4W97A

Structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
196
structure length
196
Chain Sequence
RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor KstR2
publication title Structural and Functional Characterization of a Ketosteroid Transcriptional Regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 86
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w97A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w97A02
1WH7A 2Y2ZA 4XICA 3JSJA 3KKDA 2D6YA 3HDDA 1B72B 2XSDC 1ZR4A 5FGLA 3JRDA 1QPIA 4IHYA 3S1QJ 1I6HJ 4ICHA 2E2JJ 1MBKA 2R5ZA 2M34A 4Y7NJ 4IHXA 2JN6A 5F04A 1IGNA 2XDNA 2JA7J 1IV6A 1JGGA 5M5WJ 2FQ4A 1AHDP 3LWJA 5F0CA 3LSRA 1WCMJ 1JJ6C 2HKUA 3A01A 2HOTA 4UUSB 1IG7A 1JUPA 2LVSA 3TP0A 3TP3A 4RBOA 3ON4A 1F36A 1NK3P 1XS9A 3UKGA 1IJWC 2VKVA 3MVPA 3BQZA 1CQTA 2JA5J 2NVYJ 1Y1VJ 3BR2A 5J1YA 2R92J 2Y9YA 3O60A 3JRFA 2MW8A 5GPCA 1HF0A 4XRSA 1AU7A 5BNGA 5K7HA 3ZQCA 2NX4A 1TWHJ 3GBGA 4QSHA 2Y0SN 4MFEA 3JREA 2H1KA 1GV5A 3NI7A 3Q0WA 2LR8A 3LSJA 3OIOA 1SGMA 3GTLJ 3ON2A 1U8BA 1LE8A 3HOYJ 3TW7A 3LSGA 3GTQJ 4GCKA 5EG0A 5CXIA 5FKNA 3KZ9A 1TWGJ 5C4XJ 2DJNA 2WB1N 1JT0A 1ZKGA 4M3BA 9ANTA 1ETWA 1MH4A 2R5ZB 3P9TA 5C3EJ 4A3IJ 3HB9A 4BKXA 2M9HA 4M6VA 1ETQA 3IH3A 4AF5A 5HBUA 2FJ1A 4I6ZA 1FTZA 1R9TJ 4PXIA 2CQQA 2CU7A 1PUFA 2EBIA 2K9SA 1UMQA 2WUIA 4I76A 2LY9A 5D18A 1UHSA 3C2BA 2UXUA 3HTHA 1HOMA 2QWTA 1HLVA 2ELKA 1JT6A 1D5YA 2XGEA 3EUPA 4FISA 3BHQA 3S2HJ 3B6AA 4B3AA 3FIWA 2YS9A 3G1MA 4X1EA 4LOCA 3LNQA 2O7TA 4J19A 2JWTA 5K7ZA 5C4YA 1Z77A 3BT9A 3VP5A 3RH2A 5DTDA 2DMQA 5IP9J 4NDLA 3JRGA 1DU0A 3NRGA 3SDGA 5JLWA 2RASA 1VF9A 4XRSG 2DA4A 5IPAA 3HOXJ 4HNVA 3ZQFA 5JLXA 5AQCA 1IDZA 4IHVA 2XB5A 3HEFA 3EGQA 3VW2A 1OFCX 4M3DA 3D1NI 4BXXJ 4XIDA 4A3EJ 3S1RJ 1PUFB 1BA5A 3BTCA 2JK3A 2HQ5A 1H89C 3CRJA 3F1BA 2E19A 1MH3A 2OERA 1RESA 1I3QJ 2DA6A 3B6CA 3L1PA 2DMUA 3Q0UA 4MO7A 2H8RA 3OSFA 4DYCA 1MBFA 1JKQC 3VPRA 2LKXA 1ZR2A 3H3VK 1SANA 3CCYA 3LSPA 1GDTA 2V57A 3BQYA 1ETOA 3M3YJ 2G0EA 3LHQA 5K58A 2L7ZA 2LLKA 5EF6A 3BTIA 3HM5A 3MN2A 5IP6A 3JRBA 2W48A 2DA2A 2DA1A 4CGRA 4JL3A 2HYJA 2HYTA 1U78A 4AC6A 2XPUA 1APLC 1JTXA 2ZB9A 2TRTA 3HBLA 5FLMJ 2OPTA 1X2NA 5EGOB 2K9NA 2HXOA 3NARA 4DYQA 2R5YB 4DW6A 4XRMA 2G7LA 3S16J 1EF4A 2NS7A 2WAQN 3JRCA 3VVYA 3NAUA 2K9QA 3RQIA 1ETKA 3QKXA 4JKZA 2PMZN 3JRAA 2JA6J 2CQXA 1H8AC 4BBRJ 3VIBA 5IYDJ 3GEUA 4ACIA 2QIBA 2L7MP 3IH2A 4D7NA 4AUXA 4BY1J 2X48A 2ZCXA 1XC5A 5M5YJ 1NTCA 2QOPA 1WPKA 5HAWA 5M3FJ 1XG1A 4JYKA 5EEAA 2M0CA 3QQAA 2UXOA 4AYBN 2EZLA 1GV2A 3BG9A 3BG3A 1B8IA 4A3GJ 4BY7J 1MBGA 2KDZA 3W6VA 3PASA 5H9TA 3F0CA 2QCOA 1T33A 5EYRA 3TEDA 4G12A 2G7GA 5D1RA 3K2AA 2YVEA 1JUSA 2EZHA 3ZQHA 1IRZA 3C07A 2ZCNA 3JR9A 1W0TA 3MNLA 1JKOC 1ETYA 5C44J 2XRLA 2CRGA 1U9NA 3QPLA 3NXCA 3RZOJ 4UDSA 5EFYA 3PM1A 2GBYA 4A3MJ 3PO2J 1Y1WJ 1ETXA 2GUHA 2DMPA 5HODA 3GTJJ 1ENHA 2XGCA 3VW1A 3HOUJ 1ZK8A 2ECBA 2X6OA 3BR0A 3BCGA 3A02A 2GFNA 4DZPA 2RAEA 2IU5A 2FX0A 2AO9A 3TW6A 2DA5A 1TC3C 2HI3A 5HSZA 2DN0A 5CW8A 3CDLA 2WGBA 1U9OA 1B8IB 2VPRA 3GZIA 1X58A 4QTRA 3QBMA 4V2GA 4Y52J 2Y30A 2EZIA 3HOZJ 1WH5A 1RKTA 3RKQA 3V78A 2YVHA 2UXHA 3IV5A 2DA7A 3G7RA 1WGXA 2E2IJ 2NP3A 4BBSJ 4JX6A 2NVTJ 2EZKA 5EGOA 5DAJA 4V2FA 4AC0A 1I50J 3BJBA 2LFBA 3CMYA 2R5YA 1MNMC 3BR6A 4A3DJ 5EZGA 1ZGWA 3GTKJ 2NS8A 2JA8J 3DPJA 5IOYA 1JKPC 5EZHA 5GPAA 1MBEA 2R7ZJ 1K83J 2F07A 5FKOA 2ID3A 1G2HA 4M3GA 3T6NA 3NPIA 2EQRA 4DZJA 1TWFJ 2MG4A 2UXIA 1GVDA 1JTYA 3JRIA 2PZ9A 4JNNA 4ME9A 5E3OA 5FKLA 5IYCJ 2GENA 3Q0VA 3S1NJ 2K40A 1OJLA 2LP0A 3HKZN 1MBJA 2L7FP 4A3JJ 4A3CJ 2YUSA 4MK6A 2DMTA 4A3FJ 2L0KA 4C3IJ 1QVUA 1FTTA 1AKHA 5E3LA 5M5XJ 1RPWA 1LFBA 3Q3SA 3M4OJ 3BTJA 2P81A 3S1MJ 4MFDA 3HGGA 3VVZA 1H88C 1E3OC 3DCFA 4MLOA 4FTHA 3S15J 1QRYA 1GUUA 3FK6A 3LOCA 3SFIA 2ME0A 3WHBA 2REKA 3S17J 2MSYA 1A5JA 3ANPA 1GT0C 3HE0A 4MIMA 3BR3A 1UG2A 3ZQLA 2ZCMA 3KNWA 3AQSA 1JKRC 4ABZA 1Z0XA 2ZOZA 3V6GA 1SFOJ 1X2MA 2LK2A 3BR5A 2YU9J 5FLVA 3AQTA 3IUVA 5FJ8J 1A6IA 1IDYA 2HDDA 2OI8A 3VW0A 2RHAA 2DG8A 4M3FA 3MKLA 1T56A 3O8GA 3JRHA 3B81A 3QPSA 3HTAA 3NNRA 1VFCA 2CUFA 1P7JA 2VI6A 5M3MJ 3BG5A 5DS9A 5EDNA 2I10A 5E3NA 3ZQIA 3E7LA 4JP0A 2HXIA 1QVTA 1S7EA 2NVXJ 3ANGA 3FKIJ 3RZDJ 4IHWA 2JMWA 1MSFC 4XK4A 2GM4A 3LJLA 3HIMA 3FK7A 1AKHB 1JUMA 3I4NJ 1BJZA 4GFLA 2COBA 5FMPA 5F27A 3VOXA 1UI6A 1BW5A 4W97A 2Y31A 2CUEA 4MXMA 2ID6A 2Q24A 3KKCA 2NOGA 4L5EA 5IYBJ 2WV1A 3DEWA 4JX5A 4A69C 5CXGA 2DG7A 4CYCB 3CJDA 5J3LA 2B63J 1TWCJ 1ETVA 2W53A 2OF7A 2N8GA 4D5CA 1OCTC 1HCRA 4C2MJ 1ITYA 2G7SA 2M2EA 4S0HB 5IOZA 4YZEA 5D19A 2O9LA 2QF7A 1MBHA 5F08A 3I4MJ 1RKWA 1YRNA 1F43A 3HTJA 3S2DJ 1LFUP 2E1OA 2O8KA 1POGA 3CQZJ 2M8GX 4QIWN 4W1UA 4A3LJ 1FIAA 2IBDA 2XGDA 5F1JA 3GTPJ 4GFKA 3ZQGA 2JJ7A 3S14J 2QKOA 4DYRA 5F0HA 1OCPA 1VI0A 4FCYA 2DA3A 3BR1A 5J1RA 3WHCA 4C3JJ 3SJMA 1JJ8C 3HTIA 5FKKA 2NVQJ 4D7MA 2XPWA 1FIPA 2GLOA 1ZTRA 2ECCA 3H0GJ 4D5FA 2LD5A 3RD3A 3O8HA 3A01B 3GTGJ 4A3BJ 4L62A 2VUMJ 1VNDA 2FBQA 4KWAA 5IP7J 4B1RA 3VVXA 3E7QA 4JX4A 3BNIA 4HKUA 3HOWJ 3CWRA 1YRNB 2R0QC 3BRUA 4C3HJ 3VUQA 4M3EA 2DTZA 4IEJA 4EEFG 4RDUA 4X6AJ 1DU6A 1LE8B 3OSGA 2L9RA 1IC8A 3VOKA 3FRQA 2PBXA 3G1LA 5EG0B 1W0UA 1RETA 1NK2P 1UI5A 2UXPA 2CJJA 2EH3A 2XPVA 2D5VA 3PO3J 3IH4A 5C4JJ 1FJLA 1B72A 1BW6A 5F0FA 1TWAJ 3HGYA 4NELA 4A93J 2AHQA 3G56A 3A03A 2VKEA 2KT0A 4NN1A 1Q1VA 2LTPA 5E3MA 1K61A 1IUFA 1ZQ3P 5GP9A 3K7AJ 1HDPA 5J1UA 4A3KJ 1BL0A 1HDDC 2HOAA 2XB0X 2QTQA 2Y9ZA 2ME6A 4UUSA 1ORKA 5FKMA 3GTMJ 2NP5A 3PPBA 4GFBA 1P7IA 4B4CA 3S5RA 4CYCA 3HOVJ 2IAIA 1RR7A 4FE7A 4FE4A 2E2HJ 1WI3A 2FD5A 1MSEC 1FEXA 3COLA 2MGQA 2DMNA 2R93J 4GCTA 3GTOJ 2X9DA 2IEKA 3BTLA 3FISA 3OOUA 5K7FA 2ZOYA 1O4XA 4UUTA 2G3BA 4GCLA 3ZOBA 5FHPA 3G1OA 2HOSA 2O7OA 2TCTA
chains in the Genus database with same CATH superfamily
2Y2ZA 2NOJB 5BPDA 4U7DA 3JSJA 4V19K 3HDDA 1B72B 1YW8A 3FBIB 1ZR4A 1UJ8A 3FXJA 4BU2A 1QPIA 1REPC 3H0DA 2CV2A 4IHYA 3S1QJ 2RN7A 1MBKA 4RAGA 1SEUA 1ZRCA 2M34A 4Y7NJ 5ILSA 5ILUA 3IP4B 4MTDA 5F04A 4L5IA 3RYPA 2FQ4A 4AWXB 5K1YA 4CCNA 3CO7C 3CCVI 2HFHA 4CXFA 2KQRA 2UXNA 2EB7A 5LBQA 4CCMA 3GZ6A 3LA3A 3TP0A 3TP3A 3VYUB 4RBOA 1F36A 2D1VA 3U2RA 3F8FA 1B9MA 1IJWC 1VQMI 2TDXA 2EIJH 1KA8A 4IX7A 4KDPA 4OIPF 1Y1VJ 1Z67A 5FD5A 4BJ6C 3CJTB 1D3YA 2R92J 1TZLA 1QO0D 3O60A 2MW8A 4B44A 4XRSA 2HGCA 4YFNF 5K7HA 2RV8A 4BQAA 2K9MA 2H1KA 2Y0SN 2KRHA 3VOEA 1GV5A 2OA4A 3KP4A 1QQIA 2FSWA 3Q0WA 1BC7C 3OIOA 1T95A 1IV8A 1JI8A 3E97A 3HOYJ 1ZG5A 5L3FA 5CXIA 4DQ2A 2DJNA 3CMEI 3KLNA 2E35A 2GOMA 3VDXA 5BOXA 2XF7A 2WWYA 2CG4A 4KICA 4I6ZA 4KMFA 1WJEA 1PP8F 2BW3B 3CD6I 1R9TJ 1JGSA 2JUCA 2K9LA 4NBQA 4IQJA 2FMYA 2CU7A 2A68F 4PSXA 2DYRH 4OIOF 2WUIA 1HKTA 2FOWA 3CDHA 3CTAA 1L3LA 2FA5A 1KZHA 1S5LC 1WVRA 1D0ZA 3WTYC 5HOOA 4E7JA 1HLVA 1TQMA 3ONQA 4IO9F 4FISA 4AU7A 3B6AA 4B3AA 3FIWA 1ZRFA 1XCVA 2PG4A 4IRIA 4CUGA 2JSPA 3WTXC 3S93A 3BT9A 5DTDA 1R1UA 1FOXA 2PMZA 1X1CA 1KU3A 3SDGA 1DPUA 1YYVA 2V9KA 1FT9A 2BV6A 2X1CA 1P2FA 3FMQA 3T5XA 2IA0A 4HZFA 1YFHA 1FP2A 3FXKA 1S8NA 3EETA 2PJRB 2R7QA 3ROUA 2QYOA 3ABUA 5L3BA 1OFCX 2XHKA 3DF8A 2ZSIB 4BXXJ 4IXAA 4XIDA 4U0WA 1IUYA 2JK3A 1H89C 3VSLA 3HL2A 2E19A 5JR3A 1D8JA 3T8RA 1PP7U 1RESA 1I3QJ 2Y69H 1K79A 2DA6A 3J80Z 3QYBA 2ISYA 3I71A 3KX2A 4LLGF 3L09A 4M9ZA 2E7XA 5HS8A 1A04A 4BS9A 3K4KA 3K1NA 3VPRA 2LKXA 3H3VK 2QGUA 4R1HA 3S8PA 3CCYA 2CQKA 1BM9A 2QSGX 4P55A 1ETOA 1QZZA 1Z7UA 3L00A 1BJAA 3QOEA 2E1MB 4I09A 3MN2A 2W48A 4N4NB 1BI3A 4DOZA 3P7NA 2XVCA 3LSTA 4PJNA 1WZ2A 2HYTA 1U78A 2XPUA 4NQWB 2OBPA 5EGOB 3M8EA 2F5EA 2G7LA 2IA1A 3S16J 2NYXA 1G8XA 1SMTA 2K9QA 1GXQA 2VBWA 2JA6J 4ZDOA 2VBZA 2DPDA 3OV8A 2FRHA 3MCZA 4AIKA 2BVLA 3PQKA 2W7NA 2EFWA 1CGPA 4PK4A 2ZOYA 1J9IA 3OOPA 5CVRA 3K70D 5ICFA 1MMGA 4I99C 1Y39A 3F22A 1NG6A 4FASD 3MKZA 3QQAA 2AQFA 4AYBN 5B1AH 2ACJA 3PFIA 3BG3A 2P6TA 2ZXJA 2DYSH 3TGNA 3LWFA 3PNTA 4P5OA 2FBHA 1R5GA 5D5XB 4BDZA 3F0CA 3CCJI 2LRDA 4XN3A 1WJFA 2QLZA 1BR1A 1QBJA 3TEDA 4L18B 3U1KA 2G7GA 4L9VA 2GIVA 4LIUA 1RI7A 3S3MA 1JUSA 2CUZA 4RGUA 1KQ0A 2WY8Q 1U8RA 2WY7Q 1P4AA 1JKOC 2A69F 3TKYA 5C44J 1WSUA 2VKHA 2IS6A 2CV1A 4WCGA 2X6WA 5FFXA 3QPLA 3NXCA 4OD5A 3IWFA 4PUSA 4A3MJ 3PO2J 2GUHA 3OS0A 4RAYA 5HODA 3GTJJ 1TW2A 4LFUA 3TO7A 3VW1A 1BI0A 2X1DA 1ZK8A 2JVGA 1OISA 2KL4A 3A02A 1DUXC 3EDPA 4ENJA 3I54A 4GYIA 1WKMA 1N78A 4RAFA 2R7UA 3WU1B 2AO9A 1YJ9I 2DA5A 3CC4I 2HI3A 2JRTA 2YVXA 2MH2A 2L9VA 3PUBA 1W5CC 4PJMA 4XSZF 3SXYA 3V8LA 4BAYA 4RM2A 2W85A 5H20A 1X58A 2E1MC 3R4KA 2EV6A 4BQOA 3LFKA 1YJWI 4UXNA 2L54A 3V78A 2YVHA 3IV5A 2UV1A 1R6RA 4M9XA 1ZG3A 1WGXA 4Q5SF 2E2IJ 3G7RA 2HQAA 4BBSJ 2LREA 2EZKA 2P4WA 4V2FA 2B3WA 3BJBA 4KN4X 4XMYA 1SMYF 2LFBA 3CMYA 2R5YA 1R5HA 1MNMC 1P92A 2OCEA 3BR6A 5EZGA 2EILH 2R7ZJ 1K83J 3V4GA 1C0WA 1TWFJ 2J5PA 2KIMA 1TL8A 2PZ9A 3FBNB 2QQBA 4GYGA 4AIDA 4DVYP 5FKLA 5IYCJ 3OYAA 3Q0VA 3A1YA 2L7FP 4LK0F 2YUSA 3B02A 3F21A 1QA6A 1V5EA 2VQGA 3CP2A 2QKLB 1AKHA 5E3LA 1X3ZB 5M5XJ 3WE3A 3HRMA 3KEOA 2O6GE 3LQRA 4MFDA 3HGGA 5D6EA 4MLOA 3LOCA 2IXSA 4G7ZF 1GT0C 4F52A 3PNYA 4MIMA 3BR3A 1X4OA 2IVMA 2XRNA 1XX5A 4ABZA 3J81Z 2CWEA 3GVAA 4ASNA 1A35A 1OCOH 1Z0XA 5JVGF 1SFOJ 2LK2A 4FT8A 3AQTA 1Y8QB 2JT1A 3RIRA 1A6IA 1IDYA 2HDDA 1UAAA 2RHAA 2DG8A 2OZ6A 4XONA 2KIFA 4XBFA 2AXTC 4XKBA 2GQQA 2EPFA 3BG5A 5EDNA 2I10A 2A5WA 3WU2C 2M4KA 1FYKA 3H36A 3E7LA 2V4JC 4BGDA 4A0ZA 5F64A 2KLOA 1QVTA 1S7EA 4HQMA 4OOIA 3RZDJ 1YLFA 4EV0A 4IHWA 2JMWA 3SEQA 1MSFC 4XK4A 1EH7A 3K4CA 2QM3A 5LRRA 1AKHB 5DEQA 2IJLA 2LC2A 4GFLA 5FMPA 3BJ6A 4AVZA 1R58A 2EFPA 3F6VA 5JVTA 2JRMA 2CUEA 2JVHA 2ID6A 3KKCA 1WWXA 2J5OA 2VBXA 1X19A 4BEHB 2WV1A 4A69C 5CXGA 3NWSA 2OTJI 5IT9Z 3WGHA 4CICA 4I01A 1XMAA 1RC9A 1TWCJ 1ETVA 2F48A 3UNGC 5D6FA 3MKYB 3KYLA 2JTVA 1ITYA 2M2EA 2Q1ZB 4ESBA 5IOZA 4YZEA 2CYYA 3FMRA 3H1CA 3OIQA 3AG1H 4EQQA 3O3KA 3R0AA 2UUZA 1X1BA 