4W97A

Structure of ketosteroid transcriptional regulator kstr2 of mycobacterium tuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
196
structure length
196
Chain Sequence
RVAGQVNSRRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR2
publication title Structural and Functional Characterization of a Ketosteroid Transcriptional Regulator of Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 86
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2014-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w97A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w97A02
2QCOA 5K7FA 3ON2A 2EQRA 3HIMA 5EG0A 3M4OJ 3JRDA 3ZQCA 1LE8B 1DU0A 4X1EA 2NS7A 2GLOA 4M3EA 2H8RA 3JRCA 1AHDP 2VUMJ 4A3GJ 3G56A 5HSZA 2JA7J 2ME6A 4GCKA 3HTHA 3W6VA 2DMQA 2M2EA 1UI5A 2GENA 4D7NA 2R5ZB 1AKHA 1Y1VJ 4A3FJ 3ZQGA 3KKCA 3Q0VA 1T33A 4JL3A 2Y30A 5IPAA 1ETVA 3DCFA 3FIWA 3S1NJ 2DA5A 1JUMA 1IJWC 2M0CA 2P81A 3TW7A 2LTPA 3S17J 5EGOB 3FKIJ 2OPTA 1VNDA 1W0UA 3G1OA 4DYQA 1H88C 2JA6J 3PO2J 4GFKA 3HOXJ 2AHQA 3TP3A 1PUFA 3VVXA 5EFYA 3G7RA 3QPSA 2ZB9A 4W97A 3WHBA 3HOZJ 2XPUA 3HKZN 4A69C 3NRGA 4AC0A 1HLVA 3EUPA 2ECCA 3FISA 4NN1A 1F43A 1ZR2A 1F36A 4MLOA 3A03A 1X2NA 2QTQA 3DEWA 2RHAA 4MFDA 3A01A 5HAWA 4JYKA 4XIDA 4MXMA 5D1RA 1MH3A 4A3DJ 2K9NA 3NXCA 4BY7J 1BA5A 4A3LJ 2W53A 1IUFA 4B1RA 3GTOJ 3LSJA 1QVUA 1TWHJ 2JN6A 5C4JJ 1VFCA 3M3YJ 3FK6A 1SGMA 4A3KJ 1O4XA 3P9TA 1H8AC 1HF0A 2Y31A 3OSGA 3BG5A 5GP9A 2KDZA 1MNMC 2UXOA 3KZ9A 2FJ1A 1T56A 1MBGA 4FE4A 1RKWA 3HE0A 4B4CA 2R92J 1JJ6C 3LOCA 4M3BA 5IP9J 2NP3A 1A6IA 2CU7A 4BXXJ 2MG4A 2HOAA 2D6YA 2XGDA 1LFBA 3NAUA 4A3EJ 2E2JJ 3OOUA 1P7JA 4QTRA 5F1JA 4XRSG 2HYTA 2EBIA 3TP0A 4MO7A 5M5XJ 3VOKA 3T6NA 5FJ8J 1NK2P 2L9RA 4V2FA 2Y0SN 4I6ZA 2JK3A 5J3LA 3AQSA 2LY9A 2XGCA 2LVSA 2I10A 2CRGA 2QWTA 3K2AA 3HDDA 5EG0B 1RPWA 3GBGA 5DTDA 2FBQA 3VVYA 3LSRA 3RKQA 5IYBJ 1XS9A 1JKPC 4LOCA 4HNVA 3OSFA 5H9TA 2DG7A 2XPWA 1FIPA 2E1OA 3SDGA 5GPCA 2HYJA 1FIAA 4JKZA 5DS9A 1AKHB 3PASA 5FKLA 1RKTA 4G12A 1WCMJ 2DMNA 5IYDJ 2WV1A 2NVXJ 2W48A 1DU6A 2WGBA 9ANTA 4NELA 4AF5A 1ETWA 2EZKA 4FE7A 1A5JA 3BCGA 3RD3A 2NOGA 1QVTA 2ZOZA 3BQZA 2PBXA 2YS9A 2JWTA 1PUFB 2QOPA 3BT9A 2K9QA 4J19A 5HODA 1HCRA 5FKNA 2LFBA 4AUXA 3Q3SA 4AC6A 3I4NJ 1UMQA 3Q0UA 4JX4A 4GFBA 1XG1A 5J1UA 1R9TJ 1B72A 3HTAA 4S0HB 3HBLA 5F04A 1E3OC 1IG7A 1BL0A 5FKOA 5FGLA 3A01B 5C4YA 3ZQFA 5C3EJ 4W1UA 2ECBA 2RAEA 3JREA 5M5YJ 4Y52J 1GVDA 4A3MJ 1I50J 3HOWJ 3JRBA 1Z0XA 3JRFA 1IV6A 1GV5A 4A3CJ 1MBHA 3BTLA 3MVPA 3HTJA 3RH2A 2L7ZA 4PXIA 3JR9A 4D5CA 3TW6A 5DAJA 4EEFG 2O9LA 2AO9A 4C3IJ 3BRUA 3IH4A 3SJMA 5GPAA 2D5VA 4AYBN 3BR1A 1TWGJ 1FJLA 1S7EA 2YUSA 5M3MJ 1YRNA 5C4XJ 4RDUA 1OCTC 4XRMA 1HOMA 3HGYA 2IBDA 4QIWN 4L5EA 5FKMA 3TEDA 3O8HA 3BR6A 4IHWA 4DW6A 3F0CA 2K40A 3MKLA 5K58A 1ZQ3P 3MN2A 2HOTA 4A93J 4XRSA 1OCPA 5AQCA 2HQ5A 2JA8J 3S15J 2EZHA 3CMYA 2NX4A 2MW8A 3BJBA 5CXIA 2QF7A 2VPRA 1QRYA 4IEJA 1NK3P 1LFUP 4GCLA 1Z77A 3PO3J 2L7FP 2DA7A 3PPBA 5E3NA 1B8IA 2ZCMA 2VI6A 3HM5A 3S1QJ 2O7TA 1IDYA 5IP6A 1JTXA 2IAIA 3VVZA 4V2GA 5HBUA 2E2IJ 2DA2A 3BTJA 1ZR4A 3LSPA 3JRIA 5EZGA 2B63J 1UI6A 3S14J 2VKEA 2H1KA 2L0KA 2DMUA 3VIBA 2M34A 1ZK8A 2DA3A 2GFNA 2PZ9A 5F0HA 1HDPA 2OI8A 4C3HJ 2HDDA 2COBA 1JKOC 4ACIA 2TRTA 3OIOA 1TWAJ 1FTTA 3VP5A 3JRHA 2M8GX 3F1BA 3S5RA 4I76A 1MSFC 3RZOJ 3EGQA 5EZHA 2XGEA 1VI0A 1CQTA 3GTGJ 3QBMA 3V78A 3GTJJ 3LJLA 1K83J 3Q0WA 2LK2A 3QQAA 1JUPA 1UG2A 5JLXA 3ANGA 5D18A 4JX5A 1X58A 5EEAA 1ZGWA 4BBRJ 1ETYA 3H3VK 3D1NI 3CCYA 1B72B 4CGRA 4FISA 4YZEA 2FD5A 4GFLA 4DYCA 4DZPA 2E19A 4DZJA 1ZKGA 2TCTA 5IP7J 3BQYA 3VW1A 3GTQJ 1JKQC 2DA6A 4Y7NJ 2F07A 4JP0A 4UUTA 2HKUA 2Q24A 5CXGA 2DA1A 3V6GA 3CWRA 1IGNA 2YVHA 3A02A 3LNQA 2E2HJ 5J1YA 2Y9YA 1Q1VA 1ORKA 3FK7A 5FMPA 5CW8A 4XICA 2CUFA 1K61A 1ITYA 4IHYA 3LHQA 2XSDC 5F27A 2DJNA 2CQQA 2G7SA 3HTIA 2REKA 3GTLJ 1YRNB 3ZQLA 4UUSA 1X2MA 1MH4A 2L7MP 2ID6A 2CQXA 3HOUJ 3C2BA 2M9HA 4M3GA 3GTPJ 2IEKA 3IH3A 3BHQA 1ETOA 2G0EA 2O7OA 5C44J 4JNNA 3HEFA 5IYCJ 5FKKA 4RBOA 4KWAA 5E3OA 2ELKA 3B81A 1MSEC 1W0TA 3GTKJ 1APLC 1JT6A 3BG9A 1ETQA 2EH3A 2EZLA 4A3BJ 3O60A 3BR0A 3GZIA 2DTZA 1UHSA 1Y1WJ 4MFEA 1JJ8C 1B8IB 5JLWA 3BTIA 3CQZJ 4NDLA 2GM4A 5J1RA 4CYCA 2O8KA 4A3IJ 2UXIA 1WH5A 3WHCA 2YU9J 2XPVA 1U9OA 3IUVA 2CJJA 5BNGA 1MBKA 3RQIA 2UXHA 3NNRA 2HXOA 3HGGA 1GDTA 4B3AA 4BKXA 3L1PA 1GT0C 2LKXA 3H0GJ 2NP5A 1QPIA 1TC3C 1H89C 2XB5A 5EDNA 3BR2A 2R5YA 2G7GA 1U8BA 4GCTA 4M3FA 3RZDJ 4C3JJ 1G2HA 1RETA 1JKRC 4DYRA 4ABZA 4MIMA 2DA4A 1TWFJ 3B6CA 3BNIA 4MK6A 1OJLA 5IOZA 3B6AA 1POGA 5F08A 4FTHA 3ZOBA 2X9DA 4BBSJ 4M3DA 2RASA 2OF7A 2MGQA 5EF6A 2ME0A 2R0QC 3E7QA 2X48A 1SFOJ 2ZCNA 3VUQA 2WAQN 2YVEA 3QKXA 4L62A 2JMWA 3K7AJ 2PMZN 3NPIA 3ZQIA 3KNWA 3CJDA 1ZTRA 2LR8A 1U9NA 4IHXA 3VW2A 2DMTA 5K7ZA 3VOXA 2N8GA 2HI3A 2G3BA 4JX6A 2R7ZJ 3FRQA 5D19A 3HB9A 1LE8A 2ZCXA 1BJZA 3VPRA 1D5YA 3HOYJ 1NTCA 3DPJA 2G7LA 2VKVA 1MBJA 2LLKA 2FX0A 1JGGA 2XRLA 2LD5A 3S1MJ 3G1MA 2V57A 3PM1A 2R5ZA 2DG8A 4C2MJ 3IH2A 1I6HJ 4UUSB 2NVTJ 1IC8A 5K7HA 2Y9ZA 1HDDC 1TWCJ 3S2DJ 3AQTA 2WB1N 3MNLA 4FCYA 2DMPA 3BR5A 5FLMJ 3GTMJ 2HOSA 5FHPA 2ID3A 3COLA 3CRJA 5EGOA 3SFIA 4M6VA 2UXPA 5E3MA 1RR7A 1XC5A 3IV5A 2DN0A 2GBYA 1FTZA 3HOVJ 3G1LA 3S16J 3C07A 4D7MA 3VW0A 5IOYA 1AU7A 1FEXA 4HKUA 1JTYA 1JT0A 3S1RJ 1MBEA 5E3LA 4CYCB 1EF4A 1ETKA 5M3FJ 1SANA 2LP0A 3LSGA 2EZIA 3ZQHA 3JRAA 1BW5A 1P7IA 5F0FA 1WGXA 4UDSA 2JA5J 1WPKA 2UXUA 2X6OA 3LWJA 4QSHA 1VF9A 2KT0A 3BR3A 2R5YB 1U78A 1IDZA 5F0CA 3JSJA 1ENHA 1GUUA 2WUIA 4X6AJ 2ZOYA 2NVYJ 3E7LA 1WI3A 3JRGA 2IU5A 2QIBA 2NVQJ 1GV2A 5FLVA 2HXIA 1RESA 3BTCA 4BY1J 3I4MJ 3S2HJ 3UKGA 1IRZA 2GUHA 2Y2ZA 2CUEA 4ME9A 2K9SA 2XDNA 4D5FA 1ETXA 2XB0X 3BG3A 5EYRA 2MSYA 3O8GA 3GEUA 3ON4A 4IHVA 2QKOA 3KKDA 2R93J 3QPLA 3NARA 4XK4A 1BW6A 3NI7A 4A3JJ 4ICHA 2NS8A 1MBFA 3ANPA 1JUSA 2OERA 1OFCX 1WH7A 2JJ7A 3CDLA 2FQ4A 1I3QJ 5M5WJ
chains in the Genus database with same CATH superfamily
3V42A 5L3EA 2IA1A 3AL0B 2AXTC 3GCMA 4DBQA 2WA0A 4EV0A 1OCZH 2OQGA 4CCKA 5EG0A 4XSZF 1QHHD 3JRDA 4GYGA 3KETA 1MJ9A 1NG6A 2GLOA 4XQFA 4BAYA 4F93B 4HSRA 5HSZA 3G56A 2JA7J 3HTHA 3FXKA 1BI3A 3CLOA 2M2EA 1OYYA 1KYZA 5FROA 1O3QA 2XAJA 1AKHA 2X6YA 1IXRC 1WQ2A 2E5NA 1R00A 3ASNH 3R0AA 4F91B 2W4SA 2IS2A 4JL3A 2Y30A 4FQGA 2M3AA 1UELB 2DA5A 1SFXA 2JSPA 3VSKA 1LPQA 3CCUI 3AAFA 2QBYB 3S17J 2NNYA 1E3PA 1P92A 4P1WA 1FP2A 3SZTA 4II2A 3G1OA 4DYQA 3PO2J 3ZMUA 1A6QA 5BOXA 4PJMA 1FOWA 5EFYA 3QPSA 4U0VA 1XMXA 2Y0SA 1ZRFA 3NRGA 4NN1A 3I55I 1KQ0A 3ABKH 3WTUC 1ZELA 2ZJPF 4XKVA 1WJ5A 2A68F 3DU6A 2DAOA 4JYKA 4A3DJ 4EGYA 2DT6A 4GO1A 4A3LJ 4JK1X 3JAMZ 2P6SA 1FC3A 1LJ9A 4L0ZB 1TWHJ 2JN6A 4L9TA 2DQRA 4A0YA 3SQNA 1IN6A 2MC3A 3W2VA 1HF0A 2Y31A 3OSGA 1D0YA 3HRSA 2KDZA 5HDKA 4CXFA 1T56A 5F64A 1MBGA 1X4PA 2O8XA 5LHIA 3OIQA 1YW8A 3KYLA 4OMZA 5CQGA 1PDNC 3HSEA 3FWEA 2OD5A 5IP9J 4NQWA 4BXFA 2A61A 3LFKA 2XGDA 4C2MA 3KPHA 3I0TA 3CLQA 3OOUA 2RGVA 2BY2A 2IGKA 1WJFA 2HOEA 1R4NB 2BZTA 4BQQA 3S3NA 3TP0A 2VLAA 5FJ8J 2L9RA 3DEUA 2Y0SN 2Y75A 2DFFA 2XGCA 3KYCB 4HG2A 4AIJA 2CRGA 1UCRA 1IF1A 2F6CA 2E1MC 3GLXA 4ZYEA 3E5QA 5F1RA 2QLZA 5EG0B 3DPTA 3VVYA 1IRFA 4FX0A 2VQGA 3LSRA 4GDFA 2MD5A 1XS9A 3K1PA 4LOCA 4HNVA 3U9GA 2P6TA 3SYTA 3G6EI 4LB6B 2DG7A 1FIPA 3F23A 4DQ2A 5GPCA 3WTSC 3MKWB 3EPZA 3LFUA 4JQFA 1FIAA 4KITB 1AKHB 5D5XB 3SHFA 2M1BA 3FMSA 2E7XA 5IYDJ 2V1XA 3L7WA 3O6BB 1BR2A 2X0LA 4FE7A 2LSOA 4RAYA 3AG1H 4A5NA 1K78A 2NOGA 1QVTA 4J01A 2QKMB 5ICFA 1VQ9I 2ZFUA 3JAMK 2DDAA 2FOKA 5KK1A 1B72A 3HTAA 3PNTA 3ZRGA 1FSHA 4Z2YA 1HKQA 1G3TA 2VBWA 2RNJA 4GGGA 1ZHFA 4XORA 5E1WA 3MWMA 5FGLA 1TP4A 2IGNA 2RKHA 5M5YJ 2HYFA 1BOAA 4B48A 4HF2A 4A3MJ 1R49A 1VQMI 3JRFA 1IV6A 1GV5A 1D8JA 1BR4A 3JR9A 5DAJA 3TW6A 1V5EA 2O9LA 1I6XA 2EINH 1EV7A 4RB1A 2H8WA 3TKYA 1OR7C 4DNCA 3ZMVA 3BR1A 2VE9A 1FJLA 1U8RA 3VYRB 5DDGA 2WADA 1KYWA 4R79A 2IBDA 3TEDA 2BY0A 4CSWA 1LNWA 3MZHA 1XX5A 2K86A 3MKLA 3HC7A 4NQWB 4PGHA 3M07A 5K58A 2K27A 3S15J 3GZ6A 2MABA 2EZHA 3CMYA 3L9FA 5CXIA 5BPDA 1QRYA 1NK3P 4YFNF 3CC4I 2AS5F 2BOLA 2PJPA 1A04A 2L7FP 5E3NA 2KHMA 2ZCMA 3GFMA 1XB4A 2A6TA 3ONQA 2VASA 3I9V2 4CCOA 2J5OA 1IDYA 1YX3A 4B3XA 1FYLA 2QEXI 3HRUA 2B9SA 2YR2A 4PUSA 2DA2A 4XL9A 4KT5C 1J9IA 6PAXA 4AIHA 3JRIA 4CH7A 2EIMH 1G59A 3S14J 1FOYA 3A2KA 1LDKB 3VIBA 3A1YA 3BOQA 4UVBA 1R5GA 3FXOA 3HSFA 4PJNA 2UWMA 1YE9A 5J47A 1Y6IA 5F0HA 3R0JA 2HPIA 2EWNA 3OR2C 1YQAA 4PFOA 3MD2A 2CYYA 3HZJA 5D5UB 4KIFA 2HZDA 4RGSA 2QA4I 2TRTA 4HSTA 4OMYA 3VP5A 3F1BA 4AU7A 3VEPA 3DLAA 3RZOJ 5EZHA 1K78B 4E70A 2DXIA 1CQTA 3QBMA 1FSEA 3GTJJ 4UHTA 2JRTA 3M1EA 5JLXA 1TL8A 1DPUA 3K6GA 5EEAA 2DDBA 3H3VK 3L09A 2CFOA 2DOAA 3RPUD 1B72B 5H6RA 4FISA 3ZMDA 4GFLA 4HX7A 1Z7LA 4DZPA 2ICWG 3QYEA 3D5LA 3DTKA 1ZKGA 4XLPF 1JKQC 3MQ0A 2HKUA 5LRSA 4LG0A 4AYBA 3VOEA 3CWRA 2LOOA 1U5TA 3A02A 4HNUA 2VOPA 1XCVA 2Y9YA 5FMPA 1YW9A 4KJZA 1K61A 3DBHB 4RLQA 4LIUA 3LHQA 3NRVA 2CQQA 2G7SA 1X1CA 2YX4A 2LKPA 2REKA 4E7IA 4LMYA 4AVPA 1FBQA 3E6DA 3GWZA 2BGCA 3HOUJ 2M9HA 2Y0MA 4YEJA 2DFHA 4MHGA 3SEQA 4CO8A 2XIGA 2ESHA 1MSEC 3KP2A 1BC7C 2RNGA 2IPQX 1JT6A 2EH3A 5F6FA 4D9JA 2VIXA 4ZC3A 4I2OA 3BR0A 4LLLA 2PFBA 1UHSA 3VTIA 1C0WA 1OCCH 5JLWA 3OYJA 1PYVA 1YI2I 1VQ6I 2KRHA 4YFKF 2M30A 3OOPA 3CJNA 2BHYA 2UXIA 2OTJI 4M9XA 3VWBA 2PQ8A 3TO7A 5BNGA 1MBKA 3K0LA 3RQIA 4LD5A 3MAJA 5DV5A 3WTWC 4E4HA 3QU6A 3GEZA 3HGGA 4HBLA 4P96A 4B3AA 3CDIA 2CUJA 3L1PA 3OYLA 2LKXA 1B6AA 1QPIA 1TC3C 1HXDA 1KU2A 2VB6A 3RZDJ 2B0LA 1G2HA 3WGIA 3OL4A 2JPBA 2K85A 3FMQA 2HKXA 2DA4A 3W6KB 2P5KA 2M45A 3SXYA 1X3UA 3MCZA 2FEZA 1LDDA 5F08A 1J75A 4BBSJ 5B3SH 2OF7A 5D6FA 1BBYA 5HVQC 1TNTA 2IRFG 2O03A 3NPIA 3E3VA 2A07F 2EV5A 2HTJA 3RIRA 4E7ZA 2W00A 2HQAA 3HPHA 2DMTA 1H0MA 2BBYA 1XD7A 2QM3A 2WWYA 2XROA 3ABUA 3DV8A 4OIQF 3DLLF 3TMOA 2UUZA 1K6OA 4EGZA 2DODA 4LG0B 1U5TB 3WTTC 2MLGA 3M7GA 