3LJLA

The crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
b'SKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator LuxT
molecule tags Transcription regulator
source organism Vibrio parahaemolyticus
publication title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633.
rcsb
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ljlA00
4G12A 4M3DA 2JJ7A 2XB5A 3G1MA 2X6OA 5J1UA 3KKDA 2OERA 2QCOA 4KWAA 5CXIA 1SGMA 2QTQA 2RHAA 3DEWA 3CJDA 4M3FA 3VVXA 4ME9A 2OF7A 2WUIA 5F08A 3F1BA 3VIBA 2ID6A 3NPIA 5FGLA 2WV1A 3ZQFA 5FKKA 2XRLA 3IH3A 4PXIA 3QBMA 5F1JA 3CDLA 1JUMA 3ZQIA 4XK4A 2Q24A 2GFNA 4AC6A 4D7NA 2HQ5A 5D19A 1UI5A 5FKNA 2ZOZA 3WHBA 3F0CA 5IPAA 1T33A 2D6YA 2UXUA 2XGDA 3QPLA 2PBXA 3BJBA 3QQAA 3HTIA 1JTYA 5HSZA 5EZHA 2Y30A 2GUHA 2Y2ZA 4YZEA 1JT0A 5H9TA 5GPAA 2ZCXA 1U9NA 5EYRA 5IOZA 3BTJA 3BHQA 3LSJA 3IH4A 3EGQA 5F04A 4ABZA 2VKVA 3BTIA 5K7HA 3ANGA 2YVEA 4AUXA 3VUQA 2FJ1A 4D5FA 3HTJA 1JUSA 3C07A 3BQYA 4GCTA 2IBDA 3VW0A 5AQCA 2HXOA 2O7OA 3QPSA 3SDGA 5HAWA 4B1RA 2HXIA 2NP3A 4JKZA 3WHCA 2UXPA 2FQ4A 5IOYA 3V78A 1ZK8A 2G7LA 3BT9A 3TP0A 3GZIA 3COLA 1ORKA 3BR6A 2G0EA 1Z77A 5FHPA 4D7MA 5CW8A 3FK6A 3T6NA 4MXMA 2REKA 1VI0A 2WGBA 3LJLA 3LWJA 3MVPA 1RKWA 3ON2A 3KZ9A 3G56A 3BR2A 4L62A 2QKOA 2V57A 1QPIA 5F0CA 4AC0A 4JL3A 3FIWA 3SFIA 2F07A 2HYTA 3LSRA 4M3GA 4M3BA 1QVTA 3MNLA 2DG8A 3VOKA 4W1UA 3DCFA 4HKUA 3BR5A 2ZOYA 2I10A 5F27A 4MK6A 5IP6A 3ZQLA 1ZKGA 3TP3A 3JSJA 4NELA 2NP5A 3VP5A 1JT6A 3B6AA 2TRTA 1Z0XA 5K7ZA 3CWRA 3BR3A 3Q3SA 4GFLA 2NS7A 4X1EA 3NI7A 2RASA 4ACIA 3BRUA 2ZB9A 3G1OA 3NXCA 3VVZA 3BNIA 2XPWA 3CRJA 3VW2A 4I76A 3PM1A 4UDSA 1BJZA 3CCYA 2O7TA 5F0FA 3VOXA 3ON4A 3LOCA 2UXOA 2G3BA 3S5RA 4V2GA 4MO7A 2YVHA 2QOPA 2HKUA 3HGYA 5D18A 3HTHA 4CGRA 3B6CA 5HBUA 5DAJA 5FMPA 3IH2A 2GENA 3B81A 2PZ9A 4JNNA 5FKLA 2G7SA 3ZQGA 2HYJA 1RPWA 3QKXA 2XPUA 2UXIA 2VKEA 5F0HA 3VW1A 3BR1A 3RH2A 2FD5A 3BTLA 3P9TA 2ID3A 3HE0A 3KKCA 2OPTA 5FKMA 5CXGA 3VVYA 2W53A 2UXHA 2IEKA 1QVUA 3O8HA 3KNWA 4AF5A 3FRQA 3NRGA 4ICHA 3BTCA 5J3LA 2EH3A 2ZCNA 4NN1A 2OI8A 2IU5A 1A6IA 5D1RA 5EFYA 3AQSA 3IUVA 2G7GA 2RAEA 3HGGA 1UI6A 3EUPA 3Q0WA 4JYKA 1U9OA 4V2FA 1JUPA 1RKTA 2XPVA 3G1LA 2FBQA 4I6ZA 3NNRA 5K58A 2QIBA 2NX4A 4GCLA 3RD3A 2VPRA 