3HGGA

Crystal structure of cmer bound to cholic acid
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for anionic ligand recognition by multidrug binding proteins: Crystal structures of CmeR-bile acid complexes
rcsb
molecule tags Transcription
molecule keywords CmeR
total genus 76
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hggA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3hggA02
3GEUA 4BY7J 2XB0X 2XB5A 1Z77A 3A01B 2R5ZB 5GPAA 4UUSA 1ETYA 4FISA 2D6YA 1B72B 2M34A 2XPVA 1AKHA 2R5YA 4A93J 5CXGA 5FKNA 3HDDA 4JKZA 5FGLA 3GTJJ 3HOWJ 1HF0A 3ANPA 3JRHA 3UKGA 3S2DJ 1ORKA 2HOAA 2JA5J 3BQYA 2H1KA 1JUSA 2XGCA 3V6GA 4I76A 1R9TJ 1ZQ3P 1JKPC 2DJNA 2G0EA 5D1RA 2ME6A 3HGYA 2PMZN 1DU0A 4DYRA 5CW8A 4A3BJ 3IV5A 1RESA 5IP7J 5E3MA 5J3LA 2JK3A 4A3DJ 4ACIA 3QKXA 3B81A 4AC6A 3DCFA 2FBQA 3TP3A 5IP6A 3G7RA 3HTAA 1ZTRA 5C3EJ 4M3GA 3AQSA 2IAIA 3COLA 1TWAJ 3FK6A 4NELA 4C3HJ 3EUPA 5C44J 1IRZA 2HQ5A 1JKOC 3RZOJ 4DZJA 5K7FA 3HBLA 5FKMA 2X48A 4GCLA 3GTPJ 3G1OA 1IJWC 2G7LA 5E3NA 2YU9J 3VW0A 3FKIJ 3Q0VA 1F43A 2XDNA 2O8KA 2NS8A 5J1YA 4V2GA 1T56A 2HXOA 2X6OA 3HEFA 3BR2A 1Q1VA 3GTQJ 2NOGA 3VPRA 3PO2J 2OI8A 2G7GA 2VI6A 3HTJA 1UHSA 4JYKA 4RBOA 5EZGA 5C4JJ 1BA5A 3C07A 2L7MP 2QIBA 1MBFA 1FTZA 2KT0A 2P81A 2AHQA 4MFEA 2FX0A 4BXXJ 2UXPA 2UXIA 2K9NA 3BT9A 5DS9A 5D18A 5EYRA 2OERA 3FISA 3JRBA 5FMPA 1E3OC 3BR0A 2LK2A 2GFNA 1JKRC 3ZQGA 1MBJA 2XGEA 2DA7A 2R0QC 3VOKA 2CUFA 5EGOA 1NK2P 3BHQA 1WCMJ 5K58A 1P7IA 1POGA 1JTYA 2IBDA 3O60A 3VVZA 3BG5A 1VF9A 2VKVA 4IHWA 2VPRA 4M3DA 5JLWA 9ANTA 1AKHB 2Y30A 2OPTA 3Q0WA 1ETKA 1BW5A 4DYQA 1HDDC 2K9QA 1ETVA 1MBEA 2ZCMA 1BL0A 1XC5A 1YRNA 1XS9A 2L9RA 1BJZA 2CJJA 4AUXA 3OSGA 1Y1WJ 1QRYA 4JL3A 4QIWN 1ETXA 3PASA 4MO7A 2ID6A 1MSEC 1OCTC 4X1EA 3LNQA 1GV2A 1VNDA 1GT0C 1YRNB 2JA6J 3JREA 3ZQIA 2EH3A 1O4XA 3D1NI 3BJBA 3M4OJ 3MVPA 3NARA 3GTGJ 1H88C 2H8RA 3RQIA 3NPIA 2RAEA 1HCRA 2W48A 2Y9ZA 2NVTJ 1K83J 2LTPA 1P7JA 1H89C 3EGQA 2WB1N 5F0CA 2M8GX 1UI6A 2E2HJ 2PBXA 1VFCA 4LOCA 4D7NA 4C3JJ 1W0UA 1RKWA 5J1UA 1FIAA 4BKXA 1I50J 1X2MA 3L1PA 3GTMJ 4I6ZA 2DA6A 3B6AA 4XRMA 1T33A 4A3MJ 4G12A 1TWHJ 3S15J 4BBRJ 2F07A 3GTKJ 2EZKA 2MGQA 4UDSA 4IHXA 3F0CA 4UUSB 3E7LA 3GBGA 1MBGA 2YUSA 3GZIA 2K40A 1APLC 1QVUA 2AO9A 2L7FP 3BTLA 4IEJA 2O9LA 5IOYA 2GUHA 4GFKA 3CDLA 4S0HB 4ABZA 1SGMA 1UI5A 5C4YA 4A3JJ 1IG7A 3OSFA 5J1RA 1RR7A 3BG9A 3JRDA 2ZOZA 3S2HJ 3B6CA 4M3FA 3CRJA 3ON4A 5BNGA 3HIMA 3VW2A 3O8GA 3VIBA 4JNNA 2E1OA 1CQTA 3H0GJ 2QKOA 1LFUP 2D5VA 4AC0A 1JJ6C 3HB9A 2ZCXA 3MKLA 4ICHA 4GCTA 2QCOA 2CU7A 3BG3A 2REKA 3QQAA 4QTRA 2MSYA 3BR6A 3JRGA 1B8IB 1MNMC 3SJMA 4XIDA 5K7HA 4GCKA 1TWCJ 4DZPA 2DMQA 2HOTA 5HAWA 2FJ1A 3ZQCA 1ETOA 1LE8A 3RD3A 3JRCA 2QWTA 5C4XJ 4J19A 1PUFB 3HOVJ 1JT0A 3S16J 4Y52J 3S1NJ 1FJLA 3V78A 4FE7A 2M0CA 4MFDA 2E2JJ 1RKTA 2R93J 2L7ZA 5F08A 2UXOA 3ON2A 2NVQJ 3VP5A 3PM1A 4BBSJ 2XPWA 1ZGWA 3ZQLA 5IYCJ 4A3LJ 5JLXA 1TC3C 2DG7A 3PPBA 1MH4A 2CQXA 4Y7NJ 3WHBA 2HYTA 1MBKA 2G3BA 2ZB9A 3VOXA 2DA5A 2PZ9A 1BW6A 2YVEA 2NX4A 2COBA 1IDZA 1PUFA 1WPKA 1GUUA 3HTIA 2DMTA 2LD5A 1TWGJ 3KZ9A 1GV5A 3VVYA 2R5ZA 2JA8J 4A3CJ 2EBIA 1IGNA 1MH3A 2HXIA 2NS7A 3VVXA 1X2NA 1U9NA 3IH3A 2QOPA 2LFBA 4CGRA 2NVXJ 5M5WJ 2EQRA 5HSZA 1Y1VJ 4A3GJ 3JR9A 1FEXA 3KKDA 4A3FJ 4X6AJ 3BCGA 2LR8A 4B3AA 3IH2A 2XRLA 1W0TA 5FHPA 1G2HA 5HODA 2MW8A 5EGOB 1S7EA 2TRTA 3HOXJ 5EZHA 2Y31A 5F1JA 1AU7A 2NP5A 1OJLA 2WGBA 3NNRA 1ENHA 2DMPA 2HDDA 2I10A 5EF6A 2DA4A 4B4CA 2EZIA 3BNIA 2YVHA 3QPLA 4JP0A 1IUFA 3O8HA 1B72A 5IPAA 2HKUA 2XSDC 4GFBA 3NI7A 3GTOJ 1WGXA 2ZOYA 2YS9A 3LSGA 1VI0A 2DA1A 1ZR4A 1WH7A 3JRAA 3IUVA 4M6VA 2VUMJ 3S14J 1JGGA 2K9SA 3RH2A 2MG4A 3BR3A 1HLVA 1XG1A 5FKLA 1A6IA 2WV1A 3A03A 2O7TA 1ETWA 3S1MJ 3K7AJ 2IEKA 4C2MJ 2RHAA 3CJDA 3OOUA 3MNLA 2ZCNA 3TW6A 2KDZA 1B8IA 4JX6A 2DMNA 3TEDA 1I6HJ 2NVYJ 3G1MA 2X9DA 5EFYA 2LKXA 2VKEA 5F04A 4XK4A 4NDLA 2FD5A 3HGGA 5F0FA 4D5CA 4M3EA 2LVSA 2CRGA 3VUQA 3FK7A 5HBUA 2GENA 3BR5A 1HOMA 2O7OA 1JKQC 5D19A 2Y0SN 2EZLA 3CCYA 5H9TA 4L5EA 1HDPA 5IP9J 1JUMA 2XPUA 1FIPA 2HI3A 4L62A 2QF7A 2IU5A 3S5RA 4AF5A 1ZR2A 3HOYJ 3F1BA 3SDGA 2XGDA 2M2EA 1ZKGA 4HNVA 5EDNA 1IV6A 4GFLA 3Q0UA 1RPWA 4XICA 3PO3J 3Q3SA 4B1RA 1I3QJ 2R92J 5M5YJ 2V57A 2HOSA 1SANA 5M3FJ 5FLMJ 5F0HA 3NRGA 1X58A 2Y9YA 4V2FA 4FTHA 3BR1A 4HKUA 2RASA 3ZOBA 2DTZA 3HM5A 3ZQHA 5K7ZA 2DMUA 3ANGA 4NN1A 3BTIA 1JJ8C 1QVTA 5FJ8J 4A3KJ 4JX4A 3I4NJ 3HKZN 4EEFG 4PXIA 3BRUA 3IH4A 3RKQA 3NXCA 1WH5A 3G1LA 3FRQA 2DG8A 2UXHA 2G7SA 3H3VK 2FQ4A 2TCTA 5FKKA 4C3IJ 1SFOJ 2R5YB 3HOZJ 2UXUA 4JX5A 1MSFC 3WHCA 1GDTA 3KKCA 4DW6A 1MBHA 1OFCX 5M3MJ 1Z0XA 2L0KA 2NP3A 4W1UA 3G56A 2JN6A 3E7QA 4MIMA 1NTCA 1LFBA 4MLOA 1UG2A 2B63J 2Y2ZA 2GLOA 3W6VA 2R7ZJ 2E19A 4W97A 5M5XJ 1ETQA 3DPJA 4FCYA 2HYJA 4KWAA 1JT6A 4FE4A 3K2AA 3LHQA 3FIWA 1IDYA 1RETA 3TW7A 1D5YA 4MXMA 4MK6A 4DYCA 5EEAA 3JRIA 3HE0A 3LJLA 5DTDA 3A02A 1K61A 4UUTA 5AQCA 3DEWA 3OIOA 5CXIA 3C2BA 4A3EJ 5E3LA 2JWTA 1NK3P 2ME0A 3BTCA 2LY9A 3I4MJ 1A5JA 2JMWA 5E3OA 3CMYA 2GM4A 2JJ7A 4D5FA 2Q24A 2ECCA 1LE8B 3RZDJ 5FLVA 4RDUA 3CWRA 1OCPA 2WUIA 3JSJA 1ITYA 4XRSA 1U9OA 3MN2A 1H8AC 4AYBN 5EG0B 1U8BA 2WAQN 2QTQA 3QBMA 2N8GA 2EZHA 3LSJA 1JTXA 4A69C 1UMQA 1U78A 3SFIA 3KNWA 4ME9A 1EF4A 1IC8A 5DAJA 1WI3A 4IHVA 2LLKA 4QSHA 2GBYA 2ECBA 4XRSG 1TWFJ 2CQQA 2ELKA 1AHDP 5IOZA 1QPIA 2JA7J 3S17J 2DA2A 4D7MA 3AQTA 3ZQFA 3QPSA 1FTTA 4CYCA 5F27A 4BY1J 2DN0A 4YZEA 5GP9A 1DU6A 5GPCA 3P9TA 3GTLJ 4M3BA 3TP0A 5IYBJ 3LSPA 1JUPA 3NAUA 5IYDJ 5FKOA 4IHYA 3LWJA 1ZK8A 2CUEA 3LSRA 3A01A 3JRFA 2ID3A 2LP0A 3BQZA 3VW1A 3HTHA 3CQZJ 4A3IJ 3S1QJ 1F36A 3BTJA 4CYCB 3S1RJ 2DA3A 3LOCA 5EG0A 1GVDA 2M9HA 3HOUJ 2W53A 2E2IJ 3M3YJ 2OF7A 3T6NA
chains in the Genus database with same CATH superfamily
3ZR8X 2OQRA 3QPHA 1FBSA 4BY7J 5L3BA 2XB0X 2XB5A 2QSHX 4HF2A 2DQLA 4UUSA 1ETYA 4FISA 1Y56A 3RKXA 1B72B 2HEOA 4P55A 1X1AA 1D3YA 5CJ9A 1PVEA 4F52A 1UELB 1J2XA 1EJ9A 2FNAA 2KKOA 2P6SA 1OMIA 3IWZA 4MNUA 4BYYA 2XC7A 2NVUB 2LF7A 3VDXA 1B4AA 1UHWA 5ILSA 2BV6A 2X1DA 3HOWJ 1XB4A 1MJ9A 1ORKA 2FA5A 2HVRA 1WJFA 4EQQA 4I76A 3H0DA 3F21A 1D8JA 2E71A 3EUAA 3OYLA 1JKPC 4YIIA 2G0EA 4NQWB 5GAEJ 1IN6A 2ZSHB 4XLHA 2MC3A 2WBMA 2HQAA 3CO6C 5HDKA 4BHCA 2DPDA 1BR1A 4ITVA 3E6CC 3O3KA 1Z6TA 4MTEA 3FBNB 2JA2A 3KIOA 3MEXA 3Q9VA 2HFHA 1QU3A 2LC2A 3QKXA 3DCFA 1SC7A 2ZBKA 4RGSA 3G7RA 2AQEA 5DYMA 4HNUA 2E5NA 3LSKA 1FY7A 3KE2A 1TWAJ 3FK6A 4R8HA 5BPIA 2VKHA 3L2QA 1TP4A 1FWZA 2HQ5A 1IRZA 2D45A 3RZOJ 2DDAA 5K7FA 4NHJA 3CJTB 5FKMA 4F92B 3L09A 1X1PA 4BXFA 4IQ4A 2EIMH 3VW0A 3MKYB 2VQHA 5FGMA 3OYNA 2WAQA 1QQIA 4KN4X 4A6EA 5J1YA 1T56A 3HEFA 1Q1VA 1FMVA 1FPQA 2VI6A 4TV7A 1UHMA 4II3A 2HQNA 1K4SA 4XORA 1JHFA 2L7MP 1W7PB 1WFXA 1A35A 1ON2A 5BQTA 2XF5A 1FTZA 3PNYA 2KT0A 2P81A 4Y33A 2FX0A 2UXIA 4BXXJ 2MBFA 1XMXA 2K9NA 5IY5H 1UFMA 1LUJB 3BT9A 5DS9A 5D18A 5ICGA 1UCRA 2OERA 1T0FC 3FISA 5E79C 2OAZA 1D0XA 1X1DA 3GUDA 3I64A 1JKRC 4A0XA 4AM3A 3J80K 2DA7A 3GMEA 1NH3A 2CUFA 1NK2P 1POGA 2FMLA 1G3SA 3VVZA 2VBZA 3CJQB 4M3DA 5HLHA 5JLWA 2ZKZA 2OPTA 2ZXHA 3Q0WA 2K9QA 1ETVA 3CJNA 1LVAA 4HOBA 1XC5A 4L9TA 1BL0A 2LKPA 2HKXA 5F64A 5KVRA 1T38A 1ERDA 1IUYA 1G3WA 1Y1WJ 1L0OC 3PASA 2F48A 4MO7A 2ID6A 4X1EA 1YRNB 1PJRA 5GAGJ 2EH3A 4BUPA 3J81K 1O4XA 3J81Z 2ESNA 2K86A 3JSOA 3M4OJ 2O5RA 3K9TA 1KU2A 5K5RA 3WTXC 1TBXA 2H8RA 3RQIA 4KFCA 4NB5A 1ONVA 4M71A 3ULQB 2DYRH 3W2WA 4XBFA 2VBYA 2LTPA 2DXIA 1H89C 3GXOA 3EGQA 4KT5C 1J7KA 2IXSA 3IP4B 2F5CA 3VYTB 4CCMA 2HVQA 2E2HJ 1G3TA 4XNFA 1VFCA 2PBXA 3HUGB 2E1MB 1D0ZA 4BGDA 4D7NA 1ZRDA 4LB5A 1RKWA 4BKXA 4QPQA 3L1PA 2K4JA 1MZBA 3KEOA 3VB2A 3LQRA 4A3MJ 1ZGAA 1W7PD 3MCZA 4G12A 1MMAA 3OWTA 2EZKA 2MGQA 1YI2I 3C2HA 4HF1A 1IXCA 1GHCA 1MGTA 3PFIA 3ERED 1MD0A 1APLC 2L7FP 2ZXWH 4BEHA 2O9LA 1SGMA 2BZTA 1UI5A 1ZREA 1IG7A 4A0ZA 5J1RA 2DK8A 1RR7A 3OSFA 3JRDA 4FASD 1FBUA 1Y0NA 1YW8A 4OAYA 4WXDA 3HIMA 5LFAA 3COAC 1SD6A 3SXYA 1X19A 1YOVB 1O7FA 5FB2A 2DPUA 1G3YA 1KONA 2EA4A 1MW7A 2LG4A 2D5VA 4ICHA 2QUFA 3GX4X 1S7AA 5D6FA 5K5QA 2ZFWA 4RB1A 4BE0A 3HTSB 2MSYA 1W5TA 2AXLA 3JRGA 3CUOA 2WADA 2F4MB 5KK1A 2HOTA 5HAWA 2DO7A 3WU1B 1ZELA 2IT0A 3K1PA 3CMAI 1PUFB 1K7AA 3WG9A 4UNOA 3HOVJ 3S16J 1FLIA 1FJLA 1VQKI 4FE7A 4I7HA 3ON2A 3ZMDA 2A05A 2NVQJ 1VZ0A 5D6EA 2BBYA 2VC0A 2XPWA 1SVOA 2ELJA 3KLNA 1FSEA 3ZQLA 4A3LJ 1XCBA 4OAZA 3OYCA 4GYIA 2KZGA 3WTSC 3F8MA 5KNLA 2G3BA 4LG0A 1KGSA 4M6XA 1BW6A 3VSLA 2YVEA 2COBA 2P8TA 3SDBA 2QYOA 5TISC 2RVCA 3BJAA 1YO5C 4M72A 1S7OA 1UZCA 2H8WA 2RQPA 5CQGA 3LAJA 2EFPA 1RUOA 3CTAA 3I5UA 1GV5A 4X0GA 4A3CJ 3OS2A 2O61A 2NS7A 1T2KA 3QP5A 4HG2A 2QWWA 5DCMB 3ZMVA 4O3MA 2QQAA 2JRTA 2LFBA 4U9LA 1F5TA 2A69F 2EWNA 5M5WJ 1D0YA 2YPRA 3I55I 1R00A 3SEQA 1H9TA 2R7SA 1KU9A 4FT8A 5HSZA 4YELA 1SMYF 5CVRA 4XKWA 5DUKA 4AIKA 4KJZA 4G7ZF 2VXDA 4B3AA 2DT6A 3IH2A 4L9VA 1XTAA 1LDKB 1G2HA 2WAEA 5EGOB 1N25A 2MW8A 2VQLA 4PJNA 3RI4A 2F5VA 5EZHA 2HOEA 4XLAA 4GRIA 1BOAA 3HUGA 2WGBA 2DMPA 2IA0A 5HS8A 2HDDA 5EF6A 2XF7A 3ELKA 2JT1A 2EZIA 3S3MA 5J8CA 1CF7B 1R5GA 3PSIA 1W5CC 1B72A 2E34A 3JSPA 1Z05A 1IN5A 2ZY9A 2YS9A 1VI0A 2DA1A 2HR3A 4M6VA 2MG4A 1IF1A 5LLQA 3BR3A 4XLEA 1QPMA 4NC8A 1B1BA 4OU0A 1WQ2A 5FKLA 4KMUX 3BLYA 4BQQA 2XF6A 2GXAA 4HQEA 2O7TA 4FHTA 5E1WA 3BJOA 2RHAA 4E7IA 2L9VA 2OQGA 4DGWB 1HKSA 2KDZA 1XMKA 4N9HA 4PCQA 4O6JA 4KISA 4JX6A 1I6HJ 3TEDA 4HDVA 1PP8F 2BGCA 2LKXA 4XK4A 4IL6C 2FD5A 2H09A 3ZN1A 3HYIA 3QPTA 2LVSA 2P5LC 3FK7A 3CCLI 5HBUA 3BR5A 2IW5A 2O7OA 3VOEA 1X1BA 2EZLA 2E60A 2EV6A 3L9FA 4CCNA 4BQAA 5IP9J 2MLKA 2XPUA 1BC8C 3JAMZ 2HI3A 4BAYA 1I3AA 3L2WA 3CCVI 3W2AA 1S6LA 3S5RA 2VT3A 4AF5A 3F1BA 4BE2A 4FQGA 4ZDOA 3H1CA 1ZARA 1QBJA 2EILH 2R92J 2YSRA 3BPVA 4AVZA 2HTJA 1DQUA 1YLFA 2RREA 3HRUA 3RYRA 2R7FA 3WU2C 3FXUA 2JVGA 4FTHA 3KFWX 3ASOH 4HV5A 2RASA 1IN8A 1WZ2A 2X1EA 3BY6A 1J0RA 