4Q47A 1MGTA 3AG4H 4HV6A 4QIWN 4W1UA 4WF2A 4LD5A 3MWMA 1TT0A 2E34A 3IWZA 4GFKA 5L3CA 2GZWA 2LY1A 1D5VA 3E6DA 3C2HA 1ZAOA 2Y0MA 4DYRA 4ZYAA 1VQNI 1K4TA 2DA3A 2PMUA 3ABTA 1R71A 2Z3YA 3HRUA 5DV5A 3COAC 4D7MA 2NVQJ 4XLHA 2GLOA 2H8WA 4FX0A 3J81K 5BMZA 2R7TA 3H0GJ 1UHMA 4N4OB 3A01B 2P5KA 1GXPA 3RYRA 1XGMA 3BZCA 3MZYA 4WXHA 1E17A 4HBLA 1JE8A 3QODA 4U87A 1DP7P 3L7WA 1USTA 1JXSA 2R0QC 1MMSA 2R7OA 4AD9A 5DYMA 2KPMA 5J4VA 3BG7A 1LE8B 3OSGA 3VOKA 4P9UA 1YIJI 1QZEA 3QPTA 2IP2A 2F4MB 1FYLA 2EH3A 4HDUA 4ZTFA 2VT2A 4UVAA 5C4JJ 1FJLA 1FBSA 1IRXA 1T08B 5F0FA 2VL8A 1TWAJ 3KZIC 5D5VB 3K6GA 3K10A 5GADJ 1RNLA 3A03A 3RKWA 5IT9K 2LTPA 1O7FA 2MLGA 4LGWA 2IGOA 1U5TB 1O3TA 4A3KJ 1BL0A 2P5VA 1EH6A 1NG7A 2CH0A 2Y9ZA 3KEYA 2NP5A 1ORKA 5FKMA 1RIOH 3FXOA 2L4MA 2VC1A 2EFNA 4CYCA 3MZ8A 2IAIA 3HOVJ 4FE7A 1XDSA 3TDUC 1WI3A 4GO1A 4S05A 4J01A 1SFXA 3COLA 4ANJA 2DMNA 2RC4A 3DKWA 2R93J 1FMVA 3GTOJ 2X9DA 3BTLA 4PZJA 4RGXA 4GGGA 1BR2A 1V54H 4GCLA 2QQ9A 4OAYA 4B48A 3I3LA 4IZZA 4I2OA 2HOSA 2O7OA 2TCTA 2KISA 1Z6RA 1WH7A 4XICA 2BXZA 1PJRA 2DOFA 2D6YA 2EIMH 1R5ID 3JRDA 2ZCWA 1XCBA 1A36A 1OKRA 4EM2A 5CQEA 4IHXA 2HR3A 1CF7A 3BZKA 1JGGA 5M5WJ 3E6BA 4XLNF 3JTGA 1OYWA 3LSRA 4BYYA 5FROA 2NS0A 2WTEA 2HOTA 4EGZA 2D45A 2K3FA 1WQ2A 3ON4A 2EV5A 2IPQX 3UKGA 4C30A 3EUHA 3MVPA 1CQTA 2ZFUA 3BR2A 1IZ1A 3OYKA 1HSTA 1YHQI 3OS1A 2YSRA 3ZQCA 1FNNA 3LMMA 3A2KA 2BY3A 2LYCA 1D0YA 1TWHJ 3GBGA 2Z5UA 2CV0A 3NI7A 2LR8A 3E6MA 1GLNA 1SGMA 3K1PA 4HG2A 4KIBA 3TW7A 2PFBA 5D8KB 5D8LB 1IF1A 5CLSA 4G7OF 1MW7A 2OCCH 1OCRH 1TBXA 2NAZA 4B43A 3SDBA 2LDUA 1ZKGA 4M3BA 3W2VA 4A3IJ 3HB9A 1MMNA 4Y15A 2KRFA 5KCMA 2R7VA 4M6VA 1ETQA 2LMDA 1FBUA 2FXAA 2R7SA 4PXIA 4HSTA 2CQQA 1YX3A 3VYTB 5KAFC 2O0YA 3OS2A 5LD2C 1XSXA 2K9SA 4ZDLA 4QLCU 1B9NA 4HF1A 3ABMH 5AIQA 1YTYA 2LY9A 2AQEA 2UXUA 2R7DA 1YS6A 2QWTA 2ELKA 3L2QA 1LVKA 2IGKA 3BPXA 3BHQA 1BC8C 3ESWB 2MBFA 3LSIA 1ZARA 3G1MA 4X1EA 2E1NA 4LOCA 2KRCA 3LNQA 3BWGA 2O7TA 2YX7A 2JWTA 3W6JB 3PIOF 3VP5A 3G4SI 4OIQF 2DMQA 3CESA 3IUOA 2DLLA 1U3EM 2RASA 4XRSG 3U9GA 3VEPA 2KJBA 2PEXA 5IPAA 1I39A 3TL4X 4Y13A 2FQ3A 3F8CA 3HEFA 2ZXIA 1FLIA 3D1NI 3QP6A 1EA3A 2HQ5A 4BHCA 3F1BA 2BY0A 4AYBA 1F1ZA 2L02A 2M8EA 2MFZA 3B6CA 4PJLA 3L1PA 4D1QA 4MO7A 3I55I 1UHWA 2H8RA 2IS4A 2NXNB 2X0LA 3PNVA 1MBFA 1ZR2A 4HSRA 2RNJA 3ZMTA 2MC3A 2DFIA 2ESHA 4K2EA 1VTNC 2P7VB 2VODA 3JAMZ 3M3YJ 2G0EA 1EV7A 2W82A 3EUKL 5B66C 3LHQA 2L7ZA 2LLKA 2B0LA 5EF6A 2G9WA 1XN7A 3WGGA 3JRBA 2M4GA 2DA2A 2HYJA 3MQ0A 4BE0A 2R7FA 2DFEA 3J7YJ 2ZB9A 4KIFA 5FLMJ 2FU4A 1OQYA 2FBIA 3I0TA 4DW6A 4XRMA 5K5OA 3F23A 4UB6C 2WAQN 3JRCA 3NAUA 1YG2A 2A6TA 2HEOA 3QKXA 1OR7A 2CQXA 1H8AC 1VQ5I 3VIBA 2RGVA 4DIQA 2BW3A 4H4KC 3PQJA 3LA7A 1Y0UA 5IYDJ 1IN5A 3IKTA 5AIPA 3EUHC 4D7NA 1T6SA 2HNHA 2PI0A 2BOLA 1XC5A 4I02A 2X1EA 2HPIA 5M5YJ 2ZCXA 3TQNA 3F8MA 1R1TA 3ZN0A 4IOAF 1ZHFA 1WPKA 2C6YA 2DFHA 3QRFF 2QVOA 1W7PD 3J7ZI 2UXOA 3KZZA 3BOQA 3REOA 4BHPA 1R4NB 1GV2A 5ERIA 1B8IA 4A3GJ 3EPZA 1V55H 4BNCA 2BHYA 3NQOA 2VPLA 1X4PA 1HKSA 2ADUA 3LA2A 2A05A 2XF6A 2KDZA 3TOBA 2XUBA 3W6VA 4UY8I 3C7JA 4RMNA 2F4OB 2QCOA 5EYRA 5DD8A 2L5QA 2KZGA 3HXLA 4CDGA 3LSMA 1YI2I 3DP7A 3K2AA 2YVEA 3H5NA 3QU3A 3QAHA 1B59A 3ZQHA 3C07A 1NHAA 2ZCNA 2YR2A 2L4AA 1JHFA 3JR9A 2PJRA 2A5YB 2BY1A 2VOPA 2HYFA 1Z91A 1W36C 3FXUA 2CRGA 1U9NA 5EFYA 4UNOA 4ZZDA 2GBYA 4L9NA 4N0BA 2QWWA 1ENHA 3JAMK 3EYIA 2HKXA 5JI6A 2X6OA 3KYDB 3FZVA 2XROA 2GFNA 2HYGD 2LSOA 3K70C 5HDKA 1E3PA 5D4RA 3GWZA 1TC3C 2GA1A 3CDLA 1MMDA 1B8IB 2VPRA 2WC2A 1IN8A 3F3XA 5LGNA 3GF2A 5FGMA 2L01A 4V2GA 4Y52J 2Y30A 2KMUA 1WH5A 1RKTA 3RKQA 4NC7A 4EJWA 1UG0A 2DT7B 2ZXHA 2UXHA 2ZMEB 2DJIA 2XAJA 1SD6A 4NQWA 5HLIA 4EJVA 1VQ4I 1OLTA 2NP3A 1XDUA 4ENKA 5EGOA 1Q1HA 4XR6A 2O3FA 1QHGA 4JBAA 3CCUI 4ETSA 4B3XA 3GTKJ 2EJRA 3BJOA 3LSKA 3L9FA 5IOYA 5EZHA 1JKPC 5GPAA 1MBEA 5FKOA 3OYJA 2DK8A 4M3GA 2EQRA 3IRRA 4FETA 2UXIA 4JNNA 4H0EA 5E3OA 4P96A 2W4SA 3K4MA 4CYDA 4F7ZA 2W00A 2GENA 4A5MA 2R7WA 1FP1D 2LP0A 1MBJA 1N77A 3RKXA 3DXJF 2K4JA 2DMTA 4A3FJ 4EM1A 2OC6A 1LDDA 4A6DA 1YS7A 3K4LA 3EUAA 2ZNYA 1VZ0A 1MJBA 3Q3SA 1BI1A 1BIAA 3A0BC 4HEA2 3S1MJ 3V8JA 1H88C 3Q5FA 2HS5A 3DCFA 4FTHA 3S15J 2DI3A 1GUUA 1MJ9A 3QP5A 3SFIA 3WHBA 1OCZH 1YW7A 4CCKA 5HLHA 4Q4ZF 1YO5C 1UG2A 3PUFA 3AQSA 2LF7A 2QZ8A 2VC0A 2ZJRF 3V6GA 4D0PA 1IXRC 3L2WA 4DBQA 3DWLE 5ILVA 2YU9J 3X2QH 2GOXB 3OL4A 3L2UA 1J2XA 1OR7C 2XAFA 3FX3A 4HYEA 4L5JA 3GX4X 1J59A 1T56A 1OYYA 3NNRA 2CUFA 1P7JA 2VI6A 4DNCA 5M3MJ 5DS9A 2HKOA 4Y3OA 3WODF 5D5UB 3SZPA 4JP0A 2HXIA 3OY9A 4XQFA 2NVXJ 2M87A 1T2KA 2E5ZA 3BZ6A 3I59B 3LJLA 2IS1A 3HIMA 4LB6B 2PN6A 1JUMA 3I4NJ 3DV8A 2A3SA 4X0GA 3I9V2 3QWLA 5F27A 3VOXA 2VBYA 4C2UA 1ZH5A 1BW5A 4W97A 2P0WA 3H35A 4MHGA 4HNUA 2X6XA 4ZTJA 1K6OA 2Z33A 3DPLC 4JX5A 3VWBA 2HZTA 4BXFA 3I56I 2DG7A 2ZMEC 2M0MA 1AA7A 2B63J 4HX7A 2W53A 4ITVA 2OF7A 2N8GA 4CCJA 4L9JA 4C2MJ 2G7SA 1HQCA 3D5RC 5D19A 3K2ZA 1YW9A 2O9LA 2I8DA 4QPOA 4IVNA 2VJ5A 3I4MJ 2FOKA 3HOTA 1F43A 3WTZA 4LJZF 1LFUP 2O8KA 3N97A 1IAWA 3GUDA 2M8GX 2VJ4A 2CW7A 3HSRA 4BE1A 4KA4A 1FIAA 2RKHA 4Y33A 3GFJA 2IBDA 2XGDA 5FO5A 5F1JA 4BQNA 2E7WA 3ZQGA 2JJ7A 2PBIA 5HS9A 3DTEA 4BJTA 1YX5A 3K8PC 1OCPA 1VI0A 4NB5A 2L2OA 4BHBA 4FCYA 4MEXF 1GVJA 1W1WE 1TT5B 5LHGA 3BR1A 3SJMA 4ZC3A 3LAPA 3ISPA 2IGMA 1EH8A 2XPWA 3K4NA 3CMMA 4GCVA 4D5FA 4KNYA 4LB5A 1FOKA 4ZYGA 3WU0A 1SVOA 4I0AA 2KIUA 5LFAA 4JK1X 1VNDA 1I5ZA 3HRSA 5EEGA 3SZGA 5HVQC 1G3YA 3PJRA 3FWEA 3N05A 1FY7A 3ZMSA 5CPRB 4KWAA 4B1RA 1RZ4A 1J5YA 4E4HA 3E7QA 2XF5A 1LB2A 2MLKA 2XV4S 4ZYDA 5GAGJ 4KN7X 3MAJA 3HZJA 4RGSA 4CGZA 1KGSA 2DTZA 4IEJA 2XGXA 5L3EA 3WTSC 1LFPA 3V7RA 2XAHA 1Z1DA 2K85A 3FRQA 4E7SA 5H6QA 5EG0B 1QPMA 3OYDA 3OR2C 3DTKA 1W0UA 2KP6A 2Z16A 3E0JB 4PFPA 2GA2A 4E7LA 3PO3J 1XSDA 3IH4A 5IT3A 4LG0B 2P7CB 4MEYF 1PDNC 3HGYA 4R8HA 1ZGJA 3C18A 3G56A 4NN1A 2VKEA 4U0VA 3OYBA 1YJNI 4NUBA 4HX4A 3G6EI 2BY2A 2HTSA 4ENNA 4U88A 4XKVA 2HVRA 4KYWA 1A6QA 1G3WA 1HDDC 1ACIA 2X85A 1I27A 3ASNH 2ME6A 3ZCOA 4BEHA 4UUSA 2Q0OA 3LFUA 2WV0A 1F5TA 1A31A 1YE9A 4UUVA 2DTRA 3KP6A 1RR7A 4FE4A 1AOYA 3OL3A 2FD5A 1MSEC 1X3UA 2YX4A 2MGQA 4EJTA 1R4MB 3TBIA 4LK1F 5D4SA 3ZGKA 2ZJQF 2IEKA 5L3DA 2E60A 4QPQA 1J75A 2G3BA 1VQPI 3GFLA 1FSEA 1K78B 5DUKA 2ZC2A 4HNTA 1V5FA 4RLQA 2XSDC 5E79C 2M7BA 3FF5A 4CSWA 5FGLA 4IJAA 1SFUA 4E7ZA 2E2JJ 4RLFA 2R5ZA 3OMYA 1IGNA 2XDNA 2JA7J 5FRMA 2PQ8A 1AHDP 2OZUA 2DT5A 3LWJA 1D1AA 5F0CA 4HRIA 1TW3A 1WCMJ 5FFZA 2VQLA 2HKUA 2X4HA 3A01A 2OTLI 4UUSB 3I64A 3JCUC 4BJ5C 1IG7A 5HDGA 1WJ5A 3ZRGA 1NK3P 4B47A 2GXGA 2XKOA 1X1PA 4N9IA 4R79A 2ZJPF 3J7AY 1X1DA 2NVYJ 4P1WA 4QWQA 3OYEA 5J1YA 1ZREA 1XB4A 2Y9YA 3JRFA 5GPCA 1HF0A 2VJJA 4XSXF 4KMUX 1AU7A 3L2CA 5HNFA 3AAFA 1STZA 1OPCA 2QKMB 3DBRB 3P9KA 2HTJA 5K5RA 3ON2A 1U8BA 2NNNA 5JHUA 4IPAA 1LE8A 1G3TA 2X6YA 3GTQJ 3LSGA 2CGPA 1T98A 3IKVA 1TWGJ 5C4XJ 4PGGA 4D9JA 4RS8A 9ANTA 1ETWA 2IW5A 2O03A 2D1HA 2R5ZB 1KQ8A 2A6HF 2MD5A 1V5GA 4CH7A 2BYVE 2M9HA 3WE2A 2HQRA 2I5UA 4BKXA 5ICGA 4E70A 3IH3A 3WTTC 3RPUD 5HBUA 1BR4A 1R36A 5ED4A 3NWTA 3BG6A 5FB2A 4OIRF 1U5TA 3C2GA 1ON1A 2DQLA 3OYFA 4MTEA 4YFXF 1G59A 1MNDA 2MA3A 1UMQA 4HX8A 2O5RA 4OU0A 5D18A 3CMAI 2KHMA 4LG3A 2V7FA 3HTHA 5J8FA 4AIJA 1IRGA 1JT6A 1D5YA 3EUPA 3S2HJ 4GRIA 1FZPB 1V4RA 2YU3A 3TDZC 1W7PA 1XD7A 4AVPA 4UV8A 2WAQA 1FBQA 5C4YA 1Z77A 1R49A 5IP9J 3W3CA 4XOPA 5EEHA 3JRGA 1DU0A 2K7LA 3U1DA 3LQQA 1R00A 1VF9A 3KZYA 2DA4A 2CMPA 4XN0A 3HOXJ 4I0BA 3ZQFA 2HOEA 4HNVA 1B1BA 1MMAA 4IHVA 4OMZA 4ZYEA 4FHTA 3EGQA 3VW2A 3ZMUA 1BN5A 3OIPA 1SC7A 2OJED 1VQLI 4A3EJ 1BA5A 5TRDA 3CRJA 4ENMA 1Z3XA 1MH3A 2Y0SA 2OERA 2WAEA 2ZKZA 2DMUA 4RB1A 2ZNZA 3DQVC 3OSFA 4DYCA 3M07A 3KP2A 3VFZA 3CC2I 1JKQC 4IL6C 3CJRB 3WG7H 2W25A 5B1BH 1IO2A 1W7PB 2LY2A 3F8NA 5K5QA 4U9NA 2VQCA 4OAZA 4ZJZA 2PLYA 5K58A 3BC8A 3BTIA 1MDMB 4XKCA 1Z6TA 5DCMB 4YRVA 5CVUA 4CGRA 5D5WB 1M1EB 4AC6A 3HUGA 1BOBA 2EINH 2ZBKA 4UV9A 2BBYA 1SAUA 3F72A 2HXOA 3DBHB 4DYQA 2O61A 3I58A 1S6LA 3CC7I 1EF4A 2NS7A 2ICWG 2HVSA 5J6XA 4WX9A 3E5QA 3RQIA 3JRAA 5DM7F 4BBRJ 2ZY9A 5LRSA 2V1DA 3CJNA 2W1OA 4RB0A 3GEUA 3PIPF 3FXMA 1PVEA 3SQNA 2L7MP 2FBKA 2DT6A 2X48A 4HF2A 1D1CA 2B1EA 2VLAA 2CFOA 3IHUA 3LSHA 3PSIA 5HLGA 2QOPA 5HAWA 3U21A 4KUMA 5HNHA 5EEAA 3CCRI 3H9GA 2BGCA 3N4MA 2FEZA 5FD6A 3OYIA 3ZMVA 4CHUA 3VTIA 3BG9A 2PX9A 1RRJA 3ZXSA 1Z3YA 2HVQA 1WJBA 2ZXWH 1MBGA 4BY7J 3PASA 3DPTA 5LEJA 5H9TA 3FHNA 3HUGB 2E71A 1W5TA 2VASA 4G12A 2QEXI 3V7CA 2A07F 1ZGAA 4BACA 2EZHA 1IRZA 4NC6A 1W0TA 3MNLA 4RB2C 1UZCA 2HZDA 3G2BA 1U5TC 3SFZA 4CZZA 3SHFA 2XRLA 4E7HA 4KJZA 4A5NA 1LDKB 3QYEA 2MC4A 1Y1WJ 1ERDA 2DMPA 2BEOA 2GAUA 2XGCA 1Y56A 1LKXA 3E5XA 2XDVA 3BR0A 4A2UA 2V1NA 2MD0A 4DZPA 2RAEA 3DFGA 2DPUA 1MJAA 4O3MA 1MNEA 3H3UA 5TISC 4ESJA 5HSZA 2JZYA 2DN0A 4Q48A 5CW8A 3KP7A 3S3OA 1IN7A 3RDIA 3GZIA 5E1XA 1Y0NA 3RCOA 3AL0B 2EZIA 3HOZJ 1LEBA 4IHTA 1R7JA 1MKMA 2KFDA 4IRGA 2DA7A 4A12A 4IQ4A 2BHZA 3PL8A 2NVTJ 3DEUA 5DAJA 1XMXA 4AC0A 1SD4A 5E8IA 2L9NA 4M6YA 4A3DJ 1ZGWA 2JA8J 3DPJA 2STWA 3I4PA 5J40A 2F07A 2FNAA 3P9IA 4DZJA 5KAIC 3M8JA 2MG4A 1QU3A 1MZBA 4PGHA 3E1SA 3ZQ7A 3JRIA 4EGYA 5CVIA 2VQHA 1FMWA 1KU2A 4IRVA 4C9YA 3S1NJ 2K40A 3ZMDA 1OJLA 4BUPA 4DBRA 3HKZN 4KIGA 1K6YA 2RQPA 2VIXA 4HOBA 3NS4A 2L0KA 1QVUA 4O6JA 4ZH4F 1W4MA 3FXRA 3BTJA 4E7KA 1TQPA 1E3OC 1QRYA 2H6CA 2REKA 2WAFA 5DUIA 3S17J 1A5JA 5F1RA 3HIFA 2KDOA 4M9SA 3ZQLA 3LAJA 4F93B 1JKRC 1O3RA 3AG2H 1ZYRF 2M30A 2ZOZA 1X2MA 2ELHA 3IUVA 2RVCA 3F6OA 5DM6F 1XTAA 5FJ8J 2OI8A 2F2EA 2ETHA 4BE2A 3HRTA 2LF8A 2Z1DA 2HWVA 3O8GA 4HDVA 3QPSA 3B81A 3HTAA 3GZNB 1VFCA 1EKEA 2QENA 5A2QZ 2JPCA 1RUOA 4EM0B 2V79A 3CLOA 2DDAA 3MEXA 1O7LA 2DK5A 2V26A 3ULQB 2R4GA 3S3NA 1U2WA 4C2MA 5AONA 3KETA 3OYLA 3QOPA 2GM4A 4RAZA 2UWMA 4ZZLA 2XSJC 3BROA 2Z9OA 5CKTA 1N75A 3CCQI 4OD4A 2A6EF 3A0HC 3ABLH 1S9HA 