3GZIA

Crystal structure of a transcriptional regulator of the tetr family (shew_3567) from shewanella loihica pv-4 at 2.05 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
203
structure length
203
Chain Sequence
b'VGRPSGDTQNRDKLILAARNLFIERPYAQVSIREIASLAGTDPGLIRYYFGSKEKLFSTMIHETAMPVLAQLHKARRETRQESPAALLQTYYSVMSKHPHFPRLMLRIAGLDQSLPENAEVTKAFYEVVNFENIAIFQRLKDKNLLKDDVDAHCAQLSFFAMMVFPFIVPENLLERVGIELTPDFLQLLAEQNTRLLQRGLMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of TETR family transcriptional regulator (YP_001095692.1) from SHEWANELLA SP. PV-4 at 2.05 A resolution
rcsb
source organism Shewanella loihica pv-4
molecule tags Transcription
total genus 65
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3gziA00
3KKCA 4GCLA 4NELA 2DTZA 3NRGA 4AF5A 1ZKGA 3BR1A 3G1LA 3G56A 3HTAA 2VKVA 2GFNA 2NP3A 3SDGA 1Z0XA 2W53A 2WGBA 4AC6A 5F0CA 4D7MA 2UXOA 3PASA 5J3LA 4GCKA 2Y2ZA 3QPLA 5F08A 5J1UA 4M3EA 5K58A 2PBXA 5HAWA 3BR3A 5HSZA 3CRJA 4I6ZA 2IU5A 2O7TA 4JYKA 2FD5A 2Y31A 4ICHA 3BNIA 2NX4A 3BTIA 3KZ9A 1A6IA 2XGCA 4B3AA 3ANPA 3IH3A 4ACIA 2HKUA 2DG8A 2FBQA 3ON2A 1QPIA 2GENA 3IUVA 3ANGA 3VP5A 3AQTA 5D19A 2FJ1A 2QKOA 4ME9A 2GBYA 2NS7A 4JL3A 2OI8A 4JNNA 5GPAA 4W97A 3ZQLA 2ZOZA 4L62A 3GEUA 2ID6A 2IBDA 5CW8A 2G3BA 4MO7A 4ABZA 5C4YA 5FKKA 2XRLA 3BJBA 4MXMA 3B6AA 2D6YA 3FK6A 2REKA 2UXIA 4PXIA 3P9TA 3FK7A 1BJZA 3BQYA 3LWJA 3BTLA 4V2GA 3B81A 2HXOA 1RPWA 3S5RA 3NI7A 1JTYA 3ZQGA 3WHCA 4I76A 2RASA 2TRTA 3BT9A 3VW1A 4G12A 2ZCXA 1UI5A 2TCTA 1T33A 3F0CA 3RH2A 4M3FA 3E7QA 3FIWA 3Q0WA 4D5FA 2XPWA 2DG7A 3NXCA 5IOZA 4AC0A 1ORKA 2ZCNA 4KWAA 4MK6A 3COLA 3QKXA 2ZCMA 3BTJA 5FHPA 1UI6A 3G1MA 4M3GA 3CWRA 1ZK8A 3VOXA 3WHBA 5K7FA 2XPUA 3BRUA 3BR0A 5IP6A 3TP3A 4W1UA 3BR6A 5FKOA 2G7LA 1JTXA 3LOCA 3LJLA 2HXIA 3CCYA 5FKMA 1U9OA 5K7HA 5K7ZA 5FMPA 5DAJA 3QBMA 3T6NA 2OPTA 1SGMA 2I10A 2XGEA 3SFIA 2G0EA 3O8HA 5F0HA 1T56A 3HE0A 2XGDA 2QCOA 3VVZA 3F1BA 5IPAA 3V78A 2JJ7A 5IOYA 3C07A 3V6GA 4YZEA 3Q0VA 5CXIA 3CDLA 1RKTA 3PM1A 2X9DA 2VPRA 4D5CA 3VIBA 5D1RA 5F04A 2UXUA 5FGLA 1QVTA 3BHQA 3LSRA 3CJDA 5F27A 4M3DA 3BR2A 4X1EA 2HYJA 2GUHA 3ON4A 2G7SA 1U9NA 5EZGA 3HGGA 3NPIA 1QVUA 4D7NA 3QQAA 5H9TA 2X6OA 5AQCA 2Y30A 4JKZA 5F1JA 3HGYA 4HKUA 1RKWA 3BR5A 2QWTA 3DEWA 3ZQFA 2FQ4A 2EH3A 4AUXA 