4MO7A

Crystal structure of superantigen pfit
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
188
structure length
187
Chain Sequence
TDPESARGKLLQTAAHLFRNKGFERTTVRDLASAVGIQSGSIFHHFKSKDEILRAVMEETIHYNTAMMRASLEEASTVRERVLALIRELQSIMGGSGEAMAVLVYEWRSLSAEGQAHVLALRDVYEQIWLQVLGEAKAAGYIRGDVFITRRFLTGALSWTTTWFRAQGSLTLEELAEEALLMVLKSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator I2
publication title Pfit is a structurally novel Crohn's disease-associated superantigen.
pubmed doi rcsb
source organism Pseudomonas fluorescens a506
total genus 74
structure length 187
sequence length 188
ec nomenclature
pdb deposition date 2013-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4mo7A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mo7A02
3G1LA 3HTJA 3ZQLA 4A93J 2LP0A 3L1PA 3BCGA 1JUSA 1VF9A 2K40A 2YU9J 3HBLA 2CRGA 2IEKA 3GTLJ 2JN6A 5CW8A 1LE8A 2R5ZA 2MSYA 1TWCJ 4L5EA 1Y1WJ 1XG1A 4BY1J 2HQ5A 2ZCNA 2DA5A 3NAUA 2DMQA 4C3IJ 2H1KA 3GBGA 4AC6A 1I50J 5EEAA 2WB1N 2LTPA 3HOUJ 3ZQGA 5IYCJ 2R5YA 1QVUA 1B8IA 1LFBA 1ZK8A 1TWFJ 3G7RA 2L0KA 3TP3A 2LY9A 4A3GJ 4QIWN 5FJ8J 3JREA 1DU6A 3K2AA 1SANA 1TC3C 1JJ8C 3HGYA 1TWGJ 2EBIA 2EQRA 3ZQHA 4CYCB 3RZDJ 4NN1A 5BNGA 5C3EJ 5E3LA 3Q0VA 1ETWA 2RHAA 2G7GA 2YVHA 1H89C 2O7OA 3A01A 5AQCA 4A3KJ 1QRYA 1HCRA 3BR6A 2VPRA 1JKOC 2HXOA 5GP9A 2K9SA 5EZHA 5CXGA 2Y0SN 3S1RJ 3O60A 3BR1A 3A03A 4C3JJ 3D1NI 5HSZA 2D6YA 3K7AJ 1ZQ3P 1EF4A 2LD5A 4B1RA 4IEJA 4FCYA 4D5FA 1NK2P 3HTIA 3ZQCA 5EG0A 3LOCA 4D7NA 2QTQA 5IOYA 5E3MA 3AQTA 1JUPA 3RKQA 2B63J 3WHCA 4IHVA 2EZHA 5D1RA 2ECBA 3GEUA 5M3FJ 4A3IJ 5D18A 2AO9A 3VPRA 2G7SA 1H8AC 4NDLA 1FJLA 3VOXA 1UG2A 2AHQA 3JRIA 1ETVA 4W97A 5J1UA 3JRFA 3VVYA 1IGNA 3BG3A 3FKIJ 4XRSA 3LHQA 2OPTA 5FKLA 2NVYJ 1NK3P 2JJ7A 3CQZJ 4M3FA 5GPAA 3RQIA 3F1BA 1OJLA 1OCPA 4X6AJ 1HDPA 1MSFC 2RASA 1JKQC 5C44J 4JX5A 1HLVA 4HKUA 3NRGA 1OFCX 4XK4A 1B72A 1JTYA 4RBOA 4KWAA 2WAQN 1ENHA 2MW8A 3PM1A 5DTDA 1HOMA 3V78A 2ZCXA 4YZEA 3VOKA 4AYBN 2UXIA 1LE8B 1FIAA 2R5ZB 3VVXA 5K58A 3KKCA 2YS9A 1X2NA 1UMQA 5DAJA 4AC0A 4G12A 3BG5A 3DEWA 1ETXA 3B6CA 3SDGA 1XC5A 3ZQFA 3VUQA 3IV5A 2MG4A 4JNNA 1F36A 2GUHA 1GVDA 4XRSG 1R9TJ 2Y9YA 4MXMA 5H9TA 5HAWA 2CUEA 1B8IB 4IHYA 1ETKA 2W48A 3ANGA 2DJNA 2XSDC 4QTRA 2GM4A 2E2HJ 2EZIA 3GTQJ 3QQAA 3BTLA 3MVPA 3QPSA 4W1UA 3CMYA 3M3YJ 4HNVA 3Q0UA 4BY7J 4D7MA 3BR5A 2ZOZA 3QKXA 3IH4A 3ZQIA 2XB0X 2LLKA 3I4MJ 1ITYA 4LOCA 4UUSA 2DA1A 2DG8A 2UXOA 3GTJJ 2L7MP 4NELA 1T56A 2XPUA 2IBDA 2G3BA 3OSGA 5JLWA 2NS8A 5IP6A 3TW6A 2PZ9A 3IH3A 3B6AA 2XPVA 5E3NA 3EUPA 4A3LJ 1X58A 3P9TA 3BNIA 1X2MA 1WGXA 4A3JJ 2DMNA 3HOWJ 2KT0A 2FX0A 2L7FP 1ETQA 5F08A 2JA7J 2DMUA 2XGEA 1FTTA 4V2FA 2JK3A 1K61A 2YUSA 1GUUA 2LR8A 3CDLA 2TCTA 3LWJA 3ZOBA 2HYTA 1DU0A 2CJJA 4MK6A 1VFCA 2WGBA 5EG0B 2O9LA 5M3MJ 3VVZA 1JT6A 1U9NA 3PO2J 4M6VA 3S5RA 3WHBA 2M34A 5J1RA 1Z0XA 4J19A 2X9DA 5M5WJ 2D5VA 3B81A 3S1QJ 4DYQA 3HOYJ 4IHWA 2M9HA 2NOGA 4M3GA 1ETOA 2JA6J 3JR9A 4I6ZA 4MLOA 3EGQA 2NP5A 2FJ1A 5F1JA 2UXHA 1A6IA 1RKWA 1JTXA 3S14J 3S2HJ 3IH2A 3PPBA 3HTAA 2L9RA 2ZOYA 2TRTA 1FIPA 3HE0A 4FTHA 3LJLA 5EDNA 1W0TA 2X6OA 4DZPA 1JKRC 4A3DJ 2N8GA 2R0QC 3MKLA 1FEXA 1B72B 4GCKA 1CQTA 2CU7A 3G56A 2LFBA 1POGA 4Y52J 2XPWA 5FKOA 2HOSA 2V57A 3LNQA 1GV5A 1IJWC 3C07A 3VIBA 2PMZN 3TW7A 3E7QA 4L62A 3COLA 3CWRA 1Q1VA 1S7EA 2XDNA 2DA7A 1A5JA 3GTMJ 5FKNA 5C4XJ 1RKTA 4A3FJ 1FTZA 2YVEA 1RR7A 4DYRA 2NVXJ 3NPIA 1YRNA 5IPAA 3UKGA 3H0GJ 2NVQJ 1AU7A 3FK6A 3PASA 3RD3A 3VW0A 4ABZA 3TP0A 3T6NA 4FISA 1OCTC 2VUMJ 2X48A 3O8GA 4A3BJ 3BR3A 1P7IA 2QOPA 2OERA 4Y7NJ 4X1EA 1MH4A 3NARA 1MBJA 3GZIA 5GPCA 1ZR2A 2DMPA 2VI6A 2XRLA 1Z77A 1AKHB 1UI5A 3BJBA 3MNLA 1RPWA 3MN2A 4M3DA 5F27A 4UUSB 1ZTRA 1BA5A 5D19A 3CCYA 5K7FA 3VP5A 3RZOJ 2CQXA 4JX4A 1ZGWA 1MBEA 3C2BA 3ANPA 4GFLA 2QWTA 3HIMA 1SGMA 4I76A 1LFUP 4GCLA 5M5YJ 2LK2A 2COBA 1E3OC 4JYKA 3G1MA 4B4CA 5JLXA 4JP0A 3OIOA 5EFYA 1I3QJ 1MNMC 2W53A 2WUIA 3HOXJ 1BW6A 4C3HJ 2UXUA 2ELKA 2P81A 3JRCA 1ZKGA 4S0HB 1JKPC 2R5YB 2XGCA 4BKXA 2KDZA 3F0CA 2QKOA 4ME9A 5IYDJ 3DPJA 2EZLA 1MBKA 3CRJA 4GFBA 4AF5A 1D5YA 1AHDP 1T33A 2O8KA 2ME0A 2XB5A 4DW6A 1RESA 1W0UA 2LKXA 5J1YA 2ZCMA 2LVSA 3H3VK 1H88C 4BBSJ 4D5CA 1GDTA 4XRMA 1UHSA 3ON2A 3BTIA 2DA4A 2NP3A 1GV2A 2Y31A 5FKMA 2VKEA 3A01B 2DTZA 3NNRA 4PXIA 4UUTA 2EZKA 4BBRJ 3O8HA 5FLMJ 1BW5A 3BT9A 4QSHA 5F0FA 5K7HA 2OI8A 1MBHA 1JT0A 2FQ4A 4A3CJ 3QBMA 1IG7A 3GTGJ 2H8RA 2EH3A 4B3AA 5C4JJ 1JJ6C 5EZGA 5IOZA 2I10A 3IUVA 3NI7A 5F0CA 1U9OA 3VW1A 2JMWA 2CUFA 3S1MJ 3HOZJ 1O4XA 2MGQA 2R92J 2NS7A 2FBQA 2REKA 3E7LA 2XGDA 4AUXA 2NVTJ 3FISA 4UDSA 1HF0A 4MO7A 4FE4A 3LSGA 3BQYA 5EYRA 3HDDA 5K7ZA 3BRUA 1TWHJ 5F0HA 3S2DJ 5EGOA 4C2MJ 4A3MJ 1QVTA 2DA2A 1YRNB 1Y1VJ 3JRBA 3LSJA 1TWAJ 1I6HJ 1ORKA 2GBYA 1IUFA 4M3EA 1WH7A 2M8GX 1PUFA 2HXIA 2FD5A 4FE7A 3CJDA 5FLVA 5IP9J 3G1OA 4A69C 5IP7J 2GLOA 3GTKJ 2M0CA 3A02A 3HB9A 4DZJA 2F07A 2E2IJ 1ZR4A 1SFOJ 1APLC 4A3EJ 2PBXA 4MFEA 1JUMA 1GT0C 2HOTA 1NTCA 1RETA 1WI3A 9ANTA 4JKZA 3HGGA 1WCMJ 3BR0A 2K9NA 5FKKA 2ME6A 2DA6A 5FGLA 2JA8J 2QCOA 1HDDC 3JRAA 4ICHA 1ETYA 2OF7A 1BL0A 2QIBA 2R7ZJ 1F43A 5E3OA 3GTPJ 2DG7A 5F04A 1WH5A 2CQQA 3HEFA 4M3BA 3S1NJ 2G7LA 4CGRA 3AQSA 4JX6A 2HDDA 1P7JA 3QPLA 2QF7A 3TEDA 3S16J 5CXIA 5FHPA 2K9QA 3SFIA 1BJZA 2WV1A 4CYCA 3BTJA 2ZB9A 2Y30A 2GENA 3HTHA 3SJMA 1VNDA 3LSRA 5HBUA 2Y9ZA 2E2JJ 5EF6A 3W6VA 4EEFG 3KKDA 3KNWA 1G2HA 4IHXA 2DN0A 2VKVA 3NXCA 3V6GA 3DCFA 3BR2A 3OSFA 4ACIA 3FK7A 2UXPA 2E1OA 2IAIA 3Q0WA 1MSEC 3Q3SA 3S15J 3S17J 2DA3A 3FIWA 2NX4A 3M4OJ 3JSJA 2GFNA 4MIMA 1IC8A 2O7TA 3OOUA 3VW2A 2HKUA 2G0EA 4XIDA 2ECCA 3I4NJ 5HODA 4XICA 5C4YA 5IYBJ 1VI0A 3KZ9A 2ID3A 1WPKA 1MH3A 3PO3J 1JGGA 2E19A 5J3LA 3GTOJ 3BTCA 4BXXJ 4DYCA 5M5XJ 1IRZA 2JA5J 3LSPA 3JRHA 3JRDA 3BHQA 2HYJA 1IDZA 2L7ZA 4RDUA 4GCTA 3HOVJ 3HKZN 4JL3A 1U78A 1U8BA 3FRQA 5EGOB 1UI6A 3BQZA 4GFKA 3HM5A 2HOAA 2ID6A 2Q24A 4V2GA 1IV6A 2R93J 2Y2ZA 5DS9A 3ON4A 2IU5A 2HI3A 2M2EA 4MFDA 2DMTA 2JWTA 5FMPA 3BG9A 1MBFA 1IDYA 3RH2A 1K83J 2RAEA 1QPIA 1PUFB 1AKHA 1MBGA 1XS9A 3JRGA
chains in the Genus database with same CATH superfamily
4ENKA 3HTJA 1VQ5I 1X3ZB 1P6RA 4N9HA 1N78A 3PUFA 2DT6A 1YX3A 1LDJA 2CRGA 5LD2C 3BROA 5FD6A 1X4PA 2R5ZA 3L09A 4UB8C 3DTKA 3IWFA 4L5EA 4ON0A 1XG1A 5JHFA 3J81Z 4XLFA 2IGMA 4I09A 1NG7A 2WB1N 2R5YA 3QPTA 2DDBA 1B8IA 1QBJA 1LFBA 1ZARA 1D0XA 3G7RA 4XKVA 4OIRF 4A3GJ 3BZ6A 3H5RA 2VT2A 2DYRH 1R4MB 5BPIA 2CYYA 1TWGJ 1QZEA 2JPBA 2ZJPF 1O3TA 1YW9A 3HRMA 2EQRA 3BP8A 4M73A 2V6EA 5E3LA 1FMVA 4XOPA 3HJEA 2FMLA 3GZNB 1IAWA 1B9MA 4HW0A 2GZWA 3ERED 2CW8A 4XSXF 1CF7B 3KPHA 5HS9A 2M7AA 1OYIA 2O7OA 4HF1A 4A3KJ 3FKJA 3TDZC 3L2UA 4IF4A 2PFBA 2VPRA 3BDDA 2F5EA 2F4MB 2ETHA 2LBFB 2E1NA 1R49A 3O60A 4JK1X 1MDMA 1MMGA 5HSZA 3CP2A 2PBIA 2MYSA 1WSUA 2DQRA 4HBLA 3QYFA 4IO9F 4CCOA 4HF2A 3DPTA 3ZQCA 3PL8A 4D7NA 2IJLA 3E5XA 5IOYA 5E3MA 3BJAA 5FLXK 2B63J 2PQ8A 3FHZA 4IHVA 2WY8Q 4IOAF 1UZCA 5D1RA 3WTSC 1O7FA 1PDNC 3QU3A 3OYDA 5M3FJ 3G71I 3PJRA 3MFKA 1R00A 3VPRA 3VOXA 1UG2A 3Q5FA 2LH9A 3K70C 2HKXA 4HA8A 3KP5A 3JTHA 2V79A 4PUSA 3U1DA 5JVTA 1S9HA 1B4AA 2OPTA 4NNJA 3H9QA 4PGHA 5D6EA 4HNUA 5DCMA 3RI4A 4LK0F 3CQZJ 5L3GA 1R5GA 1Y39A 1SFXA 2H09A 3RQIA 1ODDA 3LSMA 2CUZA 3GYHX 3E6BA 4BL0B 2EK5A 4BQAA 4YG2F 3OOPA 4BDZA 4ZTFA 4HX7A 4JX5A 4EJUA 2VC1A 2IRFG 4KWAA 4UV8A 2MW8A 1Y8RB 2V1NA 5FO5A 3BWGA 1ZLKA 3ABLH 5K58A 3KKCA 4O5VA 1MJAA 3LWFA 3M9AA 4BXUA 1TT0A 1BM9A 1HQCA 4XRSG 2Y9YA 4R8HA 1O7LA 1Z21A 2QYOA 2XV4S 3BTLA 3MVPA 3QPSA 3M3YJ 2ZKZA 3EQLF 1MZBA 1Z91A 2HYGD 4MQ9F 4Z2YA 3BR5A 2QGUA 3QP5A 1KQ8A 2VQLA 3QOEA 3BCBA 4E4HA 3OYNA 1ACIA 2STWA 4XN0A 3RKWA 4A0XA 2ZJRF 1X19A 3ZGKA 4LOCA 3L2WA 2DA1A 4A12A 5IT9Z 5BS6A 1KYZA 1LEAA 2HVSA 3GTJJ 2UXOA 2OUMA 1MNDA 4UVAA 2FE3A 4UXNA 2HZTA 1T56A 2ZMEB 3P9KA 5JVGF 3FM5A 1SC7A 2BXZA 2JTVA 2XAHA 2YPRA 1GVJA 1KU2A 2L9NA 3MZHA 5A2QK 2JQ7A 3IH3A 3LSHA 2HDCA 4IHTA 2H6BA 4CYDA 2F5DA 3L2VA 1X2MA 2VXDA 1WGXA 2DMNA 3M8EA 5JR3A 2FX0A 1UHWA 3HOTA 1VQPI 2OTJI 4LLLA 2JK3A 4LG3A 2LYCA 3CDLA 4ITVA 1JGSA 1T6SA 3M1EA 5LEJA 1U9NA 4YIRX 3QYEA 3PO2J 2RVCA 4MGRA 1Z0XA 2B0LA 2BOLA 2Z3YA 2FEZA 2X9DA 2ZNZA 4DYQA 3HOYJ 1FC3A 2M9HA 1XCBA 2JA6J 1OPCA 2Z99A 4MLOA 5LRRA 2VJ5A 5F1JA 3ZPLA 2UXHA 2Q2EB 3S2HJ 1BC8C 5H6QA 3VYSB 3CMMA 3REOA 1R22A 3CD6I 3KEOA 4QWQA 1K6YA 4FTHA 2E1CA 3IL2A 1FOWA 4ZJZA 1IRFA 1ZRCA 3FMQA 1KQ0A 1JKRC 4A3DJ 3K1NA 3OYLA 2N8GA 4RM2A 2R0QC 3DEEA 1B72B 1FEXA 2F5VA 5E79C 2YX4A 3ABTA 2M8EA 1CQTA 2CU7A 3CP8A 4RLQA 2DPDA 2XPWA 3F3XA 2V57A 3C07A 4XLCA 2DODA 2PMZN 3RQ4A 1UELB 4HPQA 1S7EA 2XDNA 2DA7A 4G9YA 2LREA 4G8XA 3GTMJ 1FTZA 1RKTA 4A3FJ 2YVEA 1ZRFA 3TQNA 4EGZA 3OS0A 3C2HA 3P9IA 2NVQJ 3CUQC 3L2CA 4CCKA 3PASA 1OCRH 3DWLE 4FISA 1IXCA 2XDVA 1OCTC 2X48A 1W5SA 5FD5A 2KFDA 2VUMJ 3BR3A 2EWNA 1BR2A 1USTA 3DV8A 4LITA 1P7IA 2EIKH 2Z5UA 1OCZH 4Y7NJ 2UV1A 1G3TA 4KDPA 5GPCA 3BZCA 1AKHB 3BJBA 1Z77A 4BHPA 5HVQC 5CKTA 1T2KA 3KZYA 3HL2A 3ABUA 2FU4A 4UUSB 4AM3A 4XORA 1BA5A 3DP7A 2M4GA 5D19A 1IUYA 2MA3A 1H0MA 4OD5A 5E8GA 3OR2C 4G6TB 3RCOA 3LSTA 2EFPA 1MBEA 3CUQB 2VONA 3ANPA 3AFHA 2QWTA 4GFLA 4I76A 2V9VA 3IUOA 1E3OC 3DXJF 4GYIA 2XF7A 1QZYA 1I3QJ 1MNMC 2A5YB 2P7VB 3CO7C 2DOEA 4C3HJ 2OCEA 4CZCA 5IY5H 1HBXG 4HX8A 1NG6A 2HOEA 3PIPF 3BY6A 2MBFA 4BKXA 2KDZA 4D9JA 2E1MC 2QKOA 2JVGA 3DKWA 2FA5A 3WTYC 2KMUA 2EZLA 2VC0A 1MBKA 3ZCOA 3QOPA 4AF5A 1T33A 3H3VK 2DLLA 1H88C 3F22A 4D5CA 2UWMA 3BTIA 2DA4A 1Y56A 1GV2A 2DFFA 4ZDOA 1OMIA 4PCQA 2DTZA 5LRSA 3NNRA 4KISA 2L01A 3J7AY 2E1MB 3HOSA 3K4NA 3Q9VA 4QSHA 1R1UA 3F9KA 4NC8A 3CC7I 1JHHA 1MBHA 2K85A 4KN4X 1RR8C 2X0LA 1IG7A 4ETSA 2H8RA 2KHMA 2DYSH 4B3AA 3S3NA 1XTAA 2EILH 4OIQF 3KCCA 3MEXA 2C6YA 4I7HA 1HW1A 2R92J 1JI8A 4AUXA 2FNPA 4UDSA 2E5NA 3PSIA 4CDGA 4FASD 2QQBA 3PFIA 4OIOF 1HF0A 4FE4A 1BI1A 4LLGF 3LSGA 3BQYA 3J81K 3LQQA 3CCQI 2NAZA 