1MMGA 2DOAA 3S93A 1WVRA 1JJ8C 1XGNA 3F9KA 1BC7C 3HKZN 2XASA 1OQYA 4EEFG 2VOOA 4EGZA 3RKQA 3DP7A 4PXIA 3QOEA 3G1LA 3FRQA 1LB2A 2DG8A 2UXHA 2G7SA 5HLGA 4PJMA 2TCTA 4C3IJ 2VC1A 4LK1F 2ZMEC 2VL8A 3ERMA 2DT7B 2HPMA 4BJ6C 3L2RA 3C18A 4JX5A 2GZWA 1GDTA 3KKCA 1OCRH 1RC9A 1MBHA 1OFCX 3C7JA 3IRRA 2NP3A 4W1UA 4YEJA 3A0BC 2JN6A 3MFKA 2LRDA 5EJCA 2B63J 2E19A 4W97A 5K1YA 4FCYA 4E7ZA 4B44A 3I3LA 1JT6A 2A61A 1XMAA 3G4SI 3F6OA 1RETA 3DTIA 3TW7A 2G7HA 4I99C 4Q48A 1DGRM 3OS1A 4ZYDA 4A6DA 1LEBA 2CW8A 1Z3XA 4RM2A 3RDIA 1NK3P 3HSRA 2R3SA 2ME0A 1MNEA 2LY9A 2B3WA 2BW3A 3CESA 5JFRA 4CHUA 4DQ2A 2FOWA 3K69A 3RZDJ 5FLVA 2DK5A 1JGSA 1F1ZA 2HS5A 3J80Z 4NC7A 2WUIA 4XRSA 3MN2A 4N9IA 1U8BA 3CDHA 4HX4A 2NXNB 3BCBA 2V79A 2EZHA 1WJEA 4A69C 5DD4A 1U78A 3SFIA 3OMYA 4ME9A 2QM3A 4MEYF 1XDUA 1YX3A 4OOIA 4OMYA 2OJED 4IHVA 1B9NA 2LLKA 4CCOA 1J9IA 4XRSG 3IWFA 1TWFJ 1ACIA 2W85A 2BXYA 2ZJPF 5IOZA 3S17J 3H5RA 4D7MA 3NRVA 1FTTA 1VQ9I 4ZTJA 4PFOA 1J5YA 2BXZA 2VODA 2ADUA 4Y15A 2DN0A 5GP9A 3R6SA 1FYMA 2L9NA 2VASA 5IYDJ 3DTKA 1JUPA 4XONA 4IHYA 4RB2C 1ZK8A 3FXMA 4CA0A 3V7SA 1A04A 4ENKA 3ABKH 3FXKA 3ASNH 1I1GA 2XUBA 3U2RA 2LY2A 1KZHA 2LH9A 4XN3A 1V5EA 1WJDA 4BEHB 3BTJA 4JOMA 1X1CA 4EM2A 2CO5A 4H0EA 1GVDA 1ULYA 2LBFB 1XSVA 2BY2A 1G8XA 2OF7A 2KIMA 3F8BA 1I5ZA 2M34A 4CO8A 4HYEA 4RAFA 5ERIA 1RUNA 5CXGA 1SFKA 2VKDA 4AVPA 2IA2A 5D5WB 1XCVA 1R58A 4JKZA 3GWZA 5D5XB 1HF0A 2DYSH 3OV8A 1YIOA 2XAUA 3M8FA 3S2DJ 2HOAA 1TT5B 2JA5J 3BQYA 3MZYA 3U9GA 2DODA 5GTHC 2Y0SA 1WJ5A 3LQQA 1X3UA 4IX7A 1A6QA 4RAZA 2ZNYA 3K1MA 3ML6A 4FX4A 1ZQ3P 2DJNA 2YU3A 2W25A 4B3XA 3ZP5A 2VQCA 2CYYA 4HZFA 4XLCA 3HGYA 2PMZN 2P7CB 1FC3A 4LK0F 3F6VA 5CPRB 1FT9A 1KYZA 1RESA 4HSTA 5IP7J 2MD5A 1OYWA 1TQIA 4RLQA 4ON0A 3G6EI 4ACIA 2IGOA 4KICA 2KDOA 3KP4A 2FXAA 2WV0A 3TP3A 1JI8A 2FBQA 4GDFA 2LKSA 5C3EJ 1O3RA 1I6XA 4M3GA 4ZYHA 4OIPF 3COLA 2RQQA 3ECOA 4UV8A 4D9JA 3WTWC 1XN7A 2KHMA 3OYEA 4CZCA 2CWEA 2L01A 1HQCA 3H9JA 4DZJA 1QHHD 1SVMA 3L2VA 1WKMA 5H6QA 4BE1A 4PGGA 4CSWA 2X48A 6PAXA 4DBQA 3I0TA 1IJWC 4ZJZA 2LY1A 1R1VA 4IPAA 5E3NA 4HV6A 2YU9J 2G7LA 3FKIJ 2XAFA 3FX3A 3ONQA 3L2CA 3I58A 2X6OA 2HVSA 2OBPA 1K78A 2G7GA 4HBLA 4LLLA 1UHSA 3GZNB 4JYKA 5EZGA 3C07A 3S3NA 2I5UA 5H6RA 2OA4A 4HNTA 1TT0A 2EA2A 4D1QA 4Y3OA 3VODA 5BS6A 1VTNC 1HW2A 3O6BB 4MFEA 2UXPA 4NBQA 4E7JA 4LITA 4II2A 4GCVA 5EYRA 1GVJA 2LDUA 2CS3A 3TKYA 4XR6A 5FRMA 2XGEA 2Z1DA 2R0QC 1WCMJ 4IHSA 1P7IA 2HYFA 5TGTA 1FMWA 2YR2A 4B48A 3WGHA 2IS1A 3DEEA 5DDGA 3W3CA 1EA3A 5DCMA 4IHWA 3U1KA 9ANTA 4XSZF 3OS0A 1HDDC 2ZCMA 3ECHA 3QU3A 3SQNA 1EH7A 5A2QK 1LPQA 1YRNA 3I71A 2L9RA 1BJZA 2OC6A 4AUXA 3OSGA 1QRYA 4NC6A 3LSMA 4G94A 1CGPA 5E8GA 2ZJQF 2IJLA 2V9PA 1GV2A 4C9YA 5FD5A 1BI2A 3ZQIA 1WRJA 3BWGA 1USSA 2V6CA 3D5SC 3OR1C 3BJBA 1K6OA 3MVPA 3GTGJ 5KAIC 1WWXA 3C1DA 4NQWA 1QZZA 2W48A 4HQMA 2Y9ZA 3HRMA 2PN6A 2E36A 1LKXA 1BOBA 1P7JA 4A5MA 3EUHA 3MQ0A 5DD8A 3UR3C 3BJ6A 4LOCA 2VPLA 5J4YA 5J1UA 2V26A 3ABUA 2V7FA 1I50J 1X2MA 2L54A 4I6ZA 2DA6A 2EJRA 2QZ8A 2PQ8A 3OL4A 3PQJA 2C6YA 2DU9A 4BBRJ 3SHFA 2NNNA 2F4IA 3CUQB 4BL0B 2F07A 3ZN0A 4UDSA 3F0CA 3OIPA 1Z9CA 3CD6I 3VWBA 1N78A 2H27A 4UUSB 2R7VA 3E7LA 3GBGA 1MBGA 4IRGA 1Z7UA 3GZIA 2K40A 2BOLA 3CDIA 2XROA 3CDLA 4S0HB 1L3LA 5C4YA 2FQ3A 4A3JJ 4BDYA 2JSCA 2M0MA 2BVLA 4E70A 5EEGA 3VW2A 4IKFA 2VT2A 3TL4X 1V4RA 4N0BA 1QZEA 1O3QA 2QKOA 3REOA 3ABTA 2PJPA 1BN5A 3MKLA 2QGUA 2QSGX 2QCOA 3ZPLA 1KQ9A 1IW7F 3BG3A 2R4GA 3LL7A 3QQAA 3E3VA 3I59B 1DP3A 3F22A 4ENMA 3LA3A 1B8IB 4LFUA 1PYVA 3BP8A 3CCSI 3SJMA 2VOPA 5IT9Z 5K7HA 2KL4A 1TWCJ 2PBIA 3VFZA 4J00A 1QA6A 1BM9A 4JQFA 1ETOA 2NAZA 3PSFA 3E1SA 3RD3A 1K4TA 2QWTA 2W82A 3SZPA 1VQMI 2KRFA 3RYPA 1SAXA 2A6HF 2NRAC 5CYVA 5E18F 1OR7A 4PDKA 4XLNF 3S1NJ 3GF2A 3M7GA 2M0CA 4MFDA 1RKTA 1M1EB 3P9KA 3WTVC 4BBSJ 2X1CA 1ZGWA 5IYCJ 2DG7A 4BHBA 2PMZA 3WTUC 2FUG2 3H9GA 3H92A 2HYTA 1OCCH 2M7AA 3J7YJ 1V54H 3BG6A 2ZB9A 5CVUA 3VOXA 1FOXA 2DA5A 3NS4A 4H4KC 4IVNA 1IDZA 3RPQA 5JVGF 2DMTA 4HA8A 3RPUA 4BH9A 1TWGJ 1F4KA 2LSOA 2UXNA 1ZLKA 4IRIA 1YX5A 2FSWA 3VVYA 2L3DA 2Z3YA 2JA8J 3H5NA 3RCOA 3K70D 3VVXA 1S5LC 1U3EM 2GIVA 1U9NA 3IH3A 3L7WA 1SEUA 1WHUA 2EQRA 2A6TA 2HZTA 3K1NA 3ESWB 4BU2A 4U0VA 5J4VA 4ZZLA 3JR9A 3KKDA 4I2OA 5ICCA 4P9FA 1A31A 2HDCA 2P0WA 5FHPA 1B59A 2JZYA 4YIRX 4F91B 2HTSA 3JTHA 4A0YA 2CGPA 1OJLA 4KN7X 4B47A 4WWCA 2DA4A 3DF8A 2I8DA 5CVIA 3ZMTA 3BNIA 3TOAA 4JP0A 4C2TA 3T1BA 3IAS2 3K6GA 2HKUA 4GFBA 3NI7A 2A5WA 2STTA 3LSGA 2ZOYA 2FU4A 1NG7A 5GAHJ 1WH7A 1ZR4A 5LD2C 3AAFA 2VUMJ 2D2WA 2VXZA 4UVBA 1E0EA 5ILVA 2Y75A 5ICEA 5LRRA 1IZ1A 2WV1A 5DM7F 3DKXA 2IEKA 1A36A 2LMDA 4D0PA 1O3TA 3MNLA 3I9V2 4ANJA 3MZ8A 1YIJI 4LIVA 1KYWA 3GFIA 1JHHA 1B8IA 2KPMA 2BE5F 2R7QA 3G1MA 3K4BA 5EFYA 4NDLA 4RAGA 5ICFA 3HGGA 3G71I 4D5CA 2CRGA 4IZZA 1R23A 2DW4A 2GENA 2MABA 1HOMA 1STZA 4K2EA 3PFYA 3SEZA 1K78B 3KZIC 5H9TA 1HDPA 1DUXC 2K3FA 3DFGA 4G8XA 3MD2A 2RNJA 2R7RA 3ZMZA 1OCZH 4V19K 5JI6A 5D4RA 2KRCA 1ZR2A 2ISYA 1F9NA 3ZXSA 4CCJA 3J7AO 4LD5A 1ZKGA 4GFLA 3G2BA 1RPWA 2PX9A 3N4MA 3Q3SA 1G6NA 1U6GA 3KYDB 2RNGA 2HNHA 3H35A 3U1DA 1Y8QB 2M8EA 4KIFA 3ZMSA 5M5YJ 1H9GA 1SANA 2EFOA 4YIFA 3NWSA 1ZG3A 1WI9A 5F0HA 4IJAA 5FLMJ 1X58A 4PSWA 1P6RA 1FP1D 1YE9A 2JPBA 4BQNA 4HKUA 1LDJA 3ZOBA 2FMYA 3HM5A 5K7ZA 2DMUA 4NN1A 2A5YB 1VQOI 3HPGA 4QWQA 4A3KJ 2K27A 3P9CA 2KJCA 3AG3H 3HSFA 4XOTA 1WH5A 2X85A 3R60A 1ODDA 1BI0A 2G9WA 3T8TA 1SFOJ 2HZDA 2R5YB 2AXTC 4B43A 1EV7A 3HOZJ 2PFVA 3I53A 4LLGF 2HWVA 3O2PE 2M4KA 3K0LA 1YS7A 2IP2A 3PQKA 4BXUA 3RSNA 1V55H 2F6CA 2L0KA 3VTIA 1YTYA 3E7QA 2F5DA 4MIMA 2OV7A 4MLOA 1UG0A 4HPQA 2Y2ZA 1SFUA 4AD9A 3CMMA 1XSDA 1ETQA 4QPOA 1G59A 2QA4I 1QGPA 2HYJA 4KWAA 4FE4A 3H9QA 3EUKL 4UB8C 1D5YA 2UUZA 2ICWG 4MEXF 3TDZC 1FOYA 4DYCA 5EEAA 3HE0A 5DTDA 3LJLA 2RV8A 4UUTA 1FSHA 2LOOA 1MJAA 5L3DA 3FXOA 3CCJI 2E1CA 2PEXA 3TDUC 1ZLJA 1R49A 3ZGKA 3TGNA 5E3OA 4IF4A 1A5JA 2WTEA 4WIBA 3PJRA 2JJ7A 2PLYA 3CCEI 4I02A 4YRVA 5E17F 3JSJA 1IN4A 2QLZA 3AG2H 2QTQA 4XMYA 5BPDA 1U0JA 2R7OA 3DBLB 3LSJA 4CZZA 1TNTA 1KU7A 2K9MA 1UMQA 4OD5A 3ZQQA 3OYJA 4U87A 1EF4A 4PJJA 1WI3A 2ESHA 4I01A 3K4CA 2GBYA 2MD0A 2KJBA 3WE2A 2CQQA 3E0JB 5HVQC 2MYSA 4JK1X 2P7VB 2BY3A 3K4JA 4U0YA 2OTJI 1ZG1A 3LSIA 2L4AA 5E20A 4BY1J 1PUEE 3AFHA 4YZEA 1MDMA 3RTRA 1RZ4A 4M3BA 3TP0A 5IYBJ 3LWJA 2CG4A 3NAUA 2RC4A 2CUEA 3GLLA 2LP0A 3BQZA 3P7NA 1T08B 2B0LA 2RDPA 1W5SA 1YYVA 4LJZF 3WTYC 3W2VA 3EETA 1F36A 3GW2A 3WU0A 1PDNC 1HW5A 2DA3A 2DFHA 3A2KA 2B9SA 2W53A 3TQNA 3LWFA 3GEUA 1OLTA 1S29A 1K79A 1USTA 1Z77A 5GPAA 3V8KA 5FO5A 1MIJA 5BOXA 4I0BA 3LFKA 3V8LA 5D5VB 3QAHA 2XPVA 4WXHA 1AKHA 4P96A 1RI7A 1R4NB 4L9NA 1VQPI 4S04A 1LVKA 2K5CA 3HDDA 4LB6B 1IN7A 1FNNA 3ANPA 3JRHA 1WJAA 2PMHA 3UKGA 1TW3A 3BZKA 3DTEA 3KEYA 1E3HA 3K4MA 1JUSA 3DU5A 3CF2A 3FZVA 3KP5A 1HSJA 3A0HC 4A2UA 3DBHB 4C30A 1LDDA 2ME6A 3ABLH 4DYRA 5CW8A 2V6EA 3FM3A 2ZSIB 5D8LB 2KFDA 4PJLA 2WAFA 3HHGA 2M30A 5J3LA 3KP3A 3DV8A 2JK3A 3FHZA 1TQMA 2X6YA 4CDGA 1VQ4I 3FMSA 4OD4A 1P2FA 1OYYA 3B81A 5CVVA 3KCCA 4G6DA 2IPQX 4L5IA 5HNFA 3T6NA 3T5XA 3HZJA 4NELA 2W4SA 3C3WA 4C3HJ 2ELHA 1TW2A 2Y69H 2KRHA 2FBHA 4Z2YA 5LHIA 5C44J 3CCUI 1JKOC 4KMFA 3HBLA 5K5OA 4FETA 2DDBA 4GCLA 3G1OA 4XKVA 3KYLA 3GVAA 5AIQA 2NS8A 2LYCA 1HKQA 2HXOA 5E1ZB 3VPRA 5GADJ 3PO2J 3HTJA 3E5QA 2O3FA 5JHFA 1BA5A 2Z99A 3V42A 2QIBA 1MBFA 4CXFA 2Q2EA 2AHQA 1YFHA 5L3CA 2CQ7A 4EVIA 1RIOH 4AIJA 1X4OA 1P92A 4AWXB 1T8IA 2CH0A 4P5OA 5B1BH 4ZH4F 3JRBA 4PK4A 1E3OC 3BR0A 1MDMB 3N97A 1O7LA 4L9JA 3S8PA 4DBRA 2IS4A 4A5NA 3VOKA 5EGOA 4KIGA 1G4DA 1MMSA 2IBDA 3BG5A 3KP2A 2MH2A 5B3SH 2VPRA 1ETKA 5H20A 2COMA 4DYQA 1MBEA 1D1AA 2OUMA 2F2EA 1XS9A 1Z67A 2CJJA 3EYYA 1KA8A 5D5UB 1B9MA 1R7JA 4JL3A 4RMNA 3R0AA 1ETXA 2K02A 5HS9A 4GXOA 3R61A 3QYBA 1MSEC 3LNQA 1VNDA 4HLYA 2JA6J 3SZTA 4DNCA 3WGIA 2NYXA 3RIRA 5LBQA 3D1NI 3UNGC 2V1XA 3OR2C 2RAEA 4U88A 4ASNA 4P1WA 2OCCH 4FX0A 1T95A 2FEZA 4NUBA 3K2ZA 2GA1A 3DPTA 5AONA 2KQRA 1MJBA 3F3XA 5HDNA 2K9LA 5F0CA 2M8GX 2E5ZA 1YQAA 4ZC3A 1ZRCA 4F93B 4ENJA 1OISA 2K7LA 4C3JJ 1W0UA 1FIAA 3NEUA 3GTMJ 2XGXA 3CJRB 4XRMA 1T33A 3ISPA 2WC2A 1C0WA 5D4SA 2QKLB 4I0AA 3S15J 2HGCA 3JTGA 4U0WA 3GTKJ 4IHXA 1MKMA 2QVOA 3JAMK 2YUSA 3IKVA 2DJIA 4XM3A 4BJ5C 2AO9A 4IEJA 4M9ZA 2CFXA 3BCAA 3AL0B 1TLHB 2ZOZA 1HSTA 1P9QC 4M3FA 3LAPA 3ON4A 3BROA 3AG4H 4OINF 5LEKA 3O8GA 3VIBA 3K70C 4E7LA 4JNNA 2EINH 1U5TB 2E1OA 3H0GJ 4IHTA 5H2FC 2O8XA 5J6XA 2ZCXA 2X0LA 2MC4A 4GCTA 1BI3A 1GXPA 2WB1A 2DI3A 3J7ZI 2W84A 5KCMA 3N05A 4F3QA 3OY9A 4QTRA 3CP2A 3G73A 4PZJA 4RM3A 2PJRA 1K6YA 4XIDA 4LMYA 2R7XA 3HJEA 4GCKA 4DZPA 2DMQA 2FJ1A 1J09A 5FD6A 3HSEA 3P9IA 5C4XJ 4J19A 3WE3A 1J59A 1VQ8I 4HX7A 1EH8A 4LG3A 4Y52J 1IAWA 3BZ6A 3DKYA 3W6JB 4M9SA 2Z5UA 2W57A 2R93J 3VP5A 5LGTA 2L7ZA 3D0SA 2CUZA 5HDGA 3KP6A 4F55A 2AS5F 2OTLI 3PPBA 3CMEI 5TJJA 2CQXA 4Y7NJ 1MBKA 5BMZA 2BVMA 3CZ6A 1WPKA 1U5TA 2HQRA 2XVCA 3F8FA 3HTIA 1NG6A 4ZYAA 1ZGJA 1KU3A 2PG4A 5F6FA 1JXSA 5E1XA 2R5ZA 2EBIA 1CF7A 1MH3A 3ZCOA 5TRDA 3PIOF 2O6GE 3D5RC 3DWLE 3FDYA 3QOPA 5JVTA 2CV1A 2EFNA 2QOPA 1LFPA 2X51A 2GAUA 2NVXJ 1EH6A 3QODA 2Y48A 2ZNZA 1KQ8A 3QYEA 5L3EA 3CF5F 4Z6YA 2CQNA 4BJTA 3RPUD 4X6AJ 3BCGA 2LR8A 1W0TA 2BHYA 4IQJA 2PFBA 1SD5A 3J7AY 3HOXJ 3TBIA 1AU7A 2NP5A 4GGGA 5F1RA 2OCEA 2XIGA 2I10A 2JPCA 2ZXJA 1IRFA 2XAGA 4DVYP 2XAQA 3WTZA 1IXRC 4AYBA 2YVHA 3QPLA 2D1HA 4EJWA 3WTTC 3O8HA 4RB3C 2X4HA 1R71A 5IPAA 5HOOA 2CV2A 1WGXA 2KIUA 3IUVA 3S14J 1JGGA 2K9SA 2M3AA 2Z16A 3V4GA 3EUHC 4KUMA 1HLVA 4KITB 1Q1HA 3A03A 2Z33A 4J01A 4MHGA 1ETWA 3FM5A 4BQOA 3V8JA 1E17A 2Z2SB 1LJ9A 4C2MJ 3CCMI 1PP7U 3OOUA 3HOSA 4ZYGA 2R7TA 3CJDA 3S3OA 3DXJF 1XGOA 2H94A 3CCRI 4KDPA 1SMTA 2DBBA 2DMNA 1RNLA 2H1LA 2NVYJ 2VKEA 5F04A 2BYVE 2STWA 1TL8A 5F0FA 4Y4RA 4M3EA 1HKTA 2XV4S 4PUSA 2ETHA 4UV9A 3TO7A 2NNYA 4EMSA 3QRFF 