4W97A

Structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
196
structure length
196
Chain Sequence
RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR2
publication title Structural and Functional Characterization of a Ketosteroid Transcriptional Regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 86
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w97A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w97A02
1TC3C 3S14J 2DG7A 3ZQIA 3HTJA 2YU9J 2ME6A 1MNMC 4BXXJ 3G1MA 5F0CA 4MFDA 3S1QJ 4W1UA 5FKLA 3B6CA 1DU0A 4KWAA 3COLA 1WCMJ 3LHQA 1O4XA 3K7AJ 1LE8B 2LY9A 3FISA 1MBEA 3K2AA 2VPRA 1IDYA 2LR8A 2XPUA 5GPCA 1VNDA 2ZCMA 3HDDA 2QTQA 3O60A 3Q3SA 3CQZJ 4ABZA 3A03A 4YZEA 4D7MA 2L7ZA 1HF0A 1TWFJ 4UUSB 3JR9A 1QPIA 1A5JA 3KNWA 3GTKJ 4AC6A 2COBA 1TWCJ 2Q24A 1FJLA 3G7RA 1RR7A 5DTDA 3BQYA 1IGNA 3GTMJ 5M3FJ 4JL3A 1FIPA 3TP3A 1AKHB 3ON4A 3S16J 2Y9ZA 2M9HA 3L1PA 2K9NA 2WV1A 5IYBJ 2DMUA 2ZB9A 3NNRA 2FD5A 3JSJA 4I76A 1HCRA 4JKZA 3RKQA 1DU6A 2NVTJ 3VIBA 3HTAA 4DYQA 2GLOA 1SFOJ 5E3NA 3IV5A 3B81A 2MG4A 5K7FA 2DA5A 1K83J 1ETOA 1Z77A 3IH2A 5D18A 5FJ8J 2YVEA 5C4JJ 3ZQLA 3GZIA 3D1NI 5F1JA 2NP5A 4DYCA 2QIBA 2LFBA 3GTOJ 1Y1WJ 3CCYA 1IC8A 3UKGA 2NVYJ 2DTZA 2XB5A 4MO7A 3A01B 3VW2A 1AKHA 4GCTA 1X2NA 4QSHA 1JKRC 1B72B 4V2GA 3KZ9A 1D5YA 3OOUA 1P7JA 1POGA 2DA1A 3NRGA 3FK6A 1YRNB 2PZ9A 2Y30A 4AC0A 1MBGA 2X9DA 5FHPA 2XGDA 3W6VA 2DA3A 5F0FA 4CGRA 2IBDA 4D7NA 3QPSA 1RESA 2G3BA 1WI3A 2E2JJ 3LSJA 2GM4A 2ID3A 2FJ1A 2O8KA 2R5ZA 5K58A 2HXOA 5IYDJ 3PM1A 3HTHA 1ZR2A 2JMWA 2G7SA 3ZQGA 2REKA 1UI5A 2EZKA 1SANA 4IHWA 5FKOA 3S2HJ 3CJDA 2FBQA 2R5YB 1W0UA 3ANPA 2DA2A 4B4CA 3LSPA 4MIMA 3IH4A 3JRDA 2HYTA 5IOZA 5EYRA 2L0KA 2JK3A 2QKOA 1K61A 1I3QJ 2K9QA 4JYKA 4GFKA 2EZLA 4A3KJ 1H89C 2HQ5A 4V2FA 1JKPC 5HAWA 5C3EJ 5HSZA 1MH4A 3BR1A 4DW6A 5H9TA 5DAJA 4C3HJ 3GTPJ 2NS7A 2EQRA 1GT0C 1ZKGA 2R7ZJ 1NK2P 2AO9A 3NAUA 4A3FJ 4BY7J 3F0CA 4XK4A 3QKXA 2GUHA 1RETA 4MXMA 3Q0WA 4JNNA 3KKDA 2LTPA 1EF4A 3S1MJ 3RD3A 4GCLA 2UXOA 3S5RA 3ZQCA 2QOPA 4M3BA 4C3IJ 2R5YA 1APLC 3FRQA 1JTXA 1I50J 5EF6A 2LVSA 2XPVA 5IOYA 2RHAA 2ZCNA 3LOCA 3HTIA 3BR5A 2E2HJ 3BQZA 1PUFB 1HLVA 3BG5A 3MVPA 5HODA 3HB9A 4IHYA 1ZK8A 3HGYA 1T33A 1RKWA 3BTJA 4IEJA 2CUEA 1UHSA 2HOAA 1A6IA 3WHCA 3PASA 3ON2A 4X1EA 2CQQA 1B8IB 4AYBN 1ZQ3P 5J1YA 3BHQA 3RZOJ 3BTLA 3VOKA 4GFLA 1IG7A 3TW6A 1CQTA 1JT6A 3S1RJ 2XDNA 4A3LJ 2MGQA 1AU7A 4MFEA 5AQCA 2IAIA 4JX4A 2QWTA 2D5VA 2O9LA 1RKTA 2UXIA 3HE0A 4M3GA 1WH7A 2G0EA 1IUFA 2OPTA 3VPRA 2NX4A 2RASA 3M4OJ 2Y2ZA 3VP5A 4XRMA 4BY1J 1UMQA 2XRLA 3GTGJ 4A3BJ 1RPWA 5M5XJ 3HEFA 1ETKA 4D5CA 1E3OC 2GENA 3QBMA 2R93J 3F1BA 1U8BA 5GPAA 2RAEA 1W0TA 2P81A 3OSFA 1IDZA 2TCTA 1OJLA 3EUPA 2MSYA 3GBGA 3JRBA 3BR2A 1LE8A 3A02A 5D1RA 5CXIA 5DS9A 2GFNA 2DA4A 4M3EA 4MK6A 3LNQA 4RDUA 4BBSJ 1GUUA 3JRCA 4A69C 2ZOYA 5BNGA 4UUSA 4I6ZA 2XPWA 4DZPA 3RQIA 4A3GJ 3HIMA 3S2DJ 1ETVA 4BKXA 4Y52J 2HKUA 3WHBA 3CWRA 2GBYA 4CYCB 4EEFG 2F07A 4S0HB 2LD5A 4L5EA 3G1OA 3TW7A 4D5FA 3JRGA 5J1RA 1ETWA 2JA5J 5F27A 1BW5A 5D19A 2LKXA 1AHDP 3GEUA 3VW0A 3T6NA 2KDZA 5M3MJ 3GTJJ 2JJ7A 3PO2J 2EZHA 1BL0A 3BNIA 5C44J 1MBFA 2X6OA 3CMYA 2HI3A 5IP7J 2X48A 3BTIA 2V57A 3VVZA 1ORKA 5EG0B 2M34A 1ETQA 1Z0XA 4FTHA 4A3EJ 2H1KA 3QPLA 3V78A 2DMTA 2JA6J 2M8GX 3DPJA 9ANTA 3VUQA 1WGXA 1WH5A 2DJNA 2ME0A 3SFIA 3VVYA 2DA6A 2YS9A 4BBRJ 3IUVA 4CYCA 1MSFC 3HOYJ 3A01A 1I6HJ 4A3JJ 4ME9A 2HDDA 4UDSA 1B72A 3JRHA 4DZJA 2ZOZA 1HDPA 4M6VA 1YRNA 4QIWN 3Q0UA 3H3VK 5K7HA 3NPIA 4FE4A 5M5WJ 3LWJA 4ACIA 1ENHA 3QQAA 3AQTA 3VW1A 2XB0X 5C4XJ 3Q0VA 2O7OA 2VI6A 1JKQC 5F04A 5EGOB 3ZQFA 5IP9J 2UXPA 4M3DA 5FGLA 3BR0A 3BG3A 1JJ6C 3IH3A 2DA7A 4QTRA 3HOZJ 5JLXA 2WGBA 1H88C 4C2MJ 4MLOA 2I10A 2Y0SN 2NS8A 1NK3P 2OI8A 2FX0A 2Y31A 3LSGA 1Q1VA 3PPBA 2LK2A 5JLWA 1F43A 1SGMA 3VOXA 2G7LA 2PMZN 4JP0A 3TP0A 1IJWC 4FCYA 1JGGA 4A3CJ 5EZGA 4B1RA 4RBOA 1VFCA 3S1NJ 3GTQJ 4A93J 1VI0A 4B3AA 1ETYA 1IRZA 3VVXA 3FIWA 3H0GJ 4FISA 5E3LA 1JJ8C 2DN0A 2ECBA 3CRJA 3HM5A 2MW8A 1UG2A 3DCFA 3I4MJ 2ZCXA 1BW6A 5M5YJ 1U78A 2CU7A 2ID6A 3MN2A 1ZR4A 2W48A 3ZQHA 1TWAJ 2JN6A 2K9SA 3E7LA 2HOSA 1Y1VJ 3JREA 1JUMA 4XICA 3HBLA 2OERA 5HBUA 2LLKA 2VKEA 2XGCA 4XRSG 3LJLA 5F0HA 2NVXJ 5CXGA 3I4NJ 4JX6A 5E3OA 5IPAA 3JRFA 2B63J 3MKLA 2WAQN 2PBXA 4XRSA 5CW8A 1XS9A 2XSDC 2EZIA 2R0QC 2E19A 2XGEA 3C07A 3EGQA 3TEDA 2IEKA 2LP0A 1GVDA 5FKKA 2H8RA 2CQXA 1MSEC 3HOWJ 1FTZA 1MBJA 1PUFA 1BJZA 1X58A 5FLMJ 1HDDC 4W97A 1LFBA 5FKMA 1ZGWA 2HXIA 1B8IA 3S15J 3PO3J 1BA5A 2O7TA 4PXIA 1FIAA 1QVTA 1U9OA 1LFUP 3S17J 3JRIA 1OFCX 1MBHA 2TRTA 5J1UA 4NDLA 2G7GA 2QCOA 3O8HA 4M3FA 3HOUJ 3BRUA 1S7EA 1FEXA 4HNVA 2JWTA 4FE7A 1OCPA 2W53A 2YUSA 2M2EA 3FKIJ 4Y7NJ 3MNLA 1U9NA 4NELA 3V6GA 1IV6A 2R5ZB 5FLVA 3FK7A 3SDGA 2UXHA 3ZOBA 2VUMJ 4AUXA 5IP6A 5K7ZA 1XG1A 2E2IJ 2WB1N 4A3DJ 2L7FP 3ANGA 3E7QA 2K40A 3DEWA 2FQ4A 5C4YA 1JKOC 3BG9A 4AF5A 2R92J 3NXCA 2CJJA 2HYJA 1G2HA 5FMPA 3G56A 3P9TA 2Y9YA 2AHQA 1TWHJ 2JA7J 3O8GA 3HOXJ 4IHVA 5J3LA 1H8AC 3RH2A 1MBKA 1JT0A 1VF9A 2DMQA 4J19A 2VKVA 3OSGA 1ETXA 4IHXA 1GV5A 2JA8J 5E3MA 3SJMA 4HKUA 4XIDA 3G1LA 2DMNA 3JRAA 5GP9A 1OCTC 2NOGA 1XC5A 3LSRA 4A3IJ 2OF7A 2ECCA 1R9TJ 4G12A 1QRYA 3BR3A 3BTCA 2HOTA 5F08A 4L62A 4A3MJ 2QF7A 2WUIA 2NVQJ 2YVHA 5FKNA 4GFBA 3AQSA 1GDTA 5IYCJ 4LOCA 5EG0A 2DG8A 3BCGA 4GCKA 2L7MP 2L9RA 1MH3A 2CUFA 3BT9A 2M0CA 1TWGJ 2E1OA 1UI6A 3HOVJ 4ICHA 1ZTRA 3KKCA 2D6YA 3B6AA 5EEAA 2EBIA 4UUTA 3NI7A 2CRGA 4C3JJ 3HKZN 4X6AJ 5EZHA 2N8GA 1NTCA 3CDLA 3OIOA 3HGGA 1JUPA 4JX5A 1GV2A 1P7IA 1ITYA 3NARA 3BJBA 1WPKA 1JUSA 5EDNA 2DMPA 5EGOA 2KT0A 3BR6A 2NP3A 2UXUA 4NN1A 1QVUA 1X2MA 1HOMA 3RZDJ 3GTLJ 2ELKA 2EH3A 1T56A 5EFYA 1FTTA 1JTYA 4DYRA 3C2BA 2IU5A 1F36A 3M3YJ
chains in the Genus database with same CATH superfamily
5HS8A 3U21A 2IT0A 4RGSA 5B3SH 4QPQA 1U3EM 4KN4X 5F0CA 4C30A 4AVPA 3DU6A 2OQGA 3ROUA 2ZNZA 3COLA 1WCMJ 2IXSA 2DFIA 3K7AJ 3LSIA 3FISA 2LR8A 1VQ9I 2ZCMA 3RJPA 3HDDA 2CO5A 3Q3SA 3A03A 2QSFX 3BJAA 1R5ID 2L7ZA 5E79C 4AC6A 2NRAC 2COBA 5LGTA 3G4SI 4XLCA 2CW8A 2XKOA 3G7RA 1XSXA 4KUMA 4JL3A 2K5CA 1N75A 2HU9A 4JBAA 1MJ9A 3S16J 1BBYA 2RNJA 3CJRB 3S32A 4U0WA 3A1YA 3NNRA 4IPAA 4I76A 2E1CA 2EFQA 1BOBA 1W4MA 3VIBA 2GLOA 4BJTA 3DEUA 5E3NA 1QU3A 3NS4A 1OYWA 3GFMA 4NB5A 2W57A 4DQ2A 4BE2A 5CKTA 2YVEA 1D3YA 3PIOF 2IPQX 2P6TA 2MA3A 4KIBA 3QOEA 3QPHA 3I5UA 1W7PA 2STWA 2QIBA 5KCMA 2QQ9A 1YJWI 2X1DA 3UKGA 2NVYJ 3DLLF 4II3A 1LKXA 1RI7A 3A01B 5CVUA 1AKHA 3KZ9A 4MGRA 5E20A 1FWZA 3C2GA 1POGA 3RYPA 4A0ZA 1CGPA 3EETA 3NRGA 3RI4A 3K0LA 5D4RA 1X4PA 2KLOA 4LITA 3IL2A 2GZWA 3E3VA 5F0FA 2IVMA 2BXYA 3LL7A 1YS7A 2GM4A 3PSIA 2ID3A 2JVHA 1XPXA 4H4KC 5K58A 3KIOA 5IYDJ 3HTHA 2AQEA 3RQ4A 1XD7A 1IXCA 2M7BA 3OYEA 2REKA 2L9SA 4CCMA 5FKOA 3CJDA 3ANPA 4B4CA 3JRDA 4YG2F 3IH4A 1UAAA 5IOZA 4PDKA 2L0KA 3JSOA 2CS3A 2QKOA 3D5SC 4A3KJ 1H89C 4V2FA 5DD8A 1LQ1A 1JKPC 1I6XA 5C3EJ 1MH4A 4XBFA 3SXYA 1EH6A 5H9TA 3H9GA 1BR1A 5DAJA 4M9XA 5FB2A 2JRMA 2LREA 2NS7A 1ZKGA 1VQ8I 4IL6C 4HDVA 1NK2P 2H27A 4A3FJ 1RR8C 2YR2A 4KN7X 3ML6A 3ELKA 4MXMA 1EF4A 3S1MJ 3RD3A 4GCLA 3R0AA 2VPLA 2XKPA 2P5LC 3CP2A 5D8LB 2JTVA 2VJ5A 1ZG5A 4C3IJ 1ZRDA 4NC8A 1VTNC 3FRQA 2ZXWH 3FZVA 2RHAA 2XAFA 1E3PA 3BR5A 3KZIC 2E2HJ 3E6CC 4OIOF 4EATA 1O7FA 1T6SA 3BG5A 5HODA 2MC3A 3HB9A 1KGSA 3CCVI 3CMMA 3TGNA 1UHSA 2W7NA 4LD5A 1OQYA 1CF7A 3BCAA 5JR3A 3ON2A 2R7DA 2ZY9A 3IUOA 5J1YA 2CW0F 3NWTA 4PSWA 3RZOJ 1KA8A 3COAC 3VOKA 1JT6A 1LNWA 3IP4B 2PLYA 4A3LJ 3VSLA 4JQFA 4MFEA 4AIJA 4UNOA 4JX4A 5EEHA 3EYYA 2FBHA 2DLLA 1DP3A 2OPTA 4OWRB 4O3MA 3BPVA 2AXTC 3VB2A 2Y2ZA 4XRMA 4G7HF 4A3BJ 4YFXF 1WJCA 5M5XJ 3KP4A 1ETKA 2B1EA 4D0PA 4XQFA 3QBMA 3F1BA 5GPAA 2Q2EA 4I02A 4B44A 5L3BA 3EUHA 2V26A 1IW7F 2ZXHA 2TCTA 1OJLA 5LHGA 3EUPA 2MSYA 3GFIA 2KDOA 3BR2A 1W7PD 3TO6A 4M3EA 4HSRA 5LRRA 1GUUA 2XC7A 2DDAA 2GXBA 3ZGKA 2ZOYA 2M87A 1REPC 2PBIA 3HC7A 2XAHA 4DZPA 3SZPA 2L7KA 4A3GJ 3S2DJ 2IS6A 1JGSA 3OYKA 2XDVA 3QP6A 3BJOA 4Y52J 2HKUA 1IN6A 3CUQA 5FGMA 2KPMA 4EEFG 2BW3B 1BI3A 2UV1A 4D9JA 2F07A 4RGRA 2HDCA 2Z9OA 3QP5A 2EFWA 4E6KG 1ETWA 2JA5J 2EFPA 1V4RA 2K02A 5F27A 3TL4X 2PMHA 2W25A 3HJEA 5TGTA 5D19A 1ZELA 4F92B 2FNAA 3U1KA 2NYXA 2P7VB 4GO1A 2HWVA 3F21A 5FD6A 5C44J 1SC7A 2MH9A 2VOOA 4E7JA 3GFLA 1DDNA 2HI3A 2DYRH 2X48A 3BTIA 4HW0A 4ZYGA 4M9ZA 1Y6IA 2M34A 1ETQA 1Y8RB 3ZR8X 4BHCA 4FTHA 4LGWA 2H1KA 4Q5SF 3V78A 2JA6J 3BCBA 5ED4A 2ME0A 2NVUB 3SFIA 2E1MB 1A6QA 1I39A 4XORA 1XDUA 5E1XA 2CSOA 5FROA 4U0YA 1I6HJ 3KYCB 3CO7C 1ZHFA 4ESJA 1B72A 3ZMTA 4DZJA 5AIPA 4EVIA 2ZOZA 1HDPA 3DKXA 1R4NB 4OINF 2R7QA 3L2WA 1Z91A 1G8XA 2E36A 5K7HA 2QBYB 3H3VK 5M5WJ 1X3UA 4OOIA 1F4KA 3J7AO 2IS2A 2JSPA 4ACIA 1HSJA 1GXQA 3VW1A 2XB0X 2F5EA 1OR7A 3BG3A 4TV7A 2M5WA 5JLXA 2E1MC 5L3EA 3ABMH 3C18A 3BLYA 1Y56A 2I10A 4FASD 5J4YA 5KNLA 3K4JA 1ZGAA 4BHBA 3LSMA 4Z6YA 4LB5A 2Y31A 3LSGA 4G9YA 4XLHA 2LK2A 3DTEA 2VQCA 3ZN0A 3VOXA 1YHQI 3QODA 5D6FA 4JP0A 3HL2A 2E5NA 4FCYA 1IJWC 3A2KA 4A3CJ 3WU1B 1Z05A 5EZGA 4RBOA 2QEXI 3PL8A 4B3AA 1DQUA 2OV7A 1IRZA 5DD4A 4HNUA 3BWGA 5E3LA 4C2TA 4NC7A 2FF4A 2ECBA 3KETA 2H94A 4CXFA 1X19A 1UG2A 3BC8A 2LG4A 3PIPF 2W48A 4HF2A 2K9SA 4E7IA 2BXZA 1R5GA 1Y1VJ 1Y0UA 3TMOA 4XICA 3F72A 1O57A 3KLNA 2LLKA 5A2QK 2VKEA 2NVXJ 5CXGA 3I4NJ 4LB6B 4JX6A 4XN3A 4OD5A 2NNNA 5IPAA 4JK1X 3TDZC 2XHKA 2XAQA 3LAJA 2HPMA 3GXOA 2ETHA 1OMIA 1FTZA 1MSEC 3HOWJ 1QZEA 3FX3A 1VQNI 1STZA 1G3SA 1PUFA 2VONA 4XOTA 1Z3YA 2V1DA 4MEXF 2DXIA 3P5JA 1HDDC 3FXMA 2W00A 1YYVA 2C6YA 3CLOA 3TO7A 3CD6I 2K86A 1U0JA 1MMNA 5JFRA 2VQGA 3HTSB 3VODA 3QYFA 3DBLB 4ZDPA 4V19K 3AG2H 1LFUP 1WJDA 1MBHA 2CV1A 2VB6A 1WJAA 2VKDA 1YFHA 1YE9A 3ISPA 2PI0A 2G7GA 2QCOA 4IVNA 4DJAA 2F4IA 3DKWA 3IAM2 3K4MA 4GYGA 3QRFF 4HNVA 2V1NA 4FE7A 2ZC2A 2YUSA 4NELA 4KYWA 3WG7H 3F23A 4IRIA 2OU2A 5KAIC 2UXHA 3GZ5A 3BOQA 