4W97A

Structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
196
structure length
196
Chain Sequence
RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of a Ketosteroid Transcriptional Regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor KstR2
total genus 86
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w97A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w97A02
1POGA 1Y1VJ 5IP7J 3V6GA 1XG1A 2VKEA 1HOMA 2Y31A 3S1RJ 3GTJJ 2DA5A 2K9SA 3IUVA 3FKIJ 4QIWN 1IC8A 2EH3A 2WAQN 3O8HA 1UMQA 3RZDJ 2NP3A 3GZIA 2NOGA 3VOKA 2AO9A 3HKZN 3ZQHA 4GFKA 2ME6A 4JP0A 2QCOA 3FRQA 3ZQIA 3CCYA 4NDLA 2ID3A 5GP9A 4X1EA 3HM5A 1VFCA 1GUUA 1U78A 2HOTA 3ANPA 4DYCA 2NVYJ 3GEUA 2IAIA 3AQTA 5E3NA 1QVUA 2YU9J 1U9OA 4GCTA 4GCKA 4C3JJ 1APLC 2CUEA 4ABZA 1IDZA 4LOCA 1LFBA 3HOZJ 3G1LA 3DPJA 2M34A 1MBKA 1ZTRA 2HOSA 5CXGA 5IOZA 2ZOYA 3CJDA 3M3YJ 1BJZA 2LVSA 2QIBA 2JWTA 5C4XJ 3BG9A 3ZOBA 1JKOC 1QPIA 2Y9YA 4A3JJ 3BNIA 2HXOA 2MGQA 2L0KA 3FISA 1WPKA 4GFBA 3C07A 1GV2A 3HOXJ 2XSDC 4DZJA 3BT9A 3QPLA 2JK3A 2JJ7A 2I10A 3SFIA 4D5CA 1FIAA 4XRSA 4W1UA 2AHQA 1FJLA 5JLXA 3HOVJ 2X9DA 1SGMA 5K58A 2TRTA 4FE4A 5EEAA 2L9RA 4QSHA 5F0HA 2E19A 4M6VA 2DTZA 4IEJA 5K7ZA 1PUFA 1F43A 3G56A 3O60A 4UUSB 2RHAA 1MBFA 1UG2A 1MH3A 1RETA 1K83J 3MKLA 3LSJA 3HEFA 3EUPA 1AKHA 3BHQA 1EF4A 3A02A 4M3FA 1MNMC 2B63J 1WH7A 5FHPA 4AUXA 1GV5A 4RBOA 4A3DJ 1JUSA 3HGYA 3GTGJ 3T6NA 1RKTA 2X6OA 1HDDC 3GTQJ 2F07A 2NVQJ 3COLA 2YVEA 4QTRA 1ZQ3P 1FEXA 4KWAA 5IOYA 2XGDA 3Q0UA 2COBA 2QWTA 1MBHA 3LWJA 3GTKJ 4C2MJ 1VI0A 1BW5A 2PZ9A 2LKXA 1LE8A 5D1RA 4NELA 2KDZA 4S0HB 1FTTA 3HTHA 1H8AC 1MBEA 1K61A 2Y30A 2XGEA 4L62A 1DU0A 3B6CA 4BBSJ 4MK6A 4A3EJ 3FIWA 3GBGA 4HNVA 1Z0XA 3ON2A 2DG7A 2ZB9A 3B6AA 4MLOA 3S1MJ 1ZK8A 2L7MP 5FLVA 4XRSG 1NK3P 5EYRA 3VIBA 2UXOA 4A3CJ 2DMUA 3JRGA 1MSEC 2FBQA 1IJWC 3JRHA 3I4NJ 1I6HJ 2XB0X 2R7ZJ 4IHYA 3KKDA 2VKVA 5D18A 2RAEA 1IV6A 2FD5A 5CXIA 5DAJA 3TW7A 5K7FA 2WB1N 5FGLA 4ME9A 1JKPC 2Y0SN 4M3DA 1OCTC 2E2HJ 5C4JJ 3NI7A 4BY1J 1ENHA 1MH4A 2CRGA 3W6VA 5DTDA 1RR7A 3F0CA 1ETQA 1AKHB 1WI3A 2WV1A 2LR8A 3RQIA 1U9NA 4MO7A 3AQSA 1HDPA 5M5XJ 2DA1A 1MBGA 2DMTA 5EZHA 1RPWA 2H1KA 2PBXA 2N8GA 1A5JA 2G7LA 2REKA 2XRLA 5HODA 2ZOZA 1ETKA 1NTCA 1S7EA 2R92J 2KT0A 3ZQGA 1WH5A 3BQZA 3LSPA 2W53A 5FKNA 4UDSA 2ZCMA 3VP5A 4B4CA 2ELKA 4MFDA 5E3MA 2JMWA 1ZR2A 2DA7A 2VUMJ 2R5YA 4D7NA 9ANTA 2XDNA 3UKGA 5HAWA 3Q3SA 5EG0B 1UI5A 4BXXJ 3S2HJ 1ZGWA 3HDDA 3HGGA 4A3GJ 1WCMJ 2OPTA 3QPSA 4D7MA 4G12A 2LLKA 1JGGA 2O7OA 2P81A 1IDYA 2DMNA 3JRFA 3JRAA 3NXCA 1ETOA 3CMYA 2D5VA 2HYTA 4AC6A 3NAUA 4I6ZA 5BNGA 3LOCA 4V2GA 3A01B 2G7GA 2WGBA 2NS7A 3JR9A 4CYCB 2H8RA 3F1BA 2QTQA 4JNNA 2M9HA 4JX6A 4BBRJ 2K40A 3RZOJ 2IU5A 3NRGA 3MN2A 3JRIA 1ETYA 4DZPA 5C44J 3C2BA 2LK2A 5IP6A 5FKOA 3HOWJ 3VOXA 3OIOA 2XB5A 2JA6J 5IYCJ 2HKUA 2RASA 2QF7A 2R5ZB 5HBUA 3OSGA 1HF0A 2DN0A 4XICA 2HDDA 3S17J 2YS9A 3S15J 3VW0A 2NS8A 3LHQA 3QKXA 4JKZA 1I3QJ 5CW8A 2Y2ZA 3E7LA 3L1PA 1Z77A 3OSFA 3TP0A 2X48A 4DYQA 4A3FJ 2W48A 1RESA 3MNLA 4FE7A 1IGNA 2YUSA 5FLMJ 3KNWA 2JA7J 2R5ZA 1X2NA 1W0TA 1X2MA 2LY9A 2ZCXA 2LTPA 2PMZN 5JLWA 3K7AJ 4IHVA 2K9QA 1XS9A 3HBLA 3HTIA 2L7ZA 2E1OA 1ZKGA 4ICHA 1OCPA 4JX5A 4C3HJ 1JKQC 2E2IJ 3VVZA 4J19A 2DA4A 1VF9A 2MSYA 3BR1A 1JJ6C 3V78A 1YRNA 2CUFA 3BR6A 2DMPA 5C4YA 2M2EA 5F08A 5J1UA 3HE0A 3BR3A 1T33A 1FTZA 2CU7A 5FMPA 3DCFA 5FKKA 1ZR4A 3IH4A 4UUSA 2IEKA 3PASA 2L7FP 1PUFB 1A6IA 1MBJA 3S1NJ 3KKCA 3P9TA 1RKWA 5M5YJ 2JN6A 1B8IB 1JKRC 3ANGA 1CQTA 1TWFJ 5F0CA 5EZGA 5EG0A 3VW2A 2LFBA 1HCRA 5EDNA 2R5YB 1ORKA 1UI6A 2UXPA 3NPIA 1TWAJ 4XIDA 3VW1A 2HOAA 2GFNA 3SJMA 1OJLA 1R9TJ 3NNRA 2V57A 3Q0VA 1JUMA 2CJJA 2NP5A 4CGRA 4A69C 1WGXA 3HB9A 2NX4A 2NVXJ 3NARA 1SFOJ 5GPCA 3I4MJ 4MFEA 3IV5A 2ECBA 5EF6A 3LSRA 3GTOJ 5AQCA 3RKQA 4IHWA 2UXHA 4XK4A 2EZLA 5D19A 1ETXA 2LD5A 1Q1VA 2XPVA 1LE8B 4NN1A 5H9TA 3PM1A 4JX4A 4FTHA 2VPRA 1G2HA 3RH2A 2FJ1A 2XPWA 2YVHA 2Y9ZA 4AF5A 1B72B 3S2DJ 1AHDP 4HKUA 2XGCA 3G1MA 1F36A 4C3IJ 2GM4A 2HYJA 1TWCJ 1TWGJ 2MW8A 3A03A 3DEWA 1D5YA 2UXIA 4I76A 1SANA 2DA3A 4B1RA 4A93J 5J3LA 3BR0A 4JL3A 3QBMA 4A3BJ 4MXMA 1ETVA 2CQXA 3O8GA 4A3KJ 1JT0A 4ACIA 2UXUA 5M3MJ 2OI8A 3B81A 3BTJA 2R93J 3HTJA 2M0CA 5F0FA 2EZKA 2G7SA 1I50J 1JUPA 2XPUA 5K7HA 3JRDA 3GTPJ 2OF7A 5E3LA 2EZIA 4BKXA 1P7JA 4IHXA 2NVTJ 2OERA 1W0UA 1OFCX 2ID6A 3EGQA 1VNDA 1NK2P 2DMQA 3PO2J 1GVDA 3SDGA 1B72A 2GENA 3S1QJ 4AYBN 2R0QC 5IP9J 3RD3A 2TCTA 2DG8A 3CWRA 3PO3J 2GBYA 3H3VK 4FISA 2FX0A 3BCGA 1X58A 5FKLA 1O4XA 2EBIA 1QRYA 3GTLJ 3HOUJ 3BTCA 5M5WJ 1H88C 5IPAA 5FJ8J 3VVYA 5J1RA 1XC5A 2ECCA 5IYBJ 3WHCA 4UUTA 1MSFC 4W97A 4XRMA 3LJLA 3BG5A 1P7IA 5DS9A 4B3AA 2E2JJ 3BJBA 2JA8J 4YZEA 3VVXA 3IH2A 3Q0WA 3LSGA 4L5EA 3TW6A 2M8GX 3BRUA 2LP0A 3ZQLA 2D6YA 3S16J 2HI3A 3QQAA 2ZCNA 4FCYA 4GFLA 3VPRA 2CQQA 3BG3A 4D5FA 1DU6A 2GUHA 3VUQA 5HSZA 3LNQA 1TWHJ 3BTLA 1AU7A 2HXIA 2HQ5A 2K9NA 2JA5J 2EZHA 5F27A 3OOUA 1IUFA 4DYRA 3BR5A 2QKOA 4PXIA 5M3FJ 4JYKA 2DJNA 3M4OJ 5EGOB 4BY7J 5EFYA 1LFUP 4Y52J 4RDUA 2FQ4A 1E3OC 2MG4A 2O9LA 1JJ8C 3D1NI 4M3GA 1ETWA 4Y7NJ 3CDLA 2DA2A 4A3IJ 5IYDJ 4AC0A 3HTAA 4DW6A 1YRNB 3ZQFA 2G3BA 3BR2A 4A3MJ 5GPAA 5J1YA 5F1JA 3FK6A 1Y1WJ 3MVPA 3WHBA 3G7RA 4EEFG 4CYCA 1U8BA 3IH3A 3S5RA 3JRCA 1B8IA 3A01A 1UHSA 1GT0C 3CQZJ 5E3OA 4V2FA 3FK7A 3E7QA 3KZ9A 2GLOA 3TP3A 1QVTA 3GTMJ 1FIPA 1IRZA 3PPBA 3HOYJ 2IBDA 2DA6A 3G1OA 1JT6A 1TC3C 2ME0A 3JSJA 4A3LJ 2G0EA 1HLVA 4GCLA 5FKMA 2QOPA 1IG7A 3TEDA 3HIMA 3BQYA 5F04A 5EGOA 1H89C 3S14J 4X6AJ 3BTIA 4M3BA 3JREA 1ITYA 3H0GJ 2WUIA 4MIMA 1GDTA 2VI6A 1BA5A 3JRBA 4M3EA 2O8KA 5C3EJ 1BL0A 3CRJA 1JTXA 1JTYA 1T56A 1BW6A 2EQRA 3K2AA 3ZQCA 3ON4A 2O7TA 2Q24A
chains in the Genus database with same CATH superfamily
2VL8A 1VZ0A 2W25A 3OIQA 1S9HA 2Y31A 4A2UA 4B8XA 3ERED 2DA5A 2M8EA 1H9TA 3IUVA 1KYZA 3FKIJ 2AQFA 4LLGF 1IC8A 1OYYA 2WAQN 2X51A 2ZKZA 4ZDLA 2E71A 3NWSA 5HLHA 1R7JA 5D4RA 2CW8A 4Y17A 4M71A 1KU7A 3ZQHA 3I5UA 2QCOA 3MZHA 3H0DA 2DODA 1UJ8A 2F5EA 5GP9A 4X1EA 1VFCA 5DD4A 4F92B 2G7UA 2DFIA 2IAIA 5ICCA 5E3NA 1B1BA 1KQ9A 1VQ5I 4L0YB 2DQRA 2P6TA 2CUEA 4ABZA 1VQOI 2JA2A 1F9NA 3EETA 3KP7A 3BJ6A 4G7ZF 2ZOYA 3F21A 4KMFA 1LKXA 1SVOA 5DYMA 2E1MC 2IS6A 3K4BA 2VT2A 1PDNC 5C4XJ 3BG9A 4HQMA 2IJLA 5L3DA 3ZOBA 3OS1A 2HXOA 2MGQA 2NAZA 3AFHA 3SEQA 3MKWB 4HSRA 2OV7A 2C6YA 4M74A 2EFOA 2I10A 4XBFA 3SFIA 3H9JA 3NWTA 1FIAA 3HSRA 2FA5A 2MYSA 5J47A 1OMIA 1SGMA 4E7JA 2PFVA 5K58A 4YELA 4FE4A 4N9HA 2QSHX 1UB9A 1VQNI 2UXXA 3DLAA 4M6VA 3W6JB 1PUFA 1F43A 3G56A 3OL4A 3CF5F 3PQJA 3R61A 1XTAA 3GWZA 1RETA 4RMNA 3RCOA 5DM7F 3HEFA 3BHQA 1EF4A 3FXRA 1RC9A 2B63J 1L0OC 5FB2A 3HOTA 4L0ZB 1GV5A 1JUSA 3N05A 3HGYA 3OYIA 4XORA 1J2XA 2VN2A 4DNCA 1E3PA 3COLA 3BROA 5HLGA 3EYYA 4QTRA 2HQNA 5L3GA 2R7FA 1FEXA 3E5QA 1R1VA 1SD4A 4M9XA 2QWTA 1MBHA 3K10A 1ZRFA 3K4NA 2CW0F 2EIJH 4ZTFA 4IZZA 3V8KA 1YOVB 4WK8F 5D5XB 4ZZDA 2VT3A 2LNBA 2VBXA 2LY2A 3K9TA 3HTHA 1K61A 3H1CA 5GAEJ 4BXUA 2BV6A 4NQWB 4HNVA 4BYYA 5LHGA 3A1YA 3ZMZA 2L7MP 2VC1A 2FOKA 3LA3A 1ZN2A 1NK3P 5EYRA 1IN4A 5LEJA 4BNCA 2UXOA 3ABKH 1MSEC 2FBQA 1IJWC 2I8DA 2WB1A 4MTEA 1ACIA 4B09A 1FOXA 3S3MA 1I6HJ 2HPMA 3BZCA 2R7ZJ 3RDIA 2VKVA 4RLFA 4CCJA 4U88A 3JAMZ 1H0MA 5D18A 1NG6A 1Y8QB 3S8PA 2CFOA 2ZXHA 3A0HC 3HHHA 2HZDA 5KAIC 3LWFA 4MHGA 3TW7A 3EPZA 3GFMA 2OZ6A 2ZC2A 2E34A 3E6DA 2Y0SN 2VXZA 1QBJA 1ENHA 2CRGA 4HRIA 3W6VA 4UY8I 2FBIA 5DTDA 3JCUC 1W1WE 1ETQA 1Z6RA 4OIPF 2LR8A 3RQIA 3G4SI 2DTRA 2K85A 1U0JA 5DV5A 4AIKA 2VE8A 5FO5A 2F2EA 2H1KA 4RB0A 1A5JA 2REKA 2XRLA 2XAQA 2M7BA 1NTCA 1S7EA 1WRJA 2KT0A 4RGRA 3L7WA 3BQZA 1SAXA 1Z05A 5D8LB 1VTNC 3VP5A 3AL0B 2ELKA 2MABA 1FLIA 4EM0B 2O6GE 3D5SC 1V5EA 4CUGA 4KJZA 2VUMJ 4D7NA 2DFFA 2XDNA 3UKGA 3HJEA 1UI5A 3IRQA 2H6BA 5LGNA 3HGGA 4GCVA 1I1SA 4D7MA 1R6RA 1JGGA 1UZCA 2M5WA 1ETOA 3FXJA 3I64A 4RB1A 1X4OA 2D5VA 2V79A 2HYTA 3NAUA 1IUYA 5ERIA 4AU7A 2IRFG 5D6EA 1ZG1A 1YX3A 2EA2A 4H4KC 3OYKA 4AVPA 4X0GA 2H8RA 3LFKA 5HDNA 1HKSA 5HNFA 4JX6A 4KIBA 4BBRJ 2BHYA 5JFRA 1YI2I 2UWMA 4D9JA 3NRGA 2QVOA 4BQAA 3SFZA 4IJAA 5BPDA 4JOMA 3C2BA 5DCMA 3M8JA 5IP6A 3E1SA 3LSMA 5FKOA 3J81Z 1KYWA 1GXPA 4KDPA 2R5ZB 5HBUA 5ICGA 3V8JA 1K4TA 1HF0A 1Y0UA 1Y0NA 1Z9CA 5EJCA 3SYTA 2KPMA 2JZYA 2IP2A 1ZGJA 3K4KA 3TDZC 5CW8A 2QKLB 4OINF 1LJ9A 1VQKI 3DV8A 2K9MA 1X3WB 3TP0A 4BJTA 3LA2A 4E4HA 2X48A 4A3FJ 1G3TA 1RESA 4DOZA 3FBNB 4M6XA 4G9YA 2VKHA 2JA7J 1WJDA 1W0TA 1FMVA 1X2MA 2DFHA 5JLWA 3HBLA 1K78B 3HTIA 1YITI 4JX5A 4C3HJ 5FRNA 4KYWA 1JKQC 5ICFA 2E2IJ 3P9KA 2OJED 2GIVA 1JJ6C 1MKMA 6PAXA 3GX4X 4G94A 2L2OA 3VSKA 3BR6A 3S3OA 5C4YA 2FEZA 2M2EA 4LG0A 1NG7A 3E6CC 2V9PA 2GIZA 3I71A 3LFUA 4ENMA 3VTIA 2IEKA 4BJ6C 2D2WA 1A6IA 1MBJA 3KKCA 3DQVC 4ASNA 3P9TA 5D5VB 3WU0A 1K6OA 2M87A 2DW4A 1JKRC 1B8IB 2VODA 3HUGA 1CQTA 4KIFA 5EZGA 4Q5SF 2KIQA 1FP1D 2DQLA 2PQ8A 2LFBA 2NNYA 1UI6A 3VB2A 2STTA 3VSLA 1XX5A 4IO9F 1R9TJ 4P5OA 5GAGJ 3DBLB 4CZCA 3CDIA 2CJJA 1N25A 1U5TB 4AD9A 2NX4A 2NVXJ 5L3EA 1BI2A 1O57A 2ZBKA 3BG7A 4BQNA 3BPXA 4P9UA 2P5VA 4XK4A 1T0FA 1MJ9A 1V4RA 4LMYA 1R4NB 5AONA 1ETXA 3FXMA 1XCVA 2R4GA 1LE8B 3DU5A 3RKXA 4NN1A 4XKVA 5H9TA 3CCUI 2BEOA 4R1HA 1G2HA 2YVHA 2DAOA 5D5UB 3DTKA 1B72B 5FLXZ 4EV0A 3N4MA 3OYDA 1D1CA 1FX7A 2XASA 2KHMA 1TWGJ 1D5YA 2XSJC 1TQIA 4EJOA 1SANA 5CQGA 4B1RA 1SFUA 3BR0A 4XL9A 1MDMB 5K5OA 1ETVA 2CS3A 4RAZA 1X1BA 5DD8A 4CGZA 2JTVA 4LLNA 3J7AO 2RDPA 4BS9A 5JHUA 3PSFA 3GW2A 4Y3OA 2FOWA 5F64A 2R93J 1D8JA 2ETHA 3H9GA 2VJJA 1JUPA 1OQYA 3IAM2 4BKXA 3FM3A 5CVIA 2PX9A 2GXAA 2MD0A 2ID6A 1BIAA 2FF4A 2DMQA 2E1NA 1GVDA 3PO2J 3SDGA 4UVCA 3I9V2 2GENA 1U2WA 3S1QJ 2KJCA 1IN6A 1UHMA 3F8CA 4HX7A 3CWRA 3FXUA 4K2EA 4QWQA 3CC7I 2GBYA 1JHHA 4WXCA 3H3VK 2FX0A 2Z99A 3DLLF 3BCGA 1R22A 3WTVC 5FKLA 1K6YA 1CF7A 2BZTA 2EBIA 4LD5A 4ZYHA 1MJBA 4OOIA 3BPVA 1H88C 3F8FA 