3LJLA

The crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
SKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator LuxT
publication title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ljlA00
2FD5A 5FMPA 3B6CA 5H9TA 2RHAA 4W97A 5K7HA 5CW8A 3GEUA 5EYRA 3VOKA 5J1YA 1RKTA 3LJLA 2OI8A 1U9NA 4ABZA 3SDGA 3BTIA 3DCFA 3FK7A 4ACIA 3HTJA 3BHQA 2XGEA 3EUPA 3F0CA 2GFNA 2YVEA 2JJ7A 4GFKA 3VVYA 3ZQHA 3HGYA 2VKEA 2ZOZA 5D1RA 5AQCA 4UDSA 4AF5A 2QWTA 5J1RA 3GZIA 1JUPA 1RKWA 5F08A 2OERA 3LSPA 1UI6A 4GCTA 5IP6A 3VW0A 4V2FA 3HTIA 2FQ4A 4KWAA 3VVXA 3HE0A 2NX4A 5EZGA 3CJDA 2V57A 3BCGA 2IEKA 3VVZA 2O7OA 2GBYA 4L62A 5K58A 3COLA 3PM1A 4PXIA 4DW6A 3ON2A 5EFYA 3DPJA 2ZCNA 2RAEA 2XGCA 3P9TA 2WV1A 5F1JA 2XPUA 2XPVA 3HGGA 3NI7A 4YZEA 1T56A 4MK6A 2ZCXA 3MVPA 3G1LA 2F07A 3BTCA 5GP9A 3VW2A 2WGBA 3BNIA 3FRQA 4I76A 2TRTA 5J3LA 3C2BA 5CXIA 4AC6A 5C4YA 2Y2ZA 3E7QA 3ANPA 5EZHA 4D5FA 4M3GA 4W1UA 2XGDA 3NPIA 5FKNA 2GUHA 3CRJA 4AC0A 1JUSA 4CGRA 4M3EA 3AQTA 2FBQA 3LSJA 1ZKGA 4ME9A 2Y30A 3ANGA 3LWJA 3QKXA 5GPCA 4GCKA 2DTZA 3B6AA 5FKKA 2ID6A 4NN1A 2TCTA 1ORKA 2W53A 4JYKA 5D18A 5K7FA 3O8HA 4I6ZA 3ZQLA 5F04A 2RASA 3VP5A 4G12A 3CCYA 3WHBA 3ZQFA 3ZQIA 3BR2A 4M3BA 4JKZA 3EGQA 3FIWA 3O8GA 5HBUA 3AQSA 5IOZA 3VUQA 5FKOA 2JK3A 1SGMA 1JUMA 2IU5A 3KKCA 2HKUA 2Y31A 1JTXA 4M3DA 3TP3A 2UXOA 5HAWA 4NELA 3RD3A 2XB5A 4D7MA 2ZCMA 4JNNA 2I10A 2UXUA 3IH2A 3T6NA 3CDLA 2D6YA 4B1RA 2QKOA 5F0CA 2IAIA 5FKLA 1JT6A 3WHCA 2DG8A 2NS7A 4M3FA 3BTJA 2GENA 5J1UA 3G1OA 3VIBA 3HTHA 3LSRA 3QQAA 4X1EA 3BR6A 2ID3A 2UXPA 2UXHA 2X6OA 1BJZA 3HTAA 5IOYA 4D7NA 3DEWA 2HQ5A 3G7RA 3KNWA 3KKDA 5HSZA 1Z77A 2QCOA 4XK4A 2FJ1A 5IPAA 2REKA 5K7ZA 1QVUA 3S5RA 5DAJA 2G7SA 3NXCA 3NNRA 2NS8A 3F1BA 3ON4A 2G7GA 3LOCA 3LHQA 4AUXA 3C07A 5FGLA 2QIBA 2QTQA 2VPRA 4MXMA 4GFLA 3SFIA 4D5CA 2IBDA 3BQZA 2HXOA 2XDNA 5FKMA 2OF7A 5GPAA 3PASA 2G7LA 2XPWA 3V78A 2DG7A 1U9OA 3ZQGA 1T33A 3IUVA 3KZ9A 3VW1A 1JTYA 4ICHA 1VI0A 3TP0A 2O7TA 3BT9A 3JSJA 3VPRA 3G56A 2NP3A 3FK6A 1UI5A 3VOXA 3BR1A 4V2GA 3BTLA 2G3BA 3MNLA 2OPTA 2HXIA 4MO7A 3IH4A 2NP5A 4GCLA 3HIMA 3PPBA 3O60A 3G1MA 2ZOYA 3QPLA 3BJBA 2PZ9A 5F0FA 2HYTA 5D19A 3QPSA 5F0HA 2PBXA 2HYJA 2Q24A 2X9DA 2UXIA 1QVTA 2YVHA 3BQYA 1ZK8A 3BR5A 3Q0VA 3QBMA 1A6IA 2XRLA 4B3AA 3BRUA 5F27A 2WUIA 5FHPA 4JL3A 2G0EA 3Q3SA 3Q0UA 4HKUA 2EH3A 3NRGA 2FX0A 2QOPA 2ZB9A 1RPWA 1Z0XA 1QPIA 3BR0A 2VKVA 3BR3A 3RH2A 3Q0WA 5CXGA 3V6GA 1JT0A 3B81A 3IH3A 3CWRA