2JK3A 2QWTA 5GPCA 2FX0A 3Q0VA 2XGCA 3PASA 3BQZA 5EZGA 3LSPA 2GBYA 3O60A 3AQTA 3ZQHA 2DG7A 3O8GA 2TCTA 5C4YA 5GP9A 3PPBA 5K7FA 3FK7A 3HIMA 2XGEA 2IAIA 4M3EA 4B3AA 3BR0A 3BCGA 3DPJA 2XDNA 4W97A 2Y31A 3VPRA 4D5CA 4DW6A 2DTZA 3ANPA 5J1RA 3Q0UA 3G7RA 3C2BA 3HTAA 4GCKA 3V6GA 1T56A 2ZCMA 3LHQA 4GFKA 5J1YA 5FKOA 2NS8A 3GEUA 1JTXA 2X9DA 3E7QA
chains in the Genus database with same CATH superfamily
4G12A 4M3DA 2JJ7A 2XB5A 3G1MA 2X6OA 5J1UA 3KKDA 2OERA 4IRVA 4U9NA 2QCOA 4KWAA 5CXIA 1SGMA 2QTQA 2RHAA 3DEWA 2R7VA 3CJDA 4M3FA 3VVXA 4ME9A 2OF7A 2WUIA 5F08A 3F1BA 3VIBA 2ID6A 3NPIA 5FGLA 2WV1A 3ZQFA 5FKKA 2XRLA 3IH3A 4PXIA 3QBMA 5F1JA 3CDLA 1JUMA 2R7RA 3ZQIA 4XK4A 2Q24A 3SWHA 2B1EA 2GFNA 4AC6A 4D7NA 2HQ5A 5D19A 2R7SA 1UI5A 4DVYP 5FKNA 2ZOZA 3WHBA 3F0CA 5IPAA 1T33A 2D6YA 2UXUA 2XGDA 3QPLA 3VTIA 2PBXA 3BJBA 4OD4A 3QQAA 3HTIA 1JTYA 5HSZA 5EZHA 2Y30A 2GUHA 2Y2ZA 4YZEA 1JT0A 5H9TA 5GPAA 2ZCXA 1U9NA 5EYRA 5IOZA 2R7UA 3BTJA 3BHQA 3LSJA 3IH4A 3EGQA 5F04A 4ABZA 2VKVA 3BTIA 5K7HA 3ANGA 2YVEA 4AUXA 3VUQA 2FJ1A 4D5FA 3HTJA 1JUSA 3C07A 3BQYA 4GCTA 2IBDA 3VW0A 5AQCA 2HXOA 2O7OA 3QPSA 3SDGA 5HAWA 3DU6A 4B1RA 2HXIA 2NP3A 4JKZA 3WHCA 2UXPA 2FQ4A 5IOYA 3V78A 1ZK8A 2G7LA 3BT9A 3TP0A 3GZIA 3COLA 1ORKA 3BR6A 2G0EA 5CQGA 1Z77A 4U9LA 5FHPA 4D7MA 5CW8A 3FK6A 3T6NA 4MXMA 2REKA 1VI0A 2WGBA 3LJLA 3LWJA 4OD5A 3MVPA 1RKWA 3ON2A 3KZ9A 3G56A 3BR2A 4L62A 2QKOA 2V57A 1QPIA 5F0CA 4AC0A 4JL3A 3FIWA 3SFIA 2F07A 2HYTA 3LSRA 2R7WA 4M3GA 4M3BA 1QVTA 3MNLA 2DG8A 3VOKA 4W1UA 3DCFA 4HKUA 3BR5A 2ZOYA 2I10A 5F27A 4MK6A 5IP6A 3ZQLA 1ZKGA 3TP3A 2FJI1 3JSJA 4NELA 2NP5A 3VP5A 1JT6A 3B6AA 2TRTA 1Z0XA 5K7ZA 3CWRA 3BR3A 3Q3SA 4GFLA 2NS7A 4X1EA 3NI7A 2RASA 4ACIA 3BRUA 4WIBA 2ZB9A 3G1OA 3NXCA 3VVZA 3BNIA 2XPWA 3CRJA 3VW2A 4I76A 3PM1A 4UDSA 1BJZA 3KYLA 3CCYA 2O7TA 3K8PC 5F0FA 3VOXA 3ON4A 2R7TA 3LOCA 2UXOA 2G3BA 3S5RA 4V2GA 4MO7A 2PFVA 2YVHA 2ZY9A 2QOPA 2HKUA 3HGYA 5D18A 3HTHA 4CGRA 3B6CA 5HBUA 5DAJA 5FMPA 2R7QA 3FHNA 3IH2A 2GENA 3B81A 4C2MA 2PZ9A 4JNNA 5FKLA 2G7SA 2A2FX 3ZQGA 2HYJA 1RPWA 3QKXA 2XPUA 2UXIA 2VKEA 5F0HA 3DU5A 3VW1A 3BR1A 3RH2A 2FD5A 3BTLA 3P9TA 2ID3A 3HE0A 3KKCA 2OPTA 5FKMA 5CXGA 3VVYA 2W53A 2UXHA 2IEKA 1QVUA 3O8HA 3KNWA 4AF5A 3FRQA 3NRGA 