1JT6A

Crystal structure of the multidrug binding protein qacr bound to dequalinium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical transcriptional regulator IN QACA 5'region
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 81
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt6A02
3HB9A 3BHQA 2L7FP 3CQZJ 1RESA 1WH7A 4M3FA 3KNWA 3A02A 5BNGA 3IH2A 4M3BA 3WHBA 3OOUA 1YRNB 1A5JA 3FISA 4AF5A 3AQSA 1MBHA 3ZQIA 1JKQC 4IEJA 2COBA 4XRSG 2LR8A 2O9LA 2NX4A 3VW1A 3GTGJ 1VF9A 2K40A 4S0HB 2JMWA 1SANA 1XC5A 4JX5A 2VKVA 4A3IJ 1ZGWA 3GTPJ 2XRLA 4MO7A 5F0HA 3IV5A 2JA6J 4NELA 1IJWC 2XPWA 5C3EJ 2DA2A 3JSJA 3CWRA 2FQ4A 4BY1J 2OPTA 4CGRA 1F36A 4JX4A 1SFOJ 3SDGA 3CMYA 4XICA 3S1RJ 3S15J 4X1EA 1FTZA 3M4OJ 2G0EA 2DMTA 2ECBA 2RASA 3JRIA 3OSGA 4NN1A 3Q0UA 3VVYA 4A69C 3CRJA 1ZTRA 3BQYA 1QVTA 1Z0XA 2WV1A 1WGXA 3MKLA 3LHQA 4JP0A 2OI8A 1ETYA 2CUFA 2R7ZJ 3HTJA 3B81A 1X2MA 4MFDA 1K61A 2EZIA 1BL0A 1NK3P 2EZLA 5EGOB 2R93J 5IP6A 5HAWA 3KZ9A 5D18A 2D6YA 4DYQA 1TWGJ 1UI6A 4JL3A 1VFCA 3MN2A 3LNQA 4C2MJ 3WHCA 3HGGA 1GVDA 2UXUA 2IBDA 5K7HA 5M3FJ 2CRGA 3BTCA 5HSZA 2TCTA 2P81A 2AO9A 3NARA 4MIMA 1RPWA 2Y9YA 1B72B 2M2EA 3M3YJ 5EFYA 3JRDA 4A3BJ 2REKA 4ME9A 3GTJJ 1NTCA 1TC3C 3LJLA 3V78A 2Y31A 5IYCJ 5FHPA 3D1NI 2HYTA 1MBGA 2L7ZA 4DYRA 2VUMJ 4MXMA 2CU7A 1FJLA 2YVHA 2QTQA 2ME0A 2JN6A 1S7EA 3BNIA 5J1YA 2GM4A 1MBJA 3HTIA 1BW5A 4YZEA 3B6AA 2B63J 4D7NA 2OF7A 1IC8A 1H8AC 3GTQJ 2GFNA 1SGMA 1ETKA 5HODA 5CW8A 5GP9A 1P7IA 2NP3A 4HNVA 1MSEC 3TW7A 1WCMJ 1JUSA 3IH4A 5FKOA 5JLXA 4EEFG 5IOZA 5IYBJ 2XGEA 4RDUA 3F0CA 4I76A 3BG5A 1TWHJ 2WUIA 5H9TA 3NXCA 3B6CA 2EBIA 4B3AA 2Q24A 2YVEA 2ZCMA 3S1MJ 1UMQA 3MNLA 1GV2A 2FX0A 2DA3A 4HKUA 5IPAA 5AQCA 4JNNA 1ENHA 3K2AA 3ZQHA 2DMQA 4IHYA 1ZKGA 4FE7A 1I50J 2Y2ZA 3BTIA 2GUHA 1LFUP 3E7QA 2XPVA 3LSGA 4M3GA 1RETA 2Y30A 1GDTA 5IYDJ 5C4YA 3NRGA 3HEFA 5GPCA 1XS9A 4A3DJ 1JGGA 1APLC 3E7LA 1ZK8A 2DN0A 1ETOA 2QIBA 4D5FA 1JKPC 4DZJA 1TWAJ 4GCKA 5EGOA 1I3QJ 4A3FJ 1EF4A 3C07A 2XDNA 3CCYA 1LE8A 5FKLA 1ZR4A 2EH3A 1AU7A 2M8GX 2QCOA 3C2BA 2LTPA 1MH4A 5M3MJ 1IGNA 2D5VA 4ICHA 2DA1A 1HOMA 1WPKA 3AQTA 3BTLA 2ZCNA 2DA5A 1E3OC 2G3BA 2E1OA 1MBFA 1CQTA 3ON4A 3JRFA 1JTXA 3BR6A 5EZHA 1AHDP 2IAIA 1B72A 4GFLA 5M5WJ 2X6OA 5E3NA 2K9SA 4UUTA 5JLWA 3UKGA 4A3CJ 3PPBA 4AC6A 4JKZA 3QKXA 1IUFA 1K83J 4DZPA 2E2JJ 4A3MJ 1WH5A 5FLVA 2PMZN 2LLKA 4XRMA 2G7SA 4FE4A 3FRQA 2L0KA 3QBMA 5IOYA 4GFKA 2MG4A 3MVPA 3PASA 2HOAA 3JR9A 3G7RA 4XK4A 4KWAA 3T6NA 2HI3A 2ID3A 5EEAA 3ZQLA 2XB5A 4JX6A 2M9HA 3G56A 1Y1WJ 2NVXJ 3BRUA 5FJ8J 2PBXA 1GV5A 2EQRA 2QOPA 2MW8A 1R9TJ 9ANTA 2TRTA 3S2DJ 2XGCA 1MNMC 1LE8B 2R92J 3KKCA 3TEDA 4XRSA 4BY7J 5J1RA 3BR3A 1B8IA 2W53A 4AUXA 3BQZA 1UHSA 2YU9J 5FMPA 3A03A 4RBOA 1I6HJ 5DAJA 3G1MA 3HTHA 3NNRA 2ECCA 2HDDA 4MFEA 1DU6A 2YS9A 2G7GA 3NAUA 3ANGA 3H0GJ 2FJ1A 2HXIA 3TP0A 5EF6A 1JKOC 5F0CA 3HE0A 3OIOA 3QQAA 1AKHA 2JA7J 3HDDA 2NS7A 4W1UA 3OSFA 4IHVA 3VP5A 5FKKA 5FGLA 3A01B 1HLVA 4B1RA 4AC0A 3Q0VA 2HXOA 1QRYA 2VPRA 1IG7A 3PO3J 1F43A 3QPLA 2CUEA 5DS9A 4CYCB 2LD5A 3HGYA 3S1NJ 2L7MP 2IU5A 5GPAA 1JKRC 3JRGA 3S17J 2XSDC 3BR0A 3H3VK 1XG1A 4C3JJ 2HQ5A 1G2HA 5FKNA 1GUUA 2E2HJ 3P9TA 1VNDA 1BA5A 1O4XA 3VOXA 2NVTJ 3BR5A 1RR7A 4A3KJ 2NP5A 3CDLA 2LKXA 5C44J 1IV6A 4L5EA 2X9DA 4LOCA 5FLMJ 1MBKA 3BT9A 1FIPA 1X58A 2HYJA 4A3GJ 2O8KA 1BW6A 1TWFJ 1H89C 1GT0C 1B8IB 2MGQA 1UI5A 2WB1N 2M34A 5K7FA 2XGDA 2ZCXA 3S16J 3K7AJ 3GTKJ 2CJJA 3VW0A 2MSYA 5E3MA 4XIDA 5IP7J 3HOXJ 4DYCA 4M6VA 3HOZJ 4J19A 4Y52J 3S5RA 2YUSA 4GCTA 3BR1A 5DTDA 2KT0A 3TW6A 3VIBA 1MH3A 4JYKA 2HOSA 1AKHB 1P7JA 3NPIA 2JWTA 4A3EJ 1JT0A 1HDPA 3ANPA 4UDSA 1JUMA 2DMPA 1ETWA 3HIMA 3ZOBA 3HOYJ 3LSRA 3I4MJ 2X48A 3BTJA 4BXXJ 1MBEA 3HOUJ 5F1JA 3BG3A 5HBUA 1DU0A 3S2HJ 1WI3A 2DMUA 1ORKA 5EG0B 2DA7A 2NVYJ 3HM5A 1OCPA 4I6ZA 2DG7A 2DA4A 1MSFC 5J1UA 1FEXA 1JJ6C 5IP9J 3JRHA 3Q0WA 1Y1VJ 3LSPA 2E2IJ 3GZIA 1NK2P 3RKQA 2VI6A 4MLOA 3HOWJ 3GTOJ 3JRAA 3VPRA 3LSJA 2V57A 2JK3A 4X6AJ 1QPIA 4M3DA 2R5ZA 2OERA 2DG8A 2IEKA 1PUFA 2H8RA 3O8HA 4C3IJ 3JRBA 3GBGA 3EUPA 4BBRJ 1IDYA 3A01A 2UXOA 4ABZA 3JREA 2LVSA 3ZQGA 4FCYA 3QPSA 4QTRA 4CYCA 1JUPA 5E3OA 1A6IA 2VKEA 5EZGA 4FTHA 1W0UA 3PO2J 2GLOA 2ZOZA 2G7LA 2LY9A 2UXPA 3HOVJ 4W97A 1HDDC 5K58A 1OFCX 3F1BA 3FK7A 1RKWA 2ELKA 1IDZA 1ZQ3P 3RD3A 3CJDA 3BR2A 3G1LA 4UUSA 2EZHA 3VUQA 2I10A 1HF0A 3S14J 3O8GA 2FD5A 2E19A 5EYRA 2F07A 1RKTA 2NOGA 2XB0X 2WGBA 3G1OA 3L1PA 1H88C 1T33A 5C4XJ 1FTTA 2Y0SN 3W6VA 1JJ8C 3RQIA 3NI7A 5FKMA 5M5XJ 2M0CA 5C4JJ 3BJBA 2CQXA 1UG2A 2DA6A 2L9RA 1X2NA 5D19A 3V6GA 2EZKA 1ETVA 4BBSJ 5F08A 2R0QC 4A93J 2XPUA 2O7OA 1JT6A 3IUVA 2QWTA 1LFBA 2R5ZB 5EDNA 2UXIA 2WAQN 4D5CA 3ZQCA 1W0TA 1PUFB 5K7ZA 5D1RA 2QKOA 5F04A 3VW2A 1T56A 2DMNA 3FKIJ 2R5YA 3RH2A 2HKUA 1ETQA 3TP3A 2KDZA 2K9NA 3BG9A 4DW6A 5EG0A 2ZOYA 3IH3A 4QSHA 1U8BA 4GFBA 3DPJA 2RAEA 3RZDJ 1FIAA 1HCRA 4A3JJ 4UUSB 4M3EA 1D5YA 3GEUA 3KKDA 2JA8J 1U9NA 4MK6A 1Q1VA 5F27A 2H1KA 3ON2A 1TWCJ 5M5YJ 5CXGA 3DEWA 2PZ9A 4GCLA 2AHQA 4NDLA 2QF7A 1ETXA 5E3LA 2CQQA 4IHXA 1IRZA 3HTAA 5J3LA 2DJNA 1OCTC 4ACIA 1OJLA 3GTLJ 3VOKA 2DTZA 3DCFA 2O7TA 3VVZA 3S1QJ 1YRNA 3ZQFA 2K9QA 4IHWA 2NS8A 2JA5J 2ID6A 2GBYA 2GENA 3FIWA 2RHAA 3SFIA 3RZOJ 1POGA 4QIWN 2NVQJ 2FBQA 5CXIA 2N8GA 1ITYA 3COLA 2Y9ZA 1U78A 2W48A 1QVUA 1VI0A 4FISA 4C3HJ 2UXHA 4PXIA 3HKZN 5F0FA 4AYBN 3JRCA 3SJMA 1U9OA 3GTMJ 3LOCA 4D7MA 4L62A 4A3LJ 3O60A 2R5YB 2JJ7A 4Y7NJ 2ZB9A 3LWJA 3VVXA 1Z77A 3BCGA 2LFBA 2HOTA 3PM1A 3I4NJ 3EGQA 1ZR2A 1JTYA 2LK2A 4B4CA 4V2FA 3Q3SA 1BJZA 4BKXA 3HBLA 3FK6A 2LP0A 4V2GA 2ME6A 4G12A
chains in the Genus database with same CATH superfamily
3IKVA 1T95A 5E1WA 4M3FA 2CH0A 3FM5A 5F6FA 3OYGA 3BOQA 5E8IA 3R0JA 3WGGA 2CV1A 2ZXHA 3ABUA 4XOPA 3BLYA 1MBHA 3ZQIA 2Q2EA 2LBFA 4IEJA 2CFOA 2LR8A 2Y48A 2OCEA 3HRTA 1OYWA 2E1CA 2V26A 3QOEA 4YIFA 4IRGA 3K2ZA 1SANA 4WK8F 2GQQA 2KMUA 2KDOA 2VKVA 1ZGWA 1TT5B 2E7XA 5D5VB 2V1XA 3GTPJ 5F0HA 1F5TA 2JA6J 1IJWC 5LLQA 4JX4A 5GTHC 3F72A 2F5CA 3CMYA 1YO5C 1R1TA 1U2WA 4X1EA 5ICCA 3M4OJ 2CSOA 2G0EA 3R61A 4XM3A 2WAEA 1SVOA 1SEUA 2RASA 2CW0F 5ERIA 5E1XA 3PIPF 5FRNA 1SFKA 3VVYA 3CRJA 2WV1A 4E7KA 1DPRA 3PNYA 4PJ0C 3LHQA 3HTJA 1X2MA 3DXJF 2CUJA 1B59A 2UWMA 3KCCA 1KYZA 3HJEA 2BV6A 3QP5A 4ITVA 2A6EF 3RTRA 1WQ2A 3SFZA 2K9LA 5IP6A 3MAJA 1MDMB 4BQAA 2D6YA 3MN2A 1RRJA 2JA2A 5FO5A 2V79A 3WHCA 4DNCA 3C1DA 1YE9A 2DFHA 3CCRI 1FC3A 4R79A 1VQNI 2DDBA 2CRGA 3BTCA 4N9IA 2TCTA 3FM3A 1KQ8A 3SXYA 1O3QA 2D2WA 3FXLA 2DK8A 2Y9YA 4P96A 5D5WB 3VYRB 4Y13A 2M2EA 4RB3C 3CUOA 2WAFA 1K78A 3M3YJ 3HL2A 4EGZA 4A3BJ 2REKA 4ME9A 2IGNA 2XAUA 1KONA 3QYEA 4I01A 3MZYA 2ZC2A 5EJCA 2Y31A 3ZMTA 4MQVA 2QKMB 4XLNF 1IRFA 3D1NI 4IZZA 2KKOA 2VUMJ 3MKZA 4U9LA 1P9QC 1TZLA 5E8GA 1U3EM 1MJBA 2YVHA 2QTQA 3RDIA 2EFWA 3ZP5A 2A3SA 2OZ6A 1S7EA 2XAJA 2DI3A 2GM4A 1MBJA 1T0FC 5LEJA 5H6RA 2ZXJA 4YZEA 4NNJA 4HEA2 4G7ZF 2X51A 2OF7A 1SGMA 2DO7A 5FD6A 5GP9A 1P7IA 3J7ZI 1MSEC 1PDNC 1N75A 3TW7A 5FKOA 3IH4A 3ISPA 4PUSA 3MFKA 2YVXA 4ZYEA 4WF2A 2E34A 2FOWA 3I58A 2H27A 3F0CA 1YW9A 3BG5A 4U0VA 2WUIA 5H9TA 1K4SA 2VC1A 3H0DA 3DBLB 1R49A 1Y6IA 1ZLKA 3ABTA 3B6CA 4IHSA 3LFKA 1K4TA 2WBMA 1T08B 2QM3A 4B3AA 2ZCMA 2Q0OA 1XD7A 2QVOA 2NAZA 4HKUA 5IPAA 1J2XA 2VASA 3CO7C 4YELA 3BP8A 2EIJH 3ZQHA 2MYSA 3GO5A 4FE7A 1I50J 3BTIA 5BOXA 4H0EA 3L7WA 5GAEJ 3OIPA 2QBYA 2XPVA 3B73A 4M3GA 5C4YA 3W3CA 3PQKA 5GADJ 3QYFA 1Z1DA 1LPQA 3CLOA 1IXCA 2QIBA 1HSTA 1TWAJ 2DK5A 3C07A 2CW7A 2PBIA 1J59A 2XDNA 2OQGA 3RIRA 2BY1A 1LKXA 4AIJA 3GXOA 2V7FA 3S3MA 1ZR4A 1EV7A 3ZPLA 4L9NA 2ACJA 2D5VA 1TW3A 4PGGA 2DA1A 4M73A 1HOMA 2YX4A 3AQTA 4I98B 1YITI 3BTLA 1NHAA 2W24A 4XKBA 2G3BA 5JFRA 2Q1ZB 3K4BA 4BL0B 3BR6A 4UVAA 2R4GA 3OOPA 5E3NA 4UV8A 3HSFA 2RN7A 4A3CJ 5IT9Z 3V7SA 1U5TC 1LB2A 4I99C 4ZTFA 4BE1A 1O3RA 2DJIA 2VT3A 2VQGA 2PMZA 5ILSA 4ZDOA 1BIBA 1BR1A 1U0JA 3FRQA 2L0KA 2HEOA 2G7UA 3OYIA 1X19A 3MVPA 2HOAA 3JR9A 4LIUA 3KP4A 4ON0A 2LC2A 2ID3A 4JX6A 2M9HA 4II2A 1Y1WJ 2R7TA 2ISZA 3BRUA 1X1PA 4E7HA 3M7GA 2PBXA 4KN4X 1W7PB 4E7IA 2QOPA 1ZREA 2MW8A 1R9TJ 3RPQA 1D8KA 3S32A 3SYTA 3A2KA 3HYIA 2DBBA 3TEDA 3KYDB 4XRSA 2M30A 4AUXA 4M9XA 3BQZA 1S6LA 4HDVA 1UHSA 2XIGA 3CF5F 4OU0A 3RJPA 5DAJA 2EPFA 5JR3A 3G1MA 3HTHA 3VTIA 2ECCA 3ANGA 2BY0A 2FJ1A 1JKOC 1MJ9A 3FXRA 1LDDA 1AKHA 1N78A 3E6BA 2PX9A 4W1UA 3IWZA 4AU7A 4IHVA 4YRVA 3EYIA 3ML6A 2DCEA 2GXGA 3ELKA 3DKYA 2XASA 3L09A 4UVCA 5GPAA 1JKRC 3JRGA 1OCCH 3LA3A 3BR0A 2XSDC 1WSUA 1XG1A 3S8PA 1F4KA 2HQ5A 3SEZA 3CCJI 1EA3A 5FKNA 2FBHA 3RI4A 2IA1A 5L3CA 5HLTA 1O4XA 1BA5A 2R7SA 3CMEI 2LKXA 1SVLA 5FLMJ 3BT9A 4GYIA 4HRIA 5KHDA 4CUGA 1FIPA 1X58A 1TWFJ 1H89C 3EPZA 1KGSA 3JTGA 1GT0C 1UI5A 3I59B 3K1PA 1HC8A 2XGDA 4WXCA 3QU3A 5E3MA 5IP7J 3WTVC 3HOXJ 3BJAA 1W36D 3HOZJ 1S9HA 1MH3A 1IF1A 2H8WA 3QPTA 4ENJA 1V5GA 1JE8A 4XORA 1GHCA 4P55A 2K02A 5DCMA 1QHGA 4HF1A 5TGTA 2HDCA 3CCQI 4XLFA 2E36A 1WI9A 2GXAA 3ZGKA 1IW7F 1QQIA 3OYNA 2VB6A 2Z3YA 3BTJA 4BXXJ 3W2VA 1S7AA 1MBEA 2QENA 5ILUA 5DD4A 5F1JA 3BG3A 4L5JA 2IGMA 1DU0A 2GIVA 2DMUA 2IPQX 2DFFA 2HVQA 2K85A 4I6ZA 2I5UA 2DA4A 4O6JA 1U5TB 5J1UA 1Z9CA 1MSFC 1FEXA 3GZIA 3E6DA 2PLYA 3RKQA 1XGOA 1AOYA 2MLGA 3JRAA 3CUQC 3LSJA 2HPIA 4NUBA 2NNYA 2R5ZA 2HYFA 1GXQA 2XVCA 2DG8A 3O8HA 3GBGA 2FE3A 3JSPA 2EV5A 2OU2A 1SMTA 3JREA 5D8LB 4ENKA 2ZY9A 3QPSA 1JUPA 2V1NA 2IS2A 1HBXG 5CPRB 2LY9A 1HDDC 1OFCX 2A2FX 3L2QA 3FK7A 1UAAA 2ELKA 3V7RA 3BCAA 3U1DA 3CJQB 4LLLA 3OV8A 4XLPF 3SWHA 1R5GA 4KYWA 2QWWA 4XKWA 2FD5A 4PSXA 2X6XA 2V9VA 2XUBA 1YI2I 2LG4A 3L1PA 1Z3YA 1RC9A 2R7OA 2Y0SA 3A0BC 1FTTA 3T5XA 4AIDA 1WHUA 3NI7A 1O3SA 2DYRH 3I9V2 3PNVA 3BJ6A 4UHTA 2CQXA 2DA6A 1T6SA 1X2NA 2IS6A 1XTAA 3DPTA 1YYVA 2XKOA 2E35A 2R0QC 2O7OA 5A2QZ 4IQ4A 4CYDA 1JT6A 2VC0A 2WA0A 1FYKA 3IUVA 4N0BA 3LQRA 1XDSA 2F4OB 1RNLA 2RDPA 4RA2A 