1VI0A

Crystal structure of a transcriptional regulator
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
189
structure length
189
Chain Sequence
PKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
total genus 71
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1vi0A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1vi0A02
2CJJA 5E3NA 2NX4A 1GT0C 1I50J 2XSDC 1IDZA 1QRYA 1WCMJ 1U9OA 3HTIA 2WB1N 3RH2A 3TP3A 4A3DJ 4A3BJ 3LOCA 3O8HA 1W0TA 1IG7A 1ETOA 4JX6A 1APLC 1FTZA 3BRUA 3P9TA 1X58A 3E7LA 1FEXA 2E1OA 3Q3SA 1A5JA 2VUMJ 5E3LA 1H8AC 1K83J 4JP0A 4HKUA 1WI3A 1XS9A 3TP0A 1ZTRA 2DMPA 3ON4A 1TWAJ 2XRLA 4D5FA 3D1NI 1ETXA 3HOVJ 3BG9A 1HOMA 3BCGA 4NN1A 1X2NA 2GUHA 2RHAA 5FKLA 3RD3A 1JKOC 1ZKGA 3HOZJ 4DYRA 4GFBA 3BR6A 3QPSA 3LSJA 3FK7A 5FKNA 5IOYA 3BG3A 3QPLA 4MFDA 3JRBA 2ME6A 4I6ZA 2FX0A 2N8GA 4A3FJ 4FCYA 1MBJA 4L5EA 5EDNA 2O8KA 1P7JA 3K7AJ 1SFOJ 2HOTA 3A01A 1OCPA 2XPVA 4BBRJ 2DG8A 5FLVA 2DA1A 3KZ9A 5FMPA 3PO3J 3RZOJ 2XGEA 5K58A 1NTCA 1TWFJ 1FJLA 1NK3P 3HOWJ 4GCKA 4IHVA 2HQ5A 3HEFA 3COLA 5K7FA 5F0CA 2HDDA 2WUIA 2WGBA 3BR1A 1ZK8A 2DN0A 2M0CA 2M8GX 1B72B 2W48A 2UXIA 2DTZA 2R92J 1TC3C 4ME9A 2PBXA 2R93J 2GM4A 2UXPA 5M5YJ 3LSGA 2HKUA 3F1BA 3JRDA 5DAJA 2GENA 2X6OA 4M3BA 1NK2P 1WH7A 4IHXA 2YVHA 1JT6A 1MBGA 2HXOA 2D6YA 3ZQFA 2O7OA 4V2GA 1CQTA 3JR9A 4AC6A 4L62A 2UXOA 1ETVA 3K2AA 4A3GJ 3C07A 1VNDA 3AQSA 2X48A 1RKWA 3Q0VA 5IPAA 4YZEA 3VOXA 2CUFA 4A3EJ 2ZCMA 3CMYA 3LJLA 2ZOYA 4JX5A 2Y9YA 3LNQA 3GTPJ 1FIAA 3RQIA 3H3VK 2LK2A 2O7TA 1X2MA 2JN6A 4X1EA 2DMUA 1IGNA 3HIMA 3VVXA 4XICA 3BR5A 5K7ZA 2B63J 2R5ZA 1Y1WJ 2Q24A 2ELKA 5EYRA 1H89C 3CQZJ 4BXXJ 2XB0X 1JJ6C 2ME0A 2WV1A 2DA3A 5C4XJ 1LFUP 2ZCNA 1WPKA 1Z77A 3VIBA 2V57A 4IEJA 3DEWA 3GTQJ 2EBIA 5M5WJ 2JJ7A 2NS8A 5IYBJ 4D5CA 4XRMA 4RBOA 2ZOZA 1YRNA 4C3IJ 5FGLA 2OPTA 1RPWA 1Z0XA 3BR2A 2LKXA 4CYCA 2E2IJ 1R9TJ 1F43A 9ANTA 4MXMA 1GUUA 4QSHA 1MH4A 5IP9J 3OSGA 1GVDA 1ORKA 1G2HA 3AQTA 1FTTA 3G7RA 2EQRA 4UUSA 1HLVA 4M3FA 2XB5A 3ZOBA 4BKXA 2CQXA 3VUQA 5HSZA 4UUTA 4B3AA 2XGDA 3VW2A 1IC8A 3ANGA 3LSPA 1JT0A 2P81A 2MGQA 3S1QJ 3S17J 3PPBA 1D5YA 1WGXA 1RKTA 2VPRA 4MFEA 1B8IA 3HDDA 4GFLA 1QVTA 2R5YA 3G1OA 5E3OA 1JKQC 1SANA 2LD5A 3HOYJ 5EFYA 4B1RA 5GP9A 1MBEA 2GLOA 2YUSA 2DMTA 5DTDA 3MKLA 3SJMA 4BY1J 3PASA 2FQ4A 1MH3A 1VF9A 2Y0SN 1TWCJ 3HTAA 3CRJA 3TW6A 2E2HJ 2K9SA 3VVYA 4A3LJ 1MNMC 1POGA 3S15J 2JA7J 2JA8J 5EGOA 3SDGA 4ABZA 4DW6A 1FIPA 4M3EA 3ZQHA 3QBMA 3QKXA 4QIWN 3V78A 3KNWA 4AC0A 2DA5A 2JA6J 4LOCA 3JREA 3G1MA 2NVYJ 1AKHA 1P7IA 1ITYA 2LFBA 3C2BA 2MSYA 3DCFA 4M6VA 2IBDA 2CUEA 4DZPA 1A6IA 2DA7A 3GEUA 2EH3A 3IUVA 4XK4A 4S0HB 2KT0A 2COBA 5EEAA 3T6NA 4BBSJ 5CXIA 1BW6A 5E3MA 3CWRA 2JWTA 1BJZA 3JSJA 5C3EJ 4C3JJ 5DS9A 2DMQA 2ZCXA 2R0QC 1JJ8C 3Q0UA 2RASA 2F07A 5M3MJ 2EZKA 3NI7A 1LE8A 2UXHA 3BHQA 2R7ZJ 3MNLA 3NPIA 2MG4A 2EZHA 1ETKA 4JKZA 1RESA 3I4NJ 2M9HA 4A69C 3WHCA 3CJDA 2QCOA 2FD5A 2IAIA 5F0FA 5EG0A 3MVPA 5K7HA 2HYTA 3HE0A 4EEFG 3ZQCA 1JUPA 4XRSA 3GBGA 1Q1VA 3G56A 1PUFB 2ID6A 3BNIA 2QTQA 2YVEA 4X6AJ 5J1RA 2L7ZA 3FISA 5JLXA 3MN2A 4MLOA 1JUSA 5J1YA 5HAWA 5HODA 4AUXA 3GTOJ 2LR8A 3FK6A 1I6HJ 2XPWA 2VI6A 1IUFA 1RR7A 2XPUA 3I4MJ 2VKEA 3O8GA 2CU7A 2LTPA 4QTRA 1UI6A 5HBUA 4PXIA 3A03A 2K9NA 2OI8A 1TWHJ 3FIWA 1MSEC 2RAEA 5C4YA 2REKA 5EF6A 2L0KA 3GTJJ 3G1LA 2QIBA 2L7FP 3LSRA 5EZHA 1BW5A 2QOPA 4UDSA 5H9TA 4JL3A 1RETA 1U8BA 1QVUA 4V2FA 4IHYA 2O9LA 3HTHA 4XIDA 3DPJA 3EUPA 4FTHA 3M3YJ 2HYJA 4BY7J 3S1NJ 4C2MJ 5D1RA 3IV5A 2LP0A 5GPAA 3GTGJ 2YU9J 3JRAA 1ETYA 2AO9A 1GDTA 1BL0A 2GFNA 4A3KJ 2DA2A 1U78A 2VKVA 5IYDJ 2K40A 2I10A 2NP5A 2KDZA 5F1JA 1WH5A 2WAQN 4M3GA 3W6VA 1XC5A 1MBFA 2HI3A 3JRCA 1HCRA 5GPCA 2JA5J 2HOAA 1F36A 4MIMA 1T56A 1GV5A 1HDDC 2FBQA 3VP5A 4JNNA 3HKZN 5C4JJ 2Y31A 1UG2A 4NDLA 1DU0A 5FLMJ 4NELA 4D7NA 3FRQA 4W97A 2ECCA 3CCYA 3B6CA 5M3FJ 4Y7NJ 1S7EA 4FE4A 2LVSA 3JRFA 3JRHA 2W53A 3V6GA 2R5ZB 2D5VA 3OSFA 4FE7A 1AU7A 4B4CA 3S5RA 5J3LA 3ANPA 3BTIA 3HGGA 4ICHA 3JRIA 1ZGWA 5IP7J 3BG5A 4M3DA 2NS7A 1GV2A 1YRNB 3M4OJ 3PO2J 2K9QA 4GCTA 3HBLA 1BA5A 2TCTA 3GTLJ 5FJ8J 2HXIA 2GBYA 1B72A 4D7MA 1W0UA 3BTJA 4G12A 4CYCB 1HF0A 1JUMA 3HOXJ 5D18A 2IEKA 3FKIJ 3HB9A 2EZLA 1I3QJ 5IYCJ 4J19A 2FJ1A 3Q0WA 5F04A 1ETQA 2XGCA 3CDLA 5J1UA 5IP6A 4FISA 4RDUA 4UUSB 3GTKJ 1TWGJ 3OOUA 2HOSA 5F08A 1ENHA 4MK6A 1XG1A 3S2DJ 3BQYA 2EZIA 3PM1A 1IV6A 2JMWA 2DJNA 2M34A 2QF7A 3IH4A 2XDNA 3LWJA 1PUFA 3QQAA 4GCLA 2MW8A 1UMQA 3IH2A 2NVXJ 3BQZA 1B8IB 5CW8A 2DA6A 2R5YB 1K61A 3S2HJ 2Y2ZA 3S1MJ 4A93J 4JX4A 3ZQGA 2Y30A 4DYCA 1OCTC 1IDYA 2NVQJ 1JTYA 3E7QA 3KKCA 1DU6A 2IU5A 1Y1VJ 2X9DA 1O4XA 3BR3A 3NAUA 5F0HA 4GFKA 3L1PA 5EGOB 3HGYA 4A3JJ 2G7SA 5CXGA 5FKMA 4CGRA 4KWAA 2JK3A 2L9RA 1ZR4A 3BT9A 2H1KA 3VVZA 2G3BA 1VFCA 5AQCA 4Y52J 3IH3A 4I76A 1MBKA 3OIOA 1JKPC 1AKHB 3RKQA 3S1RJ 2NP3A 2DA4A 1SGMA 4DZJA 1H88C 4MO7A 2NOGA 1IRZA 3SFIA 5JLWA 4A3MJ 2OERA 3VOKA 3A01B 3NXCA 2E19A 1JGGA 3ZQIA 3LHQA 3VW0A 3A02A 2DG7A 2PZ9A 2TRTA 2NVTJ 2QWTA 1ETWA 2LLKA 3NNRA 1HDPA 3B6AA 2QKOA 3GTMJ 1LE8B 2ZB9A 3ON2A 1ZQ3P 1MSFC 3VW1A 3TW7A 3F0CA 4C3HJ 3ZQLA 5BNGA 4A3IJ 2CQQA 2ECBA 3JRGA 4XRSG 1EF4A 3O60A 2G0EA 5F27A 5D19A 4AYBN 1U9NA 3HOUJ 2G7LA 2DMNA 5EG0B 3KKDA 1IJWC 2E2JJ 1UI5A 3NARA 4W1UA 3H0GJ 3RZDJ 2Y9ZA 3EGQA 5EZGA 4A3CJ 2ID3A 3BTCA 3UKGA 1LFBA 1AHDP 3HM5A 2H8RA 3BR0A 3B81A 5FKOA 4IHWA 2LY9A 1OFCX 5FKKA 3HTJA 2M2EA 3S16J 3S14J 3VPRA 2G7GA 3GZIA 4ACIA 1MBHA 1UHSA 1VI0A 4HNVA 2CRGA 1T33A 1QPIA 4AF5A 3NRGA 3TEDA 1ZR2A 5C44J 2YS9A 3BJBA 5FHPA 1E3OC 2OF7A 1JTXA 3BTLA 2L7MP 5IOZA 3WHBA 1JKRC 4DYQA 2AHQA 5M5XJ 2UXUA 1OJLA 4JYKA 2PMZN
chains in the Genus database with same CATH superfamily
2CJJA 4Q5SF 1R7JA 1JGSA 1R5HA 3KLNA 5JVGF 1VQLI 3MKYB 2A3SA 1QRYA 3CP8A 3D5SC 1IDZA 2GA2A 2Z33A 1U9OA 3HXLA 3KP2A 4GGGA 1K7AA 3RH2A 3VYTB 2RDPA 3ZN1A 4A3BJ 2IJLA 3BRUA 1APLC 1JHFA 4HOBA 4F93B 3OL3A 4I7HA 2DQLA 4GO1A 1KU3A 2RC4A 3E7LA 1FEXA 3CCEI 1MIJA 4LLGF 1A5JA 2VUMJ 3GVAA 3HC7A 5HNFA 2BY1A 2PFVA 5DCFA 5K5OA 4HKUA 3A0BC 1YE9A 1ZTRA 2OQRA 1TWAJ 2XRLA 3D1NI 3HOVJ 2P5KA 3BG9A 1HOMA 2GQQA 1ZGJA 1ACIA 4NN1A 1X2NA 5HDNA 2GUHA 3RD3A 4LIUA 4WCGA 1JKOC 3QPHA 1TW3A 2YX7A 2A5WA 4LFUA 2P4WA 1TP4A 3HOZJ 4ESJA 4BQQA 1D1BA 4PJNA 2M0MA 5DUKA 3QPSA 1H9TA 3CC2I 2B9SA 3RYRA 3QPLA 3OYIA 1VQ6I 4E6KG 3I54A 2FX0A 4RLFA 3HSEA 2ELJA 2L2OA 2HOEA 3RIRA 2O8KA 4HQMA 1T95A 2CO5A 3K7AJ 2KRCA 2K9MA 1OCPA 1WFXA 3K4JA 4BBRJ 3CCMI 5FLVA 2DLLA 4GCKA 1NTCA 1NK3P 3HOWJ 4BDYA 3QU3A 3REOA 5DCMB 3HEFA 5KAIC 2HS5A 3COAC 2E1CA 2WUIA 2KMUA 4D9JA 2M0CA 2ZMEC 2JQ7A 4HRIA 2UXIA 3HTSB 1NH3A 3VSKA 4ME9A 2E35A 2P8TA 2PBXA 4BJ5C 1RUOA 2DOAA 4HLXA 2CW0F 4XLHA 1OISA 1YW8A 3P7NA 3I59A 1K78B 2HVSA 5DAJA 2OQGA 1WH7A 2B3WA 2DU9A 3HHHA 3BROA 3FM3A 1UZCA 2YR2A 2O7OA 1L3LA 2YSRA 2HWVA 3SZTA 3JR9A 2UXOA 1ETVA 2W1OA 2FBHA 1RKWA 4Q48A 3FHNA 4HNUA 3VOXA 1RRJA 3IKVA 3EUHC 2CS3A 2F4IA 2MLGA 4E7LA 4Z6YA 2DOEA 5FROA 3H3VK 5H2FC 2R7TA 1W5SA 3KZIC 4O3MA 3FWEA 1EH7A 4XNFA 1XSDA 2JN6A 2RREA 2DMUA 2O03A 1UJ8A 3LWFA 3BR5A 5K7ZA 2B63J 1JI8A 3OS1A 1KQ0A 3PUFA 4RB0A 2ME0A 4BQNA 5HDKA 5M5WJ 4CA0A 4D5CA 2R3SA 3BG6A 3FBNB 3HHGA 4RBOA 1J75A 3HRTA 2OPTA 2ADUA 1ONVA 2W7NA 4OOIA 3ZQQA 1UHMA 1FMVA 3CF5F 1WJ5A 2V4JC 3TOAA 2E1MC 2CV2A 3D5RC 3T8TA 1W5CC 4LB5A 2LKXA 4P9UA 2E2IJ 1OYWA 3ZMZA 1R71A 1OYIA 3L2VA 4A5MA 4PFPA 1F43A 5HS7A 5IP9J 4H4KC 2BY3A 2EQRA 4IF4A 2PMHA 4UUTA 4WXCA 3E3VA 1Z9CA 3DXJF 1Y39A 3MCZA 3OYDA 1IXSB 2ACJA 3S1QJ 1D5YA 2VPRA 2ZJRF 3HDDA 2JTVA 2LD5A 3IC7A 1J7KA 2GLOA 1ZARA 1MH3A 1VQPI 1W7PB 5FFZA 3TW6A 2E34A 2W00A 3AG1H 2KL4A 4BL0B 4A3LJ 1MNMC 3S15J 2JA8J 4BXUA 4ABZA 4ESBA 3GMEA 3HRUA 5ICCA 2IS1A 1UAAA 2BY0A 3QKXA 4QIWN 1WJAA 1XN7A 4AC0A 2VQGA 3G1MA 1KGSA 4YRVA 2OTJI 4XLNF 1P7IA 1ITYA 1MZBA 2LFBA 4V19K 2CUEA 2VKHA 3OL4A 4DZPA 4H0EA 1A6IA 4NB5A 5J8FA 2KQRA 1VQ5I 2QSFX 4AU7A 1SC7A 2QUFA 2BE5F 1BR1A 1E3PA 2COBA 5EEAA 5KCMA 3IL2A 4JOMA 4BBSJ 4ESFA 1LQ1A 4C3JJ 1G3SA 4PUSA 1U0JA 3EUKL 4HDVA 3OR2C 3LAPA 4G7HF 2RASA 3GO5A 2HTSA 3CCJI 2A07F 5B3SH 4RAGA 2ZFUA 3WTZA 1JXSA 3HOSA 3C1DA 1BR4A 2M1BA 3G3ZA 5E1ZB 5TRDA 1O7FA 2BXZA 2HEOA 1S9HA 2V1DA 3T1BA 1R6RA 2QCOA 2FD5A 4KJZA 4XSXF 2RQPA 2DO7A 4XOPA 4DBRA 3L2CA 4XRSA 3GBGA 3FXLA 5H6RA 3I9V2 3JAMZ 3G56A 1PUFB 2XV4S 2ID6A 1CGPA 2IGKA 4X6AJ 1USTA 2L7ZA 3OOPA 4XONA 3CCVI 4L5JA 3ZMSA 5HODA 2L54A 2LR8A 2KLOA 2ZXJA 4Y4RA 3DKXA 3BP8A 2OUMA 2VI6A 4EJUA 1RR7A 4AD9A 2VKEA 3DWLE 2AQFA 3O8GA 3OIQA 4AYBA 2G7HA 5ILUA 4OWRB 4M74A 4CICA 2MA3A 5C4YA 4FASD 2RAEA 1W1WE 4XORA 3GTJJ 4UDSA 1B59A 2L7FP 3WTYC 5LBQA 4HYEA 1U8BA 3HTHA 2QOPA 2XIGA 1YO5C 2D1VA 4U0YA 1I5ZA 2W82A 3FMRA 2LG4A 2HYJA 4ZYAA 1QZYA 3DTEA 4PDKA 4AVZA 4XOTA 4C2MJ 5D1RA 2LP0A 2H27A 2LREA 5FGMA 2DW4A 4QPQA 1ETYA 3I59B 1USSA 1SFKA 3GFJA 2VKVA 4OAYA 5DUIA 1RIOH 5FD5A 2K40A 3D5LA 1RZ4A 1TQIA 4LK0F 2KDZA 1OMIA 1I27A 5F1JA 4WX9A 1G4DA 1WHUA 3CDIA 5JR3A 2HZDA 1HCRA 1MBFA 3JRCA 4KDPA 3ESWB 2HOAA 1GVJA 3VB2A 4MQ9F 4BXFA 2CFOA 3V8JA 5EEGA 3GLXA 4YIRX 4OMYA 2Z3YA 1ERDA 4NDLA 2WB1A 1IRXA 1ZH5A 2MC4A 3NEUA 4UHTA 4W97A 2ECCA 2XGXA 3VFZA 4C2MA 2UZKA 4BQOA 1DQUA 3ABMH 2LY2A 2ZXIA 3V6GA 3CJNA 1HC8A 3OSFA 4K2EA 5HS8A 1P4WA 2H6BA 1AU7A 4CZCA 4FX4A 4ICHA 2PN6A 1YW7A 2VXZA 5IP7J 4IHSA 3BG5A 4RGRA 2FNPA 3M4OJ 2K9QA 3M1EA 4OD5A 1O57A 1E17A 2VBXA 2R7DA 4HF0A 3GTLJ 5FJ8J 3AL0B 5GTHC 4BH9A 3GFIA 1B72A 3X2QH 2H1LA 4G12A 1HF0A 1XTAA 3UNGC 5D18A 4XKVA 1BI1A 3PIPF 1U2WA 5FRNA 3DV8A 2WBMA 1FSEA 5IP6A 1S7OA 1EKEA 1H0MA 3BWGA 2HOSA 1XG1A 3J7AO 2O61A 3HL2A 1Y0UA 2LBFA 2XDNA 3IH4A 1BBYA 2EIKH 2XUBA 4GCLA 2MW8A 4EMSA 3PFYA 3V42A 1WKMA 2VKDA 3OR1C 3BQZA 4E7KA 3K2ZA 5CW8A 3CJRB 4I0AA 1O7LA 3S1MJ 4A93J 4JX4A 3ZQGA 1IF1A 2Y30A 2VASA 3KP4A 5JVTA 4NHJA 1TZLA 3K1NA 1DU6A 4WXDA 1Y1VJ 1FOKA 2NNNA 