1E17A 2R7DA 3S93A 2DA2A 2FSWA 1SD7A 2BY3A 2RV8A 3JRBA 2X1EA 1ORKA 3U21A 1QHHD 2KZVA 1WFXA 3RDIA 1WH7A 4WX9A 2FD5A 2P5VA 5IP9J 3G1OA 2FUG2 3A02A 4DZJA 3VSLA 2PJPA 3MZ8A 1T0FC 4OWRB 4BACA 4BDYA 3OYMA 2ZXIA 1NTCA 1RETA 2HPMA 1W5TA 3V8LA 1A35A 2GXAA 3BR0A 1E3PA 5FKKA 5HLGA 4IRHA 3FWEA 3BZKA 2JA8J 2QCOA 4ICHA 3JCUC 1IRXA 2CO5A 3FXUA 3I3LA 1BL0A 2QIBA 2GOMA 4CA0A 1OISA 1ZGJA 2P5LC 1WH5A 1ZG1A 2CQQA 4M3BA 5ICCA 1LVAA 4CGRA 4YEJA 1YTYA 1VQLI 2DFEA 3HSFA 3QPLA 3SFZA 2K4BA 3S16J 4HZFA 2UXNA 2LDUA 1K78A 1Q1HA 3SQNA 1SVMA 4R1HA 2GENA 2XAFA 2XHKA 3FM3A 4FT8A 4WF2A 3LSRA 2R7OA 5EF6A 3VYUB 2LY1A 3CCJI 3QODA 1WJCA 2DN0A 1SD6A 2L4AA 3AKZA 3COAC 2DW4A 1LPQA 3OSFA 4RB2C 2FRHA 2QKMB 3FHNA 2OZ6A 4XNFA 4L0YB 2MC4A 4N4OB 1WJFA 3CUOA 2DXIA 3L00A 2QBYA 2VN2A 3VEPA 2M87A 2NRAC 1FOXA 2GFNA 1IC8A 2KLOA 4II2A 4U0YA 2BHYA 3RPUA 4XQFA 5HODA 3GUDA 3IAS2 5LLQA 3KZ9A 3FXRA 2RQQA 1YHQI 1MH3A 2E19A 4DYCA 5M5XJ 2JPCA 1SFUA 3BHQA 2HYJA 3WODF 1QPMA 3MQ0A 2EPFA 3V7SA 2WTEA 1U8BA 2MABA 3ASOH 2HOAA 2Q24A 2W1OA 1X1CA 1IV6A 1XB4A 5EEHA 1TLHB 3M8FA 2IU5A 4MFDA 4XL9A 3AG2H 2ELHA 1IDYA 2X6XA 2RAEA 3KLOA 1XSDA 3WU2C 1V3FA 1BOBA 2GQQA 4EM2A 3ZQLA 4KNYA 4BJ6C 4E7HA 3BCGA 2K40A 3D5SC 2YU9J 3J7YJ 2CSOA 2EA4A 3F23A 2IEKA 1QNTA 1VZ0A 4RAFA 1LE8A 3NWTA 1WJ5A 5CVRA 2MSYA 1Y1WJ 2BVMA 2ZCNA 2LY2A 1DGWY 1DGRM 3NAUA 5D4SA 1YIJI 4XN3A 3H9JA 4RGUA 3V4GA 2A69F 4OMYA 5EEAA 5DUIA 4U7BA 3HOUJ 3ZQGA 1PP7U 1QVUA 4L9JA 2QQAA 1EH8A 1ZK8A 5JI6A 4AIKA 2CMPA 2L0KA 1YYVA 2RNGA 1WJBA 4RAGA 1MMSA 1I6XA 5FJ8J 3JREA 4M72A 1DU6A 3K2AA 3F21A 1KONA 3HGYA 1FPQA 2V9PA 4KICA 4A6DA 2CGPA 4HQEA 4BQQA 2MC3A 3IKTA 3RZDJ 2A6TA 4MEXF 2LG4A 1ETWA 2RHAA 4KIBA 2G7GA 1UJ8A 2E71A 5L3EA 3N97A 2AQFA 4WIBA 2GIZA 4XLNF 2HTJA 5DDGA 3TDUC 1LDDA 3I71A 3DLLF 3BR6A 3K4JA 4IXAA 4AYBA 2QLZA 4IRIA 1EH7A 4B09A 5GP9A 2G7UA 5CXGA 1SAXA 2KIFA 3S1RJ 2IS1A 2DG8A 3A03A 4XLPF 3T0YA 1T39A 2I8DA 4CO8A 3K7AJ 1ZQ3P 1YG2A 1X1DA 4FCYA 2LF8A 4OD4A 1FBSA 4A0ZA 1ON1A 5EG0A 1HKSA 1TBXA 1KU9A 2BY0A 3BJOA 1HSTA 5FRNA 2V9KA 3WHCA 3K4LA 4AVZA 2BV6A 3ERMA 3ZN0A 1SEUA 2Y0MA 3L9FA 2ECBA 1Z7LA 3ECOA 3ZMVA 1S72I 3KP7A 3CJNA 1Z7UA 5TISC 1ZH5A 3RKYA 4NDLA 2JZYA 2AHQA 3JRIA 1KQ9A 4RMNA 4CCNA 4W97A 4RGSA 3TOBA 4MTEA 1MIJA 3VYRB 1DP3A 5B3SH 3FKIJ 3LHQA 1VQ4I 2YVXA 1NK3P 2NVYJ 3K4KA 1SD5A 3SWHA 1F9NA 1Z6RA 2A61A 2VJJA 2K3PA 5GPAA 3QYBA 1BBYA 3J80Z 1BR4A 1OCPA 5LGNA 4X6AJ 2D1VA 2VE9A 3A4CA 2OQGA 3SZTA 1JKQC 3VWBA 1OQYA 4BQOA 3R0JA 1OFCX 1FSHA 1JTYA 2H6CA 4Q4ZF 1N75A 1WQ2A 2MH2A 5B1AH 2WAQN 3HSEA 2W25A 1ENHA 4KMUX 1HOMA 3V78A 2DFHA 1O3RA 2R5ZB 3ZQ7A 4CSWA 2B1EA 1R1TA 1X2NA 4B8XA 2DOAA 1IN5A 3I54A 1O3QA 2W7NA 3OYJA 5DAJA 4TV7A 2AXLA 3RPQA 2UUZA 5F6FA 3TBIA 4B48A 3DEWA 1ETXA 3B6CA 3SDGA 1F5TA 3ZQFA 3VUQA 3K4MA 3IV5A 3GX4X 2MG4A 1F36A 3R4KA 4NB5A 3TO6A 2GA1A 5HAWA 1B8IB 4IHYA 1ETKA 3DTEA 1W5CC 2DJNA 1PVEA 2XSDC 3G3ZA 4I98B 3QQAA 4C2MA 1V4RA 1TW2A 1ZAOA 1RC9A 2ZOZA 3WE2A 3ZQIA 2CWEA 3KZIC 5DD8A 4XLHA 2VKHA 4C9YA 3MWMA 2LLKA 4NC6A 3I4MJ 1ITYA 2QA4I 3F8NA 1DDNA 2DO7A 2R7FA 2CG4A 3ZQQA 1E0EA 2IBDA 2ZFWA 2XRNA 2JVHA 4FX0A 3V7CA 2NS8A 1I27A 1R5ID 5IP6A 2QWWA 1NH3A 1OCCH 2XPVA 1QU3A 1I3AA 3EUPA 4A3LJ 3P9TA 2YX7A 1FSEA 1S3JA 3GO5A 4A3JJ 4RB3C 1S6LA 1FZPB 3HOWJ 2L7FP 1IN4A 2DMUA 4Y33A 2HYFA 2B7EA 1GUUA 5HOOA 1Z9CA 1RRJA 2AXTC 2R7WA 1WZ2A 3FZVA 4MK6A 1DU0A 3SEQA 4F93B 1VFCA 2O9LA 2WGBA 3VVZA 1JT6A 3GW2A 5LGTA 2A3SA 3U1KA 4LG0B 2WV0A 1P4AA 2H1LA 3I0TA 5J1RA 4WK8F 4MQVA 4J19A 2KPMA 5M5WJ 3CESA 5ICFA 4Y4RA 3PNYA 4OINF 4PFPA 4WXHA 1JE8A 5E1ZB 3EYIA 4I6ZA 1Z3YA 3EUHA 1TNSA 3GFLA 1OLTA 3ZP5A 3EGQA 2FJ1A 3HG9A 5BMZA 1D8JA 1I39A 4HX4A 1U3EM 3TKYA 5E17F 3PPBA 1TZLA 3HTAA 1R7JA 2L9RA 2UZKA 4PDKA 3OYFA 2TRTA 5DCMB 1SMYF 3BPXA 4OMZA 5K5QA 3EPZA 2FBKA 5IT3A 3LJLA 3J7AO 5EDNA 2K27A 2MD5A 4E7ZA 4ENJA 4GCKA 3MAJA 3H3UA 1XX5A 2FMYA 2LFBA 1BOAA 4BAYA 3DBRB 1OKRA 4NC7A 2HOSA 3OYAA 3LNQA 1GV5A 4U87A 4BU2A 2HGCA 3E7QA 3BPVA 3CWRA 1Q1VA 2M7BA 5C4XJ 1RR7A 2D2WA 5HLHA 2JT1A 2QSHX 1TQPA 3CZ6A 5HS7A 1PUEE 1OR7A 3UKGA 3ZMUA 1YRNA 3LA3A 1AU7A 3FK6A 2JUCA 3VW0A 1DP7P 1E3HA 2P7CB 3T6NA 2XF5A 4II3A 5AONA 1F1ZA 4OIPF 1K4TA 5J4VA 4M74A 3A0HC 1MH4A 1LUJB 1MBJA 2BYVE 2HFHA 3AAFA 4MTDA 2VBYA 2L2OA 3D0SA 3WG7H 1WWXA 2K4JA 4CCLA 5E1XA 2R7QA 3I56I 2VKDA 2MFZA 3CCYA 4RLFA 1WVRA 1HW2A 2CQXA 3H36A 3WTVC 3HSRA 3ZXSA 4B44A 1ZREA 4O6JA 2O8XA 3HIMA 1SGMA 1AOYA 4PSXA 5M5YJ 2COBA 1VQ9I 2VLAA 1HKTA 1X1AA 4JP0A 3CCSI 2WUIA 4DOZA 1YW8A 2G9WA 3KP4A 2X51A 2O61A 2ELKA 1FNNA 2ESHA 3JRCA 3AL0C 1ZKGA 2NVUB 4S0HB 2XGCA 1BI3A 3C1DA 1ZLJA 1X1BA 4ME9A 1P4XA 3DPJA 3CRJA 3PUBA 3FXMA 4AWXB 3H35A 2O8KA 2B9SA 5CVUA 1W0UA 4E7IA 5J1YA 1D3YA 4P96A 3RJPA 4GGGA 4BBSJ 1GDTA 4XRMA 2EV6A 4ESBA 4I0BA 3A01B 1W36D 4F91B 5DEQA 4UUTA 4BHBA 4E70A 2ZSHB 3AL0B 1HC8A 2ZJ2A 1BW5A 3BT9A 5F0FA 1P92A 2OQRA 1VQOI 1BR1A 3HPGA 4I02A 1FWZA 4IL6C 4ANJA 3MKWB 2M1BA 5C4JJ 1JJ6C 2MD0A 2I10A 5ICEA 5F0CA 1U9OA 3FXOA 3CO6C 1LFPA 3HOZJ 1O4XA 4LLNA 2MGQA 5HNHA 3P7NA 1BI2A 2KZGA 2F5FA 1XPXA 3FBNB 3FISA 3GF2A 3FF5A 4MO7A 4XRFA 3CTAA 4AU7A 1YOVB 1BIBA 3HDDA 5K7ZA 1TWHJ 3S2DJ 2BY1A 5EGOA 3VDXA 4RB0A 5K5RA 4HRIA 1VQ7I 3OL3A 4EVIA 1B6AA 1QVTA 2KIMA 4WCGA 4MEYF 1T8IA 1I6HJ 4ASNA 1MMNA 2XAQA 4M71A 2KRCA 3DF8A 4IQ4A 3GVAA 4ZDLA 2M8GX 2HXIA 2R7XA 3CJDA 1J75A 2QVOA 4NQWB 1FY7A 2PMHA 4A69C 2KKOA 5L3CA 1V54H 2R7UA 2GLOA 3GTKJ 2F2EA 3HYIA 3HB9A 1J9IA 2W84A 2E2IJ 1IF1A 2ZMEA 3W6JB 1R71A 2VQGA 4A3EJ 3I59A 1B59A 2PBXA 1RNLA 4ZDPA 2HOTA 2JA2A 2LMDA 1WI3A 1JXSA 4JKZA 4BYYA 1YS6A 2A5WA 3TL4X 5GAHJ 1FYKA 2BVLA 1I5ZA 4OU0A 2K9NA 2ME6A 3OR1C 3HKZA 4IQJA 2OAZA 5ERIA 3RYRA 4DIQA 1TTYA 1U5TA 5F04A 5D8LB 2EB7A 3HEFA 1G3YA 3S1NJ 3OIQA 4JX6A 2EIJH 3L2RA 2DPUA 2HDDA 1EV7A 4ZC3A 3KYDB 3O3KA 4YFKF 3T1BA 1OCOH 2EA2A 2FJI1 5FHPA 4LIVA 4EV0A 2WV1A 2HNHA 4CYCA 1B9NA 2PLYA 2DTRA 5FB2A 1MGTA 1VNDA 3KE2A 1HA8A 3E6DA 5D5WB 3M8JA 3RYPA 4BJTA 4GRIA 4EEFG 1T38A 3W6VA 3KKDA 1G2HA 3QU6A 1ZG3A 4UVCA 2WAFA 2XROA 4IHXA 3KP6A 5ED4A 2OJED 2GA2A 3V6GA 4C30A 3ZN1A 2X1DA 4YIFA 3FK7A 3MMYB 5DCFA 4H4KC 1HXDA 2UXPA 4RM3A 2E1OA 3OMYA 4Q5SF 2IAIA 3KYLA 4KFCA 3DLAA 2A6HF 4PJJA 3J80K 1MSEC 3Q3SA 2HVQA 2L54A 2DA3A 2WB1A 3CJQB 3H9GA 5D6FA 3ISPA 3HIFA 3WTWC 4MHGA 4RA2A 2O6GE 3ML6A 4XICA 5C4YA 2ZXWH 3DBLB 3ZMZA 4F7ZA 3C7JA 1ZN2A 5J3LA 4IZZA 1IRZA 5HLIA 3CCVI 2JA5J 3LSPA 2XAGA 1O3SA 4RDUA 4GCTA 5HDGA 4HSTA 3HOVJ 2BXYA 3CC2I 3HUGA 1J0RA 4EMSA 2ID6A 4FQGA 5J8FA 3E5QA 5LHGA 3K8PC 3ON4A 2HI3A 2O0YA 3W3CA 2DMTA 2IXSA 2QENA 3BG9A 1MBFA 1QQIA 1KZHA 1QPIA 2HEOA 1AKHA 4X0GA 4L5IA 3NRVA 4M6XA 1X3UA 1T95A 3MKYB 2BE5F 1D5VA 3LAJA 1MJ9A 1YLFA 1XMXA 1IN7A 1JUSA 2ZO4A 4ZYDA 3HBLA 4L9VA 3GTLJ 5CW8A 4KT5C 5FFXA 4C2TA 2FOWA 1YIOA 2O5RA 4PJNA 2QSGX 3L2QA 2XSJC 2HQ5A 4MNUA 2ACJA 2ZXJA 2VL8A 4ZZDA 3Q9SA 1J2XA 2DA5A 5CVIA 1HSJA 1GXQA 4C3IJ 2H1KA 3AG3H 3RTRA 1I50J 2W85A 1N25A 3LMMA 3RIRA 4ZYGA 2OTLI 1FP2A 3EDPA 5F64A 4BEHB 2A07F 2VJIA 4AIJA 3B02A 3GCMA 2Y48A 3TP3A 1MJBA 4QIWN 1LQ1A 3BG6A 1TC3C 2DI3A 3CCEI 3WU1B 2EBIA 4J01A 3MD2A 5BQTA 1IRGA 1TNTA 2IA1A 1K78B 4IVNA 1R58A 2VBWA 4A2UA 2XIGA 1YFHA 2V6CA 2EV0A 3V42A 2HQNA 3FXLA 4L9TA 3JSOA 4XBFA 3ULQB 2DT5A 1H89C 4CUGA 5AQCA 3ZR8X 1QRYA 1C0WA 3RKXA 5EJCA 1JKOC 5L3DA 2HXOA 4HDUA 5EZHA 1TW3A 3LFUA 2AS5F 3FBIB 1SVLA 1ULYA 1XMAA 2AQEA 2ZNYA 4C3JJ 2D6YA 2L9SA 2ZC2A 3CC4I 1RUOA 1RUNA 3OYHA 2LD5A 1EF4A 1OYWA 3KIOA 4IEJA 4B47A 3HTIA 3S32A 3LA2A 4LMYA 4ZYEA 2MLKA 4PZJA 3LOCA 5FLXZ 3CJRB 2WADA 2Y75A 1U8RA 1JUPA 3RKQA 1KYWA 1LEBA 4EGYA 1VTNC 4JOMA 3RPUD 2BW3A 3GEUA 1IXSB 5D8KB 2H94A 3GZ6A 1XGOA 4LD5A 2AO9A 4HV5A 2G7SA 1FJLA 2E5ZA 3CCLI 2DCEA 2IGNA 5K1YA 5LHIA 4XLEA 1QGPA 1XSVA 3WGHA 2ZY9A 3VVYA 1ZHFA 4I0AA 3BG3A 2CQKA 3HRTA 5FKLA 2IVMA 3SZPA 3E97A 4FHTA 2ADUA 3H3ZA 2X1CA 3F1BA 2DAOA 1VQKI 4K2EA 4EJOA 5C44J 3FXKA 3NRGA 3I9V2 4XK4A 2XVCA 3QP6A 2W82A 3HXLA 5H20A 1PJRA 3PM1A 5AIQA 1MW7A 3DEUA 4A0YA 4QLCU 2UXIA 1LE8B 3VVXA 4G6QA 2YS9A 2K3FA 2P8TA 4AC0A 2F6CA 5AIPA 4OOIA 1XC5A 1X3WB 1FYLA 1FYMA 1GVDA 1R5HA 1R9TJ 5TGTA 4MXMA 2HKOA 5H2FC 4F52A 5JFRA 1GXPA 3ANGA 2GM4A 5E8IA 2EZIA 2E2HJ 3E5UA 3GTQJ 3VSKA 3Q0UA 2Y0SA 1X1PA 3QKXA 5D5UB 3IH4A 1GHCA 1ON2A 3ONQA 1R4NB 2CQ7A 2XB0X 1R6RA 3TGNA 4RB1A 4UB6C 3QRFF 1QO0D 3JW4A 2NNYA 2L7MP 2HZDA 3BOQA 3F8FA 5IT9K 4NELA 2XPUA 4DBQA 1ERDA 4JBAA 3NQOA 3OSGA 2G3BA 3O2PE 5JLWA 2ZCWA 2H27A 3TW6A 1U6GA 2NOJB 2PZ9A 2PMZA 3KEYA 2IT0A 2FF4A 5CPRB 3H5NA 3HRUA 4IHSA 1TP4A 1X58A 3BNIA 1W7PD 4L9NA 2KT0A 3WG9A 4P9UA 2XF6A 5F08A 1YJ9I 2JA7J 2I5UA 1QHGA 2XGEA 2YUSA 1YQAA 2Z1DA 5J4YA 2H8WA 4BQNA 3ZOBA 2HYTA 2CJJA 4LJZF 3HTUA 5EG0B 5GADJ 1DPRA 1VQMI 2ZJQF 3S5RA 3EUAA 4AIDA 2IPQX 3WHBA 4A6EA 2M34A 4ZYHA 3F6VA 2CV2A 4UNOA 1Z3XA 1WJEA 2X85A 3PNVA 3SZGA 4EQQA 2D5VA 4ESJA 4L0ZB 3B81A 4IHWA 1WI9A 3FXJA 2NOGA 4DVYP 1V5FA 2K02A 1EA3A 1ETOA 3PSFA 4XLAA 2YSRA 5E18F 3WU0A 2GWRA 2KJBA 1IV8A 3BJ6A 4I01A 1W7PA 4Z6YA 1JTXA 3IH2A 2EFWA 5TJJA 1A04A 2ZOYA 1W0TA 2JSPA 2X6OA 4DZPA 3G6EI 4EJVA 2ISZA 2VOPA 3VTIA 4QPOA 4Y52J 5FKOA 2CV1A 2Z16A 1J5YA 3B73A 3VIBA 1YO5C 3TW7A 4L62A 2L02A 4F3QA 3EYYA 5DUKA 3GLXA 2GAUA 4F92B 4DYRA 1FMWA 2NVXJ 3VFZA 3FMSA 5IPAA 3G2BA 3ABKH 1DQUA 3RD3A 1TL8A 5GTHC 5HNFA 3O8GA 1S7AA 4CICA 3V7RA 1P4WA 2HQAA 4YELA 5K5OA 3OYGA 4UY8I 3IC7A 3S2WA 4HF0A 4X1EA 2CV0A 2ZFUA 2J5OA 3GZIA 1ZR2A 3MNLA 2DMPA 2XRLA 1UI5A 2HS5A 3C18A 4UUVA 2O3FA 2RREA 3MN2A 4YFXF 4M3DA 2PEXA 5F27A 2RGVA 2G7HA 4CXFA 1L3LA 1ZELA 2WC2A 4BHCA 1ZGWA 2RQPA 3BG7A 3C2BA 1A36A 4GXOA 2KL4A 3CCUI 4GCLA 4AVPA 4D0PA 2QSFX 4E7LA 3G1MA 4B4CA 1Z6TA 2M0MA 3DKYA 3OIOA 1P2FA 4Q47A 4AIHA 2QQ9A 2XUBA 5E20A 2W53A 4E7SA 3I55I 3NWSA 1YJWI 3EUHC 2UXUA 2P81A 2P5KA 2HPIA 2VT3A 3H0DA 1JKPC 2R5YB 4E7KA 1Y6IA 1BI0A 4EM0B 3F0CA 4S05A 2R4GA 3OS2A 1KGSA 4GFBA 2RN7A 