3GEUA

Crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
189
structure length
189
Chain Sequence
SNAMKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Intercellular adhesion protein R
publication title Crystal Structure of IcaR from Staphylococcus aureus, a member of the tetracycline repressor protein family
rcsb
source organism Staphylococcus aureus
total genus 75
structure length 189
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF18665 TetR_C_37 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3geuA00
2ZCMA 3KKCA 2HYJA 1JTXA 1Z77A 2NP3A 2G7SA 3VW1A 2G7GA 3VW2A 5GPAA 5F0HA 2VPRA 5F0CA 2PZ9A 3BRUA 2GUHA 3BTLA 3Q3SA 2F07A 5D1RA 5FKOA 3BJBA 3P9TA 4KWAA 2RHAA 3C2BA 4XK4A 5D18A 2XPVA 3O60A 5IOZA 3BHQA 5K7HA 3LOCA 4HKUA 5EYRA 2FBQA 3VVXA 2IAIA 2XB5A 4D5CA 1U9OA 3F0CA 4I6ZA 2O7TA 3S5RA 3F1BA 3BT9A 3HTIA 5J3LA 3WHBA 1T33A 3B81A 2XGCA 4AC0A 2YVEA 3BR6A 3GZIA 3E7QA 3VIBA 2HKUA 4I76A 5EFYA 2G0EA 3ZQLA 3NPIA 2XDNA 3LWJA 2UXUA 2Y31A 2G7LA 1JUPA 4B1RA 5F27A 2HYTA 4NN1A 2WGBA 2O7OA 3TP3A 1ORKA 3CRJA 5HAWA 3LJLA 2DG7A 3HTHA 2X9DA 4JL3A 4L62A 4MXMA 1U9NA 2ZB9A 3AQSA 4V2GA 2XPWA 2QIBA 5AQCA 4M3FA 1QVTA 3AQTA 3IH2A 3MNLA 2XRLA 3FK7A 4YZEA 4JKZA 2REKA 3BR2A 5J1YA 2OI8A 4ICHA 3V6GA 3G1OA 3HTAA 3QPLA 3ZQFA 2JK3A 2UXIA 3VPRA 2RASA 3QQAA 3KZ9A 1Z0XA 3WHCA 5GPCA 5CXIA 5FMPA 2HXIA 3ZQGA 2Y2ZA 2W53A 2UXHA 5FKMA 1RKWA 4JYKA 3BR3A 2JJ7A 3BTIA 4GCLA 4D7MA 2EH3A 3NRGA 3BTJA 4GCKA 5FKLA 1RKTA 3FK6A 2ZCNA 3SDGA 4M3BA 5DAJA 3G56A 2YVHA 2XGEA 5F04A 3HGGA 2IEKA 5HBUA 5K7ZA 5IOYA 3LSRA 2V57A 2Y30A 2RAEA 2G3BA 2ZOYA 2NX4A 2D6YA 3FRQA 3HGYA 3B6AA 3PM1A 4B3AA 5EZGA 2ID3A 4ME9A 5K7FA 3PASA 1BJZA 3HIMA 5IPAA 1JUMA 4NELA 3DEWA 3RD3A 4M3GA 5FGLA 4W1UA 3BNIA 4ABZA 3NXCA 2NS7A 5C4YA 3O8HA 2QTQA 3FIWA 5IP6A 5CXGA 4CGRA 3VVYA 5CW8A 3LSPA 2VKEA 2UXOA 2GFNA 3Q0UA 2XGDA 5EZHA 3G1LA 4GFKA 2WV1A 3B6CA 5D19A 3ON4A 5FKKA 4AF5A 2OF7A 2Q24A 3EUPA 2NS8A 2IU5A 1JT0A 1UI6A 3G7RA 3IH3A 5F0FA 3G1MA 3IH4A 1RPWA 2QCOA 3MVPA 1JT6A 3BTCA 3VVZA 3COLA 2FD5A 3CDLA 2QOPA 2HXOA 4M3EA 2ZCXA 3VW0A 2FQ4A 3V78A 3QBMA 3JSJA 3DCFA 3IUVA 3KKDA 3VUQA 4W97A 2TRTA 5FKNA 3ZQIA 2FJ1A 1JTYA 2OERA 3HE0A 3ANGA 2TCTA 3ANPA 1QVUA 4MO7A 1ZK8A 2ZOZA 3BR0A 3Q0WA 3Q0VA 4ACIA 