4G8XA 3AL0C 4MXMA 3JSOA 2Q24A 3RTRA 2EFOA 3G73A 3DEWA 1SAXA 2NRAC 4PSWA 3KYCB 3CJDA 5J3LA 2ZMEA 2W24A 4HA8A 3HSEA 4D5CA 3EQLF 1SVMA 1XGSA 4S0HB 2QF7A 4LLLA 5F08A 2KIQA 2OUMA 1J0RA 3WTVC 2B7EA 3OYCA 2E1OA 3S2DJ 1POGA 2ZFWA 1DP3A 4WIBA 4Z2YA 5ICCA 2V9PA 3NRVA 2IT0A 4A3LJ 4EATA 2E5NA 2VE9A 1KYZA 1EJ9A 2IGNA 3GMEA 5BS6A 3GTPJ 2LKPA 5LGUA 2QKOA 1T0FA 5CVVA 3I5UA 4PDKA 5BPIA 1RUNA 3QPHA 3RPQA 3WHCA 4C3JJ 2EA4A 1U6GA 3HTIA 2UZKA 4B8XA 5CQGA 1I6XA 1WJAA 1FIPA 1ZTRA 5FRNA 2LD5A 3RD3A 4U9LA 1WRJA 1Z05A 2DXIA 4L9TA 3GTGJ 2CW8A 1I3AA 4HV5A 4A3BJ 1LDJA 1OYIA 2OQGA 1K4SA 4XLPF 4IOCF 3LL7A 1WHUA 2EIKH 1U0JA 4L0ZB 2DW4A 3JTHA 2VT3A 1HW1A 2QSFX 3BNIA 4RB3C 3HSFA 4HKUA 5A2QK 2Y75A 3CF2A 2CO5A 1XSVA 2NVUB 2GXAA 3BRUA 4UVBA 4E6KG 1GHCA 4M3EA 3C3WA 4A0XA 3CUQA 3C1DA 4EEFG 5CJ9A 4Z6YA 1LUJB 5E8GA 4XRFA 3CO6C 2L9RA 3FHZA 1IC8A 1VQ8I 2PBXA 2CUJA 2XIGA 4G6QA 3BY6A 4GDFA 1RETA 4XLFA 1NK2P 2XPVA 1X3WB 5CVJA 3GYHX 3TO9A 1BW6A 4F55A 1VQ9I 4N9HA 3I59A 3BLYA 3ECOA 1LEAA 2QQ8A 1TNTA 4NELA 5TJJA 1G3SA 1V3FA 5E3MA 4XM3A 1IUFA 2VOOA 1T39A 3GXOA 5GP9A 4U7BA 4EMSA 1HDPA 3RPUA 4AM3A 2V6EA 2MABA 2QTQA 3MD2A 3NEUA 4G6TB 1P7IA 3R6SA 3E6CC 1I1SA 3S5RA 1SFKA 1S7OA 2E2HJ 1G4DA 5LHHA 5HDNA 1TLHB 2EA2A 2R3SA 3E5UA 1WJDA 2FMLA 3DEEA 2BVMA 3W6KB 2X51A 4GCTA 3K69A 4NHJA 3OR1C 3FISA 3OOUA 2Z2SB 3CUQB 2AXLA 1MD0A 1F9NA 2XKPA 4HF0A 5K7FA 3HC7A 4AIHA 4XOTA 3G71I 1O4XA 3HPGA 1E0EA 3D5LA 1S29A 3G1OA 3ECHA 3FXQA 1ETYA 3VODA 2ZSHB 2BZTA 3ZQQA 1FOYA 3KKDA 2ESNA 3ZN1A 1ODDA 1HW5A 2KZVA 2P6SA 2PMHA 4YELA 5E20A 3WG9A 4ICHA 5DDGA 4I7HA 2G7HA 1RR8C 1I6HJ 5ICEA 1I1GA 2M5WA 2RREA 2COMA 4M71A 2JN6A 3M1CA 2B9SA 2Z99A 1IV6A 2VXZA 4G6DA 3ERED 2NNYA 5LLQA 1W36D 3D5SC 2EK5A 2WBMA 2CFXA 1JJ6C 2VONA 2LH9A 3DU6A 1ZG1A 1E3HA 3ERMA 1D8KA 1JUPA 2LVSA 2WADA 4BH9A 4UB8C 1XS9A 1SD5A 2WA0A 5BQTA 4O5VA 1DQUA 2VKVA 3ZMZA 1KONA 3BQZA 4WWCA 2JA5J 5EJCA 4PCQA 5KK1A 3KEQA 4MGRA 1SD7A 3J7AO 5BNGA 2NX4A 3K4BA 3DKXA 4QSHA 4MFEA 3BP8A 2EV0A 5J47A 3KLOA 3JREA 2F6CA 3O6BB 2K4BA 3LSJA 3GTLJ 2XAGA 4M74A 4OINF 5JHFA 1T0FC 3WTWC 2K86A 4GCKA 1TNSA 5EG0A 2G7UA 5FKNA 3BCBA 3KZ9A 2WB1N 1JT0A 4JOMA 3A4CA 4LG0A 1MH4A 3MMYB 4MQ9F 3DU5A 1LPQA 5C3EJ 3P9TA 4NNJA 3CZ6A 1T38A 1PUEE 3ZPLA 3J80K 5L3GA 4AF5A 3AG3H 1ON2A 2FJ1A 2Y48A 3CCMI 2L7KA 1FTZA 5KVRA 1J7KA 2ISZA 1PUFA 5E1ZB 3OYGA 2EBIA 2LOOA 4XLEA 4HW0A 3KCCA 1TP4A 4F92B 4I76A 2H1LA 3ELKA 1UHSA 3C2BA 2O8XA 2E1CA 2XC7A 3QYFA 5GTHC 3Q9VA 1HOMA 1XPXA 2XGEA 2A2FX 1QNTA 5E18F 3GFMA 1P9QC 3CUQC 2YS9A 3I53A 3H3ZA 3K4JA 4WXCA 2K3PA 4J19A 5K7ZA 2QUFA 1UCRA 2H6BA 4G7HF 3RH2A 2EWNA 3SZTA 3KE2A 2M3AA 2ZJ2A 4NDLA 3NRGA 1P6RA 1UFMA 1K78A 4M72A 1MIJA 5JLWA 1Z7LA 5CYVA 3HYIA 4CA0A 4HLXA 5JLXA 2QBYA 5AQCA 1IDZA 2DOAA 1BI2A 2CQ7A 2XB5A 3DKYA 2JQ7A 1YITI 2VB6A 2XAQA 3E3VA 2YPRA 4M3DA 3GW2A 5B5EC 4HPQA 5LHIA 2QQAA 3L2RA 3S1RJ 1PUFB 1E2XA 3BTCA 2MYSA 1DGWY 4YIFA 2R7RA 1FYMA 1YIOA 2EFQA 1D0XA 4LMYA 4EVIA 1LVAA 3Q0UA 3OYNA 2IS2A 3HPHA 3GFIA 4LITA 2V9VA 2L9SA 3KFWX 2M7AA 4A0YA 5IY5H 2OQRA 4MQVA 3AFHA 1SANA 1O3SA 2HDWA 3BDDA 3LSPA 2JSCA 1H9TA 1GDTA 1HW2A 1Z9CA 3BQYA 2CSOA 2V57A 3HM5A 5IP6A 3GO5A 4RM3A 5LEKA 2DA1A 4JL3A 1AWCA 2GWRA 1JTXA 1APLC 2TRTA 1IXCA 1UELB 3HBLA 4M73A 4XLCA 2OPTA 1X2NA 4MNUA 2K9NA 3B73A 3NARA 4CO8A 2R5YB 3M8FA 2HDCA 2QBYB 3O2PE 1B6AA 2OAZA 2HU9A 5F6FA 1F4KA 4S04A 3VVYA 4XL9A 3PSFA 3CDIA 4PJJA 4JKZA 1ETKA 2PMZN 4YIIA 1IN6A 1ZN2A 2DAOA 2LG4A 1L0OC 1QGPA 4ACIA 2QIBA 4Y17A 3IH2A 4AUXA 4BY1J 3EYYA 4TV7A 5J8CA 3UR3C 4YIRX 1NTCA 3FMSA 3H9JA 3ZR8X 3W2AA 3S32A 2DFFA 1ULYA 5M3FJ 4IKFA 5FLXZ 1XG1A 2MH9A 1ZELA 5B3SH 3H92A 4JYKA 1IW7F 3L2VA 2M0CA 4PFOA 3SWHA 4II3A 4WXDA 2K27A 1QZYA 5KNLA 2VN2A 2EZLA 4IF4A 1XMKA 4BL0B 4HQEA 2GXBA 3HHHA 3CF5F 5HS7A 2H27A 4OMYA 4HAMA 4LIVA 1FSHA 1DGRM 2FNPA 3HTUA 3W2WA 3S2WA 1T33A 3KP5A 4ON0A 1Y8RB 1ZLKA 5D1RA 3K9TA 2VE8A 4NC8A 4BXUA 4OWRB 3HKZA 2IRFG 4J00A 4EJOA 4IHSA 3T8TA 2V1UA 3FM3A 3RI4A 4XORA 3RZOJ 3H9QA 1BBYA 4UDSA 1VQ6I 3CLQA 3PM1A 3MKWB 1ETXA 3FDYA 2RDPA 4I98B 1ONVA 4F3QA 3HOUJ 2ECBA 1B4AA 1FPQA 3BCGA 4RA2A 4XNFA 1DPRA 3ABKH 2IU5A 2FX0A 4ZDPA 3BJAA 3M1EA 3TW6A 3KP3A 2WGBA 1U9OA 2P8TA 2RQQA 1KU9A 4KT6A 4QTRA 3Q9SA 3QBMA 1SFEA 4II2A 4PJ0C 1MDMA 5DCMA 2BXYA 3VYRB 2PFVA 3GCMA 2VJIA 1NH3A 2F5DA 3DBLB 4YFKF 4JX6A 5JFRA 4EJUA 1I50J 2FUG2 3BCAA 2F5CA 1H0MA 3PFYA 4Y4RA 2F5VA 1Y6IA 2NS8A 1S3JA 2DDBA 3F9KA 5LGTA 2ID3A 1G2HA 1FX7A 3RJPA 2M1BA 3GLLA 2R7XA 3NPIA 3T6NA 2CS3A 3M7GA 2E36A 3GZ5A 5FLXK 3K1MA 1GVDA 1JTYA 2OV7A 3GEZA 3K0LA 4ME9A 2STTA 2OD5A 3WTUC 3DLLF 2M45A 4KITB 4A3JJ 4A3CJ 3VYSB 4MK6A 2VXDA 4XLAA 4KFCA 3RSNA 4C3IJ 1FTTA 4G94A 3MZHA 1WI9A 1RPWA 1LFBA 3BPVA 3M4OJ 3IAM2 2P81A 3V7SA 3VVZA 1VQ7I 1HBXG 1X1AA 3FK6A 2ME0A 3ANPA 3KPHA 2MSYA 2FE3A 3R61A 4G9YA 1N25A 4ESFA 3HE0A 1YQAA 3V42A 4UHTA 3T0YA 3IAS2 2ZCMA 3KNWA 2LKSA 3RQ4A 3CP8A 4CCOA 1S72I 3BR5A 5FLVA 3MFKA 2HPMA 2K5CA 3VW0A 2IA2A 4M3FA 3CJQB 3MKLA 3JRHA 2P5LC 3ML6A 4BDYA 1O57A 3TOAA 2UXXA 1FOWA 1QHHD 4YG2F 1P4XA 2VKDA 5E3NA 3ZQIA 1G6NA 3AKZA 3V8KA 2HQNA 2V1XA 3OYHA 2QSHX 1IRFA 3ANGA 2H94A 3FKIJ 4XKWA 3FXLA 3TMOA 2OU2A 3G3ZA 4CCLA 4CZCA 2XASA 3FK7A 1BJZA 2W84A 2COBA 2FF4A 3FKJA 1UI6A 4LLNA 1HA8A 3CCSI 3IRQA 2JA2A 2Y31A 3OWTA 1XGOA 1FWZA 3H5AA 2NOGA 4L5EA 5IYBJ 3DLAA 4F91B 1K7AA 4CYCB 1LQ1A 1SVLA 2QA4I 3JSPA 1VQKI 2DBBA 4FX4A 1HCRA 1OCTC 1R1VA 1YOVB 4KT5C 2JPBA 5H6RA 3SEZA 4DJAA 3ZP5A 1MBHA 2JUGA 2DU9A 1RKWA 4UVCA 1YRNA 3HTJA 4L0YB 2Q2EA 3CQZJ 3IL2A 3DTIA 1W5SA 2CW0F 3HG9A 1ZRDA 3CUOA 3TO6A 4BQQA 3S14J 1PYVA 2DO7A 5F0HA 2D2WA 3ASOH 2DOEA 5GTIC 1WFXA 5GAEJ 2L3DA 1T8IA 2K02A 5J1RA 2ELJA 1JJ8C 3F8BA 1BOAA 5FKKA 4E7IA 1CF7B 2F5FA 2A61A 3R60A 2BE5F 3VSKA 1H9GA 2ECCA 3VB2A 3O8HA 2Q8KA 3CCLI 3CCEI 1LNWA 1KQ9A 2DCEA 4L62A 1P4WA 2VUMJ 3GLXA 1KU7A 2DQRA 1TTYA 1BIBA 1D1BA 5TGTA 1LJ9A 4ZYHA 1WJCA 3OYMA 2FBQA 2LBFA 5IP7J 5HLTA 3VVXA 2CQNA 4JX4A 3HTSB 3HOWJ 4DGWB 5J4YA 4IRHA 3CWRA 1YRNB 4B09A 5DCFA 1JHHA 4C3HJ 1KYWA 3VUQA 2Q2EB 3D0SA 1R22A 2KJCA 1ZLJA 1OMIA 2ZO4A 5E1WA 4RDUA 4WK8F 3P5JA 4X6AJ 2PJPA 1DU6A 1FC3A 2W57A 3HHGA 1VQOI 3T1BA 3G1LA 1IN4A 2F4IA 3WGIA 3KIOA 2FJI1 1UI5A 2UXPA 2CJJA 2D5VA 5KHDA 5E17F 1HKQA 2LNBA 4A6EA 1B72A 3HOSA 4RGRA 5GAHJ 4M6XA 4YEJA 4A93J 2AHQA 4U0YA 1O3QA 2KT0A 4P9FA 3IC7A 1J09A 1Q1VA 1DDNA 1K61A 1R23A 1ZQ3P 4KISA 1OCCH 1IXSB 3K7AJ 1HSJA 6PAXA 5J1UA 5DD4A 4JQFA 2HOAA 2XB0X 4C2TA 1TQIA 3GTMJ 3PPBA 2LBFB 3DPUA 3H5RA 4B4CA 3QU6A 4GFBA 3HJEA 5H2FC 1HXDA 2GIZA 3M9AA 2H09A 2V6CA 3RKYA 2XAUA 4GXOA 1S7AA 4FQGA 3P9CA 4HLYA 1XGNA 3FM5A 1FEXA 3JW4A 2WB1A 1USSA 1HC8A 2DODA 3SYTA 4UUTA 2RNGA 3ZOBA 1Z21A 2KKOA 5FHPA 3R0JA 1UB9A 2AS5F
chains in the Genus database with same CATH topology
1WH7A 2Y2ZA 4XICA 3JSJA 3KKDA 2D6YA 3HDDA 1B72B 2XSDC 1ZR4A 5FGLA 3JRDA 1QPIA 4IHYA 3S1QJ 1I6HJ 4ICHA 2E2JJ 1MBKA 2R5ZA 2M34A 4Y7NJ 4IHXA 2JN6A 5F04A 1IGNA 2XDNA 2JA7J 1IV6A 1JGGA 5M5WJ 2FQ4A 1AHDP 3LWJA 5F0CA 3LSRA 1WCMJ 1JJ6C 2HKUA 3A01A 2HOTA 4UUSB 1IG7A 1JUPA 2LVSA 3TP0A 3TP3A 4RBOA 3ON4A 1F36A 1NK3P 1XS9A 3UKGA 1IJWC 2VKVA 3MVPA 3BQZA 1CQTA 2JA5J 2NVYJ 1Y1VJ 3BR2A 5J1YA 2R92J 2Y9YA 3O60A 3JRFA 2MW8A 5GPCA 1HF0A 4XRSA 1AU7A 5BNGA 5K7HA 3ZQCA 2NX4A 1TWHJ 3GBGA 4QSHA 2Y0SN 4MFEA 3JREA 2H1KA 1GV5A 3NI7A 3Q0WA 2LR8A 3LSJA 3OIOA 1SGMA 3GTLJ 3ON2A 1U8BA 1LE8A 3HOYJ 3TW7A 3LSGA 3GTQJ 4GCKA 5EG0A 5CXIA 5FKNA 3KZ9A 1TWGJ 5C4XJ 2DJNA 2WB1N 1JT0A 1ZKGA 4M3BA 9ANTA 1ETWA 1MH4A 2R5ZB 3P9TA 5C3EJ 4A3IJ 3HB9A 4BKXA 2M9HA 4M6VA 1ETQA 3IH3A 4AF5A 5HBUA 2FJ1A 4I6ZA 1FTZA 1R9TJ 4PXIA 2CQQA 2CU7A 1PUFA 2EBIA 2K9SA 1UMQA 2WUIA 4I76A 2LY9A 5D18A 1UHSA 3C2BA 2UXUA 3HTHA 1HOMA 2QWTA 1HLVA 2ELKA 1JT6A 1D5YA 2XGEA 3EUPA 4FISA 3BHQA 3S2HJ 3B6AA 4B3AA 3FIWA 2YS9A 3G1MA 4X1EA 4LOCA 3LNQA 2O7TA 4J19A 2JWTA 5K7ZA 5C4YA 1Z77A 3BT9A 3VP5A 3RH2A 5DTDA 2DMQA 5IP9J 4NDLA 3JRGA 1DU0A 3NRGA 3SDGA 5JLWA 2RASA 1VF9A 4XRSG 2DA4A 5IPAA 3HOXJ 4HNVA 3ZQFA 5JLXA 5AQCA 1IDZA 4IHVA 2XB5A 3HEFA 3EGQA 3VW2A 1OFCX 4M3DA 3D1NI 4BXXJ 4XIDA 4A3EJ 3S1RJ 1PUFB 1BA5A 3BTCA 2JK3A 2HQ5A 1H89C 3CRJA 3F1BA 2E19A 1MH3A 2OERA 1RESA 1I3QJ 2DA6A 3B6CA 3L1PA 2DMUA 3Q0UA 4MO7A 2H8RA 3OSFA 4DYCA 1MBFA 1JKQC 3VPRA 2LKXA 1ZR2A 3H3VK 1SANA 3CCYA 3LSPA 1GDTA 2V57A 3BQYA 1ETOA 3M3YJ 2G0EA 3LHQA 5K58A 2L7ZA 2LLKA 5EF6A 3BTIA 3HM5A 3MN2A 5IP6A 3JRBA 2W48A 2DA2A 2DA1A 4CGRA 4JL3A 2HYJA 2HYTA 1U78A 4AC6A 2XPUA 1APLC 1JTXA 2ZB9A 2TRTA 3HBLA 5FLMJ 2OPTA 1X2NA 5EGOB 2K9NA 2HXOA 3NARA 4DYQA 2R5YB 4DW6A 4XRMA 2G7LA 3S16J 1EF4A 2NS7A 2WAQN 3JRCA 3VVYA 3NAUA 2K9QA 3RQIA 1ETKA 3QKXA 4JKZA 2PMZN 3JRAA 2JA6J 2CQXA 1H8AC 4BBRJ 3VIBA 5IYDJ 3GEUA 4ACIA 2QIBA 2L7MP 3IH2A 4D7NA 4AUXA 4BY1J 2X48A 2ZCXA 1XC5A 5M5YJ 1NTCA 2QOPA 1WPKA 5HAWA 5M3FJ 1XG1A 4JYKA 5EEAA 2M0CA 3QQAA 2UXOA 4AYBN 2EZLA 1GV2A 3BG9A 3BG3A 1B8IA 4A3GJ 4BY7J 1MBGA 2KDZA 3W6VA 3PASA 5H9TA 3F0CA 2QCOA 1T33A 5EYRA 3TEDA 4G12A 2G7GA 5D1RA 3K2AA 2YVEA 1JUSA 2EZHA 3ZQHA 1IRZA 3C07A 2ZCNA 3JR9A 1W0TA 3MNLA 1JKOC 1ETYA 5C44J 2XRLA 2CRGA 1U9NA 3QPLA 3NXCA 3RZOJ 4UDSA 5EFYA 3PM1A 2GBYA 4A3MJ 3PO2J 1Y1WJ 1ETXA 2GUHA 2DMPA 5HODA 3GTJJ 1ENHA 2XGCA 3VW1A 3HOUJ 1ZK8A 2ECBA 2X6OA 3BR0A 3BCGA 3A02A 2GFNA 4DZPA 2RAEA 2IU5A 2FX0A 2AO9A 3TW6A 2DA5A 1TC3C 2HI3A 5HSZA 2DN0A 5CW8A 3CDLA 2WGBA 1U9OA 1B8IB 2VPRA 3GZIA 1X58A 4QTRA 3QBMA 4V2GA 4Y52J 2Y30A 2EZIA 3HOZJ 1WH5A 1RKTA 3RKQA 3V78A 2YVHA 2UXHA 3IV5A 2DA7A 3G7RA 1WGXA 2E2IJ 2NP3A 4BBSJ 4JX6A 2NVTJ 2EZKA 5EGOA 5DAJA 4V2FA 4AC0A 1I50J 3BJBA 2LFBA 3CMYA 2R5YA 1MNMC 3BR6A 4A3DJ 5EZGA 1ZGWA 3GTKJ 2NS8A 2JA8J 3DPJA 5IOYA 1JKPC 5EZHA 5GPAA 1MBEA 2R7ZJ 1K83J 2F07A 5FKOA 2ID3A 1G2HA 4M3GA 3T6NA 3NPIA 2EQRA 4DZJA 1TWFJ 2MG4A 2UXIA 1GVDA 1JTYA 3JRIA 2PZ9A 4JNNA 4ME9A 5E3OA 5FKLA 