chains in the Genus database with same CATH superfamily
2FD5A 5FMPA 3B6CA 5H9TA 3FHNA 2RHAA 4W97A 5K7HA 5CW8A 3GEUA 5EYRA 4DVYP 3VOKA 5J1YA 1RKTA 3LJLA 2OI8A 1U9NA 4ABZA 3SDGA 3BTIA 3DCFA 2R7QA 3FK7A 4ACIA 3HTJA 3BHQA 2XGEA 3EUPA 3F0CA 2GFNA 3SWHA 2YVEA 2JJ7A 4GFKA 3VVYA 3ZQHA 2ZY9A 3HGYA 2VKEA 2ZOZA 5D1RA 5AQCA 4UDSA 2FJI1 4AF5A 2QWTA 2R7SA 3NS4A 5J1RA 3GZIA 1JUPA 1RKWA 5F08A 2OERA 3LSPA 1UI6A 4GCTA 4C2MA 5IP6A 3VW0A 4V2FA 3HTIA 2FQ4A 4KWAA 4OD5A 3VVXA 3HE0A 2NX4A 5EZGA 3CJDA 2V57A 3BCGA 2IEKA 3VVZA 2O7OA 2GBYA 4L62A 5K58A 3COLA 3PM1A 4OD4A 4PXIA 4DW6A 3KYLA 3ON2A 5EFYA 3DPJA 2ZCNA 2RAEA 2XGCA 3P9TA 4U9LA 2WV1A 5F1JA 2XPUA 2XPVA 3HGGA 3NI7A 4YZEA 1T56A 4MK6A 2ZCXA 3MVPA 3G1LA 2F07A 3BTCA 5GP9A 3VW2A 2WGBA 2R7RA 3BNIA 3FRQA 4I76A 2TRTA 5J3LA 3C2BA 5CXIA 4AC6A 5C4YA 2Y2ZA 3E7QA 3ANPA 5EZHA 4D5FA 4M3GA 4W1UA 2XGDA 3NPIA 5FKNA 2GUHA 3CRJA 4AC0A 1JUSA 2YVXA 4CGRA 4M3EA 3AQTA 2FBQA 3LSJA 1ZKGA 4ME9A 2Y30A 3ANGA 3LWJA 3QKXA 5GPCA 4GCKA 2DTZA 3B6AA 5FKKA 2ID6A 4NN1A 2TCTA 1ORKA 2B1EA 2W53A 4JYKA 2R7WA 4U9NA 5D18A 5K7FA 3O8HA 4I6ZA 3ZQLA 5F04A 2RASA 3VP5A 4G12A 3CCYA 3WHBA 3ZQFA 2R7VA 3ZQIA 3BR2A 4M3BA 4JKZA 3EGQA 3FIWA 3O8GA 5HBUA 3AQSA 5IOZA 3VUQA 5FKOA 3DU5A 2JK3A 1SGMA 1JUMA 2IU5A 3KKCA 2HKUA 2Y31A 1JTXA 4M3DA 3TP3A 2UXOA 5HAWA 4NELA 3RD3A 2XB5A 4D7MA 2ZCMA 4JNNA 2I10A 2UXUA 3IH2A 3T6NA 3CDLA 2D6YA 4B1RA 2QKOA 5F0CA 2IAIA 5FKLA 1JT6A 3WHCA 2DG8A 2NS7A 4M3FA 3BTJA 2GENA 5J1UA 2B3WA 2R7UA 3G1OA 3VIBA 3HTHA 3LSRA 3QQAA 4X1EA 3BR6A 2ID3A 2UXPA 2UXHA 2X6OA 1BJZA 3HTAA 5IOYA 4D7NA 3DEWA 2HQ5A 3G7RA 3KNWA 3KKDA 5HSZA 1Z77A 2QCOA 4XK4A 2FJ1A 5IPAA 2R7TA 2REKA 5K7ZA 1QVUA 3S5RA 5DAJA 2G7SA 3NXCA 3NNRA 2NS8A 3F1BA 3ON4A 2G7GA 3LOCA 3LHQA 4AUXA 3C07A 5FGLA 2QIBA 2QTQA 2VPRA 3DU6A 4MXMA 4GFLA 3SFIA 3K8PC 4D5CA 2IBDA 3BQZA 2HXOA 2XDNA 5FKMA 2OF7A 5GPAA 3PASA 2G7LA 2XPWA 3V78A 2DG7A 1U9OA 3ZQGA 1T33A 3IUVA 3KZ9A 3VW1A 1JTYA 4ICHA 1VI0A 3TP0A 2O7TA 3BT9A 4WIBA 3JSJA 3VPRA 