3GZIA

Crystal structure of a transcriptional regulator of the tetr family (shew_3567) from shewanella loihica pv-4 at 2.05 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
203
Chain Sequence
VGRPSGDTQNRDKLILAARNLFIERPYAQVSIREIASLAGTDPGLIRYYFGSKEKLFSTMIHETAMPVLAQLHKARRETRQESPAALLQTYYSVMSKHPHFPRLMLRIAGLDQSLPENAEVTKAFYEVVNFENIAIFQRLKDKNLLKDDVDAHCAQLSFFAMMVFPFIVPENLLERVGIELTPDFLQLLAEQNTRLLQRGLMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TETR family transcriptional regulator (YP_001095692.1) from SHEWANELLA SP. PV-4 at 2.05 A resolution
rcsb
source organism Shewanella loihica pv-4
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
total genus 65
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3gziA00
2GBYA 3FK6A 1JT6A 3IH3A 4AF5A 3HGYA 5HBUA 3G7RA 5FGLA 2Y2ZA 3BTJA 2NX4A 5IOZA 1RKWA 3LSJA 2OF7A 4YZEA 2YVHA 3FIWA 2GUHA 3NNRA 3P9TA 3LJLA 3HIMA 3DPJA 3BR5A 3QQAA 1Z77A 2HXIA 2G7GA 4D7MA 2XRLA 4ACIA 3PASA 5GPAA 3CRJA 2X9DA 4JNNA 2ID3A 2NP5A 2F07A 2V57A 1JUMA 3E7QA 5FHPA 2PBXA 4JKZA 1SGMA 2HYTA 5FKNA 4W97A 1ZK8A 4I6ZA 5EYRA 5FKMA 3BQZA 3VVYA 2WGBA 5IP6A 4D5CA 4ICHA 2TRTA 3C2BA 4AUXA 4GCLA 2FX0A 5J1YA 4MO7A 3BNIA 2IBDA 5K7HA 5D19A 5HSZA 5H9TA 3RH2A 4V2GA 5EZGA 2WUIA 3RD3A 3VW0A 5IOYA 2HXOA 3QKXA 4AC6A 2FJ1A 2G3BA 3DCFA 1Z0XA 5F0HA 4MK6A 4HKUA 2W53A 3FK7A 3BJBA 3HGGA 5F04A 1ORKA 2ZOYA 3B6CA 5GP9A 3BR6A 3S5RA 3BTCA 3CDLA 3ANGA 5DAJA 2ZB9A 3Q0UA 4GFKA 2XPVA 3SFIA 3Q0VA 2Y30A 5CXIA 3ZQHA 2RHAA 5F1JA 2ZOZA 3BTLA 3ZQIA 3B81A 3NPIA 2REKA 2UXOA 3HTAA 3BQYA 5CW8A 4CGRA 3BR2A 3MNLA 3LOCA 3CWRA 3NI7A 2QKOA 3IUVA 1A6IA 3F0CA 3CJDA 4GFLA 2FD5A 2PZ9A 2GFNA 2QOPA 2DG8A 2XGCA 2HYJA 3FRQA 1QPIA 4NELA 2IU5A 4UDSA 3IH2A 3LSRA 2O7OA 3QPLA 3ZQGA 2NS7A 3O8HA 1U9OA 2G7LA 5FKOA 3VVZA 5F0CA 4XK4A 2XPWA 3LHQA 3TP3A 5F08A 4X1EA 2YVEA 4PXIA 3VOKA 3B6AA 2XPUA 2G7SA 5FKKA 4M3BA 2DG7A 1JUPA 2DTZA 4V2FA 3O60A 3V78A 2IAIA 3AQSA 3HE0A 3JSJA 5F0FA 2G0EA 1RKTA 4B3AA 1JTXA 3VW1A 2FBQA 3GZIA 3Q0WA 2WV1A 2QIBA 2IEKA 1T56A 2XB5A 3QBMA 4AC0A 2OPTA 4MXMA 3QPSA 3BCGA 5D18A 1JUSA 4ME9A 4L62A 3TP0A 2VKVA 3NRGA 3VIBA 3LWJA 5IPAA 4JL3A 3HTIA 2Q24A 3VW2A 4GCTA 3DEWA 3G56A 2QTQA 3VVXA 2ID6A 3BTIA 3G1OA 3SDGA 5EFYA 2EH3A 3EUPA 2GENA 3V6GA 4GCKA 3ON4A 2NP3A 3VPRA 3COLA 