4JYKA

Structure of e. coli transcriptional regulator rutr with bound uracil
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
201
structure length
201
Chain Sequence
RSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
publication title Structure of E. coli Transcriptional Regulator RutR with bound uracil
rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 77
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4jykA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jykA02
3BTIA 2JA6J 4IHYA 4DYQA 4MFDA 3C2BA 1JTYA 4I76A 2Y9ZA 1ZGWA 5M3FJ 5E3NA 1IJWC 2VPRA 2R5ZA 4V2FA 2GM4A 2WB1N 2CU7A 5FJ8J 5EDNA 2JA7J 4G12A 3TEDA 3BG3A 2QWTA 4JKZA 3H3VK 2R5YA 1D5YA 2ZOZA 2NS7A 1U78A 1MBFA 3HTAA 3EUPA 5FKMA 2P81A 2W48A 2QIBA 2YVHA 3QBMA 1QVUA 4GFBA 5F0FA 1ITYA 2XB5A 3V6GA 3AQTA 1WGXA 3G56A 1JUMA 3CQZJ 3FRQA 1I50J 2JA8J 3PASA 4MFEA 5EYRA 2H1KA 2AO9A 3ON4A 3S16J 1DU0A 3E7LA 3VPRA 1JT0A 2N8GA 5IPAA 3GEUA 4D5FA 3NAUA 2DA5A 3B6AA 2HOTA 3GTPJ 3G7RA 1RESA 3JRBA 5J1RA 3S1RJ 2JWTA 2XGDA 2TCTA 3O8GA 1TWCJ 3ZQHA 4GFLA 2LP0A 3BR2A 2K9NA 4A3IJ 2GENA 4XICA 3OSFA 2QOPA 1PUFA 1WI3A 1XC5A 2LD5A 2EZKA 2Y2ZA 1QRYA 4M3DA 3CJDA 3TW7A 2R92J 4C3JJ 3JR9A 4Y52J 2EBIA 4AC0A 3VVXA 2EZLA 2FX0A 5J1UA 5JLXA 3GTQJ 4M3FA 2PZ9A 1OFCX 1JUSA 4ABZA 4W1UA 2GUHA 5BNGA 3O8HA 3VP5A 3B81A 3RZDJ 5IP6A 4CYCB 3JRFA 1QVTA 1GDTA 3D1NI 4BBSJ 1VI0A 4ICHA 5C4YA 1LFBA 4MLOA 2XPUA 3GTJJ 4B4CA 3TP0A 1MSEC 1FIPA 2O7TA 2YUSA 1U9OA 5EZGA 1A6IA 3HGGA 4GFKA 2FD5A 2X6OA 1UHSA 4FTHA 3TP3A 1A5JA 1ETYA 2HXOA 3GTMJ 4A3KJ 1BW5A 3HE0A 4MO7A 2B63J 3A01B 5D19A 5DAJA 2DJNA 2XB0X 2E2HJ 4NN1A 2ME0A 4D5CA 5M5XJ 4M3GA 2M9HA 3BTJA 1Z0XA 3MKLA 2ZCXA 3GZIA 1EF4A 3KZ9A 5IOYA 4CYCA 2K40A 3ZQGA 4AF5A 2KDZA 3S2DJ 2M34A 2MSYA 4UUTA 3S5RA 5C4JJ 2ECCA 3LNQA 1JKQC 3LSPA 3JRHA 2REKA 2AHQA 1OCPA 2D6YA 2RASA 1ZR4A 3NXCA 1IV6A 3LSGA 3S1NJ 3S14J 1RKWA 3FISA 4Y7NJ 3V78A 3M4OJ 1FIAA 2LLKA 3NARA 2R5YB 2NX4A 3ZQCA 3ANPA 5FGLA 5E3LA 3Q0WA 1X2MA 3IUVA 1B72A 4RBOA 2G7GA 2F07A 2ID3A 2OERA 3VW0A 1SGMA 4A3MJ 2XPVA 1S7EA 3GTOJ 3JRDA 1UMQA 1MNMC 1SANA 3HBLA 2ZB9A 4W97A 2M8GX 3K7AJ 3MN2A 3RKQA 1ETVA 1OJLA 3RD3A 5GP9A 4A3EJ 3A02A 1AHDP 3LWJA 1NTCA 3HOYJ 3BQYA 3IH4A 3VIBA 5F08A 2O8KA 3WHCA 2G7LA 4HKUA 5EFYA 2DMTA 5HBUA 1JKPC 5F1JA 1ENHA 3LOCA 1ZR2A 2DMNA 4UDSA 4BKXA 3QKXA 2Y31A 3VOXA 1FTTA 5K7ZA 2X9DA 5DTDA 3PPBA 3ZQFA 3ZQLA 5M5YJ 1RETA 1X2NA 1IDYA 3VVYA 1PUFB 4JP0A 2NVQJ 3BNIA 1F36A 5HODA 2OI8A 5GPCA 1ZTRA 4FISA 3GBGA 3BR6A 1NK3P 2JN6A 4RDUA 3HIMA 2M0CA 4DZJA 2HI3A 2PBXA 4A93J 2JMWA 4EEFG 1DU6A 2DTZA 2WV1A 3LJLA 2CUEA 2HQ5A 3QQAA 1U8BA 4BY7J 3KNWA 3KKCA 1HDPA 2CJJA 3DCFA 2R0QC 4HNVA 4XIDA 2ZCMA 4FCYA 4ACIA 1IUFA 3JREA 2UXHA 3CWRA 2MGQA 3BRUA 2QKOA 1K61A 5D18A 3RH2A 2ECBA 3I4NJ 3JRIA 1ZK8A 3NPIA 3GTLJ 3C07A 2GLOA 3SDGA 1G2HA 1RPWA 2JJ7A 4BXXJ 1TWAJ 1LFUP 2OF7A 2LTPA 3BQZA 3HEFA 2DA6A 2E19A 1FEXA 2EZHA 2TRTA 4X1EA 2ME6A 5F0CA 1HDDC 2CUFA 2COBA 2GFNA 5E3MA 5C4XJ 4B1RA 5CXGA 5IYBJ 4BY1J 3F0CA 3K2AA 1UI5A 2HDDA 1I3QJ 1U9NA 4DZPA 3T6NA 1AKHB 1VF9A 3BG5A 2G7SA 2UXOA 3I4MJ 5AQCA 1T56A 2CQQA 1ORKA 3OIOA 1ETKA 3WHBA 4QIWN 2NP3A 3VUQA 4PXIA 4NELA 3GTKJ 2QTQA 5EZHA 1B72B 2WGBA 2DG8A 2ZOYA 1MBEA 2OPTA 1T33A 2K9QA 2FJ1A 5FMPA 5IP7J 1AU7A 1POGA 3LSRA 4XRSG 5IOZA 3JRAA 5FHPA 1OCTC 3OSGA 3VOKA 1TWFJ 1FJLA 3BHQA 1VNDA 4D7MA 1HCRA 2XSDC 3P9TA 5JLWA 1VFCA 1HF0A 1AKHA 3HTJA 4XRMA 1UG2A 3VW2A 1Y1VJ 2DMQA 2I10A 2DA4A 3JRGA 5FKKA 2DA1A 1O4XA 2DG7A 4QTRA 1X58A 2G0EA 5EF6A 2VI6A 2W53A 3ZOBA 3BR3A 1MBKA 4GCTA 1I6HJ 2HYTA 4UUSA 5CW8A 2DA3A 3B6CA 1WH7A 3BR0A 9ANTA 5IYDJ 2LFBA 5EGOA 3FIWA 2UXPA 4DW6A 4D7NA 2YU9J 1IDZA 4C2MJ 4MIMA 1TWHJ 3HOVJ 4B3AA 1W0TA 4FE4A 1GVDA 3OOUA 5C3EJ 4I6ZA 1BA5A 4GCKA 3E7QA 2Y0SN 3PO2J 1MH3A 3HM5A 5D1RA 3JSJA 4IHWA 3S1QJ 2L7FP 2NS8A 2NVXJ 1GV2A 1MH4A 3BR5A 4MK6A 3G1MA 3IH2A 5F04A 2DA7A 4M3BA 2XRLA 2DMPA 2GBYA 5F27A 2JA5J 5E3OA 2LR8A 3G1LA 3VVZA 1FTZA 3HTHA 2E2JJ 4A3DJ 5EG0B 4NDLA 1JT6A 1XS9A 2H8RA 4C3IJ 4BBRJ 2UXUA 1JTXA 3FKIJ 2UXIA 2RHAA 2WAQN 3SJMA 1LE8B 2IBDA 3DPJA 3L1PA 2E1OA 2NP5A 2VKEA 3HOWJ 5K58A 2Y30A 1YRNA 2FQ4A 1RR7A 3BCGA 3CDLA 3Q0UA 2O7OA 2VKVA 2FBQA 2NVYJ 3HKZN 5EEAA 1APLC 2EH3A 1K83J 3HTIA 3HGYA 3Q3SA 2QCOA 4KWAA 1BW6A 2XDNA 2HKUA 2IEKA 3JRCA 3RZOJ 2R93J 5EG0A 5IP9J 4A3LJ 3NNRA 3QPLA 5K7FA 1BJZA 3FK7A 1H89C 1JJ6C 3NRGA 4AUXA 3F1BA 1UI6A 1ETQA 3EGQA 4QSHA 3S15J 4DYRA 1LE8A 3BTLA 3HOZJ 3ANGA 2ELKA 2YS9A 1P7IA 3BR1A 3BJBA 3CRJA 4JX5A 5K7HA 1TC3C 2EQRA 1ZKGA 2Y9YA 3S17J 4AC6A 1R9TJ 2HXIA 3Q0VA 3W6VA 2R7ZJ 1MBHA 3LSJA 2XPWA 2L0KA 1WCMJ 2LVSA 3PO3J 2G3BA 5M3MJ 2MG4A 5FLVA 2EZIA 2WUIA 2XGCA 4A3CJ 1IRZA 4CGRA 3RQIA 4X6AJ 4C3HJ 2K9SA 3BTCA 2QF7A 3IV5A 1GT0C 1JUPA 2NVTJ 2E2IJ 3O60A 2NOGA 5HSZA 4FE7A 4JX4A 2JK3A 2LY9A 5DS9A 1P7JA 2PMZN 1E3OC 1NK2P 1QPIA 2O9LA 4JNNA 1HOMA 5F0HA 1BL0A 4L62A 2YVEA 1B8IB 2Q24A 2M2EA 4IEJA 1IG7A 3MNLA 1JKRC 2RAEA 3AQSA 3ZQIA 5M5WJ 1JJ8C 3H0GJ 1ETOA 3PM1A 4UUSB 1Y1WJ 4AYBN 3CMYA 3QPSA 2IU5A 2DN0A 5EGOB 2KT0A 3ON2A 5J1YA 2CRGA 1MBGA 1IGNA 1WPKA 3KKDA 4ME9A 2L9RA 3VW1A 1MBJA 2DA2A 1GUUA 4A3GJ 1W0UA 3TW6A 5FLMJ 4A3FJ 1ETXA 1CQTA 1ETWA 2D5VA 4JX6A 2IAIA 1WH5A 4V2GA 4GCLA 4JYKA 4A3BJ 2HOSA 4A69C 2DMUA 4XK4A 5IYCJ 5GPAA 5J3LA 2V57A 4S0HB 3M3YJ 1HLVA 1ZQ3P 1B8IA 4IHVA 1MSFC 1F43A 3SFIA 3A03A 3G1OA 2XGEA 2MW8A 3LHQA 1H8AC 1Q1VA 1Z77A 5FKLA 3HOXJ 1TWGJ 1XG1A 3S1MJ 3MVPA 2LKXA 5CXIA 3DEWA 4L5EA 2L7ZA 3HOUJ 3HDDA 3IH3A 2X48A 2R5ZB 5H9TA 2HOAA 1JKOC 4M6VA 5FKNA 3FK6A 2LK2A 1GV5A 3BG9A 4MXMA 4IHXA 2HYJA 2CQXA 4M3EA 4J19A 3UKGA 1YRNB 3A01A 1IC8A 5C44J 3S2HJ 3GTGJ 5HAWA 1H88C 3CCYA 4A3JJ 3COLA 2L7MP 1JGGA 4YZEA 4DYCA 4LOCA 1RKTA 4XRSA 2VUMJ 2ID6A 1SFOJ 3HB9A 3NI7A 2ZCNA 5FKOA 4JL3A 3BT9A
chains in the Genus database with same CATH superfamily
1KQ9A 3BTIA 1U6GA 4DYQA 2A68F 2DO7A 3C2BA 1JTYA 2GQQA 2Y9ZA 1HC8A 1WZ2A 1VQ7I 4DBQA 2VPRA 4V2FA 1KU2A 3HSFA 3S2WA 2DOFA 4G12A 3OYBA 2QWTA 1A35A 2Z2SB 2R5YA 4RLQA 1U78A 2XAFA 2Y48A 1Z6RA 1VQNI 2QIBA 2DW4A 2A69F 3LQRA 3DTIA 4Y17A 2XB5A 3V6GA 1U5TB 2P5VA 2NYXA 3AQTA 3G56A 1Z1DA 3CQZJ 2JPBA 2KDOA 1SEUA 4MFEA 3BG6A 2AXTC 1Y8RB 3S16J 2DI3A 3E7LA 3VPRA 4EGYA 2EA4A 1JT0A 4CXFA 2W85A 1ZLJA 2KRFA 3WU2C 3IAM2 3GLLA 3B6AA 2HOTA 3S3NA 3G7RA 3FMSA 2QQAA 2WB1A 1EH6A 5D4RA 2O6GE 1TWCJ 2ZMEC 4GFLA 4ZYGA 4KMFA 4HQEA 3I55I 4XICA 1Z6TA 2QOPA 1IO2A 3CF2A 2LD5A 1RC9A 3GYHX 3CJQB 2EZKA 5ERIA 3I9V2 2V1XA 1TQPA 4M3DA 4TV7A 3JSOA 2W7NA 1QBJA 3LAPA 4XLAA 4Y52J 4CCLA 2M3AA 1Z7LA 3CESA 3BPXA 2FX0A 3BROA 2Q0OA 3HUGB 3I64A 4QLCU 4IRIA 3S3OA 4Y13A 2Z9OA 1OFCX 2DK5A 3BDDA 5BNGA 2HVQA 3AG4H 4GXOA 3L00A 1K6YA 4CYCB 1GDTA 3ASNH 4LITA 5H20A 2OCEA 4PSWA 1LFBA 3LA7A 2XPUA 4MLOA 3GTJJ 3IP4B 4B4CA 1R1TA 4CO8A 3CCQI 4B47A 1FIPA 1LUJB 1U9OA 3FXMA 4XLFA 5L3FA 1VQOI 3L9FA 1A6IA 3HGGA 1K4TA 2BVLA 1JHHA 1Y8QB 2EK5A 4AIDA 3J7YJ 1ODDA 2H94A 3TO9A 3TP3A 2HXOA 2VQHA 3PSIA 4FX4A 2QLZA 3PQJA 5BOXA 5D19A 5DAJA 4PFOA 3QAHA 4JQFA 1W4MA 1W5TA 2E2HJ 5E1ZB 2MH9A 1LVAA 3NS4A 1D0XA 4CYDA 2M9HA 1MIJA 4GDFA 3SEQA 5E8IA 4B43A 5IOYA 4KISA 3CJRB 2KDZA 1WI9A 2KJCA 2M34A 3I53A 1QHGA 4JOMA 4RS8A 1YJ9I 2NVUB 2ECCA 3L2CA 3N4MA 1VQ8I 3P9CA 4IKFA 3JRHA 3LSMA 2RASA 2MABA 4KT6A 3S1NJ 3S14J 1RKWA 4WCGA 3M4OJ 1Y0NA 2LLKA 4U88A 3ANPA 5FD5A 2ADUA 2F5CA 2OERA 2A05A 1RRJA 3JRDA 4PJLA 1R58A 2IS2A 3HBLA 1UCRA 2M45A 2M8GX 2ZB9A 3MN2A 5FFZA 1ZG1A 1ETVA 2DYRH 2KIQA 4A3EJ 3O3KA 3C18A 3IC7A 3FKJA 1AHDP 3LWJA 1G3TA 3IAS2 3VIBA 2ZBKA 2G7LA 4HKUA 5HBUA 1JKPC 2KLOA 3HXLA 1ENHA 2QZ8A 4OU0A 3L2UA 1Y6IA 2DMNA 2W00A 2Y31A 4B8XA 5E1WA 5H6RA 2PJRB 4IQJA 3SZGA 5CJ9A 2E7WA 2Z1DA 3EQLF 1J5YA 4XL9A 4G9YA 4JP0A 2NVQJ 4UXNA 5ILSA 2RVCA 4C2MA 1UZCA 2FUG2 3BR6A 4I7HA 1Z7UA 5A2QZ 2EWNA 3HIMA 4DZJA 2HI3A 2ZMEA 3K8PC 4HSRA 1LNWA 3L7WA 3DEUA 4XLPF 4Q5SF 2DTZA 2CUEA 2LG4A 5B1AH 2R7TA 4IQ4A 1G3SA 2P7CB 3MFKA 3KKCA 1XDUA 1HDPA 2H09A 1KGSA 4HNVA 4G7ZF 4OD4A 1D1AA 3LSHA 2AQFA 5K1YA 3JREA 5ICEA 1K7AA 1J59A 3F8CA 1S3JA 5F6FA 3DPTA 4BEHA 2PEXA 5BQTA 1R5GA 1K61A 1CF7B 3TO7A 3RH2A 2V7FA 5IT9Z 2DXIA 3I4NJ 1ZK8A 2HR3A 3NPIA 3RYRA 2GLOA 4FX0A 2OA4A 3E6CC 2OF7A 3F72A 1BOBA 4QPQA 5BS6A 2EV0A 3I58A 2DA6A 2NOJB 5HNFA 1FEXA 3BJOA 1K79A 2TRTA 4RB1A 5IT9K 1X3ZB 5F0CA 1HDDC 3QU6A 2YR2A 3GWZA 5JR3A 5C4XJ 3OYKA 2YPRA 1UI5A 2LRDA 2MFZA 5DEQA 4DZPA 1C0WA 1OMIA 2HNHA 1A36A 2HTSA 2UXOA 1XGOA 2TDXA 5AQCA 1QHHD 1T56A 1ORKA 3VUQA 3WHBA 4NELA 3V8KA 3KLNA 3HZJA 2VL8A 2QTQA 5E17F 4M72A 3QYBA 3VSKA 3FXJA 3OYFA 2K9QA 2P6SA 3V8JA 2FBHA 2EFPA 1T95A 2CFOA 1MW7A 4ZDOA 1HXDA 2HYGD 5IP7J 4E7LA 1POGA 4Q48A 4XRSG 5IOZA 3LSRA 3JRAA 5DUIA 2WBMA 4RM3A 3OSGA 1J7KA 1VTNC 4D7MA 1HCRA 2XSDC 5HVQC 1OCCH 4MEYF 4A6EA 4S05A 3KCCA 1L3LA 2M1BA 1MMGA 3CMMA 1FOWA 3PUFA 5FGMA 3FMQA 1YE9A 3VSLA 1UELB 2FNAA 1P4AA 1Y1VJ 2DMQA 4HX8A 4HW0A 2VBZA 2I10A 2FSWA 3TMOA 3H0DA 5FKKA 4E7SA 4UVCA 2ZJRF 2STTA 5CVUA 2W53A 2ZNZA 3PNYA 2BY2A 2F5EA 1PP8F 1W1WE 3KZIC 3BR3A 5CKTA 2OD5A 1XMKA 2PX9A 4OOIA 3B6CA 3BR0A 1WH7A 1ZGJA 3IWFA 5KCMA 3G4SI 9ANTA 2BOLA 4AYBA 4J01A 1VQKI 2E35A 4D7NA 1IDZA 3R61A 4C2MJ 4MTDA 1TWHJ 1W0TA 2R7DA 3ZRGA 2HKOA 3E7QA 4EM0B 1P2FA 1YX3A 3F23A 4C2TA 4ZYEA 2HKXA 1FP2A 1J2XA 1WJEA 4IHWA 1FSEA 3S1QJ 2XHKA 2L02A 4UNOA 4IJAA 2NVXJ 3C2GA 1GV2A 2VE9A 3GCMA 3G1MA 2DOAA 1LB2A 2DA7A 2CW7A 3CCSI 3WE2A 2JA5J 1FTZA 2RQPA 3VYSB 1PDNC 4A3DJ 2QBYA 3J80K 4IOCF 3HTSB 1A31A 1XS9A 2CGPA 4A2UA 1IZ1A 1Y56A 2L9SA 2FA5A 3E6MA 3FKIJ 1J0RA 2WAQN 2VXDA 3L1PA 2G9WA 2FMLA 2NP5A 2Z16A 1XSVA 2UUZA 4XSZF 3HOWJ 4I0AA 3W3CA 2Y30A 1B6AA 3F21A 1RR7A 2DOEA 5LD2C 1QZZA 4QPOA 3B73A 2VKDA 5EEAA 3GFIA 1D3YA 3E5UA 1APLC 2EH3A 3KZYA 2L54A 3HTIA 2KISA 3ABUA 1JGSA 1YO5C 2F5DA 2XDNA 2CUJA 2DFEA 3F22A 3FXQA 2FNPA 4PUSA 5HDKA 4KICA 2EV6A 5DCMB 