1QVUA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvuA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvuA02
1MH4A 1X2MA 2Y30A 1AHDP 3HIMA 5FKKA 5IP9J 3S1QJ 2GM4A 4A3JJ 2HXOA 4IEJA 2CUEA 4CYCB 1HDPA 1W0TA 2FQ4A 2Y9YA 5E3LA 5E3MA 1VFCA 2R7ZJ 3NNRA 4A3CJ 4RDUA 3ZQLA 5F0CA 1F43A 3BNIA 1W0UA 3CWRA 5JLXA 3VW2A 3IH3A 3QQAA 3ON4A 4X1EA 5IP7J 3ZQIA 4I76A 3FK6A 2CRGA 2CQXA 3GTKJ 3NPIA 3COLA 2Y31A 2L7FP 3ZOBA 1A5JA 4DZJA 1IDZA 2GBYA 4AYBN 2DA5A 3QPSA 4C3JJ 3HGYA 5E3NA 1ZKGA 3LWJA 1UHSA 3NXCA 2DMQA 5D1RA 2JA5J 1QVTA 2QCOA 4AC6A 4BY7J 3GTGJ 4D5FA 3GEUA 5CXGA 1G2HA 3S2DJ 1ENHA 1ZR4A 4GCLA 2O7OA 2M9HA 1ZTRA 2W53A 3WHCA 3EUPA 3ANGA 2HKUA 2NX4A 2WAQN 3VUQA 3IV5A 1U78A 3BHQA 3NRGA 1TWHJ 2HQ5A 5C4XJ 1TC3C 4NN1A 3S17J 1RR7A 1EF4A 4QIWN 3VVZA 4JL3A 2F07A 2AO9A 5EG0A 4UDSA 3SJMA 3BTJA 2NVQJ 2UXPA 2JN6A 2XSDC 1NK3P 5HBUA 2MSYA 4QTRA 3HOYJ 4XRSG 2DG7A 5GPAA 1SANA 2DN0A 1UI6A 2OI8A 3PASA 3DCFA 4MLOA 4DW6A 2ZCNA 3GBGA 2JJ7A 2H1KA 3HTIA 5J1UA 3ZQHA 1UI5A 4A3EJ 3FK7A 1POGA 2X48A 2YU9J 2DG8A 4DYRA 3S15J 2ZCMA 3Q0VA 2G7GA 4MFDA 5EDNA 5M3FJ 2QF7A 2YVEA 2EZLA 3HDDA 1XC5A 2AHQA 4A3DJ 3JRBA 1U9OA 5DAJA 1TWCJ 1ETOA 2M2EA 3CDLA 5EG0B 3A01B 1HCRA 5FGLA 2CU7A 5FHPA 2RAEA 3VOXA 4HNVA 2M34A 4CYCA 3TW7A 5IOYA 1IRZA 2YVHA 2E2IJ 2K9NA 3G1MA 2CJJA 2R5YA 2COBA 3A03A 5M5WJ 2PMZN 5FLVA 3LNQA 3KNWA 2Y2ZA 2DA1A 2GFNA 3UKGA 2XB0X 4B4CA 2NP3A 5IPAA 5J1RA 1FJLA 2DMNA 1ETWA 2FX0A 2ME6A 2OERA 3G1OA 3B6CA 3JRAA 3BTLA 5DS9A 1MBHA 3NAUA 3GTQJ 3S2HJ 1GT0C 5DTDA 1FTTA 3KKCA 3V78A 4LOCA 3VW1A 5J3LA 5EF6A 3JRIA 2CQQA 2EZIA 3Q0WA 2GLOA 3A01A 2VUMJ 4HKUA 2PZ9A 2I10A 3TEDA 3BCGA 5D19A 3EGQA 4RBOA 2V57A 1YRNA 1FIPA 1RKWA 1WH7A 2LR8A 4MXMA 3S1MJ 2XPVA 3PPBA 2H8RA 3GTJJ 3JR9A 2E2HJ 1WCMJ 5K7HA 4FISA 2VKEA 3JREA 2MGQA 1ZQ3P 1IC8A 4IHWA 9ANTA 2XDNA 3BR0A 5GP9A 2JA7J 2CUFA 4MFEA 3HOWJ 2ZOZA 4GCTA 3VPRA 5F1JA 3TP3A 3HEFA 4JX6A 1S7EA 2O9LA 2K9QA 2VPRA 3HKZN 4IHVA 3BRUA 2X9DA 3KKDA 1B72B 3SDGA 5EZGA 1H89C 3VP5A 1ZR2A 4YZEA 5EFYA 2G0EA 3T6NA 2L7MP 2LFBA 3ON2A 2DA4A 3S1NJ 4MO7A 1JT6A 4FTHA 1H8AC 4FE4A 3HGGA 1MSFC 3HBLA 4Y52J 2NVTJ 3BR2A 3F0CA 2Q24A 1LFUP 2LLKA 1JGGA 1ETXA 2NOGA 4AUXA 3JSJA 5F0HA 1JUPA 5M5YJ 4M3BA 3HOVJ 1SGMA 5F04A 3VVXA 1XG1A 4D7MA 1A6IA 5M5XJ 2LK2A 1HDDC 1XS9A 4M3GA 1OFCX 2VI6A 3LHQA 2NS7A 2GUHA 2LVSA 3VOKA 1GVDA 2ZB9A 4W1UA 4BBRJ 1BW6A 2DMPA 1LE8B 4C2MJ 3W6VA 1BW5A 2WUIA 2M8GX 2W48A 5CXIA 5H9TA 2ECCA 4BBSJ 4JX4A 4XICA 2EZHA 5FKNA 3WHBA 1IJWC 4JKZA 3C07A 5FKMA 2LTPA 1MBFA 5FMPA 5FKLA 4V2GA 4XRSA 1ETQA 2YUSA 2JWTA 4BY1J 3IH4A 1MBEA 1QVUA 3NARA 3JRFA 2TRTA 3BQZA 5EZHA 2B63J 5IYBJ 1PUFB 3BR6A 2M0CA 4UUTA 3GTLJ 1I50J 5FLMJ 3FKIJ 4C3HJ 3MNLA 4L5EA 4XRMA 2EBIA 4AF5A 1LE8A 2QWTA 1WI3A 5C4JJ 1JUSA 3HOZJ 1JJ6C 2HOSA 3VVYA 1NK2P 1U9NA 1JTXA 4GFLA 5C4YA 2E2JJ 4JX5A 5C44J 4A3GJ 3MN2A 3VW0A 2X6OA 2UXIA 1RKTA 4UUSB 1GV5A 4ME9A 1MSEC 1JJ8C 1B72A 3PM1A 2Y9ZA 3PO2J 1K83J 2DTZA 2LP0A 2D5VA 1JT0A 3V6GA 3FIWA 2JA8J 3BG9A 5BNGA 4CGRA 3ZQFA 3MKLA 1R9TJ 1X58A 5EGOB 4A3IJ 3RD3A 4M3DA 3LOCA 1GV2A 4A3FJ 1RPWA 2N8GA 1HOMA 4XK4A 2ECBA 3F1BA 3S5RA 1BA5A 2UXHA 4ICHA 1IGNA 3MVPA 1IDYA 3TW6A 3DEWA 4B1RA 3KZ9A 4KWAA 2G3BA 2XGDA 4M3FA 2MW8A 3BR5A 2JA6J 2R92J 2R0QC 3FRQA 3AQSA 4D5CA 3I4MJ 1FIAA 3CRJA 5HODA 3QBMA 1B8IA 3DPJA 3JRDA 3G56A 2IU5A 2JMWA 2P81A 1F36A 2LY9A 5E3OA 3HOXJ 4ABZA 1VI0A 4MK6A 1MBJA 2MG4A 2NVYJ 2ZCXA 1WGXA 2G7SA 4A69C 1TWGJ 4IHXA 4FCYA 4M3EA 1UG2A 3RKQA 2DA6A 3BG5A 4NDLA 4B3AA 1WH5A 2G7LA 2QTQA 2ZOYA 3GTOJ 4ACIA 2O8KA 2IAIA 2XRLA 2HOAA 1JUMA 1MBKA 2WB1N 5C3EJ 1P7JA 2KT0A 3C2BA 1IV6A 5IYDJ 3BR3A 3LSRA 1AU7A 3LSPA 3GTMJ 1PUFA 4D7NA 3G7RA 1APLC 5K7FA 4MIMA 2GENA 3O60A 1QPIA 1ETYA 1T33A 3BTIA 2DA2A 3QPLA 1GDTA 4GFBA 4A3KJ 5IOZA 5EYRA 4FE7A 5IP6A 2IBDA 3H3VK 2ID3A 3H0GJ 4DZPA 5K58A 4V2FA 2XPWA 1ZGWA 1ZK8A 3JRHA 3QKXA 2VKVA 3Q0UA 1MH3A 5IYCJ 3S14J 2HYTA 3B6AA 1JKRC 1D5YA 2EZKA 2L9RA 5F27A 3GTPJ 4J19A 2R5ZA 2R93J 2RASA 2FJ1A 4M6VA 1U8BA 2QIBA 4G12A 3B81A 3G1LA 1AKHA 3HM5A 2UXUA 2OF7A 3K2AA 1HF0A 4L62A 1YRNB 2LD5A 2IEKA 1TWAJ 2K9SA 5FJ8J 1UMQA 3HTHA 2HXIA 2Y0SN 2FBQA 2OPTA 4A93J 1Q1VA 1OCTC 1I3QJ 1Y1WJ 5HSZA 1TWFJ 3SFIA 2HOTA 5EGOA 2XGEA 4XIDA 3A02A 4DYQA 2REKA 2R5YB 2HI3A 2JK3A 4GCKA 2E19A 1T56A 3RQIA 4UUSA 3Q3SA 2R5ZB 2HDDA 2O7TA 3HE0A 3NI7A 1IUFA 4AC0A 1X2NA 3HOUJ 3OSFA 5HAWA 2ELKA 3LSGA 4EEFG 4A3MJ 1O4XA 2DMTA 3AQTA 2WV1A 2QOPA 4JP0A 3IH2A 3CQZJ 1QRYA 3JRCA 5CW8A 1RETA 2D6YA 2FD5A 4PXIA 1JTYA 1FEXA 1GUUA 5K7ZA 1DU0A 2QKOA 1OJLA 3OIOA 4W97A 4DYCA 4GFKA 2HYJA 3O8HA 3ZQGA 3O8GA 1P7IA 1WPKA 2DJNA 3BT9A 1Z0XA 3OOUA 1FTZA 1MNMC 3BG3A 3S16J 2NP5A 5AQCA 4C3IJ 2TCTA 3CMYA 3ZQCA 1BJZA 2RHAA 3S1RJ 2XPUA 3BJBA 4BKXA 1OCPA 1HLVA 1MBGA 4Y7NJ 1NTCA 1Y1VJ 2NS8A 2DA3A 3HB9A 3JRGA 1H88C 1DU6A 3CCYA 3CJDA 1Z77A 4QSHA 4JNNA 2ME0A 2EQRA 1ETKA 4I6ZA 2NVXJ 3D1NI 1VF9A 2ID6A 1E3OC 2UXOA 5M3MJ 5F0FA 1K61A 4JYKA 1IG7A 3HTAA 2L7ZA 1JKPC 3BTCA 3RZDJ 5JLWA 3ANPA 4NELA 2XGCA 3P9TA 1BL0A 3FISA 2YS9A 1RESA 2L0KA 2DMUA 1SFOJ 3OSGA 2E1OA 3IUVA 5F08A 3BR1A 3K7AJ 4X6AJ 1VNDA 5FKOA 2LKXA 2EH3A 3E7LA 3PO3J 1I6HJ 4A3BJ 2PBXA 4S0HB 4A3LJ 3I4NJ 5D18A 2XB5A 3TP0A 4BXXJ 3E7QA 5J1YA 3VIBA 1JKQC 3RZOJ 1AKHB 1JKOC 1ETVA 3HTJA 2DA7A 3LJLA 4IHYA 3BQYA 1ORKA 5EEAA 3L1PA 2KDZA 3M4OJ 2WGBA 5GPCA 3LSJA 1B8IB 1CQTA 1ITYA 1LFBA 3RH2A 3M3YJ 2K40A 3GZIA
chains in the Genus database with same CATH superfamily
1X2MA 1VQKI 2ZSHB 2MLKA 1VQ5I 3H3UA 1IXCA 4QPOA 2V1UA 4CYCB 3F23A 2FRHA 3GLXA 3QP5A 2Y69H 2FQ4A 2MD0A 5E3LA 3ZP5A 4P9FA 3J7AO 2K27A 3ZQLA 3CJNA 3CUQC 3HKZA 1F43A 2MC3A 3TQNA 1O3RA 3CWRA 2VJIA 5JLXA 1OLTA 2Q1ZB 3W3CA 3E0JB 2XF6A 1WKMA 3GTKJ 1LDKB 4V19K 2KZVA 5CVRA 1TQPA 2L7FP 2W4SA 2GBYA 3QPSA 2DU9A 5DDGA 3G2BA 3M9AA 4C3JJ 2JUGA 2WV0A 2OJED 2DMQA 2UUZA 3LSHA 5DCMB 4YIFA 2BW3B 2JA5J 5E8GA 3J7ZI 5D4SA 1VQOI 3QYFA 4B09A 2FJI1 3KLNA 3GEUA 1G2HA 2VT2A 2B9SA 2E5ZA 3GFMA 1K79A 3OYBA 3BPXA 4GXOA 1QZYA 2BBYA 4AIDA 1YITI 2L54A 1QO0D 1ULYA 3IV5A 1BC7C 1ZLJA 2GOXB 1TWHJ 2ZJPF 5C4XJ 1WQ2A 1RR7A 1HW2A 1EF4A 4QIWN 4M9XA 4JL3A 2DBBA 4Q48A 2ZO4A 1D1BA 4L9NA 2AQFA 4LB6B 2NVQJ 3DBHB 2O5RA 1LNWA 2BW3A 2W84A 4YIIA 1DPUA 3RKXA 3I5UA 4HDVA 2X6YA 1W7PA 1TP4A 4FT8A 4IXAA 5H6QA 4WF2A 1SVMA 6PAXA 2DG7A 2MFZA 2J5OA 3PASA 4MLOA 2LF7A 2XGXA 3GBGA 2BVMA 4YRVA 3E5QA 2WAEA 4A3EJ 4Y15A 3S15J 1ZHFA 4NBQA 3DPLC 4KITB 1ERDA 2W25A 3L00A 5J47A 5L3EA 5D5VB 2QF7A 2DT6A 1XC5A 5DAJA 1U9OA 2VQLA 5KCMA 4OIRF 1MDMA 4A0YA 3A01B 4XLNF 1HCRA 2KIFA 5FHPA 1TLHB 4BE0A 4ETSA 2OU2A 3KP7A 4HNVA 5LFAA 1O57A 2M34A 5LGNA 5IOYA 1IRZA 1D1CA 1E17A 5KVRA 4FX4A 2FBIA 2K86A 2K9NA 1TQIA 4U9LA 1RI7A 5E18F 4A12A 3VEPA 3LNQA 5F64A 1P4AA 3KNWA 2Y2ZA 4MEYF 4PGGA 2CO5A 3QPTA 3OL4A 5J1RA 2OCCH 2DMNA 1FJLA 4I0AA 2BGCA 4NC6A 3TO7A 1UAAA 1OCOH 1MBHA 3LA7A 3CO6C 3GTQJ 4RAYA 3DU6A 2GAUA 3JRIA 2CQQA 2EZIA 1S29A 3Q0WA 4EM0B 3A01A 1FP2A 1KU7A 1XMXA 2I10A 2EA2A 1A04A 2PG4A 3BCGA 3JW4A 1ON2A 3WG9A 3HRMA 2YX4A 2QGUA 1XMAA 3K1PA 2O3FA 1R4MB 5FRMA 2H8RA 1WJBA 3JR9A 1FYLA 2E2HJ 1WCMJ 4RB3C 1MMGA 2QSFX 2M5WA 1ZQ3P 5BQTA 3BR0A 2CV0A 2DFFA 4FX0A 4MFEA 1W36D 2QYOA 1VQ7I 2ZOZA 4GCTA 4BJ6C 1SVOA 3OR2C 1D3YA 2E34A 1I27A 2CW8A 2V9PA 1OCZH 3HEFA 3S8PA 3HKZN 4UVCA 1S5LC 4F3QA 1B72B 3LSKA 3LSMA 5DD8A 2R4GA 1FT9A 4RB2C 3I59A 3L9FA 2Q0OA 3CMEI 1FNNA 2JRTA 4GYGA 4I0BA 1WZ2A 1FX7A 3S1NJ 1W7PB 4G8XA 1KU2A 5HS7A 1PDNC 2HR3A 3WTYC 3PIOF 3W6KB 3HGGA 4RLFA 5ICEA 4WWCA 1J9IA 5EEHA 1W4MA 5J6XA 1YW7A 2MBFA 4EJWA 2VT3A 1JGGA 1BI1A 3K1NA 1IW7F 1STZA 2P6SA 4P55A 1R5GA 2KDOA 1JUPA 1NH3A 4A6DA 3PFIA 4BDYA 5KK1A 4D7MA 4MEXF 5M5XJ 1HDDC 1R4NB 2DOFA 3BCAA 1YI2I 1XS9A 3J80K 1HW5A 2Q2EB 2R7FA 1OFCX 3TBIA 3W2AA 2DK5A 4ZYDA 3AAFA 1U0JA 2NS7A 3KEYA 2OQRA 1MMDA 3WTXC 1ZN2A 2ESHA 2YVXA 5F1RA 4E7JA 5LGTA 3E6CC 4C2MJ 3K4KA 4XORA 2ECCA 4N0BA 4XKWA 2CS3A 3F8NA 4XICA 4JKZA 1IJWC 3HUGB 3C07A 2K3PA 3CMAI 2VN2A 3F6OA 5GAEJ 2W24A 4L9TA 4BL0B 1MBFA 4Y3OA 5FKLA 3V8JA 3J81Z 3ML6A 2PI0A 1MBEA 1WFXA 3GFJA 3KPHA 3NARA 4DNCA 3OMYA 2TRTA 3HRUA 4F93B 2VKDA 3HTSB 3CUQB 4RS8A 2M0CA 3GTLJ 3EETA 3FKIJ 4C3HJ 4L5EA 4AF5A 2NRAC 3AG1H 1WI3A 3C3WA 5C4JJ 3D5RC 4HF0A 1X1DA 3TL4X 1JE8A 2HOSA 3VVYA 4GFLA 3FXUA 1LKXA 5C4YA 3EDPA 5J4YA 2HKXA 1D5VA 4AVPA 3DV8A 5DYMA 2DO7A 2ESNA 4UUSB 2ZCWA 1D1AA 1EJ9A 4ME9A 1MSEC 3PM1A 1YTYA 1K83J 3RTRA 1Z67A 3VYSB 5CVUA 4OIPF 2D5VA 1K6YA 3V6GA 4IHTA 4E7KA 3FIWA 2R7TA 3A2KA 3BG9A 2HKOA 4M73A 2QENA 2QQBA 1F5TA 3K4MA 5JVGF 1Z1DA 1FP1D 4TV7A 4M3DA 1GV2A 4NC8A 1KZHA 4PJNA 2UZKA 3WGHA 1Z7UA 4XK4A 4JQFA 4S05A 3TW6A 4IQJA 4OD4A 3ZCOA 5CYVA 5HVQC 4MHGA 3I4MJ 1FIAA 1D0ZA 3H92A 1ONVA 3CRJA 4AD9A 3G56A 5AIQA 2H6CA 2LNBA 2P81A 2WAFA 2LY9A 1GLNA 4IRGA 4MK6A 4ABZA 1G3TA 1VI0A 2VB6A 5LEKA 1EA3A 3R6SA 2HZTA 2EJRA 2M4KA 5DM7F 2L9SA 4IHXA 3DWLE 4FCYA 1UG2A 1MNDA 3BG5A 2HDWA 4NDLA 4RMNA 5BS6A 4IO9F 2G7LA 4ACIA 1D8KA 2O8KA 2XRLA 4HOBA 4XLPF 3RKWA 1XMKA 1MBKA 2HOAA 2KT0A 2CQ7A 3DPUA 5CVJA 1CF7A 5AONA 1AU7A 3GFLA 3LSPA 4GO1A 1IN7A 1PUFA 1WJFA 2LKPA 2QQ8A 3VYTB 3IRQA 3R60A 4MIMA 1I1GA 3DKYA 2EV0A 1QPIA 1ETYA 2IA0A 2GXAA 3BTIA 2DA2A 2QUFA 2FNPA 5CKTA 3I9V2 1WJEA 1Z21A 4M6YA 4PJMA 4DZPA 2YPRA 3W2VA 2XPWA 1ZK8A 3JRHA 1BI3A 1MH3A 3KCCA 4LD5A 3B6AA 3KEQA 1D5YA 4PJLA 4XKVA 3VSLA 1ODDA 2R5ZA 3WTUC 1NG6A 2A6EF 2VPLA 2L7KA 1HKTA 3B81A 3G1LA 1AKHA 4QLCU 2O03A 2UXUA 2DDBA 3HC7A 3K2AA 4L62A 3OL3A 1YRNB 1TWAJ 4CHUA 1I1SA 1JGSA 1R5HA 1UMQA 2HXIA 1RNLA 2ZJ2A 2AXTC 3KZZA 4NUBA 5H20A 3PL8A 3CESA 3ASOH 1Y1WJ 2W1OA 1Z3XA 2XGEA 2XAGA 3DPTA 1YYVA 4ZDLA 3ZQ7A 4DYQA 2P8TA 2WY8Q 2JK3A 4GCKA 1XSXA 3LFKA 3RQIA 2R5ZB 2HDDA 2O7TA 3E5XA 2KISA 3I0TA 4PGHA 2ELKA 1G4DA 3MFKA 3QOPA 4A3MJ 3TOAA 2MD5A 4BGDA 3QP6A 5CVVA 1T6SA 1N77A 