4W97A

Structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
196
structure length
196
Chain Sequence
b'RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR2
publication title Structural and Functional Characterization of a Ketosteroid Transcriptional Regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 86
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w97A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w97A02
3IUVA 3BT9A 1X2MA 3HBLA 2LKXA 3ZOBA 4XRSA 1MBHA 2DA2A 3HOYJ 2FJ1A 2LP0A 2NS8A 3BR0A 3HDDA 5F0FA 3QBMA 3BR3A 1DU6A 1ITYA 5M5WJ 1WH5A 3BQZA 1CQTA 2E2JJ 1P7IA 2YVHA 2Q24A 5D19A 2LD5A 3O8HA 4LOCA 1FJLA 3B6CA 1IV6A 4JX4A 3HTHA 4AC0A 3TW6A 5FJ8J 5C3EJ 4I76A 5EEAA 1ZTRA 3JRAA 1RKWA 2HOTA 2MG4A 5JLXA 4QTRA 1F43A 3GTLJ 1ZR2A 2L9RA 2YS9A 3H0GJ 5EGOA 2TCTA 4ABZA 3ZQCA 2NVXJ 1VNDA 1K61A 3VW2A 3JRHA 2IBDA 1TWGJ 1XS9A 3Q0WA 4Y52J 2YUSA 2VUMJ 1IC8A 4DYQA 3E7LA 3RZDJ 2DA1A 1GT0C 2K9QA 3VP5A 2ELKA 3G1MA 2WGBA 2XDNA 2GM4A 2AO9A 4JX5A 3QPLA 2NVTJ 4S0HB 2O7TA 1JTYA 4C3IJ 3M3YJ 4ACIA 4DYCA 3JREA 2DJNA 3GTGJ 2L7ZA 2D6YA 2L7MP 4XICA 4DW6A 3HTIA 4UDSA 4C3HJ 3S1NJ 2JJ7A 2M9HA 1PUFB 2CUEA 5K7ZA 3NAUA 4IHYA 1IUFA 1YRNB 2AHQA 2RHAA 1OJLA 4L5EA 5GPCA 1AHDP 3S2HJ 3HM5A 5E3OA 3W6VA 3I4MJ 3B81A 4AUXA 3KKDA 1WH7A 4AC6A 1Z77A 1HLVA 1SFOJ 1NK2P 2MSYA 3ZQLA 1GUUA 3NRGA 5FLMJ 2DG8A 5HODA 1I50J 4NDLA 5DS9A 1ZGWA 3RD3A 3OSFA 2R92J 2X48A 4JYKA 1XC5A 3GTQJ 2ZOYA 1MSFC 1GV2A 2Y9YA 2GFNA 1B72B 2HI3A 2NS7A 3MN2A 2F07A 3BG9A 1H8AC 3FK6A 1APLC 2EZKA 2EZIA 2ECBA 1HF0A 2GLOA 2QF7A 3GZIA 4IHXA 3RQIA 1BJZA 1IDYA 2G3BA 3NARA 5EDNA 5DAJA 3LSPA 3S17J 1PUFA 4A3JJ 2PZ9A 3HOXJ 5HBUA 1R9TJ 1JT6A 3IH2A 1T33A 3BR1A 3Q3SA 3TW7A 2UXIA 3BQYA 2NX4A 3VVYA 1DU0A 2DA6A 2XRLA 2NP5A 2FQ4A 5JLWA 3F0CA 1JUPA 1QPIA 3OOUA 4RDUA 2XSDC 3COLA 3BTIA 3RZOJ 3A01A 5IYDJ 3RH2A 2DMPA 2D5VA 1X2NA 5HAWA 3HE0A 2XGEA 4GCTA 2X9DA 3P9TA 4B1RA 1BW6A 2XPWA 2ID6A 3GTOJ 3OSGA 2RASA 3VW1A 5F0HA 3ZQFA 2Y31A 3ZQGA 3ZQHA 4MXMA 4A3IJ 1OCPA 3EUPA 1JUSA 2P81A 2HYJA 1B72A 2YVEA 2DA5A 3TP0A 4CYCB 4A3BJ 3CMYA 4QIWN 1AKHB 2JMWA 4V2GA 4JX6A 2ZCNA 5C4XJ 5M3FJ 3BTCA 4JP0A 3MKLA 3IH3A 5H9TA 3GEUA 4AF5A 4L62A 5EG0B 3FKIJ 3G56A 2E19A 2WAQN 1ZQ3P 5IYCJ 5F08A 3A02A 4AYBN 5EZGA 2ZCXA 1D5YA 3QKXA 3A03A 2XGCA 5FKLA 1NK3P 2HOSA 1O4XA 4HKUA 1UG2A 1FTZA 4XRMA 2R5YB 4Y7NJ 5C4JJ 2JA8J 1RESA 5J1UA 3HEFA 2DMTA 1B8IB 2JA7J 3BR2A 2V57A 4M3EA 2R93J 5J1RA 3OIOA 1T56A 3GTKJ 3GBGA 1ETVA 5K58A 2G7LA 2QKOA 2UXUA 2DMQA 5J1YA 2ECCA 2JA5J 3FRQA 2NVYJ 1ETWA 3BR6A 9ANTA 1JKOC 3GTJJ 5HSZA 4A69C 2DTZA 2JA6J 1ETOA 3NNRA 5K7FA 5AQCA 4NELA 4G12A 1JTXA 2M34A 2GENA 2K40A 5BNGA 3GTPJ 2Y0SN 2DN0A 3BR5A 2O8KA 3LJLA 3H3VK 5M5YJ 4A93J 1RPWA 1TWHJ 2EQRA 3B6AA 3DCFA 3K2AA 5FGLA 4DZPA 1JKPC 3BRUA 2RAEA 2CJJA 5C44J 1AKHA 1MBKA 2W48A 1E3OC 2R5ZB 1LE8B 2ZCMA 4UUSB 4GFLA 1IG7A 2X6OA 3VVXA 5EG0A 1JJ6C 3MVPA 2B63J 4GCKA 1EF4A 2W53A 4FE7A 4M3BA 3S16J 1QRYA 3NI7A 5C4YA 1POGA 3L1PA 1JKQC 2QWTA 3BHQA 1VFCA 5D1RA 1ETKA 2IEKA 4NN1A 3SDGA 1GDTA 2R5YA 4MFEA 2NVQJ 2IAIA 3IV5A 4MLOA 4I6ZA 1UHSA 4D7NA 2VKEA 2HDDA 3BJBA 1U9OA 2GBYA 2LVSA 1RR7A 4A3KJ 3PM1A 2NOGA 2QTQA 3EGQA 1MSEC 1ZKGA 4B3AA 4C2MJ 3S15J 2ME6A 1HDDC 1IRZA 4D5CA 2L0KA 3JRDA 3TP3A 3WHCA 4ME9A 1MBJA 2L7FP 2PMZN 4M6VA 2CRGA 2E2HJ 2HYTA 2NP3A 1HOMA 4M3DA 3VOKA 3D1NI 1Y1WJ 5CXIA 1WPKA 4J19A 5FHPA 3FK7A 2COBA 2QOPA 2XPUA 5M5XJ 3FISA 4DYRA 3ANPA 4JL3A 1YRNA 3K7AJ 3G7RA 1H89C 1BA5A 1LE8A 3T6NA 2TRTA 1VF9A 4W97A 4UUSA 1BW5A 5EF6A 4PXIA 4M3FA 5FKKA 1TC3C 3DEWA 5M3MJ 1W0UA 5F1JA 4M3GA 1WGXA 3AQTA 3Q0UA 2CU7A 3PO3J 1FTTA 4BKXA 3JRGA 2UXOA 4A3MJ 3ZQIA 3I4NJ 2MW8A 2OF7A 4BY1J 1ENHA 2K9SA 3LOCA 2H1KA 1Y1VJ 4JNNA 1ZK8A 5E3LA 3VPRA 5FKMA 4W1UA 5FKNA 4V2FA 1GV5A 3CRJA 3FIWA 2OPTA 2WV1A 2HXIA 1G2HA 3JSJA 1WI3A 4D5FA 1XG1A 3VIBA 2DA7A 3CQZJ 4IHVA 3S1QJ 2OERA 3HKZN 3JR9A 4XRSG 4DZJA 5E3NA 4A3DJ 3KZ9A 2JN6A 2LLKA 2Y9ZA 1UI6A 3G1LA 4FISA 2FD5A 2ID3A 3LSGA 3V78A 1ETYA 3CDLA 2R7ZJ 3CJDA 3NPIA 2LY9A 1K83J 2I10A 2MGQA 4CGRA 2XPVA 3GTMJ 4X1EA 4BBSJ 2DMNA 5FMPA 5EZHA 4A3GJ 5F27A 1UI5A 5F0CA 1TWAJ 2O7OA 3JRIA 2N8GA 1IJWC 1ORKA 1GVDA 2KDZA 3S14J 1NTCA 1JUMA 1ETQA 1OFCX 5IOZA 4XIDA 1I6HJ 3AQSA 3NXCA 1W0TA 1JT0A 3KNWA 2Y2ZA 4D7MA 4ICHA 1OCTC 4IHWA 4X6AJ 3PASA 3C2BA 1SANA 1F36A 1WCMJ 3BTLA 2EH3A 4JKZA 3M4OJ 4A3LJ 2EBIA 5GP9A 5EYRA 2JWTA 3JRBA 2ZOZA 3LNQA 3PPBA 2VPRA 1TWFJ 3S1MJ 3BG5A 1A6IA 3BNIA 4GFKA 2CUFA 3HTAA 5EFYA 5D18A 4FE4A 2XB0X 4UUTA 2UXPA 3VOXA 2HOAA 4MO7A 4A3FJ 4CYCA 3HGGA 1U8BA 1P7JA 4RBOA 2HKUA 2M0CA 2ZB9A 3SJMA 1A5JA 2DA3A 1MNMC 4QSHA 4A3CJ 1FIPA 4GFBA 2K9NA 3DPJA 1H88C 2Y30A 3JRCA 2UXHA 4BBRJ 3HTJA 1Z0XA 1FIAA 2HXOA 3LSRA 1MBEA 2R0QC 4FTHA 3WHBA 2DG7A 2G7SA 4IEJA 2LTPA 2WUIA 3LSJA 1HDPA 2E2IJ 4MFDA 4EEFG 1MBFA 4A3EJ 2CQXA 2E1OA 3RKQA 1MBGA 2REKA 5IP7J 2YU9J 3CWRA 3HOWJ 2HQ5A 5GPAA 5IOYA 2M2EA 2OI8A 1B8IA 3BCGA 2PBXA 3PO2J 2VKVA 1IDZA 5E3MA 3HOUJ 4GCLA 3BTJA 3O8GA 5FLVA 2H8RA 4BY7J 3UKGA 2LK2A 4MK6A 3A01B 2KT0A 2QCOA 3G1OA 3E7QA 1QVTA 3QPSA 4KWAA 1LFUP 3Q0VA 1VI0A 2WB1N 5K7HA 2GUHA 3HIMA 2QIBA 1Q1VA 1U9NA 1MH4A 1S7EA 2EZLA 2VI6A 4HNVA 4XK4A 4MIMA 3S2DJ 3HOZJ 1LFBA 2LFBA 1JJ8C 2FBQA 2O9LA 1X58A 3HB9A 2XGDA 3C07A 5J3LA 1HCRA 5CXGA 2CQQA 2R5ZA 2FX0A 2M8GX 4FCYA 1ETXA 3SFIA 5IPAA 3JRFA 5FKOA 1RETA 5IP9J 3F1BA 2DMUA 5CW8A 1MH3A 3V6GA 3BG3A 3QQAA 3IH4A 1AU7A 2JK3A 1QVUA 4C3JJ 2DA4A 3O60A 5EGOB 2XB5A 1SGMA 2IU5A 3S5RA 1TWCJ 3VVZA 5IYBJ 5IP6A 1ZR4A 3TEDA 3VUQA 3HGYA 3LWJA 3MNLA 1JGGA 5F04A 4YZEA 1FEXA 1BL0A 2G7GA 3ANGA 2G0EA 2EZHA 3ON4A 3VW0A 1RKTA 3HOVJ 3ON2A 3S1RJ 5DTDA 1UMQA 3KKCA 2LR8A 3CCYA 1U78A 1JKRC 1IGNA 1I3QJ 4BXXJ 3LHQA 2ME0A 4B4CA
chains in the Genus database with same CATH superfamily
5LEJA 4BEHB 3FWEA 3CO7C 3HBLA 2COMA 4HRIA 2IXSA 2DA2A 2NS8A 3OL3A 5ICEA 3CMMA 3OIQA 3HDDA 3QBMA 1Z91A 5HLIA 3BR3A 1REPC 4JK1X 1E17A 5M5WJ 4G6QA 1P7IA 3BDDA 1MIJA 2A07F 4OOIA 3LA3A 3HSEA 1IXRC 4YIIA 1IV6A 3KP4A 3AKZA 1SMYF 2FNPA 4AC0A 1AOYA 5D8LB 5FJ8J 3L2UA 4I76A 4IRIA 3DBHB 2QKMB 3VSKA 2M87A 4XLEA 3JRAA 1K6OA 2HOTA 1F43A 1TT5B 2C6YA 1XB4A 3J7YJ 4CHUA 3H3ZA 1T98A 3GTLJ 2L9RA 4KMUX 1A35A 4Z2YA 3EPZA 1Z67A 3OL4A 3V7CA 3JRHA 2DT7B 2ZBKA 3V7RA 4AYBA 2CV0A 2VXZA 1IRFA 1FOXA 4XLCA 4OAZA 2VL8A 2VQCA 1GT0C 1FMWA 4C30A 1HW2A 4F91B 2PEXA 3H9GA 4WX9A 4D1QA 4E7KA 2ZY9A 1JTYA 2ZMEB 3R0JA 1LVKA 4C3IJ 4MGRA 1IXSB 4IF4A 5L3EA 3CCSI 1MZBA 2CUJA 2D6YA 4DW6A 4FASD 1ODDA 1YX3A 4L5JA 4C3HJ 3W2AA 3L2RA 4CH7A 2CUEA 3K10A 3F8CA 3KIOA 3NAUA 4RA2A 3C2GA 3HIFA 4CZCA 2MD0A 2Y0SA 1OJLA 3MD2A 5CVIA 3TOBA 3K9TA 5E3OA 2DQRA 3W6VA 2BW3A 3I4MJ 3B81A 1TT0A 2KIMA 5F6FA 5JR3A 3TO7A 4E7IA 4KA4A 4UUVA 1SFOJ 3KCCA 3H1CA 3GYHX 3VEPA 4LIVA 1FSHA 3ZQLA 4YIRX 2OTLI 2L02A 3GFJA 1NG6A 1ZELA 1ZGWA 3F8FA 5CVVA 2VT3A 4CXFA 2GXAA 1B9MA 3GTQJ 2OTJI 3E5QA 3GWZA 1MSFC 2GFNA 2RNJA 1BOAA 2V1NA 2ELHA 3FXRA 4ZC3A 2E5ZA 3KP5A 2O61A 1FT9A 2EZIA 3CDIA 3VTIA 2FBHA 1VQPI 3FMQA 1VQ9I 3ML6A 2DLLA 3RQIA 1BJZA 2V26A 2XUBA 3NARA 2HYFA 5DEQA 3LSPA 4IVNA 4GGGA 4A3JJ 4E7LA 1JT6A 3BOQA 1FBQA 5KCMA 4UB6C 2X1CA 1JI8A 1DU0A 2JUCA 3VVYA 1X1AA 1RRJA 2CSOA 3F0CA 3KEOA 3LL7A 1WQ2A 4B8XA 2TDXA 3BTIA 3RH2A 1XDUA 1K4TA 1PUEE 4OWRB 4WF2A 1OMIA 2HQRA 4IKFA 5LHGA 1OCOH 4B1RA 5HDNA 2VKDA 2ID6A 3GTOJ 1LNWA 3OSGA 1U3EM 5HLGA 1MDMA 2Y31A 5LEKA 1OCPA 2H8WA 2LF8A 3EQLF 3R61A 2GIZA 2YVEA 2DA5A 3E3VA 4LGWA 3TP0A 4CYCB 3J7AO 4A3BJ 4V2GA 2W7NA 3LFKA 4ZZLA 3BTCA 3W2VA 3MKLA 4GYGA 2DOEA 3GEUA 4IRHA 5H2FC 1HW5A 1ZARA 2P5LC 3GLLA 1BR1A 2WAQN 1ZQ3P 2ZCXA 3QKXA 2L2OA 1U8RA 2XGCA 3HKZA 4RAYA 2OV7A 3HOTA 3N97A 2IS6A 2M1BA 4XOPA 4XKVA 5C4JJ 5J1UA 2UUZA 1ZLKA 1OQYA 4RMNA 3SHFA 4HA8A 1SAXA 2KMUA 4EJTA 2GOXB 4A6DA 1YIOA 3C1DA 5J47A 1FP1D 4OD5A 2G7LA 1LUJB 2P6SA 2ECCA 4L9VA 1I1SA 5L3DA 3BR6A 2PX9A 1U0JA 5HSZA 2M7AA 1V5GA 2DTZA 2KLOA 3H9JA 1ETOA 3U1KA 2JA6J 5AQCA 4BEHA 3DLAA 2EIJH 1DDNA 2K40A 2P6TA 3FBNB 3QU6A 2A05A 4HLXA 3BJ6A 3DKYA 4ZH4F 4ZYGA 5JVTA 5H20A 5BOXA 4HF0A 2R7RA 2E7WA 3H3VK 4QPQA 4A93J 1YI2I 3K2AA 2K86A 2YX7A 3P9CA 4DZPA 1JKPC 2RAEA 5GTIC 2R5ZB 1RC9A 3WTSC 1ZG5A 1IG7A 2FF4A 5EG0A 2RQPA 4RM2A 1BC8C 2B63J 4GCKA 2BY0A 2K9MA 4M3BA 2O5RA 3ABTA 1U5TC 3L1PA 1JKQC 4F55A 5D1RA 1ETKA 3JSOA 1WI9A 3BJOA 1ZYRF 1OR7A 3F3XA 3SDGA 4R1HA 1KONA 2BEOA 2IAIA 3IV5A 1O3SA 1FYMA 2KIUA 3WU1B 3E5UA 3PQJA 1UHSA 4E7SA 3LAPA 2PFBA 1U9OA 2ZXHA 2LVSA 1TQIA 2ZSIB 1RR7A 1YOVB 3W6KB 2V6CA 2NOGA 3BZCA 1MSEC 4XKWA 1XSXA 2LOOA 2JSCA 3EYYA 4PSXA 3TKYA 2L0KA 1IN6A 1VQ5I 3WHCA 1UFMA 5KAFC 2L7FP 2PMZN 4M6VA 3CCLI 2E2HJ 2NP3A 2DOFA 2KKOA 4KFCA 3IC7A 2CW7A 1HA8A 3H36A 5TGTA 2OA4A 5ED4A 2COBA 1PVEA 2MFZA 3KP2A 4XORA 2WB1A 2R7WA 4PK4A 4DYRA 1X4PA 4JL3A 2QQ8A 4XN3A 3K7AJ 2RQQA 2XSJC 3H5NA 5B66C 5TJJA 5FLXK 5AONA 1QU3A 2V4JC 4UUSA 2PBIA 3DPTA 4M3FA 1TC3C 5FLXZ 3CUQB 3E6DA 3Q0UA 4XONA 3V7SA 4G94A 3FHZA 2V6EA 3PO3J 2UXOA 2JPBA 2I5UA 3ZQIA 2LREA 4MTDA 1K6YA 2K9SA 1H0MA 1Y1VJ 1XMAA 1ZK8A 2WWYA 3VPRA 1YLFA 4QPOA 5HS8A 5CVJA 2XAJA 5J8CA 5FKNA 1GV5A 2V9KA 1D5VA 5LRRA 1UHWA 3CTAA 4D5FA 1XG1A 3VIBA 1QHHD 2JTVA 5CQGA 1P4AA 3S1QJ 1EJ9A 1GVJA 4DQ2A 4LB5A 2O3FA 3RSNA 3JR9A 2EIKH 5E3NA 3OS1A 2RREA 3FZVA 3KP3A 2Z33A 3WTZA 2FD5A 2VQHA 3LSGA 5E1XA 4CA0A 1ETYA 3CDLA 3V78A 1AA7A 2LY9A 1BI1A 2ZCWA 2DFFA 4CGZA 5FMPA 1E0EA 2RGVA 2LY2A 2XKOA 5CLSA 4F93B 2FOKA 2W57A 5CYVA 4IOCF 3BZ6A 4GXOA 4HLYA 3F6OA 4F7ZA 4XLAA 2A6EF 3ZR8X 4DNCA 3KP7A 3IAM2 1JT0A 3KNWA 5LGTA 2O0YA 4ICHA 4U0VA 4X6AJ 3C2BA 1F36A 1WCMJ 3BTLA 2CG4A 3G3ZA 2EH3A 2L4MA 4ENJA 2K7LA 4K2EA 2HKXA 1CF7A 4A5NA 4L0ZB 4A3LJ 1MJ9A 2EBIA 2GAUA 2JWTA 2FMLA 3HZJA 1YJWI 3PPBA 3HRTA 3I54A 2ICWG 5J6XA 4NC6A 3HXLA 1A6IA 4OIRF 1SEUA 4GFKA 5EFYA 2LDUA 1DQUA 2XB0X 2WAFA 4II2A 1F9NA 4UUTA 4N4NB 5GTHC 