4JYKA

Structure of e. coli transcriptional regulator rutr with bound uracil
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
201
structure length
201
Chain Sequence
RSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of E. coli Transcriptional Regulator RutR with bound uracil
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator RutR
total genus 77
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4jykA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jykA02
1XS9A 3NXCA 3F1BA 2E1OA 2QF7A 3S15J 4AF5A 5JLXA 5FGLA 3S1MJ 2XGCA 2HYTA 3AQSA 4MLOA 3VVXA 5DAJA 1TWCJ 1MNMC 3A02A 1IRZA 3CDLA 3BJBA 3DCFA 4JX5A 5EZHA 2COBA 2XPVA 2XGEA 3TP3A 2HXOA 4A3MJ 2G0EA 3JRCA 3MN2A 4MFDA 1MH4A 1R9TJ 2X9DA 1JTXA 3KZ9A 3CWRA 4KWAA 3S2HJ 2R5ZA 4IHXA 3JRAA 2WUIA 2EZKA 2ZB9A 2M2EA 3O8HA 1X2MA 2VUMJ 3S16J 3S2DJ 1IJWC 3QBMA 3GTQJ 1TWFJ 5J1YA 5IOYA 1ZTRA 3A01B 1IDZA 1RKTA 2AHQA 5F0HA 1B72A 5HBUA 2M9HA 2DA7A 3L1PA 1DU0A 2JA7J 4NN1A 3B81A 4ICHA 3KKCA 1BW5A 3VW1A 2IAIA 1I6HJ 1AHDP 4GFLA 2XRLA 3MVPA 1T56A 1Y1VJ 4M3DA 3RKQA 1X58A 2TCTA 3OIOA 4DYRA 5EEAA 2DMNA 2EZLA 1O4XA 3PO2J 2JN6A 4XK4A 2CUFA 3D1NI 5C4XJ 4XICA 2K9SA 3Q0VA 4MK6A 1HLVA 2HKUA 1MBJA 2DA3A 2G3BA 2WGBA 1WCMJ 4LOCA 2V57A 2JK3A 1GUUA 3GTJJ 1TWGJ 1IV6A 4MO7A 1I50J 1HDDC 2CRGA 1IC8A 3BCGA 4L62A 1TWHJ 5CXIA 4M3FA 2HI3A 2EH3A 2I10A 2PMZN 2X6OA 4I76A 4V2GA 1LFUP 4JX6A 3FKIJ 3LSGA 1IG7A 1B72B 3GTLJ 5FHPA 3H3VK 3NRGA 3BR6A 2Y31A 4I6ZA 1IDYA 4B3AA 1JT6A 2NS8A 3S17J 1WI3A 1X2NA 5EG0A 2NX4A 4BY7J 1JKPC 4AUXA 3GTGJ 1H89C 4M3BA 2NP3A 1OFCX 4L5EA 2W53A 1B8IB 3ZQGA 2MGQA 2WV1A 1ZQ3P 1IGNA 2E2HJ 3ZQFA 5IPAA 3HOZJ 3IH4A 1A6IA 2NVXJ 5FKNA 1SFOJ 3BTIA 3CCYA 5EDNA 2DMPA 2CJJA 3IH3A 2UXUA 4RBOA 1FEXA 2K40A 2MSYA 3HOYJ 3FISA 2YVEA 1T33A 3HTIA 3FK7A 3VVYA 3QPSA 5GPCA 1JJ6C 3K2AA 5EZGA 1JT0A 1XC5A 2HDDA 1HOMA 2PBXA 3HE0A 3LJLA 3ZQHA 2ZCNA 2R5YB 2Y0SN 4B1RA 2DMTA 2ZCXA 5IP7J 3HM5A 2DG8A 4JNNA 2JMWA 1NK2P 5E3OA 1YRNB 4BBRJ 1JKOC 1PUFA 1U9NA 4HKUA 3BTLA 3CJDA 2Y2ZA 4JKZA 2R0QC 2E2IJ 2CQQA 1B8IA 4C3IJ 2JA8J 2YVHA 4A3BJ 2N8GA 1BJZA 3V78A 4A3EJ 4A3CJ 3VP5A 1LE8B 2RASA 2DMQA 1U8BA 1W0UA 1HF0A 1Q1VA 4A69C 1BA5A 1K83J 2M0CA 3K7AJ 2R92J 1ETYA 2K9QA 1BW6A 5HODA 2F07A 1P7IA 2GLOA 4A3FJ 3IV5A 2QWTA 3LWJA 3BHQA 4JL3A 2EZIA 4W97A 2L7ZA 4D7NA 5EGOB 3JRIA 5M3FJ 3QPLA 2IEKA 4RDUA 2REKA 3HOVJ 1WPKA 2ME6A 3KNWA 3ZQIA 4C3HJ 2DJNA 4M6VA 1QPIA 2MW8A 5DS9A 1ETQA 1F36A 2JA5J 1FTZA 2JJ7A 1ORKA 1ZK8A 2OI8A 2PZ9A 5F27A 4UUSB 2O7OA 2QCOA 1VF9A 3RH2A 5IYBJ 1FIPA 5K7ZA 2O9LA 5E3NA 3VIBA 4C3JJ 2EZHA 2XGDA 1Z77A 3A01A 2GM4A 3BT9A 2NVTJ 3IUVA 1QVTA 3CRJA 4MIMA 4XRSA 3TP0A 4ME9A 4S0HB 3RZOJ 4JP0A 1F43A 1WGXA 2Y9YA 4UDSA 2HXIA 3PASA 3VUQA 3ZQCA 5GP9A 2L7FP 2L0KA 4IHYA 5C4JJ 4A3KJ 3GTOJ 4EEFG 2RHAA 5D19A 1ZR4A 2CU7A 2M8GX 1MBFA 3SDGA 4W1UA 3B6CA 5DTDA 3GTMJ 2P81A 2DA4A 2H8RA 4IHWA 1MH3A 3S14J 1JKRC 3BR1A 9ANTA 2O7TA 3P9TA 2MG4A 4FCYA 2R5ZB 2G7SA 3S1NJ 2LY9A 1QRYA 1OCPA 5F04A 5AQCA 3HTJA 3HBLA 5FLMJ 5FLVA 4GFKA 4M3EA 3HDDA 5EFYA 1A5JA 5F08A 5J3LA 1U9OA 4C2MJ 2XSDC 5HSZA 2FQ4A 5C3EJ 1AU7A 3JSJA 1GT0C 2HQ5A 3QKXA 3HIMA 3HGGA 2ID6A 1XG1A 1Z0XA 2XB5A 3BTCA 3LNQA 4M3GA 1AKHA 2HYJA 2JWTA 1ZR2A 2QIBA 2E19A 3E7QA 3JR9A 4HNVA 3WHBA 2NVYJ 1RPWA 3NI7A 4A3IJ 3CQZJ 1MBHA 3TW6A 3VOXA 1HCRA 5CXGA 1ETWA 3BQZA 3OSGA 1U78A 5FMPA 2XPWA 2LK2A 4MXMA 5J1UA 3HB9A 3HOUJ 1P7JA 2QKOA 4Y7NJ 3HOXJ 2GBYA 3BG9A 2M34A 4A3DJ 3HKZN 2YUSA 3C2BA 1JGGA 4GFBA 3G56A 3RZDJ 3BR0A 2OERA 5F0CA 2QTQA 3O60A 4D7MA 3V6GA 2LR8A 3S1RJ 2ZOZA 2R5YA 5IYDJ 3JRBA 2D6YA 1LE8A 4D5FA 5M5XJ 2H1KA 2Q24A 5F0FA 3B6AA 4GCLA 5EF6A 4DZPA 5M5YJ 2LKXA 3IH2A 1JUSA 1E3OC 2O8KA 5D1RA 2X48A 2XPUA 3ZQLA 1JUPA 5EG0B 3ON4A 3W6VA 1GDTA 5K7FA 2K9NA 2NS7A 4IHVA 1RETA 1UI6A 2TRTA 2VI6A 3BNIA 2UXIA 3PO3J 1ZGWA 3H0GJ 5M5WJ 4IEJA 3LSRA 2DMUA 4A93J 1TC3C 3SJMA 1JTYA 4MFEA 3S1QJ 2ID3A 2UXOA 2UXHA 2UXPA 2XDNA 3NPIA 2DA2A 2RAEA 4DZJA 4A3JJ 1I3QJ 1NTCA 4Y52J 1Y1WJ 5HAWA 1EF4A 2L7MP 3TEDA 5CW8A 3Q3SA 4FE4A 4XRSG 4QSHA 1PUFB 3ANGA 1HDPA 2EBIA 5IP9J 4PXIA 2ECBA 1ETKA 2OPTA 1RESA 5D18A 5J1RA 3GEUA 1G2HA 3FK6A 5E3MA 1OCTC 2CUEA 2NVQJ 3EUPA 3FRQA 1DU6A 5IP6A 3LSPA 2JA6J 3QQAA 1JJ8C 4YZEA 4DYCA 1IUFA 2HOAA 1POGA 1FJLA 2LD5A 3BQYA 1OJLA 2KDZA 4XRMA 3KKDA 4AC6A 1ENHA 4BKXA 3ANPA 3GBGA 2FD5A 2QOPA 2WB1N 3A03A 1GVDA 3F0CA 5C4YA 3T6NA 2GENA 2HOSA 2G7LA 4V2FA 3O8GA 4XIDA 1FTTA 3EGQA 2LLKA 1MSEC 3HTAA 2D5VA 1D5YA 3LOCA 4FISA 3JRFA 1W0TA 3LHQA 2OF7A 1RKWA 5FKMA 5EGOA 3G1OA 2ZCMA 2R7ZJ 2NP5A 3HTHA 2HOTA 3BR2A 4J19A 2NOGA 4BY1J 1K61A 4CGRA 1NK3P 3Q0UA 2E2JJ 1ETXA 3VVZA 3DEWA 1UHSA 3G1LA 2W48A 3VW2A 2VKEA 3NAUA 3JRHA 2FBQA 5E3LA 3HEFA 3UKGA 5K7HA 2CQXA 4UUSA 4A3GJ 4GCTA 5IOZA 1VI0A 2DG7A 2LTPA 2WAQN 2IBDA 1MBKA 1UG2A 3JREA 2G7GA 3COLA 3S5RA 3M3YJ 3G1MA 4A3LJ 3ON2A 4FE7A 3BR3A 1ETOA 3JRGA 4JYKA 1UI5A 3G7RA 4NDLA 4D5CA 3WHCA 5F1JA 2VPRA 1VFCA 3Q0WA 1SANA 3ZOBA 2Y9ZA 2FJ1A 3CMYA 1VNDA 4CYCA 4AC0A 3FIWA 3VPRA 2DA5A 3RD3A 2LVSA 3LSJA 2LFBA 1WH5A 3GTKJ 5IYCJ 5GPAA 1TWAJ 3OOUA 4GCKA 4UUTA 4FTHA 2ECCA 2FX0A 3TW7A 2GFNA 3DPJA 3MNLA 3HOWJ 2R93J 1MBEA 5FJ8J 3NARA 1MBGA 4ABZA 1GV2A 2ELKA 3VW0A 1SGMA 1AKHB 2XB0X 2GUHA 3I4NJ 3I4MJ 1QVUA 4AYBN 5M3MJ 1APLC 1ITYA 3E7LA 1LFBA 1WH7A 2Y30A 3BRUA 1S7EA 2EQRA 2VKVA 4G12A 5JLWA 1JKQC 1ZKGA 4DW6A 3M4OJ 1BL0A 2DA6A 4B4CA 3GZIA 4NELA 3BG5A 3BTJA 4ACIA 2YS9A 1ETVA 2DA1A 3BR5A 1MSFC 2L9RA 5FKKA 2IU5A 5K58A 4DYQA 3PPBA 5FKOA 4JX4A 3RQIA 1H8AC 1UMQA 2DTZA 3BG3A 3NNRA 3SFIA 1JUMA 4CYCB 5EYRA 2AO9A 2KT0A 1RR7A 3PM1A 3AQTA 1GV5A 5BNGA 4BXXJ 1FIAA 5C44J 2DN0A 4QIWN 2YU9J 2B63J 5H9TA 4X1EA 1H88C 1YRNA 1CQTA 3OSFA 3HGYA 3MKLA 2ME0A 4QTRA 2LP0A 4X6AJ 3C07A 2ZOYA 3VOKA 3JRDA 3GTPJ 5FKLA 4BBSJ
chains in the Genus database with same CATH superfamily
2HPMA 2PMHA 2QF7A 3S15J 5JLXA 3PQKA 2BOLA 2XGCA 3F3XA 2HYTA 3AQSA 2BY0A 3AAFA 1O3RA 3CJRB 5DAJA 2STWA 4PUSA 4ENNA 2CWEA 3MZHA 4N4NB 5GAEJ 4JX5A 1KQ9A 1KZHA 2IT0A 3WG7H 3TP3A 1E0EA 3EYYA 2O61A 4XKBA 2KQRA 4ESJA 4MFDA 1BR2A 3JW4A 3CWRA 2CH0A 3FXRA 1N77A 4IHXA 1AOYA 3O8HA 2VJ5A 2VUMJ 3S2DJ 1QZYA 2PMZA 3EYIA 2FBHA 3MQ0A 3ZN1A 4Y15A 3LA3A 5DD4A 2QUFA 2KRFA 2Z16A 3AFHA 1RRJA 3F23A 4KITB 3LA2A 3A01B 4AM3A 2FRHA 1T0FC 4HAMA 2UXNA 1DU0A 1YIOA 4ICHA 2JVGA 3HOTA 2LNBA 4EMSA 1AHDP 3FDYA 4ESFA 4CHUA 5D6EA 2X1CA 2M3AA 1LKXA 2FJI1 4M73A 2RQPA 1SFKA 3PFYA 1R1UA 4GYIA 1GLNA 4XK4A 3H3ZA 2CUFA 5TGTA 4QPOA 3D1NI 4UNOA 3Q0VA 1F5TA 4PDKA 1MBJA 5BMZA 3L2QA 1LDDA 4GO1A 3GTJJ 4CCLA 1TWGJ 3T8TA 1O3TA 4IZZA 1I50J 1R49A 3E5QA 5L3CA 3M07A 1HW5A 4KICA 4M3FA 1DPRA 3CMEI 2X6OA 3ZCOA 4V2GA 1TNSA 4TV7A 4XLHA 4H4KC 2V1NA 3GTLJ 3NRGA 3BR6A 4BE2A 4I6ZA 4HG2A 2FU4A 3I9V2 1IDYA 4B3AA 3K70C 2CV1A 1G6NA 1USTA 2NX4A 3V7RA 4AUXA 3GTGJ 1OPCA 4NHJA 2BZTA 4HX8A 4M3BA 1KU3A 1NHAA 3QPTA 1RUNA 2W00A 4DJAA 4UVAA 1ZQ3P 2WV1A 1YI2I 3CO6C 3FMRA 3OYJA 1IGNA 1VQPI 2E2HJ 1D8KA 2JUGA 2MC4A 1VQ8I 3HOZJ 2VBXA 2A6HF 3KP5A 2NVXJ 5FKNA 3BTIA 4BUPA 5E1WA 2HVQA 4UVBA 2DI3A 2HQAA 3TO6A 1RIOH 3IH3A 3E1SA 3AL0B 3KEYA 2OD5A 2MSYA 4GGGA 1G59A 3HOYJ 3FXQA 1T33A 2WTEA 2DFIA 4P9FA 2YPRA 3HE0A 2K4JA 2ZCXA 2IXSA 4IHSA 2W4SA 5DCFA 2EB7A 4L5IA 3EQLF 2JMWA 2MH9A 4CZCA 3WGHA 1JKOC 2B1EA 2XVCA 1C0WA 2D2WA 1T08B 5F1RA 2YVHA 4RAFA 4A3BJ 3DLLF 5B66C 2V6CA 4XBFA 2QQAA 4LG3A 5JFRA 1U8BA 2RASA 2K9MA 4QLCU 3B02A 3K7AJ 2L02A 1ETYA 2K9QA 3CESA 3F8CA 1BW6A 1J75A 2F07A 1FP1D 4BU2A 1Z9CA 2DLLA 2ZO4A 1LQ1A 2EZIA 2RVCA 3I4PA 4LB5A 1WQ2A 2EJRA 3HPHA 1X1PA 3FM5A 4NQWB 2Y0SA 2QZ8A 5TISC 1R4NB 1N75A 1PJRA 5DCMB 3KX2A 1ETQA 2NS0A 1IXCA 4YEJA 3OR2C 2R7RA 2EIKH 1Y8RB 2K7LA 4C3JJ 4J01A 3VIBA 1B59A 1Z77A 1IN8A 1N78A 3H9JA 5LHIA 5BPDA 1R1VA 1RNLA 2DDBA 4RAGA 3CLOA 1TT0A 4XRSA 4U88A 3TP0A 2DPUA 1F43A 5J8CA 4UDSA 5FFZA 4XKVA 4ZYEA 1L3LA 4A3KJ 3S93A 3GTOJ 3SDGA 3C2GA 4AIDA 2BE5F 1AA7A 4IHWA 3S14J 2H8RA 9ANTA 2ICWG 4BJTA 2MG4A 3S1NJ 1OCPA 2OUMA 5E1XA 2CQ7A 2RREA 5HNFA 5IT3A 4EJVA 3IL2A 1HKTA 3EETA 3Q9VA 3WE3A 4X0GA 2ZJPF 3NWSA 4BH9A 1KA8A 5J3LA 4KJZA 5C3EJ 4UV8A 4UUVA 3JSJA 1XN7A 3DBLB 3VSKA 1B6AA 3AG2H 2P6TA 2DCEA 2IGOA 1VTNC 2XB5A 3K6GA 4M3GA 1AKHA 2HYJA 3K4KA 5LGUA 1SVLA 2GOMA 1LVAA 2ZXWH 2E19A 1UB9A 1R5HA 3JR9A 1BI0A 1FPQA 5HDKA 2HNHA 2VIXA 3WHBA 5J6XA 3VB2A 1SEUA 3HRMA 4ENMA 1VQ9I 1DUXC 5HOOA 3CQZJ 2K85A 3CP2A 3TW6A 1HCRA 1P4XA 2WV0A 4F7ZA 4G7OF 2CW7A 2OV7A 3BQZA 3OSGA 3A0HC 4HDVA 1U78A 2XPWA 2LK2A 3BZKA 2GXBA 3J7AO 2OC6A 1LDJA 1B4AA 3L00A 2GBYA 1LEBA 2WADA 4OAYA 4GFBA 3JTGA 5JHFA 3RZDJ 3BR0A 4U0YA 2QTQA 3KYLA 4A5MA 4D7MA 1QBJA 4LLGF 3HL2A 2R5YA 4L5JA 3SZGA 3E5XA 2Y69H 3H3UA 2HKXA 3OS1A 5M5XJ 2H1KA 2Q24A 4CDGA 3L09A 1FOYA 2ZMEB 5ILVA 2W85A 1X1CA 1YX3A 4GCLA 4LK1F 1QZZA 1IO2A 4DZPA 3OS0A 2LKXA 2NYXA 2FBKA 3IH2A 2DK5A 3LL7A 3VYUB 3OYGA 4KN4X 1ON2A 3OS2A 2XPUA 3ZQLA 3KFWX 1RI7A 5KNLA 5EG0B 3W6VA 2DAOA 1QHGA 4XKCA 3MKWB 2NS7A 2JPCA 1RETA 3BNIA 2VI6A 4BE1A 1K78A 3BDDA 2UXIA 3H0GJ 4AIJA 4CCOA 1F4KA 2UWMA 1WWXA 2XAFA 1QQIA 2DMUA 4WF2A 2QLZA 1FYMA 2CV0A 3JSOA 1TC3C 2UXOA 3K4CA 2ID3A 5FLXK 2UXPA 2DA2A 2O3FA 2X51A 2KLOA 4EM2A 3D0SA 2B3WA 2BYVE 4LLNA 1HKQA 1EF4A 2L7MP 3TEDA 5CW8A 2KJCA 2EFQA 1VQOI 2L54A 4NNJA 1ERDA 2M7BA 3SYTA 5IP9J 3J80Z 3LMMA 1K7AA 4RAYA 2IVMA 5E3MA 4BL0B 2GAUA 5IP6A 3FXUA 3LSPA 1JJ8C 4CH7A 2WC2A 2R7TA 2W24A 5EJCA 3CZ6A 2OBPA 4XKWA 3GLXA 5J8FA 2KDZA 5LEKA 1YYVA 4K2EA 5D6FA 1ENHA 2MH2A 2X6WA 4BKXA 2LDUA 5C4YA 3A03A 2E7WA 2WBMA 2VXZA 3IRRA 2BY1A 4M71A 5HVQC 3GF2A 2G7LA 2A5YB 1FTTA 4XIDA 2M0MA 3F8NA 4OIRF 2KL4A 4B43A 1TLHB 4FISA 1W0TA 2R7SA 3LHQA 2ZNYA 1PP7U 3I59A 2ZCMA 3I58A 2NP5A 5ICCA 4OMZA 5JHUA 3S3NA 1KGSA 1D1CA 3BZ6A 1NK3P 3K2ZA 2E2JJ 5DV5A 1QNTA 3K4LA 1IRFA 1K6OA 2X6YA 1Z05A 3H92A 2W48A 3VW2A 1R58A 4HX7A 4E7JA 3HEFA 3QYFA 3UKGA 