3GEUA

Crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
189
Chain Sequence
SNAMKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Intercellular adhesion protein R
total genus 75
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3geuA00
2NS8A 3BR3A 2G0EA 2DG7A 2JJ7A 3BRUA 4UDSA 3NNRA 2O7OA 3BT9A 2GBYA 3BTIA 5J1YA 3MNLA 2ZOYA 2RAEA 5F1JA 2X6OA 2FX0A 2Y2ZA 3CRJA 4GFKA 2F07A 5HAWA 3LSRA 5CXGA 4MO7A 2FBQA 2IAIA 3CJDA 5IP6A 3LJLA 2NS7A 3F1BA 2UXIA 2G3BA 3QBMA 5GPAA 3O8HA 3TP0A 3HTHA 3ZQGA 5CXIA 3GEUA 3ZQLA 2XGEA 3IUVA 3LSPA 2XGDA 3LOCA 4AC6A 4ABZA 4W1UA 1JTYA 2PBXA 3LSJA 4GFLA 3VOXA 3FIWA 2FQ4A 4MK6A 5J1RA 5FHPA 3VW0A 3ANGA 2TRTA 4V2GA 3O8GA 3HGGA 5HBUA 5D18A 5IOZA 3KNWA 5AQCA 3VUQA 5F08A 2W53A 3PASA 5FKLA 3BTCA 2HXOA 2XGCA 3QPLA 1JT0A 3AQTA 3SFIA 2QIBA 3HIMA 2OPTA 3IH3A 2ZCNA 3HTJA 5FKOA 2HQ5A 1U9OA 2ID6A 3T6NA 3G1MA 2HYTA 3P9TA 1UI5A 5FKNA 3VVXA 4AUXA 1SGMA 5F0HA 3V78A 3G1OA 3S5RA 3TP3A 1JTXA 3EUPA 4L62A 3DPJA 5K7HA 3BR6A 3Q0UA 5J3LA 3BQZA 5HSZA 5K7ZA 5GP9A 3G56A 2NP5A 3VW1A 2XB5A 4JKZA 2GFNA 3AQSA 1BJZA 2XPUA 4D7MA 1UI6A 2Q24A 3B6CA 2FJ1A 3BR5A 2QWTA 3V6GA 2IBDA 1RPWA 5K7FA 2VKVA 3BR2A 4AF5A 4HKUA 2ZCXA 3NXCA 2EH3A 2XDNA 2X9DA 3VVYA 4M3GA 2NX4A 2Y30A 3G1LA 5IPAA 3F0CA 4JYKA 3LHQA 5F27A 2JK3A 3ZQIA 3VVZA 3HTIA 4W97A 3NPIA 3WHCA 2QOPA 5FKMA 3VW2A 3ZQFA 5EYRA 3BNIA 2WUIA 5F0FA 1QVUA 2OERA 4M3EA 4GCLA 3GZIA 3BTJA 3ON4A 2G7SA 2IEKA 4I6ZA 2GENA 1U9NA 4JL3A 4X1EA 3O60A 3VP5A 4NN1A 4I76A 2G7GA 3PM1A 2UXOA 1QVTA 3BR0A 2WGBA 5DAJA 2RHAA 5K58A 4D5CA 2YVHA 3Q0VA 2QKOA 4B3AA 4GCTA 3DEWA 1VI0A 2XPVA 4XK4A 2HKUA 5FKKA 3ON2A 3EGQA 3C07A 4V2FA 2NP3A 1JUMA 2OI8A 5H9TA 3VOKA 4M3FA 2I10A 5J1UA 5EZGA 3B81A 3HE0A 5F0CA 3KKDA 4B1RA 3BJBA 2ZB9A 4ICHA 4M3BA 2FD5A 1JUSA 4AC0A 3VIBA 3NI7A 4CGRA 3IH2A 4D5FA 2IU5A 3KZ9A 3VPRA 3JSJA 2V57A 3ZQHA 3HGYA 5IOYA 3QKXA 2DTZA 3ANPA 2Y31A 3LWJA 3COLA 3HTAA 2XRLA 3RH2A 2ZCMA 5EFYA 4KWAA 2PZ9A 1JT6A 3BQYA 4GCKA 4G12A 1QPIA 3C2BA 3IH4A 4M3DA 3RD3A 1ZKGA 3E7QA 4YZEA 3QQAA 5D1RA 1JUPA 4ME9A 1Z77A 3FK7A 3PPBA 4DW6A 3MVPA 3NRGA 5FMPA 4JNNA 5C4YA 1RKWA 2ID3A 2ZOZA 3KKCA 5F04A 5D19A 3FK6A 4MXMA 2UXPA 2D6YA 2QCOA 3BCGA 2TCTA 3CCYA 2G7LA 4D7NA 2HYJA 1T56A 2HXIA 3FRQA 3G7RA 5FGLA 3WHBA 3Q3SA 4ACIA 2YVEA 3DCFA 1A6IA 1T33A 1ZK8A 5GPCA 3Q0WA 4PXIA 2REKA 3SDGA 3CWRA 2GUHA 2UXHA 3BR1A 5CW8A 3B6AA 2RASA 1ORKA 2QTQA 1RKTA 2DG8A 3BHQA 2OF7A 2VPRA 3BTLA 2O7TA 3QPSA 1Z0XA 2VKEA 3CDLA 2UXUA 2XPWA 4NELA 2WV1A 5EZHA
