3QPLA

G106w mutant of ethr from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
194
structure length
194
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTWINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural activation of the transcriptional repressor EthR from Mycobacterium tuberculosis by single amino acid change mimicking natural and synthetic ligands.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator EthR
total genus 74
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qplA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qplA02
5D18A 4BBRJ 1JUMA 3HEFA 5C4YA 3K7AJ 3ON2A 1BL0A 5EGOB 2EBIA 1WPKA 3F1BA 2O7OA 1W0TA 2MW8A 4DYCA 3BG9A 4NN1A 4JX6A 4HNVA 1HCRA 3TP3A 2PMZN 3BQYA 2UXIA 5FHPA 1WGXA 1UMQA 3BR5A 3LSRA 1RETA 1OJLA 1GDTA 1X2MA 4ICHA 4BY1J 4FE4A 2UXOA 1X2NA 4IEJA 5FMPA 2P81A 3ZQIA 1FEXA 3VW0A 2IAIA 3BR1A 3S17J 3TW7A 1D5YA 2NP5A 4W1UA 3HGGA 1FJLA 2CUEA 3RH2A 4IHVA 4MLOA 2AO9A 2XGCA 3BCGA 3NRGA 4DYQA 3JRBA 4BBSJ 3GTOJ 4GFBA 1TWHJ 3RZDJ 1MH3A 1RR7A 2K9NA 3S1NJ 1I3QJ 5DTDA 1PUFA 1YRNA 3QQAA 5E3NA 1JUPA 2LFBA 1U8BA 3E7LA 5FGLA 2K9QA 2KT0A 2ID3A 5GPCA 2R5ZB 1ZQ3P 2JWTA 5F0CA 1U9OA 2L7FP 1JJ6C 5F08A 4CGRA 5IYBJ 2NP3A 2IBDA 2JJ7A 4JX5A 3S16J 1JKOC 3Q0WA 2CU7A 5IP9J 3JREA 1H89C 2D6YA 3FISA 5M5YJ 1DU0A 5CW8A 4A3MJ 3QPSA 4NDLA 1SGMA 5IOZA 2G7SA 3M4OJ 3DCFA 1P7JA 1H8AC 1TWGJ 3HBLA 4A3IJ 2H8RA 3NXCA 3SJMA 2D5VA 2E2HJ 1ORKA 2MSYA 3O8HA 1QVTA 1LFBA 3VPRA 3ZQHA 5IOYA 2LP0A 2CRGA 1GT0C 5FKLA 2ECBA 2NVXJ 2Y9ZA 3HOWJ 3OOUA 3I4NJ 1BW6A 3S5RA 3T6NA 4M3DA 4UDSA 2DA1A 5JLWA 3FK6A 3ANPA 1JT0A 3IH2A 2NX4A 4JNNA 4C3HJ 3PO2J 3HIMA 4HKUA 2TCTA 2Y30A 3LSGA 3D1NI 4A3EJ 4XIDA 5J1RA 1TC3C 4DYRA 3WHBA 1I50J 2EZIA 5BNGA 1LE8B 3AQTA 3G1OA 2QF7A 1U78A 2CQQA 1FTTA 1QRYA 5C4JJ 3VW1A 4A3CJ 3ZQLA 3HB9A 2DN0A 2M2EA 1IV6A 2Y31A 2UXHA 3NARA 1GUUA 3HOYJ 2L7MP 4GCTA 3S1RJ 1TWCJ 1UG2A 2WGBA 1LE8A 5F1JA 2DTZA 2WAQN 1HDDC 3L1PA 4JYKA 3GTJJ 2L9RA 4L5EA 1VF9A 5EG0A 4AF5A 4UUTA 5M3FJ 4A3KJ 4M3FA 1CQTA 1AHDP 3HE0A 2DA5A 4D7MA 3IH4A 2Q24A 1MBHA 1IJWC 2H1KA 3A02A 2X9DA 4FE7A 4BKXA 2B63J 1ZR2A 2LVSA 3H0GJ 4A3LJ 4A93J 1MH4A 5M5WJ 1HLVA 3FIWA 1ZGWA 4D7NA 5EZGA 3GTKJ 3ON4A 5EEAA 3TW6A 3W6VA 1A6IA 2ZCMA 4YZEA 3BTJA 1Y1WJ 2XGDA 2R7ZJ 3RZOJ 2QKOA 5E3MA 5F0FA 2LKXA 2XB5A 2RHAA 1T33A 5EDNA 3CCYA 3TEDA 4A3GJ 4B1RA 5HAWA 4C2MJ 5FJ8J 3HTIA 1MNMC 5FKMA 1ITYA 4AYBN 3HDDA 1SANA 3KKCA 1K83J 4MXMA 3DPJA 3VVZA 4FCYA 4J19A 1ZKGA 3PM1A 4FTHA 1Y1VJ 1OFCX 2OERA 4KWAA 1Z77A 1IGNA 1PUFB 1YRNB 4MIMA 3QKXA 3P9TA 3HGYA 1EF4A 1Q1VA 3LNQA 3CJDA 2COBA 2XRLA 5K58A 2EZHA 2I10A 4QIWN 1VI0A 1E3OC 3M3YJ 4CYCB 3O8GA 1NTCA 5GP9A 4D5CA 3TP0A 4L62A 4AUXA 2XDNA 1JUSA 2M9HA 9ANTA 2OPTA 3COLA 4QSHA 2G0EA 4C3IJ 5IP6A 1ETYA 1GVDA 2M8GX 3Q0UA 3FKIJ 3HOVJ 3RKQA 1F36A 3BR0A 3E7QA 2Y0SN 2YS9A 2LR8A 5J1YA 3ZOBA 2YU9J 3BG3A 4M3EA 1NK3P 1BW5A 1RKWA 4B3AA 1WH5A 3G1LA 3Q0VA 2ME0A 3OSFA 4IHYA 2K9SA 5EF6A 2QWTA 4UUSA 2O8KA 1Z0XA 5C44J 3NPIA 4V2FA 4UUSB 2E2JJ 2DMPA 3BNIA 5M3MJ 5FLMJ 3BTIA 2JA6J 4DZJA 5J1UA 3JR9A 3S2HJ 2GFNA 4S0HB 4FISA 5CXIA 3DEWA 2R0QC 2R93J 2DA6A 3BTCA 1ZK8A 4M3BA 3A01A 4XRSG 5CXGA 3V6GA 2VKEA 2G7GA 3LSJA 1QPIA 4GFKA 4BY7J 1NK2P 2E2IJ 2DMNA 5K7ZA 3CMYA 4DW6A 2R92J 1B72A 4GFLA 4JL3A 4XRMA 5IPAA 3GEUA 2XB0X 2EZLA 2JK3A 3JRCA 2ZOYA 4MFDA 1WH7A 3FK7A 1HDPA 2DMQA 1O4XA 1MSFC 4A69C 5HSZA 5EGOA 2O7TA 4NELA 5D1RA 2YVHA 2X6OA 5J3LA 1AKHB 3JRDA 1JJ8C 5EFYA 2AHQA 4AC0A 2E1OA 1AKHA 4W97A 3C2BA 2L0KA 3GTMJ 2HXOA 3HTJA 3GZIA 1I6HJ 3HTHA 2IU5A 2XGEA 4ACIA 5E3LA 1XS9A 4D5FA 5AQCA 1UI6A 3MKLA 3BJBA 2DA2A 2O9LA 2R5YB 1BA5A 2CUFA 2WV1A 4ME9A 2ME6A 1TWFJ 3SFIA 2QCOA 5F0HA 2EZKA 3G56A 3V78A 1IC8A 2LLKA 1ZR4A 3PO3J 3LWJA 4BXXJ 1IDYA 4I76A 3JRGA 4JKZA 2JA5J 2EQRA 2WUIA 3S2DJ 3A03A 2ECCA 4V2GA 2WB1N 3RQIA 3FRQA 2M34A 3JSJA 4MK6A 3VOKA 4GCLA 4MO7A 1VNDA 1UI5A 2HOSA 1BJZA 3LSPA 4G12A 2MGQA 3HM5A 2ID6A 3MN2A 3LJLA 1POGA 1U9NA 1IRZA 1GV5A 3B6AA 2TRTA 2UXPA 2W48A 1FIPA 3CQZJ 3IH3A 4PXIA 5FLVA 2NOGA 3VVYA 5JLXA 3NNRA 1ETXA 5EYRA 3VP5A 2L7ZA 3A01B 3KNWA 4M6VA 4A3FJ 4Y52J 3S1QJ 1OCPA 2Y9YA 2ZCXA 1APLC 3JRAA 2W53A 3LHQA 3VVXA 3RD3A 1JGGA 1MBFA 2ELKA 4X1EA 2QIBA 2QOPA 2Y2ZA 2PBXA 3IV5A 1X58A 4C3JJ 4JX4A 5F27A 3C07A 3BHQA 1ETQA 1MBJA 3ZQCA 5D19A 2DA7A 2K40A 2QTQA 2OI8A 4M3GA 3KZ9A 1JKQC 1S7EA 1FIAA 2HYTA 3B81A 4GCKA 1IUFA 4RDUA 1RKTA 2HXIA 2GBYA 2VPRA 3BR6A 1ZTRA 3S15J 5IYCJ 3NAUA 1HF0A 2DMUA 3OSGA 2OF7A 4RBOA 1ETOA 2R5ZA 1G2HA 2XPUA 2YVEA 2FQ4A 3BTLA 1MBKA 3UKGA 4AC6A 1K61A 2RAEA 2NS8A 1VFCA 1P7IA 5EZHA 2FJ1A 3EGQA 2ZB9A 3ZQGA 3G1MA 3VW2A 2HOAA 1DU6A 2NS7A 2JA7J 3VOXA 2GUHA 2PZ9A 2GM4A 4XK4A 4JP0A 1TWAJ 2G3BA 3GTQJ 3NI7A 2N8GA 4ABZA 3O60A 3BR3A 2G7LA 1MBEA 3AQSA 4Y7NJ 5E3OA 1FTZA 1JT6A 2FX0A 3G7RA 2EH3A 2FBQA 4EEFG 3F0CA 2HKUA 1B8IA 2HYJA 5K7HA 3CRJA 2XPWA 2XPVA 1XC5A 2M0CA 3VIBA 3JRIA 5GPAA 4DZPA 1HOMA 4LOCA 1JTYA 2LTPA 1RESA 1WCMJ 3MVPA 5HODA 1B8IB 5IYDJ 4CYCA 2DG8A 2NVYJ 3BRUA 2JMWA 3S14J 3HTAA 2F07A 2DMTA 3JRHA 3BT9A 2HOTA 2GLOA 4I6ZA 5EG0B 4X6AJ 5HBUA 4A3JJ 5C3EJ 2X48A 2CJJA 2XSDC 5M5XJ 1SFOJ 1XG1A 3BQZA 2YUSA 3IUVA 2HQ5A 3EUPA 4IHXA 1W0UA 1MSEC 1IDZA 3GBGA 2CQXA 2MG4A 3Q3SA 3PPBA 3GTPJ 3WHCA 2HI3A 2JN6A 1T56A 1RPWA 1F43A 4B4CA 2JA8J 3HOXJ 3S1MJ 3VUQA 1ENHA 4QTRA 3QBMA 2UXUA 2DA3A 1A5JA 5DS9A 2NVTJ 5C4XJ 4XICA 2DJNA 2FD5A 1R9TJ 3H3VK 3HKZN 3JRFA 3SDGA 3OIOA 5F04A 3HOZJ 3MNLA 3QPLA 5IP7J 3BG5A 2E19A 1IG7A 1GV2A 2VUMJ 5FKKA 1LFUP 1ETKA 3CWRA 2LK2A 3PASA 2IEKA 2LY9A 4IHWA 4A3DJ 2VI6A 3BR2A 1UHSA 1ETWA 2GENA 2LD5A 4A3BJ 1JTXA 3HOUJ 1WI3A 1H88C 2HDDA 2V57A 3ANGA 5FKOA 2R5YA 3I4MJ 1JKPC 3KKDA 4XRSA 3CDLA 5K7FA 2NVQJ 1MBGA 1JKRC 5FKNA 2ZCNA 3ZQFA 3LOCA 1B72B 5H9TA 1OCTC 5DAJA 4MFEA 2VKVA 1AU7A 3GTGJ 3GTLJ 2DG7A 2KDZA 2RASA 2REKA 1QVUA 3K2AA 2DA4A 3B6CA 2ZOZA 1ETVA
chains in the Genus database with same CATH superfamily
4L5JA 1FMWA 1D1AA 3HEFA 4BBRJ 3K7AJ 1QQIA 2KRFA 4HYEA 1J7KA 3ESWB 1MIJA 2L4AA 2ELJA 2W57A 3RKXA 4R8HA 1I3AA 5K5QA 2JSCA 4A5NA 2DQRA 3RYPA 2R7OA 3OYFA 2WAQA 4Y17A 4N9HA 4HRIA 1T6SA 2QKMB 2M45A 2V1UA 3FDYA 2KISA 1ZLJA 1R4MB 1ZN2A 1FC3A 2R7XA 3R0JA 4RB0A 3ZQIA 2BW3B 1FEXA 3K6GA 2IAIA 1WRJA 4P5OA 3TW7A 2NP5A 1FJLA 2M5WA 3M7GA 3RH2A 1OKRA 4NBQA 2XGCA 4A0XA 5J4YA 4IOCF 1CGPA 4BBSJ 3L9FA 3GTOJ 2XSJC 1FSHA 3DTKA 1OR7C 3TDZC 1RR7A 4EVIA 1I3QJ 3I0TA 2XROA 3QQAA 2JUCA 3DU6A 2OCEA 1B1BA 2BHYA 2BEOA 3E7LA 2PJRA 1J2XA 2FOKA 3F9KA 2HS5A 1I39A 2OU2A 5AIPA 1U9OA 1Y56A 1JE8A 1OCCH 4CGRA 2VQHA 4M6XA 4LB5A 2NP3A 2W82A 3JCUC 3S16J 1BI2A 3Q0WA 2CU7A 3MKYB 1H89C 1OPCA 3FISA 3EYIA 5ICEA 2X6YA 4A3MJ 3QPSA 4BS9A 2DBBA 2QQ9A 2G7SA 1D1CA 2BGCA 4A3IJ 2H8RA 4BEHB 5HS9A 1MNEA 2LH9A 1DQUA 2E2HJ 2BYVE 1ORKA 1X4OA 3IL2A 3UNGC 1H9TA 2Z9OA 3ZQHA 2CRGA 1W4MA 4I01A 2ECBA 3M8FA 3HOWJ 2VJJA 3IC7A 3OOUA 2VLAA 3AG4H 3I4NJ 4UDSA 2DA1A 3FK6A 3VFZA 1JT0A 4E7IA 2NX4A 3ANPA 3HIMA 1XN7A 4ESBA 4ZYGA 3LSGA 4A3EJ 2VN2A 2WA0A 2FF4A 2IGMA 2DOFA 2EZIA 4M9SA 4BEHA 4CZCA 1L3LA 2HNHA 2QF7A 1ZREA 2D1VA 4Y4RA 1SD5A 1DGRM 1FOWA 4UY8I 1GUUA 3FXRA 3HOYJ 2L7MP 3GF2A 1I6XA 2DFIA 3I55I 1TWCJ 3G6EI 4J01A 2FJI1 3WGGA 2DTZA 1HDDC 3H5NA 2Q0OA 3K4LA 1VQ6I 3HRMA 2BY3A 1W5SA 2FQ3A 4E6KG 3E5UA 3P9CA 4II2A 4M3FA 1AHDP 3HE0A 2K02A 4D7MA 3K1MA 2RN7A 2Q24A 1IJWC 2H1KA 4PJNA 1YJ9I 1D8JA 4FE7A 4BKXA 2WWYA 4WCGA 2LVSA 3FKJA 2VE9A 5KHDA 5M5WJ 2Y48A 2LG4A 3FIWA 1ZGWA 4XN0A 2VBZA 2RDPA 3F6VA 3IAM2 5EEAA 2R7TA 3W6VA 2EINH 4YZEA 3RYRA 3CCUI 1BOBA 1LEAA 2VIXA 1NG6A 4HF0A 1KZHA 2R7ZJ 1B4AA 2W4SA 1FZPB 2RHAA 1IO2A 3HRSA 2FXAA 1QNTA 5D8LB 1YO5C 4XBFA 2NOJB 4M9XA 4N4NB 4AYBN 1ZLKA 4RM2A 4FCYA 2VC0A 3BG7A 2QUFA 5KNLA 1S72I 4B8XA 5AIQA 1Y8RB 4UHTA 4FQGA 4BHPA 2HVSA 3P7NA 3SFZA 1PUFB 1OYWA 4MIMA 3QKXA 1G6NA 1I27A 3S3OA 2XF6A 1SFXA 1IXRC 3KFWX 4F55A 1EF4A 2TDXA 2ZKZA 3LNQA 5K58A 2UV1A 4QWQA 1TL8A 1YHQI 3BPVA 1S3JA 2M4GA 3L00A 3DF8A 1SAUA 2Q8KA 1VQ9I 2CO5A 3O8GA 2F5VA 4AUXA 4ZJZA 1DDNA 4NUBA 2RREA 2KFDA 1K6OA 2M9HA 5E17F 2OPTA 3GVAA 4A5MA 2JVHA 2G0EA 1QBJA 1ETYA 1FPQA 3TMOA 1TNSA 1MW7A 2NYXA 4M73A 3RKQA 2YS9A 1W7PA 5LHIA 5J1YA 1Z67A 1FYMA 4M3EA 3VTIA 5CVJA 1RKWA 4B3AA 1WH5A 2MC4A 5F64A 5IT3A 3PUFA 3SZPA 2XAHA 4LK0F 5HLTA 2XVCA 4UNOA 1Z9CA 2O8KA 1L0OC 4C2MA 3ASOH 4OIPF 3L2WA 2D45A 2UXXA 2K4JA 1OYIA 3G4SI 1HW2A 2QSFX 4Q5SF 2E1NA 1VQ4I 4S0HB 2AQEA 2R0QC 2DA6A 1X3UA 1ZK8A 1B59A 4XRSG 4X0GA 4BHBA 3V6GA 3K69A 3LSJA 4HX8A 4BY7J 2E2IJ 1E17A 1W7PB 4XKCA 3CMYA 1YJWI 4GFLA 4JL3A 4Q4ZF 5ILUA 3BZCA 4EV0A 5IPAA 1FOXA 5TRDA 3GLLA 1BR1A 3J80K 3BJOA 2YX7A 3OIQA 4GGGA 5TISC 4BXUA 1LDJA 2ZFWA 2QSGX 2F48A 2MLGA 3FMQA 2VONA 3KCCA 4MFDA 1WJDA 3FK7A 2DMQA 1ZG1A 3EPZA 4RAFA 1MSFC 5EGOA 1S7OA 1YW9A 2X6OA 4GYGA 1AKHB 1R7JA 4MTDA 3R61A 3WTYC 1JJ8C 2AHQA 3LAJA 4W97A 3C2BA 2X4HA 2QGUA 3SHFA 4ON0A 4E7KA 3I3LA 3GZIA 3HTHA 4F52A 2XGEA 3ECOA 1WI9A 2Q2EA 3I5UA 4D5FA 1UI6A 5AQCA 3PJRA 3SWHA 1WJAA 1VQPI 2RC4A 2R5YB 2KPMA 4G9YA 1PYVA 4BACA 1BA5A 2W84A 1Q1HA 2CUFA 2MC3A 3PSIA 3QRFF 4BUPA 4QPOA 2BY1A 1M1EB 4DNCA 2F5FA 1F9NA 3A0HC 2QEXI 3G56A 2DQLA 3V78A 3IUOA 1ZR4A 3PO3J 3LWJA 4HA8A 1F4KA 4KJZA 3TOAA 1IDYA 4I76A 4CCJA 2B3WA 1SFUA 2OD5A 3P9IA 2X51A 1FY7A 3DEUA 2G9WA 4LJZF 2WB1N 3FRQA 1UB9A 3KP3A 2M34A 4MK6A 4GCLA 3FM5A 2FEZA 2HQRA 2HOSA 1BJZA 3LSPA 2V6EA 3AL0C 4LFUA 3DXJF 2K9MA 1IN4A 1U9NA 3MFKA 1IRZA 3LJLA 3QPTA 3ASNH 2XAJA 2W48A 3MZYA 1FIPA 2Q2EB 3CQZJ 4U88A 5IY5H 5E1WA 1MKMA 2LSOA 1ETXA 2HTJA 5EYRA 3WG7H 4II3A 3VP5A 1P6RA 1WHUA 2CW0F 2HPIA 4Y52J 3HG9A 4RAYA 1APLC 2W53A 4FX0A 5J8FA 2QIBA 2QOPA 2E5NA 3IV5A 4EJWA 4JX4A 5D5UB 1Z6TA 1MBJA 3CCEI 4E7ZA 5K5OA 4MEXF 4BL0B 4WXHA 2PN6A 1OLTA 4M3GA 1PVEA 4B44A 5LGTA 5BOXA 3KZ9A 2H6BA 5E8GA 4GCKA 4XLFA 1KYZA 2HXIA 3VSLA 2VPRA 2RKHA 1TQPA 3C7JA 2Z99A 2RGVA 