3I54A 2V79A 3EUHA 1QRYA 5CW8A 1RETA 3QU6A 3BZCA 4LB5A 1T38A 2FD5A 5LBQA 5B1BH 1DU0A 2QKOA 4DVYP 4W97A 4PJJA 4GFKA 4BJTA 3O8HA 1QQIA 4IQ4A 1WPKA 2EFNA 1SD5A 3G73A 2X4HA 2R7XA 2OZ6A 3BG3A 4EJTA 2TCTA 2QWWA 2NNYA 3FMQA 2Z99A 2RHAA 4PFOA 4G9YA 1FMVA 3BJBA 4F91B 3ABKH 2VJJA 3LSIA 2QKLB 2A5YB 1VQPI 2KJBA 2BVLA 4EJUA 1FZPB 2JPBA 1MBGA 2H1LA 1NTCA 1H88C 1LEAA 2R7UA 1HKSA 1ZG3A 2IA1A 2L4MA 3JTGA 1KQ0A 2MABA 2X6XA 1DU6A 1A36A 1IF1A 3QRFF 1R36A 1D0YA 1E2XA 4I6ZA 3I59B 3IRRA 4KN7X 1VF9A 2E1MC 1T2KA 2M0MA 4EMSA 1CGPA 3DKXA 4KIFA 5M3MJ 2UXOA 2DCEA 5F0FA 4CSWA 3RKYA 1NG7A 4XN3A 1RRJA 3WU2C 1IAWA 3OWTA 1B9MA 1J2XA 4FQGA 4B43A 3IL2A 3GCMA 2XGCA 4I99C 2IGMA 2LDUA 3OY9A 3AG4H 1UHWA 3ERMA 4DQ2A 2EFWA 5F08A 3BR1A 3K7AJ 2VQGA 3NRVA 5B3SH 3DBLB 2R7QA 3PUFA 5CPRB 3TDZC 1N78A 2R7OA 3MKZA 2XKOA 4BJ5C 1SFKA 2IXSA 1TZLA 1FBSA 4XN0A 1SMTA 3WG7H 4J00A 5FD5A 2QLZA 2XB5A 5DUIA 4LMYA 1VTNC 3QWLA 2PMZA 2P7VB 4BEHA 2DODA 4M9SA 3OIPA 3P7NA 4EJVA 4E7IA 1FOXA 1JKOC 1ETVA 3OYGA 4IHYA 3BQYA 4BHPA 3BDDA 2KDZA 2WGBA 3ABTA 2MA3A 3TGNA 3RYRA 5GPCA 2CW0F 4R1HA 2IS4A 2YU3A 2FUG2 3I55I 1HSTA 5H6RA 4ANJA 3IUOA 3GZIA 2P5LC 2FA5A 4BYYA 2ELJA 3I71A 3G6EI 1H0MA 2Y30A 1MDMB 4ITVA 4P9UA 1IUYA 1P92A 3KP2A 3SYTA 2A5WA 2GM4A 4AIKA 1IV8A 4A3JJ 4AYBA 4IOCF 2HXOA 3LAPA 1K7AA 2BEOA 3KZIC 4A3CJ 4XSZF 3CCSI 3BNIA 3PNYA 1SAXA 4OMYA 3VW2A 4MNUA 3RPQA 5IP7J 5ICCA 4PJ0C 4R8HA 2IGNA 4RAZA 2ZJQF 3ON4A 3ZQIA 4I76A 2QVOA 3NS4A 4B47A 2GWRA 3H9GA 4U88A 1P9QC 3COLA 3NPIA 4U9NA 2IGKA 1H9GA 3DTKA 3V8LA 1PP7U 1RC9A 4U0VA 2VOOA 1FSEA 3HGYA 1HQCA 2OTLI 3PJRA 3DXJF 2V6CA 3DFGA 4WIBA 2OV7A 2H09A 4XQFA 4GGGA 2F5FA 1QVTA 4AC6A 4JK1X 3SWHA 3KYDB 4D5FA 2DDAA 1B59A 4AIJA 2M9HA 1Y39A 2W53A 2ETHA 3EUPA 3BG7A 4HX7A 2HKUA 3FXLA 2WAQN 3VFZA 5HLGA 3OS2A 3BHQA 3RDIA 2MH2A 1TC3C 4NN1A 1XGNA 4HA8A 3T8TA 3T0YA 4RLQA 3WTSC 4UV9A 5A2QK 4UDSA 3SJMA 1YIOA 5JHFA 5IT3A 2DPUA 2XSDC 2HVQA 4C30A 5GADJ 3NWTA 2KIQA 2MSYA 1KQ8A 3NEUA 4XRSG 5K5RA 1YW8A 1SANA 4NHJA 2HNHA 3TDUC 3LMMA 4DW6A 2ZCNA 4HF2A 2H1KA 3HSRA 3IWFA 1FBUA 1POGA 1FPQA 3DTEA 4DYRA 1O3SA 2ZCMA 3Q0VA 2HQAA 4A5MA 1U2WA 2YVEA 3HIFA 1R22A 4KIGA 1TWCJ 1SEUA 4HV5A 3ULQB 1VQLI 4U87A 1Z3YA 4CA0A 2ZMEA 1R1VA 3FHZA 3N05A 2G7UA 4XOPA 3LL7A 1WJDA 2BOLA 4PCQA 2EPFA 4XLCA 5FFXA 4I98B 1Z6TA 2P5KA 2H8WA 3GW2A 2CJJA 3G1MA 3A03A 1XB4A 2PMZN 4OU0A 4PDKA 3ZMUA 4A6EA 2L2OA 2DA1A 3WTVC 1SMYF 3SEZA 2VLAA 3UKGA 1M1EB 1DGRM 1P4WA 5IPAA 2RDPA 5L3CA 2FX0A 2ME6A 2OERA 3M8EA 3G1OA 4M72A 4N4NB 1SAUA 3CCJI 3ZR8X 3JRAA 1J0RA 3IC7A 3GZ6A 3NAUA 4L9VA 2E7WA 1GT0C 3MMYB 3BJAA 2VUMJ 2GLOA 4HKUA 4HSRA 2EFPA 3M7GA 3PNTA 5D19A 3EGQA 4RBOA 1OR7A 1YRNA 3BLYA 4B3XA 1RKWA 4HX8A 2V1NA 2UXNA 3V42A 5KHDA 3S1MJ 2XPVA 3GTJJ 1FBQA 1XPXA 4BU2A 2RNJA 4XLHA 4HSTA 2IS6A 4A5NA 2GZWA 2XDNA 2KL4A 3T1BA 3CP2A 1HW1A 1YX3A 2K4JA 2PFVA 2JVGA 3FWEA 4HF1A 5DD4A 3BRUA 3KE2A 4XL9A 3SDGA 5EZGA 1H89C 3VP5A 1ZR2A 3WU1B 3F8MA 4EQQA 2G0EA 2LFBA 3HTUA 2E5NA 1JT6A 1H9TA 1E3PA 1S7AA 2V6EA 3HBLA 2DPDA 2NVTJ 1S7OA 2KMUA 1LJ9A 2MLGA 2ZXHA 4IJAA 2LLKA 1LFUP 2E71A 3ZN0A 4ZH4F 1ETXA 1P4XA 5KAIC 4AUXA 5F0HA 1WRJA 3HOVJ 2L5QA 2P5VA 2D1HA 2E7XA 5E1WA 1X4PA 3BY6A 1W7PD 2Q2EA 4BS9A 4CZZA 2XAQA 4OOIA 4CICA 3HJEA 3ONQA 2GUHA 3OYHA 2LVSA 4W1UA 2ZB9A 1BW6A 1OISA 3W6VA 2W00A 5LRSA 2PJRA 4BHCA 2LY2A 4P1WA 1YJNI 1N75A 5FGMA 1Z9CA 1R23A 2EZHA 5FKNA 3WHBA 3S93A 5LD2C 1MGTA 3MWMA 2FBHA 1J7KA 2YUSA 5L3FA 1B9NA 1QA6A 2VE8A 1S6LA 3JRFA 1G3YA 3BQZA 4HV6A 5EZHA 3FDYA 3KEOA 2B63J 1LFPA 5IYBJ 1PUFB 4CCJA 2RQPA 1SD7A 1I50J 3I56I 1PJRA 2FEZA 2MYSA 2VC0A 3CCLI 3MNLA 5D6EA 2QWTA 1U9NA 1YFHA 2XAHA 1KYWA 2FF4A 3MN2A 3ZN1A 2X6OA 2UXIA 1GV5A 4MQ9F 3KP5A 2ZXIA 1FOYA 3V7SA 2DTZA 2CGPA 3EYIA 4ZZLA 4KT5C 4AVZA 1ZG5A 2WTEA 2Z3YA 3HXLA 4N4OB 2GOMA 4XMYA 3R0AA 3GO5A 2XSJC 3F72A 5K5QA 5FRNA 4CGRA 2RGVA 4RAGA 3OYDA 5EGOB 4A3IJ 3MCZA 2JSPA 2R7SA 3LOCA 1RPWA 2N8GA 2M8EA 3B02A 4LLLA 5FFZA 3OYMA 3PSFA 3MVPA 4RAFA 2W7NA 4A2UA 4B1RA 3KZ9A 2KHMA 2XGDA 2R7WA 2JA6J 2R92J 1K78A 4KMUX 3FRQA 1REPC 2ZFUA 3DBRB 4NQWA 1SFXA 1AWCA 1R71A 2A6HF 3JRDA 4YG2F 3FXQA 3CC2I 3RPUA 5E3OA 3PSIA 5CJ9A 4E6KG 1MJBA 4LLNA 2NVYJ 2LY1A 4K2EA 1XX5A 5H2FC 2G7SA 1D8JA 4GRIA 3MKWB 3RKQA 1W1WE 3HHHA 4B3AA 1UCRA 4IL6C 4XSXF 3F8FA 1MMNA 4MQVA 1P7JA 2WADA 1IV6A 1T95A 1HXDA 4IX7A 3LSRA 1C0WA 4HX4A 3WGIA 3ZXSA 4E4HA 2YR2A 3ZMSA 2DFHA 1O7FA 3K4NA 3G7RA 4CCOA 3CO7C 1APLC 2FOKA 3UR3C 1U3EM 3O60A 1TW2A 4DIQA 3DQVC 1T33A 1GDTA 1ZARA 3PFYA 3Q9SA 4MGRA 4A3KJ 2OTJI 1XGOA 5EYRA 1L0OC 4CCKA 2DQLA 3D5SC 1DGWY 3H0GJ 2EB7A 5ICFA 2RNGA 2LMDA 5L3DA 2ISYA 3QKXA 3C2GA 2VKVA 4J01A 2HYTA 2EIMH 3S14J 4U7BA 2P4WA 2L9RA 3FXMA 4ZYHA 2B0LA 1LVKA 4M6VA 4Q47A 1XGSA 3HSEA 3ROUA 3W6JB 4FHTA 4LIUA 5J8FA 1HF0A 2EFQA 1I3AA 2AXLA 1A31A 1T98A 4ENNA 2HEOA 4RM3A 1J5YA 5FJ8J 1MW7A 3T8RA 2A07F 3V7RA 1ZYRF 1O7LA 4BDZA 1TT0A 3PNVA 1I5ZA 1S72I 1MNEA 1AA7A 2JA2A 5L3BA 4PFPA 1BBYA 5LRRA 5EGOA 3L7WA 3DLAA 4HLYA 3BJOA 3A02A 3GYHX 3GXOA 3R4KA 2H27A 2KPMA 3CMMA 5E1ZB 3KP4A 3H1CA 1X2NA 1ZREA 4G7HF 2EIKH 3K69A 2HTSA 3H3ZA 3AL0B 1YJWI 3FXOA 5HS9A 2WV1A 2ZNZA 2LREA 4CGZA 4JP0A 3CQZJ 4B8XA 4D0PA 5CQEA 3JRCA 3KP6A 3FXRA 1IO2A 1FEXA 1PUEE 4PSXA 1G6NA 4EV0A 3OIOA 3WTTC 4XM3A 2HYJA 4KN4X 5DCMA 3DEUA 3OOPA 1WWXA 3ZQGA 3O8GA 3BT9A 2DJNA 1Z0XA 1FTZA 5HLIA 1X4OA 2NP5A 2LKSA 5AQCA 4HAMA 2XAJA 4E7LA 2A2FX 2A68F 1BJZA 4BE2A 4S04A 1X1PA 2XPUA 3S1RJ 1E0EA 2VBZA 3AG3H 1SVLA 2FMLA 4BKXA 1WJAA 4B44A 2CQNA 3CTAA 3HPHA 2D2WA 2NS8A 1Z6RA 3K4JA 1USSA 3CJDA 3CCYA 2HYFA 3VODA 1OCCH 4QSHA 2E1NA 4JNNA 2ME0A 2EQRA 1ETKA 2OBPA 5ICGA 2VOPA 1WHUA 2BY0A 5LEJA 2ID6A 1BN5A 2NS0A 5JVTA 2QQAA 3ERED 2BY1A 3VOEA 4JYKA 3GUDA 1JKPC 1R1UA 3BTCA 4PZJA 1QBJA 5BPIA 1MMAA 3RZDJ 2IRFG 2IA2A 1IN8A 4NELA 3P9TA 4FETA 4IVNA 3SZPA 1G3SA 4LIVA 1R6RA 4LG0A 4ZDOA 3LA2A 3IUVA 2VE9A 1EH6A 1VNDA 5DEQA 2LKXA 1UELB 1K4TA 2EH3A 3PO3J 1QU3A 1U6GA 1QHHD 1I6HJ 1TT5B 1NHAA 2E60A 3F3XA 4A3BJ 2PBXA 5TISC 1YQAA 2CUZA 3TP0A 3LWFA 3RCOA 1DUXC 1F9NA 3O2PE 4C9YA 1WVRA 1XCBA 2DYSH 1YOVB 4ZYGA 5J1YA 2HFHA 1JKQC 3CJTB 4KDPA 1TBXA 2Z33A 1BOAA 2IP2A 3REOA 1Z7LA 3CDIA 3QPHA 1A35A 3M4OJ 3LSJA 1B8IB 4LG0B 5HNFA 3F8BA 3RH2A 5LGUA 1Y0NA 4EGYA 2YX7A 2Z2SB 2ZMEC 2D1VA 3TO6A 1KYZA 5IT9K 3SEQA 1DDNA 1MH4A 3HIMA 2X1EA 5D5WB 2EV5A 2KRCA 5E20A 5IP9J 3S1QJ 2M30A 1S3JA 2NAZA 4YFNF 1RZ4A 2CUEA 1OCRH 1HDPA 2PX9A 1W0TA 5E3MA 1IXSB 2CW7A 4BAYA 2R7ZJ 3PUBA 3NNRA 3RYPA 4RDUA 3K1MA 1LUJB 3ECHA 3L2CA 2ZJRF 2EFOA 4X1EA 2F5CA 1V5EA 2FSWA 3V7CA 2Y48A 2HZDA 3ZMTA 2CRGA 3ZGKA 2Y31A 2L9NA 2IVMA 2PMHA 3ZOBA 4DZJA 3CCEI 1A5JA 2DA5A 1ZAOA 5E3NA 4IRVA 1ZKGA 3LWJA 1QNTA 1UHSA 2V9VA 3NXCA 5HS8A 4HQMA 4U0YA 1VQMI 1J75A 3TKYA 2QCOA 5F6FA 3CJRB 3S2DJ 1ZTRA 4C2UA 5IT9Z 2L02A 2EA4A 3ANGA 2DXIA 1Z05A 3E5UA 3ZMZA 4RGXA 1U78A 2HQ5A 3WTWC 3MQ0A 3VVZA 4WXHA 3H35A 4F92B 4HRIA 1I39A 5EG0A 2RV8A 3IKTA 1VQNI 4HDUA 3BTJA 4BHBA 3N4MA 3ZRGA 4NQWB 3CUOA 3H0DA 1NK3P 1LEBA 5HBUA 2P6TA 1EV7A 3BOQA 1N25A 3WE3A 2G9WA 4LK1F 3SZTA 3OYIA 4NC7A 1I6XA 2YSRA 5E8IA 3DCFA 3AG2H 4UB6C 2LRDA 1IRXA 2KQRA 5J1UA 3FZVA 1UI5A 2XUBA 2CYYA 3ZMVA 1ZELA 2M7AA 3IP4B 2ZC2A 3H9JA 2Z9OA 4XLFA 1R1TA 1DP7P 2R7DA 3KX2A 2EZLA 2AHQA 3JRBA 1ETOA 5EG0B 3F8CA 4D9JA 4OD5A 2CU7A 2RAEA 4AWXB 3VOXA 2KZGA 4F7ZA 2I8DA 3KFWX 2VL8A 2YVHA 4KISA 2V1DA 4QPQA 2A6TA 4BH9A 2COBA 3RQ4A 3VB2A 5FLVA 4Q5SF 5D5XB 2WBMA 4F52A 2F48A 2GFNA 2M4GA 2XB0X 4B4CA 2NP3A 1T08B 2PMUA 3JSPA 2F6CA 1ETWA 5D4RA 5CVIA 3OYEA 4RB0A 3B6CA 2WA0A 2PN6A 3M1EA 3SQNA 4LITA 3F21A 3KKCA 5DTDA 1FTTA 3V78A 3VW1A 4LOCA 3BWGA 5J3LA 2IGOA 1ON1A 1CF7B 4GDFA 1ZGAA 2OCEA 3GZNB 2PZ9A 1LDDA 1LPQA 1G3WA 1ZG1A 3TEDA 5E79C 1R58A 3MZHA 3HHGA 1GHCA 3WODF 3OS0A 1WH7A 2LR8A 4MXMA 2HVRA 1X19A 3O3KA 3PPBA 1VQ4I 2XVCA 5JFRA 1OYIA 1X3ZB 2OD5A 5K7HA 4FISA 2MGQA 3ASNH 4M71A 2RC4A 4BXUA 4IHWA 9ANTA 1OYWA 2CUFA 3IHUA 2LYCA 3S3MA 3VPRA 4Z6YA 5F1JA 3CJQB 5TJJA 3TP3A 4UB8C 2O9LA 1S7EA 4IHVA 3OYAA 4ESFA 2O61A 3OYJA 2QM3A 2X9DA 2HQRA 5DUKA 4YEJA 1J09A 3U21A 4YZEA 2K9LA 4MTEA 3FMRA 3T6NA 2L7MP 3DKWA 2KRFA 3ON2A 2DA4A 2WAQA 3K4LA 4UUVA 1FOKA 3EPZA 3P9CA 2IJLA 1GVJA 3GF2A 2K85A 4UVAA 2ZXWH 3LA3A 1MSFC 4Y52J 2QBYB 3ABUA 2ELHA 2NOGA 3JSJA 2VIXA 5M5YJ 1U5TB 4M3BA 2DAOA 3FHNA 4P5OA 2XC7A 4NB5A 1SGMA 5F04A 2LSOA 3VVXA 2ZXJA 1R49A 1XG1A 1A6IA 1OMIA 4IRHA 2LK2A 4RB1A 4L5IA 1FMWA 2Q8KA 4M3GA 2F5DA 3LHQA 2VI6A 4KNYA 3DLLF 3JAMK 3LQQA 3MAJA 1IZ1A 2STWA 3DF8A 1ACIA 3VOKA 1T8IA 4BBRJ 2UV1A 3LSTA 2FMYA 2DMPA 2DFIA 3CCRI 3H36A 1BW5A 2PJRB 5CXIA 2M8GX 2W48A 4BQNA 2WWYA 2BY3A 1MMSA 4KUMA 3BC8A 3E97A 1ZRFA 3ABLH 2B1EA 3GZ5A 3C2HA 1KGSA 3CD6I 2LC2A 5FKMA 2LTPA 3PIPF 2HU9A 1MIJA 4XRSA 1ETQA 1BC8C 4YFXF 3IKVA 4BY1J 3KP3A 4AM3A 5KAFC 1UHMA 2X6WA 3UNGC 3BZ6A 3VSKA 1BI2A 3MEXA 2F2EA 5FLMJ 1YHQI 1MJ9A 3GWZA 4XRMA 2CQKA 2EBIA 1ZRCA 1BI0A 1K6OA 1JUSA 3H9QA 2KRHA 4G7ZF 1JJ6C 3HOZJ 1NK2P 1UJ8A 2XAFA 4EVIA 4AU7A 1KU3A 3RIRA 2E2JJ 1QPMA 3HRSA 3L2VA 3J80Z 4A3GJ 1RKTA 4ZYAA 3OR1C 2QKMB 3OYKA 1JHHA 1DQUA 2HWVA 1HA8A 4CZCA 2HTJA 4HLXA 4BQQA 1JT0A 5FO5A 3J7AY 4A0XA 5BNGA 2COMA 1FC3A 2VXDA 3H5AA 3MKLA 3MZ8A 4PK4A 3ZQFA 1X58A 3CP8A 1R9TJ 1JXSA 3OS1A 2QQ9A 2E36A 2LG4A 5GTHC 4L0ZB 3MD2A 3S2WA 3Q5FA 2ECBA 3S5RA 2R7RA 1BA5A 4ICHA 4LFUA 3E1SA 4IKFA 2CSOA 2NNNA 3DEWA 1S9HA 4KWAA 3OIQA 3ABMH 3BR5A 4M3FA 2R0QC 1RIOH 3AQSA 5E1XA 3QBMA 1UG0A 4ESJA 4ZZDA 2IU5A 3L2RA 2CMPA 2L9VA 1F36A 2E35A 1XDSA 3GFIA 1KU9A 3BZKA 2PFBA 2ZCXA 1WGXA 4XONA 5ED4A 3F6VA 4M3EA 4M9ZA 4KA4A 1BR1A 2K02A 2DI3A 2NVUB 1XSVA 3GTOJ 4PSWA 2IAIA 1JUMA 2WB1N 1XTAA 3C2BA 2QEXI 1KONA 2ACJA 4N9IA 3SXYA 4BQAA 3FM5A 3GTMJ 2GXBA 1DPRA 4D7NA 3K8PC 3GLLA 2JUCA 5K7FA 3CCUI 4L18B 2BYVE 4XNFA 3QPLA 4CXFA 5K1YA 