4P9UA 3HSFA 2Z3YA 4U9LA 4CYCA 3KYLA 2DPDA 3E1SA 2OQRA 3GO5A 1U8BA 2EK5A 4RBOA 1F4KA 1DP3A 2HKUA 2M0CA 3L09A 4WXDA 4QSHA 2CS3A 4E7HA 2VC1A 1H88C 4BBRJ 4BXFA 1FSEA 4ZTFA 3WHBA 5L3GA 1W1WE 2FRHA 5IY5H 4OU0A 1S3JA 4ZDLA 2REKA 1IUYA 1N77A 3WE2A 1TLHB 5IOYA 2M2EA 3BCBA 1YHQI 4BQQA 2XROA 2QQAA 2F4OB 3BCGA 2OUMA 2VKVA 1JHFA 1IDZA 1G3WA 3HOUJ 4NQWA 4GCLA 1USSA 3BTJA 3O8GA 3FM5A 2LK2A 2LKPA 3KLOA 3I56I 3WTTC 1MMGA 5LLQA 4IO9F 2DT6A 4CO8A 1TZLA 3QYBA 4QLCU 2IGKA 2E1MC 1VI0A 4II3A 3ELKA 4Y17A 3E0JB 5K7HA 2GUHA 1IW7F 3RI4A 4ZYEA 1MH4A 2EZLA 2VI6A 2WY7Q 1HQCA 3S2DJ 1G6NA 1I27A 2G7HA 2FBQA 4IZZA 1X58A 3GLXA 2G7UA 4CCJA 1VQ8I 4BHPA 2CQQA 2R5ZA 3FF5A 4F3QA 3ISPA 3SFIA 3QPTA 1IN4A 3F1BA 5CW8A 1MH3A 1W36D 4MQ9F 2OAZA 2CUZA 1QVUA 4G6DA 2M0MA 2LNBA 3CUOA 4L9NA 2VBYA 5IYBJ 1IRGA 2EIMH 3FM3A 3GFLA 3VUQA 4BGDA 1J5YA 4LFUA 3LWJA 2QLZA 4UXNA 4N4OB 4YZEA 2QSGX 2G7GA 1J0RA 1WJBA 2UWMA 3ANGA 2G0EA 2DBBA 2WY8Q 2EZHA 1OCRH 5B1BH 4OIQF 2VBWA 3OR1C 1XSVA 2HPMA 3S1RJ 1UMQA 3HOSA 4HOBA 1WSUA 3ZQ7A 3SXYA 3FXQA 1IXCA 1IGNA 1I3QJ 3RQ4A 3AL0C 2MLKA 2HU9A 2FUG2 2Y69H 2L9NA 3FXOA 2K9LA 1X2MA 3BZKA 2QZ8A 2CQ7A 1KU7A 2GXGA 2VONA 3RYRA 4LMYA 3GEZA 1TNTA 1Y56A 2J5OA 1R49A 2EFOA 3H0DA 1SD4A 3DF8A 2HZTA 2EINH 2Q24A 5D19A 4YRVA 2LD5A 2BW3B 3O8HA 1FJLA 2XGXA 2XRNA 4JX4A 5E1ZB 5C3EJ 3TW6A 3WTXC 3ERED 3FX3A 5CJ9A 1ZTRA 2K27A 3DWLE 5DCMA 3W6JB 4F52A 2P5VA 2VC0A 4B3XA 2DFHA 2W24A 3H0GJ 2KQRA 2ZNZA 4ABZA 3ZQCA 3IUOA 2YPRA 4XBFA 3VYSB 4YFNF 2D45A 3FXKA 3DTKA 5LHHA 2VOOA 1IC8A 3CC7I 3OYLA 3JTGA 2Z1DA 1YJ9I 2P4WA 2WGBA 3K4NA 2E7XA 4CSWA 3QPLA 2FQ3A 4S0HB 3A1YA 4NHJA 3Q5FA 3M3YJ 4ACIA 1FOKA 2JA2A 2BHYA 5CPRB 2P0WA 2FXAA 2PFVA 1I5ZA 3PNTA 5HDKA 4CCOA 5FO5A 3HTIA 4UDSA 3SEQA 1EV7A 2FMYA 4IJAA 2VB6A 1NHAA 3DV8A 2W85A 5K7ZA 3DFGA 3N05A 1ZRCA 1SD5A 2LKSA 4IHYA 1UHMA 1IUFA 2M5WA 2DK8A 3MMYB 4WIBA 1MMAA 1YW8A 3ZXSA 4H0EA 3S2HJ 1MJAA 3BG7A 1SD7A 3JAMK 3MEXA 1WH7A 5LGNA 1Z77A 4L9JA 3TL4X 3HRSA 4I01A 2MSYA 2XAFA 2VT2A 2ZXIA 3AFHA 3JAMZ 3IRQA 2NOJB 1X19A 4EM1A 3VODA 4WCGA 2DG8A 3RPUD 1I50J 4NDLA 5F64A 5DS9A 4EV0A 2R92J 1GHCA 2E71A 1D1CA 1XGNA 4JYKA 3ZGKA 2W4SA 4KN4X 2OD5A 1MDMB 3CC4I 2MBFA 1R5HA 5H6QA 2M4KA 1GV2A 3I0TA 2HI3A 2NS7A 3CF5F 2E35A 3F8NA 4LG3A 2KRFA 3BG9A 1H8AC 1ONVA 1XCBA 1APLC 3P7NA 2QA4I 3ZMUA 5J8FA 2HTJA 3WTYC 4HDVA 1GXPA 1HF0A 5E17F 2QF7A 3OYDA 2CW0F 5K5RA 2VJ5A 1DPRA 2XAGA 2G3BA 2V79A 3QYEA 3RPUA 1FBUA 3UR3C 3S17J 4EM2A 2DI3A 1SFKA 2CO5A 1G3YA 5HBUA 3LSTA 1T33A 3BR1A 1KYZA 2IGOA 3Q3SA 3BQYA 3HHHA 2NX4A 3LSMA 3HYIA 1XGOA 3DKXA 2DA6A 2CWEA 2V1XA 3FXUA 3S3OA 1RNLA 1V55H 2RN7A 4M6YA 1B59A 1S6LA 2CFOA 3M07A 4RDUA 3FMSA 1KU9A 4IL6C 3OS2A 2BZTA 1YITI 4PFPA 1SAUA 2HVRA 2B1EA 3F21A 3ULQB 2XGEA 5B3SH 2LF7A 3GVAA 3P9TA 1BW6A 5HDGA 5KK1A 2E34A 4BHCA 3HTSB 3I58A 1QQIA 3R0AA 5F0HA 3ZQFA 5HLTA 1UELB 3ZQGA 3EUPA 2X6XA 2F5CA 3VFZA 4LG0A 1B72A 2L7KA 2LMDA 5C4XJ 3JTHA 3KPHA 5M3FJ 4JP0A 2X1EA 5EG0B 2E19A 3OYGA 1X3UA 3REOA 1J2XA 4AYBN 4Q47A 2HNHA 5E8IA 4ZYAA 2EA4A 2Z16A 2R7TA 4E7JA 4HQMA 1LPQA 4RGRA 2R7VA 4Y13A 2HPIA 1MD0A 2XHKA 1YS6A 4KMFA 5GAGJ 3HEFA 5IT9K 3B02A 3OYMA 2JA7J 3BR2A 2HQNA 3E6BA 3GTKJ 1T56A 3MAJA 5IT9Z 2M3AA 3WTUC 3MKYB 2KJCA 2EFPA 2JA5J 2HGCA 2IPQX 2NVYJ 2YU3A 1ETWA 4DOZA 9ANTA 4HX7A 2LRDA 4A69C 2F5EA 3NNRA 4NELA 4A5MA 2O03A 3PQKA 1STZA 2Y0SN 3BR5A 3HRUA 5M5YJ 2EQRA 3TQNA 1Z9CA 2WA0A 3DCFA 2JPCA 1MBKA 3OYHA 1R5GA 2LG4A 4WK8F 2ZCMA 2VLAA 2BOLA 4UUSB 1K4SA 5KAIC 1JJ6C 1WKMA 4WXCA 3NI7A 1TW2A 5ILUA 2DT5A 1JXSA 1D1AA 1LFPA 1VFCA 3BHQA 2R5YA 3K69A 2KIFA 2P7CB 2MH2A 3IAS2 4LLLA 1WVRA 2HDDA 3HTUA 1U5TA 1JE8A 3ECOA 2VBXA 3F8MA 3RKYA 1PDNC 4N9HA 3WU0A 4B44A 1QZZA 3RCOA 4B3AA 3PIPF 4XRFA 3TBIA 2QTQA 3MWMA 2LYCA 2LBFA 3DBRB 2ME6A 4KITB 1NH3A 1HDDC 3JRDA 2Y48A 2PN6A 1Z6TA 4UNOA 1A04A 1Z7LA 3ZMVA 1DGRM 1MNEA 3JW4A 1MW7A 4M3DA 3R4KA 4I0AA 1W7PA 4HX4A 3F6VA 4PJLA 4J19A 2X6WA 3PNVA 4BE2A 4U87A 3DTIA 1YYVA 2QOPA 2XPUA 3K70C 2IA1A 1MJBA 3BCAA 4IQ4A 5FROA 2GXBA 3ANPA 4C2TA 2H09A 4GCVA 4HX8A 3K6GA 5D5WB 1LE8A 3NQOA 4W97A 5EF6A 2R7DA 5B1AH 3DEWA 5M3MJ 1W0UA 2X6YA 2JQ7A 4M3GA 1G4DA 3QU3A 1CF7B 5DV5A 4V19K 2R7SA 2BVMA 3GCMA 1O3QA 2QGUA 4BKXA 3I4NJ 1W5SA 1BBYA 1D0YA 2MW8A 5HVQC 4BY1J 1ENHA 4OINF 2D1HA 2H1KA 2IGMA 4RAFA 3KZZA 4BAYA 4V2FA 3ZN1A 4WWCA 1J75A 2Z2SB 3ZMSA 1OPCA 2L4AA 3I55I 2A2FX 2WV1A 2FA5A 2YX4A 1XMKA 1X3WB 2DA7A 2DTRA 2VN2A 3CCJI 4IHVA 4JQFA 1BN5A 4DBRA 2OERA 3HKZN 4DZJA 3NWSA 4A0ZA 2JN6A 2KZVA 1XTAA 1TP4A 1R5ID 4R79A 3CLOA 4FISA 3TMOA 3V42A 2HS5A 2GIVA 2R7ZJ 3NPIA 3KP6A 1SVMA 1S9HA 1G3TA 1Z7UA 2JVHA 2XPVA 3T0YA 3GTMJ 2DO7A 1ERDA 4BBSJ 2DMNA 4EQQA 2GOMA 3H92A 3AG2H 5ICGA 5GAHJ 3K0LA 4EJUA 3CJTB 1VQ4I 4YIFA 2KDOA 4ZJZA 1LB2A 2KDZA 2MC4A 2RKHA 3S14J 1JUMA 3KE2A 4PFOA 4AIKA 3AQSA 3NXCA 2EA2A 4NQWB 1UAAA 2YSRA 4IHWA 3PASA 4XOTA 1VTNC 1V3FA 2QSHX 4LK0F 5AIQA 5K1YA 4JKZA 1ZHFA 3MZYA 3M1CA 1V5FA 5EYRA 3LNQA 2VPRA 3CLQA 1ZN2A 2L9SA 1BIBA 3HTAA 3G2BA 5D18A 1XD7A 2V9VA 2EV5A 2VIXA 4U88A 3D5RC 3HL2A 3GF2A 2J5PA 2DFEA 1A6QA 3G71I 3K1PA 4TV7A 3HGGA 2K4JA 4ZDOA 1BI0A 2ZJRF 1KQ8A 3OYIA 3SJMA 1A5JA 2RV8A 3CESA 3FBIB 4ENKA 4GFBA 1IN8A 2ISZA 4NNJA 2ZNYA 2Y30A 4A0XA 3JRCA 1U6GA 4E70A 3HTJA 1FIAA 2R0QC 4HQEA 3DEEA 3D5SC 4IEJA 2CGPA 2WUIA 3LSJA 2QEXI 2E2IJ 4EEFG 2H6CA 2E1OA 2RNGA 3F72A 2YU9J 4U7DA 4G7HF 2HQ5A 3CCUI 2WTEA 1WJDA 3KZYA 4LK1F 3ZMDA 5DD4A 2A6TA 2PBXA 2CV2A 2H8RA 4BY7J 2QKLB 3C3WA 4P96A 4MK6A 1YJNI 3M7GA 2A6HF 1LEAA 2KT0A 3EDPA 5D4SA 1LDDA 2GA2A 4KWAA 3K4MA 4M9ZA 2WB1N 1XDSA 2V1DA 4FX4A 1S7EA 1Y0NA 1YW7A 2Q2EA 1FNNA 4M6XA 2PI0A 4YEJA 1R1UA 4O3MA 1BR2A 2JZYA 2OBPA 2Z5UA 3WU2C 1LFBA 2LFBA 1S72I 1JJ8C 1X3ZB 4RM3A 2GWRA 4XLNF 2M8GX 1ETXA 1N25A 4EJVA 3CF2A 4A6EA 4XLPF 5IPAA 2ZKZA 5FKOA 3JRFA 1XMXA 2DMUA 5FRMA 1B9NA 3LSKA 3V6GA 4YELA 3QQAA 3X2QH 1Y39A 5DCMB 4C3JJ 2XB5A 1BI2A 3KETA 5BPIA 1SGMA 1FBSA 1T38A 1ZLJA 3Q9VA 5DD8A 3MNLA 1KZHA 5D8KB 1FEXA 4ITVA 4BJ6C 1JHHA 3HRMA 2GA1A 3ON4A 3PIOF 2NNYA 1RKTA 4ESBA 3HOVJ 3PFYA 1LDKB 1Z1DA 2M8EA 1L0OC 3CCYA 3BJAA 5D5VB 4I7HA 4BXXJ 3DEUA 2FOWA 3EUHA 4JOMA 5DCFA 3DXJF 4B4CA 2X51A 1J7KA 4U0WA 3IUVA 3T8RA 5KNLA 3BT9A 2LKXA 4PJMA 4LLGF 3ZOBA 4XRSA 3HOYJ 4HEA2 2FJ1A 2LP0A 2JRTA 5F0FA 1I3AA 1KA8A 3RKXA 2ZFWA 1ZREA 1DU6A 3A0HC 4ZYDA 4HDUA 2E2JJ 4I09A 4ESJA 5BQTA 1D3YA 1EH8A 3BLYA 4MNUA 4PJ0C 4GO1A 4LOCA 3B6CA 3SZTA 5HOOA 1SC7A 3HTHA 3M8JA 5FGMA 2XF5A 3FXMA 3N4MA 3MCZA 4S04A 4AWXB 2MG4A 5JLXA 1DGWY 2X85A 4KIGA 1ZR2A 2YS9A 4UV9A 1K79A 6PAXA 1X1BA 1VNDA 1K61A 2BGCA 3COAC 4BDZA 1TWGJ 4N0BA 4C9YA 1P9QC 1XS9A 2YUSA 2E36A 3Q9SA 1T0FA 5H6RA 3RZDJ 1HW1A 2DA1A 1VQ6I 3KLNA 2KP6A 3QODA 4BE0A 3VSLA 2B9SA 2ELKA 3VP5A 3G1MA 1S8NA 4JX5A 2ELJA 2NVTJ 1KQ9A 2O7TA 3IKTA 5J4VA 1YS7A 4Y4RA 3CCEI 3I53A 4ASNA 4U9NA 4E7ZA 4LLNA 2H94A 3JREA 2DJNA 1EH7A 2L3DA 2L7ZA 2L7MP 3BG6A 4XICA 1CGPA 2VJ4A 2W82A 3I5UA 1ON2A 2KJBA 1FOWA 3NRVA 1NG7A 5DUKA 2DJIA 4G8XA 4FT8A 2QSFX 3V8JA 3KEQA 2AHQA 2RHAA 1QZYA 4KUMA 3HM5A 2R3SA 4AUXA 3KKDA 4Y33A 3PUFA 1MMSA 4AC6A 2CV1A 2A68F 1NK2P 3PFIA 2EILH 1GUUA 2VASA 5FLMJ 2IVMA 4M72A 5HODA 1T6SA 3FDYA 1MNDA 3OSFA 2ZJPF 2DK5A 2ZMEC 4M9SA 3G4SI 1KYWA 1MKMA 2A5YB 2Y9YA 1B72B 4LG0B 3J7AY 2OZUA 3MN2A 2VODA 2F07A 2F6CA 2F2EA 4AIDA 3CJNA 2EZKA 2FSWA 1PJRA 2AXTC 2ECBA 4G7OF 2GLOA 4ZTJA 2QBYA 3GZIA 3LSHA 4NBQA 4AIHA 3ABLH 4HZFA 5EDNA 4AD9A 3BY6A 1Z3XA 1PUFA 1FYKA 4RB0A 4HV6A 1WJCA 2ZJ2A 1R4NB 1ZRFA 2KL4A 1I1GA 1XGSA 3TW7A 3BP8A 2UXIA 5CKTA 2AS5F 4YFXF 2NP5A 5L3FA 1JUPA 3WE3A 1QPIA 1T39A 5KHDA 4H4KC 1QO0D 2XSDC 3GFIA 2PJRA 4KDPA 3HUGA 2K3FA 1H9GA 4XQFA 3RZOJ 5IYDJ 2V7FA 1LQ1A 4HAMA 1YQAA 3H5AA 2CYYA 4GCTA 2X9DA 1DUXC 1DPUA 2ISYA 4IHSA 2XC7A 4J00A 1UZCA 2RASA 1D8KA 4KT6A 2I8DA 1SVLA 3ZQHA 4MXMA 4RGXA 4A3IJ 5EEHA 4PDKA 1X4OA 2LY1A 2FNAA 4I2OA 3CMYA 4QIWN 1WJ5A 2JMWA 4JX6A 4BQNA 4XKBA 2DXIA 3WTWC 2FE3A 2IW5A 1YG2A 3IH3A 4AF5A 4KIFA 2R7OA 3V8LA 4UV8A 1EKEA 3A02A 2E5NA 5FKLA 3TO9A 3L2VA 2IS2A 1O4XA 4HKUA 4ENMA 4XRMA 2R5YB 1C0WA 1IO2A 2X1DA 4Y7NJ 5E18F 1RESA 3V4GA 2PMUA 3ZMZA 4XM3A 2G9WA 4KISA 4Y15A 2GQQA 2R7XA 4E6KG 3RPQA 2MH9A 2DMTA 1U5TB 3P9KA 4RAZA 3T8TA 1B8IB 4ENNA 2V57A 2MD5A 4M3EA 2R93J 3NS4A 1UCRA 1ETVA 5K58A 2QKOA 1ZAOA 2AQFA 2LBFB 4IRGA 1SMTA 3GTJJ 1R4MB 2XV4S 3OYFA 2JUGA 2STWA 4Q5SF 3SYTA 2VJJA 1JTXA 1W7PB 4L0YB 5K5OA 4BE1A 3GTPJ 5CQEA 2O8KA 3W3CA 1FPQA 5F1RA 4CCLA 2A69F 3S3NA 2CMPA 1TWHJ 3BPXA 4RAGA 4IHTA 1M1EB 2F4IA 1Y0UA 4RGUA 4ON0A 2EPFA 5C44J 1AKHA 2W48A 2EWNA 1E3OC 1LE8B 4EGZA 1LEBA 3GZ5A 4AVZA 2Q0OA 4XLHA 1R58A 4I99C 2EFQA 1BM9A 2K3PA 2QUFA 2ZJQF 3ASOH 1EF4A 2W53A 4FE7A 3S16J 4RB1A 5C4YA 2O8XA 1POGA 2DDAA 1VQOI 5FFXA 3QOPA 2QWTA 2IT0A 3J81K 4NN1A 3T5XA 3S8PA 4MFEA 2BV6A 5DM7F 3J80K 2DDBA 3TOAA 1OISA 3SQNA 4S05A 3J81Z 2VKEA 3H5RA 2XF6A 3OV8A 4FETA 1BJAA 3J80Z 3ECHA 2GBYA 2L5QA 3H35A 4MEYF 4FX0A 3EGQA 1ZKGA 2L9VA 4C2MJ 3H3UA 1V5EA 4M74A 3C7JA 2QM3A 1IRZA 5ILSA 4D5CA 2NNNA 3HC7A 1R1TA 4ME9A 1MBJA 2CRGA 3DU5A 2LSOA 1WWXA 3CC2I 3CCQI 4RB2C 2K5CA 4MHGA 3L7WA 3KFWX 1WFXA 2ZXJA 4A2UA 1YE9A 1KQ0A 5FHPA 3FK7A 5E20A 4NB5A 1X1PA 2W84A 1VZ0A 1O7FA 1EH6A 2NS0A 3FISA 5LBQA 4CCKA 2FBIA 3G7RA 4AIJA 3VDXA 1H89C 2XAQA 1OCZH 1R71A 4AM3A 2TRTA 2WBMA 4OIPF 2F5DA 3I59A 4PXIA 2OQGA 4KYWA 5F1JA 1BOBA 1K78A 1WGXA 1N78A 1LJ9A 1RUOA 2B3WA 2CU7A 5L3BA 4HW0A 3JRGA 4A3MJ 2B0LA 2H1LA 5D5XB 3V8KA 1QGPA 4JNNA 1WJAA 5HS7A 1I39A 2P8TA 3SEZA 5E3LA 5FKMA 4X0GA 4W1UA 2E1CA 1IRXA 3EETA 4RS8A 4BXUA 2KFDA 3LWFA 5J4YA 2UZKA 2HXIA 1W36C 1G2HA 1WI3A 3JSJA 3CZ6A 4LD5A 3WGHA 4CYDA 1VQNI 3CQZJ 2NXNB 1XX5A 5DYMA 5EEGA 3BC8A 3I4PA 2UXXA 3IL2A 3I9V2 4A3DJ 1TNSA 3KZ9A 4EMSA 1FLIA 2UXNA 2XF7A 1UI6A 1O57A 1XN7A 3FXLA 2GZWA 3OIPA 5FFZA 5FD5A 2ID3A 3E5XA 3A2KA 2I10A 1B4AA 2DPUA 