1IAWA 1G4DA 2ISYA 4MHGA 4A3GJ 1A6QA 4GCTA 2MD5A 1VI0A 3K1NA 3X2QH 3AG3H 1LJ9A 4XLAA 3JREA 1UG2A 3RPQA 1IN5A 4BHBA 1ZLKA 1G8XA 2K02A 4U0VA 2OTLI 5JVGF 3LQQA 4JYKA 1ONVA 3U2RA 3G3ZA 2L9NA 2M8EA 1SANA 3N05A 2FJ1A 2QENA 4KNYA 1U0JA 2L5QA 3H5NA 3CCJI 3GZ5A 1IXSB 3AKZA 3K9TA 1WH5A 3GTKJ 2D45A 3HG9A 3TO9A 1G3TA 3H1CA 1BI2A 4DOZA 1TQMA 1QPMA 2UXXA 2MLKA 2KISA 4DVYP 5HNHA 4J00A 2ELKA 3VW0A 4IQ4A 2XB0X 2A68F 1S9HA 3DEEA 5H2FC 4AWXB 5M3MJ 3CC7I 4KMUX 4XRFA 4XLFA 2EQRA 1V4RA 2VPLA 3OYLA 3EPZA 3I53A 5LHGA 3DBRB 1BL0A 3BG5A 1TT5B 2HYFA 2YS9A 2VLAA 5TJJA 1T6SA 2ZJ2A 3R6SA 2VJIA 1IW7F 4EJTA 2ELJA 2VBYA 1MSFC 3WU0A 1QGPA 3VDXA 2JT1A 4DYQA 4G6DA 1UMQA 1NH3A 5CYVA 2DTZA 1P4AA 1U5TA 2P5KA 4R1HA 2KT0A 1RR7A 3PM1A 2QBYB 1X19A 1FIAA 4E7KA 2A2FX 4E7IA 3QP5A 4QIWN 3L2RA 2DQRA 4IOCF 5FD6A 3WTZA 4XLCA 1OYYA 2PEXA 4XLNF 4IKFA 3ZN0A 2LP0A 3S2WA 4X6AJ 3HTSB 5FO5A 4YIFA 3JRDA 2IS1A 5FKLA 4RGRA 3QU6A 3LFUA 3TO7A 1XS9A 2A3SA 4EJWA 2E1OA 1SAUA 3F1BA 1P6RA 2L7KA 2JRTA 3PSFA 3S1MJ 4C2MA 1YW7A 4YRVA 2WAEA 1UAAA 1IRGA 1K79A 3OYDA 1V5GA 4G6QA 1ZG1A 3WTTC 1K4TA 1MNMC 4BYYA 1IRZA 1TQPA 3CDLA 4IOAF 4ZDLA 5EZHA 2EIMH 2HXOA 2LMDA 1Y39A 1HKSA 3DF8A 2G0EA 3ABLH 4LD5A 3MN2A 4RB2C 2X9DA 1JTXA 3EUHA 2MFZA 4KWAA 2QM3A 2R7WA 3S2HJ 2R5ZA 5CPRB 1IRXA 2WUIA 1EKEA 1A04A 2EZKA 2RQQA 1VQMI 3S16J 1V5FA 1P2FA 1KQ0A 3FM3A 5AONA 3E6DA 1IJWC 3QBMA 5L3BA 1TWFJ 2PFVA 2A05A 3JTHA 5J1YA 2Q8KA 5IOYA 2OCEA 3KEOA 1RKTA 5F0HA 1B72A 5HBUA 2DA7A 1DQUA 4GDFA 1JHHA 2W7NA 3KKCA 2PQ8A 4DBRA 1S72I 1I6HJ 2NVUB 4RM3A 2QEXI 3RKQA 2ZKZA 2TCTA 3IHUA 3OIOA 5EEAA 4NUBA 3CO7C 3K8PC 3PO2J 2XSJC 2JN6A 3S32A 1BI1A 1STZA 2B7EA 2RDPA 4NB5A 4ON0A 1AWCA 2K9SA 1GVJA 1UJ8A 1X3UA 3IRQA 4CZZA 1HLVA 1MKMA 4IRIA 1MMAA 1WCMJ 4IVNA 4OAZA 5B1BH 5CKTA 3SEZA 4IXAA 1IC8A 1BR1A 4L9VA 1TWHJ 5CXIA 2P7VB 3PIOF 2HI3A 2I10A 4IX7A 4I76A 2JVHA 5KHDA 2HEOA 1YLFA 2A07F 3LSGA 2RV8A 2I5UA 3AG4H 3FXLA 4IRGA 1B72B 4OIOF 4HW0A 4Y13A 2V26A 1W7PD 1Z3XA 1S7OA 2EK5A 3ZMZA 1E3PA 3W2VA 1Z7UA 2RN7A 3T5XA 3TGNA 2R7UA 3ERMA 2E1CA 2PJRA 3OWTA 1X2NA 3R61A 3DTIA 5EG0A 4BY7J 2XROA 2Z5UA 1ZAOA 4M72A 4LGWA 3KYDB 5HLIA 4I99C 2W53A 2VT2A 1B8IB 2ZXIA 4WWCA 1XSVA 3OMYA 2CUZA 2IA2A 2NNYA 2IP2A 3DFGA 5HS9A 3A2KA 4U7BA 4PFOA 1A6IA 2Z2SB 2X4HA 4XM3A 4HDUA 1OKRA 3M8EA 1HSJA 4FETA 1A31A 4WXDA 2A6EF 2BXYA 1OYWA 3HTIA 2VE9A 3VVYA 2CG4A 1XC5A 3FZVA 3ZMSA 1RR8C 3LJLA 5D5VB 3BC8A 2DT6A 2R5YB 4B1RA 2AQEA 2DMTA 4B3XA 3HM5A 1WKMA 3HHHA 1WJ5A 1MIJA 3W6JB 3LSHA 1ZREA 1NK2P 1J7KA 5E3OA 4ZYDA 1LPQA 1J2XA 2IS4A 4AU7A 1PUFA 4XOTA 2VOPA 1Z21A 2K4BA 2CQQA 4JQFA 4C3IJ 5DUKA 1B8IA 4Z6YA 2AS5F 3CTAA 4A3CJ 4P96A 1OCCH 4PCQA 1LE8B 1HF0A 2XAQA 1FBSA 3QWLA 3OR1C 3CCQI 2M0CA 2MC3A 1VZ0A 5HODA 2GLOA 4A3FJ 4XONA 3IV5A 3LWJA 4JL3A 1U5TC 2HZTA 1BIBA 4D7NA 4D9JA 5EGOB 2XAUA 3FX3A 3COAC 3JRIA 5M3FJ 2DPDA 2VB6A 3E6MA 2AXTC 1WJCA 4KDPA 1D3YA 4RDUA 2REKA 4XQFA 3GWZA 1S7AA 2X85A 4I09A 3E6CC 3EUHC 3VWBA 1ORKA 1EH6A 1ZK8A 2VJJA 2PZ9A 2O7OA 1W7PB 2GZWA 3RH2A 1W5SA 1SMTA 5IYBJ 4LIUA 4E7SA 5K7ZA 4F3QA 2EFWA 3KP3A 1FZPB 4BQNA 1VQ4I 3G71I 1R1TA 4H0EA 1QA6A 3DTKA 3A01A 3BT9A 3D5SC 3KP4A 2NAZA 2NVTJ 5D4SA 3CRJA 4MIMA 2CW8A 3DU6A 2GA2A 4RLFA 1ZLJA 1OCOH 3SQNA 5DM6F 2HXIA 3PASA 5LRSA 2L7FP 4M6XA 4F92B 2V7FA 5FRNA 2XC7A 1D1BA 3K4JA 4EEFG 2RHAA 5GAGJ 4BQAA 2XHKA 4PK4A 1MBFA 1V3FA 1N25A 4XNFA 4R79A 2FMLA 2IW5A 2LOOA 4CSWA 2ZFWA 1SC7A 3CCMI 5H6QA 2JRMA 2DA4A 2P81A 2X1DA 3QOEA 4RB0A 1JKRC 1ACIA 2KIFA 2PFBA 2O7TA 1GHCA 4BEHB 2QSHX 2EILH 2G7SA 2ELHA 4AIHA 2YU3A 3KP7A 3WODF 1USSA 5AQCA 2TDXA 1O57A 4G94A 3HBLA 3VSLA 5FLMJ 2PI0A 4OD4A 3QU3A 4M3EA 3OYIA 3HDDA 5F08A 4C2MJ 1U9OA 2XSDC 3I55I 3T1BA 4IO9F 2VQGA 3HRTA 1XGOA 2DDAA 1TBXA 2IS2A 1D1AA 3TKYA 3CDIA 3A0BC 4OD5A 3HGGA 4EQQA 1ZHFA 4WK8F 1TW3A 2LKSA 2FNAA 4Q47A 4Q48A 3PQJA 5KK1A 2PX9A 2LREA 2XKOA 1H9GA 4HNVA 2PN6A 3L2CA 3GUDA 3CUOA 1B9MA 1RPWA 5ILSA 1QU3A 5ICFA 3VOXA 2FMYA 4F55A 1FBUA 2G7UA 5FMPA 4HF0A 3RCOA 4QWQA 4MXMA 2LYCA 2Z1DA 1P7JA 3M1CA 3SDBA 4LIVA 3HOXJ 2L4AA 3BG9A 2M34A 3FBIB 3FF5A 1JGGA 1BBYA 2OERA 1D0XA 3BOQA 2HS5A 3P7NA 3PNTA 3S1RJ 2ZOZA 4OMYA 2DOFA 3BLYA 1FT9A 5IYDJ 2OCCH 3WG9A 4D5FA 2H94A 3GZ6A 1T8IA 1SD4A 4BHPA 5M5YJ 1OR7C 4DBQA 1E3OC 2O8KA 4D1QA 3DPUA 2MLGA 2H1LA 3I0TA 2K5CA 1E17A 1JUPA 1CGPA 3O3KA 4BJ5C 1LNWA 2BVLA 2LBFA 2DYRH 3J7ZI 2AXLA 2ZJQF 4XLPF 2KZGA 2WB1A 2M87A 4D0PA 4UV9A 3LSRA 4A93J 2R7XA 3VEPA 4ETSA 2XDNA 2XIGA 3NPIA 1X1BA 2HTSA 3ZMVA 4OIPF 1R4MB 1Z7LA 1Y1WJ 5HAWA 4WIBA 3CJDA 2UV1A 5DDGA 3ANGA 1HDPA 3VYRB 2EBIA 5E8GA 2F6CA 5IT9Z 2M4GA 3OYHA 1ETKA 3KCCA 1RESA 4BXFA 1B1BA 3FK6A 3KP6A 2DFHA 2NVQJ 3LA7A 2HVRA 1FSHA 3FKJA 4YZEA 3JSPA 3BZCA 2KRHA 3PNVA 4JOMA 1POGA 4BNCA 4ZTJA 3WTSC 4HOBA 1V54H 5B5EC 2QOPA 3F0CA 3ZMDA 3T6NA 2GENA 3BPXA 2ZSHB 4MQVA 4P55A 1PUEE 5CQEA 1UCRA 4PFPA 3CMMA 3EGQA 2FF4A 1IZ1A 4UXNA 3LOCA 1K4SA 3HRSA 1UFMA 3LSTA 4I02A 3J80K 1ZG5A 3RYRA 2R7ZJ 5FROA 2HOTA 3BR2A 2ZNZA 1Z67A 2NOGA 4OINF 1TNTA 1T39A 1K61A 1X4PA 5A2QZ 2VT3A 3F72A 3G1LA 3J81K 3NAUA 2V1UA 2FBQA 4II3A 3RDIA 1T95A 5J47A 5K7HA 1SD7A 1J09A 2FA5A 4UUSA 2F5DA 1ZRCA 3VTIA 2IBDA 4A0XA 2Q2EA 3SEQA 3M3YJ 3S3MA 4A3LJ 3ON2A 4FE7A 3BR3A 3OYEA 3AL0C 3G7RA 4HBLA 4D5CA 3ZQQA 1HW2A 3WHCA 5F1JA 2ACJA 2VPRA 5CVVA 1JXSA 5H6RA 1K6YA 1P9QC 4P1WA 3ZOBA 2XV4S 2E5ZA 3WGGA 1FYLA 5E20A 1FOKA 4HEA2 2Z33A 3VPRA 2DA5A 3RPUA 4E6KG 2LFBA 4ZTFA 2VQCA 5GPAA 3ZPLA 1IN7A 1TWAJ 4ZZDA 4GCKA 2L3DA 1R7JA 2ECCA 3TW7A 3DPJA 4FASD 4E4HA 3HOWJ 2J5PA 2XF7A 5HDGA 4EM0B 3WU1B 1MBEA 1SFXA 4YFKF 1FOWA 2LG4A 2HQRA 5FJ8J 2IA1A 2V4JC 3L2WA 1DP3A 1GV2A 3ECHA 4ENJA 1ODDA 2VKHA 4CXFA 1IF1A 2WY8Q 3I4NJ 1B9NA 1Z6RA 2QYOA 4IRHA 2ETHA 1WH7A 2Y30A 3IP4B 4RAZA 2VKVA 5JLWA 4MEYF 4CO8A 1ZKGA 4UHTA 1YE9A 4DW6A 3M4OJ 3GYHX 4NELA 1SMYF 2P5LC 3BTJA 2K9LA 2L2OA 4PJ0C 3U9GA 5L3FA 2L9RA 5FKKA 3PPBA 1SFEA 1EA3A 2HPIA 3F8MA 3NNRA 1Q1HA 1TZLA 1X4OA 2BEOA 3W2WA 3D5LA 1BC7C 2NNNA 2W82A 1IV8A 5EEHA 1RZ4A 2E36A 4CCMA 2BW3B 3AQTA 1QHHD 3PUFA 2DN0A 3Q9SA 2YU9J 3G2BA 4X1EA 1WJAA 1P4WA 1CQTA 5KVRA 3EUAA 4ZYHA 3OSFA 4BQOA 4IHTA 1MNEA 2OZ6A 4XMYA 2ME0A 4QTRA 1I5ZA 2GWRA 2F4OB 2UZKA 2ZOYA 3VOKA 2XASA 2CMPA 3CUQC 4KUMA 4EGYA 3NXCA 3MZ8A 2LBFB 5K5OA 1VQNI 1VQLI 2A61A 2VQLA 4ESBA 3KLNA 5CLSA 5E18F 4BJ6C 5L3DA 4ZJZA 4MLOA 4KN7X 1G3YA 5K1YA 3VVXA 2QWWA 4HV5A 2F5FA 2HKOA 1WRJA 5CVIA 2HOEA 2PMUA 3BJBA 2GIZA 2A5WA 2COBA 4PZJA 3KZIC 2JA2A 2K3FA 3I56I 1EH8A 2R4GA 3JRCA 2HGCA 3QODA 2OAZA 4IPAA 1R9TJ 3KZ9A 3WTXC 4I98B 1YIJI 4YFXF 2F5VA 2ZB9A 2M2EA 3GTQJ 4OU0A 5FLXZ 1ON1A 3M7GA 1ZTRA 2CSOA 1WZ2A 1IDZA 2XAGA 1YJNI 2AHQA 3V4GA 4EGZA 2M9HA 2HWVA 2HDWA 3U1KA 1BW5A 3BG7A 3G73A 2XRLA 1XMXA 1X58A 1KYZA 4O3MA 2WAQA 4DYRA 4PGHA 3A1YA 1R00A 5ICGA 3FBNB 3I64A 3WTYC 1TTYA 3OY9A 2BV6A 2XAJA 2WAFA 5C4XJ 4XICA 4MK6A 2V9KA 3CCRI 2HFHA 3MKYB 2HKUA 4LOCA 2V57A 3H9QA 4HSRA 3FHZA 1YJ9I 3FXJA 3RTRA 2K3PA 3BCGA 4XSZF 2DQLA 2P4WA 1W5TA 4M9SA 1FMVA 2EH3A 4ANJA 2PMZN 1DP7P 3KE2A 2O03A 3I71A 3CCUI 1DGWY 5FHPA 3H3VK 4MQ9F 4HF2A 3V42A 1BIAA 3DBHB 1SD6A 3TBIA 2E5NA 5TRDA 2NS8A 2Y75A 4F93B 3H5RA 2F4IA 1W36D 3S17J 2E1MB 1O3QA 1TL8A 1JKPC 5FGMA 3V7CA 2AQFA 1H89C 4DGWB 4Y3OA 1HXDA 1SD5A 2JPBA 3DP7A 1OFCX 4L5EA 3QYBA 2DOAA 2VODA 3CCLI 3K4MA 4LJZF 3W6KB 2K27A 1OCZH 2KIQA 2X0LA 3ZQGA 4I2OA 2FOWA 4YFNF 5IPAA 3ERED 1SFOJ 3CCYA 5EDNA 4FX0A 2B0LA 2VC1A 3L2UA 4N9IA 2D1VA 2UXUA 1R5GA 2K40A 1BC8C 3FXOA 3FISA 3KETA 5KAFC 1TQIA 5GPCA 2PBXA 5JVTA 2HDDA 1HOMA 2OQRA 3ZQHA 2HU9A 2Y0SN 3R0AA 2X6XA 5AIQA 5IP7J 2ADUA 3F22A 3IKVA 3HC7A 2QBYA 2DO7A 2QSFX 4G9YA 5FD5A 3NS4A 2UUZA 2XAHA 3IUOA 4UB8C 2NRAC 4B8XA 4HKUA 5LD2C 1Z6TA 3FMQA 4RLQA 3MD2A 1W1WE 1KU7A 5L3EA 3VP5A 3E3VA 2DMQA 4G8XA 3TDZC 1W0UA 2Z99A 4A69C 2KP6A 2R92J 2ZXHA 4WXCA 2V1XA 1P7IA 3WTVC 2DXIA 2VKDA 2DFEA 1XMKA 4RGSA 2QWTA 1CF7B 3BHQA 2W84A 3L7WA 1IUYA 3I59B 4I0AA 2LY1A 5KCMA 1VQ6I 2IEKA 2H27A 2ME6A 4ZYGA 3QAHA 3VODA 3KNWA 3CLQA 4CYDA 1YFHA 1G3WA 4C3HJ 2DJNA 3IWZA 2MW8A 5DS9A 1F36A 2JA5J 2JJ7A 2GIVA 4OOIA 1J9IA 5F27A 3DPTA 3GLLA 3GXOA 1XX5A 1NG6A 3P9IA 1Y6IA 2MYSA 1FIPA 3TOAA 2KJBA 2O9LA 2OA4A 5E3NA 2VN2A 2EZHA 1FOXA 2XGDA 1ZELA 5E17F 2DFFA 3KLOA 1XGNA 2O0YA 1QZEA 2ZXJA 1QVTA 1Z1DA 1F9NA 3CJTB 3FWEA 4S0HB 1A36A 4AVZA 1WGXA 2Y9YA 3KZZA 3VFZA 4F52A 4NC7A 5GP9A 4PJJA 3V8JA 2VXDA 5C4JJ 2VONA 1DDNA 2E60A 4LMYA 2Q0OA 1YO5C 1R23A 3B6CA 4W1UA 3LWFA 3GTMJ 3UNGC 1O7FA 5CXGA 1MH3A 3BR1A 3P9TA 3JCUC 2EWNA 3OYMA 3FXKA 5F04A 3O2PE 3H36A 4UVCA 2CO5A 3QYEA 3HTJA 5FLVA 1ZGJA 4GFKA 5EFYA 1A5JA 3RJPA 3L2VA 2O5RA 5LGTA 2FQ4A 2IA0A 4XORA 3VYTB 3MZYA 1GT0C 3QKXA 2MD0A 1O7LA 4U9NA 1Z0XA 5D5XB 4IF4A 4EJOA 4L0ZB 4KISA 2JWTA 4A6DA 1VQ5I 2CGPA 2IJLA 1V5EA 2EFNA 2W57A 3C3WA 1ZR2A 3TL4X 3E7QA 1MJBA 2MBFA 3CC4I 3I54A 2VASA 2FE3A 3WTWC 4C2UA 4A3IJ 1MBHA 2Z9OA 5J40A 2LY2A 3F9KA 3V8LA 2V79A 3C1DA 2VC0A 1D5VA 2ZSIB 3QPHA 4A6EA 4BE0A 2DOEA 4L9NA 2Z3YA 3NQOA 2DW4A 2V9VA 3HB9A 1LEAA 3HOUJ 4HLXA 4Y7NJ 4P5OA 2M30A 3OYAA 3S3OA 3K69A 5ICEA 3P5JA 5LBQA 4A3DJ 3C2BA 4C30A 3KYCB 3O60A 4IJAA 2LR8A 4DIQA 3JRBA 2D6YA 3IKTA 3NWTA 3CP8A 3F8BA 2GA1A 3QP6A 3CUQA 3WE2A 3WU2C 1M1EB 5F0FA 1MD0A 4LG0A 2L4MA 2D1HA 4BAYA 1FLIA 1S6LA 5BQTA 1U8RA 3RI4A 4GXOA 3LSKA 1MJAA 1PVEA 1HA8A 5K7FA 2XRNA 2Y0MA 4IHVA 1XSDA 3G4SI 1R22A 1MGTA 4GCVA 5DM7F 3PO3J 3GCMA 3OYCA 3F6OA 3ASOH 1OMIA 1S5LC 4FX4A 5E1ZB 1JE8A 3S1QJ 3SJMA 1JTYA 3AG1H 4RA2A 1L0OC 3PFIA 2LF8A 2RAEA 2O6GE 4DZJA 2M1BA 3HZJA 2MABA 3BJ6A 1HW1A 1I3QJ 2L01A 3BP8A 1MDMA 4E7LA 3Q3SA 2W25A 1KU2A 1WFXA 2F2EA 4XRSG 4ASNA 4QSHA 4CCNA 3PSIA 4KIBA 2DU9A 4EJUA 2F5CA 2OPTA 5D4RA 4I0BA 2E71A 3C7JA 3E97A 5D18A 1I6XA 1OCTC 2CUEA 5ED4A 3FRQA 1DU6A 3D5RC 3CJQB 1W36C 1MNDA 2E7XA 2L9SA 3RKYA 4DYCA 1IUFA 3L9FA 2IS6A 5ILUA 1FJLA 2MA3A 2R3SA 