3GEUA

Crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
189
Chain Sequence
SNAMKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intercellular adhesion protein R
publication title Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family
rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 75
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3geuA00
5K7ZA 2EH3A 2DG8A 3KZ9A 2XGEA 2YVEA 3COLA 2QKOA 2YVHA 2O7TA 3TP0A 3CDLA 5GP9A 1UI6A 3G7RA 4GFKA 3IH4A 5K58A 4I6ZA 3SDGA 4NELA 1RKWA 3ANPA 5FKMA 5IPAA 1JUPA 2NP3A 4ABZA 5H9TA 3GEUA 1RKTA 3NNRA 2FX0A 4GFLA 2G7SA 2Y31A 1RPWA 2G7GA 2ID3A 3Q3SA 1QPIA 2RHAA 2QIBA 3HGYA 3QQAA 5J3LA 3BQZA 2Q24A 3VVXA 3NPIA 3HIMA 3HTJA 4M3GA 1U9NA 2REKA 4UDSA 2XPVA 3LHQA 1JT0A 2JK3A 5J1UA 2HYTA 3T6NA 2XGCA 3AQTA 2F07A 2IBDA 3BR3A 5FGLA 2G0EA 2IU5A 3C2BA 2QWTA 1ZK8A 4YZEA 4AC6A 3ZQHA 3ZQLA 4ME9A 5K7HA 5FMPA 2ID6A 3O8HA 3E7QA 3BTIA 2JJ7A 4W97A 3NRGA 4KWAA 3BRUA 5EYRA 2PBXA 5HSZA 5F1JA 5D18A 3PASA 3VP5A 3Q0UA 5DAJA 2DTZA 3F1BA 2ZCXA 4JNNA 5F27A 3PPBA 2Y30A 4D7NA 1ORKA 5F08A 1VI0A 3HE0A 3EUPA 4M3EA 5EFYA 2XPWA 5CXGA 2QTQA 3BTLA 2D6YA 4NN1A 3NXCA 3BR1A 2FJ1A 4L62A 4X1EA 5IP6A 3BTCA 2HYJA 3MNLA 2XDNA 3KKDA 2X6OA 4D7MA 3HTIA 2HXIA 2NP5A 2XPUA 3Q0VA 3LSJA 1JUSA 4MK6A 2O7OA 4PXIA 3WHBA 3FK7A 2Y2ZA 3S5RA 3V78A 4I76A 3AQSA 3Q0WA 5AQCA 2IEKA 3DEWA 3O8GA 1Z0XA 5J1RA 3O60A 4V2FA 3GZIA 3VIBA 3FK6A 1ZKGA 4JYKA 3HTAA 2ZOZA 5FKLA 5D19A 4W1UA 4JKZA 4AUXA 2HKUA 3LWJA 3LSPA 3VW1A 3RD3A 2XGDA 5J1YA 3CCYA 2OF7A 2XRLA 3DCFA 4AF5A 2UXIA 2XB5A 2W53A 3JSJA 5F0HA 3F0CA 2QCOA 3C07A 3EGQA 4B3AA 2FQ4A 2RAEA 3CWRA 4HKUA 4D5FA 4MXMA 4M3FA 3KNWA 3FRQA 3VVYA 3BNIA 1JUMA 3ON2A 2WGBA 3HGGA 3VVZA 2RASA 3ZQGA 5CXIA 4D5CA 1A6IA 2VKEA 1T56A 3VUQA 5D1RA 3BR0A 2IAIA 3ZQFA 4B1RA 4AC0A 5GPCA 2FBQA 2WV1A 3QBMA 4V2GA 2GUHA 1U9OA 3BTJA 3B6AA 3ZQIA 3MVPA 2TCTA 2ZCMA 3B6CA 2V57A 5IOYA 5CW8A 2ZCNA 3BR2A 5HAWA 5F0FA 3TP3A 3QPSA 5K7FA 2QOPA 5C4YA 3VOKA 2GENA 3VW2A 5F0CA 3KKCA 4JL3A 3G1MA 2ZOYA 3NI7A 5F04A 5EZHA 3QKXA 1UI5A 2UXUA 4M3BA 4GCLA 2UXOA 4DW6A 3HTHA 1BJZA 2VKVA 3VOXA 2NX4A 2PZ9A 3BR5A 3RH2A 3ON4A 4XK4A 2DG7A 5EZGA 4ACIA 3BJBA 1JTXA 2ZB9A 2I10A 2VPRA 1Z77A 3DPJA 1QVUA 4CGRA 1JT6A 3VPRA 1SGMA 