chains in the Genus database with same CATH superfamily
2NS8A 3BR3A 2G0EA 2DG7A 2JJ7A 3BRUA 4UDSA 3NNRA 2O7OA 3BT9A 2R7WA 2GBYA 2B3WA 3BTIA 3DU6A 3MNLA 2ZOYA 2RAEA 5J1YA 5F1JA 2X6OA 2FX0A 2Y2ZA 3CRJA 4GFKA 2F07A 2R7UA 5HAWA 3LSRA 5CXGA 4MO7A 2FBQA 2IAIA 3CJDA 5IP6A 3LJLA 2NS7A 3F1BA 2UXIA 2G3BA 3QBMA 3DU5A 5GPAA 3O8HA 3TP0A 2FJI1 3HTHA 3ZQGA 5CXIA 3GEUA 3ZQLA 2XGEA 3IUVA 3LSPA 2XGDA 3LOCA 4AC6A 4ABZA 4W1UA 1JTYA 2PBXA 3LSJA 4GFLA 3VOXA 3FIWA 2R7VA 2FQ4A 4MK6A 5J1RA 5FHPA 3VW0A 3ANGA 2TRTA 4V2GA 3O8GA 3HGGA 5HBUA 5D18A 4WIBA 5IOZA 3KNWA 5AQCA 3VUQA 5F08A 3VTIA 2W53A 3PASA 5FKLA 3BTCA 2HXOA 2XGCA 3QPLA 1JT0A 3AQTA 3SFIA 2QIBA 3HIMA 2OPTA 3IH3A 2ZCNA 3HTJA 5FKOA 2HQ5A 3KYLA 1U9OA 2ID6A 3T6NA 3G1MA 2HYTA 3P9TA 1UI5A 5FKNA 3VVXA 4AUXA 1SGMA 5F0HA 3V78A 2YVXA 3G1OA 3S5RA 3TP3A 1JTXA 3EUPA 4L62A 3DPJA 2R7QA 5K7HA 3BR6A 4OD5A 3Q0UA 5J3LA 3BQZA 5HSZA 5K7ZA 5GP9A 3G56A 2R7OA 2NP5A 3VW1A 2XB5A 4JKZA 2GFNA 3AQSA 1BJZA 2XPUA 4D7MA 1UI6A 2Q24A 3B6CA 2FJ1A 3BR5A 2QWTA 3V6GA 2IBDA 1RPWA 5K7FA 2VKVA 3BR2A 2A2FX 4AF5A 4HKUA 2ZCXA 3NXCA 2EH3A 2XDNA 2X9DA 3VVYA 4M3GA 2NX4A 2Y30A 2B1EA 3G1LA 5IPAA 3F0CA 4JYKA 3LHQA 5F27A 2JK3A 3ZQIA 3VVZA 3HTIA 4W97A 3NPIA 3WHCA 2QOPA 5FKMA 3VW2A 3ZQFA 5EYRA 3BNIA 2WUIA 5F0FA 4C2MA 1QVUA 2OERA 4M3EA 4GCLA 3GZIA 3BTJA 4U9NA 3ON4A 5CQGA 2G7SA 2IEKA 4I6ZA 2GENA 1U9NA 4JL3A 4X1EA 3O60A 3VP5A 4NN1A 4I76A 2G7GA 3PM1A 2UXOA 1QVTA 3BR0A 2WGBA 3K8PC 5DAJA 2RHAA 5K58A 4D5CA 2YVHA 3Q0VA 2QKOA 4B3AA 4GCTA 2PFVA 3DEWA 1VI0A 4U9LA 2XPVA 4XK4A 2HKUA 2ZY9A 5FKKA 3ON2A 3EGQA 3C07A 4V2FA 2NP3A 1JUMA 2OI8A 5H9TA 3VOKA 4M3FA 2I10A 5J1UA 5EZGA 3B81A 3HE0A 5F0CA 3KKDA 4B1RA 3BJBA 2ZB9A 4ICHA 4M3BA 2FD5A 3FHNA 1JUSA 4AC0A 3VIBA 3NI7A 4CGRA 3IH2A 4D5FA 2IU5A 3KZ9A 3VPRA 3JSJA 2V57A 3ZQHA 3HGYA 5IOYA 2R7TA 3SWHA 3QKXA 2DTZA 3ANPA 2Y31A 3LWJA 3COLA 3HTAA 2XRLA 2R7RA 3RH2A 2ZCMA 5EFYA 4KWAA 2PZ9A 1JT6A 3BQYA 4GCKA 4G12A 1QPIA 3C2BA 3IH4A 