5IYCJ 2GENA 3Q0VA 3S1NJ 2K40A 1OJLA 2LP0A 3HKZN 1MBJA 2L7FP 4A3JJ 4A3CJ 2YUSA 4MK6A 2DMTA 4A3FJ 2L0KA 4C3IJ 1QVUA 1FTTA 1AKHA 5E3LA 5M5XJ 1RPWA 1LFBA 3Q3SA 3M4OJ 3BTJA 2P81A 3S1MJ 4MFDA 3HGGA 3VVZA 1H88C 1E3OC 3DCFA 4MLOA 4FTHA 3S15J 1QRYA 1GUUA 3FK6A 3LOCA 3SFIA 2ME0A 3WHBA 2REKA 3S17J 2MSYA 1A5JA 3ANPA 1GT0C 3HE0A 4MIMA 3BR3A 1UG2A 3ZQLA 2ZCMA 3KNWA 3AQSA 1JKRC 4ABZA 1Z0XA 2ZOZA 3V6GA 1SFOJ 1X2MA 2LK2A 3BR5A 2YU9J 5FLVA 3AQTA 3IUVA 5FJ8J 1A6IA 1IDYA 2HDDA 2OI8A 3VW0A 2RHAA 2DG8A 4M3FA 3MKLA 1T56A 3O8GA 3JRHA 3B81A 3QPSA 3HTAA 3NNRA 1VFCA 2CUFA 1P7JA 2VI6A 5M3MJ 3BG5A 5DS9A 5EDNA 2I10A 5E3NA 3ZQIA 3E7LA 4JP0A 2HXIA 1QVTA 1S7EA 2NVXJ 3ANGA 3FKIJ 3RZDJ 4IHWA 2JMWA 1MSFC 4XK4A 2GM4A 3LJLA 3HIMA 3FK7A 1AKHB 1JUMA 3I4NJ 1BJZA 4GFLA 2COBA 5FMPA 5F27A 3VOXA 1UI6A 1BW5A 4W97A 2Y31A 2CUEA 4MXMA 2ID6A 2Q24A 3KKCA 2NOGA 4L5EA 5IYBJ 2WV1A 3DEWA 4JX5A 4A69C 5CXGA 2DG7A 4CYCB 3CJDA 5J3LA 2B63J 1TWCJ 1ETVA 2W53A 2OF7A 2N8GA 4D5CA 1OCTC 1HCRA 4C2MJ 1ITYA 2G7SA 2M2EA 4S0HB 5IOZA 4YZEA 5D19A 2O9LA 2QF7A 1MBHA 5F08A 3I4MJ 1RKWA 1YRNA 1F43A 3HTJA 3S2DJ 1LFUP 2E1OA 2O8KA 1POGA 3CQZJ 2M8GX 4QIWN 4W1UA 4A3LJ 1FIAA 2IBDA 2XGDA 5F1JA 3GTPJ 4GFKA 3ZQGA 2JJ7A 3S14J 2QKOA 4DYRA 5F0HA 1OCPA 1VI0A 4FCYA 2DA3A 3BR1A 5J1RA 3WHCA 4C3JJ 3SJMA 1JJ8C 3HTIA 5FKKA 2NVQJ 4D7MA 2XPWA 1FIPA 2GLOA 1ZTRA 2ECCA 3H0GJ 4D5FA 2LD5A 3RD3A 3O8HA 3A01B 3GTGJ 4A3BJ 4L62A 2VUMJ 1VNDA 2FBQA 4KWAA 5IP7J 4B1RA 3VVXA 3E7QA 4JX4A 3BNIA 4HKUA 3HOWJ 3CWRA 1YRNB 2R0QC 3BRUA 4C3HJ 3VUQA 4M3EA 2DTZA 4IEJA 4EEFG 4RDUA 4X6AJ 1DU6A 1LE8B 3OSGA 2L9RA 1IC8A 3VOKA 3FRQA 2PBXA 3G1LA 5EG0B 1W0UA 1RETA 1NK2P 1UI5A 2UXPA 2CJJA 2EH3A 2XPVA 2D5VA 3PO3J 3IH4A 5C4JJ 1FJLA 1B72A 1BW6A 5F0FA 1TWAJ 3HGYA 4NELA 4A93J 2AHQA 3G56A 3A03A 2VKEA 2KT0A 4NN1A 1Q1VA 2LTPA 5E3MA 1K61A 1IUFA 1ZQ3P 5GP9A 3K7AJ 1HDPA 5J1UA 4A3KJ 1BL0A 1HDDC 2HOAA 2XB0X 2QTQA 2Y9ZA 2ME6A 4UUSA 1ORKA 5FKMA 3GTMJ 2NP5A 3PPBA 4GFBA 1P7IA 4B4CA 3S5RA 4CYCA 3HOVJ 2IAIA 1RR7A 4FE7A 4FE4A 2E2HJ 1WI3A 2FD5A 1MSEC 1FEXA 3COLA 2MGQA 2DMNA 2R93J 4GCTA 3GTOJ 2X9DA 2IEKA 3BTLA 3FISA 3OOUA 5K7FA 2ZOYA 1O4XA 4UUTA 2G3BA 4GCLA 3ZOBA 5FHPA 3G1OA 2HOSA 2O7OA 2TCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH7 A;  2Y2Z A;  4XIC A;  3JSJ A;  3KKD A;  2D6Y A;  3HDD A;  1B72 B;  2XSD C;  1ZR4 A;  5FGL A;  3JRD A;  1QPI A;  4IHY A;  3S1Q J;  1I6H J;  4ICH A;  2E2J J;  1MBK A;  2R5Z A;  2M34 A;  4Y7N J;  4IHX A;  2JN6 A;  5F04 A;  1IGN A;  2XDN A;  2JA7 J;  1IV6 A;  1JGG A;  5M5W J;  2FQ4 A;  1AHD P;  3LWJ A;  5F0C A;  3LSR A;  1WCM J;  1JJ6 C;  2HKU A;  3A01 A;  2HOT A;  4UUS B;  1IG7 A;  1JUP A;  2LVS A;  3TP0 A;  3TP3 A;  4RBO A;  3ON4 A;  1F36 A;  1NK3 P;  1XS9 A;  3UKG A;  1IJW C;  2VKV A;  3MVP A;  3BQZ A;  1CQT A;  2JA5 J;  2NVY J;  1Y1V J;  3BR2 A;  5J1Y A;  2R92 J;  2Y9Y A;  3O60 A;  3JRF A;  2MW8 A;  5GPC A;  1HF0 A;  4XRS A;  1AU7 A;  5BNG A;  5K7H A;  3ZQC A;  2NX4 A;  1TWH J;  3GBG A;  4QSH A;  2Y0S N;  4MFE A;  3JRE A;  2H1K A;  1GV5 A;  3NI7 A;  3Q0W A;  2LR8 A;  3LSJ A;  3OIO A;  1SGM A;  3GTL J;  3ON2 A;  1U8B A;  1LE8 A;  3HOY J;  3TW7 A;  3LSG A;  3GTQ J;  4GCK A;  5EG0 A;  5CXI A;  5FKN A;  3KZ9 A;  1TWG J;  5C4X J;  2DJN A;  2WB1 N;  1JT0 A;  1ZKG A;  4M3B A;  9ANT A;  1ETW A;  1MH4 A;  2R5Z B;  3P9T A;  5C3E J;  4A3I J;  3HB9 A;  4BKX A;  2M9H A;  4M6V A;  1ETQ A;  3IH3 A;  4AF5 A;  5HBU A;  2FJ1 A;  4I6Z A;  1FTZ A;  1R9T J;  4PXI A;  2CQQ A;  2CU7 A;  1PUF A;  2EBI A;  2K9S A;  1UMQ A;  2WUI A;  4I76 A;  2LY9 A;  5D18 A;  1UHS A;  3C2B A;  2UXU A;  3HTH A;  1HOM A;  2QWT A;  1HLV A;  2ELK A;  1JT6 A;  1D5Y A;  2XGE A;  3EUP A;  4FIS A;  3BHQ A;  3S2H J;  3B6A A;  4B3A A;  3FIW A;  2YS9 A;  3G1M A;  4X1E A;  4LOC A;  3LNQ A;  2O7T A;  4J19 A;  2JWT A;  5K7Z A;  5C4Y A;  1Z77 A;  3BT9 A;  3VP5 A;  3RH2 A;  5DTD A;  2DMQ A;  5IP9 J;  4NDL A;  3JRG A;  1DU0 A;  3NRG A;  3SDG A;  5JLW A;  2RAS A;  1VF9 A;  4XRS G;  2DA4 A;  5IPA A;  3HOX J;  4HNV A;  3ZQF A;  5JLX A;  5AQC A;  1IDZ A;  4IHV A;  2XB5 A;  3HEF A;  3EGQ A;  3VW2 A;  1OFC X;  4M3D A;  3D1N I;  4BXX J;  4XID A;  4A3E J;  3S1R J;  1PUF B;  1BA5 A;  3BTC A;  2JK3 A;  2HQ5 A;  1H89 C;  3CRJ A;  3F1B A;  2E19 A;  1MH3 A;  2OER A;  1RES A;  1I3Q J;  2DA6 A;  3B6C A;  3L1P A;  2DMU A;  3Q0U A;  4MO7 A;  2H8R A;  3OSF A;  4DYC A;  1MBF A;  1JKQ C;  3VPR A;  2LKX A;  1ZR2 A;  3H3V K;  1SAN A;  3CCY A;  3LSP A;  1GDT A;  2V57 A;  3BQY A;  1ETO A;  3M3Y J;  2G0E A;  3LHQ A;  5K58 A;  2L7Z A;  2LLK A;  5EF6 A;  3BTI A;  3HM5 A;  3MN2 A;  5IP6 A;  3JRB A;  2W48 A;  2DA2 A;  2DA1 A;  4CGR A;  4JL3 A;  2HYJ A;  2HYT A;  1U78 A;  4AC6 A;  2XPU A;  1APL C;  1JTX A;  2ZB9 A;  2TRT A;  3HBL A;  5FLM J;  2OPT A;  1X2N A;  5EGO B;  2K9N A;  2HXO A;  3NAR A;  4DYQ A;  2R5Y B;  4DW6 A;  4XRM A;  2G7L A;  3S16 J;  1EF4 A;  2NS7 A;  2WAQ N;  3JRC A;  3VVY A;  3NAU A;  2K9Q A;  3RQI A;  1ETK A;  3QKX A;  4JKZ A;  2PMZ N;  3JRA A;  2JA6 J;  2CQX A;  1H8A C;  4BBR J;  3VIB A;  5IYD J;  3GEU A;  4ACI A;  2QIB A;  2L7M P;  3IH2 A;  4D7N A;  4AUX A;  4BY1 J;  2X48 A;  2ZCX A;  1XC5 A;  5M5Y J;  1NTC A;  2QOP A;  1WPK A;  5HAW A;  5M3F J;  1XG1 A;  4JYK A;  5EEA A;  2M0C A;  3QQA A;  2UXO A;  4AYB N;  2EZL A;  1GV2 A;  3BG9 A;  3BG3 A;  1B8I A;  4A3G J;  4BY7 J;  1MBG A;  2KDZ A;  3W6V A;  3PAS A;  5H9T A;  3F0C A;  2QCO A;  1T33 A;  5EYR A;  3TED A;  4G12 A;  2G7G A;  5D1R A;  3K2A A;  2YVE A;  1JUS A;  2EZH A;  3ZQH A;  1IRZ A;  3C07 A;  2ZCN A;  3JR9 A;  1W0T A;  3MNL A;  1JKO C;  1ETY A;  5C44 J;  2XRL A;  2CRG A;  1U9N A;  3QPL A;  3NXC A;  3RZO J;  4UDS A;  5EFY A;  3PM1 A;  2GBY A;  4A3M J;  3PO2 J;  1Y1W J;  1ETX A;  2GUH A;  2DMP A;  5HOD A;  3GTJ J;  1ENH A;  2XGC A;  3VW1 A;  3HOU J;  1ZK8 A;  2ECB A;  2X6O A;  3BR0 A;  3BCG A;  3A02 A;  2GFN A;  4DZP A;  2RAE A;  2IU5 A;  2FX0 A;  2AO9 A;  3TW6 A;  2DA5 A;  1TC3 C;  2HI3 A;  5HSZ A;  2DN0 A;  5CW8 A;  3CDL A;  2WGB A;  1U9O A;  1B8I B;  2VPR A;  3GZI A;  1X58 A;  4QTR A;  3QBM A;  4V2G A;  4Y52 J;  2Y30 A;  2EZI A;  3HOZ J;  1WH5 A;  1RKT A;  3RKQ A;  3V78 A;  2YVH A;  2UXH A;  3IV5 A;  2DA7 A;  3G7R A;  1WGX A;  2E2I J;  2NP3 A;  4BBS J;  4JX6 A;  2NVT J;  2EZK A;  5EGO A;  5DAJ A;  4V2F A;  4AC0 A;  1I50 J;  3BJB A;  2LFB A;  3CMY A;  2R5Y A;  1MNM C;  3BR6 A;  4A3D J;  5EZG A;  1ZGW A;  3GTK J;  2NS8 A;  2JA8 J;  3DPJ A;  5IOY A;  1JKP C;  5EZH A;  5GPA A;  1MBE A;  2R7Z J;  1K83 J;  2F07 A;  5FKO A;  2ID3 A;  1G2H A;  4M3G A;  3T6N A;  3NPI A;  2EQR A;  4DZJ A;  1TWF J;  2MG4 A;  2UXI A;  1GVD A;  1JTY A;  3JRI A;  2PZ9 A;  4JNN A;  4ME9 A;  5E3O A;  5FKL A;  5IYC J;  2GEN A;  3Q0V A;  3S1N J;  2K40 A;  1OJL A;  2LP0 A;  3HKZ N;  1MBJ A;  2L7F P;  4A3J J;  4A3C J;  2YUS A;  4MK6 A;  2DMT A;  4A3F J;  2L0K A;  4C3I J;  1QVU A;  1FTT A;  1AKH A;  5E3L A;  5M5X J;  1RPW A;  1LFB A;  3Q3S A;  3M4O J;  3BTJ A;  2P81 A;  3S1M J;  4MFD A;  3HGG A;  3VVZ A;  1H88 C;  1E3O C;  3DCF A;  4MLO A;  4FTH A;  3S15 J;  1QRY A;  1GUU A;  3FK6 A;  3LOC A;  3SFI A;  2ME0 A;  3WHB A;  2REK A;  3S17 J;  2MSY A;  1A5J A;  3ANP A;  1GT0 C;  3HE0 A;  4MIM A;  3BR3 A;  1UG2 A;  3ZQL A;  2ZCM A;  3KNW A;  3AQS A;  1JKR C;  4ABZ A;  1Z0X A;  2ZOZ A;  3V6G A;  1SFO J;  1X2M A;  2LK2 A;  3BR5 A;  2YU9 J;  5FLV A;  3AQT A;  3IUV A;  5FJ8 J;  1A6I A;  1IDY A;  2HDD A;  2OI8 A;  3VW0 A;  2RHA A;  2DG8 A;  4M3F A;  3MKL A;  1T56 A;  3O8G A;  3JRH A;  3B81 A;  3QPS A;  3HTA A;  3NNR A;  1VFC A;  2CUF A;  1P7J A;  2VI6 A;  5M3M J;  3BG5 A;  5DS9 A;  5EDN A;  2I10 A;  5E3N A;  3ZQI A;  3E7L A;  4JP0 A;  2HXI A;  1QVT A;  1S7E A;  2NVX J;  3ANG A;  3FKI J;  3RZD J;  4IHW A;  2JMW A;  1MSF C;  4XK4 A;  2GM4 A;  3LJL A;  3HIM A;  3FK7 A;  1AKH B;  1JUM A;  3I4N J;  1BJZ A;  4GFL A;  2COB A;  5FMP A;  5F27 A;  3VOX A;  1UI6 A;  1BW5 A;  4W97 A;  2Y31 A;  2CUE A;  4MXM A;  2ID6 A;  2Q24 A;  3KKC A;  2NOG A;  4L5E A;  5IYB J;  2WV1 A;  3DEW A;  4JX5 A;  4A69 C;  5CXG A;  2DG7 A;  4CYC B;  3CJD A;  5J3L A;  2B63 J;  1TWC J;  1ETV A;  2W53 A;  2OF7 A;  2N8G A;  4D5C A;  1OCT C;  1HCR A;  4C2M J;  1ITY A;  2G7S A;  2M2E A;  4S0H B;  5IOZ A;  4YZE A;  5D19 A;  2O9L A;  2QF7 A;  1MBH A;  5F08 A;  3I4M J;  1RKW A;  1YRN A;  1F43 A;  3HTJ A;  3S2D J;  1LFU P;  2E1O A;  2O8K A;  1POG A;  3CQZ J;  2M8G X;  4QIW N;  4W1U A;  4A3L J;  1FIA A;  2IBD A;  2XGD A;  5F1J A;  3GTP J;  4GFK A;  3ZQG A;  2JJ7 A;  3S14 J;  2QKO A;  4DYR A;  5F0H A;  1OCP A;  1VI0 A;  4FCY A;  2DA3 A;  3BR1 A;  5J1R A;  3WHC A;  4C3J J;  3SJM A;  1JJ8 C;  3HTI A;  5FKK A;  2NVQ J;  4D7M A;  2XPW A;  1FIP A;  2GLO A;  1ZTR A;  2ECC A;  3H0G J;  4D5F A;  2LD5 A;  3RD3 A;  3O8H A;  3A01 B;  3GTG J;  4A3B J;  4L62 A;  2VUM J;  1VND A;  2FBQ A;  4KWA A;  5IP7 J;  4B1R A;  3VVX A;  3E7Q A;  4JX4 A;  3BNI A;  4HKU A;  3HOW J;  3CWR A;  1YRN B;  2R0Q C;  3BRU A;  4C3H J;  3VUQ A;  4M3E A;  2DTZ A;  4IEJ A;  4EEF G;  4RDU A;  4X6A J;  1DU6 A;  1LE8 B;  3OSG A;  2L9R A;  1IC8 A;  3VOK A;  3FRQ A;  2PBX A;  3G1L A;  5EG0 B;  1W0U A;  1RET A;  1NK2 P;  1UI5 A;  2UXP A;  2CJJ A;  2EH3 A;  2XPV A;  2D5V A;  3PO3 J;  3IH4 A;  5C4J J;  1FJL A;  1B72 A;  1BW6 A;  5F0F A;  1TWA J;  3HGY A;  4NEL A;  4A93 J;  2AHQ A;  3G56 A;  3A03 A;  2VKE A;  2KT0 A;  4NN1 A;  1Q1V A;  2LTP A;  5E3M A;  1K61 A;  1IUF A;  1ZQ3 P;  5GP9 A;  3K7A J;  1HDP A;  5J1U A;  4A3K J;  1BL0 A;  1HDD C;  2HOA A;  2XB0 X;  2QTQ A;  2Y9Z A;  2ME6 A;  4UUS A;  1ORK A;  5FKM A;  3GTM J;  2NP5 A;  3PPB A;  4GFB A;  1P7I A;  4B4C A;  3S5R A;  4CYC A;  3HOV J;  2IAI A;  1RR7 A;  4FE7 A;  4FE4 A;  2E2H J;  1WI3 A;  2FD5 A;  1MSE C;  1FEX A;  3COL A;  2MGQ A;  2DMN A;  2R93 J;  4GCT A;  3GTO J;  2X9D A;  2IEK A;  3BTL A;  3FIS A;  3OOU A;  5K7F A;  2ZOY A;  1O4X A;  4UUT A;  2G3B A;  4GCL A;  3ZOB A;  5FHP A;  3G1O A;  2HOS A;  2O7O A;  2TCT A; 
