3LJLA

The crystal structure of the full-length transcriptional regulator luxt from vibrio parahaemolyticus rimd 2210633.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
149
structure length
149
Chain Sequence
SKEDTEITIQKIMDAVVDQLLRLGYDKMSYTTLSQQTGVSRTGISHHFPKKTDFTAALDGRIFKMFIEHLEFEKGLDAFSQSWIKALEDSEFLAILRLLFHHIVTSESAHEFAANGIDRLYKMVESQFGSGGDKELEWLIGRSLIQMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords transcriptional regulator LuxT
publication title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633.
rcsb
source organism Vibrio parahaemolyticus
total genus 47
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18285 LuxT_C Tetracycline repressor LuxT C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ljlA00
3NXCA 2G7GA 3ZQGA 3E7QA 2VKVA 3FK6A 3NPIA 2QCOA 4AUXA 2FJ1A 3G1LA 5EFYA 2NP3A 2NP5A 3HTJA 5AQCA 3VOXA 3KKDA 2VPRA 2UXHA 2IU5A 3ON4A 4D5CA 3C07A 3Q3SA 4UDSA 2JJ7A 2QOPA 4M3BA 2DG7A 4JYKA 1UI6A 1JT0A 1T56A 3FRQA 2ZCNA 3RD3A 3BR3A 4ME9A 2XGEA 1JTXA 1ORKA 2Q24A 4GFKA 4AF5A 4B1RA 4JNNA 3BJBA 3TP3A 2D6YA 5IOYA 4M3GA 2HXOA 5FKMA 5FKOA 2YVEA 2FD5A 3T6NA 2O7TA 2FQ4A 3HGGA 3ANPA 3VOKA 2XPUA 3BTJA 3COLA 1Z77A 2G7SA 1ZKGA 2UXPA 2XPVA 5H9TA 5DAJA 4I76A 3CWRA 2QKOA 5HAWA 2X9DA 3WHCA 5J1UA 4XK4A 1RKTA 3BTLA 3BR5A 5C4YA 3F0CA 4D7MA 5EYRA 5FMPA 4GCTA 4PXIA 3Q0UA 2PBXA 2G0EA 2GUHA 5GPAA 3SDGA 3AQTA 4ACIA 4D7NA 1QVUA 1QPIA 3ANGA 1BJZA 4JL3A 3BT9A 4JKZA 5J3LA 2IAIA 3HTHA 3HGYA 1VI0A 2Y30A 2OF7A 2DTZA 5D19A 4GFLA 2TCTA 2XRLA 4YZEA 5HBUA 4NN1A 3KZ9A 3KKCA 1ZK8A 2UXUA 4MXMA 2G7LA 3BTIA 4I6ZA 3Q0WA 3LJLA 5F0FA 1JUMA 2WGBA 5K58A 2G3BA 1UI5A 5IP6A 3ON2A 5F0HA 3QQAA 3VW2A 3BR0A 3FK7A 4KWAA 3NI7A 2XDNA 2EH3A 3JSJA 2NX4A 3CDLA 4MO7A 4NELA 3EGQA 1SGMA 4GCLA 5CXGA 3NRGA 1JUPA 3G1MA 3S5RA 3VW1A 3BRUA 3VUQA 2ZOZA 3PM1A 5F27A 4D5FA 2OPTA 5F04A 3SFIA 3B6AA 3CRJA 5F08A 3C2BA 2QTQA 3B81A 3PPBA 3WHBA 2I10A 3G56A 3BQZA 3HTAA 3VVZA 3AQSA 3P9TA 2HKUA 2WV1A 4M3FA 3O60A 2W53A 3MVPA 2IEKA 2QIBA 2XB5A 2HQ5A 3LSJA 3ZQLA 1JT6A 3HTIA 1QVTA 3LSPA 2TRTA 5IPAA 1JUSA 2XPWA 3CJDA 2OI8A 5CXIA 3KNWA 2RAEA 5FGLA 2Y2ZA 2QWTA 3DPJA 3QKXA 3BR2A 2VKEA 4L62A 3LWJA 3TP0A 2F07A 3CCYA 5J1YA 4GCKA 2HXIA 3BHQA 3G1OA 3MNLA 4MK6A 3GZIA 4B3AA 2XGCA 3HE0A 3BQYA 3VPRA 4V2GA 