3QPLA

G106w mutant of ethr from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
b'GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTWINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Structural activation of the transcriptional repressor EthR from Mycobacterium tuberculosis by single amino acid change mimicking natural and synthetic ligands.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qplA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qplA02
3HOVJ 2QCOA 3TP3A 2PBXA 4LOCA 1MNMC 3GTPJ 5IYBJ 3W6VA 3ON2A 4M3EA 1VF9A 1Z77A 2WV1A 4J19A 3GTOJ 4D5CA 4UUSB 2JA5J 2E19A 3QPLA 4MK6A 4A3DJ 1T56A 3ZQHA 1IDYA 3COLA 2DA2A 2UXPA 1ORKA 3JR9A 1HF0A 5C4XJ 5D19A 2R93J 3CWRA 5J3LA 3HOXJ 2YVEA 3QBMA 4BBRJ 2CJJA 2FD5A 1X58A 3K7AJ 4XK4A 3ZQCA 3BQYA 3LHQA 2FJ1A 2X6OA 4DZJA 3HTHA 2GLOA 2XPUA 4NELA 2E2IJ 1I3QJ 1RPWA 3F1BA 3UKGA 3V6GA 3S15J 2OF7A 1JJ8C 1JGGA 4XRSA 2HOTA 1UI5A 2JWTA 1GUUA 5CXGA 2JA6J 1MBHA 1RETA 3RZDJ 4GCKA 1HOMA 1POGA 2L0KA 1R9TJ 3VVZA 3OOUA 1B72B 3TW7A 1ETOA 2DA6A 3WHBA 3H3VK 4EEFG 1NK3P 2XPVA 3Q0VA 1MSFC 3ZOBA 3BG5A 5HSZA 1XS9A 3RD3A 3FRQA 2L7MP 5F27A 2E2JJ 3S16J 4AC6A 3BTJA 2UXHA 2PMZN 3TEDA 1WH7A 3QQAA 4C2MJ 2E2HJ 3A01B 2G0EA 3KZ9A 2HI3A 4I6ZA 2N8GA 4A3LJ 3DPJA 4MIMA 1VFCA 4AYBN 3F0CA 3G1MA 1FTTA 3LSRA 3VW1A 2DTZA 2NP5A 3VOXA 3JRFA 2UXOA 3TP0A 1XC5A 5IP6A 2REKA 2QWTA 4FE7A 1MBGA 3SDGA 2R92J 2HYTA 2ZOZA 3BCGA 3HE0A 4XICA 3S5RA 4XRMA 1ZKGA 2EZLA 2ZCXA 4JP0A 2LFBA 2CU7A 3BG9A 3NAUA 4AC0A 1BW5A 3FKIJ 3CDLA 3ZQIA 4G12A 2K40A 1JKOC 5E3OA 4KWAA 2DMQA 1BJZA 4FE4A 2H8RA 3HTAA 5FKKA 2NS8A 5BNGA 4GFLA 2EZIA 1FIAA 3M4OJ 3CJDA 4XRSG 2P81A 1FJLA 3CCYA 1IUFA 1K83J 1MBEA 1U9NA 2NVYJ 2KDZA 2WGBA 2NVQJ 4A69C 1SGMA 5M5WJ 3JREA 1T33A 3OIOA 1ETVA 1ENHA 2EQRA 2HQ5A 4A3KJ 1DU6A 1W0TA 2VUMJ 2V57A 1D5YA 1IJWC 3IH4A 5C3EJ 1HCRA 3EUPA 3HBLA 3D1NI 3IUVA 4D7NA 3BTLA 4C3HJ 3G7RA 5F04A 1RR7A 2X9DA 1JKRC 1FTZA 3V78A 1OCPA 2XPWA 2TCTA 3GTMJ 3PASA 3PO2J 4A3FJ 4FCYA 4UDSA 5FKOA 3P9TA 2IAIA 1ETWA 2ZCMA 1TWFJ 3PO3J 3GEUA 2K9NA 2D5VA 3ON4A 2VKEA 1MBFA 5FMPA 4IHVA 1JJ6C 3A03A 3I4MJ 3NARA 4CYCB 4B3AA 1HDPA 2FX0A 4X1EA 2Y9ZA 2JA8J 3LNQA 3NRGA 3B6AA 3M3YJ 5E3NA 4GCLA 4BKXA 3NNRA 3O60A 4A3MJ 2CUEA 5EZGA 1OJLA 3IH3A 2K9SA 3BR5A 5K58A 3BTCA 2M9HA 3I4NJ 4NDLA 2DN0A 1UI6A 3JRHA 5EGOA 2NS7A 3Q0WA 2WAQN 3C2BA 3FIWA 2AHQA 3PM1A 1PUFA 1ZTRA 3SJMA 3G1LA 5HAWA 4A3BJ 5FLMJ 3L1PA 2MG4A 3MVPA 5CW8A 3BR0A 1GDTA 5IYCJ 1IG7A 1UG2A 4MFDA 1E3OC 3HGYA 2OERA 1O4XA 3VUQA 2R5ZA 2WB1N 5EYRA 5EFYA 1TWCJ 4D7MA 3G56A 2UXUA 5HBUA 2FQ4A 2R7ZJ 2DA4A 2COBA 2HKUA 1GVDA 3GBGA 2YS9A 4D5FA 5IYDJ 2ELKA 3B81A 2LP0A 5D18A 1A6IA 4C3JJ 3IV5A 4MFEA 2W48A 1UHSA 3KKDA 3MNLA 3T6NA 1W0UA 2XB0X 2DA7A 3A02A 2ZOYA 1FEXA 2OI8A 1RKWA 4B4CA 5IPAA 2ME0A 2Y0SN 2L9RA 2XDNA 3BR2A 3KKCA 1U8BA 2IBDA 1WI3A 2HOAA 3BTIA 2ECBA 4B1RA 3BHQA 1DU0A 2GFNA 3RZOJ 5GP9A 4A3EJ 5DAJA 2DG8A 3DCFA 1ETXA 4IHWA 4GFBA 2E1OA 2M8GX 5EGOB 2WUIA 5GPAA 9ANTA 4M3DA 1PUFB 2ID6A 2M2EA 2QF7A 4V2FA 2YUSA 2ME6A 4IEJA 4HNVA 2L7ZA 4W97A 1VI0A 2XGEA 4W1UA 2LKXA 2H1KA 4BXXJ 3HIMA 3HM5A 1H88C 2F07A 2OPTA 1JT6A 4A93J 2MGQA 2K9QA 1MSEC 2HDDA 4V2GA 2GM4A 2VPRA 5M3FJ 3BT9A 4QTRA 4RDUA 1H89C 3JRAA 2R0QC 1QVTA 4IHXA 3AQTA 1GV2A 4DW6A 3RKQA 3RQIA 2G7GA 3WHCA 1ZK8A 1Y1VJ 3ANGA 4JL3A 1ETQA 2Y31A 2O7OA 4Y7NJ 3VW2A 1BL0A 1X2MA 3HOYJ 2DA3A 2QTQA 5CXIA 5D1RA 1LFUP 1OFCX 2GUHA 3JRBA 2YVHA 1F36A 3CQZJ 3LOCA 2NP3A 2M0CA 1YRNA 2DMUA 2DMPA 2RHAA 2ZCNA 5F08A 3AQSA 1SANA 2ID3A 3FK6A 5FJ8J 4PXIA 2G7LA 3CRJA 4NN1A 1P7IA 1FIPA 4ICHA 2G3BA 2VKVA 5IP7J 1H8AC 3OSFA 3HOUJ 4A3GJ 4C3IJ 2O9LA 2YU9J 1B8IA 1WCMJ 2W53A 2HYJA 5C4JJ 2CQXA 2XRLA 5J1RA 2MSYA 4UUSA 1IGNA 3CMYA 1VNDA 5JLXA 2JJ7A 1I6HJ 2XGDA 2CRGA 4AF5A 4L62A 1RKTA 1LFBA 3LWJA 4M6VA 2ZB9A 3BJBA 5AQCA 3LJLA 2LK2A 3HKZN 3ZQGA 1BA5A 3EGQA 5IOYA 3HGGA 4DYRA 4JNNA 2R5YA 3BR3A 3VIBA 2Y9YA 2LY9A 5J1YA 2MW8A 3JRDA 4BY7J 3S1RJ 4BBSJ 1ETYA 3NI7A 1U9OA 4GCTA 1YRNB 1RESA 3MKLA 4JX4A 3VVYA 2PZ9A 1IV6A 2Q24A 2EZHA 3GZIA 2FBQA 2JK3A 5EF6A 5HODA 1Y1WJ 3S1NJ 3DEWA 5M3MJ 3O8GA 1JTYA 5F0CA 4L5EA 1MBJA 1JUMA 2X48A 3S14J 2LLKA 2HXIA 1AKHA 1ETKA 3C07A 5K7FA 3JRCA 3ZQLA 4UUTA 1B8IB 3FISA 1IDZA 2DMTA 3HDDA 1JT0A 1TWGJ 3VPRA 5IP9J 3E7LA 3A01A 2NOGA 2NX4A 2NVTJ 1P7JA 3JSJA 1QVUA 1G2HA 2RASA 2GBYA 1AHDP 5EEAA 2HOSA 4M3BA 2QIBA 1ZR2A 5EDNA 1MH4A 3HOZJ 3BR1A 1JKPC 2GENA 3VW0A 2VI6A 1MBKA 1QRYA 2IEKA 5J1UA 5M5XJ 3RH2A 4GFKA 2R5YB 1LE8A 5C44J 5IOZA 4JX6A 5F1JA 3BRUA 2Y30A 3MN2A 1TWHJ 4M3FA 4BY1J 2L7FP 5FKNA 5H9TA 2I10A 1Z0XA 1SFOJ 5E3LA 3O8HA 2DJNA 3BR6A 1QPIA 3GTGJ 4A3JJ 4MXMA 3E7QA 4FTHA 4HKUA 4A3CJ 3Q3SA 5DS9A 2XB5A 1HDDC 4ACIA 2M34A 1AKHB 3LSGA 2XGCA 1JKQC 2EH3A 4QIWN 1AU7A 3BNIA 4X6AJ 4A3IJ 3LSJA 5EG0A 2R5ZB 4IHYA 2DA1A 2KT0A 2ECCA 1K61A 3GTKJ 3S2DJ 4AUXA 2O7TA 2LD5A 2D6YA 4DZPA 1XG1A 3HOWJ 5FKMA 1WH5A 1IC8A 3S17J 4XIDA 1UMQA 2NVXJ 3OSGA 2DG7A 2CUFA 2LTPA 4FISA 1JTXA 1S7EA 1NK2P 2XSDC 3GTLJ 4MLOA 3JRGA 3VOKA 4DYCA 1EF4A 3B6CA 2DMNA 3GTJJ 1LE8B 5FGLA 3SFIA 1ZQ3P 1ITYA 4JKZA 5JLWA 3LSPA 1WGXA 2Y2ZA 5E3MA 2JA7J 5M5YJ 2CQQA 1NTCA 5F0HA 3HB9A 1A5JA 1JUSA 3S2HJ 3QKXA 2HXOA 4CYCA 3JRIA 3HEFA 5EZHA 4QSHA 3VVXA 2B63J 3BQZA 2G7SA 2EBIA 3HTJA 3NPIA 1OCTC 4JX5A 5C4YA 3S1MJ 1TC3C 3FK7A 2UXIA 3KNWA 5EG0B 2EZKA 1HLVA 3HTIA 3TW6A 2QOPA 3IH2A 1GV5A 3ZQFA 4ME9A 2TRTA 1BW6A 3G1OA 1U78A 2QKOA 2DA5A 1GT0C 2LVSA 3S1QJ 4JYKA 1TWAJ 5GPCA 3Q0UA 4I76A 1I50J 1X2NA 5FLVA 1WPKA 4M3GA 2AO9A 3NXCA 2JN6A 3BG3A 2IU5A 4YZEA 3GTQJ 3QPSA 2JMWA 1IRZA 2RAEA 3K2AA 1CQTA 5F0FA 3VP5A 5K7ZA 4MO7A 2O8KA 3H0GJ 1F43A 4S0HB 1MH3A 3PPBA 3ANPA 1Q1VA 1ZR4A 4RBOA 4CGRA 5FKLA 1ZGWA 2LR8A 1APLC 5K7HA 4DYQA 5FHPA 4ABZA 4Y52J 1B72A 1JUPA 5DTDA
chains in the Genus database with same CATH superfamily
3ZMDA 3H0DA 3TP3A 1T8IA 3QU3A 3GTPJ 3ABKH 2QSGX 3M8FA 1R49A 5IYBJ 4NC6A 3C2HA 2AS5F 2EFPA 3QU6A 2X51A 3VYRB 1T56A 2ZCWA 3DKWA 5DYMA 2ZKZA 3COLA 1D1BA 1DQUA 5A2QZ 4BHPA 1ORKA 3NRVA 1O3RA 3R60A 5C4XJ 2XRNA 5D19A 3IRRA 2JQ7A 2R93J 1MNDA 1R00A 3HOXJ 1X1AA 2YVEA 4G7HF 4F7ZA 2EWNA 2E1MB 2F6CA 2Q2EB 3TO9A 3BQYA 3ZQCA 3LHQA 4B43A 2GLOA 3WE3A 2EV5A 2E2IJ 1QHHD 5D6EA 4E7JA 3C18A 1YLFA 1Z6TA 1OYYA 4XRSA 2ZXIA 3OYNA 4Q5SF 3R61A 3CF5F 3P9CA 3K0LA 4Q47A 1RETA 3E5UA 5B1BH 2HWVA 4KMFA 1R9TJ 3VVZA 2JA2A 1G3YA 1BC8C 1B72B 1YS6A 2LSOA 5HDKA 2PEXA 1ETOA 4XKBA 3WHBA 5E20A 3VDXA 4EEFG 1PVEA 1MSFC 1OISA 5HSZA 2VQHA 1W7PB 2L7MP 2ZJ2A 5AIQA 2E2JJ 2X6XA 4AC6A 2PLYA 4M9SA 1S29A 2G0EA 3K4NA 2HI3A 4M9XA 3DPJA 4FX0A 4MIMA 1VFCA 3F0CA 1FTTA 1ZLJA 3J80K 3LSRA 3HYIA 3DBHB 2IS6A 1S7AA 2Z9OA 2MH9A 1A31A 4KIGA 4AD9A 3VW1A 2NP5A 3J80Z 4C30A 3VOXA 1E0EA 4CCJA 2MLKA 5IP6A 4I01A 3CCSI 1YIJI 4IZZA 4FE7A 3SDGA 3HRMA 3WTZA 2XROA 1VQ8I 4HF1A 1GLNA 3ZMSA 1KQ8A 1HKQA 3AAFA 1YYVA 3FXUA 3DKXA 2JT1A 2DT7B 3FKIJ 4NHJA 2LH9A 3CDLA 2ACJA 4HOBA 4RB3C 5E3OA 2VXDA 4PGHA 4D0PA 2LDUA 3SZGA 2FSWA 4WCGA 2H8RA 3NEUA 5FKKA 1B59A 4RAYA 2K4JA 4GFLA 3M4OJ 1VQPI 2K9LA 4II2A 2CG4A 4HZFA 3WGGA 1A36A 1JE8A 2B1EA 3CCYA 1Z05A 3DEEA 3TO7A 2FF4A 4A69C 3ERMA 5M5WJ 2O5RA 2A5YB 3KZZA 4AM3A 2L4AA 4CH7A 1ENHA 3ZMTA 3LSHA 4HNTA 2CV0A 4EJWA 4IO9F 1D5YA 2WV0A 2LNBA 3HPGA 3HBLA 4CDGA 1N77A 1UFMA 1W5SA 4D7NA 2LKPA 4GRIA 1RR7A 1XSVA 1FTZA 2QUFA 2LBFB 1IN7A 5CVIA 4HSRA 3OY9A 3TOBA 2R7OA 2KHMA 4A3FJ 4UDSA 3K4BA 1ETWA 2D45A 4JQFA 3GEUA 3ON4A 3FHNA 2XKOA 1VQ7I 4XKVA 4PK4A 1MBFA 4IHVA 3A03A 5HDNA 4B3AA 5KNLA 2FX0A 2A68F 1TQIA 2Y9ZA 2Q8KA 2JA8J 2IA1A 3KEYA 2HQAA 4DIQA 1K78B 2G7HA 2QBYB 4GCLA 3K9TA 4BKXA 5GTIC 3NNRA 2ZFWA 2DAOA 1SFXA 2P7VB 1U0JA 1R4NB 2M9HA 3T1BA 4YRVA 3QRFF 1KU2A 1WJBA 4NDLA 1XGNA 5EGOA 1UI6A 3CDHA 2WAQN 3EUHC 3FIWA 5ERIA 5H20A 2W7NA 4OIQF 4XSZF 2IGMA 3RCOA 1O3QA 2MC3A 3JTGA 1STZA 4UV8A 5HVQC 4MEXF 1IG7A 2P7CB 4ZTFA 1E3OC 3AL0C 1R4MB 4MTDA 4CA0A 2YR2A 2ELJA 5EFYA 1TWCJ 1VQ6I 1MJ9A 1WSUA 4ENNA 2FQ4A 2DA4A 4M71A 1GVDA 1O3SA 3CCVI 5IYDJ 2ELKA 2CW7A 3B81A 4RGXA 2ADUA 1K4TA 1A6IA 4C3JJ 2ZJPF 2W48A 2A2FX 1UHSA 2PBIA 4LG3A 2E71A 1W0UA 1HW2A 3A02A 2DT5A 4Y15A 2ZOYA 2WY8Q 2ME0A 2AXLA 4FETA 1U8BA 1V4RA 1XDSA 2HOAA 2IBDA 2ECBA 4B1RA 3LSMA 5DD4A 5D5VB 1E2XA 5J4YA 2PFVA 3BHQA 1DU0A 2V79A 2H27A 2IPQX 1ETXA 2Z5UA 2KIFA 4IHWA 3WG9A 2WUIA 2M8GX 2R7WA 4ZDPA 9ANTA 3WODF 4JOMA 2M2EA 1IAWA 1S3JA 3K4LA 2C6YA 1WJEA 2Y69H 2ME6A 4OU0A 2F5EA 4G6QA 4IEJA 2L7ZA 4W97A 1UB9A 3HRTA 1VI0A 2DW4A 2H09A 2XGEA 2H1KA 3I58A 1G3SA 3ABLH 1H88C 2FNAA 1LNWA 5JHUA 2L3DA 1VQMI 4A93J 1MSEC 4P9FA 4V2GA 2GM4A 4QTRA 4RB2C 1Z3YA 3JRAA 4CYDA 1LVKA 3RKQA 3ISPA 3WHCA 1S9HA 4B09A 3IWZA 3J7ZI 2KPMA 4JL3A 2Z3YA 1ETQA 2O7OA 4LIVA 1S72I 3TKYA 1X2MA 3HOYJ 2O61A 2XSJC 5D1RA 2KKOA 1PP7U 2YVHA 2AQFA 3HJEA 3CZ6A 3K6GA 3LOCA 3CCMI 3N97A 1K79A 4XLEA 1ZG1A 2V6EA 5DEQA 5E8IA 2ZCNA 4DGWB 2ID3A 3FK6A 4BEHB 4ITVA 3LL7A 4PXIA 5D5UB 1YJNI 3LSIA 2XGXA 3OYDA 2ETHA 5K5RA 4RS8A 3B73A 4ZYHA 3FKJA 2HDCA 1EKEA 1Y6IA 3HOUJ 2KMUA 2VJ4A 3RYRA 3PUFA 1ERDA 5J1RA 3WU2C 4WXHA 5B1AH 4NBQA 2GA1A 3KP5A 1VNDA 4XM3A 2FOWA 4F3QA 4NC8A 3GF2A 4OIRF 2V7FA 1MMNA 3DEUA 1RKTA 3HC7A 2PI0A 2ZB9A 1BI0A 4XBFA 1PUEE 2QA4I 5CYVA 1YW9A 3ZQGA 2WBMA 1R58A 1AWCA 4AWXB 2XUBA 1P4AA 2Y9YA 5IT3A 2LY9A 5J1YA 2V1UA 4XLHA 4Y4RA 3JRDA 3RKXA 1YI2I 2EINH 3IUOA 2XVCA 3CCUI 2Z99A 3NI7A 3BPXA 3GVAA 4BE2A 1YRNB 3MKLA 1T39A 1RUOA 3X2QH 2QQAA 3LWFA 3GZ5A 5CPRB 3TDUC 1OCZH 2ZFUA 3KETA 4G7OF 4U9NA 2IA2A 1MDMA 2FBQA 4CGZA 1C0WA 4OAYA 4HLXA 3KYDB 1P92A 4H0EA 3OR1C 4L5EA 1DP3A 1FOYA 3QP6A 2EA4A 3S14J 1MZBA 3PSFA 3C07A 3JRCA 1OR7A 3TGNA 4HAMA 2DMTA 2BGCA 1F5TA 2BY0A 3ZXSA 4X0GA 3AL0B 3GZ6A 4OIPF 1MD0A 3HTUA 3WTUC 2NOGA 3ZQQA 5ILUA 2XAJA 2DDBA 1AOYA 4WXCA 1W36C 1J59A 1U6GA 3JSJA 2RASA 4LJZF 1SD6A 5EEAA 5D4SA 1ZR2A 1MH4A 3VOEA 3BR1A 1JKPC 3K69A 