5GPAA 2G3BA 3P9TA 2OPTA 2OI8A 3WHCA 2HQ5A 2X9DA 3LOCA 3V6GA 1JTYA 3BQYA 5FKKA 4GCTA 2TRTA 2GBYA 3FIWA 3BCGA 3LJLA 5IOZA 4ICHA 2UXPA 3QPLA 3BHQA 4M3DA 3CRJA 3VW0A 4GCKA 3SFIA 2UXHA 5FKOA 3BR6A 5FKNA 5HBUA 2GFNA 1T33A 3LSRA 2WUIA 3IH3A 5FHPA 3IUVA 3G56A 2OERA 3BT9A 1QVTA 3IH2A 4G12A 3G1LA 2NS8A 2HXOA 2G7LA 3ANGA 3B81A 3G1OA 3PM1A 4MO7A 2NS7A 2FD5A 3CJDA
chains in the Genus database with same CATH superfamily
5K7ZA 2EH3A 2DG8A 3KZ9A 2XGEA 2YVEA 3COLA 2QKOA 2YVHA 2O7TA 3TP0A 3CDLA 5GP9A 1UI6A 3G7RA 4GFKA 3IH4A 5K58A 4I6ZA 3SDGA 2ZY9A 4NELA 1RKWA 3ANPA 5FKMA 5IPAA 1JUPA 2NP3A 4ABZA 5H9TA 3GEUA 1RKTA 3NNRA 2FX0A 4GFLA 2G7SA 2Y31A 3DU5A 1RPWA 2G7GA 2ID3A 2R7QA 3Q3SA 1QPIA 2RHAA 2QIBA 3HGYA 3QQAA 5J3LA 3BQZA 2Q24A 3VVXA 3NPIA 3HIMA 2R7TA 3HTJA 4M3GA 1U9NA 2REKA 4UDSA 2XPVA 3LHQA 1JT0A 2JK3A 2B1EA 5J1UA 2HYTA 3T6NA 2XGCA 3AQTA 4C2MA 3K8PC 2F07A 2IBDA 3BR3A 5FGLA 2G0EA 2IU5A 3C2BA 2QWTA 1ZK8A 4YZEA 4AC6A 3ZQHA 3ZQLA 4ME9A 5K7HA 5FMPA 4DVYP 2ID6A 3O8HA 3E7QA 3BTIA 2JJ7A 4W97A 3NRGA 4KWAA 3BRUA 5EYRA 2PBXA 5HSZA 5F1JA 5D18A 3PASA 3VP5A 3Q0UA 5DAJA 2DTZA 3F1BA 2ZCXA 4JNNA 5F27A 3PPBA 2Y30A 4D7NA 2R7XA 3NS4A 1ORKA 5F08A 1VI0A 3HE0A 3EUPA 4M3EA 5EFYA 2XPWA 5CXGA 2QTQA 3BTLA 2D6YA 4NN1A 3NXCA 3BR1A 2FJ1A 4L62A 4X1EA 5IP6A 3BTCA 2HYJA 4U9LA 3MNLA 2XDNA 3KKDA 2X6OA 4D7MA 3HTIA 2HXIA 2NP5A 2XPUA 3Q0VA 3LSJA 1JUSA 4MK6A 2O7OA 4PXIA 3WHBA 3FK7A 2Y2ZA 2FJI1 3S5RA 3V78A 4WIBA 4IRVA 4I76A 3AQSA 3Q0WA 5AQCA 2IEKA 3DEWA 3O8GA 1Z0XA 5J1RA 3O60A 4V2FA 3GZIA 3VIBA 3FK6A 1ZKGA 4JYKA 3HTAA 2ZOZA 5FKLA 5D19A 4W1UA 3SWHA 4JKZA 4AUXA 2HKUA 3LWJA 3LSPA 3VW1A 3RD3A 2XGDA 5J1YA 3CCYA 2OF7A 2XRLA 3DCFA 4AF5A 2UXIA 2XB5A 2W53A 3JSJA 5F0HA 3F0CA 2QCOA 3C07A 3EGQA 4B3AA 2FQ4A 2RAEA 3CWRA 4HKUA 2PFVA 4D5FA 4MXMA 4M3FA 3KNWA 3FRQA 3VVYA 3BNIA 1JUMA 3ON2A 2WGBA 3HGGA 3VVZA 2RASA 3ZQGA 5CXIA 4D5CA 1A6IA 2VKEA 1T56A 3VUQA 3FHNA 5D1RA 3BR0A 2IAIA 3ZQFA 4B1RA 4AC0A 5GPCA 2FBQA 2WV1A 3QBMA 4V2GA 2GUHA 1U9OA 3BTJA 3VTIA 3B6AA 3ZQIA 3MVPA 2TCTA 2ZCMA 3B6CA 2V57A 5IOYA 5CW8A 2R7UA 2ZCNA 3BR2A 5HAWA 2R7WA 5F0FA 2A2FX 3TP3A 3QPSA 5K7FA 4OD5A 2QOPA 5C4YA 3VOKA 2GENA 3VW2A 5F0CA 3KKCA 4OD4A 4JL3A 3G1MA 2ZOYA 3NI7A 5F04A 5EZHA 3QKXA 1UI5A 