3ML6A 5F0HA 1OYYA 4LLNA 4CGRA 4A3JJ 5FKMA 5CVIA 3JTHA 4IRIA 1S8NA 2E7WA 2XROA 2M3AA 2EV0A 2ETHA 1FP2A 2E60A 3IHUA 2P5VA 3S1RJ 3SZGA 2DA4A 1XDSA 2EK5A 3GCMA 3VYSB 3CMAI 4A12A 4R8HA 1SGMA 1WJEA 2A6TA 2QKMB 3KZZA 1IRZA 3SFIA 2C6YA 3LSKA 5GADJ 3NXCA 2E19A 2WV0A 2LKPA 5L3GA 3W6KB 3LHQA 1V55H 3VW0A 4OAZA 3IRRA 2NVTJ 2DJIA 1HDPA 2MD5A 3B6AA 2JVGA 1ZN2A 2QKOA 4RLQA 5HLGA 1UB9A 3QPTA 3IUOA 1YS6A 3F0CA 3KP6A 4HA8A 3ZQLA 3ZP5A 2O3FA 2CQQA 4PFOA 4U7DA 3O60A 1G8XA 2EFNA 3JSPA 1N77A 2G7LA 4M72A 2FE3A 2JT1A 3GZ5A 3PNTA 3KKDA 4UV9A 5EJCA 3C2HA 2EFQA 3H0GJ 3W3CA 3JAMK 4M9ZA 3E6CC 3EGQA 2CMPA 5EZGA 4Q4ZF 1IO2A 5ICEA 4A3CJ 4HNTA 3W2WA 3HZJA 3HM5A 3BR0A 3T8RA 4A6DA 4GCVA 3P9KA 5FKKA 1KONA 3S14J 4ZZDA 4ACIA 4P55A 1UHSA 2OV7A 4G9YA 2F4MB 4N9IA 1TLHB 3A1YA 4NNJA 4AF5A 2NOJB 2ZNYA 3TEDA 5K5RA 2KHMA 3TQNA 1LFPA 1WZ2A 2L7MP 4G94A 4PGGA 4X0GA 5M5XJ 3HUGA 2PMZN 4JYKA 1YX3A 1QO0D 3GWZA 5E3NA 2KIFA 1GT0C 2OAZA 1WCMJ 4RAFA 1IN8A 3KP7A 1W0TA 3F3XA 4EJTA 1Y56A 4DGWB 3RCOA 2XAGA 1X58A 3NQOA 3DEUA 1XMAA 2YX4A 1YJNI 5E3LA 2X51A 3F6VA 4JP0A 4J01A 4BE1A 4U0VA 4Y15A 1QPMA 3RQ4A 2DMPA 2EFOA 3HYIA 3RPUD 4LG0B 3ON4A 1DGWY 1SD5A 4UNOA 1HXDA 1X1PA 3L2RA 2RHAA 2ZMEA 5FKLA 2MYSA 4EGYA 1LUJB 3GYHX 3TGNA 4HDUA 1MD0A 2QQ8A 3BR6A 3K1PA 4OU0A 3GZ6A 3LSJA 2BW3A 3FK7A 4UVCA 3J7AY 5FKNA 1D1AA 2FNAA 3CJTB 3BG3A 1LKXA 3DKYA 3JRBA 2STTA 4XLCA 5DEQA 4I6ZA 1FBQA 1MNEA 1NHAA 4A3FJ 1OCCH 1HKQA 1WRJA 1XMKA 1N78A 2NVUB 2MLKA 3MMYB 5E8IA 3OYCA 3QP5A 3TBIA 1SFOJ 3K4CA 2HOTA 3A01A 1IXRC 3BZ6A 3IWZA 2DG8A 2Z1DA 3A4CA 2QZ8A 1X3ZB 5D8LB 5K58A 2XGEA 1FJLA 2HQ5A 5J4YA 1UHWA 1SVOA 5F0CA 2HDDA 3F6OA 2WGBA 1B72B 1RNLA 5BPIA 5H20A 4N0BA 2XC7A 3HPGA 1FZPB 3CUOA 3CTAA 4C9YA 3KETA 1IV8A 2EA4A 2R93J 3VEPA 1LB2A 1UG0A 3ASOH 5L3EA 4CH7A 2Y69H 3R6SA 4QLCU 2X6OA 2OC6A 3O2PE 1J9IA 2YVHA 1XD7A 3S3MA 2HXOA 2LBFB 1CQTA 5B1AH 3L2UA 4AC6A 4L62A 3C07A 2X48A 3LMMA 4ON0A 1FT9A 3GFLA 2ZOYA 4RAZA 4NC8A 3CMEI 2F5EA 1OR7C 3L09A 2PEXA 3H9QA 3LNQA 1K79A 1T0FC 5IT9Z 1B4AA 1YI2I 5E17F 1FIAA 2OU2A 2KJBA 4II2A 4XSZF 2XHKA 2MABA 1RR8C 1X2MA 3K1MA 1DPUA 3BDDA 1D8KA 3CUQC 3WGGA 3OYKA 2OBPA 2R5ZA 2Z16A 1Y1WJ 1EJ9A 1AOYA 3DKWA 1C0WA 5EYRA 1R23A 3CQZJ 1X1BA 2WAQA 3RKYA 1JJ6C 2V9VA 4M71A 4B09A 1Z77A 5CVVA 2V57A 3PNVA 3VTIA 4IEJA 1FSHA 2EBIA 3HKZA 1ZRFA 3E6BA 2ZOZA 3FF5A 1FNNA 2UXNA 3GEZA 4CCLA 3M8EA 4C30A 2LYCA 1HQCA 2IGOA 5ERIA 2X85A 4F3QA 4CYCA 2B1EA 1LPQA 3WU1B 4MXMA 4QSHA 2HGCA 2DCEA 3OSGA 3DP7A 3QAHA 1ORKA 1FTTA 3MWMA 2GXGA 3M07A 4G6QA 4N9HA 4HLYA 3VWBA 2R7RA 3TO9A 1QGPA 1HSTA 2X1EA 2CGPA 2FSWA 4AIHA 4HBLA 2RGVA 3H5AA 4YELA 5J4VA 1TNSA 2UXXA 1PUEE 1RKTA 4MFEA 4P96A 2R5YA 3KEQA 2KIQA 5DM6F 3OYHA 2XAJA 4B1RA 1NG6A 5GP9A 1MGTA 2M30A 2LNBA 5DTDA 2DMTA 3MKLA 2FQ4A 2NNYA 1TWCJ 2JUGA 2QQAA 3CRJA 2E2HJ 2QM3A 4A6EA 3CLOA 1Z7UA 2JA7J 2VL8A 3E6DA 3SDGA 2RQQA 3M8JA 4M3EA 1LJ9A 3MKWB 3ONQA 4XLEA 1YG2A 3JREA 2PX9A 2EIMH 2JUCA 2NVYJ 1ON2A 1Z3YA 3LA2A 2HQRA 3L00A 1DUXC 3HUGB 2F2EA 4ZH4F 2VT3A 2DA7A 2EH3A 2MFZA 4EM2A 4AM3A 3IUVA 1YOVB 2IGMA 2QSHX 3ZPLA 4ZDLA 3E0JB 1BW6A 1JE8A 1QHHD 1LEAA 3KPHA 2OCCH 3SYTA 5D4SA 4BU2A 5ED4A 1S6LA 4E70A 2R0QC 1JJ8C 6PAXA 4I98B 2IA2A 4KITB 4BAYA 3K6GA 3U1KA 5TGTA 1TT0A 2EZKA 2CH0A 3RDIA 1G3YA 3BHQA 1HBXG 2BHZA 4L9TA 3K0LA 4DNCA 2EA2A 1UELB 2F5VA 2XDVA 4GRIA 4RB2C 3CJQB 2M9HA 3QP6A 3CP2A 4F55A 4RMNA 1P2FA 1XB4A 1J59A 2ZMEB 1KYWA 2V6EA 2HYTA 2EFPA 2EWNA 2OCEA 1SVLA 3AG3H 3LA3A 2MH9A 3M1CA 1E0EA 3ZQCA 3HE0A 1JUPA 2QSGX 2GOXB 2M45A 3A2KA 5HOOA 3BNIA 3H35A 2M7BA 2QTQA 3OYNA 2PFBA 4ZTFA 5JLXA 3MN2A 1JUSA 5HAWA 4XBFA 3OYFA 3ULQB 2YU3A 1IUFA 3I4MJ 4GYGA 4PCQA 4EJOA 3ISPA 1H9GA 3WTXC 3PNYA 2EIJH 3H1CA 2XVCA 5EZHA 5H9TA 4JL3A 2FMYA 5HS9A 3DU5A 3H3ZA 3LSMA 2FMLA 1Z67A 2DTRA 2O9LA 2XAHA 3U1DA 3N97A 5BPDA 3DPJA 2DDBA 3M3YJ 1R4NB 4XRFA 4MNUA 4BY7J 5HVQC 3K9TA 5E79C 2XSJC 4PJLA 5LFAA 3T5XA 1XSVA 2VLAA 1SVMA 3MZYA 3KYDB 1X4PA 4LJZF 3JRAA 3H5NA 2GFNA 1B9NA 4YG2F 1U78A 4KT6A 3U2RA 5IYDJ 2DT5A 1IN6A 3SFZA 4CDGA 3BJOA 4IOAF 2HI3A 4MQVA 3AKZA 1HDDC 3VP5A 1GV5A 4UVBA 2E36A 2W85A 3F8BA 3LFUA 2GOMA 4E7HA 4BHPA 1OLTA 2LC2A 5C4JJ 1IN5A 2QWWA 4LITA 3CCSI 3L2WA 3FMQA 5FLMJ 2M8EA 3FRQA 5IT9K 3K4BA 2M87A 2QEXI 3FXOA 1OCZH 3H36A 3CCYA 4RM3A 5H6QA 2ZXHA 3B6CA 5M3FJ 1I39A 4DQ2A 4BUPA 1MMDA 4Y13A 3VSLA 5IY5H 2VN2A 4ENMA 2W53A 3W2VA 2R5ZB 2D5VA 3TL4X 3GX4X 3QOPA 3KEOA 2X4HA 3ANPA 4BEHA 5DYMA 4CCOA 3JRIA 1ZGWA 2O0YA 1X1CA 2K3PA 2V1UA 4EJWA 3V7CA 5GAGJ 4ENNA 4RM2A 1EA3A 2FBIA 4NBQA 2BZTA 3GLLA 1BA5A 3V4GA 3LFKA 2HXIA 2KRHA 2VQCA 3P9IA 3KCCA 3H9JA 1W0UA 3VDXA 1L0OC 5D5XB 4CYCB 3U21A 3GF2A 1VQNI 1JUMA 2L3DA 1VQ7I 3HB9A 3BC8A 2CQ7A 2FJ1A 2W24A 1ETQA 3CDLA 2HDCA 1S29A 4FISA 4G6DA 1I1SA 2X6XA 3EPZA 3GTKJ 2X6WA 3OOUA 5F08A 1D0YA 4MK6A 3S2DJ 2PMUA 2XKPA 3NS4A 2QF7A 2QQBA 1ZELA 3LWJA 1J5YA 1UMQA 3IH2A 1DP7P 4U9NA 2R5YB 3PSIA 4PK4A 2JRMA 5FLXZ 1K61A 3S2HJ 2L9VA 2X6YA 1OCTC 2NVQJ 3BY6A 1LDKB 4MGRA 3OY9A 1JTYA 4MEYF 3KKCA 3DLLF 2X9DA 4U87A 3EYYA 1XDUA 4GFKA 5K1YA 3V8KA 5KVRA 3IKTA 1U5TA 1ZR4A 4LGWA 3VVZA 1Z21A 4I09A 3FXUA 2HR3A 1VFCA 3QYEA 4II3A 4Y3OA 3GFMA 1G59A 3IH3A 1VQ4I 4Y52J 1T6SA 3RPQA 3I56I 4IQJA 2BGCA 2O5RA 4DZJA 4MO7A 1XPXA 2KDOA 2XRNA 1BIAA 5GTIC 3VOKA 1D0XA 3S2WA 1T39A 2Z9OA 2CQKA 4ZDPA 2VE9A 4KA4A 4OIOF 4PJJA 4WF2A 2DDAA 2PZ9A 3NNRA 3U9GA 2R4GA 4O6JA 3TKYA 2BEOA 2ZB9A 1PP8F 3I71A 1BN5A 4CO8A 4YIIA 3TW7A 4ASNA 4Y17A 4HX4A 3Q5FA 4WXHA 3MKZA 4AYBN 1U9NA 3IWFA 1J09A 4MTDA 3I3LA 3ZMTA 2A69F 1Z91A 1WJBA 3K4NA 3W6JB 5GAEJ 3MZHA 3JSOA 4W1UA 2GIVA 1I1GA 2IVMA 1WJFA 2PLYA 2L7KA 2ISZA 4KN7X 1FP1D 1FLIA 2QQ9A 5FKOA 1K4TA 3KP3A 2LY9A 2RN7A 1JHHA 3HTJA 2FRHA 3AG4H 3EUAA 2M2EA 5HLHA 4L18B 2LF8A 1VI0A 4LMYA 4HNVA 1Z05A 2P6TA 3HIFA 4B43A 1SAUA 1T08B 2FA5A 3UR3C 2BVMA 2OF7A 3FKJA 1JKRC 4YEJA 5IOZA 3WHBA 1MMGA 1X4OA 3WTWC 1OJLA 2E5NA 2BY2A 4UY8I 1DP3A 2Z99A 4XMYA 1R4MB 3DFGA 4PJMA 3BCAA 5HLTA 4RB1A 1BI2A 2Y0SA 1VTNC 2VT2A 3HTIA 5F6FA 2WB1N 3S93A 3FDYA 4KICA 3TP3A 3L2QA 1ULYA 2ELHA 3LOCA 3O8HA 4BQAA 1KU2A 1ETOA 4JX6A 2W57A 1VQ9I 1FTZA 5LHHA 3WGIA 3KYLA 3ZMVA 3OS2A 3P9TA 4P1WA 2EINH 2XAUA 2F5FA 3E1SA 1SD7A 1A36A 1IRGA 5CVRA 4MTEA 2FOKA 1K83J 1FMWA 3AL0C 3RTRA 3F8MA 2VJIA 4A5NA 4IX7A 1PYVA 2RV8A 1XS9A 2V9KA 2ESHA 2FOWA 4L5IA 3K4KA 1ETXA 2A05A 2CW8A 5E1XA 2ZJPF 3RYPA 3CD6I 4ZYDA 3ECHA 1TBXA 4HX7A 1MNDA 4GFBA 2KP6A 4XKCA 4FETA 2VJ4A 1T98A 1AA7A 4F7ZA 1Y8QB 4DIQA 1MBJA 5EDNA 2EB7A 4BEHB 3VODA 1P7JA 2G7SA 2GZWA 1SFXA 1T2KA 4PGHA 2X0LA 2XPVA 2PJRA 4G6TB 3KZ9A 4HPQA 3PO3J 3OYMA 3BZKA 3RZOJ 1ZG3A 3NRVA 4HG2A 4IHVA 4ITVA 3COLA 3DPTA 5K7FA 1UFMA 2WY7Q 3ELKA 2IS4A 1G3TA 1ZK8A 2HKOA 2M8GX 2W48A 1XCVA 5LLQA 4HF1A 1OR7A 3GW2A 4RGXA 3WGHA 2DTZA 1T0FA 2R7QA 2XAQA 1TC3C 4JK1X 5BMZA 5TISC 3K8PC 3PJRA 2UXPA 5M5YJ 1OKRA 3CUQA 2ZNZA 3F1BA 2OJED 2ZY9A 2GENA 3E5UA 3FXQA 3PFIA 3I4PA 3G6EI 1V3FA 3RI4A 1OQYA 1R5ID 1MBGA 5CPRB 4AWXB 3ZQFA 4ZYEA 2E1NA 2LOOA 4V2GA 5CQEA 1HW2A 2PQ8A 2Q2EA 3K2AA 3LSHA 1VNDA 2OD5A 3AQSA 3K4MA 3Q0VA 1I3AA 4XLPF 1R49A 1GXPA 4IRGA 5FLXK 1I6XA 4YZEA 2IT0A 1HKTA 4A3EJ 2QA4I 3ABUA 3R0AA 1FYLA 5ICGA 2M7AA 1ZAOA 4N4NB 1KZHA 3GTPJ 2R7SA 2ZC2A 4Z2YA 1IGNA 4X1EA 3TOBA 3HIMA 3PL8A 1U5TB 2R7FA 3TDZC 3OYEA 1H89C 1S7AA 4BXXJ 2P5LC 2WV1A 2NRAC 3RSNA 1LFUP 2F5CA 2UUZA 3J7ZI 3ZMUA 3VIBA 4BACA 4CSWA 4WWCA 1V54H 2G9WA 1V4RA 2KRFA 3GTQJ 5JHUA 2JJ7A 4ZYHA 4XRMA 4C3IJ 2A6HF 2FBKA 4KIBA 1RPWA 1Z0XA 1SMYF 3DF8A 1BIBA 5L3DA 1STZA 2DK8A 4XR6A 4U7BA 5E18F 2VOOA 3G2BA 1LEBA 3WE2A 4XLAA 1A6QA 3MFKA 9ANTA 1Y8RB 4CUGA 1MH4A 2H6CA 4IVNA 1W5TA 3B02A 4Y33A 4F92B 2CG4A 2LMDA 4EM1A 5L3CA 3G7RA 3MAJA 4M3FA 3CF2A 2XB5A 2VQHA 1AWCA 1P4AA 3ZOBA 2CQXA 2O8XA 2WAFA 2L02A 4PJ0C 4CCMA 4B3AA 2XGDA 3VUQA 3FMSA 3ANGA 4P5OA 4U9LA 2BHYA 2AQEA 1JT0A 2P81A 2WTEA 3DQVC 1SEUA 4LG3A 3TO7A 4OD4A 1WGXA 4S05A 2LRDA 1B8IA 2E5ZA 4L0ZB 1Z3XA 3G1OA 5E3OA 1JKQC 5EFYA 4HSRA 5GAHJ 2YUSA 2CUJA 3OYAA 4BY1J 2Q0OA 1VF9A 2HVQA 4XN3A 5LEJA 3HTAA 1ZREA 2KFDA 2ZJQF 2K9SA 4E7SA 3KZYA 4ZJZA 3VVYA 1K6YA 3CCQI 4HX8A 4IO9F 2VC0A 4HSTA 3SEQA 4DW6A 1FIPA 3ZQHA 3KNWA 2DA5A 4LOCA 4E7ZA 1AKHA 1YITI 2FUG2 2MSYA 1TTYA 1FWZA 4UXNA 2IBDA 4WK8F 1IUYA 2JSPA 4ZZLA 5JHFA 4EM0B 3OV8A 4DJAA 1IN4A 1MW7A 5E1WA 5D5VB 3H92A 3R60A 1RI7A 1VZ0A 3OMYA 4J00A 1K78A 3F8NA 4XK4A 3P5JA 3D0SA 3T6NA 1TQMA 5E3MA 4RAYA 3CWRA 2JWTA 1BJZA 3JSJA 4XKBA 2D2WA 5DS9A 1ON1A 1LNWA 3SXYA 4IKFA 1QZEA 5LD2C 5M3MJ 1Y6IA 2NAZA 3EUHA 2DAOA 4JBAA 3WTTC 4OIPF 1YYVA 2UXHA 3NI7A 2CWEA 2R7ZJ 2HZTA 1QZZA 4BDZA 3NPIA 2EZHA 2LH9A 4BJ6C 4DBQA 3CCUI 2Q1ZB 5EEHA 4G7ZF 1F5TA 1ETKA 1HW5A 2HYFA 4ENKA 4EVIA 1RESA 3I4NJ 2QBYA 2IAIA 5F0FA 3LA7A 2V9PA 5E20A 3PIOF 2HQNA 4B3XA 3BJAA 5K7HA 5ILVA 1XCBA 3SQNA 2DI3A 3I64A 3K10A 3MQ0A 2W25A 2E7XA 2EV6A 1IRFA 3I55I 3M9AA 1NG7A 1WI9A 2F5DA 5J1RA 3DBLB 3QYFA 4IPAA 1BC7C 4MLOA 1Z7LA 2I8DA 2GXAA 4AUXA 3GTOJ 3FK6A 1KYZA 1Z6RA 2K9LA 3JCUC 3VYRB 1I6HJ 2XPWA 3RPUA 2XPUA 1WQ2A 2CU7A 1OCRH 2PJRB 1VQ8I 3HSFA 5HBUA 3IRQA 3J80Z 3A03A 3V7RA 2K9NA 4U0WA 4XL9A 2K02A 4A0YA 1W36C 2D45A 2REKA 4IJAA 5EF6A 2L0KA 4E4HA 1R00A 3G1LA 2DYRH 3LSRA 4HF2A 4RGSA 4IHYA 2MBFA 4V2FA 4ZDOA 3R4KA 4XIDA 4BS9A 1O3QA 1R1VA 4FTHA 2YPRA 2K3FA 3IAM2 4LLLA 3S1NJ 3WG7H 3GTGJ 4NQWA 5DV5A 2R7XA 1M1EB 1BL0A 1TQPA 2M4KA 3HG9A 1YJ9I 3ZMDA 1W4MA 3HJEA 2DYSH 2I10A 3E97A 2ZBKA 3DPLC 1WH5A 1LVKA 2WAQN 4M3GA 1A31A 1XC5A 3W6VA 3VVXA 4MIMA 1F36A 1T56A 4D1QA 2VC1A 1YJWI 3HKZN 1EV7A 1A35A 5LGNA 4UB6C 3DLAA 4NELA 2V79A 1BOBA 4HAMA 4E7IA 5ILSA 4Y7NJ 4GXOA 2ZJ2A 2LVSA 3JRFA 2KIMA 1ZLKA 4RGUA 3BZCA 3DPUA 4I99C 2WAEA 3FXKA 2VJJA 4FE7A 4B4CA 1UCRA 3S5RA 5J3LA 1R1UA 1BC8C 3J81Z 4M73A 3I5UA 4M3DA 2KZVA 2NS7A 1GV2A 4IRVA 2R7UA 1WVRA 3HBLA 2L4AA 2VBZA 2HPIA 2TCTA 2NS0A 