3GZIA

Crystal structure of a transcriptional regulator of the tetr family (shew_3567) from shewanella loihica pv-4 at 2.05 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
203
Chain Sequence
VGRPSGDTQNRDKLILAARNLFIERPYAQVSIREIASLAGTDPGLIRYYFGSKEKLFSTMIHETAMPVLAQLHKARRETRQESPAALLQTYYSVMSKHPHFPRLMLRIAGLDQSLPENAEVTKAFYEVVNFENIAIFQRLKDKNLLKDDVDAHCAQLSFFAMMVFPFIVPENLLERVGIELTPDFLQLLAEQNTRLLQRGLMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of TETR family transcriptional regulator (YP_001095692.1) from SHEWANELLA SP. PV-4 at 2.05 A resolution
rcsb
source organism Shewanella loihica pv-4
total genus 65
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3gziA00
3KKDA 3HTJA 3BQYA 4AC6A 3BTCA 2QCOA 1RKTA 3ZQHA 5CW8A 4AC0A 5F04A 3VW1A 5AQCA 1RKWA 3COLA 4JL3A 5GP9A 2Q24A 3HTHA 3S5RA 2FQ4A 2XGEA 2DG7A 3GEUA 2ZCNA 2XPUA 3GZIA 5IP6A 3FRQA 2IU5A 4X1EA 3HTAA 2XPVA 3RD3A 3QBMA 4V2FA 2QWTA 3BR5A 1QVTA 2V57A 2I10A 5J1RA 3LWJA 5F0HA 3IH4A 1ORKA 2REKA 2ZCMA 2O7OA 3C2BA 2OF7A 2HYJA 1JUPA 2FX0A 5EZHA 2X6OA 2RAEA 5J1UA 2G0EA 2NS7A 3KKCA 2VPRA 2XGDA 5K7HA 4D7MA 5CXGA 2RASA 2G7LA 3BTIA 3NXCA 2IAIA 1ZKGA 2YVEA 2QTQA 3ON4A 3Q0WA 4JYKA 1JUMA 3LSRA 2UXUA 3CWRA 3G1LA 5FHPA 3CDLA 3O8GA 3QPLA 4W97A 3HE0A 4D5CA 3BT9A 5K7FA 1U9NA 4W1UA 2Y2ZA 4B1RA 1QVUA 2OI8A 2G7SA 5FKKA 3VUQA 5D1RA 2EH3A 5J3LA 4HKUA 3P9TA 5F08A 4MO7A 2G3BA 3VVYA 3V6GA 3BR3A 5F1JA 2ZOZA 5F27A 2G7GA 3CJDA 3AQTA 1RPWA 3JSJA 4M3FA 4YZEA 2XPWA 1JUSA 3FIWA 3E7QA 4KWAA 3VIBA 5CXIA 3CRJA 3VW2A 2HXIA 1JTYA 2Y31A 3ZQLA 4ACIA 4MK6A 3DEWA 2HXOA 1Z77A 3BR2A 2DG8A 3VVXA 2NP3A 4B3AA 5J1YA 3HGYA 3BR6A 3PASA 3G1MA 2HQ5A 2TRTA 2QKOA 1A6IA 3VP5A 3G1OA 4GFKA 2YVHA 2UXHA 1U9OA 2ZB9A 5K58A 3BTJA 3EGQA 3SDGA 2NP5A 4GFLA 3KNWA 1QPIA 3SFIA 3B81A 1BJZA 5IOYA 2W53A 3WHCA 5GPAA 5H9TA 5HAWA 4ME9A 2UXOA 3NRGA 2XB5A 3HIMA 3PPBA 3NI7A 2D6YA 4ABZA 5FMPA 2WGBA 4L62A 2DTZA 2Y30A 2PBXA 2OPTA 4M3BA 3HGGA 2GFNA 3PM1A 2X9DA 3MVPA 1UI6A 5FKNA 2XDNA 5FKMA 3F0CA 3RH2A 3AQSA 4JNNA 2WUIA 3C07A 4D5FA 2O7TA 2IBDA 2RHAA 3ZQGA 2JK3A 3BR1A 3ZQIA 3FK6A 4AUXA 4D7NA 3BQZA 3ANGA 5EFYA 4M3GA 3T6NA 2HYTA 3LJLA 2F07A 1T56A 2GBYA 3QKXA 3IH2A 4DW6A 3QQAA 2ZOYA 3IUVA 4MXMA 3O60A 2QIBA 3BCGA 3VPRA 3WHBA 2GUHA 2FBQA 5F0CA 4GCKA 2FD5A 