4MO7A

Crystal structure of superantigen pfit
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
188
structure length
187
Chain Sequence
TDPESARGKLLQTAAHLFRNKGFERTTVRDLASAVGIQSGSIFHHFKSKDEILRAVMEETIHYNTAMMRASLEEASTVRERVLALIRELQSIMGGSGEAMAVLVYEWRSLSAEGQAHVLALRDVYEQIWLQVLGEAKAAGYIRGDVFITRRFLTGALSWTTTWFRAQGSLTLEELAEEALLMVLKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pfit is a structurally novel Crohn's disease-associated superantigen.
pubmed doi rcsb
source organism Pseudomonas fluorescens a506
molecule tags Transcription
molecule keywords Transcriptional regulator I2
total genus 74
structure length 187
sequence length 188
ec nomenclature
pdb deposition date 2013-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4mo7A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mo7A02
3RD3A 2YVHA 2M2EA 3HOVJ 5E3OA 5D19A 1POGA 2CQXA 3JREA 2G7SA 3OIOA 2R5ZB 3BTCA 1I50J 2VKVA 3HOXJ 5IYDJ 2O7TA 1B72A 2R0QC 2EQRA 4X6AJ 3VVYA 5DTDA 5E3NA 2LY9A 2PZ9A 2ZB9A 2DJNA 1U9OA 2JA6J 5GP9A 2HOSA 1RETA 2P81A 3JRAA 1Z0XA 3RQIA 2XSDC 1ZR2A 2JA5J 3M4OJ 1I3QJ 2NVXJ 4HKUA 1UG2A 1ETXA 3F1BA 5F0CA 1TC3C 3QQAA 2EH3A 3BHQA 1GVDA 3RZDJ 2E2JJ 1UHSA 4C3HJ 2MGQA 5HSZA 2HYTA 3GTQJ 2TRTA 3B6CA 1VI0A 1MNMC 2ZCNA 2N8GA 4GCLA 2DA2A 4MFDA 2LP0A 3VP5A 3TP0A 1CQTA 1MBFA 3PPBA 1NK3P 4AYBN 1F36A 3L1PA 5M3FJ 2NP3A 1B8IB 5C44J 1IGNA 5HBUA 3VW0A 3ZQFA 3JRFA 2ZOZA 3C07A 3GTMJ 4I6ZA 3WHCA 1HOMA 3KNWA 1PUFA 1DU6A 4MFEA 4AC0A 3O8GA 3LWJA 2G7GA 2X48A 1TWCJ 3BTIA 5C3EJ 1TWFJ 4QIWN 3BR1A 1G2HA 3PO3J 3GTKJ 5K7FA 5IOZA 2I10A 5F1JA 2CUFA 4W1UA 2W48A 3NNRA 2XPVA 3JSJA 2KDZA 1OCTC 3VPRA 2E2IJ 4A3MJ 2O7OA 2F07A 3PM1A 5DS9A 3K7AJ 3TEDA 5F04A 4J19A 3H3VK 5IPAA 1Y1WJ 1GT0C 4ME9A 2GENA 2UXOA 3JRDA 3BJBA 2LR8A 4NDLA 5JLWA 3ANPA 1FTZA 1WGXA 5EZGA 5M5YJ 1TWGJ 4BXXJ 2VI6A 2Q24A 3VOXA 4A3CJ 2CJJA 2GFNA 5EG0A 3AQSA 3O60A 2Y30A 3HTIA 2Y31A 1JKQC 1H88C 4GCTA 2E19A 2WUIA 4A3LJ 2R5YA 1JKPC 3HGGA 1X58A 2K40A 3ZQIA 3JRBA 3S5RA 1JJ6C 4Y52J 2V57A 2COBA 4RBOA 3BR0A 2R7ZJ 1P7JA 2HI3A 2HOTA 3JRGA 1D5YA 2DTZA 1RPWA 2D5VA 1JTXA 3VUQA 4Y7NJ 2LD5A 1B72B 2RASA 1YRNB 1UMQA 3S1QJ 3NXCA 1T56A 1AU7A 4JNNA 2LTPA 4V2FA 2QF7A 3LSGA 1AKHA 3SDGA 3MN2A 1HDDC 1APLC 4C3JJ 2NVYJ 3KKCA 1A5JA 3I4MJ 2DA5A 2R5YB 3GTOJ 4M3BA 2VPRA 5J1YA 2D6YA 2NS8A 2OF7A 3QKXA 4NN1A 2HOAA 1LFBA 4YZEA 1FJLA 3LOCA 4A3DJ 3IH3A 3HBLA 2RAEA 2E2HJ 3BG3A 2E1OA 1PUFB 2MW8A 3JRHA 4HNVA 4UUSB 4JX4A 3A01A 4A3JJ 4M3FA 4D5CA 1R9TJ 2AHQA 3KKDA 4IEJA 9ANTA 2LVSA 3LNQA 1FEXA 4JX5A 5JLXA 4A3FJ 1MBHA 4JL3A 2CU7A 3NPIA 3VVZA 2XGDA 3BR6A 3HOWJ 2ZOYA 3GTJJ 2M34A 4A3KJ 4IHYA 3RZOJ 2JJ7A 1OCPA 2TCTA 4XRSA 3T6NA 3GTLJ 5FHPA 2JMWA 5EZHA 2DA3A 5IOYA 1JKOC 1GV2A 2LLKA 1QRYA 3GTPJ 2HYJA 4DW6A 4G12A 1RESA 3F0CA 4L5EA 2Y9ZA 4D5FA 4BY1J 2QTQA 2UXHA 5FJ8J 2K9SA 5IP9J 3S1MJ 1HDPA 4A3BJ 1H89C 1JT0A 3P9TA 3CDLA 2QOPA 1U78A 5EG0B 4UUTA 3ZQGA 1ZGWA 2X9DA 3NARA 1HF0A 4DYQA 2DG7A 3VW2A 3BG9A 2KT0A 1IDYA 2HKUA 3V78A 2WV1A 3A03A 3I4NJ 3PO2J 4MO7A 2LK2A 1O4XA 2DMUA 2K9QA 3LSPA 3ON2A 5FKOA 1JKRC 3G1LA 2L0KA 4MXMA 2WGBA 3TP3A 1X2NA 4V2GA 2VKEA 2YU9J 5J1RA 2WAQN 5FKKA 3FKIJ 3HOYJ 4A3EJ 2NP5A 1ENHA 2PMZN 4XRMA 5EDNA 2NOGA 2HXIA 5E3LA 5EGOA 3MVPA 4GFKA 2FBQA 3BR5A 3DCFA 1WH5A 2MG4A 2Y9YA 4M3GA 3AQTA 1U8BA 4EEFG 5DAJA 4IHWA 5F0HA 4XICA 2XB5A 1TWHJ 1BW6A 1BL0A 3WHBA 3COLA 4AUXA 2NS7A 2DMPA 2XPUA 5FGLA 3Q0VA 2H8RA 2REKA 1FIPA 1SFOJ 2ZCMA 3BR3A 3JRCA 4LOCA 2ZCXA 4IHVA 4MLOA 1ITYA 1FIAA 5BNGA 4D7MA 2DA1A 1I6HJ 4JKZA 2W53A 5EGOB 3RH2A 2R5ZA 1JUPA 1IC8A 2GM4A 2EZKA 3BRUA 1ZK8A 2GUHA 2Y2ZA 4B4CA 3BR2A 2FD5A 2DMNA 5J1UA 3QPLA 2ME6A 2WB1N 3IH2A 1Q1VA 4XRSG 5CXIA 1MSFC 2GBYA 1X2MA 5FLVA 1ETQA 2DMQA 5F08A 2EZHA 2R92J 1JGGA 4GCKA 1VNDA 3FRQA 3TW6A 3BCGA 4DZPA 4A69C 4BKXA 1K61A 4UUSA 2RHAA 3A01B 3S15J 2FQ4A 3FISA 3RKQA 3E7QA 3DPJA 5EF6A 4DZJA 3S17J 3G1OA 1T33A 1MSEC 4AC6A 5J3LA 1VF9A 3ZQHA 2JN6A 3SFIA 3LSJA 2GLOA 1MBGA 2VUMJ 4MK6A 5HAWA 2AO9A 3H0GJ 3HM5A 2JK3A 4FCYA 3G56A 1WPKA 1QVUA 3KZ9A 2G0EA 5F0FA 2EZLA 1VFCA 1QPIA 4B3AA 5IP6A 2B63J 5FLMJ 2UXIA 4A3IJ 2L7MP 2NVTJ 4KWAA 2O9LA 4UDSA 3HDDA 3EGQA 1ETKA 3LHQA 4GFBA 4FE4A 2OI8A 2NVQJ 3K2AA 5CXGA 2HXOA 3JR9A 3OSGA 5C4JJ 1S7EA 5HODA 4C2MJ 2L9RA 4QSHA 3S2HJ 1ZTRA 1ETWA 3LSRA 3HTAA 1P7IA 1RKWA 2CRGA 4D7NA 5H9TA 4JX6A 5K7ZA 4DYRA 3S16J 5FMPA 2QKOA 1UI6A 4JYKA 2XGEA 2DG8A 2M0CA 2UXUA 2DA7A 4FTHA 1ZQ3P 2HQ5A 2ECBA 3Q3SA 1AHDP 1H8AC 1JJ8C 4L62A 3OOUA 1XS9A 3FIWA 2YS9A 5EEAA 4CYCB 1F43A 1YRNA 3VW1A 5AQCA 3VIBA 3FK6A 2ME0A 5FKMA 3B6AA 2PBXA 2G3BA 1AKHB 2XPWA 3G1MA 4B1RA 3CCYA 4M3DA 3BNIA 3GZIA 3HTJA 3BQYA 5E3MA 4A3GJ 1XC5A 3PASA 1RR7A 1E3OC 1RKTA 3VVXA 5M5XJ 4MIMA 1IRZA 4XIDA 4IHXA 1IDZA 5CW8A 2K9NA 2DMTA 1A6IA 3HOZJ 5F27A 3E7LA 1ORKA 1Z77A 5FKLA 2O8KA 3QBMA 4GFLA 2LKXA 3HEFA 5GPAA 3CWRA 1OJLA 2XGCA 2HDDA 1HCRA 1MH4A 3BQZA 4DYCA 1NK2P 3S1NJ 2QCOA 2IEKA 4RDUA 1BA5A 3ZQCA 1WH7A 3O8HA 3Q0UA 2LFBA 3S2DJ 4FISA 3NI7A 2IBDA 1TWAJ 2G7LA 3CJDA 3BT9A 1GUUA 3S1RJ 4NELA 3ANGA 1K83J 3HE0A 5IYBJ 1MBEA 4M3EA 2YUSA 1WCMJ 3HB9A 1Y1VJ 2DA6A 1WI3A 3A02A 1ZKGA 1BJZA 4I76A 3GEUA 1FTTA 5IYCJ 2QWTA 3CMYA 4CGRA 3BTJA 3HTHA 1GDTA 1W0TA 5D1RA 4ABZA 1MBJA 1JTYA 3NRGA 5EYRA 1W0UA 2ID6A 2DA4A 3C2BA 5FKNA 3HOUJ 3LJLA 3Q0WA 3MNLA 1IG7A 1ETOA 1DU0A 2IU5A 3GTGJ 3G7RA 1IJWC 3V6GA 2YVEA 5M5WJ 2NX4A 2UXPA 4W97A 3HIMA 4BY7J 3M3YJ 5C4YA 5K58A 2FX0A 3TW7A 1B8IA 3IH4A 1ETYA 5EFYA 2EBIA 2XDNA 1ETVA 3QPSA 2H1KA 5D18A 2JA7J 5C4XJ 1JUMA 5M3MJ 1EF4A 3ON4A 4M6VA 4XK4A 3OSFA 3W6VA 1BW5A 4JP0A 2M8GX 2M9HA 2L7ZA 3NAUA 2L7FP 3MKLA 2X6OA 4BBRJ 1U9NA 1OFCX 1XG1A 3BTLA 4BBSJ 1UI5A 2OERA 1QVTA 1MBKA 3CQZJ 3B81A 2QIBA 3SJMA 3VOKA 2IAIA 1JT6A 1HLVA 1LE8A 3CRJA 2R93J 2ID3A 1ZR4A 3BG5A 4PXIA 1NTCA 2XRLA 1IV6A 3EUPA 3ZQLA 2Y0SN 2CUEA 3DEWA 4A93J 3UKGA 3ZOBA 5IP7J 5K7HA 3IUVA 2XB0X 2JWTA 1MH3A 4ACIA 4X1EA 3HGYA 4CYCA 2DN0A 3S14J 1SGMA 5GPCA 2FJ1A 4ICHA 2CQQA 4S0HB 4QTRA 4FE7A 2ECCA 4AF5A 2OPTA 3JRIA 4C3IJ 3HKZN 3D1NI 1SANA 3FK7A 1GV5A 2ELKA 3IV5A 3GBGA 1LE8B 2EZIA 1LFUP 1IUFA 1JUSA 2MSYA 2JA8J
chains in the Genus database with same CATH superfamily
3L7WA 5L3CA 2M2EA 3HOVJ 2O0YA 5E3OA 1EV7A 2K3FA 4E7KA 3OIOA 3WU1B 1RNLA 3BTCA 3WE2A 4KISA 2LY1A 1X3ZB 3HOXJ 2AQFA 2BOLA 3I59A 3ZGKA 1XDSA 2K02A 3PFIA 1MKMA 3WGHA 2L4AA 5DTDA 1R71A 2A61A 2CGPA 1G3YA 2HGCA 1U9OA 1TQIA 2HOSA 1RETA 2P81A 1QHGA 4HX7A 3U1KA 1Q1HA 3GCMA 3V7RA 1UG2A 3F1BA 3HSEA 4Z6YA 1D8JA 1XSXA 2FRHA 4AIHA 5ICGA 4NQWA 1XMAA 3BHQA 4C3HJ 5FD5A 4XORA 4YIIA 1VQ8I 2QSHX 1I39A 2I8DA 2JUGA 3B6CA 1VI0A 4BYYA 2FMLA 3SZGA 4Y15A 4FHTA 2M3AA 3W2VA 2O8XA 4UNOA 1T39A 3VP5A 3CO6C 4GXOA 1MBFA 1ZREA 2FBIA 4CGZA 1LUJB 4AYBN 2F5EA 4Z2YA 1ZYRF 4EM0B 3OMYA 4N9IA 3J81K 5M3FJ 1IGNA 3PNYA 5IY5H 3OYDA 4DQ2A 3C07A 5HDNA 3KNWA 5ICEA 1PUFA 1DU6A 4HEA2 5FLXZ 3HTSB 2DLLA 3MKYB 3K4LA 5HNFA 5CVJA 3J7ZI 3BR1A 3FWEA 3K1PA 3ZCOA 1ZARA 2OTLI 3GTKJ 3PO3J 5K7FA 4WXHA 4RS8A 1LDKB 4HQMA 4IXAA 2GZWA 2R7QA 1V3FA 2KDZA 4I0BA 3C2HA 1TP4A 3VPRA 4A3MJ 2O7OA 4FX4A 1E2XA 1B9MA 3TEDA 3H3VK 2XV4S 5IPAA 5K5RA 3LMMA 1Y1WJ 2EJRA 2L54A 4ME9A 4IRVA 1R1VA 5HOOA 2V1NA 2RN7A 2LR8A 4NDLA 3ANPA 1FTZA 1Y56A 1WGXA 2KQRA 2Y69H 3RKWA 5M5YJ 1KQ8A 2ZY9A 2IP2A 5H6QA 2PFBA 2MLKA 3ZQQA 2IS2A 2CQ7A 2HR3A 3TO9A 1MMGA 2Y30A 1SC7A 3O60A 5FGMA 1B59A 4CO8A 1JKQC 1FBQA 2OBPA 3GF2A 2E19A 2GXGA 3BCAA 4OU0A 1USSA 1U6GA 3DBRB 3EUAA 3T5XA 3S3NA 1YJNI 2VC0A 5D5VB 2QQBA 3I58A 3IKVA 4KIBA 1IN8A 1X58A 4M71A 3ZQIA 1IO2A 3JRBA 1GXQA 1UJ8A 3RSNA 2V57A 2KIMA 4WK8F 4RBOA 1SFUA 2HDCA 4XSXF 2O3FA 2R7ZJ 1X4OA 4ZC3A 4PUSA 2PBIA 1D5YA 2DTZA 2RDPA 1FSHA 4IPAA 1JTXA 1T0FA 4BNCA 2LD5A 3VUQA 4I98B 1T56A 3DTKA 5IT3A 1BI3A 2I5UA 5JI6A 3HUGB 1KU2A 4IQ4A 1OISA 1IN7A 3SDGA 3U1DA 1N78A 5DCMA 4GDFA 1A5JA 2R5YB 2QVOA 3IRQA 1T6SA 5J1YA 3CCMI 1X1CA 2D6YA 2K4JA 2AXLA 2HOAA 3MMYB 1LFBA 3Q5FA 1S9HA 2XF7A 4JOMA 3E5QA 1M1EB 1SVOA 4WXDA 4MTDA 3QODA 2MD0A 5HNHA 1XB4A 2DODA 2E1OA 2ZO4A 1PUFB 2IRFG 2CWEA 3LA2A 3K0LA 4A3JJ 4JX4A 3RKXA 1QO0D 3KKDA 2XAFA 3LNQA 4C9YA 4LLLA 2KPMA 2IA1A 3VB2A 3VVZA 1BJAA 2K85A 3QWLA 1W5SA 2JUCA 2AS5F 4BUPA 2TCTA 4XRSA 1W36D 2L4MA 3GTLJ 5EZHA 2VKDA 1JKOC 1GV2A 1LDJA 5CVUA 1WJBA 4P55A 3HRTA 4QPOA 1WJFA 4G12A 3LFKA 4BY1J 1WKMA 1XX5A 2WBMA 3AG2H 2QBYB 3DLAA 2FE3A 3DQVC 2FU4A 1O7LA 2EV5A 3PNTA 3QYBA 4HQEA 2BV6A 3HOSA 1JT0A 2VASA 3CDLA 2QOPA 3ERMA 2FA5A 3GFJA 3REOA 5BPDA 2HNHA 2DBBA 2X9DA 2J5PA 2IVMA 3QPTA 5KVRA 5HLHA 3J80Z 3CCEI 3VW2A 4YG2F 3WTWC 1BOAA 3I9V2 1FWZA 3A03A 3L2CA 3PO2J 2DCEA 2MBFA 3TQNA 4MO7A 3V4GA 2LK2A 3A2KA 4JQFA 4BHPA 5FKOA 3G1LA 4ZYAA 2VXZA 4KMUX 4MXMA 3FM5A 1X2NA 3IAM2 3M8JA 4V2GA 2AQEA 2WAQN 1U0JA 1K6OA 5D4RA 3LSTA 2NP5A 4XRMA 2PMZN 1J2XA 2NOGA 1R00A 3PSIA 2YX4A 2FBQA 2HKOA 2L01A 4FETA 1ON2A 4EEFG 3OYEA 4HOBA 4IHWA 3OYCA 1BW6A 3WHBA 3MZ8A 2DI3A 1FIPA 4YFNF 3COAC 2HTSA 3GLXA 4ON0A 3MD2A 3KEYA 2X51A 2HWVA 3CUQB 1ITYA 1YG2A 2OD5A 4D7MA 3K9TA 2F5FA 1H0MA 2FBKA 2MC4A 3VSKA 2LF8A 2M45A 3EUHC 2OV7A 3ESWB 3UR3C 3BZKA 1BN5A 2IGOA 3W2AA 2VIXA 5J1UA 4BJ5C 4O6JA 5CPRB 2WB1N 3IH2A 1AWCA 1C0WA 3JW4A 5FRNA 5HS8A 5CXIA 2XGXA 2LBFB 2Y75A 4MEXF 5F08A 3VODA 1WWXA 3A0BC 3L09A 4RB2C 3ECOA 3FRQA 2NNYA 2R3SA 1BR4A 4OIRF 1KQ0A 1S3JA 3F6VA 1K61A 3ZN0A 4KNYA 4YIFA 4BDZA 1YHQI 4DZJA 2H6BA 4F52A 4AC6A 4XLNF 1K78A 2VOPA 2LH9A 3B02A 3K6GA 1X1BA 2JN6A 3H35A 2VUMJ 2LBFA 5HAWA 2LKSA 2AO9A 1UB9A 3H0GJ 3ABUA 3GEZA 4OIPF 4FCYA 3F72A 1YO5C 3OYHA 4EGZA 2WADA 1W7PD 3QAHA 2G0EA 3I71A 3FMQA 3J7AY 2EZLA 1QPIA 4K2EA 2K5CA 5IP6A 2B63J 4CCLA 3BJOA 4LITA 4IO9F 4ESJA 2CV0A 5FRMA 4ZJZA 1NHAA 3NRVA 2DFIA 1PUEE 1ULYA 3CLQA 2NVQJ 1YJWI 1IUYA 3ZPLA 1SVLA 2NXNB 1S7EA 5HODA 1XGNA 5CLSA 3BPXA 4C2MJ 2E1MC 3IP4B 2DFFA 1YFHA 1OCRH 4DOZA 4R1HA 3HTAA 4DYRA 1MJ9A 1VQKI 4JYKA 2XGEA 1IV8A 1YITI 