2IA0A 2ZBKA 1B4AA 1MBJA 1S72I 1JGGA 4CYDA 2LD5A 2X1DA 3WTVC 3PM1A 1JHFA 3COAC 3EYIA 1UHMA 2NVTJ 1Z67A 4Q4ZF 1IC8A 1ZYRF 4HLXA 3AQTA 1X4OA 4RGRA 2WB1N 1MDMA 5HNHA 2JUGA 3GTMJ 5FLXK 1W5CC 3IAS2 3K4KA 3KP7A 5BPIA 5CVRA 1ZRDA 5CVJA 2EA4A 2RREA 3CRJA 1S7AA 3LSIA 3SFIA 3KEYA 3TQNA 2E1CA 3FZVA 1YJWI 2VBYA 2DN0A 1XGOA 2D45A 3V8KA 5HS8A 3C07A 4D7MA 2GA2A 3VW0A 4HKUA 4HV5A 3X2QH 3BZKA 1ACIA 1FYKA 2P4WA 4OIOF 3FXUA 5FGMA 1TZLA 2XUBA 4XM3A 3WGHA 4YELA 1R36A 4S04A 4XR6A 2EZIA 3IHUA 3ZQHA 5ILUA 2M87A 4HF0A 3JRAA 2B1EA 1P7IA 5F0FA 1WGXA 4BHBA 4OD5A 2X6OA 1N75A 3OMYA 3Q9SA 4BU2A 3PQJA 3JSJA 5DD8A 2WUIA 2MD0A 2AXLA 4BJ6C 2NVYJ 4ESBA 3E7LA 1WI3A 1YJNI 1E0EA 1DP3A 5LHHA 2CSOA 1TQPA 1IW7F 2XGXA 1IRZA 1DDNA 2GUHA 2CWEA 4ETSA 1B59A 2VJ4A 4R8HA 4HAMA 2X4HA 4D5FA 5ED4A 4ZYAA 1YITI 2ZSHB 4EATA 3HYIA 3E97A 3SFZA 3GEUA 2JZYA 1FOKA 2YX7A 1F1ZA 1O3TA 1OISA 3NARA 1K79A 1R1TA 4IL6C 2YU3A 4A3JJ 1MBFA 3BZCA 3PSFA 2D1VA 4KMUX 2G7UA 3CDLA 2W85A 2FUG2 1V54H 5ICCA 4LJZF 2Y69H 3IWZA 1TT0A 5K7FA 2DU9A 3ON2A 4ENJA 3KEQA 4Y3OA 3VYTB 3HIMA 4XOTA 4X1EA 1S9HA 4Y15A 2ELJA 4B44A 4EM0B 1FOXA 3JRCA 2ZXHA 1B9MA 2ME6A 3FF5A 4UXNA 2DMQA 1UI5A 3LL7A 4U87A 5HDGA 4D7NA 3OL3A 1RIOH 3I56I 2JVHA 1Y1VJ 4A3FJ 2KIUA 3GF2A 2V26A 1ONVA 5IPAA 1R1UA 3DCFA 3FIWA 2BY3A 1VZ0A 3LWFA 3RTRA 1PUEE 1MDMB 4ZYHA 1XGNA 3ECOA 1Q1HA 3P9CA 1WJBA 1IJWC 4RGUA 2LTPA 2LY2A 2O5RA 1W0UA 1DGWY 3FXQA 4KN4X 1H88C 4PK4A 1V55H 3KLOA 2NNNA 3G7RA 1XGSA 1MNDA 2F5CA 2ZB9A 2IS1A 3AG3H 3HKZN 3IKVA 4A69C 4HEA2 3FISA 1F43A 5E18F 1BC8C 1M1EB 4RM3A 4BACA 1ZR2A 1XPXA 1IN5A 4MLOA 3SZGA 3J7YJ 1XDUA 2QTQA 4G6QA 3A01A 1O3SA 1BI1A 5D1RA 3NXCA 1G8XA 1LVAA 3CJQB 4BY7J 4UB6C 2XV4S 1UJ8A 1BA5A 1IXSB 1QVUA 1EA3A 4O5VA 1VFCA 2OUMA 4A3KJ 5D5VB 3RKYA 2Z1DA 1V4RA 4CA0A 3GZNB 2BYVE 2CMPA 1U2WA 3BG5A 1R58A 5GP9A 3V7SA 4A6DA 4BHPA 3JSPA 1XSDA 1UAAA 2UXOA 3KZ9A 1NHAA 4FE4A 2R92J 3HPGA 1S8NA 3LOCA 2W84A 2VODA 1S3JA 2ZNYA 3BJ6A 3K2ZA 1S29A 4OU0A 5GTIC 3ZMTA 4BXXJ 2MG4A 1WFXA 1W36C 2D6YA 2EPFA 2OU2A 3NAUA 2HNHA 1RNLA 5TGTA 4NBQA 3PUFA 3T8RA 2QUFA 4V19K 1X19A 3WTXC 3IP4B 5E79C 4NUBA 3WE2A 4ZH4F 1U6GA 4IVNA 3VOKA 4EVIA 3T6NA 1YS6A 4RLFA 1NK2P 1T8IA 3AQSA 3ABTA 5JI6A 1VQ4I 2LVSA 1TQIA 3J80K 1Y0UA 1MMNA 5HLGA 4Q48A 2ZKZA 3GBGA 3HJEA 4HF1A 2NOJB 3ECHA 3OR1C 5IYBJ 3RKQA 5GAEJ 3QRFF 3HOTA 3LAPA 1DQUA 2M7BA 3CDHA 1I27A 2GAUA 4MTDA 2E1OA 2QVOA 2VXDA 3HUGA 5DS9A 3VODA 1KQ8A 1WCMJ 2PN6A 4AM3A 2KP6A 4L18B 4BYYA 3I58A 4NELA 1X1PA 2R7DA 1A5JA 3G2BA 2NS0A 2GQQA 2KIQA 2PBXA 2NVUB 4HPQA 4WF2A 5D4RA 2QOPA 1ZG3A 2BEOA 3BT9A 4M71A 2OV7A 4OOIA 1UMQA 4UUVA 1H9TA 2Y48A 3PUBA 1R9TJ 4Z6YA 3OS2A 3CMEI 4S0HB 3ROUA 4HQMA 1QQIA 4ANJA 4E6KG 3K4NA 1E3OC 1CGPA 2A5WA 2VT3A 1VQNI 4P55A 2JRMA 3A01B 4PJJA 1SFEA 3ZQFA 5K1YA 3AFHA 2LREA 4KYWA 4G94A 5HS7A 1I50J 4WCGA 2W7NA 3HOWJ 1Z0XA 4A3CJ 2EA2A 1PJRA 3MVPA 4EM2A 3HTJA 2L7ZA 3RH2A 3RYRA 3A0BC 3J7AY 4EEFG 2AO9A 5CQEA 4C3IJ 2OZ6A 2FBIA 5GPAA 1TWGJ 1S7EA 2YUSA 5M3MJ 5AONA 1OCTC 4XRMA 1RUNA 1R71A 3ZPLA 2L9NA 4OWRB 3FBNB 5FKMA 5LHGA 4IHWA 4DW6A 4HRIA 1IN8A 1BI2A 3MN2A 2CW7A 4A93J 5AQCA 4MNUA 3IAM2 2IW5A 4KNYA 2ESNA 3BJBA 2QF7A 2VPRA 1KQ9A 2R7QA 4IEJA 2XASA 3TO6A 3CCEI 4BHCA 1D3YA 4GCLA 3PO3J 4IPAA 1EKEA 3E6BA 3QODA 3EUAA 3KZYA 3L2UA 4H0EA 2P7VB 2PBIA 1W36D 3PPBA 1YG2A 3M8FA 2CH0A 1Z91A 2ZMEC 4IJAA 4CZZA 2O7TA 1T6SA 2CG4A 1JTXA 3KE2A 3V7CA 3WTZA 2MC4A 2FNAA 3LA2A 4PSXA 4ZJZA 4LB5A 3H35A 5HBUA 3GFIA 1BR1A 3BTJA 1U0JA 4EJOA 2KMUA 1FYMA 3LSPA 2JQ7A 2OCEA 3H3UA 4EJUA 2L0KA 3KP4A 2O61A 1MZBA 2LNBA 1AOYA 2V6EA 3Q5FA 2WV0A 3DXJF 1P4AA 1ZK8A 3JTHA 3HUGB 2X6WA 2XF5A 5EEGA 3OY9A 4IQJA 1HDPA 2E36A 4QPOA 2Z5UA 2EFNA 3G73A 1JKOC 2KRCA 3RJPA 3DWLE 4PFPA 3ASOH 3OIOA 2F5EA 2KJCA 1T95A 3S5RA 4MEXF 3MZ8A 4I76A 3RPUA 1MSFC 3ZCOA 3EGQA 3NQOA 3J81K 3K4LA 2Q2EA 3VFZA 3V78A 1TQMA 1XMAA 2LK2A 2JA2A 2OCCH 3GMEA 2DQLA 1GLNA 3GLLA 1PP7U 1DGRM 1ZGWA 1X1DA 3D1NI 4UB8C 1J5YA 2DO7A 4WWCA 1P6RA 1SC7A 3WG7H 2PJRA 4DYCA 1IUYA 4YIFA 3Q9VA 5JHFA 2V7FA 4DZJA 1YYVA 3GUDA 1LQ1A 2P5LC 3BQYA 4QWQA 3VW1A 4ZDLA 3GTQJ 2F07A 2DA6A 4Y7NJ 1XDSA 4C30A 5L3BA 2UZKA 3V6GA 1VQ5I 4CCNA 2MBFA 2YVHA 2GXGA 4ON0A 3LNQA 1T0FA 5CPRB 1Q1VA 1ORKA 2VC1A 5BS6A 4XICA 2CUFA 2GXBA 4RAGA 3B73A 5BQTA 2MFZA 3L2RA 3HTIA 3H3ZA 2A6EF 4I01A 2CO5A 3GTLJ 5E8GA 3ZQLA 2DTRA 4UUSA 1Z05A 3J7AO 3V8JA 4P5OA 2ID6A 2LYCA 4XMYA 2VT2A 4KIGA 4LIVA 4UVAA 4EMSA 3CUQA 3GTPJ 2IEKA 3ZMSA 3BHQA 3CCQI 2G0EA 1R5ID 3L2QA 2HDCA 2KISA 2PMZA 4NC8A 3CCMI 2ELKA 5ILSA 2EZLA 2DOFA 2PFVA 2DTZA 4WXHA 1JJ8C 3BTIA 1REPC 3LSMA 3T1BA 2E1MB 5J1RA 4CYCA 2O8KA 4A3IJ 5DM6F 4DOZA 2YU9J 3WU1B 1VQ7I 3PIPF 2XAQA 4KA4A 2CJJA 3DFGA 3NNRA 1JE8A 2HXOA 2WTEA 1ERDA 3CO7C 4XONA 2ZY9A 1W4MA 3I4PA 2L3DA 2NP5A 4P9UA 1H89C 2UV1A 3BR2A 3N05A 1MD0A 2R5YA 3T0YA 5LFAA 4D1QA 2L9VA 4XLCA 2VE8A 1RETA 2XSJC 4R1HA 1ZLKA 3V4GA 3CESA 3HRTA 4ABZA 2F4OB 2O0YA 1MMGA 1TWFJ 4YIIA 4MK6A 4FTHA 3JTGA 1OKRA 2X9DA 3E0JB 4M3DA 2RASA 2F5VA 3RSNA 2R0QC 1GVJA 3E7QA 3VUQA 4EJTA 3HG9A 2HR3A 1VQPI 2YVEA 4AIDA 5CVUA 3QKXA 4BE0A 3GW2A 2PMZN 4Q5SF 5ERIA 1D8KA 4E7LA 2BW3A 1ZTRA 3RPQA 4EM1A 5FFXA 4IHXA 4P9FA 5KAIC 1USTA 5AIPA 3W6JB 3VOXA 3F9KA 1DPRA 4KFCA 2PJRB 2HI3A 5DUIA 2R7ZJ 3I53A 1SD5A 3QU3A 1SFKA 3HB9A 4WK8F 4LK0F 1GHCA 4CZCA 2HQNA 4GCVA 4GXOA 4F3QA 3H5NA 1ZG1A 1K4SA 1LE8A 2HPMA 3P7NA 1D5YA 1P4WA 1NTCA 1HKSA 1TT5B 4I98B 1KONA 3LSKA 1YTYA 2VKVA 1R23A 4M6XA 2FX0A 3S1MJ 3G1MA 2R5ZA 2DG8A 4C2MJ 2ZXIA 1ZGJA 3FKJA 3IH2A 4KT6A 2IGOA 4UUSB 3F3XA 5K7HA 3ELKA 2Y9ZA 1S6LA 1HDDC 1TWCJ 5D8KB 3MNLA 2DMPA 3BR5A 3CUQB 4IRVA 2HOSA 3OYIA 5CYVA 4KN7X 3BZ6A 5HLHA 4UY8I 2X85A 3WODF 2WY8Q 5EGOA 2NRAC 4M6VA 2UXPA 4MTEA 4XLNF 5E3MA 2AQFA 2RQQA 1YW7A 1FTZA 2KPMA 4EQQA 3FDYA 1AU7A 2ZC2A 1MBEA 4I7HA 5E3LA 1Z3YA 3DPLC 3FXMA 4CYCB 2HQRA 1EF4A 3W2WA 4HDVA 5M3FJ 1SANA 2RQPA 3LSGA 2LG4A 3S3MA 5L3GA 2LDUA 2Q1ZB 2JA5J 1WPKA 4IOAF 3LWJA 4BNCA 2KT0A 3BR3A 2HGCA 2R5YB 1IDZA 2EFOA 2HYGD 2F5DA 1ENHA 3IL2A 2LRDA 2H27A 2LMDA 5LBQA 3OYBA 2FU4A 1GV2A 5FLVA 1RESA 3S2HJ 3ERMA 4G7ZF 5K5RA 2QENA 5GAGJ 1R5HA 2XAUA 2XDNA 3VYUB 1SVOA 3P5JA 3LQQA 2XB0X 3O3KA 4E7KA 4BQAA 2MSYA 1OYIA 3I5UA 2RV8A 4IHVA 1ZLJA 2QSGX 5FLXZ 3VDXA 1HBXG 4Y17A 2UXNA 2BW3B 2M4GA 4XK4A 3TOAA 1BW6A 1IO2A 1TBXA 4PJLA 3CC7I 3DTIA 4L0YB 2HVSA 2H1LA 2JJ7A 1WSUA 1QU3A 1TTYA 4B47A 2VJJA 4A12A 2STTA 1I3QJ 3E5UA 2QCOA 1QA6A 2FJI1 2EQRA 3KX2A 3G71I 2XKOA 5FO5A 3ZQCA 1LE8B 4FETA 3GX4X 2BE5F 3LA7A 1T39A 2ZO4A 3WTYC 1HW5A 1AHDP 4S05A 4BE2A 2V9PA 2VJ5A 2VL8A 1WRJA 2WB1A 4C2UA 3QP5A 2R5ZB 4KUMA 3ZQGA 4ENKA 1T33A 1ETVA 1U5TC 5B66C 3S1NJ 2NAZA 4XKCA 3A4CA 4FT8A 3FXLA 4ZZDA 2M0CA 2A05A 2GOXB 5EGOB 3FKIJ 1PP8F 2CQNA 4RB2C 1QPMA 2L9SA 2AHQA 3UNGC 1PUFA 2DYRH 2CV2A 1E3HA 4W97A 1FY7A 1KZHA 2I8DA 3PFYA 2VN2A 2ECCA 3K1MA 1UFMA 1FBSA 5BMZA 4LK1F 2Q8KA 4ZZLA 3A03A 2HS5A 3RKXA 5K5OA 4DGWB 2RHAA 2MLKA 3M8EA 4MFDA 2R7UA 3GO5A 5FD6A 2STWA 1MH3A 1SEUA 2K9NA 4IF4A 5LEKA 4N0BA 4GRIA 2E35A 3M9AA 3F8FA 2KFDA 2R4GA 1FMVA 3MZYA 1QO0D 3LSTA 3F22A 3GTOJ 4OIPF 1Z3XA 5C4JJ 2YVXA 3M3YJ 1SGMA 3QWLA 3BROA 2M0MA 2O3FA 3LQRA 2CV1A 2V6CA 3P9TA 1H8AC 1FP1D 2R7WA 2HWVA 1G3WA 3PQKA 1MW7A 1RI7A 1MNMC 2C6YA 2XF6A 1UHWA 3ZGKA 1KGSA 1RKWA 3QOEA 3IC7A 4B4CA 5KVRA 1WWXA 1CF7A 3KP3A 3C3WA 4M73A 3OYAA 3CCSI 2IS6A 1A6IA 3FXJA 1MMAA 2PMHA 2MH2A 3IUOA 4A3EJ 2P8TA 1JI8A 5HNFA 2L01A 2X1CA 2CGPA 3UR3C 2LY1A 3ML6A 4WX9A 4XRSG 4IHSA 2K3PA 2EBIA 3KZZA 1LEBA 2HYTA 3MMYB 3FBIB 4V2FA 4I6ZA 2JK3A 5J3LA 5GADJ 1ZARA 2I10A 2KL4A 3HDDA 4RB0A 2CV0A 1JXSA 1RPWA 5DTDA 3CF2A 3I3LA 2W82A 4UV9A 1N77A 1G6NA 2GOMA 3BCAA 1XTAA 3KLNA 3OSFA 5H9TA 2HFHA 2R7RA 1P9QC 2XPWA 3SDGA 2BVMA 4E7SA 3BC8A 1D1CA 4IKFA 3PASA 1A36A 2L5QA 4G12A 2DMNA 1WI9A 1OQYA 2GA1A 2WV1A 2NVXJ 2W48A 5ICGA 5LGNA 3CP2A 1O7LA 3M8JA 1ETWA 3BCGA 4AF5A 3RD3A 3HKZA 2ZOZA 3EUHA 3BQZA 4L9NA 1HC8A 3EQLF 3QYFA 3WE3A 2JWTA 1PUFB 5HLIA 2K9QA 4J19A 1QGPA 1HCRA 2LFBA 2V1UA 1WJEA 2K4JA 2RDPA 3TL4X 4JX4A 1XMKA 1XG1A 2M8EA 2LF7A 5J1UA 2VBZA 2L4MA 3HBLA 4WIBA 4CGZA 1FT9A 2GIVA 5E1XA 2IP2A 5AIQA 1IG7A 5HOOA 4XOPA 4ESFA 2B3WA 4YIRX 5C4YA 1I3AA 3JREA 5C3EJ 1W7PD 3OS1A 4Y52J 1GVDA 2E60A 2QQ8A 3J80Z 4G7OF 1MGTA 3KZIC 4O3MA 4CCMA 3S3OA 1MBHA 3BTLA 4PXIA 1D0ZA 4D5CA 2V9VA 2ZFWA 3K4CA 4XN0A 1IN7A 3IH4A 1T38A 2BVLA 3R60A 1MMDA 2DJIA 2RC4A 3FM5A 5L3FA 3IKTA 1YRNA 2KQRA 4RDUA 3W2AA 4BQOA 3HGYA 4IX7A 5KHDA 3WU2C 2EJRA 2QGUA 3O8HA 1CF7B 2CFXA 4IHTA 3F0CA 2DFEA 2K40A 5CVVA 3K4MA 1KU7A 1V5FA 2H6BA 5J6XA 2HQ5A 3ZXSA 2JA8J 5D8LB 3A0HC 2L54A 4ESJA 3L2CA 4E7JA 1FNNA 4FASD 3J7ZI 1NH3A 1LFUP 2VOOA 1FX7A 4ZTFA 2F5FA 1U3EM 3U21A 2VI6A 3BLYA 3HM5A 4Q47A 2KIMA 3S1QJ 5J4YA 5IP6A 2DPUA 4L5JA 3T8TA 5IT9K 3VVZA 4V2GA 2PLYA 2E2IJ 3W3CA 2KZVA 1DP7P 4RM2A 1LKXA 2CW0F 3S2WA 3KFWX 1LVKA 1UI6A 2VKEA 3H5AA 1Y39A 3OIPA 2FMLA 1EH7A 1RC9A 3EETA 3I71A 1ZREA 4HX8A 1IV8A 3OYHA 4I0AA 2OC6A 2DA3A 2GFNA 3ZQ7A 1RZ4A 1D1BA 3EDPA 3LMMA 2OI8A 4C3HJ 3F21A 1BJAA 1FPQA 3DPUA 3C18A 3FXRA 3BWGA 4ACIA 5TJJA 1V3FA 1FTTA 2XVCA 3JRHA 2M8GX 2DYSH 1X1AA 1J2XA 2FMYA 3JW4A 3F8CA 3R6SA 2IVMA 3FMRA 3HRMA 2R7FA 4I99C 5H6QA 2O6GE 1K83J 4HA8A 4PZJA 2DW4A 1UG2A 5D18A 3CO6C 1X58A 1O7FA 4A0XA 2EB7A 1F4KA 1NG7A 1RUOA 4U0WA 4CGRA 4KISA 5H20A 2RVCA 1K7AA 4WXDA 2E19A 1B1BA 2TCTA 2OBPA 5IP7J 1SFUA 3PNVA 2MH9A 1Z6TA 4JP0A 2FSWA 4UUTA 4YG2F 2EK5A 2L7KA 3RKWA 3V7RA 5CXGA 2DA1A 3AL0C 1BM9A 1IGNA 2HVRA 5DCMA 1QHGA 2HZTA 2E2HJ 4IQ4A 4HQEA 2COMA 1I5ZA 4M72A 1SD4A 2ZCWA 5CW8A 1UB9A 1Z9CA 1ITYA 4IHYA 3ZP5A 2DJNA 2QQBA 2DPDA 2YSRA 3K1NA 3RCOA 1L3LA 1YRNB 4ZTJA 4AVZA 2P0WA 1MH4A 2L7MP 2FQ3A 4OAYA 2CQXA 2L02A 2H09A 3IH3A 4J00A 2KLOA 2QQ9A 2O7OA 2W25A 4JNNA 4DJAA 5IYCJ 5FKKA 2NXNB 2AQEA 1OYWA 5E3OA 4H4KC 3B81A 1XGMA 5E20A 4L5IA 1ETQA 2A6HF 3J81Z 3O60A 