4JYKA

Structure of e. coli transcriptional regulator rutr with bound uracil
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
201
structure length
201
Chain Sequence
RSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator RutR
publication title Structure of E. coli Transcriptional Regulator RutR with bound uracil
rcsb
source organism Escherichia coli
total genus 77
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4jykA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jykA02
2DMUA 1WH7A 3HOVJ 2X6OA 3E7QA 3AQSA 5C3EJ 5J3LA 3A01B 3Q0VA 1NTCA 3BR1A 5F08A 3GTOJ 2GBYA 3SFIA 2RASA 2D6YA 2LVSA 5FKKA 3RZDJ 3JR9A 3OOUA 4GFLA 4MO7A 3A03A 3HGGA 1NK3P 5DS9A 2XPWA 5FKLA 3S2HJ 4Y52J 3S16J 2W53A 1JKPC 2HXIA 1CQTA 1ETOA 2RAEA 3QPSA 2Y0SN 1JTYA 1UMQA 3SJMA 2OI8A 4FTHA 3VW0A 4A93J 2JMWA 3ZQFA 2VPRA 4BBRJ 2GENA 5FKMA 5GP9A 4QIWN 4JX6A 3COLA 2FJ1A 2ZCNA 2NP5A 5FKOA 3TEDA 2CJJA 4DZJA 5EG0A 3GTKJ 4L62A 2JK3A 4V2FA 2PBXA 5H9TA 4GCLA 2YS9A 1Z0XA 4XRSA 1U9OA 3KKDA 3LSJA 3JRBA 2D5VA 3W6VA 2V57A 3NXCA 2M8GX 2H8RA 1TWGJ 2HKUA 2DMTA 3A02A 1NK2P 2ZOZA 3NAUA 2R5ZB 2XGCA 2IU5A 2XDNA 2UXIA 1MBJA 1MNMC 4I76A 2E19A 1B72B 5E3LA 2E1OA 4NELA 2HOTA 5IP6A 4B4CA 1LFBA 1O4XA 2EBIA 3H3VK 3VIBA 3O8HA 1A6IA 5J1YA 2EQRA 2OERA 3QQAA 5AQCA 4UUTA 5BNGA 5FGLA 3LWJA 3V78A 2G0EA 1VF9A 2UXUA 1HLVA 3BRUA 3UKGA 5IYCJ 2IBDA 3ANGA 4HNVA 1LE8A 2GM4A 4QTRA 3HOYJ 2ZOYA 3GEUA 3S5RA 1WCMJ 1Q1VA 2L7ZA 2L7MP 2R0QC 2Y2ZA 4AC6A 5M5YJ 1JJ8C 5FLVA 3CDLA 2MW8A 2PMZN 3GTPJ 2L7FP 1W0UA 4XIDA 3JRGA 1FEXA 1OCPA 4NDLA 4RDUA 4RBOA 1LFUP 2IAIA 2UXOA 3BJBA 2YU9J 1AU7A 3TP0A 1RKTA 3S1RJ 1A5JA 1GV5A 1OCTC 2CUFA 2Y30A 1T56A 2M0CA 4FISA 4XRMA 2QIBA 3VVXA 1E3OC 3G7RA 1TWAJ 3LSGA 4UUSA 3JRDA 3HTHA 1GV2A 3QBMA 2Y9YA 3PM1A 1X58A 3O8GA 4JNNA 2DN0A 2L0KA 4XICA 4A69C 1X2MA 1AKHA 2HOAA 1IDZA 5K7FA 5C4XJ 1FIPA 5E3NA 2R92J 4DYRA 3K2AA 3LJLA 2FQ4A 3RZOJ 2VKVA 2HYTA 1DU0A 3AQTA 5DAJA 4BBSJ 2EH3A 5C44J 1IG7A 1YRNA 1H88C 3IH4A 3CRJA 1MBFA 4XRSG 2DA7A 3NARA 4Y7NJ 3MVPA 2G7GA 5F04A 3JREA 4CGRA 1GVDA 2XGEA 4IEJA 5IP7J 3KNWA 1VFCA 4EEFG 5HODA 1JKRC 2COBA 5IYDJ 2HYJA 4ME9A 1Y1VJ 3JRHA 2N8GA 2QTQA 4AC0A 1JUMA 3NRGA 2R5YB 4IHVA 2EZKA 1POGA 2NOGA 3B6AA 2VUMJ 1IRZA 3ZQCA 2JA6J 3PPBA 5F27A 2B63J 1MH4A 5IOZA 3CJDA 3C07A 2DMPA 1WI3A 2H1KA 1XC5A 4AYBN 3P9TA 1H8AC 3F0CA 5EDNA 1ETYA 4JP0A 2F07A 3F1BA 3FISA 4QSHA 1Z77A 2QOPA 2XB0X 1ZR2A 1JKOC 2M34A 3BTCA 1T33A 1JTXA 2Q24A 3VOKA 2G7SA 2NP3A 2ZCXA 5HAWA 5HBUA 3DCFA 3ZQGA 3HGYA 3PO2J 1TWHJ 4DZPA 3VUQA 1WPKA 1U8BA 2GUHA 1QVUA 3GTQJ 4D7NA 5E3OA 5GPAA 1VNDA 1DU6A 1UHSA 4KWAA 1TC3C 3IH2A 4MLOA 3JSJA 2AO9A 2WAQN 5EEAA 2X9DA 1RPWA 3OSGA 1QVTA 2K9QA 3L1PA 4X1EA 4FE4A 5EF6A 4AUXA 3TP3A 2WB1N 4M6VA 3VPRA 2KDZA 1GUUA 2DA6A 2JJ7A 1B8IB 5EGOB 2DG7A 2EZIA 5JLWA 2XB5A 1ETQA 4CYCB 3BTLA 4JL3A 1PUFA 2OF7A 3ANPA 2M2EA 5DTDA 4PXIA 1F43A 3BHQA 3V6GA 2HI3A 4MIMA 4X6AJ 3FK7A 5FLMJ 5D19A 3LHQA 3O60A 3JRAA 3WHBA 2DJNA 1ENHA 2TCTA 4D7MA 1IDYA 2NVXJ 2LD5A 2JA7J 3BR5A 3HE0A 3MNLA 2DA2A 1MBEA 3DPJA 3TW6A 2ECBA 5F0CA 2DA5A 3FK6A 4GFKA 1BJZA 2XPVA 2I10A 2E2JJ 3BG9A 3I4MJ 2YVHA 4M3BA 1MBGA 4MFDA 4BXXJ 5FHPA 1APLC 3SDGA 3IUVA 1TWFJ 3HTJA 2NVQJ 2PZ9A 2VI6A 4I6ZA 4A3LJ 1SGMA 3D1NI 3PASA 3TW7A 3IV5A 4A3MJ 3VOXA 5HSZA 5IP9J 1X2NA 3A01A 3GBGA 1JUSA 1BA5A 3NNRA 4M3FA 3LNQA 3PO3J 1XS9A 4GCKA 2ID3A 1I6HJ 1K61A 3FIWA 3BG3A 1ETKA 3H0GJ 5FKNA 2ME0A 2JWTA 5EG0B 5F1JA 3Q0WA 3FKIJ 4XK4A 5C4JJ 4M3GA 3BQYA 3HM5A 4D5CA 1IGNA 2E2IJ 5FMPA 5K7ZA 2DA4A 3DEWA 2NS8A 2R93J 5M3FJ 1GDTA 2O7OA 2MG4A 2FBQA 4UDSA 2CUEA 3Q3SA 1ZK8A 1SFOJ 1P7JA 2G3BA 2ECCA 2O7TA 4J19A 4A3DJ 1ETWA 3BT9A 3S2DJ 3HKZN 4ABZA 5JLXA 2G7LA 4S0HB 5J1RA 1IJWC 5M5XJ 2LTPA 3HOZJ 2R7ZJ 4A3FJ 1MSFC 2ELKA 1G2HA 2AHQA 3CCYA 4MK6A 1QRYA 4JX5A 4W97A 3QKXA 1JT6A 3EUPA 3NPIA 1JT0A 2XGDA 3HOWJ 4NN1A 4AF5A 4A3KJ 4L5EA 1IV6A 1MBHA 1QPIA 2XRLA 3BNIA 2EZLA 3GTLJ 5F0HA 4A3JJ 2QWTA 2UXPA 4JX4A 2E2HJ 3ZQIA 3RD3A 5K7HA 3BR2A 2W48A 3VP5A 1LE8B 2R5ZA 4YZEA 4W1UA 1H89C 1FTZA 2CU7A 2EZHA 1TWCJ 2LK2A 2ZCMA 4HKUA 2O8KA 3S1QJ 3B81A 2MGQA 2KT0A 4FCYA 1HCRA 2VKEA 2WGBA 2DMNA 2FX0A 1B72A 2OPTA 3BR3A 3HTAA 5CXIA 1ZKGA 2DA1A 2QF7A 4M3EA 5E3MA 3HOXJ 1S7EA 4M3DA 4A3CJ 4C3IJ 2GLOA 3RQIA 2DA3A 5M3MJ 1W0TA 2L9RA 3CMYA 2ID6A 3ZQHA 1RESA 1HDDC 3OSFA 3G56A 2LFBA 4DYQA 5K58A 4UUSB 3G1OA 1GT0C 4ICHA 2JA5J 1AHDP 1WH5A 1FIAA 3RH2A 4D5FA 3HBLA 3LSRA 2M9HA 4JKZA 2X48A 3VW1A 2NVYJ 2RHAA 3ZOBA 1HDPA 3S1NJ 3HIMA 2MSYA 1AKHB 3VVZA 3BR6A 1JUPA 1XG1A 2WV1A 2LKXA 3S15J 1I3QJ 1OFCX 4LOCA 3HOUJ 1UI6A 3BTJA 4IHXA 3RKQA 2HQ5A 3CWRA 3MN2A 3CQZJ 5EYRA 1ITYA 2NVTJ 1RR7A 3G1MA 4DYCA 2XSDC 2IEKA 3I4NJ 3GTJJ 5F0FA 2LLKA 1P7IA 4JYKA 3S17J 4MXMA 4G12A 5D1RA 3T6NA 1R9TJ 5IYBJ 1YRNB 3M3YJ 3KZ9A 2LY9A 3ON4A 1HOMA 1JGGA 4MFEA 5CW8A 1ORKA 2ZB9A 5EZHA 2ME6A 1ZQ3P 5C4YA 2LP0A 2FD5A 3NI7A 1RETA 3VW2A 2GFNA 3GTMJ 3LOCA 4IHYA 4DW6A 1ETXA 1MH3A 2JA8J 2XPUA 1F36A 3VVYA 1OJLA 5D18A 2CQQA 1EF4A 3HDDA 3WHCA 1MSEC 2QCOA 1BW5A 1VI0A 1JKQC 2QKOA 2Y9ZA 3C2BA 1FJLA 3KKCA 3BR0A 4A3GJ 1Y1WJ 1U9NA 2HDDA 3BCGA 4B3AA 3S1MJ 3HTIA 1ZTRA 3K7AJ 4V2GA 5IPAA 4A3BJ 2WUIA 2DMQA 1ETVA 4A3IJ 3BQZA 1IUFA 5M5WJ 4C2MJ 3QPLA 5EZGA 3GTGJ 1IC8A 2JN6A 3B6CA 2R5YA 4GCTA 2YVEA 2TRTA 3HB9A 1WGXA 1I50J 2CQXA 2REKA 4B1RA 5FJ8J 2K9NA 4BY1J 3MKLA 4GFBA 1RKWA 2P81A 3M4OJ 1UI5A 1BW6A 2K40A 5EFYA 3BG5A 4A3EJ 1ZR4A 2LR8A 3ZQLA 5GPCA 3Q0UA 2HOSA 5CXGA 4BY7J 2UXHA 1U78A 2K9SA 3ON2A 1SANA 1PUFB 2O9LA 2NS7A 3GZIA 4IHWA 4ACIA 2DG8A 1K83J 3LSPA 3G1LA 1HF0A 1D5YA 3E7LA 2NX4A 1MBKA 3JRCA 9ANTA 4FE7A 4C3JJ 3S14J 3HEFA 3JRFA 1JJ6C 2Y31A 1BL0A 2HXOA 3JRIA 4BKXA 3FRQA 1UG2A 3EGQA 2DTZA 3BTIA 5EGOA 1B8IA 1ZGWA 5IOYA 4C3HJ 4CYCA 2CRGA 3IH3A 2YUSA 1FTTA 3OIOA 5J1UA
chains in the Genus database with same CATH superfamily
4AVPA 4HEA2 3BZ6A 2X6OA 4B48A 3AQSA 3F8BA 2EIMH 1IRXA 2QQ8A 3G4SI 2ZKZA 1ZARA 1IRGA 4QPQA 1YYVA 2QEXI 2GBYA 2CQNA 2XKOA 1XB4A 3CJTB 2E1NA 2LVSA 4ZDLA 2VBZA 3ERED 2IT0A 3K10A 3JR9A 2DI3A 3S2WA 1OR7C 3DBHB 3F72A 3HGGA 3KP4A 3MEXA 4C9YA 1K6YA 1N25A 3S2HJ 2F5VA 2X85A 1P4AA 2HXIA 5DCMA 1T2KA 1ETOA 3ULQB 2EFPA 3GMEA 2Y0SN 1UMQA 3X2QH 1XN7A 3ERMA 3ZQFA 2VPRA 2L3DA 3CUQC 3WGGA 1MW7A 4JX6A 4XR6A 3COLA 3BCAA 3FKJA 4Z6YA 2FJ1A 4L9VA 2ZCNA 3RQ4A 3SQNA 1XTAA 4DIQA 2CJJA 2DFHA 3OIPA 2JK3A 1RZ4A 4GCLA 2H94A 3F8CA 1Z0XA 1SC7A 1U9OA 2CO5A 3KKDA 4KMUX 2KFDA 3I9V2 2D5VA 2CYYA 3W6VA 2V57A 3K69A 4MTEA 2D45A 3SWHA 1QHGA 3QU6A 2HKUA 2DMTA 2HDWA 2Y0MA 1E2XA 3L2WA 3F22A 1DDNA 2W82A 3ABKH 2FMLA 2DO7A 4E7KA 3A0HC 3GUDA 3I59A 1ONVA 2E19A 2E60A 4CDGA 1B72B 3M8FA 5E3LA 2M7AA 2HOTA 2FRHA 1NG7A 3QWLA 2NNYA 1A6IA 4OWRB 4PJLA 5K1YA 1LEBA 2VQHA 4N9IA 5FGLA 5BNGA 3IHUA 4L0YB 1YW9A 2VBYA 5DCFA 5D8KB 3BRUA 5IYCJ 5GTHC 3HOYJ 2R7QA 1PYVA 2L7ZA 2KRCA 4HOBA 4KICA 3LAPA 1HBXG 5B1AH 4IRVA 3M1CA 1U5TC 2PMZN 2LDUA 4HX8A 3RDIA 2ZXHA 4XIDA 1CF7B 1LFUP 2DPUA 4CZCA 3BJBA 2YU9J 5E1WA 1RKTA 3OR1C 1QZYA 1BI1A 1R23A 2JPCA 2F5DA 4KYWA 2KLOA 2W84A 1T56A 2JRTA 2RNGA 2XIGA 2QIBA 3QOEA 4OIRF 2DOFA 2CQ7A 3O3KA 4UUSA 2YVXA 2HDCA 4Q5SF 2JZYA 3EUHC 3DTEA 3PM1A 1X58A 1JGSA 1B6AA 2F4OB 4HA8A 1REPC 4IHTA 1G3WA 1HSTA 2DN0A 5D6FA 3VB2A 4BE2A 4IQJA 1S6LA 2HWVA 4A69C 1FOWA 1X2MA 3QPHA 4G9YA 4GRIA 2HOAA 2IA0A 4OU0A 1SMYF 4C30A 5E3NA 5CQGA 1L0OC 4DYRA 1BIBA 5FGMA 4GYIA 4L5IA 1TQPA 5FD6A 1BOBA 5TJJA 2IS2A 2HS5A 4AIJA 2HR3A 1OLTA 3RYPA 3KIOA 3ZCOA 3D5SC 2CQKA 4Y7NJ 3DEEA 4DQ2A 5F04A 3IKTA 2G7GA 1WKMA 4EJVA 2MLGA 3JREA 4I09A 2GXBA 4CGRA 1GVDA 4BQAA 5HODA 1NH3A 2COBA 1WZ2A 1P9QC 2EPFA 3HUGB 4EMSA 1LEAA 1XCVA 4ME9A 1UG0A 4U0WA 2M1BA 1MKMA 4AC0A 1VQPI 3DXJF 3NRGA 5J47A 3WTYC 3CMAI 2BZTA 1POGA 3B6AA 1DP7P 2OAZA 3ESWB 3MZYA 4I0BA 2JA6J 4IQ4A 3K4NA 2J5PA 3CJDA 3DF8A 4II3A 1TBXA 2ELHA 2NNNA 1Z6TA 2JSPA 4JP0A 4F3QA 2L5QA 4QSHA 3F8MA 3QYBA 3BCBA 1GLNA 3SXYA 4RLQA 4HDVA 4RM2A 1R22A 4H4KC 1R5ID 3KZYA 3UR3C 3V4GA 3JTHA 3J80Z 5DDGA 3P5JA 1T98A 1TNTA 3DCFA 2YX4A 3HGYA 3K4KA 3VUQA 2GUHA 3JSOA 4P96A 2FE3A 1LVKA 4L0ZB 1VNDA 2NAZA 5LHHA 3IH2A 2Q1ZB 3VSLA 2Y75A 1AA7A 3OSGA 1QVTA 3L2VA 1Y6IA 1KZHA 3LL7A 4FE4A 4XNFA 5D6EA 4AUXA 5EF6A 3TP3A 2KDZA 4FETA 4WK8F 1GUUA 2KKOA 1ERDA 5JLWA 1B1BA 2W24A 2B0LA 1R1VA 3NWSA 1YX3A 3W6JB 4JL3A 3EUAA 1J5YA 3WTVC 1PUFA 1V55H 3E5XA 3DTIA 1IZ1A 1MNDA 2OCEA 4NUBA 3HRMA 3LHQA 1VQLI 3K70D 2CW8A 4D7MA 2NOJB 2LD5A 3HE0A 4I0AA 3WG9A 1W4MA 2DA2A 3LA3A 3CC4I 3HKZA 5F0CA 5HDKA 2DA5A 1P6RA 2HYGD 4U7DA 4IO9F 5JI6A 2ACJA 2I10A 1QNTA 3CCQI 3F8NA 3I4MJ 4BXXJ 2XUBA 2DPDA 3K0LA 5FHPA 3GZ6A 3GVAA 1MMDA 2PZ9A 1IN5A 1A04A 3NWTA 1OYIA 3D1NI 2ZC2A 4XSXF 3HRUA 4ENMA 4PJJA 1MMSA 3TW7A 4KUMA 5IP9J 3GZ5A 3ZR8X 2B9SA 1CGPA 3NNRA 5CYVA 3PO3J 3EPZA 1XS9A 4E7HA 4AU7A 1W5SA 2K9LA 2RGVA 3BG3A 3FIWA 2BHYA 2Q2EA 5F1JA 3FKIJ 4ESFA 2XROA 2K9MA 4M3GA 3BQYA 3HM5A 4NQWA 3WODF 4AYBA 2E2IJ 1IN7A 1UJ8A 5L3EA 3QODA 4BU2A 5M3FJ 1WJ5A 4WF2A 3J7YJ 1OISA 3N05A 5HNHA 2FBQA 2CG4A 2GOXB 1P7JA 3D0SA 2ECCA 2FA5A 2O7TA 2P7CB 2F4MB 4EM1A 3BPVA 3FHZA 4Y4RA 4ABZA 2BEOA 1RUNA 1MSFC 4D0PA 4MK6A 3W2WA 3CCSI 2BW3A 3EQLF 3EUPA 2GAUA 3OR2C 3NPIA 2AXTC 2XGDA 1PP7U 2GA1A 1FNNA 2HVQA 1W36C 1IN8A 1IV6A 2E1MB 1I27A 4HX4A 2XRLA 2O61A 2QWTA 3ZQIA 3KZIC 2LC2A 2W48A 4PCQA 2PI0A 2A2FX 4HKUA 1FTZA 3ECOA 2EZHA 1Q1HA 4FCYA 2KT0A 4B47A 3SEZA 3CD6I 3QAHA 4P9UA 3R4KA 3HTAA 2Y69H 1ZKGA 4M3EA 5E3MA 2GXGA 2IS4A 2O03A 2R7RA 2LKPA 2CV1A 1QHHD 4A3CJ 2NYXA 3CUQB 4C3IJ 5H2FC 1ON2A 3SZTA 3V7CA 4WWCA 2GLOA 1FMWA 3BZCA 4BEHA 4MQVA 4EATA 2H1LA 3MQ0A 3MKZA 1FBQA 2R7SA 2L9RA 3ZQHA 3OYGA 1HDDC 2Q8KA 1LQ1A 3G1OA 3BROA 1GT0C 4HRIA 4OIOF 3F8FA 2CS3A 2OUMA 4D5FA 3HBLA 4KN4X 3IC7A 2M9HA 4HQMA 2NVYJ 5CLSA 2CH0A 2K3PA 3DU6A 2MSYA 4LIVA 3MMYB 5D4SA 1X4OA 3WTSC 1XG1A 2A6TA 4ZYEA 2LKXA 3S15J 