3FK7A 3MCZA 2V79A 4DYRA 1O57A 1RNLA 3H5NA 5AIQA 3BR1A 3CRJA 3PSFA 1CGPA 1H9TA 2EQRA 4HZFA 2IA0A 2IGKA 3LWFA 3BC8A 3AG3H 5D8KB 1GXPA 3WTZA 5D5UB 3TBIA 4C2UA 1YFHA 2R7ZJ 3HPHA 1MBHA 4XORA 2ZJQF 3HL2A 2IPQX 2LVSA 1IXSB 3PO3J 2MG4A 3MMYB 2XGCA 2A6EF 1U5TA 4HLXA 4CDGA 3HKZA 4E6KG 3OYNA 4A3CJ 1M1EB 4C30A 3FXRA 4ZZDA 2LY9A 3DP7A 1P7JA 1UFMA 3FMRA 3QODA 2QQBA 4KT5C 4BE0A 1QPIA 2WTEA 4II3A 2QWWA 4F52A 4UHTA 4L62A 1B8IB 2Q24A 2KIUA 3H36A 3MNLA 4YIRX 2A6TA 1IV8A 3EYIA 3ZQIA 2K4BA 1XX5A 3OS2A 4YELA 2KZVA 1G3WA 5KAFC 5CLSA 5F64A 3WODF 2EV5A 2DQLA 5EGOB 3ON2A 3GW2A 3RIRA 1W5SA 3K69A 1MBGA 2VC1A 3JTGA 4RLFA 2VT3A 2BW3B 1GUUA 3HYIA 3M1EA 4A3FJ 1CQTA 2D5VA 1ETWA 4S04A 4JX6A 3JAMK 2IAIA 1WH5A 3AAFA 2VXZA 4GCLA 3RKWA 3HUGA 1ZAOA 4A69C 4WXHA 5IYCJ 4LFUA 2HYFA 1YI2I 3M3YJ 1QZYA 2O8XA 2STWA 4IHVA 3CUOA 3A03A 4WXCA 3VDXA 3FBIB 2XGEA 2MW8A 2M4GA 2VQGA 4ESBA 3F3XA 1Z77A 2CV0A 3K1NA 3HOXJ 1TWGJ 1XG1A 2M0MA 1S7AA 1WJBA 2XAQA 3DU6A 4L5EA 1BR1A 1HSTA 2OJED 2LKXA 4X0GA 1SMYF 3IH3A 3RYPA 1EKEA 2XAJA 5DUKA 4M6VA 5FKNA 2BE5F 1GV5A 3BG9A 2IT0A 4HQMA 2CQXA 2KKOA 2FOWA 5L3BA 4U9LA 1IC8A 4KJZA 5C44J 1F1ZA 3S2HJ 1FC3A 5HAWA 3CCYA 3FXLA 2FF4A 2EFWA 2XASA 4XKWA 3V42A 4YIIA 4XRSA 1USSA 2ID6A 1XGSA 4HAMA 3SZTA 2W25A 4BGDA 1YS7A 3E6BA 4YFNF 3JSPA 2R7VA 4MFDA 1OPCA 2JVGA 4UV8A 4EJTA 4ESFA 4EJUA 4G8XA 4EGZA 3H9JA 1IJWC 2F6CA 3KZZA 3FM3A 2RNGA 2CU7A 2JA7J 2X1EA 4XKVA 3OL4A 3BG3A 4IPAA 2RDPA 3NQOA 2ZOZA 3DXJF 3BCBA 5JI6A 2P81A 2W48A 1TNSA 2JA2A 1QVUA 4Y15A 3IL2A 4GFBA 2GWRA 4OD5A 3WTYC 1I1SA 2ISYA 1WGXA 1JUMA 3FRQA 3DKWA 2LY2A 1DPUA 1YS6A 1DU0A 3Q9VA 2R7WA 1W7PB 2DBBA 2DK8A 4L9NA 1WRJA 1PJRA 2N8GA 2WY7Q 4WK8F 2H27A 4IO9F 1V3FA 3W6JB 2BYVE 1OQYA 4OWRB 5HNHA 5HDGA 3AFHA 3GTPJ 2UZKA 3T5XA 2C6YA 4KN4X 2XKPA 4HOBA 2G7HA 5J1RA 3CUQB 2G7UA 2XGDA 3ZQHA 3BR2A 3RCOA 3NWTA 2GENA 2DDBA 4FETA 1WI3A 1XC5A 4E7HA 6PAXA 1N25A 2M8EA 2MH2A 2XDVA 2HVRA 1F9NA 1QRYA 3K1MA 4K2EA 1QO0D 3M1CA 3BY6A 1FY7A 1SC7A 1EH8A 2EBIA 3R60A 2WWYA 2EZLA 1E0EA 5J1UA 3REOA 3GTQJ 1FSHA 3BZ6A 4M3FA 4N4NB 3T1BA 2CQNA 3VODA 3HRTA 4PSXA 3RZDJ 5IP6A 1YITI 4P9FA 1Z91A 2Z3YA 3EYYA 2X6YA 4ZYAA 2K85A 3K0LA 4BBSJ 4F91B 5J8CA 3GFLA 3TP0A 2PI0A 2O7TA 2YX4A 2YUSA 3SZPA 1G59A 1G8XA 1U8RA 5EZGA 1H9GA 3OIPA 3W2AA 2VOOA 3TQNA 3KP3A 3MWMA 4AIJA 4V19K 2H8WA 4ZH4F 3OYLA 2FD5A 2DT6A 1HA8A 3KYDB 1UHSA 3LMMA 1J9IA 1RUOA 3HE0A 5EEHA 1OKRA 4P1WA 3IRQA 4PGHA 1SFXA 2MD0A 2ME0A 3TKYA 4AIHA 3MKLA 2ZCXA 1YJWI 4E7JA 2K40A 2OQGA 4XSXF 4XM3A 4AF5A 5CYVA 3OYMA 2MSYA 5H2FC 2J5PA 3DKXA 3RQ4A 3M9AA 4A6DA 4N0BA 2P5KA 2CYYA 1JKQC 2P8TA 3WGIA 2EFOA 3E1SA 2CO5A 1ZR4A 5GTHC 3NXCA 1IV6A 4BE1A 2FE3A 2BEOA 3CP2A 2NNYA 2OUMA 2VQLA 3ERMA 3NARA 1ACIA 2NX4A 3ZQCA 2NRAC 2GA2A 3WG7H 1MDMB 4A3MJ 3GTOJ 1MNMC 1WFXA 4W97A 3K7AJ 2PFVA 3GZ6A 4CUGA 1OJLA 2ELJA 2K9LA 2FBKA 2O3FA 3CMAI 2Q2EA 2Z5UA 4XOTA 4PJMA 3KFWX 5GAHJ 4ON0A 3IH4A 2O8KA 1FLIA 2BXYA 1LPQA 1D1CA 1B1BA 1EH7A 5J6XA 3RPQA 3WTTC 2ICWG 1Z9CA 3X2QH 2IA2A 4GRIA 4CCJA 3FXOA 2OV7A 1KZHA 3ZN1A 3QYFA 2K7LA 2IA1A 2WY8Q 1X1AA 1L0OC 2EFQA 4CA0A 3OY9A 3P5JA 1RETA 1BBYA 3I59B 1R7JA 1QA6A 2VJ4A 3VVYA 1JHFA 2LSOA 3OMYA 2E5NA 3BNIA 4HRIA 5HODA 4NNJA 1V4RA 3T8TA 2HQNA 2K02A 3GBGA 2QA4I 1U3EM 4RB0A 3HTUA 1DPRA 5FB2A 2JN6A 4CICA 4MEXF 3UNGC 4HX7A 3U1KA 1MJAA 1FMWA 1DU6A 2WV1A 3HOTA 3LJLA 3QQAA 1Z3XA 3KNWA 4HF1A 4G6DA 5J40A 5LBQA 4XIDA 3KETA 3C7JA 1IUFA 2Q1ZB 5FROA 4ZDLA 2A3SA 2MGQA 1D1BA 4UUVA 3BRUA 4KIFA 2JVHA 4XMYA 2QKOA 3G73A 2HGCA 1FOKA 3F8FA 1BJAA 5HS7A 4NHJA 2LMDA 3JRIA 3GTLJ 3C07A 1N75A 3BCAA 3FXKA 3TO6A 2LTPA 1Q1HA 3HEFA 4KN7X 2MLGA 1XCBA 2DAOA 2K9MA 2VBYA 2ME6A 3WTUC 2AS5F 4Y3OA 3MEXA 2CUFA 2QQ9A 1ZELA 2COBA 1FT9A 4B1RA 5CXGA 5IYBJ 1G4DA 3CLOA 3SWHA 3ECHA 4MTEA 2HDDA 1I3QJ 4HA8A 1IUYA 1AKHB 3HHGA 3BG5A 1KU9A 1OCZH 4PJ0C 1IW7F 2NP3A 3OIOA 2Y69H 3OYAA 2HPIA 1I39A 4FASD 4LIUA 3CD6I 3F6OA 1WVRA 1EV7A 2WGBA 2DG8A 2ZOYA 4XNFA 1T33A 5J47A 2E36A 4EMSA 5LHHA 2WADA 2L4AA 2V6EA 1XB4A 5KNLA 2LNBA 1MD0A 1Z3YA 4BJTA 5CQGA 3KEOA 1U0JA 4NQWB 4EATA 3A0BC 2BY3A 2FBIA 2F5VA 2K4JA 5JHUA 1FJLA 2WC2A 2ZXIA 2LY1A 2PMUA 4EJWA 3GMEA 2R3SA 3CJTB 3P9TA 2XAHA 1VFCA 1HF0A 2E1NA 3MKZA 3HTJA 2QSHX 1KYZA 1UG2A 1T98A 1OYIA 5D6EA 3VW2A 3ESWB 3H1CA 2RC4A 2QSFX 2FU4A 4LG3A 4LLNA 3H3UA 2BHZA 2A6HF 2DA4A 2A61A 3F8NA 4IVNA 4RB2C 5HS9A 1X58A 2DFFA 2E60A 2VI6A 2ZXHA 3ZN0A 2EA2A 1SD5A 1I6HJ 2PN6A 2R7QA 1TTYA 2EIKH 3QOEA 2VQCA 4PGGA 3H35A 4L5JA 2XROA 4I0BA 4BJ6C 5HOOA 5EGOA 1NHAA 1Y39A 2I5UA 3F9KA 3HOVJ 2ZXJA 4I6ZA 2V4JC 2BW3A 1SFUA 1YX5A 4GCKA 5CQEA 1DGWY 4I98B 3ZCOA 1MH3A 5DD8A 1FYKA 1ON2A 4OIQF 1IN4A 2FRHA 4GYGA 3HPGA 4KMUX 1QQIA 1Z21A 3DU5A 2DQRA 3ZQ7A 2NS8A 4UY8I 2DDAA 3K4JA 5KHDA 3CMEI 2EFNA 3A0HC 2MD5A 1A04A 2DMPA 5F27A 3K10A 3V4GA 1R4MB 3CC7I 3HTHA 1R36A 4MGRA 1K6OA 2E2JJ 4PJNA 4NDLA 1WWXA 5EG0B 3ROUA 3GO5A 1JT6A 2LBFB 5FD6A 2H8RA 2FXAA 2BV6A 3VFZA 2UXUA 1JTXA 2VJIA 2CG4A 2R7XA 4E7IA 4HNTA 3AG2H 2Y0SA 1XPXA 3AL0C 4BQNA 3BCGA 2Q8KA 3CDLA 3O2PE 4P5OA 5J4YA 3Q0UA 2O7OA 2VKVA 3OYGA 2FBQA 5L3DA 2QCOA 3HGYA 3Q3SA 1KU7A 2GXAA 1BW6A 2ZCWA 4CCMA 1LQ1A 1YIOA 3F8BA 3JRCA 3RZOJ 3ZMTA 3BPVA 2CMPA 2R7OA 3DWLE 4ZTJA 2R93J 3NNRA 1RUNA 1KYWA 1BI1A 2L5QA 1H89C 4PJJA 2XAGA 4AUXA 4ENKA 1UI6A 1FNNA 2GZWA 4ANJA 1ETQA 3QP6A 3K9TA 3S15J 4FT8A 1LE8A 1DP3A 4GO1A 3BJBA 1ZGAA 1V54H 5GTIC 5ICCA 2YU3A 5K7HA 1TC3C 4LG0B 2JUGA 3DTKA 1E3HA 1P4XA 2EJRA 2H1LA 4AC6A 3Q0VA 4O3MA 4HG2A 3ZMSA 2A5YB 3V7SA 4H4KC 3TGNA 3R0AA 1WCMJ 1R1VA 4UB6C 2XUBA 2LYCA 1O3SA 2EZIA 3G2BA 3F6VA 3GLXA 3SDBA 3RQIA 4MQ9F 2K9SA 3BTCA 3DBLB 2E2IJ 5HSZA 2JK3A 2O9LA 1F5TA 3ZMVA 2Y75A 1HOMA 2IP2A 3DEEA 3IWZA 1BC8C 1P6RA 4CZCA 2M2EA 1IG7A 3PJRA 2ZJPF 1U5TC 1IRFA 1JI8A 1TT5B 3CUQA 5M5WJ 2HPMA 1LEAA 1ETOA 3PM1A 4UUSB 1Y1WJ 5LGTA 3CMYA 1ON1A 2OBPA 2IU5A 2WV0A 2L4MA 1NG7A 2CRGA 3QU3A 4M73A 3QWLA 2NNNA 2L9RA 2DT7B 2DA2A 4Z6YA 1W0UA 4M9ZA 2UWMA 1ETXA 4M71A 1W36C 1HBXG 3RPUA 4V2GA 1Z67A 4JYKA 4BHCA 5K5QA 1HW1A 2HOSA 5F1RA 3WTSC 2DMUA 4DQ2A 4WF2A 2PMZA 2XGXA 4S0HB 3KYCB 1HLVA 1ZQ3P 4LJZF 1MSFC 4RA2A 3OL3A 2F4IA 3IUOA 3ZGKA 3LHQA 1R00A 5HDNA 2CW8A 1QZEA 3KPHA 2E1MB 2W1OA 2FMYA 1ZRDA 3DEWA 1MNEA 2UXXA 2X48A 2GIVA 5H9TA 1JKOC 3SHFA 3CCJI 4MXMA 3E5XA 4M3EA 4YIFA 5E18F 2KFDA 4G7HF 1UHMA 4D1QA 4YEJA 1LEBA 3FF5A 4ASNA 2V1NA 3J80Z 4IL6C 2QKMB 1UHWA 2XVCA 2LF7A 5DM6F 2L7MP 2V9KA 1RKTA 4IRHA 1IAWA 2Z33A 3HB9A 4XLHA 1FBUA 4MK6A 5FLXZ 3GZ5A 3BT9A 5EJCA 1O3RA 1LDKB 5K5OA 2BY1A 4KUMA 1HW2A 2JA6J 4IHYA 3ABKH 2KZGA 4I76A 1IF1A 4BQOA 4LK0F 5E3NA 3CCUI 1XGNA 4MQVA 2R5ZA 2GM4A 1FWZA 2WB1N 5FLXK 2F48A 2HDCA 4JKZA 1D5YA 2NXNB 2NS7A 4BL0B 1MBFA 3U21A 3HTAA 5FO5A 3EUPA 3S32A 3J7ZI 1D8KA 1MDMA 1BC7C 3QBMA 3CO6C 2CH0A 2X85A 1ITYA 2HZDA 4PDKA 1EJ9A 1KQ0A 1XCVA 5DD4A 1I50J 5TISC 2H1KA 2JSPA 2AO9A 5JFRA 3ON4A 3EDPA 5ED4A 2CQKA 3Q9SA 5HLIA 5IPAA 3GEUA 4AVZA 3WU0A 2DA5A 5CVJA 1FOXA 2L01A 5AIPA 1RESA 3VYTB 4LIVA 4G7OF 5TGTA 3L2WA 3I0TA 1SFEA 3CC4I 2TCTA 2DYSH 3RKXA 3KYLA 4U0WA 3D5RC 2K9NA 3OYIA 3W2VA 4J00A 4A3IJ 1NH3A 3OSFA 4BQAA 3BZCA 2RV8A 1FZPB 2IGMA 2VT2A 1N77A 3SEZA 2CS3A 2NAZA 3CP8A 2PLYA 3CCLI 2F2EA 2ZC2A 3TW7A 2LREA 3E3VA 4C3JJ 1PYVA 3ZPLA 1SD6A 4LMYA 2L3DA 3WGGA 3OYEA 4DNCA 3OR1C 1HKQA 1HSJA 2QVOA 3D5SC 2XSJC 3DLLF 1JUSA 4ABZA 3VEPA 1OR7C 3O8HA 2E34A 3JRFA 3DBHB 4I01A 1VI0A 3ZMUA 4WX9A 2D45A 3S8PA 4ICHA 5C4YA 5FRNA 3M7GA 2R7SA 2ESNA 3W2WA 3G71I 3MZ8A 1MSEC 1XDSA 3JAMZ 4I99C 4KITB 1S5LC 1YOVB 5LEKA 1YJNI 3IKVA 5CPRB 4AIKA 2BY0A 5TRDA 1IN7A 2X6OA 4FTHA 1VQMI 2HEOA 1ETYA 2DTRA 1MMAA 3E6DA 1BW5A 3H9GA 3F8MA 2KRCA 2CUZA 3BJAA 4DGWB 3A01B 2XKOA 2IXSA 4IOAF 3DV8A 1DDNA 1D0ZA 3J7AY 4N9IA 4II2A 2HZTA 4D5CA 2RN7A 4BNCA 4ETSA 3QPHA 3BTJA 2OCCH 3E5QA 4ESJA 1EF4A 3DLAA 4CYCA 3PUBA 2IW5A 5LEJA 4UUTA 1O3TA 2VJ5A 4ZYDA 3LNQA 3GFJA 4E7KA 3LSPA 2REKA 4H0EA 2D6YA 1TP4A 4U0VA 2M4KA 3LSGA 2P0WA 3ECOA 3FISA 4Y7NJ 3MKYB 5D5XB 1W36D 3Q0WA 1S6LA 3IUVA 2G7GA 2F07A 2JPCA 3VW0A 2I8DA 1MKMA 1SGMA 3ML6A 1SMTA 4WWCA 3HOSA 1SANA 2HQRA 2VONA 1SD7A 4BYYA 1OISA 4U7BA 1W5CC 1ZYRF 5E79C 4NQWA 5CVIA 1FYLA 3KEQA 2ZMEB 1T39A 1NTCA 1TNTA 3HOYJ 4EV0A 4E70A 3K4NA 3WHCA 5EFYA 4E7ZA 2M87A 4OMZA 4BKXA 4N9HA 3VOXA 4U0YA 1FTTA 3P9IA 2X9DA 4I09A 3EUKL 5DTDA 3PPBA 3ZQFA 3GF2A 5M5YJ 4BH9A 1X2NA 2OZUA 2R7FA 3GEZA 4BEHB 1PUFB 4WXDA 1Z05A 3FBNB 3QP5A 1F36A 2GAUA 3LQQA 2OI8A 1ZTRA 1O7FA 4FISA 1YW7A 4XN0A 2X4HA 2PQ8A 3VWBA 4CHUA 5E8GA 1NK3P 5KK1A 4QWQA 4ITVA 2LDUA 4NB5A 1I27A 4A93J 4M9SA 3HRMA 2JMWA 4Q4ZF 1RIOH 3P7NA 2E7XA 2HQ5A 1HKSA 3PFIA 1MJBA 4BY7J 4CGZA 2MLKA 3OYHA 1VQ4I 2DJIA 2PJRA 2ZO4A 3DCFA 2R0QC 4ACIA 4FCYA 2UXHA 2OTLI 5DM7F 3A2KA 1UG0A 2IJLA 3GUDA 2MYSA 4R1HA 2QEXI 3COAC 1OR7A 2ECBA 2XC7A 3DKYA 3UR3C 1E17A 3MAJA 5EEGA 2RKHA 1X19A 3CDIA 3SDGA 3JW4A 1RPWA 2JJ7A 1G2HA 1TWAJ 4MNUA 4ZJZA 2H6CA 5D5WB 3BQZA 3SXYA 2E19A 2EZHA 4LLGF 4X1EA 3TL4X 4DVYP 2QUFA 1WJAA 2GFNA 3U1DA 1HKTA 4PFPA 3MKWB 1JXSA 4PCQA 2K27A 3F0CA 3LL7A 3QYEA 2L7KA 4L9JA 2VKHA 1O7LA 1U9NA 1ONVA 1VQ9I 2O61A 3T6NA 2KQRA 3T8RA 1VF9A 1ZHFA 1CF7A 1E2XA 4HPQA 1R5HA 3S93A 3KP7A 3V8LA 4QIWN 4ZYHA 3ZP5A 4PXIA 2ISZA 1BIAA 2XRNA 4NC7A 3BOQA 1WHUA 1S7OA 1X3UA 3TOBA 2BHYA 2DT5A 3M07A 4BDZA 1MBEA 2OPTA 1S72I 1X1PA 1B72B 2B9SA 2H6BA 4UVBA 1X1DA 2HTJA 4GGGA 1SAUA 1AU7A 5FHPA 4CCNA 3E0JB 1MMSA 2VBWA 1OCTC 3WTWC 2KIFA 3VOKA 4HF0A 1TWFJ 4PZJA 2YX7A 3BHQA 1VNDA 4B09A 3PNVA 3MZHA 2HFHA 1BI3A 3M8JA 4XRMA 1T0FA 4EVIA 2ACJA 1MJ9A 2COMA 3PQKA 3N05A 3QOPA 3BJ6A 1ULYA 4BU2A 2DG7A 1LKXA 3RSNA 1R1UA 2KHMA 1K78B 3L2RA 3ZOBA 2MC3A 2GXGA 3GX4X 4UUSA 1ZLKA 2HYTA 2OAZA 2DA3A 3WE3A 1WQ2A 2F4MB 5IYDJ 1T08B 2LFBA 3J81K 2XF6A 3FIWA 4L0ZB 1IN5A 5HLHA 1D5VA 4MIMA 3TDZC 2IGNA 3RTRA 1GVDA 1V5FA 1BA5A 2HQAA 1PVEA 2FQ3A 4HDVA 3V7RA 