2UXUA 4M3BA 4GCLA 2UXOA 4DW6A 3HTHA 1BJZA 2VKVA 3VOXA 2NX4A 2PZ9A 3BR5A 3RH2A 3ON4A 4XK4A 2DG7A 5EZGA 2R7SA 4ACIA 3BJBA 1JTXA 2ZB9A 2I10A 2VPRA 1Z77A 3DPJA 1QVUA 4CGRA 2R7RA 1JT6A 3VPRA 1SGMA 5GPAA 2G3BA 3P9TA 2OPTA 2OI8A 3WHCA 2HQ5A 2X9DA 3LOCA 3V6GA 1JTYA 3BQYA 5FKKA 4GCTA 3KYLA 2TRTA 2GBYA 3FIWA 3BCGA 3LJLA 5IOZA 4ICHA 2UXPA 3QPLA 3BHQA 4M3DA 3CRJA 3VW0A 4GCKA 2YVXA 5FKOA 3SFIA 2UXHA 3DU6A 3BR6A 5FKNA 5HBUA 2GFNA 1T33A 3LSRA 2WUIA 3IH3A 2R7VA 5FHPA 3IUVA 3G56A 2OERA 3BT9A 2R7OA 2B3WA 1QVTA 3IH2A 4G12A 3G1LA 2NS8A 2HXOA 4U9NA 2G7LA 3ANGA 3B81A 3G1OA 3PM1A 4MO7A 5CQGA 2NS7A 2FD5A 3CJDA
chains in the Genus database with same CATH topology
5K7ZA 2EH3A 2DG8A 3KZ9A 2XGEA 2YVEA 3COLA 2QKOA 2YVHA 2O7TA 3TP0A 3CDLA 5GP9A 1UI6A 3G7RA 4GFKA 3IH4A 5K58A 4I6ZA 3SDGA 4NELA 1RKWA 3ANPA 5FKMA 5IPAA 1JUPA 2NP3A 4ABZA 5H9TA 3GEUA 1RKTA 3NNRA 2FX0A 4GFLA 2G7SA 2Y31A 1RPWA 2G7GA 2ID3A 3Q3SA 1QPIA 2RHAA 2QIBA 3HGYA 3QQAA 5J3LA 3BQZA 2Q24A 3VVXA 3NPIA 3HIMA 3HTJA 4M3GA 1U9NA 2REKA 4UDSA 2XPVA 3LHQA 1JT0A 2JK3A 5J1UA 2HYTA 3T6NA 2XGCA 3AQTA 2F07A 2IBDA 3BR3A 5FGLA 2G0EA 2IU5A 3C2BA 2QWTA 1ZK8A 4YZEA 4AC6A 3ZQHA 3ZQLA 4ME9A 5K7HA 5FMPA 2ID6A 3O8HA 3E7QA 3BTIA 2JJ7A 4W97A 3NRGA 4KWAA 3BRUA 5EYRA 2PBXA 5HSZA 5F1JA 5D18A 3PASA 3VP5A 3Q0UA 5DAJA 2DTZA 3F1BA 2ZCXA 4JNNA 5F27A 3PPBA 2Y30A 4D7NA 1ORKA 5F08A 1VI0A 3HE0A 3EUPA 4M3EA 5EFYA 2XPWA 5CXGA 2QTQA 3BTLA 2D6YA 4NN1A 3NXCA 3BR1A 2FJ1A 4L62A 4X1EA 5IP6A 3BTCA 2HYJA 3MNLA 2XDNA 3KKDA 2X6OA 4D7MA 3HTIA 2HXIA 2NP5A 2XPUA 3Q0VA 3LSJA 1JUSA 4MK6A 2O7OA 4PXIA 3WHBA 3FK7A 2Y2ZA 3S5RA 3V78A 4I76A 3AQSA 3Q0WA 5AQCA 2IEKA 3DEWA 3O8GA 1Z0XA 5J1RA 3O60A 4V2FA 3GZIA 3VIBA 3FK6A 1ZKGA 4JYKA 3HTAA 2ZOZA 5FKLA 5D19A 4W1UA 4JKZA 4AUXA 2HKUA 3LWJA 3LSPA 3VW1A 3RD3A 2XGDA 5J1YA 3CCYA 2OF7A 2XRLA 3DCFA 4AF5A 2UXIA 2XB5A 2W53A 3JSJA 5F0HA 3F0CA 2QCOA 3C07A 3EGQA 4B3AA 2FQ4A 2RAEA 3CWRA 4HKUA 4D5FA 4MXMA 4M3FA 3KNWA 3FRQA 3VVYA 3BNIA 1JUMA 3ON2A 2WGBA 3HGGA 3VVZA 2RASA 3ZQGA 5CXIA 4D5CA 1A6IA 2VKEA 1T56A 3VUQA 5D1RA 3BR0A 2IAIA 3ZQFA 4B1RA 4AC0A 5GPCA 2FBQA 2WV1A 3QBMA 4V2GA 2GUHA 1U9OA 3BTJA 3B6AA 3ZQIA 3MVPA 2TCTA 2ZCMA 3B6CA 2V57A 5IOYA 5CW8A 2ZCNA 3BR2A 5HAWA 5F0FA 3TP3A 3QPSA 