1PJRA 2XAFA 4IHXA 5EYRA 4EV0A 1MJAA 3PIPF 1K4TA 1DUXC 1B59A 3G1MA 4DYCA 3E6CC 1D0ZA 1W5TA 3FX3A 4EJWA 3GTJJ 1MMGA 2LLKA 5LHGA 4JYKA 2EA4A 4FT8A 1FPQA 3E97A 5D4RA 3E5UA 5GAEJ 1R1TA 1YRNB 4M6XA 3WTUC 1Y56A 3BY6A 4XLNF 5A2QZ 3ON4A 4ON0A 4YFKF 4CCNA 2DXIA 1FOXA 4MFEA 2WAFA 5F6FA 1ZQ3P 2ZJRF 2FD5A 2X6XA 4YIFA 3NI7A 3CLQA 3I4PA 2PFVA 1VQMI 4MTDA 4G7ZF 2UWMA 1IXCA 1R58A 1O7FA 3V7SA 2EK5A 2XPUA 1OJLA 4HBLA 3ZQ7A 1FZPB 2V1DA 3HDDA 2KDOA 2LF8A 1EF4A 5JR3A 2FNPA 2XAJA 3C2BA 2Y9ZA 4PGGA 4IX7A 4HDUA 1QGPA 4RAFA 1W7PA 1Y1WJ 3KP3A 4KN7X 2LMDA 1O3QA 4UUVA 4ZZLA 3S1MJ 3HTIA 1ZTRA 3K7AJ 5IPAA 2HPMA 2ZCWA 4JOMA 2VOOA 5GTIC 1IUFA 5AONA 2O6GE 1VQNI 4G7HF 5M5WJ 4Q47A 1YI2I 4C2MJ 4NC7A 3GTGJ 3VYUB 3L09A 2W25A 2EA2A 1FYLA 3B6CA 4GCTA 5JHUA 4NBQA 4LB5A 1I39A 1WGXA 4I98B 2P5KA 3BJ6A 4JK1X 3VYRB 3FMQA 1YHQI 2YR2A 2K9NA 2VC0A 1WI9A 3OYJA 2DK5A 2KMUA 3HHGA 2GXAA 3QYEA 4BL0B 1V3FA 3CP2A 1Z6RA 1WSUA 2P81A 3M4OJ 3JAMK 2LKSA 1IV8A 1P2FA 2MH9A 2K40A 4KISA 1UI5A 3BG5A 3QU3A 2HNHA 3LWFA 3ZQLA 1J7KA 3CJNA 3CCUI 5CXGA 4BY7J 2K9SA 1BC8C 3ON2A 1ZAOA 2OA4A 3H0DA 2LSOA 4IHWA 1G3SA 4S05A 4MNUA 1V4RA 2QLZA 1P4XA 4XM3A 3CZ6A 3JRCA 4FE7A 3TOAA 4F55A 9ANTA 3HEFA 1VZ0A 4M9XA 4GYGA 2BXYA 4UVCA 4LK1F 3J81Z 2Y31A 5J6XA 1HQCA 1WJEA 2QENA 2V6EA 3FRQA 1UG2A 3EGQA 2DTZA 1B8IA 1KQ0A 5EGOA 3HOTA 1YQAA 1FBUA 2QVOA 1XCBA 2CRGA 4DBQA 4HAMA 1Y8RB 2EFNA 1DQUA 1V5EA 3CJRB 1B4AA 3T6NA 3QYFA 5J1UA 2DMUA 2E5NA 1WH7A 2ZMEC 5C3EJ 2NXNB 3MD2A 4I01A 3BWGA 5J3LA 3HC7A 3A01B 2LRDA 3GTOJ 5ILUA 2X1DA 3VOEA 3SFIA 3I64A 3FXQA 3IL2A 1ZG5A 5L3BA 2XVCA 5FKKA 2R7UA 5LBQA 4XLCA 4GFLA 1USTA 5B66C 4M74A 4LIUA 2XPWA 5FKLA 3P9KA 4J00A 3TO6A 3S16J 2DODA 3FHNA 1FLIA 4IRHA 1JKPC 1E0EA 3I71A 1CQTA 3CCMI 3I54A 2J5OA 3WE3A 4B44A 1OKRA 3QPSA 3KEQA 2OI8A 4FTHA 1HA8A 2GWRA 2M30A 2L4AA 4A93J 1DPRA 2JMWA 2EIJH 4F92B 5FD5A 2HOEA 2NP5A 2O5RA 2VQGA 4P55A 4WXHA 3H3ZA 1YJWI 5H9TA 2HZTA 5EEHA 1V5GA 5CJ9A 1E17A 3CCEI 4XRSA 5E18F 3LSJA 3ML6A 4E7SA 1YS6A 4PUSA 3VYTB 5ICEA 1R36A 2DQLA 2VQLA 4IXAA 2P7VB 5DD4A 5LGNA 1NK2P 2RKHA 2ZOZA 3NAUA 2R5ZB 4DJAA 1YG2A 3OYBA 4A12A 5CVIA 4BJ6C 2PMUA 4CZZA 2VLAA 3R6SA 1SVLA 4BNCA 4DBRA 5LHIA 1FYMA 2DK8A 4NELA 4XLFA 4B4CA 1SFKA 2EBIA 4R1HA 3CJQB 1VTNC 2W7NA 5L3CA 4Y13A 2OERA 2BY1A 3TDUC 1EH6A 5E79C 2XGXA 3L9FA 1HLVA 4XMYA 4UY8I 2F6CA 1FP2A 2KQRA 1G6NA 1TW2A 4KIFA 3K4CA 3H1CA 3ANGA 2OQRA 4MGRA 2GM4A 1R5GA 4QTRA 4HLYA 2ZOYA 1WCMJ 5LEKA 4WXDA 2L7MP 2R0QC 5M5YJ 1QA6A 2DAOA 5L3GA 1FEXA 4BACA 1OCPA 3ELKA 4S04A 2IAIA 2BVLA 4IOAF 1JHHA 3ZMDA 3HYIA 3TP0A 4HG2A 2BHZA 3JCUC 4O5VA 2EIKH 4HF2A 2E1CA 1U8RA 2M0CA 3HL2A 1SVOA 5KK1A 3FMRA 2OV7A 1E3OC 3G7RA 5FO5A 2UV1A 4UHTA 3HTHA 4CSWA 5GAGJ 1Z3XA 3QBMA 4E7IA 3O8GA 1TQIA 2MLKA 4HF1A 2QBYA 4XRFA 2PJRA 1IDZA 4L9NA 4UVAA 1FIPA 3S93A 2LBFB 3RZOJ 2HYTA 2HFHA 3AQTA 5DAJA 3V42A 2W4SA 1IG7A 4LG0B 2D2WA 2ZSIB 2GQQA 3IH4A 2NVUB 1MBFA 4XRSG 2DA7A 2L9NA 1MDMA 4M73A 4PJMA 2WA0A 2FBIA 3MZ8A 2IGOA 5IP7J 3MFKA 4IEJA 4BQOA 2L9SA 4EGYA 1JKRC 1BI2A 2V1NA 4Y33A 3JRHA 1SFUA 4G94A 2R5YB 2XF7A 4WX9A 2NOGA 5HS9A 4FASD 5K5RA 4U87A 2QSFX 3GFIA 3KP5A 5BPDA 3H9GA 2LH9A 2H1KA 4AYBN 2O0YA 3F0CA 2ZJ2A 4KA4A 1ETYA 1RNLA 2VE8A 1YS7A 3EETA 3PFYA 1ZR2A 2ETHA 2M34A 3H35A 3ONQA 5CPRB 1JTXA 2WWYA 3DKXA 4CHUA 3VOKA 2KHMA 3TKYA 5HAWA 3ZQGA 4XL9A 1FYKA 1O7LA 3PO2J 4DZPA 4B09A 2Y48A 1YJ9I 1V54H 2FBKA 5E3OA 2L9VA 1TLHB 5HS7A 3O2PE 1SFEA 4KWAA 4ASNA 1TC3C 3DFGA 4PFOA 2X9DA 3EYIA 1O3TA 3U9GA 3L1PA 1FWZA 3L7WA 1XSDA 1VQ8I 1FBSA 2WB1N 1R00A 4N4NB 2FBHA 3PSFA 5D8LB 1HC8A 3ABMH 1ETQA 1S29A 4CYCB 3BTLA 4IJAA 3KP2A 2M2EA 5DTDA 1FSEA 1EV7A 2H8WA 3BHQA 4MIMA 5ICFA 2DBBA 3OOPA 5FLMJ 2E7WA 1K79A 1T0FA 3JRAA 5CVRA 3HSEA 2DJNA 4OAZA 4DOZA 1EA3A 4LGWA 1SD5A 1TW3A 4LFUA 1E3HA 1MBEA 3DPJA 2ECBA 2RN7A 3Q9SA 3E6BA 3FK6A 4HZFA 1TQMA 1WQ2A 5IT9K 3BG9A 5LFAA 4MFDA 3C2HA 1APLC 3VSKA 4RMNA 1R4MB 2F5CA 4HLXA 4L9JA 4IRGA 3REOA 3OYDA 2NVQJ 2H6CA 4I6ZA 3CCRI 2FJI1 3KYCB 3VFZA 2XF5A 1HW1A 4LJZF 3WTXC 3K70C 3VOXA 5HSZA 2OQGA 4ENJA 1X2NA 2V6CA 4G6TB 3GBGA 3VDXA 1HW5A 2CV2A 1UFMA 3T8TA 3OL3A 4GCKA 2ID3A 1X4PA 1DGRM 2RQQA 1ZLKA 2ME0A 2PEXA 5DV5A 5EG0B 2JRMA 3W2AA 2IW5A 4NB5A 4E7ZA 5FMPA 3LA7A 1B9MA 4OINF 4HX7A 4KNYA 5K7ZA 2DLLA 4ENNA 1VQ9I 4I02A 2NS8A 5DM6F 2OBPA 2O7OA 4KDPA 2CUEA 3Q3SA 2G3BA 4J19A 4G6QA 5CVUA 2LG4A 1VQKI 2YX7A 5FRMA 1J2XA 2PBIA 2A5WA 2QQAA 3V8LA 5BMZA 1ON1A 4S0HB 5J4VA 2M45A 5J1RA 2LTPA 1IJWC 1G4DA 2R7ZJ 4BHCA 6PAXA 2ELKA 2ZMEB 2AHQA 3GXOA 5D5XB 1QRYA 2VONA 3RYRA 4N0BA 4C2UA 3WTTC 4UB6C 5FROA 4E4HA 1K78B 4WCGA 4AF5A 1FP1D 5FLXK 3BZKA 4A3JJ 1SAUA 1Y39A 4JX4A 3CMMA 3CMEI 3WTWC 5K7HA 3RD3A 1ZN2A 4LLLA 3K1NA 2DT7B 1LE8B 4YZEA 3K2ZA 4W1UA 1H89C 2CU7A 2ZCMA 4YFNF 2O8KA 3CESA 3B81A 2ISZA 4UV8A 1B72A 5D5UB 5H20A 4PSXA 2P6SA 2X51A 5LRRA 5L3DA 1YTYA 3HG9A 4KIBA 4GDFA 2Z1DA 2V9PA 1SAXA 3EDPA 4CXFA 3D5LA 4ZH4F 3RQIA 2STTA 5M3MJ 1W0TA 3KE2A 1EJ9A 1A36A 1RESA 2MD0A 1X1DA 5K58A 2JA5J 1MMNA 1FIAA 1WH5A 3GLXA 4AIKA 3RH2A 5JVGF 3SZGA 2G7HA 2F5FA 2XC7A 4JKZA 3GX4X 3VW1A 2RHAA 4B8XA 4LD5A 2DOEA 1AKHB 2OTJI 3VVZA 1CF7A 4RGUA 4BJTA 2WV1A 2M5WA 1OFCX 1KU2A 3DPTA 5EJCA 1UI6A 3BTJA 3CWRA 2HQ5A 1FMVA 3CQZJ 1TZLA 1JHFA 3T5XA 3K4MA 3ZN1A 2K3FA 3P7NA 5ED4A 4IL6C 4MXMA 3PIOF 1OYWA 2R7FA 1Z91A 1R9TJ 1ZELA 5IYBJ 4UVBA 2DW4A 5LGUA 1N77A 2IJLA 4RAZA 1LUJB 1HOMA 1DGWY 5CW8A 4XOTA 1GHCA 2O3FA 2OC6A 1ZRDA 2ME6A 1P92A 2DT5A 3GF2A 2CGPA 2LP0A 1RETA 3RPUD 3K1PA 5KAFC 4KMFA 2GFNA 3OYNA 3AG2H 2PLYA 1YJNI 3CO7C 3RJPA 1O57A 4DW6A 4PGHA 1MJBA 5ICCA 2VBWA 1Z7LA 2GZWA 1D0YA 2CQQA 1UAAA 1UHMA 2CUZA 1FT9A 1FJLA 4ZTJA 3KKCA 2IA1A 2K4BA 4B3AA 3I58A 4A3BJ 2FMYA 3PL8A 2QQ9A 3RKXA 3NQOA 1ETVA 4CA0A 1X19A 4A3IJ 2YU3A 2QKMB 4F91B 4R8HA 2MA3A 5J8FA 2M87A 3HUGA 3QPLA 5L3FA 1D5VA 2KIUA 2ZFUA 3M9AA 1IC8A 3WU1B 4V19K 2JN6A 2FF4A 2AXLA 3J7AY 3IWZA 2FSWA 3HB9A 4ANJA 1I50J 4ZDOA 3OYCA 1XPXA 3KFWX 2DJIA 3K6GA 3KP7A 3LMMA 2W57A 3RSNA 3FBNB 2HTJA 4B1RA 5FJ8J 2X1CA 3S8PA 1ULYA 1YIOA 3F23A 3AFHA 3ZGKA 1UCRA 1WFXA 3MKLA 4GFBA 1Z7UA 3OYFA 1IRFA 1BBYA 5EFYA 1R71A 4Y3OA 4A3EJ 1ZR4A 2A69F 3HJEA 2COMA 3K4LA 5GPCA 3Q0UA 2IRFG 5DM7F 4B3XA 3LA2A 2VJ4A 1KONA 3H36A 2JVHA 1VQ7I 4YEJA 2NS7A 3WE2A 2A6EF 3R0JA 1Z3YA 1XMXA 3LSPA 2H09A 2XAGA 1H9GA 1HF0A 1D5YA 2NX4A 3Q5FA 1MZBA 2V7FA 1QU3A 2Y0SA 2V4JC 3S14J 1J59A 2BV6A 3JRFA 1WVRA 1EH8A 1BL0A 2HXOA 1OQYA 2VKDA 4Q48A 4CICA 5E20A 2DFIA 2ELJA 3OYLA 4RB3C 1VQOI 1IN6A 5IOYA 3ZMTA 4CGZA 3FWEA 1U3EM 1SVMA 4FQGA 2EV5A 3C3WA 3W6KB 2YUSA 4G6DA 3N97A 2OCCH 1W5CC 4BQNA 3CTAA 3OY9A 2HTSA 2TDXA 2H27A 4HNUA 3HOVJ 2M4KA 2K4JA 3EUKL 3Q0VA 3HPHA 3BR1A 1FOKA 1XSVA 5HVQC 2D6YA 5B1BH 1T0FC 4UV9A 1QZEA 3WGHA 3RZDJ 3OOUA 2FU4A 2MYSA 4MO7A 3A03A 3JSPA 1NK3P 1KYZA 2V1UA 3OIQA 2Z9OA 4Y52J 2W53A 3M7GA 3BP8A 1IW7F 5BPIA 2JUCA 1JTYA 5GAHJ 4LITA 3VW0A 4YIIA 4HF0A 2XV4S 2GENA 3B73A 1OCOH 3HHHA 5CKTA 4M72A 3ECHA 3WU2C 4X0GA 3ZMVA 2PMZA 1JXSA 4L62A 4V2FA 4GCVA 4GXOA 2YS9A 1LDJA 4K2EA 2HKOA 4D9JA 5FRNA 1T95A 4HW0A 5E1XA 4RGRA 2H8RA 3DLLF 1TWGJ 1U5TB 2VXDA 2XGCA 2FOWA 2IU5A 2XDNA 3G71I 2UXIA 1GVJA 4A6EA 3OYMA 2ISYA 2EFWA 3CCLI 3ZPLA 3AKZA 2EB7A 3I5UA 3S3OA 4A0ZA 4KITB 1MNMC 2XHKA 1BR1A 2XSJC 4XLEA 3GWZA 1OYYA 2E1OA 2QM3A 5IP6A 5B3SH 1O4XA 3H3VK 1W1WE 2V79A 3O8HA 3CC7I 2STWA 5J1YA 5CVVA 1AWCA 3RKWA 2KZGA 1IF1A 3L2CA 2G0EA 1VF9A 2V9VA 3R0AA 2UXUA 1XSXA 3BDDA 2K5CA 3WG7H 1OR7A 4Z2YA 2IBDA 2PN6A 3OV8A 2ZNZA 3GEUA 2IXSA 4A5NA 3S5RA 2R3SA 4WXCA 2PX9A 4L18B 1WJDA 1JJ8C 3VWBA 5FLVA 3C1DA 3CDLA 3DU5A 1Y0NA 3GTPJ 2KL4A 2L7FP 4LMYA 5LD2C 1W0UA 1A31A 3ISPA 5CVJA 2JPBA 2R7TA 4NDLA 4RBOA 2UXOA 2IS1A 3CUQA 3JTGA 4MHGA 3P9CA 4BH9A 3S1RJ 1A5JA 1OCTC 1WJBA 4P1WA 2KPMA 3ZRGA 2HU9A 2L7KA 4FISA 4XRMA 2IGKA 4ZYAA 2ZJPF 1BC7C 1TWAJ 3LSGA 1D1CA 3JRDA 4AD9A 4YRVA 1KGSA 3TGNA 4RB0A 3CCJI 1HSJA 3SDBA 2Y9YA 5E8GA 4EJOA 3OMYA 2L0KA 2ZO4A 1A6QA 4XICA 1HKSA 2EJRA 4F7ZA 2Z2SB 3FXOA 4A2UA 4BUPA 1GXQA 3FF5A 1W36D 1U0JA 5K7FA 1RUOA 4PSWA 1RI7A 4HV5A 1UELB 2QA4I 5C4XJ 2IGMA 2DFEA 5J4YA 3K2AA 4YIRX 1LNWA 3VYSB 3LJLA 1ZRCA 2FQ4A 4ETSA 1Y0UA 5HLIA 4BBSJ 2EH3A 2BGCA 5C44J 4HYEA 3RPUA 4YFXF 1YRNA 4AVZA 3CRJA 3PNYA 3I55I 1X1BA 3NARA 1ACIA 1BR2A 3MVPA 2EINH 3HIFA 2A68F 3KNWA 3B02A 1VFCA 4EEFG 3U1KA 3NS4A 3FXJA 4CUGA 2HYJA 3L2RA 2N8GA 2UUZA 4U0YA 3F6OA 1JUMA 4XQFA 3I53A 3CUOA 1EKEA 4UB8C 3T0YA 4Y17A 3PPBA 5F27A 1S8NA 2E35A 3C07A 2DMPA 1WI3A 3KYDB 4BXFA 4E7LA 2OZ6A 3HRTA 1XC5A 2LOOA 1J9IA 2NRAC 1YLFA 1H8AC 1WWXA 2F07A 4BE0A 3FISA 3HTSB 4CCJA 1YW7A 4J01A 1IO2A 3H3UA 4Q4ZF 2QOPA 1D1AA 5CQEA 1JKOC 1T33A 1IUYA 2Q24A 2G7SA 2I5UA 1G3YA 3MZHA 4XBFA 3H5RA 5H6RA 2PJPA 4HPQA 2PQ8A 3E1SA 1U6GA 1N75A 1WPKA 2ZSHB 4XLPF 4N4OB 1U8BA 3DP7A 3FBIB 4E7JA 5LLQA 1SMTA 3CDIA 3PNVA 1GXPA 3GTQJ 4A0XA 1BI3A 3VEPA 3F6VA 1OCCH 2QQBA 2A5YB 1UHSA 4YELA 1XDSA 4ZJZA 3JSJA 4MLOA 4IPAA 4U7BA 1YE9A 5EEAA 2Z16A 3O6BB 3A2KA 1DP3A 1S5LC 1ZHFA 1TP4A 2HQNA 4LK0F 4M6VA 3VPRA 1ZYRF 2DG7A 2EZIA 2XB5A 1LVAA 3L00A 2IS6A 2A61A 3V8JA 2M7BA 3R60A 4PXIA 2XRNA 2JT1A 3IAM2 3V6GA 2HI3A 3ZXSA 4X6AJ 4II2A 1BI0A 3FK7A 4CO8A 5D19A 3O60A 1ENHA 2G9WA 2NVXJ 1Z9CA 2JA7J 3RCOA 3BR5A 3MWMA 2X6YA 1QZZA 5TRDA 2QGUA 3MAJA 3HPGA 2ZXIA 2ADUA 2A07F 4GFKA 3KYLA 2P4WA 4M3BA 1MBGA 4M9SA 3U21A 5AIQA 1TWFJ 4JQFA 2VQCA 2C6YA 2VI6A 4A3LJ 5DCMB 1MNEA 3J7AO 2KJBA 3PASA 3KLNA 3IV5A 2OD5A 2G7UA 3A01A 1XGOA 4IVNA 2WY8Q 4M3FA 2I8DA 2FNAA 2VN2A 3F9KA 5JFRA 1K61A 1ETKA 2DQRA 3H0GJ 5FKNA 4LB6B 5ICGA 1Z67A 2JWTA 4IZZA 3J80K 3Q0WA 4F52A 4RM3A 5C4JJ 4D5CA 3IKVA 2VODA 2AQFA 2RV8A 3E3VA 1ZH5A 2DA4A 2BY2A 1GDTA 4ZC3A 2M8EA 3A1YA 4HSTA 1YO5C 1J09A 1G3TA 4XOPA 2B1EA 5F1RA 2EFOA 2MFZA 3CLOA 3S2DJ 4WIBA 3HKZN 2FXAA 3I59B 1RRJA 5JLXA 3MKWB 1USSA 2E36A 4R79A 4A3FJ 2H6BA 3GCMA 1G2HA 