4AUXA 4PXIA 5J1UA 2FX0A 1UI5A 3VP5A 4UDSA 2PBXA 2X6OA 3LSJA 4G12A 3TP0A 2ID6A 3BR1A 4D7NA 2IBDA 4M3DA 3BR5A 1T56A 3CJDA 3GEUA 2I10A 3LHQA 5F08A 5J1RA 1A6IA 3C07A 3BCGA 2QKOA 3QKXA 4GFLA 3HTJA 4V2FA 2OPTA 3NNRA 4DW6A 3BQYA 3VOKA 4AC6A 2NP5A 3PPBA 2GENA 5F1JA 3NI7A 2HQ5A 4GCTA 5HSZA 3O8GA 1JUSA 4X1EA 3QPSA 3DPJA 3T6NA 2GBYA 4JNNA 1ZKGA 1VI0A 5GP9A 3BQZA 2UXPA 2DTZA 5H9TA 3VOXA 3CCYA 3RH2A 5FHPA 3SFIA 1QPIA 5K58A 3EGQA 3ON2A 3KNWA 2VKVA 2DG8A 3ZQHA 3CWRA 1SGMA 2QWTA 2WUIA 4MK6A 4D5FA 2XPUA
chains in the Genus database with same CATH superfamily
2ZCMA 2R7OA 3KKCA 2HYJA 1JTXA 1Z77A 2NP3A 2G7SA 3VW1A 2G7GA 3VW2A 5GPAA 5F0HA 2VPRA 5F0CA 2PZ9A 3BRUA 2GUHA 3BTLA 3Q3SA 2F07A 5D1RA 5FKOA 3BJBA 3P9TA 4KWAA 2RHAA 3C2BA 4XK4A 5D18A 2XPVA 3O60A 5IOZA 3BHQA 3NS4A 5K7HA 3LOCA 4HKUA 5EYRA 2FBQA 3VVXA 2IAIA 2XB5A 4D5CA 1U9OA 3F0CA 2R7RA 4I6ZA 2O7TA 3S5RA 3F1BA 3BT9A 3HTIA 5J3LA 3WHBA 1T33A 3B81A 2R7UA 2XGCA 4AC0A 2YVEA 3BR6A 3GZIA 3E7QA 2FJI1 3VIBA 2HKUA 4I76A 5EFYA 2G0EA 3ZQLA 3NPIA 2XDNA 2B3WA 3LWJA 2UXUA 2Y31A 2G7LA 1JUPA 4B1RA 2ZY9A 5F27A 2HYTA 4NN1A 2WGBA 4C2MA 2O7OA 3TP3A 1ORKA 3CRJA 5HAWA 3LJLA 3KYLA 2DG7A 3HTHA 2X9DA 4JL3A 4L62A 4MXMA 1U9NA 2ZB9A 3SWHA 3AQSA 4V2GA 2XPWA 2QIBA 5AQCA 4WIBA 4M3FA 3DU6A 1QVTA 3AQTA 3IH2A 3MNLA 2XRLA 3FK7A 4YZEA 4JKZA 2REKA 3BR2A 5J1YA 2OI8A 4ICHA 3V6GA 3G1OA 3HTAA 3QPLA 3ZQFA 2JK3A 2UXIA 3VPRA 2RASA 3QQAA 4OD4A 3KZ9A 1Z0XA 3WHCA 5GPCA 5CXIA 5FMPA 2HXIA 4U9LA 3ZQGA 3K8PC 2Y2ZA 2W53A 2UXHA 5FKMA 1RKWA 4JYKA 2R7QA 3BR3A 2JJ7A 3BTIA 4GCLA 4D7MA 2EH3A 3NRGA 3BTJA 2PFVA 4GCKA 5CQGA 5FKLA 1RKTA 3FK6A 2A2FX 2ZCNA 3SDGA 4M3BA 5DAJA 3G56A 2YVHA 2XGEA 5F04A 3HGGA 2IEKA 5HBUA 5K7ZA 5IOYA 3LSRA 2V57A 2Y30A 2RAEA 2G3BA 2ZOYA 2NX4A 2D6YA 3FRQA 3HGYA 3B6AA 3PM1A 4B3AA 5EZGA 2ID3A 4ME9A 5K7FA 3PASA 3DU5A 1BJZA 3HIMA 5IPAA 1JUMA 4NELA 3DEWA 3RD3A 4M3GA 5FGLA 4W1UA 3BNIA 4ABZA 3NXCA 2NS7A 5C4YA 3O8HA 2QTQA 3FIWA 5IP6A 5CXGA 4CGRA 3VVYA 5CW8A 4DVYP 3LSPA 2VKEA 2UXOA 2GFNA 3Q0UA 2XGDA 5EZHA 3VTIA 3G1LA 4GFKA 2WV1A 3B6CA 5D19A 3ON4A 5FKKA 4AF5A 2OF7A 2Q24A 3EUPA 2NS8A 2IU5A 1JT0A 1UI6A 3G7RA 3IH3A 5F0FA 3G1MA 3IH4A 1RPWA 2QCOA 3MVPA 1JT6A 3BTCA 3VVZA 2R7VA 3COLA 2FD5A 3CDLA 2QOPA 2HXOA 4M3EA 2R7SA 2ZCXA 