1QRYA 3PIPF 3RH2A 2F5FA 4GFKA 3MZYA 4L9TA 2EIJH 3I5UA 1JXSA 2P8TA 3EUAA 4XKCA 3S3OA 4M3FA 3DBRB 1J9IA 1Z0XA 3ASNH 2L5QA 1S6LA 2OZUA 3CP8A 2JVHA 3I4PA 4ZH4F 3WTXC 3L2WA 1N75A 2CV1A 2XIGA 3OYIA 3QPTA 3L09A 2NYXA 4MXMA 4XORA 1QQIA 4F93B 3EQLF 3LSGA 5D4RA 2JTVA 1ZLKA 2M4GA 3DPLC 2W85A 1AU7A 1D1AA 3BNIA 3LSJA 3PQKA 4E7ZA 5EG0A 4OIOF 2CGPA 1KZHA 4EATA 5E79C 2HVRA 4R8HA 2FMYA 3ONQA 1UG0A 3GTKJ 1FPQA 4XLAA 2O7TA 3LSKA 5FKMA 1WH5A 2M45A 1MMAA 1QGPA 3K1MA 1NK2P 3CDIA 1K6YA 2ICWG 1HW5A 4MLOA 4MHGA 2DFHA 5BOXA 1EF4A 3JSPA 1ZG3A 1LE8B 2GA2A 1WKMA 2V26A 1UHWA 3WTYC 4EGZA 1E17A 1ZQ3P 1T98A 1NH3A 3G6EI 5F64A 1WGXA 4B44A 5M5YJ 1NTCA 3HSFA 3WE2A 4GO1A 3HB9A 5LRSA 3VVXA 2FU4A 2R3SA 4HPQA 1T38A 1QU3A 3NPIA 2CQ7A 4JX5A 1Z7LA 1E3HA 2QSFX 2MD0A 2DYSH 3FK7A 4CZZA 2UXIA 3H5NA 3LA7A 2EZKA 1W5TA 1MIJA 3CUQC 1PYVA 3LQQA 3IH2A 4I98B 2KQRA 2TRTA 2LVSA 3S1QJ 5GPCA 1TWAJ 2HPMA 4I76A 1TTYA 3F22A 4N4NB 5FLVA 2ZY9A 1FP1D 4BQAA 2JN6A 3EPZA 3QPSA 3HSRA 3K2AA 2IP2A 1B9MA 1SAUA 3WTVC 1Y39A 2E5ZA 1CQTA 1Z91A 5GAEJ 1LFPA 2KRFA 5HS8A 2VQGA 2O8KA 3H0GJ 3PNTA 1JHHA 4S0HB 3PPBA 2V9VA 3O3KA 3SYTA 1ZR4A 1JGSA 4AIHA 3QOEA 5FKLA 1APLC 5K7HA 4LD5A 3LQRA 2QZ8A 3ZMZA 4I7HA 2IXSA 5KAIC 3HOVJ 2L54A 4LOCA 1XCBA 1S5LC 1MNMC 1VZ0A 5HS7A 3SEQA 3V8KA 4OD4A 3A0BC 1Z77A 2ISYA 5ILSA 2WB1A 2JA5J 2VPLA 1D8KA 2E1NA 2ZSHB 4A3DJ 2VBWA 3NS4A 2M7AA 3AG1H 4PFOA 2UXNA 3JR9A 3FZVA 2K9MA 1GXQA 2JPCA 1TT5B 4L0ZB 3CWRA 1D0ZA 1USSA 1IRGA 3OS1A 4BBRJ 3QBMA 2HVQA 2FD5A 3GFJA 1X58A 2QQBA 3EYYA 1FWZA 2CQKA 4N9HA 2FJ1A 2X6OA 4DZJA 2XV4S 2XPUA 3H1CA 3UKGA 3V6GA 2HR3A 2H1LA 2PFBA 3TBIA 2OF7A 2Z33A 3S15J 1YIOA 4ANJA 1JGGA 4BH9A 3M8EA 2HOTA 1UI5A 1R71A 3OS2A 1ZRFA 3TO6A 5CXGA 4DVYP 5DCMA 4U7BA 3RZDJ 2Z2SB 2HEOA 3OOUA 2V6CA 2KJCA 3TW7A 2DA6A 1ZGAA 4M72A 3GZNB 1VQNI 5H2FC 2J5OA 1YJWI 3BOQA 1XS9A 2RGVA 2A3SA 5F27A 4HQMA 2UXHA 1WH7A 4C2MJ 5J8FA 2R7TA 3A01B 1TQPA 4M73A 1RNLA 4MTEA 1A6QA 4A5MA 3KYCB 3FMSA 3HG9A 5FD5A 4A3LJ 2F5CA 2Y48A 3AKZA 2KIUA 3G1MA 5LHGA 3OMYA 4FASD 3MKYB 4U88A 5ICGA 1LDKB 1I6XA 3E6DA 2DTZA 4BGDA 2O3FA 4BDYA 2KZVA 5B5EC 2PMUA 2UXOA 4XSXF 3CJQB 3TP0A 2REKA 4LMYA 4HRIA 3L2VA 2R92J 5CKTA 2HYTA 4LGWA 1P2FA 4ASNA 4XRMA 2MABA 5DUIA 3AG2H 1V5FA 1Z21A 1MW7A 1BW5A 4RA2A 3VB2A 3HL2A 1FOWA 4ZYGA 3ZQIA 1JKOC 2W82A 2X1DA 1YX3A 2V4JC 1BJZA 4FE4A 4RLFA 3UNGC 3HTAA 2ZO4A 2NS8A 3FHZA 2FJI1 2W00A 2IGNA 2F5DA 2Z1DA 3HOTA 3T0YA 2BY2A 4YFKF 4IRHA 5JI6A 2NXNB 1X1DA 4KITB 2HTSA 2RV8A 1MBEA 1U9NA 2BBYA 1B6AA 2NVYJ 3TQNA 3G71I 1XGMA 1ZRCA 2WGBA 4OOIA 4L0YB 2QENA 3CUQB 1G4DA 4KA4A 1ETVA 3EUHA 3WU0A 2BVMA 2KLOA 2HQ5A 1W0TA 2VUMJ 2VC1A 2A6TA 5DDGA 1IJWC 5ILVA 1R36A 4UB8C 3EUPA 3I64A 2QEXI 3L00A 2HGCA 2BHZA 3DTKA 4WXDA 4NNJA 1JKRC 3VSKA 3V78A 1OCPA 2KIQA 3PIOF 3QYEA 3KEOA 4MQ9F 3PO2J 3FXKA 3K4JA 2JZYA 5B3SH 5TISC 4HX8A 5FKOA 4E4HA 3P9TA 1TWFJ 4XNFA 1X1BA 3PO3J 3OYBA 4IPAA 2D5VA 2VIXA 1X3WB 2GZWA 2X4HA 5B66C 2VKHA 2VKEA 1N78A 1HQCA 3M8JA 4YFXF 4CYCB 3PL8A 1HDPA 3H3ZA 3PUBA 4X1EA 3DKYA 3ZMUA 3AFHA 2VASA 2QKMB 2O6GE 2RVCA 4IOAF 1QZEA 5A2QK 4A3MJ 2CUEA 1OJLA 4U9LA 3F3XA 3ZQ7A 3I4NJ 2TDXA 4LG0B 2V9PA 2DN0A 1H0MA 1I1SA 3MZ8A 2IW5A 3Q0WA 2ZMEA 3C2BA 3ZCOA 1PUFA 2DOFA 3ECOA 3SJMA 1P9QC 1L0OC 5FLMJ 3ZPLA 4LB6B 5CW8A 3N4MA 3J7YJ 3DV8A 1UG2A 4KISA 1LDJA 3HGYA 2OERA 3VUQA 3I9V2 1FNNA 2WB1N 2LF8A 3I53A 3O6BB 4DOZA 4ETSA 3CO7C 3G56A 2W57A 3CF2A 2CFXA 4ZJZA 1FBSA 3K1PA 3H9QA 4E7SA 1RUNA 2QVOA 5HNFA 3F6VA 4ENKA 3FXLA 3EETA 2OV7A 5D18A 3GX4X 2HZDA 3DTIA 4KDPA 3H9GA 1P6RA 4BDZA 1RIOH 3KKDA 3T6NA 1J09A 4LFUA 2XB0X 1FEXA 4KIBA 3R0JA 5IPAA 2X0LA 2ZSIB 2XDNA 3G3ZA 1T08B 4OWRB 3ZGKA 4E6KG 3BTIA 1R23A 3KE2A 2GFNA 3CCLI 3CO6C 3RQ4A 4E7KA 3RZOJ 2QM3A 4A3EJ 2DG8A 1IZ1A 1R1VA 3HHGA 3LA3A 2QLZA 4RAZA 2VBXA 5GPAA 3RPQA 1B9NA 2CFOA 5IT9K 1O57A 4V2FA 2YUSA 2XAGA 3IHUA 4HNVA 3FXQA 4JBAA 2JVGA 5E1ZB 4KNYA 5IT9Z 4W1UA 1X19A 4BXXJ 1J5YA 2RKHA 4UNOA 3HIMA 3HM5A 5CVJA 4A6DA 1IRFA 3HRSA 3H35A 3CC2I 1H89C 3OYMA 2R0QC 3IAS2 1VQLI 4DW6A 2OD5A 1Y1VJ 3CLOA 5E18F 2E1CA 4R1HA 1PDNC 2DA3A 5CXIA 1OMIA 2E36A 3HUGA 1F36A 3CQZJ 1USTA 3HPHA 1R5GA 2M0CA 2NP3A 2OC6A 2DMPA 3GFIA 3L2CA 1SANA 1UELB 4NN1A 3J7AO 1FIPA 4QPQA 4HYEA 4XN3A 2G3BA 3IKTA 2K86A 2JPBA 5KVRA 2DPUA 1VQ5I 1F4KA 2YU9J 4A3GJ 1B8IA 1WCMJ 2HYJA 3MKZA 2LF7A 2DU9A 2CQXA 4GDFA 5FRNA 3D5RC 4IHTA 3BJAA 3K70D 1IGNA 4Y3OA 4Y33A 1IN5A 4U0WA 1Y0UA 1IN4A 3M1EA 3BCAA 2ZJQF 1LFBA 4M6VA 3RIRA 3LJLA 1BA5A 3EGQA 3HGGA 4DYRA 2R5YA 1XPXA 2ZC2A 3VIBA 2X85A 4P5OA 3S1RJ 2CO5A 3HIFA 2JUGA 2YPRA 3L2QA 3CTAA 2GIVA 4JX4A 4XONA 3S2WA 1Q1HA 1MMDA 2IGKA 2Q24A 3LAPA 3F9KA 1XGSA 2LG4A 2EZHA 1UAAA 3GZIA 1TL8A 1Y1WJ 3DEWA 5M3MJ 3TOAA 3O8GA 1JTYA 5F0CA 2PG4A 3RTRA 4ENJA 1MBJA 2X48A 1IXSB 4OINF 3V8LA 1AKHA 1ETKA 5K7FA 4L9VA 1XN7A 3P9IA 4NQWB 2Q1ZB 4ZZLA 4QLCU 2LMDA 2FXAA 3E7LA 1RC9A 3A01A 2KISA 4K2EA 3M07A 1P7JA 4LIUA 3GXOA 2LRDA 1SMYF 1RI7A 3C7JA 2GBYA 1AHDP 1KU9A 2P6SA 3V7CA 3VEPA 1ACIA 4M9ZA 5D8KB 3IWFA 1MBKA 2VI6A 5J1UA 1SD5A 2IEKA 5M5XJ 1U5TC 1IXCA 5C44J 5IOZA 3CJNA 2V1DA 4LK1F 4RMNA 2L7FP 2I10A 2I8DA 4P96A 5HOOA 4G7ZF 1SFOJ 4G94A 5E3LA 3GTGJ 3BR6A 5CQEA 2ZJRF 3BC8A 4HLYA 2E7XA 2XB5A 1QNTA 2XGCA 3FWEA 2HTJA 4DBRA 2BW3B 2EH3A 1JKQC 3U2RA 4X6AJ 3V42A 2DA1A 3NWTA 3P5JA 2ECCA 1SVLA 2KFDA 2DODA 1K61A 1CGPA 3CUQA 5L3DA 2XKPA 3VYTB 2LD5A 5J40A 3OYLA 1XG1A 2FRHA 2OU2A 1GXPA 3S17J 3FM3A 4XIDA 3I55I 3OSGA 2NVXJ 2CUFA 4N9IA 4FISA 2DG7A 2JRMA 1S7EA 2M87A 2LOOA 4HBLA 3JRGA 3BZCA 4U0VA 1HKSA 4FX4A 1S7OA 3JSOA 1L3LA 3H92A 1HXDA 3E6BA 1BI3A 3N05A 4G9YA 3F8MA 4HG2A 3LSPA 2HVSA 3KIOA 2Y2ZA 2CV2A 3FXOA 1IUYA 2CQQA 4F92B 5FFXA 2W4SA 2LY2A 4KN7X 4OMYA 3R4KA 4A0ZA 2VQLA 2VL8A 3S2HJ 3BJ6A 1BI1A 4LLGF 4YELA 3HEFA 4CYCA 4BQNA 5EZHA 4C2UA 3MD2A 3CMMA 2B63J 1ZN2A 3RI4A 4BXFA 2F4OB 4RB0A 2EBIA 4M74A 2M30A 5C4YA 3G4SI 3K70C 3KNWA 3I59B 1HLVA 1SAXA 3W6JB 3HTIA 4LG0A 2GIZA 1U8RA 3HRUA 3ZQFA 1BW6A 1ON1A 1HBXG 2QKOA 2VJJA 2EJRA 1LEBA 2H6CA 3Q0UA 2VOOA 2E7WA 4M3GA 1A35A 2Q2EA 3ULQB 4YZEA 4EJOA 2HYGD 4BJ6C 3KCCA 5J4VA 2RAEA 3NQOA 1TT0A 3VP5A 4XLNF 3AG3H 5K7ZA 3T8TA 5D8LB 1ZAOA 4IXAA 1FOXA 1PP8F 2LR8A 4FT8A 4PDKA 1TW3A 1XB4A 2ZXJA 1B72A 3T5XA 1JUPA 5DTDA 3VYSB 5DV5A 2QCOA 2PBXA 4EM1A 4MQVA 3ZN1A 3W6VA 3ON2A 1W7PA 2HZTA 4YIIA 4J19A 3CC4I 4MK6A 2VJ5A 4HV5A 2GQQA 3ZQHA 1IDYA 2DA2A 2UXPA 2NRAC 4PJ0C 1BN5A 1ODDA 3CJRB 3W6KB 1JI8A 5HNHA 2IRFG 2FMLA 4E70A 5LRRA 3ABMH 2L02A 3HTHA 2R7QA 4WIBA 3BCBA 1I3QJ 1RPWA 4XR6A 2IS1A 3F1BA 5LHIA 2L7KA 5DUKA 2CH0A 1JJ8C 4AVPA 1U5TB 2KL4A 4BHCA 4Y13A 3GYHX 1Z6RA 4AIKA 1GUUA 4HA8A 3DPUA 2VC0A 5F6FA 2O8XA 3VTIA 4BL0B 4KICA 5L3GA 3HSEA 3BPVA 4F52A 2NNYA 3F8CA 3FBIB 2K7LA 2M0MA 3F8BA 4L5IA 2EA2A 3MAJA 3F6OA 3H3VK 3QYBA 2O0YA 3ZOBA 2IGOA 2AQEA 4P1WA 2STWA 1LKXA 3A1YA 5LBQA 4HW0A 2IT0A 3D0SA 2E2HJ 5LGUA 3F72A 2KIMA 2DCEA 3DFGA 4CXFA 1WWXA 4I6ZA 5K1YA 2BY3A 4I2OA 1XCVA 3E3VA 1I39A 3FF5A 4IKFA 2WWYA 5TJJA 4O6JA 4B48A 4F55A 5HLHA 1LDDA 2DK5A 2VB6A 5IY5H 3JRFA 3ABTA 2LBFA 2CYYA 1XDUA 1MBGA 2DK8A 3IAM2 5JHFA 4WX9A 3S8PA 2ZOZA 3JAMK 1ZKGA 2R7RA 4JP0A 2LFBA 1FYMA 2CU7A 3ERED 1FMVA 1SFEA 2HNHA 3NAUA 2IS2A 4E7IA 1B1BA 1V5EA 3RPUA 2CS3A 1YHQI 4RGRA 3JAMZ 4G12A 2K40A 2NVUB 3A0HC 2XAUA 2ESNA 4V19K 4BAYA 1VQOI 3CESA 1IXRC 1FIAA 1MJBA 2NOJB 3IP4B 4I0BA 4U87A 4UXNA 1K78A 2QBYA 2W24A 3C1DA 2R7SA 3I54A 4ZDLA 2P81A 5LD2C 1IUFA 1K83J 2KDZA 2VKDA 2ZBKA 1SGMA 3JREA 3CLQA 3OV8A 2PJPA 3SXYA 2D1HA 2EQRA 1DU6A 2MYSA 2R7FA 1FX7A 2BY1A 3IH4A 5C3EJ 3HKZA 4XQFA 2DFEA 1BOAA 3D1NI 3BTLA 4OD5A 4XLCA 3G7RA 6PAXA 5F04A 3S32A 4B8XA 2X9DA 3DTEA 2ISZA 2P5KA 5FD6A 4LB5A 3GW2A 3FM5A 3G2BA 2TCTA 3GTMJ 3KP7A 4OAZA 2IAIA 3MEXA 2ZCMA 5CVVA 4M6YA 4D9JA 2KDOA 2UWMA 2FUG2 4RAGA 1GVJA 1Z7UA 1SVMA 1XX5A 2CWEA 2HU9A 3K10A 5FMPA 2JUCA 3CP2A 1BR1A 3WGIA 3LNQA 3NRGA 3M3YJ 1Y8RB 5EEHA 4IX7A 3PQJA 4GYIA 1FY7A 1LB2A 2L9NA 3O60A 1HW1A 3MZHA 5EZGA 5LGTA 3KP2A 3BR5A 3IH3A 4IF4A 5K5OA 5K58A 1UHMA 3BTCA 1W4MA 2CQNA 4EQQA 4HQEA 2EV6A 2IJLA 2OCCH 3JRHA 1V54H 4IVNA 1RZ4A 3PM1A 1ZTRA 3G1LA 5HAWA 3OYHA 2DLLA 4UV9A 4L9JA 2MG4A 1BI2A 3MVPA 4IRGA 3BR0A 4XRFA 5E1WA 5IYCJ 2COMA 1YX5A 4MFDA 2BW3A 2VT2A 1OCOH 2RNJA 3H5RA 2BZTA 1FOKA 3L2RA 1OQYA 1F9NA 4D7MA 5HBUA 4DBQA 3F21A 2COBA 2EILH 3GBGA 4EMSA 2F48A 4KIFA 3ECHA 2YS9A 4D5FA 4N4OB 1BOBA 1CF7B 2CUJA 2K4BA 2LP0A 3IV5A 3BZKA 1BC7C 2X6YA 3NWSA 5TGTA 1K4SA 2OBPA 2OCEA 3E0JB 1LJ9A 2OQGA 3OS0A 3MNLA 2STTA 1ZGJA 1RKWA 4B4CA 3EYIA 2L9RA 2Y75A 2PN6A 2QKLB 4XN0A 1WJCA 2MD5A 1J75A 4PSXA 4G8XA 4A0XA 2YX7A 5DAJA 1EH6A 4BEHA 1YITI 4GFBA 2E1OA 5EGOB 3QP5A 3UR3C 4PJJA 4BS9A 4M3DA 5JVTA 5DCFA 1QHGA 2LYCA 4RM2A 2KRHA 3PNYA 4UVBA 2UUZA 2QQ8A 4BUPA 4AU7A 2O03A 4HDVA 2LKXA 1G59A 1XMXA 3ZRGA 3I59A 2BXZA 2OPTA 3K1NA 1JT6A 4ENMA 1H9GA 2BOLA 2K9QA 2HDDA 5JVGF 2QSHX 4IHSA 4HNUA 5M3FJ 1WI9A 2W25A 3SFZA 3BP8A 1QVTA 3H3UA 3AQTA 2HDWA 4GXOA 2G7GA 3ZP5A 4U7DA 2HKXA 2EFWA 3BZ6A 3ANGA 2Y31A 3OIQA 3F8NA 4I99C 3U9GA 1BL0A 2MC4A 1LFUP 1TZLA 2GUHA 3JRBA 4PCQA 1LPQA 3E97A 4MGRA 3CMEI 1R5HA 2DOAA 3U1DA 4A5NA 1YRNA 2DMUA 2OZ6A 1TQMA 2RHAA 4BYYA 3AQSA 2HKOA 1R1TA 5FJ8J 1WVRA 4ZDOA 1QZZA 1OKRA 1DGRM 1P7IA 2DYRH 3I0TA 4ICHA 4N0BA 1X3UA 1FYKA 1H8AC 2P5VA 3OSFA 2EFOA 4LLNA 4UY8I 2O9LA 3KX2A 3Q9VA 2MLGA 4HV6A 2W53A 2IVMA 5J8CA 3P7NA 2HQRA 5L3FA 2XRLA 5C4JJ 3C2GA 1WJFA 4CZCA 2HOEA 2CW8A 2RREA 3SQNA 5KHDA 4ZYDA 3MFKA 5JLXA 2JJ7A 1I6HJ 2XGDA 1KU7A 2CRGA 1MMGA 3HHHA 4AF5A 3JW4A 3QOPA 1O3TA 3LWJA 3S93A 2A6EF 5DD8A 2VBYA 4HEA2 3EUKL 5H6RA 3KP3A 5AQCA 2LK2A 3HKZN 3EDPA 1IV8A 5J47A 2PMHA 4KT5C 2FBKA 1TP4A 3LAJA 3F23A 4JNNA 1OLTA 5ICFA 5FRMA 2F5VA 3DBLB 3BR3A 3C3WA 1ON2A 3WTTC 2FQ3A 2MW8A 4BBSJ 3CJTB 1ETYA 1WHUA 4GCTA 3I56I 2ZNZA 2E34A 5FFZA 3GFMA 3KLNA 1VQ4I 2PZ9A 1IV6A 4RGUA 