3QPLA

G106w mutant of ethr from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTWINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Structural activation of the transcriptional repressor EthR from Mycobacterium tuberculosis by single amino acid change mimicking natural and synthetic ligands.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qplA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qplA02
3QQAA 4A3DJ 3VOKA 2QTQA 1ETXA 5HAWA 1U8BA 5C3EJ 3OIOA 3V78A 1WH7A 5IYDJ 3PO2J 1NK3P 2W53A 2K9QA 5EF6A 1RR7A 5K7ZA 2Y9ZA 3JRAA 1YRNA 1NK2P 2CJJA 4C3IJ 1DU0A 1RPWA 2CU7A 4YZEA 4PXIA 3A02A 4JKZA 2R5ZB 3SJMA 4X1EA 2LY9A 2M8GX 4AYBN 1AU7A 4RBOA 2ID6A 2DA7A 2TRTA 2JA6J 2R5ZA 3RKQA 1GV2A 2E19A 4A3EJ 2DA2A 3JRDA 2P81A 3A01B 5F08A 1JUPA 3ZQFA 3COLA 3EUPA 4D5FA 5FGLA 3Q0WA 1ETYA 3BT9A 1ZR2A 3LHQA 4IHXA 2CQQA 3A01A 5C4JJ 3MVPA 1WPKA 3S16J 2NS8A 4FCYA 1JKOC 3M4OJ 3ANPA 5D1RA 3HGYA 5EZGA 1P7IA 1Y1VJ 2OPTA 5HODA 3L1PA 3GTQJ 2Y0SN 3G7RA 3P9TA 2KDZA 2JK3A 3CJDA 4XICA 3HM5A 4DYCA 2GLOA 3I4MJ 4BXXJ 5D18A 2M2EA 2ZB9A 2DA3A 2DG7A 1SFOJ 1WCMJ 1GUUA 3BQZA 2EH3A 4HNVA 3O8HA 4V2FA 3HTJA 2XPUA 4DZPA 2X6OA 3ZQLA 1H8AC 3QBMA 3O8GA 5CW8A 5J1RA 1BL0A 3VW1A 2DA1A 1IDYA 5F0HA 2PMZN 1FJLA 2O7OA 1SGMA 2G7GA 1WGXA 3AQTA 5FHPA 2TCTA 1BW6A 2NVXJ 2XDNA 2XB0X 2X9DA 4IEJA 3LSPA 1LE8B 5C4YA 3G1OA 2EZHA 1RETA 3I4NJ 2WAQN 2IU5A 5M5YJ 4ME9A 4ABZA 3H3VK 3BR1A 5H9TA 2LLKA 4MFDA 3JRCA 3QPLA 2DMTA 1GT0C 1OCTC 3ZQGA 1ZGWA 1MNMC 1ETQA 5F27A 4UUSB 1LFUP 2D5VA 1G2HA 3BR6A 4GFBA 2K40A 1JUSA 1IV6A 1JTXA 4IHYA 1GVDA 2CUEA 1HDDC 3KKCA 3CDLA 3ZOBA 2E2HJ 3S15J 5F04A 2NX4A 4L62A 1ENHA 2MGQA 3G1LA 2RAEA 1JT0A 3NNRA 1B72B 5K7FA 5IP7J 1EF4A 2Y30A 4MO7A 3WHCA 4S0HB 3DEWA 2I10A 3IV5A 1B72A 1W0TA 4L5EA 3BG3A 4Y7NJ 1Q1VA 5EGOB 3RZDJ 1TC3C 2K9SA 3G56A 3TW7A 1K83J 1MSEC 3VUQA 5IP6A 3JR9A 2DMQA 3EGQA 5EGOA 1H88C 3LWJA 2LVSA 2OERA 5FKOA 4NN1A 2DJNA 5EDNA 1P7JA 3QKXA 1IG7A 3HOVJ 5EYRA 1ETVA 1JUMA 2FD5A 3C07A 1XS9A 3S14J 4QSHA 1B8IA 4AUXA 1TWGJ 3OSFA 4V2GA 1IRZA 1ZKGA 5F1JA 2YS9A 2QIBA 2Y2ZA 2O7TA 2IAIA 2HOSA 2UXUA 2DG8A 3FK6A 5M3FJ 2ELKA 3K2AA 1GDTA 5IP9J 3JRGA 3K7AJ 3GTLJ 5IPAA 1JTYA 3CMYA 1R9TJ 2DA4A 3G1MA 2H8RA 1VNDA 2X48A 2F07A 3S2DJ 1QPIA 3IH3A 1VF9A 2FX0A 2O9LA 2PBXA 3LSRA 2XPWA 2CRGA 4A3MJ 1W0UA 2XPVA 3RQIA 2E2JJ 4BY1J 3JSJA 4BY7J 2HXIA 1JJ6C 5FJ8J 3VIBA 4JX4A 2ECBA 3GTPJ 1MBKA 2G7LA 3CCYA 2CQXA 3SDGA 2VUMJ 2ZOZA 4JNNA 1S7EA 1ZR4A 3HGGA 2HYJA 2XRLA 1I50J 5IYBJ 2AO9A 3H0GJ 4MFEA 4BBSJ 4UDSA 2WUIA 4W97A 3IUVA 4JX6A 4JP0A 1JKQC 2LP0A 2UXPA 3TP0A 3W6VA 2HKUA 4W1UA 3PPBA 3UKGA 4MIMA 3FKIJ 4DYRA 3F0CA 2FBQA 2N8GA 3V6GA 3BR0A 2M0CA 2HDDA 2DTZA 5FLMJ 3HOUJ 3B6AA 1D5YA 5AQCA 5FKKA 3ZQCA 2NP5A 3BG9A 5E3MA 1I6HJ 2LR8A 4A3CJ 1H89C 3HTAA 3GZIA 2ECCA 2MSYA 1JJ8C 2L7MP 4B3AA 4B4CA 2NOGA 4CYCB 3A03A 3KKDA 4GCLA 2L7ZA 1VI0A 1MBJA 3IH4A 1MH3A 4CYCA 5F0FA 2GFNA 3GEUA 2EQRA 2KT0A 1DU6A 4ICHA 3RZOJ 3LSJA 2JWTA 2PZ9A 1A6IA 4D7MA 3CRJA 1JT6A 2ME6A 1BW5A 3D1NI 4RDUA 3TEDA 5M5WJ 2G0EA 2O8KA 1T56A 2QOPA 3T6NA 2JA8J 2DMPA 5FKMA 5M5XJ 2NS7A 3S17J 1HOMA 3NPIA 1QRYA 3BTLA 3VPRA 5EEAA 3QPSA 2R7ZJ 4XIDA 2GUHA 1LE8A 2QF7A 3VVZA 4MK6A 2OI8A 1GV5A 4M3GA 2EZLA 1WH5A 4XRMA 2LTPA 5DAJA 3GTKJ 1U9OA 2EZKA 2Y31A 3HOZJ 4QTRA 1OCPA 3KZ9A 1HDPA 4A3IJ 3M3YJ 1ZK8A 3PASA 2B63J 4UUSA 4A3GJ 1QVTA 3FRQA 2GBYA 1ETWA 4DW6A 1Z77A 4QIWN 2ZCMA 5IOYA 2E2IJ 3ON4A 1XC5A 1T33A 5EG0B 4KWAA 1AHDP 4GCKA 4C3JJ 2NVQJ 4XRSA 4A3JJ 5C4XJ 2YUSA 2JMWA 2CUFA 1APLC 1Z0XA 1FTTA 1U78A 4JYKA 1RESA 2V57A 3BR5A 2XGEA 3BHQA 3IH2A 4I6ZA 3LJLA 5E3LA 1WI3A 3ZQIA 3NXCA 2RHAA 3VOXA 3GBGA 4GFLA 1NTCA 4A3BJ 1UMQA 5J1UA 4C3HJ 5K7HA 1ITYA 3KNWA 4FE7A 3BR2A 1QVUA 2E1OA 1HF0A 1MSFC 2IBDA 3BTIA 3AQSA 3MKLA 2HQ5A 1JKRC 2K9NA 1JGGA 4XK4A 2WV1A 2EZIA 3C2BA 4D5CA 3HTIA 4I76A 4GCTA 2G3BA 3HTHA 3HIMA 2LKXA 3B81A 2XSDC 3DCFA 4A3LJ 1RKWA 5HBUA 3NAUA 2MW8A 1IC8A 1HCRA 1POGA 3Q3SA 1F36A 1IJWC 4DYQA 1Y1WJ 3Q0UA 1VFCA 3GTGJ 5DS9A 3MNLA 4NDLA 1RKTA 2JA5J 2VPRA 2EBIA 2IEKA 2DA5A 3S1NJ 3ON2A 3VP5A 1YRNB 5JLXA 2M34A 5EZHA 4IHVA 5JLWA 1ZQ3P 1PUFB 1ORKA 3Q0VA 1TWCJ 3GTJJ 2VKVA 2GENA 2ZCNA 4NELA 2YVEA 4XRSG 1I3QJ 1MBEA 3BTCA 4J19A 1K61A 2JA7J 1PUFA 1IDZA 3PM1A 4D7NA 5E3NA 1A5JA 3NRGA 1X2NA 5D19A 1O4XA 1IUFA 3HB9A 4G12A 3S1RJ 1FTZA 2UXIA 2NVYJ 2Y9YA 1OFCX 3WHBA 1LFBA 3BQYA 4DZJA 4GFKA 4MXMA 2NP3A 1XG1A 3HBLA 5FKNA 1CQTA 4FTHA 1ZTRA 3JRHA 3FIWA 4AF5A 1MBHA 1BJZA 3BRUA 3OSGA 4IHWA 2L9RA 5M3MJ 2R92J 2MG4A 4M3BA 3JRBA 1TWAJ 3GTMJ 2HYTA 5GP9A 4M6VA 2FJ1A 2L0KA 2JN6A 1FEXA 3OOUA 3TW6A 3VW0A 1JKPC 2L7FP 2DN0A 5GPAA 4ACIA 3HDDA 4BKXA 2REKA 2GM4A 4MLOA 4EEFG 1MH4A 3HOWJ 3F1BA 5K58A 5FMPA 5IYCJ 3MN2A 4C2MJ 2YVHA 5J1YA 2JJ7A 2HOAA 2WB1N 2G7SA 3DPJA 2QKOA 4JL3A 2VKEA 3FK7A 1ETKA 2WGBA 5IOZA 2LD5A 2DMUA 3VVYA 2COBA 2ZOYA 2HI3A 4HKUA 4BBRJ 1UI6A 3LOCA 1OJLA 3S1MJ 3GTOJ 1MBGA 5C44J 4UUTA 3LNQA 2RASA 4FISA 2FQ4A 2OF7A 4A3FJ 3HE0A 2R93J 2DA6A 3LSGA 5FKLA 2XGDA 2UXOA 3NI7A 1FIAA 3PO3J 3RD3A 4A3KJ 2QCOA 1IGNA 1HLVA 3BCGA 5HSZA 4LOCA 2R5YB 5DTDA 3S5RA 5EG0A 1BA5A 5EFYA 2ID3A 3E7QA 4A93J 3E7LA 3B6CA 1UG2A 3HOYJ 3BG5A 2R5YA 3HKZN 3BJBA 3ZQHA 2DMNA 1SANA 2VI6A 1UI5A 5CXIA 2D6YA 1ETOA 3BNIA 3CWRA 3VW2A 1TWHJ 3JREA 3S2HJ 3ANGA 2UXHA 2HXOA 5FLVA 9ANTA 1AKHB 4Y52J 3NARA 4AC6A 5F0CA 2M9HA 1TWFJ 3JRIA 3RH2A 4JX5A 4A69C 3S1QJ 1U9NA 3SFIA 3O60A 3CQZJ 1X2MA 4B1RA 2R0QC 3TP3A 1AKHA 5CXGA 2YU9J 3HOXJ 3VVXA 4CGRA 1UHSA 5GPCA 2XGCA 3FISA 1F43A 1X58A 2W48A 2HOTA 2Q24A 5BNGA 5E3OA 4AC0A 1E3OC 4X6AJ 1MBFA 2H1KA 4FE4A 5J3LA 2LFBA 4M3DA 3BR3A 3HEFA 2QWTA 2ZCXA 2NVTJ 4M3EA 2AHQA 1B8IB 3JRFA 2ME0A 2LK2A 4M3FA 2XB5A 1FIPA 3BTJA
chains in the Genus database with same CATH superfamily
4A3DJ 3VOKA 2GOXB 4C2TA 1Z7LA 1ETXA 1IAWA 4EV0A 4WIBA 1R23A 3CCMI 3SEZA 3OIOA 4PFPA 5KAFC 1X3WB 1SC7A 2L7KA 2K9LA 3TO6A 5K7ZA 4E7HA 2E34A 4OU0A 2CJJA 3L2UA 3DEUA 1DU0A 1RPWA 2PI0A 4YZEA 4PXIA 3E5XA 4BDYA 4JKZA 2R5ZB 5B1BH 3ERMA 3FHNA 2M8GX 1C0WA 4RBOA 2MBFA 4J00A 3EUAA 5E8GA 2P5LC 2R5ZA 1YW9A 3RKQA 1K79A 3KYLA 1ONVA 1W36D 1OYYA 3JRDA 4LB5A 5F08A 4U9NA 5FGLA 4D5FA 3Q0WA 3G2BA 3AAFA 1KGSA 1N78A 5FRNA 3LHQA 4HYEA 2V9VA 3I64A 3HYIA 5E79C 2L9NA 1JI8A 3MZ8A 5C4JJ 1HW5A 2ZNYA 1WPKA 3CCJI 1I1SA 5ILUA 2NS8A 3EQLF 2CQNA 3F8MA 1SFUA 2XF7A 4X0GA 3QP5A 4KA4A 1WWXA 2OPTA 3FBIB 3FXUA 4EM1A 4XL9A 2MFZA 5AONA 5GTIC 3G7RA 2CW7A 4HDVA 4M9ZA 1A35A 3CJDA 3HM5A 2GLOA 3I4MJ 4BXXJ 2X1CA 4N4NB 1SAXA 3I53A 4OAZA 2DG7A 1GUUA 2IRFG 2V1UA 2P5VA 3PIPF 2HFHA 4V2FA 3SZPA 4Y15A 3CUOA 1H8AC 3IWFA 5J1RA 2UUZA 3RQ4A 4L18B 3MKYB 3VW1A 4NUBA 3CO7C 1FJLA 1TLHB 4UV9A 2MLKA 1SGMA 1V5FA 1WGXA 3HUGA 5K5OA 1Z6TA 2OZUA 3DPUA 2NS0A 5FHPA 2TCTA 2JT1A 1T2KA 1Y0UA 1DPRA 2WWYA 4LK1F 3RSNA 1J5YA 4H4KC 1XGOA 1OISA 5H6QA 2FOWA 3G1OA 2K9MA 5CYVA 3I4NJ 1D0ZA 4XONA 3WGGA 2W85A 4DVYP 3J7ZI 1DUXC 5H9TA 3F6OA 1Z9CA 5E18F 1HW1A 3E3VA 2A6EF 1ODDA 3QPLA 1EH7A 1G2HA 4UUSB 3D5SC 3OIQA 4BL0B 3BR6A 3FXJA 2K40A 1JUSA 1JTXA 2WV0A 3DEEA 4PFOA 1GVDA 1HDDC 2V6CA 1H9GA 3S15J 5FO5A 2PMUA 1OYIA 5F04A 3KP4A 5LBQA 1ENHA 4CDGA 1YX3A 5A2QZ 1TL8A 2A5WA 1SVLA 3SXYA 2FOKA 5CJ9A 3OYEA 4I01A 5IP7J 4MO7A 2CYYA 4KISA 3VYTB 2GZWA 3ZPLA 2DU9A 4M74A 3RZDJ 5EGOB 3HJEA 2B7EA 3DU5A 1RUOA 5DD4A 2QLZA 3MKWB 3VUQA 2FXAA 2DMQA 2EJRA 5EGOA 4M6XA 4NQWB 5FKOA 1F4KA 3PFIA 1P2FA 5KHDA 1YW7A 3QKXA 2O03A 2J5OA 1G3WA 4RS8A 4NQWA 2RC4A 4AWXB 5EYRA 1ETVA 1LEAA 2BV6A 2FD5A 2P7CB 3PUFA 5DUIA 3E6MA 2HWVA 1TWGJ 1V54H 1IRZA 5F1JA 2O7TA 2UXUA 2DG8A 1QBJA 3FK6A 5M3FJ 4CCKA 4KN4X 2EV0A 2W00A 3GTLJ 4QWQA 3FWEA 2BBYA 2EILH 3K4KA 2DA4A 3G1MA 1H0MA 2Y0MA 2XROA 2X48A 4HQMA 3IH3A 1TT0A 3LSRA 1X1DA 2YX7A 4BY1J 4PZJA 3F8NA 4HV5A 4BY7J 4MTEA 5FJ8J 3OYAA 3CESA 3ZQ7A 3CCYA 2CQXA 3FXOA 4BS9A 2VUMJ 4JNNA 1Y39A 4G7HF 1I50J 3KP3A 1IN8A 4Q4ZF 1WFXA 2LSOA 4LD5A 2H6CA 2DPUA 2DDAA 4BBSJ 4W97A 3IUVA 4JX6A 1YJNI 4JP0A 5KVRA 4W1UA 1I3AA 5H6RA 4MIMA 3FKIJ 4FHTA 3GO5A 2XVCA 2FBQA 4PK4A 3CCSI 4UB8C 5BOXA 1SFEA 2M0CA 2DTZA 3OS2A 1TZLA 3RPUA 5ILVA 4O5VA 2MC3A 4U7DA 3HRSA 5AQCA 1TNTA 3BCAA 5FKKA 1S7AA 3CCLI 2Z99A 3H9GA 3ZQCA 3BG9A 1D8JA 4G8XA 4NC6A 1H89C 3ABUA 4RB3C 5FRMA 1BR4A 2VODA 3HTAA 4N9IA 3MKZA 4XM3A 3MQ0A 5ICFA 4B3AA 4IHSA 2OU2A 2WADA 3I58A 2VLAA 3KKDA 3F21A 3ZXSA 2FBIA 3RI4A 2EFPA 4M9SA 2PX9A 2GFNA 3W2WA 3CD6I 3GEUA 2XC7A 4ICHA 3RZOJ 3LSJA 1UHWA 4QPQA 3L7WA 4RDUA 3TEDA 1RIOH 5M5WJ 4O3MA 2ZSHB 1RRJA 2KIMA 3IKVA 2RKHA 2NS7A 3HSRA 3P9IA 1YJ9I 3NPIA 1QRYA 3BTLA 4XIDA 1TNSA 2QQ9A 4HLYA 4HA8A 4AVZA 4HF2A 1QGPA 4AD9A 3GWZA 1GV5A 2M1BA 2DFEA 1ACIA 2GIVA 2UXNA 4OIOF 2PMZA 3KP6A 1QHGA 3NEUA 1FP1D 3QYEA 3J81K 1G3TA 2EZKA 1HSJA 3GTKJ 3HOZJ 1KONA 1BJAA 1HDPA 4A3IJ 1R5ID 3LSIA 4IOAF 4XLHA 1V4RA 1R71A 1Z77A 3V8KA 2DXIA 2ZCMA 4WK8F 2V6EA 1XC5A 2W84A 2BGCA 4KWAA 4EGZA 3R60A 3ECOA 5C4XJ 4GCKA 3P9KA 2JMWA 4ZDOA 2NNYA 1Z0XA 3EDPA 3I56I 1WSUA 1W4MA 3BR5A 2M30A 4R1HA 2XGEA 3C2GA 3SEQA 3SZTA 5KAIC 3RIRA 3KEOA 1WI3A 3M7GA 1R36A 4WXCA 5E3LA 3ZMDA 5HNHA 2HVRA 2RHAA 3NXCA 3TO9A 2A69F 3VOXA 2HOEA 2WC2A 1NTCA 3GFMA 4XKVA 4C3HJ 1QO0D 1ITYA 3EUKL 3JSPA 3WTWC 3JAMK 1MSFC 1D1BA 4RAGA 4ZTJA 2EK5A 4KMUX 4LLLA 3BTIA 1WJAA 3AQSA 3BZCA 4HQEA 1BI0A 2KLOA 2F4MB 5LRSA 2Z5UA 2R7RA 3HIMA 1PJRA 3L9FA 5D6FA 2FBKA 3DCFA 1RKWA 3UNGC 5HBUA 3VB2A 1HCRA 1NG6A 1XMAA 4DYQA 1Y1WJ 2ZCWA 4ESBA 3WU1B 2LH9A 3P7NA 3CMEI 1ZARA 1QA6A 2CWEA 2M3AA 1QNTA 2XAFA 1XX5A 4G7ZF 3K1NA 1YIOA 2BYVE 3BP8A 2NXNB 4N4OB 4BHPA 2O6GE 1YTYA 5E1ZB 2VBZA 1ORKA 5CPRB 5JVTA 3SQNA 2IA1A 4GDFA 2ZCNA 5DUKA 2BOLA 5K5QA 2KRFA 2JA7J 1A36A 2ELJA 1FPQA 3O3KA 3PSIA 3PM1A 2IA2A 5DEQA 5E3NA 1EJ9A 3CJRB 3KZZA 3GFJA 1A5JA 3PJRA 3NRGA 2VIXA 4J01A 2W24A 5D19A 1KZHA 3WTSC 3QWLA 4G12A 3S1RJ 2UXIA 2V9PA 4BYYA 5K1YA 2Y9YA 