5K7FA 2QOPA 5C4YA 3VOKA 2GENA 3VW2A 5F0CA 3KKCA 4JL3A 3G1MA 2ZOYA 3NI7A 5F04A 5EZHA 3QKXA 1UI5A 2UXUA 4M3BA 4GCLA 2UXOA 4DW6A 3HTHA 1BJZA 2VKVA 3VOXA 2NX4A 2PZ9A 3BR5A 3RH2A 3ON4A 4XK4A 2DG7A 5EZGA 4ACIA 3BJBA 1JTXA 2ZB9A 2I10A 2VPRA 1Z77A 3DPJA 1QVUA 4CGRA 1JT6A 3VPRA 1SGMA 5GPAA 2G3BA 3P9TA 2OPTA 2OI8A 3WHCA 2HQ5A 2X9DA 3LOCA 3V6GA 1JTYA 3BQYA 5FKKA 4GCTA 2TRTA 2GBYA 3FIWA 3BCGA 3LJLA 5IOZA 4ICHA 2UXPA 3QPLA 3BHQA 4M3DA 3CRJA 3VW0A 4GCKA 3SFIA 2UXHA 5FKOA 3BR6A 5FKNA 5HBUA 2GFNA 1T33A 3LSRA 2WUIA 3IH3A 5FHPA 3IUVA 3G56A 2OERA 3BT9A 1QVTA 3IH2A 4G12A 3G1LA 2NS8A 2HXOA 2G7LA 3ANGA 3B81A 3G1OA 3PM1A 4MO7A 2NS7A 2FD5A 3CJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7Z A;  2EH3 A;  2DG8 A;  3KZ9 A;  2XGE A;  2YVE A;  3COL A;  2QKO A;  2YVH A;  2O7T A;  3TP0 A;  3CDL A;  5GP9 A;  1UI6 A;  3G7R A;  4GFK A;  3IH4 A;  5K58 A;  4I6Z A;  3SDG A;  4NEL A;  1RKW A;  3ANP A;  5FKM A;  5IPA A;  1JUP A;  2NP3 A;  4ABZ A;  5H9T A;  3GEU A;  1RKT A;  3NNR A;  2FX0 A;  4GFL A;  2G7S A;  2Y31 A;  1RPW A;  2G7G A;  2ID3 A;  3Q3S A;  1QPI A;  2RHA A;  2QIB A;  3HGY A;  3QQA A;  5J3L A;  3BQZ A;  2Q24 A;  3VVX A;  3NPI A;  3HIM A;  3HTJ A;  4M3G A;  1U9N A;  2REK A;  4UDS A;  2XPV A;  3LHQ A;  1JT0 A;  2JK3 A;  5J1U A;  2HYT A;  3T6N A;  2XGC A;  3AQT A;  2F07 A;  2IBD A;  3BR3 A;  5FGL A;  2G0E A;  2IU5 A;  3C2B A;  2QWT A;  1ZK8 A;  4YZE A;  4AC6 A;  3ZQH A;  3ZQL A;  4ME9 A;  5K7H A;  5FMP A;  2ID6 A;  3O8H A;  3E7Q A;  3BTI A;  2JJ7 A;  4W97 A;  3NRG A;  4KWA A;  3BRU A;  5EYR A;  2PBX A;  5HSZ A;  5F1J A;  5D18 A;  3PAS A;  3VP5 A;  3Q0U A;  5DAJ A;  2DTZ A;  3F1B A;  2ZCX A;  4JNN A;  5F27 A;  3PPB A;  2Y30 A;  4D7N A;  1ORK A;  5F08 A;  1VI0 A;  3HE0 A;  3EUP A;  4M3E A;  5EFY A;  2XPW A;  5CXG A;  2QTQ A;  3BTL A;  2D6Y A;  4NN1 A;  3NXC A;  3BR1 A;  2FJ1 A;  4L62 A;  4X1E A;  5IP6 A;  3BTC A;  2HYJ A;  3MNL A;  2XDN A;  3KKD A;  2X6O A;  4D7M A;  3HTI A;  2HXI A;  2NP5 A;  2XPU A;  3Q0V A;  3LSJ A;  1JUS A;  4MK6 A;  2O7O A;  4PXI A;  3WHB A;  3FK7 A;  2Y2Z A;  3S5R A;  3V78 A;  4I76 A;  3AQS A;  3Q0W A;  5AQC A;  2IEK A;  3DEW A;  3O8G A;  1Z0X A;  5J1R A;  3O60 A;  4V2F A;  3GZI A;  3VIB