1JT6A

Crystal structure of the multidrug binding protein qacr bound to dequalinium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Hypothetical transcriptional regulator IN QACA 5'region
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 81
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jt6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jt6A02
2DMPA 1EF4A 1FTTA 5D19A 3HOYJ 3S2HJ 4MFEA 5CXIA 1WCMJ 2XGDA 1MH3A 5FKLA 4Y7NJ 2ME6A 3E7LA 1HF0A 3VPRA 1LE8B 4ME9A 3CMYA 2OF7A 2NVXJ 2H1KA 2DA3A 4B3AA 1TWHJ 2DMUA 3JRHA 3S17J 3KKDA 1GV2A 1MBKA 1AU7A 3QQAA 2UXPA 5M5YJ 1JT0A 3SDGA 2OPTA 3G1LA 3V6GA 5K7ZA 3BTLA 2PBXA 2VUMJ 3G1OA 2HOAA 3VVZA 2AO9A 5IPAA 1JKQC 1HDPA 2L7FP 5DTDA 5IOZA 4FTHA 1VFCA 1QPIA 4BBSJ 3S2DJ 2XGEA 3BR1A 3GTJJ 1SGMA 3BJBA 4GFKA 1MBFA 3JRAA 3IH2A 5F04A 3RZDJ 3BT9A 2UXHA 5EDNA 4UUSB 2CJJA 5EZGA 1MSEC 2ZCXA 2MSYA 4IEJA 2Y30A 2UXIA 3IH4A 2DMQA 2Y31A 3VW2A 1OCPA 1JGGA 5D18A 1WPKA 2HOSA 4BY1J 3TW6A 3JRDA 2HQ5A 1CQTA 2MW8A 3S1QJ 3BCGA 3NI7A 1HCRA 1MBJA 2R5ZA 1X2NA 4JP0A 2DA1A 2LK2A 4C3HJ 2XB5A 2UXOA 3DPJA 2RHAA 4W1UA 1WH7A 2XB0X 3L1PA 3VOXA 1Y1VJ 1NK3P 1F43A 5CW8A 4CYCA 1IJWC 2DTZA 4DYQA 2EBIA 3DCFA 4LOCA 2L9RA 3LSPA 4MO7A 2HYTA 1H89C 4AC6A 4D7NA 4XRMA 3H0GJ 1NTCA 1JKPC 4GFLA 1UI6A 3GTMJ 5K7FA 2X6OA 5BNGA 5EG0A 4A3BJ 2K9NA 4DZPA 3RKQA 2DA5A 2B63J 2XRLA 3QBMA 3BG9A 1GUUA 2IEKA 1MSFC 1ZR4A 3Q0WA 1FIPA 1W0UA 2XDNA 5FKKA 5FHPA 4PXIA 5EF6A 3FKIJ 3S15J 5E3OA 3RQIA 3FK6A 2Y9ZA 2HI3A 2E2JJ 4DW6A 2CQQA 2E2IJ 2NS7A 4HKUA 2XPWA 4M3GA 4XRSA 4L5EA 1UI5A 5DAJA 5AQCA 3B81A 4EEFG 3NPIA 3BR0A 3HM5A 3Q0VA 2G7GA 2YVHA 1JKOC 5DS9A 1XG1A 2Y2ZA 5IYDJ 2HXOA 5C4YA 4A69C 1B72B 1U8BA 2M0CA 2L7ZA 3A01A 1JT6A 3OSGA 3M3YJ 3LHQA 5D1RA 3JRBA 4JX6A 5CXGA 3HE0A 1TC3C 2IBDA 2ZB9A 1VF9A 4X1EA 5HODA 4RBOA 1SANA 3RD3A 2ZCMA 1RR7A 2W48A 3LOCA 5GPCA 2NVYJ 4C3IJ 3HGYA 4AC0A 2COBA 4C3JJ 5J1YA 5F1JA 1ZK8A 1FIAA 5EZHA 2NVQJ 4MK6A 3KZ9A 3COLA 2XSDC 3GEUA 1ZTRA 4YZEA 1FEXA 5FKMA 3HTHA 1IG7A 3OOUA 2ELKA 4W97A 5FLMJ 2QOPA 2CU7A 3B6AA 1BL0A 4GFBA 2R0QC 4UUTA 1Z77A 3VP5A 2DA6A 5F08A 2YUSA 1UG2A 2UXUA 1I3QJ 1B72A 2G3BA 3HTAA 1HDDC 5C44J 1S7EA 3BR5A 5F27A 5K7HA 2R5YA 3QPSA 3H3VK 2GUHA 4M3FA 2R7ZJ 2NVTJ 2MG4A 3VIBA 2R93J 2VKEA 3PM1A 2R5ZB 3LSJA 5F0CA 4IHVA 1IDYA 4BY7J 1JJ8C 1SFOJ 4GCKA 5C4JJ 4CYCB 2HYJA 5M3FJ 2LP0A 1H88C 3VOKA 3HGGA 3G56A 1ETQA 2WV1A 3NARA 3BTJA 1ITYA 3IV5A 2LD5A 1QRYA 3C07A 4FE4A 2LVSA 3S1MJ 1YRNA 2DJNA 4FE7A 3RH2A 3VW0A 3HOVJ 4AYBN 5EG0B 2OERA 1IC8A 3E7QA 2GM4A 1T33A 4KWAA 4CGRA 1JTXA 4D5CA 1JJ6C 3M4OJ 2JA7J 2E2HJ 4MFDA 3CDLA 3HOZJ 3G7RA 5J3LA 1BW6A 1W0TA 2LY9A 1K61A 4DZJA 3GTOJ 5IYBJ 3AQSA 1WGXA 1JKRC 5K58A 3LWJA 5JLWA 4RDUA 3FIWA 1ENHA 1JUPA 4A3MJ 2CUFA 3ON2A 4NN1A 4B4CA 1ETXA 1BJZA 1I6HJ 1T56A 5IOYA 2M34A 2ZOYA 3SJMA 1TWCJ 3LJLA 2ZOZA 2GLOA 3Q0UA 2VPRA 1UMQA 3BTIA 3BR3A 2Q24A 2ZCNA 1RKTA 1MBGA 2TRTA 1A5JA 2LFBA 2XGCA 5EFYA 4ICHA 2TCTA 1RESA 2L0KA 1GT0C 1U9OA 3SFIA 3A01B 1ETOA 1HOMA 1NK2P 5HBUA 4V2GA 5C3EJ 2DA7A 3ZQHA 2FD5A 3VVYA 2IU5A 1WI3A 3K7AJ 2WGBA 3C2BA 3VUQA 5E3NA 4L62A 3PO3J 4FISA 5F0HA 4A3GJ 2NP5A 4D5FA 3ZQGA 2P81A 3HB9A 4A3EJ 1P7JA 2M2EA 3MKLA 1XC5A 1TWAJ 5E3LA 1Z0XA 3BTCA 1ORKA 5EYRA 2I10A 1I50J 3IH3A 4JYKA 3JREA 4C2MJ 3HTJA 2LTPA 2VI6A 3JRIA 1BW5A 3LSGA 4M3DA 3NAUA 3ZQIA 1R9TJ 5J1UA 2EZLA 2DA4A 3S1RJ 3JR9A 1TWGJ 4M3BA 2GENA 1MBEA 4MIMA 2R5YB 1BA5A 1E3OC 4G12A 2QCOA 2Y9YA 3G1MA 2FJ1A 1JUMA 2HOTA 1IGNA 1POGA 5HAWA 5C4XJ 4Y52J 3CCYA 3BG5A 3BHQA 3HDDA 1UHSA 5IP6A 4JKZA 3MN2A 4XIDA 1X2MA 2EQRA 4AUXA 1HLVA 4NELA 4XICA 3I4NJ 1GDTA 4IHXA 3PPBA 1OFCX 1ZKGA 4BKXA 1IUFA 2DMTA 2ME0A 3FRQA 2XPVA 1PUFB 3TW7A 2X48A 2HXIA 1YRNB 3GTGJ 2LLKA 2FBQA 2CRGA 2O7OA 1ETKA 2EH3A 3KKCA 3NRGA 4JX4A 1B8IA 3GTKJ 1TWFJ 1F36A 2GFNA 1P7IA 4GCTA 4ABZA 1ETWA 1H8AC 2EZKA 3TP3A 3GTQJ 3ANPA 1MBHA 4XRSG 4QTRA 1ETYA 2L7MP 4BBRJ 3EUPA 3OSFA 3P9TA 2HKUA 4I6ZA 1G2HA 1LFUP 4IHYA 5F0FA 5HSZA 3CWRA 3A03A 3HOWJ 2R92J 2YS9A 2RASA 3GZIA 1IV6A 2LR8A 2DG7A 3AQTA 4A3FJ 2FQ4A 2JMWA 3S14J 3VW1A 5H9TA 3K2AA 3O8HA 3LNQA 3JRCA 5EEAA 4A3DJ 1PUFA 4D7MA 2NS8A 3UKGA 2O8KA 4UDSA 1JTYA 3HTIA 5FLVA 4MLOA 3ZQFA 1JUSA 5J1RA 1GVDA 3TP0A 1AKHA 1U78A 3BQYA 5GPAA 4A3IJ 3JRFA 3CJDA 5IYCJ 3MNLA 1ZGWA 2WB1N 4DYRA 3BRUA 3VVXA 4IHWA 3RZOJ 1DU6A 2JA5J 2XPUA 1LFBA 3HKZN 2FX0A 3F0CA 2NP3A 4MXMA 2DA2A 2JJ7A 4ACIA 3CQZJ 2RAEA 1MH4A 2W53A 2NX4A 3QPLA 5IP9J 2M9HA 1ETVA 3HEFA 3HBLA 2M8GX 3W6VA 4XK4A 2ID3A 4S0HB 5FKOA 1GV5A 3T6NA 1LE8A 1APLC 2Y0SN 4JX5A 2QKOA 1OJLA 2WAQN 1VNDA 1FJLA 1IRZA 3ZOBA 1RKWA 5IP7J 2PMZN 1ZR2A 3KNWA 3PASA 4X6AJ 3EGQA 3QKXA 2OI8A 4GCLA 5EGOB 1AHDP 4A3CJ 3Q3SA 3O8GA 1QVTA 3F1BA 3BNIA 3S1NJ 4BXXJ 4A93J 2D6YA 1DU0A 2DN0A 1K83J 2VKVA 2YVEA 9ANTA 4HNVA 5FGLA 2JK3A 5E3MA 2WUIA 3I4MJ 2O9LA 2QIBA 4UUSA 1Y1WJ 2HDDA 2NOGA 4J19A 3ZQLA 1WH5A 3GTPJ 1RETA 5M5WJ 5M3MJ 2YU9J 3NXCA 2G0EA 2MGQA 4JL3A 1VI0A 5JLXA 2KDZA 2DG8A 1A6IA 3ON4A 3FISA 3JSJA 2JA8J 4FCYA 2PZ9A 2GBYA 1FTZA 2KT0A 3B6CA 1B8IB 2V57A 1QVUA 4V2FA 2LKXA 3OIOA 4AF5A 1Q1VA 5EGOA 3PO2J 2CUEA 3HOXJ 1IDZA 2G7LA 2EZHA 3BR6A 3GTLJ 5M5XJ 1OCTC 2E19A 1RPWA 3S5RA 2REKA 3FK7A 3ZQCA 2ECBA 2QF7A 3WHCA 1D5YA 2O7TA 3NNRA 4I76A 3HIMA 1X58A 2DMNA 4M3EA 4NDLA 2IAIA 3LSRA 1XS9A 1MNMC 2G7SA 3D1NI 3CRJA 3BQZA 4B1RA 3V78A 5FMPA 2CQXA 2QWTA 4A3JJ 4M6VA 5GP9A 3JRGA 2ECCA 2D5VA 2K9QA 4A3LJ 4QSHA 3DEWA 3ANGA 2N8GA 3IUVA 1O4XA 3BG3A 2QTQA 1AKHB 4DYCA 3TEDA 2JA6J 2K40A 3WHBA 3O60A 3S16J 2JWTA 3GBGA 3BR2A 2ID6A 2EZIA 2X9DA 1ZQ3P 4JNNA 4QIWN 2F07A 2JN6A 1U9NA 3MVPA 2H8RA 4A3KJ 2E1OA 2K9SA 3HOUJ 5FKNA 5FJ8J 3A02A 2AHQA
chains in the Genus database with same CATH superfamily
4E7HA 2OC6A 3IKVA 2BGCA 4I99C 2HQAA 4ZYGA 1WCMJ 1LDKB 1MDMB 2XGDA 2ME6A 3E7LA 2OCEA 3GF2A 2BZTA 3VPRA 4G7OF 3R0JA 2DXIA 1SEUA 4ME9A 4HAMA 3JAMZ 1LEBA 1YLFA 4B3AA 3JRHA 1GV2A 2VXDA 3GZ6A 2P5LC 2IA0A 1AU7A 4WK8F 3SDGA 2V7FA 3DKWA 4BDZA 2B9SA 3DKXA 2L02A 1UAAA 1HW5A 4IOCF 4L9TA 3WTTC 2JRMA 2KPMA 1D1BA 1KZHA 1EV7A 4XBFA 3F8CA 1MNEA 2AO9A 5IPAA 1HDPA 1Y6IA 2GOMA 4R8HA 3W2AA 5HDNA 1K78B 1OLTA 2JT1A 4LG0A 1A36A 2XF7A 2A2FX 3IH2A 1KU3A 4XSXF 2VOPA 5EZGA 2R7RA 2ZCXA 2DJIA 2HKOA 1X1DA 2XRNA 4RB1A 4XLAA 4IEJA 2UXIA 3IH4A 3DLLF 1USTA 1ULYA 5BQTA 4KYWA 2PLYA 1WPKA 2HOSA 4I09A 1HCRA 4GO1A 4OAZA 3I53A 4YEJA 3BPXA 3ZPLA 3ABKH 4BUPA 4C3HJ 3LSTA 4AD9A 1YX5A 2KRHA 1D3YA 1FBUA 4W1UA 3REOA 3L1PA 5D6EA 1TQIA 3K1MA 4XN3A 4RA2A 3IC7A 2HDCA 3JSOA 1F43A 4LB6B 4G6TB 1MJ9A 3RI4A 1IJWC 5LLQA 2EILH 3WU0A 2DTZA 4MTEA 2V9KA 3LSPA 2OUMA 4Y15A 4EM1A 1Z3XA 4IX7A 4DOZA 1RZ4A 1YOVB 1L3LA 4GFLA 3GTMJ 1KQ0A 1NG7A 1BI2A 2X85A 2K9NA 2H94A 4HOBA 1MMGA 1JGSA 3DKYA 1WJAA 4IZZA 1MSFC 1XSVA 3Q0WA 1FIPA 1W0UA 2FNPA 2JPBA 5FKKA 2XDNA 1ZG3A 1ERDA 4PXIA 3J7AO 5EF6A 3RQIA 5K5OA 2HI3A 2DQLA 4PGHA 2E2IJ 3LSIA 1D1AA 3ZMVA 1BR4A 4A6EA 4FQGA 3CCVI 4XRSA 3D0SA 5DUIA 5TGTA 4O6JA 2B0LA 1H9TA 1ZLKA 1U5TC 1EKEA 3BZCA 4OIRF 4E7ZA 2G7GA 5CVJA 2F5CA 5IYDJ 5C4YA 1QZZA 4AWXB 2K85A 1USSA 2M0CA 5F64A 3A4CA 4EMSA 2EFOA 1N77A 5LGUA 3SDBA 3JRBA 1FY7A 2VN2A 4HSRA 2KFDA 3HE0A 2UXXA 2ZB9A 4CO8A 3SZPA 1YG2A 4YIFA 4WX9A 2ZC2A 2OQRA 3ZMZA 1X19A 2CWEA 4PGGA 2EFPA 3MFKA 3WTUC 3AG2H 4C3JJ 1DP7P 2XDVA 5J1YA 1U5TA 3IAS2 1VQ4I 3COLA 4YZEA 3VOEA 5J8FA 1FEXA 3HTHA 2BE5F 1IG7A 3OOUA 2O6GE 4MGRA 3V42A 2QOPA 2E5ZA 1Z77A 1G3TA 1WHUA 4IF4A 1I3QJ 3FBNB 3ZN1A 3HTAA 2P5VA 1Z7UA 4BHPA 4RM2A 3P9KA 2ZXHA 2RDPA 1YITI 4Y33A 1V5FA 4O5VA 1MMDA 2PG4A 1K7AA 4NQWA 3FXOA 1ZH5A 4PSXA 2XROA 3AKZA 4ZDOA 2A05A 1UCRA 1SFOJ 3OR1C 3VTIA 1ZGAA 3CCRI 4GCKA 5KAIC 5C4JJ 4PJJA 3KLOA 5M3FJ 2CV0A 3G56A 3MQ0A 3B73A 1SC7A 2WV1A 4X0GA 3BTJA 4E7JA 5E1ZB 2ZXIA 2PJPA 4FE7A 1TNTA 4AYBN 3E5UA 3FXKA 5EG0B 2GM4A 1T33A 3QWLA 1DGRM 2LF8A 1OYYA 2WAFA 3BC8A 3DU6A 5TISC 1KGSA 3LSHA 1S8NA 3QU3A 2JA7J 3M4OJ 4MFDA 3SEZA 2WY7Q 2IP2A 3JCUC 2Y0SA 5FRNA 1SD5A 3MKWB 4I01A 1W0TA 2RGVA 3M8JA 4DZJA 1KQ9A 3HRUA 1BR2A 2K02A 5AIPA 1YIJI 2MLGA 4HEA2 3RYPA 4F52A 3OYHA 2EPFA 4NN1A 2PMZA 1IN8A 1Z9CA 3T8RA 3WTXC 1UJ8A 2QSGX 1W5CC 5FFXA 4CH7A 3E5QA 3BTIA 4XKVA 2LC2A 1RKTA 1RESA 4PCQA 2L0KA 2NNNA 2QQ9A 3TKYA 2ZMEA 3A01B 2DLLA 1NK2P 2FU4A 3OYJA 5C3EJ 5HBUA 2FD5A 2MABA 3I0TA 2WADA 3K7AJ 4GYIA 5GAGJ 4KN4X 2OZUA 3WODF 5FLXK 3LQRA 4A3EJ 2ZFUA 3CJRB 1W36C 1TT0A 4PSWA 1QHGA 2OTLI 1X1CA 3H3ZA 4KIFA 3J7YJ 4C9YA 4HQEA 1K6YA 4XONA 2DPDA 1ODDA 2I10A 2PFVA 3KP7A 5E1XA 1I50J 3E6DA 3HTJA 4C2MJ 1FPQA 5E79C 1X1AA 3CF5F 2LTPA 4RAZA 2VI6A 3DEUA 5ICGA 2DYSH 2R7TA 1AOYA 4EVIA 5ED4A 5E8GA 3MZ8A 5CLSA 1R9TJ 5J1UA 3EDPA 3LAJA 5DCFA 2DA4A 2GOXB 2K86A 3H5NA 3JR9A 3S1RJ 4HNUA 4M3BA 1SVMA 3ABTA 3U1KA 4BEHA 5E8IA 2MLKA 4HNTA 2QWWA 1IAWA 4ZYEA 2JVHA 2HQRA 3G1MA 5ICCA 2KLOA 1FP1D 2HOTA 4II2A 2IS4A 5HAWA 1IW7F 4Y52J 1W7PA 3BG5A 3DFGA 5FD5A 2PX9A 3HDDA 1ZAOA 2HYFA 3HHGA 3MN2A 4XIDA 4YFXF 4E7LA 2CS3A 4XICA 3SQNA 3S8PA 1GDTA 1RUOA 2E36A 1ZKGA 3M8EA 3FRQA 3CJQB 3E6BA 2XPVA 2YPRA 1PUFB 4OD5A 3TW7A 2X48A 4C2MA 4MEYF 1ZRDA 2FBQA 2ZXWH 4HX8A 1N25A 3ECOA 3MEXA 3GTKJ 1TWFJ 4G7HF 2EFNA 1P7IA 2XKOA 1FMWA 2E7XA 1FT9A 2EZKA 3GTQJ 1REPC 4BL0B 1G59A 2EK5A 4KISA 1MKMA 4LIVA 3OSFA 2R7FA 3HZJA 1OMIA 1X3ZB 1G2HA 1LFUP 1V55H 5CKTA 3QU6A 3CWRA 5B3SH 4B3XA 3GFIA 2CQ7A 2LR8A 2DO7A 3AQTA 1V54H 3HSFA 1YX3A 2JMWA 3VW1A 2R4GA 3K2AA 3O8HA 5TJJA 3LNQA 3GZ5A 5CVRA 1TZLA 3FM3A 4D7MA 1UZCA 3CP8A 4IKFA 3QOPA 5DYMA 2LYCA 3B02A 4MLOA 3ZQFA 1IN7A 1XGNA 4ESFA 4A3IJ 2JZYA 2ETHA 3EPZA 4GXOA 2GXBA 3CJDA 4DVYP 1WSUA 3H36A 2WA0A 1L0OC 2OCCH 4IHWA 1DUXC 1R1VA 2EA4A 3ZR8X 1KYZA 2XPUA 1ZGJA 3C1DA 1FSEA 4Y17A 2FX0A 2VJ4A 4ACIA 2W53A 2KKOA 1LKXA 4UVCA 4LB5A 4UVBA 5EEHA 5FRMA 1ETVA 1MDMA 3W6VA 2M8GX 4NC6A 4XK4A 1GV5A 1Z67A 2X1EA 1P92A 3K1NA 1F5TA 3NQOA 2P8TA 4Y3OA 1VQLI 