3K0LA 1YW8A 2RVCA 2EFNA 4GYIA 5EEHA 4DZJA 2NP3A 5FKNA 3I5UA 3HC7A 4XR6A 1ZTRA 3JRHA 5FB2A 3GLLA 3FIWA 3LAPA 2CV0A 4IQJA 3ELKA 3VYRB 4FQGA 5LGNA 3BRUA 4F7ZA 2Z9OA 4K2EA 2MG4A 4M3BA 4AIJA 5HOOA 1TWAJ 3S3MA 5CVUA 4KYWA 3GTMJ 1YX5A 3BY6A 4M6VA 3G6EI 2FJ1A 4ZYEA 5BPDA 3OOUA 4OMZA 2L7FP 5GPAA 1WJFA 2IS6A 4KT6A 2VQLA 4HSTA 5KNLA 3RKYA 3F8CA 3AG3H 4MLOA 5K58A 3KEYA 3HOWJ 5LLQA 3T8TA 4FX4A 2DPDA 2KL4A 3MN2A 2CG4A 4C2MJ 5J1YA 2CQ7A 5CVJA 4XBFA 4ZZLA 2E7XA 3CUQC 2M4GA 1CGPA 2G7SA 1VQKI 2VKEA 2DK8A 3FK7A 1RZ4A 4WF2A 4UNOA 3KP2A 5IOZA 2LD5A 2DMUA 3VVYA 3NQOA 2CW0F 2DI3A 2COBA 2MABA 5JR3A 5HLGA 2IGNA 2ISYA 4C2UA 4HKUA 3WTUC 2VKDA 2X1DA 1UI6A 1Z3XA 2BXZA 2FMLA 4QPOA 4CA0A 4FISA 2OF7A 1X4OA 4A3FJ 3WG7H 3HE0A 2CSOA 1VQPI 2R93J 4WX9A 3EYIA 3KYCB 2Y48A 2BY1A 5F6FA 2K4BA 3X2QH 2PJRB 3PQKA 2KRCA 1X1PA 2ZFUA 3PO3J 2K5CA 4A3KJ 2QCOA 1HLVA 2M45A 2V1NA 3BJAA 1V5GA 3LFKA 5DTDA 2PJRA 1TQPA 4A93J 3GXOA 3B6CA 3QPTA 3H5NA 3HOYJ 4M9XA 4XLNF 2IA0A 1TTYA 3ZQHA 1ZLKA 3ZN0A 4UV8A 2DMNA 1LDKB 5J47A 1K78B 2D6YA 1O3TA 5JFRA 3K4NA 5DYMA 3I0TA 3CWRA 3VW2A 5ICCA 2A68F 2RNGA 2HXOA 3R4KA 3ZMTA 5FLVA 9ANTA 1AKHB 5JVGF 4Y52J 3SDBA 3NARA 4RGRA 1IN6A 3I71A 5ERIA 2M9HA 2CQKA 3JRIA 3RH2A 2QM3A 4A69C 1U9NA 3H36A 1U2WA 1R7JA 5HS9A 3T8RA 1AKHA 2ICWG 2YU9J 2HZDA 1J9IA 1T0FC 3I3LA 4YIFA 2BVLA 2QBYB 4IRGA 4QLCU 1X58A 2R3SA 2Q24A 4HAMA 2HGCA 4AC0A 2KPMA 3HL2A 1MBFA 4FE4A 3CF5F 3WTXC 3BZKA 4M3DA 1UZCA 2KHMA 3S3NA 4HF1A 4M3FA 5JHUA 4S05A 1FBUA 1V55H 4XLCA 2QTQA 4KNYA 4XQFA 4HSRA 2GXBA 3TDZC 4AM3A 2XAHA 1LQ1A 3LL7A 5B66C 4E4HA 3PO2J 1WJEA 2DW4A 4PGGA 4BUPA 2K9QA 5EF6A 1SD5A 2Y9ZA 5DCFA 1YRNA 1NK2P 2CU7A 2M8EA 4P55A 3A02A 3SJMA 1G59A 1KU7A 2DA7A 4P96A 2VONA 3CO6C 3F9KA 1ON2A 4C9YA 3CCEI 3MZYA 4JBAA 5LD2C 1JGSA 4LIVA 3CMMA 3O6BB 4HZFA 2OV7A 3J7AY 4L5JA 3J80Z 4IXAA 2FA5A 2P5KA 3M4OJ 1KQ0A 3ANPA 3HIFA 1YS6A 1P92A 2Q2EB 3QRFF 4L9VA 4FETA 1H9TA 5EZGA 1P7IA 5HODA 4IQ4A 4CSWA 2JK3A 4XICA 3L2VA 2FNAA 5HS8A 1MMGA 2ZB9A 2DA3A 2PBIA 2D2WA 1BOBA 2EH3A 1OQYA 1G3YA 2Y69H 2ZY9A 3HTJA 1S7OA 2K27A 3ZQLA 4BDZA 1EH6A 4ASNA 3O8GA 4DQ2A 1IV8A 1J7KA 2O5RA 3ABLH 5F0HA 3I4PA 1NG7A 2QKMB 1X4PA 1RC9A 3WTYC 1L0OC 2JRMA 1R22A 4C30A 5CQGA 2NVXJ 2XB0X 4RM2A 2X9DA 2G7HA 4IEJA 3LSPA 1K4SA 3JSOA 1R1VA 1R1TA 4U7BA 3ERED 5IT9K 1BN5A 5C4YA 2RN7A 2WAQN 1S72I 5M5YJ 3GUDA 2LLKA 4IVNA 2IVMA 4RMNA 2CO5A 1IN7A 1GT0C 2DMTA 3P9CA 2VBWA 4XOPA 3ZQGA 5HDKA 5D5WB 1ETQA 1MNMC 2LY1A 1DQUA 1M1EB 4XLAA 4RB0A 3GLXA 4CZZA 2DAOA 1LVKA 1SD4A 3KETA 2NX4A 4L62A 1W7PB 1K6YA 1AWCA 4XOTA 2K02A 1ZG1A 3QU6A 3VSLA 1OYWA 3G1LA 2K86A 3ISPA 2RAEA 3M1CA 6PAXA 2WAQA 3QU3A 1W7PA 1XSXA 3R6SA 2DODA 1JT0A 5K7FA 1B72B 3NNRA 1EF4A 3WHCA 2MD0A 2B1EA 4KIFA 1T98A 1QQIA 2BY3A 4BU2A 3DEWA 1D0XA 1JXSA 1B72A 3W2VA 2HU9A 1TC3C 3G56A 3FXRA 2WBMA 3TW7A 4I99C 5FFXA 1H88C 3H3UA 3LWJA 1JE8A 2OERA 4BJTA 1I39A 1IUYA 1X3UA 2H1LA 2DCEA 3VOEA 4EVIA 3ABMH 2HPMA 1BIBA 5L3DA 2W4SA 3TDUC 4OMYA 4ITVA 2X6WA 2IS1A 1IRXA 1LPQA 4GGGA 1B8IA 4V2GA 1E2XA 1ZKGA 1XDSA 2YS9A 2Y2ZA 1TBXA 1ZRFA 2ELKA 3S32A 1GDTA 1I5ZA 4OD4A 1R9TJ 3H5RA 5E8IA 1FNNA 1QZZA 4G6QA 2AS5F 2H8RA 2HPIA 1VNDA 2QKLB 1T8IA 1Y0NA 3BPXA 2CMPA 4IOCF 1BI3A 2R7UA 4A3MJ 1LEBA 2RREA 4HG2A 1Z67A 2HXIA 1V5EA 1JJ6C 3H9QA 2ECBA 2COMA 1MBKA 2G7LA 1GHCA 2FUG2 2R4GA 3SDGA 2ZOZA 3E1SA 3AL0C 1ZYRF 1KYWA 3HGGA 2BE5F 1R1UA 2P6TA 3FMSA 3JTHA 4CCNA 1MKMA 4KFCA 4UDSA 3DF8A 3H0GJ 3KLOA 4HOBA 2L5QA 4XRFA 2ZKZA 1KA8A 1JKQC 3TP0A 2HQRA 3V7CA 4YEJA 2ADUA 1HKSA 2ZXIA 4KMFA 5DV5A 4U0YA 3G3ZA 1D5YA 1MDMB 3C2HA 2CV2A 1I6HJ 3DTIA 1O57A 2ESNA 2LY2A 3QOEA 1JHFA 2ZMEB 1MDMA 2ELHA 3K6GA 1XSDA 4B4CA 5D4RA 3HOTA 2DK5A 4DBQA 2ZMEA 5LHGA 4Y3OA 1DPUA 2QZ8A 3KCCA 2F5DA 2KDOA 2PZ9A 3DKXA 2V9KA 1SVMA 1Z7UA 4PGHA 1BW5A 4D0PA 2QYOA 2W57A 2O8KA 1T56A 2VASA 2QOPA 3T6NA 1U6GA 5FKMA 5M5XJ 1O3RA 1HOMA 4Y17A 2ZNZA 2R7ZJ 1UAAA 1U8RA 4ZTFA 3NWTA 5D4SA 4MK6A 1UHMA 2GXAA 4BACA 3K4CA 4EJOA 4PDKA 2E7WA 3DV8A 3H1CA 2R7QA 3ZGKA 4XRMA 1U9OA 2GIZA 2XRNA 2EIMH 3KZ9A 3PASA 4UUSA 2AQFA 2EFOA 3FRQA 1PP8F 1ETWA 2A5YB 2QA4I 1B1BA 5EEGA 5GADJ 1N77A 3K1PA 4C3JJ 2ZBKA 3LSKA 2H8WA 4A3JJ 1NH3A 2YUSA 3LAJA 5D5UB 5LHIA 4G6DA 3VYSB 2VE9A 2F5CA 4JYKA 1MMDA 1Y56A 1J09A 3FXLA 2EPFA 1IXCA 4M71A 3M9AA 4M72A 1OCRH 4BGDA 1B9MA 1LDDA 5IY5H 1Z6RA 4DNCA 1USSA 4YFNF 4ENNA 1ZH5A 3KNWA 3BR2A 1QVUA 3KE2A 1PUEE 3B02A 4FT8A 1HF0A 2BEOA 4IX7A 2EV6A 4HNUA 3WU2C 3KFWX 2K9NA 2L01A 4XK4A 2WV1A 2EZIA 4CH7A 4D5CA 4B44A 1JGGA 3W2AA 3BPVA 1FYLA 2K3FA 2XSDC 1RR8C 5J6XA 4A3LJ 3D0SA 3EUHA 2MW8A 2ZC2A 3CJNA 1IJWC 4WXDA 1VFCA 3GTGJ 1K4TA 3IC7A 3TOAA 4EQQA 4M6YA 4NDLA 2JA5J 2VPRA 5GAGJ 4CCOA 3LQRA 3S1NJ 4FASD 2LYCA 2VC1A 1SMTA 3TO7A 3GVAA 1XPXA 1G3SA 4IHVA 4ZZDA 2M87A 5JLWA 2JQ7A 3FBNB 1ZQ3P 2E71A 3CMAI 3TMOA 3ABTA 2Z33A 2EA2A 2YVEA 5AIPA 3HHGA 2GWRA 1XSVA 2CUJA 4I02A 4D7NA 1B9NA 3OY9A 2VOOA 2CV1A 3WODF 3KP7A 4CICA 5FROA 2Z16A 1O4XA 1IUFA 4B47A 3HB9A 1XMKA 1FTZA 2MH2A 2NVYJ 3M1EA 1ERDA 5J4VA 1RUNA 3COAC 1CQTA 1YYVA 1IXRC 2CH0A 4E7IA 2Y75A 3T0YA 1CF7B 2B0LA 2F5FA 2A07F 3I54A 2KZGA 4F52A 3L00A 3OSGA 4HV6A 4BEHB 1KQ9A 2L9RA 5M3MJ 1BC7C 4BHCA 1E17A 2VOPA 4UVCA 1J2XA 2XF5A 3KPHA 4BEHA 3PFYA 5L3FA 1MGTA 1TP4A 2DN0A 2PFBA 2YU3A 1TT5B 2IXSA 4NC7A 4KIGA 2ZXJA 4PCQA 3TL4X 2REKA 2UV1A 1MH4A 1Z91A 2RDPA 1A04A 3FX3A 3V4GA 5FMPA 5IYCJ 2EV5A 2YVHA 4MEXF 2JJ7A 2R7TA 4L9TA 2HOAA 3LSTA 2OCCH 3UR3C 3SHFA 3D5RC 3DPJA 3GFLA 2VXZA 2VJIA 3QP6A 4NHJA 2XKPA 1LDJA 1TQIA 4RB2C 2NNNA 2HI3A 4E70A 5ED4A 4BBRJ 2F48A 2KZVA 2O8XA 4BHBA 4RLFA 4EJVA 3GTOJ 1MBGA 5C44J 1WJ5A 4UUTA 4BJ6C 4ZJZA 1FMVA 4RA2A 4LJZF 3B73A 4ENJA 5FKLA 2NYXA 3S8PA 1SVOA 2VQCA 2XGDA 1WJCA 3ZRGA 1SEUA 5LRRA 4F91B 4WWCA 1TQMA 3LFUA 2DTRA 1U5TB 5DCMB 3BJBA 3OYKA 2ZMEC 3DU6A 4RGSA 1D1CA 3ONQA 3JCUC 4C2MA 3R61A 1U5TA 1BR1A 3C7JA 3KX2A 5DCMA 4B8XA 2F5VA 3FHZA 2V7FA 4A2UA 2DFFA 2UXHA 2YX4A 4YFXF 1YE9A 5F0CA 1BI2A 2X6YA 2OCEA 4R8HA 3SFIA 3O60A 2HNHA 2KRHA 1X2MA 2R0QC 5CXGA 2AQEA 2DJIA 3FDYA 3A0BC 1NHAA 1UHSA 3ASOH 4BAYA 3G71I 1U3EM 2W1OA 3V42A 2HOTA 4U88A 5BNGA 5K5RA 1E3OC 4X6AJ 5LEKA 2H1KA 2M5WA 2V1XA 3PQJA 5J3LA 2PLYA 2QSGX 1XDUA 2XV4S 3S93A 3EETA 2ZCXA 4II2A 4F92B 4M3EA 4LFUA 4N9HA 1GXQA 1J59A 3W6JB 3KLNA 4EJTA 5HLTA 2GA1A 2X85A 5HAWA 3H9JA 4YG2F 5C3EJ 3V78A 5IYDJ 3OYDA 3QAHA 1BBYA 2J5PA 2VJJA 1OCZH 1NK3P 1FOXA 2DOAA 2YR2A 2F2EA 4II3A 2QENA 4PUSA 4JK1X 2MLGA 1MD0A 4C3IJ 2EFWA 5HLIA 4IKFA 4OOIA 4X1EA 4AYBN 4XN3A 2OD5A 2PQ8A 4L9JA 2X0LA 1B4AA 5H20A 2JA6J 4CGZA 1XTAA 4A3EJ 2E19A 1MJAA 2QGUA 2DA2A 5CVVA 2P81A 4GXOA 1IRGA 3I55I 1N75A 1JUPA 3WGIA 3HZJA 4ON0A 4PSXA 3N05A 1MMNA 3BT9A 5D6EA 1HA8A 1WHUA 1ZGJA 1S8NA 4XMYA 4NB5A 3DTKA 4ZYAA 2X51A 3BZ6A 2E1MB 3LA2A 3MVPA 3S16J 1VQ9I 1MNDA 3TBIA 1FMWA 4OIRF 4CCMA 2QQAA 3DKYA 5D1RA 2IJLA 3CCRI 1Y1VJ 1REPC 2QQ8A 2R7SA 3GTQJ 2Y0SN 3AKZA 3P9TA 3ABKH 3GX4X 4DYCA 5D18A 2L4MA 2GQQA 4H0EA 1MJ9A 3BG6A 3QOPA 4HW0A 3PUBA 1SFOJ 2O3FA 3BQZA 1PVEA 1ULYA 1STZA 2BZTA 2DQLA 4HNVA 3DQVC 2P8TA 3O8HA 4U0VA 1YJWI 3ULQB 2XPUA 4DZPA 4NBQA 3QBMA 3TGNA 1OLTA 5E20A 2E60A 2DA1A 2LNBA 1IDYA 4U9LA 4HX4A 2K85A 5HVQC 1D5VA 2O7OA 2G7GA 3ZMZA 1HQCA 3OYHA 4KICA 3AQTA 2QVOA 1HKTA 2LDUA 3ECHA 1BW6A 1X3ZB 3IAM2 2XDNA 1LE8B 3HRMA 3QYFA 2LG4A 2EZHA 1RETA 3OYGA 3FXQA 2X6XA 3A4CA 2IU5A 4KUMA 4P9FA 3BR1A 1FOYA 4ABZA 5FLXZ 1VQ8I 1WVRA 3GMEA 3I9V2 5L3BA 2D5VA 2CS3A 2P4WA 3EYYA 3G4SI 4IHYA 2JSCA 1ZREA 2Q1ZB 2WA0A 1HBXG 2GAUA 2L9SA 1IN4A 3CDLA 2E2HJ 2NAZA 3LQQA 3D5LA 3BOQA 5IT3A 3IKTA 1B59A 2MGQA 2Z1DA 1J75A 4ENKA 3OL3A 1MW7A 1K78A 4MGRA 5E1WA 3VWBA 4N0BA 1J0RA 4B48A 4S0HB 3GFIA 2HZTA 1VQOI 2I10A 3IV5A 4KITB 1W0TA 4Y7NJ 1Q1VA 3F22A 1YFHA 4M73A 2K9SA 1G4DA 3VTIA 1S9HA 4YIRX 4XN0A 5HNFA 3EGQA 2QBYA 2LVSA 2JVGA 4NN1A 4RAZA 3RKWA 2DJNA 1USTA 5BS6A 2EIKH 5EDNA 2VC0A 4I0AA 2OAZA 3SWHA 1LUJB 4ANJA 4DOZA 4UVBA 2ZJQF 3VDXA 1Y8RB 4U0WA 4A5MA 3OSFA 3LWFA 2K4JA 3L2CA 3JW4A 2QIBA 2IAIA 2HOSA 2XKOA 1YG2A 5IP9J 2XUBA 3K7AJ 5IPAA 1OR7A 1FX7A 2BY2A 2ETHA 1T08B 4XSXF 2ZXWH 2VT3A 2VJ4A 2F07A 3FMRA 3S2DJ 2FX0A 4HEA2 3CCUI 2O9LA 4L0YB 1SFXA 2PBXA 2XPWA 2CRGA 4LG0B 1W0UA 1O3QA 2OTLI 3JSJA 2KJCA 3K4BA 3HOSA 1OKRA 3VIBA 4JX4A 3GTPJ 1P9QC 3GEZA 3WTVC 1BI1A 2FU4A 1ZR4A 1K6OA 2HYJA 2Z3YA 2XRLA 4BE2A 5IYBJ 1IXSB 4MFEA 1FP2A 2GOMA 1PDNC 4F3QA 5ILSA 2L3DA 2LP0A 2VBYA 2UXPA 3W6VA 2HKUA 3PPBA 2UZKA 1ZHFA 2EB7A 3BJOA 1R4MB 3PNYA 3OYIA 2LMDA 3DTEA 2N8GA 4ENMA 3BR0A 3V6GA 3V7SA 5FLMJ 3RCOA 3B6AA 3ZN1A 1A31A 3LA7A 2GXGA 2Q2EA 1FSEA 3MEXA 1GXPA 2UWMA 3GYHX 4A6DA 4OD5A 2NP5A 1V3FA 2LR8A 1IRFA 3GZIA 3GZNB 2ECCA 3BWGA 3HRUA 2MSYA 5HDGA 4BQNA 4AIKA 1JJ8C 1I6XA 4PJLA 1ZRDA 2L7ZA 5LFAA 1ZAOA 4I2OA 1VI0A 1FBQA 2IP2A 3IH4A 1P4WA 5ICGA 4UY8I 4D1QA 5F0FA 3V7RA 3OYCA 2EQRA 2KT0A 1DU6A 5J40A 2JWTA 4IRVA 2HVSA 3CRJA 4RLQA 3HSFA 3Q9SA 3DWLE 2ME6A 3D1NI 1QZEA 4WXHA 1YHQI 3BLYA 2PFVA 2ZJPF 2JA8J 3OMYA 5B3SH 1BR2A 1RNLA 2VJ5A 5EEAA 3VPRA 3QPSA 2DBBA 2VT2A 3GW2A 2A6TA 2DFHA 3DP7A 3AG1H 4M3GA 4Y33A 2EZLA 1W1WE 2IW5A 3QPHA 1WH5A 5DAJA 4IRIA 1VQ4I 2FSWA 3T1BA 4QTRA 2F5EA 4XLPF 3JTGA 1ZK8A 5F1RA 2H6BA 1I1GA 5FD6A 3DXJF 2HQNA 2DT7B 2GBYA 1B6AA 2E1MC 2E36A 2OA4A 4IL6C 3BROA 2HTSA 5TJJA 2K3PA 5IOYA 2K7LA 1UJ8A 2E2IJ 1T33A 5EG0B 2OQRA 3J7YJ 2HYGD 4XRSA 3OYJA 3IUOA 2CUFA 4XNFA 1UCRA 2E35A 3L09A 1U78A 1FTTA 1RESA 3BHQA 2H09A 3IH2A 4CCLA 5DM6F 1Z05A 3LJLA 1UB9A 1XN7A 2FE3A 2XGXA 3CLQA 1G8XA 2VN2A 1YITI 3S2WA 5J1UA 3KYDB 2V79A 1UFMA 3OYBA 2JSPA 3WE3A 5CKTA 2HYFA 1F5TA 3C18A 2I8DA 2HQ5A 3HPGA 1JKRC 2L4AA 2IS4A 3HTIA 4GCTA 3IP4B 2G3BA 3HTHA 2LKXA 2AXTC 3B81A 2DDBA 2FQ3A 1T95A 3NAUA 4GRIA 5DM7F 1POGA 1R6RA 3Q0UA 2BXYA 2OJED 1S3JA 4GO1A 2HQAA 3ZMUA 5DDGA 1RKTA 2ZJ2A 2JPBA 2B9SA 4E7SA 3MWMA 4TV7A 4PJJA 4KIBA 3ON2A 