2DA7A 2ECBA 2KKOA 4EJTA 1AHDP 5BQTA 2UV1A 3HSRA 1T2KA 1JJ8C 1EH7A 2JZYA 1XS9A 4CYCB 2QQAA 4XQFA 3VW1A 2B0LA 1B6AA 1XGOA 2QUFA 3B6AA 3I59B 1UAAA 1H9TA 1DQUA 3G1MA 1O3TA 3CCYA 1PJRA 2ZMEC 3BNIA 3F8BA 1YW9A 3HTJA 3A1YA 3VVXA 1RR7A 4NUBA 4LG0B 2LNBA 5DEQA 3PUFA 4GFLA 3KP2A 3W2WA 1ON1A 3A4CA 3HTUA 4RDUA 4XOTA 1Y0UA 3ZQCA 4CCKA 2BW3B 2VLAA 5LRRA 2UZKA 1CF7B 3SEQA 1QZYA 4HNUA 1GUUA 2ZJQF 4NELA 3HE0A 1K83J 5IYBJ 5HS7A 3VYRB 4BH9A 1WCMJ 1OQYA 1Y1VJ 3E1SA 4UVBA 3JTGA 1ZKGA 2ICWG 4XKWA 4HSTA 1FTTA 5ERIA 2CUZA 3T8TA 5IYCJ 2RNGA 3U21A 1G6NA 3OL4A 4HW0A 3BTJA 3HTHA 1GDTA 5LEKA 2E7XA 4XLEA 1J5YA 4OD5A 4ABZA 4AYBA 3CCSI 4KMFA 4LLGF 1WQ2A 2EWNA 1UFMA 2FOKA 3H5AA 2TDXA 1W0UA 3MZHA 4MHGA 3HOUJ 4AIDA 3RQ4A 5LBQA 2R7UA 1ETOA 4AVZA 1P2FA 1DPRA 2IU5A 4CYDA 3G7RA 2FJI1 2P5VA 2YVEA 2UXPA 4W97A 3HIMA 1RIOH 2K9LA 3HOTA 1B8IA 3IH4A 1RUOA 5EFYA 3BJ6A 2EBIA 3H1CA 1LEBA 3RYRA 4HNTA 3FHZA 4IX7A 5CKTA 4LB6B 4M6VA 2W57A 5ICCA 2B7EA 3CZ6A 3CCJI 4G6DA 3KYLA 2CG4A 2M9HA 3NAUA 5TGTA 5E8GA 2L7FP 1OCOH 3KEOA 1XG1A 3BTLA 1Y39A 2WA0A 1IF1A 2PJRB 1XSVA 4G94A 3BC8A 2OERA 3IC7A 2PJRA 1MBKA 5FB2A 3E6CC 2IAIA 2LOOA 1FOXA 3P9KA 2ID3A 2K27A 3ZMDA 5E1XA 3BG5A 1X1AA 1IV6A 2FBHA 2H1LA 3TL4X 2CUEA 2OUMA 4UV8A 4A93J 2HQNA 2YSRA 4PJLA 1BI1A 2XB0X 4X1EA 3N97A 3DU6A 3L2WA 1QZZA 3S14J 1K7AA 4N4NB 3ECHA 1MJBA 2W7NA 3PFYA 2M0MA 4AF5A 4Y33A 3HL2A 2L3DA 3EYYA 4X0GA 3OYAA 4XN0A 1Z9CA 1GV5A 2ELKA 3IV5A 1LE8B 4XN3A 3WTXC 1BBYA 3FM3A 3QP5A 1IUFA 1WHUA 2DOFA 1R5HA 1P9QC 1JUSA 3JAMK 2YVHA 2LYCA 3E5UA 5D19A 1T08B 2DK5A 4JBAA 4F55A 1MNDA 3LSIA 2PG4A 1I50J 3CMMA 4P96A 2CQNA 3H5RA 3CP8A 5FD6A 1HKQA 2R0QC 2DO7A 4X6AJ 3VVYA 2DW4A 2K3PA 1PVEA 2PZ9A 4Y17A 2F6CA 4XSZF 2DJNA 3JRAA 5L3GA 1Z0XA 1WRJA 3RQIA 3WTYC 3SZTA 1UHWA 4FT8A 1TC3C 1Z3YA 4L9VA 5HS9A 1MGTA 3QQAA 1KZHA 2IS1A 2EH3A 2YX7A 1W7PA 2IGNA 2IS4A 3KZIC 2HEOA 1RC9A 5FROA 1SEUA 2MGQA 3GTQJ 3D0SA 1MNMC 3LSKA 4Y13A 3KZZA 2L7KA 4M9ZA 2LP0A 4MFDA 2STTA 1FBUA 2PX9A 2VJ5A 3PPBA 1LNWA 1NK3P 1F36A 2XRNA 1H9GA 2HU9A 5C44J 1FYLA 1VQ9I 1ZRFA 3KPHA 3JRFA 3CCRI 4GCVA 4EMSA 1IRGA 3FDYA 3GTMJ 3QYFA 2RKHA 3WHCA 1V5EA 5GAHJ 1LQ1A 3F8FA 4RAFA 2NOJB 2R7SA 2HTJA 1TNSA 2G7GA 2X48A 3LWJA 4UXNA 1SFKA 2BVLA 4XOPA 1TWFJ 2ZCWA 3WG9A 1G2HA 3H9QA 4ZYGA 5IOZA 2CUFA 2YU3A 1W1WE 2A68F 3KP4A 2W48A 4W1UA 2G7UA 2CV1A 1ACIA 2BHYA 2EA4A 1Y6IA 2E2IJ 2CW8A 5DS9A 2LSOA 3DP7A 2WY7Q 5F04A 2HPIA 3K4CA 2UXOA 3FXMA 4OAZA 4XONA 4FX0A 2BY0A 2Q24A 3VOXA 3VFZA 3TBIA 2CJJA 1D8KA 4P5OA 1G3WA 3H0DA 5D5XB 1WJDA 3I55I 5IT9Z 1H88C 2NS0A 4EJOA 1YW7A 1WJCA 3OYIA 5BOXA 1ZG1A 4BE1A 3ZRGA 1X3WB 2HQAA 2WAQA 3S3OA 2WUIA 2R5YA 3ELKA 5J40A 3LSHA 3GO5A 1XD7A 3S5RA 1JJ6C 1S7OA 2STWA 4C2TA 1QNTA 1P7JA 4XKBA 3BP8A 1DDNA 3JRGA 4WIBA 2DQRA 2M87A 3FX3A 4IRIA 1B72B 1SAXA 3S1QJ 3JCUC 1AU7A 3MEXA 1KYZA 2X1EA 1AKHA 2KIUA 3SQNA 1HCRA 5CJ9A 2PMZA 4OD4A 1WI9A 1HDDC 1APLC 3IWFA 4C3JJ 2R7WA 4KA4A 3SXYA 2R7OA 4CH7A 3DKWA 2V9KA 5HVQC 2RVCA 3WGIA 3W6JB 4GRIA 4NN1A 2E5ZA 1FJLA 1I1GA 1FOYA 1WVRA 5B1AH 3WTZA 3ZMUA 3FXQA 2RAEA 3J81Z 2IW5A 2DTRA 3JRHA 4HNVA 3DPTA 3A01A 1BC7C 4B43A 3FXRA 2LVSA 1FEXA 1U2WA 4JX5A 5JR3A 2KFDA 2KDOA 2R7FA 4JL3A 3HSFA 3BR6A 2ZOYA 3GTJJ 5J6XA 1OCPA 1N77A 3P7NA 1FPQA 3F9KA 5GTIC 5KK1A 2L5QA 2CO5A 2IGKA 1RESA 2Y9ZA 2UXHA 4D5FA 1Z21A 5LGUA 2VQGA 2E5NA 1DGWY 4CZZA 4IVNA 1IXCA 1BM9A 4A3BJ 3K70D 2DQLA 3P9TA 2G9WA 5F64A 3OYNA 4AWXB 3ZQGA 3NARA 4UB8C 1YIJI 1RRJA 3FKJA 1B9NA 2MFZA 4ZYHA 3ZMZA 2F5VA 4M72A 4GO1A 3WTTC 2D2WA 5E17F 2H8WA 1O4XA 3LSPA 1L0OC 1I27A 2HZTA 2CQKA 3IAS2 3G71I 3U9GA 2CMPA 1ZRCA 3FKIJ 4A3EJ 4HBLA 3AKZA 2XAHA 4L9JA 2HXIA 2MD5A 5BS6A 3MVPA 1YYVA 2VC1A 3CCQI 4DJAA 2KRCA 1HKTA 2BGCA 5CVVA 1U8BA 5DCMB 1IN5A 3LL7A 4XICA 3GWZA 1TWHJ 3GMEA 3HJEA 4ETSA 4AUXA 2NS7A 3Q0VA 2VBZA 2L9NA 4RGSA 3MFKA 1ONVA 3C3WA 3JRCA 4MLOA 5LLQA 2GIZA 1I6HJ 4JKZA 4MQ9F 2W53A 1MJAA 3CDHA 1D0XA 2R5ZA 1JUPA 2BXZA 1DGRM 2E35A 4M9SA 2ZSIB 2IXSA 3CC7I 4M73A 1SVMA 2H09A 1HC8A 1LVAA 1R6RA 4L5JA 4XRSG 2RQQA 3R0AA 2GBYA 4XLHA 5FLVA 2DMQA 4BAYA 5DUIA 4IF4A 3E6BA 5ILSA 3IRRA 3CUQA 2FNAA 2ZMEA 1WJEA 4N9HA 2IA0A 1F9NA 4ZZDA 4DZPA 2QQ8A 1TW2A 5EEHA 1T0FC 2K86A 4UUSA 4E7LA 3PNVA 2FQ4A 3RKQA 3VOEA 3S17J 1Y0NA 3IUOA 3O3KA 2F48A 5FFXA 4EJVA 4RAYA 4CSWA 3CJQB 2HVQA 4DVYP 4HPQA 3SFIA 3OL3A 3DBLB 4ESFA 5LHHA 1VQ4I 1R7JA 4L0ZB 3S32A 3G56A 1QVUA 3BG6A 5GTHC 1FYKA 1W7PB 5F0FA 4CUGA 1PYVA 4MNUA 4BACA 2UXIA 4A3IJ 3NWTA 1R5GA 2MC3A 4PJNA 2EINH 5EEGA 2NVTJ 3ZXSA 3TDUC 3QPHA 3MCZA 2X6XA 3ABLH 3AFHA 3ZP5A 3EGQA 1F4KA 2H27A 4RM3A 4FE4A 4F7ZA 4GFBA 5FFZA 3KZYA 2X1CA 3I3LA 3OSGA 3LA7A 5C4JJ 2L9RA 3VDXA 2PJPA 4XLCA 4U0VA 1JHHA 4HLYA 1ZTRA 3LWFA 5A2QZ 2QEXI 3F23A 2MH2A 1P7IA 1RKWA 2CRGA 2VB6A 4PGGA 4U88A 3K4MA 5K7ZA 2ZFUA 3BJAA 2HFHA 4FTHA 1ZQ3P 1P92A 2HQ5A 4U87A 2PFVA 4U0WA 2LC2A 4OAYA 2H6CA 3LFUA 1STZA 5JFRA 1F43A 3HG9A 4J00A 1YRNA 3DFGA 5AQCA 2ISYA 3D5LA 2ME0A 3G2BA 2G3BA 2XPWA 3LAPA 3AL0B 2Q2EA 3MZYA 1IRXA 2IGMA 2FEZA 3D5SC 4EJWA 4A3GJ 1D1BA 2LDUA 2WTEA 3PASA 3HRMA 4XMYA 1IRZA 4G6QA 2OJED 5CW8A 2K9NA 4EM1A 5F27A 2VN2A 1FY7A 1ORKA 2CFXA 1ZGAA 2O8KA 4ZYEA 2LRDA 2HDDA 3M7GA 1P4XA 5ED4A 1MH4A 4DYCA 2QCOA 4NB5A 5DDGA 1WH7A 5AONA 2HKXA 3SEZA 4EGYA 1S6LA 3NI7A 3S2DJ 4Q4ZF 1JHFA 3F3XA 4BEHA 3ANGA 2JPCA 1EJ9A 1VQ6I 4BE2A 1KU7A 1YW8A 2CW7A 3E3VA 4E70A 2X6YA 3KP7A 2DA6A 2JVGA 4ASNA 1BJZA 2HPMA 1UCRA 1X1DA 5B66C 2DFEA 1YQAA 2XAQA 4G6TB 3CLOA 1BR1A 1UZCA 4E7JA 1QQIA 4CGRA 5FO5A 1TQPA 1W0TA 2A6EF 5D1RA 3G3ZA 2QSFX 1MBJA 1JTYA 4L9NA 2GWRA 2OQRA 4R8HA 1QA6A 3RI4A 2ID6A 3LQRA 4E7IA 2O6GE 3VSLA 3C2BA 3RPUD 1NG7A 3GTGJ 2V4JC 4NBQA 4KN7X 2EK5A 1OYYA 1R4NB 5LEJA 4BY7J 3M3YJ 5KAFC 4DNCA 5D5UB 5K58A 2OCEA 3TW7A 4PSXA 3ERED 2XDNA 4MQVA 2KRHA 3QPSA 2H1KA 1X4PA 1OYIA 4HV6A 3OS1A 2JA7J 4G7OF 5M3MJ 4XK4A 1YJ9I 2QM3A 3CO7C 5HLIA 1TNTA 5F6FA 1XTAA 2M8GX 3K4BA 1S72I 4BHCA 1T8IA 1Y8QB 2DT6A 3M1CA 4BBRJ 3TDZC 1FYMA 5B5EC 5BPIA 3I4PA 2VKHA 3PL8A 1UI5A 4EJUA 2LMDA 5DD8A 3KLOA 1I6XA 1U8RA 3B81A 3SJMA 1OYWA 3ULQB 4ZDLA 5D4SA 1IW7F 2NRAC 1EKEA 1LDDA 1DP3A 1IAWA 1LE8A 3CRJA 2BZTA 2NNNA 3QU6A 3DKXA 4P1WA 3WU2C 4EATA 2AXTC 3WU0A 3UKGA 2BBYA 4JK1X 4L18B 5IP7J 5K7HA 2PMHA 3HGYA 5AIPA 3DU5A 4CYCA 2JPBA 2M5WA 5LRSA 2PLYA 2GAUA 2CQQA 3B73A 1CF7A 4FE7A 1FOKA 4XKCA 2OPTA 2O5RA 4C3IJ 2XUBA 1IXSB 4PCQA 2JQ7A 1BC8C 2DDBA 2VT2A 5D5WB 4RGRA 3RD3A 1G4DA 2CQXA 2G7SA 4GYGA 4E7ZA 2R5ZB 2VKVA 5IYDJ 2XDVA 2L2OA 5E8IA 2O7TA 5L3FA 1B72A 4CHUA 4II3A 2M30A 2Q2EB 5E3NA 2LY9A 4AIKA 2ZB9A 2X6WA 1ZRDA 2DU9A 5GP9A 4AVPA 4BEHB 4A6DA 5GAEJ 2L9SA 2QKLB 1QPMA 4XKVA 3EUHA 1ZR2A 2JA5J 1Z67A 1I3QJ 3ML6A 3VYSB 2NVXJ 1E3HA 4M9XA 1RZ4A 1YX5A 5F0CA 3KLNA 4V19K 1JXSA 2V9VA 1MIJA 3HHGA 5HDGA 2RREA 4NQWB 1U5TC 3SFZA 4XLFA 4XNFA 5HSZA 2HYTA 2Q8KA 3QYEA 2BYVE 1YE9A 3ASNH 3OYKA 2HVRA 2ZCNA 4GCLA 2DA2A 2HZDA 2X1DA 4U7BA 2Z16A 3K1NA 2O03A 4LGWA 4XM3A 4RAGA 1W5CC 2BEOA 4HDVA 1O3RA 1B8IB 5HBUA 1HBXG 2VJ4A 3ZQFA 1A36A 1P4AA 1WJAA 1R22A 2ZJPF 3VEPA 4XL9A 3PIOF 4CZCA 5HLGA 2M7AA 4AC0A 4QLCU 2QWWA 1MMSA 1V55H 3CMEI 4G7ZF 2A5YB 4EM2A 1TWCJ 3BTIA 1BI2A 5C3EJ 2W24A 3TGNA 1LB2A 2CV2A 4GYIA 2KP6A 3H9JA 1HQCA 1FSEA 3JSPA 3BG7A 3HHHA 2PEXA 1E17A 3NNRA 4NC6A 2VBYA 3KETA 2XPVA 3JSJA 1VQPI 5JHFA 2A69F 3Q9VA 3OYGA 3K7AJ 3HPGA 3ASOH 4RAZA 3SZPA 2ELJA 1GT0C 4L9TA 3BROA 3ZQ7A 2GENA 2B9SA 5LFAA 3BJBA 2W84A 3BZCA 2BY1A 3S2WA 1A31A 2W4SA 1N75A 2JVHA 4FQGA 1WSUA 1TWGJ 4BXXJ 3KIOA 4DBRA 1U5TB 3DXJF 4A3CJ 1EH6A 2X4HA 5EG0A 2GOMA 4ZTFA 3DWLE 4PFOA 4ZTJA 2GA1A 3V7SA 4GCTA 2EILH 2H94A 2DXIA 1XCVA 3EPZA 3SHFA 1D1AA 1T95A 1JKPC 3V8KA 4AU7A 3NEUA 1W5TA 4Y52J 2COBA 2IPQX 3BR0A 2JSCA 2HOTA 4AM3A 1RPWA 2NVUB 2D5VA 1VTNC 3NXCA 4DGWB 2J5OA 2LTPA 5GAGJ 2QF7A 1K4TA 1FZPB 1J9IA 4KFCA 1S7AA 4BJ6C 3CF2A 3I4MJ 2DA5A 3F8CA 2E1CA 3L2QA 3CMAI 4M3BA 2D1HA 2ZXIA 2G7HA 2DPUA 1Z3XA 1HA8A 1F5TA 3QKXA 5J4YA 4LG0A 5E1ZB 4BQOA 1MMDA 1Z91A 4YZEA 3CJNA 2PI0A 3IH3A 1SD4A 3FXUA 4A6EA 3K4NA 3IWZA 1NG6A 2COMA 4IOAF 1PP8F 1ZLJA 2EFOA 3OS0A 3HUGA 3W3CA 5DM7F 1K78B 2HOEA 5DUKA 3P5JA 4M3FA 5L3DA 3ZMTA 1R9TJ 1Z6TA 2QSGX 1R1TA 9ANTA 1TLHB 5JLXA 1VQMI 3T1BA 1MBHA 1SD5A 2JRTA 1BIAA 2M4KA 3GW2A 1J59A 2JA2A 4IHYA 1IZ1A 2WWYA 1TTYA 3E97A 4C2UA 3RZOJ 3T6NA 1R5ID 1SFXA 2JMWA 3DPLC 2LLKA 1QRYA 3EYIA 3GTPJ 2F4MB 4DW6A 2NAZA 3F0CA 2WV0A 3I56I 1VQNI 1V4RA 3MQ0A 3S1MJ 4A5NA 4B09A 1HW5A 2IJLA 3NWSA 1H89C 1SFEA 1FMVA 1E3PA 4A12A 5EG0B 4UUTA 5ICFA 1ZGWA 1ZELA 5TJJA 4DYQA 2DG7A 2K7LA 3FBNB 2GXBA 1IN4A 3BG9A 3FHNA 2EFPA 1IDYA 2CSOA 3M8FA 2HKUA 3I4NJ 1QBJA 2EFNA 3EDPA 4KT5C 5E1WA 2IS6A 3O2PE 1KGSA 1ZG5A 2Q0OA 3RIRA 1MMNA 2L0KA 3M1EA 3TP3A 4HDUA 4CCOA 1A35A 2P5LC 4C2MA 3R4KA 2VKEA 5J1RA 5FKKA 3VYTB 5JHUA 2LREA 1FC3A 5EDNA 2DOAA 2DPDA 2KISA 5E3LA 1YX3A 3SWHA 4MEYF 5EGOA 4GFKA 3DCFA 1S5LC 3KFWX 1WH5A 2Y9YA 1PP7U 3WG7H 4M3GA 4A0XA 5J4VA 2QYOA 5DAJA 5F0HA 2IA2A 2XB5A 3LQQA 4UB6C 3CCVI 3F21A 2L9VA 2DMPA 2FF4A 2XPUA 2REKA 3VYUB 1W4MA 5HLTA 2MYSA 2ZCMA 4KICA 3BR3A 3EUKL 4LOCA 2ZCXA 1FIAA 2FUG2 5BNGA 4CA0A 5A2QK 5LHIA 5J8CA 5EGOB 3RH2A 1TT5B 5DCFA 1IC8A 5LD2C 2P0WA 2GM4A 3BRUA 3JSOA 4RA2A 1ZK8A 2P6SA 2GUHA 4B4CA 3AG4H 4MGRA 2P6TA 4KIGA 3QPLA 1OCCH 2Y48A 3H9GA 4LIVA 1X2MA 1ETQA 3KP5A 4KT6A 3X2QH 2EZHA 1RUNA 2GA2A 4E4HA 1JGGA 2R92J 2ZJ2A 3AL0C 3S8PA 2MLGA 4LB5A 1FNNA 4GCKA 4DIQA 1O57A 2V7FA 2KL4A 2HYGD 4BKXA 2XC7A 2UWMA 2RHAA 3A01B 3S15J 3E7QA 5EF6A 1A04A 2Z5UA 3G1OA 1T33A 2EV6A 5L3BA 4ITVA 5J3LA 3RKYA 3F8MA 1YOVB 3ZQHA 4LFUA 3SYTA 3QRFF 2B3WA 2GLOA 3BZ6A 2XKPA 3HM5A 4I2OA 4F93B 5DV5A 3E0JB 1HSTA 4HLXA 3K4JA 3DBHB 1VFCA 5K5QA 3HYIA 3H3ZA 5FLMJ 3G73A 4PZJA 4KWAA 2O9LA 4B44A 2W1OA 3LHQA 2OI8A 1F1ZA 3K2AA 5F1RA 3DEUA 3DPUA 3N05A 3WODF 4UHTA 2D45A 1XCBA 4LJZF 2HYFA 4S04A 3SDBA 2KMUA 3S2HJ 5CQEA 1ETWA 1B4AA 3LSRA 1KYWA 4WWCA 4L5IA 