1QVUA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvuA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvuA02
2Y31A 2HOTA 1H89C 3VIBA 4MO7A 1BW6A 1VI0A 4M3FA 3VW2A 5C3EJ 1UMQA 1JKRC 5FKOA 1MBGA 2Y0SN 3O8GA 2GENA 2LY9A 3O60A 3HOYJ 4W97A 1P7IA 1NK3P 1TWAJ 3BR5A 4BXXJ 2OERA 3E7QA 1ZKGA 3S16J 3A01B 5FKLA 2MG4A 1IUFA 3ANPA 1QRYA 2QF7A 4IHYA 1A5JA 3HTIA 5IYCJ 1YRNA 2QKOA 5D18A 3KKCA 3BRUA 2GFNA 3NXCA 5M5YJ 2L7FP 4DZJA 2GUHA 1LE8B 2AHQA 2WAQN 2K9SA 2JA6J 3S14J 2IAIA 3NAUA 2ZOYA 4JP0A 2W48A 2XB0X 3SFIA 1RKTA 5IP9J 1IV6A 2G0EA 2WB1N 2JN6A 3FIWA 4DYCA 1TC3C 2ZOZA 1O4XA 4M3BA 2F07A 1ZGWA 3BG5A 1MBFA 2COBA 2ID6A 1RKWA 1K61A 4A3GJ 3ON4A 5J1RA 1VF9A 2HYJA 2NVTJ 4A69C 3A03A 3CRJA 3EGQA 3GZIA 1RR7A 5DTDA 1I6HJ 3NPIA 3FKIJ 3LSRA 1FTZA 3KKDA 4B3AA 2VUMJ 1QVUA 3HBLA 5EEAA 3B81A 3TEDA 3NNRA 2DA7A 1PUFB 1TWGJ 4IHWA 1RPWA 3Q0UA 3NRGA 5FKKA 3BR3A 3ON2A 3BCGA 4GCTA 3CCYA 3MKLA 3SJMA 3S1MJ 2WV1A 3O8HA 4FE7A 2D5VA 2E2JJ 3S2DJ 2RAEA 2E2IJ 2V57A 3VP5A 4ACIA 2TCTA 5FJ8J 5GPAA 3FISA 1E3OC 3VPRA 3LSPA 2JWTA 2ID3A 3BTJA 1ORKA 3IH4A 1U8BA 3HOZJ 3I4NJ 4GFKA 5EFYA 3E7LA 2JA8J 3ZQFA 4V2FA 2VKVA 1MBEA 2UXPA 4X6AJ 2QIBA 5F1JA 3ANGA 4A3DJ 2R5ZA 2W53A 4UDSA 5CXGA 2DA1A 1UG2A 3GTMJ 3Q3SA 1MNMC 4BBSJ 3HEFA 5IOZA 3CWRA 1ZQ3P 3TP3A 4A3JJ 5HAWA 1UHSA 1FEXA 2HOAA 1HDDC 5J1YA 4GCKA 4A3FJ 4M3GA 1U78A 3VVXA 1Q1VA 3JRFA 4JYKA 5EG0A 3QPSA 2XGDA 5FKMA 1ZTRA 1WPKA 4DZPA 1EF4A 2Y30A 1AU7A 2KT0A 3C07A 4QSHA 1IRZA 5EGOB 2HQ5A 3LNQA 2JA5J 4Y7NJ 5GP9A 1I3QJ 2LFBA 2YS9A 4UUTA 2DMPA 2X6OA 3OSFA 3OIOA 1HLVA 1SANA 4C3JJ 2R93J 3HOVJ 1UI5A 1RESA 3HB9A 5JLXA 1BW5A 1F43A 2VPRA 3BNIA 4FTHA 5EYRA 4JNNA 2DN0A 2ELKA 5FLMJ 3VW0A 1IG7A 5C4YA 4XICA 4UUSB 4D7NA 1AKHA 5E3MA 1CQTA 2UXIA 2GLOA 5F27A 2O8KA 4YZEA 4HKUA 1LFBA 3BG3A 4AC0A 2LK2A 3BR1A 3FK7A 5EZGA 2UXUA 4A3KJ 3S1QJ 2Y9ZA 4NN1A 1T56A 3BQZA 2RHAA 3JRBA 1WI3A 1ETKA 2TRTA 2CQQA 3VOXA 1UI6A 1B8IB 3C2BA 2PBXA 1XG1A 3S15J 1XC5A 4FE4A 4B1RA 3AQSA 1G2HA 5FKNA 4BY7J 2DMQA 2O7OA 4EEFG 3FK6A 1WH7A 2QCOA 1ETWA 1R9TJ 2WUIA 3QBMA 3V6GA 2K40A 5C44J 2NVQJ 4V2GA 1BJZA 1OJLA 3IH2A 3LJLA 1H8AC 3BT9A 2H1KA 2E1OA 2HKUA 4DW6A 4JKZA 3RD3A 3P9TA 3QKXA 4MLOA 5IPAA 1SGMA 2NX4A 3KZ9A 2EH3A 2XSDC 3BQYA 1GVDA 1LFUP 3DEWA 1IJWC 2DMUA 3SDGA 1JKOC 2WGBA 1GT0C 3GTQJ 4AUXA 2CU7A 5F08A 4MIMA 2DMNA 2P81A 3EUPA 2JMWA 2FX0A 5EF6A 4IEJA 2M2EA 3ZQLA 2R5YA 2X48A 1P7JA 3G1OA 4Y52J 4GCLA 1BL0A 4A3IJ 3VW1A 5FMPA 1SFOJ 1S7EA 3IH3A 4UUSA 5IYDJ 3AQTA 5EDNA 3JSJA 1APLC 4M3EA 4A3LJ 3LSGA 3BR6A 2L9RA 9ANTA 4A93J 3LWJA 3H3VK 3MN2A 3S1NJ 3ZOBA 2MSYA 2OI8A 4X1EA 5CXIA 5D19A 4D7MA 1FTTA 3HE0A 2MW8A 1K83J 3MVPA 1B72B 4D5CA 4DYRA 1IC8A 1U9NA 2UXHA 3CMYA 2FD5A 4A3BJ 4MXMA 3LSJA 2HYTA 2XDNA 5F0FA 2YUSA 1GV2A 2REKA 2I10A 4G12A 3TW6A 4CYCB 4MK6A 1H88C 5HSZA 5AQCA 3A01A 1JTXA 4MFDA 3BTCA 1ZR2A 2XB5A 3CJDA 1BA5A 5M3MJ 2CUEA 1GUUA 3JRGA 1W0TA 1MSFC 1JKPC 5F0CA 2NVYJ 3S5RA 1LE8A 4C2MJ 2LLKA 2YVHA 2JA7J 3JRCA 2IBDA 2XGCA 3D1NI 5M3FJ 5FLVA 2RASA 4GFLA 2EZHA 2FQ4A 4RBOA 1VNDA 3HKZN 4ICHA 2E19A 1WGXA 2OF7A 3GTJJ 5M5WJ 5DS9A 2CRGA 3GTPJ 5K7HA 4L5EA 1JJ8C 1I50J 3JRIA 3BR2A 1XS9A 1JT0A 4XK4A 2M0CA 3ZQGA 2O9LA 4GFBA 1ITYA 1D5YA 2HI3A 3COLA 2LVSA 2YU9J 4JX5A 3PPBA 2L7ZA 4JL3A 1PUFA 1YRNB 2PMZN 5FHPA 2D6YA 1ZR4A 1GV5A 3T6NA 3RZOJ 2UXOA 1JUSA 2DG7A 2QWTA 5DAJA 3F1BA 4XRSG 1RETA 3TW7A 1HCRA 5EZHA 3B6CA 5IYBJ 3FRQA 4IHVA 2LD5A 1FIPA 1MH3A 5K7FA 1FJLA 2L0KA 2ME6A 2R7ZJ 3S1RJ 1ETXA 1JGGA 1VFCA 3VUQA 3JRHA 2H8RA 3HOXJ 4NELA 5FGLA 4HNVA 1MBJA 3PO2J 2ZCMA 3NI7A 3HDDA 5GPCA 4D5FA 4C3IJ 3RH2A 4DYQA 3MNLA 1OCPA 3I4MJ 3S2HJ 3IUVA 3HTHA 2GM4A 4BY1J 3QQAA 5HODA 1OFCX 2HXIA 2OPTA 3HGYA 2E2HJ 2R92J 3F0CA 5CW8A 3CQZJ 3GTGJ 5IP6A 