#chains in the Genus database with same CATH topology
 2Y2Z A;  2NOJ B;  5BPD A;  4U7D A;  3JSJ A;  4V19 K;  3HDD A;  1B72 B;  1YW8 A;  3FBI B;  1ZR4 A;  1UJ8 A;  3FXJ A;  4BU2 A;  1QPI A;  1REP C;  3H0D A;  2CV2 A;  4IHY A;  3S1Q J;  2RN7 A;  1MBK A;  4RAG A;  1SEU A;  1ZRC A;  2M34 A;  4Y7N J;  5ILS A;  5ILU A;  3IP4 B;  4MTD A;  5F04 A;  4L5I A;  3RYP A;  2FQ4 A;  4AWX B;  5K1Y A;  4CCN A;  3CO7 C;  3CCV I;  2HFH A;  4CXF A;  2KQR A;  2UXN A;  2EB7 A;  5LBQ A;  4CCM A;  3GZ6 A;  3LA3 A;  3TP0 A;  3TP3 A;  3VYU B;  4RBO A;  1F36 A;  2D1V A;  3U2R A;  3F8F A;  1B9M A;  1IJW C;  1VQM I;  2TDX A;  2EIJ H;  1KA8 A;  4IX7 A;  4KDP A;  4OIP F;  1Y1V J;  1Z67 A;  5FD5 A;  4BJ6 C;  3CJT B;  1D3Y A;  2R92 J;  1TZL A;  1QO0 D;  3O60 A;  2MW8 A;  4B44 A;  4XRS A;  2HGC A;  4YFN F;  5K7H A;  2RV8 A;  4BQA A;  2K9M A;  2H1K A;  2Y0S N;  2KRH A;  3VOE A;  1GV5 A;  2OA4 A;  3KP4 A;  1QQI A;  2FSW A;  3Q0W A;  1BC7 C;  3OIO A;  1T95 A;  1IV8 A;  1JI8 A;  3E97 A;  3HOY J;  1ZG5 A;  5L3F A;  5CXI A;  4DQ2 A;  2DJN A;  3CME I;  3KLN A;  2E35 A;  2GOM A;  3VDX A;  5BOX A;  2XF7 A;  2WWY A;  2CG4 A;  4KIC A;  4I6Z A;  4KMF A;  1WJE A;  1PP8 F;  2BW3 B;  3CD6 I;  1R9T J;  1JGS A;  2JUC A;  2K9L A;  4NBQ A;  4IQJ A;  2FMY A;  2CU7 A;  2A68 F;  4PSX A;  2DYR H;  4OIO F;  2WUI A;  1HKT A;  2FOW A;  3CDH A;  3CTA A;  1L3L A;  2FA5 A;  1KZH A;  1S5L C;  1WVR A;  1D0Z A;  3WTY C;  5HOO A;  4E7J A;  1HLV A;  1TQM A;  3ONQ A;  4IO9 F;  4FIS A;  4AU7 A;  3B6A A;  4B3A A;  3FIW A;  1ZRF A;  1XCV A;  2PG4 A;  4IRI A;  4CUG A;  2JSP A;  3WTX C;  3S93 A;  3BT9 A;  5DTD A;  1R1U A;  1FOX A;  2PMZ A;  1X1C A;  1KU3 A;  3SDG A;  1DPU A;  1YYV A;  2V9K A;  1FT9 A;  2BV6 A;  2X1C A;  1P2F A;  3FMQ A;  3T5X A;  2IA0 A;  4HZF A;  1YFH A;  1FP2 A;  3FXK A;  1S8N A;  3EET A;  2PJR B;  2R7Q A;  3ROU A;  2QYO A;  3ABU A;  5L3B A;  1OFC X;  2XHK A;  3DF8 A;  2ZSI B;  4BXX J;  4IXA A;  4XID A;  4U0W A;  1IUY A;  2JK3 A;  1H89 C;  3VSL A;  3HL2 A;  2E19 A;  5JR3 A;  1D8J A;  3T8R A;  1PP7 U;  1RES A;  1I3Q J;  2Y69 H;  1K79 A;  2DA6 A;  3J80 Z;  3QYB A;  2ISY A;  3I71 A;  3KX2 A;  4LLG F;  3L09 A;  4M9Z A;  2E7X A;  5HS8 A;  1A04 A;  4BS9 A;  3K4K A;  3K1N A;  3VPR A;  2LKX A;  3H3V K;  2QGU A;  4R1H A;  3S8P A;  3CCY A;  2CQK A;  1BM9 A;  2QSG X;  4P55 A;  1ETO A;  1QZZ A;  1Z7U A;  3L00 A;  1BJA A;  3QOE A;  2E1M B;  4I09 A;  3MN2 A;  2W48 A;  4N4N B;  1BI3 A;  4DOZ A;  3P7N A;  2XVC A;  3LST A;  4PJN A;  1WZ2 A;  2HYT A;  1U78 A;  2XPU A;  4NQW B;  2OBP A;  5EGO B;  3M8E A;  2F5E A;  2G7L A;  2IA1 A;  3S16 J;  2NYX A;  1G8X A;  1SMT A;  2K9Q A;  1GXQ A;  2VBW A;  2JA6 J;  4ZDO A;  2VBZ A;  2DPD A;  3OV8 A;  2FRH A;  3MCZ A;  4AIK A;  2BVL A;  3PQK A;  2W7N A;  2EFW A;  1CGP A;  4PK4 A;  2ZOY A;  1J9I A;  3OOP A;  5CVR A;  3K70 D;  5ICF A;  1MMG A;  4I99 C;  1Y39 A;  3F22 A;  1NG6 A;  4FAS D;  3MKZ A;  3QQA A;  2AQF A;  4AYB N;  5B1A H;  2ACJ A;  3PFI A;  3BG3 A;  2P6T A;  2ZXJ A;  2DYS H;  3TGN A;  3LWF A;  3PNT A;  4P5O A;  2FBH A;  1R5G A;  5D5X B;  4BDZ A;  3F0C A;  3CCJ I;  2LRD A;  4XN3 A;  1WJF A;  2QLZ A;  1BR1 A;  1QBJ A;  3TED A;  4L18 B;  3U1K A;  2G7G A;  4L9V A;  2GIV A;  4LIU A;  1RI7 A;  3S3M A;  1JUS A;  2CUZ A;  4RGU A;  1KQ0 A;  2WY8 Q;  1U8R A;  2WY7 Q;  1P4A A;  1JKO C;  2A69 F;  3TKY A;  5C44 J;  1WSU A;  2VKH A;  2IS6 A;  2CV1 A;  4WCG A;  2X6W A;  5FFX A;  3QPL A;  3NXC A;  4OD5 A;  3IWF A;  4PUS A;  4A3M J;  3PO2 J;  2GUH A;  3OS0 A;  4RAY A;  5HOD A;  3GTJ J;  1TW2 A;  4LFU A;  3TO7 A;  3VW1 A;  1BI0 A;  2X1D A;  1ZK8 A;  2JVG A;  1OIS A;  2KL4 A;  3A02 A;  1DUX C;  3EDP A;  4ENJ A;  3I54 A;  4GYI A;  1WKM A;  1N78 A;  4RAF A;  2R7U A;  3WU1 B;  2AO9 A;  1YJ9 I;  2DA5 A;  3CC4 I;  2HI3 A;  2JRT A;  2YVX A;  2MH2 A;  2L9V A;  3PUB A;  1W5C C;  4PJM A;  4XSZ F;  3SXY A;  3V8L A;  4BAY A;  4RM2 A;  2W85 A;  5H20 A;  1X58 A;  2E1M C;  3R4K A;  2EV6 A;  4BQO A;  3LFK A;  1YJW I;  4UXN A;  2L54 A;  3V78 A;  2YVH A;  3IV5 A;  2UV1 A;  1R6R A;  4M9X A;  1ZG3 A;  1WGX A;  4Q5S F;  2E2I J;  3G7R A;  2HQA A;  4BBS J;  2LRE A;  2EZK A;  2P4W A;  4V2F A;  2B3W A;  3BJB A;  4KN4 X;  4XMY A;  1SMY F;  2LFB A;  3CMY A;  2R5Y A;  1R5H A;  1MNM C;  1P92 A;  2OCE A;  3BR6 A;  5EZG A;  2EIL H;  2R7Z J;  1K83 J;  3V4G A;  1C0W A;  1TWF J;  2J5P A;  2KIM A;  1TL8 A;  2PZ9 A;  3FBN B;  2QQB A;  4GYG A;  4AID A;  4DVY P;  5FKL A;  5IYC J;  3OYA A;  3Q0V A;  3A1Y A;  2L7F P;  4LK0 F;  2YUS A;  3B02 A;  3F21 A;  1QA6 A;  1V5E A;  2VQG A;  3CP2 A;  2QKL B;  1AKH A;  5E3L A;  1X3Z B;  5M5X J;  3WE3 A;  3HRM A;  3KEO A;  2O6G E;  3LQR A;  4MFD A;  3HGG A;  5D6E A;  4MLO A;  3LOC A;  2IXS A;  4G7Z F;  1GT0 C;  4F52 A;  3PNY A;  4MIM A;  3BR3 A;  1X4O A;  2IVM A;  2XRN A;  1XX5 A;  4ABZ A;  3J81 Z;  2CWE A;  3GVA A;  4ASN A;  1A35 A;  1OCO H;  1Z0X A;  5JVG F;  1SFO J;  2LK2 A;  4FT8 A;  3AQT A;  1Y8Q B;  2JT1 A;  3RIR A;  1A6I A;  1IDY A;  2HDD A;  1UAA A;  2RHA A;  2DG8 A;  2OZ6 A;  4XON A;  2KIF A;  4XBF A;  2AXT C;  4XKB A;  2GQQ A;  2EPF A;  3BG5 A;  5EDN A;  2I10 A;  2A5W A;  3WU2 C;  2M4K A;  1FYK A;  3H36 A;  3E7L A;  2V4J C;  4BGD A;  4A0Z A;  5F64 A;  2KLO A;  1QVT A;  1S7E A;  4HQM A;  4OOI A;  3RZD J;  1YLF A;  4EV0 A;  4IHW A;  2JMW A;  3SEQ A;  1MSF C;  4XK4 A;  1EH7 A;  3K4C A;  2QM3 A;  5LRR A;  1AKH B;  5DEQ A;  2IJL A;  2LC2 A;  4GFL A;  5FMP A;  3BJ6 A;  4AVZ A;  1R58 A;  2EFP A;  3F6V A;  5JVT A;  2JRM A;  2CUE A;  2JVH A;  2ID6 A;  3KKC A;  1WWX A;  2J5O A;  2VBX A;  1X19 A;  4BEH B;  2WV1 A;  4A69 C;  5CXG A;  3NWS A;  2OTJ I;  5IT9 Z;  3WGH A;  4CIC A;  4I01 A;  1XMA A;  1RC9 A;  1TWC J;  1ETV A;  2F48 A;  3UNG C;  5D6F A;  3MKY B;  3KYL A;  2JTV A;  1ITY A;  2M2E A;  2Q1Z B;  4ESB A;  5IOZ A;  4YZE A;  2CYY A;  3FMR A;  3H1C A;  3OIQ A;  3AG1 H;  4EQQ A;  3O3K A;  3R0A A;  2UUZ A;  1X1B A;  4Q47 A;  1MGT A;  3AG4 H;  4HV6 A;  4QIW N;  4W1U A;  4WF2 A;  4LD5 A;  3MWM A;  1TT0 A;  2E34 A;  3IWZ A;  4GFK A;  5L3C A;  2GZW A;  2LY1 A;  1D5V A;  3E6D A;  3C2H A;  1ZAO A;  2Y0M A;  4DYR A;  4ZYA A;  1VQN I;  1K4T A;  2DA3 A;  2PMU A;  3ABT A;  1R71 A;  2Z3Y A;  3HRU A;  5DV5 A;  3COA C;  4D7M A;  2NVQ J;  4XLH A;  2GLO A;  2H8W A;  4FX0 A;  3J81 K;  5BMZ A;  2R7T A;  3H0G J;  1UHM A;  4N4O B;  3A01 B;  2P5K A;  1GXP A;  3RYR A;  1XGM A;  3BZC A;  3MZY A;  4WXH A;  1E17 A;  4HBL A;  1JE8 A;  3QOD A;  4U87 A;  1DP7 P;  3L7W A;  1UST A;  1JXS A;  2R0Q C;  1MMS A;  2R7O A;  4AD9 A;  5DYM A;  2KPM A;  5J4V A;  3BG7 A;  1LE8 B;  3OSG A;  3VOK A;  4P9U A;  1YIJ I;  1QZE A;  3QPT A;  2IP2 A;  2F4M B;  1FYL A;  2EH3 A;  4HDU A;  4ZTF A;  2VT2 A;  4UVA A;  5C4J J;  1FJL A;  1FBS A;  1IRX A;  1T08 B;  5F0F A;  2VL8 A;  1TWA J;  3KZI C;  5D5V B;  3K6G A;  3K10 A;  5GAD J;  1RNL A;  3A03 A;  3RKW A;  5IT9 K;  2LTP A;  1O7F A;  2MLG A;  4LGW A;  2IGO A;  1U5T B;  1O3T A;  4A3K J;  1BL0 A;  2P5V A;  1EH6 A;  1NG7 A;  2CH0 A;  2Y9Z A;  3KEY A;  2NP5 A;  1ORK A;  5FKM A;  1RIO H;  3FXO A;  2L4M A;  2VC1 A;  2EFN A;  4CYC A;  3MZ8 A;  2IAI A;  3HOV J;  4FE7 A;  1XDS A;  3TDU C;  1WI3 A;  4GO1 A;  4S05 A;  4J01 A;  1SFX A;  3COL A;  4ANJ A;  2DMN A;  2RC4 A;  3DKW A;  2R93 J;  1FMV A;  3GTO J;  2X9D A;  3BTL A;  4PZJ A;  4RGX A;  4GGG A;  1BR2 A;  1V54 H;  4GCL A;  2QQ9 A;  4OAY A;  4B48 A;  3I3L A;  4IZZ A;  4I2O A;  2HOS A;  2O7O A;  2TCT A;  2KIS A;  1Z6R A;  1WH7 A;  4XIC A;  2BXZ A;  1PJR A;  2DOF A;  2D6Y A;  2EIM H;  1R5I D;  3JRD A;  2ZCW A;  1XCB A;  1A36 A;  1OKR A;  4EM2 A;  5CQE A;  4IHX A;  2HR3 A;  1CF7 A;  3BZK A;  1JGG A;  5M5W J;  3E6B A;  4XLN F;  3JTG A;  1OYW A;  3LSR A;  4BYY A;  5FRO A;  2NS0 A;  2WTE A;  2HOT A;  4EGZ A;  2D45 A;  2K3F A;  1WQ2 A;  3ON4 A;  2EV5 A;  2IPQ X;  3UKG A;  4C30 A;  3EUH A;  3MVP A;  1CQT A;  2ZFU A;  3BR2 A;  1IZ1 A;  3OYK A;  1HST A;  1YHQ I;  3OS1 A;  2YSR A;  3ZQC A;  1FNN A;  3LMM A;  3A2K A;  2BY3 A;  2LYC A;  1D0Y A;  1TWH J;  3GBG A;  2Z5U A;  2CV0 A;  3NI7 A;  2LR8 A;  3E6M A;  1GLN A;  1SGM A;  3K1P A;  4HG2 A;  4KIB A;  3TW7 A;  2PFB A;  5D8K B;  5D8L B;  1IF1 A;  5CLS A;  4G7O F;  1MW7 A;  2OCC H;  1OCR H;  1TBX A;  2NAZ A;  4B43 A;  3SDB A;  2LDU A;  1ZKG A;  4M3B A;  3W2V A;  4A3I J;  3HB9 A;  1MMN A;  4Y15 A;  2KRF A;  5KCM A;  2R7V A;  4M6V A;  1ETQ A;  2LMD A;  1FBU A;  2FXA A;  2R7S A;  4PXI A;  4HST A;  2CQQ A;  1YX3 A;  3VYT B;  5KAF C;  2O0Y A;  3OS2 A;  5LD2 C;  1XSX A;  2K9S A;  4ZDL A;  4QLC U;  1B9N A;  4HF1 A;  3ABM H;  5AIQ A;  1YTY A;  2LY9 A;  2AQE A;  2UXU A;  2R7D A;  1YS6 A;  2QWT A;  2ELK A;  3L2Q A;  1LVK A;  2IGK A;  3BPX A;  3BHQ A;  1BC8 C;  3ESW B;  2MBF A;  3LSI A;  1ZAR A;  3G1M A;  4X1E A;  2E1N A;  4LOC A;  2KRC A;  3LNQ A;  3BWG A;  2O7T A;  2YX7 A;  2JWT A;  3W6J B;  3PIO F;  3VP5 A;  3G4S I;  4OIQ F;  2DMQ A;  3CES A;  3IUO A;  2DLL A;  1U3E M;  2RAS A;  4XRS G;  3U9G A;  3VEP A;  2KJB A;  2PEX A;  5IPA A;  1I39 A;  3TL4 X;  4Y13 A;  2FQ3 A;  3F8C A;  3HEF A;  2ZXI A;  1FLI A;  3D1N I;  3QP6 A;  1EA3 A;  2HQ5 A;  4BHC A;  3F1B A;  2BY0 A;  4AYB A;  1F1Z A;  2L02 A;  2M8E A;  2MFZ A;  3B6C A;  4PJL A;  