5D4SA 1XDUA 4LG0B 2D2WA 2L4MA 2OF7A 2XKOA 4OIRF 4XSZF 3V8JA 5K1YA 3UKGA 4ZYEA 4U9NA 2RAEA 2M8EA 2PQ8A 4Y3OA 5JR3A 5TJJA 4PSWA 2FJ1A 3MWMA 1SEUA 2ZB9A 2L9NA 4IRIA 2NS7A 4XM3A 4F91B 2JA7J 2PZ9A 2GM4A 4XK4A 4ENNA 2F4MB 4I99C 1IRFA 1ONVA 2G3BA 2GOXB 5DYMA 5CVUA 4AM3A 3O60A 5ICFA 4B43A 4E7HA 2EH3A 2FBQA 3PSFA 4HDUA 1P4WA 2HYJA 4C2UA 4M72A 3BLYA 4XOTA 3ZXSA 1EJ9A 3CDIA 5GPAA 2V1NA 4DZPA 1HOMA 4LOCA 1RESA 3E6DA 5H6QA 2Z2SB 1OCZH 3MVPA 3R0AA 4PCQA 2E35A 3JTGA 2K7LA 3OYNA 3S14J 1FOKA 2DMTA 3R4KA 2DYSH 2ZXIA 4X6AJ 3A2KA 1SFKA 3BY6A 4A3JJ 2AXLA 2X48A 4FETA 4AIKA 1SFOJ 2DU9A 3F22A 1YJNI 3IUVA 4PZJA 2HQ5A 2UWMA 3EUPA 2E36A 3I9V2 5BMZA 4K2EA 2IS2A 2E1MC 2EIMH 2JTVA 1LPQA 3GTPJ 3DKWA 3CMMA 2ZY9A 2JN6A 1W5CC 3QYBA 4EGYA 1T56A 3LSKA 1F43A 5LD2C 3ZMVA 2JA8J 2VKHA 4BQOA 2HEOA 2NVUB 3S1MJ 5JFRA 2OC6A 3LSIA 3D5LA 5C4XJ 2QQBA 3JAMK 4XICA 2DJNA 3A1YA 1R9TJ 3HKZN 5DD8A 2R7UA 4LG0A 2R4GA 1QZZA 1ZYRF 1XCBA 3OIOA 5E79C 2YX4A 1GXQA 1LB2A 2E19A 2DODA 2V1XA 1A35A 5DD4A 1K79A 1HA8A 3AG3H 3N4MA 5D5XB 1ETKA 2LK2A 2K85A 3PASA 4HZFA 2VI6A 3E6MA 4PSXA 3RJPA 4Y33A 3HPHA 2PBIA 3FMRA 4A3BJ 5HLIA 3LA2A 2R5YA 3H9QA 4ZZLA 4IXAA 1ZRCA 1EA3A 5L3GA 4XRSA 5K7FA 1MBGA 1JKRC 3T5XA 1YOVB 2DFEA 4IF4A 3WU1B 2LY1A 1NHAA 2CGPA 2ZCNA 1B72B 3EYYA 3RPUA 3L2CA 2RQPA 2A05A 3IKVA 4PK4A 4BAYA 4NC8A 2VKVA 1T2KA 2VXDA 3GTGJ 2DG7A 1TTYA 2CFOA 3I59A 2OJED 4A2UA 3W2WA 1V5FA 3KETA 5C4YA 4LB6B 3CCJI 2P7VB 1BL0A 2P4WA 5EGOB 2EBIA 1WPKA 2BXYA 2O7OA 3TDUC 2M30A 3G3ZA 2KZGA 2P5LC 4F7ZA 3R60A 4LIVA 3DLAA 4NN1A 1MNDA 2L5QA 5JVGF 3TP3A 3BP8A 1WSUA 3LMMA 2PMZN 4AYBA 3IP4B 3WTWC 3CDHA 1U0JA 3H9GA 2GWRA 1SD4A 3TQNA 4BY1J 3ULQB 2L54A 2VXZA 1X2NA 2P5KA 5AONA 2DOAA 5JI6A 3HPGA 2M3AA 3DKYA 3AFHA 3BR1A 4ENMA 3WTUC 1KU3A 4MQ9F 3WU0A 5DDGA 1S5LC 2K3PA 4IHVA 3OYAA 4A0YA 2AO9A 3AG2H 2ZJ2A 3E5XA 3QYEA 2NNNA 4DYQA 3H3ZA 1W36D 4BE2A 5ERIA 4GFBA 5L3BA 2XASA 3CP2A 4HV5A 4EGZA 2K9NA 3S1NJ 5BPDA 1YRNA 2FA5A 1JUPA 4YFKF 1U8BA 1BIAA 1UJ8A 4HAMA 2MABA 2R5ZB 2DAOA 1ZQ3P 3RPQA 1Y0UA 5F0CA 1R6RA 2IJLA 4A6EA 3W6JB 5IYBJ 1HC8A 4HSTA 4R1HA 3BJ6A 4JX5A 2MA3A 4IQ4A 2D6YA 2F2EA 1SMYF 3BZ6A 5CW8A 1DU0A 1JHFA 2FBIA 2R7RA 2H09A 2V1DA 4LD5A 3JAMZ 2BW3A 3K70C 2V9VA 3QPHA 3DCFA 1P7JA 1H8AC 3HBLA 1UHMA 5ILSA 1LNWA 1UZCA 3TO9A 4YFNF 2EFQA 2VL8A 3KYCB 2IGNA 2LKPA 1O3RA 3FXLA 4RB3C 5H6RA 4BXFA 1RIOH 4RM3A 5FKLA 4MGRA 3S8PA 3V8LA 2JVGA 1R23A 2VC1A 3L09A 1N78A 3SQNA 3H3UA 3EUHA 3WTTC 3IWZA 3S5RA 3T6NA 1XMAA 5JLWA 4JNNA 3FHNA 3QP5A 2ZMEB 5L3CA 2EV6A 5ED4A 5LHGA 4DYRA 3WHBA 2BXZA 3DV8A 4PDKA 4C9YA 2KIQA 1LE8B 3AQTA 1RZ4A 3MCZA 1FTTA 1KU2A 3VW1A 2CQQA 3EDPA 1QRYA 5C4JJ 3L2QA 2V9KA 5E1ZB 3ZQLA 1IV6A 2DK8A 3HXLA 2XHKA 2EWNA 4G6TB 3Q9VA 3HOTA 3S1RJ 4XNFA 1HXDA 5D4RA 2GZWA 2IP2A 1V5GA 1T8IA 5CYVA 4QPQA 1BI1A 4JYKA 4ESJA 2KRHA 4U7DA 4L5EA 2XRNA 3LSTA 2QVOA 1KONA 4CYDA 4AF5A 3L2RA 4A3KJ 1CQTA 3MAJA 1Y39A 3OYJA 1KQ9A 2M87A 1DPUA 1SD6A 3F23A 2B63J 4U9LA 1ZR2A 2DW4A 1Z7UA 1G59A 4JK1X 2CW8A 1IV8A 3ML6A 4A93J 2VPLA 4NQWA 3GTKJ 2HKXA 3ON4A 3ONQA 3TW6A 1A6IA 1XX5A 3LA7A 3BTJA 3H1CA 3HIFA 4CICA 2L9SA 3K1NA 5D5WB 1N75A 3WE3A 2W7NA 4A3GJ 1R4NB 4RGXA 3KEQA 5E18F 3SEZA 3OOPA 3HTIA 2YU3A 2CMPA 4HX4A 4U0YA 3KKCA 1T39A 4UB6C 3VVZA 4LITA 4KIGA 1ZKGA 4J19A 3VODA 2JPBA 2ZSIB 2OZ6A 4KWAA 3KP6A 1Z77A 4MTEA 1IGNA 4IKFA 5ILVA 5D6EA 5GAHJ 3OYMA 3Q5FA 3HGYA 4F3QA 2Z5UA 2XDVA 3RPUD 3ZQ7A 1NG7A 1U5TC 3FWEA 1R5ID 4DVYP 3E1SA 3SYTA 1YS6A 3M3YJ 2BV6A 2LY2A 4CYCB 1UCRA 3GFMA 1W36C 4L62A 1Z05A 1H9GA 3KE2A 2NNYA 1J5YA 1XSXA 4QSHA 5LBQA 1GVDA 3HOVJ 1F36A 2LBFA 3BCAA 3BR0A 2KKOA 1YTYA 2YU9J 2QA4I 5FLXZ 3BG3A 1NK3P 2M7AA 1F1ZA 3G1LA 2DTRA 2KIUA 3WGIA 2ME0A 3OSFA 3QAHA 4IHYA 2COMA 2CQNA 3K9TA 2OQGA 3GX4X 2QWTA 4GYIA 2CFXA 2L7KA 3T1BA 5LEKA 3E5QA 4UUSA 1Z0XA 3HHHA 2L3DA 3JW4A 4BQQA 5EEGA 3NPIA 3NS4A 4BDYA 1O7FA 3BNIA 1G3WA 5FLMJ 1C0WA 1K4TA 3OS2A 1LDDA 5J1UA 3S2HJ 3KP4A 5FD5A 4FISA 3DEWA 3U9GA 1E3HA 1IF1A 4AIHA 3PNYA 1T0FC 2G7GA 1QPIA 3DU5A 1NK2P 1R5HA 2YVXA 5H2FC 2WC2A 5GAGJ 3S3NA 1B72A 2FUG2 3K1PA 2JT1A 4I7HA 2EV0A 2HVQA 2EFWA 1J9IA 2DJIA 4E4HA 2ZOYA 4OOIA 4GCVA 3H36A 1HDPA 1O4XA 2UUZA 1KA8A 4B47A 4A69C 1YQAA 5HSZA 4NELA 2YVHA 3VWBA 3E3VA 1MD0A 3GXOA 3WODF 3DTIA 5J3LA 3BJAA 3JRDA 3DPLC 2XGXA 1X1CA 5EFYA 2RQQA 4C2TA 3GTMJ 2O03A 2ZJPF 1K78B 2OUMA 4IX7A 1I6HJ 1USSA 2OTJI 1RC9A 2IU5A 1ZAOA 1D3YA 3OYEA 2WB1A 3MKLA 4G6QA 3BJBA 5DCMB 2O9LA 2DT5A 3COAC 2EILH 2JQ7A 1LVKA 1DP3A 1IAWA 2ELHA 3NEUA 1O3QA 1U5TA 2GIVA 4BQNA 5JVTA 4UVAA 4OINF 3SZTA 2OZUA 3FHZA 3HC7A 5A2QK 3RQ4A 1PDNC 1XMKA 4HLYA 1ZGJA 2AS5F 1TP4A 4U0WA 1MJAA 4BXXJ 4JKZA 3JRGA 3EUAA 4PUSA 2F6CA 4HV6A 3A03A 3DPUA 1FNNA 2ECCA 3D5SC 3M1EA 2O8XA 2QBYB 2LREA 1FYLA 4WXCA 3VOKA 3DKXA 1VNDA 4KIFA 4G12A 2MGQA 3MN2A 3FMSA 1POGA 3B6AA 2KJBA 2K3FA 2TRTA 2HTSA 2UXPA 2A6EF 2BBYA 2HU9A 3MZ8A 4PXIA 3KNWA 2VASA 2BE5F 2M4KA 5JHUA 4ENJA 1FYKA 3VVXA 3JRAA 4RLQA 3LHQA 4MEYF 3VSKA 1D0XA 3H92A 1JGGA 3RD3A 5KAFC 4X1EA 4MHGA 2GQQA 1F5TA 3DBHB 4B09A 3GEZA 3F8NA 5F27A 1WZ2A 3I4PA 3PUBA 1ON2A 1Z6RA 2ZC2A 4XMYA 3ZQCA 3F8BA 4HW0A 2LF8A 2K40A 2OI8A 2RNGA 2K9LA 4BE1A 4A0ZA 4RDUA 3NWSA 1RKTA 2FNPA 4M9ZA 3CTAA 1ZELA 2EV5A 4HNTA 1WJBA 5IYCJ 1VTNC 1HF0A 4U87A 4CO8A 2LMDA 2QQ8A 1MMDA 1YW7A 3VOEA 1G2HA 3K0LA 2FQ4A 5DCFA 1MBKA 2HFHA 3FXKA 3CO6C 2NS8A 1I1SA 2HGCA 4UV9A 1FLIA 1HKTA 4Y13A 5DCMA 5JHFA 1VQ5I 5H20A 4BJ6C 5CVIA 2DK5A 4OU0A 2MYSA 3QU6A 1TWAJ 3ZP5A 5GADJ 2W25A 3BR3A 4E7LA 1MBEA 2NRAC 4Y7NJ 5E3OA 2PFVA 4AVPA 2Z33A 2FX0A 1X3WB 2ZMEC 3G7RA 1BIBA 3DFGA 1B8IA 3NQOA 5L3EA 5K7HA 3CRJA 3CUQA 2ZO4A 1WKMA 2DT7B 2XPVA 4RGSA 1XC5A 2M0CA 3VIBA 2LBFB 4O6JA 4OAYA 3U1DA 4L0YB 2AQFA 4YIIA 1Z91A 1OISA 2PMUA 3T8TA 4JBAA 4L9VA 3HJEA 3BT9A 1O7LA 1OCOH 1USTA 1XCVA 3ECHA 3JSPA 3CO7C 4I6ZA 1OCRH 1U3EM 1X1BA 3CMAI 4DIQA 5DM7F 5FRNA 2YUSA 3BG6A 4IHXA 1W0UA 4RGUA 4CZZA 1IDZA 3GBGA 4XORA 1BR2A 2F5CA 4XKWA 3PPBA 3CCQI 2QYOA 1K6YA 2KL4A 4ZYHA 2FMYA 3GCMA 5DEQA 4EJOA 3DLLF 1N77A 1P92A 1SVMA 4XQFA 4XLNF 2CYYA 2XAFA 1XSVA 3KPHA 3CUQB 2E1MB 2ZJRF 1ENHA 2Z3YA 2RNJA 2Z1DA 2EFOA 2DA3A 2K27A 3HRTA 3RIRA 4KMFA 2IW5A 4F92B 1A5JA 1S29A 1BOAA 4LLNA 2R7SA 2JA2A 5HNHA 2FU4A 2Y75A 1ZH5A 2A68F 2JRMA 3ZMTA 2HOEA 1HSJA 2KLOA 4G7HF 3GYHX 3SDGA 3V7SA 2GXGA 5GAEJ 3KZIC 3BG5A 1IRGA 4BH9A 2R7QA 2VUMJ 5HVQC 2VBWA 5FROA 3HSFA 3CWRA 2IEKA 1U2WA 4IHWA 1UAAA 2NAZA 3BR2A 2O0YA 1LVAA 2XKPA 2IA2A 3DP7A 4RB2C 4PJ0C 3OV8A 1H88C 2H6CA 2X6WA 3ZN0A 2HDDA 5KK1A 5FKOA 3I4MJ 1JKPC 2NVQJ 3CDLA 2MLKA 1W7PD 2DYRH 3I64A 3LOCA 2DFHA 1Z3YA 4LK1F 1OCTC 4MFEA 2LYCA 3C18A 5FFZA 2RASA 3OYKA 2DA4A 3B6CA 3MZHA 4OMZA 2ZOZA 4ICHA 5D18A 1ERDA 1JUMA 2M0MA 4CXFA 3WGHA 3ON2A 2VOOA 2G7HA 2VJ4A 2V4JC 3FBIB 3F1BA 4G94A 2ZBKA 2MW8A 3LAPA 1EKEA 1QHGA 1JGSA 3BG9A 4IZZA 3RKWA 3S93A 1A04A 2O6GE 2X0LA 1HCRA 3BQYA 2UXIA 4EJUA 5FHPA 1UMQA 4CCMA 3B73A 1YLFA 3I54A 3FXUA 4BJTA 3BDDA 3CCSI 2UXOA 1IZ1A 4IEJA 5FMPA 5CKTA 3VW0A 1S7AA 1BC7C 2MD5A 3J81K 2E7XA 3HGGA 1Z1DA 2V7FA 4ZDLA 3ZCOA 5B3SH 3J7AY 2DPUA 2LRDA 3BCGA 3KYLA 3M9AA 4RA2A 1GLNA 3JRBA 4J00A 3IHUA 3DQVC 1TWHJ 1MH3A 4HDVA 2OAZA 4FT8A 3U21A 1D8KA 2BHZA 3CC4I 5FGMA 1PUFA 1WJCA 2LFBA 1YX3A 3H9JA 3F21A 5F1RA 2KHMA 2DCEA 2K9QA 3GWZA 1V3FA 5FGLA 3FZVA 4YG2F 2X1CA 2Z16A 2QM3A 1JJ6C 1PUEE 5F08A 1UFMA 2YPRA 3ISPA 2GA1A 4H0EA 2STTA 1E3PA 4HNUA 1IN5A 3JREA 5M5YJ 3ZMUA 3L7WA 4YRVA 3OYLA 2IVMA 4NDLA 5IOZA 3M4OJ 2IT0A 3NXCA 2KDOA 4H4KC 3OYBA 1R22A 3SJMA 1T08B 3W2AA 2D5VA 2HR3A 5DV5A 5D5VB 2MSYA 3SZGA 3O8HA 5F6FA 1LFBA 3HSRA 3VPRA 4M74A 2LP0A 1Y8QB 3OY9A 4E70A 2NVXJ 2MH2A 4GDFA 5DUIA 1BW6A 3KP2A 4NB5A 1FP2A 2WBMA 2R7FA 2VBXA 3W3CA 1X1DA 1TZLA 4HLXA 3PO2J 4QLCU 3CCVI 3ZN1A 2Y30A 2ZFUA 4BGDA 1G8XA 3D1NI 4FX4A 4XIDA 5J1RA 2K4BA 3LWFA 4NNJA 3JTHA 2JZYA 1FBSA 1ODDA 2KQRA 3FXJA 5BNGA 4CDGA 5J47A 4AD9A 1U78A 3T8RA 2DN0A 4CCKA 1NH3A 3OIPA 1HSTA 3WTSC 2Y31A 2X1EA 3KEOA 4GO1A 4L9JA 1DP7P 1CF7A 2Q1ZB 2CSOA 1MMGA 5F1JA 2WAQN 3RI4A 1O3TA 3L1PA 2E5ZA 2L9RA 3MD2A 1BC8C 3EQLF 1VF9A 5EJCA 2OBPA 3W6KB 3O6BB 4XL9A 2DA5A 3IH4A 5CLSA 1FOYA 3K70D 4WWCA 1MBHA 1BN5A 2X9DA 2CWEA 1YW8A 3SDBA 3G2BA 1X19A 3H0GJ 1G3YA 3PFIA 4A3LJ 5ICCA 1MH4A 2XV4S 1IXSB 1SFEA 3F6OA 4NQWB 1HLVA 2PI0A 1P4AA 5BQTA 5GTHC 4D7NA 5EZGA 4XLHA 5KAIC 2DLLA 1XMXA 2XGDA 5LEJA 2VODA 5F0FA 3GO5A 2LKXA 1SC7A 2QSHX 1K4SA 4IOAF 1T33A 3C2HA 3TEDA 3CCYA 1IN6A 4B1RA 4IJAA 1QZYA 3K2ZA 4C2MJ 1XD7A 5FJ8J 3KP5A 1AOYA 3AL0B 1ITYA 4PJJA 1EH8A 4XLCA 3HDDA 5BS6A 3REOA 1SANA 1TQIA 2ISZA 4MXMA 3DPJA 1WJEA 4KICA 4CCOA 3PM1A 4FTHA 1Y1VJ 5HDGA 2X6XA 1OFCX 3PFYA 2WADA 3P9TA 2ZSHB 2HQNA 3BPXA 3F8MA 3H5AA 3EETA 3H0DA 3DEEA 3CJDA 3V7RA 2XRLA 2CG4A 2EZHA 2I10A 5J8CA 1WQ2A 3E6BA 1VI0A 4RLFA 4YELA 2IS1A 1BM9A 2FE3A 4P55A 1ZARA 2HKOA 5GP9A 2XDNA 2I8DA 2XC7A 1JUSA 5FRMA 9ANTA 4XLAA 3SEQA 5IP6A 1D0ZA 2BY0A 2M8GX 2QLZA 3Q0UA 3RKYA 3E7QA 1R5GA 2Y0SN 2LR8A 3ZOBA 2EB7A 2BVLA 3O3KA 3H5RA 1BW5A 4HBLA 2IA1A 2Y0MA 4N4OB 1LFPA 3VEPA 3GFIA 3Q0VA 2CUJA 2QBYA 4RMNA 3OWTA 4P9FA 2K9SA 4HG2A 1EV7A 2WY8Q 3E0JB 5HOOA 4V2FA 3CC7I 2E2JJ 1VZ0A 1YS7A 2DMPA 5M3MJ 3FX3A 4DZJA 3KLNA 3ZMZA 3MMYB 4I09A 5CXIA 2R93J 4F93B 4WIBA 3BTCA 4M3BA 3QOEA 2VKEA 2IGOA 3HYIA 4LLLA 2OTLI 4IHSA 5J40A 4GFKA 3OYGA 1BI3A 4N0BA 2R92J 4DW6A 4ZC3A 3AAFA 4XONA 4XRMA 3N05A 4NHJA 3GEUA 2XB0X 2A3SA 4CHUA 3U2RA 3JRCA 1WH7A 1KU9A 3V8KA 2A5YB 1HQCA 3HSEA 5D1RA 1R1UA 1W1WE 2E34A 2UXNA 1TT5B 3OL3A 1PJRA 2JPCA 4XOPA 1YE9A 1Z7LA 2PMZA 1XSDA 2D1HA 1K78A 2E1OA 4KUMA 2L0KA 4UV8A 2C6YA 1B9MA 4IQJA 1UELB 4UVCA 3HTJA 3DBRB 3CD6I 5HDKA 1U5TB 5E3LA 3BROA 3CLQA 1UHWA 1MDMA 1GHCA 4GXOA 5K5RA 2P5VA 2FBHA 4UXNA 2VQLA 2MD0A 1V54H 1O3SA 1TT0A 2LNBA 3KP7A 2WV1A 1T0FA 5HS8A 2DO7A 2XIGA 5KVRA 2H27A 5DM6F 4YEJA 3PL8A 3S3MA 5FFXA 2ME6A 3F3XA 3SFIA 2QCOA 