4ICHA 3BTCA 5J3LA 2EH3A 3NS4A 2ZCNA 4NN1A 2OI8A 2IU5A 1A6IA 5D1RA 5EFYA 3AQSA 3IUVA 2G7GA 2RAEA 3HGGA 1UI6A 3EUPA 3Q0WA 4JYKA 1U9OA 4V2FA 1JUPA 1RKTA 2XPVA 3G1LA 2B3WA 2FBQA 4I6ZA 3NNRA 5K58A 2QIBA 2NX4A 4GCLA 3RD3A 2VPRA 2JK3A 2QWTA 5GPCA 2FX0A 3Q0VA 2XGCA 3PASA 3BQZA 5EZGA 2R7OA 3LSPA 2GBYA 3O60A 3AQTA 3ZQHA 2DG7A 3O8GA 2TCTA 5C4YA 5GP9A 3PPBA 5K7FA 3FK7A 3HIMA 2R7XA 2XGEA 2IAIA 4M3EA 4B3AA 3BR0A 3BCGA 3DPJA 2XDNA 4W97A 2Y31A 3VPRA 4D5CA 4DW6A 2DTZA 3ANPA 5J1RA 3Q0UA 3G7RA 3C2BA 3HTAA 4GCKA 3V6GA 1T56A 2ZCMA 3LHQA 4GFKA 5J1YA 5FKOA 2NS8A 3GEUA 1JTXA 2YVXA 2X9DA 3E7QA
chains in the Genus database with same CATH topology
4G12A 4M3DA 2JJ7A 2XB5A 3G1MA 2X6OA 5J1UA 3KKDA 2OERA 2QCOA 4KWAA 5CXIA 1SGMA 2QTQA 2RHAA 3DEWA 3CJDA 4M3FA 3VVXA 4ME9A 2OF7A 2WUIA 5F08A 3F1BA 3VIBA 2ID6A 3NPIA 5FGLA 2WV1A 3ZQFA 5FKKA 2XRLA 3IH3A 4PXIA 3QBMA 5F1JA 3CDLA 1JUMA 3ZQIA 4XK4A 2Q24A 2GFNA 4AC6A 4D7NA 2HQ5A 5D19A 1UI5A 5FKNA 2ZOZA 3WHBA 3F0CA 5IPAA 1T33A 2D6YA 2UXUA 2XGDA 3QPLA 2PBXA 3BJBA 3QQAA 3HTIA 1JTYA 5HSZA 5EZHA 2Y30A 2GUHA 2Y2ZA 4YZEA 1JT0A 5H9TA 5GPAA 2ZCXA 1U9NA 5EYRA 5IOZA 3BTJA 3BHQA 3LSJA 3IH4A 3EGQA 5F04A 4ABZA 2VKVA 3BTIA 5K7HA 3ANGA 2YVEA 4AUXA 3VUQA 2FJ1A 4D5FA 3HTJA 1JUSA 3C07A 3BQYA 4GCTA 2IBDA 3VW0A 5AQCA 2HXOA 2O7OA 3QPSA 3SDGA 5HAWA 4B1RA 2HXIA 2NP3A 4JKZA 3WHCA 2UXPA 2FQ4A 5IOYA 3V78A 1ZK8A 2G7LA 3BT9A 3TP0A 3GZIA 3COLA 1ORKA 3BR6A 2G0EA 1Z77A 5FHPA 4D7MA 5CW8A 3FK6A 3T6NA 4MXMA 2REKA 1VI0A 2WGBA 3LJLA 3LWJA 3MVPA 1RKWA 3ON2A 3KZ9A 3G56A 3BR2A 4L62A 2QKOA 2V57A 1QPIA 5F0CA 4AC0A 4JL3A 3FIWA 3SFIA 2F07A 2HYTA 3LSRA 4M3GA 4M3BA 1QVTA 3MNLA 2DG8A 3VOKA 4W1UA 3DCFA 4HKUA 3BR5A 2ZOYA 2I10A 5F27A 4MK6A 5IP6A 3ZQLA 1ZKGA 3TP3A 3JSJA 4NELA 2NP5A 3VP5A 1JT6A 3B6AA 2TRTA 1Z0XA 5K7ZA 3CWRA 3BR3A 3Q3SA 4GFLA 2NS7A 4X1EA 3NI7A 2RASA 4ACIA 3BRUA 2ZB9A 3G1OA 3NXCA 3VVZA 3BNIA 2XPWA 3CRJA 3VW2A 4I76A 3PM1A 4UDSA 1BJZA 3CCYA 2O7TA 5F0FA 3VOXA 3ON4A 3LOCA 2UXOA 2G3BA 3S5RA 4V2GA 4MO7A 2YVHA 2QOPA 2HKUA 3HGYA 5D18A 3HTHA 4CGRA 3B6CA 5HBUA 5DAJA 5FMPA 3IH2A 2GENA 3B81A 2PZ9A 4JNNA 5FKLA 2G7SA 3ZQGA 2HYJA 1RPWA 3QKXA 2XPUA 2UXIA 2VKEA 5F0HA 3VW1A 3BR1A 3RH2A 2FD5A 3BTLA 3P9TA 2ID3A 3HE0A 3KKCA 2OPTA 