3GEUA

Crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
189
Chain Sequence
b'SNAMKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion protein R
molecule tags Cell adhesion
source organism Staphylococcus aureus
publication title Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family
rcsb
total genus 75
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3geuA00
1T33A 3O60A 3KKDA 2YVHA 2JJ7A 4M3GA 3VVZA 3BHQA 3PASA 1RPWA 4ME9A 4M3BA 5C4YA 2XPVA 5D19A 2XGCA 2XB5A 3LSPA 1UI6A 4AF5A 2UXUA 2XPUA 3B6CA 3BJBA 3QPSA 5FKNA 3S5RA 3QPLA 3Q3SA 5EZHA 5FGLA 2F07A 3Q0VA 3BCGA 3LSJA 5IP6A 2DTZA 2HKUA 4GCLA 2OERA 3JSJA 2FD5A 2FJ1A 2HYJA 2O7OA 5D1RA 5GPAA 4ACIA 3HTJA 3VUQA 4PXIA 3V78A 3SFIA 4MK6A 1JUPA 2V57A 4M3DA 3DPJA 3T6NA 3RH2A 5GPCA 1JTXA 2ZCXA 1U9NA 4W1UA 3E7QA 2W53A 2OF7A 2WUIA 3HE0A 3HGGA 4D7MA 3EUPA 2WV1A 3LOCA 4AC0A 4D5FA 5K7ZA 3ZQGA 3FK7A 2NP3A 2EH3A 2O7TA 2WGBA 3CRJA 4DW6A 2Q24A 3ZQLA 3COLA 3G1LA 3IH2A 2RAEA 2XGEA 3ZQIA 5GP9A 2RASA 3C2BA 3BTJA 3BR0A 3FK6A 1UI5A 2NS7A 3Q0WA 3NNRA 2HQ5A 5EYRA 3BTCA 3VW1A 2GFNA 2REKA 3BTIA 3VP5A 4GCKA 2G7GA 5K7HA 1Z0XA 2DG7A 3PM1A 3HTAA 3F0CA 1ZK8A 4GCTA 4KWAA 5K7FA 2OI8A 3SDGA 2Y2ZA 2UXHA 2GENA 5F0CA 2G3BA 3Q0UA 5D18A 2G7SA 1JUMA 2VPRA 4B3AA 4XK4A 5CXGA 2FX0A 3NXCA 3NPIA 2ZOYA 4D5CA 3BT9A 2GUHA 5FKMA 3P9TA 3O8HA 4UDSA 1ORKA 5FKKA 2NX4A 4V2GA 3LWJA 3HIMA 4JYKA 3G56A 2Y31A 2FBQA 2QCOA 3ANGA 2HXOA 4ICHA 2TRTA 2DG8A 3CCYA 2QOPA 5IOZA 3BR6A 5IOYA 4AC6A 3WHBA 5FHPA 1JT0A 2D6YA 3G7RA 3HTHA 4MXMA 2XPWA 3HGYA 5FKOA 1RKWA 3VPRA 2ZCNA 5K58A 2IU5A 3NI7A 2QKOA 2X9DA 1ZKGA 3BR2A 3ON2A 4D7NA 5HBUA 3QBMA 3VOKA 3VVYA 1SGMA 1U9OA 2VKVA 3LHQA 3EGQA 1BJZA 2XGDA 3WHCA 3BRUA 2HXIA 1JT6A 2FQ4A 3ZQFA 5DAJA 4CGRA 3NRGA 4X1EA 2VKEA 3AQTA 4GFKA 4I6ZA 3KKCA 2XRLA 2IEKA 2ZCMA 3BQZA 3G1OA 2G7LA 3ON4A 5H9TA 2I10A 4JKZA 4ABZA 3FRQA 3C07A 4GFLA 2HYTA 3QKXA 1JUSA 2PZ9A 1QVUA 3VW0A 4V2FA 2IBDA 3TP3A 4AUXA 2OPTA 5J1UA 2X6OA 3KNWA 3RD3A 5FMPA 1JTYA 5AQCA 5F27A 3IH4A 5CXIA 4M3FA 2ZB9A 5EFYA 2TCTA 4W97A 2QIBA 3V6GA 2UXOA 5CW8A 5F08A 4YZEA 1QVTA 5J3LA 3AQSA 4I76A 3GEUA 2RHAA 3O8GA 3VOXA 2Y30A 4NELA 3B6AA 3BR1A 5FKLA 3LJLA 3MVPA 1A6IA 4MO7A 3CJDA 5EZGA 3PPBA 1RKTA 2NP5A 3TP0A 3MNLA 2NS8A 