1JT6A

Crystal structure of the multidrug binding protein qacr bound to dequalinium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical transcriptional regulator IN QACA 5'region
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 81
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt6A02
1Y1VJ 2RASA 1MBFA 4JL3A 1PUFA 2XSDC 5F0CA 1X58A 3T6NA 4C3JJ 3QPSA 1W0UA 2ZOZA 2H1KA 2MW8A 3B6CA 2LP0A 2W53A 3NXCA 5EG0B 4B4CA 3B81A 5JLXA 1GT0C 2N8GA 3F0CA 2I10A 2H8RA 3B6AA 3L1PA 2Y30A 5IYDJ 3CMYA 1WGXA 4A3BJ 5IOZA 4IHXA 3GTGJ 2Y9YA 4DYCA 1WCMJ 2WAQN 5IPAA 3OSGA 3COLA 1MBKA 1AKHA 2DA5A 1F43A 3BR3A 2HQ5A 1U9OA 3HM5A 4RDUA 3BQYA 2Y2ZA 3RQIA 2OPTA 1Q1VA 4M3FA 3PO3J 1UI6A 2NVYJ 2YU9J 2IAIA 3JRDA 3TW6A 3ANPA 1MBGA 2DA3A 1BW6A 2ZCXA 1IJWC 1RETA 3S2DJ 1QVTA 4BBSJ 3HTAA 1X2MA 3BRUA 3ZQCA 3LJLA 4M3GA 2OF7A 2Y0SN 2CUEA 4IHYA 1RESA 1MH3A 1MNMC 1ETWA 1I50J 3BG9A 2G7LA 5K7FA 2HYTA 3VP5A 1QPIA 3SDGA 1YRNB 2L0KA 1FIPA 2NVTJ 2JA8J 4B1RA 1VNDA 2FX0A 4D5FA 3GTMJ 5D19A 4XIDA 1OJLA 1RKTA 3AQTA 4UUTA 3IV5A 5F1JA 3BHQA 3G1OA 2LK2A 1VI0A 1OCPA 1CQTA 3SJMA 3JRHA 4V2FA 2X6OA 2ZCNA 4UUSA 5CXIA 3VW2A 4PXIA 1B72B 5M5WJ 2K9SA 3E7QA 5J3LA 3F1BA 1XS9A 5J1RA 1Z0XA 2DA6A 3QQAA 3OOUA 3NARA 2DJNA 1B8IB 2R5ZB 1TWHJ 1SFOJ 3A01B 4A3IJ 5FKKA 2NOGA 3BG3A 4I76A 5F0FA 3VOKA 1AU7A 1MSFC 2XB5A 2HOTA 4J19A 4W1UA 4IHWA 3GTQJ 2ECBA 2ZB9A 2DG8A 1MBEA 5EG0A 4A3CJ 4A93J 2YUSA 2ID3A 2UXHA 4B3AA 3HOXJ 2P81A 5F27A 3TP0A 2WB1N 3NAUA 2XPUA 2DA2A 3JREA 4AF5A 2HXIA 5D1RA 2PBXA 2XPVA 2TRTA 4AUXA 3GEUA 5FGLA 1ENHA 2Y31A 3GZIA 5F08A 4L62A 2WV1A 3M3YJ 3W6VA 4FISA 1ETQA 4CYCB 3IH2A 1DU6A 4MK6A 2EZLA 4XK4A 1XG1A 1GUUA 2KDZA 5FJ8J 3EGQA 3MN2A 1JKRC 2GLOA 1MH4A 1WH7A 4LOCA 3K2AA 2DG7A 4GFBA 2FBQA 3NPIA 1SANA 2XPWA 5FHPA 1VF9A 1U9NA 2VI6A 1S7EA 4BBRJ 2QTQA 2D5VA 3C07A 3VVYA 4DYQA 2PMZN 3CCYA 3CQZJ 3HB9A 2VKEA 2E2HJ 2L7FP 2QF7A 4JX6A 4HNVA 2QIBA 2IBDA 1YRNA 3BTIA 3FK6A 1JUMA 2R93J 2M34A 1H88C 1WH5A 2LFBA 1A6IA 2JA7J 1ZQ3P 3V78A 5DTDA 3IH3A 1I6HJ 4AYBN 4ACIA 3OIOA 5AQCA 2DMUA 2QWTA 3RKQA 9ANTA 3O8HA 3HE0A 2G0EA 2RAEA 2JA6J 2M2EA 2AO9A 2CQXA 5DAJA 3BR2A 2PZ9A 4MIMA 4JX4A 3GBGA 2JMWA 1B72A 5M5YJ 3ZQGA 1JKPC 1Z77A 2R0QC 1TC3C 4A3KJ 2VUMJ 5D18A 1FIAA 5K58A 2OERA 5JLWA 3BTCA 1X2NA 1ETVA 4M3BA 3VIBA 3JRCA 3IUVA 1B8IA 1NK2P 2R5ZA 2LR8A 2DA7A 1JKOC 2JJ7A 4RBOA 2K9QA 1ZR2A 2JWTA 4Y52J 3WHCA 4MXMA 4DZPA 2XGEA 1LE8B 1BJZA 4L5EA 2O8KA 1QVUA 2JN6A 2ECCA 3CRJA 1NTCA 1APLC 2JK3A 2M8GX 2DMQA 3BQZA 1IGNA 5C4XJ 1TWAJ 1R9TJ 2LD5A 1H89C 4D7NA 1T33A 3DEWA 3HOWJ 1UG2A 1IDYA 4IHVA 1MBHA 3LWJA 2IEKA 3Q0UA 5FKNA 5E3MA 3ANGA 3LSGA 4FE7A 5EZGA 4QTRA 2QOPA 5IP9J 5IP6A 4DYRA 1JUPA 3MVPA 3HIMA 1POGA 1FTZA 4X1EA 1JJ6C 3S14J 1OFCX 2HXOA 3JRGA 1HF0A 2IU5A 2GENA 2HOSA 2GBYA 4KWAA 4CYCA 3FIWA 3VVZA 2DMNA 1DU0A 4XRSG 3WHBA 1O4XA 3EUPA 2E1OA 3VOXA 2X48A 2DTZA 2TCTA 1PUFB 1HLVA 4A3GJ 2GFNA 5C4YA 1T56A 2O9LA 2O7TA 2YVHA 3BR0A 3BNIA 2CJJA 3BT9A 2DA1A 1QRYA 1BA5A 2LVSA 2HYJA 3M4OJ 4GCTA 2D6YA 3GTJJ 2NX4A 1GV2A 2L7MP 3JRFA 2L7ZA 2XB0X 3I4NJ 5HBUA 3JRAA 4MFEA 4BY1J 2EZKA 1RR7A 2AHQA 2MG4A 5C4JJ 3CWRA 4MFDA 4JKZA 2ME6A 4DZJA 3S16J 1IV6A 1K61A 4HKUA 3TW7A 2DMPA 1FEXA 2HKUA 2UXOA 3DPJA 2X9DA 2R7ZJ 3QKXA 5EF6A 3BJBA 2DMTA 5IP7J 1TWGJ 1IUFA 3TP3A 1Y1WJ 4AC0A 1P7IA 1IC8A 2EZHA 3S1QJ 1IRZA 2GUHA 1ETKA 3RZOJ 2G3BA 4ABZA 2VKVA 5EGOB 2DA4A 3ZQIA 5IYBJ 2LTPA 4A3FJ 2O7OA 2FD5A 1XC5A 2KT0A 4MLOA 2XRLA 3HTHA 2JA5J 3O60A 4M3EA 5FKOA 5E3NA 1JT0A 1WPKA 4NN1A 3S1RJ 2K40A 3D1NI 2XDNA 3FKIJ 3RH2A 3GTLJ 3FRQA 2CUFA 1I3QJ 4M6VA 3Q0VA 3HTJA 2CQQA 2R92J 3S1MJ 3O8GA 1JUSA 1JTXA 3RD3A 1LE8A 4A3DJ 1P7JA 3ZQHA 4Y7NJ 2L9RA 2DN0A 1JGGA 3TEDA 1AHDP 4IEJA 3VW0A 1GV5A 2ME0A 3S5RA 1ORKA 4JYKA 3V6GA 3VUQA 2B63J 1HDDC 3C2BA 3K7AJ 3HTIA 3IH4A 4MO7A 2YS9A 3NI7A 2HOAA 4GFKA 2UXIA 2NS7A 1ZR4A 2MSYA 3NNRA 5FLVA 1IG7A 4UUSB 4XRSA 1TWCJ 1LFUP 3BG5A 5CXGA 2YVEA 3KNWA 1NK3P 5E3OA 2LKXA 3HOUJ 2NP5A 3P9TA 4QSHA 5FKMA 1G2HA 4XICA 3MNLA 1RPWA 2M0CA 3S2HJ 5IOYA 1IDZA 5C44J 2ZCMA 2Y9ZA 2R5YB 1HDPA 4A3MJ 1UI5A 3A02A 4XRMA 4M3DA 3VVXA 5DS9A 2Q24A 5F0HA 4JNNA 4I6ZA 2ELKA 2NP3A 1ZTRA 5M3FJ 5FMPA 4A3LJ 4S0HB 1FTTA 3A01A 1W0TA 3HDDA 2FQ4A 5EDNA 1BL0A 3VPRA 2G7GA 3HGYA 2MGQA 2RHAA 3G56A 1LFBA 1H8AC 5M5XJ 1GVDA 4V2GA 3LSJA 4D5CA 3ZQFA 3HOVJ 4C2MJ 3OSFA 3H3VK 3ON4A 5H9TA 1WI3A 3FK7A 3ZOBA 1ETXA 2EZIA 2NS8A 2REKA 3QPLA 1OCTC 3GTPJ 5EGOA 1HOMA 5FLMJ 2QKOA 3LSRA 3Q3SA 1U78A 2XGCA 4BXXJ 4D7MA 2WUIA 2NVXJ 4GFLA 3G1MA 1K83J 3BTLA 3HEFA 3KKDA 1UHSA 3NRGA 2EBIA 1ZKGA 4A3JJ 5K7HA 5GP9A 1UMQA 3CDLA 5F04A 4FTHA 4C3HJ 2EQRA 5EZHA 4FCYA 3A03A 5CW8A 4QIWN 2FJ1A 3PO2J 4CGRA 2EH3A 3ZQLA 3VW1A 3DCFA 3JSJA 3PASA 3G1LA 3HGGA 4EEFG 2W48A 3PPBA 1JJ8C 3SFIA 4G12A 4NDLA 3HOZJ 2ZOYA 2OI8A 3KKCA 2UXPA 5IYCJ 3Q0WA 4A3EJ 2M9HA 5C3EJ 2UXUA 2CRGA 5EEAA 4X6AJ 5M3MJ 3S15J 3BCGA 1SGMA 4ICHA 2E19A 1F36A 3AQSA 4BKXA 3BR6A 2E2JJ 2G7SA 3KZ9A 3BR1A 1AKHB 4AC6A 5J1YA 3HOYJ 5E3LA 1RKWA 1VFCA 1ETYA 2COBA 3BTJA 4ME9A 1JTYA 3QBMA 2HI3A 2R5YA 4JP0A 1JKQC 2CU7A 3MKLA 4DW6A 4FE4A 1ZK8A 1MSEC 3S1NJ 5HSZA 1JT6A 1ZGWA 4GCLA 3BR5A 3JRBA 4YZEA 1GDTA 1FJLA 1BW5A 3JRIA 1A5JA 4C3IJ 2QCOA 3LSPA 3E7LA 5K7ZA 3H0GJ 5J1UA 2XGDA 1EF4A 2WGBA 3ON2A 3HBLA 2HDDA 5EYRA 4BY7J 3LOCA 5GPAA 4A69C 4NELA 5EFYA 1TWFJ 2GM4A 4JX5A 2NVQJ 1MBJA 3PM1A 4W97A 3JR9A 3S17J 5GPCA 3GTKJ 5FKLA 3UKGA 3GTOJ 2K9NA 3HKZN 3FISA 1ITYA 2F07A 3LHQA 2E2IJ 4UDSA 2LLKA 1D5YA 2VPRA 1HCRA 2ID6A 2V57A 3LNQA 1E3OC 5BNGA 1ETOA 3I4MJ 3CJDA 5HODA 4GCKA 1U8BA 3G7RA 2LY9A 5HAWA 3RZDJ
chains in the Genus database with same CATH superfamily
4R1HA 5J6XA 3LSMA 1MBFA 2KRFA 4C3JJ 3RYPA 3QPSA 2MW8A 2LF7A 2VOOA 2XVCA 3NXCA 3VYUB 2VT3A 2BY2A 5EG0B 3B81A 4HLXA 5JLXA 2N8GA 1Z1DA 4CCNA 2K9LA 3B6AA 5EJCA 1VQKI 1TLHB 3E3VA 4UNOA 1WGXA 4IHSA 2VQLA 2NYXA 3R60A 4DYCA 3K4BA 1EKEA 4DBQA 3OSGA 3GFLA 3JTHA 3COLA 1MBKA 3DKXA 2DA5A 3GFMA 2HQ5A 3HM5A 5HOOA 4IL6C 2DFEA 3CESA 3DQVC 2HVSA 3WE2A 1ACIA 2CWEA 2IAIA 3CF2A 2R7DA 3QPTA 3TW6A 4A0XA 3ANPA 4KJZA 1MBGA 3GMEA 1BW6A 2V9PA 5TISC 5D4SA 2ZCXA 4BHBA 4ENKA 3S2DJ 3PQKA 3R61A 3H36A 4QWQA 1D1AA 3ZQCA 2PFBA 2Z99A 2HFHA 2RNGA 1KGSA 4B09A 2AQFA 4LK1F 5DV5A 3CJQB 3DBRB 2OU2A 2WA0A 2X6YA 1YW9A 3EUAA 3H9QA 3J81K 4WIBA 2VKHA 3VYSB 4L18B 1G4DA 3SDGA 1SVMA 4GXOA 3GFIA 2QENA 1OPCA 2HYGD 2FX0A 2OQGA 4B1RA 4D5FA 3GO5A 2PBIA 3FBIB 3BHQA 3DFGA 2EA4A 3IKVA 1R5ID 1VI0A 2BW3B 2X6OA 2V9KA 4HQEA 3OS1A 4PXIA 3IRRA 1F4KA 5J3LA 2L54A 2M7BA 1SMTA 2R7FA 1W36C 2DJNA 4ZDPA 4E7IA 3CLOA 2FU4A 3DWLE 3HKZA 2CQ7A 2LH9A 4BQAA 4Z6YA 2HQRA 2GA2A 3BG3A 4HV6A 1MSFC 3TO9A 4J19A 1FC3A 3CO7C 3ZMDA 3I55I 5HNHA 1MBEA 1FMVA 1I3AA 2H6CA 4HX8A 5E79C 2PG4A 4AU7A 1JHHA 3LSKA 4Y15A 2P81A 5A2QZ 2MH9A 1FYKA 1ZARA 1O7FA 2EILH 2M1BA 5TGTA 1SMYF 2PFVA 2EV6A 1L0OC 3LWFA 4AF5A 2R7SA 4A12A 2ESNA 2JPCA 3DP7A 2F5FA 4KT6A 2VT2A 3K4LA 4C2MA 2P7CB 1OYWA 1XB4A 3ZPLA 3KYDB 1ENHA 3TDZC 1RUOA 3M3YJ 4XR6A 1ETQA 1DU6A 4MK6A 4RGRA 4CZCA 2EZLA 5HS7A 4N9IA 1D0ZA 1STZA 4L9NA 3C2GA 2QVOA 3MN2A 3RYRA 4HG2A 3PSIA 1JKRC 2GLOA 3U2RA 1MMNA 1RZ4A 1SANA 2XPWA 1U5TC 1BOBA 2NRAC 3SZPA 2MH2A 2K9MA 3BY6A 1LDKB 1FT9A 4KIGA 2K4JA 4UVAA 3VVYA 3C07A 5AIPA 1D0XA 4EJWA 2QF7A 4WF2A 4JX6A 2QIBA 2VJ4A 3FK6A 1S7AA 5FFXA 1H88C 1WH5A 3L2UA 3OYNA 2QQ8A 3HPHA 2M5WA 3VODA 3V78A 5DTDA 3IH3A 4EJVA 4AYBN 4U7DA 1IF1A 4HLYA 3OWTA 3HRTA 1PUEE 4HEA2 2QWTA 4O5VA 2LBFA 2A2FX 1LDDA 3KLOA 3FMRA 2G0EA 2DFFA 1S3JA 5E18F 5IT9K 3BR2A 3V7CA 1MDMA 1KYZA 3AAFA 5M5YJ 3CMAI 2ACJA 3PQJA 3MKZA 1W1WE 1JKPC 1TC3C 1LEAA 1FIAA 1REPC 4DJAA 5JLWA 2W4SA 4JQFA 4EM1A 1X2NA 3BZKA 2F48A 3JRCA 5K5RA 1PJRA 1XPXA 4RGSA 4I99C 1YJNI 2R5ZA 1B8IA 2K02A 5FFZA 4LB5A 1QQIA 4RBOA 3RQ4A 2JWTA 3VYRB 2R7OA 1G3SA 4HSTA 1BJZA 4LITA 2DYSH 3OR1C 3SQNA 2ECCA 3KP7A 3BQZA 3SZTA 1U2WA 2FUG2 3DEWA 4HOBA 4UB6C 1MBHA 1O3RA 2HPMA 2F6CA 1SD6A 1R1UA 1WRJA 2AXLA 3LSGA 3BZCA 1FYLA 2DYRH 5EZGA 5EEGA 3HTUA 1T98A 2JTVA 4XOPA 4DYRA 3HIMA 4BGDA 4PCQA 1D1CA 2EFNA 1UJ8A 2MC4A 3JRGA 1V5GA 1HF0A 2LSOA 4IRIA 2X6WA 1O3QA 4KWAA 5GAEJ 3T0YA 3TMOA 3FIWA 3OOPA 4XRSG 4M74A 4BQNA 4S04A 2TCTA 1HLVA 3WGGA 2L02A 3GW2A 3HOSA 1DUXC 2O9LA 2O7TA 4RM2A 1SFUA 3BT9A 1U5TB 1ZYRF 2V6EA 1DGWY 3W6KB 1HQCA 4LMYA 3DTIA 3QRFF 4FHTA 3MAJA 1HW1A 3V8JA 2L7MP 3JRFA 1T39A 5AONA 4MFEA 2KL4A 3T5XA 2HZTA 4LK0F 3PJRA 3PNVA 1X1CA 1B59A 4DZJA 1YOVB 4HKUA 5ILSA 3CUOA 2A5YB 3TW7A 4G8XA 3DPJA 3RPUD 1T08B 1XDUA 3QODA 2Z9OA 4CZZA 3QYFA 1P7IA 2EZHA 1IRZA 5CYVA 1ETKA 1WJCA 2F4MB 2DJIA 2ELJA 4MTEA 4KNYA 2DA4A 3HSRA 3FF5A 2O7OA 4IXAA 1XC5A 4KUMA 5JHUA 1GHCA 4XLHA 4MLOA 1MKMA 2XRLA 2JA5J 4M3EA 5FKOA 2O5RA 2HTSA 4MHGA 1HBXG 4C9YA 3GTLJ 3LSTA 1X1DA 4AM3A 2CUFA 1OCZH 4M6VA 3Q0VA 5K1YA 1X4OA 5E20A 3V8KA 5B66C 3IRQA 3HTSB 3O8GA 2R92J 1WJFA 1J0RA 3K10A 4HBLA 1LE8A 1KU9A 1P7JA 3KP2A 5DM6F 4C2TA 2XUBA 4LIUA 2VN2A 2DN0A 1JGGA 3VW0A 4IEJA 2XV4S 1IN8A 1OKRA 2P6TA 4JYKA 4I0BA 4U7BA 3V6GA 2JPBA 1MW7A 2B63J 3HJEA 3U21A 3L7WA 3IAS2 2CH0A 2QKMB 2WAFA 2HOAA 2UXIA 2JQ7A 2WTEA 3U1KA 3NNRA 2VASA 2UXNA 3PL8A 1E17A 3FXOA 4LGWA 2YVEA 2O03A 2OCEA 3HOUJ 5E3OA 2LKXA 5LGNA 1S5LC 2M0CA 1VQ5I 3S2HJ 4UVBA 4XKWA 2MA3A 5ICCA 2AS5F 5HLTA 1UHWA 3I56I 4IOCF 3LAJA 5IY5H 3FXJA 3HHHA 4R8HA 2GXAA 5FLXK 4NQWA 5D6FA 3CUQB 5GTHC 1F5TA 3H9JA 5JFRA 3A02A 3O2PE 4IJAA 5D5XB 3JAMK 4ZYEA 5JI6A 5DS9A 4GDFA 3I71A 4JNNA 4I6ZA 4LG0B 5M3FJ 3CCQI 4HA8A 5FMPA 3GZ6A 4A3LJ 1FTTA 3E5QA 4ENNA 1IRXA 3I3LA 4NBQA 1BL0A 4YFNF 2QGUA 2G7GA 2MGQA 3F8FA 3QP6A 2ZJRF 1J59A 3NS4A 1IZ1A 3IKTA 3J7AY 2E60A 2NXNB 1LFBA 3CZ6A 4YG2F 5M5XJ 4V2GA 3LSJA 2DPUA 4C2MJ 4ETSA 1WHUA 3ON4A 3HOTA 1ETXA 2EZIA 2F4IA 3CJTB 4RGXA 4RB0A 2REKA 5JHFA 1YW7A 1OCTC 4C2UA 3C1DA 2B1EA 1R5HA 4PFOA 2QKOA 3ZXSA 1DGRM 3TKYA 