4CCLA 3GZIA 5JFRA 2V9KA 2ZMEA 2VONA 1HA8A 5J4VA 2GM4A 2VPLA 1WH5A 3MFKA 4O6JA 3F8MA 3HIFA 5HDNA 1XSXA 2XPVA 1U9OA 3CZ6A 3IUVA 2UXHA 4XN3A 2K7LA 3DBLB 4OINF 5DCFA 2DT5A 1GDTA 1SVMA 4BKXA 1J59A 4MQ9F 3H0GJ 1OMIA 2XB5A 5EDNA 2G7GA 4IRHA 4M3FA 4C3JJ 4N4OB 2G7HA 3CMAI 2XAFA 1JKRC 4DYRA 1SAUA 3H9JA 2FF4A 2EV0A 2JT1A 3BJAA 3C2GA 4IRGA 4MIMA 1QBJA 4DIQA 3OYDA 1OPCA 3GVAA 3B6CA 1TLHB 3BNIA 1XN7A 2XC7A 4A5MA 5IOZA 3B6AA 1POGA 3ZOBA 2ELHA 1TW2A 2EIKH 4I0BA 2MGQA 3BY6A 2ME0A 4Y13A 5A2QK 3HHGA 1SFOJ 2Z99A 2ZCNA 4XLHA 1I1SA 2CQKA 1WJAA 3BPXA 3CUOA 3ZQIA 4U9LA 3KIOA 3KNWA 2A2FX 2QSFX 2VXZA 3P9KA 4BXUA 1U9NA 1VQKI 2OAZA 1RRJA 2VJIA 2D1HA 4AWXB 4HX4A 2QKLB 2WY7Q 3OWTA 3CC2I 2H6CA 3FX3A 3FRQA 1LFPA 2R7SA 2DI3A 1D0XA 4BEHA 2L2OA 5D19A 2FBKA 1O57A 1R7JA 2ZCXA 1BJZA 5J8CA 2HVQA 4BGDA 3HXLA 5DCMB 1MMSA 4NHJA 1Y56A 3DPJA 5CVIA 2G7LA 4LGWA 3ISPA 5TRDA 2LH9A 2LLKA 3DQVC 2XRLA 4XLAA 4RB3C 3PIOF 4KDPA 3CP8A 1KA8A 1I6HJ 1KU9A 2Z16A 5CJ9A 2W1OA 3D0SA 2DLLA 1BN5A 4TV7A 2WAFA 4G6DA 5FHPA 2ID3A 2CW8A 2ACJA 4HLYA 2QWWA 3TGNA 2F48A 1XC5A 4A0ZA 3IV5A 4BE1A 3WGGA 5LGTA 2R7XA 3G1LA 3FHZA 3ABLH 1QNTA 1H9GA 2ZMEB 3M1CA 5IOYA 2XF7A 1JTYA 3ESWB 3S1RJ 4B09A 1YOVB 4RGXA 2WAEA 4NC7A 1JT0A 1W5TA 2GWRA 2K4BA 5HLTA 3E6CC 4XKBA 2LP0A 3PNYA 3TOBA 3PSIA 1BW5A 1OR7A 5CKTA 3F6VA 5LLQA 3IWFA 2IS4A 4UDSA 4N9HA 1OLTA 3DKWA 3L00A 3JCUC 5J8FA 1U78A 1FZPB 1GUUA 5DUKA 1WJCA 4X6AJ 2ZOYA 4CDGA 3EUKL 4M6YA 3JRGA 2IU5A 2QIBA 1GXPA 2NVQJ 1EH8A 2P7CB 3OYCA 1VQ8I 2HXIA 3BTCA 2EIJH 3D5RC 4BY1J 3I4MJ 4N4NB 1MNEA 2Y2ZA 2CUEA 3QAHA 4LG3A 4ME9A 3ZN1A 2M5WA 2M7AA 3ZQQA 3BG3A 5EYRA 4AD9A 2K9LA 5E8IA 1UZCA 3ON4A 4PSWA 4XKWA 2QYOA 2R93J 3L2WA 3F8BA 3B02A 2WBMA 2D2WA 2NS8A 1SMYF 2LC2A 2KDOA 1A35A 1JUSA 2R3SA 1OFCX 1WH7A 1EJ9A 2OERA 1SVLA 2FA5A 3ANPA 4U0YA 2ETHA 2FQ4A 2QZ8A 1X3WB 3TO9A 5M5WJ 4GFKA 4QLCU 2M4KA 4BEHB 2PI0A 1MIJA 5KAFC 4BS9A 4CCJA 3TDZC 3RI4A 5DD4A 1LEAA 3M4OJ 1DU0A 3I64A 4X0GA 2NS7A 5GTHC 4M3EA 4YFXF 2H8RA 2VUMJ 4A3GJ 2IJLA 2FE3A 4GCKA 1N25A 3W6VA 5JHUA 2GENA 3E1SA 1HSJA 3KKCA 3Q0VA 3V8LA 3HHHA 4M74A 1T0FC 2Q2EB 1G3SA 3VYSB 1L0OC 1JUMA 1Y0NA 2F2EA 2E7WA 4HV6A 1TNSA 1SD7A 2P81A 2PMUA 3TW7A 3K69A 3OYNA 4AIKA 4KICA 2OPTA 1VNDA 2A69F 3IRRA 2EV6A 5LRRA 2JA6J 3HOXJ 2QSHX 3TP3A 3VVXA 3HOSA 4HZFA 4BUPA 3WHBA 3CUQC 1X3ZB 2XPUA 3HOZJ 2PX9A 3AG2H 3KP5A 2JUCA 4ITVA 4AC0A 1HLVA 3EUPA 3T5XA 4UV8A 3DU5A 1F36A 3I54A 3VSLA 4CICA 4WXCA 1X2NA 3DEWA 5L3CA 3LAJA 4CHUA 2QQAA 5E17F 1BI0A 4XIDA 4MXMA 5HAWA 1IN4A 1Z6RA 2BHZA 2W53A 2I5UA 1IUFA 2KKOA 3FM3A 4B1RA 2Z9OA 1UG0A 3LSJA 1I39A 4OD4A 3H5RA 3FK6A 3OYKA 2ISYA 2BXZA 1K4TA 2IGMA 3C1DA 4XNFA 2CS3A 1O4XA 3E6MA 3HSRA 1S7OA 4HNTA 4MEYF 5H2FC 3CCVI 2FJ1A 3JSOA 3ERED 4RA2A 2DT7B 4LLNA 3HE0A 2Z33A 4RAZA 1JJ6C 1BOBA 2ZXWH 4M3BA 3S93A 2NP3A 1FMWA 2CU7A 2DK8A 4KIBA 2HOAA 1LFBA 4EJVA 2E2JJ 1P7JA 2J5PA 1X1BA 4QTRA 5B5EC 1KU3A 4ENNA 2E71A 5F1JA 4XLEA 5FRMA 4MO7A 5M5XJ 3ABMH 1WHUA 4B43A 3DEEA 5K5QA 2LY9A 2FRHA 2X1EA 2QWTA 4C2TA 3CTAA 4L9JA 5IT3A 3K2AA 2A5YB 3K4BA 1VTNC 4FHTA 1YIOA 3RQ4A 2KJBA 2FBQA 1T08B 2G9WA 1JKPC 3AG4H 3WG9A 3KYDB 4FX4A 2OZUA 2ZXJA 3OYFA 3QP6A 1YX5A 2Q0OA 2ADUA 2HYJA 4JKZA 3K70C 5FKLA 1RKTA 2V1NA 3HL2A 4A2UA 5ICEA 4PCQA 4HDUA 1W1WE 1J0RA 1DU6A 1OCOH 2WGBA 9ANTA 4ZYGA 4I02A 5JR3A 2RN7A 5GAHJ 2EZKA 5E1ZB 2X51A 5LD2C 3DP7A 5CLSA 3OYGA 1Z1DA 3H9GA 2HKOA 2YS9A 1D1AA 2H94A 3OV8A 2VQCA 5HODA 4YRVA 1W7PA 1BIBA 5FKNA 4OIRF 3Q3SA 4PDKA 5KCMA 3Q0UA 4IXAA 4AUXA 3I4NJ 3N97A 1ON1A 1STZA 4AC6A 4DVYP 4GFBA 3QPHA 3BJOA 3CJTB 2VC0A 4BL0B 5F04A 2BV6A 1BL0A 4F7ZA 2K5CA 5FKOA 4W1UA 2ECBA 2RAEA 5L3DA 2XDVA 3JRBA 4E7HA 5J40A 3CCJI 1ZGAA 1YO5C 3SWHA 5FB2A 1ON2A 3DKXA 4B8XA 1A31A 3BRUA 5D4SA 1ODDA 2PG4A 3CCRI 3SJMA 2D5VA 2XAGA 4AYBN 1O3RA 5C4XJ 5FRNA 1IRGA 1HOMA 4M9SA 4U88A 4G9YA 4L5EA 4QIWN 4C9YA 3BR6A 3DF8A 3CCLI 2F4IA 1ZQ3P 1EH6A 1MJBA 2HOTA 4XRSA 1OCPA 2V4JC 4HW0A 1VQOI 1F5TA 2NX4A 2MW8A 1ZRCA 3U1KA 3ULQB 3DKYA 4XSXF 3ZMZA 4KMFA 1Z77A 2WC2A 2K02A 2DA7A 1TW3A 1B8IA 1YS7A 2EFWA 4F92B 1USSA 3HTSB 1FBUA 1LUJB 2IAIA 5ILVA 4JOMA 4M9ZA 3IRQA 1ZR4A 2FBHA 2KRFA 4NB5A 5EZGA 2ZJRF 2B63J 1K6YA 3HTUA 2H1KA 3FHNA 2LBFA 2CQ7A 2XAHA 2DMUA 1R22A 3U1DA 2EILH 1XSVA 1MJAA 2M34A 4ZYDA 3PJRA 2V79A 2PZ9A 4A6EA 3F6OA 3KEOA 4EJWA 1FLIA 1YLFA 2VKHA 4IZZA 2TDXA 2HDDA 4G6TB 2COBA 1ULYA 1W5SA 4OAZA 4F52A 1TWAJ 3K70D 1S5LC 3BG7A 2OTLI 2E34A 1BIAA 4NNJA 5B1BH 2X6XA 3MKZA 3K10A 4NC6A 3RDIA 2ISZA 2XGEA 1VI0A 3C2HA 3LJLA 2DFIA 3Q0WA 3QQAA 4CUGA 5KNLA 1JUPA 4ZDOA 3ANGA 2GXAA 4JX5A 3K9TA 1W7PB 2XHKA 4F55A 4BQNA 4BBRJ 1ETYA 4U7DA 2R7OA 3CCYA 4LLGF 1LDJA 4YZEA 2FD5A 2P5VA 3G3ZA 2B7EA 1P2FA 2DBBA 3QPTA 3BDDA 1G3YA 3SDBA 4I09A 2W57A 3ZR8X 4UNOA 2Q24A 2XRNA 3LA3A 3QYBA 4IOCF 5IT9Z 3RYPA 2VQLA 3L2VA 5JVGF 3CF5F 2DCEA 5J1YA 2ZJQF 3FK7A 3I59A 1HQCA 4UVCA 4ZDPA 2EFQA 1SMTA 4ASNA 2XSDC 5F27A 3R4KA 4GYIA 1WVRA 2V1DA 1X2MA 2E5ZA 2FOWA 3ZN0A 3KCCA 3C2BA 4M3GA 3D5SC 2WAQA 1YFHA 3H36A 1ETOA 4HYEA 5C44J 3F72A 3CMMA 3HEFA 4RBOA 1SD6A 4KWAA 3NEUA 4D0PA 1HW1A 1W0TA 3GTKJ 2MA3A 1APLC 3BG9A 1Z7UA 4A3BJ 2JTVA 2ZJ2A 3R61A 2BY1A 1Y1WJ 4MFEA 4RAFA 1B8IB 3CQZJ 4NDLA 5B1AH 4IRIA 3WHCA 1RR8C 2XKPA 2R7VA 3PFIA 2R7TA 2ZNZA 4Y4RA 1I1GA 4BDYA 3F8NA 3S8PA 5HS9A 3CJRB 1WZ2A 2OA4A 4BH9A 1GT0C 2LBFB 1YJ9I 1ZG5A 2GIZA 4GCTA 1U8BA 2GZWA 2Z2SB 1AWCA 1P4XA 2JPCA 2DK5A 1R4MB 3AKZA 2Z3YA 3H92A 3H9QA 4L9VA 1T98A 4ENMA 3CD6I 1E17A 1YHQI 1R1VA 4G8XA 4RMNA 5DM7F 5DEQA 1J7KA 5DYMA 1WKMA 1OJLA 5JVTA 2JVGA 2HDWA 5EF6A 5EEHA 4RS8A 2X48A 2HEOA 3OS0A 4XLFA 2WAQN 3REOA 4L62A 1WJDA 2JMWA 4MGRA 3K7AJ 5EJCA 3MEXA 3U2RA 3CJDA 2IXSA 3GYHX 3K8PC 2LR8A 1IRXA 3P9IA 5K7ZA 3VW2A 2F4MB 1T2KA 1D5VA 1E2XA 2OJED 3BP8A 3GZ5A 2LKSA 1VQLI 2DOEA 2FNPA 2N8GA 4II3A 3EUHC 2G3BA 4PJ0C 4JX6A 3OYEA 2NYXA 5TISC 2UXXA 1Z21A 2IA2A 2KZGA 3BPVA 3H0DA 3GTGJ 3VPRA 3HOYJ 3VB2A 1YIJI 1GXQA 2L4AA 3I59B 2K9MA 4Y33A 2E1NA 1HW2A 3OYMA 2V57A 1MKMA 3TBIA 2HTSA 2YPRA 1ZH5A 2VKDA 1R6RA 2BXYA 2K3FA 3S32A 4MQVA 3S2DJ 5FD5A 4FCYA 5FLMJ 1Y8QB 1JHHA 3BG6A 3LSHA 2IT0A 4K2EA 2QBYA 2W24A 4BDZA 2KIFA 3COLA 1HSTA 1QZZA 1B9NA 3G4SI 2JSCA 2PEXA 4XBFA 1RR7A 5A2QZ 3DBRB 3KP6A 3GFLA 3C7JA 2GBYA 4BJTA 4DBRA 3HOVJ 1HKTA 3S16J 3O2PE 1FEXA 3GXOA 2FXAA 3NWSA 3N4MA 1ETKA 3NS4A 1IAWA 5LEJA 3NWTA 2ZSIB 2LF8A 3EYYA 1V5GA 3SZPA 3TDUC 2UXUA 4QSHA 2OQRA 1VF9A 3K4JA 1FWZA 5FFZA 1LB2A 1IXCA 5F0CA 4IO9F 2HU9A 2MYSA 3PL8A 4U7BA 1OCRH 1XCBA 2EFPA 4QPQA 1SAXA 3UKGA 4BJ5C 4G7HF 1ZAOA 3GFJA 1Y8RB 2K9SA 1QZEA 1F9NA 3H1CA 5LGUA 4U9NA 1ETXA 4N9IA 1ZN2A 1G4DA 3E5XA 3O8GA 4PGGA 2A3SA 2CUZA 3DTEA 4JBAA 4LITA 1PVEA 2QKOA 3KKDA 5IY5H 3QPLA 3QOPA 5D5WB 4HOBA 4LFUA 2VBXA 1IZ1A 1DUXC 3NI7A 4ICHA 1QZYA 4XRFA 5D6EA 3BCBA 1AA7A 1J09A 3WU0A 2VQHA 3MKYB 1N78A 1JGSA 3SEZA
chains in the Genus database with same CATH topology
2QCOA 5K7FA 3ON2A 2EQRA 3HIMA 5EG0A 3M4OJ 3JRDA 3ZQCA 1LE8B 1DU0A 4X1EA 2NS7A 2GLOA 4M3EA 2H8RA 3JRCA 1AHDP 2VUMJ 4A3GJ 3G56A 5HSZA 2JA7J 2ME6A 4GCKA 3HTHA 3W6VA 2DMQA 2M2EA 1UI5A 2GENA 4D7NA 2R5ZB 1AKHA 1Y1VJ 4A3FJ 3ZQGA 3KKCA 3Q0VA 1T33A 4JL3A 2Y30A 5IPAA 1ETVA 3DCFA 3FIWA 3S1NJ 2DA5A 1JUMA 1IJWC 2M0CA 2P81A 3TW7A 2LTPA 3S17J 5EGOB 3FKIJ 2OPTA 1VNDA 1W0UA 3G1OA 4DYQA 1H88C 2JA6J 3PO2J 4GFKA 3HOXJ 2AHQA 3TP3A 1PUFA 3VVXA 5EFYA 3G7RA 3QPSA 2ZB9A 4W97A 3WHBA 3HOZJ 2XPUA 3HKZN 4A69C 3NRGA 4AC0A 1HLVA 3EUPA 2ECCA 3FISA 4NN1A 1F43A 1ZR2A 1F36A 4MLOA 3A03A 1X2NA 2QTQA 3DEWA 2RHAA 4MFDA 3A01A 5HAWA 4JYKA 4XIDA 4MXMA 5D1RA 1MH3A 4A3DJ 2K9NA 3NXCA 4BY7J 1BA5A 4A3LJ 2W53A 1IUFA 4B1RA 3GTOJ 3LSJA 1QVUA 1TWHJ 2JN6A 5C4JJ 1VFCA 3M3YJ 3FK6A 1SGMA 4A3KJ 1O4XA 3P9TA 1H8AC 1HF0A 2Y31A 3OSGA 3BG5A 5GP9A 2KDZA 1MNMC 2UXOA 3KZ9A 2FJ1A 1T56A 1MBGA 4FE4A 1RKWA 3HE0A 4B4CA 2R92J 1JJ6C 3LOCA 4M3BA 5IP9J 2NP3A 1A6IA 2CU7A 4BXXJ 2MG4A 2HOAA 2D6YA 2XGDA 1LFBA 3NAUA 4A3EJ 2E2JJ 3OOUA 1P7JA 4QTRA 5F1JA 4XRSG 2HYTA 2EBIA 3TP0A 4MO7A 5M5XJ 3VOKA 3T6NA 5FJ8J 1NK2P 2L9RA 4V2FA 2Y0SN 4I6ZA 2JK3A 5J3LA 3AQSA 2LY9A 2XGCA 2LVSA 2I10A 2CRGA 2QWTA 3K2AA 3HDDA 5EG0B 1RPWA 3GBGA 5DTDA 2FBQA 3VVYA 3LSRA 3RKQA 5IYBJ 1XS9A 1JKPC 4LOCA 4HNVA 3OSFA 5H9TA 2DG7A 2XPWA 1FIPA 2E1OA 3SDGA 5GPCA 2HYJA 1FIAA 4JKZA 5DS9A 1AKHB 3PASA 5FKLA 1RKTA 4G12A 1WCMJ 2DMNA 5IYDJ 2WV1A 2NVXJ 2W48A 1DU6A 2WGBA 9ANTA 4NELA 4AF5A 1ETWA 2EZKA 4FE7A 1A5JA 3BCGA 3RD3A 2NOGA 1QVTA 2ZOZA 3BQZA 2PBXA 2YS9A 2JWTA 1PUFB 2QOPA 3BT9A 2K9QA 4J19A 5HODA 1HCRA 5FKNA 2LFBA 4AUXA 3Q3SA 4AC6A 3I4NJ 1UMQA 3Q0UA 4JX4A 4GFBA 1XG1A 5J1UA 1R9TJ 1B72A 3HTAA 4S0HB 3HBLA 5F04A 1E3OC 1IG7A 1BL0A 5FKOA 5FGLA 3A01B 5C4YA 3ZQFA 5C3EJ 4W1UA 2ECBA 2RAEA 3JREA 5M5YJ 4Y52J 1GVDA 4A3MJ 1I50J 3HOWJ 3JRBA 1Z0XA 3JRFA 1IV6A 1GV5A 4A3CJ 1MBHA 3BTLA 3MVPA 3HTJA 3RH2A 2L7ZA 4PXIA 3JR9A 4D5CA 3TW6A 5DAJA 4EEFG 2O9LA 2AO9A 4C3IJ 3BRUA 3IH4A 3SJMA 5GPAA 2D5VA 4AYBN 3BR1A 1TWGJ 1FJLA 1S7EA 2YUSA 5M3MJ 1YRNA 5C4XJ 4RDUA 1OCTC 4XRMA 1HOMA 3HGYA 2IBDA 4QIWN 4L5EA 5FKMA 3TEDA 3O8HA 3BR6A 4IHWA 4DW6A 3F0CA 2K40A 3MKLA 5K58A 1ZQ3P 3MN2A 2HOTA 4A93J 4XRSA 1OCPA 5AQCA 2HQ5A 2JA8J 3S15J 2EZHA 3CMYA 2NX4A 2MW8A 3BJBA 5CXIA 2QF7A 2VPRA 1QRYA 4IEJA 1NK3P 1LFUP 4GCLA 1Z77A 3PO3J 2L7FP 2DA7A 3PPBA 5E3NA 1B8IA 2ZCMA 2VI6A 3HM5A 3S1QJ 2O7TA 1IDYA 5IP6A 1JTXA 2IAIA 3VVZA 4V2GA 5HBUA 2E2IJ 2DA2A 3BTJA 1ZR4A 3LSPA 3JRIA 5EZGA 2B63J 1UI6A 3S14J 2VKEA 2H1KA 2L0KA 2DMUA 3VIBA 2M34A 1ZK8A 2DA3A 2GFNA 2PZ9A 5F0HA 1HDPA 2OI8A 4C3HJ 2HDDA 2COBA 1JKOC 4ACIA 2TRTA 3OIOA 1TWAJ 1FTTA 3VP5A 3JRHA 2M8GX 3F1BA 3S5RA 4I76A 1MSFC 3RZOJ 3EGQA 5EZHA 2XGEA 1VI0A 1CQTA 3GTGJ 3QBMA 3V78A 3GTJJ 3LJLA 1K83J 3Q0WA 2LK2A 3QQAA 1JUPA 1UG2A 5JLXA 3ANGA 5D18A 4JX5A 1X58A 5EEAA 1ZGWA 4BBRJ 1ETYA 3H3VK 3D1NI 3CCYA 1B72B 4CGRA 4FISA 4YZEA 2FD5A 4GFLA 4DYCA 