4WCGA 5D19A 3F23A 2JQ7A 4EM1A 3CCYA 1I39A 4L5EA 1X3WB 1QO0D 4XSXF 2ZCWA 1TNSA 3HPHA 4ZTFA 2QF7A 2YX7A 3K10A 4KIBA 3P5JA 3HOYJ 3F8NA 1LEAA 2D1VA 2M2EA 1IV6A 1BIAA 2Q1ZB 1OCOH 2VE8A 3LSTA 5FROA 4XICA 3PO3J 1W7PA 2VLAA 4WXCA 4B1RA 1I3QJ 2WWYA 2VBXA 3IAM2 5ED4A 2HOSA 3E5UA 3NQOA 5M3FJ 2QBYA 1VQ5I 2Y9YA 4V2FA 3T8RA 1BIBA 2L9SA 3BR1A 3H5AA 3OYGA 2DTZA 3ZQHA 1D5VA 3ANGA 3I59A 3BTIA 4CUGA 3BRUA 3FXRA 3OYMA 4A12A 5AIPA 2JUGA 3H3VK 2FQ4A 1ZG5A 3DKWA 2ZMEA 2VIXA 3SZGA 3JW4A 2RGVA 2R7UA 3CLQA 1REPC 3IUOA 2UXUA 1MSFC 3F8CA 5HS7A 3WHCA 5LRSA 4PJ0C 5CLSA 3E6DA 5M3MJ 5J47A 1Z0XA 3DBRB 5IT3A 5DEQA 3S32A 3G56A 2LBFA 1LFBA 1S3JA 2GLOA 3W6VA 2ZFUA 5M5XJ 3DPJA 4C2UA 2H6CA 3K2AA 2L5QA 3FIWA 2F5FA 2YX4A 3EDPA 5ILUA 2GOXB 3GZ6A 2H6BA 3JRIA 3KZYA 1BR4A 1R1UA 3I4PA 4CYDA 4M73A 3DEWA 3OIOA 5CXIA 4E7SA 5AQCA 2HYGD 5E3LA 2JWTA 4XKCA 1W36C 4LG0B 3BTCA 2WA0A 2HPIA 3ABMH 1BBYA 4YFKF 1IRGA 2JMWA 2GXBA 3CMYA 2B7EA 2Q24A 1ZHFA 2W1OA 2ECCA 3V7RA 3CWRA 1OCPA 1ITYA 1U9OA 1H8AC 2CUJA 4AYBN 4IRVA 1R6RA 3GFMA 3GO5A 1VQNI 3QBMA 4OIQF 2N8GA 4MGRA 1V5GA 5DCFA 1JTXA 1SFEA 1DDNA 2QEXI 4ESJA 2CV0A 1T6SA 2A6EF 5LHGA 5HLIA 3KNWA 4KT6A 2XHKA 1IC8A 5DAJA 3KYCB 2PJRB 4I09A 3KPHA 1MMNA 4HEA2 4BHPA 3H36A 1QPIA 2DA2A 3AQTA 3ZQFA 3FXLA 3QPSA 5LGNA 4Q5SF 2PMUA 3VSKA 4YG2F 3KETA 1T39A 3ZQ7A 5GPCA 1XPXA 3P9TA 2ZO4A 5K58A 3B73A 3JRFA 3A01A 2ID3A 4LLNA 2JVHA 1O3SA 1R1TA 4UY8I 3KEQA 2QBYB 2M45A 4KA4A 3FXJA 3CQZJ 2E7XA 4A3IJ 4UVAA 4CYCB 4XLPF 3S1RJ 3LOCA 3HXLA 4WF2A 2CQKA 5EG0A 3HOUJ 4HLXA 2KISA 2E2IJ 4MQVA 4E7HA 2X6WA 1BR2A 2UXXA 3GZ5A 3BOQA 1SD7A 3LMMA 2R5ZB 3A01B 5A2QZ 4C2MA 3L00A 2V1UA 2D6YA 1TQPA 3PUBA 5E8IA 4AIDA 1JE8A 1N75A 4KYWA 2R5YA 4A93J 4U7BA 3T0YA 4JBAA 1O57A 1HXDA 5FKNA 3IKTA 5FGLA 1ZAOA 3GTJJ 4GO1A 2R7DA 2OU2A 3M8EA 1SFXA 2L4MA 4Q4ZF 1VQ6I 2H1KA 2ACJA 5DV5A 4E4HA 2XGCA 3V6GA 1R9TJ 1ZH5A 1DGWY 3W6KB 3DQVC 5LEJA 2M1BA 3KZZA 5D1RA 3Q5FA 2JRMA 1DU0A 2A68F 3IHUA 3OL3A 5LGUA 2MA3A 3HRTA 2X6XA 4A3BJ 2E1MC 1Y8RB 2GWRA 2VBWA 1MNDA 2M5WA 3M9AA 3IV5A 5E3MA 3OYDA 4BDZA 5JR3A 4A3DJ 1I27A 3R4KA 1WJCA 2V9KA 4OWRB 4AC6A 3IL2A 5IP6A 3CCQI 3HTAA 1ZTRA 3AQSA 2IAIA 2HU9A 3EUPA 1IXSB 3FHNA 2V1NA 4MQ9F 1DPUA 2RN7A 2MFZA 2O03A 3CC4I 3OYKA 2FJI1 5GTIC 4M9XA 3R0JA 3GTPJ 2CFOA 4DJAA 3Q0VA 1HBXG 1F43A 2XDNA 4IRHA 2O8KA 4L0ZB 5B66C 4RS8A 2VQGA 4ENNA 1VQ7I 1YJNI 1FOKA 4V2GA 3SWHA 2EIKH 3BR2A 3GTQJ 2NOGA 5CQEA 2OI8A 3RKYA 2OZUA 3GYHX 1R4MB 4RBOA 3DPLC 3KX2A 5C4JJ 2VONA 2IS2A 3AKZA 2FBKA 3GEZA 2HKOA 2FE3A 2A2FX 2JTVA 2B1EA 4PSXA 4G9YA 4RB0A 3OOPA 2L2OA 4EV0A 4ZZDA 3FWEA 2F5EA 4EJTA 3OYIA 5FMPA 4HAMA 2LK2A 4R1HA 2GFNA 2K4BA 3ZQGA 1MBJA 1D1BA 1XGSA 1R22A 1FZPB 3BHQA 4B8XA 1JTYA 3O60A 2W00A 3M1CA 1VF9A 5HNHA 2VKVA 3FBIB 1YJWI 2Y30A 4U7DA 1AKHB 1BW5A 5FFXA 1U5TC 2ZXIA 2OZ6A 3TO6A 4RGRA 4QLCU 2EPFA 2BEOA 2GXGA 1WJBA 2IVMA 4HF0A 4M74A 3RKWA 4QIWN 3FXQA 3H3ZA 1OCTC 1GT0C 3JREA 2M4GA 2LNBA 4BACA 1AOYA 2LF8A 2J5PA 3NARA 1XDSA 3HTUA 1H88C 4N4NB 2KP6A 3IRQA 3NPIA 1HCRA 1S8NA 2Y0MA 2NVTJ 1K83J 3V7CA 5L3GA 2RKHA 3F72A 1FX7A 3KLOA 4P9UA 2WB1N 1YITI 1UI6A 3CC7I 2E7WA 4HSRA 3LA2A 4IXAA 4IOAF 4HRIA 1X4PA 3G3ZA 3B6AA 4UHTA 1HA8A 3NWTA 3AG1H 5L3FA 2XAJA 2L7KA 1XGMA 1X3ZB 4L18B 5FLXK 1TWHJ 4XQFA 2M87A 4EJUA 2EV0A 2E35A 3PUFA 4AIHA 2Q8KA 2IGKA 1FYLA 4BNCA 2QQ9A 5DUIA 1QVUA 2GUHA 3BTLA 3QWLA 4GFKA 3FMQA 5IOYA 4ABZA 2CSOA 2WY7Q 3BG9A 2KMUA 3S2HJ 3HG9A 3B6CA 1HC8A 3CRJA 5BNGA 1IV8A 2IA1A 3CLOA 2BW3B 2KZVA 5FFZA 1RR8C 3SFZA 1CQTA 1LFUP 4AC0A 1JJ6C 3HB9A 3GCMA 2KIFA 2DFIA 2Q2EB 4OMZA 5JHUA 2CU7A 2P5VA 4HDUA 1R5HA 2REKA 1QZYA 2DT5A 3GLXA 4OIRF 3BR6A 4YFXF 4UUVA 1MNMC 2GA2A 3ZQCA 1S9HA 1LE8A 2QQ8A 4G6TB 3JRCA 1NHAA 4LGWA 1D1CA 1JT0A 3MAJA 2NOJB 1OPCA 3V78A 1ZN2A 1MMDA 2VN2A 2E2JJ 2UXOA 5F08A 3E6BA 4UB6C 3PM1A 2AQFA 1ZYRF 1FYKA 3BDDA 5JLXA 2LREA 1TC3C 1MH4A 3BZCA 3WHBA 2L02A 4EJVA 1Y39A 2PZ9A 4XL9A 2NX4A 2EFQA 3ROUA 1PUFA 1GUUA 1Z6RA 2LD5A 5DM6F 2FNPA 3LFUA 1OKRA 1LQ1A 3KZ9A 1BJAA 2HDWA 1ON1A 3QU6A 1U8RA 1UB9A 1IGNA 2HXIA 3BPXA 2BY1A 3DLLF 1SAUA 1X2NA 3I54A 4G7HF 3Q9SA 4CGRA 3OYBA 1YW9A 3GFLA 2XKOA 3K4NA 1Z3YA 3HKZA 3MWMA 1RRJA 2VJ4A 1DP7P 2QKMB 3K4KA 2JUCA 2BY0A 5KHDA 1Y1VJ 4A3GJ 2KLOA 1FEXA 1GXQA 4A3FJ 2OD5A 3IC7A 2XRLA 3VYSB 5FLXZ 5D8KB 1TTYA 3A1YA 1HW1A 1ZRFA 4ZDPA 2BHZA 4YFNF 3EQLF 3TOBA 5HODA 2IGMA 1S7EA 2TRTA 2DAOA 2Y31A 5F1JA 3EPZA 3OIQA 3NNRA 1ENHA 3OYAA 4B4CA 3MKWB 1TZLA 2TDXA 2GIZA 1IUFA 2VE9A 4XKBA 1XX5A 4E6KG 3RQ4A 1BI1A 2XSDC 1W1WE 3H3UA 3VYRB 3GTOJ 2IRFG 2VJIA 1QHGA 3JRAA 2M7BA 4M6YA 2K85A 2ZC2A 2XKPA 3RH2A 4DOZA 3WGGA 2FOKA 3ZRGA 3I56I 3BC8A 4L0YB 2P5KA 1XG1A 2CW0F 1Z1DA 1YW7A 1A6IA 1SD4A 3JCUC 3QYFA 3RJPA 1N77A 3S1MJ 3K7AJ 1XD7A 4N4OB 5B5EC 3MKZA 2PI0A 2DOEA 1Y6IA 2F4OB 3QP6A 2ZCNA 4LIUA 3TW6A 1EKEA 3WG7H 2VJ5A 2FF4A 4XRFA 1Z21A 2UZKA 2X9DA 2GQQA 1Y0UA 4EJOA 3FF5A 2DLLA 3DU6A 1UAAA 5EEHA 3VUQA 3B02A 2XAHA 1P4XA 4HW0A 4RGUA 4MTDA 3VEPA 1S72I 2DQRA 4NNJA 2EIJH 2Q0OA 1YJ9I 1JKQC 2Y0SN 3FMRA 2CMPA 4O5VA 4DIQA 3TMOA 3HC7A 3OYFA 2VJJA 2ISZA 4WX9A 1JUMA 2DTRA 3M8JA 2FBIA 1FIPA 3PL8A 4S05A 4AU7A 4L62A 2IU5A 3SDGA 1W36D 2XGDA 4Y17A 4Y13A 4HNVA 5EDNA 3K4LA 1AA7A 3Q0UA 2EFWA 1YG2A 2K3PA 2FRHA 2V1DA 1T0FA 2P4WA 2A07F 1I1SA 1DPRA 3M07A 2XSJC 4UXNA 4XN0A 2V57A 3HRSA 3NRGA 4RAYA 4Q47A 1U2WA 4I98B 4PGHA 3CUQA 2EB7A 4ZDLA 2UWMA 4RA2A 5J8FA 1YS6A 2MLGA 4EGYA 3AL0C 1QVTA 4L5JA 3DPUA 5FJ8J 4JX4A 3CO7C 3I4NJ 2R7WA 3OYHA 1V3FA 4CICA 3DEUA 3IH4A 3NXCA 3C2GA 5LHHA 4F7ZA 4PFPA 1P4WA 1SVLA 3PIPF 5FKKA 1R5ID 2EK5A 4CCKA 1QNTA 2O0YA 5KAFC 4CGZA 2CW7A 2UV1A 4DW6A 3A4CA 2DFEA 4E7KA 5B1AH 3LSHA 4HX8A 4ETSA 2EV5A 3M1EA 2YVXA 1NTCA 3MZHA 1UG2A 4KNYA 1FBQA 2A3SA 3X2QH 2P6TA 4IO9F 1W4MA 1Z91A 3CUQC 4GYGA 2R7ZJ 1Z7LA 3L2UA 2ZJRF 4XOPA 2XRNA 4RLFA 3LHQA 1V5FA 1IDYA 2KIQA 4MXMA 3HL2A 4MK6A 2G7UA 1GLNA 3GFJA 5CVJA 1R36A 1D8KA 3A02A 1K61A 2V4JC 3C2BA 4EATA 4A3EJ 3U21A 2XDVA 1YHQI 1IRXA 3DLAA 1AWCA 2IGNA 3PNVA 3I4MJ 2ZMEB 5CKTA 4U9NA 1H0MA 2GM4A 4G6QA 2QQBA 3HIFA 2NS0A 3ZMUA 4D5FA 2MH9A 2QSFX 1LE8B 4RDUA 4WK8F 1LNWA 3BG7A 4IOCF 5HLTA 3CP8A 3MMYB 3EYIA 1P4AA 5EG0B 3K8PC 3SYTA 2WAQN 1VQLI 4XLFA 1E2XA 2V9VA 4CCLA 4EM0B 2W24A 3E97A 1UJ8A 2GOMA 2IS6A 3HOTA 4ESBA 5FRNA 3VYUB 4CH7A 3WODF 4QSHA 2ECBA 4G7OF 2Z9OA 1OR7C 2ELKA 1AHDP 2JA7J 2J5OA 3E5XA 2DOFA 2DFFA 1T98A 4UVCA 1J75A 4BS9A 4B09A 1IO2A 4CYCA 5F27A 3PNTA 4RGXA 5IT9K 4ZYEA 1DU6A 2VB6A 3GTLJ 1FOWA 3D5LA 3LSPA 5FKOA 2JSPA 1B6AA 3TO9A 4ESFA 3LSRA 2WY8Q 3E6MA 3KP7A 5J40A 2QENA 2E1NA 1KQ0A 1XSXA 3CC2I 1WSUA 3VW1A 3HTHA 4OIOF 3S1QJ 1OYIA 4R79A 2ZJ2A 2W7NA 3S2WA 2M9HA 3LA7A 3HHHA 3M3YJ 3FKJA 2DCEA 1FP2A 1E3PA
chains in the Genus database with same CATH topology
3GEUA 4BY7J 2XB0X 2XB5A 1Z77A 3A01B 2R5ZB 5GPAA 4UUSA 1ETYA 4FISA 2D6YA 1B72B 2M34A 2XPVA 1AKHA 2R5YA 4A93J 5CXGA 5FKNA 3HDDA 4JKZA 5FGLA 3GTJJ 3HOWJ 1HF0A 3ANPA 3JRHA 3UKGA 3S2DJ 1ORKA 2HOAA 2JA5J 3BQYA 2H1KA 1JUSA 2XGCA 3V6GA 4I76A 1R9TJ 1ZQ3P 1JKPC 2DJNA 2G0EA 5D1RA 2ME6A 3HGYA 2PMZN 1DU0A 4DYRA 5CW8A 4A3BJ 3IV5A 1RESA 5IP7J 5E3MA 5J3LA 2JK3A 4A3DJ 4ACIA 3QKXA 3B81A 4AC6A 3DCFA 2FBQA 3TP3A 5IP6A 3G7RA 3HTAA 1ZTRA 5C3EJ 4M3GA 3AQSA 2IAIA 3COLA 1TWAJ 3FK6A 4NELA 4C3HJ 3EUPA 5C44J 1IRZA 2HQ5A 1JKOC 3RZOJ 4DZJA 5K7FA 3HBLA 5FKMA 2X48A 4GCLA 3GTPJ 3G1OA 1IJWC 2G7LA 5E3NA 2YU9J 3VW0A 3FKIJ 3Q0VA 1F43A 2XDNA 2O8KA 2NS8A 5J1YA 4V2GA 1T56A 2HXOA 2X6OA 3HEFA 3BR2A 1Q1VA 3GTQJ 2NOGA 3VPRA 3PO2J 2OI8A 2G7GA 2VI6A 3HTJA 1UHSA 4JYKA 4RBOA 5EZGA 5C4JJ 1BA5A 3C07A 2L7MP 2QIBA 1MBFA 1FTZA 2KT0A 2P81A 2AHQA 4MFEA 2FX0A 4BXXJ 2UXPA 2UXIA 2K9NA 3BT9A 5DS9A 5D18A 5EYRA 2OERA 3FISA 3JRBA 5FMPA 1E3OC 3BR0A 2LK2A 2GFNA 1JKRC 3ZQGA 1MBJA 2XGEA 2DA7A 2R0QC 3VOKA 2CUFA 5EGOA 1NK2P 3BHQA 1WCMJ 5K58A 1P7IA 1POGA 1JTYA 2IBDA 3O60A 3VVZA 3BG5A 1VF9A 2VKVA 4IHWA 2VPRA 4M3DA 5JLWA 9ANTA 1AKHB 2Y30A 2OPTA 3Q0WA 1ETKA 1BW5A 4DYQA 1HDDC 2K9QA 1ETVA 1MBEA 2ZCMA 1BL0A 1XC5A 1YRNA 1XS9A 2L9RA 1BJZA 2CJJA 4AUXA 3OSGA 1Y1WJ 1QRYA 4JL3A 4QIWN 1ETXA 3PASA 4MO7A 2ID6A 1MSEC 1OCTC 4X1EA 3LNQA 1GV2A 1VNDA 1GT0C 1YRNB 2JA6J 3JREA 3ZQIA 2EH3A 1O4XA 3D1NI 3BJBA 3M4OJ 3MVPA 3NARA 3GTGJ 1H88C 2H8RA 3RQIA 3NPIA 2RAEA 1HCRA 2W48A 2Y9ZA 2NVTJ 1K83J 2LTPA 1P7JA 1H89C 3EGQA 2WB1N 5F0CA 2M8GX 1UI6A 2E2HJ 2PBXA 1VFCA 4LOCA 4D7NA 4C3JJ 1W0UA 1RKWA 5J1UA 1FIAA 4BKXA 1I50J 1X2MA 3L1PA 3GTMJ 4I6ZA 2DA6A 3B6AA 4XRMA 1T33A 4A3MJ 4G12A 1TWHJ 3S15J 4BBRJ 2F07A 3GTKJ 2EZKA 2MGQA 4UDSA 4IHXA 3F0CA 4UUSB 3E7LA 3GBGA 1MBGA 2YUSA 3GZIA 2K40A 1APLC 1QVUA 2AO9A 2L7FP 3BTLA 4IEJA 2O9LA 5IOYA 2GUHA 4GFKA 3CDLA 4S0HB 4ABZA 1SGMA 1UI5A 5C4YA 4A3JJ 1IG7A 3OSFA 5J1RA 1RR7A 3BG9A 3JRDA 2ZOZA 3S2HJ 3B6CA 4M3FA 3CRJA 3ON4A 5BNGA 3HIMA 3VW2A 3O8GA 3VIBA 4JNNA 2E1OA 1CQTA 3H0GJ 2QKOA 1LFUP 2D5VA 4AC0A 1JJ6C 3HB9A 2ZCXA 3MKLA 4ICHA 4GCTA 2QCOA 2CU7A 3BG3A 2REKA 3QQAA 4QTRA 2MSYA 3BR6A 3JRGA 1B8IB 1MNMC 3SJMA 4XIDA 5K7HA 4GCKA 1TWCJ 4DZPA 2DMQA 2HOTA 5HAWA 2FJ1A 3ZQCA 1ETOA 1LE8A 3RD3A 3JRCA 2QWTA 5C4XJ 4J19A 1PUFB 3HOVJ 1JT0A 3S16J 4Y52J 3S1NJ 1FJLA 3V78A 4FE7A 2M0CA 4MFDA 2E2JJ 1RKTA 2R93J 2L7ZA 5F08A 2UXOA 3ON2A 2NVQJ 3VP5A 3PM1A 4BBSJ 2XPWA 1ZGWA 3ZQLA 5IYCJ 4A3LJ 5JLXA 1TC3C 2DG7A 3PPBA 1MH4A 2CQXA 4Y7NJ 3WHBA 2HYTA 1MBKA 2G3BA 2ZB9A 3VOXA 2DA5A 2PZ9A 1BW6A 2YVEA 2NX4A 2COBA 1IDZA 1PUFA 1WPKA 1GUUA 3HTIA 2DMTA 2LD5A 1TWGJ 3KZ9A 1GV5A 3VVYA 2R5ZA 2JA8J 4A3CJ 2EBIA 1IGNA 1MH3A 2HXIA 2NS7A 3VVXA 1X2NA 1U9NA 3IH3A 2QOPA 2LFBA 4CGRA 2NVXJ 5M5WJ 2EQRA 5HSZA 1Y1VJ 4A3GJ 3JR9A 1FEXA 3KKDA 4A3FJ 4X6AJ 3BCGA 2LR8A 4B3AA 3IH2A 2XRLA 1W0TA 5FHPA 1G2HA 5HODA 2MW8A 5EGOB 1S7EA 2TRTA 3HOXJ 5EZHA 2Y31A 5F1JA 1AU7A 2NP5A 1OJLA 2WGBA 3NNRA 1ENHA 2DMPA 2HDDA 2I10A 5EF6A 2DA4A 4B4CA 2EZIA 3BNIA 2YVHA 