5FKLA 3IH2A 2FX0A 3HIMA 2HYTA 3NNRA 3VOKA 3LSJA 3VW2A 3VUQA 4GFKA 3RD3A 2UXHA 2RAEA 2V57A 1JUMA 3VPRA 5FKNA 2OERA 5J1RA 5F0FA 4GCTA 2QTQA 1JT6A 4GFLA 4XK4A 5CXGA 5HBUA 3O8GA 2XDNA 5EYRA 5EZHA 4M3BA 3PPBA 3AQSA 4DW6A 5GP9A 2XB5A 1JT0A 2JK3A 1JUPA 3G1OA 3KKDA 2PZ9A 4NN1A 2XPVA 3QPSA 2ID3A 2G7GA 4B1RA 2WUIA 3BQZA 2QIBA 2WV1A 3C2BA 3FRQA 3LHQA 3BCGA 3G7RA 3MVPA 3B6CA 1VI0A 2F07A 3ZQIA 3Q3SA 2IAIA 2VKEA 3LSPA 2YVEA 2IEKA 4UDSA 3O60A 5EFYA 3VVXA 2HQ5A 3JSJA 3HTIA 3VVYA 5GPCA 3EUPA 3Q0UA 3MNLA 3EGQA 2ZOYA 3DPJA 4V2FA 2Q24A 2NP5A 3KNWA 2NS8A 2QOPA 2RHAA 3DCFA 2ZB9A 3ZQHA 5J1YA 1Z77A 2YVHA 3TP0A 4CGRA 1JUSA 2OF7A 3HTHA 3HTJA 3VW0A 2UXPA 5D18A 2O7OA 3GZIA 3IH4A 3BTCA
chains in the Genus database with same CATH superfamily
3KKCA 4GCLA 4NELA 2DTZA 3NRGA 3K8PC 4AF5A 1ZKGA 2A2FX 3BR1A 3G1LA 3G56A 3HTAA 2VKVA 2GFNA 2NP3A 3SDGA 1Z0XA 2W53A 2WGBA 4AC6A 5F0CA 4D7MA 2UXOA 4DVYP 3PASA 5J3LA 4GCKA 2Y2ZA 2R7WA 3QPLA 5F08A 5J1UA 4M3EA 5K58A 2PBXA 5HAWA 3BR3A 5HSZA 3CRJA 4I6ZA 2IU5A 2O7TA 4JYKA 2FD5A 2Y31A 4ICHA 3BNIA 2NX4A 3BTIA 3KZ9A 1A6IA 2XGCA 4B3AA 3ANPA 3IH3A 4ACIA 2HKUA 2DG8A 2FBQA 2R7UA 3ON2A 1QPIA 2GENA 3IUVA 3ANGA 3VP5A 3AQTA 5D19A 2FJ1A 2QKOA 4ME9A 2GBYA 4U9LA 2NS7A 4JL3A 2OI8A 4JNNA 5GPAA 4W97A 3ZQLA 2ZOZA 4L62A 3GEUA 2ID6A 2IBDA 5CW8A 2G3BA 4MO7A 4ABZA 5C4YA 5FKKA 2XRLA 3BJBA 4MXMA 3B6AA 2D6YA 3FK6A 2REKA 2UXIA 4PXIA 3P9TA 3FK7A 1BJZA 3BQYA 3LWJA 3BTLA 4V2GA 3B81A 2HXOA 1RPWA 3S5RA 3NI7A 1JTYA 3ZQGA 3WHCA 4I76A 2RASA 2TRTA 3BT9A 3VW1A 4G12A 2ZCXA 1UI5A 2R7QA 2TCTA 1T33A 3F0CA 3RH2A 4M3FA 3E7QA 3FIWA 3Q0WA 3VTIA 4D5FA 2XPWA 2DG7A 3NXCA 5IOZA 4AC0A 1ORKA 2ZCNA 4KWAA 4MK6A 3COLA 3QKXA 2ZCMA 3BTJA 5FHPA 1UI6A 3G1MA 4M3GA 3CWRA 1ZK8A 3DU5A 3VOXA 3WHBA 5K7FA 2XPUA 3BRUA 4U9NA 3BR0A 5IP6A 3TP3A 4W1UA 3BR6A 5FKOA 2G7LA 1JTXA 3LOCA 3LJLA 2HXIA 3CCYA 5FKMA 1U9OA 5K7HA 5K7ZA 2FJI1 5FMPA 5DAJA 3QBMA 3T6NA 3SWHA 2OPTA 1SGMA 2I10A 2XGEA 3SFIA 2G0EA 3O8HA 5F0HA 1T56A 3HE0A 3DU6A 2XGDA 2QCOA 3VVZA 3F1BA 5IPAA 3V78A 2JJ7A 5IOYA 3C07A 3V6GA 4YZEA 3Q0VA 5CXIA 3CDLA 1RKTA 3PM1A 2X9DA 2VPRA 4D5CA 3VIBA 5D1RA 5F04A 2UXUA 5FGLA 1QVTA 3BHQA 3LSRA 3CJDA 5F27A 4M3DA 3BR2A 4X1EA 2HYJA 2GUHA 3ON4A 2G7SA 1U9NA 5EZGA 3HGGA 3NPIA 1QVUA 4D7NA 3QQAA 5H9TA 2X6OA 5AQCA 