2R7OA 3G56A 2NP3A 3FK6A 1UI5A 3VOXA 3BR1A 4V2GA 2R7XA 3BTLA 2G3BA 3MNLA 2OPTA 2HXIA 4MO7A 5CQGA 3IH4A 2NP5A 4GCLA 3HIMA 3PPBA 3O60A 3G1MA 2ZOYA 3QPLA 3BJBA 2PZ9A 5F0FA 2HYTA 5D19A 3QPSA 5F0HA 2PBXA 2HYJA 2Q24A 2X9DA 2UXIA 1QVTA 3VTIA 2YVHA 3BQYA 1ZK8A 3BR5A 3Q0VA 3QBMA 1A6IA 2A2FX 2XRLA 4B3AA 3BRUA 4IRVA 5F27A 2PFVA 2WUIA 5FHPA 4JL3A 2G0EA 3Q3SA 3Q0UA 4HKUA 2EH3A 3NRGA 2FX0A 2QOPA 2ZB9A 1RPWA 1Z0XA 1QPIA 3BR0A 2VKVA 3BR3A 3RH2A 3Q0WA 5CXGA 3V6GA 1JT0A 3B81A 3IH3A 3CWRA
chains in the Genus database with same CATH topology
2FD5A 5FMPA 3B6CA 5H9TA 2RHAA 4W97A 5K7HA 5CW8A 3GEUA 5EYRA 3VOKA 5J1YA 1RKTA 3LJLA 2OI8A 1U9NA 4ABZA 3SDGA 3BTIA 3DCFA 3FK7A 4ACIA 3HTJA 3BHQA 2XGEA 3EUPA 3F0CA 2GFNA 2YVEA 2JJ7A 4GFKA 3VVYA 3ZQHA 3HGYA 2VKEA 2ZOZA 5D1RA 5AQCA 4UDSA 4AF5A 2QWTA 5J1RA 3GZIA 1JUPA 1RKWA 5F08A 2OERA 3LSPA 1UI6A 4GCTA 5IP6A 3VW0A 4V2FA 3HTIA 2FQ4A 4KWAA 3VVXA 3HE0A 2NX4A 5EZGA 3CJDA 2V57A 3BCGA 2IEKA 3VVZA 2O7OA 2GBYA 4L62A 5K58A 3COLA 3PM1A 4PXIA 4DW6A 3ON2A 5EFYA 3DPJA 2ZCNA 2RAEA 2XGCA 3P9TA 2WV1A 5F1JA 2XPUA 2XPVA 3HGGA 3NI7A 4YZEA 1T56A 4MK6A 2ZCXA 3MVPA 3G1LA 2F07A 3BTCA 5GP9A 3VW2A 2WGBA 3BNIA 3FRQA 4I76A 2TRTA 5J3LA 3C2BA 5CXIA 4AC6A 5C4YA 2Y2ZA 3E7QA 3ANPA 5EZHA 4D5FA 4M3GA 4W1UA 2XGDA 3NPIA 5FKNA 2GUHA 3CRJA 4AC0A 1JUSA 4CGRA 4M3EA 3AQTA 2FBQA 3LSJA 1ZKGA 4ME9A 2Y30A 3ANGA 3LWJA 3QKXA 5GPCA 4GCKA 2DTZA 3B6AA 5FKKA 2ID6A 4NN1A 2TCTA 1ORKA 2W53A 4JYKA 5D18A 5K7FA 3O8HA 4I6ZA 3ZQLA 5F04A 2RASA 3VP5A 4G12A 3CCYA 3WHBA 3ZQFA 3ZQIA 3BR2A 4M3BA 4JKZA 3EGQA 3FIWA 3O8GA 5HBUA 3AQSA 5IOZA 3VUQA 5FKOA 2JK3A 1SGMA 1JUMA 2IU5A 3KKCA 2HKUA 2Y31A 1JTXA 4M3DA 3TP3A 2UXOA 5HAWA 4NELA 3RD3A 2XB5A 4D7MA 2ZCMA 4JNNA 2I10A 2UXUA 3IH2A 3T6NA 3CDLA 2D6YA 4B1RA 2QKOA 5F0CA 2IAIA 5FKLA 1JT6A 3WHCA 2DG8A 2NS7A 4M3FA 3BTJA 2GENA 5J1UA 3G1OA 3VIBA 3HTHA 3LSRA 3QQAA 4X1EA 3BR6A 2ID3A 2UXPA 2UXHA 2X6OA 1BJZA 3HTAA 5IOYA 4D7NA 3DEWA 2HQ5A 3G7RA 3KNWA 3KKDA 5HSZA 1Z77A 2QCOA 4XK4A 2FJ1A 5IPAA 2REKA 5K7ZA 1QVUA 3S5RA 5DAJA 2G7SA 3NXCA 3NNRA 2NS8A 3F1BA 3ON4A 2G7GA 3LOCA 3LHQA 4AUXA 3C07A 5FGLA 2QIBA 2QTQA 2VPRA 4MXMA 4GFLA 3SFIA 4D5CA 2IBDA 3BQZA 2HXOA 2XDNA 5FKMA 2OF7A 5GPAA 3PASA 2G7LA 2XPWA 