A;  3FK6 A;  1ZKG A;  4JYK A;  3HTA A;  2ZOZ A;  5FKL A;  5D19 A;  4W1U A;  4JKZ A;  4AUX A;  2HKU A;  3LWJ A;  3LSP A;  3VW1 A;  3RD3 A;  2XGD A;  5J1Y A;  3CCY A;  2OF7 A;  2XRL A;  3DCF A;  4AF5 A;  2UXI A;  2XB5 A;  2W53 A;  3JSJ A;  5F0H A;  3F0C A;  2QCO A;  3C07 A;  3EGQ A;  4B3A A;  2FQ4 A;  2RAE A;  3CWR A;  4HKU A;  4D5F A;  4MXM A;  4M3F A;  3KNW A;  3FRQ A;  3VVY A;  3BNI A;  1JUM A;  3ON2 A;  2WGB A;  3HGG A;  3VVZ A;  2RAS A;  3ZQG A;  5CXI A;  4D5C A;  1A6I A;  2VKE A;  1T56 A;  3VUQ A;  5D1R A;  3BR0 A;  2IAI A;  3ZQF A;  4B1R A;  4AC0 A;  5GPC A;  2FBQ A;  2WV1 A;  3QBM A;  4V2G A;  2GUH A;  1U9O A;  3BTJ A;  3B6A A;  3ZQI A;  3MVP A;  2TCT A;  2ZCM A;  3B6C A;  2V57 A;  5IOY A;  5CW8 A;  2ZCN A;  3BR2 A;  5HAW A;  5F0F A;  3TP3 A;  3QPS A;  5K7F A;  2QOP A;  5C4Y A;  3VOK A;  2GEN A;  3VW2 A;  5F0C A;  3KKC A;  4JL3 A;  3G1M A;  2ZOY A;  3NI7 A;  5F04 A;  5EZH A;  3QKX A;  1UI5 A;  2UXU A;  4M3B A;  4GCL A;  2UXO A;  4DW6 A;  3HTH A;  1BJZ A;  2VKV A;  3VOX A;  2NX4 A;  2PZ9 A;  3BR5 A;  3RH2 A;  3ON4 A;  4XK4 A;  2DG7 A;  5EZG A;  4ACI A;  3BJB A;  1JTX A;  2ZB9 A;  2I10 A;  2VPR A;  1Z77 A;  3DPJ A;  1QVU A;  4CGR A;  1JT6 A;  3VPR A;  1SGM A;  5GPA A;  2G3B A;  3P9T A;  2OPT A;  2OI8 A;  3WHC A;  2HQ5 A;  2X9D A;  3LOC A;  3V6G A;  1JTY A;  3BQY A;  5FKK A;  4GCT A;  2TRT A;  2GBY A;  3FIW A;  3BCG A;  3LJL A;  5IOZ A;  4ICH A;  2UXP A;  3QPL A;  3BHQ A;  4M3D A;  3CRJ A;  3VW0 A;  4GCK A;  3SFI A;  2UXH A;  5FKO A;  3BR6 A;  5FKN A;  5HBU A;  2GFN A;  1T33 A;  3LSR A;  2WUI A;  3IH3 A;  5FHP A;  3IUV A;  3G56 A;  2OER A;  3BT9 A;  1QVT A;  3IH2 A;  4G12 A;  3G1L A;  2NS8 A;  2HXO A;  2G7L A;  3ANG A;  3B81 A;  3G1O A;  3PM1 A;  4MO7 A;  2NS7 A;  2FD5 A;  3CJD A; 
#chains in the Genus database with same CATH topology
 5K7Z A;  2EH3 A;  2DG8 A;  3KZ9 A;  2XGE A;  2YVE A;  3COL A;  2QKO A;  2YVH A;  2O7T A;  3TP0 A;  3CDL A;  5GP9 A;  1UI6 A;  3G7R A;  4GFK A;  3IH4 A;  5K58 A;  4I6Z A;  3SDG A;  2ZY9 A;  4NEL A;  1RKW A;  3ANP A;  5FKM A;  5IPA A;  1JUP A;  2NP3 A;  4ABZ A;  5H9T A;  3GEU A;  1RKT A;  3NNR A;  2FX0 A;  4GFL A;  2G7S A;  2Y31 A;  3DU5 A;  1RPW A;  2G7G