5DUIA 4L9VA 1SD5A 3Q3SA 3LSRA 2XGCA 3IC7A 3ROUA 1CGPA 2VKDA 3C2HA 3HEFA 3K2ZA 2MBFA 2HPIA 4MGRA 3KKDA 2ZJQF 4HNUA 4XORA 1HW2A 1UMQA 3HSFA 4Y33A 3ECHA 5F64A 1LUJB 5LHGA 4U9LA 2EQRA 3N05A 1BR4A 3QU3A 2FJI1 2P0WA 5FROA 3ZP5A 4CGRA 2EH3A 3WU1B 2V4JC 3KYLA 3VW1A 3JSJA 2OBPA 3DTEA 3PASA 1IXCA 4PJLA 2W48A 4EEFG 4OIPF 2XKOA 3ABKH 2EK5A 3PPBA 2E7WA 4NC7A 4NDLA 4PJ0C 2XGXA 1CF7B 2ETHA 2UWMA 2KZVA 2M9HA 3FHZA 5C3EJ 2EA2A 4A5MA 4ICHA 2D1HA 1J09A 3PFIA 3RCOA 4BKXA 2FBIA 5HDGA 3BR1A 3ZMUA 1W36D 2VE9A 1GXPA 3FBNB 3HOYJ 4AIHA 2X51A 1I1SA 3K4CA 3JTGA 1ETYA 4ME9A 1HKTA 2XROA 3G73A 2QYOA 3QBMA 3EDPA 4KYWA 2QLZA 2P5VA 2HQAA 2GOXB 1AWCA 5HLGA 1ZK8A 2IJLA 3ZMZA 5HSZA 1JT6A 3R0AA 1BIAA 1ZGWA 4GCLA 3BR5A 4LD5A 4A2UA 4CCKA 4YZEA 2HDCA 1SFXA 2IGKA 1FJLA 4ZZLA 4HRIA 1MD0A 2L4MA 2DPDA 3K1NA 2Z5UA 3ULQB 2W1OA 4C3IJ 4UXNA 2CW0F 2QSGX 2CQKA 5J1UA 2XGDA 3V7SA 4DNCA 1MNEA 2WGBA 2IPQX 3HBLA 4PFPA 3HRMA 3MFKA 1OR7A 1KONA 1TP4A 4A69C 1JHFA 2K4BA 2O8XA 3VFZA 2WC2A 1LFPA 2OD5A 3PM1A 1XGMA 1BI2A 1T95A 4KFCA 2XAFA 3GTOJ 4ZYHA 5L3FA 2OAZA 4U0WA 3GX4X 1DP3A 3FXRA 3NWTA 3FWEA 1FOWA 3GF2A 3CC2I 3A2KA 2QQAA 3ZMSA 4MEXF 1HCRA 2ID6A 2FSWA 2RDPA 2Q8KA 4PSXA 4RLQA 2COMA 5BNGA 5GAGJ 1E3OC 4GCKA 5HAWA 3JCUC 5F6FA 3PIPF 3GFJA 4TV7A 3DU6A 3AFHA 1WJEA 3W2VA 4JL3A 3P9IA 1PUFA 3F8CA 4N0BA 3FM5A 4ZYGA 5IT9Z 3B6CA 2HZDA 3CDIA 3CCEI 2LF8A 4U9NA 2L5QA 1S7OA 1SC7A 2Q0OA 4B4CA 1K78A 2QA4I 1P4WA 2DOFA 3L1PA 4M9SA 3CMYA 1YW8A 5IOZA 5J8FA 4ZDLA 1P2FA 3LFUA 3OYCA 3KFWX 1Y0UA 5IPAA 3OYAA 4N4NB 1F43A 4CCLA 3BR3A 3WTSC 1U9OA 2KJBA 2BHYA 2Y2ZA 4XLEA 3RQIA 3J7AO 1UI6A 2NVYJ 1UCRA 2E5ZA 2L9SA 2M30A 5HS9A 3OYFA 1HC8A 2DA3A 4HYEA 5EEHA 1VQLI 3HYIA 2DT7B 3BRUA 2STWA 2P5LC 1LB2A 3DLAA 3SDBA 2FEZA 1MNMC 1MH3A 1FP2A 3J80K 5LLQA 5TRDA 1XX5A 3OYDA 4D0PA 5K5QA 3OYEA 5FRMA 1YRNB 2L0KA 2QBYB 4FQGA 4NNJA 1VQ6I 2BOLA 2JA8J 2Q2EB 1VNDA 3ZMVA 4XIDA 3M07A 1D8KA 1RKTA 1GXQA 3A0BC 3WODF 3AQTA 1P92A 1UZCA 1WWXA 1OCRH 2A68F 2QUFA 2OC6A 3I59A 2LK2A 4F92B 1FY7A 4BQOA 3SJMA 3JRHA 2PMHA 1TQIA 4UUSA 4HF0A 1SAXA 3LSHA 2BEOA 1KU3A 2RQPA 2LY1A 4XM3A 3SZGA 3DEEA 4E7ZA 3F1BA 1W7PA 2VC0A 1IRGA 3OOUA 4IPAA 3K1PA 3ERED 3RPQA 1LQ1A 3PNTA 3KEQA 4J00A 4RAYA 1SFOJ 1XN7A 3K69A 1TW3A 3VOKA 2DK8A 2Z33A 2XB5A 4JOMA 4PZJA 1ZLKA 4W1UA 2LYCA 2PQ8A 5LHIA 2ECBA 4YIRX 1QNTA 2XIGA 4WXDA 5E1ZB 4Y4RA 3CMEI 4OIRF 3OL4A 2FF4A 1RRJA 2M8EA 3A4CA 5FD5A 2C6YA 5F27A 1ZH5A 2WB1N 3X2QH 3D5SC 2XPUA 2QSFX 2HXIA 2E1NA 4AYBA 3IWZA 2XPVA 3GEUA 5HDKA 1KQ9A 1XGOA 2QZ8A 3ZGKA 3GZIA 2VBZA 3W6VA 3EUHA 1XCVA 4BEHB 2QSHX 2ZKZA 2GWRA 4OIQF 3AL0B 1MJBA 4FASD 1TT0A 5ICEA 3OYBA 1JI8A 3KYCB 3EGQA 1XMAA 3K2AA 2ZFWA 4YFKF 2OQRA 4IKFA 1QHHD 2CW8A 3CD6I 3A1YA 2QWWA 3E5XA 2DK5A 1WJDA 1V54H 2D5VA 5KK1A 1MMGA 2PMZN 3CQZJ 3L2VA 2VKEA 4HNVA 2IBDA 2BVLA 3BTIA 2R93J 2L7KA 2XF5A 6PAXA 1R6RA 2LFBA 1IN4A 4BACA 3OIOA 1ZHFA 5AQCA 2RV8A 9ANTA 3MWMA 3O8HA 2IW5A 5CJ9A 2M2EA 2CQXA 1R23A 2W24A 5BQTA 4ESFA 2PZ9A 3NEUA 4MIMA 1B72A 3ZQGA 1DQUA 2XF7A 5J40A 4RB1A 1IV8A 2EPFA 2R0QC 2JRTA 3C7JA 2VUMJ 4CDGA 4XLAA 1EA3A 2OERA 1WJBA 2W82A 4M3BA 3IUVA 3OYIA 1VQ9I 1SVLA 2DFHA 1A36A 2DA7A 2JJ7A 4U87A 2K9QA 2ZMEA 3UR3C 4Y52J 2VLAA 2VL8A 3ONQA 3WHCA 3V4GA 2L3DA 3I4PA 4LLGF 2E1CA 2O8KA 1O3SA 3K9TA 4XMYA 2VXZA 1VQ8I 1IGNA 2XAHA 3AG3H 4CSWA 1WSUA 4V19K 1T33A 2A6TA 4IHVA 1IDYA 1VQ7I 2ZXJA 2KMUA 5B5EC 3HUGA 3K6GA 1BR2A 2ESHA 2XAUA 2QOPA 2K3PA 1JUPA 2VQCA 1W5TA 4X1EA 1JJ6C 1OFCX 1SFEA 2VE8A 3CCLI 1V4RA 4CYCA 3H0DA 2DMNA 3EPZA 4UV8A 1O4XA 3EUPA 1RIOH 5GAHJ 3P7NA 2BHZA 2X48A 2X85A 2ZSHB 1ZREA 1H9TA 1PUFB 4A3GJ 4GYGA 2XRNA 4DVYP 2YVHA 3ZCOA 3BNIA 4HF2A 1U8RA 3CP2A 2TDXA 2LVSA 2HYJA 4PSWA 4UHTA 1BA5A 4GCTA 3D5LA 3GTJJ 2NX4A 3KIOA 2XB0X 4LLLA 3F6VA 3RKWA 2MG4A 2OZUA 4YIFA 5BPDA 2ME6A 1RUNA 3S16J 3SEQA 1MZBA 3BLYA 1IAWA 3QKXA 5EF6A 3DTKA 3ABTA 4XKBA 4HQMA 5L3CA 4WWCA 1XCBA 2CMPA 3ZMTA 4BNCA 2GUHA 1T0FA 3DXJF 2HVQA 3MEXA 3RZOJ 2HKOA 4EV0A 1XGSA 1Z7LA 2VKVA 5EGOB 4KMFA 3ZQIA 1USSA 2LTPA 2X1DA 5IYBJ 2FD5A 2K86A 4EM0B 3COAC 4ZTFA 2EFOA 1BJAA 3OV8A 4BU2A 2PJRA 3HTHA 3O60A 1LJ9A 3HSEA 5E3NA 4RAZA 2R7WA 2IS4A 3H5AA 4CXFA 3S1RJ 5D6EA 2R7RA 1YE9A 4IRHA 2XC7A 2XDNA 1YG2A 3FKIJ 3CDHA 3FRQA 4O6JA 2M4GA 2CQQA 3ECOA 3KLNA 1JUSA 1JTXA 2DO7A 1O7LA 3WG9A 3ZQHA 3GYHX 2YVXA 4KISA 2KRHA 2PLYA 1AHDP 3TEDA 2EV5A 2A69F 2QM3A 2UXXA 3LA2A 4B44A 1ORKA 3VUQA 3DF8A 3OMYA 1HDDC 3C2BA 3K7AJ 3HTIA 3CLQA 3IH4A 5H20A 1W4MA 4MO7A 1TNSA 3CF5F 3NI7A 4AVPA 4GFKA 2KIUA 2W84A 5DCMA 2NS7A 1ZR4A 2MSYA 2F2EA 1IG7A 1YI2I 4UUSB 2XDVA 4BAYA 4XRSA 1LFUP 3BG5A 3RIRA 3I54A 5CXGA 5L3DA 4P55A 1S72I 3KNWA 3HXLA 1NK3P 2OJED 2E34A 4HZFA 1G2HA 2Z16A 4XICA 1RPWA 5IOYA 1IDZA 3KZYA 1Y56A 3TDUC 2IRFG 2R5YB 1IRFA 1ODDA 3L2WA 1R71A 3QP5A 1TW2A 2EJRA 2D45A 2I8DA 1BOAA 3SFZA 1R4MB 4CUGA 1IN5A 2FMYA 1TNTA 2ZFUA 3VVXA 3J7ZI 2CV2A 2ELKA 2NP3A 1ZTRA 2V7FA 1IO2A 3NRVA 4S0HB 3A01A 4U88A 2LRDA 3LL7A 2DW4A 3PSFA 3VPRA 3FM3A 3H5NA 2WY8Q 3ABUA 3M8EA 5DUKA 1GVDA 1OMIA 3E6BA 3LA3A 3M8FA 5D4RA 1R00A 3REOA 3HOVJ 5D5UB 1X3ZB 1WI3A 1LPQA 3ISPA 2IT0A 3J80Z 3QPLA 2G7UA 4BH9A 3ZRGA 5FLMJ 1LEBA 3CTAA 2STTA 4BXXJ 4OMZA 2J5OA 4H0EA 2NVXJ 3G1MA 4L5IA 3BPXA 4AIJA 3BTLA 4DGWB 3H1CA 4OAYA 4MEYF 4Q5SF 4II2A 5BOXA 1ZKGA 4A3JJ 3E0JB 2VIXA 5GP9A 2VBXA 1QHGA 2MABA 3CDLA 5HLIA 4C3HJ 2RKHA 5EZHA 3RSNA 2L2OA 5CW8A 4ANJA 1RNLA 3ZQLA 1P6RA 5DD8A 4PJJA 4AVZA 3DCFA 2CG4A 3SHFA 2BY1A 1TL8A 1PVEA 2F4OB 3SXYA 2KDOA 2BZTA 1R1VA 4M72A 1T0FC 2K3FA 2KRCA 3Q0WA 2P7VB 4AD9A 2UXPA 4YRVA 1A6QA 2CRGA 3KP4A 3M7GA 4LB6B 4I2OA 5EEAA 4HF1A 4X6AJ 3S15J 3GCMA 2E19A 1F36A 2E35A 3TO7A 3AQSA 2BXYA 2E2JJ 3KZ9A 3KPHA 1FOKA 1DDNA 4RA2A 5J1YA 4MQ9F 4KDPA 1VFCA 2ELHA 2COBA 5ILVA 1JTYA 5DCFA 4AIDA 3FXUA 2KISA 4IVNA 2MD0A 2DBBA 2E7XA 1VQNI 1V3FA 3KZIC 2CFXA 1W5SA 3MKLA 4FE4A 1T8IA 3IAM2 2ZCWA 4XSZF 3S1NJ 3GZNB 4ZYDA 3JRBA 2WBMA 1HSJA 2VC1A 4BHPA 1SEUA 4OIOF 2O61A 1G59A 1FX7A 1G3YA 1A5JA 4JK1X 2DI3A 3H0GJ 2BVMA 1WI9A 3ON2A 2MYSA 3MD2A 2WV0A 3HUGB 4MQVA 2VPLA 5EYRA 1D5VA 3LOCA 5GPAA 3GZ5A 4I09A 3DLLF 4NELA 1TWFJ 2GM4A 4BUPA 1U3EM 3B73A 1M1EB 1XMXA 4E7HA 4L9JA 4W97A 1P9QC 2IS6A 1X1BA 2FA5A 3HKZN 3E1SA 5GADJ 2E2IJ 2LLKA 5DM7F 3CO6C 3T1BA 2JT1A 2OUMA 1X19A 3EQLF 2RC4A 5HODA 1U8BA 3G7RA 2KIFA 1OLTA 3RZDJ 3TGNA 2V26A 1VQMI 3WGIA 2RASA 4Y13A 1X58A 3FZVA 5CPRB 4P9UA 2DQLA 2YX4A 5L3GA 2H1KA 1MNDA 3H9GA 4F93B 3VDXA 5E1WA 4P96A 3BCBA 2I10A 2H8RA 3O3KA 2M7AA 2Y30A 3JSOA 4A5NA 2X1EA 4IHXA 5CVVA 3FMQA 3IUOA 1R7JA 4DIQA 2Y9YA 4ESJA 4PDKA 1R36A 2PEXA 2Z2SB 1AKHA 2VODA 2JRMA 3TOBA 3BQYA 4Q4ZF 2LC2A 1Q1VA 4M3FA 2GA1A 2H8WA 3JRDA 2MFZA 2OTLI 1G3TA 1YQAA 3FHNA 2A6HF 1IJWC 1QVTA 2IVMA 2BV6A 3J81Z 3HTAA 4HAMA 4MTDA 2V79A 4YEJA 1UB9A 4M3GA 2OF7A 2Y0SN 1E2XA 2CUEA 4IZZA 4FX0A 4OMYA 1I50J 3BG9A 3E97A 3K8PC 2VONA 3KE2A 4XL9A 2G7LA 2L9NA 4XLCA 1YLFA 2EFWA 5K7FA 3IL2A 2VXDA 1YX5A 5DD4A 1WKMA 5DCMB 5ERIA 2ISZA 1JGSA 1W7PD 1G6NA 3HHGA 1G3WA 1G8XA 1OJLA 2A5WA 4UUTA 3IV5A 5F1JA 2LBFB 3G1OA 3M1EA 3CC7I 1CQTA 2JVHA 2DODA 4CH7A 1A31A 3ZQ7A 1R58A 1BIBA 1MDMB 4PJMA 2HGCA 1JXSA 3F23A 2BY3A 2A61A 1TQPA 1FOXA 4G94A 5M5WJ 2K9SA 3OIPA 5J1RA 1Z0XA 3QQAA 1BC7C 3W2WA 2M0MA 3NARA 4IRGA 4F55A 4BQQA 1QO0D 4EGYA 1B8IB 2R5ZB 1EJ9A 3VOEA 4QLCU 3A01B 3P5JA 4XLFA 1Z67A 2HU9A 4IRVA 2NOGA 4I76A 5F0FA 1OCCH 3E6MA 3K0LA 3KEYA 4HX7A 1ZRFA 1V5FA 2RVCA 3VEPA 2DG8A 5EG0A 4A93J 2YUSA 2IA2A 2LREA 4YFXF 4NC8A 2M87A 2UUZA 4B3AA 3Q9VA 2WY7Q 3D0SA 2PMZA 4GGGA 2XF6A 5HVQC 4FT8A 4BE0A 3NAUA 3BPVA 2DA2A 2EB7A 5TJJA 5D1RA 1KA8A 4KT5C 2IGOA 3BZ6A 5CQGA 2LOOA 1T38A 4XRFA 2TRTA 4CCOA 5FGLA 1X3WB 3S93A 2WV1A 4A0YA 3WU0A 4FISA 3T8TA 4XK4A 1B1BA 1BI3A 2Y48A 1GUUA 2JUGA 4X0GA 3V8LA 2KDZA 2QQ9A 4IQ4A 2IXSA 3HRSA 5CVRA 1MH4A 4LOCA 4F3QA 1S6LA 3NPIA 1UG0A 1VQ4I 2L9VA 1VF9A 3DV8A 1U9NA 1Y6IA 4BE1A 1N78A 1QZYA 2VI6A 4B43A 2DOAA 2DOEA 3L00A 1S7EA 3QU6A 2DDAA 1LNWA 1ON2A 1J2XA 5LRRA 4DYQA 4HV5A 4UV9A 3CCYA 3HB9A 2R7TA 1Z6RA 4CGZA 4OD4A 5L3EA 2M34A 2VJ5A 5KHDA 2JUCA 2V1DA 4D1QA 1ZQ3P 5FO5A 1AOYA 5ILUA 3RKQA 3K1MA 3GVAA 1YITI 2HS5A 4E7JA 2F5VA 3S3MA 1U0JA 1XD7A 2BY0A 2JMWA 2GOMA 3UNGC 1IUYA 5LGUA 1XSXA 2VB6A 4PK4A 4G7HF 4A3KJ 5D18A 5DYMA 2FQ3A 4EJUA 1ETVA 3VIBA 4UUVA 4M6XA 5CLSA 2LR8A 1YS7A 2NS0A 2YX7A 2RNJA 1JKOC 2R4GA 1ZR2A 4ZC3A 1MMDA 5HDNA 1LE8B 5ICFA 1IN7A 4BXUA 1QVUA 1S29A 3CRJA 4ESBA 2H27A 2JK3A 2DMQA 4HX4A 4WX9A 1TWAJ 2LD5A 4IOAF 1Y8QB 1H89C 2LDUA 3HOWJ 1UG2A 3LWJA 1WJAA 3AG2H 4FE7A 5IP9J 5JVTA 2VBWA 2XASA 2VQHA 2K5CA 3F8BA 4F91B 5AIQA 4S05A 3S14J 2HXOA 3F8MA 4OOIA 1E3HA 4EM2A 3MKWB 2IA0A 1KQ8A 2IU5A 3MZYA 2E71A 3FXKA 3H92A 4XLNF 2P5KA 4OINF 2EFQA 3WHBA 3WU2C 3VOXA 2E1OA 1FPQA 3WTYC 4NQWB 4EGZA 5C4YA 4UVCA 3KETA 3I53A 4E7LA 4D9JA 2DA1A 2KIMA 2JVGA 4U0YA 2P4WA 2D6YA 2D2WA 2V1XA 4Q48A 3I4NJ 4ENMA 2EZKA 5C4JJ 2AHQA 2PI0A 5E17F 2ZJ2A 4KN4X 2WWYA 5HS8A 2UZKA 3BJAA 4JKZA 2M3AA 3L2RA 2CSOA 5BS6A 1OR7C 3I5UA 1H0MA 1E3PA 2LG4A 2DMPA 1FEXA 2HKUA 4B8XA 2YR2A 2UXOA 4BYYA 1I5ZA 1WQ2A 4KIBA 2FXAA 1P4XA 4N4OB 4PJNA 4RLFA 1YHQI 1J5YA 1HA8A 1Z05A 3M9AA 1Y1WJ 4AC0A 1IC8A 3R0JA 4BL0B 1EH8A 3K4KA 3DBLB 4NC6A 2NAZA 2GIVA 1Y0NA 3MKYB 1F1ZA 4M9XA 2KT0A 3H3UA 1R1TA 5JVGF 3KX2A 2GIZA 1WPKA 4NN1A 5B1BH 2HYFA 3MCZA 3D1NI 3K4MA 3RH2A 5LGTA 1LKXA 1Y8RB 3CCJI 4DBRA 3HTJA 2KKOA 3T8RA 4I0AA 3S1MJ 4BE2A 4Y7NJ 3AKZA 2L9RA 2O3FA 3RDIA 2ZO4A 3S5RA 3WTVC 4P9FA 4G7ZF 1MMAA 3V42A 2IGMA 2YS9A 4IHTA 4RM3A 5FLVA 4XKCA 2XHKA 2GZWA 2DTRA 1TWCJ 3LFKA 1S9HA 5FLXZ 3OYMA 4QPOA 2MLGA 2DDBA 1W5CC 2FE3A 2ZNZA 3P9TA 4E6KG 4QSHA 3P9CA 3JAMZ 5LHHA 5LRSA 3MNLA 1KU7A 1Z3XA 2FMLA 4JBAA 3VB2A 2MC3A 4CCMA 1EH6A 4XBFA 1ZGAA 5HLHA 4EATA 2JSPA 2F5CA 1HDPA 3SEZA 4A3MJ 2CGPA 2W00A 2P6SA 3OS2A 4BJTA 1B4AA 1ERDA 4BS9A 