1JT6A

Crystal structure of the multidrug binding protein qacr bound to dequalinium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical transcriptional regulator IN QACA 5'region
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 81
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt6A02
4L62A 1JKQC 1MBJA 2FD5A 2LK2A 5CW8A 1Y1WJ 2CQQA 1QVTA 3PM1A 4XRMA 1ZR4A 5F08A 2NVTJ 4JNNA 3ANPA 4ME9A 4MXMA 3A03A 3RD3A 1NTCA 2O7OA 1BW5A 2PBXA 3RZDJ 2DA3A 1FEXA 1WH7A 1RPWA 1H8AC 3I4NJ 3CQZJ 3BJBA 5H9TA 1MH3A 2VPRA 1IRZA 3HEFA 3JRCA 1PUFA 1GT0C 2L7ZA 1B8IB 4M3FA 3S2DJ 1BA5A 2WGBA 2R5ZB 2UXOA 5HBUA 3ZQIA 1APLC 3VOXA 2NP3A 3JREA 2FX0A 1B72B 2B63J 5CXGA 4DYCA 3K7AJ 3SJMA 2IU5A 1Z77A 2XGEA 3JRAA 3OSFA 3S2HJ 4JX6A 2QCOA 4QSHA 1F36A 2QF7A 2FJ1A 4M3EA 1ETVA 3ZOBA 4GCTA 4W1UA 5K58A 1JUSA 5DAJA 2R5YA 2ECCA 2PZ9A 2QWTA 1AKHA 2XRLA 3H0GJ 1LFUP 3IH4A 4FTHA 1H88C 2O7TA 4M3GA 3VVZA 2K40A 1ENHA 4YZEA 3E7QA 2O8KA 1P7JA 4A3GJ 5J1YA 3JRDA 1GV2A 4BBSJ 2DA2A 1ZQ3P 2F07A 4W97A 3K2AA 1LE8B 2Y31A 2LVSA 5EZGA 2YU9J 1JTXA 3BHQA 4HKUA 5IYCJ 4XIDA 1IUFA 5FJ8J 3TW7A 4Y52J 2AO9A 1QRYA 3LSGA 2LFBA 3TP3A 3GZIA 3VUQA 1X2MA 2E19A 5FKKA 4JX5A 3S5RA 3ZQFA 2V57A 3S16J 5E3MA 3VOKA 1TWHJ 1XG1A 5F0CA 4A3MJ 5EGOB 1MNMC 1UI5A 4MO7A 3CDLA 2HYJA 5F27A 2FQ4A 4D7MA 4NDLA 3GTMJ 1IDZA 3TEDA 3OSGA 1QPIA 4ACIA 1I3QJ 3Q0VA 5EZHA 3LJLA 4MFDA 2EBIA 1VFCA 2DJNA 1JUPA 1ZGWA 2WUIA 2HDDA 2JA6J 3NRGA 2RAEA 3VP5A 1JT6A 3QQAA 3BTLA 4XRSG 4A3BJ 2HYTA 1ORKA 2UXPA 2UXHA 2Y9ZA 5GP9A 4J19A 3C2BA 5GPAA 2AHQA 5E3LA 3NI7A 1QVUA 2RASA 2H8RA 1D5YA 1VNDA 2QTQA 4UDSA 2HOAA 3VW2A 5EG0B 3CCYA 1NK3P 2QIBA 2ME6A 3JRHA 1PUFB 2DMPA 3MNLA 3JSJA 4DZJA 3MN2A 2CQXA 1SANA 4DZPA 3CRJA 2DA7A 4DW6A 2EZLA 4HNVA 2DA4A 2M0CA 2O9LA 5J3LA 2XPVA 3FRQA 1G2HA 1RETA 2CRGA 3PO3J 3ANGA 5C3EJ 2K9QA 3F1BA 1LFBA 3BR3A 1EF4A 2JA7J 2OI8A 3PASA 1OJLA 3BR6A 1OCTC 4UUSB 3SFIA 4RDUA 4NN1A 2TCTA 4S0HB 4BBRJ 2DG7A 2OERA 1S7EA 1ITYA 2Y30A 4A3FJ 2G7LA 1ETYA 4BKXA 4B3AA 4IHYA 3BR2A 3COLA 3GBGA 2CU7A 1H89C 3HE0A 2M8GX 1HDPA 4A3IJ 3A01B 4CYCB 2JJ7A 1OFCX 1NK2P 4GCKA 3TP0A 2GUHA 5J1UA 4XRSA 3GTJJ 3ZQLA 1ETKA 3NARA 4A3DJ 3F0CA 2XPWA 5E3OA 3G56A 5GPCA 1XC5A 2NVYJ 1JKRC 5FKOA 5FKLA 3V6GA 2CJJA 3S17J 1FIPA 3CWRA 2ECBA 2VKVA 3LSPA 3AQSA 1UHSA 3TW6A 1WI3A 5IP6A 3GTPJ 3NNRA 2Q24A 1SFOJ 1A6IA 2JMWA 5M5YJ 1JJ8C 1GDTA 1WGXA 2NS8A 2X48A 2K9SA 2E2HJ 2LLKA 2D5VA 5FKMA 5C4JJ 2EZKA 4BY1J 4FCYA 2YS9A 1MBKA 2K9NA 3LHQA 4L5EA 3CJDA 5IYDJ 5M5WJ 1MH4A 2MSYA 2D6YA 3IH3A 1IC8A 4XK4A 2GBYA 3HIMA 3BQYA 5E3NA 2XDNA 3KKDA 1T33A 2COBA 3LWJA 2N8GA 1JUMA 3BG9A 2VI6A 3HOXJ 2FBQA 3S1QJ 2DA1A 1U9NA 2ELKA 1HOMA 3SDGA 1TWFJ 1ZKGA 4NELA 1Y1VJ 2Y9YA 1WCMJ 4MFEA 5FLVA 1YRNB 5EEAA 2JN6A 1RKTA 5CXIA 4MIMA 1OCPA 2DTZA 3HGGA 1K83J 1X2NA 4A69C 1O4XA 2QOPA 3DCFA 3S1MJ 3P9TA 2G7GA 2YUSA 4MK6A 2VKEA 1FJLA 1MSFC 1U8BA 4A93J 4ICHA 2LY9A 5AQCA 4FE7A 4JYKA 3H3VK 4PXIA 3LOCA 3AQTA 1R9TJ 4MLOA 5M3MJ 1IJWC 1AHDP 1HF0A 2XGCA 4QIWN 1X58A 5IPAA 4UUTA 3ON4A 5C44J 2OPTA 2W53A 1K61A 1B8IA 2M2EA 3RKQA 2DMUA 3HTHA 2R5ZA 2JA8J 2GENA 1IDYA 1MBEA 3FKIJ 1MBHA 3IH2A 4JP0A 5K7HA 5F04A 2HXIA 2DA5A 5M5XJ 1GV5A 1XS9A 1B72A 3QPSA 4IHVA 3IUVA 2PMZN 2XPUA 5FGLA 2IAIA 1A5JA 2W48A 1POGA 3UKGA 5DS9A 5HAWA 1ZK8A 4C3IJ 2H1KA 4I6ZA 1RKWA 4JX4A 5F1JA 2JWTA 3S14J 2ID6A 2EQRA 3JRBA 2DMQA 2R5YB 1W0TA 2HI3A 4C2MJ 1AKHB 3RH2A 3I4MJ 4B1RA 3CMYA 1IG7A 1JJ6C 4AUXA 2DG8A 2E1OA 5HSZA 1FIAA 2OF7A 2ZCXA 3B81A 2IEKA 2M9HA 2R7ZJ 2X6OA 2DN0A 3GTOJ 2JA5J 1LE8A 2DMNA 3Q3SA 1MBGA 9ANTA 5IOYA 3MKLA 2XSDC 3D1NI 5D19A 2ZOZA 3HTIA 3BR5A 3HDDA 3ZQHA 3FK7A 1VI0A 3QPLA 4ABZA 3S15J 2L7MP 5FLMJ 2CUEA 3VIBA 1SGMA 1VF9A 3HM5A 3HBLA 3VVYA 4CGRA 3QBMA 1U78A 2G3BA 2E2IJ 1HLVA 3RZOJ 3NAUA 2ME0A 5C4XJ 4AF5A 4QTRA 1UG2A 1ETWA 4DYQA 3NXCA 1UI6A 2WV1A 5F0FA 3G1MA 2Y0SN 3G7RA 3WHBA 3Q0UA 5JLXA 2TRTA 4GFKA 5IYBJ 2EZHA 2EZIA 5M3FJ 4A3CJ 2YVEA 3Q0WA 5EG0A 4DYRA 1AU7A 3JR9A 1HDDC 4AYBN 3B6CA 1RESA 2MG4A 4X6AJ 1DU6A 4V2FA 4IEJA 2P81A 1ETOA 2ID3A 4KWAA 2LTPA 4I76A 4M6VA 3HOYJ 2NVXJ 3GTKJ 5JLWA 2YVHA 2I10A 1ZR2A 5FKNA 2R93J 1I6HJ 5EDNA 1F43A 4XICA 2E2JJ 2XB5A 3NPIA 3OOUA 3L1PA 3VW0A 1FTTA 3BTCA 3T6NA 4GCLA 2MW8A 1U9OA 2XGDA 5J1RA 1Q1VA 1WPKA 4C3JJ 2HKUA 3O8HA 3B6AA 1TWCJ 4UUSA 3GTQJ 2L9RA 3HOWJ 2NOGA 2CUFA 2L0KA 3JRIA 2NP5A 4D5FA 1ZTRA 2UXIA 2ZOYA 2NS7A 1MBFA 2DMTA 2G0EA 3QKXA 1JT0A 3KKCA 1JKOC 4IHWA 3FK6A 5FMPA 5D18A 3RQIA 3ZQCA 2DA6A 1DU0A 4M3DA 1TWGJ 3FISA 4RBOA 3LSRA 4D7NA 5HODA 2NX4A 3O60A 3BCGA 2Y2ZA 4B4CA 4Y7NJ 2VUMJ 3A01A 1BJZA 4FISA 4CYCA 3HGYA 3S1NJ 4AC6A 3GTGJ 3G1OA 3BG5A 5K7ZA 2HQ5A 4D5CA 3GTLJ 3V78A 3BG3A 3HTAA 4X1EA 2NVQJ 2HOTA 1IV6A 3M4OJ 2REKA 5BNGA 3HB9A 3BNIA 3VPRA 1TC3C 3JRGA 4AC0A 3HOUJ 1E3OC 2IBDA 3C07A 4A3KJ 3BQZA 1Z0XA 3G1LA 2HXOA 4IHXA 3LNQA 4GFBA 2R92J 3DPJA 1UMQA 2JK3A 1IGNA 3HOVJ 3ZQGA 4A3JJ 5EF6A 5DTDA 3O8GA 3IV5A 2XB0X 1W0UA 4EEFG 2ZCMA 5IP7J 3VVXA 1JTYA 3E7LA 3PPBA 1WH5A 3BRUA 3LSJA 4JL3A 3MVPA 5IOZA 2LR8A 1BL0A 2G7SA 1HCRA 2GFNA 4G12A 3OIOA 3W6VA 5FHPA 2UXUA 3A02A 3BTJA 4GFLA 3KZ9A 3BR0A 1I50J 3S1RJ 4A3LJ 4BXXJ 2WB1N 1FTZA 3BR1A 5EYRA 2QKOA 2HOSA 2RHAA 5F0HA 3BT9A 5EFYA 1RR7A 1GVDA 3M3YJ 4M3BA 1ETXA 2KDZA 2WAQN 4FE4A 1ETQA 4A3EJ 1CQTA 2R0QC 2GLOA 5C4YA 3GEUA 3ON2A 3FIWA 2M34A 1TWAJ 4V2GA 1GUUA 3DEWA 2LD5A 4LOCA 2X9DA 3HTJA 3WHCA 2LP0A 3EGQA 1JKPC 5IP9J 4BY7J 2L7FP 1JGGA 2ZB9A 2MGQA 3PO2J 3KNWA 4JKZA 3BTIA 2ZCNA 1YRNA 1MSEC 2GM4A 3HKZN 5D1RA 5EGOA 3VW1A 3JRFA 2KT0A 5K7FA 2LKXA 1BW6A 1P7IA 3EUPA 1T56A 2EH3A 4C3HJ 3HOZJ
chains in the Genus database with same CATH superfamily
3LFKA 3E5XA 1YX5A 2OTJI 1BOBA 1Z9CA 1YQAA 3T5XA 5HVQC 1LKXA 3W6JB 1QVTA 2KJBA 3PM1A 2DYRH 4S04A 1ZHFA 2HVRA 4JNNA 1R5ID 4HZFA 1ZRCA 1R4NB 2O7OA 4HAMA 1Z1DA 1MH3A 2E60A 1USTA 1IRZA 3OYKA 2DODA 1JE8A 1YJ9I 1GT0C 2EA4A 2X1EA 2HTJA 2QQ9A 4XM3A 2WGBA 2IVMA 1W7PD 2UUZA 4EGYA 3CLOA 1FYLA 2UXOA 1APLC 2XSJC 2IGOA 3M07A 4MEYF 2ZJRF 1WVRA 2M45A 3ASOH 5CYVA 1B72B 3OYJA 2VT3A 1SD7A 4II3A 2LF8A 2WAEA 3W2WA 3M8FA 1ETVA 4Q5SF 2VXDA 5DCMA 2F48A 2VXZA 5AIQA 2PZ9A 2QWTA 4R79A 3ZMSA 1AKHA 2ZKZA 2HKOA 2VBWA 2ZSHB 4M3GA 2K40A 3VVZA 4II2A 2XAUA 3MFKA 3VSKA 2V1UA 4L5JA 3HRSA 4XSZF 5CJ9A 4XMYA 3VSLA 4A6DA 1W36C 2C6YA 3U2RA 1IRXA 4U9LA 1VQNI 4RB2C 2PN6A 2BHYA 4L18B 2F07A 4W97A 2YVXA 1FBUA 3JW4A 4MTEA 5IYCJ 2ISYA 1IUFA 3IWFA 2V1DA 2AO9A 2LFBA 3L2QA 3VUQA 1X2MA 3H3ZA 1CF7A 3S5RA 4BAYA 1A35A 3IWZA 5H6RA 1FSEA 5E3MA 3VOKA 1GXPA 1J9IA 1UI5A 3I55I 2KRHA 3J7AO 2QYOA 3HOTA 4E7LA 3TKYA 3TEDA 3Q9SA 4ACIA 1OYYA 1PJRA 1I3QJ 3Q0VA 5EZHA 4AVZA 1GXQA 2YU3A 5IY5H 2X6XA 2A2FX 4HX4A 2WUIA 5L3GA 4ZTJA 3VP5A 2FU4A 4XRSG 1D1CA 1W5CC 1ORKA 4RA2A 5GP9A 4J19A 5FD5A 5HLGA 3G4SI 3WGGA 3KIOA 5FRMA 2H8RA 3DU6A 4RB0A 3LSMA 2QTQA 3GF2A 1Z3XA 3I5UA 3CCYA 3F9KA 2GWRA 2QIBA 4PSWA 3JRHA 2EILH 3MNLA 2XC7A 2V7FA 2P5VA 3WE3A 2Z99A 3T8TA 3RTRA 4DZPA 2QEXI 3IKVA 3I71A 3QPHA 3CRJA 4DW6A 2EZLA 3OIPA 4G9YA 3FRQA 1FLIA 3GXOA 4B3XA 1B6AA 2EB7A 3K0LA 2FSWA 2QKMB 3DBHB 1Z3YA 3K4CA 3I54A 4ESJA 1WJ5A 3PO3J 1L3LA 3QPTA 4BU2A 3BR3A 5FFXA 1RNLA 4N4OB 1OJLA 1OCTC 2UZKA 2EIMH 1LDJA 3DQVC 3WTXC 3L2CA 3OYGA 2P8TA 1MGTA 2KZVA 3K6GA 3VEPA 1MD0A 2JPBA 2DG7A 3BZCA 3QU3A 3ZRGA 2BW3A 4WWCA 3R0JA 1S7EA 2DQLA 3G3ZA 1VQ7I 2R7VA 1FWZA 4ZTFA 2RQQA 4QLCU 2M4KA 1ETYA 4BKXA 2JVGA 3CCVI 4GCVA 3HL2A 2B1EA 1J7KA 3GEZA 3I3LA 2M8GX 4A3IJ 4XBFA 4M73A 1YOVB 3U1DA 2E1CA 2G7UA 4A0ZA 2LY1A 2OV7A 1IF1A 2LRDA 3M8JA 1UJ8A 4Z2YA 3I53A 4RB3C 5E20A 1R1TA 5D8LB 5FKOA 4CCMA 2HDWA 5LLQA 2OD5A 1ZG1A 1FOXA 3CWRA 5LFAA 2ECBA 1S8NA 4R1HA 3VYTB 2QQBA 5FRNA 4JK1X 4YIRX 2EK5A 3VTIA 5IP6A 3GTPJ 1Q1HA 3WG9A 2M7AA 5CQGA 2PQ8A 1BI1A 4PCQA 1SFOJ 1IV8A 1R58A 4XOTA 3QP5A 2JMWA 1GLNA 1XMKA 1JJ8C 2NS8A 1WQ2A 4HPQA 5LGTA 1UFMA 2D5VA 3DF8A 1OQYA 5LRRA 2UV1A 3ULQB 1FYMA 2YS9A 3LHQA 2KP6A 5HLIA 3HOSA 2LY2A 3E6MA 3U21A 2E34A 4AU7A 3OL4A 2IS4A 2D6YA 5DV5A 1M1EB 3IH3A 2GBYA 3EPZA 1B4AA 2GXBA 1BJAA 3KKDA 1T33A 3OIQA 2ZJPF 3LWJA 1UAAA 2ICWG 3BG9A 1R71A 2AQEA 2M7BA 2FBQA 1HBXG 1U9NA 2V9PA 3TQNA 1W7PB 3ABLH 4JQFA 3FX3A 3ZN0A 5HNFA 2LKSA 5FLVA 4HLXA 1N77A 1MMSA 1RKTA 2Y48A 3F22A 1OCPA 1QNTA 4FX4A 4U88A 4PDKA 3CF2A 3HGGA 3PUBA 4RAFA 4ESFA 1O4XA 1AWCA 1MJAA 4P9FA 1DP3A 2XIGA 1FJLA 5J8CA 1MSFC 1U8BA 2DXIA 5HS7A 3FF5A 2IT0A 4JYKA 4Q4ZF 1IJWC 2X6WA 2JRTA 1JHHA 2ZMEA 3DP7A 1W5TA 3LQRA 1UHMA 4FHTA 3R4KA 2O3FA 4EM2A 2M2EA 2WB1A 4I98B 4LITA 2FA5A 1IXRC 3H9QA 5K7HA 2E1NA 4OU0A 3V42A 2CW7A 3NS4A 1P4XA 4K2EA 4KMUX 1F4KA 2WAQA 3L09A 4ZZDA 2ZXHA 4ENKA 2W25A 5FGLA 4AWXB 2EFPA 4ASNA 3SEQA 2K4BA 4M71A 1U6GA 2OU2A 3CJQB 4I6ZA 1RKWA 2KISA 4F92B 4KT5C 3JRBA 1W4MA 5DCMB 4CUGA 3ECHA 2Q2EA 2HI3A 1AKHB 2IXSA 2QGUA 3G71I 1LDKB 1IG7A 3GYHX 1V5GA 1G3SA 1XCBA 3K69A 4A2UA 4AIHA 3G73A 1O3RA 5HSZA 1PDNC 3RDIA 2M9HA 3BP8A 4UVAA 3SZPA 5LEJA 1LE8A 2XSDC 5H6QA 2W24A 3HHHA 3BR5A 3KZZA 3FK7A 1VI0A 3ZP5A 3CCLI 1P2FA 2IGKA 2PEXA 3DKWA 1CF7B 2M87A 3HM5A 3CC7I 3KP2A 1UELB 2G3BA 3RZOJ 2QLZA 2VBZA 3ABUA 1BI2A 3S3OA 3EYIA 1UI6A 1K6YA 1ZGAA 4PUSA 2Y0SN 4RGSA 1XPXA 2HYFA 2MA3A 3Q0UA 2TRTA 1FOYA 1VTNC 2FBIA 3C1DA 3K1MA 1ZELA 3FXJA 5M3FJ 4E4HA 2VJ5A 1IN5A 4HQMA 2HWVA 4YFXF 1RESA 1A04A 4LK1F 4WK8F 3OYAA 4V2FA 1R49A 1YIOA 2ZSIB 3L9FA 2HS5A 2LTPA 4UVCA 4I76A 4RMNA 4B8XA 1YS7A 4ZH4F 1U3EM 3HOYJ 2DDBA 4LJZF 3P9KA 4RS8A 1MDMA 5JFRA 1I6HJ 4L9NA 4E7SA 5EDNA 1WJFA 5DUKA 4H4KC 3OOUA 2MH9A 3N4MA 3P7NA 5LHGA 5E1XA 1ODDA 5FO5A 3F6OA 4LB5A 2XGDA 4C3JJ 3SZGA 2XUBA 1YW9A 1LFPA 1OYWA 3HHGA 1TWCJ 1X4PA 4UUSA 3AAFA 1ZARA 3V8JA 2WAFA 4FASD 1WHUA 2NOGA 3K70C 4ITVA 4DOZA 2CG4A 1MZBA 2UXIA 2ZOYA 2NS7A 5TRDA 2L9VA 1KQ8A 1D5VA 1V3FA 3GX4X 4IHWA 4BYYA 5D18A 3E6BA 4IRHA 2BW3B 2CUJA 3VODA 3TDZC 2B0LA 2DA6A 3HUGA 