1ERDA 1J7KA 3B02A 2HS5A 5D5UB 3I56I 3MKYB 2NOJB 2L7FP 3EYIA 5HNFA 2FMLA 4KDPA 5EEGA 3BG9A 2QWWA 2CJJA 5B5EC 1RC9A 1YW7A 2CQNA 4BS9A 5D5XB 1UG0A 1H8AC 5CYVA 1MBKA 1R49A 3RH2A 1VF9A 4LK1F 2NS0A 4N4NB 3VSKA 4E7LA 2QA4I 5FD5A 2VJIA 5A2QZ 4YFNF 1R4MB 3JCUC 5GP9A 1OCTC 4ESFA 2NOGA 1TZLA 4JOMA 4ENNA 5L3CA 3H3UA 1VQOI 2PMUA 4HV5A 4Q48A 1Z3XA 3I58A 5FLXK 4PGGA 4CCJA 2YVHA 3O3KA 1MD0A 1GDTA 3JAMK 5EG0A 3F22A 1WJBA 1X1AA 3CJNA 2OTLI 2LSOA 2X1EA 1B9NA 3BT9A 4UVAA 1VQ4I 1TQMA 3K2ZA 2E1OA 2M3AA 4KISA 5GAEJ 2IGKA 3HOVJ 1LUJB 2V9PA 3SYTA 2D6YA 3B6AA 1QPMA 3OS0A 2EBIA 5AIQA 1SVLA 4C3JJ 2X6WA 4EJWA 2R7TA 2VKHA 3IKTA 2E34A 1JUPA 5HS9A 3OL4A 1PYVA 3GMEA 4AIKA 4KITB 4XLFA 3GTLJ 2UWMA 4PZJA 2H09A 1W1WE 2A6EF 3C2BA 2IU5A 1F36A 1OYYA 4ZTFA 3M3YJ 3S14J 2DG7A 3D5RC 1TP4A 2DW4A 3ZMUA 3ZMZA 2LF7A 4ZZDA 2ZMEB 4F7ZA 1IN5A 2H8WA 3BPXA 3G1MA 2PG4A 3FF5A 1W5SA 2HTJA 4W1UA 1I3AA 3B6CA 4KWAA 4KIFA 5D6EA 1VQKI 3LHQA 2R7FA 1ZG3A 3WTYC 1S6LA 2D1VA 3K2AA 5JVGF 2XPUA 4UY8I 2WA0A 1KZHA 3K4NA 2GQQA 3CQZJ 2ZJRF 4XNFA 4F52A 4YZEA 3C3WA 3JR9A 1A5JA 3E6DA 1QPIA 1R36A 3J7ZI 4DVYP 2WY7Q 2ZFUA 1AA7A 1K7AA 2A5WA 1FJLA 4WX9A 4CSWA 3P9IA 2GOMA 3BQYA 3DP7A 1T0FC 1FIPA 3EUAA 3TP3A 2ZMEC 2KZGA 4WXHA 3K10A 3GZ6A 4UVCA 2Y9ZA 3L1PA 2RGVA 1IXSB 4G8XA 2YVXA 2K9NA 2L2OA 3KP3A 2DMUA 1QGPA 3JSJA 3ERED 2GIVA 1HCRA 3OS2A 4JKZA 1SMYF 2NVTJ 4DYQA 4EQQA 5FLXZ 1TL8A 2LBFA 3DEEA 4KA4A 3CTAA 3JAMZ 2DA5A 3X2QH 1ETOA 1ON1A 3PQKA 4J00A 3P7NA 4XM3A 5D18A 4CCOA 3GZIA 1WQ2A 3PNTA 1MJAA 3D1NI 5F1JA 3ABLH 4DYCA 2EV0A 4YFKF 3GTOJ 2H1LA 1Y1WJ 1IC8A 2RREA 2EV6A 3QWLA 1ZARA 2DTZA 1ZYRF 3FM5A 2ZSIB 1S5LC 2JPBA 3VW2A 1B72B 1ZN2A 2K9MA 4V2GA 1D5YA 3OOUA 2W1OA 1T2KA 2Z3YA 3FK6A 1HC8A 1R1UA 1UJ8A 1MBGA 5FHPA 3ZMSA 2XGDA 2ISYA 2DA3A 2VE8A 2PX9A 3JTHA 4BEHA 1YO5C 4D7NA 3QPSA 5DCMA 4LLLA 4LK0F 1WI3A 2DQLA 3HPHA 3LSJA 2LDUA 3BG6A 2BV6A 1KQ0A 1GVJA 2CQ7A 2HXOA 2JUCA 3G2BA 3ZQQA 2R5ZA 1HA8A 1FNNA 3D5LA 1ZR2A 2JMWA 3KYLA 3ASOH 2ZXIA 3H5NA 4S04A 4K2EA 5ICGA 3AG1H 4CH7A 1SANA 2FA5A 2F5DA 3AAFA 2WAFA 2R5YB 1W0UA 1T08B 4N9IA 4MIMA 2ZO4A 5CVJA 3J7YJ 4Z2YA 4A12A 1R1VA 2HYTA 4E4HA 1YQAA 5EYRA 2K9QA 2HQ5A 1X1BA 1K4SA 4U9NA 3OMYA 3KP6A 3T1BA 3WGHA 3HSEA 3MKZA 3GTPJ 2R7ZJ 2HPIA 1K6YA 2H6CA 3J81K 4BY7J 4XK4A 5D5VB 2CGPA 3QKXA 1T98A 2GUHA 1RETA 3WGIA 4O6JA 1J5YA 2LTPA 3SFZA 2RDPA 4HG2A 2CYYA 3I53A 4LG3A 5DCFA 3ULQB 1TT0A 2UXOA 3S5RA 1OCOH 2AXLA 3G71I 4PJ0C 1SMTA 3EUKL 3ZQCA 3ZCOA 1I1GA 5HDNA 4RAFA 3J80K 4CCLA 1APLC 4HRIA 1I27A 1JTXA 2HTSA 3M7GA 4BJ5C 4BUPA 2XPVA 1LDDA 2WY8Q 4XN0A 4BE0A 1YTYA 2ZCNA 2KP6A 3ZXSA 2K4BA 1PUFB 1HLVA 3T8RA 3HRMA 2P5VA 1YIJI 3EDPA 1W5TA 1RKWA 3S93A 4LFUA 2XVCA 2CUEA 2XAUA 1A6IA 3KX2A 2DDBA 3WHCA 3PASA 3TDUC 5DM6F 5L3FA 2H6BA 2B9SA 2ELHA 3GZNB 1FP1D 2X0LA 3S1RJ 2XDNA 1TNSA 3KEYA 1MGTA 2MGQA 3HUGA 1E3HA 1AU7A 4DNCA 3FKJA 2IAIA 5FRMA 2QWTA 1QZZA 3GW2A 4BXFA 2UXIA 1USSA 4MNUA 1IZ1A 2G0EA 3P9CA 3VPRA 1XN7A 3A0HC 3LQQA 1UMQA 2XRLA 3QYBA 4I98B 4EJTA 2WBMA 1NH3A 2R93J 2BY2A 1U8BA 1BN5A 1TTYA 3HSFA 4XLNF 2X6YA 4AVZA 5BS6A 3KZYA 2BBYA 5FO5A 5D1RA 3GBGA 1LE8A 3A02A 4KICA 2HNHA 5CXIA 4OAZA 1FBSA 2DA4A 2IGOA 1SFUA 3LNQA 2RV8A 2EB7A 2OQRA 4RDUA 3QAHA 4ENMA 1IAWA 3GWZA 4I6ZA 3F3XA 3ZMDA 1SAXA 2KRCA 5BMZA 3GYHX 3WHBA 3DU5A 3IWZA 2GBYA 4CYCB 4YEJA 3J81Z 3CC2I 3DV8A 2L9VA 2LD5A 4L5EA 1PUEE 3G1OA 5L3GA 2EV5A 3S2WA 4RGUA 2WAEA 4D5FA 4EV0A 3JRGA 1U2WA 1AHDP 4BQOA 3T6NA 2FRHA 1YX5A 2VC1A 5J6XA 4WK8F 3GTJJ 2KDZA 2JJ7A 2F48A 1BL0A 3BNIA 1ZAOA 2RNGA 2YX4A 3J80Z 1W36C 1S29A 1LFPA 4EJUA 2FBIA 2ZSHB 2A6HF 3WE3A 3OYLA 1FSEA 4U7BA 5EG0B 2RC4A 1BOAA 2FU4A 4A3EJ 3K1NA 2I8DA 1O3SA 1FMVA 1YX3A 3VYSB 2PJPA 3VEPA 3R6SA 2V1UA 2YS9A 4BBRJ 1V5FA 2EIKH 3ZRGA 1MSFC 3HOYJ 2QGUA 2OUMA 4I99C 4UDSA 1H9GA 5H2FC 4IHSA 1D5VA 4NHJA 1YRNA 2FBKA 2HYFA 2ZKZA 3F8NA 4PSXA 3OYDA 4KNYA 3QQAA 3Q0VA 2O7OA 2VJJA 3BP8A 3OOPA 5IP9J 2P4WA 1P9QC 3BR0A 1IRGA 5FGLA 4I01A 3MD2A 4G94A 3IH3A 4IO9F 2DA7A 3K70C 1EA3A 1BR4A 1QA6A 4L9JA 1XCVA 2FUG2 4C2MJ 4Y13A 2KKOA 5JVTA 2JRTA 2NS8A 2VN2A 3A4CA 3KPHA 1NK3P 4L0ZB 3OS1A 2FX0A 1E0EA 2OI8A 3MQ0A 1E17A 2CUZA 3LSKA 5F6FA 4L9VA 4GYIA 2XAGA 2WTEA 1Y0NA 3TP0A 1JGGA 1VFCA 4AU7A 1P2FA 1ONVA 1MW7A 4A93J 1MIJA 1WZ2A 3FWEA 2M45A 3BJ6A 3H0GJ 2J5OA 1B9MA 1N25A 1P4XA 5DEQA 3WTXC 2F5FA 2MW8A 3HXLA 4A5NA 3I4MJ 5E8IA 1WWXA 3RYRA 4ZH4F 2CU7A 3MN2A 3WTWC 4I0BA 3ZQHA 2EK5A 2JN6A 1YIOA 2AQFA 3KFWX 1KYWA 2OERA 1JHFA 1EH8A 5E3OA 3AFHA 3NRVA 4IX7A 3MKLA 1XGMA 3MZYA 2VT2A 3DFGA 4ETSA 5K5OA 4XRSA 1XS9A 1ACIA 5CW8A 2R0QC 2LBFB 4DBRA 1FBQA 3EGQA 3E97A 2CQXA 3VYUB 1ZGJA 1X58A 2ELJA 5CVVA 2VXDA 3CJTB 5FLMJ 2QZ8A 2KIQA 1MMSA 1FT9A 5FKMA 4XKVA 2DFEA 2CQKA 3BY6A 2KIMA 3K1PA 2KJBA 1Z6RA 4B47A 1NG7A 1U9OA 2W24A 4FT8A 1YOVB 3N05A 5CQGA 4YIIA 4HBLA 4S05A 1T39A 3S17J 1OFCX 1GLNA 2TRTA 4A6DA 3T8TA 3ZMVA 2QKLB 3E6BA 4GXOA 1VQLI 3RKYA 2EIMH 3DTKA 2WC2A 1TW2A 2Z2SB 4M3FA 2KFDA 3HHGA 2KISA 1S7EA 1X3ZB 3IRQA 1U6GA 2W53A 4P5OA 4Y7NJ 2O03A 3NQOA 3CF2A 1IV6A 1QHGA 2R5ZB 1K78A 4C2MA 4OMZA 5FLVA 3OYMA 4CO8A 5TISC 2VUMJ 2PJRA 5IP6A 1F9NA 1E2XA 2M4KA 5LBQA 5K7ZA 4Y17A 3A0BC 1EH7A 1Z67A 2R7RA 3E7QA 3VOEA 4B8XA 3DEWA 2FQ4A 4WF2A 3TKYA 3ABTA 2QVOA 1G2HA 3OV8A 5FMPA 1SD7A 2PQ8A 6PAXA 3P9TA 4QWQA 5JI6A 2OCCH 1Q1HA 3O8GA 4IHVA 5J3LA 3H5AA 1MDMA 4CHUA 2DMQA 3P9KA 1U8RA 4ANJA 2VKVA 1FX7A 4HV6A 2V6EA 2FEZA 2KMUA 1GV5A 2DFFA 2K85A 2JA8J 2X85A 1S8NA 4A5MA 3SJMA 4XIDA 1X1DA 4I09A 2DT7B 4FQGA 2O5RA 3HRTA 5D8KB 5GAGJ 2DT6A 5TJJA 1XC5A 3LSRA 1IF1A 4HPQA 2ECCA 5DUKA 3QU6A 4KMUX 3RKWA 3CMAI 2HOTA 4L62A 2BY0A 1G59A 2QF7A 1A35A 2RN7A 3CF5F 3LQRA 4PFPA 5FKNA 4LIUA 2CFOA 2FOKA 2G9WA 3F8FA 4LOCA 3UR3C 2F4OB 1R6RA 2L7MP 2NAZA 4MQ9F 1PP7U 1DUXC 4G7ZF 5E17F 3FXKA 3JSPA 2QYOA 5BPDA 2E5ZA 3Q9SA 4ZYEA 2Z16A 3CESA 4NC6A 5J47A 1D8KA 1ZTRA 3KKCA 3GCMA 1IN7A 4UUTA 2IW5A 3NI7A 3GF2A 1NHAA 5EZHA 5KAFC 1NTCA 2GA2A 1UFMA 4AD9A 3DKYA 1GV2A 1ITYA 3NARA 2P7CB 4MHGA 2E7WA 2D45A 1JI8A 3BJBA 4G7OF 2DMPA 2Z33A 5EGOA 3BR6A 2ZNYA 2NP3A 4NN1A 3RZDJ 1MNDA 1PJRA 4CICA 3SEQA 2EH3A 2B7EA 3LAPA 1T56A 3B73A 1BC8C 1XTAA 2KRHA 3U2RA 4M72A 1AOYA 2XROA 2V9VA 2OCEA 2EILH 3OYAA 1TC3C 3ZQIA 4HNTA 2L54A 4WIBA 1M1EB 2ZJPF 2WADA 4BXXJ 2IS1A 4MFDA 2K7LA 5FKLA 1DU0A 3WU2C 2JQ7A 3K4LA 4RGXA 4FX4A 1LE8B 3S3MA 3F8MA 1MBEA 3W3CA 4XR6A 5DYMA 3PUBA 5GPCA 1VNDA 2X1CA 3DPTA 5FRNA 4ABZA 2M7AA 1HF0A 1TWFJ 5B1BH 1B59A 3KNWA 1W7PB 2P8TA 3GTKJ 2E1NA 4B09A 2Q24A 3ABKH 5K5RA 2R4GA 1RR7A 2DPDA 3L2QA 1JXSA 1IGNA 5LHIA 2L4AA 5M3FJ 1WVRA 1AKHB 1RZ4A 1FY7A 3SQNA 2OC6A 2FJI1 3EPZA 5IYBJ 2ZB9A 2FD5A 4YIFA 3HTUA 2HQAA 3RKQA 1DU6A 3PUFA 1KQ8A 2VXZA 3Q9VA 3G3ZA 4M73A 5K7FA 2YPRA 1K83J 3S8PA 1Z77A 3IH2A 3LMMA 3V42A 5C4JJ 3H0DA 3ZQLA 2G7UA 4R8HA 4Q4ZF 3V8JA 3FBNB 4DOZA 4UV9A 2D2WA 2LFBA 3CCYA 3TO9A 5B1AH 2OJED 3K4CA 1ON2A 1OPCA 1JHHA 3E5XA 1IUYA 1MZBA 5E1ZB 1R23A 3FMRA 1X3WB 2A61A 5HVQC 2AS5F 3CUOA 3F6VA 2PFBA 3RDIA 4AM3A 4GGGA 1JKRC 5H6QA 3OYIA 1B1BA 2HR3A 4RS8A 1R7JA 3KZZA 4ENKA 3RSNA 3L2RA 1XB4A 1YG2A 1YRNB 2X9DA 1YS6A 1WKMA 5CVIA 1BI1A 4CGRA 3DQVC 2IBDA 4PFOA 3TQNA 1RESA 2UZKA 4UB8C 1XMAA 1HKSA 2QKMB 4RA2A 2O8KA 2K3PA 2BGCA 2ESHA 3CCRI 2RKHA 3ZPLA 2OAZA 5JHFA 2G7SA 1WSUA 3O6BB 3MWMA 4XKBA 1UI5A 3CCLI 2EZKA 4I0AA 4IHWA 1ZG1A 3EQLF 3FDYA 1J9IA 1XX5A 5AONA 5HS7A 2MC4A 2TDXA 4LG0A 2GA1A 4ZDOA 2JK3A 2L5QA 5D5WB 3LSHA 4Y3OA 3JW4A 1I3QJ 1O7LA 4GFKA 2VASA 5HAWA 5HSZA 1IRXA 2QQBA 3BR1A 1P6RA 3MAJA 4C3HJ 3OIQA 5KHDA 1CF7B 2AO9A 3NAUA 3DLAA 4YELA 1B4AA 3HRUA 3F0CA 4HF1A 1V5EA 3KCCA 1BM9A 5LRSA 3Q0WA 4JNNA 2IP2A 4A2UA 1UELB 2DT5A 3FHZA 1XCBA 1MJBA 4ZZLA 2VC0A 2O61A 1KU9A 4M3BA 3M8JA 4D1QA 4IHTA 2CFXA 1I50J 1R5HA 2GXAA 2LVSA 2COMA 2BHYA 2OZ6A 1QQIA 4P9FA 1DPUA 3IWFA 5KK1A 3OYHA 2JT1A 1RUNA 4KMFA 1TBXA 5ILSA 2Q2EB 4N4OB 4IHYA 1G3WA 4RAGA 4L18B 1I1SA 2HOAA 2VL8A 2GXGA 1XDSA 2CQQA 3R4KA 4IRGA 1ZQ3P 3CC7I 3S3NA 4ZTJA 3BTLA 2LF8A 1IG7A 1CQTA 3SWHA 3CP8A 4HEA2 2FSWA 4RAZA 3GX4X 2DPUA 1Y39A 3AG4H 4Q47A 2DCEA 3RPUD 4XLEA 4ASNA 3CUQB 2O9LA 5LD2C 1ZRFA 4M3GA 1IUFA 4IQ4A 3BG7A 4E7KA 2NX4A 3M4OJ 2VODA 3EUHC 3AKZA 4D5CA 1E3OC 4BGDA 3Q5FA 1MNEA 1ZLJA 5CLSA 1W0TA 1Z7UA 3FMQA 2P81A 1KQ9A 3OSFA 5LEJA 2ICWG 2Q1ZB 3N97A 2PJRB 3JRBA 1FSHA 1FPQA 3OYJA 1WJFA 1HKTA 1J0RA 3OYCA 3RTRA 3JRCA 4RB3C 4L9NA 2ACJA 5BNGA 4UUSA 2VIXA 1YLFA 2CW7A 3CUQC 5LGNA 2XF5A 3SZGA 3HIMA 4HZFA 1HQCA 3WTUC 3MKWB 1XGSA 1S3JA 2EA2A 2XRNA 2MBFA 4L5IA 3FXJA 4CGZA 1UCRA 2EPFA 1YW9A 3ABUA 4S0HB 1VQ7I 1VQ6I 2W82A 2V7FA 3TW7A 2OA4A 1IV8A 1FOWA 2HVQA 3W2AA 3F8CA 4HX4A 5J1RA 4N0BA 5GTHC 4B43A 4HQMA 5HOOA 2LKXA 1BW5A 1U5TA 2DOEA 4PJMA 3GEUA 2XSJC 3OYFA 1RIOH 5DDGA 2JA2A 2IRFG 4BNCA 2EZHA 1W36D 1LVAA 1OYIA 1FZPB 1MBFA 2DYSH 3CMYA 4IZZA 5LFAA 2Z1DA 3VVZA 1ORKA 2HKXA 3LA2A 1Z0XA 3QPLA 4A0XA 2KZVA 2M8GX 2LOOA 4FETA 5H6RA 9ANTA 3DPJA 2DJNA 1KU3A 2DJIA 3VUQA 3GEZA 3LFKA 3DBHB 1Y8QB 2ADUA 3DBRB 5HDKA 3CCEI 5H20A 1VQPI 4ME9A 4EM1A 2HDDA 1HW5A 5EJCA 4IKFA 5KVRA 1YW8A 2Q8KA 1XSDA 3Q0UA 3LA7A 4L5JA 2Y69H 4IOAF 2PFVA 3ECHA 1ENHA 4B3XA 5E18F 1OR7C 2V4JC 1MKMA 1T38A 3OL3A 4XKCA 2STTA 2IS4A 2VI6A 3TOBA 5DM7F 2A5YB 1JKQC 4WXDA 5EGOB 1Z7LA 3K1MA 3TOAA 4XLPF 3K70D 3V8KA 4M6XA 3L09A 3MCZA 3AL0B 2WGBA 5GAHJ 2O6GE 1EJ9A 2GIZA 3AG3H 1S7OA 4XKWA 1YITI 4KIGA 2HDWA 1NG6A 3H9JA 1Q1VA 3PPBA 4EM2A 1F43A 1SGMA 4CZZA 2VBZA 4DBQA 4B1RA 1HSTA 4F93B 3GTQJ 4E7SA 1ETYA 1YJ9I 2L9NA 3VVXA 2QBYA 4FISA 3KE2A 2EWNA 5HLGA 3SZTA 2FXAA 3CRJA 3HM5A 3H1CA 1X4OA 4DGWB 1XSVA 4UUVA 3AL0C 4IF4A 2DBBA 1FOXA 2ZCXA 1U78A 1UHWA 1ZR4A 4HF0A 4CDGA 5ILVA 3R0JA 2HOSA 2Q0OA 3E7LA 4DIQA 1JUMA 2EA4A 3C7JA 2KRFA 3HBLA 3JREA 4ZC3A 5HBUA 2XGCA 4XRSG 3LJLA 5F0HA 1LPQA 5GTIC 4BHPA 3GLLA 5FFZA 5LHHA 4I7HA 2B63J 2HFHA 3K4KA 4RLQA 1UHMA 2XSDC 2BOLA 