3LJLA

The crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
SKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
molecule keywords transcriptional regulator LuxT
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ljlA00
3P9TA 3CJDA 3O8HA 4AC0A 1JUSA 5GPAA 4JYKA 3FRQA 5CW8A 4D5FA 4GCKA 3QBMA 3IH3A 3LJLA 3JSJA 3F0CA 3IH2A 2WUIA 3TP0A 2FQ4A 2HQ5A 3ZQFA 5EFYA 3BTLA 2OPTA 1U9OA 3NXCA 3EUPA 1T56A 2G7LA 5F08A 3QQAA 3BTIA 3LOCA 2ZOYA 4AUXA 3SFIA 4UDSA 2TRTA 1QVUA 1VI0A 2PZ9A 1SGMA 3BR0A 5GPCA 3WHBA 3RD3A 5FKLA 3VW1A 5K7FA 3ON4A 2Y30A 3NI7A 2TCTA 1ORKA 3BR5A 4I6ZA 2NS8A 5F0FA 3LWJA 2GFNA 3CCYA 3KNWA 2UXUA 5FKMA 2I10A 2GUHA 3NRGA 3CRJA 2EH3A 4GCTA 1T33A 3ANPA 3V6GA 3IUVA 2VKEA 1UI6A 1BJZA 3HE0A 3EGQA 4GFKA 5D1RA 1JUMA 5J1UA 5EYRA 3RH2A 3VOXA 5IOZA 2Y2ZA 2XB5A 5HBUA 2RHAA 3PM1A 3LSRA 3ZQIA 5F04A 2QCOA 1JUPA 3VW0A 4PXIA 2HYTA 4ME9A 2O7TA 2XRLA 1Z77A 2WV1A 2QOPA 3PASA 4I76A 2G7GA 3V78A 5J1RA 2GENA 1JTXA 5D19A 2NP3A 5CXGA 5IPAA 2Q24A 1RPWA 2XGCA 5FGLA 1A6IA 3BR3A 1ZK8A 3VPRA 3ZQGA 2ZB9A 2QWTA 2ID3A 5IOYA 5DAJA 3ON2A 1RKTA 2F07A 3B6CA 5K58A 2D6YA 3VP5A 4NELA 4MXMA 4AF5A 2JJ7A 2REKA 2HXOA 2OF7A 3Q0VA 3TP3A 1ZKGA 3BTJA 3C2BA 3KKCA 2FD5A 3PPBA 2XPUA 3BTCA 4D7MA 3LHQA 4M3EA 5FMPA 2VPRA 2YVEA 5K7HA 4JNNA 2XDNA 3G1LA 3VUQA 2PBXA 2G7SA 4W1UA 3T6NA 3Q0WA 4YZEA 3VVXA 4B1RA 4DW6A 4L62A 2JK3A 2XPWA 3VIBA 3F1BA 3COLA 5K7ZA 2NP5A 3GEUA 5FKNA 2FJ1A 5FKOA 3G56A 4M3BA 4X1EA 2UXOA 3C07A 3B81A 2NS7A 5J3LA 3AQSA 3GZIA 4JL3A 5D18A 2QIBA 2ZCXA 4ABZA 3HIMA 2QKOA 5H9TA 3BT9A 4M3GA 3WHCA 3KKDA 4W97A 2ZCNA 5FHPA 4GCLA 3BQZA 2X6OA 3VW2A 2DG7A 3ZQHA 5CXIA 5AQCA 5GP9A 3ANGA 3AQTA 3HTIA 3DCFA 3VVZA 3VOKA 2OERA 1RKWA 1U9NA 3NNRA 4D5CA 2DTZA 4V2GA 4CGRA 1JT6A 3BQYA 4JKZA 3BR1A 2FX0A 2G0EA 3G1OA 2G3BA 4B3AA 2GBYA 2IEKA 5IP6A 5FKKA 2IU5A 4ACIA 3HTAA 4AC6A 2WGBA 3FIWA 3O8GA 3FK7A 2UXPA 2XGEA 3SDGA 3BR6A 2W53A 5F1JA 2ZOZA 3ZQLA 4D7NA 5EZGA 2O7OA 2HXIA 3BHQA 3BJBA 2ZCMA 3IH4A 3MVPA 4HKUA 1UI5A 3G7RA 3QPSA 3VVYA 2Y31A 2DG8A 2HKUA 4V2FA 5HAWA 3DPJA 1QVTA 2VKVA 4GFLA 4M3FA 3B6AA 4XK4A 3QPLA 5J1YA 3HGGA 2IAIA 3BCGA 4NN1A 5EZHA 3HTHA 3BR2A 2XPVA 5F27A 2ID6A 5C4YA 5F0HA 3LSJA 4MK6A 1QPIA 3FK6A 2RAEA 2XGDA 4MO7A 2OI8A 2YVHA 2UXIA 1JT0A 3LSPA 2UXHA 3DEWA 3QKXA 4ICHA 3BNIA 4G12A 3CWRA 3HTJA 3CDLA 3Q3SA 2NX4A 3S5RA 4KWAA 3G1MA 2QTQA 2IBDA 3Q0UA 4M3DA 2RASA 2FBQA 3BRUA 3NPIA 3KZ9A 3HGYA 3O60A 2V57A 3MNLA 1Z0XA 5F0CA 3E7QA 2X9DA 2HYJA 1JTYA 5HSZA