3PO2J 3BP8A 4IHSA 5D6FA 3HM5A 1TW2A 3JSJA 3RDIA 2L7FP 3VB2A 1ZARA 1E3PA 4XLEA 1IN6A 1B4AA 2OQRA 2V6CA 4PK4A 3IKTA 5DYMA 1B9NA 3BR5A 4HDUA 3T0YA 4RAFA 1QGPA 5F04A 5DDGA 1X1BA 2HOEA 5J8FA 2KJBA 3DPUA 3H9QA 5E3OA 3VVZA 3NRVA 2FOKA 4AM3A 4HLYA 5B3SH 1TW3A 1DUXC 2OTJI 4GYIA 4CSWA 2R7RA 4C3IJ 4XKCA 4BBRJ 3CCEI 4D9JA 4AD9A 2D1HA 3LA3A 3SJMA 1B59A 1TT0A 3K70C 4RGXA 3SQNA 5LHGA 3AKZA 1AWCA 3K2ZA 1STZA 1V55H 4BACA 2K3PA 1IN8A 2VOPA 1X1CA 4HV6A 5K58A 2FQ4A 3O6BB 1VQ5I 1FOYA 2X1CA 3HKZN 4BJ5C 3CJNA 3MZYA 1K83J 5FFXA 4KWAA 2PG4A 1OCRH 2BZTA 2R7UA 1ERDA 2HKUA 4A3LJ 1SD4A 3HSEA 3QPLA 5K7FA 1BJZA 4R79A 5D4SA 1JJ6C 3NRGA 3F1BA 1PP7U 5ICGA 1K4SA 2X1DA 4QSHA 1QPMA 3R6SA 3SYTA 3HOZJ 3BTLA 3LFUA 2ELKA 1I6XA 1P7IA 2WAQA 1WJ5A 1GHCA 3K4BA 4AU7A 2P6TA 2W4SA 2OC6A 1ZKGA 3ZXSA 3S17J 4U87A 3W6KB 3KE2A 2HXIA 5LFAA 3WTVC 1R9TJ 1XN7A 3W6VA 4L9TA 4C9YA 2IS4A 3LSJA 2GOXB 2XPWA 2V9VA 1TZLA 4R8HA 4BUPA 3LA2A 4CGRA 4X6AJ 2IS6A 2QF7A 1GT0C 1JUPA 2KP6A 1LVKA 2ZSHB 3WU1B 5BPDA 2O5RA 4FE7A 4JX4A 1I1GA 1X4PA 5DS9A 4IXAA 5DCMA 1E3OC 4HV5A 5ICFA 5KVRA 3KEYA 2DPDA 4LK1F 5HLTA 1BL0A 2IVMA 3EPZA 2DU9A 3M8EA 1I3AA 2QKLB 4OAZA 4IEJA 4EJOA 4KA4A 2RAEA 4OAYA 3VOEA 3AQSA 2W24A 1JJ8C 3H0GJ 1J09A 3CTAA 2ESHA 3QPSA 1OYYA 4BE2A 2DN0A 3H3ZA 3VYUB 4M9XA 4F55A 3HRUA 3PIOF 2KT0A 5J1YA 4P9UA 3KKDA 3C3WA 1WPKA 1D0YA 3AG1H 4ME9A 3VW1A 2LH9A 1MBJA 2ZNYA 3TW6A 1OLTA 2CQ7A 2FEZA 3CUQC 3K4CA 1LDJA 2F4OB 4O6JA 4A3BJ 2PBIA 4HYEA 4ENMA 1YHQI 5HS8A 4P55A 5GPAA 4I02A 3KLOA 3KP2A 4OINF 1B8IA 4LB6B 2GOMA 3ABMH 1ZREA 1F43A 2QSGX 4KFCA 3SFIA 3G1OA 1F4KA 2JSCA 2XIGA 2KPMA 2D1VA 1LJ9A 3R0JA 1Q1VA 4RGUA 4UV9A 5FKLA 5JHFA 3MVPA 1MZBA 3HOUJ 3HDDA 1R22A 2HOAA 2LK2A 2EINH 4XQFA 3CDHA 4IHXA 4OMYA 3ZQQA 2HYJA 1BN5A 1BR2A 1P9QC 3K4LA 3OS0A 4J19A 2KL4A 3DBRB 4G6QA 1XSDA 2CFXA 3UKGA 2OZ6A 1YRNB 1AA7A 2WAFA 1MMNA 5LRSA 3A01A 2VC0A 3GTGJ 1ZN2A 4M74A 5E20A 2GIZA 2ELHA 1XMAA 3I3LA 1H88C 1H0MA 1JGGA 3ISPA 2PJPA 4YZEA 5D5VB 2VUMJ 3NI7A 1LFPA 3HIFA 2ZCNA 3DPLC 2MBFA 1FPQA 3QRFF 4HX4A 3WTXC 3HJEA 5KAIC 2QGUA 1ZGWA 5M3FJ 1D8JA 3ASOH 4YFKF 5FJ8J 5EDNA 5LRRA 3TEDA 1MNDA 4NC8A 3H3VK 3PFYA 3EETA 5FKMA 2VLAA 2PMHA 2XAUA 1VZ0A 4KIGA 5BPIA 2YVHA 2WA0A 4YRVA 5F0FA 3CLQA 1KA8A 3I56I 2YVXA 3WGHA 5L3EA 1ZG5A 4EJVA 4A5MA 2JA8J 3PASA 5EYRA 2BXZA 2P4WA 4OIOF 3SFZA 3FDYA 3I4PA 3BWGA 4D5FA 3NAUA 4HBLA 5A2QK 5TJJA 3K70D 3FWEA 4JK1X 2JRMA 3JRBA 4CCKA 3S1RJ 2JWTA 3O8GA 2LP0A 3LSKA 5BMZA 1PUFA 2VASA 4RAYA 1FX7A 1YW9A 3OR2C 4LGWA 4Y4RA 3KP6A 2Y2ZA 3PIPF 2FJI1 1SVLA 3CJDA 4KNYA 3EUHC 4B44A 2E71A 2R92J 3K1PA 3JR9A 1DP7P 4RAZA 4AC0A 4F3QA 4U9NA 3VVXA 5JLXA 4XN3A 1W7PA 3FM5A 1OYWA 1SAXA 2PZ9A 4EQQA 4W1UA 2GUHA 4DBRA 3VP5A 1A6QA 3B81A 1QVTA 3D1NI 3ABTA 1N78A 4B3XA 3ULQB 1T8IA 3FX3A 3D0SA 3Q5FA 2JQ7A 2E5ZA 2P5LC 4ZC3A 3PNTA 1V5EA 3FXUA 2DFIA 5IY5H 1BI0A 3QPTA 1S9HA 2Z99A 3H5AA 3S3MA 1X3WB 4GFKA 3BZKA 1YW8A 1A5JA 1FBSA 2R4GA 4A3KJ 3GTMJ 4DJAA 3JTHA 2E1CA 4MO7A 3EUAA 2B63J 2DJNA 4BXFA 4EM1A 2XB0X 4NN1A 3IRRA 1IXRC 5M5XJ 4M3GA 2B7EA 3KX2A 4OIPF 1Z0XA 3ERED 3GZIA 3VTIA 2Q2EB 3KZ9A 3GZNB 3ZQGA 3S2DJ 4AVPA 4XLCA 5LGNA 3S5RA 1HW5A 5C4JJ 4U7DA 3HRSA 2KIMA 1W7PD 2B0LA 1I5ZA 4M6YA 2AHQA 1OCPA 1FYMA 2DODA 4GCVA 4RM2A 2RGVA 3V78A 1FIAA 2R5YB 5FGLA 5E3LA 1X2MA 2J5OA 1UB9A 1B72A 4RBOA 3LSTA 2ID3A 3K4KA 2XPVA 1S7EA 4XRFA 1UMQA 4L5IA 2DCEA 3RKQA 3L09A 4CH7A 3RD3A 2Y0MA 5GP9A 3A02A 4BQQA 1S29A 3L2QA 1J75A 3BQYA 5DCFA 5F08A 3RPUD 1R23A 2DMTA 5JVTA 4YG2F 2QYOA 5F1JA 3LOCA 1ZR2A 4UDSA 3QKXA 2HS5A 5K7ZA 3OYCA 5J4VA 3HHHA 4BDYA 5LHIA 1Y0UA 1YTYA 2B1EA 2OU2A 3ZQLA 4LLLA 3CC2I 1IDYA 1K78A 3M8FA 3FHNA 1WJFA 1YG2A 3L2VA 1RR8C 2W82A 2XF7A 3E97A 5GPCA 2IRFG 2W84A 3CO7C 3ONQA 4ENNA 4RDUA 2V26A 3CCRI 2M0CA 4HEA2 4NC6A 1YYVA 2PBXA 3G3ZA 4UB8C 2KMUA 2VE8A 4EEFG 4EM2A 1DGRM 2EPFA 4RMNA 1P4WA 4A12A 1AOYA 1U8BA 2EIMH 3LFKA 3EUHA 1NG6A 2CJJA 1B9MA 2EIJH 2PFBA 2RNJA 3TDUC 2ZCMA 2M30A 2K3FA 2A07F 1RI7A 5LLQA 1TLHB 3I59A 3CWRA 3RKYA 5B66C 1TL8A 4KDPA 5B1BH 5FRMA 1T2KA 5D18A 1SVOA 3I54A 1FMVA 1G6NA 1BM9A 1IRXA 4ENJA 3A4CA 2LF8A 2HU9A 4LD5A 5AONA 4BXXJ 1LFUP 4F92B 4XONA 2JZYA 2V9PA 4BHPA 3HSRA 5H6QA 2CW0F 5DV5A 3K4MA 1X4OA 2X6XA 4KIBA 2IS1A 2L9NA 5E3MA 2VJJA 3KP5A 4BY1J 1SVMA 2CWEA 3K2AA 1WKMA 4N4OB 1BOAA 1ZG3A 3ELKA 2O0YA 1WJCA 4F93B 1REPC 4CCOA 3IHUA 3I71A 2ZKZA 4UVAA 2G7SA 4HNUA 2UXNA 3GXOA 3I4MJ 2CQQA 4YFXF 1ETKA 4IX7A 4L18B 1KONA 1EA3A 3GTKJ 1KQ8A 2F5FA 5GAGJ 2DFHA 5EZHA 4L9VA 1O3QA 2V1UA 2A5WA 4ZZLA 3RI4A 1GVJA 1JE8A 2FJ1A 2JUCA 4BXUA 5FMPA 2MC4A 2CSOA 1XTAA 4ZDPA 2DLLA 2ZFWA 4NUBA 2HWVA 5L3CA 2QM3A 4Q47A 4A0XA 1VQLI 4DIQA 1LDDA 1MGTA 4NBQA 1UAAA 5JLWA 1PUEE 1AKHA 2BGCA 5CVRA 2ZXWH 2QQ8A 3R4KA 2M5WA 2XF5A 2VB6A 4A0ZA 3G6EI 4FQGA 3HC7A 3KIOA 1ZH5A 2HDWA 3JRGA 2DA1A 1O4XA 4QTRA 3MD2A 1U2WA 3PL8A 3V7CA 2G0EA 5EF6A 1XSXA 1MBKA 2X0LA 3CF5F 4GCTA 1BI2A 5CW8A 1TBXA 1RZ4A 5JVGF 3GFMA 1XMXA 1T0FC 3P9KA 4A0YA 3CZ6A 5GAEJ 4IRVA 2ZY9A 2UXPA 2BVMA 4DW6A 2A2FX 2YU9J 1NK2P 4B3AA 4FE4A 5IT3A 3OOUA 5C3EJ 3FHZA 2Y0SN 1OCOH 2AQEA 2V1DA 5D1RA 2BBYA 4JBAA 3U2RA 3KP4A 1MH4A 3DTEA 5B5EC 1BIBA 1T6SA 3IH2A 3VYRB 4M3BA 2XRLA 2ETHA 3H5RA 2GBYA 4XKBA 2LR8A 3G1LA 5HLGA 4P96A 3BLYA 1P92A 3GVAA 4A5NA 2LKSA 4IRGA 4IF4A 1GXQA 2VN2A 2RQQA 1XD7A 1G3YA 3BG7A 3C2HA 1R4NB 3ZR8X 2UXIA 2RHAA 1LE8B 2ZSIB 2IBDA 1UJ8A 3DPJA 2P7VB 1WSUA 2E1OA 4I2OA 2VKEA 1QU3A 2XV4S 1WJDA 1YRNA 4G6TB 1YQAA 2UV1A 4RGRA 2D2WA 2YSRA 2M7BA 2E1MC 2JTVA 4IHTA 4HSTA 2NVYJ 1IRGA 4Y33A 4MHGA 1BR4A 3C1DA 3OS1A 2DPUA 2IEKA 2M7AA 5EG0A 4F7ZA 5IP9J 1VQPI 1VQ6I 2LBFA 2VBXA 1YIJI 4XOPA 1TQMA 3EGQA 3D5LA 3NEUA 3OIQA 5ILVA 2L9VA 5E1XA 3ANGA 2YS9A 1T38A 1TQIA 4CZZA 5K5RA 3MQ0A 4JX5A 1R49A 4FHTA 3RJPA 2Y9YA 4RB3C 1QNTA 2K5CA 3LSIA 4B48A 2VODA 3A1YA 3U9GA 4BHBA 4D0PA 2L0KA 4LB5A 2LC2A 4BS9A 1DQUA 5M3MJ 1S8NA 5FLVA 4AWXB 2G3BA 2WUIA 4WIBA 2ZJ2A 1IRZA 4XLNF 4C3HJ 4RAGA 3OV8A 2NVTJ 3ABLH 3IV5A 3O60A 2NOGA 1GLNA 2PMZN 4JNNA 2CV2A 2HVSA 3I5UA 2K86A 2LOOA 2ZFUA 1KU3A 5F0HA 3CCMI 2YVEA 3NWSA 3DQVC 2GA1A 2L2OA 4G94A 1JKRC 4Z2YA 1SFKA 2EILH 2IGOA 2X6WA 3OYDA 4IZZA 4LG0A 1ZRCA 1FBQA 4O5VA 5D8LB 2LKPA 4AYBN 4L0YB 3WG9A 1FP1D 1IGNA 2MA3A 4KYWA 2KRHA 3OOPA 1HQCA 4XBFA 2W57A 4A3GJ 5FLMJ 3OYJA 3OWTA 4M6XA 4RGSA 4OIRF 1R5ID 3TOAA 3H92A 3HG9A 2V57A 4XK4A 5J3LA 1MMDA 2CV1A 2NS0A 1XGMA 3J81Z 4XR6A 3CCVI 3LAJA 5L3GA 1ZRFA 1R6RA 2B3WA 3DF8A 1H8AC 3JCUC 5GADJ 2QBYB 3AL0B 2GXBA 2JT1A 1R71A 3B02A 3S1MJ 1USTA 1YLFA 4ZTFA 5CXIA 5ILUA 2L7ZA 2R5ZB 3DFGA 2RREA 2WAEA 2EB7A 3ZMDA 2O03A 3FK6A 4HF2A 3K6GA 1V5GA 2QENA 2X51A 3ZMZA 3J7AO 2VIXA 5CVVA 1IXCA 3FZVA 5LGUA 4A3JJ 4DOZA 4E4HA 2VPLA 3COLA 4DYCA 4LOCA 4BAYA 2AXLA 1SFOJ 4JL3A 3N97A 2JRTA 5FKOA
chains in the Genus database with same CATH topology
3BTIA 2JA6J 4IHYA 4DYQA 4MFDA 3C2BA 1JTYA 4I76A 2Y9ZA 1ZGWA 5M3FJ 5E3NA 1IJWC 2VPRA 2R5ZA 4V2FA 2GM4A 2WB1N 2CU7A 5FJ8J 5EDNA 2JA7J 4G12A 3TEDA 3BG3A 2QWTA 4JKZA 3H3VK 2R5YA 1D5YA 2ZOZA 2NS7A 1U78A 1MBFA 3HTAA 3EUPA 5FKMA 2P81A 2W48A 2QIBA 2YVHA 3QBMA 1QVUA 4GFBA 5F0FA 1ITYA 2XB5A 3V6GA 3AQTA 1WGXA 3G56A 1JUMA 3CQZJ 3FRQA 1I50J 2JA8J 3PASA 4MFEA 5EYRA 2H1KA 2AO9A 3ON4A 3S16J 1DU0A 3E7LA 3VPRA 1JT0A 2N8GA 5IPAA 3GEUA 4D5FA 3NAUA 2DA5A 3B6AA 2HOTA 3GTPJ 3G7RA 1RESA 3JRBA 5J1RA 3S1RJ 2JWTA 2XGDA 2TCTA 3O8GA 1TWCJ 3ZQHA 4GFLA 2LP0A 3BR2A 2K9NA 4A3IJ 2GENA 4XICA 3OSFA 2QOPA 1PUFA 1WI3A 1XC5A 2LD5A 2EZKA 2Y2ZA 1QRYA 4M3DA 3CJDA 3TW7A 2R92J 4C3JJ 3JR9A 4Y52J 2EBIA 4AC0A 3VVXA 2EZLA 2FX0A 5J1UA 5JLXA 3GTQJ 4M3FA 2PZ9A 1OFCX 1JUSA 4ABZA 4W1UA 2GUHA 5BNGA 3O8HA 3VP5A 3B81A 3RZDJ 5IP6A 4CYCB 3JRFA 1QVTA 1GDTA 3D1NI 4BBSJ 1VI0A 4ICHA 5C4YA 1LFBA 4MLOA 2XPUA 3GTJJ 4B4CA 3TP0A 1MSEC 1FIPA 2O7TA 2YUSA 1U9OA 5EZGA 1A6IA 3HGGA 4GFKA 2FD5A 2X6OA 1UHSA 4FTHA 3TP3A 1A5JA 1ETYA 2HXOA 3GTMJ 4A3KJ 1BW5A 3HE0A 4MO7A 2B63J 3A01B 5D19A 5DAJA 2DJNA 2XB0X 2E2HJ 4NN1A 2ME0A 4D5CA 5M5XJ 4M3GA 2M9HA 3BTJA 1Z0XA 3MKLA 2ZCXA 3GZIA 1EF4A 3KZ9A 5IOYA 4CYCA 2K40A 3ZQGA 4AF5A 2KDZA 3S2DJ 2M34A 2MSYA 4UUTA 3S5RA 5C4JJ 2ECCA 3LNQA 1JKQC 3LSPA 3JRHA 2REKA 2AHQA 1OCPA 2D6YA 2RASA 1ZR4A 3NXCA 1IV6A 3LSGA 3S1NJ 3S14J 1RKWA 3FISA 4Y7NJ 3V78A 3M4OJ 1FIAA 2LLKA 3NARA 2R5YB 2NX4A 3ZQCA 3ANPA 5FGLA 5E3LA 3Q0WA 1X2MA 3IUVA 1B72A 4RBOA 2G7GA 2F07A 2ID3A 2OERA 3VW0A 1SGMA 4A3MJ 2XPVA 1S7EA 3GTOJ 3JRDA 1UMQA 1MNMC 1SANA 3HBLA 2ZB9A 4W97A 2M8GX 3K7AJ 3MN2A 3RKQA 1ETVA 1OJLA 3RD3A 5GP9A 4A3EJ 3A02A 1AHDP 3LWJA 1NTCA 3HOYJ 3BQYA 3IH4A 3VIBA 5F08A 2O8KA 3WHCA 2G7LA 4HKUA 5EFYA 2DMTA 5HBUA 1JKPC 5F1JA 1ENHA 3LOCA 1ZR2A 2DMNA 4UDSA 4BKXA 3QKXA 2Y31A 3VOXA 1FTTA 5K7ZA 2X9DA 5DTDA 3PPBA 3ZQFA 3ZQLA 5M5YJ 1RETA 1X2NA 1IDYA 3VVYA 1PUFB 4JP0A 2NVQJ 3BNIA 1F36A 5HODA 2OI8A 5GPCA 1ZTRA 4FISA 3GBGA 3BR6A 1NK3P 2JN6A 4RDUA 3HIMA 2M0CA 4DZJA 2HI3A 2PBXA 4A93J 2JMWA 4EEFG 1DU6A 2DTZA 2WV1A 3LJLA 2CUEA 2HQ5A 3QQAA 1U8BA 4BY7J 3KNWA 3KKCA 1HDPA 2CJJA 3DCFA 2R0QC 4HNVA 4XIDA 2ZCMA 4FCYA 4ACIA 1IUFA 3JREA 2UXHA 3CWRA 2MGQA 3BRUA 2QKOA 1K61A 5D18A 3RH2A 2ECBA 3I4NJ 3JRIA 1ZK8A 3NPIA 3GTLJ 3C07A 2GLOA 3SDGA 1G2HA 1RPWA 2JJ7A 4BXXJ 1TWAJ 1LFUP 2OF7A 2LTPA 3BQZA 3HEFA 2DA6A 2E19A 1FEXA 2EZHA 2TRTA 4X1EA 2ME6A 5F0CA 1HDDC 2CUFA 2COBA 2GFNA 5E3MA 5C4XJ 4B1RA 5CXGA 5IYBJ 4BY1J 3F0CA 3K2AA 1UI5A 2HDDA 1I3QJ 1U9NA 4DZPA 3T6NA 1AKHB 1VF9A 3BG5A 2G7SA 2UXOA 3I4MJ 5AQCA 1T56A 2CQQA 1ORKA 3OIOA 1ETKA 3WHBA 4QIWN 2NP3A 3VUQA 4PXIA 4NELA 3GTKJ 2QTQA 5EZHA 1B72B 2WGBA 2DG8A 2ZOYA 1MBEA 2OPTA 1T33A 2K9QA 2FJ1A 5FMPA 5IP7J 1AU7A 1POGA 3LSRA 4XRSG 5IOZA 3JRAA 5FHPA 1OCTC 3OSGA 3VOKA 1TWFJ 1FJLA 3BHQA 1VNDA 4D7MA 1HCRA 2XSDC 3P9TA 5JLWA 1VFCA 1HF0A 1AKHA 3HTJA 4XRMA 1UG2A 3VW2A 1Y1VJ 2DMQA 2I10A 2DA4A 3JRGA 5FKKA 2DA1A 1O4XA 2DG7A 4QTRA 1X58A 