4KJZA 5FROA 4BH9A 1D5YA 1AHDP 4Q48A 4Y17A 2X6WA 2XKPA 1RESA 4XKBA 3RSNA 3WTTC 2ZCMA 3W6KB 2ESNA 2LVSA 2JSCA 3PFYA 2O03A 2RKHA 3NEUA 2COMA 2XKOA 2VIXA 3K4BA 3ON2A 2D1HA 2NP3A 5CJ9A 2Y31A 4EJWA 2PJRA 2DK5A 4Y15A 4HNTA 4OAZA 2Q1ZB 4ENMA 1G59A 2IS6A 2NYXA 4PXIA 3R61A 2IGOA 3LFKA 4BBRJ 3E0JB 4BE1A 4KIGA 5LFAA 2KRFA 5FLMJ 2B3WA 4XSZF 5K7HA 2OI8A 1JT0A 4A3CJ 2FQ4A 3QWLA 3CMEI 1OR7C 2IA0A 3GTGJ 2XGXA 5HDNA 1MDMB 1M1EB 2DDAA 2EH3A 1SMTA 3HC7A 1NHAA 4U7DA 1OYYA 4P5OA 3NI7A 3IUVA 4AD9A 1D0ZA 3VW1A 1Z67A 2CUFA 3S1MJ 1J7KA 1YJNI 1JHFA 3OYBA 2REKA 1AWCA 3E7LA 3F6OA 2XGDA 4YRVA 2E60A 1ZGAA 4A5NA 3IP4B 1K6OA 5EYRA 4ESFA 3BRUA 5F0HA 2E34A 2K9LA 4A3MJ 1YRNB 1FBUA 4LB6B 3U9GA 5CQGA 3K69A 1LB2A 1IUFA 4WWCA 4M3EA 5KAIC 3I5UA 3LAPA 1PUFA 2NS0A 4M9XA 3ZRGA 5TRDA 5FLVA 4GDFA 3QPHA 1IW7F 2BBYA 1RI7A 5DD4A 2M0CA 3N05A 2VASA 2F07A 4U9NA 2CH0A 4RAYA 1G3WA 1SFOJ 2EV5A 1APLC 1L0OC 2CFXA 4RGRA 1K79A 1GT0C 3E1SA 3WTUC 2LNBA 1BC7C 3HGGA 2YU3A 1WCMJ 3U2RA 5KVRA 2M45A 2X6YA 3OV8A 4EATA 2DA6A 5FGLA 1HDDC 3JRAA 1UG0A 1ETYA 2R7ZJ 5CQEA 1V5GA 2XASA 5E3OA 3GTPJ 2DG7A 3JSPA 2OCCH 2E7XA 2G7LA 3DPUA 3AQSA 2P0WA 2DBBA 3GFMA 3SXYA 4DGWB 4IKFA 2HU9A 3EETA 1HW5A 2Z9OA 4LG0A 4KN7X 4LGWA 4CZZA 3TEDA 2GOXB 3BLYA 2K9QA 3SFIA 1LNWA 1XD7A 1BJZA 5CXIA 1MNEA 3HTHA 2Y30A 1USSA 5HBUA 2E2JJ 2GXGA 1CF7A 1EJ9A 3KNWA 1XDSA 3HHHA 4HLXA 2FQ3A 1D0YA 4U0VA 3DPLC 3DCFA 3BR2A 4ACIA 2OZUA 2LBFA 2WA0A 2CW7A 3E3VA 3HHGA 1W36C 1B1BA 1VQ6I 3G4SI 2X4HA 5L3FA 4HAMA 3S17J 3QAHA 3A0BC 3FIWA 2F4IA 4DQ2A 3M4OJ 2IS4A 3JSJA 2D45A 3W2WA 5ILSA 3OS1A 2CW0F 2CUJA 4XKCA 4E6KG 4Y13A 2ECCA 3I4NJ 4E7JA 3H5AA 4IRGA 2DT7B 4HG2A 5IYBJ 1WJDA 4PJ0C 1G4DA 3PO3J 3K10A 4L18B 4BXXJ 4M9SA 2BHZA 5EEGA 3JRDA 2OU2A 2E35A 5CVJA 2ZMEC 4BNCA 1U78A 3K70D 3N4MA 5EGOB 4GFKA 3BQZA 4HEA2 1BIAA 2R93J 5FFZA 1KA8A 2IA2A 3DU5A 5DS9A 2HVRA 3FMRA 2IS2A 4BE0A 2JWTA 1WJAA 5FMPA 4GYGA 2CQNA 2WBMA 5GTIC 3RH2A 1K83J 2EIMH 1MBGA 3KYCB 1U5TC 3JRGA 2DJIA 2BZTA 3G1LA 2ICWG 3WGIA 4A93J 4HQMA 2LP0A 3L1PA 1VF9A 4EJTA 1G3SA 4PFOA 2JN6A 3I59B 3I53A 2QEXI 1ZRDA 2OA4A 1BJAA 2UXXA 1TWCJ 3F8MA 4QPQA 3V8KA 3HRSA 4BS9A 4EM1A 4BGDA 3G73A 4BY1J 2FNAA 2LRDA 2PI0A 4KT6A 3TOAA 4BE2A 2GXBA 3CLOA 2DMQA 2VQHA 3GBGA 4AC6A 2F48A 2LTPA 1ZYRF 1YE9A 3SYTA 3K4CA 5J6XA 5IYCJ 3WTXC 1FBQA 1U5TB 2V1UA 5ICGA 1TWFJ 1RZ4A 2P4WA 3T8RA 3GFJA 2QZ8A 2VOOA 2LY9A 3F8BA 2V26A 1SANA 1JJ8C 2R7SA 4LK1F 2DQLA 1U0JA 2K86A 2TDXA 5B1BH 3ZQHA 4CYCB 4DJAA 4NN1A 2V7FA 3TO7A 5BNGA 5C3EJ 1V5EA 3Q0VA 2R7RA 3K9TA 2PG4A 1H9GA 2WAQA 1K7AA 1FOKA 3LSIA 2YVHA 3A01A 3R6SA 2VXZA 2ZXHA 1HCRA 2VE8A 4WXDA 2MLGA 5D5XB 2RC4A 3EUKL 4H0EA 5L3BA 2K9SA 4KUMA 3KFWX 3DFGA 4M9ZA 1XCVA 2L7KA 5DV5A 4BUPA 2KIUA 2Y0SN 3CF2A 1TT5B 3BR1A 2FBIA 3D1NI 2K7LA 4PJLA 3FXQA 3K2ZA 1YW7A 3AG1H 1D8KA 4XOTA 5JHUA 3P5JA 4KIFA 4B1RA 2WWYA 4D5FA 1NK2P 4KMFA 3CLQA 3R0AA 5ILVA 3F72A 3VYTB 2JUGA 2QTQA 3AQTA 4UHTA 3C2GA 4ZTJA 1F4KA 3JAMZ 5BOXA 2EZHA 2PFVA 4PSWA 3E6CC 5BPDA 4A3IJ 2BGCA 1LJ9A 5KHDA 3PIOF 3DU6A 5E1WA 5D18A 3WGGA 1PYVA 1TQIA 1H8AC 3ECHA 4HOBA 3HZJA 3AG4H 4KITB 2RNJA 3HUGB 3MZYA 1ETVA 1S7OA 3T8TA 2GIVA 2Q2EA 5J1UA 5DM7F 3JRFA 2L3DA 1IGNA 4XRSA 3KP2A 4PGGA 2OBPA 3ZMSA 2JJ7A 4M3FA 1K4SA 1SFEA 4IPAA 1OJLA 4NQWA 1HDPA 2J5PA 3H92A 5J40A 3TO9A 1VQNI 3X2QH 1MSFC 2RASA 4XM3A 2JRMA 1HLVA 4HKUA 2WY7Q 1B72A 3S8PA 3SHFA 4RBOA 4B43A 3OL4A 5DTDA 1XMKA 1Z05A 2ZCXA 4YZEA 3VOKA 1HKQA 1H9TA 4AYBN 1FIAA 5ILUA 4O3MA 2KP6A 1UMQA 1D1CA 3W2VA 3NS4A 4G12A 3BG5A 3KETA 3DBHB 1R23A 4HDVA 1MKMA 1QZZA 2OD5A 4JNNA 2GUHA 2NNNA 2HR3A 1N77A 5H9TA 2CUEA 1FP1D 2HTSA 2OV7A 2W48A 4QTRA 3CMYA 1S29A 4W1UA 4UV9A 4HNVA 4BY7J 4D7MA 4I2OA 3FDYA 4PK4A 2M30A 6PAXA 1ONVA 3IAM2 4RS8A 1SVOA 3F8CA 4F55A 3TMOA 1ZG5A 3M07A 1A31A 4I99C 4UUSA 3GMEA 4IX7A 3CJTB 3PQKA 3DKXA 2L9VA 1XGMA 3MCZA 3CUQA 4FETA 2DOFA 4HV6A 2HDWA 3B6AA 2M4KA 1EKEA 1EH6A 5E3NA 1V55H 1YX5A 3WTZA 3GXOA 2FXAA 5HDKA 1Y8QB 1ETQA 1FTTA 3CDIA 1LKXA 3PNTA 4V2FA 1K61A 2LOOA 5CYVA 4IOCF 2LR8A 3OIPA 2TCTA 3LWJA 1WRJA 1R36A 3DTIA 3K6GA 5M3MJ 5FGMA 4ZZLA 2BEOA 4M6VA 4ENNA 3OY9A 4JQFA 4HLYA 2YR2A 2BW3B 2W57A 3LQRA 4U88A 1KU7A 1UAAA 3VOEA 3S1QJ 5CVVA 5B5EC 4OAYA 1SD4A 2EFOA 4M3GA 2V4JC 3JR9A 1FLIA 2EJRA 2NP5A 3D5LA 1A6IA 1RKWA 3S14J 1UCRA 5LHHA 3HPHA 1AA7A 1QA6A 3S3OA 2IGKA 2PN6A 2K5CA 3CDHA 1TQMA 5HS8A 3H1CA 1FIPA 1W1WE 2ZBKA 3HE0A 4DBRA 3IRRA 1I1SA 2QBYB 3GZ5A 2QUFA 3MKLA 2ISYA 1IN6A 4YFNF 3G56A 3KEQA 2STTA 2MH9A 1POGA 3T5XA 1IJWC 4CGZA 3COLA 2W4SA 5D4RA 2QQ8A 5LGUA 3CF5F 1A5JA 5FKNA 3KX2A 2XAUA 2DK8A 4BEHA 3NPIA 3H0GJ 3IRQA 5D5VB 3WE3A 4ABZA 4NUBA 4U0WA 3TP0A 1DPUA 3KLNA 2KRHA 4XKWA 1G6NA 4A3BJ 3CCMI 2HQRA 3M7GA 2QOPA 4P9FA 5KNLA 2OERA 3NARA 3IKVA 2Q0OA 2IW5A 2VI6A 3BC8A 2XAJA 1RPWA 2A68F 2EINH 3D5RC 4U9LA 1ZTRA 3K1PA 2KQRA 4IJAA 2VBZA 5K7FA 2A2FX 3VP5A 3RZOJ 4JX4A 5FRMA 4NBQA 3V8JA 4Y3OA 3ABMH 5CLSA 1LFUP 4IRVA 2VB6A 3CMAI 2LK2A 4L5JA 4JYKA 3ZMDA 4P55A 5JLXA 5EFYA 2QKLB 4G7ZF 2F5CA 2M5WA 3HOXJ 1BW6A 4D1QA 2W24A 2JRTA 1XSXA 4XR6A 1I1GA 5KAFC 2VQCA 1FOYA 2V1DA 1CGPA 2PMUA 1T0FA 2XC7A 5IYDJ 1A6QA 5B66C 2LKPA 1UFMA 3M1CA 2ME0A 2XB5A 1E2XA 4DW6A 2Q8KA 2OC6A 3SEZA 2LKXA 4KA4A 2DU9A 4LIUA 1UHSA 2P6TA 2E36A 1WKMA 2CFOA 5FKMA 1P9QC 4C2UA 2VKEA 5A2QZ 5LEKA 5KCMA 3HTSB 2EZKA 2ELJA 3UR3C 3S3MA 1W7PB 3O8HA 3OYKA 1IXRC 3ROUA 3K1MA 1X4OA 4P1WA 3GLLA 3KP3A 3QBMA 1STZA 2ZSIB 4ZH4F 3FX3A 2PX9A 3ZMTA 2P6SA 2FBHA 5EZGA 4HSRA 5IOZA 3LSKA 5LBQA 3MKZA 4LB5A 2JMWA 1LVKA 3K0LA 1SFKA 3UNGC 1XGSA 3CCRI 1IO2A 2FBQA 2LSOA 2NS7A 2E7WA 4S04A 3A2KA 2NVTJ 3ELKA 3SDBA 2RDPA 4CCMA 3E6MA 1Y0NA 1U2WA 2Z2SB 1BN5A 1XN7A 3JTGA 2M3AA 4C2MJ 2WAEA 4RGXA 1Y1VJ 1SAUA 3I64A 3LSJA 2DFIA 1TWAJ 2GBYA 3IHUA 1IZ1A 2Y69H 2KIQA 3L7WA 4HYEA 3O6BB 4FE7A 5J47A 1D1BA 1GLNA 3I4PA 4GO1A 2KISA 2F4OB 2L5QA 4N9IA 4ZYAA 5IP7J 1KU3A 1S8NA 1J09A 4G7OF 2FOKA 1ZR4A 4MFEA 1JUMA 1T08B 3GEZA 5F1RA 5DM6F 4G7HF 9ANTA 3OWTA 1Z1DA 1FX7A 1D1AA 1XDUA 2A05A 2VPLA 4BXFA 2LKSA 4N0BA 2QM3A 2OF7A 4BJ5C 1WHUA 3KZZA 5KK1A 4J00A 1YS7A 1F43A 4N4NB 2KDOA 4A5MA 3P9CA 1MD0A 1UHMA 2V1XA 4RAZA 1P7JA 2QF7A 1T98A 5J8CA 2NXNB 1R1VA 3BTJA 4G94A 1PP8F 2ZB9A 3JAMK 4XMYA 3SJMA 3VODA 2Y9ZA 3GWZA 4CH7A 3C3WA 2VKVA 3NXCA 2BY2A 4KYWA 5GAGJ 3OYCA 2EFQA 2PJRB 2A6EF 4YIIA 5H6RA 1UB9A 3ASNH 5HLTA 4PJMA 3IWZA 4CCJA 4R79A 5GAEJ 1XGNA 3Q0WA 4V19K 3DQVC 3S15J 2NX4A 3A1YA 2VODA 4MIMA 2O7TA 2KJCA 3OOUA 2HKUA 2G0EA 5DYMA 4XIDA 3VW2A 2R3SA 1Y0UA 2IP2A 4LFUA 2R7VA 1MMDA 1G8XA 4GCVA 3R60A 1VI0A 2ID3A 1WPKA 2L4MA 1JGGA 4CHUA 4XONA 3VB2A 3GTOJ 3BTCA 2Z33A 3ESWB 2W00A 3J7ZI 4UVBA 1RIOH 1W4MA 3JRHA 1J59A 4DNCA 2CS3A 1IDZA 2L7ZA 4B3XA 1REPC 2HWVA 4WXCA 2K9MA 3HKZN 4JL3A 2LC2A 1DUXC 3I58A 3FRQA 3PQJA 1IN8A 2VJ4A 2LF7A 3OYEA 3HM5A 2VBXA 1UI6A 1O57A 3LL7A 3LA7A 4V2GA 3GFIA 1LDKB 1YI2I 1FT9A 1VQ8I 3W2AA 1S5LC 2Y2ZA 2EFNA 4NHJA 1YITI 2R7TA 2M2EA 4M6YA 3OYIA 4G6DA 4FX4A 1PUFB 1XS9A 3BCAA 1MMAA
chains in the Genus database with same CATH topology
3G1LA 3HTJA 3ZQLA 4A93J 2LP0A 3L1PA 3BCGA 1JUSA 1VF9A 2K40A 2YU9J 3HBLA 2CRGA 2IEKA 3GTLJ 2JN6A 5CW8A 1LE8A 2R5ZA 2MSYA 1TWCJ 4L5EA 1Y1WJ 1XG1A 4BY1J 2HQ5A 2ZCNA 2DA5A 3NAUA 2DMQA 4C3IJ 2H1KA 3GBGA 4AC6A 1I50J 5EEAA 2WB1N 2LTPA 3HOUJ 3ZQGA 5IYCJ 2R5YA 1QVUA 1B8IA 1LFBA 1ZK8A 1TWFJ 3G7RA 2L0KA 3TP3A 2LY9A 4A3GJ 4QIWN 5FJ8J 3JREA 1DU6A 3K2AA 1SANA 1TC3C 1JJ8C 3HGYA 1TWGJ 2EBIA 2EQRA 3ZQHA 4CYCB 3RZDJ 4NN1A 5BNGA 5C3EJ 5E3LA 3Q0VA 1ETWA 2RHAA 2G7GA 2YVHA 1H89C 2O7OA 3A01A 5AQCA 4A3KJ 1QRYA 1HCRA 3BR6A 2VPRA 1JKOC 2HXOA 5GP9A 2K9SA 5EZHA 5CXGA 2Y0SN 3S1RJ 3O60A 3BR1A 3A03A 4C3JJ 3D1NI 5HSZA 2D6YA 3K7AJ 1ZQ3P 1EF4A 2LD5A 4B1RA 4IEJA 4FCYA 4D5FA 1NK2P 3HTIA 3ZQCA 5EG0A 3LOCA 4D7NA 2QTQA 5IOYA 5E3MA 3AQTA 1JUPA 3RKQA 2B63J 3WHCA 4IHVA 2EZHA 5D1RA 2ECBA 3GEUA 5M3FJ 4A3IJ 5D18A 2AO9A 3VPRA 2G7SA 1H8AC 4NDLA 1FJLA 3VOXA 1UG2A 2AHQA 3JRIA 1ETVA 4W97A 5J1UA 3JRFA 3VVYA 1IGNA 3BG3A 3FKIJ 4XRSA 3LHQA 2OPTA 5FKLA 2NVYJ 1NK3P 2JJ7A 3CQZJ 4M3FA 5GPAA 3RQIA 3F1BA 1OJLA 1OCPA 4X6AJ 1HDPA 1MSFC 2RASA 1JKQC 5C44J 4JX5A 1HLVA 4HKUA 3NRGA 1OFCX 4XK4A 1B72A 1JTYA 4RBOA 4KWAA 2WAQN 1ENHA 2MW8A 3PM1A 5DTDA 1HOMA 3V78A 2ZCXA 4YZEA 3VOKA 4AYBN 2UXIA 1LE8B 1FIAA 2R5ZB 3VVXA 5K58A 3KKCA 2YS9A 1X2NA 1UMQA 5DAJA 4AC0A 4G12A 3BG5A 3DEWA 1ETXA 3B6CA 3SDGA 1XC5A 3ZQFA 3VUQA 3IV5A 2MG4A 4JNNA 1F36A 2GUHA 1GVDA 4XRSG 1R9TJ 2Y9YA 4MXMA 5H9TA 5HAWA 2CUEA 1B8IB 4IHYA 1ETKA 2W48A 3ANGA 2DJNA 2XSDC 4QTRA 2GM4A 2E2HJ 2EZIA 3GTQJ 3QQAA 3BTLA 3MVPA 3QPSA 4W1UA 3CMYA 3M3YJ 4HNVA 3Q0UA 4BY7J 4D7MA 3BR5A 2ZOZA 3QKXA 3IH4A 3ZQIA 2XB0X 2LLKA 3I4MJ 1ITYA 4LOCA 4UUSA 2DA1A 2DG8A 2UXOA 3GTJJ 2L7MP 4NELA 1T56A 2XPUA 2IBDA 2G3BA 3OSGA 5JLWA 2NS8A 5IP6A 3TW6A 2PZ9A 3IH3A 3B6AA 2XPVA 5E3NA 3EUPA 4A3LJ 1X58A 3P9TA 3BNIA 1X2MA 1WGXA 4A3JJ 2DMNA 3HOWJ 2KT0A 2FX0A 2L7FP 1ETQA 5F08A 2JA7J 2DMUA 2XGEA 1FTTA 4V2FA 2JK3A 1K61A 2YUSA 1GUUA 2LR8A 3CDLA 2TCTA 3LWJA 3ZOBA 2HYTA 1DU0A 2CJJA 4MK6A 1VFCA 2WGBA 5EG0B 2O9LA 5M3MJ 3VVZA 1JT6A 1U9NA 3PO2J 4M6VA 3S5RA 3WHBA 2M34A 5J1RA 1Z0XA 4J19A 2X9DA 5M5WJ 2D5VA 3B81A 3S1QJ 4DYQA 3HOYJ 4IHWA 2M9HA 2NOGA 4M3GA 1ETOA 2JA6J 3JR9A 4I6ZA 4MLOA 3EGQA 2NP5A 2FJ1A 5F1JA 2UXHA 1A6IA 1RKWA 1JTXA 3S14J 3S2HJ 3IH2A 3PPBA 3HTAA 2L9RA 2ZOYA 2TRTA 1FIPA 3HE0A 4FTHA 3LJLA 5EDNA 1W0TA 2X6OA 4DZPA 1JKRC 4A3DJ 2N8GA 2R0QC 3MKLA 1FEXA 1B72B 4GCKA 1CQTA 2CU7A 3G56A 2LFBA 1POGA 4Y52J 2XPWA 5FKOA 2HOSA 2V57A 3LNQA 1GV5A 1IJWC 3C07A 3VIBA 2PMZN 3TW7A 3E7QA 4L62A 3COLA 3CWRA 1Q1VA 1S7EA 2XDNA 2DA7A 1A5JA 3GTMJ 5FKNA 5C4XJ 1RKTA 4A3FJ 1FTZA 2YVEA 1RR7A 4DYRA 2NVXJ 3NPIA 1YRNA 5IPAA 3UKGA 3H0GJ 2NVQJ 1AU7A 3FK6A 3PASA 3RD3A 3VW0A 4ABZA 3TP0A 3T6NA 4FISA 1OCTC 2VUMJ 2X48A 3O8GA 4A3BJ 3BR3A 1P7IA 2QOPA 2OERA 4Y7NJ 4X1EA 1MH4A 3NARA 1MBJA 3GZIA 