3LJLA

The crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
SKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
molecule keywords transcriptional regulator LuxT
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ljlA00
3HIMA 2ZCXA 3BNIA 2G7LA 3O8GA 1RKWA 5F08A 3BCGA 3KKDA 4JL3A 3V78A 3HGYA 3HTHA 3DCFA 1JUPA 3VW0A 4AUXA 2GFNA 2VKVA 5FKOA 3VVXA 2YVHA 3QBMA 2NS8A 4X1EA 3CDLA 1QVUA 4XK4A 4GCLA 2WGBA 3NRGA 4W1UA 3V6GA 2RAEA 2JJ7A 5J1RA 3KKCA 3BTLA 5F0FA 2QKOA 3BR6A 2ID3A 5K7HA 3Q3SA 2PBXA 5HSZA 3GZIA 2ZOYA 5FHPA 3KZ9A 5EYRA 3EUPA 2GBYA 2ZCNA 4HKUA 1RPWA 3QQAA 4GCKA 4M3DA 2YVEA 5DAJA 4UDSA 5D18A 3ANGA 4M3BA 3COLA 3QPLA 3BR1A 2TCTA 3FIWA 5F0CA 2XB5A 3F0CA 2UXHA 2VKEA 5FKNA 2QCOA 5CXIA 4M3FA 4CGRA 1T33A 2Y2ZA 2IBDA 2HQ5A 2HKUA 4JNNA 2Y30A 1JUSA 3G7RA 3ZQGA 1JT6A 3VOXA 3BTIA 2XPVA 2X6OA 3BRUA 4MK6A 4MO7A 3HTJA 2JK3A 3LSJA 3IUVA 2G7GA 3WHCA 3TP3A 1U9OA 2XGEA 1VI0A 3RH2A 2UXPA 2TRTA 3HTAA 5GPCA 3NPIA 5FGLA 4B3AA 5F27A 3FK7A 3O8HA 2WUIA 3G1MA 5FKMA 5F0HA 3VOKA 3CJDA 2OPTA 2EH3A 3CWRA 3BQZA 2F07A 2PZ9A 2QTQA 2QIBA 1Z77A 3LOCA 2XGDA 2O7OA 5CXGA 1ZKGA 3AQTA 1JTYA 5K58A 4D7MA 5F04A 1SGMA 2I10A 5IP6A 2REKA 2NX4A 4M3EA 3C07A 3G56A 2QOPA 3ANPA 4M3GA 2V57A 3VVYA 5D1RA 3HE0A 4AF5A 3T6NA 4I6ZA 2HXOA 4PXIA 3Q0VA 3VPRA 3VW1A 3F1BA 2UXUA 4ME9A 2FBQA 2DG8A 5H9TA 3G1LA 5CW8A 3MNLA 5D19A 2G3BA 1UI6A 5C4YA 3E7QA 1QPIA 3MVPA 3QKXA 5IOYA 3FK6A 2D6YA 4ICHA 3WHBA 3ON2A 2ZB9A 5IOZA 3NXCA 2NP3A 2HXIA 4AC6A 3KNWA 5FKLA 3TP0A 2OERA 4G12A 3IH4A 2UXOA 3ON4A 4JYKA 3VP5A 1ZK8A 3BR5A 3GEUA 3CCYA 3LWJA 4W97A 4V2FA 4DW6A 3NI7A 3EGQA 4GFLA 1Z0XA 5EZGA 5GP9A 3BR3A 5EFYA 3LSRA 3P9TA 2IU5A 4ACIA 2FJ1A 5FMPA 3VUQA 2DG7A 1A6IA 3LHQA 1JTXA 4NN1A 2HYTA 1JT0A 4AC0A 3ZQLA 3RD3A 3NNRA 3ZQHA 4D5CA 5HBUA 2RHAA 3B6CA 3PM1A 3AQSA 3PASA 3IH3A 1QVTA 2IEKA 4MXMA 3BR2A 2DTZA 2IAIA 2UXIA 3QPSA 2NS7A 5GPAA 4YZEA 3BT9A 2NP5A 4KWAA 2XGCA 1RKTA 2FX0A 2FD5A 3BHQA 3HGGA 2Y31A 4D5FA 3ZQIA 2ZCMA 2Q24A 3FRQA 3LSPA 4NELA 2OI8A 2RASA 2XDNA 2GENA 5J1UA 2FQ4A 1U9NA 3BJBA 3SFIA 2QWTA 2GUHA 3VIBA 2WV1A 3B81A 4D7NA 1UI5A 1ORKA 3DPJA 2OF7A 4V2GA 3G1OA 3VW2A 3BR0A 3LJLA 5J3LA 2XPWA 3BTCA 2O7TA 5F1JA 1T56A 3JSJA 2G7SA 3DEWA 3S5RA 3SDGA 2G0EA 2XRLA 3CRJA 3B6AA 3VVZA 2ZOZA 5HAWA 3BQYA 5EZHA 2XPUA 4I76A 3HTIA 5AQCA 5K7FA 4L62A 3PPBA 4GFKA 4ABZA 2HYJA 2ID6A 3C2BA 3Q0WA 3O60A 4GCTA 5FKKA 2W53A 1BJZA 2VPRA 3IH2A 3ZQFA 5K7ZA 5IPAA 3BTJA 4JKZA 1JUMA 2X9DA 4B1RA 5J1YA 3Q0UA