5F0HA 3TL4X 2EZKA 4KITB 2NS0A 3OYDA 4G7ZF 4ENKA 4M6YA 3MKZA 3F8FA 2ETHA 3ZGKA 2VKDA 2JA5J 2WUIA 4ZDOA 4OD5A 4V2GA 2R7WA 3RQIA 3V42A 2L01A 3RTRA 2W00A 3JSJA 4EATA 3FF5A 4I02A 4LIUA 3IKTA 2GAUA 2CV2A 1YIJI 3OYHA 2A2FX 2R7VA 4A12A 1GV5A 2F5DA 2JRTA 1MDMB 3IH3A 1LEBA 5FLVA 4O3MA 2NOGA 3KEYA 2EK5A 5JLXA 2ADUA 3VVYA 3NWTA 2EA4A 1Y0NA 3A01B 4A3FJ 2EJRA 2Y9YA 1BR4A 1R1VA 3FXOA 1YIOA 1HW1A 1J09A 2QENA 3I71A 4C3JJ 3HRUA 2KIMA 1VQ8I 3E6CC 2HQAA 5CJ9A 5D19A 4IPAA 2DA7A 4OD4A 2A6TA 1R58A 1KQ8A 1JKQC 1IUFA 3I59B 1JXSA 1R36A 3ZMSA 4KT6A 1U6GA 4CUGA 1D1BA 5E20A 2BZTA 3S15J 1VQLI 2DMUA 3OSGA 4RBOA 1TQMA 2HDWA 4AWXB 3AKZA 1VQ7I 1OR7A 2YVEA 4B48A 1OQYA 4E7JA 3ZQQA 1K61A 2JUGA 4AIJA 2E7WA 3MEXA 1P7IA 2B7EA 3LSMA 3HHGA 3CMEI 2UZKA 5B1BH 4AVZA 5E8IA 2LOOA 3Q9SA 1U8RA 3G1MA 1DU6A 3VOXA 2GUHA 2LKSA 4JP0A 4GRIA 1FSEA 4EMSA 2GXBA 4PFOA 4EM2A 1XDSA 4JQFA 1JT6A 3A4CA 2HKUA 4RB1A 1XGMA 3K4BA 1OMIA 2OQRA 1SD7A 4IL6C 3GZ6A 1TW3A 3FXMA 4AIDA 1JTYA 2DG8A 5HODA 2RV8A 2QKLB 1RNLA 4XSXF 2HDCA 3HTAA 1DPRA 1WFXA 4EM0B 4XR6A 3DPTA 5FD6A 3TGNA 2F07A 4PJLA 2HYFA 3P5JA 2GLOA 2HOTA 5EG0B 5C3EJ 2WY7Q 5M5XJ 1JHHA 2L9VA 3BQZA 3V4GA 1IN7A 1B9NA 3L2UA 3S32A 4RAZA 1MSEC 3VYSB 5A2QZ 5LHHA 4G6DA 2CQXA 3Q3SA 2OCCH 4EM1A 1RPWA 3O2PE 3CESA 3FXQA 4B4CA 4P9UA 2V9PA 3FBNB 2QQAA 1R49A 2VE8A 3S2WA 3HTSB 3VUQA 2VT2A 2KJCA 2KZVA 4QTRA 4L18B 3PQKA 2UXUA 4I98B 2W24A 3ZR8X 3VYUB 5DS9A 2IS4A 4CSWA 3X2QH 2FD5A 3H3VK 1ZGAA 3M8EA 4IRVA 3JRFA 5B66C 3VDXA 2FNAA 1KGSA 5F04A 4PJMA 3CF2A 1RI7A 3GW2A 3QPLA 5IP7J 3QP6A 3ABKH 1IG7A 4M71A 1GV2A 3OS0A 1B6AA 1WVRA 4IRHA 4RGRA 3LQRA 3D0SA 2LY9A 1XTAA 2K5CA 4A3DJ 1R00A 3ABLH 1ETWA 1T38A 3KYDB 4TV7A 2ZCWA 2F4OB 2LD5A 3K4NA 2LF7A 2YR2A 3ROUA 1XB4A 4Y15A 2QZ8A 3KKDA 3L2VA 1STZA 3K4KA 4HX7A 2WV0A 1Y6IA 3MQ0A 4HF2A 4NC6A 3ZQFA 4KT5C 3ZPLA 4KA4A 5H9TA 1FMVA 5DAJA 5FO5A 1AU7A 1X4PA 4HEA2 1UG0A 3QODA 3K2AA 4XLPF 3I58A 1ETVA 2GIZA 1IW7F 5CQGA 4LG3A 3KIOA 4Q47A 2A61A 3E97A 2GXAA 1WJFA 3ABMH 5E1XA 5LGNA 1W0TA 1XGSA 4DYCA 3VB2A 1WWXA 4JOMA 4I0BA 2P6TA 2G7UA 4JX6A 4YIFA 4HNVA 1H0MA 5L3DA 3P9KA 4L9NA 1WGXA 2XUBA 3BR5A 1XGOA 4ITVA 2CV0A 3LSRA 1RETA 1OJLA 3GMEA 1BBYA 3QYFA 2BOLA 1X2MA 1GDTA 3BZKA 4FE4A 3CP8A 3RDIA 1RUNA 3GFLA 4KMUX 2LC2A 1GXPA 2VJ5A 1S8NA 2P81A 3KZYA 4MNUA 2A5WA 2IRFG 3KLOA 3S17J 1D5YA 4OWRB 4W1UA 4HQEA 3N97A 2CUEA 3IAS2 4CH7A 4MLOA 6PAXA 3M07A 3NRGA 1ZRFA 2ZNYA 3OS1A 4G7OF 4HQMA 4S05A 1P4XA 1Z21A 1HBXG 2P0WA 3RZDJ 1ZG3A 5DTDA 1OYYA 2R7DA 5E3NA 1PP8F 1V4RA 2KT0A 2Y0SA 2ID3A 2W85A 5GPCA 2JWTA 3WG9A 3HKZA 3OYCA 4ANJA 2IXSA 2L7FP 2EFNA 2W1OA 3WTXC 4N9IA 2KRCA 3OR2C 4WX9A 2IBDA 4V19K 3ERED 2JJ7A 3ZMDA 2DDBA 1JKOC 5IP9J 2CQ7A 1SMTA 1LDKB 2ESNA 3EUKL 1BJAA 1SGMA 1TWGJ 4DBRA 3I53A 3G73A 1LQ1A 2EFPA 3RSNA 3VYRB 3F72A 2HVRA 3CJQB 2DOEA 1QVTA 2WTEA 2CUZA 2V79A 4UVBA 5IOYA 2KP6A 4KYWA 4OIQF 1GT0C 3K4CA 4CA0A 4S04A 4DGWB 5IT9Z 1RRJA 1QHHD 2Y9ZA 1ULYA 5LLQA 2A07F 4M3DA 2ZNZA 2ACJA 2ZMEA 3IH2A 2NXNB 4C3HJ 3CF5F 4HKUA 4BHCA 2TCTA 4IHTA 1ACIA 1D0YA 2PLYA 1TC3C 4RAGA 4XRFA 4B3XA 1I50J 4DQ2A 4ZYDA 1FP1D 3VYTB 3G1OA 4A3CJ 3HB9A 1MMSA 2ZJQF 2M2EA 3HTUA 2UXHA 3NARA 4GCTA 1QA6A 2GA2A 1UG2A 2OV7A 4UUVA 4OMYA 2WGBA 1LE8A 1X3ZB 4EQQA 3F8CA 3GTJJ 5LGUA 2E1CA 3R6SA 3HUGB 5EG0A 2DI3A 1S9HA 4UUTA 5M3FJ 2OA4A 4O5VA 3U1KA 1J0RA 1ON1A 2CV1A 1I5ZA 5J4VA 2E71A 1D5VA 5LFAA 3A02A 1JI8A 2K86A 3HOSA 3EUHC 2BY2A 3PIPF 4WK8F 3OL4A 3V7CA 4ASNA 4HOBA 1G3SA 3CCRI 2XAQA 2ZCMA 3FM3A 1MMNA 4BDZA 1Y1WJ 4U7BA 2MBFA 3J7AO 3TO6A 3RZOJ 2QKOA 5E3MA 2IGKA 2XB5A 1V5EA 4C30A 5EDNA 2YSRA 5HAWA 4CCLA 2XAGA 3DTEA 1HW5A 3LFKA 4KN7X 2HYGD 4DJAA 3TOBA 1G3TA 1J59A 1MNMC 1P2FA 5FKMA 4BNCA 3LFUA 1K83J 2FSWA 2DXIA 1J75A 1XGNA 4XKBA 2OERA 4BYYA 5HLGA 3MKWB 4L0ZB 2DT6A 1YRNB 2PMHA 1Q1VA 4D9JA 2A6HF 2COBA 5GTIC 4PFPA 2PEXA 4ESFA 1HKSA 2WAEA 1LJ9A 4QIWN 1W5TA 1E3OC 2HWVA 4YIRX 3DWLE 1NTCA 1K7AA 4D5CA 3TP0A 5CVRA 3COLA 3QWLA 4C3IJ 2ZXHA 4FASD 2HPMA 2J5PA 3K4MA 3FKIJ 1EH6A 4BU2A 3DBLB 4DBQA 1XPXA 2VBYA 1ZG5A 3CUQC 2EA2A 2PFBA 1FBUA 2O5RA 2F4IA 2XF7A 3LA3A 2QWWA 2ESHA 5CQEA 3CCMI 3PNVA 2FBKA 5EF6A 5LRSA 1WJ5A 2WAFA 1RUOA 1LKXA 5C44J 1QGPA 3C3WA 3I56I 2VT3A 4UUSB 3HZJA 3BTIA 1LUJB 2JA6J 1FX7A 5L3FA 2X1DA 1Z3XA 4A6DA 3JR9A 2GFNA 2CW7A 4ZTFA 3A01A 1BI0A 1KYWA 2O3FA 1KU7A 5CXGA 5LRRA 3M8JA 3HL2A 2DMNA 5K7ZA 4KDPA 1X1AA 5CVVA 3TBIA 3LL7A 3J7ZI 2EZLA 4RS8A 2VQCA 2JK3A 4I0AA 4XLEA 1SVLA 4KN4X 4P96A 1TBXA 3CCLI 2AXTC 2BVMA 2O7TA 4KISA 3GZ5A 4YFXF 3IRRA 4LGWA 4XKVA 1VQOI 1YG2A 3PNTA 3TKYA 4AC0A 4LMYA 1IN8A 1AKHA 2V26A 4CCNA 2HXOA 1VQKI 3CUOA 3OYIA 5TGTA 2FOWA 2O61A 5CPRB 3CJTB 4FHTA 4AU7A 4ACIA 1AA7A 1XS9A 1YX5A 2DA2A 1HKQA 1N25A 3BOQA 1V55H 2J5OA 4EJTA 3NRVA 1MZBA 4ME9A 3CJNA 4IVNA 2VOPA 3CLOA 1TWFJ 3CJRB 1IRXA 4ZZDA 5HDNA 1IC8A 2LLKA 2JSPA 5D8KB 5D6FA 2B0LA 4ETSA 3LQQA 1QZEA 2EQRA 3OMYA 3S2DJ 5FB2A 1TLHB 2ZXWH 3JSOA 3TO7A 4P1WA 1A31A 2M7BA 4IRGA 2CS3A 1PP7U 2EIJH 4MO7A 2V6CA 1DUXC 1UI5A 5ICGA 2VB6A 4D1QA 3HM5A 2ID6A 2KIFA 1P9QC 4BQAA 4PGHA 3B02A 2XAUA 4R79A 1E0EA 3NNRA 3BCBA 2L7ZA 5B5EC 4M6VA 1FBQA 2E60A 4ZYAA 3S1QJ 1OCPA 2PJRB 2ZCXA 2P6SA 1RR8C 2DFFA 1MBFA 2ELKA 2H94A 2HZTA 5FLXK 2Y2ZA 2IA0A 2PBXA 1X58A 1TNTA 3BWGA 4XN3A 3BHQA 3C07A 1ETQA 1E2XA 1MMAA 1O57A 2PJPA 2QTQA 4PGGA 1S7EA 1FIAA 2X85A 2HYTA 3B81A 2KMUA 4BJ5C 4ZTJA 2GBYA 4WXDA 3QU3A 4OAZA 3BR6A 3ABTA 1I1GA 1ZTRA 3WTZA 3NAUA 5KCMA 4KIBA 1SAXA 1AWCA 4DOZA 1ETOA 4ZDPA 2R5ZA 2XPUA 4AC6A 3BTLA 2RVCA 1MJBA 1VFCA 5EZHA 1YI2I 4KFCA 3H35A 3ABUA 2FRHA 4L9TA 3EGQA 2HZDA 4HPQA 3ERMA 5BPIA 3ZQGA 3J80Z 5J6XA 1QPMA 2HOAA 3VW2A 1T95A 2LDUA 1VQNI 2A69F 2IPQX 2VJIA 1YYVA 3GTQJ 2N8GA 3UR3C 3NI7A 2EPFA 2L02A 2R3SA 4ABZA 2G7LA 4I2OA 3AQSA 3ZRGA 1FTZA 4EEFG 2XF5A 3F0CA 2GOMA 3BC8A 2ISYA 1ZHFA 3AG1H 3T0YA 2CQKA 2XPWA 3J7YJ 2CH0A 1SVOA 2L2OA 3IWFA 3JRIA 2VQGA 1EH7A 2LTPA 1WCMJ 3W2VA 5IYDJ 3J81Z 1B8IB 4CYCA 3BRUA 2NVYJ 3KZZA 2JMWA 2P8TA 3SXYA 4OIOF 3JRHA 1CF7B 5HBUA 1FT9A 1REPC 5HLHA 4CGZA 2CJJA 2XSDC 1KQ0A 3ELKA 2PG4A 1XG1A 2MFZA 4Z6YA 3PIOF 3IRQA 1S6LA 2ICWG 4E7SA 2DDAA 1R71A 2MG4A 3PQJA 4WF2A 3WHCA 4IO9F 4ZH4F 3K4JA 2EIKH 2HI3A 4G8XA 3CZ6A 3C1DA 1FWZA 3D5RC 4Z2YA 3HOXJ 3WE2A 1VQMI 3A0BC 1YITI 2Y69H 3QBMA 1YFHA 5DUKA 2NVTJ 5B1AH 4HF1A 3K8PC 2H1LA 1DGWY 4L5IA 1G4DA 1A36A 2ZXJA 2IS6A 4NC7A 2H8WA 3K10A 1QO0D 3HOZJ 4BE0A 1IUYA 3WTVC 3MNLA 1IXCA 3M1CA 3CC2I 4KNYA 1MJ9A 2STWA 4UB8C 5FKKA 1LFUP 5IT9K 4U0VA 5HS7A 1QU3A 2B9SA 1GVJA 1ZRDA 1R1TA 2DPDA 2M1BA 1UHSA 2PX9A 4LLGF 3C2GA 3WU2C 2P7CB 4EJVA 3HUGA 3GZNB 2GENA 3GUDA 1JTXA 1T98A 4MQVA 3HOUJ 1WI3A 2V57A 3ANGA 3GLXA 3OR1C 3RCOA 1X1PA 5FKNA 3KX2A 3LSHA 1TW2A 2FMLA 1MGTA 2F5EA 2MH9A 4D0PA 3G71I 2B1EA 3GFJA 3QOPA 5EEHA 3GTLJ 1A6QA 2KDZA 4HSRA 5HNFA 2REKA 1QVUA 4Q48A 2I5UA
chains in the Genus database with same CATH topology
5D18A 4BBRJ 1JUMA 3HEFA 5C4YA 3K7AJ 3ON2A 1BL0A 5EGOB 2EBIA 1WPKA 3F1BA 2O7OA 1W0TA 2MW8A 4DYCA 3BG9A 4NN1A 4JX6A 4HNVA 1HCRA 3TP3A 2PMZN 3BQYA 2UXIA 5FHPA 1WGXA 1UMQA 3BR5A 3LSRA 1RETA 1OJLA 1GDTA 1X2MA 4ICHA 4BY1J 4FE4A 2UXOA 1X2NA 4IEJA 5FMPA 2P81A 3ZQIA 1FEXA 3VW0A 2IAIA 3BR1A 3S17J 3TW7A 1D5YA 2NP5A 4W1UA 3HGGA 1FJLA 2CUEA 3RH2A 4IHVA 4MLOA 2AO9A 2XGCA 3BCGA 3NRGA 4DYQA 3JRBA 4BBSJ 3GTOJ 4GFBA 1TWHJ 3RZDJ 1MH3A 1RR7A 2K9NA 3S1NJ 1I3QJ 5DTDA 1PUFA 1YRNA 3QQAA 5E3NA 1JUPA 2LFBA 1U8BA 3E7LA 5FGLA 2K9QA 2KT0A 2ID3A 5GPCA 2R5ZB 1ZQ3P 2JWTA 5F0CA 1U9OA 2L7FP 1JJ6C 5F08A 4CGRA 5IYBJ 2NP3A 2IBDA 2JJ7A 4JX5A 3S16J 1JKOC 3Q0WA 2CU7A 5IP9J 3JREA 1H89C 2D6YA 3FISA 5M5YJ 1DU0A 5CW8A 4A3MJ 3QPSA 4NDLA 1SGMA 5IOZA 2G7SA 3M4OJ 3DCFA 1P7JA 1H8AC 1TWGJ 3HBLA 4A3IJ 2H8RA 3NXCA 3SJMA 2D5VA 2E2HJ 1ORKA 2MSYA 3O8HA 1QVTA 1LFBA 3VPRA 3ZQHA 5IOYA 2LP0A 2CRGA 1GT0C 5FKLA 2ECBA 2NVXJ 2Y9ZA 3HOWJ 3OOUA 3I4NJ 1BW6A 3S5RA 3T6NA 4M3DA 4UDSA 2DA1A 5JLWA 3FK6A 3ANPA 1JT0A 3IH2A 2NX4A 4JNNA 4C3HJ 3PO2J 3HIMA 4HKUA 2TCTA 2Y30A 3LSGA 3D1NI 4A3EJ 4XIDA 5J1RA 1TC3C 4DYRA 3WHBA 1I50J 2EZIA 5BNGA 1LE8B 3AQTA 3G1OA 2QF7A 1U78A 2CQQA 1FTTA 1QRYA 5C4JJ 3VW1A 4A3CJ 3ZQLA 3HB9A 2DN0A 2M2EA 1IV6A 2Y31A 2UXHA 3NARA 1GUUA 3HOYJ 2L7MP 4GCTA 3S1RJ 1TWCJ 1UG2A 2WGBA 1LE8A 5F1JA 2DTZA 2WAQN 1HDDC 3L1PA 4JYKA 3GTJJ 2L9RA 4L5EA 1VF9A 5EG0A 4AF5A 4UUTA 5M3FJ 4A3KJ 4M3FA 1CQTA 1AHDP 3HE0A 2DA5A 4D7MA 3IH4A 2Q24A 1MBHA 1IJWC 2H1KA 3A02A 2X9DA 4FE7A 4BKXA 2B63J 1ZR2A 2LVSA 3H0GJ 4A3LJ 4A93J 1MH4A 5M5WJ 1HLVA 3FIWA 1ZGWA 4D7NA 5EZGA 3GTKJ 3ON4A 5EEAA 3TW6A 3W6VA 1A6IA 2ZCMA 4YZEA 3BTJA 1Y1WJ 2XGDA 2R7ZJ 3RZOJ 2QKOA 5E3MA 5F0FA 2LKXA 2XB5A 2RHAA 1T33A 5EDNA 3CCYA 3TEDA 4A3GJ 4B1RA 5HAWA 4C2MJ 5FJ8J 3HTIA 1MNMC 5FKMA 1ITYA 4AYBN 3HDDA 1SANA 3KKCA 1K83J 4MXMA 3DPJA 3VVZA 4FCYA 4J19A 1ZKGA 3PM1A 4FTHA 1Y1VJ 1OFCX 2OERA 4KWAA 1Z77A 1IGNA 1PUFB 1YRNB 4MIMA 3QKXA 3P9TA 3HGYA 1EF4A 1Q1VA 3LNQA 3CJDA 2COBA 2XRLA 5K58A 2EZHA 2I10A 4QIWN 1VI0A 1E3OC 3M3YJ 4CYCB 3O8GA 1NTCA 5GP9A 4D5CA 3TP0A 4L62A 4AUXA 2XDNA 1JUSA 2M9HA 9ANTA 2OPTA 3COLA 4QSHA 2G0EA 4C3IJ 5IP6A 1ETYA 1GVDA 2M8GX 3Q0UA 3FKIJ 3HOVJ 3RKQA 1F36A 3BR0A 3E7QA 2Y0SN 2YS9A 2LR8A 5J1YA 3ZOBA 2YU9J 3BG3A 4M3EA 1NK3P 1BW5A 1RKWA 4B3AA 1WH5A 3G1LA 3Q0VA 2ME0A 3OSFA 4IHYA 2K9SA 5EF6A 2QWTA 4UUSA 2O8KA 1Z0XA 5C44J 3NPIA 4V2FA 4UUSB 2E2JJ 2DMPA 3BNIA 5M3MJ 5FLMJ 3BTIA 2JA6J 4DZJA 5J1UA 3JR9A 3S2HJ 2GFNA 4S0HB 4FISA 5CXIA 3DEWA 2R0QC 2R93J 2DA6A 3BTCA 1ZK8A 4M3BA 3A01A 4XRSG 5CXGA 3V6GA 2VKEA 2G7GA 3LSJA 1QPIA 4GFKA 4BY7J 1NK2P 2E2IJ 2DMNA 5K7ZA 3CMYA 4DW6A 2R92J 1B72A 4GFLA 4JL3A 4XRMA 5IPAA 3GEUA 2XB0X 2EZLA 2JK3A 3JRCA 2ZOYA 4MFDA 1WH7A 3FK7A 1HDPA 2DMQA 1O4XA 1MSFC 4A69C 5HSZA 5EGOA 2O7TA 4NELA 5D1RA 2YVHA 2X6OA 5J3LA 1AKHB 3JRDA 1JJ8C 5EFYA 2AHQA 4AC0A 2E1OA 1AKHA 4W97A 3C2BA 2L0KA 3GTMJ 2HXOA 3HTJA 3GZIA 1I6HJ 