3GEUA

Crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
189
Chain Sequence
SNAMKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords Intercellular adhesion protein R
total genus 75
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3geuA00
3G1LA 3BNIA 3VP5A 2WGBA 2QIBA 3CRJA 3BTIA 3C2BA 3FK7A 2FD5A 3C07A 4GCTA 3DPJA 3QPSA 2NX4A 1UI6A 4JYKA 2D6YA 3QBMA 1JUMA 1A6IA 4ICHA 3BTCA 2ID6A 5J1UA 2VPRA 3KKDA 3VVXA 3NPIA 3IH2A 1JT0A 5FKLA 2V57A 3SFIA 5FKOA 4W1UA 4X1EA 4I76A 3ON2A 3ANGA 5EYRA 5EZHA 2ZCMA 2RHAA 5F0FA 1Z0XA 5GPCA 3CDLA 3NNRA 3QKXA 3NRGA 5EFYA 1ZK8A 4V2FA 4YZEA 3ZQHA 3BCGA 2XRLA 2GBYA 3BRUA 3LWJA 4M3BA 3MNLA 4HKUA 4D7MA 4L62A 2X9DA 2ZCNA 4B3AA 2ZOYA 5D19A 3CJDA 3LSPA 2GFNA 3TP3A 3VW0A 5F08A 2QCOA 3COLA 4JKZA 3IH3A 4M3DA 3TP0A 2QOPA 2UXOA 3HIMA 3BTLA 4B1RA 2HKUA 2UXPA 2X6OA 2XGCA 3HGYA 3VIBA 2VKEA 4M3FA 3Q0UA 5FGLA 3GZIA 3LJLA 5K7HA 2I10A 4PXIA 4D5CA 2PBXA 5IPAA 2REKA 3VW1A 4GFKA 5GP9A 2ID3A 3PASA 2ZB9A 3BJBA 4NN1A 3V78A 3LOCA 5F27A 4JNNA 5FMPA 2G7GA 5CXGA 4GFLA 3VOXA 3AQTA 3G1MA 2XB5A 2NP3A 4GCKA 3BQYA 3G1OA 3S5RA 3IUVA 5FKKA 2ZOZA 3BR0A 3F0CA 3HTHA 4UDSA 5HSZA 3QPLA 1UI5A 2HYTA 2G7SA 4M3EA 5EZGA 4DW6A 2OF7A 3ON4A 2IU5A 4G12A 4AF5A 2OERA 2XPUA 2UXHA 3ZQLA 2O7TA 4CGRA 2YVHA 2XPWA 3FIWA 2Q24A 2WV1A 4GCLA 2IEKA 2HYJA 5HBUA 5J1RA 4MXMA 3KKCA 5K7FA 3VVYA 3CWRA 3BR6A 5AQCA 1RKTA 2JJ7A 3DCFA 4AC6A 5K58A 2ZCXA 3IH4A 5J1YA 5K7ZA 4W97A 5HAWA 2VKVA 4M3GA 3NI7A 5FHPA 3LSRA 2HQ5A 3BR3A 2QKOA 3BR1A 3T6NA 2TCTA 2WUIA 3EGQA 1ORKA 2IAIA 3BTJA 3FRQA 4JL3A 2NS8A 4D7NA 3E7QA 1U9NA 2XGDA 4ACIA 3FK6A 3O8HA 2XGEA 3WHBA 5D18A 3GEUA 3B6AA 3SDGA 2QWTA 3DEWA 3G56A 3CCYA 3VPRA 1QPIA 1JUPA 3LSJA 2JK3A 2GENA 5D1RA 3AQSA 5DAJA 4AUXA 1RPWA 2GUHA 5C4YA 3F1BA 2QTQA 3V6GA 3B6CA 3JSJA 5F0CA 2UXIA 4XK4A 3EUPA 4MO7A 4I6ZA 2RASA 2PZ9A 2W53A 3QQAA 5FKNA 4AC0A 5CW8A 5F1JA 1JTYA 3ANPA 4V2GA 2YVEA 2O7OA 3VW2A 2DG8A 3MVPA 1Z77A 2UXUA 3RD3A 4ABZA 1JT6A 5FKMA 3Q0WA 5F04A 3KZ9A 2XDNA 3BR5A 2G3BA 3BT9A 2EH3A 2HXOA 5GPAA 4ME9A 2G0EA 5IOZA 2Y2ZA 1VI0A 2NS7A 2OI8A 2FBQA 2XPVA 2TRTA 3HGGA 2NP5A 2FJ1A 3ZQGA 3LHQA 5IOYA 3BQZA 1U9OA 3VUQA 2G7LA 2IBDA 2Y30A 3B81A 3G7RA 3O60A 1RKWA 3PM1A 3WHCA 2FX0A 3Q3SA 3RH2A 3HE0A 4D5FA 1QVUA 3HTJA 5CXIA 5H9TA 3HTAA 5F0HA 3ZQIA 1ZKGA 3NXCA 2F07A 3P9TA 5IP6A 4MK6A 3PPBA 3ZQFA 3HTIA 2Y31A 2DTZA 4KWAA 1SGMA 3KNWA 1JTXA 1BJZA 2FQ4A 3VOKA 1QVTA 3BHQA 2DG7A 2OPTA 3BR2A 1JUSA 1T33A 5J3LA 1T56A 2HXIA 4NELA 3VVZA 3Q0VA 3O8GA 2RAEA