3VW0A 2FQ4A 3V78A 3FHNA 3QBMA 3JSJA 3DCFA 4IRVA 3IUVA 3KKDA 3VUQA 4W97A 2TRTA 5FKNA 3ZQIA 2FJ1A 1JTYA 2OERA 3HE0A 3ANGA 2TCTA 3ANPA 1QVUA 4MO7A 1ZK8A 2ZOZA 3BR0A 3Q0WA 2B1EA 3Q0VA 4ACIA 4AUXA 4PXIA 5J1UA 2FX0A 1UI5A 3VP5A 4UDSA 2PBXA 2X6OA 3LSJA 4G12A 3TP0A 2ID6A 3BR1A 4D7NA 2IBDA 4M3DA 3BR5A 1T56A 3CJDA 3GEUA 2I10A 3LHQA 2R7TA 5F08A 5J1RA 1A6IA 3C07A 3BCGA 2QKOA 3QKXA 4GFLA 3HTJA 4V2FA 2OPTA 3NNRA 4DW6A 3BQYA 3VOKA 4AC6A 2NP5A 3PPBA 2GENA 5F1JA 3NI7A 2HQ5A 4GCTA 5HSZA 2R7XA 3O8GA 1JUSA 4X1EA 2YVXA 3QPSA 3DPJA 3T6NA 2GBYA 4JNNA 1ZKGA 1VI0A 5GP9A 3BQZA 2UXPA 2DTZA 5H9TA 3VOXA 3CCYA 2R7WA 3RH2A 5FHPA 3SFIA 1QPIA 5K58A 4U9NA 4OD5A 3EGQA 3ON2A 3KNWA 2VKVA 2DG8A 3ZQHA 3CWRA 1SGMA 2QWTA 2WUIA 4MK6A 4D5FA 2XPUA
chains in the Genus database with same CATH topology
2ZCMA 3KKCA 2HYJA 1JTXA 1Z77A 2NP3A 2G7SA 3VW1A 2G7GA 3VW2A 5GPAA 5F0HA 2VPRA 5F0CA 2PZ9A 3BRUA 2GUHA 3BTLA 3Q3SA 2F07A 5D1RA 5FKOA 3BJBA 3P9TA 4KWAA 2RHAA 3C2BA 4XK4A 5D18A 2XPVA 3O60A 5IOZA 3BHQA 5K7HA 3LOCA 4HKUA 5EYRA 2FBQA 3VVXA 2IAIA 2XB5A 4D5CA 1U9OA 3F0CA 4I6ZA 2O7TA 3S5RA 3F1BA 3BT9A 3HTIA 5J3LA 3WHBA 1T33A 3B81A 2XGCA 4AC0A 2YVEA 3BR6A 3GZIA 3E7QA 3VIBA 2HKUA 4I76A 5EFYA 2G0EA 3ZQLA 3NPIA 2XDNA 3LWJA 2UXUA 2Y31A 2G7LA 1JUPA 4B1RA 5F27A 2HYTA 4NN1A 2WGBA 2O7OA 3TP3A 1ORKA 3CRJA 5HAWA 3LJLA 2DG7A 3HTHA 2X9DA 4JL3A 4L62A 4MXMA 1U9NA 2ZB9A 3AQSA 4V2GA 2XPWA 2QIBA 5AQCA 4M3FA 1QVTA 3AQTA 3IH2A 3MNLA 2XRLA 3FK7A 4YZEA 4JKZA 2REKA 3BR2A 5J1YA 2OI8A 4ICHA 3V6GA 3G1OA 3HTAA 3QPLA 3ZQFA 2JK3A 2UXIA 3VPRA 2RASA 3QQAA 3KZ9A 1Z0XA 3WHCA 5GPCA 5CXIA 5FMPA 2HXIA 3ZQGA 2Y2ZA 2W53A 2UXHA 5FKMA 1RKWA 4JYKA 3BR3A 2JJ7A 3BTIA 4GCLA 4D7MA 2EH3A 3NRGA 3BTJA 4GCKA 5FKLA 1RKTA 3FK6A 2ZCNA 3SDGA 4M3BA 5DAJA 3G56A 2YVHA 2XGEA 5F04A 3HGGA 2IEKA 5HBUA 5K7ZA 5IOYA 3LSRA 2V57A 2Y30A 2RAEA 2G3BA 2ZOYA 2NX4A 2D6YA 3FRQA 3HGYA 3B6AA 3PM1A 4B3AA 5EZGA 2ID3A 4ME9A 5K7FA 3PASA 1BJZA 3HIMA 5IPAA 1JUMA 4NELA 3DEWA 3RD3A 4M3GA 5FGLA 4W1UA 3BNIA 4ABZA 3NXCA 2NS7A 5C4YA 3O8HA 2QTQA 3FIWA 5IP6A 5CXGA 4CGRA 3VVYA 5CW8A 3LSPA 2VKEA 2UXOA 2GFNA 3Q0UA 2XGDA 5EZHA 3G1LA 4GFKA 2WV1A 3B6CA 5D19A 3ON4A 5FKKA 4AF5A 2OF7A 2Q24A 3EUPA 2NS8A 2IU5A 1JT0A 1UI6A 3G7RA 3IH3A 5F0FA 3G1MA 3IH4A 1RPWA 2QCOA 