2Y30A 4JKZA 5F1JA 3KYLA 2R7SA 3HGYA 4HKUA 1RKWA 3BR5A 2QWTA 3DEWA 3ZQFA 2FQ4A 2EH3A 4AUXA 4OD4A 4OD5A 5FKLA 3IH2A 2FX0A 3HIMA 2HYTA 3NNRA 3VOKA 3LSJA 3VW2A 2R7VA 3VUQA 4GFKA 3RD3A 2UXHA 2RAEA 2B1EA 2V57A 1JUMA 3VPRA 5FKNA 4C2MA 2OERA 5J1RA 5F0FA 4GCTA 2QTQA 1JT6A 4GFLA 4XK4A 5CXGA 5HBUA 3O8GA 2XDNA 5EYRA 5EZHA 3NS4A 4M3BA 3PPBA 3AQSA 4DW6A 2R7OA 5GP9A 2XB5A 1JT0A 2JK3A 1JUPA 3G1OA 3KKDA 2PZ9A 4NN1A 2XPVA 3QPSA 2ID3A 2G7GA 4B1RA 2WUIA 3BQZA 2QIBA 2WV1A 3C2BA 3FRQA 3LHQA 3BCGA 3G7RA 3MVPA 2B3WA 3B6CA 1VI0A 2F07A 3ZQIA 3Q3SA 2IAIA 2VKEA 3LSPA 2YVEA 4IRVA 2IEKA 4UDSA 2ZY9A 3O60A 5CQGA 5EFYA 3VVXA 2HQ5A 3JSJA 3HTIA 3VVYA 5GPCA 3EUPA 3Q0UA 3MNLA 3EGQA 2ZOYA 3DPJA 4V2FA 2Q24A 2NP5A 3KNWA 2NS8A 2R7RA 2QOPA 2RHAA 3DCFA 2ZB9A 3ZQHA 2R7TA 5J1YA 1Z77A 3FHNA 2YVHA 2PFVA 3TP0A 4CGRA 1JUSA 2YVXA 2OF7A 3HTHA 3HTJA 3VW0A 2UXPA 5D18A 2O7OA 3GZIA 3IH4A 4WIBA 2R7XA 3BTCA
chains in the Genus database with same CATH topology
3KKCA 4GCLA 4NELA 2DTZA 3NRGA 4AF5A 1ZKGA 3BR1A 3G1LA 3G56A 3HTAA 2VKVA 2GFNA 2NP3A 3SDGA 1Z0XA 2W53A 2WGBA 4AC6A 5F0CA 4D7MA 2UXOA 3PASA 5J3LA 4GCKA 2Y2ZA 3QPLA 5F08A 5J1UA 4M3EA 5K58A 2PBXA 5HAWA 3BR3A 5HSZA 3CRJA 4I6ZA 2IU5A 2O7TA 4JYKA 2FD5A 2Y31A 4ICHA 3BNIA 2NX4A 3BTIA 3KZ9A 1A6IA 2XGCA 4B3AA 3ANPA 3IH3A 4ACIA 2HKUA 2DG8A 2FBQA 3ON2A 1QPIA 2GENA 3IUVA 3ANGA 3VP5A 3AQTA 5D19A 2FJ1A 2QKOA 4ME9A 2GBYA 2NS7A 4JL3A 2OI8A 4JNNA 5GPAA 4W97A 3ZQLA 2ZOZA 4L62A 3GEUA 2ID6A 2IBDA 5CW8A 2G3BA 4MO7A 4ABZA 5C4YA 5FKKA 2XRLA 3BJBA 4MXMA 3B6AA 2D6YA 3FK6A 2REKA 2UXIA 4PXIA 3P9TA 3FK7A 1BJZA 3BQYA 3LWJA 3BTLA 4V2GA 3B81A 2HXOA 1RPWA 3S5RA 3NI7A 1JTYA 3ZQGA 3WHCA 4I76A 2RASA 2TRTA 3BT9A 3VW1A 4G12A 2ZCXA 1UI5A 2TCTA 1T33A 3F0CA 3RH2A 4M3FA 3E7QA 3FIWA 3Q0WA 4D5FA 2XPWA 2DG7A 3NXCA 5IOZA 4AC0A 1ORKA 2ZCNA 4KWAA 4MK6A 3COLA 3QKXA 2ZCMA 3BTJA 5FHPA 1UI6A 3G1MA 4M3GA 3CWRA 1ZK8A 3VOXA 3WHBA 5K7FA 2XPUA 3BRUA 3BR0A 5IP6A 3TP3A 4W1UA 3BR6A 5FKOA 2G7LA 1JTXA 3LOCA 3LJLA 2HXIA 3CCYA 5FKMA 1U9OA 5K7HA 5K7ZA 5FMPA 5DAJA 3QBMA 3T6NA 2OPTA 1SGMA 2I10A 2XGEA 3SFIA 2G0EA 3O8HA 5F0HA 1T56A 3HE0A 2XGDA 2QCOA 3VVZA 3F1BA 5IPAA 3V78A 2JJ7A 5IOYA 3C07A 3V6GA 4YZEA 3Q0VA 5CXIA 3CDLA 1RKTA 3PM1A 2X9DA 2VPRA 4D5CA 3VIBA 5D1RA 5F04A 2UXUA 5FGLA 1QVTA 3BHQA 3LSRA 