chains in the Genus database with same CATH superfamily
3G1LA 3BNIA 3VP5A 2WGBA 2QIBA 3CRJA 3BTIA 3C2BA 3FK7A 2FD5A 3C07A 4GCTA 3NS4A 3DPJA 3QPSA 2NX4A 1UI6A 4JYKA 2D6YA 3QBMA 1JUMA 1A6IA 4ICHA 2R7OA 3BTCA 2ID6A 5J1UA 2VPRA 3KKDA 3VVXA 3NPIA 3IH2A 1JT0A 5FKLA 2V57A 3SFIA 5FKOA 4W1UA 4X1EA 4I76A 2R7UA 3ON2A 3ANGA 5EYRA 5EZHA 2YVXA 2ZCMA 2RHAA 5F0FA 1Z0XA 3VTIA 5GPCA 3CDLA 3NNRA 3QKXA 4OD4A 3NRGA 5EFYA 1ZK8A 4V2FA 4YZEA 3ZQHA 3BCGA 2XRLA 2GBYA 3BRUA 3LWJA 4M3BA 2R7RA 3MNLA 4HKUA 4D7MA 4L62A 2X9DA 2ZCNA 2B1EA 4B3AA 2ZOYA 5D19A 3CJDA 3LSPA 2GFNA 3TP3A 3VW0A 2FJI1 5F08A 2QCOA 3COLA 4JKZA 3IH3A 4M3DA 3TP0A 2QOPA 2UXOA 3HIMA 3BTLA 4B1RA 2HKUA 2UXPA 2X6OA 4IRVA 2XGCA 3HGYA 2R7TA 3VIBA 2VKEA 4M3FA 4U9NA 3Q0UA 5FGLA 3K8PC 3GZIA 3LJLA 5K7HA 2I10A 4PXIA 4D5CA 2PBXA 5IPAA 2REKA 3VW1A 4GFKA 5GP9A 2ID3A 3PASA 2ZB9A 3BJBA 4NN1A 3V78A 3LOCA 5F27A 4JNNA 5FMPA 2G7GA 5CXGA 4GFLA 3VOXA 3AQTA 3G1MA 2XB5A 2NP3A 4GCKA 3BQYA 3G1OA 3S5RA 3IUVA 5FKKA 2ZOZA 3BR0A 3F0CA 3HTHA 4UDSA 5HSZA 3QPLA 2PFVA 4DVYP 1UI5A 2HYTA 2G7SA 4M3EA 5EZGA 4DW6A 2OF7A 3ON4A 2IU5A 4G12A 4AF5A 2OERA 2XPUA 2UXHA 3ZQLA 2O7TA 4CGRA 2XPWA 3FIWA 2YVHA 2Q24A 2WV1A 4GCLA 2A2FX 2R7XA 2IEKA 2HYJA 5HBUA 5J1RA 4MXMA 3KKCA 3FHNA 5K7FA 3VVYA 3CWRA 3BR6A 5AQCA 1RKTA 2JJ7A 3DCFA 4AC6A 5K58A 2ZCXA 3IH4A 5J1YA 5K7ZA 4W97A 5HAWA 2VKVA 4M3GA 3NI7A 5FHPA 3LSRA 2HQ5A 3BR3A 2QKOA 3BR1A 3T6NA 2TCTA 2WUIA 4WIBA 3EGQA 1ORKA 4U9LA 2IAIA 3BTJA 3FRQA 4JL3A 2NS8A 4D7NA 3E7QA 1U9NA 2XGDA 4ACIA 3FK6A 3O8HA 2XGEA 3WHBA 5D18A 3GEUA 3B6AA 3SDGA 2QWTA 3DEWA 3G56A 3CCYA 3VPRA 3SWHA 3DU6A 1QPIA 1JUPA 3LSJA 4OD5A 2JK3A 2GENA 5D1RA 3AQSA 5DAJA 4AUXA 1RPWA 2GUHA 5C4YA 2R7VA 3F1BA 2QTQA 3V6GA 3B6CA 3JSJA 5F0CA 2UXIA 4XK4A 3EUPA 4MO7A 4I6ZA 2RASA 2R7QA 2PZ9A 2W53A 3QQAA 5FKNA 4AC0A 5CW8A 5F1JA 1JTYA 3ANPA 4V2GA 2R7SA 5CQGA 2YVEA 2O7OA 3VW2A 2DG8A 3MVPA 1Z77A 2UXUA 3RD3A 4ABZA 1JT6A 4C2MA 5FKMA 3Q0WA 5F04A 3KZ9A 2XDNA 