3BY6A 1XSXA 1R4MB 3V7RA 4Y4RA 4ESJA 3B73A 3WHCA 4UUTA 4W97A 4XRMA 3L2VA 1SFKA 2OBPA 1E0EA 1P7IA 4B3AA 2E2JJ 5FGMA 3I4PA 4L9NA 2IT0A 1N75A 3FM5A 3CP2A 3IH2A 3C3WA 3VWBA 2OAZA 4L5EA 3TW6A 2OTJI 2ELHA 3ZRGA 1S6LA 2V9KA 2LP0A 2D6YA 1YO5C 3ZMUA 4EJWA 2ZCNA 3E97A 2LBFB 2B9SA 3VUQA 4D5FA 3BG3A 3SWHA 2LREA 3KEOA 3L00A 3CJRB 1G6NA 3BR5A 1DUXC 2BY2A 5M3FJ 2DJNA 1WJAA 2DBBA 1HW5A 3EUHC 2ADUA 3KEYA 2JSCA 2FQ4A 1E3OC 4P55A 2MG4A 4PJLA 2DI3A 2F4IA 2L9NA 4Y7NJ 4LG0B 2DO7A 4R8HA 2HTSA 1E3HA 4EQQA 4A3IJ 4AC0A 3HTAA 2EIKH 1UELB 4UXNA 4DW6A 1SVLA 5BMZA 3BR2A 1ZREA 2JUGA 5GPAA 1TNTA 3WG9A 5F1JA 3FF5A 4BH9A 1Y1WJ 3MVPA 3DPLC 4XSXF 4HNUA 3G7RA 1WHUA 3QAHA 2F5FA 3HXLA 3M8EA 3S5RA 2OCCH 5ILVA 4U0YA 4BDYA 3LAJA 1G59A 3DKXA 1PVEA 3FK7A 4ZTJA 3PUFA 3DBRB 3KZ9A 4YFXF 2M0MA 4LK0F 1QVTA 3HC7A 3HOYJ 2OC6A 2DA6A 3DTIA 2DLLA 4IVNA 5IY5H 3JSJA 2KIMA 4A3LJ 2VC0A 2G0EA 5IT9Z 4MGRA 4GCLA 3ZMTA 5FKMA 1JXSA 3HYIA 4XLCA 5F04A 3RTRA 5CYVA 2OD5A 4F7ZA 1MMSA 4DBRA 3HKZA 3BTIA 4II2A 2V26A 4M3BA 3CO7C 4MEYF 1ERDA 1R5ID 3VODA 3ASNH 4ETSA 1XGNA 3ERMA 3PJRA 2P7CB 1LNWA 1T56A 4AIDA 2HTJA 3R0AA 2HEOA 1I3AA 1POGA 4YIIA 1Y1VJ 4XLNF 1XG1A 5J4VA 1O7LA 2F48A 1DGWY 1ZLKA 2WY7Q 5FLXK 3ESWB 2KLOA 4G6DA 4BXFA 5E8IA 3IHUA 4P96A 2A6EF 3O8HA 2NP3A 3L2RA 3VOKA 1FMWA 4GFKA 2M1BA 1XN7A 3FRQA 4NDLA 1DDNA 3SXYA 4RGUA 4DYCA 2BY3A 2GZWA 4HG2A 3IL2A 2VONA 2Q8KA 1FBUA 2Z33A 4KNYA 1DQUA 2LDUA 2VBWA 4RAGA 4GCTA 2KRHA 3O3KA 3DKYA 4PCQA 1APLC 2CW7A 1IDZA 3HOZJ 1R5HA 3G1LA 1MMNA 2E7WA 2X0LA 3C1DA 4GYIA 4E7ZA 1YHQI 1MBKA 1ZTRA 2XAHA 5B1AH 3TQNA 3C18A 2OUMA 2WAQA 1YW8A 2EJRA 3SZGA 2P8TA 3M3YJ 4PK4A 3EUAA 2K27A 2QIBA 2A69F 2JWTA 2K7LA 4BL0B 1B6AA 1TW2A 5JVGF 5DDGA 4WX9A 1P92A 5KNLA 4H0EA 5CJ9A 4F93B 1LPQA 3BNIA 2L0KA 4XKBA 4MNUA 5TJJA 1MMGA 3HOXJ 2BE5F 1HSTA 1MW7A 2DJIA 3QPLA 4UHTA 5H2FC 1NH3A 2JJ7A 1OPCA 1ON1A 2OCEA 3OWTA 5E8GA 2QQ9A 1EV7A 2K02A 4CICA 2KL4A 2ISYA 2AHQA 1D0XA 2WTEA 4W1UA 2QSGX 2STWA 2RGVA 2CSOA 2X9DA 1FBSA 4HYEA 3GF2A 4AIJA 2QBYB 5EEAA 2L9RA 2E19A 2DTZA 5K7ZA 1IN8A 4UUSB 1A35A 3HRTA 2MC4A 4YIFA 1MBFA 2MH2A 1MH3A 1K83J 2Z3YA 3DTEA 3MKLA 4Y33A 1RUOA 2GXBA 2KRCA 2DT7B 3ROUA 1AKHA 4BAYA 2JUCA 1MNDA 4M3FA 2PI0A 4OMYA 3M07A 3EUKL 2HS5A 5FHPA 2M4GA 4IRHA 3T6NA 3GXOA 3KP2A 2V1NA 2CV0A 5J8CA 3GTQJ 2L7KA 3H9QA 2NVQJ 2ZJPF 3TMOA 4FX4A 2Q1ZB 1G3SA 3K4JA 3L9FA 4JQFA 3HTSB 4KWAA 3Q0UA 3KYLA 1Z7LA 1VI0A 4M73A 1YG2A 1YLFA 1Y6IA 3KP5A 1FZPB 1MGTA 1XD7A 4HF0A 4ON0A 3ZMSA 2R7QA 4NELA 4LG3A 3WE2A 3IP4B 4XR6A 4ZZLA 3A0BC 2DOAA 1MBEA 4EGYA 2Y30A 4YG2F 3W2AA 4CCOA 4BACA 1OCZH 2L54A 4MK6A 1X1DA 2O5RA 3GBGA 3FX3A 4OD4A 3B6AA 4MLOA 5TGTA 4WF2A 3S1MJ 4XRSG 3JRGA 1SMTA 2A05A 2BW3A 3CCMI 1GXQA 2QGUA 5HLTA 4NC7A 2KJBA 1P6RA 2W85A 4RM2A 3RPQA 5K7FA 3F23A 1R49A 3E3VA 3MQ0A 1JKPC 3VEPA 3MFKA 4KN4X 1MH4A 3OS2A 1VQ9I 2BW3B 1V3FA 1IN7A 3EDPA 3R0JA 1OCOH 1OLTA 3E5UA 1U9NA 1HDPA 2DA1A 1MBGA 4U87A 1X19A 1JHFA 5EZHA 5D8KB 1RPWA 4FASD 1YFHA 2PBXA 2N8GA 2G7LA 1P4WA 1YJ9I 2LKSA 3LSKA 4CZZA 4G7OF 1ETKA 3ZMVA 2R92J 2HYGD 2WAFA 4ITVA 1Y56A 1FT9A 3LSPA 4B43A 4IF4A 4BE2A 4UDSA 5BOXA 4EJUA 3H35A 2JMWA 3CCRI 2DA7A 3ZXSA 4WXDA 4CSWA 2R5YA 3V7CA 3QOPA 3Q3SA 5HOOA 2XF5A 4UB6C 3UNGC 1WJEA 4PFOA 1ZGWA 3WE3A 2VBYA 3DF8A 4G12A 2LLKA 4G6QA 2O7OA 1IDYA 4J00A 1VQ6I 2R7UA 2FXAA 4M9ZA 3JRFA 1T0FC 2BGCA 3D5RC 3SZPA 3F72A 3CMYA 3TO9A 3KLNA 2H94A 4C2MA 1YE9A 3A01B 2G7GA 3CCVI 3G2BA 2RNJA 2J5PA 4BEHB 3KZZA 3R6SA 2EPFA 3OV8A 1O3SA 1ODDA 2Y0MA 4LIVA 2M9HA 5IT3A 5E79C 3JW4A 2HGCA 4A5MA 1IXSB 1ETYA 1LB2A 1K78A 1S7AA 5C44J 3PIPF 4I09A 1O3QA 3SQNA 2LK2A 4CGRA 2JA6J 2F5DA 2QF7A 3OSGA 4R79A 4XICA 1D1BA 1AWCA 3LHQA 3TOBA 2F6CA 4IL6C 2RREA 2Y2ZA 3L1PA 2X6WA 1OKRA 1TT5B 2R7RA 3WTUC 3GZ6A 1HXDA 3OYBA 3M7GA 2NVUB 4JBAA 3KNWA 1D0YA 3OYFA 1RIOH 4PJNA 2L4AA 4HEA2 2ZCXA 3OY9A 2LTPA 2HWVA 3CJNA 2K9QA 3QYBA 3PUBA 1XS9A 4E6KG 3S3NA 3HHGA 3Q9VA 2ZSIB 1LVKA 1B9MA 2E1CA 4UUVA 4ICHA 1OCPA 2ACJA 1RUNA 2PBIA 5F1RA 1VF9A 3L09A 4LFUA 2KKOA 2HQAA 2MFZA 4IOCF 3ULQB 3DP7A 3J80Z 2CUFA 3KP6A 3OYEA 2ZMEC 2D1VA 1QNTA 2O8XA 2R7WA 2CH0A 2QA4I 3BR3A 3HE0A 2DYRH 5HVQC 2ESHA 3PFIA 4M6YA 5FKKA 3AAFA 3I53A 2FMLA 2X1DA 4UUSA 3UR3C 1IF1A 1VQ7I 2L7FP 1PUFB 1V5FA 2GOMA 2VQLA 4A6EA 4EM1A 3S1NJ 1SEUA 3QYEA 1TQMA 4IX7A 3A2KA 5F0CA 4BGDA 3VW2A 2CV2A 1XCBA 3SHFA 4G6TB 1HCRA 5EDNA 2EWNA 2R5YB 1WZ2A 5JVTA 3VW1A 1MJAA 3ZQQA 2CQKA 2VQGA 2GFNA 3SJMA 1VQMI 2JVHA 2NRAC 3T0YA 4FX0A 4A69C 2RQQA 2RN7A 4XMYA 3RKYA 3T1BA 4IPAA 4F3QA 1QHGA 5GPCA 3FBIB 3IV5A 1OYIA 2ECBA 2NXNB 5EF6A 3LSRA 3GTOJ 3LQRA 3RKQA 2B1EA 4NC8A 4XN0A 4F91B 3CESA 1WKMA 3MZ8A 3GCMA 4I7HA 5FRMA 2V7FA 2ZFUA 1Q1VA 5A2QZ 2WC2A 3PM1A 3OMYA 1U3EM 4A0XA 4JX4A 4ZYDA 4FTHA 2VPRA 3IKVA 3RH2A 2FJ1A 1ZH5A 2Y9ZA 3BZKA 4YFNF 4GYGA 2R7SA 1YS6A 2QQBA 2V4JC 3DEUA 4AF5A 1W7PA 2LG4A 1AHDP 4XOTA 3K6GA 2ZO4A 3CF2A 3G1MA 1BC8C 2HYJA 5CVVA 2YR2A 2IS2A 4HDUA 4HBLA 1YIJI 4OIRF 5J3LA 4M9SA 4RLQA 2QSFX 3QBMA 4MXMA 2CQXA 4LB6B 4A3KJ 3C2HA 3IKTA 3ZN1A 2FU4A 3U1KA 1Z6TA 4EJTA 3K1PA 2VPLA 2LYCA 1S29A 1U5TA 2WWYA 3NEUA 2F4OB 1FPQA 1W5SA 2QLZA 3GFIA 5F0FA 2G7SA 1XB4A 5KCMA 1IO2A 3WGIA 2XPUA 1S72I 3GTPJ 2OF7A 3TO7A 1P7JA 2GXGA 2VQCA 4HA8A 3GVAA 2KIUA 4N0BA 3WTZA 3J7ZI 2EV6A 1OFCX 3S2WA 3EGQA 2O61A 4UV9A 4Z2YA 2DT6A 5CVRA 2X6XA 1B72A 3U9GA 3CCLI 4G8XA 2R0QC 1G3YA 5IP9J 3RD3A 3GUDA 2TCTA 2DG8A 2A6HF 3MZYA 3V7SA 3NS4A 1D3YA 4PSWA 2OTLI 1Z1DA 4PJ0C 4HDVA 1XGMA 2VJ4A 1TNSA 3DFGA 2Z16A 1T95A 5KHDA 3GTLJ 3KE2A 4AYBA 3HOUJ 1G3WA 2YX4A 3PFYA 1KU3A 5FD5A 2DOEA 3VVYA 1X4PA 1LFPA 1IRXA 1HW2A 2MBFA 2M4KA 3BG5A 3FMQA 3RYRA 5DS9A 5KK1A 4YZEA 2JA8J 2IVMA 2K4JA 1PP8F 1ONVA 3K70D 4OAYA 1UG0A 2XGXA 3ZR8X 2YVXA 1FNNA 4A6DA 4IHTA 2DCEA 2W1OA 3ZQLA 5GAHJ 3PSIA 4FCYA 3FHNA 3FWEA 3VPRA 1UCRA 3PNVA 2ELJA 2L3DA 2BHZA 3BTLA 1AU7A 2CFXA 2HQ5A 2UXNA 3S32A 4DYRA 2DXIA 3FMSA 2VLAA 5B3SH 3WODF 3M4OJ 4BY7J 4PZJA 3G3ZA 4RDUA 4I99C 1ZARA 2KP6A 1JJ8C 4M3GA 3BJAA 3CDLA 3AG2H 4YRVA 3ZQFA 3OYAA 4C30A 3CCSI 1TZLA 5J1YA 3OYGA 4A3MJ 1WFXA 2VASA 3WHBA 2IS4A 2OQRA 3M1EA 1HBXG 1E17A 2BYVE 3I0TA 4TV7A 1U8BA 3IH3A 3JRCA 1I5ZA 3A01A 1UHSA 4E7HA 1R1TA 1R23A 2O03A 3BG6A 3CQZJ 3DEEA 4P9FA 5E3OA 2HDCA 4V2FA 4OU0A 3E7QA 2GLOA 4RB2C 2LY1A 2MC3A 3JTHA 5GTIC 4KA4A 1IRZA 3PPBA 3G1OA 1XMAA 4L9JA 2IS1A 2ME0A 4KITB 4IKFA 2DDBA 1W4MA 2I5UA 2BVLA 2IPQX 3HIMA 5EGOA 1H89C 3GLLA 1PYVA 3JSPA 3QWLA 4KFCA 3M1CA 4HX8A 4MIMA 4WCGA 2OZUA 4MQ9F 2VI6A 3JRBA 4CH7A 1ZYRF 3CRJA 1JTXA 2ZSHB 3ZMDA 5J6XA 3ON4A 1SD7A 2JPCA 1JI8A 3BCAA 1J75A 3K8PC 1QO0D 3V6GA 2J5OA 1TL8A 2F5CA 2KFDA 2VKEA 1J9IA 1FOKA 4LB5A 3H36A 3S1RJ 3F6VA 1W36C 2V1DA 4AWXB 2K9SA 3P5JA 2X85A 1W5CC 3T5XA 3X2QH 2DPUA 1UMQA 3RZDJ 3GZIA 3OYJA 2NOGA 1BIBA 3HKZN 4IQ4A 2D1HA 5F6FA 2CG4A 4JP0A 3I55I 3HOSA 3ZQIA 3CCYA 1FYLA 2OA4A 1BOBA 3I59A 2W4SA 2VIXA 5HLIA 1V55H 5LFAA 3WTSC 1YJNI 3FXLA 1DPRA 3GEUA 5L3FA 1OYWA 3AQTA 3LAPA 1QVUA 5E1XA 1SD6A 1HQCA 1T98A 2HDWA 1U9OA 2QM3A 2W82A 2ZNYA 2B0LA 4BEHA 5DM6F 2JT1A 2LSOA 4GCKA 2GA1A 4C3JJ 2RC4A 3F8MA 4ZJZA 3CC4I 3DPJA 1LFBA 2BVMA 2G7HA 2M34A 1SMYF 4MEXF 3CC2I 5IOZA 4HQEA 4CDGA 2W00A 4A5NA 3C7JA 1MMDA 1BJZA 2LVSA 4N4OB 2XKOA 1ZRDA 2GOXB 5JHFA 1JKOC 1QPIA 4U9LA 2Y9YA 2FE3A 4A3JJ 4GFBA 1WJ5A 2DDAA 3QODA 4DZJA 2XSDC 3BT9A 2JK3A 4CYDA 4Q4ZF 3CJQB 5E18F 4D5CA 2GQQA 3RJPA 4XKCA 2RQPA 3NRVA 2CQ7A 4AVZA 2TRTA 4DIQA 4Y15A 4QSHA 4MTDA 4IEJA 5EEGA 4V19K 3ELKA 1Z67A 1T08B 3S93A 3LSJA 3OYNA 3HSFA 1BC7C 1ZGAA 3A02A 3KETA 4PJMA 4LJZF 1WH7A 4AUXA 2QBYA 2QUFA 4BHCA 4XKWA 1RKTA 2X6OA 1HDDC 1FC3A 4NC6A 1E2XA 1OR7A 1REPC 1TLHB 1W7PB 1R58A 2ZNZA 1LEBA 1JGSA 4BU2A 3AG3H 2XGDA 4HF1A 3LWJA 4C2MJ 1BW5A 2LKXA 4QPOA 2E5NA 1LE8A 5D1RA 4AIHA 1YQAA 3OIPA 2HQRA 2L9SA 5GTHC 4S0HB 4D0PA 1FTTA 4BUPA 1H8AC 4L62A 3B6CA 3RQ4A 4A3EJ 4ESBA 1J09A 3ZQ7A 3OYCA 1UAAA 2HVRA 1ZK8A 4A3CJ 2HKOA 3BWGA 2K5CA 1MDMA 1KQ8A 2MD5A 3G6EI 2XB0X 4KIGA 5A2QK 5HS9A 2FD5A 4QPQA 5FD6A 1OR7C 3CMMA 5CXIA 3J7AY 4UB8C 5DUIA 4BDZA 4RGXA 2WB1N 3H5AA 4EM2A 3HUGB 4B48A 3VYTB 1OCTC 4OWRB 4UV8A 4BY1J 4EMSA 1T2KA 3GYHX 1IN5A 3F0CA 1JE8A 3L2CA 3C2GA 1MZBA 2IGKA 1A36A 3QP5A 1F5TA 5LGUA 2AQEA 2XAFA 5TISC 1UHWA 4BE1A 2DMTA 1P9QC 1LDKB 3F8NA 3PIOF 1TQPA 4FHTA 3TL4X 1LQ1A 1DP7P 5E17F 1QPMA 1WVRA 2QTQA 2F4MB 1B59A 1I1GA 2ZOZA 1D0ZA 3E6MA 3CUQA 2W24A 2GWRA 2ISZA 2W53A 1S8NA 4BJ5C 3ZN0A 3CZ6A 2FRHA 4HZFA 1ZR2A 3HRUA 5IT9K 1LDDA 1I39A 2H8WA 9ANTA 5BPIA 5HAWA 1ON2A 4OAZA 3VDXA 3HDDA 4A3GJ 1WCMJ 2BY1A 2W57A 2OPTA 2CGPA 2P81A 2DMNA 1ZG5A 3HIFA 3JRAA 3GMEA 3QPTA 4YFKF 4EATA 4AC6A 2ZFWA 3WG7H 5BNGA 3WTYC 3LOCA 4V2GA 4O3MA 3M9AA 2WGBA 1STZA 5DCMB 5H20A 3JR9A 4FETA 4L9VA 4CYCB 4IQJA 2HKXA 3CCJI 3SZTA 4HAMA 3RZOJ 2H09A 2WADA 2IU5A 5E20A 3MN2A 5GADJ 1Z7UA 4DZPA 2XUBA 5LLQA 3KPHA 2COMA 4HV5A 2XB5A 2HKUA 1QHHD 2HDDA 2K4BA 1ZG3A 2YS9A 3S15J 3S17J 1P4AA 4CCNA 3RPUA 4NQWA 5HS7A 4IOAF 2E7XA 1I3QJ 4RM3A 3E7LA 2BXZA 2LBFA 2W48A 3WTXC 3MNLA 3O2PE 4P1WA 1IGNA 1X1PA 1D1AA 3RSNA 5FLMJ 1TP4A 2HZTA 2V6CA 2R5ZA 1X2NA 2LY9A 2PMZN 3GFJA 2GA2A 3K7AJ 4BHPA 3W2VA 2K9LA 3H5NA 3OOPA 3BCBA 2YX7A 3ABLH 3VVZA 3LSIA 1YS7A 3IWFA 4J19A 5LRSA 1YRNA 3OYMA 5FFZA 1W36D 3GEZA 3DBHB 1CF7B 2W84A 1RZ4A 2E35A 5F08A 5J1UA 1SC7A 4XLFA 1T33A 2CU7A 3REOA 2JPBA 2R7DA 1ZR4A 1B9NA 3D5LA 3IH4A 2PMUA 4NUBA 3PASA 1RRJA 2DK5A 3OS0A 1RKWA 3EYIA 1Z3YA 3K70C 2JN6A 3CCEI 2XRNA 1BR4A 2W7NA 3BJOA 2QYOA 1TWFJ 5EG0A 4I2OA 2LMDA 1J59A 1X1CA 4RAFA 4PDKA 2EB7A 1ORKA 1P4XA 4U7BA 2WAEA 2IGMA 2ZMEB 5D4SA 5LBQA 2A5YB 3NNRA 2VOOA 1U8RA 2LKPA 2E1MB 1R71A 1CGPA 1ZAOA 2NP5A 3DPUA 3HB9A 5AIPA 2KMUA 4RAYA 2A61A 1SFOJ 3I4MJ 3K1NA 4MFEA 4DJAA 4XLHA 2DT5A 2CO5A 4IHWA 3VYSB 2UXHA 2R7TA 3E6BA 2D45A 2ZXIA 1W5TA 3KZIC 4BHBA 2LD5A 3OYLA 4C2TA 2G9WA 4RS8A 2CV1A 2X1CA 