3L1P A;  4D1Q A;  4MO7 A;  3I55 I;  1UHW A;  2H8R A;  2IS4 A;  2NXN B;  2X0L A;  3PNV A;  1MBF A;  1ZR2 A;  4HSR A;  2RNJ A;  3ZMT A;  2MC3 A;  2DFI A;  2ESH A;  4K2E A;  1VTN C;  2P7V B;  2VOD A;  3JAM Z;  3M3Y J;  2G0E A;  1EV7 A;  2W82 A;  3EUK L;  5B66 C;  3LHQ A;  2L7Z A;  2LLK A;  2B0L A;  5EF6 A;  2G9W A;  1XN7 A;  3WGG A;  3JRB A;  2M4G A;  2DA2 A;  2HYJ A;  3MQ0 A;  4BE0 A;  2R7F A;  2DFE A;  3J7Y J;  2ZB9 A;  4KIF A;  5FLM J;  2FU4 A;  1OQY A;  2FBI A;  3I0T A;  4DW6 A;  4XRM A;  5K5O A;  3F23 A;  4UB6 C;  2WAQ N;  3JRC A;  3NAU A;  1YG2 A;  2A6T A;  2HEO A;  3QKX A;  1OR7 A;  2CQX A;  1H8A C;  1VQ5 I;  3VIB A;  2RGV A;  4DIQ A;  2BW3 A;  4H4K C;  3PQJ A;  3LA7 A;  1Y0U A;  5IYD J;  1IN5 A;  3IKT A;  5AIP A;  3EUH C;  4D7N A;  1T6S A;  2HNH A;  2PI0 A;  2BOL A;  1XC5 A;  4I02 A;  2X1E A;  2HPI A;  5M5Y J;  2ZCX A;  3TQN A;  3F8M A;  1R1T A;  3ZN0 A;  4IOA F;  1ZHF A;  1WPK A;  2C6Y A;  2DFH A;  3QRF F;  2QVO A;  1W7P D;  3J7Z I;  2UXO A;  3KZZ A;  3BOQ A;  3REO A;  4BHP A;  1R4N B;  1GV2 A;  5ERI A;  1B8I A;  4A3G J;  3EPZ A;  1V55 H;  4BNC A;  2BHY A;  3NQO A;  2VPL A;  1X4P A;  1HKS A;  2ADU A;  3LA2 A;  2A05 A;  2XF6 A;  2KDZ A;  3TOB A;  2XUB A;  3W6V A;  4UY8 I;  3C7J A;  4RMN A;  2F4O B;  2QCO A;  5EYR A;  5DD8 A;  2L5Q A;  2KZG A;  3HXL A;  4CDG A;  3LSM A;  1YI2 I;  3DP7 A;  3K2A A;  2YVE A;  3H5N A;  3QU3 A;  3QAH A;  1B59 A;  3ZQH A;  3C07 A;  1NHA A;  2ZCN A;  2YR2 A;  2L4A A;  1JHF A;  3JR9 A;  2PJR A;  2A5Y B;  2BY1 A;  2VOP A;  2HYF A;  1Z91 A;  1W36 C;  3FXU A;  2CRG A;  1U9N A;  5EFY A;  4UNO A;  4ZZD A;  2GBY A;  4L9N A;  4N0B A;  2QWW A;  1ENH A;  3JAM K;  3EYI A;  2HKX A;  5JI6 A;  2X6O A;  3KYD B;  3FZV A;  2XRO A;  2GFN A;  2HYG D;  2LSO A;  3K70 C;  5HDK A;  1E3P A;  5D4R A;  3GWZ A;  1TC3 C;  2GA1 A;  3CDL A;  1MMD A;  1B8I B;  2VPR A;  2WC2 A;  1IN8 A;  3F3X A;  5LGN A;  3GF2 A;  5FGM A;  2L01 A;  4V2G A;  4Y52 J;  2Y30 A;  2KMU A;  1WH5 A;  1RKT A;  3RKQ A;  4NC7 A;  4EJW A;  1UG0 A;  2DT7 B;  2ZXH A;  2UXH A;  2ZME B;  2DJI A;  2XAJ A;  1SD6 A;  4NQW A;  5HLI A;  4EJV A;  1VQ4 I;  1OLT A;  2NP3 A;  1XDU A;  4ENK A;  5EGO A;  1Q1H A;  4XR6 A;  2O3F A;  1QHG A;  4JBA A;  3CCU I;  4ETS A;  4B3X A;  3GTK J;  2EJR A;  3BJO A;  3LSK A;  3L9F A;  5IOY A;  5EZH A;  1JKP C;  5GPA A;  1MBE A;  5FKO A;  3OYJ A;  2DK8 A;  4M3G A;  2EQR A;  3IRR A;  4FET A;  2UXI A;  4JNN A;  4H0E A;  5E3O A;  4P96 A;  2W4S A;  3K4M A;  4CYD A;  4F7Z A;  2W00 A;  2GEN A;  4A5M A;  2R7W A;  1FP1 D;  2LP0 A;  1MBJ A;  1N77 A;  3RKX A;  3DXJ F;  2K4J A;  2DMT A;  4A3F J;  4EM1 A;  2OC6 A;  1LDD A;  4A6D A;  1YS7 A;  3K4L A;  3EUA A;  2ZNY A;  1VZ0 A;  1MJB A;  3Q3S A;  1BI1 A;  1BIA A;  3A0B C;  4HEA 2;  3S1M J;  3V8J A;  1H88 C;  3Q5F A;  2HS5 A;  3DCF A;  4FTH A;  3S15 J;  2DI3 A;  1GUU A;  1MJ9 A;  3QP5 A;  3SFI A;  3WHB A;  1OCZ H;  1YW7 A;  4CCK A;  5HLH A;  4Q4Z F;  1YO5 C;  1UG2 A;  3PUF A;  3AQS A;  2LF7 A;  2QZ8 A;  2VC0 A;  2ZJR F;  3V6G A;  4D0P A;  1IXR C;  3L2W A;  4DBQ A;  3DWL E;  5ILV A;  2YU9 J;  3X2Q H;  2GOX B;  3OL4 A;  3L2U A;  1J2X A;  1OR7 C;  2XAF A;  3FX3 A;  4HYE A;  4L5J A;  3GX4 X;  1J59 A;  1T56 A;  1OYY A;  3NNR A;  2CUF A;  1P7J A;  2VI6 A;  4DNC A;  5M3M J;  5DS9 A;  2HKO A;  4Y3O A;  3WOD F;  5D5U B;  3SZP A;  4JP0 A;  2HXI A;  3OY9 A;  4XQF A;  2NVX J;  2M87 A;  1T2K A;  2E5Z A;  3BZ6 A;  3I59 B;  3LJL A;  2IS1 A;  3HIM A;  4LB6 B;  2PN6 A;  1JUM A;  3I4N J;  3DV8 A;  2A3S A;  4X0G A;  3I9V 2;  3QWL A;  5F27 A;  3VOX A;  2VBY A;  4C2U A;  1ZH5 A;  1BW5 A;  4W97 A;  2P0W A;  3H35 A;  4MHG A;  4HNU A;  2X6X A;  4ZTJ A;  1K6O A;  2Z33 A;  3DPL C;  4JX5 A;  3VWB A;  2HZT A;  4BXF A;  3I56 I;  2DG7 A;  2ZME C;  2M0M A;  1AA7 A;  2B63 J;  4HX7 A;  2W53 A;  4ITV A;  2OF7 A;  2N8G A;  4CCJ A;  4L9J A;  4C2M J;  2G7S A;  1HQC A;  3D5R C;  5D19 A;  3K2Z A;  1YW9 A;  2O9L A;  2I8D A;  4QPO A;  4IVN A;  2VJ5 A;  3I4M J;  2FOK A;  3HOT A;  1F43 A;  3WTZ A;  4LJZ F;  1LFU P;  2O8K A;  3N97 A;  1IAW A;  3GUD A;  2M8G X;  2VJ4 A;  2CW7 A;  3HSR A;  4BE1 A;  4KA4 A;  1FIA A;  2RKH A;  4Y33 A;  3GFJ A;  2IBD A;  2XGD A;  5FO5 A;  5F1J A;  4BQN A;  2E7W A;  3ZQG A;  2JJ7 A;  2PBI A;  5HS9 A;  3DTE A;  4BJT A;  1YX5 A;  3K8P C;  1OCP A;  1VI0 A;  4NB5 A;  2L2O A;  4BHB A;  4FCY A;  4MEX F;  1GVJ A;  1W1W E;  1TT5 B;  5LHG A;  3BR1 A;  3SJM A;  4ZC3 A;  3LAP A;  3ISP A;  2IGM A;  1EH8 A;  2XPW A;  3K4N A;  3CMM A;  4GCV A;  4D5F A;  4KNY A;  4LB5 A;  1FOK A;  4ZYG A;  3WU0 A;  1SVO A;  4I0A A;  2KIU A;  5LFA A;  4JK1 X;  1VND A;  1I5Z A;  3HRS A;  5EEG A;  3SZG A;  5HVQ C;  1G3Y A;  3PJR A;  3FWE A;  3N05 A;  1FY7 A;  3ZMS A;  5CPR B;  4KWA A;  4B1R A;  1RZ4 A;  1J5Y A;  4E4H A;  3E7Q A;  2XF5 A;  1LB2 A;  2MLK A;  2XV4 S;  4ZYD A;  5GAG J;  4KN7 X;  3MAJ A;  3HZJ A;  4RGS A;  4CGZ A;  1KGS A;  2DTZ A;  4IEJ A;  2XGX A;  5L3E A;  3WTS C;  1LFP A;  3V7R A;  2XAH A;  1Z1D A;  2K85 A;  3FRQ A;  4E7S A;  5H6Q A;  5EG0 B;  1QPM A;  3OYD A;  3OR2 C;  3DTK A;  1W0U A;  2KP6 A;  2Z16 A;  3E0J B;  4PFP A;  2GA2 A;  4E7L A;  3PO3 J;  1XSD A;  3IH4 A;  5IT3 A;  4LG0 B;  2P7C B;  4MEY F;  1PDN C;  3HGY A;  4R8H A;  1ZGJ A;  3C18 A;  3G56 A;  4NN1 A;  2VKE A;  4U0V A;  3OYB A;  1YJN I;  4NUB A;  4HX4 A;  3G6E I;  2BY2 A;  2HTS A;  4ENN A;  4U88 A;  4XKV A;  2HVR A;  4KYW A;  1A6Q A;  1G3W A;  1HDD C;  1ACI A;  2X85 A;  1I27 A;  3ASN H;  2ME6 A;  3ZCO A;  4BEH A;  4UUS A;  2Q0O A;  3LFU A;  2WV0 A;  1F5T A;  1A31 A;  1YE9 A;  4UUV A;  2DTR A;  3KP6 A;  1RR7 A;  4FE4 A;  1AOY A;  3OL3 A;  2FD5 A;  1MSE C;  1X3U A;  2YX4 A;  2MGQ A;  4EJT A;  1R4M B;  3TBI A;  4LK1 F;  5D4S A;  3ZGK A;  2ZJQ F;  2IEK A;  5L3D A;  2E60 A;  4QPQ A;  1J75 A;  2G3B A;  1VQP I;  3GFL A;  1FSE A;  1K78 B;  5DUK A;  2ZC2 A;  4HNT A;  1V5F A;  4RLQ A;  2XSD C;  5E79 C;  2M7B A;  3FF5 A;  4CSW A;  5FGL A;  4IJA A;  1SFU A;  4E7Z A;  2E2J J;  4RLF A;  2R5Z A;  3OMY A;  1IGN A;  2XDN A;  2JA7 J;  5FRM A;  2PQ8 A;  1AHD P;  2OZU A;  2DT5 A;  3LWJ A;  1D1A A;  5F0C A;  4HRI A;  1TW3 A;  1WCM J;  5FFZ A;  2VQL A;  2HKU A;  2X4H A;  3A01 A;  2OTL I;  4UUS B;  3I64 A;  3JCU C;  4BJ5 C;  1IG7 A;  5HDG A;  1WJ5 A;  3ZRG A;  1NK3 P;  4B47 A;  2GXG A;  2XKO A;  1X1P A;  4N9I A;  4R79 A;  2ZJP F;  3J7A Y;  1X1D A;  2NVY J;  4P1W A;  4QWQ A;  3OYE A;  5J1Y A;  1ZRE A;  1XB4 A;  2Y9Y A;  3JRF A;  5GPC A;  1HF0 A;  2VJJ A;  4XSX F;  4KMU X;  1AU7 A;  3L2C A;  5HNF A;  3AAF A;  1STZ A;  1OPC A;  2QKM B;  3DBR B;  3P9K A;  2HTJ A;  5K5R A;  3ON2 A;  1U8B A;  2NNN A;  5JHU A;  4IPA A;  1LE8 A;  1G3T A;  2X6Y A;  3GTQ J;  3LSG A;  2CGP A;  1T98 A;  3IKV A;  1TWG J;  5C4X J;  4PGG A;  4D9J A;  4RS8 A;  9ANT A;  1ETW A;  2IW5 A;  2O03 A;  2D1H A;  2R5Z B;  1KQ8 A;  2A6H F;  2MD5 A;  1V5G A;  4CH7 A;  2BYV E;  2M9H A;  3WE2 A;  2HQR A;  2I5U A;  4BKX A;  5ICG A;  4E70 A;  3IH3 A;  3WTT C;  3RPU D;  5HBU A;  1BR4 A;  1R36 A;  5ED4 A;  3NWT A;  3BG6 A;  5FB2 A;  4OIR F;  1U5T A;  3C2G A;  1ON1 A;  2DQL A;  3OYF A;  4MTE A;  4YFX F;  1G59 A;  1MND A;  2MA3 A;  1UMQ A;  4HX8 A;  2O5R A;  4OU0 A;  5D18 A;  3CMA I;  2KHM A;  4LG3 A;  2V7F A;  3HTH A;  5J8F A;  4AIJ A;  1IRG A;  1JT6 A;  1D5Y A;  3EUP A;  3S2H J;  4GRI A;  1FZP B;  1V4R A;  2YU3 A;  3TDZ C;  1W7P A;  1XD7 A;  4AVP A;  4UV8 A;  2WAQ A;  1FBQ A;  5C4Y A;  1Z77 A;  1R49 A;  5IP9 J;  3W3C A;  4XOP A;  5EEH A;  3JRG A;  1DU0 A;  2K7L A;  3U1D A;  3LQQ A;  1R00 A;  1VF9 A;  3KZY A;  2DA4 A;  2CMP A;  4XN0 A;  3HOX J;  4I0B A;  3ZQF A;  2HOE A;  4HNV A;  1B1B A;  1MMA A;  4IHV A;  4OMZ A;  4ZYE A;  4FHT A;  3EGQ A;  3VW2 A;  3ZMU A;  1BN5 A;  3OIP A;  1SC7 A;  2OJE D;  1VQL I;  4A3E J;  1BA5 A;  5TRD A;  3CRJ A;  4ENM A;  1Z3X A;  1MH3 A;  2Y0S A;  2OER A;  2WAE A;  2ZKZ A;  2DMU A;  4RB1 A;  2ZNZ A;  3DQV C;  3OSF A;  4DYC A;  3M07 A;  3KP2 A;  3VFZ A;  3CC2 I;  1JKQ C;  4IL6 C;  3CJR B;  3WG7 H;  2W25 A;  5B1B H;  1IO2 A;  1W7P B;  2LY2 A;  3F8N A;  5K5Q A;  4U9N A;  2VQC A;  4OAZ A;  4ZJZ A;  2PLY A;  5K58 A;  3BC8 A;  3BTI A;  1MDM B;  4XKC A;  1Z6T A;  5DCM B;  4YRV A;  5CVU A;  4CGR A;  5D5W B;  1M1E B;  4AC6 A;  3HUG A;  1BOB A;  2EIN H;  2ZBK A;  4UV9 A;  2BBY A;  1SAU A;  3F72 A;  2HXO A;  3DBH B;  4DYQ A;  2O61 A;  3I58 A;  1S6L A;  3CC7 I;  1EF4 A;  2NS7 A;  2ICW G;  2HVS A;  5J6X A;  4WX9 A;  3E5Q A;  3RQI A;  3JRA A;  5DM7 F;  4BBR J;  2ZY9 A;  5LRS A;  2V1D A;  3CJN A;  2W1O A;  4RB0 A;  3GEU A;  3PIP F;  3FXM A;  1PVE A;  3SQN A;  2L7M P;  2FBK A;  2DT6 A;  2X48 A;  4HF2 A;  1D1C A;  2B1E A;  2VLA A;  2CFO A;  3IHU A;  3LSH A;  3PSI A;  5HLG A;  2QOP A;  5HAW A;  3U21 A;  4KUM A;  5HNH A;  5EEA A;  3CCR I;  3H9G A;  2BGC A;  3N4M A;  2FEZ A;  5FD6 A;  3OYI A;  3ZMV A;  4CHU A;  3VTI A;  3BG9 A;  2PX9 A;  1RRJ A;  3ZXS A;  1Z3Y A;  2HVQ A;  1WJB A;  2ZXW H;  1MBG A;  4BY7 J;  3PAS A;  3DPT A;  5LEJ A;  5H9T A;  3FHN A;  3HUG B;  2E71 A;  1W5T A;  2VAS A;  4G12 A;  2QEX I;  3V7C A;  2A07 F;  1ZGA A;  4BAC A;  2EZH A;  1IRZ A;  4NC6 A;  1W0T A;  3MNL A;  4RB2 C;  1UZC A;  2HZD A;  3G2B A;  1U5T C;  3SFZ A;  4CZZ A;  3SHF A;  2XRL A;  4E7H A;  4KJZ A;  4A5N A;  1LDK B;  3QYE A;  2MC4 A;  1Y1W J;  1ERD A;  2DMP A;  2BEO A;  2GAU A;  2XGC A;  1Y56 A;  1LKX A;  3E5X A;  2XDV A;  3BR0 A;  4A2U A;  2V1N A;  2MD0 A;  4DZP A;  2RAE A;  3DFG A;  2DPU A;  1MJA A;  4O3M A;  1MNE A;  3H3U A;  5TIS C;  4ESJ A;  5HSZ A;  2JZY A;  2DN0 A;  4Q48 A;  5CW8 A;  3KP7 A;  3S3O