2UXIA 4D5CA 2W85A 4DVYP 1BC8C 4U88A 1MMGA 4XN3A 4A5NA 1R58A 2M0MA 4PDKA 3G4SI 3KLOA 1R36A 4Z6YA 3RH2A 1ZN2A 1SD5A 1ETQA 4IRHA 1S8NA 2K9NA 4BGDA 1QZEA 4DW6A 2V1DA 1ZG3A 2X6WA 5CQEA 3V7CA 1U8BA 1U5TA 4UUSB 1XN7A 4KNYA 2CQKA 3GEUA 4IQJA 2JA8J 2NRAC 2E60A 5F27A 1ZHFA 2V4JC 1CF7B 4LK0F 3RPUD 4NDLA 3OYFA 1W36C 3HTAA 2CQQA 2CO5A 3HC7A 3BROA 1U8RA 2E7WA 3FXQA 3F8CA 3Q9SA 5HDGA 4LGWA 1JHHA 3TO9A 5K1YA 2O5RA 2K9QA 4XNFA 2NS8A 2COMA 5KVRA 2ID6A 5KNLA 3MEXA 3VSKA 2DDAA 1Y8QB 2P6TA 1POGA 1FP2A 2NVQJ 1D0XA 3ZMZA 1X4PA 1TQIA 4D0PA 3CMAI 1FBQA 3HKZA 3JRCA 1V5FA 4CH7A 4UB8C 3A4CA 3LOCA 3F23A 1WJDA 2HYGD 2KL4A 4U7BA 2L9VA 2Y0MA 4C2UA 4ZJZA 4CCOA 3D5LA 1WKMA 2VBZA 2X1EA 3CUQB 3BCGA 2G9WA 2MLKA 5D8KB 1K7AA 1Z67A 2KRFA 3I4NJ 2HWVA 2B1EA 3EGQA 3B02A 4V2FA 3MD2A 3FHNA 3Q3SA 2GIZA 1UHMA 2VJIA 3HBLA 3WTYC 3FK6A 1P4WA 2J5OA 5TISC 1UCRA 2XAGA 3I3LA 4GGGA 1ZRFA 2XROA 3BHQA 1J0RA 1S5LC 4E7SA 3CQZJ 4IF4A 4IX7A 4EM2A 1WH7A 5L3DA 3KNWA 3A02A 3BJOA 5BNGA 4M3BA 3DFGA 3H35A 2OUMA 3WHBA 3OOUA 1YRNB 4HNTA 5KAFC 3NWSA 4UXNA 5FGMA 1WRJA 3MMYB 3AQSA 1E0EA 5BPIA 4R1HA 2MA3A 3CC7I 5HDKA 2NX4A 2COBA 2O9LA 1W4MA 3VW1A 4Q48A 3OR2C 2R7DA 2VONA 4BEHA 1XMKA 2K40A 3E5XA 5E17F 3KP2A 2EFPA 5HOOA 2OJED 1XC5A 4JX5A 4A3IJ 1LQ1A 2H6CA 5ED4A 1BOAA 1MKMA 2XRLA 3MZ8A 4MO7A 3CCVI 4OAZA 1CF7A 4ASNA 3JSJA 4HYEA 1SC7A 3CWRA 4BY1J 2M3AA 2OPTA 4LG0A 4XICA 3S1RJ 1FTZA 4L9TA 2DMTA 3DBRB 2VKHA 2ECBA 4Y17A 3JRIA 2VN2A 1B1BA 4U7DA 4PFPA 3Q0UA 2FMLA 1OR7C 3OWTA 4HX8A 3FZVA 1YIJI 1Z0XA 3MKLA 4MHGA 4ETSA 4JP0A 4NC8A 2CUFA 3B81A 2L9SA 4MFDA 3EETA 3VYTB 3TO7A 5DUIA 1NK3P 2JVGA 3K4JA 5HAWA 3KZ9A 3W6KB 1FSEA 5D18A 5EEGA 3OYHA 4CO8A 2QA4I 4DYQA 2R7QA 2ZO4A 2J5PA 5EEHA 4CDGA 2FBIA 2Q2EB 3WGHA 3LNQA 2LBFB 2VPLA 3V4GA 2UXUA 3LFUA 3HG9A 2KP6A 3K70D 5K7HA 1W5TA 2B0LA 3WG9A 3KFWX 3KEQA 3L2CA 2K5CA 3UNGC 4X0GA 4Q5SF 2AO9A 3NARA 3R4KA 4DQ2A 3LQQA 2HGCA 1VQ6I 1Y0UA 2EA4A 2JT1A 3CO6C 1QA6A 2FRHA 2AQEA 4EMSA 1TC3C 4E7LA 3GW2A 2DT7B 5IYCJ 2WY7Q 1MBGA 4MXMA 3W2WA 2FA5A 1MZBA 1FLIA 2ME0A 4RB2C 2ZJRF 2Y75A 4HX7A 2E1MC 5HLGA 1V5EA 1Z6TA 2F5FA 2O6GE 2G7HA 1R7JA 4M9SA 3AAFA 3B6AA 2B63J 2QQAA 2VJ5A 4D7NA 1TW2A 3HRSA 2GFNA 4OD5A 1ETKA 4V19K 3BZCA 4HNVA 2V6CA 1IZ1A 4EATA 1WCMJ 2RNJA 5JLXA 1Z05A 2XGEA 2RV8A 4C30A 3RKWA 1O7FA 1TWHJ 2DODA 4WXHA 4OAYA 3WU1B 2GA1A 1B4AA 4CICA 5F64A 1MNDA 1EH7A 2KLOA 4BJTA 3FXUA 1D0YA 2EBIA 4LIVA 1WJBA 3V8LA 3OYDA 4G6DA 3OYCA 1UMQA 3M8FA 2FX0A 2DA3A 2EFNA 1ENHA 3LSIA 3K2AA 4G7HF 1K78B 2DMQA 3O2PE 4I09A 1SFUA 4C2MA 4PFOA 4BDYA 4XLEA 1QBJA 2IS4A 2O0YA 4O5VA 2EA2A 2F5DA 4AIKA 5BMZA 1GDTA 4PGHA 1H9GA 5IYDJ 2GAUA 3HPHA 3NRGA 3QWLA 4A3DJ 5E1ZB 2KRHA 1APLC 4BHCA 1NH3A 2DN0A 1SFEA 1ETOA 4D5FA 3RYPA 2GZWA 4DZJA 4IO9F 1ON2A 1EF4A 4UNOA 5CVVA 2Z1DA 2L5QA 5K5RA 3CCSI 3IUOA 2GXBA 2O3FA 2ZSIB 3C2BA 4OOIA 1MH4A 5M3MJ 1VQ8I 3Q5FA 2CYYA 3ONQA 2HU9A 5K5QA 1WPKA 3EUAA 3H36A 1IUYA 1TTYA 2E1OA 4HNUA 4U0YA 2HKXA 4DBRA 2HDWA 1ZGJA 4P5OA 4Q47A 1H9TA 5EZHA 3WE2A 1YW8A 2IAIA 1OCRH 4UUTA 4BDZA 3DV8A 4RAYA 4JKZA 4CZZA 1RI7A 1MGTA 3JAMZ 4DZPA 3QP6A 2LREA 1A36A 2V1UA 2CQNA 2VBXA 1WH5A 4F91B 1B6AA 2PMZN 2LLKA 2R7WA 4FE4A 3CCUI 3QBMA 3WU2C 5IOYA 4GFKA 1LFPA 1WWXA 1T8IA 2HVRA 4KWAA 3VEPA 1DGRM 4PJJA 3T6NA 5D5UB 1W5CC 2QBYB 2HI3A 4ZC3A 1E2XA 1PUEE 2STWA 2NVXJ 4DJAA 5JHUA 3HPGA 1TT0A 3K70C 1YFHA 2KJBA 1WZ2A 3S2DJ 2XGCA 3KKCA 3ZXSA 5J1RA 2HZDA 3GMEA 2XHKA 4KA4A 3QAHA 1HW2A 3F3XA 3ASOH 2RGVA 3KPHA 4JBAA 1EH6A 4RBOA 5IT3A 2WTEA 1W1WE 2KIMA 4XSZF 4ZDPA 1T2KA 2IJLA 1DU6A 1HQCA 2G7GA 1TQMA 4IJAA 3H0GJ 3NRVA 3HE0A 4RGXA 3OIOA 2E1MB 3DU5A 3QQAA 1MNEA 3PFIA 4UV9A 3HDDA 2NS7A 1MW7A 1E3PA 3LWFA 1USTA 3VP5A 1LVAA 5FGLA 1BOBA 2W53A 4AC0A 1G3WA 3Q0VA 2VPRA 5J8CA 3PO3J 3KYCB 5ICFA 4E7ZA 2CUEA 3S1NJ 2LD5A 1YJ9I 3GLLA 2IU5A 1XCVA 4PSWA 1BI3A 3CF2A 2R7RA 2LH9A 3H3VK 1DQUA 1WJEA 1VQ4I 3A1YA 2QSFX 4HA8A 2JUGA 3LA2A 5E20A 4GDFA 2FJI1 1GUUA 2XAQA 2E2HJ 2CFXA 1G59A 2I8DA 2DTRA 1IV6A 1XSVA 4L5EA 3QOPA 4LOCA 5AIQA 4BAYA 3IKTA 1XGNA 2ZFUA 2R7XA 3F6VA 2HNHA 3TDUC 4RMNA 1OR7A 2EWNA 2CJJA 4ANJA 4XIDA 4M6VA 1XCBA 3C3WA 4AWXB 2KT0A 1UELB 1HW5A 2DOEA 5HNFA 2IGKA 4JYKA 3GZ6A 1AKHB 4QWQA 2QQ8A 3IAS2 2MH9A 4KMUX 4OMZA 1HDPA 3DKXA 3BCBA 4UDSA 5HS7A 2LYCA 3I54A 3TQNA 2WWYA 1JUMA 2W25A 3WE3A 4L0ZB 3LSRA 3RPUA 2X48A 2Z9OA 2EFOA 2IVMA 2KJCA 2NOJB 2E5ZA 4A12A 4IL6C 3J81K 4BE2A 2KZVA 4WX9A 3HOUJ 3IP4B 1WI3A 4YFKF 3S2HJ 4OIOF 2DA7A 3HM5A 4EM0B 2DG7A 5IP9J 4HOBA 3SZPA 2W57A 3OR1C 3Q0WA 4RLFA 2E2IJ 1X1DA 3AG4H 4LB6B 3D0SA 3HSEA 3PJRA 3ESWB 3GTOJ 2Z5UA 1QZZA 4QPOA 4HSRA 2HOEA 2JK3A 1AWCA 4X6AJ 1TNTA 1QPIA 2Z99A 2E71A 2ZBKA 3F21A 3CJTB 5HNHA 4XMYA 4HAMA 1ONVA 2ESNA 2IXSA 4ABZA 4HF0A 1XB4A 2HR3A 4FCYA 1N25A 3GX4X 4QTRA 2JA7J 5E3OA 1FY7A 2GLOA 3PO2J 2BHYA 4RGUA 2G7LA 3K9TA 4W97A 3CD6I 3K4NA 2CV2A 5K58A 5DCMB 4PCQA 4KMFA 1BR2A 2JSCA 3FBIB 3DU6A 1B9NA 1W5SA 3MKYB 4EVIA 3CJDA 3BR2A 2EZHA 3VUQA 2WC2A 3J7AO 3ZQQA 3HXLA 2PEXA 1HF0A 1P6RA 3U1KA 1UZCA 5B1AH 2E19A 5EYRA 2F07A 2NOGA 1IXSB 2XB0X 1V54H 2D45A 1VQPI 3DEUA 1Z91A 2RVCA 2Y0SN 4CSWA 3M07A 1JJ8C 5GTIC 2BW3A 4EQQA 2M0CA 3R60A 2D1VA 3BJBA 5DUKA 2XF5A 3TOAA 3CDHA 4HLYA 4YIRX 2IS1A 2XPUA 1BC7C 3WTSC 2K4BA 2P6SA 3WTTC 2FXAA 2QWTA 2QLZA 1LFBA 2R5ZB 2A05A 2EJRA 3RSNA 2BZTA 1XSXA 3MQ0A 1OLTA 2F5EA 2DAOA 3CC4I 2ZMEC 3VW2A 2M5WA 2GOMA 1T56A 2JPBA 2OV7A 3VYSB 2R5YA 4IOAF 2DPDA 2VXZA 2HKUA 2KDZA 4CCNA 4RGSA 3REOA 2ZOYA 4QSHA 2P4WA 3LAJA 3ERED 3DPJA 1YLFA 4S05A 4BS9A 4LLNA 4CGZA 1FPQA 4A3JJ 2VOPA 3H9JA 3DP7A 4MK6A 1MMSA 4G6QA 3ON2A 4M71A 1TWCJ 2LMDA 4L5IA 3WODF 1SAXA 2PZ9A 5CXGA 4GCLA 2QF7A 1ETXA 4ZH4F 1IRZA 3H9GA 3I71A 4F55A 5CVRA 2W82A 1OCTC 4ACIA 2NYXA 2DOFA 3HRUA 3OY9A 1OJLA 3GTLJ 2KIFA 4H4KC 3DCFA 3VOKA 1GLNA 1XPXA 2GBYA 3OMYA 2FNAA 3QODA 4F7ZA 2P7VB 2A69F 3ZRGA 1S7OA 4QIWN 2FBQA 5CXIA 3L9FA 2VKDA 2OZUA 1ITYA 1I27A 1DP7P 1KU9A 3F6OA 4FISA 3N97A 4M6XA 2K9MA 4PXIA 1QO0D 3HKZN 3SJMA 1U9OA 3AL0C 4L62A 4A3LJ 4Y33A 1J7KA 2QYOA 2MD5A 1O57A 2ZB9A 3FXJA 1G3TA 5CJ9A 4PJNA 2BY3A 5JI6A 1WFXA 2L3DA 4NBQA 4F3QA 3O6BB 3J7YJ 1JTYA 2LK2A 4BJ6C 2VBWA 3K6GA 2BY2A 2ZJ2A 2HPMA 4HX4A 1WJCA 1K79A 2VT2A 2QGUA 3LL7A 2MC4A 1G4DA 4NC7A 4V2GA 1Z21A 1UB9A 3HB9A 4A6EA 2L7FP 4BXUA 3LA7A 3UR3C 1RESA 3GZNB 2H6BA 5L3EA 3H9QA 2QUFA 2Y69H 1A5JA 3LSMA 4RM3A 3FISA 5D4SA 3NEUA 1VTNC 4AF5A 1IN7A 1PVEA 1HKTA 3GFIA 3JTHA 1JKQC 4XRSG 1TL8A 1YJWI 1H0MA 3I64A 1F9NA 2C6YA 3E6MA 4ENNA 5J6XA 1J09A 3H5NA 4CHUA 4HV6A 2B7EA 1UFMA 5CQGA 1DP3A 3W2AA 1IN8A 1X1CA 1EJ9A 1A31A 4RS8A 4KDPA 1D3YA 1D1CA 3FBNB 2KPMA 5CVIA 2DA2A 3J80K 1DUXC 3J7AY 4I02A 1XGSA 1BJAA 4GYGA 3S15J 3ASNH 2ZMEB 4EM1A 5JVTA 1FOKA 4OIQF 4B3XA 2VODA 2XC7A 3GFLA 1RZ4A 3OSGA 3AG3H 4NN1A 3OYLA 2ZXWH 1I6XA 2A6HF 5B66C 3BQYA 3ZN1A 4B48A 4MEXF 5FB2A 1WGXA 3AG1H 2DT6A 1ZGAA 2OI8A 1ETYA 2R7ZJ 1LEBA 1K61A 1BL0A 1E3HA 2HZTA 2QZ8A 2VQCA 2R93J 3TGNA 1IN4A 4C9YA 4JL3A 1VFCA 4XKCA 4ENMA 5LBQA 4C2MJ 2A5YB 5FLXK 5M3FJ 1G8XA 4P9FA 4BEHB 5HSZA 2Z2SB 4HZFA 2P81A 1PJRA 2KRCA 2LSOA 1LEAA 3GWZA 3HIFA 3P9CA 1REPC 4MIMA 4JQFA 1RPWA 2RHAA 1B72B 3OYBA 1YJNI 3JRDA 1ZRDA 1SFXA 3DTEA 3CCMI 2M4KA 2AXTC 3E6CC 2ISYA 4CCJA 4LG0B 1R5ID 3M1EA 1P4AA 4RB1A 2CU7A 1GXPA 1FJLA 3DTIA 2EV0A 3V42A 2JN6A 3BNIA 5J1YA 1D1BA 3KEYA 2P5LC 4BNCA 1BW5A 5K5OA 1Y8RB 4B47A 1IC8A 1H8AC 3BZ6A 5CW8A 1SAUA 3KX2A 2P0WA 3L2RA 1Z6RA 1G6NA 1JUSA 2UV1A 3GVAA 4RDUA 2HKOA 4UVBA 1T39A 1FWZA 3T8TA 3DTKA 4Y15A 3OYKA 4DOZA 5TJJA 4N4OB 1YX5A 3MNLA 3RKXA 1GV2A 2FU4A 5AQCA 3QYBA 3HOSA 2ZJPF 4BE0A 1XGMA 2ZMEA 4QPQA 2Y2ZA 2PJRB 3PUBA 2PI0A 2OAZA 2P5KA 2GUHA 1LFUP 1ZH5A 4MQ9F 1WVRA 4PJLA 1RETA 2Y30A 3FXOA 3ERMA 3HEFA 2W00A 3S2WA 2MFZA 3IWFA 2BVLA 3ZQ7A 6PAXA 4M9ZA 2VXDA 3CCYA 1LE8A 5DYMA 4GCVA 5FKLA 1X3WB 4OINF 2EH3A 1AU7A 2QCOA 3DLAA 3K4MA 3RCOA 1IGNA 1ERDA 2L9NA 3T1BA 2DYSH 1E3OC 1QU3A 2ZCNA 4NQWA 2VOOA 1R1UA 3ON4A 3JRFA 1JTXA 1YW7A 1AHDP 1B72A 2QSHX 3P7NA 2X6OA 4HBLA 2A5WA 2MD0A 5JLWA 3KP3A 4BYYA 2CWEA 5E18F 2K27A 1VQMI 3OS2A 4KJZA 1IUFA 1K83J 2JRTA 4WCGA 2GOXB 3I4PA 2VIXA 2E2JJ 3LMMA 3GF2A 2Z16A 4LMYA 4XSXF 1YOVB 3PASA 2L4MA 3G7RA 3CDIA 4XK4A 3TMOA 2PG4A 5EEAA 1KZHA 3ZQLA 4AD9A 4AVZA 2XV4S 4CZCA 4UY8I 3G56A 4IHTA 4FHTA 1QZYA 5FJ8J 2KHMA 2LY1A 2PFVA 9ANTA 4B43A 1J75A 1MNMC 2ZSHB 2BXYA 3E5UA 4HV5A 4KIFA 4BY7J 1B8IA 2LOOA 4OIPF 4EJVA 2DW4A 3ZMVA 4U9NA 5FMPA 1S3JA 1I6HJ 3DBHB 5CVJA 2P5VA 3NNRA 2XKPA 4MFEA 1FMWA 1I5ZA 3AKZA 3G2BA 3K10A 5F0CA 1TBXA 3SQNA 1HKSA 1Y56A 2EB7A 2X4HA 3GCMA 4FQGA 4XBFA 2PJRA 2VJ4A 4UUVA 2IRFG 4HG2A 1HLVA 4B1RA 1MIJA 3K1NA 1D8JA 1QRYA 3G6EI 5DM6F 1IG7A 3K0LA 2ZJQF 5LEKA 5DS9A 4CYCB 2L7MP 2EIMH 1QPMA 3SEQA 5ILVA 1KU7A 3S17J 4I7HA 2O03A 2PFBA 5HS8A 1O7LA 3HOTA 4I0AA 1ZAOA 4C3JJ 4L9JA 1G2HA 4YFXF 3P9TA 3FX3A 2PMUA 3E3VA 2NVTJ 3IRRA 3BR5A 3FF5A 4A3KJ 3HHGA 1ZG1A 3CDLA 4G9YA 3G73A 4KN7X 4EGYA 3NQOA 5GAGJ 4A3GJ 2HQNA 2O8KA 5LGTA 1W7PD 3W6JB 3C18A 2WB1A 3JW4A 4N4NB 5D4RA 1BR4A 3I53A 3OS0A 4BACA 2RQPA 1FT9A 3S16J 3H5RA 3K7AJ 2IT0A 2VLAA 3GTKJ 3FDYA 1KQ0A 1QNTA 1LJ9A 4DYCA 4OD4A 5J4VA 1HKQA 4Y52J 3S5RA 2YUSA 5LHIA 2RKHA 3BR1A 5DTDA 3KYLA 2DOAA 2JVHA 3ABMH 3LSTA 1S29A 5J8FA 2R7UA 3HTUA 5JHFA 3NPIA 2KIQA 2JWTA 4A3EJ 1JT0A 3RQ4A 3ANPA 1MMNA 2YR2A 2ZCWA 4BXFA 1O3TA 2DMPA 1ETWA 3ZOBA 5L3BA 1WJFA 2CW8A 4YEJA 1R5HA 3KZYA 3IL2A 3T0YA 1OCPA 1RUOA 4D1QA 4S04A 3ROUA 3RYRA 4ZDLA 1Y1VJ 4BJ5C 2B9SA 5H6QA 1MMAA 2VI6A 1HA8A 3H5AA 4L9VA 3H3ZA 3VPRA 1LDKB 4L18B 2F4IA 2V57A 3FKJA 1R23A 4M3DA 2B3WA 2VL8A 2IEKA 1PUFA 3JRBA 5ICGA 2F48A 4BHPA 1STZA 4JK1X 3SZTA 2UXOA 2AQFA 2LVSA 3TO6A 3ZQGA 1I1SA 1OKRA 4CYCA 2E5NA 5FFZA 2VKEA 2CS3A 5EZGA 1W0UA 2ZOZA 1D5VA 2A07F 1XDUA 1YX3A 5J47A 4HW0A 5L3FA 3TDZC 3F1BA 1IDZA 1L0OC 2ICWG 3DWLE 3RD3A 3GFJA 