3QPLA

G106w mutant of ethr from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTWINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator EthR
publication title Structural activation of the transcriptional repressor EthR from Mycobacterium tuberculosis by single amino acid change mimicking natural and synthetic ligands.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qplA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qplA02
3IH3A 3BQZA 5D1RA 3TEDA 1I50J 5EZHA 1Z77A 2XPUA 2YS9A 1I6HJ 4I6ZA 4BXXJ 3RH2A 1SFOJ 5IYDJ 3PPBA 4UUTA 3QBMA 1K83J 3KZ9A 4DZPA 3ON4A 3VOKA 3ZQHA 3KKCA 2WAQN 4A3MJ 1ETVA 3JRDA 3W6VA 1B72A 3FK6A 4C3IJ 2LR8A 4V2GA 1DU6A 2ZOZA 2AHQA 3BR5A 2R5ZA 2HOSA 4MIMA 1GUUA 3BNIA 5FKNA 1ETKA 5EYRA 2B63J 3E7LA 5IP7J 2EQRA 1LFUP 1AKHA 1JKQC 1HDDC 3ZOBA 3VPRA 3LHQA 4FCYA 2E2IJ 1IG7A 3NPIA 1MBEA 1IGNA 1GV5A 2CQXA 5IP9J 1BL0A 3HOXJ 4RBOA 3QPLA 2M34A 1MH3A 1JGGA 3TW7A 2DG7A 3F0CA 2ME0A 3HEFA 3GTLJ 1RESA 2ID3A 2L7MP 3BR3A 2E2JJ 1ZTRA 3SFIA 3H0GJ 2NVXJ 2GUHA 2R0QC 1VNDA 3TP3A 3CMYA 3TW6A 1BW6A 4QSHA 3MVPA 3FRQA 2M8GX 3VVXA 4XK4A 3JSJA 2ZOYA 1IRZA 5EZGA 2G0EA 2JA6J 5J1RA 5F27A 1RKWA 2Y31A 2LY9A 1VI0A 3CQZJ 4D7MA 5C4JJ 3HTJA 4XIDA 1G2HA 3GEUA 1TWAJ 2HKUA 2HOTA 2PMZN 3LSJA 3KNWA 2R5YA 4FTHA 2G7SA 3S17J 4MXMA 5HBUA 3VVYA 2L7FP 5M5YJ 3VIBA 3FK7A 3VUQA 3GTKJ 1WI3A 3S15J 4JX5A 1Y1VJ 5GP9A 1VFCA 5DS9A 1VF9A 4XRMA 3ZQCA 2Y9ZA 3HTAA 3PASA 1PUFB 4C3JJ 1U78A 3BTLA 1AU7A 3MNLA 4GFBA 3H3VK 1B8IB 2QKOA 4KWAA 4Y52J 3G1MA 1GV2A 1WCMJ 5IYCJ 5HAWA 2RAEA 5C4YA 1IDZA 3HOUJ 5J1UA 2GM4A 2DJNA 3GTQJ 2QWTA 1S7EA 1BA5A 2H8RA 5CXIA 1MSFC 4M3GA 1RKTA 2HQ5A 2UXHA 5E3MA 4JNNA 2OF7A 2YU9J 2RHAA 3LOCA 2LKXA 2NX4A 2QF7A 1FIPA 2JA5J 2XDNA 3HOVJ 5IOYA 1IJWC 5HODA 3JRAA 1HF0A 1P7IA 2LLKA 2D6YA 2L0KA 1MBGA 5FGLA 2XB0X 3A02A 3LSPA 2Y30A 1DU0A 3CDLA 2MGQA 2VUMJ 2XPVA 3BG5A 3ZQGA 3OSGA 1UI6A 4JYKA 2NP3A 3B81A 3S1QJ 1T56A 3WHCA 5GPAA 2DA1A 5M3FJ 3Q0UA 2R93J 3CCYA 2Q24A 4C3HJ 2X6OA 4XICA 1RETA 2CRGA 1Z0XA 3BJBA 4AYBN 3O8HA 3NNRA 1UI5A 2K9NA 3NXCA 2R92J 1FIAA 5FKLA 2MG4A 2ZCMA 4GFLA 4PXIA 4ME9A 2VKEA 4IEJA 2DMUA 1H8AC 1ZK8A 4QIWN 4UUSB 2O7TA 4L62A 2XSDC 4IHWA 1ETYA 5E3LA 5J1YA 2G7LA 2DA3A 1XC5A 2PBXA 4B4CA 1ZR4A 2PZ9A 3A01B 2DA4A 2RASA 4XRSA 2WUIA 4B3AA 2DMNA 3RD3A 3OOUA 1O4XA 3V78A 4M3DA 2E2HJ 2VPRA 5FJ8J 3RZOJ 3HOYJ 1IV6A 5JLXA 2IU5A 1QVTA 2HYJA 5IOZA 4MK6A 3I4MJ 3SDGA 1ORKA 1F36A 1ZGWA 1JKPC 1IUFA 5EG0B 1PUFA 3IH4A 1TWGJ 2GFNA 4W97A 3HE0A 1B8IA 1LE8B 1X2MA 2H1KA 2NS8A 4X6AJ 1OJLA 2QCOA 2E19A 2Y2ZA 2LFBA 1ENHA 2K9SA 2O9LA 2X9DA 5D18A 2WV1A 4GCKA 1IC8A 4CYCB 4AC6A 4BBSJ 2L7ZA 2HI3A 3RQIA 2UXIA 3NI7A 1ZQ3P 2EZKA 4M3BA 3CJDA 5FMPA 2HDDA 1QVUA 3GTJJ 3CRJA 5BNGA 1U8BA 3BR2A 2REKA 4DYCA 1RR7A 3BTCA 2DA2A 3GTMJ 1FEXA 3DPJA 3VVZA 2CJJA 4NDLA 4IHVA 3PM1A 4A3JJ 2ZCXA 3JRGA 4HNVA 5EFYA 4BBRJ 5E3NA 1RPWA 1FTZA 1I3QJ 2IEKA 2VI6A 3FISA 3S5RA 3C2BA 4A93J 2FQ4A 1MNMC 4X1EA 4W1UA 4DYRA 1FTTA 3JRHA 1JT0A 1UG2A 1POGA 2XGCA 4M6VA 5K7ZA 3O60A 2IBDA 5K7HA 3O8GA 2LTPA 3CWRA 2HXIA 1HCRA 4D5FA 3D1NI 4M3FA 1JT6A 2XB5A 5JLWA 3RKQA 1MH4A 2G3BA 2M9HA 2O7OA 1U9NA 2DMPA 3IUVA 3VP5A 1HOMA 2CQQA 1GVDA 3JR9A 2F07A 1JKRC 3HOWJ 3S2HJ 4NN1A 2Y0SN 3IH2A 3G1LA 4A3EJ 3VW2A 4JKZA 5EF6A 3JRCA 4UUSA 1JUMA 2YVHA 3VOXA 1BW5A 3E7QA 2ME6A 4D7NA 3S2DJ 3RZDJ 4DYQA 2COBA 3MKLA 1MSEC 4NELA 3V6GA 3HTHA 2UXUA 3ZQFA 1TWCJ 5CW8A 1JTYA 3A01A 1W0TA 1FJLA 3B6AA 1JKOC 1X58A 4I76A 4ICHA 4YZEA 5M5WJ 5CXGA 3DCFA 3K7AJ 3BRUA 3K2AA 3M4OJ 2EZLA 2XRLA 2HXOA 1Q1VA 2DMTA 2P81A 4C2MJ 1W0UA 4CGRA 5M3MJ 1ETOA 1JUPA 4ACIA 2W48A 4RDUA 1OFCX 2NS7A 5EG0A 4JX6A 4A69C 1H89C 5IPAA 4XRSG 5IYBJ 2GBYA 3QKXA 1JUSA 2DA5A 1LE8A 5J3LA 1NTCA 1LFBA 1GT0C 2NP5A 1WH5A 2JJ7A 2OERA 3TP0A 4CYCA 3QQAA 4DZJA 1NK2P 1WPKA 2WGBA 1OCTC 3COLA 2NVTJ 3NAUA 1MBFA 3ZQLA 3NARA 4GCLA 2FX0A 1JJ6C 4A3IJ 1X2NA 5H9TA 4LOCA 5F08A 1U9OA 3EGQA 3HGYA 1AHDP 5AQCA 4GCTA 3BT9A 2CUEA 3FKIJ 9ANTA 2CUFA 3GZIA 1YRNB 3HB9A 5FLVA 1T33A 4G12A 2XGEA 4ABZA 3HM5A 3WHBA 3L1PA 5FKOA 3VW0A 3HIMA 3C07A 2E1OA 2DG8A 3ANGA 3G7RA 2TCTA 2TRTA 5EGOB 3BTIA 3Q0WA 4A3BJ 5IP6A 3GTOJ 3VW1A 4JX4A 4Y7NJ 2LK2A 2JWTA 2GLOA 2HOAA 3PO2J 4A3GJ 1TWHJ 4QTRA 2XPWA 4AC0A 1ZKGA 2JN6A 1GDTA 1ZR2A 1A6IA 3BR0A 3HDDA 4DW6A 2FD5A 4M3EA 3S1RJ 3LJLA 2K40A 2ID6A 3S16J 3ANPA 2DN0A 1F43A 2GENA 3S14J 3HTIA 5EDNA 3BG3A 1MBJA 3JRFA 5F0FA 1SANA 3LSRA 4BKXA 2YVEA 4B1RA 3S1MJ 2UXOA 3IV5A 3G1OA 4MLOA 3BTJA 1JJ8C 4AUXA 5DAJA 2JA7J 2DA7A 4A3DJ 1JTXA 3QPSA 2R7ZJ 3FIWA 2K9QA 4IHXA 4A3FJ 2ECCA 2NOGA 2YUSA 1HDPA 2W53A 3LWJA 5FHPA 3LSGA 5K58A 1R9TJ 4FISA 4A3CJ 1QRYA 4MFEA 5FKMA 4MFDA 1SGMA 3PO3J 2QTQA 2JK3A 4D5CA 3AQTA 2NVQJ 3AQSA 2QIBA 4HKUA 3BR6A 2ECBA 3EUPA 4BY1J 2WB1N 2L9RA 1ITYA 5F0HA 4A3LJ 2EZHA 5F0CA 2G7GA 3GTGJ 1B72B 3A03A 5FKKA 1D5YA 3DEWA 4FE4A 4V2FA 1H88C 2EBIA 2R5ZB 3HKZN 4EEFG 1MBKA 4MO7A 3GTPJ 3KKDA 2M0CA 1ETWA 1ETXA 1AKHB 5M5XJ 3Q0VA 3I4NJ 2FBQA 4JP0A 1TWFJ 5F1JA 1UHSA 2MW8A 2I10A 4S0HB 4UDSA 2Y9YA 1Y1WJ 3T6NA 1CQTA 3BR1A 2X48A 3ZQIA 5C44J 2XGDA 2D5VA 2EZIA 1HLVA 1A5JA 5C4XJ 3ON2A 5FLMJ 1XG1A 1BJZA 5EEAA 2MSYA 2FJ1A 3G56A 3OIOA 2DA6A 3M3YJ 3B6CA 1YRNA 4GFKA 3UKGA 3JRIA 2M2EA 5K7FA 1K61A 2DMQA 5F04A 2JA8J 3S1NJ 4JL3A 1WGXA 3Q3SA 3HOZJ 5EGOA 3OSFA 2LP0A 2NVYJ 2OI8A 4A3KJ 2JMWA 2N8GA 4BY7J 1XS9A 2QOPA 1IDYA 2ZCNA 5C3EJ 2ELKA 1QPIA 3SJMA 2ZB9A 3BHQA 3MN2A 1P7JA 1ETQA 2KT0A 2LD5A 4FE7A 1EF4A 3BG9A 2R5YB 2KDZA 1UMQA 2IAIA 4AF5A 2O8KA 5D19A 3JRBA 4J19A 3BCGA 3JREA 1TC3C 2CU7A 3NRGA 2LVSA 1MBHA 4L5EA 3P9TA 5GPCA 3HGGA 1NK3P 3F1BA 2EH3A 2UXPA 1OCPA 2AO9A 4IHYA 2HYTA 1APLC 5DTDA 1E3OC 5E3OA 1WH7A 3GBGA 3HBLA 5HSZA 2V57A 2VKVA 3BQYA 3LNQA 2DTZA 2OPTA
chains in the Genus database with same CATH superfamily
4HDUA 1CGPA 3VYUB 4OOIA 3TEDA 3WTTC 4HNUA 3HZJA 3TBIA 4WK8F 2W4SA 3QBMA 5A2QK 2IPQX 2PFBA 1R22A 1R23A 2RDPA 2ZC2A 4Q48A 2ZJQF 3VYSB 5LD2C 4DZPA 1ODDA 4HF0A 2QEXI 4YRVA 2QKMB 2O8XA 3ABUA 1B72A 5FFZA 4C3IJ 2P4WA 3OYIA 4UHTA 1WKMA 1DU6A 1YIJI 4BJ5C 2R5ZA 1W5CC 1ZLJA 1FBQA 4MIMA 1U6GA 2L01A 3QP5A 2VJIA 3O6BB 3HL2A 3ABLH 1JKQC 4AVPA 2OZ6A 4PFPA 1HDDC 3ZOBA 3GLXA 1YLFA 3CUQA 3DP7A 1BL0A 3BJ6A 2ZFWA 2M34A 1MH3A 1JGGA 3CCQI 1SD6A 2VQHA 3OOPA 4CZZA 5HLTA 2HDWA 1A35A 3GTLJ 3SZTA 2ID3A 2PJPA 1ZTRA 3HC7A 2NVXJ 4B3XA 4ESJA 3DBLB 5BS6A 3Q9SA 5TRDA 4M71A 4XN0A 2ZOYA 4MTDA 2V6CA 1IRZA 2X51A 1RKWA 2Y31A 2LY9A 1VI0A 4EJVA 4XLPF 5C4JJ 2ZBKA 4E7HA 2KIMA 4XIDA 2BGCA 5CQEA 1TWAJ 3QAHA 2AXLA 3HRTA 5HS9A 2ZJ2A 4KIFA 2O3FA 2XROA 3QODA 1G3YA 2L7FP 3OYGA 2PMUA 3FK7A 3RKYA 1X19A 1WZ2A 2DOEA 1D1AA 3WGIA 1UHMA 3S15J 5D4SA 3DU5A 1L3LA 1Y1VJ 3HTAA 3HIFA 3ZQCA 3SEQA 2WAEA 4C3JJ 2BY0A 3MNLA 3W2VA 2XF5A 3H3VK 2QKOA 4Y52J 3G1MA 1WCMJ 1K6YA 2VT3A 3QYBA 3N97A 4KMFA 3WTSC 2M4GA 3DLAA 3LFUA 5J1UA 4Y3OA 4AWXB 1DPRA 1XD7A 2QWTA 2ISYA 2F2EA 4DIQA 2ETHA 4F92B 1BA5A 4MHGA 4LJZF 4M3GA 2Z3YA 3NS4A 4IQJA 5E3MA 1V5GA 1K6OA 3QWLA 5E1WA 2JA5J 1T95A 1TT0A 5HODA 3JRAA 3V7CA 3FDYA 4EATA 3OIPA 1T98A 1FT9A 2LLKA 2PQ8A 5DD8A 5J4YA 4BHPA 2VODA 2EV6A 2W82A 3A02A 3H35A 2OZUA 2VUMJ 1Q1HA 2HWVA 2XPVA 4LD5A 5E20A 3GW2A 2NP3A 3K1MA 3WHCA 2DODA 1K78A 3I71A 1XGSA 2HVSA 2RQPA 3CCYA 2Q24A 3BCBA 3OYNA 4RAGA 2EA4A 3H5NA 4JK1X 3TKYA 2MH2A 4V19K 5J40A 3ZMUA 3BJBA 1GLNA 4AYBN 3O8HA 1ON2A 1OQYA 2LH9A 3P5JA 5KHDA 2UZKA 3PJRA 3BG6A 1MDMA 1HW1A 3KLOA 2R92J 1VQ5I 3PL8A 1BIBA 2COMA 1UELB 4PXIA 5F64A 1DDNA 4BJTA 2G7UA 1PUEE 4HYEA 4ETSA 5CPRB 2VKEA 2HZTA 1ZK8A 3J81Z 1ZELA 3L2QA 5KK1A 1N25A 2XVCA 5E3LA 2DA3A 2K85A 2PBXA 1E2XA 1P9QC 1ZR4A 2EFPA 3A01B 1V3FA 3E97A 3K4LA 2DMNA 3RD3A 4P9FA 1FP1D 4HEA2 4BAYA 3EUAA 3CJNA 3LA2A 2WAQA 3L00A 2VPRA 3E5QA 3KETA 1E3PA 3AAFA 1ZRFA 1IN6A 5HLHA 2JUGA 1O3SA 2FMLA 1WJCA 3VSLA 4XQFA 2DOFA 3SDGA 1ORKA 4RB1A 1FLIA 2Q0OA 1ZYRF 3E6CC 2EIKH 1JKPC 1XMXA 5EG0B 2GFNA 4W97A 3HE0A 2DBBA 2NS8A 3BOQA 4PJ0C 4LB6B 2QCOA 5HLGA 4G7ZF 2K9SA 1MMSA 2ZXIA 2LBFA 4CYCB 3CF2A 1OCZH 3FX3A 4M3BA 1ZQ3P 3CJDA 3KLNA 4XLAA 3SFZA 2QSHX 1QVUA 2CV2A 2V7FA 1R5ID 5LHHA 4XKVA 1D8JA 2LC2A 3J80K 4U9NA 5BNGA 3MD2A 1ZHFA 2DA2A 5KAIC 3GTMJ 2ESHA 3C7JA 2JT1A 2DAOA 1BR2A 3F8NA 4BBRJ 4YELA 4IO9F 4FETA 2IS2A 3J80Z 2E1CA 3IRRA 1S3JA 2M45A 2VASA 1OYYA 3WE2A 5K1YA 3C2BA 2I5UA 2FQ4A 1A04A 3CO7C 1MNMC 3PNTA 4LMYA 3GCMA 3JRHA 3O60A 2DQRA 1WJ5A 4RA2A 3T8TA 4XLHA 2LTPA 3DEEA 3PIPF 2HXIA 2V1XA 4M3FA 5JI6A 1YJ9I 1MH4A 2B0LA 2IA2A 1U9NA 2BW3B 3C3WA 2X6WA 3DU6A 2DMPA 5E1XA 5ED4A 2D1HA 1GVDA 3FXUA 1JKRC 1WJFA 5AIPA 3HOWJ 1HC8A 4NN1A 2DFEA 3IH2A 3FXKA 4BS9A 2ISZA 2DYSH 2OC6A 3PUFA 2NVUB 1TQMA 2BV6A 1DUXC 3RZDJ 4DYQA 2Z99A 4UVCA 2FEZA 5BPIA 4LG0B 2TDXA 2OV7A 2X0LA 3KYCB 1LEBA 1W0TA 1U2WA 2QKLB 4I76A 2KJCA 2V9PA 4ICHA 3HOSA 5DM7F 5CXGA 3DCFA 2UXXA 2V9KA 4CCOA 3K2AA 2VIXA 3ZMTA 2Q1ZB 2AS5F 1BOAA 2O5RA 5M3MJ 1JUPA 1YX3A 3A4CA 2A69F 5JVTA 1WSUA 2HQNA 4RDUA 2KIUA 4KT5C 4JX6A 3CCEI 2QQ8A 1QO0D 1SVMA 1GXPA 2Z16A 5L3BA 2X1CA 1P92A 3ZGKA 1XMKA 2W25A 1G59A 4YEJA 2EFNA 3COLA 2NVTJ 3ZQLA 3NWSA 3P9CA 4LK0F 1X4PA 3IAM2 1X2NA 3R0JA 5H9TA 4NBQA 3F8BA 2AQEA 5F08A 1RUOA 3U1DA 3OS2A 5AQCA 1SAXA 3BT9A 2F4OB 1SD4A 3ZQ7A 3CC4I 9ANTA 2LKSA 1TT5B 3TDZC 3CJRB 3OYEA 4ABZA 1F9NA 3L1PA 3K4BA 3GX4X 3C07A 2E1OA 5DCFA 2DG8A 3G7RA 2P7VB 2TRTA 4OIRF 5EGOB 3Q0WA 4IRHA 3FM5A 4E7SA 3OYCA 1MMGA 5IP6A 4A3BJ 1OMIA 4XLNF 2NAZA 2LREA 1YE9A 3K4CA 4JX4A 2LK2A 4Y7NJ 4E7JA 2HOAA 2GLOA 2LDUA 4XN3A 2W57A 4QTRA 1FMWA 1R58A 1W7PB 3G6EI 1S7OA 3E0JB 1EH7A 2JN6A 2QGUA 4ZYDA 5E1ZB 4BE1A 3ZMSA 2FD5A 3ANPA 3S16J 2DN0A 4BACA 2GENA 4F7ZA 1HKSA 4LIVA 3S14J 3HTIA 1MBJA 1T6SA 3IKVA 5B1AH 3JRFA 2ZY9A 3I59A 3W6KB 2PN6A 2KRCA 2OA4A 3OYBA 2ZXHA 3ERMA 3BTJA 2JA7J 4HOBA 3SQNA 2K9QA 4RM2A 2YUSA 5D5WB 4CXFA 4OU0A 2HPIA 4FISA 5FKMA 4MFEA 4MFDA 