3FIWA 3DCFA 3BNIA 2JK3A 3B81A 2UXPA 4B1RA 3VIBA 3CWRA 3IH3A 5F1JA 2YVEA 3G1MA 3BR5A 4HKUA 5J1YA 2XDNA 2PBXA 3IUVA 5F0HA 1QPIA 3ANPA 3QQAA 4JNNA 2IAIA 5HAWA 1T56A 2QWTA 3GZIA 4L62A 5F0FA 4NN1A 2ID6A 5F04A 3HTIA 3BQYA 2GBYA 5HSZA 4G12A 3VVXA 1VI0A 3ZQHA 4JL3A 2ZOZA 3BTLA 3CDLA 3KZ9A 3F1BA 5J1RA 3LSRA 1Z77A 2ID3A 2G0EA 2UXIA 3BR3A 2QTQA 3VW2A 3DEWA 5IPAA 4M3EA
chains in the Genus database with same CATH superfamily
1T33A 3O60A 2ZY9A 3KKDA 2YVHA 2JJ7A 4WIBA 4M3GA 3VVZA 3BHQA 3PASA 1RPWA 4ME9A 4M3BA 5C4YA 2XPVA 5D19A 2XGCA 2XB5A 3NS4A 3LSPA 1UI6A 4AF5A 2B3WA 2UXUA 2XPUA 3B6CA 3BJBA 3QPSA 5FKNA 3S5RA 3QPLA 3Q3SA 5EZHA 5FGLA 2F07A 3Q0VA 3BCGA 3LSJA 5IP6A 2DTZA 2HKUA 3SWHA 4GCLA 2OERA 3JSJA 2FD5A 2FJ1A 2HYJA 2O7OA 5D1RA 5GPAA 4ACIA 3HTJA 3VUQA 4PXIA 3V78A 3SFIA 4MK6A 1JUPA 2V57A 3T6NA 4M3DA 3DPJA 3RH2A 2YVXA 5GPCA 1JTXA 2ZCXA 1U9NA 4W1UA 3E7QA 2W53A 2OF7A 2WUIA 2FJI1 2A2FX 3HE0A 3HGGA 4D7MA 3EUPA 2WV1A 3LOCA 4AC0A 4D5FA 5K7ZA 3ZQGA 3FK7A 2NP3A 2EH3A 2O7TA 2WGBA 3CRJA 4DW6A 2Q24A 3ZQLA 3COLA 3G1LA 3IH2A 2RAEA 2XGEA 3ZQIA 5GP9A 2RASA 3C2BA 3BTJA 3BR0A 3FK6A 1UI5A 2NS7A 3Q0WA 3NNRA 3DU6A 2HQ5A 5EYRA 3BTCA 3VW1A 2GFNA 2REKA 3BTIA 3VP5A 4GCKA 2G7GA 5K7HA 1Z0XA 2DG7A 3PM1A 3HTAA 2R7UA 3F0CA 1ZK8A 4GCTA 4KWAA 5K7FA 2OI8A 3SDGA 2Y2ZA 2UXHA 2GENA 5F0CA 2G3BA 3Q0UA 3FHNA 5D18A 2R7TA 2G7SA 1JUMA 2VPRA 4B3AA 4XK4A 5CXGA 2FX0A 3NXCA 3NPIA 4C2MA 4U9LA 2ZOYA 4D5CA 3BT9A 2GUHA 5FKMA 3P9TA 3O8HA 4UDSA 1ORKA 5FKKA 2NX4A 4V2GA 3LWJA 3HIMA 4JYKA 3G56A 2Y31A 2FBQA 2QCOA 3ANGA 2HXOA 4ICHA 2R7OA 2TRTA 2DG8A 3CCYA 2QOPA 5IOZA 3BR6A 5IOYA 4AC6A 3WHBA 5FHPA 1JT0A 2D6YA 3G7RA 3HTHA 4MXMA 2R7VA 2R7WA 2XPWA 3HGYA 5FKOA 1RKWA 3VPRA 2ZCNA 4U9NA 5K58A 2IU5A 3NI7A 2R7SA 2QKOA 2X9DA 1ZKGA 3BR2A 3ON2A 4D7NA 5HBUA 3QBMA 3VOKA 3VVYA 5CQGA 1SGMA 1U9OA 2VKVA 3LHQA 3EGQA 1BJZA 2XGDA 3WHCA 3BRUA 2HXIA 1JT6A 2FQ4A 3ZQFA 5DAJA 4CGRA 3NRGA 4X1EA 3K8PC 2VKEA 3AQTA 4GFKA 4I6ZA 3KKCA 2XRLA 2IEKA 2ZCMA 3BQZA 3G1OA 2G7LA 3ON4A 5H9TA 2R7XA 2I10A 4JKZA 4ABZA 3FRQA 3C07A 4GFLA 4DVYP 2HYTA 3QKXA 1JUSA 2PZ9A 1QVUA 3VW0A 4V2FA 2IBDA 3TP3A 2R7QA 4AUXA 2OPTA 5J1UA 2X6OA 3KNWA 3RD3A 1JTYA 5AQCA 5FMPA 5F27A 3IH4A 5CXIA 4M3FA 2ZB9A 5EFYA 2TCTA 4W97A 