3HTHA 2IU5A 2XGEA 4ACIA 5E3LA 1XS9A 4D5FA 5AQCA 1UI6A 3MKLA 3BJBA 2DA2A 2O9LA 2R5YB 1BA5A 2CUFA 2WV1A 4ME9A 2ME6A 1TWFJ 3SFIA 2QCOA 5F0HA 2EZKA 3G56A 3V78A 1IC8A 2LLKA 1ZR4A 3PO3J 3LWJA 4BXXJ 1IDYA 4I76A 3JRGA 4JKZA 2JA5J 2EQRA 2WUIA 3S2DJ 3A03A 2ECCA 4V2GA 2WB1N 3RQIA 3FRQA 2M34A 3JSJA 4MK6A 3VOKA 4GCLA 4MO7A 1VNDA 1UI5A 2HOSA 1BJZA 3LSPA 4G12A 2MGQA 3HM5A 2ID6A 3MN2A 3LJLA 1POGA 1U9NA 1IRZA 1GV5A 3B6AA 2TRTA 2UXPA 2W48A 1FIPA 3CQZJ 3IH3A 4PXIA 5FLVA 2NOGA 3VVYA 5JLXA 3NNRA 1ETXA 5EYRA 3VP5A 2L7ZA 3A01B 3KNWA 4M6VA 4A3FJ 4Y52J 3S1QJ 1OCPA 2Y9YA 2ZCXA 1APLC 3JRAA 2W53A 3LHQA 3VVXA 3RD3A 1JGGA 1MBFA 2ELKA 4X1EA 2QIBA 2QOPA 2Y2ZA 2PBXA 3IV5A 1X58A 4C3JJ 4JX4A 5F27A 3C07A 3BHQA 1ETQA 1MBJA 3ZQCA 5D19A 2DA7A 2K40A 2QTQA 2OI8A 4M3GA 3KZ9A 1JKQC 1S7EA 1FIAA 2HYTA 3B81A 4GCKA 1IUFA 4RDUA 1RKTA 2HXIA 2GBYA 2VPRA 3BR6A 1ZTRA 3S15J 5IYCJ 3NAUA 1HF0A 2DMUA 3OSGA 2OF7A 4RBOA 1ETOA 2R5ZA 1G2HA 2XPUA 2YVEA 2FQ4A 3BTLA 1MBKA 3UKGA 4AC6A 1K61A 2RAEA 2NS8A 1VFCA 1P7IA 5EZHA 2FJ1A 3EGQA 2ZB9A 3ZQGA 3G1MA 3VW2A 2HOAA 1DU6A 2NS7A 2JA7J 3VOXA 2GUHA 2PZ9A 2GM4A 4XK4A 4JP0A 1TWAJ 2G3BA 3GTQJ 3NI7A 2N8GA 4ABZA 3O60A 3BR3A 2G7LA 1MBEA 3AQSA 4Y7NJ 5E3OA 1FTZA 1JT6A 2FX0A 3G7RA 2EH3A 2FBQA 4EEFG 3F0CA 2HKUA 1B8IA 2HYJA 5K7HA 3CRJA 2XPWA 2XPVA 1XC5A 2M0CA 3VIBA 3JRIA 5GPAA 4DZPA 1HOMA 4LOCA 1JTYA 2LTPA 1RESA 1WCMJ 3MVPA 5HODA 1B8IB 5IYDJ 4CYCA 2DG8A 2NVYJ 3BRUA 2JMWA 3S14J 3HTAA 2F07A 2DMTA 3JRHA 3BT9A 2HOTA 2GLOA 4I6ZA 5EG0B 4X6AJ 5HBUA 4A3JJ 5C3EJ 2X48A 2CJJA 2XSDC 5M5XJ 1SFOJ 1XG1A 3BQZA 2YUSA 3IUVA 2HQ5A 3EUPA 4IHXA 1W0UA 1MSEC 1IDZA 3GBGA 2CQXA 2MG4A 3Q3SA 3PPBA 3GTPJ 3WHCA 2HI3A 2JN6A 1T56A 1RPWA 1F43A 4B4CA 2JA8J 3HOXJ 3S1MJ 3VUQA 1ENHA 4QTRA 3QBMA 2UXUA 2DA3A 1A5JA 5DS9A 2NVTJ 5C4XJ 4XICA 2DJNA 2FD5A 1R9TJ 3H3VK 3HKZN 3JRFA 3SDGA 3OIOA 5F04A 3HOZJ 3MNLA 3QPLA 5IP7J 3BG5A 2E19A 1IG7A 1GV2A 2VUMJ 5FKKA 1LFUP 1ETKA 3CWRA 2LK2A 3PASA 2IEKA 2LY9A 4IHWA 4A3DJ 2VI6A 3BR2A 1UHSA 1ETWA 2GENA 2LD5A 4A3BJ 1JTXA 3HOUJ 1WI3A 1H88C 2HDDA 2V57A 3ANGA 5FKOA 2R5YA 3I4MJ 1JKPC 3KKDA 4XRSA 3CDLA 5K7FA 2NVQJ 1MBGA 1JKRC 5FKNA 2ZCNA 3ZQFA 3LOCA 1B72B 5H9TA 1OCTC 5DAJA 4MFEA 2VKVA 1AU7A 3GTGJ 3GTLJ 2DG7A 2KDZA 2RASA 2REKA 1QVUA 3K2AA 2DA4A 3B6CA 2ZOZA 1ETVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D18 A;  4BBR J;  1JUM A;  3HEF A;  5C4Y A;  3K7A J;  3ON2 A;  1BL0 A;  5EGO B;  2EBI A;  1WPK A;  3F1B A;  2O7O A;  1W0T A;  2MW8 A;  4DYC A;  3BG9 A;  4NN1 A;  4JX6 A;  4HNV A;  1HCR A;  3TP3 A;  2PMZ N;  3BQY A;  2UXI A;  5FHP A;  1WGX A;  1UMQ A;  3BR5 A;  3LSR A;  1RET A;  1OJL A;  1GDT A;  1X2M A;  4ICH A;  4BY1 J;  4FE4 A;  2UXO A;  1X2N A;  4IEJ A;  5FMP A;  2P81 A;  3ZQI A;  1FEX A;  3VW0 A;  2IAI A;  3BR1 A;  3S17 J;  3TW7 A;  1D5Y A;  2NP5 A;  4W1U A;  3HGG A;  1FJL A;  2CUE A;  3RH2 A;  4IHV A;  4MLO A;  2AO9 A;  2XGC A;  3BCG A;  3NRG A;  4DYQ A;  3JRB A;  4BBS J;  3GTO J;  4GFB A;  1TWH J;  3RZD J;  1MH3 A;  1RR7 A;  2K9N A;  3S1N J;  1I3Q J;  5DTD A;  1PUF A;  1YRN A;  3QQA A;  5E3N A;  1JUP A;  2LFB A;  1U8B A;  3E7L A;  5FGL A;  2K9Q A;  2KT0 A;  2ID3 A;  5GPC A;  2R5Z B;  1ZQ3 P;  2JWT A;  5F0C A;  1U9O A;  2L7F P;  1JJ6 C;  5F08 A;  4CGR A;  5IYB J;  2NP3 A;  2IBD A;  2JJ7 A;  4JX5 A;  3S16 J;  1JKO C;  3Q0W A;  2CU7 A;  5IP9 J;  3JRE A;  1H89 C;  2D6Y A;  3FIS A;  5M5Y J;  1DU0 A;  5CW8 A;  4A3M J;  3QPS A;  4NDL A;  1SGM A;  5IOZ A;  2G7S A;  3M4O J;  3DCF A;  1P7J A;  1H8A C;  1TWG J;  3HBL A;  4A3I J;  2H8R A;  3NXC A;  3SJM A;  2D5V A;  2E2H J;  1ORK A;  2MSY A;  3O8H A;  1QVT A;  1LFB A;  3VPR A;  3ZQH A;  5IOY A;  2LP0 A;  2CRG A;  1GT0 C;  5FKL A;  2ECB A;  2NVX J;  2Y9Z A;  3HOW J;  3OOU A;  3I4N J;  1BW6 A;  3S5R A;  3T6N A;  4M3D A;  4UDS A;  2DA1 A;  5JLW A;  3FK6 A;  3ANP A;  1JT0 A;  3IH2 A;  2NX4 A;  4JNN A;  4C3H J;  3PO2 J;  3HIM A;  4HKU A;  2TCT A;  2Y30 A;  3LSG A;  3D1N I;  4A3E J;  4XID A;  5J1R A;  1TC3 C;  4DYR A;  3WHB A;  1I50 J;  2EZI A;  5BNG A;  1LE8 B;  3AQT A;  3G1O A;  2QF7 A;  1U78 A;  2CQQ A;  1FTT A;  1QRY A;  5C4J J;  3VW1 A;  4A3C J;  3ZQL A;  3HB9 A;  2DN0 A;  2M2E A;  1IV6 A;  2Y31 A;  2UXH A;  3NAR A;  1GUU A;  3HOY J;  2L7M P;  4GCT A;  3S1R J;  1TWC J;  1UG2 A;  2WGB A;  1LE8 A;  5F1J A;  2DTZ A;  2WAQ N;  1HDD C;  3L1P A;  4JYK A;  3GTJ J;  2L9R A;  4L5E A;  1VF9 A;  5EG0 A;  4AF5 A;  4UUT A;  5M3F J;  4A3K J;  4M3F A;  1CQT A;  1AHD P;  3HE0 A;  2DA5 A;  4D7M A;  3IH4 A;  2Q24 A;  1MBH A;  1IJW C;  2H1K A;  3A02 A;  2X9D A;  4FE7 A;  4BKX A;  2B63 J;  1ZR2 A;  2LVS A;  3H0G J;  4A3L J;  4A93 J;  1MH4 A;  5M5W J;  1HLV A;  3FIW A;  1ZGW A;  4D7N A;  5EZG A;  3GTK J;  3ON4 A;  5EEA A;  3TW6 A;  3W6V A;  1A6I A;  2ZCM A;  4YZE A;  3BTJ A;  1Y1W J;  2XGD A;  2R7Z J;  3RZO J;  2QKO A;  5E3M A;  5F0F A;  2LKX A;  2XB5 A;  2RHA A;  1T33 A;  5EDN A;  3CCY A;  3TED A;  4A3G J;  4B1R A;  5HAW A;  4C2M J;  5FJ8 J;  3HTI A;  1MNM C;  5FKM A;  1ITY A;  4AYB N;  3HDD A;  1SAN A;  3KKC A;  1K83 J;  4MXM A;  3DPJ A;  3VVZ A;  4FCY A;  4J19 A;  1ZKG A;  3PM1 A;  4FTH A;  1Y1V J;  1OFC X;  2OER A;  4KWA A;  1Z77 A;  1IGN A;  1PUF B;  1YRN B;  4MIM A;  3QKX A;  3P9T A;  3HGY A;  1EF4 A;  1Q1V A;  3LNQ A;  3CJD A;  2COB A;  2XRL A;  5K58 A;  2EZH A;  2I10 A;  4QIW N;  1VI0 A;  1E3O C;  3M3Y J;  4CYC B;  3O8G A;  1NTC A;  5GP9 A;  4D5C A;  3TP0 A;  4L62 A;  4AUX A;  2XDN A;  1JUS A;  2M9H A;  9ANT A;  2OPT A;  3COL A;  4QSH A;  2G0E A;  4C3I J;  5IP6 A;  1ETY A;  1GVD A;  2M8G X;  3Q0U A;  3FKI J;  3HOV J;  3RKQ A;  1F36 A;  3BR0 A;  3E7Q A;  2Y0S N;  2YS9 A;  2LR8 A;  5J1Y A;  3ZOB A;  2YU9 J;  3BG3 A;  4M3E A;  1NK3 P;  1BW5 A;  1RKW A;  4B3A A;  1WH5 A;  3G1L A;  3Q0V A;  2ME0 A;  3OSF A;  4IHY A;  2K9S A;  5EF6 A;  2QWT A;  4UUS A;  2O8K A;  1Z0X A;  5C44 J;  3NPI A;  4V2F A;  4UUS B;  2E2J J;  2DMP A;  3BNI A;  5M3M J;  5FLM J;  3BTI A;  2JA6 J;  4DZJ A;  5J1U A;  3JR9 A;  3S2H J;  2GFN A;  4S0H B;  4FIS A;  5CXI A;  3DEW A;  2R0Q C;  2R93 J;  2DA6 A;  3BTC A;  1ZK8 A;  4M3B A;  3A01 A;  4XRS G;  5CXG A;  3V6G A;  2VKE A;  2G7G A;  3LSJ A;  1QPI A;  4GFK A;  4BY7 J;  1NK2 P;  2E2I J;  2DMN A;  5K7Z A;  3CMY A;  4DW6 A;  2R92 J;  1B72 A;  4GFL A;  4JL3 A;  4XRM A;  5IPA A;  3GEU A;  2XB0 X;  2EZL A;  2JK3 A;  3JRC A;  2ZOY A;  4MFD A;  1WH7 A;  3FK7 A;  1HDP A;  2DMQ A;  1O4X A;  1MSF C;  4A69 C;  5HSZ A;  5EGO A;  2O7T A;  4NEL A;  5D1R A;  2YVH A;  2X6O A;  5J3L A;  1AKH B;  3JRD A;  1JJ8 C;  5EFY A;  2AHQ A;  4AC0 A;  2E1O A;  1AKH A;  4W97 A;  3C2B A;  2L0K A;  3GTM J;  2HXO A;  3HTJ A;  3GZI A;  1I6H J;  3HTH A;  2IU5 A;  2XGE A;  4ACI A;  5E3L A;  1XS9 A;  4D5F A;  5AQC A;  1UI6 A;  3MKL A;  3BJB A;  2DA2 A;  2O9L A;  2R5Y B;  1BA5 A;  2CUF A;  2WV1 A;  4ME9 A;  2ME6 A;  1TWF J;  3SFI A;  2QCO A;  5F0H A;  2EZK A;  3G56 A;  3V78 A;  1IC8 A;  2LLK A;  1ZR4 A;  3PO3 J;  3LWJ A;  4BXX J;  1IDY A;  4I76 A;  3JRG A;  4JKZ A;  2JA5 J;  2EQR A;  2WUI A;  3S2D J;  3A03 A;  2ECC A;  4V2G A;  2WB1 N;  3RQI A;  3FRQ A;  2M34 A;  3JSJ A;  4MK6 A;  3VOK A;  4GCL A;  4MO7 A;  1VND A;  1UI5 A;  2HOS A;  1BJZ A;  3LSP A;  4G12 A;  2MGQ A;  3HM5 A;  2ID6 A;  3MN2 A;  3LJL A;  1POG A;  1U9N A;  1IRZ A;  1GV5 A;  3B6A A;  2TRT A;  2UXP A;  2W48 A;  1FIP A;  3CQZ J;  3IH3 A;  4PXI A;  5FLV A;  2NOG A;  3VVY A;  5JLX A;  3NNR A;  1ETX A;  5EYR A;  3VP5 A;  2L7Z A;  3A01 B;  3KNW A;  4M6V A;  4A3F J;  4Y52 J;  3S1Q J;  1OCP A;  2Y9Y A;  2ZCX A;  1APL C;  3JRA A;  2W53 A;  3LHQ A;  3VVX A;  3RD3 A;  1JGG A;  1MBF A;  2ELK A;  4X1E A;  2QIB A;  2QOP A;  2Y2Z A;  2PBX A;  3IV5 A;  1X58 A;  4C3J J;  4JX4 A;  5F27 A;  3C07 A;  3BHQ A;  1ETQ A;  1MBJ A;  3ZQC A;  5D19 A;  2DA7 A;  2K40 A;  2QTQ A;  2OI8 A;  4M3G A;  3KZ9 A;  1JKQ C;  1S7E A;  1FIA A;  2HYT A;  3B81 A;  4GCK A;  1IUF A;  4RDU A;  1RKT A;  2HXI A;  2GBY A;  2VPR A;  3BR6 A;  1ZTR A;  3S15 J;  5IYC J;  3NAU A;  1HF0 A;  2DMU A;  3OSG A;  2OF7 A;  4RBO A;  1ETO A;  2R5Z A;  1G2H A;  2XPU A;  2YVE A;  2FQ4 A;  3BTL A;  1MBK A;  3UKG A;  4AC6 A;  1K61 A;  2RAE A;  2NS8 A;  1VFC A;  1P7I A;  5EZH A;  2FJ1 A;  3EGQ A;  2ZB9 A;  3ZQG A;  3G1M A;  3VW2 A;  2HOA A;  1DU6 A;  2NS7 A;  2JA7 J;  3VOX A;  2GUH A;  2PZ9 A;  2GM4 A;  4XK4 A;  4JP0 A;  1TWA J;  2G3B A;  3GTQ J;  3NI7 A;  2N8G A;  4ABZ A;  3O60 A;  3BR3 A;  2G7L A;  1MBE A;  3AQS A;  4Y7N J;  5E3O A;  1FTZ A;  1JT6 A;  2FX0 A;  3G7R A;  2EH3 A;  2FBQ A;  4EEF G;  3F0C A;  2HKU A;  1B8I A;  2HYJ A;  5K7H A;  3CRJ A;  2XPW A;  2XPV A;  1XC5 A;  2M0C A;  3VIB A;  3JRI A;  5GPA A;  4DZP A;  1HOM A;  4LOC A;  1JTY A;  2LTP A;  1RES A;  1WCM J;  3MVP A;  5HOD A;  1B8I B;  5IYD J;  4CYC A;  2DG8 A;  2NVY J;  3BRU A;  2JMW A;  3S14 J;  3HTA A;  2F07 A;  2DMT A;  3JRH A;  3BT9 A;  2HOT A;  2GLO A;  4I6Z A;  5EG0 B;  4X6A J;  5HBU A;  4A3J J;  5C3E J;  2X48 A;  2CJJ A;  2XSD C;  5M5X J;  1SFO J;  1XG1 A;  3BQZ A;  2YUS A;  3IUV A;  2HQ5 A;  3EUP A;  4IHX A;  1W0U A;  1MSE C;  1IDZ A;  3GBG A;  2CQX A;  2MG4 A;  3Q3S A;  3PPB A;  3GTP J;  3WHC A;  2HI3 A;  2JN6 A;  1T56 A;  1RPW A;  1F43 A;  4B4C A;  2JA8 J;  3HOX J;  3S1M J;  3VUQ A;  1ENH A;  4QTR A;  3QBM A;  2UXU A;  2DA3 A;  1A5J A;  5DS9 A;  2NVT J;  5C4X J;  4XIC A;  2DJN A;  2FD5 A;  1R9T J;  3H3V K;  3HKZ N;  3JRF A;  3SDG A;  3OIO A;  5F04 A;  3HOZ J;  3MNL A;  3QPL A;  5IP7 J;  3BG5 A;  2E19 A;  1IG7 A;  1GV2 A;  2VUM J;  5FKK A;  1LFU P;  1ETK A;  3CWR A;  2LK2 A;  3PAS A;  2IEK A;  2LY9 A;  4IHW A;  4A3D J;  2VI6 A;  3BR2 A;  1UHS A;  1ETW A;  2GEN A;  2LD5 A;  4A3B J;  1JTX A;  3HOU J;  1WI3 A;  1H88 C;  2HDD A;  2V57 A;  3ANG A;  5FKO A;  2R5Y A;  3I4M J;  1JKP C;  3KKD A;  4XRS A;  3CDL A;  5K7F A;  2NVQ J;  1MBG A;  1JKR C;  5FKN A;  2ZCN A;  3ZQF A;  3LOC A;  1B72 B;  5H9T A;  1OCT C;  5DAJ A;  4MFE A;  2VKV A;  1AU7 A;  3GTG J;  3GTL J;  2DG7 A;  2KDZ A;  2RAS A;  2REK A;  1QVU A;  3K2A A;  2DA4 A;  3B6C A;  2ZOZ A;  1ETV A; 