chains in the Genus database with same CATH superfamily
3HIMA 4U9LA 2ZCXA 3BNIA 2G7LA 3O8GA 1RKWA 5F08A 3BCGA 3KKDA 4JL3A 3V78A 3HGYA 3HTHA 3DCFA 1JUPA 3VW0A 4AUXA 2GFNA 2VKVA 5FKOA 3VVXA 2YVHA 3QBMA 2NS8A 4X1EA 3CDLA 1QVUA 4XK4A 4GCLA 2WGBA 3NRGA 2R7TA 4W1UA 3V6GA 2RAEA 2JJ7A 5J1RA 3KKCA 3BTLA 5F0FA 3DU5A 2QKOA 3BR6A 2ID3A 5K7HA 3Q3SA 2PBXA 5HSZA 3GZIA 2ZOYA 5FHPA 3KZ9A 5EYRA 4C2MA 3EUPA 2GBYA 2ZCNA 4HKUA 1RPWA 3QQAA 4GCKA 4M3DA 2R7SA 2A2FX 2YVXA 2YVEA 5DAJA 4UDSA 5D18A 3ANGA 4M3BA 3COLA 3QPLA 3BR1A 2TCTA 3FIWA 5F0CA 4DVYP 2XB5A 3F0CA 2B1EA 2UXHA 2VKEA 2B3WA 5FKNA 2QCOA 5CXIA 4M3FA 4CGRA 3DU6A 1T33A 2R7QA 2Y2ZA 2IBDA 2HQ5A 2HKUA 4JNNA 2Y30A 1JUSA 3G7RA 3ZQGA 2ZY9A 1JT6A 3VOXA 3BTIA 2XPVA 2X6OA 3BRUA 4MK6A 4MO7A 3HTJA 2JK3A 3LSJA 3IUVA 2G7GA 3WHCA 3TP3A 1U9OA 2XGEA 1VI0A 3RH2A 2UXPA 2TRTA 3HTAA 5GPCA 3NPIA 4IRVA 5FGLA 4B3AA 5F27A 3FK7A 3O8HA 2WUIA 3G1MA 5FKMA 5F0HA 3VOKA 3CJDA 2OPTA 2EH3A 3CWRA 3BQZA 2F07A 2PZ9A 2QTQA 2QIBA 1Z77A 3LOCA 2XGDA 2O7OA 5CXGA 1ZKGA 3AQTA 1JTYA 5K58A 4D7MA 3KYLA 5F04A 1SGMA 2I10A 5IP6A 2REKA 2NX4A 4M3EA 3C07A 3G56A 2QOPA 3ANPA 4OD4A 4M3GA 2V57A 3VVYA 5D1RA 3HE0A 4AF5A 3T6NA 4I6ZA 2HXOA 4PXIA 3Q0VA 3VPRA 3VW1A 3F1BA 2UXUA 4ME9A 2FBQA 2DG8A 5H9TA 3G1LA 5CW8A 3MNLA 5D19A 2G3BA 1UI6A 5C4YA 4WIBA 3E7QA 1QPIA 3MVPA 3QKXA 5IOYA 3FK6A 2D6YA 4ICHA 3WHBA 3ON2A 2ZB9A 5IOZA 3NXCA 2NP3A 2HXIA 4AC6A 3KNWA 5FKLA 3FHNA 3K8PC 3TP0A 2OERA 4G12A 2R7OA 3IH4A 2UXOA 3ON4A 4JYKA 3VP5A 1ZK8A 3BR5A 3GEUA 3CCYA 3LWJA 4W97A 4V2FA 2R7XA 3NI7A 4DW6A 2FJI1 3EGQA 4GFLA 2R7VA 1Z0XA 5EZGA 5GP9A 3BR3A 5EFYA 3LSRA 3P9TA 4U9NA 2IU5A 4ACIA 2FJ1A 5FMPA 3VUQA 2DG7A 1A6IA 2PFVA 3LHQA 1JTXA 4NN1A 2HYTA 4OD5A 1JT0A 4AC0A 3ZQLA 3RD3A 3NNRA 3ZQHA 4D5CA 5HBUA 2RHAA 3B6CA 3PM1A 3AQSA 3PASA 2R7UA 3IH3A 1QVTA 2IEKA 4MXMA 3BR2A 2DTZA 2IAIA 2UXIA 3QPSA 2NS7A 5GPAA 4YZEA 3BT9A 2NP5A 4KWAA 2XGCA 1RKTA 2FX0A 2FD5A 3BHQA 3HGGA 5CQGA 2Y31A 4D5FA 3ZQIA 2ZCMA 2Q24A 3FRQA 