chains in the Genus database with same CATH superfamily
3P9TA 3CJDA 3O8HA 2B1EA 4AC0A 1JUSA 5GPAA 4JYKA 3FRQA 5CW8A 4D5FA 4GCKA 3QBMA 3IH3A 3LJLA 3JSJA 3F0CA 3IH2A 2WUIA 3TP0A 2FQ4A 2HQ5A 3ZQFA 2R7VA 5EFYA 3BTLA 2OPTA 1U9OA 3NXCA 3EUPA 1T56A 2G7LA 5F08A 3QQAA 3BTIA 3LOCA 3FHNA 2YVXA 2ZOYA 4AUXA 3SFIA 4UDSA 2TRTA 1QVUA 1VI0A 2PZ9A 1SGMA 3BR0A 5GPCA 2FJI1 3WHBA 3RD3A 5FKLA 3VW1A 5K7FA 3ON4A 2Y30A 3NI7A 2TCTA 1ORKA 3BR5A 4I6ZA 2NS8A 5F0FA 3LWJA 4DVYP 2GFNA 3CCYA 3KNWA 2UXUA 5CQGA 5FKMA 2I10A 2GUHA 3NRGA 3CRJA 2EH3A 4GCTA 1T33A 3ANPA 3V6GA 3IUVA 2VKEA 1UI6A 1BJZA 3HE0A 3EGQA 4GFKA 3DU6A 5D1RA 1JUMA 5J1UA 5EYRA 3RH2A 3VOXA 5IOZA 2Y2ZA 3VTIA 2XB5A 5HBUA 2RHAA 3PM1A 3LSRA 3ZQIA 5F04A 2QCOA 1JUPA 3VW0A 4PXIA 2HYTA 4ME9A 2O7TA 2R7UA 2XRLA 1Z77A 2WV1A 2QOPA 3PASA 4I76A 2G7GA 3V78A 5J1RA 2GENA 2R7WA 1JTXA 5D19A 2NP3A 5CXGA 5IPAA 2Q24A 1RPWA 2XGCA 5FGLA 1A6IA 3BR3A 1ZK8A 3VPRA 3ZQGA 2ZB9A 2QWTA 2ID3A 5IOYA 5DAJA 3ON2A 1RKTA 2ZY9A 2F07A 3B6CA 4WIBA 5K58A 2D6YA 3VP5A 2R7SA 4NELA 4MXMA 4AF5A 2JJ7A 2REKA 2HXOA 2OF7A 3Q0VA 3TP3A 1ZKGA 3BTJA 3C2BA 3KKCA 2FD5A 3SWHA 3PPBA 2XPUA 3BTCA 4D7MA 2R7XA 3LHQA 4M3EA 5FMPA 2VPRA 2YVEA 5K7HA 4JNNA 2XDNA 3G1LA 3VUQA 3T6NA 2PBXA 2G7SA 4W1UA 3Q0WA 4YZEA 3VVXA 4B1RA 4DW6A 4L62A 2JK3A 2XPWA 3VIBA 3F1BA 3COLA 5K7ZA 2NP5A 3GEUA 5FKNA 2FJ1A 5FKOA 3G56A 2PFVA 4M3BA 4X1EA 2UXOA 3C07A 4OD5A 3B81A 2NS7A 5J3LA 3AQSA 3GZIA 4JL3A 5D18A 2R7OA 2R7RA 2QIBA 2ZCXA 4ABZA 3HIMA 2QKOA 5H9TA 3BT9A 4IRVA 2A2FX 4M3GA 3WHCA 3KKDA 4W97A 2ZCNA 5FHPA 4GCLA 3BQZA 2X6OA 3VW2A 2DG7A 3ZQHA 5CXIA 5AQCA 5GP9A 3ANGA 3AQTA 3HTIA 3DCFA 3VVZA 3VOKA 2OERA 4U9NA 1RKWA 1U9NA 3NNRA 4D5CA 2DTZA 4V2GA 4CGRA 1JT6A 3BQYA 4JKZA 3BR1A 2FX0A 2G0EA 3G1OA 2G3BA 4B3AA 2GBYA 2IEKA 3KYLA 5IP6A 5FKKA 2IU5A 4ACIA 3HTAA 2B3WA 4AC6A 2WGBA 3FIWA 3O8GA 3FK7A 2UXPA 2XGEA 3SDGA 3BR6A 2W53A 5F1JA 2ZOZA 3ZQLA 5EZGA 4D7NA 2O7OA 2HXIA 3BHQA 3BJBA 2ZCMA 3IH4A 3MVPA 4HKUA 1UI5A 3G7RA 3QPSA 