3LSPA 2PZ9A 3DPJA 5F0FA 5FKLA 3BTLA 3NNRA 3B6CA 3ON2A 3VVZA 5HSZA 2ID6A 4M3EA 4UDSA 3LHQA 1JTXA 5IOZA 5GPCA 3CCYA 2QOPA 5K7ZA 2VKVA 3LSJA 3TP0A 5HBUA 3FK7A 3BNIA 5EYRA 3F1BA 3Q3SA 5D18A 2UXPA 1JT6A 4CGRA 2TCTA 1SGMA 2ID3A 1VI0A 3QPSA 4NN1A 3Q0UA 3HTIA 2OERA 2JJ7A 2NS8A 4G12A 4NELA 3VOKA 4I76A 2GENA 2HKUA 4JKZA 5D19A 4PXIA 3DCFA 2WV1A 4AF5A 3KZ9A 3BHQA 5FGLA 1JT0A 2IEKA 1Z0XA 4V2GA 5IPAA 3Q0VA 4M3DA 4ICHA 3EUPA 3G56A 3IH3A 2XRLA 3VOXA 3BJBA 4I6ZA 3G7RA 4GCLA 3MNLA 3BR0A 2UXIA 3NPIA 3B6AA 2NX4A 3BRUA 2FJ1A 3ANPA 3TP3A 3LOCA 1UI5A 5DAJA 1ZK8A 3ZQFA 4GCTA 4XK4A 2XGCA 3O8HA 3V78A 2ZCXA 5C4YA 3VW0A 1T33A 2VKEA 5FKOA 5EZGA
chains in the Genus database with same CATH superfamily
3KKDA 3HTJA 2R7XA 3BQYA 4AC6A 3BTCA 2QCOA 1RKTA 3ZQHA 5CW8A 4AC0A 3FHNA 5F04A 3VW1A 5AQCA 1RKWA 3COLA 4JL3A 5GP9A 2Q24A 3HTHA 3S5RA 2FQ4A 2XGEA 2DG7A 3GEUA 2ZCNA 2XPUA 2B1EA 3GZIA 5IP6A 3FRQA 2IU5A 2R7TA 4X1EA 3HTAA 4WIBA 2XPVA 3RD3A 3QBMA 4V2FA 2QWTA 3BR5A 1QVTA 2V57A 2I10A 5J1RA 3LWJA 5F0HA 2R7SA 3IH4A 1ORKA 2REKA 2ZCMA 2O7OA 2PFVA 3C2BA 2OF7A 2HYJA 1JUPA 2FX0A 5EZHA 2X6OA 2RAEA 5J1UA 2G0EA 2NS7A 3KKCA 4DVYP 2VPRA 2XGDA 5K7HA 4D7MA 5CXGA 2RASA 2G7LA 3BTIA 3NXCA 2IAIA 1ZKGA 2YVEA 2QTQA 3ON4A 3Q0WA 4JYKA 1JUMA 3LSRA 2UXUA 3CWRA 3G1LA 5FHPA 3CDLA 3O8GA 3QPLA 4W97A 3HE0A 4D5CA 3BT9A 5K7FA 1U9NA 4W1UA 2Y2ZA 4B1RA 1QVUA 3SWHA 2OI8A 2G7SA 5FKKA 3VUQA 5D1RA 3DU5A 2EH3A 5J3LA 4HKUA 3P9TA 5F08A 4MO7A 2G3BA 3VVYA 3V6GA 3BR3A 5F1JA 2ZOZA 5F27A 2G7GA 3CJDA 3AQTA 1RPWA 3JSJA 4U9LA 4M3FA 4YZEA 2XPWA 1JUSA 3FIWA 3E7QA 4KWAA 3VIBA 2R7RA 5CXIA 3CRJA 3VW2A 2HXIA 1JTYA 2Y31A 3ZQLA 2R7OA 4MK6A 4ACIA 3DEWA 2HXOA 2ZY9A 1Z77A 3BR2A 2A2FX 2DG8A 4OD5A 3VVXA 2FJI1 2NP3A 4B3AA 5J1YA 3HGYA 3BR6A 3PASA 3G1MA 2HQ5A 2TRTA 2QKOA 1A6IA 3VP5A 3G1OA 4GFKA 2YVHA 2UXHA 1U9OA 2ZB9A 5K58A 3BTJA 3EGQA 3SDGA 2NP5A 4GFLA 3KNWA 1QPIA 3SFIA 3B81A 3K8PC 1BJZA 5IOYA 2W53A 3WHCA 5GPAA 5H9TA 5HAWA 2R7WA 4ME9A 2UXOA 3NRGA 2XB5A 3HIMA 3PPBA 3NI7A 2D6YA 4ABZA 5FMPA 3DU6A 2WGBA 4L62A 2DTZA 2Y30A 2PBXA 2OPTA 4M3BA 3HGGA 3NS4A 2GFNA 3PM1A 2X9DA 3MVPA 1UI6A 5FKNA 2XDNA 5FKMA 2B3WA 3F0CA 3RH2A 3AQSA 4JNNA 2WUIA 3C07A 4D5FA 3VTIA 2O7TA 2IBDA 2RHAA 3ZQGA 2JK3A 3BR1A 3ZQIA 3FK6A 4AUXA 4D7NA 3BQZA 3ANGA 5EFYA 4M3GA 