3LSPA 4NELA 2OI8A 2RASA 2XDNA 2GENA 5J1UA 2FQ4A 1U9NA 3BJBA 3SFIA 3VTIA 2QWTA 2GUHA 3VIBA 2WV1A 3B81A 4D7NA 1UI5A 1ORKA 3DPJA 2OF7A 4V2GA 3G1OA 3VW2A 3BR0A 3LJLA 5J3LA 3SWHA 2XPWA 3BTCA 2O7TA 5F1JA 1T56A 3JSJA 2G7SA 3DEWA 3S5RA 3SDGA 2R7RA 2G0EA 2XRLA 3CRJA 3B6AA 3VVZA 2ZOZA 5HAWA 3BQYA 5EZHA 2XPUA 4I76A 3HTIA 5AQCA 5K7FA 4L62A 3PPBA 4GFKA 4ABZA 2HYJA 2ID6A 3C2BA 2R7WA 3Q0WA 3O60A 4GCTA 5FKKA 2W53A 3NS4A 1BJZA 2VPRA 3IH2A 3ZQFA 5K7ZA 5IPAA 3BTJA 4JKZA 1JUMA 2X9DA 4B1RA 5J1YA 3Q0UA
chains in the Genus database with same CATH topology
3HIMA 2ZCXA 3BNIA 2G7LA 3O8GA 1RKWA 5F08A 3BCGA 3KKDA 4JL3A 3V78A 3HGYA 3HTHA 3DCFA 1JUPA 3VW0A 4AUXA 2GFNA 2VKVA 5FKOA 3VVXA 2YVHA 3QBMA 2NS8A 4X1EA 3CDLA 1QVUA 4XK4A 4GCLA 2WGBA 3NRGA 4W1UA 3V6GA 2RAEA 2JJ7A 5J1RA 3KKCA 3BTLA 5F0FA 2QKOA 3BR6A 2ID3A 5K7HA 3Q3SA 2PBXA 5HSZA 3GZIA 2ZOYA 5FHPA 3KZ9A 5EYRA 3EUPA 2GBYA 2ZCNA 4HKUA 1RPWA 3QQAA 4GCKA 4M3DA 2YVEA 5DAJA 4UDSA 5D18A 3ANGA 4M3BA 3COLA 3QPLA 3BR1A 2TCTA 3FIWA 5F0CA 2XB5A 3F0CA 2UXHA 2VKEA 5FKNA 2QCOA 5CXIA 4M3FA 4CGRA 1T33A 2Y2ZA 2IBDA 2HQ5A 2HKUA 4JNNA 2Y30A 1JUSA 3G7RA 3ZQGA 1JT6A 3VOXA 3BTIA 2XPVA 2X6OA 3BRUA 4MK6A 4MO7A 3HTJA 2JK3A 3LSJA 3IUVA 2G7GA 3WHCA 3TP3A 1U9OA 2XGEA 1VI0A 3RH2A 2UXPA 2TRTA 3HTAA 5GPCA 3NPIA 5FGLA 4B3AA 5F27A 3FK7A 3O8HA 2WUIA 3G1MA 5FKMA 5F0HA 3VOKA 3CJDA 2OPTA 2EH3A 3CWRA 3BQZA 2F07A 2PZ9A 2QTQA 2QIBA 1Z77A 3LOCA 2XGDA 2O7OA 5CXGA 1ZKGA 3AQTA 1JTYA 5K58A 4D7MA 5F04A 1SGMA 2I10A 5IP6A 2REKA 2NX4A 4M3EA 3C07A 3G56A 2QOPA 3ANPA 4M3GA 2V57A 3VVYA 5D1RA 3HE0A 4AF5A 3T6NA 4I6ZA 2HXOA 4PXIA 3Q0VA 3VPRA 3VW1A 3F1BA 2UXUA 4ME9A 2FBQA 2DG8A 5H9TA 3G1LA 5CW8A 3MNLA 5D19A 2G3BA 1UI6A 5C4YA 3E7QA 1QPIA 3MVPA 3QKXA 5IOYA 3FK6A 2D6YA 4ICHA 3WHBA 3ON2A 2ZB9A 5IOZA 3NXCA 2NP3A 2HXIA 4AC6A 3KNWA 5FKLA 3TP0A 2OERA 4G12A 3IH4A 2UXOA 3ON4A 4JYKA 3VP5A 1ZK8A 3BR5A 3GEUA 3CCYA 3LWJA 4W97A 4V2FA 4DW6A 3NI7A 3EGQA 4GFLA 1Z0XA 5EZGA 5GP9A 3BR3A 5EFYA 3LSRA 3P9TA 2IU5A 4ACIA 2FJ1A 5FMPA 3VUQA 2DG7A 1A6IA 3LHQA 1JTXA 4NN1A 2HYTA 1JT0A 4AC0A 3ZQLA 3RD3A 3NNRA 3ZQHA 4D5CA 5HBUA 2RHAA 3B6CA 3PM1A 3AQSA 3PASA 3IH3A 1QVTA 2IEKA 4MXMA 3BR2A 2DTZA 2IAIA 2UXIA 3QPSA 2NS7A 5GPAA 4YZEA 3BT9A 