2CUJA 4V19K 2ZNZA 4ASNA 5K5RA 2FE3A 3KP5A 1UHMA 4ZYAA 3TO6A 2BHYA 2H8WA 3PFYA 5H6QA 3QKXA 3LA2A 1X1PA 4LD5A 1AHDP 3JTGA 3CUQC 1QVTA 3I71A 2NXNB 3F6OA 4KT6A 4A6DA 1AWCA 2QLZA 3S1NJ 4DBQA 1S9HA 1X4PA 3HRTA 2L9SA 2A6HF 3E3VA 2VKVA 4XMYA 1V3FA 2FOKA 2WUIA 4GDFA 1QZYA 3L2QA 3COAC 2L54A 2PMUA 4OIPF 1Z05A 1WH5A 5M5WJ 2G0EA 2MGQA 1YI2I 1YJ9I 2KDZA 2X6WA 3FISA 3N4MA 3ON4A 3CC4I 2OA4A 4L9NA 2A5WA 1QVUA 2UXNA 2E35A 4AIHA 3OIOA 3E97A 1LJ9A 1OCOH 1GHCA 2CUEA 2BEOA 3HOXJ 1R22A 2NAZA 3NWTA 5CPRB 1IDZA 2G7LA 2ZSHB 3F8NA 5FD6A 3I56I 3GTLJ 1OKRA 1QA6A 5DD8A 2REKA 3FK7A 5E18F 3ZQCA 2AQFA 2L5QA 1K79A 1D5YA 4BGDA 1Z1DA 1NHAA 2MD0A 1EH7A 4M72A 4NUBA 3VYTB 1IN6A 2A5YB 2EWNA 3D1NI 2DK5A 2R7SA 3CRJA 4XLHA 1WJFA 5FMPA 3QYBA 1XX5A 4M6VA 3GX4X 1Y56A 1PJRA 4FX4A 3PQJA 3ANGA 2N8GA 2DFEA 4ZTFA 3BG3A 3RSNA 3CF2A 3M9AA 3DTIA 3TEDA 3WHBA 4HDVA 3OL4A 3E1SA 3GBGA 1HKSA 2XC7A 4QWQA 2IGOA 2F07A 3VB2A 4I2OA 3MVPA 3H92A 3RPQA 3SZTA 3ZMSA 5DCMB 1VQMI 4EJUA 5FKNA 2KQRA 2V1NA 2VBXA 2AHQA 3SEQA 2DMPA 1EF4A 3WTSC 3M8FA 5D19A 2YVXA 4FHTA 4ANJA 3S2HJ 5CXIA 4PDKA 2CMPA 4J01A 3FBIB 1HF0A 2GXAA 3HSRA 4AIDA 3G71I 1YYVA 2NVXJ 1XCBA 2VT3A 4HBLA 3C7JA 3HXLA 3X2QH 4ENMA 1MNDA 3RKXA 2O8XA 2JSPA 2OD5A 2R7DA 4AIKA 3RKYA 3HUGB 1G3SA 5M5YJ 1SMTA 1X1BA 2OPTA 3G1LA 1HQCA 2O5RA 3V6GA 3BTLA 2PBXA 1QU3A 3PL8A 2HOAA 2DPUA 3VVZA 3M1EA 1YFHA 3IUOA 1JKQC 2ICWG 5DTDA 3HOTA 1VFCA 4BBSJ 4AYBA 3S2DJ 3ASNH 1FWZA 4U0VA 5BMZA 1MBFA 3JRAA 1TQMA 3RZDJ 5EDNA 3TOBA 4CZCA 2LMDA 1MSEC 1ZLJA 4G6DA 2MH2A 3HTSB 2DMQA 3L2CA 2L2OA 5ILUA 2Y31A 4ON0A 2Y0MA 3NRVA 1BN5A 1BIAA 2HVSA 3JRDA 2HQ5A 2MW8A 3S1QJ 1VQPI 3BCGA 2LOOA 1KU9A 2DA1A 4CCNA 1TBXA 1O3SA 4RB2C 1VQ8I 5J8CA 3KX2A 4KJZA 2XB0X 4OIOF 2KZVA 3OYGA 2WTEA 2WWYA 1Y1VJ 2XF6A 3GLLA 2DOFA 2EV5A 1R7JA 2IGNA 2WV0A 4BHBA 4Q4ZF 3OR2C 3MD2A 4WF2A 4LOCA 2L9RA 4MO7A 3EUAA 2PJRA 1P9QC 4XRMA 3GLXA 3H0GJ 1D8KA 1NTCA 1JKPC 2DFIA 3E5XA 1R5GA 2X6OA 5BNGA 5EG0A 6PAXA 1TP4A 3K9TA 4A3BJ 4DZPA 3GYHX 2GA1A 3DPTA 1FZPB 5JHFA 1J2XA 2XRLA 4C30A 2KIMA 4U87A 2LKPA 1K4SA 5FHPA 1U2WA 4LLLA 4IQJA 4E4HA 5CQGA 3FK6A 3FHZA 1ON2A 5LEKA 3E0JB 2VLAA 4HLYA 2XKPA 2NS7A 5LBQA 1TTYA 4M3GA 3MKZA 2JUGA 3P9CA 4MQ9F 3H1CA 3TDUC 5DAJA 3RDIA 3TO7A 1B1BA 2IXSA 3BR0A 4EEFG 3NPIA 2BVMA 2W24A 1JKOC 2ADUA 3LFUA 1XG1A 1HBXG 4A69C 4F3QA 2QVOA 2DOEA 2L7ZA 3A01A 3M3YJ 3LHQA 3PNTA 1U6GA 2MYSA 2CYYA 2RV8A 2FEZA 1TC3C 2Q8KA 3CO6C 4RBOA 1SANA 2VBYA 5ICEA 2RQQA 2FBIA 2BXZA 3LOCA 2DODA 1OR7A 2DT5A 2NVYJ 1BR1A 2P7CB 4AC0A 2HPIA 2VE8A 3M07A 4RLFA 1FIAA 2NVQJ 2XSDC 4QPQA 3CCEI 1BC8C 2M8EA 4F92B 4W97A 1T08B 2CU7A 1OCCH 1BL0A 1FLIA 2R0QC 3F8MA 3MZYA 2K5CA 3VP5A 4KUMA 4A5MA 2DA6A 2YUSA 1JHHA 3ML6A 3DTEA 2UXUA 1B72A 2G3BA 5B1BH 2A61A 2NS0A 4NBQA 1S7EA 4HF0A 5F27A 4CCMA 4EATA 3H3VK 2CV1A 3QYEA 1YHQI 2R7ZJ 5GADJ 4UHTA 2MG4A 2NVTJ 5F1RA 2IRFG 2VKEA 2BY0A 2R5ZB 5KCMA 4IHVA 1P6RA 4U9LA 2VC0A 4CCKA 1LDDA 2CW7A 1QPMA 3R0AA 4FT8A 1JJ8C 1XGSA 4NHJA 1G4DA 1FMVA 5J47A 5D8KB 4RGUA 3KP4A 4CYCB 2HYJA 2LP0A 3UR3C 3VOKA 3HGGA 4UXNA 1ETQA 3NARA 2Z3YA 4YFKF 1R1UA 2W1OA 1E3PA 2BYVE 2L9NA 2EV6A 3HOVJ 3KEYA 2VKDA 2OERA 1XMKA 4IOAF 1IC8A 5HS9A 3E7QA 2QKLB 1E17A 3U21A 3EUHA 2VOOA 1PUEE 2UZKA 3ZMUA 1JTXA 4XOTA 1KA8A 3O3KA 4HSTA 1OYWA 3F6VA 5HNHA 4RAYA 3CDLA 4II3A 4KIBA 4IRVA 1CGPA 4EGYA 1BW6A 2LY9A 2G7HA 3Q9VA 4ITVA 4R1HA 5IYBJ 3WU1B 2OJED 1BOBA 3BY6A 2LDUA 5IY5H 5JLWA 2HVRA 2LH9A 4HZFA 3ON2A 1JHFA 2CUFA 3HC7A 2Q2EB 1T56A 2DYRH 5IOYA 2M34A 2ZOYA 2F5DA 3D5SC 4EJOA 2ZOZA 3W6JB 2GLOA 1T2KA 4IRHA 3A0BC 2Q24A 2LREA 4JQFA 3T8TA 4YG2F 2ZSIB 5L3DA 4ICHA 1U9OA 3SFIA 1HOMA 2VL8A 3GXOA 2ISYA 2DA7A 3ZQHA 2WY8Q 3VVYA 3FF5A 4E70A 3F22A 3BP8A 5F0HA 4A3GJ 4I0AA 5HDGA 1SAXA 2R7WA 3F72A 2CFXA 2FBHA 3ZQGA 4HG2A 1W36D 4OIQF 5CVVA 3ABMH 2W84A 3MKLA 2DOAA 2H09A 2M30A 1SFEA 2E1MB 3F8BA 5E3LA 3OYKA 1O57A 2C6YA 2D1VA 3ISPA 1W7PD 1VZ0A 1S6LA 4GCVA 3C3WA 5EYRA 3BWGA 3WTZA 2W00A 3IH3A 3RTRA 4XKWA 1MW7A 3JREA 3LMMA 2E60A 3JRIA 4OMZA 3J81K 3OOPA 3LSGA 2UUZA 3BPVA 3NAUA 3KE2A 3SXYA 3W3CA 4EM0B 1CF7B 1W4MA 3H3UA 3GMEA 4MIMA 5CQEA 3TBIA 5CVIA 4YFNF 1BA5A 1E3OC 3FXUA 3TOAA 2IJLA 2Y9YA 2F6CA 2ZJ2A 2LRDA 1JUMA 1O3RA 2BY1A 1POGA 2V79A 5C4XJ 3FMRA 3PFIA 3PUBA 3BHQA 2HU9A 1UHSA 3N97A 3CUOA 1VQOI 2EQRA 2XAFA 1GXPA 2V1DA 3WE3A 4XKCA 2QBYB 2H27A 4U7DA 3PPBA 3OYMA 5DD4A 1OFCX 1NG6A 3DU5A 1U8RA 1X4OA 3R6SA 2PI0A 3BCBA 2L9VA 2K7LA 2LKSA 3QPHA 1YRNB 2W4SA 4XQFA 2O7OA 4FASD 2EH3A 5D4SA 3FWEA 1LEAA 3OIPA 2GFNA 2HS5A 1T8IA 4LG3A 1RIOH 3TP3A 2HPMA 3ANPA 4G8XA 4QTRA 1Y8QB 5CJ9A 4FETA 2L7MP 2VQLA 3M1CA 2P5KA 5B5EC 4IHYA 5F0FA 1Y0UA 2KJCA 1LVKA 4BJ5C 3HOWJ 4LGWA 2RASA 2VJ5A 2EIJH 3DBHB 2F5FA 5LRSA 3S2WA 4A3FJ 3H9GA 3AG3H 4OWRB 4PUSA 2NOJB 4PK4A 5LHHA 5IT9K 1V5GA 2E1CA 5GTHC 1LQ1A 3UKGA 1G8XA 1QO0D 3ESWB 4B48A 4ENJA 5FLVA 3HTIA 2A69F 3TP0A 4D0PA 4M71A 1U78A 5GPAA 5IYCJ 1D0ZA 2L3DA 2WB1N 3J7AY 2QGUA 1G6NA 2CW0F 1DU6A 4BJTA 2JA5J 5J4VA 2ZMEC 4EQQA 3HKZN 5DCMA 3K4BA 1J7KA 2NP3A 4MXMA 2RAEA 2P4WA 1MH4A 2VASA 3K4JA 4N4NB 4UV9A 2CG4A 3QPLA 2XIGA 3AL0C 1J9IA 2E1NA 4BE1A 4RGRA 2ID3A 4S0HB 5HLTA 3T6NA 4ZTJA 3ABLH 1XGMA 1UHWA 3D5RC 2QKOA 2EJRA 1HKQA 3KPHA 3BG6A 2CQKA 2L7KA 2ZNYA 2KHMA 4N4OB 3S3OA 3A1YA 1RRJA 1FOYA 3HUGA 3ZOBA 1LB2A 3DTKA 2OI8A 2LNBA 1A04A 5IT9Z 1WVRA 1OQYA 3Q3SA 3O8GA 5LHIA 4XKBA 1LVAA 2A6EF 4QLCU 3BNIA 2D6YA 4BXXJ 3I58A 5E20A 1Z7LA 5FFZA 1S5LC 1R4MB 4WCGA 4HF1A 2ZXJA 2YVEA 5FGLA 3MCZA 1VQ9I 4ZZDA 2JK3A 5E3MA 3MZHA 4RB0A 3CESA 1DDNA 2WC2A 2YU9J 1DPUA 2IA1A 2VB6A 3NXCA 4MQVA 2MFZA 5JLXA 2L4AA 1A6IA 1XGOA 3JSJA 3L2VA 2JA8J 1VQ5I 2YX4A 2PZ9A 3O6BB 3JW4A 4OINF 1S72I 2ZY9A 4WXHA 1HA8A 2HOEA 2FRHA 1WRJA 5GTIC 1B59A 5KHDA 3E6MA 1G3WA 4LK0F 2LKXA 1Q1VA 5EGOA 1WJ5A 3LQQA 1D5VA 1F1ZA 2CSOA 2IGKA 5JFRA 3MWMA 2DAOA 2E19A 2F4MB 3RKWA 5ICFA 5BS6A 1ZRFA 3MMYB 1BI0A 2QF7A 1R1TA 3NNRA 4N9IA 2E5NA 4M3EA 2QYOA 5JI6A 1WJBA 3K4CA 1MNMC 5KNLA 1BC7C 4B1RA 3CD6I 3V78A 2CQXA 1ON1A 5FLXZ 4A3JJ 2D45A 2QWTA 3FHNA 5GP9A 4RB3C 3BJAA 3TDZC 3DEWA 1RC9A 3GCMA 2QTQA 4H4KC 3G3ZA 2Z5UA 4DYCA 3O60A 4HV6A 5B66C 3OV8A 2BV6A 3BR2A 2R7OA 2ID6A 2X9DA 1P4XA 4JNNA 1QNTA 4WXDA 1MMAA 1U9NA 4PJNA 4A3KJ 2EV0A 1BBYA 5EEGA 2PMHA 3H9JA 3CCQI 3A02A 1E0EA 3EUPA 1T0FA 4EV0A 1FTTA 1S7OA 3HOYJ 3RPUA 4A12A 1MH3A 5FKLA 4Y7NJ 3ERED 1LE8B 2Q1ZB 1LPQA 1S7AA 2E7WA 3CMYA 1YIOA 4IJAA 2DA3A 3SHFA 2DMUA 5L3GA 4BQAA 2G9WA 1J09A 4PJ0C 3S17J 1SMYF 2W57A 1R4NB 4U0YA 1RNLA 3QQAA 1BI1A 1Z6TA 4XN0A 2VQHA 3S3NA 2Y75A 2CW8A 4M9ZA 5LRRA 2DCEA 5D5WB 1ZYRF 3DP7A 3TL4X 5K7ZA 2FQ3A 3G1OA 2VUMJ 2HNHA 2IT0A 1SAUA 3W2VA 1ZELA 4NNJA 3WGHA 4EGZA 5IOZA 4FTHA 5TRDA 3ZMTA 2GWRA 3GTJJ 3QODA 2EIMH 4GFKA 1FBQA 2YSRA 2DK8A 5F04A 2UXHA 4A0XA 4YRVA 2W82A 3KYDB 2MSYA 5ILSA 1SVOA 5AIQA 2M87A 3WTYC 2VQCA 5FGMA 2IVMA 2PFBA 4RAGA 2W7NA 2ZKZA 3NWSA 1JGGA 5D18A 3FDYA 5D8LB 2MC3A 3CLQA 1JXSA 2JUCA 3L7WA 4I7HA 2R5ZA 2V9VA 3I54A 2XB5A 1KONA 2HKXA 4HPQA 2ZJQF 3DPJA 1P4WA 3CDIA 1WH7A 4CA0A 4ZZLA 4RM3A 2XAUA 4U88A 3ULQB 4LFUA 4H0EA 3QRFF 4L0ZB 4ETSA 3G6EI 2FMYA 1NK3P 4M74A 4CYCA 2MC4A 2EFQA 1K78A 2Q0OA 5K5QA 2EBIA 3DCFA 3L00A 1R58A 2HYTA 2HQNA 1H89C 4AC6A 4KIGA 3ZQQA 1QHHD 1VQKI 3VYUB 1UI6A 2OZ6A 1VQ6I 5K7FA 2DDAA 3KEQA 3RKQA 1E3HA 2VC1A 2DA5A 3QAHA 3RIRA 2QUFA 4EJTA 2K27A 1GVJA 2MD5A 3BG9A 2IEKA 5J40A 2WBMA 3PUFA 4ZYHA 4RMNA 2GAUA 1MGTA 3BLYA 1SVLA 1MD0A 3FKIJ 1W5TA 2OAZA 2V26A 5E3OA 2Y9ZA 4ESJA 2E2JJ 3KYLA 1I1SA 4E7IA 1U5TB 5HLGA 2XPWA 4CICA 1IRGA 3BJOA 2Z99A 2Q2EA 5AQCA 4IL6C 3DF8A 3B81A 2ACJA 3HM5A 3HJEA 1FNNA 3P7NA 4HDUA 5GAHJ 5DS9A 1YO5C 4AIJA 2Y2ZA 1XCVA 2HXOA 1F9NA 5DM7F 2ZJPF 1U8BA 2ESNA 3P5JA 3CP2A 3FX3A 5BPIA 2XAHA 5D1RA 1QGPA 2L01A 2K9LA 2Z16A 1R49A 1M1EB 3H9QA 1H0MA 4F7ZA 1VF9A 4X1EA 5L3CA 5HODA 2IS1A 5L3FA 2ZCMA 3HYIA 1LFPA 1KYWA 1OCZH 1RR7A 2W48A 5LHGA 1RI7A 4NQWB 1MJAA 4C3IJ 3HGYA 4LLGF 1A31A 3L09A 1UELB 3N05A 4L9JA 1ZK8A 5F1JA 3R4KA 4MK6A 2ISZA 5LFAA 1OISA 4RS8A 2VQGA 3RYRA 4UNOA 2ELKA 1KU2A 2RVCA 5ERIA 3B6AA 1WFXA 4UUTA 4OU0A 5KVRA 1DGWY 3GZNB 1A35A 4ZC3A 4MEXF 1MMSA 3K8PC 1UG2A 3K6GA 3OYLA 3E6CC 3DQVC 3L2WA 1HDDC 5K7HA 4XLPF 1CF7A 2QZ8A 1FC3A 4ESBA 4M3FA 2PN6A 2R93J 3KCCA 2BW3B 1IV8A 4IVNA 3LSJA 1T38A 5F0CA 3FXMA 2Z2SB 3HG9A 2QSFX 1N75A 2A68F 1I6XA 4BY7J 3CTAA 1OCRH 3FXLA 2IA2A 2DU9A 4M73A 4CCLA 2QBYA 1H88C 3ZGKA 2K4BA 4Z2YA 4KNYA 3EYIA 4QPOA 2J5OA 2WB1A 3V7SA 1R71A 5LEJA 3C07A 3HKZA 1YRNA 3DBLB 1HC8A 2DJNA 1WZ2A 3OWTA 3RH2A 3V8LA 3HRMA 4O3MA 2GIVA 2EINH 4PJMA 4KWAA 4D5CA 3OYCA 2VBWA 3HOZJ 4HA8A 2GIZA 5J3LA 2IW5A 3BJ6A 3HHHA 4XLNF 4BS9A 3HIFA 1BJAA 3AQSA 1WGXA 3GFLA 2QENA 3F9KA 4BU2A 5IT3A 4ZYDA 3LWJA 4RDUA 1ENHA 2Z33A 1ETXA 2FUG2 3H0DA 3DPUA 1C0WA 3DLAA 3SJMA 3G2BA 3KETA 1B6AA 1QBJA 3LJLA 1UMQA 4BHCA 2ZCNA 2DW4A 3S93A 2FXAA 1MBGA 3KZYA 2LFBA 1A5JA 5EFYA 2FSWA 2D2WA 2CH0A 4XRFA 1GT0C 2LY2A 3R61A 3DV8A 5K1YA 5HDKA 2COMA 4D1QA 4HV5A 2IU5A 2WGBA 4IXAA 3C2BA 4F91B 3WG7H 4DNCA 3HB9A 4DJAA 1W7PB 2MA3A 2G7UA 2KL4A 4NC7A 2FBKA 3CCUI 2BXYA 1XC5A 5KAFC 3UNGC 3GFJA 1SD4A 1ORKA 3I64A 1V5EA 2LG4A 1OR7C 2Y48A 2ZFWA 1T39A 3SFZA 1FOWA 3U9GA 2PEXA 2CQNA 1R6RA 5H20A 3BCAA 4ZJZA 1BW5A 1FOXA 2VE9A 3PNVA 1IUYA 4L18B 4M3DA 3ZQIA 3OYBA 1ACIA 1XB4A 1TWGJ 4PFOA 4CDGA 1MBEA 2R5YB 2YU3A 3FZVA 1R23A 1HSTA 3KP6A 3KYCB 2M45A 4E7SA 2X51A 2JSCA 2QSHX 3JAMK 2MH9A 2AXLA 2M1BA 3K1PA 2ELJA 4CUGA 1PYVA 2DBBA 4JKZA 4BQQA 3IWZA 1X2MA 4AUXA 1HLVA 4NELA 3I4NJ 4S05A 5DUKA 5FB2A 4IHXA 3RCOA 2AXTC 3OS0A 4MHGA 4KMFA 4FX0A 3GEZA 1IUFA 2DMTA 3LA3A 3GTGJ 2HXIA 3G4SI 3A0HC 2CRGA 2VBZA 1ETKA 3LAPA 3LL7A 3KKCA 3NRGA 4JX4A 4DGWB 1IZ1A 3QP6A 2P6TA 2NNYA 4GCTA 4A5NA 4XLCA 1H8AC 4KFCA 4U0WA 1MBHA 1J59A 1ZRCA 4C2UA 1D1CA 3EUHC 1ETYA 5D5UB 4BBRJ 3BDDA 3ABUA 4I6ZA 3LWFA 5H6RA 