3LJLA

The crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
b'SKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator LuxT
publication title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
molecule tags Transcription regulator
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ljlA00
4ICHA 1JT0A 3HTIA 3VVZA 4MO7A 1BJZA 2XPUA 3QBMA 3EUPA 2YVHA 3Q0WA 2IAIA 3QQAA 5EZGA 3ON4A 4GFKA 4W97A 4AUXA 3BHQA 2Y30A 5IOYA 4HKUA 3ZQHA 5K58A 2QIBA 5CW8A 3COLA 5H9TA 4AC0A 1U9OA 4NELA 5DAJA 3F1BA 2GFNA 5IP6A 2QKOA 2HYTA 3ZQIA 2VKEA 2G3BA 1UI5A 3BQYA 2GBYA 1ZKGA 2REKA 3HGYA 2NS8A 4M3FA 2DG7A 3QKXA 2X6OA 1JUSA 1ORKA 2WUIA 5J3LA 2XGCA 4DW6A 3BCGA 3HIMA 2F07A 3PASA 2UXUA 2NP5A 3ZQLA 4V2GA 1VI0A 1Z0XA 3VOKA 1RKTA 3IUVA 2FD5A 2XPVA 2Q24A 3IH3A 3NNRA 5J1YA 3G1MA 2UXIA 3VP5A 2JJ7A 3B81A 4KWAA 3LJLA 2ZCNA 3KNWA 4PXIA 2UXOA 3V6GA 3Q0VA 3IH4A 2UXHA 4D5CA 5HSZA 2ZB9A 2G7SA 2XRLA 2G7LA 2XPWA 1UI6A 3Q3SA 3IH2A 3FK7A 3GZIA 3LHQA 5FKKA 4B3AA 2HKUA 2VPRA 3BJBA 2G7GA 3BQZA 2FX0A 2ID3A 5EZHA 2GUHA 3SDGA 4ABZA 2ZCXA 2PBXA 3TP3A 3VW0A 4D7MA 1JTXA 1ZK8A 2V57A 4GCLA 2IU5A 3VVYA 4JKZA 3BR6A 4D7NA 2ID6A 2FQ4A 2IBDA 3FIWA 3FRQA 4ACIA 5GPAA 2HXIA 3P9TA 3BR2A 4W1UA 3NXCA 5C4YA 3RD3A 2QOPA 4D5FA 3VUQA 3VOXA 2OPTA 3BTLA 2TCTA 5CXGA 3C07A 2QTQA 3PPBA 3VVXA 1QPIA 3KKDA 2WV1A 3Q0UA 4AC6A 3B6AA 3O8GA 3VW1A 3G1OA 5EFYA 1T56A 4X1EA 3VIBA 3BTJA 1U9NA 2YVEA 4M3GA 4I76A 2XGDA 1JT6A 3DCFA 3BR0A 4GCKA 4ME9A 3VPRA 2ZOYA 3KZ9A 2NS7A 4JNNA 4B1RA 5FKMA 3HTAA 3GEUA 5EYRA 3WHCA 3SFIA 3FK6A 5FKOA 4XK4A 2WGBA 2JK3A 2DTZA 3E7QA 1JTYA 5K7ZA 3CCYA 3PM1A 3CRJA 1Z77A 3HTJA 3LSJA 5FKLA 3ANPA 2HXOA 5FHPA 4V2FA 2TRTA 3G56A 2UXPA 3CWRA 1JUPA 5K7HA 2RASA 3BR1A 3QPLA 5IPAA 2I10A 5F08A 2O7TA 4GCTA 2ZOZA 4G12A 2NX4A 4I6ZA 3MNLA 3AQSA 5GP9A 3NI7A 1RPWA 3CDLA 3VW2A 2XGEA 2QCOA 2HYJA 4M3DA 2Y31A 3CJDA 1SGMA 4M3BA 3S5RA 3F0CA 2VKVA 2RAEA 5F04A 5F0CA 2W53A 5F27A 2ZCMA 2FBQA 3ANGA 5FMPA 3G7RA 3T6NA 2OF7A 4AF5A 4CGRA 1T33A 2RHAA 5AQCA 5IOZA 4JYKA 2PZ9A 5J1UA 4GFLA 3BTCA 3KKCA 2DG8A 5F0FA 3NRGA 3G1LA 3HTHA 3ON2A 2QWTA 5J1RA 4MXMA 3HGGA 5FGLA 2OERA 5F1JA 3BTIA 2FJ1A 5GPCA 2D6YA 3LOCA 4M3EA 5HBUA 4MK6A 3MVPA 5D1RA 2HQ5A 5K7FA 3ZQGA 3BR3A 4L62A 3DEWA 2EH3A 3RH2A 1RKWA 5D19A 3DPJA 5CXIA 1QVUA 5FKNA 3TP0A 3EGQA 2G0EA 3JSJA 3BR5A 4YZEA 2XDNA 5F0HA 3B6CA 3O8HA 3O60A 3ZQFA 2GENA 2XB5A 3AQTA 3C2BA 2NP3A 3BNIA 1JUMA 4UDSA 2O7OA 1A6IA 4JL3A 3BT9A 2Y2ZA 4NN1A 3NPIA 1QVTA 3WHBA 3QPSA 5HAWA 3V78A 2IEKA 3HE0A 3LSRA 3LSPA 3BRUA 2X9DA 2OI8A 3LWJA 5D18A