4JX6A 5FMPA 3L2RA 1K6YA 2QKOA 4KUMA 2M0CA 4C30A 5ILVA 1ZLKA 2DG8A 3GLLA 3Q3SA 2WAEA 4HYEA 2JTVA 2P7VB 3OOUA 5E18F 2W85A 2YS9A 1HKSA 2OU2A 2OTJI 2E1MB 4KN4X 1YLFA 5FKMA 3WGGA 3J7AO 3GYHX 1JI8A 2PBXA 2R7DA 2W00A 1AKHB 4R79A 2BHZA 4M3DA 3TKYA 3M9AA 1E3OC 1EH8A 2PQ8A 4P9UA 4IHXA 5ILUA 4YFXF 1A6IA 1QHHD 2A3SA 3E7LA 1FOWA 3OY9A 3HOZJ 1OKRA 3QBMA 1WJ5A 3K70C 2OC6A 3AG1H 1G3TA 1OJLA 4TV7A 4PSWA 5K5OA 3BQZA 3OV8A 1BA5A 4LLNA 3DV8A 4UVCA 2M8EA 2VJJA 2LFBA 4FISA 3OS2A 2DYSH 2OQGA 1TWAJ 1K4SA 2Z9OA 3S1RJ 4CDGA 1MBEA 3O6BB 1GVJA 5E20A 1KU9A 2L02A 3HB9A 3KCCA 2CFOA 2D1VA 1IXRC 3CC4I 2R7TA 3GEUA 3A02A 3CDIA 6PAXA 1YS7A 2ZMEB 1SAUA 1REPC 2QWTA 1MMAA 4PK4A 4LMYA 2LF7A 4IRHA 4BXUA 3G6EI 4J01A 4XRFA 3GFIA 1XPXA 2KJBA 2OZUA 2M4GA 3BCBA 2OCCH 2HS5A 5EYRA 4O5VA 1Z05A 3Q9SA 3TOAA 1O7FA 1Y8RB 2DA4A 3PQJA 5FKNA 3F22A 3MNLA 2RNJA 1IG7A 1DU0A 5AIQA 2E36A 3OIQA 2HQRA 1IJWC 2WC2A 3WTUC 3R6SA 3CCUI 4G9YA 1QZEA 4PFPA 5M5WJ 2NX4A 5C4YA 2Z33A 2FX0A 2R7VA 4M6YA 2XSJC 1ETVA 5D18A 1OR7A 2EV0A 5C4XJ 1JUMA 4D9JA 4ZDOA 2VT3A 4HF1A 3OSFA 4L0YB 3W6VA 3K8PC 3HKZA 2M1BA 3T0YA 3FMRA 4JP0A 1FT9A 2RC4A 2LKPA 2X6OA 3MKLA 1U9NA 2Z2SB 4ENMA 4B8XA 3F8NA 4UY8I 4BBSJ 3OYMA 1XMXA 1TW3A 1MD0A 2QKMB 4LIUA 2HVSA 2P8TA 4IL6C 3S93A 1QVTA 1XN7A 3CQZJ 4I0AA 4WXCA 3ZMSA 1W36C 2XF5A 3HRUA 3PSFA 3VOKA 2FNPA 3KX2A 1JT6A 5TRDA 4YELA 1RR8C 4B47A 3AG3H 4U7DA 1ZR4A 1I3AA 2R93J 1TQMA 4AD9A 2QQ9A 4PXIA 3FXKA 1NTCA 2XRLA 3EUPA 4QPQA 2ETHA 1D0ZA 4MTEA 4ANJA 3PIPF 3ZQLA 1E0EA 2Y0SN 3BPVA 2FSWA 1FLIA 1ODDA 3DTIA 3AAFA 2FXAA 1IRFA 2JWTA 1MH3A 1OR7C 2BE5F 2ZC2A 4BQAA 4ACIA 3PQKA 2DN0A 2RV8A 1SGMA 4I99C 3V42A 4D1QA 1BIBA 1X1PA 4QTRA 3CUOA 3OWTA 1ZG3A 3ABTA 3JRIA 3PJRA 4KYWA 5D8LB 2QZ8A 2ELHA 3CJTB 3FK7A 3K69A 1DP7P 3GBGA 1XDUA 4Q5SF 2EZIA 1S29A 2LG4A 2K4BA 4OOIA 4Y4RA 1LFUP 3ISPA 5D6FA 4S05A 2MSYA 5HDKA 1D3YA 3OYBA 1ZGJA 3L00A 1POGA 2QENA 3JREA 3WTSC 5J8FA 4FASD 2DDAA 3T8RA 3MAJA 4B3XA 2RQPA 2EQRA 3FF5A 2X0LA 2R4GA 4B48A 5KNLA 1JE8A 2E1NA 4HX4A 4OMZA 5JVTA 2JA6J 4Y3OA 5FLXK 2GIVA 4KDPA 4BS9A 2F2EA 4BHBA 2XSDC 1B1BA 4HKUA 3M4OJ 1TZLA 4YEJA 2ESHA 1ETXA 2ZXHA 4BGDA 3HRSA 1GVDA 3RZDJ 2E2JJ 1UHSA 5DD4A 2MA3A 2R7RA 1MNEA 1USTA 3HZJA 2QBYA 4KJZA 2TRTA 4A2UA 2A5WA 2V26A 1ZHFA 2N8GA 1T98A 1NH3A 1KONA 3TP0A 1CQTA 3GZ5A 2A07F 3L1PA 2EIMH 2M7BA 4HF0A 1Z7UA 2NP3A 4HA8A 4CCMA 4LG3A 3VW0A 1LJ9A 2BY2A 2ZOZA 1SMYF 3C18A 4I6ZA 1YTYA 1UHMA 1HOMA 1RI7A 2C6YA 2W25A 4MFEA 3O8GA 3FMSA 3OYLA 1R1UA 3I54A 4ENJA 1OMIA 3LA3A 4QIWN 2ZXWH 1J75A 2V1UA 2V6CA 1R36A 4HSRA 2IT0A 3KP6A 1G3SA 2I10A 3W6KB 5F1JA 3IL2A 2CW0F 3DEEA 2HDWA 4G7HF 1LFPA 1O3SA 1LEAA 3I5UA 2YVXA 1SD6A 3BDDA 3ONQA 1OCTC 2F07A 2EIKH 3PM1A 3VWBA 4J19A 5E79C 4HV5A 2XIGA 1D0YA 2KZVA 3NQOA 1V5GA 2A2FX 5L3EA 4LK0F 3JRDA 1Z7LA 5JLWA 3J80K 1R58A 1R4MB 3V7CA 5EZGA 2KIQA 4A5MA 3GVAA 4RLQA 3CF5F 1XSDA 1HW2A 1N25A 3OOPA 4PGHA 2VI6A 3LSMA 3C2GA 1D1CA 2GFNA 3AQSA 4OMYA 3HTIA 2ZFWA 2Y31A 5CQGA 1V5FA 1QGPA 3F6OA 2XASA 3RDIA 2BW3A 1UG0A 4N0BA 5CYVA 3RPUA 4A3LJ 2VQHA 1SMTA 3HGGA 2EPFA 2K40A 3ROUA 3V8LA 5BMZA 2YR2A 4RB3C 3J7YJ 5LGTA 1GXPA 1V54H 2HI3A 3TOBA 3FXOA 1U3EM 1SD7A 3CP2A 2CUJA 4UV9A 2Z1DA 4ESBA 3RCOA 4BL0B 4Y7NJ 2RASA 1YRNB 1UMQA 3FXJA 4IOCF 4RM2A 4JNNA 4CXFA 2DK8A 2PN6A 4IHTA 4V2FA 3KYDB 2QLZA 3K4KA 1VZ0A 3LSGA 1TT0A 2ZKZA 3HXLA 3MN2A 4I01A 4NC8A 2NVYJ 2V79A 3KKCA 3GTOJ 4XBFA 4IQJA 2VPRA 3KYCB 4NHJA 2NS8A 1MDMB 1AA7A 2OF7A 1T38A 2F4IA 2VQCA 3LOCA 2NYXA 2JRMA 4A3DJ 3GFMA 3QP6A 2YPRA 5H20A 1HSJA 3DF8A 4ZYDA 4IHSA 3HBLA 4D0PA 2E2HJ 3BG3A 2RGVA 2VXDA 2Y0MA 2E34A 1BR2A 2MW8A 1D5VA 2LY2A 1R23A 4BDYA 4UUSB 2Q1ZB 3H92A 3WE3A 4D5CA 4A0YA 1DPUA 2AHQA 2V6EA 4IEJA 5K1YA 1AOYA 5J47A 2GQQA 4A3FJ 3ZMVA 3GZNB 2CU7A 2CYYA 3NPIA 3LAJA 4XLPF 2XGDA 2KLOA 3M07A 2EIJH 3HOWJ 2M34A 4A3KJ 4BQQA 2KRFA 2DYRH 3DKYA 3CC2I 2JJ7A 4AIJA 2Z99A 3ZN1A 1J0RA 4DBQA 5IOYA 5FHPA 2DA3A 3K1MA 4F92B 2P7CB 2HYJA 4YRVA 4BJTA 1GLNA 5DM6F 3GX4X 4HAMA 2OA4A 4L5EA 2VONA 1CGPA 2QTQA 4PJMA 4CCJA 5FJ8J 1TBXA 2K9SA 5IP9J 1HDPA 2KJCA 1P4WA 3OR1C 4I02A 2KIFA 4P9FA 1U78A 1HF0A 4M6XA 1XGMA 5CVRA 3VTIA 2ADUA 2KT0A 2XVCA 3FBIB 3GZ6A 4IZZA 1BOBA 1J09A 2WV1A 4U9NA 3V78A 2F4OB 1VQOI 5IT9K 2ZNYA 4BU2A 1PDNC 1HXDA 2DMUA 2K9QA 2VL8A 3EETA 4I7HA 1HW1A 2P4WA 3P9IA 1JKRC 1VQ5I 3ON2A 2F5DA 2WGBA 2EA2A 2WB1A 1ZAOA 5KHDA 2XROA 2YU9J 1G59A 3HOYJ 1IN6A 1ENHA 4M74A 3U2RA 3OYFA 3DLLF 3BR5A 4NC7A 2MG4A 3FZVA 3QOEA 4RB1A 1R49A 3AQTA 3GXOA 3K2ZA 5B1BH 3R0JA 3TO7A 3MKWB 2QGUA 2KZGA 1BL0A 3COLA 1OCZH 3E5XA 4RLFA 2XAJA 2VPLA 1YIOA 5FGLA 2H8RA 2XAUA 5B3SH 3FXLA 1SFOJ 3I64A 4IHVA 2W82A 1BI0A 3C1DA 2DA1A 4BE0A 2V9PA 5D8KB 2EZKA 4A0ZA 3CESA 4CICA 5KCMA 1P6RA 2Y2ZA 1L3LA 3BR2A 2FD5A 2DMNA 2VQLA 2ME6A 3CCLI 5CVIA 1Q1VA 1VQ7I 1MSFC 3D5RC 4ENNA 4EVIA 1VNDA 4IJAA 4HZFA 4ZDPA 3TW6A 2OAZA 3UNGC 3BCGA 1JGSA 3GFLA 3I0TA 1OPCA 4CCNA 4E7SA 4A69C 1ERDA 4Q47A 3V8JA 2ZNZA 3RTRA 3FISA 2A05A 3DPJA 3L9FA 4II2A 1MSEC 3L2UA 4UUVA 1VF9A 4LK1F 3R60A 3MKZA 2GXAA 1J7KA 3CJRB 3LSJA 1MBGA 4MK6A 2JK3A 2UUZA 3PUBA 4WF2A 4HF2A 1WPKA 2VODA 3ABMH 4HRIA 2DOEA 5GADJ 3KZ9A 3CUQC 2A6HF 3MWMA 4B3AA 2UXXA 2UXNA 2ZSHB 4HG2A 2L7MP 1S8NA 2VE9A 1TL8A 2V1XA 4EQQA 4PDKA 3WTVC 4UDSA 3HDDA 2ZXJA 2FQ3A 1ETKA 4BXFA 4EV0A 4IRGA 1YS6A 3GUDA 4LD5A 5TISC 3IKTA 3NS4A 2V1DA 5CXGA 2HXOA 2E71A 2PMUA 4G8XA 3JR9A 2JSPA 2XKOA 4QSHA 2DJIA 4WCGA 3TO6A 2Y0SA 1X3UA 4RB0A 4NNJA 1FBSA 3BWGA 2XAGA 4D7NA 5H9TA 3RYPA 2BXYA 3IHUA 3S16J 1I5ZA 2JT1A 1UI6A 3OYJA 2E7WA 2UXUA 1I1SA 1Z1DA 3H5NA 2DT7B 2CH0A 2P5KA 1H8AC 4L62A 1XGSA 3FIWA 5EEAA 2KHMA 1LPQA 3VIBA 3FK6A 4H0EA 3A0HC 1FMWA 4HX8A 2XHKA 3OR2C 4B1RA 2DT5A 3C7JA 2VOOA 3GZIA 3BQYA 5E3MA 1XC5A 1XMKA 1RKTA 1FP1D 4MIMA 5M5XJ 4XIDA 1IDZA 4BQNA 2FOWA 4PJJA 2DMTA 5D6EA 2CS3A 1Z77A 5FKLA 2DAOA 2LKXA 3HEFA 1X19A 5GPAA 3CWRA 4KIFA 2XGCA 1MZBA 2Z3YA 1U5TA 2F5CA 3RJPA 5H2FC 3KP3A 1OLTA 2FMYA 3M8EA 1NK2P 3S1NJ 3HPHA 2IEKA 2VJIA 4O3MA 3HIFA 3O8HA 3Q0UA 3BY6A 3H3UA 4RMNA 3ZR8X 2B1EA 3I53A 2IBDA 2EB7A 2WY8Q 5EJCA 2G7LA 2MABA 3BT9A 3CTAA 3CJDA 3E6MA 1G8XA 3JAMZ 1A6QA 4M3EA 2YUSA 3P9CA 3H36A 3E6DA 4I76A 1WI3A 2XF6A 4IKFA 4N4OB 3S3MA 3HC7A 4F3QA 2ACJA 3CMYA 1FP2A 5H6RA 2EFWA 1O3QA 4UVAA 4U9LA 3NRGA 2ISZA 4Q48A 4WX9A 2BY3A 2BVMA 4OINF 3LJLA 3Q0WA 1VQLI 4E7HA 1MW7A 2K9MA 2VBXA 2E60A 2ESNA 2ZJRF 2QA4I 3V6GA 2WAFA 3BLYA 4E6KG 3RPQA 3G4SI 4XR6A 4U0YA 5KAIC 3N4MA 3BOQA 1ETYA 4RGUA 4OIQF 1DUXC 1FX7A 3CD6I 3K10A 1ZH5A 4YFKF 1EF4A 3ABKH 3ON4A 1BW5A 5LHGA 4RGXA 4ENKA 4I09A 5LGNA 2L7ZA 2X85A 1QU3A 1GHCA 4YIRX 2ZBKA 1OFCX 2EFQA 1K79A 4PJ0C 4F91B 1KA8A 1LVKA 3JTHA 3TMOA 2O61A 3R61A 2QIBA 1HLVA 3QOPA 2A6TA 3EQLF 3DTEA 4XLAA 4KITB 1Z6RA 1KQ9A 4ZZLA 1WFXA 5JVGF 3DEWA 1WZ2A 3ZOBA 1LKXA 2GOXB 3L2VA 3IUVA 4GGGA 5DYMA 1ZN2A 1UELB 2R7XA 2VE8A 2FJ1A 5GPCA 3QU3A 3KE2A 4ICHA 4S0HB 2MH9A 2ECCA 3KEQA 3OIPA 2VBWA 3HKZN 3D1NI 1SANA 4ZH4F 1MDMA 4OWRB 4OIOF 4QWQA 2OZ6A 1EA3A 4H4KC 1KU3A 1YI2I 2DFHA 2JA8J
chains in the Genus database with same CATH topology
3RD3A 2YVHA 2M2EA 3HOVJ 5E3OA 5D19A 1POGA 2CQXA 3JREA 2G7SA 3OIOA 2R5ZB 3BTCA 1I50J 2VKVA 3HOXJ 5IYDJ 2O7TA 1B72A 2R0QC 2EQRA 4X6AJ 3VVYA 5DTDA 5E3NA 2LY9A 2PZ9A 2ZB9A 2DJNA 1U9OA 2JA6J 5GP9A 2HOSA 1RETA 2P81A 3JRAA 1Z0XA 3RQIA 2XSDC 1ZR2A 2JA5J 3M4OJ 1I3QJ 2NVXJ 4HKUA 1UG2A 1ETXA 3F1BA 5F0CA 1TC3C 3QQAA 2EH3A 3BHQA 1GVDA 3RZDJ 2E2JJ 1UHSA 4C3HJ 2MGQA 5HSZA 2HYTA 3GTQJ 2TRTA 3B6CA 1VI0A 1MNMC 2ZCNA 2N8GA 4GCLA 2DA2A 4MFDA 2LP0A 3VP5A 3TP0A 1CQTA 1MBFA 3PPBA 1NK3P 4AYBN 1F36A 3L1PA 5M3FJ 2NP3A 1B8IB 5C44J 1IGNA 5HBUA 3VW0A 3ZQFA 3JRFA 2ZOZA 3C07A 3GTMJ 4I6ZA 3WHCA 1HOMA 3KNWA 1PUFA 1DU6A 4MFEA 4AC0A 3O8GA 3LWJA 2G7GA 2X48A 1TWCJ 3BTIA 5C3EJ 1TWFJ 4QIWN 3BR1A 1G2HA 3PO3J 3GTKJ 5K7FA 5IOZA 2I10A 5F1JA 2CUFA 4W1UA 2W48A 3NNRA 2XPVA 3JSJA 2KDZA 1OCTC 3VPRA 2E2IJ 4A3MJ 2O7OA 2F07A 3PM1A 5DS9A 3K7AJ 3TEDA 5F04A 4J19A 3H3VK 5IPAA 1Y1WJ 1GT0C 4ME9A 2GENA 2UXOA 3JRDA 3BJBA 2LR8A 4NDLA 5JLWA 3ANPA 1FTZA 1WGXA 5EZGA 5M5YJ 1TWGJ 4BXXJ 2VI6A 2Q24A 3VOXA 4A3CJ 2CJJA 2GFNA 5EG0A 3AQSA 3O60A 2Y30A 3HTIA 2Y31A 1JKQC 1H88C 4GCTA 2E19A 2WUIA 4A3LJ 2R5YA 1JKPC 3HGGA 1X58A 2K40A 3ZQIA 3JRBA 3S5RA 1JJ6C 4Y52J 2V57A 2COBA 4RBOA 3BR0A 2R7ZJ 1P7JA 2HI3A 2HOTA 3JRGA 1D5YA 2DTZA 1RPWA 2D5VA 1JTXA 3VUQA 4Y7NJ 2LD5A 1B72B 2RASA 1YRNB 1UMQA 3S1QJ 3NXCA 1T56A 1AU7A 4JNNA 2LTPA 4V2FA 2QF7A 3LSGA 1AKHA 3SDGA 3MN2A 1HDDC 1APLC 4C3JJ 2NVYJ 3KKCA 1A5JA 3I4MJ 2DA5A 2R5YB 3GTOJ 4M3BA 2VPRA 5J1YA 2D6YA 2NS8A 2OF7A 3QKXA 4NN1A 2HOAA 1LFBA 4YZEA 1FJLA 3LOCA 4A3DJ 3IH3A 3HBLA 2RAEA 2E2HJ 3BG3A 2E1OA 1PUFB 2MW8A 3JRHA 4HNVA 4UUSB 4JX4A 3A01A 4A3JJ 4M3FA 4D5CA 1R9TJ 2AHQA 3KKDA 4IEJA 9ANTA 2LVSA 3LNQA 1FEXA 4JX5A 5JLXA 4A3FJ 1MBHA 4JL3A 2CU7A 3NPIA 3VVZA 2XGDA 3BR6A 3HOWJ 2ZOYA 3GTJJ 2M34A 4A3KJ 4IHYA 3RZOJ 2JJ7A 1OCPA 2TCTA 4XRSA 3T6NA 3GTLJ 5FHPA 2JMWA 5EZHA 2DA3A 5IOYA 1JKOC 1GV2A 2LLKA 1QRYA 3GTPJ 2HYJA 4DW6A 4G12A 1RESA 3F0CA 4L5EA 2Y9ZA 4D5FA 4BY1J 2QTQA 2UXHA 5FJ8J 2K9SA 5IP9J 3S1MJ 1HDPA 4A3BJ 1H89C 1JT0A 3P9TA 3CDLA 2QOPA 1U78A 5EG0B 4UUTA 3ZQGA 1ZGWA 2X9DA 3NARA 1HF0A 4DYQA 2DG7A 3VW2A 3BG9A 2KT0A 1IDYA 2HKUA 3V78A 2WV1A 3A03A 3I4NJ 3PO2J 4MO7A 2LK2A 1O4XA 2DMUA 2K9QA 3LSPA 3ON2A 5FKOA 1JKRC 3G1LA 2L0KA 4MXMA 2WGBA 3TP3A 1X2NA 4V2GA 2VKEA 2YU9J 5J1RA 2WAQN 5FKKA 3FKIJ 3HOYJ 4A3EJ 2NP5A 1ENHA 2PMZN 4XRMA 5EDNA 2NOGA 2HXIA 5E3LA 5EGOA 3MVPA 4GFKA 2FBQA 3BR5A 3DCFA 1WH5A 2MG4A 2Y9YA 4M3GA 3AQTA 1U8BA 4EEFG 5DAJA 4IHWA 5F0HA 4XICA 2XB5A 1TWHJ 1BW6A 1BL0A 3WHBA 3COLA 4AUXA 2NS7A 2DMPA 2XPUA 5FGLA 3Q0VA 2H8RA 2REKA 1FIPA 1SFOJ 2ZCMA 3BR3A 3JRCA 4LOCA 2ZCXA 4IHVA 4MLOA 1ITYA 1FIAA 5BNGA 4D7MA 2DA1A 1I6HJ 4JKZA 2W53A 5EGOB 3RH2A 2R5ZA 1JUPA 1IC8A 2GM4A 2EZKA 3BRUA 1ZK8A 2GUHA 2Y2ZA 4B4CA 3BR2A 2FD5A 2DMNA 