2D1HA 2DK8A 1OLTA 2E19A 2XGEA 1XMKA 3C07A 2IGMA 2IEKA 2LP0A 5FKKA 1J2XA 1WRJA 4CZCA 5LEKA 3CCSI 1BJZA 4HA8A 3CDHA 4XSXF 1LFBA 2LMDA 4II2A 1ZGWA 3FM3A 2CUJA 1R00A 4PJJA 1B8IA 3S15J 3PO3J 1H0MA 3VTIA 4UV8A 1KU7A 4CCKA 4RLFA 2XAJA 2ZJ2A 5J4VA 4BQAA 2O7TA 2KIUA 2RQPA 3GVAA 4J01A 1BIBA 2QM3A 1QVTA 3CO6C 1S9HA 3GO5A 1TQPA 3JRIA 4ZYHA 5J1UA 2IGNA 5F1RA 4NDLA 3O8HA 4UHTA 2QUFA 2LKSA 2XV4S 2BYVE 5BQTA 3HOUJ 2MD5A 5B66C 3BRUA 1FEXA 2JWTA 2MLKA 3V6GA 3MNLA 4BDYA 1IN4A 4U0VA 2OBPA 4PK4A 3E5QA 1RRJA 3WTZA 3FK7A 2DU9A 3I71A 3SDGA 3BZCA 3ZOBA 3E5UA 2XF6A 1OKRA 4XL9A 4YIRX 2WB1N 4A3DJ 3UNGC 2L4MA 4CCNA 3ANGA 4M74A 3HHHA 5BPIA 4OIQF 1JKOC 2R92J 3NXCA 2F6CA 1RNLA 4LG0B 2A05A 4P55A 2JA7J 1KONA 5K5QA 3I64A 5HLHA 2XGXA 3S3OA 5CVRA 2P6SA 4IHXA 3DWLE 5E1WA 3M1CA 4HX8A 2QSHX 1K79A 1FOKA 4HKUA 4ENJA 3G1LA 2XF7A 3OR1C 4HQEA 3M9AA 2HGCA 5CJ9A 4A3IJ 4OIPF 1PP8F 2OF7A 3MZ8A 1V55H 3C2HA 3H92A 4G12A 4Y33A 1QRYA 3BTCA 3WE2A 5F08A 2KHMA 3PFYA 1ZREA 2L3DA 2K4JA 2Y48A 4CUGA 3FHNA 1V3FA 4OU0A 1FP2A 2NVQJ 4GFBA 4U88A 4NBQA 1PVEA 1LB2A 1SFXA 3BCGA 1MH3A 2CUFA 4BDZA 2M30A 4LLGF 1TWGJ 3IRRA 4M9SA 1UI6A 3SEZA 4ITVA 3KEOA 3HOTA 3ZN1A 1A36A 3C1DA 4QLCU 2XIGA 3D0SA 1LJ9A 3QPTA 2E35A 2CRGA 4X6AJ 3HKZN 4E7HA 1SFKA 2HZDA 2N8GA 3HGGA 1T8IA 4JX5A 1R71A 1LEBA 4RB0A 1L3LA 2GAUA 3H36A 4OMYA 4EGZA 5EDNA 1WJ5A 2IA1A 2KT0A 1X2MA 1HOMA 4A0YA 1OCCH 4LJZF 4B48A 5EFYA 3NEUA 2GOXB 3KP2A 4DYRA 1FTTA 3ASNH 4WXCA 2A6TA 1DPRA 3E6MA 4PUSA 2DTRA 5HDGA 3HTJA 3L9FA 2ME6A 3ERMA 4BQNA 2YU9J 2RVCA 3W6JB 1MNMC 3FXOA 3I59A 1W5CC 2KIFA 3S1QJ 4O5VA 1HW1A 2V6CA 3GUDA 5DUIA 1O4XA 5D4SA 2LY9A 1K4TA 2EFOA 2VPRA 1IDYA 2LY2A 3ZP5A 2HVSA 2QTQA 3O60A 2O3FA 2WB1A 3RCOA 3OIPA 4D7MA 4UB6C 4UUSB 1Z1DA 5ICEA 2MH2A 1LEAA 1TWCJ 1MMAA 1FC3A 4RMNA 2F5CA 2MABA 4LIVA 5DTDA 1JE8A 3GTMJ 3VFZA 2MFZA 3ON4A 1S7AA 3HSRA 3W6KB 5IY5H 3H5RA 3MEXA 1BI2A 2M9HA 1T0FA 2WV1A 4H0EA 2LY1A 1U5TB 2ZMEA 3QOPA 1SVMA 5LLQA 3OY9A 2IA0A 4BE1A 2M1BA 3KP7A 4X0GA 3HTAA 4GDFA 2UXNA 5F64A 4BEHB 4EMSA 1SFOJ 4PJNA 3IV5A 3B81A 2MG4A 5DCMB 1V5GA 3FXUA 5J8CA 3GFJA 3HPGA 1BI0A 5FJ8J 1USTA 1K6OA 2XASA 1IN8A 2HQRA 2NP5A 4F55A 4U9LA 1IXRC 3OR2C 2E60A 3FMSA 2E7XA 2XB5A 1D8JA 2CV2A 2ZXJA 4MO7A 1U5TC 2Y75A 4GCTA 1X2NA 3F6OA 4QSHA 2JPCA 2K9LA 1P7JA 2DA1A 4MQVA 2PZ9A 3I9V2 2Y30A 4AC0A 2A3SA 3HKZA 2O8XA 3L2VA 3CCUI 3VYTB 2A2FX 3W6VA 2P5KA 3MZHA 2CG4A 1QHHD 2RQQA 2G3BA 2E2JJ 2VBYA 4C9YA 4N9HA 2FJ1A 1LDKB 1J75A 2HVRA 2W85A 2MLGA 4F3QA 3PM1A 2OTJI 3REOA 2KQRA 5IT9K 4C2UA 3ZQGA 4ZDLA 1FYLA 3KEQA 3CCJI 1I5ZA 3S2HJ 2FBQA 3VWBA 2DA2A 3LSPA 1G3TA 1EKEA 3ESWB 4I2OA 1F1ZA 2L02A 3IC7A 3CCQI 4Y15A 3M8FA 5K1YA 1K61A 2LC2A 4JYKA 4XSZF 2EZLA 4IJAA 2VE9A 2A07F 2DO7A 4DW6A 2VQLA 2QLZA 4ESBA 1HXDA 2JVGA 1HBXG 1KYZA 3PNVA 1GT0C 2EQRA 4OD4A 4RM2A 2ZFWA 2IJLA 2CV0A 2IA2A 4HX7A 4WCGA 1ZRCA 4PJLA 4P9UA 3I55I 3KKDA 2I5UA 3HUGB 2YU3A 1BR2A 3M1EA 1N78A 1SD4A 2VBXA 5HLTA 2R7XA 4ZYAA 5ILUA 2QOPA 4EM0B 2R5YA 5EF6A 2UUZA 5IOYA 3FBIB 3LOCA 3HTIA 3L00A 4NQWA 3BQZA 1YJNI 4BQQA 1IRFA 3V8LA 3V4GA 4A6EA 1LVKA 3FXLA 3MVPA 2GWRA 4LLNA 2O0YA 1ZK8A 1XGOA 1T33A 3HGYA 3BROA 3BTJA 3H3ZA 4IEJA 4NUBA 1H9TA 2ESNA 2K27A 2EFNA 4BU2A 2JZYA 3PFIA 2R7UA 4X1EA 1B8IB 2UXXA 4AYBN 1Z9CA 4HYEA 5TRDA 3BHQA 3ZQ7A 4GFLA 3TW6A 2F5VA 2HKOA 2VOPA 5J40A 2BY3A 4OAYA 3T5XA 5GADJ 1N77A 1PDNC 4EGYA 4RB1A 4MTEA 5AQCA 1SVOA 3LSTA 5BOXA 2ISZA 2CH0A 2X51A 1IO2A 4XMYA 2D5VA 1RKTA 3BZ6A 4G6TB 4L0YB 3HE0A 2X6XA 4XRFA 4IXAA 1WH7A 1V54H 2MD0A 3PQJA 2CMPA 4P96A 3RPUA 4CA0A 1UZCA 4R79A 2BVMA 3WTVC 3WG9A 2RASA 3VP5A 4AF5A 3HOSA 4BY1J 3GTGJ 2WV0A 3WTTC 1RPWA 3HEFA 1Z6TA 1GXPA 5IT9Z 4IOCF 2GENA 1WJEA 2BHZA 2LNBA 2RAEA 4BACA 2PEXA 1HKQA 4EJOA 1IDZA 5DS9A 2GFNA 1WI9A 3DPUA 4MK6A 1G4DA 3OYGA 1D1AA 2FE3A 3WU0A 1BIAA 4BBSJ 1SD5A 1LDJA 4A69C 3JTGA 1QBJA 2VT3A 2XPWA 1BJAA 3RQIA 3CCMI 1A04A 1ETVA 3WGGA 4BKXA 5HNHA 1D0YA 3CWRA 3QYEA 3MMYB 2Y0MA 4BYYA 1VQMI 1RUOA 3DF8A 1TW3A 2LYCA 3K69A 3IAS2 4CYDA 4YRVA 3VW0A 4PCQA 1XMXA 2PN6A 5ICFA 5M3MJ 3F8BA 4KFCA 1QNTA 3PO2J 1P4AA 2E71A 4E7ZA 1MMGA 3LA3A 3TBIA 4U87A 3K6GA 2R7SA 1QZYA 2X6OA 5IP7J 2F2EA 1OCRH 2V9KA 1SFEA 2V57A 4NNJA 4UXNA 2A69F 2DOAA 2LH9A 3U1DA 1X1CA 2DMTA 3HIFA 1WGXA 1WH5A 3BDDA 3I4PA 3K4BA 3VVYA 2DA6A 3O2PE 3HG9A 1G6NA 2LKPA 3L2UA 4CYCA 3IUVA 3A01A 1ULYA 4RB2C 4A3JJ 1SEUA 4IRHA 3JRHA 3G6EI 2J5PA 2Z5UA 4KT5C 4M6VA 3V7CA 4QIWN 3SDBA 4AYBA 3NPIA 2W84A 4FE4A 4G6QA 3V7RA 3VYRB 3LWJA 3HYIA 1SD6A 3DXJF 3AQTA 1WFXA 2W4SA 5E8GA 1HW2A 1SAUA 5C4XJ 4EJVA 5IT3A 5F04A 3ZQFA 2UXPA 4M3DA 4WWCA 4U7DA 1JJ6C 4LMYA 4UVBA 2MYSA 2ZBKA 4QTRA 3HOZJ 1R58A 1H88C 1J09A 4MLOA 2Y0SN 3BZKA 5J8FA 3CLQA 3E0JB 4BXUA 1OCZH 5JLWA 3I59B 4M71A 3K9TA 2G7LA 3RPQA 4AIHA 2PMZN 3W2VA 2R7OA 2Z99A 2V1XA 2L01A 3S1NJ 1VI0A 1TNTA 3FIWA 1D0ZA 1JJ8C 1TLHB 3DTIA 2DN0A 1FLIA 1FBUA 2CWEA 1D0XA 4IQJA 3T0YA 4HOBA 2KL4A 3MFKA 2BY1A 2HYGD 1A31A 3DCFA 3PJRA 2DFHA 4R1HA 1BW6A 2JUGA 2V79A 5M5YJ 2ID6A 3DPLC 1TWAJ 3CZ6A 3LFUA 1EV7A 3W2WA 2M8EA 4MEYF 3FXQA 3LWFA 4KJZA 3JRFA 4XONA 3RKXA 1ZLKA 4AWXB 1QO0D 2A68F 2ZJQF 2WAQN 2PBXA 1P92A 2EZIA 2HOEA 3OYBA 3WTSC 4HLXA 1X1PA 4HLYA 3TEDA 2EINH 2X4HA 1GVDA 3KLOA 2H8RA 1P4WA 3I0TA 4Y4RA 1MBJA 2NNYA 1T95A 2VLAA 1K78B 2EIJH 4AIDA 4W97A 1D1BA 3I54A 2DK5A 3E1SA 4G6DA 2HXIA 2OZUA 1TQIA 1G3YA 1FYMA 4QPOA 1BA5A 2QSGX 1J59A 2VQHA 4PXIA 2VBWA 1FIAA 1R22A 4HSTA 1O3QA 5ERIA 2B0LA 3R61A 4P1WA 4F91B 2ZCWA 3GLXA 3U9GA 5DV5A 2QQAA 1MDMB 1OISA 4IRVA 4HAMA 4XOPA 3N4MA 2XUBA 4M6YA 1OCPA 2M2EA 3FKIJ 4FHTA 4RAYA 1U9NA 1S72I 4ON0A 1WHUA 3V7SA 4BAYA 2FNPA 4MTDA 3K8PC 2F4MB 3M07A 1DP7P 4AUXA 2Y0SA 1BC7C 1XG1A 2E2IJ 3CMEI 1O3TA 2K40A 4FX0A 5C4YA 2FMYA 2WWYA 2HYJA 5FFXA 2PMZA 3G56A 2K3FA 3ECOA 4HDUA 4BL0B 1L0OC 2LRDA 2Y9YA 3CC4I 3IHUA 1ZH5A 2AHQA 1TWHJ 3HOXJ 2HQNA 5CPRB 4XLAA 2BW3A 1JT0A 2FOWA 1ODDA 5HLIA 2EJRA 2YX7A 4J19A 3CDIA 1ETXA 3L7WA 3OSGA 2FQ3A 3G73A 5E3MA 4ZYDA 1C0WA 2QQ8A 2M4GA 1O3RA 1FYKA 2DMNA 2B3WA 3JRAA 1R1TA 4OIRF 4E70A 1VQ5I 3CJQB 2BZTA 2YSRA 2M0MA 5LGUA 3HRSA 1R9TJ 3QU3A 3BR3A 2NXNB 4A3MJ 4ZJZA 3VDXA 2WUIA 2QENA 3HZJA 2R7VA 2WAQA 3AQSA 5IYCJ 2P0WA 3WODF 2DG8A 1D1CA 1DGWY 2JSCA 3IKVA 3KP5A 4GRIA 1FOYA 1XGNA 4KT6A 5L3DA 3RIRA 2HEOA 4GCKA 2L9RA 4NQWB 5ICCA 2DOFA 3ONQA 3H9QA 2BE5F 1Z21A 2M0CA 3L2CA 3OYNA 3NWSA 5CQEA 2HZTA 4ICHA 1FMWA 1YI2I 2G7HA 4BH9A 1AWCA 2DQRA 3R60A 5EEAA 3KYDB 2KJCA 1B6AA 1GHCA 1MMDA 3CDLA 3I3LA 3F9KA 2DODA 3OIOA 2OD5A 2BVLA 2DI3A 3SHFA 1DGRM 2R7WA 1KU2A 3J7AY 2VJ4A 1P7IA 3OWTA 4GCVA 1UB9A 1WPKA 4RM3A 1JUSA 3FXRA 3PSFA 2UXUA 1QVUA 1F5TA 1VZ0A 3M8EA 4L9TA 4PGHA 5JHUA 2BEOA 2R3SA 3H35A 2ELKA 1TT5B 2DAOA 1JTYA 3PNYA 4BJ6C
chains in the Genus database with same CATH topology
1TC3C 3S14J 2DG7A 3ZQIA 3HTJA 2YU9J 2ME6A 1MNMC 4BXXJ 3G1MA 5F0CA 4MFDA 3S1QJ 4W1UA 5FKLA 3B6CA 1DU0A 4KWAA 3COLA 1WCMJ 3LHQA 1O4XA 3K7AJ 1LE8B 2LY9A 3FISA 1MBEA 3K2AA 2VPRA 1IDYA 2LR8A 2XPUA 5GPCA 1VNDA 2ZCMA 3HDDA 2QTQA 3O60A 3Q3SA 3CQZJ 4ABZA 3A03A 4YZEA 4D7MA 2L7ZA 1HF0A 1TWFJ 4UUSB 3JR9A 1QPIA 1A5JA 3KNWA 3GTKJ 4AC6A 2COBA 1TWCJ 2Q24A 1FJLA 3G7RA 1RR7A 5DTDA 3BQYA 1IGNA 3GTMJ 5M3FJ 4JL3A 1FIPA 3TP3A 1AKHB 3ON4A 3S16J 2Y9ZA 2M9HA 3L1PA 2K9NA 2WV1A 5IYBJ 2DMUA 2ZB9A 3NNRA 2FD5A 3JSJA 4I76A 1HCRA 4JKZA 3RKQA 1DU6A 2NVTJ 3VIBA 3HTAA 4DYQA 2GLOA 1SFOJ 5E3NA 3IV5A 3B81A 2MG4A 5K7FA 2DA5A 1K83J 1ETOA 1Z77A 3IH2A 5D18A 5FJ8J 2YVEA 5C4JJ 3ZQLA 3GZIA 3D1NI 5F1JA 2NP5A 4DYCA 2QIBA 2LFBA 3GTOJ 1Y1WJ 3CCYA 1IC8A 3UKGA 2NVYJ 2DTZA 2XB5A 4MO7A 3A01B 3VW2A 1AKHA 4GCTA 1X2NA 4QSHA 1JKRC 1B72B 4V2GA 3KZ9A 1D5YA 3OOUA 1P7JA 1POGA 2DA1A 3NRGA 3FK6A 1YRNB 2PZ9A 2Y30A 4AC0A 1MBGA 2X9DA 5FHPA 2XGDA 3W6VA 2DA3A 5F0FA 4CGRA 2IBDA 4D7NA 3QPSA 1RESA 2G3BA 1WI3A 2E2JJ 3LSJA 2GM4A 2ID3A 2FJ1A 2O8KA 2R5ZA 5K58A 2HXOA 5IYDJ 3PM1A 3HTHA 1ZR2A 2JMWA 2G7SA 3ZQGA 2REKA 1UI5A 2EZKA 1SANA 4IHWA 5FKOA 3S2HJ 3CJDA 2FBQA 2R5YB 1W0UA 3ANPA 2DA2A 4B4CA 3LSPA 4MIMA 3IH4A 3JRDA 2HYTA 5IOZA 5EYRA 2L0KA 2JK3A 2QKOA 1K61A 1I3QJ 2K9QA 4JYKA 4GFKA 2EZLA 4A3KJ 1H89C 2HQ5A 4V2FA 1JKPC 5HAWA 5C3EJ 5HSZA 1MH4A 3BR1A 4DW6A 5H9TA 5DAJA 4C3HJ 3GTPJ 2NS7A 2EQRA 1GT0C 1ZKGA 2R7ZJ 1NK2P 2AO9A 3NAUA 4A3FJ 4BY7J 3F0CA 4XK4A 3QKXA 2GUHA 1RETA 4MXMA 3Q0WA 4JNNA 3KKDA 2LTPA 1EF4A 3S1MJ 3RD3A 4GCLA 2UXOA 3S5RA 3ZQCA 2QOPA 4M3BA 4C3IJ 2R5YA 1APLC 3FRQA 1JTXA 1I50J 5EF6A 2LVSA 2XPVA 5IOYA 2RHAA 2ZCNA 3LOCA 3HTIA 3BR5A 2E2HJ 3BQZA 1PUFB 1HLVA 3BG5A 3MVPA 5HODA 3HB9A 4IHYA 1ZK8A 3HGYA 1T33A 1RKWA 3BTJA 4IEJA 2CUEA 1UHSA 2HOAA 1A6IA 3WHCA 3PASA 3ON2A 4X1EA 2CQQA 1B8IB 4AYBN 1ZQ3P 5J1YA 3BHQA 3RZOJ 3BTLA 3VOKA 4GFLA 1IG7A 3TW6A 1CQTA 1JT6A 3S1RJ 2XDNA 4A3LJ 2MGQA 1AU7A 4MFEA 5AQCA 2IAIA 4JX4A 2QWTA 2D5VA 2O9LA 1RKTA 2UXIA 3HE0A 4M3GA 1WH7A 2G0EA 1IUFA 2OPTA 3VPRA 2NX4A 2RASA 3M4OJ 2Y2ZA 3VP5A 4XRMA 4BY1J 1UMQA 2XRLA 3GTGJ 4A3BJ 1RPWA 5M5XJ 3HEFA 1ETKA 4D5CA 1E3OC 2GENA 3QBMA 2R93J 3F1BA 1U8BA 5GPAA 2RAEA 1W0TA 2P81A 3OSFA 1IDZA 2TCTA 1OJLA 3EUPA 2MSYA 3GBGA 3JRBA 3BR2A 1LE8A 3A02A 5D1RA 5CXIA 5DS9A 2GFNA 2DA4A 4M3EA 4MK6A 3LNQA 4RDUA 4BBSJ 1GUUA 3JRCA 4A69C 2ZOYA 5BNGA 4UUSA 4I6ZA 2XPWA 4DZPA 3RQIA 4A3GJ 3HIMA 3S2DJ 1ETVA 4BKXA 4Y52J 2HKUA 3WHBA 3CWRA 2GBYA 4CYCB 4EEFG 2F07A 4S0HB 2LD5A 4L5EA 3G1OA 3TW7A 4D5FA 3JRGA 5J1RA 1ETWA 2JA5J 5F27A 1BW5A 5D19A 2LKXA 1AHDP 3GEUA 3VW0A 3T6NA 2KDZA 5M3MJ 3GTJJ 2JJ7A 3PO2J 2EZHA 1BL0A 3BNIA 5C44J 1MBFA 2X6OA 3CMYA 2HI3A 5IP7J 2X48A 3BTIA 2V57A 3VVZA 1ORKA 5EG0B 2M34A 1ETQA 1Z0XA 4FTHA 4A3EJ 2H1KA 3QPLA 3V78A 2DMTA 2JA6J 2M8GX 3DPJA 9ANTA 3VUQA 1WGXA 1WH5A 2DJNA 2ME0A 3SFIA 3VVYA 2DA6A 2YS9A 4BBRJ 3IUVA 4CYCA 1MSFC 3HOYJ 3A01A 1I6HJ 4A3JJ 4ME9A 2HDDA 4UDSA 1B72A 3JRHA 4DZJA 2ZOZA 1HDPA 4M6VA 1YRNA 4QIWN 3Q0UA 3H3VK 