A;  1IN7 A;  3RDI A;  3GZI A;  5E1X A;  1Y0N A;  3RCO A;  3AL0 B;  2EZI A;  3HOZ J;  1LEB A;  4IHT A;  1R7J A;  1MKM A;  2KFD A;  4IRG A;  2DA7 A;  4A12 A;  4IQ4 A;  2BHZ A;  3PL8 A;  2NVT J;  3DEU A;  5DAJ A;  1XMX A;  4AC0 A;  1SD4 A;  5E8I A;  2L9N A;  4M6Y A;  4A3D J;  1ZGW A;  2JA8 J;  3DPJ A;  2STW A;  3I4P A;  5J40 A;  2F07 A;  2FNA A;  3P9I A;  4DZJ A;  5KAI C;  3M8J A;  2MG4 A;  1QU3 A;  1MZB A;  4PGH A;  3E1S A;  3ZQ7 A;  3JRI A;  4EGY A;  5CVI A;  2VQH A;  1FMW A;  1KU2 A;  4IRV A;  4C9Y A;  3S1N J;  2K40 A;  3ZMD A;  1OJL A;  4BUP A;  4DBR A;  3HKZ N;  4KIG A;  1K6Y A;  2RQP A;  2VIX A;  4HOB A;  3NS4 A;  2L0K A;  1QVU A;  4O6J A;  4ZH4 F;  1W4M A;  3FXR A;  3BTJ A;  4E7K A;  1TQP A;  1E3O C;  1QRY A;  2H6C A;  2REK A;  2WAF A;  5DUI A;  3S17 J;  1A5J A;  5F1R A;  3HIF A;  2KDO A;  4M9S A;  3ZQL A;  3LAJ A;  4F93 B;  1JKR C;  1O3R A;  3AG2 H;  1ZYR F;  2M30 A;  2ZOZ A;  1X2M A;  2ELH A;  3IUV A;  2RVC A;  3F6O A;  5DM6 F;  1XTA A;  5FJ8 J;  2OI8 A;  2F2E A;  2ETH A;  4BE2 A;  3HRT A;  2LF8 A;  2Z1D A;  2HWV A;  3O8G A;  4HDV A;  3QPS A;  3B81 A;  3HTA A;  3GZN B;  1VFC A;  1EKE A;  2QEN A;  5A2Q Z;  2JPC A;  1RUO A;  4EM0 B;  2V79 A;  3CLO A;  2DDA A;  3MEX A;  1O7L A;  2DK5 A;  2V26 A;  3ULQ B;  2R4G A;  3S3N A;  1U2W A;  4C2M A;  5AON A;  3KET A;  3OYL A;  3QOP A;  2GM4 A;  4RAZ A;  2UWM A;  4ZZL A;  2XSJ C;  3BRO A;  2Z9O A;  5CKT A;  1N75 A;  3CCQ I;  4OD4 A;  2A6E F;  3A0H C;  3ABL H;  1S9H A;  4G8X A;  3AL0 C;  4MXM A;  3JSO A;  2Q24 A;  3RTR A;  2EFO A;  3G73 A;  3DEW A;  1SAX A;  2NRA C;  4PSW A;  3KYC B;  3CJD A;  5J3L A;  2ZME A;  2W24 A;  4HA8 A;  3HSE A;  4D5C A;  3EQL F;  1SVM A;  1XGS A;  4S0H B;  2QF7 A;  4LLL A;  5F08 A;  2KIQ A;  2OUM A;  1J0R A;  3WTV C;  2B7E A;  3OYC A;  2E1O A;  3S2D J;  1POG A;  2ZFW A;  1DP3 A;  4WIB A;  4Z2Y A;  5ICC A;  2V9P A;  3NRV A;  2IT0 A;  4A3L J;  4EAT A;  2E5N A;  2VE9 A;  1KYZ A;  1EJ9 A;  2IGN A;  3GME A;  5BS6 A;  3GTP J;  2LKP A;  5LGU A;  2QKO A;  1T0F A;  5CVV A;  3I5U A;  4PDK A;  5BPI A;  1RUN A;  3QPH A;  3RPQ A;  3WHC A;  4C3J J;  2EA4 A;  1U6G A;  3HTI A;  2UZK A;  4B8X A;  5CQG A;  1I6X A;  1WJA A;  1FIP A;  1ZTR A;  5FRN A;  2LD5 A;  3RD3 A;  4U9L A;  1WRJ A;  1Z05 A;  2DXI A;  4L9T A;  3GTG J;  2CW8 A;  1I3A A;  4HV5 A;  4A3B J;  1LDJ A;  1OYI A;  2OQG A;  1K4S A;  4XLP F;  4IOC F;  3LL7 A;  1WHU A;  2EIK H;  1U0J A;  4L0Z B;  2DW4 A;  3JTH A;  2VT3 A;  1HW1 A;  2QSF X;  3BNI A;  4RB3 C;  3HSF A;  4HKU A;  5A2Q K;  2Y75 A;  3CF2 A;  2CO5 A;  1XSV A;  2NVU B;  2GXA A;  3BRU A;  4UVB A;  4E6K G;  1GHC A;  4M3E A;  3C3W A;  4A0X A;  3CUQ A;  3C1D A;  4EEF G;  5CJ9 A;  4Z6Y A;  1LUJ B;  5E8G A;  4XRF A;  3CO6 C;  2L9R A;  3FHZ A;  1IC8 A;  1VQ8 I;  2PBX A;  2CUJ A;  2XIG A;  4G6Q A;  3BY6 A;  4GDF A;  1RET A;  4XLF A;  1NK2 P;  2XPV A;  1X3W B;  5CVJ A;  3GYH X;  3TO9 A;  1BW6 A;  4F55 A;  1VQ9 I;  4N9H A;  3I59 A;  3BLY A;  3ECO A;  1LEA A;  2QQ8 A;  1TNT A;  4NEL A;  5TJJ A;  1G3S A;  1V3F A;  5E3M A;  4XM3 A;  1IUF A;  2VOO A;  1T39 A;  3GXO A;  5GP9 A;  4U7B A;  4EMS A;  1HDP A;  3RPU A;  4AM3 A;  2V6E A;  2MAB A;  2QTQ A;  3MD2 A;  3NEU A;  4G6T B;  1P7I A;  3R6S A;  3E6C C;  1I1S A;  3S5R A;  1SFK A;  1S7O A;  2E2H J;  1G4D A;  5LHH A;  5HDN A;  1TLH B;  2EA2 A;  2R3S A;  3E5U A;  1WJD A;  2FML A;  3DEE A;  2BVM A;  3W6K B;  2X51 A;  4GCT A;  3K69 A;  4NHJ A;  3OR1 C;  3FIS A;  3OOU A;  2Z2S B;  3CUQ B;  2AXL A;  1MD0 A;  1F9N A;  2XKP A;  4HF0 A;  5K7F A;  3HC7 A;  4AIH A;  4XOT A;  3G71 I;  1O4X A;  3HPG A;  1E0E A;  3D5L A;  1S29 A;  3G1O A;  3ECH A;  3FXQ A;  1ETY A;  3VOD A;  2ZSH B;  2BZT A;  3ZQQ A;  1FOY A;  3KKD A;  2ESN A;  3ZN1 A;  1ODD A;  1HW5 A;  2KZV A;  2P6S A;  2PMH A;  4YEL A;  5E20 A;  3WG9 A;  4ICH A;  5DDG A;  4I7H A;  2G7H A;  1RR8 C;  1I6H J;  5ICE A;  1I1G A;  2M5W A;  2RRE A;  2COM A;  4M71 A;  2JN6 A;  3M1C A;  2B9S A;  2Z99 A;  1IV6 A;  2VXZ A;  4G6D A;  3ERE D;  2NNY A;  5LLQ A;  1W36 D;  3D5S C;  2EK5 A;  2WBM A;  2CFX A;  1JJ6 C;  2VON A;  2LH9 A;  3DU6 A;  1ZG1 A;  1E3H A;  3ERM A;  1D8K A;  1JUP A;  2LVS A;  2WAD A;  4BH9 A;  4UB8 C;  1XS9 A;  1SD5 A;  2WA0 A;  5BQT A;  4O5V A;  1DQU A;  2VKV A;  3ZMZ A;  1KON A;  3BQZ A;  4WWC A;  2JA5 J;  5EJC A;  4PCQ A;  5KK1 A;  3KEQ A;  4MGR A;  1SD7 A;  3J7A O;  5BNG A;  2NX4 A;  3K4B A;  3DKX A;  4QSH A;  4MFE A;  3BP8 A;  2EV0 A;  5J47 A;  3KLO A;  3JRE A;  2F6C A;  3O6B B;  2K4B A;  3LSJ A;  3GTL J;  2XAG A;  4M74 A;  4OIN F;  5JHF A;  1T0F C;  3WTW C;  2K86 A;  4GCK A;  1TNS A;  5EG0 A;  2G7U A;  5FKN A;  3BCB A;  3KZ9 A;  2WB1 N;  1JT0 A;  4JOM A;  3A4C A;  4LG0 A;  1MH4 A;  3MMY B;  4MQ9 F;  3DU5 A;  1LPQ A;  5C3E J;  3P9T A;  4NNJ A;  3CZ6 A;  1T38 A;  1PUE E;  3ZPL A;  3J80 K;  5L3G A;  4AF5 A;  3AG3 H;  1ON2 A;  2FJ1 A;  2Y48 A;  3CCM I;  2L7K A;  1FTZ A;  5KVR A;  1J7K A;  2ISZ A;  1PUF A;  5E1Z B;  3OYG A;  2EBI A;  2LOO A;  4XLE A;  4HW0 A;  3KCC A;  1TP4 A;  4F92 B;  4I76 A;  2H1L A;  3ELK A;  1UHS A;  3C2B A;  2O8X A;  2E1C A;  2XC7 A;  3QYF A;  5GTH C;  3Q9V A;  1HOM A;  1XPX A;  2XGE A;  2A2F X;  1QNT A;  5E18 F;  3GFM A;  1P9Q C;  3CUQ C;  2YS9 A;  3I53 A;  3H3Z A;  3K4J A;  4WXC A;  2K3P A;  4J19 A;  5K7Z A;  2QUF A;  1UCR A;  2H6B A;  4G7H F;  3RH2 A;  2EWN A;  3SZT A;  3KE2 A;  2M3A A;  2ZJ2 A;  4NDL A;  3NRG A;  1P6R A;  1UFM A;  1K78 A;  4M72 A;  1MIJ A;  5JLW A;  1Z7L A;  5CYV A;  3HYI A;  4CA0 A;  4HLX A;  5JLX A;  2QBY A;  5AQC A;  1IDZ A;  2DOA A;  1BI2 A;  2CQ7 A;  2XB5 A;  3DKY A;  2JQ7 A;  1YIT I;  2VB6 A;  2XAQ A;  3E3V A;  2YPR A;  4M3D A;  3GW2 A;  5B5E C;  4HPQ A;  5LHI A;  2QQA A;  3L2R A;  3S1R J;  1PUF B;  1E2X A;  3BTC A;  2MYS A;  1DGW Y;  4YIF A;  2R7R A;  1FYM A;  1YIO A;  2EFQ A;  1D0X A;  4LMY A;  4EVI A;  1LVA A;  3Q0U A;  3OYN A;  2IS2 A;  3HPH A;  3GFI A;  4LIT A;  2V9V A;  2L9S A;  3KFW X;  2M7A A;  4A0Y A;  5IY5 H;  2OQR A;  4MQV A;  3AFH A;  1SAN A;  1O3S A;  2HDW A;  3BDD A;  3LSP A;  2JSC A;  1H9T A;  1GDT A;  1HW2 A;  1Z9C A;  3BQY A;  2CSO A;  2V57 A;  3HM5 A;  5IP6 A;  3GO5 A;  4RM3 A;  5LEK A;  2DA1 A;  4JL3 A;  1AWC A;  2GWR A;  1JTX A;  1APL C;  2TRT A;  1IXC A;  1UEL B;  3HBL A;  4M73 A;  4XLC A;  2OPT A;  1X2N A;  4MNU A;  2K9N A;  3B73 A;  3NAR A;  4CO8 A;  2R5Y B;  3M8F A;  2HDC A;  2QBY B;  3O2P E;  1B6A A;  2OAZ A;  2HU9 A;  5F6F A;  1F4K A;  4S04 A;  3VVY A;  4XL9 A;  3PSF A;  3CDI A;  4PJJ A;  4JKZ A;  1ETK A;  2PMZ N;  4YII A;  1IN6 A;  1ZN2 A;  2DAO A;  2LG4 A;  1L0O C;  1QGP A;  4ACI A;  2QIB A;  4Y17 A;  3IH2 A;  4AUX A;  4BY1 J;  3EYY A;  4TV7 A;  5J8C A;  3UR3 C;  4YIR X;  1NTC A;  3FMS A;  3H9J A;  3ZR8 X;  3W2A A;  3S32 A;  2DFF A;  1ULY A;  5M3F J;  4IKF A;  5FLX Z;  1XG1 A;  2MH9 A;  1ZEL A;  5B3S H;  3H92 A;  4JYK A;  1IW7 F;  3L2V A;  2M0C A;  4PFO A;  3SWH A;  4II3 A;  4WXD A;  2K27 A;  1QZY A;  5KNL A;  2VN2 A;  2EZL A;  4IF4 A;  1XMK A;  4BL0 B;  4HQE A;  2GXB A;  3HHH A;  3CF5 F;  5HS7 A;  2H27 A;  4OMY A;  4HAM A;  4LIV A;  1FSH A;  1DGR M;  2FNP A;  3HTU A;  3W2W A;  3S2W A;  1T33 A;  3KP5 A;  4ON0 A;  1Y8R B;  1ZLK A;  5D1R A;  3K9T A;  2VE8 A;  4NC8 A;  4BXU A;  4OWR B;  3HKZ A;  2IRF G;  4J00 A;  4EJO A;  4IHS A;  3T8T A;  2V1U A;  3FM3 A;  3RI4 A;  4XOR A;  3RZO J;  3H9Q A;  1BBY A;  4UDS A;  1VQ6 I;  3CLQ A;  3PM1 A;  3MKW B;  1ETX A;  3FDY A;  2RDP A;  4I98 B;  1ONV A;  4F3Q A;  3HOU J;  2ECB A;  1B4A A;  1FPQ A;  3BCG A;  4RA2 A;  4XNF A;  1DPR A;  3ABK H;  2IU5 A;  2FX0 A;  4ZDP A;  3BJA A;  3M1E A;  3TW6 A;  3KP3 A;  2WGB A;  1U9O A;  2P8T A;  2RQQ A;  1KU9 A;  4KT6 A;  4QTR A;  3Q9S A;  3QBM A;  1SFE A;  4II2 A;  4PJ0 C;  1MDM A;  5DCM A;  2BXY A;  3VYR B;  2PFV A;  3GCM A;  2VJI A;  1NH3 A;  2F5D A;  3DBL B;  4YFK F;  4JX6 A;  5JFR A;  4EJU A;  1I50 J;  2FUG 2;  3BCA A;  2F5C A;  1H0M A;  3PFY A;  4Y4R A;  2F5V A;  1Y6I A;  2NS8 A;  1S3J A;  2DDB A;  3F9K A;  5LGT A;  2ID3 A;  1G2H A;  1FX7 A;  3RJP A;  2M1B A;  3GLL A;  2R7X A;  3NPI A;  3T6N A;  2CS3 A;  3M7G A;  2E36 A;  3GZ5 A;  5FLX K;  3K1M A;  1GVD A;  1JTY A;  2OV7 A;  3GEZ A;  3K0L A;  4ME9 A;  2STT A;  2OD5 A;  3WTU C;  3DLL F;  2M45 A;  4KIT B;  4A3J J;  4A3C J;  3VYS B;  4MK6 A;  2VXD A;  4XLA A;  4KFC A;  3RSN A;  4C3I J;  1FTT A;  4G94 A;  3MZH A;  1WI9 A;  1RPW A;  1LFB A;  3BPV A;  3M4O J;  3IAM 2;  2P81 A;  3V7S A;  3VVZ A;  1VQ7 I;  1HBX G;  1X1A A;  3FK6 A;  2ME0 A;  3ANP A;  3KPH A;  2MSY A;  2FE3 A;  3R61 A;  4G9Y A;  1N25 A;  4ESF A;  3HE0 A;  1YQA A;  3V42 A;  4UHT A;  3T0Y A;  3IAS 2;  2ZCM A;  3KNW A;  2LKS A;  3RQ4 A;  3CP8 A;  4CCO A;  1S72 I;  3BR5 A;  5FLV A;  3MFK A;  2HPM A;  2K5C A;  3VW0 A;  2IA2 A;  4M3F A;  3CJQ B;  3MKL A;  3JRH A;  2P5L C;  3ML6 A;  4BDY A;  1O57 A;  3TOA A;  2UXX A;  1FOW A;  1QHH D;  4YG2 F;  1P4X A;  2VKD A;  5E3N A;  3ZQI A;  1G6N A;  3AKZ A;  3V8K A;  2HQN A;  2V1X A;  3OYH A;  2QSH X;  1IRF A;  3ANG A;  2H94 A;  3FKI J;  4XKW A;  3FXL A;  3TMO A;  2OU2 A;  3G3Z A;  4CCL A;  4CZC A;  2XAS A;  3FK7 A;  1BJZ A;  2W84 A;  2COB A;  2FF4 A;  3FKJ A;  1UI6 A;  4LLN A;  1HA8 A;  3CCS I;  3IRQ A;  2JA2 A;  2Y31 A;  3OWT A;  1XGO A;  1FWZ A;  3H5A A;  2NOG A;  4L5E A;  5IYB J;  3DLA A;  4F91 B;  1K7A A;  4CYC B;  1LQ1 A;  1SVL A;  2QA4 I;  3JSP A;  1VQK I;  2DBB A;  4FX4 A;  1HCR A;  1OCT C;  1R1V A;  1YOV B;  4KT5 C;  2JPB A;  5H6R A;  3SEZ A;  4DJA A;  3ZP5 A;  1MBH A;  2JUG A;  2DU9 A;  1RKW A;  4UVC A;  1YRN A;  3HTJ A;  4L0Y B;  