1HDPA 2NS7A 2G7SA 5E3NA 4BBRJ 3B6AA 2ZB9A 2DA6A 3W6VA 4XIDA 5EGOA 4L62A 4FCYA 2X9DA 4ABZA 1W0UA 2R5ZB 2DA4A 3BHQA 5J1UA 2G3BA 2VI6A 2AO9A 2ZCXA 4I76A 3HOUJ 1Z0XA 2ZCNA 1Z77A 3DPJA 4ME9A 3CDLA 2VKEA 4W1UA 4QTRA 3JRDA 2JJ7A 3LHQA 2YVEA 3OSGA 3PM1A 1FIAA 4FISA 2JK3A 2Y2ZA 2IEKA 3PO3J 2XRLA 5EG0B 2LP0A 4B4CA 3BR0A 1ETQA 1IGNA 3RQIA 2PZ9A 3DCFA 1MH4A 3BJBA 2G7GA 3VVZA 2ECCA 3BTIA 3OOUA 3UKGA 2XGEA 5M5XJ 2LR8A 1TWFJ 2KDZA 4AYBN 2EQRA 2QOPA 2R0QC 1ETVA 3KNWA 4J19A 2DG8A 2NP5A 1ETYA 5HBUA 1U9OA 3K2AA 2CQXA 3G1LA 1IDYA 2XPVA 2DA5A 1JUPA 3GTKJ 2LTPA 3V78A 1B8IA 1JJ6C 1QVTA 5E3LA 3IV5A 1HF0A 5J3LA 5E3OA 2NVXJ 2FJ1A 1MSEC 4PXIA 1WCMJ 5IOYA 3Q0VA 5D1RA 2CJJA 3G7RA 3ZQCA 5H9TA 2NOGA 4M6VA 4A3MJ 2EZLA 4XRMA 2ECBA 3GBGA 1AKHB 1X2MA 5F0HA 4QIWN 3L1PA 2MGQA 3JR9A 2NP3A 2K9QA 1POGA 3JRAA 3VOKA 3H0GJ 3VVYA 2DTZA 1T33A 2XPUA 2LKXA 3M4OJ 3A02A 3ZQIA 1ZK8A 3ZQHA 2HXOA 3RKQA 4M3DA 2EBIA 4A3CJ 1JTYA 3WHBA 4NDLA 1A6IA 1AHDP 1F36A 1ETOA 3HIMA 2XPWA 3HTAA 2NS8A 5BNGA 3M3YJ 3JREA 3K7AJ 2M8GX 3G56A 1QPIA 3GEUA 2ME0A 2G7LA 1NK2P 4MFEA 2FBQA 2IU5A 5K58A 4I6ZA 3HGGA 1NTCA 4JX6A 4AF5A 4LOCA 1Y1VJ 4A3EJ 1Y1WJ 1WH5A 3BTLA 3HOWJ 3NARA 5K7ZA 1HOMA 3QPLA 1DU0A 2O7TA 3S17J 1B72A 3RZDJ 2CUFA 3GTLJ 4XRSA 2N8GA 4KWAA 4CGRA 3Q0WA 1TWHJ 2DA3A 1X58A 3WHCA 5C4XJ 5C4JJ 2Q24A 1MBKA 3G1MA 2GBYA 1MBHA 2DA2A 4CYCA 5F04A 2HDDA 2R5YB 2B63J 1DU6A 2QTQA 1TWCJ 5JLWA 1JUMA 4JX4A 3GTOJ 3BG9A 1JT6A 1OCTC 2EZIA 1X2NA 5IP7J 3HM5A 4S0HB 4BKXA 4RDUA 1IDZA 3PASA 2EZKA 2M34A 1ENHA 4AC6A 2M9HA 3TP0A 2L7MP 4C3HJ 2K9NA 2HOSA 3LOCA 3HTJA 2DJNA 2Y9YA 4IHXA 2DMTA 1GDTA 1JKQC
chains in the Genus database with same CATH superfamily
2XUBA 3DEEA 3MQ0A 3QODA 1VI0A 2HTSA 2OC6A 1WZ2A 1UMQA 1B4AA 2NYXA 1XGSA 3I59A 4NUBA 5GTIC 1R23A 3QP6A 1BN5A 4FT8A 1R6RA 2OBPA 1IN7A 1XGNA 2YX4A 4LK1F 2FRHA 3HOYJ 3E7QA 1ZKGA 3S16J 1KQ9A 1S9HA 2EWNA 1WKMA 1W36D 4NHJA 2LY2A 3GEZA 2QF7A 4RM2A 1Z7UA 3KP5A 2DU9A 1A5JA 2KKOA 1YRNA 2QKOA 3DTIA 2GUHA 2K9MA 1O7LA 2DDBA 5E17F 4ON0A 2QSHX 3M9AA 3FHNA 2H09A 2VOOA 3LAJA 2ZOYA 2E1MB 2W48A 2F5FA 2RNGA 2V26A 1RKTA 4G94A 2RREA 4LJZF 2WB1N 2ZOZA 3FIWA 3G3ZA 4HV5A 3MKWB 2F07A 2ADUA 3BG5A 2ID6A 1RKWA 1K61A 3LSTA 2MLGA 5HVQC 1DPUA 5J1RA 1VF9A 4YEJA 3F22A 2XF7A 2L3DA 1WI9A 3CMEI 1ERDA 3LSRA 3CC7I 4B3AA 3ZXSA 4AIKA 3CJQB 3B81A 3NNRA 4OU0A 1IRXA 1PUFB 4A0YA 1RPWA 2WBMA 2QENA 5J40A 5D8KB 3RSNA 5B5EC 1FYLA 1WQ2A 4U7BA 1XD7A 4HNUA 3S1MJ 3I5UA 3O8HA 4FE7A 2D5VA 2QZ8A 1IXRC 4ACIA 2VXZA 2F4OB 3ONQA 5FO5A 5TRDA 4CO8A 3K4CA 3LSPA 4EGYA 2ID3A 3BTJA 1ORKA 5KHDA 1E3OC 3HOZJ 1PJRA 5HLHA 1SD7A 2PQ8A 1KONA 1TQIA 4RB1A 4G7ZF 3W2VA 4GYIA 1WJFA 1T0FC 3HSEA 3DEUA 3ZN1A 3G73A 2O8XA 1W5CC 3SWHA 2HS5A 1EA3A 2FBHA 2W53A 2JZYA 3IWFA 2P8TA 2UZKA 5CXGA 2KL4A 3PUBA 3Q3SA 1MNMC 4BBSJ 5IOZA 1P9QC 4KITB 5F1RA 3CO7C 3CCQI 1ZQ3P 1HA8A 4KICA 1DGRM 4BYYA 2B3WA 5H2FC 2JSCA 3OMYA 4ZC3A 1LB2A 4M3GA 2ETHA 3VVXA 5CQGA 3JRFA 4HX7A 1Z21A 1MDMB 3VTIA 2A6TA 3CZ6A 1X4PA 5FKMA 2E1MC 4PJNA 5D4SA 2Y30A 2K5CA 1AU7A 2HZDA 2KT0A 3EDPA 3HKZA 1SFEA 5EGOB 2MABA 1GXQA 2X6OA 3H9JA 3L00A 2BYVE 1SANA 4ZTJA 2G9WA 3K1NA 2M30A 2R7OA 4PZJA 2R93J 2BOLA 2LBFA 2Q0OA 3VODA 5JLXA 2VPRA 2V79A 3WE3A 2ELKA 2JRTA 4ENKA 1IG7A 4XICA 4D7NA 4ZYDA 2UXIA 2GLOA 5F27A 1BIBA 1U0JA 4F3QA 1KYWA 4ETSA 1YJ9I 2O8KA 5JFRA 4YZEA 3S8PA 4AC0A 2X51A 1D1BA 2IW5A 1X19A 2UXNA 1BI2A 1IN6A 3FXRA 2ZMEA 3L2WA 4A3KJ 2QGUA 1YYVA 2Y9ZA 2RHAA 1KA8A 1BBYA 4Q48A 2QQAA 4XORA 4EJWA 1R71A 1XB4A 1ETKA 2O61A 2CQQA 3VOXA 1UI6A 4YIIA 2L54A 3VOEA 3E5XA 2QSFX 5ERIA 3CF2A 5DUIA 4O6JA 1G2HA 4OIPF 2NAZA 2DMQA 2O7OA 3KLNA 4P1WA 3TOAA 4BJ5C 4I09A 1MDMA 1OJLA 3IH2A 4XKVA 1OR7C 2LG4A 2KFDA 2NRAC 4II3A 4MLOA 2QQBA 1SGMA 3CCMI 