5K7HA 3NPIA 4FE4A 5M5WJ 3LWJA 4ACIA 1ENHA 3QQAA 3AQTA 3VW1A 2XB0X 5C4XJ 3Q0VA 2O7OA 2VI6A 1JKQC 5F04A 5EGOB 3ZQFA 5IP9J 2UXPA 4M3DA 5FGLA 3BR0A 3BG3A 1JJ6C 3IH3A 2DA7A 4QTRA 3HOZJ 5JLXA 2WGBA 1H88C 4C2MJ 4MLOA 2I10A 2Y0SN 2NS8A 1NK3P 2OI8A 2FX0A 2Y31A 3LSGA 1Q1VA 3PPBA 2LK2A 5JLWA 1F43A 1SGMA 3VOXA 2G7LA 2PMZN 4JP0A 3TP0A 1IJWC 4FCYA 1JGGA 4A3CJ 5EZGA 4B1RA 4RBOA 1VFCA 3S1NJ 3GTQJ 4A93J 1VI0A 4B3AA 1ETYA 1IRZA 3VVXA 3FIWA 3H0GJ 4FISA 5E3LA 1JJ8C 2DN0A 2ECBA 3CRJA 3HM5A 2MW8A 1UG2A 3DCFA 3I4MJ 2ZCXA 1BW6A 5M5YJ 1U78A 2CU7A 2ID6A 3MN2A 1ZR4A 2W48A 3ZQHA 1TWAJ 2JN6A 2K9SA 3E7LA 2HOSA 1Y1VJ 3JREA 1JUMA 4XICA 3HBLA 2OERA 5HBUA 2LLKA 2VKEA 2XGCA 4XRSG 3LJLA 5F0HA 2NVXJ 5CXGA 3I4NJ 4JX6A 5E3OA 5IPAA 3JRFA 2B63J 3MKLA 2WAQN 2PBXA 4XRSA 5CW8A 1XS9A 2XSDC 2EZIA 2R0QC 2E19A 2XGEA 3C07A 3EGQA 3TEDA 2IEKA 2LP0A 1GVDA 5FKKA 2H8RA 2CQXA 1MSEC 3HOWJ 1FTZA 1MBJA 1PUFA 1BJZA 1X58A 5FLMJ 1HDDC 4W97A 1LFBA 5FKMA 1ZGWA 2HXIA 1B8IA 3S15J 3PO3J 1BA5A 2O7TA 4PXIA 1FIAA 1QVTA 1U9OA 1LFUP 3S17J 3JRIA 1OFCX 1MBHA 2TRTA 5J1UA 4NDLA 2G7GA 2QCOA 3O8HA 4M3FA 3HOUJ 3BRUA 1S7EA 1FEXA 4HNVA 2JWTA 4FE7A 1OCPA 2W53A 2YUSA 2M2EA 3FKIJ 4Y7NJ 3MNLA 1U9NA 4NELA 3V6GA 1IV6A 2R5ZB 5FLVA 3FK7A 3SDGA 2UXHA 3ZOBA 2VUMJ 4AUXA 5IP6A 5K7ZA 1XG1A 2E2IJ 2WB1N 4A3DJ 2L7FP 3ANGA 3E7QA 2K40A 3DEWA 2FQ4A 5C4YA 1JKOC 3BG9A 4AF5A 2R92J 3NXCA 2CJJA 2HYJA 1G2HA 5FMPA 3G56A 3P9TA 2Y9YA 2AHQA 1TWHJ 2JA7J 3O8GA 3HOXJ 4IHVA 5J3LA 1H8AC 3RH2A 1MBKA 1JT0A 1VF9A 2DMQA 4J19A 2VKVA 3OSGA 1ETXA 4IHXA 1GV5A 2JA8J 5E3MA 3SJMA 4HKUA 4XIDA 3G1LA 2DMNA 3JRAA 5GP9A 1OCTC 2NOGA 1XC5A 3LSRA 4A3IJ 2OF7A 2ECCA 1R9TJ 4G12A 1QRYA 3BR3A 3BTCA 2HOTA 5F08A 4L62A 4A3MJ 2QF7A 2WUIA 2NVQJ 2YVHA 5FKNA 4GFBA 3AQSA 1GDTA 5IYCJ 4LOCA 5EG0A 2DG8A 3BCGA 4GCKA 2L7MP 2L9RA 1MH3A 2CUFA 3BT9A 2M0CA 1TWGJ 2E1OA 1UI6A 3HOVJ 4ICHA 1ZTRA 3KKCA 2D6YA 3B6AA 5EEAA 2EBIA 4UUTA 3NI7A 2CRGA 4C3JJ 3HKZN 4X6AJ 5EZHA 2N8GA 1NTCA 3CDLA 3OIOA 3HGGA 1JUPA 4JX5A 1GV2A 1P7IA 1ITYA 3NARA 3BJBA 1WPKA 1JUSA 5EDNA 2DMPA 5EGOA 2KT0A 3BR6A 2NP3A 2UXUA 4NN1A 1QVUA 1X2MA 1HOMA 3RZDJ 3GTLJ 2ELKA 2EH3A 1T56A 5EFYA 1FTTA 1JTYA 4DYRA 3C2BA 2IU5A 1F36A 3M3YJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TC3 C;  3S14 J;  2DG7 A;  3ZQI A;  3HTJ A;  2YU9 J;  2ME6 A;  1MNM C;  4BXX J;  3G1M A;  5F0C A;  4MFD A;  3S1Q J;  4W1U A;  5FKL A;  3B6C A;  1DU0 A;  4KWA A;  3COL A;  1WCM J;  3LHQ A;  1O4X A;  3K7A J;  1LE8 B;  2LY9 A;  3FIS A;  1MBE A;  3K2A A;  2VPR A;  1IDY A;  2LR8 A;  2XPU A;  5GPC A;  1VND A;  2ZCM A;  3HDD A;  2QTQ A;  3O60 A;  3Q3S A;  3CQZ J;  4ABZ A;  3A03 A;  4YZE A;  4D7M A;  2L7Z A;  1HF0 A;  1TWF J;  4UUS B;  3JR9 A;  1QPI A;  1A5J A;  3KNW A;  3GTK J;  4AC6 A;  2COB A;  1TWC J;  2Q24 A;  1FJL A;  3G7R A;  1RR7 A;  5DTD A;  3BQY A;  1IGN A;  3GTM J;  5M3F J;  4JL3 A;  1FIP A;  3TP3 A;  1AKH B;  3ON4 A;  3S16 J;  2Y9Z A;  2M9H A;  3L1P A;  2K9N A;  2WV1 A;  5IYB J;  2DMU A;  2ZB9 A;  3NNR A;  2FD5 A;  3JSJ A;  4I76 A;  1HCR A;  4JKZ A;  3RKQ A;  1DU6 A;  2NVT J;  3VIB A;  3HTA A;  4DYQ A;  2GLO A;  1SFO J;  5E3N A;  3IV5 A;  3B81 A;  2MG4 A;  5K7F A;  2DA5 A;  1K83 J;  1ETO A;  1Z77 A;  3IH2 A;  5D18 A;  5FJ8 J;  2YVE A;  5C4J J;  3ZQL A;  3GZI A;  3D1N I;  5F1J A;  2NP5 A;  4DYC A;  2QIB A;  2LFB A;  3GTO J;  1Y1W J;  3CCY A;  1IC8 A;  3UKG A;  2NVY J;  2DTZ A;  2XB5 A;  4MO7 A;  3A01 B;  3VW2 A;  1AKH A;  4GCT A;  1X2N A;  4QSH A;  1JKR C;  1B72 B;  4V2G A;  3KZ9 A;  1D5Y A;  3OOU A;  1P7J A;  1POG A;  2DA1 A;  3NRG A;  3FK6 A;  1YRN B;  2PZ9 A;  2Y30 A;  4AC0 A;  1MBG A;  2X9D A;  5FHP A;  2XGD A;  3W6V A;  2DA3 A;  5F0F A;  4CGR A;  2IBD A;  4D7N A;  3QPS A;  1RES A;  2G3B A;  1WI3 A;  2E2J J;  3LSJ A;  2GM4 A;  2ID3 A;  2FJ1 A;  2O8K A;  2R5Z A;  5K58 A;  2HXO A;  5IYD J;  3PM1 A;  3HTH A;  1ZR2 A;  2JMW A;  2G7S A;  3ZQG A;  2REK A;  1UI5 A;  2EZK A;  1SAN A;  4IHW A;  5FKO A;  3S2H J;  3CJD A;  2FBQ A;  2R5Y B;  1W0U A;  3ANP A;  2DA2 A;  4B4C A;  3LSP A;  4MIM A;  3IH4 A;  3JRD A;  2HYT A;  5IOZ A;  5EYR A;  2L0K A;  2JK3 A;  2QKO A;  1K61 A;  1I3Q J;  2K9Q A;  4JYK A;  4GFK A;  2EZL A;  4A3K J;  1H89 C;  2HQ5 A;  4V2F A;  1JKP C;  5HAW A;  5C3E J;  5HSZ A;  1MH4 A;  3BR1 A;  4DW6 A;  5H9T A;  5DAJ A;  4C3H J;  3GTP J;  2NS7 A;  2EQR A;  1GT0 C;  1ZKG A;  2R7Z J;  1NK2 P;  2AO9 A;  3NAU A;  4A3F J;  4BY7 J;  3F0C A;  4XK4 A;  3QKX A;  2GUH A;  1RET A;  4MXM A;  3Q0W A;  4JNN A;  3KKD A;  2LTP A;  1EF4 A;  3S1M J;  3RD3 A;  4GCL A;  2UXO A;  3S5R A;  3ZQC A;  2QOP A;  4M3B A;  4C3I J;  2R5Y A;  1APL C;  3FRQ A;  1JTX A;  1I50 J;  5EF6 A;  2LVS A;  2XPV A;  5IOY A;  2RHA A;  2ZCN A;  3LOC A;  3HTI A;  3BR5 A;  2E2H J;  3BQZ A;  1PUF B;  1HLV A;  3BG5 A;  3MVP A;  5HOD A;  3HB9 A;  4IHY A;  1ZK8 A;  3HGY A;  1T33 A;  1RKW A;  3BTJ A;  4IEJ A;  2CUE A;  1UHS A;  2HOA A;  1A6I A;  3WHC A;  3PAS A;  3ON2 A;  4X1E A;  2CQQ A;  1B8I B;  4AYB N;  1ZQ3 P;  5J1Y A;  3BHQ A;  3RZO J;  3BTL A;  3VOK A;  4GFL A;  1IG7 A;  3TW6 A;  1CQT A;  1JT6 A;  3S1R J;  2XDN A;  4A3L J;  2MGQ A;  1AU7 A;  4MFE A;  5AQC A;  2IAI A;  4JX4 A;  2QWT A;  2D5V A;  2O9L A;  1RKT A;  2UXI A;  3HE0 A;  4M3G A;  1WH7 A;  2G0E A;  1IUF A;  2OPT A;  3VPR A;  2NX4 A;  2RAS A;  3M4O J;  2Y2Z A;  3VP5 A;  4XRM A;  4BY1 J;  1UMQ A;  2XRL A;  3GTG J;  4A3B J;  1RPW A;  5M5X J;  3HEF A;  1ETK A;  4D5C A;  1E3O C;  2GEN A;  3QBM A;  2R93 J;  3F1B A;  1U8B A;  5GPA A;  2RAE A;  1W0T A;  2P81 A;  3OSF A;  1IDZ A;  2TCT A;  1OJL A;  3EUP A;  2MSY A;  3GBG A;  3JRB A;  3BR2 A;  1LE8 A;  3A02 A;  5D1R A;  5CXI A;  5DS9 A;  2GFN A;  2DA4 A;  4M3E A;  4MK6 A;  3LNQ A;  4RDU A;  4BBS J;  1GUU A;  3JRC A;  4A69 C;  2ZOY A;  5BNG A;  4UUS A;  4I6Z A;  2XPW A;  4DZP A;  3RQI A;  4A3G J;  3HIM A;  3S2D J;  1ETV A;  4BKX A;  4Y52 J;  2HKU A;  3WHB A;  3CWR A;  2GBY A;  4CYC B;  4EEF G;  2F07 A;  4S0H B;  2LD5 A;  4L5E A;  3G1O A;  3TW7 A;  4D5F A;  3JRG A;  5J1R A;  1ETW A;  2JA5 J;  5F27 A;  1BW5 A;  5D19 A;  2LKX A;  1AHD P;  3GEU A;  3VW0 A;  3T6N A;  2KDZ A;  5M3M J;  3GTJ J;  2JJ7 A;  3PO2 J;  2EZH A;  1BL0 A;  3BNI A;  5C44 J;  1MBF A;  2X6O A;  3CMY A;  2HI3 A;  5IP7 J;  2X48 A;  3BTI A;  2V57 A;  3VVZ A;  1ORK A;  5EG0 B;  2M34 A;  1ETQ A;  1Z0X A;  4FTH A;  4A3E J;  2H1K A;  3QPL A;  3V78 A;  2DMT A;  2JA6 J;  2M8G X;  3DPJ A;  9ANT A;  3VUQ A;  1WGX A;  1WH5 A;  2DJN A;  2ME0 A;  3SFI A;  3VVY A;  2DA6 A;  2YS9 A;  4BBR J;  3IUV A;  4CYC A;  1MSF C;  3HOY J;  3A01 A;  1I6H J;  4A3J J;  4ME9 A;  2HDD A;  4UDS A;  1B72 A;  3JRH A;  4DZJ A;  2ZOZ A;  1HDP A;  4M6V A;  1YRN A;  4QIW N;  3Q0U A;  3H3V K;  5K7H A;  3NPI A;  4FE4 A;  5M5W J;  3LWJ A;  4ACI A;  1ENH A;  3QQA A;  3AQT A;  3VW1 A;  2XB0 X;  5C4X J;  3Q0V A;  2O7O A;  2VI6 A;  1JKQ C;  5F04 A;  5EGO B;  3ZQF A;  5IP9 J;  2UXP A;  4M3D A;  5FGL A;  3BR0 A;  3BG3 A;  1JJ6 C;  3IH3 A;  2DA7 A;  4QTR A;  3HOZ J;  5JLX A;  2WGB A;  1H88 C;  4C2M J;  4MLO A;  2I10 A;  2Y0S N;  2NS8 A;  1NK3 P;  2OI8 A;  2FX0 A;  2Y31 A;  3LSG A;  1Q1V A;  3PPB A;  2LK2 A;  5JLW A;  1F43 A;  1SGM A;  3VOX A;  2G7L A;  2PMZ N;  4JP0 A;  3TP0 A;  1IJW C;  4FCY A;  1JGG A;  4A3C J;  5EZG A;  4B1R A;  4RBO A;  1VFC A;  3S1N J;  3GTQ J;  4A93 J;  1VI0 A;  4B3A A;  1ETY A;  1IRZ A;  3VVX A;  3FIW A;  3H0G J;  4FIS A;  5E3L A;  1JJ8 C;  2DN0 A;  2ECB A;  3CRJ A;  3HM5 A;  2MW8 A;  1UG2 A;  3DCF A;  3I4M J;  2ZCX A;  1BW6 A;  5M5Y J;  1U78 A;  2CU7 A;  2ID6 A;  3MN2 A;  1ZR4 A;  2W48 A;  3ZQH A;  1TWA J;  2JN6 A;  2K9S A;  3E7L A;  2HOS A;  1Y1V J;  3JRE A;  1JUM A;  4XIC A;  3HBL A;  2OER A;  5HBU A;  2LLK A;  2VKE A;  2XGC A;  4XRS G;  3LJL A;  5F0H A;  2NVX J;  5CXG A;  3I4N J;  4JX6 A;  5E3O A;  5IPA A;  3JRF A;  2B63 J;  3MKL A;  2WAQ N;  2PBX A;  4XRS A;  5CW8 A;  1XS9 A;  2XSD C;  2EZI A;  2R0Q C;  2E19 A;  2XGE A;  3C07 A;  3EGQ A;  3TED A;  2IEK A;  2LP0 A;  1GVD A;  5FKK A;  2H8R A;  2CQX A;  1MSE C;  3HOW J;  1FTZ A;  1MBJ A;  1PUF A;  1BJZ A;  1X58 A;  5FLM J;  1HDD C;  4W97 A;  1LFB A;  5FKM A;  1ZGW A;  2HXI A;  1B8I A;  3S15 J;  3PO3 J;  1BA5 A;  2O7T A;  4PXI A;  1FIA A;  1QVT A;  1U9O A;  1LFU P;  3S17 J;  3JRI A;  1OFC X;  1MBH A;  2TRT A;  5J1U A;  4NDL A;  2G7G A;  2QCO A;  3O8H A;  4M3F A;  3HOU J;  3BRU A;  1S7E A;  1FEX A;  4HNV A;  2JWT A;  4FE7 A;  1OCP A;  2W53 A;  2YUS A;  2M2E A;  3FKI J;  4Y7N J;  3MNL A;  1U9N A;  4NEL A;  3V6G A;  1IV6 A;  2R5Z B;  5FLV A;  3FK7 A;  3SDG A;  2UXH A;  3ZOB A;  2VUM J;  4AUX A;  5IP6 A;  5K7Z A;  1XG1 A;  2E2I J;  2WB1 N;  4A3D J;  2L7F P;  3ANG A;  3E7Q A;  2K40 A;  3DEW A;  2FQ4 A;  5C4Y A;  1JKO C;  3BG9 A;  4AF5 A;  2R92 J;  3NXC A;  2CJJ A;  2HYJ A;  1G2H A;  5FMP A;  3G56 A;  3P9T A;  2Y9Y A;  2AHQ A;  1TWH J;  2JA7 J;  3O8G A;  3HOX J;  4IHV A;  5J3L A;  1H8A C;  3RH2 A;  1MBK A;  1JT0 A;  1VF9 A;  2DMQ A;  4J19 A;  2VKV A;  3OSG A;  1ETX A;  4IHX A;  1GV5 A;  2JA8 J;  5E3M A;  3SJM A;  4HKU A;  4XID A;  3G1L A;  2DMN A;  3JRA A;  5GP9 A;  1OCT C;  2NOG A;  1XC5 A;  3LSR A;  4A3I J;  2OF7 A;  2ECC A;  1R9T J;  4G12 A;  1QRY A;  3BR3 A;  3BTC A;  2HOT A;  5F08 A;  4L62 A;  4A3M J;  2QF7 A;  2WUI A;  2NVQ J;  2YVH A;  5FKN A;  4GFB A;  3AQS A;  1GDT A;  5IYC J;  4LOC A;  5EG0 A;  2DG8 A;  3BCG A;  4GCK A;  2L7M P;  2L9R A;  1MH3 A;  2CUF A;  3BT9 A;  2M0C A;  1TWG J;  2E1O A;  1UI6 A;  3HOV J;  4ICH A;  1ZTR A;  3KKC A;  2D6Y A;  3B6A A;  5EEA A;  2EBI A;  4UUT A;  3NI7 A;  2CRG A;  4C3J J;  3HKZ N;  4X6A J;  5EZH A;  2N8G A;  1NTC A;  3CDL A;  3OIO A;  3HGG A;  1JUP A;  4JX5 A;  1GV2 A;  1P7I A;  1ITY A;  3NAR A;  3BJB A;  1WPK A;  1JUS A;  5EDN A;  2DMP A;  5EGO A;  2KT0 A;  3BR6 A;  2NP3 A;  2UXU A;  4NN1 A;  1QVU A;  1X2M A;  1HOM A;  3RZD J;  3GTL J;  2ELK A;  2EH3 A;  1T56 A;  5EFY A;  1FTT A;  1JTY A;  4DYR A;  3C2B A;  2IU5 A;  1F36 A;  3M3Y J; 