3T6NA 2HYTA 3LJLA 2F07A 1T56A 2GBYA 3QKXA 3IH2A 4IRVA 4DW6A 3QQAA 2ZOYA 3IUVA 4MXMA 3O60A 2R7QA 2QIBA 3BCGA 3VPRA 3WHBA 2R7VA 2R7UA 2GUHA 2FBQA 5F0CA 4GCKA 2FD5A 3LSPA 2PZ9A 3DPJA 5F0FA 5FKLA 3BTLA 3NNRA 3B6CA 3ON2A 3VVZA 5HSZA 2ID6A 4M3EA 4UDSA 3LHQA 1JTXA 5IOZA 4OD4A 5GPCA 3CCYA 2QOPA 5K7ZA 2VKVA 3LSJA 3TP0A 5HBUA 3FK7A 3BNIA 5EYRA 3F1BA 3Q3SA 5D18A 2UXPA 1JT6A 4CGRA 2TCTA 1SGMA 2ID3A 1VI0A 3QPSA 4NN1A 3Q0UA 3HTIA 2OERA 2JJ7A 2NS8A 4G12A 4NELA 3VOKA 4U9NA 4I76A 3KYLA 2GENA 2HKUA 4JKZA 5D19A 4PXIA 3DCFA 2WV1A 4AF5A 3KZ9A 3BHQA 5FGLA 1JT0A 2IEKA 1Z0XA 4V2GA 5IPAA 3Q0VA 4M3DA 4ICHA 3EUPA 3G56A 3IH3A 2XRLA 3VOXA 4C2MA 3BJBA 4I6ZA 3G7RA 4GCLA 3MNLA 3BR0A 2UXIA 3NPIA 3B6AA 2NX4A 2YVXA 3BRUA 2FJ1A 3ANPA 3TP3A 3LOCA 5CQGA 1UI5A 5DAJA 1ZK8A 3ZQFA 4GCTA 4XK4A 2XGCA 3O8HA 3V78A 2ZCXA 5C4YA 3VW0A 1T33A 2VKEA 5FKOA 5EZGA
chains in the Genus database with same CATH topology
3KKDA 3HTJA 3BQYA 4AC6A 3BTCA 2QCOA 1RKTA 3ZQHA 5CW8A 4AC0A 5F04A 3VW1A 5AQCA 1RKWA 3COLA 4JL3A 5GP9A 2Q24A 3HTHA 3S5RA 2FQ4A 2XGEA 2DG7A 3GEUA 2ZCNA 2XPUA 3GZIA 5IP6A 3FRQA 2IU5A 4X1EA 3HTAA 2XPVA 3RD3A 3QBMA 4V2FA 2QWTA 3BR5A 1QVTA 2V57A 2I10A 5J1RA 3LWJA 5F0HA 3IH4A 1ORKA 2REKA 2ZCMA 2O7OA 3C2BA 2OF7A 2HYJA 1JUPA 2FX0A 5EZHA 2X6OA 2RAEA 5J1UA 2G0EA 2NS7A 3KKCA 2VPRA 2XGDA 5K7HA 4D7MA 5CXGA 2RASA 2G7LA 3BTIA 3NXCA 2IAIA 1ZKGA 2YVEA 2QTQA 3ON4A 3Q0WA 4JYKA 1JUMA 3LSRA 2UXUA 3CWRA 3G1LA 5FHPA 3CDLA 3O8GA 3QPLA 4W97A 3HE0A 4D5CA 3BT9A 5K7FA 1U9NA 4W1UA 2Y2ZA 4B1RA 1QVUA 2OI8A 2G7SA 5FKKA 3VUQA 5D1RA 2EH3A 5J3LA 4HKUA 3P9TA 5F08A 4MO7A 2G3BA 3VVYA 3V6GA 3BR3A 5F1JA 2ZOZA 5F27A 2G7GA 3CJDA 3AQTA 1RPWA 3JSJA 4M3FA 4YZEA 2XPWA 1JUSA 3FIWA 3E7QA 4KWAA 3VIBA 5CXIA 3CRJA 3VW2A 2HXIA 1JTYA 2Y31A 3ZQLA 4ACIA 4MK6A 3DEWA 2HXOA 1Z77A 3BR2A 2DG8A 3VVXA 2NP3A 4B3AA 5J1YA 3HGYA 3BR6A 3PASA 3G1MA 2HQ5A 2TRTA 2QKOA 1A6IA 3VP5A 3G1OA 4GFKA 2YVHA 2UXHA 1U9OA 2ZB9A 5K58A 3BTJA 3EGQA 3SDGA 2NP5A 4GFLA 3KNWA 1QPIA 3SFIA 3B81A 1BJZA 5IOYA 2W53A 3WHCA 5GPAA 5H9TA 5HAWA 4ME9A 2UXOA 3NRGA 2XB5A 3HIMA 3PPBA 3NI7A 2D6YA 4ABZA 5FMPA 2WGBA 4L62A 2DTZA 2Y30A 2PBXA 2OPTA 4M3BA 3HGGA 2GFNA 3PM1A 2X9DA 3MVPA 1UI6A 5FKNA 2XDNA 5FKMA 3F0CA 3RH2A 3AQSA 4JNNA 2WUIA 3C07A 4D5FA 2O7TA 2IBDA 2RHAA 3ZQGA 