4N4NB 1XMXA 3U2RA 2XC7A 2XPWA 1Z3XA 2CWEA 2M7AA 3ONQA 2X4HA 2LOOA 3A4CA 3S2DJ 3AKZA 2XGCA 4LK1F 2GM4A 4C3IJ 1TWCJ 3DEWA 3A03A 4M72A 4DVYP 1TT0A 2UXIA 4I02A 4HX4A 2HPIA 2WY8Q 4A93J 1Y39A 2K3PA 2QENA 4JL3A 1IZ1A 2FMYA 3DXJF 4B3XA 2XF7A 5JI6A 4A3BJ 1FSHA 2A6TA 4L5JA 4YEJA 1XDSA 3COAC 1A31A 2HU9A 2MLGA 1JT0A 4ACIA 3BOQA 2UXUA 3V4GA 2MLKA 5M3MJ 3B81A 3BTJA 2IXSA 1PUEE 2EZKA 4HNTA 1I50J 1R00A 2DYSH 1RI7A 5K7HA 5K5QA 1IRGA 5E3LA 2EZIA 1EA3A 4LLLA 2HVSA 1XMKA 2P4WA 3P9IA 2WV0A 1VQPI 3P9CA 2UV1A 2BBYA 2L9VA 2E5ZA 1NK2P 3IAS2 2FBHA 3CUOA 3F9KA 3FXOA 3CLOA 1WJCA 4PJJA 3I59B 3AG1H 4OIQF 4FISA 2HOEA 3LSHA 3FKJA 2HR3A 4C2UA 4RA2A 1HSJA 4WIBA 1O4XA 3QOEA 3IUOA 1QRYA 4N9IA 2XKPA 3BTCA 5M5WJ 2Q2EA 3HG9A 2LF7A 1KGSA 3PNYA 2ECCA 4UNOA 2KQRA 3TGNA 4L9TA 3FZVA 3LSTA 2X1EA 2FNAA 5CVJA 1D5VA 3BJBA 4Q48A 2HNHA 2JSPA 3VVXA 3F8BA 3TDUC 3J7YJ 3Q0WA 3IRRA 1QGPA 3H3UA 4CCLA 3CLQA 4S05A 2M8GX 3IWZA 2EFNA 3BRUA 3S16J 4ZDOA 3OR1C 3QQAA 1LUJB 2FNPA 2CQQA 3LNQA 1TWHJ 5ED4A 3VOEA 2HXIA 2K9NA 4PSXA 1K7AA 5F27A 1GLNA 1O7FA 4PXIA 3BP8A 4EGZA 2NYXA 1KQ0A 3GFLA 4Y52J 1FWZA 3TOAA 4ZYGA 3H3ZA 1SVMA 1IAWA 3D1NI 1UFMA 1ETWA 2ZJQF 2DA2A 5IYDJ 4U0VA 1L3LA 3KP3A 1IW7F 1XGOA 3R4KA 4IRGA 4F52A 3RI4A 2VOPA 3FK6A 2JVGA 2Y69H 2VJIA 3AG4H 2QQAA 2CQNA 1V5GA 2LH9A 1S3JA 1S7OA 1B8IA 1HW1A 4E7LA 2R7VA 3J81K 5ILUA 1EH7A 2A68F 3VYUB 4S04A 3GTMJ 3V8LA 2IBDA 5AIQA 1GHCA 3MMYB 1W7PD 2R7XA 1HLVA 2LRDA 3TO6A 3SDBA 2E60A 4C9YA 3KFWX 1IG7A 2QOPA 3TEDA 5EEHA 3QYFA 1IXRC 5HDGA 3JREA 1FY7A 1ITYA 2NS0A 2WUIA 2PLYA 1ZELA 2A2FX 1S5LC 3CTAA 3OYHA 4A0ZA 3PNTA 4M3EA 4KT6A 2O8KA 5JR3A 5C3EJ 1BL0A 1JTYA 1BW6A 2EQRA 1Z21A 1G8XA 1Y8RB 3HPHA 3ZQCA 1BI3A 4I0BA 2O7TA 2PEXA 1SD5A 3BDDA 3W2WA 2B3WA 1ZLJA 5IP7J 4OIOF 2AXTC 4NBQA 4BQOA 1WQ2A 1HOMA 3KX2A 1QZZA 5ILSA 5ICEA 3GTJJ 2V9VA 1T8IA 3VFZA 4PFPA 4QIWN 2EH3A 4CCKA 4ESFA 2Q2EB 5LHIA 4Y13A 1QQIA 2AO9A 3LMMA 4DQ2A 2B7EA 3WGGA 2ME6A 4LGWA 3WGHA 3QRFF 4Z6YA 2ZXWH 3ZPLA 2ID3A 3HM5A 1GUUA 1U78A 4HSTA 2HOTA 3ANPA 3H5RA 5J8FA 3HTUA 2NVYJ 4I98B 3QPHA 1DP3A 2HVQA 4GGGA 3JTGA 1ULYA 2YU9J 3T8TA 3FXQA 1IRFA 2VE9A 1PJRA 3OR2C 2M45A 4FQGA 4ZYEA 2DOFA 2AXLA 4LOCA 3TBIA 2CUJA 2EV0A 2ZY9A 4D1QA 2HOSA 5CXGA 1QA6A 1EH8A 2L4MA 3CJDA 5HS8A 4I01A 3JAMK 1IV8A 5B66C 4XONA 3WTWC 1KONA 2PN6A 2FBKA 4DGWB 2XHKA 4AM3A 4KN7X 4ZYAA 1T38A 3FISA 2A3SA 2WBMA 1FOWA 1WPKA 3G73A 1GV2A 3C07A 2XAJA 3GLXA 4RGSA 5LD2C 1YW7A 2ZMEA 2Q0OA 3HSEA 3MAJA 1KU2A 4CXFA 4U9NA 3DPTA 2HFHA 3FHZA 1BM9A 4XRSA 1J0RA 4ANJA 1FJLA 4LIUA 5JLXA 3HL2A 3HOVJ 2DK8A 2L02A 3F3XA 2IW5A 2RHAA 3PQKA 2JQ7A 4HW0A 5F0HA 5CQEA 1HC8A 1EKEA 3O60A 1X3UA 1UG2A 3F22A 2Y48A 3EUPA 2M30A 4NHJA 3GO5A 2F5VA 3GZNB 4GO1A 2X6YA 1MNMC 4KMUX 2XAGA 4XQFA 4RBOA 4A3DJ 3GTGJ 4B44A 4BQQA 4E7IA 2F07A 2YSRA 2QKMB 2Z2SB 3BC8A 3FMRA 1RR8C 4L5IA 2YVEA 2H27A 1ZQ3P 4OD5A 5DCFA 5IOYA 3KP4A 1BR2A 1GVJA 1RNLA 1J5YA 2COBA 3CD6I 3GTKJ 2R3SA 2AS5F 2FJI1 2PZ9A 1N77A 3DKWA 1LEAA 2KDZA 2L01A 2Y0SA 1BI0A 2XGEA 2DPDA 2EFWA 4Q47A 1DU0A 4BBSJ 3FIWA 3KCCA 5DEQA 1Z0XA 3HZJA 3I56I 3ON2A 2DG7A 4IXAA 3E0JB 2ZB9A 2ZJRF 3DWLE 5FLVA 1TW3A 1G4DA 1EH6A 3VIBA 2PMZA 4OMZA 4BE0A 2DMUA 4LITA 1H9GA 3JRHA 3I4NJ 3LQQA 1USSA 3KKDA 4IHYA 2TDXA 1Q1HA 3CUQC 2RAEA 1IV6A 1VQ4I 1XDUA 3K69A 4CA0A 1WWXA 5LHHA 5DAJA 3M8FA 4XOPA 4JK1X 3U1DA 2KDOA 5FGLA 4ME9A 4M3DA 2E2HJ 5C4JJ 3NI7A 3MCZA 3R60A 2DU9A 4XSZF 1RR7A 1AKHB 2JRTA 1WI3A 1A04A 2WV1A 3MKYB 4MO7A 1V54H 2FQ3A 3AQSA 3ABTA 4RB3C 2V57A 1FYMA 5M5XJ 1F1ZA 4KISA 2PJRB 4F55A 5L3BA 2MA3A 1K4SA 5HODA 2KZGA 1VQLI 1XPXA 2E36A 2NNNA 3KYCB 4KUMA 2YPRA 2IA0A 1WH5A 3WU2C 3ZQGA 2ZCWA 5LEKA 5FKNA 2EILH 2ZCMA 3I3LA 4B4CA 1O3TA 4MFDA 3CUQB 4PUSA 5E3MA 3RPUD 1TBXA 5KAFC 3V42A 3RIRA 1BR1A 4HLYA 1SAUA 5EG0B 4A12A 4BXXJ 3S2HJ 1YJWI 3QPSA 3ECHA 3SEZA 3KEQA 2L5QA 3QU3A 1PP7U 3L2QA 2EFQA 4ENJA 2RKHA 3NXCA 4U0WA 4I6ZA 5HDKA 3RKWA 3CMAI 3CJTB 1WI9A 2NS7A 3HRMA 1I6XA 2FSWA 1NHAA 2XIGA 3K2ZA 4GDFA 2WA0A 3F1BA 4JNNA 4YIRX 3QU6A 2K40A 3ABMH 3O6BB 5H6RA 3JRIA 1A6QA 4B47A 5J40A 3NQOA 1XSDA 3BZ6A 3T8RA 1O3RA 1YX5A 1WSUA 4O6JA 4EJVA 3HOWJ 3VOXA 3OIOA 3KIOA 5IYCJ 2RASA 2VKDA 5KVRA 4FT8A 2DN0A 5K5RA 3VW0A 3K4LA 1R1UA 2NS8A 3QKXA 2OQGA 3FDYA 3ML6A 4JKZA 4PGGA 2CYYA 1Z77A 3OSFA 2QQ8A 4CHUA 4XLAA 4DYQA 3FXKA 1ZRCA 2EV5A 4NB5A 4FE7A 5B1BH 1BBYA 5DUKA 4WWCA 2YUSA 2P0WA 1U6GA 4GRIA 2Z1DA 5CKTA 3ABUA 4IHVA 1KZHA 5LRRA 5J4YA 3TKYA 3K4MA 4ENKA 2L7ZA 2E1OA 1ZKGA 2H6CA 1MD0A 2BXYA 2O3FA 3CP8A 2DA4A 3V78A 1U5TC 2MSYA 3BR1A 2LF8A 2OU2A 3L2WA 2DMPA 1J7KA 2EA4A 1FTZA 5FMPA 3U21A 3DCFA 3OL3A 2Y75A 3ISPA 3QP6A 2RV8A 4A0YA 3IC7A 4EVIA 2PMHA 3KLOA 5M5YJ 2Z5UA 3ANGA 3EUHA 1X3ZB 1QZYA 1T39A 2IGOA 2XAUA 4IRVA 3E5XA 2K3FA 4XM3A 3W3CA 2UXPA 3NPIA 5CLSA 2V6EA 2P5KA 1TWAJ 4XIDA 4UVBA 1LDJA 2HOAA 1OJLA 4CCMA 2VBZA 3WU1B 2MH9A 5L3CA 1D8KA 1JUMA 3Q0VA 3ASOH 4II3A 1BN5A 3ZP5A 1WGXA 5TRDA 1HKTA 1R36A 1TTYA 4E70A 2ICWG 2XVCA 2RNGA 1MNEA 4NNJA 4XRFA 3NARA 4J01A 2EFPA 2BY0A 5AQCA 5FROA 3HRSA 2PJRA 4I0AA 1K79A 2EZLA 5D19A 3Q5FA 2XPVA 2XV4S 4DBQA 1SFEA 3I58A 2XROA 5D6FA 1BJAA 1USTA 1YIOA 1OCCH 3N97A 2CUZA 2VB6A 3KZYA 3WTTC 4HKUA 3LL7A 3CO6C 1M1EB 4ENNA 1WJFA 1F36A 2A07F 5E1ZB 2V1XA 4UVAA 5CVUA 2KRFA 2MW8A 3CDHA 4I76A 2EIMH 2DA3A 3J80K 1KA8A 1SFXA 2YU3A 3G71I 1FOYA 4CO8A 3O8GA 3DU6A 3K0LA 2PG4A 4ZH4F 2XF6A 5K1YA 1C0WA 3K1MA 2IGNA 2OI8A 2KZVA 3HTJA 2IA2A 2M0CA 4HV6A 1ZHFA 2NOJB 1BOAA 2VJ5A 2DFEA 3JRDA 1AOYA 4IHXA 2NVTJ 3MWMA 4G7HF 2IA1A 1I27A 3MD2A 1W0UA 3F6OA 2OERA 3I54A 2HYFA 3D0SA 5H6QA 1FYKA 1DPUA 1VNDA 1X1AA 1MMAA 4KT5C 4AYBN 3ZGKA 3BLYA 2VQHA 3PO3J 1IXCA 3K4CA 2CMPA 4XLEA 4QLCU 1Z91A 1LVAA 1X58A 2QZ8A 2UZKA 3HPGA 2EK5A 4XN3A 4U7DA 5IPAA 5FJ8J 4O5VA 5J1RA 1XC5A 5IYBJ 1OISA 1MSFC 3LJLA 5D5WB 1T6SA 5HNHA 3MKZA 2LC2A 2ZXJA 2R7OA 1VQ8I 5LGTA 3LSGA 2QWWA 4HLXA 2HI3A 2GAUA 5BQTA 1R5GA 1FP2A 3GZ5A 3AL0C 4L18B 2QEXI 2GUHA 4GFLA 1XGSA 1DU6A 5HSZA 1YTYA 2JA5J 2EZHA 5BS6A 4ZC3A 3OOUA 1IUFA 2QKOA 3ECOA 1HA8A 4JYKA 5EGOB 3ZCOA 3CMEI 5EFYA 1LFUP 4IRIA 2FUG2 1YYVA 1QU3A 2O9LA 4HF2A 1DGRM 2EINH 4E7SA 2PJPA 1YW9A 3KYDB 1QZEA 2KISA 3LA7A 1MIJA 3L2UA 4E7KA 1F4KA 1YRNB 2G3BA 4PGHA 4IHSA 1B4AA 4KICA 3B02A 5E1WA 3VYRB 4HOBA 5FFXA 2JRMA 2BOLA 4EEFG 2RVCA 4CYCA 5B5EC 3CCQI 2P7VB 3P7NA 2M3AA 1P2FA 1GT0C 3H92A 1HKQA 2PFBA 1KU9A 2K86A 2V1UA 3TP3A 2Z9OA 1WJBA 2O0YA 3EQLF 1FIPA 1FSEA 1JT6A 1TC3C 1N78A 4XNFA 2H1LA 4WXHA 3Q9SA 2ZJ2A 4GXOA 4MQVA 3JSOA 3BQYA 2P5LC 2ESNA 4HPQA 3S14J 4X6AJ 1OCRH 3H0GJ 3MEXA 1GDTA 2XDVA 2VXDA 3RYPA 1BA5A 1XSVA 3W6KB 1BI1A 2A5WA 4XLPF 5CPRB 1EJ9A 2P6SA 4ZDPA 3PL8A 1AA7A 2UUZA 1FBQA 3K2AA 2KIFA 2Q24A
chains in the Genus database with same CATH topology
1POGA 1Y1VJ 5IP7J 3V6GA 1XG1A 2VKEA 1HOMA 2Y31A 3S1RJ 3GTJJ 2DA5A 2K9SA 3IUVA 3FKIJ 4QIWN 1IC8A 2EH3A 2WAQN 3O8HA 1UMQA 3RZDJ 2NP3A 3GZIA 2NOGA 3VOKA 2AO9A 3HKZN 3ZQHA 4GFKA 2ME6A 4JP0A 2QCOA 3FRQA 3ZQIA 3CCYA 4NDLA 2ID3A 5GP9A 4X1EA 3HM5A 1VFCA 1GUUA 1U78A 2HOTA 3ANPA 4DYCA 2NVYJ 3GEUA 2IAIA 3AQTA 5E3NA 1QVUA 2YU9J 1U9OA 4GCTA 4GCKA 4C3JJ 1APLC 2CUEA 4ABZA 1IDZA 4LOCA 1LFBA 3HOZJ 3G1LA 3DPJA 2M34A 1MBKA 1ZTRA 2HOSA 5CXGA 5IOZA 2ZOYA 3CJDA 3M3YJ 1BJZA 2LVSA 2QIBA 2JWTA 5C4XJ 3BG9A 3ZOBA 1JKOC 1QPIA 2Y9YA 4A3JJ 3BNIA 2HXOA 2MGQA 2L0KA 3FISA 1WPKA 4GFBA 3C07A 1GV2A 3HOXJ 2XSDC 4DZJA 3BT9A 3QPLA 2JK3A 2JJ7A 2I10A 3SFIA 4D5CA 1FIAA 4XRSA 4W1UA 2AHQA 1FJLA 5JLXA 3HOVJ 2X9DA 1SGMA 5K58A 2TRTA 4FE4A 5EEAA 2L9RA 4QSHA 5F0HA 2E19A 4M6VA 2DTZA 4IEJA 5K7ZA 1PUFA 1F43A 3G56A 3O60A 4UUSB 2RHAA 1MBFA 1UG2A 1MH3A 1RETA 1K83J 3MKLA 3LSJA 3HEFA 3EUPA 1AKHA 3BHQA 1EF4A 3A02A 4M3FA 1MNMC 2B63J 1WH7A 5FHPA 4AUXA 1GV5A 4RBOA 4A3DJ 1JUSA 3HGYA 3GTGJ 3T6NA 1RKTA 2X6OA 1HDDC 3GTQJ 2F07A 2NVQJ 3COLA 2YVEA 4QTRA 1ZQ3P 1FEXA 4KWAA 5IOYA 2XGDA 3Q0UA 2COBA 2QWTA 1MBHA 3LWJA 3GTKJ 4C2MJ 1VI0A 1BW5A 2PZ9A 2LKXA 1LE8A 5D1RA 4NELA 2KDZA 4S0HB 1FTTA 3HTHA 1H8AC 1MBEA 1K61A 2Y30A 2XGEA 4L62A 1DU0A 3B6CA 4BBSJ 4MK6A 4A3EJ 3FIWA 3GBGA 4HNVA 1Z0XA 3ON2A 2DG7A 2ZB9A 3B6AA 4MLOA 3S1MJ 1ZK8A 2L7MP 5FLVA 4XRSG 1NK3P 5EYRA 3VIBA 2UXOA 4A3CJ 2DMUA 3JRGA 1MSEC 2FBQA 1IJWC 3JRHA 3I4NJ 1I6HJ 2XB0X 2R7ZJ 4IHYA 3KKDA 2VKVA 5D18A 2RAEA 1IV6A 2FD5A 5CXIA 5DAJA 3TW7A 5K7FA 2WB1N 5FGLA 4ME9A 1JKPC 2Y0SN 4M3DA 1OCTC 2E2HJ 5C4JJ 3NI7A 4BY1J 1ENHA 1MH4A 2CRGA 3W6VA 5DTDA 1RR7A 3F0CA 1ETQA 1AKHB 1WI3A 2WV1A 2LR8A 3RQIA 1U9NA 4MO7A 3AQSA 1HDPA 5M5XJ 2DA1A 1MBGA 2DMTA 5EZHA 1RPWA 2H1KA 2PBXA 2N8GA 1A5JA 2G7LA 2REKA 2XRLA 5HODA 2ZOZA 1ETKA 1NTCA 1S7EA 2R92J 2KT0A 3ZQGA 1WH5A 3BQZA 3LSPA 2W53A 5FKNA 4UDSA 2ZCMA 3VP5A 4B4CA 2ELKA 4MFDA 5E3MA 2JMWA 1ZR2A 2DA7A 2VUMJ 2R5YA 4D7NA 9ANTA 2XDNA 3UKGA 5HAWA 3Q3SA 5EG0B 1UI5A 4BXXJ 3S2HJ 1ZGWA 3HDDA 3HGGA 4A3GJ 1WCMJ 2OPTA 3QPSA 4D7MA 4G12A 2LLKA 1JGGA 2O7OA 2P81A 1IDYA 2DMNA 3JRFA 3JRAA 3NXCA 1ETOA 3CMYA 2D5VA 2HYTA 4AC6A 3NAUA 4I6ZA 5BNGA 3LOCA 4V2GA 3A01B 2G7GA 2WGBA 2NS7A 3JR9A 4CYCB 2H8RA 3F1BA 2QTQA 4JNNA 2M9HA 4JX6A 4BBRJ 2K40A 3RZOJ 2IU5A 3NRGA 3MN2A 3JRIA 1ETYA 4DZPA 5C44J 3C2BA 2LK2A 5IP6A 5FKOA 3HOWJ 3VOXA 3OIOA 2XB5A 2JA6J 5IYCJ 2HKUA 2RASA 2QF7A 2R5ZB 5HBUA 3OSGA 1HF0A 2DN0A 4XICA 2HDDA 3S17J 2YS9A 3S15J 3VW0A 2NS8A 3LHQA 3QKXA 4JKZA 1I3QJ 5CW8A 2Y2ZA 3E7LA 3L1PA 1Z77A 3OSFA 3TP0A 2X48A 4DYQA 4A3FJ 2W48A 1RESA 3MNLA 4FE7A 1IGNA 2YUSA 5FLMJ 3KNWA 2JA7J 2R5ZA 1X2NA 1W0TA 1X2MA 2LY9A 2ZCXA 2LTPA 2PMZN 5JLWA 3K7AJ 4IHVA 2K9QA 1XS9A 3HBLA 3HTIA 2L7ZA 2E1OA 1ZKGA 4ICHA 1OCPA 4JX5A 4C3HJ 1JKQC 2E2IJ 3VVZA 4J19A 2DA4A 1VF9A 2MSYA 3BR1A 1JJ6C 3V78A 1YRNA 2CUFA 3BR6A 2DMPA 5C4YA 2M2EA 5F08A 5J1UA 3HE0A 3BR3A 1T33A 1FTZA 2CU7A 5FMPA 3DCFA 5FKKA 1ZR4A 3IH4A 4UUSA 2IEKA 3PASA 2L7FP 1PUFB 1A6IA 1MBJA 3S1NJ 3KKCA 3P9TA 1RKWA 5M5YJ 