1YW9A 1TNSA 2YS9A 2KP6A 3GZIA 1Z6RA 5HS8A 2DFFA 2KRFA 3NEUA 2DG7A 2FQ4A 4CYDA 4F93B 4IO9F 1PP7U 4BE0A 3L9FA 2M4KA 1XPXA 3JRCA 5EEAA 1PUFA 3ERMA 2NS8A 3TO9A 4UDSA 1JTYA 4P55A 2CFOA 5J1RA 4HX7A 5J6XA 3BQYA 3JRFA 1ZGWA 2H1LA 1RR8C 4DYRA 1SD6A 2VXZA 3HSEA 2F2EA 3IL2A 2OV7A 1LFBA 1O7LA 3CMAI 2O3FA 2JJ7A 4G94A 3M7GA 3ZQ7A 5A2QK 3H5RA 3VYSB 1PP8F 2NX4A 4I0BA 3GW2A 1FYLA 5IP9J 5AONA 3HBLA 2XVCA 5FKOA 3ELKA 1LE8A 2M5WA 3AAFA 2IS2A 1EH8A 1TW3A 4M6XA 4JX5A 1KQ8A 1OJLA 4XLEA 4UY8I 1XMAA 2FA5A 2W25A 2M7AA 3WGIA 2EFWA 3OS2A 4YIRX 3CUQB 2EIKH 1RKWA 5IP7J 2ZBKA 4K2EA 2Z1DA 4TV7A 3FMQA 1ZR2A 1Z91A 4X6AJ 3KNWA 3IRRA 4AVZA 3F3XA 2O0YA 1FP2A 4ZDLA 2ZCWA 3V8KA 4IHTA 2UV1A 3WG9A 2LSOA 3OYFA 3Q5FA 1D0YA 2HFHA 1DU0A 1K83J 4HNVA 4BE2A 1I5ZA 2HGCA 3C18A 3I4MJ 1STZA 4P5OA 1Y1WJ 1OPCA 4GYGA 4BYYA 2NOGA 3JSPA 4J19A 3ZQLA 4BXUA 4M9SA 2V1UA 1RETA 3GTPJ 5M3MJ 5JHUA 5A2QZ 2OQGA 4JL3A 1Y8RB 4A2UA 2DG8A 1O3TA 1PDNC 2GBYA 3SYTA 3EETA 3B6CA 1B8IB 2XAQA 4V2FA 4AF5A 2Y69H 3WGGA 2XV4S 3I3LA 1DQUA 2OBPA 1SD7A 1AA7A 1BM9A 3A2KA 1R5ID 3SWHA 3BR6A 4AM3A 3FKJA 1DPRA 1SFXA 3QOEA 1OCTC 1RPWA 3L2UA 3S5RA 3F8FA 2DT6A 2XF5A 4PFPA 2ECBA 3WHCA 2P7VB 3PSFA 1MZBA 2DMNA 2E71A 4NDLA 3LSRA 2R7UA 2G7SA 4PZJA 3RPUD 3BQZA 2B1EA 3HTUA 2P6SA 3PJRA 4L5JA 3GVAA 4UV8A 2ECCA 2D5VA 2K9QA 4LJZF 4CHUA 4ENKA 4QSHA 3RJPA 2X1DA 1FYKA 3IUVA 1GXQA 2ELHA 1AKHB 4B44A 2JA6J 2K40A 1D0XA 2M4GA 5CVUA 2JWTA 3H5AA 3TGNA 2EZIA 1ZQ3P 3CJNA 1EA3A 2HZTA 4QIWN 3D5LA 2JN6A 2LY1A 4Q48A 4F55A 3J81Z 4XNFA 2K9SA 3GWZA 4R79A 3R60A 3IP4B 5FJ8J 4YIIA 3NS4A 3CLOA 4OAYA 2HDWA 1B9MA 4DQ2A 2K3FA 1TW2A 2QEXI 4MFEA 3U2RA 4KICA 2JTVA 4IPAA 4OOIA 3WU2C 3K4KA 3LFKA 3CJTB 4KA4A 3KP2A 2OF7A 4BQOA 5HNFA 2H1KA 2ESHA 2KDOA 1TWHJ 2R7QA 3FXQA 4CZZA 2A3SA 1YS6A 3CO7C 3KKDA 1MBKA 3F23A 2IPQX 3OIQA 5D4RA 2UXPA 1JT0A 3ASOH 3I5UA 2RC4A 2BBYA 3V7RA 3OYDA 4WWCA 1IN5A 1HKTA 2R3SA 3EUKL 4L5IA 2X0LA 3I9V2 2MBFA 2F5EA 1QPIA 2H6BA 2L7FP 3VYRB 1I39A 1TT5B 2XGEA 1ZN2A 3BR1A 2LBFB 1SGMA 3BJBA 3QYFA 5DM6F 4LMYA 1LNWA 1IXRC 4HQMA 4E6KG 5GAEJ 5L3BA 2UWMA 2PJRB 3BT9A 1YW7A 2FJI1 2RKHA 4UUSB 4B8XA 2CJJA 2X6XA 4D9JA 1WQ2A 1WWXA 2HTSA 2Y30A 4A0ZA 3W6KB 4C2TA 3CCSI 2R7VA 3DXJF 1OCPA 3VW2A 2V1XA 3G73A 2J5PA 3TW6A 1CQTA 3NI7A 2BW3A 2RN7A 1FSHA 2BVLA 1MBJA 2STTA 1X2NA 4JP0A 2LK2A 3RQ4A 2UXOA 4P96A 2HZDA 4IRIA 2RHAA 5F6FA 5HLHA 1YS7A 2WAQA 2FOWA 3I59B 3VOXA 1MJBA 4UB8C 3IRQA 5CW8A 4GRIA 2FMLA 5BOXA 3K4MA 3DBRB 4DYQA 1TQPA 2A07F 1IO2A 2HR3A 3FM5A 2HYGD 3CCLI 2VODA 2W85A 4D7NA 4XORA 2XUBA 4B43A 4KITB 3K70D 1UG0A 2BY2A 4XM3A 5LD2C 2B63J 3QBMA 2NVUB 4L0YB 1GUUA 2EB7A 2IGMA 1ZR4A 3F21A 2YR2A 4UB6C 1IRFA 4Q47A 3AFHA 4BQNA 3S15J 5E1WA 1ZG5A 4DW6A 2CQQA 4LLNA 4N0BA 5JVGF 4HKUA 4IQ4A 4L5EA 3KP3A 4CCOA 2QM3A 4DIQA 1UI5A 4PJLA 3Q0VA 2YVHA 1J0RA 1GLNA 1T0FC 3OYEA 4P9UA 3FXJA 3BZ6A 1B72B 3PNYA 4ZDPA 1EJ9A 1HW1A 1HXDA 3KZZA 4RGSA 1JT6A 3W2WA 3OSGA 5FROA 2X6YA 5DEQA 4JX6A 2GZWA 5CXGA 4RLQA 4IRGA 2IBDA 4MNUA 3LSMA 3RD3A 1TLHB 4G9YA 4KMUX 2PQ8A 5GPCA 3OY9A 2XHKA 3T5XA 2NRAC 2COBA 2ZO4A 5EZHA 1S3JA 3KZ9A 3BOQA 3GEUA 1ZTRA 2D1HA 5FKMA 2KIUA 3T0YA 2CV2A 4CXFA 4CSWA 1P2FA 4LG0B 5FLMJ 4KDPA 4GFBA 2DTRA 2RNGA 5HS7A 5ILVA 2K4JA 5F08A 4KT5C 3HPGA 1ZREA 1LUJB 1YE9A 5C44J 1IXCA 3BR5A 4CGZA 2XSJC 1X3WB 5CYVA 3QPSA 2R5YA 3SZGA 2GUHA 5B1AH 3WTWC 2JA2A 3VIBA 2VJJA 1E2XA 3I4PA 1T98A 3DPLC 3PM1A 2VJIA 2ZJRF 5H2FC 2JRTA 2M3AA 1IDYA 3GFMA 1JE8A 2XAJA 3C2HA 1W1WE 4XLFA 3ZN0A 2A6TA 1D8JA 4XL9A 3HL2A 3BROA 2E34A 4ZH4F 3IKTA 5EJCA 1ITYA 3IV5A 2LD5A 3OS1A 1QRYA 4FE4A 3CC7I 2LVSA 3S1MJ 2DFHA 2HEOA 1R5HA 2XASA 3VW0A 1VTNC 1DP3A 3Q9SA 4P9FA 1YJWI 1H9GA 3ONQA 3CC2I 2V6CA 1Q1HA 1G3YA 2KIQA 3QPTA 4CGRA 1J5YA 2HVQA 1JJ6C 3OL3A 3KIOA 1UFMA 4OMYA 1B4AA 2E2HJ 4DBRA 3G7RA 4BXFA 1BOAA 4NC8A 3DEEA 1HW2A 3VFZA 3KFWX 1K61A 4EJWA 3GTOJ 2RREA 1JKRC 4BJ6C 2O61A 4B47A 1JI8A 1Z3YA 1N78A 1Y39A 3FXRA 1MMNA 3LSKA 4EJVA 5K58A 3FIWA 5HVQC 1ZG1A 2CUZA 1JUPA 1T6SA 1P4AA 3FMSA 3ROUA 2M0MA 3OYAA 4A3MJ 4B4CA 1BJZA 1I6HJ 4HW0A 1XMXA 4UVAA 2HWVA 1TWCJ 1FOKA 3Q0UA 2VPRA 3BR3A 1RUNA 2TRTA 3ZXSA 1PVEA 2XGCA 2TCTA 4I98B 2B7EA 4NB5A 3K70C 1ETOA 3EQLF 4V2GA 4BH9A 2H6CA 1YTYA 1MIJA 2VPLA 1WI3A 3VUQA 5E3NA 4Q5SF 4L62A 3PO3J 4FISA 1O7FA 2NP5A 4D5FA 2P81A 3MKYB 1K4TA 2KIFA 2KISA 1P7JA 2M2EA 3OMYA 3WTVC 1YQAA 1TWAJ 2FF4A 1Z0XA 3BTCA 1U0JA 2X1CA 3CCMI 2NYXA 1FBSA 2E1MC 4JYKA 5FO5A 5D5XB 2P0WA 3J80K 3JTHA 2L4MA 2V9PA 1QZEA 2GA2A 1WJEA 1XD7A 2I8DA 2LF7A 3ZP5A 3CUQA 3VSKA 2EZLA 4G6QA 1KU7A 4JOMA 2V4JC 2VONA 4M9XA 2GENA 1IRXA 2Z9OA 3CMMA 4G12A 4HX4A 2QCOA 5HOOA 2FJ1A 1IGNA 1V4RA 4LK1F 5L3EA 1K6OA 3CCYA 5HLIA 2KZGA 1VQNI 5IP6A 5JVTA 2QKMB 2QQBA 2KRCA 2F5VA 3VEPA 1ZARA 3VWBA 4BKXA 3K10A 2ME0A 1LDJA 2VIXA 1EH6A 4CCJA 2LLKA 4U7BA 2B3WA 2F4OB 2WAEA 1B8IA 1F36A 4P1WA 5LGTA 2JVGA 3U1DA 3V8JA 2STWA 1ZHFA 3GO5A 4ABZA 1ETWA 3J80Z 4J00A 1YJNI 1WI9A 2BY3A 2OTJI 3MAJA 2XGXA 3TQNA 4XRSG 4WIBA 2RNJA 2QQAA 3P9TA 2HKUA 3V7CA 4BACA 1TL8A 1S29A 5HSZA 3A03A 1R00A 2R92J 1R36A 4I02A 4XR6A 3S32A 1IV6A 2DQRA 3V4GA 1VQ7I 2IS6A 3K69A 2X4HA 3IHUA 3S14J 5H9TA 2M7BA 1Z21A 3ECHA 1W5SA 3QP5A 4A3DJ 2GXGA 5KK1A 4HRIA 2O8KA 2FNAA 3L2RA 4ENNA 1F4KA 1BIBA 1JUSA 1HSJA 1GVDA 1AKHA 3VDXA 2ZMEB 3PIPF 3CCJI 4BAYA 3MNLA 3BRUA 3VVXA 3RZOJ 4G7ZF 2GQQA 4RAFA 4L9VA 1XSDA 5DDGA 3IAM2 1UB9A 4HLXA 3AL0B 2JQ7A 3F0CA 1XTAA 3S3MA 2DA2A 3C2GA 4OD4A 2QA4I 3CQZJ 2AQEA 1U3EM 1WKMA 4Z6YA 2M9HA 3HEFA 1XDUA 3TMOA 3P9IA 2V6EA 3T1BA 3DWLE 3I55I 4EM2A 1APLC 2Y0SN 4S04A 1B9NA 4E7KA 3EYYA 4B09A 2AS5F 3HRSA 3BZKA 2O03A 1NH3A 1BI3A 3CDHA 2WAQN 3BG7A 1VNDA 1X3UA 2DT7B 2F4IA 4KN7X 1FJLA 2CGPA 1IRZA 5BPDA 3PIOF 5J4YA 2QQ8A 4GGGA 4Y13A 3LA7A 3IWFA 2PMZN 3PASA 4JBAA 3KLNA 2K3PA 1A6QA 4XOPA 3EGQA 1J75A 4GCLA 5EGOB 4BEHB 4XSZF 1FYMA 2PBIA 4A3CJ 3K4NA 4HYEA 1O3QA 3ZRGA 3J7ZI 3F1BA 3PSIA 4A93J 2XAGA 1IF1A 2BHZA 4UUVA 4AVPA 2LBFA 3K4LA 2DN0A 2KJBA 4N9HA 4Y4RA 1IN4A 9ANTA 3VODA 3H35A 1OYIA 4M6YA 3PQKA 2O9LA 2QIBA 4UUSA 2HDDA 5LGNA 1XN7A 2DDBA 3ZCOA 4YELA 1XDSA 1I1GA 1VI0A 3AG4H 4FCYA 4RGXA 1FTZA 2KT0A 2V57A 4LITA 2RQPA 3OYNA 2EA2A 1Y0NA 3PO2J 2OU2A 5D6FA 4HF2A 1IXSB 4MTDA 1FX7A 4U9NA 4JK1X 3WE2A 2EZHA 4AU7A 3ZMDA 1YW8A 3I59A 5M5XJ 3OYIA 1WJDA 2JPCA 4BNCA 2R7XA 1SFUA 1I3AA 3KZIC 1XSXA 2O7TA 3VSLA 4I76A 3HIMA 1X58A 2VT2A 2HTJA 1QQIA 2BOLA 2I5UA 2IAIA 2KMUA 3HOSA 1SFKA 1XS9A 3KEOA 1ONVA 5JR3A 1T95A 4LIUA 3CZ6A 3K0LA 3JRGA 5D5VB 4WXCA 4A3LJ 4IHSA 3O2PE 1I27A 2F48A 4A0YA 2TDXA 3AG1H 1O4XA 3CMEI 2YX7A 2K9MA 3S16J 1WJCA 3K2ZA 5DV5A 2CO5A 3HPHA 4BDYA 2H8RA 2VKHA 2E1OA 3HOUJ 2DI3A 3GUDA 5E17F 4BY1J
chains in the Genus database with same CATH topology
2DMPA 1EF4A 1FTTA 5D19A 3HOYJ 3S2HJ 4MFEA 5CXIA 1WCMJ 2XGDA 1MH3A 5FKLA 4Y7NJ 2ME6A 3E7LA 1HF0A 3VPRA 1LE8B 4ME9A 3CMYA 2OF7A 2NVXJ 2H1KA 2DA3A 4B3AA 1TWHJ 2DMUA 3JRHA 3S17J 3KKDA 1GV2A 1MBKA 1AU7A 3QQAA 2UXPA 5M5YJ 1JT0A 3SDGA 2OPTA 3G1LA 3V6GA 5K7ZA 3BTLA 2PBXA 2VUMJ 3G1OA 2HOAA 3VVZA 2AO9A 5IPAA 1JKQC 1HDPA 2L7FP 5DTDA 5IOZA 4FTHA 1VFCA 1QPIA 4BBSJ 3S2DJ 2XGEA 3BR1A 3GTJJ 1SGMA 3BJBA 4GFKA 1MBFA 3JRAA 3IH2A 5F04A 3RZDJ 3BT9A 2UXHA 5EDNA 4UUSB 2CJJA 5EZGA 1MSEC 2ZCXA 2MSYA 4IEJA 2Y30A 2UXIA 3IH4A 2DMQA 2Y31A 3VW2A 1OCPA 1JGGA 5D18A 1WPKA 2HOSA 4BY1J 3TW6A 3JRDA 2HQ5A 1CQTA 2MW8A 3S1QJ 3BCGA 3NI7A 1HCRA 1MBJA 2R5ZA 1X2NA 4JP0A 2DA1A 2LK2A 4C3HJ 2XB5A 2UXOA 3DPJA 2RHAA 4W1UA 1WH7A 2XB0X 3L1PA 3VOXA 1Y1VJ 1NK3P 1F43A 5CW8A 4CYCA 1IJWC 2DTZA 4DYQA 2EBIA 3DCFA 4LOCA 2L9RA 3LSPA 4MO7A 2HYTA 1H89C 4AC6A 4D7NA 4XRMA 3H0GJ 1NTCA 1JKPC 4GFLA 1UI6A 3GTMJ 5K7FA 2X6OA 5BNGA 5EG0A 4A3BJ 2K9NA 4DZPA 3RKQA 2DA5A 2B63J 2XRLA 3QBMA 3BG9A 1GUUA 2IEKA 1MSFC 1ZR4A 3Q0WA 1FIPA 1W0UA 2XDNA 5FKKA 5FHPA 4PXIA 5EF6A 3FKIJ 3S15J 5E3OA 3RQIA 3FK6A 2Y9ZA 2HI3A 2E2JJ 4DW6A 2CQQA 2E2IJ 2NS7A 4HKUA 2XPWA 4M3GA 4XRSA 4L5EA 1UI5A 5DAJA 5AQCA 3B81A 4EEFG 3NPIA 3BR0A 3HM5A 3Q0VA 2G7GA 2YVHA 1JKOC 5DS9A 1XG1A 2Y2ZA 5IYDJ 2HXOA 5C4YA 4A69C 1B72B 1U8BA 2M0CA 2L7ZA 3A01A 1JT6A 3OSGA 3M3YJ 3LHQA 5D1RA 3JRBA 4JX6A 5CXGA 3HE0A 1TC3C 2IBDA 2ZB9A 1VF9A 4X1EA 5HODA 4RBOA 1SANA 3RD3A 2ZCMA 1RR7A 2W48A 3LOCA 5GPCA 2NVYJ 4C3IJ 3HGYA 4AC0A 2COBA 4C3JJ 5J1YA 5F1JA 1ZK8A 1FIAA 5EZHA 2NVQJ 4MK6A 3KZ9A 3COLA 2XSDC 3GEUA 1ZTRA 4YZEA 1FEXA 5FKMA 3HTHA 1IG7A 3OOUA 2ELKA 4W97A 5FLMJ 2QOPA 2CU7A 3B6AA 1BL0A 4GFBA 2R0QC 4UUTA 1Z77A 3VP5A 2DA6A 5F08A 2YUSA 1UG2A 2UXUA 1I3QJ 1B72A 2G3BA 3HTAA 1HDDC 5C44J 1S7EA 3BR5A 5F27A 5K7HA 2R5YA 3QPSA 3H3VK 2GUHA 4M3FA 2R7ZJ 2NVTJ 2MG4A 3VIBA 2R93J 2VKEA 3PM1A 2R5ZB 3LSJA 5F0CA 4IHVA 1IDYA 4BY7J 1JJ8C 1SFOJ 4GCKA 5C4JJ 4CYCB 2HYJA 5M3FJ 2LP0A 1H88C 3VOKA 3HGGA 3G56A 1ETQA 2WV1A 3NARA 3BTJA 1ITYA 3IV5A 2LD5A 1QRYA 3C07A 4FE4A 2LVSA 3S1MJ 1YRNA 2DJNA 4FE7A 3RH2A 3VW0A 3HOVJ 4AYBN 5EG0B 2OERA 1IC8A 3E7QA 2GM4A 1T33A 4KWAA 4CGRA 1JTXA 4D5CA 1JJ6C 3M4OJ 2JA7J 2E2HJ 4MFDA 3CDLA 3HOZJ 3G7RA 5J3LA 1BW6A 1W0TA 2LY9A 1K61A 4DZJA 3GTOJ 5IYBJ 3AQSA 1WGXA 1JKRC 5K58A 3LWJA 5JLWA 4RDUA 3FIWA 1ENHA 1JUPA 4A3MJ 2CUFA 3ON2A 4NN1A 4B4CA 1ETXA 1BJZA 1I6HJ 1T56A 5IOYA 2M34A 2ZOYA 3SJMA 1TWCJ 3LJLA 2ZOZA 2GLOA 3Q0UA 2VPRA 1UMQA 3BTIA 3BR3A 2Q24A 2ZCNA 1RKTA 1MBGA 2TRTA 1A5JA 2LFBA 2XGCA 5EFYA 4ICHA 2TCTA 1RESA 2L0KA 1GT0C 1U9OA 3SFIA 3A01B 1ETOA 1HOMA 1NK2P 5HBUA 4V2GA 5C3EJ 2DA7A 3ZQHA 2FD5A 3VVYA 2IU5A 1WI3A 3K7AJ 2WGBA 3C2BA 3VUQA 5E3NA 4L62A 3PO3J 4FISA 5F0HA 4A3GJ 2NP5A 4D5FA 3ZQGA 2P81A 3HB9A 4A3EJ 1P7JA 2M2EA 3MKLA 1XC5A 1TWAJ 5E3LA 1Z0XA 3BTCA 1ORKA 5EYRA 2I10A 1I50J 3IH3A 4JYKA 3JREA 4C2MJ 3HTJA 2LTPA 2VI6A 3JRIA 1BW5A 3LSGA 4M3DA 3NAUA 3ZQIA 1R9TJ 5J1UA 2EZLA 2DA4A 3S1RJ 3JR9A 1TWGJ 4M3BA 2GENA 1MBEA 4MIMA 2R5YB 1BA5A 1E3OC 4G12A 2QCOA 2Y9YA 3G1MA 2FJ1A 1JUMA 