2JK3A 3BR1A 3ZQIA 3FK6A 4AUXA 4D7NA 3BQZA 3ANGA 5EFYA 4M3GA 3T6NA 2HYTA 3LJLA 2F07A 1T56A 2GBYA 3QKXA 3IH2A 4DW6A 3QQAA 2ZOYA 3IUVA 4MXMA 3O60A 2QIBA 3BCGA 3VPRA 3WHBA 2GUHA 2FBQA 5F0CA 4GCKA 2FD5A 3LSPA 2PZ9A 3DPJA 5F0FA 5FKLA 3BTLA 3NNRA 3B6CA 3ON2A 3VVZA 5HSZA 2ID6A 4M3EA 4UDSA 3LHQA 1JTXA 5IOZA 5GPCA 3CCYA 2QOPA 5K7ZA 2VKVA 3LSJA 3TP0A 5HBUA 3FK7A 3BNIA 5EYRA 3F1BA 3Q3SA 5D18A 2UXPA 1JT6A 4CGRA 2TCTA 1SGMA 2ID3A 1VI0A 3QPSA 4NN1A 3Q0UA 3HTIA 2OERA 2JJ7A 2NS8A 4G12A 4NELA 3VOKA 4I76A 2GENA 2HKUA 4JKZA 5D19A 4PXIA 3DCFA 2WV1A 4AF5A 3KZ9A 3BHQA 5FGLA 1JT0A 2IEKA 1Z0XA 4V2GA 5IPAA 3Q0VA 4M3DA 4ICHA 3EUPA 3G56A 3IH3A 2XRLA 3VOXA 3BJBA 4I6ZA 3G7RA 4GCLA 3MNLA 3BR0A 2UXIA 3NPIA 3B6AA 2NX4A 3BRUA 2FJ1A 3ANPA 3TP3A 3LOCA 1UI5A 5DAJA 1ZK8A 3ZQFA 4GCTA 4XK4A 2XGCA 3O8HA 3V78A 2ZCXA 5C4YA 3VW0A 1T33A 2VKEA 5FKOA 5EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKD A;  3HTJ A;  3BQY A;  4AC6 A;  3BTC A;  2QCO A;  1RKT A;  3ZQH A;  5CW8 A;  4AC0 A;  5F04 A;  3VW1 A;  5AQC A;  1RKW A;  3COL A;  4JL3 A;  5GP9 A;  2Q24 A;  3HTH A;  3S5R A;  2FQ4 A;  2XGE A;  2DG7 A;  3GEU A;  2ZCN A;  2XPU A;  3GZI A;  5IP6 A;  3FRQ A;  2IU5 A;  4X1E A;  3HTA A;  2XPV A;  3RD3 A;  3QBM A;  4V2F A;  2QWT A;  3BR5 A;  1QVT A;  2V57 A;  2I10 A;  5J1R A;  3LWJ A;  5F0H A;  3IH4 A;  1ORK A;  2REK A;  2ZCM A;  2O7O A;  3C2B A;  2OF7 A;  2HYJ A;  1JUP A;  2FX0 A;  5EZH A;  2X6O A;  2RAE A;  5J1U A;  2G0E A;  2NS7 A;  3KKC A;  2VPR A;  2XGD A;  5K7H A;  4D7M A;  5CXG A;  2RAS A;  2G7L A;  3BTI A;  3NXC A;  2IAI A;  1ZKG A;  2YVE A;  2QTQ A;  3ON4 A;  3Q0W A;  4JYK A;  1JUM A;  3LSR A;  2UXU A;  3CWR A;  3G1L A;  5FHP A;  3CDL A;  3O8G A;  3QPL A;  4W97 A;  3HE0 A;  4D5C A;  3BT9 A;  5K7F A;  1U9N A;  4W1U A;  2Y2Z A;  4B1R A;  1QVU A;  2OI8 A;  2G7S A;  5FKK A;  3VUQ A;  5D1R A;  2EH3 A;  5J3L A;  4HKU A;  3P9T A;  5F08 A;  4MO7 A;  2G3B A;  3VVY A;  3V6G A;  3BR3 A;  5F1J A;  2ZOZ A;  5F27 A;  2G7G A;  3CJD A;  3AQT A;  1RPW A;  3JSJ A;  4M3F A;  4YZE A;  2XPW A;  1JUS A;  3FIW A;  3E7Q A;  4KWA A;  3VIB A;  5CXI A;  3CRJ A;  3VW2 A;  2HXI A;  1JTY A;  2Y31 A;  3ZQL A;  4ACI A;  4MK6 A;  3DEW A;  2HXO A;  1Z77 A;  3BR2 A;  2DG8 A;  3VVX A;  2NP3 A;  4B3A