2HQ5A 3PPBA 5FMPA 4ABZA 2ZCMA 2VPRA 1VI0A 1UI5A 3EGQA 2NS8A 3HTJA 4M3GA 3ON2A 4DW6A 2JJ7A 5K7ZA 5HAWA 5CXGA 4M3EA 3Q3SA 3AQTA 2XGDA 3BR0A 2I10A 3G1LA 5EZHA 5J3LA 2UXHA 1ZKGA 3ANPA 4I76A 2UXIA 5AQCA 1U9NA 5K58A 3LSPA 2HKUA 2UXPA 4D7NA 2ZCXA 3BHQA 3KKDA 4D5FA 3F1BA 3ZQLA 3BR3A 3NXCA 3T6NA 3KNWA 5C4YA 2TCTA 2OI8A 2X6OA 1UI6A 5J1RA 3BT9A 3CCYA 1QVTA 5D1RA 3HTHA 4M3DA 3VP5A 2FQ4A 4KWAA 2RASA 1JT0A 5F27A 1RPWA 2JK3A 3VUQA 4G12A 3BR1A 3IH4A 1QVUA 1T33A 3O8GA 2XDNA 3G1MA 4B1RA 2QCOA 3MVPA 5J1UA 5K7FA 1BJZA 3C07A 3VOXA 2OERA 5FKLA 3WHBA 4M3FA 4NN1A 3GEUA 3KZ9A 3WHCA 2D6YA 4JYKA 2Y31A 2RAEA 3KKCA 2XGEA 3BRUA 2UXUA 2ZCNA 1JTYA 2O7TA 4W1UA 5GPCA 3PM1A 3ZQFA 2QWTA 2VKEA
chains in the Genus database with same CATH superfamily
2GBYA 3FK6A 1JT6A 3IH3A 4AF5A 3HGYA 5HBUA 3G7RA 5FGLA 2Y2ZA 3BTJA 2NX4A 5IOZA 1RKWA 3LSJA 2OF7A 4YZEA 3SWHA 2YVHA 3FIWA 2GUHA 3NNRA 2R7UA 3P9TA 3LJLA 3HIMA 3DPJA 3BR5A 3QQAA 1Z77A 2HXIA 2G7GA 4D7MA 2XRLA 4ACIA 3PASA 5GPAA 3CRJA 2X9DA 4JNNA 2ID3A 2NP5A 2F07A 2V57A 1JUMA 3E7QA 5FHPA 2PBXA 4JKZA 1SGMA 2HYTA 5FKNA 4W97A 1ZK8A 4I6ZA 5EYRA 4IRVA 5FKMA 3BQZA 3VVYA 2WGBA 5IP6A 4D5CA 4ICHA 2TRTA 3C2BA 4AUXA 4GCLA 2FX0A 5J1YA 4MO7A 3BNIA 2IBDA 5K7HA 5D19A 5HSZA 5H9TA 3RH2A 4V2GA 5EZGA 2WUIA 3RD3A 3VW0A 5IOYA 2HXOA 3QKXA 4AC6A 2FJ1A 2G3BA 3DCFA 1Z0XA 5F0HA 4MK6A 2R7WA 4HKUA 2W53A 3FK7A 3BJBA 3HGGA 5F04A 1ORKA 2ZOYA 3B6CA 5GP9A 3BR6A 2ZY9A 3S5RA 3DU6A 3DU5A 3BTCA 3CDLA 3ANGA 5DAJA 2ZB9A 3Q0UA 4GFKA 2XPVA 3SFIA 3Q0VA 2Y30A 4U9NA 4C2MA 5CXIA 2R7OA 3ZQHA 2RHAA 5F1JA 2ZOZA 3VTIA 3BTLA 2R7VA 3ZQIA 3B81A 3NPIA 2REKA 2UXOA 3HTAA 2R7XA 3BQYA 5CW8A 4CGRA 3BR2A 3MNLA 3LOCA 3CWRA 3NI7A 2YVXA 4WIBA 2QKOA 3IUVA 1A6IA 3F0CA 3CJDA 4GFLA 2FD5A 2PZ9A 2GFNA 2QOPA 2DG8A 2XGCA 2R7TA 2HYJA 3FRQA 1QPIA 4NELA 2IU5A 4UDSA 3IH2A 3LSRA 2O7OA 3QPLA 3ZQGA 2NS7A 3O8HA 1U9OA 2G7LA 5FKOA 3VVZA 5F0CA 4XK4A 2XPWA 3LHQA 3TP3A 5F08A 2R7RA 4OD5A 2YVEA 4X1EA 4PXIA 3VOKA 3B6AA 2B1EA 2G7SA 2XPUA 5CQGA 5FKKA 4M3BA 2DG7A 1JUPA 2DTZA 4V2FA 3O60A 3V78A 2IAIA 3AQSA 3HE0A 3JSJA 4U9LA 5F0FA 2G0EA 1RKTA 4B3AA 1JTXA 3VW1A 2FBQA 3GZIA 3Q0WA 2R7SA 2WV1A 2QIBA 3FHNA 2IEKA 1T56A 2XB5A 3QBMA 4AC0A 2OPTA 4MXMA 3QPSA 3BCGA 5D18A 1JUSA 4ME9A 4L62A 3TP0A 2VKVA 3NRGA 3VIBA 3LWJA 5IPAA 4JL3A 