A;  2ID3 A;  2R7Q A;  3Q3S A;  1QPI A;  2RHA A;  2QIB A;  3HGY A;  3QQA A;  5J3L A;  3BQZ A;  2Q24 A;  3VVX A;  3NPI A;  3HIM A;  2R7T A;  3HTJ A;  4M3G A;  1U9N A;  2REK A;  4UDS A;  2XPV A;  3LHQ A;  1JT0 A;  2JK3 A;  2B1E A;  5J1U A;  2HYT A;  3T6N A;  2XGC A;  3AQT A;  4C2M A;  3K8P C;  2F07 A;  2IBD A;  3BR3 A;  5FGL A;  2G0E A;  2IU5 A;  3C2B A;  2QWT A;  1ZK8 A;  4YZE A;  4AC6 A;  3ZQH A;  3ZQL A;  4ME9 A;  5K7H A;  5FMP A;  4DVY P;  2ID6 A;  3O8H A;  3E7Q A;  3BTI A;  2JJ7 A;  4W97 A;  3NRG A;  4KWA A;  3BRU A;  5EYR A;  2PBX A;  5HSZ A;  5F1J A;  5D18 A;  3PAS A;  3VP5 A;  3Q0U A;  5DAJ A;  2DTZ A;  3F1B A;  2ZCX A;  4JNN A;  5F27 A;  3PPB A;  2Y30 A;  4D7N A;  2R7X A;  3NS4 A;  1ORK A;  5F08 A;  1VI0 A;  3HE0 A;  3EUP A;  4M3E A;  5EFY A;  2XPW A;  5CXG A;  2QTQ A;  3BTL A;  2D6Y A;  4NN1 A;  3NXC A;  3BR1 A;  2FJ1 A;  4L62 A;  4X1E A;  5IP6 A;  3BTC A;  2HYJ A;  4U9L A;  3MNL A;  2XDN A;  3KKD A;  2X6O A;  4D7M A;  3HTI A;  2HXI A;  2NP5 A;  2XPU A;  3Q0V A;  3LSJ A;  1JUS A;  4MK6 A;  2O7O A;  4PXI A;  3WHB A;  3FK7 A;  2Y2Z A;  2FJI 1;  3S5R A;  3V78 A;  4WIB A;  4IRV A;  4I76 A;  3AQS A;  3Q0W A;  5AQC A;  2IEK A;  3DEW A;  3O8G A;  1Z0X A;  5J1R A;  3O60 A;  4V2F A;  3GZI A;  3VIB A;  3FK6 A;  1ZKG A;  4JYK A;  3HTA A;  2ZOZ A;  5FKL A;  5D19 A;  4W1U A;  3SWH A;  4JKZ A;  4AUX A;  2HKU A;  3LWJ A;  3LSP A;  3VW1 A;  3RD3 A;  2XGD A;  5J1Y A;  3CCY A;  2OF7 A;  2XRL A;  3DCF A;  4AF5 A;  2UXI A;  2XB5 A;  2W53 A;  3JSJ A;  5F0H A;  3F0C A;  2QCO A;  3C07 A;  3EGQ A;  4B3A A;  2FQ4 A;  2RAE A;  3CWR A;  4HKU A;  2PFV A;  4D5F A;  4MXM A;  4M3F A;  3KNW A;  3FRQ A;  3VVY A;  3BNI A;  1JUM A;  3ON2 A;  2WGB A;  3HGG A;  3VVZ A;  2RAS A;  3ZQG A;  5CXI A;  4D5C A;  1A6I A;  2VKE A;  1T56 A;  3VUQ A;  3FHN A;  5D1R A;  3BR0 A;  2IAI A;  3ZQF A;  4B1R A;  4AC0 A;  5GPC A;  2FBQ A;  2WV1 A;  3QBM A;  4V2G A;  2GUH A;  1U9O A;  3BTJ A;  3VTI A;  3B6A A;  3ZQI A;  3MVP A;  2TCT A;  2ZCM A;  3B6C A;  2V57 A;  5IOY A;  5CW8 A;  2R7U A;  2ZCN A;  3BR2 A;  5HAW A;  2R7W A;  5F0F A;  2A2F X;  3TP3 A;  3QPS A;  5K7F A;  4OD5 A;  2QOP A;  5C4Y A;  3VOK A;  2GEN A;  3VW2 A;  5F0C A;  