3NS4A 3VVYA 2Y31A 2DG8A 2HKUA 4V2FA 5HAWA 3DPJA 1QVTA 2VKVA 4GFLA 4M3FA 3B6AA 4XK4A 3QPLA 5J1YA 3HGGA 2IAIA 3BCGA 4NN1A 5EZHA 3HTHA 3BR2A 2XPVA 5F27A 2ID6A 5C4YA 5F0HA 3LSJA 4MK6A 1QPIA 3FK6A 2RAEA 2XGDA 4MO7A 2OI8A 2YVHA 2R7TA 2UXIA 1JT0A 3LSPA 2UXHA 3DEWA 3QKXA 4ICHA 3BNIA 4G12A 3CWRA 4U9LA 3HTJA 3DU5A 3CDLA 3Q3SA 2NX4A 3S5RA 4KWAA 3G1MA 2QTQA 2IBDA 3Q0UA 4M3DA 2RASA 2FBQA 2R7QA 3BRUA 3NPIA 3KZ9A 3HGYA 3O60A 2V57A 3MNLA 1Z0XA 5F0CA 3K8PC 3E7QA 2X9DA 2HYJA 4C2MA 1JTYA 5HSZA 4OD4A
chains in the Genus database with same CATH topology
3P9TA 3CJDA 3O8HA 4AC0A 1JUSA 5GPAA 4JYKA 3FRQA 5CW8A 4D5FA 4GCKA 3QBMA 3IH3A 3LJLA 3JSJA 3F0CA 3IH2A 2WUIA 3TP0A 2FQ4A 2HQ5A 3ZQFA 5EFYA 3BTLA 2OPTA 1U9OA 3NXCA 3EUPA 1T56A 2G7LA 5F08A 3QQAA 3BTIA 3LOCA 2ZOYA 4AUXA 3SFIA 4UDSA 2TRTA 1QVUA 1VI0A 2PZ9A 1SGMA 3BR0A 5GPCA 3WHBA 3RD3A 5FKLA 3VW1A 5K7FA 3ON4A 2Y30A 3NI7A 2TCTA 1ORKA 3BR5A 4I6ZA 2NS8A 5F0FA 3LWJA 2GFNA 3CCYA 3KNWA 2UXUA 5FKMA 2I10A 2GUHA 3NRGA 3CRJA 2EH3A 4GCTA 1T33A 3ANPA 3V6GA 3IUVA 2VKEA 1UI6A 1BJZA 3HE0A 3EGQA 4GFKA 5D1RA 1JUMA 5J1UA 5EYRA 3RH2A 3VOXA 5IOZA 2Y2ZA 2XB5A 5HBUA 2RHAA 3PM1A 3LSRA 3ZQIA 5F04A 2QCOA 1JUPA 3VW0A 4PXIA 2HYTA 4ME9A 2O7TA 2XRLA 1Z77A 2WV1A 2QOPA 3PASA 4I76A 2G7GA 3V78A 5J1RA 2GENA 1JTXA 5D19A 2NP3A 5CXGA 5IPAA 2Q24A 1RPWA 2XGCA 5FGLA 1A6IA 3BR3A 1ZK8A 3VPRA 3ZQGA 2ZB9A 2QWTA 2ID3A 5IOYA 5DAJA 3ON2A 1RKTA 2F07A 3B6CA 5K58A 2D6YA 3VP5A 4NELA 4MXMA 4AF5A 2JJ7A 2REKA 2HXOA 2OF7A 3Q0VA 3TP3A 1ZKGA 3BTJA 3C2BA 3KKCA 2FD5A 3PPBA 2XPUA 3BTCA 4D7MA 3LHQA 4M3EA 5FMPA 2VPRA 2YVEA 5K7HA 4JNNA 2XDNA 3G1LA 3VUQA 2PBXA 2G7SA 4W1UA 3T6NA 3Q0WA 4YZEA 3VVXA 4B1RA 4DW6A 4L62A 2JK3A 2XPWA 3VIBA 3F1BA 3COLA 5K7ZA 2NP5A 3GEUA 5FKNA 2FJ1A 5FKOA 3G56A 4M3BA 4X1EA 2UXOA 3C07A 3B81A 2NS7A 5J3LA 3AQSA 3GZIA 4JL3A 5D18A 2QIBA 2ZCXA 4ABZA 3HIMA 2QKOA 5H9TA 3BT9A 4M3GA 3WHCA 3KKDA 4W97A 2ZCNA 5FHPA 4GCLA 3BQZA 2X6OA 3VW2A 2DG7A 3ZQHA 5CXIA 5AQCA 5GP9A 3ANGA 3AQTA 3HTIA 3DCFA 3VVZA 3VOKA 2OERA 1RKWA 1U9NA 3NNRA 4D5CA 2DTZA 4V2GA 4CGRA 1JT6A 3BQYA 4JKZA 3BR1A 2FX0A 2G0EA 3G1OA 2G3BA 4B3AA 2GBYA 2IEKA 5IP6A 5FKKA 2IU5A 4ACIA 3HTAA 4AC6A 2WGBA 3FIWA 3O8GA 3FK7A 2UXPA 2XGEA 3SDGA 3BR6A 