4W97A

Structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
196
structure length
196
Chain Sequence
RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of a Ketosteroid Transcriptional Regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor KstR2
total genus 86
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w97A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w97A02
3HEFA 2MGQA 3SFIA 1RPWA 3JR9A 1MNMC 5J1YA 3JRFA 2YVHA 3S16J 2RASA 3PM1A 3JRHA 1XS9A 2PBXA 3ANPA 2DA3A 4B1RA 2ECBA 3NARA 2XPWA 1SGMA 3JSJA 3HDDA 5EZHA 5IYCJ 3A01B 4FISA 2CU7A 1EF4A 2HKUA 2Q24A 1A6IA 2K9NA 2UXIA 3BG3A 2ID6A 3RH2A 3A03A 1IC8A 1JJ6C 5E3LA 4D5CA 1A5JA 1P7IA 2NVYJ 4Y7NJ 1SFOJ 1F43A 4JX4A 1HLVA 3S1MJ 1CQTA 2LD5A 2EZKA 3KKDA 4JX6A 2DA6A 3VOKA 5F04A 3HOZJ 1T33A 3S1RJ 4A3FJ 2JMWA 3BR2A 3TW6A 1SANA 4UUSB 4FCYA 1BA5A 4A3DJ 2OI8A 2NX4A 1HCRA 1IV6A 2JA6J 3Q0WA 4XRSA 3HM5A 4D7MA 4GFKA 1ZTRA 3FKIJ 4JYKA 3C2BA 1IRZA 3IUVA 2LVSA 5IP7J 2NVXJ 5EFYA 4MO7A 1R9TJ 9ANTA 3GZIA 3BCGA 4L62A 5H9TA 1BL0A 1MH4A 2DMTA 5DTDA 4NDLA 1RKTA 5IYDJ 1AKHA 1XG1A 2HXIA 5K7FA 1B72B 4BY1J 2GLOA 1POGA 3O8HA 4M3FA 3HOXJ 1UI6A 2QIBA 1WI3A 3HE0A 5FGLA 4AUXA 4A93J 4I76A 5C3EJ 1H88C 3E7QA 1G2HA 2NVQJ 1AHDP 2DMUA 3RZDJ 1RETA 2JK3A 2XB5A 4A3CJ 2MSYA 4RBOA 2YVEA 2IAIA 3FIWA 3OSFA 1X2MA 3F0CA 5BNGA 3EUPA 3JRBA 4BKXA 2G7SA 2E1OA 4M6VA 5M5XJ 5K7HA 2DG8A 2X9DA 2XB0X 3HTJA 2KDZA 1B8IB 1I3QJ 5EGOA 2AO9A 5F0CA 2UXUA 1VFCA 3AQTA 3HTAA 2JA7J 2W53A 1ETKA 2B63J 3NRGA 4XIDA 4YZEA 5FKMA 4RDUA 2JA5J 3LSPA 1GDTA 1JTYA 2HDDA 2XSDC 5EYRA 2E19A 2DMQA 5IP6A 4A3BJ 2ME6A 2ZCNA 3GTKJ 3BNIA 2AHQA 4QSHA 3O8GA 1FTTA 2G7LA 1W0UA 2O9LA 4IHYA 3C07A 3LSRA 2K9QA 1DU6A 1TC3C 4IHXA 2E2HJ 1RR7A 4LOCA 3VW1A 1MBHA 2Y30A 5J3LA 1H8AC 3KNWA 1S7EA 2HOSA 1ZGWA 4V2GA 1XC5A 3QQAA 1ZQ3P 5M5YJ 2LFBA 4ABZA 1ENHA 4A69C 1PUFB 5F08A 3S14J 1WGXA 1NK3P 2G3BA 2F07A 3G1MA 1UMQA 3IV5A 4M3EA 4C2MJ 2UXOA 1OFCX 1IDZA 4DZJA 4XICA 4JP0A 3S1QJ 3G1LA 1NK2P 2XPVA 1ZR2A 5E3NA 3BHQA 3CQZJ 2QKOA 3ZQCA 3Q0VA 3GEUA 2PMZN 2H8RA 5DS9A 1QRYA 3CDLA 2HYJA 3H0GJ 2EH3A 2TRTA 5EDNA 2WV1A 3WHCA 1WH5A 1QVUA 3HGYA 2VKEA 3ZQFA 5C4XJ 3BR0A 3VVYA 5HAWA 5AQCA 3LWJA 1U8BA 4A3IJ 3GTOJ 1LE8A 2DA2A 2COBA 4GCLA 2XPUA 3G1OA 5IP9J 2D6YA 5CXIA 1ETQA 5C4YA 3OOUA 3CRJA 3HTIA 1JKOC 3NI7A 2KT0A 2XRLA 2M34A 4BBRJ 3GTMJ 2R5ZA 1JJ8C 1Z77A 5E3OA 2MW8A 3M4OJ 3QBMA 1ORKA 4MFEA 5EGOB 3MN2A 2FX0A 2M8GX 4D5FA 3ZQLA 4V2FA 3LHQA 4A3LJ 2XGDA 2GENA 2EQRA 4QTRA 4CYCB 1MSEC 2CUFA 3NPIA 3BT9A 1K61A 2LY9A 2V57A 3P9TA 2NP3A 3B6AA 1MH3A 1BW6A 2NS7A 1PUFA 2HYTA 1F36A 1IDYA 2XGCA 4W97A 3DPJA 4NELA 4DZPA 1ZR4A 5M3FJ 4UUSA 5J1UA 1MBFA 3GTQJ 4ICHA 5CW8A 3VIBA 2EBIA 2Y9ZA 3QPLA 4JX5A 3LNQA 5C4JJ 4A3KJ 4L5EA 3HOVJ 3LJLA 2DA7A 2FD5A 3O60A 1DU0A 5FKLA 4X6AJ 4XRSG 3AQSA 2QWTA 1VI0A 4W1UA 1JT6A 4DYCA 3ZQIA 1JTXA 2Y9YA 3BR1A 3BQZA 3H3VK 3FISA 3DEWA 2DJNA 3RD3A 2R93J 3DCFA 3NAUA 2HXOA 5CXGA 3I4NJ 3W6VA 2O7OA 3M3YJ 4A3GJ 5FKNA 2K9SA 4PXIA 1TWCJ 3BQYA 2QTQA 5J1RA 3T6NA 4BXXJ 3HOUJ 3QKXA 2ME0A 3Q3SA 3HOWJ 2ZOYA 3BTCA 3BTLA 3ZQHA 1WCMJ 4DYRA 2YUSA 2IEKA 5JLWA 4GFBA 3MKLA 3JRCA 3UKGA 2IU5A 4GFLA 1JT0A 2GBYA 1FTZA 1HF0A 3CJDA 3NNRA 4JL3A 2YU9J 2CQXA 3IH4A 5F0FA 2VPRA 1BJZA 2E2IJ 1UG2A 4GCTA 1OJLA 1OCTC 4B4CA 2X6OA 3ON2A 1ETWA 4B3AA 3VVXA 1FIPA 5EF6A 3PASA 2LK2A 3OSGA 4GCKA 4DW6A 5GPCA 1E3OC 4BBSJ 1IG7A 5D19A 3ANGA 2JWTA 3BG9A 2CJJA 3Q0UA 2QCOA 1JKQC 3GBGA 1QPIA 3JRDA 1RESA 3BR3A 3PO2J 3D1NI 1ETVA 3BTIA 3SJMA 1D5YA 3S15J 2DA5A 2L0KA 4UDSA 4CGRA 2ELKA 3E7LA 3SDGA 4AYBN 2NOGA 3HIMA 5FKKA 2L7ZA 2QF7A 2UXHA 2JJ7A 4UUTA 4S0HB 4XRMA 2DMNA 5C44J 2OERA 1VNDA 1I6HJ 2O7TA 2L7MP 1Y1VJ 2Y31A 5IOYA 2DTZA 3F1BA 2EZHA 4MIMA 1FEXA 4D7NA 2WB1N 2X48A 1JGGA 4IHWA 4A3JJ 5FLVA 2NP5A 3B81A 3FK6A 3ZOBA 1MSFC 1I50J 4HKUA 1Q1VA 5EZGA 4JKZA 1ETYA 2XGEA 4CYCA 3TEDA 1HDDC 2GUHA 1TWHJ 2JA8J 2DN0A 4KWAA 3CCYA 5EEAA 2PZ9A 2UXPA 1IJWC 1FJLA 3GTJJ 1GT0C 2DG7A 5FJ8J 2RHAA 2DA1A 3KKCA 3JRIA 2I10A 3BJBA 2VI6A 3CWRA 3JREA 3BR5A 3JRGA 4NN1A 1T56A 3VVZA 3WHBA 1GV5A 2EZLA 1LE8B 3PO3J 2Y2ZA 1P7JA 1APLC 1MBGA 3COLA 1WH7A 2L9RA 4FE4A 5E3MA 3S5RA 5IPAA 1GV2A 2R5ZB 5K58A 5EG0B 1X2NA 2ECCA 2REKA 1U9OA 2N8GA 1GUUA 4XK4A 1ZK8A 1IGNA 3HKZN 2NS8A 3TW7A 1U9NA 2XDNA 1JUPA 2M2EA 5F27A 2H1KA 1YRNB 2FQ4A 4DYQA 5EG0A 2LKXA 2R5YA 3FK7A 5FLMJ 4J19A 3TP0A 3VUQA 3HB9A 1JUMA 5FMPA 1RKWA 5GPAA 2VUMJ 4AF5A 4FE7A 2HI3A 2ZCMA 1AKHB 1W0TA 1H89C 1LFBA 5FKOA 3GTLJ 2MG4A 1ETXA 4M3BA 2Y0SN 3VW2A 4MLOA 3VOXA 4M3GA 1UHSA 2YS9A 3IH2A 4C3HJ 1BW5A 3LSGA 1QVTA 1JUSA 2DA4A 2L7FP 3S1NJ 3OIOA 2VKVA 2JN6A 3ZQGA 2WAQN 2G7GA 3V6GA 2QOPA 3G7RA 3VW0A 5F0HA 3CMYA 1Y1WJ 1ITYA 3GTGJ 2CUEA 2P81A 2OPTA 3I4MJ 4IHVA 5M5WJ 2TCTA 1MBJA 2CRGA 2LR8A 1NTCA 2ID3A 4X1EA 2CQQA 5K7ZA 3FRQA 1YRNA 2R7ZJ 5IOZA 3IH3A 5HBUA 3BG5A 1TWAJ 5GP9A 3G56A 3MNLA 4I6ZA 4AC0A 4EEFG 4MFDA 5D1RA 3A01A 1MBKA 3QPSA 2HOTA 2R92J 2GFNA 4AC6A 3HBLA 3NXCA 3BR6A 4ACIA 2R0QC 4IEJA 2ZOZA 3BTJA 4FTHA 1UI5A 2K40A 3S2HJ 1JKRC 3KZ9A 2LTPA 1B72A 3VP5A 4MXMA 3RQIA 3TP3A 2OF7A 3V78A 2G0EA 3ON4A 1JKPC 2FBQA 2FJ1A 4A3MJ 1O4XA 2HOAA 1TWGJ 4BY7J 3VPRA 4C3IJ 1WPKA 3HGGA 1IUFA 2RAEA 1VF9A 5M3MJ 1ETOA 4M3DA 2ZCXA 3B6CA 2LLKA 2ZB9A 1K83J 1X58A 3K2AA 1MBEA 3MVPA 3HTHA 3EGQA 2R5YB 2W48A 4ME9A 1B8IA 5JLXA 3A02A 2GM4A 3L1PA 4HNVA 1OCPA 5HODA 2NVTJ 3S17J 3LOCA 2WGBA 3PPBA 4QIWN 3K7AJ 2D5VA 3BRUA 3RKQA 1HOMA 4MK6A 4Y52J 2IBDA 4JNNA 5FHPA 2LP0A 3JRAA 2EZIA 2M9HA 3RZOJ 2DMPA 2HQ5A 5F1JA 1HDPA 1LFUP 4C3JJ 1ZKGA 3LSJA 4G12A 1GVDA 2WUIA 4A3EJ 1Z0XA 1FIAA 3GTPJ 1TWFJ 5DAJA 5HSZA 5D18A 1U78A 5IYBJ 2O8KA 2M0CA 1AU7A 3S2DJ 3HOYJ 2E2JJ
chains in the Genus database with same CATH superfamily
4O3MA 1P4AA 1R6RA 1MNMC 2YVHA 1MMSA 3NEUA 2ZBKA 2WA0A 2DA3A 2KZGA 2XAJA 3KP7A 2NNYA 3G2BA 5E79C 4AM3A 2HZTA 2DFFA 3HDDA 5EZHA 2UXIA 5JFRA 1R71A 1W36C 1A6IA 4RGSA 5LHGA 3BG3A 4DVYP 5ICFA 4OINF 5HS9A 3WG7H 1JJ6C 1FYKA 2Y0SA 4IRHA 1XSDA 2V1UA 2Q0OA 4P9FA 2Q2EA 4G9YA 5H20A 1F43A 1SEUA 1S7AA 2A07F 3OOPA 1ACIA 4JX6A 3KKDA 1R1TA 4FASD 5GTHC 2W00A 3WE2A 5LGNA 4BL0B 2KMUA 4UUSB 2VE8A 4A3DJ 2OI8A 2OZ6A 4KIFA 1IV6A 1P6RA 2OBPA 4YRVA 3C2BA 3RKWA 3IUVA 5IP7J 2NVXJ 2HZDA 4MO7A 9ANTA 3VTIA 4CDGA 4WWCA 4L62A 3ASNH 3BPXA 3CDHA 4EM0B 2F6CA 3S8PA 3V42A 3K9TA 1RKTA 2RVCA 4L9NA 1Y8RB 5J47A 5DUIA 5K7FA 4BY1J 1UI6A 3O8HA 3M8EA 2ZKZA 3HE0A 5EJCA 1T0FC 2VQHA 2VLAA 4BDZA 3K1MA 3CF5F 1ZG1A 4DBRA 4HNUA 5C3EJ 3CCJI 1MW7A 3W2WA 1H88C 3M7GA 3QPTA 1KU7A 3GZ6A 3HJEA 4U9LA 1WZ2A 3BPVA 3RZDJ 1UELB 5HDGA 4RLQA 1SFEA 1KU3A 2JK3A 2R7XA 4RBOA 1XSXA 2YVEA 2IAIA 2EB7A 3C1DA 2JPBA 1I27A 1Z3XA 3OY9A 3FWEA 4RAFA 5BOXA 3JRBA 4BJTA 2G7SA 2XAUA 5M5XJ 5CVVA 1PDNC 2XB0X 2X1CA 3H1CA 1B8IB 3IAM2 1SD4A 4RM2A 1FWZA 4RB1A 2UXUA 3GFMA 1VFCA 1NHAA 4E7SA 2B63J 2HFHA 4BQOA 4HEA2 4F3QA 5FKMA 1FYMA 2JA5J 3LSPA 2K4JA 1WVRA 3ERMA 3I64A 2X51A 4HPQA 2QA4I 1TT5B 3OYCA 3L00A 3WTZA 2A5WA 2EK5A 2AHQA 2VBYA 3JW4A 4ENMA 1FTTA 1W0UA 2TDXA 2E5NA 2E1NA 2BZTA 2PFBA 2V7FA 2IPQX 2M4GA 3HPHA 2E2HJ 1V3FA 1MBHA 4KITB 2K86A 5DM6F 1RUOA 2DJIA 1QPMA 1S7EA 3IUOA 3HC7A 2HOSA 1X1PA 1ZQ3P 1PUFB 2LFBA 3OL4A 1BI0A 4II3A 2P0WA 5D6EA 2WY8Q 2XIGA 3R0AA 3G1MA 1TQIA 4I2OA 1P92A 2VBXA 2G3BA 1A35A 4M3EA 2X1DA 2GXBA 1S6LA 1T39A 1IDZA 4JP0A 1OYWA 3CO7C 1R5GA 4PSXA 2E5ZA 3G1LA 3WU0A 4ASNA 3LA7A 5E3NA 3BHQA 3VDXA 2BE5F 1BJAA 3G4SI 4BDYA 3FDYA 3K1PA 4L5IA 3VYUB 3VWBA 1QRYA 1FP1D 2TRTA 2WV1A 2YX4A 2ZMEC 3ZQFA 5C4XJ 1T08B 2VKEA 3P9CA 4PJ0C 3VVYA 1YX3A 5HAWA 4XONA 3GTOJ 2DA2A 1Z05A 4XN0A 5DV5A 2PFVA 1YW9A 4E7LA 3OOUA 3CRJA 5KAIC 2KQRA 4ZJZA 3M1EA 5JVTA 2KT0A 2XRLA 2CW7A 3QP6A 2M7AA 2M34A 4XSZF 2AXLA 4KMUX 2W1OA 4D1QA 2RNJA 5FGMA 2RV8A 1ORKA 3BJ6A 3WE3A 3MMYB 1LNWA 1ON2A 3W2AA 2FMYA 3AL0B 1HW2A 5LBQA 3F72A 2M8GX 4TV7A 2QEXI 1UJ8A 4AIDA 3LHQA 3L2CA 1WI9A 3BT9A 3FZVA 1G3SA 1U3EM 2RDPA 4G7HF 1MH3A 2Z1DA 3C7JA 2IVMA 2HYTA 4O5VA 4A6EA 2XGCA 3HPGA 3FBNB 4UV9A 3DPJA 4I98B 2ETHA 1KU2A 1XGMA 4BHBA 4XLAA 1MBFA 1IW7F 3KETA 1Z67A 2YR2A 1STZA 2EBIA 3E0JB 5DYMA 2Y9ZA 4JX5A 2CUJA 4EGYA 5C4JJ 1VQ5I 4KDPA 4IO9F 1E17A 3J7ZI 2XC7A 3SEQA 5DEQA 2WAEA 2M87A 1DU0A 2WBMA 3GLLA 2PG4A 2VKDA 5FKLA 2FSWA 2CV2A 3AQSA 1H9GA 4ESBA 2QWTA 1VI0A 4W1UA 2O8XA 1SMYF 1YOVB 3H3ZA 4CCMA 2KKOA 3CCUI 4WF2A 4DYCA 1IXRC 2GOMA 3MKWB 1RI7A 1OR7C 2E7XA 5LFAA 3WTVC 3DEWA 3TOAA 4H0EA 1Q1HA 3IHUA 3DCFA 4NQWB 4LB5A 1KQ8A 3NAUA 4E7IA 5HS7A 2KJBA 3I4NJ 2O7OA 5TRDA 4BNCA 4YIIA 1P4XA 2ESHA 2K9SA 5TJJA 5ILUA 1TWCJ 3N05A 5D5VB 2FF4A 2W84A 4GDFA 3QKXA 3Q3SA 2AQEA 2KIQA 2ZNYA 2L9NA 3BTCA 2QBYA 2GA2A 1PJRA 3ABUA 1WCMJ 3QOEA 2YUSA 2IEKA 4HOBA 4KFCA 2PJRB 2HS5A 2HOEA 3RCOA 3JRCA 3HOTA 3ZR8X 2A3SA 3FM5A 1FTZA 4OMZA 3CJDA 2VQLA 3GF2A 1OMIA 3HHGA 3K4NA 4IRGA 1QA6A 2FNAA 4RB3C 3K4JA 1FBUA 2E2IJ 2E36A 4UHTA 3BC8A 1OJLA 4FETA 4XLPF 4B3AA 2DFEA 2LK2A 4GCKA 2B9SA 3ANGA 2VC1A 2DW4A 2GIZA 1JKQC 1QPIA 1KQ9A 2E1MB 3GBGA 2DPUA 3BR3A 3QPHA 4IQ4A 3D1NI 3ZRGA 3S15J 2OUMA 4ANJA 2V9VA 4CGRA 4Z6YA 3E7LA 4HBLA 1MMGA 3SDGA 4AYBN 2F4IA 1F9NA 1HKSA 2QF7A 2JJ7A 2X6XA 4XRMA 3WU1B 3PL8A 3Q9VA 2OERA 4LK0F 2L5QA 1X3ZB 2HU9A 1FEXA 4Z2YA 1V55H 4OAYA 1MDMB 1T98A 3HG9A 2NP5A 1JGGA 4A3JJ 5FLVA 2IRFG 2R7VA 2LH9A 1MSFC 1I50J 3SZGA 1W7PB 2ADUA 4UNOA 5JHUA 1I3AA 1QZYA 2JA8J 2DN0A 2W4SA 1HSTA 1R00A 1FBQA 1U5TB 2V1XA 3CJTB 2QENA 3VFZA 2UXPA 1IJWC 3LA3A 1FJLA 1GT0C 4CO8A 4U0VA 2DG7A 3KE2A 2JVGA 4RMNA 4HAMA 3M8JA 4U0WA 2DQRA 2RC4A 3VEPA 4P5OA 4C9YA 2RHAA 3IWFA 2DA1A 3KKCA 3BJBA 2VI6A 3R6SA 4G7OF 1T56A 3WHBA 1GXQA 2FEZA 4B3XA 2EZLA 3PIOF 4IJAA 3A0BC 2GA1A 5ERIA 2MH2A 2CGPA 1MBGA 4B48A 3L2RA 3QYBA 3HOSA 4HV5A 4N0BA 2VN2A 1GV2A 2R5ZB 5K58A 1X2NA 2ECCA 1J59A 3BJOA 3FMSA 3ZMUA 2AQFA 1GUUA 2K9LA 2WC2A 2PI0A 4UUVA 2XASA 1IGNA 