3QPLA 4JP0A 1IUFA 3O8HA 1B72A 5IPAA 2HKUA 2XSDC 4GFBA 3NI7A 3GTOJ 1WGXA 2ZOYA 2YS9A 3LSGA 1VI0A 2DA1A 1ZR4A 1WH7A 3JRAA 3IUVA 4M6VA 2VUMJ 3S14J 1JGGA 2K9SA 3RH2A 2MG4A 3BR3A 1HLVA 1XG1A 5FKLA 1A6IA 2WV1A 3A03A 2O7TA 1ETWA 3S1MJ 3K7AJ 2IEKA 4C2MJ 2RHAA 3CJDA 3OOUA 3MNLA 2ZCNA 3TW6A 2KDZA 1B8IA 4JX6A 2DMNA 3TEDA 1I6HJ 2NVYJ 3G1MA 2X9DA 5EFYA 2LKXA 2VKEA 5F04A 4XK4A 4NDLA 2FD5A 3HGGA 5F0FA 4D5CA 4M3EA 2LVSA 2CRGA 3VUQA 3FK7A 5HBUA 2GENA 3BR5A 1HOMA 2O7OA 1JKQC 5D19A 2Y0SN 2EZLA 3CCYA 5H9TA 4L5EA 1HDPA 5IP9J 1JUMA 2XPUA 1FIPA 2HI3A 4L62A 2QF7A 2IU5A 3S5RA 4AF5A 1ZR2A 3HOYJ 3F1BA 3SDGA 2XGDA 2M2EA 1ZKGA 4HNVA 5EDNA 1IV6A 4GFLA 3Q0UA 1RPWA 4XICA 3PO3J 3Q3SA 4B1RA 1I3QJ 2R92J 5M5YJ 2V57A 2HOSA 1SANA 5M3FJ 5FLMJ 5F0HA 3NRGA 1X58A 2Y9YA 4V2FA 4FTHA 3BR1A 4HKUA 2RASA 3ZOBA 2DTZA 3HM5A 3ZQHA 5K7ZA 2DMUA 3ANGA 4NN1A 3BTIA 1JJ8C 1QVTA 5FJ8J 4A3KJ 4JX4A 3I4NJ 3HKZN 4EEFG 4PXIA 3BRUA 3IH4A 3RKQA 3NXCA 1WH5A 3G1LA 3FRQA 2DG8A 2UXHA 2G7SA 3H3VK 2FQ4A 2TCTA 5FKKA 4C3IJ 1SFOJ 2R5YB 3HOZJ 2UXUA 4JX5A 1MSFC 3WHCA 1GDTA 3KKCA 4DW6A 1MBHA 1OFCX 5M3MJ 1Z0XA 2L0KA 2NP3A 4W1UA 3G56A 2JN6A 3E7QA 4MIMA 1NTCA 1LFBA 4MLOA 1UG2A 2B63J 2Y2ZA 2GLOA 3W6VA 2R7ZJ 2E19A 4W97A 5M5XJ 1ETQA 3DPJA 4FCYA 2HYJA 4KWAA 1JT6A 4FE4A 3K2AA 3LHQA 3FIWA 1IDYA 1RETA 3TW7A 1D5YA 4MXMA 4MK6A 4DYCA 5EEAA 3JRIA 3HE0A 3LJLA 5DTDA 3A02A 1K61A 4UUTA 5AQCA 3DEWA 3OIOA 5CXIA 3C2BA 4A3EJ 5E3LA 2JWTA 1NK3P 2ME0A 3BTCA 2LY9A 3I4MJ 1A5JA 2JMWA 5E3OA 3CMYA 2GM4A 2JJ7A 4D5FA 2Q24A 2ECCA 1LE8B 3RZDJ 5FLVA 4RDUA 3CWRA 1OCPA 2WUIA 3JSJA 1ITYA 4XRSA 1U9OA 3MN2A 1H8AC 4AYBN 5EG0B 1U8BA 2WAQN 2QTQA 3QBMA 2N8GA 2EZHA 3LSJA 1JTXA 4A69C 1UMQA 1U78A 3SFIA 3KNWA 4ME9A 1EF4A 1IC8A 5DAJA 1WI3A 4IHVA 2LLKA 4QSHA 2GBYA 2ECBA 4XRSG 1TWFJ 2CQQA 2ELKA 1AHDP 5IOZA 1QPIA 2JA7J 3S17J 2DA2A 4D7MA 3AQTA 3ZQFA 3QPSA 1FTTA 4CYCA 5F27A 4BY1J 2DN0A 4YZEA 5GP9A 1DU6A 5GPCA 3P9TA 3GTLJ 4M3BA 3TP0A 5IYBJ 3LSPA 1JUPA 3NAUA 5IYDJ 5FKOA 4IHYA 3LWJA 1ZK8A 2CUEA 3LSRA 3A01A 3JRFA 2ID3A 2LP0A 3BQZA 3VW1A 3HTHA 3CQZJ 4A3IJ 3S1QJ 1F36A 3BTJA 4CYCB 3S1RJ 2DA3A 3LOCA 5EG0A 1GVDA 2M9HA 3HOUJ 2W53A 2E2IJ 3M3YJ 2OF7A 3T6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEU A;  4BY7 J;  2XB0 X;  2XB5 A;  1Z77 A;  3A01 B;  2R5Z B;  5GPA A;  4UUS A;  1ETY A;  4FIS A;  2D6Y A;  1B72 B;  2M34 A;  2XPV A;  1AKH A;  2R5Y A;  4A93 J;  5CXG A;  5FKN A;  3HDD A;  4JKZ A;  5FGL A;  3GTJ J;  3HOW J;  1HF0 A;  3ANP A;  3JRH A;  3UKG A;  3S2D J;  1ORK A;  2HOA A;  2JA5 J;  3BQY A;  2H1K A;  1JUS A;  2XGC A;  3V6G A;  4I76 A;  1R9T J;  1ZQ3 P;  1JKP C;  2DJN A;  2G0E A;  5D1R A;  2ME6 A;  3HGY A;  2PMZ N;  1DU0 A;  4DYR A;  5CW8 A;  4A3B J;  3IV5 A;  1RES A;  5IP7 J;  5E3M A;  5J3L A;  2JK3 A;  4A3D J;  4ACI A;  3QKX A;  3B81 A;  4AC6 A;  3DCF A;  2FBQ A;  3TP3 A;  5IP6 A;  3G7R A;  3HTA A;  1ZTR A;  5C3E J;  4M3G A;  3AQS A;  2IAI A;  3COL A;  1TWA J;  3FK6 A;  4NEL A;  4C3H J;  3EUP A;  5C44 J;  1IRZ A;  2HQ5 A;  1JKO C;  3RZO J;  4DZJ A;  5K7F A;  3HBL A;  5FKM A;  2X48 A;  4GCL A;  3GTP J;  3G1O A;  1IJW C;  2G7L A;  5E3N A;  2YU9 J;  3VW0 A;  3FKI J;  3Q0V A;  1F43 A;  2XDN A;  2O8K A;  2NS8 A;  5J1Y A;  4V2G A;  1T56 A;  2HXO A;  2X6O A;  3HEF A;  3BR2 A;  1Q1V A;  3GTQ J;  2NOG A;  3VPR A;  3PO2 J;  2OI8 A;  2G7G A;  2VI6 A;  3HTJ A;  1UHS A;  4JYK A;  4RBO A;  5EZG A;  5C4J J;  1BA5 A;  3C07 A;  2L7M P;  2QIB A;  1MBF A;  1FTZ A;  2KT0 A;  2P81 A;  2AHQ A;  4MFE A;  2FX0 A;  4BXX J;  2UXP A;  2UXI A;  2K9N A;  3BT9 A;  5DS9 A;  5D18 A;  5EYR A;  2OER A;  3FIS A;  3JRB A;  5FMP A;  1E3O C;  3BR0 A;  2LK2 A;  2GFN A;  1JKR C;  3ZQG A;  1MBJ A;  2XGE A;  2DA7 A;  2R0Q C;  3VOK A;  2CUF A;  5EGO A;  1NK2 P;  3BHQ A;  1WCM J;  5K58 A;  1P7I A;  1POG A;  1JTY A;  2IBD A;  3O60 A;  3VVZ A;  3BG5 A;  1VF9 A;  2VKV A;  4IHW A;  2VPR A;  4M3D A;  5JLW A;  9ANT A;  1AKH B;  2Y30 A;  2OPT A;  3Q0W A;  1ETK A;  1BW5 A;  4DYQ A;  1HDD C;  2K9Q A;  1ETV A;  1MBE A;  2ZCM A;  1BL0 A;  1XC5 A;  1YRN A;  1XS9 A;  2L9R A;  1BJZ A;  2CJJ A;  4AUX A;  3OSG A;  1Y1W J;  1QRY A;  4JL3 A;  4QIW N;  1ETX A;  3PAS A;  4MO7 A;  2ID6 A;  1MSE C;  1OCT C;  4X1E A;  3LNQ A;  1GV2 A;  1VND A;  1GT0 C;  1YRN B;  2JA6 J;  3JRE A;  3ZQI A;  2EH3 A;  1O4X A;  3D1N I;  3BJB A;  3M4O J;  3MVP A;  3NAR A;  3GTG J;  1H88 C;  2H8R A;  3RQI A;  3NPI A;  2RAE A;  1HCR A;  2W48 A;  2Y9Z A;  2NVT J;  1K83 J;  2LTP A;  1P7J A;  1H89 C;  3EGQ A;  2WB1 N;  5F0C A;  2M8G X;  1UI6 A;  2E2H J;  2PBX A;  1VFC A;  4LOC A;  4D7N A;  4C3J J;  1W0U A;  1RKW A;  5J1U A;  1FIA A;  4BKX A;  1I50 J;  1X2M A;  3L1P A;  3GTM J;  4I6Z A;  2DA6 A;  3B6A A;  4XRM A;  1T33 A;  4A3M J;  4G12 A;  1TWH J;  3S15 J;  4BBR J;  2F07 A;  3GTK J;  2EZK A;  2MGQ A;  4UDS A;  4IHX A;  3F0C A;  4UUS B;  3E7L A;  3GBG A;  1MBG A;  2YUS A;  3GZI A;  2K40 A;  1APL C;  1QVU A;  2AO9 A;  2L7F P;  3BTL A;  4IEJ A;  2O9L A;  5IOY A;  2GUH A;  4GFK A;  3CDL A;  4S0H B;  4ABZ A;  1SGM A;  1UI5 A;  5C4Y A;  4A3J J;  1IG7 A;  3OSF A;  5J1R A;  1RR7 A;  3BG9 A;  3JRD A;  2ZOZ A;  3S2H J;  3B6C A;  4M3F A;  3CRJ A;  3ON4 A;  5BNG A;  3HIM A;  3VW2 A;  3O8G A;  3VIB A;  4JNN A;  2E1O A;  1CQT A;  3H0G J;  2QKO A;  1LFU P;  2D5V A;  4AC0 A;  1JJ6 C;  3HB9 A;  2ZCX A;  3MKL A;  4ICH A;  4GCT A;  2QCO A;  2CU7 A;  3BG3 A;  2REK A;  3QQA A;  4QTR A;  2MSY A;  3BR6 A;  3JRG A;  1B8I B;  1MNM C;  3SJM A;  4XID A;  5K7H A;  4GCK A;  1TWC J;  4DZP A;  2DMQ A;  2HOT A;  5HAW A;  2FJ1 A;  3ZQC A;  1ETO A;  1LE8 A;  3RD3 A;  3JRC A;  2QWT A;  5C4X J;  4J19 A;  1PUF B;  3HOV J;  1JT0 A;  3S16 J;  4Y52 J;  3S1N J;  1FJL A;  3V78 A;  4FE7 A;  2M0C A;  4MFD A;  2E2J J;  1RKT A;  2R93 J;  2L7Z A;  5F08 A;  2UXO A;  3ON2 A;  2NVQ J;  3VP5 A;  3PM1 A;  4BBS J;  2XPW A;  1ZGW A;  3ZQL A;  5IYC J;  4A3L J;  5JLX A;  1TC3 C;  2DG7 A;  3PPB A;  1MH4 A;  2CQX A;  4Y7N J;  3WHB A;  2HYT A;  1MBK A;  2G3B A;  2ZB9 A;  3VOX A;  2DA5 A;  2PZ9 A;  1BW6 A;  2YVE A;  2NX4 A;  2COB A;  1IDZ A;  1PUF A;  1WPK A;  1GUU A;  3HTI A;  2DMT A;  2LD5 A;  1TWG J;  3KZ9 A;  1GV5 A;  3VVY A;  2R5Z A;  2JA8 J;  4A3C J;  2EBI A;  1IGN A;  1MH3 A;  2HXI A;  2NS7 A;  3VVX A;  1X2N A;  1U9N A;  3IH3 A;  2QOP A;  2LFB A;  4CGR A;  2NVX J;  5M5W J;  2EQR A;  5HSZ A;  1Y1V J;  4A3G J;  3JR9 A;  1FEX A;  3KKD A;  4A3F J;  4X6A J;  3BCG A;  2LR8 A;  4B3A A;  3IH2 A;  2XRL A;  1W0T A;  5FHP A;  1G2H A;  5HOD A;  2MW8 A;  5EGO B;  1S7E A;  2TRT A;  3HOX J;  5EZH A;  2Y31 A;  5F1J A;  1AU7 A;  2NP5 A;  1OJL A;  2WGB A;  3NNR A;  1ENH A;  2DMP A;  2HDD A;  2I10 A;  5EF6 A;  2DA4 A;  4B4C A;  2EZI A;  3BNI A;  2YVH A;  3QPL A;  4JP0 A;  1IUF A;  3O8H A;  1B72 A;  5IPA A;  2HKU A;  2XSD C;  4GFB A;  3NI7 A;  3GTO J;  1WGX A;  2ZOY A;  2YS9 A;  3LSG A;  1VI0 A;  2DA1 A;  1ZR4 A;  1WH7 A;  3JRA A;  3IUV A;  4M6V A;  2VUM J;  3S14 J;  1JGG A;  2K9S A;  3RH2 A;  2MG4 A;  3BR3 A;  1HLV A;  1XG1 A;  5FKL A;  1A6I A;  2WV1 A;  3A03 A;  2O7T A;  1ETW A;  3S1M J;  3K7A J;  2IEK A;  4C2M J;  2RHA A;  3CJD A;  3OOU A;  3MNL A;  2ZCN A;  3TW6 A;  2KDZ A;  1B8I A;  4JX6 A;  2DMN A;  3TED A;  1I6H J;  2NVY J;  3G1M A;  2X9D A;  5EFY A;  2LKX A;  2VKE A;  5F04 A;  4XK4 A;  4NDL A;  2FD5 A;  3HGG A;  5F0F A;  4D5C A;  4M3E A;  2LVS A;  2CRG A;  3VUQ A;  3FK7 A;  5HBU A;  2GEN A;  3BR5 A;  1HOM A;  2O7O A;  1JKQ C;  5D19 A;  2Y0S N;  2EZL A;  3CCY A;  5H9T A;  4L5E A;  1HDP A;  5IP9 J;  1JUM A;  2XPU A;  1FIP A;  2HI3 A;  4L62 A;  2QF7 A;  2IU5 A;  3S5R A;  4AF5 A;  1ZR2 A;  3HOY J;  3F1B A;  3SDG A;  2XGD A;  2M2E A;  1ZKG A;  4HNV A;  5EDN A;  1IV6 A;  4GFL A;  3Q0U A;  1RPW A;  4XIC A;  3PO3 J;  3Q3S A;  4B1R A;  1I3Q J;  2R92 J;  5M5Y J;  2V57 A;  2HOS A;  1SAN A;  5M3F J;  5FLM J;  5F0H A;  3NRG A;  1X58 A;  2Y9Y A;  4V2F A;  4FTH A;  3BR1 A;  4HKU A;  2RAS A;  3ZOB A;  2DTZ A;  3HM5 A;  3ZQH A;  5K7Z A;  2DMU A;  3ANG A;  4NN1 A;  3BTI A;  1JJ8 C;  1QVT A;  5FJ8 J;  4A3K J;  4JX4 A;  3I4N J;  3HKZ N;  4EEF G;  4PXI A;  3BRU A;  3IH4 A;  3RKQ A;  3NXC A;  1WH5 A;  3G1L A;  3FRQ A;  2DG8 A;  2UXH A;  2G7S A;  3H3V K;  2FQ4 A;  2TCT A;  5FKK A;  4C3I J;  1SFO J;  2R5Y B;  3HOZ J;  2UXU A;  4JX5 A;  1MSF C;  3WHC A;  1GDT A;  3KKC A;  4DW6 A;  1MBH A;  1OFC X;  5M3M J;  1Z0X A;  2L0K A;  2NP3 A;  4W1U A;  3G56 A;  2JN6 A;  3E7Q A;  4MIM A;  1NTC A;  1LFB A;  4MLO A;  1UG2 A;  2B63 J;  2Y2Z A;  2GLO A;  3W6V A;  2R7Z J;  2E19 A;  4W97 A;  5M5X J;  1ETQ A;  3DPJ A;  4FCY A;  2HYJ A;  4KWA A;  1JT6 A;  4FE4 A;  3K2A A;  3LHQ A;  3FIW A;  1IDY A;  1RET A;  3TW7 A;  1D5Y A;  4MXM A;  4MK6 A;  4DYC A;  5EEA A;  3JRI A;  3HE0 A;  3LJL A;  5DTD A;  3A02 A;  1K61 A;  4UUT A;  5AQC A;  3DEW A;  3OIO A;  5CXI A;  3C2B A;  4A3E J;  5E3L A;  2JWT A;  1NK3 P;  2ME0 A;  3BTC A;  2LY9 A;  3I4M J;  1A5J A;  2JMW A;  5E3O A;  3CMY A;  2GM4 A;  2JJ7 A;  4D5F A;  2Q24 A;  2ECC A;  1LE8 B;  3RZD J;  5FLV A;  4RDU A;  3CWR A;  1OCP A;  2WUI A;  3JSJ A;  1ITY A;  4XRS A;  1U9O A;  3MN2 A;  1H8A C;  4AYB N;  5EG0 B;  1U8B A;  2WAQ N;  2QTQ A;  3QBM A;  2N8G A;  2EZH A;  3LSJ A;  1JTX A;  4A69 C;  1UMQ A;  1U78 A;  3SFI A;  3KNW A;  4ME9 A;  1EF4 A;  1IC8 A;  5DAJ A;  1WI3 A;  4IHV A;  2LLK A;  4QSH A;  2GBY A;  2ECB A;  4XRS G;  1TWF J;  2CQQ A;  2ELK A;  1AHD P;  5IOZ A;  1QPI A;  2JA7 J;  3S17 J;  2DA2 A;  4D7M A;  3AQT A;  3ZQF A;  3QPS A;  1FTT A;  4CYC A;  5F27 A;  4BY1 J;  2DN0 A;  4YZE A;  5GP9 A;  1DU6 A;  5GPC A;  3P9T A;  3GTL J;  4M3B A;  3TP0 A;  5IYB J;  3LSP A;  1JUP A;  3NAU A;  5IYD J;  5FKO A;  4IHY A;  3LWJ A;  1ZK8 A;  2CUE A;  3LSR A;  3A01 A;  3JRF A;  2ID3 A;  2LP0 A;  3BQZ A;  3VW1 A;  3HTH A;  3CQZ J;  4A3I J;  3S1Q J;  1F36 A;  3BTJ A;  4CYC B;  3S1R J;  2DA3 A;  3LOC A;  5EG0 A;  1GVD A;  2M9H A;  3HOU J;  2W53 A;  2E2I J;  3M3Y J;  2OF7 A;  3T6N A; 