4E6KG 3J80K 3E6CC 2A6HF 3DBHB 2M34A 5JLXA 2D1VA 2F4OB 2L2OA 1MZBA 3MMYB 2BY0A 1PUFB 3Q0VA 1TWCJ 3WE2A 3GTJJ 3W3CA 2GENA 4XRSG 2OZ6A 3ZP5A 1I3QJ 1MBEA 3BTCA 4BH9A 4J19A 1PUFA 3CJQB 4CYDA 5H2FC 1QPMA 3FMQA 3NS4A 2HEOA 1R5HA 2XAJA 2OC6A 4LMYA 2YPRA 2RNJA 1FSHA 1PYVA 1X2NA 4LLGF 1O3SA 4GFKA 4RAYA 1LFBA 4MXMA 2FEZA 4EATA 3ROUA 4LLNA 2XSJC 4KN7X 3P5JA 1L3LA 1KYZA 1MBHA 1BJZA 3BDDA 5J8CA 2DFIA 5L3EA 1OCOH 4HNTA 4B09A 3JRBA 3E5UA 2VKHA 2HYTA 1FZPB 1RI7A 3OR2C 2ZFWA 2JN6A 1FEXA 3GZ5A 3HTSB 3FKJA 3Q5FA 4ACIA 1OR7C 3DPLC 2QQBA 2GM4A 2IGKA 2DOFA 3K4JA 4DIQA 2DO7A 3KZYA 2L54A 3F1BA 3BG7A 3G73A 2WB1N 3PNTA 1P4XA 4BQQA 2QKOA 4JL3A 5FD5A 3HUGB 1FOWA 3K8PC 2LKPA 3GCMA 4G6TB 3CC7I 2CW8A 2ZOYA 3RTRA 3RPQA 1T38A 4GCVA 1DP7P 3LOCA 5CVRA 5D8LB 1D8KA 2RASA 3LNQA 5FFZA 3CJTB 2FQ4A 2MC4A 3F3XA 4HLXA 2WB1A 3F23A 3NI7A 1FIAA 2W25A 2X4HA 4MNUA 4A5NA 1XGSA 3RD3A 4RGUA 3NWSA 2R5YB 3LSHA 3RDIA 3S5RA 4L5IA 5EFYA 4XKBA 1YI2I 4A0ZA 1UG2A 3U2RA 1F1ZA 2R5YA 3HKZN 2UXXA 3WTZA 3N4MA 4KJZA 2VI6A 3E97A 1UI5A 5CXIA 4LIUA 3J81Z 1ETOA 3QODA 3BNIA 5TRDA 3S2HJ 3ZMVA 2OBPA 4KDPA 4I7HA 2ZO4A 2RQQA 5BPIA 2W82A 3CCVI 4IO9F 1FC3A 3K70C 4EGYA 1F9NA 4Z2YA 3S1QJ 4B1RA 3U9GA 3TP3A 4FX0A 1ZRCA 2H94A 3K2ZA 3HOXJ 4IF4A 2OUMA 4LITA 3ML6A 4CGRA 3F8FA 5TGTA 2XGCA 1F43A 3HKZA 3DPTA 3SYTA 2XIGA 2G9WA 5E3OA 2R7OA 2CUZA 1YIJI 2LBFB 3M8JA 3FXMA 1WJDA 2ISZA 4RM3A 2XF6A 2QWTA 3ZQQA 4IRHA 2AHQA 3JRFA 2ME0A 2LK2A 1GVJA 2LBFA 4ME9A 1FIPA 2M0MA 1OCTC 3QQAA 1Z3YA 2MA3A 3FM5A 3H35A 1MJBA 1U8BA 2CFXA 2HR3A 2JRTA 2R7DA 3MD2A 2E1CA 1WH7A 3JAMZ 1AOYA 5L3CA 2W53A 3HHHA 5LEJA 2DT5A 2B3WA 1RR7A 1WJBA 3JRAA 3CC4I 4DBRA 2F4IA 3ZR8X 2HDCA 1FYMA 4OAYA 3CUQB 4LGWA 2KIFA 1S5LC 1SD7A 2V1DA 2WAEA 2VPLA 2R7FA 1TW2A 2LY9A 3VEPA 1AU7A 2ID6A 1WRJA 1LVAA 3OOPA 2LREA 2TRTA 5DD8A 3CUQA 4HF0A 3CLOA 1GV2A 4LG3A 5JI6A 4D9JA 3FF5A 3I59B 1R00A 3H3ZA 3LSMA 3SZGA 2GA2A 3CP2A 3A01B 4IJAA 3ZQFA 3COLA 3RPUD 3EUPA 3I59A 1ETYA 1ZR2A 1R58A 4LB6B 2QSFX 5BMZA 2CQQA 3A01A 4IHXA 4EM2A 1VQ5I 2FNPA 4YRVA 5E17F 4FCYA 1CF7A 1JKOC 1IF1A 3OIPA 2C6YA 1S6LA 4AIHA 3OR1C 4EJUA 2EFQA 2STWA 1Z1DA 2FJI1 2JPCA 3HGYA 2HDWA 3IRRA 3S3OA 1XB4A 3HXLA 2EIJH 3E5QA 3AFHA 2M2EA 3DLLF 4RB1A 1WCMJ 4R79A 1FBSA 3MAJA 1KU9A 3FZVA 2F6CA 2X6OA 3OV8A 2ESHA 5CW8A 4YFKF 2XAQA 1XCBA 1BL0A 3ZCOA 2PMZN 2A05A 3FM3A 3QYBA 3T5XA 1QHHD 4UUVA 4ZDLA 4ZYDA 4E7JA 5A2QK 1HXDA 2JTVA 3K10A 4JOMA 5KCMA 1W36C 2WY8Q 2A2FX 4CO8A 1T0FA 2QEXI 4IHTA 4G7OF 3H3VK 4WCGA 5HLHA 4MFDA 3JRCA 1ZGWA 2VXDA 3CCQI 2DOEA 5F27A 5HDNA 1LFUP 3K4MA 3E0JB 2KMUA 1X1AA 4GFBA 4JQFA 1IV6A 1SD6A 3M8EA 4RAFA 4AU7A 2CUEA 4RGXA 4HBLA 1T6SA 1ZELA 3KKCA 2XAUA 3ZOBA 5L3GA 2P7VB 3MCZA 3HPHA 3AG4H 2FBHA 2FF4A 3MZHA 2X1EA 4PSWA 3OS1A 2M4KA 1MMSA 3TKYA 2Y30A 1EKEA 3ZMSA 2IS2A 4UHTA 4L5EA 3BG3A 3KEQA 1BM9A 2P6SA 1K83J 1MSEC 5IP6A 3JR9A 1SMYF 4BQOA 4BXFA 2MD5A 3DBRB 1P7JA 3RYPA 1IG7A 3HOVJ 1DP3A 3A1YA 3BCBA 3CDIA 4EM0B 3C07A 1JUMA 1XS9A 3FXKA 4Y4RA 3S14J 4QSHA 1EH8A 2R7WA 4AUXA 1VQLI 4NNJA 5EJCA 1IO2A 1DGRM 3C1DA 3LA3A 3IL2A 4A0YA 3E6DA 2LKSA 4E7ZA 1FLIA 4OIPF 3K2AA 4HX8A 4UVAA 2MH9A 4MQ9F 2XDVA 3JRGA 1JTYA 2LF8A 3AG2H 2KFDA 3CMYA 4A12A 1LFPA 1D3YA 3CF2A 4P5OA 3DLAA 4HX7A 1KQ8A 1ZG3A 2VE8A 2ZJRF 1QPIA 3E6BA 1VQ6I 1VF9A 2E1NA 2JUCA 2A3SA 3IAS2 4PJ0C 3SFZA 3RYRA 2XPVA 3RQIA 2E2JJ 5D5XB 2XHKA 4XORA 3F6VA 3M07A 1LJ9A 2RQPA 1TW3A 4B3XA 1S7EA 4BNCA 4YIIA 4AVPA 4CCJA 1FOKA 2G7UA 2AO9A 4IPAA 2M7AA 3MFKA 2WUIA 1O7FA 2DYSH 3KP5A 1IW7F 4BXUA 3BC8A 4AYBA 3L2QA 3UKGA 1O7LA 1XD7A 3F0CA 4DYRA 2PJPA 3J7AO 3F8BA 5CQEA 3EUHC 1UG0A 2L02A 2HDDA 3HOUJ 1E3PA 4L9NA 4HPQA 3WG9A 4MHGA 2LC2A 3LMMA 5E3MA 4A3CJ 4P9UA 3PNVA 3CTAA 4A6EA 1P6RA 2Z2SB 1OMIA 2YVXA 2HTJA 1Z21A 2L7MP 2QSHX 3R0JA 3R0AA 2NOGA 1U0JA 2DQRA 3A03A 4CYCB 4GCLA 1KU2A 3V8LA 3L2WA 2RGVA 3BJ6A 1MBJA 1MH3A 3CC2I 3CP8A 4G94A 4IZZA 4CYCA 3PL8A 3U1DA 2QWWA 1DGWY 2D1HA 1JHHA 5GTHC 1A6IA 4BJ5C 4D7MA 2Y0SA 4OIQF 1JT6A 5D5VB 1FY7A 3DKWA 1XGNA 1N25A 1G6NA 5LGTA 2G0EA 3K69A 2DMPA 2LF7A 1DDNA 4KT5C 2EA4A 1WZ2A 3S17J 4EJWA 2D45A 2JZYA 1YS7A 1LE8A 2QF7A 2GUHA 2IPQX 3VVZA 1SAUA 3HG9A 2KIQA 5HS7A 1LB2A 4G9YA 2OI8A 4BQAA 4UXNA 2RV8A 2LTPA 3F72A 2HS5A 1WQ2A 4NC8A 4S04A 2Y31A 1D1AA 1GLNA 4PJMA 1OCPA 3M3YJ 4GYGA 2Q8KA 4OWRB 1FYKA 2B63J 4F93B 1YOVB 3PIOF 4A3GJ 2KQRA 5J8FA 1FT9A 1QVTA 1X19A 4E7LA 3GZ6A 2WAFA 3K4LA 4DW6A 4QIWN 1XMXA 4ZYHA 4ESFA 1BC8C 3ON4A 3WU0A 3W6KB 5FGMA 4E7KA 2WTEA 4XKWA 2R7XA 1AHDP 2DLLA 1EV7A 1VQ7I 2NVQJ 1E0EA 2KP6A 3NRVA 5D8KB 5IT9Z 1APLC 1X1BA 5BQTA 1WI9A 2R7VA 2V57A 3HTUA 4I6ZA 2BVMA 1E3HA 2CFOA 3Q9VA 5CLSA 1HW2A 3ZQIA 3AL0B 1IN5A 1MMAA 4ESJA 3GBGA 4GFLA 4A3BJ 1UMQA 2PN6A 1ZGAA 4V19K 5K7HA 5B1AH 4ZYGA 4FE7A 4CUGA 5GAEJ 2E1OA 2VBXA 3TQNA 2IBDA 4BE0A 2KISA 3MKLA 3KIOA 3C2BA 4I76A 2EINH 1Y8QB 2HVQA 2EWNA 2QUFA 1UELB 2O0YA 3EPZA 2CGPA 2ZXHA 4MQVA 2LRDA 5B5EC 3C3WA 2STTA 1R49A 4PJNA 1IC8A 1Q1HA 1VQNI 1QZYA 3Q3SA 1F36A 3K1MA 1YLFA 3DBLB 2FRHA 2PEXA 2KIUA 2ZSIB 5DS9A 3MNLA 1WKMA 3IWZA 2VL8A 2EBIA 1OCCH 2IEKA 2DA5A 1YO5C 5CVIA 4Q48A 4MEYF 4UB6C 3U1KA 2E5NA 3VP5A 3OL4A 4O6JA 2DT6A 4LG0A 1U5TC 1YRNB 5EZHA 3H5AA 2AXLA 1R4NB 1MNEA 3VODA 2IGMA 2XAGA 2KKOA 2VKVA 4NELA 3V8JA 1Y6IA 2HKOA 1K61A 4ZC3A 1IDZA 2OQGA 5GAHJ 4ETSA 3TOBA 1BIAA 3ESWB 5F64A 1SFKA 4XLFA 5LGUA 1VZ0A 1XCVA 3H92A 2TDXA 1OFCX 1P4AA 4LK0F 3BQYA 3WHBA 1QU3A 1XG1A 3HBLA 1ON1A 4ZH4F 3HRTA 4I09A 1HKQA 4FTHA 1YQAA 4DJAA 1PP7U 2NVUB 2LOOA 1VQMI 4AF5A 3RKXA 1HSTA 2JVHA 1K7AA 2NOJB 2IT0A 4IHWA 2YSRA 2H27A 4B43A 2R92J 4L0ZB 5JHFA 4I98B 5GP9A 3OYFA 2L0KA 3TW6A 3VW0A 1JKPC 2M7BA 4AIDA 5KK1A 2ACJA 3HDDA 2JUGA 4BKXA 5J4YA 4BE1A 3OS0A 1X1CA 4EEFG 3A2KA 3OYNA 4Y13A 3M8FA 1I27A 2BW3B 3OWTA 5FLXK 3K70D 3IHUA 2NRAC 2DYRH 1A6QA 1FWZA 1BOAA 2FMYA 1OPCA 1ZN2A 1ZLJA 2BW3A 4F55A 2BHZA 3DFGA 4MTDA 3OYLA 1ETKA 3N97A 2W7NA 2WGBA 2PG4A 2MYSA 3O2PE 1MIJA 2I5UA 1W5SA 4U87A 2OTJI 3HSEA 1XGMA 1OJLA 2L9VA 3S1MJ 2KJBA 3K9TA 4ZDPA 3IRQA 5E1XA 4OINF 2DA6A 3LSGA 5AIQA 2UXOA 1AA7A 4Q5SF 1W5CC 1KU3A 3WTTC 4I0BA 4XLEA 4HRIA 1IGNA 3BCGA 5HSZA 2V4JC 4LOCA 4HDUA 3VSKA 1W7PD 3ASNH 5EG0A 1BA5A 2IGOA 2ID3A 4CHUA 3E7QA 3L2RA 3E7LA 2Q0OA 4DGWB 3WGHA 1R5GA 2PMHA 4XKCA 1T39A 3BG5A 1LNWA 5TISC 3RJPA 1LKXA 3VYUB 2WY7Q 1SANA 2JA2A 5ICEA 4Q47A 1D0YA 4EMSA 3CZ6A 2V26A 1HC8A 3KZIC 1TWHJ 3JREA 3ANGA 2A61A 3GF2A 4CZCA 3H0DA 4AC6A 1TWFJ 5LHHA 4P1WA 2O61A 4JX5A 3CQZJ 3U21A 4YELA 2HKXA 3VVXA 2P0WA 3REOA 2BHYA 5GPCA 3FISA 2W48A 4CXFA 1IZ1A 3CDHA 2VQGA 1ZG5A 4XSZF 2LFBA 1VTNC 1S29A 2VB6A 2XASA 4A0XA 3BR3A 3HEFA 3VFZA 3PSFA 3OYMA 2NVTJ 2VQHA 1W5TA 4Z6YA 1EA3A 2E5ZA 3A0HC 1B8IB 3L1PA 2XB5A 2KDZA 3BTJA
chains in the Genus database with same CATH topology
3QQAA 4A3DJ 3VOKA 2QTQA 1ETXA 5HAWA 1U8BA 5C3EJ 3OIOA 3V78A 1WH7A 5IYDJ 3PO2J 1NK3P 2W53A 2K9QA 5EF6A 1RR7A 5K7ZA 2Y9ZA 3JRAA 1YRNA 1NK2P 2CJJA 4C3IJ 1DU0A 1RPWA 2CU7A 4YZEA 4PXIA 3A02A 4JKZA 2R5ZB 3SJMA 4X1EA 2LY9A 2M8GX 4AYBN 1AU7A 4RBOA 2ID6A 2DA7A 2TRTA 2JA6J 2R5ZA 3RKQA 1GV2A 2E19A 4A3EJ 2DA2A 3JRDA 2P81A 3A01B 5F08A 1JUPA 3ZQFA 3COLA 3EUPA 4D5FA 5FGLA 3Q0WA 1ETYA 3BT9A 1ZR2A 3LHQA 4IHXA 2CQQA 3A01A 5C4JJ 3MVPA 1WPKA 3S16J 2NS8A 4FCYA 1JKOC 3M4OJ 3ANPA 5D1RA 3HGYA 5EZGA 1P7IA 1Y1VJ 2OPTA 5HODA 3L1PA 3GTQJ 2Y0SN 3G7RA 3P9TA 2KDZA 2JK3A 3CJDA 4XICA 3HM5A 4DYCA 2GLOA 3I4MJ 4BXXJ 5D18A 2M2EA 2ZB9A 2DA3A 2DG7A 1SFOJ 1WCMJ 1GUUA 3BQZA 2EH3A 4HNVA 3O8HA 4V2FA 3HTJA 2XPUA 4DZPA 2X6OA 3ZQLA 1H8AC 3QBMA 3O8GA 5CW8A 5J1RA 1BL0A 3VW1A 2DA1A 1IDYA 5F0HA 2PMZN 1FJLA 2O7OA 1SGMA 2G7GA 1WGXA 3AQTA 5FHPA 2TCTA 1BW6A 2NVXJ 2XDNA 2XB0X 2X9DA 4IEJA 3LSPA 1LE8B 5C4YA 3G1OA 2EZHA 1RETA 3I4NJ 2WAQN 2IU5A 5M5YJ 4ME9A 4ABZA 3H3VK 3BR1A 5H9TA 2LLKA 4MFDA 3JRCA 3QPLA 2DMTA 1GT0C 1OCTC 3ZQGA 1ZGWA 1MNMC 1ETQA 5F27A 4UUSB 1LFUP 2D5VA 1G2HA 3BR6A 4GFBA 2K40A 1JUSA 1IV6A 1JTXA 4IHYA 1GVDA 2CUEA 1HDDC 3KKCA 3CDLA 3ZOBA 2E2HJ 3S15J 5F04A 2NX4A 4L62A 1ENHA 2MGQA 3G1LA 2RAEA 1JT0A 3NNRA 1B72B 5K7FA 5IP7J 1EF4A 2Y30A 4MO7A 3WHCA 4S0HB 3DEWA 2I10A 3IV5A 1B72A 1W0TA 4L5EA 3BG3A 4Y7NJ 1Q1VA 5EGOB 3RZDJ 1TC3C 2K9SA 3G56A 3TW7A 1K83J 1MSEC 3VUQA 5IP6A 3JR9A 2DMQA 3EGQA 5EGOA 1H88C 3LWJA 2LVSA 2OERA 5FKOA 4NN1A 2DJNA 5EDNA 1P7JA 3QKXA 1IG7A 3HOVJ 5EYRA 1ETVA 1JUMA 2FD5A 3C07A 1XS9A 3S14J 4QSHA 1B8IA 4AUXA 1TWGJ 3OSFA 4V2GA 1IRZA 1ZKGA 5F1JA 2YS9A 2QIBA 2Y2ZA 2O7TA 2IAIA 2HOSA 2UXUA 2DG8A 3FK6A 5M3FJ 2ELKA 3K2AA 1GDTA 5IP9J 3JRGA 3K7AJ 3GTLJ 5IPAA 1JTYA 3CMYA 1R9TJ 2DA4A 3G1MA 2H8RA 1VNDA 2X48A 2F07A 3S2DJ 1QPIA 3IH3A 1VF9A 2FX0A 2O9LA 2PBXA 3LSRA 2XPWA 2CRGA 4A3MJ 1W0UA 2XPVA 3RQIA 2E2JJ 4BY1J 3JSJA 4BY7J 2HXIA 1JJ6C 5FJ8J 3VIBA 4JX4A 2ECBA 3GTPJ 1MBKA 2G7LA 3CCYA 2CQXA 3SDGA 2VUMJ 2ZOZA 4JNNA 1S7EA 1ZR4A 3HGGA 2HYJA 2XRLA 1I50J 5IYBJ 2AO9A 3H0GJ 4MFEA 4BBSJ 4UDSA 2WUIA 4W97A 3IUVA 4JX6A 4JP0A 1JKQC 2LP0A 2UXPA 3TP0A 3W6VA 2HKUA 4W1UA 3PPBA 3UKGA 4MIMA 3FKIJ 4DYRA 3F0CA 2FBQA 2N8GA 3V6GA 3BR0A 2M0CA 2HDDA 2DTZA 5FLMJ 3HOUJ 3B6AA 1D5YA 5AQCA 5FKKA 3ZQCA 2NP5A 3BG9A 5E3MA 1I6HJ 2LR8A 4A3CJ 1H89C 3HTAA 3GZIA 2ECCA 2MSYA 1JJ8C 2L7MP 4B3AA 4B4CA 2NOGA 4CYCB 3A03A 3KKDA 4GCLA 2L7ZA 1VI0A 1MBJA 3IH4A 1MH3A 4CYCA 5F0FA 2GFNA 3GEUA 2EQRA 2KT0A 1DU6A 4ICHA 3RZOJ 3LSJA 2JWTA 2PZ9A 1A6IA 4D7MA 3CRJA 1JT6A 2ME6A 1BW5A 3D1NI 4RDUA 3TEDA 5M5WJ 2G0EA 2O8KA 1T56A 2QOPA 3T6NA 2JA8J 2DMPA 5FKMA 5M5XJ 2NS7A 3S17J 1HOMA 3NPIA 1QRYA 3BTLA 3VPRA 5EEAA 3QPSA 2R7ZJ 4XIDA 2GUHA 1LE8A 2QF7A 3VVZA 4MK6A 2OI8A 1GV5A 4M3GA 2EZLA 1WH5A 4XRMA 2LTPA 5DAJA 3GTKJ 1U9OA 2EZKA 2Y31A 3HOZJ 4QTRA 1OCPA 3KZ9A 1HDPA 4A3IJ 3M3YJ 1ZK8A 3PASA 2B63J 4UUSA 4A3GJ 1QVTA 3FRQA 2GBYA 1ETWA 4DW6A 1Z77A 4QIWN 2ZCMA 5IOYA 2E2IJ 3ON4A 1XC5A 1T33A 5EG0B 4KWAA 1AHDP 4GCKA 4C3JJ 2NVQJ 