3PO3J 2Z2SB 4NUBA 1S72I 1D0ZA 3UNGC 1ITYA 2LY2A 2EZHA 2BXZA 2MH9A 5F0CA 3WG9A 1SFEA 3LQRA 3CDIA 3MZYA 3A03A 3HSEA 4NC6A 4ZYEA 3FXQA 5FKKA 3BG7A 1UHWA 1Y39A 3GFJA 3COAC 2X6XA 5FFXA 3MAJA 3HSRA 4EEFG 2KQRA 5H6RA 2WC2A 4Y15A 1ETWA 3K1PA 4PZJA 3FBNB 3OWTA 5D6FA 1EJ9A 2HYFA 4JP0A 1TWFJ 2K4JA 4BJ6C 2I10A 4U7DA 4UDSA 1J5YA 4NC8A 4FX0A 3BR1A 2X48A 2OD5A 4HZFA 2L7KA 2Y0SA 1SAUA 1Y8RB 5FLMJ 1XG1A 3BPVA 2AXTC 3AKZA 2MC4A 3DPUA 3M3YJ 1RUNA 3RPUA 1X3WB 1YRNA 4XNFA 2DT7B 2G9WA 3ROUA 3JSPA 1Z7UA 1K61A 4Y13A 3G71I 4JL3A 1WJBA 3BWGA 3F72A 4M9SA 4U9LA 2VBWA 3H1CA 2V79A 3HOZJ 3HJEA 3VSKA 4BY7J 3S93A 1XN7A 4QWQA 2ZCNA 5C3EJ 2ELKA 2OUMA 3J7AO 4XM3A 4F91B 2DTRA 1OCOH 2DK5A 1ETQA 3EUHC 4BL0B 2LD5A 1EF4A 4IRIA 1MZBA 2CWEA 1ZN2A 2KDZA 2HKXA 2X6YA 1UB9A 2MYSA 1V55H 4NHJA 3VYRB 1DP7P 5D19A 3TDUC 4J19A 1F5TA 2L9SA 4M74A 3JREA 2Q2EB 2CU7A 1TC3C 2LVSA 4KFCA 5HS7A 4A0ZA 1QA6A 1HSTA 1XCBA 5GPCA 1OPCA 3HGGA 1NK3P 1D1CA 2CV0A 2NS0A 3F1BA 2UXPA 3HRMA 2FE3A 2E1MB 4HF1A 1OCPA 4I98B 3ZRGA 2R7FA 4L9VA 3CJTB 1YI2I 1FOKA 3KIOA 5H20A 3HBLA 5HSZA 2VKVA 4KMUX 3DXJF 2P5LC 3IRQA 4D1QA 3LNQA 4II2A 2OPTA 1S6LA 3JRIA 1TW3A 1MMDA 1I50J 2BY3A 4MQVA 2QSGX 5EZHA 1Z77A 3PPBA 4UUTA 4I0AA 1ZG1A 2VBYA 4LLGF 1G8XA 2MC3A 5FB2A 3KP5A 3KZ9A 2H6BA 3RIRA 3VOKA 4A3MJ 1ETVA 1O57A 3MEXA 1GVJA 3FZVA 4AU7A 2R7XA 1MD0A 3JCUC 2F4IA 3LSIA 2JRTA 4IVNA 1GUUA 1K7AA 3BNIA 2CW7A 5FKNA 2IVMA 2B63J 2KKOA 4E6KG 1AKHA 5ICGA 2F48A 4TV7A 4Y17A 4FCYA 3NPIA 2A61A 1BN5A 3S32A 3T1BA 3FHZA 5IP9J 1RZ4A 2BE5F 1QZYA 3JW4A 4RBOA 3QPLA 5FO5A 3TW7A 2ZCWA 3B73A 3F0CA 3HEFA 2M0MA 4RM3A 2L7MP 1SC7A 3BR3A 4L9TA 2E2JJ 4G7HF 3PUBA 3H0GJ 2GIVA 5LEKA 1VNDA 3GMEA 2OCCH 1KU9A 3BP8A 1BW6A 3LSMA 1YS6A 2LRDA 3ABMH 3MVPA 2CYYA 4XK4A 2IRFG 3FRQA 3DBRB 5F27A 2KRHA 3CQZJ 3S3OA 2BHZA 1G2HA 2A05A 3M8FA 4QLCU 1YO5C 3VFZA 4HF2A 2HOTA 2C6YA 2WB1A 4QPQA 3U1KA 3KNWA 5HBUA 3VUQA 3S17J 5CVVA 1XCVA 4CCKA 4S05A 1D8KA 2E35A 1BOBA 4M72A 5FROA 3JAMK 2VONA 2HR3A 4EV0A 3BJOA 1FNNA 4O3MA 1U8RA 5KCMA 1BC8C 2HTJA 3HKZA 4XRMA 3PASA 1W7PD 5DEQA 3WE3A 4UV9A 2A2FX 1PUFB 4P9UA 3U2RA 3BTLA 2PFVA 5HAWA 3R61A 1XTAA 1T08B 3WGGA 1D1BA 4PFOA 4X0GA 5C4YA 3K70C 4E70A 3F9KA 3R4KA 3JAMZ 3GTQJ 1PP8F 2K9MA 4F55A 4R8HA 2FNAA 2GWRA 2IS1A 1FOYA 1MSFC 1RKTA 1QQIA 2ZNYA 5HDNA 4XR6A 1YW8A 2MFZA 2CUZA 4XSZF 2P0WA 4YFXF 2CFOA 3LOCA 2DT6A 2E5NA 3OYDA 3S3NA 1B6AA 1FIPA 2BY2A 4KYWA 1TBXA 3HOVJ 1P7IA 4P55A 4OD5A 4KITB 3MMYB 2L0KA 2BXYA 2K3PA 3MZ8A 1V4RA 3GZ5A 2P5KA 3CDLA 4O6JA 4A2UA 4KA4A 1I27A 1B4AA 3H3ZA 3IP4B 4JYKA 1JI8A 1W36C 3AL0C 4G6DA 5M3FJ 1Z9CA 2BHYA 2ZKZA 2OJED 4C3HJ 2VQLA 2X6OA 3MKWB 4LG3A 4O5VA 1D5VA 2LF8A 2QQBA 3C1DA 3ZN0A 2V6EA 1I5ZA 3FHNA 3NWTA 2K9NA 3EUHA 4RAFA 5FKLA 5ERIA 3I4PA 2CQ7A 4IEJA 2JQ7A 1H8AC 4QIWN 4UUSB 4IOCF 5DCMB 2O7TA 2XSDC 4IHWA 1ETYA 3I9V2 1LKXA 2GXAA 1XDUA 2G7LA 4I0BA 4CSWA 1FC3A 4B4CA 2Z33A 2PZ9A 4N9HA 1R4NB 4XRSA 4S04A 2WUIA 4Y33A 3KP6A 3CMMA 3KEYA 3OOUA 1O4XA 2KRFA 1W1WE 4DQ2A 3HOYJ 4PK4A 4ZDPA 5JLXA 1QVTA 1FY7A 2HYJA 3I4MJ 4WWCA 1W4MA 2WAFA 4U0WA 1E3HA 2ZSIB 4M6YA 4XMYA 4EGYA 3IH4A 1TWGJ 4EJUA 4OD4A 1B8IA 3DTEA 1LE8B 3OYHA 4I09A 2DW4A 3G3ZA 4H0EA 3L2RA 1OJLA 1BR1A 2QBYA 2E19A 2Y2ZA 2VL8A 4BHCA 4PJLA 1QU3A 2UUZA 2O9LA 2X9DA 5CQGA 4AC6A 4M73A 2DCEA 3RQIA 2UXIA 1OYWA 4BEHB 5H2FC 1Y0NA 3O3KA 2K86A 4XRFA 3C18A 2DU9A 1U8BA 3BR2A 1ZH5A 2REKA 4DYCA 3BTCA 5ILUA 3IC7A 3HOTA 3VVZA 1OKRA 2CJJA 2HKOA 5JHUA 3PM1A 4HX8A 2X1EA 2GOMA 1YQAA 4AIDA 4I01A 5EFYA 4HNTA 5E3NA 2V1UA 3RYPA 1HQCA 1U5TC 1I3QJ 2BBYA 4A12A 2IEKA 1MW7A 3M07A 3H5AA 4GRIA 1FYKA 2UV1A 2R7SA 1TZLA 4RGRA 4DYRA 5J47A 2DJIA 4M6VA 2LF7A 4YIRX 4ENKA 4U87A 5K7HA 4MNUA 3CWRA 1SVLA 3K1NA 4BE2A 4WIBA 1HCRA 4D5FA 3D1NI 4XKBA 4EJTA 1X1BA 3RKQA 4PSWA 1IUYA 4OAYA 2M9HA 1TNSA 4QPOA 3ZPLA 2EJRA 3CF5F 4HDVA 1HOMA 2CQQA 1I39A 1IN7A 4XL9A 4AIKA 2RC4A 2XASA 4B43A 1SMYF 5KNLA 3G1LA 3VW2A 4JKZA 3K4MA 2ICWG 3JRCA 1JUMA 2YVHA 1R1TA 4L5JA 5D8LB 1UAAA 1BW5A 2ME6A 1FOWA 3S2DJ 3MKLA 3V6GA 5TJJA 3HTHA 3S8PA 3ZQFA 5CW8A 4F93B 1X58A 2CW0F 1WWXA 1TL8A 1M1EB 1F4KA 3RPQA 5M5WJ 2JVHA 3BRUA 3DV8A 4DBRA 3VTIA 1O3RA 1N75A 2JVGA 3MQ0A 3F21A 3ZMVA 1W0UA 2P81A 4CGRA 4R79A 2DO7A 3M9AA 4IHTA 2EILH 2W48A 4E7IA 3DTKA 2R7VA 5JVGF 1E17A 2NRAC 1YG2A 1Y0UA 5IPAA 4CICA 3J81K 4I2OA 1I6XA 2GBYA 2DA5A 2VE8A 4Q4ZF 3QPHA 4XLEA 1HBXG 5D5VB 1KYZA 2W24A 4BXUA 4C2TA 2OERA 4AYBA 2DLLA 3TP0A 4B48A 3J7AY 3QQAA 2BVMA 2P5VA 3L09A 3H9GA 1NK2P 1WPKA 4OIPF 1VQ4I 1JHHA 3NAUA 5LLQA 2CSOA 1FPQA 2FX0A 4A3IJ 4IXAA 4B8XA 3FM3A 5AONA 1ZARA 4AVZA 4ZZDA 3J7YJ 3CCJI 3DTIA 5LGNA 3HGYA 4K2EA 5J4VA 2P8TA 4GCTA 2FOWA 2CUEA 3CESA 4PCQA 3VYTB 5E17F 3BZ6A 2CQNA 2CS3A 3HB9A 1ZG5A 3G73A 1B9MA 2WV0A 4G12A 3ZXSA 3M8EA 3T0YA 4GCVA 1LNWA 3D5LA 3WHBA 3KE2A 1LEAA 3ANGA 2TCTA 3TL4X 4XLCA 2R7UA 3LL7A 5J8CA 3VW1A 1ZLKA 4LLNA 3SHFA 2JWTA 3ISPA 4ZDLA 4A3GJ 4UXNA 1S5LC 2GA1A 4ON0A 1WJDA 1X1CA 3BCAA 3KYDB 3HHGA 4EM1A 2XPWA 4AC0A 2VB6A 2KDOA 1A36A 1WFXA 1Z21A 2AQFA 2IGKA 1Z67A 4P5OA 3OYJA 1XGNA 1WJEA 1UCRA 3S1RJ 2V4JC 2VQGA 2ID6A 5KVRA 3AG2H 2W00A 2DOAA 1XMAA 2M7BA 2KJBA 3K4KA 1Z6TA 4ZZLA 4U0VA 1U0JA 1CF7A 3LSRA 2YVEA 2YSRA 3IV5A 4MLOA 1FYLA 2L5QA 2H1LA 4A3DJ 2VJ5A 1JTXA 4DGWB 5L3EA 1BI2A 4Q47A 3VODA 2NOGA 2W53A 3LWJA 2VC0A 2IJLA 2VT2A 3LSGA 2BZTA 2K7LA 2NYXA 4RMNA 1HKTA 4CO8A 2L02A 4UY8I 1MJ9A 4N0BA 1QRYA 2IA1A 2UXNA 5TGTA 3AG3H 4A3CJ 2QTQA 3H36A 2LSOA 1PP7U 4D5CA 2NVQJ 2QIBA 1WI9A 4PJMA 3IAS2 4OINF 3PSFA 2G7GA 3CZ6A 2H8WA 1B72B 2KLOA 3H9JA 3ERED 4KT6A 5HLIA 4Z6YA 1BR4A 1D5YA 3DEWA 4V2FA 4HLYA 1H88C 5JFRA 2EBIA 2R5ZB 3HRUA 4A6DA 1BC7C 1SFUA 1XSVA 1U3EM 4MO7A 3GTPJ 1U5TA 5CKTA 2BVLA 1JHFA 2FF4A 3Q0VA 3I4NJ 2RN7A 4XKCA 1VQ7I 3I3LA 3ZMZA 1ULYA 3A0BC 4RLFA 4S0HB 3CUQB 3CCMI 3I5UA 1HLVA 1OLTA 3I0TA 5HDKA 3I54A 2ZMEB 2WBMA 1BJZA 5EEAA 2MSYA 3HHHA 4UB6C 2JUCA 3OY9A 5CYVA 2PJRA 1IRGA 1SFKA 2M2EA 2XHKA 3RTRA 3K10A 1TQPA 2VC1A 5K7FA 1L0OC 2DMQA 5F04A 4J01A 4C2MA 1DGWY 2E5ZA 2E60A 2NVYJ 2OI8A 3I55I 2QUFA 4IKFA 5D6EA 1J7KA 1XS9A 4GXOA 2XGXA 4CGZA 4FE7A 3LSKA 3L2UA 3WG7H 2B7EA 3V8KA 1ZRCA 3LA3A 1X4OA 2B1EA 3JRBA 2YU3A 4B09A 4ENJA 4KDPA 2V1DA 3E1SA 4HLXA 1XGMA 4LLLA 1FMVA 3P7NA 2K27A 2AO9A 2HOEA 4IHYA 2HYTA 2CFXA 4BDZA 1WH7A 2PBIA 4OIOF 2CW8A 3VWBA 3BQYA 2J5PA 3H0DA 2KZVA 2OTLI 1USSA 2XRNA 3IH3A 4E7LA 3BQZA 3AFHA 1ZAOA 2KHMA 3OS1A 2XPUA 4ENMA 4D9JA 4BXXJ 3RH2A 1Y6IA 4HSRA 4NQWA 2RVCA 2M5WA 5IYDJ 4NNJA 2IT0A 3JTHA 5LRSA 2D45A 4ENNA 3CDHA 3ON4A 3L2WA 5HDGA 3CMEI 1N77A 2RREA 3TOAA 3JRDA 4AIJA 3Q9VA 3EUKL 2QA4I 2F5EA 4D0PA 2FJI1 3MKZA 4ZYGA 2PEXA 2ZOZA 3BR5A 5D4RA 3ZCOA 2LOOA 2HOSA 1W5TA 4AD9A 5EYRA 1LB2A 1V5FA 2GZWA 5IP7J 1LFUP 3AG4H 6PAXA 4ITVA 4EGZA 2MA3A 3M7GA 4UVAA 1BI1A 3VPRA 3LHQA 1ZRDA 3H5RA 4PSXA 1IG7A 3K6GA 1MBEA 4GGGA 4E7KA 1IGNA 1JXSA 1GV5A 2HQRA 1QHGA 2FBKA 4KN7X 1IAWA 1G4DA 1MDMB 3S3MA 1R1VA 3BPXA 2ME0A 3A0HC 5JHFA 1AOYA 1TP4A 3OYMA 2EIMH 5B3SH 3PFYA 3SFIA 2GUHA 2R7DA 2R0QC 2R7RA 3CMYA 1HKQA 3BLYA 3TW6A 4QSHA 2ELHA 2M8GX 2Y75A 1ACIA 1NG7A 5EZGA 1YFHA 2QQAA 3KEQA 3HTJA 1XGOA 3GEUA 4CCNA 3GLLA 2HKUA 4EQQA 2PMZN 2IGMA 3LSJA 2R5YA 4FTHA 1P4AA 3VVYA 2V26A 3R6SA 3AG1H 4WF2A 1D0XA 4CCMA 5H6QA 3CMAI 3TQNA 2JPBA 3SZPA 1WI3A 3DPTA 2DK8A 3CCVI 4G6QA 4JX5A 3DEUA 4II3A 3WGHA 4ASNA 5DS9A 1VF9A 1VFCA 2ADUA 1U78A 2ACJA 3KZYA 2ZNZA 4GFBA 2R4GA 4EJOA 1GV2A 3HUGB 5LBQA 2RAEA 2VLAA 2GM4A 2DJNA 3F8FA 4KUMA 1STZA 3ECHA 2P6SA 2LBFB 2RGVA 3F8MA 1IN8A 3RDIA 4RB2C 5CXIA 1XDSA 3OR2C 3TMOA 3QYEA 3RQ4A 2YU9J 2E34A 1TW2A 2XSJC 2NX4A 1J0RA 2FBHA 5DD4A 4A5MA 4F3QA 3EYIA 5IOYA 3FMRA 1IW7F 1YYVA 4ZH4F 1HW2A 4DNCA 1HF0A 2FBIA 4EMSA 2A3SA 1MGTA 3HYIA 2D6YA 1MBGA 5ILSA 3RJPA 2XB0X 4RAYA 3LSPA 1DU0A 2BOLA 2CO5A 2MGQA 2HVQA 3KP2A 3ZQGA 3OV8A 5ILVA 3OSGA 1T56A 2VBXA 5GPAA 4XBFA 2VQCA 3VEPA 3K9TA 1SFXA 3Q0UA 1SEUA 3VDXA 2QYOA 4XICA 2CRGA 4H4KC 1YTYA 1Z0XA 2VN2A 3NNRA 1R5GA 1R5HA 2ZSHB 3NXCA 2VXDA 5IT3A 5HNFA 1XSXA 3PNVA 4ESBA 2MG4A 1YJNI 2ZCMA 4ME9A 1OR7C 4UUVA 1ZG3A 5TISC 2EFWA 1PDNC 1G3TA 3BDDA 1RI7A 1IXRC 2JA2A 3FMQA 4L62A 3LA7A 4GO1A 5HOOA 2CGPA 2FQ3A 4LGWA 4WCGA 2HU9A 2Z1DA 2L9NA 3QOEA 1WVRA 2NOJB 2RASA 2G7HA 4B3AA 1KQ0A 1WJAA 2R7WA 3R0AA 4WXCA 1LUJB 3WU2C 3V78A 2P6TA 4BH9A 2MLGA 3RZOJ 3EQLF 1IV6A 1IN5A 3A1YA 3P9IA 3IL2A 4IPAA 4EM0B 3CP8A 3FXRA 5F6FA 3CCUI 3ESWB 3TGNA 4J00A 3FXMA 1BIAA 4BQAA 2HS5A 1IUFA 4N4OB 1Y56A 2CUJA 3RYRA 3CCSI 3WTZA 5DYMA 5LFAA 5CVJA 2RNJA 2LYCA 1X2MA 3RCOA 4X6AJ 1MJBA 3BZCA 5ICFA 1SD7A 4RB0A 4GCKA 3UR3C 2GXGA 5D5XB 4XLFA 4IQ4A 2HI3A 1S9HA 5B1BH 4BBSJ 3NI7A 2EZKA 2B9SA 4BXFA 2HDDA 2V9VA 1KONA 1YS7A 1R6RA 4ZJZA 1K79A 2RNGA 2BEOA 2GXBA 3WU0A 5L3DA 2WA0A 1FEXA 4NDLA 4A3JJ 4FT8A 3JRGA 1H9GA 2A68F 2IGOA 2EINH 2WWYA 2QWWA 2FOKA 4MEXF 4HW0A 2V1NA 3CP2A 1KZHA 2VI6A 4HAMA 3GUDA 3S5RA 4A93J 2HNHA 3V8LA 2OAZA 2YR2A 1MIJA 5E8GA 2KP6A 2HFHA 3MWMA 1FTTA 1JT0A 1UG2A 1POGA 2XGCA 3DFGA 4BQQA 1LVKA 2OQRA 5LEJA 3OIQA 2STWA 3K0LA 5JLWA 1Z3XA 2GIZA 1B9NA 3LWFA 1O3QA 5FD6A 3ECOA 2X85A 3VP5A 3K8PC 1VQLI 1WHUA 1R49A 4DJAA 2F07A 2HQAA 2FRHA 2EV5A 2NNYA 4GYGA 3OYFA 3VOXA 3WTXC 3E7QA 4GYIA 4D7NA 5BMZA 3I59B 3HTSB 3V7RA 2COBA 4BGDA 1MSEC 5L3GA 2LG4A 2VXZA 2UXUA 1TWCJ 2FUG2 1JTYA 3A01A 1FJLA 2A07F 1JKOC 1BBYA 3BJAA 1QHHD 1NHAA 2XRLA 2LY1A 2PMHA 2DMTA 4C2MJ 3ML6A 1ETOA 4XONA 3LAPA 3GEZA 4UNOA 1OFCX 2NS7A 5EG0A 1AWCA 1H89C 1KYWA 4XRSG 4N4NB 3QKXA 1JUSA 3GF2A 1NTCA 3L9FA 2E7WA 1Y8QB 3CTAA 4BQOA 1BJAA 4HBLA 4E7ZA 4YIFA 1WH5A 3TO7A 3ZN1A 4CCLA 4CYCA 3WTUC 2JPCA 2EA2A 2KMUA 1MBFA 1J09A 4A5NA 3NARA 1P4XA 4GCLA 1G3WA 1JJ6C 1I1GA 1Z05A 4LOCA 4PUSA 3F23A 4MGRA 3I53A 4G9YA 1IXCA 1AHDP 3VB2A 2CUFA 1DP3A 5E8IA 1YRNB 4CDGA 1J59A 1OR7A 5BOXA 1XPXA 3C2GA 5LHIA 1BI0A 2H94A 1Z3YA 2VOPA 2L2OA 4CHUA 1HSJA 