2Q2E A;  3CQZ J;  3IL2 A;  3DTI A;  1W5S A;  2CW0 F;  3HG9 A;  1ZRD A;  3CUO A;  3TO6 A;  4BQQ A;  3S14 J;  1PYV A;  2DO7 A;  5F0H A;  2D2W A;  3ASO H;  2DOE A;  5GTI C;  1WFX A;  5GAE J;  2L3D A;  1T8I A;  2K02 A;  5J1R A;  2ELJ A;  1JJ8 C;  3F8B A;  1BOA A;  5FKK A;  4E7I A;  1CF7 B;  2F5F A;  2A61 A;  3R60 A;  2BE5 F;  3VSK A;  1H9G A;  2ECC A;  3VB2 A;  3O8H A;  2Q8K A;  3CCL I;  3CCE I;  1LNW A;  1KQ9 A;  2DCE A;  4L62 A;  1P4W A;  2VUM J;  3GLX A;  1KU7 A;  2DQR A;  1TTY A;  1BIB A;  1D1B A;  5TGT A;  1LJ9 A;  4ZYH A;  1WJC A;  3OYM A;  2FBQ A;  2LBF A;  5IP7 J;  5HLT A;  3VVX A;  2CQN A;  4JX4 A;  3HTS B;  3HOW J;  4DGW B;  5J4Y A;  4IRH A;  3CWR A;  1YRN B;  4B09 A;  5DCF A;  1JHH A;  4C3H J;  1KYW A;  3VUQ A;  2Q2E B;  3D0S A;  1R22 A;  2KJC A;  1ZLJ A;  1OMI A;  2ZO4 A;  5E1W A;  4RDU A;  4WK8 F;  3P5J A;  4X6A J;  2PJP A;  1DU6 A;  1FC3 A;  2W57 A;  3HHG A;  1VQO I;  3T1B A;  3G1L A;  1IN4 A;  2F4I A;  3WGI A;  3KIO A;  2FJI 1;  1UI5 A;  2UXP A;  2CJJ A;  2D5V A;  5KHD A;  5E17 F;  1HKQ A;  2LNB A;  4A6E A;  1B72 A;  3HOS A;  4RGR A;  5GAH J;  4M6X A;  4YEJ A;  4A93 J;  2AHQ A;  4U0Y A;  1O3Q A;  2KT0 A;  4P9F A;  3IC7 A;  1J09 A;  1Q1V A;  1DDN A;  1K61 A;  1R23 A;  1ZQ3 P;  4KIS A;  1OCC H;  1IXS B;  3K7A J;  1HSJ A;  6PAX A;  5J1U A;  5DD4 A;  4JQF A;  2HOA A;  2XB0 X;  4C2T A;  1TQI A;  3GTM J;  3PPB A;  2LBF B;  3DPU A;  3H5R A;  4B4C A;  3QU6 A;  4GFB A;  3HJE A;  5H2F C;  1HXD A;  2GIZ A;  3M9A A;  2H09 A;  2V6C A;  3RKY A;  2XAU A;  4GXO A;  1S7A A;  4FQG A;  3P9C A;  4HLY A;  1XGN A;  3FM5 A;  1FEX A;  3JW4 A;  2WB1 A;  1USS A;  1HC8 A;  2DOD A;  3SYT A;  4UUT A;  2RNG A;  3ZOB A;  1Z21 A;  2KKO A;  5FHP A;  3R0J A;  1UB9 A;  2AS5 F; 
#chains in the Genus database with same CATH homology
 1WH7 A;  2Y2Z A;  4XIC A;  3JSJ A;  3KKD A;  2D6Y A;  3HDD A;  1B72 B;  2XSD C;  1ZR4 A;  5FGL A;  3JRD A;  1QPI A;  4IHY A;  3S1Q J;  1I6H J;  4ICH A;  2E2J J;  1MBK A;  2R5Z A;  2M34 A;  4Y7N J;  4IHX A;  2JN6 A;  5F04 A;  1IGN A;  2XDN A;  2JA7 J;  1IV6 A;  1JGG A;  5M5W J;  2FQ4 A;  1AHD P;  3LWJ A;  5F0C A;  3LSR A;  1WCM J;  1JJ6 C;  2HKU A;  3A01 A;  2HOT A;  4UUS B;  1IG7 A;  1JUP A;  2LVS A;  3TP0 A;  3TP3 A;  4RBO A;  3ON4 A;  1F36 A;  1NK3 P;  1XS9 A;  3UKG A;  1IJW C;  2VKV A;  3MVP A;  3BQZ A;  1CQT A;  2JA5 J;  2NVY J;  1Y1V J;  3BR2 A;  5J1Y A;  2R92 J;  2Y9Y A;  3O60 A;  3JRF A;  2MW8 A;  5GPC A;  1HF0 A;  4XRS A;  1AU7 A;  5BNG A;  5K7H A;  3ZQC A;  2NX4 A;  1TWH J;  3GBG A;  4QSH A;  2Y0S N;  4MFE A;  3JRE A;  2H1K A;  1GV5 A;  3NI7 A;  3Q0W A;  2LR8 A;  3LSJ A;  3OIO A;  1SGM A;  3GTL J;  3ON2 A;  1U8B A;  1LE8 A;  3HOY J;  3TW7 A;  3LSG A;  3GTQ J;  4GCK A;  5EG0 A;  5CXI A;  5FKN A;  3KZ9 A;  1TWG J;  5C4X J;  2DJN A;  2WB1 N;  1JT0 A;  1ZKG A;  4M3B A;  9ANT A;  1ETW A;  1MH4 A;  2R5Z B;  3P9T A;  5C3E J;  4A3I J;  3HB9 A;  4BKX A;  2M9H A;  4M6V A;  1ETQ A;  3IH3 A;  4AF5 A;  5HBU A;  2FJ1 A;  4I6Z A;  1FTZ A;  1R9T J;  4PXI A;  2CQQ A;  2CU7 A;  1PUF A;  2EBI A;  2K9S A;  1UMQ A;  2WUI A;  4I76 A;  2LY9 A;  5D18 A;  1UHS A;  3C2B A;  2UXU A;  3HTH A;  1HOM A;  2QWT A;  1HLV A;  2ELK A;  1JT6 A;  1D5Y A;  2XGE A;  3EUP A;  4FIS A;  3BHQ A;  3S2H J;  3B6A A;  4B3A A;  3FIW A;  2YS9 A;  3G1M A;  4X1E A;  4LOC A;  3LNQ A;  2O7T A;  4J19 A;  2JWT A;  5K7Z A;  5C4Y A;  1Z77 A;  3BT9 A;  3VP5 A;  3RH2 A;  5DTD A;  2DMQ A;  5IP9 J;  4NDL A;  3JRG A;  1DU0 A;  3NRG A;  3SDG A;  5JLW A;  2RAS A;  1VF9 A;  4XRS G;  2DA4 A;  5IPA A;  3HOX J;  4HNV A;  3ZQF A;  5JLX A;  5AQC A;  1IDZ A;  4IHV A;  2XB5 A;  3HEF A;  3EGQ A;  3VW2 A;  1OFC X;  4M3D A;  3D1N I;  4BXX J;  4XID A;  4A3E J;  3S1R J;  1PUF B;  1BA5 A;  3BTC A;  2JK3 A;  2HQ5 A;  1H89 C;  3CRJ A;  3F1B A;  2E19 A;  1MH3 A;  2OER A;  1RES A;  1I3Q J;  2DA6 A;  3B6C A;  3L1P A;  2DMU A;  3Q0U A;  4MO7 A;  2H8R A;  3OSF A;  4DYC A;  1MBF A;  1JKQ C;  3VPR A;  2LKX A;  1ZR2 A;  3H3V K;  1SAN A;  3CCY A;  3LSP A;  1GDT A;  2V57 A;  3BQY A;  1ETO A;  3M3Y J;  2G0E A;  3LHQ A;  5K58 A;  2L7Z A;  2LLK A;  5EF6 A;  3BTI A;  3HM5 A;  3MN2 A;  5IP6 A;  3JRB A;  2W48 A;  2DA2 A;  2DA1 A;  4CGR A;  4JL3 A;  2HYJ A;  2HYT A;  1U78 A;  4AC6 A;  2XPU A;  1APL C;  1JTX A;  2ZB9 A;  2TRT A;  3HBL A;  5FLM J;  2OPT A;  1X2N A;  5EGO B;  2K9N A;  2HXO A;  3NAR A;  4DYQ A;  2R5Y B;  4DW6 A;  4XRM A;  2G7L A;  3S16 J;  1EF4 A;  2NS7 A;  2WAQ N;  3JRC A;  3VVY A;  3NAU A;  2K9Q A;  3RQI A;  1ETK A;  3QKX A;  4JKZ A;  2PMZ N;  3JRA A;  2JA6 J;  2CQX A;  1H8A C;  4BBR J;  3VIB A;  5IYD J;  3GEU A;  4ACI A;  2QIB A;  2L7M P;  3IH2 A;  4D7N A;  4AUX A;  4BY1 J;  2X48 A;  2ZCX A;  1XC5 A;  5M5Y J;  1NTC A;  2QOP A;  1WPK A;  5HAW A;  5M3F J;  1XG1 A;  4JYK A;  5EEA A;  2M0C A;  3QQA A;  2UXO A;  4AYB N;  2EZL A;  1GV2 A;  3BG9 A;  3BG3 A;  1B8I A;  4A3G J;  4BY7 J;  1MBG A;  2KDZ A;  3W6V A;  3PAS A;  5H9T A;  3F0C A;  2QCO A;  1T33 A;  5EYR A;  3TED A;  4G12 A;  2G7G A;  5D1R A;  3K2A A;  2YVE A;  1JUS A;  2EZH A;  3ZQH A;  1IRZ A;  3C07 A;  2ZCN A;  3JR9 A;  1W0T A;  3MNL A;  1JKO C;  1ETY A;  5C44 J;  2XRL A;  2CRG A;  1U9N A;  3QPL A;  3NXC A;  3RZO J;  4UDS A;  5EFY A;  3PM1 A;  2GBY A;  4A3M J;  3PO2 J;  1Y1W J;  1ETX A;  2GUH A;  2DMP A;  5HOD A;  3GTJ J;  1ENH A;  2XGC A;  3VW1 A;  3HOU J;  1ZK8 A;  2ECB A;  2X6O A;  3BR0 A;  3BCG A;  3A02 A;  2GFN A;  4DZP A;  2RAE A;  2IU5 A;  2FX0 A;  2AO9 A;  3TW6 A;  2DA5 A;  1TC3 C;  2HI3 A;  5HSZ A;  2DN0 A;  5CW8 A;  3CDL A;  2WGB A;  1U9O A;  1B8I B;  2VPR A;  3GZI A;  1X58 A;  4QTR A;  3QBM A;  4V2G A;  4Y52 J;  2Y30 A;  2EZI A;  3HOZ J;  1WH5 A;  1RKT A;  3RKQ A;  3V78 A;  2YVH A;  2UXH A;  3IV5 A;  2DA7 A;  3G7R A;  1WGX A;  2E2I J;  2NP3 A;  4BBS J;  4JX6 A;  2NVT J;  2EZK A;  5EGO A;  5DAJ A;  4V2F A;  4AC0 A;  1I50 J;  3BJB A;  2LFB A;  3CMY A;  2R5Y A;  1MNM C;  3BR6 A;  4A3D J;  5EZG A;  1ZGW A;  3GTK J;  2NS8 A;  2JA8 J;  3DPJ A;  5IOY A;  1JKP C;  5EZH A;  5GPA A;  1MBE A;  2R7Z J;  1K83 J;  2F07 A;  5FKO A;  2ID3 A;  1G2H A;  4M3G A;  3T6N A;  3NPI A;  2EQR A;  4DZJ A;  1TWF J;  2MG4 A;  2UXI A;  1GVD A;  1JTY A;  3JRI A;  2PZ9 A;  4JNN A;  4ME9 A;  5E3O A;  5FKL A;  5IYC J;  2GEN A;  3Q0V A;  3S1N J;  2K40 A;  1OJL A;  2LP0 A;  3HKZ N;  1MBJ A;  2L7F P;  4A3J J;  4A3C J;  2YUS A;  4MK6 A;  2DMT A;  4A3F J;  2L0K A;  4C3I J;  1QVU A;  1FTT A;  1AKH A;  5E3L A;  5M5X J;  1RPW A;  1LFB A;  3Q3S A;  3M4O J;  3BTJ A;  2P81 A;  3S1M J;  4MFD A;  3HGG A;  3VVZ A;  1H88 C;  1E3O C;  3DCF A;  4MLO A;  4FTH A;  3S15 J;  1QRY A;  1GUU A;  3FK6 A;  3LOC A;  3SFI A;  2ME0 A;  3WHB A;  2REK A;  3S17 J;  2MSY A;  1A5J A;  3ANP A;  1GT0 C;  3HE0 A;  4MIM A;  3BR3 A;  1UG2 A;  3ZQL A;  2ZCM A;  3KNW A;  3AQS A;  1JKR C;  4ABZ A;  1Z0X A;  2ZOZ A;  3V6G A;  1SFO J;  1X2M A;  2LK2 A;  3BR5 A;  2YU9 J;  5FLV A;  3AQT A;  3IUV A;  5FJ8 J;  1A6I A;  1IDY A;  2HDD A;  2OI8 A;  3VW0 A;  2RHA A;  2DG8 A;  4M3F A;  3MKL A;  1T56 A;  3O8G A;  3JRH A;  3B81 A;  3QPS A;  3HTA A;  3NNR A;  1VFC A;  2CUF A;  1P7J A;  2VI6 A;  5M3M J;  3BG5 A;  5DS9 A;  5EDN A;  2I10 A;  5E3N A;  3ZQI A;  3E7L A;  4JP0 A;  2HXI A;  1QVT A;  1S7E A;  2NVX J;  3ANG A;  3FKI J;  3RZD J;  4IHW A;  2JMW A;  1MSF C;  4XK4 A;  2GM4 A;  3LJL A;  3HIM A;  3FK7 A;  1AKH B;  1JUM A;  3I4N J;  1BJZ A;  4GFL A;  2COB A;  5FMP A;  5F27 A;  3VOX A;  1UI6 A;  1BW5 A;  4W97 A;  2Y31 A;  2CUE A;  4MXM A;  2ID6 A;  2Q24 A;  3KKC A;  2NOG A;  4L5E A;  5IYB J;  2WV1 A;  3DEW A;  4JX5 A;  4A69 C;  5CXG A;  2DG7 A;  4CYC B;  3CJD A;  5J3L A;  2B63 J;  1TWC J;  1ETV A;  2W53 A;  2OF7 A;  2N8G A;  4D5C A;  1OCT C;  1HCR A;  4C2M J;  1ITY A;  2G7S A;  2M2E A;  4S0H B;  5IOZ A;  4YZE A;  5D19 A;  2O9L A;  2QF7 A;  1MBH A;  5F08 A;  3I4M J;  1RKW A;  1YRN A;  1F43 A;  3HTJ A;  3S2D J;  1LFU P;  2E1O A;  2O8K A;  1POG A;  3CQZ J;  2M8G X;  4QIW N;  4W1U A;  4A3L J;  1FIA A;  2IBD A;  2XGD A;  5F1J A;  3GTP J;  4GFK A;  3ZQG A;  2JJ7 A;  3S14 J;  2QKO A;  4DYR A;  5F0H A;  1OCP A;  1VI0 A;  4FCY A;  2DA3 A;  3BR1 A;  5J1R A;  3WHC A;  4C3J J;  3SJM A;  1JJ8 C;  3HTI A;  5FKK A;  2NVQ J;  4D7M A;  2XPW A;  1FIP A;  2GLO A;  1ZTR A;  2ECC A;  3H0G J;  4D5F A;  2LD5 A;  3RD3 A;  3O8H A;  3A01 B;  3GTG J;  4A3B J;  4L62 A;  2VUM J;  1VND A;  2FBQ A;  4KWA A;  5IP7 J;  4B1R A;  3VVX A;  3E7Q A;  4JX4 A;  3BNI A;  4HKU A;  3HOW J;  3CWR A;  1YRN B;  2R0Q C;  3BRU A;  4C3H J;  3VUQ A;  4M3E A;  2DTZ A;  4IEJ A;  4EEF G;  4RDU A;  4X6A J;  1DU6 A;  1LE8 B;  3OSG A;  2L9R A;  1IC8 A;  3VOK A;  3FRQ A;  2PBX A;  3G1L A;  5EG0 B;  1W0U A;  1RET A;  1NK2 P;  1UI5 A;  2UXP A;  2CJJ A;  2EH3 A;  2XPV A;  2D5V A;  3PO3 J;  3IH4 A;  5C4J J;  1FJL A;  1B72 A;  1BW6 A;  5F0F A;  1TWA J;  3HGY A;  4NEL A;  4A93 J;  2AHQ A;  3G56 A;  3A03 A;  2VKE A;  2KT0 A;  4NN1 A;  1Q1V A;  2LTP A;  5E3M A;  1K61 A;  1IUF A;  1ZQ3 P;  5GP9 A;  3K7A J;  1HDP A;  5J1U A;  4A3K J;  1BL0 A;  1HDD C;  2HOA A;  2XB0 X;  2QTQ A;  2Y9Z A;  2ME6 A;  4UUS A;  1ORK A;  5FKM A;  3GTM J;  2NP5 A;  3PPB A;  4GFB A;  1P7I A;  4B4C A;  3S5R A;  4CYC A;  3HOV J;  2IAI A;  1RR7 A;  4FE7 A;  4FE4 A;  2E2H J;  1WI3 A;  2FD5 A;  1MSE C;  1FEX A;  3COL A;  2MGQ A;  2DMN A;  2R93 J;  4GCT A;  3GTO J;  2X9D A;  2IEK A;  3BTL A;  3FIS A;  3OOU A;  5K7F A;  2ZOY A;  1O4X A;  4UUT A;  2G3B A;  4GCL A;  3ZOB A;  5FHP A;  3G1O A;  2HOS A;  2O7O A;  2TCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...