A;  5J1Y A;  3HGY A;  3BR6 A;  3PAS A;  3G1M A;  2HQ5 A;  2TRT A;  2QKO A;  1A6I A;  3VP5 A;  3G1O A;  4GFK A;  2YVH A;  2UXH A;  1U9O A;  2ZB9 A;  5K58 A;  3BTJ A;  3EGQ A;  3SDG A;  2NP5 A;  4GFL A;  3KNW A;  1QPI A;  3SFI A;  3B81 A;  1BJZ A;  5IOY A;  2W53 A;  3WHC A;  5GPA A;  5H9T A;  5HAW A;  4ME9 A;  2UXO A;  3NRG A;  2XB5 A;  3HIM A;  3PPB A;  3NI7 A;  2D6Y A;  4ABZ A;  5FMP A;  2WGB A;  4L62 A;  2DTZ A;  2Y30 A;  2PBX A;  2OPT A;  4M3B A;  3HGG A;  2GFN A;  3PM1 A;  2X9D A;  3MVP A;  1UI6 A;  5FKN A;  2XDN A;  5FKM A;  3F0C A;  3RH2 A;  3AQS A;  4JNN A;  2WUI A;  3C07 A;  4D5F A;  2O7T A;  2IBD A;  2RHA A;  3ZQG A;  2JK3 A;  3BR1 A;  3ZQI A;  3FK6 A;  4AUX A;  4D7N A;  3BQZ A;  3ANG A;  5EFY A;  4M3G A;  3T6N A;  2HYT A;  3LJL A;  2F07 A;  1T56 A;  2GBY A;  3QKX A;  3IH2 A;  4DW6 A;  3QQA A;  2ZOY A;  3IUV A;  4MXM A;  3O60 A;  2QIB A;  3BCG A;  3VPR A;  3WHB A;  2GUH A;  2FBQ A;  5F0C A;  4GCK A;  2FD5 A;  3LSP A;  2PZ9 A;  3DPJ A;  5F0F A;  5FKL A;  3BTL A;  3NNR A;  3B6C A;  3ON2 A;  3VVZ A;  5HSZ A;  2ID6 A;  4M3E A;  4UDS A;  3LHQ A;  1JTX A;  5IOZ A;  5GPC A;  3CCY A;  2QOP A;  5K7Z A;  2VKV A;  3LSJ A;  3TP0 A;  5HBU A;  3FK7 A;  3BNI A;  5EYR A;  3F1B A;  3Q3S A;  5D18 A;  2UXP A;  1JT6 A;  4CGR A;  2TCT A;  1SGM A;  2ID3 A;  1VI0 A;  3QPS A;  4NN1 A;  3Q0U A;  3HTI A;  2OER A;  2JJ7 A;  2NS8 A;  4G12 A;  4NEL A;  3VOK A;  4I76 A;  2GEN A;  2HKU A;  4JKZ A;  5D19 A;  4PXI A;  3DCF A;  2WV1 A;  4AF5 A;  3KZ9 A;  3BHQ A;  5FGL A;  1JT0 A;  2IEK A;  1Z0X A;  4V2G A;  5IPA A;  3Q0V A;  4M3D A;  4ICH A;  3EUP A;  3G56 A;  3IH3 A;  2XRL A;  3VOX A;  3BJB A;  4I6Z A;  3G7R A;  4GCL A;  3MNL A;  3BR0 A;  2UXI A;  3NPI A;  3B6A A;  2NX4 A;  3BRU A;  2FJ1 A;  3ANP A;  3TP3 A;  3LOC A;  1UI5 A;  5DAJ A;  1ZK8 A;  3ZQF A;  4GCT A;  4XK4 A;  2XGC A;  3O8H A;  3V78 A;  2ZCX A;  5C4Y A;  3VW0 A;  1T33 A;  2VKE A;  5FKO A;  5EZG A; 
#chains in the Genus database with same CATH topology