2VJJA 1K7AA 2Y75A 2KFDA 1U5TA 4BDYA 4M3DA 2Q24A 1FBSA 3E6CC 5D5VB 3CCVI 4WCGA 3HDDA 3TO6A 5EDNA 1BR1A 3H5RA 3HGYA 3RJPA 3L09A 3G56A 1YJ9I 2KP6A 4ZZDA 4BXFA 1FWZA 1YS6A 4XONA 1XDSA 3ELKA 4D5CA 3OSFA 4ZDOA 3FK7A 3Q9SA 2NS8A 2RQQA 4HDUA 4OD5A 1TQMA 5B3SH 3BG6A 3I0TA 3GTPJ 1HOMA 1OQYA 2GQQA 4ZJZA 3H3ZA 1QU3A 1R4NB 3S32A 4IQJA 4IX7A 2X4HA 2A3SA 3WGHA 4H4KC 1Z9CA 1ULYA 2WUIA 3K70C 1K83J 2YU3A 1BI0A 3OL3A 3L9FA 5FRNA 1ON1A 1I39A 5KVRA 3NRGA 3HC7A 2OZ6A 2FOKA 3K4NA 5F04A 4FCYA 3A03A 2FBHA 2FJ1A 4K2EA 2HNHA 2DAOA 3FXLA 1B9MA 3RTRA 3OYJA 1IN6A 4HDVA 1K78B 3G1LA 3HGGA 3PIOF 3CCSI 1LDJA 1JJ8C 1IXSB 1S8NA 4G12A 2OI8A 4L9TA 4A3EJ 1B9NA 1H9GA 3AG4H 3BWGA 3WG7H 2RGVA 4A6EA 1XMKA 4BJ6C 4HNTA 5J4VA 1SGMA 1Z6TA 1RC9A 3BR6A 4OU0A 4Y3OA 2J5PA 2VOPA 4CYDA 1UHMA 3A0HC 4AC6A 5E3LA 5E8GA 2M4KA 1RKWA 4M6YA 3EUHC 3LSIA 2LY2A 1USTA 3VWBA 2QQBA 4U0VA 3IWFA 1XSDA 1MMSA 1SAUA 2CU7A 3CUQA 3F22A 2PN6A 1TZLA 3MMYB 1MSEC 4ASNA 3ABLH 3U9GA 4Q47A 1ZG1A 1GDTA 2FBKA 2CYYA 4LG0A 2QCOA 1T2KA 3E7LA 5K7ZA 3G4SI 4XLPF 1KZHA 2P8TA 1EF4A 4BHCA 1NG6A 4XN0A 2EIKH 2Z1DA 2HDDA 2KPMA 4BY7J 1N75A 2LKSA 3C18A 3GLLA 1OISA 2NVQJ 2OTJI 3FX3A 1MBJA 1ZG5A 4M71A 2NNNA 3I59B 2ICWG 2ZXHA 3LA7A 5KAFC 5GPCA 3GTKJ 5FKLA 3UKGA 3HL2A 2X6XA 3QOPA 2HOEA 2K9NA 3BJBA 3FISA 3LHQA 1BI1A 4XOTA 4NUBA 1WZ2A 1FBQA 1D5YA 2VPRA 4R79A 2V57A 4KA4A 3LNQA 3CJDA 1QA6A 1W7PB 4CHUA 1O57A 4WXHA 3IHUA 3G71I 1VTNC 1Y1VJ 2H94A 1V55H 4YELA 1KYWA 2ZMEC 1D3YA 2XSDC 5F0CA 3BG7A 3T6NA 4QPQA 1W0UA 2YSRA 2ZOZA 1LVAA 2RN7A 3SYTA 2LP0A 2GAUA 2Y0SA 4GYIA 2W53A 4WXCA 3TQNA 1SFKA 1YFHA 1GT0C 3F0CA 3CC4I 5IT3A 5IYDJ 1CF7A 3EYYA 2DT5A 4LJZF 4A3BJ 3F3XA 3GTGJ 1RI7A 1U6GA 3LQQA 5FGMA 3WE3A 3K4JA 1WCMJ 2WAQN 3P9KA 4RDUA 1J9IA 1F9NA 2ZNYA 2OPTA 3PO3J 1MGTA 3Q5FA 2YU9J 1QZEA 1FYMA 3RI4A 3DU5A 4RB2C 3VTIA 2A07F 1UFMA 1RETA 3TOAA 4EJOA 1YJWI 2H1LA 2W25A 4L0YB 4BBSJ 1X2MA 5LD2C 4B47A 3LMMA 3LJLA 3E5UA 1TBXA 2XAGA 2ZJPF 4IHYA 1RESA 4EMSA 3BCAA 4IF4A 1ETWA 3DKWA 4GO1A 2A05A 2HYTA 2EWNA 2JA2A 4KN7X 1PDNC 3CCMI 4N9HA 3VP5A 2X1CA 1QPIA 2ADUA 1T6SA 4J01A 1GLNA 1FIPA 1XTAA 3OR2C 4IO9F 2CUJA 3FDYA 5J4YA 2NVTJ 1KQ0A 2M45A 2R3SA 3GTMJ 5D19A 1AA7A 3DBHB 2E5NA 3O6BB 5E1XA 5B1AH 1VQOI 1QBJA 2OV7A 3PUFA 4KIFA 2I5UA 1OCPA 1EH7A 2EIJH 3BOQA 3HG9A 4V2FA 1FLIA 4F7ZA 2ZCNA 1IXRC 5CXIA 2LNBA 3VW2A 2Q1ZB 1B72B 3BC8A 4KICA 3CUQC 3I9V2 4XN3A 3W6JB 3CJRB 2LKPA 4II3A 4B3XA 3E7QA 5KCMA 5D8KB 1XS9A 2DA6A 2DFIA 5FB2A 2NNYA 2KIQA 2CS3A 3CP8A 4M9ZA 1TWHJ 4AIKA 4PUSA 4A3IJ 2GXGA 2ZMEB 4FETA 5FKKA 3HRUA 1AU7A 1L3LA 2HOTA 2K85A 4IHWA 3GTQJ 2VJIA 2DLLA 1ZN2A 2ZB9A 3I58A 4A3CJ 3EYIA 2ID3A 2XKPA 3OYLA 2UXHA 3HOXJ 4I98B 3OY9A 2V6CA 3FKJA 3TP0A 3RKXA 3LAPA 2ISYA 3JREA 1FZPB 1R49A 3D5RC 1WFXA 1ZRCA 1HSTA 1XSVA 4RAFA 2PBXA 3M8JA 3B02A 4AUXA 2Y31A 3G2BA 5F08A 4L62A 2ZC2A 4EQQA 4LG3A 4CYCB 1DPRA 3IH2A 2IGNA 4UY8I 1NHAA 1XG1A 4I02A 1FMWA 1LVKA 3V7RA 5FJ8J 1FOYA 1WH7A 2FBQA 2DG7A 4GFBA 1K4SA 3IP4B 2R7QA 1SVOA 5CKTA 2CO5A 1D1BA 5FHPA 2XAQA 2IP2A 3KP3A 2KQRA 4CO8A 5GTIC 2HDWA 2LMDA 4BDZA 4BBRJ 4ON0A 5D5WB 2QTQA 4KMUX 3J7YJ 2E2HJ 2NOJB 2L7FP 5J47A 4FX4A 3I64A 5F1RA 3OYKA 4GCVA 1YRNA 1JUMA 2QBYA 3TBIA 5KNLA 1TTYA 3EETA 4E7KA 1XGNA 1A6IA 3CJNA 2Q2EA 3BJOA 4F52A 3H35A 2JA7J 2R7XA 1I6HJ 4ACIA 2CUZA 5L3BA 2DMUA 4CICA 3ZQQA 1OCOH 3HE0A 4LFUA 2RAEA 3NQOA 2JA6J 1YO5C 3EUKL 2AO9A 2MLKA 1C0WA 2DXIA 5DAJA 4JX4A 3GBGA 3ASOH 2R7VA 3DEUA 2HWVA 3WTWC 1Z77A 3MZ8A 2B9SA 2PJRB 5K58A 1I27A 1MIJA 3BTCA 2D1VA 2W85A 1HKQA 2ZBKA 2O0YA 3S2WA 4Z2YA 1NK2P 3CCRI 5H6QA 1X1PA 2VBYA 5CVIA 2O6GE 4L0ZB 5DEQA 1DPUA 2XAJA 4MXMA 2DQRA 2XGEA 3C3WA 4DZPA 2KZGA 2OCCH 4L5EA 2B3WA 2JN6A 1NTCA 2H6BA 1OYYA 3GLXA 1APLC 2AXTC 2M8GX 1FSHA 3GUDA 5C4XJ 1R9TJ 2HVRA 4RGUA 3QYEA 4C30A 4D7NA 5BMZA 2EV0A 2DCEA 2IEKA 3Q0UA 2E1MC 4O3MA 5FKNA 2CFOA 5E3MA 3HIFA 1NH3A 3ANGA 1YTYA 1DP7P 4PGGA 2PX9A 3VSKA 4QTRA 3K70D 5IP6A 3MVPA 1POGA 1FTZA 3BJ6A 1X3UA 2KJCA 4G9YA 4NHJA 2GENA 4EVIA 4DQ2A 2HOSA 2GBYA 2F5DA 1A04A 2BGCA 3VVZA 2UV1A 4BEHA 3HZJA 4XNFA 1DU0A 2WB1A 3WTXC 5ED4A 2DTZA 2ZXWH 2GFNA 1T56A 3BR0A 3F6OA 2HEOA 2CJJA 4L5JA 1FSEA 1QRYA 2IS2A 1BBYA 3M4OJ 1GV2A 3DPTA 5HBUA 2L7ZA 4G6DA 3JRAA 4BY1J 4E7SA 1RR7A 3CWRA 4MFDA 1FP1D 2FOWA 3G3ZA 3KEOA 3PUBA 5JR3A 1IV6A 2K7LA 1K61A 1KU2A 5ICGA 1ONVA 2V1NA 1MJAA 3FXQA 2AQEA 2X9DA 2PMUA 2R7ZJ 5CVUA 2DMTA 5IP7J 1TWGJ 1IUFA 2VQGA 3TP3A 4AWXB 3W2AA 3S1QJ 2G3BA 2V1UA 3N97A 3QPHA 4ABZA 5D8LB 1D0YA 4ZH4F 4OAZA 4A3FJ 4G6TB 3KZZA 4P1WA 1BM9A 1ZGJA 1JT0A 5A2QK 2EFPA 1UAAA 3RPUA 3GXOA 2K40A 3ZN1A 1P4AA 2FRHA 5H6RA 3ML6A 4M73A 1I3QJ 2BXZA 2ZXIA 3ZR8X 3RD3A 1I6XA 4A3DJ 1YIOA 2K27A 1WJ5A 3WTZA 1NG7A 4P5OA 4RMNA 3F21A 3ZN0A 2A6EF 5CQEA 5LBQA 2L4AA 2ZY9A 1GV5A 2XSJC 2ME0A 2WADA 3BDDA 4ITVA 3MQ0A 3S3OA 3BROA 4BJ5C 4YIIA 2E1MB 2HTJA 4XSXF 4DOZA 3JSPA 1J75A 4RS8A 3L2QA 1BC8C 2G9WA 4PGHA 1Z21A 1VQPI 4RB3C 1A35A 2NP5A 2IA1A 2BW3A 5FKMA 1I1GA 4I01A 2CW7A 5C44J 4MNUA 5H2FC 3HPGA 3R4KA 2Y9ZA 2ZCMA 2V9VA 2W7NA 3OIQA 3OS0A 1SD7A 1MJ9A 3PNYA 1UI5A 3QYBA 3DKYA 2MD5A 2HQNA 3W3CA 3VSLA 3GEZA 1HW5A 5E8IA 4OWRB 4XRMA 4RAGA 2KLOA 2Y69H 1EV7A 5F0HA 1X1AA 3KP5A 2JZYA 1YX3A 2DU9A 1D8JA 3LQRA 1UELB 1W0TA 1Z3YA 3F72A 2FQ4A 3R6SA 3ERMA 2GXBA 1V5EA 5HNFA 2RHAA 4ZYAA 3PFYA 1Q1HA 2CV1A 1H8AC 4GRIA 4HPQA 3G6EI 3MZHA 3ZQFA 4ENJA 1PP7U 3H3VK 5H9TA 3NWSA 3TL4X 3ZOBA 4KITB 1YYVA 4XKVA 1QGPA 2KHMA 2Z3YA 3GWZA 5K5OA 1QZZA 5EGOA 3AL0C 3U1DA 4CCJA 2HR3A 1U78A 4D7MA 5DDGA 4GFLA 1N25A 2CQNA 1BN5A 1UHSA 2HKXA 2BBYA 1IW7F 2EBIA 2QEXI 1K79A 4Y17A 5K7HA 2ZSIB 3AG1H 2B7EA 4FTHA 4UB8C 2FNAA 5LEJA 2PJPA 1FNNA 2B0LA 4QIWN 3S3NA 3M1CA 4B48A 3PO2J 3E6DA 4G7OF 2JSCA 2RREA 2DT6A 1ZRDA 3VYTB 5BPIA 5J8CA 4G6QA 3WTUC 1HXDA 1ZAOA 2W57A 3SFIA 2QKLB 3HOZJ 2H09A 2ZOYA 3KKCA 2R7UA 1HKSA 5IYCJ 3ABMH 4NB5A 2UXUA 1X4PA 2EIMH 5M3MJ 3BCGA 3OYGA 4HSRA 2G7SA 1PP8F 2OA4A 1AKHB 3BP8A 2G7HA 1WVRA 1Y39A 3DPUA 1ZG3A 1TT5B 1ZLJA 5CVJA 4CA0A 2IS1A 3BTJA 1O3TA 3CCUI 3QAHA 1QPMA 2HI3A 2R5YA 4JP0A 1K6YA 2EINH 1JKQC 1E0EA 3ASNH 3DPLC 4DW6A 4E70A 4E4HA 3WTTC 3QOEA 1B6AA 1FBUA 2F5EA 2FNPA 4HW0A 1J7KA 1BW5A 5LEKA 1R22A 1PYVA 3JRIA 3KP6A 2NVUB 3FMSA 3F8NA 3LSPA 3N4MA 1RR8C 4WK8F 4EJTA 3FXMA 4I7HA 5FD6A 1R5GA 3SWHA 2BYVE 3KCCA 2CV0A 3S8PA 1ZELA 2YPRA 3RKYA 4A6DA 2E36A 2BE5F 4A0ZA 5EFYA 1SD4A 4JX5A 2Y0MA 1YIJI 4ZTJA 5LFAA 3S17J 3JR9A 1JE8A 4LIVA 1N77A 3ESWB 1Z7UA 2F07A 2L01A 1ITYA 1OYIA 4UDSA 1VZ0A 1Z91A 1GVJA 3CMMA 3F9KA 2WAQA 3L2CA 4LLNA 1ETOA 3JW4A 3OYHA 3I4MJ 1K6OA 1K4TA 2LY9A 2WAEA 5KAIC 3QWLA 2X0LA 4XQFA
chains in the Genus database with same CATH topology
1Y1VJ 2RASA 1MBFA 4JL3A 1PUFA 2XSDC 5F0CA 1X58A 3T6NA 4C3JJ 3QPSA 1W0UA 2ZOZA 2H1KA 2MW8A 3B6CA 2LP0A 2W53A 3NXCA 5EG0B 4B4CA 3B81A 5JLXA 1GT0C 2N8GA 3F0CA 2I10A 2H8RA 3B6AA 3L1PA 2Y30A 5IYDJ 3CMYA 1WGXA 4A3BJ 5IOZA 4IHXA 3GTGJ 2Y9YA 4DYCA 1WCMJ 2WAQN 5IPAA 3OSGA 3COLA 1MBKA 1AKHA 2DA5A 1F43A 3BR3A 2HQ5A 1U9OA 3HM5A 4RDUA 3BQYA 2Y2ZA 3RQIA 2OPTA 1Q1VA 4M3FA 3PO3J 1UI6A 2NVYJ 2YU9J 2IAIA 3JRDA 3TW6A 3ANPA 1MBGA 2DA3A 1BW6A 2ZCXA 1IJWC 1RETA 3S2DJ 1QVTA 4BBSJ 3HTAA 1X2MA 3BRUA 3ZQCA 3LJLA 4M3GA 2OF7A 2Y0SN 2CUEA 4IHYA 1RESA 1MH3A 1MNMC 1ETWA 1I50J 3BG9A 2G7LA 5K7FA 2HYTA 3VP5A 1QPIA 3SDGA 1YRNB 2L0KA 1FIPA 2NVTJ 2JA8J 4B1RA 1VNDA 2FX0A 4D5FA 3GTMJ 5D19A 4XIDA 1OJLA 1RKTA 3AQTA 4UUTA 3IV5A 5F1JA 3BHQA 3G1OA 2LK2A 1VI0A 1OCPA 1CQTA 3SJMA 3JRHA 4V2FA 2X6OA 2ZCNA 4UUSA 5CXIA 3VW2A 4PXIA 1B72B 5M5WJ 2K9SA 3E7QA 5J3LA 3F1BA 1XS9A 5J1RA 1Z0XA 2DA6A 3QQAA 3OOUA 3NARA 2DJNA 1B8IB 2R5ZB 1TWHJ 1SFOJ 3A01B 4A3IJ 5FKKA 2NOGA 3BG3A 4I76A 5F0FA 3VOKA 1AU7A 1MSFC 2XB5A 2HOTA 4J19A 4W1UA 4IHWA 3GTQJ 2ECBA 2ZB9A 2DG8A 1MBEA 5EG0A 4A3CJ 4A93J 2YUSA 2ID3A 2UXHA 4B3AA 3HOXJ 2P81A 5F27A 3TP0A 2WB1N 3NAUA 2XPUA 2DA2A 3JREA 4AF5A 2HXIA 5D1RA 2PBXA 2XPVA 2TRTA 4AUXA 3GEUA 5FGLA 1ENHA 2Y31A 3GZIA 5F08A 4L62A 2WV1A 3M3YJ 3W6VA 4FISA 1ETQA 4CYCB 3IH2A 1DU6A 4MK6A 2EZLA 4XK4A 1XG1A 1GUUA 2KDZA 5FJ8J 3EGQA 3MN2A 1JKRC 2GLOA 1MH4A 1WH7A 4LOCA 3K2AA 2DG7A 4GFBA 2FBQA 3NPIA 1SANA 2XPWA 5FHPA 1VF9A 1U9NA 2VI6A 1S7EA 4BBRJ 2QTQA 2D5VA 3C07A 3VVYA 4DYQA 2PMZN 3CCYA 3CQZJ 3HB9A 2VKEA 2E2HJ 2L7FP 2QF7A 4JX6A 4HNVA 2QIBA 2IBDA 1YRNA 3BTIA 3FK6A 1JUMA 2R93J 2M34A 1H88C 1WH5A 2LFBA 1A6IA 2JA7J 1ZQ3P 3V78A 5DTDA 3IH3A 1I6HJ 4AYBN 4ACIA 3OIOA 5AQCA 2DMUA 2QWTA 3RKQA 9ANTA 3O8HA 3HE0A 2G0EA 2RAEA 2JA6J 2M2EA 2AO9A 2CQXA 5DAJA 3BR2A 2PZ9A 4MIMA 4JX4A 3GBGA 2JMWA 1B72A 5M5YJ 3ZQGA 1JKPC 1Z77A 2R0QC 1TC3C 4A3KJ 2VUMJ 5D18A 1FIAA 5K58A 2OERA 5JLWA 3BTCA 1X2NA 1ETVA 4M3BA 3VIBA 3JRCA 3IUVA 1B8IA 1NK2P 2R5ZA 2LR8A 2DA7A 1JKOC 2JJ7A 4RBOA 2K9QA 1ZR2A 2JWTA 4Y52J 3WHCA 4MXMA 4DZPA 2XGEA 1LE8B 1BJZA 4L5EA 2O8KA 1QVUA 2JN6A 2ECCA 3CRJA 1NTCA 1APLC 2JK3A 2M8GX 2DMQA 3BQZA 1IGNA 5C4XJ 1TWAJ 1R9TJ 2LD5A 1H89C 4D7NA 1T33A 3DEWA 3HOWJ 1UG2A 1IDYA 4IHVA 1MBHA 3LWJA 2IEKA 3Q0UA 5FKNA 5E3MA 3ANGA 3LSGA 4FE7A 5EZGA 4QTRA 2QOPA 5IP9J 5IP6A 4DYRA 1JUPA 3MVPA 3HIMA 1POGA 1FTZA 4X1EA 1JJ6C 3S14J 1OFCX 2HXOA 3JRGA 1HF0A 2IU5A 2GENA 2HOSA 2GBYA 4KWAA 4CYCA 3FIWA 3VVZA 2DMNA 1DU0A 4XRSG 3WHBA 1O4XA 3EUPA 2E1OA 3VOXA 2X48A 2DTZA 2TCTA 1PUFB 1HLVA 4A3GJ 2GFNA 5C4YA 1T56A 2O9LA 2O7TA 2YVHA 3BR0A 3BNIA 2CJJA 3BT9A 2DA1A 1QRYA 1BA5A 2LVSA 2HYJA 3M4OJ 4GCTA 2D6YA 3GTJJ 2NX4A 1GV2A 2L7MP 3JRFA 2L7ZA 2XB0X 3I4NJ 5HBUA 3JRAA 4MFEA 4BY1J 2EZKA 1RR7A 2AHQA 2MG4A 5C4JJ 3CWRA 4MFDA 4JKZA 2ME6A 4DZJA 3S16J 1IV6A 1K61A 4HKUA 3TW7A 2DMPA 1FEXA 2HKUA 2UXOA 3DPJA 2X9DA 2R7ZJ 3QKXA 5EF6A 3BJBA 2DMTA 5IP7J 1TWGJ 1IUFA 3TP3A 1Y1WJ 4AC0A 1P7IA 1IC8A 2EZHA 3S1QJ 1IRZA 2GUHA 1ETKA 3RZOJ 2G3BA 4ABZA 2VKVA 5EGOB 2DA4A 3ZQIA 5IYBJ 2LTPA 4A3FJ 2O7OA 2FD5A 1XC5A 2KT0A 