2HOTA 1IGNA 1POGA 5HAWA 5C4XJ 4Y52J 3CCYA 3BG5A 3BHQA 3HDDA 1UHSA 5IP6A 4JKZA 3MN2A 4XIDA 1X2MA 2EQRA 4AUXA 1HLVA 4NELA 4XICA 3I4NJ 1GDTA 4IHXA 3PPBA 1OFCX 1ZKGA 4BKXA 1IUFA 2DMTA 2ME0A 3FRQA 2XPVA 1PUFB 3TW7A 2X48A 2HXIA 1YRNB 3GTGJ 2LLKA 2FBQA 2CRGA 2O7OA 1ETKA 2EH3A 3KKCA 3NRGA 4JX4A 1B8IA 3GTKJ 1TWFJ 1F36A 2GFNA 1P7IA 4GCTA 4ABZA 1ETWA 1H8AC 2EZKA 3TP3A 3GTQJ 3ANPA 1MBHA 4XRSG 4QTRA 1ETYA 2L7MP 4BBRJ 3EUPA 3OSFA 3P9TA 2HKUA 4I6ZA 1G2HA 1LFUP 4IHYA 5F0FA 5HSZA 3CWRA 3A03A 3HOWJ 2R92J 2YS9A 2RASA 3GZIA 1IV6A 2LR8A 2DG7A 3AQTA 4A3FJ 2FQ4A 2JMWA 3S14J 3VW1A 5H9TA 3K2AA 3O8HA 3LNQA 3JRCA 5EEAA 4A3DJ 1PUFA 4D7MA 2NS8A 3UKGA 2O8KA 4UDSA 1JTYA 3HTIA 5FLVA 4MLOA 3ZQFA 1JUSA 5J1RA 1GVDA 3TP0A 1AKHA 1U78A 3BQYA 5GPAA 4A3IJ 3JRFA 3CJDA 5IYCJ 3MNLA 1ZGWA 2WB1N 4DYRA 3BRUA 3VVXA 4IHWA 3RZOJ 1DU6A 2JA5J 2XPUA 1LFBA 3HKZN 2FX0A 3F0CA 2NP3A 4MXMA 2DA2A 2JJ7A 4ACIA 3CQZJ 2RAEA 1MH4A 2W53A 2NX4A 3QPLA 5IP9J 2M9HA 1ETVA 3HEFA 3HBLA 2M8GX 3W6VA 4XK4A 2ID3A 4S0HB 5FKOA 1GV5A 3T6NA 1LE8A 1APLC 2Y0SN 4JX5A 2QKOA 1OJLA 2WAQN 1VNDA 1FJLA 1IRZA 3ZOBA 1RKWA 5IP7J 2PMZN 1ZR2A 3KNWA 3PASA 4X6AJ 3EGQA 3QKXA 2OI8A 4GCLA 5EGOB 1AHDP 4A3CJ 3Q3SA 3O8GA 1QVTA 3F1BA 3BNIA 3S1NJ 4BXXJ 4A93J 2D6YA 1DU0A 2DN0A 1K83J 2VKVA 2YVEA 9ANTA 4HNVA 5FGLA 2JK3A 5E3MA 2WUIA 3I4MJ 2O9LA 2QIBA 4UUSA 1Y1WJ 2HDDA 2NOGA 4J19A 3ZQLA 1WH5A 3GTPJ 1RETA 5M5WJ 5M3MJ 2YU9J 3NXCA 2G0EA 2MGQA 4JL3A 1VI0A 5JLXA 2KDZA 2DG8A 1A6IA 3ON4A 3FISA 3JSJA 2JA8J 4FCYA 2PZ9A 2GBYA 1FTZA 2KT0A 3B6CA 1B8IB 2V57A 1QVUA 4V2FA 2LKXA 3OIOA 4AF5A 1Q1VA 5EGOA 3PO2J 2CUEA 3HOXJ 1IDZA 2G7LA 2EZHA 3BR6A 3GTLJ 5M5XJ 1OCTC 2E19A 1RPWA 3S5RA 2REKA 3FK7A 3ZQCA 2ECBA 2QF7A 3WHCA 1D5YA 2O7TA 3NNRA 4I76A 3HIMA 1X58A 2DMNA 4M3EA 4NDLA 2IAIA 3LSRA 1XS9A 1MNMC 2G7SA 3D1NI 3CRJA 3BQZA 4B1RA 3V78A 5FMPA 2CQXA 2QWTA 4A3JJ 4M6VA 5GP9A 3JRGA 2ECCA 2D5VA 2K9QA 4A3LJ 4QSHA 3DEWA 3ANGA 2N8GA 3IUVA 1O4XA 3BG3A 2QTQA 1AKHB 4DYCA 3TEDA 2JA6J 2K40A 3WHBA 3O60A 3S16J 2JWTA 3GBGA 3BR2A 2ID6A 2EZIA 2X9DA 1ZQ3P 4JNNA 4QIWN 2F07A 2JN6A 1U9NA 3MVPA 2H8RA 4A3KJ 2E1OA 2K9SA 3HOUJ 5FKNA 5FJ8J 3A02A 2AHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMP A;  1EF4 A;  1FTT A;  5D19 A;  3HOY J;  3S2H J;  4MFE A;  5CXI A;  1WCM J;  2XGD A;  1MH3 A;  5FKL A;  4Y7N J;  2ME6 A;  3E7L A;  1HF0 A;  3VPR A;  1LE8 B;  4ME9 A;  3CMY A;  2OF7 A;  2NVX J;  2H1K A;  2DA3 A;  4B3A A;  1TWH J;  2DMU A;  3JRH A;  3S17 J;  3KKD A;  1GV2 A;  1MBK A;  1AU7 A;  3QQA A;  2UXP A;  5M5Y J;  1JT0 A;  3SDG A;  2OPT A;  3G1L A;  3V6G A;  5K7Z A;  3BTL A;  2PBX A;  2VUM J;  3G1O A;  2HOA A;  3VVZ A;  2AO9 A;  5IPA A;  1JKQ C;  1HDP A;  2L7F P;  5DTD A;  5IOZ A;  4FTH A;  1VFC A;  1QPI A;  4BBS J;  3S2D J;  2XGE A;  3BR1 A;  3GTJ J;  1SGM A;  3BJB A;  4GFK A;  1MBF A;  3JRA A;  3IH2 A;  5F04 A;  3RZD J;  3BT9 A;  2UXH A;  5EDN A;  4UUS B;  2CJJ A;  5EZG A;  1MSE C;  2ZCX A;  2MSY A;  4IEJ A;  2Y30 A;  2UXI A;  3IH4 A;  2DMQ A;  2Y31 A;  3VW2 A;  1OCP A;  1JGG A;  5D18 A;  1WPK A;  2HOS A;  4BY1 J;  3TW6 A;  3JRD A;  2HQ5 A;  1CQT A;  2MW8 A;  3S1Q J;  3BCG A;  3NI7 A;  1HCR A;  1MBJ A;  2R5Z A;  1X2N A;  4JP0 A;  2DA1 A;  2LK2 A;  4C3H J;  2XB5 A;  2UXO A;  3DPJ A;  2RHA A;  4W1U A;  1WH7 A;  2XB0 X;  3L1P A;  3VOX A;  1Y1V J;  1NK3 P;  1F43 A;  5CW8 A;  4CYC A;  1IJW C;  2DTZ A;  4DYQ A;  2EBI A;  3DCF A;  4LOC A;  2L9R A;  3LSP A;  4MO7 A;  2HYT A;  1H89 C;  4AC6 A;  4D7N A;  4XRM A;  3H0G J;  1NTC A;  1JKP C;  4GFL A;  1UI6 A;  3GTM J;  5K7F A;  2X6O A;  5BNG A;  5EG0 A;  4A3B J;  2K9N A;  4DZP A;  3RKQ A;  2DA5 A;  2B63 J;  2XRL A;  3QBM A;  3BG9 A;  1GUU A;  2IEK A;  1MSF C;  1ZR4 A;  3Q0W A;  1FIP A;  1W0U A;  2XDN A;  5FKK A;  5FHP A;  4PXI A;  5EF6 A;  3FKI J;  3S15 J;  5E3O A;  3RQI A;  3FK6 A;  2Y9Z A;  2HI3 A;  2E2J J;  4DW6 A;  2CQQ A;  2E2I J;  2NS7 A;  4HKU A;  2XPW A;  4M3G A;  4XRS A;  4L5E A;  1UI5 A;  5DAJ A;  5AQC A;  3B81 A;  4EEF G;  3NPI A;  3BR0 A;  3HM5 A;  3Q0V A;  2G7G A;  2YVH A;  1JKO C;  5DS9 A;  1XG1 A;  2Y2Z A;  5IYD J;  2HXO A;  5C4Y A;  4A69 C;  1B72 B;  1U8B A;  2M0C A;  2L7Z A;  3A01 A;  1JT6 A;  3OSG A;  3M3Y J;  3LHQ A;  5D1R A;  3JRB A;  4JX6 A;  5CXG A;  3HE0 A;  1TC3 C;  2IBD A;  2ZB9 A;  1VF9 A;  4X1E A;  5HOD A;  4RBO A;  1SAN A;  3RD3 A;  2ZCM A;  1RR7 A;  2W48 A;  3LOC A;  5GPC A;  2NVY J;  4C3I J;  3HGY A;  4AC0 A;  2COB A;  4C3J J;  5J1Y A;  5F1J A;  1ZK8 A;  1FIA A;  5EZH A;  2NVQ J;  4MK6 A;  3KZ9 A;  3COL A;  2XSD C;  3GEU A;  1ZTR A;  4YZE A;  1FEX A;  5FKM A;  3HTH A;  1IG7 A;  3OOU A;  2ELK A;  4W97 A;  5FLM J;  2QOP A;  2CU7 A;  3B6A A;  1BL0 A;  4GFB A;  2R0Q C;  4UUT A;  1Z77 A;  3VP5 A;  2DA6 A;  5F08 A;  2YUS A;  1UG2 A;  2UXU A;  1I3Q J;  1B72 A;  2G3B A;  3HTA A;  1HDD C;  5C44 J;  1S7E A;  3BR5 A;  5F27 A;  5K7H A;  2R5Y A;  3QPS A;  3H3V K;  2GUH A;  4M3F A;  2R7Z J;  2NVT J;  2MG4 A;  3VIB A;  2R93 J;  2VKE A;  3PM1 A;  2R5Z B;  3LSJ A;  5F0C A;  4IHV A;  1IDY A;  4BY7 J;  1JJ8 C;  1SFO J;  4GCK A;  5C4J J;  4CYC B;  2HYJ A;  5M3F J;  2LP0 A;  1H88 C;  3VOK A;  3HGG A;  3G56 A;  1ETQ A;  2WV1 A;  3NAR A;  3BTJ A;  1ITY A;  3IV5 A;  2LD5 A;  1QRY A;  3C07 A;  4FE4 A;  2LVS A;  3S1M J;  1YRN A;  2DJN A;  4FE7 A;  3RH2 A;  3VW0 A;  3HOV J;  4AYB N;  5EG0 B;  2OER A;  1IC8 A;  3E7Q A;  2GM4 A;  1T33 A;  4KWA A;  4CGR A;  1JTX A;  4D5C A;  1JJ6 C;  3M4O J;  2JA7 J;  2E2H J;  4MFD A;  3CDL A;  3HOZ J;  3G7R A;  5J3L A;  1BW6 A;  1W0T A;  2LY9 A;  1K61 A;  4DZJ A;  3GTO J;  5IYB J;  3AQS A;  1WGX A;  1JKR C;  5K58 A;  3LWJ A;  5JLW A;  4RDU A;  3FIW A;  1ENH A;  1JUP A;  4A3M J;  2CUF A;  3ON2 A;  4NN1 A;  4B4C A;  1ETX A;  1BJZ A;  1I6H J;  1T56 A;  5IOY A;  2M34 A;  2ZOY A;  3SJM A;  1TWC J;  3LJL A;  2ZOZ A;  2GLO A;  3Q0U A;  2VPR A;  1UMQ A;  3BTI A;  3BR3 A;  2Q24 A;  2ZCN A;  1RKT A;  1MBG A;  2TRT A;  1A5J A;  2LFB A;  2XGC A;  5EFY A;  4ICH A;  2TCT A;  1RES A;  2L0K A;  1GT0 C;  1U9O A;  3SFI A;  3A01 B;  1ETO A;  1HOM A;  1NK2 P;  5HBU A;  4V2G A;  5C3E J;  2DA7 A;  3ZQH A;  2FD5 A;  3VVY A;  2IU5 A;  1WI3 A;  3K7A J;  2WGB A;  3C2B A;  3VUQ A;  5E3N A;  4L62 A;  3PO3 J;  4FIS A;  5F0H A;  4A3G J;  2NP5 A;  4D5F A;  3ZQG A;  2P81 A;  3HB9 A;  4A3E J;  1P7J A;  2M2E A;  3MKL A;  1XC5 A;  1TWA J;  5E3L A;  1Z0X A;  3BTC A;  1ORK A;  5EYR A;  2I10 A;  1I50 J;  3IH3 A;  4JYK A;  3JRE A;  4C2M J;  3HTJ A;  2LTP A;  2VI6 A;  3JRI A;  1BW5 A;  3LSG A;  4M3D A;  3NAU A;  3ZQI A;  1R9T J;  5J1U A;  2EZL A;  2DA4 A;  3S1R J;  3JR9 A;  1TWG J;  4M3B A;  2GEN A;  1MBE A;  4MIM A;  2R5Y B;  1BA5 A;  1E3O C;  4G12 A;  2QCO A;  2Y9Y A;  3G1M A;  2FJ1 A;  1JUM A;  2HOT A;  1IGN A;  1POG A;  5HAW A;  5C4X J;  4Y52 J;  3CCY A;  3BG5 A;  3BHQ A;  3HDD A;  1UHS A;  5IP6 A;  4JKZ A;  3MN2 A;  4XID A;  1X2M A;  2EQR A;  4AUX A;  1HLV A;  4NEL A;  4XIC A;  3I4N J;  1GDT A;  4IHX A;  3PPB A;  1OFC X;  1ZKG A;  4BKX A;  1IUF A;  2DMT A;  2ME0 A;  3FRQ A;  2XPV A;  1PUF B;  3TW7 A;  2X48 A;  2HXI A;  1YRN B;  3GTG J;  2LLK A;  2FBQ A;  2CRG A;  2O7O A;  1ETK A;  2EH3 A;  3KKC A;  3NRG A;  4JX4 A;  1B8I A;  3GTK J;  1TWF J;  1F36 A;  2GFN A;  1P7I A;  4GCT A;  4ABZ A;  1ETW A;  1H8A C;  2EZK A;  3TP3 A;  3GTQ J;  3ANP A;  1MBH A;  4XRS G;  4QTR A;  1ETY A;  2L7M P;  4BBR J;  3EUP A;  3OSF A;  3P9T A;  2HKU A;  4I6Z A;  1G2H A;  1LFU P;  4IHY A;  5F0F A;  5HSZ A;  3CWR A;  3A03 A;  3HOW J;  2R92 J;  2YS9 A;  2RAS A;  3GZI A;  1IV6 A;  2LR8 A;  2DG7 A;  3AQT A;  4A3F J;  2FQ4 A;  2JMW A;  3S14 J;  3VW1 A;  5H9T A;  3K2A A;  3O8H A;  3LNQ A;  3JRC A;  5EEA A;  4A3D J;  1PUF A;  4D7M A;  2NS8 A;  3UKG A;  2O8K A;  4UDS A;  1JTY A;  3HTI A;  5FLV A;  4MLO A;  3ZQF A;  1JUS A;  5J1R A;  1GVD A;  3TP0 A;  1AKH A;  1U78 A;  3BQY A;  5GPA A;  4A3I J;  3JRF A;  3CJD A;  5IYC J;  3MNL A;  1ZGW A;  2WB1 N;  4DYR A;  3BRU A;  3VVX A;  4IHW A;  3RZO J;  1DU6 A;  2JA5 J;  2XPU A;  1LFB A;  3HKZ N;  2FX0 A;  3F0C A;  2NP3 A;  4MXM A;  2DA2 A;  2JJ7 A;  4ACI A;  3CQZ J;  2RAE A;  1MH4 A;  2W53 A;  2NX4 A;  3QPL A;  5IP9 J;  2M9H A;  1ETV A;  3HEF A;  3HBL A;  2M8G X;  3W6V A;  4XK4 A;  2ID3 A;  4S0H B;  5FKO A;  1GV5 A;  3T6N A;  1LE8 A;  1APL C;  2Y0S N;  4JX5 A;  2QKO A;  1OJL A;  2WAQ N;  1VND A;  1FJL A;  1IRZ A;  3ZOB A;  1RKW A;  5IP7 J;  2PMZ N;  1ZR2 A;  3KNW A;  3PAS A;  4X6A J;  3EGQ A;  3QKX A;  2OI8 A;  4GCL A;  5EGO B;  1AHD P;  4A3C J;  3Q3S A;  3O8G A;  1QVT A;  3F1B A;  3BNI A;  3S1N J;  4BXX J;  4A93 J;  2D6Y A;  1DU0 A;  2DN0 A;  1K83 J;  2VKV A;  2YVE A;  9ANT A;  4HNV A;  5FGL A;  2JK3 A;  5E3M A;  2WUI A;  3I4M J;  2O9L A;  2QIB A;  4UUS A;  1Y1W J;  2HDD A;  2NOG A;  4J19 A;  3ZQL A;  1WH5 A;  3GTP J;  1RET A;  5M5W J;  5M3M J;  2YU9 J;  3NXC A;  2G0E A;  2MGQ A;  4JL3 A;  1VI0 A;  5JLX A;  2KDZ A;  2DG8 A;  1A6I A;  3ON4 A;  3FIS A;  3JSJ A;  2JA8 J;  4FCY A;  2PZ9 A;  2GBY A;  1FTZ A;  2KT0 A;  3B6C A;  1B8I B;  2V57 A;  1QVU A;  4V2F A;  2LKX A;  3OIO A;  4AF5 A;  1Q1V A;  5EGO A;  3PO2 J;  2CUE A;  3HOX J;  1IDZ A;  2G7L A;  2EZH A;  3BR6 A;  3GTL J;  5M5X J;  1OCT C;  2E19 A;  1RPW A;  3S5R A;  2REK A;  3FK7 A;  3ZQC A;  2ECB A;  2QF7 A;  3WHC A;  1D5Y A;  2O7T A;  3NNR A;  4I76 A;  3HIM A;  1X58 A;  2DMN A;  4M3E A;  4NDL A;  2IAI A;  3LSR A;  1XS9 A;  1MNM C;  2G7S A;  3D1N I;  3CRJ A;  3BQZ A;  4B1R A;  3V78 A;  5FMP A;  2CQX A;  2QWT A;  4A3J J;  4M6V A;  5GP9 A;  3JRG A;  2ECC A;  2D5V A;  2K9Q A;  4A3L J;  4QSH A;  3DEW A;  3ANG A;  2N8G A;  3IUV A;  1O4X A;  3BG3 A;  2QTQ A;  1AKH B;  4DYC A;  3TED A;  2JA6 J;  2K40 A;  3WHB A;  3O60 A;  3S16 J;  2JWT A;  3GBG A;  3BR2 A;  2ID6 A;  2EZI A;  2X9D A;  1ZQ3 P;  4JNN A;  4QIW N;  2F07 A;  2JN6 A;  1U9N A;  3MVP A;  2H8R A;  4A3K J;  2E1O A;  2K9S A;  3HOU J;  5FKN A;  5FJ8 J;  3A02 A;  2AHQ A; 