5J1UA 3QPLA 2ME6A 2WB1N 3IH2A 1Q1VA 4XRSG 5CXIA 1MSFC 2GBYA 1X2MA 5FLVA 1ETQA 2DMQA 5F08A 2EZHA 2R92J 1JGGA 4GCKA 1VNDA 3FRQA 3TW6A 3BCGA 4DZPA 4A69C 4BKXA 1K61A 4UUSA 2RHAA 3A01B 3S15J 2FQ4A 3FISA 3RKQA 3E7QA 3DPJA 5EF6A 4DZJA 3S17J 3G1OA 1T33A 1MSEC 4AC6A 5J3LA 1VF9A 3ZQHA 2JN6A 3SFIA 3LSJA 2GLOA 1MBGA 2VUMJ 4MK6A 5HAWA 2AO9A 3H0GJ 3HM5A 2JK3A 4FCYA 3G56A 1WPKA 1QVUA 3KZ9A 2G0EA 5F0FA 2EZLA 1VFCA 1QPIA 4B3AA 5IP6A 2B63J 5FLMJ 2UXIA 4A3IJ 2L7MP 2NVTJ 4KWAA 2O9LA 4UDSA 3HDDA 3EGQA 1ETKA 3LHQA 4GFBA 4FE4A 2OI8A 2NVQJ 3K2AA 5CXGA 2HXOA 3JR9A 3OSGA 5C4JJ 1S7EA 5HODA 4C2MJ 2L9RA 4QSHA 3S2HJ 1ZTRA 1ETWA 3LSRA 3HTAA 1P7IA 1RKWA 2CRGA 4D7NA 5H9TA 4JX6A 5K7ZA 4DYRA 3S16J 5FMPA 2QKOA 1UI6A 4JYKA 2XGEA 2DG8A 2M0CA 2UXUA 2DA7A 4FTHA 1ZQ3P 2HQ5A 2ECBA 3Q3SA 1AHDP 1H8AC 1JJ8C 4L62A 3OOUA 1XS9A 3FIWA 2YS9A 5EEAA 4CYCB 1F43A 1YRNA 3VW1A 5AQCA 3VIBA 3FK6A 2ME0A 5FKMA 3B6AA 2PBXA 2G3BA 1AKHB 2XPWA 3G1MA 4B1RA 3CCYA 4M3DA 3BNIA 3GZIA 3HTJA 3BQYA 5E3MA 4A3GJ 1XC5A 3PASA 1RR7A 1E3OC 1RKTA 3VVXA 5M5XJ 4MIMA 1IRZA 4XIDA 4IHXA 1IDZA 5CW8A 2K9NA 2DMTA 1A6IA 3HOZJ 5F27A 3E7LA 1ORKA 1Z77A 5FKLA 2O8KA 3QBMA 4GFLA 2LKXA 3HEFA 5GPAA 3CWRA 1OJLA 2XGCA 2HDDA 1HCRA 1MH4A 3BQZA 4DYCA 1NK2P 3S1NJ 2QCOA 2IEKA 4RDUA 1BA5A 3ZQCA 1WH7A 3O8HA 3Q0UA 2LFBA 3S2DJ 4FISA 3NI7A 2IBDA 1TWAJ 2G7LA 3CJDA 3BT9A 1GUUA 3S1RJ 4NELA 3ANGA 1K83J 3HE0A 5IYBJ 1MBEA 4M3EA 2YUSA 1WCMJ 3HB9A 1Y1VJ 2DA6A 1WI3A 3A02A 1ZKGA 1BJZA 4I76A 3GEUA 1FTTA 5IYCJ 2QWTA 3CMYA 4CGRA 3BTJA 3HTHA 1GDTA 1W0TA 5D1RA 4ABZA 1MBJA 1JTYA 3NRGA 5EYRA 1W0UA 2ID6A 2DA4A 3C2BA 5FKNA 3HOUJ 3LJLA 3Q0WA 3MNLA 1IG7A 1ETOA 1DU0A 2IU5A 3GTGJ 3G7RA 1IJWC 3V6GA 2YVEA 5M5WJ 2NX4A 2UXPA 4W97A 3HIMA 4BY7J 3M3YJ 5C4YA 5K58A 2FX0A 3TW7A 1B8IA 3IH4A 1ETYA 5EFYA 2EBIA 2XDNA 1ETVA 3QPSA 2H1KA 5D18A 2JA7J 5C4XJ 1JUMA 5M3MJ 1EF4A 3ON4A 4M6VA 4XK4A 3OSFA 3W6VA 1BW5A 4JP0A 2M8GX 2M9HA 2L7ZA 3NAUA 2L7FP 3MKLA 2X6OA 4BBRJ 1U9NA 1OFCX 1XG1A 3BTLA 4BBSJ 1UI5A 2OERA 1QVTA 1MBKA 3CQZJ 3B81A 2QIBA 3SJMA 3VOKA 2IAIA 1JT6A 1HLVA 1LE8A 3CRJA 2R93J 2ID3A 1ZR4A 3BG5A 4PXIA 1NTCA 2XRLA 1IV6A 3EUPA 3ZQLA 2Y0SN 2CUEA 3DEWA 4A93J 3UKGA 3ZOBA 5IP7J 5K7HA 3IUVA 2XB0X 2JWTA 1MH3A 4ACIA 4X1EA 3HGYA 4CYCA 2DN0A 3S14J 1SGMA 5GPCA 2FJ1A 4ICHA 2CQQA 4S0HB 4QTRA 4FE7A 2ECCA 4AF5A 2OPTA 3JRIA 4C3IJ 3HKZN 3D1NI 1SANA 3FK7A 1GV5A 2ELKA 3IV5A 3GBGA 1LE8B 2EZIA 1LFUP 1IUFA 1JUSA 2MSYA 2JA8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD3 A;  2YVH A;  2M2E A;  3HOV J;  5E3O A;  5D19 A;  1POG A;  2CQX A;  3JRE A;  2G7S A;  3OIO A;  2R5Z B;  3BTC A;  1I50 J;  2VKV A;  3HOX J;  5IYD J;  2O7T A;  1B72 A;  2R0Q C;  2EQR A;  4X6A J;  3VVY A;  5DTD A;  5E3N A;  2LY9 A;  2PZ9 A;  2ZB9 A;  2DJN A;  1U9O A;  2JA6 J;  5GP9 A;  2HOS A;  1RET A;  2P81 A;  3JRA A;  1Z0X A;  3RQI A;  2XSD C;  1ZR2 A;  2JA5 J;  3M4O J;  1I3Q J;  2NVX J;  4HKU A;  1UG2 A;  1ETX A;  3F1B A;  5F0C A;  1TC3 C;  3QQA A;  2EH3 A;  3BHQ A;  1GVD A;  3RZD J;  2E2J J;  1UHS A;  4C3H J;  2MGQ A;  5HSZ A;  2HYT A;  3GTQ J;  2TRT A;  3B6C A;  1VI0 A;  1MNM C;  2ZCN A;  2N8G A;  4GCL A;  2DA2 A;  4MFD A;  2LP0 A;  3VP5 A;  3TP0 A;  1CQT A;  1MBF A;  3PPB A;  1NK3 P;  4AYB N;  1F36 A;  3L1P A;  5M3F J;  2NP3 A;  1B8I B;  5C44 J;  1IGN A;  5HBU A;  3VW0 A;  3ZQF A;  3JRF A;  2ZOZ A;  3C07 A;  3GTM J;  4I6Z A;  3WHC A;  1HOM A;  3KNW A;  1PUF A;  1DU6 A;  4MFE A;  4AC0 A;  3O8G A;  3LWJ A;  2G7G A;  2X48 A;  1TWC J;  3BTI A;  5C3E J;  1TWF J;  4QIW N;  3BR1 A;  1G2H A;  3PO3 J;  3GTK J;  5K7F A;  5IOZ A;  2I10 A;  5F1J A;  2CUF A;  4W1U A;  2W48 A;  3NNR A;  2XPV A;  3JSJ A;  2KDZ A;  1OCT C;  3VPR A;  2E2I J;  4A3M J;  2O7O A;  2F07 A;  3PM1 A;  5DS9 A;  3K7A J;  3TED A;  5F04 A;  4J19 A;  3H3V K;  5IPA A;  1Y1W J;  1GT0 C;  4ME9 A;  2GEN A;  2UXO A;  3JRD A;  3BJB A;  2LR8 A;  4NDL A;  5JLW A;  3ANP A;  1FTZ A;  1WGX A;  5EZG A;  5M5Y J;  1TWG J;  4BXX J;  2VI6 A;  2Q24 A;  3VOX A;  4A3C J;  2CJJ A;  2GFN A;  5EG0 A;  3AQS A;  3O60 A;  2Y30 A;  3HTI A;  2Y31 A;  1JKQ C;  1H88 C;  4GCT A;  2E19 A;  2WUI A;  4A3L J;  2R5Y A;  1JKP C;  3HGG A;  1X58 A;  2K40 A;  3ZQI A;  3JRB A;  3S5R A;  1JJ6 C;  4Y52 J;  2V57 A;  2COB A;  4RBO A;  3BR0 A;  2R7Z J;  1P7J A;  2HI3 A;  2HOT A;  3JRG A;  1D5Y A;  2DTZ A;  1RPW A;  2D5V A;  1JTX A;  3VUQ A;  4Y7N J;  2LD5 A;  1B72 B;  2RAS A;  1YRN B;  1UMQ A;  3S1Q J;  3NXC A;  1T56 A;  1AU7 A;  4JNN A;  2LTP A;  4V2F A;  2QF7 A;  3LSG A;  1AKH A;  3SDG A;  3MN2 A;  1HDD C;  1APL C;  4C3J J;  2NVY J;  3KKC A;  1A5J A;  3I4M J;  2DA5 A;  2R5Y B;  3GTO J;  4M3B A;  2VPR A;  5J1Y A;  2D6Y A;  2NS8 A;  2OF7 A;  3QKX A;  4NN1 A;  2HOA A;  1LFB A;  4YZE A;  1FJL A;  3LOC A;  4A3D J;  3IH3 A;  3HBL A;  2RAE A;  2E2H J;  3BG3 A;  2E1O A;  1PUF B;  2MW8 A;  3JRH A;  4HNV A;  4UUS B;  4JX4 A;  3A01 A;  4A3J J;  4M3F A;  4D5C A;  1R9T J;  2AHQ A;  3KKD A;  4IEJ A;  9ANT A;  2LVS A;  3LNQ A;  1FEX A;  4JX5 A;  5JLX A;  4A3F J;  1MBH A;  4JL3 A;  2CU7 A;  3NPI A;  3VVZ A;  2XGD A;  3BR6 A;  3HOW J;  2ZOY A;  3GTJ J;  2M34 A;  4A3K J;  4IHY A;  3RZO J;  2JJ7 A;  1OCP A;  2TCT A;  4XRS A;  3T6N A;  3GTL J;  5FHP A;  2JMW A;  5EZH A;  2DA3 A;  5IOY A;  1JKO C;  1GV2 A;  2LLK A;  1QRY A;  3GTP J;  2HYJ A;  4DW6 A;  4G12 A;  1RES A;  3F0C A;  4L5E A;  2Y9Z A;  4D5F A;  4BY1 J;  2QTQ A;  2UXH A;  5FJ8 J;  2K9S A;  5IP9 J;  3S1M J;  1HDP A;  4A3B J;  1H89 C;  1JT0 A;  3P9T A;  3CDL A;  2QOP A;  1U78 A;  5EG0 B;  4UUT A;  3ZQG A;  1ZGW A;  2X9D A;  3NAR A;  1HF0 A;  4DYQ A;  2DG7 A;  3VW2 A;  3BG9 A;  2KT0 A;  1IDY A;  2HKU A;  3V78 A;  2WV1 A;  3A03 A;  3I4N J;  3PO2 J;  4MO7 A;  2LK2 A;  1O4X A;  2DMU A;  2K9Q A;  3LSP A;  3ON2 A;  5FKO A;  1JKR C;  3G1L A;  2L0K A;  4MXM A;  2WGB A;  3TP3 A;  1X2N A;  4V2G A;  2VKE A;  2YU9 J;  5J1R A;  2WAQ N;  5FKK A;  3FKI J;  3HOY J;  4A3E J;  2NP5 A;  1ENH A;  2PMZ N;  4XRM A;  5EDN A;  2NOG A;  2HXI A;  5E3L A;  5EGO A;  3MVP A;  4GFK A;  2FBQ A;  3BR5 A;  3DCF A;  1WH5 A;  2MG4 A;  2Y9Y A;  4M3G A;  3AQT A;  1U8B A;  4EEF G;  5DAJ A;  4IHW A;  5F0H A;  4XIC A;  2XB5 A;  1TWH J;  1BW6 A;  1BL0 A;  3WHB A;  3COL A;  4AUX A;  2NS7 A;  2DMP A;  2XPU A;  5FGL A;  3Q0V A;  2H8R A;  2REK A;  1FIP A;  1SFO J;  2ZCM A;  3BR3 A;  3JRC A;  4LOC A;  2ZCX A;  4IHV A;  4MLO A;  1ITY A;  1FIA A;  5BNG A;  4D7M A;  2DA1 A;  1I6H J;  4JKZ A;  2W53 A;  5EGO B;  3RH2 A;  2R5Z A;  1JUP A;  1IC8 A;  2GM4 A;  2EZK A;  3BRU A;  1ZK8 A;  2GUH A;  2Y2Z A;  4B4C A;  3BR2 A;  2FD5 A;  2DMN A;  5J1U A;  3QPL A;  2ME6 A;  2WB1 N;  3IH2 A;  1Q1V A;  4XRS G;  5CXI A;  1MSF C;  2GBY A;  1X2M A;  5FLV A;  1ETQ A;  2DMQ A;  5F08 A;  2EZH A;  2R92 J;  1JGG A;  4GCK A;  1VND A;  3FRQ A;  3TW6 A;  3BCG A;  4DZP A;  4A69 C;  4BKX A;  1K61 A;  4UUS A;  2RHA A;  3A01 B;  3S15 J;  2FQ4 A;  3FIS A;  3RKQ A;  3E7Q A;  3DPJ A;  5EF6 A;  4DZJ A;  3S17 J;  3G1O A;  1T33 A;  1MSE C;  4AC6 A;  5J3L A;  1VF9 A;  3ZQH A;  2JN6 A;  3SFI A;  3LSJ A;  2GLO A;  1MBG A;  2VUM J;  4MK6 A;  5HAW A;  2AO9 A;  3H0G J;  3HM5 A;  2JK3 A;  4FCY A;  3G56 A;  1WPK A;  1QVU A;  3KZ9 A;  2G0E A;  5F0F A;  2EZL A;  1VFC A;  1QPI A;  4B3A A;  5IP6 A;  2B63 J;  5FLM J;  2UXI A;  4A3I J;  2L7M P;  2NVT J;  4KWA A;  2O9L A;  4UDS A;  3HDD A;  3EGQ A;  1ETK A;  3LHQ A;  4GFB A;  4FE4 A;  2OI8 A;  2NVQ J;  3K2A A;  5CXG A;  2HXO A;  3JR9 A;  3OSG A;  5C4J J;  1S7E A;  5HOD A;  4C2M J;  2L9R A;  4QSH A;  3S2H J;  1ZTR A;  1ETW A;  3LSR A;  3HTA A;  1P7I A;  1RKW A;  2CRG A;  4D7N A;  5H9T A;  4JX6 A;  5K7Z A;  4DYR A;  3S16 J;  5FMP A;  2QKO A;  1UI6 A;  4JYK A;  2XGE A;  2DG8 A;  2M0C A;  2UXU A;  2DA7 A;  4FTH A;  1ZQ3 P;  2HQ5 A;  2ECB A;  3Q3S A;  1AHD P;  1H8A C;  1JJ8 C;  4L62 A;  3OOU A;  1XS9 A;  3FIW A;  2YS9 A;  5EEA A;  4CYC B;  1F43 A;  1YRN A;  3VW1 A;  5AQC A;  3VIB A;  3FK6 A;  2ME0 A;  5FKM A;  3B6A A;  2PBX A;  2G3B A;  1AKH B;  2XPW A;  3G1M A;  4B1R A;  3CCY A;  4M3D A;  3BNI A;  3GZI A;  3HTJ A;  3BQY A;  5E3M A;  4A3G J;  1XC5 A;  3PAS A;  1RR7 A;  1E3O C;  1RKT A;  3VVX A;  5M5X J;  4MIM A;  1IRZ A;  4XID A;  4IHX A;  1IDZ A;  5CW8 A;  2K9N A;  2DMT A;  1A6I A;  3HOZ J;  5F27 A;  3E7L A;  1ORK A;  1Z77 A;  5FKL A;  2O8K A;  3QBM A;  4GFL A;  2LKX A;  3HEF A;  5GPA A;  3CWR A;  1OJL A;  2XGC A;  2HDD A;  1HCR A;  1MH4 A;  3BQZ A;  4DYC A;  1NK2 P;  3S1N J;  2QCO A;  2IEK A;  4RDU A;  1BA5 A;  3ZQC A;  1WH7 A;  3O8H A;  3Q0U A;  2LFB A;  3S2D J;  4FIS A;  3NI7 A;  2IBD A;  1TWA J;  2G7L A;  3CJD A;  3BT9 A;  1GUU A;  3S1R J;  4NEL A;  3ANG A;  1K83 J;  3HE0 A;  5IYB J;  1MBE A;  4M3E A;  2YUS A;  1WCM J;  3HB9 A;  1Y1V J;  2DA6 A;  1WI3 A;  3A02 A;  1ZKG A;  1BJZ A;  4I76 A;  3GEU A;  1FTT A;  5IYC J;  2QWT A;  3CMY A;  4CGR A;  3BTJ A;  3HTH A;  1GDT A;  1W0T A;  5D1R A;  4ABZ A;  1MBJ A;  1JTY A;  3NRG A;  5EYR A;  1W0U A;  2ID6 A;  2DA4 A;  3C2B A;  5FKN A;  3HOU J;  3LJL A;  3Q0W A;  3MNL A;  1IG7 A;  1ETO A;  1DU0 A;  2IU5 A;  3GTG J;  3G7R A;  1IJW C;  3V6G A;  2YVE A;  5M5W J;  2NX4 A;  2UXP A;  4W97 A;  3HIM A;  4BY7 J;  3M3Y J;  5C4Y A;  5K58 A;  2FX0 A;  3TW7 A;  1B8I A;  3IH4 A;  1ETY A;  5EFY A;  2EBI A;  2XDN A;  1ETV A;  3QPS A;  2H1K A;  5D18 A;  2JA7 J;  5C4X J;  1JUM A;  5M3M J;  1EF4 A;  3ON4 A;  4M6V A;  4XK4 A;  3OSF A;  3W6V A;  1BW5 A;  4JP0 A;  2M8G X;  2M9H A;  2L7Z A;  3NAU A;  2L7F P;  3MKL A;  2X6O A;  4BBR J;  1U9N A;  1OFC X;  1XG1 A;  3BTL A;  4BBS J;  1UI5 A;  2OER A;  1QVT A;  1MBK A;  3CQZ J;  3B81 A;  2QIB A;  3SJM A;  3VOK A;  2IAI A;  1JT6 A;  1HLV A;  1LE8 A;  3CRJ A;  2R93 J;  2ID3 A;  1ZR4 A;  3BG5 A;  4PXI A;  1NTC A;  2XRL A;  1IV6 A;  3EUP A;  3ZQL A;  2Y0S N;  2CUE A;  3DEW A;  4A93 J;  3UKG A;  3ZOB A;  5IP7 J;  5K7H A;  3IUV A;  2XB0 X;  2JWT A;  1MH3 A;  4ACI A;  4X1E A;  3HGY A;  4CYC A;  2DN0 A;  3S14 J;  1SGM A;  5GPC A;  2FJ1 A;  4ICH A;  2CQQ A;  4S0H B;  4QTR A;  4FE7 A;  2ECC A;  4AF5 A;  2OPT A;  3JRI A;  4C3I J;  3HKZ N;  3D1N I;  1SAN A;  3FK7 A;  1GV5 A;  2ELK A;  3IV5 A;  3GBG A;  1LE8 B;  2EZI A;  1LFU P;  1IUF A;  1JUS A;  2MSY A;  2JA8 J; 