3PO2J 1NG6A 3O2PE 1TWHJ 4G94A 1UFMA 4YG2F 1ZKGA 2OU2A 3NEUA 2A6EF 2BW3A 2NXNB 3RKXA 1ZR2A 4L0YB 4OIQF 3HDDA 5A2QZ 1PVEA 4DW6A 3F3XA 2NNNA 4M3EA 2VJ4A 4KIGA 4L18B 1P2FA 4LITA 1J2XA 3T5XA 3SXYA 5EDNA 3OS0A 3BG3A 4NB5A 5F0FA 1SANA 1TNTA 4BKXA 3FMSA 4B1RA 3S1MJ 4HG2A 3G1OA 4LG0A 1XX5A 1G3SA 1EV7A 4AUXA 4Q5SF 2HYGD 5DAJA 3LFKA 3R60A 3H92A 5HNHA 2ZMEA 4XORA 5FD5A 3FIWA 1PJRA 3PNYA 4BDYA 3ULQB 4ZYAA 5CVUA 3W6JB 1IV8A 3FXOA 4HX7A 2DDBA 1SGMA 1MNDA 4CUGA 2JK3A 1USTA 3AQTA 4I99C 2RQQA 3BR6A 2PLYA 2XDVA 3EUPA 3MZHA 2L9RA 3EPZA 3OMYA 2KZGA 3GWZA 1QNTA 2E1MC 1FSEA 1O7LA 4A6EA 2L54A 4XOPA 5FRNA 1UJ8A 2FU4A 2DQLA 3ZQQA 2H09A 4HX4A 3KKDA 2M0CA 4M9ZA 4IL6C 2YX4A 4M9XA 1AKHB 1DPUA 3WTVC 1IRXA 1B59A 3ELKA 2FBQA 4PDKA 1JGSA 5F1JA 4OAZA 4ZYHA 1Z6RA 2VKDA 4G7OF 2OTJI 2Y9YA 3CCLI 2EIJH 3D0SA 3CO6C 2IS4A 3ZQIA 5C44J 3E6BA 2EZIA 1JE8A 1A5JA 3ON2A 2HDCA 1R1UA 1VTNC 2XKOA 1IF1A 5DUIA 1VQOI 4GFKA 1LFPA 3UKGA 4CYDA 2QZ8A 1X1DA 3ASOH 5FLXK 3CC7I 3S1NJ 3D5RC 2XAGA 1WGXA 3Q3SA 5EGOA 3OSFA 1FWZA 2QM3A 2DI3A 1TLHB 1A6QA 3BY6A 3K4NA 1ZGAA 4HV6A 1ON1A 2E7XA 3B02A 2QOPA 3IKTA 1QPIA 1SMTA 1ZGJA 2ZB9A 3BHQA 5FLXZ 2JSPA 2CV1A 1W7PA 2XUBA 1P7JA 1IRFA 3BG9A 4IZZA 5K5RA 1UMQA 2A6TA 2IAIA 2Y69H 4AF5A 4IX7A 2O8KA 1QBJA 2Y48A 2D2WA 2HGCA 2EB7A 3NRGA 1MBHA 3P9TA 3TO6A 5E79C 2E1NA 2JRMA 3N05A 2EH3A 4HSTA 3WU1B 3CLOA 4XKWA 2MBFA 3DLLF 5DTDA 5CLSA 3DPLC 3E6MA 3PIOF 2V57A 4I7HA 3HRSA 1S29A 5FRMA 2IA0A 2DTZA 4IHSA 4OMZA 5D1RA 2O6GE 1T0FC 2EK5A 3K69A 2YS9A 1T8IA 1I6HJ 2J5OA 4I6ZA 1SFOJ 4ESFA 3IUOA 4KN4X 1K83J 2XAFA 1W5SA 3GZNB 4HQEA 3ZQHA 3KKCA 2B3WA 2KPMA 2WAQN 5LGUA 1TQIA 3FXJA 3W6VA 3FK6A 4UVBA 2W84A 4AIHA 1LQ1A 4BU2A 2LR8A 4V2GA 3BC8A 2R7TA 2AHQA 2VBZA 4Z2YA 4KICA 5FGMA 1DQUA 1ETKA 1OCRH 2K9LA 4IOAF 3E7LA 2EQRA 3V4GA 5GAEJ 4ZC3A 1REPC 4L0ZB 1KU3A 1H0MA 1J75A 3SEZA 2E2IJ 4IJAA 5GAGJ 3L2VA 2CQXA 1RNLA 1TTYA 5EEHA 4HV5A 1IN4A 3HUGA 2OQGA 3HOXJ 1R7JA 1FBUA 1VQMI 5CVIA 4BNCA 2DG7A 3FBIB 4BUPA 3MCZA 4EVIA 4WX9A 4L5IA 3FKJA 1RESA 1K4TA 2F4MB 3SYTA 3I64A 1X3ZB 2IGNA 5F1RA 2KFDA 4A0YA 5LHGA 3TP3A 4I02A 1G6NA 1R36A 1R00A 3N4MA 3VVXA 2DPDA 3JSJA 1VQNI 1EA3A 2G0EA 2JA6J 3RPUD 5J1RA 4KIBA 4D7MA 1AA7A 3H9QA 1YITI 1QZZA 5L3FA 3FXLA 3LQQA 1IXSB 4FQGA 5D5UB 2FXAA 2EWNA 3RSNA 1V5EA 4MXMA 2G7SA 3VIBA 5M5YJ 1I3AA 3E6DA 3MKYB 3GTKJ 1YW7A 3OYAA 1FP2A 5ICCA 3T8RA 2Q2EA 2F5DA 5GP9A 2Y9ZA 2X1DA 3ZMDA 1R4MB 1HXDA 2X4HA 4YIIA 2F5FA 5JR3A 1AU7A 2XKPA 3KFWX 3LAJA 1B8IB 1XSDA 4KWAA 1T38A 1QPMA 5IYCJ 3REOA 3GYHX 1B1BA 2CH0A 1IDZA 3HOUJ 5DM6F 2WY8Q 2QBYB 2RV8A 4EM2A 4YFNF 1S7EA 2H8RA 4B44A 3HG9A 3I56I 3CCRI 2HQ5A 3IHUA 2UXHA 1S8NA 4U7BA 4N9IA 1LDJA 2OF7A 5D8KB 2RHAA 3QU6A 2E36A 1LVAA 3DBHB 2LKXA 1Z7LA 2QF7A 3P9KA 3GFIA 2XDNA 3KZIC 1IJWC 5L3CA 2M8EA 4BYYA 2E71A 4HQMA 2QQ9A 2VE9A 4HPQA 2F5VA 5FGLA 1VQ9I 4ZTFA 1GHCA 2Y30A 4MQ9F 1BI3A 3HPHA 1ONVA 2XV4S 2ZXJA 3HSFA 3BG5A 1UI6A 4RLQA 4HRIA 3B81A 3S1QJ 2EPFA 2DA1A 1D3YA 3IWFA 3PQJA 1MMNA 2LKPA 3OR1C 2R93J 3SWHA 3EDPA 1RETA 1XB4A 2YX7A 2EV0A 3ZP5A 2QSFX 3VOEA 2GOXB 4NC7A 2ELJA 3NQOA 3TOBA 4Y4RA 2JSCA 3KX2A 1KU7A 1UI5A 1FIAA 2VKHA 3OL3A 4GFLA 2ZO4A 3LSTA 1OYIA 4G6TB 4EJWA 1MJAA 2DMUA 2M7AA 1SVOA 5DDGA 1P6RA 4C30A 3E3VA 4LK1F 4ANJA 5J1YA 4LB5A 1D0YA 1X1AA 1XC5A 3S2WA 4M6XA 4C9YA 1WRJA 2L4MA 2DA4A 4UV8A 4P96A 3JSOA 1EH8A 2R7OA 5HVQC 1HA8A 5K5QA 1T2KA 2LMDA 2H6CA 1IO2A 5J6XA 5BPDA 4M3DA 2E2HJ 2R7QA 5FJ8J 2M3AA 1T0FA 2FSWA 2IU5A 4MK6A 5DUKA 5IOZA 3J7ZI 3CLQA 1K78B 2XAHA 1F36A 3F8CA 1ZGWA 3W3CA 5E18F 1PUFA 1O3TA 2QENA 1X1PA 2DPUA 2H1KA 1X3UA 2A6HF 2QVOA 1C0WA 2LFBA 1ENHA 3ABTA 1PYVA 4XSXF 1N78A 5D18A 2WV1A 4WXHA 1IC8A 2XAQA 4JNNA 2L7ZA 5FMPA 5LRRA 2UWMA 3X2QH 3AL0B 3BROA 1GXQA 2ESNA 3QPTA 3GTJJ 1RIOH 3CRJA 3GO5A 2K02A 2DYRH 3GFMA 1VQ8I 2EFQA 3K2ZA 1RR7A 1MMAA 4OWRB 3DPJA 4AM3A 3LSHA 2K3FA 4WXDA 3GZ6A 5CVRA 1FZPB 3G2BA 3KP4A 4IHVA 2ZCXA 2DXIA 4HNVA 4L9JA 1RC9A 3ZR8X 1KQ8A 3GXOA 1RPWA 4CH7A 4CZCA 3QRFF 1RRJA 2W85A 1FTZA 5B5EC 3FISA 2PMZA 1SD5A 4X1EA 4W1UA 2F6CA 5AIQA 4RGUA 3QYFA 5K7ZA 2HZDA 2IBDA 3O8GA 2M1BA 4KISA 2HVRA 2Z9OA 1JT6A 2XB5A 4RAZA 4C2UA 2G3BA 1MNEA 4CCJA 2O7OA 1YIOA 4ZDOA 2XIGA 2CMPA 2RKHA 3IUVA 2XC7A 4PGHA 3JR9A 3ABKH 1UZCA 3F6OA 3S2HJ 3EYYA 2Y0SN 4JBAA 4A3EJ 1T39A 5EF6A 5LGTA 4UUSA 1CF7B 3DKWA 5DCMA 1OISA 3PQKA 2P7CB 3V7SA 1VZ0A 5GTIC 2CQKA 3HXLA 5KAFC 4NELA 4U88A 4L9NA 4E4HA 3B6AA 3L7WA 2XF6A 4MEYF 5B66C 4YZEA 1V54H 2IP2A 3M1EA 2A5WA 3K7AJ 2KISA 3M4OJ 1WQ2A 2EZLA 2GAUA 2HXOA 1Q1VA 1YJWI 2D1VA 3KP7A 1J9IA 3PFIA 3E5XA 4R1HA 3QOPA 4ACIA 5K5OA 3C2HA 2M87A 2LNBA 4BQNA 4A69C 2BYVE 2ZFUA 3CUOA 5IYBJ 1LE8A 2PI0A 5BQTA 5J3LA 1LFBA 1ZREA 1GT0C 4BE0A 1YOVB 2NP5A 3H3UA 5IY5H 2JJ7A 3DQVC 2Q8KA 1U5TB 4ZTJA 4DZJA 3EETA 2WGBA 1OCTC 1EKEA 2XAJA 4BEHA 2L3DA 3KYLA 3V8JA 3G4SI 1EH6A 4IRGA 1O7FA 4JQFA 4FHTA 2OCEA 1LJ9A 1U9OA 3EGQA 3RI4A 1YHQI 3K4JA 1NH3A 5ICEA 3FKIJ 3DKXA 3GZIA 2FMYA 2PJRB 2GQQA 5CJ9A 3W2AA 1VQ6I 1QGPA 3D5SC 2KL4A 4KJZA 1T33A 5FLVA 2XGEA 3HM5A 4KNYA 5FKOA 3VW0A 3HIMA 1QZEA 2XAUA 2M4KA 4RB3C 1FOXA 2O0YA 5EJCA 1OCCH 3M1CA 3KCCA 3BTIA 3GFLA 3GVAA 2Y0MA 1F1ZA 3I58A 2L4AA 2MD5A 5EEGA 3GTOJ 3E5UA 1Z1DA 2FNPA 5GTHC 3CUQC 2K5CA 2L9VA 4BHBA 3ONQA 1FX7A 4IRVA 2DDAA 1H9TA 4MTEA 2ZMEC 2KIQA 4B47A 1UG0A 3OYKA 3HTUA 1GDTA 2R3SA 2QLZA 1A6IA 3BR0A 4FASD 3OYLA 2M30A 3TO9A 3LJLA 2K40A 2GA2A 2ZJRF 2DFFA 3DWLE 1F43A 1IZ1A 2WY7Q 3NRVA 4GDFA 4IF4A 1KA8A 2PG4A 4PJNA 4A0XA 4G8XA 1K4SA 4P1WA 3V42A 4OMYA 2MABA 2JTVA 2UXOA 1DGRM 1FBSA 3CJQB 3HPGA 2H27A 3KEOA 1JJ8C 1HW5A 5DV5A 3U9GA 2O61A 2DA7A 3QPSA 2R7ZJ 3DKYA 2HPMA 2IXSA 4IHXA 4A3FJ 2ECCA 2OBPA 1HDPA 2Z5UA 3ASNH 5FHPA 2A5YB 2IW5A 5K58A 1R9TJ 2O03A 1ERDA 1LDKB 2I8DA 3KP3A 1VQPI 3AQSA 3CC2I 4NQWB 4HKUA 1VQKI 2YVXA 4JOMA 2ECBA 3K70D 2VJJA 4RGSA 3WTWC 1KQ9A 2WB1N 2BY1A 4BY1J 5F0HA 4A3LJ 3M8JA 2PX9A 3MFKA 3FF5A 3GTGJ 3RKWA 1KU2A 1BM9A 2EFOA 4YFKF 5HS8A 4PJJA 3U21A 4FE4A 2DT5A 1YW9A 3HKZN 2WTEA 4U0YA 1MBKA 3PSIA 5J8FA 1ETXA 5M5XJ 2DFIA 1S7AA 1LPQA 2XF7A 2MLKA 3IWZA 2W7NA 2HTSA 1UHSA 2KIFA 2MW8A 3T6NA 1Y1WJ 2MD0A 1CQTA 4HA8A 1Z91A 3Q5FA 2CG4A 2ZJPF 2XGDA 2D5VA 1KGSA 1I1SA 2VOOA 5C4XJ 1YX5A 2FJ1A 3G56A 2DA6A 3OIOA 2F5CA 3B6CA 1W36D 2IS6A 3CD6I 2K4BA 2STTA 5GADJ 2JZYA 2VPLA 4RS8A 4PGGA 1E0EA 1FSHA 2JA8J 3A2KA 5IT9K 3FWEA 1MKMA 1A31A 2WADA 4FX4A 2YPRA 3F22A 2LP0A 4A3KJ 2FA5A 3KPHA 2JMWA 3W2WA 2N8GA 3JTGA 4F52A 3QU3A 1IDYA 3OL4A 3BZKA 3SJMA 3DF8A 3MN2A 5IT9Z 3SDBA 4DVYP 2KT0A 2R5YB 3LMMA 3QP6A 3WODF 2DFHA 4XOTA 3BCGA 3WTYC 1RR8C 4DBQA 1P4WA 2ZXWH 4L5EA 3F6VA 4UB8C 3L2CA 1R71A 5GAHJ 3SZGA 1APLC 1FYMA 1E3OC 4RGXA 4DOZA 1LDDA 4LFUA 5E3OA 3GBGA 4CA0A 4LIUA 2HEOA 3KZZA 2W1OA
chains in the Genus database with same CATH topology
3IH3A 3BQZA 5D1RA 3TEDA 1I50J 5EZHA 1Z77A 2XPUA 2YS9A 1I6HJ 4I6ZA 4BXXJ 3RH2A 1SFOJ 5IYDJ 3PPBA 4UUTA 3QBMA 1K83J 3KZ9A 4DZPA 3ON4A 3VOKA 3ZQHA 3KKCA 2WAQN 4A3MJ 1ETVA 3JRDA 3W6VA 1B72A 3FK6A 4C3IJ 2LR8A 4V2GA 1DU6A 2ZOZA 2AHQA 3BR5A 2R5ZA 2HOSA 4MIMA 1GUUA 3BNIA 5FKNA 1ETKA 5EYRA 2B63J 3E7LA 5IP7J 2EQRA 1LFUP 1AKHA 1JKQC 1HDDC 3ZOBA 3VPRA 3LHQA 4FCYA 2E2IJ 1IG7A 3NPIA 1MBEA 1IGNA 1GV5A 2CQXA 5IP9J 1BL0A 3HOXJ 4RBOA 3QPLA 2M34A 1MH3A 1JGGA 3TW7A 2DG7A 3F0CA 2ME0A 3HEFA 3GTLJ 1RESA 2ID3A 2L7MP 3BR3A 2E2JJ 1ZTRA 3SFIA 3H0GJ 2NVXJ 2GUHA 2R0QC 1VNDA 3TP3A 3CMYA 3TW6A 1BW6A 4QSHA 3MVPA 3FRQA 2M8GX 3VVXA 4XK4A 3JSJA 2ZOYA 1IRZA 5EZGA 2G0EA 2JA6J 5J1RA 5F27A 1RKWA 2Y31A 2LY9A 1VI0A 3CQZJ 4D7MA 5C4JJ 3HTJA 4XIDA 1G2HA 3GEUA 1TWAJ 2HKUA 2HOTA 2PMZN 3LSJA 3KNWA 2R5YA 4FTHA 2G7SA 3S17J 4MXMA 5HBUA 3VVYA 2L7FP 5M5YJ 3VIBA 3FK7A 3VUQA 3GTKJ 1WI3A 3S15J 4JX5A 1Y1VJ 5GP9A 1VFCA 5DS9A 1VF9A 4XRMA 3ZQCA 2Y9ZA 3HTAA 3PASA 1PUFB 4C3JJ 1U78A 3BTLA 1AU7A 3MNLA 4GFBA 3H3VK 1B8IB 2QKOA 4KWAA 4Y52J 3G1MA 1GV2A 1WCMJ 5IYCJ 5HAWA 2RAEA 5C4YA 1IDZA 3HOUJ 5J1UA 2GM4A 2DJNA 3GTQJ 2QWTA 1S7EA 1BA5A 2H8RA 5CXIA 1MSFC 4M3GA 1RKTA 2HQ5A 2UXHA 5E3MA 4JNNA 2OF7A 2YU9J 2RHAA 3LOCA 2LKXA 2NX4A 2QF7A 1FIPA 2JA5J 2XDNA 3HOVJ 5IOYA 1IJWC 5HODA 3JRAA 1HF0A 1P7IA 2LLKA 2D6YA 2L0KA 1MBGA 5FGLA 2XB0X 3A02A 3LSPA 2Y30A 1DU0A 3CDLA 2MGQA 2VUMJ 2XPVA 3BG5A 3ZQGA 3OSGA 1UI6A 4JYKA 2NP3A 3B81A 3S1QJ 1T56A 3WHCA 5GPAA 2DA1A 5M3FJ 3Q0UA 2R93J 3CCYA 2Q24A 4C3HJ 2X6OA 4XICA 1RETA 2CRGA 1Z0XA 3BJBA 4AYBN 3O8HA 3NNRA 1UI5A 2K9NA 3NXCA 2R92J 1FIAA 5FKLA 2MG4A 2ZCMA 4GFLA 4PXIA 4ME9A 2VKEA 4IEJA 2DMUA 1H8AC 1ZK8A 4QIWN 4UUSB 2O7TA 4L62A 2XSDC 4IHWA 1ETYA 5E3LA 5J1YA 2G7LA 2DA3A 1XC5A 2PBXA 4B4CA 1ZR4A 2PZ9A 3A01B 2DA4A 2RASA 4XRSA 2WUIA 4B3AA 2DMNA 3RD3A 3OOUA 1O4XA 3V78A 4M3DA 2E2HJ 2VPRA 5FJ8J 3RZOJ 3HOYJ 1IV6A 5JLXA 2IU5A 1QVTA 2HYJA 5IOZA 4MK6A 3I4MJ 3SDGA 1ORKA 1F36A 1ZGWA 1JKPC 1IUFA 5EG0B 1PUFA 3IH4A 1TWGJ 2GFNA 4W97A 3HE0A 1B8IA 1LE8B 1X2MA 2H1KA 2NS8A 4X6AJ 1OJLA 2QCOA 2E19A 2Y2ZA 2LFBA 1ENHA 2K9SA 2O9LA 2X9DA 5D18A 2WV1A 4GCKA 1IC8A 4CYCB 4AC6A 4BBSJ 2L7ZA 2HI3A 3RQIA 2UXIA 3NI7A 1ZQ3P 2EZKA 4M3BA 3CJDA 5FMPA 2HDDA 1QVUA 3GTJJ 3CRJA 5BNGA 1U8BA 3BR2A 2REKA 4DYCA 1RR7A 3BTCA 2DA2A 3GTMJ 1FEXA 3DPJA 3VVZA 2CJJA 4NDLA 4IHVA 3PM1A 4A3JJ 2ZCXA 3JRGA 4HNVA 5EFYA 4BBRJ 5E3NA 1RPWA 1FTZA 1I3QJ 2IEKA 2VI6A 3FISA 3S5RA 3C2BA 4A93J 2FQ4A 1MNMC 4X1EA 4W1UA 4DYRA 1FTTA 3JRHA 1JT0A 1UG2A 1POGA 2XGCA 4M6VA 5K7ZA 3O60A 2IBDA 5K7HA 3O8GA 2LTPA 3CWRA 2HXIA 1HCRA 4D5FA 3D1NI 4M3FA 1JT6A 2XB5A 5JLWA 3RKQA 1MH4A 2G3BA 2M9HA 2O7OA 1U9NA 2DMPA 3IUVA 3VP5A 1HOMA 2CQQA 1GVDA 3JR9A 2F07A 1JKRC 3HOWJ 3S2HJ 4NN1A 2Y0SN 3IH2A 3G1LA 4A3EJ 3VW2A 4JKZA 5EF6A 3JRCA 4UUSA 1JUMA 2YVHA 3VOXA 1BW5A 3E7QA 2ME6A 4D7NA 3S2DJ 3RZDJ 4DYQA 2COBA 3MKLA 1MSEC 4NELA 3V6GA 3HTHA 2UXUA 3ZQFA 1TWCJ 5CW8A 1JTYA 3A01A 1W0TA 1FJLA 3B6AA 1JKOC 1X58A 4I76A 4ICHA 4YZEA 5M5WJ 5CXGA 3DCFA 3K7AJ 3BRUA 3K2AA 3M4OJ 2EZLA 2XRLA 2HXOA 1Q1VA 2DMTA 2P81A 4C2MJ 1W0UA 4CGRA 5M3MJ 1ETOA 1JUPA 4ACIA 2W48A 4RDUA 1OFCX 2NS7A 5EG0A 4JX6A 4A69C 1H89C 5IPAA 4XRSG 5IYBJ 2GBYA 3QKXA 1JUSA 2DA5A 1LE8A 5J3LA 1NTCA 1LFBA 1GT0C 2NP5A 1WH5A 2JJ7A 2OERA 3TP0A 4CYCA 3QQAA 4DZJA 1NK2P 1WPKA 2WGBA 1OCTC 3COLA 2NVTJ 3NAUA 1MBFA 3ZQLA 3NARA 4GCLA 2FX0A 1JJ6C 4A3IJ 1X2NA 5H9TA 4LOCA 5F08A 1U9OA 3EGQA 3HGYA 1AHDP 5AQCA 4GCTA 3BT9A 2CUEA 3FKIJ 9ANTA 2CUFA 3GZIA 1YRNB 3HB9A 5FLVA 1T33A 4G12A 2XGEA 4ABZA 3HM5A 3WHBA 3L1PA 5FKOA 3VW0A 3HIMA 3C07A 2E1OA 2DG8A 3ANGA 3G7RA 2TCTA 2TRTA 5EGOB 3BTIA 3Q0WA 4A3BJ 5IP6A 3GTOJ 3VW1A 4JX4A 4Y7NJ 2LK2A 2JWTA 2GLOA 2HOAA 3PO2J 4A3GJ 1TWHJ 4QTRA 2XPWA 4AC0A 1ZKGA 2JN6A 1GDTA 1ZR2A 1A6IA 3BR0A 3HDDA 4DW6A 2FD5A 4M3EA 3S1RJ 3LJLA 2K40A 2ID6A 3S16J 3ANPA 2DN0A 1F43A 2GENA 3S14J 3HTIA 5EDNA 3BG3A 1MBJA 3JRFA 5F0FA 1SANA 3LSRA 4BKXA 2YVEA 4B1RA 3S1MJ 2UXOA 3IV5A 3G1OA 4MLOA 3BTJA 1JJ8C 4AUXA 5DAJA 2JA7J 2DA7A 4A3DJ 1JTXA 3QPSA 2R7ZJ 3FIWA 2K9QA 4IHXA 4A3FJ 2ECCA 2NOGA 2YUSA 1HDPA 2W53A 3LWJA 5FHPA 3LSGA 5K58A 1R9TJ 4FISA 4A3CJ 1QRYA 4MFEA 5FKMA 4MFDA 1SGMA 3PO3J 2QTQA 2JK3A 4D5CA 3AQTA 2NVQJ 3AQSA 2QIBA 4HKUA 3BR6A 2ECBA 3EUPA 4BY1J 2WB1N 2L9RA 1ITYA 5F0HA 4A3LJ 2EZHA 5F0CA 2G7GA 3GTGJ 1B72B 3A03A 5FKKA 1D5YA 3DEWA 4FE4A 4V2FA 1H88C 2EBIA 2R5ZB 3HKZN 4EEFG 1MBKA 4MO7A 3GTPJ 3KKDA 2M0CA 1ETWA 1ETXA 1AKHB 5M5XJ 3Q0VA 3I4NJ 2FBQA 4JP0A 1TWFJ 5F1JA 1UHSA 2MW8A 2I10A 4S0HB 4UDSA 2Y9YA 1Y1WJ 3T6NA 1CQTA 3BR1A 2X48A 3ZQIA 5C44J 2XGDA 2D5VA 2EZIA 1HLVA 1A5JA 5C4XJ 3ON2A 5FLMJ 1XG1A 1BJZA 5EEAA 2MSYA 2FJ1A 3G56A 3OIOA 2DA6A 3M3YJ 3B6CA 1YRNA 4GFKA 3UKGA 3JRIA 2M2EA 5K7FA 1K61A 2DMQA 5F04A 2JA8J 3S1NJ 4JL3A 1WGXA 3Q3SA 3HOZJ 5EGOA 3OSFA 2LP0A 2NVYJ 2OI8A 4A3KJ 2JMWA 2N8GA 4BY7J 1XS9A 2QOPA 1IDYA 2ZCNA 5C3EJ 2ELKA 1QPIA 3SJMA 2ZB9A 3BHQA 3MN2A 1P7JA 1ETQA 2KT0A 2LD5A 4FE7A 1EF4A 3BG9A 2R5YB 2KDZA 1UMQA 2IAIA 4AF5A 2O8KA 5D19A 3JRBA 4J19A 3BCGA 3JREA 1TC3C 2CU7A 3NRGA 2LVSA 1MBHA 4L5EA 3P9TA 5GPCA 3HGGA 1NK3P 3F1BA 2EH3A 2UXPA 1OCPA 2AO9A 4IHYA 2HYTA 1APLC 5DTDA 1E3OC 5E3OA 1WH7A 3GBGA 3HBLA 5HSZA 2V57A 2VKVA 3BQYA 3LNQA 2DTZA 2OPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH3 A;  3BQZ A;  5D1R A;  3TED A;  1I50 J;  5EZH A;  1Z77 A;  2XPU A;  2YS9 A;  1I6H J;  4I6Z A;  4BXX J;  3RH2 A;  1SFO J;  5IYD J;  3PPB A;  4UUT A;  3QBM A;  1K83 J;  3KZ9 A;  4DZP A;  3ON4 A;  3VOK A;  3ZQH A;  3KKC A;  2WAQ N;  4A3M J;  1ETV A;  3JRD A;  3W6V A;  1B72 A;  3FK6 A;  4C3I J;  2LR8 A;  4V2G A;  1DU6 A;  2ZOZ A;  2AHQ A;  3BR5 A;  2R5Z A;  2HOS A;  4MIM A;  1GUU A;  3BNI A;  5FKN A;  1ETK A;  5EYR A;  2B63 J;  3E7L A;  5IP7 J;  2EQR A;  1LFU P;  1AKH A;  1JKQ C;  1HDD C;  3ZOB A;  3VPR A;  3LHQ A;  4FCY A;  2E2I J;  1IG7 A;  3NPI A;  1MBE A;  1IGN A;  1GV5 A;  2CQX A;  5IP9 J;  1BL0 A;  3HOX J;  4RBO A;  3QPL A;  2M34 A;  1MH3 A;  1JGG A;  3TW7 A;  2DG7 A;  3F0C A;  2ME0 A;  3HEF A;  3GTL J;  1RES A;  2ID3 A;  2L7M P;  3BR3 A;  2E2J J;  1ZTR A;  3SFI A;  3H0G J;  2NVX J;  2GUH A;  2R0Q C;  1VND A;  3TP3 A;  3CMY A;  3TW6 A;  1BW6 A;  4QSH A;  3MVP A;  3FRQ A;  2M8G X;  3VVX A;  4XK4 A;  3JSJ A;  2ZOY A;  1IRZ A;  5EZG A;  2G0E A;  2JA6 J;  5J1R A;  5F27 A;  1RKW A;  2Y31 A;  2LY9 A;  1VI0 A;  3CQZ J;  4D7M A;  5C4J J;  3HTJ A;  4XID A;  1G2H A;  3GEU A;  1TWA J;  2HKU A;  2HOT A;  2PMZ N;  3LSJ A;  3KNW A;  2R5Y A;  4FTH A;  2G7S A;  3S17 J;  4MXM A;  5HBU A;  3VVY A;  2L7F P;  5M5Y J;  3VIB A;  3FK7 A;  3VUQ A;  3GTK J;  1WI3 A;  3S15 J;  4JX5 A;  1Y1V J;  5GP9 A;  1VFC A;  5DS9 A;  1VF9 A;  4XRM A;  3ZQC A;  2Y9Z A;  3HTA A;  3PAS A;  1PUF B;  4C3J J;  1U78 A;  3BTL A;  1AU7 A;  3MNL A;  4GFB A;  3H3V K;  1B8I B;  2QKO A;  4KWA A;  4Y52 J;  3G1M A;  1GV2 A;  1WCM J;  5IYC J;  5HAW A;  2RAE A;  5C4Y A;  1IDZ A;  3HOU J;  5J1U A;  2GM4 A;  2DJN A;  3GTQ J;  2QWT A;  1S7E A;  1BA5 A;  2H8R A;  5CXI A;  1MSF C;  4M3G A;  1RKT A;  2HQ5 A;  2UXH A;  5E3M A;  4JNN A;  2OF7 A;  2YU9 J;  2RHA A;  3LOC A;  2LKX A;  2NX4 A;  2QF7 A;  1FIP A;  2JA5 J;  2XDN A;  3HOV J;  5IOY A;  1IJW C;  5HOD A;  3JRA A;  1HF0 A;  1P7I A;  2LLK A;  2D6Y A;  2L0K A;  1MBG A;  5FGL A;  2XB0 X;  3A02 A;  3LSP A;  2Y30 A;  1DU0 A;  3CDL A;  2MGQ A;  2VUM J;  2XPV A;  3BG5 A;  3ZQG A;  3OSG A;  1UI6 A;  4JYK A;  2NP3 A;  3B81 A;  3S1Q J;  1T56 A;  3WHC A;  5GPA A;  2DA1 A;  5M3F J;  3Q0U A;  2R93 J;  3CCY A;  2Q24 A;  4C3H J;  2X6O A;  4XIC A;  1RET A;  2CRG A;  1Z0X A;  3BJB A;  4AYB N;  3O8H A;  3NNR A;  1UI5 A;  2K9N A;  3NXC A;  2R92 J;  1FIA A;  5FKL A;  2MG4 A;  2ZCM A;  4GFL A;  4PXI A;  4ME9 A;  2VKE A;  4IEJ A;  2DMU A;  1H8A C;  1ZK8 A;  4QIW N;  4UUS B;  2O7T A;  4L62 A;  2XSD C;  4IHW A;  1ETY A;  5E3L A;  5J1Y A;  2G7L A;  2DA3 A;  1XC5 A;  2PBX A;  4B4C A;  1ZR4 A;  2PZ9 A;  3A01 B;  2DA4 A;  2RAS A;  4XRS A;  2WUI A;  4B3A A;  2DMN A;  3RD3 A;  3OOU A;  1O4X A;  3V78 A;  4M3D A;  2E2H J;  2VPR A;  5FJ8 J;  3RZO J;  3HOY J;  1IV6 A;  5JLX A;  2IU5 A;  1QVT A;  2HYJ A;  5IOZ A;  4MK6 A;  3I4M J;  3SDG A;  1ORK A;  1F36 A;  1ZGW A;  1JKP C;  1IUF A;  5EG0 B;  1PUF A;  3IH4 A;  1TWG J;  2GFN A;  4W97 A;  3HE0 A;  1B8I A;  1LE8 B;  1X2M A;  2H1K A;  2NS8 A;  4X6A J;  1OJL A;  2QCO A;  2E19 A;  2Y2Z A;  2LFB A;  1ENH A;  2K9S A;  2O9L A;  2X9D A;  5D18 A;  2WV1 A;  4GCK A;  1IC8 A;  4CYC B;  4AC6 A;  4BBS J;  2L7Z A;  2HI3 A;  3RQI A;  2UXI A;  3NI7 A;  1ZQ3 P;  2EZK A;  4M3B A;  3CJD A;  5FMP A;  2HDD A;  1QVU A;  3GTJ J;  3CRJ A;  5BNG A;  1U8B A;  3BR2 A;  2REK A;  4DYC A;  1RR7 A;  3BTC A;  2DA2 A;  3GTM J;  1FEX A;  3DPJ A;  3VVZ A;  2CJJ A;  4NDL A;  4IHV A;  3PM1 A;  4A3J J;  2ZCX A;  3JRG A;  4HNV A;  5EFY A;  4BBR J;  5E3N A;  1RPW A;  1FTZ A;  1I3Q J;  2IEK A;  2VI6 A;  3FIS A;  3S5R A;  3C2B A;  4A93 J;  2FQ4 A;  1MNM C;  4X1E A;  4W1U A;  4DYR A;  1FTT A;  3JRH A;  1JT0 A;  1UG2 A;  1POG A;  2XGC A;  4M6V A;  5K7Z A;  3O60 A;  2IBD A;  5K7H A;  3O8G A;  2LTP A;  3CWR A;  2HXI A;  1HCR A;  4D5F A;  3D1N I;  4M3F A;  1JT6 A;  2XB5 A;  5JLW A;  3RKQ A;  1MH4 A;  2G3B A;  2M9H A;  2O7O A;  1U9N A;  2DMP A;  3IUV A;  3VP5 A;  1HOM A;  2CQQ A;  1GVD A;  3JR9 A;  2F07 A;  1JKR C;  3HOW J;  3S2H J;  4NN1 A;  2Y0S N;  3IH2 A;  3G1L A;  4A3E J;  3VW2 A;  4JKZ A;  5EF6 A;  3JRC A;  4UUS A;  1JUM A;  2YVH A;  3VOX A;  1BW5 A;  3E7Q A;  2ME6 A;  4D7N A;  3S2D J;  3RZD J;  4DYQ A;  2COB A;  3MKL A;  1MSE C;  4NEL A;  3V6G A;  3HTH A;  2UXU A;  3ZQF A;  1TWC J;  5CW8 A;  1JTY A;  3A01 A;  1W0T A;  1FJL A;  3B6A A;  1JKO C;  1X58 A;  4I76 A;  4ICH A;  4YZE A;  5M5W J;  5CXG A;  3DCF A;  3K7A J;  3BRU A;  3K2A A;  3M4O J;  2EZL A;  2XRL A;  2HXO A;  1Q1V A;  2DMT A;  2P81 A;  4C2M J;  1W0U A;  4CGR A;  5M3M J;  1ETO A;  1JUP A;  4ACI A;  2W48 A;  4RDU A;  1OFC X;  2NS7 A;  5EG0 A;  4JX6 A;  4A69 C;  1H89 C;  5IPA A;  4XRS G;  5IYB J;  2GBY A;  3QKX A;  1JUS A;  2DA5 A;  1LE8 A;  5J3L A;  1NTC A;  1LFB A;  1GT0 C;  2NP5 A;  1WH5 A;  2JJ7 A;  2OER A;  3TP0 A;  4CYC A;  3QQA A;  4DZJ A;  1NK2 P;  1WPK A;  2WGB A;  1OCT C;  3COL A;  2NVT J;  3NAU A;  1MBF A;  3ZQL A;  3NAR A;  4GCL A;  2FX0 A;  1JJ6 C;  4A3I J;  1X2N A;  5H9T A;  4LOC A;  5F08 A;  1U9O A;  3EGQ A;  3HGY A;  1AHD P;  5AQC A;  4GCT A;  3BT9 A;  2CUE A;  3FKI J;  9ANT A;  2CUF A;  3GZI A;  1YRN B;  3HB9 A;  5FLV A;  1T33 A;  4G12 A;  2XGE A;  4ABZ A;  3HM5 A;  3WHB A;  3L1P A;  5FKO A;  3VW0 A;  3HIM A;  3C07 A;  2E1O A;  2DG8 A;  3ANG A;  3G7R A;  2TCT A;  2TRT A;  5EGO B;  3BTI A;  3Q0W A;  4A3B J;  5IP6 A;  3GTO J;  3VW1 A;  4JX4 A;  4Y7N J;  2LK2 A;  2JWT A;  2GLO A;  2HOA A;  3PO2 J;  4A3G J;  1TWH J;  4QTR A;  2XPW A;  4AC0 A;  1ZKG A;  2JN6 A;  1GDT A;  1ZR2 A;  1A6I A;  3BR0 A;  3HDD A;  4DW6 A;  2FD5 A;  4M3E A;  3S1R J;  3LJL A;  2K40 A;  2ID6 A;  3S16 J;  3ANP A;  2DN0 A;  1F43 A;  2GEN A;  3S14 J;  3HTI A;  5EDN A;  3BG3 A;  1MBJ A;  3JRF A;  5F0F A;  1SAN A;  3LSR A;  4BKX A;  2YVE A;  4B1R A;  3S1M J;  2UXO A;  3IV5 A;  3G1O A;  4MLO A;  3BTJ A;  1JJ8 C;  4AUX A;  5DAJ A;  2JA7 J;  2DA7 A;  4A3D J;  1JTX A;  3QPS A;  2R7Z J;  3FIW A;  2K9Q A;  4IHX A;  4A3F J;  2ECC A;  2NOG A;  2YUS A;  1HDP A;  2W53 A;  3LWJ A;  5FHP A;  3LSG A;  5K58 A;  1R9T J;  4FIS A;  4A3C J;  1QRY A;  4MFE A;  5FKM A;  4MFD A;  1SGM A;  3PO3 J;  2QTQ A;  2JK3 A;  4D5C A;  3AQT A;  2NVQ J;  3AQS A;  2QIB A;  4HKU A;  3BR6 A;  2ECB A;  3EUP A;  4BY1 J;  2WB1 N;  2L9R A;  1ITY A;  5F0H A;  4A3L J;  2EZH A;  5F0C A;  2G7G A;  3GTG J;  1B72 B;  3A03 A;  5FKK A;  1D5Y A;  3DEW A;  4FE4 A;  4V2F A;  1H88 C;  2EBI A;  2R5Z B;  3HKZ N;  4EEF G;  1MBK A;  4MO7 A;  3GTP J;  3KKD A;  2M0C A;  1ETW A;  1ETX A;  1AKH B;  5M5X J;  3Q0V A;  3I4N J;  2FBQ A;  4JP0 A;  1TWF J;  5F1J A;  1UHS A;  2MW8 A;  2I10 A;  4S0H B;  4UDS A;  2Y9Y A;  1Y1W J;  3T6N A;  1CQT A;  3BR1 A;  2X48 A;  3ZQI A;  5C44 J;  2XGD A;  2D5V A;  2EZI A;  1HLV A;  1A5J A;  5C4X J;  3ON2 A;  5FLM J;  1XG1 A;  1BJZ A;  5EEA A;  2MSY A;  2FJ1 A;  3G56 A;  3OIO A;  2DA6 A;  3M3Y J;  3B6C A;  1YRN A;  4GFK A;  3UKG A;  3JRI A;  2M2E A;  5K7F A;  1K61 A;  2DMQ A;  5F04 A;  2JA8 J;  3S1N J;  4JL3 A;  1WGX A;  3Q3S A;  3HOZ J;  5EGO A;  3OSF A;  2LP0 A;  2NVY J;  2OI8 A;  4A3K J;  2JMW A;  2N8G A;  4BY7 J;  1XS9 A;  2QOP A;  1IDY A;  2ZCN A;  5C3E J;  2ELK A;  1QPI A;  3SJM A;  2ZB9 A;  3BHQ A;  3MN2 A;  1P7J A;  1ETQ A;  2KT0 A;  2LD5 A;  4FE7 A;  1EF4 A;  3BG9 A;  2R5Y B;  2KDZ A;  1UMQ A;  2IAI A;  4AF5 A;  2O8K A;  5D19 A;  3JRB A;  4J19 A;  3BCG A;  3JRE A;  1TC3 C;  2CU7 A;  3NRG A;  2LVS A;  1MBH A;  4L5E A;  3P9T A;  5GPC A;  3HGG A;  1NK3 P;  3F1B A;  2EH3 A;  2UXP A;  1OCP A;  2AO9 A;  4IHY A;  2HYT A;  1APL C;  5DTD A;  1E3O C;  5E3O A;  1WH7 A;  3GBG A;  3HBL A;  5HSZ A;  2V57 A;  2VKV A;  3BQY A;  3LNQ A;  2DTZ A;  2OPT A; 