2RC4A 1A36A 4PDKA 1X1BA 4MQ9F 1TL8A 2Y48A 5LRSA 1DPRA 1XCBA 1K4TA 1JKOC 3R0JA 4M73A 3L2RA 3IRQA 3PIOF 4BL0B 4XLCA 1XMXA 1R49A 2JMWA 2FX0A 2MD0A 3ZMVA 1HBXG 4B09A 2L02A 1P7JA 4CYDA 4ANJA 3TL4X 3VW1A 2DO7A 2M4GA 1S7EA 3LA2A 2M7BA 3MZHA 5IYDJ 3KZYA 5EDNA 2EIMH 1APLC 3L09A 3BR6A 3NWSA 3GCMA 9ANTA 1KU2A 1WWXA 4EQQA 2HOEA 1XGOA 4UB6C 2Z99A 2DOFA 3EUHC 4OMZA 4D9JA 2GXBA 2OI8A 2EB7A 3I56I 1K83J 3CMYA 4O5VA 3BJAA 2V1NA 3C1DA 3SZTA 4YIFA 2YUSA 4X0GA 5JVTA 5KVRA 4AYBA 4G12A 4XSXF 3TW6A 3WTTC 3LAPA 1W7PB 4MFDA 4UV8A 1YW9A 1MNEA 3BTCA 3RPUA 3KEOA 4WX9A 4RAGA 3GZNB 1U5TB 5M3MJ 2CUEA 1GLNA 1DUXC 4Y33A 5K5QA 3WE2A 2K27A 1JKPC 4F93B 1O3QA 2DJIA 4H4KC 4YFKF 3G2BA 4A5MA 2LLKA 2IXSA 4BGDA 3J7AY 2HGCA 4PJMA 3KIOA 4RGRA 3TMOA 2DQLA 2E36A 4B43A 2A6EF 1YS6A 3GTJJ 1ON2A 2RN7A 3ECOA 4FQGA 5LBQA 3OYLA 5K7HA 3WU1B 3ABMH 3BR2A 5HLGA 2CSOA 1JT0A 1R36A 2A2FX 3ZQGA 2O9LA 2MYSA 1ITYA 1D5YA 2ZJQF 2LVSA 4JL3A 1X1DA 4G6DA 1P4AA 1P4XA 3VSLA 2PMZN 3OL3A 3L2QA 2BW3A 3LFUA 1ZR4A 1LEAA 2P5LC 2QWTA 3JSPA 4QPOA 3I53A 4BHBA 4WWCA 4XLNF 3R6SA 1V54H 1Q1HA 3PNVA 5BPDA 1ZH5A 4IHVA 1FIPA 1TBXA 1MH3A 4GCVA 3HRUA 2JT1A 3HYIA 1HQCA 2NNYA 5H6QA 4WIBA 4UY8I 4A5NA 2IGNA 2VC0A 2JPCA 5KK1A 3FDYA 2AXTC 2EJRA 4L9JA 4PCQA 2RNJA 4LGWA 3JRHA 2H8RA 3HOXJ 4BQNA 5AIQA 4IKFA 5FGLA 1MBJA 2X6XA 1U5TC 5CVUA 2ZY9A 2XSJC 5HLIA 3HDDA 3QRFF 3MMYB 3PSFA 4DYQA 4OAYA 2ZXWH 1BR4A 3V8JA 1JHFA 3SQNA 3KX2A 4S04A 4WCGA 4BXFA 3L2VA 3N97A 2X4HA 1RRJA 2F6CA 4KNYA 5B3SH 4Y15A 3WGIA 4BY1J 3S3OA 2OPTA 2R92J 3PNTA 1KU3A 3HOTA 2L4AA 4RGXA 5E3NA 3B6AA 3LA3A 4L18B 2ZB9A 1P4WA 4ZZLA 3W6VA 2D1VA 3ML6A 2XKOA 3KP4A 1A04A 3HRMA 1IF1A 3L7WA 2DCEA 1W5TA 4PJ0C 2R5ZB 2DI3A 2KJCA 5J1UA 4BNCA 2ZCXA 5ILVA 4RM3A 2HTJA 2Y69H 1Y8RB 3JRDA 1DP7P 2JJ7A 3PM1A 4I98B 5TJJA 1LVKA 5K1YA 4KJZA 1ZLKA 5EG0B 2IP2A 2Z5UA 1MW7A 1Y8QB 4FASD 3W3CA 4B4CA 4MK6A 3RQIA 3DCFA 3UKGA 2XGEA 2LR8A 3FMSA 1IRGA 3WTZA 2EQRA 5AIPA 4CXFA 2HKXA 4J19A 2KP6A 2TDXA 2IRFG 1U9OA 3G1LA 1IN5A 2DA5A 1YX5A 1K78B 5HS8A 3MKYB 3HSFA 1FX7A 3SEQA 1QVTA 2MFZA 3DKWA 3M1EA 2UUZA 4BEHB 4XLHA 2KZGA 2PX9A 4CA0A 3Q0VA 3G7RA 3ZQCA 1FP1D 5H9TA 3F21A 2EZLA 4XRMA 3BZCA 2DBBA 2PMHA 3JR9A 2M5WA 2KIMA 4E6KG 2P4WA 2GXGA 4XOTA 2E34A 1MMDA 2KJBA 1N77A 2HVRA 5CPRB 4ZH4F 1BR2A 1LJ9A 2COMA 2LF7A 3L2CA 2NS0A 3D5RC 5L3CA 3ZMSA 3M4OJ 2GAUA 2QQ9A 4HDUA 1XSXA 3ZQIA 3ZQHA 2HXOA 5LGNA 5D5WB 2EBIA 1JTYA 3WHBA 3AKZA 1FYKA 1A6IA 1R58A 1OLTA 3WODF 1GXPA 3HTAA 1WJDA 2HQRA 5DCFA 2ZXHA 2XAFA 3M3YJ 2VC1A 2QBYB 3G56A 4LG0B 4Y17A 3TDUC 2E7WA 3P9IA 3REOA 4ASNA 3SFZA 1Y0NA 1ONVA 4LG3A 1MD0A 1BI1A 3TO7A 4XQFA 2IU5A 3CC4I 5K58A 4F92B 4E7JA 3J7YJ 3OYFA 5A2QK 1IN8A 4RB0A 4LOCA 1Y1VJ 2IA0A 3BTLA 4LFUA 3EPZA 1HOMA 3IRRA 2XDVA 4PJJA 4IOCF 1B72A 4ZYEA 3S17J 1XSVA 1RNLA 1G8XA 5JVGF 4BQAA 2A6HF 2DFEA 5C4JJ 1MBKA 3G1MA 1X3ZB 2VBWA 3CF5F 1DGWY 1X1AA 2DA2A 2LF8A 1ZG3A 4BEHA 3H35A 2QTQA 4ESFA 1TWCJ 3AG2H 1YS7A 3GTOJ 1SEUA 1OCTC 4PGHA 4RB3C 1YHQI 2KRCA 6PAXA 4RDUA 5HNFA 2M34A 4LLLA 2ZJ2A 2MC3A 2OZUA 2OQRA 2HOSA 2K9NA 3EYIA 2NXNB 2DXIA 1YIOA 3Q5FA 1YJNI 2XF6A 2JQ7A 2DMTA 1BIAA 3W6KB 2Y31A 1HXDA 1H89C 2HOTA 4M3FA 3ZPLA 5FLXZ 3SZGA 1T98A 1JKRC 5FKOA 1MBGA 1QHHD 1WSUA 2HQNA 4IRVA 3K4KA 4IQJA 1O7FA 4BXXJ 1P7IA 3MWMA 1TWAJ 1ZHFA 4BJTA 1NK3P 2QBYA 2OERA 4U9LA 1FPQA 2Y0SA 1QO0D 3E5UA 3ANPA 2STWA 3OYNA 4IHYA 3BPXA 4OIRF 1I6XA 4DBRA 5LEJA 2IS4A 3NXCA 2L7FP 2DAOA 4G7HF 2K9SA 3S14J 1BM9A 1MMNA 3K4LA 3NAUA 5FGMA 1VTNC 2CFXA 4G9YA 1F1ZA 3SFIA 4B47A 5IP9J 1IV6A 2ESNA 2JN6A 4HA8A 4DYCA 1O4XA 1T95A 1ZGWA 1SVMA 4AIJA 2J5PA 1QU3A 1AA7A 1MBFA 3SEZA 2COBA 3M8JA 1KQ8A 2EPFA 5L3BA 4A3GJ 5J8FA 1V5GA 1PP7U 2F4MB 1HW1A 3DKYA 2NVTJ 3CRJA 2IJLA 3EGQA 3GZIA 1T8IA 