#chains in the Genus database with same CATH topology
 4E7H A;  2OC6 A;  3IKV A;  2BGC A;  4I99 C;  2HQA A;  4ZYG A;  1WCM J;  1LDK B;  1MDM B;  2XGD A;  2ME6 A;  3E7L A;  2OCE A;  3GF2 A;  2BZT A;  3VPR A;  4G7O F;  3R0J A;  2DXI A;  1SEU A;  4ME9 A;  4HAM A;  3JAM Z;  1LEB A;  1YLF A;  4B3A A;  3JRH A;  1GV2 A;  2VXD A;  3GZ6 A;  2P5L C;  2IA0 A;  1AU7 A;  4WK8 F;  3SDG A;  2V7F A;  3DKW A;  4BDZ A;  2B9S A;  3DKX A;  2L02 A;  1UAA A;  1HW5 A;  4IOC F;  4L9T A;  3WTT C;  2JRM A;  2KPM A;  1D1B A;  1KZH A;  1EV7 A;  4XBF A;  3F8C A;  1MNE A;  2AO9 A;  5IPA A;  1HDP A;  1Y6I A;  2GOM A;  4R8H A;  3W2A A;  5HDN A;  1K78 B;  1OLT A;  2JT1 A;  4LG0 A;  1A36 A;  2XF7 A;  2A2F X;  3IH2 A;  1KU3 A;  4XSX F;  2VOP A;  5EZG A;  2R7R A;  2ZCX A;  2DJI A;  2HKO A;  1X1D A;  2XRN A;  4RB1 A;  4XLA A;  4IEJ A;  2UXI A;  3IH4 A;  3DLL F;  1UST A;  1ULY A;  5BQT A;  4KYW A;  2PLY A;  1WPK A;  2HOS A;  4I09 A;  1HCR A;  4GO1 A;  4OAZ A;  3I53 A;  4YEJ A;  3BPX A;  3ZPL A;  3ABK H;  4BUP A;  4C3H J;  3LST A;  4AD9 A;  1YX5 A;  2KRH A;  1D3Y A;  1FBU A;  4W1U A;  3REO A;  3L1P A;  5D6E A;  1TQI A;  3K1M A;  4XN3 A;  4RA2 A;  3IC7 A;  2HDC A;  3JSO A;  1F43 A;  4LB6 B;  4G6T B;  1MJ9 A;  3RI4 A;  1IJW C;  5LLQ A;  2EIL H;  3WU0 A;  2DTZ A;  4MTE A;  2V9K A;  3LSP A;  2OUM A;  4Y15 A;  4EM1 A;  1Z3X A;  4IX7 A;  4DOZ A;  1RZ4 A;  1YOV B;  1L3L A;  4GFL A;  3GTM J;  1KQ0 A;  1NG7 A;  1BI2 A;  2X85 A;  2K9N A;  2H94 A;  4HOB A;  1MMG A;  1JGS A;  3DKY A;  1WJA A;  4IZZ A;  1MSF C;  1XSV A;  3Q0W A;  1FIP A;  1W0U A;  2FNP A;  2JPB A;  5FKK A;  2XDN A;  1ZG3 A;  1ERD A;  4PXI A;  3J7A O;  5EF6 A;  3RQI A;  5K5O A;  2HI3 A;  2DQL A;  4PGH A;  2E2I J;  3LSI A;  1D1A A;  3ZMV A;  1BR4 A;  4A6E A;  4FQG A;  3CCV I;  4XRS A;  3D0S A;  5DUI A;  5TGT A;  4O6J A;  2B0L A;  1H9T A;  1ZLK A;  1U5T C;  1EKE A;  3BZC A;  4OIR F;  4E7Z A;  2G7G A;  5CVJ A;  2F5C A;  5IYD J;  5C4Y A;  1QZZ A;  4AWX B;  2K85 A;  1USS A;  2M0C A;  5F64 A;  3A4C A;  4EMS A;  2EFO A;  1N77 A;  5LGU A;  3SDB A;  3JRB A;  1FY7 A;  2VN2 A;  4HSR A;  2KFD A;  3HE0 A;  2UXX A;  2ZB9 A;  4CO8 A;  3SZP A;  1YG2 A;  4YIF A;  4WX9 A;  2ZC2 A;  2OQR A;  3ZMZ A;  1X19 A;  2CWE A;  4PGG A;  2EFP A;  3MFK A;  3WTU C;  3AG2 H;  4C3J J;  1DP7 P;  2XDV A;  5J1Y A;  1U5T A;  3IAS 2;  1VQ4 I;  3COL A;  4YZE A;  3VOE A;  5J8F A;  1FEX A;  3HTH A;  2BE5 F;  1IG7 A;  3OOU A;  2O6G E;  4MGR A;  3V42 A;  2QOP A;  2E5Z A;  1Z77 A;  1G3T A;  1WHU A;  4IF4 A;  1I3Q J;  3FBN B;  3ZN1 A;  3HTA A;  2P5V A;  1Z7U A;  4BHP A;  4RM2 A;  3P9K A;  2ZXH A;  2RDP A;  1YIT I;  4Y33 A;  1V5F A;  4O5V A;  1MMD A;  2PG4 A;  1K7A A;  4NQW A;  3FXO A;  1ZH5 A;  4PSX A;  2XRO A;  3AKZ A;  4ZDO A;  2A05 A;  1UCR A;  1SFO J;  3OR1 C;  3VTI A;  1ZGA A;  3CCR I;  4GCK A;  5KAI C;  5C4J J;  4PJJ A;  3KLO A;  5M3F J;  2CV0 A;  3G56 A;  3MQ0 A;  3B73 A;  1SC7 A;  2WV1 A;  4X0G A;  3BTJ A;  4E7J A;  5E1Z B;  2ZXI A;  2PJP A;  4FE7 A;  1TNT A;  4AYB N;  3E5U A;  3FXK A;  5EG0 B;  2GM4 A;  1T33 A;  3QWL A;  1DGR M;  2LF8 A;  1OYY A;  2WAF A;  3BC8 A;  3DU6 A;  5TIS C;  1KGS A;  3LSH A;  1S8N A;  3QU3 A;  2JA7 J;  3M4O J;  4MFD A;  3SEZ A;  2WY7 Q;  2IP2 A;  3JCU C;  2Y0S A;  5FRN A;  1SD5 A;  3MKW B;  4I01 A;  1W0T A;  2RGV A;  3M8J A;  4DZJ A;  1KQ9 A;  3HRU A;  1BR2 A;  2K02 A;  5AIP A;  1YIJ I;  2MLG A;  4HEA 2;  3RYP A;  4F52 A;  3OYH A;  2EPF A;  4NN1 A;  2PMZ A;  1IN8 A;  1Z9C A;  3T8R A;  3WTX C;  1UJ8 A;  2QSG X;  1W5C C;  5FFX A;  4CH7 A;  3E5Q A;  3BTI A;  4XKV A;  2LC2 A;  1RKT A;  1RES A;  4PCQ A;  2L0K A;  2NNN A;  2QQ9 A;  3TKY A;  2ZME A;  3A01 B;  2DLL A;  1NK2 P;  2FU4 A;  3OYJ A;  5C3E J;  5HBU A;  2FD5 A;  2MAB A;  3I0T A;  2WAD A;  3K7A J;  4GYI A;  5GAG J;  4KN4 X;  2OZU A;  3WOD F;  5FLX K;  3LQR A;  4A3E J;  2ZFU A;  3CJR B;  1W36 C;  1TT0 A;  4PSW A;  1QHG A;  2OTL I;  1X1C A;  3H3Z A;  4KIF A;  3J7Y J;  4C9Y A;  4HQE A;  1K6Y A;  4XON A;  2DPD A;  1ODD A;  2I10 A;  2PFV A;  3KP7 A;  5E1X A;  1I50 J;  3E6D A;  3HTJ A;  4C2M J;  1FPQ A;  5E79 C;  1X1A A;  3CF5 F;  2LTP A;  4RAZ A;  2VI6 A;  3DEU A;  5ICG A;  2DYS H;  2R7T A;  1AOY A;  4EVI A;  5ED4 A;  5E8G A;  3MZ8 A;  5CLS A;  1R9T J;  5J1U A;  3EDP A;  3LAJ A;  5DCF A;  2DA4 A;  2GOX B;  2K86 A;  3H5N A;  3JR9 A;  3S1R J;  4HNU A;  4M3B A;  1SVM A;  3ABT A;  3U1K A;  4BEH A;  5E8I A;  2MLK A;  4HNT A;  2QWW A;  1IAW A;  4ZYE A;  2JVH A;  2HQR A;  3G1M A;  5ICC A;  2KLO A;  1FP1 D;  2HOT A;  4II2 A;  2IS4 A;  5HAW A;  1IW7 F;  4Y52 J;  1W7P A;  3BG5 A;  3DFG A;  5FD5 A;  2PX9 A;  3HDD A;  1ZAO A;  2HYF A;  3HHG A;  3MN2 A;  4XID A;  4YFX F;  4E7L A;  2CS3 A;  4XIC A;  3SQN A;  3S8P A;  1GDT A;  1RUO A;  2E36 A;  1ZKG A;  3M8E A;  3FRQ A;  3CJQ B;  3E6B A;  2XPV A;  2YPR A;  1PUF B;  4OD5 A;  3TW7 A;  2X48 A;  4C2M A;  4MEY F;  1ZRD A;  2FBQ A;  2ZXW H;  4HX8 A;  1N25 A;  3ECO A;  3MEX A;  3GTK J;  1TWF J;  4G7H F;  2EFN A;  1P7I A;  2XKO A;  1FMW A;  2E7X A;  1FT9 A;  2EZK A;  3GTQ J;  1REP C;  4BL0 B;  1G59 A;  2EK5 A;  4KIS A;  1MKM A;  4LIV A;  3OSF A;  2R7F A;  3HZJ A;  1OMI A;  1X3Z B;  1G2H A;  1LFU P;  1V55 H;  5CKT A;  3QU6 A;  3CWR A;  5B3S H;  4B3X A;  3GFI A;  2CQ7 A;  2LR8 A;  2DO7 A;  3AQT A;  1V54 H;  3HSF A;  1YX3 A;  2JMW A;  3VW1 A;  2R4G A;  3K2A A;  3O8H A;  5TJJ A;  3LNQ A;  3GZ5 A;  5CVR A;  1TZL A;  3FM3 A;  4D7M A;  1UZC A;  3CP8 A;  4IKF A;  3QOP A;  5DYM A;  2LYC A;  3B02 A;  4MLO A;  3ZQF A;  1IN7 A;  1XGN A;  4ESF A;  4A3I J;  2JZY A;  2ETH A;  3EPZ A;  4GXO A;  2GXB A;  3CJD A;  4DVY P;  1WSU A;  3H36 A;  2WA0 A;  1L0O C;  2OCC H;  4IHW A;  1DUX C;  1R1V A;  2EA4 A;  3ZR8 X;  1KYZ A;  2XPU A;  1ZGJ A;  3C1D A;  1FSE A;  4Y17 A;  2FX0 A;  2VJ4 A;  4ACI A;  2W53 A;  2KKO A;  1LKX A;  4UVC A;  4LB5 A;  4UVB A;  5EEH A;  5FRM A;  1ETV A;  1MDM A;  3W6V A;  2M8G X;  4NC6 A;  4XK4 A;  1GV5 A;  1Z67 A;  2X1E A;  1P92 A;  3K1N A;  1F5T A;  3NQO A;  2P8T A;  4Y3O A;  1VQL I;  2CUJ A;  4V19 K;  2ZNZ A;  4ASN A;  5K5R A;  2FE3 A;  3KP5 A;  1UHM A;  4ZYA A;  3TO6 A;  2BHY A;  2H8W A;  3PFY A;  5H6Q A;  3QKX A;  3LA2 A;  1X1P A;  4LD5 A;  1AHD P;  3JTG A;  3CUQ C;  1QVT A;  3I71 A;  2NXN B;  3F6O A;  4KT6 A;  4A6D A;  1AWC A;  2QLZ A;  3S1N J;  4DBQ A;  1S9H A;  1X4P A;  3HRT A;  2L9S A;  2A6H F;  3E3V A;  2VKV A;  4XMY A;  1V3F A;  2FOK A;  2WUI A;  4GDF A;  1QZY A;  3L2Q A;  3COA C;  2L54 A;  2PMU A;  4OIP F;  1Z05 A;  1WH5 A;  5M5W J;  2G0E A;  2MGQ A;  1YI2 I;  1YJ9 I;  2KDZ A;  2X6W A;  3FIS A;  3N4M A;  3ON4 A;  3CC4 I;  2OA4 A;  4L9N A;  2A5W A;  1QVU A;  2UXN A;  2E35 A;  4AIH A;  3OIO A;  3E97 A;  1LJ9 A;  1OCO H;  1GHC A;  2CUE A;  2BEO A;  3HOX J;  1R22 A;  2NAZ A;  3NWT A;  5CPR B;  1IDZ A;  2G7L A;  2ZSH B;  3F8N A;  5FD6 A;  3I56 I;  3GTL J;  1OKR A;  1QA6 A;  5DD8 A;  2REK A;  3FK7 A;  5E18 F;  3ZQC A;  2AQF A;  2L5Q A;  1K79 A;  1D5Y A;  4BGD A;  1Z1D A;  1NHA A;  2MD0 A;  1EH7 A;  4M72 A;  4NUB A;  3VYT B;  1IN6 A;  2A5Y B;  2EWN A;  3D1N I;  2DK5 A;  2R7S A;  3CRJ A;  4XLH A;  1WJF A;  5FMP A;  3QYB A;  1XX5 A;  4M6V A;  3GX4 X;  1Y56 A;  1PJR A;  4FX4 A;  3PQJ A;  3ANG A;  2N8G A;  2DFE A;  4ZTF A;  3BG3 A;  3RSN A;  3CF2 A;  3M9A A;  3DTI A;  3TED A;  3WHB A;  4HDV A;  3OL4 A;  3E1S A;  3GBG A;  1HKS A;  2XC7 A;  4QWQ A;  2IGO A;  2F07 A;  3VB2 A;  4I2O A;  3MVP A;  3H92 A;  3RPQ A;  3SZT A;  3ZMS A;  5DCM B;  1VQM I;  4EJU A;  5FKN A;  2KQR A;  2V1N A;  2VBX A;  2AHQ A;  3SEQ A;  2DMP A;  1EF4 A;  3WTS C;  3M8F A;  5D19 A;  2YVX A;  4FHT A;  4ANJ A;  3S2H J;  5CXI A;  4PDK A;  2CMP A;  4J01 A;  3FBI B;  1HF0 A;  2GXA A;  3HSR A;  4AID A;  3G71 I;  1YYV A;  2NVX J;  1XCB A;  2VT3 A;  4HBL A;  3C7J A;  3HXL A;  3X2Q H;  4ENM A;  1MND A;  3RKX A;  2O8X A;  2JSP A;  2OD5 A;  2R7D A;  4AIK A;  3RKY A;  3HUG B;  1G3S A;  5M5Y J;  1SMT A;  1X1B A;  2OPT A;  3G1L A;  1HQC A;  2O5R A;  3V6G A;  3BTL A;  2PBX A;  1QU3 A;  3PL8 A;  2HOA A;  2DPU A;  3VVZ A;  3M1E A;  1YFH A;  3IUO A;  1JKQ C;  2ICW G;  5DTD A;  3HOT A;  1VFC A;  4BBS J;  4AYB A;  3S2D J;  3ASN H;  1FWZ A;  4U0V A;  5BMZ A;  1MBF A;  3JRA A;  1TQM A;  3RZD J;  5EDN A;  3TOB A;  4CZC A;  2LMD A;  1MSE C;  1ZLJ A;  4G6D A;  2MH2 A;  3HTS B;  2DMQ A;  3L2C A;  2L2O A;  5ILU A;  2Y31 A;  4ON0 A;  2Y0M A;  3NRV A;  1BN5 A;  1BIA A;  2HVS A;  3JRD A;  2HQ5 A;  2MW8 A;  3S1Q J;  1VQP I;  3BCG A;  2LOO A;  1KU9 A;  2DA1 A;  4CCN A;  1TBX A;  1O3S A;  4RB2 C;  1VQ8 I;  5J8C A;  3KX2 A;  4KJZ A;  2XB0 X;  4OIO F;  2KZV A;  3OYG A;  2WTE A;  2WWY A;  1Y1V J;  2XF6 A;  3GLL A;  2DOF A;  2EV5 A;  1R7J A;  2IGN A;  2WV0 A;  4BHB A;  4Q4Z F;  3OR2 C;  3MD2 A;  4WF2 A;  4LOC A;  2L9R A;  4MO7 A;  3EUA A;  2PJR A;  1P9Q C;  4XRM A;  3GLX A;  3H0G J;  1D8K A;  1NTC A;  1JKP C;  2DFI A;  3E5X A;  1R5G A;  2X6O A;  5BNG A;  5EG0 A;  6PAX A;  1TP4 A;  3K9T A;  4A3B J;  4DZP A;  3GYH X;  2GA1 A;  3DPT A;  1FZP B;  5JHF A;  1J2X A;  2XRL A;  4C30 A;  2KIM A;  4U87 A;  2LKP A;  1K4S A;  5FHP A;  1U2W A;  4LLL A;  4IQJ A;  4E4H A;  5CQG A;  3FK6 A;  3FHZ A;  1ON2 A;  5LEK A;  3E0J B;  2VLA A;  4HLY A;  2XKP A;  2NS7 A;  5LBQ A;  1TTY A;  