1RKWA 3VIBA 3O8GA 1A6IA 3VVYA 3QBMA 4AC0A 5GP9A 4X1EA 5HSZA 4W97A 3IH2A 5J1RA 3IH4A 3LHQA 2FX0A 2X6OA 2GFNA 2JK3A 3FIWA 3V6GA 2PZ9A 3ZQHA 4M3EA 2RASA 5D1RA 1U9OA 5D18A 2RHAA 5EZHA 2HYTA 3G7RA 3B6CA 1T33A 2ID3A 3IUVA 4ICHA 3VVXA 2UXIA 2HYJA 5K7FA 4ABZA 3F1BA 4V2FA 5K7ZA 2ZOYA 5GPCA 5FHPA 2V57A 3BR1A 1JTYA 2Y31A 3QPSA 2REKA 3RH2A 1RPWA 2YVHA 3BCGA 5EZGA 3BTCA 2GBYA 3DCFA 3IH3A 2ZCMA 3HIMA 3QPLA 4AC6A 2ZCXA 3V78A 3EUPA 3O8HA 3GEUA 5K7HA 2UXOA 3NNRA 3ZQFA 4DW6A 3BR6A 5IOZA 5FKKA 3ZQIA 5F0CA 2DG8A 2WUIA 2ID6A 5CW8A 2GENA 3VW0A 3LSRA 4CGRA 2NS7A 3VP5A 4HKUA 1Z0XA 5FKNA 3PASA 3Q0VA 2O7OA 5F1JA 4W1UA 4M3DA 2FBQA 2IBDA 2XGDA 3BNIA 2NS8A 5FKLA 2ZB9A 2OERA 4G12A 3DEWA 1U9NA 3LOCA
chains in the Genus database with same CATH superfamily
3NXCA 2G7GA 3ZQGA 3E7QA 2VKVA 3FK6A 3NPIA 2QCOA 2R7UA 4AUXA 2FJ1A 3G1LA 3NS4A 3K8PC 5EFYA 2NP3A 2NP5A 3HTJA 5AQCA 3VOXA 3KKDA 2VPRA 2UXHA 3FHNA 2IU5A 3ON4A 4C2MA 4D5CA 3C07A 3Q3SA 4UDSA 2JJ7A 2QOPA 4M3BA 2DG7A 4JYKA 1UI6A 1JT0A 1T56A 3FRQA 2ZCNA 3RD3A 3BR3A 4ME9A 2XGEA 1JTXA 1ORKA 2Q24A 4GFKA 4AF5A 4B1RA 4JNNA 3BJBA 3TP3A 2D6YA 5IOYA 4M3GA 2HXOA 5FKMA 5FKOA 2YVEA 2FD5A 2R7SA 3T6NA 2O7TA 2FQ4A 3HGGA 3ANPA 3VOKA 2XPUA 3BTJA 3COLA 1Z77A 2G7SA 1ZKGA 2UXPA 2XPVA 5H9TA 5DAJA 4I76A 3CWRA 2QKOA 5HAWA 2X9DA 3WHCA 5J1UA 4XK4A 1RKTA 3BTLA 3BR5A 5C4YA 3F0CA 4D7MA 5EYRA 5FMPA 4GCTA 4PXIA 3Q0UA 2PBXA 2G0EA 2GUHA 5GPAA 3SDGA 3AQTA 4ACIA 4D7NA 1QVUA 1QPIA 3ANGA 1BJZA 4JL3A 3BT9A 2R7XA 2ZY9A 4JKZA 5J3LA 2IAIA 3HTHA 3HGYA 3VTIA 1VI0A 2Y30A 2OF7A 2DTZA 5D19A 4GFLA 2TCTA 2XRLA 2A2FX 3DU5A 4YZEA 5HBUA 4NN1A 3KZ9A 4IRVA 3KKCA 1ZK8A 2UXUA 4MXMA 2G7LA 3BTIA 4I6ZA 3Q0WA 3LJLA 5F0FA 1JUMA 2WGBA 5K58A 2G3BA 1UI5A 5IP6A 3ON2A 5F0HA 3QQAA 3VW2A 3BR0A 3FK7A 4KWAA 3NI7A 2B1EA 2XDNA 2EH3A 3JSJA 2NX4A 3CDLA 5CQGA 2R7RA 4MO7A 4NELA 3EGQA 1SGMA 4GCLA 5CXGA 3NRGA 1JUPA 3G1MA 3S5RA 3VW1A 3BRUA 3VUQA 2ZOZA 3PM1A 5F27A 4D5FA 2OPTA 5F04A 3SFIA 3B6AA 4OD5A 2R7OA 3CRJA 2PFVA 5F08A 3C2BA 2QTQA 3B81A 3PPBA 3WHBA 2I10A 3G56A 3BQZA 3HTAA 3DU6A 3VVZA 3AQSA 3P9TA 2HKUA 2WV1A 4M3FA 3O60A 2W53A 3MVPA 2IEKA 2QIBA 2XB5A 2HQ5A 3LSJA 3ZQLA 1JT6A 3HTIA 1QVTA 3LSPA 2TRTA 5IPAA 1JUSA 2XPWA 3CJDA 2OI8A 5CXIA 3KNWA 2RAEA 5FGLA 2Y2ZA 2QWTA 3DPJA 3QKXA 3BR2A 2VKEA 4L62A 