4GRIA 2QQBA 5EZHA 1L3LA 3CUQC 4OAYA 1UI5A 5F0CA 1TWAJ 3JRIA 3HPHA 1XCVA 5E79C 1GVDA 2JT1A 4Y3OA 1UG0A 4CZZA 1NTCA 3G6EI 3ZPLA 1ETQA 4XIDA 3K8PC 1O3RA 1J9IA 1W0TA 1T95A 1ZH5A 3E6MA 3VYUB 4D7MA 3TDUC 1AWCA 1OCTC 1SANA 1VQMI 3PUBA 2E1NA 1GLNA 3PSIA 3ROUA 2K02A 4KIBA 5GP9A 1XSDA 4O5VA 1IAWA 4XMYA 2ZOZA 2NVUB 5D5UB 2VBZA 3I71A 4L9TA 3S1MJ 1HBXG 2EV6A 3BG5A 1R1VA 2CUFA 4MQVA 1W4MA 3RYPA 2Q2EB 3GZNB 4HNTA 4B43A 1BC7C 3M9AA 4HYEA 1Q1HA 5L3CA 5AIPA 1ACIA 4XN0A 4RLQA 2BY2A 2W1OA 1V4RA 3VOXA 2E1MB 4MO7A 5LRSA 4PZJA 4PUSA 1P7JA 4Q4ZF 4I98B 3KZIC 1MNMC 4A3CJ 3BPVA 2OU2A 2UXHA 3K4BA 1QNTA 1Z0XA 2HXOA 1W7PD 1MBEA 3E97A 3LSRA 2G7SA 2LTPA 3KYDB 2OJED 4EJOA 3QPHA 2CQXA 5DUIA 4HPQA 1LKXA 3TDZC 3RKQA 2YVXA 1FYLA 1MBGA 3VYRB 1F5TA 2H6BA 3CP8A 1J09A 1LDJA 5ICCA 4OIOF 3CWRA 4HF2A 4HG2A 5GPAA 4MTEA 3QOEA 3CMAI 4OMYA 2OI8A 1B8IA 4QWQA 1IN5A 3PO2J 2XAUA 3OOPA 1T8IA 1FX7A 3D5LA 4XSZF 5FLVA 3S32A 2ACJA 1FOYA 2HYGD 3UNGC 4HNUA 1RR8C 3A01B 5D6FA 4CICA 2QCOA 3G1OA 1QVTA 2H27A 3K4CA 3HG9A 2IRFG 3DBLB 2F48A 3IP4B 1RI7A 3HIMA 3ESWB 3I64A 2NAZA 1Q1VA 4UB8C 4IRVA 2M4GA 2FBKA 3CJRB 4XK4A 3S2WA 1QHGA 1G3SA 3AL0B 2EFWA 4PCQA 2O9LA 4GDFA 4HSTA 2HKOA 3ZN0A 3T1BA 4ZDPA 3L2WA 3ABMH 1FY7A 5J3LA 2FX0A 2ZSHB 5FRNA 2FU4A 2KHMA 3FXJA 4XKCA 5ILVA 1RETA 2OC6A 4PJJA 2HDWA 2HFHA 3BG3A 4BQAA 2MC3A 4M73A 4ZZDA 3IH4A 1WHUA 2DA4A 3CCVI 1YTYA 3S5RA 1TWCJ 5IP6A 2R7QA 1FMVA 1ZG1A 2BE5F 5KVRA 5DDGA 1HKTA 2Q1ZB 2IP2A 3VW0A 1IN7A 4B47A 3OYCA 2LC2A 3ON2A 2CFXA 3CCRI 4BDYA 2LR8A 4BNCA 3KKCA 2IA2A 1U78A 2KIQA 1JKRC 3NEUA 1R00A 5B5EC 2XAHA 4MEXF 1KGSA 2RDPA 2BBYA 3GXOA 2YR2A 4G9YA 3LAJA 2X4HA 2QQ9A 4EM0B 1MBHA 4BS9A 3BR0A 4BU2A 5BMZA 1I6XA 3DPLC 4A12A 1ITYA 4O6JA 1WH5A 3BQZA 1CQTA 2YVHA 4FHTA 2KISA 3S93A 1YX5A 1A36A 3DKWA 5EEAA 1RKWA 1MMNA 4QTRA 3K4KA 4I02A 4M71A 5EGOA 1TTYA 2TCTA 3OYBA 1HKSA 2NVXJ 3EYIA 2MYSA 3VW2A 3K4JA 2IS4A 2IBDA 2WAQA 4RGSA 3Q0WA 4Y52J 2EV0A 2VQGA 3GUDA 2VUMJ 2DQLA 3R60A 5TISC 3W2WA 4DYQA 3B73A 3E7LA 3GMEA 1UB9A 2RC4A 2Q8KA 1UJ8A 3LA2A 2ESHA 3TO6A 1SD6A 4XR6A 4A0YA 2K9QA 1WJEA 4B09A 2O6GE 4IPAA 1Y6IA 3A0BC 2XDNA 2GM4A 2AO9A 3LMMA 1QZEA 2P7VB 4NC7A 4DYCA 1MMDA 1B6AA 5FD6A 2QBYB 3GTGJ 4BACA 1PYVA 3ASNH 4IX7A 1ZRDA 5JHFA 2Y0MA 1Z6RA 2M30A 3LQRA 3S1NJ 2JJ7A 2KRHA 2M9HA 1PUFB 2B7EA 3SWHA 1TBXA 1YRNB 4L5EA 1USTA 5GPCA 3JSPA 3LSIA 3GZ6A 1AHDP 4LJZF 2HR3A 3C2HA 3HPGA 3CCMI 2PJRB 1HLVA 3HUGB 5BS6A 1IF1A 3GW2A 3QAHA 1VQLI 4CCNA 4KT5C 1RUNA 1J59A 2ZC2A 3NRGA 2VJIA 1IZ1A 3QWLA 3RD3A 4XL9A 4P1WA 4N9IA 2Z9OA 2RVCA 3K1NA 2X48A 1XC5A 2ZOYA 3VB2A 2PLYA 1FZPB 1BI3A 2VE9A 2KZGA 4DIQA 3VWBA 3MFKA 2MLGA 3AG3H 1OYIA 3S3MA 3FK6A 3OWTA 4BQOA 4HV5A 1A31A 5D4RA 1SFEA 2ZMEA 3WODF 1E2XA 5J40A 1ZGJA 4IHXA 1IDYA 4BH9A 5DAJA 3P9IA 3QP5A 1TQMA 4P5OA 2PMZA 1ULYA 2V9PA 3IWFA 2PZ9A 1R22A 3HOXJ 1R9TJ 5JHUA 3IH2A 3PSFA 5E1WA 4KNYA 3G73A 1Y8RB 3U21A 2E60A 5JFRA 2HTSA 2XRLA 1YW9A 3IWZA 2FQ4A 5JLWA 3WG9A 2QYOA 3M8EA 3OMYA 3NWTA 3OOUA 3QRFF 4J01A 3LFUA 1PP8F 4D9JA 3VOEA 5FB2A 3F23A 3COLA 2ESNA 4I0BA 2DODA 2L01A 3F9KA 3A01A 3DLLF 2DMPA 2D5VA 3OS0A 1X2NA 5HAWA 3HE0A 3ABUA 2UV1A 2D2WA 3CP2A 4IOAF 2XPWA 1TW3A 2VOPA 2BXYA 4C2MA 3VW1A 4HSRA 3RDIA 2WC2A 1JUSA 1ZG3A 2P81A 2QWWA 3I3LA 1O3TA 3L00A 3ZMTA 2HYJA 4FQGA 1AKHB 3WGIA 2IGNA 2ZCNA 3F8BA 2IS1A 5H9TA 4BL0B 2QVOA 4L62A 3FKIJ 3G56A 2EFNA 3O2PE 5IYCJ 2VE8A 5F08A 3O6BB 5EZGA 1D5YA 2EJRA 4OMZA 3A03A 2MABA 1R23A 2OZ6A 3JCUC 4Q48A 5DM6F 3MKZA 1NK3P 5LGUA 2HOSA 2PJPA 1UG2A 3BWGA 3OYJA 1FTZA 1B1BA 1T2KA 3OR2C 3WG7H 3L2CA 3E6CC 2JA8J 2CQKA 3J7ZI 3PNYA 2DYRH 4RLFA 1QPMA 4BJ5C 1OYWA 4XNFA 5J1RA 4CCMA 3OIOA 2BY3A 2EB7A 3GBGA 1WZ2A 5HNHA 2L54A 2ZO4A 2DMQA 4EATA 2UXUA 5J1YA 1XGMA 2WAEA 3FRQA 4CUGA 1T08B 2ZFUA 1JKOC 4DVYP 4WXHA 2Y75A 3L2QA 3PL8A 2BXZA 5K7FA 3PJRA 4G12A 2M34A 2GENA 4CDGA 5BNGA 4UVAA 2DN0A 3U1DA 3LJLA 5LFAA 1RPWA 3B6AA 3SZGA 2BVLA 5FGLA 3BRUA 1P4XA 2CJJA 1HKQA 2AXLA 2KPMA 3QP6A 4HF1A 1OR7C 2D1VA 4UVCA 4GFLA 3I59B 1Z3YA 2X6OA 3K1MA 3VVXA 1SFXA 2XKPA 3MVPA 1R36A 2ETHA 5GAEJ 3LQQA 1K78B 1V54H 4DJAA 1QRYA 2F5FA 3OYKA 4PJNA 2IEKA 5K5QA 2XIGA 3C18A 2R7FA 1GDTA 1QA6A 2VPLA 2NVQJ 4UVBA 4GYIA 3O3KA 2HWVA 1RIOH 4MLOA 4YG2F 4I6ZA 2M45A 4D7NA 1DP7P 3BJBA 2M7BA 5LHIA 3QYFA 1R7JA 3RIRA 4A3KJ 3PM1A 2JVGA 5LD2C 3S15J 4PGHA 2JSPA 4P9FA 4B48A 3CDHA 3MZHA 3TP3A 1WJFA 3WGGA 3HHGA 2A61A 1D8JA 2HYTA 3OYAA 4DGWB 1HOMA 2FEZA 1LVAA 3VOKA 3M8FA 3AG1H 3D1NI 2ADUA 1Y1WJ 5CXIA 1WPKA 4HBLA 4G7ZF 4KN7X 5HNFA 4XLFA 3M1EA 3CD6I 4PSWA 5M5XJ 4ZYHA 1S5LC 1D0XA 1P2FA 3GX4X 1YRNA 3SFZA 1BA5A 1HSTA 3T6NA 1OKRA 2NRAC 1VF9A 1XPXA 1BW5A 4U7BA 2STTA 3DQVC 5FKKA 4EJWA 2HQAA 1RZ4A 3BROA 4P55A 3AQTA 2BY1A 1FTTA 1U2WA 1S29A 1WRJA 4BHBA 2DAOA 2OF7A 3LOCA 1TQPA 4BJTA 2DFIA 2CW8A 3MZ8A 2F5VA 2QENA 3EUHC 1D1BA 2DOAA 3FMRA 3CRJA 3FIWA 2OPTA 2Z99A 1F1ZA 3IHUA 1JGSA 1Z05A 2X0LA 3RJPA 5EJCA 2A5WA 4XRSG 1KU3A 1O7LA 2LLKA 4XSXF 1G8XA 4RB3C 2Y9ZA 3G1LA 1YFHA 3WTVC 3P5JA 3CJDA 1X1CA 1K83J 2MGQA 4CGRA 3KEYA 4C2UA 4X1EA 1SVOA 4UHTA 1G59A 3SDBA 3ERMA 4A3GJ 5F27A 1Z21A 3ABKH 2O7OA 4DBQA 4PGGA 2WV0A 2N8GA 3F22A 1IJWC 1ORKA 4EVIA 2KRCA 4YFKF 1ON1A 5IOZA 1OFCX 1I6HJ 2Y2ZA 4ANJA 3IRRA 5CVUA 1IV8A 1KU2A 1T0FC 3CUQA 2DYSH 3KYCB 5JVGF 4AU7A 1HXDA 2ZXWH 3L9FA 3M4OJ 1SFUA 4L18B 2DW4A 2DU9A 3AAFA 1HC8A 3AG4H 1OCCH 3JRBA 1TL8A 2CH0A 1TWFJ 3H9QA 1K7AA 3IKVA 2V1UA 3BNIA 2IJLA 1N75A 4FE4A 5E8GA 3EUKL 2R7UA 3K4LA 2UXPA 2HOAA 3GFMA 1P4WA 4A3FJ 2XASA 3EUAA 2BYVE 1EA3A 2ZB9A 2XVCA 4L5IA 1FP2A 2DA3A 1P6RA 3D0SA 4LB6B 1FWZA 1FIPA 3RTRA 4ESFA 2K9NA 3DPJA 3HJEA 5A2QK 2DG7A 4BYYA 4FTHA 2R4GA 2PMHA 4ETSA 1BR4A 3ZP5A 1HDPA 4JBAA 4MFDA 4Z6YA 2LH9A 1MBFA 4A3EJ 5BPDA 3DTEA 3FHNA 1H9TA 2NYXA 5A2QZ 3MKWB 3CJQB 4KICA 5IP7J 2MA3A 3HSRA 3KX2A 3HOWJ 2OCEA 2K4BA 4IXAA 1E3HA 5ICFA 3OYEA 3FKJA 1Y8QB 1R6RA 3ZRGA 4U0YA 5E3MA 2A3SA 4BUPA 1VQKI 2OCCH 2HDCA 3SZPA 3UKGA 2FJI1 3K70D 3U2RA 3VYTB 1YO5C 3DPUA 4LIUA 1S7OA 2HVSA 5GADJ 1YIJI 3E7QA 4E4HA 3QPSA 4G6TB 3LA7A 1LFUP 2JRMA 3Q0VA 2PG4A 2IA0A 3ONQA 3U9GA 4IQJA 2QIBA 1MGTA 1U9NA 2PQ8A 4HNVA 4MIMA 2VXDA 3R6SA 2CQNA 3DU6A 3DP7A 3HOZJ 2VKHA 3HB9A 2XGDA 3C07A 5CVRA 1HCRA 5CXGA 4FCYA 5IT3A 1QBJA 1VQ7I 3MQ0A 5JI6A 5IP9J 1W5CC 5HS9A 1HSJA 3ZCOA 2HEOA 4AVPA 4R8HA 4D0PA 1AU7A 2JK3A 2AQEA 2HVQA 2W00A 3O60A 5EGOB 2IU5A 2HZDA 2WADA 3VVZA 1D0ZA 2XDVA 4NC8A 3CO6C 4OD4A 1ZR4A 1X1DA 3TEDA 4EGYA 3HGYA 3OY9A 3OYNA 1JGGA 5F04A 2F4MB 4UY8I 1S7AA 3ZQQA 1BL0A 2VQLA 2BHZA 1BIAA 1OLTA 2DCEA 5D6EA 5ERIA 3CMEI 1ZGAA 2P5KA 4M9XA 2HOEA 4KJZA 1OYYA 5HLHA 5DTDA 5TRDA 4F92B 3A4CA 1E3PA 2W25A 4NUBA 2K85A 3TGNA 1P92A 1GXQA 1PP7U 3LHQA 1W5TA 4LITA 2ME0A 3RKWA 1FC3A 3K2ZA
chains in the Genus database with same CATH topology
3IUVA 3BT9A 1X2MA 3HBLA 2LKXA 3ZOBA 4XRSA 1MBHA 2DA2A 3HOYJ 2FJ1A 2LP0A 2NS8A 3BR0A 3HDDA 5F0FA 3QBMA 3BR3A 1DU6A 1ITYA 5M5WJ 1WH5A 3BQZA 1CQTA 2E2JJ 1P7IA 2YVHA 2Q24A 5D19A 2LD5A 3O8HA 4LOCA 1FJLA 3B6CA 1IV6A 4JX4A 3HTHA 4AC0A 3TW6A 5FJ8J 5C3EJ 4I76A 5EEAA 1ZTRA 3JRAA 1RKWA 2HOTA 2MG4A 5JLXA 4QTRA 1F43A 3GTLJ 1ZR2A 2L9RA 2YS9A 3H0GJ 5EGOA 2TCTA 4ABZA 3ZQCA 2NVXJ 1VNDA 1K61A 3VW2A 3JRHA 2IBDA 1TWGJ 1XS9A 3Q0WA 4Y52J 2YUSA 2VUMJ 1IC8A 4DYQA 3E7LA 3RZDJ 2DA1A 1GT0C 2K9QA 3VP5A 2ELKA 3G1MA 2WGBA 2XDNA 2GM4A 2AO9A 4JX5A 3QPLA 2NVTJ 4S0HB 2O7TA 1JTYA 4C3IJ 3M3YJ 4ACIA 4DYCA 3JREA 2DJNA 3GTGJ 2L7ZA 2D6YA 2L7MP 4XICA 4DW6A 3HTIA 4UDSA 4C3HJ 3S1NJ 2JJ7A 2M9HA 1PUFB 2CUEA 5K7ZA 3NAUA 4IHYA 1IUFA 1YRNB 2AHQA 2RHAA 1OJLA 4L5EA 5GPCA 1AHDP 3S2HJ 3HM5A 5E3OA 3W6VA 3I4MJ 3B81A 4AUXA 3KKDA 1WH7A 4AC6A 1Z77A 1HLVA 1SFOJ 1NK2P 2MSYA 3ZQLA 1GUUA 3NRGA 5FLMJ 2DG8A 5HODA 1I50J 4NDLA 5DS9A 1ZGWA 3RD3A 3OSFA 2R92J 2X48A 4JYKA 1XC5A 3GTQJ 2ZOYA 1MSFC 1GV2A 2Y9YA 2GFNA 1B72B 2HI3A 2NS7A 3MN2A 2F07A 3BG9A 1H8AC 3FK6A 1APLC 2EZKA 2EZIA 2ECBA 1HF0A 2GLOA 2QF7A 3GZIA 4IHXA 3RQIA 1BJZA 1IDYA 2G3BA 3NARA 5EDNA 5DAJA 3LSPA 3S17J 1PUFA 4A3JJ 2PZ9A 3HOXJ 5HBUA 1R9TJ 1JT6A 3IH2A 1T33A 3BR1A 3Q3SA 3TW7A 2UXIA 3BQYA 2NX4A 3VVYA 1DU0A 2DA6A 2XRLA 2NP5A 2FQ4A 5JLWA 3F0CA 1JUPA 1QPIA 3OOUA 4RDUA 2XSDC 3COLA 3BTIA 3RZOJ 3A01A 5IYDJ 3RH2A 2DMPA 2D5VA 1X2NA 5HAWA 3HE0A 2XGEA 4GCTA 2X9DA 3P9TA 4B1RA 1BW6A 2XPWA 2ID6A 3GTOJ 3OSGA 2RASA 3VW1A 5F0HA 3ZQFA 2Y31A 3ZQGA 3ZQHA 4MXMA 4A3IJ 1OCPA 3EUPA 1JUSA 2P81A 2HYJA 1B72A 2YVEA 2DA5A 3TP0A 4CYCB 4A3BJ 3CMYA 4QIWN 1AKHB 2JMWA 4V2GA 4JX6A 2ZCNA 5C4XJ 5M3FJ 3BTCA 4JP0A 3MKLA 3IH3A 5H9TA 3GEUA 4AF5A 4L62A 5EG0B 3FKIJ 3G56A 2E19A 2WAQN 1ZQ3P 5IYCJ 5F08A 3A02A 4AYBN 5EZGA 2ZCXA 1D5YA 3QKXA 3A03A 2XGCA 5FKLA 1NK3P 2HOSA 1O4XA 4HKUA 1UG2A 1FTZA 4XRMA 2R5YB 4Y7NJ 5C4JJ 2JA8J 1RESA 5J1UA 3HEFA 2DMTA 1B8IB 2JA7J 3BR2A 2V57A 4M3EA 2R93J 5J1RA 3OIOA 1T56A 3GTKJ 3GBGA 1ETVA 5K58A 2G7LA 2QKOA 2UXUA 2DMQA 5J1YA 2ECCA 2JA5J 3FRQA 2NVYJ 1ETWA 3BR6A 9ANTA 1JKOC 3GTJJ 5HSZA 4A69C 2DTZA 2JA6J 1ETOA 3NNRA 5K7FA 5AQCA 4NELA 4G12A 1JTXA 2M34A 2GENA 2K40A 5BNGA 3GTPJ 2Y0SN 2DN0A 3BR5A 2O8KA 3LJLA 3H3VK 5M5YJ 4A93J 1RPWA 1TWHJ 2EQRA 3B6AA 3DCFA 3K2AA 5FGLA 4DZPA 1JKPC 3BRUA 2RAEA 2CJJA 5C44J 1AKHA 1MBKA 2W48A 1E3OC 2R5ZB 1LE8B 2ZCMA 4UUSB 4GFLA 1IG7A 2X6OA 3VVXA 5EG0A 1JJ6C 3MVPA 2B63J 4GCKA 1EF4A 2W53A 4FE7A 4M3BA 3S16J 1QRYA 3NI7A 5C4YA 1POGA 3L1PA 1JKQC 2QWTA 3BHQA 1VFCA 5D1RA 1ETKA 2IEKA 4NN1A 3SDGA 1GDTA 2R5YA 4MFEA 2NVQJ 2IAIA 3IV5A 4MLOA 4I6ZA 1UHSA 4D7NA 2VKEA 2HDDA 3BJBA 1U9OA 2GBYA 2LVSA 1RR7A 4A3KJ 3PM1A 2NOGA 2QTQA 3EGQA 1MSEC 1ZKGA 4B3AA 4C2MJ 3S15J 2ME6A 1HDDC 1IRZA 4D5CA 2L0KA 3JRDA 3TP3A 3WHCA 4ME9A 1MBJA 2L7FP 2PMZN 4M6VA 2CRGA 2E2HJ 2HYTA 2NP3A 1HOMA 4M3DA 3VOKA 3D1NI 1Y1WJ 5CXIA 1WPKA 4J19A 5FHPA 3FK7A 2COBA 2QOPA 2XPUA 5M5XJ 3FISA 4DYRA 3ANPA 4JL3A 1YRNA 3K7AJ 3G7RA 1H89C 1BA5A 1LE8A 