4DZPA 2E19A 4DZJA 1ZKGA 2TCTA 5IP7J 3BQYA 3VW1A 3GTQJ 1JKQC 2DA6A 4Y7NJ 2F07A 4JP0A 4UUTA 2HKUA 2Q24A 5CXGA 2DA1A 3V6GA 3CWRA 1IGNA 2YVHA 3A02A 3LNQA 2E2HJ 5J1YA 2Y9YA 1Q1VA 1ORKA 3FK7A 5FMPA 5CW8A 4XICA 2CUFA 1K61A 1ITYA 4IHYA 3LHQA 2XSDC 5F27A 2DJNA 2CQQA 2G7SA 3HTIA 2REKA 3GTLJ 1YRNB 3ZQLA 4UUSA 1X2MA 1MH4A 2L7MP 2ID6A 2CQXA 3HOUJ 3C2BA 2M9HA 4M3GA 3GTPJ 2IEKA 3IH3A 3BHQA 1ETOA 2G0EA 2O7OA 5C44J 4JNNA 3HEFA 5IYCJ 5FKKA 4RBOA 4KWAA 5E3OA 2ELKA 3B81A 1MSEC 1W0TA 3GTKJ 1APLC 1JT6A 3BG9A 1ETQA 2EH3A 2EZLA 4A3BJ 3O60A 3BR0A 3GZIA 2DTZA 1UHSA 1Y1WJ 4MFEA 1JJ8C 1B8IB 5JLWA 3BTIA 3CQZJ 4NDLA 2GM4A 5J1RA 4CYCA 2O8KA 4A3IJ 2UXIA 1WH5A 3WHCA 2YU9J 2XPVA 1U9OA 3IUVA 2CJJA 5BNGA 1MBKA 3RQIA 2UXHA 3NNRA 2HXOA 3HGGA 1GDTA 4B3AA 4BKXA 3L1PA 1GT0C 2LKXA 3H0GJ 2NP5A 1QPIA 1TC3C 1H89C 2XB5A 5EDNA 3BR2A 2R5YA 2G7GA 1U8BA 4GCTA 4M3FA 3RZDJ 4C3JJ 1G2HA 1RETA 1JKRC 4DYRA 4ABZA 4MIMA 2DA4A 1TWFJ 3B6CA 3BNIA 4MK6A 1OJLA 5IOZA 3B6AA 1POGA 5F08A 4FTHA 3ZOBA 2X9DA 4BBSJ 4M3DA 2RASA 2OF7A 2MGQA 5EF6A 2ME0A 2R0QC 3E7QA 2X48A 1SFOJ 2ZCNA 3VUQA 2WAQN 2YVEA 3QKXA 4L62A 2JMWA 3K7AJ 2PMZN 3NPIA 3ZQIA 3KNWA 3CJDA 1ZTRA 2LR8A 1U9NA 4IHXA 3VW2A 2DMTA 5K7ZA 3VOXA 2N8GA 2HI3A 2G3BA 4JX6A 2R7ZJ 3FRQA 5D19A 3HB9A 1LE8A 2ZCXA 1BJZA 3VPRA 1D5YA 3HOYJ 1NTCA 3DPJA 2G7LA 2VKVA 1MBJA 2LLKA 2FX0A 1JGGA 2XRLA 2LD5A 3S1MJ 3G1MA 2V57A 3PM1A 2R5ZA 2DG8A 4C2MJ 3IH2A 1I6HJ 4UUSB 2NVTJ 1IC8A 5K7HA 2Y9ZA 1HDDC 1TWCJ 3S2DJ 3AQTA 2WB1N 3MNLA 4FCYA 2DMPA 3BR5A 5FLMJ 3GTMJ 2HOSA 5FHPA 2ID3A 3COLA 3CRJA 5EGOA 3SFIA 4M6VA 2UXPA 5E3MA 1RR7A 1XC5A 3IV5A 2DN0A 2GBYA 1FTZA 3HOVJ 3G1LA 3S16J 3C07A 4D7MA 3VW0A 5IOYA 1AU7A 1FEXA 4HKUA 1JTYA 1JT0A 3S1RJ 1MBEA 5E3LA 4CYCB 1EF4A 1ETKA 5M3FJ 1SANA 2LP0A 3LSGA 2EZIA 3ZQHA 3JRAA 1BW5A 1P7IA 5F0FA 1WGXA 4UDSA 2JA5J 1WPKA 2UXUA 2X6OA 3LWJA 4QSHA 1VF9A 2KT0A 3BR3A 2R5YB 1U78A 1IDZA 5F0CA 3JSJA 1ENHA 1GUUA 2WUIA 4X6AJ 2ZOYA 2NVYJ 3E7LA 1WI3A 3JRGA 2IU5A 2QIBA 2NVQJ 1GV2A 5FLVA 2HXIA 1RESA 3BTCA 4BY1J 3I4MJ 3S2HJ 3UKGA 1IRZA 2GUHA 2Y2ZA 2CUEA 4ME9A 2K9SA 2XDNA 4D5FA 1ETXA 2XB0X 3BG3A 5EYRA 2MSYA 3O8GA 3GEUA 3ON4A 4IHVA 2QKOA 3KKDA 2R93J 3QPLA 3NARA 4XK4A 1BW6A 3NI7A 4A3JJ 4ICHA 2NS8A 1MBFA 3ANPA 1JUSA 2OERA 1OFCX 1WH7A 2JJ7A 3CDLA 2FQ4A 1I3QJ 5M5WJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QCO A;  5K7F A;  3ON2 A;  2EQR A;  3HIM A;  5EG0 A;  3M4O J;  3JRD A;  3ZQC A;  1LE8 B;  1DU0 A;  4X1E A;  2NS7 A;  2GLO A;  4M3E A;  2H8R A;  3JRC A;  1AHD P;  2VUM J;  4A3G J;  3G56 A;  5HSZ A;  2JA7 J;  2ME6 A;  4GCK A;  3HTH A;  3W6V A;  2DMQ A;  2M2E A;  1UI5 A;  2GEN A;  4D7N A;  2R5Z B;  1AKH A;  1Y1V J;  4A3F J;  3ZQG A;  3KKC A;  3Q0V A;  1T33 A;  4JL3 A;  2Y30 A;  5IPA A;  1ETV A;  3DCF A;  3FIW A;  3S1N J;  2DA5 A;  1JUM A;  1IJW C;  2M0C A;  2P81 A;  3TW7 A;  2LTP A;  3S17 J;  5EGO B;  3FKI J;  2OPT A;  1VND A;  1W0U A;  3G1O A;  4DYQ A;  1H88 C;  2JA6 J;  3PO2 J;  4GFK A;  3HOX J;  2AHQ A;  3TP3 A;  1PUF A;  3VVX A;  5EFY A;  3G7R A;  3QPS A;  2ZB9 A;  4W97 A;  3WHB A;  3HOZ J;  2XPU A;  3HKZ N;  4A69 C;  3NRG A;  4AC0 A;  1HLV A;  3EUP A;  2ECC A;  3FIS A;  4NN1 A;  1F43 A;  1ZR2 A;  1F36 A;  4MLO A;  3A03 A;  1X2N A;  2QTQ A;  3DEW A;  2RHA A;  4MFD A;  3A01 A;  5HAW A;  4JYK A;  4XID A;  4MXM A;  5D1R A;  1MH3 A;  4A3D J;  2K9N A;  3NXC A;  4BY7 J;  1BA5 A;  4A3L J;  2W53 A;  1IUF A;  4B1R A;  3GTO J;  3LSJ A;  1QVU A;  1TWH J;  2JN6 A;  5C4J J;  1VFC A;  3M3Y J;  3FK6 A;  1SGM A;  4A3K J;  1O4X A;  3P9T A;  1H8A C;  1HF0 A;  2Y31 A;  3OSG A;  3BG5 A;  5GP9 A;  2KDZ A;  1MNM C;  2UXO A;  3KZ9 A;  2FJ1 A;  1T56 A;  1MBG A;  4FE4 A;  1RKW A;  3HE0 A;  4B4C A;  2R92 J;  1JJ6 C;  3LOC A;  4M3B A;  5IP9 J;  2NP3 A;  1A6I A;  2CU7 A;  4BXX J;  2MG4 A;  2HOA A;  2D6Y A;  2XGD A;  1LFB A;  3NAU A;  4A3E J;  2E2J J;  3OOU A;  1P7J A;  4QTR A;  5F1J A;  4XRS G;  2HYT A;  2EBI A;  3TP0 A;  4MO7 A;  5M5X J;  3VOK A;  3T6N A;  5FJ8 J;  1NK2 P;  2L9R A;  4V2F A;  2Y0S N;  4I6Z A;  2JK3 A;  5J3L A;  3AQS A;  2LY9 A;  2XGC A;  2LVS A;  2I10 A;  2CRG A;  2QWT A;  3K2A A;  3HDD A;  5EG0 B;  1RPW A;  3GBG A;  5DTD A;  2FBQ A;  3VVY A;  3LSR A;  3RKQ A;  5IYB J;  1XS9 A;  1JKP C;  4LOC A;  4HNV A;  3OSF A;  5H9T A;  2DG7 A;  2XPW A;  1FIP A;  2E1O A;  3SDG A;  5GPC A;  2HYJ A;  1FIA A;  4JKZ A;  5DS9 A;  1AKH B;  3PAS A;  5FKL A;  1RKT A;  4G12 A;  1WCM J;  2DMN A;  5IYD J;  2WV1 A;  2NVX J;  2W48 A;  1DU6 A;  2WGB A;  9ANT A;  4NEL A;  4AF5 A;  1ETW A;  2EZK A;  4FE7 A;  1A5J A;  3BCG A;  3RD3 A;  2NOG A;  1QVT A;  2ZOZ A;  3BQZ A;  2PBX A;  2YS9 A;  2JWT A;  1PUF B;  2QOP A;  3BT9 A;  2K9Q A;  4J19 A;  5HOD A;  1HCR A;  5FKN A;  2LFB A;  4AUX A;  3Q3S A;  4AC6 A;  3I4N J;  1UMQ A;  3Q0U A;  4JX4 A;  4GFB A;  1XG1 A;  5J1U A;  1R9T J;  1B72 A;  3HTA A;  4S0H B;  3HBL A;  5F04 A;  1E3O C;  1IG7 A;  1BL0 A;  5FKO A;  5FGL A;  3A01 B;  5C4Y A;  3ZQF A;  5C3E J;  4W1U A;  2ECB A;  2RAE A;  3JRE A;  5M5Y J;  4Y52 J;  1GVD A;  4A3M J;  1I50 J;  3HOW J;  3JRB A;  1Z0X A;  3JRF A;  1IV6 A;  1GV5 A;  4A3C J;  1MBH A;  3BTL A;  3MVP A;  3HTJ A;  3RH2 A;  2L7Z A;  4PXI A;  3JR9 A;  4D5C A;  3TW6 A;  5DAJ A;  4EEF G;  2O9L A;  2AO9 A;  4C3I J;  3BRU A;  3IH4 A;  3SJM A;  5GPA A;  2D5V A;  4AYB N;  3BR1 A;  1TWG J;  1FJL A;  1S7E A;  2YUS A;  5M3M J;  1YRN A;  5C4X J;  4RDU A;  1OCT C;  4XRM A;  1HOM A;  3HGY A;  2IBD A;  4QIW N;  4L5E A;  5FKM A;  3TED A;  3O8H A;  3BR6 A;  4IHW A;  4DW6 A;  3F0C A;  2K40 A;  3MKL A;  5K58 A;  1ZQ3 P;  3MN2 A;  2HOT A;  4A93 J;  4XRS A;  1OCP A;  5AQC A;  2HQ5 A;  2JA8 J;  3S15 J;  2EZH A;  3CMY A;  2NX4 A;  2MW8 A;  3BJB A;  5CXI A;  2QF7 A;  2VPR A;  1QRY A;  4IEJ A;  1NK3 P;  1LFU P;  4GCL A;  1Z77 A;  3PO3 J;  2L7F P;  2DA7 A;  3PPB A;  5E3N A;  1B8I A;  2ZCM A;  2VI6 A;  3HM5 A;  3S1Q J;  2O7T A;  1IDY A;  5IP6 A;  1JTX A;  2IAI A;  3VVZ A;  4V2G A;  5HBU A;  2E2I J;  2DA2 A;  3BTJ A;  1ZR4 A;  3LSP A;  3JRI A;  5EZG A;  2B63 J;  1UI6 A;  3S14 J;  2VKE A;  2H1K A;  2L0K A;  2DMU A;  3VIB A;  2M34 A;  1ZK8 A;  2DA3 A;  2GFN A;  2PZ9 A;  5F0H A;  1HDP A;  2OI8 A;  4C3H J;  2HDD A;  2COB A;  1JKO C;  4ACI A;  2TRT A;  3OIO A;  1TWA J;  1FTT A;  3VP5 A;  3JRH A;  2M8G X;  3F1B A;  3S5R A;  4I76 A;  1MSF C;  3RZO J;  3EGQ A;  5EZH A;  2XGE A;  1VI0 A;  1CQT A;  3GTG J;  3QBM A;  3V78 A;  3GTJ J;  3LJL A;  1K83 J;  3Q0W A;  2LK2 A;  3QQA A;  1JUP A;  1UG2 A;  5JLX A;  3ANG A;  5D18 A;  4JX5 A;  1X58 A;  5EEA A;  1ZGW A;  4BBR J;  1ETY A;  3H3V K;  3D1N I;  3CCY A;  1B72 B;  4CGR A;  4FIS A;  4YZE A;  2FD5 A;  4GFL A;  4DYC A;  4DZP A;  2E19 A;  4DZJ A;  1ZKG A;  2TCT A;  5IP7 J;  3BQY A;  3VW1 A;  3GTQ J;  1JKQ C;  2DA6 A;  4Y7N J;  2F07 A;  4JP0 A;  4UUT A;  2HKU A;  2Q24 A;  5CXG A;  2DA1 A;  3V6G A;  3CWR A;  1IGN A;  2YVH A;  3A02 A;  3LNQ A;  2E2H J;  5J1Y A;  2Y9Y A;  1Q1V A;  1ORK A;  3FK7 A;  5FMP A;  5CW8 A;  4XIC A;  2CUF A;  1K61 A;  1ITY A;  4IHY A;  3LHQ A;  2XSD C;  5F27 A;  2DJN A;  2CQQ A;  2G7S A;  3HTI A;  2REK A;  3GTL J;  1YRN B;  3ZQL A;  4UUS A;  1X2M A;  1MH4 A;  2L7M P;  2ID6 A;  2CQX A;  3HOU J;  3C2B A;  2M9H A;  4M3G A;  3GTP J;  2IEK A;  3IH3 A;  3BHQ A;  1ETO A;  2G0E A;  2O7O A;  5C44 J;  4JNN A;  3HEF A;  5IYC J;  5FKK A;  4RBO A;  4KWA A;  5E3O A;  2ELK A;  3B81 A;  1MSE C;  1W0T A;  3GTK J;  1APL C;  1JT6 A;  3BG9 A;  1ETQ A;  2EH3 A;  2EZL A;  4A3B J;  3O60 A;  3BR0 A;  3GZI A;  2DTZ A;  1UHS A;  1Y1W J;  4MFE A;  1JJ8 C;  1B8I B;  5JLW A;  3BTI A;  3CQZ J;  4NDL A;  2GM4 A;  5J1R A;  4CYC A;  2O8K A;  4A3I J;  2UXI A;  1WH5 A;  3WHC A;  2YU9 J;  2XPV A;  1U9O A;  3IUV A;  2CJJ A;  5BNG A;  1MBK A;  3RQI A;  2UXH A;  3NNR A;  2HXO A;  3HGG A;  1GDT A;  4B3A A;  4BKX A;  3L1P A;  1GT0 C;  2LKX A;  3H0G J;  2NP5 A;  1QPI A;  1TC3 C;  1H89 C;  2XB5 A;  5EDN A;  3BR2 A;  2R5Y A;  2G7G A;  1U8B A;  4GCT A;  4M3F A;  3RZD J;  4C3J J;  1G2H A;  1RET A;  1JKR C;  4DYR A;  4ABZ A;  4MIM A;  2DA4 A;  1TWF J;  3B6C A;  3BNI A;  4MK6 A;  1OJL A;  5IOZ A;  3B6A A;  1POG A;  5F08 A;  4FTH A;  3ZOB A;  2X9D A;  4BBS J;  4M3D A;  2RAS A;  2OF7 A;  2MGQ A;  5EF6 A;  2ME0 A;  2R0Q C;  3E7Q A;  2X48 A;  1SFO J;  2ZCN A;  3VUQ A;  2WAQ N;  2YVE A;  3QKX A;  4L62 A;  2JMW A;  3K7A J;  2PMZ N;  3NPI A;  3ZQI A;  3KNW A;  3CJD A;  1ZTR A;  2LR8 A;  1U9N A;  4IHX A;  3VW2 A;  2DMT A;  5K7Z A;  3VOX A;  2N8G A;  2HI3 A;  2G3B A;  4JX6 A;  2R7Z J;  3FRQ A;  5D19 A;  3HB9 A;  1LE8 A;  2ZCX A;  1BJZ A;  3VPR A;  1D5Y A;  3HOY J;  1NTC A;  3DPJ A;  2G7L A;  2VKV A;  1MBJ A;  2LLK A;  2FX0 A;  1JGG A;  2XRL A;  2LD5 A;  3S1M J;  3G1M A;  2V57 A;  3PM1 A;  2R5Z A;  2DG8 A;  4C2M J;  3IH2 A;  1I6H J;  4UUS B;  2NVT J;  1IC8 A;  5K7H A;  2Y9Z A;  1HDD C;  1TWC J;  3S2D J;  3AQT A;  2WB1 N;  3MNL A;  4FCY A;  2DMP A;  3BR5 A;  5FLM J;  3GTM J;  2HOS A;  5FHP A;  2ID3 A;  3COL A;  3CRJ A;  5EGO A;  3SFI A;  4M6V A;  2UXP A;  5E3M A;  1RR7 A;  1XC5 A;  3IV5 A;  2DN0 A;  2GBY A;  1FTZ A;  3HOV J;  3G1L A;  3S16 J;  3C07 A;  4D7M A;  3VW0 A;  5IOY A;  1AU7 A;  1FEX A;  4HKU A;  1JTY A;  1JT0 A;  3S1R J;  1MBE A;  5E3L A;  4CYC B;  1EF4 A;  1ETK A;  5M3F J;  1SAN A;  2LP0 A;  3LSG A;  2EZI A;  3ZQH A;  3JRA A;  1BW5 A;  1P7I A;  5F0F A;  1WGX A;  4UDS A;  2JA5 J;  1WPK A;  2UXU A;  2X6O A;  3LWJ A;  4QSH A;  1VF9 A;  2KT0 A;  3BR3 A;  2R5Y B;  1U78 A;  1IDZ A;  5F0C A;  3JSJ A;  1ENH A;  1GUU A;  2WUI A;  4X6A J;  2ZOY A;  2NVY J;  3E7L A;  1WI3 A;  3JRG A;  2IU5 A;  2QIB A;  2NVQ J;  1GV2 A;  5FLV A;  2HXI A;  1RES A;  3BTC A;  4BY1 J;  3I4M J;  3S2H J;  3UKG A;  1IRZ A;  2GUH A;  2Y2Z A;  2CUE A;  4ME9 A;  2K9S A;  2XDN A;  4D5F A;  1ETX A;  2XB0 X;  3BG3 A;  5EYR A;  2MSY A;  3O8G A;  3GEU A;  3ON4 A;  4IHV A;  2QKO A;  3KKD A;  2R93 J;  3QPL A;  3NAR A;  4XK4 A;  1BW6 A;  3NI7 A;  4A3J J;  4ICH A;  2NS8 A;  1MBF A;  3ANP A;  1JUS A;  2OER A;  1OFC X;  1WH7 A;  2JJ7 A;  3CDL A;  2FQ4 A;  1I3Q J;  5M5W J; 