1N25A 3OYGA 3SYTA 3DKYA 1JUPA 2M2EA 2UXNA 4IRVA 1FP2A 4DYQA 4RB2C 1W7PA 3BLYA 1LVAA 2R5YA 2FXAA 2XAHA 2HWVA 3RPUD 1W0TA 1XGSA 1H89C 3L2UA 2B7EA 3IP4B 2ZC2A 3G6EI 3GWZA 3LMMA 1D0YA 3VOXA 4M73A 1B1BA 4HQMA 4C3HJ 3LSGA 2GXAA 1QVTA 3KCCA 2DA4A 1R5ID 2D1VA 4BHCA 4C2MA 2L7FP 1R4NB 5ILVA 3OIOA 3E5XA 1SFUA 3ZQGA 2QOPA 3VW0A 1Y1WJ 3CMYA 4YEJA 5TISC 1UFMA 3GYHX 2OPTA 4N4NB 4MGRA 2LR8A 2QUFA 3LL7A 4I02A 4PK4A 3FRQA 5IOZA 3ZP5A 2HPMA 3BG5A 3A0HC 2K4BA 3T0YA 4M72A 4EEFG 2O61A 1KYZA 2X4HA 2R7OA 4RAZA 4IEJA 3F9KA 4HSRA 3ZN1A 1VTNC 2K40A 4YFNF 3KZ9A 4LGWA 3OYBA 1ODDA 3TP3A 4BQNA 3OIQA 3ON4A 1JKPC 4D0PA 5HDNA 1O4XA 2LYCA 3CUQC 1T6SA 4UVCA 2HOAA 1TWGJ 3PUFA 3VPRA 2OCCH 3HGGA 1WPKA 2UUZA 2XVCA 3FXUA 4JOMA 5HOOA 1H9TA 4P96A 4GCVA 2OTLI 2FA5A 2ZB9A 2FUG2 3HTHA 3F8CA 4CH7A 3HTSB 3EGQA 3C18A 2VODA 1B8IA 2L54A 1DGWY 3L1PA 2V6EA 4RB0A 3ZMTA 4QWQA 4U88A 2CV1A 3VB2A 4G6TB 4MK6A 2D5VA 2ZSHB 1HOMA 3OWTA 4JNNA 2WADA 3S3NA 1IXSB 5FHPA 1YX5A 3L2QA 1KU9A 4CA0A 2UZKA 2CMPA 2KRCA 2PBIA 4RLFA 4V19K 4C3JJ 3LSJA 3KPHA 2Y0MA 4A3EJ 1TWFJ 5HSZA 2V6CA 1U78A 3U1KA 5F64A 5IYBJ 2O8KA 3FXOA 2YVXA 2M0CA 1I6XA 1TP4A 1YG2A 2E2JJ 3HEFA 3WU2C 2MGQA 1RPWA 5J1YA 2RASA 3DLAA 2CFOA 1O3SA 1OCCH 3ANPA 4BH9A 4B1RA 1XGOA 2ECBA 3RYRA 4MQ9F 1R5HA 4U7DA 3OYHA 2W25A 1SGMA 2Z5UA 5IYCJ 4FISA 4ZH4F 3A01B 4HLYA 2ID6A 2P4WA 4HZFA 3A03A 2F4OB 4PZJA 1P7IA 4HV6A 5GADJ 5B1AH 3P9KA 3CMAI 2LD5A 5HVQC 5E20A 5F04A 3HOZJ 3TDUC 2VKHA 4G94A 2R7FA 3QP5A 3BR2A 2DK5A 1SANA 1TTYA 1L0OC 4DGWB 3IRQA 1ON1A 3Q0WA 4XRSA 1Z9CA 1PVEA 4JYKA 4KIBA 1IRZA 2LVSA 1F4KA 3OMYA 4KT6A 5H9TA 2H6BA 2X0LA 1QQIA 3I56I 4M9ZA 1J2XA 5LHHA 3PNTA 4B8XA 5A2QZ 4E6KG 2RQPA 2HXIA 2LY1A 3HOXJ 1OYYA 1YLFA 1WI3A 2L4MA 3R0JA 4PDKA 4AUXA 4ESJA 1V5EA 1P2FA 2QM3A 3BDDA 4KICA 1DUXC 3S3MA 1W5SA 4L9TA 4XLNF 1RETA 3RYPA 2JPCA 5KK1A 2OA4A 2QBYB 2XB5A 2MSYA 1IN8A 4U87A 5B1BH 2JTVA 3OSFA 4L18B 4PFPA 1X2MA 4A0ZA 2Q2EB 4KISA 3KX2A 3EUPA 4HF2A 2E1OA 4CCLA 4DJAA 1X1DA 5LHIA 4L5JA 3HUGA 2AO9A 2GQQA 3TL4X 3FXMA 3HTUA 4LIUA 4IKFA 2XF7A 3VODA 1QU3A 4I0BA 3ML6A 5LEKA 3QODA 1K79A 4XIDA 2B1EA 1MMNA 3F8FA 1SMTA 3OS2A 4B09A 4AYBA 1TZLA 3ROUA 3AFHA 3F22A 3MEXA 1TNSA 5IP6A 4U0YA 2ME6A 1KYWA 3GTKJ 1K4SA 3BNIA 4J00A 3FXKA 2L2OA 4NB5A 2O9LA 1VQ4I 5LGUA 2P5KA 5FD5A 2K9QA 3OYDA 3Q9SA 5J40A 1TC3C 3FXJA 1RR7A 4LOCA 3VW1A 2WTEA 3H9QA 5J3LA 4DOZA 4NC8A 2EA2A 2CUZA 1DP7P 3KNWA 3K8PC 4L9VA 4V2GA 1XC5A 5M5YJ 1ENHA 3SEZA 1WWXA 4CHUA 2YSRA 3DV8A 1UMQA 3HKZA 2DYSH 2Z9OA 4C2TA 3IV5A 2BW3A 4BEHA 1E0EA 1OISA 3AG1H 2OQRA 4F52A 1PYVA 1E3HA 1JHHA 1LEBA 2XPVA 1E3PA 3CQZJ 3Q0VA 4XMYA 5J8FA 2M4KA 3A1YA 3I71A 2X85A 3UR3C 4PCQA 3CUOA 2DU9A 3JAMZ 4ZYGA 3H0GJ 2RREA 4BE0A 2HDCA 2PJRA 2FBKA 3LWJA 5AQCA 3DXJF 3T5XA 3S32A 1U8BA 2COBA 2D6YA 1CGPA 1C0WA 5C4YA 3HTIA 1TQMA 3D0SA 1JKOC 1YS6A 3CZ6A 2CG4A 4D9JA 4DIQA 3AG4H 4BBRJ 4I09A 2R7TA 4OD4A 5ICGA 3J81Z 1G6NA 3M4OJ 2DCEA 1MDMA 4XN3A 3N4MA 3ONQA 3E5QA 1R7JA 1D0ZA 4V2FA 4IF4A 5L3DA 3DLLF 2VJIA 4IHTA 3I0TA 4BEHB 2KIUA 3F23A 2BVMA 3P9TA 4CICA 3RSNA 3MKYB 1BW6A 1PUFA 2BOLA 2ZSIB 1D1CA 1JHFA 1IDYA 4NELA 1WJ5A 3B02A 5J1UA 2VJ4A 2FU4A 3ZGKA 2IA2A 5E17F 4CYDA 5FB2A 3Q5FA 2F5DA 4MEYF 4CXFA 2DFIA 4CCNA 5B3SH 2JRMA 4GRIA 2BY2A 4L5EA 2Q8KA 3WGHA 4LB6B 1DGRM 1HW5A 1YW8A 5HLIA 3KFWX 1NG7A 3HXLA 3TO6A 4XRSG 3CCMI 1Y8QB 3I53A 3WGGA 1JI8A 1JT6A 3I5UA 4ZDPA 3OS0A 2ZY9A 3ZQIA 1IRFA 4HLXA 1VQ9I 2G7HA 3BQZA 3BR1A 1KONA 3MZHA 2J5OA 3BOQA 1T38A 5AIQA 5HNFA 4XBFA 1ZGJA 1WJBA 4E70A 3JAMK 1HSJA 4PXIA 2K7LA 2PN6A 1ZLJA 3BQYA 3DTKA 4FX0A 4HG2A 5J1RA 4BXXJ 2ME0A 2R4GA 4AVZA 3HOWJ 1ZYRF 4UV8A 4XLFA 2EIJH 1GLNA 2HKXA 2UV1A 4EM2A 3ZQHA 4ITVA 4DYRA 3R60A 1UHMA 3HIFA 3OIPA 1QHGA 2F5CA 3OR1C 2HEOA 4GFBA 2IU5A 1QNTA 2YU9J 1EH8A 2V26A 4GGGA 1FSHA 4RAYA 4BACA 2KRHA 1UG2A 5HLHA 4GCTA 1OCTC 2D1HA 1WJAA 2IGNA 3CMEI 1USSA 2M3AA 3VSLA 1FIPA 5J4VA 5CJ9A 4YIFA 3DQVC 1E3OC 5H6RA 2ZFUA 1QZZA 2QVOA 3Q0UA 1YW7A 3JRDA 1YJWI 4OIPF 2J5PA 3PO2J 1FLIA 4HF0A 3BTIA 2L02A 5E8IA 4E4HA 5E8GA 2LF7A 3EUHC 3LSTA 5FKKA 2RNGA 3DPLC 3KIOA 4WXDA 2DMNA 2HNHA 3U2RA 5C44J 1V4RA 2O7TA 2Y31A 2FMLA 1U6GA 2KRFA 5IOYA 1Z6TA 3F1BA 4HRIA 4MIMA 3KYLA 4D7NA 2WB1N 4IHWA 1U2WA 2DQLA 3ZOBA 5ICCA 2XGEA 4CYCA 1HDDC 2FOWA 2XAQA 1SFXA 2GUHA 2QQ8A 1A6QA 1ZN2A 4HX7A 3GW2A 1BR1A 2BGCA 1XTAA 4GYIA 4KWAA 2L3DA 4CCKA 2XF6A 5EEAA 5IY5H 3KYDB 3V8JA 3TOBA 2G9WA 1LKXA 4EJVA 3BWGA 5FRNA 4IQJA 4UY8I 2QQBA 5FJ8J 3JRIA 3CWRA 3BR5A 3BZ6A 3QWLA 2Y69H 1ONVA 3JRGA 3VVZA 2PX9A 4JBAA 4BGDA 2P8TA 4LG3A 1LE8B 2VOPA 2DODA 4XOTA 2XROA 3BG7A 3CUQA 2AXTC 1APLC 1WH7A 2ICWG 1XDUA 4FE4A 4NQWA 3PJRA 1MJAA 2OV7A 4FHTA 5CVUA 2R3SA 5IPAA 2REKA 2A69F 5GAHJ 4XK4A 2CYYA 3QAHA 3KZYA 4XL9A 2D45A 3JSPA 1FZPB 1YRNB 3H5RA 5EG0A 3K1NA 2QSHX 1LDJA 3FK7A 2M45A 4PUSA 2STTA 5FO5A 3HB9A 2ZXIA 2BY1A 5CPRB 1RKWA 1FBSA 1U8RA 4XQFA 2VUMJ 2JSPA 3AG2H 4AF5A 4FE7A 1Y0UA 2HI3A 3HRSA 6PAXA 1D3YA 2LKPA 2DO7A 3JTHA 4A0YA 4ZDOA 1LFBA 3DTIA 2DLLA 5FKOA 3GTLJ 1ZH5A 2MG4A 4M3BA 2KHMA 4ZZLA 2YS9A 2KISA 2OZUA 1CF7A 3OL3A 1JUSA 3TDZC 4MQVA 3BROA 3S1NJ 2VKVA 2HTSA 1YS7A 3CTAA 4XKVA 4BQQA 2WY7Q 2G7GA 3G7RA 3K70C 5F0HA 3E6MA 3CO6C 2CUEA 3KP5A 2RQQA 1ZG5A 2P6TA 3I4MJ 3CCQI 3KP6A 2TCTA 1MBJA 1UHWA 1U5TA 4X1EA 2CQQA 4BYYA 1SFKA 1YRNA 4RGRA 4P55A 2WV0A 5HBUA 4IXAA 3J7YJ 5LEJA 3WGIA 3A2KA 1HKTA 3TMOA 1ZLKA 1V5GA 1XN7A 4HX8A 3QPSA 3S3OA 2LC2A 4AC6A 3G73A 3ZPLA 3BR6A 4ACIA 2XSJC 2A05A 2R0QC 3PIPF 1IF1A 1R49A 4YFKF 2VE9A 1YHQI 3S2HJ 4U9NA 2LTPA 1TL8A 3VP5A 3ZXSA 3QRFF 4FT8A 1YFHA 3V78A 1YYVA 5LRRA 4Y13A 2JUGA 3QYEA 1CF7B 1A04A 4EVIA 2LF8A 5L3BA 3H9GA 4LK1F 1FPQA 4CZZA 2ZXHA 4F91B 2BY3A 1HC8A 3MCZA 2V1NA 1WJFA 3EQLF 3C2HA 1UB9A 4MTDA 1Y56A 5AIPA 2WB1A 1IUFA 3LQQA 3K4LA 1HA8A 4LFUA 5M3MJ 4M3DA 2IXSA 2ZCXA 2CV0A 2IGMA 5K1YA 1S9HA 3K2AA 2M5WA 3MVPA 4I7HA 2F2EA 3I4PA 3CCRI 1RIOH 2ELHA 2W48A 5KCMA 4ME9A 2KP6A 3A02A 3KEYA 5FFZA 3RDIA 3J80K 4BQAA 4I99C 4HNVA 2FRHA 5HODA 2NVTJ 1PP7U 3LOCA 3S17J 3K2ZA 1AOYA 4ZYEA 5A2QK 2WGBA 3PPBA 2LG4A 1FMVA 1K7AA 2W57A 5D6FA 1XPXA 2EFPA 2LP0A 2COMA 3ABKH 3JRAA 1K6OA 1J75A 4I01A 2M9HA 3K69A 1ZKGA 1GVDA 4G12A 2GZWA 2EINH 2WUIA 3MWMA 1FIAA 5DCFA 4EJWA 3PFIA 4EQQA 1WKMA 3UNGC 4CCJA 4XKBA 3E3VA 1AU7A 5L3FA 1RZ4A 3CJRB 2ZJPF 3SFIA 3WTSC 3JR9A 2IT0A 3JRFA 3OR2C 3PFYA 2EPFA 3PM1A 3WODF 1HXDA 1XS9A 4BJ5C 1B9NA 2OTJI 1SD5A 3SHFA 3NARA 4JQFA 2Z3YA 1XSVA 2XPWA 2DPDA 3JSJA 4HA8A 3AKZA 2CU7A 1I1GA 2DOFA 2ZFWA 5CVJA 2XKPA 4BJ6C 2B3WA 2QQAA 1A5JA 4D5CA 3TO7A 4Y7NJ 2CQNA 2JRTA 4IPAA 3J81K 1SFOJ 3CDIA 4CGZA 2QKMB 1TW3A 1CQTA 3VOKA 2DA6A 4XSXF 2O5RA 2QQ9A 1BI3A 3G71I 3S1RJ 3GMEA 2JMWA 3TW6A 5HLTA 3W6JB 5K5OA 2M1BA 4FCYA 1X3WB 2W82A 3F6VA 2NX4A 3K10A 2JA6J 3TBIA 1X4OA 4D7MA 3F8BA 4GFKA 3FKIJ 3K4CA 3BCBA 1B6AA 3LFUA 5EFYA 2EFOA 1R9TJ 3BCGA 1X1BA 2WAFA 3H92A 1BL0A 3DTEA 3S93A 1MH4A 2DMTA 5DTDA 4B44A 3BZKA 1AKHA 1YE9A 2E60A 3DKXA 3ABMH 2XHKA 3K0LA 4AIHA 3D5LA 1XMKA 1UG0A 2QYOA 5L3EA 2F5EA 4M3FA 3CMMA 3CLQA 4WK8F 1O7LA 5FGLA 3E6DA 2A6EF 2GAUA 4LIVA 2VIXA 3HSFA 5CVRA 1HQCA 4A93J 3WTWC 3SFZA 1OQYA 2L9VA 3CC4I 1FOYA 4AVPA 2NVQJ 3E7QA 4ZZDA 1AHDP 4NBQA 2GOXB 4NHJA 1HW1A 4HX4A 1P4WA 2ZNZA 2ESNA 4O6JA 1FYLA 4WX9A 4KNYA 1Y0NA 3HRUA 4LJZF 2IGKA 1ZGAA 3FIWA 3RI4A 3GVAA 3IKVA 1MZBA 3F0CA 5JI6A 4BHPA 3KZZA 5BNGA 2M8EA 5KHDA 4BKXA 3HTJA 4M6VA 1X1AA 5K7HA 2DG8A 2X9DA 2M7BA 1I3QJ 5EGOA 2A2FX 2CW0F 3HRMA 4M9XA 1IO2A 3LSIA 2D2WA 4XKWA 5BPDA 3DPTA 4FQGA 2W53A 1ETKA 2FOKA 4XLCA 2DFHA 3E97A 2EWNA 2KLOA 4ZTFA 1IN4A 4YZEA 2K9MA 2CQ7A 2PMZA 2VASA 3E6CC 2L01A 2HDDA 3BP8A 5J6XA 4A3BJ 4LG0A 4N9HA 4EATA 2ZCNA 4DQ2A 1JGSA 4EJUA 4IL6C 4QSHA 3CCLI 4R1HA 1OCRH 4OWRB 3C07A 3LFKA 3ERED 4AIJA 4IHXA 3T8TA 2KPMA 2LSOA 1WJCA 5GAEJ 2F4MB 4UB8C 4A5NA 3N97A 4EJOA 1ZREA 2F5VA 3QQAA 4OIQF 3DPUA 5F08A 2PMUA 5DCMA 2BBYA 3JTGA 3CP8A 1ZRFA 2K3FA 4C2MJ 1SC7A 4PJNA 2X1EA 4DZJA 2DT5A 3HL2A 3S1QJ 5DUKA 2FBIA 1NK2P 1MKMA 1SVOA 1ZR2A 2RN7A 2DT7B 2QKOA 2UXXA 4M71A 2H8RA 3DFGA 2ZO4A 1KA8A 1VQLI 4ZYAA 2VPLA 1BI2A 1TLHB 1QVUA 4RM3A 2LDUA 3BR0A 3ZCOA 4A0XA 4GCLA 2XPUA 3G1OA 5IP9J 3FHZA 1JE8A 3MAJA 3K4MA 1VQNI 1Z7LA 2I5UA 3SZPA 2MLGA 1USTA 2MA3A 1MMAA 1B9MA 1D0XA 3GTMJ 4R8HA 2R5ZA 1Z91A 1Z77A 4M6YA 2MW8A 2WWYA 3DBRB 3QBMA 4MFEA 4WCGA 2HGCA 3OYEA 3S2WA 2E1CA 2H09A 5EEGA 5KVRA 4A3LJ 2XGDA 4KIGA 3D5RC 4QTRA 4CYCB 1MSEC 3NPIA 4A5MA 1TW2A 3L9FA 2DBBA 2NP3A 1R36A 1KQ0A 3B6AA 1XX5A 1F36A 1UCRA 1RR8C 4W97A 4ZTJA 3X2QH 2KIMA 4BE1A 2O6GE 4DZPA 5KNLA 3OYAA 1ZR4A 5M3FJ 4UUSA 1D8JA 4ICHA 1BOBA 1O57A 5DDGA 5IT9K 3QPLA 4Y33A 3GFIA 2MD0A 3LNQA 4A3KJ 4Y3OA 4LLLA 2HYFA 2A68F 2DA7A 2FD5A 3IWZA 1JXSA 3O60A 3SDBA 3I59A 4ZDLA 3V4GA 2K02A 2PMHA 1YITI 1HKQA 2C6YA 3LA2A 5FRMA 3MFKA 3OYLA 1JTXA 2VT3A 4CUGA 3IRRA 3H3VK 1B59A 3RD3A 2DJNA 2R93J 4YELA 3VYTB 5L3GA 5K5QA 1WRJA 5CXGA 1N77A 3W6VA 3RKXA 3M3YJ 4A3GJ 2VQGA 3NS4A 2L7KA 3QU6A 3COAC 2CW8A 2QTQA 4WXHA 2PLYA 2NAZA 1NH3A 4GYGA 5F1RA 2ZOYA 1REPC 2VL8A 4MEXF 2HYGD 3BTLA 1BR4A 5D5UB 4XOPA 2CWEA 2IA0A 2PEXA 1IN5A 5DD4A 2AS5F 3L7WA 5JLWA 4GFLA 4PFOA 3T8RA 2P7CB 2XUBA 5LD2C 3NNRA 1HF0A 5D8KB 2E7WA 2JSCA 3IH4A 4PSWA 5F0FA 3ZMVA 1XD7A 3VOEA 5L3CA 1FT9A 3VYRB 4B4CA 1K78B 4MHGA 2DXIA 4G7ZF 4BBSJ 1IN6A 1IG7A 5D19A 2R7QA 5EEHA 1S5LC 3BG9A 2CJJA 2QCOA 5BPIA 4IHSA 2VC0A 1ETVA 1D5YA 3SJMA 2L0KA 4UDSA 2ELKA 3EUKL 5ICEA 3R61A 3SWHA 2L7ZA 3JCUC 1AWCA 5IT9Z 1VNDA 3EUHA 2L7MP 3WTUC 3FBIB 2EZHA 4ZC3A 2LNBA 1BI1A 4L0ZB 3B81A 1DPRA 3OYNA 4Q48A 2DTRA 2VXDA 3FK6A 3HYIA 1BN5A 4HKUA 3K4KA 1Q1VA 2IA1A 5EZGA 2STWA 4JKZA 3TEDA 4LITA 1VQ7I 4OOIA 1TWHJ 4RGUA 2E35A 4G6DA 4QPOA 2R7UA 3CCYA 2R7WA 1BC7C 1F1ZA 3GTJJ 3W2VA 4AU7A 4P1WA 4M9SA 2I10A 5E18F 3WTYC 2MD5A 3TQNA 1EJ9A 4NN1A 4PJJA 2R7DA 1MNEA 1VQMI 5D5XB 2A61A 