3BR5A 2G3BA 2ZY9A 3BT9A 2EH3A 2HXOA 5GPAA 4ME9A 2G0EA 5IOZA 2Y2ZA 1VI0A 2NS7A 2OI8A 2FBQA 2XPVA 2TRTA 3HGGA 2NP5A 2FJ1A 3ZQGA 3LHQA 5IOYA 3BQZA 1U9OA 3VUQA 2G7LA 2B3WA 2IBDA 2Y30A 3B81A 3G7RA 3O60A 1RKWA 3PM1A 3WHCA 2FX0A 3Q3SA 3RH2A 3HE0A 4D5FA 1QVUA 3HTJA 5CXIA 5H9TA 3HTAA 5F0HA 3ZQIA 1ZKGA 3NXCA 2F07A 3P9TA 5IP6A 4MK6A 3PPBA 3ZQFA 3HTIA 2Y31A 2DTZA 4KWAA 1SGMA 3KNWA 1JTXA 1BJZA 2FQ4A 3VOKA 1QVTA 3BHQA 2DG7A 2OPTA 3BR2A 1JUSA 3DU5A 1T33A 5J3LA 1T56A 2HXIA 3KYLA 4NELA 3VVZA 3Q0VA 3O8GA 2RAEA 2R7WA
chains in the Genus database with same CATH topology
3G1LA 3BNIA 3VP5A 2WGBA 2QIBA 3CRJA 3BTIA 3C2BA 3FK7A 2FD5A 3C07A 4GCTA 3DPJA 3QPSA 2NX4A 1UI6A 4JYKA 2D6YA 3QBMA 1JUMA 1A6IA 4ICHA 3BTCA 2ID6A 5J1UA 2VPRA 3KKDA 3VVXA 3NPIA 3IH2A 1JT0A 5FKLA 2V57A 3SFIA 5FKOA 4W1UA 4X1EA 4I76A 3ON2A 3ANGA 5EYRA 5EZHA 2ZCMA 2RHAA 5F0FA 1Z0XA 5GPCA 3CDLA 3NNRA 3QKXA 3NRGA 5EFYA 1ZK8A 4V2FA 4YZEA 3ZQHA 3BCGA 2XRLA 2GBYA 3BRUA 3LWJA 4M3BA 3MNLA 4HKUA 4D7MA 4L62A 2X9DA 2ZCNA 4B3AA 2ZOYA 5D19A 3CJDA 3LSPA 2GFNA 3TP3A 3VW0A 5F08A 2QCOA 3COLA 4JKZA 3IH3A 4M3DA 3TP0A 2QOPA 2UXOA 3HIMA 3BTLA 4B1RA 2HKUA 2UXPA 2X6OA 2XGCA 3HGYA 3VIBA 2VKEA 4M3FA 3Q0UA 5FGLA 3GZIA 3LJLA 5K7HA 2I10A 4PXIA 4D5CA 2PBXA 5IPAA 2REKA 3VW1A 4GFKA 5GP9A 2ID3A 3PASA 2ZB9A 3BJBA 4NN1A 3V78A 3LOCA 5F27A 4JNNA 5FMPA 2G7GA 5CXGA 4GFLA 3VOXA 3AQTA 3G1MA 2XB5A 2NP3A 4GCKA 3BQYA 3G1OA 3S5RA 3IUVA 5FKKA 2ZOZA 3BR0A 3F0CA 3HTHA 4UDSA 5HSZA 3QPLA 1UI5A 2HYTA 2G7SA 4M3EA 5EZGA 4DW6A 2OF7A 3ON4A 2IU5A 4G12A 4AF5A 2OERA 2XPUA 2UXHA 3ZQLA 2O7TA 4CGRA 2YVHA 2XPWA 3FIWA 2Q24A 2WV1A 4GCLA 2IEKA 2HYJA 5HBUA 5J1RA 4MXMA 3KKCA 5K7FA 3VVYA 3CWRA 3BR6A 5AQCA 1RKTA 2JJ7A 3DCFA 4AC6A 5K58A 2ZCXA 3IH4A 5J1YA 5K7ZA 4W97A 5HAWA 2VKVA 4M3GA 3NI7A 5FHPA 3LSRA 2HQ5A 3BR3A 2QKOA 3BR1A 3T6NA 2TCTA 2WUIA 3EGQA 1ORKA 2IAIA 3BTJA 3FRQA 4JL3A 2NS8A 4D7NA 3E7QA 1U9NA 2XGDA 4ACIA 3FK6A 3O8HA 2XGEA 3WHBA 5D18A 3GEUA 3B6AA 3SDGA 2QWTA 3DEWA 3G56A 3CCYA 3VPRA 1QPIA 1JUPA 3LSJA 2JK3A 2GENA 5D1RA 3AQSA 5DAJA 4AUXA 1RPWA 2GUHA 5C4YA 3F1BA 2QTQA 3V6GA 3B6CA 3JSJA 5F0CA 2UXIA 4XK4A 3EUPA 4MO7A 4I6ZA 2RASA 2PZ9A 2W53A 3QQAA 5FKNA 4AC0A 5CW8A 5F1JA 1JTYA 3ANPA 4V2GA 2YVEA 