3BQYA 2HR3A 3OIPA 1V55H 1OJLA 1FYKA 4AC6A 5FFXA 4LITA 2FD5A 1GVDA 2R7OA 2FBIA 4HLYA 2P6SA 1VQ7I 2E34A 4A0ZA 3HTAA 1MSEC 2IGNA 1W5CC 1WJBA 1R6RA 2OF7A 2P0WA 1RKWA 4IQJA 4NC6A 3HTHA 4M9XA 5FRMA 1OYIA 1SFUA 2Q1ZB 2JSCA 3C2HA 3Q0UA 3P9CA 3SXYA 3DEWA 1UHSA 3V7SA 1WJEA 4UB6C 4RM2A 4KMFA 5BS6A 5CVRA 4FHTA 3ASNH 2CQXA 3CCVI 4P9UA 1I1GA 2H09A 1BOBA 2DG7A 1E2XA 3OOPA 2WAQN 3SFZA 1MBKA 2G7GA 3COLA 3S5RA 2CV2A 3G1MA 2HDCA 2BHYA 4HV6A 1E3HA 3FXMA 3ZMTA 1ETOA 2H6CA 1UI5A 6PAXA 4LG0B 2JSPA 1LFPA 3BJOA 1VFCA 1XPXA 2RNGA 3JAMZ 3MAJA 2I8DA 4N4OB 5B1AH 1I3AA 1R71A 1Y56A 4AC0A 3FIWA 3RD3A 3HUGA 3LSJA 1WJFA 1XGMA 3LSMA 3ZXSA 3HYIA 4CUGA 1YOVB 3SZTA 1XB4A 1X3WB 2FX0A 3MNLA 2GFNA 5DD8A 4BDYA 1OISA 2XKPA 3RKXA 3CF2A 3HKZA 2R93J 4XSXF 2FEZA 3BY6A 1XMAA 4U9LA 3DPLC 5D8LB 1ZARA 4L9JA 1SGMA 1UHMA 1AKHB 4AYBA 3I4MJ 2EFOA 3HOSA 3KIOA 2KHMA 1APLC 2E35A 3E7LA 1LFBA 3BRUA 1NG7A 3K1MA 1PP8F 4G12A 1XSXA 4JK1X 2DA6A 5GADJ 3GZIA 1I27A 3HSEA 4ACIA 1DPUA 2DA1A 3BR5A 3F6VA 4ZDOA 3O6BB 2BY3A 1BJAA 5F6FA 4F91B 4RB3C 2IU5A 2VBWA 3ECOA 1BOAA 4HQEA 5FKOA 3WGIA 1H8AC 4LK0F 3RQIA 3U21A 4MNUA 3GO5A 3BG3A 2ESNA 4G7HF 2KMUA 5EYRA 2VQHA 2AO9A 4AD9A 5LLQA 2QA4I 1W7PA 2WA0A 3R0JA 4HX4A 4N9HA 5E79C 2NOJB 2IGKA 4XL9A 3SWHA 4BXXJ 4JBAA 1MMGA 5C44J 3SHFA 2B63J 5H9TA 4PSWA 2VL8A 1D0YA 3HIFA 3V8KA 1H88C 2LH9A 3MEXA 2FUG2 3HGYA 1UELB 4M9ZA 5DUIA 4ZH4F 1YW8A 3MKLA 2KIUA 2WWYA 2PJRB 2R7FA 3GTPJ 4A12A 3ULQB 5K5QA 3ABMH 3RSNA 4ITVA 1ZRFA 4MEXF 3F8FA 2QQ9A 2V9PA 2YX7A 4AF5A 1YTYA 4DQ2A 3EUKL 5FGLA 5F64A 3VOEA 5D5WB 2KZVA 2DBBA 3K1PA 1FBQA 1BR4A 1TWCJ 4OIQF 3K0LA 3A02A 3P9KA 3DCFA 4PJLA 4ENKA 1U6GA 2XPVA 2XGEA 3M9AA 4BGDA 4A3MJ 2RGVA 5D8KB 1MDMB 1MH4A 2GQQA 3IAS2 2JUCA 1YG2A 1Z3YA 3BPVA 3CDHA 3JRAA 1MZBA 1WI9A 1GXPA 1X2MA 2LF7A 3G6EI 1U3EM 4C9YA 1FNNA 4LB6B 1MJ9A 1XGSA 1OQYA 3NEUA 3HSRA 2M7AA 1W4MA 2JA7J 1I39A 3L1PA 1ULYA 2KPMA 4KA4A 4NN1A 3B81A 3DEUA 4Y33A 3VW1A 2IAIA 2FXAA 4C2TA 4GFLA 1X1DA 4II2A 1D8JA 3MVPA 1T56A 1Y1VJ 4M3DA 3MWMA 4XN3A 3RQ4A 2OU2A 4E70A 2BHZA 3SZPA 1PDNC 4HF1A 2DMNA 2EZLA 1O4XA 1FX7A 3K70D 3GMEA 5B3SH 1YITI 3DKYA 4WXHA 3MCZA 2VOOA 3K4BA 1ZYRF 3ISPA 3OL3A 2DA3A 2G3BA 2WGBA 2JK3A 4PJNA 2A6TA 1GUUA 4HSTA 1OCRH 3ONQA 5ERIA 2EV0A 3B73A 1IV6A 2KFDA 4MO7A 3FHNA 5A2QK 1HDDC 2CRGA 3GX4X 1S29A 2F48A 3MFKA 4L62A 2C6YA 2XF5A 1A35A 3I5UA 1YS7A 3HRUA 1LFUP 1XCBA 4JX6A 2XUBA 3FKIJ 2ZMEC 1IG7A 4YIIA 5DCMA 3TDUC 2VJ4A 3DKXA 2Y31A 3ABKH 1G3SA 2GOXB 1JT6A 1XDUA 3DLAA 1WI3A 3OYNA 2E1NA 2W1OA 4A0YA 4BACA 3IC7A 1Z91A 1WSUA 4B44A 2NP3A 3LFKA 3H5AA 2EA2A 4L0YB 5LHHA 2KIMA 3BROA 2EIJH 4IL6C 2XF6A 5E8IA 2LKPA 2MGQA 4RMNA 2PJPA 3DXJF 3ZQFA 4PGGA 3IH4A 4Y4RA 2QKMB 1J59A 5IT9K 3KPHA 3RKWA 2CW0F 1P92A 2DMPA 1FC3A 5DYMA 2CJJA 3HXLA 1WJDA 4WCGA 3OYFA 5JI6A 2GXAA 4RBOA 4MTDA 1FEXA 1T2KA 3GVAA 2ZBKA 2YVEA 3FK7A 3QPSA 1JJ6C 3K2AA 5EZGA 2P5VA 1JT0A 3GZNB 2DT7B 3HPGA 4R8HA 5EEGA 2ZCNA 3IAM2 1XD7A 2HQNA 3BJAA 3ROUA 2DG8A 2V1DA 3RIRA 4JNNA 1LDKB 4GRIA 2R7VA 1YRNB 2STTA 4BBRJ 5HLHA 3HHGA 1KYWA 2YR2A 1FY7A 1U9NA 3BTLA 3K10A 1J0RA 1YX5A 2Y2ZA 4M6YA 4BHCA 1HQCA 5GTHC 4HNUA 5CJ9A 3OYBA 2R0QC 4G7ZF 2E2IJ 2JA8J 4U0WA 2N8GA 2XGXA 1BJZA 3H35A 4ZZLA 3CMAI 3V78A 4A3EJ 4KT6A 1BA5A 1Q1VA 4KIGA 1K83J 3H0DA 4Y17A 5CVUA 4BXUA 4E7HA 2BXZA 4WX9A 1H9TA 2QQ8A 5HLGA 3CJNA 2DYSH 1XCVA 3DQVC 2EV6A 3MMYB 2ESHA 4A5NA 1J5YA 4KIFA 3W2AA 4W97A 2L7ZA 2QKLB 3GEZA 1WHUA 2CQNA 1RC9A 2HTJA 4GYGA 4BS9A 3QPLA 2IPQX 2CQKA 2JZYA 4EM1A 3PNYA 3PL8A 1ZH5A 2KRCA 3HOVJ 1WPKA 4PSXA 3T8RA 3PIPF 3ZQIA 4U7DA 3PUBA 4M6VA 1QPIA 1FTZA 4ZC3A 4S05A 2OI8A 1UZCA 4HRIA 4UUSB 3ZR8X 2FQ3A 2QCOA 1YQAA 1VF9A 4ZDPA 2OZUA 2FNPA 2PLYA 1Y8QB 2E1MC 3OL4A 3ZQ7A 3HJEA 3QOPA 2ZY9A 1YHQI 2GM4A 2ZCWA 3ML6A 1QO0D 4HYEA 3IUVA 3ESWB 3HTUA 1S3JA 2M4KA 4V19K 4ME9A 3RZOJ 1HSTA 1FMWA 4JP0A 3VUQA 2IGMA 1T38A 4PJMA 3MKZA 3ZQCA 2F5EA 2L0KA 2EA4A 4IHYA 4B48A 5H20A 4XN0A 1GXQA 3R60A 5D19A 3CF5F 1ZR4A 4AIKA 2CU7A 2M8GX 5LFAA 4O5VA 5DTDA 3M8FA 2ZC2A 4YG2F 4FCYA 4NBQA 2R5ZB 1I1SA 2LY9A 2QGUA 1QRYA 5GAHJ 5JR3A 2DODA 1ZGAA 4LFUA 2KKOA 5AIPA 2ZJRF 3RPUD 5HSZA 3EDPA 2CYYA 3ABTA 2HZDA 2JQ7A 3M1EA 1AU7A 4FT8A 5BOXA 1XDSA 2HQ5A 3ZGKA 5LRRA 1IN4A 3HIMA 3DKWA 4XR6A 1S8NA 2ID6A 3NRVA 1XG1A 5LGNA 3BTCA 3LNQA 4IRVA 3OIQA 1LB2A 1KU9A 2CFOA 1R36A 2QIBA 2EPFA 1U2WA 2YX4A 3DU5A 2OTJI 2NVYJ 1H0MA 3NI7A 4HZFA 1VQKI 2G7HA 4HA8A 1BN5A 2G9WA 2CUJA 1ETWA 1FP2A 2R7DA 3C18A 3CCSI 3PJRA 1O3SA 5J4VA 5J1UA 3LQRA 1HC8A 2QKOA 1EV7A 4CCKA 3HKZN 2YUSA 1Y0UA 4BDZA 2L9VA 4FQGA 3G56A 4YIRX 5F0CA 3ELKA 4B09A 3E0JB 3V6GA 4DNCA 2QSGX 4OWRB 2BW3A 1LE8A 3F21A 1F1ZA 4ZYAA 3CUQB 5J4YA 3B6AA 4S04A 5EF6A 2P7CB 3DV8A 3GFLA 1JUSA 2M45A 3ABUA 5D1RA 3JAMK 2X48A 2Q2EB 2QQBA 2HVSA 2PBIA 3QRFF 3ON4A 4Q5SF 2H6BA 1GDTA 2M5WA 4KFCA 2K9NA 2DJIA 4L9TA 5DEQA 5IY5H 3J7YJ 1UI6A 2TRTA 3CD6I 4EV0A 1K78B 2NXNB 5KAIC 4CICA 5L3GA 3Q5FA 1ZGWA 5M5WJ 1KQ8A 3UR3C 2B9SA 2BGCA 3A4CA 3REOA 4IEJA 2A69F 3ZP5A 4BEHA 4CGZA 1D0ZA 3IWFA 4MFEA 2UXHA 4NQWA 4EVIA 1DGRM 1MMDA 3J7AY 4HPQA 2LC2A 1ZRDA 2CFXA 2LSOA 4A3JJ 1NTCA 1IXRC 3R4KA 4HNTA 3N97A 3TQNA 4Y52J 1BM9A 1SAXA 4FE4A 5LEJA 3LAPA 4JKZA 1PUFB 1X1AA 4RGXA 5HS8A 2CS3A 3GFJA 4PXIA 2ECBA 2VBZA 1ZG3A 1SVMA 1T98A 5J1RA 2QVOA 5HDNA 3GEUA 1G2HA 4HQMA 3EUPA 3BWGA 4I7HA 2JA6J 3QQAA 2F4MB 3K4NA 1LVKA 1JGSA 2EINH 3T0YA 2DT5A 2HOAA 2EV5A 2LD5A 3I3LA 3M8JA 4XRMA 3TOBA 3KKDA 4CCJA 5CQGA 3ANPA 4MGRA 3GBGA 2WB1N 3HSFA 4QPQA 2RC4A 3KEQA 5GTIC 2FOKA 1TW2A 2HOSA 2V6EA 4V2FA 3O8GA 1IN6A 2LLKA 4XOPA 1T0FA 2D5VA 1D5YA 2KDOA 3JRFA 1LUJB 1YJWI 3BCAA 4RB1A 5FKMA 5K5RA 3G1OA 2YSRA 5EGOA 3J81Z 4UY8I 1X3ZB 2DK8A 4J19A 4BY1J 3ZMUA 2RKHA 3S8PA 1U5TB 4CGRA 1EH7A 2GXGA 3W3CA 1ETXA 3VVZA 1JI8A 4U87A 4Z2YA 2VKEA 3JRHA 3BG6A 3DTEA 5E3LA 1EJ9A 3CC2I 4G6TB 2J5OA 5IOZA 1FSEA 4YELA 2LTPA 2O8XA 3U1DA 5CVJA 3WTUC 1HBXG 3GFIA 1TP4A 4B47A 1ZN2A 3LSIA 3JRGA 4NDLA 2EFPA 2LRDA 3Q0WA 2BVMA 2IRFG 4KT5C 2BY2A 2Y9ZA 3GW2A 4BQQA 3CMYA 1VNDA 4CYCA 1SVOA 2JTVA 2LVSA 3KZYA 5IYCJ 3H9GA 3OOUA 5D5UB 4UUTA 4FTHA 1MMSA 4NC8A 4MTEA 1WVRA 2HYGD 4A2UA 1R5ID 3OYKA 3NARA 1MBGA 1BI3A 4ABZA 4E7ZA 2VE8A 4KYWA 1OLTA 5BPIA 2GUHA 1QVUA 2ZMEA 4LLLA 3TMOA 1XTAA 4AYBN 1JHFA 2K86A 4XLEA 3RYPA 3GFMA 2OJED 4CA0A 1ITYA 3E6BA 3CCEI 3KP2A 1S7EA 1JKQC 2XDVA 2Y48A 1CF7A 1OR7A 3LAJA 2FSWA 2H8WA 4B4CA 1REPC 5FB2A 4M74A 1YS6A 5HS7A 2ISZA 1ETVA 2PG4A 2R7QA 3BCBA 5K58A 3ZRGA 4JX4A 3DWLE 4AVPA 3N4MA 3SFIA 1JUMA 4RS8A 5HLTA 4CYCB 1RUOA 3E5UA 4EATA 2COMA 1FWZA 1UHWA 4Q4ZF 1KONA 3HUGB 4L18B 2RNJA 4N0BA 1GV5A 5BNGA 4O6JA 1Y0NA 2P8TA 2WY7Q 1UG0A 1MMNA 2OQGA 1PYVA 1YRNA 4I01A 1MW7A 2X1EA 2YVXA 2DTRA 2ZFUA 3C07A 3VYSB 1YW9A 4RGUA 2BBYA 3OV8A 4BBSJ 3FMSA
chains in the Genus database with same CATH topology
1XS9A 3NXCA 3F1BA 2E1OA 2QF7A 3S15J 4AF5A 5JLXA 5FGLA 3S1MJ 2XGCA 2HYTA 3AQSA 4MLOA 3VVXA 5DAJA 1TWCJ 1MNMC 3A02A 1IRZA 3CDLA 3BJBA 3DCFA 4JX5A 5EZHA 2COBA 2XPVA 2XGEA 3TP3A 2HXOA 4A3MJ 2G0EA 3JRCA 3MN2A 4MFDA 1MH4A 1R9TJ 2X9DA 1JTXA 3KZ9A 3CWRA 4KWAA 3S2HJ 2R5ZA 4IHXA 3JRAA 2WUIA 2EZKA 2ZB9A 2M2EA 3O8HA 1X2MA 2VUMJ 3S16J 3S2DJ 1IJWC 3QBMA 3GTQJ 1TWFJ 5J1YA 5IOYA 1ZTRA 3A01B 1IDZA 1RKTA 2AHQA 5F0HA 1B72A 5HBUA 2M9HA 2DA7A 3L1PA 1DU0A 2JA7J 4NN1A 3B81A 4ICHA 3KKCA 1BW5A 3VW1A 2IAIA 1I6HJ 1AHDP 4GFLA 2XRLA 3MVPA 1T56A 1Y1VJ 4M3DA 3RKQA 1X58A 2TCTA 3OIOA 4DYRA 5EEAA 2DMNA 2EZLA 1O4XA 3PO2J 2JN6A 4XK4A 2CUFA 3D1NI 5C4XJ 4XICA 2K9SA 3Q0VA 4MK6A 1HLVA 2HKUA 1MBJA 2DA3A 2G3BA 2WGBA 1WCMJ 4LOCA 2V57A 2JK3A 1GUUA 3GTJJ 1TWGJ 1IV6A 4MO7A 1I50J 1HDDC 2CRGA 1IC8A 3BCGA 4L62A 1TWHJ 5CXIA 4M3FA 2HI3A 2EH3A 2I10A 2PMZN 2X6OA 4I76A 4V2GA 1LFUP 4JX6A 3FKIJ 3LSGA 1IG7A 1B72B 3GTLJ 5FHPA 3H3VK 3NRGA 3BR6A 2Y31A 4I6ZA 1IDYA 4B3AA 1JT6A 2NS8A 3S17J 1WI3A 1X2NA 5EG0A 2NX4A 4BY7J 1JKPC 4AUXA 3GTGJ 1H89C 4M3BA 2NP3A 1OFCX 4L5EA 2W53A 1B8IB 3ZQGA 2MGQA 2WV1A 1ZQ3P 1IGNA 2E2HJ 3ZQFA 5IPAA 3HOZJ 3IH4A 1A6IA 2NVXJ 5FKNA 1SFOJ 3BTIA 3CCYA 5EDNA 2DMPA 2CJJA 3IH3A 2UXUA 4RBOA 1FEXA 2K40A 2MSYA 3HOYJ 3FISA 2YVEA 1T33A 3HTIA 3FK7A 3VVYA 3QPSA 5GPCA 1JJ6C 3K2AA 5EZGA 1JT0A 1XC5A 2HDDA 1HOMA 2PBXA 3HE0A 3LJLA 3ZQHA 2ZCNA 2R5YB 2Y0SN 4B1RA 2DMTA 2ZCXA 5IP7J 3HM5A 2DG8A 4JNNA 2JMWA 1NK2P 5E3OA 1YRNB 4BBRJ 1JKOC 1PUFA 1U9NA 4HKUA 3BTLA 3CJDA 2Y2ZA 4JKZA 2R0QC 2E2IJ 2CQQA 1B8IA 4C3IJ 2JA8J 2YVHA 4A3BJ 2N8GA 1BJZA 3V78A 4A3EJ 4A3CJ 3VP5A 1LE8B 2RASA 2DMQA 1U8BA 1W0UA 1HF0A 1Q1VA 4A69C 1BA5A 1K83J 2M0CA 3K7AJ 2R92J 1ETYA 2K9QA 1BW6A 5HODA 2F07A 1P7IA 2GLOA 4A3FJ 3IV5A 2QWTA 3LWJA 3BHQA 4JL3A 2EZIA 4W97A 2L7ZA 4D7NA 5EGOB 3JRIA 5M3FJ 3QPLA 2IEKA 4RDUA 2REKA 3HOVJ 1WPKA 2ME6A 3KNWA 3ZQIA 4C3HJ 2DJNA 4M6VA 1QPIA 2MW8A 5DS9A 1ETQA 1F36A 2JA5J 1FTZA 2JJ7A 1ORKA 1ZK8A 2OI8A 2PZ9A 5F27A 4UUSB 2O7OA 2QCOA 1VF9A 3RH2A 5IYBJ 1FIPA 5K7ZA 2O9LA 5E3NA 3VIBA 4C3JJ 2EZHA 2XGDA 1Z77A 3A01A 2GM4A 3BT9A 2NVTJ 3IUVA 1QVTA 3CRJA 4MIMA 4XRSA 3TP0A 4ME9A 4S0HB 3RZOJ 4JP0A 1F43A 1WGXA 2Y9YA 4UDSA 2HXIA 3PASA 3VUQA 3ZQCA 5GP9A 2L7FP 2L0KA 4IHYA 5C4JJ 4A3KJ 3GTOJ 4EEFG 2RHAA 5D19A 1ZR4A 2CU7A 2M8GX 1MBFA 3SDGA 4W1UA 3B6CA 5DTDA 3GTMJ 2P81A 2DA4A 2H8RA 4IHWA 1MH3A 3S14J 1JKRC 3BR1A 9ANTA 2O7TA 3P9TA 2MG4A 4FCYA 2R5ZB 2G7SA 3S1NJ 2LY9A 1QRYA 1OCPA 5F04A 5AQCA 3HTJA 3HBLA 5FLMJ 5FLVA 4GFKA 4M3EA 3HDDA 5EFYA 1A5JA 5F08A 5J3LA 1U9OA 4C2MJ 2XSDC 5HSZA 2FQ4A 5C3EJ 1AU7A 3JSJA 1GT0C 2HQ5A 3QKXA 3HIMA 3HGGA 2ID6A 1XG1A 1Z0XA 2XB5A 3BTCA 3LNQA 4M3GA 1AKHA 2HYJA 2JWTA 1ZR2A 2QIBA 2E19A 3E7QA 3JR9A 4HNVA 3WHBA 2NVYJ 1RPWA 3NI7A 4A3IJ 3CQZJ 1MBHA 3TW6A 3VOXA 1HCRA 5CXGA 1ETWA 3BQZA 3OSGA 1U78A 5FMPA 2XPWA 2LK2A 4MXMA 5J1UA 3HB9A 3HOUJ 1P7JA 2QKOA 4Y7NJ 3HOXJ 2GBYA 3BG9A 2M34A 4A3DJ 3HKZN 2YUSA 3C2BA 1JGGA 4GFBA 3G56A 3RZDJ 3BR0A 2OERA 