 3KKD A;  3HTJ A;  2R7X A;  3BQY A;  4AC6 A;  3BTC A;  2QCO A;  1RKT A;  3ZQH A;  5CW8 A;  4AC0 A;  3FHN A;  5F04 A;  3VW1 A;  5AQC A;  1RKW A;  3COL A;  4JL3 A;  5GP9 A;  2Q24 A;  3HTH A;  3S5R A;  2FQ4 A;  2XGE A;  2DG7 A;  3GEU A;  2ZCN A;  2XPU A;  2B1E A;  3GZI A;  5IP6 A;  3FRQ A;  2IU5 A;  2R7T A;  4X1E A;  3HTA A;  4WIB A;  2XPV A;  3RD3 A;  3QBM A;  4V2F A;  2QWT A;  3BR5 A;  1QVT A;  2V57 A;  2I10 A;  5J1R A;  3LWJ A;  5F0H A;  2R7S A;  3IH4 A;  1ORK A;  2REK A;  2ZCM A;  2O7O A;  2PFV A;  3C2B A;  2OF7 A;  2HYJ A;  1JUP A;  2FX0 A;  5EZH A;  2X6O A;  2RAE A;  5J1U A;  2G0E A;  2NS7 A;  3KKC A;  4DVY P;  2VPR A;  2XGD A;  5K7H A;  4D7M A;  5CXG A;  2RAS A;  2G7L A;  3BTI A;  3NXC A;  2IAI A;  1ZKG A;  2YVE A;  2QTQ A;  3ON4 A;  3Q0W A;  4JYK A;  1JUM A;  3LSR A;  2UXU A;  3CWR A;  3G1L A;  5FHP A;  3CDL A;  3O8G A;  3QPL A;  4W97 A;  3HE0 A;  4D5C A;  3BT9 A;  5K7F A;  1U9N A;  4W1U A;  2Y2Z A;  4B1R A;  1QVU A;  3SWH A;  2OI8 A;  2G7S A;  5FKK A;  3VUQ A;  5D1R A;  3DU5 A;  2EH3 A;  5J3L A;  4HKU A;  3P9T A;  5F08 A;  4MO7 A;  2G3B A;  3VVY A;  3V6G A;  3BR3 A;  5F1J A;  2ZOZ A;  5F27 A;  2G7G A;  3CJD A;  3AQT A;  1RPW A;  3JSJ A;  4U9L A;  4M3F A;  4YZE A;  2XPW A;  1JUS A;  3FIW A;  3E7Q A;  4KWA A;  3VIB A;  2R7R A;  5CXI A;  3CRJ A;  3VW2 A;  2HXI A;  1JTY A;  2Y31 A;  3ZQL A;  2R7O A;  4MK6 A;  4ACI A;  3DEW A;  2HXO A;  2ZY9 A;  1Z77 A;  3BR2 A;  2A2F X;  2DG8 A;  4OD5 A;  3VVX A;  2FJI 1;  2NP3 A;  4B3A A;  5J1Y A;  3HGY A;  3BR6 A;  3PAS A;  3G1M A;  2HQ5 A;  2TRT A;  2QKO A;  1A6I A;  3VP5 A;  3G1O A;  4GFK A;  2YVH A;  2UXH A;  1U9O A;  2ZB9 A;  5K58 A;  3BTJ A;  3EGQ A;  3SDG A;  2NP5 A;  4GFL A;  3KNW A;  1QPI A;  3SFI A;  3B81 A;  3K8P C;  1BJZ A;  5IOY A;  2W53 A;  3WHC A;  5GPA A;  5H9T A;  5HAW A;  2R7W A;  4ME9 A;  2UXO A;  3NRG A;  2XB5 A;  3HIM A;  3PPB A;  3NI7 A;  2D6Y A;  4ABZ A;  5FMP A;  3DU6 A;  2WGB A;  4L62 A;  2DTZ A;  2Y30 A;  2PBX A;  2OPT A;  4M3B A;  3HGG A;  3NS4 A;  2GFN A;  3PM1 A;  2X9D A;  3MVP A;  1UI6 A;  5FKN A;  2XDN A;  5FKM A;  2B3W A;  3F0C A;  3RH2 A;  3AQS A;  4JNN A;  2WUI A;  3C07 A;  4D5F A;  3VTI A;  2O7T A;  2IBD A;  2RHA A;  3ZQG A;  2JK3 A;  3BR1 A;  3ZQI A;  3FK6 A;  4AUX A;  4D7N A;  3BQZ A;  3ANG A;  5EFY A;  4M3G A;  3T6N A;  2HYT A;  3LJL A;  2F07 A;  1T56 A;  2GBY A;  3QKX A;  3IH2 A;  4IRV A;  4DW6 A;  3QQA A;  2ZOY A;  3IUV A;  4MXM A;  3O60 A;  2R7Q A;  2QIB A;  3BCG A;  3VPR A;  3WHB