2PFVA 2QIBA 3V6GA 2UXOA 5CW8A 5F08A 4YZEA 1QVTA 2R7RA 5J3LA 3AQSA 4I76A 3GEUA 2RHAA 3O8GA 4OD4A 2Y30A 3VOXA 4NELA 3B6AA 3BR1A 5FKLA 3LJLA 3MVPA 3VTIA 1A6IA 4MO7A 3CJDA 5EZGA 3PPBA 1RKTA 2NP5A 3TP0A 3MNLA 2NS8A 3DU5A 3FIWA 3DCFA 3BNIA 2JK3A 3B81A 2UXPA 4B1RA 3VIBA 3CWRA 3IH3A 5F1JA 2YVEA 3G1MA 4IRVA 3BR5A 4HKUA 5J1YA 2XDNA 2PBXA 3IUVA 5F0HA 1QPIA 3ANPA 3QQAA 4JNNA 2IAIA 5HAWA 1T56A 2QWTA 3GZIA 2B1EA 4L62A 5F0FA 4NN1A 2ID6A 5F04A 4OD5A 3HTIA 3BQYA 2GBYA 5HSZA 4G12A 3VVXA 1VI0A 3ZQHA 4JL3A 2ZOZA 3BTLA 3CDLA 3KZ9A 3F1BA 5J1RA 3LSRA 1Z77A 3KYLA 2ID3A 2G0EA 2UXIA 3BR3A 2QTQA 3VW2A 3DEWA 5IPAA 4M3EA
chains in the Genus database with same CATH topology
1T33A 3O60A 3KKDA 2YVHA 2JJ7A 4M3GA 3VVZA 3BHQA 3PASA 1RPWA 4ME9A 4M3BA 5C4YA 2XPVA 5D19A 2XGCA 2XB5A 3LSPA 1UI6A 4AF5A 2UXUA 2XPUA 3B6CA 3BJBA 3QPSA 5FKNA 3S5RA 3QPLA 3Q3SA 5EZHA 5FGLA 2F07A 3Q0VA 3BCGA 3LSJA 5IP6A 2DTZA 2HKUA 4GCLA 2OERA 3JSJA 2FD5A 2FJ1A 2HYJA 2O7OA 5D1RA 5GPAA 4ACIA 3HTJA 3VUQA 4PXIA 3V78A 3SFIA 4MK6A 1JUPA 2V57A 4M3DA 3DPJA 3T6NA 3RH2A 5GPCA 1JTXA 2ZCXA 1U9NA 4W1UA 3E7QA 2W53A 2OF7A 2WUIA 3HE0A 3HGGA 4D7MA 3EUPA 2WV1A 3LOCA 4AC0A 4D5FA 5K7ZA 3ZQGA 3FK7A 2NP3A 2EH3A 2O7TA 2WGBA 3CRJA 4DW6A 2Q24A 3ZQLA 3COLA 3G1LA 3IH2A 2RAEA 2XGEA 3ZQIA 5GP9A 2RASA 3C2BA 3BTJA 3BR0A 3FK6A 1UI5A 2NS7A 3Q0WA 3NNRA 2HQ5A 5EYRA 3BTCA 3VW1A 2GFNA 2REKA 3BTIA 3VP5A 4GCKA 2G7GA 5K7HA 1Z0XA 2DG7A 3PM1A 3HTAA 3F0CA 1ZK8A 4GCTA 4KWAA 5K7FA 2OI8A 3SDGA 2Y2ZA 2UXHA 2GENA 5F0CA 2G3BA 3Q0UA 5D18A 2G7SA 1JUMA 2VPRA 4B3AA 4XK4A 5CXGA 2FX0A 3NXCA 3NPIA 2ZOYA 4D5CA 3BT9A 2GUHA 5FKMA 3P9TA 3O8HA 4UDSA 1ORKA 5FKKA 2NX4A 4V2GA 3LWJA 3HIMA 4JYKA 3G56A 2Y31A 2FBQA 2QCOA 3ANGA 2HXOA 4ICHA 2TRTA 2DG8A 3CCYA 2QOPA 5IOZA 3BR6A 5IOYA 4AC6A 3WHBA 5FHPA 1JT0A 2D6YA 3G7RA 3HTHA 4MXMA 2XPWA 3HGYA 5FKOA 1RKWA 3VPRA 2ZCNA 5K58A 2IU5A 3NI7A 2QKOA 2X9DA 1ZKGA 3BR2A 3ON2A 4D7NA 5HBUA 3QBMA 3VOKA 3VVYA 1SGMA 1U9OA 2VKVA 3LHQA 3EGQA 1BJZA 2XGDA 3WHCA 3BRUA 2HXIA 1JT6A 2FQ4A 3ZQFA 5DAJA 4CGRA 3NRGA 4X1EA 2VKEA 3AQTA 4GFKA 4I6ZA 3KKCA 2XRLA 2IEKA 2ZCMA 3BQZA 3G1OA 2G7LA 3ON4A 5H9TA 2I10A 4JKZA 4ABZA 3FRQA 3C07A 4GFLA 2HYTA 3QKXA 1JUSA 2PZ9A 1QVUA 3VW0A 4V2FA 2IBDA 3TP3A 4AUXA 2OPTA 