1BR4A 2WA0A 5FLXK 2JK3A 5HODA 2R7DA 2VXZA 4I02A 3M7GA 1YO5C 1JUMA 1U3EM 1D0YA 5FLXZ 3KYLA 1T0FC 2GOXB 2XHKA 4IOCF 3FISA 2WTEA 3GUDA 4PUSA 1IDZA 5FROA 1TWGJ 1R5ID 2H6BA 4IQJA 2FA5A 4KT6A 3WTWC 2NVTJ 4GGGA 1H9TA 5LFAA 2H94A 1SFKA 4WK8F 2EFNA 4YG2F 3ML6A 5HDGA 1QVUA 2HOSA 4M3BA 5CVRA 2QIBA 3DP7A 3DU6A 3GLXA 3H36A 2B7EA 4Z2YA 4BXUA 3HOZJ 5K5QA 3VW0A 3MMYB 3MKWB 3RKWA 4NB5A 1LE8A 3GWZA 1W5CC 3OYGA 5F1JA 3BRUA 1QO0D 4ZYAA 5L3BA 1MGTA 4UHTA 1IW7F 1SD4A 3KP6A 3RSNA 2PMZA 2BXYA 5AIPA 5FKNA 2A5WA 5GAGJ 1KQ0A 1TNTA 3O8HA 2DJNA 3E5QA 1KONA 1G8XA 4AYBA 2K02A 1MDMB 4A3JJ 3E7QA 4FTHA 4HKUA 1AA7A 3Q3SA 5DS9A 1DP7P 1O7FA 3VWBA 3QAHA 5FB2A 3LSTA 4YIFA 4ACIA 1R22A 4II3A 5GTHC 1Z1DA 4QIWN 2E35A 2R5ZB 4IHYA 2RQQA 2V1XA 4BHBA 4B3XA 4PGGA 1QA6A 2DBBA 1IN6A 2D1VA 1IO2A 1XGOA 2BYVE 2GWRA 4CCOA 4ESFA 2Q0OA 4AUXA 2D6YA 3L7WA 3LMMA 4DZPA 1YG2A 5D5WB 3G73A 1LVAA 4YEJA 1ZRDA 1Y0NA 2LTPA 1JTXA 3W2WA 4A0YA 3KPHA 2XSDC 3GTLJ 3HOSA 3ASOH 4BJTA 1D8JA 3B6CA 2DMNA 5E1XA 1F1ZA 1ITYA 3CMAI 4JKZA 1Y56A 2M4KA 3MCZA 4E7HA 3CCJI 2UV1A 4PJLA 3KZYA 1I5ZA 2E60A 3E6CC 2XF6A 2EPFA 3JRIA 2YU3A 4AVZA 4QSHA 5D6FA 3V7RA 3BQZA 1JHFA 2G7SA 3HTJA 2W84A 1OCTC 3OIPA 2K3PA 1YE9A 5CJ9A 1TC3C 3S1MJ 5ED4A 5BMZA 3VYUB 1KA8A 5EG0B 3BJOA 2DQLA 2X1CA 3TW6A 5L3EA 2QOPA 1GV5A 3FXMA 4S04A 4EVIA 1U78A 1EV7A 2DA5A 1GT0C 2VBZA 4CHUA 2XF7A 2L01A 2BE5F 2PQ8A 2QGUA 1I50J 3FMRA 1WPKA 4M6XA 2AO9A 5BQTA 2IU5A 1R1UA 2BV6A 1DPRA 2JSPA 4L9NA 5BPIA 1Z9CA 2ZXHA 1OYIA 2JMWA 1IRZA 3GLLA 3H9JA 3ZR8X 3HXLA 2LY1A 4CUGA 4MO7A 3I71A 1FSEA 1F43A 4F91B 1MH3A 4Y52J 3IC7A 1DUXC 1BBYA 1CF7A 1Q1VA 3ESWB 3KLOA 3J81K 1D5VA 4IL6C 3SZTA 4BQQA 1YTYA 2B9SA 4CGRA 4EJVA 1ZGWA 5BS6A 4L5JA 4DYQA 3ELKA 2JA6J 2NX4A 2YX4A 3J81Z 5HLIA 4KYWA 4IJAA 2XDVA 2MBFA 4M3EA 1VF9A 4I0AA 2WV1A 3OL3A 4HSTA 2WAEA 1WJ5A 2RN7A 3GTOJ 2J5PA 4D5CA 4UUSB 2E19A 2R4GA 3QPLA 1SC7A 5HLGA 4A12A 3SEZA 1FMWA 4GCVA 3L9FA 4FHTA 1BIAA 4DNCA 2A6HF 2KZGA 1HF0A 5CLSA 4LK0F 2ESHA 1FYLA 5J3LA 1EH7A 2L9VA 2L2OA 2HPIA 3ABUA 1V5GA 2CJJA 3LFUA 3K7AJ 3E6MA 2D2WA 2VJIA 2VLAA 4XK4A 2VE9A 3CD6I 2Y0SA 4NELA 3R0AA 3TDZC 5ICCA 5E8GA 4CSWA 1WZ2A 5J6XA 2QWWA 1XMKA 2JWTA 4EJUA 2M7BA 1MNEA 1W36D 1MBHA 2L9SA 4O3MA 4GCKA 2A61A 5EEGA 1HOMA 1POGA 2L0KA 1X3ZB 3V8JA 1WRJA 4RAFA 1G3WA 2DXIA 3DXJF 3PJRA 3K2ZA 1X4OA 2VE8A 3M9AA 5KK1A 1NK3P 2A69F 2XPVA 3Q0VA 2NAZA 3BG5A 2X6WA 3RD3A 5LLQA 4D1QA 3FRQA 1G6NA 2WY7Q 1EA3A 3S16J 3BTJA 2A05A 2PMZN 3TEDA 3V4GA 3QQAA 1KYZA 2FEZA 2HYFA 2ZMEC 3KZ9A 2EB7A 1Z67A 3GFLA 2N8GA 4AYBN 5LEJA 2AXTC 1WFXA 4BE0A 1FLIA 4O5VA 1VTNC 3LA2A 4ESBA 3Q9SA 1YW7A 1IRXA 4NUBA 1BJAA 2OA4A 2X1EA 4BJ5C 4UVAA 3E1SA 5LEKA 1OPCA 1XC5A 2QWTA 1ONVA 2DQRA 1I3AA 3TL4X 3BCGA 3HE0A 1NG7A 4XICA 3DLLF 2RNGA 3S5RA 2EZLA 2ZCXA 5LGNA 3FBNB 3BG9A 2DOEA 4AC0A 3ZN0A 5DCMB 4DQ2A 2HQNA 2P5LC 3WU1B 5KAFC 4KWAA 2DMQA 2WADA 1W1WE 2RDPA 5BNGA 2R7UA 2EZIA 4P55A 1MKMA 3CJDA 1OCCH 1RRJA 4XRSG 1FJLA 1R6RA 1XD7A 3M1CA 2UZKA 2OAZA 2K85A 3ZMVA 3V7SA 2NVQJ 1FC3A 1D0XA 3ROUA 4HF0A 5JR3A 3VODA 1BM9A 1LUJB 1T33A 2WAFA 3OIOA 3OWTA 3QWLA 4WF2A 3U21A 4XOPA 4CO8A 2MH2A 4A3KJ 2V57A 2VT3A 1HCRA 3KP4A 2G9WA 4Q4ZF 3BG6A 3IUVA 2RQPA 4C3HJ 5GAHJ 3SZPA 1J0RA 2DDAA 3W3CA 2XPWA 3CUOA 3PASA 4BNCA 3CCQI 5CQGA 5E17F 4FCYA 4CCNA 5ICEA 3VFZA 2F4IA 1Y8QB 2K9NA 3FXJA 2CUZA 4KN4X 1A04A 1HSJA 4RLQA 2K27A 3SWHA 4BE1A 3SHFA 3I4MJ 1JJ6C 2PX9A 3BDDA 4R79A 3BROA 3NARA 2FBHA 1YFHA 1X1CA 3B6AA 4PSWA 2R7XA 4C9YA 5E3NA 4A2UA 1SD7A 3B02A 1YW8A 4ZC3A 1NHAA 2B0LA 5L3CA 2G7UA 2K9SA 3JCUC 3D5SC 3I3LA 4EM0B 3GEZA 1UCRA 2OUMA 2NS7A 2AHQA 4Y17A 1DDNA 2P6TA 3DLAA 2JRTA 3J7AY 3CCEI 4A3BJ 4C2TA 4ZTJA 3L1PA 1YS7A 2BVLA 4CCMA 1GDTA 1K6OA 2K3FA 5H6QA 2DFIA 4BQOA 2PJRB 1O4XA 3OYAA 3DPTA 2R5ZA 1ZYRF 5EYRA 2UXUA 2R7ZJ 2CSOA 1DPUA 2HKUA 2KP6A 1K7AA 1VQ9I 4WWCA 4KJZA 4JK1X 1O7LA 4QWQA 1LQ1A 3JTHA 3REOA 4MFEA 4ON0A 2Y0MA 3WTSC 1TLHB 5LHHA 3DWLE 2DA7A 1XSDA 2W1OA 3O2PE 4YFNF 1ZH5A 3E5XA 2OI8A 5CVUA 2Y0SN 3BR2A 3GMEA 4E7LA 3KKCA 4HX7A 1WI3A 4G6DA 2M3AA 4Z6YA 4XOTA 1G3TA 5GP9A 2XASA 4YIRX 3DCFA 3R6SA 1XMAA 3A2KA 4C2MA 1QBJA 4G6TB 4PJMA 2ZMEB 3RDIA 2I5UA 1PUFB 2ID6A 3QPHA 3QODA 2QF7A 4S05A 4A6EA 4BU2A 4PFPA 1P4WA 5KCMA 2IS4A 2BEOA 1W7PD 3OYKA 1ZHFA 2F07A 2DJIA 1FT9A 3IL2A 1P4XA 4IQ4A 1XTAA 2MGQA 2YSRA 3OYCA 2VPRA 2GOMA 3BT9A 4RDUA 2VQCA 4IHXA 1GV2A 2GXBA 3RQIA 3BG7A 1DGWY 2XAFA 1ZK8A 4RGSA 3W2VA 2FE3A 4AIJA 3P9KA 4Y7NJ 1BR2A 1D1CA 1TW2A 2LC2A 2DPDA 1GHCA 2QTQA 3VW2A 1OFCX 2M1BA 3Q5FA 1SFUA 3CCRI 3OOPA 2OQRA 2RC4A 1HC8A 3IKVA 2Z16A 2VODA 4CCKA 1MMSA 5F08A 4BACA 3DF8A 3F8FA 5HLTA 2G7LA 3CRJA 4MEYF 1E3PA 3S3NA 1OYWA 3HZJA 3MQ0A 4XL9A 1HKTA 2VKVA 5IP7J 1YOVB 4AIDA 2GXGA 1UJ8A 3WGHA 4C3IJ 4PZJA 1S8NA 1TBXA 4NQWA 1T0FA 2MSYA 4UUSA 1R7JA 3T8RA 3AG4H 2VONA 1SVOA 1KQ9A 1V55H 3CMYA 5BPDA 2EIKH 2GXAA 2B3WA 4CCLA 3LFKA 4L62A 3OYFA 4HDUA 3FX3A 4UUVA 3BJBA 1EH8A 3BWGA 2LREA 5IOYA 2HS5A 2KRCA 2IA0A 1ULYA 1J2XA 1Z3XA 2ELHA 2NS0A 3HUGB 2M5WA 4BY7J 4QPOA 2HFHA 1EJ9A 2A07F 1U9OA 1SMTA 2WC2A 3PFIA 2EK5A 4J00A 1REPC 2VOPA 1FSHA 1RESA 4KMUX 3VVYA 3RPUD 3FMQA 2F2EA 4I09A 4TV7A 3DQVC 4RB1A 3DU5A 4ZYEA 5EF6A 3S1NJ 2F4MB 3CC7I 3A4CA 1HSTA 4EV0A 2R7VA 3W2AA 2QYOA 2LLKA 2HXIA 1MJAA 3SDBA 1T2KA 3FXRA 3K4KA 4UUTA 3ZQLA 3OYJA 1B8IB 4IRVA 2P0WA 3OR2C 2ZNYA 3HDDA 1OCRH 2M8EA 1JT0A 4L18B 3PFYA 3VPRA 5IP9J 1HA8A 1LEAA 1U2WA 4GYGA 4Q48A 1WJDA 1IN8A 1J7KA 4XMYA 4XLFA 4ZZDA 4J01A 3RYPA 1G2HA 2E1MC 2E5NA 3WG7H 3K8PC 1FBQA 1I1GA 5EDNA 2GENA 2H8WA 3IRQA 2K5CA 3RJPA 2R5YB 2MA3A 1IF1A 1ZREA 4JX6A 2Y30A 4KFCA 3GO5A 3MN2A 1TWHJ 1QZYA 4BY1J 1WQ2A 5H9TA 2LKSA 2DTRA 5FGMA 3K4CA 5FO5A 5DM7F 3U1KA 4KUMA 1QPIA 4XKWA 3L2UA 4A3CJ 3FDYA 3KFWX 1OR7C 1HDDC 4LLLA 2M34A 1AKHB 3RKYA 4OMZA 4A3IJ 2CW0F 2QQ9A 1FP2A 4XLPF 2KT0A 4P9UA 4UB6C 4RM3A 4MNUA 2V9KA 5D5XB 4U0YA 4HF2A 4FQGA 2L4MA 3S2DJ 4CICA 2GAUA 2EV0A 1ZARA 3HOWJ 1IC8A 3BY6A 1UMQA 1KU3A 3MWMA 3K4MA 5GADJ 3BLYA 5DM6F 2XC7A 5EJCA 3VOKA 2FBIA 1N25A 1KGSA 4DYCA 2MFZA 5FGLA 3GTJJ 3SFIA 4EGYA 4DJAA 1X1PA 5JLWA 2DO7A 4B47A 1BIBA 1FBUA 5E3MA 2JA7J 1V3FA 4NC7A 2JSCA 1FZPB 3S3MA 1TNSA 1M1EB 1NG6A 1RR8C 4H4KC 4LITA 5F0HA 2EFQA 1A5JA 1JUSA 2XAHA 5F1RA 2HXOA 2UXXA 3QKXA 2OTJI 2BHYA 3OYEA 1I27A 4IRIA 5AONA 2DT6A 1QPMA 3HTSB 1X4PA 2DI3A 3PSIA 5TRDA 4EJTA 3D5LA 2P4WA 4EM2A 1KYWA 2CMPA 4UVCA 3H5AA 3KZIC 2OTLI 2NNNA 3OL4A 4ME9A 3G1OA 3TMOA 4ESJA 1ZG5A 2V1NA 1ZELA 3KEQA 2FNPA 4JYKA 2VN2A 2OJED 3COAC 1D3YA 5JFRA 1X2NA 2ZXWH 3NXCA 3BG3A 2DFFA 3GCMA 3GTQJ 1SEUA 2PJRA 2XF5A 5HS9A 1B4AA 5F0FA 1WJAA 1T95A 1UZCA 1XSXA 1U5TA 3PNVA 1T6SA 3ANPA 1YQAA 2EIMH 2FOKA 4RBOA 2YVXA 2XAQA 2WAQA 1YJ9I 1VQKI 4PJNA 1PJRA 5FHPA 3QYFA 4HX4A 3VSLA 4ABZA 2KJBA
chains in the Genus database with same CATH topology
3HOVJ 2QCOA 3TP3A 2PBXA 4LOCA 1MNMC 3GTPJ 5IYBJ 3W6VA 3ON2A 4M3EA 1VF9A 1Z77A 2WV1A 4J19A 3GTOJ 4D5CA 4UUSB 2JA5J 2E19A 3QPLA 4MK6A 4A3DJ 1T56A 3ZQHA 1IDYA 3COLA 2DA2A 2UXPA 1ORKA 3JR9A 1HF0A 5C4XJ 5D19A 2R93J 3CWRA 5J3LA 3HOXJ 2YVEA 3QBMA 4BBRJ 2CJJA 2FD5A 1X58A 3K7AJ 4XK4A 3ZQCA 3BQYA 3LHQA 2FJ1A 2X6OA 4DZJA 3HTHA 2GLOA 2XPUA 4NELA 2E2IJ 1I3QJ 1RPWA 3F1BA 3UKGA 3V6GA 3S15J 2OF7A 1JJ8C 1JGGA 4XRSA 2HOTA 1UI5A 2JWTA 1GUUA 5CXGA 2JA6J 1MBHA 1RETA 3RZDJ 4GCKA 1HOMA 1POGA 2L0KA 1R9TJ 3VVZA 3OOUA 1B72B 3TW7A 1ETOA 2DA6A 3WHBA 3H3VK 4EEFG 1NK3P 2XPVA 3Q0VA 1MSFC 3ZOBA 3BG5A 5HSZA 1XS9A 3RD3A 3FRQA 2L7MP 5F27A 2E2JJ 3S16J 4AC6A 3BTJA 2UXHA 2PMZN 3TEDA 1WH7A 3QQAA 4C2MJ 2E2HJ 3A01B 2G0EA 3KZ9A 2HI3A 4I6ZA 2N8GA 4A3LJ 3DPJA 4MIMA 1VFCA 4AYBN 3F0CA 3G1MA 1FTTA 3LSRA 3VW1A 2DTZA 2NP5A 3VOXA 3JRFA 2UXOA 3TP0A 1XC5A 5IP6A 2REKA 2QWTA 4FE7A 1MBGA 3SDGA 2R92J 2HYTA 2ZOZA 3BCGA 3HE0A 4XICA 3S5RA 4XRMA 1ZKGA 2EZLA 2ZCXA 4JP0A 2LFBA 2CU7A 3BG9A 3NAUA 4AC0A 1BW5A 3FKIJ 3CDLA 3ZQIA 4G12A 2K40A 1JKOC 5E3OA 4KWAA 2DMQA 1BJZA 4FE4A 2H8RA 3HTAA 5FKKA 2NS8A 5BNGA 4GFLA 2EZIA 1FIAA 3M4OJ 3CJDA 4XRSG 2P81A 1FJLA 3CCYA 1IUFA 1K83J 1MBEA 1U9NA 2NVYJ 2KDZA 2WGBA 2NVQJ 4A69C 1SGMA 5M5WJ 3JREA 1T33A 3OIOA 1ETVA 1ENHA 2EQRA 2HQ5A 4A3KJ 1DU6A 1W0TA 2VUMJ 2V57A 1D5YA 1IJWC 3IH4A 5C3EJ 1HCRA 3EUPA 3HBLA 3D1NI 3IUVA 4D7NA 3BTLA 4C3HJ 3G7RA 5F04A 1RR7A 2X9DA 1JKRC 1FTZA 3V78A 1OCPA 2XPWA 2TCTA 3GTMJ 3PASA 3PO2J 4A3FJ 4FCYA 4UDSA 5FKOA 3P9TA 2IAIA 1ETWA 2ZCMA 1TWFJ 3PO3J 3GEUA 2K9NA 2D5VA 3ON4A 2VKEA 1MBFA 5FMPA 4IHVA 1JJ6C 3A03A 3I4MJ 3NARA 4CYCB 4B3AA 1HDPA 2FX0A 4X1EA 2Y9ZA 2JA8J 3LNQA 3NRGA 3B6AA 3M3YJ 5E3NA 4GCLA 4BKXA 3NNRA 3O60A 4A3MJ 2CUEA 5EZGA 1OJLA 3IH3A 2K9SA 3BR5A 5K58A 3BTCA 2M9HA 3I4NJ 4NDLA 2DN0A 1UI6A 3JRHA 5EGOA 2NS7A 3Q0WA 2WAQN 3C2BA 3FIWA 2AHQA 3PM1A 1PUFA 1ZTRA 3SJMA 3G1LA 5HAWA 4A3BJ 5FLMJ 3L1PA 2MG4A 3MVPA 5CW8A 3BR0A 1GDTA 5IYCJ 1IG7A 1UG2A 4MFDA 1E3OC 3HGYA 2OERA 1O4XA 3VUQA 2R5ZA 2WB1N 5EYRA 5EFYA 1TWCJ 4D7MA 3G56A 2UXUA 5HBUA 2FQ4A 2R7ZJ 2DA4A 2COBA 2HKUA 1GVDA 3GBGA 2YS9A 4D5FA 5IYDJ 2ELKA 3B81A 2LP0A 5D18A 1A6IA 4C3JJ 3IV5A 4MFEA 2W48A 1UHSA 3KKDA 3MNLA 3T6NA 1W0UA 2XB0X 2DA7A 3A02A 2ZOYA 1FEXA 2OI8A 1RKWA 4B4CA 5IPAA 2ME0A 2Y0SN 2L9RA 2XDNA 3BR2A 3KKCA 1U8BA 2IBDA 1WI3A 2HOAA 3BTIA 2ECBA 4B1RA 3BHQA 1DU0A 2GFNA 3RZOJ 5GP9A 4A3EJ 5DAJA 2DG8A 3DCFA 1ETXA 4IHWA 4GFBA 2E1OA 2M8GX 5EGOB 2WUIA 5GPAA 9ANTA 4M3DA 1PUFB 2ID6A 2M2EA 2QF7A 4V2FA 2YUSA 2ME6A 4IEJA 4HNVA 2L7ZA 4W97A 1VI0A 2XGEA 4W1UA 2LKXA 2H1KA 4BXXJ 3HIMA 3HM5A 1H88C 2F07A 2OPTA 1JT6A 4A93J 2MGQA 2K9QA 1MSEC 2HDDA 4V2GA 2GM4A 2VPRA 5M3FJ 3BT9A 4QTRA 4RDUA 1H89C 3JRAA 2R0QC 1QVTA 4IHXA 3AQTA 1GV2A 4DW6A 3RKQA 3RQIA 2G7GA 3WHCA 1ZK8A 1Y1VJ 3ANGA 4JL3A 1ETQA 2Y31A 2O7OA 4Y7NJ 3VW2A 1BL0A 1X2MA 3HOYJ 2DA3A 2QTQA 5CXIA 5D1RA 1LFUP 1OFCX 2GUHA 3JRBA 2YVHA 1F36A 3CQZJ 3LOCA 2NP3A 2M0CA 1YRNA 2DMUA 2DMPA 2RHAA 2ZCNA 