3MVPA 1JT6A 3BTCA 3VVZA 3COLA 2FD5A 3CDLA 2QOPA 2HXOA 4M3EA 2ZCXA 3VW0A 2FQ4A 3V78A 3QBMA 3JSJA 3DCFA 3IUVA 3KKDA 3VUQA 4W97A 2TRTA 5FKNA 3ZQIA 2FJ1A 1JTYA 2OERA 3HE0A 3ANGA 2TCTA 3ANPA 1QVUA 4MO7A 1ZK8A 2ZOZA 3BR0A 3Q0WA 3Q0VA 4ACIA 4AUXA 4PXIA 5J1UA 2FX0A 1UI5A 3VP5A 4UDSA 2PBXA 2X6OA 3LSJA 4G12A 3TP0A 2ID6A 3BR1A 4D7NA 2IBDA 4M3DA 3BR5A 1T56A 3CJDA 3GEUA 2I10A 3LHQA 5F08A 5J1RA 1A6IA 3C07A 3BCGA 2QKOA 3QKXA 4GFLA 3HTJA 4V2FA 2OPTA 3NNRA 4DW6A 3BQYA 3VOKA 4AC6A 2NP5A 3PPBA 2GENA 5F1JA 3NI7A 2HQ5A 4GCTA 5HSZA 3O8GA 1JUSA 4X1EA 3QPSA 3DPJA 3T6NA 2GBYA 4JNNA 1ZKGA 1VI0A 5GP9A 3BQZA 2UXPA 2DTZA 5H9TA 3VOXA 3CCYA 3RH2A 5FHPA 3SFIA 1QPIA 5K58A 3EGQA 3ON2A 3KNWA 2VKVA 2DG8A 3ZQHA 3CWRA 1SGMA 2QWTA 2WUIA 4MK6A 4D5FA 2XPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCM A;  3KKC A;  2HYJ A;  1JTX A;  1Z77 A;  2NP3 A;  2G7S A;  3VW1 A;  2G7G A;  3VW2 A;  5GPA A;  5F0H A;  2VPR A;  5F0C A;  2PZ9 A;  3BRU A;  2GUH A;  3BTL A;  3Q3S A;  2F07 A;  5D1R A;  5FKO A;  3BJB A;  3P9T A;  4KWA A;  2RHA A;  3C2B A;  4XK4 A;  5D18 A;  2XPV A;  3O60 A;  5IOZ A;  3BHQ A;  5K7H A;  3LOC A;  4HKU A;  5EYR A;  2FBQ A;  3VVX A;  2IAI A;  2XB5 A;  4D5C A;  1U9O A;  3F0C A;  4I6Z A;  2O7T A;  3S5R A;  3F1B A;  3BT9 A;  3HTI A;  5J3L A;  3WHB A;  1T33 A;  3B81 A;  2XGC A;  4AC0 A;  2YVE A;  3BR6 A;  3GZI A;  3E7Q A;  3VIB A;  2HKU A;  4I76 A;  5EFY A;  2G0E A;  3ZQL A;  3NPI A;  2XDN A;  3LWJ A;  2UXU A;  2Y31 A;  2G7L A;  1JUP A;  4B1R A;  5F27 A;  2HYT A;  4NN1 A;  2WGB A;  2O7O A;  3TP3 A;  1ORK A;  3CRJ A;  5HAW A;  3LJL A;  2DG7 A;  3HTH A;  2X9D A;  4JL3 A;  4L62 A;  4MXM A;  1U9N A;  2ZB9 A;  3AQS A;  4V2G A;  2XPW A;  2QIB A;  5AQC A;  4M3F A;  1QVT A;  3AQT A;  3IH2 A;  3MNL A;  2XRL A;  3FK7 A;  4YZE A;  4JKZ A;  2REK A;  3BR2 A;  5J1Y A;  2OI8 A;  4ICH A;  3V6G A;  3G1O A;  3HTA A;  3QPL A;  3ZQF A;  2JK3 A;  2UXI A;  3VPR A;  2RAS A;  3QQA A;  3KZ9 A;  1Z0X A;  3WHC A;  5GPC A;  5CXI A;  5FMP A;  2HXI A;  3ZQG A;  2Y2Z A;  2W53 A;  2UXH A;  5FKM A;  1RKW A;  4JYK A;  3BR3 A;  2JJ7 A;  3BTI A;  4GCL A;  4D7M A;  2EH3 A;  3NRG A;  3BTJ A;  4GCK A;  5FKL A;  1RKT A;  3FK6 A;  2ZCN A;  3SDG A;  4M3B A;  5DAJ A;  3G56 