2VJ5A 3H3UA 3BY6A 1DPUA 1ZAOA 1P7JA 1X1CA 4HW0A 1ERDA 3COLA 1M1EB 3I58A 4AD9A 4AIKA 5CLSA 4MNUA 3AG3H 1LFPA 2N8GA 1LEAA 1SAUA 4YIRX 1IZ1A 1ZK8A 3RKYA 1Z21A 3KYCB 2NS8A 3FMRA 3HKZN 3TW7A 1MJ9A 4A2UA 3MZ8A 2FQ4A 4UVBA 5FLMJ 2DT6A 1VQKI 3VUQA 2Z2SB 1JUMA 4HF1A 3KLNA 3I55I 4X0GA 3T1BA 2V9PA 4E7JA 4JK1X 1BC8C 1AKHB 3K70D 2VQCA 3IC7A 4ENNA 3RTRA 3F8MA 1BIBA 3NWSA 4DNCA 2Y75A 2DYRH 3P9IA 4MLOA 1BM9A 4ENJA 2QKLB 1X19A 1RNLA 4RGXA 3L2VA 3H0DA 3KP4A 2NS0A 4IX7A 3TO9A 3V6GA 1FMWA 5JVGF 2NOJB 3F6OA 1ITYA 2MABA 4BS9A 3GTGJ 2Q1ZB 5BS6A 1IN7A 1KZHA 1FC3A 4IHVA 3ZQQA 2CRGA 4S04A 1N78A 2IW5A 4J01A 1NTCA 2ID3A 2HVSA 5K7ZA 5CQEA 3BJAA 1TWAJ 5GP9A 1FOKA 2BW3B 4AC0A 4KMFA 4S05A 4N9IA 4HQEA 1MBKA 2MBFA 1R23A 4QLCU 2HOTA 2ISZA 2GFNA 4HSTA 3NXCA 2EIMH 3C2GA 1XCBA 2ZOZA 4FTHA 3PQJA 1UI5A 4OAZA 1JKRC 1KGSA 1QZEA 3V8KA 3RQIA 4WIBA 4I0AA 3GX4X 3ECOA 1Z3YA 4K2EA 3J7AO 2QLZA 5K5RA 2E34A 4OMYA 2FBQA 2BV6A 3GLXA 3IAS2 4A3MJ 4L0YB 4YFXF 2HTJA 2KIFA 3E6BA 4H4KC 5J8CA 2F5FA 2OU2A 1I5ZA 2IJLA 2EV6A 2W85A 3KP2A 4LMYA 4A6DA 4C3IJ 3LAJA 1L3LA 5FLXK 1WSUA 2DDBA 4ESFA 1SVLA 1VF9A 2EFWA 3L09A 1R4MB 1ETOA 1RC9A 2W24A 3REOA 3RQ4A 1O3QA 3B6CA 1T2KA 1PUEE 3V8LA 4LLNA 1LDKB 3KEOA 2H1LA 1B4AA 4HDUA 1OKRA 1DQUA 5H2FC 4LLGF 4CSWA 2GM4A 1J7KA 1D5VA 1OCPA 3DEUA 3KP3A 5GTIC 3DF8A 2K85A 3U9GA 4QIWN 2QSFX 3K7AJ 3BRUA 2KDOA 3RKQA 3OYFA 4Y52J 3FXRA 2EZIA 2MH9A 3RZOJ 1V5FA 4U7BA 1LFUP 1HDPA 3H5AA 3GO5A 1OYIA 5JR3A 1Z0XA 2QGUA 2A5YB 2Z16A 2BHYA 2XAGA 2NYXA 5D18A 1W4MA 2XAFA 4EM1A 3ZMZA 4EJTA 3OYMA 3H36A 3RJPA 1LB2A 3GUDA 3S16J 1QO0D 4E7ZA 3JRHA 2PBXA 4F7ZA 2P5LC 5JHFA 3ELKA 3O3KA 2W7NA 1EF4A 2Q24A 2V1DA 2HKUA 2K9NA 4XR6A 3HSRA 2E1MC 3M07A 5E1XA 2NRAC 3RH2A 1S72I 1IC8A 5E3LA 5LLQA 1ZHFA 3WG9A 2NVYJ 1K6YA 1UAAA 2V9KA 2ELJA 1XMAA 2H8WA 4EGZA 3KZIC 5H6QA 4OIOF 4JX4A 1HLVA 1OCOH 3S1MJ 3DBHB 2EZKA 2ZXJA 4PJLA 2CH0A 5DM7F 1G4DA 1TBXA 1T33A 4BAYA 2HKOA 4A3FJ 3TGNA 2HR3A 3CCVI 2XF5A 1QGPA 2ZCWA 2LY2A 1BA5A 1WFXA 3GZNB 5D4RA 3SXYA 1K4TA 1HCRA 2KZVA 3HM5A 1ZTRA 4YG2F 2CQKA 1EV7A 4B43A 2ZMEB 2YU3A 3GZIA 3DBLB 1PP8F 2BYVE 3B73A 1D1AA 2GXGA 2P5VA 5B5EC 4E7KA 3DWLE 4NDLA 5IYDJ 1G3YA 3ZMDA 1XG1A 2RGVA 2V79A 3DKWA 3BCAA 2O0YA 1B72B 1R1VA 2GLOA 1POGA 4CZCA 3J80Z 3H9JA 2QIBA 1F5TA 5CKTA 3DEEA 1R58A 4CCOA 4I76A 1YI2I 2IGOA 1J9IA 5LRSA 3AL0C 1G2HA 3W3CA 2DMUA 3FMQA 3ISPA 3LQRA 4IRIA 2O03A 3SZTA 5LGTA 3FKJA 2P6SA 1YJ9I 4A3CJ 2MLKA 2R7RA 2WAQA 2H27A 2IP2A 3HZJA 1ZARA 2FJI1 1R22A 2F48A 2IS2A 1OLTA 4OD5A 5B66C 3GFJA 2KDZA 2BXYA 3F3XA 3RPQA 5F0CA 5HDKA 2OD5A 3AQTA 3HTAA 2JA7J 2YX7A 2ACJA 4PJMA 4Y4RA 2KL4A 2BXZA 4UXNA 4ZYDA 3NRGA 2XGXA 4RDUA 4Q4ZF 3I54A 1GDTA 2JZYA 4WXCA 1JTYA 3PNVA 4NC7A 4KYWA 2XSDC 5EYRA 2E19A 2DMQA 3AAFA 2DDAA 4RAGA 2HQAA 1T0FA 3M9AA 1WJEA 3O8GA 3CC2I 4ETSA 2G7LA 2H6CA 2O3FA 4XORA 5DD8A 4IHYA 3CUQB 3LSRA 1DU6A 3EPZA 2HVQA 2FE3A 2Y30A 1H8AC 1VQ8I 2K27A 1O3TA 1XMXA 3I59B 2EIKH 1TT0A 1ZGWA 1YO5C 4ABZA 4A69C 3GCMA 2DI3A 3S14J 1WGXA 3HSEA 1NK3P 1IXCA 2F07A 2UXOA 1OFCX 2EJRA 2QSGX 2RKHA 1UZCA 2LOOA 4XICA 3L2WA 2Z33A 4KUMA 2IS1A 2DAOA 1VQOI 2JVHA 1LPQA 2ISYA 2E71A 3MD2A 4PGHA 1K78A 2FBHA 1P9QC 4GXOA 3ZQCA 2EV0A 3ASOH 3CP2A 2PMZN 2PQ8A 3GEUA 3SQNA 5DS9A 2JT1A 4HYEA 2MYSA 3CDLA 2HYJA 2EH3A 2ZXWH 5EDNA 4UVAA 2HVRA 1O7FA 3WHCA 1WH5A 3HGYA 3FXQA 4RS8A 4A3IJ 1LE8A 1J0RA 3H5NA 2L9SA 1A36A 5CXIA 2IS6A 2I8DA 1ETQA 3LSMA 5D8LB 4XLEA 3NI7A 1ULYA 2MC4A 4L9JA 1DP3A 1Y6IA 1JJ8C 3U1DA 2HQRA 3E1SA 5E3OA 3CCEI 2EILH 3FM3A 1IAWA 3EYYA 3FHNA 1ZG3A 5EGOB 1XB4A 5J4YA 3MN2A 5FLXZ 1OCZH 2FX0A 4M6XA 4D5FA 4IOCF 3ZQLA 1J09A 2GENA 2EQRA 3I3LA 2DOEA 2CUFA 1K61A 4IOAF 2HQNA 2LY9A 1FY7A 2V57A 1VZ0A 3DP7A 5KAFC 3V7RA 2NS7A 1X3UA 3CC7I 5E1ZB 3MZYA 4Q5SF 3FX3A 1MJBA 3QYFA 2GIVA 4BE2A 2GWRA 5D4SA 1T95A 3F8NA 2OAZA 2OC6A 3G3ZA 2BY0A 3RPUA 3GZ5A 3GTQJ 2VT2A 2A6HF 2BEOA 5CW8A 2X6YA 3VIBA 4KT5C 5IT3A 4BUPA 3HOVJ 1S3JA 1MGTA 3LJLA 1S7OA 1W7PD 1T8IA 4LG0B 4GO1A 1XDSA 1BOAA 5FROA 2OCEA 4X6AJ 4II2A 1V54H 3CLOA 1OR7A 2P7VB 1GXPA 1SD6A 3E5UA 2XV4S 3MQ0A 2Y9YA 3O2PE 1VQPI 3KEQA 3FISA 3VSKA 4ON0A 4EMSA 3PNYA 2HXOA 1ZRDA 2MFZA 1NG6A 3JSOA 4XNFA 2KFDA 1I1SA 2VJJA 5FKNA 2ZJ2A 1LUJB 3T6NA 3HOUJ 1GHCA 4LD5A 2UWMA 3GEZA 3A4CA 4N4OB 4R79A 2XKOA 1S29A 4BXUA 3EDPA 2JA2A 2LBFA 2ZMEA 3MKLA 3UKGA 1JT0A 2GBYA 2EFNA 4JL3A 2Y48A 2OQGA 2CQXA 3CJQB 2VPRA 1EKEA 1BJZA 5F6FA 3U21A 3IKTA 2X6OA 3ON2A 3P5JA 1BIAA 4NC6A 1ETWA 3VVXA 3EYIA 2HDWA 5EF6A 3PASA 1WHUA 3CJNA 1D1BA 3OSGA 3CF2A 4DW6A 5GPCA 2BHZA 2JWTA 1Y39A 4G6QA 5GAGJ 1WJDA 3J7AY 1RESA 1QBJA 4HDVA 4XRFA 2CO5A 2G7UA 1DDNA 3M8FA 2DA5A 2KJCA 1YTYA 2CFXA 1QHHD 1RUNA 3HHHA 1MNDA 2NOGA 3HIMA 1MMDA 2R7SA 2UXHA 1OPCA 4UUTA 4S0HB 2NNNA 4BU2A 3PUBA 3CCSI 1I6HJ 1J5YA 1YIJI 1Y1VJ 2DTZA 1YQAA 2H94A 2X48A 3CESA 3OYKA 2VXZA 2K5CA 1U5TC 3TKYA 1FOWA 3WTTC 3PSIA 2NXNB 3ZQ7A 1ETYA 3HUGB 1MIJA 4KJZA 3R4KA 1FNNA 3DU5A 3M1CA 4QPQA 2PZ9A 4ENKA 3OS1A 3NWTA 3OYIA 1G3WA 3EETA 4Y15A 3IL2A 1Z1DA 3I9V2 4IVNA 1D8KA 2QWWA 4PGGA 5CYVA 4HNTA 2FNPA 2A6TA 2CS3A 3JREA 2VOOA 1IRXA 1IUYA 1GV5A 1LQ1A 1I39A 2LMDA 5CQGA 3PO3J 2Y2ZA 3BG6A 5E1WA 1XCVA 3P7NA 1ZELA 3WTXC 2L9RA 5E3MA 1LJ9A 4EV0A 3S5RA 2VONA 5EG0B 3ABLH 1Z6RA 1U9OA 3VYSB 5HLGA 2M0MA 3MKZA 2BVLA 3OV8A 1U9NA 5FD6A 2XDNA 5ILSA 5F27A 2H1KA 2V4JC 3FXLA 3EUAA 4P9UA 4Q47A 2L4AA 3GXOA 4KN7X 2LKXA 3V7SA 5BQTA 2OJED 1W1WE 1EA3A 4J19A 3TP0A 1E2XA 1TQPA 1W5TA 1YJNI 5FMPA 5GPAA 1W5CC 3ECHA 4G8XA 2ZCMA 2CSOA 5HNHA 3LWFA 1WQ2A 3QOPA 5AONA 1ETXA 1R1UA 2Y0SN 3VW2A 5HS8A 4XLHA 4M3GA 1UHSA 2K3PA 3IH2A 5DCMB 4KN4X 2FQ3A 3V7CA 5ED4A 1G59A 1BW5A 1IRGA 2NVUB 1G8XA 2JQ7A 1SVMA 1ZRCA 1SD7A 2JN6A 2WAQN 4XM3A 2XDVA 4F92B 1HBXG 2P81A 3NRVA 3FF5A 2DOAA 3PSFA 4OU0A 3GFLA 5D5WB 3H35A 1TNTA 5M5WJ 2PJPA 4FX4A 2VBWA 2HPIA 2R7ZJ 3KLOA 1EH6A 3OYJA 3IH3A 1SAXA 1Z7UA 4C2UA 3G56A 4I6ZA 3MNLA 4MFDA 1W36D 5D1RA 3BZCA 3ZN0A 3A01A 3F21A 2R92J 1FOXA 3HBLA 4A12A 2LREA 1MD0A 3DU6A 2DK8A 2EFQA 3BTJA 2EV5A 1AA7A 5CVIA 1B72A 4KA4A 3ABTA 4MXMA 4OIRF 3K6GA 1VQ6I 2B0LA 2OF7A 2Z99A 3LSKA 4AWXB 1YIOA 1BBYA 2G0EA 1BR2A 1IV8A 1S8NA 2FJ1A 2LRDA 2IS4A 3LSHA 1N75A 3HRTA 4E7HA 2M30A 1A31A 2QZ8A 2LKSA 2ZJRF 4BY7J 2JUCA 1LVKA 1O3RA 4NNJA 1H0MA 3ESWB 3K4BA 4F55A 2RAEA 5BMZA 1LDDA 4NUBA 3C3WA 4XKCA 4IZZA 2LLKA 1G3TA 3O6BB 1K83J 1X58A 1FSEA 1MBEA 3D5SC 2R5YB 3PQKA 1U0JA 1GVJA 3LAPA 2VBZA 5JLXA 3ULQB 4ZYHA 5FFXA 1X4PA 1XGNA 2XRNA 4M74A 2IBDA 2LBFB 3W6KB 4Y17A 2DMPA 2HQ5A 3RIRA 5F1JA 2MC3A 2YPRA 5TGTA 4RA2A 2X6WA 4UB6C 4C30A 1RRJA 3NQOA 2VB6A 3QU3A 3GTPJ 5DAJA 3ZMSA 2ZJQF 1FX7A 4F93B 3CD6I 4B47A 4BXFA 3S2DJ 2EA4A 3HOYJ 4DBQA 1EH7A 4MTEA
chains in the Genus database with same CATH topology
3HEFA 2MGQA 3SFIA 1RPWA 3JR9A 1MNMC 5J1YA 3JRFA 2YVHA 3S16J 2RASA 3PM1A 3JRHA 1XS9A 2PBXA 3ANPA 2DA3A 4B1RA 2ECBA 3NARA 2XPWA 1SGMA 3JSJA 3HDDA 5EZHA 5IYCJ 3A01B 4FISA 2CU7A 1EF4A 2HKUA 2Q24A 1A6IA 2K9NA 2UXIA 3BG3A 2ID6A 3RH2A 3A03A 1IC8A 1JJ6C 5E3LA 4D5CA 1A5JA 1P7IA 2NVYJ 4Y7NJ 1SFOJ 1F43A 4JX4A 1HLVA 3S1MJ 1CQTA 2LD5A 2EZKA 3KKDA 4JX6A 2DA6A 3VOKA 5F04A 3HOZJ 1T33A 3S1RJ 4A3FJ 2JMWA 3BR2A 3TW6A 1SANA 4UUSB 4FCYA 1BA5A 4A3DJ 2OI8A 2NX4A 1HCRA 1IV6A 2JA6J 3Q0WA 4XRSA 3HM5A 4D7MA 4GFKA 1ZTRA 3FKIJ 4JYKA 3C2BA 1IRZA 3IUVA 2LVSA 5IP7J 2NVXJ 5EFYA 4MO7A 1R9TJ 9ANTA 3GZIA 3BCGA 4L62A 5H9TA 1BL0A 1MH4A 2DMTA 5DTDA 4NDLA 1RKTA 5IYDJ 1AKHA 1XG1A 2HXIA 5K7FA 1B72B 4BY1J 2GLOA 1POGA 3O8HA 4M3FA 3HOXJ 1UI6A 2QIBA 1WI3A 3HE0A 5FGLA 4AUXA 4A93J 4I76A 5C3EJ 1H88C 3E7QA 1G2HA 2NVQJ 1AHDP 2DMUA 3RZDJ 1RETA 2JK3A 2XB5A 4A3CJ 2MSYA 4RBOA 2YVEA 2IAIA 3FIWA 3OSFA 1X2MA 3F0CA 5BNGA 3EUPA 3JRBA 4BKXA 2G7SA 2E1OA 4M6VA 5M5XJ 5K7HA 2DG8A 2X9DA 2XB0X 3HTJA 2KDZA 1B8IB 1I3QJ 5EGOA 2AO9A 5F0CA 2UXUA 1VFCA 3AQTA 3HTAA 2JA7J 2W53A 1ETKA 2B63J 3NRGA 4XIDA 4YZEA 5FKMA 4RDUA 2JA5J 3LSPA 1GDTA 1JTYA 2HDDA 2XSDC 5EYRA 2E19A 2DMQA 5IP6A 4A3BJ 2ME6A 2ZCNA 3GTKJ 3BNIA 2AHQA 4QSHA 3O8GA 1FTTA 2G7LA 1W0UA 2O9LA 4IHYA 3C07A 3LSRA 2K9QA 1DU6A 1TC3C 4IHXA 2E2HJ 1RR7A 4LOCA 3VW1A 1MBHA 2Y30A 5J3LA 1H8AC 3KNWA 1S7EA 2HOSA 1ZGWA 4V2GA 1XC5A 3QQAA 1ZQ3P 5M5YJ 2LFBA 4ABZA 1ENHA 4A69C 1PUFB 5F08A 3S14J 1WGXA 1NK3P 2G3BA 2F07A 3G1MA 1UMQA 3IV5A 4M3EA 4C2MJ 2UXOA 1OFCX 1IDZA 4DZJA 4XICA 4JP0A 3S1QJ 3G1LA 1NK2P 2XPVA 1ZR2A 5E3NA 3BHQA 3CQZJ 2QKOA 3ZQCA 3Q0VA 3GEUA 2PMZN 2H8RA 5DS9A 1QRYA 3CDLA 2HYJA 3H0GJ 2EH3A 2TRTA 5EDNA 2WV1A 3WHCA 1WH5A 1QVUA 3HGYA 2VKEA 3ZQFA 5C4XJ 3BR0A 3VVYA 5HAWA 5AQCA 3LWJA 1U8BA 4A3IJ 3GTOJ 1LE8A 2DA2A 2COBA 4GCLA 2XPUA 3G1OA 5IP9J 2D6YA 5CXIA 1ETQA 5C4YA 3OOUA 3CRJA 3HTIA 1JKOC 3NI7A 2KT0A 2XRLA 2M34A 4BBRJ 3GTMJ 2R5ZA 1JJ8C 1Z77A 5E3OA 2MW8A 3M4OJ 3QBMA 1ORKA 4MFEA 5EGOB 3MN2A 2FX0A 2M8GX 4D5FA 3ZQLA 4V2FA 3LHQA 4A3LJ 2XGDA 2GENA 2EQRA 4QTRA 4CYCB 1MSEC 2CUFA 3NPIA 3BT9A 1K61A 2LY9A 2V57A 3P9TA 2NP3A 3B6AA 1MH3A 1BW6A 2NS7A 1PUFA 2HYTA 1F36A 1IDYA 2XGCA 4W97A 3DPJA 4NELA 4DZPA 1ZR4A 5M3FJ 4UUSA 5J1UA 1MBFA 3GTQJ 4ICHA 5CW8A 3VIBA 2EBIA 2Y9ZA 3QPLA 4JX5A 3LNQA 5C4JJ 4A3KJ 4L5EA 3HOVJ 3LJLA 2DA7A 2FD5A 3O60A 1DU0A 5FKLA 4X6AJ 4XRSG 3AQSA 2QWTA 1VI0A 4W1UA 1JT6A 4DYCA 3ZQIA 1JTXA 2Y9YA 3BR1A 3BQZA 3H3VK 3FISA 3DEWA 2DJNA 3RD3A 2R93J 3DCFA 3NAUA 2HXOA 5CXGA 3I4NJ 3W6VA 2O7OA 3M3YJ 4A3GJ 5FKNA 2K9SA 4PXIA 1TWCJ 3BQYA 2QTQA 5J1RA 3T6NA 4BXXJ 3HOUJ 3QKXA 2ME0A 3Q3SA 3HOWJ 2ZOYA 3BTCA 3BTLA 3ZQHA 1WCMJ 4DYRA 2YUSA 2IEKA 5JLWA 4GFBA 3MKLA 3JRCA 3UKGA 2IU5A 4GFLA 1JT0A 2GBYA 1FTZA 1HF0A 3CJDA 3NNRA 4JL3A 2YU9J 2CQXA 3IH4A 5F0FA 2VPRA 1BJZA 2E2IJ 1UG2A 4GCTA 1OJLA 1OCTC 4B4CA 2X6OA 3ON2A 1ETWA 4B3AA 3VVXA 1FIPA 5EF6A 3PASA 2LK2A 3OSGA 4GCKA 4DW6A 5GPCA 1E3OC 4BBSJ 1IG7A 5D19A 3ANGA 2JWTA 3BG9A 2CJJA 3Q0UA 2QCOA 1JKQC 3GBGA 1QPIA 3JRDA 1RESA 