3LWJA 3TP0A 2R7VA 2F07A 3CCYA 5J1YA 4GCKA 2HXIA 3BHQA 3G1OA 3MNLA 4MK6A 3GZIA 4B3AA 2XGCA 3HE0A 3BQYA 3VPRA 2FJI1 4V2GA 1RKWA 2B3WA 3VIBA 3O8GA 1A6IA 3VVYA 3QBMA 4AC0A 5GP9A 4X1EA 5HSZA 4W97A 3IH2A 5J1RA 3IH4A 3LHQA 2FX0A 2X6OA 2GFNA 2JK3A 3FIWA 3V6GA 2PZ9A 3ZQHA 4M3EA 2RASA 5D1RA 1U9OA 5D18A 2RHAA 5EZHA 2HYTA 3G7RA 3B6CA 1T33A 2ID3A 3IUVA 4ICHA 4WIBA 3VVXA 2UXIA 2HYJA 5K7FA 4ABZA 3F1BA 4V2FA 5K7ZA 2ZOYA 5GPCA 5FHPA 2V57A 3KYLA 3BR1A 1JTYA 2Y31A 3QPSA 2REKA 3RH2A 1RPWA 2YVHA 3BCGA 3SWHA 5EZGA 3BTCA 2GBYA 4U9LA 3DCFA 3IH3A 2ZCMA 3HIMA 3QPLA 4AC6A 2ZCXA 3V78A 3EUPA 2R7WA 3O8HA 3GEUA 5K7HA 2UXOA 3NNRA 3ZQFA 4DW6A 3BR6A 5IOZA 5FKKA 3ZQIA 5F0CA 4U9NA 2DG8A 2WUIA 2ID6A 5CW8A 2R7TA 2GENA 3VW0A 3LSRA 4CGRA 2NS7A 3VP5A 4HKUA 2YVXA 4OD4A 4DVYP 1Z0XA 5FKNA 3PASA 3Q0VA 2O7OA 5F1JA 4W1UA 4M3DA 2FBQA 2IBDA 2XGDA 3BNIA 2NS8A 5FKLA 2ZB9A 2OERA 4G12A 3DEWA 2R7QA 1U9NA 3LOCA
chains in the Genus database with same CATH topology
3NXCA 2G7GA 3ZQGA 3E7QA 2VKVA 3FK6A 3NPIA 2QCOA 4AUXA 2FJ1A 3G1LA 5EFYA 2NP3A 2NP5A 3HTJA 5AQCA 3VOXA 3KKDA 2VPRA 2UXHA 2IU5A 3ON4A 4D5CA 3C07A 3Q3SA 4UDSA 2JJ7A 2QOPA 4M3BA 2DG7A 4JYKA 1UI6A 1JT0A 1T56A 3FRQA 2ZCNA 3RD3A 3BR3A 4ME9A 2XGEA 1JTXA 1ORKA 2Q24A 4GFKA 4AF5A 4B1RA 4JNNA 3BJBA 3TP3A 2D6YA 5IOYA 4M3GA 2HXOA 5FKMA 5FKOA 2YVEA 2FD5A 3T6NA 2O7TA 2FQ4A 3HGGA 3ANPA 3VOKA 2XPUA 3BTJA 3COLA 1Z77A 2G7SA 1ZKGA 2UXPA 2XPVA 5H9TA 5DAJA 4I76A 3CWRA 2QKOA 5HAWA 2X9DA 3WHCA 5J1UA 4XK4A 1RKTA 3BTLA 3BR5A 5C4YA 3F0CA 4D7MA 5EYRA 5FMPA 4GCTA 4PXIA 3Q0UA 2PBXA 2G0EA 2GUHA 5GPAA 3SDGA 3AQTA 4ACIA 4D7NA 1QVUA 1QPIA 3ANGA 1BJZA 4JL3A 3BT9A 4JKZA 5J3LA 2IAIA 3HTHA 3HGYA 1VI0A 2Y30A 2OF7A 2DTZA 5D19A 4GFLA 2TCTA 2XRLA 4YZEA 5HBUA 4NN1A 3KZ9A 3KKCA 1ZK8A 2UXUA 4MXMA 2G7LA 3BTIA 4I6ZA 3Q0WA 3LJLA 5F0FA 1JUMA 2WGBA 5K58A 2G3BA 1UI5A 5IP6A 3ON2A 5F0HA 3QQAA 3VW2A 3BR0A 3FK7A 4KWAA 3NI7A 2XDNA 2EH3A 3JSJA 2NX4A 3CDLA 4MO7A 4NELA 3EGQA 1SGMA 4GCLA 5CXGA 3NRGA 1JUPA 3G1MA 3S5RA 3VW1A 3BRUA 3VUQA 2ZOZA 3PM1A 5F27A 4D5FA 2OPTA 5F04A 3SFIA 3B6AA 3CRJA 5F08A 3C2BA 2QTQA 3B81A 3PPBA 3WHBA 2I10A 3G56A 3BQZA 3HTAA 3VVZA 3AQSA 3P9TA 2HKUA 2WV1A 4M3FA 3O60A 2W53A 3MVPA 2IEKA 2QIBA 2XB5A 2HQ5A 3LSJA 3ZQLA 1JT6A 3HTIA 1QVTA 3LSPA 2TRTA 5IPAA 1JUSA 2XPWA 