#chains in the Genus database with same CATH topology
 3L7W A;  5L3C A;  2M2E A;  3HOV J;  2O0Y A;  5E3O A;  1EV7 A;  2K3F A;  4E7K A;  3OIO A;  3WU1 B;  1RNL A;  3BTC A;  3WE2 A;  4KIS A;  2LY1 A;  1X3Z B;  3HOX J;  2AQF A;  2BOL A;  3I59 A;  3ZGK A;  1XDS A;  2K02 A;  3PFI A;  1MKM A;  3WGH A;  2L4A A;  5DTD A;  1R71 A;  2A61 A;  2CGP A;  1G3Y A;  2HGC A;  1U9O A;  1TQI A;  2HOS A;  1RET A;  2P81 A;  1QHG A;  4HX7 A;  3U1K A;  1Q1H A;  3GCM A;  3V7R A;  1UG2 A;  3F1B A;  3HSE A;  4Z6Y A;  1D8J A;  1XSX A;  2FRH A;  4AIH A;  5ICG A;  4NQW A;  1XMA A;  3BHQ A;  4C3H J;  5FD5 A;  4XOR A;  4YII A;  1VQ8 I;  2QSH X;  1I39 A;  2I8D A;  2JUG A;  3B6C A;  1VI0 A;  4BYY A;  2FML A;  3SZG A;  4Y15 A;  4FHT A;  2M3A A;  3W2V A;  2O8X A;  4UNO A;  1T39 A;  3VP5 A;  3CO6 C;  4GXO A;  1MBF A;  1ZRE A;  2FBI A;  4CGZ A;  1LUJ B;  4AYB N;  2F5E A;  4Z2Y A;  1ZYR F;  4EM0 B;  3OMY A;  4N9I A;  3J81 K;  5M3F J;  1IGN A;  3PNY A;  5IY5 H;  3OYD A;  4DQ2 A;  3C07 A;  5HDN A;  3KNW A;  5ICE A;  1PUF A;  1DU6 A;  4HEA 2;  5FLX Z;  3HTS B;  2DLL A;  3MKY B;  3K4L A;  5HNF A;  5CVJ A;  3J7Z I;  3BR1 A;  3FWE A;  3K1P A;  3ZCO A;  1ZAR A;  2OTL I;  3GTK J;  3PO3 J;  5K7F A;  4WXH A;  4RS8 A;  1LDK B;  4HQM A;  4IXA A;  2GZW A;  2R7Q A;  1V3F A;  2KDZ A;  4I0B A;  3C2H A;  1TP4 A;  3VPR A;  4A3M J;  2O7O A;  4FX4 A;  1E2X A;  1B9M A;  3TED A;  3H3V K;  2XV4 S;  5IPA A;  5K5R A;  3LMM A;  1Y1W J;  2EJR A;  2L54 A;  4ME9 A;  4IRV A;  1R1V A;  5HOO A;  2V1N A;  2RN7 A;  2LR8 A;  4NDL A;  3ANP A;  1FTZ A;  1Y56 A;  1WGX A;  2KQR A;  2Y69 H;  3RKW A;  5M5Y J;  1KQ8 A;  2ZY9 A;  2IP2 A;  5H6Q A;  2PFB A;  2MLK A;  3ZQQ A;  2IS2 A;  2CQ7 A;  2HR3 A;  3TO9 A;  1MMG A;  2Y30 A;  1SC7 A;  3O60 A;  5FGM A;  1B59 A;  4CO8 A;  1JKQ C;  1FBQ A;  2OBP A;  3GF2 A;  2E19 A;  2GXG A;  3BCA A;  4OU0 A;  1USS A;  1U6G A;  3DBR B;  3EUA A;  3T5X A;  3S3N A;  1YJN I;  2VC0 A;  5D5V B;  2QQB A;  3I58 A;  3IKV A;  4KIB A;  1IN8 A;  1X58 A;  4M71 A;  3ZQI A;  1IO2 A;  3JRB A;  1GXQ A;  1UJ8 A;  3RSN A;  2V57 A;  2KIM A;  4WK8 F;  4RBO A;  1SFU A;  2HDC A;  4XSX F;  2O3F A;  2R7Z J;  1X4O A;  4ZC3 A;  4PUS A;  2PBI A;  1D5Y A;  2DTZ A;  2RDP A;  1FSH A;  4IPA A;  1JTX A;  1T0F A;  4BNC A;  2LD5 A;  3VUQ A;  4I98 B;  1T56 A;  3DTK A;  5IT3 A;  1BI3 A;  2I5U A;  5JI6 A;  3HUG B;  1KU2 A;  4IQ4 A;  1OIS A;  1IN7 A;  3SDG A;  3U1D A;  1N78 A;  5DCM A;  4GDF A;  1A5J A;  2R5Y B;  2QVO A;  3IRQ A;  1T6S A;  5J1Y A;  3CCM I;  1X1C A;  2D6Y A;  2K4J A;  2AXL A;  2HOA A;  3MMY B;  1LFB A;  3Q5F A;  1S9H A;  2XF7 A;  4JOM A;  3E5Q A;  1M1E B;  1SVO A;  4WXD A;  4MTD A;  3QOD A;  2MD0 A;  5HNH A;  1XB4 A;  2DOD A;  2E1O A;  2ZO4 A;  1PUF B;  2IRF G;  2CWE A;  3LA2 A;  3K0L A;  4A3J J;  4JX4 A;  3RKX A;  1QO0 D;  3KKD A;  2XAF A;  3LNQ A;  4C9Y A;  4LLL A;  2KPM A;  2IA1 A;  3VB2 A;  3VVZ A;  1BJA A;  2K85 A;  3QWL A;  1W5S A;  2JUC A;  2AS5 F;  4BUP A;  2TCT A;  4XRS A;  1W36 D;  2L4M A;  3GTL J;  5EZH A;  2VKD A;  1JKO C;  1GV2 A;  1LDJ A;  5CVU A;  1WJB A;  4P55 A;  3HRT A;  4QPO A;  1WJF A;  4G12 A;  3LFK A;  4BY1 J;  1WKM A;  1XX5 A;  2WBM A;  3AG2 H;  2QBY B;  3DLA A;  2FE3 A;  3DQV C;  2FU4 A;  1O7L A;  2EV5 A;  3PNT A;  3QYB A;  4HQE A;  2BV6 A;  3HOS A;  1JT0 A;  2VAS A;  3CDL A;  2QOP A;  3ERM A;  2FA5 A;  3GFJ A;  3REO A;  5BPD A;  2HNH A;  2DBB A;  2X9D A;  2J5P A;  2IVM A;  3QPT A;  5KVR A;  5HLH A;  3J80 Z;  3CCE I;  3VW2 A;  4YG2 F;  3WTW C;  1BOA A;  3I9V 2;  1FWZ A;  3A03 A;  3L2C A;  3PO2 J;  2DCE A;  2MBF A;  3TQN A;  4MO7 A;  3V4G A;  2LK2 A;  3A2K A;  4JQF A;  4BHP A;  5FKO A;  3G1L A;  4ZYA A;  2VXZ A;  4KMU X;  4MXM A;  3FM5 A;  1X2N A;  3IAM 2;  3M8J A;  4V2G A;  2AQE A;  2WAQ N;  1U0J A;  1K6O A;  5D4R A;  3LST A;  2NP5 A;  4XRM A;  2PMZ N;  1J2X A;  2NOG A;  1R00 A;  3PSI A;  2YX4 A;  2FBQ A;  2HKO A;  2L01 A;  4FET A;  1ON2 A;  4EEF G;  3OYE A;  4HOB A;  4IHW A;  3OYC A;  1BW6 A;  3WHB A;  3MZ8 A;  2DI3 A;  1FIP A;  4YFN F;  3COA C;  2HTS A;  3GLX A;  4ON0 A;  3MD2 A;  3KEY A;  2X51 A;  2HWV A;  3CUQ B;  1ITY A;  1YG2 A;  2OD5 A;  4D7M A;  3K9T A;  2F5F A;  1H0M A;  2FBK A;  2MC4 A;  3VSK A;  2LF8 A;  2M45 A;  3EUH C;  2OV7 A;  3ESW B;  3UR3 C;  3BZK A;  1BN5 A;  2IGO A;  3W2A A;  2VIX A;  5J1U A;  4BJ5 C;  4O6J A;  5CPR B;  2WB1 N;  3IH2 A;  1AWC A;  1C0W A;  3JW4 A;  5FRN A;  5HS8 A;  5CXI A;  2XGX A;  2LBF B;  2Y75 A;  4MEX F;  5F08 A;  3VOD A;  1WWX A;  3A0B C;  3L09 A;  4RB2 C;  3ECO A;  3FRQ A;  2NNY A;  2R3S A;  1BR4 A;  4OIR F;  1KQ0 A;  1S3J A;  3F6V A;  1K61 A;  3ZN0 A;  4KNY A;  4YIF A;  4BDZ A;  1YHQ I;  4DZJ A;  2H6B A;  4F52 A;  4AC6 A;  4XLN F;  1K78 A;  2VOP A;  2LH9 A;  3B02 A;  3K6G A;  1X1B A;  2JN6 A;  3H35 A;  2VUM J;  2LBF A;  5HAW A;  2LKS A;  2AO9 A;  1UB9 A;  3H0G J;  3ABU A;  3GEZ A;  4OIP F;  4FCY A;  3F72 A;  1YO5 C;  3OYH A;  4EGZ A;  2WAD A;  1W7P D;  3QAH A;  2G0E A;  3I71 A;  3FMQ A;  3J7A Y;  2EZL A;  1QPI A;  4K2E A;  2K5C A;  5IP6 A;  2B63 J;  4CCL A;  3BJO A;  4LIT A;  4IO9 F;  4ESJ A;  2CV0 A;  5FRM A;  4ZJZ A;  1NHA A;  3NRV A;  2DFI A;  1PUE E;  1ULY A;  3CLQ A;  2NVQ J;  1YJW I;  1IUY A;  3ZPL A;  1SVL A;  2NXN B;  1S7E A;  5HOD A;  1XGN A;  5CLS A;  3BPX A;  4C2M J;  2E1M C;  3IP4 B;  2DFF A;  1YFH A;  1OCR H;  4DOZ A;  4R1H A;  3HTA A;  4DYR A;  1MJ9 A;  1VQK I;  4JYK A;  2XGE A;  1IV8 A;  1YIT I;  2DA7 A;  2ECB A;  2KKO A;  4EJT A;  1AHD P;  5BQT A;  2UV1 A;  3HSR A;  1T2K A;  1JJ8 C;  1EH7 A;  2JZY A;  1XS9 A;  4CYC B;  2QQA A;  4XQF A;  3VW1 A;  2B0L A;  1B6A A;  1XGO A;  2QUF A;  3B6A A;  3I59 B;  1UAA A;  1H9T A;  1DQU A;  3G1M A;  1O3T A;  3CCY A;  1PJR A;  2ZME C;  3BNI A;  3F8B A;  1YW9 A;  3HTJ A;  3A1Y A;  3VVX A;  1RR7 A;  4NUB A;  4LG0 B;  2LNB A;  5DEQ A;  3PUF A;  4GFL A;  3KP2 A;  3W2W A;  1ON1 A;  3A4C A;  3HTU A;  4RDU A;  4XOT A;  1Y0U A;  3ZQC A;  4CCK A;  2BW3 B;  2VLA A;  5LRR A;  2UZK A;  1CF7 B;  3SEQ A;  1QZY A;  4HNU A;  1GUU A;  2ZJQ F;  4NEL A;  3HE0 A;  1K83 J;  5IYB J;  5HS7 A;  3VYR B;  4BH9 A;  1WCM J;  1OQY A;  1Y1V J;  3E1S A;  4UVB A;  3JTG A;  1ZKG A;  2ICW G;  4XKW A;  4HST A;  1FTT A;  5ERI A;  2CUZ A;  3T8T A;  5IYC J;  2RNG A;  3U21 A;  1G6N A;  3OL4 A;  4HW0 A;  3BTJ A;  3HTH A;  1GDT A;  5LEK A;  2E7X A;  4XLE A;  1J5Y A;  4OD5 A;  4ABZ A;  4AYB A;  3CCS I;  4KMF A;  4LLG F;  1WQ2 A;  2EWN A;  1UFM A;  2FOK A;  3H5A A;  2TDX A;  1W0U A;  3MZH A;  4MHG A;  3HOU J;  4AID A;  3RQ4 A;  5LBQ A;  2R7U A;  1ETO A;  4AVZ A;  1P2F A;  1DPR A;  2IU5 A;  4CYD A;  3G7R A;  2FJI 1;  2P5V A;  2YVE A;  2UXP A;  4W97 A;  3HIM A;  1RIO H;  2K9L A;  3HOT A;  1B8I A;  3IH4 A;  1RUO A;  5EFY A;  3BJ6 A;  2EBI A;  3H1C A;  1LEB A;  3RYR A;  4HNT A;  3FHZ A;  4IX7 A;  5CKT A;  4LB6 B;  4M6V A;  2W57 A;  5ICC A;  2B7E A;  3CZ6 A;  3CCJ I;  4G6D A;  3KYL A;  2CG4 A;  2M9H A;  3NAU A;  5TGT A;  5E8G A;  2L7F P;  1OCO H;  3KEO A;  1XG1 A;  3BTL A;  1Y39 A;  2WA0 A;  1IF1 A;  2PJR B;  1XSV A;  4G94 A;  3BC8 A;  2OER A;  3IC7 A;  2PJR A;  1MBK A;  5FB2 A;  3E6C C;  2IAI A;  2LOO A;  1FOX A;  3P9K A;  2ID3 A;  2K27 A;  3ZMD A;  5E1X A;  3BG5 A;  1X1A A;  1IV6 A;  2FBH A;  2H1L A;  3TL4 X;  2CUE A;  2OUM A;  4UV8 A;  4A93 J;  2HQN A;  2YSR A;  4PJL A;  1BI1 A;  2XB0 X;  4X1E A;  3N97 A;  3DU6 A;  3L2W A;  1QZZ A;  3S14 J;  1K7A A;  4N4N B;  3ECH A;  1MJB A;  2W7N A;  3PFY A;  2M0M A;  4AF5 A;  4Y33 A;  3HL2 A;  2L3D A;  3EYY A;  4X0G A;  3OYA A;  4XN0 A;  1Z9C A;  1GV5 A;  2ELK A;  3IV5 A;  1LE8 B;  4XN3 A;  3WTX C;  1BBY A;  3FM3 A;  3QP5 A;  1IUF A;  1WHU A;  2DOF A;  1R5H A;  1P9Q C;  1JUS A;  3JAM K;  2YVH A;  2LYC A;  3E5U A;  5D19 A;  1T08 B;  2DK5 A;  4JBA A;  4F55 A;  1MND A;  3LSI A;  2PG4 A;  1I50 J;  3CMM A;  4P96 A;  2CQN A;  3H5R A;  3CP8 A;  5FD6 A;  1HKQ A;  2R0Q C;  2DO7 A;  4X6A J;  3VVY A;  2DW4 A;  2K3P A;  1PVE A;  2PZ9 A;  4Y17 A;  2F6C A;  4XSZ F;  2DJN A;  3JRA A;  5L3G A;  1Z0X A;  1WRJ A;  3RQI A;  3WTY C;  3SZT A;  1UHW A;  4FT8 A;  1TC3 C;  1Z3Y A;  4L9V A;  5HS9 A;  1MGT A;  3QQA A;  1KZH A;  2IS1 A;  2EH3 A;  2YX7 A;  1W7P A;  2IGN A;  2IS4 A;  3KZI C;  2HEO A;  1RC9 A;  5FRO A;  1SEU A;  2MGQ A;  3GTQ J;  3D0S A;  1MNM C;  3LSK A;  4Y13 A;  3KZZ A;  2L7K A;  4M9Z A;  2LP0 A;  4MFD A;  2STT A;  1FBU A;  2PX9 A;  2VJ5 A;  3PPB A;  1LNW A;  1NK3 P;  1F36 A;  2XRN A;  1H9G A;  2HU9 A;  5C44 J;  1FYL A;  1VQ9 I;  1ZRF A;  3KPH A;  3JRF A;  3CCR I;  4GCV A;  4EMS A;  1IRG A;  3FDY A;  3GTM J;  3QYF A;  2RKH A;  3WHC A;  1V5E A;  5GAH J;  1LQ1 A;  3F8F A;  4RAF A;  2NOJ B;  2R7S A;  2HTJ A;  1TNS A;  2G7G A;  2X48 A;  3LWJ A;  4UXN A;  1SFK A;  2BVL A;  4XOP A;  1TWF J;  2ZCW A;  3WG9 A;  1G2H A;  3H9Q A;  4ZYG A;  5IOZ A;  2CUF A;  2YU3 A;  1W1W E;  2A68 F;  3KP4 A;  2W48 A;  4W1U A;  2G7U A;  2CV1 A;  1ACI A;  2BHY A;  2EA4 A;  1Y6I A;  2E2I J;  2CW8 A;  5DS9 A;  2LSO A;  3DP7 A;  2WY7 Q;  5F04 A;  2HPI A;  3K4C A;  2UXO A;  3FXM A;  4OAZ A;  4XON A;  4FX0 A;  2BY0 A;  