1IN6A 4HQEA 2I10A 1WJAA 1Z7LA 2PN6A 5KAIC 1OCOH 3O8GA 4NHJA 5FROA 5KCMA 3VODA 2P8TA 1FYLA 3DPLC 1IAWA 3PNTA 2DPUA 2WGBA 1RKTA 2LRDA 3JSOA 1JI8A 3G1OA 2IGOA 1SVMA 2DFIA 1T33A 5C4XJ 3BZKA 3WGIA 2F6CA 3W6VA 1VQKI 1P4XA 5FKMA 2CV0A 1UG2A 2L9RA 3M8EA 5LGNA 1OMIA 3V6GA 2EZKA 4RGRA 4BBSJ 4XL9A 5F08A 5JVGF 5IT9K 4HDUA 2XRNA 2DQRA 4KIGA 5HVQC 4P9UA 1VQ7I 2WV0A 1ZELA 4JOMA 2IA2A 2WAQA 3DPUA 3EUKL 3LSKA 3ZQCA 1CGPA 2QQ9A 2QKOA 2RQQA 5F04A 4YFNF 5KK1A 3GUDA 1IN5A 2BGCA 2LF7A 3ZMSA 2DMNA 2H94A 4ZZDA 3BWGA 3BG9A 1ULYA 3CCLI 1ZARA 2R7FA 3GZ5A 3IH3A 2ZFWA 1X1BA 4GFBA 1I3AA 5LGUA 5FRMA 2RAEA 4MTEA 1FIAA 3RZDJ 1HCRA 4M3EA 4HF2A 1Y0NA 5F1RA 4ZYDA 2DU9A 4I0BA 1D5YA 1LNWA 3E0JB 2H1KA 5M5YJ 1XMAA 3DEWA 4OMYA 3ABKH 3KETA 5E3LA 4E4HA 5HLHA 3DQVC 4PZJA 5J3LA 2W4SA 3FHZA 4UB6C 2Z33A 3OL4A 1X3UA 2BW3B 4ESJA 3VVZA 2O7TA 3ZQFA 4IHWA 1FP1D 4GO1A 3WU0A 2ADUA 3L2WA 2MH2A 3TOBA 3IHUA 3MZHA 3M1CA 3ZN0A 3RZOJ 4M74A 2X6YA 3N05A 2H09A 2KZGA 3U2RA 3WG7H 3COAC 2N8GA 1FMVA 3COLA 4HQMA 2W48A 1UHWA 1VI0A 2XAHA 1VQ5I 4C3HJ 2UXHA 3C7JA 3RKYA 5F0FA 4AYBA 4XLAA 2NNNA 2K86A 3HHHA 1Z3XA 2ETHA 3O60A 2K4JA 5CVUA 2R5YB 1D1AA 3L2VA 4U87A 1DPUA 3S3NA 1Z77A 5LHGA 1R4NB 4DGWB 1XMXA 1FBUA 2R7VA 4FX4A 2O8XA 2HOTA 3KE2A 1OISA 3AG2H 3K4LA 1MD0A 1ZR2A 3FWEA 1BM9A 1BJZA 4BKXA 5LHHA 3NS4A 1YS6A 2CG4A 1OYIA 3VOEA 1OCZH 5B1BH 1OYYA 2LP0A 5B5EC 1LDJA 4FT8A 4NC6A 2OQRA 3WTZA 2BOLA 4FASD 2DT5A 1FBSA 1LUJB 1V3FA 2Q8KA 3IH2A 1BIAA 3IAM2 1MDMA 1FX7A 3IRQA 3AFHA 4XN0A 4BQQA 2M7AA 2XF6A 3TKYA 3VSLA 2AS5F 5AIPA 3GTGJ 1VF9A 3ECHA 5HS9A 3VB2A 1IV8A 2BEOA 4S0HB 2QKLB 5BS6A 2EINH 2JMWA 1J9IA 4G7OF 3ECOA 1MMDA 5E79C 3ZR8X 2MBFA 3OYEA 4EJWA 3IV5A 1XX5A 3DKWA 3OL3A 4NELA 2XPWA 5C3EJ 1GVJA 2QQBA 2FQ4A 4CGRA 2JTVA 1F36A 3HUGB 1SFOJ 3SDGA 3FXKA 3TBIA 3ZMDA 1SMYF 2D1HA 3VDXA 1PP7U 1X4OA 2R3SA 4U0WA 4A69C 4KFCA 1ZTRA 4ZTJA 5DM7F 1QVTA 2H1LA 5LFAA 2UXXA 5FFXA 5DCFA 3SDBA 2RREA 1T38A 4R8HA 1FZPB 2EZIA 2KFDA 2EZLA 4KIBA 5EGOB 4II3A 5FD5A 1TWGJ 1RR8C 1UI6A 1TP4A 1TNSA 3G71I 4LB5A 1JXSA 2VQHA 4PK4A 4F52A 1M1EB 3HGGA 1GVDA 3CJNA 5B3SH 2IBDA 4XONA 1SD7A 2M4GA 3E1SA 2DXIA 1R6RA 4L0YB 2EFQA 4AVPA 3FMSA 2MC3A 5EFYA 4XLHA 4RLQA 3X2QH 2FEZA 4A0XA 3CC2I 1BI0A 3GTJJ 1NTCA 3HTSB 3LJLA 2JRMA 3V78A 3I55I 5FHPA 2BXZA 4B8XA 2HYTA 2L7ZA 4DYRA 3EUHC 5BQTA 4P1WA 2JZYA 3M9AA 3PL8A 5A2QK 1KYWA 4I2OA 5AONA 3OS1A 2BVMA 3S3OA 1G3SA 3KP6A 5GAHJ 3J81Z 1ACIA 3HTIA 1EH8A 1X3ZB 2EIKH 4DBQA 5DD8A 5L3GA 1DDNA 1VQ9I 1V4RA 3H92A 2M8EA 3GTQJ 3F9KA 5HODA 4DIQA 1QGPA 1P92A 4IRIA 2NP3A 2OC6A 1HW1A 3ZCOA 2DLLA 2KIUA 4EEFG 5IOZA 5IYBJ 3R6SA 2ZNYA 4I76A 3NXCA 5HLIA 2FF4A 1N77A 1KU3A 2F2EA 4B44A 2Q24A 4LK1F 2YVEA 3S1MJ 3PIOF 4KITB 3HUGA 3L00A 3CJRB 4JNNA 5LRSA 2KQRA 4IHYA 1ZKGA 2ZKZA 3CTAA 4EJOA 5D5XB 2ELHA 2V6EA 5D6EA 4XRFA 4KISA 3OYAA 3E7QA 1ZRCA 3LSGA 1YIOA 2GA2A 2VQLA 5GPCA 4CCLA 3H1CA 1XS9A 1W7PA 1JGGA 2FNPA 3E7LA 1ZK8A 4A6DA 3D5RC 4YG2F 1JKPC 1K6OA 4GCKA 5EGOA 1I3QJ 4A3FJ 5CYVA 1Q1HA 2W84A 3FMQA 3SHFA 4D9JA 2M8GX 2LTPA 2K3PA 4M6YA 4ICHA 3F8NA 3HRMA 1BI2A 1FOWA 1FNNA 2F4MB 4BHBA 2LY2A 2DA5A 1MBFA 1ODDA 1CQTA 3ULQB 1YHQI 3EYYA 3OYJA 2YU3A 3DEEA 4BUPA 5CLSA 4CA0A 3S93A 2HVSA 4LLGF 4GFLA 1ON1A 5M5WJ 1T0FA 2K9SA 2YX7A 4M72A 3UKGA 3K4KA 3PPBA 3KP5A 4AC6A 2FUG2 2CQ7A 3QKXA 5DDGA 4A3MJ 5FLVA 2JPCA 4XRMA 2G7SA 1J5YA 2TDXA 2VBYA 1BBYA 2MG4A 4J00A 2LDUA 4XR6A 2YPRA 2FSWA 4LITA 4HLXA 2XB5A 4A5MA 4KUMA 4KICA 3GEZA 4J01A 2KISA 1GV5A 2EQRA 4AM3A 3A0HC 2ELJA 4ZYHA 2M45A 4WWCA 4RAGA 2TRTA 2R92J 1LE8B 2XAFA 1T98A 1FSHA 5LD2C 2K3FA 3BR3A 3I59A 3Q9VA 2HQRA 3BDDA 3FXMA 2X85A 1YQAA 2W7NA 3E5QA 2YU9J 1Z7UA 3KZIC 1G3YA 2IP2A 3A03A 3MKWB 4BU2A 4NQWB 2E1NA 4G94A 1VZ0A 2CMPA 2HDDA 1USSA 2YS9A 3DLLF 3NAUA 3V8JA 2HXIA 3TP0A 4IXAA 5EF6A 4MEYF 2BHZA 1HSJA 5DEQA 2ESHA 2X0LA 4ZZLA 3OSFA 1ZG5A 3QPHA 5FKKA 2M87A 1C0WA 3VWBA 2XGXA 3A01B 4BQOA 5ICEA 2A61A 3CESA 2HXOA 1F43A 1R4MB 3CMMA 3QPLA 2OTLI 3HGYA 2P7CB 2QSGX 2UUZA 4RAFA 1UG0A 1NG7A 5LRRA 4RM2A 3CLQA 5CKTA 3AL0B 3C2GA 1VNDA 2JQ7A 3BC8A 2M1BA 4KT5C 1V55H 3VOXA 1RR7A 2NP5A 5C44J 2X9DA 4ZYAA 1YG2A 1MBKA 2X1DA 2RC4A 3PSIA 4PJMA 2HYJA 3I56I 1BW6A 3LAPA 4FX0A 1UJ8A 1VQLI 3GLXA 1B8IB 2MGQA 2UZKA 1KU2A 3KP7A 2WB1N 1YTYA 3BPXA 1IO2A 2M34A 3I0TA 4LG3A 5K7FA 2ZCXA 3VW0A 2MSYA 2HQAA 1HXDA 5D6FA 3U9GA 4IKFA 2L54A 4J19A 3F22A 4GCTA 3KZZA 2YSRA 2LF8A 4RB0A 3PFYA 3TW6A 2DQLA 4HSTA 3VIBA 1R22A 1RIOH 2K7LA 2HOSA 4LD5A 4NB5A 4E6KG 5IY5H 1PP8F 1P7JA 3HZJA 4EJTA 4IOCF 1DGWY 1F1ZA 1QHHD 3GYHX 2ZXIA 3PQJA 3HIMA 1R1VA 3HOYJ 3CP8A 3R0AA 3I4MJ 2FMYA 3OYMA 2DFEA 4ESBA 5HBUA 3EQLF 1ORKA 2UXNA 5EG0B 1I39A 2NVYJ 2NS0A 3T8RA 2JSPA 1YS7A 2PQ8A 3J80Z 1JJ6C 2FBKA 3JRHA 1K6YA 1R00A 3LSPA 2NXNB 4A2UA 1JHFA 4B09A 2OA4A 1NK2P 3EUHA 2F5VA 1I1GA 3EDPA 4MLOA 3HOWJ 3F8FA 4Y3OA 3ZMUA 4G6TB 3V8KA 1JGSA 3D5SC 4IPAA 2OERA 4LFUA 2H8RA 2M7BA 4C3IJ 4A0ZA 3EUPA 4EV0A 4BBRJ 1A04A 1KQ9A 1LVKA 1IDYA 2EK5A 3A01A 2IW5A 1B9MA 2ZNZA 4BH9A 4FTHA 3QU6A 1A6IA 3GFMA 3DF8A 3KEOA 2IA0A 2LKPA 2VJJA 3BG6A 2NVUB 2UXPA 4Z2YA 4BQNA 5J40A 3HOVJ 1TLHB 2EV6A 4MGRA 4TV7A 1RKWA 1L3LA 4LJZF 1ZQ3P 3K69A 2RNGA 5FLXZ 3TL4X 2FQ3A 2L7KA 3G1LA 4UUSA 1OPCA 4N9HA 4Q4ZF 3F8MA 3S14J 3WTXC 2OBPA 2L01A 2PMHA 5H2FC 1S72I 4OIRF 4F92B 1H88C 3CZ6A 1ZYRF 3LSHA 2VE8A 1IRGA 3RQIA 1BI1A 2HFHA 3HSRA 5M5XJ 5C4JJ 2PJPA 4E70A 5D19A 2GWRA 2FOKA 2L2OA 4GXOA 1ETVA 3C2HA 5J4YA 4A93J 3P9KA 3IC7A 4YIIA 1WJ5A 1U6GA 2V9PA 2O61A 2LNBA 1FOYA 3KLNA 3U21A 5EDNA 4AIHA 2WAQN 3JAMK 3MCZA 1W0TA 1PUFB 3P5JA 5K7ZA 5D1RA 4WXDA 1AA7A 5DV5A 1R71A 3F8BA 3VFZA 1KA8A 3H3UA 4WIBA 3QRFF 3FKIJ 3ABLH 4XLCA 4XOTA 4IVNA 1ZLJA 4MTDA 3CUQA 4C2TA 1XSDA 3TP3A 3JCUC 5EG0A 1EKEA 2L02A 4K2EA 3E97A 3PUFA 3K8PC 2WADA 4ESFA 4HPQA 4XQFA 4CXFA 2L4AA 4GRIA 3WTWC 5TRDA 3OIQA 2MABA 3KKDA 1U9NA 3BPVA 4MNUA 1Q1VA 4EJUA 2OCCH 1P2FA 2OD5A 1IRXA 3I5UA 5BPDA 2CGPA 2AHQA 3WTUC 2W1OA 4IHXA 2X1CA 2V9KA 2DJNA 3NWTA 2AXLA 2BE5F 2OTJI 2DTZA 2BYVE 3FMRA 3S1QJ 2CUZA 1YRNA 2HTSA 2HS5A 3CP2A 4CCMA 1A35A 2JA5J 1TQPA 2XDVA 3BY6A 2A68F 1X1AA 1PYVA 3K1MA 4RAZA 3FIWA 4XKVA 3SFIA 4E7JA 4O3MA 2EILH 3KIOA 2GENA 5HDNA 4KT6A 3CCEI 2STTA 4Y4RA 1SD4A 1A6QA 1D0ZA 3VYUB 1FOXA 1FYMA 2Y9ZA 1U78A 1MJAA 1QVUA 2QEXI 3SZGA 1Y39A 4AYBN 2XF7A 3GTMJ 3MWMA 3K4CA 4D7MA 1VQOI 3N4MA 2XSJC 3PSFA 3L2UA 1RUNA 3M8JA 4CCKA 2HTJA 2JJ7A 4Y7NJ 3BG7A 4A0YA 3LWJA 3VVXA 4F93B 1IXRC 2VE9A 4QLCU 2LFBA 2JUCA 3PM1A 3G3ZA 1E17A 2LKSA 4B4CA 2BBYA 1NG6A 4OWRB 3P9IA 1SD6A 4ZYGA 4FETA 1OQYA 5H20A 3O3KA 2WY8Q 2A6TA 4G8XA 4IRVA 1BN5A 2ME6A 4G12A
chains in the Genus database with same CATH topology
3HB9A 3BHQA 2L7FP 3CQZJ 1RESA 1WH7A 4M3FA 3KNWA 3A02A 5BNGA 3IH2A 4M3BA 3WHBA 3OOUA 1YRNB 1A5JA 3FISA 4AF5A 3AQSA 1MBHA 3ZQIA 1JKQC 4IEJA 2COBA 4XRSG 2LR8A 2O9LA 2NX4A 3VW1A 3GTGJ 1VF9A 2K40A 4S0HB 2JMWA 1SANA 1XC5A 4JX5A 2VKVA 4A3IJ 1ZGWA 3GTPJ 2XRLA 4MO7A 5F0HA 3IV5A 2JA6J 4NELA 1IJWC 2XPWA 5C3EJ 2DA2A 3JSJA 3CWRA 2FQ4A 4BY1J 2OPTA 4CGRA 1F36A 4JX4A 1SFOJ 3SDGA 3CMYA 4XICA 3S1RJ 3S15J 4X1EA 1FTZA 3M4OJ 2G0EA 2DMTA 2ECBA 2RASA 3JRIA 3OSGA 4NN1A 3Q0UA 3VVYA 4A69C 3CRJA 1ZTRA 3BQYA 1QVTA 1Z0XA 2WV1A 1WGXA 3MKLA 3LHQA 4JP0A 2OI8A 1ETYA 2CUFA 2R7ZJ 3HTJA 3B81A 1X2MA 4MFDA 1K61A 2EZIA 1BL0A 1NK3P 2EZLA 5EGOB 2R93J 5IP6A 5HAWA 3KZ9A 5D18A 2D6YA 4DYQA 1TWGJ 1UI6A 4JL3A 1VFCA 3MN2A 3LNQA 4C2MJ 3WHCA 3HGGA 1GVDA 2UXUA 2IBDA 5K7HA 5M3FJ 2CRGA 3BTCA 5HSZA 2TCTA 2P81A 2AO9A 3NARA 4MIMA 1RPWA 2Y9YA 1B72B 2M2EA 3M3YJ 5EFYA 3JRDA 4A3BJ 2REKA 4ME9A 3GTJJ 1NTCA 1TC3C 3LJLA 3V78A 2Y31A 5IYCJ 5FHPA 3D1NI 2HYTA 1MBGA 2L7ZA 4DYRA 2VUMJ 4MXMA 2CU7A 1FJLA 2YVHA 2QTQA 2ME0A 2JN6A 1S7EA 3BNIA 5J1YA 2GM4A 1MBJA 3HTIA 1BW5A 4YZEA 3B6AA 2B63J 4D7NA 2OF7A 1IC8A 1H8AC 3GTQJ 2GFNA 1SGMA 1ETKA 5HODA 5CW8A 5GP9A 1P7IA 2NP3A 4HNVA 1MSEC 3TW7A 1WCMJ 1JUSA 3IH4A 5FKOA 5JLXA 4EEFG 5IOZA 5IYBJ 2XGEA 4RDUA 3F0CA 4I76A 3BG5A 1TWHJ 2WUIA 5H9TA 3NXCA 3B6CA 2EBIA 4B3AA 2Q24A 2YVEA 2ZCMA 3S1MJ 1UMQA 3MNLA 1GV2A 2FX0A 2DA3A 4HKUA 5IPAA 5AQCA 4JNNA 1ENHA 3K2AA 3ZQHA 2DMQA 4IHYA 1ZKGA 4FE7A 1I50J 2Y2ZA 3BTIA 2GUHA 1LFUP 3E7QA 2XPVA 3LSGA 4M3GA 1RETA 2Y30A 1GDTA 5IYDJ 5C4YA 3NRGA 3HEFA 5GPCA 1XS9A 4A3DJ 1JGGA 1APLC 3E7LA 1ZK8A 2DN0A 1ETOA 2QIBA 4D5FA 1JKPC 4DZJA 1TWAJ 4GCKA 5EGOA 1I3QJ 4A3FJ 1EF4A 3C07A 2XDNA 3CCYA 1LE8A 5FKLA 1ZR4A 2EH3A 1AU7A 2M8GX 2QCOA 3C2BA 2LTPA 1MH4A 5M3MJ 1IGNA 2D5VA 4ICHA 2DA1A 1HOMA 1WPKA 3AQTA 3BTLA 2ZCNA 2DA5A 1E3OC 2G3BA 2E1OA 1MBFA 1CQTA 3ON4A 3JRFA 1JTXA 3BR6A 5EZHA 1AHDP 2IAIA 1B72A 4GFLA 5M5WJ 2X6OA 5E3NA 2K9SA 4UUTA 5JLWA 3UKGA 4A3CJ 3PPBA 4AC6A 4JKZA 3QKXA 1IUFA 1K83J 4DZPA 2E2JJ 4A3MJ 1WH5A 5FLVA 2PMZN 2LLKA 4XRMA 2G7SA 4FE4A 3FRQA 2L0KA 3QBMA 5IOYA 4GFKA 2MG4A 3MVPA 3PASA 2HOAA 3JR9A 3G7RA 4XK4A 4KWAA 3T6NA 2HI3A 2ID3A 5EEAA 3ZQLA 2XB5A 4JX6A 2M9HA 3G56A 1Y1WJ 2NVXJ 3BRUA 5FJ8J 2PBXA 1GV5A 2EQRA 2QOPA 2MW8A 1R9TJ 9ANTA 2TRTA 3S2DJ 2XGCA 1MNMC 1LE8B 2R92J 3KKCA 3TEDA 4XRSA 4BY7J 5J1RA 3BR3A 1B8IA 2W53A 4AUXA 3BQZA 1UHSA 2YU9J 5FMPA 3A03A 4RBOA 1I6HJ 5DAJA 3G1MA 3HTHA 3NNRA 2ECCA 2HDDA 4MFEA 1DU6A 2YS9A 2G7GA 3NAUA 3ANGA 3H0GJ 2FJ1A 2HXIA 3TP0A 5EF6A 1JKOC 5F0CA 3HE0A 3OIOA 3QQAA 1AKHA 2JA7J 3HDDA 2NS7A 4W1UA 3OSFA 4IHVA 3VP5A 5FKKA 5FGLA 3A01B 1HLVA 4B1RA 4AC0A 3Q0VA 2HXOA 1QRYA 2VPRA 1IG7A 3PO3J 1F43A 3QPLA 2CUEA 5DS9A 4CYCB 2LD5A 3HGYA 3S1NJ 2L7MP 2IU5A 5GPAA 1JKRC 3JRGA 3S17J 2XSDC 3BR0A 3H3VK 1XG1A 4C3JJ 2HQ5A 1G2HA 5FKNA 1GUUA 2E2HJ 3P9TA 1VNDA 1BA5A 1O4XA 3VOXA 2NVTJ 3BR5A 1RR7A 4A3KJ 2NP5A 3CDLA 2LKXA 5C44J 1IV6A 4L5EA 2X9DA 4LOCA 5FLMJ 1MBKA 3BT9A 1FIPA 1X58A 2HYJA 4A3GJ 2O8KA 1BW6A 1TWFJ 1H89C 1GT0C 1B8IB 2MGQA 1UI5A 2WB1N 2M34A 5K7FA 2XGDA 2ZCXA 3S16J 3K7AJ 3GTKJ 2CJJA 