2ZNYA 2ZCWA 2F5DA 2HZTA 3HSRA 3ABKH 4Y15A 4B09A 1ZREA 3FKJA 1BJZA 3HGYA 4NNJA 1XB4A 3GTGJ 3CJTB 3OYBA 4BDZA 3I56I 2HQ5A 1D0XA 2R7DA 3GTLJ 4HSRA 3BG3A 3GLLA 3AL0C 1SFEA 1U2WA 2E7WA 4BL0B 2P7CB 4Y4RA 4F3QA 3H3UA 1MMAA 5LGNA 1IZ1A 3V4GA 3HOUJ 1YW8A 4M9XA 4A3KJ 1Z0XA 3P9CA 1ZAOA 2HNHA 4DQ2A 4KIFA 4BHCA 1K7AA 3PNTA 2NXNB 2BY0A 3HOVJ 3QYFA 3IV5A 4EEFG 3CC2I 2E1MB 1JTYA 3IAS2 3BRUA 4JL3A 3MVPA 2LR8A 1ON2A 2MBFA 5L3EA 2GFNA 1BOAA 2Q8KA 2IGMA 3BC8A 1G6NA 4A3LJ 3FMRA 4HG2A 5D4SA 2F5FA 1YLFA 2HOSA 4D9JA 3TGNA 1KU2A 1GVDA 5DD8A 4YIFA 2NNYA 1ETXA 2IA0A 2GLOA 5C4YA 3DWLE 3GEUA 2HZDA 4JOMA 4NUBA 2LD5A 1H0MA 4LOCA 4PGHA 3WHCA 5IP9J 4KIBA 1YW7A 3KCCA 2L7FP 4BY7J 4CA0A 2MGQA 5HLTA 1YJNI 1JGGA 3KNWA 2CQNA 1UB9A 3BTIA 2ZCNA 1MSEC 2VQCA 3F8CA 4XKCA 5L3DA 3VW1A 2KT0A 1Y8QB 2VT2A 3H9GA 5K7FA 1S7AA 3K4BA 1MBJA 2LK2A 2FXAA 1Y1WJ 2CQQA 4WF2A 2WA0A 2M5WA 1BIBA 1QO0D 3OL3A 1BC8C 4HOBA 2OCCH 4ME9A 4MXMA 4RGUA 4ZDLA 3RD3A 2PBXA 3LAJA 2BY2A 1RPWA 3GZ6A 1H8AC 2DT5A 4OD4A 4ON0A 2ZNZA 2XKPA 2ZMEB 4WXDA 3HEFA 1TNTA 1WJBA 1MNEA 1XMAA 3CCJI 4TV7A 2DJIA 2ELHA 3ZQIA 5HBUA 3NQOA 2Y75A 3JREA 2B63J 4KT6A 5LD2C 3DPUA 3K7AJ 3MMYB 1RI7A 1HKSA 4KDPA 5KAFC 3DBRB 2ZY9A 4GDFA 2QF7A 4UV9A 5LRSA 4M3EA 4L9JA 4GCTA 1D0ZA 4W1UA 1FMVA 2RN7A 1JUSA 5B3SH 3HSEA 5A2QK 5DAJA 1YI2I 1LDDA 2Q2EB 2XRLA 1DQUA 2E71A 1FY7A 2PMHA 2BVMA 3IH4A 1H88C 2A05A 2EV5A 2L2OA 4BACA 3E5UA 1O7FA 2X6YA 4PGGA 2H09A 1P7JA 3F8NA 3U1KA 3HIFA 2HU9A 4BBSJ 1SFXA 2DA2A 1LE8B 1PVEA 5EZGA 3LSKA 2ISZA 3Q5FA 3BHQA 3VFZA 1H9GA 3E97A 3V8KA 4IRVA 3AG2H 5FJ8J 1Y56A 4Y52J 1QRYA 3LSGA 4IKFA 1DPRA 2E19A 4JX5A 4LK0F 2DFFA 3T8RA 3ZQFA 1YHQI 1XG1A 4A3MJ 2O6GE 5ICGA 3VB2A 4MO7A 4ZC3A 4F93B 3FHZA 1UZCA 2FQ4A 3MKYB 2J5OA 4D7MA 4ENMA 3L2VA 3GTMJ 3W2VA 4CO8A 3OSGA 1T38A 1IDZA 2EWNA 4G6TB 1NH3A 1VFCA 2OBPA 1XGMA 3IKTA 4IOCF 4LLLA 2HDDA 4G94A 2JA6J 4L5IA 3BLYA 2RAEA 3L2WA 5IT9Z 3NRGA 5ILVA 2BXYA 1JT6A 3C2GA 2PMZA 5ICEA 3FMQA 4CH7A 4DBQA 1Z7LA 4XORA 2JVHA 4XKWA 1IN4A 2AHQA 5E3LA 3BPVA 4AVPA 1RIOH 1D5YA 2IS6A 3VW2A 2LBFA 3O3KA 1R4MB 3H92A 1PYVA 3ZN1A 2K86A 1PUFB 2DMPA 1KONA 2L02A 1P6RA 2ZJ2A 3FXKA 3JSJA 2R7TA 2QWWA 1Z6TA 4BQQA 4DZJA 3MN2A 2OZUA 1Z05A 5FLXZ 3OYLA 3KP4A 3AG3H 4HNVA 3S93A 1MDMB 2O9LA 2XPVA 5JI6A 2VLAA 1G3TA 3K4KA 4FX0A 1WJCA 4F91B 4ZDOA 1RETA 3FMSA 4XLNF 3F1BA 2YX7A 1EF4A 3ZMDA 2PJPA 2OI8A 3PASA 3BR6A 4UUSB 3TBIA 1B59A 3ROUA 3SFIA 2DBBA 3JSOA 5J47A 4NN1A 2FE3A 4C9YA 2KIFA 4S0HB 4BNCA 1O3QA 5CQEA 4U7BA 1HC8A 2OERA 1T08B 3K10A 1E17A 1YX3A 3D5LA 3A0HC 3LFUA 1OKRA 3LSHA 3HUGB 3S3MA 4GRIA 1SAUA 3D5SC 4CDGA 2IP2A 3H35A 3T0YA 2A5WA 4CCJA 3GBGA 1X1AA 2DFEA 4MQVA 4RM3A 1HA8A 1J0RA 1H89C 1R7JA 1OR7C 3HE0A 1KQ0A 3TDUC 1VQOI 3DFGA 4RAGA 1MMNA 1OFCX 3PFIA 4AYBA 3EUKL 1QGPA 5DD4A 1S6LA 2BOLA 4XQFA 1FNNA 2Q0OA 3CUOA 2FMYA 2AQFA 2HOEA 2L4MA 5J1UA 4OD5A 3GTJJ 5EEHA 3L2RA 1WZ2A 5E3OA 5GPCA 2NAZA 1SD6A 1XC5A 2P6TA 3TOAA 4CSWA 2NVYJ 4L9TA 4KUMA 3V6GA 2V1NA 3S17J 1D8JA 4EQQA 4LG0A 4BQAA 2VKVA 3MCZA 1FMWA 4KIGA 2M1BA 5JHUA 2DPUA 3CUQC 3DU5A 3TW6A 1KGSA 1WI3A 1WI9A 2VQLA 2CW8A 2R7SA 3ZMZA 1QU3A 3CMEI 2E7XA 3I58A 5F64A 1B9NA 1WGXA 2WY8Q 4OWRB 4RAZA 4P9UA 3CZ6A 3SWHA 3FHNA 1SVMA 5FKMA 2DI3A 4BY1J 2EINH 1E2XA 3A2KA 1E3PA 3K8PC 1FBQA 3KLNA 2LSOA 5B66C 1V4RA 3AG1H 2HFHA 1YFHA 3HZJA 3ISPA 4C2MA 2IS1A 4PJJA 4ESBA 2V1XA 3P5JA 3RIRA 5F6FA 3REOA 2VI6A 2LF7A 4IZZA 3OV8A 2RQPA 4FT8A 3SDGA 2M0MA 2X85A 1Y1VJ 3ONQA 4MFEA 2IS2A 2JN6A 3RKXA 3CCRI 1UG0A 4HF1A 2W57A 4MIMA 2HQRA 2K5CA 3M8EA 1V54H 3PL8A 3P9TA 2G7GA 3VDXA 2P5LC 4IXAA 1P9QC 5AQCA 2IU5A 3H3VK 4BE2A 2JTVA 3LOCA 1R9TJ 4MLOA 5M3MJ 4PJ0C 2BVLA 2XGCA 2DYSH 4QIWN 2PLYA 4Y3OA 2F5VA 4BQOA 2Y0MA 2DMUA 4CYDA 2QVOA 3IP4B 1MBHA 1I5ZA 2GAUA 3PQJA 5F04A 5FLXK 2DA5A 3TL4X 5M5XJ 1GV5A 2GOXB 2X4HA 3HC7A 3QPSA 4IHVA 1AA7A 2DU9A 2XPUA 5E79C 3DBLB 1A5JA 4J00A 3S14J 3LSIA 5F1JA 3PSIA 2JWTA 4A5NA 4O3MA 2PG4A 1HSTA 3DV8A 5D6FA 3CCSI 2XAFA 1W0TA 5BS6A 2XASA 3MZ8A 2ZXIA 3ZPLA 1WJAA 1KA8A 3OMYA 3I4MJ 1QPMA 3RH2A 3CMYA 1EKEA 5CVVA 4AUXA 2E1OA 4ZJZA 2FOKA 4BJTA 3EETA 1O3SA 1FIAA 4U0VA 1PP7U 2ZCXA 1A36A 1IW7F 2R7ZJ 2X6OA 4S05A 3I64A 3Q3SA 1MBGA 3KP7A 4LLNA 1IO2A 1FX7A 2VC1A 1XD7A 1KYZA 3D1NI 5K1YA 2D1VA 4RAYA 3S15J 5FLMJ 2DCEA 2JUGA 4HW0A 1EJ9A 1LEAA 1VF9A 3K2ZA 3HBLA 4ENJA 3VVYA 1TZLA 3QBMA 1U78A 3SEZA 1HLVA 1Y6IA 3LMMA 4UHTA 3FXLA 4YEJA 3W6KB 1UG2A 3NXCA 4DYQA 3BROA 1XN7A 1P92A 2YPRA 4G6QA 1CGPA 3V7RA 1PP8F 1BN5A 1EH7A 3JCUC 3RCOA 3I4PA 4HEA2 4PJMA 4GFKA 5B1BH 5IYBJ 2CV2A 1ACIA 2PI0A 2G7HA 3R61A 2TDXA 2YVEA 3WTWC 3EDPA 1OCRH 2FMLA 3HSFA 4DYRA 5EG0A 2H27A 1BIAA 2LBFB 2J5PA 5DEQA 3EQLF 5J4YA 3OYFA 4ANJA 2IJLA 2P81A 4LB6B 1Z67A 4KWAA 2ZFUA 2JUCA 4M74A 4M6VA 2DW4A 3HPGA 2IPQX 4KN4X 3GTKJ 3K1NA 1RR8C 2YVHA 1SFUA 2DK5A 3RYPA 3FBIB 1EA3A 2EFQA 3L1PA 4GCLA 1HSJA 1FTTA 4E7IA 2VIXA 1U9OA 2W84A 2KQRA 5J1RA 2MABA 2HKUA 3O8HA 3TO7A 1QHGA 1YYVA 2L9RA 2K3PA 3JRIA 3CO7C 3CCMI 2GIVA 2KHMA 4I0AA 1MBFA 1T0FA 3KKCA 3QKXA 3FK6A 2G9WA 3RQIA 1YITI 4G8XA 3ZQCA 5TGTA 4NC6A 3MWMA 1IXCA 1KQ9A 1TWGJ 3FISA 4LFUA 3FXRA 4QPOA 4D7NA 3LSRA 2LREA 2NX4A 2GOMA 4FQGA 2Y2ZA 3A4CA 3A01A 3WE2A 4FISA 4DJAA 3S1NJ 1WSUA 2KDOA 3BG5A 4M72A 1XX5A 5HS9A 1TQIA 3ZMVA 1J5YA 2GA2A 1QBJA 3GFJA 2NVQJ 4M9ZA 1IV6A 2HOTA 3M4OJ 3OYNA 2NRAC 4NB5A 3SQNA 3HB9A 5BNGA 4E7HA 3J81Z 4XOPA 3VPRA 3JRGA 1QZYA 1E3OC 1VQ5I 2IBDA 4Y13A 1WRJA 3BQZA 2HXOA 4IHXA 1R22A 1Z21A 3ZGKA 4LG0B 5ILUA 3H5AA 1IGNA 1VQMI 1ZGJA 4A3JJ 5EF6A 5ED4A 2Z5UA 5DTDA 3O8GA 1FZPB 2NS0A 3E1SA 3LA3A 3E7LA 5KK1A 2JPCA 1WH5A 2M30A 4XKBA 3VVXA 2CO5A 3GWZA 3LSJA 4I2OA 5KHDA 3LA7A 2KPMA 4EV0A 3W6VA 5FHPA 2UXUA 3ASNH 4GFLA 2GXGA 3BY6A 3BR0A 2AXLA 1I50J 2A6TA 3FZVA 3S1RJ 5BPDA 1DGWY 2RHAA 4B47A 5F0HA 4U87A 1RR7A 2HYGD 4LG3A 4LD5A 3M3YJ 2GA1A 1Y0UA 1VQPI 1STZA 4OMYA 2KJCA 1ETQA 4FE4A 1R5HA 3R60A 4BJ6C 3KP3A 4HV5A 2LP0A 3MZHA 5ICCA 1OYIA 4DIQA 1LVAA 5D1RA 3HKZN 3KEQA 3JRFA 3H9JA 2RREA 1BW6A 3EUPA 4BHPA 1SEUA 4UB6C 1N75A 2EH3A 2L01A 2EFNA 2OA4A 3PIOF 1HW2A 3HOZJ 1JKQC 2BEOA 2FD5A 2LC2A 3ABTA 3GMEA 2CUZA 1F1ZA 4HF2A 1ZR4A 5AIPA 2W85A 4F55A 4KYWA 2EFWA 1WJDA 4OAYA 5GADJ 2GIZA 5J40A 3A03A 4F52A 1MIJA 3HXLA 3RZDJ 3B02A 1XMXA 1FEXA 3I4NJ 3T1BA 2CMPA 3CQZJ 2E35A 5H9TA 2VPRA 1SMYF 2A61A 2Z9OA 3KEOA 1PUFA 1ZN2A 2F2EA 2L7ZA 1T6SA 1BA5A 3S2DJ 2QUFA 4HV6A 1W36D 3S3NA 1K79A 5FB2A 2PMUA 3OOPA 2NP3A 2XRNA 2HVQA 5HLHA 1ZLKA 3E0JB 4WX9A 3SJMA 2FRHA 1QZZA 1QQIA 2KLOA 2QCOA 5FROA 1F36A 2VBYA 4N9IA 2DFIA 1ZYRF 3ZOBA 1OPCA 5BPIA 5K58A 1HKQA 4XNFA 2R5YA 1I27A 1LFUP 2O7TA 2BE5F 4ZYGA 1ENHA 4YZEA 3E7QA 4A3GJ 3R6SA 5J1YA 4G6DA 2B9SA 3HRTA 4U0WA 4UUVA 4RB1A 1JTXA 1X1BA 2EA2A 5J4VA 2H6BA 4IQJA 3C3WA 3CCUI 2VASA 3GZIA 1I6XA 2DO7A 1TTYA 3BWGA 1LB2A 4RM2A 3WTYC 2V57A 5F0CA 5EGOB 1MNMC 3IC7A 5D5UB 1T2KA 1E3HA 4EGZA 4NDLA 1QPIA 1Z7UA 5ICFA 3WTVC 3LJLA 4MFDA 1JUPA 1ZGWA 2UXXA 2RVCA 3QRFF 1MKMA 3QQAA 2LDUA 4C30A 4XLPF 2HYTA 2W1OA 3MD2A 2DT6A 4KMFA 3PUFA 1XDUA 1QVUA 2RASA 1EV7A 1VNDA 5DYMA 2HOAA 4UDSA 5EG0B 1ZLJA 2B3WA 4ZYAA 3HRUA 3MKZA 2ME6A 1RZ4A 3GZNB 4O6JA 1ON1A 1XTAA 1G3YA 3WG7H 2CQXA 4XONA 1BC7C 2FNPA 1YS6A 2LH9A 2D2WA 5J3LA 2QSHX 1G2HA 1G59A 1QZEA 3GLXA 4L9VA 4L0ZB 2BBYA 5E17F 3CC4I 2OUMA 4D1QA 2STWA 3ABMH 3DPTA 1LFBA 2JZYA 4BGDA 2JA7J 3HKZA 3CDHA 3VOEA 1UHWA 4RDUA 2F5EA 2L3DA 2L7KA 2TCTA 1P4WA 3KZIC 2PJRA 4BBRJ 3D0SA 1FBSA 2QENA 3OYDA 1ITYA 2Y30A 4BDYA 3SXYA 1U5TB 2UXNA 5D4RA 2Y0SA 4A3FJ 4HBLA 4P1WA 3J80Z 4IHYA 3BR2A 2R3SA 4IRIA 1W5SA 3F8FA 3CJNA 2R7WA 3I59A 1VQ4I 3DXJF 3A01B 4B43A 2V4JC 4IF4A 4WCGA 1BM9A 2JJ7A 4AIKA 4CCOA 1NK2P 4BJ5C 4E7ZA 2VN2A 5JR3A 4GCKA 3TP0A 2GUHA 2XHKA 3N97A 2X1DA 2Z3YA 1TQPA 4RLFA 1U0JA 3ZQLA 4A3DJ 3F0CA 3DKXA 2XPWA 1AOYA 2AS5F 3G56A 5L3CA 3DTEA 5FKLA 4XLCA 1RUOA 3WTUC 1E0EA 2R7FA 3CP8A 2AXTC 2DPDA 1J2XA 2R7XA 3LSPA 2XDVA 1UHSA 2Z33A 4XN3A 3O2PE 1REPC 3NNRA 2Q24A 2XV4S 2DTRA 1XCVA 3BDDA 1A6IA 4GYGA 3CCQI 3CTAA 5M5YJ 2W82A 1TW3A 3H36A 2K9SA 2LLKA 4M6YA 5C4JJ 2EZKA 5CVIA 3SDBA 3QP6A 4FCYA 2VJIA 1MBKA 4EJWA 2K9NA 4L5EA 2RDPA 2XF6A 2Z1DA 1OMIA 4A12A 5IYDJ 2CWEA 2OJED 1MH4A 1OCOH 2MSYA 2O5RA 3FXQA 5K5RA 4XK4A 3KLOA 2XVCA 3HIMA 3BQYA 3A0BC 5E3NA 3CESA 2XDNA 4A0YA 1JUMA 2DA1A 2ELKA 3RI4A 2K7LA 1ZKGA 4NELA 2A3SA 1WCMJ 2Y9YA 4DGWB 2MLKA 3KYLA 3BZ6A 3E6DA 1K83J 3HG9A 4A69C 4V19K 1TW2A 3DCFA 1SMTA 3IRQA 1YO5C 3OR1C 2MC4A 2RKHA 2VKEA 3PFYA 1VQ9I 4KISA 4CXFA 1F5TA 3BJ6A 4CGZA 4A93J 3ECOA 3M1CA 3L7WA 4EM1A 4FE7A 1SC7A 3TO6A 5E1WA 5TISC 5HDKA 2STTA 3AQTA 2NOJB 3E5QA 3KEYA 3H0DA 1HF0A 5L3FA 5IPAA 1X58A 4EJTA 3I9V2 1R23A 1OLTA 1R5GA 4XLAA 4A5MA 1J09A 5C44J 1HQCA 1K61A 1B8IA 3RKQA 1BR4A 4QWQA 2R5ZA 2E1MC 1IDYA 2GENA 3OYEA 1MBEA 3FKIJ 3DLLF 3BJOA 2R7RA 1KZHA 4KN7X 2HXIA 3ZR8X 4BXUA 4ETSA 3VYSB 3J7YJ 1JGSA 5GAEJ 1KU3A 2HQAA 5D5XB 3UKGA 1A6QA 5DS9A 5HAWA 2JA2A 4C3IJ 2H1KA 3RKYA 4JX4A 2VOOA 2VODA 3NRVA 4CICA 2ID6A 4XL9A 2EQRA 3JSPA 3CMMA 2DMQA 5DM7F 2R5YB 2D1HA 4C2MJ 4MNUA 3WTTC 1Y39A 4UY8I 4OMZA 4B1RA 1SFKA 2ZC2A 2K4JA 2DG8A 1BBYA 3J7ZI 2OF7A 2H94A 2IEKA 4IX7A 2DN0A 4CHUA 4HQEA 2JA5J 1X4OA 5GTHC 3M9AA 3GTOJ 3PSFA 2IA2A 2CGPA 9ANTA 5IOYA 3MKLA 3J80K 3JTHA 2ZOZA 3AFHA 5L3BA 5LHIA 2KIQA 3TMOA 3HDDA 3QYEA 3ZQHA 4OIPF 4ABZA 5DCFA 3H5NA 1ZRDA 2F4IA 2L7MP 2CUEA 1B1BA 1NG6A 3VIBA 3SHFA 1VQ8I 3WTZA 4CGRA 2EIJH 2GQQA 6PAXA 2KIMA 2OTLI 2HVSA 3KE2A 4I0BA 2R7OA 2E2IJ 3NAUA 2ME0A 2QKLB 1FP1D 5C4XJ 4QTRA 1ETWA 1BI3A 2WV1A 2FBKA 5B5EC 3OR2C 3G7RA 3BCBA 3VYUB 2ZMEC 3WHBA 5KAIC 4X0GA 3KYCB 2EZHA 4YG2F 2BXZA 2EZIA 4BUPA 3K70D 3Q0WA 4IQ4A 5DDGA 1AU7A 2NVUB 1HDDC 3UR3C 3B6CA 5EEGA 3HTUA 2A68F 4IEJA 4OAZA 2FQ3A 2A69F 3MQ0A 2E5NA 3K1PA 4YFNF 2KIUA 2NVXJ 1IXSB 5E1ZB 3NWSA 4AIDA 1OISA 2I10A 4XKVA 1ZR2A 2KRCA 3LWFA 