2NP5A 4KWAA 2XGCA 1RKTA 2FX0A 2FD5A 3BHQA 3HGGA 2Y31A 4D5FA 3ZQIA 2ZCMA 2Q24A 3FRQA 3LSPA 4NELA 2OI8A 2RASA 2XDNA 2GENA 5J1UA 2FQ4A 1U9NA 3BJBA 3SFIA 2QWTA 2GUHA 3VIBA 2WV1A 3B81A 4D7NA 1UI5A 1ORKA 3DPJA 2OF7A 4V2GA 3G1OA 3VW2A 3BR0A 3LJLA 5J3LA 2XPWA 3BTCA 2O7TA 5F1JA 1T56A 3JSJA 2G7SA 3DEWA 3S5RA 3SDGA 2G0EA 2XRLA 3CRJA 3B6AA 3VVZA 2ZOZA 5HAWA 3BQYA 5EZHA 2XPUA 4I76A 3HTIA 5AQCA 5K7FA 4L62A 3PPBA 4GFKA 4ABZA 2HYJA 2ID6A 3C2BA 3Q0WA 3O60A 4GCTA 5FKKA 2W53A 1BJZA 2VPRA 3IH2A 3ZQFA 5K7ZA 5IPAA 3BTJA 4JKZA 1JUMA 2X9DA 4B1RA 5J1YA 3Q0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIM A;  2ZCX A;  3BNI A;  2G7L A;  3O8G A;  1RKW A;  5F08 A;  3BCG A;  3KKD A;  4JL3 A;  3V78 A;  3HGY A;  3HTH A;  3DCF A;  1JUP A;  3VW0 A;  4AUX A;  2GFN A;  2VKV A;  5FKO A;  3VVX A;  2YVH A;  3QBM A;  2NS8 A;  4X1E A;  3CDL A;  1QVU A;  4XK4 A;  4GCL A;  2WGB A;  3NRG A;  4W1U A;  3V6G A;  2RAE A;  2JJ7 A;  5J1R A;  3KKC A;  3BTL A;  5F0F A;  2QKO A;  3BR6 A;  2ID3 A;  5K7H A;  3Q3S A;  2PBX A;  5HSZ A;  3GZI A;  2ZOY A;  5FHP A;  3KZ9 A;  5EYR A;  3EUP A;  2GBY A;  2ZCN A;  4HKU A;  1RPW A;  3QQA A;  4GCK A;  4M3D A;  2YVE A;  5DAJ A;  4UDS A;  5D18 A;  3ANG A;  4M3B A;  3COL A;  3QPL A;  3BR1 A;  2TCT A;  3FIW A;  5F0C A;  2XB5 A;  3F0C A;  2UXH A;  2VKE A;  5FKN A;  2QCO A;  5CXI A;  4M3F A;  4CGR A;  1T33 A;  2Y2Z A;  2IBD A;  2HQ5 A;  2HKU A;  4JNN A;  2Y30 A;  1JUS A;  3G7R A;  3ZQG A;  1JT6 A;  3VOX A;  3BTI A;  2XPV A;  2X6O A;  3BRU A;  4MK6 A;  4MO7 A;  3HTJ A;  2JK3 A;  3LSJ A;  3IUV A;  2G7G A;  3WHC A;  3TP3 A;  1U9O A;  2XGE A;  1VI0 A;  3RH2 A;  2UXP A;  2TRT A;  3HTA A;  5GPC A;  3NPI A;  5FGL A;  4B3A A;  5F27 A;  3FK7 A;  3O8H A;  2WUI A;  3G1M A;  5FKM A;  5F0H A;  3VOK A;  3CJD A;  2OPT A;  2EH3 A;  3CWR A;  3BQZ A;  2F07 A;  2PZ9 A;  2QTQ A;  2QIB A;  1Z77 A;  3LOC A;  2XGD A;  2O7O A;  5CXG A;  1ZKG A;  3AQT A;  1JTY A;  5K58 A;  4D7M A;  5F04 A;  1SGM A;  2I10 A;  5IP6 A;  2REK A;  2NX4 A;  4M3E A;  3C07 A;  3G56 A;  2QOP A;  3ANP A;  4M3G A;  2V57 A;  3VVY A;  5D1R A;  3HE0 A;  4AF5 A;  3T6N A;  4I6Z A;  2HXO A;  4PXI A;  3Q0V A;  3VPR A;  3VW1 A;  3F1B A;  