3CJDA 5F27A 4M3DA 3BR2A 4X1EA 2HYJA 2GUHA 3ON4A 2G7SA 1U9NA 5EZGA 3HGGA 3NPIA 1QVUA 4D7NA 3QQAA 5H9TA 2X6OA 5AQCA 2Y30A 4JKZA 5F1JA 3HGYA 4HKUA 1RKWA 3BR5A 2QWTA 3DEWA 3ZQFA 2FQ4A 2EH3A 4AUXA 5FKLA 3IH2A 2FX0A 3HIMA 2HYTA 3NNRA 3VOKA 3LSJA 3VW2A 3VUQA 4GFKA 3RD3A 2UXHA 2RAEA 2V57A 1JUMA 3VPRA 5FKNA 2OERA 5J1RA 5F0FA 4GCTA 2QTQA 1JT6A 4GFLA 4XK4A 5CXGA 5HBUA 3O8GA 2XDNA 5EYRA 5EZHA 4M3BA 3PPBA 3AQSA 4DW6A 5GP9A 2XB5A 1JT0A 2JK3A 1JUPA 3G1OA 3KKDA 2PZ9A 4NN1A 2XPVA 3QPSA 2ID3A 2G7GA 4B1RA 2WUIA 3BQZA 2QIBA 2WV1A 3C2BA 3FRQA 3LHQA 3BCGA 3G7RA 3MVPA 3B6CA 1VI0A 2F07A 3ZQIA 3Q3SA 2IAIA 2VKEA 3LSPA 2YVEA 2IEKA 4UDSA 3O60A 5EFYA 3VVXA 2HQ5A 3JSJA 3HTIA 3VVYA 5GPCA 3EUPA 3Q0UA 3MNLA 3EGQA 2ZOYA 3DPJA 4V2FA 2Q24A 2NP5A 3KNWA 2NS8A 2QOPA 2RHAA 3DCFA 2ZB9A 3ZQHA 5J1YA 1Z77A 2YVHA 3TP0A 4CGRA 1JUSA 2OF7A 3HTHA 3HTJA 3VW0A 2UXPA 5D18A 2O7OA 3GZIA 3IH4A 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKC A;  4GCL A;  4NEL A;  2DTZ A;  3NRG A;  4AF5 A;  1ZKG A;  3BR1 A;  3G1L A;  3G56 A;  3HTA A;  2VKV A;  2GFN A;  2NP3 A;  3SDG A;  1Z0X A;  2W53 A;  2WGB A;  4AC6 A;  5F0C A;  4D7M A;  2UXO A;  3PAS A;  5J3L A;  4GCK A;  2Y2Z A;  3QPL A;  5F08 A;  5J1U A;  4M3E A;  5K58 A;  2PBX A;  5HAW A;  3BR3 A;  5HSZ A;  3CRJ A;  4I6Z A;  2IU5 A;  2O7T A;  4JYK A;  2FD5 A;  2Y31 A;  4ICH A;  3BNI A;  2NX4 A;  3BTI A;  3KZ9 A;  1A6I A;  2XGC A;  4B3A A;  3ANP A;  3IH3 A;  4ACI A;  2HKU A;  2DG8 A;  2FBQ A;  3ON2 A;  1QPI A;  2GEN A;  3IUV A;  3ANG A;  3VP5 A;  3AQT A;  5D19 A;  2FJ1 A;  2QKO A;  4ME9 A;  2GBY A;  2NS7 A;  4JL3 A;  2OI8 A;  4JNN A;  5GPA A;  4W97 A;  3ZQL A;  2ZOZ A;  4L62 A;  3GEU A;  2ID6 A;  2IBD A;  5CW8 A;  2G3B A;  4MO7 A;  4ABZ A;  5C4Y A;  5FKK A;  2XRL A;  3BJB A;  4MXM A;  3B6A A;  2D6Y A;  3FK6 A;  2REK A;  2UXI A;  4PXI A;  3P9T A;  3FK7 A;  1BJZ A;  3BQY A;  3LWJ A;  3BTL A;  4V2G A;  3B81 A;  2HXO A;  1RPW A;  3S5R A;  3NI7 A;  1JTY A;  3ZQG A;  3WHC A;  4I76 A;  2RAS A;  2TRT A;  3BT9 A;  3VW1 A;  4G12 A;  2ZCX A;  1UI5 A;  2TCT A;  1T33 A;  3F0C A;  3RH2 A;  4M3F A;  3E7Q A;  3FIW A;  3Q0W A;  4D5F A;  2XPW A;  2DG7 A;  3NXC A;  5IOZ A;  4AC0 A;  1ORK A;  2ZCN A;  4KWA A;  4MK6 A;  3COL A;  3QKX A;  2ZCM A;  3BTJ A;  5FHP