4M3DA 3RD3A 1ZKGA 3E7QA 4YZEA 3QQAA 5D1RA 1JUPA 4ME9A 1Z77A 3FK7A 3PPBA 4DW6A 3MVPA 3NRGA 2R7SA 5FMPA 4JNNA 5C4YA 1RKWA 2ID3A 2ZOZA 3KKCA 5F04A 5D19A 3FK6A 3NS4A 4MXMA 2UXPA 2D6YA 2QCOA 3BCGA 2TCTA 3CCYA 2G7LA 4D7NA 2HYJA 1T56A 2HXIA 3FRQA 3G7RA 5FGLA 3WHBA 4DVYP 3Q3SA 4ACIA 2YVEA 3DCFA 1A6IA 1T33A 1ZK8A 5GPCA 3Q0WA 4PXIA 2REKA 3SDGA 3CWRA 2GUHA 2UXHA 3BR1A 5CW8A 3B6AA 2RASA 1ORKA 4OD4A 2QTQA 1RKTA 2DG8A 3BHQA 2OF7A 2VPRA 2R7XA 4IRVA 3BTLA 2O7TA 3QPSA 1Z0XA 2VKEA 3CDLA 2UXUA 2XPWA 4NELA 2WV1A 5EZHA
chains in the Genus database with same CATH topology
2NS8A 3BR3A 2G0EA 2DG7A 2JJ7A 3BRUA 4UDSA 3NNRA 2O7OA 3BT9A 2GBYA 3BTIA 5J1YA 3MNLA 2ZOYA 2RAEA 5F1JA 2X6OA 2FX0A 2Y2ZA 3CRJA 4GFKA 2F07A 5HAWA 3LSRA 5CXGA 4MO7A 2FBQA 2IAIA 3CJDA 5IP6A 3LJLA 2NS7A 3F1BA 2UXIA 2G3BA 3QBMA 5GPAA 3O8HA 3TP0A 3HTHA 3ZQGA 5CXIA 3GEUA 3ZQLA 2XGEA 3IUVA 3LSPA 2XGDA 3LOCA 4AC6A 4ABZA 4W1UA 1JTYA 2PBXA 3LSJA 4GFLA 3VOXA 3FIWA 2FQ4A 4MK6A 5J1RA 5FHPA 3VW0A 3ANGA 2TRTA 4V2GA 3O8GA 3HGGA 5HBUA 5D18A 5IOZA 3KNWA 5AQCA 3VUQA 5F08A 2W53A 3PASA 5FKLA 3BTCA 2HXOA 2XGCA 3QPLA 1JT0A 3AQTA 3SFIA 2QIBA 3HIMA 2OPTA 3IH3A 2ZCNA 3HTJA 5FKOA 2HQ5A 1U9OA 2ID6A 3T6NA 3G1MA 2HYTA 3P9TA 1UI5A 5FKNA 3VVXA 4AUXA 1SGMA 5F0HA 3V78A 3G1OA 3S5RA 3TP3A 1JTXA 3EUPA 4L62A 3DPJA 5K7HA 3BR6A 3Q0UA 5J3LA 3BQZA 5HSZA 5K7ZA 5GP9A 3G56A 2NP5A 3VW1A 2XB5A 4JKZA 2GFNA 3AQSA 1BJZA 2XPUA 4D7MA 1UI6A 2Q24A 3B6CA 2FJ1A 3BR5A 2QWTA 3V6GA 2IBDA 1RPWA 5K7FA 2VKVA 3BR2A 4AF5A 4HKUA 2ZCXA 3NXCA 2EH3A 2XDNA 2X9DA 3VVYA 4M3GA 2NX4A 2Y30A 3G1LA 5IPAA 3F0CA 4JYKA 3LHQA 5F27A 2JK3A 3ZQIA 3VVZA 3HTIA 4W97A 3NPIA 3WHCA 2QOPA 5FKMA 3VW2A 3ZQFA 5EYRA 3BNIA 2WUIA 5F0FA 1QVUA 2OERA 4M3EA 4GCLA 3GZIA 3BTJA 3ON4A 2G7SA 2IEKA 4I6ZA 2GENA 1U9NA 4JL3A 4X1EA 3O60A 3VP5A 4NN1A 4I76A 2G7GA 3PM1A 2UXOA 1QVTA 3BR0A 2WGBA 5DAJA 2RHAA 5K58A 4D5CA 2YVHA 3Q0VA 2QKOA 4B3AA 4GCTA 3DEWA 1VI0A 2XPVA 4XK4A 2HKUA 5FKKA 3ON2A 3EGQA 3C07A 4V2FA 2NP3A 1JUMA 2OI8A 5H9TA 3VOKA 4M3FA 2I10A 5J1UA 5EZGA 3B81A 3HE0A 5F0CA 3KKDA 4B1RA 3BJBA 2ZB9A 4ICHA 4M3BA 2FD5A 1JUSA 4AC0A 3VIBA 3NI7A 4CGRA 3IH2A 4D5FA 2IU5A 3KZ9A 3VPRA 3JSJA 2V57A 3ZQHA 3HGYA 5IOYA 3QKXA 2DTZA 3ANPA 2Y31A 3LWJA 3COLA 