2UXU A;  4ME9 A;  2FBQ A;  2DG8 A;  5H9T A;  3G1L A;  5CW8 A;  3MNL A;  5D19 A;  2G3B A;  1UI6 A;  5C4Y A;  3E7Q A;  1QPI A;  3MVP A;  3QKX A;  5IOY A;  3FK6 A;  2D6Y A;  4ICH A;  3WHB A;  3ON2 A;  2ZB9 A;  5IOZ A;  3NXC A;  2NP3 A;  2HXI A;  4AC6 A;  3KNW A;  5FKL A;  3TP0 A;  2OER A;  4G12 A;  3IH4 A;  2UXO A;  3ON4 A;  4JYK A;  3VP5 A;  1ZK8 A;  3BR5 A;  3GEU A;  3CCY A;  3LWJ A;  4W97 A;  4V2F A;  4DW6 A;  3NI7 A;  3EGQ A;  4GFL A;  1Z0X A;  5EZG A;  5GP9 A;  3BR3 A;  5EFY A;  3LSR A;  3P9T A;  2IU5 A;  4ACI A;  2FJ1 A;  5FMP A;  3VUQ A;  2DG7 A;  1A6I A;  3LHQ A;  1JTX A;  4NN1 A;  2HYT A;  1JT0 A;  4AC0 A;  3ZQL A;  3RD3 A;  3NNR A;  3ZQH A;  4D5C A;  5HBU A;  2RHA A;  3B6C A;  3PM1 A;  3AQS A;  3PAS A;  3IH3 A;  1QVT A;  2IEK A;  4MXM A;  3BR2 A;  2DTZ A;  2IAI A;  2UXI A;  3QPS A;  2NS7 A;  5GPA A;  4YZE A;  3BT9 A;  2NP5 A;  4KWA A;  2XGC A;  1RKT A;  2FX0 A;  2FD5 A;  3BHQ A;  3HGG A;  2Y31 A;  4D5F A;  3ZQI A;  2ZCM A;  2Q24 A;  3FRQ A;  3LSP A;  4NEL A;  2OI8 A;  2RAS A;  2XDN A;  2GEN A;  5J1U A;  2FQ4 A;  1U9N A;  3BJB A;  3SFI A;  2QWT A;  2GUH A;  3VIB A;  2WV1 A;  3B81 A;  4D7N A;  1UI5 A;  1ORK A;  3DPJ A;  2OF7 A;  4V2G A;  3G1O A;  3VW2 A;  3BR0 A;  3LJL A;  5J3L A;  2XPW A;  3BTC A;  2O7T A;  5F1J A;  1T56 A;  3JSJ A;  2G7S A;  3DEW A;  3S5R A;  3SDG A;  2G0E A;  2XRL A;  3CRJ A;  3B6A A;  3VVZ A;  2ZOZ A;  5HAW A;  3BQY A;  5EZH A;  2XPU A;  4I76 A;  3HTI A;  5AQC A;  5K7F A;  4L62 A;  3PPB A;  4GFK A;  4ABZ A;  2HYJ A;  2ID6 A;  3C2B A;  3Q0W A;  3O60 A;  4GCT A;  5FKK A;  2W53 A;  1BJZ A;  2VPR A;  3IH2 A;  3ZQF A;  5K7Z A;  5IPA A;  3BTJ A;  4JKZ A;  1JUM A;  2X9D A;  4B1R A;  5J1Y A;  3Q0U A; 
#chains in the Genus database with same CATH topology
 3HIM A;  4U9L A;  2ZCX A;  3BNI A;  2G7L A;  3O8G A;  1RKW A;  5F08 A;  3BCG A;  3KKD A;  4JL3 A;  3V78 A;  3HGY A;  3HTH A;  3DCF A;  1JUP A;  3VW0 A;  4AUX A;  2GFN A;  2VKV A;  5FKO A;  3VVX A;  2YVH A;  3QBM A;  2NS8 A;  4X1E A;  3CDL A;  1QVU A;  4XK4 A;  4GCL A;  2WGB A;  3NRG A;  2R7T A;  4W1U A;  3V6G A;  2RAE A;  2JJ7 A;  5J1R A;  3KKC A;  3BTL A;  5F0F A;  3DU5 A;  2QKO A;  3BR6 A;  2ID3 A;  