4M3G A;  3MKZ A;  2JUG A;  3P9C A;  4MQ9 F;  3H1C A;  3TDU C;  5DAJ A;  3RDI A;  3TO7 A;  1B1B A;  2IXS A;  3BR0 A;  4EEF G;  3NPI A;  2BVM A;  2W24 A;  1JKO C;  2ADU A;  3LFU A;  1XG1 A;  1HBX G;  4A69 C;  4F3Q A;  2QVO A;  2DOE A;  2L7Z A;  3A01 A;  3M3Y J;  3LHQ A;  3PNT A;  1U6G A;  2MYS A;  2CYY A;  2RV8 A;  2FEZ A;  1TC3 C;  2Q8K A;  3CO6 C;  4RBO A;  1SAN A;  2VBY A;  5ICE A;  2RQQ A;  2FBI A;  2BXZ A;  3LOC A;  2DOD A;  1OR7 A;  2DT5 A;  2NVY J;  1BR1 A;  2P7C B;  4AC0 A;  2HPI A;  2VE8 A;  3M07 A;  4RLF A;  1FIA A;  2NVQ J;  2XSD C;  4QPQ A;  3CCE I;  1BC8 C;  2M8E A;  4F92 B;  4W97 A;  1T08 B;  2CU7 A;  1OCC H;  1BL0 A;  1FLI A;  2R0Q C;  3F8M A;  3MZY A;  2K5C A;  3VP5 A;  4KUM A;  4A5M A;  2DA6 A;  2YUS A;  1JHH A;  3ML6 A;  3DTE A;  2UXU A;  1B72 A;  2G3B A;  5B1B H;  2A61 A;  2NS0 A;  4NBQ A;  1S7E A;  4HF0 A;  5F27 A;  4CCM A;  4EAT A;  3H3V K;  2CV1 A;  3QYE A;  1YHQ I;  2R7Z J;  5GAD J;  4UHT A;  2MG4 A;  2NVT J;  5F1R A;  2IRF G;  2VKE A;  2BY0 A;  2R5Z B;  5KCM A;  4IHV A;  1P6R A;  4U9L A;  2VC0 A;  4CCK A;  1LDD A;  2CW7 A;  1QPM A;  3R0A A;  4FT8 A;  1JJ8 C;  1XGS A;  4NHJ A;  1G4D A;  1FMV A;  5J47 A;  5D8K B;  4RGU A;  3KP4 A;  4CYC B;  2HYJ A;  2LP0 A;  3UR3 C;  3VOK A;  3HGG A;  4UXN A;  1ETQ A;  3NAR A;  2Z3Y A;  4YFK F;  1R1U A;  2W1O A;  1E3P A;  2BYV E;  2L9N A;  2EV6 A;  3HOV J;  3KEY A;  2VKD A;  2OER A;  1XMK A;  4IOA F;  1IC8 A;  5HS9 A;  3E7Q A;  2QKL B;  1E17 A;  3U21 A;  3EUH A;  2VOO A;  1PUE E;  2UZK A;  3ZMU A;  1JTX A;  4XOT A;  1KA8 A;  3O3K A;  4HST A;  1OYW A;  3F6V A;  5HNH A;  4RAY A;  3CDL A;  4II3 A;  4KIB A;  4IRV A;  1CGP A;  4EGY A;  1BW6 A;  2LY9 A;  2G7H A;  3Q9V A;  4ITV A;  4R1H A;  5IYB J;  3WU1 B;  2OJE D;  1BOB A;  3BY6 A;  2LDU A;  5IY5 H;  5JLW A;  2HVR A;  2LH9 A;  4HZF A;  3ON2 A;  1JHF A;  2CUF A;  3HC7 A;  2Q2E B;  1T56 A;  2DYR H;  5IOY A;  2M34 A;  2ZOY A;  2F5D A;  3D5S C;  4EJO A;  2ZOZ A;  3W6J B;  2GLO A;  1T2K A;  4IRH A;  3A0B C;  2Q24 A;  2LRE A;  4JQF A;  3T8T A;  4YG2 F;  2ZSI B;  5L3D A;  4ICH A;  1U9O A;  3SFI A;  1HOM A;  2VL8 A;  3GXO A;  2ISY A;  2DA7 A;  3ZQH A;  2WY8 Q;  3VVY A;  3FF5 A;  4E70 A;  3F22 A;  3BP8 A;  5F0H A;  4A3G J;  4I0A A;  5HDG A;  1SAX A;  2R7W A;  3F72 A;  2CFX A;  2FBH A;  3ZQG A;  4HG2 A;  1W36 D;  4OIQ F;  5CVV A;  3ABM H;  2W84 A;  3MKL A;  2DOA A;  2H09 A;  2M30 A;  1SFE A;  2E1M B;  3F8B A;  5E3L A;  3OYK A;  1O57 A;  2C6Y A;  2D1V A;  3ISP A;  1W7P D;  1VZ0 A;  1S6L A;  4GCV A;  3C3W A;  5EYR A;  3BWG A;  3WTZ A;  2W00 A;  3IH3 A;  3RTR A;  4XKW A;  1MW7 A;  3JRE A;  3LMM A;  2E60 A;  3JRI A;  4OMZ A;  3J81 K;  3OOP A;  3LSG A;  2UUZ A;  3BPV A;  3NAU A;  3KE2 A;  3SXY A;  3W3C A;  4EM0 B;  1CF7 B;  1W4M A;  3H3U A;  3GME A;  4MIM A;  5CQE A;  3TBI A;  5CVI A;  4YFN F;  1BA5 A;  1E3O C;  3FXU A;  3TOA A;  2IJL A;  2Y9Y A;  2F6C A;  2ZJ2 A;  2LRD A;  1JUM A;  1O3R A;  2BY1 A;  1POG A;  2V79 A;  5C4X J;  3FMR A;  3PFI A;  3PUB A;  3BHQ A;  2HU9 A;  1UHS A;  3N97 A;  3CUO A;  1VQO I;  2EQR A;  2XAF A;  1GXP A;  2V1D A;  3WE3 A;  4XKC A;  2QBY B;  2H27 A;  4U7D A;  3PPB A;  3OYM A;  5DD4 A;  1OFC X;  1NG6 A;  3DU5 A;  1U8R A;  1X4O A;  3R6S A;  2PI0 A;  3BCB A;  2L9V A;  2K7L A;  2LKS A;  3QPH A;  1YRN B;  2W4S A;  4XQF A;  2O7O A;  4FAS D;  2EH3 A;  5D4S A;  3FWE A;  1LEA A;  3OIP A;  2GFN A;  2HS5 A;  1T8I A;  4LG3 A;  1RIO H;  3TP3 A;  2HPM A;  3ANP A;  4G8X A;  4QTR A;  1Y8Q B;  5CJ9 A;  4FET A;  2L7M P;  2VQL A;  3M1C A;  2P5K A;  5B5E C;  4IHY A;  5F0F A;  1Y0U A;  2KJC A;  1LVK A;  4BJ5 C;  3HOW J;  4LGW A;  2RAS A;  2VJ5 A;  2EIJ H;  3DBH B;  2F5F A;  5LRS A;  3S2W A;  4A3F J;  3H9G A;  3AG3 H;  4OWR B;  4PUS A;  2NOJ B;  4PK4 A;  5LHH A;  5IT9 K;  1V5G A;  2E1C A;  5GTH C;  1LQ1 A;  3UKG A;  1G8X A;  1QO0 D;  3ESW B;  4B48 A;  4ENJ A;  5FLV A;  3HTI A;  2A69 F;  3TP0 A;  4D0P A;  4M71 A;  1U78 A;  5GPA A;  5IYC J;  1D0Z A;  2L3D A;  2WB1 N;  3J7A Y;  2QGU A;  1G6N A;  2CW0 F;  1DU6 A;  4BJT A;  2JA5 J;  5J4V A;  2ZME C;  4EQQ A;  3HKZ N;  5DCM A;  3K4B A;  1J7K A;  2NP3 A;  4MXM A;  2RAE A;  2P4W A;  1MH4 A;  2VAS A;  3K4J A;  4N4N B;  4UV9 A;  2CG4 A;  3QPL A;  2XIG A;  3AL0 C;  1J9I A;  2E1N A;  4BE1 A;  4RGR A;  2ID3 A;  4S0H B;  5HLT A;  3T6N A;  4ZTJ A;  3ABL H;  1XGM A;  1UHW A;  3D5R C;  2QKO A;  2EJR A;  1HKQ A;  3KPH A;  3BG6 A;  2CQK A;  2L7K A;  2ZNY A;  2KHM A;  4N4O B;  3S3O A;  3A1Y A;  1RRJ A;  1FOY A;  3HUG A;  3ZOB A;  1LB2 A;  3DTK A;  2OI8 A;  2LNB A;  1A04 A;  5IT9 Z;  1WVR A;  1OQY A;  3Q3S A;  3O8G A;  5LHI A;  4XKB A;  1LVA A;  2A6E F;  4QLC U;  3BNI A;  2D6Y A;  4BXX J;  3I58 A;  5E20 A;  1Z7L A;  5FFZ A;  1S5L C;  1R4M B;  4WCG A;  4HF1 A;  2ZXJ A;  2YVE A;  5FGL A;  3MCZ A;  1VQ9 I;  4ZZD A;  2JK3 A;  5E3M A;  3MZH A;  4RB0 A;  3CES A;  1DDN A;  2WC2 A;  2YU9 J;  1DPU A;  2IA1 A;  2VB6 A;  3NXC A;  4MQV A;  2MFZ A;  5JLX A;  2L4A A;  1A6I A;  1XGO A;  3JSJ A;  3L2V A;  2JA8 J;  1VQ5 I;  2YX4 A;  2PZ9 A;  3O6B B;  3JW4 A;  4OIN F;  1S72 I;  2ZY9 A;  4WXH A;  1HA8 A;  2HOE A;  2FRH A;  1WRJ A;  5GTI C;  1B59 A;  5KHD A;  3E6M A;  1G3W A;  4LK0 F;  2LKX A;  1Q1V A;  5EGO A;  1WJ5 A;  3LQQ A;  1D5V A;  1F1Z A;  2CSO A;  2IGK A;  5JFR A;  3MWM A;  2DAO A;  2E19 A;  2F4M B;  3RKW A;  5ICF A;  5BS6 A;  1ZRF A;  3MMY B;  1BI0 A;  2QF7 A;  1R1T A;  3NNR A;  4N9I A;  2E5N A;  4M3E A;  2QYO A;  5JI6 A;  1WJB A;  3K4C A;  1MNM C;  5KNL A;  1BC7 C;  4B1R A;  3CD6 I;  3V78 A;  2CQX A;  1ON1 A;  5FLX Z;  4A3J J;  2D45 A;  2QWT A;  3FHN A;  5GP9 A;  4RB3 C;  3BJA A;  3TDZ C;  3DEW A;  1RC9 A;  3GCM A;  2QTQ A;  4H4K C;  3G3Z A;  2Z5U A;  4DYC A;  3O60 A;  4HV6 A;  5B66 C;  3OV8 A;  2BV6 A;  3BR2 A;  2R7O A;  2ID6 A;  2X9D A;  1P4X A;  4JNN A;  1QNT A;  4WXD A;  1MMA A;  1U9N A;  4PJN A;  4A3K J;  2EV0 A;  1BBY A;  5EEG A;  2PMH A;  3H9J A;  3CCQ I;  3A02 A;  1E0E A;  3EUP A;  1T0F A;  4EV0 A;  1FTT A;  1S7O A;  3HOY J;  3RPU A;  4A12 A;  1MH3 A;  5FKL A;  4Y7N J;  3ERE D;  1LE8 B;  2Q1Z B;  1LPQ A;  1S7A A;  2E7W A;  3CMY A;  1YIO A;  4IJA A;  2DA3 A;  3SHF A;  2DMU A;  5L3G A;  4BQA A;  2G9W A;  1J09 A;  4PJ0 C;  3S17 J;  1SMY F;  2W57 A;  1R4N B;  4U0Y A;  1RNL A;  3QQA A;  1BI1 A;  1Z6T A;  4XN0 A;  2VQH A;  3S3N A;  2Y75 A;  2CW8 A;  4M9Z A;  5LRR A;  2DCE A;  5D5W B;  1ZYR F;  3DP7 A;  3TL4 X;  5K7Z A;  2FQ3 A;  3G1O A;  2VUM J;  2HNH A;  2IT0 A;  1SAU A;  3W2V A;  1ZEL A;  4NNJ A;  3WGH A;  4EGZ A;  5IOZ A;  4FTH A;  5TRD A;  3ZMT A;  2GWR A;  3GTJ J;  3QOD A;  2EIM H;  4GFK A;  1FBQ A;  2YSR A;  2DK8 A;  5F04 A;  2UXH A;  4A0X A;  4YRV A;  2W82 A;  3KYD B;  2MSY A;  5ILS A;  1SVO A;  5AIQ A;  2M87 A;  3WTY C;  2VQC A;  5FGM A;  2IVM A;  2PFB A;  4RAG A;  2W7N A;  2ZKZ A;  3NWS A;  1JGG A;  5D18 A;  3FDY A;  5D8L B;  2MC3 A;  3CLQ A;  1JXS A;  2JUC A;  3L7W A;  4I7H A;  2R5Z A;  2V9V A;  3I54 A;  2XB5 A;  1KON A;  2HKX A;  4HPQ A;  2ZJQ F;  3DPJ A;  1P4W A;  3CDI A;  1WH7 A;  4CA0 A;  4ZZL A;  4RM3 A;  2XAU A;  4U88 A;  3ULQ B;  4LFU A;  4H0E A;  3QRF F;  4L0Z B;  4ETS A;  3G6E I;  2FMY A;  1NK3 P;  4M74 A;  4CYC A;  2MC4 A;  2EFQ A;  1K78 A;  2Q0O A;  5K5Q A;  2EBI A;  3DCF A;  3L00 A;  1R58 A;  2HYT A;  2HQN A;  1H89 C;  4AC6 A;  4KIG A;  3ZQQ A;  1QHH D;  1VQK I;  3VYU B;  1UI6 A;  2OZ6 A;  1VQ6 I;  5K7F A;  2DDA A;  3KEQ A;  3RKQ A;  1E3H A;  2VC1 A;  2DA5 A;  3QAH A;  3RIR A;  2QUF A;  4EJT A;  2K27 A;  1GVJ A;  2MD5 A;  3BG9 A;  2IEK A;  5J40 A;  2WBM A;  3PUF A;  4ZYH A;  4RMN A;  2GAU A;  1MGT A;  3BLY A;  1SVL A;  1MD0 A;  3FKI J;  1W5T A;  2OAZ A;  2V26 A;  5E3O A;  2Y9Z A;  4ESJ A;  2E2J J;  3KYL A;  1I1S A;  4E7I A;  1U5T B;  5HLG A;  2XPW A;  4CIC A;  1IRG A;  3BJO A;  2Z99 A;  2Q2E A;  5AQC A;  4IL6 C;  3DF8 A;  3B81 A;  2ACJ A;  3HM5 A;  3HJE A;  1FNN A;  3P7N A;  4HDU A;  5GAH J;  5DS9 A;  1YO5 C;  4AIJ A;  2Y2Z A;  1XCV A;  2HXO A;  1F9N A;  5DM7 F;  2ZJP F;  1U8B A;  2ESN A;  3P5J A;  3CP2 A;  3FX3 A;  5BPI A;  2XAH A;  5D1R A;  1QGP A;  2L01 A;  2K9L A;  2Z16 A;  1R49 A;  1M1E B;  3H9Q A;  1H0M A;  4F7Z A;  1VF9 A;  4X1E A;  5L3C A;  5HOD A;  2IS1 A;  5L3F A;  2ZCM A;  3HYI A;  1LFP A;  1KYW A;  1OCZ H;  1RR7 A;  2W48 A;  5LHG A;  1RI7 A;  4NQW B;  1MJA A;  4C3I J;  3HGY A;  4LLG F;  1A31 A;  3L09 A;  1UEL B;  3N05 A;  4L9J A;  1ZK8 A;  5F1J A;  3R4K A;  4MK6 A;  2ISZ A;  5LFA A;  1OIS A;  4RS8 A;  2VQG A;  3RYR A;  4UNO A;  2ELK A;  1KU2 A;  2RVC A;  5ERI A;  3B6A A;  1WFX A;  4UUT A;  4OU0 A;  5KVR A;  1DGW Y;  3GZN B;  1A35 A;  4ZC3 A;  4MEX F;  1MMS A;  3K8P C;  1UG2 A;  3K6G A;  3OYL A;  3E6C C;  3DQV C;  3L2W A;  1HDD C;  5K7H A;  4XLP F;  1CF7 A;  2QZ8 A;  1FC3 A;  4ESB A;  4M3F A;  2PN6 A;  2R93 J;  3KCC A;  2BW3 B;  1IV8 A;  4IVN A;  3LSJ A;  1T38 A;  5F0C A;  3FXM A;  2Z2S B;  3HG9 A;  2QSF X;  1N75 A;  2A68 F;  1I6X A;  4BY7 J;  3CTA A;  1OCR H;  3FXL A;  2IA2 A;  2DU9 A;  4M73 A;  4CCL A;  2QBY A;  1H88 C;  3ZGK A;  2K4B A;  4Z2Y A;  4KNY A;  3EYI A;  4QPO A;  2J5O A;  2WB1 A;  3V7S A;  1R71 A;  5LEJ A;  3C07 A;  3HKZ A;  1YRN A;  3DBL B;  1HC8 A;  2DJN A;  1WZ2 A;  3OWT A;  3RH2 A;  3V8L A;  3HRM A;  4O3M A;  2GIV A;  2EIN H;  4PJM A;  4KWA A;  4D5C A;  3OYC A;  2VBW A;  3HOZ J;  4HA8 A;  2GIZ A;  5J3L A;  2IW5 A;  3BJ6 A;  3HHH A;  4XLN F;  4BS9 A;  3HIF A;  1BJA A;  3AQS A;  1WGX A;  3GFL A;  2QEN A;  3F9K A;  4BU2 A;  5IT3 A;  4ZYD A;  3LWJ A;  4RDU A;  1ENH A;  2Z33 A;  1ETX A;  2FUG 2;  3H0D A;  3DPU