3BR3A 3PO2J 3D1NI 1ETVA 3BTIA 3SJMA 1D5YA 3S15J 2DA5A 2L0KA 4UDSA 4CGRA 2ELKA 3E7LA 3SDGA 4AYBN 2NOGA 3HIMA 5FKKA 2L7ZA 2QF7A 2UXHA 2JJ7A 4UUTA 4S0HB 4XRMA 2DMNA 5C44J 2OERA 1VNDA 1I6HJ 2O7TA 2L7MP 1Y1VJ 2Y31A 5IOYA 2DTZA 3F1BA 2EZHA 4MIMA 1FEXA 4D7NA 2WB1N 2X48A 1JGGA 4IHWA 4A3JJ 5FLVA 2NP5A 3B81A 3FK6A 3ZOBA 1MSFC 1I50J 4HKUA 1Q1VA 5EZGA 4JKZA 1ETYA 2XGEA 4CYCA 3TEDA 1HDDC 2GUHA 1TWHJ 2JA8J 2DN0A 4KWAA 3CCYA 5EEAA 2PZ9A 2UXPA 1IJWC 1FJLA 3GTJJ 1GT0C 2DG7A 5FJ8J 2RHAA 2DA1A 3KKCA 3JRIA 2I10A 3BJBA 2VI6A 3CWRA 3JREA 3BR5A 3JRGA 4NN1A 1T56A 3VVZA 3WHBA 1GV5A 2EZLA 1LE8B 3PO3J 2Y2ZA 1P7JA 1APLC 1MBGA 3COLA 1WH7A 2L9RA 4FE4A 5E3MA 3S5RA 5IPAA 1GV2A 2R5ZB 5K58A 5EG0B 1X2NA 2ECCA 2REKA 1U9OA 2N8GA 1GUUA 4XK4A 1ZK8A 1IGNA 3HKZN 2NS8A 3TW7A 1U9NA 2XDNA 1JUPA 2M2EA 5F27A 2H1KA 1YRNB 2FQ4A 4DYQA 5EG0A 2LKXA 2R5YA 3FK7A 5FLMJ 4J19A 3TP0A 3VUQA 3HB9A 1JUMA 5FMPA 1RKWA 5GPAA 2VUMJ 4AF5A 4FE7A 2HI3A 2ZCMA 1AKHB 1W0TA 1H89C 1LFBA 5FKOA 3GTLJ 2MG4A 1ETXA 4M3BA 2Y0SN 3VW2A 4MLOA 3VOXA 4M3GA 1UHSA 2YS9A 3IH2A 4C3HJ 1BW5A 3LSGA 1QVTA 1JUSA 2DA4A 2L7FP 3S1NJ 3OIOA 2VKVA 2JN6A 3ZQGA 2WAQN 2G7GA 3V6GA 2QOPA 3G7RA 3VW0A 5F0HA 3CMYA 1Y1WJ 1ITYA 3GTGJ 2CUEA 2P81A 2OPTA 3I4MJ 4IHVA 5M5WJ 2TCTA 1MBJA 2CRGA 2LR8A 1NTCA 2ID3A 4X1EA 2CQQA 5K7ZA 3FRQA 1YRNA 2R7ZJ 5IOZA 3IH3A 5HBUA 3BG5A 1TWAJ 5GP9A 3G56A 3MNLA 4I6ZA 4AC0A 4EEFG 4MFDA 5D1RA 3A01A 1MBKA 3QPSA 2HOTA 2R92J 2GFNA 4AC6A 3HBLA 3NXCA 3BR6A 4ACIA 2R0QC 4IEJA 2ZOZA 3BTJA 4FTHA 1UI5A 2K40A 3S2HJ 1JKRC 3KZ9A 2LTPA 1B72A 3VP5A 4MXMA 3RQIA 3TP3A 2OF7A 3V78A 2G0EA 3ON4A 1JKPC 2FBQA 2FJ1A 4A3MJ 1O4XA 2HOAA 1TWGJ 4BY7J 3VPRA 4C3IJ 1WPKA 3HGGA 1IUFA 2RAEA 1VF9A 5M3MJ 1ETOA 4M3DA 2ZCXA 3B6CA 2LLKA 2ZB9A 1K83J 1X58A 3K2AA 1MBEA 3MVPA 3HTHA 3EGQA 2R5YB 2W48A 4ME9A 1B8IA 5JLXA 3A02A 2GM4A 3L1PA 4HNVA 1OCPA 5HODA 2NVTJ 3S17J 3LOCA 2WGBA 3PPBA 4QIWN 3K7AJ 2D5VA 3BRUA 3RKQA 1HOMA 4MK6A 4Y52J 2IBDA 4JNNA 5FHPA 2LP0A 3JRAA 2EZIA 2M9HA 3RZOJ 2DMPA 2HQ5A 5F1JA 1HDPA 1LFUP 4C3JJ 1ZKGA 3LSJA 4G12A 1GVDA 2WUIA 4A3EJ 1Z0XA 1FIAA 3GTPJ 1TWFJ 5DAJA 5HSZA 5D18A 1U78A 5IYBJ 2O8KA 2M0CA 1AU7A 3S2DJ 3HOYJ 2E2JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEF A;  2MGQ A;  3SFI A;  1RPW A;  3JR9 A;  1MNM C;  5J1Y A;  3JRF A;  2YVH A;  3S16 J;  2RAS A;  3PM1 A;  3JRH A;  1XS9 A;  2PBX A;  3ANP A;  2DA3 A;  4B1R A;  2ECB A;  3NAR A;  2XPW A;  1SGM A;  3JSJ A;  3HDD A;  5EZH A;  5IYC J;  3A01 B;  4FIS A;  2CU7 A;  1EF4 A;  2HKU A;  2Q24 A;  1A6I A;  2K9N A;  2UXI A;  3BG3 A;  2ID6 A;  3RH2 A;  3A03 A;  1IC8 A;  1JJ6 C;  5E3L A;  4D5C A;  1A5J A;  1P7I A;  2NVY J;  4Y7N J;  1SFO J;  1F43 A;  4JX4 A;  1HLV A;  3S1M J;  1CQT A;  2LD5 A;  2EZK A;  3KKD A;  4JX6 A;  2DA6 A;  3VOK A;  5F04 A;  3HOZ J;  1T33 A;  3S1R J;  4A3F J;  2JMW A;  3BR2 A;  3TW6 A;  1SAN A;  4UUS B;  4FCY A;  1BA5 A;  4A3D J;  2OI8 A;  2NX4 A;  1HCR A;  1IV6 A;  2JA6 J;  3Q0W A;  4XRS A;  3HM5 A;  4D7M A;  4GFK A;  1ZTR A;  3FKI J;  4JYK A;  3C2B A;  1IRZ A;  3IUV A;  2LVS A;  5IP7 J;  2NVX J;  5EFY A;  4MO7 A;  1R9T J;  9ANT A;  3GZI A;  3BCG A;  4L62 A;  5H9T A;  1BL0 A;  1MH4 A;  2DMT A;  5DTD A;  4NDL A;  1RKT A;  5IYD J;  1AKH A;  1XG1 A;  2HXI A;  5K7F A;  1B72 B;  4BY1 J;  2GLO A;  1POG A;  3O8H A;  4M3F A;  3HOX J;  1UI6 A;  2QIB A;  1WI3 A;  3HE0 A;  5FGL A;  4AUX A;  4A93 J;  4I76 A;  5C3E J;  1H88 C;  3E7Q A;  1G2H A;  2NVQ J;  1AHD P;  2DMU A;  3RZD J;  1RET A;  2JK3 A;  2XB5 A;  4A3C J;  2MSY A;  4RBO A;  2YVE A;  2IAI A;  3FIW A;  3OSF A;  1X2M A;  3F0C A;  5BNG A;  3EUP A;  3JRB A;  4BKX A;  2G7S A;  2E1O A;  4M6V A;  5M5X J;  5K7H A;  2DG8 A;  2X9D A;  2XB0 X;  3HTJ A;  2KDZ A;  1B8I B;  1I3Q J;  5EGO A;  2AO9 A;  5F0C A;  2UXU A;  1VFC A;  3AQT A;  3HTA A;  2JA7 J;  2W53 A;  1ETK A;  2B63 J;  3NRG A;  4XID A;  4YZE A;  5FKM A;  4RDU A;  2JA5 J;  3LSP A;  1GDT A;  1JTY A;  2HDD A;  2XSD C;  5EYR A;  2E19 A;  2DMQ A;  5IP6 A;  4A3B J;  2ME6 A;  2ZCN A;  3GTK J;  3BNI A;  2AHQ A;  4QSH A;  3O8G A;  1FTT A;  2G7L A;  1W0U A;  2O9L A;  4IHY A;  3C07 A;  3LSR A;  2K9Q A;  1DU6 A;  1TC3 C;  4IHX A;  2E2H J;  1RR7 A;  4LOC A;  3VW1 A;  1MBH A;  2Y30 A;  5J3L A;  1H8A C;  3KNW A;  1S7E A;  2HOS A;  1ZGW A;  4V2G A;  1XC5 A;  3QQA A;  1ZQ3 P;  5M5Y J;  2LFB A;  4ABZ A;  1ENH A;  4A69 C;  1PUF B;  5F08 A;  3S14 J;  1WGX A;  1NK3 P;  2G3B A;  2F07 A;  3G1M A;  1UMQ A;  3IV5 A;  4M3E A;  4C2M J;  2UXO A;  1OFC X;  1IDZ A;  4DZJ A;  4XIC A;  4JP0 A;  3S1Q J;  3G1L A;  1NK2 P;  2XPV A;  1ZR2 A;  5E3N A;  3BHQ A;  3CQZ J;  2QKO A;  3ZQC A;  3Q0V A;  3GEU A;  2PMZ N;  2H8R A;  5DS9 A;  1QRY A;  3CDL A;  2HYJ A;  3H0G J;  2EH3 A;  2TRT A;  5EDN A;  2WV1 A;  3WHC A;  1WH5 A;  1QVU A;  3HGY A;  2VKE A;  3ZQF A;  5C4X J;  3BR0 A;  3VVY A;  5HAW A;  5AQC A;  3LWJ A;  1U8B A;  4A3I J;  3GTO J;  1LE8 A;  2DA2 A;  2COB A;  4GCL A;  2XPU A;  3G1O A;  5IP9 J;  2D6Y A;  5CXI A;  1ETQ A;  5C4Y A;  3OOU A;  3CRJ A;  3HTI A;  1JKO C;  3NI7 A;  2KT0 A;  2XRL A;  2M34 A;  4BBR J;  3GTM J;  2R5Z A;  1JJ8 C;  1Z77 A;  5E3O A;  2MW8 A;  3M4O J;  3QBM A;  1ORK A;  4MFE A;  5EGO B;  3MN2 A;  2FX0 A;  2M8G X;  4D5F A;  3ZQL A;  4V2F A;  3LHQ A;  4A3L J;  2XGD A;  2GEN A;  2EQR A;  4QTR A;  4CYC B;  1MSE C;  2CUF A;  3NPI A;  3BT9 A;  1K61 A;  2LY9 A;  2V57 A;  3P9T A;  2NP3 A;  3B6A A;  1MH3 A;  1BW6 A;  2NS7 A;  1PUF A;  2HYT A;  1F36 A;  1IDY A;  2XGC A;  4W97 A;  3DPJ A;  4NEL A;  4DZP A;  1ZR4 A;  5M3F J;  4UUS A;  5J1U A;  1MBF A;  3GTQ J;  4ICH A;  5CW8 A;  3VIB A;  2EBI A;  2Y9Z A;  3QPL A;  4JX5 A;  3LNQ A;  5C4J J;  4A3K J;  4L5E A;  3HOV J;  3LJL A;  2DA7 A;  2FD5 A;  3O60 A;  1DU0 A;  5FKL A;  4X6A J;  4XRS G;  3AQS A;  2QWT A;  1VI0 A;  4W1U A;  1JT6 A;  4DYC A;  3ZQI A;  1JTX A;  2Y9Y A;  3BR1 A;  3BQZ A;  3H3V K;  3FIS A;  3DEW A;  2DJN A;  3RD3 A;  2R93 J;  3DCF A;  3NAU A;  2HXO A;  5CXG A;  3I4N J;  3W6V A;  2O7O A;  3M3Y J;  4A3G J;  5FKN A;  2K9S A;  4PXI A;  1TWC J;  3BQY A;  2QTQ A;  5J1R A;  3T6N A;  4BXX J;  3HOU J;  3QKX A;  2ME0 A;  3Q3S A;  3HOW J;  2ZOY A;  3BTC A;  3BTL A;  3ZQH A;  1WCM J;  4DYR A;  2YUS A;  2IEK A;  5JLW A;  4GFB A;  3MKL A;  3JRC A;  3UKG A;  2IU5 A;  4GFL A;  1JT0 A;  2GBY A;  1FTZ A;  1HF0 A;  3CJD A;  3NNR A;  4JL3 A;  2YU9 J;  2CQX A;  3IH4 A;  5F0F A;  2VPR A;  1BJZ A;  2E2I J;  1UG2 A;  4GCT A;  1OJL A;  1OCT C;  4B4C A;  2X6O A;  3ON2 A;  1ETW A;  4B3A A;  3VVX A;  1FIP A;  5EF6 A;  3PAS A;  2LK2 A;  3OSG A;  4GCK A;  4DW6 A;  5GPC A;  1E3O C;  4BBS J;  1IG7 A;  5D19 A;  3ANG A;  2JWT A;  3BG9 A;  2CJJ A;  3Q0U A;  2QCO A;  1JKQ C;  3GBG A;  1QPI A;  3JRD A;  1RES A;  3BR3 A;  3PO2 J;  3D1N I;  1ETV A;  3BTI A;  3SJM A;  1D5Y A;  3S15 J;  2DA5 A;  2L0K A;  4UDS A;  4CGR A;  2ELK A;  3E7L A;  3SDG A;  4AYB N;  2NOG A;  3HIM A;  5FKK A;  2L7Z A;  2QF7 A;  2UXH A;  2JJ7 A;  4UUT A;  4S0H B;  4XRM A;  2DMN A;  5C44 J;  2OER A;  1VND A;  1I6H J;  2O7T A;  2L7M P;  1Y1V J;  2Y31 A;  5IOY A;  2DTZ A;  3F1B A;  2EZH A;  4MIM A;  1FEX A;  4D7N A;  2WB1 N;  2X48 A;  1JGG A;  4IHW A;  4A3J J;  5FLV A;  2NP5 A;  3B81 A;  3FK6 A;  3ZOB A;  1MSF C;  1I50 J;  4HKU A;  1Q1V A;  5EZG A;  4JKZ A;  1ETY A;  2XGE A;  4CYC A;  3TED A;  1HDD C;  2GUH A;  1TWH J;  2JA8 J;  2DN0 A;  4KWA A;  3CCY A;  5EEA A;  2PZ9 A;  2UXP A;  1IJW C;  1FJL A;  3GTJ J;  1GT0 C;  2DG7 A;  5FJ8 J;  2RHA A;  2DA1 A;  3KKC A;  3JRI A;  2I10 A;  3BJB A;  2VI6 A;  3CWR A;  3JRE A;  3BR5 A;  3JRG A;  4NN1 A;  1T56 A;  3VVZ A;  3WHB A;  1GV5 A;  2EZL A;  1LE8 B;  3PO3 J;  2Y2Z A;  1P7J A;  1APL C;  1MBG A;  3COL A;  1WH7 A;  2L9R A;  4FE4 A;  5E3M A;  3S5R A;  5IPA A;  1GV2 A;  2R5Z B;  5K58 A;  5EG0 B;  1X2N A;  2ECC A;  2REK A;  1U9O A;  2N8G A;  1GUU A;  4XK4 A;  1ZK8 A;  1IGN A;  3HKZ N;  2NS8 A;  3TW7 A;  1U9N A;  2XDN A;  1JUP A;  2M2E A;  5F27 A;  2H1K A;  1YRN B;  2FQ4 A;  4DYQ A;  5EG0 A;  2LKX A;  2R5Y A;  3FK7 A;  5FLM J;  4J19 A;  3TP0 A;  3VUQ A;  3HB9 A;  1JUM A;  5FMP A;  1RKW A;  5GPA A;  2VUM J;  4AF5 A;  4FE7 A;  2HI3 A;  2ZCM A;  1AKH B;  1W0T A;  1H89 C;  1LFB A;  5FKO A;  3GTL J;  2MG4 A;  1ETX A;  4M3B A;  2Y0S N;  3VW2 A;  4MLO A;  3VOX A;  4M3G A;  1UHS A;  2YS9 A;  3IH2 A;  4C3H J;  1BW5 A;  3LSG A;  1QVT A;  1JUS A;  2DA4 A;  2L7F P;  3S1N J;  3OIO A;  2VKV A;  2JN6 A;  3ZQG A;  2WAQ N;  2G7G A;  3V6G A;  2QOP A;  3G7R A;  3VW0 A;  5F0H A;  3CMY A;  1Y1W J;  1ITY A;  3GTG J;  2CUE A;  2P81 A;  2OPT A;  3I4M J;  4IHV A;  5M5W J;  2TCT A;  1MBJ A;  2CRG A;  2LR8 A;  1NTC A;  2ID3 A;  4X1E A;  2CQQ A;  5K7Z A;  3FRQ A;  1YRN A;  2R7Z J;  5IOZ A;  3IH3 A;  5HBU A;  3BG5 A;  1TWA J;  5GP9 A;  3G56 A;  3MNL A;  4I6Z A;  4AC0 A;  4EEF G;  4MFD A;  5D1R A;  3A01 A;  1MBK A;  3QPS A;  2HOT A;  2R92 J;  2GFN A;  4AC6 A;  3HBL A;  3NXC A;  3BR6 A;  4ACI A;  2R0Q C;  4IEJ A;  2ZOZ A;  3BTJ A;  4FTH A;  1UI5 A;  2K40 A;  3S2H J;  1JKR C;  3KZ9 A;  2LTP A;  1B72 A;  3VP5 A;  4MXM A;  3RQI A;  3TP3 A;  2OF7 A;  3V78 A;  2G0E A;  3ON4 A;  1JKP C;  2FBQ A;  2FJ1 A;  4A3M J;  1O4X A;  2HOA A;  1TWG J;  4BY7 J;  3VPR A;  4C3I J;  1WPK A;  3HGG A;  1IUF A;  2RAE A;  1VF9 A;  5M3M J;  1ETO A;  4M3D A;  2ZCX A;  3B6C A;  2LLK A;  2ZB9 A;  1K83 J;  1X58 A;  3K2A A;  1MBE A;  3MVP A;  3HTH A;  3EGQ A;  2R5Y B;  2W48 A;  4ME9 A;  1B8I A;  5JLX A;  3A02 A;  2GM4 A;  3L1P A;  4HNV A;  1OCP A;  5HOD A;  2NVT J;  3S17 J;  3LOC A;  2WGB A;  3PPB A;  4QIW N;  3K7A J;  2D5V A;  3BRU A;  3RKQ A;  1HOM A;  4MK6 A;  4Y52 J;  2IBD A;  4JNN A;  5FHP A;  2LP0 A;  3JRA A;  2EZI A;  2M9H A;  3RZO J;  2DMP A;  2HQ5 A;  5F1J A;  1HDP A;  1LFU P;  4C3J J;  1ZKG A;  3LSJ A;  4G12 A;  1GVD A;  2WUI A;  4A3E J;  1Z0X A;  1FIA A;  3GTP J;  1TWF J;  5DAJ A;  5HSZ A;  5D18 A;  1U78 A;  5IYB J;  2O8K A;  2M0C A;  1AU7 A;  3S2D J;  3HOY J;  2E2J J; 