2JN6A 1B8IB 1JKRC 3ANGA 1CQTA 1TWFJ 5F0CA 5EZGA 5EG0A 3VW2A 2LFBA 1HCRA 5EDNA 2R5YB 1ORKA 1UI6A 2UXPA 3NPIA 1TWAJ 4XIDA 3VW1A 2HOAA 2GFNA 3SJMA 1OJLA 1R9TJ 3NNRA 2V57A 3Q0VA 1JUMA 2CJJA 2NP5A 4CGRA 4A69C 1WGXA 3HB9A 2NX4A 2NVXJ 3NARA 1SFOJ 5GPCA 3I4MJ 4MFEA 3IV5A 2ECBA 5EF6A 3LSRA 3GTOJ 5AQCA 3RKQA 4IHWA 2UXHA 4XK4A 2EZLA 5D19A 1ETXA 2LD5A 1Q1VA 2XPVA 1LE8B 4NN1A 5H9TA 3PM1A 4JX4A 4FTHA 2VPRA 1G2HA 3RH2A 2FJ1A 2XPWA 2YVHA 2Y9ZA 4AF5A 1B72B 3S2DJ 1AHDP 4HKUA 2XGCA 3G1MA 1F36A 4C3IJ 2GM4A 2HYJA 1TWCJ 1TWGJ 2MW8A 3A03A 3DEWA 1D5YA 2UXIA 4I76A 1SANA 2DA3A 4B1RA 4A93J 5J3LA 3BR0A 4JL3A 3QBMA 4A3BJ 4MXMA 1ETVA 2CQXA 3O8GA 4A3KJ 1JT0A 4ACIA 2UXUA 5M3MJ 2OI8A 3B81A 3BTJA 2R93J 3HTJA 2M0CA 5F0FA 2EZKA 2G7SA 1I50J 1JUPA 2XPUA 5K7HA 3JRDA 3GTPJ 2OF7A 5E3LA 2EZIA 4BKXA 1P7JA 4IHXA 2NVTJ 2OERA 1W0UA 1OFCX 2ID6A 3EGQA 1VNDA 1NK2P 2DMQA 3PO2J 1GVDA 3SDGA 1B72A 2GENA 3S1QJ 4AYBN 2R0QC 5IP9J 3RD3A 2TCTA 2DG8A 3CWRA 3PO3J 2GBYA 3H3VK 4FISA 2FX0A 3BCGA 1X58A 5FKLA 1O4XA 2EBIA 1QRYA 3GTLJ 3HOUJ 3BTCA 5M5WJ 1H88C 5IPAA 5FJ8J 3VVYA 5J1RA 1XC5A 2ECCA 5IYBJ 3WHCA 4UUTA 1MSFC 4W97A 4XRMA 3LJLA 3BG5A 1P7IA 5DS9A 4B3AA 2E2JJ 3BJBA 2JA8J 4YZEA 3VVXA 3IH2A 3Q0WA 3LSGA 4L5EA 3TW6A 2M8GX 3BRUA 2LP0A 3ZQLA 2D6YA 3S16J 2HI3A 3QQAA 2ZCNA 4FCYA 4GFLA 3VPRA 2CQQA 3BG3A 4D5FA 1DU6A 2GUHA 3VUQA 5HSZA 3LNQA 1TWHJ 3BTLA 1AU7A 2HXIA 2HQ5A 2K9NA 2JA5J 2EZHA 5F27A 3OOUA 1IUFA 4DYRA 3BR5A 2QKOA 4PXIA 5M3FJ 4JYKA 2DJNA 3M4OJ 5EGOB 4BY7J 5EFYA 1LFUP 4Y52J 4RDUA 2FQ4A 1E3OC 2MG4A 2O9LA 1JJ8C 3D1NI 4M3GA 1ETWA 4Y7NJ 3CDLA 2DA2A 4A3IJ 5IYDJ 4AC0A 3HTAA 4DW6A 1YRNB 3ZQFA 2G3BA 3BR2A 4A3MJ 5GPAA 5J1YA 5F1JA 3FK6A 1Y1WJ 3MVPA 3WHBA 3G7RA 4EEFG 4CYCA 1U8BA 3IH3A 3S5RA 3JRCA 1B8IA 3A01A 1UHSA 1GT0C 3CQZJ 5E3OA 4V2FA 3FK7A 3E7QA 3KZ9A 2GLOA 3TP3A 1QVTA 3GTMJ 1FIPA 1IRZA 3PPBA 3HOYJ 2IBDA 2DA6A 3G1OA 1JT6A 1TC3C 2ME0A 3JSJA 4A3LJ 2G0EA 1HLVA 4GCLA 5FKMA 2QOPA 1IG7A 3TEDA 3HIMA 3BQYA 5F04A 5EGOA 1H89C 3S14J 4X6AJ 3BTIA 4M3BA 3JREA 1ITYA 3H0GJ 2WUIA 4MIMA 1GDTA 2VI6A 1BA5A 3JRBA 4M3EA 2O8KA 5C3EJ 1BL0A 3CRJA 1JTXA 1JTYA 1T56A 1BW6A 2EQRA 3K2AA 3ZQCA 3ON4A 2O7TA 2Q24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POG A;  1Y1V J;  5IP7 J;  3V6G A;  1XG1 A;  2VKE A;  1HOM A;  2Y31 A;  3S1R J;  3GTJ J;  2DA5 A;  2K9S A;  3IUV A;  3FKI J;  4QIW N;  1IC8 A;  2EH3 A;  2WAQ N;  3O8H A;  1UMQ A;  3RZD J;  2NP3 A;  3GZI A;  2NOG A;  3VOK A;  2AO9 A;  3HKZ N;  3ZQH A;  4GFK A;  2ME6 A;  4JP0 A;  2QCO A;  3FRQ A;  3ZQI A;  3CCY A;  4NDL A;  2ID3 A;  5GP9 A;  4X1E A;  3HM5 A;  1VFC A;  1GUU A;  1U78 A;  2HOT A;  3ANP A;  4DYC A;  2NVY J;  3GEU A;  2IAI A;  3AQT A;  5E3N A;  1QVU A;  2YU9 J;  1U9O A;  4GCT A;  4GCK A;  4C3J J;  1APL C;  2CUE A;  4ABZ A;  1IDZ A;  4LOC A;  1LFB A;  3HOZ J;  3G1L A;  3DPJ A;  2M34 A;  1MBK A;  1ZTR A;  2HOS A;  5CXG A;  5IOZ A;  2ZOY A;  3CJD A;  3M3Y J;  1BJZ A;  2LVS A;  2QIB A;  2JWT A;  5C4X J;  3BG9 A;  3ZOB A;  1JKO C;  1QPI A;  2Y9Y A;  4A3J J;  3BNI A;  2HXO A;  2MGQ A;  2L0K A;  3FIS A;  1WPK A;  4GFB A;  3C07 A;  1GV2 A;  3HOX J;  2XSD C;  4DZJ A;  3BT9 A;  3QPL A;  2JK3 A;  2JJ7 A;  2I10 A;  3SFI A;  4D5C A;  1FIA A;  4XRS A;  4W1U A;  2AHQ A;  1FJL A;  5JLX A;  3HOV J;  2X9D A;  1SGM A;  5K58 A;  2TRT A;  4FE4 A;  5EEA A;  2L9R A;  4QSH A;  5F0H A;  2E19 A;  4M6V A;  2DTZ A;  4IEJ A;  5K7Z A;  1PUF A;  1F43 A;  3G56 A;  3O60 A;  4UUS B;  2RHA A;  1MBF A;  1UG2 A;  1MH3 A;  1RET A;  1K83 J;  3MKL A;  3LSJ A;  3HEF A;  3EUP A;  1AKH A;  3BHQ A;  1EF4 A;  3A02 A;  4M3F A;  1MNM C;  2B63 J;  1WH7 A;  5FHP A;  4AUX A;  1GV5 A;  4RBO A;  4A3D J;  1JUS A;  3HGY A;  3GTG J;  3T6N A;  1RKT A;  2X6O A;  1HDD C;  3GTQ J;  2F07 A;  2NVQ J;  3COL A;  2YVE A;  4QTR A;  1ZQ3 P;  1FEX A;  4KWA A;  5IOY A;  2XGD A;  3Q0U A;  2COB A;  2QWT A;  1MBH A;  3LWJ A;  3GTK J;  4C2M J;  1VI0 A;  1BW5 A;  2PZ9 A;  2LKX A;  1LE8 A;  5D1R A;  4NEL A;  2KDZ A;  4S0H B;  1FTT A;  3HTH A;  1H8A C;  1MBE A;  1K61 A;  2Y30 A;  2XGE A;  4L62 A;  1DU0 A;  3B6C A;  4BBS J;  4MK6 A;  4A3E J;  3FIW A;  3GBG A;  4HNV A;  1Z0X A;  3ON2 A;  2DG7 A;  2ZB9 A;  3B6A A;  4MLO A;  3S1M J;  1ZK8 A;  2L7M P;  5FLV A;  4XRS G;  1NK3 P;  5EYR A;  3VIB A;  2UXO A;  4A3C J;  2DMU A;  3JRG A;  1MSE C;  2FBQ A;  1IJW C;  3JRH A;  3I4N J;  1I6H J;  2XB0 X;  2R7Z J;  4IHY A;  3KKD A;  2VKV A;  5D18 A;  2RAE A;  1IV6 A;  2FD5 A;  5CXI A;  5DAJ A;  3TW7 A;  5K7F A;  2WB1 N;  5FGL A;  4ME9 A;  1JKP C;  2Y0S N;  4M3D A;  1OCT C;  2E2H J;  5C4J J;  3NI7 A;  4BY1 J;  1ENH A;  1MH4 A;  2CRG A;  3W6V A;  5DTD A;  1RR7 A;  3F0C A;  1ETQ A;  1AKH B;  1WI3 A;  2WV1 A;  2LR8 A;  3RQI A;  1U9N A;  4MO7 A;  3AQS A;  1HDP A;  5M5X J;  2DA1 A;  1MBG A;  2DMT A;  5EZH A;  1RPW A;  2H1K A;  2PBX A;  2N8G A;  1A5J A;  2G7L A;  2REK A;  2XRL A;  5HOD A;  2ZOZ A;  1ETK A;  1NTC A;  1S7E A;  2R92 J;  2KT0 A;  3ZQG A;  1WH5 A;  3BQZ A;  3LSP A;  2W53 A;  5FKN A;  4UDS A;  2ZCM A;  3VP5 A;  4B4C A;  2ELK A;  4MFD A;  5E3M A;  2JMW A;  1ZR2 A;  2DA7 A;  2VUM J;  2R5Y A;  4D7N A;  9ANT A;  2XDN A;  3UKG A;  5HAW A;  3Q3S A;  5EG0 B;  1UI5 A;  4BXX J;  3S2H J;  1ZGW A;  3HDD A;  3HGG A;  4A3G J;  1WCM J;  2OPT A;  3QPS A;  4D7M A;  4G12 A;  2LLK A;  1JGG A;  2O7O A;  2P81 A;  1IDY A;  2DMN A;  3JRF A;  3JRA A;  3NXC A;  1ETO A;  3CMY A;  2D5V A;  2HYT A;  4AC6 A;  3NAU A;  4I6Z A;  5BNG A;  3LOC A;  4V2G A;  3A01 B;  2G7G A;  2WGB A;  2NS7 A;  3JR9 A;  4CYC B;  2H8R A;  3F1B A;  2QTQ A;  4JNN A;  2M9H A;  4JX6 A;  4BBR J;  2K40 A;  3RZO J;  2IU5 A;  3NRG A;  3MN2 A;  3JRI A;  1ETY A;  4DZP A;  5C44 J;  3C2B A;  2LK2 A;  5IP6 A;  5FKO A;  3HOW J;  3VOX A;  3OIO A;  2XB5 A;  2JA6 J;  5IYC J;  2HKU A;  2RAS A;  2QF7 A;  2R5Z B;  5HBU A;  3OSG A;  1HF0 A;  2DN0 A;  4XIC A;  2HDD A;  3S17 J;  2YS9 A;  3S15 J;  3VW0 A;  2NS8 A;  3LHQ A;  3QKX A;  4JKZ A;  1I3Q J;  5CW8 A;  2Y2Z A;  3E7L A;  3L1P A;  1Z77 A;  3OSF A;  3TP0 A;  2X48 A;  4DYQ A;  4A3F J;  2W48 A;  1RES A;  3MNL A;  4FE7 A;  1IGN A;  2YUS A;  5FLM J;  3KNW A;  2JA7 J;  2R5Z A;  1X2N A;  1W0T A;  1X2M A;  2LY9 A;  2ZCX A;  2LTP A;  2PMZ N;  5JLW A;  3K7A J;  4IHV A;  2K9Q A;  1XS9 A;  3HBL A;  3HTI A;  2L7Z A;  2E1O A;  1ZKG A;  4ICH A;  1OCP A;  4JX5 A;  4C3H J;  1JKQ C;  2E2I J;  3VVZ A;  4J19 A;  2DA4 A;  1VF9 A;  2MSY A;  3BR1 A;  1JJ6 C;  3V78 A;  1YRN A;  2CUF A;  3BR6 A;  2DMP A;  5C4Y A;  2M2E A;  5F08 A;  5J1U A;  3HE0 A;  3BR3 A;  1T33 A;  1FTZ A;  2CU7 A;  5FMP A;  3DCF A;  5FKK A;  1ZR4 A;  3IH4 A;  4UUS A;  2IEK A;  3PAS A;  2L7F P;  1PUF B;  1A6I A;  1MBJ A;  3S1N J;  3KKC A;  3P9T A;  1RKW A;  5M5Y J;  2JN6 A;  1B8I B;  1JKR C;  3ANG A;  1CQT A;  1TWF J;  5F0C A;  5EZG A;  5EG0 A;  3VW2 A;  2LFB A;  1HCR A;  5EDN A;  2R5Y B;  1ORK A;  1UI6 A;  2UXP A;  3NPI A;  1TWA J;  4XID A;  3VW1 A;  2HOA A;  2GFN A;  3SJM A;  1OJL A;  1R9T J;  3NNR A;  2V57 A;  3Q0V A;  1JUM A;  2CJJ A;  2NP5 A;  4CGR A;  4A69 C;  1WGX A;  3HB9 A;  2NX4 A;  2NVX J;  3NAR A;  1SFO J;  5GPC A;  3I4M J;  4MFE A;  3IV5 A;  2ECB A;  5EF6 A;  3LSR A;  3GTO J;  5AQC A;  3RKQ A;  4IHW A;  2UXH A;  4XK4 A;  2EZL A;  5D19 A;  1ETX A;  2LD5 A;  1Q1V A;  2XPV A;  1LE8 B;  4NN1 A;  5H9T A;  3PM1 A;  4JX4 A;  4FTH A;  2VPR A;  1G2H A;  3RH2 A;  2FJ1 A;  2XPW A;  2YVH A;  2Y9Z A;  4AF5 A;  1B72 B;  3S2D J;  1AHD P;  4HKU A;  2XGC A;  3G1M A;  1F36 A;  4C3I J;  2GM4 A;  2HYJ A;  1TWC J;  1TWG J;  2MW8 A;  3A03 A;  3DEW A;  1D5Y A;  2UXI A;  4I76 A;  1SAN A;  2DA3 A;  4B1R A;  4A93 J;  5J3L A;  3BR0 A;  4JL3 A;  3QBM A;  4A3B J;  4MXM A;  1ETV A;  2CQX A;  3O8G A;  4A3K J;  1JT0 A;  4ACI A;  2UXU A;  5M3M J;  2OI8 A;  3B81 A;  3BTJ A;  2R93 J;  3HTJ A;  2M0C A;  5F0F A;  2EZK A;  2G7S A;  1I50 J;  1JUP A;  2XPU A;  5K7H A;  3JRD A;  3GTP J;  2OF7 A;  5E3L A;  2EZI A;  4BKX A;  1P7J A;  4IHX A;  2NVT J;  2OER A;  1W0U A;  1OFC X;  2ID6 A;  3EGQ A;  1VND A;  1NK2 P;  2DMQ A;  3PO2 J;  1GVD A;  3SDG A;  1B72 A;  2GEN A;  3S1Q J;  4AYB N;  2R0Q C;  5IP9 J;  3RD3 A;  2TCT A;  2DG8 A;  3CWR A;  3PO3 J;  2GBY A;  3H3V K;  4FIS A;  2FX0 A;  3BCG A;  1X58 A;  5FKL A;  1O4X A;  2EBI A;  1QRY A;  3GTL J;  3HOU J;  3BTC A;  5M5W J;  1H88 C;  5IPA A;  5FJ8 J;  3VVY A;  5J1R A;  1XC5 A;  2ECC A;  5IYB J;  3WHC A;  4UUT A;  1MSF C;  4W97 A;  4XRM A;  3LJL A;  3BG5 A;  1P7I A;  5DS9 A;  4B3A A;  2E2J J;  3BJB A;  2JA8 J;  4YZE A;  3VVX A;  3IH2 A;  3Q0W A;  3LSG A;  4L5E A;  3TW6 A;  2M8G X;  3BRU A;  2LP0 A;  3ZQL A;  2D6Y A;  3S16 J;  2HI3 A;  3QQA A;  2ZCN A;  4FCY A;  4GFL A;  3VPR A;  2CQQ A;  3BG3 A;  4D5F A;  1DU6 A;  2GUH A;  3VUQ A;  5HSZ A;  3LNQ A;  1TWH J;  3BTL A;  1AU7 A;  2HXI A;  2HQ5 A;  2K9N A;  2JA5 J;  2EZH A;  5F27 A;  3OOU A;  1IUF A;  4DYR A;  3BR5 A;  2QKO A;  4PXI A;  5M3F J;  4JYK A;  2DJN A;  3M4O J;  5EGO B;  4BY7 J;  5EFY A;  1LFU P;  4Y52 J;  4RDU A;  2FQ4 A;  1E3O C;  2MG4 A;  2O9L A;  1JJ8 C;  3D1N I;  4M3G A;  1ETW A;  4Y7N J;  3CDL A;  2DA2 A;  4A3I J;  5IYD J;  4AC0 A;  3HTA A;  4DW6 A;  1YRN B;  3ZQF A;  2G3B A;  3BR2 A;  4A3M J;  5GPA A;  5J1Y A;  5F1J A;  3FK6 A;  1Y1W J;  3MVP A;  3WHB A;  3G7R A;  4EEF G;  4CYC A;  1U8B A;  3IH3 A;  3S5R A;  3JRC A;  1B8I A;  3A01 A;  1UHS A;  1GT0 C;  3CQZ J;  5E3O A;  4V2F A;  3FK7 A;  3E7Q A;  3KZ9 A;  2GLO A;  3TP3 A;  1QVT A;  3GTM J;  1FIP A;  1IRZ A;  3PPB A;  3HOY J;  2IBD A;  2DA6 A;  3G1O A;  1JT6 A;  1TC3 C;  2ME0 A;  3JSJ A;  4A3L J;  2G0E A;  1HLV A;  4GCL A;  5FKM A;  2QOP A;  1IG7 A;  3TED A;  3HIM A;  3BQY A;  5F04 A;  5EGO A;  1H89 C;  3S14 J;  4X6A J;  3BTI A;  4M3B A;  3JRE A;  1ITY A;  3H0G J;  2WUI A;  4MIM A;  1GDT A;  2VI6 A;  1BA5 A;  3JRB A;  4M3E A;  2O8K A;  5C3E J;  1BL0 A;  3CRJ A;  1JTX A;  1JTY A;  1T56 A;  1BW6 A;  2EQR A;  3K2A A;  3ZQC A;  3ON4 A;  2O7T A;  2Q24 A; 