5F0CA 2QTQA 3O60A 4D7MA 3V6GA 2LR8A 3S1RJ 2ZOZA 2R5YA 5IYDJ 3JRBA 2D6YA 1LE8A 4D5FA 5M5XJ 2H1KA 2Q24A 5F0FA 3B6AA 4GCLA 5EF6A 4DZPA 5M5YJ 2LKXA 3IH2A 1JUSA 1E3OC 2O8KA 5D1RA 2X48A 2XPUA 3ZQLA 1JUPA 5EG0B 3ON4A 3W6VA 1GDTA 5K7FA 2K9NA 2NS7A 4IHVA 1RETA 1UI6A 2TRTA 2VI6A 3BNIA 2UXIA 3PO3J 1ZGWA 3H0GJ 5M5WJ 4IEJA 3LSRA 2DMUA 4A93J 1TC3C 3SJMA 1JTYA 4MFEA 3S1QJ 2ID3A 2UXOA 2UXHA 2UXPA 2XDNA 3NPIA 2DA2A 2RAEA 4DZJA 4A3JJ 1I3QJ 1NTCA 4Y52J 1Y1WJ 5HAWA 1EF4A 2L7MP 3TEDA 5CW8A 3Q3SA 4FE4A 4XRSG 4QSHA 1PUFB 3ANGA 1HDPA 2EBIA 5IP9J 4PXIA 2ECBA 1ETKA 2OPTA 1RESA 5D18A 5J1RA 3GEUA 1G2HA 3FK6A 5E3MA 1OCTC 2CUEA 2NVQJ 3EUPA 3FRQA 1DU6A 5IP6A 3LSPA 2JA6J 3QQAA 1JJ8C 4YZEA 4DYCA 1IUFA 2HOAA 1POGA 1FJLA 2LD5A 3BQYA 1OJLA 2KDZA 4XRMA 3KKDA 4AC6A 1ENHA 4BKXA 3ANPA 3GBGA 2FD5A 2QOPA 2WB1N 3A03A 1GVDA 3F0CA 5C4YA 3T6NA 2GENA 2HOSA 2G7LA 4V2FA 3O8GA 4XIDA 1FTTA 3EGQA 2LLKA 1MSEC 3HTAA 2D5VA 1D5YA 3LOCA 4FISA 3JRFA 1W0TA 3LHQA 2OF7A 1RKWA 5FKMA 5EGOA 3G1OA 2ZCMA 2R7ZJ 2NP5A 3HTHA 2HOTA 3BR2A 4J19A 2NOGA 4BY1J 1K61A 4CGRA 1NK3P 3Q0UA 2E2JJ 1ETXA 3VVZA 3DEWA 1UHSA 3G1LA 2W48A 3VW2A 2VKEA 3NAUA 3JRHA 2FBQA 5E3LA 3HEFA 3UKGA 5K7HA 2CQXA 4UUSA 4A3GJ 4GCTA 5IOZA 1VI0A 2DG7A 2LTPA 2WAQN 2IBDA 1MBKA 1UG2A 3JREA 2G7GA 3COLA 3S5RA 3M3YJ 3G1MA 4A3LJ 3ON2A 4FE7A 3BR3A 1ETOA 3JRGA 4JYKA 1UI5A 3G7RA 4NDLA 4D5CA 3WHCA 5F1JA 2VPRA 1VFCA 3Q0WA 1SANA 3ZOBA 2Y9ZA 2FJ1A 3CMYA 1VNDA 4CYCA 4AC0A 3FIWA 3VPRA 2DA5A 3RD3A 2LVSA 3LSJA 2LFBA 1WH5A 3GTKJ 5IYCJ 5GPAA 1TWAJ 3OOUA 4GCKA 4UUTA 4FTHA 2ECCA 2FX0A 3TW7A 2GFNA 3DPJA 3MNLA 3HOWJ 2R93J 1MBEA 5FJ8J 3NARA 1MBGA 4ABZA 1GV2A 2ELKA 3VW0A 1SGMA 1AKHB 2XB0X 2GUHA 3I4NJ 3I4MJ 1QVUA 4AYBN 5M3MJ 1APLC 1ITYA 3E7LA 1LFBA 1WH7A 2Y30A 3BRUA 1S7EA 2EQRA 2VKVA 4G12A 5JLWA 1JKQC 1ZKGA 4DW6A 3M4OJ 1BL0A 2DA6A 4B4CA 3GZIA 4NELA 3BG5A 3BTJA 4ACIA 2YS9A 1ETVA 2DA1A 3BR5A 1MSFC 2L9RA 5FKKA 2IU5A 5K58A 4DYQA 3PPBA 5FKOA 4JX4A 3RQIA 1H8AC 1UMQA 2DTZA 3BG3A 3NNRA 3SFIA 1JUMA 4CYCB 5EYRA 2AO9A 2KT0A 1RR7A 3PM1A 3AQTA 1GV5A 5BNGA 4BXXJ 1FIAA 5C44J 2DN0A 4QIWN 2YU9J 2B63J 5H9TA 4X1EA 1H88C 1YRNA 1CQTA 3OSFA 3HGYA 3MKLA 2ME0A 4QTRA 2LP0A 4X6AJ 3C07A 2ZOYA 3VOKA 3JRDA 3GTPJ 5FKLA 4BBSJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS9 A;  3NXC A;  3F1B A;  2E1O A;  2QF7 A;  3S15 J;  4AF5 A;  5JLX A;  5FGL A;  3S1M J;  2XGC A;  2HYT A;  3AQS A;  4MLO A;  3VVX A;  5DAJ A;  1TWC J;  1MNM C;  3A02 A;  1IRZ A;  3CDL A;  3BJB A;  3DCF A;  4JX5 A;  5EZH A;  2COB A;  2XPV A;  2XGE A;  3TP3 A;  2HXO A;  4A3M J;  2G0E A;  3JRC A;  3MN2 A;  4MFD A;  1MH4 A;  1R9T J;  2X9D A;  1JTX A;  3KZ9 A;  3CWR A;  4KWA A;  3S2H J;  2R5Z A;  4IHX A;  3JRA A;  2WUI A;  2EZK A;  2ZB9 A;  2M2E A;  3O8H A;  1X2M A;  2VUM J;  3S16 J;  3S2D J;  1IJW C;  3QBM A;  3GTQ J;  1TWF J;  5J1Y A;  5IOY A;  1ZTR A;  3A01 B;  1IDZ A;  1RKT A;  2AHQ A;  5F0H A;  1B72 A;  5HBU A;  2M9H A;  2DA7 A;  3L1P A;  1DU0 A;  2JA7 J;  4NN1 A;  3B81 A;  4ICH A;  3KKC A;  1BW5 A;  3VW1 A;  2IAI A;  1I6H J;  1AHD P;  4GFL A;  2XRL A;  3MVP A;  1T56 A;  1Y1V J;  4M3D A;  3RKQ A;  1X58 A;  2TCT A;  3OIO A;  4DYR A;  5EEA A;  2DMN A;  2EZL A;  1O4X A;  3PO2 J;  2JN6 A;  4XK4 A;  2CUF A;  3D1N I;  5C4X J;  4XIC A;  2K9S A;  3Q0V A;  4MK6 A;  1HLV A;  2HKU A;  1MBJ A;  2DA3 A;  2G3B A;  2WGB A;  1WCM J;  4LOC A;  2V57 A;  2JK3 A;  1GUU A;  3GTJ J;  1TWG J;  1IV6 A;  4MO7 A;  1I50 J;  1HDD C;  2CRG A;  1IC8 A;  3BCG A;  4L62 A;  1TWH J;  5CXI A;  4M3F A;  2HI3 A;  2EH3 A;  2I10 A;  2PMZ N;  2X6O A;  4I76 A;  4V2G A;  1LFU P;  4JX6 A;  3FKI J;  3LSG A;  1IG7 A;  1B72 B;  3GTL J;  5FHP A;  3H3V K;  3NRG A;  3BR6 A;  2Y31 A;  4I6Z A;  1IDY A;  4B3A A;  1JT6 A;  2NS8 A;  3S17 J;  1WI3 A;  1X2N A;  5EG0 A;  2NX4 A;  4BY7 J;  1JKP C;  4AUX A;  3GTG J;  1H89 C;  4M3B A;  2NP3 A;  1OFC X;  4L5E A;  2W53 A;  1B8I B;  3ZQG A;  2MGQ A;  2WV1 A;  1ZQ3 P;  1IGN A;  2E2H J;  3ZQF A;  5IPA A;  3HOZ J;  3IH4 A;  1A6I A;  2NVX J;  5FKN A;  1SFO J;  3BTI A;  3CCY A;  5EDN A;  2DMP A;  2CJJ A;  3IH3 A;  2UXU A;  4RBO A;  1FEX A;  2K40 A;  2MSY A;  3HOY J;  3FIS A;  2YVE A;  1T33 A;  3HTI A;  3FK7 A;  3VVY A;  3QPS A;  5GPC A;  1JJ6 C;  3K2A A;  5EZG A;  1JT0 A;  1XC5 A;  2HDD A;  1HOM A;  2PBX A;  3HE0 A;  3LJL A;  3ZQH A;  2ZCN A;  2R5Y B;  2Y0S N;  4B1R A;  2DMT A;  2ZCX A;  5IP7 J;  3HM5 A;  2DG8 A;  4JNN A;  2JMW A;  1NK2 P;  5E3O A;  1YRN B;  4BBR J;  1JKO C;  1PUF A;  1U9N A;  4HKU A;  3BTL A;  3CJD A;  2Y2Z A;  4JKZ A;  2R0Q C;  2E2I J;  2CQQ A;  1B8I A;  4C3I J;  2JA8 J;  2YVH A;  4A3B J;  2N8G A;  1BJZ A;  3V78 A;  4A3E J;  4A3C J;  3VP5 A;  1LE8 B;  2RAS A;  2DMQ A;  1U8B A;  1W0U A;  1HF0 A;  1Q1V A;  4A69 C;  1BA5 A;  1K83 J;  2M0C A;  3K7A J;  2R92 J;  1ETY A;  2K9Q A;  1BW6 A;  5HOD A;  2F07 A;  1P7I A;  2GLO A;  4A3F J;  3IV5 A;  2QWT A;  3LWJ A;  3BHQ A;  4JL3 A;  2EZI A;  4W97 A;  2L7Z A;  4D7N A;  5EGO B;  3JRI A;  5M3F J;  3QPL A;  2IEK A;  4RDU A;  2REK A;  3HOV J;  1WPK A;  2ME6 A;  3KNW A;  3ZQI A;  4C3H J;  2DJN A;  4M6V A;  1QPI A;  2MW8 A;  5DS9 A;  1ETQ A;  1F36 A;  2JA5 J;  1FTZ A;  2JJ7 A;  1ORK A;  1ZK8 A;  2OI8 A;  2PZ9 A;  5F27 A;  4UUS B;  2O7O A;  2QCO A;  1VF9 A;  3RH2 A;  5IYB J;  1FIP A;  5K7Z A;  2O9L A;  5E3N A;  3VIB A;  4C3J J;  2EZH A;  2XGD A;  1Z77 A;  3A01 A;  2GM4 A;  3BT9 A;  2NVT J;  3IUV A;  1QVT A;  3CRJ A;  4MIM A;  4XRS A;  3TP0 A;  4ME9 A;  4S0H B;  3RZO J;  4JP0 A;  1F43 A;  1WGX A;  2Y9Y A;  4UDS A;  2HXI A;  3PAS A;  3VUQ A;  3ZQC A;  5GP9 A;  2L7F P;  2L0K A;  4IHY A;  5C4J J;  4A3K J;  3GTO J;  4EEF G;  2RHA A;  5D19 A;  1ZR4 A;  2CU7 A;  2M8G X;  1MBF A;  3SDG A;  4W1U A;  3B6C A;  5DTD A;  3GTM J;  2P81 A;  2DA4 A;  2H8R A;  4IHW A;  1MH3 A;  3S14 J;  1JKR C;  3BR1 A;  9ANT A;  2O7T A;  3P9T A;  2MG4 A;  4FCY A;  2R5Z B;  2G7S A;  3S1N J;  2LY9 A;  1QRY A;  1OCP A;  5F04 A;  5AQC A;  3HTJ A;  3HBL A;  5FLM J;  5FLV A;  4GFK A;  4M3E A;  3HDD A;  5EFY A;  1A5J A;  5F08 A;  5J3L A;  1U9O A;  4C2M J;  2XSD C;  5HSZ A;  2FQ4 A;  5C3E J;  1AU7 A;  3JSJ A;  1GT0 C;  2HQ5 A;  3QKX A;  3HIM A;  3HGG A;  2ID6 A;  1XG1 A;  1Z0X A;  2XB5 A;  3BTC A;  3LNQ A;  4M3G A;  1AKH A;  2HYJ A;  2JWT A;  1ZR2 A;  2QIB A;  2E19 A;  3E7Q A;  3JR9 A;  4HNV A;  3WHB A;  2NVY J;  1RPW A;  3NI7 A;  4A3I J;  3CQZ J;  1MBH A;  3TW6 A;  3VOX A;  1HCR A;  5CXG A;  1ETW A;  3BQZ A;  3OSG A;  1U78 A;  5FMP A;  2XPW A;  2LK2 A;  4MXM A;  5J1U A;  3HB9 A;  3HOU J;  1P7J A;  2QKO A;  4Y7N J;  3HOX J;  2GBY A;  3BG9 A;  2M34 A;  4A3D J;  3HKZ N;  2YUS A;  3C2B A;  1JGG A;  4GFB A;  3G56 A;  3RZD J;  3BR0 A;  2OER A;  5F0C A;  2QTQ A;  3O60 A;  4D7M A;  3V6G A;  2LR8 A;  3S1R J;  2ZOZ A;  2R5Y A;  5IYD J;  3JRB A;  2D6Y A;  1LE8 A;  4D5F A;  5M5X J;  2H1K A;  2Q24 A;  5F0F A;  3B6A A;  4GCL A;  5EF6 A;  4DZP A;  5M5Y J;  2LKX A;  3IH2 A;  1JUS A;  1E3O C;  2O8K A;  5D1R A;  2X48 A;  2XPU A;  3ZQL A;  1JUP A;  5EG0 B;  3ON4 A;  3W6V A;  1GDT A;  5K7F A;  2K9N A;  2NS7 A;  4IHV A;  1RET A;  1UI6 A;  2TRT A;  2VI6 A;  3BNI A;  2UXI A;  3PO3 J;  1ZGW A;  3H0G J;  5M5W J;  4IEJ A;  3LSR A;  2DMU A;  4A93 J;  1TC3 C;  3SJM A;  1JTY A;  4MFE A;  3S1Q J;  2ID3 A;  2UXO A;  2UXH A;  2UXP A;  2XDN A;  3NPI A;  2DA2 A;  2RAE A;  4DZJ A;  4A3J J;  1I3Q J;  1NTC A;  4Y52 J;  1Y1W J;  5HAW A;  1EF4 A;  2L7M P;  3TED A;  5CW8 A;  3Q3S A;  4FE4 A;  4XRS G;  4QSH A;  1PUF B;  3ANG A;  1HDP A;  2EBI A;  5IP9 J;  4PXI A;  2ECB A;  1ETK A;  2OPT A;  1RES A;  5D18 A;  5J1R A;  3GEU A;  1G2H A;  3FK6 A;  5E3M A;  1OCT C;  2CUE A;  2NVQ J;  3EUP A;  3FRQ A;  1DU6 A;  5IP6 A;  3LSP A;  2JA6 J;  3QQA A;  1JJ8 C;  4YZE A;  4DYC A;  1IUF A;  2HOA A;  1POG A;  1FJL A;  2LD5 A;  3BQY A;  1OJL A;  2KDZ A;  4XRM A;  3KKD A;  4AC6 A;  1ENH A;  4BKX A;  3ANP A;  3GBG A;  2FD5 A;  2QOP A;  2WB1 N;  3A03 A;  1GVD A;  3F0C A;  5C4Y A;  3T6N A;  2GEN A;  2HOS A;  2G7L A;  4V2F A;  3O8G A;  4XID A;  1FTT A;  3EGQ A;  2LLK A;  1MSE C;  3HTA A;  2D5V A;  1D5Y A;  3LOC A;  4FIS A;  3JRF A;  1W0T A;  3LHQ A;  2OF7 A;  1RKW A;  5FKM A;  5EGO A;  3G1O A;  2ZCM A;  2R7Z J;  2NP5 A;  3HTH A;  2HOT A;  3BR2 A;  4J19 A;  2NOG A;  4BY1 J;  1K61 A;  4CGR A;  1NK3 P;  3Q0U A;  2E2J J;  1ETX A;  3VVZ A;  3DEW A;  1UHS A;  3G1L A;  2W48 A;  3VW2 A;  2VKE A;  3NAU A;  3JRH A;  2FBQ A;  5E3L A;  3HEF A;  3UKG A;  5K7H A;  2CQX A;  4UUS A;  4A3G J;  4GCT A;  5IOZ A;  1VI0 A;  2DG7 A;  2LTP A;  2WAQ N;  2IBD A;  1MBK A;  1UG2 A;  3JRE A;  2G7G A;  3COL A;  3S5R A;  3M3Y J;  3G1M A;  4A3L J;  3ON2 A;  4FE7 A;  3BR3 A;  1ETO A;  3JRG A;  4JYK A;  1UI5 A;  3G7R A;  4NDL A;  4D5C A;  3WHC A;  5F1J A;  2VPR A;  1VFC A;  3Q0W A;  1SAN A;  3ZOB A;  2Y9Z A;  2FJ1 A;  3CMY A;  1VND A;  4CYC A;  4AC0 A;  3FIW A;  3VPR A;  2DA5 A;  3RD3 A;  2LVS A;  3LSJ A;  2LFB A;  1WH5 A;  3GTK J;  5IYC J;  5GPA A;  1TWA J;  3OOU A;  4GCK A;  4UUT A;  4FTH A;  2ECC A;  2FX0 A;  3TW7 A;  2GFN A;  3DPJ A;  3MNL A;  3HOW J;  2R93 J;  1MBE A;  5FJ8 J;  3NAR A;  1MBG A;  4ABZ A;  1GV2 A;  2ELK A;  3VW0 A;  1SGM A;  1AKH B;  2XB0 X;  2GUH A;  3I4N J;  3I4M J;  1QVU A;  4AYB N;  5M3M J;  1APL C;  1ITY A;  3E7L A;  1LFB A;  1WH7 A;  2Y30 A;  3BRU A;  1S7E A;  2EQR A;  2VKV A;  4G12 A;  5JLW A;  1JKQ C;  1ZKG A;  4DW6 A;  3M4O J;  1BL0 A;  2DA6 A;  4B4C A;  3GZI A;  4NEL A;  3BG5 A;  3BTJ A;  4ACI A;  2YS9 A;  1ETV A;  2DA1 A;  3BR5 A;  1MSF C;  2L9R A;  5FKK A;  2IU5 A;  5K58 A;  4DYQ A;  3PPB A;  5FKO A;  4JX4 A;  3RQI A;  1H8A C;  1UMQ A;  2DTZ A;  3BG3 A;  3NNR A;  3SFI A;  1JUM A;  4CYC B;  5EYR A;  2AO9 A;  2KT0 A;  1RR7 A;  3PM1 A;  3AQT A;  1GV5 A;  5BNG A;  4BXX J;  1FIA A;  5C44 J;  2DN0 A;  4QIW N;  2YU9 J;  2B63 J;  5H9T A;  4X1E A;  1H88 C;  1YRN A;  1CQT A;  3OSF A;  3HGY A;  3MKL A;  2ME0 A;  4QTR A;  2LP0 A;  4X6A J;  3C07 A;  2ZOY A;  3VOK A;  3JRD A;  3GTP J;  5FKL A;  4BBS J; 