#chains in the Genus database with same CATH topology
 3ZR8 X;  2OQR A;  3QPH A;  1FBS A;  4BY7 J;  5L3B A;  2XB0 X;  2XB5 A;  2QSH X;  4HF2 A;  2DQL A;  4UUS A;  1ETY A;  4FIS A;  1Y56 A;  3RKX A;  1B72 B;  2HEO A;  4P55 A;  1X1A A;  1D3Y A;  5CJ9 A;  1PVE A;  4F52 A;  1UEL B;  1J2X A;  1EJ9 A;  2FNA A;  2KKO A;  2P6S A;  1OMI A;  3IWZ A;  4MNU A;  4BYY A;  2XC7 A;  2NVU B;  2LF7 A;  3VDX A;  1B4A A;  1UHW A;  5ILS A;  2BV6 A;  2X1D A;  3HOW J;  1XB4 A;  1MJ9 A;  1ORK A;  2FA5 A;  2HVR A;  1WJF A;  4EQQ A;  4I76 A;  3H0D A;  3F21 A;  1D8J A;  2E71 A;  3EUA A;  3OYL A;  1JKP C;  4YII A;  2G0E A;  4NQW B;  5GAE J;  1IN6 A;  2ZSH B;  4XLH A;  2MC3 A;  2WBM A;  2HQA A;  3CO6 C;  5HDK A;  4BHC A;  2DPD A;  1BR1 A;  4ITV A;  3E6C C;  3O3K A;  1Z6T A;  4MTE A;  3FBN B;  2JA2 A;  3KIO A;  3MEX A;  3Q9V A;  2HFH A;  1QU3 A;  2LC2 A;  3QKX A;  3DCF A;  1SC7 A;  2ZBK A;  4RGS A;  3G7R A;  2AQE A;  5DYM A;  4HNU A;  2E5N A;  3LSK A;  1FY7 A;  3KE2 A;  1TWA J;  3FK6 A;  4R8H A;  5BPI A;  2VKH A;  3L2Q A;  1TP4 A;  1FWZ A;  2HQ5 A;  1IRZ A;  2D45 A;  3RZO J;  2DDA A;  5K7F A;  4NHJ A;  3CJT B;  5FKM A;  4F92 B;  3L09 A;  1X1P A;  4BXF A;  4IQ4 A;  2EIM H;  3VW0 A;  3MKY B;  2VQH A;  5FGM A;  3OYN A;  2WAQ A;  1QQI A;  4KN4 X;  4A6E A;  5J1Y A;  1T56 A;  3HEF A;  1Q1V A;  1FMV A;  1FPQ A;  2VI6 A;  4TV7 A;  1UHM A;  4II3 A;  2HQN A;  1K4S A;  4XOR A;  1JHF A;  2L7M P;  1W7P B;  1WFX A;  1A35 A;  1ON2 A;  5BQT A;  2XF5 A;  1FTZ A;  3PNY A;  2KT0 A;  2P81 A;  4Y33 A;  2FX0 A;  2UXI A;  4BXX J;  2MBF A;  1XMX A;  2K9N A;  5IY5 H;  1UFM A;  1LUJ B;  3BT9 A;  5DS9 A;  5D18 A;  5ICG A;  1UCR A;  2OER A;  1T0F C;  3FIS A;  5E79 C;  2OAZ A;  1D0X A;  1X1D A;  3GUD A;  3I64 A;  1JKR C;  4A0X A;  4AM3 A;  3J80 K;  2DA7 A;  3GME A;  1NH3 A;  2CUF A;  1NK2 P;  1POG A;  2FML A;  1G3S A;  3VVZ A;  2VBZ A;  3CJQ B;  4M3D A;  5HLH A;  5JLW A;  2ZKZ A;  2OPT A;  2ZXH A;  3Q0W A;  2K9Q A;  1ETV A;  3CJN A;  1LVA A;  4HOB A;  1XC5 A;  4L9T A;  1BL0 A;  2LKP A;  2HKX A;  5F64 A;  5KVR A;  1T38 A;  1ERD A;  1IUY A;  1G3W A;  1Y1W J;  1L0O C;  3PAS A;  2F48 A;  4MO7 A;  2ID6 A;  4X1E A;  1YRN B;  1PJR A;  5GAG J;  2EH3 A;  4BUP A;  3J81 K;  1O4X A;  3J81 Z;  2ESN A;  2K86 A;  3JSO A;  3M4O J;  2O5R A;  3K9T A;  1KU2 A;  5K5R A;  3WTX C;  1TBX A;  2H8R A;  3RQI A;  4KFC A;  4NB5 A;  1ONV A;  4M71 A;  3ULQ B;  2DYR H;  3W2W A;  4XBF A;  2VBY A;  2LTP A;  2DXI A;  1H89 C;  3GXO A;  3EGQ A;  4KT5 C;  1J7K A;  2IXS A;  3IP4 B;  2F5C A;  3VYT B;  4CCM A;  2HVQ A;  2E2H J;  1G3T A;  4XNF A;  1VFC A;  2PBX A;  3HUG B;  2E1M B;  1D0Z A;  4BGD A;  4D7N A;  1ZRD A;  4LB5 A;  1RKW A;  4BKX A;  4QPQ A;  3L1P A;  2K4J A;  1MZB A;  3KEO A;  3VB2 A;  3LQR A;  4A3M J;  1ZGA A;  1W7P D;  3MCZ A;  4G12 A;  1MMA A;  3OWT A;  2EZK A;  2MGQ A;  1YI2 I;  3C2H A;  4HF1 A;  1IXC A;  1GHC A;  1MGT A;  3PFI A;  3ERE D;  1MD0 A;  1APL C;  2L7F P;  2ZXW H;  4BEH A;  2O9L A;  1SGM A;  2BZT A;  1UI5 A;  1ZRE A;  1IG7 A;  4A0Z A;  5J1R A;  2DK8 A;  1RR7 A;  3OSF A;  3JRD A;  4FAS D;  1FBU A;  1Y0N A;  1YW8 A;  4OAY A;  4WXD A;  3HIM A;  5LFA A;  3COA C;  1SD6 A;  3SXY A;  1X19 A;  1YOV B;  1O7F A;  5FB2 A;  2DPU A;  1G3Y A;  1KON A;  2EA4 A;  1MW7 A;  2LG4 A;  2D5V A;  4ICH A;  2QUF A;  3GX4 X;  1S7A A;  5D6F A;  5K5Q A;  2ZFW A;  4RB1 A;  4BE0 A;  3HTS B;  2MSY A;  1W5T A;  2AXL A;  3JRG A;  3CUO A;  2WAD A;  2F4M B;  5KK1 A;  2HOT A;  5HAW A;  2DO7 A;  3WU1 B;  1ZEL A;  2IT0 A;  3K1P A;  3CMA I;  1PUF B;  1K7A A;  3WG9 A;  4UNO A;  3HOV J;  3S16 J;  1FLI A;  1FJL A;  1VQK I;  4FE7 A;  4I7H A;  3ON2 A;  3ZMD A;  2A05 A;  2NVQ J;  1VZ0 A;  5D6E A;  2BBY A;  2VC0 A;  2XPW A;  1SVO A;  2ELJ A;  3KLN A;  1FSE A;  3ZQL A;  4A3L J;  1XCB A;  4OAZ A;  3OYC A;  4GYI A;  2KZG A;  3WTS C;  3F8M A;  5KNL A;  2G3B A;  4LG0 A;  1KGS A;  4M6X A;  1BW6 A;  3VSL A;  2YVE A;  2COB A;  2P8T A;  3SDB A;  2QYO A;  5TIS C;  2RVC A;  3BJA A;  1YO5 C;  4M72 A;  1S7O A;  1UZC A;  2H8W A;  2RQP A;  5CQG A;  3LAJ A;  2EFP A;  1RUO A;  3CTA A;  3I5U A;  1GV5 A;  4X0G A;  4A3C J;  3OS2 A;  2O61 A;  2NS7 A;  1T2K A;  3QP5 A;  4HG2 A;  2QWW A;  5DCM B;  3ZMV A;  4O3M A;  2QQA A;  2JRT A;  2LFB A;  4U9L A;  1F5T A;  2A69 F;  2EWN A;  5M5W J;  1D0Y A;  2YPR A;  3I55 I;  1R00 A;  3SEQ A;  1H9T A;  2R7S A;  1KU9 A;  4FT8 A;  5HSZ A;  4YEL A;  1SMY F;  5CVR A;  4XKW A;  5DUK A;  4AIK A;  4KJZ A;  4G7Z F;  2VXD A;  4B3A A;  2DT6 A;  3IH2 A;  4L9V A;  1XTA A;  1LDK B;  1G2H A;  2WAE A;  5EGO B;  1N25 A;  2MW8 A;  2VQL A;  4PJN A;  3RI4 A;  2F5V A;  5EZH A;  2HOE A;  4XLA A;  4GRI A;  1BOA A;  3HUG A;  2WGB A;  2DMP A;  2IA0 A;  5HS8 A;  2HDD A;  5EF6 A;  2XF7 A;  3ELK A;  2JT1 A;  2EZI A;  3S3M A;  5J8C A;  1CF7 B;  1R5G A;  3PSI A;  1W5C C;  1B72 A;  2E34 A;  3JSP A;  1Z05 A;  1IN5 A;  2ZY9 A;  2YS9 A;  1VI0 A;  2DA1 A;  2HR3 A;  4M6V A;  2MG4 A;  1IF1 A;  5LLQ A;  3BR3 A;  4XLE A;  1QPM A;  4NC8 A;  1B1B A;  4OU0 A;  1WQ2 A;  5FKL A;  4KMU X;  3BLY A;  4BQQ A;  2XF6 A;  2GXA A;  4HQE A;  2O7T A;  4FHT A;  5E1W A;  3BJO A;  2RHA A;  4E7I A;  2L9V A;  2OQG A;  4DGW B;  1HKS A;  2KDZ A;  1XMK A;  4N9H A;  4PCQ A;  4O6J A;  4KIS A;  4JX6 A;  1I6H J;  3TED A;  4HDV A;  1PP8 F;  2BGC A;  2LKX A;  4XK4 A;  4IL6 C;  2FD5 A;  2H09 A;  3ZN1 A;  3HYI A;  3QPT A;  2LVS A;  2P5L C;  3FK7 A;  3CCL I;  5HBU A;  3BR5 A;  2IW5 A;  2O7O A;  3VOE A;  1X1B A;  2EZL A;  2E60 A;  2EV6 A;  3L9F A;  4CCN A;  4BQA A;  5IP9 J;  2MLK A;  2XPU A;  1BC8 C;  3JAM Z;  2HI3 A;  4BAY A;  1I3A A;  3L2W A;  3CCV I;  3W2A A;  1S6L A;  3S5R A;  2VT3 A;  4AF5 A;  3F1B A;  4BE2 A;  4FQG A;  4ZDO A;  3H1C A;  1ZAR A;  1QBJ A;  2EIL H;  2R92 J;  2YSR A;  3BPV A;  4AVZ A;  2HTJ A;  1DQU A;  1YLF A;  2RRE A;  3HRU A;  3RYR A;  2R7F A;  3WU2 C;  3FXU A;  2JVG A;  4FTH A;  3KFW X;  3ASO H;  4HV5 A;  2RAS A;  1IN8 A;  1WZ2 A;  2X1E A;  3BY6 A;  1J0R A;  1MMG A;  2DOA A;  3S93 A;  1WVR A;  1JJ8 C;  1XGN A;  3F9K A;  1BC7 C;  3HKZ N;  2XAS A;  1OQY A;  4EEF G;  2VOO A;  4EGZ A;  3RKQ A;  3DP7 A;  4PXI A;  3QOE A;  3G1L A;  3FRQ A;  1LB2 A;  2DG8 A;  2UXH A;  2G7S A;  5HLG A;  4PJM A;  2TCT A;  4C3I J;  2VC1 A;  4LK1 F;  2ZME C;  2VL8 A;  3ERM A;  2DT7 B;  2HPM A;  4BJ6 C;  3L2R A;  3C18 A;  4JX5 A;  2GZW A;  1GDT A;  3KKC A;  1OCR H;  1RC9 A;  1MBH A;  1OFC X;  3C7J A;  3IRR A;  2NP3 A;  4W1U A;  4YEJ A;  3A0B C;  2JN6 A;  3MFK A;  2LRD A;  5EJC A;  2B63 J;  2E19 A;  4W97 A;  5K1Y A;  4FCY A;  4E7Z A;  4B44 A;  3I3L A;  1JT6 A;  2A61 A;  1XMA A;  3G4S I;  3F6O A;  1RET A;  3DTI A;  3TW7 A;  2G7H A;  4I99 C;  4Q48 A;  1DGR M;  3OS1 A;  4ZYD A;  4A6D A;  1LEB A;  2CW8 A;  1Z3X A;  4RM2 A;  3RDI A;  1NK3 P;  3HSR A;  2R3S A;  2ME0 A;  1MNE A;  2LY9 A;  2B3W A;  2BW3 A;  3CES A;  5JFR A;  4CHU A;  4DQ2 A;  2FOW A;  3K69 A;  3RZD J;  5FLV A;  2DK5 A;  1JGS A;  1F1Z A;  2HS5 A;  3J80 Z;  4NC7 A;  2WUI A;  4XRS A;  3MN2 A;  4N9I A;  1U8B A;  3CDH A;  4HX4 A;  2NXN B;  3BCB A;  2V79 A;  2EZH A;  1WJE A;  4A69 C;  5DD4 A;  1U78 A;  3SFI A;  3OMY A;  4ME9 A;  2QM3 A;  4MEY F;  1XDU A;  1YX3 A;  4OOI A;  4OMY A;  2OJE D;  4IHV A;  1B9N A;  2LLK A;  4CCO A;  1J9I A;  4XRS G;  3IWF A;  1TWF J;  1ACI A;  2W85 A;  2BXY A;  2ZJP F;  5IOZ A;  3S17 J;  3H5R A;  4D7M A;  3NRV A;  1FTT A;  1VQ9 I;  4ZTJ A;  4PFO A;  1J5Y A;  2BXZ A;  2VOD A;  2ADU A;  4Y15 A;  2DN0 A;  5GP9 A;  3R6S A;  1FYM A;  2L9N A;  2VAS A;  5IYD J;  3DTK A;  1JUP A;  4XON A;  4IHY A;  4RB2 C;  1ZK8 A;  3FXM A;  4CA0 A;  3V7S A;  1A04 A;  4ENK A;  3ABK H;  3FXK A;  3ASN H;  1I1G A;  2XUB A;  3U2R A;  2LY2 A;  1KZH A;  2LH9 A;  4XN3 A;  1V5E A;  1WJD A;  4BEH B;  3BTJ A;  4JOM A;  1X1C A;  4EM2 A;  2CO5 A;  4H0E A;  1GVD A;  1ULY A;  2LBF B;  1XSV A;  2BY2 A;  1G8X A;  2OF7 A;  2KIM A;  3F8B A;  1I5Z A;  2M34 A;  4CO8 A;  4HYE A;  4RAF A;  5ERI A;  1RUN A;  5CXG A;  1SFK A;  2VKD A;  4AVP A;  2IA2 A;  5D5W B;  1XCV A;  1R58 A;  4JKZ A;  3GWZ A;  5D5X B;  1HF0 A;  2DYS H;  3OV8 A;  1YIO A;  2XAU A;  3M8F A;  3S2D J;  2HOA A;  1TT5 B;  2JA5 J;  3BQY A;  3MZY A;  3U9G A;  2DOD A;  5GTH C;  2Y0S A;  1WJ5 A;  3LQQ A;  1X3U A;  4IX7 A;  1A6Q A;  4RAZ A;  2ZNY A;  3K1M A;  3ML6 A;  4FX4 A;  1ZQ3 P;  2DJN A;  2YU3 A;  2W25 A;  4B3X A;  3ZP5 A;  2VQC A;  2CYY A;  4HZF A;  4XLC A;  3HGY A;  2PMZ N;  2P7C B;  1FC3 A;  4LK0 F;  3F6V A;  5CPR B;  1FT9 A;  1KYZ A;  1RES A;  4HST A;  5IP7 J;  2MD5 A;  1OYW A;  1TQI A;  4RLQ A;  4ON0 A;  3G6E I;  4ACI A;  2IGO A;  4KIC A;  2KDO A;  3KP4 A;  2FXA A;  2WV0 A;  3TP3 A;  1JI8 A;  2FBQ A;  4GDF A;  2LKS A;  5C3E J;  1O3R A;  1I6X A;  4M3G A;  4ZYH A;  4OIP F;  3COL A;  2RQQ A;  3ECO A;  4UV8 A;  4D9J A;  3WTW C;  1XN7 A;  2KHM A;  3OYE A;  4CZC A;  2CWE A;  2L01 A;  1HQC A;  3H9J A;  4DZJ A;  1QHH D;  1SVM A;  3L2V A;  1WKM A;  5H6Q A;  4BE1 A;  4PGG A;  4CSW A;  2X48 A;  6PAX A;  4DBQ A;  3I0T A;  1IJW C;  4ZJZ A;  2LY1 A;  1R1V A;  4IPA A;  5E3N A;  4HV6 A;  2YU9 J;  2G7L A;  3FKI J;  2XAF A;  3FX3 A;  3ONQ A;  3L2C A;  3I58 A;  2X6O A;  2HVS A;  2OBP A;  1K78 A;  2G7G A;  4HBL A;  4LLL A;  1UHS A;  3GZN B;  4JYK A;  5EZG