5K7H A;  3Q3S A;  2PBX A;  5HSZ A;  3GZI A;  2ZOY A;  5FHP A;  3KZ9 A;  5EYR A;  4C2M A;  3EUP A;  2GBY A;  2ZCN A;  4HKU A;  1RPW A;  3QQA A;  4GCK A;  4M3D A;  2R7S A;  2A2F X;  2YVX A;  2YVE A;  5DAJ A;  4UDS A;  5D18 A;  3ANG A;  4M3B A;  3COL A;  3QPL A;  3BR1 A;  2TCT A;  3FIW A;  5F0C A;  4DVY P;  2XB5 A;  3F0C A;  2B1E A;  2UXH A;  2VKE A;  2B3W A;  5FKN A;  2QCO A;  5CXI A;  4M3F A;  4CGR A;  3DU6 A;  1T33 A;  2R7Q A;  2Y2Z A;  2IBD A;  2HQ5 A;  2HKU A;  4JNN A;  2Y30 A;  1JUS A;  3G7R A;  3ZQG A;  2ZY9 A;  1JT6 A;  3VOX A;  3BTI A;  2XPV A;  2X6O A;  3BRU A;  4MK6 A;  4MO7 A;  3HTJ A;  2JK3 A;  3LSJ A;  3IUV A;  2G7G A;  3WHC A;  3TP3 A;  1U9O A;  2XGE A;  1VI0 A;  3RH2 A;  2UXP A;  2TRT A;  3HTA A;  5GPC A;  3NPI A;  4IRV A;  5FGL A;  4B3A A;  5F27 A;  3FK7 A;  3O8H A;  2WUI A;  3G1M A;  5FKM A;  5F0H A;  3VOK A;  3CJD A;  2OPT A;  2EH3 A;  3CWR A;  3BQZ A;  2F07 A;  2PZ9 A;  2QTQ A;  2QIB A;  1Z77 A;  3LOC A;  2XGD A;  2O7O A;  5CXG A;  1ZKG A;  3AQT A;  1JTY A;  5K58 A;  4D7M A;  3KYL A;  5F04 A;  1SGM A;  2I10 A;  5IP6 A;  2REK A;  2NX4 A;  4M3E A;  3C07 A;  3G56 A;  2QOP A;  3ANP A;  4OD4 A;  4M3G A;  2V57 A;  3VVY A;  5D1R A;  3HE0 A;  4AF5 A;  3T6N A;  4I6Z A;  2HXO A;  4PXI A;  3Q0V A;  3VPR A;  3VW1 A;  3F1B A;  2UXU A;  4ME9 A;  2FBQ A;  2DG8 A;  5H9T A;  3G1L A;  5CW8 A;  3MNL A;  5D19 A;  2G3B A;  1UI6 A;  5C4Y A;  4WIB A;  3E7Q A;  1QPI A;  3MVP A;  3QKX A;  5IOY A;  3FK6 A;  2D6Y A;  4ICH A;  3WHB A;  3ON2 A;  2ZB9 A;  5IOZ A;  3NXC A;  2NP3 A;  2HXI A;  4AC6 A;  3KNW A;  5FKL A;  3FHN A;  3K8P C;  3TP0 A;  2OER A;  4G12 A;  2R7O A;  3IH4 A;  2UXO A;  3ON4 A;  4JYK A;  3VP5 A;  1ZK8 A;  3BR5 A;  3GEU A;  3CCY A;  3LWJ A;  4W97 A;  4V2F A;  2R7X A;  3NI7 A;  4DW6 A;  2FJI 1;  3EGQ A;  4GFL A;  2R7V A;  1Z0X A;  5EZG A;  5GP9 A;  3BR3 A;  5EFY A;  3LSR A;  3P9T A;  4U9N A;  2IU5 A;  4ACI A;  2FJ1 A;  5FMP A;  3VUQ A;  2DG7 A;  1A6I A;  2PFV A;  3LHQ A;  1JTX A;  4NN1 A;  2HYT A;  4OD5 A;  1JT0 A;  4AC0 A;  3ZQL A;  3RD3 A;  3NNR A;  3ZQH A;  4D5C A;  5HBU A;  2RHA A;  3B6C A;  3PM1 A;  3AQS A;  3PAS A;  2R7U A;  3IH3 A;  1QVT A;  2IEK A;  4MXM A;  