chains in the Genus database with same CATH superfamily
4ICHA 1JT0A 3HTIA 3VVZA 4MO7A 2R7OA 1BJZA 2XPUA 3QBMA 3EUPA 2YVHA 3Q0WA 2IAIA 3QQAA 5EZGA 3ON4A 4GFKA 4W97A 4AUXA 3BHQA 2Y30A 5IOYA 4HKUA 3ZQHA 5K58A 2QIBA 5CW8A 3COLA 5H9TA 4AC0A 1U9OA 4NELA 5DAJA 3F1BA 2GFNA 5IP6A 2B1EA 2QKOA 3K8PC 2HYTA 3ZQIA 2VKEA 2G3BA 1UI5A 3BQYA 2GBYA 1ZKGA 2REKA 3HGYA 2NS8A 4M3FA 2DG7A 3QKXA 2X6OA 1JUSA 1ORKA 2WUIA 5J3LA 2XGCA 4DW6A 2R7XA 3BCGA 3HIMA 2F07A 3PASA 2UXUA 2NP5A 2R7TA 3ZQLA 4V2GA 2B3WA 1VI0A 1Z0XA 4IRVA 3VOKA 1RKTA 3IUVA 2FD5A 2XPVA 2Q24A 3IH3A 3NNRA 5J1YA 3G1MA 2UXIA 3VP5A 2JJ7A 3B81A 4KWAA 3LJLA 2ZCNA 3KNWA 4PXIA 2UXOA 3V6GA 3Q0VA 3IH4A 2UXHA 4D5CA 5HSZA 2ZB9A 2G7SA 2XRLA 2G7LA 2R7QA 2XPWA 1UI6A 3Q3SA 3IH2A 3FK7A 3GZIA 3LHQA 5FKKA 4B3AA 3NS4A 2HKUA 2VPRA 3BJBA 2G7GA 2YVXA 3BQZA 2FX0A 2ID3A 5EZHA 2GUHA 3SDGA 4ABZA 2ZCXA 2PBXA 3TP3A 3VW0A 4D7MA 1JTXA 3KYLA 1ZK8A 2V57A 4GCLA 2IU5A 3VVYA 4JKZA 3BR6A 5CQGA 4D7NA 2ID6A 2FQ4A 2IBDA 3DU5A 4U9LA 3FIWA 3FRQA 4ACIA 5GPAA 2HXIA 3P9TA 3BR2A 4W1UA 3NXCA 5C4YA 3RD3A 3VTIA 2QOPA 4D5FA 2PFVA 3VUQA 2OPTA 3BTLA 3VOXA 2TCTA 5CXGA 3C07A 2R7UA 2QTQA 3PPBA 3VVXA 1QPIA 3KKDA 2WV1A 3Q0UA 4C2MA 4AC6A 3B6AA 3O8GA 3VW1A 3G1OA 5EFYA 1T56A 4X1EA 3BTJA 3VIBA 1U9NA 3FHNA 2YVEA 4M3GA 4I76A 2XGDA 1JT6A 3DCFA 3BR0A 4GCKA 4ME9A 3VPRA 2ZOYA 3KZ9A 2NS7A 4JNNA 4B1RA 5FKMA 3HTAA 3GEUA 5EYRA 3WHCA 3SFIA 3FK6A 5FKOA 4XK4A 2WGBA 2JK3A 2DTZA 3E7QA 1JTYA 5K7ZA 3CCYA 4OD5A 3PM1A 3CRJA 1Z77A 3HTJA 3LSJA 5FKLA 3ANPA 2HXOA 5FHPA 4V2FA 2TRTA 3G56A 2UXPA 3CWRA 1JUPA 5K7HA 2RASA 3BR1A 3QPLA 2FJI1 5IPAA 2R7RA 2I10A 5F08A 2O7TA 4GCTA 2ZOZA 4G12A 2NX4A 4I6ZA 2R7SA 3MNLA 3AQSA 5GP9A 3NI7A 1RPWA 3CDLA 3VW2A 2XGEA 2QCOA 2HYJA 4M3DA 2Y31A 3CJDA 1SGMA 4M3BA 3S5RA 3F0CA 2VKVA 2RAEA 5F04A 5F0CA 2W53A 5F27A 2ZCMA 2FBQA 3ANGA 5FMPA 3G7RA 3T6NA 2OF7A 4AF5A 4CGRA 1T33A 2RHAA 5AQCA 5IOZA 4JYKA 2PZ9A 5J1UA 2R7VA 