5FKMA 5CXGA 3VVYA 2W53A 2UXHA 2IEKA 1QVUA 3O8HA 3KNWA 4AF5A 3FRQA 3NRGA 4ICHA 3BTCA 5J3LA 2EH3A 2ZCNA 4NN1A 2OI8A 2IU5A 1A6IA 5D1RA 5EFYA 3AQSA 3IUVA 2G7GA 2RAEA 3HGGA 1UI6A 3EUPA 3Q0WA 4JYKA 1U9OA 4V2FA 1JUPA 1RKTA 2XPVA 3G1LA 2FBQA 4I6ZA 3NNRA 5K58A 2QIBA 2NX4A 4GCLA 3RD3A 2VPRA 2JK3A 2QWTA 5GPCA 2FX0A 3Q0VA 2XGCA 3PASA 3BQZA 5EZGA 3LSPA 2GBYA 3O60A 3AQTA 3ZQHA 2DG7A 3O8GA 2TCTA 5C4YA 5GP9A 3PPBA 5K7FA 3FK7A 3HIMA 2XGEA 2IAIA 4M3EA 4B3AA 3BR0A 3BCGA 3DPJA 2XDNA 4W97A 2Y31A 3VPRA 4D5CA 4DW6A 2DTZA 3ANPA 5J1RA 3Q0UA 3G7RA 3C2BA 3HTAA 4GCKA 3V6GA 1T56A 2ZCMA 3LHQA 4GFKA 5J1YA 5FKOA 2NS8A 3GEUA 1JTXA 2X9DA 3E7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G12 A;  4M3D A;  2JJ7 A;  2XB5 A;  3G1M A;  2X6O A;  5J1U A;  3KKD A;  2OER A;  2QCO A;  4KWA A;  5CXI A;  1SGM A;  2QTQ A;  2RHA A;  3DEW A;  3CJD A;  4M3F A;  3VVX A;  4ME9 A;  2OF7 A;  2WUI A;  5F08 A;  3F1B A;  3VIB A;  2ID6 A;  3NPI A;  5FGL A;  2WV1 A;  3ZQF A;  5FKK A;  2XRL A;  3IH3 A;  4PXI A;  3QBM A;  5F1J A;  3CDL A;  1JUM A;  3ZQI A;  4XK4 A;  2Q24 A;  2GFN A;  4AC6 A;  4D7N A;  2HQ5 A;  5D19 A;  1UI5 A;  5FKN A;  2ZOZ A;  3WHB A;  3F0C A;  5IPA A;  1T33 A;  2D6Y A;  2UXU A;  2XGD A;  3QPL A;  2PBX A;  3BJB A;  3QQA A;  3HTI A;  1JTY A;  5HSZ A;  5EZH A;  2Y30 A;  2GUH A;  2Y2Z A;  4YZE A;  1JT0 A;  5H9T A;  5GPA A;  2ZCX A;  1U9N A;  5EYR A;  5IOZ A;  3BTJ A;  3BHQ A;  3LSJ A;  3IH4 A;  3EGQ A;  5F04 A;  4ABZ A;  2VKV A;  3BTI A;  5K7H A;  3ANG A;  2YVE A;  4AUX A;  3VUQ A;  2FJ1 A;  4D5F A;  3HTJ A;  1JUS A;  3C07 A;  3BQY A;  4GCT A;  2IBD A;  3VW0 A;  5AQC A;  2HXO A;  2O7O A;  3QPS A;  3SDG A;  5HAW A;  4B1R A;  2HXI A;  2NP3 A;  4JKZ A;  3WHC A;  2UXP A;  2FQ4 A;  5IOY A;  3V78 A;  1ZK8 A;  2G7L A;  3BT9 A;  3TP0 A;  3GZI A;  3COL A;  1ORK A;  3BR6 A;  2G0E A;  1Z77 A;  5FHP A;  4D7M A;  5CW8 A;  3FK6 A;  3T6N A;  4MXM A;  2REK A;  1VI0 A;  2WGB A;  3LJL A;  3LWJ A;  3MVP A;  1RKW A;  3ON2 A;  3KZ9 A;  3G56 A;  3BR2 A;  4L62 A;  2QKO A;  2V57 A;  1QPI A;  5F0C A;  4AC0 A;  4JL3 A;  3FIW A;  3SFI A;  2F07 A;  2HYT A;  3LSR A;  4M3G A;  4M3B A;  1QVT A;  3MNL A;  2DG8 A;  3VOK A;  4W1U A;  3DCF A;  4HKU A;  3BR5 