2Q24 A;  3VOX A;  3VFZ A;  3TBI A;  2CJJ A;  1D8K A;  4P5O A;  1G3W A;  3H0D A;  5D5X B;  1WJD A;  3I55 I;  5IT9 Z;  1H88 C;  2NS0 A;  4EJO A;  1YW7 A;  1WJC A;  3OYI A;  5BOX A;  1ZG1 A;  4BE1 A;  3ZRG A;  1X3W B;  2HQA A;  2WAQ A;  3S3O A;  2WUI A;  2R5Y A;  3ELK A;  5J40 A;  3LSH A;  3GO5 A;  1XD7 A;  3S5R A;  1JJ6 C;  1S7O A;  2STW A;  4C2T A;  1QNT A;  1P7J A;  4XKB A;  3BP8 A;  1DDN A;  3JRG A;  4WIB A;  2DQR A;  2M87 A;  3FX3 A;  4IRI A;  1B72 B;  1SAX A;  3S1Q J;  3JCU C;  1AU7 A;  3MEX A;  1KYZ A;  2X1E A;  1AKH A;  2KIU A;  3SQN A;  1HCR A;  5CJ9 A;  2PMZ A;  4OD4 A;  1WI9 A;  1HDD C;  1APL C;  3IWF A;  4C3J J;  2R7W A;  4KA4 A;  3SXY A;  2R7O A;  4CH7 A;  3DKW A;  2V9K A;  5HVQ C;  2RVC A;  3WGI A;  3W6J B;  4GRI A;  4NN1 A;  2E5Z A;  1FJL A;  1I1G A;  1FOY A;  1WVR A;  5B1A H;  3WTZ A;  3ZMU A;  3FXQ A;  2RAE A;  3J81 Z;  2IW5 A;  2DTR A;  3JRH A;  4HNV A;  3DPT A;  3A01 A;  1BC7 C;  4B43 A;  3FXR A;  2LVS A;  1FEX A;  1U2W A;  4JX5 A;  5JR3 A;  2KFD A;  2KDO A;  2R7F A;  4JL3 A;  3HSF A;  3BR6 A;  2ZOY A;  3GTJ J;  5J6X A;  1OCP A;  1N77 A;  3P7N A;  1FPQ A;  3F9K A;  5GTI C;  5KK1 A;  2L5Q A;  2CO5 A;  2IGK A;  1RES A;  2Y9Z A;  2UXH A;  4D5F A;  1Z21 A;  5LGU A;  2VQG A;  2E5N A;  1DGW Y;  4CZZ A;  4IVN A;  1IXC A;  1BM9 A;  4A3B J;  3K70 D;  2DQL A;  3P9T A;  2G9W A;  5F64 A;  3OYN A;  4AWX B;  3ZQG A;  3NAR A;  4UB8 C;  1YIJ I;  1RRJ A;  3FKJ A;  1B9N A;  2MFZ A;  4ZYH A;  3ZMZ A;  2F5V A;  4M72 A;  4GO1 A;  3WTT C;  2D2W A;  5E17 F;  2H8W A;  1O4X A;  3LSP A;  1L0O C;  1I27 A;  2HZT A;  2CQK A;  3IAS 2;  3G71 I;  3U9G A;  2CMP A;  1ZRC A;  3FKI J;  4A3E J;  4HBL A;  3AKZ A;  2XAH A;  4L9J A;  2HXI A;  2MD5 A;  5BS6 A;  3MVP A;  1YYV A;  2VC1 A;  3CCQ I;  4DJA A;  2KRC A;  1HKT A;  2BGC A;  5CVV A;  1U8B A;  5DCM B;  1IN5 A;  3LL7 A;  4XIC A;  3GWZ A;  1TWH J;  3GME A;  3HJE A;  4ETS A;  4AUX A;  2NS7 A;  3Q0V A;  2VBZ A;  2L9N A;  4RGS A;  3MFK A;  1ONV A;  3C3W A;  3JRC A;  4MLO A;  5LLQ A;  2GIZ A;  1I6H J;  4JKZ A;  4MQ9 F;  2W53 A;  1MJA A;  3CDH A;  1D0X A;  2R5Z A;  1JUP A;  2BXZ A;  1DGR M;  2E35 A;  4M9S A;  2ZSI B;  2IXS A;  3CC7 I;  4M73 A;  1SVM A;  2H09 A;  1HC8 A;  1LVA A;  1R6R A;  4L5J A;  4XRS G;  2RQQ A;  3R0A A;  2GBY A;  4XLH A;  5FLV A;  2DMQ A;  4BAY A;  5DUI A;  4IF4 A;  3E6B A;  5ILS A;  3IRR A;  3CUQ A;  2FNA A;  2ZME A;  1WJE A;  4N9H A;  2IA0 A;  1F9N A;  4ZZD A;  4DZP A;  2QQ8 A;  1TW2 A;  5EEH A;  1T0F C;  2K86 A;  4UUS A;  4E7L A;  3PNV A;  2FQ4 A;  3RKQ A;  3VOE A;  3S17 J;  1Y0N A;  3IUO A;  3O3K A;  2F48 A;  5FFX A;  4EJV A;  4RAY A;  4CSW A;  3CJQ B;  2HVQ A;  4DVY P;  4HPQ A;  3SFI A;  3OL3 A;  3DBL B;  4ESF A;  5LHH A;  1VQ4 I;  1R7J A;  4L0Z B;  3S32 A;  3G56 A;  1QVU A;  3BG6 A;  5GTH C;  1FYK A;  1W7P B;  5F0F A;  4CUG A;  1PYV A;  4MNU A;  4BAC A;  2UXI A;  4A3I J;  3NWT A;  1R5G A;  2MC3 A;  4PJN A;  2EIN H;  5EEG A;  2NVT J;  3ZXS A;  3TDU C;  3QPH A;  3MCZ A;  2X6X A;  3ABL H;  3AFH A;  3ZP5 A;  3EGQ A;  1F4K A;  2H27 A;  4RM3 A;  4FE4 A;  4F7Z A;  4GFB A;  5FFZ A;  3KZY A;  2X1C A;  3I3L A;  3OSG A;  3LA7 A;  5C4J J;  2L9R A;  3VDX A;  2PJP A;  4XLC A;  4U0V A;  1JHH A;  4HLY A;  1ZTR A;  3LWF A;  5A2Q Z;  2QEX I;  3F23 A;  2MH2 A;  1P7I A;  1RKW A;  2CRG A;  2VB6 A;  4PGG A;  4U88 A;  3K4M A;  5K7Z A;  2ZFU A;  3BJA A;  2HFH A;  4FTH A;  1ZQ3 P;  1P92 A;  2HQ5 A;  4U87 A;  2PFV A;  4U0W A;  2LC2 A;  4OAY A;  2H6C A;  3LFU A;  1STZ A;  5JFR A;  1F43 A;  3HG9 A;  4J00 A;  1YRN A;  3DFG A;  5AQC A;  2ISY A;  3D5L A;  2ME0 A;  3G2B A;  2G3B A;  2XPW A;  3LAP A;  3AL0 B;  2Q2E A;  3MZY A;  1IRX A;  2IGM A;  2FEZ A;  3D5S C;  4EJW A;  4A3G J;  1D1B A;  2LDU A;  2WTE A;  3PAS A;  3HRM A;  4XMY A;  1IRZ A;  4G6Q A;  2OJE D;  5CW8 A;  2K9N A;  4EM1 A;  5F27 A;  2VN2 A;  1FY7 A;  1ORK A;  2CFX A;  1ZGA A;  2O8K A;  4ZYE A;  2LRD A;  2HDD A;  3M7G A;  1P4X A;  5ED4 A;  1MH4 A;  4DYC A;  2QCO A;  4NB5 A;  5DDG A;  1WH7 A;  5AON A;  2HKX A;  3SEZ A;  4EGY A;  1S6L A;  3NI7 A;  3S2D J;  4Q4Z F;  1JHF A;  3F3X A;  4BEH A;  3ANG A;  2JPC A;  1EJ9 A;  1VQ6 I;  4BE2 A;  1KU7 A;  1YW8 A;  2CW7 A;  3E3V A;  4E70 A;  2X6Y A;  3KP7 A;  2DA6 A;  2JVG A;  4ASN A;  1BJZ A;  2HPM A;  1UCR A;  1X1D A;  5B66 C;  2DFE A;  1YQA A;  2XAQ A;  4G6T B;  3CLO A;  1BR1 A;  1UZC A;  4E7J A;  1QQI A;  4CGR A;  5FO5 A;  1TQP A;  1W0T A;  2A6E F;  5D1R A;  3G3Z A;  2QSF X;  1MBJ A;  1JTY A;  4L9N A;  2GWR A;  2OQR A;  4R8H A;  1QA6 A;  3RI4 A;  2ID6 A;  3LQR A;  4E7I A;  2O6G E;  3VSL A;  3C2B A;  3RPU D;  1NG7 A;  3GTG J;  2V4J C;  4NBQ A;  4KN7 X;  2EK5 A;  1OYY A;  1R4N B;  5LEJ A;  4BY7 J;  3M3Y J;  5KAF C;  4DNC A;  5D5U B;  5K58 A;  2OCE A;  3TW7 A;  4PSX A;  3ERE D;  2XDN A;  4MQV A;  2KRH A;  3QPS A;  2H1K A;  1X4P A;  1OYI A;  4HV6 A;  3OS1 A;  2JA7 J;  4G7O F;  5M3M J;  4XK4 A;  1YJ9 I;  2QM3 A;  3CO7 C;  5HLI A;  1TNT A;  5F6F A;  1XTA A;  2M8G X;  3K4B A;  1S72 I;  4BHC A;  1T8I A;  1Y8Q B;  2DT6 A;  3M1C A;  4BBR J;  3TDZ C;  1FYM A;  5B5E C;  5BPI A;  3I4P A;  2VKH A;  3PL8 A;  1UI5 A;  4EJU A;  2LMD A;  5DD8 A;  3KLO A;  1I6X A;  1U8R A;  3B81 A;  3SJM A;  1OYW A;  3ULQ B;  4ZDL A;  5D4S A;  1IW7 F;  2NRA C;  1EKE A;  1LDD A;  1DP3 A;  1IAW A;  1LE8 A;  3CRJ A;  2BZT A;  2NNN A;  3QU6 A;  3DKX A;  4P1W A;  3WU2 C;  4EAT A;  2AXT C;  3WU0 A;  3UKG A;  2BBY A;  4JK1 X;  4L18 B;  5IP7 J;  5K7H A;  2PMH A;  3HGY A;  5AIP A;  3DU5 A;  4CYC A;  2JPB A;  2M5W A;  5LRS A;  2PLY A;  2GAU A;  2CQQ A;  3B73 A;  1CF7 A;  4FE7 A;  1FOK A;  4XKC A;  2OPT A;  2O5R A;  4C3I J;  2XUB A;  1IXS B;  4PCQ A;  2JQ7 A;  1BC8 C;  2DDB A;  2VT2 A;  5D5W B;  4RGR A;  3RD3 A;  1G4D A;  2CQX A;  2G7S A;  4GYG A;  4E7Z A;  2R5Z B;  2VKV A;  5IYD J;  2XDV A;  2L2O A;  5E8I A;  2O7T A;  5L3F A;  1B72 A;  4CHU A;  4II3 A;  2M30 A;  2Q2E B;  5E3N A;  2LY9 A;  4AIK A;  2ZB9 A;  2X6W A;  1ZRD A;  2DU9 A;  5GP9 A;  4AVP A;  4BEH B;  4A6D A;  5GAE J;  2L9S A;  2QKL B;  1QPM A;  4XKV A;  3EUH A;  1ZR2 A;  2JA5 J;  1Z67 A;  1I3Q J;  3ML6 A;  3VYS B;  2NVX J;  1E3H A;  4M9X A;  1RZ4 A;  1YX5 A;  5F0C A;  3KLN A;  4V19 K;  1JXS A;  2V9V A;  1MIJ A;  3HHG A;  5HDG A;  2RRE A;  4NQW B;  1U5T C;  3SFZ A;  4XLF A;  4XNF A;  5HSZ A;  2HYT A;  2Q8K A;  3QYE A;  2BYV E;  1YE9 A;  3ASN H;  3OYK A;  2HVR A;  2ZCN A;  4GCL A;  2DA2 A;  2HZD A;  2X1D A;  4U7B A;  2Z16 A;  3K1N A;  2O03 A;  4LGW A;  4XM3 A;  4RAG A;  1W5C C;  2BEO A;  4HDV A;  1O3R A;  1B8I B;  5HBU A;  1HBX G;  2VJ4 A;  3ZQF A;  1A36 A;  1P4A A;  1WJA A;  1R22 A;  2ZJP F;  3VEP A;  4XL9 A;  3PIO F;  4CZC A;  5HLG A;  2M7A A;  4AC0 A;  4QLC U;  2QWW A;  1MMS A;  1V55 H;  3CME I;  4G7Z F;  2A5Y B;  4EM2 A;  1TWC J;  3BTI A;  1BI2 A;  5C3E J;  2W24 A;  3TGN A;  1LB2 A;  2CV2 A;  4GYI A;  2KP6 A;  3H9J A;  1HQC A;  1FSE A;  3JSP A;  3BG7 A;  3HHH A;  2PEX A;  1E17 A;  3NNR A;  4NC6 A;  2VBY A;  3KET A;  2XPV A;  3JSJ A;  1VQP I;  5JHF A;  2A69 F;  3Q9V A;  3OYG A;  3K7A J;  3HPG A;  3ASO H;  4RAZ A;  3SZP A;  2ELJ A;  1GT0 C;  4L9T A;  3BRO A;  3ZQ7 A;  2GEN A;  2B9S A;  5LFA A;  3BJB A;  2W84 A;  3BZC A;  2BY1 A;  3S2W A;  1A31 A;  2W4S A;  1N75 A;  2JVH A;  4FQG A;  1WSU A;  1TWG J;  4BXX J;  3KIO A;  4DBR A;  1U5T B;  3DXJ F;  4A3C J;  1EH6 A;  2X4H A;  5EG0 A;  2GOM A;  4ZTF A;  3DWL E;  4PFO A;  4ZTJ A;  2GA1 A;  3V7S A;  4GCT A;  2EIL H;  2H94 A;  2DXI A;  1XCV A;  3EPZ A;  3SHF A;  1D1A A;  1T95 A;  1JKP C;  3V8K A;  4AU7 A;  3NEU A;  1W5T A;  4Y52 J;  2COB A;  2IPQ X;  3BR0 A;  2JSC A;  2HOT A;  4AM3 A;  1RPW A;  2NVU B;  2D5V A;  1VTN C;  3NXC A;  4DGW B;  2J5O A;  2LTP A;  5GAG J;  2QF7 A;  1K4T A;  1FZP B;  1J9I A;  4KFC A;  1S7A A;  4BJ6 C;  3CF2 A;  3I4M J;  2DA5 A;  3F8C A;  2E1C A;  3L2Q A;  3CMA I;  4M3B A;  2D1H A;  2ZXI A;  2G7H A;  2DPU A;  1Z3X A;  1HA8 A;  1F5T A;  3QKX A;  5J4Y A;  4LG0 A;  5E1Z B;  4BQO A;  1MMD A;  1Z91 A;  4YZE A;  3CJN A;  2PI0 A;  3IH3 A;  1SD4 A;  3FXU A;  4A6E A;  3K4N A;  3IWZ A;  1NG6 A;  2COM A;  4IOA F;  1PP8 F;  1ZLJ A;  2EFO A;  3OS0 A;  3HUG A;  3W3C A;  5DM7 F;  1K78 B;  2HOE A;  5DUK A;  3P5J A;  4M3F A;  5L3D A;  3ZMT A;  1R9T J;  1Z6T A;  2QSG X;  1R1T A;  9ANT A;  1TLH B;  5JLX A;  1VQM I;  3T1B A;  1MBH A;  1SD5 A;  2JRT A;  1BIA A;  2M4K A;  3GW2 A;  1J59 A;  2JA2 A;  4IHY A;  1IZ1 A;  2WWY A;  1TTY A;  3E97 A;  4C2U A;  3RZO J;  3T6N A;  1R5I D;  1SFX A;  2JMW A;  3DPL C;  2LLK A;  1QRY A;  3EYI A;  3GTP J;  2F4M B;  4DW6 A;  2NAZ A;  3F0C A;  2WV0 A;  3I56 I;  1VQN I;  1V4R A;  3MQ0 A;  3S1M J;  4A5N A;  4B09 A;  1HW5 A;  2IJL A;  3NWS A;  1H89 C;  1SFE A;  1FMV A;  1E3P A;  4A12 A;  5EG0 B;  4UUT A;  5ICF A;  1ZGW A;  1ZEL A;  5TJJ A;  4DYQ A;  2DG7 A;  2K7L A;  3FBN B;  2GXB A;  1IN4 A;  3BG9 A;  3FHN A;  2EFP A;  1IDY A;  2CSO A;  3M8F A;  2HKU A;  3I4N J;  1QBJ A;  2EFN A;  3EDP A;  4KT5 C;  5E1W A;  2IS6 A;  3O2P E;  1KGS A;  1ZG5 A;  2Q0O A;  3RIR A;  1MMN A;  2L0K A;  3M1E A;  3TP3 A;  4HDU A;  4CCO A;  1A35 A;  2P5L C;  4C2M A;  3R4K A;  2VKE A;  5J1R A;  5FKK A;  3VYT B;  5JHU A;  2LRE A;  1FC3 A;  5EDN A;  2DOA A;  2DPD A;  2KIS A;  5E3L A;  1YX3 A;  3SWH A;  4MEY F;  5EGO A;  4GFK A;  3DCF A;  1S5L C;  3KFW X;  1WH5 A;  2Y9Y A;  1PP7 U;  3WG7 H;  4M3G A;  4A0X A;  5J4V A;  2QYO A;  5DAJ A;  5F0H A;  2IA2 A;  2XB5 A;  3LQQ A;  4UB6 C;  3CCV I;  3F21 A;  2L9V A;  2DMP A;  2FF4 A;  2XPU A;  2REK A;  3VYU B;  1W4M A;  5HLT A;  2MYS A;  2ZCM A;  4KIC A;  3BR3 A;  3EUK L;  4LOC A;  2ZCX A;  1FIA A;  2FUG 