4GFLA 3BTCA 3KKCA 2DG8A 5F0FA 3NRGA 3G1LA 3HTHA 3ON2A 2QWTA 5J1RA 4MXMA 3DU6A 3HGGA 5FGLA 2OERA 5F1JA 3BTIA 2FJ1A 5GPCA 2D6YA 4DVYP 3LOCA 4M3EA 4WIBA 4MK6A 5HBUA 3MVPA 5D1RA 2HQ5A 5K7FA 3ZQGA 3BR3A 4L62A 3DEWA 2EH3A 3RH2A 1RKWA 5D19A 3DPJA 5CXIA 1QVUA 2ZY9A 5FKNA 3TP0A 3EGQA 2G0EA 3JSJA 3BR5A 3SWHA 4OD4A 4YZEA 2XDNA 5F0HA 3B6CA 3O8HA 3O60A 3ZQFA 2GENA 2R7WA 2XB5A 3AQTA 3C2BA 2NP3A 3BNIA 1JUMA 4UDSA 2A2FX 2O7OA 1A6IA 4JL3A 3BT9A 2Y2ZA 4NN1A 3NPIA 1QVTA 3WHBA 3QPSA 5HAWA 3V78A 2IEKA 3HE0A 3LSRA 3LSPA 3BRUA 4U9NA 2X9DA 2OI8A 3LWJA 5D18A
chains in the Genus database with same CATH topology
4ICHA 1JT0A 3HTIA 3VVZA 4MO7A 1BJZA 2XPUA 3QBMA 3EUPA 2YVHA 3Q0WA 2IAIA 3QQAA 5EZGA 3ON4A 4GFKA 4W97A 4AUXA 3BHQA 2Y30A 5IOYA 4HKUA 3ZQHA 5K58A 2QIBA 5CW8A 3COLA 5H9TA 4AC0A 1U9OA 4NELA 5DAJA 3F1BA 2GFNA 5IP6A 2QKOA 2HYTA 3ZQIA 2VKEA 2G3BA 1UI5A 3BQYA 2GBYA 1ZKGA 2REKA 3HGYA 2NS8A 4M3FA 2DG7A 3QKXA 2X6OA 1JUSA 1ORKA 2WUIA 5J3LA 2XGCA 4DW6A 3BCGA 3HIMA 2F07A 3PASA 2UXUA 2NP5A 3ZQLA 4V2GA 1VI0A 1Z0XA 3VOKA 1RKTA 3IUVA 2FD5A 2XPVA 2Q24A 3IH3A 3NNRA 5J1YA 3G1MA 2UXIA 3VP5A 2JJ7A 3B81A 4KWAA 3LJLA 2ZCNA 3KNWA 4PXIA 2UXOA 3V6GA 3Q0VA 3IH4A 2UXHA 4D5CA 5HSZA 2ZB9A 2G7SA 2XRLA 2G7LA 2XPWA 1UI6A 3Q3SA 3IH2A 3FK7A 3GZIA 3LHQA 5FKKA 4B3AA 2HKUA 2VPRA 3BJBA 2G7GA 3BQZA 2FX0A 2ID3A 5EZHA 2GUHA 3SDGA 4ABZA 2ZCXA 2PBXA 3TP3A 3VW0A 4D7MA 1JTXA 1ZK8A 2V57A 4GCLA 2IU5A 3VVYA 4JKZA 3BR6A 4D7NA 2ID6A 2FQ4A 2IBDA 3FIWA 3FRQA 4ACIA 5GPAA 2HXIA 3P9TA 3BR2A 4W1UA 3NXCA 5C4YA 3RD3A 2QOPA 4D5FA 3VUQA 3VOXA 2OPTA 3BTLA 2TCTA 5CXGA 3C07A 2QTQA 3PPBA 3VVXA 1QPIA 3KKDA 2WV1A 3Q0UA 4AC6A 3B6AA 3O8GA 3VW1A 3G1OA 5EFYA 1T56A 4X1EA 3VIBA 3BTJA 1U9NA 2YVEA 4M3GA 4I76A 2XGDA 1JT6A 3DCFA 3BR0A 4GCKA 4ME9A 3VPRA 2ZOYA 3KZ9A 2NS7A 4JNNA 4B1RA 5FKMA 3HTAA 3GEUA 5EYRA 3WHCA 3SFIA 3FK6A 5FKOA 4XK4A 2WGBA 2JK3A 2DTZA 3E7QA 1JTYA 5K7ZA 3CCYA 3PM1A 3CRJA 1Z77A 3HTJA 3LSJA 5FKLA 3ANPA 2HXOA 5FHPA 4V2FA 2TRTA 3G56A 2UXPA 3CWRA 1JUPA 5K7HA 2RASA 3BR1A 3QPLA 5IPAA 2I10A 5F08A 2O7TA 4GCTA 2ZOZA 4G12A 2NX4A 4I6ZA 3MNLA 3AQSA 5GP9A 3NI7A 1RPWA 3CDLA 3VW2A 2XGEA 2QCOA 2HYJA 4M3DA 2Y31A 3CJDA 1SGMA 4M3BA 3S5RA 3F0CA 2VKVA 2RAEA 5F04A 5F0CA 2W53A 