2B3WA 2R7QA 3HTIA 2Q24A 3VW2A 4GCTA 3DEWA 3G56A 2QTQA 3VVXA 2ID6A 3BTIA 3G1OA 3SDGA 5EFYA 3KYLA 2EH3A 3EUPA 2GENA 3V6GA 4GCKA 4OD4A 3ON4A 2NP3A 3VPRA 3COLA 2HQ5A 3PPBA 5FMPA 4ABZA 2ZCMA 2VPRA 1VI0A 1UI5A 3EGQA 2NS8A 3HTJA 4M3GA 3ON2A 4DW6A 2JJ7A 5K7ZA 5HAWA 5CXGA 4M3EA 3Q3SA 3AQTA 2XGDA 3BR0A 2I10A 3G1LA 5EZHA 5J3LA 2UXHA 1ZKGA 3ANPA 4I76A 2UXIA 5AQCA 1U9NA 5K58A 3K8PC 3LSPA 2HKUA 2UXPA 4D7NA 2ZCXA 3BHQA 3KKDA 4D5FA 2FJI1 3F1BA 2PFVA 3ZQLA 3BR3A 3NXCA 3T6NA 3KNWA 5C4YA 2TCTA 2OI8A 2X6OA 1UI6A 5J1RA 3BT9A 2A2FX 3CCYA 1QVTA 5D1RA 3HTHA 4M3DA 3VP5A 2FQ4A 4KWAA 2RASA 1JT0A 5F27A 1RPWA 2JK3A 3VUQA 4G12A 3BR1A 3IH4A 1QVUA 1T33A 3O8GA 2XDNA 3G1MA 4B1RA 2QCOA 4DVYP 3MVPA 5J1UA 5K7FA 1BJZA 3C07A 3VOXA 2OERA 5FKLA 3WHBA 4M3FA 4NN1A 3GEUA 3NS4A 3KZ9A 3WHCA 2D6YA 4JYKA 2Y31A 2RAEA 3KKCA 2XGEA 3BRUA 2UXUA 2ZCNA 1JTYA 2O7TA 4W1UA 5GPCA 3PM1A 3ZQFA 2QWTA 2VKEA
chains in the Genus database with same CATH topology
2GBYA 3FK6A 1JT6A 3IH3A 4AF5A 3HGYA 5HBUA 3G7RA 5FGLA 2Y2ZA 3BTJA 2NX4A 5IOZA 1RKWA 3LSJA 2OF7A 4YZEA 2YVHA 3FIWA 2GUHA 3NNRA 3P9TA 3LJLA 3HIMA 3DPJA 3BR5A 3QQAA 1Z77A 2HXIA 2G7GA 4D7MA 2XRLA 4ACIA 3PASA 5GPAA 3CRJA 2X9DA 4JNNA 2ID3A 2NP5A 2F07A 2V57A 1JUMA 3E7QA 5FHPA 2PBXA 4JKZA 1SGMA 2HYTA 5FKNA 4W97A 1ZK8A 4I6ZA 5EYRA 5FKMA 3BQZA 3VVYA 2WGBA 5IP6A 4D5CA 4ICHA 2TRTA 3C2BA 4AUXA 4GCLA 2FX0A 5J1YA 4MO7A 3BNIA 2IBDA 5K7HA 5D19A 5HSZA 5H9TA 3RH2A 4V2GA 5EZGA 2WUIA 3RD3A 3VW0A 5IOYA 2HXOA 3QKXA 4AC6A 2FJ1A 2G3BA 3DCFA 1Z0XA 5F0HA 4MK6A 4HKUA 2W53A 3FK7A 3BJBA 3HGGA 5F04A 1ORKA 2ZOYA 3B6CA 5GP9A 3BR6A 3S5RA 3BTCA 3CDLA 3ANGA 5DAJA 2ZB9A 3Q0UA 4GFKA 2XPVA 3SFIA 3Q0VA 2Y30A 5CXIA 3ZQHA 2RHAA 5F1JA 2ZOZA 3BTLA 3ZQIA 3B81A 3NPIA 2REKA 2UXOA 3HTAA 3BQYA 5CW8A 4CGRA 3BR2A 3MNLA 3LOCA 3CWRA 3NI7A 2QKOA 3IUVA 1A6IA 3F0CA 3CJDA 4GFLA 2FD5A 2PZ9A 2GFNA 2QOPA 2DG8A 2XGCA 2HYJA 3FRQA 1QPIA 4NELA 2IU5A 4UDSA 3IH2A 3LSRA 2O7OA 3QPLA 3ZQGA 2NS7A 3O8HA 1U9OA 2G7LA 5FKOA 3VVZA 5F0CA 4XK4A 2XPWA 3LHQA 3TP3A 5F08A 4X1EA 2YVEA 4PXIA 3VOKA 3B6AA 2XPUA 2G7SA 5FKKA 4M3BA 2DG7A 1JUPA 2DTZA 4V2FA 3O60A 3V78A 2IAIA 3AQSA 3HE0A 3JSJA 5F0FA 2G0EA 1RKTA 4B3AA 1JTXA 3VW1A 2FBQA 3GZIA 3Q0WA 2WV1A 2QIBA 2IEKA 1T56A 2XB5A 3QBMA 4AC0A 2OPTA 4MXMA 3QPSA 3BCGA 5D18A 1JUSA 