4HW0A 3CC7I 4FE7A 2L4AA 3BP8A 2IBDA 2ID3A 1YE9A 2VQCA 4RGRA 4EGZA 1PP8F 5K58A 4V2FA 1ZGWA 2F5VA 1KA8A 1IRFA 4IRIA 5B5EC 1GXPA 2JQ7A 2R93J 5JI6A 3H5NA 2JZYA 4BEHB 2QIBA 4G12A 4UY8I 4UNOA 4IZZA 1BJAA 4L0YB 1HBXG 3DP7A 2M87A 2XAUA 4LLGF 2X85A 1BR4A 3HRTA 1J59A 2Y0SN 3WE2A 2OPTA 4HQEA 2ZBKA 2P7CB 1Q1VA 2BXYA 3DU5A 1OCTC 5HSZA 1TWFJ 2PEXA 3IWZA 4YIRX 1RUOA 1BR2A 1HKQA 2RKHA 1TNSA 2DLLA 4UUSA 1ZGJA 3QYEA 3Q3SA 3NI7A 3HE0A 4EATA 1IUFA 2VASA 3OSFA 5HAWA 3M8FA 2EILH 1IN4A 1VQ9I 3C1DA 3LSGA 4XKCA 4EEFG 4CO8A 1XGMA 2XHKA 1IXRC 3CC4I 2JT1A 2QOPA 3IH2A 2DW4A 5GAGJ 2QSHX 3CCQI 2FNAA 3EQLF 1IN5A 2D6YA 2ZMEB 1B1BA 4HZFA 1GUUA 5K7ZA 1OKRA 2JRMA 4DYCA 2Z16A 3P5JA 1Y0UA 5EEGA 1P7IA 5J40A 2CFOA 2WC2A 3OOUA 1SC7A 2XDVA 3CUQA 3Q9VA 4HPQA 1YG2A 3O6BB 4C3IJ 3CMYA 5LHGA 3ZQCA 5HDKA 4AIHA 2IS1A 3T5XA 3GX4X 4IHSA 1OCPA 5ERIA 1HLVA 4Y7NJ 3JRGA 1YW9A 2DA3A 1YS7A 3HB9A 3NWSA 2PQ8A 1XDUA 2A61A 1BIAA 2G7HA 3AFHA 2BZTA 3D1NI 2AQEA 4LJZF 4E7HA 1YIJI 1R5ID 3QAHA 2VKHA 4XKBA 3F9KA 3HTAA 2L7ZA 3I64A 2C6YA 3VDXA 2IT0A 3ANPA 1R7JA 2V7FA 2HQNA 1BL0A 2V26A 3D0SA 3FISA 1XSDA 2L0KA 4CUGA 2DMUA 1SFOJ 3VYRB 2E1OA 3OSGA 5DCFA 5HLTA 3OYNA 3A4CA 4Y33A 3HG9A 5FKOA 1XD7A 2ZSIB 2DOAA 2L3DA 3E7LA 4XLAA 3A0HC 2K4BA 5FROA 5EJCA 1XCVA 4WXDA 2L01A 1D0XA 4S0HB 3K2ZA 4A3LJ 5TRDA 4DBQA 3I4NJ 5D18A 1P6RA 2GA2A 3E6MA 1USTA 2KKOA 3QODA 4BACA 3VIBA 1AKHB 2WY7Q 3L2QA 3COAC 3QOEA 3AL0C 2DA7A 4DBRA 2Y75A 4KFCA 3CLOA 3LJLA 4KT6A 5EEAA 5CLSA 1BM9A 2BY2A 1ITYA 4BXFA 3EUHC 3K4BA 3M3YJ 4ZTJA 2DQRA 2LBFA 3PQKA 5LLQA 4EJOA 5GAHJ 1SD4A 1AHDP 2H6BA 5FKKA 2HYGD 1TL8A 3FXJA 2J5PA 4IEJA 2VXZA 2F5EA 3KYCB 3C18A 2Y9YA 1VFCA 2H94A 5F0CA 3RI4A 1W0UA 2DK8A 4L5JA 3IH3A 3P9KA 3QQAA 4ESBA 5ILUA 3FK6A 2CQXA 4L9JA 4O6JA 1IDZA 1SD6A 4AYBN 3OYCA 5BPDA 4OAZA 2STTA 2XKPA 5HDGA 4I02A 4XLEA 4KICA 1LQ1A 5D1RA 4I7HA 3CZ6A 4BY7J 3GTGJ 2RREA 1IRGA 4YFKF 5CXGA 1ENHA 1ZR4A 3GVAA 2O7OA 2IS2A 4GCLA 1VQ6I 4GYIA 3WHCA 3FBNB 5D8LB 3R61A 3RJPA 2NX4A 3VUQA 2XV4S 4XR6A 4ZYEA 1T0FC 4UV8A 3NRGA 3BG6A 4Y13A 1FYMA 3S17J 2DT7B 3ISPA 4FASD 2F07A 2AO9A 2K3FA 3L2WA 2X0LA 3QYBA 4I09A 2UXPA 4BQOA 2JN6A 4IOAF 3BCBA 5J8CA 2O0YA 3U1DA 1WI9A 3ZMDA 4C2MA 4QTRA 3HOYJ 1TQMA 2V4JC 5GPAA 1ZH5A 3JAMZ 2DN0A 1UI6A 2OI8A 2XRNA 2JJ7A 2V9KA 4EM1A 3HTIA 3ZQHA 2HPIA 3FK7A 2X48A 2YU9J 2CH0A 2CWEA 3CDHA 5D5UB 2DG8A 3KZYA 3V4GA 2JTVA 2G7GA 4MFDA 4XBFA 5EDNA 5M3FJ 3HDDA 4A3DJ 3E6DA 2LOOA 3CDLA 2M2EA 3MKYB 3BPVA 3KYLA 3TO9A 5FGLA 1U5TC 3I3LA 2OZUA 2JPCA 4CYCA 3TW7A 3JSOA 4KMFA 2E2IJ 4DJAA 1MZBA 2R5YA 2IW5A 1Y8RB 2A05A 5HLHA 5M5WJ 2W57A 2XF5A 2GXGA 1K78B 5FLXK 2VBYA 3FBIB 2UWMA 2K9MA 1VZ0A 1W36C 3CF2A 5FB2A 2OAZA 3BTLA 3CF5F 5DS9A 2FOWA 3S2HJ 2KIMA 5EF6A 2HVSA 2KFDA 1OQYA 2PJPA 3KLOA 3U2RA 3ZPLA 2GQQA 5BOXA 2ZNYA 3FKJA 4H0EA 2VONA 3F22A 2V57A 1X1CA 1EKEA 2UXXA 3ESWB 1FIPA 1X1BA 4WCGA 1O3QA 5B1AH 2BHZA 2Y0MA 5CQGA 3CLQA 1FSHA 4HNTA 1A6QA 2O8XA 3VYUB 2VQHA 2VKEA 3JREA 3E3VA 1IC8A 4A0ZA 4UVBA 3K10A 5GP9A 3U9GA 2JA7J 3HOWJ 3K4CA 3KIOA 3S3NA 1GXQA 2VBXA 2XROA 3MZYA 4JX6A 2X1CA 2E1MB 2K9QA 2RN7A 2VPRA 1F4KA 1B4AA 1PVEA 3LQRA 3KKDA 2HPMA 3BROA 1E3HA 3K70D 5EFYA 5LHIA 2I5UA 5HNHA 4MO7A 5E17F 1FWZA 4CCLA 4E70A 4FTHA 1H8AC 4RGSA 1KQ9A 1WJCA 4FE4A 4CYDA 2DTRA 1YS6A 5IY5H 3BR2A 3F0CA 3D5LA 5ILSA 2Q24A 4G6DA 2WB1A 2LF8A 4O5VA 4OAYA 3HYIA 2KLOA 4E7ZA 2W82A 4X0GA 2EV6A 4ON0A 3ELKA 1YO5C 3V8KA 4OIOF 4P96A 3WU0A 2M7BA 3M8JA 3FXKA 1LDJA 1GVDA 1P2FA 1Y8QB 1LE8B 2WUIA 4KYWA 5H9TA 1RR8C 4LK0F 1V5FA 2FQ3A 2FBKA 2BE5F 1JHFA 2A3SA 4LG3A 4Z2YA 4BBSJ 2NXNB 1FOWA 4JX4A 2GA1A 5JR3A 1MD0A 3HUGA 4M6XA 1Q1HA 5FMPA 4V2GA 3B73A 1BIBA 4I01A 2JWTA 3A1YA 1OR7C 4JOMA 3IH4A 1QVUA 3SZGA 4LGWA 4Y4RA 1U8RA 2B3WA 4ZTFA 1IN6A 3BR6A 4UUTA 4ASNA 3HOSA 5A2QZ 3FX3A 1B6AA 5BMZA 2HDCA 1T0FA 1ZRDA 2ZY9A 1LE8A 1EH8A 1Z91A 2HGCA 1V5GA 3W2WA 5D8KB 5K5OA 1OYYA 1JTXA 4JX5A 5C44J 3VW0A 4II2A 4ENKA 2RQQA 2DFEA 2DOEA 1JJ8C 1B72A 2Y9ZA 5DV5A 3PO2J 4GCVA 2LP0A 2M45A 4BNCA 2Y0SA 2K7LA 3LFUA 1W5TA 1ZLKA 2JA8J 3HOTA 2A69F 1X3WB 1K4SA 4NNJA 5TGTA 5B66C 1V54H 3RD3A 2KIUA 2QSGX 1QZZA 4E7SA 3NQOA 1Y56A 4KJZA 4A3FJ 1YX5A 1HOMA 1G59A 1JI8A 2PBIA 3TMOA 1F1ZA 3F1BA 4I2OA 2UXHA 1IGNA 5FLXZ 1IDYA 1BOBA 4HEA2 3FM3A 1AOYA 4R79A 4G6TB 2G3BA 3I58A 1QGPA 4DOZA 2MW8A 2CFXA 4BE1A 1YLFA 3DEEA 3OYLA 4RA2A 4D5CA 4DGWB 5DM6F 5HODA 1B8IA 3DPJA 1TW3A 4XRFA 2JMWA 3HOXJ 2HS5A 3L09A 1MBJA 2MG4A 2IPQX 1WSUA 3EUAA 4A69C 3BJ6A 1TWGJ 1S8NA 1V55H 2DA6A 4HNUA 1WH5A 2QTQA 3M1CA 2ZOYA 2NOJB 3RSNA 4CCNA 3DTIA 4WK8F 3K70C 2Z5UA 4EM2A 4ZJZA 2VC1A 3VTIA 5C3EJ 4ZC3A 4M74A 5IYDJ 3BR3A 1Y6IA 2CG4A 5FD6A 4UXNA 2VJ4A 1LB2A 2ZFWA 1YJ9I 2W85A 4CCMA 1HC8A 2F4MB 2RVCA 1X3UA 2DT5A 4ENJA 2Z1DA 4D1QA 2GENA 2DJIA 3H5RA 4GFBA 1TNTA 4F55A 5IOZA 5IP6A 3H3VK 4CDGA 2HOEA 2M3AA 2OUMA 3C7JA 4OINF 3Q0UA 3ECOA 5IYCJ 3LAJA 3I4PA 1JKRC 2B7EA 2EZKA 4O3MA 5F27A 5J4VA 3GTPJ 4J19A 4U0WA 2RASA 2FJ1A 4XOTA 1TTYA 5LHHA 2OA4A 4PUSA 3J81K 1U8BA 2OQGA 2ZKZA 4II3A 1X1AA 3HM5A 4OMZA 4UHTA 3SFZA 2OF7A 3SHFA 2X1DA 4ENMA 2LD5A 2IEKA 2K9SA 1L3LA 3L2UA 3HTHA 3EYYA 3TOBA 1WJ5A 3WTZA 2FBQA 4A93J 4G94A 5GTIC 2ISZA 3FF5A 1T39A 1I3QJ 3ZQQA 1W5CC 2XF7A 4RM2A 1V3FA 3SFIA 3CCMI 4CH7A 3CCVI 2HOTA 3K0LA 2XASA 4U7DA 4XIDA 2REKA 3WGGA 2R5YB 2HI3A 2FE3A 3SDBA 2E19A 1T56A 5AIPA 4OWRB 3KETA 1QHGA 5ILVA 3GMEA 4H4KC 3A0BC 4AC0A 3HOUJ 3AKZA 4KIBA 2D45A 3X2QH 3GEZA 1MKMA 1O4XA 2P0WA 2DMTA 2KJCA 3OYFA 3AQTA 2NYXA 4B48A 2CV2A 3R0JA 4MTDA 2CUJA 2V1XA 3OV8A 2F4IA 1JTYA 5HDNA 1SFEA 2LBFB 1O3TA 2EWNA 3HZJA 4PXIA 1FY7A 1OJLA 4N9HA 1EH7A 1HSJA 2TDXA 3FMSA 1XN7A 1MJAA 1RUNA 2VBWA 3I53A 2ICWG 3IAM2 4YELA 1MNMC 3S16J 1R00A 5HOOA 1V4RA 2O6GE 4BUPA 2R7VA 3VWBA 2EIJH 4JBAA 2QZ8A 1G8XA 3K6GA 3QU3A 3JTHA 2QA4I 3G71I 1Y1VJ 4WX9A 3HPGA 4Y17A 1W5SA 1Z77A 5D6FA 3JCUC 3S32A 3J7YJ 2BV6A 1UB9A 4IF4A 2NVXJ 2MH9A 3HSFA 2XIGA 4HG2A 1FLIA 3IAS2 2AS5F 1E3OC 2VODA 1LVAA 2MC4A 1UFMA 4HBLA 2F4OB 1K61A 1FYKA 1IG7A 4G6QA 4Q4ZF 4QWQA 2OC6A 3E6BA 3M07A 5JLWA 3PQJA 5JHUA 2JVHA 2BHYA 3HL2A 2YS9A 1RESA 2GIZA 4RGUA 4HYEA 3S3OA 4X6AJ 4OIQF 4C2TA 4G7OF 3G4SI 4IPAA 4ZDPA 2GIVA 2X51A 1DP3A 3RPUD 1QZEA 3K9TA 2VJ5A 1UZCA 5L3GA 1OPCA 5KNLA 3P9IA 3N97A 1SFUA 4BXXJ 3E7QA 2EINH 2BXZA 3RZOJ 2CV1A 2K5CA 3HTJA 2E1CA 2LH9A 1ORKA 3L1PA 1VQ8I 2KP6A 2QBYA 2EK5A 4WXCA 2JSCA 1CQTA 1LFBA 2R3SA 3U1KA 1PYVA 3G3ZA 2FU4A 2K40A 1U5TA 2FXAA 2M1BA 2DYRH 3EUKL 2PLYA 2ADUA
chains in the Genus database with same CATH topology
1MH4A 1X2MA 2Y30A 1AHDP 3HIMA 5FKKA 5IP9J 3S1QJ 2GM4A 4A3JJ 2HXOA 4IEJA 2CUEA 4CYCB 1HDPA 1W0TA 2FQ4A 2Y9YA 5E3LA 5E3MA 1VFCA 2R7ZJ 3NNRA 4A3CJ 4RDUA 3ZQLA 5F0CA 1F43A 3BNIA 1W0UA 3CWRA 5JLXA 3VW2A 3IH3A 3QQAA 3ON4A 4X1EA 5IP7J 3ZQIA 4I76A 3FK6A 2CRGA 2CQXA 3GTKJ 3NPIA 3COLA 2Y31A 2L7FP 3ZOBA 1A5JA 4DZJA 1IDZA 2GBYA 4AYBN 2DA5A 3QPSA 4C3JJ 3HGYA 5E3NA 1ZKGA 3LWJA 1UHSA 3NXCA 2DMQA 5D1RA 2JA5J 1QVTA 2QCOA 4AC6A 4BY7J 3GTGJ 4D5FA 3GEUA 5CXGA 1G2HA 3S2DJ 1ENHA 1ZR4A 4GCLA 2O7OA 2M9HA 1ZTRA 2W53A 3WHCA 3EUPA 3ANGA 2HKUA 2NX4A 2WAQN 3VUQA 3IV5A 1U78A 3BHQA 3NRGA 1TWHJ 2HQ5A 5C4XJ 1TC3C 4NN1A 3S17J 1RR7A 1EF4A 4QIWN 3VVZA 4JL3A 2F07A 2AO9A 5EG0A 4UDSA 3SJMA 3BTJA 2NVQJ 2UXPA 2JN6A 2XSDC 1NK3P 5HBUA 2MSYA 4QTRA 3HOYJ 4XRSG 2DG7A 5GPAA 1SANA 2DN0A 1UI6A 2OI8A 3PASA 3DCFA 4MLOA 4DW6A 2ZCNA 3GBGA 2JJ7A 2H1KA 3HTIA 5J1UA 3ZQHA 1UI5A 4A3EJ 3FK7A 1POGA 2X48A 2YU9J 2DG8A 4DYRA 3S15J 2ZCMA 3Q0VA 2G7GA 4MFDA 5EDNA 5M3FJ 2QF7A 2YVEA 2EZLA 3HDDA 1XC5A 2AHQA 4A3DJ 3JRBA 1U9OA 5DAJA 1TWCJ 1ETOA 2M2EA 3CDLA 5EG0B 3A01B 1HCRA 5FGLA 2CU7A 5FHPA 2RAEA 3VOXA 4HNVA 2M34A 4CYCA 3TW7A 5IOYA 1IRZA 2YVHA 2E2IJ 2K9NA 3G1MA 2CJJA 2R5YA 2COBA 3A03A 5M5WJ 2PMZN 5FLVA 3LNQA 3KNWA 2Y2ZA 2DA1A 2GFNA 3UKGA 2XB0X 4B4CA 2NP3A 5IPAA 5J1RA 1FJLA 2DMNA 1ETWA 2FX0A 2ME6A 2OERA 3G1OA 3B6CA 3JRAA 3BTLA 5DS9A 1MBHA 3NAUA 3GTQJ 3S2HJ 1GT0C 5DTDA 1FTTA 3KKCA 3V78A 4LOCA 3VW1A 5J3LA 5EF6A 3JRIA 2CQQA 2EZIA 3Q0WA 2GLOA 3A01A 2VUMJ 4HKUA 2PZ9A 2I10A 3TEDA 3BCGA 5D19A 3EGQA 4RBOA 2V57A 1YRNA 1FIPA 1RKWA 1WH7A 2LR8A 4MXMA 3S1MJ 2XPVA 3PPBA 2H8RA 3GTJJ 3JR9A 2E2HJ 1WCMJ 5K7HA 4FISA 2VKEA 3JREA 2MGQA 1ZQ3P 1IC8A 4IHWA 9ANTA 2XDNA 3BR0A 5GP9A 2JA7J 2CUFA 4MFEA 3HOWJ 2ZOZA 4GCTA 3VPRA 5F1JA 3TP3A 3HEFA 4JX6A 1S7EA 2O9LA 2K9QA 2VPRA 3HKZN 4IHVA 3BRUA 2X9DA 3KKDA 1B72B 3SDGA 5EZGA 1H89C 3VP5A 1ZR2A 4YZEA 5EFYA 2G0EA 3T6NA 2L7MP 2LFBA 3ON2A 2DA4A 3S1NJ 4MO7A 1JT6A 4FTHA 1H8AC 4FE4A 3HGGA 1MSFC 3HBLA 4Y52J 2NVTJ 3BR2A 3F0CA 2Q24A 1LFUP 2LLKA 1JGGA 1ETXA 2NOGA 4AUXA 3JSJA 5F0HA 1JUPA 5M5YJ 4M3BA 3HOVJ 1SGMA 5F04A 3VVXA 1XG1A 4D7MA 1A6IA 5M5XJ 2LK2A 1HDDC 1XS9A 4M3GA 1OFCX 2VI6A 3LHQA 2NS7A 2GUHA 2LVSA 3VOKA 1GVDA 2ZB9A 4W1UA 4BBRJ 1BW6A 2DMPA 1LE8B 4C2MJ 3W6VA 1BW5A 2WUIA 2M8GX 2W48A 5CXIA 5H9TA 2ECCA 4BBSJ 4JX4A 4XICA 2EZHA 5FKNA 3WHBA 1IJWC 4JKZA 3C07A 5FKMA 2LTPA 1MBFA 5FMPA 5FKLA 4V2GA 4XRSA 1ETQA 2YUSA 2JWTA 4BY1J 3IH4A 1MBEA 1QVUA 3NARA 3JRFA 2TRTA 3BQZA 5EZHA 2B63J 5IYBJ 1PUFB 3BR6A 2M0CA 4UUTA 3GTLJ 1I50J 5FLMJ 3FKIJ 4C3HJ 3MNLA 4L5EA 4XRMA 2EBIA 4AF5A 1LE8A 2QWTA 1WI3A 5C4JJ 1JUSA 3HOZJ 1JJ6C 2HOSA 3VVYA 1NK2P 1U9NA 1JTXA 4GFLA 5C4YA 2E2JJ 4JX5A 5C44J 4A3GJ 3MN2A 3VW0A 2X6OA 2UXIA 1RKTA 4UUSB 1GV5A 4ME9A 1MSEC 1JJ8C 1B72A 3PM1A 2Y9ZA 3PO2J 1K83J 2DTZA 2LP0A 2D5VA 1JT0A 3V6GA 3FIWA 2JA8J 3BG9A 5BNGA 4CGRA 3ZQFA 3MKLA 1R9TJ 1X58A 5EGOB 4A3IJ 3RD3A 4M3DA 3LOCA 1GV2A 4A3FJ 1RPWA 2N8GA 1HOMA 4XK4A 2ECBA 3F1BA 3S5RA 1BA5A 2UXHA 4ICHA 1IGNA 3MVPA 1IDYA 3TW6A 3DEWA 4B1RA 3KZ9A 4KWAA 2G3BA 2XGDA 4M3FA 2MW8A 3BR5A 2JA6J 2R92J 2R0QC 3FRQA 3AQSA 4D5CA 3I4MJ 1FIAA 3CRJA 5HODA 3QBMA 1B8IA 3DPJA 3JRDA 3G56A 2IU5A 2JMWA 2P81A 1F36A 2LY9A 5E3OA 