A;  2YVH A;  2XGE A;  5F04 A;  3HGG A;  2IEK A;  5HBU A;  5K7Z A;  5IOY A;  3LSR A;  2V57 A;  2Y30 A;  2RAE A;  2G3B A;  2ZOY A;  2NX4 A;  2D6Y A;  3FRQ A;  3HGY A;  3B6A A;  3PM1 A;  4B3A A;  5EZG A;  2ID3 A;  4ME9 A;  5K7F A;  3PAS A;  1BJZ A;  3HIM A;  5IPA A;  1JUM A;  4NEL A;  3DEW A;  3RD3 A;  4M3G A;  5FGL A;  4W1U A;  3BNI A;  4ABZ A;  3NXC A;  2NS7 A;  5C4Y A;  3O8H A;  2QTQ A;  3FIW A;  5IP6 A;  5CXG A;  4CGR A;  3VVY A;  5CW8 A;  3LSP A;  2VKE A;  2UXO A;  2GFN A;  3Q0U A;  2XGD A;  5EZH A;  3G1L A;  4GFK A;  2WV1 A;  3B6C A;  5D19 A;  3ON4 A;  5FKK A;  4AF5 A;  2OF7 A;  2Q24 A;  3EUP A;  2NS8 A;  2IU5 A;  1JT0 A;  1UI6 A;  3G7R A;  3IH3 A;  5F0F A;  3G1M A;  3IH4 A;  1RPW A;  2QCO A;  3MVP A;  1JT6 A;  3BTC A;  3VVZ A;  3COL A;  2FD5 A;  3CDL A;  2QOP A;  2HXO A;  4M3E A;  2ZCX A;  3VW0 A;  2FQ4 A;  3V78 A;  3QBM A;  3JSJ A;  3DCF A;  3IUV A;  3KKD A;  3VUQ A;  4W97 A;  2TRT A;  5FKN A;  3ZQI A;  2FJ1 A;  1JTY A;  2OER A;  3HE0 A;  3ANG A;  2TCT A;  3ANP A;  1QVU A;  4MO7 A;  1ZK8 A;  2ZOZ A;  3BR0 A;  3Q0W A;  3Q0V A;  4ACI A;  4AUX A;  4PXI A;  5J1U A;  2FX0 A;  1UI5 A;  3VP5 A;  4UDS A;  2PBX A;  2X6O A;  3LSJ A;  4G12 A;  3TP0 A;  2ID6 A;  3BR1 A;  4D7N A;  2IBD A;  4M3D A;  3BR5 A;  1T56 A;  3CJD A;  3GEU A;  2I10 A;  3LHQ A;  5F08 A;  5J1R A;  1A6I A;  3C07 A;  3BCG A;  2QKO A;  3QKX A;  4GFL A;  3HTJ A;  4V2F A;  2OPT A;  3NNR A;  4DW6 A;  3BQY A;  3VOK A;  4AC6 A;  2NP5 A;  3PPB A;  2GEN A;  5F1J A;  3NI7 A;  2HQ5 A;  4GCT A;  5HSZ A;  3O8G A;  1JUS A;  4X1E A;  3QPS A;  3DPJ A;  3T6N A;  2GBY A;  4JNN A;  1ZKG A;  1VI0 A;  5GP9 A;  3BQZ A;  2UXP A;  2DTZ A;  5H9T A;  3VOX A;  3CCY A;  3RH2 A;  5FHP A;  3SFI A;  1QPI A;  5K58 A;  3EGQ A;  3ON2 A;  3KNW A;  2VKV A;  2DG8 A;  3ZQH A;  3CWR A;  1SGM A;  2QWT A;  2WUI A;  4MK6 A;  4D5F A;  2XPU A; 
#chains in the Genus database with same CATH topology