3CJDA 2OI8A 5CXIA 3KNWA 2RAEA 5FGLA 2Y2ZA 2QWTA 3DPJA 3QKXA 3BR2A 2VKEA 4L62A 3LWJA 3TP0A 2F07A 3CCYA 5J1YA 4GCKA 2HXIA 3BHQA 3G1OA 3MNLA 4MK6A 3GZIA 4B3AA 2XGCA 3HE0A 3BQYA 3VPRA 4V2GA 1RKWA 3VIBA 3O8GA 1A6IA 3VVYA 3QBMA 4AC0A 5GP9A 4X1EA 5HSZA 4W97A 3IH2A 5J1RA 3IH4A 3LHQA 2FX0A 2X6OA 2GFNA 2JK3A 3FIWA 3V6GA 2PZ9A 3ZQHA 4M3EA 2RASA 5D1RA 1U9OA 5D18A 2RHAA 5EZHA 2HYTA 3G7RA 3B6CA 1T33A 2ID3A 3IUVA 4ICHA 3VVXA 2UXIA 2HYJA 5K7FA 4ABZA 3F1BA 4V2FA 5K7ZA 2ZOYA 5GPCA 5FHPA 2V57A 3BR1A 1JTYA 2Y31A 3QPSA 2REKA 3RH2A 1RPWA 2YVHA 3BCGA 5EZGA 3BTCA 2GBYA 3DCFA 3IH3A 2ZCMA 3HIMA 3QPLA 4AC6A 2ZCXA 3V78A 3EUPA 3O8HA 3GEUA 5K7HA 2UXOA 3NNRA 3ZQFA 4DW6A 3BR6A 5IOZA 5FKKA 3ZQIA 5F0CA 2DG8A 2WUIA 2ID6A 5CW8A 2GENA 3VW0A 3LSRA 4CGRA 2NS7A 3VP5A 4HKUA 1Z0XA 5FKNA 3PASA 3Q0VA 2O7OA 5F1JA 4W1UA 4M3DA 2FBQA 2IBDA 2XGDA 3BNIA 2NS8A 5FKLA 2ZB9A 2OERA 4G12A 3DEWA 1U9NA 3LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXC A;  2G7G A;  3ZQG A;  3E7Q A;  2VKV A;  3FK6 A;  3NPI A;  2QCO A;  4AUX A;  2FJ1 A;  3G1L A;  5EFY A;  2NP3 A;  2NP5 A;  3HTJ A;  5AQC A;  3VOX A;  3KKD A;  2VPR A;  2UXH A;  2IU5 A;  3ON4 A;  4D5C A;  3C07 A;  3Q3S A;  4UDS A;  2JJ7 A;  2QOP A;  4M3B A;  2DG7 A;  4JYK A;  1UI6 A;  1JT0 A;  1T56 A;  3FRQ A;  2ZCN A;  3RD3 A;  3BR3 A;  4ME9 A;  2XGE A;  1JTX A;  1ORK A;  2Q24 A;  4GFK A;  4AF5 A;  4B1R A;  4JNN A;  3BJB A;  3TP3 A;  2D6Y A;  5IOY A;  4M3G A;  2HXO A;  5FKM A;  5FKO A;  2YVE A;  2FD5 A;  3T6N A;  2O7T A;  2FQ4 A;  3HGG A;  3ANP A;  3VOK A;  2XPU A;  3BTJ A;  3COL A;  1Z77 A;  2G7S A;  1ZKG A;  2UXP A;  2XPV A;  5H9T A;  5DAJ A;  4I76 A;  3CWR A;  2QKO A;  5HAW A;  2X9D A;  3WHC A;  5J1U A;  4XK4 A;  1RKT A;  3BTL A;  3BR5 A;  5C4Y A;  3F0C A;  4D7M A;  5EYR A;  5FMP A;  4GCT A;  4PXI A;  3Q0U A;  2PBX A;  2G0E A;  2GUH A;  5GPA A;  3SDG A;  3AQT A;  4ACI A;  4D7N A;  1QVU A;  1QPI A;  3ANG A;  1BJZ A;  4JL3 A;  3BT9 A;  4JKZ A;  5J3L A;  2IAI A;  3HTH A;  3HGY A;  1VI0 A;  2Y30 A;  2OF7 A;  2DTZ A;  5D19 A;  4GFL A;  2TCT A;  2XRL A;  4YZE A;  5HBU A;  4NN1 A;  3KZ9 A;  3KKC A;  1ZK8 A;  2UXU A;  4MXM A;  2G7L A;  3BTI A;  4I6Z A;  3Q0W A;  3LJL A;  5F0F A;  1JUM A;  2WGB A;  5K58 A;  2G3B A;  1UI5 A;  5IP6 A;  3ON2 A;  