3HOXJ 4ABZA 1VI0A 4MK6A 1MBJA 2MG4A 2NVYJ 2ZCXA 1WGXA 2G7SA 4A69C 1TWGJ 4IHXA 4FCYA 4M3EA 1UG2A 3RKQA 2DA6A 3BG5A 4NDLA 4B3AA 1WH5A 2G7LA 2QTQA 2ZOYA 3GTOJ 4ACIA 2O8KA 2IAIA 2XRLA 2HOAA 1JUMA 1MBKA 2WB1N 5C3EJ 1P7JA 2KT0A 3C2BA 1IV6A 5IYDJ 3BR3A 3LSRA 1AU7A 3LSPA 3GTMJ 1PUFA 4D7NA 3G7RA 1APLC 5K7FA 4MIMA 2GENA 3O60A 1QPIA 1ETYA 1T33A 3BTIA 2DA2A 3QPLA 1GDTA 4GFBA 4A3KJ 5IOZA 5EYRA 4FE7A 5IP6A 2IBDA 3H3VK 2ID3A 3H0GJ 4DZPA 5K58A 4V2FA 2XPWA 1ZGWA 1ZK8A 3JRHA 3QKXA 2VKVA 3Q0UA 1MH3A 5IYCJ 3S14J 2HYTA 3B6AA 1JKRC 1D5YA 2EZKA 2L9RA 5F27A 3GTPJ 4J19A 2R5ZA 2R93J 2RASA 2FJ1A 4M6VA 1U8BA 2QIBA 4G12A 3B81A 3G1LA 1AKHA 3HM5A 2UXUA 2OF7A 3K2AA 1HF0A 4L62A 1YRNB 2LD5A 2IEKA 1TWAJ 2K9SA 5FJ8J 1UMQA 3HTHA 2HXIA 2Y0SN 2FBQA 2OPTA 4A93J 1Q1VA 1OCTC 1I3QJ 1Y1WJ 5HSZA 1TWFJ 3SFIA 2HOTA 5EGOA 2XGEA 4XIDA 3A02A 4DYQA 2REKA 2R5YB 2HI3A 2JK3A 4GCKA 2E19A 1T56A 3RQIA 4UUSA 3Q3SA 2R5ZB 2HDDA 2O7TA 3HE0A 3NI7A 1IUFA 4AC0A 1X2NA 3HOUJ 3OSFA 5HAWA 2ELKA 3LSGA 4EEFG 4A3MJ 1O4XA 2DMTA 3AQTA 2WV1A 2QOPA 4JP0A 3IH2A 3CQZJ 1QRYA 3JRCA 5CW8A 1RETA 2D6YA 2FD5A 4PXIA 1JTYA 1FEXA 1GUUA 5K7ZA 1DU0A 2QKOA 1OJLA 3OIOA 4W97A 4DYCA 4GFKA 2HYJA 3O8HA 3ZQGA 3O8GA 1P7IA 1WPKA 2DJNA 3BT9A 1Z0XA 3OOUA 1FTZA 1MNMC 3BG3A 3S16J 2NP5A 5AQCA 4C3IJ 2TCTA 3CMYA 3ZQCA 1BJZA 2RHAA 3S1RJ 2XPUA 3BJBA 4BKXA 1OCPA 1HLVA 1MBGA 4Y7NJ 1NTCA 1Y1VJ 2NS8A 2DA3A 3HB9A 3JRGA 1H88C 1DU6A 3CCYA 3CJDA 1Z77A 4QSHA 4JNNA 2ME0A 2EQRA 1ETKA 4I6ZA 2NVXJ 3D1NI 1VF9A 2ID6A 1E3OC 2UXOA 5M3MJ 5F0FA 1K61A 4JYKA 1IG7A 3HTAA 2L7ZA 1JKPC 3BTCA 3RZDJ 5JLWA 3ANPA 4NELA 2XGCA 3P9TA 1BL0A 3FISA 2YS9A 1RESA 2L0KA 2DMUA 1SFOJ 3OSGA 2E1OA 3IUVA 5F08A 3BR1A 3K7AJ 4X6AJ 1VNDA 5FKOA 2LKXA 2EH3A 3E7LA 3PO3J 1I6HJ 4A3BJ 2PBXA 4S0HB 4A3LJ 3I4NJ 5D18A 2XB5A 3TP0A 4BXXJ 3E7QA 5J1YA 3VIBA 1JKQC 3RZOJ 1AKHB 1JKOC 1ETVA 3HTJA 2DA7A 3LJLA 4IHYA 3BQYA 1ORKA 5EEAA 3L1PA 2KDZA 3M4OJ 2WGBA 5GPCA 3LSJA 1B8IB 1CQTA 1ITYA 1LFBA 3RH2A 3M3YJ 2K40A 3GZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH4 A;  1X2M A;  2Y30 A;  1AHD P;  3HIM A;  5FKK A;  5IP9 J;  3S1Q J;  2GM4 A;  4A3J J;  2HXO A;  4IEJ A;  2CUE A;  4CYC B;  1HDP A;  1W0T A;  2FQ4 A;  2Y9Y A;  5E3L A;  5E3M A;  1VFC A;  2R7Z J;  3NNR A;  4A3C J;  4RDU A;  3ZQL A;  5F0C A;  1F43 A;  3BNI A;  1W0U A;  3CWR A;  5JLX A;  3VW2 A;  3IH3 A;  3QQA A;  3ON4 A;  4X1E A;  5IP7 J;  3ZQI A;  4I76 A;  3FK6 A;  2CRG A;  2CQX A;  3GTK J;  3NPI A;  3COL A;  2Y31 A;  2L7F P;  3ZOB A;  1A5J A;  4DZJ A;  1IDZ A;  2GBY A;  4AYB N;  2DA5 A;  3QPS A;  4C3J J;  3HGY A;  5E3N A;  1ZKG A;  3LWJ A;  1UHS A;  3NXC A;  2DMQ A;  5D1R A;  2JA5 J;  1QVT A;  2QCO A;  4AC6 A;  4BY7 J;  3GTG J;  4D5F A;  3GEU A;  5CXG A;  1G2H A;  3S2D J;  1ENH A;  1ZR4 A;  4GCL A;  2O7O A;  2M9H A;  1ZTR A;  2W53 A;  3WHC A;  3EUP A;  3ANG A;  2HKU A;  2NX4 A;  2WAQ N;  3VUQ A;  3IV5 A;  1U78 A;  3BHQ A;  3NRG A;  1TWH J;  2HQ5 A;  5C4X J;  1TC3 C;  4NN1 A;  3S17 J;  1RR7 A;  1EF4 A;  4QIW N;  3VVZ A;  4JL3 A;  2F07 A;  2AO9 A;  5EG0 A;  4UDS A;  3SJM A;  3BTJ A;  2NVQ J;  2UXP A;  2JN6 A;  2XSD C;  1NK3 P;  5HBU A;  2MSY A;  4QTR A;  3HOY J;  4XRS G;  2DG7 A;  5GPA A;  1SAN A;  2DN0 A;  1UI6 A;  2OI8 A;  3PAS A;  3DCF A;  4MLO A;  4DW6 A;  2ZCN A;  3GBG A;  2JJ7 A;  2H1K A;  3HTI A;  5J1U A;  3ZQH A;  1UI5 A;  4A3E J;  3FK7 A;  1POG A;  2X48 A;  2YU9 J;  2DG8 A;  4DYR A;  3S15 J;  2ZCM A;  3Q0V A;  2G7G A;  4MFD A;  5EDN A;  5M3F J;  2QF7 A;  2YVE A;  2EZL A;  3HDD A;  1XC5 A;  2AHQ A;  4A3D J;  3JRB A;  1U9O A;  5DAJ A;  1TWC J;  1ETO A;  2M2E A;  3CDL A;  5EG0 B;  3A01 B;  1HCR A;  5FGL A;  2CU7 A;  5FHP A;  2RAE A;  3VOX A;  4HNV A;  2M34 A;  4CYC A;  3TW7 A;  5IOY A;  1IRZ A;  2YVH A;  2E2I J;  2K9N A;  3G1M A;  2CJJ A;  2R5Y A;  2COB A;  3A03 A;  5M5W J;  2PMZ N;  5FLV A;  3LNQ A;  3KNW A;  2Y2Z A;  2DA1 A;  2GFN A;  3UKG A;  2XB0 X;  4B4C A;  2NP3 A;  5IPA A;  5J1R A;  1FJL A;  2DMN A;  1ETW A;  2FX0 A;  2ME6 A;  2OER A;  3G1O A;  3B6C A;  3JRA A;  3BTL A;  5DS9 A;  1MBH A;  3NAU A;  3GTQ J;  3S2H J;  1GT0 C;  5DTD A;  1FTT A;  3KKC A;  3V78 A;  4LOC A;  3VW1 A;  5J3L A;  5EF6 A;  3JRI A;  2CQQ A;  2EZI A;  3Q0W A;  2GLO A;  3A01 A;  2VUM J;  4HKU A;  2PZ9 A;  2I10 A;  3TED A;  3BCG A;  5D19 A;  3EGQ A;  4RBO A;  2V57 A;  1YRN A;  1FIP A;  1RKW A;  1WH7 A;  2LR8 A;  4MXM A;  3S1M J;  2XPV A;  3PPB A;  2H8R A;  3GTJ J;  3JR9 A;  2E2H J;  1WCM J;  5K7H A;  4FIS A;  2VKE A;  3JRE A;  2MGQ A;  1ZQ3 P;  1IC8 A;  4IHW A;  9ANT A;  2XDN A;  3BR0 A;  5GP9 A;  2JA7 J;  2CUF A;  4MFE A;  3HOW J;  2ZOZ A;  4GCT A;  3VPR A;  5F1J A;  3TP3 A;  3HEF A;  4JX6 A;  1S7E A;  2O9L A;  2K9Q A;  2VPR A;  3HKZ N;  4IHV A;  3BRU A;  2X9D A;  3KKD A;  1B72 B;  3SDG A;  5EZG A;  1H89 C;  3VP5 A;  1ZR2 A;  4YZE A;  5EFY A;  2G0E A;  3T6N A;  2L7M P;  2LFB A;  3ON2 A;  2DA4 A;  3S1N J;  4MO7 A;  1JT6 A;  4FTH A;  1H8A C;  4FE4 A;  3HGG A;  1MSF C;  3HBL A;  4Y52 J;  2NVT J;  3BR2 A;  3F0C A;  2Q24 A;  1LFU P;  2LLK A;  1JGG A;  1ETX A;  2NOG A;  4AUX A;  3JSJ A;  5F0H A;  1JUP A;  5M5Y J;  4M3B A;  3HOV J;  1SGM A;  5F04 A;  3VVX A;  1XG1 A;  4D7M A;  1A6I A;  5M5X J;  2LK2 A;  1HDD C;  1XS9 A;  4M3G A;  1OFC X;  2VI6 A;  3LHQ A;  2NS7 A;  2GUH A;  2LVS A;  3VOK A;  1GVD A;  2ZB9 A;  4W1U A;  4BBR J;  1BW6 A;  2DMP A;  1LE8 B;  4C2M J;  3W6V A;  1BW5 A;  2WUI A;  2M8G X;  2W48 A;  5CXI A;  5H9T A;  2ECC A;  4BBS J;  4JX4 A;  4XIC A;  2EZH A;  5FKN A;  3WHB A;  1IJW C;  4JKZ A;  3C07 A;  5FKM A;  2LTP A;  1MBF A;  5FMP A;  5FKL A;  4V2G A;  4XRS A;  1ETQ A;  2YUS A;  2JWT A;  4BY1 J;  3IH4 A;  1MBE A;  1QVU A;  3NAR A;  3JRF A;  2TRT A;  3BQZ A;  5EZH A;  2B63 J;  5IYB J;  1PUF B;  3BR6 A;  2M0C A;  4UUT A;  3GTL J;  1I50 J;  5FLM J;  3FKI J;  4C3H J;  3MNL A;  4L5E A;  4XRM A;  2EBI A;  4AF5 A;  1LE8 A;  2QWT A;  1WI3 A;  5C4J J;  1JUS A;  3HOZ J;  1JJ6 C;  2HOS A;  3VVY A;  1NK2 P;  1U9N A;  1JTX A;  4GFL A;  5C4Y A;  2E2J J;  4JX5 A;  5C44 J;  4A3G J;  3MN2 A;  3VW0 A;  2X6O A;  2UXI A;  1RKT A;  4UUS B;  1GV5 A;  4ME9 A;  1MSE C;  1JJ8 C;  1B72 A;  3PM1 A;  2Y9Z A;  3PO2 J;  1K83 J;  2DTZ A;  2LP0 A;  2D5V A;  1JT0 A;  3V6G A;  3FIW A;  2JA8 J;  3BG9 A;  5BNG A;  4CGR A;  3ZQF A;  3MKL A;  1R9T J;  1X58 A;  5EGO B;  4A3I J;  3RD3 A;  4M3D A;  3LOC A;  1GV2 A;  4A3F J;  1RPW A;  2N8G A;  1HOM A;  4XK4 A;  2ECB A;  3F1B A;  3S5R A;  1BA5 A;  2UXH A;  4ICH A;  1IGN A;  3MVP A;  1IDY A;  3TW6 A;  3DEW A;  4B1R A;  3KZ9 A;  4KWA A;  2G3B A;  2XGD A;  4M3F A;  2MW8 A;  3BR5 A;  2JA6 J;  2R92 J;  2R0Q C;  3FRQ A;  3AQS A;  4D5C A;  3I4M J;  1FIA A;  3CRJ A;  5HOD A;  3QBM A;  1B8I A;  3DPJ A;  3JRD A;  3G56 A;  2IU5 A;  2JMW A;  2P81 A;  1F36 A;  2LY9 A;  5E3O A;  3HOX J;  4ABZ A;  1VI0 A;  4MK6 A;  1MBJ A;  2MG4 A;  2NVY J;  2ZCX A;  1WGX A;  2G7S A;  4A69 C;  1TWG J;  4IHX A;  4FCY A;  4M3E A;  1UG2 A;  3RKQ A;  2DA6 A;  3BG5 A;  4NDL A;  4B3A A;  1WH5 A;  2G7L A;  2QTQ A;  2ZOY A;  3GTO J;  4ACI A;  2O8K A;  2IAI A;  2XRL A;  2HOA A;  1JUM A;  1MBK A;  2WB1 N;  5C3E J;  1P7J A;  2KT0 A;  3C2B A;  1IV6 A;  5IYD J;  3BR3 A;  3LSR A;  1AU7 A;  3LSP A;  3GTM J;  1PUF A;  4D7N A;  3G7R A;  1APL C;  5K7F A;  4MIM A;  2GEN A;  3O60 A;  1QPI A;  1ETY A;  1T33 A;  3BTI A;  2DA2 A;  3QPL A;  1GDT A;  4GFB A;  4A3K J;  5IOZ A;  5EYR A;  4FE7 A;  5IP6 A;  2IBD A;  3H3V K;  2ID3 A;  3H0G J;  4DZP A;  5K58 A;  4V2F A;  2XPW A;  1ZGW A;  1ZK8 A;  3JRH A;  3QKX A;  2VKV A;  3Q0U A;  1MH3 A;  5IYC J;  3S14 J;  2HYT A;  3B6A A;  1JKR C;  1D5Y A;  2EZK A;  2L9R A;  5F27 A;  3GTP J;  4J19 A;  2R5Z A;  2R93 J;  2RAS A;  2FJ1 A;  4M6V A;  1U8B A;  2QIB A;  4G12 A;  3B81 A;  3G1L A;  1AKH A;  3HM5 A;  2UXU A;  2OF7 A;  3K2A A;  1HF0 A;  4L62 A;  1YRN B;  2LD5 A;  2IEK A;  1TWA J;  2K9S A;  5FJ8 J;  1UMQ A;  3HTH A;  2HXI A;  2Y0S N;  2FBQ A;  2OPT A;  4A93 J;  1Q1V A;  1OCT C;  1I3Q J;  1Y1W J;  5HSZ A;  1TWF J;  3SFI A;  2HOT A;  5EGO A;  2XGE A;  4XID A;  3A02 A;  4DYQ A;  2REK A;  2R5Y B;  2HI3 A;  2JK3 A;  4GCK A;  2E19 A;  1T56 A;  3RQI A;  4UUS A;  3Q3S A;  2R5Z B;  2HDD A;  2O7T A;  3HE0 A;  3NI7 A;  1IUF A;  4AC0 A;  1X2N A;  3HOU J;  3OSF A;  5HAW A;  2ELK A;  3LSG A;  4EEF G;  4A3M J;  1O4X A;  2DMT A;  3AQT A;  2WV1 A;  2QOP A;  4JP0 A;  3IH2 A;  3CQZ J;  1QRY A;  3JRC A;  5CW8 A;  1RET A;  2D6Y A;  2FD5 A;  4PXI A;  1JTY A;  1FEX A;  1GUU A;  5K7Z A;  1DU0 A;  2QKO A;  1OJL A;  3OIO A;  4W97 A;  4DYC A;  4GFK A;  2HYJ A;  3O8H A;  3ZQG A;  3O8G A;  1P7I A;  1WPK A;  2DJN A;  3BT9 A;  1Z0X A;  3OOU A;  1FTZ A;  1MNM C;  3BG3 A;  3S16 J;  2NP5 A;  5AQC A;  4C3I J;  2TCT A;  3CMY A;  3ZQC A;  1BJZ A;  2RHA A;  3S1R J;  2XPU A;  3BJB A;  4BKX A;  1OCP A;  1HLV A;  1MBG A;  4Y7N J;  1NTC A;  1Y1V J;  2NS8 A;  2DA3 A;  3HB9 A;  3JRG A;  1H88 C;  1DU6 A;  3CCY A;  3CJD A;  1Z77 A;  4QSH A;  4JNN A;  2ME0 A;  2EQR A;  1ETK A;  4I6Z A;  2NVX J;  3D1N I;  1VF9 A;  2ID6 A;  1E3O C;  2UXO A;  5M3M J;  5F0F A;  1K61 A;  4JYK A;  1IG7 A;  3HTA A;  2L7Z A;  1JKP C;  3BTC A;  3RZD J;  5JLW A;  3ANP A;  4NEL A;  2XGC A;  3P9T A;  1BL0 A;  3FIS A;  2YS9 A;  1RES A;  2L0K A;  2DMU A;  1SFO J;  3OSG A;  2E1O A;  3IUV A;  5F08 A;  3BR1 A;  3K7A J;  4X6A J;  1VND A;  5FKO A;  2LKX A;  2EH3 A;  3E7L A;  3PO3 J;  1I6H J;  4A3B J;  2PBX A;  4S0H B;  4A3L J;  3I4N J;  5D18 A;  2XB5 A;  3TP0 A;  4BXX J;  3E7Q A;  5J1Y A;  3VIB A;  1JKQ C;  3RZO J;  1AKH B;  1JKO C;  1ETV A;  3HTJ A;  2DA7 A;  3LJL A;  4IHY A;  3BQY A;  1ORK A;  5EEA A;  3L1P A;  2KDZ A;  3M4O J;  2WGB A;  5GPC A;  3LSJ A;  1B8I B;  1CQT A;  1ITY A;  1LFB A;  3RH2 A;  3M3Y J;  2K40 A;  3GZI A; 