1KA8A 2HZDA 3A0BC 3FXLA 3QKXA 1JT6A 4EM2A 1JT0A 2WY7Q 4NN1A 3KETA 3SYTA 4XLAA 1NHAA 2W00A 1LDDA 3BNIA 3GTLJ 2WAQA 5F0HA 3MCZA 1S7OA 2CW0F 1XGMA 1DPUA 1YOVB 2KIMA 2L02A 1VQ5I 2DYRH 2R5ZA 1EH7A 2LK2A 2A05A 3U2RA 4RB1A 3S1QJ 3F21A 2FEZA 2ICWG 1HCRA 2OU2A 2VKEA 1KQ8A 2OPTA 1O3RA 5CXIA 2QF7A 2DA1A 1XD7A 2GIVA 3HOXJ 1S7EA 2XDVA 1F1ZA 2D1VA 1F5TA 4RLFA 5F64A 4HV6A 3SFZA 1R5HA 2ID6A 4NHJA 3G56A 2LFBA 5GADJ 4U9NA 3KZZA 4UUSB 3E0JB 1AHDP 3SHFA 2E1MC 4QLCU 3LSRA 4CCMA 2X48A 2PG4A 2MD5A 3R61A 3N4MA 1SD6A 3ZOBA 3JAMZ 3S1NJ 2X1EA 2WAEA 1A35A 3BR6A 3M1EA 2AS5F 4M9ZA 1I3QJ 3ABLH 2PMHA 4LOCA 2JA2A 3RKQA 2P8TA 3FXKA 3TMOA 4YG2F 1ITYA 2NVTJ 1STZA 2QYOA 4NNJA 1LDKB 4ZYHA 4AIHA 2XSDC 2IEKA 1P7IA 3CCVI 4C2TA 2DCEA 2CMPA 2VB6A 1Z1DA 2JVGA 1MJ9A 2LY9A 2WC2A 1ZLJA 5HLHA 3KZ9A 1JGGA 5DEQA 2VPLA 2ZB9A 5EZHA 1X1CA 2CWEA 3GFMA 3VW2A 1RR8C 3ZMSA 2A6HF 3ASOH 4AM3A 3GTMJ 1XGSA 1HW2A 3NRVA 4D1QA 4ZDPA 1I1GA 2QZ8A 2JA8J 2DDBA 2LBFA 3M8JA 4PDKA 1S7AA 4LG0A 2D1HA 2NS0A 4I99C 1OCRH 2ZBKA 3VODA 2M4GA 4JBAA 4CCOA 3G73A 1ZG3A 3IWFA 1R6RA 1LPQA 2DMQA 1T8IA 3BQZA 2FUG2 3WGIA 2BYVE 4U0VA 3OYKA 3TDZC 2DDAA 5HLTA 5EZGA 3GFJA 4XLHA 2R5YA 3K8PC 3DV8A 1KU3A 2YVEA 2TRTA 3PUBA 1MD0A 1F9NA 3OYEA 2REKA 2LF7A 3AG3H 4OD4A 4ENKA 2XASA 3SZPA 3DTKA 4ESBA 1QBJA 1SD4A 3AG1H 3EYYA 4BQQA 2R7OA 2UZKA 1WJAA 4CCKA 2LR8A 4LLNA 2Z99A 1RC9A 5ERIA 3ZMZA 2VL8A 5HDNA 3J7ZI 2UXHA 3W3CA 2ESNA 1PUFB 2O9LA 4MEYF 3HTUA 4LG3A 5ILVA 4IRIA 1K83J 5A2QK 3G1LA 2IVMA 1K6OA 5EEGA 5KVRA 2K27A 4RA2A 3AG4H 4C3JJ 2IA2A 2HGCA 4CYDA 4BJ5C 3QP5A 3KPHA 3JRIA 1SD7A 3HSFA 2CUJA 4A0YA 4BKXA 4OMZA 3BTIA 1ZGWA 1BJAA 1R4NB 1FX7A 4CYCA 3LQQA 3VTIA 2BY3A 3DPLC 3KLOA 1U2WA 3OIOA 2XAHA 3E7QA 1RIOH 4PK4A 4EJTA 1W7PD 1IN4A 3DBLB 4CH7A 2KJCA 4BE1A 4H0EA 1NTCA 4ZTFA 5ILSA 5F08A 3LSIA 3CF5F 2RASA 3CO6C 2Q2EB 2E7XA 4M71A 1VQ6I 2EV6A 2UXNA 4NQWB 2HQRA 5DS9A 3COAC 5HS8A 4RS8A 3FZVA 1HXDA 2M3AA 3K1MA 1E3PA 3FXUA 1UB9A 2RAEA 1YIJI 3SJMA 1YX5A 2UXXA 1FOYA 2WBMA 3GEZA 1J0RA 3K4JA 4BBRJ 5FKMA 5GP9A 1BN5A 4QIWN 1T39A 1ZREA 1S9HA 3LSHA 3DKYA 3LQRA 1ZGJA 5FKOA 3TEDA 3HOSA 4TV7A 2BW3B 4DZJA 5EG0A 4QWQA 3GTKJ 4A6DA 2PBXA 2RREA 1PUEE 3BG6A 5DD8A 3OS2A 1Z05A 2GIZA 4BHPA 3JRBA 1VQ4I 3NXCA 3P9IA 2HQAA 2M8GX 2KIFA 3NEUA 2E34A 3A02A 2JQ7A 4U9LA 4XKBA 1I5ZA 3OYHA 5LEJA 1B9NA 1MBJA 3KEYA 2V9KA 5E1ZB 2DTRA 3IAS2 4I76A 4MEXF 1LFPA 4ITVA 4P5OA 3J81K 2ZMEA 1LFBA 1T38A 1LKXA 2EWNA 3AL0C 3VIBA 4A5MA 3V7RA 3IRRA 2BE5F 1K78A 2OZUA 2EQRA 4BEHB 4Y15A 3QQAA 5AQCA 3K4BA 4UUTA 4RB2C 3LWJA 3V78A 5K5QA 3CDHA 3QRFF 1BOAA 3GW2A 2MH2A 3WU0A 3UKGA 1IXSB 2KP6A 2RDPA 2LREA 4HNVA 1LE8A 2GA2A 2QKLB 2HYFA 1XMKA 1Q1VA 3LFUA 4AWXB 3G2BA 3U1DA 2L54A 1G8XA 4IHSA 2Y2ZA 4AC6A 1WRJA 4NC6A 2F2EA 4FX0A 2MW8A 3OS1A 1J75A 2VXZA 4EQQA 3JRGA 4RDUA 4FHTA 3RTRA 4KFCA 2L01A 1AU7A 2FOKA 4BS9A 2R7VA 1GV5A 3PJRA 2E5ZA 2CUFA 3WTZA 4ESJA 2Y30A 3ABUA 2XKPA 2K7LA 4CCLA 3BC8A 3VVXA 5HOOA 4BXUA 2RNJA 1GV2A 2A3SA 2R4GA 3HXLA 2HVSA 4ZYGA 4JNNA 2X4HA 1X3UA 3UNGC 2Z3YA 2E71A 5IT3A 2YSRA 2LY2A 3S3MA 1AKHA 4C2MA 2VOPA 4DVYP 2EFQA 5E8IA 3W2VA 2R92J 3M8EA 3ZP5A 2KISA 2VKVA 5BS6A 1DU0A 2BBYA 2ZXWH 5FFXA 3DLAA 2VE9A 2IPQX 3PUFA 1H88C 2LY1A 1W7PB 2K02A 2R7XA 3KP6A 3BLYA 2O8XA 4BHBA 3I56I 1H0MA 1ODDA 1BM9A 1OCZH 2CW7A 4U88A 4DGWB 2CFOA 1XGNA 4MQ9F 3GYHX 2QWWA 2XGEA 2LYCA 5IYDJ 3LFKA 3S3NA 2M0MA 1S72I 1Y1VJ 3PSIA 2QTQA 2K85A 5IT9Z 3KEOA 2PFBA 2WB1A 2VC1A 4XSZF 2CV0A 4IHVA 2EZKA 3AAFA 2MC4A 2VUMJ 1IRZA 3ZQCA 2R7WA 2B63J 4OAYA 1MH4A 2B7EA 5IOZA 3P9TA 3HSRA 5EDNA 3E6DA 3LSMA 3GZNB 3F1BA 4HSRA 5HLGA 1Z77A 1XX5A 2XB0X 5HNFA 5B5EC 1D8KA 3BTCA 3MKYB 1Z21A 1LB2A 5KAIC 3V8KA 1H9TA 1N78A 2NP3A 2ZCXA 4XORA 4OIQF 4UNOA 5D5VB 5HBUA 4RGXA 2HVRA 2VT3A 3CF2A 1TWHJ 1BIAA 2W85A 1UHWA 3FXRA 1QVUA 2VIXA 2BXZA 4D7NA 5GPAA 1DU6A 1R1UA 2L2OA 3ZN0A 1TT0A 4IF4A 3DBRB 3L2UA 2R7DA 1NG6A 2AO9A 2WAQN 3BG7A 1RPWA 5TGTA 2W1OA 2K9QA 4L9TA 1KQ9A 4X1EA 4KIGA 1K7AA 2DA6A 3RIRA 2JJ7A 1B8IB 5EGOB 3DPUA 1KU7A 2VBXA 1SFXA 3A4CA 3H5AA 2OF7A 2P0WA 3FMSA 4L5JA 5FLXZ 3E6MA 4BYYA 4EGZA 3ANPA 2DYSH 1YITI 1S3JA 2RVCA 1F43A 3QOPA 3TQNA 2OJED 2BOLA 1PVEA 3PNTA 4XONA 3KX2A 3FDYA 4ZZDA 2V1XA 3WHBA 1I3AA 2TCTA 2WV0A 1IDYA 1G59A 1D3YA 3MNLA 1QO0D 1WHUA 3TW6A 2L4MA 4BAYA 3I3LA 2DT6A 1HKQA 1MGTA 1I1SA 1BJZA 4FX4A 4EVIA 2XPVA 4XN3A 2E2JJ 2YVHA 1X1PA 4N9HA 5AIPA 3SDGA 3IUVA 3L2QA 3HTJA 3G3ZA 5J40A 1IXRC 5FB2A 2JUGA 1D1BA 4LLGF 1SGMA 4HQEA 3GFLA 2VJ5A 4QPOA 2XAUA 4A3MJ 2KRFA 2X0LA 2XAQA 3Q9VA 2HEOA 1JUSA 1BA5A 3LNQA 1HKTA 2F48A 1I6HJ 2JTVA 1WJCA 1LJ9A 4NC8A 1X3ZB 4IKFA 4XK4A 1IGNA 3LAJA 1I6XA 5KHDA 4PJ0C 5LGTA 5IY5H 3DEWA 3F3XA 4E6KG 2R93J 4G8XA 3PQKA 1FSHA 3JW4A 2MG4A 4UDSA 1SFOJ 1ZK8A 4AIDA 2HKXA 2DU9A 4A3DJ 3BJOA 1ETWA 3BT9A 2JSCA 2CSOA 5DYMA 2G7LA 3DQVC 4KT5C 5M5XJ 3HOZJ 3QPTA 3K9TA 3CCYA 4JX5A 4W97A 2FQ3A 3OYIA 3HOWJ 2EILH 3LSKA 4XKWA 4L5EA 4A3KJ 1MBHA 4GO1A 2RC4A 1QPIA 2EZLA 1OMIA 2UXPA 1P4WA 2E2HJ 3E5QA 3BR2A 4EJUA 3VP5A 3OL4A 1U5TA 2VJJA 1L3LA 1D0XA 4P9FA 4EM0B 1TWCJ 4OOIA 3DKWA 2MGQA 3H9JA 3H9QA 2WGBA 2DMNA 2FX0A 3BR3A 5LRSA 1QQIA 2IP2A 2MABA 1TL8A 4M3DA 3SEQA 4I2OA 2GOMA 2P5VA 3TOBA 2DA3A 2BY0A 1R7JA 1V5FA 4UXNA 3EUHA 3CMYA 3OSFA 4IOCF 3FM5A 4DYQA 4BDZA 3C7JA 3D5RC 4BGDA 1ZG1A 4OMYA 2MBFA 4ICHA 2ZY9A 4KT6A 1C0WA 3ASNH 3IP4B 5HDGA 3KCCA 3ZQQA 1T6SA 5BQTA 1JE8A 1FY7A 1FC3A 2EV0A 1R49A 1O3SA 1HDPA 2ESHA 1PDNC 4B43A 1XDUA 2QBYB 3HIMA 3C18A 2QSHX 2PJRB 5BOXA 4G7OF 1YW8A 1JUPA 2K86A 2DFFA 3HOUJ 3H5NA 2F5EA 1K4SA 3FXMA 3MN2A 3RPQA 3OS0A 4HNTA 2VJIA 3HZJA 1RR7A 1TT5B 3AL0B 3I4NJ 5F0FA 1X3WB 3S17J 5D1RA 4G12A 1YFHA 4PZJA 4RAYA 3BPXA 1WJFA 1BR4A 2YPRA 3M3YJ 3TO7A 1D8JA 1MDMB 1KU9A 5FFZA 4E70A 1ORKA 3G6EI 5C4YA 1X1AA 1M1EB 5D5WB 2BVMA 2V26A 2MC3A 1MIJA 2P6TA 1AOYA 2KZVA 3LOCA 3TL4X 4IHYA 1QPMA 1ZRFA 3IUOA 3ABTA 1ETXA 2QSGX 1MH3A 2DOAA 3VVYA 1F36A 3GLLA 5D18A 3ROUA 4OD5A 1XMAA 3WHCA 1MSEC 2QCOA 1BW5A 1VI0A 3FM3A 4XN0A 2P5LC 1JKQC 2QKOA 1SEUA 2WADA 3BR0A 4A3GJ 4RAGA 1TNSA 5TISC 1U9NA 3RKYA 3S32A 5H6QA 3CP8A 3TO9A 4ZYDA 2HDDA 3BCGA 3M07A 5J8CA 3HRSA 2ZNYA 3LSTA 4V2GA 2WUIA 2WTEA 3BJAA 4O3MA 1KYWA 1MMAA 2LNBA 2RQPA 2VASA 4XKCA 3IRQA 3RI4A 2F4IA 4OIPF 5K5OA 1OPCA 2HPIA 1PP8F 3PQJA 2B3WA 3GO5A 4KJZA 2KRHA 2CQXA 4PFPA 3CC2I 1JI8A 4I7HA 4BY1J 2AQEA 1RKWA 5JHFA 3I0TA 3BOQA 1BW6A 1T08B 5JVTA 2ZJQF 2CFXA 1UZCA 2VT2A 2ZXJA 4F93B 4BDYA 1Y8QB 2HOSA 3PFIA 2Q0OA 3H92A 5DUIA 1U78A 5KCMA 1SANA 4O6JA 3OWTA 3GZIA 4DNCA 1ZGAA 5DUKA 4ACIA 2VKHA 2DG8A 5E17F 3C2GA 1F4KA 3T8RA 2Z33A 3E7LA 3T1BA 1MBKA 5KNLA 3DWLE 4RGSA 3OYAA 4GGGA 2OTLI 1JJ6C 1TTYA 2ZFWA 3TBIA 2XF6A 3DEUA 1IAWA 4M6YA 3ZMUA 3QP6A 4PJNA 2X6WA 4C3HJ 3IH3A 2KIQA 1FTTA 4XKVA 2QUFA 2Z5UA 2IGNA
chains in the Genus database with same CATH topology
2DMUA 1WH7A 3HOVJ 2X6OA 3E7QA 3AQSA 5C3EJ 5J3LA 3A01B 3Q0VA 1NTCA 3BR1A 5F08A 3GTOJ 2GBYA 3SFIA 2RASA 2D6YA 2LVSA 5FKKA 3RZDJ 3JR9A 3OOUA 4GFLA 4MO7A 3A03A 3HGGA 1NK3P 5DS9A 2XPWA 5FKLA 3S2HJ 4Y52J 3S16J 2W53A 1JKPC 2HXIA 1CQTA 1ETOA 2RAEA 3QPSA 2Y0SN 1JTYA 1UMQA 3SJMA 2OI8A 4FTHA 3VW0A 4A93J 2JMWA 3ZQFA 2VPRA 4BBRJ 2GENA 5FKMA 5GP9A 4QIWN 4JX6A 3COLA 2FJ1A 2ZCNA 2NP5A 5FKOA 3TEDA 2CJJA 4DZJA 5EG0A 3GTKJ 4L62A 2JK3A 4V2FA 2PBXA 5H9TA 4GCLA 2YS9A 1Z0XA 4XRSA 1U9OA 3KKDA 3LSJA 3JRBA 2D5VA 3W6VA 2V57A 3NXCA 2M8GX 2H8RA 1TWGJ 2HKUA 2DMTA 3A02A 1NK2P 2ZOZA 3NAUA 2R5ZB 2XGCA 2IU5A 2XDNA 2UXIA 1MBJA 1MNMC 4I76A 2E19A 1B72B 5E3LA 2E1OA 4NELA 2HOTA 5IP6A 4B4CA 1LFBA 1O4XA 2EBIA 3H3VK 3VIBA 3O8HA 1A6IA 5J1YA 2EQRA 2OERA 3QQAA 5AQCA 4UUTA 5BNGA 5FGLA 3LWJA 3V78A 2G0EA 1VF9A 2UXUA 1HLVA 3BRUA 3UKGA 5IYCJ 2IBDA 3ANGA 4HNVA 1LE8A 2GM4A 4QTRA 3HOYJ 2ZOYA 3GEUA 3S5RA 1WCMJ 1Q1VA 2L7ZA 2L7MP 2R0QC 2Y2ZA 4AC6A 5M5YJ 1JJ8C 5FLVA 3CDLA 2MW8A 2PMZN 3GTPJ 2L7FP 1W0UA 4XIDA 3JRGA 1FEXA 1OCPA 4NDLA 4RDUA 4RBOA 1LFUP 2IAIA 2UXOA 3BJBA 2YU9J 1AU7A 3TP0A 1RKTA 3S1RJ 1A5JA 1GV5A 1OCTC 2CUFA 2Y30A 1T56A 2M0CA 4FISA 4XRMA 2QIBA 3VVXA 1E3OC 3G7RA 1TWAJ 3LSGA 4UUSA 3JRDA 3HTHA 1GV2A 3QBMA 2Y9YA 3PM1A 1X58A 3O8GA 4JNNA 2DN0A 2L0KA 4XICA 4A69C 1X2MA 1AKHA 2HOAA 1IDZA 5K7FA 5C4XJ 1FIPA 5E3NA 2R92J 4DYRA 3K2AA 3LJLA 2FQ4A 3RZOJ 2VKVA 2HYTA 1DU0A 3AQTA 5DAJA 4BBSJ 2EH3A 5C44J 1IG7A 1YRNA 1H88C 3IH4A 3CRJA 1MBFA 4XRSG 2DA7A 3NARA 4Y7NJ 3MVPA 2G7GA 5F04A 3JREA 4CGRA 1GVDA 2XGEA 4IEJA 5IP7J 3KNWA 1VFCA 4EEFG 5HODA 1JKRC 2COBA 5IYDJ 2HYJA 4ME9A 1Y1VJ 3JRHA 2N8GA 2QTQA 4AC0A 1JUMA 3NRGA 2R5YB 4IHVA 2EZKA 1POGA 2NOGA 3B6AA 2VUMJ 1IRZA 3ZQCA 2JA6J 3PPBA 5F27A 2B63J 1MH4A 5IOZA 3CJDA 3C07A 2DMPA 1WI3A 2H1KA 1XC5A 4AYBN 3P9TA 1H8AC 3F0CA 5EDNA 1ETYA 4JP0A 2F07A 3F1BA 3FISA 4QSHA 1Z77A 2QOPA 2XB0X 1ZR2A 1JKOC 2M34A 3BTCA 1T33A 1JTXA 2Q24A 3VOKA 2G7SA 2NP3A 2ZCXA 5HAWA 5HBUA 3DCFA 3ZQGA 3HGYA 3PO2J 1TWHJ 4DZPA 3VUQA 1WPKA 1U8BA 2GUHA 1QVUA 3GTQJ 4D7NA 5E3OA 5GPAA 1VNDA 1DU6A 1UHSA 4KWAA 1TC3C 3IH2A 4MLOA 3JSJA 2AO9A 2WAQN 5EEAA 2X9DA 1RPWA 3OSGA 1QVTA 2K9QA 3L1PA 4X1EA 4FE4A 5EF6A 4AUXA 3TP3A 2WB1N 4M6VA 3VPRA 2KDZA 1GUUA 2DA6A 2JJ7A 1B8IB 5EGOB 2DG7A 2EZIA 5JLWA 2XB5A 1ETQA 4CYCB 3BTLA 4JL3A 1PUFA 2OF7A 3ANPA 2M2EA 5DTDA 4PXIA 1F43A 3BHQA 3V6GA 2HI3A 4MIMA 4X6AJ 3FK7A 5FLMJ 5D19A 3LHQA 3O60A 3JRAA 3WHBA 2DJNA 1ENHA 2TCTA 4D7MA 1IDYA 2NVXJ 2LD5A 2JA7J 3BR5A 3HE0A 3MNLA 2DA2A 1MBEA 3DPJA 3TW6A 2ECBA 5F0CA 2DA5A 3FK6A 4GFKA 1BJZA 2XPVA 2I10A 2E2JJ 3BG9A 3I4MJ 2YVHA 4M3BA 1MBGA 4MFDA 4BXXJ 5FHPA 1APLC 3SDGA 3IUVA 1TWFJ 3HTJA 2NVQJ 2PZ9A 2VI6A 4I6ZA 4A3LJ 1SGMA 3D1NI 3PASA 3TW7A 3IV5A 4A3MJ 3VOXA 5HSZA 5IP9J 1X2NA 3A01A 3GBGA 1JUSA 1BA5A 3NNRA 4M3FA 3LNQA 3PO3J 1XS9A 4GCKA 2ID3A 1I6HJ 1K61A 3FIWA 3BG3A 1ETKA 3H0GJ 5FKNA 2ME0A 2JWTA 5EG0B 5F1JA 3Q0WA 3FKIJ 4XK4A 5C4JJ 4M3GA 3BQYA 3HM5A 4D5CA 1IGNA 