4XRSA 4A3JJ 5C4XJ 2YUSA 2JMWA 2CUFA 1APLC 1Z0XA 1FTTA 1U78A 4JYKA 1RESA 2V57A 3BR5A 2XGEA 3BHQA 3IH2A 4I6ZA 3LJLA 5E3LA 1WI3A 3ZQIA 3NXCA 2RHAA 3VOXA 3GBGA 4GFLA 1NTCA 4A3BJ 1UMQA 5J1UA 4C3HJ 5K7HA 1ITYA 3KNWA 4FE7A 3BR2A 1QVUA 2E1OA 1HF0A 1MSFC 2IBDA 3BTIA 3AQSA 3MKLA 2HQ5A 1JKRC 2K9NA 1JGGA 4XK4A 2WV1A 2EZIA 3C2BA 4D5CA 3HTIA 4I76A 4GCTA 2G3BA 3HTHA 3HIMA 2LKXA 3B81A 2XSDC 3DCFA 4A3LJ 1RKWA 5HBUA 3NAUA 2MW8A 1IC8A 1HCRA 1POGA 3Q3SA 1F36A 1IJWC 4DYQA 1Y1WJ 3Q0UA 1VFCA 3GTGJ 5DS9A 3MNLA 4NDLA 1RKTA 2JA5J 2VPRA 2EBIA 2IEKA 2DA5A 3S1NJ 3ON2A 3VP5A 1YRNB 5JLXA 2M34A 5EZHA 4IHVA 5JLWA 1ZQ3P 1PUFB 1ORKA 3Q0VA 1TWCJ 3GTJJ 2VKVA 2GENA 2ZCNA 4NELA 2YVEA 4XRSG 1I3QJ 1MBEA 3BTCA 4J19A 1K61A 2JA7J 1PUFA 1IDZA 3PM1A 4D7NA 5E3NA 1A5JA 3NRGA 1X2NA 5D19A 1O4XA 1IUFA 3HB9A 4G12A 3S1RJ 1FTZA 2UXIA 2NVYJ 2Y9YA 1OFCX 3WHBA 1LFBA 3BQYA 4DZJA 4GFKA 4MXMA 2NP3A 1XG1A 3HBLA 5FKNA 1CQTA 4FTHA 1ZTRA 3JRHA 3FIWA 4AF5A 1MBHA 1BJZA 3BRUA 3OSGA 4IHWA 2L9RA 5M3MJ 2R92J 2MG4A 4M3BA 3JRBA 1TWAJ 3GTMJ 2HYTA 5GP9A 4M6VA 2FJ1A 2L0KA 2JN6A 1FEXA 3OOUA 3TW6A 3VW0A 1JKPC 2L7FP 2DN0A 5GPAA 4ACIA 3HDDA 4BKXA 2REKA 2GM4A 4MLOA 4EEFG 1MH4A 3HOWJ 3F1BA 5K58A 5FMPA 5IYCJ 3MN2A 4C2MJ 2YVHA 5J1YA 2JJ7A 2HOAA 2WB1N 2G7SA 3DPJA 2QKOA 4JL3A 2VKEA 3FK7A 1ETKA 2WGBA 5IOZA 2LD5A 2DMUA 3VVYA 2COBA 2ZOYA 2HI3A 4HKUA 4BBRJ 1UI6A 3LOCA 1OJLA 3S1MJ 3GTOJ 1MBGA 5C44J 4UUTA 3LNQA 2RASA 4FISA 2FQ4A 2OF7A 4A3FJ 3HE0A 2R93J 2DA6A 3LSGA 5FKLA 2XGDA 2UXOA 3NI7A 1FIAA 3PO3J 3RD3A 4A3KJ 2QCOA 1IGNA 1HLVA 3BCGA 5HSZA 4LOCA 2R5YB 5DTDA 3S5RA 5EG0A 1BA5A 5EFYA 2ID3A 3E7QA 4A93J 3E7LA 3B6CA 1UG2A 3HOYJ 3BG5A 2R5YA 3HKZN 3BJBA 3ZQHA 2DMNA 1SANA 2VI6A 1UI5A 5CXIA 2D6YA 1ETOA 3BNIA 3CWRA 3VW2A 1TWHJ 3JREA 3S2HJ 3ANGA 2UXHA 2HXOA 5FLVA 9ANTA 1AKHB 4Y52J 3NARA 4AC6A 5F0CA 2M9HA 1TWFJ 3JRIA 3RH2A 4JX5A 4A69C 3S1QJ 1U9NA 3SFIA 3O60A 3CQZJ 1X2MA 4B1RA 2R0QC 3TP3A 1AKHA 5CXGA 2YU9J 3HOXJ 3VVXA 4CGRA 1UHSA 5GPCA 2XGCA 3FISA 1F43A 1X58A 2W48A 2HOTA 2Q24A 5BNGA 5E3OA 4AC0A 1E3OC 4X6AJ 1MBFA 2H1KA 4FE4A 5J3LA 2LFBA 4M3DA 3BR3A 3HEFA 2QWTA 2ZCXA 2NVTJ 4M3EA 2AHQA 1B8IB 3JRFA 2ME0A 2LK2A 4M3FA 2XB5A 1FIPA 3BTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  4A3D J;  3VOK A;  2QTQ A;  1ETX A;  5HAW A;  1U8B A;  5C3E J;  3OIO A;  3V78 A;  1WH7 A;  5IYD J;  3PO2 J;  1NK3 P;  2W53 A;  2K9Q A;  5EF6 A;  1RR7 A;  5K7Z A;  2Y9Z A;  3JRA A;  1YRN A;  1NK2 P;  2CJJ A;  4C3I J;  1DU0 A;  1RPW A;  2CU7 A;  4YZE A;  4PXI A;  3A02 A;  4JKZ A;  2R5Z B;  3SJM A;  4X1E A;  2LY9 A;  2M8G X;  4AYB N;  1AU7 A;  4RBO A;  2ID6 A;  2DA7 A;  2TRT A;  2JA6 J;  2R5Z A;  3RKQ A;  1GV2 A;  2E19 A;  4A3E J;  2DA2 A;  3JRD A;  2P81 A;  3A01 B;  5F08 A;  1JUP A;  3ZQF A;  3COL A;  3EUP A;  4D5F A;  5FGL A;  3Q0W A;  1ETY A;  3BT9 A;  1ZR2 A;  3LHQ A;  4IHX A;  2CQQ A;  3A01 A;  5C4J J;  3MVP A;  1WPK A;  3S16 J;  2NS8 A;  4FCY A;  1JKO C;  3M4O J;  3ANP A;  5D1R A;  3HGY A;  5EZG A;  1P7I A;  1Y1V J;  2OPT A;  5HOD A;  3L1P A;  3GTQ J;  2Y0S N;  3G7R A;  3P9T A;  2KDZ A;  2JK3 A;  3CJD A;  4XIC A;  3HM5 A;  4DYC A;  2GLO A;  3I4M J;  4BXX J;  5D18 A;  2M2E A;  2ZB9 A;  2DA3 A;  2DG7 A;  1SFO J;  1WCM J;  1GUU A;  3BQZ A;  2EH3 A;  4HNV A;  3O8H A;  4V2F A;  3HTJ A;  2XPU A;  4DZP A;  2X6O A;  3ZQL A;  1H8A C;  3QBM A;  3O8G A;  5CW8 A;  5J1R A;  1BL0 A;  3VW1 A;  2DA1 A;  1IDY A;  5F0H A;  2PMZ N;  1FJL A;  2O7O A;  1SGM A;  2G7G A;  1WGX A;  3AQT A;  5FHP A;  2TCT A;  1BW6 A;  2NVX J;  2XDN A;  2XB0 X;  2X9D A;  4IEJ A;  3LSP A;  1LE8 B;  5C4Y A;  3G1O A;  2EZH A;  1RET A;  3I4N J;  2WAQ N;  2IU5 A;  5M5Y J;  4ME9 A;  4ABZ A;  3H3V K;  3BR1 A;  5H9T A;  2LLK A;  4MFD A;  3JRC A;  3QPL A;  2DMT A;  1GT0 C;  1OCT C;  3ZQG A;  1ZGW A;  1MNM C;  1ETQ A;  5F27 A;  4UUS B;  1LFU P;  2D5V A;  1G2H A;  3BR6 A;  4GFB A;  2K40 A;  1JUS A;  1IV6 A;  1JTX A;  4IHY A;  1GVD A;  2CUE A;  1HDD C;  3KKC A;  3CDL A;  3ZOB A;  2E2H J;  3S15 J;  5F04 A;  2NX4 A;  4L62 A;  1ENH A;  2MGQ A;  3G1L A;  2RAE A;  1JT0 A;  3NNR A;  1B72 B;  5K7F A;  5IP7 J;  1EF4 A;  2Y30 A;  4MO7 A;  3WHC A;  4S0H B;  3DEW A;  2I10 A;  3IV5 A;  1B72 A;  1W0T A;  4L5E A;  3BG3 A;  4Y7N J;  1Q1V A;  5EGO B;  3RZD J;  1TC3 C;  2K9S A;  3G56 A;  3TW7 A;  1K83 J;  1MSE C;  3VUQ A;  5IP6 A;  3JR9 A;  2DMQ A;  3EGQ A;  5EGO A;  1H88 C;  3LWJ A;  2LVS A;  2OER A;  5FKO A;  4NN1 A;  2DJN A;  5EDN A;  1P7J A;  3QKX A;  1IG7 A;  3HOV J;  5EYR A;  1ETV A;  1JUM A;  2FD5 A;  3C07 A;  1XS9 A;  3S14 J;  4QSH A;  1B8I A;  4AUX A;  1TWG J;  3OSF A;  4V2G A;  1IRZ A;  1ZKG A;  5F1J A;  2YS9 A;  2QIB A;  2Y2Z A;  2O7T A;  2IAI A;  2HOS A;  2UXU A;  2DG8 A;  3FK6 A;  5M3F J;  2ELK A;  3K2A A;  1GDT A;  5IP9 J;  3JRG A;  3K7A J;  3GTL J;  5IPA A;  1JTY A;  3CMY A;  1R9T J;  2DA4 A;  3G1M A;  2H8R A;  1VND A;  2X48 A;  2F07 A;  3S2D J;  1QPI A;  3IH3 A;  1VF9 A;  2FX0 A;  2O9L A;  2PBX A;  3LSR A;  2XPW A;  2CRG A;  4A3M J;  1W0U A;  2XPV A;  3RQI A;  2E2J J;  4BY1 J;  3JSJ A;  4BY7 J;  2HXI A;  1JJ6 C;  5FJ8 J;  3VIB A;  4JX4 A;  2ECB A;  3GTP J;  1MBK A;  2G7L A;  3CCY A;  2CQX A;  3SDG A;  2VUM J;  2ZOZ A;  4JNN A;  1S7E A;  1ZR4 A;  3HGG A;  2HYJ A;  2XRL A;  1I50 J;  5IYB J;  2AO9 A;  3H0G J;  4MFE A;  4BBS J;  4UDS A;  2WUI A;  4W97 A;  3IUV A;  4JX6 A;  4JP0 A;  1JKQ C;  2LP0 A;  2UXP A;  3TP0 A;  3W6V A;  2HKU A;  4W1U A;  3PPB A;  3UKG A;  4MIM A;  3FKI J;  4DYR A;  3F0C A;  2FBQ A;  2N8G A;  3V6G A;  3BR0 A;  2M0C A;  2HDD A;  2DTZ A;  5FLM J;  3HOU J;  3B6A A;  1D5Y A;  5AQC A;  5FKK A;  3ZQC A;  2NP5 A;  3BG9 A;  5E3M A;  1I6H J;  2LR8 A;  4A3C J;  1H89 C;  3HTA A;  3GZI A;  2ECC A;  2MSY A;  1JJ8 C;  2L7M P;  4B3A A;  4B4C A;  2NOG A;  4CYC B;  3A03 A;  3KKD A;  4GCL A;  2L7Z A;  1VI0 A;  1MBJ A;  3IH4 A;  1MH3 A;  4CYC A;  5F0F A;  2GFN A;  3GEU A;  2EQR A;  2KT0 A;  1DU6 A;  4ICH A;  3RZO J;  3LSJ A;  2JWT A;  2PZ9 A;  1A6I A;  4D7M A;  3CRJ A;  1JT6 A;  2ME6 A;  1BW5 A;  3D1N I;  4RDU A;  3TED A;  5M5W J;  2G0E A;  2O8K A;  1T56 A;  2QOP A;  3T6N A;  2JA8 J;  2DMP A;  5FKM A;  5M5X J;  2NS7 A;  3S17 J;  1HOM A;  3NPI A;  1QRY A;  3BTL A;  3VPR A;  5EEA A;  3QPS A;  2R7Z J;  4XID A;  2GUH A;  1LE8 A;  2QF7 A;  3VVZ A;  4MK6 A;  2OI8 A;  1GV5 A;  4M3G A;  2EZL A;  1WH5 A;  4XRM A;  2LTP A;  5DAJ A;  3GTK J;  1U9O A;  2EZK A;  2Y31 A;  3HOZ J;  4QTR A;  1OCP A;  3KZ9 A;  1HDP A;  4A3I J;  3M3Y J;  1ZK8 A;  3PAS A;  2B63 J;  4UUS A;  4A3G J;  1QVT A;  3FRQ A;  2GBY A;  1ETW A;  4DW6 A;  1Z77 A;  4QIW N;  2ZCM A;  5IOY A;  2E2I J;  3ON4 A;  1XC5 A;  1T33 A;  5EG0 B;  4KWA A;  1AHD P;  4GCK A;  4C3J J;  2NVQ J;  4XRS A;  4A3J J;  5C4X J;  2YUS A;  2JMW A;  2CUF A;  1APL C;  1Z0X A;  1FTT A;  1U78 A;  4JYK A;  1RES A;  2V57 A;  3BR5 A;  2XGE A;  3BHQ A;  3IH2 A;  4I6Z A;  3LJL A;  5E3L A;  1WI3 A;  3ZQI A;  3NXC A;  2RHA A;  3VOX A;  3GBG A;  4GFL A;  1NTC A;  4A3B J;  1UMQ A;  5J1U A;  4C3H J;  5K7H A;  1ITY A;  3KNW A;  4FE7 A;  3BR2 A;  1QVU A;  2E1O A;  1HF0 A;  1MSF C;  2IBD A;  3BTI A;  3AQS A;  3MKL A;  2HQ5 A;  1JKR C;  2K9N A;  1JGG A;  4XK4 A;  2WV1 A;  2EZI A;  3C2B A;  4D5C A;  3HTI A;  4I76 A;  4GCT A;  2G3B A;  3HTH A;  3HIM A;  2LKX A;  3B81 A;  2XSD C;  3DCF A;  4A3L J;  1RKW A;  5HBU A;  3NAU A;  2MW8 A;  1IC8 A;  1HCR A;  1POG A;  3Q3S A;  1F36 A;  1IJW C;  4DYQ A;  1Y1W J;  3Q0U A;  1VFC A;  3GTG J;  5DS9 A;  3MNL A;  4NDL A;  1RKT A;  2JA5 J;  2VPR A;  2EBI A;  2IEK A;  2DA5 A;  3S1N J;  3ON2 A;  3VP5 A;  1YRN B;  5JLX A;  2M34 A;  5EZH A;  4IHV A;  5JLW A;  1ZQ3 P;  1PUF B;  1ORK A;  3Q0V A;  1TWC J;  3GTJ J;  2VKV A;  2GEN A;  2ZCN A;  4NEL A;  2YVE A;  4XRS G;  1I3Q J;  1MBE A;  3BTC A;  4J19 A;  1K61 A;  2JA7 J;  1PUF A;  1IDZ A;  3PM1 A;  4D7N A;  5E3N A;  1A5J A;  3NRG A;  1X2N A;  5D19 A;  1O4X A;  1IUF A;  3HB9 A;  4G12 A;  3S1R J;  1FTZ A;  2UXI A;  2NVY J;  2Y9Y A;  1OFC X;  3WHB A;  1LFB A;  3BQY A;  4DZJ A;  4GFK A;  4MXM A;  2NP3 A;  1XG1 A;  3HBL A;  5FKN A;  1CQT A;  4FTH A;  1ZTR A;  3JRH A;  3FIW A;  4AF5 A;  1MBH A;  1BJZ A;  3BRU A;  3OSG A;  4IHW A;  2L9R A;  5M3M J;  2R92 J;  2MG4 A;  4M3B A;  3JRB A;  1TWA J;  3GTM J;  2HYT A;  5GP9 A;  4M6V A;  2FJ1 A;  2L0K A;  2JN6 A;  1FEX A;  3OOU A;  3TW6 A;  3VW0 A;  1JKP C;  2L7F P;  2DN0 A;  5GPA A;  4ACI A;  3HDD A;  4BKX A;  2REK A;  2GM4 A;  4MLO A;  4EEF G;  1MH4 A;  3HOW J;  3F1B A;  5K58 A;  5FMP A;  5IYC J;  3MN2 A;  4C2M J;  2YVH A;  5J1Y A;  2JJ7 A;  2HOA A;  2WB1 N;  2G7S A;  3DPJ A;  2QKO A;  4JL3 A;  2VKE A;  3FK7 A;  1ETK A;  2WGB A;  5IOZ A;  2LD5 A;  2DMU A;  3VVY A;  2COB A;  2ZOY A;  2HI3 A;  4HKU A;  4BBR J;  1UI6 A;  3LOC A;  1OJL A;  3S1M J;  3GTO J;  1MBG A;  5C44 J;  4UUT A;  3LNQ A;  2RAS A;  4FIS A;  2FQ4 A;  2OF7 A;  4A3F J;  3HE0 A;  2R93 J;  2DA6 A;  3LSG A;  5FKL A;  2XGD A;  2UXO A;  3NI7 A;  1FIA A;  3PO3 J;  3RD3 A;  4A3K J;  2QCO A;  1IGN A;  1HLV A;  3BCG A;  5HSZ A;  4LOC A;  2R5Y B;  5DTD A;  3S5R A;  5EG0 A;  1BA5 A;  5EFY A;  2ID3 A;  3E7Q A;  4A93 J;  3E7L A;  3B6C A;  1UG2 A;  3HOY J;  3BG5 A;  2R5Y A;  3HKZ N;  3BJB A;  3ZQH A;  2DMN A;  1SAN A;  2VI6 A;  1UI5 A;  5CXI A;  2D6Y A;  1ETO A;  3BNI A;  3CWR A;  3VW2 A;  1TWH J;  3JRE A;  3S2H J;  3ANG A;  2UXH A;  2HXO A;  5FLV A;  9ANT A;  1AKH B;  4Y52 J;  3NAR A;  4AC6 A;  5F0C A;  2M9H A;  1TWF J;  3JRI A;  3RH2 A;  4JX5 A;  4A69 C;  3S1Q J;  1U9N A;  3SFI A;  3O60 A;  3CQZ J;  1X2M A;  4B1R A;  2R0Q C;  3TP3 A;  1AKH A;  5CXG A;  2YU9 J;  3HOX J;  3VVX A;  4CGR A;  1UHS A;  5GPC A;  2XGC A;  3FIS A;  1F43 A;  1X58 A;  2W48 A;  2HOT A;  2Q24 A;  5BNG A;  5E3O A;  4AC0 A;  1E3O C;  4X6A J;  1MBF A;  2H1K A;  4FE4 A;  5J3L A;  2LFB A;  4M3D A;  3BR3 A;  3HEF A;  2QWT A;  2ZCX A;  2NVT J;  4M3E A;  2AHQ A;  1B8I B;  3JRF A;  2ME0 A;  2LK2 A;  4M3F A;  2XB5 A;  1FIP A;  3BTJ A; 