5J1UA 2X6OA 3KNWA 3RD3A 5FMPA 1JTYA 5AQCA 5F27A 3IH4A 5CXIA 4M3FA 2ZB9A 5EFYA 2TCTA 4W97A 2QIBA 3V6GA 2UXOA 5CW8A 5F08A 4YZEA 1QVTA 5J3LA 3AQSA 4I76A 3GEUA 2RHAA 3O8GA 3VOXA 2Y30A 4NELA 3B6AA 3BR1A 5FKLA 3LJLA 3MVPA 1A6IA 4MO7A 3CJDA 5EZGA 3PPBA 1RKTA 2NP5A 3TP0A 3MNLA 2NS8A 3FIWA 3DCFA 3BNIA 2JK3A 3B81A 2UXPA 4B1RA 3VIBA 3CWRA 3IH3A 5F1JA 2YVEA 3G1MA 3BR5A 4HKUA 5J1YA 2XDNA 2PBXA 3IUVA 5F0HA 1QPIA 3ANPA 3QQAA 4JNNA 2IAIA 5HAWA 1T56A 2QWTA 3GZIA 4L62A 5F0FA 4NN1A 2ID6A 5F04A 3HTIA 3BQYA 2GBYA 5HSZA 4G12A 3VVXA 1VI0A 3ZQHA 4JL3A 2ZOZA 3BTLA 3CDLA 3KZ9A 3F1BA 5J1RA 3LSRA 1Z77A 2ID3A 2G0EA 2UXIA 3BR3A 2QTQA 3VW2A 3DEWA 5IPAA 4M3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T33 A;  3O60 A;  3KKD A;  2YVH A;  2JJ7 A;  4M3G A;  3VVZ A;  3BHQ A;  3PAS A;  1RPW A;  4ME9 A;  4M3B A;  5C4Y A;  2XPV A;  5D19 A;  2XGC A;  2XB5 A;  3LSP A;  1UI6 A;  4AF5 A;  2UXU A;  2XPU A;  3B6C A;  3BJB A;  3QPS A;  5FKN A;  3S5R A;  3QPL A;  3Q3S A;  5EZH A;  5FGL A;  2F07 A;  3Q0V A;  3BCG A;  3LSJ A;  5IP6 A;  2DTZ A;  2HKU A;  4GCL A;  2OER A;  3JSJ A;  2FD5 A;  2FJ1 A;  2HYJ A;  2O7O A;  5D1R A;  5GPA A;  4ACI A;  3HTJ A;  3VUQ A;  4PXI A;  3V78 A;  3SFI A;  4MK6 A;  1JUP A;  2V57 A;  4M3D A;  3DPJ A;  3T6N A;  3RH2 A;  5GPC A;  1JTX A;  2ZCX A;  1U9N A;  4W1U A;  3E7Q A;  2W53 A;  2OF7 A;  2WUI A;  3HE0 A;  3HGG A;  4D7M A;  3EUP A;  2WV1 A;  3LOC A;  4AC0 A;  4D5F A;  5K7Z A;  3ZQG A;  3FK7 A;  2NP3 A;  2EH3 A;  2O7T A;  2WGB A;  3CRJ A;  4DW6 A;  2Q24 A;  3ZQL A;  3COL A;  3G1L A;  3IH2 A;  2RAE A;  2XGE A;  3ZQI A;  5GP9 A;  2RAS A;  3C2B A;  3BTJ A;  3BR0 A;  3FK6 A;  1UI5 A;  2NS7 A;  3Q0W A;  3NNR A;  2HQ5 A;  5EYR A;  3BTC A;  3VW1 A;  2GFN A;  2REK A;  3BTI A;  3VP5 A;  4GCK A;  2G7G A;  5K7H A;  1Z0X A;  2DG7 A;  3PM1 A;  3HTA A;  3F0C A;  1ZK8 A;  4GCT A;  4KWA A;  5K7F A;  2OI8 A;  3SDG A;  2Y2Z A;  2UXH A;  2GEN A;  5F0C A;  2G3B A;  3Q0U A;  5D18 A;  2G7S A;  1JUM A;  2VPR A;  4B3A A;  4XK4 A;  5CXG A;  2FX0 A;  3NXC A;  3NPI A;  2ZOY A;  4D5C A;  3BT9 A;  2GUH A;  5FKM A;  3P9T A;  3O8H A;  4UDS A;  1ORK A;  5FKK A;  2NX4 A;  4V2G A;  3LWJ A;  3HIM A;  4JYK A;  3G56 A;  2Y31 A;  2FBQ A;  