1LVAA 1V5FA 2PBIA 2MC3A 1U8RA 4CCJA 3ASNH 3C3WA 3HOXJ 2IEKA 4I01A 1BI0A 3ZN0A 1K4SA 3FM5A 3VOEA 3MD2A 3Q0WA 3MEXA 4J19A 5BQTA 3FZVA 4KMUX 3OS0A 1ENHA 5B1BH 4KUMA 3ERMA 2EZIA 3PM1A 4BHBA 1IXCA 2JMWA 2DJNA 2HFHA 3E5QA 1Q1HA 2JPCA 1PUFA 3QQAA 3E5XA 3NWTA 3EYIA 5J6XA 1B8IB 4ETSA 2DA6A 5KK1A 2Y2ZA 2VQLA 4XLFA 1PVEA 4DYCA 3WG9A 1ZG1A 2A2FX 2XAFA 2JRTA 3KFWX 1QBJA 4BYYA 5D6EA 1O4XA 3DTKA 4BHCA 3NAUA 3KLOA 4BE0A 3L1PA 2FQ3A 3HGYA 5CXGA 5HLIA 2JZYA 2JK3A 2L9RA 4KWAA 1P4XA 2GA1A 3BT9A 2BW3B 2G3BA 1J2XA 4F91B 3ERED 2V7FA 5AQCA 3H3UA 3JTGA 1JKPC 4I76A 1AKHB 3OIOA 1RC9A 2IS6A 2NP3A 2EILH 3C18A 5LRRA 4P9FA 2NOGA 2WADA 4UV8A 4A3MJ 5CJ9A 3A01B 2IS2A 2PG4A 1JGGA 1MJ9A 3ZQIA 3A02A 1ZGAA 2DG7A 2DOFA 3V7SA 2QWTA 1ETWA 2WWYA 2LLKA 2QGUA 2QLZA 2LDUA 1KQ8A 3N05A 1BR2A 3GTMJ 4IQ4A 5JFRA 3QWLA 5KHDA 4HZFA 3VW1A 4UVAA 2VBWA 4C3HJ 5BNGA 2DK5A 4A3IJ 2ECBA 3QU6A 5J47A 1TL8A 5F27A 4U88A 5CKTA 4AVPA 5D19A 3HOUJ 5CVJA 2QBYB 5AIPA 1IAWA 1V5EA 2DMNA 1WJDA 2E2JJ 1UI5A 2RNGA 3NARA 2OA4A 3F21A 2JVHA 4NC6A 4KIFA 2IA0A 2CV1A 2L01A 1X3WB 2L5QA 3UKGA 2H8RA 4LD5A 1MJAA 2A61A 3B81A 3RJPA 1IN7A 3ZXSA 1HKSA 1OFCX 2E1MB 2YVXA 4S04A 3VPRA 3GZIA 2F4OB 2VIXA 2RKHA 2IA1A 2CRGA 2J5PA 1T33A 2DFEA 5F64A 2BV6A 3J80K 2D1HA 2HKXA 4QPOA 3BJBA 2B0LA 4XKWA 1E3OC 2DBBA 1U3EM 1REPC 3RKXA 4QWQA 4DYQA 2K4JA 2RNJA 3CMMA 2UXUA 1X19A 3EUPA 2K85A 3E6MA 1R58A 4UB8C 2M5WA 5FB2A 3CC7I 2NX4A 1I50J 2XSDC 3LQQA 2CFXA 3BG7A 3BJ6A 2GXBA 4B8XA 1TW2A 4A3DJ 3K70C 1SAXA 5DD4A 3SZPA 4NQWB 1KA8A 1IG7A 2IGNA 4TV7A 3CDHA 3KP5A 1D3YA 2A68F 1IZ1A 4BGDA 1S5LC 5LHGA 3A0HC 2X1DA 3HTUA 4M6XA 4XN0A 1IW7F 2H8WA 2E1OA 3Q3SA 4OIQF 5KNLA 1H8AC 4YFXF 1KU7A 1YW9A 2L9SA 2VJ5A 3ZRGA 5D4RA 1WI3A 1G3WA 3TP0A 2WC2A 2EJRA 4D5FA 1ZRDA 2V6CA 3BCGA 3BCBA 5BOXA 5DD8A 5LRSA 1O3RA 1ZKGA 3OIPA 2Z5UA 4DYRA 2JPBA 2IPQX 1YIOA 3WTSC 3O3KA 5K5QA 3T0YA 2HNHA 3GUDA 4CYDA 5ICFA 3OYJA 3S3NA 2UV1A 2BVLA 1FYKA 3KIOA 4KIGA 3CCLI 5IOYA 4WIBA 3FBIB 4MFDA 3BOQA 2ME6A 1SD4A 1MDMA 3CO7C 2N8GA 4EJVA 4FCYA 4YFNF 3ABTA 3CO6C 3J81K 3QYBA 4L5EA 3EDPA 3I53A 3AAFA 4D0PA 1BM9A 1R36A 2K27A 2DA1A 5FMPA 1GHCA 1F4KA 3W2AA 4CZZA 3WTVC 5FRMA 1TWFJ 3PQJA 5J40A 1D5VA 3EETA 3BR1A 2DN0A 2KISA 2XF7A 4IOCF 1B1BA 3OYBA 4CGZA 1TNTA 2ZO4A 1CF7A 4GDFA 1FOWA 2R92J 3RKWA 2A5YB 5DDGA 1XMXA 2W84A 2NXNB 1RUNA 2GM4A 2V1NA 3MZ8A 3G4SI 3LSGA 1ZRCA 3CC4I 2HKUA 3I0TA 4L9NA 3JRDA 4M3BA 1NK2P 4IHXA 3CZ6A 4LK1F 1FYMA 1JT6A 2ICWG 2D6YA 3TDUC 4A3GJ 2K5CA 1EH6A 1QU3A 3OYLA 3F9KA 3FXRA 5IPAA 2CUFA 2ZCMA 3CMYA 3LJLA 2OZ6A 3WU0A 2O6GE 1YHQI 1O3SA 1ODDA 1VQOI 4JX5A 1N25A 2Y9YA 3J7YJ 1YTYA 1D8JA 5D8KB 4MHGA 3RQIA 2HVRA 2LK2A 1PJRA 2P6SA 4NUBA 5JI6A 4CCKA 2O7TA 2Q8KA 3BPXA 3F72A 3R0JA 4XICA 2VPLA 1FPQA 2Q24A 2ELKA 2RVCA 4L0YB 2XB0X 3O6BB 1BOAA 2DA3A 5C4XJ 4IRHA 2ZCNA 1WPKA 1YX5A 2B7EA 2DFFA 1LDDA 4IL6C 4BNCA 3OYGA 1KU9A 3DEWA 2NS8A 5IYBJ 5BS6A 2STWA 3GXOA 1Y0NA 1YRNA 5TJJA 4Q47A 2H09A 5FGLA 4HEA2 2CQNA 1U6GA 2CW7A 2EFWA 4DVYP 3ROUA 4KNYA 2DFHA 2AS5F 1S3JA 5KAFC 4OMZA 3BR2A 2H94A 1SFEA 1FX7A 2A6EF 1X3UA 4FX0A 1R9TJ 4CXFA 4M9XA 1R1TA 2QYOA 1GUUA 5LGUA 4CHUA 5B5EC 3NWSA 3DTIA 3EQLF 3WE3A 3G73A 1GVDA 4LG0A 1W36D 2KZGA 4OIRF 1G2HA 3AQTA 4UUSA 3N4MA 1HLVA 2VBYA 3ZQ7A 2ZFWA 4BKXA 5CYVA 5HSZA 4ANJA 3VW2A 1P6RA 2F6CA 2FU4A 1ZHFA 4FT8A 3LSPA 1IC8A 1DPRA 5B66C 5IT3A 2DT7B 2MGQA 2QENA 2J5OA 1XSXA 3S17J 3HSRA 3PPBA 1SD6A 2HQAA 1E2XA 4GFLA 1QVTA 3ECOA 4I0BA 1SANA 3WODF 4RS8A 3QOEA 4EATA 3HOYJ 4G7OF 1MBEA 2LY1A 1B9MA 2LF7A 3SJMA 3PASA 3CLQA 2Y0SN 1F9NA 3ABLH 2JA2A 2KKOA 3FX3A 3ZCOA 4KYWA 3IP4B 1P9QC 2KIUA 5LEKA 2GWRA 1POGA 5CVUA 1MJBA 2DPDA 4NC7A 4YIFA 5EGOA 1E3HA 2VONA 2K4BA 2P7VB 4XQFA 3QBMA 3SDBA 2VOPA 1YFHA 1HSJA 3ZGKA 3V78A 2JA6J 2TDXA 3LQRA 3WU2C 2V1XA 3DEEA 3C2BA 1V5GA 3DCFA 4M6VA 3G71I 2CUZA 2L4MA 2MD0A 2HDWA 2FF4A 3KEYA 3GEUA 3SWHA 3P9CA 1OPCA 2PJPA 4R1HA 1FBSA 2KT0A 4S0HB 2DXIA 5CXIA 3V8LA 2K7LA 5C3EJ 3LSTA 2CV0A 2L9NA 2DMQA 1X1AA 2ZCXA 5FD6A 3Q0UA 5D6FA 2NYXA 2F07A 2K86A 1LE8A 2EPFA 3OWTA 2DPUA 1P92A 4KMFA 3MNLA 4B47A 1G6NA 2KPMA 2MG4A 1FOYA 3JW4A 3S8PA 4JKZA 2QVOA 4A69C 3WHCA 3CJDA 2IRFG 1QHGA 5EG0A 4C2TA 4EV0A 3C7JA 3MVPA 4OINF 3FXMA 1VQKI 2P7CB 4EEFG 2X1CA 4I2OA 2CYYA 1Q1VA 1OCOH 5AIQA 4KFCA 4BE2A 2YVEA 2HTJA 3FISA 5A2QZ 1MDMB 3DBRB 5J1YA 2ZCWA 3H5RA 4IZZA 3SHFA 4RB3C 1FOXA 3WTUC 4KN4X 3F22A 1MKMA 2HU9A 2LTPA 1BI3A 2ZSIB 4QTRA 2VODA 1UI6A 4PXIA 4XM3A 2OI8A 1TWHJ 3FIWA 3HRSA 3F23A 1S72I 1MSEC 4B44A 1KQ9A 4LB6B 3CESA 2FEZA 1PDNC 1BW5A 2F48A 1D0ZA 2Y0MA 3AFHA 3H0DA 2QIBA 1RETA 1T8IA 1QNTA 1QVUA 1XGSA 3KX2A 2QKLB 4E7JA 3SEZA 4MEXF 1CF7B 1MMNA 4O5VA 4B48A 1U5TC 2ESNA 2VXDA 2DODA 5D5UB 1T38A 3IV5A 5GPAA 2YU9J 2AO9A 1GDTA 3ZR8X 5LGTA 4A3KJ 1MMSA 1LDJA 2DA2A 4I02A 3LSIA 1DGRM 2CSOA 4HV5A 2NP5A 3PUBA 4FQGA 4L9VA 4IHTA 2PMZA 5DM7F 5GPCA 2JA5J 4R79A 3R61A 2FBQA 2FJI1 4AIJA 3PSFA 3M8FA 4JNNA 2XF5A 3I58A 2Y31A 1EH8A 5HNHA 1UG2A 2WY8Q 1YQAA 1DU0A 4D7NA 4A2UA 3L7WA 4HQEA 1FBUA 2VE8A 4RA2A 3HRMA 2COMA 1S7EA 1R22A 4FE4A 2G7UA 2LKSA 1Z1DA 3JRHA 1QA6A 4HV6A 3L9FA 4C2UA 2R7VA 2P0WA 1XGNA 3BTIA 5HDGA 3HGGA 1YIJI 2DFIA 2M4GA 2Y48A 4YFKF 4ZYGA 3F8FA 3Q9VA 4FHTA 1ZG5A 2R7WA 3LL7A 1YRNB 3PO2J 4GCTA 5F1RA 3CCRI 5E8GA 5DCMA 3M7GA 4AIDA 3IAS2 5L3BA 3S3OA 2DT6A 1YLFA 2GBYA 4G8XA 2V26A 4ZTJA 3B73A 4D7MA 3BLYA 2VB6A 4EGZA 3QRFF 3BTJA 4A0XA 3Q9SA 2Y75A 3FKIJ 5LHIA 1FY7A 2EZLA 2UWMA 2GIZA 1I3QJ 4L9JA 5IYCJ 5F04A 2XGCA 5J1UA 3FHZA 1ZLJA 3KE2A 4RDUA 4UUSB 4KT5C 3HPHA 1TWGJ 2ZSHB 2FXAA 3BQYA 3DBHB 4EQQA 1IV6A 1QQIA 1GXQA 1XGMA 2M34A 5CQGA 3GZNB 4KISA 3QODA 1TT5B 2NVXJ 3BPVA 4CCNA 3K70D 1W7PD 2R7OA 2W4SA 1SMTA 2Z2SB 1IDYA 3TMOA 3E7QA 2JSCA 2IU5A 1GLNA 3BR3A 2ZXWH 1FC3A 3K4LA 2BXYA 2XASA 1D1CA 2AXTC 2IW5A 3FXJA 3VYUB 4F52A 3ABKH 5EGOB 1R5GA 1J0RA 3S32A 1PP7U 1VQMI 1N75A 4IXAA 4DOZA 2H1KA 3PQKA 2XF6A 1SFUA 2HPMA 1MBKA 2E71A 3RKQA 4PSWA 3KYCB 1WJCA 3F8CA 4ENJA 2AXLA 2I5UA 1H88C 2IP2A 2MH2A 2KJCA 5AONA 2OZUA 5JLWA 4M6YA 2PI0A 1MMAA 2OERA 1ZYRF 4PZJA 4A0ZA 2LSOA 2TRTA 2ZKZA 1B6AA 1O3TA 4JQFA 3HOTA 1YS7A 2BOLA 1LE8B 3ON2A 1BJAA 2ISYA 1ZQ3P 1MSFC 3JRGA 1XGOA 3DU6A 1A04A 4XRSG 1X1DA 3C2GA 2G0EA 4UUVA 1EF4A 3H9GA 5FFXA 3CUQB 3AG2H 5EG0B 5J8CA 1IJWC 2EV5A 1HA8A 1F1ZA 2XKOA 2WA0A 3LAJA 3TO6A 3RZDJ 2Y9ZA 1WWXA 2BBYA 2ID3A 3BTCA 2Q2EB 2HYGD 5A2QK 1LFBA 1AHDP 4HW0A 2IXSA 1W7PA 2DQRA 1K6OA 4AIKA 4ZC3A 1HW1A 4IHWA 4M9SA 5L3FA 4GYIA 3S16J 2G7GA 4BJTA 1MBHA 2GAUA 1XX5A 3K69A 1QPIA 2OTLI 3NRGA 1WSUA 2BYVE 1ZR2A 1DDNA 4LIVA 2YS9A 5CLSA 5C44J 4N4OB 5FHPA 5D5WB 1JTXA 3BTLA 2AHQA 5FO5A 4PSXA 1Z6TA
chains in the Genus database with same CATH topology
2CJJA 5E3NA 2NX4A 1GT0C 1I50J 2XSDC 1IDZA 1QRYA 1WCMJ 1U9OA 3HTIA 2WB1N 3RH2A 3TP3A 4A3DJ 4A3BJ 3LOCA 3O8HA 1W0TA 1IG7A 1ETOA 4JX6A 1APLC 1FTZA 3BRUA 3P9TA 1X58A 3E7LA 1FEXA 2E1OA 3Q3SA 1A5JA 2VUMJ 5E3LA 1H8AC 1K83J 4JP0A 4HKUA 1WI3A 1XS9A 3TP0A 1ZTRA 2DMPA 3ON4A 1TWAJ 2XRLA 4D5FA 3D1NI 1ETXA 3HOVJ 3BG9A 1HOMA 3BCGA 4NN1A 1X2NA 2GUHA 2RHAA 5FKLA 3RD3A 1JKOC 1ZKGA 3HOZJ 4DYRA 4GFBA 3BR6A 3QPSA 3LSJA 3FK7A 5FKNA 5IOYA 3BG3A 3QPLA 4MFDA 3JRBA 2ME6A 4I6ZA 2FX0A 2N8GA 4A3FJ 4FCYA 1MBJA 4L5EA 5EDNA 2O8KA 1P7JA 3K7AJ 1SFOJ 2HOTA 3A01A 1OCPA 2XPVA 4BBRJ 2DG8A 5FLVA 2DA1A 3KZ9A 5FMPA 3PO3J 3RZOJ 2XGEA 5K58A 1NTCA 1TWFJ 1FJLA 1NK3P 3HOWJ 4GCKA 4IHVA 2HQ5A 3HEFA 3COLA 5K7FA 5F0CA 2HDDA 2WUIA 2WGBA 3BR1A 1ZK8A 2DN0A 2M0CA 2M8GX 1B72B 2W48A 2UXIA 2DTZA 2R92J 1TC3C 4ME9A 2PBXA 2R93J 2GM4A 2UXPA 5M5YJ 3LSGA 2HKUA 3F1BA 3JRDA 5DAJA 2GENA 2X6OA 4M3BA 1NK2P 1WH7A 4IHXA 2YVHA 1JT6A 1MBGA 2HXOA 2D6YA 3ZQFA 2O7OA 4V2GA 1CQTA 3JR9A 4AC6A 4L62A 2UXOA 1ETVA 3K2AA 4A3GJ 3C07A 1VNDA 3AQSA 2X48A 1RKWA 3Q0VA 5IPAA 4YZEA 3VOXA 2CUFA 4A3EJ 2ZCMA 3CMYA 3LJLA 2ZOYA 4JX5A 2Y9YA 3LNQA 3GTPJ 1FIAA 3RQIA 3H3VK 2LK2A 2O7TA 1X2MA 2JN6A 4X1EA 2DMUA 1IGNA 3HIMA 3VVXA 4XICA 3BR5A 5K7ZA 2B63J 2R5ZA 1Y1WJ 2Q24A 2ELKA 5EYRA 1H89C 3CQZJ 4BXXJ 2XB0X 1JJ6C 2ME0A 2WV1A 2DA3A 5C4XJ 1LFUP 2ZCNA 1WPKA 1Z77A 3VIBA 2V57A 4IEJA 3DEWA 3GTQJ 2EBIA 5M5WJ 2JJ7A 2NS8A 5IYBJ 4D5CA 4XRMA 4RBOA 2ZOZA 1YRNA 4C3IJ 5FGLA 2OPTA 1RPWA 1Z0XA 3BR2A 2LKXA 4CYCA 2E2IJ 1R9TJ 1F43A 9ANTA 4MXMA 1GUUA 4QSHA 1MH4A 5IP9J 3OSGA 1GVDA 1ORKA 1G2HA 3AQTA 1FTTA 3G7RA 2EQRA 4UUSA 1HLVA 4M3FA 2XB5A 3ZOBA 4BKXA 2CQXA 3VUQA 5HSZA 4UUTA 4B3AA 2XGDA 3VW2A 1IC8A 3ANGA 3LSPA 1JT0A 2P81A 2MGQA 3S1QJ 3S17J 3PPBA 1D5YA 1WGXA 1RKTA 2VPRA 4MFEA 1B8IA 3HDDA 4GFLA 1QVTA 2R5YA 3G1OA 5E3OA 1JKQC 1SANA 2LD5A 3HOYJ 5EFYA 4B1RA 5GP9A 1MBEA 2GLOA 2YUSA 2DMTA 5DTDA 3MKLA 3SJMA 4BY1J 3PASA 2FQ4A 1MH3A 1VF9A 2Y0SN 1TWCJ 3HTAA 3CRJA 3TW6A 2E2HJ 2K9SA 3VVYA 4A3LJ 1MNMC 1POGA 3S15J 2JA7J 2JA8J 5EGOA 3SDGA 4ABZA 4DW6A 1FIPA 4M3EA 3ZQHA 3QBMA 3QKXA 4QIWN 3V78A 3KNWA 4AC0A 2DA5A 2JA6J 4LOCA 3JREA 3G1MA 2NVYJ 1AKHA 1P7IA 1ITYA 2LFBA 3C2BA 2MSYA 3DCFA 4M6VA 2IBDA 2CUEA 4DZPA 1A6IA 2DA7A 3GEUA 2EH3A 3IUVA 4XK4A 4S0HB 2KT0A 2COBA 5EEAA 3T6NA 4BBSJ 5CXIA 1BW6A 5E3MA 3CWRA 2JWTA 1BJZA 3JSJA 5C3EJ 4C3JJ 5DS9A 2DMQA 2ZCXA 2R0QC 1JJ8C 3Q0UA 2RASA 2F07A 5M3MJ 2EZKA 3NI7A 1LE8A 2UXHA 3BHQA 2R7ZJ 3MNLA 3NPIA 2MG4A 2EZHA 1ETKA 4JKZA 1RESA 3I4NJ 2M9HA 4A69C 3WHCA 3CJDA 2QCOA 2FD5A 2IAIA 5F0FA 5EG0A 3MVPA 5K7HA 2HYTA 3HE0A 4EEFG 3ZQCA 1JUPA 4XRSA 3GBGA 1Q1VA 3G56A 1PUFB 2ID6A 3BNIA 2QTQA 2YVEA 4X6AJ 5J1RA 2L7ZA 3FISA 5JLXA 3MN2A 4MLOA 1JUSA 5J1YA 5HAWA 5HODA 4AUXA 3GTOJ 2LR8A 3FK6A 1I6HJ 2XPWA 2VI6A 1IUFA 1RR7A 2XPUA 3I4MJ 2VKEA 3O8GA 2CU7A 2LTPA 4QTRA 1UI6A 5HBUA 4PXIA 3A03A 2K9NA 2OI8A 1TWHJ 3FIWA 1MSEC 2RAEA 5C4YA 2REKA 5EF6A 2L0KA 3GTJJ 3G1LA 2QIBA 2L7FP 3LSRA 5EZHA 1BW5A 2QOPA 4UDSA 5H9TA 4JL3A 1RETA 1U8BA 1QVUA 4V2FA 4IHYA 2O9LA 3HTHA 4XIDA 3DPJA 3EUPA 4FTHA 3M3YJ 