#chains in the Genus database with same CATH topology
 1X2M A;  1VQK I;  2ZSH B;  2MLK A;  1VQ5 I;  3H3U A;  1IXC A;  4QPO A;  2V1U A;  4CYC B;  3F23 A;  2FRH A;  3GLX A;  3QP5 A;  2Y69 H;  2FQ4 A;  2MD0 A;  5E3L A;  3ZP5 A;  4P9F A;  3J7A O;  2K27 A;  3ZQL A;  3CJN A;  3CUQ C;  3HKZ A;  1F43 A;  2MC3 A;  3TQN A;  1O3R A;  3CWR A;  2VJI A;  5JLX A;  1OLT A;  2Q1Z B;  3W3C A;  3E0J B;  2XF6 A;  1WKM A;  3GTK J;  1LDK B;  4V19 K;  2KZV A;  5CVR A;  1TQP A;  2L7F P;  2W4S A;  2GBY A;  3QPS A;  2DU9 A;  5DDG A;  3G2B A;  3M9A A;  4C3J J;  2JUG A;  2WV0 A;  2OJE D;  2DMQ A;  2UUZ A;  3LSH A;  5DCM B;  4YIF A;  2BW3 B;  2JA5 J;  5E8G A;  3J7Z I;  5D4S A;  1VQO I;  3QYF A;  4B09 A;  2FJI 1;  3KLN A;  3GEU A;  1G2H A;  2VT2 A;  2B9S A;  2E5Z A;  3GFM A;  1K79 A;  3OYB A;  3BPX A;  4GXO A;  1QZY A;  2BBY A;  4AID A;  1YIT I;  2L54 A;  1QO0 D;  1ULY A;  3IV5 A;  1BC7 C;  1ZLJ A;  2GOX B;  1TWH J;  2ZJP F;  5C4X J;  1WQ2 A;  1RR7 A;  1HW2 A;  1EF4 A;  4QIW N;  4M9X A;  4JL3 A;  2DBB A;  4Q48 A;  2ZO4 A;  1D1B A;  4L9N A;  2AQF A;  4LB6 B;  2NVQ J;  3DBH B;  2O5R A;  1LNW A;  2BW3 A;  2W84 A;  4YII A;  1DPU A;  3RKX A;  3I5U A;  4HDV A;  2X6Y A;  1W7P A;  1TP4 A;  4FT8 A;  4IXA A;  5H6Q A;  4WF2 A;  1SVM A;  6PAX A;  2DG7 A;  2MFZ A;  2J5O A;  3PAS A;  4MLO A;  2LF7 A;  2XGX A;  3GBG A;  2BVM A;  4YRV A;  3E5Q A;  2WAE A;  4A3E J;  4Y15 A;  3S15 J;  1ZHF A;  4NBQ A;  3DPL C;  4KIT B;  1ERD A;  2W25 A;  3L00 A;  5J47 A;  5L3E A;  5D5V B;  2QF7 A;  2DT6 A;  1XC5 A;  5DAJ A;  1U9O A;  2VQL A;  5KCM A;  4OIR F;  1MDM A;  4A0Y A;  3A01 B;  4XLN F;  1HCR A;  2KIF A;  5FHP A;  1TLH B;  4BE0 A;  4ETS A;  2OU2 A;  3KP7 A;  4HNV A;  5LFA A;  1O57 A;  2M34 A;  5LGN A;  5IOY A;  1IRZ A;  1D1C A;  1E17 A;  5KVR A;  4FX4 A;  2FBI A;  2K86 A;  2K9N A;  1TQI A;  4U9L A;  1RI7 A;  5E18 F;  4A12 A;  3VEP A;  3LNQ A;  5F64 A;  1P4A A;  3KNW A;  2Y2Z A;  4MEY F;  4PGG A;  2CO5 A;  3QPT A;  3OL4 A;  5J1R A;  2OCC H;  2DMN A;  1FJL A;  4I0A A;  2BGC A;  4NC6 A;  3TO7 A;  1UAA A;  1OCO H;  1MBH A;  3LA7 A;  3CO6 C;  3GTQ J;  4RAY A;  3DU6 A;  2GAU A;  3JRI A;  2CQQ A;  2EZI A;  1S29 A;  3Q0W A;  4EM0 B;  3A01 A;  1FP2 A;  1KU7 A;  1XMX A;  2I10 A;  2EA2 A;  1A04 A;  2PG4 A;  3BCG A;  3JW4 A;  1ON2 A;  3WG9 A;  3HRM A;  2YX4 A;  2QGU A;  1XMA A;  3K1P A;  2O3F A;  1R4M B;  5FRM A;  2H8R A;  1WJB A;  3JR9 A;  1FYL A;  2E2H J;  1WCM J;  4RB3 C;  1MMG A;  2QSF X;  2M5W A;  1ZQ3 P;  5BQT A;  3BR0 A;  2CV0 A;  2DFF A;  4FX0 A;  4MFE A;  1W36 D;  2QYO A;  1VQ7 I;  2ZOZ A;  4GCT A;  4BJ6 C;  1SVO A;  3OR2 C;  1D3Y A;  2E34 A;  1I27 A;  2CW8 A;  2V9P A;  1OCZ H;  3HEF A;  3S8P A;  3HKZ N;  4UVC A;  1S5L C;  4F3Q A;  1B72 B;  3LSK A;  3LSM A;  5DD8 A;  2R4G A;  1FT9 A;  4RB2 C;  3I59 A;  3L9F A;  2Q0O A;  3CME I;  1FNN A;  2JRT A;  4GYG A;  4I0B A;  1WZ2 A;  1FX7 A;  3S1N J;  1W7P B;  4G8X A;  1KU2 A;  5HS7 A;  1PDN C;  2HR3 A;  3WTY C;  3PIO F;  3W6K B;  3HGG A;  4RLF A;  5ICE A;  4WWC A;  1J9I A;  5EEH A;  1W4M A;  5J6X A;  1YW7 A;  2MBF A;  4EJW A;  2VT3 A;  1JGG A;  1BI1 A;  3K1N A;  1IW7 F;  1STZ A;  2P6S A;  4P55 A;  1R5G A;  2KDO A;  1JUP A;  1NH3 A;  4A6D A;  3PFI A;  4BDY A;  5KK1 A;  4D7M A;  4MEX F;  5M5X J;  1HDD C;  1R4N B;  2DOF A;  3BCA A;  1YI2 I;  1XS9 A;  3J80 K;  1HW5 A;  2Q2E B;  2R7F A;  1OFC X;  3TBI A;  3W2A A;  2DK5 A;  4ZYD A;  3AAF A;  1U0J A;  2NS7 A;  3KEY A;  2OQR A;  1MMD A;  3WTX C;  1ZN2 A;  2ESH A;  2YVX A;  5F1R A;  4E7J A;  5LGT A;  3E6C C;  4C2M J;  3K4K A;  4XOR A;  2ECC A;  4N0B A;  4XKW A;  2CS3 A;  3F8N A;  4XIC A;  4JKZ A;  1IJW C;  3HUG B;  3C07 A;  2K3P A;  3CMA I;  2VN2 A;  3F6O A;  5GAE J;  2W24 A;  4L9T A;  4BL0 B;  1MBF A;  4Y3O A;  5FKL A;  3V8J A;  3J81 Z;  3ML6 A;  2PI0 A;  1MBE A;  1WFX A;  3GFJ A;  3KPH A;  3NAR A;  4DNC A;  3OMY A;  2TRT A;  3HRU A;  4F93 B;  2VKD A;  3HTS B;  3CUQ B;  4RS8 A;  2M0C A;  3GTL J;  3EET A;  3FKI J;  4C3H J;  4L5E A;  4AF5 A;  2NRA C;  3AG1 H;  1WI3 A;  3C3W A;  5C4J J;  3D5R C;  4HF0 A;  1X1D A;  3TL4 X;  1JE8 A;  2HOS A;  3VVY A;  4GFL A;  3FXU A;  1LKX A;  5C4Y A;  3EDP A;  5J4Y A;  2HKX A;  1D5V A;  4AVP A;  3DV8 A;  5DYM A;  2DO7 A;  2ESN A;  4UUS B;  2ZCW A;  1D1A A;  1EJ9 A;  4ME9 A;  1MSE C;  3PM1 A;  1YTY A;  1K83 J;  3RTR A;  1Z67 A;  3VYS B;  5CVU A;  4OIP F;  2D5V A;  1K6Y A;  3V6G A;  4IHT A;  4E7K A;  3FIW A;  2R7T A;  3A2K A;  3BG9 A;  2HKO A;  4M73 A;  2QEN A;  2QQB A;  1F5T A;  3K4M A;  5JVG F;  1Z1D A;  1FP1 D;  4TV7 A;  4M3D A;  1GV2 A;  4NC8 A;  1KZH A;  4PJN A;  2UZK A;  3WGH A;  1Z7U A;  4XK4 A;  4JQF A;  4S05 A;  3TW6 A;  4IQJ A;  4OD4 A;  3ZCO A;  5CYV A;  5HVQ C;  4MHG A;  3I4M J;  1FIA A;  1D0Z A;  3H92 A;  1ONV A;  3CRJ A;  4AD9 A;  3G56 A;  5AIQ A;  2H6C A;  2LNB A;  2P81 A;  2WAF A;  2LY9 A;  1GLN A;  4IRG A;  4MK6 A;  4ABZ A;  1G3T A;  1VI0 A;  2VB6 A;  5LEK A;  1EA3 A;  3R6S A;  2HZT A;  2EJR A;  2M4K A;  5DM7 F;  2L9S A;  4IHX A;  3DWL E;  4FCY A;  1UG2 A;  1MND A;  3BG5 A;  2HDW A;  4NDL A;  4RMN A;  5BS6 A;  4IO9 F;  2G7L A;  4ACI A;  1D8K A;  2O8K A;  2XRL A;  4HOB A;  4XLP F;  3RKW A;  1XMK A;  1MBK A;  2HOA A;  2KT0 A;  2CQ7 A;  3DPU A;  5CVJ A;  1CF7 A;  5AON A;  1AU7 A;  3GFL A;  3LSP A;  4GO1 A;  1IN7 A;  1PUF A;  1WJF A;  2LKP A;  2QQ8 A;  3VYT B;  3IRQ A;  3R60 A;  4MIM A;  1I1G A;  3DKY A;  2EV0 A;  1QPI A;  1ETY A;  2IA0 A;  2GXA A;  3BTI A;  2DA2 A;  2QUF A;  2FNP A;  5CKT A;  3I9V 2;  1WJE A;  1Z21 A;  4M6Y A;  4PJM A;  4DZP A;  2YPR A;  3W2V A;  2XPW A;  1ZK8 A;  3JRH A;  1BI3 A;  1MH3 A;  3KCC A;  4LD5 A;  3B6A A;  3KEQ A;  1D5Y A;  4PJL A;  4XKV A;  3VSL A;  1ODD A;  2R5Z A;  3WTU C;  1NG6 A;  2A6E F;  2VPL A;  2L7K A;  1HKT A;  3B81 A;  3G1L A;  1AKH A;  4QLC U;  2O03 A;  2UXU A;  2DDB A;  3HC7 A;  3K2A A;  4L62 A;  3OL3 A;  1YRN B;  1TWA J;  4CHU A;  1I1S A;  1JGS A;  1R5H A;  1UMQ A;  2HXI A;  1RNL A;  2ZJ2 A;  2AXT C;  3KZZ A;  4NUB A;  5H20 A;  3PL8 A;  3CES A;  3ASO H;  1Y1W J;  2W1O A;  1Z3X A;  2XGE A;  2XAG A;  3DPT A;  1YYV A;  4ZDL A;  3ZQ7 A;  4DYQ A;  2P8T A;  2WY8 Q;  2JK3 A;  4GCK A;  1XSX A;  3LFK A;  3RQI A;  2R5Z B;  2HDD A;  2O7T A;  3E5X A;  2KIS A;  3I0T A;  4PGH A;  2ELK A;  1G4D A;  3MFK A;  3QOP A;  4A3M J;  3TOA A;  2MD5 A;  4BGD A;  3QP6 A;  5CVV A;  1T6S A;  1N77 A;  3I54 A;  2V79 A;  3EUH A;  1QRY A;  5CW8 A;  1RET A;  3QU6 A;  3BZC A;  4LB5 A;  1T38 A;  2FD5 A;  5LBQ A;  5B1B H;  1DU0 A;  2QKO A;  4DVY P;  4W97 A;  4PJJ A;  4GFK A;  4BJT A;  3O8H A;  1QQI A;  4IQ4 A;  1WPK A;  2EFN A;  1SD5 A;  3G73 A;  2X4H A;  2R7X A;  2OZ6 A;  3BG3 A;  4EJT A;  2TCT A;  2QWW A;  2NNY A;  3FMQ A;  2Z99 A;  2RHA A;  4PFO A;  4G9Y A;  1FMV A;  3BJB A;  4F91 B;  3ABK H;  2VJJ A;  3LSI A;  2QKL B;  2A5Y B;  1VQP I;  2KJB A;  2BVL A;  4EJU A;  1FZP B;  2JPB A;  1MBG A;  2H1L A;  1NTC A;  1H88 C;  1LEA A;  2R7U A;  1HKS A;  1ZG3 A;  2IA1 A;  2L4M A;  3JTG A;  1KQ0 A;  2MAB A;  2X6X A;  1DU6 A;  1A36 A;  1IF1 A;  3QRF F;  1R36 A;  1D0Y A;  1E2X A;  4I6Z A;  3I59 B;  3IRR A;  4KN7 X;  1VF9 A;  2E1M C;  1T2K A;  2M0M A;  4EMS A;  1CGP A;  3DKX A;  4KIF A;  5M3M J;  2UXO A;  2DCE A;  5F0F A;  4CSW A;  3RKY A;  1NG7 A;  4XN3 A;  1RRJ A;  3WU2 C;  1IAW A;  3OWT A;  1B9M A;  1J2X A;  4FQG A;  4B43 A;  3IL2 A;  3GCM A;  2XGC A;  4I99 C;  2IGM A;  2LDU A;  3OY9 A;  3AG4 H;  1UHW A;  3ERM A;  4DQ2 A;  2EFW A;  5F08 A;  3BR1 A;  3K7A J;  2VQG A;  3NRV A;  5B3S H;  3DBL B;  2R7Q A;  3PUF A;  5CPR B;  3TDZ C;  1N78 A;  2R7O A;  3MKZ A;  2XKO A;  4BJ5 C;  1SFK A;  2IXS A;  1TZL A;  1FBS A;  4XN0 A;  1SMT A;  3WG7 H;  4J00 A;  5FD5 A;  2QLZ A;  2XB5 A;  5DUI A;  4LMY A;  1VTN C;  3QWL A;  2PMZ A;  2P7V B;  4BEH A;  2DOD A;  4M9S A;  3OIP A;  3P7N A;  4EJV A;  4E7I A;  1FOX A;  1JKO C;  1ETV A;  3OYG A;  4IHY A;  3BQY A;  4BHP A;  3BDD A;  2KDZ A;  2WGB A;  3ABT A;  2MA3 A;  3TGN A;  3RYR A;  5GPC A;  2CW0 F;  4R1H A;  2IS4 A;  2YU3 A;  2FUG 2;  3I55 I;  1HST A;  5H6R A;  4ANJ A;  3IUO A;  3GZI A;  2P5L C;  2FA5 A;  4BYY A;  2ELJ A;  3I71 A;  3G6E I;  1H0M A;  2Y30 A;  1MDM B;  4ITV A;  4P9U A;  1IUY A;  1P92 A;  3KP2 A;  3SYT A;  2A5W A;  2GM4 A;  4AIK A;  1IV8 A;  4A3J J;  4AYB A;  4IOC F;  2HXO A;  3LAP A;  1K7A A;  2BEO A;  3KZI C;  4A3C J;  4XSZ F;  3CCS I;  3BNI A;  3PNY A;  1SAX A;  4OMY A;  3VW2 A;  4MNU A;  3RPQ A;  5IP7 J;  5ICC A;  4PJ0 C;  4R8H A;  2IGN A;  4RAZ A;  2ZJQ F;  3ON4 A;  3ZQI A;  4I76 A;  2QVO A;  3NS4 A;  4B47 A;  2GWR A;  3H9G A;  4U88 A;  1P9Q C;  3COL A;  3NPI A;  4U9N A;  2IGK A;  1H9G A;  3DTK A;  3V8L A;  1PP7 U;  1RC9 A;  4U0V A;  2VOO A;  1FSE A;  3HGY A;  1HQC A;  2OTL I;  3PJR A;  3DXJ F;  2V6C A;  3DFG A;  4WIB A;  2OV7 A;  2H09 A;  4XQF A;  4GGG A;  2F5F A;  1QVT A;  4AC6 A;  4JK1 X;  3SWH A;  3KYD B;  4D5F A;  2DDA A;  1B59 A;  4AIJ A;  2M9H A;  1Y39 A;  2W53 A;  2ETH A;  3EUP A;  3BG7 A;  4HX7 A;  2HKU A;  3FXL A;  2WAQ N;  3VFZ A;  5HLG A;  3OS2 A;  3BHQ A;  3RDI A;  2MH2 A;  1TC3 C;  4NN1 A;  1XGN A;  4HA8 A;  3T8T A;  3T0Y A;  4RLQ A;  3WTS C;  4UV9 A;  5A2Q K;  4UDS A;  3SJM A;  1YIO A;  5JHF A;  5IT3 A;  2DPU A;  2XSD C;  2HVQ A;  4C30 A;  5GAD J;  3NWT A;  2KIQ A;  2MSY A;  1KQ8 A;  3NEU A;  4XRS G;  5K5R A;  1YW8 A;  1SAN A;  4NHJ A;  2HNH