2;  5BNG A;  4CA0 A;  5A2Q K;  5LHI A;  5J8C A;  5EGO B;  3RH2 A;  1TT5 B;  5DCF A;  1IC8 A;  5LD2 C;  2P0W A;  2GM4 A;  3BRU A;  3JSO A;  4RA2 A;  1ZK8 A;  2P6S A;  2GUH A;  4B4C A;  3AG4 H;  4MGR A;  2P6T A;  4KIG A;  3QPL A;  1OCC H;  2Y48 A;  3H9G A;  4LIV A;  1X2M A;  1ETQ A;  3KP5 A;  4KT6 A;  3X2Q H;  2EZH A;  1RUN A;  2GA2 A;  4E4H A;  1JGG A;  2R92 J;  2ZJ2 A;  3AL0 C;  3S8P A;  2MLG A;  4LB5 A;  1FNN A;  4GCK A;  4DIQ A;  1O57 A;  2V7F A;  2KL4 A;  2HYG D;  4BKX A;  2XC7 A;  2UWM A;  2RHA A;  3A01 B;  3S15 J;  3E7Q A;  5EF6 A;  1A04 A;  2Z5U A;  3G1O A;  1T33 A;  2EV6 A;  5L3B A;  4ITV A;  5J3L A;  3RKY A;  3F8M A;  1YOV B;  3ZQH A;  4LFU A;  3SYT A;  3QRF F;  2B3W A;  2GLO A;  3BZ6 A;  2XKP A;  3HM5 A;  4I2O A;  4F93 B;  5DV5 A;  3E0J B;  1HST A;  4HLX A;  3K4J A;  3DBH B;  1VFC A;  5K5Q A;  3HYI A;  3H3Z A;  5FLM J;  3G73 A;  4PZJ A;  4KWA A;  2O9L A;  4B44 A;  2W1O A;  3LHQ A;  2OI8 A;  1F1Z A;  3K2A A;  5F1R A;  3DEU A;  3DPU A;  3N05 A;  3WOD F;  4UHT A;  2D45 A;  1XCB A;  4LJZ F;  2HYF A;  4S04 A;  3SDB A;  2KMU A;  3S2H J;  5CQE A;  1ETW A;  1B4A A;  3LSR A;  1KYW A;  4WWC A;  4L5I A;  4JX6 A;  5FMP A;  3L2R A;  1K6Y A;  2QKO A;  4KUM A;  2M0C A;  4C30 A;  5ILV A;  1ZLK A;  2DG8 A;  3GLL A;  3Q3S A;  2WAE A;  4HYE A;  2JTV A;  2P7V B;  3OOU A;  5E18 F;  2W85 A;  2YS9 A;  1HKS A;  2OU2 A;  2OTJ I;  2E1M B;  4KN4 X;  1YLF A;  5FKM A;  3WGG A;  3J7A O;  3GYH X;  1JI8 A;  2PBX A;  2R7D A;  2W00 A;  1AKH B;  4R79 A;  2BHZ A;  4M3D A;  3TKY A;  3M9A A;  1E3O C;  1EH8 A;  2PQ8 A;  4P9U A;  4IHX A;  5ILU A;  4YFX F;  1A6I A;  1QHH D;  2A3S A;  3E7L A;  1FOW A;  3OY9 A;  3HOZ J;  1OKR A;  3QBM A;  1WJ5 A;  3K70 C;  2OC6 A;  3AG1 H;  1G3T A;  1OJL A;  4TV7 A;  4PSW A;  5K5O A;  3BQZ A;  3OV8 A;  1BA5 A;  4LLN A;  3DV8 A;  4UVC A;  2M8E A;  2VJJ A;  2LFB A;  4FIS A;  3OS2 A;  2DYS H;  2OQG A;  1TWA J;  1K4S A;  2Z9O A;  3S1R J;  4CDG A;  1MBE A;  3O6B B;  1GVJ A;  5E20 A;  1KU9 A;  2L02 A;  3HB9 A;  3KCC A;  2CFO A;  2D1V A;  1IXR C;  3CC4 I;  2R7T A;  3GEU A;  3A02 A;  3CDI A;  6PAX A;  1YS7 A;  2ZME B;  1SAU A;  1REP C;  2QWT A;  1MMA A;  4PK4 A;  4LMY A;  2LF7 A;  4IRH A;  4BXU A;  3G6E I;  4J01 A;  4XRF A;  3GFI A;  1XPX A;  2KJB A;  2OZU A;  2M4G A;  3BCB A;  2OCC H;  2HS5 A;  5EYR A;  4O5V A;  1Z05 A;  3Q9S A;  3TOA A;  1O7F A;  1Y8R B;  2DA4 A;  3PQJ A;  5FKN A;  3F22 A;  3MNL A;  2RNJ A;  1IG7 A;  1DU0 A;  5AIQ A;  2E36 A;  3OIQ A;  2HQR A;  1IJW C;  2WC2 A;  3WTU C;  3R6S A;  3CCU I;  4G9Y A;  1QZE A;  4PFP A;  5M5W J;  2NX4 A;  5C4Y A;  2Z33 A;  2FX0 A;  2R7V A;  4M6Y A;  2XSJ C;  1ETV A;  5D18 A;  1OR7 A;  2EV0 A;  5C4X J;  1JUM A;  4D9J A;  4ZDO A;  2VT3 A;  4HF1 A;  3OSF A;  4L0Y B;  3W6V A;  3K8P C;  3HKZ A;  2M1B A;  3T0Y A;  3FMR A;  4JP0 A;  1FT9 A;  2RC4 A;  2LKP A;  2X6O A;  3MKL A;  1U9N A;  2Z2S B;  4ENM A;  4B8X A;  3F8N A;  4UY8 I;  4BBS J;  3OYM A;  1XMX A;  1TW3 A;  1MD0 A;  2QKM B;  4LIU A;  2HVS A;  2P8T A;  4IL6 C;  3S93 A;  1QVT A;  1XN7 A;  3CQZ J;  4I0A A;  4WXC A;  3ZMS A;  1W36 C;  2XF5 A;  3HRU A;  3PSF A;  3VOK A;  2FNP A;  3KX2 A;  1JT6 A;  5TRD A;  4YEL A;  1RR8 C;  4B47 A;  3AG3 H;  4U7D A;  1ZR4 A;  1I3A A;  2R93 J;  1TQM A;  4AD9 A;  2QQ9 A;  4PXI A;  3FXK A;  1NTC A;  2XRL A;  3EUP A;  4QPQ A;  2ETH A;  1D0Z A;  4MTE A;  4ANJ A;  3PIP F;  3ZQL A;  1E0E A;  2Y0S N;  3BPV A;  2FSW A;  1FLI A;  1ODD A;  3DTI A;  3AAF A;  2FXA A;  1IRF A;  2JWT A;  1MH3 A;  1OR7 C;  2BE5 F;  2ZC2 A;  4BQA A;  4ACI A;  3PQK A;  2DN0 A;  2RV8 A;  1SGM A;  4I99 C;  3V42 A;  4D1Q A;  1BIB A;  1X1P A;  4QTR A;  3CUO A;  3OWT A;  1ZG3 A;  3ABT A;  3JRI A;  3PJR A;  4KYW A;  5D8L B;  2QZ8 A;  2ELH A;  3CJT B;  3FK7 A;  3K69 A;  1DP7 P;  3GBG A;  1XDU A;  4Q5S F;  2EZI A;  1S29 A;  2LG4 A;  2K4B A;  4OOI A;  4Y4R A;  1LFU P;  3ISP A;  5D6F A;  4S05 A;  2MSY A;  5HDK A;  1D3Y A;  3OYB A;  1ZGJ A;  3L00 A;  1POG A;  2QEN A;  3JRE A;  3WTS C;  5J8F A;  4FAS D;  2DDA A;  3T8R A;  3MAJ A;  4B3X A;  2RQP A;  2EQR A;  3FF5 A;  2X0L A;  2R4G A;  4B48 A;  5KNL A;  1JE8 A;  2E1N A;  4HX4 A;  4OMZ A;  5JVT A;  2JA6 J;  4Y3O A;  5FLX K;  2GIV A;  4KDP A;  4BS9 A;  2F2E A;  4BHB A;  2XSD C;  1B1B A;  4HKU A;  3M4O J;  1TZL A;  4YEJ A;  2ESH A;  1ETX A;  2ZXH A;  4BGD A;  3HRS A;  1GVD A;  3RZD J;  2E2J J;  1UHS A;  5DD4 A;  2MA3 A;  2R7R A;  1MNE A;  1UST A;  3HZJ A;  2QBY A;  4KJZ A;  2TRT A;  4A2U A;  2A5W A;  2V26 A;  1ZHF A;  2N8G A;  1T98 A;  1NH3 A;  1KON A;  3TP0 A;  1CQT A;  3GZ5 A;  2A07 F;  3L1P A;  2EIM H;  2M7B A;  4HF0 A;  1Z7U A;  2NP3 A;  4HA8 A;  4CCM A;  4LG3 A;  3VW0 A;  1LJ9 A;  2BY2 A;  2ZOZ A;  1SMY F;  3C18 A;  4I6Z A;  1YTY A;  1UHM A;  1HOM A;  1RI7 A;  2C6Y A;  2W25 A;  4MFE A;  3O8G A;  3FMS A;  3OYL A;  1R1U A;  3I54 A;  4ENJ A;  1OMI A;  3LA3 A;  4QIW N;  2ZXW H;  1J75 A;  2V1U A;  2V6C A;  1R36 A;  4HSR A;  2IT0 A;  3KP6 A;  1G3S A;  2I10 A;  3W6K B;  5F1J A;  3IL2 A;  2CW0 F;  3DEE A;  2HDW A;  4G7H F;  1LFP A;  1O3S A;  1LEA A;  3I5U A;  2YVX A;  1SD6 A;  3BDD A;  3ONQ A;  1OCT C;  2F07 A;  2EIK H;  3PM1 A;  3VWB A;  4J19 A;  5E79 C;  4HV5 A;  2XIG A;  1D0Y A;  2KZV A;  3NQO A;  1V5G A;  2A2F X;  5L3E A;  4LK0 F;  3JRD A;  1Z7L A;  5JLW A;  3J80 K;  1R58 A;  1R4M B;  3V7C A;  5EZG A;  2KIQ A;  4A5M A;  3GVA A;  4RLQ A;  3CF5 F;  1XSD A;  1HW2 A;  1N25 A;  3OOP A;  4PGH A;  2VI6 A;  3LSM A;  3C2G A;  1D1C A;  2GFN A;  3AQS A;  4OMY A;  3HTI A;  2ZFW A;  2Y31 A;  5CQG A;  1V5F A;  1QGP A;  3F6O A;  2XAS A;  3RDI A;  2BW3 A;  1UG0 A;  4N0B A;  5CYV A;  3RPU A;  4A3L J;  2VQH A;  1SMT A;  3HGG A;  2EPF A;  2K40 A;  3ROU A;  3V8L A;  5BMZ A;  2YR2 A;  4RB3 C;  3J7Y J;  5LGT A;  1GXP A;  1V54 H;  2HI3 A;  3TOB A;  3FXO A;  1U3E M;  1SD7 A;  3CP2 A;  2CUJ A;  4UV9 A;  2Z1D A;  4ESB A;  3RCO A;  4BL0 B;  4Y7N J;  2RAS A;  1YRN B;  1UMQ A;  3FXJ A;  4IOC F;  4RM2 A;  4JNN A;  4CXF A;  2DK8 A;  2PN6 A;  4IHT A;  4V2F A;  3KYD B;  2QLZ A;  3K4K A;  1VZ0 A;  3LSG A;  1TT0 A;  2ZKZ A;  3HXL A;  3MN2 A;  4I01 A;  4NC8 A;  2NVY J;  2V79 A;  3KKC A;  3GTO J;  4XBF A;  4IQJ A;  2VPR A;  3KYC B;  4NHJ A;  2NS8 A;  1MDM B;  1AA7 A;  2OF7 A;  1T38 A;  2F4I A;  2VQC A;  3LOC A;  2NYX A;  2JRM A;  4A3D J;  3GFM A;  3QP6 A;  2YPR A;  5H20 A;  1HSJ A;  3DF8 A;  4ZYD A;  4IHS A;  3HBL A;  4D0P A;  2E2H J;  3BG3 A;  2RGV A;  2VXD A;  2Y0M A;  2E34 A;  1BR2 A;  2MW8 A;  1D5V A;  2LY2 A;  1R23 A;  4BDY A;  4UUS B;  2Q1Z B;  3H92 A;  3WE3 A;  4D5C A;  4A0Y A;  1DPU A;  2AHQ A;  2V6E A;  4IEJ A;  5K1Y A;  1AOY A;  5J47 A;  2GQQ A;  4A3F J;  3ZMV A;  3GZN B;  2CU7 A;  2CYY A;  3NPI A;  3LAJ A;  4XLP F;  2XGD A;  2KLO A;  3M07 A;  2EIJ H;  3HOW J;  2M34 A;  4A3K J;  4BQQ A;  2KRF A;  2DYR H;  3DKY A;  3CC2 I;  2JJ7 A;  4AIJ A;  2Z99 A;  3ZN1 A;  1J0R A;  4DBQ A;  5IOY A;  5FHP A;  2DA3 A;  3K1M A;  4F92 B;  2P7C B;  2HYJ A;  4YRV A;  4BJT A;  1GLN A;  5DM6 F;  3GX4 X;  4HAM A;  2OA4 A;  4L5E A;  2VON A;  1CGP A;  2QTQ A;  4PJM A;  4CCJ A;  5FJ8 J;  1TBX A;  2K9S A;  5IP9 J;  1HDP A;  2KJC A;  1P4W A;  3OR1 C;  4I02 A;  2KIF A;  4P9F A;  1U78 A;  1HF0 A;  4M6X A;  1XGM A;  5CVR A;  3VTI A;  2ADU A;  2KT0 A;  2XVC A;  3FBI B;  3GZ6 A;  4IZZ A;  1BOB A;  1J09 A;  2WV1 A;  4U9N A;  3V78 A;  2F4O B;  1VQO I;  5IT9 K;  2ZNY A;  4BU2 A;  1PDN C;  1HXD A;  2DMU A;  2K9Q A;  2VL8 A;  3EET A;  4I7H A;  1HW1 A;  2P4W A;  3P9I A;  1JKR C;  1VQ5 I;  3ON2 A;  2F5D A;  2WGB A;  2EA2 A;  2WB1 A;  1ZAO A;  5KHD A;  2XRO A;  2YU9 J;  1G59 A;  3HOY J;  1IN6 A;  1ENH A;  4M74 A;  3U2R A;  3OYF A;  3DLL F;  3BR5 A;  4NC7 A;  2MG4 A;  3FZV A;  3QOE A;  4RB1 A;  1R49 A;  3AQT A;  3GXO A;  3K2Z A;  5B1B H;  3R0J A;  3TO7 A;  3MKW B;  2QGU A;  2KZG A;  1BL0 A;  3COL A;  1OCZ H;  3E5X A;  4RLF A;  2XAJ A;  2VPL A;  1YIO A;  5FGL A;  2H8R A;  2XAU A;  5B3S H;  3FXL A;  1SFO J;  3I64 A;  4IHV A;  2W82 A;  1BI0 A;  3C1D A;  2DA1 A;  4BE0 A;  2V9P A;  5D8K B;  2EZK A;  4A0Z A;  3CES A;  4CIC A;  5KCM A;  1P6R A;  2Y2Z A;  1L3L A;  3BR2 A;  2FD5 A;  2DMN A;  2VQL A;  2ME6 A;  3CCL I;  5CVI A;  1Q1V A;  1VQ7 I;  1MSF C;  3D5R C;  4ENN A;  4EVI A;  1VND A;  4IJA A;  4HZF A;  4ZDP A;  3TW6 A;  2OAZ A;  3UNG C;  3BCG A;  1JGS A;  3GFL A;  3I0T A;  1OPC A;  4CCN A;  4E7S A;  4A69 C;  1ERD A;  4Q47 A;  3V8J A;  2ZNZ A;  3RTR A;  3FIS A;  2A05 A;  3DPJ A;  3L9F A;  4II2 A;  1MSE C;  3L2U A;  4UUV A;  1VF9 A;  4LK1 F;  3R60 A;  3MKZ A;  2GXA A;  1J7K A;  3CJR B;  3LSJ A;  1MBG A;  4MK6 A;  2JK3 A;  2UUZ A;  3PUB A;  4WF2 A;  4HF2 A;  1WPK A;  2VOD A;  3ABM H;  4HRI A;  2DOE A;  5GAD J;  3KZ9 A;  3CUQ C;  2A6H F;  3MWM A;  4B3A A;  2UXX A;  2UXN A;  2ZSH B;  4HG2 A;  2L7M P;  1S8N A;  2VE9 A;  1TL8 A;  2V1X A;  4EQQ A;  4PDK A;  3WTV C;  4UDS A;  3HDD A;  2ZXJ A;  2FQ3 A;  1ETK A;  4BXF A;  4EV0 A;  4IRG A;  1YS6 A;  3GUD A;  4LD5 A;  5TIS C;  3IKT A;  3NS4 A;  2V1D A;  5CXG A;  2HXO A;  2E71 A;  2PMU A;  4G8X A;  3JR9 A;  2JSP A;  2XKO A;  4QSH A;  2DJI A;  4WCG A;  3TO6 A;  2Y0S A;  1X3U A;  4RB0 A;  4NNJ A;  1FBS A;  3BWG A;  2XAG A;  4D7N A;  5H9T A;  3RYP A;  2BXY A;  3IHU A;  3S16 J;  1I5Z A;  2JT1 A;  1UI6 A;  3OYJ A;  2E7W A;  2UXU A;  1I1S A;  1Z1D A;  3H5N A;  2DT7 B;  2CH0 A;  2P5K A;  1H8A C;  4L62 A;  1XGS A;  3FIW A;  5EEA A;  2KHM A;  1LPQ A;  3VIB A;  3FK6 A;  4H0E A;  3A0H C;  1FMW A;  4HX8 A;  2XHK A;  3OR2 C;  4B1R A;  2DT5 A;  3C7J A;  2VOO A;  3GZI A;  3BQY A;  5E3M A;  1XC5 A;  1XMK A;  1RKT A;  1FP1 D;  4MIM A;  5M5X J;  4XID A;  