#chains in the Genus database with same CATH topology
 2VL8 A;  1VZ0 A;  2W25 A;  3OIQ A;  1S9H A;  2Y31 A;  4A2U A;  4B8X A;  3ERE D;  2DA5 A;  2M8E A;  1H9T A;  3IUV A;  1KYZ A;  3FKI J;  2AQF A;  4LLG F;  1IC8 A;  1OYY A;  2WAQ N;  2X51 A;  2ZKZ A;  4ZDL A;  2E71 A;  3NWS A;  5HLH A;  1R7J A;  5D4R A;  2CW8 A;  4Y17 A;  4M71 A;  1KU7 A;  3ZQH A;  3I5U A;  2QCO A;  3MZH A;  3H0D A;  2DOD A;  1UJ8 A;  2F5E A;  5GP9 A;  4X1E A;  1VFC A;  5DD4 A;  4F92 B;  2G7U A;  2DFI A;  2IAI A;  5ICC A;  5E3N A;  1B1B A;  1KQ9 A;  1VQ5 I;  4L0Y B;  2DQR A;  2P6T A;  2CUE A;  4ABZ A;  1VQO I;  2JA2 A;  1F9N A;  3EET A;  3KP7 A;  3BJ6 A;  4G7Z F;  2ZOY A;  3F21 A;  4KMF A;  1LKX A;  1SVO A;  5DYM A;  2E1M C;  2IS6 A;  3K4B A;  2VT2 A;  1PDN C;  5C4X J;  3BG9 A;  4HQM A;  2IJL A;  5L3D A;  3ZOB A;  3OS1 A;  2HXO A;  2MGQ A;  2NAZ A;  3AFH A;  3SEQ A;  3MKW B;  4HSR A;  2OV7 A;  2C6Y A;  4M74 A;  2EFO A;  2I10 A;  4XBF A;  3SFI A;  3H9J A;  3NWT A;  1FIA A;  3HSR A;  2FA5 A;  2MYS A;  5J47 A;  1OMI A;  1SGM A;  4E7J A;  2PFV A;  5K58 A;  4YEL A;  4FE4 A;  4N9H A;  2QSH X;  1UB9 A;  1VQN I;  2UXX A;  3DLA A;  4M6V A;  3W6J B;  1PUF A;  1F43 A;  3G56 A;  3OL4 A;  3CF5 F;  3PQJ A;  3R61 A;  1XTA A;  3GWZ A;  1RET A;  4RMN A;  3RCO A;  5DM7 F;  3HEF A;  3BHQ A;  1EF4 A;  3FXR A;  1RC9 A;  2B63 J;  1L0O C;  5FB2 A;  3HOT A;  4L0Z B;  1GV5 A;  1JUS A;  3N05 A;  3HGY A;  3OYI A;  4XOR A;  1J2X A;  2VN2 A;  4DNC A;  1E3P A;  3COL A;  3BRO A;  5HLG A;  3EYY A;  4QTR A;  2HQN A;  5L3G A;  2R7F A;  1FEX A;  3E5Q A;  1R1V A;  1SD4 A;  4M9X A;  2QWT A;  1MBH A;  3K10 A;  1ZRF A;  3K4N A;  2CW0 F;  2EIJ H;  4ZTF A;  4IZZ A;  3V8K A;  1YOV B;  4WK8 F;  5D5X B;  4ZZD A;  2VT3 A;  2LNB A;  2VBX A;  2LY2 A;  3K9T A;  3HTH A;  1K61 A;  3H1C A;  5GAE J;  4BXU A;  2BV6 A;  4NQW B;  4HNV A;  4BYY A;  5LHG A;  3A1Y A;  3ZMZ A;  2L7M P;  2VC1 A;  2FOK A;  3LA3 A;  1ZN2 A;  1NK3 P;  5EYR A;  1IN4 A;  5LEJ A;  4BNC A;  2UXO A;  3ABK H;  1MSE C;  2FBQ A;  1IJW C;  2I8D A;  2WB1 A;  4MTE A;  1ACI A;  4B09 A;  1FOX A;  3S3M A;  1I6H J;  2HPM A;  3BZC A;  2R7Z J;  3RDI A;  2VKV A;  4RLF A;  4CCJ A;  4U88 A;  3JAM Z;  1H0M A;  5D18 A;  1NG6 A;  1Y8Q B;  3S8P A;  2CFO A;  2ZXH A;  3A0H C;  3HHH A;  2HZD A;  5KAI C;  3LWF A;  4MHG A;  3TW7 A;  3EPZ A;  3GFM A;  2OZ6 A;  2ZC2 A;  2E34 A;  3E6D A;  2Y0S N;  2VXZ A;  1QBJ A;  1ENH A;  2CRG A;  4HRI A;  3W6V A;  4UY8 I;  2FBI A;  5DTD A;  3JCU C;  1W1W E;  1ETQ A;  1Z6R A;  4OIP F;  2LR8 A;  3RQI A;  3G4S I;  2DTR A;  2K85 A;  1U0J A;  5DV5 A;  4AIK A;  2VE8 A;  5FO5 A;  2F2E A;  2H1K A;  4RB0 A;  1A5J A;  2REK A;  2XRL A;  2XAQ A;  2M7B A;  1NTC A;  1S7E A;  1WRJ A;  2KT0 A;  4RGR A;  3L7W A;  3BQZ A;  1SAX A;  1Z05 A;  5D8L B;  1VTN C;  3VP5 A;  3AL0 B;  2ELK A;  2MAB A;  1FLI A;  4EM0 B;  2O6G E;  3D5S C;  1V5E A;  4CUG A;  4KJZ A;  2VUM J;  4D7N A;  2DFF A;  2XDN A;  3UKG A;  3HJE A;  1UI5 A;  3IRQ A;  2H6B A;  5LGN A;  3HGG A;  4GCV A;  1I1S A;  4D7M A;  1R6R A;  1JGG A;  1UZC A;  2M5W A;  1ETO A;  3FXJ A;  3I64 A;  4RB1 A;  1X4O A;  2D5V A;  2V79 A;  2HYT A;  3NAU A;  1IUY A;  5ERI A;  4AU7 A;  2IRF G;  5D6E A;  1ZG1 A;  1YX3 A;  2EA2 A;  4H4K C;  3OYK A;  4AVP A;  4X0G A;  2H8R A;  3LFK A;  5HDN A;  1HKS A;  5HNF A;  4JX6 A;  4KIB A;  4BBR J;  2BHY A;  5JFR A;  1YI2 I;  2UWM A;  4D9J A;  3NRG A;  2QVO A;  4BQA A;  3SFZ A;  4IJA A;  5BPD A;  4JOM A;  3C2B A;  5DCM A;  3M8J A;  5IP6 A;  3E1S A;  3LSM A;  5FKO A;  3J81 Z;  1KYW A;  1GXP A;  4KDP A;  2R5Z B;  5HBU A;  5ICG A;  3V8J A;  1K4T A;  1HF0 A;  1Y0U A;  1Y0N A;  1Z9C A;  5EJC A;  3SYT A;  2KPM A;  2JZY A;  2IP2 A;  1ZGJ A;  3K4K A;  3TDZ C;  5CW8 A;  2QKL B;  4OIN F;  1LJ9 A;  1VQK I;  3DV8 A;  2K9M A;  1X3W B;  3TP0 A;  4BJT A;  3LA2 A;  4E4H A;  2X48 A;  4A3F J;  1G3T A;  1RES A;  4DOZ A;  3FBN B;  4M6X A;  4G9Y A;  2VKH A;  2JA7 J;  1WJD A;  1W0T A;  1FMV A;  1X2M A;  2DFH A;  5JLW A;  3HBL A;  1K78 B;  3HTI A;  1YIT I;  4JX5 A;  4C3H J;  5FRN A;  4KYW A;  1JKQ C;  5ICF A;  2E2I J;  3P9K A;  2OJE D;  2GIV A;  1JJ6 C;  1MKM A;  6PAX A;  3GX4 X;  4G94 A;  2L2O A;  3VSK A;  3BR6 A;  3S3O A;  5C4Y A;  2FEZ A;  2M2E A;  4LG0 A;  1NG7 A;  3E6C C;  2V9P A;  2GIZ A;  3I71 A;  3LFU A;  4ENM A;  3VTI A;  2IEK A;  4BJ6 C;  2D2W A;  1A6I A;  1MBJ A;  3KKC A;  3DQV C;  4ASN A;  3P9T A;  5D5V B;  3WU0 A;  1K6O A;  2M87 A;  2DW4 A;  1JKR C;  1B8I B;  2VOD A;  3HUG A;  1CQT A;  4KIF A;  5EZG A;  4Q5S F;  2KIQ A;  1FP1 D;  2DQL A;  2PQ8 A;  2LFB A;  2NNY A;  1UI6 A;  3VB2 A;  2STT A;  3VSL A;  1XX5 A;  4IO9 F;  1R9T J;  4P5O A;  5GAG J;  3DBL B;  4CZC A;  3CDI A;  2CJJ A;  1N25 A;  1U5T B;  4AD9 A;  2NX4 A;  2NVX J;  5L3E A;  1BI2 A;  1O57 A;  2ZBK A;  3BG7 A;  4BQN A;  3BPX A;  4P9U A;  2P5V A;  4XK4 A;  1T0F A;  1MJ9 A;  1V4R A;  4LMY A;  1R4N B;  5AON A;  1ETX A;  3FXM A;  1XCV A;  2R4G A;  1LE8 B;  3DU5 A;  3RKX A;  4NN1 A;  4XKV A;  5H9T A;  3CCU I;  2BEO A;  4R1H A;  1G2H A;  2YVH A;  2DAO A;  5D5U B;  3DTK A;  1B72 B;  5FLX Z;  4EV0 A;  3N4M A;  3OYD A;  1D1C A;  1FX7 A;  2XAS A;  2KHM A;  1TWG J;  1D5Y A;  2XSJ C;  1TQI A;  4EJO A;  1SAN A;  5CQG A;  4B1R A;  1SFU A;  3BR0 A;  4XL9 A;  1MDM B;  5K5O A;  1ETV A;  2CS3 A;  4RAZ A;  1X1B A;  5DD8 A;  4CGZ A;  2JTV A;  4LLN A;  3J7A O;  2RDP A;  4BS9 A;  5JHU A;  3PSF A;  3GW2 A;  4Y3O A;  2FOW A;  5F64 A;  2R93 J;  1D8J A;  2ETH A;  3H9G A;  2VJJ A;  1JUP A;  1OQY A;  3IAM 2;  4BKX A;  3FM3 A;  5CVI A;  2PX9 A;  2GXA A;  2MD0 A;  2ID6 A;  1BIA A;  2FF4 A;  2DMQ A;  2E1N A;  1GVD A;  3PO2 J;  3SDG A;  4UVC A;  3I9V 2;  2GEN A;  1U2W A;  3S1Q J;  2KJC A;  1IN6 A;  1UHM A;  3F8C A;  4HX7 A;  3CWR A;  3FXU A;  4K2E A;  4QWQ A;  3CC7 I;  2GBY A;  1JHH A;  4WXC A;  3H3V K;  2FX0 A;  2Z99 A;  3DLL F;  3BCG A;  1R22 A;  3WTV C;  5FKL A;  1K6Y A;  1CF7 A;  2BZT A;  2EBI A;  4LD5 A;  4ZYH A;  1MJB A;  4OOI A;  3BPV A;  1H88 C;  3F8F A;  3BY6 A;  1XSX A;  1R4M B;  3V7R A;  4Y4R A;  4ESJ A;  3B73 A;  3WHC A;  4UUT A;  4W97 A;  4XRM A;  3L2V A;  1SFK A;  2OBP A;  1E0E A;  1P7I A;  4B3A A;  2E2J J;  5FGM A;  3I4P A;  4L9N A;  2IT0 A;  1N75 A;  3FM5 A;  3CP2 A;  3IH2 A;  3C3W A;  3VWB A;  2OAZ A;  4L5E A;  3TW6 A;  2OTJ I;  2ELH A;  3ZRG A;  1S6L A;  2V9K A;  2LP0 A;  2D6Y A;  1YO5 C;  3ZMU A;  4EJW A;  2ZCN A;  3E97 A;  2LBF B;  2B9S A;  3VUQ A;  4D5F A;  3BG3 A;  3SWH A;  2LRE A;  3KEO A;  3L00 A;  3CJR B;  1G6N A;  3BR5 A;  1DUX C;  2BY2 A;  5M3F J;  2DJN A;  1WJA A;  2DBB A;  1HW5 A;  3EUH C;  2ADU A;  3KEY A;  2JSC A;  2FQ4 A;  1E3O C;  4P55 A;  2MG4 A;  4PJL A;  2DI3 A;  2F4I A;  2L9N A;  4Y7N J;  4LG0 B;  2DO7 A;  4R8H A;  2HTS A;  1E3H A;  4EQQ A;  4A3I J;  4AC0 A;  3HTA A;  2EIK H;  1UEL B;  4UXN A;  4DW6 A;  1SVL A;  5BMZ A;  3BR2 A;  1ZRE A;  2JUG A;  5GPA A;  1TNT A;  3WG9 A;  5F1J A;  3FF5 A;  4BH9 A;  1Y1W J;  3MVP A;  3DPL C;  4XSX F;  4HNU A;  3G7R A;  1WHU A;  3QAH A;  2F5F A;  3HXL A;  3M8E A;  3S5R A;  2OCC H;  5ILV A;  4U0Y A;  4BDY A;  3LAJ A;  1G59 A;  3DKX A;  1PVE A;  3FK7 A;  4ZTJ A;  3PUF A;  3DBR B;  3KZ9 A;  4YFX F;  2M0M A;  4LK0 F;  1QVT A;  3HC7 A;  3HOY J;  2OC6 A;  2DA6 A;  3DTI A;  2DLL A;  4IVN A;  5IY5 H;  3JSJ A;  2KIM A;  4A3L J;  2VC0 A;  2G0E A;  5IT9 Z;  4MGR A;  4GCL A;  3ZMT A;  5FKM A;  1JXS A;  3HYI A;  4XLC A;  5F04 A;  3RTR A;  5CYV A;  2OD5 A;  4F7Z A;  1MMS A;  4DBR A;  3HKZ A;  3BTI A;  4II2 A;  2V26 A;  4M3B A;  3CO7 C;  4MEY F;  1ERD A;  1R5I D;  3VOD A;  3ASN H;  4ETS A;  1XGN A;  3ERM A;  3PJR A;  2P7C B;  1LNW A;  1T56 A;  4AID A;  2HTJ A;  3R0A A;  2HEO A;  1I3A A;  1POG A;  4YII A;  1Y1V J;  4XLN F;  1XG1 A;  5J4V A;  1O7L A;  2F48 A;  1DGW Y;  1ZLK A;  2WY7 Q;  5FLX K;  3ESW B;  2KLO A;  4G6D A;  4BXF A;  5E8I A;  3IHU A;  4P96 A;  2A6E F;  3O8H A;  2NP3 A;  3L2R A;  3VOK A;  1FMW A;  4GFK A;  2M1B A;  1XN7 A;  3FRQ A;  4NDL A;  1DDN A;  3SXY A;  4RGU A;  4DYC A;  2BY3 A;  2GZW A;  4HG2 A;  3IL2 A;  2VON A;  2Q8K A;  1FBU A;  2Z33 A;  4KNY A;  1DQU A;  2LDU A;  2VBW A;  4RAG A;  4GCT A;  2KRH A;  3O3K A;  3DKY A;  4PCQ A;  1APL C;  2CW7 A;  1IDZ A;  3HOZ J;  1R5H A;  3G1L A;  1MMN A;  2E7W A;  2X0L A;  3C1D A;  4GYI A;  4E7Z A;  1YHQ I;  1MBK A;  1ZTR A;  2XAH A;  5B1A H;  3TQN A;  3C18 A;  2OUM A;  2WAQ A;  1YW8 A;  2EJR A;  3SZG A;  2P8T A;  3M3Y J;  4PK4 A;  3EUA A;  2K27 A;  2QIB A;  2A69 F;  2JWT A;  2K7L A;  4BL0 B;  1B6A A;  1TW2 A;  5JVG F;  5DDG A;  4WX9 A;  1P92 A;  5KNL A;  4H0E A;  5CJ9 A;  4F93 B;  1LPQ A;  3BNI A;  2L0K A;  4XKB A;  4MNU A;  5TJJ A;  1MMG A;  3HOX J;  2BE5 F;  1HST A;  1MW7 A;  2DJI A;  3QPL A;  4UHT A;  5H2F C;  1NH3 A;  2JJ7 A;  1OPC A;  1ON1 A;  2OCE A;  3OWT A;  5E8G A;  2QQ9 A;  1EV7 A;  2K02 A;  4CIC A;  2KL4 A;  2ISY A;  2AHQ A;  1D0X A;  2WTE A;  4W1U A;  2QSG X;  2STW A;  2RGV A;  2CSO A;  2X9D A;  1FBS A;  4HYE A;  3GF2 A;  4AIJ A;  2QBY B;  5EEA A;  2L9R A;  2E19 A;  2DTZ A;  5K7Z A;  1IN8 A;  4UUS B;  1A35 A;  3HRT A;  2MC4 A;  4YIF A;  1MBF A;  2MH2 A;  1MH3 A;  1K83 J;  2Z3Y A;  3DTE A;  3MKL A;  4Y33 A;  1RUO A;  2GXB A;  2KRC A;  2DT7 B;  3ROU A;  1AKH A;  4BAY A;  2JUC A;  