5F08A 3AQSA 1SANA 2ID3A 3FK6A 5FJ8J 4PXIA 2G7LA 3CRJA 4NN1A 1P7IA 1FIPA 4ICHA 2G3BA 2VKVA 5IP7J 1H8AC 3OSFA 3HOUJ 4A3GJ 4C3IJ 2O9LA 2YU9J 1B8IA 1WCMJ 2W53A 2HYJA 5C4JJ 2CQXA 2XRLA 5J1RA 2MSYA 4UUSA 1IGNA 3CMYA 1VNDA 5JLXA 2JJ7A 1I6HJ 2XGDA 2CRGA 4AF5A 4L62A 1RKTA 1LFBA 3LWJA 4M6VA 2ZB9A 3BJBA 5AQCA 3LJLA 2LK2A 3HKZN 3ZQGA 1BA5A 3EGQA 5IOYA 3HGGA 4DYRA 4JNNA 2R5YA 3BR3A 3VIBA 2Y9YA 2LY9A 5J1YA 2MW8A 3JRDA 4BY7J 3S1RJ 4BBSJ 1ETYA 3NI7A 1U9OA 4GCTA 1YRNB 1RESA 3MKLA 4JX4A 3VVYA 2PZ9A 1IV6A 2Q24A 2EZHA 3GZIA 2FBQA 2JK3A 5EF6A 5HODA 1Y1WJ 3S1NJ 3DEWA 5M3MJ 3O8GA 1JTYA 5F0CA 4L5EA 1MBJA 1JUMA 2X48A 3S14J 2LLKA 2HXIA 1AKHA 1ETKA 3C07A 5K7FA 3JRCA 3ZQLA 4UUTA 1B8IB 3FISA 1IDZA 2DMTA 3HDDA 1JT0A 1TWGJ 3VPRA 5IP9J 3E7LA 3A01A 2NOGA 2NX4A 2NVTJ 1P7JA 3JSJA 1QVUA 1G2HA 2RASA 2GBYA 1AHDP 5EEAA 2HOSA 4M3BA 2QIBA 1ZR2A 5EDNA 1MH4A 3HOZJ 3BR1A 1JKPC 2GENA 3VW0A 2VI6A 1MBKA 1QRYA 2IEKA 5J1UA 5M5XJ 3RH2A 4GFKA 2R5YB 1LE8A 5C44J 5IOZA 4JX6A 5F1JA 3BRUA 2Y30A 3MN2A 1TWHJ 4M3FA 4BY1J 2L7FP 5FKNA 5H9TA 2I10A 1Z0XA 1SFOJ 5E3LA 3O8HA 2DJNA 3BR6A 1QPIA 3GTGJ 4A3JJ 4MXMA 3E7QA 4FTHA 4HKUA 4A3CJ 3Q3SA 5DS9A 2XB5A 1HDDC 4ACIA 2M34A 1AKHB 3LSGA 2XGCA 1JKQC 2EH3A 4QIWN 1AU7A 3BNIA 4X6AJ 4A3IJ 3LSJA 5EG0A 2R5ZB 4IHYA 2DA1A 2KT0A 2ECCA 1K61A 3GTKJ 3S2DJ 4AUXA 2O7TA 2LD5A 2D6YA 4DZPA 1XG1A 3HOWJ 5FKMA 1WH5A 1IC8A 3S17J 4XIDA 1UMQA 2NVXJ 3OSGA 2DG7A 2CUFA 2LTPA 4FISA 1JTXA 1S7EA 1NK2P 2XSDC 3GTLJ 4MLOA 3JRGA 3VOKA 4DYCA 1EF4A 3B6CA 2DMNA 3GTJJ 1LE8B 5FGLA 3SFIA 1ZQ3P 1ITYA 4JKZA 5JLWA 3LSPA 1WGXA 2Y2ZA 5E3MA 2JA7J 5M5YJ 2CQQA 1NTCA 5F0HA 3HB9A 1A5JA 1JUSA 3S2HJ 3QKXA 2HXOA 4CYCA 3JRIA 3HEFA 5EZHA 4QSHA 3VVXA 2B63J 3BQZA 2G7SA 2EBIA 3HTJA 3NPIA 1OCTC 4JX5A 5C4YA 3S1MJ 1TC3C 3FK7A 2UXIA 3KNWA 5EG0B 2EZKA 1HLVA 3HTIA 3TW6A 2QOPA 3IH2A 1GV5A 3ZQFA 4ME9A 2TRTA 1BW6A 3G1OA 1U78A 2QKOA 2DA5A 1GT0C 2LVSA 3S1QJ 4JYKA 1TWAJ 5GPCA 3Q0UA 4I76A 1I50J 1X2NA 5FLVA 1WPKA 4M3GA 2AO9A 3NXCA 2JN6A 3BG3A 2IU5A 4YZEA 3GTQJ 3QPSA 2JMWA 1IRZA 2RAEA 3K2AA 1CQTA 5F0FA 3VP5A 5K7ZA 4MO7A 2O8KA 3H0GJ 1F43A 4S0HB 1MH3A 3PPBA 3ANPA 1Q1VA 1ZR4A 4RBOA 4CGRA 5FKLA 1ZGWA 2LR8A 1APLC 5K7HA 4DYQA 5FHPA 4ABZA 4Y52J 1B72A 1JUPA 5DTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOV J;  2QCO A;  3TP3 A;  2PBX A;  4LOC A;  1MNM C;  3GTP J;  5IYB J;  3W6V A;  3ON2 A;  4M3E A;  1VF9 A;  1Z77 A;  2WV1 A;  4J19 A;  3GTO J;  4D5C A;  4UUS B;  2JA5 J;  2E19 A;  3QPL A;  4MK6 A;  4A3D J;  1T56 A;  3ZQH A;  1IDY A;  3COL A;  2DA2 A;  2UXP A;  1ORK A;  3JR9 A;  1HF0 A;  5C4X J;  5D19 A;  2R93 J;  3CWR A;  5J3L A;  3HOX J;  2YVE A;  3QBM A;  4BBR J;  2CJJ A;  2FD5 A;  1X58 A;  3K7A J;  4XK4 A;  3ZQC A;  3BQY A;  3LHQ A;  2FJ1 A;  2X6O A;  4DZJ A;  3HTH A;  2GLO A;  2XPU A;  4NEL A;  2E2I J;  1I3Q J;  1RPW A;  3F1B A;  3UKG A;  3V6G A;  3S15 J;  2OF7 A;  1JJ8 C;  1JGG A;  4XRS A;  2HOT A;  1UI5 A;  2JWT A;  1GUU A;  5CXG A;  2JA6 J;  1MBH A;  1RET A;  3RZD J;  4GCK A;  1HOM A;  1POG A;  2L0K A;  1R9T J;  3VVZ A;  3OOU A;  1B72 B;  3TW7 A;  1ETO A;  2DA6 A;  3WHB A;  3H3V K;  4EEF G;  1NK3 P;  2XPV A;  3Q0V A;  1MSF C;  3ZOB A;  3BG5 A;  5HSZ A;  1XS9 A;  3RD3 A;  3FRQ A;  2L7M P;  5F27 A;  2E2J J;  3S16 J;  4AC6 A;  3BTJ A;  2UXH A;  2PMZ N;  3TED A;  1WH7 A;  3QQA A;  4C2M J;  2E2H J;  3A01 B;  2G0E A;  3KZ9 A;  2HI3 A;  4I6Z A;  2N8G A;  4A3L J;  3DPJ A;  4MIM A;  1VFC A;  4AYB N;  3F0C A;  3G1M A;  1FTT A;  3LSR A;  3VW1 A;  2DTZ A;  2NP5 A;  3VOX A;  3JRF A;  2UXO A;  3TP0 A;  1XC5 A;  5IP6 A;  2REK A;  2QWT A;  4FE7 A;  1MBG A;  3SDG A;  2R92 J;  2HYT A;  2ZOZ A;  3BCG A;  3HE0 A;  4XIC A;  3S5R A;  4XRM A;  1ZKG A;  2EZL A;  2ZCX A;  4JP0 A;  2LFB A;  2CU7 A;  3BG9 A;  3NAU A;  4AC0 A;  1BW5 A;  3FKI J;  3CDL A;  3ZQI A;  4G12 A;  2K40 A;  1JKO C;  5E3O A;  4KWA A;  2DMQ A;  1BJZ A;  4FE4 A;  2H8R A;  3HTA A;  5FKK A;  2NS8 A;  5BNG A;  4GFL A;  2EZI A;  1FIA A;  3M4O J;  3CJD A;  4XRS G;  2P81 A;  1FJL A;  3CCY A;  1IUF A;  1K83 J;  1MBE A;  1U9N A;  2NVY J;  2KDZ A;  2WGB A;  2NVQ J;  4A69 C;  1SGM A;  5M5W J;  3JRE A;  1T33 A;  3OIO A;  1ETV A;  1ENH A;  2EQR A;  2HQ5 A;  4A3K J;  1DU6 A;  1W0T A;  2VUM J;  2V57 A;  1D5Y A;  1IJW C;  3IH4 A;  5C3E J;  1HCR A;  3EUP A;  3HBL A;  3D1N I;  3IUV A;  4D7N A;  3BTL A;  4C3H J;  3G7R A;  5F04 A;  1RR7 A;  2X9D A;  1JKR C;  1FTZ A;  3V78 A;  1OCP A;  2XPW A;  2TCT A;  3GTM J;  3PAS A;  3PO2 J;  4A3F J;  4FCY A;  4UDS A;  5FKO A;  3P9T A;  2IAI A;  1ETW A;  2ZCM A;  1TWF J;  3PO3 J;  3GEU A;  2K9N A;  2D5V A;  3ON4 A;  2VKE A;  1MBF A;  5FMP A;  4IHV A;  1JJ6 C;  3A03 A;  3I4M J;  3NAR A;  4CYC B;  4B3A A;  1HDP A;  2FX0 A;  4X1E A;  2Y9Z A;  2JA8 J;  3LNQ A;  3NRG A;  3B6A A;  3M3Y J;  5E3N A;  4GCL A;  4BKX A;  3NNR A;  3O60 A;  4A3M J;  2CUE A;  5EZG A;  1OJL A;  3IH3 A;  2K9S A;  3BR5 A;  5K58 A;  3BTC A;  2M9H A;  3I4N J;  4NDL A;  2DN0 A;  1UI6 A;  3JRH A;  5EGO A;  2NS7 A;  3Q0W A;  2WAQ N;  3C2B A;  3FIW A;  2AHQ A;  3PM1 A;  1PUF A;  1ZTR A;  3SJM A;  3G1L A;  5HAW A;  4A3B J;  5FLM J;  3L1P A;  2MG4 A;  3MVP A;  5CW8 A;  3BR0 A;  1GDT A;  5IYC J;  1IG7 A;  1UG2 A;  4MFD A;  1E3O C;  3HGY A;  2OER A;  1O4X A;  3VUQ A;  2R5Z A;  2WB1 N;  5EYR A;  5EFY A;  1TWC J;  4D7M A;  3G56 A;  2UXU A;  5HBU A;  2FQ4 A;  2R7Z J;  2DA4 A;  2COB A;  2HKU A;  1GVD A;  3GBG A;  2YS9 A;  4D5F A;  5IYD J;  2ELK A;  3B81 A;  2LP0 A;  5D18 A;  1A6I A;  4C3J J;  3IV5 A;  4MFE A;  2W48 A;  1UHS A;  3KKD A;  3MNL A;  3T6N A;  1W0U A;  2XB0 X;  2DA7 A;  3A02 A;  2ZOY A;  1FEX A;  2OI8 A;  1RKW A;  4B4C A;  5IPA A;  2ME0 A;  2Y0S N;  2L9R A;  2XDN A;  3BR2 A;  3KKC A;  1U8B A;  2IBD A;  1WI3 A;  2HOA A;  3BTI A;  2ECB A;  4B1R A;  3BHQ A;  1DU0 A;  2GFN A;  3RZO J;  5GP9 A;  4A3E J;  5DAJ A;  2DG8 A;  3DCF A;  1ETX A;  4IHW A;  4GFB A;  2E1O A;  2M8G X;  5EGO B;  2WUI A;  5GPA A;  9ANT A;  4M3D A;  1PUF B;  2ID6 A;  2M2E A;  2QF7 A;  4V2F A;  2YUS A;  2ME6 A;  4IEJ A;  4HNV A;  2L7Z A;  4W97 A;  1VI0 A;  2XGE A;  4W1U A;  2LKX A;  2H1K A;  4BXX J;  3HIM A;  3HM5 A;  1H88 C;  2F07 A;  2OPT A;  1JT6 A;  4A93 J;  2MGQ A;  2K9Q A;  1MSE C;  2HDD A;  4V2G A;  2GM4 A;  2VPR A;  5M3F J;  3BT9 A;  4QTR A;  4RDU A;  1H89 C;  3JRA A;  2R0Q C;  1QVT A;  4IHX A;  3AQT A;  1GV2 A;  4DW6 A;  3RKQ A;  3RQI A;  2G7G A;  3WHC A;  1ZK8 A;  1Y1V J;  3ANG A;  4JL3 A;  1ETQ A;  2Y31 A;  2O7O A;  4Y7N J;  3VW2 A;  1BL0 A;  1X2M A;  3HOY J;  2DA3 A;  2QTQ A;  5CXI A;  5D1R A;  1LFU P;  1OFC X;  2GUH A;  3JRB A;  2YVH A;  1F36 A;  3CQZ J;  3LOC A;  2NP3 A;  2M0C A;  1YRN A;  2DMU A;  2DMP A;  2RHA A;  2ZCN A;  5F08 A;  3AQS A;  1SAN A;  2ID3 A;  3FK6 A;  5FJ8 J;  4PXI A;  2G7L A;  3CRJ A;  4NN1 A;  1P7I A;  1FIP A;  4ICH A;  2G3B A;  2VKV A;  5IP7 J;  1H8A C;  3OSF A;  3HOU J;  4A3G J;  4C3I J;  2O9L A;  2YU9 J;  1B8I A;  1WCM J;  2W53 A;  2HYJ A;  5C4J J;  2CQX A;  2XRL A;  5J1R A;  2MSY A;  4UUS A;  1IGN A;  3CMY A;  1VND A;  5JLX A;  2JJ7 A;  1I6H J;  2XGD A;  2CRG A;  4AF5 A;  4L62 A;  1RKT A;  1LFB A;  3LWJ A;  4M6V A;  2ZB9 A;  3BJB A;  5AQC A;  3LJL A;  2LK2 A;  3HKZ N;  3ZQG A;  1BA5 A;  3EGQ A;  5IOY A;  3HGG A;  4DYR A;  4JNN A;  2R5Y A;  3BR3 A;  3VIB A;  2Y9Y A;  2LY9 A;  5J1Y A;  2MW8 A;  3JRD A;  4BY7 J;  3S1R J;  4BBS J;  1ETY A;  3NI7 A;  1U9O A;  4GCT A;  1YRN B;  1RES A;  3MKL A;  4JX4 A;  3VVY A;  2PZ9 A;  1IV6 A;  2Q24 A;  2EZH A;  3GZI A;  2FBQ A;  2JK3 A;  5EF6 A;  5HOD A;  1Y1W J;  3S1N J;  3DEW A;  5M3M J;  3O8G A;  1JTY A;  5F0C A;  4L5E A;  1MBJ A;  1JUM A;  2X48 A;  3S14 J;  2LLK A;  2HXI A;  1AKH A;  1ETK A;  3C07 A;  5K7F A;  3JRC A;  3ZQL A;  4UUT A;  1B8I B;  3FIS A;  1IDZ A;  2DMT A;  3HDD A;  1JT0 A;  1TWG J;  3VPR A;  5IP9 J;  3E7L A;  3A01 A;  2NOG A;  2NX4 A;  2NVT J;  1P7J A;  3JSJ A;  1QVU A;  1G2H A;  2RAS A;  2GBY A;  1AHD P;  5EEA A;  2HOS A;  4M3B A;  2QIB A;  1ZR2 A;  5EDN A;  1MH4 A;  3HOZ J;  3BR1 A;  1JKP C;  2GEN A;  3VW0 A;  2VI6 A;  1MBK A;  1QRY A;  2IEK A;  5J1U A;  5M5X J;  3RH2 A;  4GFK A;  2R5Y B;  1LE8 A;  5C44 J;  5IOZ A;  4JX6 A;  5F1J A;  3BRU A;  2Y30 A;  3MN2 A;  1TWH J;  4M3F A;  4BY1 J;  2L7F P;  5FKN A;  5H9T A;  2I10 A;  1Z0X A;  1SFO J;  5E3L A;  3O8H A;  2DJN A;  3BR6 A;  1QPI A;  3GTG J;  4A3J J;  4MXM A;  3E7Q A;  4FTH A;  4HKU A;  4A3C J;  3Q3S A;  5DS9 A;  2XB5 A;  1HDD C;  4ACI A;  2M34 A;  1AKH B;  3LSG A;  2XGC A;  1JKQ C;  2EH3 A;  4QIW N;  1AU7 A;  3BNI A;  4X6A J;  4A3I J;  3LSJ A;  5EG0 A;  2R5Z B;  4IHY A;  2DA1 A;  2KT0 A;  2ECC A;  1K61 A;  3GTK J;  3S2D J;  4AUX A;  2O7T A;  2LD5 A;  2D6Y A;  4DZP A;  1XG1 A;  3HOW J;  5FKM A;  1WH5 A;  1IC8 A;  3S17 J;  4XID A;  1UMQ A;  2NVX J;  3OSG A;  2DG7 A;  2CUF A;  2LTP A;  4FIS A;  1JTX A;  1S7E A;  1NK2 P;  2XSD C;  3GTL J;  4MLO A;  3JRG A;  3VOK A;  4DYC A;  1EF4 A;  3B6C A;  2DMN A;  3GTJ J;  1LE8 B;  5FGL A;  3SFI A;  1ZQ3 P;  1ITY A;  4JKZ A;  5JLW A;  3LSP A;  1WGX A;  2Y2Z A;  5E3M A;  2JA7 J;  5M5Y J;  2CQQ A;  1NTC A;  5F0H A;  3HB9 A;  1A5J A;  1JUS A;  3S2H J;  3QKX A;  2HXO A;  4CYC A;  3JRI A;  3HEF A;  5EZH A;  4QSH A;  3VVX A;  2B63 J;  3BQZ A;  2G7S A;  2EBI A;  3HTJ A;  3NPI A;  1OCT C;  4JX5 A;  5C4Y A;  3S1M J;  1TC3 C;  3FK7 A;  2UXI A;  3KNW A;  5EG0 B;  2EZK A;  1HLV A;  3HTI A;  3TW6 A;  2QOP A;  3IH2 A;  1GV5 A;  3ZQF A;  4ME9 A;  2TRT A;  1BW6 A;  3G1O A;  1U78 A;  2QKO A;  2DA5 A;  1GT0 C;  2LVS A;  3S1Q J;  4JYK A;  1TWA J;  5GPC A;  3Q0U A;  4I76 A;  1I50 J;  1X2N A;  5FLV A;  1WPK A;  4M3G A;  2AO9 A;  3NXC A;  2JN6 A;  3BG3 A;  2IU5 A;  4YZE A;  3GTQ J;  3QPS A;  2JMW A;  1IRZ A;  2RAE A;  3K2A A;  1CQT A;  5F0F A;  3VP5 A;  5K7Z A;  4MO7 A;  2O8K A;  3H0G J;  1F43 A;  4S0H B;  1MH3 A;  3PPB A;  3ANP A;  1Q1V A;  1ZR4 A;  4RBO A;  4CGR A;  5FKL A;  1ZGW A;  2LR8 A;  1APL C;  5K7H A;  4DYQ A;  5FHP A;  4ABZ A;  4Y52 J;  1B72 A;  1JUP A;  5DTD A; 