A;  3TDU C;  3LMM A;  4DW6 A;  2ZCN A;  4HF2 A;  2H1K A;  3HSR A;  3IWF A;  1FBU A;  1POG A;  1FPQ A;  3DTE A;  4DYR A;  1O3S A;  2ZCM A;  3Q0V A;  2HQA A;  4A5M A;  1U2W A;  2YVE A;  3HIF A;  1R22 A;  4KIG A;  1TWC J;  1SEU A;  4HV5 A;  3ULQ B;  1VQL I;  4U87 A;  1Z3Y A;  4CA0 A;  2ZME A;  1R1V A;  3FHZ A;  3N05 A;  2G7U A;  4XOP A;  3LL7 A;  1WJD A;  2BOL A;  4PCQ A;  2EPF A;  4XLC A;  5FFX A;  4I98 B;  1Z6T A;  2P5K A;  2H8W A;  3GW2 A;  2CJJ A;  3G1M A;  3A03 A;  1XB4 A;  2PMZ N;  4OU0 A;  4PDK A;  3ZMU A;  4A6E A;  2L2O A;  2DA1 A;  3WTV C;  1SMY F;  3SEZ A;  2VLA A;  3UKG A;  1M1E B;  1DGR M;  1P4W A;  5IPA A;  2RDP A;  5L3C A;  2FX0 A;  2ME6 A;  2OER A;  3M8E A;  3G1O A;  4M72 A;  4N4N B;  1SAU A;  3CCJ I;  3ZR8 X;  3JRA A;  1J0R A;  3IC7 A;  3GZ6 A;  3NAU A;  4L9V A;  2E7W A;  1GT0 C;  3MMY B;  3BJA A;  2VUM J;  2GLO A;  4HKU A;  4HSR A;  2EFP A;  3M7G A;  3PNT A;  5D19 A;  3EGQ A;  4RBO A;  1OR7 A;  1YRN A;  3BLY A;  4B3X A;  1RKW A;  4HX8 A;  2V1N A;  2UXN A;  3V42 A;  5KHD A;  3S1M J;  2XPV A;  3GTJ J;  1FBQ A;  1XPX A;  4BU2 A;  2RNJ A;  4XLH A;  4HST A;  2IS6 A;  4A5N A;  2GZW A;  2XDN A;  2KL4 A;  3T1B A;  3CP2 A;  1HW1 A;  1YX3 A;  2K4J A;  2PFV A;  2JVG A;  3FWE A;  4HF1 A;  5DD4 A;  3BRU A;  3KE2 A;  4XL9 A;  3SDG A;  5EZG A;  1H89 C;  3VP5 A;  1ZR2 A;  3WU1 B;  3F8M A;  4EQQ A;  2G0E A;  2LFB A;  3HTU A;  2E5N A;  1JT6 A;  1H9T A;  1E3P A;  1S7A A;  2V6E A;  3HBL A;  2DPD A;  2NVT J;  1S7O A;  2KMU A;  1LJ9 A;  2MLG A;  2ZXH A;  4IJA A;  2LLK A;  1LFU P;  2E71 A;  3ZN0 A;  4ZH4 F;  1ETX A;  1P4X A;  5KAI C;  4AUX A;  5F0H A;  1WRJ A;  3HOV J;  2L5Q A;  2P5V A;  2D1H A;  2E7X A;  5E1W A;  1X4P A;  3BY6 A;  1W7P D;  2Q2E A;  4BS9 A;  4CZZ A;  2XAQ A;  4OOI A;  4CIC A;  3HJE A;  3ONQ A;  2GUH A;  3OYH A;  2LVS A;  4W1U A;  2ZB9 A;  1BW6 A;  1OIS A;  3W6V A;  2W00 A;  5LRS A;  2PJR A;  4BHC A;  2LY2 A;  4P1W A;  1YJN I;  1N75 A;  5FGM A;  1Z9C A;  1R23 A;  2EZH A;  5FKN A;  3WHB A;  3S93 A;  5LD2 C;  1MGT A;  3MWM A;  2FBH A;  1J7K A;  2YUS A;  5L3F A;  1B9N A;  1QA6 A;  2VE8 A;  1S6L A;  3JRF A;  1G3Y A;  3BQZ A;  4HV6 A;  5EZH A;  3FDY A;  3KEO A;  2B63 J;  1LFP A;  5IYB J;  1PUF B;  4CCJ A;  2RQP A;  1SD7 A;  1I50 J;  3I56 I;  1PJR A;  2FEZ A;  2MYS A;  2VC0 A;  3CCL I;  3MNL A;  5D6E A;  2QWT A;  1U9N A;  1YFH A;  2XAH A;  1KYW A;  2FF4 A;  3MN2 A;  3ZN1 A;  2X6O A;  2UXI A;  1GV5 A;  4MQ9 F;  3KP5 A;  2ZXI A;  1FOY A;  3V7S A;  2DTZ A;  2CGP A;  3EYI A;  4ZZL A;  4KT5 C;  4AVZ A;  1ZG5 A;  2WTE A;  2Z3Y A;  3HXL A;  4N4O B;  2GOM A;  4XMY A;  3R0A A;  3GO5 A;  2XSJ C;  3F72 A;  5K5Q A;  5FRN A;  4CGR A;  2RGV A;  4RAG A;  3OYD A;  5EGO B;  4A3I J;  3MCZ A;  2JSP A;  2R7S A;  3LOC A;  1RPW A;  2N8G A;  2M8E A;  3B02 A;  4LLL A;  5FFZ A;  3OYM A;  3PSF A;  3MVP A;  4RAF A;  2W7N A;  4A2U A;  4B1R A;  3KZ9 A;  2KHM A;  2XGD A;  2R7W A;  2JA6 J;  2R92 J;  1K78 A;  4KMU X;  3FRQ A;  1REP C;  2ZFU A;  3DBR B;  4NQW A;  1SFX A;  1AWC A;  1R71 A;  2A6H F;  3JRD A;  4YG2 F;  3FXQ A;  3CC2 I;  3RPU A;  5E3O A;  3PSI A;  5CJ9 A;  4E6K G;  1MJB A;  4LLN A;  2NVY J;  2LY1 A;  4K2E A;  1XX5 A;  5H2F C;  2G7S A;  1D8J A;  4GRI A;  3MKW B;  3RKQ A;  1W1W E;  3HHH A;  4B3A A;  1UCR A;  4IL6 C;  4XSX F;  3F8F A;  1MMN A;  4MQV A;  1P7J A;  2WAD A;  1IV6 A;  1T95 A;  1HXD A;  4IX7 A;  3LSR A;  1C0W A;  4HX4 A;  3WGI A;  3ZXS A;  4E4H A;  2YR2 A;  3ZMS A;  2DFH A;  1O7F A;  3K4N A;  3G7R A;  4CCO A;  3CO7 C;  1APL C;  2FOK A;  3UR3 C;  1U3E M;  3O60 A;  1TW2 A;  4DIQ A;  3DQV C;  1T33 A;  1GDT A;  1ZAR A;  3PFY A;  3Q9S A;  4MGR A;  4A3K J;  2OTJ I;  1XGO A;  5EYR A;  1L0O C;  4CCK A;  2DQL A;  3D5S C;  1DGW Y;  3H0G J;  2EB7 A;  5ICF A;  2RNG A;  2LMD A;  5L3D A;  2ISY A;  3QKX A;  3C2G A;  2VKV A;  4J01 A;  2HYT A;  2EIM H;  3S14 J;  4U7B A;  2P4W A;  2L9R A;  3FXM A;  4ZYH A;  2B0L A;  1LVK A;  4M6V A;  4Q47 A;  1XGS A;  3HSE A;  3ROU A;  3W6J B;  4FHT A;  4LIU A;  5J8F A;  1HF0 A;  2EFQ A;  1I3A A;  2AXL A;  1A31 A;  1T98 A;  4ENN A;  2HEO A;  4RM3 A;  1J5Y A;  5FJ8 J;  1MW7 A;  3T8R A;  2A07 F;  3V7R A;  1ZYR F;  1O7L A;  4BDZ A;  1TT0 A;  3PNV A;  1I5Z A;  1S72 I;  1MNE A;  1AA7 A;  2JA2 A;  5L3B A;  4PFP A;  1BBY A;  5LRR A;  5EGO A;  3L7W A;  3DLA A;  4HLY A;  3BJO A;  3A02 A;  3GYH X;  3GXO A;  3R4K A;  2H27 A;  2KPM A;  3CMM A;  5E1Z B;  3KP4 A;  3H1C A;  1X2N A;  1ZRE A;  4G7H F;  2EIK H;  3K69 A;  2HTS A;  3H3Z A;  3AL0 B;  1YJW I;  3FXO A;  5HS9 A;  2WV1 A;  2ZNZ A;  2LRE A;  4CGZ A;  4JP0 A;  3CQZ J;  4B8X A;  4D0P A;  5CQE A;  3JRC A;  3KP6 A;  3FXR A;  1IO2 A;  1FEX A;  1PUE E;  4PSX A;  1G6N A;  4EV0 A;  3OIO A;  3WTT C;  4XM3 A;  2HYJ A;  4KN4 X;  5DCM A;  3DEU A;  3OOP A;  1WWX A;  3ZQG A;  3O8G A;  3BT9 A;  2DJN A;  1Z0X A;  1FTZ A;  5HLI A;  1X4O A;  2NP5 A;  2LKS A;  5AQC A;  4HAM A;  2XAJ A;  4E7L A;  2A2F X;  2A68 F;  1BJZ A;  4BE2 A;  4S04 A;  1X1P A;  2XPU A;  3S1R J;  1E0E A;  2VBZ A;  3AG3 H;  1SVL A;  2FML A;  4BKX A;  1WJA A;  4B44 A;  2CQN A;  3CTA A;  3HPH A;  2D2W A;  2NS8 A;  1Z6R A;  3K4J A;  1USS A;  3CJD A;  3CCY A;  2HYF A;  3VOD A;  1OCC H;  4QSH A;  2E1N A;  4JNN A;  2ME0 A;  2EQR A;  1ETK A;  2OBP A;  5ICG A;  2VOP A;  1WHU A;  2BY0 A;  5LEJ A;  2ID6 A;  1BN5 A;  2NS0 A;  5JVT A;  2QQA A;  3ERE D;  2BY1 A;  3VOE A;  4JYK A;  3GUD A;  1JKP C;  1R1U A;  3BTC A;  4PZJ A;  1QBJ A;  5BPI A;  1MMA A;  3RZD J;  2IRF G;  2IA2 A;  1IN8 A;  4NEL A;  3P9T A;  4FET A;  4IVN A;  3SZP A;  1G3S A;  4LIV A;  1R6R A;  4LG0 A;  4ZDO A;  3LA2 A;  3IUV A;  2VE9 A;  1EH6 A;  1VND A;  5DEQ A;  2LKX A;  1UEL B;  1K4T A;  2EH3 A;  3PO3 J;  1QU3 A;  1U6G A;  1QHH D;  1I6H J;  1TT5 B;  1NHA A;  2E60 A;  3F3X A;  4A3B J;  2PBX A;  5TIS C;  1YQA A;  2CUZ A;  3TP0 A;  3LWF A;  3RCO A;  1DUX C;  1F9N A;  3O2P E;  4C9Y A;  1WVR A;  1XCB A;  2DYS H;  1YOV B;  4ZYG A;  5J1Y A;  2HFH A;  1JKQ C;  3CJT B;  4KDP A;  1TBX A;  2Z33 A;  1BOA A;  2IP2 A;  3REO A;  1Z7L A;  3CDI A;  3QPH A;  1A35 A;  3M4O J;  3LSJ A;  1B8I B;  4LG0 B;  5HNF A;  3F8B A;  3RH2 A;  5LGU A;  1Y0N A;  4EGY A;  2YX7 A;  2Z2S B;  2ZME C;  2D1V A;  3TO6 A;  1KYZ A;  5IT9 K;  3SEQ A;  1DDN A;  1MH4 A;  3HIM A;  2X1E A;  5D5W B;  2EV5 A;  2KRC A;  5E20 A;  5IP9 J;  3S1Q J;  2M30 A;  1S3J A;  2NAZ A;  4YFN F;  1RZ4 A;  2CUE A;  1OCR H;  1HDP A;  2PX9 A;  1W0T A;  5E3M A;  1IXS B;  2CW7 A;  4BAY A;  2R7Z J;  3PUB A;  3NNR A;  3RYP A;  4RDU A;  3K1M A;  1LUJ B;  3ECH A;  3L2C A;  2ZJR F;  2EFO A;  4X1E A;  2F5C A;  1V5E A;  2FSW A;  3V7C A;  2Y48 A;  2HZD A;  3ZMT A;  2CRG A;  3ZGK A;  2Y31 A;  2L9N A;  2IVM A;  2PMH A;  3ZOB A;  4DZJ A;  3CCE I;  1A5J A;  2DA5 A;  1ZAO A;  5E3N A;  4IRV A;  1ZKG A;  3LWJ A;  1QNT A;  1UHS A;  2V9V A;  3NXC A;  5HS8 A;  4HQM A;  4U0Y A;  1VQM I;  1J75 A;  3TKY A;  2QCO A;  5F6F A;  3CJR B;  3S2D J;  1ZTR A;  4C2U A;  5IT9 Z;  2L02 A;  2EA4 A;  3ANG A;  2DXI A;  1Z05 A;  3E5U A;  3ZMZ A;  4RGX A;  1U78 A;  2HQ5 A;  3WTW C;  3MQ0 A;  3VVZ A;  4WXH A;  3H35 A;  4F92 B;  4HRI A;  1I39 A;  5EG0 A;  2RV8 A;  3IKT A;  1VQN I;  4HDU A;  3BTJ A;  4BHB A;  3N4M A;  3ZRG A;  4NQW B;  3CUO A;  3H0D A;  1NK3 P;  1LEB A;  5HBU A;  2P6T A;  1EV7 A;  3BOQ A;  1N25 A;  3WE3 A;  2G9W A;  4LK1 F;  3SZT A;  3OYI A;  4NC7 A;  1I6X A;  2YSR A;  5E8I A;  3DCF A;  3AG2 H;  4UB6 C;  2LRD A;  1IRX A;  2KQR A;  5J1U A;  3FZV A;  1UI5 A;  2XUB A;  2CYY A;  3ZMV A;  1ZEL A;  2M7A A;  3IP4 B;  2ZC2 A;  3H9J A;  2Z9O A;  4XLF A;  1R1T A;  1DP7 P;  2R7D A;  3KX2 A;  2EZL A;  2AHQ A;  3JRB A;  1ETO A;  5EG0 B;  3F8C A;  4D9J A;  4OD5 A;  2CU7 A;  2RAE A;  4AWX B;  3VOX A;  2KZG A;  4F7Z A;  2I8D A;  3KFW X;  2VL8 A;  2YVH A;  4KIS A;  2V1D A;  4QPQ A;  2A6T A;  4BH9 A;  2COB A;  3RQ4 A;  3VB2 A;  5FLV A;  4Q5S F;  5D5X B;  2WBM A;  4F52 A;  2F48 A;  2GFN A;  2M4G A;  2XB0 X;  4B4C A;  2NP3 A;  1T08 B;  2PMU A;  3JSP A;  2F6C A;  1ETW A;  5D4R A;  5CVI A;  3OYE A;  4RB0 A;  3B6C A;  2WA0 A;  2PN6 A;  3M1E A;  3SQN A;  4LIT A;  3F21 A;  3KKC A;  5DTD A;  1FTT A;  3V78 A;  3VW1 A;  4LOC A;  3BWG A;  5J3L A;  2IGO A;  1ON1 A;  1CF7 B;  4GDF A;  1ZGA A;  2OCE A;  3GZN B;  2PZ9 A;  1LDD A;  1LPQ A;  1G3W A;  1ZG1 A;  3TED A;  5E79 C;  1R58 A;  3MZH A;  3HHG A;  1GHC A;  3WOD F;  3OS0 A;  1WH7 A;  2LR8 A;  4MXM A;  2HVR A;  1X19 A;  3O3K A;  3PPB A;  1VQ4 I;  2XVC A;  5JFR A;  1OYI A;  1X3Z B;  2OD5 A;  5K7H A;  4FIS A;  2MGQ A;  3ASN H;  4M71 A;  2RC4 A;  4BXU A;  4IHW A;  9ANT A;  1OYW A;  2CUF A;  3IHU A;  2LYC A;  3S3M A;  3VPR A;  4Z6Y A;  5F1J A;  3CJQ B;  5TJJ A;  3TP3 A;  4UB8 C;  2O9L A;  1S7E A;  4IHV A;  3OYA A;  4ESF A;  2O61 A;  3OYJ A;  2QM3 A;  2X9D A;  2HQR A;  5DUK A;  4YEJ A;  1J09 A;  3U21 A;  4YZE A;  2K9L A;  4MTE A;  3FMR A;  3T6N A;  2L7M P;  3DKW A;  2KRF A;  3ON2 A;  2DA4 A;  2WAQ A;  3K4L A;  4UUV A;  1FOK A;  3EPZ A;  3P9C A;  2IJL A;  1GVJ A;  3GF2 A;  2K85 A;  4UVA A;  2ZXW H;  3LA3 A;  1MSF C;  4Y52 J;  2QBY B;  3ABU A;  2ELH A;  2NOG A;  3JSJ A;  2VIX A;  5M5Y J;  1U5T B;  4M3B A;  2DAO A;  3FHN A;  4P5O A;  2XC7 A;  4NB5 A;  1SGM A;  5F04 A;  2LSO A;  3VVX A;  2ZXJ A;  1R49 A;  1XG1 A;  1A6I A;  1OMI A;  4IRH A;  2LK2 A;  4RB1 A;  4L5I A;  1FMW A;  2Q8K A;  4M3G A;  2F5D A;  3LHQ A;  2VI6 A;  4KNY A;  3DLL F;  3JAM K;  3LQQ A;  3MAJ A;  1IZ1 A;  2STW A;  3DF8 A;  1ACI A;  3VOK A;  1T8I A;  4BBR J;  2UV1 A;  3LST A;  2FMY A;  2DMP A;  2DFI