3V78A 2DG7A 1U9OA 3ZQGA 1T33A 3IUVA 3KZ9A 3VW1A 1JTYA 4ICHA 1VI0A 3TP0A 2O7TA 3BT9A 3JSJA 3VPRA 3G56A 2NP3A 3FK6A 1UI5A 3VOXA 3BR1A 4V2GA 3BTLA 2G3BA 3MNLA 2OPTA 2HXIA 4MO7A 3IH4A 2NP5A 4GCLA 3HIMA 3PPBA 3O60A 3G1MA 2ZOYA 3QPLA 3BJBA 2PZ9A 5F0FA 2HYTA 5D19A 3QPSA 5F0HA 2PBXA 2HYJA 2Q24A 2X9DA 2UXIA 1QVTA 2YVHA 3BQYA 1ZK8A 3BR5A 3Q0VA 3QBMA 1A6IA 2XRLA 4B3AA 3BRUA 5F27A 2WUIA 5FHPA 4JL3A 2G0EA 3Q3SA 3Q0UA 4HKUA 2EH3A 3NRGA 2FX0A 2QOPA 2ZB9A 1RPWA 1Z0XA 1QPIA 3BR0A 2VKVA 3BR3A 3RH2A 3Q0WA 5CXGA 3V6GA 1JT0A 3B81A 3IH3A 3CWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD5 A;  5FMP A;  3B6C A;  5H9T A;  2RHA A;  4W97 A;  5K7H A;  5CW8 A;  3GEU A;  5EYR A;  3VOK A;  5J1Y A;  1RKT A;  3LJL A;  2OI8 A;  1U9N A;  4ABZ A;  3SDG A;  3BTI A;  3DCF A;  3FK7 A;  4ACI A;  3HTJ A;  3BHQ A;  2XGE A;  3EUP A;  3F0C A;  2GFN A;  2YVE A;  2JJ7 A;  4GFK A;  3VVY A;  3ZQH A;  3HGY A;  2VKE A;  2ZOZ A;  5D1R A;  5AQC A;  4UDS A;  4AF5 A;  2QWT A;  5J1R A;  3GZI A;  1JUP A;  1RKW A;  5F08 A;  2OER A;  3LSP A;  1UI6 A;  4GCT A;  5IP6 A;  3VW0 A;  4V2F A;  3HTI A;  2FQ4 A;  4KWA A;  3VVX A;  3HE0 A;  2NX4 A;  5EZG A;  3CJD A;  2V57 A;  3BCG A;  2IEK A;  3VVZ A;  2O7O A;  2GBY A;  4L62 A;  5K58 A;  3COL A;  3PM1 A;  4PXI A;  4DW6 A;  3ON2 A;  5EFY A;  3DPJ A;  2ZCN A;  2RAE A;  2XGC A;  3P9T A;  2WV1 A;  5F1J A;  2XPU A;  2XPV A;  3HGG A;  3NI7 A;  4YZE A;  1T56 A;  4MK6 A;  2ZCX A;  3MVP A;  3G1L A;  2F07 A;  3BTC A;  5GP9 A;  3VW2 A;  2WGB A;  3BNI A;  3FRQ A;  4I76 A;  2TRT A;  5J3L A;  3C2B A;  5CXI A;  4AC6 A;  5C4Y A;  2Y2Z A;  3E7Q A;  3ANP A;  5EZH A;  4D5F A;  4M3G A;  4W1U A;  2XGD A;  3NPI A;  5FKN A;  2GUH A;  3CRJ A;  4AC0 A;  1JUS A;  4CGR A;  4M3E A;  3AQT A;  2FBQ A;  3LSJ A;  1ZKG A;  4ME9 A;  2Y30 A;  3ANG A;  3LWJ A;  3QKX A;  5GPC A;  4GCK A;  2DTZ A;  3B6A A;  5FKK A;  2ID6 A;  4NN1 A;  2TCT A;  1ORK A;  2W53 A;  4JYK A;  5D18 A;  5K7F A;  3O8H A;  4I6Z A;  3ZQL A;  5F04 A;  2RAS A;  3VP5 A;  4G12 A;  3CCY A;  3WHB A;  3ZQF A;  3ZQI A;  3BR2 A;  4M3B A;  4JKZ A;  3EGQ A;  3FIW A;  3O8G A;  5HBU A;  3AQS A;  5IOZ A;  3VUQ A;  5FKO A;  2JK3 A;  1SGM A;  1JUM A;  2IU5 