#chains in the Genus database with same CATH topology
 3V42 A;  5L3E A;  2IA1 A;  3AL0 B;  2AXT C;  3GCM A;  4DBQ A;  2WA0 A;  4EV0 A;  1OCZ H;  2OQG A;  4CCK A;  5EG0 A;  4XSZ F;  1QHH D;  3JRD A;  4GYG A;  3KET A;  1MJ9 A;  1NG6 A;  2GLO A;  4XQF A;  4BAY A;  4F93 B;  4HSR A;  5HSZ A;  3G56 A;  2JA7 J;  3HTH A;  3FXK A;  1BI3 A;  3CLO A;  2M2E A;  1OYY A;  1KYZ A;  5FRO A;  1O3Q A;  2XAJ A;  1AKH A;  2X6Y A;  1IXR C;  1WQ2 A;  2E5N A;  1R00 A;  3ASN H;  3R0A A;  4F91 B;  2W4S A;  2IS2 A;  4JL3 A;  2Y30 A;  4FQG A;  2M3A A;  1UEL B;  2DA5 A;  1SFX A;  2JSP A;  3VSK A;  1LPQ A;  3CCU I;  3AAF A;  2QBY B;  3S17 J;  2NNY A;  1E3P A;  1P92 A;  4P1W A;  1FP2 A;  3SZT A;  4II2 A;  3G1O A;  4DYQ A;  3PO2 J;  3ZMU A;  1A6Q A;  5BOX A;  4PJM A;  1FOW A;  5EFY A;  3QPS A;  4U0V A;  1XMX A;  2Y0S A;  1ZRF A;  3NRG A;  4NN1 A;  3I55 I;  1KQ0 A;  3ABK H;  3WTU C;  1ZEL A;  2ZJP F;  4XKV A;  1WJ5 A;  2A68 F;  3DU6 A;  2DAO A;  4JYK A;  4A3D J;  4EGY A;  2DT6 A;  4GO1 A;  4A3L J;  4JK1 X;  3JAM Z;  2P6S A;  1FC3 A;  1LJ9 A;  4L0Z B;  1TWH J;  2JN6 A;  4L9T A;  2DQR A;  4A0Y A;  3SQN A;  1IN6 A;  2MC3 A;  3W2V A;  1HF0 A;  2Y31 A;  3OSG A;  1D0Y A;  3HRS A;  2KDZ A;  5HDK A;  4CXF A;  1T56 A;  5F64 A;  1MBG A;  1X4P A;  2O8X A;  5LHI A;  3OIQ A;  1YW8 A;  3KYL A;  4OMZ A;  5CQG A;  1PDN C;  3HSE A;  3FWE A;  2OD5 A;  5IP9 J;  4NQW A;  4BXF A;  2A61 A;  3LFK A;  2XGD A;  4C2M A;  3KPH A;  3I0T A;  3CLQ A;  3OOU A;  2RGV A;  2BY2 A;  2IGK A;  1WJF A;  2HOE A;  1R4N B;  2BZT A;  4BQQ A;  3S3N A;  3TP0 A;  2VLA A;  5FJ8 J;  2L9R A;  3DEU A;  2Y0S N;  2Y75 A;  2DFF A;  2XGC A;  3KYC B;  4HG2 A;  4AIJ A;  2CRG A;  1UCR A;  1IF1 A;  2F6C A;  2E1M C;  3GLX A;  4ZYE A;  3E5Q A;  5F1R A;  2QLZ A;  5EG0 B;  3DPT A;  3VVY A;  1IRF A;  4FX0 A;  2VQG A;  3LSR A;  4GDF A;  2MD5 A;  1XS9 A;  3K1P A;  4LOC A;  4HNV A;  3U9G A;  2P6T A;  3SYT A;  3G6E I;  4LB6 B;  2DG7 A;  1FIP A;  3F23 A;  4DQ2 A;  5GPC A;  3WTS C;  3MKW B;  3EPZ A;  3LFU A;  4JQF A;  1FIA A;  4KIT B;  1AKH B;  5D5X B;  3SHF A;  2M1B A;  3FMS A;  2E7X A;  5IYD J;  2V1X A;  3L7W A;  3O6B B;  1BR2 A;  2X0L A;  4FE7 A;  2LSO A;  4RAY A;  3AG1 H;  4A5N A;  1K78 A;  2NOG A;  1QVT A;  4J01 A;  2QKM B;  5ICF A;  1VQ9 I;  2ZFU A;  3JAM K;  2DDA A;  2FOK A;  5KK1 A;  1B72 A;  3HTA A;  3PNT A;  3ZRG A;  1FSH A;  4Z2Y A;  1HKQ A;  1G3T A;  2VBW A;  2RNJ A;  4GGG A;  1ZHF A;  4XOR A;  5E1W A;  3MWM A;  5FGL A;  1TP4 A;  2IGN A;  2RKH A;  5M5Y J;  2HYF A;  1BOA A;  4B48 A;  4HF2 A;  4A3M J;  1R49 A;  1VQM I;  3JRF A;  1IV6 A;  1GV5 A;  1D8J A;  1BR4 A;  3JR9 A;  5DAJ A;  3TW6 A;  1V5E A;  2O9L A;  1I6X A;  2EIN H;  1EV7 A;  4RB1 A;  2H8W A;  3TKY A;  1OR7 C;  4DNC A;  3ZMV A;  3BR1 A;  2VE9 A;  1FJL A;  1U8R A;  3VYR B;  5DDG A;  2WAD A;  1KYW A;  4R79 A;  2IBD A;  3TED A;  2BY0 A;  4CSW A;  1LNW A;  3MZH A;  1XX5 A;  2K86 A;  3MKL A;  3HC7 A;  4NQW B;  4PGH A;  3M07 A;  5K58 A;  2K27 A;  3S15 J;  3GZ6 A;  2MAB A;  2EZH A;  3CMY A;  3L9F A;  5CXI A;  5BPD A;  1QRY A;  1NK3 P;  4YFN F;  3CC4 I;  2AS5 F;  2BOL A;  2PJP A;  1A04 A;  2L7F P;  5E3N A;  2KHM A;  2ZCM A;  3GFM A;  1XB4 A;  2A6T A;  3ONQ A;  2VAS A;  3I9V 2;  4CCO A;  2J5O A;  1IDY A;  1YX3 A;  4B3X A;  1FYL A;  2QEX I;  3HRU A;  2B9S A;  2YR2 A;  4PUS A;  2DA2 A;  4XL9 A;  4KT5 C;  1J9I A;  6PAX A;  4AIH A;  3JRI A;  4CH7 A;  2EIM H;  1G59 A;  3S14 J;  1FOY A;  3A2K A;  1LDK B;  3VIB A;  3A1Y A;  3BOQ A;  4UVB A;  1R5G A;  3FXO A;  3HSF A;  4PJN A;  2UWM A;  1YE9 A;  5J47 A;  1Y6I A;  5F0H A;  3R0J A;  2HPI A;  2EWN A;  3OR2 C;  1YQA A;  4PFO A;  3MD2 A;  2CYY A;  3HZJ A;  5D5U B;  4KIF A;  2HZD A;  4RGS A;  2QA4 I;  2TRT A;  4HST A;  4OMY A;  3VP5 A;  3F1B A;  4AU7 A;  3VEP A;  3DLA A;  3RZO J;  5EZH A;  1K78 B;  4E70 A;  2DXI A;  1CQT A;  3QBM A;  1FSE A;  3GTJ J;  4UHT A;  2JRT A;  3M1E A;  5JLX A;  1TL8 A;  1DPU A;  3K6G A;  5EEA A;  2DDB A;  3H3V K;  3L09 A;  2CFO A;  2DOA A;  3RPU D;  1B72 B;  5H6R A;  4FIS A;  3ZMD A;  4GFL A;  4HX7 A;  1Z7L A;  4DZP A;  2ICW G;  3QYE A;  3D5L A;  3DTK A;  1ZKG A;  4XLP F;  1JKQ C;  3MQ0 A;  2HKU A;  5LRS A;  4LG0 A;  4AYB A;  3VOE A;  3CWR A;  2LOO A;  1U5T A;  3A02 A;  4HNU A;  2VOP A;  1XCV A;  2Y9Y A;  5FMP A;  1YW9 A;  4KJZ A;  1K61 A;  3DBH B;  4RLQ A;  4LIU A;  3LHQ A;  3NRV A;  2CQQ A;  2G7S A;  1X1C A;  2YX4 A;  2LKP A;  2REK A;  4E7I A;  4LMY A;  4AVP A;  1FBQ A;  3E6D A;  3GWZ A;  2BGC A;  3HOU J;  2M9H A;  2Y0M A;  4YEJ A;  2DFH A;  4MHG A;  3SEQ A;  4CO8 A;  2XIG A;  2ESH A;  1MSE C;  3KP2 A;  1BC7 C;  2RNG A;  2IPQ X;  1JT6 A;  2EH3 A;  5F6F A;  4D9J A;  2VIX A;  4ZC3 A;  4I2O A;  3BR0 A;  4LLL A;  2PFB A;  1UHS A;  3VTI A;  1C0W A;  1OCC H;  5JLW A;  3OYJ A;  1PYV A;  1YI2 I;  1VQ6 I;  2KRH A;  4YFK F;  2M30 A;  3OOP A;  3CJN A;  2BHY A;  2UXI A;  2OTJ I;  4M9X A;  3VWB A;  2PQ8 A;  3TO7 A;  5BNG A;  1MBK A;  3K0L A;  3RQI A;  4LD5 A;  3MAJ A;  5DV5 A;  3WTW C;  4E4H A;  3QU6 A;  3GEZ A;  3HGG A;  4HBL A;  4P96 A;  4B3A A;  3CDI A;  2CUJ A;  3L1P A;  3OYL A;  2LKX A;  1B6A A;  1QPI A;  1TC3 C;  1HXD A;  1KU2 A;  2VB6 A;  3RZD J;  2B0L A;  1G2H A;  3WGI A;  3OL4 A;  2JPB A;  2K85 A;  3FMQ A;  2HKX A;  2DA4 A;  3W6K B;  2P5K A;  2M45 A;  3SXY A;  1X3U A;  3MCZ A;  2FEZ A;  1LDD A;  5F08 A;  1J75 A;  4BBS J;  5B3S H;  2OF7 A;  5D6F A;  1BBY A;  5HVQ C;  1TNT A;  2IRF G;  2O03 A;  3NPI A;  3E3V A;  2A07 F;  2EV5 A;  2HTJ A;  3RIR A;  4E7Z A;  2W00 A;  2HQA A;  3HPH A;  2DMT A;  1H0M A;  2BBY A;  1XD7 A;  2QM3 A;  2WWY A;  2XRO A;  3ABU A;  3DV8 A;  4OIQ F;  3DLL F;  3TMO A;  2UUZ A;  1K6O A;  4EGZ A;  2DOD A;  4LG0 B;  1U5T B;  3WTT C;  2MLG A;  3M7G A;  2IA0 A;  2ZBK A;  1B4A A;  1MBJ A;  1S72 I;  1JGG A;  4CYD A;  2LD5 A;  2X1D A;  3WTV C;  3PM1 A;  1JHF A;  3COA C;  3EYI A;  1UHM A;  2NVT J;  1Z67 A;  4Q4Z F;  1IC8 A;  1ZYR F;  4HLX A;  3AQT A;  1X4O A;  4RGR A;  2WB1 N;  1MDM A;  5HNH A;  2JUG A;  3GTM J;  5FLX K;  1W5C C;  3IAS 2;  3K4K A;  3KP7 A;  5BPI A;  5CVR A;  1ZRD A;  5CVJ A;  2EA4 A;  2RRE A;  3CRJ A;  1S7A A;  3LSI A;  3SFI A;  3KEY A;  3TQN A;  2E1C A;  3FZV A;  1YJW I;  2VBY A;  2DN0 A;  1XGO A;  2D45 A;  3V8K A;  5HS8 A;  3C07 A;  4D7M A;  2GA2 A;  3VW0 A;  4HKU A;  4HV5 A;  3X2Q H;  3BZK A;  1ACI A;  1FYK A;  2P4W A;  4OIO F;  3FXU A;  5FGM A;  1TZL A;  2XUB A;  4XM3 A;  3WGH A;  4YEL A;  1R36 A;  4S04 A;  4XR6 A;  2EZI A;  3IHU A;  3ZQH A;  5ILU A;  2M87 A;  4HF0 A;  3JRA A;  2B1E A;  1P7I A;  5F0F A;  1WGX A;  4BHB A;  4OD5 A;  2X6O A;  1N75 A;  3OMY A;  3Q9S A;  4BU2 A;  3PQJ A;  3JSJ A;  5DD8 A;  2WUI A;  2MD0 A;  2AXL A;  4BJ6 C;  2NVY J;  4ESB A;  3E7L A;  1WI3 A;  1YJN I;  1E0E A;  1DP3 A;  5LHH A;  2CSO A;  1TQP A;  1IW7 F;  2XGX A;  1IRZ A;  1DDN A;  2GUH A;  2CWE A;  4ETS A;  1B59 A;  2VJ4 A;  4R8H A;  4HAM A;  2X4H A;  4D5F A;  5ED4 A;  4ZYA A;  1YIT I;  2ZSH B;  4EAT A;  3HYI A;  3E97 A;  3SFZ A;  3GEU A;  2JZY A;  1FOK A;  2YX7 A;  1F1Z A;  1O3T A;  1OIS A;  3NAR A;  1K79 A;  1R1T A;  4IL6 C;  2YU3 A;  4A3J J;  1MBF A;  3BZC A;  3PSF A;  2D1V A;  4KMU X;  2G7U A;  3CDL A;  2W85 A;  2FUG 2;  1V54 H;  5ICC A;  4LJZ F;  2Y69 H;  3IWZ A;  1TT0 A;  5K7F A;  2DU9 A;  3ON2 A;  4ENJ A;  3KEQ A;  4Y3O A;  3VYT B;  3HIM A;  4XOT A;  4X1E A;  1S9H A;  4Y15 A;  2ELJ A;  4B44 A;  4EM0 B;  1FOX A;  3JRC A;  2ZXH A;  1B9M A;  2ME6 A;  3FF5 A;  4UXN A;  2DMQ A;  1UI5 A;  3LL7 A;  4U87 A;  5HDG A;  4D7N A;  3OL3 A;  1RIO H;  3I56 I;  2JVH A;  1Y1V J;  4A3F J;  2KIU A;  3GF2 A;  2V26 A;  1ONV A;  5IPA A;  1R1U A;  3DCF A;  3FIW A;  2BY3 A;  1VZ0 A;  3LWF A;  3RTR A;  1PUE E;  1MDM B;  4ZYH A;  1XGN A;  3ECO A;  1Q1H A;  3P9C A;  1WJB A;  1IJW C;  4RGU A;  2LTP A;  2LY2 A;  2O5R A;  1W0U A;  1DGW Y;  3FXQ A;  4KN4 X;  1H88 C;  4PK4 A;  1V55 H;  3KLO A;  2NNN A;  3G7R A;  1XGS A;  1MND A;  2F5C A;  2ZB9 A;  2IS1 A;  3AG3 H;  3HKZ N;  3IKV A;  4A69 C;  4HEA 2;  3FIS A;  1F43 A;  5E18 F;  1BC8 C;  1M1E B;  4RM3 A;  4BAC A;  1ZR2 A;  1XPX A;  1IN5 A;  4MLO A;  3SZG A;  3J7Y J;  1XDU A;  2QTQ A;  4G6Q A;  3A01 A;  1O3S A;  1BI1 A;  5D1R A;  3NXC A;  1G8X A;  1LVA A;  3CJQ B;  4BY7 J;  4UB6 C;  2XV4 S;  1UJ8 A;  1BA5 A;  1IXS B;  1QVU A;  1EA3 A;  4O5V A;  1VFC A;  2OUM A;  4A3K J;  5D5V B;  3RKY A;  2Z1D A;  1V4R A;  4CA0 A;  3GZN B;  2BYV E;  2CMP A;  1U2W A;  3BG5 A;  1R58 A;  5GP9 A;  3V7S A;  4A6D A;  4BHP A;  3JSP A;  1XSD A;  1UAA A;  2UXO A;  3KZ9 A;  1NHA A;  4FE4 A;  2R92 J;  3HPG A;  1S8N A;  3LOC A;  2W84 A;  2VOD A;  1S3J A;  2ZNY A;  3BJ6 A;  3K2Z A;  1S29 A;  4OU0 A;  5GTI C;  3ZMT A;  4BXX J;  2MG4 A;  1WFX A;  1W36 C;  2D6Y A;  2EPF A;  2OU2 A;  3NAU A;  2HNH A;  1RNL A;  5TGT A;  4NBQ A;  3PUF A;  3T8R A;  2QUF A;  4V19 K;  1X19 A;  3WTX C;  3IP4 B;  5E79 C;  4NUB A;  3WE2 A;  4ZH4 F;  1U6G A;  4IVN A;  3VOK A;  4EVI A;  3T6N A;  1YS6 A;  4RLF A;  1NK2 P;  1T8I A;  3AQS A;  3ABT A;  5JI6 A;  1VQ4 I;  2LVS A;  1TQI A;  3J80 K;  1Y0U A;  1MMN A;  5HLG A;  4Q48 A;  2ZKZ A;  3GBG A;  3HJE A;  4HF1 A;  2NOJ B;  3ECH A;  3OR1 C;  5IYB J;  