#chains in the Genus database with same CATH topology
 4A3D J;  3VOK A;  2GOX B;  4C2T A;  1Z7L A;  1ETX A;  1IAW A;  4EV0 A;  4WIB A;  1R23 A;  3CCM I;  3SEZ A;  3OIO A;  4PFP A;  5KAF C;  1X3W B;  1SC7 A;  2L7K A;  2K9L A;  3TO6 A;  5K7Z A;  4E7H A;  2E34 A;  4OU0 A;  2CJJ A;  3L2U A;  3DEU A;  1DU0 A;  1RPW A;  2PI0 A;  4YZE A;  4PXI A;  3E5X A;  4BDY A;  4JKZ A;  2R5Z B;  5B1B H;  3ERM A;  3FHN A;  2M8G X;  1C0W A;  4RBO A;  2MBF A;  4J00 A;  3EUA A;  5E8G A;  2P5L C;  2R5Z A;  1YW9 A;  3RKQ A;  1K79 A;  3KYL A;  1ONV A;  1W36 D;  1OYY A;  3JRD A;  4LB5 A;  5F08 A;  4U9N A;  5FGL A;  4D5F A;  3Q0W A;  3G2B A;  3AAF A;  1KGS A;  1N78 A;  5FRN A;  3LHQ A;  4HYE A;  2V9V A;  3I64 A;  3HYI A;  5E79 C;  2L9N A;  1JI8 A;  3MZ8 A;  5C4J J;  1HW5 A;  2ZNY A;  1WPK A;  3CCJ I;  1I1S A;  5ILU A;  2NS8 A;  3EQL F;  2CQN A;  3F8M A;  1SFU A;  2XF7 A;  4X0G A;  3QP5 A;  4KA4 A;  1WWX A;  2OPT A;  3FBI B;  3FXU A;  4EM1 A;  4XL9 A;  2MFZ A;  5AON A;  5GTI C;  3G7R A;  2CW7 A;  4HDV A;  4M9Z A;  1A35 A;  3CJD A;  3HM5 A;  2GLO A;  3I4M J;  4BXX J;  2X1C A;  4N4N B;  1SAX A;  3I53 A;  4OAZ A;  2DG7 A;  1GUU A;  2IRF G;  2V1U A;  2P5V A;  3PIP F;  2HFH A;  4V2F A;  3SZP A;  4Y15 A;  3CUO A;  1H8A C;  3IWF A;  5J1R A;  2UUZ A;  3RQ4 A;  4L18 B;  3MKY B;  3VW1 A;  4NUB A;  3CO7 C;  1FJL A;  1TLH B;  4UV9 A;  2MLK A;  1SGM A;  1V5F A;  1WGX A;  3HUG A;  5K5O A;  1Z6T A;  2OZU A;  3DPU A;  2NS0 A;  5FHP A;  2TCT A;  2JT1 A;  1T2K A;  1Y0U A;  1DPR A;  2WWY A;  4LK1 F;  3RSN A;  1J5Y A;  4H4K C;  1XGO A;  1OIS A;  5H6Q A;  2FOW A;  3G1O A;  2K9M A;  5CYV A;  3I4N J;  1D0Z A;  4XON A;  3WGG A;  2W85 A;  4DVY P;  3J7Z I;  1DUX C;  5H9T A;  3F6O A;  1Z9C A;  5E18 F;  1HW1 A;  3E3V A;  2A6E F;  1ODD A;  3QPL A;  1EH7 A;  1G2H A;  4UUS B;  3D5S C;  3OIQ A;  4BL0 B;  3BR6 A;  3FXJ A;  2K40 A;  1JUS A;  1JTX A;  2WV0 A;  3DEE A;  4PFO A;  1GVD A;  1HDD C;  2V6C A;  1H9G A;  3S15 J;  5FO5 A;  2PMU A;  1OYI A;  5F04 A;  3KP4 A;  5LBQ A;  1ENH A;  4CDG A;  1YX3 A;  5A2Q Z;  1TL8 A;  2A5W A;  1SVL A;  3SXY A;  2FOK A;  5CJ9 A;  3OYE A;  4I01 A;  5IP7 J;  4MO7 A;  2CYY A;  4KIS A;  3VYT B;  2GZW A;  3ZPL A;  2DU9 A;  4M74 A;  3RZD J;  5EGO B;  3HJE A;  2B7E A;  3DU5 A;  1RUO A;  5DD4 A;  2QLZ A;  3MKW B;  3VUQ A;  2FXA A;  2DMQ A;  2EJR A;  5EGO A;  4M6X A;  4NQW B;  5FKO A;  1F4K A;  3PFI A;  1P2F A;  5KHD A;  1YW7 A;  3QKX A;  2O03 A;  2J5O A;  1G3W A;  4RS8 A;  4NQW A;  2RC4 A;  4AWX B;  5EYR A;  1ETV A;  1LEA A;  2BV6 A;  2FD5 A;  2P7C B;  3PUF A;  5DUI A;  3E6M A;  2HWV A;  1TWG J;  1V54 H;  1IRZ A;  5F1J A;  2O7T A;  2UXU A;  2DG8 A;  1QBJ A;  3FK6 A;  5M3F J;  4CCK A;  4KN4 X;  2EV0 A;  2W00 A;  3GTL J;  4QWQ A;  3FWE A;  2BBY A;  2EIL H;  3K4K A;  2DA4 A;  3G1M A;  1H0M A;  2Y0M A;  2XRO A;  2X48 A;  4HQM A;  3IH3 A;  1TT0 A;  3LSR A;  1X1D A;  2YX7 A;  4BY1 J;  4PZJ A;  3F8N A;  4HV5 A;  4BY7 J;  4MTE A;  5FJ8 J;  3OYA A;  3CES A;  3ZQ7 A;  3CCY A;  2CQX A;  3FXO A;  4BS9 A;  2VUM J;  4JNN A;  1Y39 A;  4G7H F;  1I50 J;  3KP3 A;  1IN8 A;  4Q4Z F;  1WFX A;  2LSO A;  4LD5 A;  2H6C A;  2DPU A;  2DDA A;  4BBS J;  4W97 A;  3IUV A;  4JX6 A;  1YJN I;  4JP0 A;  5KVR A;  4W1U A;  1I3A A;  5H6R A;  4MIM A;  3FKI J;  4FHT A;  3GO5 A;  2XVC A;  2FBQ A;  4PK4 A;  3CCS I;  4UB8 C;  5BOX A;  1SFE A;  2M0C A;  2DTZ A;  3OS2 A;  1TZL A;  3RPU A;  5ILV A;  4O5V A;  2MC3 A;  4U7D A;  3HRS A;  5AQC A;  1TNT A;  3BCA A;  5FKK A;  1S7A A;  3CCL I;  2Z99 A;  3H9G A;  3ZQC A;  3BG9 A;  1D8J A;  4G8X A;  4NC6 A;  1H89 C;  3ABU A;  4RB3 C;  5FRM A;  1BR4 A;  2VOD A;  3HTA A;  4N9I A;  3MKZ A;  4XM3 A;  3MQ0 A;  5ICF A;  4B3A A;  4IHS A;  2OU2 A;  2WAD A;  3I58 A;  2VLA A;  3KKD A;  3F21 A;  3ZXS A;  2FBI A;  3RI4 A;  2EFP A;  4M9S A;  2PX9 A;  2GFN A;  3W2W A;  3CD6 I;  3GEU A;  2XC7 A;  4ICH A;  3RZO J;  3LSJ A;  1UHW A;  4QPQ A;  3L7W A;  4RDU A;  3TED A;  1RIO H;  5M5W J;  4O3M A;  2ZSH B;  1RRJ A;  2KIM A;  3IKV A;  2RKH A;  2NS7 A;  3HSR A;  3P9I A;  1YJ9 I;  3NPI A;  1QRY A;  3BTL A;  4XID A;  1TNS A;  2QQ9 A;  4HLY A;  4HA8 A;  4AVZ A;  4HF2 A;  1QGP A;  4AD9 A;  3GWZ A;  1GV5 A;  2M1B A;  2DFE A;  1ACI A;  2GIV A;  2UXN A;  4OIO F;  2PMZ A;  3KP6 A;  1QHG A;  3NEU A;  1FP1 D;  3QYE A;  3J81 K;  1G3T A;  2EZK A;  1HSJ A;  3GTK J;  3HOZ J;  1KON A;  1BJA A;  1HDP A;  4A3I J;  1R5I D;  3LSI A;  4IOA F;  4XLH A;  1V4R A;  1R71 A;  1Z77 A;  3V8K A;  2DXI A;  2ZCM A;  4WK8 F;  2V6E A;  1XC5 A;  2W84 A;  2BGC A;  4KWA A;  4EGZ A;  3R60 A;  3ECO A;  5C4X J;  4GCK A;  3P9K A;  2JMW A;  4ZDO A;  2NNY A;  1Z0X A;  3EDP A;  3I56 I;  1WSU A;  1W4M A;  3BR5 A;  2M30 A;  4R1H A;  2XGE A;  3C2G A;  3SEQ A;  3SZT A;  5KAI C;  3RIR A;  3KEO A;  1WI3 A;  3M7G A;  1R36 A;  4WXC A;  5E3L A;  3ZMD A;  5HNH A;  2HVR A;  2RHA A;  3NXC A;  3TO9 A;  2A69 F;  3VOX A;  2HOE A;  2WC2 A;  1NTC A;  3GFM A;  4XKV A;  4C3H J;  1QO0 D;  1ITY A;  3EUK L;  3JSP A;  3WTW C;  3JAM K;  1MSF C;  1D1B A;  4RAG A;  4ZTJ A;  2EK5 A;  4KMU X;  4LLL A;  3BTI A;  1WJA A;  3AQS A;  3BZC A;  4HQE A;  1BI0 A;  2KLO A;  2F4M B;  5LRS A;  2Z5U A;  2R7R A;  3HIM A;  1PJR A;  3L9F A;  5D6F A;  2FBK A;  3DCF A;  1RKW A;  3UNG C;  5HBU A;  3VB2 A;  1HCR A;  1NG6 A;  1XMA A;  4DYQ A;  1Y1W J;  2ZCW A;  4ESB A;  3WU1 B;  2LH9 A;  3P7N A;  3CME I;  1ZAR A;  1QA6 A;  2CWE A;  2M3A A;  1QNT A;  2XAF A;  1XX5 A;  4G7Z F;  3K1N A;  1YIO A;  2BYV E;  3BP8 A;  2NXN B;  4N4O B;  4BHP A;  2O6G E;  1YTY A;  5E1Z B;  2VBZ A;  1ORK A;  5CPR B;  5JVT A;  3SQN A;  2IA1 A;  4GDF A;  2ZCN A;  5DUK A;  2BOL A;  5K5Q A;  2KRF A;  2JA7 J;  1A36 A;  2ELJ A;  1FPQ A;  3O3K A;  3PSI A;  3PM1 A;  2IA2 A;  5DEQ A;  5E3N A;  1EJ9 A;  3CJR B;  3KZZ A;  3GFJ A;  1A5J A;  3PJR A;  3NRG A;  2VIX A;  4J01 A;  2W24 A;  5D19 A;  1KZH A;  3WTS C;  3QWL A;  4G12 A;  3S1R J;  2UXI A;  2V9P A;  4BYY A;  5K1Y A;  2Y9Y A;  3K0L A;  1YW8 A;  2RVC A;  2EFN A;  4GYI A;  5EEH A;  4DZJ A;  2NP3 A;  5FKN A;  3I5U A;  3HC7 A;  4XR6 A;  1ZTR A;  3JRH A;  5FB2 A;  3GLL A;  3FIW A;  3LAP A;  2CV0 A;  4IQJ A;  3ELK A;  3VYR B;  4FQG A;  5LGN A;  3BRU A;  4F7Z A;  2Z9O A;  4K2E A;  2MG4 A;  4M3B A;  4AIJ A;  5HOO A;  1TWA J;  3S3M A;  5CVU A;  4KYW A;  3GTM J;  1YX5 A;  3BY6 A;  4M6V A;  3G6E I;  2FJ1 A;  4ZYE A;  5BPD A;  3OOU A;  4OMZ A;  2L7F P;  5GPA A;  1WJF A;  2IS6 A;  4KT6 A;  2VQL A;  4HST A;  5KNL A;  3RKY A;  3F8C A;  3AG3 H;  4MLO A;  5K58 A;  3KEY A;  3HOW J;  5LLQ A;  3T8T A;  4FX4 A;  2DPD A;  2KL4 A;  3MN2 A;  2CG4 A;  4C2M J;  5J1Y A;  2CQ7 A;  5CVJ A;  4XBF A;  4ZZL A;  2E7X A;  3CUQ C;  2M4G A;  1CGP A;  2G7S A;  1VQK I;  2VKE A;  2DK8 A;  3FK7 A;  1RZ4 A;  4WF2 A;  4UNO A;  3KP2 A;  5IOZ A;  2LD5 A;  2DMU A;  3VVY A;  3NQO A;  2CW0 F;  2DI3 A;  2COB A;  2MAB A;  5JR3 A;  5HLG A;  2IGN A;  2ISY A;  4C2U A;  4HKU A;  3WTU C;  2VKD A;  2X1D A;  1UI6 A;  1Z3X A;  2BXZ A;  2FML A;  4QPO A;  4CA0 A;  4FIS A;  2OF7 A;  1X4O A;  4A3F J;  3WG7 H;  3HE0 A;  2CSO A;  1VQP I;  2R93 J;  4WX9 A;  3EYI A;  3KYC B;  2Y48 A;  2BY1 A;  5F6F A;  2K4B A;  3X2Q H;  2PJR B;  3PQK A;  2KRC A;  1X1P A;  2ZFU A;  3PO3 J;  2K5C A;  4A3K J;  2QCO A;  1HLV A;  2M45 A;  2V1N A;  3BJA A;  1V5G A;  3LFK A;  5DTD A;  2PJR A;  1TQP A;  4A93 J;  3GXO A;  3B6C A;  3QPT A;  3H5N A;  3HOY J;  4M9X A;  4XLN F;  2IA0 A;  1TTY A;  3ZQH A;  1ZLK A;  3ZN0 A;  4UV8 A;  2DMN A;  1LDK B;  5J47 A;  1K78 B;  2D6Y A;  1O3T A;  5JFR A;  3K4N A;  5DYM A;  3I0T A;  3CWR A;  3VW2 A;  5ICC A;  2A68 F;  2RNG A;  2HXO A;  3R4K A;  3ZMT A;  5FLV A;  9ANT A;  1AKH B;  5JVG F;  4Y52 J;  3SDB A;  3NAR A;  4RGR A;  1IN6 A;  3I71 A;  5ERI A;  2M9H A;  2CQK A;  3JRI A;  3RH2 A;  2QM3 A;  4A69 C;  1U9N A;  3H36 A;  1U2W A;  1R7J A;  5HS9 A;  3T8R A;  1AKH A;  2ICW G;  2YU9 J;  2HZD A;  1J9I A;  1T0F C;  3I3L A;  4YIF A;  2BVL A;  2QBY B;  4IRG A;  4QLC U;  1X58 A;  2R3S A;  2Q24 A;  4HAM A;  2HGC A;  4AC0 A;  2KPM A;  3HL2 A;  1MBF A;  4FE4 A;  3CF5 F;  3WTX C;  3BZK A;  4M3D A;  1UZC A;  2KHM A;  3S3N A;  4HF1 A;  4M3F A;  5JHU A;  4S05 A;  1FBU A;  1V55 H;  4XLC A;  2QTQ A;  4KNY A;  4XQF A;  4HSR A;  2GXB A;  3TDZ C;  4AM3 A;  2XAH A;  1LQ1 A;  3LL7 A;  5B66 C;  4E4H A;  3PO2 J;  1WJE A;  2DW4 A;  4PGG A;  4BUP A;  2K9Q A;  5EF6 A;  1SD5 A;  2Y9Z A;  5DCF A;  1YRN A;  1NK2 P;  2CU7 A;  2M8E A;  4P55 A;  3A02 A;  3SJM A;  1G59 A;  1KU7 A;  2DA7 A;  4P96 A;  2VON A;  3CO6 C;  3F9K A;  1ON2 A;  4C9Y A;  3CCE I;  3MZY A;  4JBA A;  5LD2 C;  1JGS A;  4LIV A;  3CMM A;  3O6B B;  4HZF A;  2OV7 A;  3J7A Y;  4L5J A;  3J80 Z;  4IXA A;  2FA5 A;  2P5K A;  3M4O J;  1KQ0 A;  3ANP A;  3HIF A;  1YS6 A;  1P92 A;  2Q2E B;  3QRF F;  4L9V A;  4FET A;  1H9T A;  5EZG A;  1P7I A;  5HOD A;  4IQ4 A;  4CSW A;  2JK3 A;  4XIC A;  3L2V A;  2FNA A;  5HS8 A;  1MMG A;  2ZB9 A;  2DA3 A;  2PBI A;  2D2W A;  1BOB A;  2EH3 A;  1OQY A;  1G3Y A;  2Y69 H;  2ZY9 A;  3HTJ A;  1S7O A;  2K27 A;  3ZQL A;  4BDZ A;  1EH6 A;  4ASN A;  3O8G A;  4DQ2 A;  1IV8 A;  1J7K A;  2O5R A;  3ABL H;  5F0H A;  3I4P A;  1NG7 A;  2QKM B;  1X4P A;  1RC9 A;  3WTY C;  1L0O C;  2JRM A;  1R22 A;  4C30 A;  