2QCO A;  3ANG A;  2HXO A;  4ICH A;  2TRT A;  2DG8 A;  3CCY A;  2QOP A;  5IOZ A;  3BR6 A;  5IOY A;  4AC6 A;  3WHB A;  5FHP A;  1JT0 A;  2D6Y A;  3G7R A;  3HTH A;  4MXM A;  2XPW A;  3HGY A;  5FKO A;  1RKW A;  3VPR A;  2ZCN A;  5K58 A;  2IU5 A;  3NI7 A;  2QKO A;  2X9D A;  1ZKG A;  3BR2 A;  3ON2 A;  4D7N A;  5HBU A;  3QBM A;  3VOK A;  3VVY A;  1SGM A;  1U9O A;  2VKV A;  3LHQ A;  3EGQ A;  1BJZ A;  2XGD A;  3WHC A;  3BRU A;  2HXI A;  1JT6 A;  2FQ4 A;  3ZQF A;  5DAJ A;  4CGR A;  3NRG A;  4X1E A;  2VKE A;  3AQT A;  4GFK A;  4I6Z A;  3KKC A;  2XRL A;  2IEK A;  2ZCM A;  3BQZ A;  3G1O A;  2G7L A;  3ON4 A;  5H9T A;  2I10 A;  4JKZ A;  4ABZ A;  3FRQ A;  3C07 A;  4GFL A;  2HYT A;  3QKX A;  1JUS A;  2PZ9 A;  1QVU A;  3VW0 A;  4V2F A;  2IBD A;  3TP3 A;  4AUX A;  2OPT A;  5J1U A;  2X6O A;  3KNW A;  3RD3 A;  5FMP A;  1JTY A;  5AQC A;  5F27 A;  3IH4 A;  5CXI A;  4M3F A;  2ZB9 A;  5EFY A;  2TCT A;  4W97 A;  2QIB A;  3V6G A;  2UXO A;  5CW8 A;  5F08 A;  4YZE A;  1QVT A;  5J3L A;  3AQS A;  4I76 A;  3GEU A;  2RHA A;  3O8G A;  3VOX A;  2Y30 A;  4NEL A;  3B6A A;  3BR1 A;  5FKL A;  3LJL A;  3MVP A;  1A6I A;  4MO7 A;  3CJD A;  5EZG A;  3PPB A;  1RKT A;  2NP5 A;  3TP0 A;  3MNL A;  2NS8 A;  3FIW A;  3DCF A;  3BNI A;  2JK3 A;  3B81 A;  2UXP A;  4B1R A;  3VIB A;  3CWR A;  3IH3 A;  5F1J A;  2YVE A;  3G1M A;  3BR5 A;  4HKU A;  5J1Y A;  2XDN A;  2PBX A;  3IUV A;  5F0H A;  1QPI A;  3ANP A;  3QQA A;  4JNN A;  2IAI A;  5HAW A;  1T56 A;  2QWT A;  3GZI A;  4L62 A;  5F0F A;  4NN1 A;  2ID6 A;  5F04 A;  3HTI A;  3BQY A;  2GBY A;  5HSZ A;  4G12 A;  3VVX A;  1VI0 A;  3ZQH A;  4JL3 A;  2ZOZ A;  3BTL A;  3CDL A;  3KZ9 A;  3F1B A;  5J1R A;  3LSR A;  1Z77 A;  2ID3 A;  2G0E A;  2UXI A;  3BR3 A;  2QTQ A;  3VW2 A;  3DEW A;  5IPA A;  4M3E A; 
#chains in the Genus database with same CATH topology
 1T33 A;  3O60 A;  2ZY9 A;  3KKD A;  2YVH A;  2JJ7 A;  4WIB A;  4M3G A;  3VVZ A;  3BHQ A;  3PAS A;  1RPW A;  4ME9 A;  4M3B A;  5C4Y A;  2XPV A;  5D19 A;  2XGC A;  2XB5 A;  3NS4 A;  3LSP A;  1UI6 A;  4AF5 A;  2B3W A;  2UXU A;  2XPU A;  3B6C A;  3BJB A;  3QPS A;  5FKN A;  3S5R A;  3QPL A;  3Q3S A;  5EZH A;  5FGL A;  2F07 A;  3Q0V A;  3BCG A;  3LSJ A;  