A;  3C07 A;  3S3N A;  2I5U A;  5H6R A;  2OA4 A;  4HNT A;  1TT0 A;  2EA2 A;  4D1Q A;  4Y3O A;  3VOD A;  5BS6 A;  1VTN C;  1HW2 A;  3O6B B;  4MFE A;  2UXP A;  4NBQ A;  4E7J A;  4LIT A;  4II2 A;  4GCV A;  5EYR A;  1GVJ A;  2LDU A;  2CS3 A;  3TKY A;  4XR6 A;  5FRM A;  2XGE A;  2Z1D A;  2R0Q C;  1WCM J;  4IHS A;  1P7I A;  2HYF A;  5TGT A;  1FMW A;  2YR2 A;  4B48 A;  3WGH A;  2IS1 A;  3DEE A;  5DDG A;  3W3C A;  1EA3 A;  5DCM A;  4IHW A;  3U1K A;  9ANT A;  4XSZ F;  3OS0 A;  1HDD C;  2ZCM A;  3ECH A;  3QU3 A;  3SQN A;  1EH7 A;  5A2Q K;  1LPQ A;  1YRN A;  3I71 A;  2L9R A;  1BJZ A;  2OC6 A;  4AUX A;  3OSG A;  1QRY A;  4NC6 A;  3LSM A;  4G94 A;  1CGP A;  5E8G A;  2ZJQ F;  2IJL A;  2V9P A;  1GV2 A;  4C9Y A;  5FD5 A;  1BI2 A;  3ZQI A;  1WRJ A;  3BWG A;  1USS A;  2V6C A;  3D5S C;  3OR1 C;  3BJB A;  1K6O A;  3MVP A;  3GTG J;  5KAI C;  1WWX A;  3C1D A;  4NQW A;  1QZZ A;  2W48 A;  4HQM A;  2Y9Z A;  3HRM A;  2PN6 A;  2E36 A;  1LKX A;  1BOB A;  1P7J A;  4A5M A;  3EUH A;  3MQ0 A;  5DD8 A;  3UR3 C;  3BJ6 A;  4LOC A;  2VPL A;  5J4Y A;  5J1U A;  2V26 A;  3ABU A;  2V7F A;  1I50 J;  1X2M A;  2L54 A;  4I6Z A;  2DA6 A;  2EJR A;  2QZ8 A;  2PQ8 A;  3OL4 A;  3PQJ A;  2C6Y A;  2DU9 A;  4BBR J;  3SHF A;  2NNN A;  2F4I A;  3CUQ B;  4BL0 B;  2F07 A;  3ZN0 A;  4UDS A;  3F0C A;  3OIP A;  1Z9C A;  3CD6 I;  3VWB A;  1N78 A;  2H27 A;  4UUS B;  2R7V A;  3E7L A;  3GBG A;  1MBG A;  4IRG A;  1Z7U A;  3GZI A;  2K40 A;  2BOL A;  3CDI A;  2XRO A;  3CDL A;  4S0H B;  1L3L A;  5C4Y A;  2FQ3 A;  4A3J J;  4BDY A;  2JSC A;  2M0M A;  2BVL A;  4E70 A;  5EEG A;  3VW2 A;  4IKF A;  2VT2 A;  3TL4 X;  1V4R A;  4N0B A;  1QZE A;  1O3Q A;  2QKO A;  3REO A;  3ABT A;  2PJP A;  1BN5 A;  3MKL A;  2QGU A;  2QSG X;  2QCO A;  3ZPL A;  1KQ9 A;  1IW7 F;  3BG3 A;  2R4G A;  3LL7 A;  3QQA A;  3E3V A;  3I59 B;  1DP3 A;  3F22 A;  4ENM A;  3LA3 A;  1B8I B;  4LFU A;  1PYV A;  3BP8 A;  3CCS I;  3SJM A;  2VOP A;  5IT9 Z;  5K7H A;  2KL4 A;  1TWC J;  2PBI A;  3VFZ A;  4J00 A;  1QA6 A;  1BM9 A;  4JQF A;  1ETO A;  2NAZ A;  3PSF A;  3E1S A;  3RD3 A;  1K4T A;  2QWT A;  2W82 A;  3SZP A;  1VQM I;  2KRF A;  3RYP A;  1SAX A;  2A6H F;  2NRA C;  5CYV A;  5E18 F;  1OR7 A;  4PDK A;  4XLN F;  3S1N J;  3GF2 A;  3M7G A;  2M0C A;  4MFD A;  1RKT A;  1M1E B;  3P9K A;  3WTV C;  4BBS J;  2X1C A;  1ZGW A;  5IYC J;  2DG7 A;  4BHB A;  2PMZ A;  3WTU C;  2FUG 2;  3H9G A;  3H92 A;  2HYT A;  1OCC H;  2M7A A;  3J7Y J;  1V54 H;  3BG6 A;  2ZB9 A;  5CVU A;  3VOX A;  1FOX A;  2DA5 A;  3NS4 A;  4H4K C;  4IVN A;  1IDZ A;  3RPQ A;  5JVG F;  2DMT A;  4HA8 A;  3RPU A;  4BH9 A;  1TWG J;  1F4K A;  2LSO A;  2UXN A;  1ZLK A;  4IRI A;  1YX5 A;  2FSW A;  3VVY A;  2L3D A;  2Z3Y A;  2JA8 J;  3H5N A;  3RCO A;  3K70 D;  3VVX A;  1S5L C;  1U3E M;  2GIV A;  1U9N A;  3IH3 A;  3L7W A;  1SEU A;  1WHU A;  2EQR A;  2A6T A;  2HZT A;  3K1N A;  3ESW B;  4BU2 A;  4U0V A;  5J4V A;  4ZZL A;  3JR9 A;  3KKD A;  4I2O A;  5ICC A;  4P9F A;  1A31 A;  2HDC A;  2P0W A;  5FHP A;  1B59 A;  2JZY A;  4YIR X;  4F91 B;  2HTS A;  3JTH A;  4A0Y A;  2CGP A;  1OJL A;  4KN7 X;  4B47 A;  4WWC A;  2DA4 A;  3DF8 A;  2I8D A;  5CVI A;  3ZMT A;  3BNI A;  3TOA A;  4JP0 A;  4C2T A;  3T1B A;  3IAS 2;  3K6G A;  2HKU A;  4GFB A;  3NI7 A;  2A5W A;  2STT A;  3LSG A;  2ZOY A;  2FU4 A;  1NG7 A;  5GAH J;  1WH7 A;  1ZR4 A;  5LD2 C;  3AAF A;  2VUM J;  2D2W A;  2VXZ A;  4UVB A;  1E0E A;  5ILV A;  2Y75 A;  5ICE A;  5LRR A;  1IZ1 A;  2WV1 A;  5DM7 F;  3DKX A;  2IEK A;  1A36 A;  2LMD A;  4D0P A;  1O3T A;  3MNL A;  3I9V 2;  4ANJ A;  3MZ8 A;  1YIJ I;  4LIV A;  1KYW A;  3GFI A;  1JHH A;  1B8I A;  2KPM A;  2BE5 F;  2R7Q A;  3G1M A;  3K4B A;  5EFY A;  4NDL A;  4RAG A;  5ICF A;  3HGG A;  3G71 I;  4D5C A;  2CRG A;  4IZZ A;  1R23 A;  2DW4 A;  2GEN A;  2MAB A;  1HOM A;  1STZ A;  4K2E A;  3PFY A;  3SEZ A;  1K78 B;  3KZI C;  5H9T A;  1HDP A;  1DUX C;  2K3F A;  3DFG A;  4G8X A;  3MD2 A;  2RNJ A;  2R7R A;  3ZMZ A;  1OCZ H;  4V19 K;  5JI6 A;  5D4R A;  2KRC A;  1ZR2 A;  2ISY A;  1F9N A;  3ZXS A;  4CCJ A;  3J7A O;  4LD5 A;  1ZKG A;  4GFL A;  3G2B A;  1RPW A;  2PX9 A;  3N4M A;  3Q3S A;  1G6N A;  1U6G A;  3KYD B;  2RNG A;  2HNH A;  3H35 A;  3U1D A;  1Y8Q B;  2M8E A;  4KIF A;  3ZMS A;  5M5Y J;  1H9G A;  1SAN A;  2EFO A;  4YIF A;  3NWS A;  1ZG3 A;  1WI9 A;  5F0H A;  4IJA A;  5FLM J;  1X58 A;  4PSW A;  1P6R A;  1FP1 D;  1YE9 A;  2JPB A;  4BQN A;  4HKU A;  1LDJ A;  3ZOB A;  2FMY A;  3HM5 A;  5K7Z A;  2DMU A;  4NN1 A;  2A5Y B;  1VQO I;  3HPG A;  4QWQ A;  4A3K J;  2K27 A;  3P9C A;  2KJC A;  3AG3 H;  3HSF A;  4XOT A;  1WH5 A;  2X85 A;  3R60 A;  1ODD A;  1BI0 A;  2G9W A;  3T8T A;  1SFO J;  2HZD A;  2R5Y B;  2AXT C;  4B43 A;  1EV7 A;  3HOZ J;  2PFV A;  3I53 A;  4LLG F;  2HWV A;  3O2P E;  2M4K A;  3K0L A;  1YS7 A;  2IP2 A;  3PQK A;  4BXU A;  3RSN A;  1V55 H;  2F6C A;  2L0K A;  3VTI A;  1YTY A;  3E7Q A;  2F5D A;  4MIM A;  2OV7 A;  4MLO A;  1UG0 A;  4HPQ A;  2Y2Z A;  1SFU A;  4AD9 A;  3CMM A;  1XSD A;  1ETQ A;  4QPO A;  1G59 A;  2QA4 I;  1QGP A;  2HYJ A;  4KWA A;  4FE4 A;  3H9Q A;  3EUK L;  4UB8 C;  1D5Y A;  2UUZ A;  2ICW G;  4MEX F;  3TDZ C;  1FOY A;  4DYC A;  5EEA A;  3HE0 A;  5DTD A;  3LJL A;  2RV8 A;  4UUT A;  1FSH A;  2LOO A;  1MJA A;  5L3D A;  3FXO A;  3CCJ I;  2E1C A;  2PEX A;  3TDU C;  1ZLJ A;  1R49 A;  3ZGK A;  3TGN A;  5E3O A;  4IF4 A;  1A5J A;  2WTE A;  4WIB A;  3PJR A;  2JJ7 A;  2PLY A;  3CCE I;  4I02 A;  4YRV A;  5E17 F;  3JSJ A;  1IN4 A;  2QLZ A;  3AG2 H;  2QTQ A;  4XMY A;  5BPD A;  1U0J A;  2R7O A;  3DBL B;  3LSJ A;  4CZZ A;  1TNT A;  1KU7 A;  2K9M A;  1UMQ A;  4OD5 A;  3ZQQ A;  3OYJ A;  4U87 A;  1EF4 A;  4PJJ A;  1WI3 A;  2ESH A;  4I01 A;  3K4C A;  2GBY A;  2MD0 A;  2KJB A;  3WE2 A;  2CQQ A;  3E0J B;  5HVQ C;  2MYS A;  4JK1 X;  2P7V B;  2BY3 A;  3K4J A;  4U0Y A;  2OTJ I;  1ZG1 A;  3LSI A;  2L4A A;  5E20 A;  4BY1 J;  1PUE E;  3AFH A;  4YZE A;  1MDM A;  3RTR A;  1RZ4 A;  4M3B A;  3TP0 A;  5IYB J;  3LWJ A;  2CG4 A;  3NAU A;  2RC4 A;  2CUE A;  3GLL A;  2LP0 A;  3BQZ A;  3P7N A;  1T08 B;  2B0L A;  2RDP A;  1W5S A;  1YYV A;  4LJZ F;  3WTY C;  3W2V A;  3EET A;  1F36 A;  3GW2 A;  3WU0 A;  1PDN C;  1HW5 A;  2DA3 A;  2DFH A;  3A2K A;  2B9S A;  2W53 A;  3TQN A;  3LWF A;  3GEU A;  1OLT A;  1S29 A;  1K79 A;  1UST A;  1Z77 A;  5GPA A;  3V8K A;  5FO5 A;  1MIJ A;  5BOX A;  4I0B A;  3LFK A;  3V8L A;  5D5V B;  3QAH A;  2XPV A;  4WXH A;  1AKH A;  4P96 A;  1RI7 A;  1R4N B;  4L9N A;  1VQP I;  4S04 A;  1LVK A;  2K5C A;  3HDD A;  4LB6 B;  1IN7 A;  1FNN A;  3ANP A;  3JRH A;  1WJA A;  2PMH A;  3UKG A;  1TW3 A;  3BZK A;  3DTE A;  3KEY A;  1E3H A;  3K4M A;  1JUS A;  3DU5 A;  3CF2 A;  3FZV A;  3KP5 A;  1HSJ A;  3A0H C;  4A2U A;  3DBH B;  4C30 A;  1LDD A;  2ME6 A;  3ABL H;  4DYR A;  5CW8 A;  2V6E A;  3FM3 A;  2ZSI B;  5D8L B;  2KFD A;  4PJL A;  2WAF A;  3HHG A;  2M30 A;  5J3L A;  3KP3 A;  3DV8 A;  2JK3 A;  3FHZ A;  1TQM A;  2X6Y A;  4CDG A;  1VQ4 I;  3FMS A;  4OD4 A;  1P2F A;  1OYY A;  3B81 A;  5CVV A;  3KCC A;  4G6D A;  2IPQ X;  4L5I A;  5HNF A;  3T6N A;  3T5X A;  3HZJ A;  4NEL A;  2W4S A;  3C3W A;  4C3H J;  2ELH A;  1TW2 A;  2Y69 H;  2KRH A;  2FBH A;  4Z2Y A;  5LHI A;  5C44 J;  3CCU I;  1JKO C;  4KMF A;  3HBL A;  5K5O A;  4FET A;  2DDB A;  4GCL A;  3G1O A;  4XKV A;  3KYL A;  3GVA A;  5AIQ A;  2NS8 A;  2LYC A;  1HKQ A;  2HXO A;  5E1Z B;  3VPR A;  5GAD J;  3PO2 J;  3HTJ A;  3E5Q A;  2O3F A;  5JHF A;  1BA5 A;  2Z99 A;  3V42 A;  2QIB A;  1MBF A;  4CXF A;  2Q2E A;  2AHQ A;  1YFH A;  5L3C A;  2CQ7 A;  4EVI A;  1RIO H;  4AIJ A;  1X4O A;  1P92 A;  4AWX B;  1T8I A;  2CH0 A;  4P5O A;  5B1B H;  4ZH4 F;  3JRB A;  4PK4 A;  1E3O C;  3BR0 A;  1MDM B;  3N97 A;  1O7L A;  4L9J A;  3S8P A;  4DBR A;  2IS4 A;  4A5N A;  3VOK A;  5EGO A;  4KIG A;  1G4D A;  1MMS A;  2IBD A;  3BG5 A;  3KP2 A;  2MH2 A;  5B3S H;  2VPR A;  1ETK A;  5H20 A;  2COM A;  4DYQ A;  1MBE A;  1D1A A;  2OUM A;  2F2E A;  1XS9 A;  1Z67 A;  2CJJ A;  3EYY A;  1KA8 A;  5D5U B;  1B9M A;  1R7J A;  4JL3 A;  4RMN A;  3R0A A;  1ETX A;  2K02 A;  5HS9 A;  4GXO A;  3R61 A;  3QYB A;  1MSE C;  3LNQ A;  1VND A;  4HLY A;  2JA6 J;  3SZT A;  4DNC A;  3WGI A;  2NYX A;  3RIR A;  5LBQ A;  3D1N I;  3UNG C;  2V1X A;  3OR2 C;  2RAE A;  4U88 A;  4ASN A;  4P1W A;  2OCC H;  4FX0 A;  1T95 A;  2FEZ A;  4NUB A;  3K2Z A;  2GA1 A;  3DPT A;  5AON A;  2KQR A;  1MJB A;  3F3X A;  5HDN A;  2K9L A;  5F0C A;  2M8G X;  2E5Z A;  1YQA A;  4ZC3 A;  1ZRC A;  4F93 B;  4ENJ A;  1OIS A;  2K7L A;  4C3J J;  1W0U A;  1FIA A;  3NEU A;  3GTM J;  2XGX A;  3CJR B;  4XRM A;  1T33 A;  3ISP A;  2WC2 A;  1C0W A;  5D4S A;  2QKL B;  4I0A A;  3S15 J;  2HGC A;  3JTG A;  4U0W A;  3GTK J;  4IHX A;  1MKM A;  2QVO A;  3JAM K;  2YUS A;  3IKV A;  2DJI A;  4XM3 A;  4BJ5 C;  2AO9 A;  4IEJ A;  4M9Z A;  2CFX A;  3BCA A;  3AL0 B;  1TLH B;  2ZOZ A;  1HST A;  1P9Q C;  4M3F A;  3LAP A;  3ON4 A;  3BRO A;  3AG4 H;  4OIN F;  5LEK A;  3O8G A;  3VIB A;  3K70 C;  4E7L A;  4JNN A;  2EIN H;  1U5T B;  2E1O A;  3H0G J;  4IHT A;  5H2F C;  2O8X A;  5J6X A;  2ZCX A;  2X0L A;  2MC4 A;  4GCT A;  1BI3 A;  1GXP A;  2WB1 A;  2DI3 A;  3J7Z I;  2W84 A;  5KCM A;  3N05 A;  4F3Q A;  3OY9 A;  4QTR A;  3CP2 A;  3G73 A;  4PZJ A;  4RM3 A;  2PJR A;  1K6Y A;  4XID A;  4LMY A;  2R7X A;  3HJE A;  4GCK A;  4DZP A;  2DMQ A;  2FJ1 A;  1J09 A;  5FD6 A;  3HSE A;  3P9I A;  5C4X J;  4J19 A;  3WE3 A;  1J59 A;  1VQ8 I;  4HX7 A;  1EH8 A;  4LG3 A;  4Y52 J;  1IAW A;  3BZ6 A;  3DKY A;  3W6J B;  4M9S A;  2Z5U A;  2W57 A;  2R93 J;  3VP5 A;  5LGT A;  2L7Z A;  3D0S