2HYJA 4BY7J 3S1NJ 4C2MJ 5D1RA 3IV5A 2LP0A 5GPAA 3GTGJ 2YU9J 3JRAA 1ETYA 2AO9A 1GDTA 1BL0A 2GFNA 4A3KJ 2DA2A 1U78A 2VKVA 5IYDJ 2K40A 2I10A 2NP5A 2KDZA 5F1JA 1WH5A 2WAQN 4M3GA 3W6VA 1XC5A 1MBFA 2HI3A 3JRCA 1HCRA 5GPCA 2JA5J 2HOAA 1F36A 4MIMA 1T56A 1GV5A 1HDDC 2FBQA 3VP5A 4JNNA 3HKZN 5C4JJ 2Y31A 1UG2A 4NDLA 1DU0A 5FLMJ 4NELA 4D7NA 3FRQA 4W97A 2ECCA 3CCYA 3B6CA 5M3FJ 4Y7NJ 1S7EA 4FE4A 2LVSA 3JRFA 3JRHA 2W53A 3V6GA 2R5ZB 2D5VA 3OSFA 4FE7A 1AU7A 4B4CA 3S5RA 5J3LA 3ANPA 3BTIA 3HGGA 4ICHA 3JRIA 1ZGWA 5IP7J 3BG5A 4M3DA 2NS7A 1GV2A 1YRNB 3M4OJ 3PO2J 2K9QA 4GCTA 3HBLA 1BA5A 2TCTA 3GTLJ 5FJ8J 2HXIA 2GBYA 1B72A 4D7MA 1W0UA 3BTJA 4G12A 4CYCB 1HF0A 1JUMA 3HOXJ 5D18A 2IEKA 3FKIJ 3HB9A 2EZLA 1I3QJ 5IYCJ 4J19A 2FJ1A 3Q0WA 5F04A 1ETQA 2XGCA 3CDLA 5J1UA 5IP6A 4FISA 4RDUA 4UUSB 3GTKJ 1TWGJ 3OOUA 2HOSA 5F08A 1ENHA 4MK6A 1XG1A 3S2DJ 3BQYA 2EZIA 3PM1A 1IV6A 2JMWA 2DJNA 2M34A 2QF7A 3IH4A 2XDNA 3LWJA 1PUFA 3QQAA 4GCLA 2MW8A 1UMQA 3IH2A 2NVXJ 3BQZA 1B8IB 5CW8A 2DA6A 2R5YB 1K61A 3S2HJ 2Y2ZA 3S1MJ 4A93J 4JX4A 3ZQGA 2Y30A 4DYCA 1OCTC 1IDYA 2NVQJ 1JTYA 3E7QA 3KKCA 1DU6A 2IU5A 1Y1VJ 2X9DA 1O4XA 3BR3A 3NAUA 5F0HA 4GFKA 3L1PA 5EGOB 3HGYA 4A3JJ 2G7SA 5CXGA 5FKMA 4CGRA 4KWAA 2JK3A 2L9RA 1ZR4A 3BT9A 2H1KA 3VVZA 2G3BA 1VFCA 5AQCA 4Y52J 3IH3A 4I76A 1MBKA 3OIOA 1JKPC 1AKHB 3RKQA 3S1RJ 2NP3A 2DA4A 1SGMA 4DZJA 1H88C 4MO7A 2NOGA 1IRZA 3SFIA 5JLWA 4A3MJ 2OERA 3VOKA 3A01B 3NXCA 2E19A 1JGGA 3ZQIA 3LHQA 3VW0A 3A02A 2DG7A 2PZ9A 2TRTA 2NVTJ 2QWTA 1ETWA 2LLKA 3NNRA 1HDPA 3B6AA 2QKOA 3GTMJ 1LE8B 2ZB9A 3ON2A 1ZQ3P 1MSFC 3VW1A 3TW7A 3F0CA 4C3HJ 3ZQLA 5BNGA 4A3IJ 2CQQA 2ECBA 3JRGA 4XRSG 1EF4A 3O60A 2G0EA 5F27A 5D19A 4AYBN 1U9NA 3HOUJ 2G7LA 2DMNA 5EG0B 3KKDA 1IJWC 2E2JJ 1UI5A 3NARA 4W1UA 3H0GJ 3RZDJ 2Y9ZA 3EGQA 5EZGA 4A3CJ 2ID3A 3BTCA 3UKGA 1LFBA 1AHDP 3HM5A 2H8RA 3BR0A 3B81A 5FKOA 4IHWA 2LY9A 1OFCX 5FKKA 3HTJA 2M2EA 3S16J 3S14J 3VPRA 2G7GA 3GZIA 4ACIA 1MBHA 1UHSA 1VI0A 4HNVA 2CRGA 1T33A 1QPIA 4AF5A 3NRGA 3TEDA 1ZR2A 5C44J 2YS9A 3BJBA 5FHPA 1E3OC 2OF7A 1JTXA 3BTLA 2L7MP 5IOZA 3WHBA 1JKRC 4DYQA 2AHQA 5M5XJ 2UXUA 1OJLA 4JYKA 2PMZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJJ A;  5E3N A;  2NX4 A;  1GT0 C;  1I50 J;  2XSD C;  1IDZ A;  1QRY A;  1WCM J;  1U9O A;  3HTI A;  2WB1 N;  3RH2 A;  3TP3 A;  4A3D J;  4A3B J;  3LOC A;  3O8H A;  1W0T A;  1IG7 A;  1ETO A;  4JX6 A;  1APL C;  1FTZ A;  3BRU A;  3P9T A;  1X58 A;  3E7L A;  1FEX A;  2E1O A;  3Q3S A;  1A5J A;  2VUM J;  5E3L A;  1H8A C;  1K83 J;  4JP0 A;  4HKU A;  1WI3 A;  1XS9 A;  3TP0 A;  1ZTR A;  2DMP A;  3ON4 A;  1TWA J;  2XRL A;  4D5F A;  3D1N I;  1ETX A;  3HOV J;  3BG9 A;  1HOM A;  3BCG A;  4NN1 A;  1X2N A;  2GUH A;  2RHA A;  5FKL A;  3RD3 A;  1JKO C;  1ZKG A;  3HOZ J;  4DYR A;  4GFB A;  3BR6 A;  3QPS A;  3LSJ A;  3FK7 A;  5FKN A;  5IOY A;  3BG3 A;  3QPL A;  4MFD A;  3JRB A;  2ME6 A;  4I6Z A;  2FX0 A;  2N8G A;  4A3F J;  4FCY A;  1MBJ A;  4L5E A;  5EDN A;  2O8K A;  1P7J A;  3K7A J;  1SFO J;  2HOT A;  3A01 A;  1OCP A;  2XPV A;  4BBR J;  2DG8 A;  5FLV A;  2DA1 A;  3KZ9 A;  5FMP A;  3PO3 J;  3RZO J;  2XGE A;  5K58 A;  1NTC A;  1TWF J;  1FJL A;  1NK3 P;  3HOW J;  4GCK A;  4IHV A;  2HQ5 A;  3HEF A;  3COL A;  5K7F A;  5F0C A;  2HDD A;  2WUI A;  2WGB A;  3BR1 A;  1ZK8 A;  2DN0 A;  2M0C A;  2M8G X;  1B72 B;  2W48 A;  2UXI A;  2DTZ A;  2R92 J;  1TC3 C;  4ME9 A;  2PBX A;  2R93 J;  2GM4 A;  2UXP A;  5M5Y J;  3LSG A;  2HKU A;  3F1B A;  3JRD A;  5DAJ A;  2GEN A;  2X6O A;  4M3B A;  1NK2 P;  1WH7 A;  4IHX A;  2YVH A;  1JT6 A;  1MBG A;  2HXO A;  2D6Y A;  3ZQF A;  2O7O A;  4V2G A;  1CQT A;  3JR9 A;  4AC6 A;  4L62 A;  2UXO A;  1ETV A;  3K2A A;  4A3G J;  3C07 A;  1VND A;  3AQS A;  2X48 A;  1RKW A;  3Q0V A;  5IPA A;  4YZE A;  3VOX A;  2CUF A;  4A3E J;  2ZCM A;  3CMY A;  3LJL A;  2ZOY A;  4JX5 A;  2Y9Y A;  3LNQ A;  3GTP J;  1FIA A;  3RQI A;  3H3V K;  2LK2 A;  2O7T A;  1X2M A;  2JN6 A;  4X1E A;  2DMU A;  1IGN A;  3HIM A;  3VVX A;  4XIC A;  3BR5 A;  5K7Z A;  2B63 J;  2R5Z A;  1Y1W J;  2Q24 A;  2ELK A;  5EYR A;  1H89 C;  3CQZ J;  4BXX J;  2XB0 X;  1JJ6 C;  2ME0 A;  2WV1 A;  2DA3 A;  5C4X J;  1LFU P;  2ZCN A;  1WPK A;  1Z77 A;  3VIB A;  2V57 A;  4IEJ A;  3DEW A;  3GTQ J;  2EBI A;  5M5W J;  2JJ7 A;  2NS8 A;  5IYB J;  4D5C A;  4XRM A;  4RBO A;  2ZOZ A;  1YRN A;  4C3I J;  5FGL A;  2OPT A;  1RPW A;  1Z0X A;  3BR2 A;  2LKX A;  4CYC A;  2E2I J;  1R9T J;  1F43 A;  9ANT A;  4MXM A;  1GUU A;  4QSH A;  1MH4 A;  5IP9 J;  3OSG A;  1GVD A;  1ORK A;  1G2H A;  3AQT A;  1FTT A;  3G7R A;  2EQR A;  4UUS A;  1HLV A;  4M3F A;  2XB5 A;  3ZOB A;  4BKX A;  2CQX A;  3VUQ A;  5HSZ A;  4UUT A;  4B3A A;  2XGD A;  3VW2 A;  1IC8 A;  3ANG A;  3LSP A;  1JT0 A;  2P81 A;  2MGQ A;  3S1Q J;  3S17 J;  3PPB A;  1D5Y A;  1WGX A;  1RKT A;  2VPR A;  4MFE A;  1B8I A;  3HDD A;  4GFL A;  1QVT A;  2R5Y A;  3G1O A;  5E3O A;  1JKQ C;  1SAN A;  2LD5 A;  3HOY J;  5EFY A;  4B1R A;  5GP9 A;  1MBE A;  2GLO A;  2YUS A;  2DMT A;  5DTD A;  3MKL A;  3SJM A;  4BY1 J;  3PAS A;  2FQ4 A;  1MH3 A;  1VF9 A;  2Y0S N;  1TWC J;  3HTA A;  3CRJ A;  3TW6 A;  2E2H J;  2K9S A;  3VVY A;  4A3L J;  1MNM C;  1POG A;  3S15 J;  2JA7 J;  2JA8 J;  5EGO A;  3SDG A;  4ABZ A;  4DW6 A;  1FIP A;  4M3E A;  3ZQH A;  3QBM A;  3QKX A;  4QIW N;  3V78 A;  3KNW A;  4AC0 A;  2DA5 A;  2JA6 J;  4LOC A;  3JRE A;  3G1M A;  2NVY J;  1AKH A;  1P7I A;  1ITY A;  2LFB A;  3C2B A;  2MSY A;  3DCF A;  4M6V A;  2IBD A;  2CUE A;  4DZP A;  1A6I A;  2DA7 A;  3GEU A;  2EH3 A;  3IUV A;  4XK4 A;  4S0H B;  2KT0 A;  2COB A;  5EEA A;  3T6N A;  4BBS J;  5CXI A;  1BW6 A;  5E3M A;  3CWR A;  2JWT A;  1BJZ A;  3JSJ A;  5C3E J;  4C3J J;  5DS9 A;  2DMQ A;  2ZCX A;  2R0Q C;  1JJ8 C;  3Q0U A;  2RAS A;  2F07 A;  5M3M J;  2EZK A;  3NI7 A;  1LE8 A;  2UXH A;  3BHQ A;  2R7Z J;  3MNL A;  3NPI A;  2MG4 A;  2EZH A;  1ETK A;  4JKZ A;  1RES A;  3I4N J;  2M9H A;  4A69 C;  3WHC A;  3CJD A;  2QCO A;  2FD5 A;  2IAI A;  5F0F A;  5EG0 A;  3MVP A;  5K7H A;  2HYT A;  3HE0 A;  4EEF G;  3ZQC A;  1JUP A;  4XRS A;  3GBG A;  1Q1V A;  3G56 A;  1PUF B;  2ID6 A;  3BNI A;  2QTQ A;  2YVE A;  4X6A J;  5J1R A;  2L7Z A;  3FIS A;  5JLX A;  3MN2 A;  4MLO A;  1JUS A;  5J1Y A;  5HAW A;  5HOD A;  4AUX A;  3GTO J;  2LR8 A;  3FK6 A;  1I6H J;  2XPW A;  2VI6 A;  1IUF A;  1RR7 A;  2XPU A;  3I4M J;  2VKE A;  3O8G A;  2CU7 A;  2LTP A;  4QTR A;  1UI6 A;  5HBU A;  4PXI A;  3A03 A;  2K9N A;  2OI8 A;  1TWH J;  3FIW A;  1MSE C;  2RAE A;  5C4Y A;  2REK A;  5EF6 A;  2L0K A;  3GTJ J;  3G1L A;  2QIB A;  2L7F P;  3LSR A;  5EZH A;  1BW5 A;  2QOP A;  4UDS A;  5H9T A;  4JL3 A;  1RET A;  1U8B A;  1QVU A;  4V2F A;  4IHY A;  2O9L A;  3HTH A;  4XID A;  3DPJ A;  3EUP A;  4FTH A;  3M3Y J;  2HYJ A;  4BY7 J;  3S1N J;  4C2M J;  5D1R A;  3IV5 A;  2LP0 A;  5GPA A;  3GTG J;  2YU9 J;  3JRA A;  1ETY A;  2AO9 A;  1GDT A;  1BL0 A;  2GFN A;  4A3K J;  2DA2 A;  1U78 A;  2VKV A;  5IYD J;  2K40 A;  2I10 A;  2NP5 A;  2KDZ A;  5F1J A;  1WH5 A;  2WAQ N;  4M3G A;  3W6V A;  1XC5 A;  1MBF A;  2HI3 A;  3JRC A;  1HCR A;  5GPC A;  2JA5 J;  2HOA A;  1F36 A;  4MIM A;  1T56 A;  1GV5 A;  1HDD C;  2FBQ A;  3VP5 A;  4JNN A;  3HKZ N;  5C4J J;  2Y31 A;  1UG2 A;  4NDL A;  1DU0 A;  5FLM J;  4NEL A;  4D7N A;  3FRQ A;  4W97 A;  2ECC A;  3CCY A;  3B6C A;  5M3F J;  4Y7N J;  1S7E A;  4FE4 A;  2LVS A;  3JRF A;  3JRH A;  2W53 A;  3V6G A;  2R5Z B;  2D5V A;  3OSF A;  4FE7 A;  1AU7 A;  4B4C A;  3S5R A;  5J3L A;  3ANP A;  3BTI A;  3HGG A;  4ICH A;  3JRI A;  1ZGW A;  5IP7 J;  3BG5 A;  4M3D A;  2NS7 A;  1GV2 A;  1YRN B;  3M4O J;  3PO2 J;  2K9Q A;  4GCT A;  3HBL A;  1BA5 A;  2TCT A;  3GTL J;  5FJ8 J;  2HXI A;  2GBY A;  1B72 A;  4D7M A;  1W0U A;  3BTJ A;  4G12 A;  4CYC B;  1HF0 A;  1JUM A;  3HOX J;  5D18 A;  2IEK A;  3FKI J;  3HB9 A;  2EZL A;  1I3Q J;  5IYC J;  4J19 A;  2FJ1 A;  3Q0W A;  5F04 A;  1ETQ A;  2XGC A;  3CDL A;  5J1U A;  5IP6 A;  4FIS A;  4RDU A;  4UUS B;  3GTK J;  1TWG J;  3OOU A;  2HOS A;  5F08 A;  1ENH A;  4MK6 A;  1XG1 A;  3S2D J;  3BQY A;  2EZI A;  3PM1 A;  1IV6 A;  2JMW A;  2DJN A;  2M34 A;  2QF7 A;  3IH4 A;  2XDN A;  3LWJ A;  1PUF A;  3QQA A;  4GCL A;  2MW8 A;  1UMQ A;  3IH2 A;  2NVX J;  3BQZ A;  1B8I B;  5CW8 A;  2DA6 A;  2R5Y B;  1K61 A;  3S2H J;  2Y2Z A;  3S1M J;  4A93 J;  4JX4 A;  3ZQG A;  2Y30 A;  4DYC A;  1OCT C;  1IDY A;  2NVQ J;  1JTY A;  3E7Q A;  3KKC A;  1DU6 A;  2IU5 A;  1Y1V J;  2X9D A;  1O4X A;  3BR3 A;  3NAU A;  5F0H A;  4GFK A;  3L1P A;  5EGO B;  3HGY A;  4A3J J;  2G7S A;  5CXG A;  5FKM A;  4CGR A;  4KWA A;  2JK3 A;  2L9R A;  1ZR4 A;  3BT9 A;  2H1K A;  3VVZ A;  2G3B A;  1VFC A;  5AQC A;  4Y52 J;  3IH3 A;  4I76 A;  1MBK A;  3OIO A;  1JKP C;  1AKH B;  3RKQ A;  3S1R J;  2NP3 A;  2DA4 A;  1SGM A;  4DZJ A;  1H88 C;  4MO7 A;  2NOG A;  1IRZ A;  3SFI A;  5JLW A;  4A3M J;  2OER A;  3VOK A;  3A01 B;  3NXC A;  2E19 A;  1JGG A;  3ZQI A;  3LHQ A;  3VW0 A;  3A02 A;  2DG7 A;  2PZ9 A;  2TRT A;  2NVT J;  2QWT A;  1ETW A;  2LLK A;  3NNR A;  1HDP A;  3B6A A;  2QKO A;  3GTM J;  1LE8 B;  2ZB9 A;  3ON2 A;  1ZQ3 P;  1MSF C;  3VW1 A;  3TW7 A;  3F0C A;  4C3H J;  3ZQL A;  5BNG A;  4A3I J;  2CQQ A;  2ECB A;  3JRG A;  4XRS G;  1EF4 A;  3O60 A;  2G0E A;  5F27 A;  5D19 A;  4AYB N;  1U9N A;  3HOU J;  2G7L A;  2DMN A;  5EG0 B;  3KKD A;  1IJW C;  2E2J J;  1UI5 A;  3NAR A;  4W1U A;  3H0G J;  3RZD J;  2Y9Z A;  3EGQ A;  5EZG A;  4A3C J;  2ID3 A;  3BTC A;  3UKG A;  1LFB A;  1AHD P;  3HM5 A;  2H8R A;  3BR0 A;  3B81 A;  5FKO A;  4IHW A;  2LY9 A;  1OFC X;  5FKK A;  3HTJ A;  2M2E A;  3S16 J;  3S14 J;  3VPR A;  2G7G A;  3GZI A;  4ACI A;  1MBH A;  1UHS A;  1VI0 A;  4HNV A;  2CRG A;  1T33 A;  1QPI A;  4AF5 A;  3NRG A;  3TED A;  1ZR2 A;  5C44 J;  2YS9 A;  3BJB A;  5FHP A;  1E3O C;  2OF7 A;  1JTX A;  3BTL A;  2L7M P;  5IOZ A;  3WHB A;  1JKR C;  4DYQ A;  2AHQ A;  5M5X J;  2UXU A;  1OJL A;  4JYK A;  2PMZ N; 