5IP6 A;  2DTZ A;  2HKU A;  3SWH A;  4GCL A;  2OER A;  3JSJ A;  2FD5 A;  2FJ1 A;  2HYJ A;  2O7O A;  5D1R A;  5GPA A;  4ACI A;  3HTJ A;  3VUQ A;  4PXI A;  3V78 A;  3SFI A;  4MK6 A;  1JUP A;  2V57 A;  3T6N A;  4M3D A;  3DPJ A;  3RH2 A;  2YVX A;  5GPC A;  1JTX A;  2ZCX A;  1U9N A;  4W1U A;  3E7Q A;  2W53 A;  2OF7 A;  2WUI A;  2FJI 1;  2A2F X;  3HE0 A;  3HGG A;  4D7M A;  3EUP A;  2WV1 A;  3LOC A;  4AC0 A;  4D5F A;  5K7Z A;  3ZQG A;  3FK7 A;  2NP3 A;  2EH3 A;  2O7T A;  2WGB A;  3CRJ A;  4DW6 A;  2Q24 A;  3ZQL A;  3COL A;  3G1L A;  3IH2 A;  2RAE A;  2XGE A;  3ZQI A;  5GP9 A;  2RAS A;  3C2B A;  3BTJ A;  3BR0 A;  3FK6 A;  1UI5 A;  2NS7 A;  3Q0W A;  3NNR A;  3DU6 A;  2HQ5 A;  5EYR A;  3BTC A;  3VW1 A;  2GFN A;  2REK A;  3BTI A;  3VP5 A;  4GCK A;  2G7G A;  5K7H A;  1Z0X A;  2DG7 A;  3PM1 A;  3HTA A;  2R7U A;  3F0C A;  1ZK8 A;  4GCT A;  4KWA A;  5K7F A;  2OI8 A;  3SDG A;  2Y2Z A;  2UXH A;  2GEN A;  5F0C A;  2G3B A;  3Q0U A;  3FHN A;  5D18 A;  2R7T A;  2G7S A;  1JUM A;  2VPR A;  4B3A A;  4XK4 A;  5CXG A;  2FX0 A;  3NXC A;  3NPI A;  4C2M A;  4U9L A;  2ZOY A;  4D5C A;  3BT9 A;  2GUH A;  5FKM A;  3P9T A;  3O8H A;  4UDS A;  1ORK A;  5FKK A;  2NX4 A;  4V2G A;  3LWJ A;  3HIM A;  4JYK A;  3G56 A;  2Y31 A;  2FBQ A;  2QCO A;  3ANG A;  2HXO A;  4ICH A;  2R7O A;  2TRT A;  2DG8 A;  3CCY A;  2QOP A;  5IOZ A;  3BR6 A;  5IOY A;  4AC6 A;  3WHB A;  5FHP A;  1JT0 A;  2D6Y A;  3G7R A;  3HTH A;  4MXM A;  2R7V A;  2R7W A;  2XPW A;  3HGY A;  5FKO A;  1RKW A;  3VPR A;  2ZCN A;  4U9N A;  5K58 A;  2IU5 A;  3NI7 A;  2R7S A;  2QKO A;  2X9D A;  1ZKG A;  3BR2 A;  3ON2 A;  4D7N A;  5HBU A;  3QBM A;  3VOK A;  3VVY A;  5CQG A;  1SGM A;  1U9O A;  2VKV A;  3LHQ A;  3EGQ A;  1BJZ A;  2XGD A;  3WHC A;  3BRU A;  2HXI A;  1JT6 A;  2FQ4 A;  3ZQF A;  5DAJ A;  4CGR A;  3NRG A;  4X1E A;  3K8P C;  2VKE A;  3AQT A;  4GFK A;  4I6Z A;  3KKC A;  2XRL A;  2IEK A;  2ZCM A;  3BQZ A;  3G1O A;  2G7L A;  3ON4 A;  5H9T A;  2R7X A;  2I10 A;  4JKZ A;  4ABZ A;  3FRQ A;  3C07 A;  4GFL A;  4DVY P;  2HYT A;  3QKX A;  1JUS A;  2PZ9 A;  1QVU A;  3VW0 A;  4V2F A;  2IBD A;  3TP3 A;  2R7Q A;  4AUX A;  2OPT A;  5J1U A;  2X6O A;  3KNW A;  3RD3 A;  1JTY A;  5AQC