A;  1UI6 A;  3G1M A;  4M3G A;  3CWR A;  1ZK8 A;  3VOX A;  3WHB A;  5K7F A;  2XPU A;  3BRU A;  3BR0 A;  5IP6 A;  3TP3 A;  4W1U A;  3BR6 A;  5FKO A;  2G7L A;  1JTX A;  3LOC A;  3LJL A;  2HXI A;  3CCY A;  5FKM A;  1U9O A;  5K7H A;  5K7Z A;  5FMP A;  5DAJ A;  3QBM A;  3T6N A;  2OPT A;  1SGM A;  2I10 A;  2XGE A;  3SFI A;  2G0E A;  3O8H A;  5F0H A;  1T56 A;  3HE0 A;  2XGD A;  2QCO A;  3VVZ A;  3F1B A;  5IPA A;  3V78 A;  2JJ7 A;  5IOY A;  3C07 A;  3V6G A;  4YZE A;  3Q0V A;  5CXI A;  3CDL A;  1RKT A;  3PM1 A;  2X9D A;  2VPR A;  4D5C A;  3VIB A;  5D1R A;  5F04 A;  2UXU A;  5FGL A;  1QVT A;  3BHQ A;  3LSR A;  3CJD A;  5F27 A;  4M3D A;  3BR2 A;  4X1E A;  2HYJ A;  2GUH A;  3ON4 A;  2G7S A;  1U9N A;  5EZG A;  3HGG A;  3NPI A;  1QVU A;  4D7N A;  3QQA A;  5H9T A;  2X6O A;  5AQC A;  2Y30 A;  4JKZ A;  5F1J A;  3HGY A;  4HKU A;  1RKW A;  3BR5 A;  2QWT A;  3DEW A;  3ZQF A;  2FQ4 A;  2EH3 A;  4AUX A;  5FKL A;  3IH2 A;  2FX0 A;  3HIM A;  2HYT A;  3NNR A;  3VOK A;  3LSJ A;  3VW2 A;  3VUQ A;  4GFK A;  3RD3 A;  2UXH A;  2RAE A;  2V57 A;  1JUM A;  3VPR A;  5FKN A;  2OER A;  5J1R A;  5F0F A;  4GCT A;  2QTQ A;  1JT6 A;  4GFL A;  4XK4 A;  5CXG A;  5HBU A;  3O8G A;  2XDN A;  5EYR A;  5EZH A;  4M3B A;  3PPB A;  3AQS A;  4DW6 A;  5GP9 A;  2XB5 A;  1JT0 A;  2JK3 A;  1JUP A;  3G1O A;  3KKD A;  2PZ9 A;  4NN1 A;  2XPV A;  3QPS A;  2ID3 A;  2G7G A;  4B1R A;  2WUI A;  3BQZ A;  2QIB A;  2WV1 A;  3C2B A;  3FRQ A;  3LHQ A;  3BCG A;  3G7R A;  3MVP A;  3B6C A;  1VI0 A;  2F07 A;  3ZQI A;  3Q3S A;  2IAI A;  2VKE A;  3LSP A;  2YVE A;  2IEK A;  4UDS A;  3O60 A;  5EFY A;  3VVX A;  2HQ5 A;  3JSJ A;  3HTI A;  3VVY A;  5GPC A;  3EUP A;  3Q0U A;  3MNL A;  3EGQ A;  2ZOY A;  3DPJ A;  4V2F A;  2Q24 A;  2NP5 A;  3KNW A;  2NS8 A;  2QOP A;  2RHA A;  3DCF A;  2ZB9 A;  3ZQH A;  5J1Y A;  1Z77 A;  2YVH A;  3TP0 A;  4CGR A;  1JUS A;  2OF7 A;  3HTH A;  3HTJ A;  3VW0 A;  2UXP A;  5D18 A;  2O7O A;  3GZI A;  3IH4 A;  3BTC A; 
#chains in the Genus database with same CATH topology