3T6NA 2TRTA 1VF9A 4W97A 4UUSA 1BW5A 5EF6A 4PXIA 4M3FA 5FKKA 1TC3C 3DEWA 5M3MJ 1W0UA 5F1JA 4M3GA 1WGXA 3AQTA 3Q0UA 2CU7A 3PO3J 1FTTA 4BKXA 3JRGA 2UXOA 4A3MJ 3ZQIA 3I4NJ 2MW8A 2OF7A 4BY1J 1ENHA 2K9SA 3LOCA 2H1KA 1Y1VJ 4JNNA 1ZK8A 5E3LA 3VPRA 5FKMA 4W1UA 5FKNA 4V2FA 1GV5A 3CRJA 3FIWA 2OPTA 2WV1A 2HXIA 1G2HA 3JSJA 1WI3A 4D5FA 1XG1A 3VIBA 2DA7A 3CQZJ 4IHVA 3S1QJ 2OERA 3HKZN 3JR9A 4XRSG 4DZJA 5E3NA 4A3DJ 3KZ9A 2JN6A 2LLKA 2Y9ZA 1UI6A 3G1LA 4FISA 2FD5A 2ID3A 3LSGA 3V78A 1ETYA 3CDLA 2R7ZJ 3CJDA 3NPIA 2LY9A 1K83J 2I10A 2MGQA 4CGRA 2XPVA 3GTMJ 4X1EA 4BBSJ 2DMNA 5FMPA 5EZHA 4A3GJ 5F27A 1UI5A 5F0CA 1TWAJ 2O7OA 3JRIA 2N8GA 1IJWC 1ORKA 1GVDA 2KDZA 3S14J 1NTCA 1JUMA 1ETQA 1OFCX 5IOZA 4XIDA 1I6HJ 3AQSA 3NXCA 1W0TA 1JT0A 3KNWA 2Y2ZA 4D7MA 4ICHA 1OCTC 4IHWA 4X6AJ 3PASA 3C2BA 1SANA 1F36A 1WCMJ 3BTLA 2EH3A 4JKZA 3M4OJ 4A3LJ 2EBIA 5GP9A 5EYRA 2JWTA 3JRBA 2ZOZA 3LNQA 3PPBA 2VPRA 1TWFJ 3S1MJ 3BG5A 1A6IA 3BNIA 4GFKA 2CUFA 3HTAA 5EFYA 5D18A 4FE4A 2XB0X 4UUTA 2UXPA 3VOXA 2HOAA 4MO7A 4A3FJ 4CYCA 3HGGA 1U8BA 1P7JA 4RBOA 2HKUA 2M0CA 2ZB9A 3SJMA 1A5JA 2DA3A 1MNMC 4QSHA 4A3CJ 1FIPA 4GFBA 2K9NA 3DPJA 1H88C 2Y30A 3JRCA 2UXHA 4BBRJ 3HTJA 1Z0XA 1FIAA 2HXOA 3LSRA 1MBEA 2R0QC 4FTHA 3WHBA 2DG7A 2G7SA 4IEJA 2LTPA 2WUIA 3LSJA 1HDPA 2E2IJ 4MFDA 4EEFG 1MBFA 4A3EJ 2CQXA 2E1OA 3RKQA 1MBGA 2REKA 5IP7J 2YU9J 3CWRA 3HOWJ 2HQ5A 5GPAA 5IOYA 2M2EA 2OI8A 1B8IA 3BCGA 2PBXA 3PO2J 2VKVA 1IDZA 5E3MA 3HOUJ 4GCLA 3BTJA 3O8GA 5FLVA 2H8RA 4BY7J 3UKGA 2LK2A 4MK6A 3A01B 2KT0A 2QCOA 3G1OA 3E7QA 1QVTA 3QPSA 4KWAA 1LFUP 3Q0VA 1VI0A 2WB1N 5K7HA 2GUHA 3HIMA 2QIBA 1Q1VA 1U9NA 1MH4A 1S7EA 2EZLA 2VI6A 4HNVA 4XK4A 4MIMA 3S2DJ 3HOZJ 1LFBA 2LFBA 1JJ8C 2FBQA 2O9LA 1X58A 3HB9A 2XGDA 3C07A 5J3LA 1HCRA 5CXGA 2CQQA 2R5ZA 2FX0A 2M8GX 4FCYA 1ETXA 3SFIA 5IPAA 3JRFA 5FKOA 1RETA 5IP9J 3F1BA 2DMUA 5CW8A 1MH3A 3V6GA 3BG3A 3QQAA 3IH4A 1AU7A 2JK3A 1QVUA 4C3JJ 2DA4A 3O60A 5EGOB 2XB5A 1SGMA 2IU5A 3S5RA 1TWCJ 3VVZA 5IYBJ 5IP6A 1ZR4A 3TEDA 3VUQA 3HGYA 3LWJA 3MNLA 1JGGA 5F04A 4YZEA 1FEXA 1BL0A 2G7GA 3ANGA 2G0EA 2EZHA 3ON4A 3VW0A 1RKTA 3HOVJ 3ON2A 3S1RJ 5DTDA 1UMQA 3KKCA 2LR8A 3CCYA 1U78A 1JKRC 1IGNA 1I3QJ 4BXXJ 3LHQA 2ME0A 4B4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IUV A;  3BT9 A;  1X2M A;  3HBL A;  2LKX A;  3ZOB A;  4XRS A;  1MBH A;  2DA2 A;  3HOY J;  2FJ1 A;  2LP0 A;  2NS8 A;  3BR0 A;  3HDD A;  5F0F A;  3QBM A;  3BR3 A;  1DU6 A;  1ITY A;  5M5W J;  1WH5 A;  3BQZ A;  1CQT A;  2E2J J;  1P7I A;  2YVH A;  2Q24 A;  5D19 A;  2LD5 A;  3O8H A;  4LOC A;  1FJL A;  3B6C A;  1IV6 A;  4JX4 A;  3HTH A;  4AC0 A;  3TW6 A;  5FJ8 J;  5C3E J;  4I76 A;  5EEA A;  1ZTR A;  3JRA A;  1RKW A;  2HOT A;  2MG4 A;  5JLX A;  4QTR A;  1F43 A;  3GTL J;  1ZR2 A;  2L9R A;  2YS9 A;  3H0G J;  5EGO A;  2TCT A;  4ABZ A;  3ZQC A;  2NVX J;  1VND A;  1K61 A;  3VW2 A;  3JRH A;  2IBD A;  1TWG J;  1XS9 A;  3Q0W A;  4Y52 J;  2YUS A;  2VUM J;  1IC8 A;  4DYQ A;  3E7L A;  3RZD J;  2DA1 A;  1GT0 C;  2K9Q A;  3VP5 A;  2ELK A;  3G1M A;  2WGB A;  2XDN A;  2GM4 A;  2AO9 A;  4JX5 A;  3QPL A;  2NVT J;  4S0H B;  2O7T A;  1JTY A;  4C3I J;  3M3Y J;  4ACI A;  4DYC A;  3JRE A;  2DJN A;  3GTG J;  2L7Z A;  2D6Y A;  2L7M P;  4XIC A;  4DW6 A;  3HTI A;  4UDS A;  4C3H J;  3S1N J;  2JJ7 A;  2M9H A;  1PUF B;  2CUE A;  5K7Z A;  3NAU A;  4IHY A;  1IUF A;  1YRN B;  2AHQ A;  2RHA A;  1OJL A;  4L5E A;  5GPC A;  1AHD P;  3S2H J;  3HM5 A;  5E3O A;  3W6V A;  3I4M J;  3B81 A;  4AUX A;  3KKD A;  1WH7 A;  4AC6 A;  1Z77 A;  1HLV A;  1SFO J;  1NK2 P;  2MSY A;  3ZQL A;  1GUU A;  3NRG A;  5FLM J;  2DG8 A;  5HOD A;  1I50 J;  4NDL A;  5DS9 A;  1ZGW A;  3RD3 A;  3OSF A;  2R92 J;  2X48 A;  4JYK A;  1XC5 A;  3GTQ J;  2ZOY A;  1MSF C;  1GV2 A;  2Y9Y A;  2GFN A;  1B72 B;  2HI3 A;  2NS7 A;  3MN2 A;  2F07 A;  3BG9 A;  1H8A C;  3FK6 A;  1APL C;  2EZK A;  2EZI A;  2ECB A;  1HF0 A;  2GLO A;  2QF7 A;  3GZI A;  4IHX A;  3RQI A;  1BJZ A;  1IDY A;  2G3B A;  3NAR A;  5EDN A;  5DAJ A;  3LSP A;  3S17 J;  1PUF A;  4A3J J;  2PZ9 A;  3HOX J;  5HBU A;  1R9T J;  1JT6 A;  3IH2 A;  1T33 A;  3BR1 A;  3Q3S A;  3TW7 A;  2UXI A;  3BQY A;  2NX4 A;  3VVY A;  1DU0 A;  2DA6 A;  2XRL A;  2NP5 A;  2FQ4 A;  5JLW A;  3F0C A;  1JUP A;  1QPI A;  3OOU A;  4RDU A;  2XSD C;  3COL A;  3BTI A;  3RZO J;  3A01 A;  5IYD J;  3RH2 A;  2DMP A;  2D5V A;  1X2N A;  5HAW A;  3HE0 A;  2XGE A;  4GCT A;  2X9D A;  3P9T A;  4B1R A;  1BW6 A;  2XPW A;  2ID6 A;  3GTO J;  3OSG A;  2RAS A;  3VW1 A;  5F0H A;  3ZQF A;  2Y31 A;  3ZQG A;  3ZQH A;  4MXM A;  4A3I J;  1OCP A;  3EUP A;  1JUS A;  2P81 A;  2HYJ A;  1B72 A;  2YVE A;  2DA5 A;  3TP0 A;  4CYC B;  4A3B J;  3CMY A;  4QIW N;  1AKH B;  2JMW A;  4V2G A;  4JX6 A;  2ZCN A;  5C4X J;  5M3F J;  3BTC A;  4JP0 A;  3MKL A;  3IH3 A;  5H9T A;  3GEU A;  4AF5 A;  4L62 A;  5EG0 B;  3FKI J;  3G56 A;  2E19 A;  2WAQ N;  1ZQ3 P;  5IYC J;  5F08 A;  3A02 A;  4AYB N;  5EZG A;  2ZCX A;  1D5Y A;  3QKX A;  3A03 A;  2XGC A;  5FKL A;  1NK3 P;  2HOS A;  1O4X A;  4HKU A;  1UG2 A;  1FTZ A;  4XRM A;  2R5Y B;  4Y7N J;  5C4J J;  2JA8 J;  1RES A;  5J1U A;  3HEF A;  2DMT A;  1B8I B;  2JA7 J;  3BR2 A;  2V57 A;  4M3E A;  2R93 J;  5J1R A;  3OIO A;  1T56 A;  3GTK J;  3GBG A;  1ETV A;  5K58 A;  2G7L A;  2QKO A;  2UXU A;  2DMQ A;  5J1Y A;  2ECC A;  2JA5 J;  3FRQ A;  2NVY J;  1ETW A;  3BR6 A;  9ANT A;  1JKO C;  3GTJ J;  5HSZ A;  4A69 C;  2DTZ A;  2JA6 J;  1ETO A;  3NNR A;  5K7F A;  5AQC A;  4NEL A;  4G12 A;  1JTX A;  2M34 A;  2GEN A;  2K40 A;  5BNG A;  3GTP J;  2Y0S N;  2DN0 A;  3BR5 A;  2O8K A;  3LJL A;  3H3V K;  5M5Y J;  4A93 J;  1RPW A;  1TWH J;  2EQR A;  3B6A A;  3DCF A;  3K2A A;  5FGL A;  4DZP A;  1JKP C;  3BRU A;  2RAE A;  2CJJ A;  5C44 J;  1AKH A;  1MBK A;  2W48 A;  1E3O C;  2R5Z B;  1LE8 B;  2ZCM A;  4UUS B;  4GFL A;  1IG7 A;  2X6O A;  3VVX A;  5EG0 A;  1JJ6 C;  3MVP A;  2B63 J;  4GCK A;  1EF4 A;  2W53 A;  4FE7 A;  4M3B A;  3S16 J;  1QRY A;  3NI7 A;  5C4Y A;  1POG A;  3L1P A;  1JKQ C;  2QWT A;  3BHQ A;  1VFC A;  5D1R A;  1ETK A;  2IEK A;  4NN1 A;  3SDG A;  1GDT A;  2R5Y A;  4MFE A;  2NVQ J;  2IAI A;  3IV5 A;  4MLO A;  4I6Z A;  1UHS A;  4D7N A;  2VKE A;  2HDD A;  3BJB A;  1U9O A;  2GBY A;  2LVS A;  1RR7 A;  4A3K J;  3PM1 A;  2NOG A;  2QTQ A;  3EGQ A;  1MSE C;  1ZKG A;  4B3A A;  4C2M J;  3S15 J;  2ME6 A;  1HDD C;  1IRZ A;  4D5C A;  2L0K A;  3JRD A;  3TP3 A;  3WHC A;  4ME9 A;  1MBJ A;  2L7F P;  2PMZ N;  4M6V A;  2CRG A;  2E2H J;  2HYT A;  2NP3 A;  1HOM A;  4M3D A;  3VOK A;  3D1N I;  1Y1W J;  5CXI A;  1WPK A;  4J19 A;  5FHP A;  3FK7 A;  2COB A;  2QOP A;  2XPU A;  5M5X J;  3FIS A;  4DYR A;  3ANP A;  4JL3 A;  1YRN A;  3K7A J;  3G7R A;  1H89 C;  1BA5 A;  1LE8 A;  3T6N A;  2TRT A;  1VF9 A;  4W97 A;  4UUS A;  1BW5 A;  5EF6 A;  4PXI A;  4M3F A;  5FKK A;  1TC3 C;  3DEW A;  5M3M J;  1W0U A;  5F1J A;  4M3G A;  1WGX A;  3AQT A;  3Q0U A;  2CU7 A;  3PO3 J;  1FTT A;  4BKX A;  3JRG A;  2UXO A;  4A3M J;  3ZQI A;  3I4N J;  2MW8 A;  2OF7 A;  4BY1 J;  1ENH A;  2K9S A;  3LOC A;  2H1K A;  1Y1V J;  4JNN A;  1ZK8 A;  5E3L A;  3VPR A;  5FKM A;  4W1U A;  5FKN A;  4V2F A;  1GV5 A;  3CRJ A;  3FIW A;  2OPT A;  2WV1 A;  2HXI A;  1G2H A;  3JSJ A;  1WI3 A;  4D5F A;  1XG1 A;  3VIB A;  2DA7 A;  3CQZ J;  4IHV A;  3S1Q J;  2OER A;  3HKZ N;  3JR9 A;  4XRS G;  4DZJ A;  5E3N A;  4A3D J;  3KZ9 A;  2JN6 A;  2LLK A;  2Y9Z A;  1UI6 A;  3G1L A;  4FIS A;  2FD5 A;  2ID3 A;  3LSG A;  3V78 A;  1ETY A;  3CDL A;  2R7Z J;  3CJD A;  3NPI A;  2LY9 A;  1K83 J;  2I10 A;  2MGQ A;  4CGR A;  2XPV A;  3GTM J;  4X1E A;  4BBS J;  2DMN A;  5FMP A;  5EZH A;  4A3G J;  5F27 A;  1UI5 A;  5F0C A;  1TWA J;  2O7O A;  3JRI A;  2N8G A;  1IJW C;  1ORK A;  1GVD A;  2KDZ A;  3S14 J;  1NTC A;  1JUM A;  1ETQ A;  1OFC X;  5IOZ A;  4XID A;  1I6H J;  3AQS A;  3NXC A;  1W0T A;  1JT0 A;  3KNW A;  2Y2Z A;  4D7M A;  4ICH A;  1OCT C;  4IHW A;  4X6A J;  3PAS A;  3C2B A;  1SAN A;  1F36 A;  1WCM J;  3BTL A;  2EH3 A;  4JKZ A;  3M4O J;  4A3L J;  2EBI A;  5GP9 A;  5EYR A;  2JWT A;  3JRB A;  2ZOZ A;  3LNQ A;  3PPB A;  2VPR A;  1TWF J;  3S1M J;  3BG5 A;  1A6I A;  3BNI A;  4GFK A;  2CUF A;  3HTA A;  5EFY A;  5D18 A;  4FE4 A;  2XB0 X;  4UUT A;  2UXP A;  3VOX A;  2HOA A;  4MO7 A;  4A3F J;  4CYC A;  3HGG A;  1U8B A;  1P7J A;  4RBO A;  2HKU A;  2M0C A;  2ZB9 A;  3SJM A;  1A5J A;  2DA3 A;  1MNM C;  4QSH A;  4A3C J;  1FIP A;  4GFB A;  2K9N A;  3DPJ A;  1H88 C;  2Y30 A;  3JRC A;  2UXH A;  4BBR J;  3HTJ A;  1Z0X A;  1FIA A;  2HXO A;  3LSR A;  1MBE A;  2R0Q C;  4FTH A;  3WHB A;  2DG7 A;  2G7S A;  4IEJ A;  2LTP A;  2WUI A;  3LSJ A;  1HDP A;  2E2I J;  4MFD A;  4EEF G;  1MBF A;  4A3E J;  2CQX A;  2E1O A;  3RKQ A;  1MBG A;  2REK A;  5IP7 J;  2YU9 J;  3CWR A;  3HOW J;  2HQ5 A;  5GPA A;  5IOY A;  2M2E A;  2OI8 A;  1B8I A;  3BCG A;  2PBX A;  3PO2 J;  2VKV A;  1IDZ A;  5E3M A;  3HOU J;  4GCL A;  3BTJ A;  3O8G A;  5FLV A;  2H8R A;  4BY7 J;  3UKG A;  2LK2 A;  4MK6 A;  3A01 B;  2KT0 A;  2QCO A;  3G1O A;  3E7Q A;  1QVT A;  3QPS A;  4KWA A;  1LFU P;  3Q0V A;  1VI0 A;  2WB1 N;  5K7H A;  2GUH A;  3HIM A;  2QIB A;  1Q1V A;  1U9N A;  1MH4 A;  1S7E A;  2EZL A;  2VI6 A;  4HNV A;  4XK4 A;  4MIM A;  3S2D J;  3HOZ J;  1LFB A;  2LFB A;  1JJ8 C;  2FBQ A;  2O9L A;  1X58 A;  3HB9 A;  2XGD A;  3C07 A;  5J3L A;  1HCR A;  5CXG A;  2CQQ A;  2R5Z A;  2FX0 A;  2M8G X;  4FCY A;  1ETX A;  3SFI A;  5IPA A;  3JRF A;  5FKO A;  1RET A;  5IP9 J;  3F1B A;  2DMU A;  5CW8 A;  1MH3 A;  3V6G A;  3BG3 A;  3QQA A;  3IH4 A;  1AU7 A;  2JK3 A;  1QVU A;  4C3J J;  2DA4 A;  3O60 A;  5EGO B;  2XB5 A;  1SGM A;  2IU5 A;  3S5R A;  1TWC J;  3VVZ A;  5IYB J;  5IP6 A;  1ZR4 A;  3TED A;  3VUQ A;  3HGY A;  3LWJ A;  3MNL A;  1JGG A;  5F04 A;  4YZE A;  1FEX A;  1BL0 A;  2G7G A;  3ANG A;  2G0E A;  2EZH A;  3ON4 A;  3VW0 A;  1RKT A;  3HOV J;  3ON2 A;  3S1R J;  5DTD A;  1UMQ A;  3KKC A;  2LR8 A;  3CCY A;  1U78 A;  1JKR C;  1IGN A;  1I3Q J;  4BXX J;  3LHQ A;  2ME0 A;  4B4C A; 