5CQG A;  2NVX J;  2XB0 X;  4RM2 A;  2X9D A;  2G7H A;  4IEJ A;  3LSP A;  1K4S A;  3JSO A;  1R1V A;  1R1T A;  4U7B A;  3ERE D;  5IT9 K;  1BN5 A;  5C4Y A;  2RN7 A;  2WAQ N;  1S72 I;  5M5Y J;  3GUD A;  2LLK A;  4IVN A;  2IVM A;  4RMN A;  2CO5 A;  1IN7 A;  1GT0 C;  2DMT A;  3P9C A;  2VBW A;  4XOP A;  3ZQG A;  5HDK A;  5D5W B;  1ETQ A;  1MNM C;  2LY1 A;  1DQU A;  1M1E B;  4XLA A;  4RB0 A;  3GLX A;  4CZZ A;  2DAO A;  1LVK A;  1SD4 A;  3KET A;  2NX4 A;  4L62 A;  1W7P B;  1K6Y A;  1AWC A;  4XOT A;  2K02 A;  1ZG1 A;  3QU6 A;  3VSL A;  1OYW A;  3G1L A;  2K86 A;  3ISP A;  2RAE A;  3M1C A;  6PAX A;  2WAQ A;  3QU3 A;  1W7P A;  1XSX A;  3R6S A;  2DOD A;  1JT0 A;  5K7F A;  1B72 B;  3NNR A;  1EF4 A;  3WHC A;  2MD0 A;  2B1E A;  4KIF A;  1T98 A;  1QQI A;  2BY3 A;  4BU2 A;  3DEW A;  1D0X A;  1JXS A;  1B72 A;  3W2V A;  2HU9 A;  1TC3 C;  3G56 A;  3FXR A;  2WBM A;  3TW7 A;  4I99 C;  5FFX A;  1H88 C;  3H3U A;  3LWJ A;  1JE8 A;  2OER A;  4BJT A;  1I39 A;  1IUY A;  1X3U A;  2H1L A;  2DCE A;  3VOE A;  4EVI A;  3ABM H;  2HPM A;  1BIB A;  5L3D A;  2W4S A;  3TDU C;  4OMY A;  4ITV A;  2X6W A;  2IS1 A;  1IRX A;  1LPQ A;  4GGG A;  1B8I A;  4V2G A;  1E2X A;  1ZKG A;  1XDS A;  2YS9 A;  2Y2Z A;  1TBX A;  1ZRF A;  2ELK A;  3S32 A;  1GDT A;  1I5Z A;  4OD4 A;  1R9T J;  3H5R A;  5E8I A;  1FNN A;  1QZZ A;  4G6Q A;  2AS5 F;  2H8R A;  2HPI A;  1VND A;  2QKL B;  1T8I A;  1Y0N A;  3BPX A;  2CMP A;  4IOC F;  1BI3 A;  2R7U A;  4A3M J;  1LEB A;  2RRE A;  4HG2 A;  1Z67 A;  2HXI A;  1V5E A;  1JJ6 C;  3H9Q A;  2ECB A;  2COM A;  1MBK A;  2G7L A;  1GHC A;  2FUG 2;  2R4G A;  3SDG A;  2ZOZ A;  3E1S A;  3AL0 C;  1ZYR F;  1KYW A;  3HGG A;  2BE5 F;  1R1U A;  2P6T A;  3FMS A;  3JTH A;  4CCN A;  1MKM A;  4KFC A;  4UDS A;  3DF8 A;  3H0G J;  3KLO A;  4HOB A;  2L5Q A;  4XRF A;  2ZKZ A;  1KA8 A;  1JKQ C;  3TP0 A;  2HQR A;  3V7C A;  4YEJ A;  2ADU A;  1HKS A;  2ZXI A;  4KMF A;  5DV5 A;  4U0Y A;  3G3Z A;  1D5Y A;  1MDM B;  3C2H A;  2CV2 A;  1I6H J;  3DTI A;  1O57 A;  2ESN A;  2LY2 A;  3QOE A;  1JHF A;  2ZME B;  1MDM A;  2ELH A;  3K6G A;  1XSD A;  4B4C A;  5D4R A;  3HOT A;  2DK5 A;  4DBQ A;  2ZME A;  5LHG A;  4Y3O A;  1DPU A;  2QZ8 A;  3KCC A;  2F5D A;  2KDO A;  2PZ9 A;  3DKX A;  2V9K A;  1SVM A;  1Z7U A;  4PGH A;  1BW5 A;  4D0P A;  2QYO A;  2W57 A;  2O8K A;  1T56 A;  2VAS A;  2QOP A;  3T6N A;  1U6G A;  5FKM A;  5M5X J;  1O3R A;  1HOM A;  4Y17 A;  2ZNZ A;  2R7Z J;  1UAA A;  1U8R A;  4ZTF A;  3NWT A;  5D4S A;  4MK6 A;  1UHM A;  2GXA A;  4BAC A;  3K4C A;  4EJO A;  4PDK A;  2E7W A;  3DV8 A;  3H1C A;  2R7Q A;  3ZGK A;  4XRM A;  1U9O A;  2GIZ A;  2XRN A;  2EIM H;  3KZ9 A;  3PAS A;  4UUS A;  2AQF A;  2EFO A;  3FRQ A;  1PP8 F;  1ETW A;  2A5Y B;  2QA4 I;  1B1B A;  5EEG A;  5GAD J;  1N77 A;  3K1P A;  4C3J J;  2ZBK A;  3LSK A;  2H8W A;  4A3J J;  1NH3 A;  2YUS A;  3LAJ A;  5D5U B;  5LHI A;  4G6D A;  3VYS B;  2VE9 A;  2F5C A;  4JYK A;  1MMD A;  1Y56 A;  1J09 A;  3FXL A;  2EPF A;  1IXC A;  4M71 A;  3M9A A;  4M72 A;  1OCR H;  4BGD A;  1B9M A;  1LDD A;  5IY5 H;  1Z6R A;  4DNC A;  1USS A;  4YFN F;  4ENN A;  1ZH5 A;  3KNW A;  3BR2 A;  1QVU A;  3KE2 A;  1PUE E;  3B02 A;  4FT8 A;  1HF0 A;  2BEO A;  4IX7 A;  2EV6 A;  4HNU A;  3WU2 C;  3KFW X;  2K9N A;  2L01 A;  4XK4 A;  2WV1 A;  2EZI A;  4CH7 A;  4D5C A;  4B44 A;  1JGG A;  3W2A A;  3BPV A;  1FYL A;  2K3F A;  2XSD C;  1RR8 C;  5J6X A;  4A3L J;  3D0S A;  3EUH A;  2MW8 A;  2ZC2 A;  3CJN A;  1IJW C;  4WXD A;  1VFC A;  3GTG J;  1K4T A;  3IC7 A;  3TOA A;  4EQQ A;  4M6Y A;  4NDL A;  2JA5 J;  2VPR A;  5GAG J;  4CCO A;  3LQR A;  3S1N J;  4FAS D;  2LYC A;  2VC1 A;  1SMT A;  3TO7 A;  3GVA A;  1XPX A;  1G3S A;  4IHV A;  4ZZD A;  2M87 A;  5JLW A;  2JQ7 A;  3FBN B;  1ZQ3 P;  2E71 A;  3CMA I;  3TMO A;  3ABT A;  2Z33 A;  2EA2 A;  2YVE A;  5AIP A;  3HHG A;  2GWR A;  1XSV A;  2CUJ A;  4I02 A;  4D7N A;  1B9N A;  3OY9 A;  2VOO A;  2CV1 A;  3WOD F;  3KP7 A;  4CIC A;  5FRO A;  2Z16 A;  1O4X A;  1IUF A;  4B47 A;  3HB9 A;  1XMK A;  1FTZ A;  2MH2 A;  2NVY J;  3M1E A;  1ERD A;  5J4V A;  1RUN A;  3COA C;  1CQT A;  1YYV A;  1IXR C;  2CH0 A;  4E7I A;  2Y75 A;  3T0Y A;  1CF7 B;  2B0L A;  2F5F A;  2A07 F;  3I54 A;  2KZG A;  4F52 A;  3L00 A;  3OSG A;  4HV6 A;  4BEH B;  1KQ9 A;  2L9R A;  5M3M J;  1BC7 C;  4BHC A;  1E17 A;  2VOP A;  4UVC A;  1J2X A;  2XF5 A;  3KPH A;  4BEH A;  3PFY A;  5L3F A;  1MGT A;  1TP4 A;  2DN0 A;  2PFB A;  2YU3 A;  1TT5 B;  2IXS A;  4NC7 A;  4KIG A;  2ZXJ A;  4PCQ A;  3TL4 X;  2REK A;  2UV1 A;  1MH4 A;  1Z91 A;  2RDP A;  1A04 A;  3FX3 A;  3V4G A;  5FMP A;  5IYC J;  2EV5 A;  2YVH A;  4MEX F;  2JJ7 A;  2R7T A;  4L9T A;  2HOA A;  3LST A;  2OCC H;  3UR3 C;  3SHF A;  3D5R C;  3DPJ A;  3GFL A;  2VXZ A;  2VJI A;  3QP6 A;  4NHJ A;  2XKP A;  1LDJ A;  1TQI A;  4RB2 C;  2NNN A;  2HI3 A;  4E70 A;  5ED4 A;  4BBR J;  2F48 A;  2KZV A;  2O8X A;  4BHB A;  4RLF A;  4EJV A;  3GTO J;  1MBG A;  5C44 J;  1WJ5 A;  4UUT A;  4BJ6 C;  4ZJZ A;  1FMV A;  4RA2 A;  4LJZ F;  3B73 A;  4ENJ A;  5FKL A;  2NYX A;  3S8P A;  1SVO A;  2VQC A;  2XGD A;  1WJC A;  3ZRG A;  1SEU A;  5LRR A;  4F91 B;  4WWC A;  1TQM A;  3LFU A;  2DTR A;  1U5T B;  5DCM B;  3BJB A;  3OYK A;  2ZME C;  3DU6 A;  4RGS A;  1D1C A;  3ONQ A;  3JCU C;  4C2M A;  3R61 A;  1U5T A;  1BR1 A;  3C7J A;  3KX2 A;  5DCM A;  4B8X A;  2F5V A;  3FHZ A;  2V7F A;  4A2U A;  2DFF A;  2UXH A;  2YX4 A;  4YFX F;  1YE9 A;  5F0C A;  1BI2 A;  2X6Y A;  2OCE A;  4R8H A;  3SFI A;  3O60 A;  2HNH A;  2KRH A;  1X2M A;  2R0Q C;  5CXG A;  2AQE A;  2DJI A;  3FDY A;  3A0B C;  1NHA A;  1UHS A;  3ASO H;  4BAY A;  3G71 I;  1U3E M;  2W1O A;  3V42 A;  2HOT A;  4U88 A;  5BNG A;  5K5R A;  1E3O C;  4X6A J;  5LEK A;  2H1K A;  2M5W A;  2V1X A;  3PQJ A;  5J3L A;  2PLY A;  2QSG X;  1XDU A;  2XV4 S;  3S93 A;  3EET A;  2ZCX A;  4II2 A;  4F92 B;  4M3E A;  4LFU A;  4N9H A;  1GXQ A;  1J59 A;  3W6J B;  3KLN A;  4EJT A;  5HLT A;  2GA1 A;  2X85 A;  5HAW A;  3H9J A;  4YG2 F;  5C3E J;  3V78 A;  5IYD J;  3OYD A;  3QAH A;  1BBY A;  2J5P A;  2VJJ A;  1OCZ H;  1NK3 P;  1FOX A;  2DOA A;  2YR2 A;  2F2E A;  4II3 A;  2QEN A;  4PUS A;  4JK1 X;  2MLG A;  1MD0 A;  4C3I J;  2EFW A;  5HLI A;  4IKF A;  4OOI A;  4X1E A;  4AYB N;  4XN3 A;  2OD5 A;  2PQ8 A;  4L9J A;  2X0L A;  1B4A A;  5H20 A;  2JA6 J;  4CGZ A;  1XTA A;  4A3E J;  2E19 A;  1MJA A;  2QGU A;  2DA2 A;  5CVV A;  2P81 A;  4GXO A;  1IRG A;  3I55 I;  1N75 A;  1JUP A;  3WGI A;  3HZJ A;  4ON0 A;  4PSX A;  3N05 A;  1MMN A;  3BT9 A;  5D6E A;  1HA8 A;  1WHU A;  1ZGJ A;  1S8N A;  4XMY A;  4NB5 A;  3DTK A;  4ZYA A;  2X51 A;  3BZ6 A;  2E1M B;  3LA2 A;  3MVP A;  3S16 J;  1VQ9 I;  1MND A;  3TBI A;  1FMW A;  4OIR F;  4CCM A;  2QQA A;  3DKY A;  5D1R A;  2IJL A;  3CCR I;  1Y1V J;  1REP C;  2QQ8 A;  2R7S A;  3GTQ J;  2Y0S N;  3AKZ A;  3P9T A;  3ABK H;  3GX4 X;  4DYC A;  5D18 A;  2L4M A;  2GQQ A;  4H0E A;  1MJ9 A;  3BG6 A;  3QOP A;  4HW0 A;  3PUB A;  1SFO J;  2O3F A;  3BQZ A;  1PVE A;  1ULY A;  1STZ A;  2BZT A;  2DQL A;  4HNV A;  3DQV C;  2P8T A;  3O8H A;  4U0V A;  1YJW I;  3ULQ B;  2XPU A;  4DZP A;  4NBQ A;  3QBM A;  3TGN A;  1OLT A;  5E20 A;  2E60 A;  2DA1 A;  2LNB A;  1IDY A;  4U9L A;  4HX4 A;  2K85 A;  5HVQ C;  1D5V A;  2O7O A;  2G7G A;  3ZMZ A;  1HQC A;  3OYH A;  4KIC A;  3AQT A;  2QVO A;  1HKT A;  2LDU A;  3ECH A;  1BW6 A;  1X3Z B;  3IAM 2;  2XDN A;  1LE8 B;  3HRM A;  3QYF A;  2LG4 A;  2EZH A;  1RET A;  3OYG A;  3FXQ A;  2X6X A;  3A4C A;  2IU5 A;  4KUM A;  4P9F A;  3BR1 A;  1FOY A;  4ABZ A;  5FLX Z;  1VQ8 I;  1WVR A;  3GME A;  3I9V 2;  5L3B A;  2D5V A;  2CS3 A;  2P4W A;  3EYY A;  3G4S I;  4IHY A;  2JSC A;  1ZRE A;  2Q1Z B;  2WA0 A;  1HBX G;  2GAU A;  2L9S A;  1IN4 A;  3CDL A;  2E2H J;  2NAZ A;  3LQQ A;  3D5L A;  3BOQ A;  5IT3 A;  3IKT A;  1B59 A;  2MGQ A;  2Z1D A;  1J75 A;  4ENK A;  3OL3 A;  1MW7 A;  1K78 A;  4MGR A;  5E1W A;  3VWB A;  4N0B A;  1J0R A;  4B48 A;  4S0H B;  3GFI A;  2HZT A;  1VQO I;  2I10 A;  3IV5 A;  4KIT B;  1W0T A;  4Y7N J;  1Q1V A;  3F22 A;  1YFH A;  4M73 A;  2K9S A;  1G4D A;  3VTI A;  1S9H A;  4YIR X;  4XN0 A;  5HNF A;  3EGQ A;  2QBY A;  2LVS A;  2JVG A;  4NN1 A;  4RAZ A;  3RKW A;  2DJN A;  1UST A;  5BS6 A;  2EIK H;  5EDN A;  2VC0 A;  4I0A A;  2OAZ A;  3SWH A;  1LUJ B;  4ANJ A;  4DOZ A;  4UVB A;  2ZJQ F;  3VDX A;  1Y8R B;  4U0W A;  4A5M A;  3OSF A;  3LWF A;  2K4J A;  3L2C A;  3JW4 A;  2QIB A;  2IAI A;  2HOS A;  2XKO A;  1YG2 A;  5IP9 J;  2XUB A;  3K7A J;  5IPA A;  1OR7 A;  1FX7 A;  2BY2 A;  2ETH A;  1T08 B;  4XSX F;  2ZXW H;  2VT3 A;  2VJ4 A;  2F07 A;  3FMR A;  3S2D J;  2FX0 A;  4HEA 2;  3CCU I;  2O9L A;  4L0Y B;  1SFX A;  2PBX A;  2XPW A;  2CRG A;  4LG0 B;  1W0U A;  1O3Q A;  2OTL I;  3JSJ A;  2KJC A;  3K4B A;  3HOS A;  1OKR A;  3VIB A;  4JX4 A;  3GTP J;  1P9Q C;  3GEZ A;  3WTV C;  1BI1 A;  2FU4 A;  1ZR4 A;  1K6O A;  2HYJ A;  2Z3Y A;  2XRL A;  4BE2 A;  5IYB J;  1IXS B;  4MFE A;  1FP2 A;  2GOM A;  1PDN C;  4F3Q A;  5ILS A;  2L3D A;  2LP0 A;  2VBY A;  2UXP A;  3W6V A;  2HKU A;  3PPB A;  2UZK A;  1ZHF A;  2EB7 A;  3BJO A;  1R4M B;  3PNY A;  3OYI A;  2LMD A;  3DTE A;  2N8G A;  4ENM A;  3BR0 A;  3V6G A;  3V7S A;  5FLM J;  3RCO A;  3B6A A;  3ZN1 A;  1A31 A;  3LA7 A;  2GXG A;  2Q2E A;  1FSE A;  3MEX A;  1GXP A;  2UWM A;  3GYH X;  4A6D A;  4OD5 A;  2NP5 A;  1V3F A;  2LR8 A;  1IRF A;  3GZI A;  3GZN B;  2ECC A;  3BWG A;  3HRU A;  2MSY A;  5HDG A;  4BQN A;  4AIK A;  1JJ8 C;  1I6X A;  4PJL A;  1ZRD A;  2L7Z A;  5LFA A;  1ZAO A;  4I2O A;  1VI0 A;  1FBQ A;  2IP2 A;  3IH4 A;  1P4W A;  5ICG A;  4UY8 I;  