#chains in the Genus database with same CATH topology
 4HDU A;  1CGP A;  3VYU B;  4OOI A;  3TED A;  3WTT C;  4HNU A;  3HZJ A;  3TBI A;  4WK8 F;  2W4S A;  3QBM A;  5A2Q K;  2IPQ X;  2PFB A;  1R22 A;  1R23 A;  2RDP A;  2ZC2 A;  4Q48 A;  2ZJQ F;  3VYS B;  5LD2 C;  4DZP A;  1ODD A;  4HF0 A;  2QEX I;  4YRV A;  2QKM B;  2O8X A;  3ABU A;  1B72 A;  5FFZ A;  4C3I J;  2P4W A;  3OYI A;  4UHT A;  1WKM A;  1DU6 A;  1YIJ I;  4BJ5 C;  2R5Z A;  1W5C C;  1ZLJ A;  1FBQ A;  4MIM A;  1U6G A;  2L01 A;  3QP5 A;  2VJI A;  3O6B B;  3HL2 A;  3ABL H;  1JKQ C;  4AVP A;  2OZ6 A;  4PFP A;  1HDD C;  3ZOB A;  3GLX A;  1YLF A;  3CUQ A;  3DP7 A;  1BL0 A;  3BJ6 A;  2ZFW A;  2M34 A;  1MH3 A;  1JGG A;  3CCQ I;  1SD6 A;  2VQH A;  3OOP A;  4CZZ A;  5HLT A;  2HDW A;  1A35 A;  3GTL J;  3SZT A;  2ID3 A;  2PJP A;  1ZTR A;  3HC7 A;  2NVX J;  4B3X A;  4ESJ A;  3DBL B;  5BS6 A;  3Q9S A;  5TRD A;  4M71 A;  4XN0 A;  2ZOY A;  4MTD A;  2V6C A;  1IRZ A;  2X51 A;  1RKW A;  2Y31 A;  2LY9 A;  1VI0 A;  4EJV A;  4XLP F;  5C4J J;  2ZBK A;  4E7H A;  2KIM A;  4XID A;  2BGC A;  5CQE A;  1TWA J;  3QAH A;  2AXL A;  3HRT A;  5HS9 A;  2ZJ2 A;  4KIF A;  2O3F A;  2XRO A;  3QOD A;  1G3Y A;  2L7F P;  3OYG A;  2PMU A;  3FK7 A;  3RKY A;  1X19 A;  1WZ2 A;  2DOE A;  1D1A A;  3WGI A;  1UHM A;  3S15 J;  5D4S A;  3DU5 A;  1L3L A;  1Y1V J;  3HTA A;  3HIF A;  3ZQC A;  3SEQ A;  2WAE A;  4C3J J;  2BY0 A;  3MNL A;  3W2V A;  2XF5 A;  3H3V K;  2QKO A;  4Y52 J;  3G1M A;  1WCM J;  1K6Y A;  2VT3 A;  3QYB A;  3N97 A;  4KMF A;  3WTS C;  2M4G A;  3DLA A;  3LFU A;  5J1U A;  4Y3O A;  4AWX B;  1DPR A;  1XD7 A;  2QWT A;  2ISY A;  2F2E A;  4DIQ A;  2ETH A;  4F92 B;  1BA5 A;  4MHG A;  4LJZ F;  4M3G A;  2Z3Y A;  3NS4 A;  4IQJ A;  5E3M A;  1V5G A;  1K6O A;  3QWL A;  5E1W A;  2JA5 J;  1T95 A;  1TT0 A;  5HOD A;  3JRA A;  3V7C A;  3FDY A;  4EAT A;  3OIP A;  1T98 A;  1FT9 A;  2LLK A;  2PQ8 A;  5DD8 A;  5J4Y A;  4BHP A;  2VOD A;  2EV6 A;  2W82 A;  3A02 A;  3H35 A;  2OZU A;  2VUM J;  1Q1H A;  2HWV A;  2XPV A;  4LD5 A;  5E20 A;  3GW2 A;  2NP3 A;  3K1M A;  3WHC A;  2DOD A;  1K78 A;  3I71 A;  1XGS A;  2HVS A;  2RQP A;  3CCY A;  2Q24 A;  3BCB A;  3OYN A;  4RAG A;  2EA4 A;  3H5N A;  4JK1 X;  3TKY A;  2MH2 A;  4V19 K;  5J40 A;  3ZMU A;  3BJB A;  1GLN A;  4AYB N;  3O8H A;  1ON2 A;  1OQY A;  2LH9 A;  3P5J A;  5KHD A;  2UZK A;  3PJR A;  3BG6 A;  1MDM A;  1HW1 A;  3KLO A;  2R92 J;  1VQ5 I;  3PL8 A;  1BIB A;  2COM A;  1UEL B;  4PXI A;  5F64 A;  1DDN A;  4BJT A;  2G7U A;  1PUE E;  4HYE A;  4ETS A;  5CPR B;  2VKE A;  2HZT A;  1ZK8 A;  3J81 Z;  1ZEL A;  3L2Q A;  5KK1 A;  1N25 A;  2XVC A;  5E3L A;  2DA3 A;  2K85 A;  2PBX A;  1E2X A;  1P9Q C;  1ZR4 A;  2EFP A;  3A01 B;  1V3F A;  3E97 A;  3K4L A;  2DMN A;  3RD3 A;  4P9F A;  1FP1 D;  4HEA 2;  4BAY A;  3EUA A;  3CJN A;  3LA2 A;  2WAQ A;  3L00 A;  2VPR A;  3E5Q A;  3KET A;  1E3P A;  3AAF A;  1ZRF A;  1IN6 A;  5HLH A;  2JUG A;  1O3S A;  2FML A;  1WJC A;  3VSL A;  4XQF A;  2DOF A;  3SDG A;  1ORK A;  4RB1 A;  1FLI A;  2Q0O A;  1ZYR F;  3E6C C;  2EIK H;  1JKP C;  1XMX A;  5EG0 B;  2GFN A;  4W97 A;  3HE0 A;  2DBB A;  2NS8 A;  3BOQ A;  4PJ0 C;  4LB6 B;  2QCO A;  5HLG A;  4G7Z F;  2K9S A;  1MMS A;  2ZXI A;  2LBF A;  4CYC B;  3CF2 A;  1OCZ H;  3FX3 A;  4M3B A;  1ZQ3 P;  3CJD A;  3KLN A;  4XLA A;  3SFZ A;  2QSH X;  1QVU A;  2CV2 A;  2V7F A;  1R5I D;  5LHH A;  4XKV A;  1D8J A;  2LC2 A;  3J80 K;  4U9N A;  5BNG A;  3MD2 A;  1ZHF A;  2DA2 A;  5KAI C;  3GTM J;  2ESH A;  3C7J A;  2JT1 A;  2DAO A;  1BR2 A;  3F8N A;  4BBR J;  4YEL A;  4IO9 F;  4FET A;  2IS2 A;  3J80 Z;  2E1C A;  3IRR A;  1S3J A;  2M45 A;  2VAS A;  1OYY A;  3WE2 A;  5K1Y A;  3C2B A;  2I5U A;  2FQ4 A;  1A04 A;  3CO7 C;  1MNM C;  3PNT A;  4LMY A;  3GCM A;  3JRH A;  3O60 A;  2DQR A;  1WJ5 A;  4RA2 A;  3T8T A;  4XLH A;  2LTP A;  3DEE A;  3PIP F;  2HXI A;  2V1X A;  4M3F A;  5JI6 A;  1YJ9 I;  1MH4 A;  2B0L A;  2IA2 A;  1U9N A;  2BW3 B;  3C3W A;  2X6W A;  3DU6 A;  2DMP A;  5E1X A;  5ED4 A;  2D1H A;  1GVD A;  3FXU A;  1JKR C;  1WJF A;  5AIP A;  3HOW J;  1HC8 A;  4NN1 A;  2DFE A;  3IH2 A;  3FXK A;  4BS9 A;  2ISZ A;  2DYS H;  2OC6 A;  3PUF A;  2NVU B;  1TQM A;  2BV6 A;  1DUX C;  3RZD J;  4DYQ A;  2Z99 A;  4UVC A;  2FEZ A;  5BPI A;  4LG0 B;  2TDX A;  2OV7 A;  2X0L A;  3KYC B;  1LEB A;  1W0T A;  1U2W A;  2QKL B;  4I76 A;  2KJC A;  2V9P A;  4ICH A;  3HOS A;  5DM7 F;  5CXG A;  3DCF A;  2UXX A;  2V9K A;  4CCO A;  3K2A A;  2VIX A;  3ZMT A;  2Q1Z B;  2AS5 F;  1BOA A;  2O5R A;  5M3M J;  1JUP A;  1YX3 A;  3A4C A;  2A69 F;  5JVT A;  1WSU A;  2HQN A;  4RDU A;  2KIU A;  4KT5 C;  4JX6 A;  3CCE I;  2QQ8 A;  1QO0 D;  1SVM A;  1GXP A;  2Z16 A;  5L3B A;  2X1C A;  1P92 A;  3ZGK A;  1XMK A;  2W25 A;  1G59 A;  4YEJ A;  2EFN A;  3COL A;  2NVT J;  3ZQL A;  3NWS A;  3P9C A;  4LK0 F;  1X4P A;  3IAM 2;  1X2N A;  3R0J A;  5H9T A;  4NBQ A;  3F8B A;  2AQE A;  5F08 A;  1RUO A;  3U1D A;  3OS2 A;  5AQC A;  1SAX A;  3BT9 A;  2F4O B;  1SD4 A;  3ZQ7 A;  3CC4 I;  9ANT A;  2LKS A;  1TT5 B;  3TDZ C;  3CJR B;  3OYE A;  4ABZ A;  1F9N A;  3L1P A;  3K4B A;  3GX4 X;  3C07 A;  2E1O A;  5DCF A;  2DG8 A;  3G7R A;  2P7V B;  2TRT A;  4OIR F;  5EGO B;  3Q0W A;  4IRH A;  3FM5 A;  4E7S A;  3OYC A;  1MMG A;  5IP6 A;  4A3B J;  1OMI A;  4XLN F;  2NAZ A;  2LRE A;  1YE9 A;  3K4C A;  4JX4 A;  2LK2 A;  4Y7N J;  4E7J A;  2HOA A;  2GLO A;  2LDU A;  4XN3 A;  2W57 A;  4QTR A;  1FMW A;  1R58 A;  1W7P B;  3G6E I;  1S7O A;  3E0J B;  1EH7 A;  2JN6 A;  2QGU A;  4ZYD A;  5E1Z B;  4BE1 A;  3ZMS A;  2FD5 A;  3ANP A;  3S16 J;  2DN0 A;  4BAC A;  2GEN A;  4F7Z A;  1HKS A;  4LIV A;  3S14 J;  3HTI A;  1MBJ A;  1T6S A;  3IKV A;  5B1A H;  3JRF A;  2ZY9 A;  3I59 A;  3W6K B;  2PN6 A;  2KRC A;  2OA4 A;  3OYB A;  2ZXH A;  3ERM A;  3BTJ A;  2JA7 J;  4HOB A;  3SQN A;  2K9Q A;  4RM2 A;  2YUS A;  5D5W B;  4CXF A;  4OU0 A;  2HPI A;  4FIS A;  5FKM A;  4MFE A;  4MFD A;  3PO3 J;  2Z2S B;  4NUB A;  1S72 I;  1D0Z A;  3UNG C;  1ITY A;  2LY2 A;  2EZH A;  2BXZ A;  2MH9 A;  5F0C A;  3WG9 A;  1SFE A;  3LQR A;  3CDI A;  3MZY A;  3A03 A;  3HSE A;  4NC6 A;  4ZYE A;  3FXQ A;  5FKK A;  3BG7 A;  1UHW A;  1Y39 A;  3GFJ A;  3COA C;  2X6X A;  5FFX A;  3MAJ A;  3HSR A;  4EEF G;  2KQR A;  5H6R A;  2WC2 A;  4Y15 A;  1ETW A;  3K1P A;  4PZJ A;  3FBN B;  3OWT A;  5D6F A;  1EJ9 A;  2HYF A;  4JP0 A;  1TWF J;  2K4J A;  4BJ6 C;  2I10 A;  4U7D A;  4UDS A;  1J5Y A;  4NC8 A;  4FX0 A;  3BR1 A;  2X48 A;  2OD5 A;  4HZF A;  2L7K A;  2Y0S A;  1SAU A;  1Y8R B;  5FLM J;  1XG1 A;  3BPV A;  2AXT C;  3AKZ A;  2MC4 A;  3DPU A;  3M3Y J;  1RUN A;  3RPU A;  1X3W B;  1YRN A;  4XNF A;  2DT7 B;  2G9W A;  3ROU A;  3JSP A;  1Z7U A;  1K61 A;  4Y13 A;  3G71 I;  4JL3 A;  1WJB A;  3BWG A;  3F72 A;  4M9S A;  4U9L A;  2VBW A;  3H1C A;  2V79 A;  3HOZ J;  3HJE A;  3VSK A;  4BY7 J;  3S93 A;  1XN7 A;  4QWQ A;  2ZCN A;  5C3E J;  2ELK A;  2OUM A;  3J7A O;  4XM3 A;  4F91 B;  2DTR A;  1OCO H;  2DK5 A;  1ETQ A;  3EUH C;  4BL0 B;  2LD5 A;  1EF4 A;  4IRI A;  1MZB A;  2CWE A;  1ZN2 A;  2KDZ A;  2HKX A;  2X6Y A;  1UB9 A;  2MYS A;  1V55 H;  4NHJ A;  3VYR B;  1DP7 P;  5D19 A;  3TDU C;  4J19 A;  1F5T A;  2L9S A;  4M74 A;  3JRE A;  2Q2E B;  2CU7 A;  1TC3 C;  2LVS A;  4KFC A;  5HS7 A;  4A0Z A;  1QA6 A;  1HST A;  1XCB A;  5GPC A;  1OPC A;  3HGG A;  1NK3 P;  1D1C A;  2CV0 A;  2NS0 A;  3F1B A;  2UXP A;  3HRM A;  2FE3 A;  2E1M B;  4HF1 A;  1OCP A;  4I98 B;  3ZRG A;  2R7F A;  4L9V A;  3CJT B;  1YI2 I;  1FOK A;  3KIO A;  5H20 A;  3HBL A;  5HSZ A;  2VKV A;  4KMU X;  3DXJ F;  2P5L C;  3IRQ A;  4D1Q A;  3LNQ A;  4II2 A;  2OPT A;  1S6L A;  3JRI A;  1TW3 A;  1MMD A;  1I50 J;  2BY3 A;  4MQV A;  2QSG X;  5EZH A;  1Z77 A;  3PPB A;  4UUT A;  4I0A A;  1ZG1 A;  2VBY A;  4LLG F;  1G8X A;  2MC3 A;  5FB2 A;  3KP5 A;  3KZ9 A;  2H6B A;  3RIR A;  3VOK A;  4A3M J;  1ETV A;  1O57 A;  3MEX A;  1GVJ A;  3FZV A;  4AU7 A;  2R7X A;  1MD0 A;  3JCU C;  2F4I A;  3LSI A;  2JRT A;  4IVN A;  1GUU A;  1K7A A;  3BNI A;  2CW7 A;  5FKN A;  2IVM A;  2B63 J;  2KKO A;  4E6K G;  1AKH A;  5ICG A;  2F48 A;  4TV7 A;  4Y17 A;  4FCY A;  3NPI A;  2A61 A;  1BN5 A;  3S32 A;  3T1B A;  3FHZ A;  5IP9 J;  1RZ4 A;  2BE5 F;  1QZY A;  3JW4 A;  4RBO A;  3QPL A;  5FO5 A;  3TW7 A;  2ZCW A;  3B73 A;  3F0C A;  3HEF A;  2M0M A;  4RM3 A;  2L7M P;  1SC7 A;  3BR3 A;  4L9T A;  2E2J J;  4G7H F;  3PUB A;  3H0G J;  2GIV A;  5LEK A;  1VND A;  3GME A;  2OCC H;  1KU9 A;  3BP8 A;  1BW6 A;  3LSM A;  1YS6 A;  2LRD A;  3ABM H;  3MVP A;  2CYY A;  4XK4 A;  2IRF G;  3FRQ A;  3DBR B;  5F27 A;  2KRH A;  3CQZ J;  3S3O A;  2BHZ A;  1G2H A;  2A05 A;  3M8F A;  4QLC U;  1YO5 C;  3VFZ A;  4HF2 A;  2HOT A;  2C6Y A;  2WB1 A;  4QPQ A;  3U1K A;  3KNW A;  5HBU A;  3VUQ A;  3S17 J;  5CVV A;  1XCV A;  4CCK A;  4S05 A;  1D8K A;  2E35 A;  1BOB A;  4M72 A;  5FRO A;  3JAM K;  2VON A;  2HR3 A;  4EV0 A;  3BJO A;  1FNN A;  4O3M A;  1U8R A;  5KCM A;  1BC8 C;  2HTJ A;  3HKZ A;  4XRM A;  3PAS A;  1W7P D;  5DEQ A;  3WE3 A;  4UV9 A;  2A2F X;  1PUF B;  4P9U A;  3U2R A;  3BTL A;  2PFV A;  5HAW A;  3R61 A;  1XTA A;  1T08 B;  3WGG A;  1D1B A;  4PFO A;  4X0G A;  5C4Y A;  3K70 C;  4E70 A;  3F9K A;  3R4K A;  3JAM Z;  3GTQ J;  1PP8 F;  2K9M