A;  2R7V A;  2R7U A;  2GUH A;  2FBQ A;  5F0C A;  4GCK A;  2FD5 A;  3LSP A;  2PZ9 A;  3DPJ A;  5F0F A;  5FKL A;  3BTL A;  3NNR A;  3B6C A;  3ON2 A;  3VVZ A;  5HSZ A;  2ID6 A;  4M3E A;  4UDS A;  3LHQ A;  1JTX A;  5IOZ A;  4OD4 A;  5GPC A;  3CCY A;  2QOP A;  5K7Z A;  2VKV A;  3LSJ A;  3TP0 A;  5HBU A;  3FK7 A;  3BNI A;  5EYR A;  3F1B A;  3Q3S A;  5D18 A;  2UXP A;  1JT6 A;  4CGR A;  2TCT A;  1SGM A;  2ID3 A;  1VI0 A;  3QPS A;  4NN1 A;  3Q0U A;  3HTI A;  2OER A;  2JJ7 A;  2NS8 A;  4G12 A;  4NEL A;  3VOK A;  4U9N A;  4I76 A;  3KYL A;  2GEN A;  2HKU A;  4JKZ A;  5D19 A;  4PXI A;  3DCF A;  2WV1 A;  4AF5 A;  3KZ9 A;  3BHQ A;  5FGL A;  1JT0 A;  2IEK A;  1Z0X A;  4V2G A;  5IPA A;  3Q0V A;  4M3D A;  4ICH A;  3EUP A;  3G56 A;  3IH3 A;  2XRL A;  3VOX A;  4C2M A;  3BJB A;  4I6Z A;  3G7R A;  4GCL A;  3MNL A;  3BR0 A;  2UXI A;  3NPI A;  3B6A A;  2NX4 A;  2YVX A;  3BRU A;  2FJ1 A;  3ANP A;  3TP3 A;  3LOC A;  5CQG A;  1UI5 A;  5DAJ A;  1ZK8 A;  3ZQF A;  4GCT A;  4XK4 A;  2XGC A;  3O8H A;  3V78 A;  2ZCX A;  5C4Y A;  3VW0 A;  1T33 A;  2VKE A;  5FKO A;  5EZG A; 
#chains in the Genus database with same CATH homology
 3KKD A;  3HTJ A;  3BQY A;  4AC6 A;  3BTC A;  2QCO A;  1RKT A;  3ZQH A;  5CW8 A;  4AC0 A;  5F04 A;  3VW1 A;  5AQC A;  1RKW A;  3COL A;  4JL3 A;  5GP9 A;  2Q24 A;  3HTH A;  3S5R A;  2FQ4 A;  2XGE A;  2DG7 A;  3GEU A;  2ZCN A;  2XPU A;  3GZI A;  5IP6 A;  3FRQ A;  2IU5 A;  4X1E A;  3HTA A;  2XPV A;  3RD3 A;  3QBM A;  4V2F A;  2QWT A;  3BR5 A;  1QVT A;  2V57 A;  2I10 A;  5J1R A;  3LWJ A;  5F0H A;  3IH4 A;  1ORK A;  2REK A;  2ZCM A;  2O7O A;  3C2B A;  2OF7 A;  2HYJ A;  1JUP A;  2FX0 A;  5EZH A;  2X6O A;  2RAE A;  5J1U A;  2G0E A;  2NS7 A;  3KKC A;  2VPR A;  2XGD A;  5K7H A;  4D7M A;  5CXG A;  2RAS A;  2G7L A;  3BTI A;  3NXC A;  2IAI A;  1ZKG A;  2YVE A;  2QTQ A;  3ON4 A;  3Q0W A;  4JYK A;  1JUM A;  3LSR A;  2UXU A;  3CWR A;  3G1L A;  5FHP A;  3CDL A;  3O8G A;  3QPL A;  4W97 A;  3HE0 A;  4D5C A;  3BT9 A;  5K7F A;  1U9N A;  4W1U A;  2Y2Z A;  4B1R A;  1QVU A;  2OI8 A;  2G7S A;  5FKK A;  3VUQ A;  5D1R A;  2EH3 A;  5J3L A;  4HKU A;  3P9T A;  5F08 A;  4MO7 A;  2G3B A;  3VVY A;  3V6G A;  3BR3 A;  5F1J A;  2ZOZ A;  5F27 A;  2G7G A;  3CJD A;  3AQT