A;  3CCR I;  3H36 A;  1BW5 A;  2PJR B;  5CXI A;  2M8G X;  2W48 A;  4BQN A;  2WWY A;  2BY3 A;  1MMS A;  4KUM A;  3BC8 A;  3E97 A;  1ZRF A;  3ABL H;  2B1E A;  3GZ5 A;  3C2H A;  1KGS A;  3CD6 I;  2LC2 A;  5FKM A;  2LTP A;  3PIP F;  2HU9 A;  1MIJ A;  4XRS A;  1ETQ A;  1BC8 C;  4YFX F;  3IKV A;  4BY1 J;  3KP3 A;  4AM3 A;  5KAF C;  1UHM A;  2X6W A;  3UNG C;  3BZ6 A;  3VSK A;  1BI2 A;  3MEX A;  2F2E A;  5FLM J;  1YHQ I;  1MJ9 A;  3GWZ A;  4XRM A;  2CQK A;  2EBI A;  1ZRC A;  1BI0 A;  1K6O A;  1JUS A;  3H9Q A;  2KRH A;  4G7Z F;  1JJ6 C;  3HOZ J;  1NK2 P;  1UJ8 A;  2XAF A;  4EVI A;  4AU7 A;  1KU3 A;  3RIR A;  2E2J J;  1QPM A;  3HRS A;  3L2V A;  3J80 Z;  4A3G J;  1RKT A;  4ZYA A;  3OR1 C;  2QKM B;  3OYK A;  1JHH A;  1DQU A;  2HWV A;  1HA8 A;  4CZC A;  2HTJ A;  4HLX A;  4BQQ A;  1JT0 A;  5FO5 A;  3J7A Y;  4A0X A;  5BNG A;  2COM A;  1FC3 A;  2VXD A;  3H5A A;  3MKL A;  3MZ8 A;  4PK4 A;  3ZQF A;  1X58 A;  3CP8 A;  1R9T J;  1JXS A;  3OS1 A;  2QQ9 A;  2E36 A;  2LG4 A;  5GTH C;  4L0Z B;  3MD2 A;  3S2W A;  3Q5F A;  2ECB A;  3S5R A;  2R7R A;  1BA5 A;  4ICH A;  4LFU A;  3E1S A;  4IKF A;  2CSO A;  2NNN A;  3DEW A;  1S9H A;  4KWA A;  3OIQ A;  3ABM H;  3BR5 A;  4M3F A;  2R0Q C;  1RIO H;  3AQS A;  5E1X A;  3QBM A;  1UG0 A;  4ESJ A;  4ZZD A;  2IU5 A;  3L2R A;  2CMP A;  2L9V A;  1F36 A;  2E35 A;  1XDS A;  3GFI A;  1KU9 A;  3BZK A;  2PFB A;  2ZCX A;  1WGX A;  4XON A;  5ED4 A;  3F6V A;  4M3E A;  4M9Z A;  4KA4 A;  1BR1 A;  2K02 A;  2DI3 A;  2NVU B;  1XSV A;  3GTO J;  4PSW A;  2IAI A;  1JUM A;  2WB1 N;  1XTA A;  3C2B A;  2QEX I;  1KON A;  2ACJ A;  4N9I A;  3SXY A;  4BQA A;  3FM5 A;  3GTM J;  2GXB A;  1DPR A;  4D7N A;  3K8P C;  3GLL A;  2JUC A;  5K7F A;  3CCU I;  4L18 B;  2BYV E;  4XNF A;  3QPL A;  4CXF A;  5K1Y A;  4HW0 A;  3CC7 I;  4FE7 A;  2L4A A;  3BP8 A;  2IBD A;  2ID3 A;  1YE9 A;  2VQC A;  4RGR A;  4EGZ A;  1PP8 F;  5K58 A;  4V2F A;  1ZGW A;  2F5V A;  1KA8 A;  1IRF A;  4IRI A;  5B5E C;  1GXP A;  2JQ7 A;  2R93 J;  5JI6 A;  3H5N A;  2JZY A;  4BEH B;  2QIB A;  4G12 A;  4UY8 I;  4UNO A;  4IZZ A;  1BJA A;  4L0Y B;  1HBX G;  3DP7 A;  2M87 A;  2XAU A;  4LLG F;  2X85 A;  1BR4 A;  3HRT A;  1J59 A;  2Y0S N;  3WE2 A;  2OPT A;  4HQE A;  2ZBK A;  2P7C B;  1Q1V A;  2BXY A;  3DU5 A;  1OCT C;  5HSZ A;  1TWF J;  2PEX A;  3IWZ A;  4YIR X;  1RUO A;  1BR2 A;  1HKQ A;  2RKH A;  1TNS A;  2DLL A;  4UUS A;  1ZGJ A;  3QYE A;  3Q3S A;  3NI7 A;  3HE0 A;  4EAT A;  1IUF A;  2VAS A;  3OSF A;  5HAW A;  3M8F A;  2EIL H;  1IN4 A;  1VQ9 I;  3C1D A;  3LSG A;  4XKC A;  4EEF G;  4CO8 A;  1XGM A;  2XHK A;  1IXR C;  3CC4 I;  2JT1 A;  2QOP A;  3IH2 A;  2DW4 A;  5GAG J;  2QSH X;  3CCQ I;  2FNA A;  3EQL F;  1IN5 A;  2D6Y A;  2ZME B;  1B1B A;  4HZF A;  1GUU A;  5K7Z A;  1OKR A;  2JRM A;  4DYC A;  2Z16 A;  3P5J A;  1Y0U A;  5EEG A;  1P7I A;  5J40 A;  2CFO A;  2WC2 A;  3OOU A;  1SC7 A;  2XDV A;  3CUQ A;  3Q9V A;  4HPQ A;  1YG2 A;  3O6B B;  4C3I J;  3CMY A;  5LHG A;  3ZQC A;  5HDK A;  4AIH A;  2IS1 A;  3T5X A;  3GX4 X;  4IHS A;  1OCP A;  5ERI A;  1HLV A;  4Y7N J;  3JRG A;  1YW9 A;  2DA3 A;  1YS7 A;  3HB9 A;  3NWS A;  2PQ8 A;  1XDU A;  2A61 A;  1BIA A;  2G7H A;  3AFH A;  2BZT A;  3D1N I;  2AQE A;  4LJZ F;  4E7H A;  1YIJ I;  1R5I D;  3QAH A;  2VKH A;  4XKB A;  3F9K A;  3HTA A;  2L7Z A;  3I64 A;  2C6Y A;  3VDX A;  2IT0 A;  3ANP A;  1R7J A;  2V7F A;  2HQN A;  1BL0 A;  2V26 A;  3D0S A;  3FIS A;  1XSD A;  2L0K A;  4CUG A;  2DMU A;  1SFO J;  3VYR B;  2E1O A;  3OSG A;  5DCF A;  5HLT A;  3OYN A;  3A4C A;  4Y33 A;  3HG9 A;  5FKO A;  1XD7 A;  2ZSI B;  2DOA A;  2L3D A;  3E7L A;  4XLA A;  3A0H C;  2K4B A;  5FRO A;  5EJC A;  1XCV A;  4WXD A;  2L01 A;  1D0X A;  4S0H B;  3K2Z A;  4A3L J;  5TRD A;  4DBQ A;  3I4N J;  5D18 A;  1P6R A;  2GA2 A;  3E6M A;  1UST A;  2KKO A;  3QOD A;  4BAC A;  3VIB A;  1AKH B;  2WY7 Q;  3L2Q A;  3COA C;  3QOE A;  3AL0 C;  2DA7 A;  4DBR A;  2Y75 A;  4KFC A;  3CLO A;  3LJL A;  4KT6 A;  5EEA A;  5CLS A;  1BM9 A;  2BY2 A;  1ITY A;  4BXF A;  3EUH C;  3K4B A;  3M3Y J;  4ZTJ A;  2DQR A;  2LBF A;  3PQK A;  5LLQ A;  4EJO A;  5GAH J;  1SD4 A;  1AHD P;  2H6B A;  5FKK A;  2HYG D;  1TL8 A;  3FXJ A;  2J5P A;  4IEJ A;  2VXZ A;  2F5E A;  3KYC B;  3C18 A;  2Y9Y A;  1VFC A;  2H94 A;  5F0C A;  3RI4 A;  1W0U A;  2DK8 A;  4L5J A;  3IH3 A;  3P9K A;  3QQA A;  4ESB A;  5ILU A;  3FK6 A;  2CQX A;  4L9J A;  4O6J A;  1IDZ A;  1SD6 A;  4AYB N;  3OYC A;  5BPD A;  4OAZ A;  2STT A;  2XKP A;  5HDG A;  4I02 A;  4XLE A;  4KIC A;  1LQ1 A;  5D1R A;  4I7H A;  3CZ6 A;  4BY7 J;  3GTG J;  2RRE A;  1IRG A;  4YFK F;  5CXG A;  1ENH A;  1ZR4 A;  3GVA A;  2O7O A;  2IS2 A;  4GCL A;  1VQ6 I;  4GYI A;  3WHC A;  3FBN B;  5D8L B;  3R61 A;  3RJP A;  2NX4 A;  3VUQ A;  2XV4 S;  4XR6 A;  4ZYE A;  1T0F C;  4UV8 A;  3NRG A;  3BG6 A;  4Y13 A;  1FYM A;  3S17 J;  2DT7 B;  3ISP A;  4FAS D;  2F07 A;  2AO9 A;  2K3F A;  3L2W A;  2X0L A;  3QYB A;  4I09 A;  2UXP A;  4BQO A;  2JN6 A;  4IOA F;  3BCB A;  5J8C A;  2O0Y A;  3U1D A;  1WI9 A;  3ZMD A;  4C2M A;  4QTR A;  3HOY J;  1TQM A;  2V4J C;  5GPA A;  1ZH5 A;  3JAM Z;  2DN0 A;  1UI6 A;  2OI8 A;  2XRN A;  2JJ7 A;  2V9K A;  4EM1 A;  3HTI A;  3ZQH A;  2HPI A;  3FK7 A;  2X48 A;  2YU9 J;  2CH0 A;  2CWE A;  3CDH A;  5D5U B;  2DG8 A;  3KZY A;  3V4G A;  2JTV A;  2G7G A;  4MFD A;  4XBF A;  5EDN A;  5M3F J;  3HDD A;  4A3D J;  3E6D A;  2LOO A;  3CDL A;  2M2E A;  3MKY B;  3BPV A;  3KYL A;  3TO9 A;  5FGL A;  1U5T C;  3I3L A;  2OZU A;  2JPC A;  4CYC A;  3TW7 A;  3JSO A;  4KMF A;  2E2I J;  4DJA A;  1MZB A;  2R5Y A;  2IW5 A;  1Y8R B;  2A05 A;  5HLH A;  5M5W J;  2W57 A;  2XF5 A;  2GXG A;  1K78 B;  5FLX K;  2VBY A;  3FBI B;  2UWM A;  2K9M A;  1VZ0 A;  1W36 C;  3CF2 A;  5FB2 A;  2OAZ A;  3BTL A;  3CF5 F;  5DS9 A;  2FOW A;  3S2H J;  2KIM A;  5EF6 A;  2HVS A;  2KFD A;  1OQY A;  2PJP A;  3KLO A;  3U2R A;  3ZPL A;  2GQQ A;  5BOX A;  2ZNY A;  3FKJ A;  4H0E A;  2VON A;  3F22 A;  2V57 A;  1X1C A;  1EKE A;  2UXX A;  3ESW B;  1FIP A;  1X1B A;  4WCG A;  1O3Q A;  5B1A H;  2BHZ A;  2Y0M A;  5CQG A;  3CLQ A;  1FSH A;  4HNT A;  1A6Q A;  2O8X A;  3VYU B;  2VQH A;  2VKE A;  3JRE A;  3E3V A;  1IC8 A;  4A0Z A;  4UVB A;  3K10 A;  5GP9 A;  3U9G A;  2JA7 J;  3HOW J;  3K4C A;  3KIO A;  3S3N A;  1GXQ A;  2VBX A;  2XRO A;  3MZY A;  4JX6 A;  2X1C A;  2E1M B;  2K9Q A;  2RN7 A;  2VPR A;  1F4K A;  1B4A A;  1PVE A;  3LQR A;  3KKD A;  2HPM A;  3BRO A;  1E3H A;  3K70 D;  5EFY A;  5LHI A;  2I5U A;  5HNH A;  4MO7 A;  5E17 F;  1FWZ A;  4CCL A;  4E70 A;  4FTH A;  1H8A C;  4RGS A;  1KQ9 A;  1WJC A;  4FE4 A;  4CYD A;  2DTR A;  1YS6 A;  5IY5 H;  3BR2 A;  3F0C A;  3D5L A;  5ILS A;  2Q24 A;  4G6D A;  2WB1 A;  2LF8 A;  4O5V A;  4OAY A;  3HYI A;  2KLO A;  4E7Z A;  2W82 A;  4X0G A;  2EV6 A;  4ON0 A;  3ELK A;  1YO5 C;  3V8K A;  4OIO F;  4P96 A;  3WU0 A;  2M7B A;  3M8J A;  3FXK A;  1LDJ A;  1GVD A;  1P2F A;  1Y8Q B;  1LE8 B;  2WUI A;  4KYW A;  5H9T A;  1RR8 C;  4LK0 F;  1V5F A;  2FQ3 A;  2FBK A;  2BE5 F;  1JHF A;  2A3S A;  4LG3 A;  4Z2Y A;  4BBS J;  2NXN B;  1FOW A;  4JX4 A;  2GA1 A;  5JR3 A;  1MD0 A;  3HUG A;  4M6X A;  1Q1H A;  5FMP A;  4V2G A;  3B73 A;  1BIB A;  4I01 A;  2JWT A;  3A1Y A;  1OR7 C;  4JOM A;  3IH4 A;  1QVU A;  3SZG A;  4LGW A;  4Y4R A;  1U8R A;  2B3W A;  4ZTF A;  1IN6 A;  3BR6 A;  4UUT A;  4ASN A;  3HOS A;  5A2Q Z;  3FX3 A;  1B6A A;  5BMZ A;  2HDC A;  1T0F A;  1ZRD A;  2ZY9 A;  1LE8 A;  1EH8 A;  1Z91 A;  2HGC A;  1V5G A;  3W2W A;  5D8K B;  5K5O A;  1OYY A;  1JTX A;  4JX5 A;  5C44 J;  3VW0 A;  4II2 A;  4ENK A;  2RQQ A;  2DFE A;  2DOE A;  1JJ8 C;  1B72 A;  2Y9Z A;  5DV5 A;  3PO2 J;  4GCV A;  2LP0 A;  2M45 A;  4BNC A;  2Y0S A;  2K7L A;  3LFU A;  1W5T A;  1ZLK A;  2JA8 J;  3HOT A;  2A69 F;  1X3W B;  1K4S A;  4NNJ A;  5TGT A;  5B66 C;  1V54 H;  3RD3 A;  2KIU A;  2QSG X;  1QZZ A;  4E7S A;  3NQO A;  1Y56 A;  4KJZ A;  4A3F J;  1YX5 A;  1HOM A;  1G59 A;  1JI8 A;  2PBI A;  3TMO A;  1F1Z A;  3F1B A;  4I2O A;  2UXH A;  1IGN A;  5FLX Z;  1IDY A;  1BOB A;  4HEA 2;  3FM3 A;  1AOY A;  4R79 A;  4G6T B;  2G3B A;  3I58 A;  1QGP A;  4DOZ A;  2MW8 A;  2CFX A;  4BE1 A;  1YLF A;  3DEE A;  3OYL A;  4RA2 A;  4D5C A;  4DGW B;  5DM6 F;  5HOD A;  1B8I A;  3DPJ A;  1TW3 A;  4XRF A;  2JMW A;  3HOX J;  2HS5 A;  3L09 A;  1MBJ A;  2MG4 A;  2IPQ X;  1WSU A;  3EUA A;  4A69 C;  3BJ6 A;  1TWG J;  1S8N A;  1V55 H;  2DA6 A;  4HNU A;  1WH5 A;  2QTQ A;  3M1C A;  2ZOY A;  2NOJ B;  3RSN A;  4CCN A;  3DTI A;  4WK8 F;  3K70 C;  2Z5U A;  4EM2 A;  4ZJZ A;  2VC1 A;  3VTI A;  5C3E J;  4ZC3 A;  4M74 A;  5IYD J;  3BR3 A;  1Y6I A;  2CG4 A;  5FD6 A;  4UXN A;  2VJ4 A;  1LB2 A;  2ZFW A;  1YJ9 I;  2W85 A;  4CCM A;  1HC8 A;  2F4M B;  2RVC A;  1X3U A;  2DT5 A;  4ENJ A;  2Z1D A;  4D1Q A;  2GEN A;  2DJI A;  3H5R A;  4GFB A;  1TNT A;  4F55 A;  5IOZ A;  5IP6 A;  3H3V K;  4CDG A;  2HOE A;  2M3A A;  2OUM A;  3C7J A;  4OIN F;  3Q0U A;  3ECO A;  5IYC J;  3LAJ A;  3I4P A;  1JKR C;  2B7E A;  2EZK A;  4O3M A;  5F27 A;  5J4V A;  3GTP J;  4J19 A;  4U0W A;  2RAS A;  2FJ1 A;  4XOT A;  1TTY A;  5LHH A;  2OA4 A;  4PUS A;  3J81 K;  1U8B A;  2OQG A;  2ZKZ A;  4II3 A;  1X1A A;  3HM5 A;  4OMZ A;  4UHT A;  3SFZ A;  2OF7 A;  3SHF A;  2X1D A;  4ENM A;  2LD5 A;  2IEK A;  2K9S A;  1L3L A;  3L2U A;  3HTH A;  3EYY A;  3TOB A;  1WJ5 A;  3WTZ A;  2FBQ A;  4A93 J;  4G94 A;  5GTI C;  2ISZ A;  3FF5 A;  1T39 A;  1I3Q J;  3ZQQ A;  1W5C C;  2XF7 A;  4RM2 A;  1V3F A;  3SFI A;  3CCM I;  4CH7 A;  3CCV I;  2HOT A;  3K0L A;  2XAS A;  4U7D A;  4XID A;  2REK