1IDZ A;  4BQN A;  2FOW A;  4PJJ A;  2DMT A;  5D6E A;  2CS3 A;  1Z77 A;  5FKL A;  2DAO A;  2LKX A;  3HEF A;  1X19 A;  5GPA A;  3CWR A;  4KIF A;  2XGC A;  1MZB A;  2Z3Y A;  1U5T A;  2F5C A;  3RJP A;  5H2F C;  3KP3 A;  1OLT A;  2FMY A;  3M8E A;  1NK2 P;  3S1N J;  3HPH A;  2IEK A;  2VJI A;  4O3M A;  3HIF A;  3O8H A;  3Q0U A;  3BY6 A;  3H3U A;  4RMN A;  3ZR8 X;  2B1E A;  3I53 A;  2IBD A;  2EB7 A;  2WY8 Q;  5EJC A;  2G7L A;  2MAB A;  3BT9 A;  3CTA A;  3CJD A;  3E6M A;  1G8X A;  3JAM Z;  1A6Q A;  4M3E A;  2YUS A;  3P9C A;  3H36 A;  3E6D A;  4I76 A;  1WI3 A;  2XF6 A;  4IKF A;  4N4O B;  3S3M A;  3HC7 A;  4F3Q A;  2ACJ A;  3CMY A;  1FP2 A;  5H6R A;  2EFW A;  1O3Q A;  4UVA A;  4U9L A;  3NRG A;  2ISZ A;  4Q48 A;  4WX9 A;  2BY3 A;  2BVM A;  4OIN F;  3LJL A;  3Q0W A;  1VQL I;  4E7H A;  1MW7 A;  2K9M A;  2VBX A;  2E60 A;  2ESN A;  2ZJR F;  2QA4 I;  3V6G A;  2WAF A;  3BLY A;  4E6K G;  3RPQ A;  3G4S I;  4XR6 A;  4U0Y A;  5KAI C;  3N4M A;  3BOQ A;  1ETY A;  4RGU A;  4OIQ F;  1DUX C;  1FX7 A;  3CD6 I;  3K10 A;  1ZH5 A;  4YFK F;  1EF4 A;  3ABK H;  3ON4 A;  1BW5 A;  5LHG A;  4RGX A;  4ENK A;  4I09 A;  5LGN A;  2L7Z A;  2X85 A;  1QU3 A;  1GHC A;  4YIR X;  2ZBK A;  1OFC X;  2EFQ A;  1K79 A;  4PJ0 C;  4F91 B;  1KA8 A;  1LVK A;  3JTH A;  3TMO A;  2O61 A;  3R61 A;  2QIB A;  1HLV A;  3QOP A;  2A6T A;  3EQL F;  3DTE A;  4XLA A;  4KIT B;  1Z6R A;  1KQ9 A;  4ZZL A;  1WFX A;  5JVG F;  3DEW A;  1WZ2 A;  3ZOB A;  1LKX A;  2GOX B;  3L2V A;  3IUV A;  4GGG A;  5DYM A;  1ZN2 A;  1UEL B;  2R7X A;  2VE8 A;  2FJ1 A;  5GPC A;  3QU3 A;  3KE2 A;  4ICH A;  4S0H B;  2MH9 A;  2ECC A;  3KEQ A;  3OIP A;  2VBW A;  3HKZ N;  3D1N I;  1SAN A;  4ZH4 F;  1MDM A;  4OWR B;  4OIO F;  4QWQ A;  2OZ6 A;  1EA3 A;  4H4K C;  1KU3 A;  1YI2 I;  2DFH A;  2JA8 J; 
#chains in the Genus database with same CATH homology
 3RD3 A;  2YVH A;  2M2E A;  3HOV J;  5E3O A;  5D19 A;  1POG A;  2CQX A;  3JRE A;  2G7S A;  3OIO A;  2R5Z B;  3BTC A;  1I50 J;  2VKV A;  3HOX J;  5IYD J;  2O7T A;  1B72 A;  2R0Q C;  2EQR A;  4X6A J;  3VVY A;  5DTD A;  5E3N A;  2LY9 A;  2PZ9 A;  2ZB9 A;  2DJN A;  1U9O A;  2JA6 J;  5GP9 A;  2HOS A;  1RET A;  2P81 A;  3JRA A;  1Z0X A;  3RQI A;  2XSD C;  1ZR2 A;  2JA5 J;  3M4O J;  1I3Q J;  2NVX J;  4HKU A;  1UG2 A;  1ETX A;  3F1B A;  5F0C A;  1TC3 C;  3QQA A;  2EH3 A;  3BHQ A;  1GVD A;  3RZD J;  2E2J J;  1UHS A;  4C3H J;  2MGQ A;  5HSZ A;  2HYT A;  3GTQ J;  2TRT A;  3B6C A;  1VI0 A;  1MNM C;  2ZCN A;  2N8G A;  4GCL A;  2DA2 A;  4MFD A;  2LP0 A;  3VP5 A;  3TP0 A;  1CQT A;  1MBF A;  3PPB A;  1NK3 P;  4AYB N;  1F36 A;  3L1P A;  5M3F J;  2NP3 A;  1B8I B;  5C44 J;  1IGN A;  5HBU A;  3VW0 A;  3ZQF A;  3JRF A;  2ZOZ A;  3C07 A;  3GTM J;  4I6Z A;  3WHC A;  1HOM A;  3KNW A;  1PUF A;  1DU6 A;  4MFE A;  4AC0 A;  3O8G A;  3LWJ A;  2G7G A;  2X48 A;  1TWC J;  3BTI A;  5C3E J;  1TWF J;  4QIW N;  3BR1 A;  1G2H A;  3PO3 J;  3GTK J;  5K7F A;  5IOZ A;  2I10 A;  5F1J A;  2CUF A;  4W1U A;  2W48 A;  3NNR A;  2XPV A;  3JSJ A;  2KDZ A;  1OCT C;  3VPR A;  2E2I J;  4A3M J;  2O7O A;  2F07 A;  3PM1 A;  5DS9 A;  3K7A J;  3TED A;  5F04 A;  4J19 A;  3H3V K;  5IPA A;  1Y1W J;  1GT0 C;  4ME9 A;  2GEN A;  2UXO A;  3JRD A;  3BJB A;  2LR8 A;  4NDL A;  5JLW A;  3ANP A;  1FTZ A;  1WGX A;  5EZG A;  5M5Y J;  1TWG J;  4BXX J;  2VI6 A;  2Q24 A;  3VOX A;  4A3C J;  2CJJ A;  2GFN A;  5EG0 A;  3AQS A;  3O60 A;  2Y30 A;  3HTI A;  2Y31 A;  1JKQ C;  1H88 C;  4GCT A;  2E19 A;  2WUI A;  4A3L J;  2R5Y A;  1JKP C;  3HGG A;  1X58 A;  2K40 A;  3ZQI A;  3JRB A;  3S5R A;  1JJ6 C;  4Y52 J;  2V57 A;  2COB A;  4RBO A;  3BR0 A;  2R7Z J;  1P7J A;  2HI3 A;  2HOT A;  3JRG A;  1D5Y A;  2DTZ A;  1RPW A;  2D5V A;  1JTX A;  3VUQ A;  4Y7N J;  2LD5 A;  1B72 B;  2RAS A;  1YRN B;  1UMQ A;  3S1Q J;  3NXC A;  1T56 A;  1AU7 A;  4JNN A;  2LTP A;  4V2F A;  2QF7 A;  3LSG A;  1AKH A;  3SDG A;  3MN2 A;  1HDD C;  1APL C;  4C3J J;  2NVY J;  3KKC A;  1A5J A;  3I4M J;  2DA5 A;  2R5Y B;  3GTO J;  4M3B A;  2VPR A;  5J1Y A;  2D6Y A;  2NS8 A;  2OF7 A;  3QKX A;  4NN1 A;  2HOA A;  1LFB A;  4YZE A;  1FJL A;  3LOC A;  4A3D J;  3IH3 A;  3HBL A;  2RAE A;  2E2H J;  3BG3 A;  2E1O A;  1PUF B;  2MW8 A;  3JRH A;  4HNV A;  4UUS B;  4JX4 A;  3A01 A;  4A3J J;  4M3F A;  4D5C A;  1R9T J;  2AHQ A;  3KKD A;  4IEJ A;  9ANT A;  2LVS A;  3LNQ A;  1FEX A;  4JX5 A;  5JLX A;  4A3F J;  1MBH A;  4JL3 A;  2CU7 A;  3NPI A;  3VVZ A;  2XGD A;  3BR6 A;  3HOW J;  2ZOY A;  3GTJ J;  2M34 A;  4A3K J;  4IHY A;  3RZO J;  2JJ7 A;  1OCP A;  2TCT A;  4XRS A;  3T6N A;  3GTL J;  5FHP A;  2JMW A;  5EZH A;  2DA3 A;  5IOY A;  1JKO C;  1GV2 A;  2LLK A;  1QRY A;  3GTP J;  2HYJ A;  4DW6 A;  4G12 A;  1RES A;  3F0C A;  4L5E A;  2Y9Z A;  4D5F A;  4BY1 J;  2QTQ A;  2UXH A;  5FJ8 J;  2K9S A;  5IP9 J;  3S1M J;  1HDP A;  4A3B J;  1H89 C;  1JT0 A;  3P9T A;  3CDL A;  2QOP A;  1U78 A;  5EG0 B;  4UUT A;  3ZQG A;  1ZGW A;  2X9D A;  3NAR A;  1HF0 A;  4DYQ A;  2DG7 A;  3VW2 A;  3BG9 A;  2KT0 A;  1IDY A;  2HKU A;  3V78 A;  2WV1 A;  3A03 A;  3I4N J;  3PO2 J;  4MO7 A;  2LK2 A;  1O4X A;  2DMU A;  2K9Q A;  3LSP A;  3ON2 A;  5FKO A;  1JKR C;  3G1L A;  2L0K A;  4MXM A;  2WGB A;  3TP3 A;  1X2N A;  4V2G A;  2VKE A;  2YU9 J;  5J1R A;  2WAQ N;  5FKK A;  3FKI J;  3HOY J;  4A3E J;  2NP5 A;  1ENH A;  2PMZ N;  4XRM A;  5EDN A;  2NOG A;  2HXI A;  5E3L A;  5EGO A;  3MVP A;  4GFK A;  2FBQ A;  3BR5 A;  3DCF A;  1WH5 A;  2MG4 A;  2Y9Y A;  4M3G A;  3AQT A;  1U8B A;  4EEF G;  5DAJ A;  4IHW A;  5F0H A;  4XIC A;  2XB5 A;  1TWH J;  1BW6 A;  1BL0 A;  3WHB A;  3COL A;  4AUX A;  2NS7 A;  2DMP A;  2XPU A;  5FGL A;  3Q0V A;  2H8R A;  2REK A;  1FIP A;  1SFO J;  2ZCM A;  3BR3 A;  3JRC A;  4LOC A;  2ZCX A;  4IHV A;  4MLO A;  1ITY A;  1FIA A;  5BNG A;  4D7M A;  2DA1 A;  1I6H J;  4JKZ A;  2W53 A;  5EGO B;  3RH2 A;  2R5Z A;  1JUP A;  1IC8 A;  2GM4 A;  2EZK A;  3BRU A;  1ZK8 A;  2GUH A;  2Y2Z A;  4B4C A;  3BR2 A;  2FD5 A;  2DMN A;  5J1U A;  3QPL A;  2ME6 A;  2WB1 N;  3IH2 A;  1Q1V A;  4XRS G;  5CXI A;  1MSF C;  2GBY A;  1X2M A;  5FLV A;  1ETQ A;  2DMQ A;  5F08 A;  2EZH A;  2R92 J;  1JGG A;  4GCK A;  1VND A;  3FRQ A;  3TW6 A;  3BCG A;  4DZP A;  4A69 C;  4BKX A;  1K61 A;  4UUS A;  2RHA A;  3A01 B;  3S15 J;  2FQ4 A;  3FIS A;  3RKQ A;  3E7Q A;  3DPJ A;  5EF6 A;  4DZJ A;  3S17 J;  3G1O A;  1T33 A;  1MSE C;  4AC6 A;  5J3L A;  1VF9 A;  3ZQH A;  2JN6 A;  3SFI A;  3LSJ A;  2GLO A;  1MBG A;  2VUM J;  4MK6 A;  5HAW A;  2AO9 A;  3H0G J;  3HM5 A;  2JK3 A;  4FCY A;  3G56 A;  1WPK A;  1QVU A;  3KZ9 A;  2G0E A;  5F0F A;  2EZL A;  1VFC A;  1QPI A;  4B3A A;  5IP6 A;  2B63 J;  5FLM J;  2UXI A;  4A3I J;  2L7M P;  2NVT J;  4KWA A;  2O9L A;  4UDS A;  3HDD A;  3EGQ A;  1ETK A;  3LHQ A;  4GFB A;  4FE4 A;  2OI8 A;  2NVQ J;  3K2A A;  5CXG A;  2HXO A;  3JR9 A;  3OSG A;  5C4J J;  1S7E A;  5HOD A;  4C2M J;  2L9R A;  4QSH A;  3S2H J;  1ZTR A;  1ETW A;  3LSR A;  3HTA A;  1P7I A;  1RKW A;  2CRG A;  4D7N A;  5H9T A;  4JX6 A;  5K7Z A;  4DYR A;  3S16 J;  5FMP A;  2QKO A;  1UI6 A;  4JYK A;  2XGE A;  2DG8 A;  2M0C A;  2UXU A;  2DA7 A;  4FTH A;  1ZQ3 P;  2HQ5 A;  2ECB A;  3Q3S A;  1AHD P;  1H8A C;  1JJ8 C;  4L62 A;  3OOU A;  1XS9 A;  3FIW A;  2YS9 A;  5EEA A;  4CYC B;  1F43 A;  1YRN A;  3VW1 A;  5AQC A;  3VIB A;  3FK6 A;  2ME0 A;  5FKM A;  3B6A A;  2PBX A;  2G3B A;  1AKH B;  2XPW A;  3G1M A;  4B1R A;  3CCY A;  4M3D A;  3BNI A;  3GZI A;  3HTJ A;  3BQY A;  5E3M A;  4A3G J;  1XC5 A;  3PAS A;  1RR7 A;  1E3O C;  1RKT A;  3VVX A;  5M5X J;  4MIM A;  1IRZ A;  4XID A;  4IHX A;  1IDZ A;  5CW8 A;  2K9N A;  2DMT A;  1A6I A;  3HOZ J;  5F27 A;  3E7L A;  1ORK A;  1Z77 A;  5FKL A;  2O8K A;  3QBM A;  4GFL A;  2LKX A;  3HEF A;  5GPA A;  3CWR A;  1OJL A;  2XGC A;  2HDD A;  1HCR A;  1MH4 A;  3BQZ A;  4DYC A;  1NK2 P;  3S1N J;  2QCO A;  2IEK A;  4RDU A;  1BA5 A;  3ZQC A;  1WH7 A;  3O8H A;  3Q0U A;  2LFB A;  3S2D J;  4FIS A;  3NI7 A;  2IBD A;  1TWA J;  2G7L A;  3CJD A;  3BT9 A;  1GUU A;  3S1R J;  4NEL A;  3ANG A;  1K83 J;  3HE0 A;  5IYB J;  1MBE A;  4M3E A;  2YUS A;  1WCM J;  3HB9 A;  1Y1V J;  2DA6 A;  1WI3 A;  3A02 A;  1ZKG A;  1BJZ A;  4I76 A;  3GEU A;  1FTT A;  5IYC J;  2QWT A;  3CMY A;  4CGR A;  3BTJ A;  3HTH A;  1GDT A;  1W0T A;  5D1R A;  4ABZ A;  1MBJ A;  1JTY A;  3NRG A;  5EYR A;  1W0U A;  2ID6 A;  2DA4 A;  3C2B A;  5FKN A;  3HOU J;  3LJL A;  3Q0W A;  3MNL A;  1IG7 A;  1ETO A;  1DU0 A;  2IU5 A;  3GTG J;  3G7R A;  1IJW C;  3V6G A;  2YVE A;  5M5W J;  2NX4 A;  2UXP A;  4W97 A;  3HIM A;  4BY7 J;  3M3Y J;  5C4Y A;  5K58 A;  2FX0 A;  3TW7 A;  1B8I A;  3IH4 A;  1ETY A;  5EFY A;  2EBI A;  2XDN A;  1ETV A;  3QPS A;  2H1K A;  5D18 A;  2JA7 J;  5C4X J;  1JUM A;  5M3M J;  1EF4 A;  3ON4 A;  4M6V A;  4XK4 A;  3OSF A;  3W6V A;  1BW5 A;  4JP0 A;  2M8G X;  2M9H A;  2L7Z A;  3NAU A;  2L7F P;  3MKL A;  2X6O A;  4BBR J;  1U9N A;  1OFC X;  1XG1 A;  3BTL A;  4BBS J;  1UI5 A;  2OER A;  1QVT A;  1MBK A;  3CQZ J;  3B81 A;  2QIB A;  3SJM A;  3VOK A;  2IAI A;  1JT6 A;  1HLV A;  1LE8 A;  3CRJ A;  2R93 J;  2ID3 A;  1ZR4 A;  3BG5 A;  4PXI A;  1NTC A;  2XRL A;  1IV6 A;  3EUP A;  3ZQL A;  2Y0S N;  2CUE A;  3DEW A;  4A93 J;  3UKG A;  3ZOB A;  5IP7 J;  5K7H A;  3IUV A;  2XB0 X;  2JWT A;  1MH3 A;  4ACI A;  4X1E A;  3HGY A;  4CYC A;  2DN0 A;  3S14 J;  1SGM A;  5GPC A;  2FJ1 A;  4ICH A;  2CQQ A;  4S0H B;  4QTR A;  4FE7 A;  2ECC A;  4AF5 A;  2OPT A;  3JRI A;  4C3I J;  3HKZ N;  3D1N I;  1SAN A;  3FK7 A;  1GV5 A;  2ELK A;  3IV5 A;  3GBG A;  1LE8 B;  2EZI A;  1LFU P;  1IUF A;  1JUS A;  2MSY A;  2JA8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...