A;  3KKC A;  2HKU A;  2Y31 A;  1JTX A;  4M3D A;  3TP3 A;  2UXO A;  5HAW A;  4NEL A;  3RD3 A;  2XB5 A;  4D7M A;  2ZCM A;  4JNN A;  2I10 A;  2UXU A;  3IH2 A;  3T6N A;  3CDL A;  2D6Y A;  4B1R A;  2QKO A;  5F0C A;  2IAI A;  5FKL A;  1JT6 A;  3WHC A;  2DG8 A;  2NS7 A;  4M3F A;  3BTJ A;  2GEN A;  5J1U A;  3G1O A;  3VIB A;  3HTH A;  3LSR A;  3QQA A;  4X1E A;  3BR6 A;  2ID3 A;  2UXP A;  2UXH A;  2X6O A;  1BJZ A;  3HTA A;  5IOY A;  4D7N A;  3DEW A;  2HQ5 A;  3G7R A;  3KNW A;  3KKD A;  5HSZ A;  1Z77 A;  2QCO A;  4XK4 A;  2FJ1 A;  5IPA A;  2REK A;  5K7Z A;  1QVU A;  3S5R A;  5DAJ A;  2G7S A;  3NXC A;  3NNR A;  2NS8 A;  3F1B A;  3ON4 A;  2G7G A;  3LOC A;  3LHQ A;  4AUX A;  3C07 A;  5FGL A;  2QIB A;  2QTQ A;  2VPR A;  4MXM A;  4GFL A;  3SFI A;  4D5C A;  2IBD A;  3BQZ A;  2HXO A;  2XDN A;  5FKM A;  2OF7 A;  5GPA A;  3PAS A;  2G7L A;  2XPW A;  3V78 A;  2DG7 A;  1U9O A;  3ZQG A;  1T33 A;  3IUV A;  3KZ9 A;  3VW1 A;  1JTY A;  4ICH A;  1VI0 A;  3TP0 A;  2O7T A;  3BT9 A;  3JSJ A;  3VPR A;  3G56 A;  2NP3 A;  3FK6 A;  1UI5 A;  3VOX A;  3BR1 A;  4V2G A;  3BTL A;  2G3B A;  3MNL A;  2OPT A;  2HXI A;  4MO7 A;  3IH4 A;  2NP5 A;  4GCL A;  3HIM A;  3PPB A;  3O60 A;  3G1M A;  2ZOY A;  3QPL A;  3BJB A;  2PZ9 A;  5F0F A;  2HYT A;  5D19 A;  3QPS A;  5F0H A;  2PBX A;  2HYJ A;  2Q24 A;  2X9D A;  2UXI A;  1QVT A;  2YVH A;  3BQY A;  1ZK8 A;  3BR5 A;  3Q0V A;  3QBM A;  1A6I A;  2XRL A;  4B3A A;  3BRU A;  5F27 A;  2WUI A;  5FHP A;  4JL3 A;  2G0E A;  3Q3S A;  3Q0U A;  4HKU A;  2EH3 A;  3NRG A;  2FX0 A;  2QOP A;  2ZB9 A;  1RPW A;  1Z0X A;  1QPI A;  3BR0 A;  2VKV A;  3BR3 A;  3RH2 A;  3Q0W A;  5CXG A;  3V6G A;  1JT0 A;  3B81 A;  3IH3 A;  3CWR A; 
#chains in the Genus database with same CATH topology
 2FD5 A;  5FMP A;  3B6C A;  5H9T A;  3FHN A;  2RHA A;  4W97 A;  5K7H A;  5CW8 A;  3GEU A;  5EYR A;  4DVY P;  3VOK A;  5J1Y A;  1RKT A;  3LJL A;  2OI8 A;  1U9N A;  4ABZ A;  3SDG A;  3BTI A;  3DCF A;  2R7Q A;  3FK7 A;  4ACI A;  3HTJ A;  3BHQ A;  2XGE A;  3EUP A;  3F0C A;  2GFN A;  3SWH A;  2YVE A;  2JJ7 A;  4GFK A;  3VVY A;  3ZQH A;  2ZY9 A;  3HGY A;  2VKE A;  2ZOZ A;  5D1R A;  5AQC A;  4UDS A;  2FJI 1;  4AF5 A;  