2G0EA 5EF6A 2VI6A 2W53A 3ZOBA 3BR3A 1MBKA 4GCTA 1I6HJ 2HYTA 4UUSA 5CW8A 2DA3A 3B6CA 1WH7A 3BR0A 9ANTA 5IYDJ 2LFBA 5EGOA 3FIWA 2UXPA 4DW6A 4D7NA 2YU9J 1IDZA 4C2MJ 4MIMA 1TWHJ 3HOVJ 4B3AA 1W0TA 4FE4A 1GVDA 3OOUA 5C3EJ 4I6ZA 1BA5A 4GCKA 3E7QA 2Y0SN 3PO2J 1MH3A 3HM5A 5D1RA 3JSJA 4IHWA 3S1QJ 2L7FP 2NS8A 2NVXJ 1GV2A 1MH4A 3BR5A 4MK6A 3G1MA 3IH2A 5F04A 2DA7A 4M3BA 2XRLA 2DMPA 2GBYA 5F27A 2JA5J 5E3OA 2LR8A 3G1LA 3VVZA 1FTZA 3HTHA 2E2JJ 4A3DJ 5EG0B 4NDLA 1JT6A 1XS9A 2H8RA 4C3IJ 4BBRJ 2UXUA 1JTXA 3FKIJ 2UXIA 2RHAA 2WAQN 3SJMA 1LE8B 2IBDA 3DPJA 3L1PA 2E1OA 2NP5A 2VKEA 3HOWJ 5K58A 2Y30A 1YRNA 2FQ4A 1RR7A 3BCGA 3CDLA 3Q0UA 2O7OA 2VKVA 2FBQA 2NVYJ 3HKZN 5EEAA 1APLC 2EH3A 1K83J 3HTIA 3HGYA 3Q3SA 2QCOA 4KWAA 1BW6A 2XDNA 2HKUA 2IEKA 3JRCA 3RZOJ 2R93J 5EG0A 5IP9J 4A3LJ 3NNRA 3QPLA 5K7FA 1BJZA 3FK7A 1H89C 1JJ6C 3NRGA 4AUXA 3F1BA 1UI6A 1ETQA 3EGQA 4QSHA 3S15J 4DYRA 1LE8A 3BTLA 3HOZJ 3ANGA 2ELKA 2YS9A 1P7IA 3BR1A 3BJBA 3CRJA 4JX5A 5K7HA 1TC3C 2EQRA 1ZKGA 2Y9YA 3S17J 4AC6A 1R9TJ 2HXIA 3Q0VA 3W6VA 2R7ZJ 1MBHA 3LSJA 2XPWA 2L0KA 1WCMJ 2LVSA 3PO3J 2G3BA 5M3MJ 2MG4A 5FLVA 2EZIA 2WUIA 2XGCA 4A3CJ 1IRZA 4CGRA 3RQIA 4X6AJ 4C3HJ 2K9SA 3BTCA 2QF7A 3IV5A 1GT0C 1JUPA 2NVTJ 2E2IJ 3O60A 2NOGA 5HSZA 4FE7A 4JX4A 2JK3A 2LY9A 5DS9A 1P7JA 2PMZN 1E3OC 1NK2P 1QPIA 2O9LA 4JNNA 1HOMA 5F0HA 1BL0A 4L62A 2YVEA 1B8IB 2Q24A 2M2EA 4IEJA 1IG7A 3MNLA 1JKRC 2RAEA 3AQSA 3ZQIA 5M5WJ 1JJ8C 3H0GJ 1ETOA 3PM1A 4UUSB 1Y1WJ 4AYBN 3CMYA 3QPSA 2IU5A 2DN0A 5EGOB 2KT0A 3ON2A 5J1YA 2CRGA 1MBGA 1IGNA 1WPKA 3KKDA 4ME9A 2L9RA 3VW1A 1MBJA 2DA2A 1GUUA 4A3GJ 1W0UA 3TW6A 5FLMJ 4A3FJ 1ETXA 1CQTA 1ETWA 2D5VA 4JX6A 2IAIA 1WH5A 4V2GA 4GCLA 4JYKA 4A3BJ 2HOSA 4A69C 2DMUA 4XK4A 5IYCJ 5GPAA 5J3LA 2V57A 4S0HB 3M3YJ 1HLVA 1ZQ3P 1B8IA 4IHVA 1MSFC 1F43A 3SFIA 3A03A 3G1OA 2XGEA 2MW8A 3LHQA 1H8AC 1Q1VA 1Z77A 5FKLA 3HOXJ 1TWGJ 1XG1A 3S1MJ 3MVPA 2LKXA 5CXIA 3DEWA 4L5EA 2L7ZA 3HOUJ 3HDDA 3IH3A 2X48A 2R5ZB 5H9TA 2HOAA 1JKOC 4M6VA 5FKNA 3FK6A 2LK2A 1GV5A 3BG9A 4MXMA 4IHXA 2HYJA 2CQXA 4M3EA 4J19A 3UKGA 1YRNB 3A01A 1IC8A 5C44J 3S2HJ 3GTGJ 5HAWA 1H88C 3CCYA 4A3JJ 3COLA 2L7MP 1JGGA 4YZEA 4DYCA 4LOCA 1RKTA 4XRSA 2VUMJ 2ID6A 1SFOJ 3HB9A 3NI7A 2ZCNA 5FKOA 4JL3A 3BT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTI A;  2JA6 J;  4IHY A;  4DYQ A;  4MFD A;  3C2B A;  1JTY A;  4I76 A;  2Y9Z A;  1ZGW A;  5M3F J;  5E3N A;  1IJW C;  2VPR A;  2R5Z A;  4V2F A;  2GM4 A;  2WB1 N;  2CU7 A;  5FJ8 J;  5EDN A;  2JA7 J;  4G12 A;  3TED A;  3BG3 A;  2QWT A;  4JKZ A;  3H3V K;  2R5Y A;  1D5Y A;  2ZOZ A;  2NS7 A;  1U78 A;  1MBF A;  3HTA A;  3EUP A;  5FKM A;  2P81 A;  2W48 A;  2QIB A;  2YVH A;  3QBM A;  1QVU A;  4GFB A;  5F0F A;  1ITY A;  2XB5 A;  3V6G A;  3AQT A;  1WGX A;  3G56 A;  1JUM A;  3CQZ J;  3FRQ A;  1I50 J;  2JA8 J;  3PAS A;  4MFE A;  5EYR A;  2H1K A;  2AO9 A;  3ON4 A;  3S16 J;  1DU0 A;  3E7L A;  3VPR A;  1JT0 A;  2N8G A;  5IPA A;  3GEU A;  4D5F A;  3NAU A;  2DA5 A;  3B6A A;  2HOT A;  3GTP J;  3G7R A;  1RES A;  3JRB A;  5J1R A;  3S1R J;  2JWT A;  2XGD A;  2TCT A;  3O8G A;  1TWC J;  3ZQH A;  4GFL A;  2LP0 A;  3BR2 A;  2K9N A;  4A3I J;  2GEN A;  4XIC A;  3OSF A;  2QOP A;  1PUF A;  1WI3 A;  1XC5 A;  2LD5 A;  2EZK A;  2Y2Z A;  1QRY A;  4M3D A;  3CJD A;  3TW7 A;  2R92 J;  4C3J J;  3JR9 A;  4Y52 J;  2EBI A;  4AC0 A;  3VVX A;  2EZL A;  2FX0 A;  5J1U A;  5JLX A;  3GTQ J;  4M3F A;  2PZ9 A;  1OFC X;  1JUS A;  4ABZ A;  4W1U A;  2GUH A;  5BNG A;  3O8H A;  3VP5 A;  3B81 A;  3RZD J;  5IP6 A;  4CYC B;  3JRF A;  1QVT A;  1GDT A;  3D1N I;  4BBS J;  1VI0 A;  4ICH A;  5C4Y A;  1LFB A;  4MLO A;  2XPU A;  3GTJ J;  4B4C A;  3TP0 A;  1MSE C;  1FIP A;  2O7T A;  2YUS A;  1U9O A;  5EZG A;  1A6I A;  3HGG A;  4GFK A;  2FD5 A;  2X6O A;  1UHS A;  4FTH A;  3TP3 A;  1A5J A;  1ETY A;  2HXO A;  3GTM J;  4A3K J;  1BW5 A;  3HE0 A;  4MO7 A;  2B63 J;  3A01 B;  5D19 A;  5DAJ A;  2DJN A;  2XB0 X;  2E2H J;  4NN1 A;  2ME0 A;  4D5C A;  5M5X J;  4M3G A;  2M9H A;  3BTJ A;  1Z0X A;  3MKL A;  2ZCX A;  3GZI A;  1EF4 A;  3KZ9 A;  5IOY A;  4CYC A;  2K40 A;  3ZQG A;  4AF5 A;  2KDZ A;  3S2D J;  2M34 A;  2MSY A;  4UUT A;  3S5R A;  5C4J J;  2ECC A;  3LNQ A;  1JKQ C;  3LSP A;  3JRH A;  2REK A;  2AHQ A;  1OCP A;  2D6Y A;  2RAS A;  1ZR4 A;  3NXC A;  1IV6 A;  3LSG A;  3S1N J;  3S14 J;  1RKW A;  3FIS A;  4Y7N J;  3V78 A;  3M4O J;  1FIA A;  2LLK A;  3NAR A;  2R5Y B;  2NX4 A;  3ZQC A;  3ANP A;  5FGL A;  5E3L A;  3Q0W A;  1X2M A;  3IUV A;  1B72 A;  4RBO A;  2G7G A;  2F07 A;  2ID3 A;  2OER A;  3VW0 A;  1SGM A;  4A3M J;  2XPV A;  1S7E A;  3GTO J;  3JRD A;  1UMQ A;  1MNM C;  1SAN A;  3HBL A;  2ZB9 A;  4W97 A;  2M8G X;  3K7A J;  3MN2 A;  3RKQ A;  1ETV A;  1OJL A;  3RD3 A;  5GP9 A;  4A3E J;  3A02 A;  1AHD P;  3LWJ A;  1NTC A;  3HOY J;  3BQY A;  3IH4 A;  3VIB A;  5F08 A;  2O8K A;  3WHC A;  2G7L A;  4HKU A;  5EFY A;  2DMT A;  5HBU A;  1JKP C;  5F1J A;  1ENH A;  3LOC A;  1ZR2 A;  2DMN A;  4UDS A;  4BKX A;  3QKX A;  2Y31 A;  3VOX A;  1FTT A;  5K7Z A;  2X9D A;  5DTD A;  3PPB A;  3ZQF A;  3ZQL A;  5M5Y J;  1RET A;  1X2N A;  1IDY A;  3VVY A;  1PUF B;  4JP0 A;  2NVQ J;  3BNI A;  1F36 A;  5HOD A;  2OI8 A;  5GPC A;  1ZTR A;  4FIS A;  3GBG A;  3BR6 A;  1NK3 P;  2JN6 A;  4RDU A;  3HIM A;  2M0C A;  4DZJ A;  2HI3 A;  2PBX A;  4A93 J;  2JMW A;  4EEF G;  1DU6 A;  2DTZ A;  2WV1 A;  3LJL A;  2CUE A;  2HQ5 A;  3QQA A;  1U8B A;  4BY7 J;  3KNW A;  3KKC A;  1HDP A;  2CJJ A;  3DCF A;  2R0Q C;  4HNV A;  4XID A;  2ZCM A;  4FCY A;  4ACI A;  1IUF A;  3JRE A;  2UXH A;  3CWR A;  2MGQ A;  3BRU A;  2QKO A;  1K61 A;  5D18 A;  3RH2 A;  2ECB A;  3I4N J;  3JRI A;  1ZK8 A;  3NPI A;  3GTL J;  3C07 A;  2GLO A;  3SDG A;  1G2H A;  1RPW A;  2JJ7 A;  4BXX J;  1TWA J;  1LFU P;  2OF7 A;  2LTP A;  3BQZ A;  3HEF A;  2DA6 A;  2E19 A;  1FEX A;  2EZH A;  2TRT A;  4X1E A;  2ME6 A;  5F0C A;  1HDD C;  2CUF A;  2COB A;  2GFN A;  5E3M A;  5C4X J;  4B1R A;  5CXG A;  5IYB J;  4BY1 J;  3F0C A;  3K2A A;  1UI5 A;  2HDD A;  1I3Q J;  1U9N A;  4DZP A;  3T6N A;  1AKH B;  1VF9 A;  3BG5 A;  2G7S A;  2UXO A;  3I4M J;  5AQC A;  1T56 A;  2CQQ A;  1ORK A;  3OIO A;  1ETK A;  3WHB A;  4QIW N;  2NP3 A;  3VUQ A;  4PXI A;  4NEL A;  3GTK J;  2QTQ A;  5EZH A;  1B72 B;  2WGB A;  2DG8 A;  2ZOY A;  1MBE A;  2OPT A;  1T33 A;  2K9Q A;  2FJ1 A;  5FMP A;  5IP7 J;  1AU7 A;  1POG A;  3LSR A;  4XRS G;  5IOZ A;  3JRA A;  5FHP A;  1OCT C;  3OSG A;  3VOK A;  1TWF J;  1FJL A;  3BHQ A;  1VND A;  4D7M A;  1HCR A;  2XSD C;  3P9T A;  5JLW A;  1VFC A;  1HF0 A;  1AKH A;  3HTJ A;  4XRM A;  1UG2 A;  3VW2 A;  1Y1V J;  2DMQ A;  2I10 A;  2DA4 A;  3JRG A;  5FKK A;  2DA1 A;  1O4X A;  2DG7 A;  4QTR A;  1X58 A;  2G0E A;  5EF6 A;  2VI6 A;  2W53 A;  3ZOB A;  3BR3 A;  1MBK A;  4GCT A;  1I6H J;  2HYT A;  4UUS A;  5CW8 A;  2DA3 A;  3B6C A;  1WH7 A;  3BR0 A;  9ANT A;  5IYD J;  2LFB A;  5EGO A;  3FIW A;  2UXP A;  4DW6 A;  4D7N A;  2YU9 J;  1IDZ A;  4C2M J;  4MIM A;  1TWH J;  3HOV J;  4B3A A;  1W0T A;  4FE4 A;  1GVD A;  3OOU A;  5C3E J;  4I6Z A;  1BA5 A;  4GCK A;  3E7Q A;  2Y0S N;  3PO2 J;  1MH3 A;  3HM5 A;  5D1R A;  3JSJ A;  4IHW A;  3S1Q J;  2L7F P;  2NS8 A;  2NVX J;  1GV2 A;  1MH4 A;  3BR5 A;  4MK6 A;  3G1M A;  3IH2 A;  5F04 A;  2DA7 A;  4M3B A;  2XRL A;  2DMP A;  2GBY A;  5F27 A;  2JA5 J;  5E3O A;  2LR8 A;  3G1L A;  3VVZ A;  1FTZ A;  3HTH A;  2E2J J;  4A3D J;  5EG0 B;  4NDL A;  1JT6 A;  1XS9 A;  2H8R A;  4C3I J;  4BBR J;  2UXU A;  1JTX A;  3FKI J;  2UXI A;  2RHA A;  2WAQ N;  3SJM A;  1LE8 B;  2IBD A;  3DPJ A;  3L1P A;  2E1O A;  2NP5 A;  2VKE A;  3HOW J;  5K58 A;  2Y30 A;  1YRN A;  2FQ4 A;  1RR7 A;  3BCG A;  3CDL A;  3Q0U A;  2O7O A;  2VKV A;  2FBQ A;  2NVY J;  3HKZ N;  5EEA A;  1APL C;  2EH3 A;  1K83 J;  3HTI A;  3HGY A;  3Q3S A;  2QCO A;  4KWA A;  1BW6 A;  2XDN A;  2HKU A;  2IEK A;  3JRC A;  3RZO J;  2R93 J;  5EG0 A;  5IP9 J;  4A3L J;  3NNR A;  3QPL A;  5K7F A;  1BJZ A;  3FK7 A;  1H89 C;  1JJ6 C;  3NRG A;  4AUX A;  3F1B A;  1UI6 A;  1ETQ A;  3EGQ A;  4QSH A;  3S15 J;  4DYR A;  1LE8 A;  3BTL A;  3HOZ J;  3ANG A;  2ELK A;  2YS9 A;  1P7I A;  3BR1 A;  3BJB A;  3CRJ A;  4JX5 A;  5K7H A;  1TC3 C;  2EQR A;  1ZKG A;  2Y9Y A;  3S17 J;  4AC6 A;  1R9T J;  2HXI A;  3Q0V A;  3W6V A;  2R7Z J;  1MBH A;  3LSJ A;  2XPW A;  2L0K A;  1WCM J;  2LVS A;  3PO3 J;  2G3B A;  5M3M J;  2MG4 A;  5FLV A;  2EZI A;  2WUI A;  2XGC A;  4A3C J;  1IRZ A;  4CGR A;  3RQI A;  4X6A J;  4C3H J;  2K9S A;  3BTC A;  2QF7 A;  3IV5 A;  1GT0 C;  1JUP A;  2NVT J;  2E2I J;  3O60 A;  2NOG A;  5HSZ A;  4FE7 A;  4JX4 A;  2JK3 A;  2LY9 A;  5DS9 A;  1P7J A;  2PMZ N;  1E3O C;  1NK2 P;  1QPI A;  2O9L A;  4JNN A;  1HOM A;  5F0H A;  1BL0 A;  4L62 A;  2YVE A;  1B8I B;  2Q24 A;  2M2E A;  4IEJ A;  1IG7 A;  3MNL A;  1JKR C;  2RAE A;  3AQS A;  3ZQI A;  5M5W J;  1JJ8 C;  3H0G J;  1ETO A;  3PM1 A;  4UUS B;  1Y1W J;  4AYB N;  3CMY A;  3QPS A;  2IU5 A;  2DN0 A;  5EGO B;  2KT0 A;  3ON2 A;  5J1Y A;  2CRG A;  1MBG A;  1IGN A;  1WPK A;  3KKD A;  4ME9 A;  2L9R A;  3VW1 A;  1MBJ A;  2DA2 A;  1GUU A;  4A3G J;  1W0U A;  3TW6 A;  5FLM J;  4A3F J;  1ETX A;  1CQT A;  1ETW A;  2D5V A;  4JX6 A;  2IAI A;  1WH5 A;  4V2G A;  4GCL A;  4JYK A;  4A3B J;  2HOS A;  4A69 C;  2DMU A;  4XK4 A;  5IYC J;  5GPA A;  5J3L A;  2V57 A;  4S0H B;  3M3Y J;  1HLV A;  1ZQ3 P;  1B8I A;  4IHV A;  1MSF C;  1F43 A;  3SFI A;  3A03 A;  3G1O A;  2XGE A;  2MW8 A;  3LHQ A;  1H8A C;  1Q1V A;  1Z77 A;  5FKL A;  3HOX J;  1TWG J;  1XG1 A;  3S1M J;  3MVP A;  2LKX A;  5CXI A;  3DEW A;  4L5E A;  2L7Z A;  3HOU J;  3HDD A;  3IH3 A;  2X48 A;  2R5Z B;  5H9T A;  2HOA A;  1JKO C;  4M6V A;  5FKN A;  3FK6 A;  2LK2 A;  1GV5 A;  3BG9 A;  4MXM A;  4IHX A;  2HYJ A;  2CQX A;  4M3E A;  4J19 A;  3UKG A;  1YRN B;  3A01 A;  1IC8 A;  5C44 J;  3S2H J;  3GTG J;  5HAW A;  1H88 C;  3CCY A;  4A3J J;  3COL A;  2L7M P;  1JGG A;  4YZE A;  4DYC A;  4LOC A;  1RKT A;  4XRS A;  2VUM J;  2ID6 A;  1SFO J;  3HB9 A;  3NI7 A;  2ZCN A;  5FKO A;  4JL3 A;  3BT9 A; 