2CW0F 3NPIA 2VKDA 3PQKA 4RLQA 1SVLA 2E2JJ 2Z16A 1FOKA 2WADA 3VW0A 3BTCA 4KICA 4LGWA 3T6NA 1KU9A 4OINF 1KYWA 1IRFA 4IHSA 2VOPA 1PUEE 2Q1ZB 4NBQA 2MD0A 3BCAA 2BY3A 1ULYA 3GTQJ 1FT9A 3HOWJ 2L0KA 1VQ6I 2NP5A 4D5FA 4FETA 4IO9F 2K3FA 2PJRB 2G0EA 3E6CC 4GYIA 1GVJA 1FP2A 3AG4H 2VKHA 4PFPA 1R36A 4OIQF 3VWBA 1D1AA 1DU0A 1ERDA 4RBOA 2WV0A 3H1CA 2MFZA 3OS2A 2H6CA 3M1EA 3WU1B 5DM6F 3PNVA 3JAMZ 2BY1A 4G7ZF 5LHHA 1D3YA 5IT9K 2VUMJ 3I59B 4CYCA 4MQ9F 3G1OA 4D5CA 1T95A 3P9IA 5HOOA 2DK8A 3HTAA 2VQHA 4X1EA 3BZKA 4EJVA 1DDNA 2REKA 2DOAA 4LIUA 3BNIA 3BJAA 4LLGF 3U9GA 2K27A 2W4SA 4MEXF 3DEUA 3FXOA 1TC3C 1X3ZB 3K4NA 5D5WB 2JQ7A 2K02A 2FEZA 4E7KA 1K4TA 4PFOA 3CO6C 4DBRA 1WKMA 1MMGA 2OZ6A 3LNQA 4GFBA 2R92J 3PNYA 3BG6A 1ONVA 1TLHB 2A5YB 2QSFX 2ZCMA 2CFOA 1YIJI 4C2TA 3QWLA 4ZDPA 3PPBA 3JTGA 4RGXA 4LIVA 1L0OC 3WTSC 3GO5A 1N78A 3TO9A 3ZMTA 4LMYA 1TL8A 1ZG3A 4G12A 1HCRA 3A02A 3BTJA 3KZ9A 2VQGA 3FXMA 4BXXJ 1Z6RA 3LAPA 2EV6A 2WB1N 3BR1A 1T39A 3F72A 2ETHA 5EFYA 4M3BA 4IL6C 2XGXA 2DOEA 2WAQN 4P5OA 4A3EJ 2DFHA 1FSHA 4GGGA 2EIKH 1Y8RB 2M34A 4V2GA 1GUUA 3DEWA 4UV8A 2L4AA 2QA4I 1JKPC 2ZB9A 2P6SA 4JKZA 2L9SA 1YRNA 2GM4A 4M9SA 5EGOA 4CZCA 2PX9A 5J6XA 1XGOA 5CKTA 1P7IA 1J75A 1T56A 1F9NA 2KL4A 4C3HJ 4L62A 2CSOA 5JVGF 3IUOA 3F23A 4PK4A 5CW8A 3GCMA 4KNYA 1DP7P 3O6BB 5GAHJ 2ZXWH 4XLHA 4XRMA 1T98A 2ZBKA 2ZO4A 2D45A 1I3AA 5F08A 4P55A 2NVTJ 3ANPA 5CLSA 4AD9A 3K4JA 4RGRA 4N4NB 1NTCA 4GXOA 1BW5A 5HDNA 2DA3A 3ERMA 1WH7A 3BJBA 4UB8C 4A6EA 3V7SA 2KZGA 3K4LA 3VYRB 1ZH5A 2DAOA 5ERIA 3JRCA 1IN7A 3FDYA 4HDUA 2DQRA 1TQMA 3W3CA 4YIIA 4M3FA 1R6RA 1B8IB 4OIOF 3NEUA 4BS9A 2R5ZB 2M4GA 1MJ9A 2VE9A 3EUAA 3VOXA 4I01A 1V5EA 2BYVE 2BGCA 2CV0A 1FC3A 2VBXA 4IJAA 1XSDA 4HRIA 2FX0A 3TOBA 3RKWA 5K5OA 5CXGA 4BQNA 4DYCA 1S3JA 4ENNA 2HTSA 1Z77A 3DKYA 2XGEA 3EUHA 5LGUA 3JRAA 3IHUA 3OSFA 4JX6A 4QSHA 3S2HJ 1ZRFA 3WODF 3IL2A 1LVKA 3LL7A 5IT3A 2FJ1A 5CVUA 2OCEA 2B7EA 2HEOA 5E18F 4E70A 4PJLA 2ECCA 1R1VA 3ZMUA 3H0GJ 1BI0A 3OYIA 4FTHA 2EV0A 4ZYHA 1D1BA 2IGNA 1G3WA 2LYCA 3COAC 5CPRB 2O8KA 1WFXA 1U5TA 2CH0A 3CP2A 3JRDA 2F5CA 1K78A 1GV2A 2QSGX 1G4DA 2BHZA 1ZQ3P 3LA2A 2YU9J 3K2AA 2Y31A 2LVSA 5GAGJ 4BE1A 3CDIA 4HKUA 2K9MA 3RSNA 4XIDA 3JAMK 4J01A 2HKXA 3TW7A 3HRMA 2DOFA 4XLFA 3TP3A 4BE0A 5FKKA 4AIJA 3S16J 1IRGA 1TWHJ 2FNAA 1UCRA 3CDLA 2HYJA 5F27A 2XAJA 2LKPA 4HNTA 4U7DA 1HW1A 1OR7A 1R00A 1X1CA 2E5ZA 2EBIA 4M6XA 2DJNA 4MGRA 4G7HF 1MW7A 1SAXA 1I1GA 2IA1A 4P96A 3RYRA 3AL0B 3BTLA 1XGSA 4A3BJ 2VPLA 4JBAA 2PBIA 3RPUA 2Z2SB 2UXPA 2RNJA 4BEHA 4O5VA 2Y9ZA 2UXHA 1X3UA 3C2BA 3SZTA 5GPAA 3NI7A 2PFVA 3CLQA 1TNSA 4A0XA 4EJOA 1USSA 3SYTA 4Q47A 4BXFA 2NYXA 3OYCA 1NK3P 2R7QA 3CUQA 3GFIA 1HKTA 2F4MB 1WWXA 2KKOA 3WU0A 3Q9VA 1ZG5A 1S72I 2L9NA 1SANA 4WXCA 2DA7A 1U8RA 1DGRM 2M8EA 1HXDA 1NHAA 3CCEI 2LG4A 2DA4A 2V9VA 2E36A 2M0CA 3CJRB 3R0AA 2LNBA 4I7HA 1TT5B 2MYSA 2I8DA 1R1UA 3KX2A 3K9TA 3X2QH 5JHFA 2EJRA 5K5QA 1GHCA 2DT7B 1MJBA 4HX7A 2CRGA 2PFBA 3RQ4A 3F8BA 3ANGA 5C3EJ 2K9QA 3KP6A 1X1PA 2QBYA 4XRFA 3RPQA 3W2AA 4HLYA 5KNLA 3ZQ7A 4CCKA 3RPUD 2X1CA 5GTIC 5TJJA 4PJNA 1JHFA 2IW5A 3CF5F 5H2FC 3S8PA 2P0WA 4MTDA 2O61A 2A6EF 3GFMA 2OQGA 2RGVA 1K6OA 1O7LA 3J7AY 2G7LA 4EATA 3KPHA 4B3AA 4B48A 3COLA 4I02A 2CU7A 4R8HA 1HDPA 1RUNA 2UWMA 2ADUA 4CYCB 3FM5A 1X3WB 5D8KB 3BG7A 4NC7A 3QU6A 2F4OB 3FWEA 2OAZA 2Y69H 2ZFWA 4XRSA 2F6CA 2WBMA 1ETKA 2HQNA 2V6CA 3BOQA 3NARA 4CZZA 4BHBA 2L54A 2M3AA 4KFCA 2KMUA 1JKRC 1MNDA 2CJJA 1FIPA 3ESWB 3MEXA 3S32A 1A31A 1J59A 3OYMA 3AQSA 3ML6A 2KRFA 2CYYA 2H1LA 2MH2A 2WY7Q 5HDGA 1BR2A 2ZXJA 2VB6A 4B44A 1GDTA 2X48A 2O8XA 3F6VA 1RC9A 3F8MA 4XLEA 5FGMA 2E2HJ 2EFOA 2WTEA 5AONA 1YJWI 1XGNA 4G7OF 2VE8A 3HJEA 4Z6YA 4U9NA 1XSXA 1SD4A 3CJDA 4ZYEA 3V8LA 2DDAA 1IN6A 2K85A 3PIPF 4IRGA 5M5WJ 5E8IA 3LQQA 2X51A 1IC8A 4CCNA 3ELKA 4NQWA 2P7VB 2COBA 2VONA 2ZJQF 2N8GA 2QQAA 2KFDA 2DLLA 3HOXJ 1VZ0A 1LPQA 5A2QZ 4C2UA 3S1QJ 1HOMA 5D5VB 1TWFJ 3N05A 4YFKF 1VQLI 1IUYA 2X0LA 1YRNB 5EEAA 2XF5A 1W1WE 2FF4A 5CXIA 2V9KA 3OS1A 2V6EA 2DTZA 4Y33A 1SVOA 1X2NA 2QOPA 3OWTA 4OOIA 3J81K 3S1MJ 1TP4A 2K9LA 2YUSA 4MK6A 1X1DA 5JVTA 4EJUA 2V79A 3LSTA 4ICHA 2LY9A 1NG7A 1N25A 3IAM2 2YX4A 4PXIA 3DPLC 2XAQA 3WGIA 1DUXC 1TT0A 4HA8A 1AHDP 2WWYA 4D0PA 2MLGA 4UUTA 3DTKA 2RC4A 5H20A 3ON4A 3QOEA 2OPTA 3RJPA 4EMSA 4H0EA 2W53A 1Z91A 2ELJA 2XAGA 3HPHA 1LJ9A 3S2WA 3HTHA 3MZYA 3NWTA 3SFZA 2JA8J 3H5RA 3IH2A 3KZYA 2XKOA 4JP0A 2XF7A 2WC2A 3E3VA 4Q48A 3FXUA 2VL8A 1XS9A 1B72A 4HYEA 2FUG2 4WXHA 3IUVA 4XR6A 2HPMA 1TBXA 2PMZN 2HDCA 1G8XA 2R4GA 2IAIA 4IPAA 2W48A 1D0YA 1YE9A 1POGA 2BV6A 5HS8A 1I39A 3PJRA 1ZK8A 2HGCA 2EPFA 3QYBA 4NHJA 4UNOA 4IHTA 3M7GA 2LMDA 3EYYA 3F3XA 4XN0A 4F7ZA 5LEKA 1OCCH 3OYHA 1SD5A 3QODA 5B1AH 1JJ6C 5CVJA 1B9MA 4Y17A 4I99C 2CQKA 1IN8A 3B81A 2JRMA 1K78B 1OCZH 3OY9A 1YG2A 2DMNA 5F1RA 3DEEA 3FM3A 1JI8A 4WIBA 5D19A 3HTIA 4UVBA 1EH6A 3QPLA 5CVRA 5KVRA 1V55H 4PZJA 1IAWA 4GO1A 3KFWX 1SGMA 1S9HA 1S29A 1I1SA 1KU7A 4HDVA 4AF5A 3UNGC 2FOWA 3G6EI 5F0FA 4ZYDA 3C18A 3WU2C 3DLAA 3G1MA 1RRJA 4DVYP 2MD5A 5JLXA 4YRVA 4EM0B 4BEHB 3ZXSA 2H8WA 3G2BA 2A07F 4A3CJ 4IVNA 5LBQA 5BMZA 1QA6A 3JR9A 4AYBN 1S5LC 2CV1A 3QOPA 4OIRF 4X6AJ 1DU6A 4YELA 5KCMA 1ETOA 2ID3A 3CUQB 4HNUA 4U0YA 2RV8A 5BQTA 3GUDA 3ERED 2RNGA 3GFLA 5FD6A 5JLWA 4I09A 3HTSB 5FKNA 3GZ5A 2OC6A 2L5QA 2R93J 1DPUA 2GZWA 1F43A 1FPQA 4XICA 2XB5A 5HNHA 1X19A 2QZ8A 1T8IA 2MW8A 2YSRA 2VC0A 1Q1VA 1WPKA 3V7CA 4L0YB 3B6AA 2QBYB 2XAHA 4KJZA 2CS3A 1XSVA 2A6HF 2NNNA 4PSXA 2CQ7A 2CUFA 3L2UA 2IRFG 1ZTRA 1BR1A 2P5KA 2MC3A 3ZCOA 2DMTA 1JT0A 1JKOC 1H9TA 5FMPA 2XROA 4E6KG 4M3DA 5D6EA 2JSCA 4ZZLA 5HODA 2LOOA 1D8KA 3O60A 1FOWA 3BCGA 4KA4A 4B4CA 4BH9A 2W00A 4Y7NJ 3GVAA 2JT1A 4AC6A 5K7ZA 2ESHA 1HW5A 4XSXF 4DNCA 1YTYA 3V78A 3HYIA 2HR3A 3C2HA 3D5RC 4MHGA 3AKZA 2R7UA 1S7OA 3KETA 4EVIA 1XDSA 4AC0A 4N9HA 2VJJA 3MAJA 2W7NA 3C07A 2FJI1 2VJ4A 3I0TA 3G1LA 2OQRA 3KYDB 2JSPA 2V26A 4HX8A 3DPJA 1UMQA 2FBHA 1EH8A 2JK3A 3DTIA 4N0BA 2CFXA 4UXNA 3KP5A 3ZQGA 1LNWA 2QQ8A 2XB0X 2O03A 1W0UA 3BPXA 1P4AA 5IP7J 3CMAI 1LEBA 1C0WA 4AM3A 2ACJA 1WJEA 4QPQA 4CCLA 5IOZA 3QAHA 5J8FA 1BL0A 2G7SA 2P4WA 3GW2A 3OIOA 1LUJB 3EUHC 3OS0A 3F21A 2QM3A 3A1YA 1QHHD 2O0YA 2GXAA 1FTZA 5E8GA 2QKOA 5EYRA 5ILSA 1FYKA 4NC8A 5FFZA 3BT9A 1K4SA 4NQWB 2ESNA 2KDZA 3FBNB 4HF0A 2YR2A 3IRRA 3WGHA 1O3TA 1CQTA 1LQ1A 2R0QC 4KITB 1T0FC 3MKWB 3ON2A 3FIWA 3B73A 1TWAJ 1MMDA 4E7JA 3HTJA 1V5FA 2X9DA 3EGQA 1U5TC 1W7PA 1Y0NA 3PO2J 5EJCA 4IOAF 1JXSA 3ZQQA 3CD6I 2COMA 3L00A 1O57A 3K4MA 3C7JA 2LKXA 5BOXA 1VQKI 2BZTA 4HSTA 2HPIA 2MG4A 2I5UA 5DUIA
chains in the Genus database with same CATH topology
4L62A 1JKQC 1MBJA 2FD5A 2LK2A 5CW8A 1Y1WJ 2CQQA 1QVTA 3PM1A 4XRMA 1ZR4A 5F08A 2NVTJ 4JNNA 3ANPA 4ME9A 4MXMA 3A03A 3RD3A 1NTCA 2O7OA 1BW5A 2PBXA 3RZDJ 2DA3A 1FEXA 1WH7A 1RPWA 1H8AC 3I4NJ 3CQZJ 3BJBA 5H9TA 1MH3A 2VPRA 1IRZA 3HEFA 3JRCA 1PUFA 1GT0C 2L7ZA 1B8IB 4M3FA 3S2DJ 1BA5A 2WGBA 2R5ZB 2UXOA 5HBUA 3ZQIA 1APLC 3VOXA 2NP3A 3JREA 2FX0A 1B72B 2B63J 5CXGA 4DYCA 3K7AJ 3SJMA 2IU5A 1Z77A 2XGEA 3JRAA 3OSFA 3S2HJ 4JX6A 2QCOA 4QSHA 1F36A 2QF7A 2FJ1A 4M3EA 1ETVA 3ZOBA 4GCTA 4W1UA 5K58A 1JUSA 5DAJA 2R5YA 2ECCA 2PZ9A 2QWTA 1AKHA 2XRLA 3H0GJ 1LFUP 3IH4A 4FTHA 1H88C 2O7TA 4M3GA 3VVZA 2K40A 1ENHA 4YZEA 3E7QA 2O8KA 1P7JA 4A3GJ 5J1YA 3JRDA 1GV2A 4BBSJ 2DA2A 1ZQ3P 2F07A 4W97A 3K2AA 1LE8B 2Y31A 2LVSA 5EZGA 2YU9J 1JTXA 3BHQA 4HKUA 5IYCJ 4XIDA 1IUFA 5FJ8J 3TW7A 4Y52J 2AO9A 1QRYA 3LSGA 2LFBA 3TP3A 3GZIA 3VUQA 1X2MA 2E19A 5FKKA 4JX5A 3S5RA 3ZQFA 2V57A 3S16J 5E3MA 3VOKA 1TWHJ 1XG1A 5F0CA 4A3MJ 5EGOB 1MNMC 1UI5A 4MO7A 3CDLA 2HYJA 5F27A 2FQ4A 4D7MA 4NDLA 3GTMJ 1IDZA 3TEDA 3OSGA 1QPIA 4ACIA 1I3QJ 3Q0VA 5EZHA 3LJLA 4MFDA 2EBIA 1VFCA 2DJNA 1JUPA 1ZGWA 2WUIA 2HDDA 2JA6J 3NRGA 2RAEA 3VP5A 1JT6A 3QQAA 3BTLA 4XRSG 4A3BJ 2HYTA 1ORKA 2UXPA 2UXHA 2Y9ZA 5GP9A 4J19A 3C2BA 5GPAA 2AHQA 5E3LA 3NI7A 1QVUA 2RASA 2H8RA 1D5YA 1VNDA 2QTQA 4UDSA 2HOAA 3VW2A 5EG0B 3CCYA 1NK3P 2QIBA 2ME6A 3JRHA 1PUFB 2DMPA 3MNLA 3JSJA 4DZJA 3MN2A 2CQXA 1SANA 4DZPA 3CRJA 2DA7A 4DW6A 2EZLA 4HNVA 2DA4A 2M0CA 2O9LA 5J3LA 2XPVA 3FRQA 1G2HA 1RETA 2CRGA 3PO3J 3ANGA 5C3EJ 2K9QA 3F1BA 1LFBA 3BR3A 1EF4A 2JA7J 2OI8A 3PASA 1OJLA 3BR6A 1OCTC 4UUSB 3SFIA 4RDUA 4NN1A 2TCTA 4S0HB 4BBRJ 2DG7A 2OERA 1S7EA 1ITYA 2Y30A 4A3FJ 2G7LA 1ETYA 4BKXA 4B3AA 4IHYA 3BR2A 3COLA 3GBGA 2CU7A 1H89C 3HE0A 2M8GX 1HDPA 4A3IJ 3A01B 4CYCB 2JJ7A 1OFCX 1NK2P 4GCKA 3TP0A 2GUHA 5J1UA 4XRSA 3GTJJ 3ZQLA 1ETKA 3NARA 4A3DJ 3F0CA 2XPWA 5E3OA 3G56A 5GPCA 1XC5A 2NVYJ 1JKRC 5FKOA 5FKLA 3V6GA 2CJJA 3S17J 1FIPA 3CWRA 2ECBA 2VKVA 3LSPA 3AQSA 1UHSA 3TW6A 1WI3A 5IP6A 3GTPJ 3NNRA 2Q24A 1SFOJ 1A6IA 2JMWA 5M5YJ 1JJ8C 1GDTA 1WGXA 2NS8A 2X48A 2K9SA 2E2HJ 2LLKA 2D5VA 5FKMA 5C4JJ 2EZKA 4BY1J 4FCYA 2YS9A 1MBKA 2K9NA 3LHQA 4L5EA 3CJDA 5IYDJ 5M5WJ 1MH4A 2MSYA 2D6YA 3IH3A 1IC8A 4XK4A 2GBYA 3HIMA 3BQYA 5E3NA 2XDNA 3KKDA 1T33A 2COBA 3LWJA 2N8GA 1JUMA 3BG9A 2VI6A 3HOXJ 2FBQA 3S1QJ 2DA1A 1U9NA 2ELKA 1HOMA 3SDGA 1TWFJ 1ZKGA 4NELA 1Y1VJ 2Y9YA 1WCMJ 4MFEA 5FLVA 1YRNB 5EEAA 2JN6A 1RKTA 5CXIA 4MIMA 1OCPA 2DTZA 3HGGA 1K83J 1X2NA 4A69C 1O4XA 2QOPA 3DCFA 3S1MJ 3P9TA 2G7GA 2YUSA 4MK6A 2VKEA 1FJLA 1MSFC 1U8BA 4A93J 4ICHA 2LY9A 5AQCA 4FE7A 4JYKA 3H3VK 4PXIA 3LOCA 3AQTA 1R9TJ 4MLOA 5M3MJ 1IJWC 1AHDP 1HF0A 2XGCA 4QIWN 1X58A 5IPAA 4UUTA 3ON4A 5C44J 2OPTA 2W53A 1K61A 1B8IA 2M2EA 3RKQA 2DMUA 3HTHA 2R5ZA 2JA8J 2GENA 1IDYA 1MBEA 3FKIJ 1MBHA 3IH2A 4JP0A 5K7HA 5F04A 2HXIA 2DA5A 5M5XJ 1GV5A 1XS9A 1B72A 3QPSA 4IHVA 3IUVA 2PMZN 2XPUA 5FGLA 2IAIA 1A5JA 2W48A 1POGA 3UKGA 5DS9A 5HAWA 1ZK8A 4C3IJ 2H1KA 4I6ZA 1RKWA 4JX4A 5F1JA 2JWTA 3S14J 2ID6A 2EQRA 3JRBA 2DMQA 2R5YB 1W0TA 2HI3A 4C2MJ 1AKHB 3RH2A 3I4MJ 4B1RA 3CMYA 1IG7A 1JJ6C 4AUXA 