4ME9A 4L62A 3TP0A 2VKVA 3NRGA 3VIBA 3LWJA 5IPAA 4JL3A 3HTIA 2Q24A 3VW2A 4GCTA 3DEWA 3G56A 2QTQA 3VVXA 2ID6A 3BTIA 3G1OA 3SDGA 5EFYA 2EH3A 3EUPA 2GENA 3V6GA 4GCKA 3ON4A 2NP3A 3VPRA 3COLA 2HQ5A 3PPBA 5FMPA 4ABZA 2ZCMA 2VPRA 1VI0A 1UI5A 3EGQA 2NS8A 3HTJA 4M3GA 3ON2A 4DW6A 2JJ7A 5K7ZA 5HAWA 5CXGA 4M3EA 3Q3SA 3AQTA 2XGDA 3BR0A 2I10A 3G1LA 5EZHA 5J3LA 2UXHA 1ZKGA 3ANPA 4I76A 2UXIA 5AQCA 1U9NA 5K58A 3LSPA 2HKUA 2UXPA 4D7NA 2ZCXA 3BHQA 3KKDA 4D5FA 3F1BA 3ZQLA 3BR3A 3NXCA 3T6NA 3KNWA 5C4YA 2TCTA 2OI8A 2X6OA 1UI6A 5J1RA 3BT9A 3CCYA 1QVTA 5D1RA 3HTHA 4M3DA 3VP5A 2FQ4A 4KWAA 2RASA 1JT0A 5F27A 1RPWA 2JK3A 3VUQA 4G12A 3BR1A 3IH4A 1QVUA 1T33A 3O8GA 2XDNA 3G1MA 4B1RA 2QCOA 3MVPA 5J1UA 5K7FA 1BJZA 3C07A 3VOXA 2OERA 5FKLA 3WHBA 4M3FA 4NN1A 3GEUA 3KZ9A 3WHCA 2D6YA 4JYKA 2Y31A 2RAEA 3KKCA 2XGEA 3BRUA 2UXUA 2ZCNA 1JTYA 2O7TA 4W1UA 5GPCA 3PM1A 3ZQFA 2QWTA 2VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBY A;  3FK6 A;  1JT6 A;  3IH3 A;  4AF5 A;  3HGY A;  5HBU A;  3G7R A;  5FGL A;  2Y2Z A;  3BTJ A;  2NX4 A;  5IOZ A;  1RKW A;  3LSJ A;  2OF7 A;  4YZE A;  2YVH A;  3FIW A;  2GUH A;  3NNR A;  3P9T A;  3LJL A;  3HIM A;  3DPJ A;  3BR5 A;  3QQA A;  1Z77 A;  2HXI A;  2G7G A;  4D7M A;  2XRL A;  4ACI A;  3PAS A;  5GPA A;  3CRJ A;  2X9D A;  4JNN A;  2ID3 A;  2NP5 A;  2F07 A;  2V57 A;  1JUM A;  3E7Q A;  5FHP A;  2PBX A;  4JKZ A;  1SGM A;  2HYT A;  5FKN A;  4W97 A;  1ZK8 A;  4I6Z A;  5EYR A;  5FKM A;  3BQZ A;  3VVY A;  2WGB A;  5IP6 A;  4D5C A;  4ICH A;  2TRT A;  3C2B A;  4AUX A;  4GCL A;  2FX0 A;  5J1Y A;  4MO7 A;  3BNI A;  2IBD A;  5K7H A;  5D19 A;  5HSZ A;  5H9T A;  3RH2 A;  4V2G A;  5EZG A;  2WUI A;  3RD3 A;  3VW0 A;  5IOY A;  2HXO A;  3QKX A;  4AC6 A;  2FJ1 A;  2G3B A;  3DCF A;  1Z0X A;  5F0H A;  4MK6 A;  4HKU A;  2W53 A;  3FK7 A;  3BJB A;  3HGG A;  5F04 A;  1ORK A;  2ZOY A;  3B6C A;  5GP9 A;  3BR6 A;  3S5R A;  3BTC A;  3CDL A;  3ANG A;  5DAJ A;  2ZB9 A;  3Q0U A;  4GFK A;  2XPV A;  3SFI A;  3Q0V A;  2Y30 A;  5CXI A;  3ZQH A;  2RHA A;  5F1J A;  2ZOZ A;  3BTL A;  3ZQI A;  3B81 A;  3NPI A;  2REK A;  2UXO A;  3HTA A;  3BQY A;  5CW8 A;  4CGR A;  3BR2 A;  3MNL A;  3LOC A;  3CWR A;  3NI7 A;  2QKO A;  3IUV A;  1A6I A;  3F0C A;  3CJD A;  4GFL A;  2FD5 A;  2PZ9 