2O7OA 3VW2A 2DG8A 3MVPA 1Z77A 2UXUA 3RD3A 4ABZA 1JT6A 5FKMA 3Q0WA 5F04A 3KZ9A 2XDNA 3BR5A 2G3BA 3BT9A 2EH3A 2HXOA 5GPAA 4ME9A 2G0EA 5IOZA 2Y2ZA 1VI0A 2NS7A 2OI8A 2FBQA 2XPVA 2TRTA 3HGGA 2NP5A 2FJ1A 3ZQGA 3LHQA 5IOYA 3BQZA 1U9OA 3VUQA 2G7LA 2IBDA 2Y30A 3B81A 3G7RA 3O60A 1RKWA 3PM1A 3WHCA 2FX0A 3Q3SA 3RH2A 3HE0A 4D5FA 1QVUA 3HTJA 5CXIA 5H9TA 3HTAA 5F0HA 3ZQIA 1ZKGA 3NXCA 2F07A 3P9TA 5IP6A 4MK6A 3PPBA 3ZQFA 3HTIA 2Y31A 2DTZA 4KWAA 1SGMA 3KNWA 1JTXA 1BJZA 2FQ4A 3VOKA 1QVTA 3BHQA 2DG7A 2OPTA 3BR2A 1JUSA 1T33A 5J3LA 1T56A 2HXIA 4NELA 3VVZA 3Q0VA 3O8GA 2RAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1L A;  3BNI A;  3VP5 A;  2WGB A;  2QIB A;  3CRJ A;  3BTI A;  3C2B A;  3FK7 A;  2FD5 A;  3C07 A;  4GCT A;  3DPJ A;  3QPS A;  2NX4 A;  1UI6 A;  4JYK A;  2D6Y A;  3QBM A;  1JUM A;  1A6I A;  4ICH A;  3BTC A;  2ID6 A;  5J1U A;  2VPR A;  3KKD A;  3VVX A;  3NPI A;  3IH2 A;  1JT0 A;  5FKL A;  2V57 A;  3SFI A;  5FKO A;  4W1U A;  4X1E A;  4I76 A;  3ON2 A;  3ANG A;  5EYR A;  5EZH A;  2ZCM A;  2RHA A;  5F0F A;  1Z0X A;  5GPC A;  3CDL A;  3NNR A;  3QKX A;  3NRG A;  5EFY A;  1ZK8 A;  4V2F A;  4YZE A;  3ZQH A;  3BCG A;  2XRL A;  2GBY A;  3BRU A;  3LWJ A;  4M3B A;  3MNL A;  4HKU A;  4D7M A;  4L62 A;  2X9D A;  2ZCN A;  4B3A A;  2ZOY A;  5D19 A;  3CJD A;  3LSP A;  2GFN A;  3TP3 A;  3VW0 A;  5F08 A;  2QCO A;  3COL A;  4JKZ A;  3IH3 A;  4M3D A;  3TP0 A;  2QOP A;  2UXO A;  3HIM A;  3BTL A;  4B1R A;  2HKU A;  2UXP A;  2X6O A;  2XGC A;  3HGY A;  3VIB A;  2VKE A;  4M3F A;  3Q0U A;  5FGL A;  3GZI A;  3LJL A;  5K7H A;  2I10 A;  4PXI A;  4D5C A;  2PBX A;  5IPA A;  2REK A;  3VW1 A;  4GFK A;  5GP9 A;  2ID3 A;  3PAS A;  2ZB9 A;  3BJB A;  4NN1 A;  3V78 A;  3LOC A;  5F27 A;  4JNN A;  5FMP A;  2G7G A;  5CXG A;  4GFL A;  3VOX A;  3AQT A;  3G1M A;  2XB5 A;  2NP3 A;  4GCK A;  3BQY A;  3G1O A;  3S5R A;  3IUV A;  5FKK A;  2ZOZ A;  3BR0 A;  3F0C A;  3HTH A;  4UDS A;  5HSZ A;  3QPL A;  1UI5 A;  2HYT A;  2G7S A;  4M3E A;  5EZG A;  4DW6 A;  2OF7 A;  3ON4 A;  2IU5 A;  4G12 A;  4AF5 A;  2OER A;  2XPU A;  2UXH A;  3ZQL A;  2O7T A;  4CGR A;  2YVH A;  2XPW A;  3FIW A;  2Q24 A;  2WV1 A;  4GCL A;  2IEK A;  2HYJ A;  5HBU A;  5J1R A;  4MXM A;  3KKC A;  5K7F A;  3VVY A;  3CWR A;  3BR6 A;  5AQC A;  1RKT A;  2JJ7 A;  3DCF A;  4AC6 A;  5K58 A;  2ZCX A;  3IH4 A;  5J1Y A;  5K7Z A;  4W97 A;  5HAW A;  2VKV A;  4M3G A;  3NI7 A;  5FHP A;  3LSR A;  2HQ5 A;  3BR3 A;  2QKO A;  3BR1 A;  3T6N A;  2TCT A;  2WUI A;  3EGQ A;  1ORK A;  2IAI A;  3BTJ A;  3FRQ A;  4JL3 A;  2NS8 A;  4D7N A;  3E7Q A;  1U9N A;  2XGD A;  4ACI A;  3FK6 A;  3O8H A;  2XGE A;  3WHB A;  5D18 A;  3GEU A;  3B6A A;  3SDG A;  2QWT A;  3DEW A;  3G56 A;  3CCY A;  3VPR A;  1QPI A;  1JUP A;  3LSJ A;  2JK3 A;  2GEN A;  5D1R A;  3AQS A;  5DAJ A;  4AUX A;  1RPW A;  2GUH A;  5C4Y A;  3F1B A;  2QTQ A;  3V6G A;  3B6C A;  3JSJ A;  5F0C A;  2UXI A;  4XK4 A;  3EUP A;  4MO7 A;  4I6Z A;  2RAS A;  2PZ9 A;  2W53 A;  3QQA A;  5FKN A;  4AC0 A;  5CW8 A;  5F1J A;  1JTY A;  3ANP A;  4V2G A;  2YVE A;  2O7O A;  3VW2 A;  2DG8 A;  3MVP A;  1Z77 A;  2UXU A;  3RD3 A;  4ABZ A;  1JT6 A;  5FKM A;  3Q0W A;  5F04 A;  3KZ9 A;  2XDN A;  3BR5 A;  2G3B A;  3BT9 A;  2EH3 A;  2HXO A;  5GPA A;  4ME9 A;  2G0E A;  5IOZ A;  2Y2Z A;  1VI0 A;  2NS7 A;  2OI8 A;  2FBQ A;  2XPV A;  2TRT A;  3HGG A;  2NP5 A;  2FJ1 A;  3ZQG A;  3LHQ A;  5IOY A;  3BQZ A;  1U9O A;  3VUQ A;  2G7L A;  2IBD A;  2Y30 A;  3B81 A;  3G7R A;  3O60 A;  1RKW A;  3PM1 A;  3WHC A;  2FX0 A;  3Q3S A;  3RH2 A;  3HE0 A;  4D5F A;  1QVU A;  3HTJ A;  5CXI A;  5H9T A;  3HTA A;  5F0H A;  3ZQI A;  1ZKG A;  3NXC A;  2F07 A;  3P9T A;  5IP6 A;  4MK6 A;  3PPB A;  3ZQF A;  3HTI A;  2Y31 A;  2DTZ A;  4KWA A;  1SGM A;  3KNW A;  1JTX A;  1BJZ A;  2FQ4 A;  3VOK A;  1QVT A;  3BHQ A;  2DG7 A;  2OPT A;  3BR2 A;  1JUS A;  1T33 A;  5J3L A;  1T56 A;  2HXI A;  4NEL A;  3VVZ A;  3Q0V A;  3O8G A;  2RAE A; 
#chains in the Genus database with same CATH topology
 3G1L A;  3BNI A;  3VP5 A;  2WGB A;  2QIB A;  3CRJ A;  3BTI A;  3C2B A;  3FK7 A;  2FD5 A;  3C07 A;  4GCT A;  3NS4 A;  3DPJ A;  3QPS A;  2NX4 A;  1UI6 A;  4JYK A;  2D6Y A;  3QBM A;  1JUM A;  1A6I A;  4ICH A;  2R7O A;  3BTC A;  2ID6 A;  5J1U A;  2VPR A;  3KKD A;  3VVX A;  3NPI A;  3IH2 A;  1JT0 A;  5FKL A;  2V57 A;  3SFI A;  5FKO A;  4W1U A;  4X1E A;  4I76 A;  2R7U A;  3ON2 A;  3ANG A;  5EYR A;  