A;  1RPW A;  3JSJ A;  4M3F A;  4YZE A;  2XPW A;  1JUS A;  3FIW A;  3E7Q A;  4KWA A;  3VIB A;  5CXI A;  3CRJ A;  3VW2 A;  2HXI A;  1JTY A;  2Y31 A;  3ZQL A;  4ACI A;  4MK6 A;  3DEW A;  2HXO A;  1Z77 A;  3BR2 A;  2DG8 A;  3VVX A;  2NP3 A;  4B3A A;  5J1Y A;  3HGY A;  3BR6 A;  3PAS A;  3G1M A;  2HQ5 A;  2TRT A;  2QKO A;  1A6I A;  3VP5 A;  3G1O A;  4GFK A;  2YVH A;  2UXH A;  1U9O A;  2ZB9 A;  5K58 A;  3BTJ A;  3EGQ A;  3SDG A;  2NP5 A;  4GFL A;  3KNW A;  1QPI A;  3SFI A;  3B81 A;  1BJZ A;  5IOY A;  2W53 A;  3WHC A;  5GPA A;  5H9T A;  5HAW A;  4ME9 A;  2UXO A;  3NRG A;  2XB5 A;  3HIM A;  3PPB A;  3NI7 A;  2D6Y A;  4ABZ A;  5FMP A;  2WGB A;  4L62 A;  2DTZ A;  2Y30 A;  2PBX A;  2OPT A;  4M3B A;  3HGG A;  2GFN A;  3PM1 A;  2X9D A;  3MVP A;  1UI6 A;  5FKN A;  2XDN A;  5FKM A;  3F0C A;  3RH2 A;  3AQS A;  4JNN A;  2WUI A;  3C07 A;  4D5F A;  2O7T A;  2IBD A;  2RHA A;  3ZQG A;  2JK3 A;  3BR1 A;  3ZQI A;  3FK6 A;  4AUX A;  4D7N A;  3BQZ A;  3ANG A;  5EFY A;  4M3G A;  3T6N A;  2HYT A;  3LJL A;  2F07 A;  1T56 A;  2GBY A;  3QKX A;  3IH2 A;  4DW6 A;  3QQA A;  2ZOY A;  3IUV A;  4MXM A;  3O60 A;  2QIB A;  3BCG A;  3VPR A;  3WHB A;  2GUH A;  2FBQ A;  5F0C A;  4GCK A;  2FD5 A;  3LSP A;  2PZ9 A;  3DPJ A;  5F0F A;  5FKL A;  3BTL A;  3NNR A;  3B6C A;  3ON2 A;  3VVZ A;  5HSZ A;  2ID6 A;  4M3E A;  4UDS A;  3LHQ A;  1JTX A;  5IOZ A;  5GPC A;  3CCY A;  2QOP A;  5K7Z A;  2VKV A;  3LSJ A;  3TP0 A;  5HBU A;  3FK7 A;  3BNI A;  5EYR A;  3F1B A;  3Q3S A;  5D18 A;  2UXP A;  1JT6 A;  4CGR A;  2TCT A;  1SGM A;  2ID3 A;  1VI0 A;  3QPS A;  4NN1 A;  3Q0U A;  3HTI A;  2OER A;  2JJ7 A;  2NS8 A;  4G12 A;  4NEL A;  3VOK A;  4I76 A;  2GEN A;  2HKU A;  4JKZ A;  5D19 A;  4PXI A;  3DCF A;  2WV1 A;  4AF5 A;  3KZ9 A;  3BHQ A;  5FGL A;  1JT0 A;  2IEK A;  1Z0X A;  4V2G A;  5IPA A;  3Q0V A;  4M3D A;  4ICH A;  3EUP A;  3G56 A;  3IH3 A;  2XRL A;  3VOX A;  3BJB A;  4I6Z A;  3G7R A;  4GCL A;  3MNL A;  3BR0 A;  2UXI A;  3NPI A;  3B6A A;  2NX4 A;  3BRU A;  2FJ1 A;  3ANP A;  3TP3 A;  3LOC A;  1UI5 A;  5DAJ A;  1ZK8 A;  3ZQF A;  4GCT A;  4XK4 A;  2XGC A;  3O8H A;  3V78 A;  2ZCX A;  5C4Y A;  3VW0 A;  1T33 A;  2VKE A;  5FKO A;  5EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...