5F27A 2ZCMA 2FBQA 3ANGA 5FMPA 3G7RA 3T6NA 2OF7A 4AF5A 4CGRA 1T33A 2RHAA 5AQCA 5IOZA 4JYKA 2PZ9A 5J1UA 4GFLA 3BTCA 3KKCA 2DG8A 5F0FA 3NRGA 3G1LA 3HTHA 3ON2A 2QWTA 5J1RA 4MXMA 3HGGA 5FGLA 2OERA 5F1JA 3BTIA 2FJ1A 5GPCA 2D6YA 3LOCA 4M3EA 5HBUA 4MK6A 3MVPA 5D1RA 2HQ5A 5K7FA 3ZQGA 3BR3A 4L62A 3DEWA 2EH3A 3RH2A 1RKWA 5D19A 3DPJA 5CXIA 1QVUA 5FKNA 3TP0A 3EGQA 2G0EA 3JSJA 3BR5A 4YZEA 2XDNA 5F0HA 3B6CA 3O8HA 3O60A 3ZQFA 2GENA 2XB5A 3AQTA 3C2BA 2NP3A 3BNIA 1JUMA 4UDSA 2O7OA 1A6IA 4JL3A 3BT9A 2Y2ZA 4NN1A 3NPIA 1QVTA 3WHBA 3QPSA 5HAWA 3V78A 2IEKA 3HE0A 3LSRA 3LSPA 3BRUA 2X9DA 2OI8A 3LWJA 5D18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICH A;  1JT0 A;  3HTI A;  3VVZ A;  4MO7 A;  1BJZ A;  2XPU A;  3QBM A;  3EUP A;  2YVH A;  3Q0W A;  2IAI A;  3QQA A;  5EZG A;  3ON4 A;  4GFK A;  4W97 A;  4AUX A;  3BHQ A;  2Y30 A;  5IOY A;  4HKU A;  3ZQH A;  5K58 A;  2QIB A;  5CW8 A;  3COL A;  5H9T A;  4AC0 A;  1U9O A;  4NEL A;  5DAJ A;  3F1B A;  2GFN A;  5IP6 A;  2QKO A;  2HYT A;  3ZQI A;  2VKE A;  2G3B A;  1UI5 A;  3BQY A;  2GBY A;  1ZKG A;  2REK A;  3HGY A;  2NS8 A;  4M3F A;  2DG7 A;  3QKX A;  2X6O A;  1JUS A;  1ORK A;  2WUI A;  5J3L A;  2XGC A;  4DW6 A;  3BCG A;  3HIM A;  2F07 A;  3PAS A;  2UXU A;  2NP5 A;  3ZQL A;  4V2G A;  1VI0 A;  1Z0X A;  3VOK A;  1RKT A;  3IUV A;  2FD5 A;  2XPV A;  2Q24 A;  3IH3 A;  3NNR A;  5J1Y A;  3G1M A;  2UXI A;  3VP5 A;  2JJ7 A;  3B81 A;  4KWA A;  3LJL A;  2ZCN A;  3KNW A;  4PXI A;  2UXO A;  3V6G A;  3Q0V A;  3IH4 A;  2UXH A;  4D5C A;  5HSZ A;  2ZB9 A;  2G7S A;  2XRL A;  2G7L A;  2XPW A;  1UI6 A;  3Q3S A;  3IH2 A;  3FK7 A;  3GZI A;  3LHQ A;  5FKK A;  4B3A A;  2HKU A;  2VPR A;  3BJB A;  2G7G A;  3BQZ A;  2FX0 A;  2ID3 A;  5EZH A;  2GUH A;  3SDG A;  4ABZ A;  2ZCX A;  2PBX A;  3TP3 A;  3VW0 A;  4D7M A;  1JTX A;  1ZK8 A;  2V57 A;  4GCL A;  2IU5 A;  3VVY A;  4JKZ A;  3BR6 A;  4D7N A;  2ID6 A;  2FQ4 A;  2IBD A;  3FIW A;  3FRQ A;  4ACI A;  5GPA A;  2HXI A;  3P9T A;  3BR2 A;  4W1U A;  3NXC A;  5C4Y A;  3RD3 A;  2QOP A;  4D5F A;  3VUQ A;  3VOX A;  2OPT A;  3BTL A;  2TCT A;  5CXG A;  3C07 A;  2QTQ A;  3PPB A;  3VVX A;  1QPI A;  3KKD A;  2WV1 A;  3Q0U A;  4AC6 A;  3B6A A;  3O8G A;  