#chains in the Genus database with same CATH topology
 1KQ9 A;  3BTI A;  1U6G A;  4DYQ A;  2A68 F;  2DO7 A;  3C2B A;  1JTY A;  2GQQ A;  2Y9Z A;  1HC8 A;  1WZ2 A;  1VQ7 I;  4DBQ A;  2VPR A;  4V2F A;  1KU2 A;  3HSF A;  3S2W A;  2DOF A;  4G12 A;  3OYB A;  2QWT A;  1A35 A;  2Z2S B;  2R5Y A;  4RLQ A;  1U78 A;  2XAF A;  2Y48 A;  1Z6R A;  1VQN I;  2QIB A;  2DW4 A;  2A69 F;  3LQR A;  3DTI A;  4Y17 A;  2XB5 A;  3V6G A;  1U5T B;  2P5V A;  2NYX A;  3AQT A;  3G56 A;  1Z1D A;  3CQZ J;  2JPB A;  2KDO A;  1SEU A;  4MFE A;  3BG6 A;  2AXT C;  1Y8R B;  3S16 J;  2DI3 A;  3E7L A;  3VPR A;  4EGY A;  2EA4 A;  1JT0 A;  4CXF A;  2W85 A;  1ZLJ A;  2KRF A;  3WU2 C;  3IAM 2;  3GLL A;  3B6A A;  2HOT A;  3S3N A;  3G7R A;  3FMS A;  2QQA A;  2WB1 A;  1EH6 A;  5D4R A;  2O6G E;  1TWC J;  2ZME C;  4GFL A;  4ZYG A;  4KMF A;  4HQE A;  3I55 I;  4XIC A;  1Z6T A;  2QOP A;  1IO2 A;  3CF2 A;  2LD5 A;  1RC9 A;  3GYH X;  3CJQ B;  2EZK A;  5ERI A;  3I9V 2;  2V1X A;  1TQP A;  4M3D A;  4TV7 A;  3JSO A;  2W7N A;  1QBJ A;  3LAP A;  4XLA A;  4Y52 J;  4CCL A;  2M3A A;  1Z7L A;  3CES A;  3BPX A;  2FX0 A;  3BRO A;  2Q0O A;  3HUG B;  3I64 A;  4QLC U;  4IRI A;  3S3O A;  4Y13 A;  2Z9O A;  1OFC X;  2DK5 A;  3BDD A;  5BNG A;  2HVQ A;  3AG4 H;  4GXO A;  3L00 A;  1K6Y A;  4CYC B;  1GDT A;  3ASN H;  4LIT A;  5H20 A;  2OCE A;  4PSW A;  1LFB A;  3LA7 A;  2XPU A;  4MLO A;  3GTJ J;  3IP4 B;  4B4C A;  1R1T A;  4CO8 A;  3CCQ I;  4B47 A;  1FIP A;  1LUJ B;  1U9O A;  3FXM A;  4XLF A;  5L3F A;  1VQO I;  3L9F A;  1A6I A;  3HGG A;  1K4T A;  2BVL A;  1JHH A;  1Y8Q B;  2EK5 A;  4AID A;  3J7Y J;  1ODD A;  2H94 A;  3TO9 A;  3TP3 A;  2HXO A;  2VQH A;  3PSI A;  4FX4 A;  2QLZ A;  3PQJ A;  5BOX A;  5D19 A;  5DAJ A;  4PFO A;  3QAH A;  4JQF A;  1W4M A;  1W5T A;  2E2H J;  5E1Z B;  2MH9 A;  1LVA A;  3NS4 A;  1D0X A;  4CYD A;  2M9H A;  1MIJ A;  4GDF A;  3SEQ A;  5E8I A;  4B43 A;  5IOY A;  4KIS A;  3CJR B;  2KDZ A;  1WI9 A;  2KJC A;  2M34 A;  3I53 A;  1QHG A;  4JOM A;  4RS8 A;  1YJ9 I;  2NVU B;  2ECC A;  3L2C A;  3N4M A;  1VQ8 I;  3P9C A;  4IKF A;  3JRH A;  3LSM A;  2RAS A;  2MAB A;  4KT6 A;  3S1N J;  3S14 J;  1RKW A;  4WCG A;  3M4O J;  1Y0N A;  2LLK A;  4U88 A;  3ANP A;  5FD5 A;  2ADU A;  2F5C A;  2OER A;  2A05 A;  1RRJ A;  3JRD A;  4PJL A;  1R58 A;  2IS2 A;  3HBL A;  1UCR A;  2M45 A;  2M8G X;  2ZB9 A;  3MN2 A;  5FFZ A;  1ZG1 A;  1ETV A;  2DYR H;  2KIQ A;  4A3E J;  3O3K A;  3C18 A;  3IC7 A;  3FKJ A;  1AHD P;  3LWJ A;  1G3T A;  3IAS 2;  3VIB A;  2ZBK A;  2G7L A;  4HKU A;  5HBU A;  1JKP C;  2KLO A;  3HXL A;  1ENH A;  2QZ8 A;  4OU0 A;  3L2U A;  1Y6I A;  2DMN A;  2W00 A;  2Y31 A;  4B8X A;  5E1W A;  5H6R A;  2PJR B;  4IQJ A;  3SZG A;  5CJ9 A;  2E7W A;  2Z1D A;  3EQL F;  1J5Y A;  4XL9 A;  4G9Y A;  4JP0 A;  2NVQ J;  4UXN A;  5ILS A;  2RVC A;  4C2M A;  1UZC A;  2FUG 2;  3BR6 A;  4I7H A;  1Z7U A;  5A2Q Z;  2EWN A;  3HIM A;  4DZJ A;  2HI3 A;  2ZME A;  3K8P C;  4HSR A;  1LNW A;  3L7W A;  3DEU A;  4XLP F;  4Q5S F;  2DTZ A;  2CUE A;  2LG4 A;  5B1A H;  2R7T A;  4IQ4 A;  1G3S A;  2P7C B;  3MFK A;  3KKC A;  1XDU A;  1HDP A;  2H09 A;  1KGS A;  4HNV A;  4G7Z F;  4OD4 A;  1D1A A;  3LSH A;  2AQF A;  5K1Y A;  3JRE A;  5ICE A;  1K7A A;  1J59 A;  3F8C A;  1S3J A;  5F6F A;  3DPT A;  4BEH A;  2PEX A;  5BQT A;  1R5G A;  1K61 A;  1CF7 B;  3TO7 A;  3RH2 A;  2V7F A;  5IT9 Z;  2DXI A;  3I4N J;  1ZK8 A;  2HR3 A;  3NPI A;  3RYR A;  2GLO A;  4FX0 A;  2OA4 A;  3E6C C;  2OF7 A;  3F72 A;  1BOB A;  4QPQ A;  5BS6 A;  2EV0 A;  3I58 A;  2DA6 A;  2NOJ B;  5HNF A;  1FEX A;  3BJO A;  1K79 A;  2TRT A;  4RB1 A;  5IT9 K;  1X3Z B;  5F0C A;  1HDD C;  3QU6 A;  2YR2 A;  3GWZ A;  5JR3 A;  5C4X J;  3OYK A;  2YPR A;  1UI5 A;  2LRD A;  2MFZ A;  5DEQ A;  4DZP A;  1C0W A;  1OMI A;  2HNH A;  1A36 A;  2HTS A;  2UXO A;  1XGO A;  2TDX A;  5AQC A;  1QHH D;  1T56 A;  1ORK A;  3VUQ A;  3WHB A;  4NEL A;  3V8K A;  3KLN A;  3HZJ A;  2VL8 A;  2QTQ A;  5E17 F;  4M72 A;  3QYB A;  3VSK A;  3FXJ A;  3OYF A;  2K9Q A;  2P6S A;  3V8J A;  2FBH A;  2EFP A;  1T95 A;  2CFO A;  1MW7 A;  4ZDO A;  1HXD A;  2HYG D;  5IP7 J;  4E7L A;  1POG A;  4Q48 A;  4XRS G;  5IOZ A;  3LSR A;  3JRA A;  5DUI A;  2WBM A;  4RM3 A;  3OSG A;  1J7K A;  1VTN C;  4D7M A;  1HCR A;  2XSD C;  5HVQ C;  1OCC H;  4MEY F;  4A6E A;  4S05 A;  3KCC A;  1L3L A;  2M1B A;  1MMG A;  3CMM A;  1FOW A;  3PUF A;  5FGM A;  3FMQ A;  1YE9 A;  3VSL A;  1UEL B;  2FNA A;  1P4A A;  1Y1V J;  2DMQ A;  4HX8 A;  4HW0 A;  2VBZ A;  2I10 A;  2FSW A;  3TMO A;  3H0D A;  5FKK A;  4E7S A;  4UVC A;  2ZJR F;  2STT A;  5CVU A;  2W53 A;  2ZNZ A;  3PNY A;  2BY2 A;  2F5E A;  1PP8 F;  1W1W E;  3KZI C;  3BR3 A;  5CKT A;  2OD5 A;  1XMK A;  2PX9 A;  4OOI A;  3B6C A;  3BR0 A;  1WH7 A;  1ZGJ A;  3IWF A;  5KCM A;  3G4S I;  9ANT A;  2BOL A;  4AYB A;  4J01 A;  1VQK I;  2E35 A;  4D7N A;  1IDZ A;  3R61 A;  4C2M J;  4MTD A;  1TWH J;  1W0T A;  2R7D A;  3ZRG A;  2HKO A;  3E7Q A;  4EM0 B;  1P2F A;  1YX3 A;  3F23 A;  4C2T A;  4ZYE A;  2HKX A;  1FP2 A;  1J2X A;  1WJE A;  4IHW A;  1FSE A;  3S1Q J;  2XHK A;  2L02 A;  4UNO A;  4IJA A;  2NVX J;  3C2G A;  1GV2 A;  2VE9 A;  3GCM A;  3G1M A;  2DOA A;  1LB2 A;  2DA7 A;  2CW7 A;  3CCS I;  3WE2 A;  2JA5 J;  1FTZ A;  2RQP A;  3VYS B;  1PDN C;  4A3D J;  2QBY A;  3J80 K;  4IOC F;  3HTS B;  1A31 A;  1XS9 A;  2CGP A;  4A2U A;  1IZ1 A;  1Y56 A;  2L9S A;  2FA5 A;  3E6M A;  3FKI J;  1J0R A;  2WAQ N;  2VXD A;  3L1P A;  2G9W A;  2FML A;  2NP5 A;  2Z16 A;  1XSV A;  2UUZ A;  4XSZ F;  3HOW J;  4I0A A;  3W3C A;  2Y30 A;  1B6A A;  3F21 A;  1RR7 A;  2DOE A;  5LD2 C;  1QZZ A;  4QPO A;  3B73 A;  2VKD A;  5EEA A;  3GFI A;  1D3Y A;  3E5U A;  1APL C;  2EH3 A;  3KZY A;  2L54 A;  3HTI A;  2KIS A;  3ABU A;  1JGS A;  1YO5 C;  2F5D A;  2XDN A;  2CUJ A;  2DFE A;  3F22 A;  3FXQ A;  2FNP A;  4PUS A;  5HDK A;  4KIC A;  2EV6 A;  5DCM B;  3FK7 A;  3MCZ A;  2V79 A;  4DYR A;  1O57 A;  1RNL A;  3H5N A;  5AIQ A;  3BR1 A;  3CRJ A;  3PSF A;  1CGP A;  1H9T A;  2EQR A;  4HZF A;  2IA0 A;  2IGK A;  3LWF A;  3BC8 A;  3AG3 H;  5D8K B;  1GXP A;  3WTZ A;  5D5U B;  3TBI A;  4C2U A;  1YFH A;  2R7Z J;  3HPH A;  1MBH A;  4XOR A;  2ZJQ F;  3HL2 A;  2IPQ X;  2LVS A;  1IXS B;  3PO3 J;  2MG4 A;  3MMY B;  2XGC A;  2A6E F;  1U5T A;  4HLX A;  4CDG A;  3HKZ A;  4E6K G;  3OYN A;  4A3C J;  1M1E B;  4C30 A;  3FXR A;  4ZZD A;  2LY9 A;  3DP7 A;  1P7J A;  1UFM A;  3FMR A;  3QOD A;  2QQB A;  4KT5 C;  4BE0 A;  1QPI A;  2WTE A;  4II3 A;  2QWW A;  4F52 A;  4UHT A;  4L62 A;  1B8I B;  2Q24 A;  2KIU A;  3H36 A;  3MNL A;  4YIR X;  2A6T A;  1IV8 A;  3EYI A;  3ZQI A;  2K4B A;  1XX5 A;  3OS2 A;  4YEL A;  2KZV A;  1G3W A;  5KAF C;  5CLS A;  5F64 A;  3WOD F;  2EV5 A;  2DQL A;  5EGO B;  3ON2 A;  3GW2 A;  3RIR A;  1W5S A;  3K69 A;  1MBG A;  2VC1 A;  3JTG A;  4RLF A;  2VT3 A;  2BW3 B;  1GUU A;  3HYI A;  3M1E A;  4A3F J;  1CQT A;  2D5V A;  1ETW A;  4S04 A;  4JX6 A;  3JAM K;  2IAI A;  1WH5 A;  3AAF A;  2VXZ A;  4GCL A;  3RKW A;  3HUG A;  1ZAO A;  4A69 C;  4WXH A;  5IYC J;  4LFU A;  2HYF A;  1YI2 I;  3M3Y J;  1QZY A;  2O8X A;  2STW A;  4IHV A;  3CUO A;  3A03 A;  4WXC A;  3VDX A;  3FBI B;  2XGE A;  2MW8 A;  2M4G A;  2VQG A;  4ESB A;  3F3X A;  1Z77 A;  2CV0 A;  3K1N A;  3HOX J;  1TWG J;  1XG1 A;  2M0M A;  1S7A A;  1WJB A;  2XAQ A;  3DU6 A;  4L5E A;  1BR1 A;  1HST A;  2OJE D;  2LKX A;  4X0G A;  1SMY F;  3IH3 A;  3RYP A;  1EKE A;  2XAJ A;  5DUK A;  4M6V A;  5FKN A;  2BE5 F;  1GV5 A;  3BG9 A;  2IT0 A;  4HQM A;  2CQX A;  2KKO A;  2FOW A;  5L3B A;  4U9L A;  1IC8 A;  4KJZ A;  5C44 J;  1F1Z A;  3S2H J;  1FC3 A;  5HAW A;  3CCY A;  3FXL A;  2FF4 A;  2EFW A;  2XAS A;  4XKW A;  3V42 A;  4YII A;  4XRS A;  1USS A;  2ID6 A;  1XGS A;  4HAM A;  3SZT A;  2W25 A;  4BGD A;  1YS7 A;  3E6B A;  4YFN F;  3JSP A;  2R7V A;  4MFD A;  1OPC A;  2JVG A;  4UV8 A;  4EJT A;  4ESF A;  4EJU A;  4G8X A;  4EGZ A;  3H9J A;  1IJW C;  2F6C A;  3KZZ A;  3FM3 A;  2RNG A;  2CU7 A;  2JA7 J;  2X1E A;  4XKV A;  3OL4 A;  3BG3 A;  4IPA A;  2RDP A;  3NQO A;  2ZOZ A;  3DXJ F;  3BCB A;  5JI6 A;  2P81 A;  2W48 A;  1TNS A;  2JA2 A;  1QVU A;  4Y15 A;  3IL2 A;  4GFB A;  2GWR A;  4OD5 A;  3WTY C;  1I1S A;  2ISY A;  1WGX A;  1JUM A;  3FRQ A;  3DKW A;  2LY2 A;  1DPU A;  1YS6 A;  1DU0 A;  3Q9V A;  2R7W A;  1W7P B;  2DBB A;  2DK8 A;  4L9N A;  1WRJ A;  1PJR A;  2N8G A;  2WY7 Q;  4WK8 F;  2H27 A;  4IO9 F;  1V3F A;  3W6J B;  2BYV E;  1OQY A;  4OWR B;  5HNH A;  5HDG A;  3AFH A;  3GTP J;  2UZK A;  3T5X A;  2C6Y A;  4KN4 X;  2XKP A;  4HOB A;  2G7H A;  5J1R A;  3CUQ B;  2G7U A;  2XGD A;  3ZQH A;  3BR2 A;  3RCO A;  3NWT A;  2GEN A;  2DDB A;  4FET A;  1WI3 A;  1XC5 A;  4E7H A;  6PAX A;  1N25 A;  2M8E A;  2MH2 A;  2XDV A;  2HVR A;  1F9N A;  1QRY A;  3K1M A;  4K2E A;  1QO0 D;  3M1C A;  3BY6 A;  1FY7 A;  1SC7 A;  1EH8 A;  2EBI A;  3R60 A;  2WWY A;  2EZL A;  1E0E A;  5J1U A;  3REO A;  3GTQ J;  1FSH A;  3BZ6 A;  4M3F A;  4N4N B;  3T1B A;  2CQN A;  3VOD A;  3HRT A;  4PSX A;  3RZD J;  5IP6 A;  1YIT I;  4P9F A;  1Z91 A;  2Z3Y A;  3EYY A;  2X6Y A;  4ZYA A;  2K85 A;  3K0L A;  4BBS J;  4F91 B;  5J8C A;  3GFL A;  3TP0 A;  2PI0 A;  2O7T A;  2YX4 A;  2YUS A;  3SZP A;  1G59 A;  1G8X A;  1U8R A;  