A;  2GFN A;  2QOP A;  2DG8 A;  2XGC A;  2HYJ A;  3FRQ A;  1QPI A;  4NEL A;  2IU5 A;  4UDS A;  3IH2 A;  3LSR A;  2O7O A;  3QPL A;  3ZQG A;  2NS7 A;  3O8H A;  1U9O A;  2G7L A;  5FKO A;  3VVZ A;  5F0C A;  4XK4 A;  2XPW A;  3LHQ A;  3TP3 A;  5F08 A;  4X1E A;  2YVE A;  4PXI A;  3VOK A;  3B6A A;  2XPU A;  2G7S A;  5FKK A;  4M3B A;  2DG7 A;  1JUP A;  2DTZ A;  4V2F A;  3O60 A;  3V78 A;  2IAI A;  3AQS A;  3HE0 A;  3JSJ A;  5F0F A;  2G0E A;  1RKT A;  4B3A A;  1JTX A;  3VW1 A;  2FBQ A;  3GZI A;  3Q0W A;  2WV1 A;  2QIB A;  2IEK A;  1T56 A;  2XB5 A;  3QBM A;  4AC0 A;  2OPT A;  4MXM A;  3QPS A;  3BCG A;  5D18 A;  1JUS A;  4ME9 A;  4L62 A;  3TP0 A;  2VKV A;  3NRG A;  3VIB A;  3LWJ A;  5IPA A;  4JL3 A;  3HTI A;  2Q24 A;  3VW2 A;  4GCT A;  3DEW A;  3G56 A;  2QTQ A;  3VVX A;  2ID6 A;  3BTI A;  3G1O A;  3SDG A;  5EFY A;  2EH3 A;  3EUP A;  2GEN A;  3V6G A;  4GCK A;  3ON4 A;  2NP3 A;  3VPR A;  3COL A;  2HQ5 A;  3PPB A;  5FMP A;  4ABZ A;  2ZCM A;  2VPR A;  1VI0 A;  1UI5 A;  3EGQ A;  2NS8 A;  3HTJ A;  4M3G A;  3ON2 A;  4DW6 A;  2JJ7 A;  5K7Z A;  5HAW A;  5CXG A;  4M3E A;  3Q3S A;  3AQT A;  2XGD A;  3BR0 A;  2I10 A;  3G1L A;  5EZH A;  5J3L A;  2UXH A;  1ZKG A;  3ANP A;  4I76 A;  2UXI A;  5AQC A;  1U9N A;  5K58 A;  3LSP A;  2HKU A;  2UXP A;  4D7N A;  2ZCX A;  3BHQ A;  3KKD A;  4D5F A;  3F1B A;  3ZQL A;  3BR3 A;  3NXC A;  3T6N A;  3KNW A;  5C4Y A;  2TCT A;  2OI8 A;  2X6O A;  1UI6 A;  5J1R A;  3BT9 A;  3CCY A;  1QVT A;  5D1R A;  3HTH A;  4M3D A;  3VP5 A;  2FQ4 A;  4KWA A;  2RAS A;  1JT0 A;  5F27 A;  1RPW A;  2JK3 A;  3VUQ A;  4G12 A;  3BR1 A;  3IH4 A;  1QVU A;  1T33 A;  3O8G A;  2XDN A;  3G1M A;  4B1R A;  2QCO A;  3MVP A;  5J1U A;  5K7F A;  1BJZ A;  3C07 A;  3VOX A;  2OER A;  5FKL A;  3WHB A;  4M3F A;  4NN1 A;  3GEU A;  3KZ9 A;  3WHC A;  2D6Y A;  4JYK A;  2Y31 A;  2RAE A;  3KKC A;  2XGE A;  3BRU A;  2UXU A;  2ZCN A;  1JTY A;  2O7T A;  4W1U A;  5GPC A;  3PM1 A;  3ZQF A;  2QWT A;  2VKE A; 
#chains in the Genus database with same CATH topology