5GPCA 1ZR2A 2DMPA 2VI6A 2XRLA 1Z77A 1AKHB 1UI5A 3BJBA 3MNLA 1RPWA 3MN2A 4M3DA 5F27A 4UUSB 1ZTRA 1BA5A 5D19A 3CCYA 5K7FA 3VP5A 3RZOJ 2CQXA 4JX4A 1ZGWA 1MBEA 3C2BA 3ANPA 4GFLA 2QWTA 3HIMA 1SGMA 4I76A 1LFUP 4GCLA 5M5YJ 2LK2A 2COBA 1E3OC 4JYKA 3G1MA 4B4CA 5JLXA 4JP0A 3OIOA 5EFYA 1I3QJ 1MNMC 2W53A 2WUIA 3HOXJ 1BW6A 4C3HJ 2UXUA 2ELKA 2P81A 3JRCA 1ZKGA 4S0HB 1JKPC 2R5YB 2XGCA 4BKXA 2KDZA 3F0CA 2QKOA 4ME9A 5IYDJ 3DPJA 2EZLA 1MBKA 3CRJA 4GFBA 4AF5A 1D5YA 1AHDP 1T33A 2O8KA 2ME0A 2XB5A 4DW6A 1RESA 1W0UA 2LKXA 5J1YA 2ZCMA 2LVSA 3H3VK 1H88C 4BBSJ 4D5CA 1GDTA 4XRMA 1UHSA 3ON2A 3BTIA 2DA4A 2NP3A 1GV2A 2Y31A 5FKMA 2VKEA 3A01B 2DTZA 3NNRA 4PXIA 4UUTA 2EZKA 4BBRJ 3O8HA 5FLMJ 1BW5A 3BT9A 4QSHA 5F0FA 5K7HA 2OI8A 1MBHA 1JT0A 2FQ4A 4A3CJ 3QBMA 1IG7A 3GTGJ 2H8RA 2EH3A 4B3AA 5C4JJ 1JJ6C 5EZGA 5IOZA 2I10A 3IUVA 3NI7A 5F0CA 1U9OA 3VW1A 2JMWA 2CUFA 3S1MJ 3HOZJ 1O4XA 2MGQA 2R92J 2NS7A 2FBQA 2REKA 3E7LA 2XGDA 4AUXA 2NVTJ 3FISA 4UDSA 1HF0A 4MO7A 4FE4A 3LSGA 3BQYA 5EYRA 3HDDA 5K7ZA 3BRUA 1TWHJ 5F0HA 3S2DJ 5EGOA 4C2MJ 4A3MJ 1QVTA 2DA2A 1YRNB 1Y1VJ 3JRBA 3LSJA 1TWAJ 1I6HJ 1ORKA 2GBYA 1IUFA 4M3EA 1WH7A 2M8GX 1PUFA 2HXIA 2FD5A 4FE7A 3CJDA 5FLVA 5IP9J 3G1OA 4A69C 5IP7J 2GLOA 3GTKJ 2M0CA 3A02A 3HB9A 4DZJA 2F07A 2E2IJ 1ZR4A 1SFOJ 1APLC 4A3EJ 2PBXA 4MFEA 1JUMA 1GT0C 2HOTA 1NTCA 1RETA 1WI3A 9ANTA 4JKZA 3HGGA 1WCMJ 3BR0A 2K9NA 5FKKA 2ME6A 2DA6A 5FGLA 2JA8J 2QCOA 1HDDC 3JRAA 4ICHA 1ETYA 2OF7A 1BL0A 2QIBA 2R7ZJ 1F43A 5E3OA 3GTPJ 2DG7A 5F04A 1WH5A 2CQQA 3HEFA 4M3BA 3S1NJ 2G7LA 4CGRA 3AQSA 4JX6A 2HDDA 1P7JA 3QPLA 2QF7A 3TEDA 3S16J 5CXIA 5FHPA 2K9QA 3SFIA 1BJZA 2WV1A 4CYCA 3BTJA 2ZB9A 2Y30A 2GENA 3HTHA 3SJMA 1VNDA 3LSRA 5HBUA 2Y9ZA 2E2JJ 5EF6A 3W6VA 4EEFG 3KKDA 3KNWA 1G2HA 4IHXA 2DN0A 2VKVA 3NXCA 3V6GA 3DCFA 3BR2A 3OSFA 4ACIA 3FK7A 2UXPA 2E1OA 2IAIA 3Q0WA 1MSEC 3Q3SA 3S15J 3S17J 2DA3A 3FIWA 2NX4A 3M4OJ 3JSJA 2GFNA 4MIMA 1IC8A 2O7TA 3OOUA 3VW2A 2HKUA 2G0EA 4XIDA 2ECCA 3I4NJ 5HODA 4XICA 5C4YA 5IYBJ 1VI0A 3KZ9A 2ID3A 1WPKA 1MH3A 3PO3J 1JGGA 2E19A 5J3LA 3GTOJ 3BTCA 4BXXJ 4DYCA 5M5XJ 1IRZA 2JA5J 3LSPA 3JRHA 3JRDA 3BHQA 2HYJA 1IDZA 2L7ZA 4RDUA 4GCTA 3HOVJ 3HKZN 4JL3A 1U78A 1U8BA 3FRQA 5EGOB 1UI6A 3BQZA 4GFKA 3HM5A 2HOAA 2ID6A 2Q24A 4V2GA 1IV6A 2R93J 2Y2ZA 5DS9A 3ON4A 2IU5A 2HI3A 2M2EA 4MFDA 2DMTA 2JWTA 5FMPA 3BG9A 1MBFA 1IDYA 3RH2A 1K83J 2RAEA 1QPIA 1PUFB 1AKHA 1MBGA 1XS9A 3JRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1L A;  3HTJ A;  3ZQL A;  4A93 J;  2LP0 A;  3L1P A;  3BCG A;  1JUS A;  1VF9 A;  2K40 A;  2YU9 J;  3HBL A;  2CRG A;  2IEK A;  3GTL J;  2JN6 A;  5CW8 A;  1LE8 A;  2R5Z A;  2MSY A;  1TWC J;  4L5E A;  1Y1W J;  1XG1 A;  4BY1 J;  2HQ5 A;  2ZCN A;  2DA5 A;  3NAU A;  2DMQ A;  4C3I J;  2H1K A;  3GBG A;  4AC6 A;  1I50 J;  5EEA A;  2WB1 N;  2LTP A;  3HOU J;  3ZQG A;  5IYC J;  2R5Y A;  1QVU A;  1B8I A;  1LFB A;  1ZK8 A;  1TWF J;  3G7R A;  2L0K A;  3TP3 A;  2LY9 A;  4A3G J;  4QIW N;  5FJ8 J;  3JRE A;  1DU6 A;  3K2A A;  1SAN A;  1TC3 C;  1JJ8 C;  3HGY A;  1TWG J;  2EBI A;  2EQR A;  3ZQH A;  4CYC B;  3RZD J;  4NN1 A;  5BNG A;  5C3E J;  5E3L A;  3Q0V A;  1ETW A;  2RHA A;  2G7G A;  2YVH A;  1H89 C;  2O7O A;  3A01 A;  5AQC A;  4A3K J;  1QRY A;  1HCR A;  3BR6 A;  2VPR A;  1JKO C;  2HXO A;  5GP9 A;  2K9S A;  5EZH A;  5CXG A;  2Y0S N;  3S1R J;  3O60 A;  3BR1 A;  3A03 A;  4C3J J;  3D1N I;  5HSZ A;  2D6Y A;  3K7A J;  1ZQ3 P;  1EF4 A;  2LD5 A;  4B1R A;  4IEJ A;  4FCY A;  4D5F A;  1NK2 P;  3HTI A;  3ZQC A;  5EG0 A;  3LOC A;  4D7N A;  2QTQ A;  5IOY A;  5E3M A;  3AQT A;  1JUP A;  3RKQ A;  2B63 J;  3WHC A;  4IHV A;  2EZH A;  5D1R A;  2ECB A;  3GEU A;  5M3F J;  4A3I J;  5D18 A;  2AO9 A;  3VPR A;  2G7S A;  1H8A C;  4NDL A;  1FJL A;  3VOX A;  1UG2 A;  2AHQ A;  3JRI A;  1ETV A;  4W97 A;  5J1U A;  3JRF A;  3VVY A;  1IGN A;  3BG3 A;  3FKI J;  4XRS A;  3LHQ A;  2OPT A;  5FKL A;  2NVY J;  1NK3 P;  2JJ7 A;  3CQZ J;  4M3F A;  5GPA A;  3RQI A;  3F1B A;  1OJL A;  1OCP A;  4X6A J;  1HDP A;  1MSF C;  2RAS A;  1JKQ C;  5C44 J;  4JX5 A;  1HLV A;  4HKU A;  3NRG A;  1OFC X;  4XK4 A;  1B72 A;  1JTY A;  4RBO A;  4KWA A;  2WAQ N;  1ENH A;  2MW8 A;  3PM1 A;  5DTD A;  1HOM A;  3V78 A;  2ZCX A;  4YZE A;  3VOK A;  4AYB N;  2UXI A;  1LE8 B;  1FIA A;  2R5Z B;  3VVX A;  5K58 A;  3KKC A;  2YS9 A;  1X2N A;  1UMQ A;  5DAJ A;  4AC0 A;  4G12 A;  3BG5 A;  3DEW A;  1ETX A;  3B6C A;  3SDG A;  1XC5 A;  3ZQF A;  3VUQ A;  3IV5 A;  2MG4 A;  4JNN A;  1F36 A;  2GUH A;  1GVD A;  4XRS G;  1R9T J;  2Y9Y A;  4MXM A;  5H9T A;  5HAW A;  2CUE A;  1B8I B;  4IHY A;  1ETK A;  2W48 A;  3ANG A;  2DJN A;  2XSD C;  4QTR A;  2GM4 A;  2E2H J;  2EZI A;  3GTQ J;  3QQA A;  3BTL A;  3MVP A;  3QPS A;  4W1U A;  3CMY A;  3M3Y J;  4HNV A;  3Q0U A;  4BY7 J;  4D7M A;  3BR5 A;  2ZOZ A;  3QKX A;  3IH4 A;  3ZQI A;  2XB0 X;  2LLK A;  3I4M J;  1ITY A;  4LOC A;  4UUS A;  2DA1 A;  2DG8 A;  2UXO A;  3GTJ J;  2L7M P;  4NEL A;  1T56 A;  2XPU A;  2IBD A;  2G3B A;  3OSG A;  5JLW A;  2NS8 A;  5IP6 A;  3TW6 A;  2PZ9 A;  3IH3 A;  3B6A A;  2XPV A;  5E3N A;  3EUP A;  4A3L J;  1X58 A;  3P9T A;  3BNI A;  1X2M A;  1WGX A;  4A3J J;  2DMN A;  3HOW J;  2KT0 A;  2FX0 A;  2L7F P;  1ETQ A;  5F08 A;  2JA7 J;  2DMU A;  2XGE A;  1FTT A;  4V2F A;  2JK3 A;  1K61 A;  2YUS A;  1GUU A;  2LR8 A;  3CDL A;  2TCT A;  3LWJ A;  3ZOB A;  2HYT A;  1DU0 A;  2CJJ A;  4MK6 A;  1VFC A;  2WGB A;  5EG0 B;  2O9L A;  5M3M J;  3VVZ A;  1JT6 A;  1U9N A;  3PO2 J;  4M6V A;  3S5R A;  3WHB A;  2M34 A;  5J1R A;  1Z0X A;  4J19 A;  2X9D A;  5M5W J;  2D5V A;  3B81 A;  3S1Q J;  4DYQ A;  3HOY J;  4IHW A;  2M9H A;  2NOG A;  4M3G A;  1ETO A;  2JA6 J;  3JR9 A;  4I6Z A;  4MLO A;  3EGQ A;  2NP5 A;  2FJ1 A;  5F1J A;  2UXH A;  1A6I A;  1RKW A;  1JTX A;  3S14 J;  3S2H J;  3IH2 A;  3PPB A;  3HTA A;  2L9R A;  2ZOY A;  2TRT A;  1FIP A;  3HE0 A;  4FTH A;  3LJL A;  5EDN A;  1W0T A;  2X6O A;  4DZP A;  1JKR C;  4A3D J;  2N8G A;  2R0Q C;  3MKL A;  1FEX A;  1B72 B;  4GCK A;  1CQT A;  2CU7 A;  3G56 A;  2LFB A;  1POG A;  4Y52 J;  2XPW A;  5FKO A;  2HOS A;  2V57 A;  3LNQ A;  1GV5 A;  1IJW C;  3C07 A;  3VIB A;  2PMZ N;  3TW7 A;  3E7Q A;  4L62 A;  3COL A;  3CWR A;  1Q1V A;  1S7E A;  2XDN A;  2DA7 A;  1A5J A;  3GTM J;  5FKN A;  5C4X J;  1RKT A;  4A3F J;  1FTZ A;  2YVE A;  1RR7 A;  4DYR A;  2NVX J;  3NPI A;  1YRN A;  5IPA A;  3UKG A;  3H0G J;  2NVQ J;  1AU7 A;  3FK6 A;  3PAS A;  3RD3 A;  3VW0 A;  4ABZ A;  3TP0 A;  3T6N A;  4FIS A;  1OCT C;  2VUM J;  2X48 A;  3O8G A;  4A3B J;  3BR3 A;  1P7I A;  2QOP A;  2OER A;  4Y7N J;  4X1E A;  1MH4 A;  3NAR A;  1MBJ A;  3GZI A;  5GPC A;  1ZR2 A;  2DMP A;  2VI6 A;  2XRL A;  1Z77 A;  1AKH B;  1UI5 A;  3BJB A;  3MNL A;  1RPW A;  3MN2 A;  4M3D A;  5F27 A;  4UUS B;  1ZTR A;  1BA5 A;  5D19 A;  3CCY A;  5K7F A;  3VP5 A;  3RZO J;  2CQX A;  4JX4 A;  1ZGW A;  1MBE A;  3C2B A;  3ANP A;  4GFL A;  2QWT A;  3HIM A;  1SGM A;  4I76 A;  1LFU P;  4GCL A;  5M5Y J;  2LK2 A;  2COB A;  1E3O C;  4JYK A;  3G1M A;  4B4C A;  5JLX A;  4JP0 A;  3OIO A;  5EFY A;  1I3Q J;  1MNM C;  2W53 A;  2WUI A;  3HOX J;  1BW6 A;  4C3H J;  2UXU A;  2ELK A;  2P81 A;  3JRC A;  1ZKG A;  4S0H B;  1JKP C;  2R5Y B;  2XGC A;  4BKX A;  2KDZ A;  3F0C A;  2QKO A;  4ME9 A;  5IYD J;  3DPJ A;  2EZL A;  1MBK A;  3CRJ A;  4GFB A;  4AF5 A;  1D5Y A;  1AHD P;  1T33 A;  2O8K A;  2ME0 A;  2XB5 A;  4DW6 A;  1RES A;  1W0U A;  2LKX A;  5J1Y A;  2ZCM A;  2LVS A;  3H3V K;  1H88 C;  4BBS J;  4D5C A;  1GDT A;  4XRM A;  1UHS A;  3ON2 A;  3BTI A;  2DA4 A;  2NP3 A;  1GV2 A;  2Y31 A;  5FKM A;  2VKE A;  3A01 B;  2DTZ A;  3NNR A;  4PXI A;  4UUT A;  2EZK A;  4BBR J;  3O8H A;  5FLM J;  1BW5 A;  3BT9 A;  4QSH A;  5F0F A;  5K7H A;  2OI8 A;  1MBH A;  1JT0 A;  2FQ4 A;  4A3C J;  3QBM A;  1IG7 A;  3GTG J;  2H8R A;  2EH3 A;  4B3A A;  5C4J J;  1JJ6 C;  5EZG A;  5IOZ A;  2I10 A;  3IUV A;  3NI7 A;  5F0C A;  1U9O A;  3VW1 A;  2JMW A;  2CUF A;  3S1M J;  3HOZ J;  1O4X A;  2MGQ A;  2R92 J;  2NS7 A;  2FBQ A;  2REK A;  3E7L A;  2XGD A;  4AUX A;  2NVT J;  3FIS A;  4UDS A;  1HF0 A;  4MO7 A;  4FE4 A;  3LSG A;  3BQY A;  5EYR A;  3HDD A;  5K7Z A;  3BRU A;  1TWH J;  5F0H A;  3S2D J;  5EGO A;  4C2M J;  4A3M J;  1QVT A;  2DA2 A;  1YRN B;  1Y1V J;  3JRB A;  3LSJ A;  1TWA J;  1I6H J;  1ORK A;  2GBY A;  1IUF A;  4M3E A;  1WH7 A;  2M8G X;  1PUF A;  2HXI A;  2FD5 A;  4FE7 A;  3CJD A;  5FLV A;  5IP9 J;  3G1O A;  4A69 C;  5IP7 J;  2GLO A;  3GTK J;  2M0C A;  3A02 A;  3HB9 A;  4DZJ A;  2F07 A;  2E2I J;  1ZR4 A;  1SFO J;  1APL C;  4A3E J;  2PBX A;  4MFE A;  1JUM A;  1GT0 C;  2HOT A;  1NTC A;  1RET A;  1WI3 A;  9ANT A;  4JKZ A;  3HGG A;  1WCM J;  3BR0 A;  2K9N A;  5FKK A;  2ME6 A;  2DA6 A;  5FGL A;  2JA8 J;  2QCO A;  1HDD C;  3JRA A;  4ICH A;  1ETY A;  2OF7 A;  1BL0 A;  2QIB A;  2R7Z J;  1F43 A;  5E3O A;  3GTP J;  2DG7 A;  5F04 A;  1WH5 A;  2CQQ A;  3HEF A;  4M3B A;  3S1N J;  2G7L A;  4CGR A;  3AQS A;  4JX6 A;  2HDD A;  1P7J A;  3QPL A;  2QF7 A;  3TED A;  3S16 J;  5CXI A;  5FHP A;  2K9Q A;  3SFI A;  1BJZ A;  2WV1 A;  4CYC A;  3BTJ A;  2ZB9 A;  2Y30 A;  2GEN A;  3HTH A;  3SJM A;  1VND A;  3LSR A;  5HBU A;  2Y9Z A;  2E2J J;  5EF6 A;  3W6V A;  4EEF G;  3KKD A;  3KNW A;  1G2H A;  4IHX A;  2DN0 A;  2VKV A;  3NXC A;  3V6G A;  3DCF A;  3BR2 A;  3OSF A;  4ACI A;  3FK7 A;  2UXP A;  2E1O A;  2IAI A;  3Q0W A;  1MSE C;  3Q3S A;  3S15 J;  3S17 J;  2DA3 A;  3FIW A;  2NX4 A;  3M4O J;  3JSJ A;  2GFN A;  4MIM A;  1IC8 A;  2O7T A;  3OOU A;  3VW2 A;  2HKU A;  2G0E A;  4XID A;  2ECC A;  3I4N J;  5HOD A;  4XIC A;  5C4Y A;  5IYB J;  1VI0 A;  3KZ9 A;  2ID3 A;  1WPK A;  1MH3 A;  3PO3 J;  1JGG A;  2E19 A;  5J3L A;  3GTO J;  3BTC A;  4BXX J;  4DYC A;  5M5X J;  1IRZ A;  2JA5 J;  3LSP A;  3JRH A;  3JRD A;  3BHQ A;  2HYJ A;  1IDZ A;  2L7Z A;  4RDU A;  4GCT A;  3HOV J;  3HKZ N;  4JL3 A;  1U78 A;  1U8B A;  3FRQ A;  5EGO B;  1UI6 A;  3BQZ A;  4GFK A;  3HM5 A;  2HOA A;  2ID6 A;  2Q24 A;  4V2G A;  1IV6 A;  2R93 J;  2Y2Z A;  5DS9 A;  3ON4 A;  2IU5 A;  2HI3 A;  2M2E A;  4MFD A;  2DMT A;  2JWT A;  5FMP A;  3BG9 A;  1MBF A;  1IDY A;  3RH2 A;  1K83 J;  2RAE A;  1QPI A;  1PUF B;  1AKH A;  1MBG A;  1XS9 A;  3JRG A; 
#chains in the Genus database with same CATH topology
 4ENK A;  3HTJ A;  1VQ5 I;  1X3Z B;  1P6R A;  4N9H A;  1N78 A;  3PUF A;  2DT6 A;  1YX3 A;  1LDJ A;  2CRG A;  5LD2 C;  3BRO A;  5FD6 A;  1X4P A;  2R5Z A;  3L09 A;  4UB8 C;  3DTK A;  3IWF A;  4L5E A;  4ON0 A;  1XG1 A;  5JHF A;  3J81 Z;  4XLF A;  2IGM A;  4I09 A;  1NG7 A;  2WB1 N;  2R5Y A;  3QPT A;  2DDB A;  1B8I A;  1QBJ A;  1LFB A;  1ZAR A;  1D0X A;  3G7R A;  4XKV A;  4OIR F;  4A3G J;  3BZ6 A;  3H5R A;  2VT2 A;  2DYR H;  1R4M B;  5BPI A;  2CYY A;  1TWG J;  1QZE A;  2JPB A;  2ZJP F;  1O3T A;  1YW9 A;  3HRM A;  2EQR A;  3BP8 A;  4M73 A;  2V6E A;  5E3L A;  1FMV A;  4XOP A;  3HJE A;  2FML A;  3GZN B;  1IAW A;  1B9M A;  4HW0 A;  2GZW A;  3ERE D;  2CW8 A;  4XSX F;  1CF7 B;  3KPH A;  5HS9 A;  2M7A A;  1OYI A;  2O7O A;  4HF1 A;  4A3K J;  3FKJ A;  3TDZ C;  3L2U A;  4IF4 A;  2PFB A;  2VPR A;  3BDD A;  2F5E A;  2F4M B;  2ETH A;  2LBF B;  2E1N A;  1R49 A;  3O60 A;  4JK1 X;  1MDM A;  1MMG A;  5HSZ A;  3CP2 A;  2PBI A;  2MYS A;  1WSU A;  2DQR A;  4HBL A;  3QYF A;  4IO9 F;  4CCO A;  4HF2 A;  3DPT A;  3ZQC A;  3PL8 A;  4D7N A;  2IJL A;  3E5X A;  5IOY A;  5E3M A;  3BJA A;  5FLX K;  2B63 J;  2PQ8 A;  3FHZ A;  4IHV A;  2WY8 Q;  4IOA F;  1UZC A;  5D1R A;  3WTS C;  1O7F A;  1PDN C;  3QU3 A;  3OYD A;  5M3F J;  3G71 I;  3PJR A;  3MFK A;  1R00 A;  3VPR A;  3VOX A;  1UG2 A;  3Q5F A;  2LH9 A;  3K70 C;  2HKX A;  4HA8 A;  3KP5 A;  3JTH A;  2V79 A;  4PUS A;  3U1D A;  5JVT A;  1S9H A;  1B4A A;  2OPT A;  4NNJ A;  3H9Q A;  4PGH A;  5D6E A;  4HNU A;  5DCM A;  3RI4 A;  4LK0 F;  3CQZ J;  5L3G A;  1R5G A;  1Y39 A;  1SFX A;  2H09 A;  3RQI A;  1ODD A;  3LSM A;  2CUZ A;  3GYH X;  3E6B A;  4BL0 B;  2EK5 A;  4BQA A;  4YG2 F;  3OOP A;  4BDZ A;  4ZTF A;  4HX7 A;  4JX5 A;  4EJU A;  2VC1 A;  2IRF G;  4KWA A;  4UV8 A;  2MW8 A;  1Y8R B;  2V1N A;  5FO5 A;  3BWG A;  1ZLK A;  3ABL H;  5K58 A;  3KKC A;  4O5V A;  1MJA A;  3LWF A;  3M9A A;  4BXU A;  1TT0 A;  1BM9 A;  1HQC A;  4XRS G;  2Y9Y A;  4R8H A;  1O7L A;  1Z21 A;  2QYO A;  2XV4 S;  3BTL A;  3MVP A;  3QPS A;  3M3Y J;  2ZKZ A;  3EQL F;  1MZB A;  1Z91 A;  2HYG D;  4MQ9 F;  4Z2Y A;  3BR5 A;  2QGU A;  3QP5 A;  1KQ8 A;  2VQL A;  3QOE A;  3BCB A;  4E4H A;  3OYN A;  1ACI A;  2STW A;  4XN0 A;  3RKW A;  4A0X A;  2ZJR F;  1X19 A;  3ZGK A;  4LOC A;  3L2W A;  2DA1 A;  4A12 A;  5IT9 Z;  5BS6 A;  1KYZ A;  1LEA A;  2HVS A;  3GTJ J;  2UXO A;  2OUM A;  1MND A;  4UVA A;  2FE3 A;  4UXN A;  2HZT A;  1T56 A;  2ZME B;  3P9K A;  5JVG F;  3FM5 A;  1SC7 A;  2BXZ A;  2JTV A;  2XAH A;  2YPR A;  1GVJ A;  1KU2 A;  2L9N A;  3MZH A;  5A2Q K;  2JQ7 A;  3IH3 A;  3LSH A;  2HDC A;  4IHT A;  2H6B A;  4CYD A;  2F5D A;  3L2V A;  1X2M A;  2VXD A;  1WGX A;  2DMN A;  3M8E A;  5JR3 A;  2FX0 A;  1UHW A;  3HOT A;  1VQP I;  2OTJ I;  4LLL A;  2JK3 A;  4LG3 A;  2LYC A;  3CDL A;  4ITV A;  1JGS A;  1T6S A;  3M1E A;  5LEJ A;  1U9N A;  4YIR X;  3QYE A;  3PO2 J;  2RVC A;  4MGR A;  1Z0X A;  2B0L A;  2BOL A;  2Z3Y A;  2FEZ A;  2X9D A;  2ZNZ A;  4DYQ A;  3HOY J;  1FC3 A;  2M9H A;  1XCB A;  2JA6 J;  1OPC A;  2Z99 A;  4MLO A;  5LRR A;  2VJ5 A;  5F1J A;  3ZPL A;  2UXH A;  2Q2E B;  3S2H J;  1BC8 C;  5H6Q A;  3VYS B;  3CMM A;  3REO A;  1R22 A;  3CD6 I;  3KEO A;  4QWQ A;  1K6Y A;  4FTH A;  2E1C A;  3IL2 A;  1FOW A;  4ZJZ A;  1IRF A;  1ZRC A;  3FMQ A;  1KQ0 A;  1JKR C;  4A3D J;  3K1N A;  3OYL A;  2N8G A;  4RM2 A;  2R0Q C;  3DEE A;  1B72 B;  1FEX A;  2F5V A;  5E79 C;  2YX4 A;  3ABT A;  2M8E A;  1CQT A;  2CU7 A;  3CP8 A;  4RLQ A;  2DPD A;  2XPW A;  3F3X A;  2V57 A;  3C07 A;  4XLC A;  2DOD A;  2PMZ N;  3RQ4 A;  1UEL B;  4HPQ A;  1S7E A;  2XDN A;  2DA7 A;  4G9Y A;  2LRE A;  4G8X A;  3GTM J;  1FTZ A;  1RKT A;  4A3F J;  2YVE A;  1ZRF A;  3TQN A;  4EGZ A;  3OS0 A;  3C2H A;  3P9I A;  2NVQ J;  3CUQ C;  3L2C A;  4CCK A;  3PAS A;  1OCR H;  3DWL E;  4FIS A;  1IXC A;  2XDV A;  1OCT C;  2X48 A;  1W5S A;  5FD5 A;  2KFD A;  2VUM J;  3BR3 A;  2EWN A;  1BR2 A;  1UST A;  3DV8 A;  4LIT A;  1P7I A;  2EIK H;  2Z5U A;  1OCZ H;  4Y7N J;  2UV1 A;  1G3T A;  4KDP A;  5GPC A;  3BZC A;  1AKH B;  3BJB A;  1Z77 A;  4BHP A;  5HVQ C;  5CKT A;  1T2K A;  3KZY A;  3HL2 A;  3ABU A;  2FU4 A;  4UUS B;  4AM3 A;  4XOR A;  1BA5 A;  3DP7 A;  2M4G A;  5D19 A;  1IUY A;  2MA3 A;  1H0M A;  4OD5 A;  5E8G A;  3OR2 C;  4G6T B;  3RCO A;  3LST A;  2EFP A;  1MBE A;  3CUQ B;  2VON A;  3ANP A;  3AFH A;  2QWT A;  4GFL A;  4I76 A;  2V9V A;  3IUO A;  1E3O C;  3DXJ F;  4GYI A;  2XF7 A;  1QZY A;  1I3Q J;  1MNM C;  2A5Y B;  2P7V B;  3CO7 C;  2DOE A;  4C3H J;  2OCE A;  4CZC A;  5IY5 H;  1HBX G;  4HX8 A;  1NG6 A;  2HOE A;  3PIP F;  3BY6 A;  2MBF A;  4BKX A;  2KDZ A;  4D9J A;  2E1M C;  2QKO A;  2JVG A;  3DKW A;  2FA5 A;  3WTY C;  2KMU A;  2EZL A;  2VC0 A;  1MBK A;  3ZCO A;  3QOP A;  4AF5 A;  1T33 A;  3H3V K;  2DLL A;  1H88 C;  3F22 A;  4D5C A;  2UWM A;  3BTI A;  2DA4 A;  1Y56 A;  1GV2 A;  2DFF A;  4ZDO A;  1OMI A;  4PCQ A;  2DTZ A;  5LRS A;  3NNR A;  4KIS A;  2L01 A;  3J7A Y;  2E1M B;  3HOS A;  3K4N A;  3Q9V A;  4QSH A;  1R1U A;  3F9K A;  4NC8 A;  3CC7 I;  1JHH A;  1MBH A;  2K85 A;  4KN4 X;  1RR8 C;  2X0L A;  1IG7 A;  4ETS A;  2H8R A;  2KHM A;  2DYS H;  4B3A A;  3S3N A;  1XTA A;  2EIL H;  4OIQ F;  3KCC A;  3MEX A;  2C6Y A;  4I7H A;  1HW1 A;  2R92 J;  1JI8 A;  4AUX A;  2FNP A;  4UDS A;  2E5N A;  3PSI A;  4CDG A;  4FAS D;  2QQB A;  3PFI A;  4OIO F;  1HF0 A;  4FE4 A;  1BI1 A;  4LLG F;  3LSG A;  3BQY A;  3J81 K;  3LQQ A;  3CCQ I;  2NAZ A;  1E17 A;  2R7D A;  3S93 A;  2DA2 A;  2FSW A;  1SD7 A;  2BY3 A;  2RV8 A;  3JRB A;  2X1E A;  1ORK A;  3U21 A;  1QHH D;  2KZV A;  1WFX A;  3RDI A;  1WH7 A;  4WX9 A;  2FD5 A;  2P5V A;  5IP9 J;  3G1O A;  2FUG 2;  3A02 A;  4DZJ A;  3VSL A;  2PJP A;  3MZ8 A;  1T0F C;  4OWR B;  4BAC A;  4BDY A;  3OYM A;  2ZXI A;  1NTC A;  1RET A;  2HPM A;  1W5T A;  3V8L A;  1A35 A;  2GXA A;  3BR0 A;  1E3P A;  5FKK A;  5HLG A;  4IRH A;  3FWE A;  3BZK A;  2JA8 J;  2QCO A;  4ICH A;  3JCU C;  1IRX A;  2CO5 A;  3FXU A;  3I3L A;  1BL0 A;  2QIB A;  2GOM A;  4CA0 A;  1OIS A;  1ZGJ A;  2P5L C;  1WH5 A;  1ZG1 A;  2CQQ A;  4M3B A;  5ICC A;  1LVA A;  4CGR A;  4YEJ A;  1YTY A;  1VQL I;  2DFE A;  3HSF A;  3QPL A;  3SFZ A;  2K4B A;  3S16 J;  4HZF A;  2UXN A;  2LDU A;  1K78 A;  1Q1H A;  3SQN A;  1SVM A;  4R1H A;  2GEN A;  2XAF A;  2XHK A;  3FM3 A;  4FT8 A;  4WF2 A;  3LSR A;  2R7O A;  5EF6 A;  3VYU B;  2LY1 A;  3CCJ I;  3QOD A;  1WJC A;  2DN0 A;  1SD6 A;  2L4A A;  3AKZ A;  3COA C;  2DW4 A;  1LPQ A;  3OSF A;  4RB2 C;  2FRH A;  2QKM B;  3FHN A;  2OZ6 A;  4XNF A;  4L0Y B;  2MC4 A;  4N4O B;  1WJF A;  3CUO A;  2DXI A;  3L00 A;  2QBY A;  2VN2 A;  3VEP A;  2M87 A;  2NRA C;  1FOX A;  2GFN A;  1IC8 A;  2KLO A;  4II2 A;  4U0Y A;  2BHY A;  3RPU A;  4XQF A;  5HOD A;  3GUD A;  3IAS 2;  5LLQ A;  3KZ9 A;  3FXR A;  2RQQ A;  1YHQ I;  1MH3 A;  2E19 A;  4DYC A;  5M5X J;  2JPC A;  1SFU A;  3BHQ A;  2HYJ A;  3WOD F;  1QPM A;  3MQ0 A;  2EPF A;  3V7S A;  2WTE A;  1U8B A;  2MAB A;  3ASO H;  2HOA A;  2Q24 A;  2W1O A;  1X1C A;  1IV6 A;  1XB4 A;  5EEH A;  1TLH B;  3M8F A;  2IU5 A;  4MFD A;  4XL9 A;  3AG2 H;  2ELH A;  1IDY A;  2X6X A;  2RAE A;  3KLO A;  1XSD A;  3WU2 C;  1V3F A;  1BOB A;  2GQQ A;  4EM2 A;  3ZQL A;  4KNY A;  4BJ6 C;  4E7H A;  3BCG A;  2K40 A;  3D5S C;  2YU9 J;  3J7Y J;  2CSO A;  2EA4 A;  3F23 A;  2IEK A;  1QNT A;  1VZ0 A;  4RAF A;  1LE8 A;  3NWT A;  1WJ5 A;  5CVR A;  2MSY A;  1Y1W J;  2BVM A;  2ZCN A;  2LY2 A;  1DGW Y;  1DGR M;  3NAU A;  5D4S A;  1YIJ I;  4XN3 A;  3H9J A;  4RGU A;  3V4G A;  2A69 F;  4OMY A;  5EEA A;  5DUI A;  4U7B A;  3HOU J;  3ZQG A;  1PP7 U;  1QVU A;  4L9J A;  2QQA A;  1EH8 A;  1ZK8 A;  5JI6 A;  4AIK A;  2CMP A;  2L0K A;  1YYV A;  2RNG A;  1WJB A;  4RAG A;  1MMS A;  1I6X A;  5FJ8 J;  3JRE A;  4M72 A;  1DU6 A;  3K2A A;  3F21 A;  1KON A;  3HGY A;  1FPQ A;  2V9P A;  4KIC A;  4A6D A;  2CGP A;  4HQE A;  4BQQ A;  2MC3 A;  3IKT A;  3RZD J;  2A6T A;  4MEX F;  2LG4 A;  1ETW A;  2RHA A;  4KIB A;  2G7G A;  1UJ8 A;  2E71 A;  5L3E A;  3N97 A;  2AQF A;  4WIB A;  2GIZ A;  4XLN F;  2HTJ A;  5DDG A;  3TDU C;  1LDD A;  3I71 A;  3DLL F;  3BR6 A;  3K4J A;  4IXA A;  4AYB A;  2QLZ A;  4IRI A;  1EH7 A;  4B09 A;  5GP9 A;  2G7U A;  5CXG A;  1SAX A;  2KIF A;  3S1R J;  2IS1 A;  2DG8 A;  3A03 A;  4XLP F;  3T0Y A;  1T39 A;  2I8D A;  4CO8 A;  3K7A J;  1ZQ3 P;  1YG2 A;  1X1D A;  4FCY A;  2LF8 A;  4OD4 A;  1FBS A;  4A0Z A;  1ON1 A;  5EG0 A;  1HKS A;  1TBX A;  1KU9 A;  2BY0 A;  3BJO A;  1HST A;  5FRN A;  2V9K A;  3WHC A;  3K4L A;  4AVZ A;  2BV6 A;  3ERM A;  3ZN0 A;  1SEU A;  2Y0M A;  3L9F A;  2ECB A;  1Z7L A;  3ECO A;  3ZMV A;  1S72 I;  3KP7 A;  3CJN A;  1Z7U A;  5TIS C;  1ZH5 A;  3RKY A;  4NDL A;  2JZY A;  2AHQ A;  3JRI A;  1KQ9 A;  4RMN A;  4CCN A;  4W97 A;  4RGS A;  3TOB A;  4MTE A;  1MIJ A;  3VYR B;  1DP3 A;  5B3S H;  3FKI J;  3LHQ A;  1VQ4 I;  2YVX A;  1NK3 P;  2NVY J;  3K4K A;  1SD5 A;  3SWH A;  1F9N A;  1Z6R A;  2A61 A;  2VJJ A;  2K3P A;  5GPA A;  3QYB A;  1BBY A;  3J80 Z;  1BR4 A;  1OCP A;  5LGN A;  4X6A J;  2D1V A;  2VE9 A;  