#chains in the Genus database with same CATH topology
 2HPM A;  2PMH A;  2QF7 A;  3S15 J;  5JLX A;  3PQK A;  2BOL A;  2XGC A;  3F3X A;  2HYT A;  3AQS A;  2BY0 A;  3AAF A;  1O3R A;  3CJR B;  5DAJ A;  2STW A;  4PUS A;  4ENN A;  2CWE A;  3MZH A;  4N4N B;  5GAE J;  4JX5 A;  1KQ9 A;  1KZH A;  2IT0 A;  3WG7 H;  3TP3 A;  1E0E A;  3EYY A;  2O61 A;  4XKB A;  2KQR A;  4ESJ A;  4MFD A;  1BR2 A;  3JW4 A;  3CWR A;  2CH0 A;  3FXR A;  1N77 A;  4IHX A;  1AOY A;  3O8H A;  2VJ5 A;  2VUM J;  3S2D J;  1QZY A;  2PMZ A;  3EYI A;  2FBH A;  3MQ0 A;  3ZN1 A;  4Y15 A;  3LA3 A;  5DD4 A;  2QUF A;  2KRF A;  2Z16 A;  3AFH A;  1RRJ A;  3F23 A;  4KIT B;  3LA2 A;  3A01 B;  4AM3 A;  2FRH A;  1T0F C;  4HAM A;  2UXN A;  1DU0 A;  1YIO A;  4ICH A;  2JVG A;  3HOT A;  2LNB A;  4EMS A;  1AHD P;  3FDY A;  4ESF A;  4CHU A;  5D6E A;  2X1C A;  2M3A A;  1LKX A;  2FJI 1;  4M73 A;  2RQP A;  1SFK A;  3PFY A;  1R1U A;  4GYI A;  1GLN A;  4XK4 A;  3H3Z A;  2CUF A;  5TGT A;  4QPO A;  3D1N I;  4UNO A;  3Q0V A;  1F5T A;  4PDK A;  1MBJ A;  5BMZ A;  3L2Q A;  1LDD A;  4GO1 A;  3GTJ J;  4CCL A;  1TWG J;  3T8T A;  1O3T A;  4IZZ A;  1I50 J;  1R49 A;  3E5Q A;  5L3C A;  3M07 A;  1HW5 A;  4KIC A;  4M3F A;  1DPR A;  3CME I;  2X6O A;  3ZCO A;  4V2G A;  1TNS A;  4TV7 A;  4XLH A;  4H4K C;  2V1N A;  3GTL J;  3NRG A;  3BR6 A;  4BE2 A;  4I6Z A;  4HG2 A;  2FU4 A;  3I9V 2;  1IDY A;  4B3A A;  3K70 C;  2CV1 A;  1G6N A;  1UST A;  2NX4 A;  3V7R A;  4AUX A;  3GTG J;  1OPC A;  4NHJ A;  2BZT A;  4HX8 A;  4M3B A;  1KU3 A;  1NHA A;  3QPT A;  1RUN A;  2W00 A;  4DJA A;  4UVA A;  1ZQ3 P;  2WV1 A;  1YI2 I;  3CO6 C;  3FMR A;  3OYJ A;  1IGN A;  1VQP I;  2E2H J;  1D8K A;  2JUG A;  2MC4 A;  1VQ8 I;  3HOZ J;  2VBX A;  2A6H F;  3KP5 A;  2NVX J;  5FKN A;  3BTI A;  4BUP A;  5E1W A;  2HVQ A;  4UVB A;  2DI3 A;  2HQA A;  3TO6 A;  1RIO H;  3IH3 A;  3E1S A;  3AL0 B;  3KEY A;  2OD5 A;  2MSY A;  4GGG A;  1G59 A;  3HOY J;  3FXQ A;  1T33 A;  2WTE A;  2DFI A;  4P9F A;  2YPR A;  3HE0 A;  2K4J A;  2ZCX A;  2IXS A;  4IHS A;  2W4S A;  5DCF A;  2EB7 A;  4L5I A;  3EQL F;  2JMW A;  2MH9 A;  4CZC A;  3WGH A;  1JKO C;  2B1E A;  2XVC A;  1C0W A;  2D2W A;  1T08 B;  5F1R A;  2YVH A;  4RAF A;  4A3B J;  3DLL F;  5B66 C;  2V6C A;  4XBF A;  2QQA A;  4LG3 A;  5JFR A;  1U8B A;  2RAS A;  2K9M A;  4QLC U;  3B02 A;  3K7A J;  2L02 A;  1ETY A;  2K9Q A;  3CES A;  3F8C A;  1BW6 A;  1J75 A;  2F07 A;  1FP1 D;  4BU2 A;  1Z9C A;  2DLL A;  2ZO4 A;  1LQ1 A;  2EZI A;  2RVC A;  3I4P A;  4LB5 A;  1WQ2 A;  2EJR A;  3HPH A;  1X1P A;  3FM5 A;  4NQW B;  2Y0S A;  2QZ8 A;  5TIS C;  1R4N B;  1N75 A;  1PJR A;  5DCM B;  3KX2 A;  1ETQ A;  2NS0 A;  1IXC A;  4YEJ A;  3OR2 C;  2R7R A;  2EIK H;  1Y8R B;  2K7L A;  4C3J J;  4J01 A;  3VIB A;  1B59 A;  1Z77 A;  1IN8 A;  1N78 A;  3H9J A;  5LHI A;  5BPD A;  1R1V A;  1RNL A;  2DDB A;  4RAG A;  3CLO A;  1TT0 A;  4XRS A;  4U88 A;  3TP0 A;  2DPU A;  1F43 A;  5J8C A;  4UDS A;  5FFZ A;  4XKV A;  4ZYE A;  1L3L A;  4A3K J;  3S93 A;  3GTO J;  3SDG A;  3C2G A;  4AID A;  2BE5 F;  1AA7 A;  4IHW A;  3S14 J;  2H8R A;  9ANT A;  2ICW G;  4BJT A;  2MG4 A;  3S1N J;  1OCP A;  2OUM A;  5E1X A;  2CQ7 A;  2RRE A;  5HNF A;  5IT3 A;  4EJV A;  3IL2 A;  1HKT A;  3EET A;  3Q9V A;  3WE3 A;  4X0G A;  2ZJP F;  3NWS A;  4BH9 A;  1KA8 A;  5J3L A;  4KJZ A;  5C3E J;  4UV8 A;  4UUV A;  3JSJ A;  1XN7 A;  3DBL B;  3VSK A;  1B6A A;  3AG2 H;  2P6T A;  2DCE A;  2IGO A;  1VTN C;  2XB5 A;  3K6G A;  4M3G A;  1AKH A;  2HYJ A;  3K4K A;  5LGU A;  1SVL A;  2GOM A;  1LVA A;  2ZXW H;  2E19 A;  1UB9 A;  1R5H A;  3JR9 A;  1BI0 A;  1FPQ A;  5HDK A;  2HNH A;  2VIX A;  3WHB A;  5J6X A;  3VB2 A;  1SEU A;  3HRM A;  4ENM A;  1VQ9 I;  1DUX C;  5HOO A;  3CQZ J;  2K85 A;  3CP2 A;  3TW6 A;  1HCR A;  1P4X A;  2WV0 A;  4F7Z A;  4G7O F;  2CW7 A;  2OV7 A;  3BQZ A;  3OSG A;  3A0H C;  4HDV A;  1U78 A;  2XPW A;  2LK2 A;  3BZK A;  2GXB A;  3J7A O;  2OC6 A;  1LDJ A;  1B4A A;  3L00 A;  2GBY A;  1LEB A;  2WAD A;  4OAY A;  4GFB A;  3JTG A;  5JHF A;  3RZD J;  3BR0 A;  4U0Y A;  2QTQ A;  3KYL A;  4A5M A;  4D7M A;  1QBJ A;  4LLG F;  3HL2 A;  2R5Y A;  4L5J A;  3SZG A;  3E5X A;  2Y69 H;  3H3U A;  2HKX A;  3OS1 A;  5M5X J;  2H1K A;  2Q24 A;  4CDG A;  3L09 A;  1FOY A;  2ZME B;  5ILV A;  2W85 A;  1X1C A;  1YX3 A;  4GCL A;  4LK1 F;  1QZZ A;  1IO2 A;  4DZP A;  3OS0 A;  2LKX A;  2NYX A;  2FBK A;  3IH2 A;  2DK5 A;  3LL7 A;  3VYU B;  3OYG A;  4KN4 X;  1ON2 A;  3OS2 A;  2XPU A;  3ZQL A;  3KFW X;  1RI7 A;  5KNL A;  5EG0 B;  3W6V A;  2DAO A;  1QHG A;  4XKC A;  3MKW B;  2NS7 A;  2JPC A;  1RET A;  3BNI A;  2VI6 A;  4BE1 A;  1K78 A;  3BDD A;  2UXI A;  3H0G J;  4AIJ A;  4CCO A;  1F4K A;  2UWM A;  1WWX A;  2XAF A;  1QQI A;  2DMU A;  4WF2 A;  2QLZ A;  1FYM A;  2CV0 A;  3JSO A;  1TC3 C;  2UXO A;  3K4C A;  2ID3 A;  5FLX K;  2UXP A;  2DA2 A;  2O3F A;  2X51 A;  2KLO A;  4EM2 A;  3D0S A;  2B3W A;  2BYV E;  4LLN A;  1HKQ A;  1EF4 A;  2L7M P;  3TED A;  5CW8 A;  2KJC A;  2EFQ A;  1VQO I;  2L54 A;  4NNJ A;  1ERD A;  2M7B A;  3SYT A;  5IP9 J;  3J80 Z;  3LMM A;  1K7A A;  4RAY A;  2IVM A;  5E3M A;  4BL0 B;  2GAU A;  5IP6 A;  3FXU A;  3LSP A;  1JJ8 C;  4CH7 A;  2WC2 A;  2R7T A;  2W24 A;  5EJC A;  3CZ6 A;  2OBP A;  4XKW A;  3GLX A;  5J8F A;  2KDZ A;  5LEK A;  1YYV A;  4K2E A;  5D6F A;  1ENH A;  2MH2 A;  2X6W A;  4BKX A;  2LDU A;  5C4Y A;  3A03 A;  2E7W A;  2WBM A;  2VXZ A;  3IRR A;  2BY1 A;  4M71 A;  5HVQ C;  3GF2 A;  2G7L A;  2A5Y B;  1FTT A;  4XID A;  2M0M A;  3F8N A;  4OIR F;  2KL4 A;  4B43 A;  1TLH B;  4FIS A;  1W0T A;  2R7S A;  3LHQ A;  2ZNY A;  1PP7 U;  3I59 A;  2ZCM A;  3I58 A;  2NP5 A;  5ICC A;  4OMZ A;  5JHU A;  3S3N A;  1KGS A;  1D1C A;  3BZ6 A;  1NK3 P;  3K2Z A;  2E2J J;  5DV5 A;  1QNT A;  3K4L A;  1IRF A;  1K6O A;  2X6Y A;  1Z05 A;  3H92 A;  2W48 A;  3VW2 A;  1R58 A;  4HX7 A;  4E7J A;  3HEF A;  3QYF A;  3UKG A;  1IAW A;  1G4D A;  2ISY A;  4MHG A;  4A3G J;  1A6Q A;  4GCT A;  2MD5 A;  1VI0 A;  3K1N A;  3X2Q H;  3AG3 H;  1LJ9 A;  4XLA A;  3JRE A;  1UG2 A;  3RPQ A;  1IN5 A;  4BHB A;  1ZLK A;  1G8X A;  2K02 A;  4U0V A;  2OTL I;  5JVG F;  3LQQ A;  4JYK A;  1ONV A;  3U2R A;  3G3Z A;  2L9N A;  2M8E A;  1SAN A;  3N05 A;  2FJ1 A;  2QEN A;  4KNY A;  1U0J A;  2L5Q A;  3H5N A;  3CCJ I;  3GZ5 A;  1IXS B;  3AKZ A;  3K9T A;  1WH5 A;  3GTK J;  2D45 A;  3HG9 A;  3TO9 A;  1G3T A;  3H1C A;  1BI2 A;  4DOZ A;  1TQM A;  1QPM A;  2UXX A;  2MLK A;  2KIS A;  4DVY P;  5HNH A;  4J00 A;  2ELK A;  3VW0 A;  4IQ4 A;  2XB0 X;  2A68 F;  1S9H A;  3DEE A;  5H2F C;  4AWX B;  5M3M J;  3CC7 I;  4KMU X;  4XRF A;  4XLF A;  2EQR A;  1V4R A;  2VPL A;  3OYL A;  3EPZ A;  3I53 A;  5LHG A;  3DBR B;  1BL0 A;  3BG5 A;  1TT5 B;  2HYF A;  2YS9 A;  2VLA A;  5TJJ A;  1T6S A;  2ZJ2 A;  3R6S A;  2VJI A;  1IW7 F;  4EJT A;  2ELJ A;  2VBY A;  1MSF C;  3WU0 A;  1QGP A;  3VDX A;  2JT1 A;  4DYQ A;  4G6D A;  1UMQ A;  1NH3 A;  5CYV A;  2DTZ A;  1P4A A;  1U5T A;  2P5K A;  4R1H A;  2KT0 A;  1RR7 A;  3PM1 A;  2QBY B;  1X19 A;  1FIA A;  4E7K A;  2A2F X;  4E7I A;  3QP5 A;  4QIW N;  3L2R A;  2DQR A;  4IOC F;  5FD6 A;  3WTZ A;  4XLC A;  1OYY A;  2PEX A;  4XLN F;  4IKF A;  3ZN0 A;  2LP0 A;  3S2W A;  4X6A J;  3HTS B;  5FO5 A;  4YIF A;  3JRD A;  2IS1 A;  5FKL A;  4RGR A;  3QU6 A;  3LFU A;  3TO7 A;  1XS9 A;  2A3S A;  4EJW A;  2E1O A;  1SAU A;  3F1B A;  1P6R A;  2L7K A;  2JRT A;  3PSF A;  3S1M J;  4C2M A;  1YW7 A;  4YRV A;  2WAE A;  1UAA A;  1IRG A;  1K79 A;  3OYD A;  1V5G A;  4G6Q A;  1ZG1 A;  3WTT C;  1K4T A;  1MNM C;  4BYY A;  1IRZ A;  1TQP A;  3CDL A;  4IOA F;  4ZDL A;  5EZH A;  2EIM H;  2HXO A;  2LMD A;  1Y39 A;  1HKS A;  3DF8 A;  2G0E A;  3ABL H;  4LD5 A;  3MN2 A;  4RB2 C;  2X9D A;  1JTX A;  3EUH A;  2MFZ A;  4KWA A;  2QM3 A;  2R7W A;  3S2H J;  2R5Z A;  5CPR B;  1IRX A;  2WUI A;  1EKE A;  1A04 A;  2EZK A;  2RQQ A;  1VQM I;  3S16 J;  1V5F A;  1P2F A;  1KQ0 A;  3FM3 A;  5AON A;  3E6D A;  1IJW C;  3QBM A;  5L3B A;  1TWF J;  2PFV A;  2A05 A;  3JTH A;  5J1Y A;  2Q8K A;  5IOY A;  2OCE A;  3KEO A;  1RKT A;  5F0H A;  1B72 A;  5HBU A;  2DA7 A;  1DQU A;  4GDF A;  1JHH A;  2W7N A;  3KKC A;  2PQ8 A;  4DBR A;  1S72 I;  1I6H J;  2NVU B;  4RM3 A;  2QEX I;  3RKQ A;  2ZKZ A;  2TCT A;  3IHU A;  3OIO A;  5EEA A;  4NUB A;  3CO7 C;  3K8P C;  3PO2 J;  2XSJ C;  2JN6 A;  3S32 A;  1BI1 A;  1STZ A;  2B7E A;  2RDP A;  4NB5 A;  4ON0 A;  1AWC A;  2K9S A;  1GVJ A;  1UJ8 A;  1X3U A;  3IRQ A;  4CZZ A;  1HLV A;  1MKM A;  4IRI A;  1MMA A;  1WCM J;  4IVN A;  4OAZ A;  5B1B H;  5CKT A;  3SEZ A;  4IXA A;  1IC8 A;  1BR1 A;  4L9V A;  1TWH J;  5CXI A;  2P7V B;  3PIO F;  2HI3 A;  2I10 A;  4IX7 A;  4I76 A;  2JVH A;  5KHD A;  2HEO A;  1YLF A;  2A07 F;  3LSG A;  2RV8 A;  2I5U A;  3AG4 H;  3FXL A;  4IRG A;  1B72 B;  4OIO F;  4HW0 A;  4Y13 A;  2V26 A;  1W7P D;  1Z3X A;  1S7O A;  2EK5 A;  3ZMZ A;  1E3P A;  3W2V A;  1Z7U A;  2RN7 A;  3T5X A;  3TGN A;  2R7U A;  3ERM A;  2E1C A;  2PJR A;  3OWT A;  1X2N A;  3R61 A;  3DTI A;  5EG0 A;  4BY7 J;  2XRO A;  2Z5U A;  1ZAO A;  4M72 A;  4LGW A;  3KYD B;  5HLI A;  4I99 C;  2W53 A;  2VT2 A;  1B8I B;  2ZXI A;  4WWC A;  1XSV A;  3OMY A;  2CUZ A;  2IA2 A;  2NNY A;  2IP2 A;  3DFG A;  5HS9 A;  3A2K A;  4U7B A;  4PFO