3NPIA 5E79C 1FTZA 1E2XA 3KEYA 2VUMJ 3CUQB 4L0ZB 5K5OA 1CF7B 2JA2A 3A2KA 3TEDA 3CESA 2JTVA 3JAMZ 3G4SI 3HIFA 3NRGA 4LLNA 4LD5A 3F8FA 1MZBA 3JW4A 3M1CA 3CCYA 4GCTA 2AQEA 3EYYA 4AU7A 2RAEA 5FJ8J 3FISA 2JWTA 3IH4A 2ZBKA 4HPQA 4U0YA 4GFKA 3E7LA 1EH6A 2JA8J 3FXKA 4HG2A 3ZQFA 3CCJI 3DBRB 3VYRB 2QWWA 4EATA 1KGSA 2X1EA 3G6EI 5F1JA 3ANGA 4A3DJ 3BJ6A 1Y6IA 4UDSA 1VZ0A 1HW5A 2CS3A 4MHGA 4BQOA 4PFOA 5HOOA 1YJWI 3K70C 4MEXF 2BY0A 3KP2A 1XMKA 4HRIA 3TP3A 5HAWA 3CLOA 1HDDC 5J1YA 2PBIA 4CDGA 1U78A 1HLVA 4D0PA 1TQMA 1HSTA 2KRHA 1K4SA 1VQ6I 3RPUD 2W57A 2DQRA 2XGDA 1ZTRA 4U7DA 3K4JA 4EM2A 5LHHA 4CCJA 1WPKA 1EF4A 2H1LA 1QNTA 3WTWC 3I71A 4YELA 4E7IA 1VQKI 5JR3A 3C07A 3IHUA 2X1CA 1IRZA 3UR3C 2HQ5A 2HZTA 5GADJ 4XLAA 4UUTA 5BOXA 2XHKA 1S5LC 1R7JA 5CQEA 1KQ0A 2UXXA 3HOVJ 3GZ6A 3CUQC 3HB9A 1MMSA 4FTHA 3F6VA 3E97A 1XDUA 3V7RA 3L9FA 1AKHA 1W4MA 5E3MA 2XRNA 1ZGJA 2LMDA 3RQ4A 1IRFA 1F4KA 1Z91A 1MKMA 2IGMA 2F5DA 3BG3A 3I9V2 1F9NA 3BR1A 4WF2A 1H9TA 3S1QJ 5FRMA 4JK1X 4E7ZA 2YX7A 4YRVA 1D8JA 2CH0A 3VYSB 4O3MA 3J81K 2EIJH 2FNAA 4IJAA 4MTEA 3K4NA 1B8IB 1XG1A 4XN3A 5DM6F 3S15J 2PBXA 3OYEA 4B1RA 3CTAA 1UB9A 3F9KA 3HG9A 4IZZA 3DTEA 4BY7J 5K5RA 4OMYA 2L01A 4RGSA 1FOWA 1QZEA 2QCOA 3IUOA 3R0AA 2WUIA 3FM3A 3HUGA 3E0JB 4AVPA 3QBMA 2XKPA 3V6GA 4KIGA 3WG7H 5FD6A 1BJZA 2EV0A 4KISA 1EH8A 4EVIA 2H1KA 2DOAA 4UNOA 4JKZA 2BY2A 3P9TA 4HV6A 2O5RA 3KZ9A 1R4NB 2K9LA 4ZZDA 2EH3A 2XSDC 1YLFA 2DFIA 1BI3A 3C2GA 1QGPA 1U6GA 1GVDA 2X0LA 3BQYA 3O2PE 3NEUA 1MMAA 1R22A 3DEWA 1FOXA 4NNJA 3SDGA 4XM3A 3GFLA 4A6EA 3CDIA 1YE9A 4AUXA 4HQEA 3OR2C 2K4JA 2KISA 2DMNA 4IEJA 1R5HA 3DF8A 4HX4A 2X48A 4RAZA 3Q9VA 1MGTA 4Y52J 1TLHB 3NWTA 2E7XA 3LFKA 3CJRB 4P5OA 4HF1A 1SFOJ 3LSKA 4EJUA 3VWBA 4CCOA 3ZGKA 3FWEA 4II2A 3AQTA 3JSJA 3RKYA 4M3EA 3LSGA 2L7KA 1YW8A 4GGGA 2Z9OA 3E5QA 3AG4H 4A93J 3H3VK 1ZAOA 2A61A 1S29A 1A6QA 3K0LA 2MSYA 3QU6A 5LHGA 1EKEA 1OYIA 3TGNA 2O6GE 2QA4I 2MW8A 4D5CA 4DYRA 1IC8A 3B73A 2CW0F 4A3BJ 2F5VA 1FY7A 2FU4A 3ESWB 1T0FA 1ZARA 2BBYA 4DIQA 5F0FA 4XSZF 5D8LB 4XLPF 1GV2A 3WU2C 2VB6A 3BZ6A 4CYCB 1NG6A 1PUEE 3DU5A 5HSZA 4KDPA 1B59A 1FSHA 4XKCA 2H27A 5AQCA 2FJI1 2A68F 2XAUA 1ZR2A 2CO5A 2XB5A 3DU6A 1S72I 3CJDA 1TNTA 1DQUA 1Z1DA 2FQ3A 3JRGA 4P55A 4CCMA 1W0TA 4TV7A 3N05A 4MTDA 4MGRA 4P9FA 3P7NA 3K69A 2YR2A 3GMEA 2JA7J 3JRCA 2E5NA 2FEZA 1O57A 1YX3A 2GOXB 3C18A 3GLLA 1VNDA 4ICHA 1Z6RA 1L3LA 5D5VB 1WJAA 5M5WJ 1V55H 4F91B 1YG2A 4L5EA 1QZYA 2AQFA 1OCCH 1XS9A 3LSHA 5HLTA 4BS9A 1XX5A 2BY3A 2XGXA 2CUZA 3RKXA 5KAFC 3GFIA 5BMZA 3GO5A 3K6GA 3COLA 3PPBA 5L3GA 2L7ZA 1LDJA 3O3KA 1PUFA 3N4MA 3T6NA 2L9SA 2DG7A 1ULYA 5DAJA 2KPMA 3TW7A 2DYRH 2IGKA 5EZHA 3FZVA 5BQTA 2K7LA 1ZLJA 2RGVA 2X85A 4Z2YA 2R7TA 3FRQA 1PVEA 5J4YA 2FOKA 2FBIA 4E7LA 3FXQA 2KIFA 3FMRA 5AONA 4C2UA 4EGZA 3DFGA 2ZNYA 4BDYA 1HKSA 2R7ZJ 3S1RJ 2EV6A 2NNNA 2BVLA 3E6DA 1ETXA 3WGGA 4OD4A 4U87A 2JVGA 1VFCA 2K3PA 2Y75A 3VUQA 2B1EA 1SD5A 3KP7A 4I7HA 4NELA 2VJ5A 1UHMA 4IL6C 1IUYA 3QWLA 4HX8A 2BHZA 2KQRA 2ZXIA 2LRDA 2QLZA 1OR7A 5DCMB 5E20A 4Q4ZF 4C2TA 3CUOA 3ZRGA 2MH9A 2JRMA 3ROUA 4IOAF 3QQAA 1BJAA 2HXIA 4G8XA 3HGYA 5CYVA 3F0CA 3CQZJ 2M4KA 1KYZA 3ZMTA 3GTGJ 4I02A 4P96A 4UUVA 5EGOA 5D5UB 4L62A 2IA1A 3D5SC 5D4RA 3S2WA 4KT5C 4XONA 4NBQA 3ZQQA 3PQKA 4ABZA 2E1CA 3H36A 1REPC 2A69F 1PP8F 2MA3A 2ZSHB 3HOUJ 5HS9A 3E6BA 5ILUA 5LRRA 1Z77A 3DPJA 4ME9A 3MD2A 3H5AA 3PUFA 4A12A 4PK4A 1SFUA 3LHQA 3EUKL 3OSGA 2F48A 2Y2ZA 2VXDA 2L9VA 4JOMA 1SMYF 3OOPA 2O3FA 2XRLA 2QYOA 3EUHA 2HYFA 3BR0A 5LLQA 2G7GA 1S8NA 1WHUA 3OYKA 5M5XJ 1NG7A 2Q2EB 4DJAA 4V19K 2QOPA 2R0QC 1QA6A 4HLYA 1I1SA 3DPTA 3U1DA 2NP5A 2H94A 2WB1A 5HBUA 1IDYA 3KCCA 4NQWB 2K86A 2G7HA 3FM5A 3WGHA 1JI8A 3V78A 2HYGD 1JJ6C 2OTLI 2KIUA 