#chains in the Genus database with same CATH topology
 5LEJ A;  4BEH B;  3FWE A;  3CO7 C;  3HBL A;  2COM A;  4HRI A;  2IXS A;  2DA2 A;  2NS8 A;  3OL3 A;  5ICE A;  3CMM A;  3OIQ A;  3HDD A;  3QBM A;  1Z91 A;  5HLI A;  3BR3 A;  1REP C;  4JK1 X;  1E17 A;  5M5W J;  4G6Q A;  1P7I A;  3BDD A;  1MIJ A;  2A07 F;  4OOI A;  3LA3 A;  3HSE A;  1IXR C;  4YII A;  1IV6 A;  3KP4 A;  3AKZ A;  1SMY F;  2FNP A;  4AC0 A;  1AOY A;  5D8L B;  5FJ8 J;  3L2U A;  4I76 A;  4IRI A;  3DBH B;  2QKM B;  3VSK A;  2M87 A;  4XLE A;  3JRA A;  1K6O A;  2HOT A;  1F43 A;  1TT5 B;  2C6Y A;  1XB4 A;  3J7Y J;  4CHU A;  3H3Z A;  1T98 A;  3GTL J;  2L9R A;  4KMU X;  1A35 A;  4Z2Y A;  3EPZ A;  1Z67 A;  3OL4 A;  3V7C A;  3JRH A;  2DT7 B;  2ZBK A;  3V7R A;  4AYB A;  2CV0 A;  2VXZ A;  1IRF A;  1FOX A;  4XLC A;  4OAZ A;  2VL8 A;  2VQC A;  1GT0 C;  1FMW A;  4C30 A;  1HW2 A;  4F91 B;  2PEX A;  3H9G A;  4WX9 A;  4D1Q A;  4E7K A;  2ZY9 A;  1JTY A;  2ZME B;  3R0J A;  1LVK A;  4C3I J;  4MGR A;  1IXS B;  4IF4 A;  5L3E A;  3CCS I;  1MZB A;  2CUJ A;  2D6Y A;  4DW6 A;  4FAS D;  1ODD A;  1YX3 A;  4L5J A;  4C3H J;  3W2A A;  3L2R A;  4CH7 A;  2CUE A;  3K10 A;  3F8C A;  3KIO A;  3NAU A;  4RA2 A;  3C2G A;  3HIF A;  4CZC A;  2MD0 A;  2Y0S A;  1OJL A;  3MD2 A;  5CVI A;  3TOB A;  3K9T A;  5E3O A;  2DQR A;  3W6V A;  2BW3 A;  3I4M J;  3B81 A;  1TT0 A;  2KIM A;  5F6F A;  5JR3 A;  3TO7 A;  4E7I A;  4KA4 A;  4UUV A;  1SFO J;  3KCC A;  3H1C A;  3GYH X;  3VEP A;  4LIV A;  1FSH A;  3ZQL A;  4YIR X;  2OTL I;  2L02 A;  3GFJ A;  1NG6 A;  1ZEL A;  1ZGW A;  3F8F A;  5CVV A;  2VT3 A;  4CXF A;  2GXA A;  1B9M A;  3GTQ J;  2OTJ I;  3E5Q A;  3GWZ A;  1MSF C;  2GFN A;  2RNJ A;  1BOA A;  2V1N A;  2ELH A;  3FXR A;  4ZC3 A;  2E5Z A;  3KP5 A;  2O61 A;  1FT9 A;  2EZI A;  3CDI A;  3VTI A;  2FBH A;  1VQP I;  3FMQ A;  1VQ9 I;  3ML6 A;  2DLL A;  3RQI A;  1BJZ A;  2V26 A;  2XUB A;  3NAR A;  2HYF A;  5DEQ A;  3LSP A;  4IVN A;  4GGG A;  4A3J J;  4E7L A;  1JT6 A;  3BOQ A;  1FBQ A;  5KCM A;  4UB6 C;  2X1C A;  1JI8 A;  1DU0 A;  2JUC A;  3VVY A;  1X1A A;  1RRJ A;  2CSO A;  3F0C A;  3KEO A;  3LL7 A;  1WQ2 A;  4B8X A;  2TDX A;  3BTI A;  3RH2 A;  1XDU A;  1K4T A;  1PUE E;  4OWR B;  4WF2 A;  1OMI A;  2HQR A;  4IKF A;  5LHG A;  1OCO H;  4B1R A;  5HDN A;  2VKD A;  2ID6 A;  3GTO J;  1LNW A;  3OSG A;  1U3E M;  5HLG A;  1MDM A;  2Y31 A;  5LEK A;  1OCP A;  2H8W A;  2LF8 A;  3EQL F;  3R61 A;  2GIZ A;  2YVE A;  2DA5 A;  3E3V A;  4LGW A;  3TP0 A;  4CYC B;  3J7A O;  4A3B J;  4V2G A;  2W7N A;  3LFK A;  4ZZL A;  3BTC A;  3W2V A;  3MKL A;  4GYG A;  2DOE A;  3GEU A;  4IRH A;  5H2F C;  1HW5 A;  1ZAR A;  2P5L C;  3GLL A;  1BR1 A;  2WAQ N;  1ZQ3 P;  2ZCX A;  3QKX A;  2L2O A;  1U8R A;  2XGC A;  3HKZ A;  4RAY A;  2OV7 A;  3HOT A;  3N97 A;  2IS6 A;  2M1B A;  4XOP A;  4XKV A;  5C4J J;  5J1U A;  2UUZ A;  1ZLK A;  1OQY A;  4RMN A;  3SHF A;  4HA8 A;  1SAX A;  2KMU A;  4EJT A;  2GOX B;  4A6D A;  1YIO A;  3C1D A;  5J47 A;  1FP1 D;  4OD5 A;  2G7L A;  1LUJ B;  2P6S A;  2ECC A;  4L9V A;  1I1S A;  5L3D A;  3BR6 A;  2PX9 A;  1U0J A;  5HSZ A;  2M7A A;  1V5G A;  2DTZ A;  2KLO A;  3H9J A;  1ETO A;  3U1K A;  2JA6 J;  5AQC A;  4BEH A;  3DLA A;  2EIJ H;  1DDN A;  2K40 A;  2P6T A;  3FBN B;  3QU6 A;  2A05 A;  4HLX A;  3BJ6 A;  3DKY A;  4ZH4 F;  4ZYG A;  5JVT A;  5H20 A;  5BOX A;  4HF0 A;  2R7R A;  2E7W A;  3H3V K;  4QPQ A;  4A93 J;  1YI2 I;  3K2A A;  2K86 A;  2YX7 A;  3P9C A;  4DZP A;  1JKP C;  2RAE A;  5GTI C;  2R5Z B;  1RC9 A;  3WTS C;  1ZG5 A;  1IG7 A;  2FF4 A;  5EG0 A;  2RQP A;  4RM2 A;  1BC8 C;  2B63 J;  4GCK A;  2BY0 A;  2K9M A;  4M3B A;  2O5R A;  3ABT A;  1U5T C;  3L1P A;  1JKQ C;  4F55 A;  5D1R A;  1ETK A;  3JSO A;  1WI9 A;  3BJO A;  1ZYR F;  1OR7 A;  3F3X A;  3SDG A;  4R1H A;  1KON A;  2BEO A;  2IAI A;  3IV5 A;  1O3S A;  1FYM A;  2KIU A;  3WU1 B;  3E5U A;  3PQJ A;  1UHS A;  4E7S A;  3LAP A;  2PFB A;  1U9O A;  2ZXH A;  2LVS A;  1TQI A;  2ZSI B;  1RR7 A;  1YOV B;  3W6K B;  2V6C A;  2NOG A;  3BZC A;  1MSE C;  4XKW A;  1XSX A;  2LOO A;  2JSC A;  3EYY A;  4PSX A;  3TKY A;  2L0K A;  1IN6 A;  1VQ5 I;  3WHC A;  1UFM A;  5KAF C;  2L7F P;  2PMZ N;  4M6V A;  3CCL I;  2E2H J;  2NP3 A;  2DOF A;  2KKO A;  4KFC A;  3IC7 A;  2CW7 A;  1HA8 A;  3H36 A;  5TGT A;  2OA4 A;  5ED4 A;  2COB A;  1PVE A;  2MFZ A;  3KP2 A;  4XOR A;  2WB1 A;  2R7W A;  4PK4 A;  4DYR A;  1X4P A;  4JL3 A;  2QQ8 A;  4XN3 A;  3K7A J;  2RQQ A;  2XSJ C;  3H5N A;  5B66 C;  5TJJ A;  5FLX K;  5AON A;  1QU3 A;  2V4J C;  4UUS A;  2PBI A;  3DPT A;  4M3F A;  1TC3 C;  5FLX Z;  3CUQ B;  3E6D A;  3Q0U A;  4XON A;  3V7S A;  4G94 A;  3FHZ A;  2V6E A;  3PO3 J;  2UXO A;  2JPB A;  2I5U A;  3ZQI A;  2LRE A;  4MTD A;  1K6Y A;  2K9S A;  1H0M A;  1Y1V J;  1XMA A;  1ZK8 A;  2WWY A;  3VPR A;  1YLF A;  4QPO A;  5HS8 A;  5CVJ A;  2XAJ A;  5J8C A;  5FKN A;  1GV5 A;  2V9K A;  1D5V A;  5LRR A;  1UHW A;  3CTA A;  4D5F A;  1XG1 A;  3VIB A;  1QHH D;  2JTV A;  5CQG A;  1P4A A;  3S1Q J;  1EJ9 A;  1GVJ A;  4DQ2 A;  4LB5 A;  2O3F A;  3RSN A;  3JR9 A;  2EIK H;  5E3N A;  3OS1 A;  2RRE A;  3FZV A;  3KP3 A;  2Z33 A;  3WTZ A;  2FD5 A;  2VQH A;  3LSG A;  5E1X A;  4CA0 A;  1ETY A;  3CDL A;  3V78 A;  1AA7 A;  2LY9 A;  1BI1 A;  2ZCW A;  2DFF A;  4CGZ A;  5FMP A;  1E0E A;  2RGV A;  2LY2 A;  2XKO A;  5CLS A;  4F93 B;  2FOK A;  2W57 A;  5CYV A;  4IOC F;  3BZ6 A;  4GXO A;  4HLY A;  3F6O A;  4F7Z A;  4XLA A;  2A6E F;  3ZR8 X;  4DNC A;  3KP7 A;  3IAM 2;  1JT0 A;  3KNW A;  5LGT A;  2O0Y A;  4ICH A;  4U0V A;  4X6A J;  3C2B A;  1F36 A;  1WCM J;  3BTL A;  2CG4 A;  3G3Z A;  2EH3 A;  2L4M A;  4ENJ A;  2K7L A;  4K2E A;  2HKX A;  1CF7 A;  4A5N A;  4L0Z B;  4A3L J;  1MJ9 A;  2EBI A;  2GAU A;  2JWT A;  2FML A;  3HZJ A;  1YJW I;  3PPB A;  3HRT A;  3I54 A;  2ICW G;  5J6X A;  4NC6 A;  3HXL A;  1A6I A;  4OIR F;  1SEU A;  4GFK A;  5EFY A;  2LDU A;  1DQU A;  2XB0 X;  2WAF A;  4II2 A;  1F9N A;  4UUT A;  4N4N B;  5GTH C;  4P9U A;  3HSF A;  2Z3Y A;  4U9L A;  4CYC A;  3KYL A;  2DPD A;  3E1S A;  2OQR A;  3GO5 A;  1U8B A;  2EK5 A;  4RBO A;  1F4K A;  1DP3 A;  2HKU A;  2M0C A;  3L09 A;  4WXD A;  4QSH A;  2CS3 A;  4E7H A;  2VC1 A;  1H88 C;  4BBR J;  4BXF A;  1FSE A;  4ZTF A;  3WHB A;  5L3G A;  1W1W E;  2FRH A;  5IY5 H;  4OU0 A;  1S3J A;  4ZDL A;  2REK A;  1IUY A;  1N77 A;  3WE2 A;  1TLH B;  5IOY A;  2M2E A;  3BCB A;  1YHQ I;  4BQQ A;  2XRO A;  2QQA A;  2F4O B;  3BCG A;  2OUM A;  2VKV A;  1JHF A;  1IDZ A;  1G3W A;  3HOU J;  4NQW A;  4GCL A;  1USS A;  3BTJ A;  3O8G A;  3FM5 A;  2LK2 A;  2LKP A;  3KLO A;  3I56 I;  3WTT C;  1MMG A;  5LLQ A;  4IO9 F;  2DT6 A;  4CO8 A;  1TZL A;  3QYB A;  4QLC U;  2IGK A;  2E1M C;  1VI0 A;  4II3 A;  3ELK A;  4Y17 A;  3E0J B;  5K7H A;  2GUH A;  1IW7 F;  3RI4 A;  4ZYE A;  1MH4 A;  2EZL A;  2VI6 A;  2WY7 Q;  1HQC A;  3S2D J;  1G6N A;  1I27 A;  2G7H A;  2FBQ A;  4IZZ A;  1X58 A;  3GLX A;  2G7U A;  4CCJ A;  1VQ8 I;  4BHP A;  2CQQ A;  2R5Z A;  3FF5 A;  4F3Q A;  3ISP A;  3SFI A;  3QPT A;  1IN4 A;  3F1B A;  5CW8 A;  1MH3 A;  1W36 D;  4MQ9 F;  2OAZ A;  2CUZ A;  1QVU A;  4G6D A;  2M0M A;  2LNB A;  3CUO A;  4L9N A;  2VBY A;  5IYB J;  1IRG A;  2EIM H;  3FM3 A;  3GFL A;  3VUQ A;  4BGD A;  1J5Y A;  4LFU A;  3LWJ A;  2QLZ A;  4UXN A;  4N4O B;  4YZE A;  2QSG X;  2G7G A;  1J0R A;  1WJB A;  2UWM A;  3ANG A;  2G0E A;  2DBB A;  2WY8 Q;  2EZH A;  1OCR H;  5B1B H;  4OIQ F;  2VBW A;  3OR1 C;  1XSV A;  2HPM A;  3S1R J;  1UMQ A;  3HOS A;  4HOB A;  1WSU A;  3ZQ7 A;  3SXY A;  3FXQ A;  1IXC A;  1IGN A;  1I3Q J;  3RQ4 A;  3AL0 C;  2MLK A;  2HU9 A;  2FUG 2;  2Y69 H;  2L9N A;  3FXO A;  2K9L A;  1X2M A;  3BZK A;  2QZ8 A;  2CQ7 A;  1KU7 A;  2GXG A;  2VON A;  3RYR A;  4LMY A;  3GEZ A;  1TNT A;  1Y56 A;  2J5O A;  1R49 A;  2EFO A;  3H0D A;  1SD4 A;  3DF8 A;  2HZT A;  2EIN H;  2Q24 A;  5D19 A;  4YRV A;  2LD5 A;  2BW3 B;  3O8H A;  1FJL A;  2XGX A;  2XRN A;  4JX4 A;  5E1Z B;  5C3E J;  3TW6 A;  3WTX C;  3ERE D;  3FX3 A;  5CJ9 A;  1ZTR A;  2K27 A;  3DWL E;  5DCM A;  3W6J B;  4F52 A;  2P5V A;  2VC0 A;  4B3X A;  2DFH A;  2W24 A;  3H0G J;  2KQR A;  2ZNZ A;  4ABZ A;  3ZQC A;  3IUO A;  2YPR A;  4XBF A;  3VYS B;  4YFN F;  2D45 A;  3FXK A;  3DTK A;  5LHH A;  2VOO A;  1IC8 A;  3CC7 I;  3OYL A;  3JTG A;  2Z1D A;  1YJ9 I;  2P4W A;  2WGB A;  3K4N A;  2E7X A;  4CSW A;  3QPL A;  2FQ3 A;  4S0H B;  3A1Y A;  4NHJ A;  3Q5F A;  3M3Y J;  4ACI A;  1FOK A;  2JA2 A;  2BHY A;  5CPR B;  2P0W A;  2FXA A;  2PFV A;  1I5Z A;  3PNT A;  5HDK A;  4CCO A;  5FO5 A;  3HTI A;  4UDS A;  3SEQ A;  1EV7 A;  2FMY A;  4IJA A;  2VB6 A;  1NHA A;  3DV8 A;  2W85 A;  5K7Z A;  3DFG A;  3N05 A;  1ZRC A;  1SD5 A;  2LKS A;  4IHY A;  1UHM A;  1IUF A;  2M5W A;  2DK8 A;  3MMY B;  4WIB A;  1MMA A;  1YW8 A;  3ZXS A;  4H0E A;  3S2H J;  1MJA A;  3BG7 A;  1SD7 A;  3JAM K;  3MEX A;  1WH7 A;  5LGN A;  1Z77 A;  4L9J A;  3TL4 X;  3HRS A;  4I01 A;  2MSY A;  2XAF A;  2VT2 A;  2ZXI A;  3AFH A;  3JAM Z;  3IRQ A;  2NOJ B;  1X19 A;  4EM1 A;  3VOD A;  4WCG A;  2DG8 A;  3RPU D;  1I50 J;  4NDL A;  5F64 A;  5DS9 A;  4EV0 A;  2R92 J;  1GHC A;  2E71 A;  1D1C A;  1XGN A;  4JYK A;  3ZGK A;  2W4S A;  4KN4 X;  2OD5 A;  1MDM B;  3CC4 I;  2MBF A;  1R5H A;  5H6Q A;  2M4K A;  1GV2 A;  3I0T A;  