A;  2ZOY A;  2I10 A;  5F27 A;  4MK6 A;  5IP6 A;  3ZQL A;  1ZKG A;  3TP3 A;  3JSJ A;  4NEL A;  2NP5 A;  3VP5 A;  1JT6 A;  3B6A A;  2TRT A;  1Z0X A;  5K7Z A;  3CWR A;  3BR3 A;  3Q3S A;  4GFL A;  2NS7 A;  4X1E A;  3NI7 A;  2RAS A;  4ACI A;  3BRU A;  2ZB9 A;  3G1O A;  3NXC A;  3VVZ A;  3BNI A;  2XPW A;  3CRJ A;  3VW2 A;  4I76 A;  3PM1 A;  4UDS A;  1BJZ A;  3CCY A;  2O7T A;  5F0F A;  3VOX A;  3ON4 A;  3LOC A;  2UXO A;  2G3B A;  3S5R A;  4V2G A;  4MO7 A;  2YVH A;  2QOP A;  2HKU A;  3HGY A;  5D18 A;  3HTH A;  4CGR A;  3B6C A;  5HBU A;  5DAJ A;  5FMP A;  3IH2 A;  2GEN A;  3B81 A;  2PZ9 A;  4JNN A;  5FKL A;  2G7S A;  3ZQG A;  2HYJ A;  1RPW A;  3QKX A;  2XPU A;  2UXI A;  2VKE A;  5F0H A;  3VW1 A;  3BR1 A;  3RH2 A;  2FD5 A;  3BTL A;  3P9T A;  2ID3 A;  3HE0 A;  3KKC A;  2OPT A;  5FKM A;  5CXG A;  3VVY A;  2W53 A;  2UXH A;  2IEK A;  1QVU A;  3O8H A;  3KNW A;  4AF5 A;  3FRQ A;  3NRG A;  4ICH A;  3BTC A;  5J3L A;  2EH3 A;  2ZCN A;  4NN1 A;  2OI8 A;  2IU5 A;  1A6I A;  5D1R A;  5EFY A;  3AQS A;  3IUV A;  2G7G A;  2RAE A;  3HGG A;  1UI6 A;  3EUP A;  3Q0W A;  4JYK A;  1U9O A;  4V2F A;  1JUP A;  1RKT A;  2XPV A;  3G1L A;  2FBQ A;  4I6Z A;  3NNR A;  5K58 A;  2QIB A;  2NX4 A;  4GCL A;  3RD3 A;  2VPR A;  2JK3 A;  2QWT A;  5GPC A;  2FX0 A;  3Q0V A;  2XGC A;  3PAS A;  3BQZ A;  5EZG A;  3LSP A;  2GBY A;  3O60 A;  3AQT A;  3ZQH A;  2DG7 A;  3O8G A;  2TCT A;  5C4Y A;  5GP9 A;  3PPB A;  5K7F A;  3FK7 A;  3HIM A;  2XGE A;  2IAI A;  4M3E A;  4B3A A;  3BR0 A;  3BCG A;  3DPJ A;  2XDN A;  4W97 A;  2Y31 A;  3VPR A;  4D5C A;  4DW6 A;  2DTZ A;  3ANP A;  5J1R A;  3Q0U A;  3G7R A;  3C2B A;  3HTA A;  4GCK A;  3V6G A;  1T56 A;  2ZCM A;  3LHQ A;  4GFK A;  5J1Y A;  5FKO A;  2NS8 A;  3GEU A;  1JTX A;  2X9D A;  3E7Q A; 
#chains in the Genus database with same CATH topology
 4G12 A;  4M3D A;  2JJ7 A;  2XB5 A;  3G1M A;  2X6O A;  5J1U A;  3KKD A;  2OER A;  4IRV A;  4U9N A;  2QCO A;  4KWA A;  5CXI A;  1SGM A;  2QTQ A;  2RHA A;  3DEW A;  2R7V A;  3CJD A;  4M3F A;  3VVX A;  4ME9 A;  2OF7 A;  2WUI A;  5F08 A;  3F1B A;  3VIB A;  2ID6 A;  3NPI A;  5FGL A;  2WV1 A;  3ZQF A;  5FKK A;  2XRL A;  3IH3 A;  4PXI A;  3QBM A;  5F1J A;  3CDL A;  