5E3LA 3IV5A 1ZREA 3DP7A 4N0BA 1VQ8I 2FJ1A 3V4GA 4PXIA 5IOYA 5D1RA 1ZRCA 1MJ9A 3I4PA 1D5VA 5F0HA 5LD2C 1WJEA 4QIWN 3WTYC 3JRAA 3VOKA 3VVYA 3I55I 1T33A 2XPUA 5GAEJ 2Q1ZB 1LPQA 4M9XA 1A31A 1D8KA 2HKOA 1HC8A 4HNTA 1ZK8A 5GAGJ 2IS1A 3GZ5A 1P6RA 2VJ4A 4A3CJ 2OV7A 1S7AA 3OY9A 1ETOA 3ZR8X 3HIMA 2NS8A 2YSRA 4I01A 4IPAA 5D5XB 5BNGA 2AS5F 3ABUA 3JREA 3K7AJ 2Q8KA 3H0DA 2L9NA 1OKRA 2ZFWA 1QPIA 3FXLA 4IO9F 1NK2P 2DW4A 1TW3A 4MFEA 5B66C 5CVRA 2R7QA 3HGGA 4I6ZA 3IAM2 3GF2A 4ZDLA 4A3EJ 1SVOA 2IPQX 1Y1WJ 3WTXC 2Z3YA 1WH5A 2R7UA 3HOWJ 5K7ZA 4ITVA 3RI4A 5DD4A 3TOBA 4JQFA 5HDGA 4DGWB 3OS1A 4KT6A 5HNHA 3RZDJ 4CGRA 1TWHJ 4XNFA 2WAFA 3WHCA 1VQMI 5C4XJ 4FETA 3GVAA 2GBYA 5F04A 2R5YB 1W7PA 1JUMA 4JX4A 2OD5A 2UV1A 4RS8A 1UFMA 2EZIA 3WU0A 2LDUA 1U5TA 1VQ5I 1IDZA 3PASA 4IXAA 4UXNA 1ENHA 3IWZA 3TP0A 2L7MP 2I8DA 1T38A 2K02A 2Y9YA 3WTSC 4AIHA 2R4GA 4IHXA 1QPMA 1GDTA 4Q47A 1N75A 5D6FA 1S7OA 1SMTA 3VIBA 4MO7A 1LQ1A 3BC8A 5C3EJ 1W36C 3IKTA 1PYVA 2PFBA 3HC7A 3F8NA 2NVUB 3M07A 2Y0SN 3VB2A 3A0BC 1YIJI 1ZG1A 2GENA 2LY9A 1JXSA 4DBQA 2XC7A 1G59A 3BR5A 2FUG2 4DQ2A 3ZN0A 3A01B 4HSTA 3M7GA 3SDBA 5FKLA 2MG4A 3KYCB 3ULQB 4NC7A 1QRYA 2VQCA 3OYGA 5IYCJ 4F7ZA 4IHSA 5D18A 2Z2SB 2IA2A 4DZJA 5M5YJ 4RLQA 2FMLA 4UVAA 3HXLA 1LE8B 2AHQA 3HTUA 2RV8A 3ZCOA 4G6QA 2O0YA 1B9MA 4Z6YA 2P7VB 4JP0A 3CCUI 1SD6A 1SAUA 1T08B 1MIJA 2G0EA 2MD5A 1TC3C 4MNUA 2ZO4A 4M3BA 4CICA 4PSWA 2WAQA 1HW2A 3ASOH 1QBJA 2HVSA 2DDAA 2CQKA 1QZZA 2VQHA 4L5JA 2WWYA 1RR7A 5DTDA 2PJPA 5ED4A 1MMGA 5KCMA 3R60A 4B44A 4S05A 3HBLA 1VQNI 3V8LA 4BAYA 3U21A 2A3SA 1R5ID 1TWGJ 3Q0UA 1IXCA 3BR3A 3ON2A 3U2RA 5A2QZ 3SJMA 2CV2A 4I99C 3PJRA 2WV1A 3BJOA 4N4NB 2JVHA 2X6YA 2XAHA 2V57A 2E2IJ 3VP5A 1FBUA 2TCTA 3FXJA 3IP4B 3BP8A 3VPRA 1VQ4I 4N9HA 2R7SA 2HNHA 1XCVA 3RDIA 4M9SA 1LKXA 2QQ8A 2P5KA 3ABLH 1TT5B 4BACA 4V2FA 2UXPA 2ELJA 3D0SA 2PI0A 4OWRB 4X6AJ 2QIBA 1S3JA 3BY6A 3IKVA 2V6EA 2R5ZA 1QHGA 4BE0A 2DA1A 4IQ4A 4L9TA 5EJCA 2DFFA 3HEFA 3CWRA 2V1DA 1B6AA 4BE1A 4A3JJ 1TQPA 1UHSA 1RIOH 1BOBA 3W6JB 4XRFA 3MCZA 4BU2A 1XDSA 3BPVA 3HOSA 2KZVA 5EG0A 2R7WA 2PJRB 3J7AO 1R1TA 1OYWA 2WY8Q 3MZ8A 5DM7F 2A05A 4KFCA 5ILSA 2CUJA 3CMAI 2ISZA 3MAJA 4N9IA 4DZPA 3OYIA 2V1UA 3GWZA 2EA2A 2KHMA 3LMMA 3A4CA 4QSHA 5B1AH 2JA5J 1TP4A 3LWFA 4Y7NJ 1I3QJ 4C30A 2YS9A 2DMPA 1K78A 3OSFA 3OIOA 1P92A 1J7KA 3E3VA 5J47A 2DT5A 1MJAA 2DN0A 4WXDA 4UUSB 3GUDA 1G3SA 3PIPF 1A35A 3KE2A 4ZYGA 3HHHA 4I0AA 4HF2A 2OUMA 4HKUA 5FFZA 3HSRA 1M1EB 2ZFUA 2LK2A 4U0WA 1U3EM 2KLOA 3FMQA 2W82A 3R61A 4XMYA 1JGSA 5EZGA 2UXUA 1TNSA 5IT9K 1I1GA 4WXHA 4ZYAA 2ZSIB 1U2WA 2MLKA 3BQZA 2ESHA 3OYCA 3KZIC 1J9IA 2DK8A 3WTVC 3JRBA 1FT9A 2IS6A 4LB6B 3P9CA 1BI0A 1V5EA 3KYLA 5TISC 1W5SA 4LG0A 5KNLA 2LREA 1ZN2A 3KP6A 1WH7A 3AL0B 4FX0A 1ETWA 1V3FA 2K40A 3V42A 3CP2A 1OCRH 4PFPA 4V2GA 3MEXA 2K4BA 2FNPA 4NC6A 3WG9A 3CJNA 3LJLA 2FMYA 3E6MA 3BT9A 2E1OA 2HKUA 3RD3A 3QKXA 5LFAA 2YPRA 1XN7A 1T2KA 4N4OB 2DK5A 2EA4A 1C0WA 2F5EA 2RQPA 1RI7A 1IJWC 2DMUA 3SXYA 2M0MA 1GT0C 1SAXA 2H8WA 3GTQJ 2CU7A 2LKSA 1G6NA 4PJLA 3J80Z 2BY1A 1OCZH 3CJTB 2J5OA 4MIMA 3A1YA 2P81A 3EUPA 5EF6A 2M2EA 3ZQLA 3S32A 4H0EA 3G1OA 1N25A 5J8CA 1TZLA 1E3PA 5FMPA 2MBFA 3IH3A 5FD5A 4UUSA 2WC2A 4ZDOA 2W7NA 2ZXJA 4XKWA 1TT0A 2CW7A 2HPMA 1S6LA 2KIQA 2L9RA 3KPHA 3GFMA 2R7RA 3MN2A 1G3YA 3S1NJ 4GO1A 3ZOBA 2WTEA 4C9YA 1J0RA 5TGTA 2BXYA 4D7MA 2R7XA 2AXLA 4JBAA 3TKYA 1FTTA 3F3XA 2UXHA 1U9NA 2D1HA 2Y0MA 4AIDA 2FD5A 1E3HA 2DOEA 1FLIA 3QAHA 3LSJA 4RMNA 5CVIA 5LGUA 2HYTA 2BEOA 3DBLB 4UV9A 4R1HA 3T1BA 1H88C 2HR3A 4AWXB 4Q5SF 3WTUC 3K4BA 3NS4A 1LDDA 3F8MA 4PUSA 3HZJA 1U8RA 3QYFA 1IV8A 3ERMA 5HDNA 3FXUA 3BG6A 2VE9A 1GUUA 3AL0C 3BROA 3P9KA 4OIOF 5E1ZB 4A6DA 2FBKA 1J09A 3SHFA 3S5RA 1K79A 4KN7X 