  4BQO A;  3S1Q J;  3WGG A;  3L09 A;  1XC5 A;  2Y0S N;  3OL3 A;  4HX7 A;  1O4X A;  2ZY9 A;  2Y9Z A;  4JX4 A;  4ZYG A;  5F0H A;  3CME I;  3HOU J;  2WWY A;  2K85 A;  3BHQ A;  1JUS A;  1FOX A;  1PYV A;  5C4Y A;  5HVQ C;  4QPO A;  4IKF A;  2RV8 A;  1T8I A;  5D19 A;  3V6G A;  2J5P A;  3HC7 A;  4FT8 A;  2A05 A;  1J75 A;  3GO5 A;  3PPB A;  4EMS A;  3BR5 A;  2FD5 A;  2FML A;  2K9N A;  3I5U A;  1TL8 A;  2KJC A;  2K4B A;  2DTR A;  5CYV A;  5BQT A;  3S17 J;  2VI6 A;  4AM3 A;  3HRU A;  3NRV A;  3L2U A;  2DT7 B;  2WA0 A;  4GCT A;  4EM1 A;  2XAS A;  3OYK A;  3GTM J;  3S15 J;  2A5Y B;  5BS6 A;  4NBQ A;  1SAN A;  1TWF J;  3Q0W A;  4F7Z A;  2BY2 A;  5EGO A;  2NAZ A;  4M3F A;  3J7Z I;  1U6G A;  3MVP A; 
#chains in the Genus database with same CATH homology
 2LR8 A;  5H9T A;  2EBI A;  1WCM J;  2JK3 A;  2Y2Z A;  3HE0 A;  1MBK A;  4D5C A;  5K7F A;  4W97 A;  1WH7 A;  2DMN A;  2XRL A;  2D6Y A;  4PXI A;  1ETY A;  3T6N A;  1ETK A;  3IH3 A;  1PUF B;  5CW8 A;  3G1O A;  3RQI A;  3GTP J;  3S1M J;  2TCT A;  5FKN A;  3OOU A;  3VP5 A;  5EF6 A;  2HYT A;  4MFD A;  4LOC A;  1IC8 A;  1ZKG A;  2V57 A;  4AYB N;  2L9R A;  2NS7 A;  3G1L A;  4AF5 A;  4CYC A;  5BNG A;  5EDN A;  3PO3 J;  1B8I B;  2ZB9 A;  3GZI A;  2NVX J;  2PBX A;  2QKO A;  2EZH A;  3HTH A;  3QPS A;  4NDL A;  3VVY A;  3RZO J;  2XGE A;  3HOV J;  4NN1 A;  4A3G J;  3LSR A;  1JT6 A;  3BJB A;  3GTO J;  5FLV A;  3ZQH A;  3GTL J;  1DU0 A;  2ZCN A;  3JRG A;  3CMY A;  4JNN A;  1NTC A;  4UUT A;  5J1R A;  3RKQ A;  1UMQ A;  2VKE A;  2P81 A;  1GUU A;  2AHQ A;  3VW1 A;  3FRQ A;  2FJ1 A;  2XB0 X;  4AC0 A;  4FE4 A;  3CWR A;  2YVH A;  2TRT A;  4A3F J;  1RPW A;  4DYC A;  2G7L A;  3FK6 A;  4XK4 A;  3JR9 A;  1ZTR A;  2R92 J;  2LLK A;  2RAE A;  2HKU A;  4XIC A;  1ETV A;  1FIA A;  1JKQ C;  3M4O J;  2M8G X;  2GEN A;  3ON4 A;  5IYB J;  2RAS A;  3O60 A;  2WUI A;  3GTK J;  5EGO B;  4UUS B;  5E3L A;  2VUM J;  2FQ4 A;  3QBM A;  4FCY A;  1MBJ A;  3BG5 A;  3O8G A;  1DU6 A;  3NAU A;  2K9Q A;  3GTG J;  3I4M J;  2IU5 A;  2JA6 J;  4J19 A;  2WV1 A;  2HOT A;  1ETO A;  2Q24 A;  5M3M J;  2O7O A;  4A3L J;  5GPA A;  1ETQ A;  4MLO A;  4ME9 A;  1APL C;  2DA5 A;  4M3B A;  2NVT J;  3HOY J;  3ANP A;  2YUS A;  1BL0 A;  2DA1 A;  3KZ9 A;  2ID3 A;  1IRZ A;  3RZD J;  3Q3S A;  1BA5 A;  2KDZ A;  4L62 A;  2G3B A;  3BNI A;  5K7H A;  4CYC B;  2W53 A;  1MBE A;  5HSZ A;  1S7E A;  1IDY A;  2N8G A;  5JLX A;  1LFU P;  2HXO A;  2M0C A;  3JRI A;  2O9L A;  2XPV A;  4A69 C;  5FKO A;  3I4N J;  3HB9 A;  5IP9 J;  1LE8 A;  2CU7 A;  1U9O A;  3DCF A;  5EYR A;  2XGD A;  1FTT A;  3QQA A;  2VKV A;  2E2J J;  2DJN A;  2JA8 J;  2DTZ A;  3BRU A;  5GPC A;  4ICH A;  5IPA A;  3EGQ A;  1A6I A;  5E3N A;  5C3E J;  4X6A J;  2CRG A;  2MGQ A;  1JJ8 C;  2JJ7 A;  4C3H J;  2LD5 A;  2K9S A;  2JN6 A;  4M3D A;  5FJ8 J;  5J3L A;  2O7T A;  2FX0 A;  2E19 A;  1NK2 P;  2X9D A;  4C2M J;  3COL A;  5FKM A;  3CQZ J;  3FIW A;  1QVT A;  4JYK A;  1VFC A;  1U9N A;  1HOM A;  4IHX A;  5F0C A;  1D5Y A;  3H3V K;  2WGB A;  2R7Z J;  4QTR A;  2R5Y A;  4BBS J;  1IJW C;  2F07 A;  2HI3 A;  1UHS A;  1UI5 A;  3JRC A;  2JA7 J;  3C07 A;  1VND A;  5EZG A;  4IHY A;  4IHV A;  5IYC J;  3TW6 A;  3TW7 A;  1FJL A;  4G12 A;  4GCL A;  1AU7 A;  3JRB A;  1RKT A;  4C3J J;  3ZQI A;  3S1R J;  4A3K J;  2M34 A;  4M3E A;  2G7G A;  3IUV A;  2M9H A;  4JP0 A;  3BG3 A;  3QPL A;  2ID6 A;  2QF7 A;  3JRH A;  1G2H A;  4GFK A;  3ZOB A;  3Q0V A;  2XDN A;  3VIB A;  1JKR C;  2LY9 A;  3B6A A;  4MIM A;  4XRS A;  1SFO J;  3H0G J;  5F08 A;  3GTQ J;  1TWC J;  5F27 A;  3RH2 A;  3S2H J;  2NS8 A;  1MSF C;  3OIO A;  1ITY A;  4YZE A;  2HQ5 A;  1W0U A;  2QCO A;  1I6H J;  5IP6 A;  3NRG A;  1BJZ A;  1LE8 B;  2XSD C;  4GFB A;  2OI8 A;  4I76 A;  4ABZ A;  4L5E A;  3QKX A;  3L1P A;  1WGX A;  2PMZ N;  1TC3 C;  1ETX A;  3E7Q A;  3E7L A;  3LJL A;  1GDT A;  1W0T A;  2EZK A;  1IDZ A;  5FKK A;  2NOG A;  4IEJ A;  1R9T J;  4A3D J;  3HKZ N;  3VW0 A;  2EH3 A;  1JT0 A;  3BT9 A;  2R5Z A;  1JTX A;  2QIB A;  3FKI J;  3KNW A;  3VOX A;  4MFE A;  3HGY A;  2ZOZ A;  1LFB A;  2ECB A;  3SJM A;  3A01 A;  3DEW A;  4XRS G;  2GBY A;  2G0E A;  5FMP A;  2CUF A;  3BR1 A;  3ZQL A;  1NK3 P;  5D1R A;  3HOZ J;  3JSJ A;  4S0H B;  3MN2 A;  1Q1V A;  1RES A;  2R0Q C;  2L7M P;  