2W53A 5F1JA 2ZOZA 3ZQLA 4D7NA 5EZGA 2O7OA 2HXIA 3BHQA 3BJBA 2ZCMA 3IH4A 3MVPA 4HKUA 1UI5A 3G7RA 3QPSA 3VVYA 2Y31A 2DG8A 2HKUA 4V2FA 5HAWA 3DPJA 1QVTA 2VKVA 4GFLA 4M3FA 3B6AA 4XK4A 3QPLA 5J1YA 3HGGA 2IAIA 3BCGA 4NN1A 5EZHA 3HTHA 3BR2A 2XPVA 5F27A 2ID6A 5C4YA 5F0HA 3LSJA 4MK6A 1QPIA 3FK6A 2RAEA 2XGDA 4MO7A 2OI8A 2YVHA 2UXIA 1JT0A 3LSPA 2UXHA 3DEWA 3QKXA 4ICHA 3BNIA 4G12A 3CWRA 3HTJA 3CDLA 3Q3SA 2NX4A 3S5RA 4KWAA 3G1MA 2QTQA 2IBDA 3Q0UA 4M3DA 2RASA 2FBQA 3BRUA 3NPIA 3KZ9A 3HGYA 3O60A 2V57A 3MNLA 1Z0XA 5F0CA 3E7QA 2X9DA 2HYJA 1JTYA 5HSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P9T A;  3CJD A;  3O8H A;  4AC0 A;  1JUS A;  5GPA A;  4JYK A;  3FRQ A;  5CW8 A;  4D5F A;  4GCK A;  3QBM A;  3IH3 A;  3LJL A;  3JSJ A;  3F0C A;  3IH2 A;  2WUI A;  3TP0 A;  2FQ4 A;  2HQ5 A;  3ZQF A;  5EFY A;  3BTL A;  2OPT A;  1U9O A;  3NXC A;  3EUP A;  1T56 A;  2G7L A;  5F08 A;  3QQA A;  3BTI A;  3LOC A;  2ZOY A;  4AUX A;  3SFI A;  4UDS A;  2TRT A;  1QVU A;  1VI0 A;  2PZ9 A;  1SGM A;  3BR0 A;  5GPC A;  3WHB A;  3RD3 A;  5FKL A;  3VW1 A;  5K7F A;  3ON4 A;  2Y30 A;  3NI7 A;  2TCT A;  1ORK A;  3BR5 A;  4I6Z A;  2NS8 A;  5F0F A;  3LWJ A;  2GFN A;  3CCY A;  3KNW A;  2UXU A;  5FKM A;  2I10 A;  2GUH A;  3NRG A;  3CRJ A;  2EH3 A;  4GCT A;  1T33 A;  3ANP A;  3V6G A;  3IUV A;  2VKE A;  1UI6 A;  1BJZ A;  3HE0 A;  3EGQ A;  4GFK A;  5D1R A;  1JUM A;  5J1U A;  5EYR A;  3RH2 A;  3VOX A;  5IOZ A;  2Y2Z A;  2XB5 A;  5HBU A;  2RHA A;  3PM1 A;  3LSR A;  3ZQI A;  5F04 A;  2QCO A;  1JUP A;  3VW0 A;  4PXI A;  2HYT A;  4ME9 A;  2O7T A;  2XRL A;  1Z77 A;  2WV1 A;  2QOP A;  3PAS A;  4I76 A;  2G7G A;  3V78 A;  5J1R A;  2GEN A;  1JTX A;  5D19 A;  2NP3 A;  5CXG A;  5IPA A;  2Q24 A;  1RPW A;  2XGC A;  5FGL A;  1A6I A;  3BR3 A;  1ZK8 A;  3VPR A;  3ZQG A;  2ZB9 A;  2QWT A;  2ID3 A;  5IOY A;  5DAJ A;  3ON2 A;  1RKT A;  2F07 A;  3B6C A;  5K58 A;  2D6Y A;  3VP5 A;  4NEL A;  4MXM A;  4AF5 A;  2JJ7 A;  2REK A;  2HXO A;  2OF7 A;  3Q0V A;  3TP3 A;  1ZKG A;  3BTJ A;  3C2B A;  3KKC A;  2FD5 A;  3PPB A;  2XPU A;  3BTC A;  4D7M A;  3LHQ A;  4M3E A;  5FMP A;  2VPR A;  2YVE A;  5K7H A;  4JNN A;  2XDN A;  3G1L A;  3VUQ A;  2PBX A;  