2HI3 A;  2NS7 A;  3CF5 F;  2E35 A;  3F8N A;  4LG3 A;  2KRF A;  3BG9 A;  1H8A C;  1ONV A;  1XCB A;  1APL C;  3P7N A;  2QA4 I;  3ZMU A;  5J8F A;  2HTJ A;  3WTY C;  4HDV A;  1GXP A;  1HF0 A;  5E17 F;  2QF7 A;  3OYD A;  2CW0 F;  5K5R A;  2VJ5 A;  1DPR A;  2XAG A;  2G3B A;  2V79 A;  3QYE A;  3RPU A;  1FBU A;  3UR3 C;  3S17 J;  4EM2 A;  2DI3 A;  1SFK A;  2CO5 A;  1G3Y A;  5HBU A;  3LST A;  1T33 A;  3BR1 A;  1KYZ A;  2IGO A;  3Q3S A;  3BQY A;  3HHH A;  2NX4 A;  3LSM A;  3HYI A;  1XGO A;  3DKX A;  2DA6 A;  2CWE A;  2V1X A;  3FXU A;  3S3O A;  1RNL A;  1V55 H;  2RN7 A;  4M6Y A;  1B59 A;  1S6L A;  2CFO A;  3M07 A;  4RDU A;  3FMS A;  1KU9 A;  4IL6 C;  3OS2 A;  2BZT A;  1YIT I;  4PFP A;  1SAU A;  2HVR A;  2B1E A;  3F21 A;  3ULQ B;  2XGE A;  5B3S H;  2LF7 A;  3GVA A;  3P9T A;  1BW6 A;  5HDG A;  5KK1 A;  2E34 A;  4BHC A;  3HTS B;  3I58 A;  1QQI A;  3R0A A;  5F0H A;  3ZQF A;  5HLT A;  1UEL B;  3ZQG A;  3EUP A;  2X6X A;  2F5C A;  3VFZ A;  4LG0 A;  1B72 A;  2L7K A;  2LMD A;  5C4X J;  3JTH A;  3KPH A;  5M3F J;  4JP0 A;  2X1E A;  5EG0 B;  2E19 A;  3OYG A;  1X3U A;  3REO A;  1J2X A;  4AYB N;  4Q47 A;  2HNH A;  5E8I A;  4ZYA A;  2EA4 A;  2Z16 A;  2R7T A;  4E7J A;  4HQM A;  1LPQ A;  4RGR A;  2R7V A;  4Y13 A;  2HPI A;  1MD0 A;  2XHK A;  1YS6 A;  4KMF A;  5GAG J;  3HEF A;  5IT9 K;  3B02 A;  3OYM A;  2JA7 J;  3BR2 A;  2HQN A;  3E6B A;  3GTK J;  1T56 A;  3MAJ A;  5IT9 Z;  2M3A A;  3WTU C;  3MKY B;  2KJC A;  2EFP A;  2JA5 J;  2HGC A;  2IPQ X;  2NVY J;  2YU3 A;  1ETW A;  4DOZ A;  9ANT A;  4HX7 A;  2LRD A;  4A69 C;  2F5E A;  3NNR A;  4NEL A;  4A5M A;  2O03 A;  3PQK A;  1STZ A;  2Y0S N;  3BR5 A;  3HRU A;  5M5Y J;  2EQR A;  3TQN A;  1Z9C A;  2WA0 A;  3DCF A;  2JPC A;  1MBK A;  3OYH A;  1R5G A;  2LG4 A;  4WK8 F;  2ZCM A;  2VLA A;  2BOL A;  4UUS B;  1K4S A;  5KAI C;  1JJ6 C;  1WKM A;  4WXC A;  3NI7 A;  1TW2 A;  5ILU A;  2DT5 A;  1JXS A;  1D1A A;  1LFP A;  1VFC A;  3BHQ A;  2R5Y A;  3K69 A;  2KIF A;  2P7C B;  2MH2 A;  3IAS 2;  4LLL A;  1WVR A;  2HDD A;  3HTU A;  1U5T A;  1JE8 A;  3ECO A;  2VBX A;  3F8M A;  3RKY A;  1PDN C;  4N9H A;  3WU0 A;  4B44 A;  1QZZ A;  3RCO A;  4B3A A;  3PIP F;  4XRF A;  3TBI A;  2QTQ A;  3MWM A;  2LYC A;  2LBF A;  3DBR B;  2ME6 A;  4KIT B;  1NH3 A;  1HDD C;  3JRD A;  2Y48 A;  2PN6 A;  1Z6T A;  4UNO A;  1A04 A;  1Z7L A;  3ZMV A;  1DGR M;  1MNE A;  3JW4 A;  1MW7 A;  4M3D A;  3R4K A;  4I0A A;  1W7P A;  4HX4 A;  3F6V A;  4PJL A;  4J19 A;  2X6W A;  3PNV A;  4BE2 A;  4U87 A;  3DTI A;  1YYV A;  2QOP A;  2XPU A;  3K70 C;  2IA1 A;  1MJB A;  3BCA A;  4IQ4 A;  5FRO A;  2GXB A;  3ANP A;  4C2T A;  2H09 A;  4GCV A;  4HX8 A;  3K6G A;  5D5W B;  1LE8 A;  3NQO A;  4W97 A;  5EF6 A;  2R7D A;  5B1A H;  3DEW A;  5M3M J;  1W0U A;  2X6Y A;  2JQ7 A;  4M3G A;  1G4D A;  3QU3 A;  1CF7 B;  5DV5 A;  4V19 K;  2R7S A;  2BVM A;  3GCM A;  1O3Q A;  2QGU A;  4BKX A;  3I4N J;  1W5S A;  1BBY A;  1D0Y A;  2MW8 A;  5HVQ C;  4BY1 J;  1ENH A;  4OIN F;  2D1H A;  2H1K A;  2IGM A;  4RAF A;  3KZZ A;  4BAY A;  4V2F A;  3ZN1 A;  4WWC A;  1J75 A;  2Z2S B;  3ZMS A;  1OPC A;  2L4A A;  3I55 I;  2A2F X;  2WV1 A;  2FA5 A;  2YX4 A;  1XMK A;  1X3W B;  2DA7 A;  2DTR A;  2VN2 A;  3CCJ I;  4IHV A;  4JQF A;  1BN5 A;  4DBR A;  2OER A;  3HKZ N;  4DZJ A;  3NWS A;  4A0Z A;  2JN6 A;  2KZV A;  1XTA A;  1TP4 A;  1R5I D;  4R79 A;  3CLO A;  4FIS A;  3TMO A;  3V42 A;  2HS5 A;  2GIV A;  2R7Z J;  3NPI A;  3KP6 A;  1SVM A;  1S9H A;  1G3T A;  1Z7U A;  2JVH A;  2XPV A;  3T0Y A;  3GTM J;  2DO7 A;  1ERD A;  4BBS J;  2DMN A;  4EQQ A;  2GOM A;  3H92 A;  3AG2 H;  5ICG A;  5GAH J;  3K0L A;  4EJU A;  3CJT B;  1VQ4 I;  4YIF A;  2KDO A;  4ZJZ A;  1LB2 A;  2KDZ A;  2MC4 A;  2RKH A;  3S14 J;  1JUM A;  3KE2 A;  4PFO A;  4AIK A;  3AQS A;  3NXC A;  2EA2 A;  4NQW B;  1UAA A;  2YSR A;  4IHW A;  3PAS A;  4XOT A;  1VTN C;  1V3F A;  2QSH X;  4LK0 F;  5AIQ A;  5K1Y A;  4JKZ A;  1ZHF A;  3MZY A;  3M1C A;  1V5F A;  5EYR A;  3LNQ A;  2VPR A;  3CLQ A;  1ZN2 A;  2L9S A;  1BIB A;  3HTA A;  3G2B A;  5D18 A;  1XD7 A;  2V9V A;  2EV5 A;  2VIX A;  4U88 A;  3D5R C;  3HL2 A;  3GF2 A;  2J5P A;  2DFE A;  1A6Q A;  3G71 I;  3K1P A;  4TV7 A;  3HGG A;  2K4J A;  4ZDO A;  1BI0 A;  2ZJR F;  1KQ8 A;  3OYI A;  3SJM A;  1A5J A;  2RV8 A;  3CES A;  3FBI B;  4ENK A;  4GFB A;  1IN8 A;  2ISZ A;  4NNJ A;  2ZNY A;  2Y30 A;  4A0X A;  3JRC A;  1U6G A;  4E70 A;  3HTJ A;  1FIA A;  2R0Q C;  4HQE A;  3DEE A;  3D5S C;  4IEJ A;  2CGP A;  2WUI A;  3LSJ A;  2QEX I;  2E2I J;  4EEF G;  2H6C A;  2E1O A;  2RNG A;  3F72 A;  2YU9 J;  4U7D A;  4G7H F;  2HQ5 A;  3CCU I;  2WTE A;  1WJD A;  3KZY A;  4LK1 F;  3ZMD A;  5DD4 A;  2A6T A;  2PBX A;  2CV2 A;  2H8R A;  4BY7 J;  2QKL B;  3C3W A;  4P96 A;  4MK6 A;  1YJN I;  3M7G A;  2A6H F;  1LEA A;  2KT0 A;  3EDP A;  5D4S A;  1LDD A;  2GA2 A;  4KWA A;  3K4M A;  4M9Z A;  2WB1 N;  1XDS A;  2V1D A;  4FX4 A;  1S7E A;  1Y0N A;  1YW7 A;  2Q2E A;  1FNN A;  4M6X A;  2PI0 A;  4YEJ A;  1R1U A;  4O3M A;  1BR2 A;  2JZY A;  2OBP A;  2Z5U A;  3WU2 C;  1LFB A;  2LFB A;  1S72 I;  1JJ8 C;  1X3Z B;  4RM3 A;  2GWR A;  4XLN F;  2M8G X;  1ETX A;  1N25 A;  4EJV A;  3CF2 A;  4A6E A;  4XLP F;  5IPA A;  2ZKZ A;  5FKO A;  3JRF A;  1XMX A;  2DMU A;  5FRM A;  1B9N A;  3LSK A;  3V6G A;  4YEL A;  3QQA A;  3X2Q H;  1Y39 A;  5DCM B;  4C3J J;  2XB5 A;  1BI2 A;  3KET A;  5BPI A;  1SGM A;  1FBS A;  1T38 A;  1ZLJ A;  3Q9V A;  5DD8 A;  3MNL A;  1KZH A;  5D8K B;  1FEX A;  4ITV A;  4BJ6 C;  1JHH A;  3HRM A;  2GA1 A;  3ON4 A;  3PIO F;  2NNY A;  1RKT A;  4ESB A;  3HOV J;  3PFY A;  1LDK B;  1Z1D A;  2M8E A;  1L0O C;  3CCY A;  3BJA A;  5D5V B;  4I7H A;  4BXX J;  3DEU A;  2FOW A;  3EUH A;  4JOM A;  5DCF A;  3DXJ F;  4B4C A;  2X51 A;  1J7K A;  4U0W A;  3IUV A;  3T8R A;  5KNL A;  3BT9 A;  2LKX A;  4PJM A;  4LLG F;  3ZOB A;  4XRS A;  3HOY J;  4HEA 2;  2FJ1 A;  2LP0 A;  2JRT A;  5F0F A;  1I3A A;  1KA8 A;  3RKX A;  2ZFW A;  1ZRE A;  1DU6 A;  3A0H C;  4ZYD A;  4HDU A;  2E2J J;  4I09 A;  4ESJ A;  5BQT A;  1D3Y A;  1EH8 A;  3BLY A;  4MNU A;  4PJ0 C;  4GO1 A;  4LOC A;  3B6C A;  3SZT A;  5HOO A;  1SC7 A;  3HTH A;  3M8J A;  5FGM A;  2XF5 A;  3FXM A;  3N4M A;  3MCZ A;  4S04 A;  4AWX B;  2MG4 A;  5JLX A;  1DGW Y;  2X85 A;  4KIG A;  1ZR2 A;  2YS9 A;  4UV9 A;  1K79 A;  6PAX A;  1X1B A;  1VND A;  1K61 A;  2BGC A;  3COA C;  4BDZ A;  1TWG J;  4N0B A;  4C9Y A;  1P9Q C;  1XS9 A;  2YUS A;  2E36 A;  3Q9S A;  1T0F A;  5H6R A;  3RZD J;  1HW1 A;  2DA1 A;  1VQ6 I;  3KLN A;  2KP6 A;  3QOD A;  4BE0 A;  3VSL A;  2B9S A;  2ELK A;  3VP5 A;  3G1M A;  1S8N A;  4JX5 A;  2ELJ A;  2NVT J;  1KQ9 A;  2O7T A;  3IKT A;  5J4V A;  1YS7 A;  4Y4R A;  3CCE I;  3I53 A;  4ASN A;  4U9N A;  4E7Z A;  4LLN A;  2H94 A;  3JRE A;  2DJN A;  1EH7 A;  2L3D A;  2L7Z A;  2L7M P;  3BG6 A;  4XIC A;  1CGP A;  2VJ4 A;  2W82 A;  3I5U A;  1ON2 A;  2KJB A;  1FOW A;  3NRV A;  1NG7 A;  5DUK A;  2DJI A;  4G8X A;  4FT8 A;  2QSF X;  3V8J A;  3KEQ A;  2AHQ A;  2RHA A;  1QZY A;  4KUM A;  3HM5 A;  2R3S A;  4AUX A;  3KKD A;  4Y33 A;  3PUF A;  1MMS A;  4AC6 A;  2CV1 A;  2A68 F;  1NK2 P;  3PFI A;  2EIL H;  1GUU A;  2VAS A;  5FLM J;  2IVM A;  4M72 A;  5HOD A;  1T6S A;  3FDY A;  1MND A;  3OSF A;  2ZJP F;  2DK5 A;  2ZME C;  4M9S A;  3G4S I;  1KYW A;  1MKM A;  2A5Y B;  2Y9Y A;  1B72 B;  4LG0 B;  3J7A Y;  2OZU A;  3MN2 A;  2VOD A;  2F07 A;  2F6C A;  2F2E A;  4AID A;  3CJN A;  2EZK A;  2FSW A;  1PJR A;  2AXT C;  2ECB A;  4G7O F;  2GLO A;  4ZTJ A;  2QBY A;  3GZI A;  3LSH A;  4NBQ A;  4AIH A;  3ABL H;  4HZF A;  5EDN A;  4AD9 A;  3BY6 A;  1Z3X A;  1PUF A;  1FYK A;  4RB0 A;  4HV6 A;  1WJC A;  2ZJ2 A;  1R4N B;  1ZRF A;  2KL4 A;  1I1G A;  1XGS A;  3TW7 A;  3BP8 A;  2UXI A;  5CKT A;  2AS5 F;  4YFX F;  2NP5 A;  5L3F A;  1JUP A;  3WE3 A;  1QPI A;  1T39 A;  5KHD A;  4H4K C;  1QO0 D;  2XSD C;  3GFI A;  2PJR A;  4KDP A;  3HUG A;  2K3F A;  1H9G A;  4XQF A;  3RZO J;  5IYD J;  2V7F A;  1LQ1 A;  4HAM A;  1YQA A;  3H5A A;  2CYY A;  4GCT A;  2X9D A;  1DUX C;  1DPU A;  2ISY A;  4IHS A;  2XC7 A;  4J00 A;  1UZC A;  2RAS A;  1D8K A;  4KT6 A;  2I8D A;  1SVL A;  3ZQH A;  4MXM A;  4RGX A;  4A3I J;  5EEH A;  4PDK A;  1X4O A;  2LY1 A;  2FNA A;  4I2O A;  3CMY A;  4QIW N;  1WJ5 A;  2JMW A;  4JX6 A;  4BQN A;  4XKB A;  2DXI A;  3WTW C;  2FE3 A;  2IW5 A;  1YG2 A;  3IH3 A;  4AF5 A;  4KIF A;  2R7O A;  3V8L A;  4UV8 A;  1EKE A;  3A02 A;  2E5N A;  5FKL A;  3TO9 A;  3L2V A;  2IS2 A;  1O4X A;  4HKU A;  4ENM A;  4XRM A;  2R5Y B;  1C0W A;  1IO2 A;  2X1D A;  4Y7N J;  5E18 F;  1RES A;  3V4G A;  2PMU A;  3ZMZ A;  4XM3 A;  2G9W A;  4KIS A;  4Y15 A;  2GQQ A;  2R7X A;  4E6K G;  3RPQ A;  2MH9 A;  2DMT A;  1U5T B;  3P9K A;  4RAZ A;  3T8T A;  1B8I B;  4ENN A;  2V57 A;  2MD5 A;  4M3E A;  2R93 J;  3NS4 A;  1UCR A;  1ETV A;  5K58 A;  2QKO A;  1ZAO A;  2AQF A;  2LBF B;  4IRG A;  1SMT A;  3GTJ J;  1R4M B;  2XV4 S;  3OYF A;  2JUG A;  2STW A;  4Q5S F;  3SYT A;  2VJJ A;  1JTX A;  1W7P B;  4L0Y B;  5K5O A;  4BE1 A;  3GTP J;  5CQE A;  2O8K A;  3W3C A;  1FPQ A;  5F1R A;  4CCL A;  2A69 F;  3S3N A;  2CMP A;  1TWH J;  3BPX A;  4RAG A;  4IHT A;  1M1E B;  2F4I A;  1Y0U A;  4RGU A;  4ON0 A;  2EPF A;  5C44 J;  1AKH A;  2W48 A;  2EWN A;  1E3O C;  1LE8 B;  4EGZ A;  1LEB A;  3GZ5 A;  4AVZ A;  2Q0O A;  4XLH A;  1R58 A;  4I99 C;  2EFQ A;  1BM9 A;  2K3P A;  2QUF A;  2ZJQ F;  3ASO H;  1EF4 A;  2W53 A;  4FE7 A;  3S16 J;  4RB1 A;  5C4Y A;  2O8X A;  1POG A;  2DDA A;  1VQO I;  5FFX A;  3QOP A;  2QWT A;  2IT0 A;  3J81 K;  4NN1 A;  3T5X A;  3S8P A;  4MFE A;  2BV6 A;  5DM7 F;  3J80 K;  2DDB