A;  2CUZ A;  5HDG A;  3KP6 A;  4F55 A;  2AS5 F;  2OTL I;  3PPB A;  3CME I;  5TJJ A;  2CQX A;  4Y7N J;  1MBK A;  5BMZ A;  2BVM A;  3CZ6 A;  1WPK A;  1U5T A;  2HQR A;  2XVC A;  3F8F A;  3HTI A;  1NG6 A;  4ZYA A;  1ZGJ A;  1KU3 A;  2PG4 A;  5F6F A;  1JXS A;  5E1X A;  2R5Z A;  2EBI A;  1CF7 A;  1MH3 A;  3ZCO A;  5TRD A;  3PIO F;  2O6G E;  3D5R C;  3DWL E;  3FDY A;  3QOP A;  5JVT A;  2CV1 A;  2EFN A;  2QOP A;  1LFP A;  2X51 A;  2GAU A;  2NVX J;  1EH6 A;  3QOD A;  2Y48 A;  2ZNZ A;  1KQ8 A;  3QYE A;  5L3E A;  3CF5 F;  4Z6Y A;  2CQN A;  4BJT A;  3RPU D;  4X6A J;  3BCG A;  2LR8 A;  1W0T A;  2BHY A;  4IQJ A;  2PFB A;  1SD5 A;  3J7A Y;  3HOX J;  3TBI A;  1AU7 A;  2NP5 A;  4GGG A;  5F1R A;  2OCE A;  2XIG A;  2I10 A;  2JPC A;  2ZXJ A;  1IRF A;  2XAG A;  4DVY P;  2XAQ A;  3WTZ A;  1IXR C;  4AYB A;  2YVH A;  3QPL A;  2D1H A;  4EJW A;  3WTT C;  3O8H A;  4RB3 C;  2X4H A;  1R71 A;  5IPA A;  5HOO A;  2CV2 A;  1WGX A;  2KIU A;  3IUV A;  3S14 J;  1JGG A;  2K9S A;  2M3A A;  2Z16 A;  3V4G A;  3EUH C;  4KUM A;  1HLV A;  4KIT B;  1Q1H A;  3A03 A;  2Z33 A;  4J01 A;  4MHG A;  1ETW A;  3FM5 A;  4BQO A;  3V8J A;  1E17 A;  2Z2S B;  1LJ9 A;  4C2M J;  3CCM I;  1PP7 U;  3OOU A;  3HOS A;  4ZYG A;  2R7T A;  3CJD A;  3S3O A;  3DXJ F;  1XGO A;  2H94 A;  3CCR I;  4KDP A;  1SMT A;  2DBB A;  2DMN A;  1RNL A;  2H1L A;  2NVY J;  2VKE A;  5F04 A;  2BYV E;  2STW A;  1TL8 A;  5F0F A;  4Y4R A;  4M3E A;  1HKT A;  2XV4 S;  4PUS A;  2ETH A;  4UV9 A;  3TO7 A;  2NNY A;  4EMS A;  3QRF F;  4WCG A;  5D19 A;  3F23 A;  2JQ7 A;  4EM1 A;  3CCY A;  1I39 A;  4L5E A;  1X3W B;  1QO0 D;  4XSX F;  2ZCW A;  1TNS A;  3HPH A;  4ZTF A;  2QF7 A;  2YX7 A;  3K10 A;  4KIB A;  3P5J A;  3HOY J;  3F8N A;  1LEA A;  2D1V A;  2M2E A;  1IV6 A;  1BIA A;  2Q1Z B;  1OCO H;  2VE8 A;  3LST A;  5FRO A;  4XIC A;  3PO3 J;  1W7P A;  2VLA A;  4WXC A;  4B1R A;  1I3Q J;  2WWY A;  2VBX A;  3IAM 2;  5ED4 A;  2HOS A;  3E5U A;  3NQO A;  5M3F J;  2QBY A;  1VQ5 I;  2Y9Y A;  4V2F A;  3T8R A;  1BIB A;  2L9S A;  3BR1 A;  3H5A A;  3OYG A;  2DTZ A;  3ZQH A;  1D5V A;  3ANG A;  3I59 A;  3BTI A;  4CUG A;  3BRU A;  3FXR A;  3OYM A;  4A12 A;  5AIP A;  2JUG A;  3H3V K;  2FQ4 A;  1ZG5 A;  3DKW A;  2ZME A;  2VIX A;  3SZG A;  3JW4 A;  2RGV A;  2R7U A;  3CLQ A;  1REP C;  3IUO A;  2UXU A;  1MSF C;  3F8C A;  5HS7 A;  3WHC A;  5LRS A;  4PJ0 C;  5CLS A;  3E6D A;  5M3M J;  5J47 A;  1Z0X A;  3DBR B;  5IT3 A;  5DEQ A;  3S32 A;  3G56 A;  2LBF A;  1LFB A;  1S3J A;  2GLO A;  3W6V A;  2ZFU A;  5M5X J;  3DPJ A;  4C2U A;  2H6C A;  3K2A A;  2L5Q A;  3FIW A;  2F5F A;  2YX4 A;  3EDP A;  5ILU A;  2GOX B;  3GZ6 A;  2H6B A;  3JRI A;  3KZY A;  1BR4 A;  1R1U A;  3I4P A;  4CYD A;  4M73 A;  3DEW A;  3OIO A;  5CXI A;  4E7S A;  5AQC A;  2HYG D;  5E3L A;  2JWT A;  4XKC A;  1W36 C;  4LG0 B;  3BTC A;  2WA0 A;  2HPI A;  3ABM H;  1BBY A;  4YFK F;  1IRG A;  2JMW A;  2GXB A;  3CMY A;  2B7E A;  2Q24 A;  1ZHF A;  2W1O A;  2ECC A;  3V7R A;  3CWR A;  1OCP A;  1ITY A;  1U9O A;  1H8A C;  2CUJ A;  4AYB N;  4IRV A;  1R6R A;  3GFM A;  3GO5 A;  1VQN I;  3QBM A;  4OIQ F;  2N8G A;  4MGR A;  1V5G A;  5DCF A;  1JTX A;  1SFE A;  1DDN A;  2QEX I;  4ESJ A;  2CV0 A;  1T6S A;  2A6E F;  5LHG A;  5HLI A;  3KNW A;  4KT6 A;  2XHK A;  1IC8 A;  5DAJ A;  3KYC B;  2PJR B;  4I09 A;  3KPH A;  1MMN A;  4HEA 2;  4BHP A;  3H36 A;  1QPI A;  2DA2 A;  3AQT A;  3ZQF A;  3FXL A;  3QPS A;  5LGN A;  4Q5S F;  2PMU A;  3VSK A;  4YG2 F;  3KET A;  1T39 A;  3ZQ7 A;  5GPC A;  1XPX A;  3P9T A;  2ZO4 A;  5K58 A;  3B73 A;  3JRF A;  3A01 A;  2ID3 A;  4LLN A;  2JVH A;  1O3S A;  1R1T A;  4UY8 I;  3KEQ A;  2QBY B;  2M45 A;  4KA4 A;  3FXJ A;  3CQZ J;  2E7X A;  4A3I J;  4UVA A;  4CYC B;  4XLP F;  3S1R J;  3LOC A;  3HXL A;  4WF2 A;  2CQK A;  5EG0 A;  3HOU J;  4HLX A;  2KIS A;  2E2I J;  4MQV A;  4E7H A;  2X6W A;  1BR2 A;  2UXX A;  3GZ5 A;  3BOQ A;  1SD7 A;  3LMM A;  2R5Z B;  3A01 B;  5A2Q Z;  4C2M A;  3L00 A;  2V1U A;  2D6Y A;  1TQP A;  3PUB A;  5E8I A;  4AID A;  1JE8 A;  1N75 A;  4KYW A;  2R5Y A;  4A93 J;  4U7B A;  3T0Y A;  4JBA A;  1O57 A;  1HXD A;  5FKN A;  3IKT A;  5FGL A;  1ZAO A;  3GTJ J;  4GO1 A;  2R7D A;  2OU2 A;  3M8E A;  1SFX A;  2L4M A;  4Q4Z F;  1VQ6 I;  2H1K A;  2ACJ A;  5DV5 A;  4E4H A;  2XGC A;  3V6G A;  1R9T J;  1ZH5 A;  1DGW Y;  3W6K B;  3DQV C;  5LEJ A;  2M1B A;  3KZZ A;  5D1R A;  3Q5F A;  2JRM A;  1DU0 A;  2A68 F;  3IHU A;  3OL3 A;  5LGU A;  2MA3 A;  3HRT A;  2X6X A;  4A3B J;  2E1M C;  1Y8R B;  2GWR A;  2VBW A;  1MND A;  2M5W A;  3M9A A;  3IV5 A;  5E3M A;  3OYD A;  4BDZ A;  5JR3 A;  4A3D J;  1I27 A;  3R4K A;  1WJC A;  2V9K A;  4OWR B;  4AC6 A;  3IL2 A;  5IP6 A;  3CCQ I;  3HTA A;  1ZTR A;  3AQS A;  2IAI A;  2HU9 A;  3EUP A;  1IXS B;  3FHN A;  2V1N A;  4MQ9 F;  1DPU A;  2RN7 A;  2MFZ A;  2O03 A;  3CC4 I;  3OYK A;  2FJI 1;  5GTI C;  4M9X A;  3R0J A;  3GTP J;  2CFO A;  4DJA A;  3Q0V A;  1HBX G;  1F43 A;  2XDN A;  4IRH A;  2O8K A;  4L0Z B;  5B66 C;  4RS8 A;  2VQG A;  4ENN A;  1VQ7 I;  1YJN I;  1FOK A;  4V2G A;  3SWH A;  2EIK H;  3BR2 A;  3GTQ J;  2NOG A;  5CQE A;  2OI8 A;  3RKY A;  2OZU A;  3GYH X;  1R4M B;  4RBO A;  3DPL C;  3KX2 A;  5C4J J;  2VON A;  2IS2 A;  3AKZ A;  2FBK A;  3GEZ A;  2HKO A;  2FE3 A;  2A2F X;  2JTV A;  2B1E A;  4PSX A;  4G9Y A;  4RB0 A;  3OOP A;  2L2O A;  4EV0 A;  4ZZD A;  3FWE A;  2F5E A;  4EJT A;  3OYI A;  5FMP A;  4HAM A;  2LK2 A;  4R1H A;  2GFN A;  2K4B A;  3ZQG A;  1MBJ A;  1D1B A;  1XGS A;  1R22 A;  1FZP B;  3BHQ A;  4B8X A;  1JTY A;  3O60 A;  2W00 A;  3M1C A;  1VF9 A;  5HNH A;  2VKV A;  3FBI B;  1YJW I;  2Y30 A;  4U7D A;  1AKH B;  1BW5 A;  5FFX A;  1U5T C;  2ZXI A;  2OZ6 A;  3TO6 A;  4RGR A;  4QLC U;  2EPF A;  2BEO A;  2GXG A;  1WJB A;  2IVM A;  4HF0 A;  4M74 A;  3RKW A;  4QIW N;  3FXQ A;  3H3Z A;  1OCT C;  1GT0 C;  3JRE A;  2M4G A;  2LNB A;  4BAC A;  1AOY A;  2LF8 A;  2J5P A;  3NAR A;  1XDS A;  3HTU A;  1H88 C;  4N4N B;  2KP6 A;  3IRQ A;  3NPI A;  1HCR A;  1S8N A;  2Y0M A;  2NVT J;  1K83 J;  3V7C A;  5L3G A;  2RKH A;  3F72 A;  1FX7 A;  3KLO A;  4P9U A;  2WB1 N;  1YIT I;  1UI6 A;  3CC7 I;  2E7W A;  4HSR A;  3LA2 A;  4IXA A;  4IOA F;  4HRI A;  1X4P A;  3G3Z A;  3B6A A;  4UHT A;  1HA8 A;  3NWT A;  3AG1 H;  5L3F A;  2XAJ A;  2L7K A;  1XGM A;  1X3Z B;  4L18 B;  5FLX K;  1TWH J;  4XQF A;  2M87 A;  4EJU A;  2EV0 A;  2E35 A;  3PUF A;  4AIH A;  2Q8K A;  2IGK A;  1FYL A;  4BNC A;  2QQ9 A;  5DUI A;  1QVU A;  2GUH A;  3BTL A;  3QWL A;  4GFK A;  3FMQ A;  5IOY A;  4ABZ A;  2CSO A;  2WY7 Q;  3BG9 A;  2KMU A;  3S2H J;  3HG9 A;  3B6C A;  1HC8 A;  3CRJ A;  5BNG A;  1IV8 A;  2IA1 A;  3CLO A;  2BW3 B;  2KZV A;  5FFZ A;  1RR8 C;  3SFZ A;  1CQT A;  1LFU P;  4AC0 A;  1JJ6 C;  3HB9 A;  3GCM A;  2KIF A;  2DFI A;  2Q2E B;  4OMZ A;  5JHU A;  2CU7 A;  2P5V A;  4HDU A;  1R5H A;  2REK A;  1QZY A;  2DT5 A;  3GLX A;  4OIR F;  3BR6 A;  4YFX F;  4UUV A;  1MNM C;  2GA2 A;  3ZQC A;  1S9H A;  1LE8 A;  2QQ8 A;  4G6T B;  3JRC A;  1NHA A;  4LGW A;  1D1C A;  1JT0 A;  3MAJ A;  2NOJ B;  1OPC A;  3V78 A;  1ZN2 A;  1MMD A;  2VN2 A;  2E2J J;  2UXO A;  5F08 A;  3E6B A;  4UB6 C;  3PM1 A;  2AQF A;  1ZYR F;  1FYK A;  3BDD A;  5JLX A;  2LRE A;  1TC3 C;  1MH4 A;  3BZC A;  3WHB A;  2L02 A;  4EJV A;  1Y39 A;  2PZ9 A;  4XL9 A;  2NX4 A;  2EFQ A;  3ROU A;  1PUF A;  1GUU A;  1Z6R A;  2LD5 A;  5DM6 F;  2FNP A;  3LFU A;  1OKR A;  1LQ1 A;  3KZ9 A;  1BJA A;  2HDW A;  1ON1 A;  3QU6 A;  1U8R A;  1UB9 A;  1IGN A;  2HXI A;  3BPX A;  2BY1 A;  3DLL F;  1SAU A;  1X2N A;  3I54 A;  4G7H F;  3Q9S A;  4CGR A;  3OYB A;  1YW9 A;  3GFL A;  2XKO A;  3K4N A;  1Z3Y A;  3HKZ A;  3MWM A;  1RRJ A;  2VJ4 A;  1DP7 P;  2QKM B;  3K4K A;  2JUC A;  2BY0 A;  5KHD A;  1Y1V J;  4A3G J;  2KLO A;  1FEX A;  1GXQ A;  4A3F J;  2OD5 A;  3IC7 A;  2XRL A;  3VYS B;  5FLX Z;  5D8K B;  1TTY A;  3A1Y A;  1HW1 A;  1ZRF A;  4ZDP A;  2BHZ A;  4YFN F;  3EQL F;  3TOB A;  5HOD A;  2IGM A;  1S7E A;  2TRT A;  2DAO A;  2Y31 A;  5F1J A;  3EPZ A;  3OIQ A;  3NNR A;  1ENH A;  3OYA A;  4B4C A;  3MKW B;  1TZL A;  2TDX A;  2GIZ A;  1IUF A;  2VE9 A;  4XKB A;  1XX5 A;  4E6K G;  3RQ4 A;  1BI1 A;  2XSD C;  1W1W E;  3H3U A;  3VYR B;  3GTO J;  2IRF G;  2VJI A;  1QHG A;  3JRA A;  2M7B A;  4M6Y A;  2K85 A;  2ZC2 A;  2XKP A;  3RH2 A;  4DOZ A;  3WGG A;  2FOK A;  3ZRG A;  3I56 I;  3BC8 A;  4L0Y B;  2P5K A;  1XG1 A;  2CW0 F;  1Z1D A;  1YW7 A;  1A6I A;  1SD4 A;  3JCU C;  3QYF A;  3RJP A;  1N77 A;  3S1M J;  3K7A J;  1XD7 A;  4N4O B;  5B5E C;  3MKZ A;  2PI0 A;  2DOE A;  1Y6I A;  2F4O B;  3QP6 A;  2ZCN A;  4LIU A;  3TW6 A;  1EKE A;  3WG7 H;  2VJ5 A;  2FF4 A;  4XRF A;  1Z21 A;  2UZK A;  2X9D A;  2GQQ A;  1Y0U A;  4EJO A;  3FF5 A;  2DLL A;  3DU6 A;  1UAA A;  5EEH A;  3VUQ A;  3B02 A;  2XAH A;  1P4X A;  4HW0 A;  4RGU A;  4MTD A;  3VEP A;  1S72 I;  2DQR A;  4NNJ A;  2EIJ H;  2Q0O A;  1YJ9 I;  1JKQ C;  2Y0S N;  3FMR A;  2CMP A;  4O5V A;  4DIQ A;  3TMO A;  3HC7 A;  3OYF A;  2VJJ A;  2ISZ A;  4WX9 A;  1JUM A;  2DTR A;  3M8J A;  2FBI A;  1FIP A;  3PL8 A;  4S05 A;  4AU7 A;  4L62 A;  2IU5 A;  3SDG A;  1W36 D;  2XGD A;  4Y17 A;  4Y13 A;  4HNV A;  5EDN A;  3K4L A;  1AA7 A;  3Q0U A;  2EFW A;  1YG2 A;  2K3P A;  2FRH A;  2V1D A;  1T0F A;  2P4W A;  2A07 F;  1I1S A;  1DPR A;  3M07 A;  2XSJ C;  4UXN A;  4XN0 A;  2V57 A;  3HRS A;  3NRG A;  4RAY A;  4Q47 A;  1U2W A;  4I98 B;  4PGH A;  3CUQ A;  2EB7 A;  4ZDL A;  2UWM A;  4RA2 A;  5J8F A;  1YS6 A;  2MLG A;  4EGY A;  3AL0 C;  1QVT A;  4L5J A;  3DPU A;  5FJ8 J;  4JX4 A;  3CO7 C;  3I4N J;  2R7W A;  3OYH A;  1V3F A;  4CIC A;  3DEU