4MLOA 2XRLA 3HTHA 2JA5J 3O60A 4M3EA 5FKOA 5E3NA 1JT0A 1WPKA 4NN1A 3S1RJ 2K40A 3D1NI 2XDNA 3FKIJ 3RH2A 3GTLJ 3FRQA 2CUFA 1I3QJ 4M6VA 3Q0VA 3HTJA 2CQQA 2R92J 3S1MJ 3O8GA 1JUSA 1JTXA 3RD3A 1LE8A 4A3DJ 1P7JA 3ZQHA 4Y7NJ 2L9RA 2DN0A 1JGGA 3TEDA 1AHDP 4IEJA 3VW0A 1GV5A 2ME0A 3S5RA 1ORKA 4JYKA 3V6GA 3VUQA 2B63J 1HDDC 3C2BA 3K7AJ 3HTIA 3IH4A 4MO7A 2YS9A 3NI7A 2HOAA 4GFKA 2UXIA 2NS7A 1ZR4A 2MSYA 3NNRA 5FLVA 1IG7A 4UUSB 4XRSA 1TWCJ 1LFUP 3BG5A 5CXGA 2YVEA 3KNWA 1NK3P 5E3OA 2LKXA 3HOUJ 2NP5A 3P9TA 4QSHA 5FKMA 1G2HA 4XICA 3MNLA 1RPWA 2M0CA 3S2HJ 5IOYA 1IDZA 5C44J 2ZCMA 2Y9ZA 2R5YB 1HDPA 4A3MJ 1UI5A 3A02A 4XRMA 4M3DA 3VVXA 5DS9A 2Q24A 5F0HA 4JNNA 4I6ZA 2ELKA 2NP3A 1ZTRA 5M3FJ 5FMPA 4A3LJ 4S0HB 1FTTA 3A01A 1W0TA 3HDDA 2FQ4A 5EDNA 1BL0A 3VPRA 2G7GA 3HGYA 2MGQA 2RHAA 3G56A 1LFBA 1H8AC 5M5XJ 1GVDA 4V2GA 3LSJA 4D5CA 3ZQFA 3HOVJ 4C2MJ 3OSFA 3H3VK 3ON4A 5H9TA 1WI3A 3FK7A 3ZOBA 1ETXA 2EZIA 2NS8A 2REKA 3QPLA 1OCTC 3GTPJ 5EGOA 1HOMA 5FLMJ 2QKOA 3LSRA 3Q3SA 1U78A 2XGCA 4BXXJ 4D7MA 2WUIA 2NVXJ 4GFLA 3G1MA 1K83J 3BTLA 3HEFA 3KKDA 1UHSA 3NRGA 2EBIA 1ZKGA 4A3JJ 5K7HA 5GP9A 1UMQA 3CDLA 5F04A 4FTHA 4C3HJ 2EQRA 5EZHA 4FCYA 3A03A 5CW8A 4QIWN 2FJ1A 3PO2J 4CGRA 2EH3A 3ZQLA 3VW1A 3DCFA 3JSJA 3PASA 3G1LA 3HGGA 4EEFG 2W48A 3PPBA 1JJ8C 3SFIA 4G12A 4NDLA 3HOZJ 2ZOYA 2OI8A 3KKCA 2UXPA 5IYCJ 3Q0WA 4A3EJ 2M9HA 5C3EJ 2UXUA 2CRGA 5EEAA 4X6AJ 5M3MJ 3S15J 3BCGA 1SGMA 4ICHA 2E19A 1F36A 3AQSA 4BKXA 3BR6A 2E2JJ 2G7SA 3KZ9A 3BR1A 1AKHB 4AC6A 5J1YA 3HOYJ 5E3LA 1RKWA 1VFCA 1ETYA 2COBA 3BTJA 4ME9A 1JTYA 3QBMA 2HI3A 2R5YA 4JP0A 1JKQC 2CU7A 3MKLA 4DW6A 4FE4A 1ZK8A 1MSEC 3S1NJ 5HSZA 1JT6A 1ZGWA 4GCLA 3BR5A 3JRBA 4YZEA 1GDTA 1FJLA 1BW5A 3JRIA 1A5JA 4C3IJ 2QCOA 3LSPA 3E7LA 5K7ZA 3H0GJ 5J1UA 2XGDA 1EF4A 2WGBA 3ON2A 3HBLA 2HDDA 5EYRA 4BY7J 3LOCA 5GPAA 4A69C 4NELA 5EFYA 1TWFJ 2GM4A 4JX5A 2NVQJ 1MBJA 3PM1A 4W97A 3JR9A 3S17J 5GPCA 3GTKJ 5FKLA 3UKGA 3GTOJ 2K9NA 3HKZN 3FISA 1ITYA 2F07A 3LHQA 2E2IJ 4UDSA 2LLKA 1D5YA 2VPRA 1HCRA 2ID6A 2V57A 3LNQA 1E3OC 5BNGA 1ETOA 3I4MJ 3CJDA 5HODA 4GCKA 1U8BA 3G7RA 2LY9A 5HAWA 3RZDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V J;  2RAS A;  1MBF A;  4JL3 A;  1PUF A;  2XSD C;  5F0C A;  1X58 A;  3T6N A;  4C3J J;  3QPS A;  1W0U A;  2ZOZ A;  2H1K A;  2MW8 A;  3B6C A;  2LP0 A;  2W53 A;  3NXC A;  5EG0 B;  4B4C A;  3B81 A;  5JLX A;  1GT0 C;  2N8G A;  3F0C A;  2I10 A;  2H8R A;  3B6A A;  3L1P A;  2Y30 A;  5IYD J;  3CMY A;  1WGX A;  4A3B J;  5IOZ A;  4IHX A;  3GTG J;  2Y9Y A;  4DYC A;  1WCM J;  2WAQ N;  5IPA A;  3OSG A;  3COL A;  1MBK A;  1AKH A;  2DA5 A;  1F43 A;  3BR3 A;  2HQ5 A;  1U9O A;  3HM5 A;  4RDU A;  3BQY A;  2Y2Z A;  3RQI A;  2OPT A;  1Q1V A;  4M3F A;  3PO3 J;  1UI6 A;  2NVY J;  2YU9 J;  2IAI A;  3JRD A;  3TW6 A;  3ANP A;  1MBG A;  2DA3 A;  1BW6 A;  2ZCX A;  1IJW C;  1RET A;  3S2D J;  1QVT A;  4BBS J;  3HTA A;  1X2M A;  3BRU A;  3ZQC A;  3LJL A;  4M3G A;  2OF7 A;  2Y0S N;  2CUE A;  4IHY A;  1RES A;  1MH3 A;  1MNM C;  1ETW A;  1I50 J;  3BG9 A;  2G7L A;  5K7F A;  2HYT A;  3VP5 A;  1QPI A;  3SDG A;  1YRN B;  2L0K A;  1FIP A;  2NVT J;  2JA8 J;  4B1R A;  1VND A;  2FX0 A;  4D5F A;  3GTM J;  5D19 A;  4XID A;  1OJL A;  1RKT A;  3AQT A;  4UUT A;  3IV5 A;  5F1J A;  3BHQ A;  3G1O A;  2LK2 A;  1VI0 A;  1OCP A;  1CQT A;  3SJM A;  3JRH A;  4V2F A;  2X6O A;  2ZCN A;  4UUS A;  5CXI A;  3VW2 A;  4PXI A;  1B72 B;  5M5W J;  2K9S A;  3E7Q A;  5J3L A;  3F1B A;  1XS9 A;  5J1R A;  1Z0X A;  2DA6 A;  3QQA A;  3OOU A;  3NAR A;  2DJN A;  1B8I B;  2R5Z B;  1TWH J;  1SFO J;  3A01 B;  4A3I J;  5FKK A;  2NOG A;  3BG3 A;  4I76 A;  5F0F A;  3VOK A;  1AU7 A;  1MSF C;  2XB5 A;  2HOT A;  4J19 A;  4W1U A;  4IHW A;  3GTQ J;  2ECB A;  2ZB9 A;  2DG8 A;  1MBE A;  5EG0 A;  4A3C J;  4A93 J;  2YUS A;  2ID3 A;  2UXH A;  4B3A A;  3HOX J;  2P81 A;  5F27 A;  3TP0 A;  2WB1 N;  3NAU A;  2XPU A;  2DA2 A;  3JRE A;  4AF5 A;  2HXI A;  5D1R A;  2PBX A;  2XPV A;  2TRT A;  4AUX A;  3GEU A;  5FGL A;  1ENH A;  2Y31 A;  3GZI A;  5F08 A;  4L62 A;  2WV1 A;  3M3Y J;  3W6V A;  4FIS A;  1ETQ A;  4CYC B;  3IH2 A;  1DU6 A;  4MK6 A;  2EZL A;  4XK4 A;  1XG1 A;  1GUU A;  2KDZ A;  5FJ8 J;  3EGQ A;  3MN2 A;  1JKR C;  2GLO A;  1MH4 A;  1WH7 A;  4LOC A;  3K2A A;  2DG7 A;  4GFB A;  2FBQ A;  3NPI A;  1SAN A;  2XPW A;  5FHP A;  1VF9 A;  1U9N A;  2VI6 A;  1S7E A;  4BBR J;  2QTQ A;  2D5V A;  3C07 A;  3VVY A;  4DYQ A;  2PMZ N;  3CCY A;  3CQZ J;  3HB9 A;  2VKE A;  2E2H J;  2L7F P;  2QF7 A;  4JX6 A;  4HNV A;  2QIB A;  2IBD A;  1YRN A;  3BTI A;  3FK6 A;  1JUM A;  2R93 J;  2M34 A;  1H88 C;  1WH5 A;  2LFB A;  1A6I A;  2JA7 J;  1ZQ3 P;  3V78 A;  5DTD A;  3IH3 A;  1I6H J;  4AYB N;  4ACI A;  3OIO A;  5AQC A;  2DMU A;  2QWT A;  3RKQ A;  9ANT A;  3O8H A;  3HE0 A;  2G0E A;  2RAE A;  2JA6 J;  2M2E A;  2AO9 A;  2CQX A;  5DAJ A;  3BR2 A;  2PZ9 A;  4MIM A;  4JX4 A;  3GBG A;  2JMW A;  1B72 A;  5M5Y J;  3ZQG A;  1JKP C;  1Z77 A;  2R0Q C;  1TC3 C;  4A3K J;  2VUM J;  5D18 A;  1FIA A;  5K58 A;  2OER A;  5JLW A;  3BTC A;  1X2N A;  1ETV A;  4M3B A;  3VIB A;  3JRC A;  3IUV A;  1B8I A;  1NK2 P;  2R5Z A;  2LR8 A;  2DA7 A;  1JKO C;  2JJ7 A;  4RBO A;  2K9Q A;  1ZR2 A;  2JWT A;  4Y52 J;  3WHC A;  4MXM A;  4DZP A;  2XGE A;  1LE8 B;  1BJZ A;  4L5E A;  2O8K A;  1QVU A;  2JN6 A;  2ECC A;  3CRJ A;  1NTC A;  1APL C;  2JK3 A;  2M8G X;  2DMQ A;  3BQZ A;  1IGN A;  5C4X J;  1TWA J;  1R9T J;  2LD5 A;  1H89 C;  4D7N A;  1T33 A;  3DEW A;  3HOW J;  1UG2 A;  1IDY A;  4IHV A;  1MBH A;  3LWJ A;  2IEK A;  3Q0U A;  5FKN A;  5E3M A;  3ANG A;  3LSG A;  4FE7 A;  5EZG A;  4QTR A;  2QOP A;  5IP9 J;  5IP6 A;  4DYR A;  1JUP A;  3MVP A;  3HIM A;  1POG A;  1FTZ A;  4X1E A;  1JJ6 C;  3S14 J;  1OFC X;  2HXO A;  3JRG A;  1HF0 A;  2IU5 A;  2GEN A;  2HOS A;  2GBY A;  4KWA A;  4CYC A;  3FIW A;  3VVZ A;  2DMN A;  1DU0 A;  4XRS G;  3WHB A;  1O4X A;  3EUP A;  2E1O A;  3VOX A;  2X48 A;  2DTZ A;  2TCT A;  1PUF B;  1HLV A;  4A3G J;  2GFN A;  5C4Y A;  1T56 A;  2O9L A;  2O7T A;  2YVH A;  3BR0 A;  3BNI A;  2CJJ A;  3BT9 A;  2DA1 A;  1QRY A;  1BA5 A;  2LVS A;  2HYJ A;  3M4O J;  4GCT A;  2D6Y A;  3GTJ J;  2NX4 A;  1GV2 A;  2L7M P;  3JRF A;  2L7Z A;  2XB0 X;  3I4N J;  5HBU A;  3JRA A;  4MFE A;  4BY1 J;  2EZK A;  1RR7 A;  2AHQ A;  2MG4 A;  5C4J J;  3CWR A;  4MFD A;  4JKZ A;  2ME6 A;  4DZJ A;  3S16 J;  1IV6 A;  1K61 A;  4HKU A;  3TW7 A;  2DMP A;  1FEX A;  2HKU A;  2UXO A;  3DPJ A;  2X9D A;  2R7Z J;  3QKX A;  5EF6 A;  3BJB A;  2DMT A;  5IP7 J;  1TWG J;  1IUF A;  3TP3 A;  1Y1W J;  4AC0 A;  1P7I A;  1IC8 A;  2EZH A;  3S1Q J;  1IRZ A;  2GUH A;  1ETK A;  3RZO J;  2G3B A;  4ABZ A;  2VKV A;  5EGO B;  2DA4 A;  3ZQI A;  5IYB J;  2LTP A;  4A3F J;  2O7O A;  2FD5 A;  1XC5 A;  2KT0 A;  4MLO A;  2XRL A;  3HTH A;  2JA5 J;  3O60 A;  4M3E A;  5FKO A;  5E3N A;  1JT0 A;  1WPK A;  4NN1 A;  3S1R J;  2K40 A;  3D1N I;  2XDN A;  3FKI J;  3RH2 A;  3GTL J;  3FRQ A;  2CUF A;  1I3Q J;  4M6V A;  3Q0V A;  3HTJ A;  2CQQ A;  2R92 J;  3S1M J;  3O8G A;  1JUS A;  1JTX A;  3RD3 A;  1LE8 A;  4A3D J;  1P7J A;  3ZQH A;  4Y7N J;  2L9R A;  2DN0 A;  1JGG A;  3TED A;  1AHD P;  4IEJ A;  3VW0 A;  1GV5 A;  2ME0 A;  3S5R A;  1ORK A;  4JYK A;  3V6G A;  3VUQ A;  2B63 J;  1HDD C;  3C2B A;  3K7A J;  3HTI A;  3IH4 A;  4MO7 A;  2YS9 A;  3NI7 A;  2HOA A;  4GFK A;  2UXI A;  2NS7 A;  1ZR4 A;  2MSY A;  3NNR A;  5FLV A;  1IG7 A;  4UUS B;  4XRS A;  1TWC J;  1LFU P;  3BG5 A;  5CXG A;  2YVE A;  3KNW A;  1NK3 P;  5E3O A;  2LKX A;  3HOU J;  2NP5 A;  3P9T A;  4QSH A;  5FKM A;  1G2H A;  4XIC A;  3MNL A;  1RPW A;  2M0C A;  3S2H J;  5IOY A;  1IDZ A;  5C44 J;  2ZCM A;  2Y9Z A;  2R5Y B;  1HDP A;  4A3M J;  1UI5 A;  3A02 A;  4XRM A;  4M3D A;  3VVX A;  5DS9 A;  2Q24 A;  5F0H A;  4JNN A;  4I6Z A;  2ELK A;  2NP3 A;  1ZTR A;  5M3F J;  5FMP A;  4A3L J;  4S0H B;  1FTT A;  3A01 A;  1W0T A;  3HDD A;  2FQ4 A;  5EDN A;  1BL0 A;  3VPR A;  2G7G A;  3HGY A;  2MGQ A;  2RHA A;  3G56 A;  1LFB A;  1H8A C;  5M5X J;  1GVD A;  4V2G A;  3LSJ A;  4D5C A;  3ZQF A;  3HOV J;  4C2M J;  3OSF A;  3H3V K;  3ON4 A;  5H9T A;  1WI3 A;  3FK7 A;  3ZOB A;  1ETX A;  2EZI A;  2NS8 A;  2REK A;  3QPL A;  1OCT C;  3GTP J;  5EGO A;  1HOM A;  5FLM J;  2QKO A;  3LSR A;  3Q3S A;  1U78 A;  2XGC A;  4BXX J;  4D7M A;  2WUI A;  2NVX J;  4GFL A;  3G1M A;  1K83 J;  3BTL A;  3HEF A;  3KKD A;  1UHS A;  3NRG A;  2EBI A;  1ZKG A;  4A3J J;  5K7H A;  5GP9 A;  1UMQ A;  3CDL A;  5F04 A;  4FTH A;  4C3H J;  2EQR A;  5EZH A;  4FCY A;  3A03 A;  5CW8 A;  4QIW N;  2FJ1 A;  3PO2 J;  4CGR A;  2EH3 A;  3ZQL A;  3VW1 A;  3DCF A;  3JSJ A;  3PAS A;  3G1L A;  3HGG A;  4EEF G;  2W48 A;  3PPB A;  1JJ8 C;  3SFI A;  4G12 A;  4NDL A;  3HOZ J;  2ZOY A;  2OI8 A;  3KKC A;  2UXP A;  5IYC J;  3Q0W A;  4A3E J;  2M9H A;  5C3E J;  2UXU A;  2CRG A;  5EEA A;  4X6A J;  5M3M J;  3S15 J;  3BCG A;  1SGM A;  4ICH A;  2E19 A;  1F36 A;  3AQS A;  4BKX A;  3BR6 A;  2E2J J;  2G7S A;  3KZ9 A;  3BR1 A;  1AKH B;  4AC6 A;  5J1Y A;  3HOY J;  5E3L A;  1RKW A;  1VFC A;  1ETY A;  2COB A;  3BTJ A;  4ME9 A;  1JTY A;  3QBM A;  2HI3 A;  2R5Y A;  4JP0 A;  1JKQ C;  2CU7 A;  3MKL A;  4DW6 A;  4FE4 A;  1ZK8 A;  1MSE C;  3S1N J;  5HSZ A;  1JT6 A;  1ZGW A;  4GCL A;  3BR5 A;  3JRB A;  4YZE A;  1GDT A;  1FJL A;  1BW5 A;  3JRI A;  1A5J A;  4C3I J;  2QCO A;  3LSP A;  3E7L A;  5K7Z A;  3H0G J;  5J1U A;  2XGD A;  1EF4 A;  2WGB A;  3ON2 A;  3HBL A;  2HDD A;  5EYR A;  4BY7 J;  3LOC A;  5GPA A;  4A69 C;  4NEL A;  5EFY A;  1TWF J;  2GM4 A;  4JX5 A;  2NVQ J;  1MBJ A;  3PM1 A;  4W97 A;  3JR9 A;  3S17 J;  5GPC A;  3GTK J;  5FKL A;  3UKG A;  3GTO J;  2K9N A;  3HKZ N;  3FIS A;  1ITY A;  2F07 A;  3LHQ A;  2E2I J;  4UDS A;  2LLK A;  1D5Y A;  2VPR A;  1HCR A;  2ID6 A;  2V57 A;  3LNQ A;  1E3O C;  5BNG A;  1ETO A;  3I4M J;  3CJD A;  5HOD A;  4GCK A;  1U8B A;  3G7R A;  2LY9 A;  5HAW A;  3RZD J; 