5EZG A;  1H9G A;  3OIP A;  3W2A A;  2VOO A;  3TQN A;  3KP3 A;  3MWM A;  4AIJ A;  4V19 K;  2H8W A;  4ZH4 F;  3OYL A;  2FD5 A;  2DT6 A;  1HA8 A;  3KYD B;  1UHS A;  3LMM A;  1J9I A;  1RUO A;  3HE0 A;  5EEH A;  1OKR A;  4P1W A;  3IRQ A;  4PGH A;  1SFX A;  2MD0 A;  2ME0 A;  3TKY A;  4AIH A;  3MKL A;  2ZCX A;  1YJW I;  4E7J A;  2K40 A;  2OQG A;  4XSX F;  4XM3 A;  4AF5 A;  5CYV A;  3OYM A;  2MSY A;  5H2F C;  2J5P A;  3DKX A;  3RQ4 A;  3M9A A;  4A6D A;  4N0B A;  2P5K A;  2CYY A;  1JKQ C;  2P8T A;  3WGI A;  2EFO A;  3E1S A;  2CO5 A;  1ZR4 A;  5GTH C;  3NXC A;  1IV6 A;  4BE1 A;  2FE3 A;  2BEO A;  3CP2 A;  2NNY A;  2OUM A;  2VQL A;  3ERM A;  3NAR A;  1ACI A;  2NX4 A;  3ZQC A;  2NRA C;  2GA2 A;  3WG7 H;  1MDM B;  4A3M J;  3GTO J;  1MNM C;  1WFX A;  4W97 A;  3K7A J;  2PFV A;  3GZ6 A;  4CUG A;  1OJL A;  2ELJ A;  2K9L A;  2FBK A;  2O3F A;  3CMA I;  2Q2E A;  2Z5U A;  4XOT A;  4PJM A;  3KFW X;  5GAH J;  4ON0 A;  3IH4 A;  2O8K A;  1FLI A;  2BXY A;  1LPQ A;  1D1C A;  1B1B A;  1EH7 A;  5J6X A;  3RPQ A;  3WTT C;  2ICW G;  1Z9C A;  3X2Q H;  2IA2 A;  4GRI A;  4CCJ A;  3FXO A;  2OV7 A;  1KZH A;  3ZN1 A;  3QYF A;  2K7L A;  2IA1 A;  2WY8 Q;  1X1A A;  1L0O C;  2EFQ A;  4CA0 A;  3OY9 A;  3P5J A;  1RET A;  1BBY A;  3I59 B;  1R7J A;  1QA6 A;  2VJ4 A;  3VVY A;  1JHF A;  2LSO A;  3OMY A;  2E5N A;  3BNI A;  4HRI A;  5HOD A;  4NNJ A;  1V4R A;  3T8T A;  2HQN A;  2K02 A;  3GBG A;  2QA4 I;  1U3E M;  4RB0 A;  3HTU A;  1DPR A;  5FB2 A;  2JN6 A;  4CIC A;  4MEX F;  3UNG C;  4HX7 A;  3U1K A;  1MJA A;  1FMW A;  1DU6 A;  2WV1 A;  3HOT A;  3LJL A;  3QQA A;  1Z3X A;  3KNW A;  4HF1 A;  4G6D A;  5J40 A;  5LBQ A;  4XID A;  3KET A;  3C7J A;  1IUF A;  2Q1Z B;  5FRO A;  4ZDL A;  2A3S A;  2MGQ A;  1D1B A;  4UUV A;  3BRU A;  4KIF A;  2JVH A;  4XMY A;  2QKO A;  3G73 A;  2HGC A;  1FOK A;  3F8F A;  1BJA A;  5HS7 A;  4NHJ A;  2LMD A;  3JRI A;  3GTL J;  3C07 A;  1N75 A;  3BCA A;  3FXK A;  3TO6 A;  2LTP A;  1Q1H A;  3HEF A;  4KN7 X;  2MLG A;  1XCB A;  2DAO A;  2K9M A;  2VBY A;  2ME6 A;  3WTU C;  2AS5 F;  4Y3O A;  3MEX A;  2CUF A;  2QQ9 A;  1ZEL A;  2COB A;  1FT9 A;  4B1R A;  5CXG A;  5IYB J;  1G4D A;  3CLO A;  3SWH A;  3ECH A;  4MTE A;  2HDD A;  1I3Q J;  4HA8 A;  1IUY A;  1AKH B;  3HHG A;  3BG5 A;  1KU9 A;  1OCZ H;  4PJ0 C;  1IW7 F;  2NP3 A;  3OIO A;  2Y69 H;  3OYA A;  2HPI A;  1I39 A;  4FAS D;  4LIU A;  3CD6 I;  3F6O A;  1WVR A;  1EV7 A;  2WGB A;  2DG8 A;  2ZOY A;  4XNF A;  1T33 A;  5J47 A;  2E36 A;  4EMS A;  5LHH A;  2WAD A;  2L4A A;  2V6E A;  1XB4 A;  5KNL A;  2LNB A;  1MD0 A;  1Z3Y A;  4BJT A;  5CQG A;  3KEO A;  1U0J A;  4NQW B;  4EAT A;  3A0B C;  2BY3 A;  2FBI A;  2F5V A;  2K4J A;  5JHU A;  1FJL A;  2WC2 A;  2ZXI A;  2LY1 A;  2PMU A;  4EJW A;  3GME A;  2R3S A;  3CJT B;  3P9T A;  2XAH A;  1VFC A;  1HF0 A;  2E1N A;  3MKZ A;  3HTJ A;  2QSH X;  1KYZ A;  1UG2 A;  1T98 A;  1OYI A;  5D6E A;  3VW2 A;  3ESW B;  3H1C A;  2RC4 A;  2QSF X;  2FU4 A;  4LG3 A;  4LLN A;  3H3U A;  2BHZ A;  2A6H F;  2DA4 A;  2A61 A;  3F8N A;  4IVN A;  4RB2 C;  5HS9 A;  1X58 A;  2DFF A;  2E60 A;  2VI6 A;  2ZXH A;  3ZN0 A;  2EA2 A;  1SD5 A;  1I6H J;  2PN6 A;  2R7Q A;  1TTY A;  2EIK H;  3QOE A;  2VQC A;  4PGG A;  3H35 A;  4L5J A;  2XRO A;  4I0B A;  4BJ6 C;  5HOO A;  5EGO A;  1NHA A;  1Y39 A;  2I5U A;  3F9K A;  3HOV J;  2ZXJ A;  4I6Z A;  2V4J C;  2BW3 A;  1SFU A;  1YX5 A;  4GCK A;  5CQE A;  1DGW Y;  4I98 B;  3ZCO A;  1MH3 A;  5DD8 A;  1FYK A;  1ON2 A;  4OIQ F;  1IN4 A;  2FRH A;  4GYG A;  3HPG A;  4KMU X;  1QQI A;  1Z21 A;  3DU5 A;  2DQR A;  3ZQ7 A;  2NS8 A;  4UY8 I;  2DDA A;  3K4J A;  5KHD A;  3CME I;  2EFN A;  3A0H C;  2MD5 A;  1A04 A;  2DMP A;  5F27 A;  3K10 A;  3V4G A;  1R4M B;  3CC7 I;  3HTH A;  1R36 A;  4MGR A;  1K6O A;  2E2J J;  4PJN A;  4NDL A;  1WWX A;  5EG0 B;  3ROU A;  3GO5 A;  1JT6 A;  2LBF B;  5FD6 A;  2H8R A;  2FXA A;  2BV6 A;  3VFZ A;  2UXU A;  1JTX A;  2VJI A;  2CG4 A;  2R7X A;  4E7I A;  4HNT A;  3AG2 H;  2Y0S A;  1XPX A;  3AL0 C;  4BQN A;  3BCG A;  2Q8K A;  3CDL A;  3O2P E;  4P5O A;  5J4Y A;  3Q0U A;  2O7O A;  2VKV A;  3OYG A;  2FBQ A;  5L3D A;  2QCO A;  3HGY A;  3Q3S A;  1KU7 A;  2GXA A;  1BW6 A;  2ZCW A;  4CCM A;  1LQ1 A;  1YIO A;  3F8B A;  3JRC A;  3RZO J;  3ZMT A;  3BPV A;  2CMP A;  2R7O A;  3DWL E;  4ZTJ A;  2R93 J;  3NNR A;  1RUN A;  1KYW A;  1BI1 A;  2L5Q A;  1H89 C;  4PJJ A;  2XAG A;  4AUX A;  4ENK A;  1UI6 A;  1FNN A;  2GZW A;  4ANJ A;  1ETQ A;  3QP6 A;  3K9T A;  3S15 J;  4FT8 A;  1LE8 A;  1DP3 A;  4GO1 A;  3BJB A;  1ZGA A;  1V54 H;  5GTI C;  5ICC A;  2YU3 A;  5K7H A;  1TC3 C;  4LG0 B;  2JUG A;  3DTK A;  1E3H A;  1P4X A;  2EJR A;  2H1L A;  4AC6 A;  3Q0V A;  4O3M A;  4HG2 A;  3ZMS A;  2A5Y B;  3V7S A;  4H4K C;  3TGN A;  3R0A A;  1WCM J;  1R1V A;  4UB6 C;  2XUB A;  2LYC A;  1O3S A;  2EZI A;  3G2B A;  3F6V A;  3GLX A;  3SDB A;  3RQI A;  4MQ9 F;  2K9S A;  3BTC A;  3DBL B;  2E2I J;  5HSZ A;  2JK3 A;  2O9L A;  1F5T A;  3ZMV A;  2Y75 A;  1HOM A;  2IP2 A;  3DEE A;  3IWZ A;  1BC8 C;  1P6R A;  4CZC A;  2M2E A;  1IG7 A;  3PJR A;  2ZJP F;  1U5T C;  1IRF A;  1JI8 A;  1TT5 B;  3CUQ A;  5M5W J;  2HPM A;  1LEA A;  1ETO A;  3PM1 A;  4UUS B;  1Y1W J;  5LGT A;  3CMY A;  1ON1 A;  2OBP A;  2IU5 A;  2WV0 A;  2L4M A;  1NG7 A;  2CRG A;  3QU3 A;  4M73 A;  3QWL A;  2NNN A;  2L9R A;  2DT7 B;  2DA2 A;  4Z6Y A;  1W0U A;  4M9Z A;  2UWM A;  1ETX A;  4M71 A;  1W36 C;  1HBX G;  3RPU A;  4V2G A;  1Z67 A;  4JYK A;  4BHC A;  5K5Q A;  1HW1 A;  2HOS A;  5F1R A;  3WTS C;  2DMU A;  4DQ2 A;  4WF2 A;  2PMZ A;  2XGX A;  4S0H B;  3KYC B;  1HLV A;  1ZQ3 P;  4LJZ F;  1MSF C;  4RA2 A;  3OL3 A;  2F4I A;  3IUO A;  3ZGK A;  3LHQ A;  1R00 A;  5HDN A;  2CW8 A;  1QZE A;  3KPH A;  2E1M B;  2W1O A;  2FMY A;  1ZRD A;  3DEW A;  1MNE A;  2UXX A;  2X48 A;  2GIV A;  5H9T A;  1JKO C;  3SHF A;  3CCJ I;  4MXM A;  3E5X A;  4M3E A;  4YIF A;  5E18 F;  2KFD A;  4G7H F;  1UHM A;  4D1Q A;  4YEJ A;  1LEB A;  3FF5 A;  4ASN A;  2V1N A;  3J80 Z;  4IL6 C;  2QKM B;  1UHW A;  2XVC A;  2LF7 A;  5DM6 F;  2L7M P;  2V9K A;  1RKT A;  4IRH A;  1IAW A;  2Z33 A;  3HB9 A;  4XLH A;  1FBU A;  4MK6 A;  5FLX Z;  3GZ5 A;  3BT9 A;  5EJC A;  1O3R A;  1LDK B;  5K5O A;  2BY1 A;  4KUM A;  1HW2 A;  2JA6 J;  4IHY A;  3ABK H;  2KZG A;  4I76 A;  1IF1 A;  4BQO A;  4LK0 F;  5E3N A;  3CCU I;  1XGN A;  4MQV A;  2R5Z A;  2GM4 A;  1FWZ A;  2WB1 N;  5FLX K;  2F48 A;  2HDC A;  4JKZ A;  1D5Y A;  2NXN B;  2NS7 A;  4BL0 B;  1MBF A;  3U21 A;  3HTA A;  5FO5 A;  3EUP A;  3S32 A;  3J7Z I;  1D8K A;  1MDM A;  1BC7 C;  3QBM A;  3CO6 C;  2CH0 A;  2X85 A;  1ITY A;  2HZD A;  4PDK A;  1EJ9 A;  1KQ0 A;  1XCV A;  5DD4 A;  1I50 J;  5TIS C;  2H1K A;  2JSP A;  2AO9 A;  5JFR A;  3ON4 A;  3EDP A;  5ED4 A;  2CQK A;  3Q9S A;  5HLI A;  5IPA A;  3GEU A;  4AVZ A;  3WU0 A;  2DA5 A;  5CVJ A;  1FOX A;  2L01 A;  5AIP A;  1RES A;  3VYT B;  4LIV A;  4G7O F;  5TGT A;  3L2W A;  3I0T A;  1SFE A;  3CC4 I;  2TCT A;  2DYS H;  3RKX A;  3KYL A;  4U0W A;  3D5R C;  2K9N A;  3OYI A;  3W2V A;  4J00 A;  4A3I J;  1NH3 A;  3OSF A;  4BQA A;  3BZC A;  2RV8 A;  1FZP B;  2IGM A;  2VT2 A;  1N77 A;  3SEZ A;  2CS3 A;  2NAZ A;  3CP8 A;  2PLY A;  3CCL I;  2F2E A;  2ZC2 A;  3TW7 A;  2LRE A;  3E3V A;  4C3J J;  1PYV A;  3ZPL A;  1SD6 A;  4LMY A;  2L3D A;  3WGG A;  3OYE A;  4DNC A;  3OR1 C;  1HKQ A;  1HSJ A;  2QVO A;  3D5S C;  2XSJ C;  3DLL F;  1JUS A;  4ABZ A;  3VEP A;  1OR7 C;  3O8H A;  2E34 A;  3JRF A;  3DBH B;  4I01 A;  1VI0 A;  3ZMU A;  4WX9 A;  2D45 A;  3S8P A;  4ICH A;  5C4Y A;  5FRN A;  3M7G A;  2R7S A;  2ESN A;  3W2W A;  3G71 I;  3MZ8 A;  1MSE C;  1XDS A;  3JAM Z;  4I99 C;  4KIT B;  1S5L C;  1YOV B;  5LEK A;  1YJN I;  3IKV A;  5CPR B;  4AIK A;  2BY0 A;  5TRD A;  1IN7 A;  2X6O A;  4FTH A;  1VQM I;  2HEO A;  1ETY A;  2DTR A;  1MMA A;  3E6D A;  1BW5 A;  3H9G A;  3F8M A;  2KRC A;  2CUZ A;  3BJA A;  4DGW B;  3A01 B;  2XKO A;  2IXS A;  4IOA F;  3DV8 A;  1DDN A;  1D0Z A;  3J7A Y;  4N9I A;  4II2 A;  2HZT A;  4D5C A;  2RN7 A;  4BNC A;  4ETS A;  3QPH A;  3BTJ A;  2OCC H;  3E5Q A;  4ESJ A;  1EF4 A;  3DLA A;  4CYC A;  3PUB A;  2IW5 A;  5LEJ A;  4UUT A;  1O3T A;  2VJ5 A;  4ZYD A;  3LNQ A;  3GFJ A;  4E7K A;  3LSP A;  2REK A;  4H0E A;  2D6Y A;  1TP4 A;  4U0V A;  2M4K A;  3LSG A;  2P0W A;  3ECO A;  3FIS A;  4Y7N J;  3MKY B;  5D5X B;  1W36 D;  3Q0W A;  1S6L A;  3IUV A;  2G7G A;  2F07 A;  2JPC A;  3VW0 A;  2I8D A;  1MKM A;  1SGM A;  3ML6 A;  1SMT A;  4WWC A;  3HOS A;  1SAN A;  2HQR A;  2VON A;  1SD7 A;  4BYY A;  1OIS A;  4U7B A;  1W5C C;  1ZYR F;  5E79 C;  4NQW A;  5CVI A;  1FYL A;  3KEQ A;  2ZME B;  1T39 A;  1NTC A;  1TNT A;  3HOY J;  4EV0 A;  4E70 A;  3K4N A;  3WHC A;  5EFY A;  4E7Z A;  2M87 A;  4OMZ A;  4BKX A;  4N9H A;  3VOX A;  4U0Y A;  1FTT A;  3P9I A;  2X9D A;  4I09 A;  3EUK L;  5DTD A;  3PPB A;  3ZQF A;  3GF2 A;  5M5Y J;  4BH9 A;  1X2N A;  2OZU A;  2R7F A;  3GEZ A;  4BEH B;  1PUF B;  4WXD A;  1Z05 A;  3FBN B;  3QP5 A;  1F36 A;  2GAU A;  3LQQ A;  2OI8 A;  1ZTR A;  1O7F A;  4FIS A;  1YW7 A;  4XN0 A;  2X4H A;  2PQ8 A;  3VWB A;  4CHU A;  5E8G A;  1NK3 P;  5KK1 A;  4QWQ A;  4ITV A;  2LDU A;  4NB5 A;  1I27 A;  4A93 J;  4M9S A;  3HRM A;  2JMW A;  4Q4Z F;  1RIO H;  3P7N A;  2E7X A;  2HQ5 A;  1HKS A;  3PFI A;  1MJB A;  4BY7 J;  4CGZ A;  2MLK A;  3OYH A;  1VQ4 I;  2DJI A;  2PJR A;  2ZO4 A;  3DCF A;  2R0Q C;  4ACI A;  4FCY A;  2UXH A;  2OTL I;  5DM7 F;  3A2K A;  1UG0 A;  2IJL A;  3GUD A;  2MYS A;  4R1H A;  2QEX I;  3COA C;  1OR7 A;  2ECB A;  2XC7 A;  3DKY A;  3UR3 C;  1E17 A;  3MAJ A;  5EEG A;  2RKH A;  1X19 A;  3CDI A;  