3VW1 A;  3G1O A;  5EFY A;  1T56 A;  4X1E A;  3VIB A;  3BTJ A;  1U9N A;  2YVE A;  4M3G A;  4I76 A;  2XGD A;  1JT6 A;  3DCF A;  3BR0 A;  4GCK A;  4ME9 A;  3VPR A;  2ZOY A;  3KZ9 A;  2NS7 A;  4JNN A;  4B1R A;  5FKM A;  3HTA A;  3GEU A;  5EYR A;  3WHC A;  3SFI A;  3FK6 A;  5FKO A;  4XK4 A;  2WGB A;  2JK3 A;  2DTZ A;  3E7Q A;  1JTY A;  5K7Z A;  3CCY A;  3PM1 A;  3CRJ A;  1Z77 A;  3HTJ A;  3LSJ A;  5FKL A;  3ANP A;  2HXO A;  5FHP A;  4V2F A;  2TRT A;  3G56 A;  2UXP A;  3CWR A;  1JUP A;  5K7H A;  2RAS A;  3BR1 A;  3QPL A;  5IPA A;  2I10 A;  5F08 A;  2O7T A;  4GCT A;  2ZOZ A;  4G12 A;  2NX4 A;  4I6Z A;  3MNL A;  3AQS A;  5GP9 A;  3NI7 A;  1RPW A;  3CDL A;  3VW2 A;  2XGE A;  2QCO A;  2HYJ A;  4M3D A;  2Y31 A;  3CJD A;  1SGM A;  4M3B A;  3S5R A;  3F0C A;  2VKV A;  2RAE A;  5F04 A;  5F0C A;  2W53 A;  5F27 A;  2ZCM A;  2FBQ A;  3ANG A;  5FMP A;  3G7R A;  3T6N A;  2OF7 A;  4AF5 A;  4CGR A;  1T33 A;  2RHA A;  5AQC A;  5IOZ A;  4JYK A;  2PZ9 A;  5J1U A;  4GFL A;  3BTC A;  3KKC A;  2DG8 A;  5F0F A;  3NRG A;  3G1L A;  3HTH A;  3ON2 A;  2QWT A;  5J1R A;  4MXM A;  3HGG A;  5FGL A;  2OER A;  5F1J A;  3BTI A;  2FJ1 A;  5GPC A;  2D6Y A;  3LOC A;  4M3E A;  5HBU A;  4MK6 A;  3MVP A;  5D1R A;  2HQ5 A;  5K7F A;  3ZQG A;  3BR3 A;  4L62 A;  3DEW A;  2EH3 A;  3RH2 A;  1RKW A;  5D19 A;  3DPJ A;  5CXI A;  1QVU A;  5FKN A;  3TP0 A;  3EGQ A;  2G0E A;  3JSJ A;  3BR5 A;  4YZE A;  2XDN A;  5F0H A;  3B6C A;  3O8H A;  3O60 A;  3ZQF A;  2GEN A;  2XB5 A;  3AQT A;  3C2B A;  2NP3 A;  3BNI A;  1JUM A;  4UDS A;  2O7O A;  1A6I A;  4JL3 A;  3BT9 A;  2Y2Z A;  4NN1 A;  3NPI A;  1QVT A;  3WHB A;  3QPS A;  5HAW A;  3V78 A;  2IEK A;  3HE0 A;  3LSR A;  3LSP A;  3BRU A;  2X9D A;  2OI8 A;  3LWJ A;  5D18 A; 
#chains in the Genus database with same CATH topology
 4ICH A;  1JT0 A;  3HTI A;  3VVZ A;  4MO7 A;  2R7O A;  1BJZ A;  2XPU A;  3QBM A;  3EUP A;  2YVH A;  3Q0W A;  2IAI A;  3QQA A;  5EZG A;  3ON4 A;  4GFK A;  4W97 A;  4AUX A;  3BHQ A;  2Y30 A;  5IOY A;  4HKU A;  3ZQH A;  5K58 A;  2QIB A;  5CW8 A;  3COL A;  5H9T A;  4AC0 A;  1U9O A;  4NEL A;  5DAJ A;  3F1B A;  2GFN A;  5IP6 A;  2B1E A;  2QKO A;  3K8P C;  2HYT A;  3ZQI A;  2VKE A;  