A;  1C0W A;  3DLA A;  3SJM A;  3G2B A;  3KET A;  1B6A A;  1QBJ A;  3LJL A;  1UMQ A;  4BHC A;  2ZCN A;  2DW4 A;  3S93 A;  2FXA A;  1MBG A;  3KZY A;  2LFB A;  1A5J A;  5EFY A;  2FSW A;  2D2W A;  2CH0 A;  4XRF A;  1GT0 C;  2LY2 A;  3R61 A;  3DV8 A;  5K1Y A;  5HDK A;  2COM A;  4D1Q A;  4HV5 A;  2IU5 A;  2WGB A;  4IXA A;  3C2B A;  4F91 B;  3WG7 H;  4DNC A;  3HB9 A;  4DJA A;  1W7P B;  2MA3 A;  2G7U A;  2KL4 A;  4NC7 A;  2FBK A;  3CCU I;  2BXY A;  1XC5 A;  5KAF C;  3UNG C;  3GFJ A;  1SD4 A;  1ORK A;  3I64 A;  1V5E A;  2LG4 A;  1OR7 C;  2Y48 A;  2ZFW A;  1T39 A;  3SFZ A;  1FOW A;  3U9G A;  2PEX A;  2CQN A;  1R6R A;  5H20 A;  3BCA A;  4ZJZ A;  1BW5 A;  1FOX A;  2VE9 A;  3PNV A;  1IUY A;  4L18 B;  4M3D A;  3ZQI A;  3OYB A;  1ACI A;  1XB4 A;  1TWG J;  4PFO A;  4CDG A;  1MBE A;  2R5Y B;  2YU3 A;  3FZV A;  1R23 A;  1HST A;  3KP6 A;  3KYC B;  2M45 A;  4E7S A;  2X51 A;  2JSC A;  2QSH X;  3JAM K;  2MH9 A;  2AXL A;  2M1B A;  3K1P A;  2ELJ A;  4CUG A;  1PYV A;  2DBB A;  4JKZ A;  4BQQ A;  3IWZ A;  1X2M A;  4AUX A;  1HLV A;  4NEL A;  3I4N J;  4S05 A;  5DUK A;  5FB2 A;  4IHX A;  3RCO A;  2AXT C;  3OS0 A;  4MHG A;  4KMF A;  4FX0 A;  3GEZ A;  1IUF A;  2DMT A;  3LA3 A;  3GTG J;  2HXI A;  3G4S I;  3A0H C;  2CRG A;  2VBZ A;  1ETK A;  3LAP A;  3LL7 A;  3KKC A;  3NRG A;  4JX4 A;  4DGW B;  1IZ1 A;  3QP6 A;  2P6T A;  2NNY A;  4GCT A;  4A5N A;  4XLC A;  1H8A C;  4KFC A;  4U0W A;  1MBH A;  1J59 A;  1ZRC A;  4C2U A;  1D1C A;  3EUH C;  1ETY A;  5D5U B;  4BBR J;  3BDD A;  3ABU A;  4I6Z A;  3LWF A;  5H6R A;  1YW9 A;  1TNS A;  2YS9 A;  2KP6 A;  3GZI A;  1Z6R A;  5HS8 A;  2DFF A;  2KRF A;  3NEU A;  2DG7 A;  2FQ4 A;  4CYD A;  4F93 B;  4IO9 F;  1PP7 U;  4BE0 A;  3L9F A;  2M4K A;  1XPX A;  3JRC A;  5EEA A;  1PUF A;  3ERM A;  2NS8 A;  3TO9 A;  4UDS A;  1JTY A;  4P55 A;  2CFO A;  5J1R A;  4HX7 A;  5J6X A;  3BQY A;  3JRF A;  1ZGW A;  2H1L A;  1RR8 C;  4DYR A;  1SD6 A;  2VXZ A;  3HSE A;  2F2E A;  3IL2 A;  2OV7 A;  1LFB A;  1O7L A;  3CMA I;  2O3F A;  2JJ7 A;  4G94 A;  3M7G A;  3ZQ7 A;  5A2Q K;  3H5R A;  3VYS B;  1PP8 F;  2NX4 A;  4I0B A;  3GW2 A;  1FYL A;  5IP9 J;  5AON A;  3HBL A;  2XVC A;  5FKO A;  3ELK A;  1LE8 A;  2M5W A;  3AAF A;  2IS2 A;  1EH8 A;  1TW3 A;  4M6X A;  4JX5 A;  1KQ8 A;  1OJL A;  4XLE A;  4UY8 I;  1XMA A;  2FA5 A;  2W25 A;  2M7A A;  3WGI A;  2EFW A;  3OS2 A;  4YIR X;  3CUQ B;  2EIK H;  1RKW A;  5IP7 J;  2ZBK A;  4K2E A;  2Z1D A;  4TV7 A;  3FMQ A;  1ZR2 A;  1Z91 A;  4X6A J;  3KNW A;  3IRR A;  4AVZ A;  3F3X A;  2O0Y A;  1FP2 A;  4ZDL A;  2ZCW A;  3V8K A;  4IHT A;  2UV1 A;  3WG9 A;  2LSO A;  3OYF A;  3Q5F A;  1D0Y A;  2HFH A;  1DU0 A;  1K83 J;  4HNV A;  4BE2 A;  1I5Z A;  2HGC A;  3C18 A;  3I4M J;  1STZ A;  4P5O A;  1Y1W J;  1OPC A;  4GYG A;  4BYY A;  2NOG A;  3JSP A;  4J19 A;  3ZQL A;  4BXU A;  4M9S A;  2V1U A;  1RET A;  3GTP J;  5M3M J;  5JHU A;  5A2Q Z;  2OQG A;  4JL3 A;  1Y8R B;  4A2U A;  2DG8 A;  1O3T A;  1PDN C;  2GBY A;  3SYT A;  3EET A;  3B6C A;  1B8I B;  2XAQ A;  4V2F A;  4AF5 A;  2Y69 H;  3WGG A;  2XV4 S;  3I3L A;  1DQU A;  2OBP A;  1SD7 A;  1AA7 A;  1BM9 A;  3A2K A;  1R5I D;  3SWH A;  3BR6 A;  4AM3 A;  3FKJ A;  1DPR A;  1SFX A;  3QOE A;  1OCT C;  1RPW A;  3L2U A;  3S5R A;  3F8F A;  2DT6 A;  2XF5 A;  4PFP A;  2ECB A;  3WHC A;  2P7V B;  3PSF A;  1MZB A;  2DMN A;  2E71 A;  4NDL A;  3LSR A;  2R7U A;  2G7S A;  4PZJ A;  3RPU D;  3BQZ A;  2B1E A;  3HTU A;  2P6S A;  3PJR A;  4L5J A;  3GVA A;  4UV8 A;  2ECC A;  2D5V A;  2K9Q A;  4LJZ F;  4CHU A;  4ENK A;  4QSH A;  3RJP A;  2X1D A;  1FYK A;  3IUV A;  1GXQ A;  2ELH A;  1AKH B;  4B44 A;  2JA6 J;  2K40 A;  1D0X A;  2M4G A;  5CVU A;  2JWT A;  3H5A A;  3TGN A;  2EZI A;  1ZQ3 P;  3CJN A;  1EA3 A;  2HZT A;  4QIW N;  3D5L A;  2JN6 A;  2LY1 A;  4Q48 A;  4F55 A;  3J81 Z;  4XNF A;  2K9S A;  3GWZ A;  4R79 A;  3R60 A;  3IP4 B;  5FJ8 J;  4YII A;  3NS4 A;  3CLO A;  4OAY A;  2HDW A;  1B9M A;  4DQ2 A;  2K3F A;  1TW2 A;  2QEX I;  4MFE A;  3U2R A;  4KIC A;  2JTV A;  4IPA A;  4OOI A;  3WU2 C;  3K4K A;  3LFK A;  3CJT B;  4KA4 A;  3KP2 A;  2OF7 A;  4BQO A;  5HNF A;  2H1K A;  2ESH A;  2KDO A;  1TWH J;  2R7Q A;  3FXQ A;  4CZZ A;  2A3S A;  1YS6 A;  3CO7 C;  3KKD A;  1MBK A;  3F23 A;  2IPQ X;  3OIQ A;  5D4R A;  2UXP A;  1JT0 A;  3ASO H;  3I5U A;  2RC4 A;  2BBY A;  3V7R A;  3OYD A;  4WWC A;  1IN5 A;  1HKT A;  2R3S A;  3EUK L;  4L5I A;  2X0L A;  3I9V 2;  2MBF A;  2F5E A;  1QPI A;  2H6B A;  2L7F P;  3VYR B;  1I39 A;  1TT5 B;  2XGE A;  1ZN2 A;  3BR1 A;  2LBF B;  1SGM A;  3BJB A;  3QYF A;  5DM6 F;  4LMY A;  1LNW A;  1IXR C;  4HQM A;  4E6K G;  5GAE J;  5L3B A;  2UWM A;  2PJR B;  3BT9 A;  1YW7 A;  2FJI 1;  2RKH A;  4UUS B;  4B8X A;  2CJJ A;  2X6X A;  4D9J A;  1WQ2 A;  1WWX A;  2HTS A;  2Y30 A;  4A0Z A;  3W6K B;  4C2T A;  3CCS I;  2R7V A;  3DXJ F;  1OCP A;  3VW2 A;  2V1X A;  3G73 A;  2J5P A;  3TW6 A;  1CQT A;  3NI7 A;  2BW3 A;  2RN7 A;  1FSH A;  2BVL A;  1MBJ A;  2STT A;  1X2N A;  4JP0 A;  2LK2 A;  3RQ4 A;  2UXO A;  4P96 A;  2HZD A;  4IRI A;  2RHA A;  5F6F A;  5HLH A;  1YS7 A;  2WAQ A;  2FOW A;  3I59 B;  3VOX A;  1MJB A;  4UB8 C;  3IRQ A;  5CW8 A;  4GRI A;  2FML A;  5BOX A;  3K4M A;  3DBR B;  4DYQ A;  1TQP A;  2A07 F;  1IO2 A;  2HR3 A;  3FM5 A;  2HYG D;  3CCL I;  2VOD A;  2W85 A;  4D7N A;  4XOR A;  2XUB A;  4B43 A;  4KIT B;  3K70 D;  1UG0 A;  2BY2 A;  4XM3 A;  5LD2 C;  2B63 J;  3QBM A;  2NVU B;  4L0Y B;  1GUU A;  2EB7 A;  2IGM A;  1ZR4 A;  3F21 A;  2YR2 A;  4UB6 C;  1IRF A;  4Q47 A;  3AFH A;  4BQN A;  3S15 J;  5E1W A;  1ZG5 A;  4DW6 A;  2CQQ A;  4LLN A;  4N0B A;  5JVG F;  4HKU A;  4IQ4 A;  4L5E A;  3KP3 A;  4CCO A;  2QM3 A;  4DIQ A;  1UI5 A;  4PJL A;  3Q0V A;  2YVH A;  1J0R A;  1GLN A;  1T0F C;  3OYE A;  4P9U A;  3FXJ A;  3BZ6 A;  1B72 B;  3PNY A;  4ZDP A;  1EJ9 A;  1HW1 A;  1HXD A;  3KZZ A;  4RGS A;  1JT6 A;  3W2W A;  3OSG A;  5FRO A;  2X6Y A;  5DEQ A;  4JX6 A;  2GZW A;  5CXG A;  4RLQ A;  4IRG A;  2IBD A;  4MNU A;  3LSM A;  3RD3 A;  1TLH B;  4G9Y A;  4KMU X;  2PQ8 A;  5GPC A;  3OY9 A;  2XHK A;  3T5X A;  2NRA C;  2COB A;  2ZO4 A;  5EZH A;  1S3J A;  3KZ9 A;  3BOQ A;  3GEU A;  1ZTR A;  2D1H A;  5FKM A;  2KIU A;  3T0Y A;  2CV2 A;  4CXF A;  4CSW A;  1P2F A;  4LG0 B;  5FLM J;  4KDP A;  4GFB A;  2DTR A;  2RNG A;  5HS7 A;  5ILV A;  2K4J A;  5F08 A;  4KT5 C;  3HPG A;  1ZRE A;  1LUJ B;  1YE9 A;  5C44 J;  1IXC A;  3BR5 A;  4CGZ A;  2XSJ C;  1X3W B;  5CYV A;  3QPS A;  2R5Y A;  3SZG A;  2GUH A;  5B1A H;  3WTW C;  2JA2 A;  3VIB A;  2VJJ A;  1E2X A;  3I4P A;  1T98 A;  3DPL C;  3PM1 A;  2VJI A;  2ZJR F;  5H2F C;  2JRT A;  2M3A A;  1IDY A;  3GFM A;  1JE8 A;  2XAJ A;  3C2H A;  1W1W E;  4XLF A;  3ZN0 A;  2A6T A;  1D8J A;  4XL9 A;  3HL2 A;  3BRO A;  2E34 A;  4ZH4 F;  3IKT A;  5EJC A;  1ITY A;  3IV5 A;  2LD5 A;  3OS1 A;  1QRY A;  4FE4 A;  3CC7 I;  2LVS A;  3S1M J;  2DFH A;  2HEO A;  1R5H A;  2XAS A;  3VW0 A;  1VTN C;  1DP3 A;  3Q9S A;  4P9F A;  1YJW I;  1H9G A;  3ONQ A;  3CC2 I;  2V6C A;  1Q1H A;  1G3Y A;  2KIQ A;  3QPT A;  4CGR A;  1J5Y A;  2HVQ A;  1JJ6 C;  3OL3 A;  3KIO A;  1UFM A;  4OMY A;  1B4A A;  2E2H J;  4DBR A;  3G7R A;  4BXF A;  1BOA A;  4NC8 A;  3DEE A;  1HW2 A;  3VFZ A;  3KFW X;  1K61 A;  4EJW A;  3GTO J;  2RRE A;  1JKR C;  4BJ6 C;  2O61 A;  4B47 A;  1JI8 A;  1Z3Y A;  1N78 A;  1Y39 A;  3FXR A;  1MMN A;  3LSK A;  4EJV A;  5K58 A;  3FIW A;  5HVQ C;  1ZG1 A;  2CUZ A;  1JUP A;  1T6S A;  1P4A A;  3FMS A;  3ROU A;  2M0M A;  3OYA A;  4A3M J;  4B4C A;  1BJZ A;  1I6H J;  4HW0 A;  1XMX A;  4UVA A;  2HWV A;  1TWC J;  1FOK A;  3Q0U A;  2VPR A;  3BR3 A;  1RUN A;  2TRT A;  3ZXS A;  1PVE A;  2XGC A;  2TCT A;  4I98 B;  2B7E A;  4NB5 A;  3K70 C;  1ETO A;  3EQL F;  4V2G A;  4BH9 A;  2H6C A;  1YTY A;  1MIJ A;  2VPL A;  1WI3 A;  3VUQ A;  5E3N A;  4Q5S F;  4L62 A;  3PO3 J;  4FIS A;  1O7F A;  2NP5 A;  4D5F A;  2P81 A;  3MKY B;  1K4T A;  2KIF A;  2KIS A;  1P7J A;  2M2E A;  3OMY A;  3WTV C;  1YQA A;  1TWA J;  2FF4 A;  1Z0X A;  3BTC A;  1U0J A;  2X1C A;  3CCM I;  2NYX A;  1FBS A;  2E1M C;  4JYK A;  5FO5 A;  5D5X B;  2P0W A;  3J80 K;  3JTH A;  2L4M A;  2V9P A;  1QZE A;  2GA2 A;  1WJE A;  1XD7 A;  2I8D A;  2LF7 A;  3ZP5 A;  3CUQ A;  3VSK A;  2EZL A;  4G6Q A;  1KU7 A;  4JOM A;  2V4J C;  2VON A;  4M9X A;  2GEN A;  1IRX A;  2Z9O A;  3CMM A;  4G12 A;  4HX4 A;  2QCO A;  5HOO A;  2FJ1 A;  1IGN A;  1V4R A;  4LK1 F;  5L3E A;  1K6O A;  3CCY A;  5HLI A;  2KZG A;  1VQN I;  5IP6 A;  5JVT A;  2QKM B;  2QQB A;  2KRC A;  2F5V A;  3VEP A;  1ZAR A;  3VWB A;  4BKX A;  3K10 A;  2ME0 A;  1LDJ A;  2VIX A;  1EH6 A;  4CCJ A;  2LLK A;  4U7B A;  2B3W A;  2F4O B;  2WAE A;  1B8I A;  1F36 A;  4P1W A;  5LGT A;  2JVG A;  3U1D A;  3V8J A;  2STW A;  1ZHF A;  3GO5 A;  4ABZ A;  1ETW A;  3J80 Z;  4J00 A;  1YJN I;  1WI9 A;  2BY3 A;  2OTJ I;  3MAJ A;  2XGX A;  3TQN A;  4XRS G;  4WIB A;  2RNJ A;  2QQA A;  3P9T A;  2HKU A;  3V7C A;  4BAC A;  1TL8 A;  1S29 A;  5HSZ A;  3A03 A;  1R00 A;  2R92 J;  1R36 A;  4I02 A;  4XR6 A;  3S32 A;  1IV6 A;  2DQR A;  3V4G A;  1VQ7 I;  2IS6 A;  3K69 A;  2X4H A;  3IHU A;  3S14 J;  5H9T A;  2M7B A;  1Z21 A;  3ECH A;  1W5S A;  3QP5 A;  4A3D J;  2GXG A;  5KK1 A;  4HRI A;  2O8K A;  2FNA A;  3L2R A;  4ENN A;  1F4K A;  1BIB A;  1JUS A;  1HSJ A;  1GVD A;  1AKH A;  3VDX A;  2ZME B;  3PIP F;  3CCJ I;  4BAY A;  3MNL A;  3BRU A;  3VVX A;  3RZO J;  4G7Z F;  2GQQ A;  4RAF A;  4L9V A;  1XSD A;  5DDG A;  3IAM 2;  1UB9 A;  4HLX A;  3AL0 B;  2JQ7 A;  3F0C A;  1XTA A;  3S3M A;  2DA2 A;  3C2G A;  4OD4 A;  2QA4 I;  3CQZ J;  2AQE A;  1U3E M;  