5F0H A;  3QQA A;  3VW2 A;  3BR0 A;  3FK7 A;  4KWA A;  3NI7 A;  2XDN A;  2EH3 A;  3JSJ A;  2NX4 A;  3CDL A;  4MO7 A;  4NEL A;  3EGQ A;  1SGM A;  4GCL A;  5CXG A;  3NRG A;  1JUP A;  3G1M A;  3S5R A;  3VW1 A;  3BRU A;  3VUQ A;  2ZOZ A;  3PM1 A;  5F27 A;  4D5F A;  2OPT A;  5F04 A;  3SFI A;  3B6A A;  3CRJ A;  5F08 A;  3C2B A;  2QTQ A;  3B81 A;  3PPB A;  3WHB A;  2I10 A;  3G56 A;  3BQZ A;  3HTA A;  3VVZ A;  3AQS A;  3P9T A;  2HKU A;  2WV1 A;  4M3F A;  3O60 A;  2W53 A;  3MVP A;  2IEK A;  2QIB A;  2XB5 A;  2HQ5 A;  3LSJ A;  3ZQL A;  1JT6 A;  3HTI A;  1QVT A;  3LSP A;  2TRT A;  5IPA A;  1JUS A;  2XPW A;  3CJD A;  2OI8 A;  5CXI A;  3KNW A;  2RAE A;  5FGL A;  2Y2Z A;  2QWT A;  3DPJ A;  3QKX A;  3BR2 A;  2VKE A;  4L62 A;  3LWJ A;  3TP0 A;  2F07 A;  3CCY A;  5J1Y A;  4GCK A;  2HXI A;  3BHQ A;  3G1O A;  3MNL A;  4MK6 A;  3GZI A;  4B3A A;  2XGC A;  3HE0 A;  3BQY A;  3VPR A;  4V2G A;  1RKW A;  3VIB A;  3O8G A;  1A6I A;  3VVY A;  3QBM A;  4AC0 A;  5GP9 A;  4X1E A;  5HSZ A;  4W97 A;  3IH2 A;  5J1R A;  3IH4 A;  3LHQ A;  2FX0 A;  2X6O A;  2GFN A;  2JK3 A;  3FIW A;  3V6G A;  2PZ9 A;  3ZQH A;  4M3E A;  2RAS A;  5D1R A;  1U9O A;  5D18 A;  2RHA A;  5EZH A;  2HYT A;  3G7R A;  3B6C A;  1T33 A;  2ID3 A;  3IUV A;  4ICH A;  3VVX A;  2UXI A;  2HYJ A;  5K7F A;  4ABZ A;  3F1B A;  4V2F A;  5K7Z A;  2ZOY A;  5GPC A;  5FHP A;  2V57 A;  3BR1 A;  1JTY A;  2Y31 A;  3QPS A;  2REK A;  3RH2 A;  1RPW A;  2YVH A;  3BCG A;  5EZG A;  3BTC A;  2GBY A;  3DCF A;  3IH3 A;  2ZCM A;  3HIM A;  3QPL A;  4AC6 A;  2ZCX A;  3V78 A;  3EUP A;  3O8H A;  3GEU A;  5K7H A;  2UXO A;  3NNR A;  3ZQF A;  4DW6 A;  3BR6 A;  5IOZ A;  5FKK A;  3ZQI A;  5F0C A;  2DG8 A;  2WUI A;  2ID6 A;  5CW8 A;  2GEN A;  3VW0 A;  3LSR A;  4CGR A;  2NS7 A;  3VP5 A;  4HKU A;  1Z0X A;  5FKN A;  3PAS A;  3Q0V A;  2O7O A;  5F1J A;  4W1U A;  4M3D A;  2FBQ A;  2IBD A;  2XGD A;  3BNI A;  2NS8 A;  5FKL A;  2ZB9 A;  2OER A;  4G12 A;  3DEW A;  1U9N A;  3LOC A; 
#chains in the Genus database with same CATH topology