3RKQ A;  5GAE J;  3QRF F;  3HOT A;  3LAP A;  1DQU A;  2M7B A;  3CDH A;  1I27 A;  2GAU A;  4MTD A;  2E1O A;  2QVO A;  2VXD A;  3HUG A;  5DS9 A;  3VOD A;  1KQ8 A;  1WCM J;  2PN6 A;  4AM3 A;  2KP6 A;  4L18 B;  4BYY A;  3I58 A;  4NEL A;  1X1P A;  2R7D A;  1A5J A;  3G2B A;  2NS0 A;  2GQQ A;  2KIQ A;  2PBX A;  2NVU B;  4HPQ A;  4WF2 A;  5D4R A;  2QOP A;  1ZG3 A;  2BEO A;  3BT9 A;  4M71 A;  2OV7 A;  4OOI A;  1UMQ A;  4UUV A;  1H9T A;  2Y48 A;  3PUB A;  1R9T J;  4Z6Y A;  3OS2 A;  3CME I;  4S0H B;  3ROU A;  4HQM A;  1QQI A;  4ANJ A;  4E6K G;  3K4N A;  1E3O C;  1CGP A;  2A5W A;  2VT3 A;  1VQN I;  4P55 A;  2JRM A;  3A01 B;  4PJJ A;  1SFE A;  3ZQF A;  5K1Y A;  3AFH A;  2LRE A;  4KYW A;  4G94 A;  5HS7 A;  1I50 J;  4WCG A;  2W7N A;  3HOW J;  1Z0X A;  4A3C J;  2EA2 A;  1PJR A;  3MVP A;  4EM2 A;  3HTJ A;  2L7Z A;  3RH2 A;  3RYR A;  3A0B C;  3J7A Y;  4EEF G;  2AO9 A;  5CQE A;  4C3I J;  2OZ6 A;  2FBI A;  5GPA A;  1TWG J;  1S7E A;  2YUS A;  5M3M J;  5AON A;  1OCT C;  4XRM A;  1RUN A;  1R71 A;  3ZPL A;  2L9N A;  4OWR B;  3FBN B;  5FKM A;  5LHG A;  4IHW A;  4DW6 A;  4HRI A;  1IN8 A;  1BI2 A;  3MN2 A;  2CW7 A;  4A93 J;  5AQC A;  4MNU A;  3IAM 2;  2IW5 A;  4KNY A;  2ESN A;  3BJB A;  2QF7 A;  2VPR A;  1KQ9 A;  2R7Q A;  4IEJ A;  2XAS A;  3TO6 A;  3CCE I;  4BHC A;  1D3Y A;  4GCL A;  3PO3 J;  4IPA A;  1EKE A;  3E6B A;  3QOD A;  3EUA A;  3KZY A;  3L2U A;  4H0E A;  2P7V B;  2PBI A;  1W36 D;  3PPB A;  1YG2 A;  3M8F A;  2CH0 A;  1Z91 A;  2ZME C;  4IJA A;  4CZZ A;  2O7T A;  1T6S A;  2CG4 A;  1JTX A;  3KE2 A;  3V7C A;  3WTZ A;  2MC4 A;  2FNA A;  3LA2 A;  4PSX A;  4ZJZ A;  4LB5 A;  3H35 A;  5HBU A;  3GFI A;  1BR1 A;  3BTJ A;  1U0J A;  4EJO A;  2KMU A;  1FYM A;  3LSP A;  2JQ7 A;  2OCE A;  3H3U A;  4EJU A;  2L0K A;  3KP4 A;  2O61 A;  1MZB A;  2LNB A;  1AOY A;  2V6E A;  3Q5F A;  2WV0 A;  3DXJ F;  1P4A A;  1ZK8 A;  3JTH A;  3HUG B;  2X6W A;  2XF5 A;  5EEG A;  3OY9 A;  4IQJ A;  1HDP A;  2E36 A;  4QPO A;  2Z5U A;  2EFN A;  3G73 A;  1JKO C;  2KRC A;  3RJP A;  3DWL E;  4PFP A;  3ASO H;  3OIO A;  2F5E A;  2KJC A;  1T95 A;  3S5R A;  4MEX F;  3MZ8 A;  4I76 A;  3RPU A;  1MSF C;  3ZCO A;  3EGQ A;  3NQO A;  3J81 K;  3K4L A;  2Q2E A;  3VFZ A;  3V78 A;  1TQM A;  1XMA A;  2LK2 A;  2JA2 A;  2OCC H;  3GME A;  2DQL A;  1GLN A;  3GLL A;  1PP7 U;  1DGR M;  1ZGW A;  1X1D A;  3D1N I;  4UB8 C;  1J5Y A;  2DO7 A;  4WWC A;  1P6R A;  1SC7 A;  3WG7 H;  2PJR A;  4DYC A;  1IUY A;  4YIF A;  3Q9V A;  5JHF A;  2V7F A;  4DZJ A;  1YYV A;  3GUD A;  1LQ1 A;  2P5L C;  3BQY A;  4QWQ A;  3VW1 A;  4ZDL A;  3GTQ J;  2F07 A;  2DA6 A;  4Y7N J;  1XDS A;  4C30 A;  5L3B A;  2UZK A;  3V6G A;  1VQ5 I;  4CCN A;  2MBF A;  2YVH A;  2GXG A;  4ON0 A;  3LNQ A;  1T0F A;  5CPR B;  1Q1V A;  1ORK A;  2VC1 A;  5BS6 A;  4XIC A;  2CUF A;  2GXB A;  4RAG A;  3B73 A;  5BQT A;  2MFZ A;  3L2R A;  3HTI A;  3H3Z A;  2A6E F;  4I01 A;  2CO5 A;  3GTL J;  5E8G A;  3ZQL A;  2DTR A;  4UUS A;  1Z05 A;  3J7A O;  3V8J A;  4P5O A;  2ID6 A;  2LYC A;  4XMY A;  2VT2 A;  4KIG A;  4LIV A;  4UVA A;  4EMS A;  3CUQ A;  3GTP J;  2IEK A;  3ZMS A;  3BHQ A;  3CCQ I;  2G0E A;  1R5I D;  3L2Q A;  2HDC A;  2KIS A;  2PMZ A;  4NC8 A;  3CCM I;  2ELK A;  5ILS A;  2EZL A;  2DOF A;  2PFV A;  2DTZ A;  4WXH A;  1JJ8 C;  3BTI A;  1REP C;  3LSM A;  3T1B A;  2E1M B;  5J1R A;  4CYC A;  2O8K A;  4A3I J;  5DM6 F;  4DOZ A;  2YU9 J;  3WU1 B;  1VQ7 I;  3PIP F;  2XAQ A;  4KA4 A;  2CJJ A;  3DFG A;  3NNR A;  1JE8 A;  2HXO A;  2WTE A;  1ERD A;  3CO7 C;  4XON A;  2ZY9 A;  1W4M A;  3I4P A;  2L3D A;  2NP5 A;  4P9U A;  1H89 C;  2UV1 A;  3BR2 A;  3N05 A;  1MD0 A;  2R5Y A;  3T0Y A;  5LFA A;  4D1Q A;  2L9V A;  4XLC A;  2VE8 A;  1RET A;  2XSJ C;  4R1H A;  1ZLK A;  3V4G A;  3CES A;  3HRT A;  4ABZ A;  2F4O B;  2O0Y A;  1MMG A;  1TWF J;  4YII A;  4MK6 A;  4FTH A;  3JTG A;  1OKR A;  2X9D A;  3E0J B;  4M3D A;  2RAS A;  2F5V A;  3RSN A;  2R0Q C;  1GVJ A;  3E7Q A;  3VUQ A;  4EJT A;  3HG9 A;  2HR3 A;  1VQP I;  2YVE A;  4AID A;  5CVU A;  3QKX A;  4BE0 A;  3GW2 A;  2PMZ N;  4Q5S F;  5ERI A;  1D8K A;  4E7L A;  2BW3 A;  1ZTR A;  3RPQ A;  4EM1 A;  5FFX A;  4IHX A;  4P9F A;  5KAI C;  1UST A;  5AIP A;  3W6J B;  3VOX A;  3F9K A;  1DPR A;  4KFC A;  2PJR B;  2HI3 A;  5DUI A;  2R7Z J;  3I53 A;  1SD5 A;  3QU3 A;  1SFK A;  3HB9 A;  4WK8 F;  4LK0 F;  1GHC A;  4CZC A;  2HQN A;  4GCV A;  4GXO A;  4F3Q A;  3H5N A;  1ZG1 A;  1K4S A;  1LE8 A;  2HPM A;  3P7N A;  1D5Y A;  1P4W A;  1NTC A;  1HKS A;  1TT5 B;  4I98 B;  1KON A;  3LSK A;  1YTY A;  2VKV A;  1R23 A;  4M6X A;  2FX0 A;  3S1M J;  3G1M A;  2R5Z A;  2DG8 A;  4C2M J;  2ZXI A;  1ZGJ A;  3FKJ A;  3IH2 A;  4KT6 A;  2IGO A;  4UUS B;  3F3X A;  5K7H A;  3ELK A;  2Y9Z A;  1S6L A;  1HDD C;  1TWC J;  5D8K B;  3MNL A;  2DMP A;  3BR5 A;  3CUQ B;  4IRV A;  2HOS A;  3OYI A;  5CYV A;  4KN7 X;  3BZ6 A;  5HLH A;  4UY8 I;  2X85 A;  3WOD F;  2WY8 Q;  5EGO A;  2NRA C;  4M6V A;  2UXP A;  4MTE A;  4XLN F;  5E3M A;  2AQF A;  2RQQ A;  1YW7 A;  1FTZ A;  2KPM A;  4EQQ A;  3FDY A;  1AU7 A;  2ZC2 A;  1MBE A;  4I7H A;  5E3L A;  1Z3Y A;  3DPL C;  3FXM A;  4CYC B;  2HQR A;  1EF4 A;  3W2W A;  4HDV A;  5M3F J;  1SAN A;  2RQP A;  3LSG A;  2LG4 A;  3S3M A;  5L3G A;  2LDU A;  2Q1Z B;  2JA5 J;  1WPK A;  4IOA F;  3LWJ A;  4BNC A;  2KT0 A;  3BR3 A;  2HGC A;  2R5Y B;  1IDZ A;  2EFO A;  2HYG D;  2F5D A;  1ENH A;  3IL2 A;  2LRD A;  2H27 A;  2LMD A;  5LBQ A;  3OYB A;  2FU4 A;  1GV2 A;  5FLV A;  1RES A;  3S2H J;  3ERM A;  4G7Z F;  5K5R A;  2QEN A;  5GAG J;  1R5H A;  2XAU A;  2XDN A;  3VYU B;  1SVO A;  3P5J A;  3LQQ A;  2XB0 X;  3O3K A;  4E7K A;  4BQA A;  2MSY A;  1OYI A;  3I5U A;  2RV8 A;  4IHV A;  1ZLJ A;  2QSG X;  5FLX Z;  3VDX A;  1HBX G;  4Y17 A;  2UXN A;  2BW3 B;  2M4G A;  4XK4 A;  3TOA A;  1BW6 A;  1IO2 A;  1TBX A;  4PJL A;  3CC7 I;  3DTI A;  4L0Y B;  2HVS A;  2H1L A;  2JJ7 A;  1WSU A;  1QU3 A;  1TTY A;  4B47 A;  2VJJ A;  4A12 A;  2STT A;  1I3Q J;  3E5U A;  2QCO A;  1QA6 A;  2FJI 1;  2EQR A;  3KX2 A;  3G71 I;  2XKO A;  5FO5 A;  3ZQC A;  1LE8 B;  4FET A;  3GX4 X;  2BE5 F;  3LA7 A;  1T39 A;  2ZO4 A;  3WTY C;  1HW5 A;  1AHD P;  4S05 A;  4BE2 A;  2V9P A;  2VJ5 A;  2VL8 A;  1WRJ A;  2WB1 A;  4C2U A;  3QP5 A;  2R5Z B;  4KUM A;  3ZQG A;  4ENK A;  1T33 A;  1ETV A;  1U5T C;  5B66 C;  3S1N J;  2NAZ A;  4XKC A;  3A4C A;  4FT8 A;  3FXL A;  4ZZD A;  2M0C A;  2A05 A;  2GOX B;  5EGO B;  3FKI J;  1PP8 F;  2CQN A;  4RB2 C;  1QPM A;  2L9S A;  2AHQ A;  3UNG C;  1PUF A;  2DYR H;  2CV2 A;  1E3H A;  4W97 A;  1FY7 A;  1KZH A;  2I8D A;  3PFY A;  2VN2 A;  2ECC A;  3K1M A;  1UFM A;  1FBS A;  5BMZ A;  4LK1 F;  2Q8K A;  4ZZL A;  3A03 A;  2HS5 A;  3RKX A;  5K5O A;  4DGW B;  2RHA A;  2MLK A;  3M8E A;  4MFD A;  2R7U A;  3GO5 A;  5FD6 A;  2STW A;  1MH3 A;  1SEU A;  2K9N A;  4IF4 A;  5LEK A;  4N0B A;  4GRI A;  2E35 A;  3M9A A;  3F8F A;  2KFD A;  2R4G A;  1FMV A;  3MZY A;  1QO0 D;  3LST A;  3F22 A;  3GTO J;  4OIP F;  1Z3X A;  5C4J J;  2YVX A;  3M3Y J;  1SGM A;  3QWL A;  3BRO A;  2M0M A;  2O3F A;  3LQR A;  2CV1 A;  2V6C A;  3P9T A;  1H8A C;  1FP1 D;  2R7W A;  2HWV A;  1G3W A;  3PQK A;  1MW7 A;  1RI7 A;  1MNM C;  2C6Y A;  2XF6 A;  1UHW A;  3ZGK A;  1KGS A;  1RKW A;  3QOE A;  3IC7 A;  4B4C A;  5KVR A;  1WWX A;  1CF7 A;  3KP3 A;  3C3W A;  4M73 A;  3OYA A;  3CCS I;  2IS6 A;  1A6I A;  3FXJ A;  1MMA A;  2PMH A;  2MH2 A;  3IUO A;  4A3E J;  2P8T A;  1JI8 A;  5HNF A;  2L01 A;  2X1C A;  2CGP A;  3UR3 C;  2LY1 A;  3ML6 A;  4WX9 A;  4XRS G;  4IHS A;  2K3P A;  2EBI A;  3KZZ A;  1LEB A;  2HYT A;  3MMY B;  3FBI B;  4V2F A;  4I6Z A;  2JK3 A;  5J3L A;  5GAD J;  1ZAR A;  2I10 A;  2KL4 A;  3HDD A;  4RB0 A;  2CV0 A;  1JXS A;  1RPW A;  5DTD A;  3CF2 A;  3I3L A;  2W82 A;  4UV9 A;  1N77 A;  1G6N A;  2GOM A;  3BCA A;  1XTA A;  3KLN A;  3OSF A;  5H9T A;  2HFH A;  2R7R A;  1P9Q C;  2XPW A;  3SDG A;  2BVM A;  4E7S A;  3BC8 A;  1D1C A;  4IKF A;  3PAS A;  1A36 A;  2L5Q A;  4G12 A;  2DMN A;  1WI9 A;  1OQY A;  2GA1 A;  2WV1 A;  2NVX J;  2W48 A;  5ICG A;  5LGN A;  3CP2 A;  1O7L A;  3M8J A;  1ETW A;  3BCG A;  4AF5 A;  3RD3 A;  3HKZ A;  2ZOZ A;  3EUH A;  3BQZ A;  4L9N A;  1HC8 A;  3EQL F;  3QYF A;  3WE3 A;  2JWT A;  1PUF B;  5HLI A;  2K9Q A;  4J19 A;  1QGP A;  1HCR A;  2LFB A;  2V1U A;  1WJE A;  2K4J A;  2RDP A;  3TL4 X;  4JX4 A;  1XMK A;  1XG1 A;  2M8E A;  2LF7 A;  5J1U A;  2VBZ A;  2L4M A;  3HBL A;  4WIB A;  4CGZ A;  1FT9 A;  2GIV A;  5E1X A;  2IP2 A;  5AIQ A;  1IG7 A;  5HOO A;  4XOP A;  4ESF A;  2B3W A;  4YIR X;  5C4Y A;  1I3A A;  3JRE A;  5C3E J;  1W7P D;  3OS1 A;  4Y52 J;  1GVD A;  2E60 A;  2QQ8 A;  3J80 Z;  4G7O F;  1MGT A;  3KZI C;  4O3M A;  4CCM A;  3S3O A;  1MBH A;  3BTL A;  4PXI A;  1D0Z A;  4D5C A;  2V9V A;  2ZFW A;  3K4C A;  4XN0 A;  1IN7 A;  3IH4 A;  1T38 A;  2BVL A;  3R60 A;  1MMD A;  2DJI A;  2RC4 A;  3FM5 A;  5L3F A;  3IKT A;  1YRN A;  2KQR A;  4RDU A;  3W2A A;  4BQO A;  3HGY A;  4IX7 A;  5KHD A;  3WU2 C;  2EJR A;  2QGU A;  3O8H A;  1CF7 B;  2CFX A;  4IHT A;  3F0C A;  2DFE A;  2K40 A;  5CVV A;  3K4M A;  1KU7 A;  1V5F A;  2H6B A;  5J6X A;  2HQ5 A;  3ZXS A;  2JA8 J;  5D8L B;  3A0H C;  2L54 A;  4ESJ A;  3L2C A;  4E7J A;  1FNN A;  4FAS D;  3J7Z I;  1NH3 A;  1LFU P;  2VOO A;  1FX7 A;  4ZTF A;  2F5F A;  1U3E M;  3U21 A;  2VI6 A;  3BLY A;  3HM5 A;  4Q47 A;  2KIM A;  3S1Q J;  5J4Y A;  5IP6 A;  2DPU A;  4L5J A;  3T8T A;  5IT9 K;  3VVZ A;  4V2G A;  2PLY A;  2E2I J;  3W3C A;  2KZV A;  1DP7 P;  4RM2 A;  1LKX A;  2CW0 F;  3S2W A;  3KFW X;  1LVK A;  1UI6 A;  2VKE A;  3H5A A;  1Y39 A;  3OIP A;  2FML A;  1EH7 A;  1RC9 A;  3EET A;  