#chains in the Genus database with same CATH topology
 4O3M A;  1P4A A;  1R6R A;  1MNM C;  2YVH A;  1MMS A;  3NEU A;  2ZBK A;  2WA0 A;  2DA3 A;  2KZG A;  2XAJ A;  3KP7 A;  2NNY A;  3G2B A;  5E79 C;  4AM3 A;  2HZT A;  2DFF A;  3HDD A;  5EZH A;  2UXI A;  5JFR A;  1R71 A;  1W36 C;  1A6I A;  4RGS A;  5LHG A;  3BG3 A;  4DVY P;  5ICF A;  4OIN F;  5HS9 A;  3WG7 H;  1JJ6 C;  1FYK A;  2Y0S A;  4IRH A;  1XSD A;  2V1U A;  2Q0O A;  4P9F A;  2Q2E A;  4G9Y A;  5H20 A;  1F43 A;  1SEU A;  1S7A A;  2A07 F;  3OOP A;  1ACI A;  4JX6 A;  3KKD A;  1R1T A;  4FAS D;  5GTH C;  2W00 A;  3WE2 A;  5LGN A;  4BL0 B;  2KMU A;  4UUS B;  2VE8 A;  4A3D J;  2OI8 A;  2OZ6 A;  4KIF A;  1IV6 A;  1P6R A;  2OBP A;  4YRV A;  3C2B A;  3RKW A;  3IUV A;  5IP7 J;  2NVX J;  2HZD A;  4MO7 A;  9ANT A;  3VTI A;  4CDG A;  4WWC A;  4L62 A;  3ASN H;  3BPX A;  3CDH A;  4EM0 B;  2F6C A;  3S8P A;  3V42 A;  3K9T A;  1RKT A;  2RVC A;  4L9N A;  1Y8R B;  5J47 A;  5DUI A;  5K7F A;  4BY1 J;  1UI6 A;  3O8H A;  3M8E A;  2ZKZ A;  3HE0 A;  5EJC A;  1T0F C;  2VQH A;  2VLA A;  4BDZ A;  3K1M A;  3CF5 F;  1ZG1 A;  4DBR A;  4HNU A;  5C3E J;  3CCJ I;  1MW7 A;  3W2W A;  1H88 C;  3M7G A;  3QPT A;  1KU7 A;  3GZ6 A;  3HJE A;  4U9L A;  1WZ2 A;  3BPV A;  3RZD J;  1UEL B;  5HDG A;  4RLQ A;  1SFE A;  1KU3 A;  2JK3 A;  2R7X A;  4RBO A;  1XSX A;  2YVE A;  2IAI A;  2EB7 A;  3C1D A;  2JPB A;  1I27 A;  1Z3X A;  3OY9 A;  3FWE A;  4RAF A;  5BOX A;  3JRB A;  4BJT A;  2G7S A;  2XAU A;  5M5X J;  5CVV A;  1PDN C;  2XB0 X;  2X1C A;  3H1C A;  1B8I B;  3IAM 2;  1SD4 A;  4RM2 A;  1FWZ A;  4RB1 A;  2UXU A;  3GFM A;  1VFC A;  1NHA A;  4E7S A;  2B63 J;  2HFH A;  4BQO A;  4HEA 2;  4F3Q A;  5FKM A;  1FYM A;  2JA5 J;  3LSP A;  2K4J A;  1WVR A;  3ERM A;  3I64 A;  2X51 A;  4HPQ A;  2QA4 I;  1TT5 B;  3OYC A;  3L00 A;  3WTZ A;  2A5W A;  2EK5 A;  2AHQ A;  2VBY A;  3JW4 A;  4ENM A;  1FTT A;  1W0U A;  2TDX A;  2E5N A;  2E1N A;  2BZT A;  2PFB A;  2V7F A;  2IPQ X;  2M4G A;  3HPH A;  2E2H J;  1V3F A;  1MBH A;  4KIT B;  2K86 A;  5DM6 F;  1RUO A;  2DJI A;  1QPM A;  1S7E A;  3IUO A;  3HC7 A;  2HOS A;  1X1P A;  1ZQ3 P;  1PUF B;  2LFB A;  3OL4 A;  1BI0 A;  4II3 A;  2P0W A;  5D6E A;  2WY8 Q;  2XIG A;  3R0A A;  3G1M A;  1TQI A;  4I2O A;  1P92 A;  2VBX A;  2G3B A;  1A35 A;  4M3E A;  2X1D A;  2GXB A;  1S6L A;  1T39 A;  1IDZ A;  4JP0 A;  1OYW A;  3CO7 C;  1R5G A;  4PSX A;  2E5Z A;  3G1L A;  3WU0 A;  4ASN A;  3LA7 A;  5E3N A;  3BHQ A;  3VDX A;  2BE5 F;  1BJA A;  3G4S I;  4BDY A;  3FDY A;  3K1P A;  4L5I A;  3VYU B;  3VWB A;  1QRY A;  1FP1 D;  2TRT A;  2WV1 A;  2YX4 A;  2ZME C;  3ZQF A;  5C4X J;  1T08 B;  2VKE A;  3P9C A;  4PJ0 C;  3VVY A;  1YX3 A;  5HAW A;  4XON A;  3GTO J;  2DA2 A;  1Z05 A;  4XN0 A;  5DV5 A;  2PFV A;  1YW9 A;  4E7L A;  3OOU A;  3CRJ A;  5KAI C;  2KQR A;  4ZJZ A;  3M1E A;  5JVT A;  2KT0 A;  2XRL A;  2CW7 A;  3QP6 A;  2M7A A;  2M34 A;  4XSZ F;  2AXL A;  4KMU X;  2W1O A;  4D1Q A;  2RNJ A;  5FGM A;  2RV8 A;  1ORK A;  3BJ6 A;  3WE3 A;  3MMY B;  1LNW A;  1ON2 A;  3W2A A;  2FMY A;  3AL0 B;  1HW2 A;  5LBQ A;  3F72 A;  2M8G X;  4TV7 A;  2QEX I;  1UJ8 A;  4AID A;  3LHQ A;  3L2C A;  1WI9 A;  3BT9 A;  3FZV A;  1G3S A;  1U3E M;  2RDP A;  4G7H F;  1MH3 A;  2Z1D A;  3C7J A;  2IVM A;  2HYT A;  4O5V A;  4A6E A;  2XGC A;  3HPG A;  3FBN B;  4UV9 A;  3DPJ A;  4I98 B;  2ETH A;  1KU2 A;  1XGM A;  4BHB A;  4XLA A;  1MBF A;  1IW7 F;  3KET A;  1Z67 A;  2YR2 A;  1STZ A;  2EBI A;  3E0J B;  5DYM A;  2Y9Z A;  4JX5 A;  2CUJ A;  4EGY A;  5C4J J;  1VQ5 I;  4KDP A;  4IO9 F;  1E17 A;  3J7Z I;  2XC7 A;  3SEQ A;  5DEQ A;  2WAE A;  2M87 A;  1DU0 A;  2WBM A;  3GLL A;  2PG4 A;  2VKD A;  5FKL A;  2FSW A;  2CV2 A;  3AQS A;  1H9G A;  4ESB A;  2QWT A;  1VI0 A;  4W1U A;  2O8X A;  1SMY F;  1YOV B;  3H3Z A;  4CCM A;  2KKO A;  3CCU I;  4WF2 A;  4DYC A;  1IXR C;  2GOM A;  3MKW B;  1RI7 A;  1OR7 C;  2E7X A;  5LFA A;  3WTV C;  3DEW A;  3TOA A;  4H0E A;  1Q1H A;  3IHU A;  3DCF A;  4NQW B;  4LB5 A;  1KQ8 A;  3NAU A;  4E7I A;  5HS7 A;  2KJB A;  3I4N J;  2O7O A;  5TRD A;  4BNC A;  4YII A;  1P4X A;  2ESH A;  2K9S A;  5TJJ A;  5ILU A;  1TWC J;  3N05 A;  5D5V B;  2FF4 A;  2W84 A;  4GDF A;  3QKX A;  3Q3S A;  2AQE A;  2KIQ A;  2ZNY A;  2L9N A;  3BTC A;  2QBY A;  2GA2 A;  1PJR A;  3ABU A;  1WCM J;  3QOE A;  2YUS A;  2IEK A;  4HOB A;  4KFC A;  2PJR B;  2HS5 A;  2HOE A;  3RCO A;  3JRC A;  3HOT A;  3ZR8 X;  2A3S A;  3FM5 A;  1FTZ A;  4OMZ A;  3CJD A;  2VQL A;  3GF2 A;  1OMI A;  3HHG A;  3K4N A;  4IRG A;  1QA6 A;  2FNA A;  4RB3 C;  3K4J A;  1FBU A;  2E2I J;  2E36 A;  4UHT A;  3BC8 A;  1OJL A;  4FET A;  4XLP F;  4B3A A;  2DFE A;  2LK2 A;  4GCK A;  2B9S A;  3ANG A;  2VC1 A;  2DW4 A;  2GIZ A;  1JKQ C;  1QPI A;  1KQ9 A;  2E1M B;  3GBG A;  2DPU A;  3BR3 A;  3QPH A;  4IQ4 A;  3D1N I;  3ZRG A;  3S15 J;  2OUM A;  4ANJ A;  2V9V A;  4CGR A;  4Z6Y A;  3E7L A;  4HBL A;  1MMG A;  3SDG A;  4AYB N;  2F4I A;  1F9N A;  1HKS A;  2QF7 A;  2JJ7 A;  2X6X A;  4XRM A;  3WU1 B;  3PL8 A;  3Q9V A;  2OER A;  4LK0 F;  2L5Q A;  1X3Z B;  2HU9 A;  1FEX A;  4Z2Y A;  1V55 H;  4OAY A;  1MDM B;  1T98 A;  3HG9 A;  2NP5 A;  1JGG A;  4A3J J;  5FLV A;  2IRF G;  2R7V A;  2LH9 A;  1MSF C;  1I50 J;  3SZG A;  1W7P B;  2ADU A;  4UNO A;  5JHU A;  1I3A A;  1QZY A;  2JA8 J;  2DN0 A;  2W4S A;  1HST A;  1R00 A;  1FBQ A;  1U5T B;  2V1X A;  3CJT B;  2QEN A;  3VFZ A;  2UXP A;  1IJW C;  3LA3 A;  1FJL A;  1GT0 C;  4CO8 A;  4U0V A;  2DG7 A;  3KE2 A;  2JVG A;  4RMN A;  4HAM A;  3M8J A;  4U0W A;  2DQR A;  2RC4 A;  3VEP A;  4P5O A;  4C9Y A;  2RHA A;  3IWF A;  2DA1 A;  3KKC A;  3BJB A;  2VI6 A;  3R6S A;  4G7O F;  1T56 A;  3WHB A;  1GXQ A;  2FEZ A;  4B3X A;  2EZL A;  3PIO F;  4IJA A;  3A0B C;  2GA1 A;  5ERI A;  2MH2 A;  2CGP A;  1MBG A;  4B48 A;  3L2R A;  3QYB A;  3HOS A;  4HV5 A;  4N0B A;  2VN2 A;  1GV2 A;  2R5Z B;  5K58 A;  1X2N A;  2ECC A;  1J59 A;  3BJO A;  3FMS A;  3ZMU A;  2AQF A;  1GUU A;  2K9L A;  2WC2 A;  2PI0 A;  4UUV A;  2XAS A;  1IGN A;  1N25 A;  3OYG A;  3SYT A;  3DKY A;  1JUP A;  2M2E A;  2UXN A;  4IRV A;  1FP2 A;  4DYQ A;  4RB2 C;  1W7P A;  3BLY A;  1LVA A;  2R5Y A;  2FXA A;  2XAH A;  2HWV A;  3RPU D;  1W0T A;  1XGS A;  1H89 C;  3L2U A;  2B7E A;  3IP4 B;  2ZC2 A;  3G6E I;  3GWZ A;  3LMM A;  1D0Y A;  3VOX A;  4M73 A;  1B1B A;  4HQM A;  4C3H J;  3LSG A;  2GXA A;  1QVT A;  3KCC A;  2DA4 A;  1R5I D;  2D1V A;  4BHC A;  4C2M A;  2L7F P;  1R4N B;  5ILV A;  3OIO A;  3E5X A;  1SFU A;  3ZQG A;  2QOP A;  3VW0 A;  1Y1W J;  3CMY A;  4YEJ A;  5TIS C;  1UFM A;  3GYH X;  2OPT A;  4N4N B;  4MGR A;  2LR8 A;  2QUF A;  3LL7 A;  4I02 A;  4PK4 A;  3FRQ A;  5IOZ A;  3ZP5 A;  2HPM A;  3BG5 A;  3A0H C;  2K4B A;  3T0Y A;  4M72 A;  4EEF G;  2O61 A;  1KYZ A;  2X4H A;  2R7O A;  4RAZ A;  4IEJ A;  3F9K A;  4HSR A;  3ZN1 A;  1VTN C;  2K40 A;  4YFN F;  3KZ9 A;  4LGW A;  3OYB A;  1ODD A;  3TP3 A;  4BQN A;  3OIQ A;  3ON4 A;  1JKP C;  4D0P A;  5HDN A;  1O4X A;  2LYC A;  3CUQ C;  1T6S A;  4UVC A;  2HOA A;  1TWG J;  3PUF A;  3VPR A;  2OCC H;  3HGG A;  1WPK A;  2UUZ A;  2XVC A;  3FXU A;  4JOM A;  5HOO A;  1H9T A;  4P96 A;  4GCV A;  2OTL I;  2FA5 A;  2ZB9 A;  2FUG 2;  3HTH A;  3F8C A;  4CH7 A;  3HTS B;  3EGQ A;  3C18 A;  2VOD A;  1B8I A;  2L54 A;  1DGW Y;  3L1P A;  2V6E A;  4RB0 A;  3ZMT A;  4QWQ A;  4U88 A;  2CV1 A;  3VB2 A;  4G6T B;  4MK6 A;  2D5V A;  2ZSH B;  1HOM A;  3OWT A;  4JNN A;  2WAD A;  3S3N A;  1IXS B;  5FHP A;  1YX5 A;  3L2Q A;  1KU9 A;  4CA0 A;  2UZK A;  2CMP A;  2KRC A;  2PBI A;  4RLF A;  4V19 K;  4C3J J;  3LSJ A;  3KPH A;  2Y0M A;  4A3E J;  1TWF J;  5HSZ A;  2V6C A;  1U78 A;  3U1K A;  5F64 A;  5IYB J;  2O8K A;  3FXO A;  2YVX A;  2M0C A;  1I6X A;  1TP4 A;  1YG2 A;  2E2J J;  3HEF A;  3WU2 C;  2MGQ A;  1RPW A;  5J1Y A;  2RAS A;  3DLA A;  2CFO A;  1O3S A;  1OCC H;  3ANP A;  4BH9 A;  4B1R A;  1XGO A;  2ECB A;  3RYR A;  4MQ9 F;  1R5H A;  4U7D A;  3OYH A;  2W25 A;  1SGM A;  2Z5U A;  5IYC J;  4FIS A;  4ZH4 F;  3A01 B;  4HLY A;  2ID6 A;  2P4W A;  4HZF A;  3A03 A;  2F4O B;  4PZJ A;  1P7I A;  4HV6 A;  5GAD J;  5B1A H;  3P9K A;  3CMA I;  2LD5 A;  5HVQ C;  5E20 A;  5F04 A;  3HOZ J;  3TDU C;  2VKH A;  4G94 A;  2R7F A;  3QP5 A;  3BR2 A;  2DK5 A;  1SAN A;  1TTY A;  1L0O C;  4DGW B;  3IRQ A;  1ON1 A;  3Q0W A;  4XRS A;  1Z9C A;  1PVE A;  4JYK A;  4KIB A;  1IRZ A;  2LVS A;  1F4K A;  3OMY A;  4KT6 A;  5H9T A;  2H6B A;  2X0L A;  1QQI A;  3I56 I;  4M9Z A;  1J2X A;  5LHH A;  3PNT A;  4B8X A;  5A2Q Z;  4E6K G;  2RQP A;  2HXI A;  2LY1 A;  3HOX J;  1OYY A;  1YLF A;  1WI3 A;  2L4M A;  3R0J A;  4PDK A;  4AUX A;  4ESJ A;  1V5E A;  1P2F A;  2QM3 A;  3BDD A;  4KIC A;  1DUX C;  3S3M A;  1W5S A;  4L9T A;  4XLN F;  1RET A;  3RYP A;  2JPC A;  5KK1 A;  2OA4 A;  2QBY B;  2XB5 A;  2MSY A;  1IN8 A;  4U87 A;  5B1B H;  2JTV A;  3OSF A;  4L18 B;  4PFP A;  1X2M A;  4A0Z A;  2Q2E B;  4KIS A;  3KX2 A;  3EUP A;  4HF2 A;  2E1O A;  4CCL A;  4DJA A;  1X1D A;  5LHI A;  4L5J A;  3HUG A;  2AO9 A;  2GQQ A;  3TL4 X;  3FXM A;  3HTU A;  4LIU A;  4IKF A;  2XF7 A;  3VOD A;  1QU3 A;  4I0B A;  3ML6 A;  5LEK A;  3QOD A;  1K79 A;  4XID A;  2B1E A;  1MMN A;  3F8F A;  1SMT A;  3OS2 A;  4B09 A;  4AYB A;  1TZL A;  3ROU A;  3AFH A;  3F22 A;  3MEX A;  1TNS A;  