3BR2 A;  2DTZ A;  2IAI A;  2UXI A;  3QPS A;  2NS7 A;  5GPA A;  4YZE A;  3BT9 A;  2NP5 A;  4KWA A;  2XGC A;  1RKT A;  2FX0 A;  2FD5 A;  3BHQ A;  3HGG A;  5CQG A;  2Y31 A;  4D5F A;  3ZQI A;  2ZCM A;  2Q24 A;  3FRQ A;  3LSP A;  4NEL A;  2OI8 A;  2RAS A;  2XDN A;  2GEN A;  5J1U A;  2FQ4 A;  1U9N A;  3BJB A;  3SFI A;  3VTI A;  2QWT A;  2GUH A;  3VIB A;  2WV1 A;  3B81 A;  4D7N A;  1UI5 A;  1ORK A;  3DPJ A;  2OF7 A;  4V2G A;  3G1O A;  3VW2 A;  3BR0 A;  3LJL A;  5J3L A;  3SWH A;  2XPW A;  3BTC A;  2O7T A;  5F1J A;  1T56 A;  3JSJ A;  2G7S A;  3DEW A;  3S5R A;  3SDG A;  2R7R A;  2G0E A;  2XRL A;  3CRJ A;  3B6A A;  3VVZ A;  2ZOZ A;  5HAW A;  3BQY A;  5EZH A;  2XPU A;  4I76 A;  3HTI A;  5AQC A;  5K7F A;  4L62 A;  3PPB A;  4GFK A;  4ABZ A;  2HYJ A;  2ID6 A;  3C2B A;  2R7W A;  3Q0W A;  3O60 A;  4GCT A;  5FKK A;  2W53 A;  3NS4 A;  1BJZ A;  2VPR A;  3IH2 A;  3ZQF A;  5K7Z A;  5IPA A;  3BTJ A;  4JKZ A;  1JUM A;  2X9D A;  4B1R A;  5J1Y A;  3Q0U A; 
#chains in the Genus database with same CATH homology
 3HIM A;  2ZCX A;  3BNI A;  2G7L A;  3O8G A;  1RKW A;  5F08 A;  3BCG A;  3KKD A;  4JL3 A;  3V78 A;  3HGY A;  3HTH A;  3DCF A;  1JUP A;  3VW0 A;  4AUX A;  2GFN A;  2VKV A;  5FKO A;  3VVX A;  2YVH A;  3QBM A;  2NS8 A;  4X1E A;  3CDL A;  1QVU A;  4XK4 A;  4GCL A;  2WGB A;  3NRG A;  4W1U A;  3V6G A;  2RAE A;  2JJ7 A;  5J1R A;  3KKC A;  3BTL A;  5F0F A;  2QKO A;  3BR6 A;  2ID3 A;  5K7H A;  3Q3S A;  2PBX A;  5HSZ A;  3GZI A;  2ZOY A;  5FHP A;  3KZ9 A;  5EYR A;  3EUP A;  2GBY A;  2ZCN A;  4HKU A;  1RPW A;  3QQA A;  4GCK A;  4M3D A;  2YVE A;  5DAJ A;  4UDS A;  5D18 A;  3ANG A;  4M3B A;  3COL A;  3QPL A;  3BR1 A;  2TCT A;  3FIW A;  5F0C A;  2XB5 A;  3F0C A;  2UXH A;  2VKE A;  5FKN A;  2QCO A;  5CXI A;  4M3F A;  4CGR A;  1T33 A;  2Y2Z A;  2IBD A;  2HQ5 A;  2HKU A;  4JNN A;  2Y30 A;  1JUS A;  3G7R A;  3ZQG A;  1JT6 A;  3VOX A;  3BTI A;  2XPV A;  2X6O A;  3BRU A;  4MK6 A;  4MO7 A;  3HTJ A;  2JK3 A;  3LSJ A;  3IUV A;  2G7G A;  3WHC A;  3TP3 A;  1U9O A;  2XGE A;  1VI0 A;  3RH2 A;  2UXP A;  2TRT A;  3HTA A;  5GPC A;  3NPI A;  5FGL A;  4B3A A;  5F27 A;  3FK7 A;  3O8H A;  2WUI A;  3G1M A;  5FKM A;  5F0H