2G3B A;  1UI5 A;  3BQY A;  2GBY A;  1ZKG A;  2REK A;  3HGY A;  2NS8 A;  4M3F A;  2DG7 A;  3QKX A;  2X6O A;  1JUS A;  1ORK A;  2WUI A;  5J3L A;  2XGC A;  4DW6 A;  2R7X A;  3BCG A;  3HIM A;  2F07 A;  3PAS A;  2UXU A;  2NP5 A;  2R7T A;  3ZQL A;  4V2G A;  2B3W A;  1VI0 A;  1Z0X A;  4IRV A;  3VOK A;  1RKT A;  3IUV A;  2FD5 A;  2XPV A;  2Q24 A;  3IH3 A;  3NNR A;  5J1Y A;  3G1M A;  2UXI A;  3VP5 A;  2JJ7 A;  3B81 A;  4KWA A;  3LJL A;  2ZCN A;  3KNW A;  4PXI A;  2UXO A;  3V6G A;  3Q0V A;  3IH4 A;  2UXH A;  4D5C A;  5HSZ A;  2ZB9 A;  2G7S A;  2XRL A;  2G7L A;  2R7Q A;  2XPW A;  1UI6 A;  3Q3S A;  3IH2 A;  3FK7 A;  3GZI A;  3LHQ A;  5FKK A;  4B3A A;  3NS4 A;  2HKU A;  2VPR A;  3BJB A;  2G7G A;  2YVX A;  3BQZ A;  2FX0 A;  2ID3 A;  5EZH A;  2GUH A;  3SDG A;  4ABZ A;  2ZCX A;  2PBX A;  3TP3 A;  3VW0 A;  4D7M A;  1JTX A;  3KYL A;  1ZK8 A;  2V57 A;  4GCL A;  2IU5 A;  3VVY A;  4JKZ A;  3BR6 A;  5CQG A;  4D7N A;  2ID6 A;  2FQ4 A;  2IBD A;  3DU5 A;  4U9L A;  3FIW A;  3FRQ A;  4ACI A;  5GPA A;  2HXI A;  3P9T A;  3BR2 A;  4W1U A;  3NXC A;  5C4Y A;  3RD3 A;  3VTI A;  2QOP A;  4D5F A;  2PFV A;  3VUQ A;  2OPT A;  3BTL A;  3VOX A;  2TCT A;  5CXG A;  3C07 A;  2R7U A;  2QTQ A;  3PPB A;  3VVX A;  1QPI A;  3KKD A;  2WV1 A;  3Q0U A;  4C2M A;  4AC6 A;  3B6A A;  3O8G A;  3VW1 A;  3G1O A;  5EFY A;  1T56 A;  4X1E A;  3BTJ A;  3VIB A;  1U9N A;  3FHN A;  2YVE A;  4M3G A;  4I76 A;  2XGD A;  1JT6 A;  3DCF A;  3BR0 A;  4GCK A;  4ME9 A;  3VPR A;  2ZOY A;  3KZ9 A;  2NS7 A;  4JNN A;  4B1R A;  5FKM A;  3HTA A;  3GEU A;  5EYR A;  3WHC A;  3SFI A;  3FK6 A;  5FKO A;  4XK4 A;  2WGB A;  2JK3 A;  2DTZ A;  3E7Q A;  1JTY A;  5K7Z A;  3CCY A;  4OD5 A;  3PM1 A;  3CRJ A;  1Z77 A;  3HTJ A;  3LSJ A;  5FKL A;  3ANP A;  2HXO A;  5FHP A;  4V2F A;  2TRT A;  3G56 A;  2UXP A;  3CWR A;  1JUP A;  5K7H A;  2RAS A;  3BR1 A;  3QPL A;  2FJI 1;  5IPA A;  2R7R A;  2I10 A;  5F08 A;  2O7T A;  4GCT A;  2ZOZ A;  4G12 A;  2NX4 A;  4I6Z A;  2R7S A;  3MNL A;  3AQS A;  5GP9 A;  3NI7 A;  1RPW A;  3CDL A;  3VW2 A;  2XGE A;  2QCO A;  2HYJ A;  4M3D A;  2Y31 A;  3CJD A;  1SGM A;  4M3B A;  3S5R A;  3F0C A;  2VKV A;  2RAE A;  5F04 A;  5F0C A;  2W53 A;  5F27 A;  