#chains in the Genus database with same CATH topology
 3ZMD A;  3H0D A;  3TP3 A;  1T8I A;  3QU3 A;  3GTP J;  3ABK H;  2QSG X;  3M8F A;  1R49 A;  5IYB J;  4NC6 A;  3C2H A;  2AS5 F;  2EFP A;  3QU6 A;  2X51 A;  3VYR B;  1T56 A;  2ZCW A;  3DKW A;  5DYM A;  2ZKZ A;  3COL A;  1D1B A;  1DQU A;  5A2Q Z;  4BHP A;  1ORK A;  3NRV A;  1O3R A;  3R60 A;  5C4X J;  2XRN A;  5D19 A;  3IRR A;  2JQ7 A;  2R93 J;  1MND A;  1R00 A;  3HOX J;  1X1A A;  2YVE A;  4G7H F;  4F7Z A;  2EWN A;  2E1M B;  2F6C A;  2Q2E B;  3TO9 A;  3BQY A;  3ZQC A;  3LHQ A;  4B43 A;  2GLO A;  3WE3 A;  2EV5 A;  2E2I J;  1QHH D;  5D6E A;  4E7J A;  3C18 A;  1YLF A;  1Z6T A;  1OYY A;  4XRS A;  2ZXI A;  3OYN A;  4Q5S F;  3R61 A;  3CF5 F;  3P9C A;  3K0L A;  4Q47 A;  1RET A;  3E5U A;  5B1B H;  2HWV A;  4KMF A;  1R9T J;  3VVZ A;  2JA2 A;  1G3Y A;  1BC8 C;  1B72 B;  1YS6 A;  2LSO A;  5HDK A;  2PEX A;  1ETO A;  4XKB A;  3WHB A;  5E20 A;  3VDX A;  4EEF G;  1PVE A;  1MSF C;  1OIS A;  5HSZ A;  2VQH A;  1W7P B;  2L7M P;  2ZJ2 A;  5AIQ A;  2E2J J;  2X6X A;  4AC6 A;  2PLY A;  4M9S A;  1S29 A;  2G0E A;  3K4N A;  2HI3 A;  4M9X A;  3DPJ A;  4FX0 A;  4MIM A;  1VFC A;  3F0C A;  1FTT A;  1ZLJ A;  3J80 K;  3LSR A;  3HYI A;  3DBH B;  2IS6 A;  1S7A A;  2Z9O A;  2MH9 A;  1A31 A;  4KIG A;  4AD9 A;  3VW1 A;  2NP5 A;  3J80 Z;  4C30 A;  3VOX A;  1E0E A;  4CCJ A;  2MLK A;  5IP6 A;  4I01 A;  3CCS I;  1YIJ I;  4IZZ A;  4FE7 A;  3SDG A;  3HRM A;  3WTZ A;  2XRO A;  1VQ8 I;  4HF1 A;  1GLN A;  3ZMS A;  1KQ8 A;  1HKQ A;  3AAF A;  1YYV A;  3FXU A;  3DKX A;  2JT1 A;  2DT7 B;  3FKI J;  4NHJ A;  2LH9 A;  3CDL A;  2ACJ A;  4HOB A;  4RB3 C;  5E3O A;  2VXD A;  4PGH A;  4D0P A;  2LDU A;  3SZG A;  2FSW A;  4WCG A;  2H8R A;  3NEU A;  5FKK A;  1B59 A;  4RAY A;  2K4J A;  4GFL A;  3M4O J;  1VQP I;  2K9L A;  4II2 A;  2CG4 A;  4HZF A;  3WGG A;  1A36 A;  1JE8 A;  2B1E A;  3CCY A;  1Z05 A;  3DEE A;  3TO7 A;  2FF4 A;  4A69 C;  3ERM A;  5M5W J;  2O5R A;  2A5Y B;  3KZZ A;  4AM3 A;  2L4A A;  4CH7 A;  1ENH A;  3ZMT A;  3LSH A;  4HNT A;  2CV0 A;  4EJW A;  4IO9 F;  1D5Y A;  2WV0 A;  2LNB A;  3HPG A;  3HBL A;  4CDG A;  1N77 A;  1UFM A;  1W5S A;  4D7N A;  2LKP A;  4GRI A;  1RR7 A;  1XSV A;  1FTZ A;  2QUF A;  2LBF B;  1IN7 A;  5CVI A;  4HSR A;  3OY9 A;  3TOB A;  2R7O A;  2KHM A;  4A3F J;  4UDS A;  3K4B A;  1ETW A;  2D45 A;  4JQF A;  3GEU A;  3ON4 A;  3FHN A;  2XKO A;  1VQ7 I;  4XKV A;  4PK4 A;  1MBF A;  4IHV A;  3A03 A;  5HDN A;  4B3A A;  5KNL A;  2FX0 A;  2A68 F;  1TQI A;  2Y9Z A;  2Q8K A;  2JA8 J;  2IA1 A;  3KEY A;  2HQA A;  4DIQ A;  1K78 B;  2G7H A;  2QBY B;  4GCL A;  3K9T A;  4BKX A;  5GTI C;  3NNR A;  2ZFW A;  2DAO A;  1SFX A;  2P7V B;  1U0J A;  1R4N B;  2M9H A;  3T1B A;  4YRV A;  3QRF F;  1KU2 A;  1WJB A;  4NDL A;  1XGN A;  5EGO A;  1UI6 A;  3CDH A;  2WAQ N;  3EUH C;  3FIW A;  5ERI A;  5H20 A;  2W7N A;  4OIQ F;  4XSZ F;  2IGM A;  3RCO A;  1O3Q A;  2MC3 A;  3JTG A;  1STZ A;  4UV8 A;  5HVQ C;  4MEX F;  1IG7 A;  2P7C B;  4ZTF A;  1E3O C;  3AL0 C;  1R4M B;  4MTD A;  4CA0 A;  2YR2 A;  2ELJ A;  5EFY A;  1TWC J;  1VQ6 I;  1MJ9 A;  1WSU A;  4ENN A;  2FQ4 A;  2DA4 A;  4M71 A;  1GVD A;  1O3S A;  3CCV I;  5IYD J;  2ELK A;  2CW7 A;  3B81 A;  4RGX A;  2ADU A;  1K4T A;  1A6I A;  4C3J J;  2ZJP F;  2W48 A;  2A2F X;  1UHS A;  2PBI A;  4LG3 A;  2E71 A;  1W0U A;  1HW2 A;  3A02 A;  2DT5 A;  4Y15 A;  2ZOY A;  2WY8 Q;  2ME0 A;  2AXL A;  4FET A;  1U8B A;  1V4R A;  1XDS A;  2HOA A;  2IBD A;  2ECB A;  4B1R A;  3LSM A;  5DD4 A;  5D5V B;  1E2X A;  5J4Y A;  2PFV A;  3BHQ A;  1DU0 A;  2V79 A;  2H27 A;  2IPQ X;  1ETX A;  2Z5U A;  2KIF A;  4IHW A;  3WG9 A;  2WUI A;  2M8G X;  2R7W A;  4ZDP A;  9ANT A;  3WOD F;  4JOM A;  2M2E A;  1IAW A;  1S3J A;  3K4L A;  2C6Y A;  1WJE A;  2Y69 H;  2ME6 A;  4OU0 A;  2F5E A;  4G6Q A;  4IEJ A;  2L7Z A;  4W97 A;  1UB9 A;  3HRT A;  1VI0 A;  2DW4 A;  2H09 A;  2XGE A;  2H1K A;  3I58 A;  1G3S A;  3ABL H;  1H88 C;  2FNA A;  1LNW A;  5JHU A;  2L3D A;  1VQM I;  4A93 J;  1MSE C;  4P9F A;  4V2G A;  2GM4 A;  4QTR A;  4RB2 C;  1Z3Y A;  3JRA A;  4CYD A;  1LVK A;  3RKQ A;  3ISP A;  3WHC A;  1S9H A;  4B09 A;  3IWZ A;  3J7Z I;  2KPM A;  4JL3 A;  2Z3Y A;  1ETQ A;  2O7O A;  4LIV A;  1S72 I;  3TKY A;  1X2M A;  3HOY J;  2O61 A;  2XSJ C;  5D1R A;  2KKO A;  1PP7 U;  2YVH A;  2AQF A;  3HJE A;  3CZ6 A;  3K6G A;  3LOC A;  3CCM I;  3N97 A;  1K79 A;  4XLE A;  1ZG1 A;  2V6E A;  5DEQ A;  5E8I A;  2ZCN A;  4DGW B;  2ID3 A;  3FK6 A;  4BEH B;  4ITV A;  3LL7 A;  4PXI A;  5D5U B;  1YJN I;  3LSI A;  2XGX A;  3OYD A;  2ETH A;  5K5R A;  4RS8 A;  3B73 A;  4ZYH A;  3FKJ A;  2HDC A;  1EKE A;  1Y6I A;  3HOU J;  2KMU A;  2VJ4 A;  3RYR A;  3PUF A;  1ERD A;  5J1R A;  3WU2 C;  4WXH A;  5B1A H;  4NBQ A;  2GA1 A;  3KP5 A;  1VND A;  4XM3 A;  2FOW A;  4F3Q A;  4NC8 A;  3GF2 A;  4OIR F;  2V7F A;  1MMN A;  3DEU A;  1RKT A;  3HC7 A;  2PI0 A;  2ZB9 A;  1BI0 A;  4XBF A;  1PUE E;  2QA4 I;  5CYV A;  1YW9 A;  3ZQG A;  2WBM A;  1R58 A;  1AWC A;  4AWX B;  2XUB A;  1P4A A;  2Y9Y A;  5IT3 A;  2LY9 A;  5J1Y A;  2V1U A;  4XLH A;  4Y4R A;  3JRD A;  3RKX A;  1YI2 I;  2EIN H;  3IUO A;  2XVC A;  3CCU I;  2Z99 A;  3NI7 A;  3BPX A;  3GVA A;  4BE2 A;  1YRN B;  3MKL A;  1T39 A;  1RUO A;  3X2Q H;  2QQA A;  3LWF A;  3GZ5 A;  5CPR B;  3TDU C;  1OCZ H;  2ZFU A;  3KET A;  4G7O F;  4U9N A;  2IA2 A;  1MDM A;  2FBQ A;  4CGZ A;  1C0W A;  4OAY A;  4HLX A;  3KYD B;  1P92 A;  4H0E A;  3OR1 C;  4L5E A;  1DP3 A;  1FOY A;  3QP6 A;  2EA4 A;  3S14 J;  1MZB A;  3PSF A;  3C07 A;  3JRC A;  1OR7 A;  3TGN A;  4HAM A;  2DMT A;  2BGC A;  1F5T A;  2BY0 A;  3ZXS A;  4X0G A;  3AL0 B;  3GZ6 A;  4OIP F;  1MD0 A;  3HTU A;  3WTU C;  2NOG A;  3ZQQ A;  5ILU A;  2XAJ A;  2DDB A;  1AOY A;  4WXC A;  1W36 C;  1J59 A;  1U6G A;  3JSJ A;  2RAS A;  4LJZ F;  1SD6 A;  5EEA A;  5D4S A;  1ZR2 A;  1MH4 A;  3VOE A;  3BR1 A;  1JKP C;  3K69 A;  1QRY A;  3PIP F;  3RH2 A;  2F5F A;  4GFK A;  3MZY A;  4L9T A;  2EIJ H;  3I5U A;  1JXS A;  2P8T A;  3EUA A;  4XKC A;  3S3O A;  4M3F A;  3DBR B;  1J9I A;  1Z0X A;  3ASN H;  2L5Q A;  1S6L A;  2OZU A;  3CP8 A;  2JVH A;  3I4P A;  4ZH4 F;  3WTX C;  3L2W A;  1N75 A;  2CV1 A;  2XIG A;  3OYI A;  3QPT A;  3L09 A;  2NYX A;  4MXM A;  4XOR A;  1QQI A;  4F93 B;  3EQL F;  3LSG A;  5D4R A;  2JTV A;  1ZLK A;  2M4G A;  3DPL C;  2W85 A;  1AU7 A;  1D1A A;  3BNI A;  3LSJ A;  3PQK A;  4E7Z A;  5EG0 A;  4OIO F;  2CGP A;  1KZH A;  4EAT A;  5E79 C;  2HVR A;  4R8H A;  2FMY A;  3ONQ A;  1UG0 A;  3GTK J;  1FPQ A;  4XLA A;  2O7T A;  3LSK A;  5FKM A;  1WH5 A;  2M45 A;  1MMA A;  1QGP A;  3K1M A;  1NK2 P;  3CDI A;  1K6Y A;  2ICW G;  1HW5 A;  4MLO A;  4MHG A;  2DFH A;  5BOX A;  1EF4 A;  3JSP A;  1ZG3 A;  1LE8 B;  2GA2 A;  1WKM A;  2V26 A;  1UHW A;  3WTY C;  4EGZ A;  1E17 A;  1ZQ3 P;  1T98 A;  1NH3 A;  3G6E I;  5F64 A;  1WGX A;  4B44 A;  5M5Y J;  1NTC A;  3HSF A;  3WE2 A;  4GO1 A;  3HB9 A;  5LRS A;  3VVX A;  2FU4 A;  2R3S A;  4HPQ A;  1T38 A;  1QU3 A;  3NPI A;  2CQ7 A;  4JX5 A;  1Z7L A;  1E3H A;  2QSF X;  2MD0 A;  2DYS H;  3FK7 A;  4CZZ A;  2UXI A;  3H5N A;  3LA7 A;  2EZK A;  1W5T A;  1MIJ A;  3CUQ C;  1PYV A;  3LQQ A;  3IH2 A;  4I98 B;  2KQR A;  2TRT A;  2LVS A;  3S1Q J;  5GPC A;  1TWA J;  2HPM A;  4I76 A;  1TTY A;  3F22 A;  4N4N B;  5FLV A;  2ZY9 A;  1FP1 D;  4BQA A;  2JN6 A;  3EPZ A;  3QPS A;  3HSR A;  3K2A A;  2IP2 A;  1B9M A;  1SAU A;  3WTV C;  1Y39 A;  2E5Z A;  1CQT A;  1Z91 A;  5GAE J;  1LFP A;  2KRF A;  5HS8 A;  2VQG A;  2O8K A;  3H0G J;  3PNT A;  1JHH A;  4S0H B;  3PPB A;  2V9V A;  3O3K A;  3SYT A;  1ZR4 A;  1JGS A;  4AIH A;  3QOE A;  5FKL A;  1APL C;  5K7H A;  4LD5 A;  3LQR A;  2QZ8 A;  3ZMZ A;  4I7H A;  2IXS A;  5KAI C;  3HOV J;  2L54 A;  4LOC A;  1XCB A;  1S5L C;  1MNM C;  1VZ0 A;  5HS7 A;  3SEQ A;  3V8K A;  4OD4 A;  3A0B C;  1Z77 A;  2ISY A;  5ILS A;  2WB1 A;  2JA5 J;  2VPL A;  1D8K A;  2E1N A;  2ZSH B;  4A3D J;  2VBW A;  3NS4 A;  2M7A A;  3AG1 H;  4PFO A;  2UXN A;  3JR9 A;  3FZV A;  2K9M A;  1GXQ A;  2JPC A;  1TT5 B;  4L0Z B;  3CWR A;  1D0Z A;  1USS A;  1IRG A;  3OS1 A;  4BBR J;  3QBM A;  2HVQ A;  2FD5 A;  3GFJ A;  1X58 A;  2QQB A;  3EYY A;  1FWZ A;  2CQK A;  4N9H A;  2FJ1 A;  2X6O A;  4DZJ A;  2XV4 S;  2XPU A;  3H1C A;  3UKG A;  3V6G A;  2HR3 A;  2H1L A;  2PFB A;  3TBI A;  2OF7 A;  2Z33 A;  3S15 J;  1YIO A;  4ANJ A;  1JGG A;  4BH9 A;  3M8E A;  2HOT A;  1UI5 A;  1R71 A;  3OS2 A;  1ZRF A;  3TO6 A;  5CXG A;  4DVY P;  5DCM A;  4U7B A;  3RZD J;  2Z2S B;  2HEO A;  3OOU A;  2V6C A;  2KJC A;  3TW7 A;  2DA6 A;  1ZGA A;  4M72 A;  3GZN B;  1VQN I;  5H2F C;  2J5O A;  1YJW I;  3BOQ A;  1XS9 A;  2RGV A;  2A3S A;  5F27 A;  4HQM A;  2UXH A;  1WH7 A;  4C2M J;  5J8F A;  2R7T A;  3A01 B;  1TQP A;  4M73 A;  1RNL A;  4MTE A;  1A6Q A;  4A5M A;  3KYC B;  3FMS A;  3HG9 A;  5FD5 A;  4A3L J;  2F5C A;  2Y48 A;  3AKZ A;  2KIU A;  3G1M A;  5LHG A;  3OMY A;  4FAS D;  3MKY B;  4U88 A;  5ICG A;  1LDK B;  1I6X A;  3E6D A;  2DTZ A;  4BGD A;  2O3F A;  4BDY A;  2KZV A;  5B5E C;  2PMU A;  2UXO A;  4XSX F;  3CJQ B;  3TP0 A;  2REK A;  4LMY A;  4HRI A;  3L2V A;  2R92 J;  5CKT A;  2HYT A;  4LGW A;  1P2F A;  4ASN A;  4XRM A;  2MAB A;  5DUI A;  3AG2 H;  1V5F A;  1Z21 A;  1MW7 