1JUM A;  2R7R A;  3ZQI A;  4XK4 A;  2Q24 A;  3SWH A;  2B1E A;  2GFN A;  4AC6 A;  4D7N A;  2HQ5 A;  5D19 A;  2R7S A;  1UI5 A;  4DVY P;  5FKN A;  2ZOZ A;  3WHB A;  3F0C A;  5IPA A;  1T33 A;  2D6Y A;  2UXU A;  2XGD A;  3QPL A;  3VTI A;  2PBX A;  3BJB A;  4OD4 A;  3QQA A;  3HTI A;  1JTY A;  5HSZ A;  5EZH A;  2Y30 A;  2GUH A;  2Y2Z A;  4YZE A;  1JT0 A;  5H9T A;  5GPA A;  2ZCX A;  1U9N A;  5EYR A;  5IOZ A;  2R7U A;  3BTJ A;  3BHQ A;  3LSJ A;  3IH4 A;  3EGQ A;  5F04 A;  4ABZ A;  2VKV A;  3BTI A;  5K7H A;  3ANG A;  2YVE A;  4AUX A;  3VUQ A;  2FJ1 A;  4D5F A;  3HTJ A;  1JUS A;  3C07 A;  3BQY A;  4GCT A;  2IBD A;  3VW0 A;  5AQC A;  2HXO A;  2O7O A;  3QPS A;  3SDG A;  5HAW A;  3DU6 A;  4B1R A;  2HXI A;  2NP3 A;  4JKZ A;  3WHC A;  2UXP A;  2FQ4 A;  5IOY A;  3V78 A;  1ZK8 A;  2G7L A;  3BT9 A;  3TP0 A;  3GZI A;  3COL A;  1ORK A;  3BR6 A;  2G0E A;  5CQG A;  1Z77 A;  4U9L A;  5FHP A;  4D7M A;  5CW8 A;  3FK6 A;  3T6N A;  4MXM A;  2REK A;  1VI0 A;  2WGB A;  3LJL A;  3LWJ A;  4OD5 A;  3MVP A;  1RKW A;  3ON2 A;  3KZ9 A;  3G56 A;  3BR2 A;  4L62 A;  2QKO A;  2V57 A;  1QPI A;  5F0C A;  4AC0 A;  4JL3 A;  3FIW A;  3SFI A;  2F07 A;  2HYT A;  3LSR A;  2R7W A;  4M3G A;  4M3B A;  1QVT A;  3MNL A;  2DG8 A;  3VOK A;  4W1U A;  3DCF A;  4HKU A;  3BR5 A;  2ZOY A;  2I10 A;  5F27 A;  4MK6 A;  5IP6 A;  3ZQL A;  1ZKG A;  3TP3 A;  2FJI 1;  3JSJ A;  4NEL A;  2NP5 A;  3VP5 A;  1JT6 A;  3B6A A;  2TRT A;  1Z0X A;  5K7Z A;  3CWR A;  3BR3 A;  3Q3S A;  4GFL A;  2NS7 A;  4X1E A;  3NI7 A;  2RAS A;  4ACI A;  3BRU A;  4WIB A;  2ZB9 A;  3G1O A;  3NXC A;  3VVZ A;  3BNI A;  2XPW A;  3CRJ A;  3VW2 A;  4I76 A;  3PM1 A;  4UDS A;  1BJZ A;  3KYL A;  3CCY A;  2O7T A;  3K8P C;  5F0F A;  3VOX A;  3ON4 A;  2R7T A;  3LOC A;  2UXO A;  2G3B A;  3S5R A;  4V2G A;  4MO7 A;  2PFV A;  2YVH A;  2ZY9 A;  2QOP A;  2HKU A;  3HGY A;  5D18 A;  3HTH A;  4CGR A;  3B6C A;  5HBU A;  5DAJ A;  5FMP A;  2R7Q A;  3FHN A;  3IH2 A;  2GEN A;  3B81 A;  4C2M A;  2PZ9 A;  4JNN A;  5FKL A;  2G7S A;  2A2F X;  3ZQG A;  2HYJ A;  1RPW A;  3QKX A;  2XPU A;  2UXI A;  2VKE A;  5F0H A;  3DU5 A;  3VW1 A;  3BR1 A;  3RH2 A;  2FD5 A;  3BTL A;  3P9T A;  2ID3 A;  3HE0 A;  3KKC A;  2OPT