A;  3TOA A;  1OIS A;  3SQN A;  4S05 A;  3J81 Z;  2VKE A;  3H5R A;  2XF6 A;  3OV8 A;  4FET A;  1BJA A;  3J80 Z;  3ECH A;  2GBY A;  2L5Q A;  3H35 A;  4MEY F;  4FX0 A;  3EGQ A;  1ZKG A;  2L9V A;  4C2M J;  3H3U A;  1V5E A;  4M74 A;  3C7J A;  2QM3 A;  1IRZ A;  5ILS A;  4D5C A;  2NNN A;  3HC7 A;  1R1T A;  4ME9 A;  1MBJ A;  2CRG A;  3DU5 A;  2LSO A;  1WWX A;  3CC2 I;  3CCQ I;  4RB2 C;  2K5C A;  4MHG A;  3L7W A;  3KFW X;  1WFX A;  2ZXJ A;  4A2U A;  1YE9 A;  1KQ0 A;  5FHP A;  3FK7 A;  5E20 A;  4NB5 A;  1X1P A;  2W84 A;  1VZ0 A;  1O7F A;  1EH6 A;  2NS0 A;  3FIS A;  5LBQ A;  4CCK A;  2FBI A;  3G7R A;  4AIJ A;  3VDX A;  1H89 C;  2XAQ A;  1OCZ H;  1R71 A;  4AM3 A;  2TRT A;  2WBM A;  4OIP F;  2F5D A;  3I59 A;  4PXI A;  2OQG A;  4KYW A;  5F1J A;  1BOB A;  1K78 A;  1WGX A;  1N78 A;  1LJ9 A;  1RUO A;  2B3W A;  2CU7 A;  5L3B A;  4HW0 A;  3JRG A;  4A3M J;  2B0L A;  2H1L A;  5D5X B;  3V8K A;  1QGP A;  4JNN A;  1WJA A;  5HS7 A;  1I39 A;  2P8T A;  3SEZ A;  5E3L A;  5FKM A;  4X0G A;  4W1U A;  2E1C A;  1IRX A;  3EET A;  4RS8 A;  4BXU A;  2KFD A;  3LWF A;  5J4Y A;  2UZK A;  2HXI A;  1W36 C;  1G2H A;  1WI3 A;  3JSJ A;  3CZ6 A;  4LD5 A;  3WGH A;  4CYD A;  1VQN I;  3CQZ J;  2NXN B;  1XX5 A;  5DYM A;  5EEG A;  3BC8 A;  3I4P A;  2UXX A;  3IL2 A;  3I9V 2;  4A3D J;  1TNS A;  3KZ9 A;  4EMS A;  1FLI A;  2UXN A;  2XF7 A;  1UI6 A;  1O57 A;  1XN7 A;  3FXL A;  2GZW A;  3OIP A;  5FFZ A;  5FD5 A;  2ID3 A;  3E5X A;  3A2K A;  2I10 A;  1B4A A;  2DPU A;  4GRI A;  2QQB A;  5EZH A;  1L3L A;  3CUQ C;  4OAY A;  1UI5 A;  5F0C A;  1TWA J;  3JRI A;  3HPH A;  1XCV A;  5E79 C;  1GVD A;  2JT1 A;  4Y3O A;  1UG0 A;  4CZZ A;  1NTC A;  3G6E I;  3ZPL A;  1ETQ A;  4XID A;  3K8P C;  1O3R A;  1J9I A;  1W0T A;  1T95 A;  1ZH5 A;  3E6M A;  3VYU B;  4D7M A;  3TDU C;  1AWC A;  1OCT C;  1SAN A;  1VQM I;  3PUB A;  2E1N A;  1GLN A;  3PSI A;  3ROU A;  2K02 A;  4KIB A;  5GP9 A;  1XSD A;  4O5V A;  1IAW A;  4XMY A;  2ZOZ A;  2NVU B;  5D5U B;  2VBZ A;  3I71 A;  4L9T A;  3S1M J;  1HBX G;  2EV6 A;  3BG5 A;  1R1V A;  2CUF A;  4MQV A;  1W4M A;  3RYP A;  2Q2E B;  3GZN B;  4HNT A;  4B43 A;  1BC7 C;  3M9A A;  4HYE A;  1Q1H A;  5L3C A;  5AIP A;  1ACI A;  4XN0 A;  4RLQ A;  2BY2 A;  2W1O A;  1V4R A;  3VOX A;  2E1M B;  4MO7 A;  5LRS A;  4PZJ A;  4PUS A;  1P7J A;  4Q4Z F;  4I98 B;  3KZI C;  1MNM C;  4A3C J;  3BPV A;  2OU2 A;  2UXH A;  3K4B A;  1QNT A;  1Z0X A;  2HXO A;  1W7P D;  1MBE A;  3E97 A;  3LSR A;  2G7S A;  2LTP A;  3KYD B;  2OJE D;  4EJO A;  3QPH A;  2CQX A;  5DUI A;  4HPQ A;  1LKX A;  3TDZ C;  3RKQ A;  2YVX A;  1FYL A;  1MBG A;  3VYR B;  1F5T A;  2H6B A;  3CP8 A;  1J09 A;  1LDJ A;  5ICC A;  4OIO F;  3CWR A;  4HF2 A;  4HG2 A;  5GPA A;  4MTE A;  3QOE A;  3CMA I;  4OMY A;  2OI8 A;  1B8I A;  4QWQ A;  1IN5 A;  3PO2 J;  2XAU A;  3OOP A;  1T8I A;  1FX7 A;  3D5L A;  4XSZ F;  5FLV A;  3S32 A;  2ACJ A;  1FOY A;  2HYG D;  3UNG C;  4HNU A;  1RR8 C;  3A01 B;  5D6F A;  4CIC A;  2QCO A;  3G1O A;  1QVT A;  2H27 A;  3K4C A;  3HG9 A;  2IRF G;  3DBL B;  2F48 A;  3IP4 B;  1RI7 A;  3HIM A;  3ESW B;  3I64 A;  2NAZ A;  1Q1V A;  4UB8 C;  4IRV A;  2M4G A;  2FBK A;  3CJR B;  4XK4 A;  3S2W A;  1QHG A;  1G3S A;  3AL0 B;  2EFW A;  4PCQ A;  2O9L A;  4GDF A;  4HST A;  2HKO A;  3ZN0 A;  3T1B A;  4ZDP A;  3L2W A;  3ABM H;  1FY7 A;  5J3L A;  2FX0 A;  2ZSH B;  5FRN A;  2FU4 A;  2KHM A;  3FXJ A;  4XKC A;  5ILV A;  1RET A;  2OC6 A;  4PJJ A;  2HDW A;  2HFH A;  3BG3 A;  4BQA A;  2MC3 A;  4M73 A;  4ZZD A;  3IH4 A;  1WHU A;  2DA4 A;  3CCV I;  1YTY A;  3S5R A;  1TWC J;  5IP6 A;  2R7Q A;  1FMV A;  1ZG1 A;  2BE5 F;  5KVR A;  5DDG A;  1HKT A;  2Q1Z B;  2IP2 A;  3VW0 A;  1IN7 A;  4B47 A;  3OYC A;  2LC2 A;  3ON2 A;  2CFX A;  3CCR I;  4BDY A;  2LR8 A;  4BNC A;  3KKC A;  2IA2 A;  1U78 A;  2KIQ A;  1JKR C;  3NEU A;  1R00 A;  5B5E C;  2XAH A;  4MEX F;  1KGS A;  2RDP A;  2BBY A;  3GXO A;  2YR2 A;  4G9Y A;  3LAJ A;  2X4H A;  2QQ9 A;  4EM0 B;  1MBH A;  4BS9 A;  3BR0 A;  4BU2 A;  5BMZ A;  1I6X A;  3DPL C;  4A12 A;  1ITY A;  4O6J A;  1WH5 A;  3BQZ A;  1CQT A;  2YVH A;  4FHT A;  2KIS A;  3S93 A;  1YX5 A;  1A36 A;  3DKW A;  5EEA A;  1RKW A;  1MMN A;  4QTR A;  3K4K A;  4I02 A;  4M71 A;  5EGO A;  1TTY A;  2TCT A;  3OYB A;  1HKS A;  2NVX J;  3EYI A;  2MYS A;  3VW2 A;  3K4J A;  2IS4 A;  2IBD A;  2WAQ A;  4RGS A;  3Q0W A;  4Y52 J;  2EV0 A;  2VQG A;  3GUD A;  2VUM J;  2DQL A;  3R60 A;  5TIS C;  3W2W A;  4DYQ A;  3B73 A;  3E7L A;  3GME A;  1UB9 A;  2RC4 A;  2Q8K A;  1UJ8 A;  3LA2 A;  2ESH A;  3TO6 A;  1SD6 A;  4XR6 A;  4A0Y A;  2K9Q A;  1WJE A;  4B09 A;  2O6G E;  4IPA A;  1Y6I A;  3A0B C;  2XDN A;  2GM4 A;  2AO9 A;  3LMM A;  1QZE A;  2P7V B;  4NC7 A;  4DYC A;  1MMD A;  1B6A A;  5FD6 A;  2QBY B;  3GTG J;  4BAC A;  1PYV A;  3ASN H;  4IX7 A;  1ZRD A;  5JHF A;  2Y0M A;  1Z6R A;  2M30 A;  3LQR A;  3S1N J;  2JJ7 A;  2KRH A;  2M9H A;  1PUF B;  2B7E A;  3SWH A;  1TBX A;  1YRN B;  4L5E A;  1UST A;  5GPC A;  3JSP A;  3LSI A;  3GZ6 A;  1AHD P;  4LJZ F;  2HR3 A;  3C2H A;  3HPG A;  3CCM I;  2PJR B;  1HLV A;  3HUG B;  5BS6 A;  1IF1 A;  3GW2 A;  3QAH A;  1VQL I;  4CCN A;  4KT5 C;  1RUN A;  1J59 A;  2ZC2 A;  3NRG A;  2VJI A;  1IZ1 A;  3QWL A;  3RD3 A;  4XL9 A;  4P1W A;  4N9I A;  2Z9O A;  2RVC A;  3K1N A;  2X48 A;  1XC5 A;  2ZOY A;  3VB2 A;  2PLY A;  1FZP B;  1BI3 A;  2VE9 A;  2KZG A;  4DIQ A;  3VWB A;  3MFK A;  2MLG A;  3AG3 H;  1OYI A;  3S3M A;  3FK6 A;  3OWT A;  4BQO A;  4HV5 A;  1A31 A;  5D4R A;  1SFE A;  2ZME A;  3WOD F;  1E2X A;  5J40 A;  1ZGJ A;  4IHX A;  1IDY A;  4BH9 A;  5DAJ A;  3P9I A;  3QP5 A;  1TQM A;  4P5O A;  2PMZ A;  1ULY A;  2V9P A;  3IWF A;  2PZ9 A;  1R22 A;  3HOX J;  1R9T J;  5JHU A;  3IH2 A;  3PSF A;  5E1W A;  4KNY A;  3G73 A;  1Y8R B;  3U21 A;  2E60 A;  5JFR A;  2HTS A;  2XRL A;  1YW9 A;  3IWZ A;  2FQ4 A;  5JLW A;  3WG9 A;  2QYO A;  3M8E A;  3OMY A;  3NWT A;  3OOU A;  3QRF F;  4J01 A;  3LFU A;  1PP8 F;  4D9J A;  3VOE A;  5FB2 A;  3F23 A;  3COL A;  2ESN A;  4I0B A;  2DOD A;  2L01 A;  3F9K A;  3A01 A;  3DLL F;  2DMP A;  2D5V A;  3OS0 A;  1X2N A;  5HAW A;  3HE0 A;  3ABU A;  2UV1 A;  2D2W A;  3CP2 A;  4IOA F;  2XPW A;  1TW3 A;  2VOP A;  2BXY A;  4C2M A;  3VW1 A;  4HSR A;  3RDI A;  2WC2 A;  1JUS A;  1ZG3 A;  2P81 A;  2QWW A;  3I3L A;  1O3T A;  3L00 A;  3ZMT A;  2HYJ A;  4FQG A;  1AKH B;  3WGI A;  2IGN A;  2ZCN A;  3F8B A;  2IS1 A;  5H9T A;  4BL0 B;  2QVO A;  4L62 A;  3FKI J;  3G56 A;  2EFN A;  3O2P E;  5IYC J;  2VE8 A;  5F08 A;  3O6B B;  5EZG A;  1D5Y A;  2EJR A;  4OMZ A;  3A03 A;  2MAB A;  1R23 A;  2OZ6 A;  3JCU C;  4Q48 A;  5DM6 F;  3MKZ A;  1NK3 P;  5LGU A;  2HOS A;  2PJP A;  1UG2 A;  3BWG A;  3OYJ A;  1FTZ A;  1B1B A;  1T2K A;  3OR2 C;  3WG7 H;  3L2C A;  3E6C C;  2JA8 J;  2CQK A;  3J7Z I;  3PNY A;  2DYR H;  4RLF A;  1QPM A;  4BJ5 C;  1OYW A;  4XNF A;  5J1R A;  4CCM A;  3OIO A;  2BY3 A;  2EB7 A;  3GBG A;  1WZ2 A;  5HNH A;  2L54 A;  2ZO4 A;  2DMQ A;  4EAT A;  2UXU A;  5J1Y A;  1XGM A;  2WAE A;  3FRQ A;  4CUG A;  1T08 B;  2ZFU A;  1JKO C;  4DVY P;  4WXH A;  2Y75 A;  3L2Q A;  3PL8 A;  2BXZ A;  5K7F A;  3PJR A;  4G12 A;  2M34 A;  2GEN A;  4CDG A;  5BNG A;  4UVA A;  2DN0 A;  3U1D A;  3LJL A;  5LFA A;  1RPW A;  3B6A A;  3SZG A;  2BVL A;  5FGL A;  3BRU A;  1P4X A;  2CJJ A;  1HKQ A;  2AXL A;  2KPM A;  3QP6 A;  4HF1 A;  1OR7 C;  2D1V A;  4UVC A;  4GFL A;  3I59 B;  1Z3Y A;  2X6O A;  3K1M A;  3VVX A;  1SFX A;  2XKP A;  3MVP A;  1R36 A;  2ETH A;  5GAE J;  3LQQ A;  1K78 B;  1V54 H;  4DJA A;  1QRY A;  2F5F A;  3OYK A;  4PJN A;  2IEK A;  5K5Q A;  2XIG A;  3C18 A;  2R7F A;  1GDT A;  1QA6 A;  2VPL A;  2NVQ J;  4UVB A;  4GYI A;  3O3K A;  2HWV A;  1RIO H;  4MLO A;  4YG2 F;  4I6Z A;  2M45 A;  4D7N A;  1DP7 P;  3BJB A;  2M7B A;  5LHI A;  3QYF A;  1R7J A;  3RIR A;  4A3K J;  3PM1 A;  2JVG A;  5LD2 C;  3S15 J;  4PGH A;  2JSP A;  4P9F A;  4B48 A;  3CDH A;  3MZH A;  3TP3 A;  1WJF A;  3WGG A;  3HHG A;  2A61 A;  1D8J A;  2HYT A;  3OYA A;  4DGW B;  1HOM A;  2FEZ A;  1LVA A;  3VOK A;  3M8F A;  3AG1 H;  3D1N I;  2ADU A;  1Y1W J;  5CXI A;  1WPK A;  4HBL A;  4G7Z F;  4KN7 X;  5HNF A;  4XLF A;  3M1E A;  3CD6 I;  4PSW A;  5M5X J;  4ZYH A;  1S5L C;  1D0X A;  1P2F A;  3GX4 X;  1YRN A;  3SFZ A;  1BA5 A;  1HST A;  3T6N A;  1OKR A;  2NRA C;  1VF9 A;  1XPX A;  1BW5 A;  4U7B A;  2STT A;  3DQV C;  5FKK A;  4EJW A;  2HQA A;  1RZ4 A;  3BRO A;  4P55 A;  3AQT A;  2BY1 A;  1FTT A;  1U2W A;  1S29 A;  1WRJ A;  4BHB A;  2DAO A;  2OF7 A;  3LOC A;  1TQP A;  4BJT A;  2DFI A;  2CW8 A;  3MZ8 A;  2F5V A;  2QEN A;  3EUH C;  1D1B A;  2DOA A;  3FMR A;  3CRJ A;  3FIW A;  2OPT A;  2Z99 A;  1F1Z A;  3IHU A;  1JGS A;  1Z05 A;  2X0L A;  3RJP A;  5EJC A;  2A5W A;  4XRS G;  1KU3 A;  1O7L A;  2LLK A;  4XSX F;  1G8X A;  4RB3 C;  2Y9Z A;  3G1L A;  1YFH A;  3WTV C;  3P5J A;  3CJD A;  1X1C A;  1K83 J;  2MGQ A;  4CGR A;  3KEY A;  4C2U A;  4X1E A;  1SVO A;  4UHT A;  1G59 A;  3SDB A;  3ERM A;  4A3G J;  5F27 A;  1Z21 A;  3ABK H;  2O7O A;  4DBQ A;  4PGG A;  2WV0 A;  2N8G A;  3F22 A;  1IJW C;  1ORK A;  4EVI A;  2KRC A;  4YFK F;  1ON1 A;  5IOZ A;  1OFC X;  1I6H J;  2Y2Z A;  4ANJ A;  3IRR A;  5CVU A;  1IV8 A;  1KU2 A;  1T0F C;  3CUQ A;  2DYS H;  3KYC B;  5JVG F;  4AU7 A;  1HXD A;  2ZXW H;  3L9F A;  3M4O J;  1SFU A;  4L18 B;  2DW4 A;  2DU9 A;  3AAF A;  1HC8 A;  3AG4 H;  1OCC H;  3JRB A;  1TL8 A;  2CH0 A;  1TWF J;  3H9Q A;  1K7A A;  3IKV A;  2V1U A;  3BNI A;  2IJL A;  1N75 A;  4FE4 A;  5E8G A;  3EUK L;  2R7U A;  3K4L A;  2UXP A;  2HOA A;  3GFM A;  1P4W A;  4A3F J;  2XAS A;  3EUA A;  2BYV E;  