3A4C A;  2OQG A;  3SZT A;  1JKQ C;  3VWB A;  1OQY A;  4BQO A;  3R0J A;  1OFC X;  1FSH A;  1JTY A;  2H6C A;  4Q4Z F;  1N75 A;  1WQ2 A;  2MH2 A;  5B1A H;  2WAQ N;  3HSE A;  2W25 A;  1ENH A;  4KMU X;  1HOM A;  3V78 A;  2DFH A;  1O3R A;  2R5Z B;  3ZQ7 A;  4CSW A;  2B1E A;  1R1T A;  1X2N A;  4B8X A;  2DOA A;  1IN5 A;  3I54 A;  1O3Q A;  2W7N A;  3OYJ A;  5DAJ A;  4TV7 A;  2AXL A;  3RPQ A;  2UUZ A;  5F6F A;  3TBI A;  4B48 A;  3DEW A;  1ETX A;  3B6C A;  3SDG A;  1F5T A;  3ZQF A;  3VUQ A;  3K4M A;  3IV5 A;  3GX4 X;  2MG4 A;  1F36 A;  3R4K A;  4NB5 A;  3TO6 A;  2GA1 A;  5HAW A;  1B8I B;  4IHY A;  1ETK A;  3DTE A;  1W5C C;  2DJN A;  1PVE A;  2XSD C;  3G3Z A;  4I98 B;  3QQA A;  4C2M A;  1V4R A;  1TW2 A;  1ZAO A;  1RC9 A;  2ZOZ A;  3WE2 A;  3ZQI A;  2CWE A;  3KZI C;  5DD8 A;  4XLH A;  2VKH A;  4C9Y A;  3MWM A;  2LLK A;  4NC6 A;  3I4M J;  1ITY A;  2QA4 I;  3F8N A;  1DDN A;  2DO7 A;  2R7F A;  2CG4 A;  3ZQQ A;  1E0E A;  2IBD A;  2ZFW A;  2XRN A;  2JVH A;  4FX0 A;  3V7C A;  2NS8 A;  1I27 A;  1R5I D;  5IP6 A;  2QWW A;  1NH3 A;  1OCC H;  2XPV A;  1QU3 A;  1I3A A;  3EUP A;  4A3L J;  3P9T A;  2YX7 A;  1FSE A;  1S3J A;  3GO5 A;  4A3J J;  4RB3 C;  1S6L A;  1FZP B;  3HOW J;  2L7F P;  1IN4 A;  2DMU A;  4Y33 A;  2HYF A;  2B7E A;  1GUU A;  5HOO A;  1Z9C A;  1RRJ A;  2AXT C;  2R7W A;  1WZ2 A;  3FZV A;  4MK6 A;  1DU0 A;  3SEQ A;  4F93 B;  1VFC A;  2O9L A;  2WGB A;  3VVZ A;  1JT6 A;  3GW2 A;  5LGT A;  2A3S A;  3U1K A;  4LG0 B;  2WV0 A;  1P4A A;  2H1L A;  3I0T A;  5J1R A;  4WK8 F;  4MQV A;  4J19 A;  2KPM A;  5M5W J;  3CES A;  5ICF A;  4Y4R A;  3PNY A;  4OIN F;  4PFP A;  4WXH A;  1JE8 A;  5E1Z B;  3EYI A;  4I6Z A;  1Z3Y A;  3EUH A;  1TNS A;  3GFL A;  1OLT A;  3ZP5 A;  3EGQ A;  2FJ1 A;  3HG9 A;  5BMZ A;  1D8J A;  1I39 A;  4HX4 A;  1U3E M;  3TKY A;  5E17 F;  3PPB A;  1TZL A;  3HTA A;  1R7J A;  2L9R A;  2UZK A;  4PDK A;  3OYF A;  2TRT A;  5DCM B;  1SMY F;  3BPX A;  4OMZ A;  5K5Q A;  3EPZ A;  2FBK A;  5IT3 A;  3LJL A;  3J7A O;  5EDN A;  2K27 A;  2MD5 A;  4E7Z A;  4ENJ A;  4GCK A;  3MAJ A;  3H3U A;  1XX5 A;  2FMY A;  2LFB A;  1BOA A;  4BAY A;  3DBR B;  1OKR A;  4NC7 A;  2HOS A;  3OYA A;  3LNQ A;  1GV5 A;  4U87 A;  4BU2 A;  2HGC A;  3E7Q A;  3BPV A;  3CWR A;  1Q1V A;  2M7B A;  5C4X J;  1RR7 A;  2D2W A;  5HLH A;  2JT1 A;  2QSH X;  1TQP A;  3CZ6 A;  5HS7 A;  1PUE E;  1OR7 A;  3UKG A;  3ZMU A;  1YRN A;  3LA3 A;  1AU7 A;  3FK6 A;  2JUC A;  3VW0 A;  1DP7 P;  1E3H A;  2P7C B;  3T6N A;  2XF5 A;  4II3 A;  5AON A;  1F1Z A;  4OIP F;  1K4T A;  5J4V A;  4M74 A;  3A0H C;  1MH4 A;  1LUJ B;  1MBJ A;  2BYV E;  2HFH A;  3AAF A;  4MTD A;  2VBY A;  2L2O A;  3D0S A;  3WG7 H;  1WWX A;  2K4J A;  4CCL A;  5E1X A;  2R7Q A;  3I56 I;  2VKD A;  2MFZ A;  3CCY A;  4RLF A;  1WVR A;  1HW2 A;  2CQX A;  3H36 A;  3WTV C;  3HSR A;  3ZXS A;  4B44 A;  1ZRE A;  4O6J A;  2O8X A;  3HIM A;  1SGM A;  1AOY A;  4PSX A;  5M5Y J;  2COB A;  1VQ9 I;  2VLA A;  1HKT A;  1X1A A;  4JP0 A;  3CCS I;  2WUI A;  4DOZ A;  1YW8 A;  2G9W A;  3KP4 A;  2X51 A;  2O61 A;  2ELK A;  1FNN A;  2ESH A;  3JRC A;  3AL0 C;  1ZKG A;  2NVU B;  4S0H B;  2XGC A;  1BI3 A;  3C1D A;  1ZLJ A;  1X1B A;  4ME9 A;  1P4X A;  3DPJ A;  3CRJ A;  3PUB A;  3FXM A;  4AWX B;  3H35 A;  2O8K A;  2B9S A;  5CVU A;  1W0U A;  4E7I A;  5J1Y A;  1D3Y A;  4P96 A;  3RJP A;  4GGG A;  4BBS J;  1GDT A;  4XRM A;  2EV6 A;  4ESB A;  4I0B A;  3A01 B;  1W36 D;  4F91 B;  5DEQ A;  4UUT A;  4BHB A;  4E70 A;  2ZSH B;  3AL0 B;  1HC8 A;  2ZJ2 A;  1BW5 A;  3BT9 A;  5F0F A;  1P92 A;  2OQR A;  1VQO I;  1BR1 A;  3HPG A;  4I02 A;  1FWZ A;  4IL6 C;  4ANJ A;  3MKW B;  2M1B A;  5C4J J;  1JJ6 C;  2MD0 A;  2I10 A;  5ICE A;  5F0C A;  1U9O A;  3FXO A;  3CO6 C;  1LFP A;  3HOZ J;  1O4X A;  4LLN A;  2MGQ A;  5HNH A;  3P7N A;  1BI2 A;  2KZG A;  2F5F A;  1XPX A;  3FBN B;  3FIS A;  3GF2 A;  3FF5 A;  4MO7 A;  4XRF A;  3CTA A;  4AU7 A;  1YOV B;  1BIB A;  3HDD A;  5K7Z A;  1TWH J;  3S2D J;  2BY1 A;  5EGO A;  3VDX A;  4RB0 A;  5K5R A;  4HRI A;  1VQ7 I;  3OL3 A;  4EVI A;  1B6A A;  1QVT A;  2KIM A;  4WCG A;  4MEY F;  1T8I A;  1I6H J;  4ASN A;  1MMN A;  2XAQ A;  4M71 A;  2KRC A;  3DF8 A;  4IQ4 A;  3GVA A;  4ZDL A;  2M8G X;  2HXI A;  2R7X A;  3CJD A;  1J75 A;  2QVO A;  4NQW B;  1FY7 A;  2PMH A;  4A69 C;  2KKO A;  5L3C A;  1V54 H;  2R7U A;  2GLO A;  3GTK J;  2F2E A;  3HYI A;  3HB9 A;  1J9I A;  2W84 A;  2E2I J;  1IF1 A;  2ZME A;  3W6J B;  1R71 A;  2VQG A;  4A3E J;  3I59 A;  1B59 A;  2PBX A;  1RNL A;  4ZDP A;  2HOT A;  2JA2 A;  2LMD A;  1WI3 A;  1JXS A;  4JKZ A;  4BYY A;  1YS6 A;  2A5W A;  3TL4 X;  5GAH J;  1FYK A;  2BVL A;  1I5Z A;  4OU0 A;  2K9N A;  2ME6 A;  3OR1 C;  3HKZ A;  4IQJ A;  2OAZ A;  5ERI A;  3RYR A;  4DIQ A;  1TTY A;  1U5T A;  5F04 A;  5D8L B;  2EB7 A;  3HEF A;  1G3Y A;  3S1N J;  3OIQ A;  4JX6 A;  2EIJ H;  3L2R A;  2DPU A;  2HDD A;  1EV7 A;  4ZC3 A;  3KYD B;  3O3K A;  4YFK F;  3T1B A;  1OCO H;  2EA2 A;  2FJI 1;  5FHP A;  4LIV A;  4EV0 A;  2WV1 A;  2HNH A;  4CYC A;  1B9N A;  2PLY A;  2DTR A;  5FB2 A;  1MGT A;  1VND A;  3KE2 A;  1HA8 A;  3E6D A;  5D5W B;  3M8J A;  3RYP A;  4BJT A;  4GRI A;  4EEF G;  1T38 A;  3W6V A;  3KKD A;  1G2H A;  3QU6 A;  1ZG3 A;  4UVC A;  2WAF A;  2XRO A;  4IHX A;  3KP6 A;  5ED4 A;  2OJE D;  2GA2 A;  3V6G A;  4C30 A;  3ZN1 A;  2X1D A;  4YIF A;  3FK7 A;  3MMY B;  5DCF A;  4H4K C;  1HXD A;  2UXP A;  4RM3 A;  2E1O A;  3OMY A;  4Q5S F;  2IAI A;  3KYL A;  4KFC A;  3DLA A;  2A6H F;  4PJJ A;  3J80 K;  1MSE C;  3Q3S A;  2HVQ A;  2L54 A;  2DA3 A;  2WB1 A;  3CJQ B;  3H9G A;  5D6F A;  3ISP A;  3HIF A;  3WTW C;  4MHG A;  4RA2 A;  2O6G E;  3ML6 A;  4XIC A;  5C4Y A;  2ZXW H;  3DBL B;  3ZMZ A;  4F7Z A;  3C7J A;  1ZN2 A;  5J3L A;  4IZZ A;  1IRZ A;  5HLI A;  3CCV I;  2JA5 J;  3LSP A;  2XAG A;  1O3S A;  4RDU A;  4GCT A;  5HDG A;  4HST A;  3HOV J;  2BXY A;  3CC2 I;  3HUG A;  1J0R A;  4EMS A;  2ID6 A;  4FQG A;  5J8F A;  3E5Q A;  5LHG A;  3K8P C;  3ON4 A;  2HI3 A;  2O0Y A;  3W3C A;  2DMT A;  2IXS A;  2QEN A;  3BG9 A;  1MBF A;  1QQI A;  1KZH A;  1QPI A;  2HEO A;  1AKH A;  4X0G A;  4L5I A;  3NRV A;  4M6X A;  1X3U A;  1T95 A;  3MKY B;  2BE5 F;  1D5V A;  3LAJ A;  1MJ9 A;  1YLF A;  1XMX A;  1IN7 A;  1JUS A;  2ZO4 A;  4ZYD A;  3HBL A;  4L9V A;  3GTL J;  5CW8 A;  4KT5 C;  5FFX A;  4C2T A;  2FOW A;  1YIO A;  2O5R A;  4PJN A;  2QSG X;  3L2Q A;  2XSJ C;  2HQ5 A;  4MNU A;  2ACJ A;  2ZXJ A;  2VL8 A;  4ZZD A;  3Q9S A;  1J2X A;  2DA5 A;  5CVI A;  1HSJ A;  1GXQ A;  4C3I J;  2H1K A;  3AG3 H;  3RTR A;  1I50 J;  2W85 A;  1N25 A;  3LMM A;  3RIR A;  4ZYG A;  2OTL I;  1FP2 A;  3EDP A;  5F64 A;  4BEH B;  2A07 F;  2VJI A;  4AIJ A;  3B02 A;  3GCM A;  2Y48 A;  3TP3 A;  1MJB A;  4QIW N;  1LQ1 A;  3BG6 A;  1TC3 C;  2DI3 A;  3CCE I;  3WU1 B;  2EBI A;  4J01 A;  3MD2 A;  5BQT A;  1IRG A;  1TNT A;  2IA1 A;  1K78 B;  4IVN A;  1R58 A;  2VBW A;  4A2U A;  2XIG A;  1YFH A;  2V6C A;  2EV0 A;  3V42 A;  2HQN A;  3FXL A;  4L9T A;  3JSO A;  4XBF A;  3ULQ B;  2DT5 A;  1H89 C;  4CUG A;  5AQC A;  3ZR8 X;  1QRY A;  1C0W A;  3RKX A;  5EJC A;  1JKO C;  5L3D A;  2HXO A;  4HDU A;  5EZH A;  1TW3 A;  3LFU A;  2AS5 F;  3FBI B;  1SVL A;  1ULY A;  1XMA A;  2AQE A;  2ZNY A;  4C3J J;  2D6Y A;  2L9S A;  2ZC2 A;  3CC4 I;  1RUO A;  1RUN A;  3OYH A;  2LD5 A;  1EF4 A;  1OYW A;  3KIO A;  4IEJ A;  4B47 A;  3HTI A;  3S32 A;  3LA2 A;  4LMY A;  4ZYE A;  2MLK A;  4PZJ A;  3LOC A;  5FLX Z;  3CJR B;  2WAD A;  2Y75 A;  1U8R A;  1JUP A;  3RKQ A;  1KYW A;  1LEB A;  4EGY A;  1VTN C;  4JOM A;  3RPU D;  2BW3 A;  3GEU A;  1IXS B;  5D8K B;  2H94 A;  3GZ6 A;  1XGO A;  4LD5 A;  2AO9 A;  4HV5 A;  2G7S A;  1FJL A;  2E5Z A;  3CCL I;  2DCE A;  2IGN A;  5K1Y A;  5LHI A;  4XLE A;  1QGP A;  1XSV A;  3WGH A;  2ZY9 A;  3VVY A;  1ZHF A;  4I0A A;  3BG3 A;  2CQK A;  3HRT A;  5FKL A;  2IVM A;  3SZP A;  3E97 A;  4FHT A;  2ADU A;  3H3Z A;  2X1C A;  3F1B A;  2DAO A;  1VQK I;  4K2E A;  4EJO A;  5C44 J;  3FXK A;  3NRG A;  3I9V 2;  4XK4 A;  2XVC A;  3QP6 A;  2W82 A;  3HXL A;  5H20 A;  1PJR A;  3PM1 A;  5AIQ A;  1MW7 A;  3DEU A;  4A0Y A;  4QLC U;  2UXI A;  1LE8 B;  3VVX A;  4G6Q A;  2YS9 A;  2K3F A;  2P8T A;  4AC0 A;  2F6C A;  5AIP A;  4OOI A;  1XC5 A;  1X3W B;  1FYL A;  1FYM A;  1GVD A;  1R5H A;  1R9T J;  5TGT A;  4MXM A;  2HKO A;  5H2F C;  4F52 A;  5JFR A;  1GXP A;  3ANG A;  2GM4 A;  5E8I A;  2EZI A;  2E2H J;  3E5U A;  3GTQ J;  3VSK A;  3Q0U A;  2Y0S A;  1X1P A;  3QKX A;  5D5U B;  3IH4 A;  1GHC A;  1ON2 A;  3ONQ A;  1R4N B;  2CQ7 A;  2XB0 X;  1R6R A;  3TGN A;  4RB1 A;  4UB6 C;  3QRF F;  1QO0 D;  3JW4 A;  2NNY A;  2L7M P;  2HZD A;  3BOQ A;  3F8F A;  5IT9 K;  4NEL A;  2XPU A;  4DBQ A;  1ERD A;  4JBA A;  3NQO A;  3OSG A;  2G3B A;  3O2P E;  5JLW A;  2ZCW A;  2H27 A;  3TW6 A;  1U6G A;  2NOJ B;  2PZ9 A;  2PMZ A;  3KEY A;  2IT0 A;  2FF4 A;  5CPR B;  3H5N A;  3HRU A;  4IHS A;  1TP4 A;  1X58 A;  3BNI A;  1W7P D;  4L9N A;  2KT0 A;  3WG9 A;  4P9U A;  2XF6 A;  5F08 A;  1YJ9 I;  2JA7 J;  2I5U A;  1QHG A;  2XGE A;  2YUS A;  1YQA A;  2Z1D A;  5J4Y A;  2H8W A;  4BQN A;  3ZOB A;  2HYT A;  2CJJ A;  4LJZ F;  3HTU A;  5EG0 B;  5GAD J;  1DPR A;  1VQM I;  2ZJQ F;  3S5R A;  3EUA A;  4AID A;  2IPQ X;  3WHB A;  4A6E A;  2M34 A;  4ZYH A;  3F6V A;  2CV2 A;  4UNO A;  1Z3X A;  1WJE A;  2X85 A;  3PNV A;  3SZG A;  4EQQ A;  2D5V A;  4ESJ A;  4L0Z B;  3B81 A;  4IHW A;  1WI9 A;  3FXJ A;  2NOG A;  4DVY P;  1V5F A;  2K02 A;  1EA3 A;  1ETO A;  3PSF A;  4XLA A;  2YSR A;  5E18 F;  3WU0 A;  2GWR A;  2KJB A;  1IV8 A;  3BJ6 A;  4I01 A;  1W7P A;  4Z6Y A;  1JTX A;  3IH2 A;  2EFW A;  5TJJ A;  1A04 A;  2ZOY A;  1W0T A;  