5EZH A;  2YVX A;  2ZCM A;  2RHA A;  5F0F A;  1Z0X A;  3VTI A;  5GPC A;  3CDL A;  3NNR A;  3QKX A;  4OD4 A;  3NRG A;  5EFY A;  1ZK8 A;  4V2F A;  4YZE A;  3ZQH A;  3BCG A;  2XRL A;  2GBY A;  3BRU A;  3LWJ A;  4M3B A;  2R7R A;  3MNL A;  4HKU A;  4D7M A;  4L62 A;  2X9D A;  2ZCN A;  2B1E A;  4B3A A;  2ZOY A;  5D19 A;  3CJD A;  3LSP A;  2GFN A;  3TP3 A;  3VW0 A;  2FJI 1;  5F08 A;  2QCO A;  3COL A;  4JKZ A;  3IH3 A;  4M3D A;  3TP0 A;  2QOP A;  2UXO A;  3HIM A;  3BTL A;  4B1R A;  2HKU A;  2UXP A;  2X6O A;  4IRV A;  2XGC A;  3HGY A;  2R7T A;  3VIB A;  2VKE A;  4M3F A;  4U9N A;  3Q0U A;  5FGL A;  3K8P C;  3GZI A;  3LJL A;  5K7H A;  2I10 A;  4PXI A;  4D5C A;  2PBX A;  5IPA A;  2REK A;  3VW1 A;  4GFK A;  5GP9 A;  2ID3 A;  3PAS A;  2ZB9 A;  3BJB A;  4NN1 A;  3V78 A;  3LOC A;  5F27 A;  4JNN A;  5FMP A;  2G7G A;  5CXG A;  4GFL A;  3VOX A;  3AQT A;  3G1M A;  2XB5 A;  2NP3 A;  4GCK A;  3BQY A;  3G1O A;  3S5R A;  3IUV A;  5FKK A;  2ZOZ A;  3BR0 A;  3F0C A;  3HTH A;  4UDS A;  5HSZ A;  3QPL A;  2PFV A;  4DVY P;  1UI5 A;  2HYT A;  2G7S A;  4M3E A;  5EZG A;  4DW6 A;  2OF7 A;  3ON4 A;  2IU5 A;  4G12 A;  4AF5 A;  2OER A;  2XPU A;  2UXH A;  3ZQL A;  2O7T A;  4CGR A;  2XPW A;  3FIW A;  2YVH A;  2Q24 A;  2WV1 A;  4GCL A;  2A2F X;  2R7X A;  2IEK A;  2HYJ A;  5HBU A;  5J1R A;  4MXM A;  3KKC A;  3FHN A;  5K7F A;  3VVY A;  3CWR A;  3BR6 A;  5AQC A;  1RKT A;  2JJ7 A;  3DCF A;  4AC6 A;  5K58 A;  2ZCX A;  3IH4 A;  5J1Y A;  5K7Z A;  4W97 A;  5HAW A;  2VKV A;  4M3G A;  3NI7 A;  5FHP A;  3LSR A;  2HQ5 A;  3BR3 A;  2QKO A;  3BR1 A;  3T6N A;  2TCT A;  2WUI A;  4WIB A;  3EGQ A;  1ORK A;  4U9L A;  2IAI A;  3BTJ A;  3FRQ A;  4JL3 A;  2NS8 A;  4D7N A;  3E7Q A;  1U9N A;  2XGD A;  4ACI A;  3FK6 A;  3O8H A;  2XGE A;  3WHB A;  5D18 A;  3GEU A;  3B6A A;  3SDG A;  2QWT A;  3DEW A;  3G56 A;  3CCY A;  3VPR A;  3SWH A;  3DU6 A;  1QPI A;  1JUP A;  3LSJ A;  4OD5 A;  2JK3 A;  2GEN A;  5D1R A;  3AQS A;  5DAJ A;  4AUX A;  1RPW A;  2GUH A;  5C4Y A;  2R7V A;  3F1B A;  2QTQ A;  3V6G A;  3B6C A;  3JSJ A;  5F0C A;  2UXI A;  4XK4 A;  3EUP A;  4MO7 A;  4I6Z A;  2RAS A;  2R7Q A;  2PZ9 A;  2W53 A;  3QQA A;  5FKN A;  4AC0 A;  5CW8 A;  5F1J