 3NXC A;  2G7G A;  3ZQG A;  3E7Q A;  2VKV A;  3FK6 A;  3NPI A;  2QCO A;  2R7U A;  4AUX A;  2FJ1 A;  3G1L A;  3NS4 A;  3K8P C;  5EFY A;  2NP3 A;  2NP5 A;  3HTJ A;  5AQC A;  3VOX A;  3KKD A;  2VPR A;  2UXH A;  3FHN A;  2IU5 A;  3ON4 A;  4C2M A;  4D5C A;  3C07 A;  3Q3S A;  4UDS A;  2JJ7 A;  2QOP A;  4M3B A;  2DG7 A;  4JYK A;  1UI6 A;  1JT0 A;  1T56 A;  3FRQ A;  2ZCN A;  3RD3 A;  3BR3 A;  4ME9 A;  2XGE A;  1JTX A;  1ORK A;  2Q24 A;  4GFK A;  4AF5 A;  4B1R A;  4JNN A;  3BJB A;  3TP3 A;  2D6Y A;  5IOY A;  4M3G A;  2HXO A;  5FKM A;  5FKO A;  2YVE A;  2FD5 A;  2R7S A;  3T6N A;  2O7T A;  2FQ4 A;  3HGG A;  3ANP A;  3VOK A;  2XPU A;  3BTJ A;  3COL A;  1Z77 A;  2G7S A;  1ZKG A;  2UXP A;  2XPV A;  5H9T A;  5DAJ A;  4I76 A;  3CWR A;  2QKO A;  5HAW A;  2X9D A;  3WHC A;  5J1U A;  4XK4 A;  1RKT A;  3BTL A;  3BR5 A;  5C4Y A;  3F0C A;  4D7M A;  5EYR A;  5FMP A;  4GCT A;  4PXI A;  3Q0U A;  2PBX A;  2G0E A;  2GUH A;  5GPA A;  3SDG A;  3AQT A;  4ACI A;  4D7N A;  1QVU A;  1QPI A;  3ANG A;  1BJZ A;  4JL3 A;  3BT9 A;  2R7X A;  2ZY9 A;  4JKZ A;  5J3L A;  2IAI A;  3HTH A;  3HGY A;  3VTI A;  1VI0 A;  2Y30 A;  2OF7 A;  2DTZ A;  5D19 A;  4GFL A;  2TCT A;  2XRL A;  2A2F X;  3DU5 A;  4YZE A;  5HBU A;  4NN1 A;  3KZ9 A;  4IRV A;  3KKC A;  1ZK8 A;  2UXU A;  4MXM A;  2G7L A;  3BTI A;  4I6Z A;  3Q0W A;  3LJL A;  5F0F A;  1JUM A;  2WGB A;  5K58 A;  2G3B A;  1UI5 A;  5IP6 A;  3ON2 A;  5F0H A;  3QQA A;  3VW2 A;  3BR0 A;  3FK7 A;  4KWA A;  3NI7 A;  2B1E A;  2XDN A;  2EH3 A;  3JSJ A;  2NX4 A;  3CDL A;  5CQG A;  2R7R A;  4MO7 A;  4NEL A;  3EGQ A;  1SGM A;  4GCL A;  5CXG A;  3NRG A;  1JUP A;  3G1M A;  3S5R A;  3VW1 A;  3BRU A;  3VUQ A;  2ZOZ A;  3PM1 A;  5F27 A;  4D5F A;  2OPT A;  5F04 A;  3SFI A;  3B6A A;  4OD5 A;  2R7O A;  3CRJ A;  2PFV A;  5F08 A;  3C2B A;  2QTQ A;  3B81 A;  3PPB A;  3WHB A;  2I10 A;  3G56 A;  3BQZ A;  3HTA A;  3DU6 A;  3VVZ A;  3AQS A;  3P9T A;  2HKU A;  2WV1 A;  4M3F A;  3O60 A;  2W53 A;  3MVP A;  2IEK A;  2QIB A;  2XB5 A;  2HQ5 A;  3LSJ A;  3ZQL A;  1JT6 A;  3HTI A;  1QVT A;  3LSP A;  2TRT A;  5IPA A;  1JUS A;  2XPW A;  3CJD A;  2OI8 A;  5CXI A;  3KNW A;  2RAE A;  5FGL A;  2Y2Z A;  2QWT A;  3DPJ A;  3QKX A;  3BR2 A;  2VKE A;  4L62 A;  3LWJ A;  3TP0 A;  2R7V A;  2F07 A;  3CCY A;  5J1Y A;  4GCK A;  2HXI A;  3BHQ A;  3G1O A;  3MNL A;  4MK6 A;  3GZI A;  4B3A A;  2XGC A;  3HE0 A;  3BQY A;  3VPR A;  2FJI 1;  4V2G A;  1RKW A;  2B3W A;  3VIB A;  3O8G A;  1A6I A;  3VVY