#chains in the Genus database with same CATH topology
 4R1H A;  5J6X A;  3LSM A;  1MBF A;  2KRF A;  4C3J J;  3RYP A;  3QPS A;  2MW8 A;  2LF7 A;  2VOO A;  2XVC A;  3NXC A;  3VYU B;  2VT3 A;  2BY2 A;  5EG0 B;  3B81 A;  4HLX A;  5JLX A;  2N8G A;  1Z1D A;  4CCN A;  2K9L A;  3B6A A;  5EJC A;  1VQK I;  1TLH B;  3E3V A;  4UNO A;  1WGX A;  4IHS A;  2VQL A;  2NYX A;  3R60 A;  4DYC A;  3K4B A;  1EKE A;  4DBQ A;  3OSG A;  3GFL A;  3JTH A;  3COL A;  1MBK A;  3DKX A;  2DA5 A;  3GFM A;  2HQ5 A;  3HM5 A;  5HOO A;  4IL6 C;  2DFE A;  3CES A;  3DQV C;  2HVS A;  3WE2 A;  1ACI A;  2CWE A;  2IAI A;  3CF2 A;  2R7D A;  3QPT A;  3TW6 A;  4A0X A;  3ANP A;  4KJZ A;  1MBG A;  3GME A;  1BW6 A;  2V9P A;  5TIS C;  5D4S A;  2ZCX A;  4BHB A;  4ENK A;  3S2D J;  3PQK A;  3R61 A;  3H36 A;  4QWQ A;  1D1A A;  3ZQC A;  2PFB A;  2Z99 A;  2HFH A;  2RNG A;  1KGS A;  4B09 A;  2AQF A;  4LK1 F;  5DV5 A;  3CJQ B;  3DBR B;  2OU2 A;  2WA0 A;  2X6Y A;  1YW9 A;  3EUA A;  3H9Q A;  3J81 K;  4WIB A;  2VKH A;  3VYS B;  4L18 B;  1G4D A;  3SDG A;  1SVM A;  4GXO A;  3GFI A;  2QEN A;  1OPC A;  2HYG D;  2FX0 A;  2OQG A;  4B1R A;  4D5F A;  3GO5 A;  2PBI A;  3FBI B;  3BHQ A;  3DFG A;  2EA4 A;  3IKV A;  1R5I D;  1VI0 A;  2BW3 B;  2X6O A;  2V9K A;  4HQE A;  3OS1 A;  4PXI A;  3IRR A;  1F4K A;  5J3L A;  2L54 A;  2M7B A;  1SMT A;  2R7F A;  1W36 C;  2DJN A;  4ZDP A;  4E7I A;  3CLO A;  2FU4 A;  3DWL E;  3HKZ A;  2CQ7 A;  2LH9 A;  4BQA A;  4Z6Y A;  2HQR A;  2GA2 A;  3BG3 A;  4HV6 A;  1MSF C;  3TO9 A;  4J19 A;  1FC3 A;  3CO7 C;  3ZMD A;  3I55 I;  5HNH A;  1MBE A;  1FMV A;  1I3A A;  2H6C A;  4HX8 A;  5E79 C;  2PG4 A;  4AU7 A;  1JHH A;  3LSK A;  4Y15 A;  2P81 A;  5A2Q Z;  2MH9 A;  1FYK A;  1ZAR A;  1O7F A;  2EIL H;  2M1B A;  5TGT A;  1SMY F;  2PFV A;  2EV6 A;  1L0O C;  3LWF A;  4AF5 A;  2R7S A;  4A12 A;  2ESN A;  2JPC A;  3DP7 A;  2F5F A;  4KT6 A;  2VT2 A;  3K4L A;  4C2M A;  2P7C B;  1OYW A;  1XB4 A;  3ZPL A;  3KYD B;  1ENH A;  3TDZ C;  1RUO A;  3M3Y J;  4XR6 A;  1ETQ A;  1DU6 A;  4MK6 A;  4RGR A;  4CZC A;  2EZL A;  5HS7 A;  4N9I A;  1D0Z A;  1STZ A;  4L9N A;  3C2G A;  2QVO A;  3MN2 A;  3RYR A;  4HG2 A;  3PSI A;  1JKR C;  2GLO A;  3U2R A;  1MMN A;  1RZ4 A;  1SAN A;  2XPW A;  1U5T C;  1BOB A;  2NRA C;  3SZP A;  2MH2 A;  2K9M A;  3BY6 A;  1LDK B;  1FT9 A;  4KIG A;  2K4J A;  4UVA A;  3VVY A;  3C07 A;  5AIP A;  1D0X A;  4EJW A;  2QF7 A;  4WF2 A;  4JX6 A;  2QIB A;  2VJ4 A;  3FK6 A;  1S7A A;  5FFX A;  1H88 C;  1WH5 A;  3L2U A;  3OYN A;  2QQ8 A;  3HPH A;  2M5W A;  3VOD A;  3V78 A;  5DTD A;  3IH3 A;  4EJV A;  4AYB N;  4U7D A;  1IF1 A;  4HLY A;  3OWT A;  3HRT A;  1PUE E;  4HEA 2;  2QWT A;  4O5V A;  2LBF A;  2A2F X;  1LDD A;  3KLO A;  3FMR A;  2G0E A;  2DFF A;  1S3J A;  5E18 F;  5IT9 K;  3BR2 A;  3V7C A;  1MDM A;  1KYZ A;  3AAF A;  5M5Y J;  3CMA I;  2ACJ A;  3PQJ A;  3MKZ A;  1W1W E;  1JKP C;  1TC3 C;  1LEA A;  1FIA A;  1REP C;  4DJA A;  5JLW A;  2W4S A;  4JQF A;  4EM1 A;  1X2N A;  3BZK A;  2F48 A;  3JRC A;  5K5R A;  1PJR A;  1XPX A;  4RGS A;  4I99 C;  1YJN I;  2R5Z A;  1B8I A;  2K02 A;  5FFZ A;  4LB5 A;  1QQI A;  4RBO A;  3RQ4 A;  2JWT A;  3VYR B;  2R7O A;  1G3S A;  4HST A;  1BJZ A;  4LIT A;  2DYS H;  3OR1 C;  3SQN A;  2ECC A;  3KP7 A;  3BQZ A;  3SZT A;  1U2W A;  2FUG 2;  3DEW A;  4HOB A;  4UB6 C;  1MBH A;  1O3R A;  2HPM A;  2F6C A;  1SD6 A;  1R1U A;  1WRJ A;  2AXL A;  3LSG A;  3BZC A;  1FYL A;  2DYR H;  5EZG A;  5EEG A;  3HTU A;  1T98 A;  2JTV A;  4XOP A;  4DYR A;  3HIM A;  4BGD A;  4PCQ A;  1D1C A;  2EFN A;  1UJ8 A;  2MC4 A;  3JRG A;  1V5G A;  1HF0 A;  2LSO A;  4IRI A;  2X6W A;  1O3Q A;  4KWA A;  5GAE J;  3T0Y A;  3TMO A;  3FIW A;  3OOP A;  4XRS G;  4M74 A;  4BQN A;  4S04 A;  2TCT A;  1HLV A;  3WGG A;  2L02 A;  3GW2 A;  3HOS A;  1DUX C;  2O9L A;  2O7T A;  4RM2 A;  1SFU A;  3BT9 A;  1U5T B;  1ZYR F;  2V6E A;  1DGW Y;  3W6K B;  1HQC A;  4LMY A;  3DTI A;  3QRF F;  4FHT A;  3MAJ A;  1HW1 A;  3V8J A;  2L7M P;  3JRF A;  1T39 A;  5AON A;  4MFE A;  2KL4 A;  3T5X A;  2HZT A;  4LK0 F;  3PJR A;  3PNV A;  1X1C A;  1B59 A;  4DZJ A;  1YOV B;  4HKU A;  5ILS A;  3CUO A;  2A5Y B;  3TW7 A;  4G8X A;  3DPJ A;  3RPU D;  1T08 B;  1XDU A;  3QOD A;  2Z9O A;  4CZZ A;  3QYF A;  1P7I A;  2EZH A;  1IRZ A;  5CYV A;  1ETK A;  1WJC A;  2F4M B;  2DJI A;  2ELJ A;  4MTE A;  4KNY A;  2DA4 A;  3HSR A;  3FF5 A;  2O7O A;  4IXA A;  1XC5 A;  4KUM A;  5JHU A;  1GHC A;  4XLH A;  4MLO A;  1MKM A;  2XRL A;  2JA5 J;  4M3E A;  5FKO A;  2O5R A;  2HTS A;  4MHG A;  1HBX G;  4C9Y A;  3GTL J;  3LST A;  1X1D A;  4AM3 A;  2CUF A;  1OCZ H;  4M6V A;  3Q0V A;  5K1Y A;  1X4O A;  5E20 A;  3V8K A;  5B66 C;  3IRQ A;  3HTS B;  3O8G A;  2R92 J;  1WJF A;  1J0R A;  3K10 A;  4HBL A;  1LE8 A;  1KU9 A;  1P7J A;  3KP2 A;  5DM6 F;  4C2T A;  2XUB A;  4LIU A;  2VN2 A;  2DN0 A;  1JGG A;  3VW0 A;  4IEJ A;  2XV4 S;  1IN8 A;  1OKR A;  2P6T A;  4JYK A;  4I0B A;  4U7B A;  3V6G A;  2JPB A;  1MW7 A;  2B63 J;  3HJE A;  3U21 A;  3L7W A;  3IAS 2;  2CH0 A;  2QKM B;  2WAF A;  2HOA A;  2UXI A;  2JQ7 A;  2WTE A;  3U1K A;  3NNR A;  2VAS A;  2UXN A;  3PL8 A;  1E17 A;  3FXO A;  4LGW A;  2YVE A;  2O03 A;  2OCE A;  3HOU J;  5E3O A;  2LKX A;  5LGN A;  1S5L C;  2M0C A;  1VQ5 I;  3S2H J;  4UVB A;  4XKW A;  2MA3 A;  5ICC A;  2AS5 F;  5HLT A;  1UHW A;  3I56 I;  4IOC F;  3LAJ A;  5IY5 H;  3FXJ A;  3HHH A;  4R8H A;  2GXA A;  5FLX K;  4NQW A;  5D6F A;  3CUQ B;  5GTH C;  1F5T A;  3H9J A;  5JFR A;  3A02 A;  3O2P E;  4IJA A;  5D5X B;  3JAM K;  4ZYE A;  5JI6 A;  5DS9 A;  4GDF A;  3I71 A;  4JNN A;  4I6Z A;  4LG0 B;  5M3F J;  3CCQ I;  4HA8 A;  5FMP A;  3GZ6 A;  4A3L J;  1FTT A;  3E5Q A;  4ENN A;  1IRX A;  3I3L A;  4NBQ A;  1BL0 A;  4YFN F;  2QGU A;  2G7G A;  2MGQ A;  3F8F A;  3QP6 A;  2ZJR F;  1J59 A;  3NS4 A;  1IZ1 A;  3IKT A;  3J7A Y;  2E60 A;  2NXN B;  1LFB A;  3CZ6 A;  4YG2 F;  5M5X J;  4V2G A;  3LSJ A;  2DPU A;  4C2M J;  4ETS A;  1WHU A;  3ON4 A;  3HOT A;  1ETX A;  2EZI A;  2F4I A;  3CJT B;  4RGX A;  4RB0 A;  2REK A;  5JHF A;  1YW7 A;  1OCT C;  4C2U A;  3C1D A;  2B1E A;  1R5H A;  4PFO A;  2QKO A;  3ZXS A;  1DGR M;  3TKY A;  5DUI A;  4L9V A;  1SD5 A;  3Q3S A;  3LSR A;  2XGC A;  3IC7 A;  3ROU A;  1CGP A;  2VKD A;  3C2H A;  3HEF A;  3K2Z A;  2MBF A;  2HPI A;  4MGR A;  3KKD A;  2ZJQ F;  4HNU A;  4XOR A;  1HW2 A;  1UMQ A;  3HSF A;  4Y33 A;  3ECH A;  5F64 A;  1LUJ B;  5LHG A;  4U9L A;  2EQR A;  3N05 A;  1BR4 A;  3QU3 A;  2FJI 1;  2P0W A;  5FRO A;  3ZP5 A;  4CGR A;  2EH3 A;  3WU1 B;  2V4J C;  3KYL A;  3VW1 A;  3JSJ A;  2OBP A;  3DTE A;  3PAS A;  1IXC A;  4PJL A;  2W48 A;  4EEF G;  4OIP F;  2XKO A;  3ABK H;  2EK5 A;  3PPB A;  2E7W A;  4NC7 A;  4NDL A;  4PJ0 C;  2XGX A;  1CF7 B;  2ETH A;  2UWM A;  2KZV A;  2M9H A;  3FHZ A;  5C3E J;  2EA2 A;  4A5M A;  4ICH A;  2D1H A;  1J09 A;  3PFI A;  3RCO A;  4BKX A;  2FBI A;  5HDG A;  3BR1 A;  3ZMU A;  1W36 D;  2VE9 A;  1GXP A;  3FBN B;  3HOY J;  4AIH A;  2X51 A;  1I1S A;  3K4C A;  3JTG A;  1ETY A;  4ME9 A;  1HKT A;  2XRO A;  3G73 A;  2QYO A;  3QBM A;  3EDP A;  4KYW A;  2QLZ A;  2P5V A;  2HQA A;  2GOX B;  1AWC A;  5HLG A;  1ZK8 A;  2IJL A;  3ZMZ A;  5HSZ A;  1JT6 A;  3R0A A;  1BIA A;  1ZGW A;  4GCL A;  3BR5 A;  4LD5 A;  4A2U A;  4CCK A;  4YZE A;  2HDC A;  1SFX A;  2IGK A;  1FJL A;  4ZZL A;  4HRI A;  1MD0 A;  2L4M A;  2DPD A;  3K1N A;  2Z5U A;  3ULQ B;  2W1O A;  4C3I J;  4UXN A;  2CW0 F;  2QSG X;  2CQK A;  5J1U A;  2XGD A;  3V7S A;  4DNC A;  1MNE A;  2WGB A;  2IPQ X;  3HBL A;  4PFP A;  3HRM A;  3MFK A;  1OR7 A;  1KON A;  1TP4 A;  4A69 C;  1JHF A;  2K4B A;  2O8X A;  3VFZ A;  2WC2 A;  1LFP A;  2OD5 A;  3PM1 A;  1XGM A;  1BI2 A;  1T95 A;  4KFC A;  2XAF A;  3GTO J;  4ZYH A;  5L3F A;  2OAZ A;  4U0W A;  3GX4 X;  1DP3 A;  3FXR A;  3NWT A;  3FWE A;  1FOW A;  3GF2 A;  3CC2 I;  3A2K A;  2QQA A;  3ZMS A;  4MEX F;  1HCR A;  2ID6 A;  2FSW A;  2RDP A;  2Q8K A;  4PSX A;  4RLQ A;  2COM A;  5BNG A;  5GAG J;  1E3O C;  4GCK A;  5HAW A;  3JCU C;  5F6F A;  3PIP F;  3GFJ A;  4TV7 A;  3DU6 A;  3AFH A;  1WJE A;  3W2V A;  4JL3 A;  3P9I A;  1PUF A;  3F8C A;  4N0B A;  3FM5 A;  4ZYG A;  5IT9 Z;  3B6C A;  2HZD A;  3CDI A;  3CCE I;  2LF8 A;  4U9N A;  2L5Q A;  1S7O A;  1SC7 A;  2Q0O A;  4B4C A;  1K78 A;  2QA4 I;  1P4W A;  2DOF A;  3L1P A;  4M9S A;  3CMY A;  1YW8 A;  5IOZ A;  5J8F A;  4ZDL A;  1P2F A;  3LFU A;  3OYC A;  3KFW X;  1Y0U A;  5IPA A;  3OYA A;  4N4N B;  1F43 A;  4CCL A;  3BR3 A;  3WTS C;  1U9O A;  2KJB A;  2BHY A;  2Y2Z A;  4XLE A;  3RQI A;  3J7A O;  1UI6 A;  2NVY J;  1UCR A;  2E5Z A;  2L9S A;  2M30 A;  5HS9 A;  3OYF A;  1HC8 A;  2DA3 A;  4HYE A;  5EEH A;  1VQL I;  3HYI A;  2DT7 B;  3BRU A;  2STW A;  2P5L C;  1LB2 A;  3DLA A;  3SDB A;  2FEZ A;  1MNM C;  1MH3 A;  1FP2 A;  3J80 K;  5LLQ A;  5TRD A;  1XX5 A;  3OYD A;  4D0P A;  5K5Q A;  3OYE A;  5FRM A;  1YRN B;  2L0K A;  2QBY B;  4FQG A;  4NNJ A;  1VQ6 I;  2BOL A;  2JA8 J;  2Q2E B;  1VND A;  3ZMV A;  4XID A;  3M07 A;  1D8K A;  1RKT A;  1GXQ A;  3A0B C;  3WOD F;  3AQT A;  1P92 A;  1UZC A;  1WWX A;  1OCR H;  2A68 F;  2QUF A;  2OC6 A;  3I59 A;  2LK2 A;  4F92 B;  1FY7 A;  4BQO A;  3SJM A;  3JRH A;  2PMH A;  1TQI A;  4UUS A;  4HF0 A;  1SAX A;  3LSH A;  2BEO A;  1KU3 A;  2RQP A;  2LY1 A;  4XM3 A;  3SZG A;  3DEE A;  4E7Z A;  