3KKC A;  4OD4 A;  4JL3 A;  3G1M A;  2ZOY A;  3NI7 A;  5F04 A;  5EZH A;  3QKX A;  1UI5 A;  2UXU A;  4M3B A;  4GCL A;  2UXO A;  4DW6 A;  3HTH A;  1BJZ A;  2VKV A;  3VOX A;  2NX4 A;  2PZ9 A;  3BR5 A;  3RH2 A;  3ON4 A;  4XK4 A;  2DG7 A;  5EZG A;  2R7S A;  4ACI A;  3BJB A;  1JTX A;  2ZB9 A;  2I10 A;  2VPR A;  1Z77 A;  3DPJ A;  1QVU A;  4CGR A;  2R7R A;  1JT6 A;  3VPR A;  1SGM A;  5GPA A;  2G3B A;  3P9T A;  2OPT A;  2OI8 A;  3WHC A;  2HQ5 A;  2X9D A;  3LOC A;  3V6G A;  1JTY A;  3BQY A;  5FKK A;  4GCT A;  3KYL A;  2TRT A;  2GBY A;  3FIW A;  3BCG A;  3LJL A;  5IOZ A;  4ICH A;  2UXP A;  3QPL A;  3BHQ A;  4M3D A;  3CRJ A;  3VW0 A;  4GCK A;  2YVX A;  5FKO A;  3SFI A;  2UXH A;  3DU6 A;  3BR6 A;  5FKN A;  5HBU A;  2GFN A;  1T33 A;  3LSR A;  2WUI A;  3IH3 A;  2R7V A;  5FHP A;  3IUV A;  3G56 A;  2OER A;  3BT9 A;  2R7O A;  2B3W A;  1QVT A;  3IH2 A;  4G12 A;  3G1L A;  2NS8 A;  2HXO A;  4U9N A;  2G7L A;  3ANG A;  3B81 A;  3G1O A;  3PM1 A;  4MO7 A;  5CQG A;  2NS7 A;  2FD5 A;  3CJD A; 
#chains in the Genus database with same CATH homology
 5K7Z A;  2EH3 A;  2DG8 A;  3KZ9 A;  2XGE A;  2YVE A;  3COL A;  2QKO A;  2YVH A;  2O7T A;  3TP0 A;  3CDL A;  5GP9 A;  1UI6 A;  3G7R A;  4GFK A;  3IH4 A;  5K58 A;  4I6Z A;  3SDG A;  4NEL A;  1RKW A;  3ANP A;  5FKM A;  5IPA A;  1JUP A;  2NP3 A;  4ABZ A;  5H9T A;  3GEU A;  1RKT A;  3NNR A;  2FX0 A;  4GFL A;  2G7S A;  2Y31 A;  1RPW A;  2G7G A;  2ID3 A;  3Q3S A;  1QPI A;  2RHA A;  2QIB A;  3HGY A;  3QQA A;  5J3L A;  3BQZ A;  2Q24 A;  3VVX A;  3NPI A;  3HIM A;  3HTJ A;  4M3G A;  1U9N A;  2REK A;  4UDS A;  2XPV A;  3LHQ A;  1JT0 A;  2JK3 A;  5J1U A;  2HYT A;  3T6N A;  2XGC A;  3AQT A;  2F07 A;  2IBD A;  3BR3 A;  5FGL A;  2G0E A;  2IU5 A;  3C2B A;  2QWT A;  1ZK8 A;  4YZE A;  4AC6 A;  3ZQH A;  3ZQL A;  4ME9 A;  5K7H A;  5FMP A;  2ID6 A;  3O8H A;  3E7Q A;  3BTI A;  2JJ7 A;  4W97 A;  3NRG A;  4KWA A;  3BRU A;  5EYR A;  2PBX A;  5HSZ A;  5F1J A;  5D18 A;  3PAS A;  3VP5 A;  3Q0U A;  5DAJ A;  2DTZ A;  3F1B A;  2ZCX A;  4JNN A;  5F27 A;  3PPB A;  2Y30 A;  4D7N A;  1ORK A;  5F08 A;  1VI0 A;  3HE0 A;  3EUP A;  4M3E A;  5EFY A;  2XPW A;  5CXG A;  2QTQ A;  3BTL A;  2D6Y A;  4NN1 A;  3NXC