A;  3IH4 A;  3NXC A;  3C2G A;  5LHH A;  4F7Z A;  4PFP A;  1P4W A;  1SVL A;  3PIP F;  5FKK A;  1R5I D;  2EK5 A;  4CCK A;  1QNT A;  2O0Y A;  5KAF C;  4CGZ A;  2CW7 A;  2UV1 A;  4DW6 A;  3A4C A;  2DFE A;  4E7K A;  5B1A H;  3LSH A;  4HX8 A;  4ETS A;  2EV5 A;  3M1E A;  2YVX A;  1NTC A;  3MZH A;  1UG2 A;  4KNY A;  1FBQ A;  2A3S A;  3X2Q H;  2P6T A;  4IO9 F;  1W4M A;  1Z91 A;  3CUQ C;  4GYG A;  2R7Z J;  1Z7L A;  3L2U A;  2ZJR F;  4XOP A;  2XRN A;  4RLF A;  3LHQ A;  1V5F A;  1IDY A;  2KIQ A;  4MXM A;  3HL2 A;  4MK6 A;  2G7U A;  1GLN A;  3GFJ A;  5CVJ A;  1R36 A;  1D8K A;  3A02 A;  1K61 A;  2V4J C;  3C2B A;  4EAT A;  4A3E J;  3U21 A;  2XDV A;  1YHQ I;  1IRX A;  3DLA A;  1AWC A;  2IGN A;  3PNV A;  3I4M J;  2ZME B;  5CKT A;  4U9N A;  1H0M A;  2GM4 A;  4G6Q A;  2QQB A;  3HIF A;  2NS0 A;  3ZMU A;  4D5F A;  2MH9 A;  2QSF X;  1LE8 B;  4RDU A;  4WK8 F;  1LNW A;  3BG7 A;  4IOC F;  5HLT A;  3CP8 A;  3MMY B;  3EYI A;  1P4A A;  5EG0 B;  3K8P C;  3SYT A;  2WAQ N;  1VQL I;  4XLF A;  1E2X A;  2V9V A;  4CCL A;  4EM0 B;  2W24 A;  3E97 A;  1UJ8 A;  2GOM A;  2IS6 A;  3HOT A;  4ESB A;  5FRN A;  3VYU B;  4CH7 A;  3WOD F;  4QSH A;  2ECB A;  4G7O F;  2Z9O A;  1OR7 C;  2ELK A;  1AHD P;  2JA7 J;  2J5O A;  3E5X A;  2DOF A;  2DFF A;  1T98 A;  4UVC A;  1J75 A;  4BS9 A;  4B09 A;  1IO2 A;  4CYC A;  5F27 A;  3PNT A;  4RGX A;  5IT9 K;  4ZYE A;  1DU6 A;  2VB6 A;  3GTL J;  1FOW A;  3D5L A;  3LSP A;  5FKO A;  2JSP A;  1B6A A;  3TO9 A;  4ESF A;  3LSR A;  2WY8 Q;  3E6M A;  3KP7 A;  5J40 A;  2QEN A;  2E1N A;  1KQ0 A;  1XSX A;  3CC2 I;  1WSU A;  3VW1 A;  3HTH A;  4OIO F;  3S1Q J;  1OYI A;  4R79 A;  2ZJ2 A;  2W7N A;  3S2W A;  2M9H A;  3LA7 A;  3HHH A;  3M3Y J;  3FKJ A;  2DCE A;  1FP2 A;  1E3P A; 
#chains in the Genus database with same CATH homology
 3GEU A;  4BY7 J;  2XB0 X;  2XB5 A;  1Z77 A;  3A01 B;  2R5Z B;  5GPA A;  4UUS A;  1ETY A;  4FIS A;  2D6Y A;  1B72 B;  2M34 A;  2XPV A;  1AKH A;  2R5Y A;  4A93 J;  5CXG A;  5FKN A;  3HDD A;  4JKZ A;  5FGL A;  3GTJ J;  3HOW J;  1HF0 A;  3ANP A;  3JRH A;  3UKG A;  3S2D J;  1ORK A;  2HOA A;  2JA5 J;  3BQY A;  2H1K A;  1JUS A;  2XGC A;  3V6G A;  4I76 A;  1R9T J;  1ZQ3 P;  1JKP C;  2DJN A;  2G0E A;  5D1R A;  2ME6 A;  3HGY A;  2PMZ N;  1DU0 A;  4DYR A;  5CW8 A;  4A3B J;  3IV5 A;  1RES A;  5IP7 J;  5E3M A;  5J3L A;  2JK3 A;  4A3D J;  4ACI A;  3QKX A;  3B81 A;  4AC6 A;  3DCF A;  2FBQ A;  3TP3 A;  5IP6 A;  3G7R A;  3HTA A;  1ZTR A;  5C3E J;  4M3G A;  3AQS A;  2IAI A;  3COL A;  1TWA J;  3FK6 A;  4NEL A;  4C3H J;  3EUP A;  5C44 J;  1IRZ A;  2HQ5 A;  1JKO C;  3RZO J;  4DZJ A;  5K7F A;  3HBL A;  5FKM A;  2X48 A;  4GCL A;  3GTP J;  3G1O A;  1IJW C;  2G7L A;  5E3N A;  2YU9 J;  3VW0 A;  3FKI J;  3Q0V A;  1F43 A;  2XDN A;  2O8K A;  2NS8 A;  5J1Y A;  4V2G A;  1T56 A;  2HXO A;  2X6O A;  3HEF A;  3BR2 A;  1Q1V A;  3GTQ J;  2NOG A;  3VPR A;  3PO2 J;  2OI8 A;  2G7G A;  2VI6 A;  3HTJ A;  1UHS A;  4JYK A;  4RBO A;  5EZG A;  5C4J J;  1BA5 A;  3C07 A;  2L7M P;  2QIB A;  1MBF A;  1FTZ A;  2KT0 A;  2P81 A;  2AHQ A;  4MFE A;  2FX0 A;  4BXX J;  2UXP A;  2UXI A;  2K9N A;  3BT9 A;  5DS9 A;  5D18 A;  5EYR A;  2OER A;  3FIS A;  3JRB A;  5FMP A;  1E3O C;  3BR0 A;  2LK2 A;  2GFN A;  1JKR C;  3ZQG A;  1MBJ A;  2XGE A;  2DA7 A;  2R0Q C;  3VOK A;  2CUF A;  5EGO A;  1NK2 P;  3BHQ A;  1WCM J;  5K58 A;  1P7I A;  1POG A;  1JTY A;  2IBD A;  3O60 A;  3VVZ A;  3BG5 A;  1VF9 A;  2VKV A;  4IHW A;  2VPR A;  4M3D A;  5JLW A;  9ANT A;  1AKH B;  2Y30 A;  2OPT A;  3Q0W A;  1ETK A;  1BW5 A;  4DYQ A;  1HDD C;  2K9Q A;  1ETV A;  1MBE A;  2ZCM A;  1BL0 A;  1XC5 A;  1YRN A;  1XS9 A;  2L9R A;  1BJZ A;  2CJJ A;  4AUX A;  3OSG A;  1Y1W J;  1QRY A;  4JL3 A;  4QIW N;  1ETX A;  3PAS A;  4MO7 A;  2ID6 A;  1MSE C;  1OCT C;  4X1E A;  3LNQ A;  1GV2 A;  1VND A;  1GT0 C;  1YRN B;  2JA6 J;  3JRE A;  3ZQI A;  2EH3 A;  1O4X A;  3D1N I;  3BJB A;  3M4O J;  3MVP A;  3NAR A;  3GTG J;  1H88 C;  2H8R A;  3RQI A;  3NPI A;  2RAE A;  1HCR A;  2W48 A;  2Y9Z A;  2NVT J;  1K83 J;  2LTP A;  1P7J A;  1H89 C;  3EGQ A;  2WB1 N;  5F0C A;  2M8G X;  1UI6 A;  2E2H J;  2PBX A;  1VFC A;  4LOC A;  4D7N A;  4C3J J;  1W0U A;  1RKW A;  5J1U A;  1FIA A;  4BKX A;  1I50 J;  1X2M A;  3L1P A;  3GTM J;  4I6Z A;  2DA6 A;  3B6A A;  4XRM A;  1T33 A;  4A3M J;  4G12 A;  1TWH J;  3S15 J;  4BBR J;  2F07 A;  3GTK J;  2EZK A;  2MGQ A;  4UDS A;  4IHX A;  3F0C A;  4UUS B;  3E7L A;  3GBG A;  1MBG A;  2YUS A;  3GZI A;  2K40 A;  1APL C;  1QVU A;  2AO9 A;  2L7F P;  3BTL A;  4IEJ A;  2O9L A;  5IOY A;  2GUH A;  4GFK A;  3CDL A;  4S0H B;  4ABZ A;  1SGM A;  1UI5 A;  5C4Y A;  4A3J J;  1IG7 A;  3OSF A;  5J1R A;  1RR7 A;  3BG9 A;  3JRD A;  2ZOZ A;  3S2H J;  3B6C A;  4M3F A;  3CRJ A;  3ON4 A;  5BNG A;  3HIM A;  3VW2 A;  3O8G A;  3VIB A;  4JNN A;  2E1O A;  1CQT A;  3H0G J;  2QKO A;  1LFU P;  2D5V A;  4AC0 A;  1JJ6 C;  3HB9 A;  2ZCX A;  3MKL A;  4ICH A;  4GCT A;  2QCO A;  2CU7 A;  3BG3 A;  2REK A;  3QQA A;  4QTR A;  2MSY A;  3BR6 A;  3JRG A;  1B8I B;  1MNM C;  3SJM A;  4XID A;  5K7H A;  4GCK A;  1TWC J;  4DZP A;  2DMQ A;  2HOT A;  5HAW A;  2FJ1 A;  3ZQC A;  1ETO A;  1LE8 A;  3RD3 A;  3JRC A;  2QWT A;  5C4X J;  4J19 A;  1PUF B;  3HOV J;  1JT0 A;  3S16 J;  4Y52 J;  3S1N J;  1FJL A;  3V78 A;  4FE7 A;  2M0C A;  4MFD A;  2E2J J;  1RKT A;  2R93 J;  2L7Z A;  5F08 A;  2UXO A;  3ON2 A;  2NVQ J;  3VP5 A;  3PM1 A;  4BBS J;  2XPW A;  1ZGW A;  3ZQL A;  5IYC J;  4A3L J;  5JLX A;  1TC3 C;  2DG7 A;  3PPB A;  1MH4 A;  2CQX A;  4Y7N J;  3WHB A;  2HYT A;  1MBK A;  2G3B A;  2ZB9 A;  3VOX A;  2DA5 A;  2PZ9 A;  1BW6 A;  2YVE A;  2NX4 A;  2COB A;  1IDZ A;  1PUF A;  1WPK A;  1GUU A;  3HTI A;  2DMT A;  2LD5 A;  1TWG J;  3KZ9 A;  1GV5 A;  3VVY A;  2R5Z A;  2JA8 J;  4A3C J;  2EBI A;  1IGN A;  1MH3 A;  2HXI A;  2NS7 A;  3VVX A;  1X2N A;  1U9N A;  3IH3 A;  2QOP A;  2LFB A;  4CGR A;  2NVX J;  5M5W J;  2EQR A;  5HSZ A;  1Y1V J;  4A3G J;  3JR9 A;  1FEX A;  3KKD A;  4A3F J;  4X6A J;  3BCG A;  2LR8 A;  4B3A A;  3IH2 A;  2XRL A;  1W0T A;  5FHP A;  1G2H A;  5HOD A;  2MW8 A;  5EGO B;  1S7E A;  2TRT A;  3HOX J;  5EZH A;  2Y31 A;  5F1J A;  1AU7 A;  2NP5 A;  1OJL A;  2WGB A;  3NNR A;  1ENH A;  2DMP A;  2HDD A;  2I10 A;  5EF6 A;  2DA4 A;  4B4C A;  2EZI A;  3BNI A;  2YVH A;  3QPL A;  4JP0 A;  1IUF A;  3O8H A;  1B72 A;  5IPA A;  2HKU A;  2XSD C;  4GFB A;  3NI7 A;  3GTO J;  1WGX A;  2ZOY A;  2YS9 A;  3LSG A;  1VI0 A;  2DA1 A;  1ZR4 A;  1WH7 A;  3JRA A;  3IUV A;  4M6V A;  2VUM J;  3S14 J;  1JGG A;  2K9S A;  3RH2 A;  2MG4 A;  3BR3 A;  1HLV A;  1XG1 A;  5FKL A;  1A6I A;  2WV1 A;  3A03 A;  2O7T A;  1ETW A;  3S1M J;  3K7A J;  2IEK A;  4C2M J;  2RHA A;  3CJD A;  3OOU A;  3MNL A;  2ZCN A;  3TW6 A;  2KDZ A;  1B8I A;  4JX6 A;  2DMN A;  3TED A;  1I6H J;  2NVY J;  3G1M A;  2X9D A;  5EFY A;  2LKX A;  2VKE A;  5F04 A;  4XK4 A;  4NDL A;  2FD5 A;  3HGG A;  5F0F A;  4D5C A;  4M3E A;  2LVS A;  2CRG A;  3VUQ A;  3FK7 A;  5HBU A;  2GEN A;  3BR5 A;  1HOM A;  2O7O A;  1JKQ C;  5D19 A;  2Y0S N;  2EZL A;  3CCY A;  5H9T A;  4L5E A;  1HDP A;  5IP9 J;  1JUM A;  2XPU A;  1FIP A;  2HI3 A;  4L62 A;  2QF7 A;  2IU5 A;  3S5R A;  4AF5 A;  1ZR2 A;  3HOY J;  3F1B A;  3SDG A;  2XGD A;  2M2E A;  1ZKG A;  4HNV A;  5EDN A;  1IV6 A;  4GFL A;  3Q0U A;  1RPW A;  4XIC A;  3PO3 J;  3Q3S A;  4B1R A;  1I3Q J;  2R92 J;  5M5Y J;  2V57 A;  2HOS A;  1SAN A;  5M3F J;  5FLM J;  5F0H A;  3NRG A;  1X58 A;  2Y9Y A;  4V2F A;  4FTH A;  3BR1 A;  4HKU A;  2RAS A;  3ZOB A;  2DTZ A;  3HM5 A;  3ZQH A;  5K7Z A;  2DMU A;  3ANG A;  4NN1 A;  3BTI A;  1JJ8 C;  1QVT A;  5FJ8 J;  4A3K J;  4JX4 A;  3I4N J;  3HKZ N;  4EEF G;  4PXI A;  3BRU A;  3IH4 A;  3RKQ A;  3NXC A;  1WH5 A;  3G1L A;  3FRQ A;  2DG8 A;  2UXH A;  2G7S A;  3H3V K;  2FQ4 A;  2TCT A;  5FKK A;  4C3I J;  1SFO J;  2R5Y B;  3HOZ J;  2UXU A;  4JX5 A;  1MSF C;  3WHC A;  1GDT A;  3KKC A;  4DW6 A;  1MBH A;  1OFC X;  5M3M J;  1Z0X A;  2L0K A;  2NP3 A;  4W1U A;  3G56 A;  2JN6 A;  3E7Q A;  4MIM A;  1NTC A;  1LFB A;  4MLO A;  1UG2 A;  2B63 J;  2Y2Z A;  2GLO A;  3W6V A;  2R7Z J;  2E19 A;  4W97 A;  5M5X J;  1ETQ A;  3DPJ A;  4FCY A;  2HYJ A;  4KWA A;  1JT6 A;  4FE4 A;  3K2A A;  3LHQ A;  3FIW A;  1IDY A;  1RET A;  3TW7 A;  1D5Y A;  4MXM A;  4MK6 A;  4DYC A;  5EEA A;  3JRI A;  3HE0 A;  3LJL A;  5DTD A;  3A02 A;  1K61 A;  4UUT A;  5AQC A;  3DEW A;  3OIO A;  5CXI A;  3C2B A;  4A3E J;  5E3L A;  2JWT A;  1NK3 P;  2ME0 A;  3BTC A;  2LY9 A;  3I4M J;  1A5J A;  2JMW A;  5E3O A;  3CMY A;  2GM4 A;  2JJ7 A;  4D5F A;  2Q24 A;  2ECC A;  1LE8 B;  3RZD J;  5FLV A;  4RDU A;  3CWR A;  1OCP A;  2WUI A;  3JSJ A;  1ITY A;  4XRS A;  1U9O A;  3MN2 A;  1H8A C;  4AYB N;  5EG0 B;  1U8B A;  2WAQ N;  2QTQ A;  3QBM A;  2N8G A;  2EZH A;  3LSJ A;  1JTX A;  4A69 C;  1UMQ A;  1U78 A;  3SFI A;  3KNW A;  4ME9 A;  1EF4 A;  1IC8 A;  5DAJ A;  1WI3 A;  4IHV A;  2LLK A;  4QSH A;  2GBY A;  2ECB A;  4XRS G;  1TWF J;  2CQQ A;  2ELK A;  1AHD P;  5IOZ A;  1QPI A;  2JA7 J;  3S17 J;  2DA2 A;  4D7M A;  3AQT A;  3ZQF A;  3QPS A;  1FTT A;  4CYC A;  5F27 A;  4BY1 J;  2DN0 A;  4YZE A;  5GP9 A;  1DU6 A;  5GPC A;  3P9T A;  3GTL J;  4M3B A;  3TP0 A;  5IYB J;  3LSP A;  1JUP A;  3NAU A;  5IYD J;  5FKO A;  4IHY A;  3LWJ A;  1ZK8 A;  2CUE A;  3LSR A;  3A01 A;  3JRF A;  2ID3 A;  2LP0 A;  3BQZ A;  3VW1 A;  3HTH A;  3CQZ J;  4A3I J;  3S1Q J;  1F36 A;  3BTJ A;  4CYC B;  3S1R J;  2DA3 A;  3LOC A;  5EG0 A;  1GVD A;  2M9H A;  3HOU J;  2W53 A;  2E2I J;  3M3Y J;  2OF7 A;  3T6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...