2G7S A;  4W1U A;  3T6N A;  3Q0W A;  4YZE A;  3VVX A;  4B1R A;  4DW6 A;  4L62 A;  2JK3 A;  2XPW A;  3VIB A;  3F1B A;  3COL A;  5K7Z A;  2NP5 A;  3GEU A;  5FKN A;  2FJ1 A;  5FKO A;  3G56 A;  4M3B A;  4X1E A;  2UXO A;  3C07 A;  3B81 A;  2NS7 A;  5J3L A;  3AQS A;  3GZI A;  4JL3 A;  5D18 A;  2QIB A;  2ZCX A;  4ABZ A;  3HIM A;  2QKO A;  5H9T A;  3BT9 A;  4M3G A;  3WHC A;  3KKD A;  4W97 A;  2ZCN A;  5FHP A;  4GCL A;  3BQZ A;  2X6O A;  3VW2 A;  2DG7 A;  3ZQH A;  5CXI A;  5AQC A;  5GP9 A;  3ANG A;  3AQT A;  3HTI A;  3DCF A;  3VVZ A;  3VOK A;  2OER A;  1RKW A;  1U9N A;  3NNR A;  4D5C A;  2DTZ A;  4V2G A;  4CGR A;  1JT6 A;  3BQY A;  4JKZ A;  3BR1 A;  2FX0 A;  2G0E A;  3G1O A;  2G3B A;  4B3A A;  2GBY A;  2IEK A;  5IP6 A;  5FKK A;  2IU5 A;  4ACI A;  3HTA A;  4AC6 A;  2WGB A;  3FIW A;  3O8G A;  3FK7 A;  2UXP A;  2XGE A;  3SDG A;  3BR6 A;  2W53 A;  5F1J A;  2ZOZ A;  3ZQL A;  4D7N A;  5EZG A;  2O7O A;  2HXI A;  3BHQ A;  3BJB A;  2ZCM A;  3IH4 A;  3MVP A;  4HKU A;  1UI5 A;  3G7R A;  3QPS A;  3VVY A;  2Y31 A;  2DG8 A;  2HKU A;  4V2F A;  5HAW A;  3DPJ A;  1QVT A;  2VKV A;  4GFL A;  4M3F A;  3B6A A;  4XK4 A;  3QPL A;  5J1Y A;  3HGG A;  2IAI A;  3BCG A;  4NN1 A;  5EZH A;  3HTH A;  3BR2 A;  2XPV A;  5F27 A;  2ID6 A;  5C4Y A;  5F0H A;  3LSJ A;  4MK6 A;  1QPI A;  3FK6 A;  2RAE A;  2XGD A;  4MO7 A;  2OI8 A;  2YVH A;  2UXI A;  1JT0 A;  3LSP A;  2UXH A;  3DEW A;  3QKX A;  4ICH A;  3BNI A;  4G12 A;  3CWR A;  3HTJ A;  3CDL A;  3Q3S A;  2NX4 A;  3S5R A;  4KWA A;  3G1M A;  2QTQ A;  2IBD A;  3Q0U A;  4M3D A;  2RAS A;  2FBQ A;  3BRU A;  3NPI A;  3KZ9 A;  3HGY A;  3O60 A;  2V57 A;  3MNL A;  1Z0X A;  5F0C A;  3E7Q A;  2X9D A;  2HYJ A;  1JTY A;  5HSZ A; 
#chains in the Genus database with same CATH topology
 3P9T A;  3CJD A;  3O8H A;  2B1E A;  4AC0 A;  1JUS A;  5GPA A;  4JYK A;  3FRQ A;  5CW8 A;  4D5F A;  4GCK A;  3QBM A;  3IH3 A;  3LJL A;  3JSJ A;  3F0C A;  3IH2 A;  2WUI A;  3TP0 A;  2FQ4 A;  2HQ5 A;  3ZQF A;  2R7V A;  5EFY A;  3BTL A;  2OPT A;  1U9O A;  3NXC A;  3EUP A;  1T56 A;  2G7L A;  5F08 A;  3QQA A;  3BTI A;  3LOC A;  3FHN A;  2YVX A;  2ZOY A;  4AUX A;  3SFI A;  4UDS A;  2TRT A;  1QVU A;  1VI0 A;  2PZ9 A;  1SGM A;  3BR0 A;  5GPC A;  2FJI 1;  3WHB A;  3RD3 A;  5FKL A;  3VW1 A;  5K7F A;  3ON4 A;  2Y30 A;  3NI7 A;  2TCT A;  1ORK A;  3BR5 A;  4I6Z A;  2NS8 A;  5F0F A;  3LWJ A;  4DVY P;  2GFN A;  3CCY A;  3KNW A;  2UXU A;  5CQG A;  5FKM A;  2I10 A;  2GUH A;  3NRG A;  3CRJ A;  2EH3 A;  4GCT A;  1T33 A;  3ANP A;  3V6G A;  3IUV A;  2VKE A;  1UI6 A;  1BJZ A;  3HE0 A;  3EGQ A;  4GFK A;  3DU6 A;  5D1R A;  1JUM A;  5J1U A;  5EYR A;  3RH2 A;  3VOX A;  5IOZ A;  2Y2Z A;  3VTI A;  2XB5 A;  5HBU A;  2RHA A;  3PM1 A;  3LSR A;  3ZQI A;  5F04 A;  2QCO A;  1JUP A;  3VW0 A;  4PXI A;  2HYT A;  4ME9 A;  2O7T A;  2R7U A;  2XRL A;  1Z77 A;  2WV1 A;  2QOP A;  3PAS A;  4I76 A;  2G7G A;  3V78 A;  5J1R A;  2GEN A;  2R7W A;  1JTX A;  5D19 A;  2NP3 A;  5CXG A;  5IPA A;  2Q24 A;  1RPW A;  2XGC A;  5FGL A;  1A6I A;  3BR3 A;  1ZK8 A;  3VPR A;  3ZQG A;  2ZB9 A;  2QWT A;  2ID3 A;  5IOY A;  5DAJ A;  3ON2 A;  1RKT A;  2ZY9 A;  2F07 A;  3B6C A;  4WIB A;  5K58 A;  2D6Y A;  3VP5 A;  2R7S A;  4NEL A;  4MXM A;  4AF5 A;  2JJ7 A;  2REK A;  2HXO A;  2OF7 A;  3Q0V A;  3TP3 A;  1ZKG A;  3BTJ A;  3C2B A;  3KKC A;  2FD5 A;  3SWH A;  3PPB A;  2XPU A;  3BTC A;  4D7M A;  2R7X A;  3LHQ A;  4M3E A;  5FMP A;  2VPR A;  2YVE A;  5K7H A;  4JNN A;  2XDN A;  3G1L A;  3VUQ A;  3T6N A;  2PBX A;  2G7S A;  4W1U A;  3Q0W A;  4YZE A;  3VVX A;  4B1R A;  4DW6 A;  4L62 A;  2JK3 A;  2XPW A;  3VIB A;  3F1B A;  3COL A;  5K7Z A;  2NP5 A;  3GEU A;  5FKN A;  2FJ1 A;  5FKO A;  3G56 A;  2PFV A;  4M3B A;  4X1E A;  2UXO A;  3C07 A;  4OD5 A;  3B81 A;  2NS7 A;  5J3L A;  3AQS A;  3GZI A;  4JL3 A;  5D18 A;  2R7O A;  2R7R A;  2QIB A;  2ZCX A;  4ABZ A;  3HIM A;  2QKO A;  5H9T A;  3BT9 A;  4IRV A;  2A2F X;  4M3G A;  3WHC A;  3KKD A;  4W97 A;  2ZCN A;  5FHP A;  4GCL A;  3BQZ A;  2X6O A;  3VW2 A;  2DG7 A;  3ZQH A;  5CXI A;  5AQC A;  5GP9 A;  3ANG A;  3AQT A;  3HTI A;  3DCF A;  3VVZ A;  3VOK A;  2OER A;  4U9N A;  1RKW A;  1U9N A;  3NNR A;  4D5C A;  2DTZ A;  4V2G A;  4CGR A;  1JT6 A;  3BQY A;  4JKZ A;  3BR1 A;  2FX0 A;  2G0E A;  3G1O A;  2G3B A;  4B3A A;  2GBY A;  2IEK A;  3KYL A;  5IP6 A;  5FKK A;  2IU5 A;  4ACI A;  3HTA A;  2B3W A;  4AC6 A;  2WGB A;  