A;  5FMP A;  5F27 A;  3IH4 A;  5CXI A;  4M3F A;  2ZB9 A;  5EFY A;  2TCT A;  4W97 A;  2PFV A;  2QIB A;  3V6G A;  2UXO A;  5CW8 A;  5F08 A;  4YZE A;  1QVT A;  2R7R A;  5J3L A;  3AQS A;  4I76 A;  3GEU A;  2RHA A;  3O8G A;  4OD4 A;  2Y30 A;  3VOX A;  4NEL A;  3B6A A;  3BR1 A;  5FKL A;  3LJL A;  3MVP A;  3VTI A;  1A6I A;  4MO7 A;  3CJD A;  5EZG A;  3PPB A;  1RKT A;  2NP5 A;  3TP0 A;  3MNL A;  2NS8 A;  3DU5 A;  3FIW A;  3DCF A;  3BNI A;  2JK3 A;  3B81 A;  2UXP A;  4B1R A;  3VIB A;  3CWR A;  3IH3 A;  5F1J A;  2YVE A;  3G1M A;  4IRV A;  3BR5 A;  4HKU A;  5J1Y A;  2XDN A;  2PBX A;  3IUV A;  5F0H A;  1QPI A;  3ANP A;  3QQA A;  4JNN A;  2IAI A;  5HAW A;  1T56 A;  2QWT A;  3GZI A;  2B1E A;  4L62 A;  5F0F A;  4NN1 A;  2ID6 A;  5F04 A;  4OD5 A;  3HTI A;  3BQY A;  2GBY A;  5HSZ A;  4G12 A;  3VVX A;  1VI0 A;  3ZQH A;  4JL3 A;  2ZOZ A;  3BTL A;  3CDL A;  3KZ9 A;  3F1B A;  5J1R A;  3LSR A;  1Z77 A;  3KYL A;  2ID3 A;  2G0E A;  2UXI A;  3BR3 A;  2QTQ A;  3VW2 A;  3DEW A;  5IPA A;  4M3E A; 
#chains in the Genus database with same CATH homology
 1T33 A;  3O60 A;  3KKD A;  2YVH A;  2JJ7 A;  4M3G A;  3VVZ A;  3BHQ A;  3PAS A;  1RPW A;  4ME9 A;  4M3B A;  5C4Y A;  2XPV A;  5D19 A;  2XGC A;  2XB5 A;  3LSP A;  1UI6 A;  4AF5 A;  2UXU A;  2XPU A;  3B6C A;  3BJB A;  3QPS A;  5FKN A;  3S5R A;  3QPL A;  3Q3S A;  5EZH A;  5FGL A;  2F07 A;  3Q0V A;  3BCG A;  3LSJ A;  5IP6 A;  2DTZ A;  2HKU A;  4GCL A;  2OER A;  3JSJ A;  2FD5 A;  2FJ1 A;  2HYJ A;  2O7O A;  5D1R A;  5GPA A;  4ACI A;  3HTJ A;  3VUQ A;  4PXI A;  3V78 A;  3SFI A;  4MK6 A;  1JUP A;  2V57 A;  4M3D A;  3DPJ A;  3T6N A;  3RH2 A;  5GPC A;  1JTX A;  2ZCX A;  1U9N A;  4W1U A;  3E7Q A;  2W53 A;  2OF7 A;  2WUI A;  3HE0 A;  3HGG A;  4D7M A;  3EUP A;  2WV1 A;  3LOC A;  4AC0 A;  4D5F A;  5K7Z A;  3ZQG A;  3FK7 A;  2NP3 A;  2EH3 A;  2O7T A;  2WGB A;  3CRJ A;  4DW6 A;  2Q24 A;  3ZQL A;  3COL A;  3G1L A;  3IH2 A;  2RAE A;  2XGE A;  3ZQI A;  5GP9 A;  2RAS A;  3C2B A;  3BTJ A;  3BR0 A;  3FK6 A;  1UI5 A;  2NS7 A;  3Q0W A;  3NNR A;  2HQ5 A;  5EYR A;  3BTC A;  3VW1 A;  2GFN A;  2REK A;  3BTI A;  3VP5 A;  4GCK A;  2G7G A;  5K7H A;  1Z0X A;  2DG7 A;  3PM1 A;  3HTA A;  3F0C A;  1ZK8 