2ZCM A;  2FBQ A;  3ANG A;  5FMP A;  3G7R A;  3T6N A;  2OF7 A;  4AF5 A;  4CGR A;  1T33 A;  2RHA A;  5AQC A;  5IOZ A;  4JYK A;  2PZ9 A;  5J1U A;  2R7V A;  4GFL A;  3BTC A;  3KKC A;  2DG8 A;  5F0F A;  3NRG A;  3G1L A;  3HTH A;  3ON2 A;  2QWT A;  5J1R A;  4MXM A;  3DU6 A;  3HGG A;  5FGL A;  2OER A;  5F1J A;  3BTI A;  2FJ1 A;  5GPC A;  2D6Y A;  4DVY P;  3LOC A;  4M3E A;  4WIB A;  4MK6 A;  5HBU A;  3MVP A;  5D1R A;  2HQ5 A;  5K7F A;  3ZQG A;  3BR3 A;  4L62 A;  3DEW A;  2EH3 A;  3RH2 A;  1RKW A;  5D19 A;  3DPJ A;  5CXI A;  1QVU A;  2ZY9 A;  5FKN A;  3TP0 A;  3EGQ A;  2G0E A;  3JSJ A;  3BR5 A;  3SWH A;  4OD4 A;  4YZE A;  2XDN A;  5F0H A;  3B6C A;  3O8H A;  3O60 A;  3ZQF A;  2GEN A;  2R7W A;  2XB5 A;  3AQT A;  3C2B A;  2NP3 A;  3BNI A;  1JUM A;  4UDS A;  2A2F X;  2O7O A;  1A6I A;  4JL3 A;  3BT9 A;  2Y2Z A;  4NN1 A;  3NPI A;  1QVT A;  3WHB A;  3QPS A;  5HAW A;  3V78 A;  2IEK A;  3HE0 A;  3LSR A;  3LSP A;  3BRU A;  4U9N A;  2X9D A;  2OI8 A;  3LWJ A;  5D18 A; 
#chains in the Genus database with same CATH homology
 4ICH A;  1JT0 A;  3HTI A;  3VVZ A;  4MO7 A;  1BJZ A;  2XPU A;  3QBM A;  3EUP A;  2YVH A;  3Q0W A;  2IAI A;  3QQA A;  5EZG A;  3ON4 A;  4GFK A;  4W97 A;  4AUX A;  3BHQ A;  2Y30 A;  5IOY A;  4HKU A;  3ZQH A;  5K58 A;  2QIB A;  5CW8 A;  3COL A;  5H9T A;  4AC0 A;  1U9O A;  4NEL A;  5DAJ A;  3F1B A;  2GFN A;  5IP6 A;  2QKO A;  2HYT A;  3ZQI A;  2VKE A;  2G3B A;  1UI5 A;  3BQY A;  2GBY A;  1ZKG A;  2REK A;  3HGY A;  2NS8 A;  4M3F A;  2DG7 A;  3QKX A;  2X6O A;  1JUS A;  1ORK A;  2WUI A;  5J3L A;  2XGC A;  4DW6 A;  3BCG A;  3HIM A;  2F07 A;  3PAS A;  2UXU A;  2NP5 A;  3ZQL A;  4V2G A;  1VI0 A;  1Z0X A;  3VOK A;  1RKT A;  3IUV A;  2FD5 A;  2XPV A;  2Q24 A;  3IH3 A;  3NNR A;  5J1Y A;  3G1M A;  2UXI A;  3VP5 A;  2JJ7 A;  3B81 A;  4KWA A;  3LJL A;  2ZCN A;  3KNW A;  4PXI A;  2UXO A;  3V6G A;  3Q0V A;  3IH4 A;  2UXH A;  4D5C A;  5HSZ A;  2ZB9 A;  2G7S A;  2XRL A;  2G7L A;  2XPW A;  1UI6 A;  3Q3S A;  3IH2 A;  3FK7 A;  3GZI A;  3LHQ A;  5FKK A;  4B3A A;  2HKU A;  2VPR A;  3BJB A;  2G7G A;  3BQZ A;  2FX0 A;  2ID3 A;  5EZH A;  2GUH A;  3SDG A;  4ABZ A;  2ZCX A;  2PBX A;  3TP3 A;  3VW0 A;  4D7M