A;  1A6I A;  2Z2S B;  2X4H A;  4XM3 A;  4HDU A;  1OKR A;  3M8E A;  1HSJ A;  4FET A;  1A31 A;  4WXD A;  2A6E F;  2BXY A;  1OYW A;  3HTI A;  2VE9 A;  3VVY A;  2CG4 A;  1XC5 A;  3FZV A;  3ZMS A;  1RR8 C;  3LJL A;  5D5V B;  3BC8 A;  2DT6 A;  2R5Y B;  4B1R A;  2AQE A;  2DMT A;  4B3X A;  3HM5 A;  1WKM A;  3HHH A;  1WJ5 A;  1MIJ A;  3W6J B;  3LSH A;  1ZRE A;  1NK2 P;  1J7K A;  5E3O A;  4ZYD A;  1LPQ A;  1J2X A;  2IS4 A;  4AU7 A;  1PUF A;  4XOT A;  2VOP A;  1Z21 A;  2K4B A;  2CQQ A;  4JQF A;  4C3I J;  5DUK A;  1B8I A;  4Z6Y A;  2AS5 F;  3CTA A;  4A3C J;  4P96 A;  1OCC H;  4PCQ A;  1LE8 B;  1HF0 A;  2XAQ A;  1FBS A;  3QWL A;  3OR1 C;  3CCQ I;  2M0C A;  2MC3 A;  1VZ0 A;  5HOD A;  2GLO A;  4A3F J;  4XON A;  3IV5 A;  3LWJ A;  4JL3 A;  1U5T C;  2HZT A;  1BIB A;  4D7N A;  4D9J A;  5EGO B;  2XAU A;  3FX3 A;  3COA C;  3JRI A;  5M3F J;  2DPD A;  2VB6 A;  3E6M A;  2AXT C;  1WJC A;  4KDP A;  1D3Y A;  4RDU A;  2REK A;  4XQF A;  3GWZ A;  1S7A A;  2X85 A;  4I09 A;  3E6C C;  3EUH C;  3VWB A;  1ORK A;  1EH6 A;  1ZK8 A;  2VJJ A;  2PZ9 A;  2O7O A;  1W7P B;  2GZW A;  3RH2 A;  1W5S A;  1SMT A;  5IYB J;  4LIU A;  4E7S A;  5K7Z A;  4F3Q A;  2EFW A;  3KP3 A;  1FZP B;  4BQN A;  1VQ4 I;  3G71 I;  1R1T A;  4H0E A;  1QA6 A;  3DTK A;  3A01 A;  3BT9 A;  3D5S C;  3KP4 A;  2NAZ A;  2NVT J;  5D4S A;  3CRJ A;  4MIM A;  2CW8 A;  3DU6 A;  2GA2 A;  4RLF A;  1ZLJ A;  1OCO H;  3SQN A;  5DM6 F;  2HXI A;  3PAS A;  5LRS A;  2L7F P;  4M6X A;  4F92 B;  2V7F A;  5FRN A;  2XC7 A;  1D1B A;  3K4J A;  4EEF G;  2RHA A;  5GAG J;  4BQA A;  2XHK A;  4PK4 A;  1MBF A;  1V3F A;  1N25 A;  4XNF A;  4R79 A;  2FML A;  2IW5 A;  2LOO A;  4CSW A;  2ZFW A;  1SC7 A;  3CCM I;  5H6Q A;  2JRM A;  2DA4 A;  2P81 A;  2X1D A;  3QOE A;  4RB0 A;  1JKR C;  1ACI A;  2KIF A;  2PFB A;  2O7T A;  1GHC A;  4BEH B;  2QSH X;  2EIL H;  2G7S A;  2ELH A;  4AIH A;  2YU3 A;  3KP7 A;  3WOD F;  1USS A;  5AQC A;  2TDX A;  1O57 A;  4G94 A;  3HBL A;  3VSL A;  5FLM J;  2PI0 A;  4OD4 A;  3QU3 A;  4M3E A;  3OYI A;  3HDD A;  5F08 A;  4C2M J;  1U9O A;  2XSD C;  3I55 I;  3T1B A;  4IO9 F;  2VQG A;  3HRT A;  1XGO A;  2DDA A;  1TBX A;  2IS2 A;  1D1A A;  3TKY A;  3CDI A;  3A0B C;  4OD5 A;  3HGG A;  4EQQ A;  1ZHF A;  4WK8 F;  1TW3 A;  2LKS A;  2FNA A;  4Q47 A;  4Q48 A;  3PQJ A;  5KK1 A;  2PX9 A;  2LRE A;  2XKO A;  1H9G A;  4HNV A;  2PN6 A;  3L2C A;  3GUD A;  3CUO A;  1B9M A;  1RPW A;  5ILS A;  1QU3 A;  5ICF A;  3VOX A;  2FMY A;  4F55 A;  1FBU A;  2G7U A;  5FMP A;  4HF0 A;  3RCO A;  4QWQ A;  4MXM A;  2LYC A;  2Z1D A;  1P7J A;  3M1C A;  3SDB A;  4LIV A;  3HOX J;  2L4A A;  3BG9 A;  2M34 A;  3FBI B;  3FF5 A;  1JGG A;  1BBY A;  2OER A;  1D0X A;  3BOQ A;  2HS5 A;  3P7N A;  3PNT A;  3S1R J;  2ZOZ A;  4OMY A;  2DOF A;  3BLY A;  1FT9 A;  5IYD J;  2OCC H;  3WG9 A;  4D5F A;  2H94 A;  3GZ6 A;  1T8I A;  1SD4 A;  4BHP A;  5M5Y J;  1OR7 C;  4DBQ A;  1E3O C;  2O8K A;  4D1Q A;  3DPU A;  2MLG A;  2H1L A;  3I0T A;  2K5C A;  1E17 A;  1JUP A;  1CGP A;  3O3K A;  4BJ5 C;  1LNW A;  2BVL A;  2LBF A;  2DYR H;  3J7Z I;  2AXL A;  2ZJQ F;  4XLP F;  2KZG A;  2WB1 A;  2M87 A;  4D0P A;  4UV9 A;  3LSR A;  4A93 J;  2R7X A;  3VEP A;  4ETS A;  2XDN A;  2XIG A;  3NPI A;  1X1B A;  2HTS A;  3ZMV A;  4OIP F;  1R4M B;  1Z7L A;  1Y1W J;  5HAW A;  4WIB A;  3CJD A;  2UV1 A;  5DDG A;  3ANG A;  1HDP A;  3VYR B;  2EBI A;  5E8G A;  2F6C A;  5IT9 Z;  2M4G A;  3OYH A;  1ETK A;  3KCC A;  1RES A;  4BXF A;  1B1B A;  3FK6 A;  3KP6 A;  2DFH A;  2NVQ J;  3LA7 A;  2HVR A;  1FSH A;  3FKJ A;  4YZE A;  3JSP A;  3BZC A;  2KRH A;  3PNV A;  4JOM A;  1POG A;  4BNC A;  4ZTJ A;  3WTS C;  4HOB A;  1V54 H;  5B5E C;  2QOP A;  3F0C A;  3ZMD A;  3T6N A;  2GEN A;  3BPX A;  2ZSH B;  4MQV A;  4P55 A;  1PUE E;  5CQE A;  1UCR A;  4PFP A;  3CMM A;  3EGQ A;  2FF4 A;  1IZ1 A;  4UXN A;  3LOC A;  1K4S A;  3HRS A;  1UFM A;  3LST A;  4I02 A;  3J80 K;  1ZG5 A;  3RYR A;  2R7Z J;  5FRO A;  2HOT A;  3BR2 A;  2ZNZ A;  1Z67 A;  2NOG A;  4OIN F;  1TNT A;  1T39 A;  1K61 A;  1X4P A;  5A2Q Z;  2VT3 A;  3F72 A;  3G1L A;  3J81 K;  3NAU A;  2V1U A;  2FBQ A;  4II3 A;  3RDI A;  1T95 A;  5J47 A;  5K7H A;  1SD7 A;  1J09 A;  2FA5 A;  4UUS A;  2F5D A;  1ZRC A;  3VTI A;  2IBD A;  4A0X A;  2Q2E A;  3SEQ A;  3M3Y J;  3S3M A;  4A3L J;  3ON2 A;  4FE7 A;  3BR3 A;  3OYE A;  3AL0 C;  3G7R A;  4HBL A;  4D5C A;  3ZQQ A;  1HW2 A;  3WHC A;  5F1J A;  2ACJ A;  2VPR A;  5CVV A;  1JXS A;  5H6R A;  1K6Y A;  1P9Q C;  4P1W A;  3ZOB A;  2XV4 S;  2E5Z A;  3WGG A;  1FYL A;  5E20 A;  1FOK A;  4HEA 2;  2Z33 A;  3VPR A;  2DA5 A;  3RPU A;  4E6K G;  2LFB A;  4ZTF A;  2VQC A;  5GPA A;  3ZPL A;  1IN7 A;  1TWA J;  4ZZD A;  4GCK A;  2L3D A;  1R7J A;  2ECC A;  3TW7 A;  3DPJ A;  4FAS D;  4E4H A;  3HOW J;  2J5P A;  2XF7 A;  5HDG A;  4EM0 B;  3WU1 B;  1MBE A;  1SFX A;  4YFK F;  1FOW A;  2LG4 A;  2HQR A;  5FJ8 J;  2IA1 A;  2V4J C;  3L2W A;  1DP3 A;  1GV2 A;  3ECH A;  4ENJ A;  1ODD A;  2VKH A;  4CXF A;  1IF1 A;  2WY8 Q;  3I4N J;  1B9N A;  1Z6R A;  2QYO A;  4IRH A;  2ETH A;  1WH7 A;  2Y30 A;  3IP4 B;  4RAZ A;  2VKV A;  5JLW A;  4MEY F;  4CO8 A;  1ZKG A;  4UHT A;  1YE9 A;  4DW6 A;  3M4O J;  3GYH X;  4NEL A;  1SMY F;  2P5L C;  3BTJ A;  2K9L A;  2L2O A;  4PJ0 C;  3U9G A;  5L3F A;  2L9R A;  5FKK A;  3PPB A;  1SFE A;  1EA3 A;  2HPI A;  3F8M A;  3NNR A;  1Q1H A;  1TZL A;  1X4O A;  2BEO A;  3W2W A;  3D5L A;  1BC7 C;  2NNN A;  2W82 A;  1IV8 A;  5EEH A;  1RZ4 A;  2E36 A;  4CCM A;  2BW3 B;  3AQT A;  1QHH D;  3PUF A;  2DN0 A;  3Q9S A;  2YU9 J;  3G2B A;  4X1E A;  1WJA A;  1P4W A;  1CQT A;  5KVR A;  3EUA A;  4ZYH A;  3OSF A;  4BQO A;  4IHT A;  1MNE A;  2OZ6 A;  4XMY A;  2ME0 A;  4QTR A;  1I5Z A;  2GWR A;  2F4O B;  2UZK A;  2ZOY A;  3VOK A;  2XAS A;  2CMP A;  3CUQ C;  4KUM A;  4EGY A;  3NXC A;  3MZ8 A;  2LBF B;  5K5O A;  1VQN I;  1VQL I;  2A61 A;  2VQL A;  4ESB A;  3KLN A;  5CLS A;  5E18 F;  4BJ6 C;  5L3D A;  4ZJZ A;  4MLO A;  4KN7 X;  1G3Y A;  5K1Y A;  3VVX A;  2QWW A;  4HV5 A;  2F5F A;  2HKO A;  1WRJ A;  5CVI A;  2HOE A;  2PMU A;  3BJB A;  2GIZ A;  2A5W A;  2COB A;  4PZJ A;  3KZI C;  2JA2 A;  2K3F A;  3I56 I;  1EH8 A;  2R4G A;  3JRC A;  2HGC A;  3QOD A;  2OAZ A;  4IPA A;  1R9T J;  3KZ9 A;  3WTX C;  4I98 B;  1YIJ I;  4YFX F;  2F5V A;  2ZB9 A;  2M2E A;  3GTQ J;  4OU0 A;  5FLX Z;  1ON1 A;  3M7G A;  1ZTR A;  2CSO A;  1WZ2 A;  1IDZ A;  2XAG A;  1YJN I;  2AHQ A;  3V4G A;  4EGZ A;  2M9H A;  2HWV A;  2HDW A;  3U1K A;  1BW5 A;  3BG7 A;  3G73 A;  2XRL A;  1XMX A;  1X58 A;  1KYZ A;  4O3M A;  2WAQ A;  4DYR A;  4PGH A;  3A1Y A;  1R00 A;  5ICG A;  3FBN B;  3I64 A;  3WTY C;  1TTY A;  3OY9 A;  2BV6 A;  2XAJ A;  2WAF A;  5C4X J;  4XIC A;  4MK6 A;  2V9K A;  3CCR I;  2HFH A;  3MKY B;  2HKU A;  4LOC A;  2V57 A;  3H9Q A;  4HSR A;  3FHZ A;  1YJ9 I;  3FXJ A;  3RTR A;  2K3P A;  3BCG A;  4XSZ F;  2DQL A;  2P4W A;  1W5T A;  4M9S A;  1FMV A;  2EH3 A;  4ANJ A;  2PMZ N;  1DP7 P;  3KE2 A;  2O03 A;  3I71 A;  3CCU I;  1DGW Y;  5FHP A;  3H3V K;  4MQ9 F;  4HF2 A;  3V42 A;  1BIA A;  3DBH B;  1SD6 A;  3TBI A;  2E5N A;  5TRD A;  2NS8 A;  2Y75 A;  4F93 B;  3H5R A;  2F4I A;  1W36 D;  3S17 J;  2E1M B;  1O3Q A;  1TL8 A;  1JKP C;  5FGM A;  3V7C A;  2AQF A;  1H89 C;  4DGW B;  4Y3O A;  1HXD A;  1SD5 A;  2JPB A;  3DP7 A;  1OFC X;  4L5E A;  3QYB A;  2DOA A;  2VOD A;  3CCL I;  3K4M A;  4LJZ F;  3W6K B;  2K27 A;  1OCZ H;  2KIQ A;  2X0L A;  3ZQG A;  4I2O A;  2FOW A;  4YFN F;  5IPA A;  3ERE D;  1SFO J;  3CCY A;  5EDN A;  4FX0 A;  2B0L A;  2VC1 A;  3L2U A;  4N9I A;  2D1V A;  2UXU A;  1R5G A;  2K40 A;  1BC8 C;  3FXO A;  3FIS A;  3KET A;  5KAF C;  1TQI A;  5GPC A;  2PBX A;  5JVT A;  2HDD A;  1HOM A;  2OQR A;  3ZQH A;  2HU9 A;  2Y0S N;  3R0A A;  2X6X A;  5AIQ A;  5IP7 J;  2ADU A;  3F22 A;  3IKV A;  3HC7 A;  2QBY A;  2DO7 A;  2QSF X;  4G9Y A;  5FD5 A;  3NS4 A;  2UUZ A;  2XAH A;  3IUO A;  4UB8 C;  2NRA C;  4B8X A;  4HKU A;  5LD2 C;  1Z6T A;  3FMQ A;  4RLQ A;  3MD2 A;  1W1W E;  1KU7 A;  5L3E A;  3VP5 A;  3E3V A;  2DMQ A;  4G8X A;  3TDZ C;  1W0U A;  2Z99 A;  4A69 C;  2KP6 A;  2R92 J;  2ZXH A;  4WXC A;  2V1X A;  1P7I A;  3WTV C;  2DXI A;  2VKD A;  2DFE A;  1XMK A;  4RGS A;  2QWT A;  1CF7 B;  3BHQ A;  2W84 A;  3L7W A;  1IUY A;  3I59 B;  4I0A A;  2LY1 A;  5KCM A;  1VQ6 I;  2IEK A;  2H27 A;  2ME6 A;  4ZYG A;  3QAH A;  3VOD A;  3KNW A;  3CLQ A;  4CYD A;  1YFH A;  1G3W A;  4C3H J;  2DJN A;  3IWZ A;  2MW8 A;  5DS9 A;  1F36 A;  2JA5 J;  2JJ7 A;  2GIV A;  4OOI A;  1J9I A;  5F27 A;  3DPT A;  3GLL A;  3GXO A;  1XX5 A;  1NG6 A;  3P9I A;  1Y6I A;  2MYS A;  1FIP A;  3TOA A;  2KJB A;  2O9L A;  2OA4 A;  5E3N A;  2VN2 A;  2EZH A;  1FOX A;  2XGD A;  1ZEL A;  5E17 F;  2DFF A;  3KLO A;  1XGN A;  2O0Y A;  1QZE A;  2ZXJ A;  1QVT A;  1Z1D A;  1F9N A;  3CJT B;  3FWE A;  4S0H B;  1A36 A;  4AVZ A;  1WGX A;  2Y9Y A;  3KZZ A;  3VFZ A;  4F52 A;  4NC7 A;  5GP9 A;  4PJJ A;  3V8J A;  2VXD A;  5C4J J;  2VON A;  1DDN A;  2E60 A;  4LMY A;  2Q0O A;  1YO5 C;  1R23 A;  3B6C A;  4W1U A;  3LWF A;  3GTM J;  3UNG C;  1O7F A;  5CXG A;  1MH3 A;  3BR1 A;  3P9T A;  3JCU C;  2EWN A;  3OYM A;  3FXK A;  5F04 A;  3O2P E;  3H36 A;  4UVC A;  2CO5 A;  3QYE A;  3HTJ A;  5FLV A;  1ZGJ A;  4GFK A;  5EFY A;  1A5J A;  3RJP A;  3L2V A;  2O5R A;  5LGT A;  2FQ4 A;  2IA0 A;  4XOR A;  3VYT B;  3MZY A;  1GT0 C;  3QKX A;  2MD0 A;  1O7L A;  4U9N A;  1Z0X A;  5D5X B;  4IF4 A;  4EJO A;  4L0Z B;  4KIS A;  2JWT A;  4A6D A;  1VQ5 I;  2CGP A;  2IJL A;  1V5E A;  2EFN A;  2W57 A;  3C3W A;  1ZR2 A;  3TL4 X;  3E7Q A;  1MJB A;  2MBF A;  3CC4 I;  3I54 A;  2VAS A;  2FE3 