 2ZCM A;  2R7O A;  3KKC A;  2HYJ A;  1JTX A;  1Z77 A;  2NP3 A;  2G7S A;  3VW1 A;  2G7G A;  3VW2 A;  5GPA A;  5F0H A;  2VPR A;  5F0C A;  2PZ9 A;  3BRU A;  2GUH A;  3BTL A;  3Q3S A;  2F07 A;  5D1R A;  5FKO A;  3BJB A;  3P9T A;  4KWA A;  2RHA A;  3C2B A;  4XK4 A;  5D18 A;  2XPV A;  3O60 A;  5IOZ A;  3BHQ A;  3NS4 A;  5K7H A;  3LOC A;  4HKU A;  5EYR A;  2FBQ A;  3VVX A;  2IAI A;  2XB5 A;  4D5C A;  1U9O A;  3F0C A;  2R7R A;  4I6Z A;  2O7T A;  3S5R A;  3F1B A;  3BT9 A;  3HTI A;  5J3L A;  3WHB A;  1T33 A;  3B81 A;  2R7U A;  2XGC A;  4AC0 A;  2YVE A;  3BR6 A;  3GZI A;  3E7Q A;  2FJI 1;  3VIB A;  2HKU A;  4I76 A;  5EFY A;  2G0E A;  3ZQL A;  3NPI A;  2XDN A;  2B3W A;  3LWJ A;  2UXU A;  2Y31 A;  2G7L A;  1JUP A;  4B1R A;  2ZY9 A;  5F27 A;  2HYT A;  4NN1 A;  2WGB A;  4C2M A;  2O7O A;  3TP3 A;  1ORK A;  3CRJ A;  5HAW A;  3LJL A;  3KYL A;  2DG7 A;  3HTH A;  2X9D A;  4JL3 A;  4L62 A;  4MXM A;  1U9N A;  2ZB9 A;  3SWH A;  3AQS A;  4V2G A;  2XPW A;  2QIB A;  5AQC A;  4WIB A;  4M3F A;  3DU6 A;  1QVT A;  3AQT A;  3IH2 A;  3MNL A;  2XRL A;  3FK7 A;  4YZE A;  4JKZ A;  2REK A;  3BR2 A;  5J1Y A;  2OI8 A;  4ICH A;  3V6G A;  3G1O A;  3HTA A;  3QPL A;  3ZQF A;  2JK3 A;  2UXI A;  3VPR A;  2RAS A;  3QQA A;  4OD4 A;  3KZ9 A;  1Z0X A;  3WHC A;  5GPC A;  5CXI A;  5FMP A;  2HXI A;  4U9L A;  3ZQG A;  3K8P C;  2Y2Z A;  2W53 A;  2UXH A;  5FKM A;  1RKW A;  4JYK A;  2R7Q A;  3BR3 A;  2JJ7 A;  3BTI A;  4GCL A;  4D7M A;  2EH3 A;  3NRG A;  3BTJ A;  2PFV A;  4GCK A;  5CQG A;  5FKL A;  1RKT A;  3FK6 A;  2A2F X;  2ZCN A;  3SDG A;  4M3B A;  5DAJ A;  3G56 A;  2YVH A;  2XGE A;  5F04 A;  3HGG A;  2IEK A;  5HBU A;  5K7Z A;  5IOY A;  3LSR A;  2V57 A;  2Y30 A;  2RAE A;  2G3B A;  2ZOY A;  2NX4 A;  2D6Y A;  3FRQ A;  3HGY A;  3B6A A;  3PM1 A;  4B3A A;  5EZG A;  2ID3 A;  4ME9 A;  5K7F A;  3PAS A;  3DU5 A;  1BJZ A;  3HIM A;  5IPA A;  1JUM A;  4NEL A;  3DEW A;  3RD3 A;  4M3G A;  5FGL A;  4W1U A;  3BNI A;  4ABZ A;  3NXC A;  2NS7 A;  5C4Y A;  3O8H A;  2QTQ A;  3FIW A;  5IP6 A;  5CXG A;  4CGR A;  3VVY A;  5CW8 A;  4DVY P;  3LSP A;  2VKE A;  2UXO A;  2GFN A;  3Q0U A;  2XGD A;  5EZH A;  3VTI A;  3G1L A;  4GFK A;  2WV1 A;  3B6C A;  5D19 A;  3ON4 A;  5FKK A;  4AF5 A;  2OF7 A;  2Q24 A;  3EUP A;  2NS8 A;  2IU5 A;  1JT0 A;  1UI6 A;  3G7R A;  3IH3 A;  5F0F A;  3G1M A;  3IH4 A;  1RPW A;  2QCO A;  3MVP A;  1JT6 A;  3BTC A;  3VVZ A;  2R7V A;  3COL A;  2FD5 A;  3CDL A;  2QOP A;  2HXO A;  4M3E A;  2R7S A;  2ZCX A;  3VW0 A;  2FQ4 A;  3V78 A;  3FHN A;  3QBM A;  3JSJ A;  3DCF A;  4IRV A;  3IUV A;  3KKD A;  3VUQ A;  4W97 A;  2TRT A;  5FKN A;  3ZQI A;  2FJ1 A;  1JTY A;  2OER A;  3HE0 A;  3ANG A;  2TCT A;  3ANP A;  1QVU A;  4MO7 A;  1ZK8 A;  2ZOZ A;  3BR0 A;  3Q0W A;  2B1E A;  3Q0V A;  4ACI A;  4AUX A;  4PXI A;  5J1U A;  2FX0 A;  1UI5 A;  3VP5 A;  4UDS A;  2PBX A;  2X6O A;  3LSJ A;  4G12 A;  3TP0 A;  2ID6 A;  3BR1 A;  4D7N A;  2IBD A;  4M3D A;  3BR5 A;  1T56 A;  3CJD A;  3GEU A;  2I10 A;  3LHQ A;  2R7T A;  5F08 A;  5J1R A;  1A6I A;  3C07 A;  3BCG A;  2QKO A;  3QKX A;  4GFL A;  3HTJ A;  4V2F A;  2OPT A;  3NNR A;  4DW6 A;  3BQY A;  3VOK A;  4AC6 A;  2NP5 A;  3PPB A;  2GEN A;  5F1J A;  3NI7 A;  2HQ5 A;  4GCT A;  5HSZ A;  2R7X A;  3O8G A;  1JUS A;  4X1E A;  2YVX A;  3QPS A;  3DPJ A;  3T6N A;  2GBY A;  4JNN A;  1ZKG A;  1VI0 A;  5GP9 A;  3BQZ A;  2UXP A;  2DTZ A;  5H9T A;  3VOX A;  3CCY A;  2R7W A;  3RH2 A;  5FHP A;  3SFI A;  1QPI A;  5K58 A;  4U9N A;  4OD5 A;  3EGQ A;  3ON2 A;  3KNW A;  2VKV A;  2DG8 A;  3ZQH A;  3CWR A;  1SGM A;  2QWT A;  2WUI A;  4MK6 A;  4D5F A;  2XPU A; 
#chains in the Genus database with same CATH homology
 2ZCM A;  3KKC A;  2HYJ A;  1JTX A;  1Z77 A;  2NP3 A;  2G7S A;  3VW1 A;  2G7G A;  3VW2 A;  5GPA A;  5F0H A;  2VPR A;  5F0C A;  2PZ9 A;  3BRU A;  2GUH A;  3BTL A;  3Q3S A;  2F07 A;  5D1R A;  5FKO A;  3BJB A;  3P9T A;  4KWA A;  2RHA A;  3C2B A;  4XK4 A;  5D18 A;  2XPV A;  3O60 A;  5IOZ A;  3BHQ A;  5K7H A;  3LOC A;  4HKU A;  5EYR A;  2FBQ A;  3VVX A;  2IAI A;  2XB5 A;  4D5C A;  1U9O A;  3F0C A;  4I6Z A;  2O7T A;  3S5R A;  3F1B A;  3BT9 A;  3HTI A;  5J3L A;  3WHB A;  1T33 A;  3B81 A;  2XGC A;  4AC0 A;  2YVE A;  3BR6 A;  3GZI A;  3E7Q A;  3VIB A;  2HKU A;  4I76 A;  5EFY A;  2G0E A;  3ZQL A;  3NPI A;  2XDN A;  3LWJ A;  2UXU A;  2Y31 A;  2G7L A;  1JUP A;  4B1R A;  5F27 A;  2HYT A;  4NN1 A;  2WGB A;  2O7O A;  3TP3 A;  1ORK A;  3CRJ A;  5HAW A;  3LJL A;  2DG7 A;  3HTH A;  2X9D A;  4JL3 A;  4L62 A;  4MXM A;  1U9N A;  2ZB9 A;  3AQS A;  4V2G A;  2XPW A;  2QIB A;  5AQC A;  4M3F A;  1QVT A;  3AQT A;  3IH2 A;  3MNL A;  2XRL A;  3FK7 A;  4YZE A;  4JKZ A;  2REK A;  3BR2 A;  5J1Y A;  2OI8 A;  4ICH A;  3V6G A;  3G1O A;  3HTA A;  3QPL A;  3ZQF A;  2JK3 A;  2UXI A;  3VPR