5IP6 A;  4U0Y A;  2ME6 A;  1KYW A;  3GTK J;  1K4S A;  3BNI A;  4J00 A;  3FXK A;  2L2O A;  4NB5 A;  2O9L A;  1VQ4 I;  5LGU A;  2P5K A;  5FD5 A;  2K9Q A;  3OYD A;  3Q9S A;  5J40 A;  1TC3 C;  3FXJ A;  1RR7 A;  4LOC A;  3VW1 A;  2WTE A;  3H9Q A;  5J3L A;  4DOZ A;  4NC8 A;  2EA2 A;  2CUZ A;  1DP7 P;  3KNW A;  3K8P C;  4L9V A;  4V2G A;  1XC5 A;  5M5Y J;  1ENH A;  3SEZ A;  1WWX A;  4CHU A;  2YSR A;  3DV8 A;  1UMQ A;  3HKZ A;  2DYS H;  2Z9O A;  4C2T A;  3IV5 A;  2BW3 A;  4BEH A;  1E0E A;  1OIS A;  3AG1 H;  2OQR A;  4F52 A;  1PYV A;  1E3H A;  1JHH A;  1LEB A;  2XPV A;  1E3P A;  3CQZ J;  3Q0V A;  4XMY A;  5J8F A;  2M4K A;  3A1Y A;  3I71 A;  2X85 A;  3UR3 C;  4PCQ A;  3CUO A;  2DU9 A;  3JAM Z;  4ZYG A;  3H0G J;  2RRE A;  4BE0 A;  2HDC A;  2PJR A;  2FBK A;  3LWJ A;  5AQC A;  3DXJ F;  3T5X A;  3S32 A;  1U8B A;  2COB A;  2D6Y A;  1CGP A;  1C0W A;  5C4Y A;  3HTI A;  1TQM A;  3D0S A;  1JKO C;  1YS6 A;  3CZ6 A;  2CG4 A;  4D9J A;  4DIQ A;  3AG4 H;  4BBR J;  4I09 A;  2R7T A;  4OD4 A;  5ICG A;  3J81 Z;  1G6N A;  3M4O J;  2DCE A;  1MDM A;  4XN3 A;  3N4M A;  3ONQ A;  3E5Q A;  1R7J A;  1D0Z A;  4V2F A;  4IF4 A;  5L3D A;  3DLL F;  2VJI A;  4IHT A;  3I0T A;  4BEH B;  2KIU A;  3F23 A;  2BVM A;  3P9T A;  4CIC A;  3RSN A;  3MKY B;  1BW6 A;  1PUF A;  2BOL A;  2ZSI B;  1D1C A;  1JHF A;  1IDY A;  4NEL A;  1WJ5 A;  3B02 A;  5J1U A;  2VJ4 A;  2FU4 A;  3ZGK A;  2IA2 A;  5E17 F;  4CYD A;  5FB2 A;  3Q5F A;  2F5D A;  4MEY F;  4CXF A;  2DFI A;  4CCN A;  5B3S H;  2JRM A;  4GRI A;  2BY2 A;  4L5E A;  2Q8K A;  3WGH A;  4LB6 B;  1DGR M;  1HW5 A;  1YW8 A;  5HLI A;  3KFW X;  1NG7 A;  3HXL A;  3TO6 A;  4XRS G;  3CCM I;  1Y8Q B;  3I53 A;  3WGG A;  1JI8 A;  1JT6 A;  3I5U A;  4ZDP A;  3OS0 A;  2ZY9 A;  3ZQI A;  1IRF A;  4HLX A;  1VQ9 I;  2G7H A;  3BQZ A;  3BR1 A;  1KON A;  3MZH A;  2J5O A;  3BOQ A;  1T38 A;  5AIQ A;  5HNF A;  4XBF A;  1ZGJ A;  1WJB A;  4E70 A;  3JAM K;  1HSJ A;  4PXI A;  2K7L A;  2PN6 A;  1ZLJ A;  3BQY A;  3DTK A;  4FX0 A;  4HG2 A;  5J1R A;  4BXX J;  2ME0 A;  2R4G A;  4AVZ A;  3HOW J;  1ZYR F;  4UV8 A;  4XLF A;  2EIJ H;  1GLN A;  2HKX A;  2UV1 A;  4EM2 A;  3ZQH A;  4ITV A;  4DYR A;  3R60 A;  1UHM A;  3HIF A;  3OIP A;  1QHG A;  2F5C A;  3OR1 C;  2HEO A;  4GFB A;  2IU5 A;  1QNT A;  2YU9 J;  1EH8 A;  2V26 A;  4GGG A;  1FSH A;  4RAY A;  4BAC A;  2KRH A;  1UG2 A;  5HLH A;  4GCT A;  1OCT C;  2D1H A;  1WJA A;  2IGN A;  3CME I;  1USS A;  2M3A A;  3VSL A;  1FIP A;  5J4V A;  5CJ9 A;  4YIF A;  3DQV C;  1E3O C;  5H6R A;  2ZFU A;  1QZZ A;  2QVO A;  3Q0U A;  1YW7 A;  3JRD A;  1YJW I;  4OIP F;  2J5P A;  3PO2 J;  1FLI A;  4HF0 A;  3BTI A;  2L02 A;  5E8I A;  4E4H A;  5E8G A;  2LF7 A;  3EUH C;  3LST A;  5FKK A;  2RNG A;  3DPL C;  3KIO A;  4WXD A;  2DMN A;  2HNH A;  3U2R A;  5C44 J;  1V4R A;  2O7T A;  2Y31 A;  2FML A;  1U6G A;  2KRF A;  5IOY A;  1Z6T A;  3F1B A;  4HRI A;  4MIM A;  3KYL A;  4D7N A;  2WB1 N;  4IHW A;  1U2W A;  2DQL A;  3ZOB A;  5ICC A;  2XGE A;  4CYC A;  1HDD C;  2FOW A;  2XAQ A;  1SFX A;  2GUH A;  2QQ8 A;  1A6Q A;  1ZN2 A;  4HX7 A;  3GW2 A;  1BR1 A;  2BGC A;  1XTA A;  4GYI A;  4KWA A;  2L3D A;  4CCK A;  2XF6 A;  5EEA A;  5IY5 H;  3KYD B;  3V8J A;  3TOB A;  2G9W A;  1LKX A;  4EJV A;  3BWG A;  5FRN A;  4IQJ A;  4UY8 I;  2QQB A;  5FJ8 J;  3JRI A;  3CWR A;  3BR5 A;  3BZ6 A;  3QWL A;  2Y69 H;  1ONV A;  3JRG A;  3VVZ A;  2PX9 A;  4JBA A;  4BGD A;  2P8T A;  4LG3 A;  1LE8 B;  2VOP A;  2DOD A;  4XOT A;  2XRO A;  3BG7 A;  3CUQ A;  2AXT C;  1APL C;  1WH7 A;  2ICW G;  1XDU A;  4FE4 A;  4NQW A;  3PJR A;  1MJA A;  2OV7 A;  4FHT A;  5CVU A;  2R3S A;  5IPA A;  2REK A;  2A69 F;  5GAH J;  4XK4 A;  2CYY A;  3QAH A;  3KZY A;  4XL9 A;  2D45 A;  3JSP A;  1FZP B;  1YRN B;  3H5R A;  5EG0 A;  3K1N A;  2QSH X;  1LDJ A;  3FK7 A;  2M45 A;  4PUS A;  2STT A;  5FO5 A;  3HB9 A;  2ZXI A;  2BY1 A;  5CPR B;  1RKW A;  1FBS A;  1U8R A;  4XQF A;  2VUM J;  2JSP A;  3AG2 H;  4AF5 A;  4FE7 A;  1Y0U A;  2HI3 A;  3HRS A;  6PAX A;  1D3Y A;  2LKP A;  2DO7 A;  3JTH A;  4A0Y A;  4ZDO A;  1LFB A;  3DTI A;  2DLL A;  5FKO A;  3GTL J;  1ZH5 A;  2MG4 A;  4M3B A;  2KHM A;  4ZZL A;  2YS9 A;  2KIS A;  2OZU A;  1CF7 A;  3OL3 A;  1JUS A;  3TDZ C;  4MQV A;  3BRO A;  3S1N J;  2VKV A;  2HTS A;  1YS7 A;  3CTA A;  4XKV A;  4BQQ A;  2WY7 Q;  2G7G A;  3G7R A;  3K70 C;  5F0H A;  3E6M A;  3CO6 C;  2CUE A;  3KP5 A;  2RQQ A;  1ZG5 A;  2P6T A;  3I4M J;  3CCQ I;  3KP6 A;  2TCT A;  1MBJ A;  1UHW A;  1U5T A;  4X1E A;  2CQQ A;  4BYY A;  1SFK A;  1YRN A;  4RGR A;  4P55 A;  2WV0 A;  5HBU A;  4IXA A;  3J7Y J;  5LEJ A;  3WGI A;  3A2K A;  1HKT A;  3TMO A;  1ZLK A;  1V5G A;  1XN7 A;  4HX8 A;  3QPS A;  3S3O A;  2LC2 A;  4AC6 A;  3G73 A;  3ZPL A;  3BR6 A;  4ACI A;  2XSJ C;  2A05 A;  2R0Q C;  3PIP F;  1IF1 A;  1R49 A;  4YFK F;  2VE9 A;  1YHQ I;  3S2H J;  4U9N A;  2LTP A;  1TL8 A;  3VP5 A;  3ZXS A;  3QRF F;  4FT8 A;  1YFH A;  3V78 A;  1YYV A;  5LRR A;  4Y13 A;  2JUG A;  3QYE A;  1CF7 B;  1A04 A;  4EVI A;  2LF8 A;  5L3B A;  3H9G A;  4LK1 F;  1FPQ A;  4CZZ A;  2ZXH A;  4F91 B;  2BY3 A;  1HC8 A;  3MCZ A;  2V1N A;  1WJF A;  3EQL F;  3C2H A;  1UB9 A;  4MTD A;  1Y56 A;  5AIP A;  2WB1 A;  1IUF A;  3LQQ A;  3K4L A;  1HA8 A;  4LFU A;  5M3M J;  4M3D A;  2IXS A;  2ZCX A;  2CV0 A;  2IGM A;  5K1Y A;  1S9H A;  3K2A A;  2M5W A;  3MVP A;  4I7H A;  2F2E A;  3I4P A;  3CCR I;  1RIO H;  2ELH A;  2W48 A;  5KCM A;  4ME9 A;  2KP6 A;  3A02 A;  3KEY A;  5FFZ A;  3RDI A;  3J80 K;  4BQA A;  4I99 C;  4HNV A;  2FRH A;  5HOD A;  2NVT J;  1PP7 U;  3LOC A;  3S17 J;  3K2Z A;  1AOY A;  4ZYE A;  5A2Q K;  2WGB A;  3PPB A;  2LG4 A;  1FMV A;  1K7A A;  2W57 A;  5D6F A;  1XPX A;  2EFP A;  2LP0 A;  2COM A;  3ABK H;  3JRA A;  1K6O A;  1J75 A;  4I01 A;  2M9H A;  3K69 A;  1ZKG A;  1GVD A;  4G12 A;  2GZW A;  2EIN H;  2WUI A;  3MWM A;  1FIA A;  5DCF A;  4EJW A;  3PFI A;  4EQQ A;  1WKM A;  3UNG C;  4CCJ A;  4XKB A;  3E3V A;  1AU7 A;  5L3F A;  1RZ4 A;  3CJR B;  2ZJP F;  3SFI A;  3WTS C;  3JR9 A;  2IT0 A;  3JRF A;  3OR2 C;  3PFY A;  2EPF A;  3PM1 A;  3WOD F;  1HXD A;  1XS9 A;  4BJ5 C;  1B9N A;  2OTJ I;  1SD5 A;  3SHF A;  3NAR A;  4JQF A;  2Z3Y A;  1XSV A;  2XPW A;  2DPD A;  3JSJ A;  4HA8 A;  3AKZ A;  2CU7 A;  1I1G A;  2DOF A;  2ZFW A;  5CVJ A;  2XKP A;  4BJ6 C;  2B3W A;  2QQA A;  1A5J A;  4D5C A;  3TO7 A;  4Y7N J;  2CQN A;  2JRT A;  4IPA A;  3J81 K;  1SFO J;  3CDI A;  4CGZ A;  2QKM B;  1TW3 A;  1CQT A;  3VOK A;  2DA6 A;  4XSX F;  2O5R A;  2QQ9 A;  1BI3 A;  3G71 I;  3S1R J;  3GME A;  2JMW A;  3TW6 A;  5HLT A;  3W6J B;  5K5O A;  2M1B A;  4FCY A;  1X3W B;  2W82 A;  3F6V A;  2NX4 A;  3K10 A;  2JA6 J;  3TBI A;  1X4O A;  4D7M A;  3F8B A;  4GFK A;  3FKI J;  3K4C A;  3BCB A;  1B6A A;  3LFU A;  5EFY A;  2EFO A;  1R9T J;  3BCG A;  1X1B A;  2WAF A;  3H92 A;  1BL0 A;  3DTE A;  3S93 A;  1MH4 A;  2DMT A;  5DTD A;  4B44 A;  3BZK A;  1AKH A;  1YE9 A;  2E60 A;  3DKX A;  3ABM H;  2XHK A;  3K0L A;  4AIH A;  3D5L A;  1XMK A;  1UG0 A;  2QYO A;  5L3E A;  2F5E A;  4M3F A;  3CMM A;  3CLQ A;  4WK8 F;  1O7L A;  5FGL A;  3E6D A;  2A6E F;  2GAU A;  4LIV A;  2VIX A;  3HSF A;  5CVR A;  1HQC A;  4A93 J;  3WTW C;  3SFZ A;  1OQY A;  2L9V A;  3CC4 I;  1FOY A;  4AVP A;  2NVQ J;  3E7Q A;  4ZZD A;  1AHD P;  4NBQ A;  2GOX B;  4NHJ A;  1HW1 A;  4HX4 A;  1P4W A;  2ZNZ A;  2ESN A;  4O6J A;  1FYL A;  4WX9 A;  4KNY A;  1Y0N A;  3HRU A;  4LJZ F;  2IGK A;  1ZGA A;  3FIW A;  3RI4 A;  3GVA A;  3IKV A;  1MZB A;  3F0C A;  5JI6 A;  4BHP A;  3KZZ A;  5BNG A;  2M8E A;  5KHD A;  4BKX A;  3HTJ A;  4M6V A;  1X1A A;  5K7H A;  2DG8 A;  2X9D A;  2M7B A;  1I3Q J;  5EGO A;  2A2F X;  2CW0 F;  3HRM A;  4M9X A;  1IO2 A;  3LSI A;  2D2W A;  4XKW A;  5BPD A;  3DPT A;  4FQG A;  2W53 A;  1ETK A;  2FOK A;  4XLC A;  2DFH A;  3E97 A;  2EWN A;  2KLO A;  4ZTF A;  1IN4 A;  4YZE A;  2K9M A;  2CQ7 A;  2PMZ A;  2VAS A;  3E6C C;  2L01 A;  2HDD A;  3BP8 A;  5J6X A;  4A3B J;  4LG0 A;  4N9H A;  4EAT A;  2ZCN A;  4DQ2 A;  1JGS A;  4EJU A;  4IL6 C;  4QSH A;  3CCL I;  4R1H A;  1OCR H;  4OWR B;  3C07 A;  3LFK A;  3ERE D;  4AIJ A;  4IHX A;  3T8T A;  2KPM A;  2LSO A;  1WJC A;  5GAE J;  2F4M B;  4UB8 C;  4A5N A;  3N97 A;  4EJO A;  1ZRE A;  2F5V A;  3QQA A;  4OIQ F;  3DPU A;  5F08 A;  2PMU A;  5DCM A;  2BBY A;  3JTG A;  3CP8 A;  1ZRF A;  2K3F A;  4C2M J;  1SC7 A;  4PJN A;  2X1E A;  4DZJ A;  2DT5 A;  3HL2 A;  3S1Q J;  5DUK A;  2FBI A;  1NK2 P;  1MKM A;  1SVO A;  1ZR2 A;  2RN7 A;  2DT7 B;  2QKO A;  2UXX A;  4M71 A;  2H8R A;  3DFG A;  2ZO4 A;  1KA8 A;  1VQL I;  4ZYA A;  2VPL A;  1BI2 A;  1TLH B;  1QVU A;  4RM3 A;  2LDU A;  3BR0 A;  3ZCO A;  4A0X A;  4GCL A;  2XPU A;  3G1O A;  5IP9 J;  3FHZ A;  1JE8 A;  3MAJ A;  3K4M A;  1VQN I;  1Z7L A;  2I5U A;  3SZP A;  2MLG A;  1UST A;  2MA3 A;  1MMA A;  1B9M A;  1D0X A;  3GTM J;  4R8H A;  2R5Z A;  1Z91 A;  1Z77 A;  4M6Y A;  2MW8 A;  2WWY A;  3DBR B;  3QBM A;  4MFE A;  4WCG A;  2HGC A;  3OYE A;  3S2W A;  2E1C A;  2H09 A;  5EEG A;  5KVR A;  4A3L J;  2XGD A;  4KIG A;  3D5R C;  4QTR A;  4CYC B;  1MSE C;  3NPI A;  4A5M A;  1TW2 A;  3L9F A;  2DBB A;  2NP3 A;  1R36 A;  1KQ0 A;  3B6A A;  1XX5 A;  1F36 A;  1UCR A;  1RR8 C;  4W97 A;  4ZTJ A;  3X2Q H;  2KIM A;  4BE1 A;  2O6G E;  4DZP A;  5KNL A;  3OYA A;  1ZR4 A;  5M3F J;  4UUS A;  1D8J A;  4ICH A;  1BOB A;  1O57 A;  5DDG A;  5IT9 K;  3QPL A;  4Y33 A;  3GFI A;  2MD0 A;  3LNQ A;  4A3K J;  4Y3O A;  4LLL A;  2HYF A;  2A68 F;  2DA7 A;  2FD5 A;  3IWZ A;  1JXS A;  3O60 A;  3SDB A;  3I59 A;  4ZDL A;  3V4G A;  2K02 A;  2PMH A;  1YIT I;  1HKQ A;  2C6Y A;  