A;  3BR1 A;  2FJ1 A;  4L62 A;  4X1E A;  5IP6 A;  3BTC A;  2HYJ A;  3MNL A;  2XDN A;  3KKD A;  2X6O A;  4D7M A;  3HTI A;  2HXI A;  2NP5 A;  2XPU A;  3Q0V A;  3LSJ A;  1JUS A;  4MK6 A;  2O7O A;  4PXI A;  3WHB A;  3FK7 A;  2Y2Z A;  3S5R A;  3V78 A;  4I76 A;  3AQS A;  3Q0W A;  5AQC A;  2IEK A;  3DEW A;  3O8G A;  1Z0X A;  5J1R A;  3O60 A;  4V2F A;  3GZI A;  3VIB A;  3FK6 A;  1ZKG A;  4JYK A;  3HTA A;  2ZOZ A;  5FKL A;  5D19 A;  4W1U A;  4JKZ A;  4AUX A;  2HKU A;  3LWJ A;  3LSP A;  3VW1 A;  3RD3 A;  2XGD A;  5J1Y A;  3CCY A;  2OF7 A;  2XRL A;  3DCF A;  4AF5 A;  2UXI A;  2XB5 A;  2W53 A;  3JSJ A;  5F0H A;  3F0C A;  2QCO A;  3C07 A;  3EGQ A;  4B3A A;  2FQ4 A;  2RAE A;  3CWR A;  4HKU A;  4D5F A;  4MXM A;  4M3F A;  3KNW A;  3FRQ A;  3VVY A;  3BNI A;  1JUM A;  3ON2 A;  2WGB A;  3HGG A;  3VVZ A;  2RAS A;  3ZQG A;  5CXI A;  4D5C A;  1A6I A;  2VKE A;  1T56 A;  3VUQ A;  5D1R A;  3BR0 A;  2IAI A;  3ZQF A;  4B1R A;  4AC0 A;  5GPC A;  2FBQ A;  2WV1 A;  3QBM A;  4V2G A;  2GUH A;  1U9O A;  3BTJ A;  3B6A A;  3ZQI A;  3MVP A;  2TCT A;  2ZCM A;  3B6C A;  2V57 A;  5IOY A;  5CW8 A;  2ZCN A;  3BR2 A;  5HAW A;  5F0F A;  3TP3 A;  3QPS A;  5K7F A;  2QOP A;  5C4Y A;  3VOK A;  2GEN A;  3VW2 A;  5F0C A;  3KKC A;  4JL3 A;  3G1M A;  2ZOY A;  3NI7 A;  5F04 A;  5EZH A;  3QKX A;  1UI5 A;  2UXU A;  4M3B A;  4GCL A;  2UXO A;  4DW6 A;  3HTH A;  1BJZ A;  2VKV A;  3VOX A;  2NX4 A;  2PZ9 A;  3BR5 A;  3RH2 A;  3ON4 A;  4XK4 A;  2DG7 A;  5EZG A;  4ACI A;  3BJB A;  1JTX A;  2ZB9 A;  2I10 A;  2VPR A;  1Z77 A;  3DPJ A;  1QVU A;  4CGR A;  1JT6 A;  3VPR A;  1SGM A;  5GPA A;  2G3B A;  3P9T A;  2OPT A;  2OI8 A;  3WHC A;  2HQ5 A;  2X9D A;  3LOC A;  3V6G A;  1JTY A;  3BQY A;  5FKK A;  4GCT A;  2TRT A;  2GBY A;  3FIW A;  3BCG A;  3LJL A;  5IOZ A;  4ICH A;  2UXP A;  3QPL A;  3BHQ A;  4M3D A;  3CRJ A;  3VW0 A;  4GCK A;  3SFI A;  2UXH A;  5FKO A;  3BR6 A;  5FKN A;  5HBU A;  2GFN A;  1T33 A;  3LSR A;  2WUI A;  3IH3 A;  5FHP A;  3IUV A;  3G56 A;  2OER A;  3BT9 A;  1QVT A;  3IH2 A;  4G12 A;  3G1L A;  2NS8 A;  2HXO A;  2G7L A;  3ANG A;  3B81 A;  3G1O A;  3PM1 A;  4MO7 A;  2NS7 A;  2FD5 A;  3CJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...