2E2IJ 5FMPA 5K7ZA 2DA4A 3DEWA 2NS8A 2R93J 5M3FJ 1GDTA 2O7OA 2MG4A 2FBQA 4UDSA 2CUEA 3Q3SA 1ZK8A 1SFOJ 1P7JA 2G3BA 2ECCA 2O7TA 4J19A 4A3DJ 1ETWA 3BT9A 3S2DJ 3HKZN 4ABZA 5JLXA 2G7LA 4S0HB 5J1RA 1IJWC 5M5XJ 2LTPA 3HOZJ 2R7ZJ 4A3FJ 1MSFC 2ELKA 1G2HA 2AHQA 3CCYA 4MK6A 1QRYA 4JX5A 4W97A 3QKXA 1JT6A 3EUPA 3NPIA 1JT0A 2XGDA 3HOWJ 4NN1A 4AF5A 4A3KJ 4L5EA 1IV6A 1MBHA 1QPIA 2XRLA 3BNIA 2EZLA 3GTLJ 5F0HA 4A3JJ 2QWTA 2UXPA 4JX4A 2E2HJ 3ZQIA 3RD3A 5K7HA 3BR2A 2W48A 3VP5A 1LE8B 2R5ZA 4YZEA 4W1UA 1H89C 1FTZA 2CU7A 2EZHA 1TWCJ 2LK2A 2ZCMA 4HKUA 2O8KA 3S1QJ 3B81A 2MGQA 2KT0A 4FCYA 1HCRA 2VKEA 2WGBA 2DMNA 2FX0A 1B72A 2OPTA 3BR3A 3HTAA 5CXIA 1ZKGA 2DA1A 2QF7A 4M3EA 5E3MA 3HOXJ 1S7EA 4M3DA 4A3CJ 4C3IJ 2GLOA 3RQIA 2DA3A 5M3MJ 1W0TA 2L9RA 3CMYA 2ID6A 3ZQHA 1RESA 1HDDC 3OSFA 3G56A 2LFBA 4DYQA 5K58A 4UUSB 3G1OA 1GT0C 4ICHA 2JA5J 1AHDP 1WH5A 1FIAA 3RH2A 4D5FA 3HBLA 3LSRA 2M9HA 4JKZA 2X48A 3VW1A 2NVYJ 2RHAA 3ZOBA 1HDPA 3S1NJ 3HIMA 2MSYA 1AKHB 3VVZA 3BR6A 1JUPA 1XG1A 2WV1A 2LKXA 3S15J 1I3QJ 1OFCX 4LOCA 3HOUJ 1UI6A 3BTJA 4IHXA 3RKQA 2HQ5A 3CWRA 3MN2A 3CQZJ 5EYRA 1ITYA 2NVTJ 1RR7A 3G1MA 4DYCA 2XSDC 2IEKA 3I4NJ 3GTJJ 5F0FA 2LLKA 1P7IA 4JYKA 3S17J 4MXMA 4G12A 5D1RA 3T6NA 1R9TJ 5IYBJ 1YRNB 3M3YJ 3KZ9A 2LY9A 3ON4A 1HOMA 1JGGA 4MFEA 5CW8A 1ORKA 2ZB9A 5EZHA 2ME6A 1ZQ3P 5C4YA 2LP0A 2FD5A 3NI7A 1RETA 3VW2A 2GFNA 3GTMJ 3LOCA 4IHYA 4DW6A 1ETXA 1MH3A 2JA8J 2XPUA 1F36A 3VVYA 1OJLA 5D18A 2CQQA 1EF4A 3HDDA 3WHCA 1MSEC 2QCOA 1BW5A 1VI0A 1JKQC 2QKOA 2Y9ZA 3C2BA 1FJLA 3KKCA 3BR0A 4A3GJ 1Y1WJ 1U9NA 2HDDA 3BCGA 4B3AA 3S1MJ 3HTIA 1ZTRA 3K7AJ 4V2GA 5IPAA 4A3BJ 2WUIA 2DMQA 1ETVA 4A3IJ 3BQZA 1IUFA 5M5WJ 4C2MJ 3QPLA 5EZGA 3GTGJ 1IC8A 2JN6A 3B6CA 2R5YA 4GCTA 2YVEA 2TRTA 3HB9A 1WGXA 1I50J 2CQXA 2REKA 4B1RA 5FJ8J 2K9NA 4BY1J 3MKLA 4GFBA 1RKWA 2P81A 3M4OJ 1UI5A 1BW6A 2K40A 5EFYA 3BG5A 4A3EJ 1ZR4A 2LR8A 3ZQLA 5GPCA 3Q0UA 2HOSA 5CXGA 4BY7J 2UXHA 1U78A 2K9SA 3ON2A 1SANA 1PUFB 2O9LA 2NS7A 3GZIA 4IHWA 4ACIA 2DG8A 1K83J 3LSPA 3G1LA 1HF0A 1D5YA 3E7LA 2NX4A 1MBKA 3JRCA 9ANTA 4FE7A 4C3JJ 3S14J 3HEFA 3JRFA 1JJ6C 2Y31A 1BL0A 2HXOA 3JRIA 4BKXA 3FRQA 1UG2A 3EGQA 2DTZA 3BTIA 5EGOA 1B8IA 1ZGWA 5IOYA 4C3HJ 4CYCA 2CRGA 3IH3A 2YUSA 1FTTA 3OIOA 5J1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMU A;  1WH7 A;  3HOV J;  2X6O A;  3E7Q A;  3AQS A;  5C3E J;  5J3L A;  3A01 B;  3Q0V A;  1NTC A;  3BR1 A;  5F08 A;  3GTO J;  2GBY A;  3SFI A;  2RAS A;  2D6Y A;  2LVS A;  5FKK A;  3RZD J;  3JR9 A;  3OOU A;  4GFL A;  4MO7 A;  3A03 A;  3HGG A;  1NK3 P;  5DS9 A;  2XPW A;  5FKL A;  3S2H J;  4Y52 J;  3S16 J;  2W53 A;  1JKP C;  2HXI A;  1CQT A;  1ETO A;  2RAE A;  3QPS A;  2Y0S N;  1JTY A;  1UMQ A;  3SJM A;  2OI8 A;  4FTH A;  3VW0 A;  4A93 J;  2JMW A;  3ZQF A;  2VPR A;  4BBR J;  2GEN A;  5FKM A;  5GP9 A;  4QIW N;  4JX6 A;  3COL A;  2FJ1 A;  2ZCN A;  2NP5 A;  5FKO A;  3TED A;  2CJJ A;  4DZJ A;  5EG0 A;  3GTK J;  4L62 A;  2JK3 A;  4V2F A;  2PBX A;  5H9T A;  4GCL A;  2YS9 A;  1Z0X A;  4XRS A;  1U9O A;  3KKD A;  3LSJ A;  3JRB A;  2D5V A;  3W6V A;  2V57 A;  3NXC A;  2M8G X;  2H8R A;  1TWG J;  2HKU A;  2DMT A;  3A02 A;  1NK2 P;  2ZOZ A;  3NAU A;  2R5Z B;  2XGC A;  2IU5 A;  2XDN A;  2UXI A;  1MBJ A;  1MNM C;  4I76 A;  2E19 A;  1B72 B;  5E3L A;  2E1O A;  4NEL A;  2HOT A;  5IP6 A;  4B4C A;  1LFB A;  1O4X A;  2EBI A;  3H3V K;  3VIB A;  3O8H A;  1A6I A;  5J1Y A;  2EQR A;  2OER A;  3QQA A;  5AQC A;  4UUT A;  5BNG A;  5FGL A;  3LWJ A;  3V78 A;  2G0E A;  1VF9 A;  2UXU A;  1HLV A;  3BRU A;  3UKG A;  5IYC J;  2IBD A;  3ANG A;  4HNV A;  1LE8 A;  2GM4 A;  4QTR A;  3HOY J;  2ZOY A;  3GEU A;  3S5R A;  1WCM J;  1Q1V A;  2L7Z A;  2L7M P;  2R0Q C;  2Y2Z A;  4AC6 A;  5M5Y J;  1JJ8 C;  5FLV A;  3CDL A;  2MW8 A;  2PMZ N;  3GTP J;  2L7F P;  1W0U A;  4XID A;  3JRG A;  1FEX A;  1OCP A;  4NDL A;  4RDU A;  4RBO A;  1LFU P;  2IAI A;  2UXO A;  3BJB A;  2YU9 J;  1AU7 A;  3TP0 A;  1RKT A;  3S1R J;  1A5J A;  1GV5 A;  1OCT C;  2CUF A;  2Y30 A;  1T56 A;  2M0C A;  4FIS A;  4XRM A;  2QIB A;  3VVX A;  1E3O C;  3G7R A;  1TWA J;  3LSG A;  4UUS A;  3JRD A;  3HTH A;  1GV2 A;  3QBM A;  2Y9Y A;  3PM1 A;  1X58 A;  3O8G A;  4JNN A;  2DN0 A;  2L0K A;  4XIC A;  4A69 C;  1X2M A;  1AKH A;  2HOA A;  1IDZ A;  5K7F A;  5C4X J;  1FIP A;  5E3N A;  2R92 J;  4DYR A;  3K2A A;  3LJL A;  2FQ4 A;  3RZO J;  2VKV A;  2HYT A;  1DU0 A;  3AQT A;  5DAJ A;  4BBS J;  2EH3 A;  5C44 J;  1IG7 A;  1YRN A;  1H88 C;  3IH4 A;  3CRJ A;  1MBF A;  4XRS G;  2DA7 A;  3NAR A;  4Y7N J;  3MVP A;  2G7G A;  5F04 A;  3JRE A;  4CGR A;  1GVD A;  2XGE A;  4IEJ A;  5IP7 J;  3KNW A;  1VFC A;  4EEF G;  5HOD A;  1JKR C;  2COB A;  5IYD J;  2HYJ A;  4ME9 A;  1Y1V J;  3JRH A;  2N8G A;  2QTQ A;  4AC0 A;  1JUM A;  3NRG A;  2R5Y B;  4IHV A;  2EZK A;  1POG A;  2NOG A;  3B6A A;  2VUM J;  1IRZ A;  3ZQC A;  2JA6 J;  3PPB A;  5F27 A;  2B63 J;  1MH4 A;  5IOZ A;  3CJD A;  3C07 A;  2DMP A;  1WI3 A;  2H1K A;  1XC5 A;  4AYB N;  3P9T A;  1H8A C;  3F0C A;  5EDN A;  1ETY A;  4JP0 A;  2F07 A;  3F1B A;  3FIS A;  4QSH A;  1Z77 A;  2QOP A;  2XB0 X;  1ZR2 A;  1JKO C;  2M34 A;  3BTC A;  1T33 A;  1JTX A;  2Q24 A;  3VOK A;  2G7S A;  2NP3 A;  2ZCX A;  5HAW A;  5HBU A;  3DCF A;  3ZQG A;  3HGY A;  3PO2 J;  1TWH J;  4DZP A;  3VUQ A;  1WPK A;  1U8B A;  2GUH A;  1QVU A;  3GTQ J;  4D7N A;  5E3O A;  5GPA A;  1VND A;  1DU6 A;  1UHS A;  4KWA A;  1TC3 C;  3IH2 A;  4MLO A;  3JSJ A;  2AO9 A;  2WAQ N;  5EEA A;  2X9D A;  1RPW A;  3OSG A;  1QVT A;  2K9Q A;  3L1P A;  4X1E A;  4FE4 A;  5EF6 A;  4AUX A;  3TP3 A;  2WB1 N;  4M6V A;  3VPR A;  2KDZ A;  1GUU A;  2DA6 A;  2JJ7 A;  1B8I B;  5EGO B;  2DG7 A;  2EZI A;  5JLW A;  2XB5 A;  1ETQ A;  4CYC B;  3BTL A;  4JL3 A;  1PUF A;  2OF7 A;  3ANP A;  2M2E A;  5DTD A;  4PXI A;  1F43 A;  3BHQ A;  3V6G A;  2HI3 A;  4MIM A;  4X6A J;  3FK7 A;  5FLM J;  5D19 A;  3LHQ A;  3O60 A;  3JRA A;  3WHB A;  2DJN A;  1ENH A;  2TCT A;  4D7M A;  1IDY A;  2NVX J;  2LD5 A;  2JA7 J;  3BR5 A;  3HE0 A;  3MNL A;  2DA2 A;  1MBE A;  3DPJ A;  3TW6 A;  2ECB A;  5F0C A;  2DA5 A;  3FK6 A;  4GFK A;  1BJZ A;  2XPV A;  2I10 A;  2E2J J;  3BG9 A;  3I4M J;  2YVH A;  4M3B A;  1MBG A;  4MFD A;  4BXX J;  5FHP A;  1APL C;  3SDG A;  3IUV A;  1TWF J;  3HTJ A;  2NVQ J;  2PZ9 A;  2VI6 A;  4I6Z A;  4A3L J;  1SGM A;  3D1N I;  3PAS A;  3TW7 A;  3IV5 A;  4A3M J;  3VOX A;  5HSZ A;  5IP9 J;  1X2N A;  3A01 A;  3GBG A;  1JUS A;  1BA5 A;  3NNR A;  4M3F A;  3LNQ A;  3PO3 J;  1XS9 A;  4GCK A;  2ID3 A;  1I6H J;  1K61 A;  3FIW A;  3BG3 A;  1ETK A;  3H0G J;  5FKN A;  2ME0 A;  2JWT A;  5EG0 B;  5F1J A;  3Q0W A;  3FKI J;  4XK4 A;  5C4J J;  4M3G A;  3BQY A;  3HM5 A;  4D5C A;  1IGN A;  2E2I J;  5FMP A;  5K7Z A;  2DA4 A;  3DEW A;  2NS8 A;  2R93 J;  5M3F J;  1GDT A;  2O7O A;  2MG4 A;  2FBQ A;  4UDS A;  2CUE A;  3Q3S A;  1ZK8 A;  1SFO J;  1P7J A;  2G3B A;  2ECC A;  2O7T A;  4J19 A;  4A3D J;  1ETW A;  3BT9 A;  3S2D J;  3HKZ N;  4ABZ A;  5JLX A;  2G7L A;  4S0H B;  5J1R A;  1IJW C;  5M5X J;  2LTP A;  3HOZ J;  2R7Z J;  4A3F J;  1MSF C;  2ELK A;  1G2H A;  2AHQ A;  3CCY A;  4MK6 A;  1QRY A;  4JX5 A;  4W97 A;  3QKX A;  1JT6 A;  3EUP A;  3NPI A;  1JT0 A;  2XGD A;  3HOW J;  4NN1 A;  4AF5 A;  4A3K J;  4L5E A;  1IV6 A;  1MBH A;  1QPI A;  2XRL A;  3BNI A;  2EZL A;  3GTL J;  5F0H A;  4A3J J;  2QWT A;  2UXP A;  4JX4 A;  2E2H J;  3ZQI A;  3RD3 A;  5K7H A;  3BR2 A;  2W48 A;  3VP5 A;  1LE8 B;  2R5Z A;  4YZE A;  4W1U A;  1H89 C;  1FTZ A;  2CU7 A;  2EZH A;  1TWC J;  2LK2 A;  2ZCM A;  4HKU A;  2O8K A;  3S1Q J;  3B81 A;  2MGQ A;  2KT0 A;  4FCY A;  1HCR A;  2VKE A;  2WGB A;  2DMN A;  2FX0 A;  1B72 A;  2OPT A;  3BR3 A;  3HTA A;  5CXI A;  1ZKG A;  2DA1 A;  2QF7 A;  4M3E A;  5E3M A;  3HOX J;  1S7E A;  4M3D A;  4A3C J;  4C3I J;  2GLO A;  3RQI A;  2DA3 A;  5M3M J;  1W0T A;  2L9R A;  3CMY A;  2ID6 A;  3ZQH A;  1RES A;  1HDD C;  3OSF A;  3G56 A;  2LFB A;  4DYQ A;  5K58 A;  4UUS B;  3G1O A;  1GT0 C;  4ICH A;  2JA5 J;  1AHD P;  1WH5 A;  1FIA A;  3RH2 A;  4D5F A;  3HBL A;  3LSR A;  2M9H A;  4JKZ A;  2X48 A;  3VW1 A;  2NVY J;  2RHA A;  3ZOB A;  1HDP A;  3S1N J;  3HIM A;  2MSY A;  1AKH B;  3VVZ A;  3BR6 A;  1JUP A;  1XG1 A;  2WV1 A;  2LKX A;  3S15 J;  1I3Q J;  1OFC X;  4LOC A;  3HOU J;  1UI6 A;  3BTJ A;  4IHX A;  3RKQ A;  2HQ5 A;  3CWR A;  3MN2 A;  3CQZ J;  5EYR A;  1ITY A;  2NVT J;  1RR7 A;  3G1M A;  4DYC A;  2XSD C;  2IEK A;  3I4N J;  3GTJ J;  5F0F A;  2LLK A;  1P7I A;  4JYK A;  3S17 J;  4MXM A;  4G12 A;  5D1R A;  3T6N A;  1R9T J;  5IYB J;  1YRN B;  3M3Y J;  3KZ9 A;  2LY9 A;  3ON4 A;  1HOM A;  1JGG A;  4MFE A;  5CW8 A;  1ORK A;  2ZB9 A;  5EZH A;  2ME6 A;  1ZQ3 P;  5C4Y A;  2LP0 A;  2FD5 A;  3NI7 A;  1RET A;  3VW2 A;  2GFN A;  3GTM J;  3LOC A;  4IHY A;  4DW6 A;  1ETX A;  1MH3 A;  2JA8 J;  2XPU A;  1F36 A;  3VVY A;  1OJL A;  5D18 A;  2CQQ A;  1EF4 A;  3HDD A;  3WHC A;  1MSE C;  2QCO A;  1BW5 A;  1VI0 A;  1JKQ C;  2QKO A;  2Y9Z A;  3C2B A;  1FJL A;  3KKC A;  3BR0 A;  4A3G J;  1Y1W J;  1U9N A;  2HDD A;  3BCG A;  4B3A A;  3S1M J;  3HTI A;  1ZTR A;  3K7A J;  4V2G A;  5IPA A;  4A3B J;  2WUI A;  2DMQ A;  1ETV A;  4A3I J;  3BQZ A;  1IUF A;  5M5W J;  4C2M J;  3QPL A;  5EZG A;  3GTG J;  1IC8 A;  2JN6 A;  3B6C A;  2R5Y A;  4GCT A;  2YVE A;  2TRT A;  3HB9 A;  1WGX A;  1I50 J;  2CQX A;  2REK A;  4B1R A;  5FJ8 J;  2K9N A;  4BY1 J;  3MKL A;  4GFB A;  1RKW A;  2P81 A;  3M4O J;  1UI5 A;  1BW6 A;  2K40 A;  5EFY A;  3BG5 A;  4A3E J;  1ZR4 A;  2LR8 A;  3ZQL A;  5GPC A;  3Q0U A;  2HOS A;  5CXG A;  4BY7 J;  2UXH A;  1U78 A;  2K9S A;  3ON2 A;  1SAN A;  1PUF B;  2O9L A;  2NS7 A;  3GZI A;  4IHW A;  4ACI A;  2DG8 A;  1K83 J;  3LSP A;  3G1L A;  1HF0 A;  1D5Y A;  3E7L A;  2NX4 A;  1MBK A;  3JRC A;  9ANT A;  4FE7 A;  4C3J J;  3S14 J;  3HEF A;  3JRF A;  1JJ6 C;  2Y31 A;  1BL0 A;  2HXO A;  3JRI A;  4BKX A;  3FRQ A;  1UG2 A;  3EGQ A;  2DTZ A;  3BTI A;  5EGO A;  1B8I A;  1ZGW A;  5IOY A;  4C3H J;  4CYC A;  2CRG A;  3IH3 A;  2YUS A;  1FTT A;  3OIO A;  5J1U A; 