3F1B A;  1W7P A;  2VC0 A;  1IRG A;  3OOU A;  4IPA A;  3K1P A;  3ERE D;  3RPQ A;  1LQ1 A;  3PNT A;  3KEQ A;  4J00 A;  4RAY A;  1SFO J;  1XN7 A;  3K69 A;  1TW3 A;  3VOK A;  2DK8 A;  2Z33 A;  2XB5 A;  4JOM A;  4PZJ A;  1ZLK A;  4W1U A;  2LYC A;  2PQ8 A;  5LHI A;  2ECB A;  4YIR X;  1QNT A;  2XIG A;  4WXD A;  5E1Z B;  4Y4R A;  3CME I;  4OIR F;  3OL4 A;  2FF4 A;  1RRJ A;  2M8E A;  3A4C A;  5FD5 A;  2C6Y A;  5F27 A;  1ZH5 A;  2WB1 N;  3X2Q H;  3D5S C;  2XPU A;  2QSF X;  2HXI A;  2E1N A;  4AYB A;  3IWZ A;  2XPV A;  3GEU A;  5HDK A;  1KQ9 A;  1XGO A;  2QZ8 A;  3ZGK A;  3GZI A;  2VBZ A;  3W6V A;  3EUH A;  1XCV A;  4BEH B;  2QSH X;  2ZKZ A;  2GWR A;  4OIQ F;  3AL0 B;  1MJB A;  4FAS D;  1TT0 A;  5ICE A;  3OYB A;  1JI8 A;  3KYC B;  3EGQ A;  1XMA A;  3K2A A;  2ZFW A;  4YFK F;  2OQR A;  4IKF A;  1QHH D;  2CW8 A;  3CD6 I;  3A1Y A;  2QWW A;  3E5X A;  2DK5 A;  1WJD A;  1V54 H;  2D5V A;  5KK1 A;  1MMG A;  2PMZ N;  3CQZ J;  3L2V A;  2VKE A;  4HNV A;  2IBD A;  2BVL A;  3BTI A;  2R93 J;  2L7K A;  2XF5 A;  6PAX A;  1R6R A;  2LFB A;  1IN4 A;  4BAC A;  3OIO A;  1ZHF A;  5AQC A;  2RV8 A;  9ANT A;  3MWM A;  3O8H A;  2IW5 A;  5CJ9 A;  2M2E A;  2CQX A;  1R23 A;  2W24 A;  5BQT A;  4ESF A;  2PZ9 A;  3NEU A;  4MIM A;  1B72 A;  3ZQG A;  1DQU A;  2XF7 A;  5J40 A;  4RB1 A;  1IV8 A;  2EPF A;  2R0Q C;  2JRT A;  3C7J A;  2VUM J;  4CDG A;  4XLA A;  1EA3 A;  2OER A;  1WJB A;  2W82 A;  4M3B A;  3IUV A;  3OYI A;  1VQ9 I;  1SVL A;  2DFH A;  1A36 A;  2DA7 A;  2JJ7 A;  4U87 A;  2K9Q A;  2ZME A;  3UR3 C;  4Y52 J;  2VLA A;  2VL8 A;  3ONQ A;  3WHC A;  3V4G A;  2L3D A;  3I4P A;  4LLG F;  2E1C A;  2O8K A;  1O3S A;  3K9T A;  4XMY A;  2VXZ A;  1VQ8 I;  1IGN A;  2XAH A;  3AG3 H;  4CSW A;  1WSU A;  4V19 K;  1T33 A;  2A6T A;  4IHV A;  1IDY A;  1VQ7 I;  2ZXJ A;  2KMU A;  5B5E C;  3HUG A;  3K6G A;  1BR2 A;  2ESH A;  2XAU A;  2QOP A;  2K3P A;  1JUP A;  2VQC A;  1W5T A;  4X1E A;  1JJ6 C;  1OFC X;  1SFE A;  2VE8 A;  3CCL I;  1V4R A;  4CYC A;  3H0D A;  2DMN A;  3EPZ A;  4UV8 A;  1O4X A;  3EUP A;  1RIO H;  5GAH J;  3P7N A;  2BHZ A;  2X48 A;  2X85 A;  2ZSH B;  1ZRE A;  1H9T A;  1PUF B;  4A3G J;  4GYG A;  2XRN A;  4DVY P;  2YVH A;  3ZCO A;  3BNI A;  4HF2 A;  1U8R A;  3CP2 A;  2TDX A;  2LVS A;  2HYJ A;  4PSW A;  4UHT A;  1BA5 A;  4GCT A;  3D5L A;  3GTJ J;  2NX4 A;  3KIO A;  2XB0 X;  4LLL A;  3F6V A;  3RKW A;  2MG4 A;  2OZU A;  4YIF A;  5BPD A;  2ME6 A;  1RUN A;  3S16 J;  3SEQ A;  1MZB A;  3BLY A;  1IAW A;  3QKX A;  5EF6 A;  3DTK A;  3ABT A;  4XKB A;  4HQM A;  5L3C A;  4WWC A;  1XCB A;  2CMP A;  3ZMT A;  4BNC A;  2GUH A;  1T0F A;  3DXJ F;  2HVQ A;  3MEX A;  3RZO J;  2HKO A;  4EV0 A;  1XGS A;  1Z7L A;  2VKV A;  5EGO B;  4KMF A;  3ZQI A;  1USS A;  2LTP A;  2X1D A;  5IYB J;  2FD5 A;  2K86 A;  4EM0 B;  3COA C;  4ZTF A;  2EFO A;  1BJA A;  3OV8 A;  4BU2 A;  2PJR A;  3HTH A;  3O60 A;  1LJ9 A;  3HSE A;  5E3N A;  4RAZ A;  2R7W A;  2IS4 A;  3H5A A;  4CXF A;  3S1R J;  5D6E A;  2R7R A;  1YE9 A;  4IRH A;  2XC7 A;  2XDN A;  1YG2 A;  3FKI J;  3CDH A;  3FRQ A;  4O6J A;  2M4G A;  2CQQ A;  3ECO A;  3KLN A;  1JUS A;  1JTX A;  2DO7 A;  1O7L A;  3WG9 A;  3ZQH A;  3GYH X;  2YVX A;  4KIS A;  2KRH A;  2PLY A;  1AHD P;  3TED A;  2EV5 A;  2A69 F;  2QM3 A;  2UXX A;  3LA2 A;  4B44 A;  1ORK A;  3VUQ A;  3DF8 A;  3OMY A;  1HDD C;  3C2B A;  3K7A J;  3HTI A;  3CLQ A;  3IH4 A;  5H20 A;  1W4M A;  4MO7 A;  1TNS A;  3CF5 F;  3NI7 A;  4AVP A;  4GFK A;  2KIU A;  2W84 A;  5DCM A;  2NS7 A;  1ZR4 A;  2MSY A;  2F2E A;  1IG7 A;  1YI2 I;  4UUS B;  2XDV A;  4BAY A;  4XRS A;  1LFU P;  3BG5 A;  3RIR A;  3I54 A;  5CXG A;  5L3D A;  4P55 A;  1S72 I;  3KNW A;  3HXL A;  1NK3 P;  2OJE D;  2E34 A;  4HZF A;  1G2H A;  2Z16 A;  4XIC A;  1RPW A;  5IOY A;  1IDZ A;  3KZY A;  1Y56 A;  3TDU C;  2IRF G;  2R5Y B;  1IRF A;  1ODD A;  3L2W A;  1R71 A;  3QP5 A;  1TW2 A;  2EJR A;  2D45 A;  2I8D A;  1BOA A;  3SFZ A;  1R4M B;  4CUG A;  1IN5 A;  2FMY A;  1TNT A;  2ZFU A;  3VVX A;  3J7Z I;  2CV2 A;  2ELK A;  2NP3 A;  1ZTR A;  2V7F A;  1IO2 A;  3NRV A;  4S0H B;  3A01 A;  4U88 A;  2LRD A;  3LL7 A;  2DW4 A;  3PSF A;  3VPR A;  3FM3 A;  3H5N A;  2WY8 Q;  3ABU A;  3M8E A;  5DUK A;  1GVD A;  1OMI A;  3E6B A;  3LA3 A;  3M8F A;  5D4R A;  1R00 A;  3REO A;  3HOV J;  5D5U B;  1X3Z B;  1WI3 A;  1LPQ A;  3ISP A;  2IT0 A;  3J80 Z;  3QPL A;  2G7U A;  4BH9 A;  3ZRG A;  5FLM J;  1LEB A;  3CTA A;  2STT A;  4BXX J;  4OMZ A;  2J5O A;  4H0E A;  2NVX J;  3G1M A;  4L5I A;  3BPX A;  4AIJ A;  3BTL A;  4DGW B;  3H1C A;  4OAY A;  4MEY F;  4Q5S F;  4II2 A;  5BOX A;  1ZKG A;  4A3J J;  3E0J B;  2VIX A;  5GP9 A;  2VBX A;  1QHG A;  2MAB A;  3CDL A;  5HLI A;  4C3H J;  2RKH A;  5EZH A;  3RSN A;  2L2O A;  5CW8 A;  4ANJ A;  1RNL A;  3ZQL A;  1P6R A;  5DD8 A;  4PJJ A;  4AVZ A;  3DCF A;  2CG4 A;  3SHF A;  2BY1 A;  1TL8 A;  1PVE A;  2F4O B;  3SXY A;  2KDO A;  2BZT A;  1R1V A;  4M72 A;  1T0F C;  2K3F A;  2KRC A;  3Q0W A;  2P7V B;  4AD9 A;  2UXP A;  4YRV A;  1A6Q A;  2CRG A;  3KP4 A;  3M7G A;  4LB6 B;  4I2O A;  5EEA A;  4HF1 A;  4X6A J;  3S15 J;  3GCM A;  2E19 A;  1F36 A;  2E35 A;  3TO7 A;  3AQS A;  2BXY A;  2E2J J;  3KZ9 A;  3KPH A;  1FOK A;  1DDN A;  4RA2 A;  5J1Y A;  4MQ9 F;  4KDP A;  1VFC A;  2ELH A;  2COB A;  5ILV A;  1JTY A;  5DCF A;  4AID A;  3FXU A;  2KIS A;  4IVN A;  2MD0 A;  2DBB A;  2E7X A;  1VQN I;  1V3F A;  3KZI C;  2CFX A;  1W5S A;  3MKL A;  4FE4 A;  1T8I A;  3IAM 2;  2ZCW A;  4XSZ F;  3S1N J;  3GZN B;  4ZYD A;  3JRB A;  2WBM A;  1HSJ A;  2VC1 A;  4BHP A;  1SEU A;  4OIO F;  2O61 A;  1G59 A;  1FX7 A;  1G3Y A;  1A5J A;  4JK1 X;  2DI3 A;  3H0G J;  2BVM A;  1WI9 A;  3ON2 A;  2MYS A;  3MD2 A;  2WV0 A;  3HUG B;  4MQV A;  2VPL A;  5EYR A;  1D5V A;  3LOC A;  5GPA A;  3GZ5 A;  4I09 A;  3DLL F;  4NEL A;  1TWF J;  2GM4 A;  4BUP A;  1U3E M;  3B73 A;  1M1E B;  1XMX A;  4E7H A;  4L9J A;  4W97 A;  1P9Q C;  2IS6 A;  1X1B A;  2FA5 A;  3HKZ N;  3E1S A;  5GAD J;  2E2I J;  2LLK A;  5DM7 F;  3CO6 C;  3T1B A;  2JT1 A;  2OUM A;  1X19 A;  3EQL F;  2RC4 A;  5HOD A;  1U8B A;  3G7R A;  2KIF A;  1OLT A;  3RZD J;  3TGN A;  2V26 A;  1VQM I;  3WGI A;  2RAS A;  4Y13 A;  1X58 A;  3FZV A;  5CPR B;  4P9U A;  2DQL A;  2YX4 A;  5L3G A;  2H1K A;  1MND A;  3H9G A;  4F93 B;  3VDX A;  5E1W A;  4P96 A;  3BCB A;  2I10 A;  2H8R A;  3O3K A;  2M7A A;  2Y30 A;  3JSO A;  4A5N A;  2X1E A;  4IHX A;  5CVV A;  3FMQ A;  3IUO A;  1R7J A;  4DIQ A;  2Y9Y A;  4ESJ A;  4PDK A;  1R36 A;  2PEX A;  2Z2S B;  1AKH A;  2VOD A;  2JRM A;  3TOB A;  3BQY A;  4Q4Z F;  2LC2 A;  1Q1V A;  4M3F A;  2GA1 A;  2H8W A;  3JRD A;  2MFZ A;  2OTL I;  1G3T A;  1YQA A;  3FHN A;  2A6H F;  1IJW C;  1QVT A;  2IVM A;  2BV6 A;  3J81 Z;  3HTA A;  4HAM A;  4MTD A;  2V79 A;  4YEJ A;  1UB9 A;  4M3G A;  2OF7 A;  2Y0S N;  1E2X A;  2CUE A;  4IZZ A;  4FX0 A;  4OMY A;  1I50 J;  3BG9 A;  3E97 A;  3K8P C;  2VON A;  3KE2 A;  4XL9 A;  2G7L A;  2L9N A;  4XLC A;  1YLF A;  2EFW A;  5K7F A;  3IL2 A;  2VXD A;  1YX5 A;  5DD4 A;  1WKM A;  5DCM B;  5ERI A;  2ISZ A;  1JGS A;  1W7P D;  1G6N A;  3HHG A;  1G3W A;  1G8X A;  1OJL A;  2A5W A;  4UUT A;  3IV5 A;  5F1J A;  2LBF B;  3G1O A;  3M1E A;  3CC7 I;  1CQT A;  2JVH A;  2DOD A;  4CH7 A;  1A31 A;  3ZQ7 A;  1R58 A;  1BIB A;  1MDM B;  4PJM A;  2HGC A;  1JXS A;  3F23 A;  2BY3 A;  2A61 A;  1TQP A;  1FOX A;  4G94 A;  5M5W J;  2K9S A;  3OIP A;  5J1R A;  1Z0X A;  3QQA A;  1BC7 C;  3W2W A;  2M0M A;  3NAR A;  4IRG A;  4F55 A;  4BQQ A;  1QO0 D;  4EGY A;  1B8I B;  2R5Z B;  1EJ9 A;  3VOE A;  4QLC U;  3A01 B;  3P5J A;  4XLF A;  1Z67 A;  2HU9 A;  4IRV A;  2NOG A;  4I76 A;  5F0F A;  1OCC H;  3E6M A;  3K0L A;  3KEY A;  4HX7 A;  1ZRF A;  1V5F A;  2RVC A;  3VEP A;  2DG8 A;  5EG0 A;  4A93 J;  2YUS A;  2IA2 A;  2LRE A;  4YFX F;  4NC8 A;  2M87 A;  2UUZ A;  4B3A A;  3Q9V A;  2WY7 Q;  3D0S A;  2PMZ A;  4GGG A;  2XF6 A;  5HVQ C;  4FT8 A;  4BE0 A;  3NAU A;  3BPV A;  2DA2 A;  2EB7 A;  5TJJ A;  5D1R A;  1KA8 A;  4KT5 C;  2IGO A;  3BZ6 A;  5CQG A;  2LOO A;  1T38 A;  4XRF A;  2TRT A;  4CCO A;  5FGL A;  1X3W B;  3S93 A;  2WV1 A;  4A0Y A;  3WU0 A;  4FIS A;  3T8T A;  4XK4 A;  1B1B A;  1BI3 A;  2Y48 A;  1GUU A;  2JUG A;  4X0G A;  3V8L A;  2KDZ A;  2QQ9 A;  4IQ4 A;  2IXS A;  3HRS A;  5CVR A;  1MH4 A;  4LOC A;  4F3Q A;  1S6L A;  3NPI A;  1UG0 A;  1VQ4 I;  2L9V A;  1VF9 A;  3DV8 A;  1U9N A;  1Y6I A;  4BE1 A;  1N78 A;  1QZY A;  2VI6 A;  4B43 A;  2DOA A;  2DOE A;  3L00 A;  1S7E A;  3QU6 A;  2DDA A;  1LNW A;  1ON2 A;  1J2X A;  5LRR A;  4DYQ A;  4HV5 A;  4UV9 A;  3CCY A;  3HB9 A;  2R7T A;  1Z6R A;  4CGZ A;  4OD4 A;  5L3E A;  2M34 A;  2VJ5 A;  5KHD A;  2JUC A;  2V1D A;  4D1Q A;  1ZQ3 P;  5FO5 A;  1AOY A;  5ILU A;  3RKQ A;  3K1M A;  3GVA A;  1YIT I;  2HS5 A;  4E7J A;  2F5V A;  3S3M A;  1U0J A;  1XD7 A;  2BY0 A;  2JMW A;  2GOM A;  3UNG C;  1IUY A;  5LGU A;  1XSX A;  2VB6 A;  4PK4 A;  4G7H F;  4A3K J;  5D18 A;  5DYM A;  2FQ3 A;  4EJU A;  1ETV A;  3VIB A;  4UUV A;  4M6X A;  5CLS A;  2LR8 A;  1YS7 A;  2NS0 A;  2YX7 A;  2RNJ A;  1JKO C;  2R4G A;  1ZR2 A;  4ZC3 A;  1MMD A;  5HDN A;  1LE8 B;  5ICF A;  1IN7 A;  4BXU A;  1QVU A;  1S29 A;  3CRJ A;  4ESB A;  2H27 A;  2JK3 A;  2DMQ A;  4HX4 A;  4WX9 A;  1TWA J;  2LD5 A;  4IOA F;  1Y8Q B;  1H89 C;  2LDU A;  3HOW J;  1UG2 A;  3LWJ A;  1WJA A;  3AG2 H;  4FE7 A;  5IP9 J;  5JVT A;  2VBW A;  2XAS A;  2VQH A;  2K5C A;  3F8B A;  4F91 B;  5AIQ A;  4S05 A;  3S14 J;  2HXO A;  3F8M A;  4OOI A;  1E3H A;  4EM2 A;  3MKW B;  2IA0 A;  1KQ8 A;  2IU5 A;  3MZY A;  2E71 A;  3FXK A;  3H92 A;  4XLN F;  2P5K