#chains in the Genus database with same CATH topology
 5HS8 A;  3U21 A;  2IT0 A;  4RGS A;  5B3S H;  4QPQ A;  1U3E M;  4KN4 X;  5F0C A;  4C30 A;  4AVP A;  3DU6 A;  2OQG A;  3ROU A;  2ZNZ A;  3COL A;  1WCM J;  2IXS A;  2DFI A;  3K7A J;  3LSI A;  3FIS A;  2LR8 A;  1VQ9 I;  2ZCM A;  3RJP A;  3HDD A;  2CO5 A;  3Q3S A;  3A03 A;  2QSF X;  3BJA A;  1R5I D;  2L7Z A;  5E79 C;  4AC6 A;  2NRA C;  2COB A;  5LGT A;  3G4S I;  4XLC A;  2CW8 A;  2XKO A;  3G7R A;  1XSX A;  4KUM A;  4JL3 A;  2K5C A;  1N75 A;  2HU9 A;  4JBA A;  1MJ9 A;  3S16 J;  1BBY A;  2RNJ A;  3CJR B;  3S32 A;  4U0W A;  3A1Y A;  3NNR A;  4IPA A;  4I76 A;  2E1C A;  2EFQ A;  1BOB A;  1W4M A;  3VIB A;  2GLO A;  4BJT A;  3DEU A;  5E3N A;  1QU3 A;  3NS4 A;  1OYW A;  3GFM A;  4NB5 A;  2W57 A;  4DQ2 A;  4BE2 A;  5CKT A;  2YVE A;  1D3Y A;  3PIO F;  2IPQ X;  2P6T A;  2MA3 A;  4KIB A;  3QOE A;  3QPH A;  3I5U A;  1W7P A;  2STW A;  2QIB A;  5KCM A;  2QQ9 A;  1YJW I;  2X1D A;  3UKG A;  2NVY J;  3DLL F;  4II3 A;  1LKX A;  1RI7 A;  3A01 B;  5CVU A;  1AKH A;  3KZ9 A;  4MGR A;  5E20 A;  1FWZ A;  3C2G A;  1POG A;  3RYP A;  4A0Z A;  1CGP A;  3EET A;  3NRG A;  3RI4 A;  3K0L A;  5D4R A;  1X4P A;  2KLO A;  4LIT A;  3IL2 A;  2GZW A;  3E3V A;  5F0F A;  2IVM A;  2BXY A;  3LL7 A;  1YS7 A;  2GM4 A;  3PSI A;  2ID3 A;  2JVH A;  1XPX A;  4H4K C;  5K58 A;  3KIO A;  5IYD J;  3HTH A;  2AQE A;  3RQ4 A;  1XD7 A;  1IXC A;  2M7B A;  3OYE A;  2REK A;  2L9S A;  4CCM A;  5FKO A;  3CJD A;  3ANP A;  4B4C A;  3JRD A;  4YG2 F;  3IH4 A;  1UAA A;  5IOZ A;  4PDK A;  2L0K A;  3JSO A;  2CS3 A;  2QKO A;  3D5S C;  4A3K J;  1H89 C;  4V2F A;  5DD8 A;  1LQ1 A;  1JKP C;  1I6X A;  5C3E J;  1MH4 A;  4XBF A;  3SXY A;  1EH6 A;  5H9T A;  3H9G A;  1BR1 A;  5DAJ A;  4M9X A;  5FB2 A;  2JRM A;  2LRE A;  2NS7 A;  1ZKG A;  1VQ8 I;  4IL6 C;  4HDV A;  1NK2 P;  2H27 A;  4A3F J;  1RR8 C;  2YR2 A;  4KN7 X;  3ML6 A;  3ELK A;  4MXM A;  1EF4 A;  3S1M J;  3RD3 A;  4GCL A;  3R0A A;  2VPL A;  2XKP A;  2P5L C;  3CP2 A;  5D8L B;  2JTV A;  2VJ5 A;  1ZG5 A;  4C3I J;  1ZRD A;  4NC8 A;  1VTN C;  3FRQ A;  2ZXW H;  3FZV A;  2RHA A;  2XAF A;  1E3P A;  3BR5 A;  3KZI C;  2E2H J;  3E6C C;  4OIO F;  4EAT A;  1O7F A;  1T6S A;  3BG5 A;  5HOD A;  2MC3 A;  3HB9 A;  1KGS A;  3CCV I;  3CMM A;  3TGN A;  1UHS A;  2W7N A;  4LD5 A;  1OQY A;  1CF7 A;  3BCA A;  5JR3 A;  3ON2 A;  2R7D A;  2ZY9 A;  3IUO A;  5J1Y A;  2CW0 F;  3NWT A;  4PSW A;  3RZO J;  1KA8 A;  3COA C;  3VOK A;  1JT6 A;  1LNW A;  3IP4 B;  2PLY A;  4A3L J;  3VSL A;  4JQF A;  4MFE A;  4AIJ A;  4UNO A;  4JX4 A;  5EEH A;  3EYY A;  2FBH A;  2DLL A;  1DP3 A;  2OPT A;  4OWR B;  4O3M A;  3BPV A;  2AXT C;  3VB2 A;  2Y2Z A;  4XRM A;  4G7H F;  4A3B J;  4YFX F;  1WJC A;  5M5X J;  3KP4 A;  1ETK A;  2B1E A;  4D0P A;  4XQF A;  3QBM A;  3F1B A;  5GPA A;  2Q2E A;  4I02 A;  4B44 A;  5L3B A;  3EUH A;  2V26 A;  1IW7 F;  2ZXH A;  2TCT A;  1OJL A;  5LHG A;  3EUP A;  2MSY A;  3GFI A;  2KDO A;  3BR2 A;  1W7P D;  3TO6 A;  4M3E A;  4HSR A;  5LRR A;  1GUU A;  2XC7 A;  2DDA A;  2GXB A;  3ZGK A;  2ZOY A;  2M87 A;  1REP C;  2PBI A;  3HC7 A;  2XAH A;  4DZP A;  3SZP A;  2L7K A;  4A3G J;  3S2D J;  2IS6 A;  1JGS A;  3OYK A;  2XDV A;  3QP6 A;  3BJO A;  4Y52 J;  2HKU A;  1IN6 A;  3CUQ A;  5FGM A;  2KPM A;  4EEF G;  2BW3 B;  1BI3 A;  2UV1 A;  4D9J A;  2F07 A;  4RGR A;  2HDC A;  2Z9O A;  3QP5 A;  2EFW A;  4E6K G;  1ETW A;  2JA5 J;  2EFP A;  1V4R A;  2K02 A;  5F27 A;  3TL4 X;  2PMH A;  2W25 A;  3HJE A;  5TGT A;  5D19 A;  1ZEL A;  4F92 B;  2FNA A;  3U1K A;  2NYX A;  2P7V B;  4GO1 A;  2HWV A;  3F21 A;  5FD6 A;  5C44 J;  1SC7 A;  2MH9 A;  2VOO A;  4E7J A;  3GFL A;  1DDN A;  2HI3 A;  2DYR H;  2X48 A;  3BTI A;  4HW0 A;  4ZYG A;  4M9Z A;  1Y6I A;  2M34 A;  1ETQ A;  1Y8R B;  3ZR8 X;  4BHC A;  4FTH A;  4LGW A;  2H1K A;  4Q5S F;  3V78 A;  2JA6 J;  3BCB A;  5ED4 A;  2ME0 A;  2NVU B;  3SFI A;  2E1M B;  1A6Q A;  1I39 A;  4XOR A;  1XDU A;  5E1X A;  2CSO A;  5FRO A;  4U0Y A;  1I6H J;  3KYC B;  3CO7 C;  1ZHF A;  4ESJ A;  1B72 A;  3ZMT A;  4DZJ A;  5AIP A;  4EVI A;  2ZOZ A;  1HDP A;  3DKX A;  1R4N B;  4OIN F;  2R7Q A;  3L2W A;  1Z91 A;  1G8X A;  2E36 A;  5K7H A;  2QBY B;  3H3V K;  5M5W J;  1X3U A;  4OOI A;  1F4K A;  3J7A O;  2IS2 A;  2JSP A;  4ACI A;  1HSJ A;  1GXQ A;  3VW1 A;  2XB0 X;  2F5E A;  1OR7 A;  3BG3 A;  4TV7 A;  2M5W A;  5JLX A;  2E1M C;  5L3E A;  3ABM H;  3C18 A;  3BLY A;  1Y56 A;  2I10 A;  4FAS D;  5J4Y A;  5KNL A;  3K4J A;  1ZGA A;  4BHB A;  3LSM A;  4Z6Y A;  4LB5 A;  2Y31 A;  3LSG A;  4G9Y A;  4XLH A;  2LK2 A;  3DTE A;  2VQC A;  3ZN0 A;  3VOX A;  1YHQ I;  3QOD A;  5D6F A;  4JP0 A;  3HL2 A;  2E5N A;  4FCY A;  1IJW C;  3A2K A;  4A3C J;  3WU1 B;  1Z05 A;  5EZG A;  4RBO A;  2QEX I;  3PL8 A;  4B3A A;  1DQU A;  2OV7 A;  1IRZ A;  5DD4 A;  4HNU A;  3BWG A;  5E3L A;  4C2T A;  4NC7 A;  2FF4 A;  2ECB A;  3KET A;  2H94 A;  4CXF A;  1X19 A;  1UG2 A;  3BC8 A;  2LG4 A;  3PIP F;  2W48 A;  4HF2 A;  2K9S A;  4E7I A;  2BXZ A;  1R5G A;  1Y1V J;  1Y0U A;  3TMO A;  4XIC A;  3F72 A;  1O57 A;  3KLN A;  2LLK A;  5A2Q K;  2VKE A;  2NVX J;  5CXG A;  3I4N J;  4LB6 B;  4JX6 A;  4XN3 A;  4OD5 A;  2NNN A;  5IPA A;  4JK1 X;  3TDZ C;  2XHK A;  2XAQ A;  3LAJ A;  2HPM A;  3GXO A;  2ETH A;  1OMI A;  1FTZ A;  1MSE C;  3HOW J;  1QZE A;  3FX3 A;  1VQN I;  1STZ A;  1G3S A;  1PUF A;  2VON A;  4XOT A;  1Z3Y A;  2V1D A;  4MEX F;  2DXI A;  3P5J A;  1HDD C;  3FXM A;  2W00 A;  1YYV A;  2C6Y A;  3CLO A;  3TO7 A;  3CD6 I;  2K86 A;  1U0J A;  1MMN A;  5JFR A;  2VQG A;  3HTS B;  3VOD A;  3QYF A;  3DBL B;  4ZDP A;  4V19 K;  3AG2 H;  1LFU P;  1WJD A;  1MBH A;  2CV1 A;  2VB6 A;  1WJA A;  2VKD A;  1YFH A;  1YE9 A;  3ISP A;  2PI0 A;  2G7G A;  2QCO A;  4IVN A;  4DJA A;  2F4I A;  3DKW A;  3IAM 2;  3K4M A;  4GYG A;  3QRF F;  4HNV A;  2V1N A;  4FE7 A;  2ZC2 A;  2YUS A;  4NEL A;  4KYW A;  3WG7 H;  3F23 A;  4IRI A;  2OU2 A;  5KAI C;  2UXH A;  3GZ5 A;  3BOQ A;  1ERD A;  1J7K A;  3B02 A;  2HS5 A;  5D5U B;  3I56 I;  3MKY B;  2NOJ B;  2L7F P;  3EYI A;  5HNF A;  2FML A;  4KDP A;  5EEG A;  3BG9 A;  2QWW A;  2CJJ A;  5B5E C;  1RC9 A;  1YW7 A;  2CQN A;  4BS9 A;  5D5X B;  1UG0 A;  1H8A C;  5CYV A;  1MBK A;  1R49 A;  3RH2 A;  1VF9 A;  4LK1 F;  2NS0 A;  4N4N B;  3VSK A;  4E7L A;  2QA4 I;  5FD5 A;  2VJI A;  5A2Q Z;  4YFN F;  1R4M B;  3JCU C;  5GP9 A;  1OCT C;  4ESF A;  2NOG A;  1TZL A;  4JOM A;  4ENN A;  5L3C A;  3H3U A;  1VQO I;  2PMU A;  4HV5 A;  4Q48 A;  1Z3X A;  3I58 A;  5FLX K;  4PGG A;  4CCJ A;  2YVH A;  3O3K A;  1MD0 A;  1GDT A;  3JAM K;  5EG0 A;  3F22 A;  1WJB A;  1X1A A;  3CJN A;  2OTL I;  2LSO A;  2X1E A;  1B9N A;  3BT9 A;  4UVA A;  1VQ4 I;  1TQM A;  3K2Z A;  2E1O A;  2M3A A;  4KIS A;  5GAE J;  2IGK A;  3HOV J;  1LUJ B;  2V9P A;  3SYT A;  2D6Y A;  3B6A A;  1QPM A;  3OS0 A;  2EBI A;  5AIQ A;  1SVL A;  4C3J J;  2X6W A;  4EJW A;  2R7T A;  2VKH A;  3IKT A;  2E34 A;  1JUP A;  5HS9 A;  3OL4 A;  1PYV A;  3GME A;  4AIK A;  4KIT B;  4XLF A;  3GTL J;  2UWM A;  4PZJ A;  2H09 A;  1W1W E;  2A6E F;  3C2B A;  2IU5 A;  1F36 A;  1OYY A;  4ZTF A;  3M3Y J;  3S14 J;  2DG7 A;  3D5R C;  1TP4 A;  2DW4 A;  3ZMU A;  3ZMZ A;  2LF7 A;  4ZZD A;  2ZME B;  4F7Z A;  1IN5 A;  2H8W A;  3BPX A;  3G1M A;  2PG4 A;  3FF5 A;  1W5S A;  2HTJ A;  4W1U A;  1I3A A;  3B6C A;  4KWA A;  4KIF A;  5D6E A;  1VQK I;  3LHQ A;  2R7F A;  1ZG3 A;  3WTY C;  1S6L A;  2D1V A;  3K2A A;  5JVG F;  2XPU A;  4UY8 I;  2WA0 A;  1KZH A;  3K4N A;  2GQQ A;  3CQZ J;  2ZJR F;  4XNF A;  4F52 A;  4YZE A;  3C3W A;  3JR9 A;  1A5J A;  3E6D A;  1QPI A;  1R36 A;  3J7Z I;  4DVY P;  2WY7 Q;  2ZFU A;  1AA7 A;  1K7A A;  2A5W A;  1FJL A;  4WX9 A;  4CSW A;  3P9I A;  2GOM A;  3BQY A;  3DP7 A;  1T0F C;  1FIP A;  3EUA A;  3TP3 A;  2ZME C;  2KZG A;  4WXH A;  3K10 A;  3GZ6 A;  4UVC A;  2Y9Z A;  3L1P A;  2RGV A;  1IXS B;  4G8X A;  2YVX A;  2K9N A;  2L2O A;  3KP3 A;  2DMU A;  1QGP A;  3JSJ A;  3ERE D;  2GIV A;  1HCR A;  3OS2 A;  4JKZ A;  1SMY F;  2NVT J;  4DYQ A;  4EQQ A;  5FLX Z;  1TL8 A;  2LBF A;  3DEE A;  4KA4 A;  3CTA A;  3JAM Z;  2DA5 A;  3X2Q H;  1ETO A;  1ON1 A;  3PQK A;  4J00 A;  3P7N A;  4XM3 A;  5D18 A;  4CCO A;  3GZI A;  1WQ2 A;  3PNT A;  1MJA A;  3D1N I;  5F1J A;  3ABL H;  4DYC A;  2EV0 A;  4YFK F;  3GTO J;  2H1L A;  1Y1W J;  1IC8 A;  2RRE A;  2EV6 A;  3QWL A;  1ZAR A;  2DTZ A;  1ZYR F;  3FM5 A;  2ZSI B;  1S5L C;  2JPB A;  3VW2 A;  1B72 B;  1ZN2 A;  2K9M A;  4V2G A;  1D5Y A;  3OOU A;  2W1O A;  1T2K A;  2Z3Y A;  3FK6 A;  1HC8 A;  1R1U A;  1UJ8 A;  1MBG A;  5FHP A;  3ZMS A;  2XGD A;  2ISY A;  2DA3 A;  2VE8 A;  2PX9 A;  3JTH A;  4BEH A;  1YO5 C;  4D7N A;  3QPS A;  5DCM A;  4LLL A;  4LK0 F;  1WI3 A;  2DQL A;  3HPH A;  3LSJ A;  2LDU A;  3BG6 A;  2BV6 A;  1KQ0 A;  1GVJ A;  2CQ7 A;  2HXO A;  2JUC A;  3G2B A;  3ZQQ A;  2R5Z A;  1HA8 A;  1FNN A;  3D5L A;  1ZR2 A;  2JMW A;  3KYL A;  3ASO H;  2ZXI A;  3H5N A;  4S04 A;  4K2E A;  5ICG A;  3AG1 H;  4CH7 A;  1SAN A;  2FA5 A;  2F5D A;  3AAF A;  2WAF A;  2R5Y B;  1W0U A;  1T08 B;  4N9I A;  4MIM A;  2ZO4 A;  5CVJ A;  3J7Y J;  4Z2Y A;  4A12 A;  1R1V A;  2HYT A;  4E4H A;  1YQA A;  5EYR A;  2K9Q A;  2HQ5 A;  1X1B A;  1K4S A;  4U9N A;  3OMY A;  3KP6 A;  3T1B A;  3WGH A;  3HSE A;  3MKZ A;  3GTP J;  2R7Z J;  2HPI A;  1K6Y A;  2H6C A;  3J81 K;  4BY7 J;  4XK4 A;  5D5V B;  2CGP A;  3QKX A;  1T98 A;  2GUH A;  1RET A;  3WGI A;  4O6J A;  1J5Y A;  2LTP A;  3SFZ A;  2RDP A;  4HG2 A;  2CYY A;  3I53 A;  4LG3 A;  5DCF A;  3ULQ B;  1TT0 A;  2UXO A;  3S5R A;  1OCO H;  2AXL A;  3G71 I;  4PJ0 C;  1SMT A;  3EUK L;  3ZQC A;  3ZCO A;  1I1G A;  5HDN A;  4RAF A;  3J80 K;  4CCL A;  1APL C;  4HRI A;  1I27 A;  1JTX A;  2HTS A;  3M7G A;  4BJ5 C;  4BUP A;  2XPV A;  1LDD A;  2WY8 Q;  4XN0 A;  4BE0 A;  1YTY A;  2ZCN A;  2KP6 A;  3ZXS A;  2K4B A;  1PUF B;  1HLV A;  3T8R A;  3HRM A;  2P5V A;  1YIJ I;  3EDP A;  1W5T A;  1RKW A;  3S93 A;  4LFU A;  2XVC A;  2CUE A;  2XAU A;  1A6I A;  3KX2 A;  2DDB A;  3WHC A;  3PAS A;  3TDU C;  5DM6 F;  5L3F A;  2H6B A;  2B9S A;  2ELH A;  3GZN B;  1FP1 D;  2X0L A;  3S1R J;  2XDN A;  1TNS A;  3KEY A;  1MGT A;  2MGQ A;  3HUG A;  1E3H A;  1AU7 A;  4DNC A;  3FKJ A;  2IAI A;  5FRM A;  2QWT A;  1QZZ A;  3GW2 A;  4BXF A;  2UXI A;  1USS A;  4MNU A;  1IZ1 A;  2G0E A;  3P9C A;  3VPR A;  1XN7 A;  3A0H C;  3LQQ A;  1UMQ A;  2XRL A;  3QYB A;  4I98 B;  4EJT A;  2WBM A;  1NH3 A;  2R93 J;  2BY2 A;  1U8B A;  1BN5 A;  1TTY A;  3HSF A;  4XLN F;  2X6Y A;  4AVZ A;  5BS6 A;  3KZY A;  2BBY A;  5FO5 A;  5D1R A;  3GBG A;  1LE8 A;  3A02 A;  4KIC A;  2HNH A;  5CXI A;  4OAZ A;  1FBS A;  2DA4 A;  2IGO A;  1SFU A;  3LNQ A;  2RV8 A;  2EB7 A;  2OQR A;  4RDU A;  3QAH A;  4ENM A;  1IAW A;  3GWZ A;  4I6Z A;  3F3X A;  3ZMD A;  1SAX A;  2KRC A;  5BMZ A;  3GYH X;  3WHB A;  3DU5 A;  3IWZ A;  2GBY A;  4CYC B;  4YEJ A;  3J81 Z;  3CC2 I;  3DV8 A;  2L9V A;  2LD5 A;  4L5E A;  1PUE E;  3G1O A;  5L3G A;  2EV5 A;  3S2W A;  4RGU A;  2WAE A;  4D5F A;  4EV0 A;  3JRG A;  1U2W A;  1AHD P;  4BQO A;  3T6N A;  2FRH A;  1YX5 A;  2VC1 A;  5J6X A;  4WK8 F;  3GTJ J;  2KDZ A;  2JJ7 A;  2F48 A;  1BL0 A;  3BNI A;  1ZAO A;  2RNG A;  2YX4 A;  3J80 Z;  1W36 C;  1S29 A;  1LFP A;  4EJU A;  2FBI A;  2ZSH B;  2A6H F;  3WE3 A;  3OYL A;  1FSE A;  4U7B A;  5EG0 B;  2RC4 A;  1BOA A;  2FU4 A;  4A3E J;  3K1N A;  2I8D A;  1O3S A;  1FMV A;  1YX3 A;  3VYS B;  2PJP A;  3VEP A;  3R6S A;  2V1U A;  2YS9 A;  4BBR J;  1V5F A;  2EIK H;  3ZRG A;  1MSF C;  3HOY J;  2QGU A;  2OUM A;  4I99 C;  4UDS A;  1H9G A;  5H2F C;  4IHS A;  1D5V A;  4NHJ A;  1YRN A;  2FBK A;  2HYF A;  2ZKZ A;  3F8N A;  4PSX A;  3OYD A;  4KNY A;  3QQA A;  3Q0V A;  2O7O A;  2VJJ A;  3BP8 A;  3OOP A;  5IP9 J;  2P4W A;  1P9Q C;  3BR0 A;  1IRG A;  5FGL A;  4I01 A;  3MD2 A;  4G94 A;  3IH3 A;  4IO9 F;  2DA7 A;  3K70 C;  1EA3 A;  1BR4 A;  1QA6 A;  4L9J A;  1XCV A;  2FUG 2;  4C2M J;  4Y13 A;  2KKO A;  5JVT A;  2JRT A;  2NS8 A;  2VN2 A;  3A4C A;  3KPH A;  1NK3 P;  4L0Z B;  3OS1 A;  2FX0 A;  1E0E A;  2OI8 A;  3MQ0 A;  1E17 A;  2CUZ A;  3LSK A;  5F6F A;  4L9V A;  4GYI A;  2XAG A;  2WTE A;  1Y0N A;  3TP0 A;  1JGG A;  1VFC A;  4AU7 A;  1P2F A;  1ONV A;  1MW7 A;  4A93 J;  1MIJ A;  1WZ2 A;  3FWE A;  2M45 A;  3BJ6 A;  3H0G J;  2J5O A;  1B9M A;  1N25 A;  1P4X A;  5DEQ A;  3WTX C;  2F5F A;  2MW8 A;  3HXL A;  4A5N A;  3I4M J;  5E8I A;  1WWX A;  3RYR A;  4ZH4 F;  2CU7 A;  3MN2 A;  3WTW C;  4I0B A;  3ZQH A;  2EK5 A;  2JN6 A;  1YIO A;  2AQF A;  3KFW X;  1KYW A;  2OER A;  1JHF A;  1EH8 A;  5E3O A;  3AFH A;  3NRV A;  4IX7 A;  3MKL A;  1XGM A;  3MZY A;  2VT2 A;  3DFG A;  4ETS A;  5K5O A;  4XRS A;  1XS9 A;  1ACI A;  5CW8 A;  2R0Q C;  2LBF B;  4DBR A;  1FBQ A;  3EGQ A;  3E97 A;  2CQX A;  3VYU B;  1ZGJ A;  1X58 A;  2ELJ A;  5CVV A;  2VXD A;  3CJT B;  5FLM J;  2QZ8 A;  2KIQ A;  1MMS A;  1FT9 A;  5FKM A;  4XKV A;  2DFE A;  2CQK A;  3BY6 A;  2KIM A;  3K1P A;  2KJB A;  1Z6R A;  4B47 A;  1NG7 A;  1U9O A;  2W24 A;  4FT8 A;  1YOV B;  3N05 A;  5CQG A;  4YII A;  4HBL A;  4S05 A;  1T39 A;  3S17 J;  1OFC X;  1GLN A;  2TRT A;  4A6D A;  3T8T A;  3ZMV A;  2QKL B;  3E6B A;  4GXO A;  1VQL I;  3RKY A;  2EIM H;  3DTK A;  2WC2 A;  1TW2 A;  2Z2S B;  4M3F A;  2KFD A;  3HHG A;  2KIS A;  1S7E A;  1X3Z B;  3IRQ A;  1U6G A;  2W53 A;  4P5O A;  4Y7N J;  2O03 A;  3NQO A;  3CF2 A;  1IV6 A;  1QHG A;  2R5Z B;  1K78 A;  4C2M A;  4OMZ A;  5FLV A;  3OYM A;  4CO8 A;  5TIS C;  2VUM J;  2PJR A;  5IP6 A;  1F9N A;  1E2X A;  2M4K A;  5LBQ A;  5K7Z A;  4Y17 A;  3A0B C;  1EH7 A;  1Z67 A;  2R7R A;  3E7Q A;  3VOE A;  4B8X A;  3DEW A;  2FQ4 A;  4WF2 A;  3TKY A;  3ABT A;  2QVO A;  1G2H A;  3OV8 A;  5FMP A;  1SD7 A;  2PQ8 A;  6PAX A;  3P9T A;  4QWQ A;  5JI6 A;  2OCC H;  1Q1H A;  3O8G A;  4IHV A;  5J3L A;  3H5A A;  1MDM A;  4CHU A;  2DMQ A;  3P9K A;  1U8R A;  4ANJ A;  2VKV A;  1FX7 A;  4HV6 A;  2V6E A;  2FEZ A;  2KMU A;  1GV5 A;  2DFF A;  2K85 A;  2JA8 J;  2X85 A;  1S8N A;  4A5M A;  3SJM A;  4XID A;  1X1D A;  4I09 A;  2DT7 B;  4FQG A;  2O5R A;  3HRT A;  5D8K B;  5GAG J;  2DT6 A;  5TJJ A;  1XC5 A;  3LSR A;  1IF1 A;  4HPQ A;  2ECC A;  5DUK A;  3QU6 A;  4KMU X;  3RKW A;  3CMA I;  2HOT A;  4L62 A;  2BY0 A;  1G59 A;  2QF7 A;  1A35 A;  2RN7 A;  3CF5 F;  3LQR A;  4PFP A;  5FKN A;  4LIU A;  2CFO A;  2FOK A;  2G9W A;  3F8F A;  4LOC A;  3UR3 C;  2F4O B;  1R6R A;  2L7M P;  2NAZ A;  4MQ9 F;  1PP7 U;  1DUX C;  4G7Z F;  5E17 F;  3FXK A;  3JSP A;  2QYO A;  5BPD A;  2E5Z A;  3Q9S A;  4ZYE A;  2Z16 A;  3CES A;  4NC6 A;  5J47 A;  1D8K A;  1ZTR A;  3KKC A;  3GCM A;  1IN7 A;  4UUT A;  2IW5 A;  3NI7 A;  3GF2 A;  1NHA A;  5EZH A;  5KAF C;  1NTC A;  2GA2 A;  1UFM A;  4AD9 A;  3DKY A;  1GV2 A;  1ITY A;  3NAR A;  2P7C B;  4MHG A;  2E7W A;  2D45 A;  1JI8 A;  3BJB A;  4G7O F;  2DMP A;  2Z33 A;  5EGO A;  3BR6 A;  2ZNY A;  2NP3 A;  4NN1 A;  3RZD J;  1MND A;  1PJR A;  4CIC A;  3SEQ A;  2EH3 A;  2B7E A;  3LAP A;  1T56 A;  3B73 A;  1BC8 C;  1XTA A;  2KRH A;  3U2R A;  4M72 A;  1AOY A;  2XRO A;  2V9V A;  2OCE A;  2EIL H;  3OYA A;  1TC3 C;  3ZQI A;  4HNT A;  2L54 A;  4WIB A;  1M1E B;  2ZJP F;  2WAD A;  4BXX J;  2IS1 A;  4MFD A;  2K7L A;  5FKL A;  1DU0 A;  3WU2 C;  2JQ7 A;  3K4L A;  4RGX A;  4FX4 A;  1LE8 B;  3S3M A;  3F8M A;  1MBE A;  3W3C A;  4XR6 A;  5DYM A;  3PUB A;  5GPC A;  1VND A;  2X1C A;  3DPT A;  5FRN A;  4ABZ A;  2M7A A;  1HF0 A;  1TWF J;  5B1B H;  1B59 A;  3KNW A;  1W7P B;  2P8T A;  3GTK J;  2E1N A;  4B09 A;  2Q24 A;  3ABK H;  5K5R A;  2R4G A;  1RR7 A;  2DPD A;  3L2Q A;  1JXS A;  1IGN A;  5LHI A;  2L4A A;  5M3F J;  1WVR A;  1AKH B;  1RZ4 A;  1FY7 A;  3SQN A;  2OC6 A;  2FJI 1;  3EPZ A;  5IYB J;  2ZB9 A;  2FD5 A;  4YIF A;  3HTU A;  2HQA A;  3RKQ A;  1DU6 A;  3PUF A;  1KQ8 A;  2VXZ A;  3Q9V A;  3G3Z A;  4M73 A;  5K7F A;  2YPR A;  1K83 J;  3S8P A;  1Z77 A;  3IH2 A;  3LMM A;  3V42 A;  5C4J J;  3H0D A;  3ZQL A;  2G7U A;  4R8H A;  4Q4Z F;  3V8J A;  3FBN B;  4DOZ A;  4UV9 A;  2D2W A;  2LFB A;  3CCY A;  3TO9 A;  5B1A H;  2OJE D;  3K4C A;  1ON2 A;  1OPC A;  1JHH A;  3E5X A;  1IUY A;  1MZB A;  5E1Z B;  1R23 A;  3FMR A;  1X3W B;  2A61 A;  5HVQ C;  2AS5 F;  3CUO A;  3F6V A;  2PFB A;  3RDI A;  4AM3 A;  4GGG A;  1JKR C;  5H6Q A;  3OYI A;  1B1B A;  2HR3 A;  4RS8 A;  1R7J A;  3KZZ A;  4ENK A;  3RSN A;  3L2R A;  1XB4 A;  1YG2 A;  1YRN B;  2X9D A;  1YS6 A;  1WKM A;  5CVI A;  1BI1 A;  4CGR A;  3DQV C;  2IBD A;  4PFO A;  3TQN A;  1RES A;  2UZK A;  4UB8 C;  1XMA A;  1HKS A;  2QKM B;  4RA2 A;  2O8K A;  2K3P A;  2BGC A;  2ESH A;  3CCR I;  2RKH A;  3ZPL A;  2OAZ A;  5JHF A;  2G7S A;  1WSU A;  3O6B B;  3MWM A;  4XKB A;  1UI5 A;  3CCL I;  2EZK A;  4I0A A;  4IHW A;  1ZG1 A;  3EQL F;  3FDY A;  1J9I A;  1XX5 A;  5AON A;  5HS7 A;  2MC4 A;  2TDX A;  4LG0 A;  2GA1 A;  4ZDO A;  2JK3 A;  2L5Q A;  5D5W B;  3LSH A;  4Y3O A;  3JW4 A;  1I3Q J;  1O7L A;  4GFK A;  2VAS A;  5HAW A;  5HSZ A;  1IRX A;  2QQB A;  3BR1 A;  1P6R A;  3MAJ A;  4C3H J;  3OIQ A;  5KHD A;  1CF7 B;  2AO9 A;  3NAU A;  3DLA A;  4YEL A;  1B4A A;  3HRU A;  3F0C A;  4HF1 A;  1V5E A;  3KCC A;  1BM9 A;  5LRS A;  3Q0W A;  4JNN A;  2IP2 A;  4A2U A;  1UEL B;  2DT5 A;  3FHZ A;  1XCB A;  1MJB A;  4ZZL A;  2VC0 A;  2O61 A;  1KU9 A;  4M3B A;  3M8J A;  4D1Q A;  4IHT A;  2CFX A;  1I50 J;  1R5H A;  2GXA A;  2LVS A;  2COM A;  2BHY A;  2OZ6 A;  1QQI A;  4P9F A;  1DPU A;  3IWF A;  5KK1 A;  3OYH A;  2JT1 A;  1RUN A;  4KMF A;  1TBX A;  5ILS A;  2Q2E B;  4N4O B;  4IHY A;  1G3W A;  4RAG A;  4L18 B;  1I1S A;  2HOA A;  2VL8 A;  2GXG A;  1XDS A;  2CQQ A;  3R4K A;  4IRG A;  1ZQ3 P;  3CC7 I;  3S3N A;  4ZTJ A;  3BTL A;  2LF8 A;  1IG7 A;  1CQT A;  3SWH A;  3CP8 A;  4HEA 2;  2FSW A;  4RAZ A;  3GX4 X;  2DPU A;  1Y39 A;  3AG4 H;  4Q47 A;  2DCE A;  3RPU D;  4XLE A;  4ASN A;  3CUQ B;  2O9L A;  5LD2 C;  1ZRF A;  4M3G A;  1IUF A;  4IQ4 A;  3BG7 A;  4E7K A;  2NX4 A;  3M4O J;  2VOD A;  3EUH C;  3AKZ A;  4D5C A;  1E3O C;  4BGD A;  3Q5F A;  1MNE A;  1ZLJ A;  5CLS A;  1W0T A;  1Z7U A;  3FMQ A;  2P81 A;  1KQ9 A;  3OSF A;  5LEJ A;  2ICW G;  2Q1Z B;  3N97 A;  2PJR B;  3JRB A;  1FSH A;  1FPQ A;  3OYJ A;  1WJF A;  1HKT A;  1J0R A;  3OYC A;  3RTR A;  3JRC A;  4RB3 C;  4L9N A;  2ACJ A;  5BNG A;  4UUS A;  2VIX A;  1YLF A;  2CW7 A;  3CUQ C;  5LGN A;  2XF5 A;  3SZG A;  3HIM A;  4HZF A;  1HQC A;  3WTU C;  3MKW B;  1XGS A;  1S3J A;  2EA2 A;  2XRN A;  2MBF A;  4L5I A;  3FXJ A;  4CGZ A;  1UCR A;  2EPF A;  1YW9 A;  3ABU A;  4S0H B;  1VQ7 I;  1VQ6 I;  2W82 A;  2V7F A;  3TW7 A;  2OA4 A;  1IV8 A;  1FOW A;  2HVQ A;  3W2A A;  3F8C A;  4HX4 A;  5J1R A;  4N0B A;  5GTH C;  4B43 A;  4HQM A;  5HOO A;  2LKX A;  1BW5 A;  1U5T A;  2DOE A;  4PJM A;  3GEU A;  2XSJ C;  3OYF A;  1RIO H;  5DDG A;  2JA2 A;  2IRF G;  4BNC A;  2EZH A;  1W36 D;  1LVA A;  1OYI A;  1FZP B;  1MBF A;  2DYS H;  3CMY A;  4IZZ A;  5LFA A;  