3FIW A;  3O8G A;  3FK7 A;  2UXP A;  2XGE A;  3SDG A;  3BR6 A;  2W53 A;  5F1J A;  2ZOZ A;  3ZQL A;  5EZG A;  4D7N A;  2O7O A;  2HXI A;  3BHQ A;  3BJB A;  2ZCM A;  3IH4 A;  3MVP A;  4HKU A;  1UI5 A;  3G7R A;  3QPS A;  3NS4 A;  3VVY A;  2Y31 A;  2DG8 A;  2HKU A;  4V2F A;  5HAW A;  3DPJ A;  1QVT A;  2VKV A;  4GFL A;  4M3F A;  3B6A A;  4XK4 A;  3QPL A;  5J1Y A;  3HGG A;  2IAI A;  3BCG A;  4NN1 A;  5EZH A;  3HTH A;  3BR2 A;  2XPV A;  5F27 A;  2ID6 A;  5C4Y A;  5F0H A;  3LSJ A;  4MK6 A;  1QPI A;  3FK6 A;  2RAE A;  2XGD A;  4MO7 A;  2OI8 A;  2YVH A;  2R7T A;  2UXI A;  1JT0 A;  3LSP A;  2UXH A;  3DEW A;  3QKX A;  4ICH A;  3BNI A;  4G12 A;  3CWR A;  4U9L A;  3HTJ A;  3DU5 A;  3CDL A;  3Q3S A;  2NX4 A;  3S5R A;  4KWA A;  3G1M A;  2QTQ A;  2IBD A;  3Q0U A;  4M3D A;  2RAS A;  2FBQ A;  2R7Q A;  3BRU A;  3NPI A;  3KZ9 A;  3HGY A;  3O60 A;  2V57 A;  3MNL A;  1Z0X A;  5F0C A;  3K8P C;  3E7Q A;  2X9D A;  2HYJ A;  4C2M A;  1JTY A;  5HSZ A;  4OD4 A; 
#chains in the Genus database with same CATH homology
 3P9T A;  3CJD A;  3O8H A;  4AC0 A;  1JUS A;  5GPA A;  4JYK A;  3FRQ A;  5CW8 A;  4D5F A;  4GCK A;  3QBM A;  3IH3 A;  3LJL A;  3JSJ A;  3F0C A;  3IH2 A;  2WUI A;  3TP0 A;  2FQ4 A;  2HQ5 A;  3ZQF A;  5EFY A;  3BTL A;  2OPT A;  1U9O A;  3NXC A;  3EUP A;  1T56 A;  2G7L A;  5F08 A;  3QQA A;  3BTI A;  3LOC A;  2ZOY A;  4AUX A;  3SFI A;  4UDS A;  2TRT A;  1QVU A;  1VI0 A;  2PZ9 A;  1SGM A;  3BR0 A;  5GPC A;  3WHB A;  3RD3 A;  5FKL A;  3VW1 A;  5K7F A;  3ON4 A;  2Y30 A;  3NI7 A;  2TCT A;  1ORK A;  3BR5 A;  4I6Z A;  2NS8 A;  5F0F A;  3LWJ A;  2GFN A;  3CCY A;  3KNW A;  2UXU A;  5FKM A;  2I10 A;  2GUH A;  3NRG A;  3CRJ A;  2EH3 A;  4GCT A;  1T33 A;  3ANP A;  3V6G A;  3IUV A;  2VKE A;  1UI6 A;  1BJZ A;  3HE0 A;  3EGQ A;  4GFK A;  5D1R A;  1JUM A;  5J1U A;  5EYR A;  3RH2 A;  3VOX A;  5IOZ A;  2Y2Z A;  2XB5 A;  5HBU A;  2RHA A;  3PM1 A;  3LSR A;  3ZQI A;  5F04 A;  2QCO A;  1JUP A;  3VW0 A;  4PXI A;  2HYT A;  4ME9 A;  2O7T A;  2XRL A;  1Z77 A;  2WV1 A;  2QOP A;  3PAS A;  4I76 A;  2G7G A;  3V78 A;  5J1R A;  2GEN A;  1JTX A;  5D19 A;  2NP3 A;  5CXG A;  5IPA A;  2Q24 A;  1RPW A;  2XGC A;  5FGL A;  1A6I