3SDG A;  3JW4 A;  1RPW A;  2JJ7 A;  1G2H A;  1TWA J;  4MNU A;  4ZJZ A;  2H6C A;  5D5W B;  3BQZ A;  3SXY A;  2E19 A;  2EZH A;  4LLG F;  4X1E A;  3TL4 X;  4DVY P;  2QUF A;  1WJA A;  2GFN A;  3U1D A;  1HKT A;  4PFP A;  3MKW B;  1JXS A;  4PCQ A;  2K27 A;  3F0C A;  3LL7 A;  3QYE A;  2L7K A;  4L9J A;  2VKH A;  1O7L A;  1U9N A;  1ONV A;  1VQ9 I;  2O61 A;  3T6N A;  2KQR A;  3T8R A;  1VF9 A;  1ZHF A;  1CF7 A;  1E2X A;  4HPQ A;  1R5H A;  3S93 A;  3KP7 A;  3V8L A;  4QIW N;  4ZYH A;  3ZP5 A;  4PXI A;  2ISZ A;  1BIA A;  2XRN A;  4NC7 A;  3BOQ A;  1WHU A;  1S7O A;  1X3U A;  3TOB A;  2BHY A;  2DT5 A;  3M07 A;  4BDZ A;  1MBE A;  2OPT A;  1S72 I;  1X1P A;  1B72 B;  2B9S A;  2H6B A;  4UVB A;  1X1D A;  2HTJ A;  4GGG A;  1SAU A;  1AU7 A;  5FHP A;  4CCN A;  3E0J B;  1MMS A;  2VBW A;  1OCT C;  3WTW C;  2KIF A;  3VOK A;  4HF0 A;  1TWF J;  4PZJ A;  2YX7 A;  3BHQ A;  1VND A;  4B09 A;  3PNV A;  3MZH A;  2HFH A;  1BI3 A;  3M8J A;  4XRM A;  1T0F A;  4EVI A;  2ACJ A;  1MJ9 A;  2COM A;  3PQK A;  3N05 A;  3QOP A;  3BJ6 A;  1ULY A;  4BU2 A;  2DG7 A;  1LKX A;  3RSN A;  1R1U A;  2KHM A;  1K78 B;  3L2R A;  3ZOB A;  2MC3 A;  2GXG A;  3GX4 X;  4UUS A;  1ZLK A;  2HYT A;  2OAZ A;  2DA3 A;  3WE3 A;  1WQ2 A;  2F4M B;  5IYD J;  1T08 B;  2LFB A;  3J81 K;  2XF6 A;  3FIW A;  4L0Z B;  1IN5 A;  5HLH A;  1D5V A;  4MIM A;  3TDZ C;  2IGN A;  3RTR A;  1GVD A;  1V5F A;  1BA5 A;  2HQA A;  1PVE A;  2FQ3 A;  4HDV A;  3V7R A;  3PO2 J;  3BP8 A;  4IHS A;  5D6F A;  3HM5 A;  1TW2 A;  3JSJ A;  3RDI A;  2L7F P;  3VB2 A;  1ZAR A;  1E3P A;  4XLE A;  1IN6 A;  1B4A A;  2OQR A;  2V6C A;  4PK4 A;  3IKT A;  5DYM A;  1B9N A;  3BR5 A;  4HDU A;  3T0Y A;  4RAF A;  1QGP A;  5F04 A;  5DDG A;  1X1B A;  2HOE A;  5J8F A;  2KJB A;  3DPU A;  3H9Q A;  5E3O A;  3VVZ A;  3NRV A;  2FOK A;  4AM3 A;  4HLY A;  5B3S H;  1TW3 A;  1DUX C;  2OTJ I;  4GYI A;  4CSW A;  2R7R A;  4C3I J;  4XKC A;  4BBR J;  3CCE I;  4D9J A;  4AD9 A;  2D1H A;  3LA3 A;  3SJM A;  1B59 A;  1TT0 A;  3K70 C;  4RGX A;  3SQN A;  5LHG A;  3AKZ A;  1AWC A;  3K2Z A;  1STZ A;  1V55 H;  4BAC A;  2K3P A;  1IN8 A;  2VOP A;  1X1C A;  4HV6 A;  5K58 A;  2FQ4 A;  3O6B B;  1VQ5 I;  1FOY A;  2X1C A;  3HKZ N;  4BJ5 C;  3CJN A;  3MZY A;  1K83 J;  5FFX A;  4KWA A;  2PG4 A;  1OCR H;  2BZT A;  2R7U A;  1ERD A;  2HKU A;  4A3L J;  1SD4 A;  3HSE A;  3QPL A;  5K7F A;  1BJZ A;  4R79 A;  5D4S A;  1JJ6 C;  3NRG A;  3F1B A;  1PP7 U;  5ICG A;  1K4S A;  2X1D A;  4QSH A;  1QPM A;  3R6S A;  3SYT A;  3HOZ J;  3BTL A;  3LFU A;  2ELK A;  1I6X A;  1P7I A;  2WAQ A;  1WJ5 A;  1GHC A;  3K4B A;  4AU7 A;  2P6T A;  2W4S A;  2OC6 A;  1ZKG A;  3ZXS A;  3S17 J;  4U87 A;  3W6K B;  3KE2 A;  2HXI A;  5LFA A;  3WTV C;  1R9T J;  1XN7 A;  3W6V A;  4L9T A;  4C9Y A;  2IS4 A;  3LSJ A;  2GOX B;  2XPW A;  2V9V A;  1TZL A;  4R8H A;  4BUP A;  3LA2 A;  4CGR A;  4X6A J;  2IS6 A;  2QF7 A;  1GT0 C;  1JUP A;  2KP6 A;  1LVK A;  2ZSH B;  3WU1 B;  5BPD A;  2O5R A;  4FE7 A;  4JX4 A;  1I1G A;  1X4P A;  5DS9 A;  4IXA A;  5DCM A;  1E3O C;  4HV5 A;  5ICF A;  5KVR A;  3KEY A;  2DPD A;  4LK1 F;  5HLT A;  1BL0 A;  2IVM A;  3EPZ A;  2DU9 A;  3M8E A;  1I3A A;  2QKL B;  4OAZ A;  4IEJ A;  4EJO A;  4KA4 A;  2RAE A;  4OAY A;  3VOE A;  3AQS A;  2W24 A;  1JJ8 C;  3H0G J;  1J09 A;  3CTA A;  2ESH A;  3QPS A;  1OYY A;  4BE2 A;  2DN0 A;  3H3Z A;  3VYU B;  4M9X A;  4F55 A;  3HRU A;  3PIO F;  2KT0 A;  5J1Y A;  4P9U A;  3KKD A;  3C3W A;  1WPK A;  1D0Y A;  3AG1 H;  4ME9 A;  3VW1 A;  2LH9 A;  1MBJ A;  2ZNY A;  3TW6 A;  1OLT A;  2CQ7 A;  2FEZ A;  3CUQ C;  3K4C A;  1LDJ A;  2F4O B;  4O6J A;  4A3B J;  2PBI A;  4HYE A;  4ENM A;  1YHQ I;  5HS8 A;  4P55 A;  5GPA A;  4I02 A;  3KLO A;  3KP2 A;  4OIN F;  1B8I A;  4LB6 B;  2GOM A;  3ABM H;  1ZRE A;  1F43 A;  2QSG X;  4KFC A;  3SFI A;  3G1O A;  1F4K A;  2JSC A;  2XIG A;  2KPM A;  2D1V A;  1LJ9 A;  3R0J A;  1Q1V A;  4RGU A;  4UV9 A;  5FKL A;  5JHF A;  3MVP A;  1MZB A;  3HOU J;  3HDD A;  1R22 A;  2HOA A;  2LK2 A;  2EIN H;  4XQF A;  3CDH A;  4IHX A;  4OMY A;  3ZQQ A;  2HYJ A;  1BN5 A;  1BR2 A;  1P9Q C;  3K4L A;  3OS0 A;  4J19 A;  2KL4 A;  3DBR B;  4G6Q A;  1XSD A;  2CFX A;  3UKG A;  2OZ6 A;  1YRN B;  1AA7 A;  2WAF A;  1MMN A;  5LRS A;  3A01 A;  2VC0 A;  3GTG J;  1ZN2 A;  4M74 A;  5E20 A;  2GIZ A;  2ELH A;  1XMA A;  3I3L A;  1H88 C;  1H0M A;  1JGG A;  3ISP A;  2PJP A;  4YZE A;  5D5V B;  2VUM J;  3NI7 A;  1LFP A;  3HIF A;  2ZCN A;  3DPL C;  2MBF A;  1FPQ A;  3QRF F;  4HX4 A;  3WTX C;  3HJE A;  5KAI C;  2QGU A;  1ZGW A;  5M3F J;  1D8J A;  3ASO H;  4YFK F;  5FJ8 J;  5EDN A;  5LRR A;  3TED A;  1MND A;  4NC8 A;  3H3V K;  3PFY A;  3EET A;  5FKM A;  2VLA A;  2PMH A;  2XAU A;  1VZ0 A;  4KIG A;  5BPI A;  2YVH A;  2WA0 A;  4YRV A;  5F0F A;  3CLQ A;  1KA8 A;  3I56 I;  2YVX A;  3WGH A;  5L3E A;  1ZG5 A;  4EJV A;  4A5M A;  2JA8 J;  3PAS A;  5EYR A;  2BXZ A;  2P4W A;  4OIO F;  3SFZ A;  3FDY A;  3I4P A;  3BWG A;  4D5F A;  3NAU A;  4HBL A;  5A2Q K;  5TJJ A;  3K70 D;  3FWE A;  4JK1 X;  2JRM A;  3JRB A;  4CCK A;  3S1R J;  2JWT A;  3O8G A;  2LP0 A;  3LSK A;  5BMZ A;  1PUF A;  2VAS A;  4RAY A;  1FX7 A;  1YW9 A;  3OR2 C;  4LGW A;  4Y4R A;  3KP6 A;  2Y2Z A;  3PIP F;  2FJI 1;  1SVL A;  3CJD A;  4KNY A;  3EUH C;  4B44 A;  2E71 A;  2R92 J;  3K1P A;  3JR9 A;  1DP7 P;  4RAZ A;  4AC0 A;  4F3Q A;  4U9N A;  3VVX A;  5JLX A;  4XN3 A;  1W7P A;  3FM5 A;  1OYW A;  1SAX A;  2PZ9 A;  4EQQ A;  4W1U A;  2GUH A;  4DBR A;  3VP5 A;  1A6Q A;  3B81 A;  1QVT A;  3D1N I;  3ABT A;  1N78 A;  4B3X A;  3ULQ B;  1T8I A;  3FX3 A;  3D0S A;  3Q5F A;  2JQ7 A;  2E5Z A;  2P5L C;  4ZC3 A;  3PNT A;  1V5E A;  3FXU A;  2DFI A;  5IY5 H;  1BI0 A;  3QPT A;  1S9H A;  2Z99 A;  3H5A A;  3S3M A;  1X3W B;  4GFK A;  3BZK A;  1YW8 A;  1A5J A;  1FBS A;  2R4G A;  4A3K J;  3GTM J;  4DJA A;  3JTH A;  2E1C A;  4MO7 A;  3EUA A;  2B63 J;  2DJN A;  4BXF A;  4EM1 A;  2XB0 X;  4NN1 A;  3IRR A;  1IXR C;  5M5X J;  4M3G A;  2B7E A;  3KX2 A;  4OIP F;  1Z0X A;  3ERE D;  3GZI A;  3VTI A;  2Q2E B;  3KZ9 A;  3GZN B;  3ZQG A;  3S2D J;  4AVP A;  4XLC A;  5LGN A;  3S5R A;  1HW5 A;  5C4J J;  4U7D A;  3HRS A;  2KIM A;  1W7P D;  2B0L A;  1I5Z A;  4M6Y A;  2AHQ A;  1OCP A;  1FYM A;  2DOD A;  4GCV A;  4RM2 A;  2RGV A;  3V78 A;  1FIA A;  2R5Y B;  5FGL A;  5E3L A;  1X2M A;  2J5O A;  1UB9 A;  1B72 A;  4RBO A;  3LST A;  2ID3 A;  3K4K A;  2XPV A;  1S7E A;  4XRF A;  1UMQ A;  4L5I A;  2DCE A;  3RKQ A;  3L09 A;  4CH7 A;  3RD3 A;  2Y0M A;  5GP9 A;  3A02 A;  4BQQ A;  1S29 A;  3L2Q A;  1J75 A;  3BQY A;  5DCF A;  5F08 A;  3RPU D;  1R23 A;  2DMT A;  5JVT A;  4YG2 F;  2QYO A;  5F1J A;  3LOC A;  1ZR2 A;  4UDS A;  3QKX A;  2HS5 A;  5K7Z A;  3OYC A;  5J4V A;  3HHH A;  4BDY A;  5LHI A;  1Y0U A;  1YTY A;  2B1E A;  2OU2 A;  3ZQL A;  4LLL A;  3CC2 I;  1IDY A;  1K78 A;  3M8F A;  3FHN A;  1WJF A;  1YG2 A;  3L2V A;  1RR8 C;  2W82 A;  2XF7 A;  3E97 A;  5GPC A;  2IRF G;  2W84 A;  3CO7 C;  3ONQ A;  4ENN A;  4RDU A;  2V26 A;  3CCR I;  2M0C A;  4HEA 2;  4NC6 A;  1YYV A;  2PBX A;  3G3Z A;  4UB8 C;  2KMU A;  2VE8 A;  4EEF G;  4EM2 A;  1DGR M;  2EPF A;  4RMN A;  1P4W A;  4A12 A;  1AOY A;  1U8B A;  2EIM H;  3LFK A;  3EUH A;  1NG6 A;  2CJJ A;  1B9M A;  2EIJ H;  2PFB A;  2RNJ A;  3TDU C;  2ZCM A;  2M30 A;  2K3F A;  2A07 F;  1RI7 A;  5LLQ A;  1TLH B;  3I59 A;  3CWR A;  3RKY A;  5B66 C;  1TL8 A;  4KDP A;  5B1B H;  5FRM A;  1T2K A;  5D18 A;  1SVO A;  3I54 A;  1FMV A;  1G6N A;  1BM9 A;  1IRX A;  4ENJ A;  3A4C A;  2LF8 A;  2HU9 A;  4LD5 A;  5AON A;  4BXX J;  1LFU P;  4F92 B;  4XON A;  2JZY A;  2V9P A;  4BHP A;  3HSR A;  5H6Q A;  2CW0 F;  5DV5 A;  3K4M A;  1X4O A;  2X6X A;  4KIB A;  2IS1 A;  2L9N A;  5E3M A;  2VJJ A;  3KP5 A;  4BY1 J;  1SVM A;  2CWE A;  3K2A A;  1WKM A;  4N4O B;  1BOA A;  1ZG3 A;  3ELK A;  2O0Y A;  1WJC A;  4F93 B;  1REP C;  4CCO A;  3IHU A;  3I71 A;  2ZKZ A;  4UVA A;  2G7S A;  4HNU A;  2UXN A;  3GXO A;  3I4M J;  2CQQ A;  4YFX F;  1ETK A;  4IX7 A;  4L18 B;  1KON A;  1EA3 A;  3GTK J;  1KQ8 A;  2F5F A;  5GAG J;  2DFH A;  5EZH A;  4L9V A;  1O3Q A;  2V1U A;  2A5W A;  4ZZL A;  3RI4 A;  1GVJ A;  1JE8 A;  2FJ1 A;  2JUC A;  4BXU A;  5FMP A;  2MC4 A;  2CSO A;  1XTA A;  4ZDP A;  2DLL A;  2ZFW A;  4NUB A;  2HWV A;  5L3C A;  2QM3 A;  4Q47 A;  4A0X A;  1VQL I;  4DIQ A;  1LDD A;  1MGT A;  4NBQ A;  1UAA A;  5JLW A;  1PUE E;  1AKH A;  2BGC A;  5CVR A;  2ZXW H;  2QQ8 A;  3R4K A;  2M5W A;  2XF5 A;  2VB6 A;  4A0Z A;  3G6E I;  4FQG A;  3HC7 A;  3KIO A;  1ZH5 A;  2HDW A;  3JRG A;  2DA1 A;  1O4X A;  4QTR A;  3MD2 A;  1U2W A;  3PL8 A;  3V7C A;  2G0E A;  5EF6 A;  1XSX A;  1MBK A;  2X0L A;  3CF5 F;  4GCT A;  1BI2 A;  5CW8 A;  1TBX A;  1RZ4 A;  5JVG F;  3GFM A;  1XMX A;  1T0F C;  3P9K A;  4A0Y A;  3CZ6 A;  5GAE J;  4IRV A;  2ZY9 A;  2UXP A;  2BVM A;  4DW6 A;  2A2F X;  2YU9 J;  1NK2 P;  4B3A A;  4FE4 A;  5IT3 A;  3OOU A;  5C3E J;  3FHZ A;  2Y0S N;  1OCO H;  2AQE A;  2V1D A;  5D1R A;  2BBY A;  4JBA A;  3U2R A;  3KP4 A;  1MH4 A;  3DTE A;  5B5E C;  1BIB A;  1T6S A;  3IH2 A;  3VYR B;  4M3B A;  2XRL A;  2ETH A;  3H5R A;  2GBY A;  4XKB A;  2LR8 A;  3G1L A;  5HLG A;  4P96 A;  3BLY A;  1P92 A;  3GVA A;  4A5N A;  2LKS A;  4IRG A;  4IF4 A;  1GXQ A;  2VN2 A;  2RQQ A;  1XD7 A;  1G3Y A;  3BG7 A;  3C2H A;  1R4N B;  3ZR8 X;  2UXI A;  2RHA A;  1LE8 B;  2ZSI B;  2IBD A;  1UJ8 A;  3DPJ A;  2P7V B;  1WSU A;  2E1O A;  4I2O A;  2VKE A;  1QU3 A;  2XV4 S;  1WJD A;  1YRN A;  4G6T B;  1YQA A;  2UV1 A;  4RGR A;  2D2W A;  2YSR A;  2M7B A;  2E1M C;  2JTV A;  4IHT A;  4HST A;  2NVY J;  1IRG A;  4Y33 A;  4MHG A;  1BR4 A;  3C1D