2JSP A;  2X6O A;  4DZP A;  3G6E I;  4EJV A;  2ISZ A;  2VOP A;  3VTI A;  4QPO A;  4Y52 J;  5FKO A;  2CV1 A;  2Z16 A;  1J5Y A;  3B73 A;  3VIB A;  1YO5 C;  3TW7 A;  4L62 A;  2L02 A;  4F3Q A;  3EYY A;  5DUK A;  3GLX A;  2GAU A;  4F92 B;  4DYR A;  1FMW A;  2NVX J;  3VFZ A;  3FMS A;  5IPA A;  3G2B A;  3ABK H;  1DQU A;  3RD3 A;  1TL8 A;  5GTH C;  5HNF A;  3O8G A;  1S7A A;  4CIC A;  3V7R A;  1P4W A;  2HQA A;  4YEL A;  5K5O A;  3OYG A;  4UY8 I;  3IC7 A;  3S2W A;  4HF0 A;  4X1E A;  2CV0 A;  2ZFU A;  2J5O A;  3GZI A;  1ZR2 A;  3MNL A;  2DMP A;  2XRL A;  1UI5 A;  2HS5 A;  3C18 A;  4UUV A;  2O3F A;  2RRE A;  3MN2 A;  4YFX F;  4M3D A;  2PEX A;  5F27 A;  2RGV A;  2G7H A;  4CXF A;  1L3L A;  1ZEL A;  2WC2 A;  4BHC A;  1ZGW A;  2RQP A;  3BG7 A;  3C2B A;  1A36 A;  4GXO A;  2KL4 A;  3CCU I;  4GCL A;  4AVP A;  4D0P A;  2QSF X;  4E7L A;  3G1M A;  4B4C A;  1Z6T A;  2M0M A;  3DKY A;  3OIO A;  1P2F A;  4Q47 A;  4AIH A;  2QQ9 A;  2XUB A;  5E20 A;  2W53 A;  4E7S A;  3I55 I;  3NWS A;  1YJW I;  3EUH C;  2UXU A;  2P81 A;  2P5K A;  2HPI A;  2VT3 A;  3H0D A;  1JKP C;  2R5Y B;  4E7K A;  1Y6I A;  1BI0 A;  4EM0 B;  3F0C A;  4S05 A;  2R4G A;  3OS2 A;  1KGS A;  4GFB A;  2RN7 A;  4KJZ A;  5FRO A;  4BH9 A;  1D5Y A;  1AHD P;  4Q48 A;  4Y17 A;  2X6W A;  2XKP A;  1RES A;  4XKB A;  3RSN A;  3WTT C;  2ZCM A;  3W6K B;  2ESN A;  2LVS A;  2JSC A;  3PFY A;  2O03 A;  2RKH A;  3NEU A;  2COM A;  2XKO A;  2VIX A;  3K4B A;  3ON2 A;  2D1H A;  2NP3 A;  5CJ9 A;  2Y31 A;  4EJW A;  2PJR A;  2DK5 A;  4Y15 A;  4HNT A;  4OAZ A;  2Q1Z B;  4ENM A;  1G59 A;  2IS6 A;  2NYX A;  4PXI A;  3R61 A;  2IGO A;  3LFK A;  4BBR J;  3E0J B;  4BE1 A;  4KIG A;  5LFA A;  2KRF A;  5FLM J;  2B3W A;  4XSZ F;  5K7H A;  2OI8 A;  1JT0 A;  4A3C J;  2FQ4 A;  3QWL A;  3CME I;  1OR7 C;  2IA0 A;  3GTG J;  2XGX A;  5HDN A;  1MDM B;  1M1E B;  2DDA A;  2EH3 A;  1SMT A;  3HC7 A;  1NHA A;  4U7D A;  1OYY A;  4P5O A;  3NI7 A;  3IUV A;  4AD9 A;  1D0Z A;  3VW1 A;  1Z67 A;  2CUF A;  3S1M J;  1J7K A;  1YJN I;  1JHF A;  3OYB A;  2REK A;  1AWC A;  3E7L A;  3F6O A;  2XGD A;  4YRV A;  2E60 A;  1ZGA A;  4A5N A;  3IP4 B;  1K6O A;  5EYR A;  4ESF A;  3BRU A;  5F0H A;  2E34 A;  2K9L A;  4A3M J;  1YRN B;  1FBU A;  4LB6 B;  3U9G A;  5CQG A;  3K69 A;  1LB2 A;  1IUF A;  4WWC A;  4M3E A;  5KAI C;  3I5U A;  3LAP A;  1PUF A;  2NS0 A;  4M9X A;  3ZRG A;  5TRD A;  5FLV A;  4GDF A;  3QPH A;  1IW7 F;  2BBY A;  1RI7 A;  5DD4 A;  2M0C A;  3N05 A;  2VAS A;  2F07 A;  4U9N A;  2CH0 A;  4RAY A;  1G3W A;  1SFO J;  2EV5 A;  1APL C;  1L0O C;  2CFX A;  4RGR A;  1K79 A;  1GT0 C;  3E1S A;  3WTU C;  2LNB A;  1BC7 C;  3HGG A;  2YU3 A;  1WCM J;  3U2R A;  5KVR A;  2M45 A;  2X6Y A;  3OV8 A;  4EAT A;  2DA6 A;  5FGL A;  1HDD C;  3JRA A;  1UG0 A;  1ETY A;  2R7Z J;  5CQE A;  1V5G A;  2XAS A;  5E3O A;  3GTP J;  2DG7 A;  3JSP A;  2OCC H;  2E7X A;  2G7L A;  3DPU A;  3AQS A;  2P0W A;  2DBB A;  3GFM A;  3SXY A;  4DGW B;  4IKF A;  2HU9 A;  3EET A;  1HW5 A;  2Z9O A;  4LG0 A;  4KN7 X;  4LGW A;  4CZZ A;  3TED A;  2GOX B;  3BLY A;  2K9Q A;  3SFI A;  1LNW A;  1XD7 A;  1BJZ A;  5CXI A;  1MNE A;  3HTH A;  2Y30 A;  1USS A;  5HBU A;  2E2J J;  2GXG A;  1CF7 A;  1EJ9 A;  3KNW A;  1XDS A;  3HHH A;  4HLX A;  2FQ3 A;  1D0Y A;  4U0V A;  3DPL C;  3DCF A;  3BR2 A;  4ACI A;  2OZU A;  2LBF A;  2WA0 A;  2CW7 A;  3E3V A;  3HHG A;  1W36 C;  1B1B A;  1VQ6 I;  3G4S I;  2X4H A;  5L3F A;  4HAM A;  3S17 J;  3QAH A;  3A0B C;  3FIW A;  2F4I A;  4DQ2 A;  3M4O J;  2IS4 A;  3JSJ A;  2D45 A;  3W2W A;  5ILS A;  3OS1 A;  2CW0 F;  2CUJ A;  4XKC A;  4E6K G;  4Y13 A;  2ECC A;  3I4N J;  4E7J A;  3H5A A;  4IRG A;  2DT7 B;  4HG2 A;  5IYB J;  1WJD A;  4PJ0 C;  1G4D A;  3PO3 J;  3K10 A;  4L18 B;  4BXX J;  4M9S A;  2BHZ A;  5EEG A;  3JRD A;  2OU2 A;  2E35 A;  5CVJ A;  2ZME C;  4BNC A;  1U78 A;  3K70 D;  3N4M A;  5EGO B;  4GFK A;  3BQZ A;  4HEA 2;  1BIA A;  2R93 J;  5FFZ A;  1KA8 A;  2IA2 A;  3DU5 A;  5DS9 A;  2HVR A;  3FMR A;  2IS2 A;  4BE0 A;  2JWT A;  1WJA A;  5FMP A;  4GYG A;  2CQN A;  2WBM A;  5GTI C;  3RH2 A;  1K83 J;  2EIM H;  1MBG A;  3KYC B;  1U5T C;  3JRG A;  2DJI A;  2BZT A;  3G1L A;  2ICW G;  3WGI A;  4A93 J;  4HQM A;  2LP0 A;  3L1P A;  1VF9 A;  4EJT A;  1G3S A;  4PFO A;  2JN6 A;  3I59 B;  3I53 A;  2QEX I;  1ZRD A;  2OA4 A;  1BJA A;  2UXX A;  1TWC J;  3F8M A;  4QPQ A;  3V8K A;  3HRS A;  4BS9 A;  4EM1 A;  4BGD A;  3G73 A;  4BY1 J;  2FNA A;  2LRD A;  2PI0 A;  4KT6 A;  3TOA A;  4BE2 A;  2GXB A;  3CLO A;  2DMQ A;  2VQH A;  3GBG A;  4AC6 A;  2F48 A;  2LTP A;  1ZYR F;  1YE9 A;  3SYT A;  3K4C A;  5J6X A;  5IYC J;  3WTX C;  1FBQ A;  1U5T B;  2V1U A;  5ICG A;  1TWF J;  1RZ4 A;  2P4W A;  3T8R A;  3GFJ A;  2QZ8 A;  2VOO A;  2LY9 A;  3F8B A;  2V26 A;  1SAN A;  1JJ8 C;  2R7S A;  4LK1 F;  2DQL A;  1U0J A;  2K86 A;  2TDX A;  5B1B H;  3ZQH A;  4CYC B;  4DJA A;  4NN1 A;  2V7F A;  3TO7 A;  5BNG A;  5C3E J;  1V5E A;  3Q0V A;  2R7R A;  3K9T A;  2PG4 A;  1H9G A;  2WAQ A;  1K7A A;  1FOK A;  3LSI A;  2YVH A;  3A01 A;  3R6S A;  2VXZ A;  2ZXH A;  1HCR A;  2VE8 A;  4WXD A;  2MLG A;  5D5X B;  2RC4 A;  3EUK L;  4H0E A;  5L3B A;  2K9S A;  4KUM A;  3KFW X;  3DFG A;  4M9Z A;  1XCV A;  2L7K A;  5DV5 A;  4BUP A;  2KIU A;  2Y0S N;  3CF2 A;  1TT5 B;  3BR1 A;  2FBI A;  3D1N I;  2K7L A;  4PJL A;  3FXQ A;  3K2Z A;  1YW7 A;  3AG1 H;  1D8K A;  4XOT A;  5JHU A;  3P5J A;  4KIF A;  4B1R A;  2WWY A;  4D5F A;  1NK2 P;  4KMF A;  3CLQ A;  3R0A A;  5ILV A;  3F72 A;  3VYT B;  2JUG A;  2QTQ A;  3AQT A;  4UHT A;  3C2G A;  4ZTJ A;  1F4K A;  3JAM Z;  5BOX A;  2EZH A;  2PFV A;  4PSW A;  3E6C C;  5BPD A;  4A3I J;  2BGC A;  1LJ9 A;  5KHD A;  3PIO F;  3DU6 A;  5E1W A;  5D18 A;  3WGG A;  1PYV A;  1TQI A;  1H8A C;  3ECH A;  4HOB A;  3HZJ A;  3AG4 H;  4KIT B;  2RNJ A;  3HUG B;  3MZY A;  1ETV A;  1S7O A;  3T8T A;  2GIV A;  2Q2E A;  5J1U A;  5DM7 F;  3JRF A;  2L3D A;  1IGN A;  4XRS A;  3KP2 A;  4PGG A;  2OBP A;  3ZMS A;  2JJ7 A;  4M3F A;  1K4S A;  1SFE A;  4IPA A;  1OJL A;  4NQW A;  1HDP A;  2J5P A;  3H92 A;  5J40 A;  3TO9 A;  1VQN I;  3X2Q H;  1MSF C;  2RAS A;  4XM3 A;  2JRM A;  1HLV A;  4HKU A;  2WY7 Q;  1B72 A;  3S8P A;  3SHF A;  4RBO A;  4B43 A;  3OL4 A;  5DTD A;  1XMK A;  1Z05 A;  2ZCX A;  4YZE A;  3VOK A;  1HKQ A;  1H9T A;  4AYB N;  1FIA A;  5ILU A;  4O3M A;  2KP6 A;  1UMQ A;  1D1C A;  3W2V A;  3NS4 A;  4G12 A;  3BG5 A;  3KET A;  3DBH B;  1R23 A;  4HDV A;  1MKM A;  1QZZ A;  2OD5 A;  4JNN A;  2GUH A;  2NNN A;  2HR3 A;  1N77 A;  5H9T A;  2CUE A;  1FP1 D;  2HTS A;  2OV7 A;  2W48 A;  4QTR A;  3CMY A;  1S29 A;  4W1U A;  4UV9 A;  4HNV A;  4BY7 J;  4D7M A;  4I2O A;  3FDY A;  4PK4 A;  2M30 A;  6PAX A;  1ONV A;  3IAM 2;  4RS8 A;  1SVO A;  3F8C A;  4F55 A;  3TMO A;  1ZG5 A;  3M07 A;  1A31 A;  4I99 C;  4UUS A;  3GME A;  4IX7 A;  3CJT B;  3PQK A;  3DKX A;  2L9V A;  1XGM A;  3MCZ A;  3CUQ A;  4FET A;  2DOF A;  4HV6 A;  2HDW A;  3B6A A;  2M4K A;  1EKE A;  1EH6 A;  5E3N A;  1V55 H;  1YX5 A;  3WTZ A;  3GXO A;  2FXA A;  5HDK A;  1Y8Q B;  1ETQ A;  1FTT A;  3CDI A;  1LKX A;  3PNT A;  4V2F A;  1K61 A;  2LOO A;  5CYV A;  4IOC F;  2LR8 A;  3OIP A;  2TCT A;  3LWJ A;  1WRJ A;  1R36 A;  3DTI A;  3K6G A;  5M3M J;  5FGM A;  4ZZL A;  2BEO A;  4M6V A;  4ENN A;  3OY9 A;  4JQF A;  4HLY A;  2YR2 A;  2BW3 B;  2W57 A;  3LQR A;  4U88 A;  1KU7 A;  1UAA A;  3VOE A;  3S1Q J;  5CVV A;  5B5E C;  4OAY A;  1SD4 A;  2EFO A;  4M3G A;  2V4J C;  3JR9 A;  1FLI A;  2EJR A;  2NP5 A;  3D5L A;  1A6I A;  1RKW A;  3S14 J;  1UCR A;  5LHH A;  3HPH A;  1AA7 A;  1QA6 A;  3S3O A;  2IGK A;  2PN6 A;  2K5C A;  3CDH A;  1TQM A;  5HS8 A;  3H1C A;  1FIP A;  1W1W E;  2ZBK A;  3HE0 A;  4DBR A;  3IRR A;  1I1S A;  2QBY B;  3GZ5 A;  2QUF A;  3MKL A;  2ISY A;  1IN6 A;  4YFN F;  3G56 A;  3KEQ A;  2STT A;  2MH9 A;  1POG A;  3T5X A;  1IJW C;  4CGZ A;  3COL A;  2W4S A;  5D4R A;  2QQ8 A;  5LGU A;  3CF5 F;  1A5J A;  5FKN A;  3KX2 A;  2XAU A;  2DK8 A;  4BEH A;  3NPI A;  3H0G J;  3IRQ A;  5D5V B;  3WE3 A;  4ABZ A;  4NUB A;  4U0W A;  3TP0 A;  1DPU A;  3KLN A;  2KRH A;  4XKW A;  1G6N A;  4A3B J;  3CCM I;  2HQR A;  3M7G A;  2QOP A;  4P9F A;  5KNL A;  2OER A;  3NAR A;  3IKV A;  2Q0O A;  2IW5 A;  2VI6 A;  3BC8 A;  2XAJ A;  1RPW A;  2A68 F;  2EIN H;  3D5R C;  4U9L A;  1ZTR A;  3K1P A;  2KQR A;  4IJA A;  2VBZ A;  5K7F A;  2A2F X;  3VP5 A;  3RZO J;  4JX4 A;  5FRM A;  4NBQ A;  3V8J A;  4Y3O A;  3ABM H;  5CLS A;  1LFU P;  4IRV A;  2VB6 A;  3CMA I;  2LK2 A;  4L5J A;  4JYK A;  3ZMD A;  4P55 A;  5JLX A;  5EFY A;  2QKL B;  4G7Z F;  2F5C A;  2M5W A;  3HOX J;  1BW6 A;  4D1Q A;  2W24 A;  2JRT A;  1XSX A;  4XR6 A;  1I1G A;  5KAF C;  2VQC A;  1FOY A;  2V1D A;  1CGP A;  2PMU A;  1T0F A;  2XC7 A;  5IYD J;  1A6Q A;  5B66 C;  2LKP A;  1UFM A;  3M1C A;  2ME0 A;  2XB5 A;  1E2X A;  4DW6 A;  2Q8K A;  2OC6 A;  3SEZ A;  2LKX A;  4KA4 A;  2DU9 A;  4LIU A;  1UHS A;  2P6T A;  2E36 A;  1WKM A;  2CFO A;  5FKM A;  1P9Q C;  4C2U A;  2VKE A;  5A2Q Z;  5LEK A;  5KCM A;  3HTS B;  2EZK A;  2ELJ A;  3UR3 C;  3S3M A;  1W7P B;  3O8H A;  3OYK A;  1IXR C;  3ROU A;  3K1M A;  1X4O A;  4P1W A;  3GLL A;  3KP3 A;  3QBM A;  1STZ A;  2ZSI B;  4ZH4 F;  3FX3 A;  2PX9 A;  3ZMT A;  2P6S A;  2FBH A;  5EZG A;  4HSR A;  5IOZ A;  3LSK A;  5LBQ A;  3MKZ A;  4LB5 A;  2JMW A;  1LVK A;  3K0L A;  1SFK A;  3UNG C;  1XGS A;  3CCR I;  1IO2 A;  2FBQ A;  2LSO A;  2NS7 A;  2E7W A;  4S04 A;  3A2K A;  2NVT J;  3ELK A;  3SDB A;  2RDP A;  4CCM A;  3E6M A;  1Y0N A;  1U2W A;  2Z2S B;  1BN5 A;  1XN7 A;  3JTG A;  2M3A A;  4C2M J;  2WAE A;  4RGX A;  1Y1V J;  1SAU A;  3I64 A;  3LSJ A;  2DFI A;  1TWA J;  