 2GBY A;  3FK6 A;  1JT6 A;  3IH3 A;  4AF5 A;  3HGY A;  5HBU A;  3G7R A;  5FGL A;  2Y2Z A;  3BTJ A;  2NX4 A;  5IOZ A;  1RKW A;  3LSJ A;  2OF7 A;  4YZE A;  3SWH A;  2YVH A;  3FIW A;  2GUH A;  3NNR A;  2R7U A;  3P9T A;  3LJL A;  3HIM A;  3DPJ A;  3BR5 A;  3QQA A;  1Z77 A;  2HXI A;  2G7G A;  4D7M A;  2XRL A;  4ACI A;  3PAS A;  5GPA A;  3CRJ A;  2X9D A;  4JNN A;  2ID3 A;  2NP5 A;  2F07 A;  2V57 A;  1JUM A;  3E7Q A;  5FHP A;  2PBX A;  4JKZ A;  1SGM A;  2HYT A;  5FKN A;  4W97 A;  1ZK8 A;  4I6Z A;  5EYR A;  4IRV A;  5FKM A;  3BQZ A;  3VVY A;  2WGB A;  5IP6 A;  4D5C A;  4ICH A;  2TRT A;  3C2B A;  4AUX A;  4GCL A;  2FX0 A;  5J1Y A;  4MO7 A;  3BNI A;  2IBD A;  5K7H A;  5D19 A;  5HSZ A;  5H9T A;  3RH2 A;  4V2G A;  5EZG A;  2WUI A;  3RD3 A;  3VW0 A;  5IOY A;  2HXO A;  3QKX A;  4AC6 A;  2FJ1 A;  2G3B A;  3DCF A;  1Z0X A;  5F0H A;  4MK6 A;  2R7W A;  4HKU A;  2W53 A;  3FK7 A;  3BJB A;  3HGG A;  5F04 A;  1ORK A;  2ZOY A;  3B6C A;  5GP9 A;  3BR6 A;  2ZY9 A;  3S5R A;  3DU6 A;  3DU5 A;  3BTC A;  3CDL A;  3ANG A;  5DAJ A;  2ZB9 A;  3Q0U A;  4GFK A;  2XPV A;  3SFI A;  3Q0V A;  2Y30 A;  4U9N A;  4C2M A;  5CXI A;  2R7O A;  3ZQH A;  2RHA A;  5F1J A;  2ZOZ A;  3VTI A;  3BTL A;  2R7V A;  3ZQI A;  3B81 A;  3NPI A;  2REK A;  2UXO A;  3HTA A;  2R7X A;  3BQY A;  5CW8 A;  4CGR A;  3BR2 A;  3MNL A;  3LOC A;  3CWR A;  3NI7 A;  2YVX A;  4WIB A;  2QKO A;  3IUV A;  1A6I A;  3F0C A;  3CJD A;  4GFL A;  2FD5 A;  2PZ9 A;  2GFN A;  2QOP A;  2DG8 A;  2XGC A;  2R7T A;  2HYJ A;  3FRQ A;  1QPI A;  4NEL A;  2IU5 A;  4UDS A;  3IH2 A;  3LSR A;  2O7O A;  3QPL A;  3ZQG A;  2NS7 A;  3O8H A;  1U9O A;  2G7L A;  5FKO A;  3VVZ A;  5F0C A;  4XK4 A;  2XPW A;  3LHQ A;  3TP3 A;  5F08 A;  2R7R A;  4OD5 A;  2YVE A;  4X1E A;  4PXI A;  3VOK A;  3B6A A;  2B1E A;  2G7S A;  2XPU A;  5CQG A;  5FKK A;  4M3B A;  2DG7 A;  1JUP A;  2DTZ A;  4V2F A;  3O60 A;  3V78 A;  2IAI A;  3AQS A;  3HE0 A;  3JSJ A;  4U9L A;  5F0F A;  2G0E A;  1RKT A;  4B3A A;  1JTX A;  3VW1 A;  2FBQ A;  3GZI A;  3Q0W A;  2R7S A;  2WV1 A;  2QIB A;  3FHN A;  2IEK A;  1T56 A;  2XB5 A;  3QBM A;  4AC0 A;  2OPT A;  4MXM A;  3QPS A;  3BCG A;  5D18 A;  1JUS A;  4ME9 A;  4L62 A;  3TP0 A;  2VKV A;  3NRG A;  3VIB A;  3LWJ A;  5IPA A;  4JL3 A;  2B3W A;  2R7Q A;  3HTI A;  2Q24 A;  3VW2 A;  4GCT A;  3DEW A;  3G56 A;  2QTQ A;  3VVX A;  2ID6 A;  3BTI A;  3G1O A;  3SDG A;  5EFY A;  3KYL A;  2EH3 A;  3EUP A;  2GEN A;  3V6G A;  4GCK A;  4OD4 A;  3ON4 A;  2NP3 A;  