3HTAA 2XRLA 3RH2A 2ZCMA 5EFYA 4KWAA 2PZ9A 1JT6A 3BQYA 4GCKA 4G12A 1QPIA 3C2BA 3IH4A 4M3DA 3RD3A 1ZKGA 3E7QA 4YZEA 3QQAA 5D1RA 1JUPA 4ME9A 1Z77A 3FK7A 3PPBA 4DW6A 3MVPA 3NRGA 5FMPA 4JNNA 5C4YA 1RKWA 2ID3A 2ZOZA 3KKCA 5F04A 5D19A 3FK6A 4MXMA 2UXPA 2D6YA 2QCOA 3BCGA 2TCTA 3CCYA 2G7LA 4D7NA 2HYJA 1T56A 2HXIA 3FRQA 3G7RA 5FGLA 3WHBA 3Q3SA 4ACIA 2YVEA 3DCFA 1A6IA 1T33A 1ZK8A 5GPCA 3Q0WA 4PXIA 2REKA 3SDGA 3CWRA 2GUHA 2UXHA 3BR1A 5CW8A 3B6AA 2RASA 1ORKA 2QTQA 1RKTA 2DG8A 3BHQA 2OF7A 2VPRA 3BTLA 2O7TA 3QPSA 1Z0XA 2VKEA 3CDLA 2UXUA 2XPWA 4NELA 2WV1A 5EZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  3BR3 A;  2G0E A;  2DG7 A;  2JJ7 A;  3BRU A;  4UDS A;  3NNR A;  2O7O A;  3BT9 A;  2GBY A;  3BTI A;  5J1Y A;  3MNL A;  2ZOY A;  2RAE A;  5F1J A;  2X6O A;  2FX0 A;  2Y2Z A;  3CRJ A;  4GFK A;  2F07 A;  5HAW A;  3LSR A;  5CXG A;  4MO7 A;  2FBQ A;  2IAI A;  3CJD A;  5IP6 A;  3LJL A;  2NS7 A;  3F1B A;  2UXI A;  2G3B A;  3QBM A;  5GPA A;  3O8H A;  3TP0 A;  3HTH A;  3ZQG A;  5CXI A;  3GEU A;  3ZQL A;  2XGE A;  3IUV A;  3LSP A;  2XGD A;  3LOC A;  4AC6 A;  4ABZ A;  4W1U A;  1JTY A;  2PBX A;  3LSJ A;  4GFL A;  3VOX A;  3FIW A;  2FQ4 A;  4MK6 A;  5J1R A;  5FHP A;  3VW0 A;  3ANG A;  2TRT A;  4V2G A;  3O8G A;  3HGG A;  5HBU A;  5D18 A;  5IOZ A;  3KNW A;  5AQC A;  3VUQ A;  5F08 A;  2W53 A;  3PAS A;  5FKL A;  3BTC A;  2HXO A;  2XGC A;  3QPL A;  1JT0 A;  3AQT A;  3SFI A;  2QIB A;  3HIM A;  2OPT A;  3IH3 A;  2ZCN A;  3HTJ A;  5FKO A;  2HQ5 A;  1U9O A;  2ID6 A;  3T6N A;  3G1M A;  2HYT A;  3P9T A;  1UI5 A;  5FKN A;  3VVX A;  4AUX A;  1SGM A;  5F0H A;  3V78 A;  3G1O A;  3S5R A;  3TP3 A;  1JTX A;  3EUP A;  4L62 A;  3DPJ A;  5K7H A;  3BR6 A;  3Q0U A;  5J3L A;  3BQZ A;  5HSZ A;  5K7Z A;  5GP9 A;  3G56 A;  2NP5 A;  3VW1 A;  2XB5 A;  4JKZ A;  2GFN A;  3AQS A;  1BJZ A;  2XPU A;  4D7M A;  1UI6 A;  2Q24 A;  3B6C A;  2FJ1 A;  3BR5 A;  2QWT A;  3V6G A;  2IBD A;  1RPW A;  5K7F A;  2VKV A;  3BR2 A;  4AF5 A;  4HKU A;  2ZCX A;  3NXC A;  2EH3 A;  2XDN A;  2X9D A;  3VVY A;  4M3G A;  2NX4 A;  2Y30 A;  3G1L A;  5IPA A;  3F0C A;  4JYK A;  3LHQ A;  5F27 A;  2JK3 A;  3ZQI A;  3VVZ A;  3HTI A;  4W97 A;  3NPI A;  3WHC