1MND A;  4M3F A;  2PI0 A;  4OMY A;  3M07 A;  3EUK L;  2HS5 A;  5FHP A;  2M4G A;  4IRH A;  3T6N A;  3GXO A;  3KP2 A;  2V1N A;  2CV0 A;  5J8C A;  3GTQ J;  2L7K A;  3H9Q A;  2NVQ J;  2ZJP F;  3TMO A;  4FX4 A;  2Q1Z B;  1G3S A;  3K4J A;  3L9F A;  4JQF A;  3HTS B;  4KWA A;  3Q0U A;  3KYL A;  1Z7L A;  1VI0 A;  4M73 A;  1YG2 A;  1YLF A;  1Y6I A;  3KP5 A;  1FZP B;  1MGT A;  1XD7 A;  4HF0 A;  4ON0 A;  3ZMS A;  2R7Q A;  4NEL A;  4LG3 A;  3WE2 A;  3IP4 B;  4XR6 A;  4ZZL A;  3A0B C;  2DOA A;  1MBE A;  4EGY A;  2Y30 A;  4YG2 F;  3W2A A;  4CCO A;  4BAC A;  1OCZ H;  2L54 A;  4MK6 A;  1X1D A;  2O5R A;  3GBG A;  3FX3 A;  4OD4 A;  3B6A A;  4MLO A;  5TGT A;  4WF2 A;  3S1M J;  4XRS G;  3JRG A;  1SMT A;  2A05 A;  2BW3 A;  3CCM I;  1GXQ A;  2QGU A;  5HLT A;  4NC7 A;  2KJB A;  1P6R A;  2W85 A;  4RM2 A;  3RPQ A;  5K7F A;  3F23 A;  1R49 A;  3E3V A;  3MQ0 A;  1JKP C;  3VEP A;  3MFK A;  4KN4 X;  1MH4 A;  3OS2 A;  1VQ9 I;  2BW3 B;  1V3F A;  1IN7 A;  3EDP A;  3R0J A;  1OCO H;  1OLT A;  3E5U A;  1U9N A;  1HDP A;  2DA1 A;  1MBG A;  4U87 A;  1X19 A;  1JHF A;  5EZH A;  5D8K B;  1RPW A;  4FAS D;  1YFH A;  2PBX A;  2N8G A;  2G7L A;  1P4W A;  1YJ9 I;  2LKS A;  3LSK A;  4CZZ A;  4G7O F;  1ETK A;  3ZMV A;  2R92 J;  2HYG D;  2WAF A;  4ITV A;  1Y56 A;  1FT9 A;  3LSP A;  4B43 A;  4IF4 A;  4BE2 A;  4UDS A;  5BOX A;  4EJU A;  3H35 A;  2JMW A;  3CCR I;  2DA7 A;  3ZXS A;  4WXD A;  4CSW A;  2R5Y A;  3V7C A;  3QOP A;  3Q3S A;  5HOO A;  2XF5 A;  4UB6 C;  3UNG C;  1WJE A;  4PFO A;  1ZGW A;  3WE3 A;  2VBY A;  3DF8 A;  4G12 A;  2LLK A;  4G6Q A;  2O7O A;  1IDY A;  4J00 A;  1VQ6 I;  2R7U A;  2FXA A;  4M9Z A;  3JRF A;  1T0F C;  2BGC A;  3D5R C;  3SZP A;  3F72 A;  3CMY A;  3TO9 A;  3KLN A;  2H94 A;  4C2M A;  1YE9 A;  3A01 B;  2G7G A;  3CCV I;  3G2B A;  2RNJ A;  2J5P A;  4BEH B;  3KZZ A;  3R6S A;  2EPF A;  3OV8 A;  1O3S A;  1ODD A;  2Y0M A;  4LIV A;  2M9H A;  5IT3 A;  5E79 C;  3JW4 A;  2HGC A;  4A5M A;  1IXS B;  1ETY A;  1LB2 A;  1K78 A;  1S7A A;  5C44 J;  3PIP F;  4I09 A;  1O3Q A;  3SQN A;  2LK2 A;  4CGR A;  2JA6 J;  2F5D A;  2QF7 A;  3OSG A;  4R79 A;  4XIC A;  1D1B A;  1AWC A;  3LHQ A;  3TOB A;  2F6C A;  4IL6 C;  2RRE A;  2Y2Z A;  3L1P A;  2X6W A;  1OKR A;  1TT5 B;  2R7R A;  3WTU C;  3GZ6 A;  1HXD A;  3OYB A;  3M7G A;  2NVU B;  4JBA A;  3KNW A;  1D0Y A;  3OYF A;  1RIO H;  4PJN A;  2L4A A;  4HEA 2;  2ZCX A;  3OY9 A;  2LTP A;  2HWV A;  3CJN A;  2K9Q A;  3QYB A;  3PUB A;  1XS9 A;  4E6K G;  3S3N A;  3HHG A;  3Q9V A;  2ZSI B;  1LVK A;  1B9M A;  2E1C A;  4UUV A;  4ICH A;  1OCP A;  2ACJ A;  1RUN A;  2PBI A;  5F1R A;  1VF9 A;  3L09 A;  4LFU A;  2KKO A;  2HQA A;  2MFZ A;  4IOC F;  3ULQ B;  3DP7 A;  3J80 Z;  2CUF A;  3KP6 A;  3OYE A;  2ZME C;  2D1V A;  1QNT A;  2O8X A;  2R7W A;  2CH0 A;  2QA4 I;  3BR3 A;  3HE0 A;  2DYR H;  5HVQ C;  2ESH A;  3PFI A;  4M6Y A;  5FKK A;  3AAF A;  3I53 A;  2FML A;  2X1D A;  4UUS A;  3UR3 C;  1IF1 A;  1VQ7 I;  2L7F P;  1PUF B;  1V5F A;  2GOM A;  2VQL A;  4A6E A;  4EM1 A;  3S1N J;  1SEU A;  3QYE A;  1TQM A;  4IX7 A;  3A2K A;  5F0C A;  4BGD A;  3VW2 A;  2CV2 A;  1XCB A;  3SHF A;  4G6T B;  1HCR A;  5EDN A;  2EWN A;  2R5Y B;  1WZ2 A;  5JVT A;  3VW1 A;  1MJA A;  3ZQQ A;  2CQK A;  2VQG A;  2GFN A;  3SJM A;  1VQM I;  2JVH A;  2NRA C;  3T0Y A;  4FX0 A;  4A69 C;  2RQQ A;  2RN7 A;  4XMY A;  3RKY A;  3T1B A;  4IPA A;  4F3Q A;  1QHG A;  5GPC A;  3FBI B;  3IV5 A;  1OYI A;  2ECB A;  2NXN B;  5EF6 A;  3LSR A;  3GTO J;  3LQR A;  3RKQ A;  2B1E A;  4NC8 A;  4XN0 A;  4F91 B;  3CES A;  1WKM A;  3MZ8 A;  3GCM A;  4I7H A;  5FRM A;  2V7F A;  2ZFU A;  1Q1V A;  5A2Q Z;  2WC2 A;  3PM1 A;  3OMY A;  1U3E M;  4A0X A;  4JX4 A;  4ZYD A;  4FTH A;  2VPR A;  3IKV A;  3RH2 A;  2FJ1 A;  1ZH5 A;  2Y9Z A;  3BZK A;  4YFN F;  4GYG A;  2R7S A;  1YS6 A;  2QQB A;  2V4J C;  3DEU A;  4AF5 A;  1W7P A;  2LG4 A;  1AHD P;  4XOT A;  3K6G A;  2ZO4 A;  3CF2 A;  3G1M A;  1BC8 C;  2HYJ A;  5CVV A;  2YR2 A;  2IS2 A;  4HDU A;  4HBL A;  1YIJ I;  4OIR F;  5J3L A;  4M9S A;  4RLQ A;  2QSF X;  3QBM A;  4MXM A;  2CQX A;  4LB6 B;  4A3K J;  3C2H A;  3IKT A;  3ZN1 A;  2FU4 A;  3U1K A;  1Z6T A;  4EJT A;  3K1P A;  2VPL A;  2LYC A;  1S29 A;  1U5T A;  2WWY A;  3NEU A;  2F4O B;  1FPQ A;  1W5S A;  2QLZ A;  3GFI A;  5F0F A;  2G7S A;  1XB4 A;  5KCM A;  1IO2 A;  3WGI A;  2XPU A;  1S72 I;  3GTP J;  2OF7 A;  3TO7 A;  1P7J A;  2GXG A;  2VQC A;  4HA8 A;  3GVA A;  2KIU A;  4N0B A;  3WTZ A;  3J7Z I;  2EV6 A;  1OFC X;  3S2W A;  3EGQ A;  2O61 A;  4UV9 A;  4Z2Y A;  2DT6 A;  5CVR A;  2X6X A;  1B72 A;  3U9G A;  3CCL I;  4G8X A;  2R0Q C;  1G3Y A;  5IP9 J;  3RD3 A;  3GUD A;  2TCT A;  2DG8 A;  2A6H F;  3MZY A;  3V7S A;  3NS4 A;  1D3Y A;  4PSW A;  2OTL I;  1Z1D A;  4PJ0 C;  4HDV A;  1XGM A;  2VJ4 A;  1TNS A;  3DFG A;  2Z16 A;  1T95 A;  5KHD A;  3GTL J;  3KE2 A;  4AYB A;  3HOU J;  1G3W A;  2YX4 A;  3PFY A;  1KU3 A;  5FD5 A;  2DOE A;  3VVY A;  1X4P A;  1LFP A;  1IRX A;  1HW2 A;  2MBF A;  2M4K A;  3BG5 A;  3FMQ A;  3RYR A;  5DS9 A;  5KK1 A;  4YZE A;  2JA8 J;  2IVM A;  2K4J A;  1PP8 F;  1ONV A;  3K70 D;  4OAY A;  1UG0 A;  2XGX A;  3ZR8 X;  2YVX A;  1FNN A;  4A6D A;  4IHT A;  2DCE A;  2W1O A;  3ZQL A;  5GAH J;  3PSI A;  4FCY A;  3FHN A;  3FWE A;  3VPR A;  1UCR A;  3PNV A;  2ELJ A;  2L3D A;  2BHZ A;  3BTL A;  1AU7 A;  2CFX A;  2HQ5 A;  2UXN A;  3S32 A;  4DYR A;  2DXI A;  3FMS A;  2VLA A;  5B3S H;  3WOD F;  3M4O J;  4BY7 J;  4PZJ A;  3G3Z A;  4RDU A;  4I99 C;  1ZAR A;  2KP6 A;  1JJ8 C;  4M3G A;  3BJA A;  3CDL A;  3AG2 H;  4YRV A;  3ZQF A;  3OYA A;  4C30 A;  3CCS I;  1TZL A;  5J1Y A;  3OYG A;  4A3M J;  1WFX A;  2VAS A;  3WHB A;  2IS4 A;  2OQR A;  3M1E A;  1HBX G;  1E17 A;  2BYV E;  3I0T A;  4TV7 A;  1U8B A;  3IH3 A;  3JRC A;  1I5Z A;  3A01 A;  1UHS A;  4E7H A;  1R1T A;  1R23 A;  2O03 A;  3BG6 A;  3CQZ J;  3DEE A;  4P9F A;  5E3O A;  2HDC A;  4V2F A;  4OU0 A;  3E7Q A;  2GLO A;  4RB2 C;  2LY1 A;  2MC3 A;  3JTH A;  5GTI C;  4KA4 A;  1IRZ A;  3PPB A;  3G1O A;  1XMA A;  4L9J A;  2IS1 A;  2ME0 A;  4KIT B;  4IKF A;  2DDB A;  1W4M A;  2I5U A;  2BVL A;  2IPQ X;  3HIM A;  5EGO A;  1H89 C;  3GLL A;  1PYV A;  3JSP A;  3QWL A;  4KFC A;  3M1C A;  4HX8 A;  4MIM A;  4WCG A;  2OZU A;  4MQ9 F;  2VI6 A;  3JRB A;  4CH7 A;  1ZYR F;  3CRJ A;  1JTX A;  2ZSH B;  3ZMD A;  5J6X A;  3ON4 A;  1SD7 A;  2JPC A;  1JI8 A;  3BCA A;  1J75 A;  3K8P C;  1QO0 D;  3V6G A;  2J5O A;  1TL8 A;  2F5C A;  2KFD A;  2VKE A;  1J9I A;  1FOK A;  4LB5 A;  3H36 A;  3S1R J;  3F6V A;  1W36 C;  2V1D A;  4AWX B;  2K9S A;  3P5J A;  2X85 A;  1W5C C;  3T5X A;  3X2Q H;  2DPU A;  1UMQ A;  3RZD J;  3GZI A;  3OYJ A;  2NOG A;  1BIB A;  3HKZ N;  4IQ4 A;  2D1H A;  5F6F A;  2CG4 A;  4JP0 A;  3I55 I;  3HOS A;  3ZQI A;  3CCY A;  1FYL A;  2OA4 A;  1BOB A;  3I59 A;  2W4S A;  2VIX A;  5HLI A;  1V55 H;  5LFA A;  3WTS C;  1YJN I;  3FXL A;  1DPR A;  3GEU A;  5L3F A;  1OYW A;  3AQT A;  3LAP A;  1QVU A;  5E1X A;  1SD6 A;  1HQC A;  1T98 A;  2HDW A;  1U9O A;  2QM3 A;  2W82 A;  2ZNY A;  2B0L A;  4BEH A;  5DM6 F;  2JT1 A;  2LSO A;  4GCK A;  2GA1 A;  4C3J J;  2RC4 A;  3F8M A;  4ZJZ A;  3CC4 I;  3DPJ A;  1LFB A;  2BVM A;  2G7H A;  2M34 A;  1SMY F;  4MEX F;  3CC2 I;  5IOZ A;  4HQE A;  4CDG A;  2W00 A;  4A5N A;  3C7J A;  1MMD A;  1BJZ A;  2LVS A;  4N4O B;  2XKO A;  1ZRD A;  2GOX B;  5JHF A;  1JKO C;  1QPI A;  4U9L A;  2Y9Y A;  2FE3 A;  4A3J J;  4GFB A;  1WJ5 A;  2DDA A;  3QOD A;  4DZJ A;  2XSD C;  3BT9 A;  2JK3 A;  4CYD A;  4Q4Z F;  3CJQ B;  5E18 F;  4D5C A;  2GQQ A;  3RJP A;  4XKC A;  2RQP A;  3NRV A;  2CQ7 A;  4AVZ A;  2TRT A;  4DIQ A;  4Y15 A;  4QSH A;  4MTD A;  4IEJ A;  5EEG A;  4V19 K;  3ELK A;  1Z67 A;  1T08 B;  3S93 A;  3LSJ A;  3OYN A;  3HSF A;  1BC7 C;  1ZGA A;  3A02 A;  3KET A;  4PJM A;  4LJZ F;  1WH7 A;  4AUX A;  2QBY A;  2QUF A;  4BHC A;  4XKW A;  1RKT A;  2X6O A;  1HDD C;  1FC3 A;  4NC6 A;  1E2X A;  1OR7 A;  1REP C;  1TLH B;  1W7P B;  1R58 A;  2ZNZ A;  1LEB A;  1JGS A;  4BU2 A;  3AG3 H;  2XGD A;  4HF1 A;  3LWJ A;  4C2M J;  1BW5 A;  2LKX A;  4QPO A;  2E5N A;  1LE8 A;  5D1R A;  4AIH A;  1YQA A;  3OIP A;  2HQR A;  2L9S A;  5GTH C;  4S0H B;  4D0P A;  1FTT A;  4BUP A;  1H8A C;  4L62 A;  3B6C A;  3RQ4 A;  4A3E J;  4ESB A;  1J09 A;  3ZQ7 A;  3OYC A;  1UAA A;  2HVR A;  1ZK8 A;  4A3C J;  2HKO A;  3BWG A;  2K5C A;  1MDM A;  1KQ8 A;  2MD5 A;  3G6E I;  2XB0 X;  4KIG A;  5A2Q K;  5HS9 A;  2FD5 A;  4QPQ A;  5FD6 A;  1OR7 C;  3CMM A;  5CXI A;  3J7A Y;  4UB8 C;  5DUI A;  4BDZ A;  4RGX A;  2WB1 N;  3H5A A;  4EM2 A;  3HUG B;  4B48 A;  3VYT B;  1OCT C;  4OWR B;  4UV8 A;  4BY1 J;  4EMS A;  1T2K A;  3GYH X;  1IN5 A;  3F0C A;  1JE8 A;  3L2C A;  3C2G A;  1MZB A;  2IGK A;  1A36 A;  3QP5 A;  1F5T A;  5LGU A;  2AQE A;  2XAF A;  5TIS C;  1UHW A;  4BE1 A;  2DMT A;  1P9Q C;  1LDK B;  3F8N A;  3PIO F;  1TQP A;  4FHT A;  3TL4 X;  1LQ1 A;  1DP7 P;  5E17 F;  1QPM A;  1WVR A;  2QTQ A;  2F4M B;  1B59 A;  1I1G A;  2ZOZ A;  1D0Z A;  3E6M A;  3CUQ A;  2W24 A;  2GWR A;  2ISZ A;  2W53 A;  1S8N A;  4BJ5 C;  3ZN0 A;  3CZ6 A;  2FRH A;  4HZF A;  1ZR2 A;  3HRU A;  5IT9 K;  1LDD A;  1I39 A;  2H8W A;  9ANT A;  5BPI A;  5HAW A;  1ON2 A;  4OAZ A;  3VDX A;  3HDD A;  4A3G J;  1WCM J;  2BY1 A;  2W57 A;  2OPT A;  2CGP A;  2P81 A;  2DMN A;  1ZG5 A;  3HIF A;  3JRA A;  3GME A;  3QPT A;  4YFK F;  4EAT A;  4AC6 A;  2ZFW A;  3WG7 H;  5BNG A;  3WTY C;  3LOC A;  4V2G A;  4O3M A;  3M9A A;  2WGB A;  1STZ A;  5DCM B;  5H20 A;  3JR9 A;  4FET A;  4L9V A;  4CYC B;  4IQJ A;  2HKX A;  3CCJ I;  3SZT A;  4HAM A;  3RZO J;  2H09 A;  2WAD A;  