A;  1BW5 A;  4RA2 A;  3VB2 A;  3HL2 A;  1FOW A;  4ZYG A;  3ZQI A;  1JKO C;  2W82 A;  2X1D A;  1YX3 A;  2V4J C;  1BJZ A;  4FE4 A;  4RLF A;  3UNG C;  3HTA A;  2ZO4 A;  2NS8 A;  3FHZ A;  2FJI 1;  2W00 A;  2IGN A;  2F5D A;  2Z1D A;  3HOT A;  3T0Y A;  2BY2 A;  4YFK F;  4IRH A;  5JI6 A;  2NXN B;  1X1D A;  4KIT B;  2HTS A;  2RV8 A;  1MBE A;  1U9N A;  2BBY A;  1B6A A;  2NVY J;  3TQN A;  3G71 I;  1XGM A;  1ZRC A;  2WGB A;  4OOI A;  4L0Y B;  2QEN A;  3CUQ B;  1G4D A;  4KA4 A;  1ETV A;  3EUH A;  3WU0 A;  2BVM A;  2KLO A;  2HQ5 A;  1W0T A;  2VUM J;  2VC1 A;  2A6T A;  5DDG A;  1IJW C;  5ILV A;  1R36 A;  4UB8 C;  3EUP A;  3I64 A;  2QEX I;  3L00 A;  2HGC A;  2BHZ A;  3DTK A;  4WXD A;  4NNJ A;  1JKR C;  3VSK A;  3V78 A;  1OCP A;  2KIQ A;  3PIO F;  3QYE A;  3KEO A;  4MQ9 F;  3PO2 J;  3FXK A;  3K4J A;  2JZY A;  5B3S H;  5TIS C;  4HX8 A;  5FKO A;  4E4H A;  3P9T A;  1TWF J;  4XNF A;  1X1B A;  3PO3 J;  3OYB A;  4IPA A;  2D5V A;  2VIX A;  1X3W B;  2GZW A;  2X4H A;  5B66 C;  2VKH A;  2VKE A;  1N78 A;  1HQC A;  3M8J A;  4YFX F;  4CYC B;  3PL8 A;  1HDP A;  3H3Z A;  3PUB A;  4X1E A;  3DKY A;  3ZMU A;  3AFH A;  2VAS A;  2QKM B;  2O6G E;  2RVC A;  4IOA F;  1QZE A;  5A2Q K;  4A3M J;  2CUE A;  1OJL A;  4U9L A;  3F3X A;  3ZQ7 A;  3I4N J;  2TDX A;  4LG0 B;  2V9P A;  2DN0 A;  1H0M A;  1I1S A;  3MZ8 A;  2IW5 A;  3Q0W A;  2ZME A;  3C2B A;  3ZCO A;  1PUF A;  2DOF A;  3ECO A;  3SJM A;  1P9Q C;  1L0O C;  5FLM J;  3ZPL A;  4LB6 B;  5CW8 A;  3N4M A;  3J7Y J;  3DV8 A;  1UG2 A;  4KIS A;  1LDJ A;  3HGY A;  2OER A;  3VUQ A;  3I9V 2;  1FNN A;  2WB1 N;  2LF8 A;  3I53 A;  3O6B B;  4DOZ A;  4ETS A;  3CO7 C;  3G56 A;  2W57 A;  3CF2 A;  2CFX A;  4ZJZ A;  1FBS A;  3K1P A;  3H9Q A;  4E7S A;  1RUN A;  2QVO A;  5HNF A;  3F6V A;  4ENK A;  3FXL A;  3EET A;  2OV7 A;  5D18 A;  3GX4 X;  2HZD A;  3DTI A;  4KDP A;  3H9G A;  1P6R A;  4BDZ A;  1RIO H;  3KKD A;  3T6N A;  1J09 A;  4LFU A;  2XB0 X;  1FEX A;  4KIB A;  3R0J A;  5IPA A;  2X0L A;  2ZSI B;  2XDN A;  3G3Z A;  1T08 B;  4OWR B;  3ZGK A;  4E6K G;  3BTI A;  1R23 A;  3KE2 A;  2GFN A;  3CCL I;  3CO6 C;  3RQ4 A;  4E7K A;  3RZO J;  2QM3 A;  4A3E J;  2DG8 A;  1IZ1 A;  1R1V A;  3HHG A;  3LA3 A;  2QLZ A;  4RAZ A;  2VBX A;  5GPA A;  3RPQ A;  1B9N A;  2CFO A;  5IT9 K;  1O57 A;  4V2F A;  2YUS A;  2XAG A;  3IHU A;  4HNV A;  3FXQ A;  4JBA A;  2JVG A;  5E1Z B;  4KNY A;  5IT9 Z;  4W1U A;  1X19 A;  4BXX J;  1J5Y A;  2RKH A;  4UNO A;  3HIM A;  3HM5 A;  5CVJ A;  4A6D A;  1IRF A;  3HRS A;  3H35 A;  3CC2 I;  1H89 C;  3OYM A;  2R0Q C;  3IAS 2;  1VQL I;  4DW6 A;  2OD5 A;  1Y1V J;  3CLO A;  5E18 F;  2E1C A;  4R1H A;  1PDN C;  2DA3 A;  5CXI A;  1OMI A;  2E36 A;  3HUG A;  1F36 A;  3CQZ J;  1UST A;  3HPH A;  1R5G A;  2M0C A;  2NP3 A;  2OC6 A;  2DMP A;  3GFI A;  3L2C A;  1SAN A;  1UEL B;  4NN1 A;  3J7A O;  1FIP A;  4QPQ A;  4HYE A;  4XN3 A;  2G3B A;  3IKT A;  2K86 A;  2JPB A;  5KVR A;  2DPU A;  1VQ5 I;  1F4K A;  2YU9 J;  4A3G J;  1B8I A;  1WCM J;  2HYJ A;  3MKZ A;  2LF7 A;  2DU9 A;  2CQX A;  4GDF A;  5FRN A;  3D5R C;  4IHT A;  3BJA A;  3K70 D;  1IGN A;  4Y3O A;  4Y33 A;  1IN5 A;  4U0W A;  1Y0U A;  1IN4 A;  3M1E A;  3BCA A;  2ZJQ F;  1LFB A;  4M6V A;  3RIR A;  3LJL A;  1BA5 A;  3EGQ A;  3HGG A;  4DYR A;  2R5Y A;  1XPX A;  2ZC2 A;  3VIB A;  2X85 A;  4P5O A;  3S1R J;  2CO5 A;  3HIF A;  2JUG A;  2YPR A;  3L2Q A;  3CTA A;  2GIV A;  4JX4 A;  4XON A;  3S2W A;  1Q1H A;  1MMD A;  2IGK A;  2Q24 A;  3LAP A;  3F9K A;  1XGS A;  2LG4 A;  2EZH A;  1UAA A;  3GZI A;  1TL8 A;  1Y1W J;  3DEW A;  5M3M J;  3TOA A;  3O8G A;  1JTY A;  5F0C A;  2PG4 A;  3RTR A;  4ENJ A;  1MBJ A;  2X48 A;  1IXS B;  4OIN F;  3V8L A;  1AKH A;  1ETK A;  5K7F A;  4L9V A;  1XN7 A;  3P9I A;  4NQW B;  2Q1Z B;  4ZZL A;  4QLC U;  2LMD A;  2FXA A;  3E7L A;  1RC9 A;  3A01 A;  2KIS A;  4K2E A;  3M07 A;  1P7J A;  4LIU A;  3GXO A;  2LRD A;  1SMY F;  1RI7 A;  3C7J A;  2GBY A;  1AHD P;  1KU9 A;  2P6S A;  3V7C A;  3VEP A;  1ACI A;  4M9Z A;  5D8K B;  3IWF A;  1MBK A;  2VI6 A;  5J1U A;  1SD5 A;  2IEK A;  5M5X J;  1U5T C;  1IXC A;  5C44 J;  5IOZ A;  3CJN A;  2V1D A;  4LK1 F;  4RMN A;  2L7F P;  2I10 A;  2I8D A;  4P96 A;  5HOO A;  4G7Z F;  1SFO J;  4G94 A;  5E3L A;  3GTG J;  3BR6 A;  5CQE A;  2ZJR F;  3BC8 A;  4HLY A;  2E7X A;  2XB5 A;  1QNT A;  2XGC A;  3FWE A;  2HTJ A;  4DBR A;  2BW3 B;  2EH3 A;  1JKQ C;  3U2R A;  4X6A J;  3V42 A;  2DA1 A;  3NWT A;  3P5J A;  2ECC A;  1SVL A;  2KFD A;  2DOD A;  1K61 A;  1CGP A;  3CUQ A;  5L3D A;  2XKP A;  3VYT B;  2LD5 A;  5J40 A;  3OYL A;  1XG1 A;  2FRH A;  2OU2 A;  1GXP A;  3S17 J;  3FM3 A;  4XID A;  3I55 I;  3OSG A;  2NVX J;  2CUF A;  4N9I A;  4FIS A;  2DG7 A;  2JRM A;  1S7E A;  2M87 A;  2LOO A;  4HBL A;  3JRG A;  3BZC A;  4U0V A;  1HKS A;  4FX4 A;  1S7O A;  3JSO A;  1L3L A;  3H92 A;  1HXD A;  3E6B A;  1BI3 A;  3N05 A;  4G9Y A;  3F8M A;  4HG2 A;  3LSP A;  2HVS A;  3KIO A;  2Y2Z A;  2CV2 A;  3FXO A;  1IUY A;  2CQQ A;  4F92 B;  5FFX A;  2W4S A;  2LY2 A;  4KN7 X;  4OMY A;  3R4K A;  4A0Z A;  2VQL A;  2VL8 A;  3S2H J;  3BJ6 A;  1BI1 A;  4LLG F;  4YEL A;  3HEF A;  4CYC A;  4BQN A;  5EZH A;  4C2U A;  3MD2 A;  3CMM A;  2B63 J;  1ZN2 A;  3RI4 A;  4BXF A;  2F4O B;  4RB0 A;  2EBI A;  4M74 A;  2M30 A;  5C4Y A;  3G4S I;  3K70 C;  3KNW A;  3I59 B;  1HLV A;  1SAX A;  3W6J B;  3HTI A;  4LG0 A;  2GIZ A;  1U8R A;  3HRU A;  3ZQF A;  1BW6 A;  1ON1 A;  1HBX G;  2QKO A;  2VJJ A;  2EJR A;  1LEB A;  2H6C A;  3Q0U A;  2VOO A;  2E7W A;  4M3G A;  1A35 A;  2Q2E A;  3ULQ B;  4YZE A;  4EJO A;  2HYG D;  4BJ6 C;  3KCC A;  5J4V A;  2RAE A;  3NQO A;  1TT0 A;  3VP5 A;  4XLN F;  3AG3 H;  5K7Z A;  3T8T A;  5D8L B;  1ZAO A;  4IXA A;  1FOX A;  1PP8 F;  2LR8 A;  4FT8 A;  4PDK A;  1TW3 A;  1XB4 A;  2ZXJ A;  1B72 A;  3T5X A;  1JUP A;  5DTD A;  3VYS B;  5DV5 A;  2QCO A;  2PBX A;  4EM1 A;  4MQV A;  3ZN1 A;  3W6V A;  3ON2 A;  1W7P A;  2HZT A;  4YII A;  4J19 A;  3CC4 I;  4MK6 A;  2VJ5 A;  4HV5 A;  2GQQ A;  3ZQH A;  1IDY A;  2DA2 A;  2UXP A;  2NRA C;  4PJ0 C;  1BN5 A;  1ODD A;  3CJR B;  3W6K B;  1JI8 A;  5HNH A;  2IRF G;  2FML A;  4E70 A;  5LRR A;  3ABM H;  2L02 A;  3HTH A;  2R7Q A;  4WIB A;  3BCB A;  1I3Q J;  1RPW A;  4XR6 A;  2IS1 A;  3F1B A;  5LHI A;  2L7K A;  5DUK A;  2CH0 A;  1JJ8 C;  4AVP A;  1U5T B;  2KL4 A;  4BHC A;  4Y13 A;  3GYH X;  1Z6R A;  4AIK A;  1GUU A;  4HA8 A;  3DPU A;  2VC0 A;  5F6F A;  2O8X A;  3VTI A;  4BL0 B;  4KIC A;  5L3G A;  3HSE A;  3BPV A;  4F52 A;  2NNY A;  3F8C A;  3FBI B;  2K7L A;  2M0M A;  3F8B A;  4L5I A;  2EA2 A;  3MAJ A;  3F6O A;  3H3V K;  3QYB A;  2O0Y A;  3ZOB A;  2IGO A;  2AQE A;  4P1W A;  2STW A;  1LKX A;  3A1Y A;  5LBQ A;  4HW0 A;  2IT0 A;  3D0S A;  2E2H J;  5LGU A;  3F72 A;  2KIM A;  2DCE A;  3DFG A;  4CXF A;  1WWX A;  4I6Z A;  5K1Y A;  2BY3 A;  4I2O A;  1XCV A;  3E3V A;  1I39 A;  3FF5 A;  4IKF A;  2WWY A;  5TJJ A;  4O6J A;  4B48 A;  4F55 A;  5HLH A;  1LDD A;  2DK5 A;  2VB6 A;  5IY5 H;  3JRF A;  3ABT A;  2LBF A;  2CYY A;  1XDU A;  1MBG A;  2DK8 A;  3IAM 2;  5JHF A;  4WX9 A;  3S8P A;  2ZOZ A;  3JAM K;  1ZKG A;  2R7R A;  4JP0 A;  2LFB A;  1FYM A;  2CU7 A;  3ERE D;  1FMV A;  1SFE A;  2HNH A;  3NAU A;  2IS2 A;  4E7I A;  1B1B A;  1V5E A;  3RPU A;  2CS3 A;  1YHQ I;  4RGR A;  3JAM Z;  4G12 A;  2K40 A;  2NVU B;  3A0H C;  2XAU A;  2ESN A;  4V19 K;  4BAY A;  1VQO I;  3CES A;  1IXR C;  1FIA A;  1MJB A;  2NOJ B;  3IP4 B;  4I0B A;  4U87 A;  4UXN A;  1K78 A;  2QBY A;  2W24 A;  3C1D A;  2R7S A;  3I54 A;  4ZDL A;  2P81 A;  5LD2 C;  1IUF A;  1K83 J;  2KDZ A;  2VKD A;  2ZBK A;  1SGM A;  3JRE A;  3CLQ A;  3OV8 A;  2PJP A;  3SXY A;  2D1H A;  2EQR A;  1DU6 A;  2MYS A;  2R7F A;  1FX7 A;  2BY1 A;  3IH4 A;  5C3E J;  3HKZ A;  4XQF A;  2DFE A;  1BOA A;  3D1N I;  3BTL A;  4OD5 A;  4XLC A;  3G7R A;  6PAX A;  5F04 A;  3S32 A;  4B8X A;  2X9D A;  3DTE A;  2ISZ A;  2P5K A;  5FD6 A;  4LB5 A;  3GW2 A;  3FM5 A;  3G2B A;  2TCT A;  3GTM J;  3KP7 A;  4OAZ A;  2IAI A;  3MEX A;  2ZCM A;  5CVV A;  4M6Y A;  4D9J A;  2KDO A;  2UWM A;  2FUG 2;  4RAG A;  1GVJ A;  1Z7U A;  1SVM A;  1XX5 A;  2CWE A;  2HU9 A;  3K10 A;  5FMP A;  2JUC A;  3CP2 A;  1BR1 A;  3WGI A;  3LNQ A;  3NRG A;  3M3Y J;  1Y8R B;  5EEH A;  4IX7 A;  3PQJ A;  4GYI A;  1FY7 A;  1LB2 A;  2L9N A;  3O60 A;  1HW1 A;  3MZH A;  5EZG A;  5LGT A;  3KP2 A;  3BR5 A;  3IH3 A;  4IF4 A;  5K5O A;  5K58 A;  1UHM A;  3BTC A;  1W4M A;  2CQN A;  4EQQ A;  4HQE A;  2EV6 A;  2IJL A;  2OCC H;  3JRH A;  1V54 H;  4IVN A;  1RZ4 A;  3PM1 A;  1ZTR A;  3G1L A;  5HAW A;  3OYH A;  2DLL A;  4UV9 A;  4L9J A;  2MG4 A;  1BI2 A;  3MVP A;  4IRG A;  3BR0 A;  4XRF A;  5E1W A;  5IYC J;  2COM A;  1YX5 A;  4MFD A;  2BW3 A;  2VT2 A;  1OCO H;  2RNJ A;  3H5R A;  2BZT A;  1FOK A;  3L2R A;  1OQY A;  1F9N A;  4D7M A;  5HBU A;  4DBQ A;  3F21 A;  2COB A;  2EIL H;  3GBG A;  4EMS A;  2F48 A;  4KIF A;  3ECH A;  2YS9 A;  4D5F A;  4N4O B;  1BOB A;  1CF7 B;  2CUJ A;  2K4B A;  2LP0 A;  3IV5 A;  3BZK A;  1BC7 C;  2X6Y A;  3NWS A;  5TGT A;  1K4S A;  2OBP A;  2OCE A;  3E0J B;  1LJ9 A;  2OQG A;  3OS0 A;  3MNL A;  2STT A;  1ZGJ A;  1RKW A;  4B4C A;  3EYI A;  2L9R A;  2Y75 A;  2PN6 A;  2QKL B;  4XN0 A;  1WJC A;  2MD5 A;  1J75 A;  4PSX A;  4G8X A;  4A0X A;  2YX7 A;  5DAJ A;  1EH6 A;  4BEH A;  1YIT I;  4GFB A;  2E1O A;  5EGO B;  3QP5 A;  3UR3 C;  4PJJ A;  4BS9 A;  4M3D A;  5JVT A;  5DCF A;  1QHG A;  2LYC A;  4RM2 A;  2KRH A;  3PNY A;  4UVB A;  2UUZ A;  2QQ8 A;  4BUP A;  4AU7 A;  2O03 A;  4HDV A;  2LKX A;  1G59 A;  1XMX A;  3ZRG A;  3I59 A;  2BXZ A;  2OPT A;  3K1N A;  1JT6 A;  4ENM A;  1H9G