4D1Q A;  5F0F A;  3V7R A;  3OYC A;  2EQR A;  2KT0 A;  1DU6 A;  5J40 A;  2JWT A;  4IRV A;  2HVS A;  3CRJ A;  4RLQ A;  3HSF A;  3Q9S A;  3DWL E;  2ME6 A;  3D1N I;  1QZE A;  4WXH A;  1YHQ I;  3BLY A;  2PFV A;  2ZJP F;  2JA8 J;  3OMY A;  5B3S H;  1BR2 A;  1RNL A;  2VJ5 A;  5EEA A;  3VPR A;  3QPS A;  2DBB A;  2VT2 A;  3GW2 A;  2A6T A;  2DFH A;  3DP7 A;  3AG1 H;  4M3G A;  4Y33 A;  2EZL A;  1W1W E;  2IW5 A;  3QPH A;  1WH5 A;  5DAJ A;  4IRI A;  1VQ4 I;  2FSW A;  3T1B A;  4QTR A;  2F5E A;  4XLP F;  3JTG A;  1ZK8 A;  5F1R A;  2H6B A;  1I1G A;  5FD6 A;  3DXJ F;  2HQN A;  2DT7 B;  2GBY A;  1B6A A;  2E1M C;  2E36 A;  2OA4 A;  4IL6 C;  3BRO A;  2HTS A;  5TJJ A;  2K3P A;  5IOY A;  2K7L A;  1UJ8 A;  2E2I J;  1T33 A;  5EG0 B;  2OQR A;  3J7Y J;  2HYG D;  4XRS A;  3OYJ A;  3IUO A;  2CUF A;  4XNF A;  1UCR A;  2E35 A;  3L09 A;  1U78 A;  1FTT A;  1RES A;  3BHQ A;  2H09 A;  3IH2 A;  4CCL A;  5DM6 F;  1Z05 A;  3LJL A;  1UB9 A;  1XN7 A;  2FE3 A;  2XGX A;  3CLQ A;  1G8X A;  2VN2 A;  1YIT I;  3S2W A;  5J1U A;  3KYD B;  2V79 A;  1UFM A;  3OYB A;  2JSP A;  3WE3 A;  5CKT A;  2HYF A;  1F5T A;  3C18 A;  2I8D A;  2HQ5 A;  3HPG A;  1JKR C;  2L4A A;  2IS4 A;  3HTI A;  4GCT A;  3IP4 B;  2G3B A;  3HTH A;  2LKX A;  2AXT C;  3B81 A;  2DDB A;  2FQ3 A;  1T95 A;  3NAU A;  4GRI A;  5DM7 F;  1POG A;  1R6R A;  3Q0U A;  2BXY A;  2OJE D;  1S3J A;  4GO1 A;  2HQA A;  3ZMU A;  5DDG A;  1RKT A;  2ZJ2 A;  2JPB A;  2B9S A;  4E7S A;  3MWM A;  4TV7 A;  4PJJ A;  4KIB A;  3ON2 A;  4E6K G;  3J80 K;  3E6C C;  2A6H F;  3DBH B;  2M34 A;  5JLX A;  2D1V A;  2F4O B;  2L2O A;  1MZB A;  3MMY B;  2BY0 A;  1PUF B;  3Q0V A;  1TWC J;  3WE2 A;  3GTJ J;  3W3C A;  2GEN A;  4XRS G;  2OZ6 A;  3ZP5 A;  1I3Q J;  1MBE A;  3BTC A;  4BH9 A;  4J19 A;  1PUF A;  3CJQ B;  4CYD A;  5H2F C;  1QPM A;  3FMQ A;  3NS4 A;  2HEO A;  1R5H A;  2XAJ A;  2OC6 A;  4LMY A;  2YPR A;  2RNJ A;  1FSH A;  1PYV A;  1X2N A;  4LLG F;  1O3S A;  4GFK A;  4RAY A;  1LFB A;  4MXM A;  2FEZ A;  4EAT A;  3ROU A;  4LLN A;  2XSJ C;  4KN7 X;  3P5J A;  1L3L A;  1KYZ A;  1MBH A;  1BJZ A;  3BDD A;  5J8C A;  2DFI A;  5L3E A;  1OCO H;  4HNT A;  4B09 A;  3JRB A;  3E5U A;  2VKH A;  2HYT A;  1FZP B;  1RI7 A;  3OR2 C;  2ZFW A;  2JN6 A;  1FEX A;  3GZ5 A;  3HTS B;  3FKJ A;  3Q5F A;  4ACI A;  1OR7 C;  3DPL C;  2QQB A;  2GM4 A;  2IGK A;  2DOF A;  3K4J A;  4DIQ A;  2DO7 A;  3KZY A;  2L54 A;  3F1B A;  3BG7 A;  3G73 A;  2WB1 N;  3PNT A;  1P4X A;  4BQQ A;  2QKO A;  4JL3 A;  5FD5 A;  3HUG B;  1FOW A;  3K8P C;  2LKP A;  3GCM A;  4G6T B;  3CC7 I;  2CW8 A;  2ZOY A;  3RTR A;  3RPQ A;  1T38 A;  4GCV A;  1DP7 P;  3LOC A;  5CVR A;  5D8L B;  1D8K A;  2RAS A;  3LNQ A;  5FFZ A;  3CJT B;  2FQ4 A;  2MC4 A;  3F3X A;  4HLX A;  2WB1 A;  3F23 A;  3NI7 A;  1FIA A;  2W25 A;  2X4H A;  4MNU A;  4A5N A;  1XGS A;  3RD3 A;  4RGU A;  3NWS A;  2R5Y B;  3LSH A;  3RDI A;  3S5R A;  4L5I A;  5EFY A;  4XKB A;  1YI2 I;  4A0Z A;  1UG2 A;  3U2R A;  1F1Z A;  2R5Y A;  3HKZ N;  2UXX A;  3WTZ A;  3N4M A;  4KJZ A;  2VI6 A;  3E97 A;  1UI5 A;  5CXI A;  4LIU A;  3J81 Z;  1ETO A;  3QOD A;  3BNI A;  5TRD A;  3S2H J;  3ZMV A;  2OBP A;  4KDP A;  4I7H A;  2ZO4 A;  2RQQ A;  5BPI A;  2W82 A;  3CCV I;  4IO9 F;  1FC3 A;  3K70 C;  4EGY A;  1F9N A;  4Z2Y A;  3S1Q J;  4B1R A;  3U9G A;  3TP3 A;  4FX0 A;  1ZRC A;  2H94 A;  3K2Z A;  3HOX J;  4IF4 A;  2OUM A;  4LIT A;  3ML6 A;  4CGR A;  3F8F A;  5TGT A;  2XGC A;  1F43 A;  3HKZ A;  3DPT A;  3SYT A;  2XIG A;  2G9W A;  5E3O A;  2R7O A;  2CUZ A;  1YIJ I;  2LBF B;  3M8J A;  3FXM A;  1WJD A;  2ISZ A;  4RM3 A;  2XF6 A;  2QWT A;  3ZQQ A;  4IRH A;  2AHQ A;  3JRF A;  2ME0 A;  2LK2 A;  1GVJ A;  2LBF A;  4ME9 A;  1FIP A;  2M0M A;  1OCT C;  3QQA A;  1Z3Y A;  2MA3 A;  3FM5 A;  3H35 A;  1MJB A;  1U8B A;  2CFX A;  2HR3 A;  2JRT A;  2R7D A;  3MD2 A;  2E1C A;  1WH7 A;  3JAM Z;  1AOY A;  5L3C A;  2W53 A;  3HHH A;  5LEJ A;  2DT5 A;  2B3W A;  1RR7 A;  1WJB A;  3JRA A;  3CC4 I;  4DBR A;  2F4I A;  3ZR8 X;  2HDC A;  1FYM A;  4OAY A;  3CUQ B;  4LGW A;  2KIF A;  1S5L C;  1SD7 A;  2V1D A;  2WAE A;  2VPL A;  2R7F A;  1TW2 A;  2LY9 A;  3VEP A;  1AU7 A;  2ID6 A;  1WRJ A;  1LVA A;  3OOP A;  2LRE A;  2TRT A;  5DD8 A;  3CUQ A;  4HF0 A;  3CLO A;  1GV2 A;  4LG3 A;  5JI6 A;  4D9J A;  3FF5 A;  3I59 B;  1R00 A;  3H3Z A;  3LSM A;  3SZG A;  2GA2 A;  3CP2 A;  3A01 B;  4IJA A;  3ZQF A;  3COL A;  3RPU D;  3EUP A;  3I59 A;  1ETY A;  1ZR2 A;  1R58 A;  4LB6 B;  2QSF X;  5BMZ A;  2CQQ A;  3A01 A;  4IHX A;  4EM2 A;  1VQ5 I;  2FNP A;  4YRV A;  5E17 F;  4FCY A;  1CF7 A;  1JKO C;  1IF1 A;  3OIP A;  2C6Y A;  1S6L A;  4AIH A;  3OR1 C;  4EJU A;  2EFQ A;  2STW A;  1Z1D A;  2FJI 1;  2JPC A;  3HGY A;  2HDW A;  3IRR A;  3S3O A;  1XB4 A;  3HXL A;  2EIJ H;  3E5Q A;  3AFH A;  2M2E A;  3DLL F;  4RB1 A;  1WCM J;  4R79 A;  1FBS A;  3MAJ A;  1KU9 A;  3FZV A;  2F6C A;  2X6O A;  3OV8 A;  2ESH A;  5CW8 A;  4YFK F;  2XAQ A;  1XCB A;  1BL0 A;  3ZCO A;  2PMZ N;  2A05 A;  3FM3 A;  3QYB A;  3T5X A;  1QHH D;  4UUV A;  4ZDL A;  4ZYD A;  4E7J A;  5A2Q K;  1HXD A;  2JTV A;  3K10 A;  4JOM A;  5KCM A;  1W36 C;  2WY8 Q;  2A2F X;  4CO8 A;  1T0F A;  2QEX I;  4IHT A;  4G7O F;  3H3V K;  4WCG A;  5HLH A;  4MFD A;  3JRC A;  1ZGW A;  2VXD A;  3CCQ I;  2DOE A;  5F27 A;  5HDN A;  1LFU P;  3K4M A;  3E0J B;  2KMU A;  1X1A A;  4GFB A;  4JQF A;  1IV6 A;  1SD6 A;  3M8E A;  4RAF A;  4AU7 A;  2CUE A;  4RGX A;  4HBL A;  1T6S A;  1ZEL A;  3KKC A;  2XAU A;  3ZOB A;  5L3G A;  2P7V B;  3MCZ A;  3HPH A;  3AG4 H;  2FBH A;  2FF4 A;  3MZH A;  2X1E A;  4PSW A;  3OS1 A;  2M4K A;  1MMS A;  3TKY A;  2Y30 A;  1EKE A;  3ZMS A;  2IS2 A;  4UHT A;  4L5E A;  3BG3 A;  3KEQ A;  1BM9 A;  2P6S A;  1K83 J;  1MSE C;  5IP6 A;  3JR9 A;  1SMY F;  4BQO A;  4BXF A;  2MD5 A;  3DBR B;  1P7J A;  3RYP A;  1IG7 A;  3HOV J;  1DP3 A;  3A1Y A;  3BCB A;  3CDI A;  4EM0 B;  3C07 A;  1JUM A;  1XS9 A;  3FXK A;  4Y4R A;  3S14 J;  4QSH A;  1EH8 A;  2R7W A;  4AUX A;  1VQL I;  4NNJ A;  5EJC A;  1IO2 A;  1DGR M;  3C1D A;  3LA3 A;  3IL2 A;  4A0Y A;  3E6D A;  2LKS A;  4E7Z A;  1FLI A;  4OIP F;  3K2A A;  4HX8 A;  4UVA A;  2MH9 A;  4MQ9 F;  2XDV A;  3JRG A;  1JTY A;  2LF8 A;  3AG2 H;  2KFD A;  3CMY A;  4A12 A;  1LFP A;  1D3Y A;  3CF2 A;  4P5O A;  3DLA A;  4HX7 A;  1KQ8 A;  1ZG3 A;  2VE8 A;  2ZJR F;  1QPI A;  3E6B A;  1VQ6 I;  1VF9 A;  2E1N A;  2JUC A;  2A3S A;  3IAS 2;  4PJ0 C;  3SFZ A;  3RYR A;  2XPV A;  3RQI A;  2E2J J;  5D5X B;  2XHK A;  4XOR A;  3F6V A;  3M07 A;  1LJ9 A;  2RQP A;  1TW3 A;  4B3X A;  1S7E A;  4BNC A;  4YII A;  4AVP A;  4CCJ A;  1FOK A;  2G7U A;  2AO9 A;  4IPA A;  2M7A A;  3MFK A;  2WUI A;  1O7F A;  2DYS H;  3KP5 A;  1IW7 F;  4BXU A;  3BC8 A;  4AYB A;  3L2Q A;  3UKG A;  1O7L A;  1XD7 A;  3F0C A;  4DYR A;  2PJP A;  3J7A O;  3F8B A;  5CQE A;  3EUH C;  1UG0 A;  2L02 A;  2HDD A;  3HOU J;  1E3P A;  4L9N A;  4HPQ A;  3WG9 A;  4MHG A;  2LC2 A;  3LMM A;  5E3M A;  4A3C J;  4P9U A;  3PNV A;  3CTA A;  4A6E A;  1P6R A;  2Z2S B;  1OMI A;  2YVX A;  2HTJ A;  1Z21 A;  2L7M P;  2QSH X;  3R0J A;  3R0A A;  2NOG A;  1U0J A;  2DQR A;  3A03 A;  4CYC B;  4GCL A;  1KU2 A;  3V8L A;  3L2W A;  2RGV A;  3BJ6 A;  1MBJ A;  1MH3 A;  3CC2 I;  3CP8 A;  4G94 A;  4IZZ A;  4CYC A;  3PL8 A;  3U1D A;  2QWW A;  1DGW Y;  2D1H A;  1JHH A;  5GTH C;  1A6I A;  4BJ5 C;  4D7M A;  2Y0S A;  4OIQ F;  1JT6 A;  5D5V B;  1FY7 A;  3DKW A;  1XGN A;  1N25 A;  1G6N A;  5LGT A;  2G0E A;  3K69 A;  2DMP A;  2LF7 A;  1DDN A;  4KT5 C;  2EA4 A;  1WZ2 A;  3S17 J;  4EJW A;  2D45 A;  2JZY A;  1YS7 A;  1LE8 A;  2QF7 A;  2GUH A;  2IPQ X;  3VVZ A;  1SAU A;  3HG9 A;  2KIQ A;  5HS7 A;  1LB2 A;  4G9Y A;  2OI8 A;  4BQA A;  4UXN A;  2RV8 A;  2LTP A;  3F72 A;  2HS5 A;  1WQ2 A;  4NC8 A;  4S04 A;  2Y31 A;  1D1A A;  1GLN A;  4PJM A;  1OCP A;  3M3Y J;  4GYG A;  2Q8K A;  4OWR B;  1FYK A;  2B63 J;  4F93 B;  1YOV B;  3PIO F;  4A3G J;  2KQR A;  5J8F A;  1FT9 A;  1QVT A;  1X19 A;  4E7L A;  3GZ6 A;  2WAF A;  3K4L A;  4DW6 A;  4QIW N;  1XMX A;  4ZYH A;  4ESF A;  1BC8 C;  3ON4 A;  3WU0 A;  3W6K B;  5FGM A;  4E7K A;  2WTE A;  4XKW A;  2R7X A;  1AHD P;  2DLL A;  1EV7 A;  1VQ7 I;  2NVQ J;  1E0E A;  2KP6 A;  3NRV A;  5D8K B;  5IT9 Z;  1APL C;  1X1B A;  5BQT A;  1WI9 A;  2R7V A;  2V57 A;  3HTU A;  4I6Z A;  2BVM A;  1E3H A;  2CFO A;  3Q9V A;  5CLS A;  1HW2 A;  3ZQI A;  3AL0 B;  1IN5 A;  1MMA A;  4ESJ A;  3GBG A;  4GFL A;  4A3B J;  1UMQ A;  2PN6 A;  1ZGA A;  4V19 K;  5K7H A;  5B1A H;  4ZYG A;  4FE7 A;  4CUG A;  5GAE J;  2E1O A;  2VBX A;  3TQN A;  2IBD A;  4BE0 A;  2KIS A;  3MKL A;  3KIO A;  3C2B A;  4I76 A;  2EIN H;  1Y8Q B;  2HVQ A;  2EWN A;  2QUF A;  1UEL B;  2O0Y A;  3EPZ A;  2CGP A;  2ZXH A;  4MQV A;  2LRD A;  5B5E C;  3C3W A;  2STT A;  1R49 A;  4PJN A;  1IC8 A;  1Q1H A;  1VQN I;  1QZY A;  3Q3S A;  1F36 A;  3K1M A;  1YLF A;  3DBL B;  2FRH A;  2PEX A;  2KIU A;  2ZSI B;  5DS9 A;  3MNL A;  1WKM A;  3IWZ A;  2VL8 A;  2EBI A;  1OCC H;  2IEK A;  2DA5 A;  1YO5 C;  5CVI A;  4Q48 A;  4MEY F;  4UB6 C;  3U1K A;  2E5N A;  3VP5 A;  3OL4 A;  4O6J A;  2DT6 A;  4LG0 A;  1U5T C;  1YRN B;  5EZH A;  3H5A A;  2AXL A;  1R4N B;  1MNE A;  3VOD A;  2IGM A;  2XAG A;  2KKO A;  2VKV A;  4NEL A;  3V8J A;  1Y6I A;  2HKO A;  1K61 A;  4ZC3 A;  1IDZ A;  2OQG A;  5GAH J;  4ETS A;  3TOB A;  1BIA A;  3ESW B;  5F64 A;  1SFK A;  4XLF A;  5LGU A;  1VZ0 A;  1XCV A;  3H92 A;  2TDX A;  1OFC X;  1P4A A;  4LK0 F;  3BQY A;  3WHB A;  1QU3 A;  1XG1 A;  3HBL A;  1ON1 A;  4ZH4 F;  3HRT A;  4I09 A;  1HKQ A;  4FTH A;  1YQA A;  4DJA A;  1PP7 U;  2NVU B;  2LOO A;  1VQM I;  4AF5 