A;  2RAS A;  3QQA A;  3KZ9 A;  1Z0X A;  3WHC A;  5GPC A;  5CXI A;  5FMP A;  2HXI A;  3ZQG A;  2Y2Z A;  2W53 A;  2UXH A;  5FKM A;  1RKW A;  4JYK A;  3BR3 A;  2JJ7 A;  3BTI A;  4GCL A;  4D7M A;  2EH3 A;  3NRG A;  3BTJ A;  4GCK A;  5FKL A;  1RKT A;  3FK6 A;  2ZCN A;  3SDG A;  4M3B A;  5DAJ A;  3G56 A;  2YVH A;  2XGE A;  5F04 A;  3HGG A;  2IEK A;  5HBU A;  5K7Z A;  5IOY A;  3LSR A;  2V57 A;  2Y30 A;  2RAE A;  2G3B A;  2ZOY A;  2NX4 A;  2D6Y A;  3FRQ A;  3HGY A;  3B6A A;  3PM1 A;  4B3A A;  5EZG A;  2ID3 A;  4ME9 A;  5K7F A;  3PAS A;  1BJZ A;  3HIM A;  5IPA A;  1JUM A;  4NEL A;  3DEW A;  3RD3 A;  4M3G A;  5FGL A;  4W1U A;  3BNI A;  4ABZ A;  3NXC A;  2NS7 A;  5C4Y A;  3O8H A;  2QTQ A;  3FIW A;  5IP6 A;  5CXG A;  4CGR A;  3VVY A;  5CW8 A;  3LSP A;  2VKE A;  2UXO A;  2GFN A;  3Q0U A;  2XGD A;  5EZH A;  3G1L A;  4GFK A;  2WV1 A;  3B6C A;  5D19 A;  3ON4 A;  5FKK A;  4AF5 A;  2OF7 A;  2Q24 A;  3EUP A;  2NS8 A;  2IU5 A;  1JT0 A;  1UI6 A;  3G7R A;  3IH3 A;  5F0F A;  3G1M A;  3IH4 A;  1RPW A;  2QCO A;  3MVP A;  1JT6 A;  3BTC A;  3VVZ A;  3COL A;  2FD5 A;  3CDL A;  2QOP A;  2HXO A;  4M3E A;  2ZCX A;  3VW0 A;  2FQ4 A;  3V78 A;  3QBM A;  3JSJ A;  3DCF A;  3IUV A;  3KKD A;  3VUQ A;  4W97 A;  2TRT A;  5FKN A;  3ZQI A;  2FJ1 A;  1JTY A;  2OER A;  3HE0 A;  3ANG A;  2TCT A;  3ANP A;  1QVU A;  4MO7 A;  1ZK8 A;  2ZOZ A;  3BR0 A;  3Q0W A;  3Q0V A;  4ACI A;  4AUX A;  4PXI A;  5J1U A;  2FX0 A;  1UI5 A;  3VP5 A;  4UDS A;  2PBX A;  2X6O A;  3LSJ A;  4G12 A;  3TP0 A;  2ID6 A;  3BR1 A;  4D7N A;  2IBD A;  4M3D A;  3BR5 A;  1T56 A;  3CJD A;  3GEU A;  2I10 A;  3LHQ A;  5F08 A;  5J1R A;  1A6I A;  3C07 A;  3BCG A;  2QKO A;  3QKX A;  4GFL A;  3HTJ A;  4V2F A;  2OPT A;  3NNR A;  4DW6 A;  3BQY A;  3VOK A;  4AC6 A;  2NP5 A;  3PPB A;  2GEN A;  5F1J A;  3NI7 A;  2HQ5 A;  4GCT A;  5HSZ A;  3O8G A;  1JUS A;  4X1E A;  3QPS A;  3DPJ A;  3T6N A;  2GBY A;  4JNN A;  1ZKG A;  1VI0 A;  5GP9 A;  3BQZ A;  2UXP A;  2DTZ A;  5H9T A;  3VOX A;  3CCY A;  3RH2 A;  5FHP A;  3SFI A;  1QPI A;  5K58 A;  3EGQ A;  3ON2 A;  3KNW A;  2VKV A;  2DG8 A;  3ZQH A;  3CWR A;  1SGM A;  2QWT A;  2WUI A;  4MK6 A;  4D5F A;  2XPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...