A;  4OIN F;  2EFQ A;  3WHB A;  3WU2 C;  3VOX A;  2E1O A;  1FPQ A;  3WTY C;  4NQW B;  4EGZ A;  5C4Y A;  4UVC A;  3KET A;  3I53 A;  4E7L A;  4D9J A;  2DA1 A;  2KIM A;  2JVG A;  4U0Y A;  2P4W A;  2D6Y A;  2D2W A;  2V1X A;  4Q48 A;  3I4N J;  4ENM A;  2EZK A;  5C4J J;  2AHQ A;  2PI0 A;  5E17 F;  2ZJ2 A;  4KN4 X;  2WWY A;  5HS8 A;  2UZK A;  3BJA A;  4JKZ A;  2M3A A;  3L2R A;  2CSO A;  5BS6 A;  1OR7 C;  3I5U A;  1H0M A;  1E3P A;  2LG4 A;  2DMP A;  1FEX A;  2HKU A;  4B8X A;  2YR2 A;  2UXO A;  4BYY A;  1I5Z A;  1WQ2 A;  4KIB A;  2FXA A;  1P4X A;  4N4O B;  4PJN A;  4RLF A;  1YHQ I;  1J5Y A;  1HA8 A;  1Z05 A;  3M9A A;  1Y1W J;  4AC0 A;  1IC8 A;  3R0J A;  4BL0 B;  1EH8 A;  3K4K A;  3DBL B;  4NC6 A;  2NAZ A;  2GIV A;  1Y0N A;  3MKY B;  1F1Z A;  4M9X A;  2KT0 A;  3H3U A;  1R1T A;  5JVG F;  3KX2 A;  2GIZ A;  1WPK A;  4NN1 A;  5B1B H;  2HYF A;  3MCZ A;  3D1N I;  3K4M A;  3RH2 A;  5LGT A;  1LKX A;  1Y8R B;  3CCJ I;  4DBR A;  3HTJ A;  2KKO A;  3T8R A;  4I0A A;  3S1M J;  4BE2 A;  4Y7N J;  3AKZ A;  2L9R A;  2O3F A;  3RDI A;  2ZO4 A;  3S5R A;  3WTV C;  4P9F A;  4G7Z F;  1MMA A;  3V42 A;  2IGM A;  2YS9 A;  4IHT A;  4RM3 A;  5FLV A;  4XKC A;  2XHK A;  2GZW A;  2DTR A;  1TWC J;  3LFK A;  1S9H A;  5FLX Z;  3OYM A;  4QPO A;  2MLG A;  2DDB A;  1W5C C;  2FE3 A;  2ZNZ A;  3P9T A;  4E6K G;  4QSH A;  3P9C A;  3JAM Z;  5LHH A;  5LRS A;  3MNL A;  1KU7 A;  1Z3X A;  2FML A;  4JBA A;  3VB2 A;  2MC3 A;  4CCM A;  1EH6 A;  4XBF A;  1ZGA A;  5HLH A;  4EAT A;  2JSP A;  2F5C A;  1HDP A;  3SEZ A;  4A3M J;  2CGP A;  2W00 A;  2P6S A;  3OS2 A;  4BJT A;  1B4A A;  1ERD A;  4BS9 A;  2VJJ A;  1K7A A;  2Y75 A;  2KFD A;  1U5T A;  4BDY A;  4M3D A;  2Q24 A;  1FBS A;  3E6C C;  5D5V B;  3CCV I;  4WCG A;  3HDD A;  3TO6 A;  5EDN A;  1BR1 A;  3H5R A;  3HGY A;  3RJP A;  3L09 A;  3G56 A;  1YJ9 I;  2KP6 A;  4ZZD A;  4BXF A;  1FWZ A;  1YS6 A;  4XON A;  1XDS A;  3ELK A;  4D5C A;  3OSF A;  4ZDO A;  3FK7 A;  3Q9S A;  2NS8 A;  2RQQ A;  4HDU A;  4OD5 A;  1TQM A;  5B3S H;  3BG6 A;  3I0T A;  3GTP J;  1HOM A;  1OQY A;  2GQQ A;  4ZJZ A;  3H3Z A;  1QU3 A;  1R4N B;  3S32 A;  4IQJ A;  4IX7 A;  2X4H A;  2A3S A;  3WGH A;  4H4K C;  1Z9C A;  1ULY A;  2WUI A;  3K70 C;  1K83 J;  2YU3 A;  1BI0 A;  3OL3 A;  3L9F A;  5FRN A;  1ON1 A;  1I39 A;  5KVR A;  3NRG A;  3HC7 A;  2OZ6 A;  2FOK A;  3K4N A;  5F04 A;  4FCY A;  3A03 A;  2FBH A;  2FJ1 A;  4K2E A;  2HNH A;  2DAO A;  3FXL A;  1B9M A;  3RTR A;  3OYJ A;  1IN6 A;  4HDV A;  1K78 B;  3G1L A;  3HGG A;  3PIO F;  3CCS I;  1LDJ A;  1JJ8 C;  1IXS B;  1S8N A;  4G12 A;  2OI8 A;  4L9T A;  4A3E J;  1B9N A;  1H9G A;  3AG4 H;  3BWG A;  3WG7 H;  2RGV A;  4A6E A;  1XMK A;  4BJ6 C;  4HNT A;  5J4V A;  1SGM A;  1Z6T A;  1RC9 A;  3BR6 A;  4OU0 A;  4Y3O A;  2J5P A;  2VOP A;  4CYD A;  1UHM A;  3A0H C;  4AC6 A;  5E3L A;  5E8G A;  2M4K A;  1RKW A;  4M6Y A;  3EUH C;  3LSI A;  2LY2 A;  1UST A;  3VWB A;  2QQB A;  4U0V A;  3IWF A;  1XSD A;  1MMS A;  1SAU A;  2CU7 A;  3CUQ A;  3F22 A;  2PN6 A;  1TZL A;  3MMY B;  1MSE C;  4ASN A;  3ABL H;  3U9G A;  4Q47 A;  1ZG1 A;  1GDT A;  2FBK A;  2CYY A;  4LG0 A;  2QCO A;  1T2K A;  3E7L A;  5K7Z A;  3G4S I;  4XLP F;  1KZH A;  2P8T A;  1EF4 A;  4BHC A;  1NG6 A;  4XN0 A;  2EIK H;  2Z1D A;  2HDD A;  2KPM A;  4BY7 J;  1N75 A;  2LKS A;  3C18 A;  3GLL A;  1OIS A;  2NVQ J;  2OTJ I;  3FX3 A;  1MBJ A;  1ZG5 A;  4M71 A;  2NNN A;  3I59 B;  2ICW G;  2ZXH A;  3LA7 A;  5KAF C;  5GPC A;  3GTK J;  5FKL A;  3UKG A;  3HL2 A;  2X6X A;  3QOP A;  2HOE A;  2K9N A;  3BJB A;  3FIS A;  3LHQ A;  1BI1 A;  4XOT A;  4NUB A;  1WZ2 A;  1FBQ A;  1D5Y A;  2VPR A;  4R79 A;  2V57 A;  4KA4 A;  3LNQ A;  3CJD A;  1QA6 A;  1W7P B;  4CHU A;  1O57 A;  4WXH A;  3IHU A;  3G71 I;  1VTN C;  1Y1V J;  2H94 A;  1V55 H;  4YEL A;  1KYW A;  2ZME C;  1D3Y A;  2XSD C;  5F0C A;  3BG7 A;  3T6N A;  4QPQ A;  1W0U A;  2YSR A;  2ZOZ A;  1LVA A;  2RN7 A;  3SYT A;  2LP0 A;  2GAU A;  2Y0S A;  4GYI A;  2W53 A;  4WXC A;  3TQN A;  1SFK A;  1YFH A;  1GT0 C;  3F0C A;  3CC4 I;  5IT3 A;  5IYD J;  1CF7 A;  3EYY A;  2DT5 A;  4LJZ F;  4A3B J;  3F3X A;  3GTG J;  1RI7 A;  1U6G A;  3LQQ A;  5FGM A;  3WE3 A;  3K4J A;  1WCM J;  2WAQ N;  3P9K A;  4RDU A;  1J9I A;  1F9N A;  2ZNY A;  2OPT A;  3PO3 J;  1MGT A;  3Q5F A;  2YU9 J;  1QZE A;  1FYM A;  3RI4 A;  3DU5 A;  4RB2 C;  3VTI A;  2A07 F;  1UFM A;  1RET A;  3TOA A;  4EJO A;  1YJW I;  2H1L A;  2W25 A;  4L0Y B;  4BBS J;  1X2M A;  5LD2 C;  4B47 A;  3LMM A;  3LJL A;  3E5U A;  1TBX A;  2XAG A;  2ZJP F;  4IHY A;  1RES A;  4EMS A;  3BCA A;  4IF4 A;  1ETW A;  3DKW A;  4GO1 A;  2A05 A;  2HYT A;  2EWN A;  2JA2 A;  4KN7 X;  1PDN C;  3CCM I;  4N9H A;  3VP5 A;  2X1C A;  1QPI A;  2ADU A;  1T6S A;  4J01 A;  1GLN A;  1FIP A;  1XTA A;  3OR2 C;  4IO9 F;  2CUJ A;  3FDY A;  5J4Y A;  2NVT J;  1KQ0 A;  2M45 A;  2R3S A;  3GTM J;  5D19 A;  1AA7 A;  3DBH B;  2E5N A;  3O6B B;  5E1X A;  5B1A H;  1VQO I;  1QBJ A;  2OV7 A;  3PUF A;  4KIF A;  2I5U A;  1OCP A;  1EH7 A;  2EIJ H;  3BOQ A;  3HG9 A;  4V2F A;  1FLI A;  4F7Z A;  2ZCN A;  1IXR C;  5CXI A;  2LNB A;  3VW2 A;  2Q1Z B;  1B72 B;  3BC8 A;  4KIC A;  3CUQ C;  3I9V 2;  4XN3 A;  3W6J B;  3CJR B;  2LKP A;  4II3 A;  4B3X A;  3E7Q A;  5KCM A;  5D8K B;  1XS9 A;  2DA6 A;  2DFI A;  5FB2 A;  2NNY A;  2KIQ A;  2CS3 A;  3CP8 A;  4M9Z A;  1TWH J;  4AIK A;  4PUS A;  4A3I J;  2GXG A;  2ZME B;  4FET A;  5FKK A;  3HRU A;  1AU7 A;  1L3L A;  2HOT A;  2K85 A;  4IHW A;  3GTQ J;  2VJI A;  2DLL A;  1ZN2 A;  2ZB9 A;  3I58 A;  4A3C J;  3EYI A;  2ID3 A;  2XKP A;  3OYL A;  2UXH A;  3HOX J;  4I98 B;  3OY9 A;  2V6C A;  3FKJ A;  3TP0 A;  3RKX A;  3LAP A;  2ISY A;  3JRE A;  1FZP B;  1R49 A;  3D5R C;  1WFX A;  1ZRC A;  1HST A;  1XSV A;  4RAF A;  2PBX A;  3M8J A;  3B02 A;  4AUX A;  2Y31 A;  3G2B A;  5F08 A;  4L62 A;  2ZC2 A;  4EQQ A;  4LG3 A;  4CYC B;  1DPR A;  3IH2 A;  2IGN A;  4UY8 I;  1NHA A;  1XG1 A;  4I02 A;  1FMW A;  1LVK A;  3V7R A;  5FJ8 J;  1FOY A;  1WH7 A;  2FBQ A;  2DG7 A;  4GFB A;  1K4S A;  3IP4 B;  2R7Q A;  1SVO A;  5CKT A;  2CO5 A;  1D1B A;  5FHP A;  2XAQ A;  2IP2 A;  3KP3 A;  2KQR A;  4CO8 A;  5GTI C;  2HDW A;  2LMD A;  4BDZ A;  4BBR J;  4ON0 A;  5D5W B;  2QTQ A;  4KMU X;  3J7Y J;  2E2H J;  2NOJ B;  2L7F P;  5J47 A;  4FX4 A;  3I64 A;  5F1R A;  3OYK A;  4GCV A;  1YRN A;  1JUM A;  2QBY A;  3TBI A;  5KNL A;  1TTY A;  3EET A;  4E7K A;  1XGN A;  1A6I A;  3CJN A;  2Q2E A;  3BJO A;  4F52 A;  3H35 A;  2JA7 J;  2R7X A;  1I6H J;  4ACI A;  2CUZ A;  5L3B A;  2DMU A;  4CIC A;  3ZQQ A;  1OCO H;  3HE0 A;  4LFU A;  2RAE A;  3NQO A;  2JA6 J;  1YO5 C;  3EUK L;  2AO9 A;  2MLK A;  1C0W A;  2DXI A;  5DAJ A;  4JX4 A;  3GBG A;  3ASO H;  2R7V A;  3DEU A;  2HWV A;  3WTW C;  1Z77 A;  3MZ8 A;  2B9S A;  2PJR B;  5K58 A;  1I27 A;  1MIJ A;  3BTC A;  2D1V A;  2W85 A;  1HKQ A;  2ZBK A;  2O0Y A;  3S2W A;  4Z2Y A;  1NK2 P;  3CCR I;  5H6Q A;  1X1P A;  2VBY A;  5CVI A;  2O6G E;  4L0Z B;  5DEQ A;  1DPU A;  2XAJ A;  4MXM A;  2DQR A;  2XGE A;  3C3W A;  4DZP A;  2KZG A;  2OCC H;  4L5E A;  2B3W A;  2JN6 A;  1NTC A;  2H6B A;  1OYY A;  3GLX A;  1APL C;  2AXT C;  2M8G X;  1FSH A;  3GUD A;  5C4X J;  1R9T J;  2HVR A;  4RGU A;  3QYE A;  4C30 A;  4D7N A;  5BMZ A;  2EV0 A;  2DCE A;  2IEK A;  3Q0U A;  2E1M C;  4O3M A;  5FKN A;  2CFO A;  5E3M A;  3HIF A;  1NH3 A;  3ANG A;  1YTY A;  1DP7 P;  4PGG A;  2PX9 A;  3VSK A;  4QTR A;  3K70 D;  5IP6 A;  3MVP A;  1POG A;  1FTZ A;  3BJ6 A;  1X3U A;  2KJC A;  4G9Y A;  4NHJ A;  2GEN A;  4EVI A;  4DQ2 A;  2HOS A;  2GBY A;  2F5D A;  1A04 A;  2BGC A;  3VVZ A;  2UV1 A;  4BEH A;  3HZJ A;  4XNF A;  1DU0 A;  2WB1 A;  3WTX C;  5ED4 A;  2DTZ A;  2ZXW H;  2GFN A;  1T56 A;  3BR0 A;  3F6O A;  2HEO A;  2CJJ A;  4L5J A;  1FSE A;  1QRY A;  2IS2 A;  1BBY A;  3M4O J;  1GV2 A;  3DPT A;  5HBU A;  2L7Z A;  4G6D A;  3JRA A;  4BY1 J;  4E7S A;  1RR7 A;  3CWR A;  4MFD A;  1FP1 D;  2FOW A;  3G3Z A;  3KEO A;  3PUB A;  5JR3 A;  1IV6 A;  2K7L A;  1K61 A;  1KU2 A;  5ICG A;  1ONV A;  2V1N A;  1MJA A;  3FXQ A;  2AQE A;  2X9D A;  2PMU A;  2R7Z J;  5CVU A;  2DMT A;  5IP7 J;  1TWG J;  1IUF A;  2VQG A;  3TP3 A;  4AWX B;  3W2A A;  3S1Q J;  2G3B A;  2V1U A;  3N97 A;  3QPH A;  4ABZ A;  5D8L B;  1D0Y A;  4ZH4 F;  4OAZ A;  4A3F J;  4G6T B;  3KZZ A;  4P1W A;  1BM9 A;  1ZGJ A;  1JT0 A;  5A2Q K;  2EFP A;  1UAA A;  3RPU A;  3GXO A;  2K40 A;  3ZN1 A;  1P4A A;  2FRH A;  5H6R A;  3ML6 A;  4M73 A;  1I3Q J;  2BXZ A;  2ZXI A;  3ZR8 X;  3RD3 A;  1I6X A;  4A3D J;  1YIO A;  2K27 A;  1WJ5 A;  3WTZ A;  1NG7 A;  4P5O A;  4RMN A;  3F21 A;  3ZN0 A;  2A6E F;  5CQE A;  5LBQ A;  2L4A A;  2ZY9 A;  1GV5 A;  2XSJ C;  2ME0 A;  2WAD A;  3BDD A;  4ITV A;  3MQ0 A;  3S3O A;  3BRO A;  4BJ5 C;  4YII A;  2E1M B;  2HTJ A;  4XSX F;  4DOZ A;  3JSP A;  1J75 A;  4RS8 A;  3L2Q A;  1BC8 C;  2G9W A;  4PGH A;  1Z21 A;  1VQP I;  4RB3 C;  1A35 A;  2NP5 A;  2IA1 A;  2BW3 A;  5FKM A;  1I1G A;  4I01 A;  2CW7 A;  5C44 J;  4MNU A;  5H2F C;  3HPG A;  3R4K A;  2Y9Z A;  2ZCM A;  2V9V A;  2W7N A;  3OIQ A;  3OS0 A;  1SD7 A;  1MJ9 A;  3PNY A;  1UI5 A;  3QYB A;  3DKY A;  2MD5 A;  2HQN A;  3W3C A;  3VSL A;  3GEZ A;  1HW5 A;  5E8I A;  4OWR B;  4XRM A;  4RAG A;  2KLO A;  2Y69 H;  1EV7 A;  5F0H A;  1X1A A;  3KP5 A;  2JZY A;  1YX3 A;  2DU9 A;  1D8J A;  3LQR A;  1UEL B;  1W0T A;  1Z3Y A;  3F72 A;  2FQ4 A;  3R6S A;  3ERM A;  2GXB A;  1V5E A;  5HNF A;  2RHA A;  4ZYA A;  3PFY A;  1Q1H A;  2CV1 A;  1H8A C;  4GRI A;  4HPQ A;  3G6E I;  3MZH A;  3ZQF A;  4ENJ A;  1PP7 U;  3H3V K;  5H9T A;  3NWS A;  3TL4 X;  3ZOB A;  4KIT B;  