2DG8A 2E1OA 5HSZA 1FIAA 2OF7A 2ZCXA 3B81A 2IEKA 2M9HA 2R7ZJ 2X6OA 2DN0A 3GTOJ 2JA5J 1LE8A 2DMNA 3Q3SA 1MBGA 9ANTA 5IOYA 3MKLA 2XSDC 3D1NI 5D19A 2ZOZA 3HTIA 3BR5A 3HDDA 3ZQHA 3FK7A 1VI0A 3QPLA 4ABZA 3S15J 2L7MP 5FLMJ 2CUEA 3VIBA 1SGMA 1VF9A 3HM5A 3HBLA 3VVYA 4CGRA 3QBMA 1U78A 2G3BA 2E2IJ 1HLVA 3RZOJ 3NAUA 2ME0A 5C4XJ 4AF5A 4QTRA 1UG2A 1ETWA 4DYQA 3NXCA 1UI6A 2WV1A 5F0FA 3G1MA 2Y0SN 3G7RA 3WHBA 3Q0UA 5JLXA 2TRTA 4GFKA 5IYBJ 2EZHA 2EZIA 5M3FJ 4A3CJ 2YVEA 3Q0WA 5EG0A 4DYRA 1AU7A 3JR9A 1HDDC 4AYBN 3B6CA 1RESA 2MG4A 4X6AJ 1DU6A 4V2FA 4IEJA 2P81A 1ETOA 2ID3A 4KWAA 2LTPA 4I76A 4M6VA 3HOYJ 2NVXJ 3GTKJ 5JLWA 2YVHA 2I10A 1ZR2A 5FKNA 2R93J 1I6HJ 5EDNA 1F43A 4XICA 2E2JJ 2XB5A 3NPIA 3OOUA 3L1PA 3VW0A 1FTTA 3BTCA 3T6NA 4GCLA 2MW8A 1U9OA 2XGDA 5J1RA 1Q1VA 1WPKA 4C3JJ 2HKUA 3O8HA 3B6AA 1TWCJ 4UUSA 3GTQJ 2L9RA 3HOWJ 2NOGA 2CUFA 2L0KA 3JRIA 2NP5A 4D5FA 1ZTRA 2UXIA 2ZOYA 2NS7A 1MBFA 2DMTA 2G0EA 3QKXA 1JT0A 3KKCA 1JKOC 4IHWA 3FK6A 5FMPA 5D18A 3RQIA 3ZQCA 2DA6A 1DU0A 4M3DA 1TWGJ 3FISA 4RBOA 3LSRA 4D7NA 5HODA 2NX4A 3O60A 3BCGA 2Y2ZA 4B4CA 4Y7NJ 2VUMJ 3A01A 1BJZA 4FISA 4CYCA 3HGYA 3S1NJ 4AC6A 3GTGJ 3G1OA 3BG5A 5K7ZA 2HQ5A 4D5CA 3GTLJ 3V78A 3BG3A 3HTAA 4X1EA 2NVQJ 2HOTA 1IV6A 3M4OJ 2REKA 5BNGA 3HB9A 3BNIA 3VPRA 1TC3C 3JRGA 4AC0A 3HOUJ 1E3OC 2IBDA 3C07A 4A3KJ 3BQZA 1Z0XA 3G1LA 2HXOA 4IHXA 3LNQA 4GFBA 2R92J 3DPJA 1UMQA 2JK3A 1IGNA 3HOVJ 3ZQGA 4A3JJ 5EF6A 5DTDA 3O8GA 3IV5A 2XB0X 1W0UA 4EEFG 2ZCMA 5IP7J 3VVXA 1JTYA 3E7LA 3PPBA 1WH5A 3BRUA 3LSJA 4JL3A 3MVPA 5IOZA 2LR8A 1BL0A 2G7SA 1HCRA 2GFNA 4G12A 3OIOA 3W6VA 5FHPA 2UXUA 3A02A 3BTJA 4GFLA 3KZ9A 3BR0A 1I50J 3S1RJ 4A3LJ 4BXXJ 2WB1N 1FTZA 3BR1A 5EYRA 2QKOA 2HOSA 2RHAA 5F0HA 3BT9A 5EFYA 1RR7A 1GVDA 3M3YJ 4M3BA 1ETXA 2KDZA 2WAQN 4FE4A 1ETQA 4A3EJ 1CQTA 2R0QC 2GLOA 5C4YA 3GEUA 3ON2A 3FIWA 2M34A 1TWAJ 4V2GA 1GUUA 3DEWA 2LD5A 4LOCA 2X9DA 3HTJA 3WHCA 2LP0A 3EGQA 1JKPC 5IP9J 4BY7J 2L7FP 1JGGA 2ZB9A 2MGQA 3PO2J 3KNWA 4JKZA 3BTIA 2ZCNA 1YRNA 1MSEC 2GM4A 3HKZN 5D1RA 5EGOA 3VW1A 3JRFA 2KT0A 5K7FA 2LKXA 1BW6A 1P7IA 3EUPA 1T56A 2EH3A 4C3HJ 3HOZJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L62 A;  1JKQ C;  1MBJ A;  2FD5 A;  2LK2 A;  5CW8 A;  1Y1W J;  2CQQ A;  1QVT A;  3PM1 A;  4XRM A;  1ZR4 A;  5F08 A;  2NVT J;  4JNN A;  3ANP A;  4ME9 A;  4MXM A;  3A03 A;  3RD3 A;  1NTC A;  2O7O A;  1BW5 A;  2PBX A;  3RZD J;  2DA3 A;  1FEX A;  1WH7 A;  1RPW A;  1H8A C;  3I4N J;  3CQZ J;  3BJB A;  5H9T A;  1MH3 A;  2VPR A;  1IRZ A;  3HEF A;  3JRC A;  1PUF A;  1GT0 C;  2L7Z A;  1B8I B;  4M3F A;  3S2D J;  1BA5 A;  2WGB A;  2R5Z B;  2UXO A;  5HBU A;  3ZQI A;  1APL C;  3VOX A;  2NP3 A;  3JRE A;  2FX0 A;  1B72 B;  2B63 J;  5CXG A;  4DYC A;  3K7A J;  3SJM A;  2IU5 A;  1Z77 A;  2XGE A;  3JRA A;  3OSF A;  3S2H J;  4JX6 A;  2QCO A;  4QSH A;  1F36 A;  2QF7 A;  2FJ1 A;  4M3E A;  1ETV A;  3ZOB A;  4GCT A;  4W1U A;  5K58 A;  1JUS A;  5DAJ A;  2R5Y A;  2ECC A;  2PZ9 A;  2QWT A;  1AKH A;  2XRL A;  3H0G J;  1LFU P;  3IH4 A;  4FTH A;  1H88 C;  2O7T A;  4M3G A;  3VVZ A;  2K40 A;  1ENH A;  4YZE A;  3E7Q A;  2O8K A;  1P7J A;  4A3G J;  5J1Y A;  3JRD A;  1GV2 A;  4BBS J;  2DA2 A;  1ZQ3 P;  2F07 A;  4W97 A;  3K2A A;  1LE8 B;  2Y31 A;  2LVS A;  5EZG A;  2YU9 J;  1JTX A;  3BHQ A;  4HKU A;  5IYC J;  4XID A;  1IUF A;  5FJ8 J;  3TW7 A;  4Y52 J;  2AO9 A;  1QRY A;  3LSG A;  2LFB A;  3TP3 A;  3GZI A;  3VUQ A;  1X2M A;  2E19 A;  5FKK A;  4JX5 A;  3S5R A;  3ZQF A;  2V57 A;  3S16 J;  5E3M A;  3VOK A;  1TWH J;  1XG1 A;  5F0C A;  4A3M J;  5EGO B;  1MNM C;  1UI5 A;  4MO7 A;  3CDL A;  2HYJ A;  5F27 A;  2FQ4 A;  4D7M A;  4NDL A;  3GTM J;  1IDZ A;  3TED A;  3OSG A;  1QPI A;  4ACI A;  1I3Q J;  3Q0V A;  5EZH A;  3LJL A;  4MFD A;  2EBI A;  1VFC A;  2DJN A;  1JUP A;  1ZGW A;  2WUI A;  2HDD A;  2JA6 J;  3NRG A;  2RAE A;  3VP5 A;  1JT6 A;  3QQA A;  3BTL A;  4XRS G;  4A3B J;  2HYT A;  1ORK A;  2UXP A;  2UXH A;  2Y9Z A;  5GP9 A;  4J19 A;  3C2B A;  5GPA A;  2AHQ A;  5E3L A;  3NI7 A;  1QVU A;  2RAS A;  2H8R A;  1D5Y A;  1VND A;  2QTQ A;  4UDS A;  2HOA A;  3VW2 A;  5EG0 B;  3CCY A;  1NK3 P;  2QIB A;  2ME6 A;  3JRH A;  1PUF B;  2DMP A;  3MNL A;  3JSJ A;  4DZJ A;  3MN2 A;  2CQX A;  1SAN A;  4DZP A;  3CRJ A;  2DA7 A;  4DW6 A;  2EZL A;  4HNV A;  2DA4 A;  2M0C A;  2O9L A;  5J3L A;  2XPV A;  3FRQ A;  1G2H A;  1RET A;  2CRG A;  3PO3 J;  3ANG A;  5C3E J;  2K9Q A;  3F1B A;  1LFB A;  3BR3 A;  1EF4 A;  2JA7 J;  2OI8 A;  3PAS A;  1OJL A;  3BR6 A;  1OCT C;  4UUS B;  3SFI A;  4RDU A;  4NN1 A;  2TCT A;  4S0H B;  4BBR J;  2DG7 A;  2OER A;  1S7E A;  1ITY A;  2Y30 A;  4A3F J;  2G7L A;  1ETY A;  4BKX A;  4B3A A;  4IHY A;  3BR2 A;  3COL A;  3GBG A;  2CU7 A;  1H89 C;  3HE0 A;  2M8G X;  1HDP A;  4A3I J;  3A01 B;  4CYC B;  2JJ7 A;  1OFC X;  1NK2 P;  4GCK A;  3TP0 A;  2GUH A;  5J1U A;  4XRS A;  3GTJ J;  3ZQL A;  1ETK A;  3NAR A;  4A3D J;  3F0C A;  2XPW A;  5E3O A;  3G56 A;  5GPC A;  1XC5 A;  2NVY J;  1JKR C;  5FKO A;  5FKL A;  3V6G A;  2CJJ A;  3S17 J;  1FIP A;  3CWR A;  2ECB A;  2VKV A;  3LSP A;  3AQS A;  1UHS A;  3TW6 A;  1WI3 A;  5IP6 A;  3GTP J;  3NNR A;  2Q24 A;  1SFO J;  1A6I A;  2JMW A;  5M5Y J;  1JJ8 C;  1GDT A;  1WGX A;  2NS8 A;  2X48 A;  2K9S A;  2E2H J;  2LLK A;  2D5V A;  5FKM A;  5C4J J;  2EZK A;  4BY1 J;  4FCY A;  2YS9 A;  1MBK A;  2K9N A;  3LHQ A;  4L5E A;  3CJD A;  5IYD J;  5M5W J;  1MH4 A;  2MSY A;  2D6Y A;  3IH3 A;  1IC8 A;  4XK4 A;  2GBY A;  3HIM A;  3BQY A;  5E3N A;  2XDN A;  3KKD A;  1T33 A;  2COB A;  3LWJ A;  2N8G A;  1JUM A;  3BG9 A;  2VI6 A;  3HOX J;  2FBQ A;  3S1Q J;  2DA1 A;  1U9N A;  2ELK A;  1HOM A;  3SDG A;  1TWF J;  1ZKG A;  4NEL A;  1Y1V J;  2Y9Y A;  1WCM J;  4MFE A;  5FLV A;  1YRN B;  5EEA A;  2JN6 A;  1RKT A;  5CXI A;  4MIM A;  1OCP A;  2DTZ A;  3HGG A;  1K83 J;  1X2N A;  4A69 C;  1O4X A;  2QOP A;  3DCF A;  3S1M J;  3P9T A;  2G7G A;  2YUS A;  4MK6 A;  2VKE A;  1FJL A;  1MSF C;  1U8B A;  4A93 J;  4ICH A;  2LY9 A;  5AQC A;  4FE7 A;  4JYK A;  3H3V K;  4PXI A;  3LOC A;  3AQT A;  1R9T J;  4MLO A;  5M3M J;  1IJW C;  1AHD P;  1HF0 A;  2XGC A;  4QIW N;  1X58 A;  5IPA A;  4UUT A;  3ON4 A;  5C44 J;  2OPT A;  2W53 A;  1K61 A;  1B8I A;  2M2E A;  3RKQ A;  2DMU A;  3HTH A;  2R5Z A;  2JA8 J;  2GEN A;  1IDY A;  1MBE A;  3FKI J;  1MBH A;  3IH2 A;  4JP0 A;  5K7H A;  5F04 A;  2HXI A;  2DA5 A;  5M5X J;  1GV5 A;  1XS9 A;  1B72 A;  3QPS A;  4IHV A;  3IUV A;  2PMZ N;  2XPU A;  5FGL A;  2IAI A;  1A5J A;  2W48 A;  1POG A;  3UKG A;  5DS9 A;  5HAW A;  1ZK8 A;  4C3I J;  2H1K A;  4I6Z A;  1RKW A;  4JX4 A;  5F1J A;  2JWT A;  3S14 J;  2ID6 A;  2EQR A;  3JRB A;  2DMQ A;  2R5Y B;  1W0T A;  2HI3 A;  4C2M J;  1AKH B;  3RH2 A;  3I4M J;  4B1R A;  3CMY A;  1IG7 A;  1JJ6 C;  4AUX A;  2DG8 A;  2E1O A;  5HSZ A;  1FIA A;  2OF7 A;  2ZCX A;  3B81 A;  2IEK A;  2M9H A;  2R7Z J;  2X6O A;  2DN0 A;  3GTO J;  2JA5 J;  1LE8 A;  2DMN A;  3Q3S A;  1MBG A;  9ANT A;  5IOY A;  3MKL A;  2XSD C;  3D1N I;  5D19 A;  2ZOZ A;  3HTI A;  3BR5 A;  3HDD A;  3ZQH A;  3FK7 A;  1VI0 A;  3QPL A;  4ABZ A;  3S15 J;  2L7M P;  5FLM J;  2CUE A;  3VIB A;  1SGM A;  1VF9 A;  3HM5 A;  3HBL A;  3VVY A;  4CGR A;  3QBM A;  1U78 A;  2G3B A;  2E2I J;  1HLV A;  3RZO J;  3NAU A;  2ME0 A;  5C4X J;  4AF5 A;  4QTR A;  1UG2 A;  1ETW A;  4DYQ A;  3NXC A;  1UI6 A;  2WV1 A;  5F0F A;  3G1M A;  2Y0S N;  3G7R A;  3WHB A;  3Q0U A;  5JLX A;  2TRT A;  4GFK A;  5IYB J;  2EZH A;  2EZI A;  5M3F J;  4A3C J;  2YVE A;  3Q0W A;  5EG0 A;  4DYR A;  1AU7 A;  3JR9 A;  1HDD C;  4AYB N;  3B6C A;  1RES A;  2MG4 A;  4X6A J;  1DU6 A;  4V2F A;  4IEJ A;  2P81 A;  1ETO A;  2ID3 A;  4KWA A;  2LTP A;  4I76 A;  4M6V A;  3HOY J;  2NVX J;  3GTK J;  5JLW A;  2YVH A;  2I10 A;  1ZR2 A;  5FKN A;  2R93 J;  1I6H J;  5EDN A;  1F43 A;  4XIC A;  2E2J J;  2XB5 A;  3NPI A;  3OOU A;  3L1P A;  3VW0 A;  1FTT A;  3BTC A;  3T6N A;  4GCL A;  2MW8 A;  1U9O A;  2XGD A;  5J1R A;  1Q1V A;  1WPK A;  4C3J J;  2HKU A;  3O8H A;  3B6A A;  1TWC J;  4UUS A;  3GTQ J;  2L9R A;  3HOW J;  2NOG A;  2CUF A;  2L0K A;  3JRI A;  2NP5 A;  4D5F A;  1ZTR A;  2UXI A;  2ZOY A;  2NS7 A;  1MBF A;  2DMT A;  2G0E A;  3QKX A;  1JT0 A;  3KKC A;  1JKO C;  4IHW A;  3FK6 A;  5FMP A;  5D18 A;  3RQI A;  3ZQC A;  2DA6 A;  1DU0 A;  4M3D A;  1TWG J;  3FIS A;  4RBO A;  3LSR A;  4D7N A;  5HOD A;  2NX4 A;  3O60 A;  3BCG A;  2Y2Z A;  4B4C A;  4Y7N J;  2VUM J;  3A01 A;  1BJZ A;  4FIS A;  4CYC A;  3HGY A;  3S1N J;  4AC6 A;  3GTG J;  3G1O A;  3BG5 A;  5K7Z A;  2HQ5 A;  4D5C A;  3GTL J;  3V78 A;  3BG3 A;  3HTA A;  4X1E A;  2NVQ J;  2HOT A;  1IV6 A;  3M4O J;  2REK A;  5BNG A;  3HB9 A;  3BNI A;  3VPR A;  1TC3 C;  3JRG A;  4AC0 A;  3HOU J;  1E3O C;  2IBD A;  3C07 A;  4A3K J;  3BQZ A;  1Z0X A;  3G1L A;  2HXO A;  4IHX A;  3LNQ A;  4GFB A;  2R92 J;  3DPJ A;  1UMQ A;  2JK3 A;  1IGN A;  3HOV J;  3ZQG A;  4A3J J;  5EF6 A;  5DTD A;  3O8G A;  3IV5 A;  2XB0 X;  1W0U A;  4EEF G;  2ZCM A;  5IP7 J;  3VVX A;  1JTY A;  3E7L A;  3PPB A;  1WH5 A;  3BRU A;  3LSJ A;  4JL3 A;  3MVP A;  5IOZ A;  2LR8 A;  1BL0 A;  2G7S A;  1HCR A;  2GFN A;  4G12 A;  3OIO A;  3W6V A;  5FHP A;  2UXU A;  3A02 A;  3BTJ A;  4GFL A;  3KZ9 A;  3BR0 A;  1I50 J;  3S1R J;  4A3L J;  4BXX J;  2WB1 N;  1FTZ A;  3BR1 A;  5EYR A;  2QKO A;  2HOS A;  2RHA A;  5F0H A;  3BT9 A;  5EFY A;  1RR7 A;  1GVD A;  3M3Y J;  4M3B A;  1ETX A;  2KDZ A;  2WAQ N;  4FE4 A;  1ETQ A;  4A3E J;  1CQT A;  2R0Q C;  2GLO A;  5C4Y A;  3GEU A;  3ON2 A;  3FIW A;  2M34 A;  1TWA J;  4V2G A;  1GUU A;  3DEW A;  2LD5 A;  4LOC A;  2X9D A;  3HTJ A;  3WHC A;  2LP0 A;  3EGQ A;  1JKP C;  5IP9 J;  4BY7 J;  2L7F P;  1JGG A;  2ZB9 A;  2MGQ A;  3PO2 J;  3KNW A;  4JKZ A;  3BTI A;  2ZCN A;  1YRN A;  1MSE C;  2GM4 A;  3HKZ N;  5D1R A;  5EGO A;  3VW1 A;  3JRF A;  2KT0 A;  5K7F A;  2LKX A;  1BW6 A;  1P7I A;  3EUP A;  1T56 A;  2EH3 A;  4C3H J;  3HOZ J; 
#chains in the Genus database with same CATH topology
 3LFK A;  3E5X A;  1YX5 A;  2OTJ I;  1BOB A;  1Z9C A;  1YQA A;  3T5X A;  5HVQ C;  1LKX A;  3W6J B;  1QVT A;  2KJB A;  3PM1 A;  2DYR H;  4S04 A;  1ZHF A;  2HVR A;  4JNN A;  1R5I D;  4HZF A;  1ZRC A;  1R4N B;  2O7O A;  4HAM A;  1Z1D A;  1MH3 A;  2E60 A;  1UST A;  1IRZ A;  3OYK A;  2DOD A;  1JE8 A;  1YJ9 I;  1GT0 C;  2EA4 A;  2X1E A;  2HTJ A;  2QQ9 A;  4XM3 A;  2WGB A;  2IVM A;  1W7P D;  2UUZ A;  4EGY A;  3CLO A;  1FYL A;  2UXO A;  1APL C;  2XSJ C;  2IGO A;  3M07 A;  4MEY F;  2ZJR F;  1WVR A;  2M45 A;  3ASO H;  5CYV A;  1B72 B;  3OYJ A;  2VT3 A;  1SD7 A;  4II3 A;  2LF8 A;  2WAE A;  3W2W A;  3M8F A;  1ETV A;  4Q5S F;  2VXD A;  5DCM A;  2F48 A;  2VXZ A;  5AIQ A;  2PZ9 A;  2QWT A;  4R79 A;  3ZMS A;  1AKH A;  2ZKZ A;  2HKO A;  2VBW A;  2ZSH B;  4M3G A;  2K40 A;  3VVZ A;  4II2 A;  2XAU A;  3MFK A;  3VSK A;  2V1U A;  4L5J A;  3HRS A;  4XSZ F;  5CJ9 A;  4XMY A;  3VSL A;  4A6D A;  1W36 C;  2C6Y A;  3U2R A;  1IRX A;  4U9L A;  1VQN I;  4RB2 C;  2PN6 A;  2BHY A;  4L18 B;  2F07 A;  4W97 A;  2YVX A;  1FBU A;  3JW4 A;  4MTE A;  5IYC J;  2ISY A;  1IUF A;  3IWF A;  2V1D A;  2AO9 A;  2LFB A;  3L2Q A;  3VUQ A;  1X2M A;  3H3Z A;  1CF7 A;  3S5R A;  4BAY A;  1A35 A;  3IWZ A;  5H6R A;  1FSE A;  5E3M A;  3VOK A;  1GXP A;  1J9I A;  1UI5 A;  3I55 I;  2KRH A;  3J7A O;  2QYO A;  3HOT A;  4E7L A;  3TKY A;  3TED A;  3Q9S A;  4ACI A;  1OYY A;  1PJR A;  1I3Q J;  3Q0V A;  5EZH A;  4AVZ A;  1GXQ A;  2YU3 A;  5IY5 H;  2X6X A;  2A2F X;  4HX4 A;  2WUI A;  5L3G A;  4ZTJ A;  3VP5 A;  2FU4 A;  4XRS G;  1D1C A;  1W5C C;  1ORK A;  4RA2 A;  5GP9 A;  4J19 A;  5FD5 A;  5HLG A;  3G4S I;  3WGG A;  3KIO A;  5FRM A;  2H8R A;  3DU6 A;  4RB0 A;  3LSM A;  2QTQ A;  3GF2 A;  1Z3X A;  3I5U A;  3CCY A;  3F9K A;  2GWR A;  2QIB A;  4PSW A;  3JRH A;  2EIL H;  3MNL A;  2XC7 A;  2V7F A;  2P5V A;  3WE3 A;  2Z99 A;  3T8T A;  3RTR A;  4DZP A;  2QEX I;  3IKV A;  3I71 A;  3QPH A;  3CRJ A;  4DW6 A;  2EZL A;  3OIP A;  4G9Y A;  3FRQ A;  1FLI A;  3GXO A;  4B3X A;  1B6A A;  2EB7 A;  3K0L A;  2FSW A;  2QKM B;  3DBH B;  1Z3Y A;  3K4C A;  3I54 A;  4ESJ A;  1WJ5 A;  3PO3 J;  1L3L A;  3QPT A;  4BU2 A;  3BR3 A;  5FFX A;  1RNL A;  4N4O B;  1OJL A;  1OCT C;  2UZK A;  2EIM H;  1LDJ A;  3DQV C;  3WTX C;  3L2C A;  3OYG A;  2P8T A;  1MGT A;  2KZV A;  3K6G A;  3VEP A;  1MD0 A;  2JPB A;  2DG7 A;  3BZC A;  3QU3 A;  3ZRG A;  2BW3 A;  4WWC A;  3R0J A;  1S7E A;  2DQL A;  3G3Z A;  1VQ7 I;  2R7V A;  1FWZ A;  4ZTF A;  2RQQ A;  4QLC U;  2M4K A;  1ETY A;  4BKX A;  2JVG A;  3CCV I;  4GCV A;  3HL2 A;  2B1E A;  1J7K A;  3GEZ A;  3I3L A;  2M8G X;  4A3I J;  4XBF A;  4M73 A;  1YOV B;  3U1D A;  2E1C A;  2G7U A;  4A0Z A;  2LY1 A;  2OV7 A;  1IF1 A;  2LRD A;  3M8J A;  1UJ8 A;  4Z2Y A;  3I53 A;  4RB3 C;  5E20 A;  1R1T A;  5D8L B;  5FKO A;  4CCM A;  2HDW A;  5LLQ A;  2OD5 A;  1ZG1 A;  1FOX A;  3CWR A;  5LFA A;  2ECB A;  1S8N A;  4R1H A;  3VYT B;  2QQB A;  5FRN A;  4JK1 X;  4YIR X;  2EK5 A;  3VTI A;  5IP6 A;  3GTP J;  1Q1H A;  3WG9 A;  2M7A A;  5CQG A;  2PQ8 A;  1BI1 A;  4PCQ A;  1SFO J;  1IV8 A;  1R58 A;  4XOT A;  3QP5 A;  2JMW A;  1GLN A;  1XMK A;  1JJ8 C;  2NS8 A;  1WQ2 A;  4HPQ A;  5LGT A;  1UFM A;  2D5V A;  3DF8 A;  1OQY A;  5LRR A;  2UV1 A;  3ULQ B;  1FYM A;  2YS9 A;  3LHQ A;  2KP6 A;  5HLI A;  3HOS A;  2LY2 A;  3E6M A;  3U21 A;  2E34 A;  4AU7 A;  3OL4 A;  2IS4 A;  2D6Y A;  5DV5 A;  1M1E B;  3IH3 A;  2GBY A;  3EPZ A;  1B4A A;  2GXB A;  1BJA A;  3KKD A;  1T33 A;  3OIQ A;  2ZJP F;  3LWJ A;  1UAA A;  2ICW G;  3BG9 A;  1R71 A;  2AQE A;  2M7B A;  2FBQ A;  1HBX G;  1U9N A;  2V9P A;  3TQN A;  1W7P B;  3ABL H;  4JQF A;  3FX3 A;  3ZN0 A;  5HNF A;  2LKS A;  5FLV A;  4HLX A;  1N77 A;  1MMS A;  1RKT A;  2Y48 A;  3F22 A;  1OCP A;  1QNT A;  4FX4 A;  4U88 A;  4PDK A;  3CF2 A;  3HGG A;  3PUB A;  4RAF A;  4ESF A;  1O4X A;  1AWC A;  1MJA A;  4P9F A;  1DP3 A;  2XIG A;  1FJL A;  5J8C A;  1MSF C;  1U8B A;  2DXI A;  5HS7 A;  3FF5 A;  2IT0 A;  4JYK A;  4Q4Z F;  1IJW C;  2X6W A;  2JRT A;  1JHH A;  2ZME A;  3DP7 A;  1W5T A;  3LQR A;  1UHM A;  4FHT A;  3R4K A;  2O3F A;  4EM2 A;  2M2E A;  2WB1 A;  4I98 B;  4LIT A;  2FA5 A;  1IXR C;  3H9Q A;  5K7H A;  2E1N A;  4OU0 A;  3V42 A;  2CW7 A;  3NS4 A;  1P4X A;  4K2E A;  4KMU X;  1F4K A;  2WAQ A;  3L09 A;  4ZZD A;  2ZXH A;  4ENK A;  2W25 A;  5FGL A;  4AWX B;  2EFP A;  4ASN A;  3SEQ A;  2K4B A;  4M71 A;  1U6G A;  2OU2 A;  3CJQ B;  4I6Z A;  1RKW A;  2KIS A;  4F92 B;  4KT5 C;  3JRB A;  1W4M A;  5DCM B;  4CUG A;  3ECH A;  2Q2E A;  2HI3 A;  1AKH B;  2IXS A;  2QGU A;  3G71 I;  1LDK B;  1IG7 A;  3GYH X;  1V5G A;  1G3S A;  1XCB A;  3K69 A;  4A2U A;  4AIH A;  3G73 A;  1O3R A;  5HSZ A;  1PDN C;  3RDI A;  2M9H A;  3BP8 A;  4UVA A;  3SZP A;  5LEJ A;  1LE8 A;  2XSD C;  5H6Q A;  2W24 A;  3HHH A;  3BR5 A;  3KZZ A;  3FK7 A;  1VI0 A;  3ZP5 A;  3CCL I;  1P2F A;  2IGK A;  2PEX A;  3DKW A;  1CF7 B;  2M87 A;  3HM5 A;  3CC7 I;  3KP2 A;  1UEL B;  2G3B A;  3RZO J;  2QLZ A;  2VBZ A;  3ABU A;  1BI2 A;  3S3O A;  3EYI A;  1UI6 A;  1K6Y A;  1ZGA A;  4PUS A;  2Y0S N;  4RGS A;  1XPX A;  2HYF A;  2MA3 A;  3Q0U A;  2TRT A;  1FOY A;  1VTN C;  2FBI A;  3C1D A;  3K1M A;  1ZEL A;  3FXJ A;  5M3F J;  4E4H A;  2VJ5 A;  1IN5 A;  4HQM A;  2HWV A;  4YFX F;  1RES A;  1A04 A;  4LK1 F;  4WK8 F;  3OYA A;  4V2F A;  1R49 A;  1YIO A;  2ZSI B;  3L9F A;  2HS5 A;  2LTP A;  4UVC A;  4I76 A;  4RMN A;  4B8X A;  1YS7 A;  4ZH4 F;  1U3E M;  3HOY J;  2DDB A;  4LJZ F;  3P9K A;  4RS8 A;  1MDM A;  5JFR A;  1I6H J;  4L9N A;  4E7S A;  5EDN A;  1WJF A;  5DUK A;  4H4K C;  3OOU A;  2MH9 A;  3N4M A;  3P7N A;  5LHG A;  5E1X A;  1ODD A;  5FO5 A;  3F6O A;  4LB5 A;  2XGD A;  4C3J J;  3SZG A;  2XUB A;  1YW9 A;  1LFP A;  1OYW A;  3HHG A;  1TWC J;  1X4P A;  4UUS A;  3AAF A;  1ZAR A;  3V8J A;  2WAF A;  4FAS D;  1WHU A;  2NOG A;  3K70 C;  4ITV A;  4DOZ A;  2CG4 A;  1MZB A;  2UXI A;  2ZOY A;  2NS7 A;  5TRD A;  2L9V A;  1KQ8 A;  1D5V A;  1V3F A;  3GX4 X;  4IHW A;  4BYY A;  5D18 A;  3E6B A;  4IRH A;  2BW3 B;  2CUJ A;  3VOD A;  3TDZ C;  2B0L A;  2DA6 A;  3HUG A;  2ZNY A;  2ZCW A;  2F5D A;  2HZT A;  3HSR A;  3ABK H;  4Y15 A;  4B09 A;  1ZRE A;  3FKJ A;  1BJZ A;  3HGY A;  4NNJ A;  1XB4 A;  3GTG J;  3CJT B;  3OYB A;  4BDZ A;  3I56 I;  2HQ5 A;  1D0X A;  2R7D A;  3GTL J;  4HSR A;  3BG3 A;  3GLL A;  3AL0 C;  1SFE A;  1U2W A;  2E7W A;  4BL0 B;  2P7C B;  4Y4R A;  4F3Q A;  3H3U A;  1MMA A;  5LGN A;  1IZ1 A;  3V4G A;  3HOU J;  1YW8 A;  4M9X A;  4A3K J;  1Z0X A;  3P9C A;  1ZAO A;  2HNH A;  4DQ2 A;  4KIF A;  4BHC A;  1K7A A;  3PNT A;  2NXN B;  2BY0 A;  3HOV J;  3QYF A;  3IV5 A;  4EEF G;  3CC2 I;  2E1M B;  1JTY A;  3IAS 2;  3BRU A;  4JL3 A;  3MVP A;  2LR8 A;  1ON2 A;  2MBF A;  5L3E A;  2GFN A;  1BOA A;  2Q8K A;  2IGM A;  3BC8 A;  1G6N A;  4A3L J;  3FMR A;  4HG2 A;  5D4S A;  2F5F A;  1YLF A;  2HOS A;  4D9J A;  3TGN A;  1KU2 A;  1GVD A;  5DD8 A;  4YIF A;  2NNY A;  1ETX A;  2IA0 A;  2GLO A;  5C4Y A;  3DWL E;  3GEU A;  2HZD A;  4JOM A;  4NUB A;  2LD5 A;  1H0M A;  4LOC A;  4PGH A;  3WHC A;  5IP9 J;  4KIB A;  1YW7 A;  3KCC A;  2L7F P;  4BY7 J;  4CA0 A;  2MGQ A;  5HLT A;  1YJN I;  1JGG A;  3KNW A;  2CQN A;  1UB9 A;  3BTI A;  2ZCN A;  1MSE C;  2VQC A;  3F8C A;  4XKC A;  5L3D A;  3VW1 A;  2KT0 A;  1Y8Q B;  2VT2 A;  3H9G A;  5K7F A;  1S7A A;  3K4B A;  1MBJ A;  2LK2 A;  2FXA A;  1Y1W J;  2CQQ A;  4WF2 A;  2WA0 A;  2M5W A;  1BIB A;  1QO0 D;  3OL3 A;  1BC8 C;  4HOB A;  2OCC H;  4ME9 A;  4MXM A;  4RGU A;  4ZDL A;  3RD3 A;  2PBX A;  3LAJ A;  2BY2 A;  1RPW A;  3GZ6 A;  1H8A C;  2DT5 A;  4OD4 A;  4ON0 A;  2ZNZ A;  2XKP A;  2ZME B;  4WXD A;  3HEF A;  1TNT A;  1WJB A;  1MNE A;  1XMA A;  3CCJ I;  4TV7 A;  2DJI A;  2ELH A;  3ZQI A;  5HBU A;  3NQO A;  2Y75 A;  3JRE A;  2B63 J;  4KT6 A;  5LD2 C;  3DPU A;  3K7A J;  3MMY B;  1RI7 A;  1HKS A;  4KDP A;  5KAF C;  3DBR B;  2ZY9 A;  4GDF A;  2QF7 A;  4UV9 A;  5LRS A;  4M3E A;  4L9J A;  4GCT A;  1D0Z A;  4W1U A;  1FMV A;  2RN7 A;  1JUS A;  5B3S H;  3HSE A;  5A2Q K;  5DAJ A;  1YI2 I;  1LDD A;  2Q2E B;  2XRL A;  1DQU A;  2E71 A;  1FY7 A;  2PMH A;  2BVM A;  3IH4 A;  1H88 C;  2A05 A;  2EV5 A;  2L2O A;  4BAC A;  3E5U A;  1O7F A;  2X6Y A;  4PGG A;  2H09 A;  1P7J A;  3F8N A;  3U1K A;  3HIF A;  2HU9 A;  4BBS J;  1SFX A;  2DA2 A;  1LE8 B;  1PVE A;  5EZG A;  3LSK A;  2ISZ A;  3Q5F A;  3BHQ A;  3VFZ A;  1H9G A;  3E97 A;  3V8K A;  4IRV A;  3AG2 H;  5FJ8 J;  1Y56 A;  4Y52 J;  1QRY A;  3LSG A;  4IKF A;  1DPR A;  2E19 A;  4JX5 A;  4LK0 F;  2DFF A;  3T8R A;  3ZQF A;  1YHQ I;  1XG1 A;  4A3M J;  2O6G E;  5ICG A;  3VB2 A;  4MO7 A;  4ZC3 A;  4F93 B;  3FHZ A;  1UZC A;  2FQ4 A;  3MKY B;  2J5O A;  4D7M A;  4ENM A;  3L2V A;  3GTM J;  3W2V A;  4CO8 A;  3OSG A;  1T38 A;  1IDZ A;  2EWN A;  4G6T B;  1NH3 A;  1VFC A;  2OBP A;  1XGM A;  3IKT A;  4IOC F;  4LLL A;  2HDD A;  4G94 A;  2JA6 J;  4L5I A;  3BLY A;  2RAE A;  3L2W A;  5IT9 Z;  3NRG A;  5ILV A;  2BXY A;  1JT6 A;  3C2G A;  2PMZ A;  5ICE A;  3FMQ A;  4CH7 A;  4DBQ A;  1Z7L A;  4XOR A;  2JVH A;  4XKW A;  1IN4 A;  2AHQ A;  5E3L A;  3BPV A;  4AVP A;  1RIO H;  1D5Y A;  2IS6 A;  3VW2 A;  2LBF A;  3O3K A;  1R4M B;  3H92 A;  1PYV A;  3ZN1 A;  2K86 A;  1PUF B;  2DMP A;  1KON A;  2L02 