A;  2QOP A;  5FKM A;  3VW2 A;  3ZQF A;  5EYR A;  3BNI A;  2WUI A;  5F0F A;  1QVU A;  2OER A;  4M3E A;  4GCL A;  3GZI A;  3BTJ A;  3ON4 A;  2G7S A;  2IEK A;  4I6Z A;  2GEN A;  1U9N A;  4JL3 A;  4X1E A;  3O60 A;  3VP5 A;  4NN1 A;  4I76 A;  2G7G A;  3PM1 A;  2UXO A;  1QVT A;  3BR0 A;  2WGB A;  5DAJ A;  2RHA A;  5K58 A;  4D5C A;  2YVH A;  3Q0V A;  2QKO A;  4B3A A;  4GCT A;  3DEW A;  1VI0 A;  2XPV A;  4XK4 A;  2HKU A;  5FKK A;  3ON2 A;  3EGQ A;  3C07 A;  4V2F A;  2NP3 A;  1JUM A;  2OI8 A;  5H9T A;  3VOK A;  4M3F A;  2I10 A;  5J1U A;  5EZG A;  3B81 A;  3HE0 A;  5F0C A;  3KKD A;  4B1R A;  3BJB A;  2ZB9 A;  4ICH A;  4M3B A;  2FD5 A;  1JUS A;  4AC0 A;  3VIB A;  3NI7 A;  4CGR A;  3IH2 A;  4D5F A;  2IU5 A;  3KZ9 A;  3VPR A;  3JSJ A;  2V57 A;  3ZQH A;  3HGY A;  5IOY A;  3QKX A;  2DTZ A;  3ANP A;  2Y31 A;  3LWJ A;  3COL A;  3HTA A;  2XRL A;  3RH2 A;  2ZCM A;  5EFY A;  4KWA A;  2PZ9 A;  1JT6 A;  3BQY A;  4GCK A;  4G12 A;  1QPI A;  3C2B A;  3IH4 A;  4M3D A;  3RD3 A;  1ZKG A;  3E7Q A;  4YZE A;  3QQA A;  5D1R A;  1JUP A;  4ME9 A;  1Z77 A;  3FK7 A;  3PPB A;  4DW6 A;  3MVP A;  3NRG A;  5FMP A;  4JNN A;  5C4Y A;  1RKW A;  2ID3 A;  2ZOZ A;  3KKC A;  5F04 A;  5D19 A;  3FK6 A;  4MXM A;  2UXP A;  2D6Y A;  2QCO A;  3BCG A;  2TCT A;  3CCY A;  2G7L A;  4D7N A;  2HYJ A;  1T56 A;  2HXI A;  3FRQ A;  3G7R A;  5FGL A;  3WHB A;  3Q3S A;  4ACI A;  2YVE A;  3DCF A;  1A6I A;  1T33 A;  1ZK8 A;  5GPC A;  3Q0W A;  4PXI A;  2REK A;  3SDG A;  3CWR A;  2GUH A;  2UXH A;  3BR1 A;  5CW8 A;  3B6A A;  2RAS A;  1ORK A;  2QTQ A;  1RKT A;  2DG8 A;  3BHQ A;  2OF7 A;  2VPR A;  3BTL A;  2O7T A;  3QPS A;  1Z0X A;  2VKE A;  3CDL A;  2UXU A;  2XPW A;  4NEL A;  2WV1 A;  5EZH A; 
#chains in the Genus database with same CATH topology
 2NS8 A;  3BR3 A;  2G0E A;  2DG7 A;  2JJ7 A;  3BRU A;  4UDS A;  3NNR A;  2O7O A;  3BT9 A;  2R7W A;  2GBY A;  2B3W A;  3BTI A;  3DU6 A;  3MNL A;  2ZOY A;  2RAE A;  5J1Y A;  5F1J A;  2X6O A;  2FX0 A;  2Y2Z A;  3CRJ A;  4GFK A;  2F07 A;  2R7U A;  5HAW A;  3LSR A;  5CXG A;  4MO7 A;  2FBQ A;  2IAI A;  3CJD A;  5IP6 A;  3LJL A;  2NS7 A;  3F1B A;  2UXI A;  2G3B A;  3QBM A;  3DU5 A;  5GPA A;  3O8H A;  3TP0 