 3KKC A;  4GCL A;  4NEL A;  2DTZ A;  3NRG A;  3K8P C;  4AF5 A;  1ZKG A;  2A2F X;  3BR1 A;  3G1L A;  3G56 A;  3HTA A;  2VKV A;  2GFN A;  2NP3 A;  3SDG A;  1Z0X A;  2W53 A;  2WGB A;  4AC6 A;  5F0C A;  4D7M A;  2UXO A;  4DVY P;  3PAS A;  5J3L A;  4GCK A;  2Y2Z A;  2R7W A;  3QPL A;  5F08 A;  5J1U A;  4M3E A;  5K58 A;  2PBX A;  5HAW A;  3BR3 A;  5HSZ A;  3CRJ A;  4I6Z A;  2IU5 A;  2O7T A;  4JYK A;  2FD5 A;  2Y31 A;  4ICH A;  3BNI A;  2NX4 A;  3BTI A;  3KZ9 A;  1A6I A;  2XGC A;  4B3A A;  3ANP A;  3IH3 A;  4ACI A;  2HKU A;  2DG8 A;  2FBQ A;  2R7U A;  3ON2 A;  1QPI A;  2GEN A;  3IUV A;  3ANG A;  3VP5 A;  3AQT A;  5D19 A;  2FJ1 A;  2QKO A;  4ME9 A;  2GBY A;  4U9L A;  2NS7 A;  4JL3 A;  2OI8 A;  4JNN A;  5GPA A;  4W97 A;  3ZQL A;  2ZOZ A;  4L62 A;  3GEU A;  2ID6 A;  2IBD A;  5CW8 A;  2G3B A;  4MO7 A;  4ABZ A;  5C4Y A;  5FKK A;  2XRL A;  3BJB A;  4MXM A;  3B6A A;  2D6Y A;  3FK6 A;  2REK A;  2UXI A;  4PXI A;  3P9T A;  3FK7 A;  1BJZ A;  3BQY A;  3LWJ A;  3BTL A;  4V2G A;  3B81 A;  2HXO A;  1RPW A;  3S5R A;  3NI7 A;  1JTY A;  3ZQG A;  3WHC A;  4I76 A;  2RAS A;  2TRT A;  3BT9 A;  3VW1 A;  4G12 A;  2ZCX A;  1UI5 A;  2R7Q A;  2TCT A;  1T33 A;  3F0C A;  3RH2 A;  4M3F A;  3E7Q A;  3FIW A;  3Q0W A;  3VTI A;  4D5F A;  2XPW A;  2DG7 A;  3NXC A;  5IOZ A;  4AC0 A;  1ORK A;  2ZCN A;  4KWA A;  4MK6 A;  3COL A;  3QKX A;  2ZCM A;  3BTJ A;  5FHP A;  1UI6 A;  3G1M A;  4M3G A;  3CWR A;  1ZK8 A;  3DU5 A;  3VOX A;  3WHB A;  5K7F A;  2XPU A;  3BRU A;  4U9N A;  3BR0 A;  5IP6 A;  3TP3 A;  4W1U A;  3BR6 A;  5FKO A;  2G7L A;  1JTX A;  3LOC A;  3LJL A;  2HXI A;  3CCY A;  5FKM A;  1U9O A;  5K7H A;  5K7Z A;  2FJI 1;  5FMP A;  5DAJ A;  3QBM A;  3T6N A;  3SWH A;  2OPT A;  1SGM A;  2I10 A;  2XGE A;  3SFI A;  2G0E A;  3O8H A;  5F0H A;  1T56 A;  3HE0 A;  3DU6 A;  2XGD A;  2QCO A;  3VVZ A;  3F1B A;  5IPA A;  3V78 A;  2JJ7 A;  5IOY A;  3C07 A;  3V6G A;  4YZE A;  3Q0V A;  5CXI A;  3CDL A;  1RKT A;  3PM1 A;  2X9D A;  2VPR A;  4D5C A;  3VIB A;  5D1R A;  5F04 A;  2UXU A;  5FGL A;  1QVT A;  3BHQ A;  3LSR A;  3CJD A;  5F27 A;  4M3D A;  3BR2 A;  4X1E A;  2HYJ A;  2GUH A;  3ON4 A;  2G7S A;  1U9N A;  5EZG A;  3HGG A;  3NPI A;  1QVU A;  4D7N A;  3QQA A;  5H9T A;  2X6O A;  5AQC A;  2Y30 A;  4JKZ A;  5F1J A;  3KYL A;  2R7S A;  3HGY A;  4HKU A;  1RKW A;  3BR5 A;  2QWT A;  3DEW A;  3ZQF A;  2FQ4 A;  2EH3 A;  4AUX A;  4OD4 A;  4OD5 A;  5FKL A;  3IH2 A;  2FX0 A;  3HIM A;  2HYT A;  3NNR A;  3VOK A;  3LSJ A;  