#chains in the Genus database with same CATH topology
 4L5J A;  1FMW A;  1D1A A;  3HEF A;  4BBR J;  3K7A J;  1QQI A;  2KRF A;  4HYE A;  1J7K A;  3ESW B;  1MIJ A;  2L4A A;  2ELJ A;  2W57 A;  3RKX A;  4R8H A;  1I3A A;  5K5Q A;  2JSC A;  4A5N A;  2DQR A;  3RYP A;  2R7O A;  3OYF A;  2WAQ A;  4Y17 A;  4N9H A;  4HRI A;  1T6S A;  2QKM B;  2M45 A;  2V1U A;  3FDY A;  2KIS A;  1ZLJ A;  1R4M B;  1ZN2 A;  1FC3 A;  2R7X A;  3R0J A;  4RB0 A;  3ZQI A;  2BW3 B;  1FEX A;  3K6G A;  2IAI A;  1WRJ A;  4P5O A;  3TW7 A;  2NP5 A;  1FJL A;  2M5W A;  3M7G A;  3RH2 A;  1OKR A;  4NBQ A;  2XGC A;  4A0X A;  5J4Y A;  4IOC F;  1CGP A;  4BBS J;  3L9F A;  3GTO J;  2XSJ C;  1FSH A;  3DTK A;  1OR7 C;  3TDZ C;  1RR7 A;  4EVI A;  1I3Q J;  3I0T A;  2XRO A;  3QQA A;  2JUC A;  3DU6 A;  2OCE A;  1B1B A;  2BHY A;  2BEO A;  3E7L A;  2PJR A;  1J2X A;  2FOK A;  3F9K A;  2HS5 A;  1I39 A;  2OU2 A;  5AIP A;  1U9O A;  1Y56 A;  1JE8 A;  1OCC H;  4CGR A;  2VQH A;  4M6X A;  4LB5 A;  2NP3 A;  2W82 A;  3JCU C;  3S16 J;  1BI2 A;  3Q0W A;  2CU7 A;  3MKY B;  1H89 C;  1OPC A;  3FIS A;  3EYI A;  5ICE A;  2X6Y A;  4A3M J;  3QPS A;  4BS9 A;  2DBB A;  2QQ9 A;  2G7S A;  1D1C A;  2BGC A;  4A3I J;  2H8R A;  4BEH B;  5HS9 A;  1MNE A;  2LH9 A;  1DQU A;  2E2H J;  2BYV E;  1ORK A;  1X4O A;  3IL2 A;  3UNG C;  1H9T A;  2Z9O A;  3ZQH A;  2CRG A;  1W4M A;  4I01 A;  2ECB A;  3M8F A;  3HOW J;  2VJJ A;  3IC7 A;  3OOU A;  2VLA A;  3AG4 H;  3I4N J;  4UDS A;  2DA1 A;  3FK6 A;  3VFZ A;  1JT0 A;  4E7I A;  2NX4 A;  3ANP A;  3HIM A;  1XN7 A;  4ESB A;  4ZYG A;  3LSG A;  4A3E J;  2VN2 A;  2WA0 A;  2FF4 A;  2IGM A;  2DOF A;  2EZI A;  4M9S A;  4BEH A;  4CZC A;  1L3L A;  2HNH A;  2QF7 A;  1ZRE A;  2D1V A;  4Y4R A;  1SD5 A;  1DGR M;  1FOW A;  4UY8 I;  1GUU A;  3FXR A;  3HOY J;  2L7M P;  3GF2 A;  1I6X A;  2DFI A;  3I55 I;  1TWC J;  3G6E I;  4J01 A;  2FJI 1;  3WGG A;  2DTZ A;  1HDD C;  3H5N A;  2Q0O A;  3K4L A;  1VQ6 I;  3HRM A;  2BY3 A;  1W5S A;  2FQ3 A;  4E6K G;  3E5U A;  3P9C A;  4II2 A;  4M3F A;  1AHD P;  3HE0 A;  2K02 A;  4D7M A;  3K1M A;  2RN7 A;  2Q24 A;  1IJW C;  2H1K A;  4PJN A;  1YJ9 I;  1D8J A;  4FE7 A;  4BKX A;  2WWY A;  4WCG A;  2LVS A;  3FKJ A;  2VE9 A;  5KHD A;  5M5W J;  2Y48 A;  2LG4 A;  3FIW A;  1ZGW A;  4XN0 A;  2VBZ A;  2RDP A;  3F6V A;  3IAM 2;  5EEA A;  2R7T A;  3W6V A;  2EIN H;  4YZE A;  3RYR A;  3CCU I;  1BOB A;  1LEA A;  2VIX A;  1NG6 A;  4HF0 A;  1KZH A;  2R7Z J;  1B4A A;  2W4S A;  1FZP B;  2RHA A;  1IO2 A;  3HRS A;  2FXA A;  1QNT A;  5D8L B;  1YO5 C;  4XBF A;  2NOJ B;  4M9X A;  4N4N B;  4AYB N;  1ZLK A;  4RM2 A;  4FCY A;  2VC0 A;  3BG7 A;  2QUF A;  5KNL A;  1S72 I;  4B8X A;  5AIQ A;  1Y8R B;  4UHT A;  4FQG A;  4BHP A;  2HVS A;  3P7N A;  3SFZ A;  1PUF B;  1OYW A;  4MIM A;  3QKX A;  1G6N A;  1I27 A;  3S3O A;  2XF6 A;  1SFX A;  1IXR C;  3KFW X;  4F55 A;  1EF4 A;  2TDX A;  2ZKZ A;  3LNQ A;  5K58 A;  2UV1 A;  4QWQ A;  1TL8 A;  1YHQ I;  3BPV A;  1S3J A;  2M4G A;  3L00 A;  3DF8 A;  1SAU A;  2Q8K A;  1VQ9 I;  2CO5 A;  3O8G A;  2F5V A;  4AUX A;  4ZJZ A;  1DDN A;  4NUB A;  2RRE A;  2KFD A;  1K6O A;  2M9H A;  5E17 F;  2OPT A;  3GVA A;  4A5M A;  2JVH A;  2G0E A;  1QBJ A;  1ETY A;  1FPQ A;  3TMO A;  1TNS A;  1MW7 A;  2NYX A;  4M73 A;  3RKQ A;  2YS9 A;  1W7P A;  5LHI A;  5J1Y A;  1Z67 A;  1FYM A;  4M3E A;  3VTI A;  5CVJ A;  1RKW A;  4B3A A;  1WH5 A;  2MC4 A;  5F64 A;  5IT3 A;  3PUF A;  3SZP A;  2XAH A;  4LK0 F;  5HLT A;  2XVC A;  4UNO A;  1Z9C A;  2O8K A;  1L0O C;  4C2M A;  3ASO H;  4OIP F;  3L2W A;  2D45 A;  2UXX A;  2K4J A;  1OYI A;  3G4S I;  1HW2 A;  2QSF X;  4Q5S F;  2E1N A;  1VQ4 I;  4S0H B;  2AQE A;  2R0Q C;  2DA6 A;  1X3U A;  1ZK8 A;  1B59 A;  4XRS G;  4X0G A;  4BHB A;  3V6G A;  3K69 A;  3LSJ A;  4HX8 A;  4BY7 J;  2E2I J;  1E17 A;  1W7P B;  4XKC A;  3CMY A;  1YJW I;  4GFL A;  4JL3 A;  4Q4Z F;  5ILU A;  3BZC A;  4EV0 A;  5IPA A;  1FOX A;  5TRD A;  3GLL A;  1BR1 A;  3J80 K;  3BJO A;  2YX7 A;  3OIQ A;  4GGG A;  5TIS C;  4BXU A;  1LDJ A;  2ZFW A;  2QSG X;  2F48 A;  2MLG A;  3FMQ A;  2VON A;  3KCC A;  4MFD A;  1WJD A;  3FK7 A;  2DMQ A;  1ZG1 A;  3EPZ A;  4RAF A;  1MSF C;  5EGO A;  1S7O A;  1YW9 A;  2X6O A;  4GYG A;  1AKH B;  1R7J A;  4MTD A;  3R61 A;  3WTY C;  1JJ8 C;  2AHQ A;  3LAJ A;  4W97 A;  3C2B A;  2X4H A;  2QGU A;  3SHF A;  4ON0 A;  4E7K A;  3I3L A;  3GZI A;  3HTH A;  4F52 A;  2XGE A;  3ECO A;  1WI9 A;  2Q2E A;  3I5U A;  4D5F A;  1UI6 A;  5AQC A;  3PJR A;  3SWH A;  1WJA A;  1VQP I;  2RC4 A;  2R5Y B;  2KPM A;  4G9Y A;  1PYV A;  4BAC A;  1BA5 A;  2W84 A;  1Q1H A;  2CUF A;  2MC3 A;  3PSI A;  3QRF F;  4BUP A;  4QPO A;  2BY1 A;  1M1E B;  4DNC A;  2F5F A;  1F9N A;  3A0H C;  2QEX I;  3G56 A;  2DQL A;  3V78 A;  3IUO A;  1ZR4 A;  3PO3 J;  3LWJ A;  4HA8 A;  1F4K A;  4KJZ A;  3TOA A;  1IDY A;  4I76 A;  4CCJ A;  2B3W A;  1SFU A;  2OD5 A;  3P9I A;  2X51 A;  1FY7 A;  3DEU A;  2G9W A;  4LJZ F;  2WB1 N;  3FRQ A;  1UB9 A;  3KP3 A;  2M34 A;  4MK6 A;  4GCL A;  3FM5 A;  2FEZ A;  2HQR A;  2HOS A;  1BJZ A;  3LSP A;  2V6E A;  3AL0 C;  4LFU A;  3DXJ F;  2K9M A;  1IN4 A;  1U9N A;  3MFK A;  1IRZ A;  3LJL A;  3QPT A;  3ASN H;  2XAJ A;  2W48 A;  3MZY A;  1FIP A;  2Q2E B;  3CQZ J;  4U88 A;  5IY5 H;  5E1W A;  1MKM A;  2LSO A;  1ETX A;  2HTJ A;  5EYR A;  3WG7 H;  4II3 A;  3VP5 A;  1P6R A;  1WHU A;  2CW0 F;  2HPI A;  4Y52 J;  3HG9 A;  4RAY A;  1APL C;  2W53 A;  4FX0 A;  5J8F A;  2QIB A;  2QOP A;  2E5N A;  3IV5 A;  4EJW A;  4JX4 A;  5D5U B;  1Z6T A;  1MBJ A;  3CCE I;  4E7Z A;  5K5O A;  4MEX F;  4BL0 B;  4WXH A;  2PN6 A;  1OLT A;  4M3G A;  1PVE A;  4B44 A;  5LGT A;  5BOX A;  3KZ9 A;  2H6B A;  5E8G A;  4GCK A;  4XLF A;  1KYZ A;  2HXI A;  3VSL A;  2VPR A;  2RKH A;  1TQP A;  3C7J A;  2Z99 A;  2RGV A;  5D4S A;  1XDU A;  4LG0 B;  2D2W A;  2L4M A;  2OF7 A;  2XKO A;  4OIR F;  4XSZ F;  3V8J A;  5K1Y A;  3UKG A;  4ZYE A;  4U9N A;  2RAE A;  2M8E A;  2PQ8 A;  4Y3O A;  5JR3 A;  5TJJ A;  4PSW A;  2FJ1 A;  3MWM A;  1SEU A;  2ZB9 A;  2L9N A;  4IRI A;  2NS7 A;  4XM3 A;  4F91 B;  2JA7 J;  2PZ9 A;  2GM4 A;  4XK4 A;  4ENN A;  2F4M B;  4I99 C;  1IRF A;  1ONV A;  2G3B A;  2GOX B;  5DYM A;  5CVU A;  4AM3 A;  3O60 A;  5ICF A;  4B43 A;  4E7H A;  2EH3 A;  2FBQ A;  3PSF A;  4HDU A;  1P4W A;  2HYJ A;  4C2U A;  4M72 A;  3BLY A;  4XOT A;  3ZXS A;  1EJ9 A;  3CDI A;  5GPA A;  2V1N A;  4DZP A;  1HOM A;  4LOC A;  1RES A;  3E6D A;  5H6Q A;  2Z2S B;  1OCZ H;  3MVP A;  3R0A A;  4PCQ A;  2E35 A;  3JTG A;  2K7L A;  3OYN A;  3S14 J;  1FOK A;  2DMT A;  3R4K A;  2DYS H;  2ZXI A;  4X6A J;  3A2K A;  1SFK A;  3BY6 A;  4A3J J;  2AXL A;  2X48 A;  4FET A;  4AIK A;  1SFO J;  2DU9 A;  3F22 A;  1YJN I;  3IUV A;  4PZJ A;  2HQ5 A;  2UWM A;  3EUP A;  2E36 A;  3I9V 2;  5BMZ A;  4K2E A;  2IS2 A;  2E1M C;  2EIM H;  2JTV A;  1LPQ A;  3GTP J;  3DKW A;  3CMM A;  2ZY9 A;  2JN6 A;  1W5C C;  3QYB A;  4EGY A;  1T56 A;  3LSK A;  1F43 A;  5LD2 C;  3ZMV A;  2JA8 J;  2VKH A;  4BQO A;  2HEO A;  2NVU B;  3S1M J;  5JFR A;  2OC6 A;  3LSI A;  3D5L A;  5C4X J;  2QQB A;  3JAM K;  4XIC A;  2DJN A;  3A1Y A;  1R9T J;  3HKZ N;  5DD8 A;  2R7U A;  4LG0 A;  2R4G A;  1QZZ A;  1ZYR F;  1XCB A;  3OIO A;  5E79 C;  2YX4 A;  1GXQ A;  1LB2 A;  2E19 A;  2DOD A;  2V1X A;  1A35 A;  5DD4 A;  1K79 A;  1HA8 A;  3AG3 H;  3N4M A;  5D5X B;  1ETK A;  2LK2 A;  2K85 A;  3PAS A;  4HZF A;  2VI6 A;  3E6M A;  4PSX A;  3RJP A;  4Y33 A;  3HPH A;  2PBI A;  3FMR A;  4A3B J;  5HLI A;  3LA2 A;  2R5Y A;  3H9Q A;  4ZZL A;  4IXA A;  1ZRC A;  1EA3 A;  5L3G A;  4XRS A;  5K7F A;  1MBG A;  1JKR C;  3T5X A;  1YOV B;  2DFE A;  4IF4 A;  3WU1 B;  2LY1 A;  1NHA A;  2CGP A;  2ZCN A;  1B72 B;  3EYY A;  3RPU A;  3L2C A;  2RQP A;  2A05 A;  3IKV A;  4PK4 A;  4BAY A;  4NC8 A;  2VKV A;  1T2K A;  2VXD A;  3GTG J;  2DG7 A;  1TTY A;  2CFO A;  3I59 A;  2OJE D;  4A2U A;  3W2W A;  1V5F A;  3KET A;  5C4Y A;  4LB6 B;  3CCJ I;  2P7V B;  1BL0 A;  2P4W A;  5EGO B;  2EBI A;  1WPK A;  2BXY A;  2O7O A;  3TDU C;  2M30 A;  3G3Z A;  2KZG A;  2P5L C;  4F7Z A;  3R60 A;  4LIV A;  3DLA A;  4NN1 A;  1MND A;  2L5Q A;  5JVG F;  3TP3 A;  3BP8 A;  1WSU A;  3LMM A;  2PMZ N;  4AYB A;  3IP4 B;  3WTW C;  3CDH A;  1U0J A;  3H9G A;  2GWR A;  1SD4 A;  3TQN A;  4BY1 J;  3ULQ B;  2L54 A;  2VXZ A;  1X2N A;  2P5K A;  5AON A;  2DOA A;  5JI6 A;  3HPG A;  2M3A A;  3DKY A;  3AFH A;  3BR1 A;  4ENM A;  3WTU C;  1KU3 A;  4MQ9 F;  3WU0 A;  5DDG A;  1S5L C;  2K3P A;  4IHV A;  3OYA A;  4A0Y A;  2AO9 A;  3AG2 H;  2ZJ2 A;  3E5X A;  3QYE A;  2NNN A;  4DYQ A;  3H3Z A;  1W36 D;  4BE2 A;  5ERI A;  4GFB A;  5L3B A;  2XAS A;  3CP2 A;  4HV5 A;  4EGZ A;  2K9N A;  3S1N J;  5BPD A;  1YRN A;  2FA5 A;  1JUP A;  4YFK F;  1U8B A;  1BIA A;  1UJ8 A;  4HAM A;  2MAB A;  2R5Z B;  2DAO A;  1ZQ3 P;  3RPQ A;  1Y0U A;  5F0C A;  1R6R A;  2IJL A;  4A6E A;  3W6J B;  5IYB J;  1HC8 A;  4HST A;  4R1H A;  3BJ6 A;  4JX5 A;  2MA3 A;  4IQ4 A;  2D6Y A;  2F2E A;  1SMY F;  3BZ6 A;  5CW8 A;  1DU0 A;  1JHF A;  2FBI A;  2R7R A;  2H09 A;  2V1D A;  4LD5 A;  3JAM Z;  2BW3 A;  3K70 C;  2V9V A;  3QPH A;  3DCF A;  1P7J A;  1H8A C;  3HBL A;  1UHM A;  5ILS A;  1LNW A;  1UZC A;  3TO9 A;  4YFN F;  2EFQ A;  2VL8 A;  3KYC