3VOK A;  2R5Y B;  2L0K A;  1OCT C;  3K2A A;  5IP7 J;  4JX6 A;  3S5R A;  1QRY A;  3LSJ A;  4RDU A;  3NPI A;  3D1N I;  1U78 A;  5J1Y A;  1GT0 C;  3RD3 A;  3BTC A;  5FKL A;  4B1R A;  4RBO A;  4BBR J;  1BW6 A;  3CRJ A;  1QVU A;  2LVS A;  3KKD A;  3JRA A;  2DA2 A;  1POG A;  1JJ6 C;  1MBG A;  4V2G A;  3ON2 A;  1T33 A;  5M5X J;  2ELK A;  2X48 A;  3OSG A;  5J1U A;  3HEF A;  1IUF A;  3NNR A;  5E3M A;  1MH4 A;  3VW2 A;  4DYR A;  4HKU A;  2JA5 J;  2CJJ A;  1GVD A;  2W48 A;  3GTJ J;  5FGL A;  5HAW A;  1WPK A;  3ZQG A;  5IOZ A;  5F04 A;  1P7I A;  3ZQC A;  3EUP A;  4AC6 A;  1HCR A;  2IAI A;  2CQX A;  4JX5 A;  3AQS A;  1ORK A;  1XS9 A;  1XG1 A;  2NP5 A;  1Z77 A;  4C3I J;  1B72 A;  3NI7 A;  2OF7 A;  4A3M J;  3Q0U A;  4DYQ A;  2K40 A;  4DZP A;  3DPJ A;  2PZ9 A;  2HXI A;  1Y1V J;  2DA4 A;  4Y52 J;  3NXC A;  1JUP A;  1EF4 A;  2ZCM A;  3UKG A;  1RET A;  3HDD A;  3V78 A;  4QIW N;  2R5Z B;  1OFC X;  5C4J J;  3GBG A;  2WB1 N;  5E3O A;  1BW5 A;  1ZK8 A;  4A3E J;  5K7Z A;  4D7M A;  5EG0 A;  4BXX J;  3TP0 A;  1VI0 A;  2JMW A;  5C4X J;  5DAJ A;  2NVQ J;  1SGM A;  3S1N J;  3JRF A;  3CJD A;  1TWA J;  3LSG A;  1K83 J;  2X6O A;  4A3C J;  1FEX A;  4A3B J;  2DA7 A;  4MK6 A;  2H8R A;  1CQT A;  3HTA A;  1ETW A;  1QPI A;  4X1E A;  2H1K A;  3LWJ A;  2YVE A;  5DTD A;  3B6C A;  2E2I J;  1ZR2 A;  3BQZ A;  5EEA A;  5EFY A;  2EZL A;  2D5V A;  4MXM A;  4FTH A;  4FIS A;  2ZOY A;  1OCP A;  4BKX A;  3VVX A;  1JGG A;  2XB5 A;  2DA6 A;  5HOD A;  2NP3 A;  1MBF A;  1TWG J;  5EZH A;  3WHC A;  2LFB A;  3F0C A;  4A93 J;  1F36 A;  4A3J J;  5CXG A;  2COB A;  1OJL A;  4AUX A;  1AKH A;  3G56 A;  2GUH A;  4QSH A;  4IHW A;  3W6V A;  4XRM A;  4DZJ A;  3NAR A;  1AHD P;  4GFL A;  2ME0 A;  3M3Y J;  3VVZ A;  3LSP A;  5HBU A;  4M6V A;  1GV2 A;  4KWA A;  3A02 A;  3MNL A;  1B72 B;  2YS9 A;  1TWH J;  5F1J A;  3BG9 A;  2MG4 A;  3KKC A;  1HLV A;  3TED A;  5M3F J;  3G7R A;  2I10 A;  2XPW A;  3K7A J;  1IG7 A;  3JRE A;  3HIM A;  2CQQ A;  2UXU A;  3LHQ A;  4B4C A;  3LOC A;  5JLW A;  2R93 J;  2Y30 A;  3TP3 A;  1U8B A;  4A3I J;  1Y1W J;  5K58 A;  2UXI A;  3HBL A;  4D5F A;  3F1B A;  