1WKM A;  4Z6Y A;  2M9H A;  3HEF A;  1XDU A;  3TMO A;  3P9I A;  2V6E A;  3T1B A;  3DWL E;  3I55 I;  4EM2 A;  1APL C;  2Y0S N;  4S04 A;  1B9N A;  4E7K A;  3EYY A;  4B09 A;  2AS5 F;  3HRS A;  3BZK A;  2O03 A;  1NH3 A;  1BI3 A;  3CDH A;  2WAQ N;  3BG7 A;  1VND A;  1X3U A;  2DT7 B;  2F4I A;  4KN7 X;  1FJL A;  2CGP A;  1IRZ A;  5BPD A;  3PIO F;  5J4Y A;  2QQ8 A;  4GGG A;  4Y13 A;  3LA7 A;  3IWF A;  2PMZ N;  3PAS A;  4JBA A;  3KLN A;  2K3P A;  1A6Q A;  4XOP A;  3EGQ A;  1J75 A;  4GCL A;  5EGO B;  4BEH B;  4XSZ F;  1FYM A;  2PBI A;  4A3C J;  3K4N A;  4HYE A;  1O3Q A;  3ZRG A;  3J7Z I;  3F1B A;  3PSI A;  4A93 J;  2XAG A;  1IF1 A;  2BHZ A;  4UUV A;  4AVP A;  2LBF A;  3K4L A;  2DN0 A;  2KJB A;  4N9H A;  4Y4R A;  1IN4 A;  9ANT A;  3VOD A;  3H35 A;  1OYI A;  4M6Y A;  3PQK A;  2O9L A;  2QIB A;  4UUS A;  2HDD A;  5LGN A;  1XN7 A;  2DDB A;  3ZCO A;  4YEL A;  1XDS A;  1I1G A;  1VI0 A;  3AG4 H;  4FCY A;  4RGX A;  1FTZ A;  2KT0 A;  2V57 A;  4LIT A;  2RQP A;  3OYN A;  2EA2 A;  1Y0N A;  3PO2 J;  2OU2 A;  5D6F A;  4HF2 A;  1IXS B;  4MTD A;  1FX7 A;  4U9N A;  4JK1 X;  3WE2 A;  2EZH A;  4AU7 A;  3ZMD A;  1YW8 A;  3I59 A;  5M5X J;  3OYI A;  1WJD A;  2JPC A;  4BNC A;  2R7X A;  1SFU A;  1I3A A;  3KZI C;  1XSX A;  2O7T A;  3VSL A;  4I76 A;  3HIM A;  1X58 A;  2VT2 A;  2HTJ A;  1QQI A;  2BOL A;  2I5U A;  2IAI A;  2KMU A;  3HOS A;  1SFK A;  1XS9 A;  3KEO A;  1ONV A;  5JR3 A;  1T95 A;  4LIU A;  3CZ6 A;  3K0L A;  3JRG A;  5D5V B;  4WXC A;  4A3L J;  4IHS A;  3O2P E;  1I27 A;  2F48 A;  4A0Y A;  2TDX A;  3AG1 H;  1O4X A;  3CME I;  2YX7 A;  2K9M A;  3S16 J;  1WJC A;  3K2Z A;  5DV5 A;  2CO5 A;  3HPH A;  4BDY A;  2H8R A;  2VKH A;  2E1O A;  3HOU J;  2DI3 A;  3GUD A;  5E17 F;  4BY1 J; 
#chains in the Genus database with same CATH homology
 2DMP A;  1EF4 A;  1FTT A;  5D19 A;  3HOY J;  3S2H J;  4MFE A;  5CXI A;  1WCM J;  2XGD A;  1MH3 A;  5FKL A;  4Y7N J;  2ME6 A;  3E7L A;  1HF0 A;  3VPR A;  1LE8 B;  4ME9 A;  3CMY A;  2OF7 A;  2NVX J;  2H1K A;  2DA3 A;  4B3A A;  1TWH J;  2DMU A;  3JRH A;  3S17 J;  3KKD A;  1GV2 A;  1MBK A;  1AU7 A;  3QQA A;  2UXP A;  5M5Y J;  1JT0 A;  3SDG A;  2OPT A;  3G1L A;  3V6G A;  5K7Z A;  3BTL A;  2PBX A;  2VUM J;  3G1O A;  2HOA A;  3VVZ A;  2AO9 A;  5IPA A;  1JKQ C;  1HDP A;  2L7F P;  5DTD A;  5IOZ A;  4FTH A;  1VFC A;  1QPI A;  4BBS J;  3S2D J;  2XGE A;  3BR1 A;  3GTJ J;  1SGM A;  3BJB A;  4GFK A;  1MBF A;  3JRA A;  3IH2 A;  5F04 A;  3RZD J;  3BT9 A;  2UXH A;  5EDN A;  4UUS B;  2CJJ A;  5EZG A;  1MSE C;  2ZCX A;  2MSY A;  4IEJ A;  2Y30 A;  2UXI A;  3IH4 A;  2DMQ A;  2Y31 A;  3VW2 A;  1OCP A;  1JGG A;  5D18 A;  1WPK A;  2HOS A;  4BY1 J;  3TW6 A;  3JRD A;  2HQ5 A;  1CQT A;  2MW8 A;  3S1Q J;  3BCG A;  3NI7 A;  1HCR A;  1MBJ A;  2R5Z A;  1X2N A;  4JP0 A;  2DA1 A;  2LK2 A;  4C3H J;  2XB5 A;  2UXO A;  3DPJ A;  2RHA A;  4W1U A;  1WH7 A;  2XB0 X;  3L1P A;  3VOX A;  1Y1V J;  1NK3 P;  1F43 A;  5CW8 A;  4CYC A;  1IJW C;  2DTZ A;  4DYQ A;  2EBI A;  3DCF A;  4LOC A;  2L9R A;  3LSP A;  4MO7 A;  2HYT A;  1H89 C;  4AC6 A;  4D7N A;  4XRM A;  3H0G J;  1NTC A;  1JKP C;  4GFL A;  1UI6 A;  3GTM J;  5K7F A;  2X6O A;  5BNG A;  5EG0 A;  4A3B J;  2K9N A;  4DZP A;  3RKQ A;  2DA5 A;  2B63 J;  2XRL A;  3QBM A;  3BG9 A;  1GUU A;  2IEK A;  1MSF C;  1ZR4 A;  3Q0W A;  1FIP A;  1W0U A;  2XDN A;  5FKK A;  5FHP A;  4PXI A;  5EF6 A;  3FKI J;  3S15 J;  5E3O A;  3RQI A;  3FK6 A;  2Y9Z A;  2HI3 A;  2E2J J;  4DW6 A;  2CQQ A;  2E2I J;  2NS7 A;  4HKU A;  2XPW A;  4M3G A;  4XRS A;  4L5E A;  1UI5 A;  5DAJ A;  5AQC A;  3B81 A;  4EEF G;  3NPI A;  3BR0 A;  3HM5 A;  3Q0V A;  2G7G A;  2YVH A;  1JKO C;  5DS9 A;  1XG1 A;  2Y2Z A;  5IYD J;  2HXO A;  5C4Y A;  4A69 C;  1B72 B;  1U8B A;  2M0C A;  2L7Z A;  3A01 A;  1JT6 A;  3OSG A;  3M3Y J;  3LHQ A;  5D1R A;  3JRB A;  4JX6 A;  5CXG A;  3HE0 A;  1TC3 C;  2IBD A;  2ZB9 A;  1VF9 A;  4X1E A;  5HOD A;  4RBO A;  1SAN A;  3RD3 A;  2ZCM A;  1RR7 A;  2W48 A;  3LOC A;  5GPC A;  2NVY J;  4C3I J;  3HGY A;  4AC0 A;  2COB A;  4C3J J;  5J1Y A;  5F1J A;  1ZK8 A;  1FIA A;  5EZH A;  2NVQ J;  4MK6 A;  3KZ9 A;  3COL A;  2XSD C;  3GEU A;  1ZTR A;  4YZE A;  1FEX A;  5FKM A;  3HTH A;  1IG7 A;  3OOU A;  2ELK A;  4W97 A;  5FLM J;  2QOP A;  2CU7 A;  3B6A A;  1BL0 A;  4GFB A;  2R0Q C;  4UUT A;  1Z77 A;  3VP5 A;  2DA6 A;  5F08 A;  2YUS A;  1UG2 A;  2UXU A;  1I3Q J;  1B72 A;  2G3B A;  3HTA A;  1HDD C;  5C44 J;  1S7E A;  3BR5 A;  5F27 A;  5K7H A;  2R5Y A;  3QPS A;  3H3V K;  2GUH A;  4M3F A;  2R7Z J;  2NVT J;  2MG4 A;  3VIB A;  2R93 J;  2VKE A;  3PM1 A;  2R5Z B;  3LSJ A;  5F0C A;  4IHV A;  1IDY A;  4BY7 J;  1JJ8 C;  1SFO J;  4GCK A;  5C4J J;  4CYC B;  2HYJ A;  5M3F J;  2LP0 A;  1H88 C;  3VOK A;  3HGG A;  3G56 A;  1ETQ A;  2WV1 A;  3NAR A;  3BTJ A;  1ITY A;  3IV5 A;  2LD5 A;  1QRY A;  3C07 A;  4FE4 A;  2LVS A;  3S1M J;  1YRN A;  2DJN A;  4FE7 A;  3RH2 A;  3VW0 A;  3HOV J;  4AYB N;  5EG0 B;  2OER A;  1IC8 A;  3E7Q A;  2GM4 A;  1T33 A;  4KWA A;  4CGR A;  1JTX A;  4D5C A;  1JJ6 C;  3M4O J;  2JA7 J;  2E2H J;  4MFD A;  3CDL A;  3HOZ J;  3G7R A;  5J3L A;  1BW6 A;  1W0T A;  2LY9 A;  1K61 A;  4DZJ A;  3GTO J;  5IYB J;  3AQS A;  1WGX A;  1JKR C;  5K58 A;  3LWJ A;  5JLW A;  4RDU A;  3FIW A;  1ENH A;  1JUP A;  4A3M J;  2CUF A;  3ON2 A;  4NN1 A;  4B4C A;  1ETX A;  1BJZ A;  1I6H J;  1T56 A;  5IOY A;  2M34 A;  2ZOY A;  3SJM A;  1TWC J;  3LJL A;  2ZOZ A;  2GLO A;  3Q0U A;  2VPR A;  1UMQ A;  3BTI A;  3BR3 A;  2Q24 A;  2ZCN A;  1RKT A;  1MBG A;  2TRT A;  1A5J A;  2LFB A;  2XGC A;  5EFY A;  4ICH A;  2TCT A;  1RES A;  2L0K A;  1GT0 C;  1U9O A;  3SFI A;  3A01 B;  1ETO A;  1HOM A;  1NK2 P;  5HBU A;  4V2G A;  5C3E J;  2DA7 A;  3ZQH A;  2FD5 A;  3VVY A;  2IU5 A;  1WI3 A;  3K7A J;  2WGB A;  3C2B A;  3VUQ A;  5E3N A;  4L62 A;  3PO3 J;  4FIS A;  5F0H A;  4A3G J;  2NP5 A;  4D5F A;  3ZQG A;  2P81 A;  3HB9 A;  4A3E J;  1P7J A;  2M2E A;  3MKL A;  1XC5 A;  1TWA J;  5E3L A;  1Z0X A;  3BTC A;  1ORK A;  5EYR A;  2I10 A;  1I50 J;  3IH3 A;  4JYK A;  3JRE A;  4C2M J;  3HTJ A;  2LTP A;  2VI6 A;  3JRI A;  1BW5 A;  3LSG A;  4M3D A;  3NAU A;  3ZQI A;  1R9T J;  5J1U A;  2EZL A;  2DA4 A;  3S1R J;  3JR9 A;  1TWG J;  4M3B A;  2GEN A;  1MBE A;  4MIM A;  2R5Y B;  1BA5 A;  1E3O C;  4G12 A;  2QCO A;  2Y9Y A;  3G1M A;  2FJ1 A;  1JUM A;  2HOT A;  1IGN A;  1POG A;  5HAW A;  5C4X J;  4Y52 J;  3CCY A;  3BG5 A;  3BHQ A;  3HDD A;  1UHS A;  5IP6 A;  4JKZ A;  3MN2 A;  4XID A;  1X2M A;  2EQR A;  4AUX A;  1HLV A;  4NEL A;  4XIC A;  3I4N J;  1GDT A;  4IHX A;  3PPB A;  1OFC X;  1ZKG A;  4BKX A;  1IUF A;  2DMT A;  2ME0 A;  3FRQ A;  2XPV A;  1PUF B;  3TW7 A;  2X48 A;  2HXI A;  1YRN B;  3GTG J;  2LLK A;  2FBQ A;  2CRG A;  2O7O A;  1ETK A;  2EH3 A;  3KKC A;  3NRG A;  4JX4 A;  1B8I A;  3GTK J;  1TWF J;  1F36 A;  2GFN A;  1P7I A;  4GCT A;  4ABZ A;  1ETW A;  1H8A C;  2EZK A;  3TP3 A;  3GTQ J;  3ANP A;  1MBH A;  4XRS G;  4QTR A;  1ETY A;  2L7M P;  4BBR J;  3EUP A;  3OSF A;  3P9T A;  2HKU A;  4I6Z A;  1G2H A;  1LFU P;  4IHY A;  5F0F A;  5HSZ A;  3CWR A;  3A03 A;  3HOW J;  2R92 J;  2YS9 A;  2RAS A;  3GZI A;  1IV6 A;  2LR8 A;  2DG7 A;  3AQT A;  4A3F J;  2FQ4 A;  2JMW A;  3S14 J;  3VW1 A;  5H9T A;  3K2A A;  3O8H A;  3LNQ A;  3JRC A;  5EEA A;  4A3D J;  1PUF A;  4D7M A;  2NS8 A;  3UKG A;  2O8K A;  4UDS A;  1JTY A;  3HTI A;  5FLV A;  4MLO A;  3ZQF A;  1JUS A;  5J1R A;  1GVD A;  3TP0 A;  1AKH A;  1U78 A;  3BQY A;  5GPA A;  4A3I J;  3JRF A;  3CJD A;  5IYC J;  3MNL A;  1ZGW A;  2WB1 N;  4DYR A;  3BRU A;  3VVX A;  4IHW A;  3RZO J;  1DU6 A;  2JA5 J;  2XPU A;  1LFB A;  3HKZ N;  2FX0 A;  3F0C A;  2NP3 A;  4MXM A;  2DA2 A;  2JJ7 A;  4ACI A;  3CQZ J;  2RAE A;  1MH4 A;  2W53 A;  2NX4 A;  3QPL A;  5IP9 J;  2M9H A;  1ETV A;  3HEF A;  3HBL A;  2M8G X;  3W6V A;  4XK4 A;  2ID3 A;  4S0H B;  5FKO A;  1GV5 A;  3T6N A;  1LE8 A;  1APL C;  2Y0S N;  4JX5 A;  2QKO A;  1OJL A;  2WAQ N;  1VND A;  1FJL A;  1IRZ A;  3ZOB A;  1RKW A;  5IP7 J;  2PMZ N;  1ZR2 A;  3KNW A;  3PAS A;  4X6A J;  3EGQ A;  3QKX A;  2OI8 A;  4GCL A;  5EGO B;  1AHD P;  4A3C J;  3Q3S A;  3O8G A;  1QVT A;  3F1B A;  3BNI A;  3S1N J;  4BXX J;  4A93 J;  2D6Y A;  1DU0 A;  2DN0 A;  1K83 J;  2VKV A;  2YVE A;  9ANT A;  4HNV A;  5FGL A;  2JK3 A;  5E3M A;  2WUI A;  3I4M J;  2O9L A;  2QIB A;  4UUS A;  1Y1W J;  2HDD A;  2NOG A;  4J19 A;  3ZQL A;  1WH5 A;  3GTP J;  1RET A;  5M5W J;  5M3M J;  2YU9 J;  3NXC A;  2G0E A;  2MGQ A;  4JL3 A;  1VI0 A;  5JLX A;  2KDZ A;  2DG8 A;  1A6I A;  3ON4 A;  3FIS A;  3JSJ A;  2JA8 J;  4FCY A;  2PZ9 A;  2GBY A;  1FTZ A;  2KT0 A;  3B6C A;  1B8I B;  2V57 A;  1QVU A;  4V2F A;  2LKX A;  3OIO A;  4AF5 A;  1Q1V A;  5EGO A;  3PO2 J;  2CUE A;  3HOX J;  1IDZ A;  2G7L A;  2EZH A;  3BR6 A;  3GTL J;  5M5X J;  1OCT C;  2E19 A;  1RPW A;  3S5R A;  2REK A;  3FK7 A;  3ZQC A;  2ECB A;  2QF7 A;  3WHC A;  1D5Y A;  2O7T A;  3NNR A;  4I76 A;  3HIM A;  1X58 A;  2DMN A;  4M3E A;  4NDL A;  2IAI A;  3LSR A;  1XS9 A;  1MNM C;  2G7S A;  3D1N I;  3CRJ A;  3BQZ A;  4B1R A;  3V78 A;  5FMP A;  2CQX A;  2QWT A;  4A3J J;  4M6V A;  5GP9 A;  3JRG A;  2ECC A;  2D5V A;  2K9Q A;  4A3L J;  4QSH A;  3DEW A;  3ANG A;  2N8G A;  3IUV A;  1O4X A;  3BG3 A;  2QTQ A;  1AKH B;  4DYC A;  3TED A;  2JA6 J;  2K40 A;  3WHB A;  3O60 A;  3S16 J;  2JWT A;  3GBG A;  3BR2 A;  2ID6 A;  2EZI A;  2X9D A;  1ZQ3 P;  4JNN A;  4QIW N;  2F07 A;  2JN6 A;  1U9N A;  3MVP A;  2H8R A;  4A3K J;  2E1O A;  2K9S A;  3HOU J;  5FKN A;  5FJ8 J;  3A02 A;  2AHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...