2IU5 A;  5E20 A;  3MN2 A;  5GAD J;  1Z7U A;  4DZP A;  2XUB A;  5LLQ A;  3KPH A;  2COM A;  4HV5 A;  2XB5 A;  2HKU A;  1QHH D;  2HDD A;  2K4B A;  1ZG3 A;  2YS9 A;  3S15 J;  3S17 J;  1P4A A;  4CCN A;  3RPU A;  4NQW A;  5HS7 A;  4IOA F;  2E7X A;  1I3Q J;  4RM3 A;  3E7L A;  2BXZ A;  2LBF A;  2W48 A;  3WTX C;  3MNL A;  3O2P E;  4P1W A;  1IGN A;  1X1P A;  1D1A A;  3RSN A;  5FLM J;  1TP4 A;  2HZT A;  2V6C A;  2R5Z A;  1X2N A;  2LY9 A;  2PMZ N;  3GFJ A;  2GA2 A;  3K7A J;  4BHP A;  3W2V A;  2K9L A;  3H5N A;  3OOP A;  3BCB A;  2YX7 A;  3ABL H;  3VVZ A;  3LSI A;  1YS7 A;  3IWF A;  4J19 A;  5LRS A;  1YRN A;  3OYM A;  5FFZ A;  1W36 D;  3GEZ A;  3DBH B;  1CF7 B;  2W84 A;  1RZ4 A;  2E35 A;  5F08 A;  5J1U A;  1SC7 A;  4XLF A;  1T33 A;  2CU7 A;  3REO A;  2JPB A;  2R7D A;  1ZR4 A;  1B9N A;  3D5L A;  3IH4 A;  2PMU A;  4NUB A;  3PAS A;  1RRJ A;  2DK5 A;  3OS0 A;  1RKW A;  3EYI A;  1Z3Y A;  3K70 C;  2JN6 A;  3CCE I;  2XRN A;  1BR4 A;  2W7N A;  3BJO A;  2QYO A;  1TWF J;  5EG0 A;  4I2O A;  2LMD A;  1J59 A;  1X1C A;  4RAF A;  4PDK A;  2EB7 A;  1ORK A;  1P4X A;  4U7B A;  2WAE A;  2IGM A;  2ZME B;  5D4S A;  5LBQ A;  2A5Y B;  3NNR A;  2VOO A;  1U8R A;  2LKP A;  2E1M B;  1R71 A;  1CGP A;  1ZAO A;  2NP5 A;  3DPU A;  3HB9 A;  5AIP A;  2KMU A;  4RAY A;  2A61 A;  1SFO J;  3I4M J;  3K1N A;  4MFE A;  4DJA A;  4XLH A;  2DT5 A;  2CO5 A;  4IHW A;  3VYS B;  2UXH A;  2R7T A;  3E6B A;  2D45 A;  2ZXI A;  1W5T A;  3KZI C;  4BHB A;  2LD5 A;  3OYL A;  4C2T A;  2G9W A;  4RS8 A;  2CV1 A;  2X1C A;  4N4N B;  1XMX A;  3U2R A;  2XC7 A;  2XPW A;  1Z3X A;  2CWE A;  2M7A A;  3ONQ A;  2X4H A;  2LOO A;  3A4C A;  3S2D J;  3AKZ A;  2XGC A;  4LK1 F;  2GM4 A;  4C3I J;  1TWC J;  3DEW A;  3A03 A;  4M72 A;  4DVY P;  1TT0 A;  2UXI A;  4I02 A;  4HX4 A;  2HPI A;  2WY8 Q;  4A93 J;  1Y39 A;  2K3P A;  2QEN A;  4JL3 A;  1IZ1 A;  2FMY A;  3DXJ F;  4B3X A;  2XF7 A;  5JI6 A;  4A3B J;  1FSH A;  2A6T A;  4L5J A;  4YEJ A;  1XDS A;  3COA C;  1A31 A;  2HU9 A;  2MLG A;  1JT0 A;  4ACI A;  3BOQ A;  2UXU A;  3V4G A;  2MLK A;  5M3M J;  3B81 A;  3BTJ A;  2IXS A;  1PUE E;  2EZK A;  4HNT A;  1I50 J;  1R00 A;  2DYS H;  1RI7 A;  5K7H A;  5K5Q A;  1IRG A;  5E3L A;  2EZI A;  1EA3 A;  4LLL A;  2HVS A;  1XMK A;  2P4W A;  3P9I A;  2WV0 A;  1VQP I;  3P9C A;  2UV1 A;  2BBY A;  2L9V A;  2E5Z A;  1NK2 P;  3IAS 2;  2FBH A;  3CUO A;  3F9K A;  3FXO A;  3CLO A;  1WJC A;  4PJJ A;  3I59 B;  3AG1 H;  4OIQ F;  4FIS A;  2HOE A;  3LSH A;  3FKJ A;  2HR3 A;  4C2U A;  4RA2 A;  1HSJ A;  4WIB A;  1O4X A;  3QOE A;  3IUO A;  1QRY A;  4N9I A;  2XKP A;  3BTC A;  5M5W J;  2Q2E A;  3HG9 A;  2LF7 A;  1KGS A;  3PNY A;  2ECC A;  4UNO A;  2KQR A;  3TGN A;  4L9T A;  3FZV A;  3LST A;  2X1E A;  2FNA A;  5CVJ A;  1D5V A;  3BJB A;  4Q48 A;  2HNH A;  2JSP A;  3VVX A;  3F8B A;  3TDU C;  3J7Y J;  3Q0W A;  3IRR A;  1QGP A;  3H3U A;  4CCL A;  3CLQ A;  4S05 A;  2M8G X;  3IWZ A;  2EFN A;  3BRU A;  3S16 J;  4ZDO A;  3OR1 C;  3QQA A;  1LUJ B;  2FNP A;  2CQQ A;  3LNQ A;  1TWH J;  5ED4 A;  3VOE A;  2HXI A;  2K9N A;  4PSX A;  1K7A A;  5F27 A;  1GLN A;  1O7F A;  4PXI A;  3BP8 A;  4EGZ A;  2NYX A;  1KQ0 A;  3GFL A;  4Y52 J;  1FWZ A;  3TOA A;  4ZYG A;  3H3Z A;  1SVM A;  1IAW A;  3D1N I;  1UFM A;  1ETW A;  2ZJQ F;  2DA2 A;  5IYD J;  4U0V A;  1L3L A;  3KP3 A;  1IW7 F;  1XGO A;  3R4K A;  4IRG A;  4F52 A;  3RI4 A;  2VOP A;  3FK6 A;  2JVG A;  2Y69 H;  2VJI A;  3AG4 H;  2QQA A;  2CQN A;  1V5G A;  2LH9 A;  1S3J A;  1S7O A;  1B8I A;  1HW1 A;  4E7L A;  2R7V A;  3J81 K;  5ILU A;  1EH7 A;  2A68 F;  3VYU B;  4S04 A;  3GTM J;  3V8L A;  2IBD A;  5AIQ A;  1GHC A;  3MMY B;  1W7P D;  2R7X A;  1HLV A;  2LRD A;  3TO6 A;  3SDB A;  2E60 A;  4C9Y A;  3KFW X;  1IG7 A;  2QOP A;  3TED A;  5EEH A;  3QYF A;  1IXR C;  5HDG A;  3JRE A;  1FY7 A;  1ITY A;  2NS0 A;  2WUI A;  2PLY A;  1ZEL A;  2A2F X;  1S5L C;  3CTA A;  3OYH A;  4A0Z A;  3PNT A;  4M3E A;  4KT6 A;  2O8K A;  5JR3 A;  5C3E J;  1BL0 A;  1JTY A;  1BW6 A;  2EQR A;  1Z21 A;  1G8X A;  1Y8R B;  3HPH A;  3ZQC A;  1BI3 A;  4I0B A;  2O7T A;  2PEX A;  1SD5 A;  3BDD A;  3W2W A;  2B3W A;  1ZLJ A;  5IP7 J;  4OIO F;  2AXT C;  4NBQ A;  4BQO A;  1WQ2 A;  1HOM A;  3KX2 A;  1QZZ A;  5ILS A;  5ICE A;  3GTJ J;  2V9V A;  1T8I A;  3VFZ A;  4PFP A;  4QIW N;  2EH3 A;  4CCK A;  4ESF A;  2Q2E B;  5LHI A;  4Y13 A;  1QQI A;  2AO9 A;  3LMM A;  4DQ2 A;  2B7E A;  3WGG A;  2ME6 A;  4LGW A;  3WGH A;  3QRF F;  4Z6Y A;  2ZXW H;  3ZPL A;  2ID3 A;  3HM5 A;  1GUU A;  1U78 A;  4HST A;  2HOT A;  3ANP A;  3H5R A;  5J8F A;  3HTU A;  2NVY J;  4I98 B;  3QPH A;  1DP3 A;  2HVQ A;  4GGG A;  3JTG A;  1ULY A;  2YU9 J;  3T8T A;  3FXQ A;  1IRF A;  2VE9 A;  1PJR A;  3OR2 C;  2M45 A;  4FQG A;  4ZYE A;  2DOF A;  2AXL A;  4LOC A;  3TBI A;  2CUJ A;  2EV0 A;  2ZY9 A;  4D1Q A;  2HOS A;  5CXG A;  1QA6 A;  1EH8 A;  2L4M A;  3CJD A;  5HS8 A;  4I01 A;  3JAM K;  1IV8 A;  5B66 C;  4XON A;  3WTW C;  1KON A;  2PN6 A;  2FBK A;  4DGW B;  2XHK A;  4AM3 A;  4KN7 X;  4ZYA A;  1T38 A;  3FIS A;  2A3S A;  2WBM A;  1FOW A;  1WPK A;  3G73 A;  1GV2 A;  3C07 A;  2XAJ A;  3GLX A;  4RGS A;  5LD2 C;  1YW7 A;  2ZME A;  2Q0O A;  3HSE A;  3MAJ A;  1KU2 A;  4CXF A;  4U9N A;  3DPT A;  2HFH A;  3FHZ A;  1BM9 A;  4XRS A;  1J0R A;  4ANJ A;  1FJL A;  4LIU A;  5JLX A;  3HL2 A;  3HOV J;  2DK8 A;  2L02 A;  3F3X A;  2IW5 A;  2RHA A;  3PQK A;  2JQ7 A;  4HW0 A;  5F0H A;  5CQE A;  1HC8 A;  1EKE A;  3O60 A;  1X3U A;  1UG2 A;  3F22 A;  2Y48 A;  3EUP A;  2M30 A;  4NHJ A;  3GO5 A;  2F5V A;  3GZN B;  4GO1 A;  2X6Y A;  1MNM C;  4KMU X;  2XAG A;  4XQF A;  4RBO A;  4A3D J;  3GTG J;  4B44 A;  4BQQ A;  4E7I A;  2F07 A;  2YSR A;  2QKM B;  2Z2S B;  3BC8 A;  3FMR A;  1RR8 C;  4L5I A;  2YVE A;  2H27 A;  1ZQ3 P;  4OD5 A;  5DCF A;  5IOY A;  3KP4 A;  1BR2 A;  1GVJ A;  1RNL A;  1J5Y A;  2COB A;  3CD6 I;  3GTK J;  2R3S A;  2AS5 F;  2FJI 1;  2PZ9 A;  1N77 A;  3DKW A;  1LEA A;  2KDZ A;  2L01 A;  2Y0S A;  1BI0 A;  2XGE A;  2DPD A;  2EFW A;  4Q47 A;  1DU0 A;  4BBS J;  3FIW A;  3KCC A;  5DEQ A;  1Z0X A;  3HZJ A;  3I56 I;  3ON2 A;  2DG7 A;  4IXA A;  3E0J B;  2ZB9 A;  2ZJR F;  3DWL E;  5FLV A;  1TW3 A;  1G4D A;  1EH6 A;  3VIB A;  2PMZ A;  4OMZ A;  4BE0 A;  2DMU A;  4LIT A;  1H9G A;  3JRH A;  3I4N J;  3LQQ A;  1USS A;  3KKD A;  4IHY A;  2TDX A;  1Q1H A;  3CUQ C;  2RAE A;  1IV6 A;  1VQ4 I;  1XDU A;  3K69 A;  4CA0 A;  1WWX A;  5LHH A;  5DAJ A;  3M8F A;  4XOP A;  4JK1 X;  3U1D A;  2KDO A;  5FGL A;  4ME9 A;  4M3D A;  2E2H J;  5C4J J;  3NI7 A;  3MCZ A;  3R60 A;  2DU9 A;  4XSZ F;  1RR7 A;  1AKH B;  2JRT A;  1WI3 A;  1A04 A;  2WV1 A;  3MKY B;  4MO7 A;  1V54 H;  2FQ3 A;  3AQS A;  3ABT A;  4RB3 C;  2V57 A;  1FYM A;  5M5X J;  1F1Z A;  4KIS A;  2PJR B;  4F55 A;  5L3B A;  2MA3 A;  1K4S A;  5HOD A;  2KZG A;  1VQL I;  1XPX A;  2E36 A;  2NNN A;  3KYC B;  4KUM A;  2YPR A;  2IA0 A;  1WH5 A;  3WU2 C;  3ZQG A;  2ZCW A;  5LEK A;  5FKN A;  2EIL H;  2ZCM A;  3I3L A;  4B4C A;  1O3T A;  4MFD A;  3CUQ B;  4PUS A;  5E3M A;  3RPU D;  1TBX A;  5KAF C;  3V42 A;  3RIR A;  1BR1 A;  4HLY A;  1SAU A;  5EG0 B;  4A12 A;  4BXX J;  3S2H J;  1YJW I;  3QPS A;  3ECH A;  3SEZ A;  3KEQ A;  2L5Q A;  3QU3 A;  1PP7 U;  3L2Q A;  2EFQ A;  4ENJ A;  2RKH A;  3NXC A;  4U0W A;  4I6Z A;  5HDK A;  3RKW A;  3CMA I;  3CJT B;  1WI9 A;  2NS7 A;  3HRM A;  1I6X A;  2FSW A;  1NHA A;  2XIG A;  3K2Z A;  4GDF A;  2WA0 A;  3F1B A;  4JNN A;  4YIR X;  3QU6 A;  2K40 A;  3ABM H;  3O6B B;  5H6R A;  3JRI A;  1A6Q A;  4B47 A;  5J40 A;  3NQO A;  1XSD A;  3BZ6 A;  3T8R A;  1O3R A;  1YX5 A;  1WSU A;  4O6J A;  4EJV A;  3HOW J;  3VOX A;  3OIO A;  3KIO A;  5IYC J;  2RAS A;  2VKD A;  5KVR A;  4FT8 A;  2DN0 A;  5K5R A;  3VW0 A;  3K4L A;  1R1U A;  2NS8 A;  3QKX A;  2OQG A;  3FDY A;  3ML6 A;  4JKZ A;  4PGG A;  2CYY A;  1Z77 A;  3OSF A;  2QQ8 A;  4CHU A;  4XLA A;  4DYQ A;  3FXK A;  1ZRC A;  2EV5 A;  4NB5 A;  4FE7 A;  5B1B H;  1BBY A;  5DUK A;  4WWC A;  2YUS A;  2P0W A;  1U6G A;  4GRI A;  2Z1D A;  5CKT A;  3ABU A;  4IHV A;  1KZH A;  5LRR A;  5J4Y A;  3TKY A;  3K4M A;  4ENK A;  2L7Z A;  2E1O A;  1ZKG A;  2H6C A;  1MD0 A;  2BXY A;  2O3F A;  3CP8 A;  2DA4 A;  3V78 A;  1U5T C;  2MSY A;  3BR1 A;  2LF8 A;  2OU2 A;  3L2W A;  2DMP A;  1J7K A;  2EA4 A;  1FTZ A;  5FMP A;  3U21 A;  3DCF A;  3OL3 A;  2Y75 A;  3ISP A;  3QP6 A;  2RV8 A;  4A0Y A;  3IC7 A;  4EVI A;  2PMH A;  3KLO A;  5M5Y J;  2Z5U A;  3ANG A;  3EUH A;  1X3Z B;  1QZY A;  1T39 A;  2IGO A;  2XAU A;  4IRV A;  3E5X A;  2K3F A;  4XM3 A;  3W3C A;  2UXP A;  3NPI A;  5CLS A;  2V6E A;  2P5K A;  1TWA J;  4XID A;  4UVB A;  1LDJ A;  2HOA A;  1OJL A;  4CCM A;  2VBZ A;  3WU1 B;  2MH9 A;  5L3C A;  1D8K A;  1JUM A;  3Q0V A;  3ASO H;  4II3 A;  1BN5 A;  3ZP5 A;  1WGX A;  5TRD A;  1HKT A;  1R36 A;  1TTY A;  4E70 A;  2ICW G;  2XVC A;  2RNG A;  1MNE A;  4NNJ A;  4XRF A;  3NAR A;  4J01 A;  2EFP A;  2BY0 A;  5AQC A;  5FRO A;  3HRS A;  2PJR A;  4I0A A;  1K79 A;  2EZL A;  5D19 A;  3Q5F A;  2XPV A;  2XV4 S;  4DBQ A;  1SFE A;  3I58 A;  2XRO A;  5D6F A;  1BJA A;  1UST A;  1YIO A;  1OCC H;  3N97 A;  2CUZ A;  2VB6 A;  3KZY A;  3WTT C;  4HKU A;  3LL7 A;  3CO6 C;  1M1E B;  4ENN A;  1WJF A;  1F36 A;  2A07 F;  5E1Z B;  2V1X A;  4UVA A;  5CVU A;  2KRF A;  2MW8 A;  3CDH A;  4I76 A;  2EIM H;  2DA3 A;  3J80 K;  1KA8 A;  1SFX A;  2YU3 A;  3G71 I;  1FOY A;  4CO8 A;  3O8G A;  3DU6 A;  3K0L A;  2PG4 A;  4ZH4 F;  2XF6 A;  5K1Y A;  1C0W A;  3K1M A;  2IGN A;  2OI8 A;  2KZV A;  3HTJ A;  2IA2 A;  2M0C A;  4HV6 A;  1ZHF A;  2NOJ B;  1BOA A;  2VJ5 A;  2DFE A;  3JRD A;  1AOY A;  