A;  3WTW C;  4C2U A;  4A3I J;  1MBH A;  2Z9O A;  5J40 A;  2LY2 A;  3F9K A;  3V8L A;  2V79 A;  3C1D A;  2VC0 A;  1D5V A;  2ZSI B;  3QPH A;  4A6E A;  4BE0 A;  2DOE A;  4L9N A;  2Z3Y A;  3NQO A;  2DW4 A;  2V9V A;  3HB9 A;  1LEA A;  3HOU J;  4HLX A;  4Y7N J;  4P5O A;  2M30 A;  3OYA A;  3S3O A;  3K69 A;  5ICE A;  3P5J A;  5LBQ A;  4A3D J;  3C2B A;  4C30 A;  3KYC B;  3O60 A;  4IJA A;  2LR8 A;  4DIQ A;  3JRB A;  2D6Y A;  3IKT A;  3NWT A;  3CP8 A;  3F8B A;  2GA1 A;  3QP6 A;  3CUQ A;  3WE2 A;  3WU2 C;  1M1E B;  5F0F A;  1MD0 A;  4LG0 A;  2L4M A;  2D1H A;  4BAY A;  1FLI A;  1S6L A;  5BQT A;  1U8R A;  3RI4 A;  4GXO A;  3LSK A;  1MJA A;  1PVE A;  1HA8 A;  5K7F A;  2XRN A;  2Y0M A;  4IHV A;  1XSD A;  3G4S I;  1R22 A;  1MGT A;  4GCV A;  5DM7 F;  3PO3 J;  3GCM A;  3OYC A;  3F6O A;  3ASO H;  1OMI A;  1S5L C;  4FX4 A;  5E1Z B;  1JE8 A;  3S1Q J;  3SJM A;  1JTY A;  3AG1 H;  4RA2 A;  1L0O C;  3PFI A;  2LF8 A;  2RAE A;  2O6G E;  4DZJ A;  2M1B A;  3HZJ A;  2MAB A;  3BJ6 A;  1HW1 A;  1I3Q J;  2L01 A;  3BP8 A;  1MDM A;  4E7L A;  3Q3S A;  2W25 A;  1KU2 A;  1WFX A;  2F2E A;  4XRS G;  4ASN A;  4QSH A;  4CCN A;  3PSI A;  4KIB A;  2DU9 A;  4EJU A;  2F5C A;  2OPT A;  5D4R A;  4I0B A;  2E71 A;  3C7J A;  3E97 A;  5D18 A;  1I6X A;  1OCT C;  2CUE A;  5ED4 A;  3FRQ A;  1DU6 A;  3D5R C;  3CJQ B;  1W36 C;  1MND A;  2E7X A;  2L9S A;  3RKY A;  4DYC A;  1IUF A;  3L9F A;  2IS6 A;  5ILU A;  1FJL A;  2MA3 A;  2R3S A;  3BQY A;  2HR3 A;  3OIP A;  1V55 H;  1OJL A;  1FYK A;  4AC6 A;  5FFX A;  4LIT A;  2FD5 A;  1GVD A;  2R7O A;  2FBI A;  4HLY A;  2P6S A;  1VQ7 I;  2E34 A;  4A0Z A;  3HTA A;  1MSE C;  2IGN A;  1W5C C;  1WJB A;  1R6R A;  2OF7 A;  2P0W A;  1RKW A;  4IQJ A;  4NC6 A;  3HTH A;  4M9X A;  5FRM A;  1OYI A;  1SFU A;  2Q1Z B;  2JSC A;  3C2H A;  3Q0U A;  3P9C A;  3SXY A;  3DEW A;  1UHS A;  3V7S A;  1WJE A;  4UB6 C;  4RM2 A;  4KMF A;  5BS6 A;  5CVR A;  4FHT A;  3ASN H;  2CQX A;  3CCV I;  4P9U A;  1I1G A;  2H09 A;  1BOB A;  2DG7 A;  1E2X A;  3OOP A;  2WAQ N;  3SFZ A;  1MBK A;  2G7G A;  3COL A;  3S5R A;  2CV2 A;  3G1M A;  2HDC A;  2BHY A;  4HV6 A;  1E3H A;  3FXM A;  3ZMT A;  1ETO A;  2H6C A;  1UI5 A;  6PAX A;  4LG0 B;  2JSP A;  1LFP A;  3BJO A;  1VFC A;  1XPX A;  2RNG A;  3JAM Z;  3MAJ A;  2I8D A;  4N4O B;  5B1A H;  1I3A A;  1R71 A;  1Y56 A;  4AC0 A;  3FIW A;  3RD3 A;  3HUG A;  3LSJ A;  1WJF A;  1XGM A;  3LSM A;  3ZXS A;  3HYI A;  4CUG A;  1YOV B;  3SZT A;  1XB4 A;  1X3W B;  2FX0 A;  3MNL A;  2GFN A;  5DD8 A;  4BDY A;  1OIS A;  2XKP A;  3RKX A;  3CF2 A;  3HKZ A;  2R93 J;  4XSX F;  2FEZ A;  3BY6 A;  1XMA A;  4U9L A;  3DPL C;  5D8L B;  1ZAR A;  4L9J A;  1SGM A;  1UHM A;  1AKH B;  4AYB A;  3I4M J;  2EFO A;  3HOS A;  3KIO A;  2KHM A;  1APL C;  2E35 A;  3E7L A;  1LFB A;  3BRU A;  1NG7 A;  3K1M A;  1PP8 F;  4G12 A;  1XSX A;  4JK1 X;  2DA6 A;  5GAD J;  3GZI A;  1I27 A;  3HSE A;  4ACI A;  1DPU A;  2DA1 A;  3BR5 A;  3F6V A;  4ZDO A;  3O6B B;  2BY3 A;  1BJA A;  5F6F A;  4F91 B;  4RB3 C;  2IU5 A;  2VBW A;  3ECO A;  1BOA A;  4HQE A;  5FKO A;  3WGI A;  1H8A C;  4LK0 F;  3RQI A;  3U21 A;  4MNU A;  3GO5 A;  3BG3 A;  2ESN A;  4G7H F;  2KMU A;  5EYR A;  2VQH A;  2AO9 A;  4AD9 A;  5LLQ A;  2QA4 I;  1W7P A;  2WA0 A;  3R0J A;  4HX4 A;  4N9H A;  5E79 C;  2NOJ B;  2IGK A;  4XL9 A;  3SWH A;  4BXX J;  4JBA A;  1MMG A;  5C44 J;  3SHF A;  2B63 J;  5H9T A;  4PSW A;  2VL8 A;  1D0Y A;  3HIF A;  3V8K A;  1H88 C;  2LH9 A;  3MEX A;  2FUG 2;  3HGY A;  1UEL B;  4M9Z A;  5DUI A;  4ZH4 F;  1YW8 A;  3MKL A;  2KIU A;  2WWY A;  2PJR B;  2R7F A;  3GTP J;  4A12 A;  3ULQ B;  5K5Q A;  3ABM H;  3RSN A;  4ITV A;  1ZRF A;  4MEX F;  3F8F A;  2QQ9 A;  2V9P A;  2YX7 A;  4AF5 A;  1YTY A;  4DQ2 A;  3EUK L;  5FGL A;  5F64 A;  3VOE A;  5D5W B;  2KZV A;  2DBB A;  3K1P A;  1FBQ A;  1BR4 A;  1TWC J;  4OIQ F;  3K0L A;  3A02 A;  3P9K A;  3DCF A;  4PJL A;  4ENK A;  1U6G A;  2XPV A;  2XGE A;  3M9A A;  4BGD A;  4A3M J;  2RGV A;  5D8K B;  1MDM B;  1MH4 A;  2GQQ A;  3IAS 2;  2JUC A;  1YG2 A;  1Z3Y A;  3BPV A;  3CDH A;  3JRA A;  1MZB A;  1WI9 A;  1GXP A;  1X2M A;  2LF7 A;  3G6E I;  1U3E M;  4C9Y A;  1FNN A;  4LB6 B;  1MJ9 A;  1XGS A;  1OQY A;  3NEU A;  3HSR A;  2M7A A;  1W4M A;  2JA7 J;  1I39 A;  3L1P A;  1ULY A;  2KPM A;  4KA4 A;  4NN1 A;  3B81 A;  3DEU A;  4Y33 A;  3VW1 A;  2IAI A;  2FXA A;  4C2T A;  4GFL A;  1X1D A;  4II2 A;  1D8J A;  3MVP A;  1T56 A;  1Y1V J;  4M3D A;  3MWM A;  4XN3 A;  3RQ4 A;  2OU2 A;  4E70 A;  2BHZ A;  3SZP A;  1PDN C;  4HF1 A;  2DMN A;  2EZL A;  1O4X A;  1FX7 A;  3K70 D;  3GME A;  5B3S H;  1YIT I;  3DKY A;  4WXH A;  3MCZ A;  2VOO A;  3K4B A;  1ZYR F;  3ISP A;  3OL3 A;  2DA3 A;  2G3B A;  2WGB A;  2JK3 A;  4PJN A;  2A6T A;  1GUU A;  4HST A;  1OCR H;  3ONQ A;  5ERI A;  2EV0 A;  3B73 A;  1IV6 A;  2KFD A;  4MO7 A;  3FHN A;  5A2Q K;  1HDD C;  2CRG A;  3GX4 X;  1S29 A;  2F48 A;  3MFK A;  4L62 A;  2C6Y A;  2XF5 A;  1A35 A;  3I5U A;  1YS7 A;  3HRU A;  1LFU P;  1XCB A;  4JX6 A;  2XUB A;  3FKI J;  2ZME C;  1IG7 A;  4YII A;  5DCM A;  3TDU C;  2VJ4 A;  3DKX A;  2Y31 A;  3ABK H;  1G3S A;  2GOX B;  1JT6 A;  1XDU A;  3DLA A;  1WI3 A;  3OYN A;  2E1N A;  2W1O A;  4A0Y A;  4BAC A;  3IC7 A;  1Z91 A;  1WSU A;  4B44 A;  2NP3 A;  3LFK A;  3H5A A;  2EA2 A;  4L0Y B;  5LHH A;  2KIM A;  3BRO A;  2EIJ H;  4IL6 C;  2XF6 A;  5E8I A;  2LKP A;  2MGQ A;  4RMN A;  2PJP A;  3DXJ F;  3ZQF A;  4PGG A;  3IH4 A;  4Y4R A;  2QKM B;  1J59 A;  5IT9 K;  3KPH A;  3RKW A;  2CW0 F;  1P92 A;  2DMP A;  1FC3 A;  5DYM A;  2CJJ A;  3HXL A;  1WJD A;  4WCG A;  3OYF A;  5JI6 A;  2GXA A;  4RBO A;  4MTD A;  1FEX A;  1T2K A;  3GVA A;  2ZBK A;  2YVE A;  3FK7 A;  3QPS A;  1JJ6 C;  3K2A A;  5EZG A;  2P5V A;  1JT0 A;  3GZN B;  2DT7 B;  3HPG A;  4R8H A;  5EEG A;  2ZCN A;  3IAM 2;  1XD7 A;  2HQN A;  3BJA A;  3ROU A;  2DG8 A;  2V1D A;  3RIR A;  4JNN A;  1LDK B;  4GRI A;  2R7V A;  1YRN B;  2STT A;  4BBR J;  5HLH A;  3HHG A;  1KYW A;  2YR2 A;  1FY7 A;  1U9N A;  3BTL A;  3K10 A;  1J0R A;  1YX5 A;  2Y2Z A;  4M6Y A;  4BHC A;  1HQC A;  5GTH C;  4HNU A;  5CJ9 A;  3OYB A;  2R0Q C;  4G7Z F;  2E2I J;  2JA8 J;  4U0W A;  2N8G A;  2XGX A;  1BJZ A;  3H35 A;  4ZZL A;  3CMA I;  3V78 A;  4A3E J;  4KT6 A;  1BA5 A;  1Q1V A;  4KIG A;  1K83 J;  3H0D A;  4Y17 A;  5CVU A;  4BXU A;  4E7H A;  2BXZ A;  4WX9 A;  1H9T A;  2QQ8 A;  5HLG A;  3CJN A;  2DYS H;  1XCV A;  3DQV C;  2EV6 A;  3MMY B;  2ESH A;  4A5N A;  1J5Y A;  4KIF A;  3W2A A;  4W97 A;  2L7Z A;  2QKL B;  3GEZ A;  1WHU A;  2CQN A;  1RC9 A;  2HTJ A;  4GYG A;  4BS9 A;  3QPL A;  2IPQ X;  2CQK A;  2JZY A;  4EM1 A;  3PNY A;  3PL8 A;  1ZH5 A;  2KRC A;  3HOV J;  1WPK A;  4PSX A;  3T8R A;  3PIP F;  3ZQI A;  4U7D A;  3PUB A;  4M6V A;  1QPI A;  1FTZ A;  4ZC3 A;  4S05 A;  2OI8 A;  1UZC A;  4HRI A;  4UUS B;  3ZR8 X;  2FQ3 A;  2QCO A;  1YQA A;  1VF9 A;  4ZDP A;  2OZU A;  2FNP A;  2PLY A;  1Y8Q B;  2E1M C;  3OL4 A;  3ZQ7 A;  3HJE A;  3QOP A;  2ZY9 A;  1YHQ I;  2GM4 A;  2ZCW A;  3ML6 A;  1QO0 D;  4HYE A;  3IUV A;  3ESW B;  3HTU A;  1S3J A;  2M4K A;  4V19 K;  4ME9 A;  3RZO J;  1HST A;  1FMW A;  4JP0 A;  3VUQ A;  2IGM A;  1T38 A;  4PJM A;  3MKZ A;  3ZQC A;  2F5E A;  2L0K A;  2EA4 A;  4IHY A;  4B48 A;  5H20 A;  4XN0 A;  1GXQ A;  3R60 A;  5D19 A;  3CF5 F;  1ZR4 A;  4AIK A;  2CU7 A;  2M8G X;  5LFA A;  4O5V A;  5DTD A;  3M8F A;  2ZC2 A;  4YG2 F;  4FCY A;  4NBQ A;  2R5Z B;  1I1S A;  2LY9 A;  2QGU A;  1QRY A;  5GAH J;  5JR3 A;  2DOD A;  1ZGA A;  4LFU A;  2KKO A;  5AIP A;  2ZJR F;  3RPU D;  5HSZ A;  3EDP A;  2CYY A;  3ABT A;  2HZD A;  2JQ7 A;  3M1E A;  1AU7 A;  4FT8 A;  5BOX A;  1XDS A;  2HQ5 A;  3ZGK A;  5LRR A;  1IN4 A;  3HIM A;  3DKW A;  4XR6 A;  1S8N A;  2ID6 A;  3NRV A;  1XG1 A;  5LGN A;  3BTC A;  3LNQ A;  4IRV A;  3OIQ A;  1LB2 A;  1KU9 A;  2CFO A;  1R36 A;  2QIB A;  2EPF A;  1U2W A;  2YX4 A;  3DU5 A;  2OTJ I;  2NVY J;  1H0M A;  3NI7 A;  4HZF A;  1VQK I;  2G7H A;  4HA8 A;  1BN5 A;  2G9W A;  2CUJ A;  1ETW A;  1FP2 A;  2R7D A;  3C18 A;  3CCS I;  3PJR A;  1O3S A;  5J4V A;  5J1U A;  3LQR A;  1HC8 A;  2QKO A;  1EV7 A;  4CCK A;  3HKZ N;  2YUS A;  1Y0U A;  4BDZ A;  2L9V A;  4FQG A;  3G56 A;  4YIR X;  5F0C A;  3ELK A;  4B09 A;  3E0J B;  3V6G A;  4DNC A;  2QSG X;  4OWR B;  2BW3 A;  1LE8 A;  3F21 A;  1F1Z A;  4ZYA A;  3CUQ B;  5J4Y A;  3B6A A;  4S04 A;  5EF6 A;  2P7C B;  3DV8 A;  3GFL A;  1JUS A;  2M45 A;  3ABU A;  5D1R A;  3JAM K;  2X48 A;  2Q2E B;  2QQB A;  2HVS A;  2PBI A;  3QRF F;  3ON4 A;  4Q5S F;  2H6B A;  1GDT A;  2M5W A;  4KFC A;  2K9N A;  2DJI A;  4L9T A;  5DEQ A;  5IY5 H;  3J7Y J;  1UI6 A;  2TRT A;  3CD6 I;  4EV0 A;  1K78 B;  2NXN B;  5KAI C;  4CIC A;  5L3G A;  3Q5F A;  1ZGW A;  5M5W J;  1KQ8 A;  3UR3 C;  2B9S A;  2BGC A;  3A4C A;  3REO A;  4IEJ A;  2A69 F;  3ZP5 A;  4BEH A;  4CGZ A;  1D0Z A;  3IWF A;  4MFE A;  2UXH A;  4NQW A;  4EVI A;  1DGR M;  1MMD A;  3J7A Y;  4HPQ A;  2LC2 A;  1ZRD A;  2CFX A;  2LSO A;  4A3J J;  1NTC A;  1IXR C;  3R4K A;  4HNT A;  3N97 A;  3TQN A;  4Y52 J;  1BM9 A;  1SAX A;  4FE4 A;  5LEJ A;  3LAP A;  4JKZ A;  1PUF B;  1X1A A;  4RGX A;  5HS8 A;  2CS3 A;  3GFJ A;  4PXI A;  2ECB A;  2VBZ A;  1ZG3 A;  1SVM A;  1T98 A;  5J1R A;  2QVO A;  5HDN A;  3GEU A;  1G2H A;  4HQM A;  3EUP A;  3BWG A;  4I7H A;  2JA6 J;  3QQA A;  2F4M B;  3K4N A;  1LVK A;  1JGS A;  2EIN H;  3T0Y A;  2DT5 A;  2HOA A;  2EV5 A;  2LD5 A;  3I3L A;  3M8J A;  4XRM A;  3TOB A;  3KKD A;  4CCJ A;  5CQG A;  3ANP A;  4MGR A;  3GBG A;  2WB1 N;  3HSF A;  4QPQ A;  2RC4 A;  3KEQ A;  5GTI C;  2FOK A;  1TW2 A;  2HOS A;  2V6E A;  4V2F A;  3O8G A;  