3VPR A;  3COL A;  2HQ5 A;  3PPB A;  5FMP A;  4ABZ A;  2ZCM A;  2VPR A;  1VI0 A;  1UI5 A;  3EGQ A;  2NS8 A;  3HTJ A;  4M3G A;  3ON2 A;  4DW6 A;  2JJ7 A;  5K7Z A;  5HAW A;  5CXG A;  4M3E A;  3Q3S A;  3AQT A;  2XGD A;  3BR0 A;  2I10 A;  3G1L A;  5EZH A;  5J3L A;  2UXH A;  1ZKG A;  3ANP A;  4I76 A;  2UXI A;  5AQC A;  1U9N A;  5K58 A;  3K8P C;  3LSP A;  2HKU A;  2UXP A;  4D7N A;  2ZCX A;  3BHQ A;  3KKD A;  4D5F A;  2FJI 1;  3F1B A;  2PFV A;  3ZQL A;  3BR3 A;  3NXC A;  3T6N A;  3KNW A;  5C4Y A;  2TCT A;  2OI8 A;  2X6O A;  1UI6 A;  5J1R A;  3BT9 A;  2A2F X;  3CCY A;  1QVT A;  5D1R A;  3HTH A;  4M3D A;  3VP5 A;  2FQ4 A;  4KWA A;  2RAS A;  1JT0 A;  5F27 A;  1RPW A;  2JK3 A;  3VUQ A;  4G12 A;  3BR1 A;  3IH4 A;  1QVU A;  1T33 A;  3O8G A;  2XDN A;  3G1M A;  4B1R A;  2QCO A;  4DVY P;  3MVP A;  5J1U A;  5K7F A;  1BJZ A;  3C07 A;  3VOX A;  2OER A;  5FKL A;  3WHB A;  4M3F A;  4NN1 A;  3GEU A;  3NS4 A;  3KZ9 A;  3WHC A;  2D6Y A;  4JYK A;  2Y31 A;  2RAE A;  3KKC A;  2XGE A;  3BRU A;  2UXU A;  2ZCN A;  1JTY A;  2O7T A;  4W1U A;  5GPC A;  3PM1 A;  3ZQF A;  2QWT A;  2VKE A; 
#chains in the Genus database with same CATH homology
 2GBY A;  3FK6 A;  1JT6 A;  3IH3 A;  4AF5 A;  3HGY A;  5HBU A;  3G7R A;  5FGL A;  2Y2Z A;  3BTJ A;  2NX4 A;  5IOZ A;  1RKW A;  3LSJ A;  2OF7 A;  4YZE A;  2YVH A;  3FIW A;  2GUH A;  3NNR A;  3P9T A;  3LJL A;  3HIM A;  3DPJ A;  3BR5 A;  3QQA A;  1Z77 A;  2HXI A;  2G7G A;  4D7M A;  2XRL A;  4ACI A;  3PAS A;  5GPA A;  3CRJ A;  2X9D A;  4JNN A;  2ID3 A;  2NP5 A;  2F07 A;  2V57 A;  1JUM A;  3E7Q A;  5FHP A;  2PBX A;  4JKZ A;  1SGM A;  2HYT A;  5FKN A;  4W97 A;  1ZK8 A;  4I6Z A;  5EYR A;  5FKM A;  3BQZ A;  3VVY A;  2WGB A;  5IP6 A;  4D5C A;  4ICH A;  2TRT A;  3C2B A;  4AUX A;  4GCL A;  2FX0 A;  5J1Y A;  4MO7 A;  3BNI A;  2IBD A;  5K7H A;  5D19 A;  5HSZ A;  5H9T A;  3RH2 A;  4V2G A;  5EZG A;  2WUI A;  3RD3 A;  3VW0 A;  5IOY A;  2HXO A;  3QKX A;  4AC6 A;  2FJ1 A;  2G3B A;  3DCF A;  1Z0X A;  5F0H A;  4MK6 A;  4HKU A;  2W53 A;  3FK7 A;  3BJB A;  3HGG A;  5F04 A;  1ORK A;  2ZOY A;  3B6C A;  5GP9 A;  3BR6 A;  3S5R A;  3BTC A;  3CDL A;  3ANG A;  5DAJ A;  2ZB9 A;  3Q0U A;  4GFK A;  2XPV A;  3SFI A;  3Q0V A;  2Y30 A;  5CXI A;  3ZQH A;  2RHA