4DNCA 3H9GA 1YOVB 4C2MJ 2YVHA 3F8CA 3VSKA 3H5NA 5FLVA 4CZCA 4GFLA 3BZKA 2EZHA 3F23A 1D3YA 2XF5A 3HKZN 3PL8A 4RBOA 2B9SA 4OD5A 4M71A 2LH9A 5DD8A 4E7KA 5DS9A 2QM3A 3I59B 3GTPJ 4EJVA 1EJ9A 3O6BB 4PGGA 2XAGA 3HTSB 3U9GA 3J81Z 3QU3A 2PFVA 2M0CA 5J6XA 3HJEA 2GZWA 1RUNA 3CUQA 4GFBA 2XAJA 1CF7A 3CLQA 5HS7A 4LB5A 2R7DA 3LQRA 3DXJF 2FF4A 1YRNB 5FHPA 3T8TA 4GDFA 3DV8A 1FOKA 4L0YB 2BZTA 3PNYA 1GV5A 4GYGA 2NOJB 2BE5F 4UB8C 3CCLI 3F1BA 4XRSG 1RETA 2A5WA 1G3TA 1HCRA 2HPIA 1J2XA 4A0ZA 4OINF 3BCAA 4F55A 1DDNA 2MC4A 3F72A 1WJ5A 4Y4RA 3G71I 2EFWA 2PLYA 2VPLA 2ACJA 3V7SA 3ABTA 4LIUA 2V6CA 1GHCA 2FXAA 1USSA 3COAC 1FBSA 4U0VA 1XSDA 1L0OC 2GQQA 1SD4A 1HKQA 2P0WA 4Y13A 4MQVA 5GPCA 4CCNA 4D5FA 4C3IJ 3RH2A 1W7PD 5CLSA 1O3SA 1X4OA 3DTKA 4HBLA 2VASA 4BUPA 4D1QA 3MNLA 4EM1A 3I4MJ 3KLOA 3HTHA 1D1AA 5HODA 1OFCX 2VQLA 4HAMA 5HDKA 1BC8C 5CW8A 3CCEI 4ZTFA 5IP6A 1HDPA 2G7SA 2GWRA 2DYSH 2XIGA 3LSIA 5L3DA 2HFHA 5FROA 1F5TA 2OTJI 5LHIA 2DA6A 1ZRDA 2VT2A 3UNGC 2WAEA 2F2EA 4FCYA 4HSRA 4KA4A 2PMUA 3CCVI 2DA4A 2L5QA 3V8KA 5DDGA 1UJ8A 4HF0A 3ZMUA 1Z0XA 2VIXA 5EEHA 1Y39A 4FISA 1BR1A 4WK8F 3PO3J 3EETA 1R1UA 1T39A 3E6CC 3K1MA 1ETQA 1OCOH 2PZ9A 1MH4A 3AFHA 2QKMB 4HW0A 4AM3A 3HPGA 2OAZA 4L9NA 3S93A 4AYBN 2KDZA 3TO6A 4E7HA 5H20A 1ETVA 1TTYA 3KNWA 1UG0A 4BXUA 5DV5A 2DG8A 1ETYA 4UVCA 2Z16A 2DTRA 2XPVA 1FP2A 1JUPA 2CW8A 1ZRFA 1B8IA 2P5VA 2STTA 2NVXJ 3FX3A 2LBFB 3BOQA 1MSEC 1E17A 2NOGA 4M6VA 5CKTA 1NH3A 2ECBA 4RAFA 3GBGA 1VQ7I 4R79A 1X2MA 2HDWA 3L1PA 1IN4A 1POGA 2DT7B 4A0XA 3VYUB 2DTZA 1FWZA 3K2ZA 1W1WE 2BVMA 1SC7A 4J01A 2ZMEB 4YFNF 2DODA 2W85A 1T6SA 2C6YA 3RKQA 3RKWA 4E70A 1FNNA 4KUMA 4NDLA 1V5FA 4EJOA 1F36A 4AVZA 3EUAA 1YW7A 1D0ZA 3AG1H 2M8GX 2QSGX 2E60A 2O03A 5F64A 2V4JC 3DKXA 4A2UA 5FRNA 3TDZC 3GEUA 1FC3A 3CP8A 4FHTA 4LK0F 2G7LA 2VKDA 3HRSA 1N78A 3H3UA 2E71A 1NTCA 3OL4A 4AF5A 1ZYRF 3KYDB 3ABKH 4K2EA 3QPLA 3IC7A 1DU0A 3P5JA 2ZCWA 2BGCA 2O7TA 4KWAA 2CUFA 3GTLJ 4XRSA 1LEBA 1RUOA 1ODDA 1WJCA 1LVAA 2DA3A 2M45A 2GA1A 1O3TA 5GAHJ 1MBHA 4CYCA 3VEPA 5JLWA 3DPUA 1MJBA 1VQOI 3BG9A 2VODA 5IY5H 4C2MA 5IP7J 5EEGA 4M9ZA 1Y0UA 3NRVA 2EZKA 4XOPA 3CCRI 1XPXA 1ZG5A 2M9HA 1K6OA 1MNDA 4XR6A 3KETA 4BH9A 2DJNA 2EFNA 3OV8A 2Q24A 1I27A 2KDOA 3OYJA 1JKQC 2DPDA 3DLAA 1G4DA 3VW2A 1BW6A 3OS2A 2IT0A 5CVJA 4E4HA 2ZMEC 1B1BA 3OIPA 3OR1C 4ENMA 4XL9A 3F8BA 3O8GA 2KRFA 2RKHA 3O60A 2EFQA 4W97A 2LY1A 2EINH 2XV4S 4YG2F 4HZFA 3MKZA 2LKPA 1IUFA 3Q9SA 2ZNZA 4ESBA 3K9TA 4QPQA 4U88A 3HTIA 5DYMA 1JE8A 1HSJA 3KKCA 3BRUA 2GFNA 2B0LA 1WJBA 3GLXA 3ZQ7A 2WAQN 1WRJA 2JA6J 1Z9CA 2IAIA 2GIZA 2ICWG 2XB0X 4M74A 2Z33A 2VBZA 3PSIA 3IAS2 3H5RA 1Z7LA 1VQPI 1IW7F 3OYMA 4B48A 3QYBA 4M6XA 1X1PA 5ICFA 2HDCA 3I58A 3TQNA 4B8XA 3ON4A 1HKTA 2HYJA 3BWGA 3A03A 1SVLA 4A69C 3K10A 3NQOA 3RJPA 2L2OA 5ICGA 3FKIJ 3H1CA 1I6HJ 3KKDA 1QVUA 3OYBA 3KFWX 5EEAA 2DA7A 1I39A 5D6EA 2VOPA 2KMUA 4IHWA 2BW3B 2HVQA 1YQAA 1BC7C 5FKKA 4CGZA 1KU7A 2W84A 3BCGA 3TO9A 5DCMA 3MKLA 2HQAA 1P2FA 4R8HA 4P9UA 1TW2A 2E2JJ 1R1VA 3S2DJ 5GPAA 2V1XA 5EFYA 2EK5A 1U8BA 3I4NJ 1QQIA 4EV0A 2YVXA 5B1BH 2IVMA 2FOWA 1MBEA 2VKVA 4IVNA 2P7CB 1VQLI 1XMAA 4CCLA 1UG2A 3GTMJ 1D0XA 4YIRX 3QOEA 4B3XA 1FEXA 2HOAA 2I5UA 2OJED 2XAQA 4GCKA 4BQQA 2WV0A 2EFPA 3RCOA 4A3FJ 1Q1VA 4DOZA 4JYKA 5CJ9A 2M87A 3K70D 3QPSA 2F5CA 3T5XA 3ISPA 3CDHA 2R7FA 1ZELA 2R3SA 3M8EA 3PFIA 3LA7A 3FF5A 2Q2EA 4UVBA 3K4MA 2OCCH 1NHAA 3DQVC 4NQWA 3LNQA 3GYHX 2VLAA 5GP9A 2LFBA 4IRIA 3FBIB 3OYAA 4HEA2 4C3JJ 1UI5A 1OYYA 1RESA 5E18F 3CO6C 1SFXA 2PEXA 1BW5A 2X6WA 1F43A 3BNIA 5EYRA 4JNNA 5FLMJ 3VW0A 5C4YA 2PN6A 3OWTA 4Y3OA 3M8FA 2JPBA 4RGUA 1CQTA 4L9VA 3DPLC 3JCUC 1I3AA 2VBXA 3VDXA 3RIRA 4KMUX 2CYYA 1LFBA 4RA2A 2LOOA 3ZMDA 2RQQA 2JSPA 3FK7A 