A;  1JTY A;  3ANP A;  4V2G A;  2R7S A;  5CQG A;  2YVE A;  2O7O A;  3VW2 A;  2DG8 A;  3MVP A;  1Z77 A;  2UXU A;  3RD3 A;  4ABZ A;  1JT6 A;  4C2M A;  5FKM A;  3Q0W A;  5F04 A;  3KZ9 A;  2XDN A;  3BR5 A;  2G3B A;  2ZY9 A;  3BT9 A;  2EH3 A;  2HXO A;  5GPA A;  4ME9 A;  2G0E A;  5IOZ A;  2Y2Z A;  1VI0 A;  2NS7 A;  2OI8 A;  2FBQ A;  2XPV A;  2TRT A;  3HGG A;  2NP5 A;  2FJ1 A;  3ZQG A;  3LHQ A;  5IOY A;  3BQZ A;  1U9O A;  3VUQ A;  2G7L A;  2B3W A;  2IBD A;  2Y30 A;  3B81 A;  3G7R A;  3O60 A;  1RKW A;  3PM1 A;  3WHC A;  2FX0 A;  3Q3S A;  3RH2 A;  3HE0 A;  4D5F A;  1QVU A;  3HTJ A;  5CXI A;  5H9T A;  3HTA A;  5F0H A;  3ZQI A;  1ZKG A;  3NXC A;  2F07 A;  3P9T A;  5IP6 A;  4MK6 A;  3PPB A;  3ZQF A;  3HTI A;  2Y31 A;  2DTZ A;  4KWA A;  1SGM A;  3KNW A;  1JTX A;  1BJZ A;  2FQ4 A;  3VOK A;  1QVT A;  3BHQ A;  2DG7 A;  2OPT A;  3BR2 A;  1JUS A;  3DU5 A;  1T33 A;  5J3L A;  1T56 A;  2HXI A;  3KYL A;  4NEL A;  3VVZ A;  3Q0V A;  3O8G A;  2RAE A;  2R7W A; 
#chains in the Genus database with same CATH homology
 3G1L A;  3BNI A;  3VP5 A;  2WGB A;  2QIB A;  3CRJ A;  3BTI A;  3C2B A;  3FK7 A;  2FD5 A;  3C07 A;  4GCT A;  3DPJ A;  3QPS A;  2NX4 A;  1UI6 A;  4JYK A;  2D6Y A;  3QBM A;  1JUM A;  1A6I A;  4ICH A;  3BTC A;  2ID6 A;  5J1U A;  2VPR A;  3KKD A;  3VVX A;  3NPI A;  3IH2 A;  1JT0 A;  5FKL A;  2V57 A;  3SFI A;  5FKO A;  4W1U A;  4X1E A;  4I76 A;  3ON2 A;  3ANG A;  5EYR A;  5EZH A;  2ZCM A;  2RHA A;  5F0F A;  1Z0X A;  5GPC A;  3CDL A;  3NNR A;  3QKX A;  3NRG A;  5EFY A;  1ZK8 A;  4V2F A;  4YZE A;  3ZQH A;  3BCG A;  2XRL A;  2GBY A;  3BRU A;  3LWJ A;  4M3B A;  3MNL A;  4HKU A;  4D7M A;  4L62 A;  2X9D A;  2ZCN A;  4B3A A;  2ZOY A;  5D19 A;  3CJD A;  3LSP A;  2GFN A;  3TP3 A;  3VW0 A;  5F08 A;  2QCO A;  3COL A;  4JKZ A;  3IH3 A;  4M3D A;  3TP0 A;  2QOP A;  2UXO A;  3HIM A;  3BTL A;  4B1R A;  2HKU A;  2UXP A;  2X6O A;  2XGC A;  3HGY A;  3VIB A;  2VKE A;  4M3F A;  3Q0U A;  5FGL A;  3GZI A;  3LJL A;  5K7H A;  2I10 A;  4PXI A;  4D5C A;  2PBX A;  5IPA A;  2REK A;  3VW1 A;  4GFK A;  5GP9 A;  2ID3 A;  3PAS A;  2ZB9 A;  3BJB A;  4NN1 A;  3V78 A;  3LOC A;  5F27 A;  4JNN A;  5FMP A;  2G7G A;  5CXG A;  4GFL