A;  2FJI 1;  3HTH A;  3ZQG A;  5CXI A;  3GEU A;  3ZQL A;  2XGE A;  3IUV A;  3LSP A;  2XGD A;  3LOC A;  4AC6 A;  4ABZ A;  4W1U A;  1JTY A;  2PBX A;  3LSJ A;  4GFL A;  3VOX A;  3FIW A;  2R7V A;  2FQ4 A;  4MK6 A;  5J1R A;  5FHP A;  3VW0 A;  3ANG A;  2TRT A;  4V2G A;  3O8G A;  3HGG A;  5HBU A;  5D18 A;  4WIB A;  5IOZ A;  3KNW A;  5AQC A;  3VUQ A;  5F08 A;  3VTI A;  2W53 A;  3PAS A;  5FKL A;  3BTC A;  2HXO A;  2XGC A;  3QPL A;  1JT0 A;  3AQT A;  3SFI A;  2QIB A;  3HIM A;  2OPT A;  3IH3 A;  2ZCN A;  3HTJ A;  5FKO A;  2HQ5 A;  3KYL A;  1U9O A;  2ID6 A;  3T6N A;  3G1M A;  2HYT A;  3P9T A;  1UI5 A;  5FKN A;  3VVX A;  4AUX A;  1SGM A;  5F0H A;  3V78 A;  2YVX A;  3G1O A;  3S5R A;  3TP3 A;  1JTX A;  3EUP A;  4L62 A;  3DPJ A;  2R7Q A;  5K7H A;  3BR6 A;  4OD5 A;  3Q0U A;  5J3L A;  3BQZ A;  5HSZ A;  5K7Z A;  5GP9 A;  3G56 A;  2R7O A;  2NP5 A;  3VW1 A;  2XB5 A;  4JKZ A;  2GFN A;  3AQS A;  1BJZ A;  2XPU A;  4D7M A;  1UI6 A;  2Q24 A;  3B6C A;  2FJ1 A;  3BR5 A;  2QWT A;  3V6G A;  2IBD A;  1RPW A;  5K7F A;  2VKV A;  3BR2 A;  2A2F X;  4AF5 A;  4HKU A;  2ZCX A;  3NXC A;  2EH3 A;  2XDN A;  2X9D A;  3VVY A;  4M3G A;  2NX4 A;  2Y30 A;  2B1E A;  3G1L A;  5IPA A;  3F0C A;  4JYK A;  3LHQ A;  5F27 A;  2JK3 A;  3ZQI A;  3VVZ A;  3HTI A;  4W97 A;  3NPI A;  3WHC A;  2QOP A;  5FKM A;  3VW2 A;  3ZQF A;  5EYR A;  3BNI A;  2WUI A;  5F0F A;  4C2M A;  1QVU A;  2OER A;  4M3E A;  4GCL A;  3GZI A;  3BTJ A;  4U9N A;  3ON4 A;  5CQG A;  2G7S A;  2IEK A;  4I6Z A;  2GEN A;  1U9N A;  4JL3 A;  4X1E A;  3O60 A;  3VP5 A;  4NN1 A;  4I76 A;  2G7G A;  3PM1 A;  2UXO A;  1QVT A;  3BR0 A;  2WGB A;  3K8P C;  5DAJ A;  2RHA A;  5K58 A;  4D5C A;  2YVH A;  3Q0V A;  2QKO A;  4B3A A;  4GCT A;  2PFV A;  3DEW A;  1VI0 A;  4U9L A;  2XPV A;  4XK4 A;  2HKU A;  2ZY9 A;  5FKK A;  3ON2 A;  3EGQ A;  3C07 A;  4V2F A;  2NP3 A;  1JUM A;  2OI8 A;  5H9T A;  3VOK A;  4M3F A;  2I10 A;  5J1U A;  5EZG A;  3B81 A;  3HE0 A;  5F0C A;  3KKD A;  4B1R A;  3BJB A;  2ZB9 A;  4ICH A;  4M3B A;  2FD5 A;  3FHN A;  1JUS A;  4AC0 A;  3VIB A;  3NI7 A;  4CGR A;  3IH2 A;  4D5F A;  2IU5 A;  3KZ9 A;  3VPR A;  3JSJ A;  2V57 A;  3ZQH A;  3HGY A;  5IOY A;  2R7T A;  3SWH