A;  3OS1 A;  2DPU A;  2IEK A;  2M7A A;  5EG0 A;  4F7Z A;  5IP9 J;  1VQP I;  1VQ6 I;  2LBF A;  2VBX A;  1YIJ I;  4XOP A;  1TQM A;  3EGQ A;  3D5L A;  3NEU A;  3OIQ A;  5ILV A;  2L9V A;  5E1X A;  3ANG A;  2YS9 A;  1T38 A;  1TQI A;  4CZZ A;  5K5R A;  3MQ0 A;  4JX5 A;  1R49 A;  4FHT A;  3RJP A;  2Y9Y A;  4RB3 C;  1QNT A;  2K5C A;  3LSI A;  4B48 A;  2VOD A;  3A1Y A;  3U9G A;  4BHB A;  4D0P A;  2L0K A;  4LB5 A;  2LC2 A;  4BS9 A;  1DQU A;  5M3M J;  1S8N A;  5FLV A;  4AWX B;  2G3B A;  2WUI A;  4WIB A;  2ZJ2 A;  1IRZ A;  4XLN F;  4C3H J;  4RAG A;  3OV8 A;  2NVT J;  3ABL H;  3IV5 A;  3O60 A;  2NOG A;  1GLN A;  2PMZ N;  4JNN A;  2CV2 A;  2HVS A;  3I5U A;  2K86 A;  2LOO A;  2ZFU A;  1KU3 A;  5F0H A;  3CCM I;  2YVE A;  3NWS A;  3DQV C;  2GA1 A;  2L2O A;  4G94 A;  1JKR C;  4Z2Y A;  1SFK A;  2EIL H;  2IGO A;  2X6W A;  3OYD A;  4IZZ A;  4LG0 A;  1ZRC A;  1FBQ A;  4O5V A;  5D8L B;  2LKP A;  4AYB N;  4L0Y B;  3WG9 A;  1FP1 D;  1IGN A;  2MA3 A;  4KYW A;  2KRH A;  3OOP A;  1HQC A;  4XBF A;  2W57 A;  4A3G J;  5FLM J;  3OYJ A;  3OWT A;  4M6X A;  4RGS A;  4OIR F;  1R5I D;  3TOA A;  3H92 A;  3HG9 A;  2V57 A;  4XK4 A;  5J3L A;  1MMD A;  2CV1 A;  2NS0 A;  1XGM A;  3J81 Z;  4XR6 A;  3CCV I;  3LAJ A;  5L3G A;  1ZRF A;  1R6R A;  2B3W A;  3DF8 A;  1H8A C;  3JCU C;  5GAD J;  2QBY B;  3AL0 B;  2GXB A;  2JT1 A;  1R71 A;  3B02 A;  3S1M J;  1UST A;  1YLF A;  4ZTF A;  5CXI A;  5ILU A;  2L7Z A;  2R5Z B;  3DFG A;  2RRE A;  2WAE A;  2EB7 A;  3ZMD A;  2O03 A;  3FK6 A;  4HF2 A;  3K6G A;  1V5G A;  2QEN A;  2X51 A;  3ZMZ A;  3J7A O;  2VIX A;  5CVV A;  1IXC A;  3FZV A;  5LGU A;  4A3J J;  4DOZ A;  4E4H A;  2VPL A;  3COL A;  4DYC A;  4LOC A;  4BAY A;  2AXL A;  1SFO J;  4JL3 A;  3N97 A;  2JRT A;  5FKO A; 
#chains in the Genus database with same CATH homology
 3BTI A;  2JA6 J;  4IHY A;  4DYQ A;  4MFD A;  3C2B A;  1JTY A;  4I76 A;  2Y9Z A;  1ZGW A;  5M3F J;  5E3N A;  1IJW C;  2VPR A;  2R5Z A;  4V2F A;  2GM4 A;  2WB1 N;  2CU7 A;  5FJ8 J;  5EDN A;  2JA7 J;  4G12 A;  3TED A;  3BG3 A;  2QWT A;  4JKZ A;  3H3V K;  2R5Y A;  1D5Y A;  2ZOZ A;  2NS7 A;  1U78 A;  1MBF A;  3HTA A;  3EUP A;  5FKM A;  2P81 A;  2W48 A;  2QIB A;  2YVH A;  3QBM A;  1QVU A;  4GFB A;  5F0F A;  1ITY A;  2XB5 A;  3V6G A;  3AQT A;  1WGX A;  3G56 A;  1JUM A;  3CQZ J;  3FRQ A;  1I50 J;  2JA8 J;  3PAS A;  4MFE A;  5EYR A;  2H1K A;  2AO9 A;  3ON4 A;  3S16 J;  1DU0 A;  3E7L A;  3VPR A;  1JT0 A;  2N8G A;  5IPA A;  3GEU A;  4D5F A;  3NAU A;  2DA5 A;  3B6A A;  2HOT A;  3GTP J;  3G7R A;  1RES A;  3JRB A;  5J1R A;  3S1R J;  2JWT A;  2XGD A;  2TCT A;  3O8G A;  1TWC J;  3ZQH A;  4GFL A;  2LP0 A;  3BR2 A;  2K9N A;  4A3I J;  2GEN A;  4XIC A;  3OSF A;  2QOP A;  1PUF A;  1WI3 A;  1XC5 A;  2LD5 A;  2EZK A;  2Y2Z A;  1QRY A;  4M3D A;  3CJD A;  3TW7 A;  2R92 J;  4C3J J;  3JR9 A;  4Y52 J;  2EBI A;  4AC0 A;  3VVX A;  2EZL A;  2FX0 A;  5J1U A;  5JLX A;  3GTQ J;  4M3F A;  2PZ9 A;  1OFC X;  1JUS A;  4ABZ A;  4W1U A;  2GUH A;  5BNG A;  3O8H A;  3VP5 A;  3B81 A;  3RZD J;  5IP6 A;  4CYC B;  3JRF A;  1QVT A;  1GDT A;  3D1N I;  4BBS J;  1VI0 A;  4ICH A;  5C4Y A;  1LFB A;  4MLO A;  2XPU A;  3GTJ J;  4B4C A;  3TP0 A;  1MSE C;  1FIP A;  2O7T A;  2YUS A;  1U9O A;  5EZG A;  1A6I A;  3HGG A;  4GFK A;  2FD5 A;  2X6O A;  1UHS A;  4FTH A;  3TP3 A;  1A5J A;  1ETY A;  2HXO A;  3GTM J;  4A3K J;  1BW5 A;  3HE0 A;  4MO7 A;  2B63 J;  3A01 B;  5D19 A;  5DAJ A;  2DJN A;  2XB0 X;  2E2H J;  4NN1 A;  2ME0 A;  4D5C A;  5M5X J;  4M3G A;  2M9H A;  3BTJ A;  1Z0X A;  3MKL A;  2ZCX A;  3GZI A;  1EF4 A;  3KZ9 A;  5IOY A;  4CYC A;  2K40 A;  3ZQG A;  4AF5 A;  2KDZ A;  3S2D J;  2M34 A;  2MSY A;  4UUT A;  3S5R A;  5C4J J;  2ECC A;  3LNQ A;  1JKQ C;  3LSP A;  3JRH A;  2REK A;  2AHQ A;  1OCP A;  2D6Y A;  2RAS A;  1ZR4 A;  3NXC A;  1IV6 A;  3LSG A;  3S1N J;  3S14 J;  1RKW A;  3FIS A;  4Y7N J;  3V78 A;  3M4O J;  1FIA A;  2LLK A;  3NAR A;  2R5Y B;  2NX4 A;  3ZQC A;  3ANP A;  5FGL A;  5E3L A;  3Q0W A;  1X2M A;  3IUV A;  1B72 A;  4RBO A;  2G7G A;  2F07 A;  2ID3 A;  2OER A;  3VW0 A;  1SGM A;  4A3M J;  2XPV A;  1S7E A;  3GTO J;  3JRD A;  1UMQ A;  1MNM C;  1SAN A;  3HBL A;  2ZB9 A;  4W97 A;  2M8G X;  3K7A J;  3MN2 A;  3RKQ A;  1ETV A;  1OJL A;  3RD3 A;  5GP9 A;  4A3E J;  3A02 A;  1AHD P;  3LWJ A;  1NTC A;  3HOY J;  3BQY A;  3IH4 A;  3VIB A;  5F08 A;  2O8K A;  3WHC A;  2G7L A;  4HKU A;  5EFY A;  2DMT A;  5HBU A;  1JKP C;  5F1J A;  1ENH A;  3LOC A;  1ZR2 A;  2DMN A;  4UDS A;  4BKX A;  3QKX A;  2Y31 A;  3VOX A;  1FTT A;  5K7Z A;  2X9D A;  5DTD A;  3PPB A;  3ZQF A;  3ZQL A;  5M5Y J;  1RET A;  1X2N A;  1IDY A;  3VVY A;  1PUF B;  4JP0 A;  2NVQ J;  3BNI A;  1F36 A;  5HOD A;  2OI8 A;  5GPC A;  1ZTR A;  4FIS A;  3GBG A;  3BR6 A;  1NK3 P;  2JN6 A;  4RDU A;  3HIM A;  2M0C A;  4DZJ A;  2HI3 A;  2PBX A;  4A93 J;  2JMW A;  4EEF G;  1DU6 A;  2DTZ A;  2WV1 A;  3LJL A;  2CUE A;  2HQ5 A;  3QQA A;  1U8B A;  4BY7 J;  3KNW A;  3KKC A;  1HDP A;  2CJJ A;  3DCF A;  2R0Q C;  4HNV A;  4XID A;  2ZCM A;  4FCY A;  4ACI A;  1IUF A;  3JRE A;  2UXH A;  3CWR A;  2MGQ A;  3BRU A;  2QKO A;  1K61 A;  5D18 A;  3RH2 A;  2ECB A;  3I4N J;  3JRI A;  1ZK8 A;  3NPI A;  3GTL J;  3C07 A;  2GLO A;  3SDG A;  1G2H A;  1RPW A;  2JJ7 A;  4BXX J;  1TWA J;  1LFU P;  2OF7 A;  2LTP A;  3BQZ A;  3HEF A;  2DA6 A;  2E19 A;  1FEX A;  2EZH A;  2TRT A;  4X1E A;  2ME6 A;  5F0C A;  1HDD C;  2CUF A;  2COB A;  2GFN A;  5E3M A;  5C4X J;  4B1R A;  5CXG A;  5IYB J;  4BY1 J;  3F0C A;  3K2A A;  1UI5 A;  2HDD A;  1I3Q J;  1U9N A;  4DZP A;  3T6N A;  1AKH B;  1VF9 A;  3BG5 A;  2G7S A;  2UXO A;  3I4M J;  5AQC A;  1T56 A;  2CQQ A;  1ORK A;  3OIO A;  1ETK A;  3WHB A;  4QIW N;  2NP3 A;  3VUQ A;  4PXI A;  4NEL A;  3GTK J;  2QTQ A;  5EZH A;  1B72 B;  2WGB A;  2DG8 A;  2ZOY A;  1MBE A;  2OPT A;  1T33 A;  2K9Q A;  2FJ1 A;  5FMP A;  5IP7 J;  1AU7 A;  1POG A;  3LSR A;  4XRS G;  5IOZ A;  3JRA A;  5FHP A;  1OCT C;  3OSG A;  3VOK A;  1TWF J;  1FJL A;  3BHQ A;  1VND A;  4D7M A;  1HCR A;  2XSD C;  3P9T A;  5JLW A;  1VFC A;  1HF0 A;  1AKH A;  3HTJ A;  4XRM A;  1UG2 A;  3VW2 A;  1Y1V J;  2DMQ A;  2I10 A;  2DA4 A;  3JRG A;  5FKK A;  2DA1 A;  1O4X A;  2DG7 A;  4QTR A;  1X58 A;  2G0E A;  5EF6 A;  2VI6 A;  2W53 A;  3ZOB A;  3BR3 A;  1MBK A;  4GCT A;  1I6H J;  2HYT A;  4UUS A;  5CW8 A;  2DA3 A;  3B6C A;  1WH7 A;  3BR0 A;  9ANT A;  5IYD J;  2LFB A;  5EGO A;  3FIW A;  2UXP A;  4DW6 A;  4D7N A;  2YU9 J;  1IDZ A;  4C2M J;  4MIM A;  1TWH J;  3HOV J;  4B3A A;  1W0T A;  4FE4 A;  1GVD A;  3OOU A;  5C3E J;  4I6Z A;  1BA5 A;  4GCK A;  3E7Q A;  2Y0S N;  3PO2 J;  1MH3 A;  3HM5 A;  5D1R A;  3JSJ A;  4IHW A;  3S1Q J;  2L7F P;  2NS8 A;  2NVX J;  1GV2 A;  1MH4 A;  3BR5 A;  4MK6 A;  3G1M A;  3IH2 A;  5F04 A;  2DA7 A;  4M3B A;  2XRL A;  2DMP A;  2GBY A;  5F27 A;  2JA5 J;  5E3O A;  2LR8 A;  3G1L A;  3VVZ A;  1FTZ A;  3HTH A;  2E2J J;  4A3D J;  5EG0 B;  4NDL A;  1JT6 A;  1XS9 A;  2H8R A;  4C3I J;  4BBR J;  2UXU A;  1JTX A;  3FKI J;  2UXI A;  2RHA A;  2WAQ N;  3SJM A;  1LE8 B;  2IBD A;  3DPJ A;  3L1P A;  2E1O A;  2NP5 A;  2VKE A;  3HOW J;  5K58 A;  2Y30 A;  1YRN A;  2FQ4 A;  1RR7 A;  3BCG A;  3CDL A;  3Q0U A;  2O7O A;  2VKV A;  2FBQ A;  2NVY J;  3HKZ N;  5EEA A;  1APL C;  2EH3 A;  1K83 J;  3HTI A;  3HGY A;  3Q3S A;  2QCO A;  4KWA A;  1BW6 A;  2XDN A;  2HKU A;  2IEK A;  3JRC A;  3RZO J;  2R93 J;  5EG0 A;  5IP9 J;  4A3L J;  3NNR A;  3QPL A;  5K7F A;  1BJZ A;  3FK7 A;  1H89 C;  1JJ6 C;  3NRG A;  4AUX A;  3F1B A;  1UI6 A;  1ETQ A;  3EGQ A;  4QSH A;  3S15 J;  4DYR A;  1LE8 A;  3BTL A;  3HOZ J;  3ANG A;  2ELK A;  2YS9 A;  1P7I A;  3BR1 A;  3BJB A;  3CRJ A;  4JX5 A;  5K7H A;  1TC3 C;  2EQR A;  1ZKG A;  2Y9Y A;  3S17 J;  4AC6 A;  1R9T J;  2HXI A;  3Q0V A;  3W6V A;  2R7Z J;  1MBH A;  3LSJ A;  2XPW A;  2L0K A;  1WCM J;  2LVS A;  3PO3 J;  2G3B A;  5M3M J;  2MG4 A;  5FLV A;  2EZI A;  2WUI A;  2XGC A;  4A3C J;  1IRZ A;  4CGR A;  3RQI A;  4X6A J;  4C3H J;  2K9S A;  3BTC A;  2QF7 A;  3IV5 A;  1GT0 C;  1JUP A;  2NVT J;  2E2I J;  3O60 A;  2NOG A;  5HSZ A;  4FE7 A;  4JX4 A;  2JK3 A;  2LY9 A;  5DS9 A;  1P7J A;  2PMZ N;  1E3O C;  1NK2 P;  1QPI A;  2O9L A;  4JNN A;  1HOM A;  5F0H A;  1BL0 A;  4L62 A;  2YVE A;  1B8I B;  2Q24 A;  2M2E A;  4IEJ A;  1IG7 A;  3MNL A;  1JKR C;  2RAE A;  3AQS A;  3ZQI A;  5M5W J;  1JJ8 C;  3H0G J;  1ETO A;  3PM1 A;  4UUS B;  1Y1W J;  4AYB N;  3CMY A;  3QPS A;  2IU5 A;  2DN0 A;  5EGO B;  2KT0 A;  3ON2 A;  5J1Y A;  2CRG A;  1MBG A;  1IGN A;  1WPK A;  3KKD A;  4ME9 A;  2L9R A;  3VW1 A;  1MBJ A;  2DA2 A;  1GUU A;  4A3G J;  1W0U A;  3TW6 A;  5FLM J;  4A3F J;  1ETX A;  1CQT A;  1ETW A;  2D5V A;  4JX6 A;  2IAI A;  1WH5 A;  4V2G A;  4GCL A;  4JYK A;  4A3B J;  2HOS A;  4A69 C;  2DMU A;  4XK4 A;  5IYC J;  5GPA A;  5J3L A;  2V57 A;  4S0H B;  3M3Y J;  1HLV A;  1ZQ3 P;  1B8I A;  4IHV A;  1MSF C;  1F43 A;  3SFI A;  3A03 A;  3G1O A;  2XGE A;  2MW8 A;  3LHQ A;  1H8A C;  1Q1V A;  1Z77 A;  5FKL A;  3HOX J;  1TWG J;  1XG1 A;  3S1M J;  3MVP A;  2LKX A;  5CXI A;  3DEW A;  4L5E A;  2L7Z A;  3HOU J;  3HDD A;  3IH3 A;  2X48 A;  2R5Z B;  5H9T A;  2HOA A;  1JKO C;  4M6V A;  5FKN A;  3FK6 A;  2LK2 A;  1GV5 A;  3BG9 A;  4MXM A;  4IHX A;  2HYJ A;  2CQX A;  4M3E A;  4J19 A;  3UKG A;  1YRN B;  3A01 A;  1IC8 A;  5C44 J;  3S2H J;  3GTG J;  5HAW A;  1H88 C;  3CCY A;  4A3J J;  3COL A;  2L7M P;  1JGG A;  4YZE A;  4DYC A;  4LOC A;  1RKT A;  4XRS A;  2VUM J;  2ID6 A;  1SFO J;  3HB9 A;  3NI7 A;  2ZCN A;  5FKO A;  4JL3 A;  3BT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...