2QWT A;  2R7S A;  3NS4 A;  5J1R A;  3GZI A;  1JUP A;  1RKW A;  5F08 A;  2OER A;  3LSP A;  1UI6 A;  4GCT A;  4C2M A;  5IP6 A;  3VW0 A;  4V2F A;  3HTI A;  2FQ4 A;  4KWA A;  4OD5 A;  3VVX A;  3HE0 A;  2NX4 A;  5EZG A;  3CJD A;  2V57 A;  3BCG A;  2IEK A;  3VVZ A;  2O7O A;  2GBY A;  4L62 A;  5K58 A;  3COL A;  3PM1 A;  4OD4 A;  4PXI A;  4DW6 A;  3KYL A;  3ON2 A;  5EFY A;  3DPJ A;  2ZCN A;  2RAE A;  2XGC A;  3P9T A;  4U9L A;  2WV1 A;  5F1J A;  2XPU A;  2XPV A;  3HGG A;  3NI7 A;  4YZE A;  1T56 A;  4MK6 A;  2ZCX A;  3MVP A;  3G1L A;  2F07 A;  3BTC A;  5GP9 A;  3VW2 A;  2WGB A;  2R7R A;  3BNI A;  3FRQ A;  4I76 A;  2TRT A;  5J3L A;  3C2B A;  5CXI A;  4AC6 A;  5C4Y A;  2Y2Z A;  3E7Q A;  3ANP A;  5EZH A;  4D5F A;  4M3G A;  4W1U A;  2XGD A;  3NPI A;  5FKN A;  2GUH A;  3CRJ A;  4AC0 A;  1JUS A;  2YVX A;  4CGR A;  4M3E A;  3AQT A;  2FBQ A;  3LSJ A;  1ZKG A;  4ME9 A;  2Y30 A;  3ANG A;  3LWJ A;  3QKX A;  5GPC A;  4GCK A;  2DTZ A;  3B6A A;  5FKK A;  2ID6 A;  4NN1 A;  2TCT A;  1ORK A;  2B1E A;  2W53 A;  4JYK A;  2R7W A;  4U9N A;  5D18 A;  5K7F A;  3O8H A;  4I6Z A;  3ZQL A;  5F04 A;  2RAS A;  3VP5 A;  4G12 A;  3CCY A;  3WHB A;  3ZQF A;  2R7V A;  3ZQI A;  3BR2 A;  4M3B A;  4JKZ A;  3EGQ A;  3FIW A;  3O8G A;  5HBU A;  3AQS A;  5IOZ A;  3VUQ A;  5FKO A;  3DU5 A;  2JK3 A;  1SGM A;  1JUM A;  2IU5 A;  3KKC A;  2HKU A;  2Y31 A;  1JTX A;  4M3D A;  3TP3 A;  2UXO A;  5HAW A;  4NEL A;  3RD3 A;  2XB5 A;  4D7M A;  2ZCM A;  4JNN A;  2I10 A;  2UXU A;  3IH2 A;  3T6N A;  3CDL A;  2D6Y A;  4B1R A;  2QKO A;  5F0C A;  2IAI A;  5FKL A;  1JT6 A;  3WHC A;  2DG8 A;  2NS7 A;  4M3F A;  3BTJ A;  2GEN A;  5J1U A;  2B3W A;  2R7U A;  3G1O A;  3VIB A;  3HTH A;  3LSR A;  3QQA A;  4X1E A;  3BR6 A;  2ID3 A;  2UXP A;  2UXH A;  2X6O A;  1BJZ A;  3HTA A;  5IOY A;  4D7N A;  3DEW A;  2HQ5 A;  3G7R A;  3KNW A;  3KKD A;  5HSZ A;  1Z77 A;  2QCO A;  4XK4 A;  2FJ1 A;  5IPA A;  2R7T A;  2REK A;  5K7Z A;  1QVU A;  3S5R A;  5DAJ A;  2G7S A;  3NXC A;  3NNR A;  2NS8 A;  3F1B A;  3ON4 A;  2G7G A;  3LOC A;  3LHQ A;  4AUX A;  3C07 A;  5FGL A;  2QIB A;  2QTQ A;  2VPR A;  3DU6 A;  4MXM A;  4GFL A;  3SFI A;  3K8P C;  4D5C A;  2IBD A;  3BQZ A;  2HXO A;  2XDN A;  5FKM A;  2OF7 A;  5GPA A;  3PAS A;  2G7L A;  2XPW A;  3V78 A;  2DG7 A;  1U9O A;  3ZQG A;  1T33 A;  3IUV A;  3KZ9 A;  3VW1 A;  1JTY A;  4ICH A;  1VI0 A;  3TP0 A;  2O7T A;  3BT9 A;  4WIB A;  3JSJ A;  3VPR A;  2R7O A;  3G56 A;  2NP3 A;  3FK6 A;  1UI5 A;  3VOX A;  3BR1 A;  4V2G A;  2R7X A;  3BTL A;  2G3B A;  3MNL A;  2OPT A;  2HXI A;  4MO7 A;  5CQG A;  3IH4 A;  2NP5 A;  4GCL A;  3HIM A;  3PPB A;  3O60 A;  3G1M A;  2ZOY A;  3QPL A;  3BJB A;  2PZ9 A;  5F0F A;  2HYT A;  5D19 A;  3QPS A;  5F0H A;  2PBX A;  2HYJ A;  2Q24 A;  2X9D A;  2UXI A;  1QVT A;  3VTI A;  2YVH A;  3BQY A;  1ZK8 A;  3BR5 A;  3Q0V A;  3QBM A;  1A6I A;  2A2F X;  2XRL A;  4B3A A;  3BRU A;  4IRV A;  5F27 A;  2PFV A;  2WUI A;  5FHP A;  4JL3 A;  2G0E A;  3Q3S A;  3Q0U A;  4HKU A;  2EH3 A;  3NRG A;  2FX0 A;  2QOP A;  2ZB9 A;  1RPW A;  1Z0X A;  1QPI A;  3BR0 A;  2VKV A;  3BR3 A;  3RH2 A;  3Q0W A;  5CXG A;  3V6G A;  1JT0 A;  3B81 A;  3IH3 A;  3CWR A; 
#chains in the Genus database with same CATH homology
 2FD5 A;  5FMP A;  3B6C A;  5H9T A;  2RHA A;  4W97 A;  5K7H A;  5CW8 A;  3GEU A;  5EYR A;  3VOK A;  5J1Y A;  1RKT A;  3LJL A;  2OI8 A;  1U9N A;  4ABZ A;  3SDG A;  3BTI A;  3DCF A;  3FK7 A;  4ACI A;  3HTJ A;  3BHQ A;  2XGE A;  3EUP A;  3F0C A;  2GFN A;  2YVE A;  2JJ7 A;  4GFK A;  3VVY A;  3ZQH A;  3HGY A;  2VKE A;  2ZOZ A;  5D1R A;  5AQC A;  4UDS A;  4AF5 A;  2QWT A;  5J1R A;  3GZI A;  1JUP A;  1RKW A;  5F08 A;  2OER A;  3LSP A;  1UI6 A;  4GCT A;  5IP6 A;  3VW0 A;  4V2F A;  3HTI A;  2FQ4 A;  4KWA A;  3VVX A;  3HE0 A;  2NX4 A;  5EZG A;  3CJD A;  2V57 A;  3BCG A;  2IEK A;  3VVZ A;  2O7O A;  2GBY A;  4L62 A;  5K58 A;  3COL A;  3PM1 A;  4PXI A;  4DW6 A;  3ON2 A;  5EFY A;  3DPJ A;  2ZCN A;  2RAE A;  2XGC A;  3P9T A;  2WV1 A;  5F1J A;  2XPU A;  2XPV A;  3HGG A;  3NI7 A;  4YZE A;  1T56 A;  4MK6 A;  2ZCX A;  3MVP A;  3G1L A;  2F07 A;  3BTC A;  5GP9 A;  3VW2 A;  2WGB A;  3BNI A;  3FRQ A;  4I76 A;  2TRT A;  5J3L A;  3C2B A;  5CXI A;  4AC6 A;  5C4Y A;  2Y2Z A;  3E7Q A;  3ANP A;  5EZH A;  4D5F A;  4M3G A;  4W1U A;  2XGD A;  3NPI A;  5FKN A;  2GUH A;  3CRJ A;  4AC0 A;  1JUS A;  4CGR A;  4M3E A;  3AQT A;  