#chains in the Genus database with same CATH topology
 4AVP A;  4HEA 2;  3BZ6 A;  2X6O A;  4B48 A;  3AQS A;  3F8B A;  2EIM H;  1IRX A;  2QQ8 A;  3G4S I;  2ZKZ A;  1ZAR A;  1IRG A;  4QPQ A;  1YYV A;  2QEX I;  2GBY A;  2CQN A;  2XKO A;  1XB4 A;  3CJT B;  2E1N A;  2LVS A;  4ZDL A;  2VBZ A;  3ERE D;  2IT0 A;  3K10 A;  3JR9 A;  2DI3 A;  3S2W A;  1OR7 C;  3DBH B;  3F72 A;  3HGG A;  3KP4 A;  3MEX A;  4C9Y A;  1K6Y A;  1N25 A;  3S2H J;  2F5V A;  2X85 A;  1P4A A;  2HXI A;  5DCM A;  1T2K A;  1ETO A;  3ULQ B;  2EFP A;  3GME A;  2Y0S N;  1UMQ A;  3X2Q H;  1XN7 A;  3ERM A;  3ZQF A;  2VPR A;  2L3D A;  3CUQ C;  3WGG A;  1MW7 A;  4JX6 A;  4XR6 A;  3COL A;  3BCA A;  3FKJ A;  4Z6Y A;  2FJ1 A;  4L9V A;  2ZCN A;  3RQ4 A;  3SQN A;  1XTA A;  4DIQ A;  2CJJ A;  2DFH A;  3OIP A;  2JK3 A;  1RZ4 A;  4GCL A;  2H94 A;  3F8C A;  1Z0X A;  1SC7 A;  1U9O A;  2CO5 A;  3KKD A;  4KMU X;  2KFD A;  3I9V 2;  2D5V A;  2CYY A;  3W6V A;  2V57 A;  3K69 A;  4MTE A;  2D45 A;  3SWH A;  1QHG A;  3QU6 A;  2HKU A;  2DMT A;  2HDW A;  2Y0M A;  1E2X A;  3L2W A;  3F22 A;  1DDN A;  2W82 A;  3ABK H;  2FML A;  2DO7 A;  4E7K A;  3A0H C;  3GUD A;  3I59 A;  1ONV A;  2E19 A;  2E60 A;  4CDG A;  1B72 B;  3M8F A;  5E3L A;  2M7A A;  2HOT A;  2FRH A;  1NG7 A;  3QWL A;  2NNY A;  1A6I A;  4OWR B;  4PJL A;  5K1Y A;  1LEB A;  2VQH A;  4N9I A;  5FGL A;  5BNG A;  3IHU A;  4L0Y B;  1YW9 A;  2VBY A;  5DCF A;  5D8K B;  3BRU A;  5IYC J;  5GTH C;  3HOY J;  2R7Q A;  1PYV A;  2L7Z A;  2KRC A;  4HOB A;  4KIC A;  3LAP A;  1HBX G;  5B1A H;  4IRV A;  3M1C A;  1U5T C;  2PMZ N;  2LDU A;  4HX8 A;  3RDI A;  2ZXH A;  4XID A;  1CF7 B;  1LFU P;  2DPU A;  4CZC A;  3BJB A;  2YU9 J;  5E1W A;  1RKT A;  3OR1 C;  1QZY A;  1BI1 A;  1R23 A;  2JPC A;  2F5D A;  4KYW A;  2KLO A;  2W84 A;  1T56 A;  2JRT A;  2RNG A;  2XIG A;  2QIB A;  3QOE A;  4OIR F;  2DOF A;  2CQ7 A;  3O3K A;  4UUS A;  2YVX A;  2HDC A;  4Q5S F;  2JZY A;  3EUH C;  3DTE A;  3PM1 A;  1X58 A;  1JGS A;  1B6A A;  2F4O B;  4HA8 A;  1REP C;  4IHT A;  1G3W A;  1HST A;  2DN0 A;  5D6F A;  3VB2 A;  4BE2 A;  4IQJ A;  1S6L A;  2HWV A;  4A69 C;  1FOW A;  1X2M A;  3QPH A;  4G9Y A;  4GRI A;  2HOA A;  2IA0 A;  4OU0 A;  1SMY F;  4C30 A;  5E3N A;  5CQG A;  1L0O C;  4DYR A;  1BIB A;  5FGM A;  4GYI A;  4L5I A;  1TQP A;  5FD6 A;  1BOB A;  5TJJ A;  2IS2 A;  2HS5 A;  4AIJ A;  2HR3 A;  1OLT A;  3RYP A;  3KIO A;  3ZCO A;  3D5S C;  2CQK A;  4Y7N J;  3DEE A;  4DQ2 A;  5F04 A;  3IKT A;  2G7G A;  1WKM A;  4EJV A;  2MLG A;  3JRE A;  4I09 A;  2GXB A;  4CGR A;  1GVD A;  4BQA A;  5HOD A;  1NH3 A;  2COB A;  1WZ2 A;  1P9Q C;  2EPF A;  3HUG B;  4EMS A;  1LEA A;  1XCV A;  4ME9 A;  1UG0 A;  4U0W A;  2M1B A;  1MKM A;  4AC0 A;  1VQP I;  3DXJ F;  3NRG A;  5J47 A;  3WTY C;  3CMA I;  2BZT A;  1POG A;  3B6A A;  1DP7 P;  2OAZ A;  3ESW B;  3MZY A;  4I0B A;  2JA6 J;  4IQ4 A;  3K4N A;  2J5P A;  3CJD A;  3DF8 A;  4II3 A;  1TBX A;  2ELH A;  2NNN A;  1Z6T A;  2JSP A;  4JP0 A;  4F3Q A;  2L5Q A;  4QSH A;  3F8M A;  3QYB A;  3BCB A;  1GLN A;  3SXY A;  4RLQ A;  4HDV A;  4RM2 A;  1R22 A;  4H4K C;  1R5I D;  3KZY A;  3UR3 C;  3V4G A;  3JTH A;  3J80 Z;  5DDG A;  3P5J A;  1T98 A;  1TNT A;  3DCF A;  2YX4 A;  3HGY A;  3K4K A;  3VUQ A;  2GUH A;  3JSO A;  4P96 A;  2FE3 A;  1LVK A;  4L0Z B;  1VND A;  2NAZ A;  5LHH A;  3IH2 A;  2Q1Z B;  3VSL A;  2Y75 A;  1AA7 A;  3OSG A;  1QVT A;  3L2V A;  1Y6I A;  1KZH A;  3LL7 A;  4FE4 A;  4XNF A;  5D6E A;  4AUX A;  5EF6 A;  3TP3 A;  2KDZ A;  4FET A;  4WK8 F;  1GUU A;  2KKO A;  1ERD A;  5JLW A;  1B1B A;  2W24 A;  2B0L A;  1R1V A;  3NWS A;  1YX3 A;  3W6J B;  4JL3 A;  3EUA A;  1J5Y A;  3WTV C;  1PUF A;  1V55 H;  3E5X A;  3DTI A;  1IZ1 A;  1MND A;  2OCE A;  4NUB A;  3HRM A;  3LHQ A;  1VQL I;  3K70 D;  2CW8 A;  4D7M A;  2NOJ B;  2LD5 A;  3HE0 A;  4I0A A;  3WG9 A;  1W4M A;  2DA2 A;  3LA3 A;  3CC4 I;  3HKZ A;  5F0C A;  5HDK A;  2DA5 A;  1P6R A;  2HYG D;  4U7D A;  4IO9 F;  5JI6 A;  2ACJ A;  2I10 A;  1QNT A;  3CCQ I;  3F8N A;  3I4M J;  4BXX J;  2XUB A;  2DPD A;  3K0L A;  5FHP A;  3GZ6 A;  3GVA A;  1MMD A;  2PZ9 A;  1IN5 A;  1A04 A;  3NWT A;  1OYI A;  3D1N I;  2ZC2 A;  4XSX F;  3HRU A;  4ENM A;  4PJJ A;  1MMS A;  3TW7 A;  4KUM A;  5IP9 J;  3GZ5 A;  3ZR8 X;  2B9S A;  1CGP A;  3NNR A;  5CYV A;  3PO3 J;  3EPZ A;  1XS9 A;  4E7H A;  4AU7 A;  1W5S A;  2K9L A;  2RGV A;  3BG3 A;  3FIW A;  2BHY A;  2Q2E A;  5F1J A;  3FKI J;  4ESF A;  2XRO A;  2K9M A;  4M3G A;  3BQY A;  3HM5 A;  4NQW A;  3WOD F;  4AYB A;  2E2I J;  1IN7 A;  1UJ8 A;  5L3E A;  3QOD A;  4BU2 A;  5M3F J;  1WJ5 A;  4WF2 A;  3J7Y J;  1OIS A;  3N05 A;  5HNH A;  2FBQ A;  2CG4 A;  2GOX B;  1P7J A;  3D0S A;  2ECC A;  2FA5 A;  2O7T A;  2P7C B;  2F4M B;  4EM1 A;  3BPV A;  3FHZ A;  4Y4R A;  4ABZ A;  2BEO A;  1RUN A;  1MSF C;  4D0P A;  4MK6 A;  3W2W A;  3CCS I;  2BW3 A;  3EQL F;  3EUP A;  2GAU A;  3OR2 C;  3NPI A;  2AXT C;  2XGD A;  1PP7 U;  2GA1 A;  1FNN A;  2HVQ A;  1W36 C;  1IN8 A;  1IV6 A;  2E1M B;  1I27 A;  4HX4 A;  2XRL A;  2O61 A;  2QWT A;  3ZQI A;  3KZI C;  2LC2 A;  2W48 A;  4PCQ A;  2PI0 A;  2A2F X;  4HKU A;  1FTZ A;  3ECO A;  2EZH A;  1Q1H A;  4FCY A;  2KT0 A;  4B47 A;  3SEZ A;  3CD6 I;  3QAH A;  4P9U A;  3R4K A;  3HTA A;  2Y69 H;  1ZKG A;  4M3E A;  5E3M A;  2GXG A;  2IS4 A;  2O03 A;  2R7R A;  2LKP A;  2CV1 A;  1QHH D;  4A3C J;  2NYX A;  3CUQ B;  4C3I J;  5H2F C;  1ON2 A;  3SZT A;  3V7C A;  4WWC A;  2GLO A;  1FMW A;  3BZC A;  4BEH A;  4MQV A;  4EAT A;  2H1L A;  3MQ0 A;  3MKZ A;  1FBQ A;  2R7S A;  2L9R A;  3ZQH A;  3OYG A;  1HDD C;  2Q8K A;  1LQ1 A;  3G1O A;  3BRO A;  1GT0 C;  4HRI A;  4OIO F;  3F8F A;  2CS3 A;  2OUM A;  4D5F A;  3HBL A;  4KN4 X;  3IC7 A;  2M9H A;  4HQM A;  2NVY J;  5CLS A;  2CH0 A;  2K3P A;  3DU6 A;  2MSY A;  4LIV A;  3MMY B;  5D4S A;  1X4O A;  3WTS C;  1XG1 A;  2A6T A;  4ZYE A;  2LKX A;  3S15 J;  1PJR A;  2XAF A;  4IHX A;  5EYR A;  4EV0 A;  1MJA A;  3PIP F;  1K4T A;  1DUX C;  1B59 A;  3G1M A;  4DYC A;  3E6C C;  1D0Z A;  1W5T A;  3FX3 A;  4EJW A;  3GTJ J;  1MMG A;  2LLK A;  5LHG A;  4JYK A;  2EA4 A;  4FT8 A;  1FPQ A;  3E97 A;  5D4R A;  3E5U A;  5GAE J;  1R1T A;  1YRN B;  4M6X A;  3WTU C;  1Y56 A;  3BY6 A;  4XLN F;  5A2Q Z;  3ON4 A;  4ON0 A;  4YFK F;  4CCN A;  2DXI A;  1FOX A;  4MFE A;  2WAF A;  5F6F A;  1ZQ3 P;  2ZJR F;  2FD5 A;  2X6X A;  4YIF A;  3NI7 A;  3CLQ A;  3I4P A;  2PFV A;  1VQM I;  4MTD A;  4G7Z F;  2UWM A;  1IXC A;  1R58 A;  1O7F A;  3V7S A;  2EK5 A;  2XPU A;  1OJL A;  4HBL A;  3ZQ7 A;  1FZP B;  2V1D A;  3HDD A;  2KDO A;  2LF8 A;  1EF4 A;  5JR3 A;  2FNP A;  2XAJ A;  3C2B A;  2Y9Z A;  4PGG A;  4IX7 A;  4HDU A;  1QGP A;  4RAF A;  1W7P A;  1Y1W J;  3KP3 A;  4KN7 X;  2LMD A;  1O3Q A;  4UUV A;  4ZZL A;  3S1M J;  3HTI A;  1ZTR A;  3K7A J;  5IPA A;  2HPM A;  2ZCW A;  4JOM A;  2VOO A;  5GTI C;  1IUF A;  5AON A;  2O6G E;  1VQN I;  4G7H F;  5M5W J;  4Q47 A;  1YI2 I;  4C2M J;  4NC7 A;  3GTG J;  3VYU B;  3L09 A;  2W25 A;  2EA2 A;  1FYL A;  3B6C A;  4GCT A;  5JHU A;  4NBQ A;  4LB5 A;  1I39 A;  1WGX A;  4I98 B;  2P5K A;  3BJ6 A;  4JK1 X;  3VYR B;  3FMQ A;  1YHQ I;  2YR2 A;  2K9N A;  2VC0 A;  1WI9 A;  3OYJ A;  2DK5 A;  2KMU A;  3HHG A;  2GXA A;  3QYE A;  4BL0 B;  1V3F A;  3CP2 A;  1Z6R A;  1WSU A;  2P81 A;  3M4O J;  3JAM K;  2LKS A;  1IV8 A;  1P2F A;  2MH9 A;  2K40 A;  4KIS A;  1UI5 A;  3BG5 A;  3QU3 A;  2HNH A;  3LWF A;  3ZQL A;  1J7K A;  3CJN A;  3CCU I;  5CXG A;  4BY7 J;  2K9S A;  1BC8 C;  3ON2 A;  1ZAO A;  2OA4 A;  3H0D A;  2LSO A;  4IHW A;  1G3S A;  4S05 A;  4MNU A;  1V4R A;  2QLZ A;  1P4X A;  4XM3 A;  3CZ6 A;  3JRC A;  4FE7 A;  3TOA A;  4F55 A;  9ANT A;  3HEF A;  1VZ0 A;  4M9X A;  4GYG A;  2BXY A;  4UVC A;  4LK1 F;  3J81 Z;  2Y31 A;  5J6X A;  1HQC A;  1WJE A;  2QEN A;  2V6E A;  3FRQ A;  1UG2 A;  3EGQ A;  2DTZ A;  1B8I A;  1KQ0 A;  5EGO A;  3HOT A;  1YQA A;  1FBU A;  2QVO A;  1XCB A;  2CRG A;  4DBQ A;  4HAM A;  1Y8R B;  2EFN A;  1DQU A;  1V5E A;  3CJR B;  1B4A A;  3T6N A;  3QYF A;  5J1U A;  2DMU A;  2E5N A;  1WH7 A;  2ZME C;  5C3E J;  2NXN B;  3MD2 A;  4I01 A;  3BWG A;  5J3L A;  3HC7 A;  3A01 B;  2LRD A;  3GTO J;  5ILU A;  2X1D A;  3VOE A;  3SFI A;  3I64 A;  3FXQ A;  3IL2 A;  1ZG5 A;  5L3B A;  2XVC A;  5FKK A;  2R7U A;  5LBQ A;  4XLC A;  4GFL A;  1UST A;  5B66 C;  4M74 A;  4LIU A;  2XPW A;  5FKL A;  3P9K A;  4J00 A;  3TO6 A;  3S16 J;  2DOD A;  3FHN A;  1FLI A;  4IRH A;  1JKP C;  1E0E A;  3I71 A;  1CQT A;  3CCM I;  3I54 A;  2J5O A;  3WE3 A;  4B44 A;  1OKR A;  3QPS A;  3KEQ A;  2OI8 A;  4FTH A;  1HA8 A;  2GWR A;  2M30 A;  2L4A A;  4A93 J;  1DPR A;  2JMW A;  2EIJ H;  4F92 B;  5FD5 A;  2HOE A;  2NP5 A;  2O5R A;  2VQG A;  4P55 A;  4WXH A;  3H3Z A;  1YJW I;  5H9T A;  2HZT A;  5EEH A;  1V5G A;  5CJ9 A;  1E17 A;  3CCE I;  4XRS A;  5E18 F;  3LSJ A;  3ML6 A;  4E7S A;  1YS6 A;  4PUS A;  3VYT B;  5ICE A;  1R36 A;  2DQL A;  2VQL A;  4IXA A;  2P7V B;  5DD4 A;  5LGN A;  1NK2 P;  2RKH A;  2ZOZ A;  3NAU A;  2R5Z B;  4DJA A;  1YG2 A;  3OYB A;  4A12 A;  5CVI A;  4BJ6 C;  2PMU A;  4CZZ A;  2VLA A;  3R6S A;  1SVL A;  4BNC A;  4DBR A;  5LHI A;  1FYM A;  2DK8 A;  4NEL A;  4XLF A;  4B4C A;  1SFK A;  2EBI A;  4R1H A;  3CJQ B;  1VTN C;  2W7N A;  5L3C