#chains in the Genus database with same CATH topology
 2CJJ A;  4Q5S F;  1R7J A;  1JGS A;  1R5H A;  3KLN A;  5JVG F;  1VQL I;  3MKY B;  2A3S A;  1QRY A;  3CP8 A;  3D5S C;  1IDZ A;  2GA2 A;  2Z33 A;  1U9O A;  3HXL A;  3KP2 A;  4GGG A;  1K7A A;  3RH2 A;  3VYT B;  2RDP A;  3ZN1 A;  4A3B J;  2IJL A;  3BRU A;  1APL C;  1JHF A;  4HOB A;  4F93 B;  3OL3 A;  4I7H A;  2DQL A;  4GO1 A;  1KU3 A;  2RC4 A;  3E7L A;  1FEX A;  3CCE I;  1MIJ A;  4LLG F;  1A5J A;  2VUM J;  3GVA A;  3HC7 A;  5HNF A;  2BY1 A;  2PFV A;  5DCF A;  5K5O A;  4HKU A;  3A0B C;  1YE9 A;  1ZTR A;  2OQR A;  1TWA J;  2XRL A;  3D1N I;  3HOV J;  2P5K A;  3BG9 A;  1HOM A;  2GQQ A;  1ZGJ A;  1ACI A;  4NN1 A;  1X2N A;  5HDN A;  2GUH A;  3RD3 A;  4LIU A;  4WCG A;  1JKO C;  3QPH A;  1TW3 A;  2YX7 A;  2A5W A;  4LFU A;  2P4W A;  1TP4 A;  3HOZ J;  4ESJ A;  4BQQ A;  1D1B A;  4PJN A;  2M0M A;  5DUK A;  3QPS A;  1H9T A;  3CC2 I;  2B9S A;  3RYR A;  3QPL A;  3OYI A;  1VQ6 I;  4E6K G;  3I54 A;  2FX0 A;  4RLF A;  3HSE A;  2ELJ A;  2L2O A;  2HOE A;  3RIR A;  2O8K A;  4HQM A;  1T95 A;  2CO5 A;  3K7A J;  2KRC A;  2K9M A;  1OCP A;  1WFX A;  3K4J A;  4BBR J;  3CCM I;  5FLV A;  2DLL A;  4GCK A;  1NTC A;  1NK3 P;  3HOW J;  4BDY A;  3QU3 A;  3REO A;  5DCM B;  3HEF A;  5KAI C;  2HS5 A;  3COA C;  2E1C A;  2WUI A;  2KMU A;  4D9J A;  2M0C A;  2ZME C;  2JQ7 A;  4HRI A;  2UXI A;  3HTS B;  1NH3 A;  3VSK A;  4ME9 A;  2E35 A;  2P8T A;  2PBX A;  4BJ5 C;  1RUO A;  2DOA A;  4HLX A;  2CW0 F;  4XLH A;  1OIS A;  1YW8 A;  3P7N A;  3I59 A;  1K78 B;  2HVS A;  5DAJ A;  2OQG A;  1WH7 A;  2B3W A;  2DU9 A;  3HHH A;  3BRO A;  3FM3 A;  1UZC A;  2YR2 A;  2O7O A;  1L3L A;  2YSR A;  2HWV A;  3SZT A;  3JR9 A;  2UXO A;  1ETV A;  2W1O A;  2FBH A;  1RKW A;  4Q48 A;  3FHN A;  4HNU A;  3VOX A;  1RRJ A;  3IKV A;  3EUH C;  2CS3 A;  2F4I A;  2MLG A;  4E7L A;  4Z6Y A;  2DOE A;  5FRO A;  3H3V K;  5H2F C;  2R7T A;  1W5S A;  3KZI C;  4O3M A;  3FWE A;  1EH7 A;  4XNF A;  1XSD A;  2JN6 A;  2RRE A;  2DMU A;  2O03 A;  1UJ8 A;  3LWF A;  3BR5 A;  5K7Z A;  2B63 J;  1JI8 A;  3OS1 A;  1KQ0 A;  3PUF A;  4RB0 A;  2ME0 A;  4BQN A;  5HDK A;  5M5W J;  4CA0 A;  4D5C A;  2R3S A;  3BG6 A;  3FBN B;  3HHG A;  4RBO A;  1J75 A;  3HRT A;  2OPT A;  2ADU A;  1ONV A;  2W7N A;  4OOI A;  3ZQQ A;  1UHM A;  1FMV A;  3CF5 F;  1WJ5 A;  2V4J C;  3TOA A;  2E1M C;  2CV2 A;  3D5R C;  3T8T A;  1W5C C;  4LB5 A;  2LKX A;  4P9U A;  2E2I J;  1OYW A;  3ZMZ A;  1R71 A;  1OYI A;  3L2V A;  4A5M A;  4PFP A;  1F43 A;  5HS7 A;  5IP9 J;  4H4K C;  2BY3 A;  2EQR A;  4IF4 A;  2PMH A;  4UUT A;  4WXC A;  3E3V A;  1Z9C A;  3DXJ F;  1Y39 A;  3MCZ A;  3OYD A;  1IXS B;  2ACJ A;  3S1Q J;  1D5Y A;  2VPR A;  2ZJR F;  3HDD A;  2JTV A;  2LD5 A;  3IC7 A;  1J7K A;  2GLO A;  1ZAR A;  1MH3 A;  1VQP I;  1W7P B;  5FFZ A;  3TW6 A;  2E34 A;  2W00 A;  3AG1 H;  2KL4 A;  4BL0 B;  4A3L J;  1MNM C;  3S15 J;  2JA8 J;  4BXU A;  4ABZ A;  4ESB A;  3GME A;  3HRU A;  5ICC A;  2IS1 A;  1UAA A;  2BY0 A;  3QKX A;  4QIW N;  1WJA A;  1XN7 A;  4AC0 A;  2VQG A;  3G1M A;  1KGS A;  4YRV A;  2OTJ I;  4XLN F;  1P7I A;  1ITY A;  1MZB A;  2LFB A;  4V19 K;  2CUE A;  2VKH A;  3OL4 A;  4DZP A;  4H0E A;  1A6I A;  4NB5 A;  5J8F A;  2KQR A;  1VQ5 I;  2QSF X;  4AU7 A;  1SC7 A;  2QUF A;  2BE5 F;  1BR1 A;  1E3P A;  2COB A;  5EEA A;  5KCM A;  3IL2 A;  4JOM A;  4BBS J;  4ESF A;  1LQ1 A;  4C3J J;  1G3S A;  4PUS A;  1U0J A;  3EUK L;  4HDV A;  3OR2 C;  3LAP A;  4G7H F;  2RAS A;  3GO5 A;  2HTS A;  3CCJ I;  2A07 F;  5B3S H;  4RAG A;  2ZFU A;  3WTZ A;  1JXS A;  3HOS A;  3C1D A;  1BR4 A;  2M1B A;  3G3Z A;  5E1Z B;  5TRD A;  1O7F A;  2BXZ A;  2HEO A;  1S9H A;  2V1D A;  3T1B A;  1R6R A;  2QCO A;  2FD5 A;  4KJZ A;  4XSX F;  2RQP A;  2DO7 A;  4XOP A;  4DBR A;  3L2C A;  4XRS A;  3GBG A;  3FXL A;  5H6R A;  3I9V 2;  3JAM Z;  3G56 A;  1PUF B;  2XV4 S;  2ID6 A;  1CGP A;  2IGK A;  4X6A J;  1UST A;  2L7Z A;  3OOP A;  4XON A;  3CCV I;  4L5J A;  3ZMS A;  5HOD A;  2L54 A;  2LR8 A;  2KLO A;  2ZXJ A;  4Y4R A;  3DKX A;  3BP8 A;  2OUM A;  2VI6 A;  4EJU A;  1RR7 A;  4AD9 A;  2VKE A;  3DWL E;  2AQF A;  3O8G A;  3OIQ A;  4AYB A;  2G7H A;  5ILU A;  4OWR B;  4M74 A;  4CIC A;  2MA3 A;  5C4Y A;  4FAS D;  2RAE A;  1W1W E;  4XOR A;  3GTJ J;  4UDS A;  1B59 A;  2L7F P;  3WTY C;  5LBQ A;  4HYE A;  1U8B A;  3HTH A;  2QOP A;  2XIG A;  1YO5 C;  2D1V A;  4U0Y A;  1I5Z A;  2W82 A;  3FMR A;  2LG4 A;  2HYJ A;  4ZYA A;  1QZY A;  3DTE A;  4PDK A;  4AVZ A;  4XOT A;  4C2M J;  5D1R A;  2LP0 A;  2H27 A;  2LRE A;  5FGM A;  2DW4 A;  4QPQ A;  1ETY A;  3I59 B;  1USS A;  1SFK A;  3GFJ A;  2VKV A;  4OAY A;  5DUI A;  1RIO H;  5FD5 A;  2K40 A;  3D5L A;  1RZ4 A;  1TQI A;  4LK0 F;  2KDZ A;  1OMI A;  1I27 A;  5F1J A;  4WX9 A;  1G4D A;  1WHU A;  3CDI A;  5JR3 A;  2HZD A;  1HCR A;  1MBF A;  3JRC A;  4KDP A;  3ESW B;  2HOA A;  1GVJ A;  3VB2 A;  4MQ9 F;  4BXF A;  2CFO A;  3V8J A;  5EEG A;  3GLX A;  4YIR X;  4OMY A;  2Z3Y A;  1ERD A;  4NDL A;  2WB1 A;  1IRX A;  1ZH5 A;  2MC4 A;  3NEU A;  4UHT A;  4W97 A;  2ECC A;  2XGX A;  3VFZ A;  4C2M A;  2UZK A;  4BQO A;  1DQU A;  3ABM H;  2LY2 A;  2ZXI A;  3V6G A;  3CJN A;  1HC8 A;  3OSF A;  4K2E A;  5HS8 A;  1P4W A;  2H6B A;  1AU7 A;  4CZC A;  4FX4 A;  4ICH A;  2PN6 A;  1YW7 A;  2VXZ A;  5IP7 J;  4IHS A;  3BG5 A;  4RGR A;  2FNP A;  3M4O J;  2K9Q A;  3M1E A;  4OD5 A;  1O57 A;  1E17 A;  2VBX A;  2R7D A;  4HF0 A;  3GTL J;  5FJ8 J;  3AL0 B;  5GTH C;  4BH9 A;  3GFI A;  1B72 A;  3X2Q H;  2H1L A;  4G12 A;  1HF0 A;  1XTA A;  3UNG C;  5D18 A;  4XKV A;  1BI1 A;  3PIP F;  1U2W A;  5FRN A;  3DV8 A;  2WBM A;  1FSE A;  5IP6 A;  1S7O A;  1EKE A;  1H0M A;  3BWG A;  2HOS A;  1XG1 A;  3J7A O;  2O61 A;  3HL2 A;  1Y0U A;  2LBF A;  2XDN A;  3IH4 A;  1BBY A;  2EIK H;  2XUB A;  4GCL A;  2MW8 A;  4EMS A;  3PFY A;  3V42 A;  1WKM A;  2VKD A;  3OR1 C;  3BQZ A;  4E7K A;  3K2Z A;  5CW8 A;  3CJR B;  4I0A A;  1O7L A;  3S1M J;  4A93 J;  4JX4 A;  3ZQG A;  1IF1 A;  2Y30 A;  2VAS A;  3KP4 A;  5JVT A;  4NHJ A;  1TZL A;  3K1N A;  1DU6 A;  4WXD A;  1Y1V J;  1FOK A;  2NNN A;  3ML6 A;  5F0H A;  1OYY A;  4LLN A;  4CGR A;  4A3J J;  5FKM A;  5CVI A;  3JTH A;  4IRI A;  1S8N A;  2E7W A;  2XRO A;  2M3A A;  2EV0 A;  2ETH A;  1FP2 A;  2E60 A;  3IHU A;  2P5V A;  3S1R J;  3SZG A;  2DA4 A;  1XDS A;  2EK5 A;  3GCM A;  3VYS B;  3CMA I;  4A12 A;  4R8H A;  1SGM A;  1WJE A;  2A6T A;  2QKM B;  3KZZ A;  1IRZ A;  3SFI A;  2C6Y A;  3LSK A;  5GAD J;  3NXC A;  2E19 A;  2WV0 A;  2LKP A;  5L3G A;  3W6K B;  3LHQ A;  1V55 H;  3VW0 A;  4OAZ A;  3IRR A;  2NVT J;  2DJI A;  1HDP A;  2MD5 A;  3B6A A;  2JVG A;  1ZN2 A;  2QKO A;  4RLQ A;  5HLG A;  1UB9 A;  3QPT A;  3IUO A;  1YS6 A;  3F0C A;  3KP6 A;  4HA8 A;  3ZQL A;  3ZP5 A;  2O3F A;  2CQQ A;  4PFO A;  4U7D A;  3O60 A;  1G8X A;  2EFN A;  3JSP A;  1N77 A;  2G7L A;  4M72 A;  2FE3 A;  2JT1 A;  3GZ5 A;  3PNT A;  3KKD A;  4UV9 A;  5EJC A;  3C2H A;  2EFQ A;  3H0G J;  3W3C A;  3JAM K;  4M9Z A;  3E6C C;  3EGQ A;  2CMP A;  5EZG A;  4Q4Z F;  1IO2 A;  5ICE A;  4A3C J;  4HNT A;  3W2W A;  3HZJ A;  3HM5 A;  3BR0 A;  3T8R A;  4A6D A;  4GCV A;  3P9K A;  5FKK A;  1KON A;  3S14 J;  4ZZD A;  4ACI A;  4P55 A;  1UHS A;  2OV7 A;  4G9Y A;  2F4M B;  4N9I A;  1TLH B;  3A1Y A;  4NNJ A;  4AF5 A;  2NOJ B;  2ZNY A;  3TED A;  5K5R A;  2KHM A;  3TQN A;  1LFP A;  1WZ2 A;  2L7M P;  4G94 A;  4PGG A;  4X0G A;  5M5X J;  3HUG A;  2PMZ N;  4JYK A;  1YX3 A;  1QO0 D;  3GWZ A;  5E3N A;  2KIF A;  1GT0 C;  2OAZ A;  1WCM J;  4RAF A;  1IN8 A;  3KP7 A;  1W0T A;  3F3X A;  4EJT A;  1Y56 A;  4DGW B;  3RCO A;  2XAG A;  1X58 A;  3NQO A;  3DEU A;  1XMA A;  2YX4 A;  1YJN I;  5E3L A;  2X51 A;  3F6V A;  4JP0 A;  4J01 A;  4BE1 A;  4U0V A;  4Y15 A;  1QPM A;  3RQ4 A;  2DMP A;  2EFO A;  3HYI A;  3RPU D;  4LG0 B;  3ON4 A;  1DGW Y;  1SD5 A;  4UNO A;  1HXD A;  1X1P A;  3L2R A;  2RHA A;  2ZME A;  5FKL A;  2MYS A;  4EGY A;  1LUJ B;  3GYH X;  3TGN A;  4HDU A;  1MD0 A;  2QQ8 A;  3BR6 A;  3K1P A;  4OU0 A;  3GZ6 A;  3LSJ A;  2BW3 A;  3FK7 A;  4UVC A;  3J7A Y;  5FKN A;  1D1A A;  2FNA A;  3CJT B;  3BG3 A;  1LKX A;  3DKY A;  3JRB A;  2STT A;  4XLC A;  5DEQ A;  4I6Z A;  1FBQ A;  1MNE A;  1NHA A;  4A3F J;  1OCC H;  1HKQ A;  1WRJ A;  1XMK A;  1N78 A;  2NVU B;  2MLK A;  3MMY B;  5E8I A;  3OYC A;  3QP5 A;  3TBI A;  1SFO J;  3K4C A;  2HOT A;  3A01 A;  1IXR C;  3BZ6 A;  3IWZ A;  2DG8 A;  2Z1D A;  3A4C A;  2QZ8 A;  1X3Z B;  5D8L B;  5K58 A;  2XGE A;  1FJL A;  2HQ5 A;  5J4Y A;  1UHW A;  1SVO A;  5F0C A;  2HDD A;  3F6O A;  2WGB A;  1B72 B;  1RNL A;  5BPI A;  5H20 A;  4N0B A;  2XC7 A;  3HPG A;  1FZP B;  3CUO A;  3CTA A;  4C9Y A;  3KET A;  1IV8 A;  2EA4 A;  2R93 J;  3VEP A;  1LB2 A;  1UG0 A;  3ASO H;  5L3E A;  4CH7 A;  2Y69 H;  3R6S A;  4QLC U;  2X6O A;  2OC6 A;  3O2P E;  1J9I A;  2YVH A;  1XD7 A;  3S3M A;  2HXO A;  2LBF B;  1CQT A;  5B1A H;  3L2U A;  4AC6 A;  4L62 A;  3C07 A;  2X48 A;  3LMM A;  4ON0 A;  1FT9 A;  3GFL A;  2ZOY A;  4RAZ A;  4NC8 A;  3CME I;  2F5E A;  1OR7 C;  3L09 A;  2PEX A;  3H9Q A;  3LNQ A;  1K79 A;  1T0F C;  5IT9 Z;  1B4A A;  1YI2 I;  5E17 F;  1FIA A;  2OU2 A;  2KJB A;  4II2 A;  4XSZ F;  2XHK A;  2MAB A;  1RR8 C;  1X2M A;  3K1M A;  1DPU A;  3BDD A;  1D8K A;  3CUQ C;  3WGG A;  3OYK A;  2OBP A;  2R5Z A;  