3VW0A 2MSYA 5E3MA 4XIDA 5IP7J 3HOXJ 4DYCA 4M6VA 3HOZJ 4J19A 4Y52J 3S5RA 2YUSA 4GCTA 3BR1A 5DTDA 2KT0A 3TW6A 3VIBA 1MH3A 4JYKA 2HOSA 1AKHB 1P7JA 3NPIA 2JWTA 4A3EJ 1JT0A 1HDPA 3ANPA 4UDSA 1JUMA 2DMPA 1ETWA 3HIMA 3ZOBA 3HOYJ 3LSRA 3I4MJ 2X48A 3BTJA 4BXXJ 1MBEA 3HOUJ 5F1JA 3BG3A 5HBUA 1DU0A 3S2HJ 1WI3A 2DMUA 1ORKA 5EG0B 2DA7A 2NVYJ 3HM5A 1OCPA 4I6ZA 2DG7A 2DA4A 1MSFC 5J1UA 1FEXA 1JJ6C 5IP9J 3JRHA 3Q0WA 1Y1VJ 3LSPA 2E2IJ 3GZIA 1NK2P 3RKQA 2VI6A 4MLOA 3HOWJ 3GTOJ 3JRAA 3VPRA 3LSJA 2V57A 2JK3A 4X6AJ 1QPIA 4M3DA 2R5ZA 2OERA 2DG8A 2IEKA 1PUFA 2H8RA 3O8HA 4C3IJ 3JRBA 3GBGA 3EUPA 4BBRJ 1IDYA 3A01A 2UXOA 4ABZA 3JREA 2LVSA 3ZQGA 4FCYA 3QPSA 4QTRA 4CYCA 1JUPA 5E3OA 1A6IA 2VKEA 5EZGA 4FTHA 1W0UA 3PO2J 2GLOA 2ZOZA 2G7LA 2LY9A 2UXPA 3HOVJ 4W97A 1HDDC 5K58A 1OFCX 3F1BA 3FK7A 1RKWA 2ELKA 1IDZA 1ZQ3P 3RD3A 3CJDA 3BR2A 3G1LA 4UUSA 2EZHA 3VUQA 2I10A 1HF0A 3S14J 3O8GA 2FD5A 2E19A 5EYRA 2F07A 1RKTA 2NOGA 2XB0X 2WGBA 3G1OA 3L1PA 1H88C 1T33A 5C4XJ 1FTTA 2Y0SN 3W6VA 1JJ8C 3RQIA 3NI7A 5FKMA 5M5XJ 2M0CA 5C4JJ 3BJBA 2CQXA 1UG2A 2DA6A 2L9RA 1X2NA 5D19A 3V6GA 2EZKA 1ETVA 4BBSJ 5F08A 2R0QC 4A93J 2XPUA 2O7OA 1JT6A 3IUVA 2QWTA 1LFBA 2R5ZB 5EDNA 2UXIA 2WAQN 4D5CA 3ZQCA 1W0TA 1PUFB 5K7ZA 5D1RA 2QKOA 5F04A 3VW2A 1T56A 2DMNA 3FKIJ 2R5YA 3RH2A 2HKUA 1ETQA 3TP3A 2KDZA 2K9NA 3BG9A 4DW6A 5EG0A 2ZOYA 3IH3A 4QSHA 1U8BA 4GFBA 3DPJA 2RAEA 3RZDJ 1FIAA 1HCRA 4A3JJ 4UUSB 4M3EA 1D5YA 3GEUA 3KKDA 2JA8J 1U9NA 4MK6A 1Q1VA 5F27A 2H1KA 3ON2A 1TWCJ 5M5YJ 5CXGA 3DEWA 2PZ9A 4GCLA 2AHQA 4NDLA 2QF7A 1ETXA 5E3LA 2CQQA 4IHXA 1IRZA 3HTAA 5J3LA 2DJNA 1OCTC 4ACIA 1OJLA 3GTLJ 3VOKA 2DTZA 3DCFA 2O7TA 3VVZA 3S1QJ 1YRNA 3ZQFA 2K9QA 4IHWA 2NS8A 2JA5J 2ID6A 2GBYA 2GENA 3FIWA 2RHAA 3SFIA 3RZOJ 1POGA 4QIWN 2NVQJ 2FBQA 5CXIA 2N8GA 1ITYA 3COLA 2Y9ZA 1U78A 2W48A 1QVUA 1VI0A 4FISA 4C3HJ 2UXHA 4PXIA 3HKZN 5F0FA 4AYBN 3JRCA 3SJMA 1U9OA 3GTMJ 3LOCA 4D7MA 4L62A 4A3LJ 3O60A 2R5YB 2JJ7A 4Y7NJ 2ZB9A 3LWJA 3VVXA 1Z77A 3BCGA 2LFBA 2HOTA 3PM1A 3I4NJ 3EGQA 1ZR2A 1JTYA 2LK2A 4B4CA 4V2FA 3Q3SA 1BJZA 4BKXA 3HBLA 3FK6A 2LP0A 4V2GA 2ME6A 4G12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HB9 A;  3BHQ A;  2L7F P;  3CQZ J;  1RES A;  1WH7 A;  4M3F A;  3KNW A;  3A02 A;  5BNG A;  3IH2 A;  4M3B A;  3WHB A;  3OOU A;  1YRN B;  1A5J A;  3FIS A;  4AF5 A;  3AQS A;  1MBH A;  3ZQI A;  1JKQ C;  4IEJ A;  2COB A;  4XRS G;  2LR8 A;  2O9L A;  2NX4 A;  3VW1 A;  3GTG J;  1VF9 A;  2K40 A;  4S0H B;  2JMW A;  1SAN A;  1XC5 A;  4JX5 A;  2VKV A;  4A3I J;  1ZGW A;  3GTP J;  2XRL A;  4MO7 A;  5F0H A;  3IV5 A;  2JA6 J;  4NEL A;  1IJW C;  2XPW A;  5C3E J;  2DA2 A;  3JSJ A;  3CWR A;  2FQ4 A;  4BY1 J;  2OPT A;  4CGR A;  1F36 A;  4JX4 A;  1SFO J;  3SDG A;  3CMY A;  4XIC A;  3S1R J;  3S15 J;  4X1E A;  1FTZ A;  3M4O J;  2G0E A;  2DMT A;  2ECB A;  2RAS A;  3JRI A;  3OSG A;  4NN1 A;  3Q0U A;  3VVY A;  4A69 C;  3CRJ A;  1ZTR A;  3BQY A;  1QVT A;  1Z0X A;  2WV1 A;  1WGX A;  3MKL A;  3LHQ A;  4JP0 A;  2OI8 A;  1ETY A;  2CUF A;  2R7Z J;  3HTJ A;  3B81 A;  1X2M A;  4MFD A;  1K61 A;  2EZI A;  1BL0 A;  1NK3 P;  2EZL A;  5EGO B;  2R93 J;  5IP6 A;  5HAW A;  3KZ9 A;  5D18 A;  2D6Y A;  4DYQ A;  1TWG J;  1UI6 A;  4JL3 A;  1VFC A;  3MN2 A;  3LNQ A;  4C2M J;  3WHC A;  3HGG A;  1GVD A;  2UXU A;  2IBD A;  5K7H A;  5M3F J;  2CRG A;  3BTC A;  5HSZ A;  2TCT A;  2P81 A;  2AO9 A;  3NAR A;  4MIM A;  1RPW A;  2Y9Y A;  1B72 B;  2M2E A;  3M3Y J;  5EFY A;  3JRD A;  4A3B J;  2REK A;  4ME9 A;  3GTJ J;  1NTC A;  1TC3 C;  3LJL A;  3V78 A;  2Y31 A;  5IYC J;  5FHP A;  3D1N I;  2HYT A;  1MBG A;  2L7Z A;  4DYR A;  2VUM J;  4MXM A;  2CU7 A;  1FJL A;  2YVH A;  2QTQ A;  2ME0 A;  2JN6 A;  1S7E A;  3BNI A;  5J1Y A;  2GM4 A;  1MBJ A;  3HTI A;  1BW5 A;  4YZE A;  3B6A A;  2B63 J;  4D7N A;  2OF7 A;  1IC8 A;  1H8A C;  3GTQ J;  2GFN A;  1SGM A;  1ETK A;  5HOD A;  5CW8 A;  5GP9 A;  1P7I A;  2NP3 A;  4HNV A;  1MSE C;  3TW7 A;  1WCM J;  1JUS A;  3IH4 A;  5FKO A;  5JLX A;  4EEF G;  5IOZ A;  5IYB J;  2XGE A;  4RDU A;  3F0C A;  4I76 A;  3BG5 A;  1TWH J;  2WUI A;  5H9T A;  3NXC A;  3B6C A;  2EBI A;  4B3A A;  2Q24 A;  2YVE A;  2ZCM A;  3S1M J;  1UMQ A;  3MNL A;  1GV2 A;  2FX0 A;  2DA3 A;  4HKU A;  5IPA A;  5AQC A;  4JNN A;  1ENH A;  3K2A A;  3ZQH A;  2DMQ A;  4IHY A;  1ZKG A;  4FE7 A;  1I50 J;  2Y2Z A;  3BTI A;  2GUH A;  1LFU P;  3E7Q A;  2XPV A;  3LSG A;  4M3G A;  1RET A;  2Y30 A;  1GDT A;  5IYD J;  5C4Y A;  3NRG A;  3HEF A;  5GPC A;  1XS9 A;  4A3D J;  1JGG A;  1APL C;  3E7L A;  1ZK8 A;  2DN0 A;  1ETO A;  2QIB A;  4D5F A;  1JKP C;  4DZJ A;  1TWA J;  4GCK A;  5EGO A;  1I3Q J;  4A3F J;  1EF4 A;  3C07 A;  2XDN A;  3CCY A;  1LE8 A;  5FKL A;  1ZR4 A;  2EH3 A;  1AU7 A;  2M8G X;  2QCO A;  3C2B A;  2LTP A;  1MH4 A;  5M3M J;  1IGN A;  2D5V A;  4ICH A;  2DA1 A;  1HOM A;  1WPK A;  3AQT A;  3BTL A;  2ZCN A;  2DA5 A;  1E3O C;  2G3B A;  2E1O A;  1MBF A;  1CQT A;  3ON4 A;  3JRF A;  1JTX A;  3BR6 A;  5EZH A;  1AHD P;  2IAI A;  1B72 A;  4GFL A;  5M5W J;  2X6O A;  5E3N A;  2K9S A;  4UUT A;  5JLW A;  3UKG A;  4A3C J;  3PPB A;  4AC6 A;  4JKZ A;  3QKX A;  1IUF A;  1K83 J;  4DZP A;  2E2J J;  4A3M J;  1WH5 A;  5FLV A;  2PMZ N;  2LLK A;  4XRM A;  2G7S A;  4FE4 A;  3FRQ A;  2L0K A;  3QBM A;  5IOY A;  4GFK A;  2MG4 A;  3MVP A;  3PAS A;  2HOA A;  3JR9 A;  3G7R A;  4XK4 A;  4KWA A;  3T6N A;  2HI3 A;  2ID3 A;  5EEA A;  3ZQL A;  2XB5 A;  4JX6 A;  2M9H A;  3G56 A;  1Y1W J;  2NVX J;  3BRU A;  5FJ8 J;  2PBX A;  1GV5 A;  2EQR A;  2QOP A;  2MW8 A;  1R9T J;  9ANT A;  2TRT A;  3S2D J;  2XGC A;  1MNM C;  1LE8 B;  2R92 J;  3KKC A;  3TED A;  4XRS A;  4BY7 J;  5J1R A;  3BR3 A;  1B8I A;  2W53 A;  4AUX A;  3BQZ A;  1UHS A;  2YU9 J;  5FMP A;  3A03 A;  4RBO A;  1I6H J;  5DAJ A;  3G1M A;  3HTH A;  3NNR A;  2ECC A;  2HDD A;  4MFE A;  1DU6 A;  2YS9 A;  2G7G A;  3NAU A;  3ANG A;  3H0G J;  2FJ1 A;  2HXI A;  3TP0 A;  5EF6 A;  1JKO C;  5F0C A;  3HE0 A;  3OIO A;  3QQA A;  1AKH A;  2JA7 J;  3HDD A;  2NS7 A;  4W1U A;  3OSF A;  4IHV A;  3VP5 A;  5FKK A;  5FGL A;  3A01 B;  1HLV A;  4B1R A;  4AC0 A;  3Q0V A;  2HXO A;  1QRY A;  2VPR A;  1IG7 A;  3PO3 J;  1F43 A;  3QPL A;  2CUE A;  5DS9 A;  4CYC B;  2LD5 A;  3HGY A;  3S1N J;  2L7M P;  2IU5 A;  5GPA A;  1JKR C;  3JRG A;  3S17 J;  2XSD C;  3BR0 A;  3H3V K;  1XG1 A;  4C3J J;  2HQ5 A;  1G2H A;  5FKN A;  1GUU A;  2E2H J;  3P9T A;  1VND A;  1BA5 A;  1O4X A;  3VOX A;  2NVT J;  3BR5 A;  1RR7 A;  4A3K J;  2NP5 A;  3CDL A;  2LKX A;  5C44 J;  1IV6 A;  4L5E A;  2X9D A;  4LOC A;  5FLM J;  1MBK A;  3BT9 A;  1FIP A;  1X58 A;  2HYJ A;  4A3G J;  2O8K A;  1BW6 A;  1TWF J;  1H89 C;  1GT0 C;  1B8I B;  2MGQ A;  1UI5 A;  2WB1 N;  2M34 A;  5K7F A;  2XGD A;  2ZCX A;  3S16 J;  3K7A J;  3GTK J;  2CJJ A;  3VW0 A;  2MSY A;  5E3M A;  4XID A;  5IP7 J;  3HOX J;  4DYC A;  4M6V A;  3HOZ J;  4J19 A;  4Y52 J;  3S5R A;  2YUS A;  4GCT A;  3BR1 A;  5DTD A;  2KT0 A;  3TW6 A;  3VIB A;  1MH3 A;  4JYK A;  2HOS A;  1AKH B;  1P7J A;  3NPI A;  2JWT A;  4A3E J;  1JT0 A;  1HDP A;  3ANP A;  4UDS A;  1JUM A;  2DMP A;  1ETW A;  3HIM A;  3ZOB A;  3HOY J;  3LSR A;  3I4M J;  2X48 A;  3BTJ A;  4BXX J;  1MBE A;  3HOU J;  5F1J A;  3BG3 A;  5HBU A;  1DU0 A;  3S2H J;  1WI3 A;  2DMU A;  1ORK A;  5EG0 B;  2DA7 A;  2NVY J;  3HM5 A;  1OCP A;  4I6Z A;  2DG7 A;  2DA4 A;  1MSF C;  5J1U A;  1FEX A;  1JJ6 C;  5IP9 J;  3JRH A;  3Q0W A;  1Y1V J;  3LSP A;  2E2I J;  3GZI A;  1NK2 P;  3RKQ A;  2VI6 A;  4MLO A;  3HOW J;  3GTO J;  3JRA A;  3VPR A;  3LSJ A;  2V57 A;  2JK3 A;  4X6A J;  1QPI A;  4M3D A;  2R5Z A;  2OER A;  2DG8 A;  2IEK A;  1PUF A;  2H8R A;  3O8H A;  4C3I J;  3JRB A;  3GBG A;  3EUP A;  4BBR J;  1IDY A;  3A01 A;  2UXO A;  4ABZ A;  3JRE A;  2LVS A;  3ZQG A;  4FCY A;  3QPS A;  4QTR A;  4CYC A;  1JUP A;  5E3O A;  1A6I A;  2VKE A;  5EZG A;  4FTH A;  1W0U A;  3PO2 J;  2GLO A;  2ZOZ A;  2G7L A;  2LY9 A;  2UXP A;  3HOV J;  4W97 A;  1HDD C;  5K58 A;  1OFC X;  3F1B A;  3FK7 A;  1RKW A;  2ELK A;  1IDZ A;  1ZQ3 P;  3RD3 A;  3CJD A;  3BR2 A;  3G1L A;  4UUS A;  2EZH A;  3VUQ A;  2I10 A;  1HF0 A;  3S14 J;  3O8G A;  2FD5 A;  2E19 A;  5EYR A;  2F07 A;  1RKT A;  2NOG A;  2XB0 X;  2WGB A;  3G1O A;  3L1P A;  1H88 C;  1T33 A;  5C4X J;  1FTT A;  2Y0S N;  3W6V A;  1JJ8 C;  3RQI A;  3NI7 A;  5FKM A;  5M5X J;  2M0C A;  5C4J J;  3BJB A;  2CQX A;  1UG2 A;  2DA6 A;  2L9R A;  1X2N A;  5D19 A;  3V6G A;  2EZK A;  1ETV A;  4BBS J;  5F08 A;  2R0Q C;  4A93 J;  2XPU A;  2O7O A;  1JT6 A;  3IUV A;  2QWT A;  1LFB A;  2R5Z B;  5EDN A;  2UXI A;  2WAQ N;  4D5C A;  3ZQC A;  1W0T A;  1PUF B;  5K7Z A;  5D1R A;  2QKO A;  5F04 A;  3VW2 A;  1T56 A;  2DMN A;  3FKI J;  2R5Y A;  3RH2 A;  2HKU A;  1ETQ A;  3TP3 A;  2KDZ A;  2K9N A;  3BG9 A;  4DW6 A;  5EG0 A;  2ZOY A;  3IH3 A;  4QSH A;  1U8B A;  4GFB A;  3DPJ A;  2RAE A;  3RZD J;  1FIA A;  1HCR A;  4A3J J;  4UUS B;  4M3E A;  1D5Y A;  3GEU A;  3KKD A;  2JA8 J;  1U9N A;  4MK6 A;  1Q1V A;  5F27 A;  2H1K A;  3ON2 A;  1TWC J;  5M5Y J;  5CXG A;  3DEW A;  2PZ9 A;  4GCL A;  2AHQ A;  4NDL A;  2QF7 A;  1ETX A;  5E3L A;  2CQQ A;  4IHX A;  1IRZ A;  3HTA A;  5J3L A;  2DJN A;  1OCT C;  4ACI A;  1OJL A;  3GTL J;  3VOK A;  2DTZ A;  3DCF A;  2O7T A;  3VVZ A;  3S1Q J;  1YRN A;  3ZQF A;  2K9Q A;  4IHW A;  2NS8 A;  2JA5 J;  2ID6 A;  2GBY A;  2GEN A;  3FIW A;  2RHA A;  3SFI A;  3RZO J;  1POG A;  4QIW N;  2NVQ J;  2FBQ A;  5CXI A;  2N8G A;  1ITY A;  3COL A;  2Y9Z A;  1U78 A;  2W48 A;  1QVU A;  1VI0 A;  4FIS A;  4C3H J;  2UXH A;  4PXI A;  3HKZ N;  5F0F A;  4AYB N;  3JRC A;  3SJM A;  1U9O A;  3GTM J;  3LOC A;  4D7M A;  4L62 A;  4A3L J;  3O60 A;  2R5Y B;  2JJ7 A;  4Y7N J;  2ZB9 A;  3LWJ A;  3VVX A;  1Z77 A;  3BCG A;  2LFB A;  2HOT A;  3PM1 A;  3I4N J;  3EGQ A;  1ZR2 A;  1JTY A;  2LK2 A;  4B4C A;  4V2F A;  3Q3S A;  1BJZ A;  4BKX A;  3HBL A;  3FK6 A;  2LP0 A;  4V2G A;  2ME6 A;  4G12 A; 