3I71 A;  1ZRE A;  4HX8 A;  1IV8 A;  3OYH A;  4I0A A;  2OC6 A;  2DA3 A;  2GFN A;  3ZQ7 A;  1RZ4 A;  1D1B A;  3EDP A;  3LMM A;  2OI8 A;  4C3H J;  3F21 A;  1BJA A;  1FPQ A;  3DPU A;  3C18 A;  3FXR A;  3BWG A;  4ACI A;  5TJJ A;  1V3F A;  1FTT A;  2XVC A;  3JRH A;  2M8G X;  2DYS H;  1X1A A;  1J2X A;  2FMY A;  3JW4 A;  3F8C A;  3R6S A;  2IVM A;  3FMR A;  3HRM A;  2R7F A;  4I99 C;  5H6Q A;  2O6G E;  1K83 J;  4HA8 A;  4PZJ A;  2DW4 A;  1UG2 A;  5D18 A;  3CO6 C;  1X58 A;  1O7F A;  4A0X A;  2EB7 A;  1F4K A;  1NG7 A;  1RUO A;  4U0W A;  4CGR A;  4KIS A;  5H20 A;  2RVC A;  1K7A A;  4WXD A;  2E19 A;  1B1B A;  2TCT A;  2OBP A;  5IP7 J;  1SFU A;  3PNV A;  2MH9 A;  1Z6T A;  4JP0 A;  2FSW A;  4UUT A;  4YG2 F;  2EK5 A;  2L7K A;  3RKW A;  3V7R A;  5CXG A;  2DA1 A;  3AL0 C;  1BM9 A;  1IGN A;  2HVR A;  5DCM A;  1QHG A;  2HZT A;  2E2H J;  4IQ4 A;  4HQE A;  2COM A;  1I5Z A;  4M72 A;  1SD4 A;  2ZCW A;  5CW8 A;  1UB9 A;  1Z9C A;  1ITY A;  4IHY A;  3ZP5 A;  2DJN A;  2QQB A;  2DPD A;  2YSR A;  3K1N A;  3RCO A;  1L3L A;  1YRN B;  4ZTJ A;  4AVZ A;  2P0W A;  1MH4 A;  2L7M P;  2FQ3 A;  4OAY A;  2CQX A;  2L02 A;  2H09 A;  3IH3 A;  4J00 A;  2KLO A;  2QQ9 A;  2O7O A;  2W25 A;  4JNN A;  4DJA A;  5IYC J;  5FKK A;  2NXN B;  2AQE A;  1OYW A;  5E3O A;  4H4K C;  3B81 A;  1XGM A;  5E20 A;  4L5I A;  1ETQ A;  2A6H F;  3J81 Z;  3O60 A;  4CCL A;  3GZI A;  5JFR A;  2V9K A;  2ZME A;  2VON A;  1HA8 A;  5J4V A;  2GM4 A;  2VPL A;  1WH5 A;  3MFK A;  4O6J A;  3F8M A;  3HIF A;  5HDN A;  1XSX A;  2XPV A;  1U9O A;  3CZ6 A;  3IUV A;  2UXH A;  4XN3 A;  2K7L A;  3DBL B;  4OIN F;  5DCF A;  2DT5 A;  1GDT A;  1SVM A;  4BKX A;  1J59 A;  4MQ9 F;  3H0G J;  1OMI A;  2XB5 A;  5EDN A;  2G7G A;  4IRH A;  4M3F A;  4C3J J;  4N4O B;  2G7H A;  3CMA I;  2XAF A;  1JKR C;  4DYR A;  1SAU A;  3H9J A;  2FF4 A;  2EV0 A;  2JT1 A;  3BJA A;  3C2G A;  4IRG A;  4MIM A;  1QBJ A;  4DIQ A;  3OYD A;  1OPC A;  3GVA A;  3B6C A;  1TLH B;  3BNI A;  1XN7 A;  2XC7 A;  4A5M A;  5IOZ A;  3B6A A;  1POG A;  3ZOB A;  2ELH A;  1TW2 A;  2EIK H;  4I0B A;  2MGQ A;  3BY6 A;  2ME0 A;  4Y13 A;  5A2Q K;  3HHG A;  1SFO J;  2Z99 A;  2ZCN A;  4XLH A;  1I1S A;  2CQK A;  1WJA A;  3BPX A;  3CUO A;  3ZQI A;  4U9L A;  3KIO A;  3KNW A;  2A2F X;  2QSF X;  2VXZ A;  3P9K A;  4BXU A;  1U9N A;  1VQK I;  2OAZ A;  1RRJ A;  2VJI A;  2D1H A;  4AWX B;  4HX4 A;  2QKL B;  2WY7 Q;  3OWT A;  3CC2 I;  2H6C A;  3FX3 A;  3FRQ A;  1LFP A;  2R7S A;  2DI3 A;  1D0X A;  4BEH A;  2L2O A;  5D19 A;  2FBK A;  1O57 A;  1R7J A;  2ZCX A;  1BJZ A;  5J8C A;  2HVQ A;  4BGD A;  3HXL A;  5DCM B;  1MMS A;  4NHJ A;  1Y56 A;  3DPJ A;  5CVI A;  2G7L A;  4LGW A;  3ISP A;  5TRD A;  2LH9 A;  2LLK A;  3DQV C;  2XRL A;  4XLA A;  4RB3 C;  3PIO F;  4KDP A;  3CP8 A;  1KA8 A;  1I6H J;  1KU9 A;  2Z16 A;  5CJ9 A;  2W1O A;  3D0S A;  2DLL A;  1BN5 A;  4TV7 A;  2WAF A;  4G6D A;  5FHP A;  2ID3 A;  2CW8 A;  2ACJ A;  4HLY A;  2QWW A;  3TGN A;  2F48 A;  1XC5 A;  4A0Z A;  3IV5 A;  4BE1 A;  3WGG A;  5LGT A;  2R7X A;  3G1L A;  3FHZ A;  3ABL H;  1QNT A;  1H9G A;  2ZME B;  3M1C A;  5IOY A;  2XF7 A;  1JTY A;  3ESW B;  3S1R J;  4B09 A;  1YOV B;  4RGX A;  2WAE A;  4NC7 A;  1JT0 A;  1W5T A;  2GWR A;  2K4B A;  5HLT A;  3E6C C;  4XKB A;  2LP0 A;  3PNY A;  3TOB A;  3PSI A;  1BW5 A;  1OR7 A;  5CKT A;  3F6V A;  5LLQ A;  3IWF A;  2IS4 A;  4UDS A;  4N9H A;  1OLT A;  3DKW A;  3L00 A;  3JCU C;  5J8F A;  1U78 A;  1FZP B;  1GUU A;  5DUK A;  1WJC A;  4X6A J;  2ZOY A;  4CDG A;  3EUK L;  4M6Y A;  3JRG A;  2IU5 A;  2QIB A;  1GXP A;  2NVQ J;  1EH8 A;  2P7C B;  3OYC A;  1VQ8 I;  2HXI A;  3BTC A;  2EIJ H;  3D5R C;  4BY1 J;  3I4M J;  4N4N B;  1MNE A;  2Y2Z A;  2CUE A;  3QAH A;  4LG3 A;  4ME9 A;  3ZN1 A;  2M5W A;  2M7A A;  3ZQQ A;  3BG3 A;  5EYR A;  4AD9 A;  2K9L A;  5E8I A;  1UZC A;  3ON4 A;  4PSW A;  4XKW A;  2QYO A;  2R93 J;  3L2W A;  3F8B A;  3B02 A;  2WBM A;  2D2W A;  2NS8 A;  1SMY F;  2LC2 A;  2KDO A;  1A35 A;  1JUS A;  2R3S A;  1OFC X;  1WH7 A;  1EJ9 A;  2OER A;  1SVL A;  2FA5 A;  3ANP A;  4U0Y A;  2ETH A;  2FQ4 A;  2QZ8 A;  1X3W B;  3TO9 A;  5M5W J;  4GFK A;  4QLC U;  2M4K A;  4BEH B;  2PI0 A;  1MIJ A;  5KAF C;  4BS9 A;  4CCJ A;  3TDZ C;  3RI4 A;  5DD4 A;  1LEA A;  3M4O J;  1DU0 A;  3I64 A;  4X0G A;  2NS7 A;  5GTH C;  4M3E A;  4YFX F;  2H8R A;  2VUM J;  4A3G J;  2IJL A;  2FE3 A;  4GCK A;  1N25 A;  3W6V A;  5JHU A;  2GEN A;  3E1S A;  1HSJ A;  3KKC A;  3Q0V A;  3V8L A;  3HHH A;  4M74 A;  1T0F C;  2Q2E B;  1G3S A;  3VYS B;  1L0O C;  1JUM A;  1Y0N A;  2F2E A;  2E7W A;  4HV6 A;  1TNS A;  1SD7 A;  2P81 A;  2PMU A;  3TW7 A;  3K69 A;  3OYN A;  4AIK A;  4KIC A;  2OPT A;  1VND A;  2A69 F;  3IRR A;  2EV6 A;  5LRR A;  2JA6 J;  3HOX J;  2QSH X;  3TP3 A;  3VVX A;  3HOS A;  4HZF A;  4BUP A;  3WHB A;  3CUQ C;  1X3Z B;  2XPU A;  3HOZ J;  2PX9 A;  3AG2 H;  3KP5 A;  2JUC A;  4ITV A;  4AC0 A;  1HLV A;  3EUP A;  3T5X A;  4UV8 A;  3DU5 A;  1F36 A;  3I54 A;  3VSL A;  4CIC A;  4WXC A;  1X2N A;  3DEW A;  5L3C A;  3LAJ A;  4CHU A;  2QQA A;  5E17 F;  1BI0 A;  4XID A;  4MXM A;  5HAW A;  1IN4 A;  1Z6R A;  2BHZ A;  2W53 A;  2I5U A;  1IUF A;  2KKO A;  3FM3 A;  4B1R A;  2Z9O A;  1UG0 A;  3LSJ A;  1I39 A;  4OD4 A;  3H5R A;  3FK6 A;  3OYK A;  2ISY A;  2BXZ A;  1K4T A;  2IGM A;  3C1D A;  4XNF A;  2CS3 A;  1O4X A;  3E6M A;  3HSR A;  1S7O A;  4HNT A;  4MEY F;  5H2F C;  3CCV I;  2FJ1 A;  3JSO A;  3ERE D;  4RA2 A;  2DT7 B;  4LLN A;  3HE0 A;  2Z33 A;  4RAZ A;  1JJ6 C;  1BOB A;  2ZXW H;  4M3B A;  3S93 A;  2NP3 A;  1FMW A;  2CU7 A;  2DK8 A;  4KIB A;  2HOA A;  1LFB A;  4EJV A;  2E2J J;  1P7J A;  2J5P A;  1X1B A;  4QTR A;  5B5E C;  1KU3 A;  4ENN A;  2E71 A;  5F1J A;  4XLE A;  5FRM A;  4MO7 A;  5M5X J;  3ABM H;  1WHU A;  4B43 A;  3DEE A;  5K5Q A;  2LY9 A;  2FRH A;  2X1E A;  2QWT A;  4C2T A;  3CTA A;  4L9J A;  5IT3 A;  3K2A A;  2A5Y B;  3K4B A;  1VTN C;  4FHT A;  1YIO A;  3RQ4 A;  2KJB A;  2FBQ A;  1T08 B;  2G9W A;  1JKP C;  3AG4 H;  3WG9 A;  3KYD B;  4FX4 A;  2OZU A;  2ZXJ A;  3OYF A;  3QP6 A;  1YX5 A;  2Q0O A;  2ADU A;  2HYJ A;  4JKZ A;  3K70 C;  5FKL A;  1RKT A;  2V1N A;  3HL2 A;  4A2U A;  5ICE A;  4PCQ A;  4HDU A;  1W1W E;  1J0R A;  1DU6 A;  1OCO H;  2WGB A;  9ANT A;  4ZYG A;  4I02 A;  5JR3 A;  2RN7 A;  5GAH J;  2EZK A;  5E1Z B;  2X51 A;  5LD2 C;  3DP7 A;  5CLS A;  3OYG A;  1Z1D A;  3H9G A;  2HKO A;  2YS9 A;  1D1A A;  2H94 A;  3OV8 A;  2VQC A;  5HOD A;  4YRV A;  1W7P A;  1BIB A;  5FKN A;  4OIR F;  3Q3S A;  4PDK A;  5KCM A;  3Q0U A;  4IXA A;  4AUX A;  3I4N J;  3N97 A;  1ON1 A;  1STZ A;  4AC6 A;  4DVY P;  4GFB A;  3QPH A;  3BJO A;  3CJT B;  2VC0 A;  4BL0 B;  5F04 A;  2BV6 A;  1BL0 A;  4F7Z A;  2K5C A;  5FKO A;  4W1U A;  2ECB A;  2RAE A;  5L3D A;  2XDV A;  3JRB A;  4E7H A;  5J40 A;  3CCJ I;  1ZGA A;  1YO5 C;  3SWH A;  5FB2 A;  1ON2 A;  3DKX A;  4B8X A;  1A31 A;  3BRU A;  5D4S A;  1ODD A;  2PG4 A;  3CCR I;  3SJM A;  2D5V A;  2XAG A;  4AYB N;  1O3R A;  5C4X J;  5FRN A;  1IRG A;  1HOM A;  4M9S A;  4U88 A;  4G9Y A;  4L5E A;  4QIW N;  4C9Y A;  3BR6 A;  3DF8 A;  3CCL I;  2F4I A;  1ZQ3 P;  1EH6 A;  1MJB A;  2HOT A;  4XRS A;  1OCP A;  2V4J C;  4HW0 A;  1VQO I;  1F5T A;  2NX4 A;  2MW8 A;  1ZRC A;  3U1K A;  3ULQ B;  3DKY A;  4XSX F;  3ZMZ A;  4KMF A;  1Z77 A;  2WC2 A;  2K02 A;  2DA7 A;  1TW3 A;  1B8I A;  1YS7 A;  2EFW A;  4F92 B;  1USS A;  3HTS B;  1FBU A;  1LUJ B;  2IAI A;  5ILV A;  4JOM A;  4M9Z A;  3IRQ A;  1ZR4 A;  2FBH A;  2KRF A;  4NB5 A;  5EZG A;  2ZJR F;  2B63 J;  1K6Y A;  3HTU A;  2H1K A;  3FHN A;  2LBF A;  2CQ7 A;  2XAH A;  2DMU A;  1R22 A;  3U1D A;  2EIL H;  1XSV A;  1MJA A;  2M34 A;  4ZYD A;  3PJR A;  2V79 A;  2PZ9 A;  4A6E A;  3F6O A;  3KEO A;  4EJW A;  1FLI A;  1YLF A;  2VKH A;  4IZZ A;  2TDX A;  2HDD A;  4G6T B;  2COB A;  1ULY A;  1W5S A;  4OAZ A;  4F52 A;  1TWA J;  3K70 D;  1S5L C;  3BG7 A;  2OTL I;  2E34 A;  1BIA A;  4NNJ A;  5B1B H;  2X6X A;  3MKZ A;  3K10 A;  4NC6 A;  3RDI A;  2ISZ A;  2XGE A;  1VI0 A;  3C2H A;  3LJL A;  2DFI A;  3Q0W A;  3QQA A;  4CUG A;  5KNL A;  1JUP A;  4ZDO A;  3ANG A;  2GXA A;  4JX5 A;  3K9T A;  1W7P B;  2XHK A;  4F55 A;  4BQN A;  4BBR J;  1ETY A;  4U7D A;  2R7O A;  3CCY A;  4LLG F;  1LDJ A;  4YZE A;  2FD5 A;  2P5V A;  3G3Z A;  2B7E A;  1P2F A;  2DBB A;  3QPT A;  3BDD A;  1G3Y A;  3SDB A;  4I09 A;  2W57 A;  3ZR8 X;  4UNO A;  2Q24 A;  2XRN A;  3LA3 A;  3QYB A;  4IOC F;  5IT9 Z;  3RYP A;  2VQL A;  3L2V A;  5JVG F;  3CF5 F;  2DCE A;  5J1Y A;  2ZJQ F;  3FK7 A;  3I59 A;  1HQC A;  4UVC A;  4ZDP A;  2EFQ A;  1SMT A;  4ASN A;  2XSD C;  5F27 A;  3R4K A;  4GYI A;  1WVR A;  2V1D A;  1X2M A;  2E5Z A;  2FOW A;  3ZN0 A;  3KCC A;  3C2B A;  4M3G A;  3D5S C;  2WAQ A;  1YFH A;  3H36 A;  1ETO A;  4HYE A;  5C44 J;  3F72 A;  3CMM A;  3HEF A;  4RBO A;  1SD6 A;  4KWA A;  3NEU A;  4D0P A;  1HW1 A;  1W0T A;  3GTK J;  2MA3 A;  1APL C;  3BG9 A;  1Z7U A;  4A3B J;  2JTV A;  2ZJ2 A;  3R61 A;  2BY1 A;  1Y1W J;  4MFE A;  4RAF A;  1B8I B;  3CQZ J;  4NDL A;  5B1A H;  4IRI A;  3WHC A;  1RR8 C;  2XKP A;  2R7V A;  3PFI A;  2R7T A;  2ZNZ A;  4Y4R A;  1I1G A;  4BDY A;  3F8N A;  3S8P A;  5HS9 A;  3CJR B;  1WZ2 A;  2OA4 A;  4BH9 A;  1GT0 C;  2LBF B;  1YJ9 I;  1ZG5 A;  2GIZ A;  4GCT A;  1U8B A;  2GZW A;  2Z2S B;  1AWC A;  1P4X A;  2JPC A;  2DK5 A;  1R4M B;  3AKZ A;  2Z3Y A;  3H92 A;  3H9Q A;  4L9V A;  1T98 A;  4ENM A;  3CD6 I;  1E17 A;  1YHQ I;  1R1V A;  4G8X A;  4RMN A;  5DM7 F;  5DEQ A;  1J7K A;  5DYM A;  1WKM A;  1OJL A;  5JVT A;  2JVG A;  2HDW A;  5EF6 A;  5EEH A;  4RS8 A;  2X48 A;  2HEO A;  3OS0 A;  4XLF A;  2WAQ N;  3REO A;  4L62 