B;  2IGN A;  2LKP A;  1O3R A;  3FXL A;  4RB3 C;  5H6R A;  4BXF A;  1RIO H;  4RM3 A;  5FKL A;  4MGR A;  3S8P A;  3V8L A;  2JVG A;  1R23 A;  2VC1 A;  3L09 A;  1N78 A;  3SQN A;  3H3U A;  3EUH A;  3WTT C;  3IWZ A;  3S5R A;  3T6N A;  1XMA A;  5JLW A;  4JNN A;  3FHN A;  3QP5 A;  2ZME B;  5L3C A;  2EV6 A;  5ED4 A;  5LHG A;  4DYR A;  3WHB A;  2BXZ A;  3DV8 A;  4PDK A;  4C9Y A;  2KIQ A;  1LE8 B;  3AQT A;  1RZ4 A;  3MCZ A;  1FTT A;  1KU2 A;  3VW1 A;  2CQQ A;  3EDP A;  1QRY A;  5C4J J;  3L2Q A;  2V9K A;  5E1Z B;  3ZQL A;  1IV6 A;  2DK8 A;  3HXL A;  2XHK A;  2EWN A;  4G6T B;  3Q9V A;  3HOT A;  3S1R J;  4XNF A;  1HXD A;  5D4R A;  2GZW A;  2IP2 A;  1V5G A;  1T8I A;  5CYV A;  4QPQ A;  1BI1 A;  4JYK A;  4ESJ A;  2KRH A;  4U7D A;  4L5E A;  2XRN A;  3LST A;  2QVO A;  1KON A;  4CYD A;  4AF5 A;  3L2R A;  4A3K J;  1CQT A;  3MAJ A;  1Y39 A;  3OYJ A;  1KQ9 A;  2M87 A;  1DPU A;  1SD6 A;  3F23 A;  2B63 J;  4U9L A;  1ZR2 A;  2DW4 A;  1Z7U A;  1G59 A;  4JK1 X;  2CW8 A;  1IV8 A;  3ML6 A;  4A93 J;  2VPL A;  4NQW A;  3GTK J;  2HKX A;  3ON4 A;  3ONQ A;  3TW6 A;  1A6I A;  1XX5 A;  3LA7 A;  3BTJ A;  3H1C A;  3HIF A;  4CIC A;  2L9S A;  3K1N A;  5D5W B;  1N75 A;  3WE3 A;  2W7N A;  4A3G J;  1R4N B;  4RGX A;  3KEQ A;  5E18 F;  3SEZ A;  3OOP A;  3HTI A;  2YU3 A;  2CMP A;  4HX4 A;  4U0Y A;  3KKC A;  1T39 A;  4UB6 C;  3VVZ A;  4LIT A;  4KIG A;  1ZKG A;  4J19 A;  3VOD A;  2JPB A;  2ZSI B;  2OZ6 A;  4KWA A;  3KP6 A;  1Z77 A;  4MTE A;  1IGN A;  4IKF A;  5ILV A;  5D6E A;  5GAH J;  3OYM A;  3Q5F A;  3HGY A;  4F3Q A;  2Z5U A;  2XDV A;  3RPU D;  3ZQ7 A;  1NG7 A;  1U5T C;  3FWE A;  1R5I D;  4DVY P;  3E1S A;  3SYT A;  1YS6 A;  3M3Y J;  2BV6 A;  2LY2 A;  4CYC B;  1UCR A;  3GFM A;  1W36 C;  4L62 A;  1Z05 A;  1H9G A;  3KE2 A;  2NNY A;  1J5Y A;  1XSX A;  4QSH A;  5LBQ A;  1GVD A;  3HOV J;  1F36 A;  2LBF A;  3BCA A;  3BR0 A;  2KKO A;  1YTY A;  2YU9 J;  2QA4 I;  5FLX Z;  3BG3 A;  1NK3 P;  2M7A A;  1F1Z A;  3G1L A;  2DTR A;  2KIU A;  3WGI A;  2ME0 A;  3OSF A;  3QAH A;  4IHY A;  2COM A;  2CQN A;  3K9T A;  2OQG A;  3GX4 X;  2QWT A;  4GYI A;  2CFX A;  2L7K A;  3T1B A;  5LEK A;  3E5Q A;  4UUS A;  1Z0X A;  3HHH A;  2L3D A;  3JW4 A;  4BQQ A;  5EEG A;  3NPI A;  3NS4 A;  4BDY A;  1O7F A;  3BNI A;  1G3W A;  5FLM J;  1C0W A;  1K4T A;  3OS2 A;  1LDD A;  5J1U A;  3S2H J;  3KP4 A;  5FD5 A;  4FIS A;  3DEW A;  3U9G A;  1E3H A;  1IF1 A;  4AIH A;  3PNY A;  1T0F C;  2G7G A;  1QPI A;  3DU5 A;  1NK2 P;  1R5H A;  2YVX A;  5H2F C;  2WC2 A;  5GAG J;  3S3N A;  1B72 A;  2FUG 2;  3K1P A;  2JT1 A;  4I7H A;  2EV0 A;  2HVQ A;  2EFW A;  1J9I A;  2DJI A;  4E4H A;  2ZOY A;  4OOI A;  4GCV A;  3H36 A;  1HDP A;  1O4X A;  2UUZ A;  1KA8 A;  4B47 A;  4A69 C;  1YQA A;  5HSZ A;  4NEL A;  2YVH A;  3VWB A;  3E3V A;  1MD0 A;  3GXO A;  3WOD F;  3DTI A;  5J3L A;  3BJA A;  3JRD A;  3DPL C;  2XGX A;  1X1C A;  5EFY A;  2RQQ A;  4C2T A;  3GTM J;  2O03 A;  2ZJP F;  1K78 B;  2OUM A;  4IX7 A;  1I6H J;  1USS A;  2OTJ I;  1RC9 A;  2IU5 A;  1ZAO A;  1D3Y A;  3OYE A;  2WB1 A;  3MKL A;  4G6Q A;  3BJB A;  5DCM B;  2O9L A;  2DT5 A;  3COA C;  2EIL H;  2JQ7 A;  1LVK A;  1DP3 A;  1IAW A;  2ELH A;  3NEU A;  1O3Q A;  1U5T A;  2GIV A;  4BQN A;  5JVT A;  4UVA A;  4OIN F;  3SZT A;  2OZU A;  3FHZ A;  3HC7 A;  5A2Q K;  3RQ4 A;  1PDN C;  1XMK A;  4HLY A;  1ZGJ A;  2AS5 F;  1TP4 A;  4U0W A;  1MJA A;  4BXX J;  4JKZ A;  3JRG A;  3EUA A;  4PUS A;  2F6C A;  4HV6 A;  3A03 A;  3DPU A;  1FNN A;  2ECC A;  3D5S C;  3M1E A;  2O8X A;  2QBY B;  2LRE A;  1FYL A;  4WXC A;  3VOK A;  3DKX A;  1VND A;  4KIF A;  4G12 A;  2MGQ A;  3MN2 A;  3FMS A;  1POG A;  3B6A A;  2KJB A;  2K3F A;  2TRT A;  2HTS A;  2UXP A;  2A6E F;  2BBY A;  2HU9 A;  3MZ8 A;  4PXI A;  3KNW A;  2VAS A;  2BE5 F;  2M4K A;  5JHU A;  4ENJ A;  1FYK A;  3VVX A;  3JRA A;  4RLQ A;  3LHQ A;  4MEY F;  3VSK A;  1D0X A;  3H92 A;  1JGG A;  3RD3 A;  5KAF C;  4X1E A;  4MHG A;  2GQQ A;  1F5T A;  3DBH B;  4B09 A;  3GEZ A;  3F8N A;  5F27 A;  1WZ2 A;  3I4P A;  3PUB A;  1ON2 A;  1Z6R A;  2ZC2 A;  4XMY A;  3ZQC A;  3F8B A;  4HW0 A;  2LF8 A;  2K40 A;  2OI8 A;  2RNG A;  2K9L A;  4BE1 A;  4A0Z A;  4RDU A;  3NWS A;  1RKT A;  2FNP A;  4M9Z A;  3CTA A;  1ZEL A;  2EV5 A;  4HNT A;  1WJB A;  5IYC J;  1VTN C;  1HF0 A;  4U87 A;  4CO8 A;  2LMD A;  2QQ8 A;  1MMD A;  1YW7 A;  3VOE A;  1G2H A;  3K0L A;  2FQ4 A;  5DCF A;  1MBK A;  2HFH A;  3FXK A;  3CO6 C;  2NS8 A;  1I1S A;  2HGC A;  4UV9 A;  1FLI A;  1HKT A;  4Y13 A;  5DCM A;  5JHF A;  1VQ5 I;  5H20 A;  4BJ6 C;  5CVI A;  2DK5 A;  4OU0 A;  2MYS A;  3QU6 A;  1TWA J;  3ZP5 A;  5GAD J;  2W25 A;  3BR3 A;  4E7L A;  1MBE A;  2NRA C;  4Y7N J;  5E3O A;  2PFV A;  4AVP A;  2Z33 A;  2FX0 A;  1X3W B;  2ZME C;  3G7R A;  1BIB A;  3DFG A;  1B8I A;  3NQO A;  5L3E A;  5K7H A;  3CRJ A;  3CUQ A;  2ZO4 A;  1WKM A;  2DT7 B;  2XPV A;  4RGS A;  1XC5 A;  2M0C A;  3VIB A;  2LBF B;  4O6J A;  4OAY A;  3U1D A;  4L0Y B;  2AQF A;  4YII A;  1Z91 A;  1OIS A;  2PMU A;  3T8T A;  4JBA A;  4L9V A;  3HJE A;  3BT9 A;  1O7L A;  1OCO H;  1UST A;  1XCV A;  3ECH A;  3JSP A;  3CO7 C;  4I6Z A;  1OCR H;  1U3E M;  1X1B A;  3CMA I;  4DIQ A;  5DM7 F;  5FRN A;  2YUS A;  3BG6 A;  4IHX A;  1W0U A;  4RGU A;  4CZZ A;  1IDZ A;  3GBG A;  4XOR A;  1BR2 A;  2F5C A;  4XKW A;  3PPB A;  3CCQ I;  2QYO A;  1K6Y A;  2KL4 A;  4ZYH A;  2FMY A;  3GCM A;  5DEQ A;  4EJO A;  3DLL F;  1N77 A;  1P92 A;  1SVM A;  4XQF A;  4XLN F;  2CYY A;  2XAF A;  1XSV A;  3KPH A;  3CUQ B;  2E1M B;  2ZJR F;  1ENH A;  2Z3Y A;  2RNJ A;  2Z1D A;  2EFO A;  2DA3 A;  2K27 A;  3HRT A;  3RIR A;  4KMF A;  2IW5 A;  4F92 B;  1A5J A;  1S29 A;  1BOA A;  4LLN A;  2R7S A;  2JA2 A;  5HNH A;  2FU4 A;  2Y75 A;  1ZH5 A;  2A68 F;  2JRM A;  3ZMT A;  2HOE A;  1HSJ A;  2KLO A;  4G7H F;  3GYH X;  3SDG A;  3V7S A;  2GXG A;  5GAE J;  3KZI C;  3BG5 A;  1IRG A;  4BH9 A;  2R7Q A;  2VUM J;  5HVQ C;  2VBW A;  5FRO A;  3HSF A;  3CWR A;  2IEK A;  1U2W A;  4IHW A;  1UAA A;  2NAZ A;  3BR2 A;  2O0Y A;  1LVA A;  2XKP A;  2IA2 A;  3DP7 A;  4RB2 C;  4PJ0 C;  3OV8 A;  1H88 C;  2H6C A;  2X6W A;  3ZN0 A;  2HDD A;  5KK1 A;  5FKO A;  3I4M J;  1JKP C;  2NVQ J;  3CDL A;  2MLK A;  1W7P D;  2DYR H;  3I64 A;  3LOC A;  2DFH A;  1Z3Y A;  4LK1 F;  1OCT C;  4MFE A;  2LYC A;  3C18 A;  5FFZ A;  2RAS A;  3OYK A;  2DA4 A;  3B6C A;  3MZH A;  4OMZ A;  2ZOZ A;  4ICH A;  5D18 A;  1ERD A;  1JUM A;  2M0M A;  4CXF A;  3WGH A;  3ON2 A;  2VOO A;  2G7H A;  2VJ4 A;  2V4J C;  3FBI B;  3F1B A;  4G94 A;  2ZBK A;  2MW8 A;  3LAP A;  1EKE A;  1QHG A;  1JGS A;  3BG9 A;  4IZZ A;  3RKW A;  3S93 A;  1A04 A;  2O6G E;  2X0L A;  1HCR A;  3BQY A;  2UXI A;  4EJU A;  5FHP A;  1UMQ A;  4CCM A;  3B73 A;  1YLF A;  3I54 A;  3FXU A;  4BJT A;  3BDD A;  3CCS I;  2UXO A;  1IZ1 A;  4IEJ A;  5FMP A;  5CKT A;  3VW0 A;  1S7A A;  1BC7 C;  2MD5 A;  3J81 K;  2E7X A;  3HGG A;  1Z1D A;  2V7F A;  4ZDL A;  3ZCO A;  5B3S H;  3J7A Y;  2DPU A;  2LRD A;  3BCG A;  3KYL A;  3M9A A;  4RA2 A;  1GLN A;  3JRB A;  4J00 A;  3IHU A;  3DQV C;  1TWH J;  1MH3 A;  4HDV A;  2OAZ A;  4FT8 A;  3U21 A;  1D8K A;  2BHZ A;  3CC4 I;  5FGM A;  1PUF A;  1WJC A;  2LFB A;  1YX3 A;  3H9J A;  3F21 A;  5F1R A;  2KHM A;  2DCE A;  2K9Q A;  3GWZ A;  1V3F A;  5FGL A;  3FZV A;  4YG2 F;  2X1C A;  2Z16 A;  2QM3 A;  1JJ6 C;  1PUE E;  5F08 A;  1UFM A;  2YPR A;  3ISP A;  2GA1 A;  4H0E A;  2STT A;  1E3P A;  4HNU A;  1IN5 A;  3JRE A;  5M5Y J;  3ZMU A;  3L7W A;  4YRV A;  3OYL A;  2IVM A;  4NDL A;  5IOZ A;  3M4O J;  2IT0 A;  3NXC A;  2KDO A;  4H4K C;  3OYB A;  1R22 A;  3SJM A;  1T08 B;  3W2A A;  2D5V A;  2HR3 A;  5DV5 A;  5D5V B;  2MSY A;  3SZG A;  3O8H A;  5F6F A;  1LFB A;  3HSR A;  3VPR A;  4M74 A;  2LP0 A;  1Y8Q B;  3OY9 A;  4E70 A;  2NVX J;  2MH2 A;  4GDF A;  5DUI A;  1BW6 A;  3KP2 A;  4NB5 A;  1FP2 A;  2WBM A;  2R7F A;  2VBX A;  3W3C A;  1X1D A;  1TZL A;  4HLX A;  3PO2 J;  4QLC U;  3CCV I;  3ZN1 A;  2Y30 A;  2ZFU A;  4BGD A;  1G8X A;  3D1N I;  4FX4 A;  4XID A;  5J1R A;  2K4B A;  3LWF A;  4NNJ A;  3JTH A;  2JZY A;  1FBS A;  1ODD A;  2KQR A;  3FXJ A;  5BNG A;  4CDG A;  5J47 A;  4AD9 A;  1U78 A;  3T8R A;  2DN0 A;  4CCK A;  1NH3 A;  3OIP A;  1HST A;  3WTS C;  2Y31 A;  2X1E A;  3KEO A;  4GO1 A;  4L9J A;  1DP7 P;  1CF7 A;  2Q1Z B;  2CSO A;  1MMG A;  5F1J A;  2WAQ N;  3RI4 A;  1O3T A;  3L1P A;  2E5Z A;  2L9R A;  3MD2 A;  1BC8 C;  3EQL F;  1VF9 A;  5EJC A;  2OBP A;  3W6K B;  3O6B B;  4XL9 A;  2DA5 A;  3IH4 A;  5CLS A;  1FOY A;  3K70 D;  4WWC A;  1MBH A;  1BN5 A;  2X9D A;  2CWE A;  1YW8 A;  3SDB A;  3G2B A;  1X19 A;  3H0G J;  1G3Y A;  3PFI A;  4A3L J;  5ICC A;  1MH4 A;  2XV4 S;  1IXS B;  1SFE A;  3F6O A;  4NQW B;  1HLV A;  2PI0 A;  1P4A A;  5BQT A;  5GTH C;  4D7N A;  5EZG A;  4XLH A;  5KAI C;  2DLL A;  1XMX A;  2XGD A;  5LEJ A;  2VOD A;  5F0F A;  3GO5 A;  2LKX A;  1SC7 A;  2QSH X;  1K4S A;  4IOA F;  1T33 A;  3C2H A;  3TED A;  3CCY A;  1IN6 A;  4B1R A;  4IJA A;  1QZY A;  3K2Z A;  4C2M J;  1XD7 A;  5FJ8 J;  3KP5 A;  1AOY A;  3AL0 B;  1ITY A;  4PJJ A;  1EH8 A;  4XLC A;  3HDD A;  5BS6 A;  3REO A;  1SAN A;  1TQI A;  2ISZ A;  4MXM A;  3DPJ A;  1WJE A;  4KIC A;  4CCO A;  3PM1 A;  4FTH A;  1Y1V J;  5HDG A;  2X6X A;  1OFC X;  3PFY A;  2WAD A;  3P9T A;  2ZSH B;  2HQN A;  3BPX A;  3F8M A;  3H5A A;  3EET A;  3H0D A;  3DEE A;  3CJD A;  3V7R A;  2XRL A;  2CG4 A;  2EZH A;  2I10 A;  5J8C A;  1WQ2 A;  3E6B A;  1VI0 A;  4RLF A;  4YEL A;  2IS1 A;  1BM9 A;  2FE3 A;  4P55 A;  1ZAR A;  2HKO A;  5GP9 A;  2XDN A;  2I8D A;  2XC7 A;  1JUS A;  5FRM A;  9ANT A;  4XLA A;  3SEQ A;  5IP6 A;  1D0Z A;  2BY0 A;  2M8G X;  