A;  4F55 A;  4R8H A;  2FNA A;  2GWR A;  2IS1 A;  1FOY A;  1MSF C;  1RKT A;  1QQI A;  2ZNY A;  5HDN A;  4XR6 A;  1YW8 A;  2MFZ A;  2CUZ A;  4XSZ F;  2P0W A;  4YFX F;  2CFO A;  3LOC A;  2DT6 A;  2E5N A;  3OYD A;  3S3N A;  1B6A A;  1FIP A;  2BY2 A;  4KYW A;  1TBX A;  3HOV J;  1P7I A;  4P55 A;  4OD5 A;  4KIT B;  3MMY B;  2L0K A;  2BXY A;  2K3P A;  3MZ8 A;  1V4R A;  3GZ5 A;  2P5K A;  3CDL A;  4O6J A;  4A2U A;  4KA4 A;  1I27 A;  1B4A A;  3H3Z A;  3IP4 B;  4JYK A;  1JI8 A;  1W36 C;  3AL0 C;  4G6D A;  5M3F J;  1Z9C A;  2BHY A;  2ZKZ A;  2OJE D;  4C3H J;  2VQL A;  2X6O A;  3MKW B;  4LG3 A;  4O5V A;  1D5V A;  2LF8 A;  2QQB A;  3C1D A;  3ZN0 A;  2V6E A;  1I5Z A;  3FHN A;  3NWT A;  2K9N A;  3EUH A;  4RAF A;  5FKL A;  5ERI A;  3I4P A;  2CQ7 A;  4IEJ A;  2JQ7 A;  1H8A C;  4QIW N;  4UUS B;  4IOC F;  5DCM B;  2O7T A;  2XSD C;  4IHW A;  1ETY A;  3I9V 2;  1LKX A;  2GXA A;  1XDU A;  2G7L A;  4I0B A;  4CSW A;  1FC3 A;  4B4C A;  2Z33 A;  2PZ9 A;  4N9H A;  1R4N B;  4XRS A;  4S04 A;  2WUI A;  4Y33 A;  3KP6 A;  3CMM A;  3KEY A;  3OOU A;  1O4X A;  2KRF A;  1W1W E;  4DQ2 A;  3HOY J;  4PK4 A;  4ZDP A;  5JLX A;  1QVT A;  1FY7 A;  2HYJ A;  3I4M J;  4WWC A;  1W4M A;  2WAF A;  4U0W A;  1E3H A;  2ZSI B;  4M6Y A;  4XMY A;  4EGY A;  3IH4 A;  1TWG J;  4EJU A;  4OD4 A;  1B8I A;  3DTE A;  1LE8 B;  3OYH A;  4I09 A;  2DW4 A;  3G3Z A;  4H0E A;  3L2R A;  1OJL A;  1BR1 A;  2QBY A;  2E19 A;  2Y2Z A;  2VL8 A;  4BHC A;  4PJL A;  1QU3 A;  2UUZ A;  2O9L A;  2X9D A;  5CQG A;  4AC6 A;  4M73 A;  2DCE A;  3RQI A;  2UXI A;  1OYW A;  4BEH B;  5H2F C;  1Y0N A;  3O3K A;  2K86 A;  4XRF A;  3C18 A;  2DU9 A;  1U8B A;  3BR2 A;  1ZH5 A;  2REK A;  4DYC A;  3BTC A;  5ILU A;  3IC7 A;  3HOT A;  3VVZ A;  1OKR A;  2CJJ A;  2HKO A;  5JHU A;  3PM1 A;  4HX8 A;  2X1E A;  2GOM A;  1YQA A;  4AID A;  4I01 A;  5EFY A;  4HNT A;  5E3N A;  2V1U A;  3RYP A;  1HQC A;  1U5T C;  1I3Q J;  2BBY A;  4A12 A;  2IEK A;  1MW7 A;  3M07 A;  3H5A A;  4GRI A;  1FYK A;  2UV1 A;  2R7S A;  1TZL A;  4RGR A;  4DYR A;  5J47 A;  2DJI A;  4M6V A;  2LF7 A;  4YIR X;  4ENK A;  4U87 A;  5K7H A;  4MNU A;  3CWR A;  1SVL A;  3K1N A;  4BE2 A;  4WIB A;  1HCR A;  4D5F A;  3D1N I;  4XKB A;  4EJT A;  1X1B A;  3RKQ A;  4PSW A;  1IUY A;  4OAY A;  2M9H A;  1TNS A;  4QPO A;  3ZPL A;  2EJR A;  3CF5 F;  4HDV A;  1HOM A;  2CQQ A;  1I39 A;  1IN7 A;  4XL9 A;  4AIK A;  2RC4 A;  2XAS A;  4B43 A;  1SMY F;  5KNL A;  3G1L A;  3VW2 A;  4JKZ A;  3K4M A;  2ICW G;  3JRC A;  1JUM A;  2YVH A;  1R1T A;  4L5J A;  5D8L B;  1UAA A;  1BW5 A;  2ME6 A;  1FOW A;  3S2D J;  3MKL A;  3V6G A;  5TJJ A;  3HTH A;  3S8P A;  3ZQF A;  5CW8 A;  4F93 B;  1X58 A;  2CW0 F;  1WWX A;  1TL8 A;  1M1E B;  1F4K A;  3RPQ A;  5M5W J;  2JVH A;  3BRU A;  3DV8 A;  4DBR A;  3VTI A;  1O3R A;  1N75 A;  2JVG A;  3MQ0 A;  3F21 A;  3ZMV A;  1W0U A;  2P81 A;  4CGR A;  4R79 A;  2DO7 A;  3M9A A;  4IHT A;  2EIL H;  2W48 A;  4E7I A;  3DTK A;  2R7V A;  5JVG F;  1E17 A;  2NRA C;  1YG2 A;  1Y0U A;  5IPA A;  4CIC A;  3J81 K;  4I2O A;  1I6X A;  2GBY A;  2DA5 A;  2VE8 A;  4Q4Z F;  3QPH A;  4XLE A;  1HBX G;  5D5V B;  1KYZ A;  2W24 A;  4BXU A;  4C2T A;  2OER A;  4AYB A;  2DLL A;  3TP0 A;  4B48 A;  3J7A Y;  3QQA A;  2BVM A;  2P5V A;  3L09 A;  3H9G A;  1NK2 P;  1WPK A;  4OIP F;  1VQ4 I;  1JHH A;  3NAU A;  5LLQ A;  2CSO A;  1FPQ A;  2FX0 A;  4A3I J;  4IXA A;  4B8X A;  3FM3 A;  5AON A;  1ZAR A;  4AVZ A;  4ZZD A;  3J7Y J;  3CCJ I;  3DTI A;  5LGN A;  3HGY A;  4K2E A;  5J4V A;  2P8T A;  4GCT A;  2FOW A;  2CUE A;  3CES A;  4PCQ A;  3VYT B;  5E17 F;  3BZ6 A;  2CQN A;  2CS3 A;  3HB9 A;  1ZG5 A;  3G73 A;  1B9M A;  2WV0 A;  4G12 A;  3ZXS A;  3M8E A;  3T0Y A;  4GCV A;  1LNW A;  3D5L A;  3WHB A;  3KE2 A;  1LEA A;  3ANG A;  2TCT A;  3TL4 X;  4XLC A;  2R7U A;  3LL7 A;  5J8C A;  3VW1 A;  1ZLK A;  4LLN A;  3SHF A;  2JWT A;  3ISP A;  4ZDL A;  4A3G J;  4UXN A;  1S5L C;  2GA1 A;  4ON0 A;  1WJD A;  1X1C A;  3BCA A;  3KYD B;  3HHG A;  4EM1 A;  2XPW A;  4AC0 A;  2VB6 A;  2KDO A;  1A36 A;  1WFX A;  1Z21 A;  2AQF A;  2IGK A;  1Z67 A;  4P5O A;  3OYJ A;  1XGN A;  1WJE A;  1UCR A;  3S1R J;  2V4J C;  2VQG A;  2ID6 A;  5KVR A;  3AG2 H;  2W00 A;  2DOA A;  1XMA A;  2M7B A;  2KJB A;  3K4K A;  1Z6T A;  4ZZL A;  4U0V A;  1U0J A;  1CF7 A;  3LSR A;  2YVE A;  2YSR A;  3IV5 A;  4MLO A;  1FYL A;  2L5Q A;  2H1L A;  4A3D J;  2VJ5 A;  1JTX A;  4DGW B;  5L3E A;  1BI2 A;  4Q47 A;  3VOD A;  2NOG A;  2W53 A;  3LWJ A;  2VC0 A;  2IJL A;  2VT2 A;  3LSG A;  2BZT A;  2K7L A;  2NYX A;  4RMN A;  1HKT A;  4CO8 A;  2L02 A;  4UY8 I;  1MJ9 A;  4N0B A;  1QRY A;  2IA1 A;  2UXN A;  5TGT A;  3AG3 H;  4A3C J;  2QTQ A;  3H36 A;  2LSO A;  1PP7 U;  4D5C A;  2NVQ J;  2QIB A;  1WI9 A;  4PJM A;  3IAS 2;  4OIN F;  3PSF A;  2G7G A;  3CZ6 A;  2H8W A;  1B72 B;  2KLO A;  3H9J A;  3ERE D;  4KT6 A;  5HLI A;  4Z6Y A;  1BR4 A;  1D5Y A;  3DEW A;  4V2F A;  4HLY A;  1H88 C;  5JFR A;  2EBI A;  2R5Z B;  3HRU A;  4A6D A;  1BC7 C;  1SFU A;  1XSV A;  1U3E M;  4MO7 A;  3GTP J;  1U5T A;  5CKT A;  2BVL A;  1JHF A;  2FF4 A;  3Q0V A;  3I4N J;  2RN7 A;  4XKC A;  1VQ7 I;  3I3L A;  3ZMZ A;  1ULY A;  3A0B C;  4RLF A;  4S0H B;  3CUQ B;  3CCM I;  3I5U A;  1HLV A;  1OLT A;  3I0T A;  5HDK A;  3I54 A;  2ZME B;  2WBM A;  1BJZ A;  5EEA A;  2MSY A;  3HHH A;  4UB6 C;  2JUC A;  3OY9 A;  5CYV A;  2PJR A;  1IRG A;  1SFK A;  2M2E A;  2XHK A;  3RTR A;  3K10 A;  1TQP A;  2VC1 A;  5K7F A;  1L0O C;  2DMQ A;  5F04 A;  4J01 A;  4C2M A;  1DGW Y;  2E5Z A;  2E60 A;  2NVY J;  2OI8 A;  3I55 I;  2QUF A;  4IKF A;  5D6E A;  1J7K A;  1XS9 A;  4GXO A;  2XGX A;  4CGZ A;  4FE7 A;  3LSK A;  3L2U A;  3WG7 H;  2B7E A;  3V8K A;  1ZRC A;  3LA3 A;  1X4O A;  2B1E A;  3JRB A;  2YU3 A;  4B09 A;  4ENJ A;  4KDP A;  2V1D A;  3E1S A;  4HLX A;  1XGM A;  4LLL A;  1FMV A;  3P7N A;  2K27 A;  2AO9 A;  2HOE A;  4IHY A;  2HYT A;  2CFX A;  4BDZ A;  1WH7 A;  2PBI A;  4OIO F;  2CW8 A;  3VWB A;  3BQY A;  2J5P A;  3H0D A;  2KZV A;  2OTL I;  1USS A;  2XRN A;  3IH3 A;  4E7L A;  3BQZ A;  3AFH A;  1ZAO A;  2KHM A;  3OS1 A;  2XPU A;  4ENM A;  4D9J A;  4BXX J;  3RH2 A;  1Y6I A;  4HSR A;  4NQW A;  2RVC A;  2M5W A;  5IYD J;  4NNJ A;  2IT0 A;  3JTH A;  5LRS A;  2D45 A;  4ENN A;  3CDH A;  3ON4 A;  3L2W A;  5HDG A;  3CME I;  1N77 A;  2RRE A;  3TOA A;  3JRD A;  4AIJ A;  3Q9V A;  3EUK L;  2QA4 I;  2F5E A;  4D0P A;  2FJI 1;  3MKZ A;  4ZYG A;  2PEX A;  2ZOZ A;  3BR5 A;  5D4R A;  3ZCO A;  2LOO A;  2HOS A;  1W5T A;  4AD9 A;  5EYR A;  1LB2 A;  1V5F A;  2GZW A;  5IP7 J;  1LFU P;  3AG4 H;  6PAX A;  4ITV A;  4EGZ A;  2MA3 A;  3M7G A;  4UVA A;  1BI1 A;  3VPR A;  3LHQ A;  1ZRD A;  3H5R A;  4PSX A;  1IG7 A;  3K6G A;  1MBE A;  4GGG A;  4E7K A;  1IGN A;  1JXS A;  1GV5 A;  2HQR A;  1QHG A;  2FBK A;  4KN7 X;  1IAW A;  1G4D A;  1MDM B;  3S3M A;  1R1V A;  3BPX A;  2ME0 A;  3A0H C;  5JHF A;  1AOY A;  1TP4 A;  3OYM A;  2EIM H;  5B3S H;  3PFY A;  3SFI A;  2GUH A;  2R7D A;  2R0Q C;  2R7R A;  3CMY A;  1HKQ A;  3BLY A;  3TW6 A;  4QSH A;  2ELH A;  2M8G X;  2Y75 A;  1ACI A;  1NG7 A;  5EZG A;  1YFH A;  2QQA A;  3KEQ A;  3HTJ A;  1XGO A;  3GEU A;  4CCN A;  3GLL A;  2HKU A;  4EQQ A;  2PMZ N;  2IGM A;  3LSJ A;  2R5Y A;  4FTH A;  1P4A A;  3VVY A;  2V26 A;  3R6S A;  3AG1 H;  4WF2 A;  1D0X A;  4CCM A;  5H6Q A;  3CMA I;  3TQN A;  2JPB A;  3SZP A;  1WI3 A;  3DPT A;  2DK8 A;  3CCV I;  4G6Q A;  4JX5 A;  3DEU A;  4II3 A;  3WGH A;  4ASN A;  5DS9 A;  1VF9 A;  1VFC A;  2ADU A;  1U78 A;  2ACJ A;  3KZY A;  2ZNZ A;  4GFB A;  2R4G A;  4EJO A;  1GV2 A;  3HUG B;  5LBQ A;  2RAE A;  2VLA A;  2GM4 A;  2DJN A;  3F8F A;  4KUM A;  1STZ A;  3ECH A;  2P6S A;  2LBF B;  2RGV A;  3F8M A;  1IN8 A;  3RDI A;  4RB2 C;  5CXI A;  1XDS A;  3OR2 C;  3TMO A;  3QYE A;  3RQ4 A;  2YU9 J;  2E34 A;  1TW2 A;  2XSJ C;  2NX4 A;  1J0R A;  2FBH A;  5DD4 A;  4A5M A;  4F3Q A;  3EYI A;  5IOY A;  3FMR A;  1IW7 F;  1YYV A;  4ZH4 F;  1HW2 A;  4DNC A;  1HF0 A;  2FBI A;  4EMS A;  2A3S A;  1MGT A;  3HYI A;  2D6Y A;  1MBG A;  5ILS A;  3RJP A;  2XB0 X;  4RAY A;  3LSP A;  1DU0 A;  2BOL A;  2CO5 A;  2MGQ A;  2HVQ A;  3KP2 A;  3ZQG A;  3OV8 A;  5ILV A;  3OSG A;  1T56 A;  2VBX A;  5GPA A;  4XBF A;  2VQC A;  3VEP A;  3K9T A;  1SFX A;  3Q0U A;  1SEU A;  3VDX A;  2QYO A;  4XIC A;  2CRG A;  4H4K C;  1YTY A;  1Z0X A;  2VN2 A;  3NNR A;  1R5G A;  1R5H A;  2ZSH B;  3NXC A;  2VXD A;  5IT3 A;  5HNF A;  1XSX A;  3PNV A;  4ESB A;  2MG4 A;  1YJN I;  2ZCM A;  4ME9 A;  1OR7 C;  4UUV A;  1ZG3 A;  5TIS C;  2EFW A;  1PDN C;  1G3T A;  3BDD A;  1RI7 A;  1IXR C;  2JA2 A;  3FMQ A;  4L62 A;  3LA7 A;  4GO1 A;  5HOO A;  2CGP A;  2FQ3 A;  4LGW A;  4WCG A;  2HU9 A;  2Z1D A;  2L9N A;  3QOE A;  1WVR A;  2NOJ B;  2RAS A;  2G7H A;  4B3A A;  1KQ0 A;  1WJA A;  2R7W A;  3R0A A;  4WXC A;  1LUJ B;  3WU2 C;  3V78 A;  2P6T A;  4BH9 A;  2MLG A;  3RZO J;  3EQL F;  1IV6 A;  1IN5 A;  3A1Y A;  3P9I A;  3IL2 A;  4IPA A;  4EM0 B;  3CP8 A;  3FXR A;  5F6F A;  3CCU I;  3ESW B;  3TGN A;  4J00 A;  3FXM A;  1BIA A;  4BQA A;  2HS5 A;  1IUF A;  4N4O B;  1Y56 A;  2CUJ A;  3RYR A;  3CCS I;  3WTZ A;  5DYM A;  5LFA A;  5CVJ A;  2RNJ A;  2LYC A;  1X2M A;  3RCO A;  4X6A J;  1MJB A;  3BZC A;  5ICF A;  1SD7 A;  4RB0 A;  4GCK A;  3UR3 C;  2GXG A;  5D5X B;  4XLF A;  4IQ4 A;  2HI3 A;  1S9H A;  5B1B H;  4BBS J;  3NI7 A;  2EZK A;  2B9S A;  4BXF A;  2HDD A;  2V9V A;  1KON A;  1YS7 A;  1R6R A;  4ZJZ A;  1K79 A;  2RNG A;  2BEO A;  2GXB A;  3WU0 A;  5L3D A;  2WA0 A;  1FEX A;  4NDL A;  4A3J J;  4FT8 A;  3JRG A;  1H9G A;  2A68 F;  2IGO A;  2EIN H;  2WWY A;  2QWW A;  2FOK A;  4MEX