A;  3VOX A;  3AQT A;  3G1M A;  2XB5 A;  2NP3 A;  4GCK A;  3BQY A;  3G1O A;  3S5R A;  3IUV A;  5FKK A;  2ZOZ A;  3BR0 A;  3F0C A;  3HTH A;  4UDS A;  5HSZ A;  3QPL A;  1UI5 A;  2HYT A;  2G7S A;  4M3E A;  5EZG A;  4DW6 A;  2OF7 A;  3ON4 A;  2IU5 A;  4G12 A;  4AF5 A;  2OER A;  2XPU A;  2UXH A;  3ZQL A;  2O7T A;  4CGR A;  2YVH A;  2XPW A;  3FIW A;  2Q24 A;  2WV1 A;  4GCL A;  2IEK A;  2HYJ A;  5HBU A;  5J1R A;  4MXM A;  3KKC A;  5K7F A;  3VVY A;  3CWR A;  3BR6 A;  5AQC A;  1RKT A;  2JJ7 A;  3DCF A;  4AC6 A;  5K58 A;  2ZCX A;  3IH4 A;  5J1Y A;  5K7Z A;  4W97 A;  5HAW A;  2VKV A;  4M3G A;  3NI7 A;  5FHP A;  3LSR A;  2HQ5 A;  3BR3 A;  2QKO A;  3BR1 A;  3T6N A;  2TCT A;  2WUI A;  3EGQ A;  1ORK A;  2IAI A;  3BTJ A;  3FRQ A;  4JL3 A;  2NS8 A;  4D7N A;  3E7Q A;  1U9N A;  2XGD A;  4ACI A;  3FK6 A;  3O8H A;  2XGE A;  3WHB A;  5D18 A;  3GEU A;  3B6A A;  3SDG A;  2QWT A;  3DEW A;  3G56 A;  3CCY A;  3VPR A;  1QPI A;  1JUP A;  3LSJ A;  2JK3 A;  2GEN A;  5D1R A;  3AQS A;  5DAJ A;  4AUX A;  1RPW A;  2GUH A;  5C4Y A;  3F1B A;  2QTQ A;  3V6G A;  3B6C A;  3JSJ A;  5F0C A;  2UXI A;  4XK4 A;  3EUP A;  4MO7 A;  4I6Z A;  2RAS A;  2PZ9 A;  2W53 A;  3QQA A;  5FKN A;  4AC0 A;  5CW8 A;  5F1J A;  1JTY A;  3ANP A;  4V2G A;  2YVE A;  2O7O A;  3VW2 A;  2DG8 A;  3MVP A;  1Z77 A;  2UXU A;  3RD3 A;  4ABZ A;  1JT6 A;  5FKM A;  3Q0W A;  5F04 A;  3KZ9 A;  2XDN A;  3BR5 A;  2G3B A;  3BT9 A;  2EH3 A;  2HXO A;  5GPA A;  4ME9 A;  2G0E A;  5IOZ A;  2Y2Z A;  1VI0 A;  2NS7 A;  2OI8 A;  2FBQ A;  2XPV A;  2TRT A;  3HGG A;  2NP5 A;  2FJ1 A;  3ZQG A;  3LHQ A;  5IOY A;  3BQZ A;  1U9O A;  3VUQ A;  2G7L A;  2IBD A;  2Y30 A;  3B81 A;  3G7R A;  3O60 A;  1RKW A;  3PM1 A;  3WHC A;  2FX0 A;  3Q3S A;  3RH2 A;  3HE0 A;  4D5F A;  1QVU A;  3HTJ A;  5CXI A;  5H9T A;  3HTA A;  5F0H A;  3ZQI A;  1ZKG A;  3NXC A;  2F07 A;  3P9T A;  5IP6 A;  4MK6 A;  3PPB A;  3ZQF A;  3HTI A;  2Y31 A;  2DTZ A;  4KWA A;  1SGM A;  3KNW A;  1JTX A;  1BJZ A;  2FQ4 A;  3VOK A;  1QVT A;  3BHQ A;  2DG7 A;  2OPT A;  3BR2 A;  1JUS A;  1T33 A;  5J3L A;  1T56 A;  2HXI A;  4NEL A;  3VVZ A;  3Q0V A;  3O8G A;  2RAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...