1EA3 A;  2ZB9 A;  2XVC A;  4L5I A;  1FP2 A;  2DA3 A;  1P6R A;  3D0S A;  4LB6 B;  1FWZ A;  1FIP A;  3RTR A;  4ESF A;  2K9N A;  3DPJ A;  3HJE A;  5A2Q K;  2DG7 A;  4BYY A;  4FTH A;  2R4G A;  2PMH A;  4ETS A;  1BR4 A;  3ZP5 A;  1HDP A;  4JBA A;  4MFD A;  4Z6Y A;  2LH9 A;  1MBF A;  4A3E J;  5BPD A;  3DTE A;  3FHN A;  1H9T A;  2NYX A;  5A2Q Z;  3MKW B;  3CJQ B;  4KIC A;  5IP7 J;  2MA3 A;  3HSR A;  3KX2 A;  3HOW J;  2OCE A;  2K4B A;  4IXA A;  1E3H A;  5ICF A;  3OYE A;  3FKJ A;  1Y8Q B;  1R6R A;  3ZRG A;  4U0Y A;  5E3M A;  2A3S A;  4BUP A;  1VQK I;  2OCC H;  2HDC A;  3SZP A;  3UKG A;  2FJI 1;  3K70 D;  3U2R A;  3VYT B;  1YO5 C;  3DPU A;  4LIU A;  1S7O A;  2HVS A;  5GAD J;  1YIJ I;  3E7Q A;  4E4H A;  3QPS A;  4G6T B;  3LA7 A;  1LFU P;  2JRM A;  3Q0V A;  2PG4 A;  2IA0 A;  3ONQ A;  3U9G A;  4IQJ A;  2QIB A;  1MGT A;  1U9N A;  2PQ8 A;  4HNV A;  4MIM A;  2VXD A;  3R6S A;  2CQN A;  3DU6 A;  3DP7 A;  3HOZ J;  2VKH A;  3HB9 A;  2XGD A;  3C07 A;  5CVR A;  1HCR A;  5CXG A;  4FCY A;  5IT3 A;  1QBJ A;  1VQ7 I;  3MQ0 A;  5JI6 A;  5IP9 J;  1W5C C;  5HS9 A;  1HSJ A;  3ZCO A;  2HEO A;  4AVP A;  4R8H A;  4D0P A;  1AU7 A;  2JK3 A;  2AQE A;  2HVQ A;  2W00 A;  3O60 A;  5EGO B;  2IU5 A;  2HZD A;  2WAD A;  3VVZ A;  1D0Z A;  2XDV A;  4NC8 A;  3CO6 C;  4OD4 A;  1ZR4 A;  1X1D A;  3TED A;  4EGY A;  3HGY A;  3OY9 A;  3OYN A;  1JGG A;  5F04 A;  2F4M B;  4UY8 I;  1S7A A;  3ZQQ A;  1BL0 A;  2VQL A;  2BHZ A;  1BIA A;  1OLT A;  2DCE A;  5D6E A;  5ERI A;  3CME I;  1ZGA A;  2P5K A;  4M9X A;  2HOE A;  4KJZ A;  1OYY A;  5HLH A;  5DTD A;  5TRD A;  4F92 B;  3A4C A;  1E3P A;  2W25 A;  4NUB A;  2K85 A;  3TGN A;  1P92 A;  1GXQ A;  1PP7 U;  3LHQ A;  1W5T A;  4LIT A;  2ME0 A;  3RKW A;  1FC3 A;  3K2Z A; 
#chains in the Genus database with same CATH homology
 3IUV A;  3BT9 A;  1X2M A;  3HBL A;  2LKX A;  3ZOB A;  4XRS A;  1MBH A;  2DA2 A;  3HOY J;  2FJ1 A;  2LP0 A;  2NS8 A;  3BR0 A;  3HDD A;  5F0F A;  3QBM A;  3BR3 A;  1DU6 A;  1ITY A;  5M5W J;  1WH5 A;  3BQZ A;  1CQT A;  2E2J J;  1P7I A;  2YVH A;  2Q24 A;  5D19 A;  2LD5 A;  3O8H A;  4LOC A;  1FJL A;  3B6C A;  1IV6 A;  4JX4 A;  3HTH A;  4AC0 A;  3TW6 A;  5FJ8 J;  5C3E J;  4I76 A;  5EEA A;  1ZTR A;  3JRA A;  1RKW A;  2HOT A;  2MG4 A;  5JLX A;  4QTR A;  1F43 A;  3GTL J;  1ZR2 A;  2L9R A;  2YS9 A;  3H0G J;  5EGO A;  2TCT A;  4ABZ A;  3ZQC A;  2NVX J;  1VND A;  1K61 A;  3VW2 A;  3JRH A;  2IBD A;  1TWG J;  1XS9 A;  3Q0W A;  4Y52 J;  2YUS A;  2VUM J;  1IC8 A;  4DYQ A;  3E7L A;  3RZD J;  2DA1 A;  1GT0 C;  2K9Q A;  3VP5 A;  2ELK A;  3G1M A;  2WGB A;  2XDN A;  2GM4 A;  2AO9 A;  4JX5 A;  3QPL A;  2NVT J;  4S0H B;  2O7T A;  1JTY A;  4C3I J;  3M3Y J;  4ACI A;  4DYC A;  3JRE A;  2DJN A;  3GTG J;  2L7Z A;  2D6Y A;  2L7M P;  4XIC A;  4DW6 A;  3HTI A;  4UDS A;  4C3H J;  3S1N J;  2JJ7 A;  2M9H A;  1PUF B;  2CUE A;  5K7Z A;  3NAU A;  4IHY A;  1IUF A;  1YRN B;  2AHQ A;  2RHA A;  1OJL A;  4L5E A;  5GPC A;  1AHD P;  3S2H J;  3HM5 A;  5E3O A;  3W6V A;  3I4M J;  3B81 A;  4AUX A;  3KKD A;  1WH7 A;  4AC6 A;  1Z77 A;  1HLV A;  1SFO J;  1NK2 P;  2MSY A;  3ZQL A;  1GUU A;  3NRG A;  5FLM J;  2DG8 A;  5HOD A;  1I50 J;  4NDL A;  5DS9 A;  1ZGW A;  3RD3 A;  3OSF A;  2R92 J;  2X48 A;  4JYK A;  1XC5 A;  3GTQ J;  2ZOY A;  1MSF C;  1GV2 A;  2Y9Y A;  2GFN A;  1B72 B;  2HI3 A;  2NS7 A;  3MN2 A;  2F07 A;  3BG9 A;  1H8A C;  3FK6 A;  1APL C;  2EZK A;  2EZI A;  2ECB A;  1HF0 A;  2GLO A;  2QF7 A;  3GZI A;  4IHX A;  3RQI A;  1BJZ A;  1IDY A;  2G3B A;  3NAR A;  5EDN A;  5DAJ A;  3LSP A;  3S17 J;  1PUF A;  4A3J J;  2PZ9 A;  3HOX J;  5HBU A;  1R9T J;  1JT6 A;  3IH2 A;  1T33 A;  3BR1 A;  3Q3S A;  3TW7 A;  2UXI A;  3BQY A;  2NX4 A;  3VVY A;  1DU0 A;  2DA6 A;  2XRL A;  2NP5 A;  2FQ4 A;  5JLW A;  3F0C A;  1JUP A;  1QPI A;  3OOU A;  4RDU A;  2XSD C;  3COL A;  3BTI A;  3RZO J;  3A01 A;  5IYD J;  3RH2 A;  2DMP A;  2D5V A;  1X2N A;  5HAW A;  3HE0 A;  2XGE A;  4GCT A;  2X9D A;  3P9T A;  4B1R A;  1BW6 A;  2XPW A;  2ID6 A;  3GTO J;  3OSG A;  2RAS A;  3VW1 A;  5F0H A;  3ZQF A;  2Y31 A;  3ZQG A;  3ZQH A;  4MXM A;  4A3I J;  1OCP A;  3EUP A;  1JUS A;  2P81 A;  2HYJ A;  1B72 A;  2YVE A;  2DA5 A;  3TP0 A;  4CYC B;  4A3B J;  3CMY A;  4QIW N;  1AKH B;  2JMW A;  4V2G A;  4JX6 A;  2ZCN A;  5C4X J;  5M3F J;  3BTC A;  4JP0 A;  3MKL A;  3IH3 A;  5H9T A;  3GEU A;  4AF5 A;  4L62 A;  5EG0 B;  3FKI J;  3G56 A;  2E19 A;  2WAQ N;  1ZQ3 P;  5IYC J;  5F08 A;  3A02 A;  4AYB N;  5EZG A;  2ZCX A;  1D5Y A;  3QKX A;  3A03 A;  2XGC A;  5FKL A;  1NK3 P;  2HOS A;  1O4X A;  4HKU A;  1UG2 A;  1FTZ A;  4XRM A;  2R5Y B;  4Y7N J;  5C4J J;  2JA8 J;  1RES A;  5J1U A;  3HEF A;  2DMT A;  1B8I B;  2JA7 J;  3BR2 A;  2V57 A;  4M3E A;  2R93 J;  5J1R A;  3OIO A;  1T56 A;  3GTK J;  3GBG A;  1ETV A;  5K58 A;  2G7L A;  2QKO A;  2UXU A;  2DMQ A;  5J1Y A;  2ECC A;  2JA5 J;  3FRQ A;  2NVY J;  1ETW A;  3BR6 A;  9ANT A;  1JKO C;  3GTJ J;  5HSZ A;  4A69 C;  2DTZ A;  2JA6 J;  1ETO A;  3NNR A;  5K7F A;  5AQC A;  4NEL A;  4G12 A;  1JTX A;  2M34 A;  2GEN A;  2K40 A;  5BNG A;  3GTP J;  2Y0S N;  2DN0 A;  3BR5 A;  2O8K A;  3LJL A;  3H3V K;  5M5Y J;  4A93 J;  1RPW A;  1TWH J;  2EQR A;  3B6A A;  3DCF A;  3K2A A;  5FGL A;  4DZP A;  1JKP C;  3BRU A;  2RAE A;  2CJJ A;  5C44 J;  1AKH A;  1MBK A;  2W48 A;  1E3O C;  2R5Z B;  1LE8 B;  2ZCM A;  4UUS B;  4GFL A;  1IG7 A;  2X6O A;  3VVX A;  5EG0 A;  1JJ6 C;  3MVP A;  2B63 J;  4GCK A;  1EF4 A;  2W53 A;  4FE7 A;  4M3B A;  3S16 J;  1QRY A;  3NI7 A;  5C4Y A;  1POG A;  3L1P A;  1JKQ C;  2QWT A;  3BHQ A;  1VFC A;  5D1R A;  1ETK A;  2IEK A;  4NN1 A;  3SDG A;  1GDT A;  2R5Y A;  4MFE A;  2NVQ J;  2IAI A;  3IV5 A;  4MLO A;  4I6Z A;  1UHS A;  4D7N A;  2VKE A;  2HDD A;  3BJB A;  1U9O A;  2GBY A;  2LVS A;  1RR7 A;  4A3K J;  3PM1 A;  2NOG A;  2QTQ A;  3EGQ A;  1MSE C;  1ZKG A;  4B3A A;  4C2M J;  3S15 J;  2ME6 A;  1HDD C;  1IRZ A;  4D5C A;  2L0K A;  3JRD A;  3TP3 A;  3WHC A;  4ME9 A;  1MBJ A;  2L7F P;  2PMZ N;  4M6V A;  2CRG A;  2E2H J;  2HYT A;  2NP3 A;  1HOM A;  4M3D A;  3VOK A;  3D1N I;  1Y1W J;  5CXI A;  1WPK A;  4J19 A;  5FHP A;  3FK7 A;  2COB A;  2QOP A;  2XPU A;  5M5X J;  3FIS A;  4DYR A;  3ANP A;  4JL3 A;  1YRN A;  3K7A J;  3G7R A;  1H89 C;  1BA5 A;  1LE8 A;  3T6N A;  2TRT A;  1VF9 A;  4W97 A;  4UUS A;  1BW5 A;  5EF6 A;  4PXI A;  4M3F A;  5FKK A;  1TC3 C;  3DEW A;  5M3M J;  1W0U A;  5F1J A;  4M3G A;  1WGX A;  3AQT A;  3Q0U A;  2CU7 A;  3PO3 J;  1FTT A;  4BKX A;  3JRG A;  2UXO A;  4A3M J;  3ZQI A;  3I4N J;  2MW8 A;  2OF7 A;  4BY1 J;  1ENH A;  2K9S A;  3LOC A;  2H1K A;  1Y1V J;  4JNN A;  1ZK8 A;  5E3L A;  3VPR A;  5FKM A;  4W1U A;  5FKN A;  4V2F A;  1GV5 A;  3CRJ A;  3FIW A;  2OPT A;  2WV1 A;  2HXI A;  1G2H A;  3JSJ A;  1WI3 A;  4D5F A;  1XG1 A;  3VIB A;  2DA7 A;  3CQZ J;  4IHV A;  3S1Q J;  2OER A;  3HKZ N;  3JR9 A;  4XRS G;  4DZJ A;  5E3N A;  4A3D J;  3KZ9 A;  2JN6 A;  2LLK A;  2Y9Z A;  1UI6 A;  3G1L A;  4FIS A;  2FD5 A;  2ID3 A;  3LSG A;  3V78 A;  1ETY A;  3CDL A;  2R7Z J;  3CJD A;  3NPI A;  2LY9 A;  1K83 J;  2I10 A;  2MGQ A;  4CGR A;  2XPV A;  3GTM J;  4X1E A;  4BBS J;  2DMN A;  5FMP A;  5EZH A;  4A3G J;  5F27 A;  1UI5 A;  5F0C A;  1TWA J;  2O7O A;  3JRI A;  2N8G A;  1IJW C;  1ORK A;  1GVD A;  2KDZ A;  3S14 J;  1NTC A;  1JUM A;  1ETQ A;  1OFC X;  5IOZ A;  4XID A;  1I6H J;  3AQS A;  3NXC A;  1W0T A;  1JT0 A;  3KNW A;  2Y2Z A;  4D7M A;  4ICH A;  1OCT C;  4IHW A;  4X6A J;  3PAS A;  3C2B A;  1SAN A;  1F36 A;  1WCM J;  3BTL A;  2EH3 A;  4JKZ A;  3M4O J;  4A3L J;  2EBI A;  5GP9 A;  5EYR A;  2JWT A;  3JRB A;  2ZOZ A;  3LNQ A;  3PPB A;  2VPR A;  1TWF J;  3S1M J;  3BG5 A;  1A6I A;  3BNI A;  4GFK A;  2CUF A;  3HTA A;  5EFY A;  5D18 A;  4FE4 A;  2XB0 X;  4UUT A;  2UXP A;  3VOX A;  2HOA A;  4MO7 A;  4A3F J;  4CYC A;  3HGG A;  1U8B A;  1P7J A;  4RBO A;  2HKU A;  2M0C A;  2ZB9 A;  3SJM A;  1A5J A;  2DA3 A;  1MNM C;  4QSH A;  4A3C J;  1FIP A;  4GFB A;  2K9N A;  3DPJ A;  1H88 C;  2Y30 A;  3JRC A;  2UXH A;  4BBR J;  3HTJ A;  1Z0X A;  1FIA A;  2HXO A;  3LSR A;  1MBE A;  2R0Q C;  4FTH A;  3WHB A;  2DG7 A;  2G7S A;  4IEJ A;  2LTP A;  2WUI A;  3LSJ A;  1HDP A;  2E2I J;  4MFD A;  4EEF G;  1MBF A;  4A3E J;  2CQX A;  2E1O A;  3RKQ A;  1MBG A;  2REK A;  5IP7 J;  2YU9 J;  3CWR A;  3HOW J;  2HQ5 A;  5GPA A;  5IOY A;  2M2E A;  2OI8 A;  1B8I A;  3BCG A;  2PBX A;  3PO2 J;  2VKV A;  1IDZ A;  5E3M A;  3HOU J;  4GCL A;  3BTJ A;  3O8G A;  5FLV A;  2H8R A;  4BY7 J;  3UKG A;  2LK2 A;  4MK6 A;  3A01 B;  2KT0 A;  2QCO A;  3G1O A;  3E7Q A;  1QVT A;  3QPS A;  4KWA A;  1LFU P;  3Q0V A;  1VI0 A;  2WB1 N;  5K7H A;  2GUH A;  3HIM A;  2QIB A;  1Q1V A;  1U9N A;  1MH4 A;  1S7E A;  2EZL A;  2VI6 A;  4HNV A;  4XK4 A;  4MIM A;  3S2D J;  3HOZ J;  1LFB A;  2LFB A;  1JJ8 C;  2FBQ A;  2O9L A;  1X58 A;  3HB9 A;  2XGD A;  3C07 A;  5J3L A;  1HCR A;  5CXG A;  2CQQ A;  2R5Z A;  2FX0 A;  2M8G X;  4FCY A;  1ETX A;  3SFI A;  5IPA A;  3JRF A;  5FKO A;  1RET A;  5IP9 J;  3F1B A;  2DMU A;  5CW8 A;  1MH3 A;  3V6G A;  3BG3 A;  3QQA A;  3IH4 A;  1AU7 A;  2JK3 A;  1QVU A;  4C3J J;  2DA4 A;  3O60 A;  5EGO B;  2XB5 A;  1SGM A;  2IU5 A;  3S5R A;  1TWC J;  3VVZ A;  5IYB J;  5IP6 A;  1ZR4 A;  3TED A;  3VUQ A;  3HGY A;  3LWJ A;  3MNL A;  1JGG A;  5F04 A;  4YZE A;  1FEX A;  1BL0 A;  2G7G A;  3ANG A;  2G0E A;  2EZH A;  3ON4 A;  3VW0 A;  1RKT A;  3HOV J;  3ON2 A;  3S1R J;  5DTD A;  1UMQ A;  3KKC A;  2LR8 A;  3CCY A;  1U78 A;  1JKR C;  1IGN A;  1I3Q J;  4BXX J;  3LHQ A;  2ME0 A;  4B4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...