F;  4HW0 A;  2V1N A;  3CP2 A;  1KZH A;  2VI6 A;  4HAM A;  3GUD A;  3S5R A;  4A93 J;  2HNH A;  3V8L A;  2OAZ A;  2YR2 A;  1MIJ A;  5E8G A;  2KP6 A;  2HFH A;  3MWM A;  1FTT A;  1JT0 A;  1UG2 A;  1POG A;  2XGC A;  3DFG A;  4BQQ A;  1LVK A;  2OQR A;  5LEJ A;  3OIQ A;  2STW A;  3K0L A;  5JLW A;  1Z3X A;  2GIZ A;  1B9N A;  3LWF A;  1O3Q A;  5FD6 A;  3ECO A;  2X85 A;  3VP5 A;  3K8P C;  1VQL I;  1WHU A;  1R49 A;  4DJA A;  2F07 A;  2HQA A;  2FRH A;  2EV5 A;  2NNY A;  4GYG A;  3OYF A;  3VOX A;  3WTX C;  3E7Q A;  4GYI A;  4D7N A;  5BMZ A;  3I59 B;  3HTS B;  3V7R A;  2COB A;  4BGD A;  1MSE C;  5L3G A;  2LG4 A;  2VXZ A;  2UXU A;  1TWC J;  2FUG 2;  1JTY A;  3A01 A;  1FJL A;  2A07 F;  1JKO C;  1BBY A;  3BJA A;  1QHH D;  1NHA A;  2XRL A;  2LY1 A;  2PMH A;  2DMT A;  4C2M J;  3ML6 A;  1ETO A;  4XON A;  3LAP A;  3GEZ A;  4UNO A;  1OFC X;  2NS7 A;  5EG0 A;  1AWC A;  1H89 C;  1KYW A;  4XRS G;  4N4N B;  3QKX A;  1JUS A;  3GF2 A;  1NTC A;  3L9F A;  2E7W A;  1Y8Q B;  3CTA A;  4BQO A;  1BJA A;  4HBL A;  4E7Z A;  4YIF A;  1WH5 A;  3TO7 A;  3ZN1 A;  4CCL A;  4CYC A;  3WTU C;  2JPC A;  2EA2 A;  2KMU A;  1MBF A;  1J09 A;  4A5N A;  3NAR A;  1P4X A;  4GCL A;  1G3W A;  1JJ6 C;  1I1G A;  1Z05 A;  4LOC A;  4PUS A;  3F23 A;  4MGR A;  3I53 A;  4G9Y A;  1IXC A;  1AHD P;  3VB2 A;  2CUF A;  1DP3 A;  5E8I A;  1YRN B;  4CDG A;  1J59 A;  1OR7 A;  5BOX A;  1XPX A;  3C2G A;  5LHI A;  1BI0 A;  2H94 A;  1Z3Y A;  2VOP A;  2L2O A;  4CHU A;  1HSJ A;  3PO2 J;  1NG6 A;  3O2P E;  1TWH J;  4G94 A;  1UFM A;  4YG2 F;  1ZKG A;  2OU2 A;  3NEU A;  2A6E F;  2BW3 A;  2NXN B;  3RKX A;  1ZR2 A;  4L0Y B;  4OIQ F;  3HDD A;  5A2Q Z;  1PVE A;  4DW6 A;  3F3X A;  2NNN A;  4M3E A;  2VJ4 A;  4KIG A;  4L18 B;  1P2F A;  4LIT A;  1J2X A;  3T5X A;  3SXY A;  5EDN A;  3OS0 A;  3BG3 A;  4NB5 A;  5F0F A;  1SAN A;  1TNT A;  4BKX A;  3FMS A;  4B1R A;  3S1M J;  4HG2 A;  3G1O A;  4LG0 A;  1XX5 A;  1G3S A;  1EV7 A;  4AUX A;  4Q5S F;  2HYG D;  5DAJ A;  3LFK A;  3R60 A;  3H92 A;  5HNH A;  2ZME A;  4XOR A;  5FD5 A;  3FIW A;  1PJR A;  3PNY A;  4BDY A;  3ULQ B;  4ZYA A;  5CVU A;  3W6J B;  1IV8 A;  3FXO A;  4HX7 A;  2DDB A;  1SGM A;  1MND A;  4CUG A;  2JK3 A;  1UST A;  3AQT A;  4I99 C;  2RQQ A;  3BR6 A;  2PLY A;  2XDV A;  3EUP A;  3MZH A;  2L9R A;  3EPZ A;  3OMY A;  2KZG A;  3GWZ A;  1QNT A;  2E1M C;  1FSE A;  1O7L A;  4A6E A;  2L54 A;  4XOP A;  5FRN A;  1UJ8 A;  2FU4 A;  2DQL A;  3ZQQ A;  2H09 A;  4HX4 A;  3KKD A;  2M0C A;  4M9Z A;  4IL6 C;  2YX4 A;  4M9X A;  1AKH B;  1DPU A;  3WTV C;  1IRX A;  1B59 A;  3ELK A;  2FBQ A;  4PDK A;  1JGS A;  5F1J A;  4OAZ A;  4ZYH A;  1Z6R A;  2VKD A;  4G7O F;  2OTJ I;  2Y9Y A;  3CCL I;  2EIJ H;  3D0S A;  3CO6 C;  2IS4 A;  3ZQI A;  5C44 J;  3E6B A;  2EZI A;  1JE8 A;  1A5J A;  3ON2 A;  2HDC A;  1R1U A;  1VTN C;  2XKO A;  1IF1 A;  5DUI A;  1VQO I;  4GFK A;  1LFP A;  3UKG A;  4CYD A;  2QZ8 A;  1X1D A;  3ASO H;  5FLX K;  3CC7 I;  3S1N J;  3D5R C;  2XAG A;  1WGX A;  3Q3S A;  5EGO A;  3OSF A;  1FWZ A;  2QM3 A;  2DI3 A;  1TLH B;  1A6Q A;  3BY6 A;  3K4N A;  1ZGA A;  4HV6 A;  1ON1 A;  2E7X A;  3B02 A;  2QOP A;  3IKT A;  1QPI A;  1SMT A;  1ZGJ A;  2ZB9 A;  3BHQ A;  5FLX Z;  2JSP A;  2CV1 A;  1W7P A;  2XUB A;  1P7J A;  1IRF A;  3BG9 A;  4IZZ A;  5K5R A;  1UMQ A;  2A6T A;  2IAI A;  2Y69 H;  4AF5 A;  4IX7 A;  2O8K A;  1QBJ A;  2Y48 A;  2D2W A;  2HGC A;  2EB7 A;  3NRG A;  1MBH A;  3P9T A;  3TO6 A;  5E79 C;  2E1N A;  2JRM A;  3N05 A;  2EH3 A;  4HST A;  3WU1 B;  3CLO A;  4XKW A;  2MBF A;  3DLL F;  5DTD A;  5CLS A;  3DPL C;  3E6M A;  3PIO F;  2V57 A;  4I7H A;  3HRS A;  1S29 A;  5FRM A;  2IA0 A;  2DTZ A;  4IHS A;  4OMZ A;  5D1R A;  2O6G E;  1T0F C;  2EK5 A;  3K69 A;  2YS9 A;  1T8I A;  1I6H J;  2J5O A;  4I6Z A;  1SFO J;  4ESF A;  3IUO A;  4KN4 X;  1K83 J;  2XAF A;  1W5S A;  3GZN B;  4HQE A;  3ZQH A;  3KKC A;  2B3W A;  2KPM A;  2WAQ N;  5LGU A;  1TQI A;  3FXJ A;  3W6V A;  3FK6 A;  4UVB A;  2W84 A;  4AIH A;  1LQ1 A;  4BU2 A;  2LR8 A;  4V2G A;  3BC8 A;  2R7T A;  2AHQ A;  2VBZ A;  4Z2Y A;  4KIC A;  5FGM A;  1DQU A;  1ETK A;  1OCR H;  2K9L A;  4IOA F;  3E7L A;  2EQR A;  3V4G A;  5GAE J;  4ZC3 A;  1REP C;  4L0Z B;  1KU3 A;  1H0M A;  1J75 A;  3SEZ A;  2E2I J;  4IJA A;  5GAG J;  3L2V A;  2CQX A;  1RNL A;  1TTY A;  5EEH A;  4HV5 A;  1IN4 A;  3HUG A;  2OQG A;  3HOX J;  1R7J A;  1FBU A;  1VQM I;  5CVI A;  4BNC A;  2DG7 A;  3FBI B;  4BUP A;  3MCZ A;  4EVI A;  4WX9 A;  4L5I A;  3FKJ A;  1RES A;  1K4T A;  2F4M B;  3SYT A;  3I64 A;  1X3Z B;  2IGN A;  5F1R A;  2KFD A;  4A0Y A;  5LHG A;  3TP3 A;  4I02 A;  1G6N A;  1R36 A;  1R00 A;  3N4M A;  3VVX A;  2DPD A;  3JSJ A;  1VQN I;  1EA3 A;  2G0E A;  2JA6 J;  3RPU D;  5J1R A;  4KIB A;  4D7M A;  1AA7 A;  3H9Q A;  1YIT I;  1QZZ A;  5L3F A;  3FXL A;  3LQQ A;  1IXS B;  4FQG A;  5D5U B;  2FXA A;  2EWN A;  3RSN A;  1V5E A;  4MXM A;  2G7S A;  3VIB A;  5M5Y J;  1I3A A;  3E6D A;  3MKY B;  3GTK J;  1YW7 A;  3OYA A;  1FP2 A;  5ICC A;  3T8R A;  2Q2E A;  2F5D A;  5GP9 A;  2Y9Z A;  2X1D A;  3ZMD A;  1R4M B;  1HXD A;  2X4H A;  4YII A;  2F5F A;  5JR3 A;  1AU7 A;  2XKP A;  3KFW X;  3LAJ A;  1B8I B;  1XSD A;  4KWA A;  1T38 A;  1QPM A;  5IYC J;  3REO A;  3GYH X;  1B1B A;  2CH0 A;  1IDZ A;  3HOU J;  5DM6 F;  2WY8 Q;  2QBY B;  2RV8 A;  4EM2 A;  4YFN F;  1S7E A;  2H8R A;  4B44 A;  3HG9 A;  3I56 I;  3CCR I;  2HQ5 A;  3IHU A;  2UXH A;  1S8N A;  4U7B A;  4N9I A;  1LDJ A;  2OF7 A;  5D8K B;  2RHA A;  3QU6 A;  2E36 A;  1LVA A;  3DBH B;  2LKX A;  1Z7L A;  2QF7 A;  3P9K A;  3GFI A;  2XDN A;  3KZI C;  1IJW C;  5L3C A;  2M8E A;  4BYY A;  2E71 A;  4HQM A;  2QQ9 A;  2VE9 A;  4HPQ A;  2F5V A;  5FGL A;  1VQ9 I;  4ZTF A;  1GHC A;  2Y30 A;  4MQ9 F;  1BI3 A;  3HPH A;  1ONV A;  2XV4 S;  2ZXJ A;  3HSF A;  3BG5 A;  1UI6 A;  4RLQ A;  4HRI A;  3B81 A;  3S1Q J;  2EPF A;  2DA1 A;  1D3Y A;  3IWF A;  3PQJ A;  1MMN A;  2LKP A;  3OR1 C;  2R93 J;  3SWH A;  3EDP A;  1RET A;  1XB4 A;  2YX7 A;  2EV0 A;  3ZP5 A;  2QSF X;  3VOE A;  2GOX B;  4NC7 A;  2ELJ A;  3NQO A;  3TOB A;  4Y4R A;  2JSC A;  3KX2 A;  1KU7 A;  1UI5 A;  1FIA A;  2VKH A;  3OL3 A;  4GFL A;  2ZO4 A;  3LST A;  1OYI A;  4G6T B;  4EJW A;  1MJA A;  2DMU A;  2M7A A;  1SVO A;  5DDG A;  1P6R A;  4C30 A;  3E3V A;  4LK1 F;  4ANJ A;  5J1Y A;  4LB5 A;  1D0Y A;  1X1A A;  1XC5 A;  3S2W A;  4M6X A;  4C9Y A;  1WRJ A;  2L4M A;  2DA4 A;  4UV8 A;  4P96 A;  3JSO A;  1EH8 A;  2R7O A;  5HVQ C;  1HA8 A;  5K5Q A;  1T2K A;  2LMD A;  2H6C A;  1IO2 A;  5J6X A;  5BPD A;  4M3D A;  2E2H J;  2R7Q A;  5FJ8 J;  2M3A A;  1T0F A;  2FSW A;  2IU5 A;  4MK6 A;  5DUK A;  5IOZ A;  3J7Z I;  3CLQ A;  1K78 B;  2XAH A;  1F36 A;  3F8C A;  1ZGW A;  3W3C A;  5E18 F;  1PUF A;  1O3T A;  2QEN A;  1X1P A;  2DPU A;  2H1K A;  1X3U A;  2A6H F;  2QVO A;  1C0W A;  2LFB A;  1ENH A;  3ABT A;  1PYV A;  4XSX F;  1N78 A;  5D18 A;  2WV1 A;  4WXH A;  1IC8 A;  2XAQ A;  4JNN A;  2L7Z A;  5FMP A;  5LRR A;  2UWM A;  3X2Q H;  3AL0 B;  3BRO A;  1GXQ A;  2ESN A;  3QPT A;  3GTJ J;  1RIO H;  3CRJ A;  3GO5 A;  2K02 A;  2DYR H;  3GFM A;  1VQ8 I;  2EFQ A;  3K2Z A;  1RR7 A;  1MMA A;  4OWR B;  3DPJ A;  4AM3 A;  3LSH A;  2K3F A;  4WXD A;  3GZ6 A;  5CVR A;  1FZP B;  3G2B A;  3KP4 A;  4IHV A;  2ZCX A;  2DXI A;  4HNV A;  4L9J A;  1RC9 A;  3ZR8 X;  1KQ8 A;  3GXO A;  1RPW A;  4CH7 A;  4CZC A;  3QRF F;  1RRJ A;  2W85 A;  1FTZ A;  5B5E C;  3FIS A;  2PMZ A;  1SD5 A;  4X1E A;  4W1U A;  2F6C A;  5AIQ A;  4RGU A;  3QYF A;  5K7Z A;  2HZD A;  2IBD A;  3O8G A;  2M1B A;  4KIS A;  2HVR A;  2Z9O A;  1JT6 A;  2XB5 A;  4RAZ A;  4C2U A;  2G3B A;  1MNE A;  4CCJ A;  2O7O A;  1YIO A;  4ZDO A;  2XIG A;  2CMP A;  2RKH A;  3IUV A;  2XC7 A;  4PGH A;  3JR9 A;  3ABK H;  1UZC A;  3F6O A;  3S2H J;  3EYY A;  2Y0S N;  4JBA A;  4A3E J;  1T39 A;  5EF6 A;  5LGT A;  4UUS A;  1CF7 B;  3DKW A;  5DCM A;  1OIS A;  3PQK A;  2P7C B;  3V7S A;  1VZ0 A;  5GTI C;  2CQK A;  3HXL A;  5KAF C;  4NEL A;  4U88 A;  4L9N A;  4E4H A;  3B6A A;  3L7W A;  2XF6 A;  4MEY F;  5B66 C;  4YZE A;  1V54 H;  2IP2 A;  3M1E A;  2A5W A;  3K7A J;  2KIS A;  3M4O J;  1WQ2 A;  2EZL A;  2GAU A;  2HXO A;  1Q1V A;  1YJW I;  2D1V A;  3KP7 A;  1J9I A;  3PFI A;  3E5X A;  4R1H A;  3QOP A;  4ACI A;  5K5O A;  3C2H A;  2M87 A;  2LNB A;  4BQN A;  4A69 C;  2BYV E;  2ZFU A;  3CUO A;  5IYB J;  1LE8 A;  2PI0 A;  5BQT A;  5J3L A;  1LFB A;  1ZRE A;  1GT0 C;  4BE0 A;  1YOV B;  2NP5 A;  3H3U A;  5IY5 H;  2JJ7 A;  3DQV C;  2Q8K A;  1U5T B;  4ZTJ A;  4DZJ A;  3EET A;  2WGB A;  1OCT C;  1EKE A;  2XAJ A;  4BEH A;  2L3D A;  3KYL A;  3V8J A;  3G4S I;  1EH6 A;  4IRG A;  1O7F A;  4JQF A;  4FHT A;  2OCE A;  1LJ9 A;  1U9O A;  3EGQ A;  3RI4 A;  1YHQ I;  3K4J A;  1NH3 A;  5ICE A;  3FKI J;  3DKX A;  3GZI A;  2FMY A;  2PJR B;  2GQQ A;  5CJ9 A;  3W2A A;  1VQ6 I;  1QGP A;  3D5S C;  2KL4 A;  4KJZ A;  1T33 A;  5FLV A;  2XGE A;  3HM5 A;  4KNY A;  5FKO A;  3VW0 A;  3HIM A;  1QZE A;  2XAU A;  2M4K A;  4RB3 C;  1FOX A;  2O0Y A;  5EJC A;  1OCC H;  3M1C A;  3KCC A;  3BTI A;  3GFL A;  3GVA A;  2Y0M A;  1F1Z A;  3I58 A;  2L4A A;  2MD5 A;  5EEG A;  3GTO J;  3E5U A;  1Z1D A;  2FNP A;  5GTH C;  3CUQ C;  2K5C A;  2L9V A;  4BHB A;  3ONQ A;  1FX7 A;  4IRV A;  2DDA A;  1H9T A;  4MTE A;  2ZME C;  2KIQ A;  4B47 A;  1UG0 A;  3OYK A;  3HTU A;  1GDT A;  2R3S A;  2QLZ A;  1A6I A;  3BR0 A;  4FAS D;  3OYL A;  2M30 A;  3TO9 A;  3LJL A;  2K40 A;  2GA2 A;  2ZJR F;  2DFF A;  3DWL E;  1F43 A;  1IZ1 A;  2WY7 Q;  3NRV A;  4GDF A;  4IF4 A;  1KA8 A;  2PG4 A;  4PJN A;  4A0X A;  4G8X A;  1K4S A;  4P1W A;  3V42 A;  4OMY A;  2MAB A;  