A;  1P6R A;  2ZJ2 A;  3FXK A;  3JSJ A;  2R7T A;  2QWW A;  1Z6T A;  4BQQ A;  4DZJ A;  3MN2 A;  2OZU A;  1Z05 A;  5FLX Z;  3OYL A;  3KP4 A;  3AG3 H;  4HNV A;  3S93 A;  1MDM B;  2O9L A;  2XPV A;  5JI6 A;  2VLA A;  1G3T A;  3K4K A;  4FX0 A;  1WJC A;  4F91 B;  4ZDO A;  1RET A;  3FMS A;  4XLN F;  3F1B A;  2YX7 A;  1EF4 A;  3ZMD A;  2PJP A;  2OI8 A;  3PAS A;  3BR6 A;  4UUS B;  3TBI A;  1B59 A;  3ROU A;  3SFI A;  2DBB A;  3JSO A;  5J47 A;  4NN1 A;  2FE3 A;  4C9Y A;  2KIF A;  4S0H B;  4BNC A;  1O3Q A;  5CQE A;  4U7B A;  1HC8 A;  2OER A;  1T08 B;  3K10 A;  1E17 A;  1YX3 A;  3D5L A;  3A0H C;  3LFU A;  1OKR A;  3LSH A;  3HUG B;  3S3M A;  4GRI A;  1SAU A;  3D5S C;  4CDG A;  2IP2 A;  3H35 A;  3T0Y A;  2A5W A;  4CCJ A;  3GBG A;  1X1A A;  2DFE A;  4MQV A;  4RM3 A;  1HA8 A;  1J0R A;  1H89 C;  1R7J A;  1OR7 C;  3HE0 A;  1KQ0 A;  3TDU C;  1VQO I;  3DFG A;  4RAG A;  1MMN A;  1OFC X;  3PFI A;  4AYB A;  3EUK L;  1QGP A;  5DD4 A;  1S6L A;  2BOL A;  4XQF A;  1FNN A;  2Q0O A;  3CUO A;  2FMY A;  2AQF A;  2HOE A;  2L4M A;  5J1U A;  4OD5 A;  3GTJ J;  5EEH A;  3L2R A;  1WZ2 A;  5E3O A;  5GPC A;  2NAZ A;  1SD6 A;  1XC5 A;  2P6T A;  3TOA A;  4CSW A;  2NVY J;  4L9T A;  4KUM A;  3V6G A;  2V1N A;  3S17 J;  1D8J A;  4EQQ A;  4LG0 A;  4BQA A;  2VKV A;  3MCZ A;  1FMW A;  4KIG A;  2M1B A;  5JHU A;  2DPU A;  3CUQ C;  3DU5 A;  3TW6 A;  1KGS A;  1WI3 A;  1WI9 A;  2VQL A;  2CW8 A;  2R7S A;  3ZMZ A;  1QU3 A;  3CME I;  2E7X A;  3I58 A;  5F64 A;  1B9N A;  1WGX A;  2WY8 Q;  4OWR B;  4RAZ A;  4P9U A;  3CZ6 A;  3SWH A;  3FHN A;  1SVM A;  5FKM A;  2DI3 A;  4BY1 J;  2EIN H;  1E2X A;  3A2K A;  1E3P A;  3K8P C;  1FBQ A;  3KLN A;  2LSO A;  5B66 C;  1V4R A;  3AG1 H;  2HFH A;  1YFH A;  3HZJ A;  3ISP A;  4C2M A;  2IS1 A;  4PJJ A;  4ESB A;  2V1X A;  3P5J A;  3RIR A;  5F6F A;  3REO A;  2VI6 A;  2LF7 A;  4IZZ A;  3OV8 A;  2RQP A;  4FT8 A;  3SDG A;  2M0M A;  2X85 A;  1Y1V J;  3ONQ A;  4MFE A;  2IS2 A;  2JN6 A;  3RKX A;  3CCR I;  1UG0 A;  4HF1 A;  2W57 A;  4MIM A;  2HQR A;  2K5C A;  3M8E A;  1V54 H;  3PL8 A;  3P9T A;  2G7G A;  3VDX A;  2P5L C;  4IXA A;  1P9Q C;  5AQC A;  2IU5 A;  3H3V K;  4BE2 A;  2JTV A;  3LOC A;  1R9T J;  4MLO A;  5M3M J;  4PJ0 C;  2BVL A;  2XGC A;  2DYS H;  4QIW N;  2PLY A;  4Y3O A;  2F5V A;  4BQO A;  2Y0M A;  2DMU A;  4CYD A;  2QVO A;  3IP4 B;  1MBH A;  1I5Z A;  2GAU A;  3PQJ A;  5F04 A;  5FLX K;  2DA5 A;  3TL4 X;  5M5X J;  1GV5 A;  2GOX B;  2X4H A;  3HC7 A;  3QPS A;  4IHV A;  1AA7 A;  2DU9 A;  2XPU A;  5E79 C;  3DBL B;  1A5J A;  4J00 A;  3S14 J;  3LSI A;  5F1J A;  3PSI A;  2JWT A;  4A5N A;  4O3M A;  2PG4 A;  1HST A;  3DV8 A;  5D6F A;  3CCS I;  2XAF A;  1W0T A;  5BS6 A;  2XAS A;  3MZ8 A;  2ZXI A;  3ZPL A;  1WJA A;  1KA8 A;  3OMY A;  3I4M J;  1QPM A;  3RH2 A;  3CMY A;  1EKE A;  5CVV A;  4AUX A;  2E1O A;  4ZJZ A;  2FOK A;  4BJT A;  3EET A;  1O3S A;  1FIA A;  4U0V A;  1PP7 U;  2ZCX A;  1A36 A;  1IW7 F;  2R7Z J;  2X6O A;  4S05 A;  3I64 A;  3Q3S A;  1MBG A;  3KP7 A;  4LLN A;  1IO2 A;  1FX7 A;  2VC1 A;  1XD7 A;  1KYZ A;  3D1N I;  5K1Y A;  2D1V A;  4RAY A;  3S15 J;  5FLM J;  2DCE A;  2JUG A;  4HW0 A;  1EJ9 A;  1LEA A;  1VF9 A;  3K2Z A;  3HBL A;  4ENJ A;  3VVY A;  1TZL A;  3QBM A;  1U78 A;  3SEZ A;  1HLV A;  1Y6I A;  3LMM A;  4UHT A;  3FXL A;  4YEJ A;  3W6K B;  1UG2 A;  3NXC A;  4DYQ A;  3BRO A;  1XN7 A;  1P92 A;  2YPR A;  4G6Q A;  1CGP A;  3V7R A;  1PP8 F;  1BN5 A;  1EH7 A;  3JCU C;  3RCO A;  3I4P A;  4HEA 2;  4PJM A;  4GFK A;  5B1B H;  5IYB J;  2CV2 A;  1ACI A;  2PI0 A;  2G7H A;  3R61 A;  2TDX A;  2YVE A;  3WTW C;  3EDP A;  1OCR H;  2FML A;  3HSF A;  4DYR A;  5EG0 A;  2H27 A;  1BIA A;  2LBF B;  2J5P A;  5DEQ A;  3EQL F;  5J4Y A;  3OYF A;  4ANJ A;  2IJL A;  2P81 A;  4LB6 B;  1Z67 A;  4KWA A;  2ZFU A;  2JUC A;  4M74 A;  4M6V A;  2DW4 A;  3HPG A;  2IPQ X;  4KN4 X;  3GTK J;  3K1N A;  1RR8 C;  2YVH A;  1SFU A;  2DK5 A;  3RYP A;  3FBI B;  1EA3 A;  2EFQ A;  3L1P A;  4GCL A;  1HSJ A;  1FTT A;  4E7I A;  2VIX A;  1U9O A;  2W84 A;  2KQR A;  5J1R A;  2MAB A;  2HKU A;  3O8H A;  3TO7 A;  1QHG A;  1YYV A;  2L9R A;  2K3P A;  3JRI A;  3CO7 C;  3CCM I;  2GIV A;  2KHM A;  4I0A A;  1MBF A;  1T0F A;  3KKC A;  3QKX A;  3FK6 A;  2G9W A;  3RQI A;  1YIT I;  4G8X A;  3ZQC A;  5TGT A;  4NC6 A;  3MWM A;  1IXC A;  1KQ9 A;  1TWG J;  3FIS A;  4LFU A;  3FXR A;  4QPO A;  4D7N A;  3LSR A;  2LRE A;  2NX4 A;  2GOM A;  4FQG A;  2Y2Z A;  3A4C A;  3A01 A;  3WE2 A;  4FIS A;  4DJA A;  3S1N J;  1WSU A;  2KDO A;  3BG5 A;  4M72 A;  1XX5 A;  5HS9 A;  1TQI A;  3ZMV A;  1J5Y A;  2GA2 A;  1QBJ A;  3GFJ A;  2NVQ J;  4M9Z A;  1IV6 A;  2HOT A;  3M4O J;  3OYN A;  2NRA C;  4NB5 A;  3SQN A;  3HB9 A;  5BNG A;  4E7H A;  3J81 Z;  4XOP A;  3VPR A;  3JRG A;  1QZY A;  1E3O C;  1VQ5 I;  2IBD A;  4Y13 A;  1WRJ A;  3BQZ A;  2HXO A;  4IHX A;  1R22 A;  1Z21 A;  3ZGK A;  4LG0 B;  5ILU A;  3H5A A;  1IGN A;  1VQM I;  1ZGJ A;  4A3J J;  5EF6 A;  5ED4 A;  2Z5U A;  5DTD A;  3O8G A;  1FZP B;  2NS0 A;  3E1S A;  3LA3 A;  3E7L A;  5KK1 A;  2JPC A;  1WH5 A;  2M30 A;  4XKB A;  3VVX A;  2CO5 A;  3GWZ A;  3LSJ A;  4I2O A;  5KHD A;  3LA7 A;  2KPM A;  4EV0 A;  3W6V A;  5FHP A;  2UXU A;  3ASN H;  4GFL A;  2GXG A;  3BY6 A;  3BR0 A;  2AXL A;  1I50 J;  2A6T A;  3FZV A;  3S1R J;  5BPD A;  1DGW Y;  2RHA A;  4B47 A;  5F0H A;  4U87 A;  1RR7 A;  2HYG D;  4LG3 A;  4LD5 A;  3M3Y J;  2GA1 A;  1Y0U A;  1VQP I;  1STZ A;  4OMY A;  2KJC A;  1ETQ A;  4FE4 A;  1R5H A;  3R60 A;  4BJ6 C;  3KP3 A;  4HV5 A;  2LP0 A;  3MZH A;  5ICC A;  1OYI A;  4DIQ A;  1LVA A;  5D1R A;  3HKZ N;  3KEQ A;  3JRF A;  3H9J A;  2RRE A;  1BW6 A;  3EUP A;  4BHP A;  1SEU A;  4UB6 C;  1N75 A;  2EH3 A;  2L01 A;  2EFN A;  2OA4 A;  3PIO F;  1HW2 A;  3HOZ J;  1JKQ C;  2BEO A;  2FD5 A;  2LC2 A;  3ABT A;  3GME A;  2CUZ A;  1F1Z A;  4HF2 A;  1ZR4 A;  5AIP A;  2W85 A;  4F55 A;  4KYW A;  2EFW A;  1WJD A;  4OAY A;  5GAD J;  2GIZ A;  5J40 A;  3A03 A;  4F52 A;  1MIJ A;  3HXL A;  3RZD J;  3B02 A;  1XMX A;  1FEX A;  3I4N J;  3T1B A;  2CMP A;  3CQZ J;  2E35 A;  5H9T A;  2VPR A;  1SMY F;  2A61 A;  2Z9O A;  3KEO A;  1PUF A;  1ZN2 A;  2F2E A;  2L7Z A;  1T6S A;  1BA5 A;  3S2D J;  2QUF A;  4HV6 A;  1W36 D;  3S3N A;  1K79 A;  5FB2 A;  2PMU A;  3OOP A;  2NP3 A;  2XRN A;  2HVQ A;  5HLH A;  1ZLK A;  3E0J B;  4WX9 A;  3SJM A;  2FRH A;  1QZZ A;  1QQI A;  2KLO A;  2QCO A;  5FRO A;  1F36 A;  2VBY A;  4N9I A;  2DFI A;  1ZYR F;  3ZOB A;  1OPC A;  5BPI A;  5K58 A;  1HKQ A;  4XNF A;  2R5Y A;  1I27 A;  1LFU P;  2O7T A;  2BE5 F;  4ZYG A;  1ENH A;  4YZE A;  3E7Q A;  4A3G J;  3R6S A;  5J1Y A;  4G6D A;  2B9S A;  3HRT A;  4U0W A;  4UUV A;  4RB1 A;  1JTX A;  1X1B A;  2EA2 A;  5J4V A;  2H6B A;  4IQJ A;  3C3W A;  3CCU I;  2VAS A;  3GZI A;  1I6X A;  2DO7 A;  1TTY A;  3BWG A;  1LB2 A;  4RM2 A;  3WTY C;  2V57 A;  5F0C A;  5EGO B;  1MNM C;  3IC7 A;  5D5U B;  1T2K A;  1E3H A;  4EGZ A;  4NDL A;  1QPI A;  1Z7U A;  5ICF A;  3WTV C;  3LJL A;  4MFD A;  1JUP A;  1ZGW A;  2UXX A;  2RVC A;  3QRF F;  1MKM A;  3QQA A;  2LDU A;  4C30 A;  4XLP F;  2HYT A;  2W1O A;  3MD2 A;  2DT6 A;  4KMF A;  3PUF A;  1XDU A;  1QVU A;  2RAS A;  1EV7 A;  1VND A;  5DYM A;  2HOA A;  4UDS A;  5EG0 B;  1ZLJ A;  2B3W A;  4ZYA A;  3HRU A;  3MKZ A;  2ME6 A;  1RZ4 A;  3GZN B;  4O6J A;  1ON1 A;  1XTA A;  1G3Y A;  3WG7 H;  2CQX A;  4XON A;  1BC7 C;  2FNP A;  1YS6 A;  2LH9 A;  2D2W A;  5J3L A;  2QSH X;  1G2H A;  1G59 A;  1QZE A;  3GLX A;  4L9V A;  4L0Z B;  2BBY A;  5E17 F;  3CC4 I;  2OUM A;  4D1Q A;  2STW A;  3ABM H;  3DPT A;  1LFB A;  2JZY A;  4BGD A;  2JA7 J;  3HKZ A;  3CDH A;  3VOE A;  1UHW A;  4RDU A;  2F5E A;  2L3D A;  2L7K A;  2TCT A;  1P4W A;  3KZI C;  2PJR A;  4BBR J;  3D0S A;  1FBS A;  2QEN A;  3OYD A;  1ITY A;  2Y30 A;  4BDY A;  3SXY A;  1U5T B;  2UXN A;  5D4R A;  2Y0S A;  4A3F J;  4HBL A;  4P1W A;  3J80 Z;  4IHY A;  3BR2 A;  2R3S A;  4IRI A;  1W5S A;  3F8F A;  3CJN A;  2R7W A;  3I59 A;  1VQ4 I;  3DXJ F;  3A01 B;  4B43 A;  2V4J C;  4IF4 A;  4WCG A;  1BM9 A;  2JJ7 A;  4AIK A;  4CCO A;  1NK2 P;  4BJ5 C;  4E7Z A;  2VN2 A;  5JR3 A;  4GCK A;  3TP0 A;  2GUH A;  2XHK A;  3N97 A;  2X1D A;  2Z3Y A;  1TQP A;  4RLF A;  1U0J A;  3ZQL A;  4A3D J;  3F0C A;  3DKX A;  2XPW A;  1AOY A;  2AS5 F;  3G56 A;  5L3C A;  3DTE A;  5FKL A;  4XLC A;  1RUO A;  3WTU C;  1E0E A;  2R7F A;  3CP8 A;  2AXT C;  2DPD A;  1J2X A;  2R7X A;  3LSP A;  2XDV A;  1UHS A;  2Z33 A;  4XN3 A;  3O2P E;  1REP C;  3NNR A;  2Q24 A;  2XV4 S;  2DTR A;  1XCV A;  3BDD A;  1A6I A;  4GYG A;  3CCQ I;  3CTA A;  5M5Y J;  2W82 A;  1TW3 A;  3H36 A;  2K9S A;  2LLK A;  4M6Y A;  5C4J J;  2EZK A;  5CVI A;  3SDB A;  3QP6 A;  4FCY A;  2VJI A;  1MBK A;  4EJW A;  2K9N A;  4L5E A;  2RDP A;  2XF6 A;  2Z1D A;  1OMI A;  4A12 A;  5IYD J;  2CWE A;  2OJE D;  1MH4 A;  1OCO H;  2MSY A;  2O5R A;  3FXQ A;  5K5R A;  4XK4 A;  3KLO A;  2XVC A;  3HIM A;  3BQY A;  3A0B C;  5E3N A;  3CES A;  2XDN A;  4A0Y A;  1JUM A;  2DA1 A;  2ELK A;  3RI4 A;  2K7L A;  1ZKG A;  4NEL A;  2A3S A;  1WCM J;  2Y9Y A;  4DGW B;  2MLK A;  3KYL A;  3BZ6 A;  3E6D A;  1K83 J;  3HG9 A;  4A69 C;  4V19 K;  1TW2 A;  3DCF A;  1SMT A;  3IRQ A;  1YO5 C;  3OR1 C;  2MC4 A;  2RKH A;  2VKE A;  3PFY A;  1VQ9 I;  4KIS A;  4CXF A;  1F5T A;  3BJ6 A;  4CGZ A;  4A93 J;  3ECO A;  3M1C A;  3L7W A;  4EM1 A;  4FE7 A;  1SC7 A;  3TO6 A;  5E1W A;  5TIS C;  5HDK A;  2STT A;  3AQT A;  2NOJ B;  3E5Q A;  3KEY A;  3H0D A;  1HF0 A;  5L3F A;  5IPA A;  1X58 A;  4EJT A;  3I9V 2;  1R23 A;  1OLT A;  1R5G A;  4XLA A;  4A5M A;  1J09 A;  5C44 J;  1HQC A;  1K61 