4CZZA 3AAFA 1YFHA 3D5LA 1I5ZA 2PG4A 1FMWA 4NN1A 1T56A 2DPUA 4RLFA 1WI3A 3LQQA 4IRHA 2TRTA 1J5YA 3OS0A 4ENNA 3C2BA 3DBHB 1XC5A 4FE4A 4XLEA 3AQSA 2H6CA 4HLXA 2VBYA 5FKNA 4EEFG 3FK6A 4BDZA 1STZA 1R9TJ 1O3RA 1FZPB 5C44J 2NVQJ 4EMSA 2XASA 2DLLA 3U1KA 1WFXA 2CFOA 3KZZA 4ZYHA 5BPIA 4M6YA 1H8AC 1OPCA 2ZJRF 4XKBA 4DW6A 1Z3YA 5F6FA 5IPAA 4RB2C 3OYHA 4KN4X 2NX4A 1LFUP 3JTHA 2IGOA 1FMVA 2QUFA 2WGBA 4WXCA 5ICCA 2DFHA 5F08A 3C3WA 2E5ZA 2R7VA 2VN2A 2R5YA 4UHTA 1LUJB 1RR8C 4GCLA 5ICEA 2OZ6A 2WY7Q 1BL0A 4A3IJ 5KAIC 1D1CA 1LNWA 1UCRA 4IF4A 3OIQA 5E1WA 3SZPA 1B9NA 1UAAA 2EIKH 4A3LJ 4QWQA 2G7UA 3PFYA 3LWJA 3IL2A 2P6SA 3H9QA 3T8RA 1KU9A 3QYEA 4KIBA 2W24A 2WADA 2L4MA 2OU2A 3H92A 4X1EA 4E7SA 5CXIA 5D19A 5GTHC 3HE0A 3MVPA 1B72B 1AOYA 5JHUA 2D2WA 2HEOA 4ENJA 2ZC2A 4MXMA 2XDNA 4LMYA 1E0EA 2REKA 2I10A 1IXSB 2VJIA 2FA5A 1LDKB 3A01A 1JTXA 1OISA 1Z6TA 2LC2A 2V9VA 2IS2A 2ISYA 3QPTA 1BA5A 1MSFC 1EV7A 3QPHA 3J7ZI 3HL2A 1JHHA 4XBFA 5F0CA 2H6BA 2NVYJ 3ELKA 1LE8A 2LNBA 1K6YA 3ERED 1X3WB 4BHCA 1R4MB 4IHTA 2IBDA 2XGCA 1XTAA 3H3ZA 3DWLE 3D1NI 5M3FJ 1VQ9I 2RASA 2FQ4A 2K3FA 1FYMA 2E19A 1WGXA 5IT9Z 2OF7A 1LFPA 1FOYA 3W2AA 1UHWA 2CRGA 3C7JA 1IO2A 1FSEA 4HQMA 2M7AA 3T0YA 3I0TA 1JJ8C 2GXAA 1I50J 3JRIA 1J59A 4XK4A 1Z3XA 2VKHA 4FX4A 2CV1A 2VJJA 4I0BA 2XVCA 2HI3A 4IX7A 1G3WA 1ON1A 2YU9J 4JX5A 2VT3A 2CWEA 2ZKZA 2UWMA 1X3UA 1SFKA 4G6TB 2D6YA 3TBIA 4J00A 3RZOJ 2UXOA 1JUSA 3CD6I 2K85A 3F6OA 1WVRA 4F52A 1X1CA 3V7CA 3BDDA 3VYTB 2PMZA 4M72A 1PDNC 4OIQF 3B6CA 2JUGA 5IYBJ 3CC2I 3QOPA 2M3AA 2P6TA 2LD5A 2V9KA 2VQGA 2MH2A 2VL8A 3FXOA 2VE8A 4U9NA 5K7FA 1FJLA 2L0KA 2ME6A 2VONA 3RYPA 1JGGA 3CCSI 3AG3H 4BHPA 2QEXI 2CV0A 2QVOA 4OOIA 1H9GA 4CCKA 4HNVA 3PO2J 4EM0B 5DEQA 2ZCMA 5L3EA 3GX4X 3NI7A 2BV6A 2E1NA 4YFXF 1Z67A 4BE2A 2W1OA 3JTGA 2PJRA 4KMFA 1OCPA 2FE3A 5JHFA 4BJ6C 3S2HJ 2B7EA 3IUVA 2GM4A 3HHGA 3ZMZA 3FKJA 1R5GA 4HDVA 2E2HJ 1RZ4A 1FBQA 1OMIA 5FFXA 2NS7A 5JI6A 3DLLF 4OAZA 4BBRJ 5DUKA 2GIVA 1AWCA 4XIDA 2X9DA 2A07F 2XROA 1W0UA 5FB2A 2F4IA 1R00A 3BHQA 2G3BA 3EQLF 2VI6A 2AO9A 1RC9A 4I76A 4LIVA 2BHYA 1USTA 1K7AA 2ZCNA 1UELB 3CDLA 2VKEA 4W1UA 3MFKA 4QTRA 3JSOA 2OCEA 1BOAA 4CH7A 2YVEA 1FIAA 2EFOA 2GA2A 2JK3A 3FBNB 2IEKA 3E1SA 3LL7A 5LGTA 4LITA 1DP3A 4I2OA 2RVCA 1YO5C 2LP0A 1IAWA 5E8IA 1XGMA 5CVVA 1IGNA 3BJBA 3I54A 3RYRA 3VVZA 4CSWA 2ECCA 3BTIA 3OOUA 5LEKA 3X2QH 5FLXK 4QLCU 1TWFJ 4XLFA 3K2AA 2CQXA 5BS6A 2FSWA 4XN0A 3GTKJ 2ELHA 1YI2I 2W25A 4IRGA 2LTPA 1ACIA 3RTRA 2V7FA 4RAYA 1HF0A 3BCBA 5J3LA 5E3OA 4DVYP 2CQ7A 1KZHA 2D45A 1WCMJ 2RDPA 1IZ1A 4G7OF 2CJJA 3PQJA 4HYEA 4ESJA 4A3MJ 3B02A 4AD9A 1AKHB 5IT3A 4MEYF 3A0HC 2MGQA 2W00A 3CMMA 3QP5A 2K9QA 1YITI 2NP3A 2CQNA 4KIFA 1J75A 3K8PC 3H0GJ 2DT6A 3LSMA 5E8GA 1GVJA 2LKXA 3S3NA 2QKLB 2V9PA 3OYDA 3R4KA 3A02A 3BLYA 2LYCA 3BG7A 4NC8A 3HPHA 5H6RA 3RPQA 3J80K 2CMPA 1EH7A 2CG4A 1ZGAA 4M3DA 3W2WA 2JUCA 3K1PA 1AHDP 1Z05A 2HWVA 2XPWA 1D0YA 4LLGF 1Y56A 5L3FA 2HU9A 2OA4A 2CGPA 3C2HA 4L5IA 3MZYA 4HOBA 4PSXA 2A5YB 3GW2A 2EILH 3ASNH 3HUGB 2ME0A 3JAMK 3L2UA 2FBQA 2EV5A 4JX6A 3I64A 3S3MA 5E1XA 4GXOA 2Z1DA 4CHUA 2BXZA 2GOMA 3I3LA 4ZJZA 1CGPA 3NARA 4NB5A 3GFJA 2OQGA 2E35A 3SYTA 3GXOA 2M1BA 2LSOA 1UZCA 2N8GA 2M8EA 3Q0WA 4ZDPA 4EJTA 1X58A 3ZP5A 3KEQA 4GRIA 3FHZA 2HDDA 2B63J 1DU6A 1H0MA 3KP3A 3ECHA 4CUGA 1JT6A 2X1DA 1X2NA 3HM5A 3HRTA 4S0HB 4BKXA 2ZJPF 5J4VA 4AC6A 1OQYA 2WA0A 3FXMA 3VFZA 4C3HJ 1V4RA 3HTJA 3LOCA 2W4SA 4KYWA 1YTYA 2YU3A
chains in the Genus database with same CATH topology