A;  3QKX A;  2DTZ A;  3ANP A;  2Y31 A;  3LWJ A;  3COL A;  3HTA A;  2XRL A;  2R7R A;  3RH2 A;  2ZCM A;  5EFY A;  4KWA A;  2PZ9 A;  1JT6 A;  3BQY A;  4GCK A;  4G12 A;  1QPI A;  3C2B A;  3IH4 A;  4M3D A;  3RD3 A;  1ZKG A;  3E7Q A;  4YZE A;  3QQA A;  5D1R A;  1JUP A;  4ME9 A;  1Z77 A;  3FK7 A;  3PPB A;  4DW6 A;  3MVP A;  3NRG A;  2R7S A;  5FMP A;  4JNN A;  5C4Y A;  1RKW A;  2ID3 A;  2ZOZ A;  3KKC A;  5F04 A;  5D19 A;  3FK6 A;  3NS4 A;  4MXM A;  2UXP A;  2D6Y A;  2QCO A;  3BCG A;  2TCT A;  3CCY A;  2G7L A;  4D7N A;  2HYJ A;  1T56 A;  2HXI A;  3FRQ A;  3G7R A;  5FGL A;  3WHB A;  4DVY P;  3Q3S A;  4ACI A;  2YVE A;  3DCF A;  1A6I A;  1T33 A;  1ZK8 A;  5GPC A;  3Q0W A;  4PXI A;  2REK A;  3SDG A;  3CWR A;  2GUH A;  2UXH A;  3BR1 A;  5CW8 A;  3B6A A;  2RAS A;  1ORK A;  4OD4 A;  2QTQ A;  1RKT A;  2DG8 A;  3BHQ A;  2OF7 A;  2VPR A;  2R7X A;  4IRV A;  3BTL A;  2O7T A;  3QPS A;  1Z0X A;  2VKE A;  3CDL A;  2UXU A;  2XPW A;  4NEL A;  2WV1 A;  5EZH A; 
#chains in the Genus database with same CATH homology
 2NS8 A;  3BR3 A;  2G0E A;  2DG7 A;  2JJ7 A;  3BRU A;  4UDS A;  3NNR A;  2O7O A;  3BT9 A;  2GBY A;  3BTI A;  5J1Y A;  3MNL A;  2ZOY A;  2RAE A;  5F1J A;  2X6O A;  2FX0 A;  2Y2Z A;  3CRJ A;  4GFK A;  2F07 A;  5HAW A;  3LSR A;  5CXG A;  4MO7 A;  2FBQ A;  2IAI A;  3CJD A;  5IP6 A;  3LJL A;  2NS7 A;  3F1B A;  2UXI A;  2G3B A;  3QBM A;  5GPA A;  3O8H A;  3TP0 A;  3HTH A;  3ZQG A;  5CXI A;  3GEU A;  3ZQL A;  2XGE A;  3IUV A;  3LSP A;  2XGD A;  3LOC A;  4AC6 A;  4ABZ A;  4W1U A;  1JTY A;  2PBX A;  3LSJ A;  4GFL A;  3VOX A;  3FIW A;  2FQ4 A;  4MK6 A;  5J1R A;  5FHP A;  3VW0 A;  3ANG A;  2TRT A;  4V2G A;  3O8G A;  3HGG A;  5HBU A;  5D18 A;  5IOZ A;  3KNW A;  5AQC A;  3VUQ A;  5F08 A;  2W53 A;  3PAS A;  5FKL A;  3BTC A;  2HXO A;  2XGC A;  3QPL A;  1JT0 A;  3AQT A;  3SFI A;  2QIB A;  3HIM A;  2OPT A;  3IH3 A;  2ZCN A;  3HTJ A;  5FKO A;  2HQ5 A;  1U9O A;  2ID6 A;  3T6N A;  3G1M A;  2HYT A;  3P9T A;  1UI5 A;  5FKN A;  3VVX A;  4AUX A;  1SGM A;  5F0H A;  3V78 A;  3G1O A;  3S5R A;  3TP3 A;  1JTX A;  3EUP A;  4L62 A;  3DPJ A;  5K7H A;  3BR6 A;  3Q0U A;  5J3L A;  3BQZ A;  5HSZ A;  5K7Z A;  5GP9 A;  3G56 