A;  4Y13 A;  2OER A;  2BY1 A;  3TDU C;  1EH6 A;  5E79 C;  2XGX A;  3L9F A;  1HLV A;  4XMY A;  4UY8 I;  2F6C A;  1FP2 A;  2KQR A;  1G6N A;  1TW2 A;  4KIF A;  3K4C A;  3H1C A;  3ANG A;  2OQR A;  4MGR A;  2GM4 A;  1R5G A;  4QTR A;  4HLY A;  2ZOY A;  1WCM J;  5LEK A;  4WXD A;  2L7M P;  2R0Q C;  5M5Y J;  1QA6 A;  2DAO A;  5L3G A;  1FEX A;  4BAC A;  1OCP A;  3ELK A;  4S04 A;  2IAI A;  2BVL A;  4IOA F;  1JHH A;  3ZMD A;  3HYI A;  3TP0 A;  4HG2 A;  2BHZ A;  3JCU C;  4O5V A;  2EIK H;  4HF2 A;  2E1C A;  1U8R A;  2M0C A;  3HL2 A;  1SVO A;  5KK1 A;  3FMR A;  2OV7 A;  1E3O C;  3G7R A;  5FO5 A;  2UV1 A;  4UHT A;  3HTH A;  4CSW A;  5GAG J;  1Z3X A;  3QBM A;  4E7I A;  3O8G A;  1TQI A;  2MLK A;  4HF1 A;  2QBY A;  4XRF A;  2PJR A;  1IDZ A;  4L9N A;  4UVA A;  1FIP A;  3S93 A;  2LBF B;  3RZO J;  2HYT A;  2HFH A;  3AQT A;  5DAJ A;  3V42 A;  2W4S A;  1IG7 A;  4LG0 B;  2D2W A;  2ZSI B;  2GQQ A;  3IH4 A;  2NVU B;  1MBF A;  4XRS G;  2DA7 A;  2L9N A;  1MDM A;  4M73 A;  4PJM A;  2WA0 A;  2FBI A;  3MZ8 A;  2IGO A;  5IP7 J;  3MFK A;  4IEJ A;  4BQO A;  2L9S A;  4EGY A;  1JKR C;  1BI2 A;  2V1N A;  4Y33 A;  3JRH A;  1SFU A;  4G94 A;  2R5Y B;  2XF7 A;  4WX9 A;  2NOG A;  5HS9 A;  4FAS D;  5K5R A;  4U87 A;  2QSF X;  3GFI A;  3KP5 A;  5BPD A;  3H9G A;  2LH9 A;  2H1K A;  4AYB N;  2O0Y A;  3F0C A;  2ZJ2 A;  4KA4 A;  1ETY A;  1RNL A;  2VE8 A;  1YS7 A;  3EET A;  3PFY A;  1ZR2 A;  2ETH A;  2M34 A;  3H35 A;  3ONQ A;  5CPR B;  1JTX A;  2WWY A;  3DKX A;  4CHU A;  3VOK A;  2KHM A;  3TKY A;  5HAW A;  3ZQG A;  4XL9 A;  1FYK A;  1O7L A;  3PO2 J;  4DZP A;  4B09 A;  2Y48 A;  1YJ9 I;  1V54 H;  2FBK A;  5E3O A;  2L9V A;  1TLH B;  5HS7 A;  3O2P E;  1SFE A;  4KWA A;  4ASN A;  1TC3 C;  3DFG A;  4PFO A;  2X9D A;  3EYI A;  1O3T A;  3U9G A;  3L1P A;  1FWZ A;  3L7W A;  1XSD A;  1VQ8 I;  1FBS A;  2WB1 N;  1R00 A;  4N4N B;  2FBH A;  3PSF A;  5D8L B;  1HC8 A;  3ABM H;  1ETQ A;  1S29 A;  4CYC B;  3BTL A;  4IJA A;  3KP2 A;  2M2E A;  5DTD A;  1FSE A;  1EV7 A;  2H8W A;  3BHQ A;  4MIM A;  5ICF A;  2DBB A;  3OOP A;  5FLM J;  2E7W A;  1K79 A;  1T0F A;  3JRA A;  5CVR A;  3HSE A;  2DJN A;  4OAZ A;  4DOZ A;  1EA3 A;  4LGW A;  1SD5 A;  1TW3 A;  4LFU A;  1E3H A;  1MBE A;  3DPJ A;  2ECB A;  2RN7 A;  3Q9S A;  3E6B A;  3FK6 A;  4HZF A;  1TQM A;  1WQ2 A;  5IT9 K;  3BG9 A;  5LFA A;  4MFD A;  3C2H A;  1APL C;  3VSK A;  4RMN A;  1R4M B;  2F5C A;  4HLX A;  4L9J A;  4IRG A;  3REO A;  3OYD A;  2NVQ J;  2H6C A;  4I6Z A;  3CCR I;  2FJI 1;  3KYC B;  3VFZ A;  2XF5 A;  1HW1 A;  4LJZ F;  3WTX C;  3K70 C;  3VOX A;  5HSZ A;  2OQG A;  4ENJ A;  1X2N A;  2V6C A;  4G6T B;  3GBG A;  3VDX A;  1HW5 A;  2CV2 A;  1UFM A;  3T8T A;  3OL3 A;  4GCK A;  2ID3 A;  1X4P A;  1DGR M;  2RQQ A;  1ZLK A;  2ME0 A;  2PEX A;  5DV5 A;  5EG0 B;  2JRM A;  3W2A A;  2IW5 A;  4NB5 A;  4E7Z A;  5FMP A;  3LA7 A;  1B9M A;  4OIN F;  4HX7 A;  4KNY A;  5K7Z A;  2DLL A;  4ENN A;  1VQ9 I;  4I02 A;  2NS8 A;  5DM6 F;  2OBP A;  2O7O A;  4KDP A;  2CUE A;  3Q3S A;  2G3B A;  4J19 A;  4G6Q A;  5CVU A;  2LG4 A;  1VQK I;  2YX7 A;  5FRM A;  1J2X A;  2PBI A;  2A5W A;  2QQA A;  3V8L A;  5BMZ A;  1ON1 A;  4S0H B;  5J4V A;  2M45 A;  5J1R A;  2LTP A;  1IJW C;  1G4D A;  2R7Z J;  4BHC A;  6PAX A;  2ELK A;  2ZME B;  2AHQ A;  3GXO A;  5D5X B;  1QRY A;  2VON A;  3RYR A;  4N0B A;  4C2U A;  3WTT C;  4UB6 C;  5FRO A;  4E4H A;  1K78 B;  4WCG A;  4AF5 A;  1FP1 D;  5FLX K;  3BZK A;  4A3J J;  1SAU A;  1Y39 A;  4JX4 A;  3CMM A;  3CME I;  3WTW C;  5K7H A;  3RD3 A;  1ZN2 A;  4LLL A;  3K1N A;  2DT7 B;  1LE8 B;  4YZE A;  3K2Z A;  4W1U A;  1H89 C;  2CU7 A;  2ZCM A;  4YFN F;  2O8K A;  3CES A;  3B81 A;  2ISZ A;  4UV8 A;  1B72 A;  5D5U B;  5H20 A;  4PSX A;  2P6S A;  2X51 A;  5LRR A;  5L3D A;  1YTY A;  3HG9 A;  4KIB A;  4GDF A;  2Z1D A;  2V9P A;  1SAX A;  3EDP A;  4CXF A;  3D5L A;  4ZH4 F;  3RQI A;  2STT A;  5M3M J;  1W0T A;  3KE2 A;  1EJ9 A;  1A36 A;  1RES A;  2MD0 A;  1X1D A;  5K58 A;  2JA5 J;  1MMN A;  1FIA A;  1WH5 A;  3GLX A;  4AIK A;  3RH2 A;  5JVG F;  3SZG A;  2G7H A;  2F5F A;  2XC7 A;  4JKZ A;  3GX4 X;  3VW1 A;  2RHA A;  4B8X A;  4LD5 A;  2DOE A;  1AKH B;  2OTJ I;  3VVZ A;  1CF7 A;  4RGU A;  4BJT A;  2WV1 A;  2M5W A;  1OFC X;  1KU2 A;  3DPT A;  5EJC A;  1UI6 A;  3BTJ A;  3CWR A;  2HQ5 A;  1FMV A;  3CQZ J;  1TZL A;  1JHF A;  3T5X A;  3K4M A;  3ZN1 A;  2K3F A;  3P7N A;  5ED4 A;  4IL6 C;  4MXM A;  3PIO F;  1OYW A;  2R7F A;  1Z91 A;  1R9T J;  1ZEL A;  5IYB J;  4UVB A;  2DW4 A;  5LGU A;  1N77 A;  2IJL A;  4RAZ A;  1LUJ B;  1HOM A;  1DGW Y;  5CW8 A;  4XOT A;  1GHC A;  2O3F A;  2OC6 A;  1ZRD A;  2ME6 A;  1P92 A;  2DT5 A;  3GF2 A;  2CGP A;  2LP0 A;  1RET A;  3RPU D;  3K1P A;  5KAF C;  4KMF A;  2GFN A;  3OYN A;  3AG2 H;  2PLY A;  1YJN I;  3CO7 C;  3RJP A;  1O57 A;  4DW6 A;  4PGH A;  1MJB A;  5ICC A;  2VBW A;  1Z7L A;  2GZW A;  1D0Y A;  2CQQ A;  1UAA A;  1UHM A;  2CUZ A;  1FT9 A;  1FJL A;  4ZTJ A;  3KKC A;  2IA1 A;  2K4B A;  4B3A A;  3I58 A;  4A3B J;  2FMY A;  3PL8 A;  2QQ9 A;  3RKX A;  3NQO A;  1ETV A;  4CA0 A;  1X19 A;  4A3I J;  2YU3 A;  2QKM B;  4F91 B;  4R8H A;  2MA3 A;  5J8F A;  2M87 A;  3HUG A;  3QPL A;  5L3F A;  1D5V A;  2KIU A;  2ZFU A;  3M9A A;  1IC8 A;  3WU1 B;  4V19 K;  2JN6 A;  2FF4 A;  2AXL A;  3J7A Y;  3IWZ A;  2FSW A;  3HB9 A;  4ANJ A;  1I50 J;  4ZDO A;  3OYC A;  1XPX A;  3KFW X;  2DJI A;  3K6G A;  3KP7 A;  3LMM A;  2W57 A;  3RSN A;  3FBN B;  2HTJ A;  4B1R A;  5FJ8 J;  2X1C A;  3S8P A;  1ULY A;  1YIO A;  3F23 A;  3AFH A;  3ZGK A;  1UCR A;  1WFX A;  3MKL A;  4GFB A;  1Z7U A;  3OYF A;  1IRF A;  1BBY A;  5EFY A;  1R71 A;  4Y3O A;  4A3E J;  1ZR4 A;  2A69 F;  3HJE A;  2COM A;  3K4L A;  5GPC A;  3Q0U A;  2IRF G;  5DM7 F;  4B3X A;  3LA2 A;  2VJ4 A;  1KON A;  3H36 A;  2JVH A;  1VQ7 I;  4YEJ A;  2NS7 A;  3WE2 A;  2A6E F;  3R0J A;  1Z3Y A;  1XMX A;  3LSP A;  2H09 A;  2XAG A;  1H9G A;  1HF0 A;  1D5Y A;  2NX4 A;  3Q5F A;  1MZB A;  2V7F A;  1QU3 A;  2Y0S A;  2V4J C;  3S14 J;  1J59 A;  2BV6 A;  3JRF A;  1WVR A;  1EH8 A;  1BL0 A;  2HXO A;  1OQY A;  2VKD A;  4Q48 A;  4CIC A;  5E20 A;  2DFI A;  2ELJ A;  3OYL A;  4RB3 C;  1VQO I;  1IN6 A;  5IOY A;  3ZMT A;  4CGZ A;  3FWE A;  1U3E M;  1SVM A;  4FQG A;  2EV5 A;  3C3W A;  3W6K B;  2YUS A;  4G6D A;  3N97 A;  2OCC H;  1W5C C;  4BQN A;  3CTA A;  3OY9 A;  2HTS A;  2TDX A;  2H27 A;  4HNU A;  3HOV J;  2M4K A;  2K4J A;  3EUK L;  3Q0V A;  3HPH A;  3BR1 A;  1FOK A;  1XSV A;  5HVQ C;  2D6Y A;  5B1B H;  1T0F C;  4UV9 A;  1QZE A;  3WGH A;  3RZD J;  3OOU A;  2FU4 A;  2MYS A;  4MO7 A;  3A03 A;  3JSP A;  1NK3 P;  1KYZ A;  2V1U A;  3OIQ A;  2Z9O A;  4Y52 J;  2W53 A;  3M7G A;  3BP8 A;  1IW7 F;  5BPI A;  2JUC A;  1JTY A;  5GAH J;  4LIT A;  3VW0 A;  4YII A;  4HF0 A;  2XV4 S;  2GEN A;  3B73 A;  1OCO H;  3HHH A;  5CKT A;  4M72 A;  3ECH A;  3WU2 C;  4X0G A;  3ZMV A;  2PMZ A;  1JXS A;  4L62 A;  4V2F A;  4GCV A;  4GXO A;  2YS9 A;  1LDJ A;  4K2E A;  2HKO A;  4D9J A;  5FRN A;  1T95 A;  4HW0 A;  5E1X A;  4RGR A;  2H8R A;  3DLL F;  1TWG J;  1U5T B;  2VXD A;  2XGC A;  2FOW A;  2IU5 A;  2XDN A;  3G71 I;  2UXI A;  1GVJ A;  4A6E A;  3OYM A;  2ISY A;  2EFW A;  3CCL I;  3ZPL A;  3AKZ A;  2EB7 A;  3I5U A;  3S3O A;  4A0Z A;  4KIT B;  1MNM C;  2XHK A;  1BR1 A;  2XSJ C;  4XLE A;  3GWZ A;  1OYY A;  2E1O A;  2QM3 A;  5IP6 A;  5B3S H;  1O4X A;  3H3V K;  1W1W E;  2V79 A;  3O8H A;  3CC7 I;  2STW A;  5J1Y A;  5CVV A;  1AWC A;  3RKW A;  2KZG A;  1IF1 A;  3L2C A;  2G0E A;  1VF9 A;  2V9V A;  3R0A A;  2UXU A;  1XSX A;  3BDD A;  2K5C A;  3WG7 H;  1OR7 A;  4Z2Y A;  2IBD A;  2PN6 A;  3OV8 A;  2ZNZ A;  3GEU A;  2IXS A;  4A5N A;  3S5R A;  2R3S A;  4WXC A;  2PX9 A;  4L18 B;  1WJD A;  1JJ8 C;  3VWB A;  5FLV A;  3C1D A;  3CDL A;  3DU5 A;  1Y0N A;  3GTP J;  2KL4 A;  2L7F P;  4LMY A;  5LD2 C;  1W0U A;  1A31 A;  3ISP A;  5CVJ A;  2JPB A;  2R7T A;  4NDL A;  4RBO A;  2UXO A;  2IS1 A;  3CUQ A;  3JTG A;  4MHG A;  3P9C A;  4BH9 A;  3S1R J;  1A5J A;  1OCT C;  1WJB A;  4P1W A;  2KPM A;  3ZRG A;  2HU9 A;  2L7K A;  4FIS A;  4XRM A;  2IGK A;  4ZYA A;  2ZJP F;  1BC7 C;  1TWA J;  3LSG A;  1D1C A;  3JRD A;  4AD9 A;  4YRV A;  1KGS A;  3TGN A;  4RB0 A;  3CCJ I;  1HSJ A;  3SDB A;  2Y9Y A;  5E8G A;  4EJO A;  3OMY A;  2L0K A;  2ZO4 A;  1A6Q A;  4XIC A;  1HKS A;  2EJR A;  4F7Z A;  2Z2S B;  3FXO A;  4A2U A;  4BUP A;  1GXQ A;  3FF5 A;  1W36 D;  1U0J A;  5K7F A;  1RUO A;  4PSW A;  1RI7 A;  4HV5 A;  1UEL B;  2QA4 I;  5C4X J;  2IGM A;  2DFE A;  5J4Y A;  3K2A A;  4YIR X;  1LNW A;  3VYS B;  3LJL A;  1ZRC A;  2FQ4 A;  4ETS A;  1Y0U A;  5HLI A;  4BBS J;  2EH3 A;  2BGC A;  5C44 J;  4HYE A;  3RPU A;  4YFX F;  1YRN A;  4AVZ A;  3CRJ A;  3PNY A;  3I55 I;  1X1B A;  3NAR A;  1ACI A;  1BR2 A;  3MVP A;  2EIN H;  3HIF A;  2A68 F;  3KNW A;  3B02 A;  1VFC A;  4EEF G;  3U1K A;  3NS4 A;  3FXJ A;  4CUG A;  2HYJ A;  3L2R A;  2N8G A;  2UUZ A;  4U0Y A;  3F6O A;  1JUM A;  4XQF A;  3I53 A;  3CUO A;  1EKE A;  4UB8 C;  3T0Y A;  4Y17 A;  3PPB A;  5F27 A;  1S8N A;  2E35 A;  3C07 A;  2DMP A;  1WI3 A;  3KYD B;  4BXF A;  4E7L A;  2OZ6 A;  3HRT A;  1XC5 A;  2LOO A;  1J9I A;  2NRA C;  1YLF A;  1H8A C;  1WWX A;  2F07 A;  4BE0 A;  3FIS A;  3HTS B;  4CCJ A;  1YW7 A;  4J01 A;  1IO2 A;  3H3U A;  4Q4Z F;  2QOP A;  1D1A A;  5CQE A;  1JKO C;  1T33 A;  1IUY A;  2Q24 A;  2G7S A;  2I5U A;  1G3Y A;  3MZH A;  4XBF A;  3H5R A;  5H6R A;  2PJP A;  4HPQ A;  2PQ8 A;  3E1S A;  1U6G A;  1N75 A;  1WPK A;  2ZSH B;  4XLP F;  4N4O B;  1U8B A;  3DP7 A;  3FBI B;  4E7J A;  5LLQ A;  1SMT A;  3CDI A;  3PNV A;  1GXP A;  3GTQ J;  4A0X A;  1BI3 A;  