3VW2 A;  2R7V A;  3VUQ A;  4GFK A;  3RD3 A;  2UXH A;  2RAE A;  2B1E A;  2V57 A;  1JUM A;  3VPR A;  5FKN A;  4C2M A;  2OER A;  5J1R A;  5F0F A;  4GCT A;  2QTQ A;  1JT6 A;  4GFL A;  4XK4 A;  5CXG A;  5HBU A;  3O8G A;  2XDN A;  5EYR A;  5EZH A;  3NS4 A;  4M3B A;  3PPB A;  3AQS A;  4DW6 A;  2R7O A;  5GP9 A;  2XB5 A;  1JT0 A;  2JK3 A;  1JUP A;  3G1O A;  3KKD A;  2PZ9 A;  4NN1 A;  2XPV A;  3QPS A;  2ID3 A;  2G7G A;  4B1R A;  2WUI A;  3BQZ A;  2QIB A;  2WV1 A;  3C2B A;  3FRQ A;  3LHQ A;  3BCG A;  3G7R A;  3MVP A;  2B3W A;  3B6C A;  1VI0 A;  2F07 A;  3ZQI A;  3Q3S A;  2IAI A;  2VKE A;  3LSP A;  2YVE A;  4IRV A;  2IEK A;  4UDS A;  2ZY9 A;  3O60 A;  5CQG A;  5EFY A;  3VVX A;  2HQ5 A;  3JSJ A;  3HTI A;  3VVY A;  5GPC A;  3EUP A;  3Q0U A;  3MNL A;  3EGQ A;  2ZOY A;  3DPJ A;  4V2F A;  2Q24 A;  2NP5 A;  3KNW A;  2NS8 A;  2R7R A;  2QOP A;  2RHA A;  3DCF A;  2ZB9 A;  3ZQH A;  2R7T A;  5J1Y A;  1Z77 A;  3FHN A;  2YVH A;  2PFV A;  3TP0 A;  4CGR A;  1JUS A;  2YVX A;  2OF7 A;  3HTH A;  3HTJ A;  3VW0 A;  2UXP A;  5D18 A;  2O7O A;  3GZI A;  3IH4 A;  4WIB A;  2R7X A;  3BTC A; 
#chains in the Genus database with same CATH homology
 3KKC A;  4GCL A;  4NEL A;  2DTZ A;  3NRG A;  4AF5 A;  1ZKG A;  3BR1 A;  3G1L A;  3G56 A;  3HTA A;  2VKV A;  2GFN A;  2NP3 A;  3SDG A;  1Z0X A;  2W53 A;  2WGB A;  4AC6 A;  5F0C A;  4D7M A;  2UXO A;  3PAS A;  5J3L A;  4GCK A;  2Y2Z A;  3QPL A;  5F08 A;  5J1U A;  4M3E A;  5K58 A;  2PBX A;  5HAW A;  3BR3 A;  5HSZ A;  3CRJ A;  4I6Z A;  2IU5 A;  2O7T A;  4JYK A;  2FD5 A;  2Y31 A;  4ICH A;  3BNI A;  2NX4 A;  3BTI A;  3KZ9 A;  1A6I A;  2XGC A;  4B3A A;  3ANP A;  3IH3 A;  4ACI A;  2HKU A;  2DG8 A;  2FBQ A;  3ON2 A;  1QPI A;  2GEN A;  3IUV A;  3ANG A;  3VP5 A;  3AQT A;  5D19 A;  2FJ1 A;  2QKO A;  4ME9 A;  2GBY A;  2NS7 A;  4JL3 A;  2OI8 A;  4JNN A;  5GPA A;  4W97 A;  3ZQL A;  2ZOZ A;  4L62 A;  3GEU A;  2ID6 A;  2IBD A;  5CW8 A;  2G3B A;  4MO7 A;  4ABZ A;  5C4Y A;  5FKK A;  2XRL A;  3BJB A;  4MXM A;  3B6A A;  2D6Y A;  3FK6 A;  2REK A;  2UXI A;  4PXI A;  3P9T A;  3FK7 A;  1BJZ A;  3BQY A;  3LWJ A;  3BTL A;  4V2G A;  3B81 A;  2HXO A;  1RPW A;  3S5R A;  3NI7 A;  1JTY A;  3ZQG A;  3WHC A;  4I76 A;  2RAS A;  2TRT A;  3BT9 A;  3VW1 A;  4G12 