2Z1D A;  3VVZ A;  1ORK A;  2HKX A;  3LA2 A;  1Z0X A;  3QPL A;  4A0X A;  2KZV A;  2M8G X;  2LOO A;  4FET A;  5H6R A;  9ANT A;  3DPJ A;  2DJN A;  1KU3 A;  2DJI A;  3VUQ A;  3GEZ A;  3LFK A;  3DBH B;  1Y8Q B;  2ADU A;  3DBR B;  5HDK A;  3CCE I;  5H20 A;  1VQP I;  4ME9 A;  4EM1 A;  2HDD A;  1HW5 A;  5EJC A;  4IKF A;  5KVR A;  1YW8 A;  2Q8K A;  1XSD A;  3Q0U A;  3LA7 A;  4L5J A;  2Y69 H;  4IOA F;  2PFV A;  3ECH A;  1ENH A;  4B3X A;  5E18 F;  1OR7 C;  2V4J C;  1MKM A;  1T38 A;  3OL3 A;  4XKC A;  2STT A;  2IS4 A;  2VI6 A;  3TOB A;  5DM7 F;  2A5Y B;  1JKQ C;  4WXD A;  5EGO B;  1Z7L A;  3K1M A;  3TOA A;  4XLP F;  3K70 D;  3V8K A;  4M6X A;  3L09 A;  3MCZ A;  3AL0 B;  2WGB A;  5GAH J;  2O6G E;  1EJ9 A;  2GIZ A;  3AG3 H;  1S7O A;  4XKW A;  1YIT I;  4KIG A;  2HDW A;  1NG6 A;  3H9J A;  1Q1V A;  3PPB A;  4EM2 A;  1F43 A;  1SGM A;  4CZZ A;  2VBZ A;  4DBQ A;  4B1R A;  1HST A;  4F93 B;  3GTQ J;  4E7S A;  1ETY A;  1YJ9 I;  2L9N A;  3VVX A;  2QBY A;  4FIS A;  3KE2 A;  2EWN A;  5HLG A;  3SZT A;  2FXA A;  3CRJ A;  3HM5 A;  3H1C A;  1X4O A;  4DGW B;  1XSV A;  4UUV A;  3AL0 C;  4IF4 A;  2DBB A;  1FOX A;  2ZCX A;  1U78 A;  1UHW A;  1ZR4 A;  4HF0 A;  4CDG A;  5ILV A;  3R0J A;  2HOS A;  2Q0O A;  3E7L A;  4DIQ A;  1JUM A;  2EA4 A;  3C7J A;  2KRF A;  3HBL A;  3JRE A;  4ZC3 A;  5HBU A;  2XGC A;  4XRS G;  3LJL A;  5F0H A;  1LPQ A;  5GTI C;  4BHP A;  3GLL A;  5FFZ A;  5LHH A;  4I7H A;  2B63 J;  2HFH A;  3K4K A;  4RLQ A;  1UHM A;  2XSD C;  2BOL A;  2D1H A;  2DK8 A;  1OLT A;  2E19 A;  2XGE A;  1XMK A;  3C07 A;  2IGM A;  2IEK A;  2LP0 A;  5FKK A;  1J2X A;  1WRJ A;  4CZC A;  5LEK A;  3CCS I;  1BJZ A;  4HA8 A;  3CDH A;  4XSX F;  1LFB A;  2LMD A;  4II2 A;  1ZGW A;  3FM3 A;  2CUJ A;  1R00 A;  4PJJ A;  1B8I A;  3S15 J;  3PO3 J;  1H0M A;  3VTI A;  4UV8 A;  1KU7 A;  4CCK A;  4RLF A;  2XAJ A;  2ZJ2 A;  5J4V A;  4BQA A;  2O7T A;  2KIU A;  2RQP A;  3GVA A;  4J01 A;  1BIB A;  2QM3 A;  1QVT A;  3CO6 C;  1S9H A;  3GO5 A;  1TQP A;  3JRI A;  4ZYH A;  5J1U A;  2IGN A;  5F1R A;  4NDL A;  3O8H A;  4UHT A;  2QUF A;  2LKS A;  2XV4 S;  2BYV E;  5BQT A;  3HOU J;  2MD5 A;  5B66 C;  3BRU A;  1FEX A;  2JWT A;  2MLK A;  3V6G A;  3MNL A;  4BDY A;  1IN4 A;  4U0V A;  2OBP A;  4PK4 A;  3E5Q A;  1RRJ A;  3WTZ A;  3FK7 A;  2DU9 A;  3I71 A;  3SDG A;  3BZC A;  3ZOB A;  3E5U A;  2XF6 A;  1OKR A;  4XL9 A;  4YIR X;  2WB1 N;  4A3D J;  3UNG C;  2L4M A;  4CCN A;  3ANG A;  4M74 A;  3HHH A;  5BPI A;  4OIQ F;  1JKO C;  2R92 J;  3NXC A;  2F6C A;  1RNL A;  4LG0 B;  2A05 A;  4P55 A;  2JA7 J;  1KON A;  5K5Q A;  3I64 A;  5HLH A;  2XGX A;  3S3O A;  5CVR A;  2P6S A;  4IHX A;  3DWL E;  5E1W A;  3M1C A;  4HX8 A;  2QSH X;  1K79 A;  1FOK A;  4HKU A;  4ENJ A;  3G1L A;  2XF7 A;  3OR1 C;  4HQE A;  3M9A A;  2HGC A;  5CJ9 A;  4A3I J;  4OIP F;  1PP8 F;  2OF7 A;  3MZ8 A;  1V55 H;  3C2H A;  3H92 A;  4G12 A;  4Y33 A;  1QRY A;  3BTC A;  3WE2 A;  5F08 A;  2KHM A;  3PFY A;  1ZRE A;  2L3D A;  2K4J A;  2Y48 A;  4CUG A;  3FHN A;  1V3F A;  4OU0 A;  1FP2 A;  2NVQ J;  4GFB A;  4U88 A;  4NBQ A;  1PVE A;  1LB2 A;  1SFX A;  3BCG A;  1MH3 A;  2CUF A;  4BDZ A;  2M30 A;  4LLG F;  1TWG J;  3IRR A;  4M9S A;  1UI6 A;  3SEZ A;  4ITV A;  3KEO A;  3HOT A;  3ZN1 A;  1A36 A;  3C1D A;  4QLC U;  2XIG A;  3D0S A;  1LJ9 A;  3QPT A;  2E35 A;  2CRG A;  4X6A J;  3HKZ N;  4E7H A;  1SFK A;  2HZD A;  2N8G A;  3HGG A;  1T8I A;  4JX5 A;  1R71 A;  1LEB A;  4RB0 A;  1L3L A;  2GAU A;  3H36 A;  4OMY A;  4EGZ A;  5EDN A;  1WJ5 A;  2IA1 A;  2KT0 A;  1X2M A;  1HOM A;  4A0Y A;  1OCC H;  4LJZ F;  4B48 A;  5EFY A;  3NEU A;  2GOX B;  3KP2 A;  4DYR A;  1FTT A;  3ASN H;  4WXC A;  2A6T A;  1DPR A;  3E6M A;  4PUS A;  2DTR A;  5HDG A;  3HTJ A;  3L9F A;  2ME6 A;  3ERM A;  4BQN A;  2YU9 J;  2RVC A;  3W6J B;  1MNM C;  3FXO A;  3I59 A;  1W5C C;  2KIF A;  3S1Q J;  4O5V A;  1HW1 A;  2V6C A;  3GUD A;  5DUI A;  1O4X A;  5D4S A;  2LY9 A;  1K4T A;  2EFO A;  2VPR A;  1IDY A;  2LY2 A;  3ZP5 A;  2HVS A;  2QTQ A;  3O60 A;  2O3F A;  2WB1 A;  3RCO A;  3OIP A;  4D7M A;  4UB6 C;  4UUS B;  1Z1D A;  5ICE A;  2MH2 A;  1LEA A;  1TWC J;  1MMA A;  1FC3 A;  4RMN A;  2F5C A;  2MAB A;  4LIV A;  5DTD A;  1JE8 A;  3GTM J;  3VFZ A;  2MFZ A;  3ON4 A;  1S7A A;  3HSR A;  3W6K B;  5IY5 H;  3H5R A;  3MEX A;  1BI2 A;  2M9H A;  1T0F A;  2WV1 A;  4H0E A;  2LY1 A;  1U5T B;  2ZME A;  3QOP A;  1SVM A;  5LLQ A;  3OY9 A;  2IA0 A;  4BE1 A;  2M1B A;  3KP7 A;  4X0G A;  3HTA A;  4GDF A;  2UXN A;  5F64 A;  4BEH B;  4EMS A;  1SFO J;  4PJN A;  3IV5 A;  3B81 A;  2MG4 A;  5DCM B;  1V5G A;  3FXU A;  5J8C A;  3GFJ A;  3HPG A;  1BI0 A;  5FJ8 J;  1UST A;  1K6O A;  2XAS A;  1IN8 A;  2HQR A;  2NP5 A;  4F55 A;  4U9L A;  1IXR C;  3OR2 C;  2E60 A;  3FMS A;  2E7X A;  2XB5 A;  1D8J A;  2CV2 A;  2ZXJ A;  4MO7 A;  1U5T C;  2Y75 A;  4GCT A;  1X2N A;  3F6O A;  4QSH A;  2JPC A;  2K9L A;  1P7J A;  2DA1 A;  4MQV A;  2PZ9 A;  3I9V 2;  2Y30 A;  4AC0 A;  2A3S A;  3HKZ A;  2O8X A;  3L2V A;  3CCU I;  3VYT B;  2A2F X;  3W6V A;  2P5K A;  3MZH A;  2CG4 A;  1QHH D;  2RQQ A;  2G3B A;  2E2J J;  2VBY A;  4C9Y A;  4N9H A;  2FJ1 A;  1LDK B;  1J75 A;  2HVR A;  2W85 A;  2MLG A;  4F3Q A;  3PM1 A;  2OTJ I;  3REO A;  2KQR A;  5IT9 K;  4C2U A;  3ZQG A;  4ZDL A;  1FYL A;  3KEQ A;  3CCJ I;  1I5Z A;  3S2H J;  2FBQ A;  3VWB A;  2DA2 A;  3LSP A;  1G3T A;  1EKE A;  3ESW B;  4I2O A;  1F1Z A;  2L02 A;  3IC7 A;  3CCQ I;  4Y15 A;  3M8F A;  5K1Y A;  1K61 A;  2LC2 A;  4JYK A;  4XSZ F;  2EZL A;  4IJA A;  2VE9 A;  2A07 F;  2DO7 A;  4DW6 A;  2VQL A;  2QLZ A;  4ESB A;  1HXD A;  2JVG A;  1HBX G;  1KYZ A;  3PNV A;  1GT0 C;  2EQR A;  4OD4 A;  4RM2 A;  2ZFW A;  2IJL A;  2CV0 A;  2IA2 A;  4HX7 A;  4WCG A;  1ZRC A;  4PJL A;  4P9U A;  3I55 I;  3KKD A;  2I5U A;  3HUG B;  2YU3 A;  1BR2 A;  3M1E A;  1N78 A;  1SD4 A;  2VBX A;  5HLT A;  2R7X A;  4ZYA A;  5ILU A;  2QOP A;  4EM0 B;  2R5Y A;  5EF6 A;  2UUZ A;  5IOY A;  3FBI B;  3LOC A;  3HTI A;  3L00 A;  4NQW A;  3BQZ A;  1YJN I;  4BQQ A;  1IRF A;  3V8L A;  3V4G A;  4A6E A;  1LVK A;  3FXL A;  3MVP A;  2GWR A;  4LLN A;  2O0Y A;  1ZK8 A;  1XGO A;  1T33 A;  3HGY A;  3BRO A;  3BTJ A;  3H3Z A;  4IEJ A;  4NUB A;  1H9T A;  2ESN A;  2K27 A;  2EFN A;  4BU2 A;  2JZY A;  3PFI A;  2R7U A;  4X1E A;  1B8I B;  2UXX A;  4AYB N;  1Z9C A;  4HYE A;  5TRD A;  3BHQ A;  3ZQ7 A;  4GFL A;  3TW6 A;  2F5V A;  2HKO A;  2VOP A;  5J40 A;  2BY3 A;  4OAY A;  3T5X A;  5GAD J;  1N77 A;  1PDN C;  4EGY A;  4RB1 A;  4MTE A;  5AQC A;  1SVO A;  3LST A;  5BOX A;  2ISZ A;  2CH0 A;  2X51 A;  1IO2 A;  4XMY A;  2D5V A;  1RKT A;  3BZ6 A;  4G6T B;  4L0Y B;  3HE0 A;  2X6X A;  4XRF A;  4IXA A;  1WH7 A;  1V54 H;  2MD0 A;  3PQJ A;  2CMP A;  4P96 A;  3RPU A;  4CA0 A;  1UZC A;  4R79 A;  2BVM A;  3WTV C;  3WG9 A;  2RAS A;  3VP5 A;  4AF5 A;  3HOS A;  4BY1 J;  3GTG J;  2WV0 A;  3WTT C;  1RPW A;  3HEF A;  1Z6T A;  1GXP A;  5IT9 Z;  4IOC F;  2GEN A;  1WJE A;  2BHZ A;  2LNB A;  2RAE A;  4BAC A;  2PEX A;  1HKQ A;  4EJO A;  1IDZ A;  5DS9 A;  2GFN A;  1WI9 A;  3DPU A;  4MK6 A;  1G4D A;  3OYG A;  1D1A A;  2FE3 A;  3WU0 A;  1BIA A;  4BBS J;  1SD5 A;  1LDJ A;  4A69 C;  3JTG A;  1QBJ A;  2VT3 A;  2XPW A;  1BJA A;  3RQI A;  3CCM I;  1A04 A;  1ETV A;  3WGG A;  4BKX A;  5HNH A;  1D0Y A;  3CWR A;  3QYE A;  3MMY B;  2Y0M A;  4BYY A;  1VQM I;  1RUO A;  3DF8 A;  1TW3 A;  2LYC A;  3K69 A;  3IAS 2;  4CYD A;  4YRV A;  3VW0 A;  4PCQ A;  1XMX A;  2PN6 A;  5ICF A;  5M3M J;  3F8B A;  4KFC A;  1QNT A;  3PO2 J;  1P4A A;  2E71 A;  4E7Z A;  1MMG A;  3LA3 A;  3TBI A;  4U87 A;  3K6G A;  2R7S A;  1QZY A;  2X6O A;  5IP7 J;  2F2E A;  1OCR H;  2V9K A;  1SFE A;  2V57 A;  4NNJ A;  4UXN A;  2A69 F;  2DOA A;  2LH9 A;  3U1D A;  1X1C A;  2DMT A;  3HIF A;  1WGX A;  1WH5 A;  3BDD A;  3I4P A;  3K4B A;  3VVY A;  2DA6 A;  3O2P E;  3HG9 A;  1G6N A;  2LKP A;  3L2U A;  4CYC A;  3IUV A;  3A01 A;  1ULY A;  4RB2 C;  4A3J J;  1SEU A;  4IRH A;  3JRH A;  3G6E I;  2J5P A;  2Z5U A;  4KT5 C;  4M6V A;  3V7C A;  4QIW N;  3SDB A;  4AYB A;  3NPI A;  2W84 A;  4FE4 A;  4G6Q A;  3V7R A;  3VYR B;  3LWJ A;  3HYI A;  1SD6 A;  3DXJ F;  3AQT A;  1WFX A;  2W4S A;  5E8G A;  1HW2 A;  1SAU A;  5C4X J;  4EJV A;  5IT3 A;  5F04 A;  3ZQF A;  2UXP A;  4M3D A;  4WWC A;  4U7D A;  1JJ6 C;  4LMY A;  4UVB A;  2MYS A;  2ZBK A;  4QTR A;  3HOZ J;  1R58 A;  1H88 C;  1J09 A;  4MLO A;  2Y0S N;  3BZK A;  5J8F A;  3CLQ A;  3E0J B;  4BXU A;  1OCZ H;  5JLW A;  3I59 B;  4M71 A;  3K9T A;  2G7L A;  3RPQ A;  4AIH A;  2PMZ N;  3W2V A;  2R7O A;  2Z99 A;  2V1X A;  2L01 A;  3S1N J;  1VI0 A;  1TNT A;  3FIW A;  1D0Z A;  1JJ8 C;  1TLH B;  3DTI A;  2DN0 A;  1FLI A;  1FBU A;  2CWE A;  1D0X A;  4IQJ A;  3T0Y A;  4HOB A;  2KL4 A;  3MFK A;  2BY1 A;  2HYG D;  1A31 A;  3DCF A;  3PJR A;  2DFH A;  4R1H A;  1BW6 A;  2JUG A;  2V79 A;  5M5Y J;  2ID6 A;  3DPL C;  1TWA J;  3CZ6 A;  3LFU A;  1EV7 A;  3W2W A;  2M8E A;  4MEY F;  3FXQ A;  3LWF A;  4KJZ A;  3JRF A;  4XON A;  3RKX A;  1ZLK A;  4AWX B;  1QO0 D;  2A68 F;  2ZJQ F;  2WAQ N;  2PBX A;  1P92 A;  2EZI A;  2HOE A;  3OYB A;  3WTS C;  4HLX A;  1X1P A;  4HLY A;  3TED A;  2EIN H;  2X4H A;  1GVD A;  3KLO A;  2H8R A;  1P4W A;  3I0T A;  4Y4R A;  1MBJ A;  2NNY A;  1T95 A;  2VLA A;  1K78 B;  2EIJ H;  4AID A;  4W97 A;  1D1B A;  3I54 A;  2DK5 A;  3E1S A;  4G6D A;  2HXI A;  2OZU A;  1TQI A;  1G3Y A;  1FYM A;  4QPO A;  1BA5 A;  2QSG X;  1J59 A;  2VQH A;  4PXI A;  2VBW A;  1FIA A;  1R22 A;  4HST A;  1O3Q A;  5ERI A;  2B0L A;  3R61 A;  4P1W A;  4F91 B;  2ZCW A;  3GLX A;  3U9G A;  5DV5 A;  2QQA A;  1MDM B;  1OIS A;  4IRV