A;  3RKX A;  1HST A;  2JVH A;  1K7A A;  2NOJ B;  2IT0 A;  4IHW A;  2YSR A;  2H27 A;  4B43 A;  2R92 J;  4L0Z B;  5JHF A;  4I98 B;  5GP9 A;  3OYF A;  2L0K A;  3TW6 A;  3VW0 A;  1JKP C;  2M7B A;  4AID A;  5KK1 A;  2ACJ A;  3HDD A;  2JUG A;  4BKX A;  5J4Y A;  4BE1 A;  3OS0 A;  1X1C A;  4EEF G;  3A2K A;  3OYN A;  4Y13 A;  3M8F A;  1I27 A;  2BW3 B;  3OWT A;  5FLX K;  3K70 D;  3IHU A;  2NRA C;  2DYR H;  1A6Q A;  1FWZ A;  1BOA A;  2FMY A;  1OPC A;  1ZN2 A;  1ZLJ A;  2BW3 A;  4F55 A;  2BHZ A;  3DFG A;  4MTD A;  3OYL A;  1ETK A;  3N97 A;  2W7N A;  2WGB A;  2PG4 A;  2MYS A;  3O2P E;  1MIJ A;  2I5U A;  1W5S A;  4U87 A;  2OTJ I;  3HSE A;  1XGM A;  1OJL A;  2L9V A;  3S1M J;  2KJB A;  3K9T A;  4ZDP A;  3IRQ A;  5E1X A;  4OIN F;  2DA6 A;  3LSG A;  5AIQ A;  2UXO A;  1AA7 A;  4Q5S F;  1W5C C;  1KU3 A;  3WTT C;  4I0B A;  4XLE A;  4HRI A;  1IGN A;  3BCG A;  5HSZ A;  2V4J C;  4LOC A;  4HDU A;  3VSK A;  1W7P D;  3ASN H;  5EG0 A;  1BA5 A;  2IGO A;  2ID3 A;  4CHU A;  3E7Q A;  3L2R A;  3E7L A;  2Q0O A;  4DGW B;  3WGH A;  1R5G A;  2PMH A;  4XKC A;  1T39 A;  3BG5 A;  1LNW A;  5TIS C;  3RJP A;  1LKX A;  3VYU B;  2WY7 Q;  1SAN A;  2JA2 A;  5ICE A;  4Q47 A;  1D0Y A;  4EMS A;  3CZ6 A;  2V26 A;  1HC8 A;  3KZI C;  1TWH J;  3JRE A;  3ANG A;  2A61 A;  3GF2 A;  4CZC A;  3H0D A;  4AC6 A;  1TWF J;  5LHH A;  4P1W A;  2O61 A;  4JX5 A;  3CQZ J;  3U21 A;  4YEL A;  2HKX A;  3VVX A;  2P0W A;  3REO A;  2BHY A;  5GPC A;  3FIS A;  2W48 A;  4CXF A;  1IZ1 A;  3CDH A;  2VQG A;  1ZG5 A;  4XSZ F;  2LFB A;  1VTN C;  1S29 A;  2VB6 A;  2XAS A;  4A0X A;  3BR3 A;  3HEF A;  3VFZ A;  3PSF A;  3OYM A;  2NVT J;  2VQH A;  1W5T A;  4Z6Y A;  1EA3 A;  2E5Z A;  3A0H C;  1B8I B;  3L1P A;  2XB5 A;  2KDZ A;  3BTJ A; 
#chains in the Genus database with same CATH homology
 3QQA A;  4A3D J;  3VOK A;  2QTQ A;  1ETX A;  5HAW A;  1U8B A;  5C3E J;  3OIO A;  3V78 A;  1WH7 A;  5IYD J;  3PO2 J;  1NK3 P;  2W53 A;  2K9Q A;  5EF6 A;  1RR7 A;  5K7Z A;  2Y9Z A;  3JRA A;  1YRN A;  1NK2 P;  2CJJ A;  4C3I J;  1DU0 A;  1RPW A;  2CU7 A;  4YZE A;  4PXI A;  3A02 A;  4JKZ A;  2R5Z B;  3SJM A;  4X1E A;  2LY9 A;  2M8G X;  4AYB N;  1AU7 A;  4RBO A;  2ID6 A;  2DA7 A;  2TRT A;  2JA6 J;  2R5Z A;  3RKQ A;  1GV2 A;  2E19 A;  4A3E J;  2DA2 A;  3JRD A;  2P81 A;  3A01 B;  5F08 A;  1JUP A;  3ZQF A;  3COL A;  3EUP A;  4D5F A;  5FGL A;  3Q0W A;  1ETY A;  3BT9 A;  1ZR2 A;  3LHQ A;  4IHX A;  2CQQ A;  3A01 A;  5C4J J;  3MVP A;  1WPK A;  3S16 J;  2NS8 A;  4FCY A;  1JKO C;  3M4O J;  3ANP A;  5D1R A;  3HGY A;  5EZG A;  1P7I A;  1Y1V J;  2OPT A;  5HOD A;  3L1P A;  3GTQ J;  2Y0S N;  3G7R A;  3P9T A;  2KDZ A;  2JK3 A;  3CJD A;  4XIC A;  3HM5 A;  4DYC A;  2GLO A;  3I4M J;  4BXX J;  5D18 A;  2M2E A;  2ZB9 A;  2DA3 A;  2DG7 A;  1SFO J;  1WCM J;  1GUU A;  3BQZ A;  2EH3 A;  4HNV A;  3O8H A;  4V2F A;  3HTJ A;  2XPU A;  4DZP A;  2X6O A;  3ZQL A;  1H8A C;  3QBM A;  3O8G A;  5CW8 A;  5J1R A;  1BL0 A;  3VW1 A;  2DA1 A;  1IDY A;  5F0H A;  2PMZ N;  1FJL A;  2O7O A;  1SGM A;  2G7G A;  1WGX A;  3AQT A;  5FHP A;  2TCT A;  1BW6 A;  2NVX J;  2XDN A;  2XB0 X;  2X9D A;  4IEJ A;  3LSP A;  1LE8 B;  5C4Y A;  3G1O A;  2EZH A;  1RET A;  3I4N J;  2WAQ N;  2IU5 A;  5M5Y J;  4ME9 A;  4ABZ A;  3H3V K;  3BR1 A;  5H9T A;  2LLK A;  4MFD A;  3JRC A;  3QPL A;  2DMT A;  1GT0 C;  1OCT C;  3ZQG A;  1ZGW A;  1MNM C;  1ETQ A;  5F27 A;  4UUS B;  1LFU P;  2D5V A;  1G2H A;  3BR6 A;  4GFB A;  2K40 A;  1JUS A;  1IV6 A;  1JTX A;  4IHY A;  1GVD A;  2CUE A;  1HDD C;  3KKC A;  3CDL A;  3ZOB A;  2E2H J;  3S15 J;  5F04 A;  2NX4 A;  4L62 A;  1ENH A;  2MGQ A;  3G1L A;  2RAE A;  1JT0 A;  3NNR A;  1B72 B;  5K7F A;  5IP7 J;  1EF4 A;  2Y30 A;  4MO7 A;  3WHC A;  4S0H B;  3DEW A;  2I10 A;  3IV5 A;  1B72 A;  1W0T A;  4L5E A;  3BG3 A;  4Y7N J;  1Q1V A;  5EGO B;  3RZD J;  1TC3 C;  2K9S A;  3G56 A;  3TW7 A;  1K83 J;  1MSE C;  3VUQ A;  5IP6 A;  3JR9 A;  2DMQ A;  3EGQ A;  5EGO A;  1H88 C;  3LWJ A;  2LVS A;  2OER A;  5FKO A;  4NN1 A;  2DJN A;  5EDN A;  1P7J A;  3QKX A;  1IG7 A;  3HOV J;  5EYR A;  1ETV A;  1JUM A;  2FD5 A;  3C07 A;  1XS9 A;  3S14 J;  4QSH A;  1B8I A;  4AUX A;  1TWG J;  3OSF A;  4V2G A;  1IRZ A;  1ZKG A;  5F1J A;  2YS9 A;  2QIB A;  2Y2Z A;  2O7T A;  2IAI A;  2HOS A;  2UXU A;  2DG8 A;  3FK6 A;  5M3F J;  2ELK A;  3K2A A;  1GDT A;  5IP9 J;  3JRG A;  3K7A J;  3GTL J;  5IPA A;  1JTY A;  3CMY A;  1R9T J;  2DA4 A;  3G1M A;  2H8R A;  1VND A;  2X48 A;  2F07 A;  3S2D J;  1QPI A;  3IH3 A;  1VF9 A;  2FX0 A;  2O9L A;  2PBX A;  3LSR A;  2XPW A;  2CRG A;  4A3M J;  1W0U A;  2XPV A;  3RQI A;  2E2J J;  4BY1 J;  3JSJ A;  4BY7 J;  2HXI A;  1JJ6 C;  5FJ8 J;  3VIB A;  4JX4 A;  2ECB A;  3GTP J;  1MBK A;  2G7L A;  3CCY A;  2CQX A;  3SDG A;  2VUM J;  2ZOZ A;  4JNN A;  1S7E A;  1ZR4 A;  3HGG A;  2HYJ A;  2XRL A;  1I50 J;  5IYB J;  2AO9 A;  3H0G J;  4MFE A;  4BBS J;  4UDS A;  2WUI A;  4W97 A;  3IUV A;  4JX6 A;  4JP0 A;  1JKQ C;  2LP0 A;  2UXP A;  3TP0 A;  3W6V A;  2HKU A;  4W1U A;  3PPB A;  3UKG A;  4MIM A;  3FKI J;  4DYR A;  3F0C A;  2FBQ A;  2N8G A;  3V6G A;  3BR0 A;  2M0C A;  2HDD A;  2DTZ A;  5FLM J;  3HOU J;  3B6A A;  1D5Y A;  5AQC A;  5FKK A;  3ZQC A;  2NP5 A;  3BG9 A;  5E3M A;  1I6H J;  2LR8 A;  4A3C J;  1H89 C;  3HTA A;  3GZI A;  2ECC A;  2MSY A;  1JJ8 C;  2L7M P;  4B3A A;  4B4C A;  2NOG A;  4CYC B;  3A03 A;  3KKD A;  4GCL A;  2L7Z A;  1VI0 A;  1MBJ A;  3IH4 A;  1MH3 A;  4CYC A;  5F0F A;  2GFN A;  3GEU A;  2EQR A;  2KT0 A;  1DU6 A;  4ICH A;  3RZO J;  3LSJ A;  2JWT A;  2PZ9 A;  1A6I A;  4D7M A;  3CRJ A;  1JT6 A;  2ME6 A;  1BW5 A;  3D1N I;  4RDU A;  3TED A;  5M5W J;  2G0E A;  2O8K A;  1T56 A;  2QOP A;  3T6N A;  2JA8 J;  2DMP A;  5FKM A;  5M5X J;  2NS7 A;  3S17 J;  1HOM A;  3NPI A;  1QRY A;  3BTL A;  3VPR A;  5EEA A;  3QPS A;  2R7Z J;  4XID A;  2GUH A;  1LE8 A;  2QF7 A;  3VVZ A;  4MK6 A;  2OI8 A;  1GV5 A;  4M3G A;  2EZL A;  1WH5 A;  4XRM A;  2LTP A;  5DAJ A;  3GTK J;  1U9O A;  2EZK A;  2Y31 A;  3HOZ J;  4QTR A;  1OCP A;  3KZ9 A;  1HDP A;  4A3I J;  3M3Y J;  1ZK8 A;  3PAS A;  2B63 J;  4UUS A;  4A3G J;  1QVT A;  3FRQ A;  2GBY A;  1ETW A;  4DW6 A;  1Z77 A;  4QIW N;  2ZCM A;  5IOY A;  2E2I J;  3ON4 A;  1XC5 A;  1T33 A;  5EG0 B;  4KWA A;  1AHD P;  4GCK A;  4C3J J;  2NVQ J;  4XRS A;  4A3J J;  5C4X J;  2YUS A;  2JMW A;  2CUF A;  1APL C;  1Z0X A;  1FTT A;  1U78 A;  4JYK A;  1RES A;  2V57 A;  3BR5 A;  2XGE A;  3BHQ A;  3IH2 A;  4I6Z A;  3LJL A;  5E3L A;  1WI3 A;  3ZQI A;  3NXC A;  2RHA A;  3VOX A;  3GBG A;  4GFL A;  1NTC A;  4A3B J;  1UMQ A;  5J1U A;  4C3H J;  5K7H A;  1ITY A;  3KNW A;  4FE7 A;  3BR2 A;  1QVU A;  2E1O A;  1HF0 A;  1MSF C;  2IBD A;  3BTI A;  3AQS A;  3MKL A;  2HQ5 A;  1JKR C;  2K9N A;  1JGG A;  4XK4 A;  2WV1 A;  2EZI A;  3C2B A;  4D5C A;  3HTI A;  4I76 A;  4GCT A;  2G3B A;  3HTH A;  3HIM A;  2LKX A;  3B81 A;  2XSD C;  3DCF A;  4A3L J;  1RKW A;  5HBU A;  3NAU A;  2MW8 A;  1IC8 A;  1HCR A;  1POG A;  3Q3S A;  1F36 A;  1IJW C;  4DYQ A;  1Y1W J;  3Q0U A;  1VFC A;  3GTG J;  5DS9 A;  3MNL A;  4NDL A;  1RKT A;  2JA5 J;  2VPR A;  2EBI A;  2IEK A;  2DA5 A;  3S1N J;  3ON2 A;  3VP5 A;  1YRN B;  5JLX A;  2M34 A;  5EZH A;  4IHV A;  5JLW A;  1ZQ3 P;  1PUF B;  1ORK A;  3Q0V A;  1TWC J;  3GTJ J;  2VKV A;  2GEN A;  2ZCN A;  4NEL A;  2YVE A;  4XRS G;  1I3Q J;  1MBE A;  3BTC A;  4J19 A;  1K61 A;  2JA7 J;  1PUF A;  1IDZ A;  3PM1 A;  4D7N A;  5E3N A;  1A5J A;  3NRG A;  1X2N A;  5D19 A;  1O4X A;  1IUF A;  3HB9 A;  4G12 A;  3S1R J;  1FTZ A;  2UXI A;  2NVY J;  2Y9Y A;  1OFC X;  3WHB A;  1LFB A;  3BQY A;  4DZJ A;  4GFK A;  4MXM A;  2NP3 A;  1XG1 A;  3HBL A;  5FKN A;  1CQT A;  4FTH A;  1ZTR A;  3JRH A;  3FIW A;  4AF5 A;  1MBH A;  1BJZ A;  3BRU A;  3OSG A;  4IHW A;  2L9R A;  5M3M J;  2R92 J;  2MG4 A;  4M3B A;  3JRB A;  1TWA J;  3GTM J;  2HYT A;  5GP9 A;  4M6V A;  2FJ1 A;  2L0K A;  2JN6 A;  1FEX A;  3OOU A;  3TW6 A;  3VW0 A;  1JKP C;  2L7F P;  2DN0 A;  5GPA A;  4ACI A;  3HDD A;  4BKX A;  2REK A;  2GM4 A;  4MLO A;  4EEF G;  1MH4 A;  3HOW J;  3F1B A;  5K58 A;  5FMP A;  5IYC J;  3MN2 A;  4C2M J;  2YVH A;  5J1Y A;  2JJ7 A;  2HOA A;  2WB1 N;  2G7S A;  3DPJ A;  2QKO A;  4JL3 A;  2VKE A;  3FK7 A;  1ETK A;  2WGB A;  5IOZ A;  2LD5 A;  2DMU A;  3VVY A;  2COB A;  2ZOY A;  2HI3 A;  4HKU A;  4BBR J;  1UI6 A;  3LOC A;  1OJL A;  3S1M J;  3GTO J;  1MBG A;  5C44 J;  4UUT A;  3LNQ A;  2RAS A;  4FIS A;  2FQ4 A;  2OF7 A;  4A3F J;  3HE0 A;  2R93 J;  2DA6 A;  3LSG A;  5FKL A;  2XGD A;  2UXO A;  3NI7 A;  1FIA A;  3PO3 J;  3RD3 A;  4A3K J;  2QCO A;  1IGN A;  1HLV A;  3BCG A;  5HSZ A;  4LOC A;  2R5Y B;  5DTD A;  3S5R A;  5EG0 A;  1BA5 A;  5EFY A;  2ID3 A;  3E7Q A;  4A93 J;  3E7L A;  3B6C A;  1UG2 A;  3HOY J;  3BG5 A;  2R5Y A;  3HKZ N;  3BJB A;  3ZQH A;  2DMN A;  1SAN A;  2VI6 A;  1UI5 A;  5CXI A;  2D6Y A;  1ETO A;  3BNI A;  3CWR A;  3VW2 A;  1TWH J;  3JRE A;  3S2H J;  3ANG A;  2UXH A;  2HXO A;  5FLV A;  9ANT A;  1AKH B;  4Y52 J;  3NAR A;  4AC6 A;  5F0C A;  2M9H A;  1TWF J;  3JRI A;  3RH2 A;  4JX5 A;  4A69 C;  3S1Q J;  1U9N A;  3SFI A;  3O60 A;  3CQZ J;  1X2M A;  4B1R A;  2R0Q C;  3TP3 A;  1AKH A;  5CXG A;  2YU9 J;  3HOX J;  3VVX A;  4CGR A;  1UHS A;  5GPC A;  2XGC A;  3FIS A;  1F43 A;  1X58 A;  2W48 A;  2HOT A;  2Q24 A;  5BNG A;  5E3O A;  4AC0 A;  1E3O C;  4X6A J;  1MBF A;  2H1K A;  4FE4 A;  5J3L A;  2LFB A;  4M3D A;  3BR3 A;  3HEF A;  2QWT A;  2ZCX A;  2NVT J;  4M3E A;  2AHQ A;  1B8I B;  3JRF A;  2ME0 A;  2LK2 A;  4M3F A;  2XB5 A;  1FIP A;  3BTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...