A;  4GCT A;  4KWA A;  5K7F A;  2OI8 A;  3SDG A;  2Y2Z A;  2UXH A;  2GEN A;  5F0C A;  2G3B A;  3Q0U A;  5D18 A;  2G7S A;  1JUM A;  2VPR A;  4B3A A;  4XK4 A;  5CXG A;  2FX0 A;  3NXC A;  3NPI A;  2ZOY A;  4D5C A;  3BT9 A;  2GUH A;  5FKM A;  3P9T A;  3O8H A;  4UDS A;  1ORK A;  5FKK A;  2NX4 A;  4V2G A;  3LWJ A;  3HIM A;  4JYK A;  3G56 A;  2Y31 A;  2FBQ A;  2QCO A;  3ANG A;  2HXO A;  4ICH A;  2TRT A;  2DG8 A;  3CCY A;  2QOP A;  5IOZ A;  3BR6 A;  5IOY A;  4AC6 A;  3WHB A;  5FHP A;  1JT0 A;  2D6Y A;  3G7R A;  3HTH A;  4MXM A;  2XPW A;  3HGY A;  5FKO A;  1RKW A;  3VPR A;  2ZCN A;  5K58 A;  2IU5 A;  3NI7 A;  2QKO A;  2X9D A;  1ZKG A;  3BR2 A;  3ON2 A;  4D7N A;  5HBU A;  3QBM A;  3VOK A;  3VVY A;  1SGM A;  1U9O A;  2VKV A;  3LHQ A;  3EGQ A;  1BJZ A;  2XGD A;  3WHC A;  3BRU A;  2HXI A;  1JT6 A;  2FQ4 A;  3ZQF A;  5DAJ A;  4CGR A;  3NRG A;  4X1E A;  2VKE A;  3AQT A;  4GFK A;  4I6Z A;  3KKC A;  2XRL A;  2IEK A;  2ZCM A;  3BQZ A;  3G1O A;  2G7L A;  3ON4 A;  5H9T A;  2I10 A;  4JKZ A;  4ABZ A;  3FRQ A;  3C07 A;  4GFL A;  2HYT A;  3QKX A;  1JUS A;  2PZ9 A;  1QVU A;  3VW0 A;  4V2F A;  2IBD A;  3TP3 A;  4AUX A;  2OPT A;  5J1U A;  2X6O A;  3KNW A;  3RD3 A;  5FMP A;  1JTY A;  5AQC A;  5F27 A;  3IH4 A;  5CXI A;  4M3F A;  2ZB9 A;  5EFY A;  2TCT A;  4W97 A;  2QIB A;  3V6G A;  2UXO A;  5CW8 A;  5F08 A;  4YZE A;  1QVT A;  5J3L A;  3AQS A;  4I76 A;  3GEU A;  2RHA A;  3O8G A;  3VOX A;  2Y30 A;  4NEL A;  3B6A A;  3BR1 A;  5FKL A;  3LJL A;  3MVP A;  1A6I A;  4MO7 A;  3CJD A;  5EZG A;  3PPB A;  1RKT A;  2NP5 A;  3TP0 A;  3MNL A;  2NS8 A;  3FIW A;  3DCF A;  3BNI A;  2JK3 A;  3B81 A;  2UXP A;  4B1R A;  3VIB A;  3CWR A;  3IH3 A;  5F1J A;  2YVE A;  3G1M A;  3BR5 A;  4HKU A;  5J1Y A;  2XDN A;  2PBX A;  3IUV A;  5F0H A;  1QPI A;  3ANP A;  3QQA A;  4JNN A;  2IAI A;  5HAW A;  1T56 A;  2QWT A;  3GZI A;  4L62 A;  5F0F A;  4NN1 A;  2ID6 A;  5F04 A;  3HTI A;  3BQY A;  2GBY A;  5HSZ A;  4G12 A;  3VVX A;  1VI0 A;  3ZQH A;  4JL3 A;  2ZOZ A;  3BTL A;  3CDL A;  3KZ9 A;  3F1B A;  5J1R A;  3LSR A;  1Z77 A;  2ID3 A;  2G0E A;  2UXI A;  3BR3 A;  2QTQ A;  3VW2 A;  3DEW A;  5IPA A;  4M3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...