A;  3VOK A;  3CJD A;  2OPT A;  2EH3 A;  3CWR A;  3BQZ A;  2F07 A;  2PZ9 A;  2QTQ A;  2QIB A;  1Z77 A;  3LOC A;  2XGD A;  2O7O A;  5CXG A;  1ZKG A;  3AQT A;  1JTY A;  5K58 A;  4D7M A;  5F04 A;  1SGM A;  2I10 A;  5IP6 A;  2REK A;  2NX4 A;  4M3E A;  3C07 A;  3G56 A;  2QOP A;  3ANP A;  4M3G A;  2V57 A;  3VVY A;  5D1R A;  3HE0 A;  4AF5 A;  3T6N A;  4I6Z A;  2HXO A;  4PXI A;  3Q0V A;  3VPR A;  3VW1 A;  3F1B A;  2UXU A;  4ME9 A;  2FBQ A;  2DG8 A;  5H9T A;  3G1L A;  5CW8 A;  3MNL A;  5D19 A;  2G3B A;  1UI6 A;  5C4Y A;  3E7Q A;  1QPI A;  3MVP A;  3QKX A;  5IOY A;  3FK6 A;  2D6Y A;  4ICH A;  3WHB A;  3ON2 A;  2ZB9 A;  5IOZ A;  3NXC A;  2NP3 A;  2HXI A;  4AC6 A;  3KNW A;  5FKL A;  3TP0 A;  2OER A;  4G12 A;  3IH4 A;  2UXO A;  3ON4 A;  4JYK A;  3VP5 A;  1ZK8 A;  3BR5 A;  3GEU A;  3CCY A;  3LWJ A;  4W97 A;  4V2F A;  4DW6 A;  3NI7 A;  3EGQ A;  4GFL A;  1Z0X A;  5EZG A;  5GP9 A;  3BR3 A;  5EFY A;  3LSR A;  3P9T A;  2IU5 A;  4ACI A;  2FJ1 A;  5FMP A;  3VUQ A;  2DG7 A;  1A6I A;  3LHQ A;  1JTX A;  4NN1 A;  2HYT A;  1JT0 A;  4AC0 A;  3ZQL A;  3RD3 A;  3NNR A;  3ZQH A;  4D5C A;  5HBU A;  2RHA A;  3B6C A;  3PM1 A;  3AQS A;  3PAS A;  3IH3 A;  1QVT A;  2IEK A;  4MXM A;  3BR2 A;  2DTZ A;  2IAI A;  2UXI A;  3QPS A;  2NS7 A;  5GPA A;  4YZE A;  3BT9 A;  2NP5 A;  4KWA A;  2XGC A;  1RKT A;  2FX0 A;  2FD5 A;  3BHQ A;  3HGG A;  2Y31 A;  4D5F A;  3ZQI A;  2ZCM A;  2Q24 A;  3FRQ A;  3LSP A;  4NEL A;  2OI8 A;  2RAS A;  2XDN A;  2GEN A;  5J1U A;  2FQ4 A;  1U9N A;  3BJB A;  3SFI A;  2QWT A;  2GUH A;  3VIB A;  2WV1 A;  3B81 A;  4D7N A;  1UI5 A;  1ORK A;  3DPJ A;  2OF7 A;  4V2G A;  3G1O A;  3VW2 A;  3BR0 A;  3LJL A;  5J3L A;  2XPW A;  3BTC A;  2O7T A;  5F1J A;  1T56 A;  3JSJ A;  2G7S A;  3DEW A;  3S5R A;  3SDG A;  2G0E A;  2XRL A;  3CRJ A;  3B6A A;  3VVZ A;  2ZOZ A;  5HAW A;  3BQY A;  5EZH A;  2XPU A;  4I76 A;  3HTI A;  5AQC A;  5K7F A;  4L62 A;  3PPB A;  4GFK A;  4ABZ A;  2HYJ A;  2ID6 A;  3C2B A;  3Q0W A;  3O60 A;  4GCT A;  5FKK A;  2W53 A;  1BJZ A;  2VPR A;  3IH2 A;  3ZQF A;  5K7Z A;  5IPA A;  3BTJ A;  4JKZ A;  1JUM A;  2X9D A;  4B1R A;  5J1Y A;  3Q0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...