2GBY A;  3IHU A;  1IZ1 A;  2Y69 H;  2KIQ A;  3L7W A;  4HYE A;  3O6B B;  4FE7 A;  5J47 A;  1D1B A;  1GLN A;  3I4P A;  4GO1 A;  2KIS A;  2F4O B;  2L5Q A;  4N9I A;  4ZYA A;  5IP7 J;  1KU3 A;  1S8N A;  1J09 A;  4G7O F;  2FOK A;  1ZR4 A;  4MFE A;  1JUM A;  1T08 B;  3GEZ A;  5F1R A;  5DM6 F;  4G7H F;  9ANT A;  3OWT A;  1Z1D A;  1FX7 A;  1D1A A;  1XDU A;  2A05 A;  2VPL A;  4BXF A;  2LKS A;  4N0B A;  2QM3 A;  2OF7 A;  4BJ5 C;  1WHU A;  3KZZ A;  5KK1 A;  4J00 A;  1YS7 A;  1F43 A;  4N4N B;  2KDO A;  4A5M A;  3P9C A;  1MD0 A;  1UHM A;  2V1X A;  4RAZ A;  1P7J A;  2QF7 A;  1T98 A;  5J8C A;  2NXN B;  1R1V A;  3BTJ A;  4G94 A;  1PP8 F;  2ZB9 A;  3JAM K;  4XMY A;  3SJM A;  3VOD A;  2Y9Z A;  3GWZ A;  4CH7 A;  3C3W A;  2VKV A;  3NXC A;  2BY2 A;  4KYW A;  5GAG J;  3OYC A;  2EFQ A;  2PJR B;  2A6E F;  4YII A;  5H6R A;  1UB9 A;  3ASN H;  5HLT A;  4PJM A;  3IWZ A;  4CCJ A;  4R79 A;  5GAE J;  1XGN A;  3Q0W A;  4V19 K;  3DQV C;  3S15 J;  2NX4 A;  3A1Y A;  2VOD A;  4MIM A;  2O7T A;  2KJC A;  3OOU A;  2HKU A;  2G0E A;  5DYM A;  4XID A;  3VW2 A;  2R3S A;  1Y0U A;  2IP2 A;  4LFU A;  2R7V A;  1MMD A;  1G8X A;  4GCV A;  3R60 A;  1VI0 A;  2ID3 A;  1WPK A;  2L4M A;  1JGG A;  4CHU A;  4XON A;  3VB2 A;  3GTO J;  3BTC A;  2Z33 A;  3ESW B;  2W00 A;  3J7Z I;  4UVB A;  1RIO H;  1W4M A;  3JRH A;  1J59 A;  4DNC A;  2CS3 A;  1IDZ A;  2L7Z A;  4B3X A;  1REP C;  2HWV A;  4WXC A;  2K9M A;  3HKZ N;  4JL3 A;  2LC2 A;  1DUX C;  3I58 A;  3FRQ A;  3PQJ A;  1IN8 A;  2VJ4 A;  2LF7 A;  3OYE A;  3HM5 A;  2VBX A;  1UI6 A;  1O57 A;  3LL7 A;  3LA7 A;  4V2G A;  3GFI A;  1LDK B;  1YI2 I;  1FT9 A;  1VQ8 I;  3W2A A;  1S5L C;  2Y2Z A;  2EFN A;  4NHJ A;  1YIT I;  2R7T A;  2M2E A;  4M6Y A;  3OYI A;  4G6D A;  4FX4 A;  1PUF B;  1XS9 A;  3BCA A;  1MMA A; 
#chains in the Genus database with same CATH homology
 3G1L A;  3HTJ A;  3ZQL A;  4A93 J;  2LP0 A;  3L1P A;  3BCG A;  1JUS A;  1VF9 A;  2K40 A;  2YU9 J;  3HBL A;  2CRG A;  2IEK A;  3GTL J;  2JN6 A;  5CW8 A;  1LE8 A;  2R5Z A;  2MSY A;  1TWC J;  4L5E A;  1Y1W J;  1XG1 A;  4BY1 J;  2HQ5 A;  2ZCN A;  2DA5 A;  3NAU A;  2DMQ A;  4C3I J;  2H1K A;  3GBG A;  4AC6 A;  1I50 J;  5EEA A;  2WB1 N;  2LTP A;  3HOU J;  3ZQG A;  5IYC J;  2R5Y A;  1QVU A;  1B8I A;  1LFB A;  1ZK8 A;  1TWF J;  3G7R A;  2L0K A;  3TP3 A;  2LY9 A;  4A3G J;  4QIW N;  5FJ8 J;  3JRE A;  1DU6 A;  3K2A A;  1SAN A;  1TC3 C;  1JJ8 C;  3HGY A;  1TWG J;  2EBI A;  2EQR A;  3ZQH A;  4CYC B;  3RZD J;  4NN1 A;  5BNG A;  5C3E J;  5E3L A;  3Q0V A;  1ETW A;  2RHA A;  2G7G A;  2YVH A;  1H89 C;  2O7O A;  3A01 A;  5AQC A;  4A3K J;  1QRY A;  1HCR A;  3BR6 A;  2VPR A;  1JKO C;  2HXO A;  5GP9 A;  2K9S A;  5EZH A;  5CXG A;  2Y0S N;  3S1R J;  3O60 A;  3BR1 A;  3A03 A;  4C3J J;  3D1N I;  5HSZ A;  2D6Y A;  3K7A J;  1ZQ3 P;  1EF4 A;  2LD5 A;  4B1R A;  4IEJ A;  4FCY A;  4D5F A;  1NK2 P;  3HTI A;  3ZQC A;  5EG0 A;  3LOC A;  4D7N A;  2QTQ A;  5IOY A;  5E3M A;  3AQT A;  1JUP A;  3RKQ A;  2B63 J;  3WHC A;  4IHV A;  2EZH A;  5D1R A;  2ECB A;  3GEU A;  5M3F J;  4A3I J;  5D18 A;  2AO9 A;  3VPR A;  2G7S A;  1H8A C;  4NDL A;  1FJL A;  3VOX A;  1UG2 A;  2AHQ A;  3JRI A;  1ETV A;  4W97 A;  5J1U A;  3JRF A;  3VVY A;  1IGN A;  3BG3 A;  3FKI J;  4XRS A;  3LHQ A;  2OPT A;  5FKL A;  2NVY J;  1NK3 P;  2JJ7 A;  3CQZ J;  4M3F A;  5GPA A;  3RQI A;  3F1B A;  1OJL A;  1OCP A;  4X6A J;  1HDP A;  1MSF C;  2RAS A;  1JKQ C;  5C44 J;  4JX5 A;  1HLV A;  4HKU A;  3NRG A;  1OFC X;  4XK4 A;  1B72 A;  1JTY A;  4RBO A;  4KWA A;  2WAQ N;  1ENH A;  2MW8 A;  3PM1 A;  5DTD A;  1HOM A;  3V78 A;  2ZCX A;  4YZE A;  3VOK A;  4AYB N;  2UXI A;  1LE8 B;  1FIA A;  2R5Z B;  3VVX A;  5K58 A;  3KKC A;  2YS9 A;  1X2N A;  1UMQ A;  5DAJ A;  4AC0 A;  4G12 A;  3BG5 A;  3DEW A;  1ETX A;  3B6C A;  3SDG A;  1XC5 A;  3ZQF A;  3VUQ A;  3IV5 A;  2MG4 A;  4JNN A;  1F36 A;  2GUH A;  1GVD A;  4XRS G;  1R9T J;  2Y9Y A;  4MXM A;  5H9T A;  5HAW A;  2CUE A;  1B8I B;  4IHY A;  1ETK A;  2W48 A;  3ANG A;  2DJN A;  2XSD C;  4QTR A;  2GM4 A;  2E2H J;  2EZI A;  3GTQ J;  3QQA A;  3BTL A;  3MVP A;  3QPS A;  4W1U A;  3CMY A;  3M3Y J;  4HNV A;  3Q0U A;  4BY7 J;  4D7M A;  3BR5 A;  2ZOZ A;  3QKX A;  3IH4 A;  3ZQI A;  2XB0 X;  2LLK A;  3I4M J;  1ITY A;  4LOC A;  4UUS A;  2DA1 A;  2DG8 A;  2UXO A;  3GTJ J;  2L7M P;  4NEL A;  1T56 A;  2XPU A;  2IBD A;  2G3B A;  3OSG A;  5JLW A;  2NS8 A;  5IP6 A;  3TW6 A;  2PZ9 A;  3IH3 A;  3B6A A;  2XPV A;  5E3N A;  3EUP A;  4A3L J;  1X58 A;  3P9T A;  3BNI A;  1X2M A;  1WGX A;  4A3J J;  2DMN A;  3HOW J;  2KT0 A;  2FX0 A;  2L7F P;  1ETQ A;  5F08 A;  2JA7 J;  2DMU A;  2XGE A;  1FTT A;  4V2F A;  2JK3 A;  1K61 A;  2YUS A;  1GUU A;  2LR8 A;  3CDL A;  2TCT A;  3LWJ A;  3ZOB A;  2HYT A;  1DU0 A;  2CJJ A;  4MK6 A;  1VFC A;  2WGB A;  5EG0 B;  2O9L A;  5M3M J;  3VVZ A;  1JT6 A;  1U9N A;  3PO2 J;  4M6V A;  3S5R A;  3WHB A;  2M34 A;  5J1R A;  1Z0X A;  4J19 A;  2X9D A;  5M5W J;  2D5V A;  3B81 A;  3S1Q J;  4DYQ A;  3HOY J;  4IHW A;  2M9H A;  2NOG A;  4M3G A;  1ETO A;  2JA6 J;  3JR9 A;  4I6Z A;  4MLO A;  3EGQ A;  2NP5 A;  2FJ1 A;  5F1J A;  2UXH A;  1A6I A;  1RKW A;  1JTX A;  3S14 J;  3S2H J;  3IH2 A;  3PPB A;  3HTA A;  2L9R A;  2ZOY A;  2TRT A;  1FIP A;  3HE0 A;  4FTH A;  3LJL A;  5EDN A;  1W0T A;  2X6O A;  4DZP A;  1JKR C;  4A3D J;  2N8G A;  2R0Q C;  3MKL A;  1FEX A;  1B72 B;  4GCK A;  1CQT A;  2CU7 A;  3G56 A;  2LFB A;  1POG A;  4Y52 J;  2XPW A;  5FKO A;  2HOS A;  2V57 A;  3LNQ A;  1GV5 A;  1IJW C;  3C07 A;  3VIB A;  2PMZ N;  3TW7 A;  3E7Q A;  4L62 A;  3COL A;  3CWR A;  1Q1V A;  1S7E A;  2XDN A;  2DA7 A;  1A5J A;  3GTM J;  5FKN A;  5C4X J;  1RKT A;  4A3F J;  1FTZ A;  2YVE A;  1RR7 A;  4DYR A;  2NVX J;  3NPI A;  1YRN A;  5IPA A;  3UKG A;  3H0G J;  2NVQ J;  1AU7 A;  3FK6 A;  3PAS A;  3RD3 A;  3VW0 A;  4ABZ A;  3TP0 A;  3T6N A;  4FIS A;  1OCT C;  2VUM J;  2X48 A;  3O8G A;  4A3B J;  3BR3 A;  1P7I A;  2QOP A;  2OER A;  4Y7N J;  4X1E A;  1MH4 A;  3NAR A;  1MBJ A;  3GZI A;  5GPC A;  1ZR2 A;  2DMP A;  2VI6 A;  2XRL A;  1Z77 A;  1AKH B;  1UI5 A;  3BJB A;  3MNL A;  1RPW A;  3MN2 A;  4M3D A;  5F27 A;  4UUS B;  1ZTR A;  1BA5 A;  5D19 A;  3CCY A;  5K7F A;  3VP5 A;  3RZO J;  2CQX A;  4JX4 A;  1ZGW A;  1MBE A;  3C2B A;  3ANP A;  4GFL A;  2QWT A;  3HIM A;  1SGM A;  4I76 A;  1LFU P;  4GCL A;  5M5Y J;  2LK2 A;  2COB A;  1E3O C;  4JYK A;  3G1M A;  4B4C A;  5JLX A;  4JP0 A;  3OIO A;  5EFY A;  1I3Q J;  1MNM C;  2W53 A;  2WUI A;  3HOX J;  1BW6 A;  4C3H J;  2UXU A;  2ELK A;  2P81 A;  3JRC A;  1ZKG A;  4S0H B;  1JKP C;  2R5Y B;  2XGC A;  4BKX A;  2KDZ A;  3F0C A;  2QKO A;  4ME9 A;  5IYD J;  3DPJ A;  2EZL A;  1MBK A;  3CRJ A;  4GFB A;  4AF5 A;  1D5Y A;  1AHD P;  1T33 A;  2O8K A;  2ME0 A;  2XB5 A;  4DW6 A;  1RES A;  1W0U A;  2LKX A;  5J1Y A;  2ZCM A;  2LVS A;  3H3V K;  1H88 C;  4BBS J;  4D5C A;  1GDT A;  4XRM A;  1UHS A;  3ON2 A;  3BTI A;  2DA4 A;  2NP3 A;  1GV2 A;  2Y31 A;  5FKM A;  2VKE A;  3A01 B;  2DTZ A;  3NNR A;  4PXI A;  4UUT A;  2EZK A;  4BBR J;  3O8H A;  5FLM J;  1BW5 A;  3BT9 A;  4QSH A;  5F0F A;  5K7H A;  2OI8 A;  1MBH A;  1JT0 A;  2FQ4 A;  4A3C J;  3QBM A;  1IG7 A;  3GTG J;  2H8R A;  2EH3 A;  4B3A A;  5C4J J;  1JJ6 C;  5EZG A;  5IOZ A;  2I10 A;  3IUV A;  3NI7 A;  5F0C A;  1U9O A;  3VW1 A;  2JMW A;  2CUF A;  3S1M J;  3HOZ J;  1O4X A;  2MGQ A;  2R92 J;  2NS7 A;  2FBQ A;  2REK A;  3E7L A;  2XGD A;  4AUX A;  2NVT J;  3FIS A;  4UDS A;  1HF0 A;  4MO7 A;  4FE4 A;  3LSG A;  3BQY A;  5EYR A;  3HDD A;  5K7Z A;  3BRU A;  1TWH J;  5F0H A;  3S2D J;  5EGO A;  4C2M J;  4A3M J;  1QVT A;  2DA2 A;  1YRN B;  1Y1V J;  3JRB A;  3LSJ A;  1TWA J;  1I6H J;  1ORK A;  2GBY A;  1IUF A;  4M3E A;  1WH7 A;  2M8G X;  1PUF A;  2HXI A;  2FD5 A;  4FE7 A;  3CJD A;  5FLV A;  5IP9 J;  3G1O A;  4A69 C;  5IP7 J;  2GLO A;  3GTK J;  2M0C A;  3A02 A;  3HB9 A;  4DZJ A;  2F07 A;  2E2I J;  1ZR4 A;  1SFO J;  1APL C;  4A3E J;  2PBX A;  4MFE A;  1JUM A;  1GT0 C;  2HOT A;  1NTC A;  1RET A;  1WI3 A;  9ANT A;  4JKZ A;  3HGG A;  1WCM J;  3BR0 A;  2K9N A;  5FKK A;  2ME6 A;  2DA6 A;  5FGL A;  2JA8 J;  2QCO A;  1HDD C;  3JRA A;  4ICH A;  1ETY A;  2OF7 A;  1BL0 A;  2QIB A;  2R7Z J;  1F43 A;  5E3O A;  3GTP J;  2DG7 A;  5F04 A;  1WH5 A;  2CQQ A;  3HEF A;  4M3B A;  3S1N J;  2G7L A;  4CGR A;  3AQS A;  4JX6 A;  2HDD A;  1P7J A;  3QPL A;  2QF7 A;  3TED A;  3S16 J;  5CXI A;  5FHP A;  2K9Q A;  3SFI A;  1BJZ A;  2WV1 A;  4CYC A;  3BTJ A;  2ZB9 A;  2Y30 A;  2GEN A;  3HTH A;  3SJM A;  1VND A;  3LSR A;  5HBU A;  2Y9Z A;  2E2J J;  5EF6 A;  3W6V A;  4EEF G;  3KKD A;  3KNW A;  1G2H A;  4IHX A;  2DN0 A;  2VKV A;  3NXC A;  3V6G A;  3DCF A;  3BR2 A;  3OSF A;  4ACI A;  3FK7 A;  2UXP A;  2E1O A;  2IAI A;  3Q0W A;  1MSE C;  3Q3S A;  3S15 J;  3S17 J;  2DA3 A;  3FIW A;  2NX4 A;  3M4O J;  3JSJ A;  2GFN A;  4MIM A;  1IC8 A;  2O7T A;  3OOU A;  3VW2 A;  2HKU A;  2G0E A;  4XID A;  2ECC A;  3I4N J;  5HOD A;  4XIC A;  5C4Y A;  5IYB J;  1VI0 A;  3KZ9 A;  2ID3 A;  1WPK A;  1MH3 A;  3PO3 J;  1JGG A;  2E19 A;  5J3L A;  3GTO J;  3BTC A;  4BXX J;  4DYC A;  5M5X J;  1IRZ A;  2JA5 J;  3LSP A;  3JRH A;  3JRD A;  3BHQ A;  2HYJ A;  1IDZ A;  2L7Z A;  4RDU A;  4GCT A;  3HOV J;  3HKZ N;  4JL3 A;  1U78 A;  1U8B A;  3FRQ A;  5EGO B;  1UI6 A;  3BQZ A;  4GFK A;  3HM5 A;  2HOA A;  2ID6 A;  2Q24 A;  4V2G A;  1IV6 A;  2R93 J;  2Y2Z A;  5DS9 A;  3ON4 A;  2IU5 A;  2HI3 A;  2M2E A;  4MFD A;  2DMT A;  2JWT A;  5FMP A;  3BG9 A;  1MBF A;  1IDY A;  3RH2 A;  1K83 J;  2RAE A;  1QPI A;  1PUF B;  1AKH A;  1MBG A;  1XS9 A;  3JRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...