A;  5FKM A;  5CXG A;  3VVY A;  2W53 A;  2UXH A;  2IEK A;  1QVU A;  3O8H A;  3KNW A;  4AF5 A;  3FRQ A;  3NRG A;  4ICH A;  3BTC A;  5J3L A;  2EH3 A;  3NS4 A;  2ZCN A;  4NN1 A;  2OI8 A;  2IU5 A;  1A6I A;  5D1R A;  5EFY A;  3AQS A;  3IUV A;  2G7G A;  2RAE A;  3HGG A;  1UI6 A;  3EUP A;  3Q0W A;  4JYK A;  1U9O A;  4V2F A;  1JUP A;  1RKT A;  2XPV A;  3G1L A;  2B3W A;  2FBQ A;  4I6Z A;  3NNR A;  5K58 A;  2QIB A;  2NX4 A;  4GCL A;  3RD3 A;  2VPR A;  2JK3 A;  2QWT A;  5GPC A;  2FX0 A;  3Q0V A;  2XGC A;  3PAS A;  3BQZ A;  5EZG A;  2R7O A;  3LSP A;  2GBY A;  3O60 A;  3AQT A;  3ZQH A;  2DG7 A;  3O8G A;  2TCT A;  5C4Y A;  5GP9 A;  3PPB A;  5K7F A;  3FK7 A;  3HIM A;  2R7X A;  2XGE A;  2IAI A;  4M3E A;  4B3A A;  3BR0 A;  3BCG A;  3DPJ A;  2XDN A;  4W97 A;  2Y31 A;  3VPR A;  4D5C A;  4DW6 A;  2DTZ A;  3ANP A;  5J1R A;  3Q0U A;  3G7R A;  3C2B A;  3HTA A;  4GCK A;  3V6G A;  1T56 A;  2ZCM A;  3LHQ A;  4GFK A;  5J1Y A;  5FKO A;  2NS8 A;  3GEU A;  1JTX A;  2YVX A;  2X9D A;  3E7Q A; 
#chains in the Genus database with same CATH homology
 4G12 A;  4M3D A;  2JJ7 A;  2XB5 A;  3G1M A;  2X6O A;  5J1U A;  3KKD A;  2OER A;  2QCO A;  4KWA A;  5CXI A;  1SGM A;  2QTQ A;  2RHA A;  3DEW A;  3CJD A;  4M3F A;  3VVX A;  4ME9 A;  2OF7 A;  2WUI A;  5F08 A;  3F1B A;  3VIB A;  2ID6 A;  3NPI A;  5FGL A;  2WV1 A;  3ZQF A;  5FKK A;  2XRL A;  3IH3 A;  4PXI A;  3QBM A;  5F1J A;  3CDL A;  1JUM A;  3ZQI A;  4XK4 A;  2Q24 A;  2GFN A;  4AC6 A;  4D7N A;  2HQ5 A;  5D19 A;  1UI5 A;  5FKN A;  2ZOZ A;  3WHB A;  3F0C A;  5IPA A;  1T33 A;  2D6Y A;  2UXU A;  2XGD A;  3QPL A;  2PBX A;  3BJB A;  3QQA A;  3HTI A;  1JTY A;  5HSZ A;  5EZH A;  2Y30 A;  2GUH A;  2Y2Z A;  4YZE A;  1JT0 A;  5H9T A;  5GPA A;  2ZCX A;  1U9N A;  5EYR A;  5IOZ A;  3BTJ A;  3BHQ A;  3LSJ A;  3IH4 A;  3EGQ A;  5F04 A;  4ABZ A;  2VKV A;  3BTI A;  5K7H A;  3ANG A;  2YVE A;  4AUX A;  3VUQ A;  2FJ1 A;  4D5F A;  3HTJ A;  1JUS A;  3C07 A;  3BQY A;  4GCT A;  2IBD A;  3VW0 A;  5AQC A;  2HXO A;  2O7O A;  3QPS A;  3SDG A;  5HAW A;  4B1R A;  2HXI A;  2NP3 A;  4JKZ A;  3WHC A;  2UXP A;  2FQ4 A;  5IOY A;  3V78 A;  1ZK8 A;  2G7L A;  3BT9 A;  3TP0 A;  3GZI A;  3COL A;  1ORK A;  3BR6 A;  