3LA2 A;  5FRM A;  3MFK A;  3OYL A;  1JTX A;  2VT3 A;  4CUG A;  3IRR A;  3H3V K;  1B59 A;  3RD3 A;  2DJN A;  2R93 J;  4YEL A;  3VYT B;  5L3G A;  5K5Q A;  1WRJ A;  5CXG A;  1N77 A;  3W6V A;  3RKX A;  3M3Y J;  4A3G J;  2VQG A;  3NS4 A;  2L7K A;  3QU6 A;  3COA C;  2CW8 A;  2QTQ A;  4WXH A;  2PLY A;  2NAZ A;  1NH3 A;  4GYG A;  5F1R A;  2ZOY A;  1REP C;  2VL8 A;  4MEX F;  2HYG D;  3BTL A;  1BR4 A;  5D5U B;  4XOP A;  2CWE A;  2IA0 A;  2PEX A;  1IN5 A;  5DD4 A;  2AS5 F;  3L7W A;  5JLW A;  4GFL A;  4PFO A;  3T8R A;  2P7C B;  2XUB A;  5LD2 C;  3NNR A;  1HF0 A;  5D8K B;  2E7W A;  2JSC A;  3IH4 A;  4PSW A;  5F0F A;  3ZMV A;  1XD7 A;  3VOE A;  5L3C A;  1FT9 A;  3VYR B;  4B4C A;  1K78 B;  4MHG A;  2DXI A;  4G7Z F;  4BBS J;  1IN6 A;  1IG7 A;  5D19 A;  2R7Q A;  5EEH A;  1S5L C;  3BG9 A;  2CJJ A;  2QCO A;  5BPI A;  4IHS A;  2VC0 A;  1ETV A;  1D5Y A;  3SJM A;  2L0K A;  4UDS A;  2ELK A;  3EUK L;  5ICE A;  3R61 A;  3SWH A;  2L7Z A;  3JCU C;  1AWC A;  5IT9 Z;  1VND A;  3EUH A;  2L7M P;  3WTU C;  3FBI B;  2EZH A;  4ZC3 A;  2LNB A;  1BI1 A;  4L0Z B;  3B81 A;  1DPR A;  3OYN A;  4Q48 A;  2DTR A;  2VXD A;  3FK6 A;  3HYI A;  1BN5 A;  4HKU A;  3K4K A;  1Q1V A;  2IA1 A;  5EZG A;  2STW A;  4JKZ A;  3TED A;  4LIT A;  1VQ7 I;  4OOI A;  1TWH J;  4RGU A;  2E35 A;  4G6D A;  4QPO A;  2R7U A;  3CCY A;  2R7W A;  1BC7 C;  1F1Z A;  3GTJ J;  3W2V A;  4AU7 A;  4P1W A;  4M9S A;  2I10 A;  5E18 F;  3WTY C;  2MD5 A;  3TQN A;  1EJ9 A;  4NN1 A;  4PJJ A;  2R7D A;  1MNE A;  1VQM I;  5D5X B;  2A61 A;  2VJ5 A;  3H3U A;  3BY6 A;  1DPU A;  1ZAO A;  1P7J A;  1X1C A;  4HW0 A;  1ERD A;  3COL A;  1M1E B;  3I58 A;  4AD9 A;  4AIK A;  5CLS A;  4MNU A;  3AG3 H;  1LFP A;  2N8G A;  1LEA A;  1SAU A;  4YIR X;  1IZ1 A;  1ZK8 A;  3RKY A;  1Z21 A;  3KYC B;  2NS8 A;  3FMR A;  3HKZ N;  3TW7 A;  1MJ9 A;  4A2U A;  3MZ8 A;  2FQ4 A;  4UVB A;  5FLM J;  2DT6 A;  1VQK I;  3VUQ A;  2Z2S B;  1JUM A;  4HF1 A;  3KLN A;  3I55 I;  4X0G A;  3T1B A;  2V9P A;  4E7J A;  4JK1 X;  1BC8 C;  1AKH B;  3K70 D;  2VQC A;  3IC7 A;  4ENN A;  3RTR A;  3F8M A;  1BIB A;  3NWS A;  4DNC A;  2Y75 A;  2DYR H;  3P9I A;  4MLO A;  1BM9 A;  4ENJ A;  2QKL B;  1X19 A;  1RNL A;  4RGX A;  3L2V A;  3H0D A;  3KP4 A;  2NS0 A;  4IX7 A;  3TO9 A;  3V6G A;  1FMW A;  5JVG F;  2NOJ B;  3F6O A;  1ITY A;  2MAB A;  4BS9 A;  3GTG J;  2Q1Z B;  5BS6 A;  1IN7 A;  1KZH A;  1FC3 A;  4IHV A;  3ZQQ A;  2CRG A;  4S04 A;  1N78 A;  2IW5 A;  4J01 A;  1NTC A;  2ID3 A;  2HVS A;  5K7Z A;  5CQE A;  3BJA A;  1TWA J;  5GP9 A;  1FOK A;  2BW3 B;  4AC0 A;  4KMF A;  4S05 A;  4N9I A;  4HQE A;  1MBK A;  2MBF A;  1R23 A;  4QLC U;  2HOT A;  2ISZ A;  2GFN A;  4HST A;  3NXC A;  2EIM H;  3C2G A;  1XCB A;  2ZOZ A;  4FTH A;  3PQJ A;  1UI5 A;  4OAZ A;  1JKR C;  1KGS A;  1QZE A;  3V8K A;  3RQI A;  4WIB A;  4I0A A;  3GX4 X;  3ECO A;  1Z3Y A;  4K2E A;  3J7A O;  2QLZ A;  5K5R A;  2E34 A;  4OMY A;  2FBQ A;  2BV6 A;  3GLX A;  3IAS 2;  4A3M J;  4L0Y B;  4YFX F;  2HTJ A;  2KIF A;  3E6B A;  4H4K C;  5J8C A;  2F5F A;  2OU2 A;  1I5Z A;  2IJL A;  2EV6 A;  2W85 A;  3KP2 A;  4LMY A;  4A6D A;  4C3I J;  3LAJ A;  1L3L A;  5FLX K;  1WSU A;  2DDB A;  4ESF A;  1SVL A;  1VF9 A;  2EFW A;  3L09 A;  1R4M B;  1ETO A;  1RC9 A;  2W24 A;  3REO A;  3RQ4 A;  1O3Q A;  3B6C A;  1T2K A;  1PUE E;  3V8L A;  4LLN A;  1LDK B;  3KEO A;  2H1L A;  1B4A A;  4HDU A;  1OKR A;  1DQU A;  5H2F C;  4LLG F;  4CSW A;  2GM4 A;  1J7K A;  1D5V A;  1OCP A;  3DEU A;  3KP3 A;  5GTI C;  3DF8 A;  2K85 A;  3U9G A;  4QIW N;  2QSF X;  3K7A J;  3BRU A;  2KDO A;  3RKQ A;  3OYF A;  4Y52 J;  3FXR A;  2EZI A;  2MH9 A;  3RZO J;  1V5F A;  4U7B A;  1LFU P;  1HDP A;  3H5A A;  3GO5 A;  1OYI A;  5JR3 A;  1Z0X A;  2QGU A;  2A5Y B;  2Z16 A;  2BHY A;  2XAG A;  2NYX A;  5D18 A;  1W4M A;  2XAF A;  4EM1 A;  3ZMZ A;  4EJT A;  3OYM A;  3H36 A;  3RJP A;  1LB2 A;  3GUD A;  3S16 J;  1QO0 D;  4E7Z A;  3JRH A;  2PBX A;  4F7Z A;  2P5L C;  5JHF A;  3ELK A;  3O3K A;  2W7N A;  1EF4 A;  2Q24 A;  2V1D A;  2HKU A;  2K9N A;  4XR6 A;  3HSR A;  2E1M C;  3M07 A;  5E1X A;  2NRA C;  3RH2 A;  1S72 I;  1IC8 A;  5E3L A;  5LLQ A;  1ZHF A;  3WG9 A;  2NVY J;  1K6Y A;  1UAA A;  2V9K A;  2ELJ A;  1XMA A;  2H8W A;  4EGZ A;  3KZI C;  5H6Q A;  4OIO F;  4JX4 A;  1HLV A;  1OCO H;  3S1M J;  3DBH B;  2EZK A;  2ZXJ A;  4PJL A;  2CH0 A;  5DM7 F;  1G4D A;  1TBX A;  1T33 A;  4BAY A;  2HKO A;  4A3F J;  3TGN A;  2HR3 A;  3CCV I;  2XF5 A;  1QGP A;  2ZCW A;  2LY2 A;  1BA5 A;  1WFX A;  3GZN B;  5D4R A;  3SXY A;  1K4T A;  1HCR A;  2KZV A;  3HM5 A;  1ZTR A;  4YG2 F;  2CQK A;  1EV7 A;  4B43 A;  2ZME B;  2YU3 A;  3GZI A;  3DBL B;  1PP8 F;  2BYV E;  3B73 A;  1D1A A;  2GXG A;  2P5V A;  5B5E C;  4E7K A;  3DWL E;  4NDL A;  5IYD J;  1G3Y A;  3ZMD A;  1XG1 A;  2RGV A;  2V79 A;  3DKW A;  3BCA A;  2O0Y A;  1B72 B;  1R1V A;  2GLO A;  1POG A;  4CZC A;  3J80 Z;  3H9J A;  2QIB A;  1F5T A;  5CKT A;  3DEE A;  1R58 A;  4CCO A;  4I76 A;  1YI2 I;  2IGO A;  1J9I A;  5LRS A;  3AL0 C;  1G2H A;  3W3C A;  2DMU A;  3FMQ A;  3ISP A;  3LQR A;  4IRI A;  2O03 A;  3SZT A;  5LGT A;  3FKJ A;  2P6S A;  1YJ9 I;  4A3C J;  2MLK A;  2R7R A;  2WAQ A;  2H27 A;  2IP2 A;  3HZJ A;  1ZAR A;  2FJI 1;  1R22 A;  2F48 A;  2IS2 A;  1OLT A;  4OD5 A;  5B66 C;  3GFJ A;  2KDZ A;  2BXY A;  3F3X A;  3RPQ A;  5F0C A;  5HDK A;  2OD5 A;  3AQT A;  3HTA A;  2JA7 J;  2YX7 A;  2ACJ A;  4PJM A;  4Y4R A;  2KL4 A;  2BXZ A;  4UXN A;  4ZYD A;  3NRG A;  2XGX A;  4RDU A;  4Q4Z F;  3I54 A;  1GDT A;  2JZY A;  4WXC A;  1JTY A;  3PNV A;  4NC7 A;  4KYW A;  2XSD C;  5EYR A;  2E19 A;  2DMQ A;  3AAF A;  2DDA A;  4RAG A;  2HQA A;  1T0F A;  3M9A A;  1WJE A;  3O8G A;  3CC2 I;  4ETS A;  2G7L A;  2H6C A;  2O3F A;  4XOR A;  5DD8 A;  4IHY A;  3CUQ B;  3LSR A;  1DU6 A;  3EPZ A;  2HVQ A;  2FE3 A;  2Y30 A;  1H8A C;  1VQ8 I;  2K27 A;  1O3T A;  1XMX A;  3I59 B;  2EIK H;  1TT0 A;  1ZGW A;  1YO5 C;  4ABZ A;  4A69 C;  3GCM A;  2DI3 A;  3S14 J;  1WGX A;  3HSE A;  1NK3 P;  1IXC A;  2F07 A;  2UXO A;  1OFC X;  2EJR A;  2QSG X;  2RKH A;  1UZC A;  2LOO A;  4XIC A;  3L2W A;  2Z33 A;  4KUM A;  2IS1 A;  2DAO A;  1VQO I;  2JVH A;  1LPQ A;  2ISY A;  2E71 A;  3MD2 A;  4PGH A;  1K78 A;  2FBH A;  1P9Q C;  4GXO A;  3ZQC A;  2EV0 A;  3ASO H;  3CP2 A;  2PMZ N;  2PQ8 A;  3GEU A;  3SQN A;  5DS9 A;  2JT1 A;  4HYE A;  2MYS A;  3CDL A;  2HYJ A;  2EH3 A;  2ZXW H;  5EDN A;  4UVA A;  2HVR A;  1O7F A;  3WHC A;  1WH5 A;  3HGY A;  3FXQ A;  4RS8 A;  4A3I J;  1LE8 A;  1J0R A;  3H5N A;  2L9S A;  1A36 A;  5CXI A;  2IS6 A;  2I8D A;  1ETQ A;  3LSM A;  5D8L B;  4XLE A;  3NI7 A;  1ULY A;  2MC4 A;  4L9J A;  1DP3 A;  1Y6I A;  1JJ8 C;  3U1D A;  2HQR A;  3E1S A;  5E3O A;  3CCE I;  2EIL H;  3FM3 A;  1IAW A;  3EYY A;  3FHN A;  1ZG3 A;  5EGO B;  1XB4 A;  5J4Y A;  3MN2 A;  5FLX Z;  1OCZ H;  2FX0 A;  4M6X A;  4D5F A;  4IOC F;  3ZQL A;  1J09 A;  2GEN A;  2EQR A;  3I3L A;  2DOE A;  2CUF A;  1K61 A;  4IOA F;  2HQN A;  2LY9 A;  1FY7 A;  2V57 A;  1VZ0 A;  3DP7 A;  5KAF C;  3V7R A;  2NS7 A;  1X3U A;  3CC7 I;  5E1Z B;  3MZY A;  4Q5S F;  3FX3 A;  1MJB A;  3QYF A;  2GIV A;  4BE2 A;  2GWR A;  5D4S A;  1T95 A;  3F8N A;  2OAZ A;  2OC6 A;  3G3Z A;  2BY0 A;  3RPU A;  3GZ5 A;  3GTQ J;  2VT2 A;  2A6H F;  2BEO A;  5CW8 A;  2X6Y A;  3VIB A;  4KT5 C;  5IT3 A;  4BUP A;  3HOV J;  1S3J A;  1MGT A;  3LJL A;  1S7O A;  1W7P D;  1T8I A;  4LG0 B;  4GO1 A;  1XDS A;  1BOA A;  5FRO A;  2OCE A;  4X6A J;  4II2 A;  1V54 H;  3CLO A;  1OR7 A;  2P7V B;  1GXP A;  1SD6 A;  3E5U A;  2XV4 S;  3MQ0 A;  2Y9Y A;  3O2P E;  1VQP I;  3KEQ A;  3FIS A;  3VSK A;  4ON0 A;  4EMS A;  3PNY A;  2HXO A;  1ZRD A;  2MFZ A;  1NG6 A;  3JSO A;  4XNF A;  2KFD A;  1I1S A;  2VJJ A;  5FKN A;  2ZJ2 A;  1LUJ B;  3T6N A;  3HOU J;  1GHC A;  4LD5 A;  2UWM A;  3GEZ A;  3A4C A;  4N4O B;  4R79 A;  2XKO A;  1S29 A;  4BXU A;  3EDP A;  2JA2 A;  2LBF A;  2ZME A;  3MKL A;  3UKG A;  1JT0 A;  2GBY A;  2EFN A;  4JL3 A;  2Y48 A;  2OQG A;  2CQX A;  3CJQ B;  2VPR A;  1EKE A;  1BJZ A;  5F6F A;  3U21 A;  3IKT A;  2X6O A;  3ON2 A;  3P5J A;  1BIA A;  4NC6 A;  1ETW A;  3VVX A;  3EYI A;  2HDW A;  5EF6 A;  3PAS A;  1WHU A;  3CJN A;  1D1B A;  3OSG A;  3CF2 A;  4DW6 A;  5GPC A;  2BHZ A;  2JWT A;  1Y39 A;  4G6Q A;  5GAG J;  1WJD A;  3J7A Y;  1RES A;  1QBJ A;  4HDV A;  4XRF A;  2CO5 A;  2G7U A;  1DDN A;  3M8F A;  2DA5 A;  2KJC A;  1YTY A;  2CFX A;  1QHH D;  1RUN A;  3HHH A;  1MND A;  2NOG A;  3HIM A;  1MMD A;  2R7S A;  2UXH A;  1OPC A;  4UUT A;  4S0H B;  2NNN A;  4BU2 A;  3PUB A;  3CCS I;  1I6H J;  1J5Y A;  1YIJ I;  1Y1V J;  2DTZ A;  1YQA A;  2H94 A;  2X48 A;  3CES A;  3OYK A;  2VXZ A;  2K5C A;  1U5T C;  3TKY A;  1FOW A;  3WTT C;  3PSI A;  2NXN B;  3ZQ7 A;  1ETY A;  3HUG B;  1MIJ A;  4KJZ A;  3R4K A;  1FNN A;  3DU5 A;  3M1C A;  4QPQ A;  2PZ9 A;  4ENK A;  3OS1 A;  3NWT A;  3OYI A;  1G3W A;  3EET A;  4Y15 A;  3IL2 A;  1Z1D A;  3I9V 2;  4IVN A;  1D8K A;  2QWW A;  4PGG A;  5CYV A;  4HNT A;  2FNP A;  2A6T A;  2CS3 A;  3JRE A;  2VOO A;  1IRX A;  1IUY A;  1GV5 A;  1LQ1 A;  1I39 A;  2LMD A;  5CQG A;  3PO3 J;  2Y2Z A;  3BG6 A;  5E1W A;  1XCV A;  3P7N A;  1ZEL A;  3WTX C;  2L9R A;  5E3M A;  1LJ9 A;  4EV0 A;  3S5R A;  2VON A;  5EG0 B;  3ABL H;  1Z6R A;  1U9O A;  3VYS B;  5HLG A;  2M0M A;  3MKZ A;  2BVL A;  3OV8 A;  1U9N A;  5FD6 A;  2XDN A;  5ILS A;  5F27 A;  2H1K A;  2V4J C;  3FXL A;  3EUA A;  4P9U A;  4Q47 A;  2L4A A;  3GXO A;  4KN7 X;  2LKX A;  3V7S A;  5BQT A;  2OJE D;  1W1W E;  1EA3 A;  4J19 A;  3TP0 A;  1E2X A;  1TQP A;  1W5T A;  1YJN I;  5FMP A;  5GPA A;  1W5C C;  3ECH A;  