2JTV A;  2UXO A;  1DGR M;  1FBS A;  3CJQ B;  3HPG A;  2H27 A;  3KEO A;  1JJ8 C;  1HW5 A;  5DV5 A;  3U9G A;  2O61 A;  2DA7 A;  3QPS A;  2R7Z J;  3DKY A;  2HPM A;  2IXS A;  4IHX A;  4A3F J;  2ECC A;  2OBP A;  1HDP A;  2Z5U A;  3ASN H;  5FHP A;  2A5Y B;  2IW5 A;  5K58 A;  1R9T J;  2O03 A;  1ERD A;  1LDK B;  2I8D A;  3KP3 A;  1VQP I;  3AQS A;  3CC2 I;  4NQW B;  4HKU A;  1VQK I;  2YVX A;  4JOM A;  2ECB A;  3K70 D;  2VJJ A;  4RGS A;  3WTW C;  1KQ9 A;  2WB1 N;  2BY1 A;  4BY1 J;  5F0H A;  4A3L J;  3M8J A;  2PX9 A;  3MFK A;  3FF5 A;  3GTG J;  3RKW A;  1KU2 A;  1BM9 A;  2EFO A;  4YFK F;  5HS8 A;  4PJJ A;  3U21 A;  4FE4 A;  2DT5 A;  1YW9 A;  3HKZ N;  2WTE A;  4U0Y A;  1MBK A;  3PSI A;  5J8F A;  1ETX A;  5M5X J;  2DFI A;  1S7A A;  1LPQ A;  2XF7 A;  2MLK A;  3IWZ A;  2W7N A;  2HTS A;  1UHS A;  2KIF A;  2MW8 A;  3T6N A;  1Y1W J;  2MD0 A;  1CQT A;  4HA8 A;  1Z91 A;  3Q5F A;  2CG4 A;  2ZJP F;  2XGD A;  2D5V A;  1KGS A;  1I1S A;  2VOO A;  5C4X J;  1YX5 A;  2FJ1 A;  3G56 A;  2DA6 A;  3OIO A;  2F5C A;  3B6C A;  1W36 D;  2IS6 A;  3CD6 I;  2K4B A;  2STT A;  5GAD J;  2JZY A;  2VPL A;  4RS8 A;  4PGG A;  1E0E A;  1FSH A;  2JA8 J;  3A2K A;  5IT9 K;  3FWE A;  1MKM A;  1A31 A;  2WAD A;  4FX4 A;  2YPR A;  3F22 A;  2LP0 A;  4A3K J;  2FA5 A;  3KPH A;  2JMW A;  3W2W A;  2N8G A;  3JTG A;  4F52 A;  3QU3 A;  1IDY A;  3OL4 A;  3BZK A;  3SJM A;  3DF8 A;  3MN2 A;  5IT9 Z;  3SDB A;  4DVY P;  2KT0 A;  2R5Y B;  3LMM A;  3QP6 A;  3WOD F;  2DFH A;  4XOT A;  3BCG A;  3WTY C;  1RR8 C;  4DBQ A;  1P4W A;  2ZXW H;  4L5E A;  3F6V A;  4UB8 C;  3L2C A;  1R71 A;  5GAH J;  3SZG A;  1APL C;  1FYM A;  1E3O C;  4RGX A;  4DOZ A;  1LDD A;  4LFU A;  5E3O A;  3GBG A;  4CA0 A;  4LIU A;  2HEO A;  3KZZ A;  2W1O A; 
#chains in the Genus database with same CATH homology
 3IH3 A;  3BQZ A;  5D1R A;  3TED A;  1I50 J;  5EZH A;  1Z77 A;  2XPU A;  2YS9 A;  1I6H J;  4I6Z A;  4BXX J;  3RH2 A;  1SFO J;  5IYD J;  3PPB A;  4UUT A;  3QBM A;  1K83 J;  3KZ9 A;  4DZP A;  3ON4 A;  3VOK A;  3ZQH A;  3KKC A;  2WAQ N;  4A3M J;  1ETV A;  3JRD A;  3W6V A;  1B72 A;  3FK6 A;  4C3I J;  2LR8 A;  4V2G A;  1DU6 A;  2ZOZ A;  2AHQ A;  3BR5 A;  2R5Z A;  2HOS A;  4MIM A;  1GUU A;  3BNI A;  5FKN A;  1ETK A;  5EYR A;  2B63 J;  3E7L A;  5IP7 J;  2EQR A;  1LFU P;  1AKH A;  1JKQ C;  1HDD C;  3ZOB A;  3VPR A;  3LHQ A;  4FCY A;  2E2I J;  1IG7 A;  3NPI A;  1MBE A;  1IGN A;  1GV5 A;  2CQX A;  5IP9 J;  1BL0 A;  3HOX J;  4RBO A;  3QPL A;  2M34 A;  1MH3 A;  1JGG A;  3TW7 A;  2DG7 A;  3F0C A;  2ME0 A;  3HEF A;  3GTL J;  1RES A;  2ID3 A;  2L7M P;  3BR3 A;  2E2J J;  1ZTR A;  3SFI A;  3H0G J;  2NVX J;  2GUH A;  2R0Q C;  1VND A;  3TP3 A;  3CMY A;  3TW6 A;  1BW6 A;  4QSH A;  3MVP A;  3FRQ A;  2M8G X;  3VVX A;  4XK4 A;  3JSJ A;  2ZOY A;  1IRZ A;  5EZG A;  2G0E A;  2JA6 J;  5J1R A;  5F27 A;  1RKW A;  2Y31 A;  2LY9 A;  1VI0 A;  3CQZ J;  4D7M A;  5C4J J;  3HTJ A;  4XID A;  1G2H A;  3GEU A;  1TWA J;  2HKU A;  2HOT A;  2PMZ N;  3LSJ A;  3KNW A;  2R5Y A;  4FTH A;  2G7S A;  3S17 J;  4MXM A;  5HBU A;  3VVY A;  2L7F P;  5M5Y J;  3VIB A;  3FK7 A;  3VUQ A;  3GTK J;  1WI3 A;  3S15 J;  4JX5 A;  1Y1V J;  5GP9 A;  1VFC A;  5DS9 A;  1VF9 A;  4XRM A;  3ZQC A;  2Y9Z A;  3HTA A;  3PAS A;  1PUF B;  4C3J J;  1U78 A;  3BTL A;  1AU7 A;  3MNL A;  4GFB A;  3H3V K;  1B8I B;  2QKO A;  4KWA A;  4Y52 J;  3G1M A;  1GV2 A;  1WCM J;  5IYC J;  5HAW A;  2RAE A;  5C4Y A;  1IDZ A;  3HOU J;  5J1U A;  2GM4 A;  2DJN A;  3GTQ J;  2QWT A;  1S7E A;  1BA5 A;  2H8R A;  5CXI A;  1MSF C;  4M3G A;  1RKT A;  2HQ5 A;  2UXH A;  5E3M A;  4JNN A;  2OF7 A;  2YU9 J;  2RHA A;  3LOC A;  2LKX A;  2NX4 A;  2QF7 A;  1FIP A;  2JA5 J;  2XDN A;  3HOV J;  5IOY A;  1IJW C;  5HOD A;  3JRA A;  1HF0 A;  1P7I A;  2LLK A;  2D6Y A;  2L0K A;  1MBG A;  5FGL A;  2XB0 X;  3A02 A;  3LSP A;  2Y30 A;  1DU0 A;  3CDL A;  2MGQ A;  2VUM J;  2XPV A;  3BG5 A;  3ZQG A;  3OSG A;  1UI6 A;  4JYK A;  2NP3 A;  3B81 A;  3S1Q J;  1T56 A;  3WHC A;  5GPA A;  2DA1 A;  5M3F J;  3Q0U A;  2R93 J;  3CCY A;  2Q24 A;  4C3H J;  2X6O A;  4XIC A;  1RET A;  2CRG A;  1Z0X A;  3BJB A;  4AYB N;  3O8H A;  3NNR A;  1UI5 A;  2K9N A;  3NXC A;  2R92 J;  1FIA A;  5FKL A;  2MG4 A;  2ZCM A;  4GFL A;  4PXI A;  4ME9 A;  2VKE A;  4IEJ A;  2DMU A;  1H8A C;  1ZK8 A;  4QIW N;  4UUS B;  2O7T A;  4L62 A;  2XSD C;  4IHW A;  1ETY A;  5E3L A;  5J1Y A;  2G7L A;  2DA3 A;  1XC5 A;  2PBX A;  4B4C A;  1ZR4 A;  2PZ9 A;  3A01 B;  2DA4 A;  2RAS A;  4XRS A;  2WUI A;  4B3A A;  2DMN A;  3RD3 A;  3OOU A;  1O4X A;  3V78 A;  4M3D A;  2E2H J;  2VPR A;  5FJ8 J;  3RZO J;  3HOY J;  1IV6 A;  5JLX A;  2IU5 A;  1QVT A;  2HYJ A;  5IOZ A;  4MK6 A;  3I4M J;  3SDG A;  1ORK A;  1F36 A;  1ZGW A;  1JKP C;  1IUF A;  5EG0 B;  1PUF A;  3IH4 A;  1TWG J;  2GFN A;  4W97 A;  3HE0 A;  1B8I A;  1LE8 B;  1X2M A;  2H1K A;  2NS8 A;  4X6A J;  1OJL A;  2QCO A;  2E19 A;  2Y2Z A;  2LFB A;  1ENH A;  2K9S A;  2O9L A;  2X9D A;  5D18 A;  2WV1 A;  4GCK A;  1IC8 A;  4CYC B;  4AC6 A;  4BBS J;  2L7Z A;  2HI3 A;  3RQI A;  2UXI A;  3NI7 A;  1ZQ3 P;  2EZK A;  4M3B A;  3CJD A;  5FMP A;  2HDD A;  1QVU A;  3GTJ J;  3CRJ A;  5BNG A;  1U8B A;  3BR2 A;  2REK A;  4DYC A;  1RR7 A;  3BTC A;  2DA2 A;  3GTM J;  1FEX A;  3DPJ A;  3VVZ A;  2CJJ A;  4NDL A;  4IHV A;  3PM1 A;  4A3J J;  2ZCX A;  3JRG A;  4HNV A;  5EFY A;  4BBR J;  5E3N A;  1RPW A;  1FTZ A;  1I3Q J;  2IEK A;  2VI6 A;  3FIS A;  3S5R A;  3C2B A;  4A93 J;  2FQ4 A;  1MNM C;  4X1E A;  4W1U A;  4DYR A;  1FTT A;  3JRH A;  1JT0 A;  1UG2 A;  1POG A;  2XGC A;  4M6V A;  5K7Z A;  3O60 A;  2IBD A;  5K7H A;  3O8G A;  2LTP A;  3CWR A;  2HXI A;  1HCR A;  4D5F A;  3D1N I;  4M3F A;  1JT6 A;  2XB5 A;  5JLW A;  3RKQ A;  1MH4 A;  2G3B A;  2M9H A;  2O7O A;  1U9N A;  2DMP A;  3IUV A;  3VP5 A;  1HOM A;  2CQQ A;  1GVD A;  3JR9 A;  2F07 A;  1JKR C;  3HOW J;  3S2H J;  4NN1 A;  2Y0S N;  3IH2 A;  3G1L A;  4A3E J;  3VW2 A;  4JKZ A;  5EF6 A;  3JRC A;  4UUS A;  1JUM A;  2YVH A;  3VOX A;  1BW5 A;  3E7Q A;  2ME6 A;  4D7N A;  3S2D J;  3RZD J;  4DYQ A;  2COB A;  3MKL A;  1MSE C;  4NEL A;  3V6G A;  3HTH A;  2UXU A;  3ZQF A;  1TWC J;  5CW8 A;  1JTY A;  3A01 A;  1W0T A;  1FJL A;  3B6A A;  1JKO C;  1X58 A;  4I76 A;  4ICH A;  4YZE A;  5M5W J;  5CXG A;  3DCF A;  3K7A J;  3BRU A;  3K2A A;  3M4O J;  2EZL A;  2XRL A;  2HXO A;  1Q1V A;  2DMT A;  2P81 A;  4C2M J;  1W0U A;  4CGR A;  5M3M J;  1ETO A;  1JUP A;  4ACI A;  2W48 A;  4RDU A;  1OFC X;  2NS7 A;  5EG0 A;  4JX6 A;  4A69 C;  1H89 C;  5IPA A;  4XRS G;  5IYB J;  2GBY A;  3QKX A;  1JUS A;  2DA5 A;  1LE8 A;  5J3L A;  1NTC A;  1LFB A;  1GT0 C;  2NP5 A;  1WH5 A;  2JJ7 A;  2OER A;  3TP0 A;  4CYC A;  3QQA A;  4DZJ A;  1NK2 P;  1WPK A;  2WGB A;  1OCT C;  3COL A;  2NVT J;  3NAU A;  1MBF A;  3ZQL A;  3NAR A;  4GCL A;  2FX0 A;  1JJ6 C;  4A3I J;  1X2N A;  5H9T A;  4LOC A;  5F08 A;  1U9O A;  3EGQ A;  3HGY A;  1AHD P;  5AQC A;  4GCT A;  3BT9 A;  2CUE A;  3FKI J;  9ANT A;  2CUF A;  3GZI A;  1YRN B;  3HB9 A;  5FLV A;  1T33 A;  4G12 A;  2XGE A;  4ABZ A;  3HM5 A;  3WHB A;  3L1P A;  5FKO A;  3VW0 A;  3HIM A;  3C07 A;  2E1O A;  2DG8 A;  3ANG A;  3G7R A;  2TCT A;  2TRT A;  5EGO B;  3BTI A;  3Q0W A;  4A3B J;  5IP6 A;  3GTO J;  3VW1 A;  4JX4 A;  4Y7N J;  2LK2 A;  2JWT A;  2GLO A;  2HOA A;  3PO2 J;  4A3G J;  1TWH J;  4QTR A;  2XPW A;  4AC0 A;  1ZKG A;  2JN6 A;  1GDT A;  1ZR2 A;  1A6I A;  3BR0 A;  3HDD A;  4DW6 A;  2FD5 A;  4M3E A;  3S1R J;  3LJL A;  2K40 A;  2ID6 A;  3S16 J;  3ANP A;  2DN0 A;  1F43 A;  2GEN A;  3S14 J;  3HTI A;  5EDN A;  3BG3 A;  1MBJ A;  3JRF A;  5F0F A;  1SAN A;  3LSR A;  4BKX A;  2YVE A;  4B1R A;  3S1M J;  2UXO A;  3IV5 A;  3G1O A;  4MLO A;  3BTJ A;  1JJ8 C;  4AUX A;  5DAJ A;  2JA7 J;  2DA7 A;  4A3D J;  1JTX A;  3QPS A;  2R7Z J;  3FIW A;  2K9Q A;  4IHX A;  4A3F J;  2ECC A;  2NOG A;  2YUS A;  1HDP A;  2W53 A;  3LWJ A;  5FHP A;  3LSG A;  5K58 A;  1R9T J;  4FIS A;  4A3C J;  1QRY A;  4MFE A;  5FKM A;  4MFD A;  1SGM A;  3PO3 J;  2QTQ A;  2JK3 A;  4D5C A;  3AQT A;  2NVQ J;  3AQS A;  2QIB A;  4HKU A;  3BR6 A;  2ECB A;  3EUP A;  4BY1 J;  2WB1 N;  2L9R A;  1ITY A;  5F0H A;  4A3L J;  2EZH A;  5F0C A;  2G7G A;  3GTG J;  1B72 B;  3A03 A;  5FKK A;  1D5Y A;  3DEW A;  4FE4 A;  4V2F A;  1H88 C;  2EBI A;  2R5Z B;  3HKZ N;  4EEF G;  1MBK A;  4MO7 A;  3GTP J;  3KKD A;  2M0C A;  1ETW A;  1ETX A;  1AKH B;  5M5X J;  3Q0V A;  3I4N J;  2FBQ A;  4JP0 A;  1TWF J;  5F1J A;  1UHS A;  2MW8 A;  2I10 A;  4S0H B;  4UDS A;  2Y9Y A;  1Y1W J;  3T6N A;  1CQT A;  3BR1 A;  2X48 A;  3ZQI A;  5C44 J;  2XGD A;  2D5V A;  2EZI A;  1HLV A;  1A5J A;  5C4X J;  3ON2 A;  5FLM J;  1XG1 A;  1BJZ A;  5EEA A;  2MSY A;  2FJ1 A;  3G56 A;  3OIO A;  2DA6 A;  3M3Y J;  3B6C A;  1YRN A;  4GFK A;  3UKG A;  3JRI A;  2M2E A;  5K7F A;  1K61 A;  2DMQ A;  5F04 A;  2JA8 J;  3S1N J;  4JL3 A;  1WGX A;  3Q3S A;  3HOZ J;  5EGO A;  3OSF A;  2LP0 A;  2NVY J;  2OI8 A;  4A3K J;  2JMW A;  2N8G A;  4BY7 J;  1XS9 A;  2QOP A;  1IDY A;  2ZCN A;  5C3E J;  2ELK A;  1QPI A;  3SJM A;  2ZB9 A;  3BHQ A;  3MN2 A;  1P7J A;  1ETQ A;  2KT0 A;  2LD5 A;  4FE7 A;  1EF4 A;  3BG9 A;  2R5Y B;  2KDZ A;  1UMQ A;  2IAI A;  4AF5 A;  2O8K A;  5D19 A;  3JRB A;  4J19 A;  3BCG A;  3JRE A;  1TC3 C;  2CU7 A;  3NRG A;  2LVS A;  1MBH A;  4L5E A;  3P9T A;  5GPC A;  3HGG A;  1NK3 P;  3F1B A;  2EH3 A;  2UXP A;  1OCP A;  2AO9 A;  4IHY A;  2HYT A;  1APL C;  5DTD A;  1E3O C;  5E3O A;  1WH7 A;  3GBG A;  3HBL A;  5HSZ A;  2V57 A;  2VKV A;  3BQY A;  3LNQ A;  2DTZ A;  2OPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...