2QLZ A;  3Q0U A;  3RKY A;  3E7Q A;  1R5G A;  2Y0S N;  2LR8 A;  3ZOB A;  2EB7 A;  2BVL A;  3O3K A;  3H5R A;  1BW5 A;  4HBL A;  2IA1 A;  2Y0M A;  4N4O B;  1LFP A;  3VEP A;  3GFI A;  3Q0V A;  2CUJ A;  2QBY A;  4RMN A;  3OWT A;  4P9F A;  2K9S A;  4HG2 A;  1EV7 A;  2WY8 Q;  3E0J B;  5HOO A;  4V2F A;  3CC7 I;  2E2J J;  1VZ0 A;  1YS7 A;  2DMP A;  5M3M J;  3FX3 A;  4DZJ A;  3KLN A;  3ZMZ A;  3MMY B;  4I09 A;  5CXI A;  2R93 J;  4F93 B;  4WIB A;  3BTC A;  4M3B A;  3QOE A;  2VKE A;  2IGO A;  3HYI A;  4LLL A;  2OTL I;  4IHS A;  5J40 A;  4GFK A;  3OYG A;  1BI3 A;  4N0B A;  2R92 J;  4DW6 A;  4ZC3 A;  3AAF A;  4XON A;  4XRM A;  3N05 A;  4NHJ A;  3GEU A;  2XB0 X;  2A3S A;  4CHU A;  3U2R A;  3JRC A;  1WH7 A;  1KU9 A;  3V8K A;  2A5Y B;  1HQC A;  3HSE A;  5D1R A;  1R1U A;  1W1W E;  2E34 A;  2UXN A;  1TT5 B;  3OL3 A;  1PJR A;  2JPC A;  4XOP A;  1YE9 A;  1Z7L A;  2PMZ A;  1XSD A;  2D1H A;  1K78 A;  2E1O A;  4KUM A;  2L0K A;  4UV8 A;  2C6Y A;  1B9M A;  4IQJ A;  1UEL B;  4UVC A;  3HTJ A;  3DBR B;  3CD6 I;  5HDK A;  1U5T B;  5E3L A;  3BRO A;  3CLQ A;  1UHW A;  1MDM A;  1GHC A;  4GXO A;  5K5R A;  2P5V A;  2FBH A;  4UXN A;  2VQL A;  2MD0 A;  1V54 H;  1O3S A;  1TT0 A;  2LNB A;  3KP7 A;  2WV1 A;  1T0F A;  5HS8 A;  2DO7 A;  2XIG A;  5KVR A;  2H27 A;  5DM6 F;  4YEJ A;  3PL8 A;  3S3M A;  5FFX A;  2ME6 A;  3F3X A;  3SFI A;  2QCO A;  5F0H A;  3TL4 X;  2EZK A;  4KIT B;  2NS0 A;  3OYD A;  4G7Z F;  4ENK A;  4M6Y A;  3MKZ A;  3F8F A;  2ETH A;  3ZGK A;  2VKD A;  2JA5 J;  2WUI A;  4ZDO A;  4OD5 A;  4V2G A;  2R7W A;  3RQI A;  3V42 A;  2L01 A;  3RTR A;  2W00 A;  3JSJ A;  4EAT A;  3FF5 A;  4I02 A;  4LIU A;  3IKT A;  2GAU A;  2CV2 A;  1YIJ I;  3OYH A;  2A2F X;  2R7V A;  4A12 A;  1GV5 A;  2F5D A;  2JRT A;  1MDM B;  3IH3 A;  1LEB A;  5FLV A;  4O3M A;  2NOG A;  3KEY A;  2EK5 A;  5JLX A;  2ADU A;  3VVY A;  3NWT A;  2EA4 A;  1Y0N A;  3A01 B;  4A3F J;  2EJR A;  2Y9Y A;  1BR4 A;  1R1V A;  3FXO A;  1YIO A;  1HW1 A;  1J09 A;  2QEN A;  3I71 A;  4C3J J;  3HRU A;  2KIM A;  1VQ8 I;  3E6C C;  2HQA A;  5CJ9 A;  5D19 A;  4IPA A;  2DA7 A;  4OD4 A;  2A6T A;  1R58 A;  1KQ8 A;  1JKQ C;  1IUF A;  3I59 B;  1JXS A;  1R36 A;  3ZMS A;  4KT6 A;  1U6G A;  4CUG A;  1D1B A;  5E20 A;  2BZT A;  3S15 J;  1VQL I;  2DMU A;  3OSG A;  4RBO A;  1TQM A;  2HDW A;  4AWX B;  3AKZ A;  1VQ7 I;  1OR7 A;  2YVE A;  4B48 A;  1OQY A;  4E7J A;  3ZQQ A;  1K61 A;  2JUG A;  4AIJ A;  2E7W A;  3MEX A;  1P7I A;  2B7E A;  3LSM A;  3HHG A;  3CME I;  2UZK A;  5B1B H;  4AVZ A;  5E8I A;  2LOO A;  3Q9S A;  1U8R A;  3G1M A;  1DU6 A;  3VOX A;  2GUH A;  2LKS A;  4JP0 A;  4GRI A;  1FSE A;  4EMS A;  2GXB A;  4PFO A;  4EM2 A;  1XDS A;  4JQF A;  1JT6 A;  3A4C A;  2HKU A;  4RB1 A;  1XGM A;  3K4B A;  1OMI A;  2OQR A;  1SD7 A;  4IL6 C;  3GZ6 A;  1TW3 A;  3FXM A;  4AID A;  1JTY A;  2DG8 A;  5HOD A;  2RV8 A;  2QKL B;  1RNL A;  4XSX F;  2HDC A;  3HTA A;  1DPR A;  1WFX A;  4EM0 B;  4XR6 A;  3DPT A;  5FD6 A;  3TGN A;  2F07 A;  4PJL A;  2HYF A;  3P5J A;  2GLO A;  2HOT A;  5EG0 B;  5C3E J;  2WY7 Q;  5M5X J;  1JHH A;  2L9V A;  3BQZ A;  3V4G A;  1IN7 A;  1B9N A;  3L2U A;  3S32 A;  4RAZ A;  1MSE C;  3VYS B;  5A2Q Z;  5LHH A;  4G6D A;  2CQX A;  3Q3S A;  2OCC H;  4EM1 A;  1RPW A;  3O2P E;  3CES A;  3FXQ A;  4B4C A;  4P9U A;  2V9P A;  3FBN B;  2QQA A;  1R49 A;  2VE8 A;  3S2W A;  3HTS B;  3VUQ A;  2VT2 A;  2KJC A;  2KZV A;  4QTR A;  4L18 B;  3PQK A;  2UXU A;  4I98 B;  2W24 A;  3ZR8 X;  3VYU B;  5DS9 A;  2IS4 A;  4CSW A;  3X2Q H;  2FD5 A;  3H3V K;  1ZGA A;  3M8E A;  4IRV A;  3JRF A;  5B66 C;  3VDX A;  2FNA A;  1KGS A;  5F04 A;  4PJM A;  3CF2 A;  1RI7 A;  3GW2 A;  3QPL A;  5IP7 J;  3QP6 A;  3ABK H;  1IG7 A;  4M71 A;  1GV2 A;  3OS0 A;  1B6A A;  1WVR A;  4IRH A;  4RGR A;  3LQR A;  3D0S A;  2LY9 A;  1XTA A;  2K5C A;  4A3D J;  1R00 A;  3ABL H;  1ETW A;  1T38 A;  3KYD B;  4TV7 A;  2ZCW A;  2F4O B;  2LD5 A;  3K4N A;  2LF7 A;  2YR2 A;  3ROU A;  1XB4 A;  4Y15 A;  2QZ8 A;  3KKD A;  3L2V A;  1STZ A;  3K4K A;  4HX7 A;  2WV0 A;  1Y6I A;  3MQ0 A;  4HF2 A;  4NC6 A;  3ZQF A;  4KT5 C;  3ZPL A;  4KA4 A;  5H9T A;  1FMV A;  5DAJ A;  5FO5 A;  1AU7 A;  1X4P A;  4HEA 2;  1UG0 A;  3QOD A;  3K2A A;  4XLP F;  3I58 A;  1ETV A;  2GIZ A;  1IW7 F;  5CQG A;  4LG3 A;  3KIO A;  4Q47 A;  2A61 A;  3E97 A;  2GXA A;  1WJF A;  3ABM H;  5E1X A;  5LGN A;  1W0T A;  1XGS A;  4DYC A;  3VB2 A;  1WWX A;  4JOM A;  4I0B A;  2P6T A;  2G7U A;  4JX6 A;  4YIF A;  4HNV A;  1H0M A;  5L3D A;  3P9K A;  4L9N A;  1WGX A;  2XUB A;  3BR5 A;  1XGO A;  4ITV A;  2CV0 A;  3LSR A;  1RET A;  1OJL A;  3GME A;  1BBY A;  3QYF A;  2BOL A;  1X2M A;  1GDT A;  3BZK A;  4FE4 A;  3CP8 A;  3RDI A;  1RUN A;  3GFL A;  4KMU X;  2LC2 A;  1GXP A;  2VJ5 A;  1S8N A;  2P81 A;  3KZY A;  4MNU A;  2A5W A;  2IRF G;  3KLO A;  3S17 J;  1D5Y A;  4OWR B;  4W1U A;  4HQE A;  3N97 A;  2CUE A;  3IAS 2;  4CH7 A;  4MLO A;  6PAX A;  3M07 A;  3NRG A;  1ZRF A;  2ZNY A;  3OS1 A;  4G7O F;  4HQM A;  4S05 A;  1P4X A;  1Z21 A;  1HBX G;  2P0W A;  3RZD J;  1ZG3 A;  5DTD A;  1OYY A;  2R7D A;  5E3N A;  1PP8 F;  1V4R A;  2KT0 A;  2Y0S A;  2ID3 A;  2W85 A;  5GPC A;  2JWT A;  3WG9 A;  3HKZ A;  3OYC A;  4ANJ A;  2IXS A;  2L7F P;  2EFN A;  2W1O A;  3WTX C;  4N9I A;  2KRC A;  3OR2 C;  4WX9 A;  2IBD A;  4V19 K;  3ERE D;  2JJ7 A;  3ZMD A;  2DDB A;  1JKO C;  5IP9 J;  2CQ7 A;  1SMT A;  1LDK B;  2ESN A;  3EUK L;  1BJA A;  1SGM A;  1TWG J;  4DBR A;  3I53 A;  3G73 A;  1LQ1 A;  2EFP A;  3RSN A;  3VYR B;  3F72 A;  2HVR A;  3CJQ B;  2DOE A;  1QVT A;  2WTE A;  2CUZ A;  2V79 A;  4UVB A;  5IOY A;  2KP6 A;  4KYW A;  4OIQ F;  1GT0 C;  3K4C A;  4CA0 A;  4S04 A;  4DGW B;  5IT9 Z;  1RRJ A;  1QHH D;  2Y9Z A;  1ULY A;  5LLQ A;  2A07 F;  4M3D A;  2ZNZ A;  2ACJ A;  2ZME A;  3IH2 A;  2NXN B;  4C3H J;  3CF5 F;  4HKU A;  4BHC A;  2TCT A;  4IHT A;  1ACI A;  1D0Y A;  2PLY A;  1TC3 C;  4RAG A;  4XRF A;  4B3X A;  1I50 J;  4DQ2 A;  4ZYD A;  1FP1 D;  3VYT B;  3G1O A;  4A3C J;  3HB9 A;  1MMS A;  2ZJQ F;  2M2E A;  3HTU A;  2UXH A;  3NAR A;  4GCT A;  1QA6 A;  2GA2 A;  1UG2 A;  2OV7 A;  4UUV A;  4OMY A;  2WGB A;  1LE8 A;  1X3Z B;  4EQQ A;  3F8C A;  3GTJ J;  5LGU A;  2E1C A;  3R6S A;  3HUG B;  5EG0 A;  2DI3 A;  1S9H A;  4UUT A;  5M3F J;  2OA4 A;  4O5V A;  3U1K A;  1J0R A;  1ON1 A;  2CV1 A;  1I5Z A;  5J4V A;  2E71 A;  1D5V A;  5LFA A;  3A02 A;  1JI8 A;  2K86 A;  3HOS A;  3EUH C;  2BY2 A;  3PIP F;  4WK8 F;  3OL4 A;  3V7C A;  4ASN A;  4HOB A;  1G3S A;  3CCR I;  2XAQ A;  2ZCM A;  3FM3 A;  1MMN A;  4BDZ A;  1Y1W J;  4U7B A;  2MBF A;  3J7A O;  3TO6 A;  3RZO J;  2QKO A;  5E3M A;  2IGK A;  2XB5 A;  1V5E A;  4C30 A;  5EDN A;  2YSR A;  5HAW A;  4CCL A;  2XAG A;  3DTE A;  1HW5 A;  3LFK A;  4KN7 X;  2HYG D;  4DJA A;  3TOB A;  1G3T A;  1J59 A;  1MNM C;  1P2F A;  5FKM A;  4BNC A;  3LFU A;  1K83 J;  2FSW A;  2DXI A;  1J75 A;  1XGN A;  4XKB A;  2OER A;  4BYY A;  5HLG A;  3MKW B;  4L0Z B;  2DT6 A;  1YRN B;  2PMH A;  1Q1V A;  4D9J A;  2A6H F;  2COB A;  5GTI C;  4PFP A;  2PEX A;  4ESF A;  1HKS A;  2WAE A;  1LJ9 A;  4QIW N;  1W5T A;  1E3O C;  2HWV A;  4YIR X;  3DWL E;  1NTC A;  1K7A A;  4D5C A;  3TP0 A;  5CVR A;  3COL A;  3QWL A;  4C3I J;  2ZXH A;  4FAS D;  2HPM A;  2J5P A;  3K4M A;  3FKI J;  1EH6 A;  4BU2 A;  3DBL B;  4DBQ A;  1XPX A;  2VBY A;  1ZG5 A;  3CUQ C;  2EA2 A;  2PFB A;  1FBU A;  2O5R A;  2F4I A;  2XF7 A;  3LA3 A;  2QWW A;  2ESH A;  5CQE A;  3CCM I;  3PNV A;  2FBK A;  5EF6 A;  5LRS A;  1WJ5 A;  2WAF A;  1RUO A;  1LKX A;  5C44 J;  1QGP A;  3C3W A;  3I56 I;  2VT3 A;  4UUS B;  3HZJ A;  3BTI A;  1LUJ B;  2JA6 J;  1FX7 A;  5L3F A;  2X1D A;  1Z3X A;  4A6D A;  3JR9 A;  2GFN A;  2CW7 A;  4ZTF A;  3A01 A;  1BI0 A;  1KYW A;  2O3F A;  1KU7 A;  5CXG A;  5LRR A;  3M8J A;  3HL2 A;  2DMN A;  5K7Z A;  4KDP A;  1X1A A;  5CVV A;  3TBI A;  3LL7 A;  3J7Z I;  2EZL A;  4RS8 A;  2VQC A;  2JK3 A;  4I0A A;  4XLE A;  1SVL A;  4KN4 X;  4P96 A;  1TBX A;  3CCL I;  2AXT C;  2BVM A;  2O7T A;  4KIS A;  3GZ5 A;  4YFX F;  3IRR A;  4LGW A;  4XKV A;  1VQO I;  1YG2 A;  3PNT A;  3TKY A;  4AC0 A;  4LMY A;  1IN8 A;  1AKH A;  2V26 A;  4CCN A;  2HXO A;  1VQK I;  3CUO A;  3OYI A;  5TGT A;  2FOW A;  2O61 A;  5CPR B;  3CJT B;  4FHT A;  4AU7 A;  4ACI A;  1AA7 A;  1XS9 A;  1YX5 A;  2DA2 A;  1HKQ A;  1N25 A;  3BOQ A;  1V55 H;  2J5O A;  4EJT A;  3NRV A;  1MZB A;  4ME9 A;  3CJN A;  4IVN A;  2VOP A;  3CLO A;  1TWF J;  3CJR B;  1IRX A;  4ZZD A;  5HDN A;  1IC8 A;  2LLK A;  2JSP A;  5D8K B;  5D6F A;  2B0L A;  4ETS A;  3LQQ A;  1QZE A;  2EQR A;  3OMY A;  3S2D J;  5FB2 A;  1TLH B;  2ZXW H;  3JSO A;  3TO7 A;  4P1W A;  1A31 A;  2M7B A;  4IRG A;  2CS3 A;  1PP7 U;  2EIJ H;  4MO7 A;  2V6C A;  1DUX C;  1UI5 A;  5ICG A;  2VB6 A;  4D1Q A;  3HM5 A;  2ID6 A;  2KIF A;  1P9Q C;  4BQA A;  4PGH A;  3B02 A;  2XAU A;  4R79 A;  1E0E A;  3NNR A;  3BCB A;  2L7Z A;  5B5E C;  4M6V A;  1FBQ A;  2E60 A;  4ZYA A;  3S1Q J;  1OCP A;  2PJR B;  2ZCX A;  2P6S A;  1RR8 C;  2DFF A;  1MBF A;  2ELK A;  2H94 A;  2HZT A;  5FLX K;  2Y2Z A;  2IA0 A;  2PBX A;  1X58 A;  1TNT A;  3BWG A;  4XN3 A;  3BHQ A;  3C07 A;  1ETQ A;  1E2X A;  1MMA A;  1O57 A;  2PJP A;  2QTQ A;  4PGG A;  1S7E A;  1FIA A;  2X85 A;  2HYT A;  3B81 A;  2KMU A;  4BJ5 C;  4ZTJ A;  2GBY A;  4WXD A;  3QU3 A;  4OAZ A;  3BR6 A;  3ABT A;  1I1G A;  1ZTR A;  3WTZ A;  3NAU A;  5KCM A;  4KIB A;  1SAX A;  1AWC A;  4DOZ A;  1ETO A;  4ZDP A;  2R5Z A;  2XPU A;  4AC6 A;  3BTL A;  2RVC A;  1MJB A;  1VFC A;  5EZH A;  1YI2 I;  4KFC A;  3H35 A;  3ABU A;  2FRH A;  4L9T A;  3EGQ A;  2HZD A;  4HPQ A;  3ERM A;  5BPI A;  3ZQG