3VEP A;  3F6V A;  1OCC H;  2QQB A;  2A5Y B;  1UHS A;  4YEL A;  1XDS A;  4ZJZ A;  3JSJ A;  4MLO A;  4IPA A;  4U7B A;  1YE9 A;  5EEA A;  2Z16 A;  3O6B B;  3A2K A;  1DP3 A;  1S5L C;  1ZHF A;  1TP4 A;  2HQN A;  4LK0 F;  4M6V A;  3VPR A;  1ZYR F;  2DG7 A;  2EZI A;  2XB5 A;  1LVA A;  3L00 A;  2IS6 A;  2A61 A;  3V8J A;  2M7B A;  3R60 A;  4PXI A;  2XRN A;  2JT1 A;  3IAM 2;  3V6G A;  2HI3 A;  3ZXS A;  4X6A J;  4II2 A;  1BI0 A;  3FK7 A;  4CO8 A;  5D19 A;  3O60 A;  1ENH A;  2G9W A;  2NVX J;  1Z9C A;  2JA7 J;  3RCO A;  3BR5 A;  3MWM A;  2X6Y A;  1QZZ A;  5TRD A;  2QGU A;  3MAJ A;  3HPG A;  2ZXI A;  2ADU A;  2A07 F;  4GFK A;  3KYL A;  2P4W A;  4M3B A;  1MBG A;  4M9S A;  3U21 A;  5AIQ A;  1TWF J;  4JQF A;  2VQC A;  2C6Y A;  2VI6 A;  4A3L J;  5DCM B;  1MNE A;  3J7A O;  2KJB A;  3PAS A;  3KLN A;  3IV5 A;  2OD5 A;  2G7U A;  3A01 A;  1XGO A;  4IVN A;  2WY8 Q;  4M3F A;  2I8D A;  2FNA A;  2VN2 A;  3F9K A;  5JFR A;  1K61 A;  1ETK A;  2DQR A;  3H0G J;  5FKN A;  4LB6 B;  5ICG A;  1Z67 A;  2JWT A;  4IZZ A;  3J80 K;  3Q0W A;  4F52 A;  4RM3 A;  5C4J J;  4D5C A;  3IKV A;  2VOD A;  2AQF A;  2RV8 A;  3E3V A;  1ZH5 A;  2DA4 A;  2BY2 A;  1GDT A;  4ZC3 A;  2M8E A;  3A1Y A;  4HST A;  1YO5 C;  1J09 A;  1G3T A;  4XOP A;  2B1E A;  5F1R A;  2EFO A;  2MFZ A;  3CLO A;  3S2D J;  4WIB A;  3HKZ N;  2FXA A;  3I59 B;  1RRJ A;  5JLX A;  3MKW B;  1USS A;  2E36 A;  4R79 A;  4A3F J;  2H6B A;  3GCM A;  1G2H A;  1KA8 A;  2HZD A;  3A0B C;  3FXL A;  3QKX A;  1JT6 A;  4EM2 A;  1JT0 A;  2WY7 Q;  4NN1 A;  3KET A;  3SYT A;  4XLA A;  1NHA A;  2W00 A;  1LDD A;  3BNI A;  3GTL J;  2WAQ A;  5F0H A;  3MCZ A;  1S7O A;  2CW0 F;  1XGM A;  1DPU A;  1YOV B;  2KIM A;  2L02 A;  1VQ5 I;  2DYR H;  2R5Z A;  1EH7 A;  2LK2 A;  2A05 A;  3U2R A;  4RB1 A;  3S1Q J;  3F21 A;  2FEZ A;  2ICW G;  1HCR A;  2OU2 A;  2VKE A;  1KQ8 A;  2OPT A;  1O3R A;  5CXI A;  2QF7 A;  2DA1 A;  1XD7 A;  2GIV A;  3HOX J;  1S7E A;  2XDV A;  1F1Z A;  2D1V A;  1F5T A;  4RLF A;  5F64 A;  4HV6 A;  3SFZ A;  1R5H A;  2ID6 A;  4NHJ A;  3G56 A;  2LFB A;  5GAD J;  4U9N A;  3KZZ A;  4UUS B;  3E0J B;  1AHD P;  3SHF A;  2E1M C;  4QLC U;  3LSR A;  4CCM A;  2X48 A;  2PG4 A;  2MD5 A;  3R61 A;  3N4M A;  1SD6 A;  3ZOB A;  3JAM Z;  3S1N J;  2X1E A;  2WAE A;  1A35 A;  3BR6 A;  3M1E A;  2AS5 F;  4M9Z A;  1I3Q J;  3ABL H;  2PMH A;  4LOC A;  2JA2 A;  3RKQ A;  2P8T A;  3FXK A;  3TMO A;  4YG2 F;  1ITY A;  2NVT J;  1STZ A;  2QYO A;  4NNJ A;  1LDK B;  4ZYH A;  4AIH A;  2XSD C;  2IEK A;  1P7I A;  3CCV I;  4C2T A;  2DCE A;  2CMP A;  2VB6 A;  1Z1D A;  2JVG A;  1MJ9 A;  2LY9 A;  2WC2 A;  1ZLJ A;  5HLH A;  3KZ9 A;  1JGG A;  5DEQ A;  2VPL A;  2ZB9 A;  5EZH A;  1X1C A;  2CWE A;  3GFM A;  3VW2 A;  1RR8 C;  3ZMS A;  2A6H F;  3ASO H;  4AM3 A;  3GTM J;  1XGS A;  1HW2 A;  3NRV A;  4D1Q A;  4ZDP A;  1I1G A;  2QZ8 A;  2JA8 J;  2DDB A;  2LBF A;  3M8J A;  4PDK A;  1S7A A;  4LG0 A;  2D1H A;  2NS0 A;  4I99 C;  1OCR H;  2ZBK A;  3VOD A;  2M4G A;  4JBA A;  4CCO A;  3G73 A;  1ZG3 A;  3IWF A;  1R6R A;  1LPQ A;  2DMQ A;  1T8I A;  3BQZ A;  2FUG 2;  3WGI A;  2BYV E;  4U0V A;  3OYK A;  3TDZ C;  2DDA A;  5HLT A;  5EZG A;  3GFJ A;  4XLH A;  2R5Y A;  3K8P C;  3DV8 A;  1KU3 A;  2YVE A;  2TRT A;  3PUB A;  1MD0 A;  1F9N A;  3OYE A;  2REK A;  2LF7 A;  3AG3 H;  4OD4 A;  4ENK A;  2XAS A;  3SZP A;  3DTK A;  4ESB A;  1QBJ A;  1SD4 A;  3AG1 H;  3EYY A;  4BQQ A;  2R7O A;  2UZK A;  1WJA A;  4CCK A;  2LR8 A;  4LLN A;  2Z99 A;  1RC9 A;  5ERI A;  3ZMZ A;  2VL8 A;  5HDN A;  3J7Z I;  2UXH A;  3W3C A;  2ESN A;  1PUF B;  2O9L A;  4MEY F;  3HTU A;  4LG3 A;  5ILV A;  4IRI A;  1K83 J;  5A2Q K;  3G1L A;  2IVM A;  1K6O A;  5EEG A;  5KVR A;  2K27 A;  4RA2 A;  3AG4 H;  4C3J J;  2IA2 A;  2HGC A;  4CYD A;  4BJ5 C;  3QP5 A;  3KPH A;  3JRI A;  1SD7 A;  3HSF A;  2CUJ A;  4A0Y A;  4BKX A;  4OMZ A;  3BTI A;  1ZGW A;  1BJA A;  1R4N B;  1FX7 A;  4CYC A;  3LQQ A;  3VTI A;  2BY3 A;  3DPL C;  3KLO A;  1U2W A;  3OIO A;  2XAH A;  3E7Q A;  1RIO H;  4PK4 A;  4EJT A;  1W7P D;  1IN4 A;  3DBL B;  4CH7 A;  2KJC A;  4BE1 A;  4H0E A;  1NTC A;  4ZTF A;  5ILS A;  5F08 A;  3LSI A;  3CF5 F;  2RAS A;  3CO6 C;  2Q2E B;  2E7X A;  4M71 A;  1VQ6 I;  2EV6 A;  2UXN A;  4NQW B;  2HQR A;  5DS9 A;  3COA C;  5HS8 A;  4RS8 A;  3FZV A;  1HXD A;  2M3A A;  3K1M A;  1E3P A;  3FXU A;  1UB9 A;  2RAE A;  1YIJ I;  3SJM A;  1YX5 A;  2UXX A;  1FOY A;  2WBM A;  3GEZ A;  1J0R A;  3K4J A;  4BBR J;  5FKM A;  5GP9 A;  1BN5 A;  4QIW N;  1T39 A;  1ZRE A;  1S9H A;  3LSH A;  3DKY A;  3LQR A;  1ZGJ A;  5FKO A;  3TED A;  3HOS A;  4TV7 A;  2BW3 B;  4DZJ A;  5EG0 A;  4QWQ A;  3GTK J;  4A6D A;  2PBX A;  2RRE A;  1PUE E;  3BG6 A;  5DD8 A;  3OS2 A;  1Z05 A;  2GIZ A;  4BHP A;  3JRB A;  1VQ4 I;  3NXC A;  3P9I A;  2HQA A;  2M8G X;  2KIF A;  3NEU A;  2E34 A;  3A02 A;  2JQ7 A;  4U9L A;  4XKB A;  1I5Z A;  3OYH A;  5LEJ A;  1B9N A;  1MBJ A;  3KEY A;  2V9K A;  5E1Z B;  2DTR A;  3IAS 2;  4I76 A;  4MEX F;  1LFP A;  4ITV A;  4P5O A;  3J81 K;  2ZME A;  1LFB A;  1T38 A;  1LKX A;  2EWN A;  3AL0 C;  3VIB A;  4A5M A;  3V7R A;  3IRR A;  2BE5 F;  1K78 A;  2OZU A;  2EQR A;  4BEH B;  4Y15 A;  3QQA A;  5AQC A;  3K4B A;  4UUT A;  4RB2 C;  3LWJ A;  3V78 A;  5K5Q A;  3CDH A;  3QRF F;  1BOA A;  3GW2 A;  2MH2 A;  3WU0 A;  3UKG A;  1IXS B;  2KP6 A;  2RDP A;  2LRE A;  4HNV A;  1LE8 A;  2GA2 A;  2QKL B;  2HYF A;  1XMK A;  1Q1V A;  3LFU A;  4AWX B;  3G2B A;  3U1D A;  2L54 A;  1G8X A;  4IHS A;  2Y2Z A;  4AC6 A;  1WRJ A;  4NC6 A;  2F2E A;  4FX0 A;  2MW8 A;  3OS1 A;  1J75 A;  2VXZ A;  4EQQ A;  3JRG A;  4RDU A;  4FHT A;  3RTR A;  4KFC A;  2L01 A;  1AU7 A;  2FOK A;  4BS9 A;  2R7V A;  1GV5 A;  3PJR A;  2E5Z A;  2CUF A;  3WTZ A;  4ESJ A;  2Y30 A;  3ABU A;  2XKP A;  2K7L A;  4CCL A;  3BC8 A;  3VVX A;  5HOO A;  4BXU A;  2RNJ A;  1GV2 A;  2A3S A;  2R4G A;  3HXL A;  2HVS A;  4ZYG A;  4JNN A;  2X4H A;  1X3U A;  3UNG C;  2Z3Y A;  2E71 A;  5IT3 A;  2YSR A;  2LY2 A;  3S3M A;  1AKH A;  4C2M A;  2VOP A;  4DVY P;  2EFQ A;  5E8I A;  3W2V A;  2R92 J;  3M8E A;  3ZP5 A;  2KIS A;  2VKV A;  5BS6 A;  1DU0 A;  2BBY A;  2ZXW H;  5FFX A;  3DLA A;  2VE9 A;  2IPQ X;  3PUF A;  1H88 C;  2LY1 A;  1W7P B;  2K02 A;  2R7X A;  3KP6 A;  3BLY A;  2O8X A;  4BHB A;  3I56 I;  1H0M A;  1ODD A;  1BM9 A;  1OCZ H;  2CW7 A;  4U88 A;  4DGW B;  2CFO A;  1XGN A;  4MQ9 F;  3GYH X;  2QWW A;  2XGE A;  2LYC A;  5IYD J;  3LFK A;  3S3N A;  2M0M A;  1S72 I;  1Y1V J;  3PSI A;  2QTQ A;  2K85 A;  5IT9 Z;  3KEO A;  2PFB A;  2WB1 A;  2VC1 A;  4XSZ F;  2CV0 A;  4IHV A;  2EZK A;  3AAF A;  2MC4 A;  2VUM J;  1IRZ A;  3ZQC A;  2R7W A;  2B63 J;  4OAY A;  1MH4 A;  2B7E A;  5IOZ A;  3P9T A;  3HSR A;  5EDN A;  3E6D A;  3LSM A;  3GZN B;  3F1B A;  4HSR A;  5HLG A;  1Z77 A;  1XX5 A;  2XB0 X;  5HNF A;  5B5E C;  1D8K A;  3BTC A;  3MKY B;  1Z21 A;  1LB2 A;  5KAI C;  3V8K A;  1H9T A;  1N78 A;  2NP3 A;  2ZCX A;  4XOR A;  4OIQ F;  4UNO A;  5D5V B;  5HBU A;  4RGX A;  2HVR A;  2VT3 A;  3CF2 A;  1TWH J;  1BIA A;  2W85 A;  1UHW A;  3FXR A;  1QVU A;  2VIX A;  2BXZ A;  4D7N A;  5GPA A;  1DU6 A;  1R1U A;  2L2O A;  3ZN0 A;  1TT0 A;  4IF4 A;  3DBR B;  3L2U A;  2R7D A;  1NG6 A;  2AO9 A;  2WAQ N;  3BG7 A;  1RPW A;  5TGT A;  2W1O A;  2K9Q A;  4L9T A;  1KQ9 A;  4X1E A;  4KIG A;  1K7A A;  2DA6 A;  3RIR A;  2JJ7 A;  1B8I B;  5EGO B;  3DPU A;  1KU7 A;  2VBX A;  1SFX A;  3A4C A;  3H5A A;  2OF7 A;  2P0W A;  3FMS A;  4L5J A;  5FLX Z;  3E6M A;  4BYY A;  4EGZ A;  3ANP A;  2DYS H;  1YIT I;  1S3J A;  2RVC A;  1F43 A;  3QOP A;  3TQN A;  2OJE D;  2BOL A;  1PVE A;  3PNT A;  4XON A;  3KX2 A;  3FDY A;  4ZZD A;  2V1X A;  3WHB A;  1I3A A;  2TCT A;  2WV0 A;  1IDY A;  1G59 A;  1D3Y A;  3MNL A;  1QO0 D;  1WHU A;  3TW6 A;  2L4M A;  4BAY A;  3I3L A;  2DT6 A;  1HKQ A;  1MGT A;  1I1S A;  1BJZ A;  4FX4 A;  4EVI A;  2XPV A;  4XN3 A;  2E2J J;  2YVH A;  1X1P A;  4N9H A;  5AIP A;  3SDG A;  3IUV A;  3L2Q A;  3HTJ A;  3G3Z A;  5J40 A;  1IXR C;  5FB2 A;  2JUG A;  1D1B A;  4LLG F;  1SGM A;  4HQE A;  3GFL A;  2VJ5 A;  4QPO A;  2XAU A;  4A3M J;  2KRF A;  2X0L A;  2XAQ A;  3Q9V A;  2HEO A;  1JUS A;  1BA5 A;  3LNQ A;  1HKT A;  2F48 A;  1I6H J;  2JTV A;  1WJC A;  1LJ9 A;  4NC8 A;  1X3Z B;  4IKF A;  4XK4 A;  1IGN A;  3LAJ A;  1I6X A;  5KHD A;  4PJ0 C;  5LGT A;  5IY5 H;  3DEW A;  3F3X A;  4E6K G;  2R93 J;  4G8X A;  3PQK A;  1FSH A;  3JW4 A;  2MG4 A;  4UDS A;  1SFO J;  1ZK8 A;  4AID A;  2HKX A;  2DU9 A;  4A3D J;  3BJO A;  1ETW A;  3BT9 A;  2JSC A;  2CSO A;  5DYM A;  2G7L A;  3DQV C;  4KT5 C;  5M5X J;  3HOZ J;  3QPT A;  3K9T A;  3CCY A;  4JX5 A;  4W97 A;  2FQ3 A;  3OYI A;  3HOW J;  2EIL H;  3LSK A;  4XKW A;  4L5E A;  4A3K J;  1MBH A;  4GO1 A;  2RC4 A;  1QPI A;  2EZL A;  1OMI A;  2UXP A;  1P4W A;  2E2H J;  3E5Q A;  3BR2 A;  4EJU A;  3VP5 A;  3OL4 A;  1U5T A;  2VJJ A;  1L3L A;  1D0X A;  4P9F A;  4EM0 B;  1TWC J;  4OOI A;  3DKW A;  2MGQ A;  3H9J A;  3H9Q A;  2WGB A;  2DMN A;  2FX0 A;  3BR3 A;  5LRS A;  1QQI A;  2IP2 A;  2MAB A;  1TL8 A;  4M3D A;  3SEQ A;  4I2O A;  2GOM A;  2P5V A;  3TOB A;  2DA3 A;  2BY0 A;  1R7J A;  1V5F A;  4UXN A;  3EUH A;  3CMY A;  3OSF A;  4IOC F;  3FM5 A;  4DYQ A;  4BDZ A;  3C7J A;  3D5R C;  4BGD A;  1ZG1 A;  4OMY A;  2MBF A;  4ICH A;  2ZY9 A;  4KT6 A;  1C0W A;  3ASN H;  3IP4 B;  5HDG A;  3KCC A;  3ZQQ A;  1T6S A;  5BQT A;  1JE8 A;  1FY7 A;  1FC3 A;  2EV0 A;  1R49 A;  1O3S A;  1HDP A;  2ESH A;  1PDN C;  4B43 A;  1XDU A;  2QBY B;  3HIM A;  3C18 A;  2QSH X;  2PJR B;  5BOX A;  4G7O F;  1YW8 A;  1JUP A;  2K86 A;  2DFF A;  3HOU J;  3H5N A;  2F5E A;  1K4S A;  3FXM A;  3MN2 