A;  1JTX A;  1ZK8 A;  2V57 A;  4GCL A;  2IU5 A;  3VVY A;  4JKZ A;  3BR6 A;  4D7N A;  2ID6 A;  2FQ4 A;  2IBD A;  3FIW A;  3FRQ A;  4ACI A;  5GPA A;  2HXI A;  3P9T A;  3BR2 A;  4W1U A;  3NXC A;  5C4Y A;  3RD3 A;  2QOP A;  4D5F A;  3VUQ A;  3VOX A;  2OPT A;  3BTL A;  2TCT A;  5CXG A;  3C07 A;  2QTQ A;  3PPB A;  3VVX A;  1QPI A;  3KKD A;  2WV1 A;  3Q0U A;  4AC6 A;  3B6A A;  3O8G A;  3VW1 A;  3G1O A;  5EFY A;  1T56 A;  4X1E A;  3VIB A;  3BTJ A;  1U9N A;  2YVE A;  4M3G A;  4I76 A;  2XGD A;  1JT6 A;  3DCF A;  3BR0 A;  4GCK A;  4ME9 A;  3VPR A;  2ZOY A;  3KZ9 A;  2NS7 A;  4JNN A;  4B1R A;  5FKM A;  3HTA A;  3GEU A;  5EYR A;  3WHC A;  3SFI A;  3FK6 A;  5FKO A;  4XK4 A;  2WGB A;  2JK3 A;  2DTZ A;  3E7Q A;  1JTY A;  5K7Z A;  3CCY A;  3PM1 A;  3CRJ A;  1Z77 A;  3HTJ A;  3LSJ A;  5FKL A;  3ANP A;  2HXO A;  5FHP A;  4V2F A;  2TRT A;  3G56 A;  2UXP A;  3CWR A;  1JUP A;  5K7H A;  2RAS A;  3BR1 A;  3QPL A;  5IPA A;  2I10 A;  5F08 A;  2O7T A;  4GCT A;  2ZOZ A;  4G12 A;  2NX4 A;  4I6Z A;  3MNL A;  3AQS A;  5GP9 A;  3NI7 A;  1RPW A;  3CDL A;  3VW2 A;  2XGE A;  2QCO A;  2HYJ A;  4M3D A;  2Y31 A;  3CJD A;  1SGM A;  4M3B A;  3S5R A;  3F0C A;  2VKV A;  2RAE A;  5F04 A;  5F0C A;  2W53 A;  5F27 A;  2ZCM A;  2FBQ A;  3ANG A;  5FMP A;  3G7R A;  3T6N A;  2OF7 A;  4AF5 A;  4CGR A;  1T33 A;  2RHA A;  5AQC A;  5IOZ A;  4JYK A;  2PZ9 A;  5J1U A;  4GFL A;  3BTC A;  3KKC A;  2DG8 A;  5F0F A;  3NRG A;  3G1L A;  3HTH A;  3ON2 A;  2QWT A;  5J1R A;  4MXM A;  3HGG A;  5FGL A;  2OER A;  5F1J A;  3BTI A;  2FJ1 A;  5GPC A;  2D6Y A;  3LOC A;  4M3E A;  5HBU A;  4MK6 A;  3MVP A;  5D1R A;  2HQ5 A;  5K7F A;  3ZQG A;  3BR3 A;  4L62 A;  3DEW A;  2EH3 A;  3RH2 A;  1RKW A;  5D19 A;  3DPJ A;  5CXI A;  1QVU A;  5FKN A;  3TP0 A;  3EGQ A;  2G0E A;  3JSJ A;  3BR5 A;  4YZE A;  2XDN A;  5F0H A;  3B6C A;  3O8H A;  3O60 A;  3ZQF A;  2GEN A;  2XB5 A;  3AQT A;  3C2B A;  2NP3 A;  3BNI A;  1JUM A;  4UDS A;  2O7O A;  1A6I A;  4JL3 A;  3BT9 A;  2Y2Z A;  4NN1 A;  3NPI A;  1QVT A;  3WHB A;  3QPS A;  5HAW A;  3V78 A;  2IEK A;  3HE0 A;  3LSR A;  3LSP A;  3BRU A;  2X9D A;  2OI8 A;  3LWJ A;  5D18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...