2FBQ A;  3LSJ A;  1ZKG A;  4ME9 A;  2Y30 A;  3ANG A;  3LWJ A;  3QKX A;  5GPC A;  4GCK A;  2DTZ A;  3B6A A;  5FKK A;  2ID6 A;  4NN1 A;  2TCT A;  1ORK A;  2W53 A;  4JYK A;  5D18 A;  5K7F A;  3O8H A;  4I6Z A;  3ZQL A;  5F04 A;  2RAS A;  3VP5 A;  4G12 A;  3CCY A;  3WHB A;  3ZQF A;  3ZQI A;  3BR2 A;  4M3B A;  4JKZ A;  3EGQ A;  3FIW A;  3O8G A;  5HBU A;  3AQS A;  5IOZ A;  3VUQ A;  5FKO A;  2JK3 A;  1SGM A;  1JUM A;  2IU5 A;  3KKC A;  2HKU A;  2Y31 A;  1JTX A;  4M3D A;  3TP3 A;  2UXO A;  5HAW A;  4NEL A;  3RD3 A;  2XB5 A;  4D7M A;  2ZCM A;  4JNN A;  2I10 A;  2UXU A;  3IH2 A;  3T6N A;  3CDL A;  2D6Y A;  4B1R A;  2QKO A;  5F0C A;  2IAI A;  5FKL A;  1JT6 A;  3WHC A;  2DG8 A;  2NS7 A;  4M3F A;  3BTJ A;  2GEN A;  5J1U A;  3G1O A;  3VIB A;  3HTH A;  3LSR A;  3QQA A;  4X1E A;  3BR6 A;  2ID3 A;  2UXP A;  2UXH A;  2X6O A;  1BJZ A;  3HTA A;  5IOY A;  4D7N A;  3DEW A;  2HQ5 A;  3G7R A;  3KNW A;  3KKD A;  5HSZ A;  1Z77 A;  2QCO A;  4XK4 A;  2FJ1 A;  5IPA A;  2REK A;  5K7Z A;  1QVU A;  3S5R A;  5DAJ A;  2G7S A;  3NXC A;  3NNR A;  2NS8 A;  3F1B A;  3ON4 A;  2G7G A;  3LOC A;  3LHQ A;  4AUX A;  3C07 A;  5FGL A;  2QIB A;  2QTQ A;  2VPR A;  4MXM A;  4GFL A;  3SFI A;  4D5C A;  2IBD A;  3BQZ A;  2HXO A;  2XDN A;  5FKM A;  2OF7 A;  5GPA A;  3PAS A;  2G7L A;  2XPW A;  3V78 A;  2DG7 A;  1U9O A;  3ZQG A;  1T33 A;  3IUV A;  3KZ9 A;  3VW1 A;  1JTY A;  4ICH A;  1VI0 A;  3TP0 A;  2O7T A;  3BT9 A;  3JSJ A;  3VPR A;  3G56 A;  2NP3 A;  3FK6 A;  1UI5 A;  3VOX A;  3BR1 A;  4V2G A;  3BTL A;  2G3B A;  3MNL A;  2OPT A;  2HXI A;  4MO7 A;  3IH4 A;  2NP5 A;  4GCL A;  3HIM A;  3PPB A;  3O60 A;  3G1M A;  2ZOY A;  3QPL A;  3BJB A;  2PZ9 A;  5F0F A;  2HYT A;  5D19 A;  3QPS A;  5F0H A;  2PBX A;  2HYJ A;  2Q24 A;  2X9D A;  2UXI A;  1QVT A;  2YVH A;  3BQY A;  1ZK8 A;  3BR5 A;  3Q0V A;  3QBM A;  1A6I A;  2XRL A;  4B3A A;  3BRU A;  5F27 A;  2WUI A;  5FHP A;  4JL3 A;  2G0E A;  3Q3S A;  3Q0U A;  4HKU A;  2EH3 A;  3NRG A;  2FX0 A;  2QOP A;  2ZB9 A;  1RPW A;  1Z0X A;  1QPI A;  3BR0 A;  2VKV A;  3BR3 A;  3RH2 A;  3Q0W A;  5CXG A;  3V6G A;  1JT0 A;  3B81 A;  3IH3 A;  3CWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...