A;  3J80 Z;  5J6X A;  1QPM A;  2HOA A;  3VW2 A;  1T95 A;  2LDU A;  1VQN I;  2A69 F;  2IPQ X;  2VJI A;  1YYV A;  3GTQ J;  2N8G A;  3UR3 C;  3NI7 A;  2EPF A;  2L02 A;  2R3S A;  4ABZ A;  2G7L A;  4I2O A;  3AQS A;  3ZRG A;  1FTZ A;  4EEF G;  2XF5 A;  3F0C A;  2GOM A;  3BC8 A;  2ISY A;  1ZHF A;  3AG1 H;  3T0Y A;  2CQK A;  2XPW A;  3J7Y J;  2CH0 A;  1SVO A;  2L2O A;  3IWF A;  3JRI A;  2VQG A;  1EH7 A;  2LTP A;  1WCM J;  3W2V A;  5IYD J;  3J81 Z;  1B8I B;  4CYC A;  3BRU A;  2NVY J;  3KZZ A;  2JMW A;  2P8T A;  3SXY A;  4OIO F;  3JRH A;  1CF7 B;  5HBU A;  1FT9 A;  1REP C;  5HLH A;  4CGZ A;  2CJJ A;  2XSD C;  1KQ0 A;  3ELK A;  2PG4 A;  1XG1 A;  2MFZ A;  4Z6Y A;  3PIO F;  3IRQ A;  1S6L A;  2ICW G;  4E7S A;  2DDA A;  1R71 A;  2MG4 A;  3PQJ A;  4WF2 A;  3WHC A;  4IO9 F;  4ZH4 F;  3K4J A;  2EIK H;  2HI3 A;  4G8X A;  3CZ6 A;  3C1D A;  1FWZ A;  3D5R C;  4Z2Y A;  3HOX J;  3WE2 A;  1VQM I;  3A0B C;  1YIT I;  2Y69 H;  3QBM A;  1YFH A;  5DUK A;  2NVT J;  5B1A H;  4HF1 A;  3K8P C;  2H1L A;  1DGW Y;  4L5I A;  1G4D A;  1A36 A;  2ZXJ A;  2IS6 A;  4NC7 A;  2H8W A;  3K10 A;  1QO0 D;  3HOZ J;  4BE0 A;  1IUY A;  3WTV C;  3MNL A;  1IXC A;  3M1C A;  3CC2 I;  4KNY A;  1MJ9 A;  2STW A;  4UB8 C;  5FKK A;  1LFU P;  5IT9 K;  4U0V A;  5HS7 A;  1QU3 A;  2B9S A;  1GVJ A;  1ZRD A;  1R1T A;  2DPD A;  2M1B A;  1UHS A;  2PX9 A;  4LLG F;  3C2G A;  3WU2 C;  2P7C B;  4EJV A;  3HUG A;  3GZN B;  2GEN A;  3GUD A;  1JTX A;  1T98 A;  4MQV A;  3HOU J;  1WI3 A;  2V57 A;  3ANG A;  3GLX A;  3OR1 C;  3RCO A;  1X1P A;  5FKN A;  3KX2 A;  3LSH A;  1TW2 A;  2FML A;  1MGT A;  2F5E A;  2MH9 A;  4D0P A;  3G71 I;  2B1E A;  3GFJ A;  3QOP A;  5EEH A;  3GTL J;  1A6Q A;  2KDZ A;  4HSR A;  5HNF A;  2REK A;  1QVU A;  4Q48 A;  2I5U A; 
#chains in the Genus database with same CATH homology
 5D18 A;  4BBR J;  1JUM A;  3HEF A;  5C4Y A;  3K7A J;  3ON2 A;  1BL0 A;  5EGO B;  2EBI A;  1WPK A;  3F1B A;  2O7O A;  1W0T A;  2MW8 A;  4DYC A;  3BG9 A;  4NN1 A;  4JX6 A;  4HNV A;  1HCR A;  3TP3 A;  2PMZ N;  3BQY A;  2UXI A;  5FHP A;  1WGX A;  1UMQ A;  3BR5 A;  3LSR A;  1RET A;  1OJL A;  1GDT A;  1X2M A;  4ICH A;  4BY1 J;  4FE4 A;  2UXO A;  1X2N A;  4IEJ A;  5FMP A;  2P81 A;  3ZQI A;  1FEX A;  3VW0 A;  2IAI A;  3BR1 A;  3S17 J;  3TW7 A;  1D5Y A;  2NP5 A;  4W1U A;  3HGG A;  1FJL A;  2CUE A;  3RH2 A;  4IHV A;  4MLO A;  2AO9 A;  2XGC A;  3BCG A;  3NRG A;  4DYQ A;  3JRB A;  4BBS J;  3GTO J;  4GFB A;  1TWH J;  3RZD J;  1MH3 A;  1RR7 A;  2K9N A;  3S1N J;  1I3Q J;  5DTD A;  1PUF A;  1YRN A;  3QQA A;  5E3N A;  1JUP A;  2LFB A;  1U8B A;  3E7L A;  5FGL A;  2K9Q A;  2KT0 A;  2ID3 A;  5GPC A;  2R5Z B;  1ZQ3 P;  2JWT A;  5F0C A;  1U9O A;  2L7F P;  1JJ6 C;  5F08 A;  4CGR A;  5IYB J;  2NP3 A;  2IBD A;  2JJ7 A;  4JX5 A;  3S16 J;  1JKO C;  3Q0W A;  2CU7 A;  5IP9 J;  3JRE A;  1H89 C;  2D6Y A;  3FIS A;  5M5Y J;  1DU0 A;  5CW8 A;  4A3M J;  3QPS A;  4NDL A;  1SGM A;  5IOZ A;  2G7S A;  3M4O J;  3DCF A;  1P7J A;  1H8A C;  1TWG J;  3HBL A;  4A3I J;  2H8R A;  3NXC A;  3SJM A;  2D5V A;  2E2H J;  1ORK A;  2MSY A;  3O8H A;  1QVT A;  1LFB A;  3VPR A;  3ZQH A;  5IOY A;  2LP0 A;  2CRG A;  1GT0 C;  5FKL A;  2ECB A;  2NVX J;  2Y9Z A;  3HOW J;  3OOU A;  3I4N J;  1BW6 A;  3S5R A;  3T6N A;  4M3D A;  4UDS A;  2DA1 A;  5JLW A;  3FK6 A;  3ANP A;  1JT0 A;  3IH2 A;  2NX4 A;  4JNN A;  4C3H J;  3PO2 J;  3HIM A;  4HKU A;  2TCT A;  2Y30 A;  3LSG A;  3D1N I;  4A3E J;  4XID A;  5J1R A;  1TC3 C;  4DYR A;  3WHB A;  1I50 J;  2EZI A;  5BNG A;  1LE8 B;  3AQT A;  3G1O A;  2QF7 A;  1U78 A;  2CQQ A;  1FTT A;  1QRY A;  5C4J J;  3VW1 A;  4A3C J;  3ZQL A;  3HB9 A;  2DN0 A;  2M2E A;  1IV6 A;  2Y31 A;  2UXH A;  3NAR A;  1GUU A;  3HOY J;  2L7M P;  4GCT A;  3S1R J;  1TWC J;  1UG2 A;  2WGB A;  1LE8 A;  5F1J A;  2DTZ A;  2WAQ N;  1HDD C;  3L1P A;  4JYK A;  3GTJ J;  2L9R A;  4L5E A;  1VF9 A;  5EG0 A;  4AF5 A;  4UUT A;  5M3F J;  4A3K J;  4M3F A;  1CQT A;  1AHD P;  3HE0 A;  2DA5 A;  4D7M A;  3IH4 A;  2Q24 A;  1MBH A;  1IJW C;  2H1K A;  3A02 A;  2X9D A;  4FE7 A;  4BKX A;  2B63 J;  1ZR2 A;  2LVS A;  3H0G J;  4A3L J;  4A93 J;  1MH4 A;  5M5W J;  1HLV A;  3FIW A;  1ZGW A;  4D7N A;  5EZG A;  3GTK J;  3ON4 A;  5EEA A;  3TW6 A;  3W6V A;  1A6I A;  2ZCM A;  4YZE A;  3BTJ A;  1Y1W J;  2XGD A;  2R7Z J;  3RZO J;  2QKO A;  5E3M A;  5F0F A;  2LKX A;  2XB5 A;  2RHA A;  1T33 A;  5EDN A;  3CCY A;  3TED A;  4A3G J;  4B1R A;  5HAW A;  4C2M J;  5FJ8 J;  3HTI A;  1MNM C;  5FKM A;  1ITY A;  4AYB N;  3HDD A;  1SAN A;  3KKC A;  1K83 J;  4MXM A;  3DPJ A;  3VVZ A;  4FCY A;  4J19 A;  1ZKG A;  3PM1 A;  4FTH A;  1Y1V J;  1OFC X;  2OER A;  4KWA A;  1Z77 A;  1IGN A;  1PUF B;  1YRN B;  4MIM A;  3QKX A;  3P9T A;  3HGY A;  1EF4 A;  1Q1V A;  3LNQ A;  3CJD A;  2COB A;  2XRL A;  5K58 A;  2EZH A;  2I10 A;  4QIW N;  1VI0 A;  1E3O C;  3M3Y J;  4CYC B;  3O8G A;  1NTC A;  5GP9 A;  4D5C A;  3TP0 A;  4L62 A;  4AUX A;  2XDN A;  1JUS A;  2M9H A;  9ANT A;  2OPT A;  3COL A;  4QSH A;  2G0E A;  4C3I J;  5IP6 A;  1ETY A;  1GVD A;  2M8G X;  3Q0U A;  3FKI J;  3HOV J;  3RKQ A;  1F36 A;  3BR0 A;  3E7Q A;  2Y0S N;  2YS9 A;  2LR8 A;  5J1Y A;  3ZOB A;  2YU9 J;  3BG3 A;  4M3E A;  1NK3 P;  1BW5 A;  1RKW A;  4B3A A;  1WH5 A;  3G1L A;  3Q0V A;  2ME0 A;  3OSF A;  4IHY A;  2K9S A;  5EF6 A;  2QWT A;  4UUS A;  2O8K A;  1Z0X A;  5C44 J;  3NPI A;  4V2F A;  4UUS B;  2E2J J;  2DMP A;  3BNI A;  5M3M J;  5FLM J;  3BTI A;  2JA6 J;  4DZJ A;  5J1U A;  3JR9 A;  3S2H J;  2GFN A;  4S0H B;  4FIS A;  5CXI A;  3DEW A;  2R0Q C;  2R93 J;  2DA6 A;  3BTC A;  1ZK8 A;  4M3B A;  3A01 A;  4XRS G;  5CXG A;  3V6G A;  2VKE A;  2G7G A;  3LSJ A;  1QPI A;  4GFK A;  4BY7 J;  1NK2 P;  2E2I J;  2DMN A;  5K7Z A;  3CMY A;  4DW6 A;  2R92 J;  1B72 A;  4GFL A;  4JL3 A;  4XRM A;  5IPA A;  3GEU A;  2XB0 X;  2EZL A;  2JK3 A;  3JRC A;  2ZOY A;  4MFD A;  1WH7 A;  3FK7 A;  1HDP A;  2DMQ A;  1O4X A;  1MSF C;  4A69 C;  5HSZ A;  5EGO A;  2O7T A;  4NEL A;  5D1R A;  2YVH A;  2X6O A;  5J3L A;  1AKH B;  3JRD A;  1JJ8 C;  5EFY A;  2AHQ A;  4AC0 A;  2E1O A;  1AKH A;  4W97 A;  3C2B A;  2L0K A;  3GTM J;  2HXO A;  3HTJ A;  3GZI A;  1I6H J;  3HTH A;  2IU5 A;  2XGE A;  4ACI A;  5E3L A;  1XS9 A;  4D5F A;  5AQC A;  1UI6 A;  3MKL A;  3BJB A;  2DA2 A;  2O9L A;  2R5Y B;  1BA5 A;  2CUF A;  2WV1 A;  4ME9 A;  2ME6 A;  1TWF J;  3SFI A;  2QCO A;  5F0H A;  2EZK A;  3G56 A;  3V78 A;  1IC8 A;  2LLK A;  1ZR4 A;  3PO3 J;  3LWJ A;  4BXX J;  1IDY A;  4I76 A;  3JRG A;  4JKZ A;  2JA5 J;  2EQR A;  2WUI A;  3S2D J;  3A03 A;  2ECC A;  4V2G A;  2WB1 N;  3RQI A;  3FRQ A;  2M34 A;  3JSJ A;  4MK6 A;  3VOK A;  4GCL A;  4MO7 A;  1VND A;  1UI5 A;  2HOS A;  1BJZ A;  3LSP A;  4G12 A;  2MGQ A;  3HM5 A;  2ID6 A;  3MN2 A;  3LJL A;  1POG A;  1U9N A;  1IRZ A;  1GV5 A;  3B6A A;  2TRT A;  2UXP A;  2W48 A;  1FIP A;  3CQZ J;  3IH3 A;  4PXI A;  5FLV A;  2NOG A;  3VVY A;  5JLX A;  3NNR A;  1ETX A;  5EYR A;  3VP5 A;  2L7Z A;  3A01 B;  3KNW A;  4M6V A;  4A3F J;  4Y52 J;  3S1Q J;  1OCP A;  2Y9Y A;  2ZCX A;  1APL C;  3JRA A;  2W53 A;  3LHQ A;  3VVX A;  3RD3 A;  1JGG A;  1MBF A;  2ELK A;  4X1E A;  2QIB A;  2QOP A;  2Y2Z A;  2PBX A;  3IV5 A;  1X58 A;  4C3J J;  4JX4 A;  5F27 A;  3C07 A;  3BHQ A;  1ETQ A;  1MBJ A;  3ZQC A;  5D19 A;  2DA7 A;  2K40 A;  2QTQ A;  2OI8 A;  4M3G A;  3KZ9 A;  1JKQ C;  1S7E A;  1FIA A;  2HYT A;  3B81 A;  4GCK A;  1IUF A;  4RDU A;  1RKT A;  2HXI A;  2GBY A;  2VPR A;  3BR6 A;  1ZTR A;  3S15 J;  5IYC J;  3NAU A;  1HF0 A;  2DMU A;  3OSG A;  2OF7 A;  4RBO A;  1ETO A;  2R5Z A;  1G2H A;  2XPU A;  2YVE A;  2FQ4 A;  3BTL A;  1MBK A;  3UKG A;  4AC6 A;  1K61 A;  2RAE A;  2NS8 A;  1VFC A;  1P7I A;  5EZH A;  2FJ1 A;  3EGQ A;  2ZB9 A;  3ZQG A;  3G1M A;  3VW2 A;  2HOA A;  1DU6 A;  2NS7 A;  2JA7 J;  3VOX A;  2GUH A;  2PZ9 A;  2GM4 A;  4XK4 A;  4JP0 A;  1TWA J;  2G3B A;  3GTQ J;  3NI7 A;  2N8G A;  4ABZ A;  3O60 A;  3BR3 A;  2G7L A;  1MBE A;  3AQS A;  4Y7N J;  5E3O A;  1FTZ A;  1JT6 A;  2FX0 A;  3G7R A;  2EH3 A;  2FBQ A;  4EEF G;  3F0C A;  2HKU A;  1B8I A;  2HYJ A;  5K7H A;  3CRJ A;  2XPW A;  2XPV A;  1XC5 A;  2M0C A;  3VIB A;  3JRI A;  5GPA A;  4DZP A;  1HOM A;  4LOC A;  1JTY A;  2LTP A;  1RES A;  1WCM J;  3MVP A;  5HOD A;  1B8I B;  5IYD J;  4CYC A;  2DG8 A;  2NVY J;  3BRU A;  2JMW A;  3S14 J;  3HTA A;  2F07 A;  2DMT A;  3JRH A;  3BT9 A;  2HOT A;  2GLO A;  4I6Z A;  5EG0 B;  4X6A J;  5HBU A;  4A3J J;  5C3E J;  2X48 A;  2CJJ A;  2XSD C;  5M5X J;  1SFO J;  1XG1 A;  3BQZ A;  2YUS A;  3IUV A;  2HQ5 A;  3EUP A;  4IHX A;  1W0U A;  1MSE C;  1IDZ A;  3GBG A;  2CQX A;  2MG4 A;  3Q3S A;  3PPB A;  3GTP J;  3WHC A;  2HI3 A;  2JN6 A;  1T56 A;  1RPW A;  1F43 A;  4B4C A;  2JA8 J;  3HOX J;  3S1M J;  3VUQ A;  1ENH A;  4QTR A;  3QBM A;  2UXU A;  2DA3 A;  1A5J A;  5DS9 A;  2NVT J;  5C4X J;  4XIC A;  2DJN A;  2FD5 A;  1R9T J;  3H3V K;  3HKZ N;  3JRF A;  3SDG A;  3OIO A;  5F04 A;  3HOZ J;  3MNL A;  3QPL A;  5IP7 J;  3BG5 A;  2E19 A;  1IG7 A;  1GV2 A;  2VUM J;  5FKK A;  1LFU P;  1ETK A;  3CWR A;  2LK2 A;  3PAS A;  2IEK A;  2LY9 A;  4IHW A;  4A3D J;  2VI6 A;  3BR2 A;  1UHS A;  1ETW A;  2GEN A;  2LD5 A;  4A3B J;  1JTX A;  3HOU J;  1WI3 A;  1H88 C;  2HDD A;  2V57 A;  3ANG A;  5FKO A;  2R5Y A;  3I4M J;  1JKP C;  3KKD A;  4XRS A;  3CDL A;  5K7F A;  2NVQ J;  1MBG A;  1JKR C;  5FKN A;  2ZCN A;  3ZQF A;  3LOC A;  1B72 B;  5H9T A;  1OCT C;  5DAJ A;  4MFE A;  2VKV A;  1AU7 A;  3GTG J;  3GTL J;  2DG7 A;  2KDZ A;  2RAS A;  2REK A;  1QVU A;  3K2A A;  2DA4 A;  3B6C A;  2ZOZ A;  1ETV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...