1IN6 A;  2LLK A;  4XOP A;  1T0F A;  2D5V A;  1D5Y A;  2KDO A;  3JRF A;  1LUJ B;  1YJW I;  3BCA A;  4RB1 A;  5FKM A;  5K5R A;  3G1O A;  2YSR A;  5EGO A;  3J81 Z;  4UY8 I;  1X3Z B;  2DK8 A;  4J19 A;  4BY1 J;  3ZMU A;  2RKH A;  3S8P A;  1U5T B;  4CGR A;  1EH7 A;  2GXG A;  3W3C A;  1ETX A;  3VVZ A;  1JI8 A;  4U87 A;  4Z2Y A;  2VKE A;  3JRH A;  3BG6 A;  3DTE A;  5E3L A;  1EJ9 A;  3CC2 I;  4G6T B;  2J5O A;  5IOZ A;  1FSE A;  4YEL A;  2LTP A;  2O8X A;  3U1D A;  5CVJ A;  3WTU C;  1HBX G;  3GFI A;  1TP4 A;  4B47 A;  1ZN2 A;  3LSI A;  3JRG A;  4NDL A;  2EFP A;  2LRD A;  3Q0W A;  2BVM A;  2IRF G;  4KT5 C;  2BY2 A;  2Y9Z A;  3GW2 A;  4BQQ A;  3CMY A;  1VND A;  4CYC A;  1SVO A;  2JTV A;  2LVS A;  3KZY A;  5IYC J;  3H9G A;  3OOU A;  5D5U B;  4UUT A;  4FTH A;  1MMS A;  4NC8 A;  4MTE A;  1WVR A;  2HYG D;  4A2U A;  1R5I D;  3OYK A;  3NAR A;  1MBG A;  1BI3 A;  4ABZ A;  4E7Z A;  2VE8 A;  4KYW A;  1OLT A;  5BPI A;  2GUH A;  1QVU A;  2ZME A;  4LLL A;  3TMO A;  1XTA A;  4AYB N;  1JHF A;  2K86 A;  4XLE A;  3RYP A;  3GFM A;  2OJE D;  4CA0 A;  1ITY A;  3E6B A;  3CCE I;  3KP2 A;  1S7E A;  1JKQ C;  2XDV A;  2Y48 A;  1CF7 A;  1OR7 A;  3LAJ A;  2FSW A;  2H8W A;  4B4C A;  1REP C;  5FB2 A;  4M74 A;  1YS6 A;  5HS7 A;  2ISZ A;  1ETV A;  2PG4 A;  2R7Q A;  3BCB A;  5K58 A;  3ZRG A;  4JX4 A;  3DWL E;  4AVP A;  3N4M A;  3SFI A;  1JUM A;  4RS8 A;  5HLT A;  4CYC B;  1RUO A;  3E5U A;  4EAT A;  2COM A;  1FWZ A;  1UHW A;  4Q4Z F;  1KON A;  3HUG B;  4L18 B;  2RNJ A;  4N0B A;  1GV5 A;  5BNG A;  4O6J A;  1Y0N A;  2P8T A;  2WY7 Q;  1UG0 A;  1MMN A;  2OQG A;  1PYV A;  1YRN A;  4I01 A;  1MW7 A;  2X1E A;  2YVX A;  2DTR A;  2ZFU A;  3C07 A;  3VYS B;  1YW9 A;  4RGU A;  2BBY A;  3OV8 A;  4BBS J;  3FMS A; 
#chains in the Genus database with same CATH homology
 1XS9 A;  3NXC A;  3F1B A;  2E1O A;  2QF7 A;  3S15 J;  4AF5 A;  5JLX A;  5FGL A;  3S1M J;  2XGC A;  2HYT A;  3AQS A;  4MLO A;  3VVX A;  5DAJ A;  1TWC J;  1MNM C;  3A02 A;  1IRZ A;  3CDL A;  3BJB A;  3DCF A;  4JX5 A;  5EZH A;  2COB A;  2XPV A;  2XGE A;  3TP3 A;  2HXO A;  4A3M J;  2G0E A;  3JRC A;  3MN2 A;  4MFD A;  1MH4 A;  1R9T J;  2X9D A;  1JTX A;  3KZ9 A;  3CWR A;  4KWA A;  3S2H J;  2R5Z A;  4IHX A;  3JRA A;  2WUI A;  2EZK A;  2ZB9 A;  2M2E A;  3O8H A;  1X2M A;  2VUM J;  3S16 J;  3S2D J;  1IJW C;  3QBM A;  3GTQ J;  1TWF J;  5J1Y A;  5IOY A;  1ZTR A;  3A01 B;  1IDZ A;  1RKT A;  2AHQ A;  5F0H A;  1B72 A;  5HBU A;  2M9H A;  2DA7 A;  3L1P A;  1DU0 A;  2JA7 J;  4NN1 A;  3B81 A;  4ICH A;  3KKC A;  1BW5 A;  3VW1 A;  2IAI A;  1I6H J;  1AHD P;  4GFL A;  2XRL A;  3MVP A;  1T56 A;  1Y1V J;  4M3D A;  3RKQ A;  1X58 A;  2TCT A;  3OIO A;  4DYR A;  5EEA A;  2DMN A;  2EZL A;  1O4X A;  3PO2 J;  2JN6 A;  4XK4 A;  2CUF A;  3D1N I;  5C4X J;  4XIC A;  2K9S A;  3Q0V A;  4MK6 A;  1HLV A;  2HKU A;  1MBJ A;  2DA3 A;  2G3B A;  2WGB A;  1WCM J;  4LOC A;  2V57 A;  2JK3 A;  1GUU A;  3GTJ J;  1TWG J;  1IV6 A;  4MO7 A;  1I50 J;  1HDD C;  2CRG A;  1IC8 A;  3BCG A;  4L62 A;  1TWH J;  5CXI A;  4M3F A;  2HI3 A;  2EH3 A;  2I10 A;  2PMZ N;  2X6O A;  4I76 A;  4V2G A;  1LFU P;  4JX6 A;  3FKI J;  3LSG A;  1IG7 A;  1B72 B;  3GTL J;  5FHP A;  3H3V K;  3NRG A;  3BR6 A;  2Y31 A;  4I6Z A;  1IDY A;  4B3A A;  1JT6 A;  2NS8 A;  3S17 J;  1WI3 A;  1X2N A;  5EG0 A;  2NX4 A;  4BY7 J;  1JKP C;  4AUX A;  3GTG J;  1H89 C;  4M3B A;  2NP3 A;  1OFC X;  4L5E A;  2W53 A;  1B8I B;  3ZQG A;  2MGQ A;  2WV1 A;  1ZQ3 P;  1IGN A;  2E2H J;  3ZQF A;  5IPA A;  3HOZ J;  3IH4 A;  1A6I A;  2NVX J;  5FKN A;  1SFO J;  3BTI A;  3CCY A;  5EDN A;  2DMP A;  2CJJ A;  3IH3 A;  2UXU A;  4RBO A;  1FEX A;  2K40 A;  2MSY A;  3HOY J;  3FIS A;  2YVE A;  1T33 A;  3HTI A;  3FK7 A;  3VVY A;  3QPS A;  5GPC A;  1JJ6 C;  3K2A A;  5EZG A;  1JT0 A;  1XC5 A;  2HDD A;  1HOM A;  2PBX A;  3HE0 A;  3LJL A;  3ZQH A;  2ZCN A;  2R5Y B;  2Y0S N;  4B1R A;  2DMT A;  2ZCX A;  5IP7 J;  3HM5 A;  2DG8 A;  4JNN A;  2JMW A;  1NK2 P;  5E3O A;  1YRN B;  4BBR J;  1JKO C;  1PUF A;  1U9N A;  4HKU A;  3BTL A;  3CJD A;  2Y2Z A;  4JKZ A;  2R0Q C;  2E2I J;  2CQQ A;  1B8I A;  4C3I J;  2JA8 J;  2YVH A;  4A3B J;  2N8G A;  1BJZ A;  3V78 A;  4A3E J;  4A3C J;  3VP5 A;  1LE8 B;  2RAS A;  2DMQ A;  1U8B A;  1W0U A;  1HF0 A;  1Q1V A;  4A69 C;  1BA5 A;  1K83 J;  2M0C A;  3K7A J;  2R92 J;  1ETY A;  2K9Q A;  1BW6 A;  5HOD A;  2F07 A;  1P7I A;  2GLO A;  4A3F J;  3IV5 A;  2QWT A;  3LWJ A;  3BHQ A;  4JL3 A;  2EZI A;  4W97 A;  2L7Z A;  4D7N A;  5EGO B;  3JRI A;  5M3F J;  3QPL A;  2IEK A;  4RDU A;  2REK A;  3HOV J;  1WPK A;  2ME6 A;  3KNW A;  3ZQI A;  4C3H J;  2DJN A;  4M6V A;  1QPI A;  2MW8 A;  5DS9 A;  1ETQ A;  1F36 A;  2JA5 J;  1FTZ A;  2JJ7 A;  1ORK A;  1ZK8 A;  2OI8 A;  2PZ9 A;  5F27 A;  4UUS B;  2O7O A;  2QCO A;  1VF9 A;  3RH2 A;  5IYB J;  1FIP A;  5K7Z A;  2O9L A;  5E3N A;  3VIB A;  4C3J J;  2EZH A;  2XGD A;  1Z77 A;  3A01 A;  2GM4 A;  3BT9 A;  2NVT J;  3IUV A;  1QVT A;  3CRJ A;  4MIM A;  4XRS A;  3TP0 A;  4ME9 A;  4S0H B;  3RZO J;  4JP0 A;  1F43 A;  1WGX A;  2Y9Y A;  4UDS A;  2HXI A;  3PAS A;  3VUQ A;  3ZQC A;  5GP9 A;  2L7F P;  2L0K A;  4IHY A;  5C4J J;  4A3K J;  3GTO J;  4EEF G;  2RHA A;  5D19 A;  1ZR4 A;  2CU7 A;  2M8G X;  1MBF A;  3SDG A;  4W1U A;  3B6C A;  5DTD A;  3GTM J;  2P81 A;  2DA4 A;  2H8R A;  4IHW A;  1MH3 A;  3S14 J;  1JKR C;  3BR1 A;  9ANT A;  2O7T A;  3P9T A;  2MG4 A;  4FCY A;  2R5Z B;  2G7S A;  3S1N J;  2LY9 A;  1QRY A;  1OCP A;  5F04 A;  5AQC A;  3HTJ A;  3HBL A;  5FLM J;  5FLV A;  4GFK A;  4M3E A;  3HDD A;  5EFY A;  1A5J A;  5F08 A;  5J3L A;  1U9O A;  4C2M J;  2XSD C;  5HSZ A;  2FQ4 A;  5C3E J;  1AU7 A;  3JSJ A;  1GT0 C;  2HQ5 A;  3QKX A;  3HIM A;  3HGG A;  2ID6 A;  1XG1 A;  1Z0X A;  2XB5 A;  3BTC A;  3LNQ A;  4M3G A;  1AKH A;  2HYJ A;  2JWT A;  1ZR2 A;  2QIB A;  2E19 A;  3E7Q A;  3JR9 A;  4HNV A;  3WHB A;  2NVY J;  1RPW A;  3NI7 A;  4A3I J;  3CQZ J;  1MBH A;  3TW6 A;  3VOX A;  1HCR A;  5CXG A;  1ETW A;  3BQZ A;  3OSG A;  1U78 A;  5FMP A;  2XPW A;  2LK2 A;  4MXM A;  5J1U A;  3HB9 A;  3HOU J;  1P7J A;  2QKO A;  4Y7N J;  3HOX J;  2GBY A;  3BG9 A;  2M34 A;  4A3D J;  3HKZ N;  2YUS A;  3C2B A;  1JGG A;  4GFB A;  3G56 A;  3RZD J;  3BR0 A;  2OER A;  5F0C A;  2QTQ A;  3O60 A;  4D7M A;  3V6G A;  2LR8 A;  3S1R J;  2ZOZ A;  2R5Y A;  5IYD J;  3JRB A;  2D6Y A;  1LE8 A;  4D5F A;  5M5X J;  2H1K A;  2Q24 A;  5F0F A;  3B6A A;  4GCL A;  5EF6 A;  4DZP A;  5M5Y J;  2LKX A;  3IH2 A;  1JUS A;  1E3O C;  2O8K A;  5D1R A;  2X48 A;  2XPU A;  3ZQL A;  1JUP A;  5EG0 B;  3ON4 A;  3W6V A;  1GDT A;  5K7F A;  2K9N A;  2NS7 A;  4IHV A;  1RET A;  1UI6 A;  2TRT A;  2VI6 A;  3BNI A;  2UXI A;  3PO3 J;  1ZGW A;  3H0G J;  5M5W J;  4IEJ A;  3LSR A;  2DMU A;  4A93 J;  1TC3 C;  3SJM A;  1JTY A;  4MFE A;  3S1Q J;  2ID3 A;  2UXO A;  2UXH A;  2UXP A;  2XDN A;  3NPI A;  2DA2 A;  2RAE A;  4DZJ A;  4A3J J;  1I3Q J;  1NTC A;  4Y52 J;  1Y1W J;  5HAW A;  1EF4 A;  2L7M P;  3TED A;  5CW8 A;  3Q3S A;  4FE4 A;  4XRS G;  4QSH A;  1PUF B;  3ANG A;  1HDP A;  2EBI A;  5IP9 J;  4PXI A;  2ECB A;  1ETK A;  2OPT A;  1RES A;  5D18 A;  5J1R A;  3GEU A;  1G2H A;  3FK6 A;  5E3M A;  1OCT C;  2CUE A;  2NVQ J;  3EUP A;  3FRQ A;  1DU6 A;  5IP6 A;  3LSP A;  2JA6 J;  3QQA A;  1JJ8 C;  4YZE A;  4DYC A;  1IUF A;  2HOA A;  1POG A;  1FJL A;  2LD5 A;  3BQY A;  1OJL A;  2KDZ A;  4XRM A;  3KKD A;  4AC6 A;  1ENH A;  4BKX A;  3ANP A;  3GBG A;  2FD5 A;  2QOP A;  2WB1 N;  3A03 A;  1GVD A;  3F0C A;  5C4Y A;  3T6N A;  2GEN A;  2HOS A;  2G7L A;  4V2F A;  3O8G A;  4XID A;  1FTT A;  3EGQ A;  2LLK A;  1MSE C;  3HTA A;  2D5V A;  1D5Y A;  3LOC A;  4FIS A;  3JRF A;  1W0T A;  3LHQ A;  2OF7 A;  1RKW A;  5FKM A;  5EGO A;  3G1O A;  2ZCM A;  2R7Z J;  2NP5 A;  3HTH A;  2HOT A;  3BR2 A;  4J19 A;  2NOG A;  4BY1 J;  1K61 A;  4CGR A;  1NK3 P;  3Q0U A;  2E2J J;  1ETX A;  3VVZ A;  3DEW A;  1UHS A;  3G1L A;  2W48 A;  3VW2 A;  2VKE A;  3NAU A;  3JRH A;  2FBQ A;  5E3L A;  3HEF A;  3UKG A;  5K7H A;  2CQX A;  4UUS A;  4A3G J;  4GCT A;  5IOZ A;  1VI0 A;  2DG7 A;  2LTP A;  2WAQ N;  2IBD A;  1MBK A;  1UG2 A;  3JRE A;  2G7G A;  3COL A;  3S5R A;  3M3Y J;  3G1M A;  4A3L J;  3ON2 A;  4FE7 A;  3BR3 A;  1ETO A;  3JRG A;  4JYK A;  1UI5 A;  3G7R A;  4NDL A;  4D5C A;  3WHC A;  5F1J A;  2VPR A;  1VFC A;  3Q0W A;  1SAN A;  3ZOB A;  2Y9Z A;  2FJ1 A;  3CMY A;  1VND A;  4CYC A;  4AC0 A;  3FIW A;  3VPR A;  2DA5 A;  3RD3 A;  2LVS A;  3LSJ A;  2LFB A;  1WH5 A;  3GTK J;  5IYC J;  5GPA A;  1TWA J;  3OOU A;  4GCK A;  4UUT A;  4FTH A;  2ECC A;  2FX0 A;  3TW7 A;  2GFN A;  3DPJ A;  3MNL A;  3HOW J;  2R93 J;  1MBE A;  5FJ8 J;  3NAR A;  1MBG A;  4ABZ A;  1GV2 A;  2ELK A;  3VW0 A;  1SGM A;  1AKH B;  2XB0 X;  2GUH A;  3I4N J;  3I4M J;  1QVU A;  4AYB N;  5M3M J;  1APL C;  1ITY A;  3E7L A;  1LFB A;  1WH7 A;  2Y30 A;  3BRU A;  1S7E A;  2EQR A;  2VKV A;  4G12 A;  5JLW A;  1JKQ C;  1ZKG A;  4DW6 A;  3M4O J;  1BL0 A;  2DA6 A;  4B4C A;  3GZI A;  4NEL A;  3BG5 A;  3BTJ A;  4ACI A;  2YS9 A;  1ETV A;  2DA1 A;  3BR5 A;  1MSF C;  2L9R A;  5FKK A;  2IU5 A;  5K58 A;  4DYQ A;  3PPB A;  5FKO A;  4JX4 A;  3RQI A;  1H8A C;  1UMQ A;  2DTZ A;  3BG3 A;  3NNR A;  3SFI A;  1JUM A;  4CYC B;  5EYR A;  2AO9 A;  2KT0 A;  1RR7 A;  3PM1 A;  3AQT A;  1GV5 A;  5BNG A;  4BXX J;  1FIA A;  5C44 J;  2DN0 A;  4QIW N;  2YU9 J;  2B63 J;  5H9T A;  4X1E A;  1H88 C;  1YRN A;  1CQT A;  3OSF A;  3HGY A;  3MKL A;  2ME0 A;  4QTR A;  2LP0 A;  4X6A J;  3C07 A;  2ZOY A;  3VOK A;  3JRD A;  3GTP J;  5FKL A;  4BBS J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...