A;  1WJD A;  2JMW A;  4MGR A;  3K7A J;  5EJC A;  3MEX A;  3U2R A;  3CJD A;  2IXS A;  3GYH X;  3K8P C;  2LR8 A;  1IRX A;  3P9I A;  5K7Z A;  3VW2 A;  2F4M B;  1T2K A;  1D5V A;  1E2X A;  2OJE D;  3BP8 A;  3GZ5 A;  2LKS A;  1VQL I;  2DOE A;  2FNP A;  2N8G A;  4II3 A;  3EUH C;  2G3B A;  4PJ0 C;  4JX6 A;  3OYE A;  2NYX A;  5TIS C;  2UXX A;  1Z21 A;  2IA2 A;  2KZG A;  3BPV A;  3H0D A;  3GTG J;  3VPR A;  3HOY J;  3VB2 A;  1YIJ I;  1GXQ A;  2L4A A;  3I59 B;  2K9M A;  4Y33 A;  2E1N A;  1HW2 A;  3OYM A;  2V57 A;  1MKM A;  3TBI A;  2HTS A;  2YPR A;  1ZH5 A;  2VKD A;  1R6R A;  2BXY A;  2K3F A;  3S32 A;  4MQV A;  3S2D J;  5FD5 A;  4FCY A;  5FLM J;  1Y8Q B;  1JHH A;  3BG6 A;  3LSH A;  2IT0 A;  4K2E A;  2QBY A;  2W24 A;  4BDZ A;  2KIF A;  3COL A;  1HST A;  1QZZ A;  1B9N A;  3G4S I;  2JSC A;  2PEX A;  4XBF A;  1RR7 A;  5A2Q Z;  3DBR B;  3KP6 A;  3GFL A;  3C7J A;  2GBY A;  4BJT A;  4DBR A;  3HOV J;  1HKT A;  3S16 J;  3O2P E;  1FEX A;  3GXO A;  2FXA A;  3NWS A;  3N4M A;  1ETK A;  3NS4 A;  1IAW A;  5LEJ A;  3NWT A;  2ZSI B;  2LF8 A;  3EYY A;  1V5G A;  3SZP A;  3TDU C;  2UXU A;  4QSH A;  2OQR A;  1VF9 A;  3K4J A;  1FWZ A;  5FFZ A;  1LB2 A;  1IXC A;  5F0C A;  4IO9 F;  2HU9 A;  2MYS A;  3PL8 A;  4U7B A;  1OCR H;  1XCB A;  2EFP A;  4QPQ A;  1SAX A;  3UKG A;  4BJ5 C;  4G7H F;  1ZAO A;  3GFJ A;  1Y8R B;  2K9S A;  1QZE A;  1F9N A;  3H1C A;  5LGU A;  4U9N A;  1ETX A;  4N9I A;  1ZN2 A;  1G4D A;  3E5X A;  3O8G A;  4PGG A;  2A3S A;  2CUZ A;  3DTE A;  4JBA A;  4LIT A;  1PVE A;  2QKO A;  3KKD A;  5IY5 H;  3QPL A;  3QOP A;  5D5W B;  4HOB A;  4LFU A;  2VBX A;  1IZ1 A;  1DUX C;  3NI7 A;  4ICH A;  1QZY A;  4XRF A;  5D6E A;  3BCB A;  1AA7 A;  1J09 A;  3WU0 A;  2VQH A;  3MKY B;  1N78 A;  1JGS A;  3SEZ A; 
#chains in the Genus database with same CATH homology
 2QCO A;  5K7F A;  3ON2 A;  2EQR A;  3HIM A;  5EG0 A;  3M4O J;  3JRD A;  3ZQC A;  1LE8 B;  1DU0 A;  4X1E A;  2NS7 A;  2GLO A;  4M3E A;  2H8R A;  3JRC A;  1AHD P;  2VUM J;  4A3G J;  3G56 A;  5HSZ A;  2JA7 J;  2ME6 A;  4GCK A;  3HTH A;  3W6V A;  2DMQ A;  2M2E A;  1UI5 A;  2GEN A;  4D7N A;  2R5Z B;  1AKH A;  1Y1V J;  4A3F J;  3ZQG A;  3KKC A;  3Q0V A;  1T33 A;  4JL3 A;  2Y30 A;  5IPA A;  1ETV A;  3DCF A;  3FIW A;  3S1N J;  2DA5 A;  1JUM A;  1IJW C;  2M0C A;  2P81 A;  3TW7 A;  2LTP A;  3S17 J;  5EGO B;  3FKI J;  2OPT A;  1VND A;  1W0U A;  3G1O A;  4DYQ A;  1H88 C;  2JA6 J;  3PO2 J;  4GFK A;  3HOX J;  2AHQ A;  3TP3 A;  1PUF A;  3VVX A;  5EFY A;  3G7R A;  3QPS A;  2ZB9 A;  4W97 A;  3WHB A;  3HOZ J;  2XPU A;  3HKZ N;  4A69 C;  3NRG A;  4AC0 A;  1HLV A;  3EUP A;  2ECC A;  3FIS A;  4NN1 A;  1F43 A;  1ZR2 A;  1F36 A;  4MLO A;  3A03 A;  1X2N A;  2QTQ A;  3DEW A;  2RHA A;  4MFD A;  3A01 A;  5HAW A;  4JYK A;  4XID A;  4MXM A;  5D1R A;  1MH3 A;  4A3D J;  2K9N A;  3NXC A;  4BY7 J;  1BA5 A;  4A3L J;  2W53 A;  1IUF A;  4B1R A;  3GTO J;  3LSJ A;  1QVU A;  1TWH J;  2JN6 A;  5C4J J;  1VFC A;  3M3Y J;  3FK6 A;  1SGM A;  4A3K J;  1O4X A;  3P9T A;  1H8A C;  1HF0 A;  2Y31 A;  3OSG A;  3BG5 A;  5GP9 A;  2KDZ A;  1MNM C;  2UXO A;  3KZ9 A;  2FJ1 A;  1T56 A;  1MBG A;  4FE4 A;  1RKW A;  3HE0 A;  4B4C A;  2R92 J;  1JJ6 C;  3LOC A;  4M3B A;  5IP9 J;  2NP3 A;  1A6I A;  2CU7 A;  4BXX J;  2MG4 A;  2HOA A;  2D6Y A;  2XGD A;  1LFB A;  3NAU A;  4A3E J;  2E2J J;  3OOU A;  1P7J A;  4QTR A;  5F1J A;  4XRS G;  2HYT A;  2EBI A;  3TP0 A;  4MO7 A;  5M5X J;  3VOK A;  3T6N A;  5FJ8 J;  1NK2 P;  2L9R A;  4V2F A;  2Y0S N;  4I6Z A;  2JK3 A;  5J3L A;  3AQS A;  2LY9 A;  2XGC A;  2LVS A;  2I10 A;  2CRG A;  2QWT A;  3K2A A;  3HDD A;  5EG0 B;  1RPW A;  3GBG A;  5DTD A;  2FBQ A;  3VVY A;  3LSR A;  3RKQ A;  5IYB J;  1XS9 A;  1JKP C;  4LOC A;  4HNV A;  3OSF A;  5H9T A;  2DG7 A;  2XPW A;  1FIP A;  2E1O A;  3SDG A;  5GPC A;  2HYJ A;  1FIA A;  4JKZ A;  5DS9 A;  1AKH B;  3PAS A;  5FKL A;  1RKT A;  4G12 A;  1WCM J;  2DMN A;  5IYD J;  2WV1 A;  2NVX J;  2W48 A;  1DU6 A;  2WGB A;  9ANT A;  4NEL A;  4AF5 A;  1ETW A;  2EZK A;  4FE7 A;  1A5J A;  3BCG A;  3RD3 A;  2NOG A;  1QVT A;  2ZOZ A;  3BQZ A;  2PBX A;  2YS9 A;  2JWT A;  1PUF B;  2QOP A;  3BT9 A;  2K9Q A;  4J19 A;  5HOD A;  1HCR A;  5FKN A;  2LFB A;  4AUX A;  3Q3S A;  4AC6 A;  3I4N J;  1UMQ A;  3Q0U A;  4JX4 A;  4GFB A;  1XG1 A;  5J1U A;  1R9T J;  1B72 A;  3HTA A;  4S0H B;  3HBL A;  5F04 A;  1E3O C;  1IG7 A;  1BL0 A;  5FKO A;  5FGL A;  3A01 B;  5C4Y A;  3ZQF A;  5C3E J;  4W1U A;  2ECB A;  2RAE A;  3JRE A;  5M5Y J;  4Y52 J;  1GVD A;  4A3M J;  1I50 J;  3HOW J;  3JRB A;  1Z0X A;  3JRF A;  1IV6 A;  1GV5 A;  4A3C J;  1MBH A;  3BTL A;  3MVP A;  3HTJ A;  3RH2 A;  2L7Z A;  4PXI A;  3JR9 A;  4D5C A;  3TW6 A;  5DAJ A;  4EEF G;  2O9L A;  2AO9 A;  4C3I J;  3BRU A;  3IH4 A;  3SJM A;  5GPA A;  2D5V A;  4AYB N;  3BR1 A;  1TWG J;  1FJL A;  1S7E A;  2YUS A;  5M3M J;  1YRN A;  5C4X J;  4RDU A;  1OCT C;  4XRM A;  1HOM A;  3HGY A;  2IBD A;  4QIW N;  4L5E A;  5FKM A;  3TED A;  3O8H A;  3BR6 A;  4IHW A;  4DW6 A;  3F0C A;  2K40 A;  3MKL A;  5K58 A;  1ZQ3 P;  3MN2 A;  2HOT A;  4A93 J;  4XRS A;  1OCP A;  5AQC A;  2HQ5 A;  2JA8 J;  3S15 J;  2EZH A;  3CMY A;  2NX4 A;  2MW8 A;  3BJB A;  5CXI A;  2QF7 A;  2VPR A;  1QRY A;  4IEJ A;  1NK3 P;  1LFU P;  4GCL A;  1Z77 A;  3PO3 J;  2L7F P;  2DA7 A;  3PPB A;  5E3N A;  1B8I A;  2ZCM A;  2VI6 A;  3HM5 A;  3S1Q J;  2O7T A;  1IDY A;  5IP6 A;  1JTX A;  2IAI A;  3VVZ A;  4V2G A;  5HBU A;  2E2I J;  2DA2 A;  3BTJ A;  1ZR4 A;  3LSP A;  3JRI A;  5EZG A;  2B63 J;  1UI6 A;  3S14 J;  2VKE A;  2H1K A;  2L0K A;  2DMU A;  3VIB A;  2M34 A;  1ZK8 A;  2DA3 A;  2GFN A;  2PZ9 A;  5F0H A;  1HDP A;  2OI8 A;  4C3H J;  2HDD A;  2COB A;  1JKO C;  4ACI A;  2TRT A;  3OIO A;  1TWA J;  1FTT A;  3VP5 A;  3JRH A;  2M8G X;  3F1B A;  3S5R A;  4I76 A;  1MSF C;  3RZO J;  3EGQ A;  5EZH A;  2XGE A;  1VI0 A;  1CQT A;  3GTG J;  3QBM A;  3V78 A;  3GTJ J;  3LJL A;  1K83 J;  3Q0W A;  2LK2 A;  3QQA A;  1JUP A;  1UG2 A;  5JLX A;  3ANG A;  5D18 A;  4JX5 A;  1X58 A;  5EEA A;  1ZGW A;  4BBR J;  1ETY A;  3H3V K;  3D1N I;  3CCY A;  1B72 B;  4CGR A;  4FIS A;  4YZE A;  2FD5 A;  4GFL A;  4DYC A;  4DZP A;  2E19 A;  4DZJ A;  1ZKG A;  2TCT A;  5IP7 J;  3BQY A;  3VW1 A;  3GTQ J;  1JKQ C;  2DA6 A;  4Y7N J;  2F07 A;  4JP0 A;  4UUT A;  2HKU A;  2Q24 A;  5CXG A;  2DA1 A;  3V6G A;  3CWR A;  1IGN A;  2YVH A;  3A02 A;  3LNQ A;  2E2H J;  5J1Y A;  2Y9Y A;  1Q1V A;  1ORK A;  3FK7 A;  5FMP A;  5CW8 A;  4XIC A;  2CUF A;  1K61 A;  1ITY A;  4IHY A;  3LHQ A;  2XSD C;  5F27 A;  2DJN A;  2CQQ A;  2G7S A;  3HTI A;  2REK A;  3GTL J;  1YRN B;  3ZQL A;  4UUS A;  1X2M A;  1MH4 A;  2L7M P;  2ID6 A;  2CQX A;  3HOU J;  3C2B A;  2M9H A;  4M3G A;  3GTP J;  2IEK A;  3IH3 A;  3BHQ A;  1ETO A;  2G0E A;  2O7O A;  5C44 J;  4JNN A;  3HEF A;  5IYC J;  5FKK A;  4RBO A;  4KWA A;  5E3O A;  2ELK A;  3B81 A;  1MSE C;  1W0T A;  3GTK J;  1APL C;  1JT6 A;  3BG9 A;  1ETQ A;  2EH3 A;  2EZL A;  4A3B J;  3O60 A;  3BR0 A;  3GZI A;  2DTZ A;  1UHS A;  1Y1W J;  4MFE A;  1JJ8 C;  1B8I B;  5JLW A;  3BTI A;  3CQZ J;  4NDL A;  2GM4 A;  5J1R A;  4CYC A;  2O8K A;  4A3I J;  2UXI A;  1WH5 A;  3WHC A;  2YU9 J;  2XPV A;  1U9O A;  3IUV A;  2CJJ A;  5BNG A;  1MBK A;  3RQI A;  2UXH A;  3NNR A;  2HXO A;  3HGG A;  1GDT A;  4B3A A;  4BKX A;  3L1P A;  1GT0 C;  2LKX A;  3H0G J;  2NP5 A;  1QPI A;  1TC3 C;  1H89 C;  2XB5 A;  5EDN A;  3BR2 A;  2R5Y A;  2G7G A;  1U8B A;  4GCT A;  4M3F A;  3RZD J;  4C3J J;  1G2H A;  1RET A;  1JKR C;  4DYR A;  4ABZ A;  4MIM A;  2DA4 A;  1TWF J;  3B6C A;  3BNI A;  4MK6 A;  1OJL A;  5IOZ A;  3B6A A;  1POG A;  5F08 A;  4FTH A;  3ZOB A;  2X9D A;  4BBS J;  4M3D A;  2RAS A;  2OF7 A;  2MGQ A;  5EF6 A;  2ME0 A;  2R0Q C;  3E7Q A;  2X48 A;  1SFO J;  2ZCN A;  3VUQ A;  2WAQ N;  2YVE A;  3QKX A;  4L62 A;  2JMW A;  3K7A J;  2PMZ N;  3NPI A;  3ZQI A;  3KNW A;  3CJD A;  1ZTR A;  2LR8 A;  1U9N A;  4IHX A;  3VW2 A;  2DMT A;  5K7Z A;  3VOX A;  2N8G A;  2HI3 A;  2G3B A;  4JX6 A;  2R7Z J;  3FRQ A;  5D19 A;  3HB9 A;  1LE8 A;  2ZCX A;  1BJZ A;  3VPR A;  1D5Y A;  3HOY J;  1NTC A;  3DPJ A;  2G7L A;  2VKV A;  1MBJ A;  2LLK A;  2FX0 A;  1JGG A;  2XRL A;  2LD5 A;  3S1M J;  3G1M A;  2V57 A;  3PM1 A;  2R5Z A;  2DG8 A;  4C2M J;  3IH2 A;  1I6H J;  4UUS B;  2NVT J;  1IC8 A;  5K7H A;  2Y9Z A;  1HDD C;  1TWC J;  3S2D J;  3AQT A;  2WB1 N;  3MNL A;  4FCY A;  2DMP A;  3BR5 A;  5FLM J;  3GTM J;  2HOS A;  5FHP A;  2ID3 A;  3COL A;  3CRJ A;  5EGO A;  3SFI A;  4M6V A;  2UXP A;  5E3M A;  1RR7 A;  1XC5 A;  3IV5 A;  2DN0 A;  2GBY A;  1FTZ A;  3HOV J;  3G1L A;  3S16 J;  3C07 A;  4D7M A;  3VW0 A;  5IOY A;  1AU7 A;  1FEX A;  4HKU A;  1JTY A;  1JT0 A;  3S1R J;  1MBE A;  5E3L A;  4CYC B;  1EF4 A;  1ETK A;  5M3F J;  1SAN A;  2LP0 A;  3LSG A;  2EZI A;  3ZQH A;  3JRA A;  1BW5 A;  1P7I A;  5F0F A;  1WGX A;  4UDS A;  2JA5 J;  1WPK A;  2UXU A;  2X6O A;  3LWJ A;  4QSH A;  1VF9 A;  2KT0 A;  3BR3 A;  2R5Y B;  1U78 A;  1IDZ A;  5F0C A;  3JSJ A;  1ENH A;  1GUU A;  2WUI A;  4X6A J;  2ZOY A;  2NVY J;  3E7L A;  1WI3 A;  3JRG A;  2IU5 A;  2QIB A;  2NVQ J;  1GV2 A;  5FLV A;  2HXI A;  1RES A;  3BTC A;  4BY1 J;  3I4M J;  3S2H J;  3UKG A;  1IRZ A;  2GUH A;  2Y2Z A;  2CUE A;  4ME9 A;  2K9S A;  2XDN A;  4D5F A;  1ETX A;  2XB0 X;  3BG3 A;  5EYR A;  2MSY A;  3O8G A;  3GEU A;  3ON4 A;  4IHV A;  2QKO A;  3KKD A;  2R93 J;  3QPL A;  3NAR A;  4XK4 A;  1BW6 A;  3NI7 A;  4A3J J;  4ICH A;  2NS8 A;  1MBF A;  3ANP A;  1JUS A;  2OER A;  1OFC X;  1WH7 A;  2JJ7 A;  3CDL A;  2FQ4 A;  1I3Q J;  5M5W J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...