A;  2ZCX A;  1UI5 A;  2TCT A;  1T33 A;  3F0C A;  3RH2 A;  4M3F A;  3E7Q A;  3FIW A;  3Q0W A;  4D5F A;  2XPW A;  2DG7 A;  3NXC A;  5IOZ A;  4AC0 A;  1ORK A;  2ZCN A;  4KWA A;  4MK6 A;  3COL A;  3QKX A;  2ZCM A;  3BTJ A;  5FHP A;  1UI6 A;  3G1M A;  4M3G A;  3CWR A;  1ZK8 A;  3VOX A;  3WHB A;  5K7F A;  2XPU A;  3BRU A;  3BR0 A;  5IP6 A;  3TP3 A;  4W1U A;  3BR6 A;  5FKO A;  2G7L A;  1JTX A;  3LOC A;  3LJL A;  2HXI A;  3CCY A;  5FKM A;  1U9O A;  5K7H A;  5K7Z A;  5FMP A;  5DAJ A;  3QBM A;  3T6N A;  2OPT A;  1SGM A;  2I10 A;  2XGE A;  3SFI A;  2G0E A;  3O8H A;  5F0H A;  1T56 A;  3HE0 A;  2XGD A;  2QCO A;  3VVZ A;  3F1B A;  5IPA A;  3V78 A;  2JJ7 A;  5IOY A;  3C07 A;  3V6G A;  4YZE A;  3Q0V A;  5CXI A;  3CDL A;  1RKT A;  3PM1 A;  2X9D A;  2VPR A;  4D5C A;  3VIB A;  5D1R A;  5F04 A;  2UXU A;  5FGL A;  1QVT A;  3BHQ A;  3LSR A;  3CJD A;  5F27 A;  4M3D A;  3BR2 A;  4X1E A;  2HYJ A;  2GUH A;  3ON4 A;  2G7S A;  1U9N A;  5EZG A;  3HGG A;  3NPI A;  1QVU A;  4D7N A;  3QQA A;  5H9T A;  2X6O A;  5AQC A;  2Y30 A;  4JKZ A;  5F1J A;  3HGY A;  4HKU A;  1RKW A;  3BR5 A;  2QWT A;  3DEW A;  3ZQF A;  2FQ4 A;  2EH3 A;  4AUX A;  5FKL A;  3IH2 A;  2FX0 A;  3HIM A;  2HYT A;  3NNR A;  3VOK A;  3LSJ A;  3VW2 A;  3VUQ A;  4GFK A;  3RD3 A;  2UXH A;  2RAE A;  2V57 A;  1JUM A;  3VPR A;  5FKN A;  2OER A;  5J1R A;  5F0F A;  4GCT A;  2QTQ A;  1JT6 A;  4GFL A;  4XK4 A;  5CXG A;  5HBU A;  3O8G A;  2XDN A;  5EYR A;  5EZH A;  4M3B A;  3PPB A;  3AQS A;  4DW6 A;  5GP9 A;  2XB5 A;  1JT0 A;  2JK3 A;  1JUP A;  3G1O A;  3KKD A;  2PZ9 A;  4NN1 A;  2XPV A;  3QPS A;  2ID3 A;  2G7G A;  4B1R A;  2WUI A;  3BQZ A;  2QIB A;  2WV1 A;  3C2B A;  3FRQ A;  3LHQ A;  3BCG A;  3G7R A;  3MVP A;  3B6C A;  1VI0 A;  2F07 A;  3ZQI A;  3Q3S A;  2IAI A;  2VKE A;  3LSP A;  2YVE A;  2IEK A;  4UDS A;  3O60 A;  5EFY A;  3VVX A;  2HQ5 A;  3JSJ A;  3HTI A;  3VVY A;  5GPC A;  3EUP A;  3Q0U A;  3MNL A;  3EGQ A;  2ZOY A;  3DPJ A;  4V2F A;  2Q24 A;  2NP5 A;  3KNW A;  2NS8 A;  2QOP A;  2RHA A;  3DCF A;  2ZB9 A;  3ZQH A;  5J1Y A;  1Z77 A;  2YVH A;  3TP0 A;  4CGR A;  1JUS A;  2OF7 A;  3HTH A;  3HTJ A;  3VW0 A;  2UXP A;  5D18 A;  2O7O A;  3GZI A;  3IH4 A;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...