2DMP A;  5EG0 B;  2LKX A;  3BR2 A;  2ZCX A;  4XID A;  3CCY A;  2LTP A;  3IV5 A;  3SDG A;  2WAQ N;  2MW8 A;  5IOY A;  1JKO C;  1JUM A;  2M2E A;  3WHB A;  5M5Y J;  3LNQ A;  2E2H J;  1UG2 A;  1HF0 A;  1VF9 A;  2L7Z A;  4DW6 A;  4HNV A;  1I3Q J;  2XGC A;  2NVY J;  3VPR A;  3BR3 A;  3HM5 A;  3AQT A;  2GLO A;  1ZQ3 P;  3FIS A;  4W1U A;  1YRN A;  4ACI A;  1MNM C;  5FHP A;  2OPT A;  3ZQF A;  3PO2 J;  2ECC A;  4MO7 A;  4B3A A;  1H89 C;  2YU9 J;  5C44 J;  4UDS A;  2DN0 A;  2RHA A;  3SFI A;  3HOX J;  1JTY A;  2L7F P;  3CDL A;  1X2N A;  1IV6 A;  2DA3 A;  2HYJ A;  5CXI A;  1H8A C;  2UXP A;  5D18 A;  5M5W J;  1AKH B;  3BCG A;  1ZR4 A;  2ME6 A;  4I6Z A;  1IGN A;  2QWT A;  2QOP A;  2GFN A;  1RR7 A;  1ZGW A;  1UI6 A;  3HOW J;  2DMQ A;  1MH3 A;  1F43 A;  4V2F A;  1HDD C;  2G7S A;  1P7J A;  3MKL A;  1WH5 A;  1X58 A;  3S2D J;  1FTZ A;  3JRD A;  9ANT A;  2DG8 A;  3GEU A;  1WI3 A;  1X2M A;  3BR0 A;  1K61 A;  3PM1 A;  2XPU A;  2Y9Y A;  4BY7 J;  1PUF A;  2UXO A;  5IYD J;  4D7N A;  3HTJ A;  3P9T A;  3VUQ A;  1RKW A;  1I50 J;  5GP9 A;  4JKZ A;  3ANG A;  1FIP A;  3BTL A;  2EZI A;  3C2B A;  3A01 B;  3FK7 A;  1MSE C;  3S1Q J;  4GCK A;  2KT0 A;  2E1O A;  2HDD A;  2DG7 A;  5AQC A;  1B8I A;  1XC5 A;  2Y0S N;  4EEF G;  1O4X A;  2Y9Z A;  4JX4 A;  5F0H A;  1H88 C;  2VPR A;  3HOU J;  3BTI A;  3PAS A;  4BY1 J;  3A03 A;  5F0F A;  3BHQ A;  1JUS A;  4FE7 A;  5FLM J;  4M3G A;  3BTJ A;  2CUE A;  3IH4 A;  2EQR A;  5C4Y A;  2DMT A;  2FBQ A;  3HTI A;  1T56 A;  2OER A;  2O8K A;  2GM4 A;  5D19 A;  3V6G A;  5DS9 A;  1Z0X A;  3BR6 A;  1GV5 A;  1E3O C;  1YRN B;  1HDP A;  3BQY A;  2REK A;  3PPB A;  2MSY A;  2IBD A;  3IH2 A;  3BR5 A;  2B63 J;  2FD5 A;  2AO9 A;  2K9N A;  2Y31 A;  4CGR A;  2HOA A;  4JL3 A;  1JKP C;  2JWT A;  3S17 J;  1A5J A;  2VI6 A;  2DMU A;  2IEK A;  4NEL A;  2LK2 A;  3S16 J;  3O8H A;  4GCT A;  2NX4 A;  3S14 J;  2LP0 A;  3G1M A;  1MBH A;  3GTM J;  3S15 J;  2UXH A;  1SAN A;  1TWF J;  4Y7N J;  2QTQ A;  3HGG A;  3Q0W A;  3B81 A;  5EGO A;  4M3F A;  4UUS A;  2HOS A;  3OSF A;  1ENH A;  3MVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...