A;  2BOL A;  2K9Q A;  2HDD A;  5JVG F;  2QSH X;  4IHS A;  4HNU A;  5M3F J;  1WI9 A;  2W25 A;  3SFZ A;  3BP8 A;  1QVT A;  3H3U A;  3AQT A;  2HDW A;  4GXO A;  2G7G A;  3ZP5 A;  4U7D A;  2HKX A;  2EFW A;  3BZ6 A;  3ANG A;  2Y31 A;  3OIQ A;  3F8N A;  4I99 C;  3U9G A;  1BL0 A;  2MC4 A;  1LFU P;  1TZL A;  2GUH A;  3JRB A;  4PCQ A;  1LPQ A;  3E97 A;  4MGR A;  3CME I;  1R5H A;  2DOA A;  3U1D A;  4A5N A;  1YRN A;  2DMU A;  2OZ6 A;  1TQM A;  2RHA A;  4BYY A;  3AQS A;  2HKO A;  1R1T A;  5FJ8 J;  1WVR A;  4ZDO A;  1QZZ A;  1OKR A;  1DGR M;  1P7I A;  2DYR H;  3I0T A;  4ICH A;  4N0B A;  1X3U A;  1FYK A;  1H8A C;  2P5V A;  3OSF A;  2EFO A;  4LLN A;  4UY8 I;  2O9L A;  3KX2 A;  3Q9V A;  2MLG A;  4HV6 A;  2W53 A;  2IVM A;  5J8C A;  3P7N A;  2HQR A;  5L3F A;  2XRL A;  5C4J J;  3C2G A;  1WJF A;  4CZC A;  2HOE A;  2CW8 A;  2RRE A;  3SQN A;  5KHD A;  4ZYD A;  3MFK A;  5JLX A;  2JJ7 A;  1I6H J;  2XGD A;  1KU7 A;  2CRG A;  1MMG A;  3HHH A;  4AF5 A;  3JW4 A;  3QOP A;  1O3T A;  3LWJ A;  3S93 A;  2A6E F;  5DD8 A;  2VBY A;  4HEA 2;  3EUK L;  5H6R A;  3KP3 A;  5AQC A;  2LK2 A;  3HKZ N;  3EDP A;  1IV8 A;  5J47 A;  2PMH A;  4KT5 C;  2FBK A;  1TP4 A;  3LAJ A;  3F23 A;  4JNN A;  1OLT A;  5ICF A;  5FRM A;  2F5V A;  3DBL B;  3BR3 A;  3C3W A;  1ON2 A;  3WTT C;  2FQ3 A;  2MW8 A;  4BBS J;  3CJT B;  1ETY A;  1WHU A;  4GCT A;  3I56 I;  2ZNZ A;  2E34 A;  5FFZ A;  3GFM A;  3KLN A;  1VQ4 I;  2PZ9 A;  1IV6 A;  4RGU A;  1BR4 A;  2WA0 A;  5FLX K;  2JK3 A;  5HOD A;  2R7D A;  2VXZ A;  4I02 A;  3M7G A;  1YO5 C;  1JUM A;  1U3E M;  1D0Y A;  5FLX Z;  3KYL A;  1T0F C;  2GOX B;  2XHK A;  4IOC F;  3FIS A;  2WTE A;  3GUD A;  4PUS A;  1IDZ A;  5FRO A;  1TWG J;  1R5I D;  2H6B A;  4IQJ A;  2FA5 A;  4KT6 A;  3WTW C;  2NVT J;  4GGG A;  1H9T A;  5LFA A;  2H94 A;  1SFK A;  4WK8 F;  2EFN A;  4YG2 F;  3ML6 A;  5HDG A;  1QVU A;  2HOS A;  4M3B A;  5CVR A;  2QIB A;  3DP7 A;  3DU6 A;  3GLX A;  3H36 A;  2B7E A;  4Z2Y A;  4BXU A;  3HOZ J;  5K5Q A;  3VW0 A;  3MMY B;  3MKW B;  3RKW A;  4NB5 A;  1LE8 A;  3GWZ A;  1W5C C;  3OYG A;  5F1J A;  3BRU A;  1QO0 D;  4ZYA A;  5L3B A;  1MGT A;  4UHT A;  1IW7 F;  1SD4 A;  3KP6 A;  3RSN A;  2PMZ A;  2BXY A;  5AIP A;  5FKN A;  2A5W A;  5GAG J;  1KQ0 A;  1TNT A;  3O8H A;  2DJN A;  3E5Q A;  1KON A;  1G8X A;  4AYB A;  2K02 A;  1MDM B;  4A3J J;  3E7Q A;  4FTH A;  4HKU A;  1AA7 A;  3Q3S A;  5DS9 A;  1DP7 P;  1O7F A;  3VWB A;  3QAH A;  5FB2 A;  3LST A;  4YIF A;  4ACI A;  1R22 A;  4II3 A;  5GTH C;  1Z1D A;  4QIW N;  2E35 A;  2R5Z B;  4IHY A;  2RQQ A;  2V1X A;  4BHB A;  4B3X A;  4PGG A;  1QA6 A;  2DBB A;  1IN6 A;  2D1V A;  1IO2 A;  1XGO A;  2BYV E;  2GWR A;  4CCO A;  4ESF A;  2Q0O A;  4AUX A;  2D6Y A;  3L7W A;  3LMM A;  4DZP A;  1YG2 A;  5D5W B;  3G73 A;  1LVA A;  4YEJ A;  1ZRD A;  1Y0N A;  2LTP A;  1JTX A;  3W2W A;  4A0Y A;  3KPH A;  2XSD C;  3GTL J;  3HOS A;  3ASO H;  4BJT A;  1D8J A;  3B6C A;  2DMN A;  5E1X A;  1F1Z A;  1ITY A;  3CMA I;  4JKZ A;  1Y56 A;  2M4K A;  3MCZ A;  4E7H A;  3CCJ I;  2UV1 A;  4PJL A;  3KZY A;  1I5Z A;  2E60 A;  3E6C C;  2XF6 A;  2EPF A;  3JRI A;  2YU3 A;  4AVZ A;  4QSH A;  5D6F A;  3V7R A;  3BQZ A;  1JHF A;  2G7S A;  3HTJ A;  2W84 A;  1OCT C;  3OIP A;  2K3P A;  1YE9 A;  5CJ9 A;  1TC3 C;  3S1M J;  5ED4 A;  5BMZ A;  3VYU B;  1KA8 A;  5EG0 B;  3BJO A;  2DQL A;  2X1C A;  3TW6 A;  5L3E A;  2QOP A;  1GV5 A;  3FXM A;  4S04 A;  4EVI A;  1U78 A;  1EV7 A;  2DA5 A;  1GT0 C;  2VBZ A;  4CHU A;  2XF7 A;  2L01 A;  2BE5 F;  2PQ8 A;  2QGU A;  1I50 J;  3FMR A;  1WPK A;  4M6X A;  2AO9 A;  5BQT A;  2IU5 A;  1R1U A;  2BV6 A;  1DPR A;  2JSP A;  4L9N A;  5BPI A;  1Z9C A;  2ZXH A;  1OYI A;  2JMW A;  1IRZ A;  3GLL A;  3H9J A;  3ZR8 X;  3HXL A;  2LY1 A;  4CUG A;  4MO7 A;  3I71 A;  1FSE A;  1F43 A;  4F91 B;  1MH3 A;  4Y52 J;  3IC7 A;  1DUX C;  1BBY A;  1CF7 A;  1Q1V A;  3ESW B;  3KLO A;  3J81 K;  1D5V A;  4IL6 C;  3SZT A;  4BQQ A;  1YTY A;  2B9S A;  4CGR A;  4EJV A;  1ZGW A;  5BS6 A;  4L5J A;  4DYQ A;  3ELK A;  2JA6 J;  2NX4 A;  2YX4 A;  3J81 Z;  5HLI A;  4KYW A;  4IJA A;  2XDV A;  2MBF A;  4M3E A;  1VF9 A;  4I0A A;  2WV1 A;  3OL3 A;  4HST A;  2WAE A;  1WJ5 A;  2RN7 A;  3GTO J;  2J5P A;  4D5C A;  4UUS B;  2E19 A;  2R4G A;  3QPL A;  1SC7 A;  5HLG A;  4A12 A;  3SEZ A;  1FMW A;  4GCV A;  3L9F A;  4FHT A;  1BIA A;  4DNC A;  2A6H F;  2KZG A;  1HF0 A;  5CLS A;  4LK0 F;  2ESH A;  1FYL A;  5J3L A;  1EH7 A;  2L9V A;  2L2O A;  2HPI A;  3ABU A;  1V5G A;  2CJJ A;  3LFU A;  3K7A J;  3E6M A;  2D2W A;  2VJI A;  2VLA A;  4XK4 A;  2VE9 A;  3CD6 I;  2Y0S A;  4NEL A;  3R0A A;  3TDZ C;  5ICC A;  5E8G A;  4CSW A;  1WZ2 A;  5J6X A;  2QWW A;  1XMK A;  2JWT A;  4EJU A;  2M7B A;  1MNE A;  1W36 D;  1MBH A;  2L9S A;  4O3M A;  4GCK A;  2A61 A;  5EEG A;  1HOM A;  1POG A;  2L0K A;  1X3Z B;  3V8J A;  1WRJ A;  4RAF A;  1G3W A;  2DXI A;  3DXJ F;  3PJR A;  3K2Z A;  1X4O A;  2VE8 A;  3M9A A;  5KK1 A;  1NK3 P;  2A69 F;  2XPV A;  3Q0V A;  2NAZ A;  3BG5 A;  2X6W A;  3RD3 A;  5LLQ A;  4D1Q A;  3FRQ A;  1G6N A;  2WY7 Q;  1EA3 A;  3S16 J;  3BTJ A;  2A05 A;  2PMZ N;  3TED A;  3V4G A;  3QQA A;  1KYZ A;  2FEZ A;  2HYF A;  2ZME C;  3KZ9 A;  2EB7 A;  1Z67 A;  3GFL A;  2N8G A;  4AYB N;  5LEJ A;  2AXT C;  1WFX A;  4BE0 A;  1FLI A;  4O5V A;  1VTN C;  3LA2 A;  4ESB A;  3Q9S A;  1YW7 A;  1IRX A;  4NUB A;  1BJA A;  2OA4 A;  2X1E A;  4BJ5 C;  4UVA A;  3E1S A;  5LEK A;  1OPC A;  1XC5 A;  2QWT A;  1ONV A;  2DQR A;  1I3A A;  3TL4 X;  3BCG A;  3HE0 A;  1NG7 A;  4XIC A;  3DLL F;  2RNG A;  3S5R A;  2EZL A;  2ZCX A;  5LGN A;  3FBN B;  3BG9 A;  2DOE A;  4AC0 A;  3ZN0 A;  5DCM B;  4DQ2 A;  2HQN A;  2P5L C;  3WU1 B;  5KAF C;  4KWA A;  2DMQ A;  2WAD A;  1W1W E;  2RDP A;  5BNG A;  2R7U A;  2EZI A;  4P55 A;  1MKM A;  3CJD A;  1OCC H;  1RRJ A;  4XRS G;  1FJL A;  1R6R A;  1XD7 A;  3M1C A;  2UZK A;  2OAZ A;  2K85 A;  3ZMV A;  3V7S A;  2NVQ J;  1FC3 A;  1D0X A;  3ROU A;  4HF0 A;  5JR3 A;  3VOD A;  1BM9 A;  1LUJ B;  1T33 A;  2WAF A;  3OIO A;  3OWT A;  3QWL A;  4WF2 A;  3U21 A;  4XOP A;  4CO8 A;  2MH2 A;  4A3K J;  2V57 A;  2VT3 A;  1HCR A;  3KP4 A;  2G9W A;  4Q4Z F;  3BG6 A;  3IUV A;  2RQP A;  4C3H J;  5GAH J;  3SZP A;  1J0R A;  2DDA A;  3W3C A;  2XPW A;  3CUO A;  3PAS A;  4BNC A;  3CCQ I;  5CQG A;  5E17 F;  4FCY A;  4CCN A;  5ICE A;  3VFZ A;  2F4I A;  1Y8Q B;  2K9N A;  3FXJ A;  2CUZ A;  4KN4 X;  1A04 A;  1HSJ A;  4RLQ A;  2K27 A;  3SWH A;  4BE1 A;  3SHF A;  3I4M J;  1JJ6 C;  2PX9 A;  3BDD A;  4R79 A;  3BRO A;  3NAR A;  2FBH A;  1YFH A;  1X1C A;  3B6A A;  4PSW A;  2R7X A;  4C9Y A;  5E3N A;  4A2U A;  1SD7 A;  3B02 A;  1YW8 A;  4ZC3 A;  1NHA A;  2B0L A;  5L3C A;  2G7U A;  2K9S A;  3JCU C;  3D5S C;  3I3L A;  4EM0 B;  3GEZ A;  1UCR A;  2OUM A;  2NS7 A;  2AHQ A;  4Y17 A;  1DDN A;  2P6T A;  3DLA A;  2JRT A;  3J7A Y;  3CCE I;  4A3B J;  4C2T A;  4ZTJ A;  3L1P A;  1YS7 A;  2BVL A;  4CCM A;  1GDT A;  1K6O A;  2K3F A;  5H6Q A;  2DFI A;  4BQO A;  2PJR B;  1O4X A;  3OYA A;  3DPT A;  2R5Z A;  1ZYR F;  5EYR A;  2UXU A;  2R7Z J;  2CSO A;  1DPU A;  2HKU A;  2KP6 A;  1K7A A;  1VQ9 I;  4WWC A;  4KJZ A;  4JK1 X;  1O7L A;  4QWQ A;  1LQ1 A;  3JTH A;  3REO A;  4MFE A;  4ON0 A;  2Y0M A;  3WTS C;  1TLH B;  5LHH A;  3DWL E;  2DA7 A;  1XSD A;  2W1O A;  3O2P E;  4YFN F;  1ZH5 A;  3E5X A;  2OI8 A;  5CVU A;  2Y0S N;  3BR2 A;  3GME A;  4E7L A;  3KKC A;  4HX7 A;  1WI3 A;  4G6D A;  2M3A A;  4Z6Y A;  4XOT A;  1G3T A;  5GP9 A;  2XAS A;  4YIR X;  3DCF A;  3R6S A;  1XMA A;  3A2K A;  4C2M A;  1QBJ A;  4G6T B;  4PJM A;  2ZME B;  3RDI A;  2I5U A;  1PUF B;  2ID6 A;  3QPH A;  3QOD A;  2QF7 A;  4S05 A;  4A6E A;  4BU2 A;  4PFP A;  1P4W A;  5KCM A;  2IS4 A;  2BEO A;  1W7P D;  3OYK A;  1ZHF A;  2F07 A;  2DJI A;  1FT9 A;  3IL2 A;  1P4X A;  4IQ4 A;  1XTA A;  2MGQ A;  2YSR A;  3OYC A;  2VPR A;  2GOM A;  3BT9 A;  4RDU A;  2VQC A;  4IHX A;  1GV2 A;  2GXB A;  3RQI A;  3BG7 A;  1DGW Y;  2XAF A;  1ZK8 A;  4RGS A;  3W2V A;  2FE3 A;  4AIJ A;  3P9K A;  4Y7N J;  1BR2 A;  1D1C A;  1TW2 A;  2LC2 A;  2DPD A;  1GHC A;  2QTQ A;  3VW2 A;  1OFC X;  2M1B A;  3Q5F A;  1SFU A;  3CCR I;  3OOP A;  2OQR A;  2RC4 A;  1HC8 A;  3IKV A;  2Z16 A;  2VOD A;  4CCK A;  1MMS A;  5F08 A;  4BAC A;  3DF8 A;  3F8F A;  5HLT A;  2G7L A;  3CRJ A;  4MEY F;  1E3P A;  3S3N A;  1OYW A;  3HZJ A;  3MQ0 A;  4XL9 A;  1HKT A;  2VKV A;  5IP7 J;  1YOV B;  4AID A;  2GXG A;  1UJ8 A;  3WGH A;  4C3I J;  4PZJ A;  1S8N A;  1TBX A;  4NQW A;  1T0F A;  2MSY A;  4UUS A;  1R7J A;  3T8R A;  3AG4 H;  2VON A;  1SVO A;  1KQ9 A;  1V55 H;  3CMY A;  5BPD A;  2EIK H;  2GXA A;  2B3W A;  4CCL A;  3LFK A;  4L62 A;  3OYF A;  4HDU A;  3FX3 A;  4UUV A;  3BJB A;  1EH8 A;  3BWG A;  2LRE A;  5IOY A;  2HS5 A;  2KRC A;  2IA0 A;  1ULY A;  1J2X A;  1Z3X A;  2ELH A;  2NS0 A;  3HUG B;  2M5W A;  4BY7 J;  4QPO A;  2HFH A;  1EJ9 A;  2A07 F;  1U9O A;  1SMT A;  2WC2 A;  3PFI A;  2EK5 A;  4J00 A;  1REP C;  2VOP A;  1FSH A;  1RES A;  4KMU X;  3VVY A;  3RPU D;  3FMQ A;  2F2E A;  4I09 A;  4TV7 A;  3DQV C;  4RB1 A;  3DU5 A;  4ZYE A;  5EF6 A;  3S1N J;  2F4M B;  3CC7 I;  3A4C A;  1HST A;  4EV0 A;  2R7V A;  3W2A A;  2QYO A;  2LLK A;  2HXI A;  1MJA A;  3SDB A;  1T2K A;  3FXR A;  3K4K A;  4UUT A;  3ZQL A;  3OYJ A;  1B8I B;  4IRV A;  2P0W A;  3OR2 C;  2ZNY A;  3HDD A;  1OCR H;  2M8E A;  1JT0 A;  4L18 B;  3PFY A;  3VPR A;  5IP9 J;  1HA8 A;  1LEA A;  1U2W A;  4GYG A;  4Q48 A;  1WJD A;  1IN8 A;  1J7K A;  4XMY A;  4XLF A;  4ZZD A;  4J01 A;  3RYP A;  1G2H A;  2E1M C;  2E5N A;  3WG7 H;  3K8P C;  1FBQ A;  1I1G A;  5EDN A;  2GEN A;  2H8W A;  3IRQ A;  2K5C A;  3RJP A;  2R5Y B;  2MA3 A;  1IF1 A;  1ZRE A;  4JX6 A;  2Y30 A;  4KFC A;  3GO5 A;  3MN2 A;  1TWH J;  1QZY A;  4BY1 J;  1WQ2 A;  5H9T A;  2LKS A;  2DTR A;  5FGM A;  3K4C A;  5FO5 A;  5DM7 F;  3U1K A;  4KUM A;  1QPI A;  4XKW A;  3L2U A;  4A3C J;  3FDY A;  3KFW X;  1OR7 C;  1HDD C;  4LLL A;  2M34 A;  1AKH B;  3RKY A;  4OMZ A;  4A3I J;  2CW0 F;  2QQ9 A;  1FP2 A;  4XLP F;  2KT0 A;  4P9U A;  4UB6 C;  4RM3 A;  4MNU A;  2V9K A;  5D5X B;  4U0Y A;  4HF2 A;  4FQG A;  2L4M A;  3S2D J;  4CIC A;  2GAU A;  2EV0 A;  1ZAR A;  3HOW J;  1IC8 A;  3BY6 A;  1UMQ A;  1KU3 A;  3MWM A;  3K4M A;  5GAD J;  3BLY A;  5DM6 F;  2XC7 A;  5EJC A;  3VOK A;  2FBI A;  1N25 A;  1KGS A;  4DYC A;  2MFZ A;  5FGL A;  3GTJ J;  3SFI A;  4EGY A;  4DJA A;  1X1P A;  5JLW A;  2DO7 A;  4B47 A;  1BIB A;  1FBU A;  5E3M A;  2JA7 J;  1V3F A;  4NC7 A;  2JSC A;  1FZP B;  3S3M A;  1TNS A;  1M1E B;  1NG6 A;  1RR8 C;  4H4K C;  4LIT A;  5F0H A;  2EFQ A;  1A5J A;  1JUS A;  2XAH A;  5F1R A;  2HXO A;  2UXX A;  3QKX A;  2OTJ I;  2BHY A;  3OYE A;  1I27 A;  4IRI A;  5AON A;  2DT6 A;  1QPM A;  3HTS B;  1X4P A;  2DI3 A;  3PSI A;  5TRD A;  4EJT A;  3D5L A;  2P4W A;  4EM2 A;  1KYW A;  2CMP A;  4UVC A;  3H5A A;  3KZI C;  2OTL I;  2NNN A;  3OL4 A;  4ME9 A;  3G1O A;  3TMO A;  4ESJ A;  1ZG5 A;  2V1N A;  1ZEL A;  3KEQ A;  2FNP A;  4JYK A;  2VN2 A;  2OJE D;  3COA C;  1D3Y A;  5JFR A;  1X2N A;  2ZXW H;  3NXC A;  3BG3 A;  2DFF A;  3GCM A;  3GTQ J;  1SEU A;  2PJR A;  2XF5 A;  5HS9 A;  1B4A A;  5F0F A;  1WJA A;  1T95 A;  1UZC A;  1XSX A;  1U5T A;  3PNV A;  1T6S A;  3ANP A;  1YQA A;  2EIM H;  2FOK A;  4RBO A;  2YVX A;  2XAQ A;  2WAQ A;  1YJ9 I;  1VQK I;  4PJN A;  1PJR A;  5FHP A;  3QYF A;  4HX4 A;  3VSL A;  4ABZ A;  2KJB A; 
#chains in the Genus database with same CATH homology
 3HOV J;  2QCO A;  3TP3 A;  2PBX A;  4LOC A;  1MNM C;  3GTP J;  5IYB J;  3W6V A;  3ON2 A;  4M3E A;  1VF9 A;  1Z77 A;  2WV1 A;  4J19 A;  3GTO J;  4D5C A;  4UUS B;  2JA5 J;  2E19 A;  3QPL A;  4MK6 A;  4A3D J;  1T56 A;  3ZQH A;  1IDY A;  3COL A;  2DA2 A;  2UXP A;  1ORK A;  3JR9 A;  1HF0 A;  5C4X J;  5D19 A;  2R93 J;  3CWR A;  5J3L A;  3HOX J;  2YVE A;  3QBM A;  4BBR J;  2CJJ A;  2FD5 A;  1X58 A;  3K7A J;  4XK4 A;  3ZQC A;  3BQY A;  3LHQ A;  2FJ1 A;  2X6O A;  4DZJ A;  3HTH A;  2GLO A;  2XPU A;  4NEL A;  2E2I J;  1I3Q J;  1RPW A;  3F1B A;  3UKG A;  3V6G A;  3S15 J;  2OF7 A;  1JJ8 C;  1JGG A;  4XRS A;  2HOT A;  1UI5 A;  2JWT A;  1GUU A;  5CXG A;  2JA6 J;  1MBH A;  1RET A;  3RZD J;  4GCK A;  1HOM A;  1POG A;  2L0K A;  1R9T J;  3VVZ A;  3OOU A;  1B72 B;  3TW7 A;  1ETO A;  2DA6 A;  3WHB A;  3H3V K;  4EEF G;  1NK3 P;  2XPV A;  3Q0V A;  1MSF C;  3ZOB A;  3BG5 A;  5HSZ A;  1XS9 A;  3RD3 A;  3FRQ A;  2L7M P;  5F27 A;  2E2J J;  3S16 J;  4AC6 A;  3BTJ A;  2UXH A;  2PMZ N;  3TED A;  1WH7 A;  3QQA A;  4C2M J;  2E2H J;  3A01 B;  2G0E A;  3KZ9 A;  2HI3 A;  4I6Z A;  2N8G A;  4A3L J;  3DPJ A;  4MIM A;  1VFC A;  4AYB N;  3F0C A;  3G1M A;  1FTT A;  3LSR A;  3VW1 A;  2DTZ A;  2NP5 A;  3VOX A;  3JRF A;  2UXO A;  3TP0 A;  1XC5 A;  5IP6 A;  2REK A;  2QWT A;  4FE7 A;  1MBG A;  3SDG A;  2R92 J;  2HYT A;  2ZOZ A;  3BCG A;  3HE0 A;  4XIC A;  3S5R A;  4XRM A;  1ZKG A;  2EZL A;  2ZCX A;  4JP0 A;  2LFB A;  2CU7 A;  3BG9 A;  3NAU A;  4AC0 A;  1BW5 A;  3FKI J;  3CDL A;  3ZQI A;  4G12 A;  2K40 A;  1JKO C;  5E3O A;  4KWA A;  2DMQ A;  1BJZ A;  4FE4 A;  2H8R A;  3HTA A;  5FKK A;  2NS8 A;  5BNG A;  4GFL A;  2EZI A;  1FIA A;  3M4O J;  3CJD A;  4XRS G;  2P81 A;  1FJL A;  3CCY A;  1IUF A;  1K83 J;  1MBE A;  1U9N A;  2NVY J;  2KDZ A;  2WGB A;  2NVQ J;  4A69 C;  1SGM A;  5M5W J;  3JRE A;  1T33 A;  3OIO A;  1ETV A;  1ENH A;  2EQR A;  2HQ5 A;  4A3K J;  1DU6 A;  1W0T A;  2VUM J;  2V57 A;  1D5Y A;  1IJW C;  3IH4 A;  5C3E J;  1HCR A;  3EUP A;  3HBL A;  3D1N I;  3IUV A;  4D7N A;  3BTL A;  4C3H J;  3G7R A;  5F04 A;  1RR7 A;  2X9D A;  1JKR C;  1FTZ A;  3V78 A;  1OCP A;  2XPW A;  2TCT A;  3GTM J;  3PAS A;  3PO2 J;  4A3F J;  4FCY A;  4UDS A;  5FKO A;  3P9T A;  2IAI A;  1ETW A;  2ZCM A;  1TWF J;  3PO3 J;  3GEU A;  2K9N A;  2D5V A;  3ON4 A;  2VKE A;  1MBF A;  5FMP A;  4IHV A;  1JJ6 C;  3A03 A;  3I4M J;  3NAR A;  4CYC B;  4B3A A;  1HDP A;  2FX0 A;  4X1E A;  2Y9Z A;  2JA8 J;  3LNQ A;  3NRG A;  3B6A A;  3M3Y J;  5E3N A;  4GCL A;  4BKX A;  3NNR A;  3O60 A;  4A3M J;  2CUE A;  5EZG A;  1OJL A;  3IH3 A;  2K9S A;  3BR5 A;  5K58 A;  3BTC A;  2M9H A;  3I4N J;  4NDL A;  2DN0 A;  1UI6 A;  3JRH A;  5EGO A;  2NS7 A;  3Q0W A;  2WAQ N;  3C2B A;  3FIW A;  2AHQ A;  3PM1 A;  1PUF A;  1ZTR A;  3SJM A;  3G1L A;  5HAW A;  4A3B J;  5FLM J;  3L1P A;  2MG4 A;  3MVP A;  5CW8 A;  3BR0 A;  1GDT A;  5IYC J;  1IG7 A;  1UG2 A;  4MFD A;  1E3O C;  3HGY A;  2OER A;  1O4X A;  3VUQ A;  2R5Z A;  2WB1 N;  5EYR A;  5EFY A;  1TWC J;  4D7M A;  3G56 A;  2UXU A;  5HBU A;  2FQ4 A;  2R7Z J;  2DA4 A;  2COB A;  2HKU A;  1GVD A;  3GBG A;  2YS9 A;  4D5F A;  5IYD J;  2ELK A;  3B81 A;  2LP0 A;  5D18 A;  1A6I A;  4C3J J;  3IV5 A;  4MFE A;  2W48 A;  1UHS A;  3KKD A;  3MNL A;  3T6N A;  1W0U A;  2XB0 X;  2DA7 A;  3A02 A;  2ZOY A;  1FEX A;  2OI8 A;  1RKW A;  4B4C A;  5IPA A;  2ME0 A;  2Y0S N;  2L9R A;  2XDN A;  3BR2 A;  3KKC A;  1U8B A;  2IBD A;  1WI3 A;  2HOA A;  3BTI A;  2ECB A;  4B1R A;  3BHQ A;  1DU0 A;  2GFN A;  3RZO J;  5GP9 A;  4A3E J;  5DAJ A;  2DG8 A;  3DCF A;  1ETX A;  4IHW A;  4GFB A;  2E1O A;  2M8G X;  5EGO B;  2WUI A;  5GPA A;  9ANT A;  4M3D A;  1PUF B;  2ID6 A;  2M2E A;  2QF7 A;  4V2F A;  2YUS A;  2ME6 A;  4IEJ A;  4HNV A;  2L7Z A;  4W97 A;  1VI0 A;  2XGE A;  4W1U A;  2LKX A;  2H1K A;  4BXX J;  3HIM A;  3HM5 A;  1H88 C;  2F07 A;  2OPT A;  1JT6 A;  4A93 J;  2MGQ A;  2K9Q A;  1MSE C;  2HDD A;  4V2G A;  2GM4 A;  2VPR A;  5M3F J;  3BT9 A;  4QTR A;  4RDU A;  1H89 C;  3JRA A;  2R0Q C;  1QVT A;  4IHX A;  3AQT A;  1GV2 A;  4DW6 A;  3RKQ A;  3RQI A;  2G7G A;  3WHC A;  1ZK8 A;  1Y1V J;  3ANG A;  4JL3 A;  1ETQ A;  2Y31 A;  2O7O A;  4Y7N J;  3VW2 A;  1BL0 A;  1X2M A;  3HOY J;  2DA3 A;  2QTQ A;  5CXI A;  5D1R A;  1LFU P;  1OFC X;  2GUH A;  3JRB A;  2YVH A;  1F36 A;  3CQZ J;  3LOC A;  2NP3 A;  2M0C A;  1YRN A;  2DMU A;  2DMP A;  2RHA A;  2ZCN A;  5F08 A;  3AQS A;  1SAN A;  2ID3 A;  3FK6 A;  5FJ8 J;  4PXI A;  2G7L A;  3CRJ A;  4NN1 A;  1P7I A;  1FIP A;  4ICH A;  2G3B A;  2VKV A;  5IP7 J;  1H8A C;  3OSF A;  3HOU J;  4A3G J;  4C3I J;  2O9L A;  2YU9 J;  1B8I A;  1WCM J;  2W53 A;  2HYJ A;  5C4J J;  2CQX A;  2XRL A;  5J1R A;  2MSY A;  4UUS A;  1IGN A;  3CMY A;  1VND A;  5JLX A;  2JJ7 A;  1I6H J;  2XGD A;  2CRG A;  4AF5 A;  4L62 A;  1RKT A;  1LFB A;  3LWJ A;  4M6V A;  2ZB9 A;  3BJB A;  5AQC A;  3LJL A;  2LK2 A;  3HKZ N;  3ZQG A;  1BA5 A;  3EGQ A;  5IOY A;  3HGG A;  4DYR A;  4JNN A;  2R5Y A;  3BR3 A;  3VIB A;  2Y9Y A;  2LY9 A;  5J1Y A;  2MW8 A;  3JRD A;  4BY7 J;  3S1R J;  4BBS J;  1ETY A;  3NI7 A;  1U9O A;  4GCT A;  1YRN B;  1RES A;  3MKL A;  4JX4 A;  3VVY A;  2PZ9 A;  1IV6 A;  2Q24 A;  2EZH A;  3GZI A;  2FBQ A;  2JK3 A;  5EF6 A;  5HOD A;  1Y1W J;  3S1N J;  3DEW A;  5M3M J;  3O8G A;  1JTY A;  5F0C A;  4L5E A;  1MBJ A;  1JUM A;  2X48 A;  3S14 J;  2LLK A;  2HXI A;  1AKH A;  1ETK A;  3C07 A;  5K7F A;  3JRC A;  3ZQL A;  4UUT A;  1B8I B;  3FIS A;  1IDZ A;  2DMT A;  3HDD A;  1JT0 A;  1TWG J;  3VPR A;  5IP9 J;  3E7L A;  3A01 A;  2NOG A;  2NX4 A;  2NVT J;  1P7J A;  3JSJ A;  1QVU A;  1G2H A;  2RAS A;  2GBY A;  1AHD P;  5EEA A;  2HOS A;  4M3B A;  2QIB A;  1ZR2 A;  5EDN A;  1MH4 A;  3HOZ J;  3BR1 A;  1JKP C;  2GEN A;  3VW0 A;  2VI6 A;  1MBK A;  1QRY A;  2IEK A;  5J1U A;  5M5X J;  3RH2 A;  4GFK A;  2R5Y B;  1LE8 A;  5C44 J;  5IOZ A;  4JX6 A;  5F1J A;  3BRU A;  2Y30 A;  3MN2 A;  1TWH J;  4M3F A;  4BY1 J;  2L7F P;  5FKN A;  5H9T A;  2I10 A;  1Z0X A;  1SFO J;  5E3L A;  3O8H A;  2DJN A;  3BR6 A;  1QPI A;  3GTG J;  4A3J J;  4MXM A;  3E7Q A;  4FTH A;  4HKU A;  4A3C J;  3Q3S A;  5DS9 A;  2XB5 A;  1HDD C;  4ACI A;  2M34 A;  1AKH B;  3LSG A;  2XGC A;  1JKQ C;  2EH3 A;  4QIW N;  1AU7 A;  3BNI A;  4X6A J;  4A3I J;  3LSJ A;  5EG0 A;  2R5Z B;  4IHY A;  2DA1 A;  2KT0 A;  2ECC A;  1K61 A;  3GTK J;  3S2D J;  4AUX A;  2O7T A;  2LD5 A;  2D6Y A;  4DZP A;  1XG1 A;  3HOW J;  5FKM A;  1WH5 A;  1IC8 A;  3S17 J;  4XID A;  1UMQ A;  2NVX J;  3OSG A;  2DG7 A;  2CUF A;  2LTP A;  4FIS A;  1JTX A;  1S7E A;  1NK2 P;  2XSD C;  3GTL J;  4MLO A;  3JRG A;  3VOK A;  4DYC A;  1EF4 A;  3B6C A;  2DMN A;  3GTJ J;  1LE8 B;  5FGL A;  3SFI A;  1ZQ3 P;  1ITY A;  4JKZ A;  5JLW A;  3LSP A;  1WGX A;  2Y2Z A;  5E3M A;  2JA7 J;  5M5Y J;  2CQQ A;  1NTC A;  5F0H A;  3HB9 A;  1A5J A;  1JUS A;  3S2H J;  3QKX A;  2HXO A;  4CYC A;  3JRI A;  3HEF A;  5EZH A;  4QSH A;  3VVX A;  2B63 J;  3BQZ A;  2G7S A;  2EBI A;  3HTJ A;  3NPI A;  1OCT C;  4JX5 A;  5C4Y A;  3S1M J;  1TC3 C;  3FK7 A;  2UXI A;  3KNW A;  5EG0 B;  2EZK A;  1HLV A;  3HTI A;  3TW6 A;  2QOP A;  3IH2 A;  1GV5 A;  3ZQF A;  4ME9 A;  2TRT A;  1BW6 A;  3G1O A;  1U78 A;  2QKO A;  2DA5 A;  1GT0 C;  2LVS A;  3S1Q J;  4JYK A;  1TWA J;  5GPC A;  3Q0U A;  4I76 A;  1I50 J;  1X2N A;  5FLV A;  1WPK A;  4M3G A;  2AO9 A;  3NXC A;  2JN6 A;  3BG3 A;  2IU5 A;  4YZE A;  3GTQ J;  3QPS A;  2JMW A;  1IRZ A;  2RAE A;  3K2A A;  1CQT A;  5F0F A;  3VP5 A;  5K7Z A;  4MO7 A;  2O8K A;  3H0G J;  1F43 A;  4S0H B;  1MH3 A;  3PPB A;  3ANP A;  1Q1V A;  1ZR4 A;  4RBO A;  4CGR A;  5FKL A;  1ZGW A;  2LR8 A;  1APL C;  5K7H A;  4DYQ A;  5FHP A;  4ABZ A;  4Y52 J;  1B72 A;  1JUP A;  5DTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...