2Z16 A;  1Y1W J;  1EJ9 A;  1AOY A;  3DKW A;  1C0W A;  5EYR A;  1R23 A;  3CQZ J;  1X1B A;  2WAQ A;  3RKY A;  1JJ6 C;  2V9V A;  4M71 A;  4B09 A;  1Z77 A;  5CVV A;  2V57 A;  3PNV A;  3VTI A;  4IEJ A;  1FSH A;  2EBI A;  3HKZ A;  1ZRF A;  3E6B A;  2ZOZ A;  3FF5 A;  1FNN A;  2UXN A;  3GEZ A;  4CCL A;  3M8E A;  4C30 A;  2LYC A;  1HQC A;  2IGO A;  5ERI A;  2X85 A;  4F3Q A;  4CYC A;  2B1E A;  1LPQ A;  3WU1 B;  4MXM A;  4QSH A;  2HGC A;  2DCE A;  3OSG A;  3DP7 A;  3QAH A;  1ORK A;  1FTT A;  3MWM A;  2GXG A;  3M07 A;  4G6Q A;  4N9H A;  4HLY A;  3VWB A;  2R7R A;  3TO9 A;  1QGP A;  1HST A;  2X1E A;  2CGP A;  2FSW A;  4AIH A;  4HBL A;  2RGV A;  3H5A A;  4YEL A;  5J4V A;  1TNS A;  2UXX A;  1PUE E;  1RKT A;  4MFE A;  4P96 A;  2R5Y A;  3KEQ A;  2KIQ A;  5DM6 F;  3OYH A;  2XAJ A;  4B1R A;  1NG6 A;  5GP9 A;  1MGT A;  2M30 A;  2LNB A;  5DTD A;  2DMT A;  3MKL A;  2FQ4 A;  2NNY A;  1TWC J;  2JUG A;  2QQA A;  3CRJ A;  2E2H J;  2QM3 A;  4A6E A;  3CLO A;  1Z7U A;  2JA7 J;  2VL8 A;  3E6D A;  3SDG A;  2RQQ A;  3M8J A;  4M3E A;  1LJ9 A;  3MKW B;  3ONQ A;  4XLE A;  1YG2 A;  3JRE A;  2PX9 A;  2EIM H;  2JUC A;  2NVY J;  1ON2 A;  1Z3Y A;  3LA2 A;  2HQR A;  3L00 A;  1DUX C;  3HUG B;  2F2E A;  4ZH4 F;  2VT3 A;  2DA7 A;  2EH3 A;  2MFZ A;  4EM2 A;  4AM3 A;  3IUV A;  1YOV B;  2IGM A;  2QSH X;  3ZPL A;  4ZDL A;  3E0J B;  1BW6 A;  1JE8 A;  1QHH D;  1LEA A;  3KPH A;  2OCC H;  3SYT A;  5D4S A;  4BU2 A;  5ED4 A;  1S6L A;  4E70 A;  2R0Q C;  1JJ8 C;  6PAX A;  4I98 B;  2IA2 A;  4KIT B;  4BAY A;  3K6G A;  3U1K A;  5TGT A;  1TT0 A;  2EZK A;  2CH0 A;  3RDI A;  1G3Y A;  3BHQ A;  1HBX G;  2BHZ A;  4L9T A;  3K0L A;  4DNC A;  2EA2 A;  1UEL B;  2F5V A;  2XDV A;  4GRI A;  4RB2 C;  3CJQ B;  2M9H A;  3QP6 A;  3CP2 A;  4F55 A;  4RMN A;  1P2F A;  1XB4 A;  1J59 A;  2ZME B;  1KYW A;  2V6E A;  2HYT A;  2EFP A;  2EWN A;  2OCE A;  1SVL A;  3AG3 H;  3LA3 A;  2MH9 A;  3M1C A;  1E0E A;  3ZQC A;  3HE0 A;  1JUP A;  2QSG X;  2GOX B;  2M45 A;  3A2K A;  5HOO A;  3BNI A;  3H35 A;  2M7B A;  2QTQ A;  3OYN A;  2PFB A;  4ZTF A;  5JLX A;  3MN2 A;  1JUS A;  5HAW A;  4XBF A;  3OYF A;  3ULQ B;  2YU3 A;  1IUF A;  3I4M J;  4GYG A;  4PCQ A;  4EJO A;  3ISP A;  1H9G A;  3WTX C;  3PNY A;  2EIJ H;  3H1C A;  2XVC A;  5EZH A;  5H9T A;  4JL3 A;  2FMY A;  5HS9 A;  3DU5 A;  3H3Z A;  3LSM A;  2FML A;  1Z67 A;  2DTR A;  2O9L A;  2XAH A;  3U1D A;  3N97 A;  5BPD A;  3DPJ A;  2DDB A;  3M3Y J;  1R4N B;  4XRF A;  4MNU A;  4BY7 J;  5HVQ C;  3K9T A;  5E79 C;  2XSJ C;  4PJL A;  5LFA A;  3T5X A;  1XSV A;  2VLA A;  1SVM A;  3MZY A;  3KYD B;  1X4P A;  4LJZ F;  3JRA A;  3H5N A;  2GFN A;  1B9N A;  4YG2 F;  1U78 A;  4KT6 A;  3U2R A;  5IYD J;  2DT5 A;  1IN6 A;  3SFZ A;  4CDG A;  3BJO A;  4IOA F;  2HI3 A;  4MQV A;  3AKZ A;  1HDD C;  3VP5 A;  1GV5 A;  4UVB A;  2E36 A;  2W85 A;  3F8B A;  3LFU A;  2GOM A;  4E7H A;  4BHP A;  1OLT A;  2LC2 A;  5C4J J;  1IN5 A;  2QWW A;  4LIT A;  3CCS I;  3L2W A;  3FMQ A;  5FLM J;  2M8E A;  3FRQ A;  5IT9 K;  3K4B A;  2M87 A;  2QEX I;  3FXO A;  1OCZ H;  3H36 A;  3CCY A;  4RM3 A;  5H6Q A;  2ZXH A;  3B6C A;  5M3F J;  1I39 A;  4DQ2 A;  4BUP A;  1MMD A;  4Y13 A;  3VSL A;  5IY5 H;  2VN2 A;  4ENM A;  2W53 A;  3W2V A;  2R5Z B;  2D5V A;  3TL4 X;  3GX4 X;  3QOP A;  3KEO A;  2X4H A;  3ANP A;  4BEH A;  5DYM A;  4CCO A;  3JRI A;  1ZGW A;  2O0Y A;  1X1C A;  2K3P A;  2V1U A;  4EJW A;  3V7C A;  5GAG J;  4ENN A;  4RM2 A;  1EA3 A;  2FBI A;  4NBQ A;  2BZT A;  3GLL A;  1BA5 A;  3V4G A;  3LFK A;  2HXI A;  2KRH A;  2VQC A;  3P9I A;  3KCC A;  3H9J A;  1W0U A;  3VDX A;  1L0O C;  5D5X B;  4CYC B;  3U21 A;  3GF2 A;  1VQN I;  1JUM A;  2L3D A;  1VQ7 I;  3HB9 A;  3BC8 A;  2CQ7 A;  2FJ1 A;  2W24 A;  1ETQ A;  3CDL A;  2HDC A;  1S29 A;  4FIS A;  4G6D A;  1I1S A;  2X6X A;  3EPZ A;  3GTK J;  2X6W A;  3OOU A;  5F08 A;  1D0Y A;  4MK6 A;  3S2D J;  2PMU A;  2XKP A;  3NS4 A;  2QF7 A;  2QQB A;  1ZEL A;  3LWJ A;  1J5Y A;  1UMQ A;  3IH2 A;  1DP7 P;  4U9N A;  2R5Y B;  3PSI A;  4PK4 A;  2JRM A;  5FLX Z;  1K61 A;  3S2H J;  2L9V A;  2X6Y A;  1OCT C;  2NVQ J;  3BY6 A;  1LDK B;  4MGR A;  3OY9 A;  1JTY A;  4MEY F;  3KKC A;  3DLL F;  2X9D A;  4U87 A;  3EYY A;  1XDU A;  4GFK A;  5K1Y A;  3V8K A;  5KVR A;  3IKT A;  1U5T A;  1ZR4 A;  4LGW A;  3VVZ A;  1Z21 A;  4I09 A;  3FXU A;  2HR3 A;  1VFC A;  3QYE A;  4II3 A;  4Y3O A;  3GFM A;  1G59 A;  3IH3 A;  1VQ4 I;  4Y52 J;  1T6S A;  3RPQ A;  3I56 I;  4IQJ A;  2BGC A;  2O5R A;  4DZJ A;  4MO7 A;  1XPX A;  2KDO A;  2XRN A;  1BIA A;  5GTI C;  3VOK A;  1D0X A;  3S2W A;  1T39 A;  2Z9O A;  2CQK A;  4ZDP A;  2VE9 A;  4KA4 A;  4OIO F;  4PJJ A;  4WF2 A;  2DDA A;  2PZ9 A;  3NNR A;  3U9G A;  2R4G A;  4O6J A;  3TKY A;  2BEO A;  2ZB9 A;  1PP8 F;  3I71 A;  1BN5 A;  4CO8 A;  4YII A;  3TW7 A;  4ASN A;  4Y17 A;  4HX4 A;  3Q5F A;  4WXH A;  3MKZ A;  4AYB N;  1U9N A;  3IWF A;  1J09 A;  4MTD A;  3I3L A;  3ZMT A;  2A69 F;  1Z91 A;  1WJB A;  3K4N A;  3W6J B;  5GAE J;  3MZH A;  3JSO A;  4W1U A;  2GIV A;  1I1G A;  2IVM A;  1WJF A;  2PLY A;  2L7K A;  2ISZ A;  4KN7 X;  1FP1 D;  1FLI A;  2QQ9 A;  5FKO A;  1K4T A;  3KP3 A;  2LY9 A;  2RN7 A;  1JHH A;  3HTJ A;  2FRH A;  3AG4 H;  3EUA A;  2M2E A;  5HLH A;  4L18 B;  2LF8 A;  1VI0 A;  4LMY A;  4HNV A;  1Z05 A;  2P6T A;  3HIF A;  4B43 A;  1SAU A;  1T08 B;  2FA5 A;  3UR3 C;  2BVM A;  2OF7 A;  3FKJ A;  1JKR C;  4YEJ A;  5IOZ A;  3WHB A;  1MMG A;  1X4O A;  3WTW C;  1OJL A;  2E5N A;  2BY2 A;  4UY8 I;  1DP3 A;  2Z99 A;  4XMY A;  1R4M B;  3DFG A;  4PJM A;  3BCA A;  5HLT A;  4RB1 A;  1BI2 A;  2Y0S A;  1VTN C;  2VT2 A;  3HTI A;  5F6F A;  2WB1 N;  3S93 A;  3FDY A;  4KIC A;  3TP3 A;  3L2Q A;  1ULY A;  2ELH A;  3LOC A;  3O8H A;  4BQA A;  1KU2 A;  1ETO A;  4JX6 A;  2W57 A;  1VQ9 I;  1FTZ A;  5LHH A;  3WGI A;  3KYL A;  3ZMV A;  3OS2 A;  3P9T A;  4P1W A;  2EIN H;  2XAU A;  2F5F A;  3E1S A;  1SD7 A;  1A36 A;  1IRG A;  5CVR A;  4MTE A;  2FOK A;  1K83 J;  1FMW A;  3AL0 C;  3RTR A;  3F8M A;  2VJI A;  4A5N A;  4IX7 A;  1PYV A;  2RV8 A;  1XS9 A;  2V9K A;  2ESH A;  2FOW A;  4L5I A;  3K4K A;  1ETX A;  2A05 A;  2CW8 A;  5E1X A;  2ZJP F;  3RYP A;  3CD6 I;  4ZYD A;  3ECH A;  1TBX A;  4HX7 A;  1MND A;  4GFB A;  2KP6 A;  4XKC A;  4FET A;  2VJ4 A;  1T98 A;  1AA7 A;  4F7Z A;  1Y8Q B;  4DIQ A;  1MBJ A;  5EDN A;  2EB7 A;  4BEH B;  3VOD A;  1P7J A;  2G7S A;  2GZW A;  1SFX A;  1T2K A;  4PGH A;  2X0L A;  2XPV A;  2PJR A;  4G6T B;  3KZ9 A;  4HPQ A;  3PO3 J;  3OYM A;  3BZK A;  3RZO J;  1ZG3 A;  3NRV A;  4HG2 A;  4IHV A;  4ITV A;  3COL A;  3DPT A;  5K7F A;  1UFM A;  2WY7 Q;  3ELK A;  2IS4 A;  1G3T A;  1ZK8 A;  2HKO A;  2M8G X;  2W48 A;  1XCV A;  5LLQ A;  4HF1 A;  1OR7 A;  3GW2 A;  4RGX A;  3WGH A;  2DTZ A;  1T0F A;  2R7Q A;  2XAQ A;  1TC3 C;  4JK1 X;  5BMZ A;  5TIS C;  3K8P C;  3PJR A;  2UXP A;  5M5Y J;  1OKR A;  3CUQ A;  2ZNZ A;  3F1B A;  2OJE D;  2ZY9 A;  2GEN A;  3E5U A;  3FXQ A;  3PFI A;  3I4P A;  3G6E I;  1V3F A;  3RI4 A;  1OQY A;  1R5I D;  1MBG A;  5CPR B;  4AWX B;  3ZQF A;  4ZYE A;  2E1N A;  2LOO A;  4V2G A;  5CQE A;  1HW2 A;  2PQ8 A;  2Q2E A;  3K2A A;  3LSH A;  1VND A;  2OD5 A;  3AQS A;  3K4M A;  3Q0V A;  1I3A A;  4XLP F;  1R49 A;  1GXP A;  4IRG A;  5FLX K;  1I6X A;  4YZE A;  2IT0 A;  1HKT A;  4A3E J;  2QA4 I;  3ABU A;  3R0A A;  1FYL A;  5ICG A;  2M7A A;  1ZAO A;  4N4N B;  1KZH A;  3GTP J;  2R7S A;  2ZC2 A;  4Z2Y A;  1IGN A;  4X1E A;  3TOB A;  3HIM A;  3PL8 A;  1U5T B;  2R7F A;  3TDZ C;  3OYE A;  1H89 C;  1S7A A;  4BXX J;  2P5L C;  2WV1 A;  2NRA C;  3RSN A;  1LFU P;  2F5C A;  2UUZ A;  3J7Z I;  3ZMU A;  3VIB A;  4BAC A;  4CSW A;  4WWC A;  1V54 H;  2G9W A;  1V4R A;  2KRF A;  3GTQ J;  5JHU A;  2JJ7 A;  4ZYH A;  4XRM A;  4C3I J;  2A6H F;  2FBK A;  4KIB A;  1RPW A;  1Z0X A;  1SMY F;  3DF8 A;  1BIB A;  5L3D A;  1STZ A;  2DK8 A;  4XR6 A;  4U7B A;  5E18 F;  2VOO A;  3G2B A;  1LEB A;  3WE2 A;  4XLA A;  1A6Q A;  3MFK A;  9ANT A;  1Y8R B;  4CUG A;  1MH4 A;  2H6C A;  4IVN A;  1W5T A;  3B02 A;  4Y33 A;  4F92 B;  2CG4 A;  2LMD A;  4EM1 A;  5L3C A;  3G7R A;  3MAJ A;  4M3F A;  3CF2 A;  2XB5 A;  2VQH A;  1AWC A;  1P4A A;  3ZOB A;  2CQX A;  2O8X A;  2WAF A;  2L02 A;  4PJ0 C;  4CCM A;  4B3A A;  2XGD A;  3VUQ A;  3FMS A;  3ANG A;  4P5O A;  4U9L A;  2BHY A;  2AQE A;  1JT0 A;  2P81 A;  2WTE A;  3DQV C;  1SEU A;  4LG3 A;  3TO7 A;  4OD4 A;  1WGX A;  4S05 A;  2LRD A;  1B8I A;  2E5Z A;  4L0Z B;  1Z3X A;  3G1O A;  5E3O A;  1JKQ C;  5EFY A;  4HSR A;  5GAH J;  2YUS A;  2CUJ A;  3OYA A;  4BY1 J;  2Q0O A;  1VF9 A;  2HVQ A;  4XN3 A;  5LEJ A;  3HTA A;  1ZRE A;  2KFD A;  2ZJQ F;  2K9S A;  4E7S A;  3KZY A;  4ZJZ A;  3VVY A;  1K6Y A;  3CCQ I;  4HX8 A;  4IO9 F;  2VC0 A;  4HST A;  3SEQ A;  4DW6 A;  1FIP A;  3ZQH A;  3KNW A;  2DA5 A;  4LOC A;  4E7Z A;  1AKH A;  1YIT I;  2FUG 2;  2MSY A;  1TTY A;  1FWZ A;  4UXN A;  2IBD A;  4WK8 F;  1IUY A;  2JSP A;  4ZZL A;  5JHF A;  4EM0 B;  3OV8 A;  4DJA A;  1IN4 A;  1MW7 A;  5E1W A;  5D5V B;  3H92 A;  3R60 A;  1RI7 A;  1VZ0 A;  3OMY A;  4J00 A;  1K78 A;  3F8N A;  4XK4 A;  3P5J A;  3D0S A;  3T6N A;  1TQM A;  5E3M A;  4RAY A;  3CWR A;  2JWT A;  1BJZ A;  3JSJ A;  4XKB A;  2D2W A;  5DS9 A;  1ON1 A;  1LNW A;  3SXY A;  4IKF A;  1QZE A;  5LD2 C;  5M3M J;  1Y6I A;  2NAZ A;  3EUH A;  2DAO A;  4JBA A;  3WTT C;  4OIP F;  1YYV A;  2UXH A;  3NI7 A;  2CWE A;  2R7Z J;  2HZT A;  1QZZ A;  4BDZ A;  3NPI A;  2EZH A;  2LH9 A;  4BJ6 C;  4DBQ A;  3CCU I;  2Q1Z B;  5EEH A;  4G7Z F;  1F5T A;  1ETK A;  1HW5 A;  2HYF A;  4ENK A;  4EVI A;  1RES A;  3I4N J;  2QBY A;  2IAI A;  5F0F A;  3LA7 A;  2V9P