#chains in the Genus database with same CATH topology
 3IKV A;  1T95 A;  5E1W A;  4M3F A;  2CH0 A;  3FM5 A;  5F6F A;  3OYG A;  3BOQ A;  5E8I A;  3R0J A;  3WGG A;  2CV1 A;  2ZXH A;  3ABU A;  4XOP A;  3BLY A;  1MBH A;  3ZQI A;  2Q2E A;  2LBF A;  4IEJ A;  2CFO A;  2LR8 A;  2Y48 A;  2OCE A;  3HRT A;  1OYW A;  2E1C A;  2V26 A;  3QOE A;  4YIF A;  4IRG A;  3K2Z A;  1SAN A;  4WK8 F;  2GQQ A;  2KMU A;  2KDO A;  2VKV A;  1ZGW A;  1TT5 B;  2E7X A;  5D5V B;  2V1X A;  3GTP J;  5F0H A;  1F5T A;  2JA6 J;  1IJW C;  5LLQ A;  4JX4 A;  5GTH C;  3F72 A;  2F5C A;  3CMY A;  1YO5 C;  1R1T A;  1U2W A;  4X1E A;  5ICC A;  3M4O J;  2CSO A;  2G0E A;  3R61 A;  4XM3 A;  2WAE A;  1SVO A;  1SEU A;  2RAS A;  2CW0 F;  5ERI A;  5E1X A;  3PIP F;  5FRN A;  1SFK A;  3VVY A;  3CRJ A;  2WV1 A;  4E7K A;  1DPR A;  3PNY A;  4PJ0 C;  3LHQ A;  3HTJ A;  1X2M A;  3DXJ F;  2CUJ A;  1B59 A;  2UWM A;  3KCC A;  1KYZ A;  3HJE A;  2BV6 A;  3QP5 A;  4ITV A;  2A6E F;  3RTR A;  1WQ2 A;  3SFZ A;  2K9L A;  5IP6 A;  3MAJ A;  1MDM B;  4BQA A;  2D6Y A;  3MN2 A;  1RRJ A;  2JA2 A;  5FO5 A;  2V79 A;  3WHC A;  4DNC A;  3C1D A;  1YE9 A;  2DFH A;  3CCR I;  1FC3 A;  4R79 A;  1VQN I;  2DDB A;  2CRG A;  3BTC A;  4N9I A;  2TCT A;  3FM3 A;  1KQ8 A;  3SXY A;  1O3Q A;  2D2W A;  3FXL A;  2DK8 A;  2Y9Y A;  4P96 A;  5D5W B;  3VYR B;  4Y13 A;  2M2E A;  4RB3 C;  3CUO A;  2WAF A;  1K78 A;  3M3Y J;  3HL2 A;  4EGZ A;  4A3B J;  2REK A;  4ME9 A;  2IGN A;  2XAU A;  1KON A;  3QYE A;  4I01 A;  3MZY A;  2ZC2 A;  5EJC A;  2Y31 A;  3ZMT A;  4MQV A;  2QKM B;  4XLN F;  1IRF A;  3D1N I;  4IZZ A;  2KKO A;  2VUM J;  3MKZ A;  4U9L A;  1P9Q C;  1TZL A;  5E8G A;  1U3E M;  1MJB A;  2YVH A;  2QTQ A;  3RDI A;  2EFW A;  3ZP5 A;  2A3S A;  2OZ6 A;  1S7E A;  2XAJ A;  2DI3 A;  2GM4 A;  1MBJ A;  1T0F C;  5LEJ A;  5H6R A;  2ZXJ A;  4YZE A;  4NNJ A;  4HEA 2;  4G7Z F;  2X51 A;  2OF7 A;  1SGM A;  2DO7 A;  5FD6 A;  5GP9 A;  1P7I A;  3J7Z I;  1MSE C;  1PDN C;  1N75 A;  3TW7 A;  5FKO A;  3IH4 A;  3ISP A;  4PUS A;  3MFK A;  2YVX A;  4ZYE A;  4WF2 A;  2E34 A;  2FOW A;  3I58 A;  2H27 A;  3F0C A;  1YW9 A;  3BG5 A;  4U0V A;  2WUI A;  5H9T A;  1K4S A;  2VC1 A;  3H0D A;  3DBL B;  1R49 A;  1Y6I A;  1ZLK A;  3ABT A;  3B6C A;  4IHS A;  3LFK A;  1K4T A;  2WBM A;  1T08 B;  2QM3 A;  4B3A A;  2ZCM A;  2Q0O A;  1XD7 A;  2QVO A;  2NAZ A;  4HKU A;  5IPA A;  1J2X A;  2VAS A;  3CO7 C;  4YEL A;  3BP8 A;  2EIJ H;  3ZQH A;  2MYS A;  3GO5 A;  4FE7 A;  1I50 J;  3BTI A;  5BOX A;  4H0E A;  3L7W A;  5GAE J;  3OIP A;  2QBY A;  2XPV A;  3B73 A;  4M3G A;  5C4Y A;  3W3C A;  3PQK A;  5GAD J;  3QYF A;  1Z1D A;  1LPQ A;  3CLO A;  1IXC A;  2QIB A;  1HST A;  1TWA J;  2DK5 A;  3C07 A;  2CW7 A;  2PBI A;  1J59 A;  2XDN A;  2OQG A;  3RIR A;  2BY1 A;  1LKX A;  4AIJ A;  3GXO A;  2V7F A;  3S3M A;  1ZR4 A;  1EV7 A;  3ZPL A;  4L9N A;  2ACJ A;  2D5V A;  1TW3 A;  4PGG A;  2DA1 A;  4M73 A;  1HOM A;  2YX4 A;  3AQT A;  4I98 B;  1YIT I;  3BTL A;  1NHA A;  2W24 A;  4XKB A;  2G3B A;  5JFR A;  2Q1Z B;  3K4B A;  4BL0 B;  3BR6 A;  4UVA A;  2R4G A;  3OOP A;  5E3N A;  4UV8 A;  3HSF A;  2RN7 A;  4A3C J;  5IT9 Z;  3V7S A;  1U5T C;  1LB2 A;  4I99 C;  4ZTF A;  4BE1 A;  1O3R A;  2DJI A;  2VT3 A;  2VQG A;  2PMZ A;  5ILS A;  4ZDO A;  1BIB A;  1BR1 A;  1U0J A;  3FRQ A;  2L0K A;  2HEO A;  2G7U A;  3OYI A;  1X19 A;  3MVP A;  2HOA A;  3JR9 A;  4LIU A;  3KP4 A;  4ON0 A;  2LC2 A;  2ID3 A;  4JX6 A;  2M9H A;  4II2 A;  1Y1W J;  2R7T A;  2ISZ A;  3BRU A;  1X1P A;  4E7H A;  3M7G A;  2PBX A;  4KN4 X;  1W7P B;  4E7I A;  2QOP A;  1ZRE A;  2MW8 A;  1R9T J;  3RPQ A;  1D8K A;  3S32 A;  3SYT A;  3A2K A;  3HYI A;  2DBB A;  3TED A;  3KYD B;  4XRS A;  2M30 A;  4AUX A;  4M9X A;  3BQZ A;  1S6L A;  4HDV A;  1UHS A;  2XIG A;  3CF5 F;  4OU0 A;  3RJP A;  5DAJ A;  2EPF A;  5JR3 A;  3G1M A;  3HTH A;  3VTI A;  2ECC A;  3ANG A;  2BY0 A;  2FJ1 A;  1JKO C;  1MJ9 A;  3FXR A;  1LDD A;  1AKH A;  1N78 A;  3E6B A;  2PX9 A;  4W1U A;  3IWZ A;  4AU7 A;  4IHV A;  4YRV A;  3EYI A;  3ML6 A;  2DCE A;  2GXG A;  3ELK A;  3DKY A;  2XAS A;  3L09 A;  4UVC A;  5GPA A;  1JKR C;  3JRG A;  1OCC H;  3LA3 A;  3BR0 A;  2XSD C;  1WSU A;  1XG1 A;  3S8P A;  1F4K A;  2HQ5 A;  3SEZ A;  3CCJ I;  1EA3 A;  5FKN A;  2FBH A;  3RI4 A;  2IA1 A;  5L3C A;  5HLT A;  1O4X A;  1BA5 A;  2R7S A;  3CME I;  2LKX A;  1SVL A;  5FLM J;  3BT9 A;  4GYI A;  4HRI A;  5KHD A;  4CUG A;  1FIP A;  1X58 A;  1TWF J;  1H89 C;  3EPZ A;  1KGS A;  3JTG A;  1GT0 C;  1UI5 A;  3I59 B;  3K1P A;  1HC8 A;  2XGD A;  4WXC A;  3QU3 A;  5E3M A;  5IP7 J;  3WTV C;  3HOX J;  3BJA A;  1W36 D;  3HOZ J;  1S9H A;  1MH3 A;  1IF1 A;  2H8W A;  3QPT A;  4ENJ A;  1V5G A;  1JE8 A;  4XOR A;  1GHC A;  4P55 A;  2K02 A;  5DCM A;  1QHG A;  4HF1 A;  5TGT A;  2HDC A;  3CCQ I;  4XLF A;  2E36 A;  1WI9 A;  2GXA A;  3ZGK A;  1IW7 F;  1QQI A;  3OYN A;  2VB6 A;  2Z3Y A;  3BTJ A;  4BXX J;  3W2V A;  1S7A A;  1MBE A;  2QEN A;  5ILU A;  5DD4 A;  5F1J A;  3BG3 A;  4L5J A;  2IGM A;  1DU0 A;  2GIV A;  2DMU A;  2IPQ X;  2DFF A;  2HVQ A;  2K85 A;  4I6Z A;  2I5U A;  2DA4 A;  4O6J A;  1U5T B;  5J1U A;  1Z9C A;  1MSF C;  1FEX A;  3GZI A;  3E6D A;  2PLY A;  3RKQ A;  1XGO A;  1AOY A;  2MLG A;  3JRA A;  3CUQ C;  3LSJ A;  2HPI A;  4NUB A;  2NNY A;  2R5Z A;  2HYF A;  1GXQ A;  2XVC A;  2DG8 A;  3O8H A;  3GBG A;  2FE3 A;  3JSP A;  2EV5 A;  2OU2 A;  1SMT A;  3JRE A;  5D8L B;  4ENK A;  2ZY9 A;  3QPS A;  1JUP A;  2V1N A;  2IS2 A;  1HBX G;  5CPR B;  2LY9 A;  1HDD C;  1OFC X;  2A2F X;  3L2Q A;  3FK7 A;  1UAA A;  2ELK A;  3V7R A;  3BCA A;  3U1D A;  3CJQ B;  4LLL A;  3OV8 A;  4XLP F;  3SWH A;  1R5G A;  4KYW A;  2QWW A;  4XKW A;  2FD5 A;  4PSX A;  2X6X A;  2V9V A;  2XUB A;  1YI2 I;  2LG4 A;  3L1P A;  1Z3Y A;  1RC9 A;  2R7O A;  2Y0S A;  3A0B C;  1FTT A;  3T5X A;  4AID A;  1WHU A;  3NI7 A;  1O3S A;  2DYR H;  3I9V 2;  3PNV A;  3BJ6 A;  4UHT A;  2CQX A;  2DA6 A;  1T6S A;  1X2N A;  2IS6 A;  1XTA A;  3DPT A;  1YYV A;  2XKO A;  2E35 A;  2R0Q C;  2O7O A;  5A2Q Z;  4IQ4 A;  4CYD A;  1JT6 A;  2VC0 A;  2WA0 A;  1FYK A;  3IUV A;  4N0B A;  3LQR A;  1XDS A;  2F4O B;  1RNL A;  2RDP A;  4RA2 A;  2UXI A;  4D5C A;  2W85 A;  4DVY P;  1BC8 C;  4U88 A;  1MMG A;  4XN3 A;  4A5N A;  1R58 A;  2M0M A;  4PDK A;  3G4S I;  3KLO A;  1R36 A;  4Z6Y A;  3RH2 A;  1ZN2 A;  1SD5 A;  1ETQ A;  4IRH A;  1S8N A;  2K9N A;  4BGD A;  1QZE A;  4DW6 A;  2V1D A;  1ZG3 A;  2X6W A;  5CQE A;  3V7C A;  1U8B A;  1U5T A;  4UUS B;  1XN7 A;  4KNY A;  2CQK A;  3GEU A;  4IQJ A;  2JA8 J;  2NRA C;  2E60 A;  5F27 A;  1ZHF A;  2V4J C;  1CF7 B;  4LK0 F;  3RPU D;  4NDL A;  3OYF A;  1W36 C;  3HTA A;  2CQQ A;  2CO5 A;  3HC7 A;  3BRO A;  1U8R A;  2E7W A;  3FXQ A;  3F8C A;  3Q9S A;  5HDG A;  4LGW A;  1JHH A;  3TO9 A;  5K1Y A;  2O5R A;  2K9Q A;  4XNF A;  2NS8 A;  2COM A;  5KVR A;  2ID6 A;  5KNL A;  3MEX A;  3VSK A;  2DDA A;  1Y8Q B;  2P6T A;  1POG A;  1FP2 A;  2NVQ J;  1D0X A;  3ZMZ A;  1X4P A;  1TQI A;  4D0P A;  3CMA I;  1FBQ A;  3HKZ A;  3JRC A;  1V5F A;  4CH7 A;  4UB8 C;  3A4C A;  3LOC A;  3F23 A;  1WJD A;  2HYG D;  2KL4 A;  4U7B A;  2L9V A;  2Y0M A;  4C2U A;  4ZJZ A;  4CCO A;  3D5L A;  1WKM A;  2VBZ A;  2X1E A;  3CUQ B;  3BCG A;  2G9W A;  2MLK A;  5D8K B;  1K7A A;  1Z67 A;  2KRF A;  3I4N J;  2HWV A;  2B1E A;  3EGQ A;  3B02 A;  4V2F A;  3MD2 A;  3FHN A;  3Q3S A;  2GIZ A;  1UHM A;  2VJI A;  3HBL A;  3WTY C;  3FK6 A;  1P4W A;  2J5O A;  5TIS C;  1UCR A;  2XAG A;  3I3L A;  4GGG A;  1ZRF A;  2XRO A;  3BHQ A;  1J0R A;  1S5L C;  4E7S A;  3CQZ J;  4IF4 A;  4IX7 A;  4EM2 A;  1WH7 A;  5L3D A;  3KNW A;  3A02 A;  3BJO A;  5BNG A;  4M3B A;  3DFG A;  3H35 A;  2OUM A;  3WHB A;  3OOU A;  1YRN B;  4HNT A;  5KAF C;  3NWS A;  4UXN A;  5FGM A;  1WRJ A;  3MMY B;  3AQS A;  1E0E A;  5BPI A;  4R1H A;  2MA3 A;  3CC7 I;  5HDK A;  2NX4 A;  2COB A;  2O9L A;  1W4M A;  3VW1 A;  4Q48 A;  3OR2 C;  2R7D A;  2VON A;  4BEH A;  1XMK A;  2K40 A;  3E5X A;  5E17 F;  3KP2 A;  2EFP A;  5HOO A;  2OJE D;  1XC5 A;  4JX5 A;  4A3I J;  1LQ1 A;  2H6C A;  5ED4 A;  1BOA A;  1MKM A;  2XRL A;  3MZ8 A;  4MO7 A;  3CCV I;  4OAZ A;  1CF7 A;  4ASN A;  3JSJ A;  4HYE A;  1SC7 A;  3CWR A;  4BY1 J;  2M3A A;  2OPT A;  4LG0 A;  4XIC A;  3S1R J;  1FTZ A;  4L9T A;  2DMT A;  3DBR B;  2VKH A;  2ECB A;  4Y17 A;  3JRI A;  2VN2 A;  1B1B A;  4U7D A;  4PFP A;  3Q0U A;  2FML A;  1OR7 C;  3OWT A;  4HX8 A;  3FZV A;  1YIJ I;  1Z0X A;  3MKL A;  4MHG A;  4ETS A;  4JP0 A;  4NC8 A;  2CUF A;  3B81 A;  2L9S A;  4MFD A;  3EET A;  3VYT B;  3TO7 A;  5DUI A;  1NK3 P;  2JVG A;  3K4J A;  5HAW A;  3KZ9 A;  3W6K B;  1FSE A;  5D18 A;  5EEG A;  3OYH A;  4CO8 A;  2QA4 I;  4DYQ A;  2R7Q A;  2ZO4 A;  2J5P A;  5EEH A;  4CDG A;  2FBI A;  2Q2E B;  3WGH A;  3LNQ A;  2LBF B;  2VPL A;  3V4G A;  2UXU A;  3LFU A;  3HG9 A;  2KP6 A;  3K70 D;  5K7H A;  1W5T A;  2B0L A;  3WG9 A;  3KFW X;  3KEQ A;  3L2C A;  2K5C A;  3UNG C;  4X0G A;  4Q5S F;  2AO9 A;  3NAR A;  3R4K A;  4DQ2 A;  3LQQ A;  2HGC A;  1VQ6 I;  1Y0U A;  2EA4 A;  2JT1 A;  3CO6 C;  1QA6 A;  2FRH A;  2AQE A;  4EMS A;  1TC3 C;  4E7L A;  3GW2 A;  2DT7 B;  5IYC J;  2WY7 Q;  1MBG A;  4MXM A;  3W2W A;  2FA5 A;  1MZB A;  1FLI A;  2ME0 A;  4RB2 C;  2ZJR F;  2Y75 A;  4HX7 A;  2E1M C;  5HLG A;  1V5E A;  1Z6T A;  2F5F A;  2O6G E;  2G7H A;  1R7J A;  