A;  3BR3 A;  1ZK8 A;  3VPR A;  3ZQG A;  2ZB9 A;  2QWT A;  2ID3 A;  5IOY A;  5DAJ A;  3ON2 A;  1RKT A;  2F07 A;  3B6C A;  5K58 A;  2D6Y A;  3VP5 A;  4NEL A;  4MXM A;  4AF5 A;  2JJ7 A;  2REK A;  2HXO A;  2OF7 A;  3Q0V A;  3TP3 A;  1ZKG A;  3BTJ A;  3C2B A;  3KKC A;  2FD5 A;  3PPB A;  2XPU A;  3BTC A;  4D7M A;  3LHQ A;  4M3E A;  5FMP A;  2VPR A;  2YVE A;  5K7H A;  4JNN A;  2XDN A;  3G1L A;  3VUQ A;  2PBX A;  2G7S A;  4W1U A;  3T6N A;  3Q0W A;  4YZE A;  3VVX A;  4B1R A;  4DW6 A;  4L62 A;  2JK3 A;  2XPW A;  3VIB A;  3F1B A;  3COL A;  5K7Z A;  2NP5 A;  3GEU A;  5FKN A;  2FJ1 A;  5FKO A;  3G56 A;  4M3B A;  4X1E A;  2UXO A;  3C07 A;  3B81 A;  2NS7 A;  5J3L A;  3AQS A;  3GZI A;  4JL3 A;  5D18 A;  2QIB A;  2ZCX A;  4ABZ A;  3HIM A;  2QKO A;  5H9T A;  3BT9 A;  4M3G A;  3WHC A;  3KKD A;  4W97 A;  2ZCN A;  5FHP A;  4GCL A;  3BQZ A;  2X6O A;  3VW2 A;  2DG7 A;  3ZQH A;  5CXI A;  5AQC A;  5GP9 A;  3ANG A;  3AQT A;  3HTI A;  3DCF A;  3VVZ A;  3VOK A;  2OER A;  1RKW A;  1U9N A;  3NNR A;  4D5C A;  2DTZ A;  4V2G A;  4CGR A;  1JT6 A;  3BQY A;  4JKZ A;  3BR1 A;  2FX0 A;  2G0E A;  3G1O A;  2G3B A;  4B3A A;  2GBY A;  2IEK A;  5IP6 A;  5FKK A;  2IU5 A;  4ACI A;  3HTA A;  4AC6 A;  2WGB A;  3FIW A;  3O8G A;  3FK7 A;  2UXP A;  2XGE A;  3SDG A;  3BR6 A;  2W53 A;  5F1J A;  2ZOZ A;  3ZQL A;  4D7N A;  5EZG A;  2O7O A;  2HXI A;  3BHQ A;  3BJB A;  2ZCM A;  3IH4 A;  3MVP A;  4HKU A;  1UI5 A;  3G7R A;  3QPS A;  3VVY A;  2Y31 A;  2DG8 A;  2HKU A;  4V2F A;  5HAW A;  3DPJ A;  1QVT A;  2VKV A;  4GFL A;  4M3F A;  3B6A A;  4XK4 A;  3QPL A;  5J1Y A;  3HGG A;  2IAI A;  3BCG A;  4NN1 A;  5EZH A;  3HTH A;  3BR2 A;  2XPV A;  5F27 A;  2ID6 A;  5C4Y A;  5F0H A;  3LSJ A;  4MK6 A;  1QPI A;  3FK6 A;  2RAE A;  2XGD A;  4MO7 A;  2OI8 A;  2YVH A;  2UXI A;  1JT0 A;  3LSP A;  2UXH A;  3DEW A;  3QKX A;  4ICH A;  3BNI A;  4G12 A;  3CWR A;  3HTJ A;  3CDL A;  3Q3S A;  2NX4 A;  3S5R A;  4KWA A;  3G1M A;  2QTQ A;  2IBD A;  3Q0U A;  4M3D A;  2RAS A;  2FBQ A;  3BRU A;  3NPI A;  3KZ9 A;  3HGY A;  3O60 A;  2V57 A;  3MNL A;  1Z0X A;  5F0C A;  3E7Q A;  2X9D A;  2HYJ A;  1JTY A;  5HSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...