A;  3QBM A;  4AC0 A;  5GP9 A;  4X1E A;  5HSZ A;  4W97 A;  3IH2 A;  5J1R A;  3IH4 A;  3LHQ A;  2FX0 A;  2X6O A;  2GFN A;  2JK3 A;  3FIW A;  3V6G A;  2PZ9 A;  3ZQH A;  4M3E A;  2RAS A;  5D1R A;  1U9O A;  5D18 A;  2RHA A;  5EZH A;  2HYT A;  3G7R A;  3B6C A;  1T33 A;  2ID3 A;  3IUV A;  4ICH A;  4WIB A;  3VVX A;  2UXI A;  2HYJ A;  5K7F A;  4ABZ A;  3F1B A;  4V2F A;  5K7Z A;  2ZOY A;  5GPC A;  5FHP A;  2V57 A;  3KYL A;  3BR1 A;  1JTY A;  2Y31 A;  3QPS A;  2REK A;  3RH2 A;  1RPW A;  2YVH A;  3BCG A;  3SWH A;  5EZG A;  3BTC A;  2GBY A;  4U9L A;  3DCF A;  3IH3 A;  2ZCM A;  3HIM A;  3QPL A;  4AC6 A;  2ZCX A;  3V78 A;  3EUP A;  2R7W A;  3O8H A;  3GEU A;  5K7H A;  2UXO A;  3NNR A;  3ZQF A;  4DW6 A;  3BR6 A;  5IOZ A;  5FKK A;  3ZQI A;  5F0C A;  4U9N A;  2DG8 A;  2WUI A;  2ID6 A;  5CW8 A;  2R7T A;  2GEN A;  3VW0 A;  3LSR A;  4CGR A;  2NS7 A;  3VP5 A;  4HKU A;  2YVX A;  4OD4 A;  4DVY P;  1Z0X A;  5FKN A;  3PAS A;  3Q0V A;  2O7O A;  5F1J A;  4W1U A;  4M3D A;  2FBQ A;  2IBD A;  2XGD A;  3BNI A;  2NS8 A;  5FKL A;  2ZB9 A;  2OER A;  4G12 A;  3DEW A;  2R7Q A;  1U9N A;  3LOC A; 
#chains in the Genus database with same CATH homology
 3NXC A;  2G7G A;  3ZQG A;  3E7Q A;  2VKV A;  3FK6 A;  3NPI A;  2QCO A;  4AUX A;  2FJ1 A;  3G1L A;  5EFY A;  2NP3 A;  2NP5 A;  3HTJ A;  5AQC A;  3VOX A;  3KKD A;  2VPR A;  2UXH A;  2IU5 A;  3ON4 A;  4D5C A;  3C07 A;  3Q3S A;  4UDS A;  2JJ7 A;  2QOP A;  4M3B A;  2DG7 A;  4JYK A;  1UI6 A;  1JT0 A;  1T56 A;  3FRQ A;  2ZCN A;  3RD3 A;  3BR3 A;  4ME9 A;  2XGE A;  1JTX A;  1ORK A;  2Q24 A;  4GFK A;  4AF5 A;  4B1R A;  4JNN A;  3BJB A;  3TP3 A;  2D6Y A;  5IOY A;  4M3G A;  2HXO A;  5FKM A;  5FKO A;  2YVE A;  2FD5 A;  3T6N A;  2O7T A;  2FQ4 A;  3HGG A;  3ANP A;  3VOK A;  2XPU A;  3BTJ A;  3COL A;  1Z77 A;  2G7S A;  1ZKG A;  2UXP A;  2XPV A;  5H9T A;  5DAJ A;  4I76 A;  3CWR A;  2QKO A;  5HAW A;  2X9D A;  3WHC A;  5J1U A;  4XK4 A;  1RKT A;  3BTL A;  3BR5 A;  5C4Y A;  3F0C A;  4D7M A;  5EYR A;  5FMP A;  4GCT A;  4PXI A;  3Q0U A;  2PBX A;  2G0E A;  2GUH A;  5GPA A;  3SDG A;  3AQT A;  4ACI A;  4D7N A;  1QVU A;  1QPI A;  3ANG A;  1BJZ A;  4JL3 A;  3BT9 A;  4JKZ A;  5J3L A;  2IAI A;  3HTH A;  3HGY A;  1VI0 A;  2Y30 A;  2OF7 A;  2DTZ A;  5D19 