4M9S A;  3AAF A;  3B6A A;  2B63 J;  2QQA A;  2VJ5 A;  4D7N A;  1TW2 A;  3HRS A;  2GFN A;  4OD5 A;  1ETK A;  4V19 K;  3BZC A;  4HNV A;  2V6C A;  1IZ1 A;  4EAT A;  1WCM J;  2RNJ A;  5JLX A;  1Z05 A;  2XGE A;  2RV8 A;  4C30 A;  3RKW A;  1O7F A;  1TWH J;  2DOD A;  4WXH A;  4OAY A;  3WU1 B;  2GA1 A;  1B4A A;  4CIC A;  5F64 A;  1MND A;  1EH7 A;  2KLO A;  4BJT A;  3FXU A;  1D0Y A;  2EBI A;  4LIV A;  1WJB A;  3V8L A;  3OYD A;  4G6D A;  3OYC A;  1UMQ A;  3M8F A;  2FX0 A;  2DA3 A;  2EFN A;  1ENH A;  3LSI A;  3K2A A;  4G7H F;  1K78 B;  2DMQ A;  3O2P E;  4I09 A;  1SFU A;  4C2M A;  4PFO A;  4BDY A;  4XLE A;  1QBJ A;  2IS4 A;  2O0Y A;  4O5V A;  2EA2 A;  2F5D A;  4AIK A;  5BMZ A;  1GDT A;  4PGH A;  1H9G A;  5IYD J;  2GAU A;  3HPH A;  3NRG A;  3QWL A;  4A3D J;  5E1Z B;  2KRH A;  1APL C;  4BHC A;  1NH3 A;  2DN0 A;  1SFE A;  1ETO A;  4D5F A;  3RYP A;  2GZW A;  4DZJ A;  4IO9 F;  1ON2 A;  1EF4 A;  4UNO A;  5CVV A;  2Z1D A;  2L5Q A;  5K5R A;  3CCS I;  3IUO A;  2GXB A;  2O3F A;  2ZSI B;  3C2B A;  4OOI A;  1MH4 A;  5M3M J;  1VQ8 I;  3Q5F A;  2CYY A;  3ONQ A;  2HU9 A;  5K5Q A;  1WPK A;  3EUA A;  3H36 A;  1IUY A;  1TTY A;  2E1O A;  4HNU A;  4U0Y A;  2HKX A;  4DBR A;  2HDW A;  1ZGJ A;  4P5O A;  4Q47 A;  1H9T A;  5EZH A;  3WE2 A;  1YW8 A;  2IAI A;  1OCR H;  4UUT A;  4BDZ A;  3DV8 A;  4RAY A;  4JKZ A;  4CZZ A;  1RI7 A;  1MGT A;  3JAM Z;  4DZP A;  3QP6 A;  2LRE A;  1A36 A;  2V1U A;  2CQN A;  2VBX A;  1WH5 A;  4F91 B;  1B6A A;  2PMZ N;  2LLK A;  2R7W A;  4FE4 A;  3CCU I;  3QBM A;  3WU2 C;  5IOY A;  4GFK A;  1LFP A;  1WWX A;  1T8I A;  2HVR A;  4KWA A;  3VEP A;  1DGR M;  4PJJ A;  3T6N A;  5D5U B;  1W5C C;  2QBY B;  2HI3 A;  4ZC3 A;  1E2X A;  1PUE E;  2STW A;  2NVX J;  4DJA A;  5JHU A;  3HPG A;  1TT0 A;  3K70 C;  1YFH A;  2KJB A;  1WZ2 A;  3S2D J;  2XGC A;  3KKC A;  3ZXS A;  5J1R A;  2HZD A;  3GME A;  2XHK A;  4KA4 A;  3QAH A;  1HW2 A;  3F3X A;  3ASO H;  2RGV A;  3KPH A;  4JBA A;  1EH6 A;  4RBO A;  5IT3 A;  2WTE A;  1W1W E;  2KIM A;  4XSZ F;  4ZDP A;  1T2K A;  2IJL A;  1DU6 A;  1HQC A;  2G7G A;  1TQM A;  4IJA A;  3H0G J;  3NRV A;  3HE0 A;  4RGX A;  3OIO A;  2E1M B;  3DU5 A;  3QQA A;  1MNE A;  3PFI A;  4UV9 A;  3HDD A;  2NS7 A;  1MW7 A;  1E3P A;  3LWF A;  1UST A;  3VP5 A;  1LVA A;  5FGL A;  1BOB A;  2W53 A;  4AC0 A;  1G3W A;  3Q0V A;  2VPR A;  5J8C A;  3PO3 J;  3KYC B;  5ICF A;  4E7Z A;  2CUE A;  3S1N J;  2LD5 A;  1YJ9 I;  3GLL A;  2IU5 A;  1XCV A;  4PSW A;  1BI3 A;  3CF2 A;  2R7R A;  2LH9 A;  3H3V K;  1DQU A;  1WJE A;  1VQ4 I;  3A1Y A;  2QSF X;  4HA8 A;  2JUG A;  3LA2 A;  5E20 A;  4GDF A;  2FJI 1;  1GUU A;  2XAQ A;  2E2H J;  2CFX A;  1G59 A;  2I8D A;  2DTR A;  1IV6 A;  1XSV A;  4L5E A;  3QOP A;  4LOC A;  5AIQ A;  4BAY A;  3IKT A;  1XGN A;  2ZFU A;  2R7X A;  3F6V A;  2HNH A;  3TDU C;  4RMN A;  1OR7 A;  2EWN A;  2CJJ A;  4ANJ A;  4XID A;  4M6V A;  1XCB A;  3C3W A;  4AWX B;  2KT0 A;  1UEL B;  1HW5 A;  2DOE A;  5HNF A;  2IGK A;  4JYK A;  3GZ6 A;  1AKH B;  4QWQ A;  2QQ8 A;  3IAS 2;  2MH9 A;  4KMU X;  4OMZ A;  1HDP A;  3DKX A;  3BCB A;  4UDS A;  5HS7 A;  2LYC A;  3I54 A;  3TQN A;  2WWY A;  1JUM A;  2W25 A;  3WE3 A;  4L0Z B;  3LSR A;  3RPU A;  2X48 A;  2Z9O A;  2EFO A;  2IVM A;  2KJC A;  2NOJ B;  2E5Z A;  4A12 A;  4IL6 C;  3J81 K;  4BE2 A;  2KZV A;  4WX9 A;  3HOU J;  3IP4 B;  1WI3 A;  4YFK F;  3S2H J;  4OIO F;  2DA7 A;  3HM5 A;  4EM0 B;  2DG7 A;  5IP9 J;  4HOB A;  3SZP A;  2W57 A;  3OR1 C;  3Q0W A;  4RLF A;  2E2I J;  1X1D A;  3AG4 H;  4LB6 B;  3D0S A;  3HSE A;  3PJR A;  3ESW B;  3GTO J;  2Z5U A;  1QZZ A;  4QPO A;  4HSR A;  2HOE A;  2JK3 A;  1AWC A;  4X6A J;  1TNT A;  1QPI A;  2Z99 A;  2E71 A;  2ZBK A;  3F21 A;  3CJT B;  5HNH A;  4XMY A;  4HAM A;  1ONV A;  2ESN A;  2IXS A;  4ABZ A;  4HF0 A;  1XB4 A;  2HR3 A;  4FCY A;  1N25 A;  3GX4 X;  4QTR A;  2JA7 J;  5E3O A;  1FY7 A;  2GLO A;  3PO2 J;  2BHY A;  4RGU A;  2G7L A;  3K9T A;  4W97 A;  3CD6 I;  3K4N A;  2CV2 A;  5K58 A;  5DCM B;  4PCQ A;  4KMF A;  1BR2 A;  2JSC A;  3FBI B;  3DU6 A;  1B9N A;  1W5S A;  3MKY B;  4EVI A;  3CJD A;  3BR2 A;  2EZH A;  3VUQ A;  2WC2 A;  3J7A O;  3ZQQ A;  3HXL A;  2PEX A;  1HF0 A;  1P6R A;  3U1K A;  1UZC A;  5B1A H;  2E19 A;  5EYR A;  2F07 A;  2NOG A;  1IXS B;  2XB0 X;  1V54 H;  2D45 A;  1VQP I;  3DEU A;  1Z91 A;  2RVC A;  2Y0S N;  4CSW A;  3M07 A;  1JJ8 C;  5GTI C;  2BW3 A;  4EQQ A;  2M0C A;  3R60 A;  2D1V A;  3BJB A;  5DUK A;  2XF5 A;  3TOA A;  3CDH A;  4HLY A;  4YIR X;  2IS1 A;  2XPU A;  1BC7 C;  3WTS C;  2K4B A;  2P6S A;  3WTT C;  2FXA A;  2QWT A;  2QLZ A;  1LFB A;  2R5Z B;  2A05 A;  2EJR A;  3RSN A;  2BZT A;  1XSX A;  3MQ0 A;  1OLT A;  2F5E A;  2DAO A;  3CC4 I;  2ZME C;  3VW2 A;  2M5W A;  2GOM A;  1T56 A;  2JPB A;  2OV7 A;  3VYS B;  2R5Y A;  4IOA F;  2DPD A;  2VXZ A;  2HKU A;  2KDZ A;  4CCN A;  4RGS A;  3REO A;  2ZOY A;  4QSH A;  2P4W A;  3LAJ A;  3ERE D;  3DPJ A;  1YLF A;  4S05 A;  4BS9 A;  4LLN A;  4CGZ A;  1FPQ A;  4A3J J;  2VOP A;  3H9J A;  3DP7 A;  4MK6 A;  1MMS A;  4G6Q A;  3ON2 A;  4M71 A;  1TWC J;  2LMD A;  4L5I A;  3WOD F;  1SAX A;  2PZ9 A;  5CXG A;  4GCL A;  2QF7 A;  1ETX A;  4ZH4 F;  1IRZ A;  3H9G A;  3I71 A;  4F55 A;  5CVR A;  2W82 A;  1OCT C;  4ACI A;  2NYX A;  2DOF A;  3HRU A;  3OY9 A;  1OJL A;  3GTL J;  2KIF A;  4H4K C;  3DCF A;  3VOK A;  1GLN A;  1XPX A;  2GBY A;  3OMY A;  2FNA A;  3QOD A;  4F7Z A;  2P7V B;  2A69 F;  3ZRG A;  1S7O A;  4QIW N;  2FBQ A;  5CXI A;  3L9F A;  2VKD A;  2OZU A;  1ITY A;  1I27 A;  1DP7 P;  1KU9 A;  3F6O A;  4FIS A;  3N97 A;  4M6X A;  2K9M A;  4PXI A;  1QO0 D;  3HKZ N;  3SJM A;  1U9O A;  3AL0 C;  4L62 A;  4A3L J;  4Y33 A;  1J7K A;  2QYO A;  2MD5 A;  1O57 A;  2ZB9 A;  3FXJ A;  1G3T A;  5CJ9 A;  4PJN A;  2BY3 A;  5JI6 A;  1WFX A;  2L3D A;  4NBQ A;  4F3Q A;  3O6B B;  3J7Y J;  1JTY A;  2LK2 A;  4BJ6 C;  2VBW A;  3K6G A;  2BY2 A;  2ZJ2 A;  2HPM A;  4HX4 A;  1WJC A;  1K79 A;  2VT2 A;  2QGU A;  3LL7 A;  2MC4 A;  1G4D A;  4NC7 A;  4V2G A;  1Z21 A;  1UB9 A;  3HB9 A;  4A6E A;  2L7F P;  4BXU A;  3LA7 A;  3UR3 C;  1RES A;  3GZN B;  2H6B A;  5L3E A;  3H9Q A;  2QUF A;  2Y69 H;  1A5J A;  3LSM A;  4RM3 A;  3FIS A;  5D4S A;  3NEU A;  1VTN C;  4AF5 A;  1IN7 A;  1PVE A;  1HKT A;  3GFI A;  3JTH A;  1JKQ C;  4XRS G;  1TL8 A;  1YJW I;  1H0M A;  3I64 A;  1F9N A;  2C6Y A;  3E6M A;  4ENN A;  5J6X A;  1J09 A;  3H5N A;  4CHU A;  4HV6 A;  2B7E A;  1UFM A;  5CQG A;  1DP3 A;  3W2A A;  1IN8 A;  1X1C A;  1EJ9 A;  1A31 A;  4RS8 A;  4KDP A;  1D3Y A;  1D1C A;  3FBN B;  2KPM A;  5CVI A;  2DA2 A;  3J80 K;  1DUX C;  3J7A Y;  4I02 A;  1XGS A;  1BJA A;  4GYG A;  3S15 J;  3ASN H;  2ZME B;  4EM1 A;  5JVT A;  1FOK A;  4OIQ F;  4B3X A;  2VOD A;  2XC7 A;  3GFL A;  1RZ4 A;  3OSG A;  3AG3 H;  4NN1 A;  3OYL A;  2ZXW H;  1I6X A;  2A6H F;  5B66 C;  3BQY A;  3ZN1 A;  4B48 A;  4MEX F;  5FB2 A;  1WGX A;  3AG1 H;  2DT6 A;  1ZGA A;  2OI8 A;  1ETY A;  2R7Z J;  1LEB A;  1K61 A;  1BL0 A;  1E3H A;  2HZT A;  2QZ8 A;  2VQC A;  2R93 J;  3TGN A;  1IN4 A;  4C9Y A;  4JL3 A;  1VFC A;  4XKC A;  4ENM A;  5LBQ A;  4C2M J;  2A5Y B;  5FLX K;  5M3F J;  1G8X A;  4P9F A;  4BEH B;  5HSZ A;  2Z2S B;  4HZF A;  2P81 A;  1PJR A;  2KRC A;  2LSO A;  1LEA A;  3GWZ A;  3HIF A;  3P9C A;  1REP C;  4MIM A;  4JQF A;  1RPW A;  2RHA A;  1B72 B;  3OYB A;  1YJN I;  3JRD A;  1ZRD A;  1SFX A;  3DTE A;  3CCM I;  2M4K A;  2AXT C;  3E6C C;  2ISY A;  4CCJ A;  4LG0 B;  1R5I D;  3M1E A;  1P4A A;  4RB1 A;  2CU7 A;  1GXP A;  1FJL A;  3DTI A;  2EV0 A;  3V42 A;  2JN6 A;  3BNI A;  5J1Y A;  1D1B A;  3KEY A;  2P5L C;  4BNC A;  1BW5 A;  5K5O A;  1Y8R B;  4B47 A;  1IC8 A;  1H8A C;  3BZ6 A;  5CW8 A;  1SAU A;  3KX2 A;  2P0W A;  3L2R A;  1Z6R A;  1G6N A;  1JUS A;  2UV1 A;  3GVA A;  4RDU A;  2HKO A;  4UVB A;  1T39 A;  1FWZ A;  3T8T A;  3DTK A;  4Y15 A;  3OYK A;  4DOZ A;  5TJJ A;  4N4O B;  1YX5 A;  3MNL A;  3RKX A;  1GV2 A;  2FU4 A;  5AQC A;  3QYB A;  3HOS A;  2ZJP F;  4BE0 A;  1XGM A;  2ZME A;  4QPQ A;  2Y2Z A;  2PJR B;  3PUB A;  2PI0 A;  2OAZ A;  2P5K A;  2GUH A;  1LFU P;  1ZH5 A;  4MQ9 F;  1WVR A;  4PJL A;  1RET A;  2Y30 A;  3FXO A;  3ERM A;  3HEF A;  2W00 A;  3S2W A;  2MFZ A;  3IWF A;  2BVL A;  3ZQ7 A;  6PAX A;  4M9Z A;  2VXD A;  3CCY A;  1LE8 A;  5DYM A;  4GCV A;  5FKL A;  1X3W B;  4OIN F;  2EH3 A;  1AU7 A;  2QCO A;  3DLA A;  3K4M A;  3RCO A;  1IGN A;  1ERD A;  2L9N A;  3T1B A;  2DYS H;  1E3O C;  1QU3 A;  2ZCN A;  4NQW A;  2VOO A;  1R1U A;  3ON4 A;  3JRF A;  1JTX A;  1YW7 A;  1AHD P;  1B72 A;  2QSH X;  3P7N A;  2X6O A;  4HBL A;  2A5W A;  2MD0 A;  5JLW A;  3KP3 A;  4BYY A;  2CWE A;  5E18 F;  2K27 A;  1VQM I;  3OS2 A;  4KJZ A;  1IUF A;  1K83 J;  2JRT A;  4WCG A;  2GOX B;  3I4P A;  2VIX A;  2E2J J;  3LMM A;  3GF2 A;  2Z16 A;  4LMY A;  4XSX F;  1YOV B;  3PAS A;  2L4M A;  3G7R A;  3CDI A;  4XK4 A;  3TMO A;  2PG4 A;  5EEA A;  1KZH A;  3ZQL A;  4AD9 A;  4AVZ A;  2XV4 S;  4CZC A;  4UY8 I;  3G56 A;  4IHT A;  4FHT A;  1QZY A;  5FJ8 J;  2KHM A;  2LY1 A;  2PFV A;  9ANT A;  4B43 A;  1J75 A;  1MNM C;  2ZSH B;  2BXY A;  3E5U A;  4HV5 A;  4KIF A;  4BY7 J;  1B8I A;  2LOO A;  4OIP F;  4EJV A;  2DW4 A;  3ZMV A;  4U9N A;  5FMP A;  1S3J A;  1I6H J;  3DBH B;  5CVJ A;  2P5V A;  3NNR A;  2XKP A;  4MFE A;  1FMW A;  1I5Z A;  3AKZ A;  3G2B A;  3K10 A;  5F0C A;  1TBX A;  3SQN A;  1HKS A;  1Y56 A;  2EB7 A;  2X4H A;  3GCM A;  4FQG A;  4XBF A;  2PJR A;  2VJ4 A;  4UUV A;  2IRF G;  4HG2 A;  1HLV A;  4B1R A;  1MIJ A;  3K1N A;  1D8J A;  1QRY A;  3G6E I;  5DM6 F;  1IG7 A;  3K0L A;  2ZJQ F;  5LEK A;  5DS9 A;  4CYC B;  2L7M