A;  5E20 A;  3PIO F;  2HQN A;  4B3X A;  3BJA A;  5K7H A;  5ILV A;  1XCB A;  3SQN A;  2DI3 A;  3I64 A;  3K10 A;  3MQ0 A;  2W25 A;  2E7X A;  2EV6 A;  1IRF A;  3I55 I;  3M9A A;  1NG7 A;  1WI9 A;  2F5D A;  5J1R A;  3DBL B;  3QYF A;  4IPA A;  1BC7 C;  4MLO A;  1Z7L A;  2I8D A;  2GXA A;  4AUX A;  3GTO J;  3FK6 A;  1KYZ A;  1Z6R A;  2K9L A;  3JCU C;  3VYR B;  1I6H J;  2XPW A;  3RPU A;  2XPU A;  1WQ2 A;  2CU7 A;  1OCR H;  2PJR B;  1VQ8 I;  3HSF A;  5HBU A;  3IRQ A;  3J80 Z;  3A03 A;  3V7R A;  2K9N A;  4U0W A;  4XL9 A;  2K02 A;  4A0Y A;  1W36 C;  2D45 A;  2REK A;  4IJA A;  5EF6 A;  2L0K A;  4E4H A;  1R00 A;  3G1L A;  2DYR H;  3LSR A;  4HF2 A;  4RGS A;  4IHY A;  2MBF A;  4V2F A;  4ZDO A;  3R4K A;  4XID A;  4BS9 A;  1O3Q A;  1R1V A;  4FTH A;  2YPR A;  2K3F A;  3IAM 2;  4LLL A;  3S1N J;  3WG7 H;  3GTG J;  4NQW A;  5DV5 A;  2R7X A;  1M1E B;  1BL0 A;  1TQP A;  2M4K A;  3HG9 A;  1YJ9 I;  3ZMD A;  1W4M A;  3HJE A;  2DYS H;  2I10 A;  3E97 A;  2ZBK A;  3DPL C;  1WH5 A;  1LVK A;  2WAQ N;  4M3G A;  1A31 A;  1XC5 A;  3W6V A;  3VVX A;  4MIM A;  1F36 A;  1T56 A;  4D1Q A;  2VC1 A;  1YJW I;  3HKZ N;  1EV7 A;  1A35 A;  5LGN A;  4UB6 C;  3DLA A;  4NEL A;  2V79 A;  1BOB A;  4HAM A;  4E7I A;  5ILS A;  4Y7N J;  4GXO A;  2ZJ2 A;  2LVS A;  3JRF A;  2KIM A;  1ZLK A;  4RGU A;  3BZC A;  3DPU A;  4I99 C;  2WAE A;  3FXK A;  2VJJ A;  4FE7 A;  4B4C A;  1UCR A;  3S5R A;  5J3L A;  1R1U A;  1BC8 C;  3J81 Z;  4M73 A;  3I5U A;  4M3D A;  2KZV A;  2NS7 A;  1GV2 A;  4IRV A;  2R7U A;  1WVR A;  3HBL A;  2L4A A;  2VBZ A;  2HPI A;  2TCT A;  2NS0 A;  1LVA A;  1V5F A;  2PBI A;  2MC3 A;  1U8R A;  4CCJ A;  3ASN H;  3C3W A;  3HOX J;  2IEK A;  4I01 A;  1BI0 A;  3ZN0 A;  1K4S A;  3FM5 A;  3VOE A;  3MD2 A;  3Q0W A;  3MEX A;  4J19 A;  5BQT A;  3FZV A;  4KMU X;  3OS0 A;  1ENH A;  5B1B H;  4KUM A;  3ERM A;  2EZI A;  3PM1 A;  4BHB A;  1IXC A;  2JMW A;  2DJN A;  2HFH A;  3E5Q A;  1Q1H A;  2JPC A;  1PUF A;  3QQA A;  3E5X A;  3NWT A;  3EYI A;  5J6X A;  1B8I B;  4ETS A;  2DA6 A;  5KK1 A;  2Y2Z A;  2VQL A;  4XLF A;  1PVE A;  4DYC A;  3WG9 A;  1ZG1 A;  2A2F X;  2XAF A;  2JRT A;  3KFW X;  1QBJ A;  4BYY A;  5D6E A;  1O4X A;  3DTK A;  4BHC A;  3NAU A;  3KLO A;  4BE0 A;  3L1P A;  2FQ3 A;  3HGY A;  5CXG A;  5HLI A;  2JZY A;  2JK3 A;  2L9R A;  4KWA A;  1P4X A;  2GA1 A;  3BT9 A;  2BW3 B;  2G3B A;  1J2X A;  4F91 B;  3ERE D;  2V7F A;  5AQC A;  3H3U A;  3JTG A;  1JKP C;  4I76 A;  1AKH B;  3OIO A;  1RC9 A;  2IS6 A;  2NP3 A;  2EIL H;  3C18 A;  5LRR A;  4P9F A;  2NOG A;  2WAD A;  4UV8 A;  4A3M J;  5CJ9 A;  3A01 B;  2IS2 A;  2PG4 A;  1JGG A;  1MJ9 A;  3ZQI A;  3A02 A;  1ZGA A;  2DG7 A;  2DOF A;  3V7S A;  2QWT A;  1ETW A;  2WWY A;  2LLK A;  2QGU A;  2QLZ A;  2LDU A;  1KQ8 A;  3N05 A;  1BR2 A;  3GTM J;  4IQ4 A;  5JFR A;  3QWL A;  5KHD A;  4HZF A;  3VW1 A;  4UVA A;  2VBW A;  4C3H J;  5BNG A;  2DK5 A;  4A3I J;  2ECB A;  3QU6 A;  5J47 A;  1TL8 A;  5F27 A;  4U88 A;  5CKT A;  4AVP A;  5D19 A;  3HOU J;  5CVJ A;  2QBY B;  5AIP A;  1IAW A;  1V5E A;  2DMN A;  1WJD A;  2E2J J;  1UI5 A;  2RNG A;  3NAR A;  2OA4 A;  3F21 A;  2JVH A;  4NC6 A;  4KIF A;  2IA0 A;  2CV1 A;  2L01 A;  1X3W B;  2L5Q A;  3UKG A;  2H8R A;  4LD5 A;  1MJA A;  2A61 A;  3B81 A;  3RJP A;  1IN7 A;  3ZXS A;  1HKS A;  1OFC X;  2E1M B;  2YVX A;  4S04 A;  3VPR A;  3GZI A;  2F4O B;  2VIX A;  2RKH A;  2IA1 A;  2CRG A;  2J5P A;  1T33 A;  2DFE A;  5F64 A;  2BV6 A;  3J80 K;  2D1H A;  2HKX A;  4QPO A;  3BJB A;  2B0L A;  4XKW A;  1E3O C;  2DBB A;  1U3E M;  1REP C;  3RKX A;  4QWQ A;  4DYQ A;  2K4J A;  2RNJ A;  3CMM A;  2UXU A;  1X19 A;  3EUP A;  2K85 A;  3E6M A;  1R58 A;  4UB8 C;  2M5W A;  5FB2 A;  3CC7 I;  2NX4 A;  1I50 J;  2XSD C;  3LQQ A;  2CFX A;  3BG7 A;  3BJ6 A;  2GXB A;  4B8X A;  1TW2 A;  4A3D J;  3K70 C;  1SAX A;  5DD4 A;  3SZP A;  4NQW B;  1KA8 A;  1IG7 A;  2IGN A;  4TV7 A;  3CDH A;  3KP5 A;  1D3Y A;  2A68 F;  1IZ1 A;  4BGD A;  1S5L C;  5LHG A;  3A0H C;  2X1D A;  3HTU A;  4M6X A;  4XN0 A;  1IW7 F;  2H8W A;  2E1O A;  3Q3S A;  4OIQ F;  5KNL A;  1H8A C;  4YFX F;  1KU7 A;  1YW9 A;  2L9S A;  2VJ5 A;  3ZRG A;  5D4R A;  1WI3 A;  1G3W A;  3TP0 A;  2WC2 A;  2EJR A;  4D5F A;  1ZRD A;  2V6C A;  3BCG A;  3BCB A;  5BOX A;  5DD8 A;  5LRS A;  1O3R A;  1ZKG A;  3OIP A;  2Z5U A;  4DYR A;  2JPB A;  2IPQ X;  1YIO A;  3WTS C;  3O3K A;  5K5Q A;  3T0Y A;  2HNH A;  3GUD A;  4CYD A;  5ICF A;  3OYJ A;  3S3N A;  2UV1 A;  2BVL A;  1FYK A;  3KIO A;  4KIG A;  3CCL I;  5IOY A;  4WIB A;  3FBI B;  4MFD A;  3BOQ A;  2ME6 A;  1SD4 A;  1MDM A;  3CO7 C;  2N8G A;  4EJV A;  4FCY A;  4YFN F;  3ABT A;  3CO6 C;  3J81 K;  3QYB A;  4L5E A;  3EDP A;  3I53 A;  3AAF A;  4D0P A;  1BM9 A;  1R36 A;  2K27 A;  2DA1 A;  5FMP A;  1GHC A;  1F4K A;  3W2A A;  4CZZ A;  3WTV C;  5FRM A;  1TWF J;  3PQJ A;  5J40 A;  1D5V A;  3EET A;  3BR1 A;  2DN0 A;  2KIS A;  2XF7 A;  4IOC F;  1B1B A;  3OYB A;  4CGZ A;  1TNT A;  2ZO4 A;  1CF7 A;  4GDF A;  1FOW A;  2R92 J;  3RKW A;  2A5Y B;  5DDG A;  1XMX A;  2W84 A;  2NXN B;  1RUN A;  2GM4 A;  2V1N A;  3MZ8 A;  3G4S I;  3LSG A;  1ZRC A;  3CC4 I;  2HKU A;  3I0T A;  4L9N A;  3JRD A;  4M3B A;  1NK2 P;  4IHX A;  3CZ6 A;  4LK1 F;  1FYM A;  1JT6 A;  2ICW G;  2D6Y A;  3TDU C;  4A3G J;  2K5C A;  1EH6 A;  1QU3 A;  3OYL A;  3F9K A;  3FXR A;  5IPA A;  2CUF A;  2ZCM A;  3CMY A;  3LJL A;  2OZ6 A;  3WU0 A;  2O6G E;  1YHQ I;  1O3S A;  1ODD A;  1VQO I;  4JX5 A;  1N25 A;  2Y9Y A;  3J7Y J;  1YTY A;  1D8J A;  5D8K B;  4MHG A;  3RQI A;  2HVR A;  2LK2 A;  1PJR A;  2P6S A;  4NUB A;  5JI6 A;  4CCK A;  2O7T A;  2Q8K A;  3BPX A;  3F72 A;  3R0J A;  4XIC A;  2VPL A;  1FPQ A;  2Q24 A;  2ELK A;  2RVC A;  4L0Y B;  2XB0 X;  3O6B B;  1BOA A;  2DA3 A;  5C4X J;  4IRH A;  2ZCN A;  1WPK A;  1YX5 A;  2B7E A;  2DFF A;  1LDD A;  4IL6 C;  4BNC A;  3OYG A;  1KU9 A;  3DEW A;  2NS8 A;  5IYB J;  5BS6 A;  2STW A;  3GXO A;  1Y0N A;  1YRN A;  5TJJ A;  4Q47 A;  2H09 A;  5FGL A;  4HEA 2;  2CQN A;  1U6G A;  2CW7 A;  2EFW A;  4DVY P;  3ROU A;  4KNY A;  2DFH A;  2AS5 F;  1S3J A;  5KAF C;  4OMZ A;  3BR2 A;  2H94 A;  1SFE A;  1FX7 A;  2A6E F;  1X3U A;  4FX0 A;  1R9T J;  4CXF A;  4M9X A;  1R1T A;  2QYO A;  1GUU A;  5LGU A;  4CHU A;  5B5E C;  3NWS A;  3DTI A;  3EQL F;  3WE3 A;  3G73 A;  1GVD A;  4LG0 A;  1W36 D;  2KZG A;  4OIR F;  1G2H A;  3AQT A;  4UUS A;  3N4M A;  1HLV A;  2VBY A;  3ZQ7 A;  2ZFW A;  4BKX A;  5CYV A;  5HSZ A;  4ANJ A;  3VW2 A;  1P6R A;  2F6C A;  2FU4 A;  1ZHF A;  4FT8 A;  3LSP A;  1IC8 A;  1DPR A;  5B66 C;  5IT3 A;  2DT7 B;  2MGQ A;  2QEN A;  2J5O A;  1XSX A;  3S17 J;  3HSR A;  3PPB A;  1SD6 A;  2HQA A;  1E2X A;  4GFL A;  1QVT A;  3ECO A;  4I0B A;  1SAN A;  3WOD F;  4RS8 A;  3QOE A;  4EAT A;  3HOY J;  4G7O F;  1MBE A;  2LY1 A;  1B9M A;  2LF7 A;  3SJM A;  3PAS A;  3CLQ A;  2Y0S N;  1F9N A;  3ABL H;  2JA2 A;  2KKO A;  3FX3 A;  3ZCO A;  4KYW A;  3IP4 B;  1P9Q C;  2KIU A;  5LEK A;  2GWR A;  1POG A;  5CVU A;  1MJB A;  2DPD A;  4NC7 A;  4YIF A;  5EGO A;  1E3H A;  2VON A;  2K4B A;  2P7V B;  4XQF A;  3QBM A;  3SDB A;  2VOP A;  1YFH A;  1HSJ A;  3ZGK A;  3V78 A;  2JA6 J;  2TDX A;  3LQR A;  3WU2 C;  2V1X A;  3DEE A;  3C2B A;  1V5G A;  3DCF A;  4M6V A;  3G71 I;  2CUZ A;  2L4M A;  2MD0 A;  2HDW A;  2FF4 A;  3KEY A;  3GEU A;  3SWH A;  3P9C A;  1OPC A;  2PJP A;  4R1H A;  1FBS A;  2KT0 A;  4S0H B;  2DXI A;  5CXI A;  3V8L A;  2K7L A;  5C3E J;  3LST A;  2CV0 A;  2L9N A;  2DMQ A;  1X1A A;  2ZCX A;  5FD6 A;  3Q0U A;  5D6F A;  2NYX A;  2F07 A;  2K86 A;  1LE8 A;  2EPF A;  3OWT A;  2DPU A;  1P92 A;  4KMF A;  3MNL A;  4B47 A;  1G6N A;  2KPM A;  2MG4 A;  1FOY A;  3JW4 A;  3S8P A;  4JKZ A;  2QVO A;  4A69 C;  3WHC A;  3CJD A;  2IRF G;  1QHG A;  5EG0 A;  4C2T A;  4EV0 A;  3C7J A;  3MVP A;  4OIN F;  3FXM A;  1VQK I;  2P7C B;  4EEF G;  2X1C A;  4I2O A;  2CYY A;  1Q1V A;  1OCO H;  5AIQ A;  4KFC A;  4BE2 A;  2YVE A;  2HTJ A;  3FIS A;  5A2Q Z;  1MDM B;  3DBR B;  5J1Y A;  2ZCW A;  3H5R A;  4IZZ A;  3SHF A;  4RB3 C;  1FOX A;  3WTU C;  4KN4 X;  3F22 A;  1MKM A;  2HU9 A;  2LTP A;  1BI3 A;  2ZSI B;  4QTR A;  2VOD A;  1UI6 A;  4PXI A;  4XM3 A;  2OI8 A;  1TWH J;  3FIW A;  3HRS A;  3F23 A;  1S72 I;  1MSE C;  4B44 A;  1KQ9 A;  4LB6 B;  3CES A;  2FEZ A;  1PDN C;  1BW5 A;  2F48 A;  1D0Z A;  2Y0M A;  3AFH A;  3H0D A;  2QIB A;  1RET A;  1T8I A;  1QNT A;  1QVU A;  1XGS A;  3KX2 A;  2QKL B;  4E7J A;  3SEZ A;  4MEX F;  1CF7 B;  1MMN A;  4O5V A;  4B48 A;  1U5T C;  2ESN A;  2VXD A;  2DOD A;  5D5U B;  1T38 A;  3IV5 A;  5GPA A;  2YU9 J;  2AO9 A;  1GDT A;  3ZR8 X;  5LGT A;  4A3K J;  1MMS A;  1LDJ A;  2DA2 A;  4I02 A;  3LSI A;  1DGR M;  2CSO A;  4HV5 A;  2NP5 A;  3PUB A;  4FQG A;  4L9V A;  4IHT A;  2PMZ A;  5DM7 F;  5GPC A;  2JA5 J;  4R79 A;  3R61 A;  2FBQ A;  2FJI 1;  4AIJ A;  3PSF A;  3M8F A;  4JNN A;  2XF5 A;  3I58 A;  2Y31 A;  1EH8 A;  5HNH A;  1UG2 A;  2WY8 Q;  1YQA A;  1DU0 A;  4D7N A;  4A2U A;  3L7W A;  4HQE A;  1FBU A;  2VE8 A;  4RA2 A;  3HRM A;  2COM A;  1S7E A;  1R22 A;  4FE4 A;  2G7U A;  2LKS A;  1Z1D A;  3JRH A;  1QA6 A;  4HV6 A;  3L9F A;  4C2U A;  2R7V A;  2P0W A;  1XGN A;  3BTI A;  5HDG A;  3HGG A;  1YIJ I;  2DFI A;  2M4G A;  2Y48 A;  4YFK F;  4ZYG A;  3F8F A;  3Q9V A;  4FHT A;  1ZG5 A;  2R7W A;  3LL7 A;  1YRN B;  3PO2 J;  4GCT A;  5F1R A;  3CCR I;  5E8G A;  5DCM A;  3M7G A;  4AID A;  3IAS 2;  5L3B A;  3S3O A;  2DT6 A;  1YLF A;  2GBY A;  4G8X A;  2V26 A;  4ZTJ A;  3B73 A;  4D7M A;  3BLY A;  2VB6 A;  4EGZ A;  3QRF F;  3BTJ A;  4A0X A;  3Q9S A;  2Y75 A;  3FKI J;  5LHI A;  1FY7 A;  2EZL A;  2UWM