A;  1B8I A;  3RKQ A;  1BR4 A;  4QWQ A;  2R5Z A;  2E1M C;  1IDY A;  2GEN A;  3OYE A;  1MBE A;  3FKI J;  3DLL F;  3BJO A;  2R7R A;  1KZH A;  4KN7 X;  2HXI A;  3ZR8 X;  4BXU A;  4ETS A;  3VYS B;  3J7Y J;  1JGS A;  5GAE J;  1KU3 A;  2HQA A;  5D5X B;  3UKG A;  1A6Q A;  5DS9 A;  5HAW A;  2JA2 A;  4C3I J;  2H1K A;  3RKY A;  4JX4 A;  2VOO A;  2VOD A;  3NRV A;  4CIC A;  2ID6 A;  4XL9 A;  2EQR A;  3JSP A;  3CMM A;  2DMQ A;  5DM7 F;  2R5Y B;  2D1H A;  4C2M J;  4MNU A;  3WTT C;  1Y39 A;  4UY8 I;  4OMZ A;  4B1R A;  1SFK A;  2ZC2 A;  2K4J A;  2DG8 A;  1BBY A;  3J7Z I;  2OF7 A;  2H94 A;  2IEK A;  4IX7 A;  2DN0 A;  4CHU A;  4HQE A;  2JA5 J;  1X4O A;  5GTH C;  3M9A A;  3GTO J;  3PSF A;  2IA2 A;  2CGP A;  9ANT A;  5IOY A;  3MKL A;  3J80 K;  3JTH A;  2ZOZ A;  3AFH A;  5L3B A;  5LHI A;  2KIQ A;  3TMO A;  3HDD A;  3QYE A;  3ZQH A;  4OIP F;  4ABZ A;  5DCF A;  3H5N A;  1ZRD A;  2F4I A;  2L7M P;  2CUE A;  1B1B A;  1NG6 A;  3VIB A;  3SHF A;  1VQ8 I;  3WTZ A;  4CGR A;  2EIJ H;  2GQQ A;  6PAX A;  2KIM A;  2OTL I;  2HVS A;  3KE2 A;  4I0B A;  2R7O A;  2E2I J;  3NAU A;  2ME0 A;  2QKL B;  1FP1 D;  5C4X J;  4QTR A;  1ETW A;  1BI3 A;  2WV1 A;  2FBK A;  5B5E C;  3OR2 C;  3G7R A;  3BCB A;  3VYU B;  2ZME C;  3WHB A;  5KAI C;  4X0G A;  3KYC B;  2EZH A;  4YG2 F;  2BXZ A;  2EZI A;  4BUP A;  3K70 D;  3Q0W A;  4IQ4 A;  5DDG A;  1AU7 A;  2NVU B;  1HDD C;  3UR3 C;  3B6C A;  5EEG A;  3HTU A;  2A68 F;  4IEJ A;  4OAZ A;  2FQ3 A;  2A69 F;  3MQ0 A;  2E5N A;  3K1P A;  4YFN F;  2KIU A;  2NVX J;  1IXS B;  5E1Z B;  3NWS A;  4AID A;  1OIS A;  2I10 A;  4XKV A;  1ZR2 A;  2KRC A;  3LWF A;  2CW0 F;  3NPI A;  2VKD A;  3PQK A;  4RLQ A;  1SVL A;  2E2J J;  2Z16 A;  1FOK A;  2WAD A;  3VW0 A;  3BTC A;  4KIC A;  4LGW A;  3T6N A;  1KU9 A;  4OIN F;  1KYW A;  1IRF A;  4IHS A;  2VOP A;  1PUE E;  2Q1Z B;  4NBQ A;  2MD0 A;  3BCA A;  2BY3 A;  1ULY A;  3GTQ J;  1FT9 A;  3HOW J;  2L0K A;  1VQ6 I;  2NP5 A;  4D5F A;  4FET A;  4IO9 F;  2K3F A;  2PJR B;  2G0E A;  3E6C C;  4GYI A;  1GVJ A;  1FP2 A;  3AG4 H;  2VKH A;  4PFP A;  1R36 A;  4OIQ F;  3VWB A;  1D1A A;  1DU0 A;  1ERD A;  4RBO A;  2WV0 A;  3H1C A;  2MFZ A;  3OS2 A;  2H6C A;  3M1E A;  3WU1 B;  5DM6 F;  3PNV A;  3JAM Z;  2BY1 A;  4G7Z F;  5LHH A;  1D3Y A;  5IT9 K;  2VUM J;  3I59 B;  4CYC A;  4MQ9 F;  3G1O A;  4D5C A;  1T95 A;  3P9I A;  5HOO A;  2DK8 A;  3HTA A;  2VQH A;  4X1E A;  3BZK A;  4EJV A;  1DDN A;  2REK A;  2DOA A;  4LIU A;  3BNI A;  3BJA A;  4LLG F;  3U9G A;  2K27 A;  2W4S A;  4MEX F;  3DEU A;  3FXO A;  1TC3 C;  1X3Z B;  3K4N A;  5D5W B;  2JQ7 A;  2K02 A;  2FEZ A;  4E7K A;  1K4T A;  4PFO A;  3CO6 C;  4DBR A;  1WKM A;  1MMG A;  2OZ6 A;  3LNQ A;  4GFB A;  2R92 J;  3PNY A;  3BG6 A;  1ONV A;  1TLH B;  2A5Y B;  2QSF X;  2ZCM A;  2CFO A;  1YIJ I;  4C2T A;  3QWL A;  4ZDP A;  3PPB A;  3JTG A;  4RGX A;  4LIV A;  1L0O C;  3WTS C;  3GO5 A;  1N78 A;  3TO9 A;  3ZMT A;  4LMY A;  1TL8 A;  1ZG3 A;  4G12 A;  1HCR A;  3A02 A;  3BTJ A;  3KZ9 A;  2VQG A;  3FXM A;  4BXX J;  1Z6R A;  3LAP A;  2EV6 A;  2WB1 N;  3BR1 A;  1T39 A;  3F72 A;  2ETH A;  5EFY A;  4M3B A;  4IL6 C;  2XGX A;  2DOE A;  2WAQ N;  4P5O A;  4A3E J;  2DFH A;  1FSH A;  4GGG A;  2EIK H;  1Y8R B;  2M34 A;  4V2G A;  1GUU A;  3DEW A;  4UV8 A;  2L4A A;  2QA4 I;  1JKP C;  2ZB9 A;  2P6S A;  4JKZ A;  2L9S A;  1YRN A;  2GM4 A;  4M9S A;  5EGO A;  4CZC A;  2PX9 A;  5J6X A;  1XGO A;  5CKT A;  1P7I A;  1J75 A;  1T56 A;  1F9N A;  2KL4 A;  4C3H J;  4L62 A;  2CSO A;  5JVG F;  3IUO A;  3F23 A;  4PK4 A;  5CW8 A;  3GCM A;  4KNY A;  1DP7 P;  3O6B B;  5GAH J;  2ZXW H;  4XLH A;  4XRM A;  1T98 A;  2ZBK A;  2ZO4 A;  2D45 A;  1I3A A;  5F08 A;  4P55 A;  2NVT J;  3ANP A;  5CLS A;  4AD9 A;  3K4J A;  4RGR A;  4N4N B;  1NTC A;  4GXO A;  1BW5 A;  5HDN A;  2DA3 A;  3ERM A;  1WH7 A;  3BJB A;  4UB8 C;  4A6E A;  3V7S A;  2KZG A;  3K4L A;  3VYR B;  1ZH5 A;  2DAO A;  5ERI A;  3JRC A;  1IN7 A;  3FDY A;  4HDU A;  2DQR A;  1TQM A;  3W3C A;  4YII A;  4M3F A;  1R6R A;  1B8I B;  4OIO F;  3NEU A;  4BS9 A;  2R5Z B;  2M4G A;  1MJ9 A;  2VE9 A;  3EUA A;  3VOX A;  4I01 A;  1V5E A;  2BYV E;  2BGC A;  2CV0 A;  1FC3 A;  2VBX A;  4IJA A;  1XSD A;  4HRI A;  2FX0 A;  3TOB A;  3RKW A;  5K5O A;  5CXG A;  4BQN A;  4DYC A;  1S3J A;  4ENN A;  2HTS A;  1Z77 A;  3DKY A;  2XGE A;  3EUH A;  5LGU A;  3JRA A;  3IHU A;  3OSF A;  4JX6 A;  4QSH A;  3S2H J;  1ZRF A;  3WOD F;  3IL2 A;  1LVK A;  3LL7 A;  5IT3 A;  2FJ1 A;  5CVU A;  2OCE A;  2B7E A;  2HEO A;  5E18 F;  4E70 A;  4PJL A;  2ECC A;  1R1V A;  3ZMU A;  3H0G J;  1BI0 A;  3OYI A;  4FTH A;  2EV0 A;  4ZYH A;  1D1B A;  2IGN A;  1G3W A;  2LYC A;  3COA C;  5CPR B;  2O8K A;  1WFX A;  1U5T A;  2CH0 A;  3CP2 A;  3JRD A;  2F5C A;  1K78 A;  1GV2 A;  2QSG X;  1G4D A;  2BHZ A;  1ZQ3 P;  3LA2 A;  2YU9 J;  3K2A A;  2Y31 A;  2LVS A;  5GAG J;  4BE1 A;  3CDI A;  4HKU A;  2K9M A;  3RSN A;  4XID A;  3JAM K;  4J01 A;  2HKX A;  3TW7 A;  3HRM A;  2DOF A;  4XLF A;  3TP3 A;  4BE0 A;  5FKK A;  4AIJ A;  3S16 J;  1IRG A;  1TWH J;  2FNA A;  1UCR A;  3CDL A;  2HYJ A;  5F27 A;  2XAJ A;  2LKP A;  4HNT A;  4U7D A;  1HW1 A;  1OR7 A;  1R00 A;  1X1C A;  2E5Z A;  2EBI A;  4M6X A;  2DJN A;  4MGR A;  4G7H F;  1MW7 A;  1SAX A;  1I1G A;  2IA1 A;  4P96 A;  3RYR A;  3AL0 B;  3BTL A;  1XGS A;  4A3B J;  2VPL A;  4JBA A;  2PBI A;  3RPU A;  2Z2S B;  2UXP A;  2RNJ A;  4BEH A;  4O5V A;  2Y9Z A;  2UXH A;  1X3U A;  3C2B A;  3SZT A;  5GPA A;  3NI7 A;  2PFV A;  3CLQ A;  1TNS A;  4A0X A;  4EJO A;  1USS A;  3SYT A;  4Q47 A;  4BXF A;  2NYX A;  3OYC A;  1NK3 P;  2R7Q A;  3CUQ A;  3GFI A;  1HKT A;  2F4M B;  1WWX A;  2KKO A;  3WU0 A;  3Q9V A;  1ZG5 A;  1S72 I;  2L9N A;  1SAN A;  4WXC A;  2DA7 A;  1U8R A;  1DGR M;  2M8E A;  1HXD A;  1NHA A;  3CCE I;  2LG4 A;  2DA4 A;  2V9V A;  2E36 A;  2M0C A;  3CJR B;  3R0A A;  2LNB A;  4I7H A;  1TT5 B;  2MYS A;  2I8D A;  1R1U A;  3KX2 A;  3K9T A;  3X2Q H;  5JHF A;  2EJR A;  5K5Q A;  1GHC A;  2DT7 B;  1MJB A;  4HX7 A;  2CRG A;  2PFB A;  3RQ4 A;  3F8B A;  3ANG A;  5C3E J;  2K9Q A;  3KP6 A;  1X1P A;  2QBY A;  4XRF A;  3RPQ A;  3W2A A;  4HLY A;  5KNL A;  3ZQ7 A;  4CCK A;  3RPU D;  2X1C A;  5GTI C;  5TJJ A;  4PJN A;  1JHF A;  2IW5 A;  3CF5 F;  5H2F C;  3S8P A;  2P0W A;  4MTD A;  2O61 A;  2A6E F;  3GFM A;  2OQG A;  2RGV A;  1K6O A;  1O7L A;  3J7A Y;  2G7L A;  4EAT A;  3KPH A;  4B3A A;  4B48 A;  3COL A;  4I02 A;  2CU7 A;  4R8H A;  1HDP A;  1RUN A;  2UWM A;  2ADU A;  4CYC B;  3FM5 A;  1X3W B;  5D8K B;  3BG7 A;  4NC7 A;  3QU6 A;  2F4O B;  3FWE A;  2OAZ A;  2Y69 H;  2ZFW A;  4XRS A;  2F6C A;  2WBM A;  1ETK A;  2HQN A;  2V6C A;  3BOQ A;  3NAR A;  4CZZ A;  4BHB A;  2L54 A;  2M3A A;  4KFC A;  2KMU A;  1JKR C;  1MND A;  2CJJ A;  1FIP A;  3ESW B;  3MEX A;  3S32 A;  1A31 A;  1J59 A;  3OYM A;  3AQS A;  3ML6 A;  2KRF A;  2CYY A;  2H1L A;  2MH2 A;  2WY7 Q;  5HDG A;  1BR2 A;  2ZXJ A;  2VB6 A;  4B44 A;  1GDT A;  2X48 A;  2O8X A;  3F6V A;  1RC9 A;  3F8M A;  4XLE A;  5FGM A;  2E2H J;  2EFO A;  2WTE A;  5AON A;  1YJW I;  1XGN A;  4G7O F;  2VE8 A;  3HJE A;  4Z6Y A;  4U9N A;  1XSX A;  1SD4 A;  3CJD A;  4ZYE A;  3V8L A;  2DDA A;  1IN6 A;  2K85 A;  3PIP F;  4IRG A;  5M5W J;  5E8I A;  3LQQ A;  2X51 A;  1IC8 A;  4CCN A;  3ELK A;  4NQW A;  2P7V B;  2COB A;  2VON A;  2ZJQ F;  2N8G A;  2QQA A;  2KFD A;  2DLL A;  3HOX J;  1VZ0 A;  1LPQ A;  5A2Q Z;  4C2U A;  3S1Q J;  1HOM A;  5D5V B;  1TWF J;  3N05 A;  4YFK F;  1VQL I;  1IUY A;  2X0L A;  1YRN B;  5EEA A;  2XF5 A;  1W1W E;  2FF4 A;  5CXI A;  2V9K A;  3OS1 A;  2V6E A;  2DTZ A;  4Y33 A;  1SVO A;  1X2N A;  2QOP A;  3OWT A;  4OOI A;  3J81 K;  3S1M J;  1TP4 A;  2K9L A;  2YUS A;  4MK6 A;  1X1D A;  5JVT A;  4EJU A;  2V79 A;  3LST A;  4ICH A;  2LY9 A;  1NG7 A;  1N25 A;  3IAM 2;  2YX4 A;  4PXI A;  3DPL C;  2XAQ A;  3WGI A;  1DUX C;  1TT0 A;  4HA8 A;  1AHD P;  2WWY A;  4D0P A;  2MLG A;  4UUT A;  3DTK A;  2RC4 A;  5H20 A;  3ON4 A;  3QOE A;  2OPT A;  3RJP A;  4EMS A;  4H0E A;  2W53 A;  1Z91 A;  2ELJ A;  2XAG A;  3HPH A;  1LJ9 A;  3S2W A;  3HTH A;  3MZY A;  3NWT A;  3SFZ A;  2JA8 J;  3H5R A;  3IH2 A;  3KZY A;  2XKO A;  4JP0 A;  2XF7 A;  2WC2 A;  3E3V A;  4Q48 A;  3FXU A;  2VL8 A;  1XS9 A;  1B72 A;  4HYE A;  2FUG 2;  4WXH A;  3IUV A;  4XR6 A;  2HPM A;  1TBX A;  2PMZ N;  2HDC A;  1G8X A;  2R4G A;  2IAI A;  4IPA A;  2W48 A;  1D0Y A;  1YE9 A;  1POG A;  2BV6 A;  5HS8 A;  1I39 A;  3PJR A;  1ZK8 A;  2HGC A;  2EPF A;  3QYB A;  4NHJ A;  4UNO A;  4IHT A;  3M7G A;  2LMD A;  3EYY A;  3F3X A;  4XN0 A;  4F7Z A;  5LEK A;  1OCC H;  3OYH A;  1SD5 A;  3QOD A;  5B1A H;  1JJ6 C;  5CVJ A;  1B9M A;  4Y17 A;  4I99 C;  2CQK A;  1IN8 A;  3B81 A;  2JRM A;  1K78 B;  1OCZ H;  3OY9 A;  1YG2 A;  2DMN A;  5F1R A;  3DEE A;  3FM3 A;  1JI8 A;  4WIB A;  5D19 A;  3HTI A;  4UVB A;  1EH6 A;  3QPL A;  5CVR A;  5KVR A;  1V55 H;  4PZJ A;  1IAW A;  4GO1 A;  3KFW X;  1SGM A;  1S9H A;  1S29 A;  1I1S A;  1KU7 A;  4HDV A;  4AF5 A;  3UNG C;  2FOW A;  3G6E I;  5F0F A;  4ZYD A;  3C18 A;  3WU2 C;  3DLA A;  3G1M A;  1RRJ A;  4DVY P;  2MD5 A;  5JLX A;  4YRV A;  4EM0 B;  4BEH B;  3ZXS A;  2H8W A;  3G2B A;  2A07 F;  4A3C J;  4IVN A;  5LBQ A;  5BMZ A;  1QA6 A;  3JR9 A;  4AYB N;  1S5L C;  2CV1 A;  3QOP A;  4OIR F;  4X6A J;  1DU6 A;  4YEL A;  5KCM A;  1ETO A;  2ID3 A;  3CUQ B;  4HNU A;  4U0Y A;  2RV8 A;  5BQT A;  3GUD A;  3ERE D;  2RNG A;  3GFL A;  5FD6 A;  5JLW A;  4I09 A;  3HTS B;  5FKN A;  3GZ5 A;  2OC6 A;  2L5Q A;  2R93 J;  1DPU A;  2GZW A;  1F43 A;  1FPQ A;  4XIC A;  2XB5 A;  5HNH A;  1X19 A;  2QZ8 A;  1T8I A;  