A;  4HAM A;  4XOP A;  3N4M A;  2XUB A;  4M6Y A;  1OCP A;  2M2E A;  3FKI J;  4FHT A;  4RAY A;  1U9N A;  1S72 I;  4ON0 A;  1WHU A;  3V7S A;  4BAY A;  2FNP A;  4MTD A;  3K8P C;  2F4M B;  3M07 A;  1DP7 P;  4AUX A;  2Y0S A;  1BC7 C;  1XG1 A;  2E2I J;  3CME I;  1O3T A;  2K40 A;  4FX0 A;  5C4Y A;  2FMY A;  2WWY A;  2HYJ A;  5FFX A;  2PMZ A;  3G56 A;  2K3F A;  3ECO A;  4HDU A;  4BL0 B;  1L0O C;  2LRD A;  2Y9Y A;  3CC4 I;  3IHU A;  1ZH5 A;  2AHQ A;  1TWH J;  3HOX J;  2HQN A;  5CPR B;  4XLA A;  2BW3 A;  1JT0 A;  2FOW A;  1ODD A;  5HLI A;  2EJR A;  2YX7 A;  4J19 A;  3CDI A;  1ETX A;  3L7W A;  3OSG A;  2FQ3 A;  3G73 A;  5E3M A;  4ZYD A;  1C0W A;  2QQ8 A;  2M4G A;  1O3R A;  1FYK A;  2DMN A;  2B3W A;  3JRA A;  1R1T A;  4OIR F;  4E70 A;  1VQ5 I;  3CJQ B;  2BZT A;  2YSR A;  2M0M A;  5LGU A;  3HRS A;  1R9T J;  3QU3 A;  3BR3 A;  2NXN B;  4A3M J;  4ZJZ A;  3VDX A;  2WUI A;  2QEN A;  3HZJ A;  2R7V A;  2WAQ A;  3AQS A;  5IYC J;  2P0W A;  3WOD F;  2DG8 A;  1D1C A;  1DGW Y;  2JSC A;  3IKV A;  3KP5 A;  4GRI A;  1FOY A;  1XGN A;  4KT6 A;  5L3D A;  3RIR A;  2HEO A;  4GCK A;  2L9R A;  4NQW B;  5ICC A;  2DOF A;  3ONQ A;  3H9Q A;  2BE5 F;  1Z21 A;  2M0C A;  3L2C A;  3OYN A;  3NWS A;  5CQE A;  2HZT A;  4ICH A;  1FMW A;  1YI2 I;  2G7H A;  4BH9 A;  1AWC A;  2DQR A;  3R60 A;  5EEA A;  3KYD B;  2KJC A;  1B6A A;  1GHC A;  1MMD A;  3CDL A;  3I3L A;  3F9K A;  2DOD A;  3OIO A;  2OD5 A;  2BVL A;  2DI3 A;  3SHF A;  1DGR M;  2R7W A;  1KU2 A;  3J7A Y;  2VJ4 A;  1P7I A;  3OWT A;  4GCV A;  1UB9 A;  1WPK A;  4RM3 A;  1JUS A;  3FXR A;  3PSF A;  2UXU A;  1QVU A;  1F5T A;  1VZ0 A;  3M8E A;  4L9T A;  4PGH A;  5JHU A;  2BEO A;  2R3S A;  3H35 A;  2ELK A;  1TT5 B;  2DAO A;  1JTY A;  3PNY A;  4BJ6 C; 
#chains in the Genus database with same CATH homology
 1TC3 C;  3S14 J;  2DG7 A;  3ZQI A;  3HTJ A;  2YU9 J;  2ME6 A;  1MNM C;  4BXX J;  3G1M A;  5F0C A;  4MFD A;  3S1Q J;  4W1U A;  5FKL A;  3B6C A;  1DU0 A;  4KWA A;  3COL A;  1WCM J;  3LHQ A;  1O4X A;  3K7A J;  1LE8 B;  2LY9 A;  3FIS A;  1MBE A;  3K2A A;  2VPR A;  1IDY A;  2LR8 A;  2XPU A;  5GPC A;  1VND A;  2ZCM A;  3HDD A;  2QTQ A;  3O60 A;  3Q3S A;  3CQZ J;  4ABZ A;  3A03 A;  4YZE A;  4D7M A;  2L7Z A;  1HF0 A;  1TWF J;  4UUS B;  3JR9 A;  1QPI A;  1A5J A;  3KNW A;  3GTK J;  4AC6 A;  2COB A;  1TWC J;  2Q24 A;  1FJL A;  3G7R A;  1RR7 A;  5DTD A;  3BQY A;  1IGN A;  3GTM J;  5M3F J;  4JL3 A;  1FIP A;  3TP3 A;  1AKH B;  3ON4 A;  3S16 J;  2Y9Z A;  2M9H A;  3L1P A;  2K9N A;  2WV1 A;  5IYB J;  2DMU A;  2ZB9 A;  3NNR A;  2FD5 A;  3JSJ A;  4I76 A;  1HCR A;  4JKZ A;  3RKQ A;  1DU6 A;  2NVT J;  3VIB A;  3HTA A;  4DYQ A;  2GLO A;  1SFO J;  5E3N A;  3IV5 A;  3B81 A;  2MG4 A;  5K7F A;  2DA5 A;  1K83 J;  1ETO A;  1Z77 A;  3IH2 A;  5D18 A;  5FJ8 J;  2YVE A;  5C4J J;  3ZQL A;  3GZI A;  3D1N I;  5F1J A;  2NP5 A;  4DYC A;  2QIB A;  2LFB A;  3GTO J;  1Y1W J;  3CCY A;  1IC8 A;  3UKG A;  2NVY J;  2DTZ A;  2XB5 A;  4MO7 A;  3A01 B;  3VW2 A;  1AKH A;  4GCT A;  1X2N A;  4QSH A;  1JKR C;  1B72 B;  4V2G A;  3KZ9 A;  1D5Y A;  3OOU A;  1P7J A;  1POG A;  2DA1 A;  3NRG A;  3FK6 A;  1YRN B;  2PZ9 A;  2Y30 A;  4AC0 A;  1MBG A;  2X9D A;  5FHP A;  2XGD A;  3W6V A;  2DA3 A;  5F0F A;  4CGR A;  2IBD A;  4D7N A;  3QPS A;  1RES A;  2G3B A;  1WI3 A;  2E2J J;  3LSJ A;  2GM4 A;  2ID3 A;  2FJ1 A;  2O8K A;  2R5Z A;  5K58 A;  2HXO A;  5IYD J;  3PM1 A;  3HTH A;  1ZR2 A;  2JMW A;  2G7S A;  3ZQG A;  2REK A;  1UI5 A;  2EZK A;  1SAN A;  4IHW A;  5FKO A;  3S2H J;  3CJD A;  2FBQ A;  2R5Y B;  1W0U A;  3ANP A;  2DA2 A;  4B4C A;  3LSP A;  4MIM A;  3IH4 A;  3JRD A;  2HYT A;  5IOZ A;  5EYR A;  2L0K A;  2JK3 A;  2QKO A;  1K61 A;  1I3Q J;  2K9Q A;  4JYK A;  4GFK A;  2EZL A;  4A3K J;  1H89 C;  2HQ5 A;  4V2F A;  1JKP C;  5HAW A;  5C3E J;  5HSZ A;  1MH4 A;  3BR1 A;  4DW6 A;  5H9T A;  5DAJ A;  4C3H J;  3GTP J;  2NS7 A;  2EQR A;  1GT0 C;  1ZKG A;  2R7Z J;  1NK2 P;  2AO9 A;  3NAU A;  4A3F J;  4BY7 J;  3F0C A;  4XK4 A;  3QKX A;  2GUH A;  1RET A;  4MXM A;  3Q0W A;  4JNN A;  3KKD A;  2LTP A;  1EF4 A;  3S1M J;  3RD3 A;  4GCL A;  2UXO A;  3S5R A;  3ZQC A;  2QOP A;  4M3B A;  4C3I J;  2R5Y A;  1APL C;  3FRQ A;  1JTX A;  1I50 J;  5EF6 A;  2LVS A;  2XPV A;  5IOY A;  2RHA A;  2ZCN A;  3LOC A;  3HTI A;  3BR5 A;  2E2H J;  3BQZ A;  1PUF B;  1HLV A;  3BG5 A;  3MVP A;  5HOD A;  3HB9 A;  4IHY A;  1ZK8 A;  3HGY A;  1T33 A;  1RKW A;  3BTJ A;  4IEJ A;  2CUE A;  1UHS A;  2HOA A;  1A6I A;  3WHC A;  3PAS A;  3ON2 A;  4X1E A;  2CQQ A;  1B8I B;  4AYB N;  1ZQ3 P;  5J1Y A;  3BHQ A;  3RZO J;  3BTL A;  3VOK A;  4GFL A;  1IG7 A;  3TW6 A;  1CQT A;  1JT6 A;  3S1R J;  2XDN A;  4A3L J;  2MGQ A;  1AU7 A;  4MFE A;  5AQC A;  2IAI A;  4JX4 A;  2QWT A;  2D5V A;  2O9L A;  1RKT A;  2UXI A;  3HE0 A;  4M3G A;  1WH7 A;  2G0E A;  1IUF A;  2OPT A;  3VPR A;  2NX4 A;  2RAS A;  3M4O J;  2Y2Z A;  3VP5 A;  4XRM A;  4BY1 J;  1UMQ A;  2XRL A;  3GTG J;  4A3B J;  1RPW A;  5M5X J;  3HEF A;  1ETK A;  4D5C A;  1E3O C;  2GEN A;  3QBM A;  2R93 J;  3F1B A;  1U8B A;  5GPA A;  2RAE A;  1W0T A;  2P81 A;  3OSF A;  1IDZ A;  2TCT A;  1OJL A;  3EUP A;  2MSY A;  3GBG A;  3JRB A;  3BR2 A;  1LE8 A;  3A02 A;  5D1R A;  5CXI A;  5DS9 A;  2GFN A;  2DA4 A;  4M3E A;  4MK6 A;  3LNQ A;  4RDU A;  4BBS J;  1GUU A;  3JRC A;  4A69 C;  2ZOY A;  5BNG A;  4UUS A;  4I6Z A;  2XPW A;  4DZP A;  3RQI A;  4A3G J;  3HIM A;  3S2D J;  1ETV A;  4BKX A;  4Y52 J;  2HKU A;  3WHB A;  3CWR A;  2GBY A;  4CYC B;  4EEF G;  2F07 A;  4S0H B;  2LD5 A;  4L5E A;  3G1O A;  3TW7 A;  4D5F A;  3JRG A;  5J1R A;  1ETW A;  2JA5 J;  5F27 A;  1BW5 A;  5D19 A;  2LKX A;  1AHD P;  3GEU A;  3VW0 A;  3T6N A;  2KDZ A;  5M3M J;  3GTJ J;  2JJ7 A;  3PO2 J;  2EZH A;  1BL0 A;  3BNI A;  5C44 J;  1MBF A;  2X6O A;  3CMY A;  2HI3 A;  5IP7 J;  2X48 A;  3BTI A;  2V57 A;  3VVZ A;  1ORK A;  5EG0 B;  2M34 A;  1ETQ A;  1Z0X A;  4FTH A;  4A3E J;  2H1K A;  3QPL A;  3V78 A;  2DMT A;  2JA6 J;  2M8G X;  3DPJ A;  9ANT A;  3VUQ A;  1WGX A;  1WH5 A;  2DJN A;  2ME0 A;  3SFI A;  3VVY A;  2DA6 A;  2YS9 A;  4BBR J;  3IUV A;  4CYC A;  1MSF C;  3HOY J;  3A01 A;  1I6H J;  4A3J J;  4ME9 A;  2HDD A;  4UDS A;  1B72 A;  3JRH A;  4DZJ A;  2ZOZ A;  1HDP A;  4M6V A;  1YRN A;  4QIW N;  3Q0U A;  3H3V K;  5K7H A;  3NPI A;  4FE4 A;  5M5W J;  3LWJ A;  4ACI A;  1ENH A;  3QQA A;  3AQT A;  3VW1 A;  2XB0 X;  5C4X J;  3Q0V A;  2O7O A;  2VI6 A;  1JKQ C;  5F04 A;  5EGO B;  3ZQF A;  5IP9 J;  2UXP A;  4M3D A;  5FGL A;  3BR0 A;  3BG3 A;  1JJ6 C;  3IH3 A;  2DA7 A;  4QTR A;  3HOZ J;  5JLX A;  2WGB A;  1H88 C;  4C2M J;  4MLO A;  2I10 A;  2Y0S N;  2NS8 A;  1NK3 P;  2OI8 A;  2FX0 A;  2Y31 A;  3LSG A;  1Q1V A;  3PPB A;  2LK2 A;  5JLW A;  1F43 A;  1SGM A;  3VOX A;  2G7L A;  2PMZ N;  4JP0 A;  3TP0 A;  1IJW C;  4FCY A;  1JGG A;  4A3C J;  5EZG A;  4B1R A;  4RBO A;  1VFC A;  3S1N J;  3GTQ J;  4A93 J;  1VI0 A;  4B3A A;  1ETY A;  1IRZ A;  3VVX A;  3FIW A;  3H0G J;  4FIS A;  5E3L A;  1JJ8 C;  2DN0 A;  2ECB A;  3CRJ A;  3HM5 A;  2MW8 A;  1UG2 A;  3DCF A;  3I4M J;  2ZCX A;  1BW6 A;  5M5Y J;  1U78 A;  2CU7 A;  2ID6 A;  3MN2 A;  1ZR4 A;  2W48 A;  3ZQH A;  1TWA J;  2JN6 A;  2K9S A;  3E7L A;  2HOS A;  1Y1V J;  3JRE A;  1JUM A;  4XIC A;  3HBL A;  2OER A;  5HBU A;  2LLK A;  2VKE A;  2XGC A;  4XRS G;  3LJL A;  5F0H A;  2NVX J;  5CXG A;  3I4N J;  4JX6 A;  5E3O A;  5IPA A;  3JRF A;  2B63 J;  3MKL A;  2WAQ N;  2PBX A;  4XRS A;  5CW8 A;  1XS9 A;  2XSD C;  2EZI A;  2R0Q C;  2E19 A;  2XGE A;  3C07 A;  3EGQ A;  3TED A;  2IEK A;  2LP0 A;  1GVD A;  5FKK A;  2H8R A;  2CQX A;  1MSE C;  3HOW J;  1FTZ A;  1MBJ A;  1PUF A;  1BJZ A;  1X58 A;  5FLM J;  1HDD C;  4W97 A;  1LFB A;  5FKM A;  1ZGW A;  2HXI A;  1B8I A;  3S15 J;  3PO3 J;  1BA5 A;  2O7T A;  4PXI A;  1FIA A;  1QVT A;  1U9O A;  1LFU P;  3S17 J;  3JRI A;  1OFC X;  1MBH A;  2TRT A;  5J1U A;  4NDL A;  2G7G A;  2QCO A;  3O8H A;  4M3F A;  3HOU J;  3BRU A;  1S7E A;  1FEX A;  4HNV A;  2JWT A;  4FE7 A;  1OCP A;  2W53 A;  2YUS A;  2M2E A;  3FKI J;  4Y7N J;  3MNL A;  1U9N A;  4NEL A;  3V6G A;  1IV6 A;  2R5Z B;  5FLV A;  3FK7 A;  3SDG A;  2UXH A;  3ZOB A;  2VUM J;  4AUX A;  5IP6 A;  5K7Z A;  1XG1 A;  2E2I J;  2WB1 N;  4A3D J;  2L7F P;  3ANG A;  3E7Q A;  2K40 A;  3DEW A;  2FQ4 A;  5C4Y A;  1JKO C;  3BG9 A;  4AF5 A;  2R92 J;  3NXC A;  2CJJ A;  2HYJ A;  1G2H A;  5FMP A;  3G56 A;  3P9T A;  2Y9Y A;  2AHQ A;  1TWH J;  2JA7 J;  3O8G A;  3HOX J;  4IHV A;  5J3L A;  1H8A C;  3RH2 A;  1MBK A;  1JT0 A;  1VF9 A;  2DMQ A;  4J19 A;  2VKV A;  3OSG A;  1ETX A;  4IHX A;  1GV5 A;  2JA8 J;  5E3M A;  3SJM A;  4HKU A;  4XID A;  3G1L A;  2DMN A;  3JRA A;  5GP9 A;  1OCT C;  2NOG A;  1XC5 A;  3LSR A;  4A3I J;  2OF7 A;  2ECC A;  1R9T J;  4G12 A;  1QRY A;  3BR3 A;  3BTC A;  2HOT A;  5F08 A;  4L62 A;  4A3M J;  2QF7 A;  2WUI A;  2NVQ J;  2YVH A;  5FKN A;  4GFB A;  3AQS A;  1GDT A;  5IYC J;  4LOC A;  5EG0 A;  2DG8 A;  3BCG A;  4GCK A;  2L7M P;  2L9R A;  1MH3 A;  2CUF A;  3BT9 A;  2M0C A;  1TWG J;  2E1O A;  1UI6 A;  3HOV J;  4ICH A;  1ZTR A;  3KKC A;  2D6Y A;  3B6A A;  5EEA A;  2EBI A;  4UUT A;  3NI7 A;  2CRG A;  4C3J J;  3HKZ N;  4X6A J;  5EZH A;  2N8G A;  1NTC A;  3CDL A;  3OIO A;  3HGG A;  1JUP A;  4JX5 A;  1GV2 A;  1P7I A;  1ITY A;  3NAR A;  3BJB A;  1WPK A;  1JUS A;  5EDN A;  2DMP A;  5EGO A;  2KT0 A;  3BR6 A;  2NP3 A;  2UXU A;  4NN1 A;  1QVU A;  1X2M A;  1HOM A;  3RZD J;  3GTL J;  2ELK A;  2EH3 A;  1T56 A;  5EFY A;  1FTT A;  1JTY A;  4DYR A;  3C2B A;  2IU5 A;  1F36 A;  3M3Y J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...