A;  2NP5 A;  3VW1 A;  2XB5 A;  4JKZ A;  2GFN A;  3AQS A;  1BJZ A;  2XPU A;  4D7M A;  1UI6 A;  2Q24 A;  3B6C A;  2FJ1 A;  3BR5 A;  2QWT A;  3V6G A;  2IBD A;  1RPW A;  5K7F A;  2VKV A;  3BR2 A;  4AF5 A;  4HKU A;  2ZCX A;  3NXC A;  2EH3 A;  2XDN A;  2X9D A;  3VVY A;  4M3G A;  2NX4 A;  2Y30 A;  3G1L A;  5IPA A;  3F0C A;  4JYK A;  3LHQ A;  5F27 A;  2JK3 A;  3ZQI A;  3VVZ A;  3HTI A;  4W97 A;  3NPI A;  3WHC A;  2QOP A;  5FKM A;  3VW2 A;  3ZQF A;  5EYR A;  3BNI A;  2WUI A;  5F0F A;  1QVU A;  2OER A;  4M3E A;  4GCL A;  3GZI A;  3BTJ A;  3ON4 A;  2G7S A;  2IEK A;  4I6Z A;  2GEN A;  1U9N A;  4JL3 A;  4X1E A;  3O60 A;  3VP5 A;  4NN1 A;  4I76 A;  2G7G A;  3PM1 A;  2UXO A;  1QVT A;  3BR0 A;  2WGB A;  5DAJ A;  2RHA A;  5K58 A;  4D5C A;  2YVH A;  3Q0V A;  2QKO A;  4B3A A;  4GCT A;  3DEW A;  1VI0 A;  2XPV A;  4XK4 A;  2HKU A;  5FKK A;  3ON2 A;  3EGQ A;  3C07 A;  4V2F A;  2NP3 A;  1JUM A;  2OI8 A;  5H9T A;  3VOK A;  4M3F A;  2I10 A;  5J1U A;  5EZG A;  3B81 A;  3HE0 A;  5F0C A;  3KKD A;  4B1R A;  3BJB A;  2ZB9 A;  4ICH A;  4M3B A;  2FD5 A;  1JUS A;  4AC0 A;  3VIB A;  3NI7 A;  4CGR A;  3IH2 A;  4D5F A;  2IU5 A;  3KZ9 A;  3VPR A;  3JSJ A;  2V57 A;  3ZQH A;  3HGY A;  5IOY A;  3QKX A;  2DTZ A;  3ANP A;  2Y31 A;  3LWJ A;  3COL A;  3HTA A;  2XRL A;  3RH2 A;  2ZCM A;  5EFY A;  4KWA A;  2PZ9 A;  1JT6 A;  3BQY A;  4GCK A;  4G12 A;  1QPI A;  3C2B A;  3IH4 A;  4M3D A;  3RD3 A;  1ZKG A;  3E7Q A;  4YZE A;  3QQA A;  5D1R A;  1JUP A;  4ME9 A;  1Z77 A;  3FK7 A;  3PPB A;  4DW6 A;  3MVP A;  3NRG A;  5FMP A;  4JNN A;  5C4Y A;  1RKW A;  2ID3 A;  2ZOZ A;  3KKC A;  5F04 A;  5D19 A;  3FK6 A;  4MXM A;  2UXP A;  2D6Y A;  2QCO A;  3BCG A;  2TCT A;  3CCY A;  2G7L A;  4D7N A;  2HYJ A;  1T56 A;  2HXI A;  3FRQ A;  3G7R A;  5FGL A;  3WHB A;  3Q3S A;  4ACI A;  2YVE A;  3DCF A;  1A6I A;  1T33 A;  1ZK8 A;  5GPC A;  3Q0W A;  4PXI A;  2REK A;  3SDG A;  3CWR A;  2GUH A;  2UXH A;  3BR1 A;  5CW8 A;  3B6A A;  2RAS A;  1ORK A;  2QTQ A;  1RKT A;  2DG8 A;  3BHQ A;  2OF7 A;  2VPR A;  3BTL A;  2O7T A;  3QPS A;  1Z0X A;  2VKE A;  3CDL A;  2UXU A;  2XPW A;  4NEL A;  2WV1 A;  5EZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...