A;  4GFL A;  2TCT A;  2XRL A;  4YZE A;  5HBU A;  4NN1 A;  3KZ9 A;  3KKC A;  1ZK8 A;  2UXU A;  4MXM A;  2G7L A;  3BTI A;  4I6Z A;  3Q0W A;  3LJL A;  5F0F A;  1JUM A;  2WGB A;  5K58 A;  2G3B A;  1UI5 A;  5IP6 A;  3ON2 A;  5F0H A;  3QQA A;  3VW2 A;  3BR0 A;  3FK7 A;  4KWA A;  3NI7 A;  2XDN A;  2EH3 A;  3JSJ A;  2NX4 A;  3CDL A;  4MO7 A;  4NEL A;  3EGQ A;  1SGM A;  4GCL A;  5CXG A;  3NRG A;  1JUP A;  3G1M A;  3S5R A;  3VW1 A;  3BRU A;  3VUQ A;  2ZOZ A;  3PM1 A;  5F27 A;  4D5F A;  2OPT A;  5F04 A;  3SFI A;  3B6A A;  3CRJ A;  5F08 A;  3C2B A;  2QTQ A;  3B81 A;  3PPB A;  3WHB A;  2I10 A;  3G56 A;  3BQZ A;  3HTA A;  3VVZ A;  3AQS A;  3P9T A;  2HKU A;  2WV1 A;  4M3F A;  3O60 A;  2W53 A;  3MVP A;  2IEK A;  2QIB A;  2XB5 A;  2HQ5 A;  3LSJ A;  3ZQL A;  1JT6 A;  3HTI A;  1QVT A;  3LSP A;  2TRT A;  5IPA A;  1JUS A;  2XPW A;  3CJD A;  2OI8 A;  5CXI A;  3KNW A;  2RAE A;  5FGL A;  2Y2Z A;  2QWT A;  3DPJ A;  3QKX A;  3BR2 A;  2VKE A;  4L62 A;  3LWJ A;  3TP0 A;  2F07 A;  3CCY A;  5J1Y A;  4GCK A;  2HXI A;  3BHQ A;  3G1O A;  3MNL A;  4MK6 A;  3GZI A;  4B3A A;  2XGC A;  3HE0 A;  3BQY A;  3VPR A;  4V2G A;  1RKW A;  3VIB A;  3O8G A;  1A6I A;  3VVY A;  3QBM A;  4AC0 A;  5GP9 A;  4X1E A;  5HSZ A;  4W97 A;  3IH2 A;  5J1R A;  3IH4 A;  3LHQ A;  2FX0 A;  2X6O A;  2GFN A;  2JK3 A;  3FIW A;  3V6G A;  2PZ9 A;  3ZQH A;  4M3E A;  2RAS A;  5D1R A;  1U9O A;  5D18 A;  2RHA A;  5EZH A;  2HYT A;  3G7R A;  3B6C A;  1T33 A;  2ID3 A;  3IUV A;  4ICH A;  3VVX A;  2UXI A;  2HYJ A;  5K7F A;  4ABZ A;  3F1B A;  4V2F A;  5K7Z A;  2ZOY A;  5GPC A;  5FHP A;  2V57 A;  3BR1 A;  1JTY A;  2Y31 A;  3QPS A;  2REK A;  3RH2 A;  1RPW A;  2YVH A;  3BCG A;  5EZG A;  3BTC A;  2GBY A;  3DCF A;  3IH3 A;  2ZCM A;  3HIM A;  3QPL A;  4AC6 A;  2ZCX A;  3V78 A;  3EUP A;  3O8H A;  3GEU A;  5K7H A;  2UXO A;  3NNR A;  3ZQF A;  4DW6 A;  3BR6 A;  5IOZ A;  5FKK A;  3ZQI A;  5F0C A;  2DG8 A;  2WUI A;  2ID6 A;  5CW8 A;  2GEN A;  3VW0 A;  3LSR A;  4CGR A;  2NS7 A;  3VP5 A;  4HKU A;  1Z0X A;  5FKN A;  3PAS A;  3Q0V A;  2O7O A;  5F1J A;  4W1U A;  4M3D A;  2FBQ A;  2IBD A;  2XGD A;  3BNI A;  2NS8 A;  5FKL A;  2ZB9 A;  2OER A;  4G12 A;  3DEW A;  1U9N A;  3LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...