A;  3WGG A;  2R5Y B;  2HI3 A;  2FE3 A;  3SDB A;  2E19 A;  1T56 A;  5AIP A;  4OWR B;  3KET A;  1QHG A;  5ILV A;  3GME A;  4H4K C;  3A0B C;  4AC0 A;  3HOU J;  3AKZ A;  4KIB A;  2D45 A;  3X2Q H;  3GEZ A;  1MKM A;  1O4X A;  2P0W A;  2DMT A;  2KJC A;  3OYF A;  3AQT A;  2NYX A;  4B48 A;  2CV2 A;  3R0J A;  4MTD A;  2CUJ A;  2V1X A;  3OV8 A;  2F4I A;  1JTY A;  5HDN A;  1SFE A;  2LBF B;  1O3T A;  2EWN A;  3HZJ A;  4PXI A;  1FY7 A;  1OJL A;  4N9H A;  1EH7 A;  1HSJ A;  2TDX A;  3FMS A;  1XN7 A;  1MJA A;  1RUN A;  2VBW A;  3I53 A;  2ICW G;  3IAM 2;  4YEL A;  1MNM C;  3S16 J;  1R00 A;  5HOO A;  1V4R A;  2O6G E;  4BUP A;  2R7V A;  3VWB A;  2EIJ H;  4JBA A;  2QZ8 A;  1G8X A;  3K6G A;  3QU3 A;  3JTH A;  2QA4 I;  3G71 I;  1Y1V J;  4WX9 A;  3HPG A;  4Y17 A;  1W5S A;  1Z77 A;  5D6F A;  3JCU C;  3S32 A;  3J7Y J;  2BV6 A;  1UB9 A;  4IF4 A;  2NVX J;  2MH9 A;  3HSF A;  2XIG A;  4HG2 A;  1FLI A;  3IAS 2;  2AS5 F;  1E3O C;  2VOD A;  1LVA A;  2MC4 A;  1UFM A;  4HBL A;  2F4O B;  1K61 A;  1FYK A;  1IG7 A;  4G6Q A;  4Q4Z F;  4QWQ A;  2OC6 A;  3E6B A;  3M07 A;  5JLW A;  3PQJ A;  5JHU A;  2JVH A;  2BHY A;  3HL2 A;  2YS9 A;  1RES A;  2GIZ A;  4RGU A;  4HYE A;  3S3O A;  4X6A J;  4OIQ F;  4C2T A;  4G7O F;  3G4S I;  4IPA A;  4ZDP A;  2GIV A;  2X51 A;  1DP3 A;  3RPU D;  1QZE A;  3K9T A;  2VJ5 A;  1UZC A;  5L3G A;  1OPC A;  5KNL A;  3P9I A;  3N97 A;  1SFU A;  4BXX J;  3E7Q A;  2EIN H;  2BXZ A;  3RZO J;  2CV1 A;  2K5C A;  3HTJ A;  2E1C A;  2LH9 A;  1ORK A;  3L1P A;  1VQ8 I;  2KP6 A;  2QBY A;  2EK5 A;  4WXC A;  2JSC A;  1CQT A;  1LFB A;  2R3S A;  3U1K A;  1PYV A;  3G3Z A;  2FU4 A;  2K40 A;  1U5T A;  2FXA A;  2M1B A;  2DYR H;  3EUK L;  2PLY A;  2ADU A; 
#chains in the Genus database with same CATH homology
 1MH4 A;  1X2M A;  2Y30 A;  1AHD P;  3HIM A;  5FKK A;  5IP9 J;  3S1Q J;  2GM4 A;  4A3J J;  2HXO A;  4IEJ A;  2CUE A;  4CYC B;  1HDP A;  1W0T A;  2FQ4 A;  2Y9Y A;  5E3L A;  5E3M A;  1VFC A;  2R7Z J;  3NNR A;  4A3C J;  4RDU A;  3ZQL A;  5F0C A;  1F43 A;  3BNI A;  1W0U A;  3CWR A;  5JLX A;  3VW2 A;  3IH3 A;  3QQA A;  3ON4 A;  4X1E A;  5IP7 J;  3ZQI A;  4I76 A;  3FK6 A;  2CRG A;  2CQX A;  3GTK J;  3NPI A;  3COL A;  2Y31 A;  2L7F P;  3ZOB A;  1A5J A;  4DZJ A;  1IDZ A;  2GBY A;  4AYB N;  2DA5 A;  3QPS A;  4C3J J;  3HGY A;  5E3N A;  1ZKG A;  3LWJ A;  1UHS A;  3NXC A;  2DMQ A;  5D1R A;  2JA5 J;  1QVT A;  2QCO A;  4AC6 A;  4BY7 J;  3GTG J;  4D5F A;  3GEU A;  5CXG A;  1G2H A;  3S2D J;  1ENH A;  1ZR4 A;  4GCL A;  2O7O A;  2M9H A;  1ZTR A;  2W53 A;  3WHC A;  3EUP A;  3ANG A;  2HKU A;  2NX4 A;  2WAQ N;  3VUQ A;  3IV5 A;  1U78 A;  3BHQ A;  3NRG A;  1TWH J;  2HQ5 A;  5C4X J;  1TC3 C;  4NN1 A;  3S17 J;  1RR7 A;  1EF4 A;  4QIW N;  3VVZ A;  4JL3 A;  2F07 A;  2AO9 A;  5EG0 A;  4UDS A;  3SJM A;  3BTJ A;  2NVQ J;  2UXP A;  2JN6 A;  2XSD C;  1NK3 P;  5HBU A;  2MSY A;  4QTR A;  3HOY J;  4XRS G;  2DG7 A;  5GPA A;  1SAN A;  2DN0 A;  1UI6 A;  2OI8 A;  3PAS A;  3DCF A;  4MLO A;  4DW6 A;  2ZCN A;  3GBG A;  2JJ7 A;  2H1K A;  3HTI A;  5J1U A;  3ZQH A;  1UI5 A;  4A3E J;  3FK7 A;  1POG A;  2X48 A;  2YU9 J;  2DG8 A;  4DYR A;  3S15 J;  2ZCM A;  3Q0V A;  2G7G A;  4MFD A;  5EDN A;  5M3F J;  2QF7 A;  2YVE A;  2EZL A;  3HDD A;  1XC5 A;  2AHQ A;  4A3D J;  3JRB A;  1U9O A;  5DAJ A;  1TWC J;  1ETO A;  2M2E A;  3CDL A;  5EG0 B;  3A01 B;  1HCR A;  5FGL A;  2CU7 A;  5FHP A;  2RAE A;  3VOX A;  4HNV A;  2M34 A;  4CYC A;  3TW7 A;  5IOY A;  1IRZ A;  2YVH A;  2E2I J;  2K9N A;  3G1M A;  2CJJ A;  2R5Y A;  2COB A;  3A03 A;  5M5W J;  2PMZ N;  5FLV A;  3LNQ A;  3KNW A;  2Y2Z A;  2DA1 A;  2GFN A;  3UKG A;  2XB0 X;  4B4C A;  2NP3 A;  5IPA A;  5J1R A;  1FJL A;  2DMN A;  1ETW A;  2FX0 A;  2ME6 A;  2OER A;  3G1O A;  3B6C A;  3JRA A;  3BTL A;  5DS9 A;  1MBH A;  3NAU A;  3GTQ J;  3S2H J;  1GT0 C;  5DTD A;  1FTT A;  3KKC A;  3V78 A;  4LOC A;  3VW1 A;  5J3L A;  5EF6 A;  3JRI A;  2CQQ A;  2EZI A;  3Q0W A;  2GLO A;  3A01 A;  2VUM J;  4HKU A;  2PZ9 A;  2I10 A;  3TED A;  3BCG A;  5D19 A;  3EGQ A;  4RBO A;  2V57 A;  1YRN A;  1FIP A;  1RKW A;  1WH7 A;  2LR8 A;  4MXM A;  3S1M J;  2XPV A;  3PPB A;  2H8R A;  3GTJ J;  3JR9 A;  2E2H J;  1WCM J;  5K7H A;  4FIS A;  2VKE A;  3JRE A;  2MGQ A;  1ZQ3 P;  1IC8 A;  4IHW A;  9ANT A;  2XDN A;  3BR0 A;  5GP9 A;  2JA7 J;  2CUF A;  4MFE A;  3HOW J;  2ZOZ A;  4GCT A;  3VPR A;  5F1J A;  3TP3 A;  3HEF A;  4JX6 A;  1S7E A;  2O9L A;  2K9Q A;  2VPR A;  3HKZ N;  4IHV A;  3BRU A;  2X9D A;  3KKD A;  1B72 B;  3SDG A;  5EZG A;  1H89 C;  3VP5 A;  1ZR2 A;  4YZE A;  5EFY A;  2G0E A;  3T6N A;  2L7M P;  2LFB A;  3ON2 A;  2DA4 A;  3S1N J;  4MO7 A;  1JT6 A;  4FTH A;  1H8A C;  4FE4 A;  3HGG A;  1MSF C;  3HBL A;  4Y52 J;  2NVT J;  3BR2 A;  3F0C A;  2Q24 A;  1LFU P;  2LLK A;  1JGG A;  1ETX A;  2NOG A;  4AUX A;  3JSJ A;  5F0H A;  1JUP A;  5M5Y J;  4M3B A;  3HOV J;  1SGM A;  5F04 A;  3VVX A;  1XG1 A;  4D7M A;  1A6I A;  5M5X J;  2LK2 A;  1HDD C;  1XS9 A;  4M3G A;  1OFC X;  2VI6 A;  3LHQ A;  2NS7 A;  2GUH A;  2LVS A;  3VOK A;  1GVD A;  2ZB9 A;  4W1U A;  4BBR J;  1BW6 A;  2DMP A;  1LE8 B;  4C2M J;  3W6V A;  1BW5 A;  2WUI A;  2M8G X;  2W48 A;  5CXI A;  5H9T A;  2ECC A;  4BBS J;  4JX4 A;  4XIC A;  2EZH A;  5FKN A;  3WHB A;  1IJW C;  4JKZ A;  3C07 A;  5FKM A;  2LTP A;  1MBF A;  5FMP A;  5FKL A;  4V2G A;  4XRS A;  1ETQ A;  2YUS A;  2JWT A;  4BY1 J;  3IH4 A;  1MBE A;  1QVU A;  3NAR A;  3JRF A;  2TRT A;  3BQZ A;  5EZH A;  2B63 J;  5IYB J;  1PUF B;  3BR6 A;  2M0C A;  4UUT A;  3GTL J;  1I50 J;  5FLM J;  3FKI J;  4C3H J;  3MNL A;  4L5E A;  4XRM A;  2EBI A;  4AF5 A;  1LE8 A;  2QWT A;  1WI3 A;  5C4J J;  1JUS A;  3HOZ J;  1JJ6 C;  2HOS A;  3VVY A;  1NK2 P;  1U9N A;  1JTX A;  4GFL A;  5C4Y A;  2E2J J;  4JX5 A;  5C44 J;  4A3G J;  3MN2 A;  3VW0 A;  2X6O A;  2UXI A;  1RKT A;  4UUS B;  1GV5 A;  4ME9 A;  1MSE C;  1JJ8 C;  1B72 A;  3PM1 A;  2Y9Z A;  3PO2 J;  1K83 J;  2DTZ A;  2LP0 A;  2D5V A;  1JT0 A;  3V6G A;  3FIW A;  2JA8 J;  3BG9 A;  5BNG A;  4CGR A;  3ZQF A;  3MKL A;  1R9T J;  1X58 A;  5EGO B;  4A3I J;  3RD3 A;  4M3D A;  3LOC A;  1GV2 A;  4A3F J;  1RPW A;  2N8G A;  1HOM A;  4XK4 A;  2ECB A;  3F1B A;  3S5R A;  1BA5 A;  2UXH A;  4ICH A;  1IGN A;  3MVP A;  1IDY A;  3TW6 A;  3DEW A;  4B1R A;  3KZ9 A;  4KWA A;  2G3B A;  2XGD A;  4M3F A;  2MW8 A;  3BR5 A;  2JA6 J;  2R92 J;  2R0Q C;  3FRQ A;  3AQS A;  4D5C A;  3I4M J;  1FIA A;  3CRJ A;  5HOD A;  3QBM A;  1B8I A;  3DPJ A;  3JRD A;  3G56 A;  2IU5 A;  2JMW A;  2P81 A;  1F36 A;  2LY9 A;  5E3O A;  3HOX J;  4ABZ A;  1VI0 A;  4MK6 A;  1MBJ A;  2MG4 A;  2NVY J;  2ZCX A;  1WGX A;  2G7S A;  4A69 C;  1TWG J;  4IHX A;  4FCY A;  4M3E A;  1UG2 A;  3RKQ A;  2DA6 A;  3BG5 A;  4NDL A;  4B3A A;  1WH5 A;  2G7L A;  2QTQ A;  2ZOY A;  3GTO J;  4ACI A;  2O8K A;  2IAI A;  2XRL A;  2HOA A;  1JUM A;  1MBK A;  2WB1 N;  5C3E J;  1P7J A;  2KT0 A;  3C2B A;  1IV6 A;  5IYD J;  3BR3 A;  3LSR A;  1AU7 A;  3LSP A;  3GTM J;  1PUF A;  4D7N A;  3G7R A;  1APL C;  5K7F A;  4MIM A;  2GEN A;  3O60 A;  1QPI A;  1ETY A;  1T33 A;  3BTI A;  2DA2 A;  3QPL A;  1GDT A;  4GFB A;  4A3K J;  5IOZ A;  5EYR A;  4FE7 A;  5IP6 A;  2IBD A;  3H3V K;  2ID3 A;  3H0G J;  4DZP A;  5K58 A;  4V2F A;  2XPW A;  1ZGW A;  1ZK8 A;  3JRH A;  3QKX A;  2VKV A;  3Q0U A;  1MH3 A;  5IYC J;  3S14 J;  2HYT A;  3B6A A;  1JKR C;  1D5Y A;  2EZK A;  2L9R A;  5F27 A;  3GTP J;  4J19 A;  2R5Z A;  2R93 J;  2RAS A;  2FJ1 A;  4M6V A;  1U8B A;  2QIB A;  4G12 A;  3B81 A;  3G1L A;  1AKH A;  3HM5 A;  2UXU A;  2OF7 A;  3K2A A;  1HF0 A;  4L62 A;  1YRN B;  2LD5 A;  2IEK A;  1TWA J;  2K9S A;  5FJ8 J;  1UMQ A;  3HTH A;  2HXI A;  2Y0S N;  2FBQ A;  2OPT A;  4A93 J;  1Q1V A;  1OCT C;  1I3Q J;  1Y1W J;  5HSZ A;  1TWF J;  3SFI A;  2HOT A;  5EGO A;  2XGE A;  4XID A;  3A02 A;  4DYQ A;  2REK A;  2R5Y B;  2HI3 A;  2JK3 A;  4GCK A;  2E19 A;  1T56 A;  3RQI A;  4UUS A;  3Q3S A;  2R5Z B;  2HDD A;  2O7T A;  3HE0 A;  3NI7 A;  1IUF A;  4AC0 A;  1X2N A;  3HOU J;  3OSF A;  5HAW A;  2ELK A;  3LSG A;  4EEF G;  4A3M J;  1O4X A;  2DMT A;  3AQT A;  2WV1 A;  2QOP A;  4JP0 A;  3IH2 A;  3CQZ J;  1QRY A;  3JRC A;  5CW8 A;  1RET A;  2D6Y A;  2FD5 A;  4PXI A;  1JTY A;  1FEX A;  1GUU A;  5K7Z A;  1DU0 A;  2QKO A;  1OJL A;  3OIO A;  4W97 A;  4DYC A;  4GFK A;  2HYJ A;  3O8H A;  3ZQG A;  3O8G A;  1P7I A;  1WPK A;  2DJN A;  3BT9 A;  1Z0X A;  3OOU A;  1FTZ A;  1MNM C;  3BG3 A;  3S16 J;  2NP5 A;  5AQC A;  4C3I J;  2TCT A;  3CMY A;  3ZQC A;  1BJZ A;  2RHA A;  3S1R J;  2XPU A;  3BJB A;  4BKX A;  1OCP A;  1HLV A;  1MBG A;  4Y7N J;  1NTC A;  1Y1V J;  2NS8 A;  2DA3 A;  3HB9 A;  3JRG A;  1H88 C;  1DU6 A;  3CCY A;  3CJD A;  1Z77 A;  4QSH A;  4JNN A;  2ME0 A;  2EQR A;  1ETK A;  4I6Z A;  2NVX J;  3D1N I;  1VF9 A;  2ID6 A;  1E3O C;  2UXO A;  5M3M J;  5F0F A;  1K61 A;  4JYK A;  1IG7 A;  3HTA A;  2L7Z A;  1JKP C;  3BTC A;  3RZD J;  5JLW A;  3ANP A;  4NEL A;  2XGC A;  3P9T A;  1BL0 A;  3FIS A;  2YS9 A;  1RES A;  2L0K A;  2DMU A;  1SFO J;  3OSG A;  2E1O A;  3IUV A;  5F08 A;  3BR1 A;  3K7A J;  4X6A J;  1VND A;  5FKO A;  2LKX A;  2EH3 A;  3E7L A;  3PO3 J;  1I6H J;  4A3B J;  2PBX A;  4S0H B;  4A3L J;  3I4N J;  5D18 A;  2XB5 A;  3TP0 A;  4BXX J;  3E7Q A;  5J1Y A;  3VIB A;  1JKQ C;  3RZO J;  1AKH B;  1JKO C;  1ETV A;  3HTJ A;  2DA7 A;  3LJL A;  4IHY A;  3BQY A;  1ORK A;  5EEA A;  3L1P A;  2KDZ A;  3M4O J;  2WGB A;  5GPC A;  3LSJ A;  1B8I B;  1CQT A;  1ITY A;  1LFB A;  3RH2 A;  3M3Y J;  2K40 A;  3GZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...