4G8X A;  2ZCM A;  2CSO A;  5HNH A;  3LWF A;  1WQ2 A;  3QOP A;  5AON A;  1ETX A;  1R1U A;  2Y0S N;  3VW2 A;  5HS8 A;  4XLH A;  4M3G A;  1UHS A;  2K3P A;  3IH2 A;  5DCM B;  4KN4 X;  2FQ3 A;  3V7C A;  5ED4 A;  1G59 A;  1BW5 A;  1IRG A;  2NVU B;  1G8X A;  2JQ7 A;  1SVM A;  1ZRC A;  1SD7 A;  2JN6 A;  2WAQ N;  4XM3 A;  2XDV A;  4F92 B;  1HBX G;  2P81 A;  3NRV A;  3FF5 A;  2DOA A;  3PSF A;  4OU0 A;  3GFL A;  5D5W B;  3H35 A;  1TNT A;  5M5W J;  2PJP A;  4FX4 A;  2VBW A;  2HPI A;  2R7Z J;  3KLO A;  1EH6 A;  3OYJ A;  3IH3 A;  1SAX A;  1Z7U A;  4C2U A;  3G56 A;  4I6Z A;  3MNL A;  4MFD A;  1W36 D;  5D1R A;  3BZC A;  3ZN0 A;  3A01 A;  3F21 A;  2R92 J;  1FOX A;  3HBL A;  4A12 A;  2LRE A;  1MD0 A;  3DU6 A;  2DK8 A;  2EFQ A;  3BTJ A;  2EV5 A;  1AA7 A;  5CVI A;  1B72 A;  4KA4 A;  3ABT A;  4MXM A;  4OIR F;  3K6G A;  1VQ6 I;  2B0L A;  2OF7 A;  2Z99 A;  3LSK A;  4AWX B;  1YIO A;  1BBY A;  2G0E A;  1BR2 A;  1IV8 A;  1S8N A;  2FJ1 A;  2LRD A;  2IS4 A;  3LSH A;  1N75 A;  3HRT A;  4E7H A;  2M30 A;  1A31 A;  2QZ8 A;  2LKS A;  2ZJR F;  4BY7 J;  2JUC A;  1LVK A;  1O3R A;  4NNJ A;  1H0M A;  3ESW B;  3K4B A;  4F55 A;  2RAE A;  5BMZ A;  1LDD A;  4NUB A;  3C3W A;  4XKC A;  4IZZ A;  2LLK A;  1G3T A;  3O6B B;  1K83 J;  1X58 A;  1FSE A;  1MBE A;  3D5S C;  2R5Y B;  3PQK A;  1U0J A;  1GVJ A;  3LAP A;  2VBZ A;  5JLX A;  3ULQ B;  4ZYH A;  5FFX A;  1X4P A;  1XGN A;  2XRN A;  4M74 A;  2IBD A;  2LBF B;  3W6K B;  4Y17 A;  2DMP A;  2HQ5 A;  3RIR A;  5F1J A;  2MC3 A;  2YPR A;  5TGT A;  4RA2 A;  2X6W A;  4UB6 C;  4C30 A;  1RRJ A;  3NQO A;  2VB6 A;  3QU3 A;  3GTP J;  5DAJ A;  3ZMS A;  2ZJQ F;  1FX7 A;  4F93 B;  3CD6 I;  4B47 A;  4BXF A;  3S2D J;  2EA4 A;  3HOY J;  4DBQ A;  1EH7 A;  4MTE A; 
#chains in the Genus database with same CATH homology
 3HEF A;  2MGQ A;  3SFI A;  1RPW A;  3JR9 A;  1MNM C;  5J1Y A;  3JRF A;  2YVH A;  3S16 J;  2RAS A;  3PM1 A;  3JRH A;  1XS9 A;  2PBX A;  3ANP A;  2DA3 A;  4B1R A;  2ECB A;  3NAR A;  2XPW A;  1SGM A;  3JSJ A;  3HDD A;  5EZH A;  5IYC J;  3A01 B;  4FIS A;  2CU7 A;  1EF4 A;  2HKU A;  2Q24 A;  1A6I A;  2K9N A;  2UXI A;  3BG3 A;  2ID6 A;  3RH2 A;  3A03 A;  1IC8 A;  1JJ6 C;  5E3L A;  4D5C A;  1A5J A;  1P7I A;  2NVY J;  4Y7N J;  1SFO J;  1F43 A;  4JX4 A;  1HLV A;  3S1M J;  1CQT A;  2LD5 A;  2EZK A;  3KKD A;  4JX6 A;  2DA6 A;  3VOK A;  5F04 A;  3HOZ J;  1T33 A;  3S1R J;  4A3F J;  2JMW A;  3BR2 A;  3TW6 A;  1SAN A;  4UUS B;  4FCY A;  1BA5 A;  4A3D J;  2OI8 A;  2NX4 A;  1HCR A;  1IV6 A;  2JA6 J;  3Q0W A;  4XRS A;  3HM5 A;  4D7M A;  4GFK A;  1ZTR A;  3FKI J;  4JYK A;  3C2B A;  1IRZ A;  3IUV A;  2LVS A;  5IP7 J;  2NVX J;  5EFY A;  4MO7 A;  1R9T J;  9ANT A;  3GZI A;  3BCG A;  4L62 A;  5H9T A;  1BL0 A;  1MH4 A;  2DMT A;  5DTD A;  4NDL A;  1RKT A;  5IYD J;  1AKH A;  1XG1 A;  2HXI A;  5K7F A;  1B72 B;  4BY1 J;  2GLO A;  1POG A;  3O8H A;  4M3F A;  3HOX J;  1UI6 A;  2QIB A;  1WI3 A;  3HE0 A;  5FGL A;  4AUX A;  4A93 J;  4I76 A;  5C3E J;  1H88 C;  3E7Q A;  1G2H A;  2NVQ J;  1AHD P;  2DMU A;  3RZD J;  1RET A;  2JK3 A;  2XB5 A;  4A3C J;  2MSY A;  4RBO A;  2YVE A;  2IAI A;  3FIW A;  3OSF A;  1X2M A;  3F0C A;  5BNG A;  3EUP A;  3JRB A;  4BKX A;  2G7S A;  2E1O A;  4M6V A;  5M5X J;  5K7H A;  2DG8 A;  2X9D A;  2XB0 X;  3HTJ A;  2KDZ A;  1B8I B;  1I3Q J;  5EGO A;  2AO9 A;  5F0C A;  2UXU A;  1VFC A;  3AQT A;  3HTA A;  2JA7 J;  2W53 A;  1ETK A;  2B63 J;  3NRG A;  4XID A;  4YZE A;  5FKM A;  4RDU A;  2JA5 J;  3LSP A;  1GDT A;  1JTY A;  2HDD A;  2XSD C;  5EYR A;  2E19 A;  2DMQ A;  5IP6 A;  4A3B J;  2ME6 A;  2ZCN A;  3GTK J;  3BNI A;  2AHQ A;  4QSH A;  3O8G A;  1FTT A;  2G7L A;  1W0U A;  2O9L A;  4IHY A;  3C07 A;  3LSR A;  2K9Q A;  1DU6 A;  1TC3 C;  4IHX A;  2E2H J;  1RR7 A;  4LOC A;  3VW1 A;  1MBH A;  2Y30 A;  5J3L A;  1H8A C;  3KNW A;  1S7E A;  2HOS A;  1ZGW A;  4V2G A;  1XC5 A;  3QQA A;  1ZQ3 P;  5M5Y J;  2LFB A;  4ABZ A;  1ENH A;  4A69 C;  1PUF B;  5F08 A;  3S14 J;  1WGX A;  1NK3 P;  2G3B A;  2F07 A;  3G1M A;  1UMQ A;  3IV5 A;  4M3E A;  4C2M J;  2UXO A;  1OFC X;  1IDZ A;  4DZJ A;  4XIC A;  4JP0 A;  3S1Q J;  3G1L A;  1NK2 P;  2XPV A;  1ZR2 A;  5E3N A;  3BHQ A;  3CQZ J;  2QKO A;  3ZQC A;  3Q0V A;  3GEU A;  2PMZ N;  2H8R A;  5DS9 A;  1QRY A;  3CDL A;  2HYJ A;  3H0G J;  2EH3 A;  2TRT A;  5EDN A;  2WV1 A;  3WHC A;  1WH5 A;  1QVU A;  3HGY A;  2VKE A;  3ZQF A;  5C4X J;  3BR0 A;  3VVY A;  5HAW A;  5AQC A;  3LWJ A;  1U8B A;  4A3I J;  3GTO J;  1LE8 A;  2DA2 A;  2COB A;  4GCL A;  2XPU A;  3G1O A;  5IP9 J;  2D6Y A;  5CXI A;  1ETQ A;  5C4Y A;  3OOU A;  3CRJ A;  3HTI A;  1JKO C;  3NI7 A;  2KT0 A;  2XRL A;  2M34 A;  4BBR J;  3GTM J;  2R5Z A;  1JJ8 C;  1Z77 A;  5E3O A;  2MW8 A;  3M4O J;  3QBM A;  1ORK A;  4MFE A;  5EGO B;  3MN2 A;  2FX0 A;  2M8G X;  4D5F A;  3ZQL A;  4V2F A;  3LHQ A;  4A3L J;  2XGD A;  2GEN A;  2EQR A;  4QTR A;  4CYC B;  1MSE C;  2CUF A;  3NPI A;  3BT9 A;  1K61 A;  2LY9 A;  2V57 A;  3P9T A;  2NP3 A;  3B6A A;  1MH3 A;  1BW6 A;  2NS7 A;  1PUF A;  2HYT A;  1F36 A;  1IDY A;  2XGC A;  4W97 A;  3DPJ A;  4NEL A;  4DZP A;  1ZR4 A;  5M3F J;  4UUS A;  5J1U A;  1MBF A;  3GTQ J;  4ICH A;  5CW8 A;  3VIB A;  2EBI A;  2Y9Z A;  3QPL A;  4JX5 A;  3LNQ A;  5C4J J;  4A3K J;  4L5E A;  3HOV J;  3LJL A;  2DA7 A;  2FD5 A;  3O60 A;  1DU0 A;  5FKL A;  4X6A J;  4XRS G;  3AQS A;  2QWT A;  1VI0 A;  4W1U A;  1JT6 A;  4DYC A;  3ZQI A;  1JTX A;  2Y9Y A;  3BR1 A;  3BQZ A;  3H3V K;  3FIS A;  3DEW A;  2DJN A;  3RD3 A;  2R93 J;  3DCF A;  3NAU A;  2HXO A;  5CXG A;  3I4N J;  3W6V A;  2O7O A;  3M3Y J;  4A3G J;  5FKN A;  2K9S A;  4PXI A;  1TWC J;  3BQY A;  2QTQ A;  5J1R A;  3T6N A;  4BXX J;  3HOU J;  3QKX A;  2ME0 A;  3Q3S A;  3HOW J;  2ZOY A;  3BTC A;  3BTL A;  3ZQH A;  1WCM J;  4DYR A;  2YUS A;  2IEK A;  5JLW A;  4GFB A;  3MKL A;  3JRC A;  3UKG A;  2IU5 A;  4GFL A;  1JT0 A;  2GBY A;  1FTZ A;  1HF0 A;  3CJD A;  3NNR A;  4JL3 A;  2YU9 J;  2CQX A;  3IH4 A;  5F0F A;  2VPR A;  1BJZ A;  2E2I J;  1UG2 A;  4GCT A;  1OJL A;  1OCT C;  4B4C A;  2X6O A;  3ON2 A;  1ETW A;  4B3A A;  3VVX A;  1FIP A;  5EF6 A;  3PAS A;  2LK2 A;  3OSG A;  4GCK A;  4DW6 A;  5GPC A;  1E3O C;  4BBS J;  1IG7 A;  5D19 A;  3ANG A;  2JWT A;  3BG9 A;  2CJJ A;  3Q0U A;  2QCO A;  1JKQ C;  3GBG A;  1QPI A;  3JRD A;  1RES A;  3BR3 A;  3PO2 J;  3D1N I;  1ETV A;  3BTI A;  3SJM A;  1D5Y A;  3S15 J;  2DA5 A;  2L0K A;  4UDS A;  4CGR A;  2ELK A;  3E7L A;  3SDG A;  4AYB N;  2NOG A;  3HIM A;  5FKK A;  2L7Z A;  2QF7 A;  2UXH A;  2JJ7 A;  4UUT A;  4S0H B;  4XRM A;  2DMN A;  5C44 J;  2OER A;  1VND A;  1I6H J;  2O7T A;  2L7M P;  1Y1V J;  2Y31 A;  5IOY A;  2DTZ A;  3F1B A;  2EZH A;  4MIM A;  1FEX A;  4D7N A;  2WB1 N;  2X48 A;  1JGG A;  4IHW A;  4A3J J;  5FLV A;  2NP5 A;  3B81 A;  3FK6 A;  3ZOB A;  1MSF C;  1I50 J;  4HKU A;  1Q1V A;  5EZG A;  4JKZ A;  1ETY A;  2XGE A;  4CYC A;  3TED A;  1HDD C;  2GUH A;  1TWH J;  2JA8 J;  2DN0 A;  4KWA A;  3CCY A;  5EEA A;  2PZ9 A;  2UXP A;  1IJW C;  1FJL A;  3GTJ J;  1GT0 C;  2DG7 A;  5FJ8 J;  2RHA A;  2DA1 A;  3KKC A;  3JRI A;  2I10 A;  3BJB A;  2VI6 A;  3CWR A;  3JRE A;  3BR5 A;  3JRG A;  4NN1 A;  1T56 A;  3VVZ A;  3WHB A;  1GV5 A;  2EZL A;  1LE8 B;  3PO3 J;  2Y2Z A;  1P7J A;  1APL C;  1MBG A;  3COL A;  1WH7 A;  2L9R A;  4FE4 A;  5E3M A;  3S5R A;  5IPA A;  1GV2 A;  2R5Z B;  5K58 A;  5EG0 B;  1X2N A;  2ECC A;  2REK A;  1U9O A;  2N8G A;  1GUU A;  4XK4 A;  1ZK8 A;  1IGN A;  3HKZ N;  2NS8 A;  3TW7 A;  1U9N A;  2XDN A;  1JUP A;  2M2E A;  5F27 A;  2H1K A;  1YRN B;  2FQ4 A;  4DYQ A;  5EG0 A;  2LKX A;  2R5Y A;  3FK7 A;  5FLM J;  4J19 A;  3TP0 A;  3VUQ A;  3HB9 A;  1JUM A;  5FMP A;  1RKW A;  5GPA A;  2VUM J;  4AF5 A;  4FE7 A;  2HI3 A;  2ZCM A;  1AKH B;  1W0T A;  1H89 C;  1LFB A;  5FKO A;  3GTL J;  2MG4 A;  1ETX A;  4M3B A;  2Y0S N;  3VW2 A;  4MLO A;  3VOX A;  4M3G A;  1UHS A;  2YS9 A;  3IH2 A;  4C3H J;  1BW5 A;  3LSG A;  1QVT A;  1JUS A;  2DA4 A;  2L7F P;  3S1N J;  3OIO A;  2VKV A;  2JN6 A;  3ZQG A;  2WAQ N;  2G7G A;  3V6G A;  2QOP A;  3G7R A;  3VW0 A;  5F0H A;  3CMY A;  1Y1W J;  1ITY A;  3GTG J;  2CUE A;  2P81 A;  2OPT A;  3I4M J;  4IHV A;  5M5W J;  2TCT A;  1MBJ A;  2CRG A;  2LR8 A;  1NTC A;  2ID3 A;  4X1E A;  2CQQ A;  5K7Z A;  3FRQ A;  1YRN A;  2R7Z J;  5IOZ A;  3IH3 A;  5HBU A;  3BG5 A;  1TWA J;  5GP9 A;  3G56 A;  3MNL A;  4I6Z A;  4AC0 A;  4EEF G;  4MFD A;  5D1R A;  3A01 A;  1MBK A;  3QPS A;  2HOT A;  2R92 J;  2GFN A;  4AC6 A;  3HBL A;  3NXC A;  3BR6 A;  4ACI A;  2R0Q C;  4IEJ A;  2ZOZ A;  3BTJ A;  4FTH A;  1UI5 A;  2K40 A;  3S2H J;  1JKR C;  3KZ9 A;  2LTP A;  1B72 A;  3VP5 A;  4MXM A;  3RQI A;  3TP3 A;  2OF7 A;  3V78 A;  2G0E A;  3ON4 A;  1JKP C;  2FBQ A;  2FJ1 A;  4A3M J;  1O4X A;  2HOA A;  1TWG J;  4BY7 J;  3VPR A;  4C3I J;  1WPK A;  3HGG A;  1IUF A;  2RAE A;  1VF9 A;  5M3M J;  1ETO A;  4M3D A;  2ZCX A;  3B6C A;  2LLK A;  2ZB9 A;  1K83 J;  1X58 A;  3K2A A;  1MBE A;  3MVP A;  3HTH A;  3EGQ A;  2R5Y B;  2W48 A;  4ME9 A;  1B8I A;  5JLX A;  3A02 A;  2GM4 A;  3L1P A;  4HNV A;  1OCP A;  5HOD A;  2NVT J;  3S17 J;  3LOC A;  2WGB A;  3PPB A;  4QIW N;  3K7A J;  2D5V A;  3BRU A;  3RKQ A;  1HOM A;  4MK6 A;  4Y52 J;  2IBD A;  4JNN A;  5FHP A;  2LP0 A;  3JRA A;  2EZI A;  2M9H A;  3RZO J;  2DMP A;  2HQ5 A;  5F1J A;  1HDP A;  1LFU P;  4C3J J;  1ZKG A;  3LSJ A;  4G12 A;  1GVD A;  2WUI A;  4A3E J;  1Z0X A;  1FIA A;  3GTP J;  1TWF J;  5DAJ A;  5HSZ A;  5D18 A;  1U78 A;  5IYB J;  2O8K A;  2M0C A;  1AU7 A;  3S2D J;  3HOY J;  2E2J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...