A;  3RPQ A;  3OS0 A;  4HNT A;  2VJI A;  3HZJ A;  1RR7 A;  1TT5 B;  3AL0 B;  3I4N J;  5F0F A;  1X3W B;  3S17 J;  5D1R A;  4G12 A;  1YFH A;  4PZJ A;  4RAY A;  3BPX A;  1WJF A;  1BR4 A;  2YPR A;  3M3Y J;  3TO7 A;  1D8J A;  1MDM B;  1KU9 A;  5FFZ A;  4E70 A;  1ORK A;  3G6E I;  5C4Y A;  1X1A A;  1M1E B;  5D5W B;  2BVM A;  2V26 A;  2MC3 A;  1MIJ A;  2P6T A;  1AOY A;  2KZV A;  3LOC A;  3TL4 X;  4IHY A;  1QPM A;  1ZRF A;  3IUO A;  3ABT A;  1ETX A;  2QSG X;  1MH3 A;  2DOA A;  3VVY A;  1F36 A;  3GLL A;  5D18 A;  3ROU A;  4OD5 A;  1XMA A;  3WHC A;  1MSE C;  2QCO A;  1BW5 A;  1VI0 A;  3FM3 A;  4XN0 A;  2P5L C;  1JKQ C;  2QKO A;  1SEU A;  2WAD A;  3BR0 A;  4A3G J;  4RAG A;  1TNS A;  5TIS C;  1U9N A;  3RKY A;  3S32 A;  5H6Q A;  3CP8 A;  3TO9 A;  4ZYD A;  2HDD A;  3BCG A;  3M07 A;  5J8C A;  3HRS A;  2ZNY A;  3LST A;  4V2G A;  2WUI A;  2WTE A;  3BJA A;  4O3M A;  1KYW A;  1MMA A;  2LNB A;  2RQP A;  2VAS A;  4XKC A;  3IRQ A;  3RI4 A;  2F4I A;  4OIP F;  5K5O A;  1OPC A;  2HPI A;  1PP8 F;  3PQJ A;  2B3W A;  3GO5 A;  4KJZ A;  2KRH A;  2CQX A;  4PFP A;  3CC2 I;  1JI8 A;  4I7H A;  4BY1 J;  2AQE A;  1RKW A;  5JHF A;  3I0T A;  3BOQ A;  1BW6 A;  1T08 B;  5JVT A;  2ZJQ F;  2CFX A;  1UZC A;  2VT2 A;  2ZXJ A;  4F93 B;  4BDY A;  1Y8Q B;  2HOS A;  3PFI A;  2Q0O A;  3H92 A;  5DUI A;  1U78 A;  5KCM A;  1SAN A;  4O6J A;  3OWT A;  3GZI A;  4DNC A;  1ZGA A;  5DUK A;  4ACI A;  2VKH A;  2DG8 A;  5E17 F;  3C2G A;  1F4K A;  3T8R A;  2Z33 A;  3E7L A;  3T1B A;  1MBK A;  5KNL A;  3DWL E;  4RGS A;  3OYA A;  4GGG A;  2OTL I;  1JJ6 C;  1TTY A;  2ZFW A;  3TBI A;  2XF6 A;  3DEU A;  1IAW A;  4M6Y A;  3ZMU A;  3QP6 A;  4PJN A;  2X6W A;  4C3H J;  3IH3 A;  2KIQ A;  1FTT A;  4XKV A;  2QUF A;  2Z5U A;  2IGN A; 
#chains in the Genus database with same CATH homology
 2DMU A;  1WH7 A;  3HOV J;  2X6O A;  3E7Q A;  3AQS A;  5C3E J;  5J3L A;  3A01 B;  3Q0V A;  1NTC A;  3BR1 A;  5F08 A;  3GTO J;  2GBY A;  3SFI A;  2RAS A;  2D6Y A;  2LVS A;  5FKK A;  3RZD J;  3JR9 A;  3OOU A;  4GFL A;  4MO7 A;  3A03 A;  3HGG A;  1NK3 P;  5DS9 A;  2XPW A;  5FKL A;  3S2H J;  4Y52 J;  3S16 J;  2W53 A;  1JKP C;  2HXI A;  1CQT A;  1ETO A;  2RAE A;  3QPS A;  2Y0S N;  1JTY A;  1UMQ A;  3SJM A;  2OI8 A;  4FTH A;  3VW0 A;  4A93 J;  2JMW A;  3ZQF A;  2VPR A;  4BBR J;  2GEN A;  5FKM A;  5GP9 A;  4QIW N;  4JX6 A;  3COL A;  2FJ1 A;  2ZCN A;  2NP5 A;  5FKO A;  3TED A;  2CJJ A;  4DZJ A;  5EG0 A;  3GTK J;  4L62 A;  2JK3 A;  4V2F A;  2PBX A;  5H9T A;  4GCL A;  2YS9 A;  1Z0X A;  4XRS A;  1U9O A;  3KKD A;  3LSJ A;  3JRB A;  2D5V A;  3W6V A;  2V57 A;  3NXC A;  2M8G X;  2H8R A;  1TWG J;  2HKU A;  2DMT A;  3A02 A;  1NK2 P;  2ZOZ A;  3NAU A;  2R5Z B;  2XGC A;  2IU5 A;  2XDN A;  2UXI A;  1MBJ A;  1MNM C;  4I76 A;  2E19 A;  1B72 B;  5E3L A;  2E1O A;  4NEL A;  2HOT A;  5IP6 A;  4B4C A;  1LFB A;  1O4X A;  2EBI A;  3H3V K;  3VIB A;  3O8H A;  1A6I A;  5J1Y A;  2EQR A;  2OER A;  3QQA A;  5AQC A;  4UUT A;  5BNG A;  5FGL A;  3LWJ A;  3V78 A;  2G0E A;  1VF9 A;  2UXU A;  1HLV A;  3BRU A;  3UKG A;  5IYC J;  2IBD A;  3ANG A;  4HNV A;  1LE8 A;  2GM4 A;  4QTR A;  3HOY J;  2ZOY A;  3GEU A;  3S5R A;  1WCM J;  1Q1V A;  2L7Z A;  2L7M P;  2R0Q C;  2Y2Z A;  4AC6 A;  5M5Y J;  1JJ8 C;  5FLV A;  3CDL A;  2MW8 A;  2PMZ N;  3GTP J;  2L7F P;  1W0U A;  4XID A;  3JRG A;  1FEX A;  1OCP A;  4NDL A;  4RDU A;  4RBO A;  1LFU P;  2IAI A;  2UXO A;  3BJB A;  2YU9 J;  1AU7 A;  3TP0 A;  1RKT A;  3S1R J;  1A5J A;  1GV5 A;  1OCT C;  2CUF A;  2Y30 A;  1T56 A;  2M0C A;  4FIS A;  4XRM A;  2QIB A;  3VVX A;  1E3O C;  3G7R A;  1TWA J;  3LSG A;  4UUS A;  3JRD A;  3HTH A;  1GV2 A;  3QBM A;  2Y9Y A;  3PM1 A;  1X58 A;  3O8G A;  4JNN A;  2DN0 A;  2L0K A;  4XIC A;  4A69 C;  1X2M A;  1AKH A;  2HOA A;  1IDZ A;  5K7F A;  5C4X J;  1FIP A;  5E3N A;  2R92 J;  4DYR A;  3K2A A;  3LJL A;  2FQ4 A;  3RZO J;  2VKV A;  2HYT A;  1DU0 A;  3AQT A;  5DAJ A;  4BBS J;  2EH3 A;  5C44 J;  1IG7 A;  1YRN A;  1H88 C;  3IH4 A;  3CRJ A;  1MBF A;  4XRS G;  2DA7 A;  3NAR A;  4Y7N J;  3MVP A;  2G7G A;  5F04 A;  3JRE A;  4CGR A;  1GVD A;  2XGE A;  4IEJ A;  5IP7 J;  3KNW A;  1VFC A;  4EEF G;  5HOD A;  1JKR C;  2COB A;  5IYD J;  2HYJ A;  4ME9 A;  1Y1V J;  3JRH A;  2N8G A;  2QTQ A;  4AC0 A;  1JUM A;  3NRG A;  2R5Y B;  4IHV A;  2EZK A;  1POG A;  2NOG A;  3B6A A;  2VUM J;  1IRZ A;  3ZQC A;  2JA6 J;  3PPB A;  5F27 A;  2B63 J;  1MH4 A;  5IOZ A;  3CJD A;  3C07 A;  2DMP A;  1WI3 A;  2H1K A;  1XC5 A;  4AYB N;  3P9T A;  1H8A C;  3F0C A;  5EDN A;  1ETY A;  4JP0 A;  2F07 A;  3F1B A;  3FIS A;  4QSH A;  1Z77 A;  2QOP A;  2XB0 X;  1ZR2 A;  1JKO C;  2M34 A;  3BTC A;  1T33 A;  1JTX A;  2Q24 A;  3VOK A;  2G7S A;  2NP3 A;  2ZCX A;  5HAW A;  5HBU A;  3DCF A;  3ZQG A;  3HGY A;  3PO2 J;  1TWH J;  4DZP A;  3VUQ A;  1WPK A;  1U8B A;  2GUH A;  1QVU A;  3GTQ J;  4D7N A;  5E3O A;  5GPA A;  1VND A;  1DU6 A;  1UHS A;  4KWA A;  1TC3 C;  3IH2 A;  4MLO A;  3JSJ A;  2AO9 A;  2WAQ N;  5EEA A;  2X9D A;  1RPW A;  3OSG A;  1QVT A;  2K9Q A;  3L1P A;  4X1E A;  4FE4 A;  5EF6 A;  4AUX A;  3TP3 A;  2WB1 N;  4M6V A;  3VPR A;  2KDZ A;  1GUU A;  2DA6 A;  2JJ7 A;  1B8I B;  5EGO B;  2DG7 A;  2EZI A;  5JLW A;  2XB5 A;  1ETQ A;  4CYC B;  3BTL A;  4JL3 A;  1PUF A;  2OF7 A;  3ANP A;  2M2E A;  5DTD A;  4PXI A;  1F43 A;  3BHQ A;  3V6G A;  2HI3 A;  4MIM A;  4X6A J;  3FK7 A;  5FLM J;  5D19 A;  3LHQ A;  3O60 A;  3JRA A;  3WHB A;  2DJN A;  1ENH A;  2TCT A;  4D7M A;  1IDY A;  2NVX J;  2LD5 A;  2JA7 J;  3BR5 A;  3HE0 A;  3MNL A;  2DA2 A;  1MBE A;  3DPJ A;  3TW6 A;  2ECB A;  5F0C A;  2DA5 A;  3FK6 A;  4GFK A;  1BJZ A;  2XPV A;  2I10 A;  2E2J J;  3BG9 A;  3I4M J;  2YVH A;  4M3B A;  1MBG A;  4MFD A;  4BXX J;  5FHP A;  1APL C;  3SDG A;  3IUV A;  1TWF J;  3HTJ A;  2NVQ J;  2PZ9 A;  2VI6 A;  4I6Z A;  4A3L J;  1SGM A;  3D1N I;  3PAS A;  3TW7 A;  3IV5 A;  4A3M J;  3VOX A;  5HSZ A;  5IP9 J;  1X2N A;  3A01 A;  3GBG A;  1JUS A;  1BA5 A;  3NNR A;  4M3F A;  3LNQ A;  3PO3 J;  1XS9 A;  4GCK A;  2ID3 A;  1I6H J;  1K61 A;  3FIW A;  3BG3 A;  1ETK A;  3H0G J;  5FKN A;  2ME0 A;  2JWT A;  5EG0 B;  5F1J A;  3Q0W A;  3FKI J;  4XK4 A;  5C4J J;  4M3G A;  3BQY A;  3HM5 A;  4D5C A;  1IGN A;  2E2I J;  5FMP A;  5K7Z A;  2DA4 A;  3DEW A;  2NS8 A;  2R93 J;  5M3F J;  1GDT A;  2O7O A;  2MG4 A;  2FBQ A;  4UDS A;  2CUE A;  3Q3S A;  1ZK8 A;  1SFO J;  1P7J A;  2G3B A;  2ECC A;  2O7T A;  4J19 A;  4A3D J;  1ETW A;  3BT9 A;  3S2D J;  3HKZ N;  4ABZ A;  5JLX A;  2G7L A;  4S0H B;  5J1R A;  1IJW C;  5M5X J;  2LTP A;  3HOZ J;  2R7Z J;  4A3F J;  1MSF C;  2ELK A;  1G2H A;  2AHQ A;  3CCY A;  4MK6 A;  1QRY A;  4JX5 A;  4W97 A;  3QKX A;  1JT6 A;  3EUP A;  3NPI A;  1JT0 A;  2XGD A;  3HOW J;  4NN1 A;  4AF5 A;  4A3K J;  4L5E A;  1IV6 A;  1MBH A;  1QPI A;  2XRL A;  3BNI A;  2EZL A;  3GTL J;  5F0H A;  4A3J J;  2QWT A;  2UXP A;  4JX4 A;  2E2H J;  3ZQI A;  3RD3 A;  5K7H A;  3BR2 A;  2W48 A;  3VP5 A;  1LE8 B;  2R5Z A;  4YZE A;  4W1U A;  1H89 C;  1FTZ A;  2CU7 A;  2EZH A;  1TWC J;  2LK2 A;  2ZCM A;  4HKU A;  2O8K A;  3S1Q J;  3B81 A;  2MGQ A;  2KT0 A;  4FCY A;  1HCR A;  2VKE A;  2WGB A;  2DMN A;  2FX0 A;  1B72 A;  2OPT A;  3BR3 A;  3HTA A;  5CXI A;  1ZKG A;  2DA1 A;  2QF7 A;  4M3E A;  5E3M A;  3HOX J;  1S7E A;  4M3D A;  4A3C J;  4C3I J;  2GLO A;  3RQI A;  2DA3 A;  5M3M J;  1W0T A;  2L9R A;  3CMY A;  2ID6 A;  3ZQH A;  1RES A;  1HDD C;  3OSF A;  3G56 A;  2LFB A;  4DYQ A;  5K58 A;  4UUS B;  3G1O A;  1GT0 C;  4ICH A;  2JA5 J;  1AHD P;  1WH5 A;  1FIA A;  3RH2 A;  4D5F A;  3HBL A;  3LSR A;  2M9H A;  4JKZ A;  2X48 A;  3VW1 A;  2NVY J;  2RHA A;  3ZOB A;  1HDP A;  3S1N J;  3HIM A;  2MSY A;  1AKH B;  3VVZ A;  3BR6 A;  1JUP A;  1XG1 A;  2WV1 A;  2LKX A;  3S15 J;  1I3Q J;  1OFC X;  4LOC A;  3HOU J;  1UI6 A;  3BTJ A;  4IHX A;  3RKQ A;  2HQ5 A;  3CWR A;  3MN2 A;  3CQZ J;  5EYR A;  1ITY A;  2NVT J;  1RR7 A;  3G1M A;  4DYC A;  2XSD C;  2IEK A;  3I4N J;  3GTJ J;  5F0F A;  2LLK A;  1P7I A;  4JYK A;  3S17 J;  4MXM A;  4G12 A;  5D1R A;  3T6N A;  1R9T J;  5IYB J;  1YRN B;  3M3Y J;  3KZ9 A;  2LY9 A;  3ON4 A;  1HOM A;  1JGG A;  4MFE A;  5CW8 A;  1ORK A;  2ZB9 A;  5EZH A;  2ME6 A;  1ZQ3 P;  5C4Y A;  2LP0 A;  2FD5 A;  3NI7 A;  1RET A;  3VW2 A;  2GFN A;  3GTM J;  3LOC A;  4IHY A;  4DW6 A;  1ETX A;  1MH3 A;  2JA8 J;  2XPU A;  1F36 A;  3VVY A;  1OJL A;  5D18 A;  2CQQ A;  1EF4 A;  3HDD A;  3WHC A;  1MSE C;  2QCO A;  1BW5 A;  1VI0 A;  1JKQ C;  2QKO A;  2Y9Z A;  3C2B A;  1FJL A;  3KKC A;  3BR0 A;  4A3G J;  1Y1W J;  1U9N A;  2HDD A;  3BCG A;  4B3A A;  3S1M J;  3HTI A;  1ZTR A;  3K7A J;  4V2G A;  5IPA A;  4A3B J;  2WUI A;  2DMQ A;  1ETV A;  4A3I J;  3BQZ A;  1IUF A;  5M5W J;  4C2M J;  3QPL A;  5EZG A;  3GTG J;  1IC8 A;  2JN6 A;  3B6C A;  2R5Y A;  4GCT A;  2YVE A;  2TRT A;  3HB9 A;  1WGX A;  1I50 J;  2CQX A;  2REK A;  4B1R A;  5FJ8 J;  2K9N A;  4BY1 J;  3MKL A;  4GFB A;  1RKW A;  2P81 A;  3M4O J;  1UI5 A;  1BW6 A;  2K40 A;  5EFY A;  3BG5 A;  4A3E J;  1ZR4 A;  2LR8 A;  3ZQL A;  5GPC A;  3Q0U A;  2HOS A;  5CXG A;  4BY7 J;  2UXH A;  1U78 A;  2K9S A;  3ON2 A;  1SAN A;  1PUF B;  2O9L A;  2NS7 A;  3GZI A;  4IHW A;  4ACI A;  2DG8 A;  1K83 J;  3LSP A;  3G1L A;  1HF0 A;  1D5Y A;  3E7L A;  2NX4 A;  1MBK A;  3JRC A;  9ANT A;  4FE7 A;  4C3J J;  3S14 J;  3HEF A;  3JRF A;  1JJ6 C;  2Y31 A;  1BL0 A;  2HXO A;  3JRI A;  4BKX A;  3FRQ A;  1UG2 A;  3EGQ A;  2DTZ A;  3BTI A;  5EGO A;  1B8I A;  1ZGW A;  5IOY A;  4C3H J;  4CYC A;  2CRG A;  3IH3 A;  2YUS A;  1FTT A;  3OIO A;  5J1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...