4IHX A;  2NVT J;  3MWM A;  4G7H F;  2IA1 A;  1I27 A;  3MD2 A;  1W0U A;  3F6O A;  2OER A;  3I54 A;  2HYF A;  3D0S A;  5H6Q A;  1FYK A;  1DPU A;  1VND A;  1X1A A;  1MMA A;  4KT5 C;  4AYB N;  3ZGK A;  3BLY A;  2VQH A;  3PO3 J;  1IXC A;  3K4C A;  2CMP A;  4XLE A;  4QLC U;  1Z91 A;  1LVA A;  1X58 A;  2QZ8 A;  2UZK A;  3HPG A;  2EK5 A;  4XN3 A;  4U7D A;  5IPA A;  5FJ8 J;  4O5V A;  5J1R A;  1XC5 A;  5IYB J;  1OIS A;  1MSF C;  3LJL A;  5D5W B;  1T6S A;  5HNH A;  3MKZ A;  2LC2 A;  2ZXJ A;  2R7O A;  1VQ8 I;  5LGT A;  3LSG A;  2QWW A;  4HLX A;  2HI3 A;  2GAU A;  5BQT A;  1R5G A;  1FP2 A;  3GZ5 A;  3AL0 C;  4L18 B;  2QEX I;  2GUH A;  4GFL A;  1XGS A;  1DU6 A;  5HSZ A;  1YTY A;  2JA5 J;  2EZH A;  5BS6 A;  4ZC3 A;  3OOU A;  1IUF A;  2QKO A;  3ECO A;  1HA8 A;  4JYK A;  5EGO B;  3ZCO A;  3CME I;  5EFY A;  1LFU P;  4IRI A;  2FUG 2;  1YYV A;  1QU3 A;  2O9L A;  4HF2 A;  1DGR M;  2EIN H;  4E7S A;  2PJP A;  1YW9 A;  3KYD B;  1QZE A;  2KIS A;  3LA7 A;  1MIJ A;  3L2U A;  4E7K A;  1F4K A;  1YRN B;  2G3B A;  4PGH A;  4IHS A;  1B4A A;  4KIC A;  3B02 A;  5E1W A;  3VYR B;  4HOB A;  5FFX A;  2JRM A;  2BOL A;  4EEF G;  2RVC A;  4CYC A;  5B5E C;  3CCQ I;  2P7V B;  3P7N A;  2M3A A;  1P2F A;  1GT0 C;  3H92 A;  1HKQ A;  2PFB A;  1KU9 A;  2K86 A;  2V1U A;  3TP3 A;  2Z9O A;  1WJB A;  2O0Y A;  3EQL F;  1FIP A;  1FSE A;  1JT6 A;  1TC3 C;  1N78 A;  4XNF A;  2H1L A;  4WXH A;  3Q9S A;  2ZJ2 A;  4GXO A;  4MQV A;  3JSO A;  3BQY A;  2P5L C;  2ESN A;  4HPQ A;  3S14 J;  4X6A J;  1OCR H;  3H0G J;  3MEX A;  1GDT A;  2XDV A;  2VXD A;  3RYP A;  1BA5 A;  1XSV A;  3W6K B;  1BI1 A;  2A5W A;  4XLP F;  5CPR B;  1EJ9 A;  2P6S A;  4ZDP A;  3PL8 A;  1AA7 A;  2UUZ A;  1FBQ A;  3K2A A;  2KIF A;  2Q24 A; 
#chains in the Genus database with same CATH homology
 1POG A;  1Y1V J;  5IP7 J;  3V6G A;  1XG1 A;  2VKE A;  1HOM A;  2Y31 A;  3S1R J;  3GTJ J;  2DA5 A;  2K9S A;  3IUV A;  3FKI J;  4QIW N;  1IC8 A;  2EH3 A;  2WAQ N;  3O8H A;  1UMQ A;  3RZD J;  2NP3 A;  3GZI A;  2NOG A;  3VOK A;  2AO9 A;  3HKZ N;  3ZQH A;  4GFK A;  2ME6 A;  4JP0 A;  2QCO A;  3FRQ A;  3ZQI A;  3CCY A;  4NDL A;  2ID3 A;  5GP9 A;  4X1E A;  3HM5 A;  1VFC A;  1GUU A;  1U78 A;  2HOT A;  3ANP A;  4DYC A;  2NVY J;  3GEU A;  2IAI A;  3AQT A;  5E3N A;  1QVU A;  2YU9 J;  1U9O A;  4GCT A;  4GCK A;  4C3J J;  1APL C;  2CUE A;  4ABZ A;  1IDZ A;  4LOC A;  1LFB A;  3HOZ J;  3G1L A;  3DPJ A;  2M34 A;  1MBK A;  1ZTR A;  2HOS A;  5CXG A;  5IOZ A;  2ZOY A;  3CJD A;  3M3Y J;  1BJZ A;  2LVS A;  2QIB A;  2JWT A;  5C4X J;  3BG9 A;  3ZOB A;  1JKO C;  1QPI A;  2Y9Y A;  4A3J J;  3BNI A;  2HXO A;  2MGQ A;  2L0K A;  3FIS A;  1WPK A;  4GFB A;  3C07 A;  1GV2 A;  3HOX J;  2XSD C;  4DZJ A;  3BT9 A;  3QPL A;  2JK3 A;  2JJ7 A;  2I10 A;  3SFI A;  4D5C A;  1FIA A;  4XRS A;  4W1U A;  2AHQ A;  1FJL A;  5JLX A;  3HOV J;  2X9D A;  1SGM A;  5K58 A;  2TRT A;  4FE4 A;  5EEA A;  2L9R A;  4QSH A;  5F0H A;  2E19 A;  4M6V A;  2DTZ A;  4IEJ A;  5K7Z A;  1PUF A;  1F43 A;  3G56 A;  3O60 A;  4UUS B;  2RHA A;  1MBF A;  1UG2 A;  1MH3 A;  1RET A;  1K83 J;  3MKL A;  3LSJ A;  3HEF A;  3EUP A;  1AKH A;  3BHQ A;  1EF4 A;  3A02 A;  4M3F A;  1MNM C;  2B63 J;  1WH7 A;  5FHP A;  4AUX A;  1GV5 A;  4RBO A;  4A3D J;  1JUS A;  3HGY A;  3GTG J;  3T6N A;  1RKT A;  2X6O A;  1HDD C;  3GTQ J;  2F07 A;  2NVQ J;  3COL A;  2YVE A;  4QTR A;  1ZQ3 P;  1FEX A;  4KWA A;  5IOY A;  2XGD A;  3Q0U A;  2COB A;  2QWT A;  1MBH A;  3LWJ A;  3GTK J;  4C2M J;  1VI0 A;  1BW5 A;  2PZ9 A;  2LKX A;  1LE8 A;  5D1R A;  4NEL A;  2KDZ A;  4S0H B;  1FTT A;  3HTH A;  1H8A C;  1MBE A;  1K61 A;  2Y30 A;  2XGE A;  4L62 A;  1DU0 A;  3B6C A;  4BBS J;  4MK6 A;  4A3E J;  3FIW A;  3GBG A;  4HNV A;  1Z0X A;  3ON2 A;  2DG7 A;  2ZB9 A;  3B6A A;  4MLO A;  3S1M J;  1ZK8 A;  2L7M P;  5FLV A;  4XRS G;  1NK3 P;  5EYR A;  3VIB A;  2UXO A;  4A3C J;  2DMU A;  3JRG A;  1MSE C;  2FBQ A;  1IJW C;  3JRH A;  3I4N J;  1I6H J;  2XB0 X;  2R7Z J;  4IHY A;  3KKD A;  2VKV A;  5D18 A;  2RAE A;  1IV6 A;  2FD5 A;  5CXI A;  5DAJ A;  3TW7 A;  5K7F A;  2WB1 N;  5FGL A;  4ME9 A;  1JKP C;  2Y0S N;  4M3D A;  1OCT C;  2E2H J;  5C4J J;  3NI7 A;  4BY1 J;  1ENH A;  1MH4 A;  2CRG A;  3W6V A;  5DTD A;  1RR7 A;  3F0C A;  1ETQ A;  1AKH B;  1WI3 A;  2WV1 A;  2LR8 A;  3RQI A;  1U9N A;  4MO7 A;  3AQS A;  1HDP A;  5M5X J;  2DA1 A;  1MBG A;  2DMT A;  5EZH A;  1RPW A;  2H1K A;  2PBX A;  2N8G A;  1A5J A;  2G7L A;  2REK A;  2XRL A;  5HOD A;  2ZOZ A;  1ETK A;  1NTC A;  1S7E A;  2R92 J;  2KT0 A;  3ZQG A;  1WH5 A;  3BQZ A;  3LSP A;  2W53 A;  5FKN A;  4UDS A;  2ZCM A;  3VP5 A;  4B4C A;  2ELK A;  4MFD A;  5E3M A;  2JMW A;  1ZR2 A;  2DA7 A;  2VUM J;  2R5Y A;  4D7N A;  9ANT A;  2XDN A;  3UKG A;  5HAW A;  3Q3S A;  5EG0 B;  1UI5 A;  4BXX J;  3S2H J;  1ZGW A;  3HDD A;  3HGG A;  4A3G J;  1WCM J;  2OPT A;  3QPS A;  4D7M A;  4G12 A;  2LLK A;  1JGG A;  2O7O A;  2P81 A;  1IDY A;  2DMN A;  3JRF A;  3JRA A;  3NXC A;  1ETO A;  3CMY A;  2D5V A;  2HYT A;  4AC6 A;  3NAU A;  4I6Z A;  5BNG A;  3LOC A;  4V2G A;  3A01 B;  2G7G A;  2WGB A;  2NS7 A;  3JR9 A;  4CYC B;  2H8R A;  3F1B A;  2QTQ A;  4JNN A;  2M9H A;  4JX6 A;  4BBR J;  2K40 A;  3RZO J;  2IU5 A;  3NRG A;  3MN2 A;  3JRI A;  1ETY A;  4DZP A;  5C44 J;  3C2B A;  2LK2 A;  5IP6 A;  5FKO A;  3HOW J;  3VOX A;  3OIO A;  2XB5 A;  2JA6 J;  5IYC J;  2HKU A;  2RAS A;  2QF7 A;  2R5Z B;  5HBU A;  3OSG A;  1HF0 A;  2DN0 A;  4XIC A;  2HDD A;  3S17 J;  2YS9 A;  3S15 J;  3VW0 A;  2NS8 A;  3LHQ A;  3QKX A;  4JKZ A;  1I3Q J;  5CW8 A;  2Y2Z A;  3E7L A;  3L1P A;  1Z77 A;  3OSF A;  3TP0 A;  2X48 A;  4DYQ A;  4A3F J;  2W48 A;  1RES A;  3MNL A;  4FE7 A;  1IGN A;  2YUS A;  5FLM J;  3KNW A;  2JA7 J;  2R5Z A;  1X2N A;  1W0T A;  1X2M A;  2LY9 A;  2ZCX A;  2LTP A;  2PMZ N;  5JLW A;  3K7A J;  4IHV A;  2K9Q A;  1XS9 A;  3HBL A;  3HTI A;  2L7Z A;  2E1O A;  1ZKG A;  4ICH A;  1OCP A;  4JX5 A;  4C3H J;  1JKQ C;  2E2I J;  3VVZ A;  4J19 A;  2DA4 A;  1VF9 A;  2MSY A;  3BR1 A;  1JJ6 C;  3V78 A;  1YRN A;  2CUF A;  3BR6 A;  2DMP A;  5C4Y A;  2M2E A;  5F08 A;  5J1U A;  3HE0 A;  3BR3 A;  1T33 A;  1FTZ A;  2CU7 A;  5FMP A;  3DCF A;  5FKK A;  1ZR4 A;  3IH4 A;  4UUS A;  2IEK A;  3PAS A;  2L7F P;  1PUF B;  1A6I A;  1MBJ A;  3S1N J;  3KKC A;  3P9T A;  1RKW A;  5M5Y J;  2JN6 A;  1B8I B;  1JKR C;  3ANG A;  1CQT A;  1TWF J;  5F0C A;  5EZG A;  5EG0 A;  3VW2 A;  2LFB A;  1HCR A;  5EDN A;  2R5Y B;  1ORK A;  1UI6 A;  2UXP A;  3NPI A;  1TWA J;  4XID A;  3VW1 A;  2HOA A;  2GFN A;  3SJM A;  1OJL A;  1R9T J;  3NNR A;  2V57 A;  3Q0V A;  1JUM A;  2CJJ A;  2NP5 A;  4CGR A;  4A69 C;  1WGX A;  3HB9 A;  2NX4 A;  2NVX J;  3NAR A;  1SFO J;  5GPC A;  3I4M J;  4MFE A;  3IV5 A;  2ECB A;  5EF6 A;  3LSR A;  3GTO J;  5AQC A;  3RKQ A;  4IHW A;  2UXH A;  4XK4 A;  2EZL A;  5D19 A;  1ETX A;  2LD5 A;  1Q1V A;  2XPV A;  1LE8 B;  4NN1 A;  5H9T A;  3PM1 A;  4JX4 A;  4FTH A;  2VPR A;  1G2H A;  3RH2 A;  2FJ1 A;  2XPW A;  2YVH A;  2Y9Z A;  4AF5 A;  1B72 B;  3S2D J;  1AHD P;  4HKU A;  2XGC A;  3G1M A;  1F36 A;  4C3I J;  2GM4 A;  2HYJ A;  1TWC J;  1TWG J;  2MW8 A;  3A03 A;  3DEW A;  1D5Y A;  2UXI A;  4I76 A;  1SAN A;  2DA3 A;  4B1R A;  4A93 J;  5J3L A;  3BR0 A;  4JL3 A;  3QBM A;  4A3B J;  4MXM A;  1ETV A;  2CQX A;  3O8G A;  4A3K J;  1JT0 A;  4ACI A;  2UXU A;  5M3M J;  2OI8 A;  3B81 A;  3BTJ A;  2R93 J;  3HTJ A;  2M0C A;  5F0F A;  2EZK A;  2G7S A;  1I50 J;  1JUP A;  2XPU A;  5K7H A;  3JRD A;  3GTP J;  2OF7 A;  5E3L A;  2EZI A;  4BKX A;  1P7J A;  4IHX A;  2NVT J;  2OER A;  1W0U A;  1OFC X;  2ID6 A;  3EGQ A;  1VND A;  1NK2 P;  2DMQ A;  3PO2 J;  1GVD A;  3SDG A;  1B72 A;  2GEN A;  3S1Q J;  4AYB N;  2R0Q C;  5IP9 J;  3RD3 A;  2TCT A;  2DG8 A;  3CWR A;  3PO3 J;  2GBY A;  3H3V K;  4FIS A;  2FX0 A;  3BCG A;  1X58 A;  5FKL A;  1O4X A;  2EBI A;  1QRY A;  3GTL J;  3HOU J;  3BTC A;  5M5W J;  1H88 C;  5IPA A;  5FJ8 J;  3VVY A;  5J1R A;  1XC5 A;  2ECC A;  5IYB J;  3WHC A;  4UUT A;  1MSF C;  4W97 A;  4XRM A;  3LJL A;  3BG5 A;  1P7I A;  5DS9 A;  4B3A A;  2E2J J;  3BJB A;  2JA8 J;  4YZE A;  3VVX A;  3IH2 A;  3Q0W A;  3LSG A;  4L5E A;  3TW6 A;  2M8G X;  3BRU A;  2LP0 A;  3ZQL A;  2D6Y A;  3S16 J;  2HI3 A;  3QQA A;  2ZCN A;  4FCY A;  4GFL A;  3VPR A;  2CQQ A;  3BG3 A;  4D5F A;  1DU6 A;  2GUH A;  3VUQ A;  5HSZ A;  3LNQ A;  1TWH J;  3BTL A;  1AU7 A;  2HXI A;  2HQ5 A;  2K9N A;  2JA5 J;  2EZH A;  5F27 A;  3OOU A;  1IUF A;  4DYR A;  3BR5 A;  2QKO A;  4PXI A;  5M3F J;  4JYK A;  2DJN A;  3M4O J;  5EGO B;  4BY7 J;  5EFY A;  1LFU P;  4Y52 J;  4RDU A;  2FQ4 A;  1E3O C;  2MG4 A;  2O9L A;  1JJ8 C;  3D1N I;  4M3G A;  1ETW A;  4Y7N J;  3CDL A;  2DA2 A;  4A3I J;  5IYD J;  4AC0 A;  3HTA A;  4DW6 A;  1YRN B;  3ZQF A;  2G3B A;  3BR2 A;  4A3M J;  5GPA A;  5J1Y A;  5F1J A;  3FK6 A;  1Y1W J;  3MVP A;  3WHB A;  3G7R A;  4EEF G;  4CYC A;  1U8B A;  3IH3 A;  3S5R A;  3JRC A;  1B8I A;  3A01 A;  1UHS A;  1GT0 C;  3CQZ J;  5E3O A;  4V2F A;  3FK7 A;  3E7Q A;  3KZ9 A;  2GLO A;  3TP3 A;  1QVT A;  3GTM J;  1FIP A;  1IRZ A;  3PPB A;  3HOY J;  2IBD A;  2DA6 A;  3G1O A;  1JT6 A;  1TC3 C;  2ME0 A;  3JSJ A;  4A3L J;  2G0E A;  1HLV A;  4GCL A;  5FKM A;  2QOP A;  1IG7 A;  3TED A;  3HIM A;  3BQY A;  5F04 A;  5EGO A;  1H89 C;  3S14 J;  4X6A J;  3BTI A;  4M3B A;  3JRE A;  1ITY A;  3H0G J;  2WUI A;  4MIM A;  1GDT A;  2VI6 A;  1BA5 A;  3JRB A;  4M3E A;  2O8K A;  5C3E J;  1BL0 A;  3CRJ A;  1JTX A;  1JTY A;  1T56 A;  1BW6 A;  2EQR A;  3K2A A;  3ZQC A;  3ON4 A;  2O7T A;  2Q24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...