2G0E A;  1Z77 A;  5FHP A;  4D7M A;  5CW8 A;  3FK6 A;  3T6N A;  4MXM A;  2REK A;  1VI0 A;  2WGB A;  3LJL A;  3LWJ A;  3MVP A;  1RKW A;  3ON2 A;  3KZ9 A;  3G56 A;  3BR2 A;  4L62 A;  2QKO A;  2V57 A;  1QPI A;  5F0C A;  4AC0 A;  4JL3 A;  3FIW A;  3SFI A;  2F07 A;  2HYT A;  3LSR A;  4M3G A;  4M3B A;  1QVT A;  3MNL A;  2DG8 A;  3VOK A;  4W1U A;  3DCF A;  4HKU A;  3BR5 A;  2ZOY A;  2I10 A;  5F27 A;  4MK6 A;  5IP6 A;  3ZQL A;  1ZKG A;  3TP3 A;  3JSJ A;  4NEL A;  2NP5 A;  3VP5 A;  1JT6 A;  3B6A A;  2TRT A;  1Z0X A;  5K7Z A;  3CWR A;  3BR3 A;  3Q3S A;  4GFL A;  2NS7 A;  4X1E A;  3NI7 A;  2RAS A;  4ACI A;  3BRU A;  2ZB9 A;  3G1O A;  3NXC A;  3VVZ A;  3BNI A;  2XPW A;  3CRJ A;  3VW2 A;  4I76 A;  3PM1 A;  4UDS A;  1BJZ A;  3CCY A;  2O7T A;  5F0F A;  3VOX A;  3ON4 A;  3LOC A;  2UXO A;  2G3B A;  3S5R A;  4V2G A;  4MO7 A;  2YVH A;  2QOP A;  2HKU A;  3HGY A;  5D18 A;  3HTH A;  4CGR A;  3B6C A;  5HBU A;  5DAJ A;  5FMP A;  3IH2 A;  2GEN A;  3B81 A;  2PZ9 A;  4JNN A;  5FKL A;  2G7S A;  3ZQG A;  2HYJ A;  1RPW A;  3QKX A;  2XPU A;  2UXI A;  2VKE A;  5F0H A;  3VW1 A;  3BR1 A;  3RH2 A;  2FD5 A;  3BTL A;  3P9T A;  2ID3 A;  3HE0 A;  3KKC A;  2OPT A;  5FKM A;  5CXG A;  3VVY A;  2W53 A;  2UXH A;  2IEK A;  1QVU A;  3O8H A;  3KNW A;  4AF5 A;  3FRQ A;  3NRG A;  4ICH A;  3BTC A;  5J3L A;  2EH3 A;  2ZCN A;  4NN1 A;  2OI8 A;  2IU5 A;  1A6I A;  5D1R A;  5EFY A;  3AQS A;  3IUV A;  2G7G A;  2RAE A;  3HGG A;  1UI6 A;  3EUP A;  3Q0W A;  4JYK A;  1U9O A;  4V2F A;  1JUP A;  1RKT A;  2XPV A;  3G1L A;  2FBQ A;  4I6Z A;  3NNR A;  5K58 A;  2QIB A;  2NX4 A;  4GCL A;  3RD3 A;  2VPR A;  2JK3 A;  2QWT A;  5GPC A;  2FX0 A;  3Q0V A;  2XGC A;  3PAS A;  3BQZ A;  5EZG A;  3LSP A;  2GBY A;  3O60 A;  3AQT A;  3ZQH A;  2DG7 A;  3O8G A;  2TCT A;  5C4Y A;  5GP9 A;  3PPB A;  5K7F A;  3FK7 A;  3HIM A;  2XGE A;  2IAI A;  4M3E A;  4B3A A;  3BR0 A;  3BCG A;  3DPJ A;  2XDN A;  4W97 A;  2Y31 A;  3VPR A;  4D5C A;  4DW6 A;  2DTZ A;  3ANP A;  5J1R A;  3Q0U A;  3G7R A;  3C2B A;  3HTA A;  4GCK A;  3V6G A;  1T56 A;  2ZCM A;  3LHQ A;  4GFK A;  5J1Y A;  5FKO A;  2NS8 A;  3GEU A;  1JTX A;  2X9D A;  3E7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...