A;  5F1J A;  2ZOZ A;  3BTL A;  3ZQI A;  3B81 A;  3NPI A;  2REK A;  2UXO A;  3HTA A;  3BQY A;  5CW8 A;  4CGR A;  3BR2 A;  3MNL A;  3LOC A;  3CWR A;  3NI7 A;  2QKO A;  3IUV A;  1A6I A;  3F0C A;  3CJD A;  4GFL A;  2FD5 A;  2PZ9 A;  2GFN A;  2QOP A;  2DG8 A;  2XGC A;  2HYJ A;  3FRQ A;  1QPI A;  4NEL A;  2IU5 A;  4UDS A;  3IH2 A;  3LSR A;  2O7O A;  3QPL A;  3ZQG A;  2NS7 A;  3O8H A;  1U9O A;  2G7L A;  5FKO A;  3VVZ A;  5F0C A;  4XK4 A;  2XPW A;  3LHQ A;  3TP3 A;  5F08 A;  4X1E A;  2YVE A;  4PXI A;  3VOK A;  3B6A A;  2XPU A;  2G7S A;  5FKK A;  4M3B A;  2DG7 A;  1JUP A;  2DTZ A;  4V2F A;  3O60 A;  3V78 A;  2IAI A;  3AQS A;  3HE0 A;  3JSJ A;  5F0F A;  2G0E A;  1RKT A;  4B3A A;  1JTX A;  3VW1 A;  2FBQ A;  3GZI A;  3Q0W A;  2WV1 A;  2QIB A;  2IEK A;  1T56 A;  2XB5 A;  3QBM A;  4AC0 A;  2OPT A;  4MXM A;  3QPS A;  3BCG A;  5D18 A;  1JUS A;  4ME9 A;  4L62 A;  3TP0 A;  2VKV A;  3NRG A;  3VIB A;  3LWJ A;  5IPA A;  4JL3 A;  3HTI A;  2Q24 A;  3VW2 A;  4GCT A;  3DEW A;  3G56 A;  2QTQ A;  3VVX A;  2ID6 A;  3BTI A;  3G1O A;  3SDG A;  5EFY A;  2EH3 A;  3EUP A;  2GEN A;  3V6G A;  4GCK A;  3ON4 A;  2NP3 A;  3VPR A;  3COL A;  2HQ5 A;  3PPB A;  5FMP A;  4ABZ A;  2ZCM A;  2VPR A;  1VI0 A;  1UI5 A;  3EGQ A;  2NS8 A;  3HTJ A;  4M3G A;  3ON2 A;  4DW6 A;  2JJ7 A;  5K7Z A;  5HAW A;  5CXG A;  4M3E A;  3Q3S A;  3AQT A;  2XGD A;  3BR0 A;  2I10 A;  3G1L A;  5EZH A;  5J3L A;  2UXH A;  1ZKG A;  3ANP A;  4I76 A;  2UXI A;  5AQC A;  1U9N A;  5K58 A;  3LSP A;  2HKU A;  2UXP A;  4D7N A;  2ZCX A;  3BHQ A;  3KKD A;  4D5F A;  3F1B A;  3ZQL A;  3BR3 A;  3NXC A;  3T6N A;  3KNW A;  5C4Y A;  2TCT A;  2OI8 A;  2X6O A;  1UI6 A;  5J1R A;  3BT9 A;  3CCY A;  1QVT A;  5D1R A;  3HTH A;  4M3D A;  3VP5 A;  2FQ4 A;  4KWA A;  2RAS A;  1JT0 A;  5F27 A;  1RPW A;  2JK3 A;  3VUQ A;  4G12 A;  3BR1 A;  3IH4 A;  1QVU A;  1T33 A;  3O8G A;  2XDN A;  3G1M A;  4B1R A;  2QCO A;  3MVP A;  5J1U A;  5K7F A;  1BJZ A;  3C07 A;  3VOX A;  2OER A;  5FKL A;  3WHB A;  4M3F A;  4NN1 A;  3GEU A;  3KZ9 A;  3WHC A;  2D6Y A;  4JYK A;  2Y31 A;  2RAE A;  3KKC A;  2XGE A;  3BRU A;  2UXU A;  2ZCN A;  1JTY A;  2O7T A;  4W1U A;  5GPC A;  3PM1 A;  3ZQF A;  2QWT A;  2VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...