P;  2EIM H;  1QPM A;  3SEQ A;  5ILV A;  1KU7 A;  3S17 J;  4I7H A;  2O03 A;  2PFB A;  5HS8 A;  1O7L A;  3HOT A;  4I0A A;  1ZAO A;  4C3J J;  4L9J A;  1G2H A;  4YFX F;  3P9T A;  3FX3 A;  2PMU A;  3E3V A;  2NVT J;  3IRR A;  3BR5 A;  3FF5 A;  4A3K J;  3HHG A;  1ZG1 A;  3CDL A;  4G9Y A;  3G73 A;  4KN7 X;  4EGY A;  3NQO A;  5GAG J;  4A3G J;  2HQN A;  2O8K A;  5LGT A;  1W7P D;  3W6J B;  3C18 A;  2WB1 A;  3JW4 A;  4N4N B;  5D4R A;  1BR4 A;  3I53 A;  3OS0 A;  4BAC A;  2RQP A;  1FT9 A;  3S16 J;  3H5R A;  3K7A J;  2IT0 A;  2VLA A;  3GTK J;  3FDY A;  1KQ0 A;  1QNT A;  1LJ9 A;  4DYC A;  4OD4 A;  5J4V A;  1HKQ A;  4Y52 J;  3S5R A;  2YUS A;  5LHI A;  2RKH A;  3BR1 A;  5DTD A;  3KYL A;  2DOA A;  2JVH A;  3ABM H;  3LST A;  1S29 A;  5J8F A;  2R7U A;  3HTU A;  5JHF A;  3NPI A;  2KIQ A;  2JWT A;  4A3E J;  1JT0 A;  3RQ4 A;  3ANP A;  1MMN A;  2YR2 A;  2ZCW A;  4BXF A;  1O3T A;  2DMP A;  1ETW A;  3ZOB A;  5L3B A;  1WJF A;  2CW8 A;  4YEJ A;  1R5H A;  3KZY A;  3IL2 A;  3T0Y A;  1OCP A;  1RUO A;  4D1Q A;  4S04 A;  3ROU A;  3RYR A;  4ZDL A;  1Y1V J;  4BJ5 C;  2B9S A;  5H6Q A;  1MMA A;  2VI6 A;  1HA8 A;  3H5A A;  4L9V A;  3H3Z A;  3VPR A;  1LDK B;  4L18 B;  2F4I A;  2V57 A;  3FKJ A;  1R23 A;  4M3D A;  2B3W A;  2VL8 A;  2IEK A;  1PUF A;  3JRB A;  5ICG A;  2F48 A;  4BHP A;  1STZ A;  4JK1 X;  3SZT A;  2UXO A;  2AQF A;  2LVS A;  3TO6 A;  3ZQG A;  1I1S A;  1OKR A;  4CYC A;  2E5N A;  5FFZ A;  2VKE A;  2CS3 A;  5EZG A;  1W0U A;  2ZOZ A;  1D5V A;  2A07 F;  1XDU A;  1YX3 A;  5J47 A;  4HW0 A;  5L3F A;  3TDZ C;  3F1B A;  1IDZ A;  1L0O C;  2ICW G;  3DWL E;  3RD3 A;  3GFJ A;  1IN6 A;  4HQE A;  2I10 A;  1WJA A;  1Z7L A;  2PN6 A;  5KAI C;  1OCO H;  3O8G A;  4NHJ A;  5FRO A;  5KCM A;  3VOD A;  2P8T A;  1FYL A;  3DPL C;  1IAW A;  3PNT A;  2DPU A;  2WGB A;  1RKT A;  2LRD A;  3JSO A;  1JI8 A;  3G1O A;  2IGO A;  1SVM A;  2DFI A;  1T33 A;  5C4X J;  3BZK A;  3WGI A;  2F6C A;  3W6V A;  1VQK I;  1P4X A;  5FKM A;  2CV0 A;  1UG2 A;  2L9R A;  3M8E A;  5LGN A;  1OMI A;  3V6G A;  2EZK A;  4RGR A;  4BBS J;  4XL9 A;  5F08 A;  5JVG F;  5IT9 K;  4HDU A;  2XRN A;  2DQR A;  4KIG A;  5HVQ C;  4P9U A;  1VQ7 I;  2WV0 A;  1ZEL A;  4JOM A;  2IA2 A;  2WAQ A;  3DPU A;  3EUK L;  3LSK A;  3ZQC A;  1CGP A;  2QQ9 A;  2QKO A;  2RQQ A;  5F04 A;  4YFN F;  5KK1 A;  3GUD A;  1IN5 A;  2BGC A;  2LF7 A;  3ZMS A;  2DMN A;  2H94 A;  4ZZD A;  3BWG A;  3BG9 A;  1ULY A;  3CCL I;  1ZAR A;  2R7F A;  3GZ5 A;  3IH3 A;  2ZFW A;  1X1B A;  4GFB A;  1I3A A;  5LGU A;  5FRM A;  2RAE A;  4MTE A;  1FIA A;  3RZD J;  1HCR A;  4M3E A;  4HF2 A;  1Y0N A;  5F1R A;  4ZYD A;  2DU9 A;  4I0B A;  1D5Y A;  1LNW A;  3E0J B;  2H1K A;  5M5Y J;  1XMA A;  3DEW A;  4OMY A;  3ABK H;  3KET A;  5E3L A;  4E4H A;  5HLH A;  3DQV C;  4PZJ A;  5J3L A;  2W4S A;  3FHZ A;  4UB6 C;  2Z33 A;  3OL4 A;  1X3U A;  2BW3 B;  4ESJ A;  3VVZ A;  2O7T A;  3ZQF A;  4IHW A;  1FP1 D;  4GO1 A;  3WU0 A;  2ADU A;  3L2W A;  2MH2 A;  3TOB A;  3IHU A;  3MZH A;  3M1C A;  3ZN0 A;  3RZO J;  4M74 A;  2X6Y A;  3N05 A;  2H09 A;  2KZG A;  3U2R A;  3WG7 H;  3COA C;  2N8G A;  1FMV A;  3COL A;  4HQM A;  2W48 A;  1UHW A;  1VI0 A;  2XAH A;  1VQ5 I;  4C3H J;  2UXH A;  3C7J A;  3RKY A;  5F0F A;  4AYB A;  4XLA A;  2NNN A;  2K86 A;  3HHH A;  1Z3X A;  2ETH A;  3O60 A;  2K4J A;  5CVU A;  2R5Y B;  1D1A A;  3L2V A;  4U87 A;  1DPU A;  3S3N A;  1Z77 A;  5LHG A;  1R4N B;  4DGW B;  1XMX A;  1FBU A;  2R7V A;  4FX4 A;  2O8X A;  2HOT A;  3KE2 A;  1OIS A;  3AG2 H;  3K4L A;  1MD0 A;  1ZR2 A;  3FWE A;  1BM9 A;  1BJZ A;  4BKX A;  5LHH A;  3NS4 A;  1YS6 A;  2CG4 A;  1OYI A;  3VOE A;  1OCZ H;  5B1B H;  1OYY A;  2LP0 A;  5B5E C;  1LDJ A;  4FT8 A;  4NC6 A;  2OQR A;  3WTZ A;  2BOL A;  4FAS D;  2DT5 A;  1FBS A;  1LUJ B;  1V3F A;  2Q8K A;  3IH2 A;  1BIA A;  3IAM 2;  1MDM A;  1FX7 A;  3IRQ A;  3AFH A;  4XN0 A;  4BQQ A;  2M7A A;  2XF6 A;  3TKY A;  3VSL A;  2AS5 F;  5AIP A;  3GTG J;  1VF9 A;  3ECH A;  5HS9 A;  3VB2 A;  1IV8 A;  2BEO A;  4S0H B;  2QKL B;  5BS6 A;  2EIN H;  2JMW A;  1J9I A;  4G7O F;  3ECO A;  1MMD A;  5E79 C;  3ZR8 X;  2MBF A;  3OYE A;  4EJW A;  3IV5 A;  1XX5 A;  3DKW A;  3OL3 A;  4NEL A;  2XPW A;  5C3E J;  1GVJ A;  2QQB A;  2FQ4 A;  4CGR A;  2JTV A;  1F36 A;  3HUG B;  1SFO J;  3SDG A;  3FXK A;  3TBI A;  3ZMD A;  1SMY F;  2D1H A;  3VDX A;  1PP7 U;  1X4O A;  2R3S A;  4U0W A;  4A69 C;  4KFC A;  1ZTR A;  4ZTJ A;  5DM7 F;  1QVT A;  2H1L A;  5LFA A;  2UXX A;  5FFX A;  5DCF A;  3SDB A;  2RRE A;  1T38 A;  4R8H A;  1FZP B;  2EZI A;  2KFD A;  2EZL A;  4KIB A;  5EGO B;  4II3 A;  5FD5 A;  1TWG J;  1RR8 C;  1UI6 A;  1TP4 A;  1TNS A;  3G71 I;  4LB5 A;  1JXS A;  2VQH A;  4PK4 A;  4F52 A;  1M1E B;  3HGG A;  1GVD A;  3CJN A;  5B3S H;  2IBD A;  4XON A;  1SD7 A;  2M4G A;  3E1S A;  2DXI A;  1R6R A;  4L0Y B;  2EFQ A;  4AVP A;  3FMS A;  2MC3 A;  5EFY A;  4XLH A;  4RLQ A;  3X2Q H;  2FEZ A;  4A0X A;  3CC2 I;  1BI0 A;  3GTJ J;  1NTC A;  3HTS B;  3LJL A;  2JRM A;  3V78 A;  3I55 I;  5FHP A;  2BXZ A;  4B8X A;  2HYT A;  2L7Z A;  4DYR A;  3EUH C;  5BQT A;  4P1W A;  2JZY A;  3M9A A;  3PL8 A;  5A2Q K;  1KYW A;  4I2O A;  5AON A;  3OS1 A;  2BVM A;  3S3O A;  1G3S A;  3KP6 A;  5GAH J;  3J81 Z;  1ACI A;  3HTI A;  1EH8 A;  1X3Z B;  2EIK H;  4DBQ A;  5DD8 A;  5L3G A;  1DDN A;  1VQ9 I;  1V4R A;  3H92 A;  2M8E A;  3GTQ J;  3F9K A;  5HOD A;  4DIQ A;  1QGP A;  1P92 A;  4IRI A;  2NP3 A;  2OC6 A;  1HW1 A;  3ZCO A;  2DLL A;  2KIU A;  4EEF G;  5IOZ A;  5IYB J;  3R6S A;  2ZNY A;  4I76 A;  3NXC A;  5HLI A;  2FF4 A;  1N77 A;  1KU3 A;  2F2E A;  4B44 A;  2Q24 A;  4LK1 F;  2YVE A;  3S1M J;  3PIO F;  4KIT B;  3HUG A;  3L00 A;  3CJR B;  4JNN A;  5LRS A;  2KQR A;  4IHY A;  1ZKG A;  2ZKZ A;  3CTA A;  4EJO A;  5D5X B;  2ELH A;  2V6E A;  5D6E A;  4XRF A;  4KIS A;  3OYA A;  3E7Q A;  1ZRC A;  3LSG A;  1YIO A;  2GA2 A;  2VQL A;  5GPC A;  4CCL A;  3H1C A;  1XS9 A;  1W7P A;  1JGG A;  2FNP A;  3E7L A;  1ZK8 A;  4A6D A;  3D5R C;  4YG2 F;  1JKP C;  1K6O A;  4GCK A;  5EGO A;  1I3Q J;  4A3F J;  5CYV A;  1Q1H A;  2W84 A;  3FMQ A;  3SHF A;  4D9J A;  2M8G X;  2LTP A;  2K3P A;  4M6Y A;  4ICH A;  3F8N A;  3HRM A;  1BI2 A;  1FOW A;  1FNN A;  2F4M B;  4BHB A;  2LY2 A;  2DA5 A;  1MBF A;  1ODD A;  1CQT A;  3ULQ B;  1YHQ I;  3EYY A;  3OYJ A;  2YU3 A;  3DEE A;  4BUP A;  5CLS A;  4CA0 A;  3S93 A;  2HVS A;  4LLG F;  4GFL A;  1ON1 A;  5M5W J;  1T0F A;  2K9S A;  2YX7 A;  4M72 A;  3UKG A;  3K4K A;  3PPB A;  3KP5 A;  4AC6 A;  2FUG 2;  2CQ7 A;  3QKX A;  5DDG A;  4A3M J;  5FLV A;  2JPC A;  4XRM A;  2G7S A;  1J5Y A;  2TDX A;  2VBY A;  1BBY A;  2MG4 A;  4J00 A;  2LDU A;  4XR6 A;  2YPR A;  2FSW A;  4LIT A;  4HLX A;  2XB5 A;  4A5M A;  4KUM A;  4KIC A;  3GEZ A;  4J01 A;  2KIS A;  1GV5 A;  2EQR A;  4AM3 A;  3A0H C;  2ELJ A;  4ZYH A;  2M45 A;  4WWC A;  4RAG A;  2TRT A;  2R92 J;  1LE8 B;  2XAF A;  1T98 A;  1FSH A;  5LD2 C;  2K3F A;  3BR3 A;  3I59 A;  3Q9V A;  2HQR A;  3BDD A;  3FXM A;  2X85 A;  1YQA A;  2W7N A;  3E5Q A;  2YU9 J;  1Z7U A;  3KZI C;  1G3Y A;  2IP2 A;  3A03 A;  3MKW B;  4BU2 A;  4NQW B;  2E1N A;  4G94 A;  1VZ0 A;  2CMP A;  2HDD A;  1USS A;  2YS9 A;  3DLL F;  3NAU A;  3V8J A;  2HXI A;  3TP0 A;  4IXA A;  5EF6 A;  4MEY F;  2BHZ A;  1HSJ A;  5DEQ A;  2ESH A;  2X0L A;  4ZZL A;  3OSF A;  1ZG5 A;  3QPH A;  5FKK A;  2M87 A;  1C0W A;  3VWB A;  2XGX A;  3A01 B;  4BQO A;  5ICE A;  2A61 A;  3CES A;  2HXO A;  1F43 A;  1R4M B;  3CMM A;  3QPL A;  2OTL I;  3HGY A;  2P7C B;  2QSG X;  2UUZ A;  4RAF A;  1UG0 A;  1NG7 A;  5LRR A;  4RM2 A;  3CLQ A;  5CKT A;  3AL0 B;  3C2G A;  1VND A;  2JQ7 A;  3BC8 A;  2M1B A;  4KT5 C;  1V55 H;  3VOX A;  1RR7 A;  2NP5 A;  5C44 J;  2X9D A;  4ZYA A;  1YG2 A;  1MBK A;  2X1D A;  2RC4 A;  3PSI A;  4PJM A;  2HYJ A;  3I56 I;  1BW6 A;  3LAP A;  4FX0 A;  1UJ8 A;  1VQL I;  3GLX A;  1B8I B;  2MGQ A;  2UZK A;  1KU2 A;  3KP7 A;  2WB1 N;  1YTY A;  3BPX A;  1IO2 A;  2M34 A;  3I0T A;  4LG3 A;  5K7F A;  2ZCX A;  3VW0 A;  2MSY A;  2HQA A;  1HXD A;  5D6F A;  3U9G A;  4IKF A;  2L54 A;  4J19 A;  3F22 A;  4GCT A;  3KZZ A;  2YSR A;  2LF8 A;  4RB0 A;  3PFY A;  3TW6 A;  2DQL A;  4HST A;  3VIB A;  1R22 A;  1RIO H;  2K7L A;  2HOS A;  4LD5 A;  4NB5 A;  4E6K G;  5IY5 H;  1PP8 F;  1P7J A;  3HZJ A;  4EJT A;  4IOC F;  1DGW Y;  1F1Z A;  1QHH D;  3GYH X;  2ZXI A;  3PQJ A;  3HIM A;  1R1V A;  3HOY J;  3CP8 A;  3R0A A;  3I4M J;  2FMY A;  3OYM A;  2DFE A;  4ESB A;  5HBU A;  3EQL F;  1ORK A;  2UXN A;  5EG0 B;  1I39 A;  2NVY J;  2NS0 A;  3T8R A;  2JSP A;  1YS7 A;  2PQ8 A;  3J80 Z;  1JJ6 C;  2FBK A;  3JRH A;  1K6Y A;  1R00 A;  3LSP A;  2NXN B;  4A2U A;  1JHF A;  4B09 A;  2OA4 A;  1NK2 P;  3EUH A;  2F5V A;  1I1G A;  3EDP A;  4MLO A;  3HOW J;  3F8F A;  4Y3O A;  3ZMU A;  4G6T B;  3V8K A;  1JGS A;  3D5S C;  4IPA A;  2OER A;  4LFU A;  2H8R A;  2M7B A;  4C3I J;  4A0Z A;  3EUP A;  4EV0 A;  4BBR J;  1A04 A;  1KQ9 A;  1LVK A;  1IDY A;  2EK5 A;  3A01 A;  2IW5 A;  1B9M A;  2ZNZ A;  4BH9 A;  4FTH A;  3QU6 A;  1A6I A;  3GFM A;  3DF8 A;  3KEO A;  2IA0 A;  2LKP A;  2VJJ A;  3BG6 A;  2NVU B;  2UXP A;  4Z2Y A;  4BQN A;  5J40 A;  3HOV J;  1TLH B;  2EV6 A;  4MGR A;  4TV7 A;  1RKW A;  1L3L A;  4LJZ F;  1ZQ3 P;  3K69 A;  2RNG A;  5FLX Z;  3TL4 X;  2FQ3 A;  2L7K A;  3G1L A;  4UUS A;  1OPC A;  4N9H A;  4Q4Z F;  3F8M A;  3S14 J;  3WTX C;  2OBP A;  2L01 A;  2PMH A;  5H2F C;  1S72 I;  4OIR F;  4F92 B;  1H88 C;  3CZ6 A;  1ZYR F;  3LSH A;  2VE8 A;  1IRG A;  3RQI A;  1BI1 A;  2HFH A;  3HSR A;  5M5X J;  5C4J J;  2PJP A;  4E70 A;  5D19 A;  2GWR A;  2FOK A;  2L2O A;  