A;  2GIZ A;  1I3Q J;  4L9J A;  5IYC J;  5F04 A;  2XGC A;  5J1U A;  3FHZ A;  1ZLJ A;  3KE2 A;  4RDU A;  4UUS B;  4KT5 C;  3HPH A;  1TWG J;  2ZSH B;  2FXA A;  3BQY A;  3DBH B;  4EQQ A;  1IV6 A;  1QQI A;  1GXQ A;  1XGM A;  2M34 A;  5CQG A;  3GZN B;  4KIS A;  3QOD A;  1TT5 B;  2NVX J;  3BPV A;  4CCN A;  3K70 D;  1W7P D;  2R7O A;  2W4S A;  1SMT A;  2Z2S B;  1IDY A;  3TMO A;  3E7Q A;  2JSC A;  2IU5 A;  1GLN A;  3BR3 A;  2ZXW H;  1FC3 A;  3K4L A;  2BXY A;  2XAS A;  1D1C A;  2AXT C;  2IW5 A;  3FXJ A;  3VYU B;  4F52 A;  3ABK H;  5EGO B;  1R5G A;  1J0R A;  3S32 A;  1PP7 U;  1VQM I;  1N75 A;  4IXA A;  4DOZ A;  2H1K A;  3PQK A;  2XF6 A;  1SFU A;  2HPM A;  1MBK A;  2E71 A;  3RKQ A;  4PSW A;  3KYC B;  1WJC A;  3F8C A;  4ENJ A;  2AXL A;  2I5U A;  1H88 C;  2IP2 A;  2MH2 A;  2KJC A;  5AON A;  2OZU A;  5JLW A;  4M6Y A;  2PI0 A;  1MMA A;  2OER A;  1ZYR F;  4PZJ A;  4A0Z A;  2LSO A;  2TRT A;  2ZKZ A;  1B6A A;  1O3T A;  4JQF A;  3HOT A;  1YS7 A;  2BOL A;  1LE8 B;  3ON2 A;  1BJA A;  2ISY A;  1ZQ3 P;  1MSF C;  3JRG A;  1XGO A;  3DU6 A;  1A04 A;  4XRS G;  1X1D A;  3C2G A;  2G0E A;  4UUV A;  1EF4 A;  3H9G A;  5FFX A;  3CUQ B;  3AG2 H;  5EG0 B;  5J8C A;  1IJW C;  2EV5 A;  1HA8 A;  1F1Z A;  2XKO A;  2WA0 A;  3LAJ A;  3TO6 A;  3RZD J;  2Y9Z A;  1WWX A;  2BBY A;  2ID3 A;  3BTC A;  2Q2E B;  2HYG D;  5A2Q K;  1LFB A;  1AHD P;  4HW0 A;  2IXS A;  1W7P A;  2DQR A;  1K6O A;  4AIK A;  4ZC3 A;  1HW1 A;  4IHW A;  4M9S A;  5L3F A;  4GYI A;  3S16 J;  2G7G A;  4BJT A;  1MBH A;  2GAU A;  1XX5 A;  3K69 A;  1QPI A;  2OTL I;  3NRG A;  1WSU A;  2BYV E;  1ZR2 A;  1DDN A;  4LIV A;  2YS9 A;  5CLS A;  5C44 J;  4N4O B;  5FHP A;  5D5W B;  1JTX A;  3BTL A;  2AHQ A;  5FO5 A;  4PSX A;  1Z6T A; 
#chains in the Genus database with same CATH homology
 2CJJ A;  5E3N A;  2NX4 A;  1GT0 C;  1I50 J;  2XSD C;  1IDZ A;  1QRY A;  1WCM J;  1U9O A;  3HTI A;  2WB1 N;  3RH2 A;  3TP3 A;  4A3D J;  4A3B J;  3LOC A;  3O8H A;  1W0T A;  1IG7 A;  1ETO A;  4JX6 A;  1APL C;  1FTZ A;  3BRU A;  3P9T A;  1X58 A;  3E7L A;  1FEX A;  2E1O A;  3Q3S A;  1A5J A;  2VUM J;  5E3L A;  1H8A C;  1K83 J;  4JP0 A;  4HKU A;  1WI3 A;  1XS9 A;  3TP0 A;  1ZTR A;  2DMP A;  3ON4 A;  1TWA J;  2XRL A;  4D5F A;  3D1N I;  1ETX A;  3HOV J;  3BG9 A;  1HOM A;  3BCG A;  4NN1 A;  1X2N A;  2GUH A;  2RHA A;  5FKL A;  3RD3 A;  1JKO C;  1ZKG A;  3HOZ J;  4DYR A;  4GFB A;  3BR6 A;  3QPS A;  3LSJ A;  3FK7 A;  5FKN A;  5IOY A;  3BG3 A;  3QPL A;  4MFD A;  3JRB A;  2ME6 A;  4I6Z A;  2FX0 A;  2N8G A;  4A3F J;  4FCY A;  1MBJ A;  4L5E A;  5EDN A;  2O8K A;  1P7J A;  3K7A J;  1SFO J;  2HOT A;  3A01 A;  1OCP A;  2XPV A;  4BBR J;  2DG8 A;  5FLV A;  2DA1 A;  3KZ9 A;  5FMP A;  3PO3 J;  3RZO J;  2XGE A;  5K58 A;  1NTC A;  1TWF J;  1FJL A;  1NK3 P;  3HOW J;  4GCK A;  4IHV A;  2HQ5 A;  3HEF A;  3COL A;  5K7F A;  5F0C A;  2HDD A;  2WUI A;  2WGB A;  3BR1 A;  1ZK8 A;  2DN0 A;  2M0C A;  2M8G X;  1B72 B;  2W48 A;  2UXI A;  2DTZ A;  2R92 J;  1TC3 C;  4ME9 A;  2PBX A;  2R93 J;  2GM4 A;  2UXP A;  5M5Y J;  3LSG A;  2HKU A;  3F1B A;  3JRD A;  5DAJ A;  2GEN A;  2X6O A;  4M3B A;  1NK2 P;  1WH7 A;  4IHX A;  2YVH A;  1JT6 A;  1MBG A;  2HXO A;  2D6Y A;  3ZQF A;  2O7O A;  4V2G A;  1CQT A;  3JR9 A;  4AC6 A;  4L62 A;  2UXO A;  1ETV A;  3K2A A;  4A3G J;  3C07 A;  1VND A;  3AQS A;  2X48 A;  1RKW A;  3Q0V A;  5IPA A;  4YZE A;  3VOX A;  2CUF A;  4A3E J;  2ZCM A;  3CMY A;  3LJL A;  2ZOY A;  4JX5 A;  2Y9Y A;  3LNQ A;  3GTP J;  1FIA A;  3RQI A;  3H3V K;  2LK2 A;  2O7T A;  1X2M A;  2JN6 A;  4X1E A;  2DMU A;  1IGN A;  3HIM A;  3VVX A;  4XIC A;  3BR5 A;  5K7Z A;  2B63 J;  2R5Z A;  1Y1W J;  2Q24 A;  2ELK A;  5EYR A;  1H89 C;  3CQZ J;  4BXX J;  2XB0 X;  1JJ6 C;  2ME0 A;  2WV1 A;  2DA3 A;  5C4X J;  1LFU P;  2ZCN A;  1WPK A;  1Z77 A;  3VIB A;  2V57 A;  4IEJ A;  3DEW A;  3GTQ J;  2EBI A;  5M5W J;  2JJ7 A;  2NS8 A;  5IYB J;  4D5C A;  4XRM A;  4RBO A;  2ZOZ A;  1YRN A;  4C3I J;  5FGL A;  2OPT A;  1RPW A;  1Z0X A;  3BR2 A;  2LKX A;  4CYC A;  2E2I J;  1R9T J;  1F43 A;  9ANT A;  4MXM A;  1GUU A;  4QSH A;  1MH4 A;  5IP9 J;  3OSG A;  1GVD A;  1ORK A;  1G2H A;  3AQT A;  1FTT A;  3G7R A;  2EQR A;  4UUS A;  1HLV A;  4M3F A;  2XB5 A;  3ZOB A;  4BKX A;  2CQX A;  3VUQ A;  5HSZ A;  4UUT A;  4B3A A;  2XGD A;  3VW2 A;  1IC8 A;  3ANG A;  3LSP A;  1JT0 A;  2P81 A;  2MGQ A;  3S1Q J;  3S17 J;  3PPB A;  1D5Y A;  1WGX A;  1RKT A;  2VPR A;  4MFE A;  1B8I A;  3HDD A;  4GFL A;  1QVT A;  2R5Y A;  3G1O A;  5E3O A;  1JKQ C;  1SAN A;  2LD5 A;  3HOY J;  5EFY A;  4B1R A;  5GP9 A;  1MBE A;  2GLO A;  2YUS A;  2DMT A;  5DTD A;  3MKL A;  3SJM A;  4BY1 J;  3PAS A;  2FQ4 A;  1MH3 A;  1VF9 A;  2Y0S N;  1TWC J;  3HTA A;  3CRJ A;  3TW6 A;  2E2H J;  2K9S A;  3VVY A;  4A3L J;  1MNM C;  1POG A;  3S15 J;  2JA7 J;  2JA8 J;  5EGO A;  3SDG A;  4ABZ A;  4DW6 A;  1FIP A;  4M3E A;  3ZQH A;  3QBM A;  3QKX A;  4QIW N;  3V78 A;  3KNW A;  4AC0 A;  2DA5 A;  2JA6 J;  4LOC A;  3JRE A;  3G1M A;  2NVY J;  1AKH A;  1P7I A;  1ITY A;  2LFB A;  3C2B A;  2MSY A;  3DCF A;  4M6V A;  2IBD A;  2CUE A;  4DZP A;  1A6I A;  2DA7 A;  3GEU A;  2EH3 A;  3IUV A;  4XK4 A;  4S0H B;  2KT0 A;  2COB A;  5EEA A;  3T6N A;  4BBS J;  5CXI A;  1BW6 A;  5E3M A;  3CWR A;  2JWT A;  1BJZ A;  3JSJ A;  5C3E J;  4C3J J;  5DS9 A;  2DMQ A;  2ZCX A;  2R0Q C;  1JJ8 C;  3Q0U A;  2RAS A;  2F07 A;  5M3M J;  2EZK A;  3NI7 A;  1LE8 A;  2UXH A;  3BHQ A;  2R7Z J;  3MNL A;  3NPI A;  2MG4 A;  2EZH A;  1ETK A;  4JKZ A;  1RES A;  3I4N J;  2M9H A;  4A69 C;  3WHC A;  3CJD A;  2QCO A;  2FD5 A;  2IAI A;  5F0F A;  5EG0 A;  3MVP A;  5K7H A;  2HYT A;  3HE0 A;  4EEF G;  3ZQC A;  1JUP A;  4XRS A;  3GBG A;  1Q1V A;  3G56 A;  1PUF B;  2ID6 A;  3BNI A;  2QTQ A;  2YVE A;  4X6A J;  5J1R A;  2L7Z A;  3FIS A;  5JLX A;  3MN2 A;  4MLO A;  1JUS A;  5J1Y A;  5HAW A;  5HOD A;  4AUX A;  3GTO J;  2LR8 A;  3FK6 A;  1I6H J;  2XPW A;  2VI6 A;  1IUF A;  1RR7 A;  2XPU A;  3I4M J;  2VKE A;  3O8G A;  2CU7 A;  2LTP A;  4QTR A;  1UI6 A;  5HBU A;  4PXI A;  3A03 A;  2K9N A;  2OI8 A;  1TWH J;  3FIW A;  1MSE C;  2RAE A;  5C4Y A;  2REK A;  5EF6 A;  2L0K A;  3GTJ J;  3G1L A;  2QIB A;  2L7F P;  3LSR A;  5EZH A;  1BW5 A;  2QOP A;  4UDS A;  5H9T A;  4JL3 A;  1RET A;  1U8B A;  1QVU A;  4V2F A;  4IHY A;  2O9L A;  3HTH A;  4XID A;  3DPJ A;  3EUP A;  4FTH A;  3M3Y J;  2HYJ A;  4BY7 J;  3S1N J;  4C2M J;  5D1R A;  3IV5 A;  2LP0 A;  5GPA A;  3GTG J;  2YU9 J;  3JRA A;  1ETY A;  2AO9 A;  1GDT A;  1BL0 A;  2GFN A;  4A3K J;  2DA2 A;  1U78 A;  2VKV A;  5IYD J;  2K40 A;  2I10 A;  2NP5 A;  2KDZ A;  5F1J A;  1WH5 A;  2WAQ N;  4M3G A;  3W6V A;  1XC5 A;  1MBF A;  2HI3 A;  3JRC A;  1HCR A;  5GPC A;  2JA5 J;  2HOA A;  1F36 A;  4MIM A;  1T56 A;  1GV5 A;  1HDD C;  2FBQ A;  3VP5 A;  4JNN A;  3HKZ N;  5C4J J;  2Y31 A;  1UG2 A;  4NDL A;  1DU0 A;  5FLM J;  4NEL A;  4D7N A;  3FRQ A;  4W97 A;  2ECC A;  3CCY A;  3B6C A;  5M3F J;  4Y7N J;  1S7E A;  4FE4 A;  2LVS A;  3JRF A;  3JRH A;  2W53 A;  3V6G A;  2R5Z B;  2D5V A;  3OSF A;  4FE7 A;  1AU7 A;  4B4C A;  3S5R A;  5J3L A;  3ANP A;  3BTI A;  3HGG A;  4ICH A;  3JRI A;  1ZGW A;  5IP7 J;  3BG5 A;  4M3D A;  2NS7 A;  1GV2 A;  1YRN B;  3M4O J;  3PO2 J;  2K9Q A;  4GCT A;  3HBL A;  1BA5 A;  2TCT A;  3GTL J;  5FJ8 J;  2HXI A;  2GBY A;  1B72 A;  4D7M A;  1W0U A;  3BTJ A;  4G12 A;  4CYC B;  1HF0 A;  1JUM A;  3HOX J;  5D18 A;  2IEK A;  3FKI J;  3HB9 A;  2EZL A;  1I3Q J;  5IYC J;  4J19 A;  2FJ1 A;  3Q0W A;  5F04 A;  1ETQ A;  2XGC A;  3CDL A;  5J1U A;  5IP6 A;  4FIS A;  4RDU A;  4UUS B;  3GTK J;  1TWG J;  3OOU A;  2HOS A;  5F08 A;  1ENH A;  4MK6 A;  1XG1 A;  3S2D J;  3BQY A;  2EZI A;  3PM1 A;  1IV6 A;  2JMW A;  2DJN A;  2M34 A;  2QF7 A;  3IH4 A;  2XDN A;  3LWJ A;  1PUF A;  3QQA A;  4GCL A;  2MW8 A;  1UMQ A;  3IH2 A;  2NVX J;  3BQZ A;  1B8I B;  5CW8 A;  2DA6 A;  2R5Y B;  1K61 A;  3S2H J;  2Y2Z A;  3S1M J;  4A93 J;  4JX4 A;  3ZQG A;  2Y30 A;  4DYC A;  1OCT C;  1IDY A;  2NVQ J;  1JTY A;  3E7Q A;  3KKC A;  1DU6 A;  2IU5 A;  1Y1V J;  2X9D A;  1O4X A;  3BR3 A;  3NAU A;  5F0H A;  4GFK A;  3L1P A;  5EGO B;  3HGY A;  4A3J J;  2G7S A;  5CXG A;  5FKM A;  4CGR A;  4KWA A;  2JK3 A;  2L9R A;  1ZR4 A;  3BT9 A;  2H1K A;  3VVZ A;  2G3B A;  1VFC A;  5AQC A;  4Y52 J;  3IH3 A;  4I76 A;  1MBK A;  3OIO A;  1JKP C;  1AKH B;  3RKQ A;  3S1R J;  2NP3 A;  2DA4 A;  1SGM A;  4DZJ A;  1H88 C;  4MO7 A;  2NOG A;  1IRZ A;  3SFI A;  5JLW A;  4A3M J;  2OER A;  3VOK A;  3A01 B;  3NXC A;  2E19 A;  1JGG A;  3ZQI A;  3LHQ A;  3VW0 A;  3A02 A;  2DG7 A;  2PZ9 A;  2TRT A;  2NVT J;  2QWT A;  1ETW A;  2LLK A;  3NNR A;  1HDP A;  3B6A A;  2QKO A;  3GTM J;  1LE8 B;  2ZB9 A;  3ON2 A;  1ZQ3 P;  1MSF C;  3VW1 A;  3TW7 A;  3F0C A;  4C3H J;  3ZQL A;  5BNG A;  4A3I J;  2CQQ A;  2ECB A;  3JRG A;  4XRS G;  1EF4 A;  3O60 A;  2G0E A;  5F27 A;  5D19 A;  4AYB N;  1U9N A;  3HOU J;  2G7L A;  2DMN A;  5EG0 B;  3KKD A;  1IJW C;  2E2J J;  1UI5 A;  3NAR A;  4W1U A;  3H0G J;  3RZD J;  2Y9Z A;  3EGQ A;  5EZG A;  4A3C J;  2ID3 A;  3BTC A;  3UKG A;  1LFB A;  1AHD P;  3HM5 A;  2H8R A;  3BR0 A;  3B81 A;  5FKO A;  4IHW A;  2LY9 A;  1OFC X;  5FKK A;  3HTJ A;  2M2E A;  3S16 J;  3S14 J;  3VPR A;  2G7G A;  3GZI A;  4ACI A;  1MBH A;  1UHS A;  1VI0 A;  4HNV A;  2CRG A;  1T33 A;  1QPI A;  4AF5 A;  3NRG A;  3TED A;  1ZR2 A;  5C44 J;  2YS9 A;  3BJB A;  5FHP A;  1E3O C;  2OF7 A;  1JTX A;  3BTL A;  2L7M P;  5IOZ A;  3WHB A;  1JKR C;  4DYQ A;  2AHQ A;  5M5X J;  2UXU A;  1OJL A;  4JYK A;  2PMZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...