2MW8 A;  2YSR A;  2VC0 A;  1Q1V A;  1WPK A;  3V7C A;  4L0Y B;  3B6A A;  2QBY B;  2XAH A;  4KJZ A;  2CS3 A;  1XSV A;  2A6H F;  2NNN A;  4PSX A;  2CQ7 A;  2CUF A;  3L2U A;  2IRF G;  1ZTR A;  1BR1 A;  2P5K A;  2MC3 A;  3ZCO A;  2DMT A;  1JT0 A;  1JKO C;  1H9T A;  5FMP A;  2XRO A;  4E6K G;  4M3D A;  5D6E A;  2JSC A;  4ZZL A;  5HOD A;  2LOO A;  1D8K A;  3O60 A;  1FOW A;  3BCG A;  4KA4 A;  4B4C A;  4BH9 A;  2W00 A;  4Y7N J;  3GVA A;  2JT1 A;  4AC6 A;  5K7Z A;  2ESH A;  1HW5 A;  4XSX F;  4DNC A;  1YTY A;  3V78 A;  3HYI A;  2HR3 A;  3C2H A;  3D5R C;  4MHG A;  3AKZ A;  2R7U A;  1S7O A;  3KET A;  4EVI A;  1XDS A;  4AC0 A;  4N9H A;  2VJJ A;  3MAJ A;  2W7N A;  3C07 A;  2FJI 1;  2VJ4 A;  3I0T A;  3G1L A;  2OQR A;  3KYD B;  2JSP A;  2V26 A;  4HX8 A;  3DPJ A;  1UMQ A;  2FBH A;  1EH8 A;  2JK3 A;  3DTI A;  4N0B A;  2CFX A;  4UXN A;  3KP5 A;  3ZQG A;  1LNW A;  2QQ8 A;  2XB0 X;  2O03 A;  1W0U A;  3BPX A;  1P4A A;  5IP7 J;  3CMA I;  1LEB A;  1C0W A;  4AM3 A;  2ACJ A;  1WJE A;  4QPQ A;  4CCL A;  5IOZ A;  3QAH A;  5J8F A;  1BL0 A;  2G7S A;  2P4W A;  3GW2 A;  3OIO A;  1LUJ B;  3EUH C;  3OS0 A;  3F21 A;  2QM3 A;  3A1Y A;  1QHH D;  2O0Y A;  2GXA A;  1FTZ A;  5E8G A;  2QKO A;  5EYR A;  5ILS A;  1FYK A;  4NC8 A;  5FFZ A;  3BT9 A;  1K4S A;  4NQW B;  2ESN A;  2KDZ A;  3FBN B;  4HF0 A;  2YR2 A;  3IRR A;  3WGH A;  1O3T A;  1CQT A;  1LQ1 A;  2R0Q C;  4KIT B;  1T0F C;  3MKW B;  3ON2 A;  3FIW A;  3B73 A;  1TWA J;  1MMD A;  4E7J A;  3HTJ A;  1V5F A;  2X9D A;  3EGQ A;  1U5T C;  1W7P A;  1Y0N A;  3PO2 J;  5EJC A;  4IOA F;  1JXS A;  3ZQQ A;  3CD6 I;  2COM A;  3L00 A;  1O57 A;  3K4M A;  3C7J A;  2LKX A;  5BOX A;  1VQK I;  2BZT A;  4HST A;  2HPI A;  2MG4 A;  2I5U A;  5DUI A; 
#chains in the Genus database with same CATH homology
 4L62 A;  1JKQ C;  1MBJ A;  2FD5 A;  2LK2 A;  5CW8 A;  1Y1W J;  2CQQ A;  1QVT A;  3PM1 A;  4XRM A;  1ZR4 A;  5F08 A;  2NVT J;  4JNN A;  3ANP A;  4ME9 A;  4MXM A;  3A03 A;  3RD3 A;  1NTC A;  2O7O A;  1BW5 A;  2PBX A;  3RZD J;  2DA3 A;  1FEX A;  1WH7 A;  1RPW A;  1H8A C;  3I4N J;  3CQZ J;  3BJB A;  5H9T A;  1MH3 A;  2VPR A;  1IRZ A;  3HEF A;  3JRC A;  1PUF A;  1GT0 C;  2L7Z A;  1B8I B;  4M3F A;  3S2D J;  1BA5 A;  2WGB A;  2R5Z B;  2UXO A;  5HBU A;  3ZQI A;  1APL C;  3VOX A;  2NP3 A;  3JRE A;  2FX0 A;  1B72 B;  2B63 J;  5CXG A;  4DYC A;  3K7A J;  3SJM A;  2IU5 A;  1Z77 A;  2XGE A;  3JRA A;  3OSF A;  3S2H J;  4JX6 A;  2QCO A;  4QSH A;  1F36 A;  2QF7 A;  2FJ1 A;  4M3E A;  1ETV A;  3ZOB A;  4GCT A;  4W1U A;  5K58 A;  1JUS A;  5DAJ A;  2R5Y A;  2ECC A;  2PZ9 A;  2QWT A;  1AKH A;  2XRL A;  3H0G J;  1LFU P;  3IH4 A;  4FTH A;  1H88 C;  2O7T A;  4M3G A;  3VVZ A;  2K40 A;  1ENH A;  4YZE A;  3E7Q A;  2O8K A;  1P7J A;  4A3G J;  5J1Y A;  3JRD A;  1GV2 A;  4BBS J;  2DA2 A;  1ZQ3 P;  2F07 A;  4W97 A;  3K2A A;  1LE8 B;  2Y31 A;  2LVS A;  5EZG A;  2YU9 J;  1JTX A;  3BHQ A;  4HKU A;  5IYC J;  4XID A;  1IUF A;  5FJ8 J;  3TW7 A;  4Y52 J;  2AO9 A;  1QRY A;  3LSG A;  2LFB A;  3TP3 A;  3GZI A;  3VUQ A;  1X2M A;  2E19 A;  5FKK A;  4JX5 A;  3S5R A;  3ZQF A;  2V57 A;  3S16 J;  5E3M A;  3VOK A;  1TWH J;  1XG1 A;  5F0C A;  4A3M J;  5EGO B;  1MNM C;  1UI5 A;  4MO7 A;  3CDL A;  2HYJ A;  5F27 A;  2FQ4 A;  4D7M A;  4NDL A;  3GTM J;  1IDZ A;  3TED A;  3OSG A;  1QPI A;  4ACI A;  1I3Q J;  3Q0V A;  5EZH A;  3LJL A;  4MFD A;  2EBI A;  1VFC A;  2DJN A;  1JUP A;  1ZGW A;  2WUI A;  2HDD A;  2JA6 J;  3NRG A;  2RAE A;  3VP5 A;  1JT6 A;  3QQA A;  3BTL A;  4XRS G;  4A3B J;  2HYT A;  1ORK A;  2UXP A;  2UXH A;  2Y9Z A;  5GP9 A;  4J19 A;  3C2B A;  5GPA A;  2AHQ A;  5E3L A;  3NI7 A;  1QVU A;  2RAS A;  2H8R A;  1D5Y A;  1VND A;  2QTQ A;  4UDS A;  2HOA A;  3VW2 A;  5EG0 B;  3CCY A;  1NK3 P;  2QIB A;  2ME6 A;  3JRH A;  1PUF B;  2DMP A;  3MNL A;  3JSJ A;  4DZJ A;  3MN2 A;  2CQX A;  1SAN A;  4DZP A;  3CRJ A;  2DA7 A;  4DW6 A;  2EZL A;  4HNV A;  2DA4 A;  2M0C A;  2O9L A;  5J3L A;  2XPV A;  3FRQ A;  1G2H A;  1RET A;  2CRG A;  3PO3 J;  3ANG A;  5C3E J;  2K9Q A;  3F1B A;  1LFB A;  3BR3 A;  1EF4 A;  2JA7 J;  2OI8 A;  3PAS A;  1OJL A;  3BR6 A;  1OCT C;  4UUS B;  3SFI A;  4RDU A;  4NN1 A;  2TCT A;  4S0H B;  4BBR J;  2DG7 A;  2OER A;  1S7E A;  1ITY A;  2Y30 A;  4A3F J;  2G7L A;  1ETY A;  4BKX A;  4B3A A;  4IHY A;  3BR2 A;  3COL A;  3GBG A;  2CU7 A;  1H89 C;  3HE0 A;  2M8G X;  1HDP A;  4A3I J;  3A01 B;  4CYC B;  2JJ7 A;  1OFC X;  1NK2 P;  4GCK A;  3TP0 A;  2GUH A;  5J1U A;  4XRS A;  3GTJ J;  3ZQL A;  1ETK A;  3NAR A;  4A3D J;  3F0C A;  2XPW A;  5E3O A;  3G56 A;  5GPC A;  1XC5 A;  2NVY J;  1JKR C;  5FKO A;  5FKL A;  3V6G A;  2CJJ A;  3S17 J;  1FIP A;  3CWR A;  2ECB A;  2VKV A;  3LSP A;  3AQS A;  1UHS A;  3TW6 A;  1WI3 A;  5IP6 A;  3GTP J;  3NNR A;  2Q24 A;  1SFO J;  1A6I A;  2JMW A;  5M5Y J;  1JJ8 C;  1GDT A;  1WGX A;  2NS8 A;  2X48 A;  2K9S A;  2E2H J;  2LLK A;  2D5V A;  5FKM A;  5C4J J;  2EZK A;  4BY1 J;  4FCY A;  2YS9 A;  1MBK A;  2K9N A;  3LHQ A;  4L5E A;  3CJD A;  5IYD J;  5M5W J;  1MH4 A;  2MSY A;  2D6Y A;  3IH3 A;  1IC8 A;  4XK4 A;  2GBY A;  3HIM A;  3BQY A;  5E3N A;  2XDN A;  3KKD A;  1T33 A;  2COB A;  3LWJ A;  2N8G A;  1JUM A;  3BG9 A;  2VI6 A;  3HOX J;  2FBQ A;  3S1Q J;  2DA1 A;  1U9N A;  2ELK A;  1HOM A;  3SDG A;  1TWF J;  1ZKG A;  4NEL A;  1Y1V J;  2Y9Y A;  1WCM J;  4MFE A;  5FLV A;  1YRN B;  5EEA A;  2JN6 A;  1RKT A;  5CXI A;  4MIM A;  1OCP A;  2DTZ A;  3HGG A;  1K83 J;  1X2N A;  4A69 C;  1O4X A;  2QOP A;  3DCF A;  3S1M J;  3P9T A;  2G7G A;  2YUS A;  4MK6 A;  2VKE A;  1FJL A;  1MSF C;  1U8B A;  4A93 J;  4ICH A;  2LY9 A;  5AQC A;  4FE7 A;  4JYK A;  3H3V K;  4PXI A;  3LOC A;  3AQT A;  1R9T J;  4MLO A;  5M3M J;  1IJW C;  1AHD P;  1HF0 A;  2XGC A;  4QIW N;  1X58 A;  5IPA A;  4UUT A;  3ON4 A;  5C44 J;  2OPT A;  2W53 A;  1K61 A;  1B8I A;  2M2E A;  3RKQ A;  2DMU A;  3HTH A;  2R5Z A;  2JA8 J;  2GEN A;  1IDY A;  1MBE A;  3FKI J;  1MBH A;  3IH2 A;  4JP0 A;  5K7H A;  5F04 A;  2HXI A;  2DA5 A;  5M5X J;  1GV5 A;  1XS9 A;  1B72 A;  3QPS A;  4IHV A;  3IUV A;  2PMZ N;  2XPU A;  5FGL A;  2IAI A;  1A5J A;  2W48 A;  1POG A;  3UKG A;  5DS9 A;  5HAW A;  1ZK8 A;  4C3I J;  2H1K A;  4I6Z A;  1RKW A;  4JX4 A;  5F1J A;  2JWT A;  3S14 J;  2ID6 A;  2EQR A;  3JRB A;  2DMQ A;  2R5Y B;  1W0T A;  2HI3 A;  4C2M J;  1AKH B;  3RH2 A;  3I4M J;  4B1R A;  3CMY A;  1IG7 A;  1JJ6 C;  4AUX A;  2DG8 A;  2E1O A;  5HSZ A;  1FIA A;  2OF7 A;  2ZCX A;  3B81 A;  2IEK A;  2M9H A;  2R7Z J;  2X6O A;  2DN0 A;  3GTO J;  2JA5 J;  1LE8 A;  2DMN A;  3Q3S A;  1MBG A;  9ANT A;  5IOY A;  3MKL A;  2XSD C;  3D1N I;  5D19 A;  2ZOZ A;  3HTI A;  3BR5 A;  3HDD A;  3ZQH A;  3FK7 A;  1VI0 A;  3QPL A;  4ABZ A;  3S15 J;  2L7M P;  5FLM J;  2CUE A;  3VIB A;  1SGM A;  1VF9 A;  3HM5 A;  3HBL A;  3VVY A;  4CGR A;  3QBM A;  1U78 A;  2G3B A;  2E2I J;  1HLV A;  3RZO J;  3NAU A;  2ME0 A;  5C4X J;  4AF5 A;  4QTR A;  1UG2 A;  1ETW A;  4DYQ A;  3NXC A;  1UI6 A;  2WV1 A;  5F0F A;  3G1M A;  2Y0S N;  3G7R A;  3WHB A;  3Q0U A;  5JLX A;  2TRT A;  4GFK A;  5IYB J;  2EZH A;  2EZI A;  5M3F J;  4A3C J;  2YVE A;  3Q0W A;  5EG0 A;  4DYR A;  1AU7 A;  3JR9 A;  1HDD C;  4AYB N;  3B6C A;  1RES A;  2MG4 A;  4X6A J;  1DU6 A;  4V2F A;  4IEJ A;  2P81 A;  1ETO A;  2ID3 A;  4KWA A;  2LTP A;  4I76 A;  4M6V A;  3HOY J;  2NVX J;  3GTK J;  5JLW A;  2YVH A;  2I10 A;  1ZR2 A;  5FKN A;  2R93 J;  1I6H J;  5EDN A;  1F43 A;  4XIC A;  2E2J J;  2XB5 A;  3NPI A;  3OOU A;  3L1P A;  3VW0 A;  1FTT A;  3BTC A;  3T6N A;  4GCL A;  2MW8 A;  1U9O A;  2XGD A;  5J1R A;  1Q1V A;  1WPK A;  4C3J J;  2HKU A;  3O8H A;  3B6A A;  1TWC J;  4UUS A;  3GTQ J;  2L9R A;  3HOW J;  2NOG A;  2CUF A;  2L0K A;  3JRI A;  2NP5 A;  4D5F A;  1ZTR A;  2UXI A;  2ZOY A;  2NS7 A;  1MBF A;  2DMT A;  2G0E A;  3QKX A;  1JT0 A;  3KKC A;  1JKO C;  4IHW A;  3FK6 A;  5FMP A;  5D18 A;  3RQI A;  3ZQC A;  2DA6 A;  1DU0 A;  4M3D A;  1TWG J;  3FIS A;  4RBO A;  3LSR A;  4D7N A;  5HOD A;  2NX4 A;  3O60 A;  3BCG A;  2Y2Z A;  4B4C A;  4Y7N J;  2VUM J;  3A01 A;  1BJZ A;  4FIS A;  4CYC A;  3HGY A;  3S1N J;  4AC6 A;  3GTG J;  3G1O A;  3BG5 A;  5K7Z A;  2HQ5 A;  4D5C A;  3GTL J;  3V78 A;  3BG3 A;  3HTA A;  4X1E A;  2NVQ J;  2HOT A;  1IV6 A;  3M4O J;  2REK A;  5BNG A;  3HB9 A;  3BNI A;  3VPR A;  1TC3 C;  3JRG A;  4AC0 A;  3HOU J;  1E3O C;  2IBD A;  3C07 A;  4A3K J;  3BQZ A;  1Z0X A;  3G1L A;  2HXO A;  4IHX A;  3LNQ A;  4GFB A;  2R92 J;  3DPJ A;  1UMQ A;  2JK3 A;  1IGN A;  3HOV J;  3ZQG A;  4A3J J;  5EF6 A;  5DTD A;  3O8G A;  3IV5 A;  2XB0 X;  1W0U A;  4EEF G;  2ZCM A;  5IP7 J;  3VVX A;  1JTY A;  3E7L A;  3PPB A;  1WH5 A;  3BRU A;  3LSJ A;  4JL3 A;  3MVP A;  5IOZ A;  2LR8 A;  1BL0 A;  2G7S A;  1HCR A;  2GFN A;  4G12 A;  3OIO A;  3W6V A;  5FHP A;  2UXU A;  3A02 A;  3BTJ A;  4GFL A;  3KZ9 A;  3BR0 A;  1I50 J;  3S1R J;  4A3L J;  4BXX J;  2WB1 N;  1FTZ A;  3BR1 A;  5EYR A;  2QKO A;  2HOS A;  2RHA A;  5F0H A;  3BT9 A;  5EFY A;  1RR7 A;  1GVD A;  3M3Y J;  4M3B A;  1ETX A;  2KDZ A;  2WAQ N;  4FE4 A;  1ETQ A;  4A3E J;  1CQT A;  2R0Q C;  2GLO A;  5C4Y A;  3GEU A;  3ON2 A;  3FIW A;  2M34 A;  1TWA J;  4V2G A;  1GUU A;  3DEW A;  2LD5 A;  4LOC A;  2X9D A;  3HTJ A;  3WHC A;  2LP0 A;  3EGQ A;  1JKP C;  5IP9 J;  4BY7 J;  2L7F P;  1JGG A;  2ZB9 A;  2MGQ A;  3PO2 J;  3KNW A;  4JKZ A;  3BTI A;  2ZCN A;  1YRN A;  1MSE C;  2GM4 A;  3HKZ N;  5D1R A;  5EGO A;  3VW1 A;  3JRF A;  2KT0 A;  5K7F A;  2LKX A;  1BW6 A;  1P7I A;  3EUP A;  1T56 A;  2EH3 A;  4C3H J;  3HOZ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...