4GXO A;  1ETV A;  3C2H A;  5J4Y A;  4A93 J;  3P9K A;  3IC7 A;  4YII A;  1WJ5 A;  1U6G A;  2V9P A;  2O61 A;  2LNB A;  1FOY A;  3KLN A;  3U21 A;  5EDN A;  4AIH A;  2WAQ N;  3JAM K;  3MCZ A;  1W0T A;  1PUF B;  3P5J A;  5K7Z A;  5D1R A;  4WXD A;  1AA7 A;  5DV5 A;  1R71 A;  3F8B A;  3VFZ A;  1KA8 A;  3H3U A;  4WIB A;  3QRF F;  3FKI J;  3ABL H;  4XLC A;  4XOT A;  4IVN A;  1ZLJ A;  4MTD A;  3CUQ A;  4C2T A;  1XSD A;  3TP3 A;  3JCU C;  5EG0 A;  1EKE A;  2L02 A;  4K2E A;  3E97 A;  3PUF A;  3K8P C;  2WAD A;  4ESF A;  4HPQ A;  4XQF A;  4CXF A;  2L4A A;  4GRI A;  3WTW C;  5TRD A;  3OIQ A;  2MAB A;  3KKD A;  1U9N A;  3BPV A;  4MNU A;  1Q1V A;  4EJU A;  2OCC H;  1P2F A;  2OD5 A;  1IRX A;  3I5U A;  5BPD A;  2CGP A;  2AHQ A;  3WTU C;  2W1O A;  4IHX A;  2X1C A;  2V9K A;  2DJN A;  3NWT A;  2AXL A;  2BE5 F;  2OTJ I;  2DTZ A;  2BYV E;  3FMR A;  3S1Q J;  2CUZ A;  1YRN A;  2HTS A;  2HS5 A;  3CP2 A;  4CCM A;  1A35 A;  2JA5 J;  1TQP A;  2XDV A;  3BY6 A;  2A68 F;  1X1A A;  1PYV A;  3K1M A;  4RAZ A;  3FIW A;  4XKV A;  3SFI A;  4E7J A;  4O3M A;  2EIL H;  3KIO A;  2GEN A;  5HDN A;  4KT6 A;  3CCE I;  2STT A;  4Y4R A;  1SD4 A;  1A6Q A;  1D0Z A;  3VYU B;  1FOX A;  1FYM A;  2Y9Z A;  1U78 A;  1MJA A;  1QVU A;  2QEX I;  3SZG A;  1Y39 A;  4AYB N;  2XF7 A;  3GTM J;  3MWM A;  3K4C A;  4D7M A;  1VQO I;  3N4M A;  2XSJ C;  3PSF A;  3L2U A;  1RUN A;  3M8J A;  4CCK A;  2HTJ A;  2JJ7 A;  4Y7N J;  3BG7 A;  4A0Y A;  3LWJ A;  3VVX A;  4F93 B;  1IXR C;  2VE9 A;  4QLC U;  2LFB A;  2JUC A;  3PM1 A;  3G3Z A;  1E17 A;  2LKS A;  4B4C A;  2BBY A;  1NG6 A;  4OWR B;  3P9I A;  1SD6 A;  4ZYG A;  4FET A;  1OQY A;  5H20 A;  3O3K A;  2WY8 Q;  2A6T A;  4G8X A;  4IRV A;  1BN5 A;  2ME6 A;  4G12 A; 
#chains in the Genus database with same CATH homology
 3HB9 A;  3BHQ A;  2L7F P;  3CQZ J;  1RES A;  1WH7 A;  4M3F A;  3KNW A;  3A02 A;  5BNG A;  3IH2 A;  4M3B A;  3WHB A;  3OOU A;  1YRN B;  1A5J A;  3FIS A;  4AF5 A;  3AQS A;  1MBH A;  3ZQI A;  1JKQ C;  4IEJ A;  2COB A;  4XRS G;  2LR8 A;  2O9L A;  2NX4 A;  3VW1 A;  3GTG J;  1VF9 A;  2K40 A;  4S0H B;  2JMW A;  1SAN A;  1XC5 A;  4JX5 A;  2VKV A;  4A3I J;  1ZGW A;  3GTP J;  2XRL A;  4MO7 A;  5F0H A;  3IV5 A;  2JA6 J;  4NEL A;  1IJW C;  2XPW A;  5C3E J;  2DA2 A;  3JSJ A;  3CWR A;  2FQ4 A;  4BY1 J;  2OPT A;  4CGR A;  1F36 A;  4JX4 A;  1SFO J;  3SDG A;  3CMY A;  4XIC A;  3S1R J;  3S15 J;  4X1E A;  1FTZ A;  3M4O J;  2G0E A;  2DMT A;  2ECB A;  2RAS A;  3JRI A;  3OSG A;  4NN1 A;  3Q0U A;  3VVY A;  4A69 C;  3CRJ A;  1ZTR A;  3BQY A;  1QVT A;  1Z0X A;  2WV1 A;  1WGX A;  3MKL A;  3LHQ A;  4JP0 A;  2OI8 A;  1ETY A;  2CUF A;  2R7Z J;  3HTJ A;  3B81 A;  1X2M A;  4MFD A;  1K61 A;  2EZI A;  1BL0 A;  1NK3 P;  2EZL A;  5EGO B;  2R93 J;  5IP6 A;  5HAW A;  3KZ9 A;  5D18 A;  2D6Y A;  4DYQ A;  1TWG J;  1UI6 A;  4JL3 A;  1VFC A;  3MN2 A;  3LNQ A;  4C2M J;  3WHC A;  3HGG A;  1GVD A;  2UXU A;  2IBD A;  5K7H A;  5M3F J;  2CRG A;  3BTC A;  5HSZ A;  2TCT A;  2P81 A;  2AO9 A;  3NAR A;  4MIM A;  1RPW A;  2Y9Y A;  1B72 B;  2M2E A;  3M3Y J;  5EFY A;  3JRD A;  4A3B J;  2REK A;  4ME9 A;  3GTJ J;  1NTC A;  1TC3 C;  3LJL A;  3V78 A;  2Y31 A;  5IYC J;  5FHP A;  3D1N I;  2HYT A;  1MBG A;  2L7Z A;  4DYR A;  2VUM J;  4MXM A;  2CU7 A;  1FJL A;  2YVH A;  2QTQ A;  2ME0 A;  2JN6 A;  1S7E A;  3BNI A;  5J1Y A;  2GM4 A;  1MBJ A;  3HTI A;  1BW5 A;  4YZE A;  3B6A A;  2B63 J;  4D7N A;  2OF7 A;  1IC8 A;  1H8A C;  3GTQ J;  2GFN A;  1SGM A;  1ETK A;  5HOD A;  5CW8 A;  5GP9 A;  1P7I A;  2NP3 A;  4HNV A;  1MSE C;  3TW7 A;  1WCM J;  1JUS A;  3IH4 A;  5FKO A;  5JLX A;  4EEF G;  5IOZ A;  5IYB J;  2XGE A;  4RDU A;  3F0C A;  4I76 A;  3BG5 A;  1TWH J;  2WUI A;  5H9T A;  3NXC A;  3B6C A;  2EBI A;  4B3A A;  2Q24 A;  2YVE A;  2ZCM A;  3S1M J;  1UMQ A;  3MNL A;  1GV2 A;  2FX0 A;  2DA3 A;  4HKU A;  5IPA A;  5AQC A;  4JNN A;  1ENH A;  3K2A A;  3ZQH A;  2DMQ A;  4IHY A;  1ZKG A;  4FE7 A;  1I50 J;  2Y2Z A;  3BTI A;  2GUH A;  1LFU P;  3E7Q A;  2XPV A;  3LSG A;  4M3G A;  1RET A;  2Y30 A;  1GDT A;  5IYD J;  5C4Y A;  3NRG A;  3HEF A;  5GPC A;  1XS9 A;  4A3D J;  1JGG A;  1APL C;  3E7L A;  1ZK8 A;  2DN0 A;  1ETO A;  2QIB A;  4D5F A;  1JKP C;  4DZJ A;  1TWA J;  4GCK A;  5EGO A;  1I3Q J;  4A3F J;  1EF4 A;  3C07 A;  2XDN A;  3CCY A;  1LE8 A;  5FKL A;  1ZR4 A;  2EH3 A;  1AU7 A;  2M8G X;  2QCO A;  3C2B A;  2LTP A;  1MH4 A;  5M3M J;  1IGN A;  2D5V A;  4ICH A;  2DA1 A;  1HOM A;  1WPK A;  3AQT A;  3BTL A;  2ZCN A;  2DA5 A;  1E3O C;  2G3B A;  2E1O A;  1MBF A;  1CQT A;  3ON4 A;  3JRF A;  1JTX A;  3BR6 A;  5EZH A;  1AHD P;  2IAI A;  1B72 A;  4GFL A;  5M5W J;  2X6O A;  5E3N A;  2K9S A;  4UUT A;  5JLW A;  3UKG A;  4A3C J;  3PPB A;  4AC6 A;  4JKZ A;  3QKX A;  1IUF A;  1K83 J;  4DZP A;  2E2J J;  4A3M J;  1WH5 A;  5FLV A;  2PMZ N;  2LLK A;  4XRM A;  2G7S A;  4FE4 A;  3FRQ A;  2L0K A;  3QBM A;  5IOY A;  4GFK A;  2MG4 A;  3MVP A;  3PAS A;  2HOA A;  3JR9 A;  3G7R A;  4XK4 A;  4KWA A;  3T6N A;  2HI3 A;  2ID3 A;  5EEA A;  3ZQL A;  2XB5 A;  4JX6 A;  2M9H A;  3G56 A;  1Y1W J;  2NVX J;  3BRU A;  5FJ8 J;  2PBX A;  1GV5 A;  2EQR A;  2QOP A;  2MW8 A;  1R9T J;  9ANT A;  2TRT A;  3S2D J;  2XGC A;  1MNM C;  1LE8 B;  2R92 J;  3KKC A;  3TED A;  4XRS A;  4BY7 J;  5J1R A;  3BR3 A;  1B8I A;  2W53 A;  4AUX A;  3BQZ A;  1UHS A;  2YU9 J;  5FMP A;  3A03 A;  4RBO A;  1I6H J;  5DAJ A;  3G1M A;  3HTH A;  3NNR A;  2ECC A;  2HDD A;  4MFE A;  1DU6 A;  2YS9 A;  2G7G A;  3NAU A;  3ANG A;  3H0G J;  2FJ1 A;  2HXI A;  3TP0 A;  5EF6 A;  1JKO C;  5F0C A;  3HE0 A;  3OIO A;  3QQA A;  1AKH A;  2JA7 J;  3HDD A;  2NS7 A;  4W1U A;  3OSF A;  4IHV A;  3VP5 A;  5FKK A;  5FGL A;  3A01 B;  1HLV A;  4B1R A;  4AC0 A;  3Q0V A;  2HXO A;  1QRY A;  2VPR A;  1IG7 A;  3PO3 J;  1F43 A;  3QPL A;  2CUE A;  5DS9 A;  4CYC B;  2LD5 A;  3HGY A;  3S1N J;  2L7M P;  2IU5 A;  5GPA A;  1JKR C;  3JRG A;  3S17 J;  2XSD C;  3BR0 A;  3H3V K;  1XG1 A;  4C3J J;  2HQ5 A;  1G2H A;  5FKN A;  1GUU A;  2E2H J;  3P9T A;  1VND A;  1BA5 A;  1O4X A;  3VOX A;  2NVT J;  3BR5 A;  1RR7 A;  4A3K J;  2NP5 A;  3CDL A;  2LKX A;  5C44 J;  1IV6 A;  4L5E A;  2X9D A;  4LOC A;  5FLM J;  1MBK A;  3BT9 A;  1FIP A;  1X58 A;  2HYJ A;  4A3G J;  2O8K A;  1BW6 A;  1TWF J;  1H89 C;  1GT0 C;  1B8I B;  2MGQ A;  1UI5 A;  2WB1 N;  2M34 A;  5K7F A;  2XGD A;  2ZCX A;  3S16 J;  3K7A J;  3GTK J;  2CJJ A;  3VW0 A;  2MSY A;  5E3M A;  4XID A;  5IP7 J;  3HOX J;  4DYC A;  4M6V A;  3HOZ J;  4J19 A;  4Y52 J;  3S5R A;  2YUS A;  4GCT A;  3BR1 A;  5DTD A;  2KT0 A;  3TW6 A;  3VIB A;  1MH3 A;  4JYK A;  2HOS A;  1AKH B;  1P7J A;  3NPI A;  2JWT A;  4A3E J;  1JT0 A;  1HDP A;  3ANP A;  4UDS A;  1JUM A;  2DMP A;  1ETW A;  3HIM A;  3ZOB A;  3HOY J;  3LSR A;  3I4M J;  2X48 A;  3BTJ A;  4BXX J;  1MBE A;  3HOU J;  5F1J A;  3BG3 A;  5HBU A;  1DU0 A;  3S2H J;  1WI3 A;  2DMU A;  1ORK A;  5EG0 B;  2DA7 A;  2NVY J;  3HM5 A;  1OCP A;  4I6Z A;  2DG7 A;  2DA4 A;  1MSF C;  5J1U A;  1FEX A;  1JJ6 C;  5IP9 J;  3JRH A;  3Q0W A;  1Y1V J;  3LSP A;  2E2I J;  3GZI A;  1NK2 P;  3RKQ A;  2VI6 A;  4MLO A;  3HOW J;  3GTO J;  3JRA A;  3VPR A;  3LSJ A;  2V57 A;  2JK3 A;  4X6A J;  1QPI A;  4M3D A;  2R5Z A;  2OER A;  2DG8 A;  2IEK A;  1PUF A;  2H8R A;  3O8H A;  4C3I J;  3JRB A;  3GBG A;  3EUP A;  4BBR J;  1IDY A;  3A01 A;  2UXO A;  4ABZ A;  3JRE A;  2LVS A;  3ZQG A;  4FCY A;  3QPS A;  4QTR A;  4CYC A;  1JUP A;  5E3O A;  1A6I A;  2VKE A;  5EZG A;  4FTH A;  1W0U A;  3PO2 J;  2GLO A;  2ZOZ A;  2G7L A;  2LY9 A;  2UXP A;  3HOV J;  4W97 A;  1HDD C;  5K58 A;  1OFC X;  3F1B A;  3FK7 A;  1RKW A;  2ELK A;  1IDZ A;  1ZQ3 P;  3RD3 A;  3CJD A;  3BR2 A;  3G1L A;  4UUS A;  2EZH A;  3VUQ A;  2I10 A;  1HF0 A;  3S14 J;  3O8G A;  2FD5 A;  2E19 A;  5EYR A;  2F07 A;  1RKT A;  2NOG A;  2XB0 X;  2WGB A;  3G1O A;  3L1P A;  1H88 C;  1T33 A;  5C4X J;  1FTT A;  2Y0S N;  3W6V A;  1JJ8 C;  3RQI A;  3NI7 A;  5FKM A;  5M5X J;  2M0C A;  5C4J J;  3BJB A;  2CQX A;  1UG2 A;  2DA6 A;  2L9R A;  1X2N A;  5D19 A;  3V6G A;  2EZK A;  1ETV A;  4BBS J;  5F08 A;  2R0Q C;  4A93 J;  2XPU A;  2O7O A;  1JT6 A;  3IUV A;  2QWT A;  1LFB A;  2R5Z B;  5EDN A;  2UXI A;  2WAQ N;  4D5C A;  3ZQC A;  1W0T A;  1PUF B;  5K7Z A;  5D1R A;  2QKO A;  5F04 A;  3VW2 A;  1T56 A;  2DMN A;  3FKI J;  2R5Y A;  3RH2 A;  2HKU A;  1ETQ A;  3TP3 A;  2KDZ A;  2K9N A;  3BG9 A;  4DW6 A;  5EG0 A;  2ZOY A;  3IH3 A;  4QSH A;  1U8B A;  4GFB A;  3DPJ A;  2RAE A;  3RZD J;  1FIA A;  1HCR A;  4A3J J;  4UUS B;  4M3E A;  1D5Y A;  3GEU A;  3KKD A;  2JA8 J;  1U9N A;  4MK6 A;  1Q1V A;  5F27 A;  2H1K A;  3ON2 A;  1TWC J;  5M5Y J;  5CXG A;  3DEW A;  2PZ9 A;  4GCL A;  2AHQ A;  4NDL A;  2QF7 A;  1ETX A;  5E3L A;  2CQQ A;  4IHX A;  1IRZ A;  3HTA A;  5J3L A;  2DJN A;  1OCT C;  4ACI A;  1OJL A;  3GTL J;  3VOK A;  2DTZ A;  3DCF A;  2O7T A;  3VVZ A;  3S1Q J;  1YRN A;  3ZQF A;  2K9Q A;  4IHW A;  2NS8 A;  2JA5 J;  2ID6 A;  2GBY A;  2GEN A;  3FIW A;  2RHA A;  3SFI A;  3RZO J;  1POG A;  4QIW N;  2NVQ J;  2FBQ A;  5CXI A;  2N8G A;  1ITY A;  3COL A;  2Y9Z A;  1U78 A;  2W48 A;  1QVU A;  1VI0 A;  4FIS A;  4C3H J;  2UXH A;  4PXI A;  3HKZ N;  5F0F A;  4AYB N;  3JRC A;  3SJM A;  1U9O A;  3GTM J;  3LOC A;  4D7M A;  4L62 A;  4A3L J;  3O60 A;  2R5Y B;  2JJ7 A;  4Y7N J;  2ZB9 A;  3LWJ A;  3VVX A;  1Z77 A;  3BCG A;  2LFB A;  2HOT A;  3PM1 A;  3I4N J;  3EGQ A;  1ZR2 A;  1JTY A;  2LK2 A;  4B4C A;  4V2F A;  3Q3S A;  1BJZ A;  4BKX A;  3HBL A;  3FK6 A;  2LP0 A;  4V2G A;  2ME6 A;  4G12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...