1YYV A;  4XKV A;  1QGP A;  2KHM A;  2Z3Y A;  3GWZ A;  5K5O A;  1QZZ A;  5EGO A;  3AL0 C;  3U1D A;  4CCJ A;  2HR3 A;  1U78 A;  4D7M A;  5DDG A;  4GFL A;  1N25 A;  2CQN A;  1BN5 A;  1UHS A;  2HKX A;  2BBY A;  1IW7 F;  2EBI A;  2QEX I;  1K79 A;  4Y17 A;  5K7H A;  2ZSI B;  3AG1 H;  2B7E A;  4FTH A;  4UB8 C;  2FNA A;  5LEJ A;  2PJP A;  1FNN A;  2B0L A;  4QIW N;  3S3N A;  3M1C A;  4B48 A;  3PO2 J;  3E6D A;  4G7O F;  2JSC A;  2RRE A;  2DT6 A;  1ZRD A;  3VYT B;  5BPI A;  5J8C A;  4G6Q A;  3WTU C;  1HXD A;  1ZAO A;  2W57 A;  3SFI A;  2QKL B;  3HOZ J;  2H09 A;  2ZOY A;  3KKC A;  2R7U A;  1HKS A;  5IYC J;  3ABM H;  4NB5 A;  2UXU A;  1X4P A;  2EIM H;  5M3M J;  3BCG A;  3OYG A;  4HSR A;  2G7S A;  1PP8 F;  2OA4 A;  1AKH B;  3BP8 A;  2G7H A;  1WVR A;  1Y39 A;  3DPU A;  1ZG3 A;  1TT5 B;  1ZLJ A;  5CVJ A;  4CA0 A;  2IS1 A;  3BTJ A;  1O3T A;  3CCU I;  3QAH A;  1QPM A;  2HI3 A;  2R5Y A;  4JP0 A;  1K6Y A;  2EIN H;  1JKQ C;  1E0E A;  3ASN H;  3DPL C;  4DW6 A;  4E70 A;  4E4H A;  3WTT C;  3QOE A;  1B6A A;  1FBU A;  2F5E A;  2FNP A;  4HW0 A;  1J7K A;  1BW5 A;  5LEK A;  1R22 A;  1PYV A;  3JRI A;  3KP6 A;  2NVU B;  3FMS A;  3F8N A;  3LSP A;  3N4M A;  1RR8 C;  4WK8 F;  4EJT A;  3FXM A;  4I7H A;  5FD6 A;  1R5G A;  3SWH A;  2BYV E;  3KCC A;  2CV0 A;  3S8P A;  1ZEL A;  2YPR A;  3RKY A;  4A6D A;  2E36 A;  2BE5 F;  4A0Z A;  5EFY A;  1SD4 A;  4JX5 A;  2Y0M A;  1YIJ I;  4ZTJ A;  5LFA A;  3S17 J;  3JR9 A;  1JE8 A;  4LIV A;  1N77 A;  3ESW B;  1Z7U A;  2F07 A;  2L01 A;  1ITY A;  1OYI A;  4UDS A;  1VZ0 A;  1Z91 A;  1GVJ A;  3CMM A;  3F9K A;  2WAQ A;  3L2C A;  4LLN A;  1ETO A;  3JW4 A;  3OYH A;  3I4M J;  1K6O A;  1K4T A;  2LY9 A;  2WAE A;  5KAI C;  3QWL A;  2X0L A;  4XQF A; 
#chains in the Genus database with same CATH homology
 1Y1V J;  2RAS A;  1MBF A;  4JL3 A;  1PUF A;  2XSD C;  5F0C A;  1X58 A;  3T6N A;  4C3J J;  3QPS A;  1W0U A;  2ZOZ A;  2H1K A;  2MW8 A;  3B6C A;  2LP0 A;  2W53 A;  3NXC A;  5EG0 B;  4B4C A;  3B81 A;  5JLX A;  1GT0 C;  2N8G A;  3F0C A;  2I10 A;  2H8R A;  3B6A A;  3L1P A;  2Y30 A;  5IYD J;  3CMY A;  1WGX A;  4A3B J;  5IOZ A;  4IHX A;  3GTG J;  2Y9Y A;  4DYC A;  1WCM J;  2WAQ N;  5IPA A;  3OSG A;  3COL A;  1MBK A;  1AKH A;  2DA5 A;  1F43 A;  3BR3 A;  2HQ5 A;  1U9O A;  3HM5 A;  4RDU A;  3BQY A;  2Y2Z A;  3RQI A;  2OPT A;  1Q1V A;  4M3F A;  3PO3 J;  1UI6 A;  2NVY J;  2YU9 J;  2IAI A;  3JRD A;  3TW6 A;  3ANP A;  1MBG A;  2DA3 A;  1BW6 A;  2ZCX A;  1IJW C;  1RET A;  3S2D J;  1QVT A;  4BBS J;  3HTA A;  1X2M A;  3BRU A;  3ZQC A;  3LJL A;  4M3G A;  2OF7 A;  2Y0S N;  2CUE A;  4IHY A;  1RES A;  1MH3 A;  1MNM C;  1ETW A;  1I50 J;  3BG9 A;  2G7L A;  5K7F A;  2HYT A;  3VP5 A;  1QPI A;  3SDG A;  1YRN B;  2L0K A;  1FIP A;  2NVT J;  2JA8 J;  4B1R A;  1VND A;  2FX0 A;  4D5F A;  3GTM J;  5D19 A;  4XID A;  1OJL A;  1RKT A;  3AQT A;  4UUT A;  3IV5 A;  5F1J A;  3BHQ A;  3G1O A;  2LK2 A;  1VI0 A;  1OCP A;  1CQT A;  3SJM A;  3JRH A;  4V2F A;  2X6O A;  2ZCN A;  4UUS A;  5CXI A;  3VW2 A;  4PXI A;  1B72 B;  5M5W J;  2K9S A;  3E7Q A;  5J3L A;  3F1B A;  1XS9 A;  5J1R A;  1Z0X A;  2DA6 A;  3QQA A;  3OOU A;  3NAR A;  2DJN A;  1B8I B;  2R5Z B;  1TWH J;  1SFO J;  3A01 B;  4A3I J;  5FKK A;  2NOG A;  3BG3 A;  4I76 A;  5F0F A;  3VOK A;  1AU7 A;  1MSF C;  2XB5 A;  2HOT A;  4J19 A;  4W1U A;  4IHW A;  3GTQ J;  2ECB A;  2ZB9 A;  2DG8 A;  1MBE A;  5EG0 A;  4A3C J;  4A93 J;  2YUS A;  2ID3 A;  2UXH A;  4B3A A;  3HOX J;  2P81 A;  5F27 A;  3TP0 A;  2WB1 N;  3NAU A;  2XPU A;  2DA2 A;  3JRE A;  4AF5 A;  2HXI A;  5D1R A;  2PBX A;  2XPV A;  2TRT A;  4AUX A;  3GEU A;  5FGL A;  1ENH A;  2Y31 A;  3GZI A;  5F08 A;  4L62 A;  2WV1 A;  3M3Y J;  3W6V A;  4FIS A;  1ETQ A;  4CYC B;  3IH2 A;  1DU6 A;  4MK6 A;  2EZL A;  4XK4 A;  1XG1 A;  1GUU A;  2KDZ A;  5FJ8 J;  3EGQ A;  3MN2 A;  1JKR C;  2GLO A;  1MH4 A;  1WH7 A;  4LOC A;  3K2A A;  2DG7 A;  4GFB A;  2FBQ A;  3NPI A;  1SAN A;  2XPW A;  5FHP A;  1VF9 A;  1U9N A;  2VI6 A;  1S7E A;  4BBR J;  2QTQ A;  2D5V A;  3C07 A;  3VVY A;  4DYQ A;  2PMZ N;  3CCY A;  3CQZ J;  3HB9 A;  2VKE A;  2E2H J;  2L7F P;  2QF7 A;  4JX6 A;  4HNV A;  2QIB A;  2IBD A;  1YRN A;  3BTI A;  3FK6 A;  1JUM A;  2R93 J;  2M34 A;  1H88 C;  1WH5 A;  2LFB A;  1A6I A;  2JA7 J;  1ZQ3 P;  3V78 A;  5DTD A;  3IH3 A;  1I6H J;  4AYB N;  4ACI A;  3OIO A;  5AQC A;  2DMU A;  2QWT A;  3RKQ A;  9ANT A;  3O8H A;  3HE0 A;  2G0E A;  2RAE A;  2JA6 J;  2M2E A;  2AO9 A;  2CQX A;  5DAJ A;  3BR2 A;  2PZ9 A;  4MIM A;  4JX4 A;  3GBG A;  2JMW A;  1B72 A;  5M5Y J;  3ZQG A;  1JKP C;  1Z77 A;  2R0Q C;  1TC3 C;  4A3K J;  2VUM J;  5D18 A;  1FIA A;  5K58 A;  2OER A;  5JLW A;  3BTC A;  1X2N A;  1ETV A;  4M3B A;  3VIB A;  3JRC A;  3IUV A;  1B8I A;  1NK2 P;  2R5Z A;  2LR8 A;  2DA7 A;  1JKO C;  2JJ7 A;  4RBO A;  2K9Q A;  1ZR2 A;  2JWT A;  4Y52 J;  3WHC A;  4MXM A;  4DZP A;  2XGE A;  1LE8 B;  1BJZ A;  4L5E A;  2O8K A;  1QVU A;  2JN6 A;  2ECC A;  3CRJ A;  1NTC A;  1APL C;  2JK3 A;  2M8G X;  2DMQ A;  3BQZ A;  1IGN A;  5C4X J;  1TWA J;  1R9T J;  2LD5 A;  1H89 C;  4D7N A;  1T33 A;  3DEW A;  3HOW J;  1UG2 A;  1IDY A;  4IHV A;  1MBH A;  3LWJ A;  2IEK A;  3Q0U A;  5FKN A;  5E3M A;  3ANG A;  3LSG A;  4FE7 A;  5EZG A;  4QTR A;  2QOP A;  5IP9 J;  5IP6 A;  4DYR A;  1JUP A;  3MVP A;  3HIM A;  1POG A;  1FTZ A;  4X1E A;  1JJ6 C;  3S14 J;  1OFC X;  2HXO A;  3JRG A;  1HF0 A;  2IU5 A;  2GEN A;  2HOS A;  2GBY A;  4KWA A;  4CYC A;  3FIW A;  3VVZ A;  2DMN A;  1DU0 A;  4XRS G;  3WHB A;  1O4X A;  3EUP A;  2E1O A;  3VOX A;  2X48 A;  2DTZ A;  2TCT A;  1PUF B;  1HLV A;  4A3G J;  2GFN A;  5C4Y A;  1T56 A;  2O9L A;  2O7T A;  2YVH A;  3BR0 A;  3BNI A;  2CJJ A;  3BT9 A;  2DA1 A;  1QRY A;  1BA5 A;  2LVS A;  2HYJ A;  3M4O J;  4GCT A;  2D6Y A;  3GTJ J;  2NX4 A;  1GV2 A;  2L7M P;  3JRF A;  2L7Z A;  2XB0 X;  3I4N J;  5HBU A;  3JRA A;  4MFE A;  4BY1 J;  2EZK A;  1RR7 A;  2AHQ A;  2MG4 A;  5C4J J;  3CWR A;  4MFD A;  4JKZ A;  2ME6 A;  4DZJ A;  3S16 J;  1IV6 A;  1K61 A;  4HKU A;  3TW7 A;  2DMP A;  1FEX A;  2HKU A;  2UXO A;  3DPJ A;  2X9D A;  2R7Z J;  3QKX A;  5EF6 A;  3BJB A;  2DMT A;  5IP7 J;  1TWG J;  1IUF A;  3TP3 A;  1Y1W J;  4AC0 A;  1P7I A;  1IC8 A;  2EZH A;  3S1Q J;  1IRZ A;  2GUH A;  1ETK A;  3RZO J;  2G3B A;  4ABZ A;  2VKV A;  5EGO B;  2DA4 A;  3ZQI A;  5IYB J;  2LTP A;  4A3F J;  2O7O A;  2FD5 A;  1XC5 A;  2KT0 A;  4MLO A;  2XRL A;  3HTH A;  2JA5 J;  3O60 A;  4M3E A;  5FKO A;  5E3N A;  1JT0 A;  1WPK A;  4NN1 A;  3S1R J;  2K40 A;  3D1N I;  2XDN A;  3FKI J;  3RH2 A;  3GTL J;  3FRQ A;  2CUF A;  1I3Q J;  4M6V A;  3Q0V A;  3HTJ A;  2CQQ A;  2R92 J;  3S1M J;  3O8G A;  1JUS A;  1JTX A;  3RD3 A;  1LE8 A;  4A3D J;  1P7J A;  3ZQH A;  4Y7N J;  2L9R A;  2DN0 A;  1JGG A;  3TED A;  1AHD P;  4IEJ A;  3VW0 A;  1GV5 A;  2ME0 A;  3S5R A;  1ORK A;  4JYK A;  3V6G A;  3VUQ A;  2B63 J;  1HDD C;  3C2B A;  3K7A J;  3HTI A;  3IH4 A;  4MO7 A;  2YS9 A;  3NI7 A;  2HOA A;  4GFK A;  2UXI A;  2NS7 A;  1ZR4 A;  2MSY A;  3NNR A;  5FLV A;  1IG7 A;  4UUS B;  4XRS A;  1TWC J;  1LFU P;  3BG5 A;  5CXG A;  2YVE A;  3KNW A;  1NK3 P;  5E3O A;  2LKX A;  3HOU J;  2NP5 A;  3P9T A;  4QSH A;  5FKM A;  1G2H A;  4XIC A;  3MNL A;  1RPW A;  2M0C A;  3S2H J;  5IOY A;  1IDZ A;  5C44 J;  2ZCM A;  2Y9Z A;  2R5Y B;  1HDP A;  4A3M J;  1UI5 A;  3A02 A;  4XRM A;  4M3D A;  3VVX A;  5DS9 A;  2Q24 A;  5F0H A;  4JNN A;  4I6Z A;  2ELK A;  2NP3 A;  1ZTR A;  5M3F J;  5FMP A;  4A3L J;  4S0H B;  1FTT A;  3A01 A;  1W0T A;  3HDD A;  2FQ4 A;  5EDN A;  1BL0 A;  3VPR A;  2G7G A;  3HGY A;  2MGQ A;  2RHA A;  3G56 A;  1LFB A;  1H8A C;  5M5X J;  1GVD A;  4V2G A;  3LSJ A;  4D5C A;  3ZQF A;  3HOV J;  4C2M J;  3OSF A;  3H3V K;  3ON4 A;  5H9T A;  1WI3 A;  3FK7 A;  3ZOB A;  1ETX A;  2EZI A;  2NS8 A;  2REK A;  3QPL A;  1OCT C;  3GTP J;  5EGO A;  1HOM A;  5FLM J;  2QKO A;  3LSR A;  3Q3S A;  1U78 A;  2XGC A;  4BXX J;  4D7M A;  2WUI A;  2NVX J;  4GFL A;  3G1M A;  1K83 J;  3BTL A;  3HEF A;  3KKD A;  1UHS A;  3NRG A;  2EBI A;  1ZKG A;  4A3J J;  5K7H A;  5GP9 A;  1UMQ A;  3CDL A;  5F04 A;  4FTH A;  4C3H J;  2EQR A;  5EZH A;  4FCY A;  3A03 A;  5CW8 A;  4QIW N;  2FJ1 A;  3PO2 J;  4CGR A;  2EH3 A;  3ZQL A;  3VW1 A;  3DCF A;  3JSJ A;  3PAS A;  3G1L A;  3HGG A;  4EEF G;  2W48 A;  3PPB A;  1JJ8 C;  3SFI A;  4G12 A;  4NDL A;  3HOZ J;  2ZOY A;  2OI8 A;  3KKC A;  2UXP A;  5IYC J;  3Q0W A;  4A3E J;  2M9H A;  5C3E J;  2UXU A;  2CRG A;  5EEA A;  4X6A J;  5M3M J;  3S15 J;  3BCG A;  1SGM A;  4ICH A;  2E19 A;  1F36 A;  3AQS A;  4BKX A;  3BR6 A;  2E2J J;  2G7S A;  3KZ9 A;  3BR1 A;  1AKH B;  4AC6 A;  5J1Y A;  3HOY J;  5E3L A;  1RKW A;  1VFC A;  1ETY A;  2COB A;  3BTJ A;  4ME9 A;  1JTY A;  3QBM A;  2HI3 A;  2R5Y A;  4JP0 A;  1JKQ C;  2CU7 A;  3MKL A;  4DW6 A;  4FE4 A;  1ZK8 A;  1MSE C;  3S1N J;  5HSZ A;  1JT6 A;  1ZGW A;  4GCL A;  3BR5 A;  3JRB A;  4YZE A;  1GDT A;  1FJL A;  1BW5 A;  3JRI A;  1A5J A;  4C3I J;  2QCO A;  3LSP A;  3E7L A;  5K7Z A;  3H0G J;  5J1U A;  2XGD A;  1EF4 A;  2WGB A;  3ON2 A;  3HBL A;  2HDD A;  5EYR A;  4BY7 J;  3LOC A;  5GPA A;  4A69 C;  4NEL A;  5EFY A;  1TWF J;  2GM4 A;  4JX5 A;  2NVQ J;  1MBJ A;  3PM1 A;  4W97 A;  3JR9 A;  3S17 J;  5GPC A;  3GTK J;  5FKL A;  3UKG A;  3GTO J;  2K9N A;  3HKZ N;  3FIS A;  1ITY A;  2F07 A;  3LHQ A;  2E2I J;  4UDS A;  2LLK A;  1D5Y A;  2VPR A;  1HCR A;  2ID6 A;  2V57 A;  3LNQ A;  1E3O C;  5BNG A;  1ETO A;  3I4M J;  3CJD A;  5HOD A;  4GCK A;  1U8B A;  3G7R A;  2LY9 A;  5HAW A;  3RZD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...