2Y31A 2HOTA 1H89C 3VIBA 4MO7A 1BW6A 1VI0A 4M3FA 3VW2A 5C3EJ 1UMQA 1JKRC 5FKOA 1MBGA 2Y0SN 3O8GA 2GENA 2LY9A 3O60A 3HOYJ 4W97A 1P7IA 1NK3P 1TWAJ 3BR5A 4BXXJ 2OERA 3E7QA 1ZKGA 3S16J 3A01B 5FKLA 2MG4A 1IUFA 3ANPA 1QRYA 2QF7A 4IHYA 1A5JA 3HTIA 5IYCJ 1YRNA 2QKOA 5D18A 3KKCA 3BRUA 2GFNA 3NXCA 5M5YJ 2L7FP 4DZJA 2GUHA 1LE8B 2AHQA 2WAQN 2K9SA 2JA6J 3S14J 2IAIA 3NAUA 2ZOYA 4JP0A 2W48A 2XB0X 3SFIA 1RKTA 5IP9J 1IV6A 2G0EA 2WB1N 2JN6A 3FIWA 4DYCA 1TC3C 2ZOZA 1O4XA 4M3BA 2F07A 1ZGWA 3BG5A 1MBFA 2COBA 2ID6A 1RKWA 1K61A 4A3GJ 3ON4A 5J1RA 1VF9A 2HYJA 2NVTJ 4A69C 3A03A 3CRJA 3EGQA 3GZIA 1RR7A 5DTDA 1I6HJ 3NPIA 3FKIJ 3LSRA 1FTZA 3KKDA 4B3AA 2VUMJ 1QVUA 3HBLA 5EEAA 3B81A 3TEDA 3NNRA 2DA7A 1PUFB 1TWGJ 4IHWA 1RPWA 3Q0UA 3NRGA 5FKKA 3BR3A 3ON2A 3BCGA 4GCTA 3CCYA 3MKLA 3SJMA 3S1MJ 2WV1A 3O8HA 4FE7A 2D5VA 2E2JJ 3S2DJ 2RAEA 2E2IJ 2V57A 3VP5A 4ACIA 2TCTA 5FJ8J 5GPAA 3FISA 1E3OC 3VPRA 3LSPA 2JWTA 2ID3A 3BTJA 1ORKA 3IH4A 1U8BA 3HOZJ 3I4NJ 4GFKA 5EFYA 3E7LA 2JA8J 3ZQFA 4V2FA 2VKVA 1MBEA 2UXPA 4X6AJ 2QIBA 5F1JA 3ANGA 4A3DJ 2R5ZA 2W53A 4UDSA 5CXGA 2DA1A 1UG2A 3GTMJ 3Q3SA 1MNMC 4BBSJ 3HEFA 5IOZA 3CWRA 1ZQ3P 3TP3A 4A3JJ 5HAWA 1UHSA 1FEXA 2HOAA 1HDDC 5J1YA 4GCKA 4A3FJ 4M3GA 1U78A 3VVXA 1Q1VA 3JRFA 4JYKA 5EG0A 3QPSA 2XGDA 5FKMA 1ZTRA 1WPKA 4DZPA 1EF4A 2Y30A 1AU7A 2KT0A 3C07A 4QSHA 1IRZA 5EGOB 2HQ5A 3LNQA 2JA5J 4Y7NJ 5GP9A 1I3QJ 2LFBA 2YS9A 4UUTA 2DMPA 2X6OA 3OSFA 3OIOA 1HLVA 1SANA 4C3JJ 2R93J 3HOVJ 1UI5A 1RESA 3HB9A 5JLXA 1BW5A 1F43A 2VPRA 3BNIA 4FTHA 5EYRA 4JNNA 2DN0A 2ELKA 5FLMJ 3VW0A 1IG7A 5C4YA 4XICA 4UUSB 4D7NA 1AKHA 5E3MA 1CQTA 2UXIA 2GLOA 5F27A 2O8KA 4YZEA 4HKUA 1LFBA 3BG3A 4AC0A 2LK2A 3BR1A 3FK7A 5EZGA 2UXUA 4A3KJ 3S1QJ 2Y9ZA 4NN1A 1T56A 3BQZA 2RHAA 3JRBA 1WI3A 1ETKA 2TRTA 2CQQA 3VOXA 1UI6A 1B8IB 3C2BA 2PBXA 1XG1A 3S15J 1XC5A 4FE4A 4B1RA 3AQSA 1G2HA 5FKNA 4BY7J 2DMQA 2O7OA 4EEFG 3FK6A 1WH7A 2QCOA 1ETWA 1R9TJ 2WUIA 3QBMA 3V6GA 2K40A 5C44J 2NVQJ 4V2GA 1BJZA 1OJLA 3IH2A 3LJLA 1H8AC 3BT9A 2H1KA 2E1OA 2HKUA 4DW6A 4JKZA 3RD3A 3P9TA 3QKXA 4MLOA 5IPAA 1SGMA 2NX4A 3KZ9A 2EH3A 2XSDC 3BQYA 1GVDA 1LFUP 3DEWA 1IJWC 2DMUA 3SDGA 1JKOC 2WGBA 1GT0C 3GTQJ 4AUXA 2CU7A 5F08A 4MIMA 2DMNA 2P81A 3EUPA 2JMWA 2FX0A 5EF6A 4IEJA 2M2EA 3ZQLA 2R5YA 2X48A 1P7JA 3G1OA 4Y52J 4GCLA 1BL0A 4A3IJ 3VW1A 5FMPA 1SFOJ 1S7EA 3IH3A 4UUSA 5IYDJ 3AQTA 5EDNA 3JSJA 1APLC 4M3EA 4A3LJ 3LSGA 3BR6A 2L9RA 9ANTA 4A93J 3LWJA 3H3VK 3MN2A 3S1NJ 3ZOBA 2MSYA 2OI8A 4X1EA 5CXIA 5D19A 4D7MA 1FTTA 3HE0A 2MW8A 1K83J 3MVPA 1B72B 4D5CA 4DYRA 1IC8A 1U9NA 2UXHA 3CMYA 2FD5A 4A3BJ 4MXMA 3LSJA 2HYTA 2XDNA 5F0FA 2YUSA 1GV2A 2REKA 2I10A 4G12A 3TW6A 4CYCB 4MK6A 1H88C 5HSZA 5AQCA 3A01A 1JTXA 4MFDA 3BTCA 1ZR2A 2XB5A 3CJDA 1BA5A 5M3MJ 2CUEA 1GUUA 3JRGA 1W0TA 1MSFC 1JKPC 5F0CA 2NVYJ 3S5RA 1LE8A 4C2MJ 2LLKA 2YVHA 2JA7J 3JRCA 2IBDA 2XGCA 3D1NI 5M3FJ 5FLVA 2RASA 4GFLA 2EZHA 2FQ4A 4RBOA 1VNDA 3HKZN 4ICHA 2E19A 1WGXA 2OF7A 3GTJJ 5M5WJ 5DS9A 2CRGA 3GTPJ 5K7HA 4L5EA 1JJ8C 1I50J 3JRIA 3BR2A 1XS9A 1JT0A 4XK4A 2M0CA 3ZQGA 2O9LA 4GFBA 1ITYA 1D5YA 2HI3A 3COLA 2LVSA 2YU9J 4JX5A 3PPBA 2L7ZA 4JL3A 1PUFA 1YRNB 2PMZN 5FHPA 2D6YA 1ZR4A 1GV5A 3T6NA 3RZOJ 2UXOA 1JUSA 2DG7A 2QWTA 5DAJA 3F1BA 4XRSG 1RETA 3TW7A 1HCRA 5EZHA 3B6CA 5IYBJ 3FRQA 4IHVA 2LD5A 1FIPA 1MH3A 5K7FA 1FJLA 2L0KA 2ME6A 2R7ZJ 3S1RJ 1ETXA 1JGGA 1VFCA 3VUQA 3JRHA 2H8RA 3HOXJ 4NELA 5FGLA 4HNVA 1MBJA 3PO2J 2ZCMA 3NI7A 3HDDA 5GPCA 4D5FA 4C3IJ 3RH2A 4DYQA 3MNLA 1OCPA 3I4MJ 3S2HJ 3IUVA 3HTHA 2GM4A 4BY1J 3QQAA 5HODA 1OFCX 2HXIA 2OPTA 3HGYA 2E2HJ 2R92J 3F0CA 5CW8A 3CQZJ 3GTGJ 5IP6A 1HDPA 2NS7A 2G7SA 5E3NA 4BBRJ 3B6AA 2ZB9A 2DA6A 3W6VA 4XIDA 5EGOA 4L62A 4FCYA 2X9DA 4ABZA 1W0UA 2R5ZB 2DA4A 3BHQA 5J1UA 2G3BA 2VI6A 2AO9A 2ZCXA 4I76A 3HOUJ 1Z0XA 2ZCNA 1Z77A 3DPJA 4ME9A 3CDLA 2VKEA 4W1UA 4QTRA 3JRDA 2JJ7A 3LHQA 2YVEA 3OSGA 3PM1A 1FIAA 4FISA 2JK3A 2Y2ZA 2IEKA 3PO3J 2XRLA 5EG0B 2LP0A 4B4CA 3BR0A 1ETQA 1IGNA 3RQIA 2PZ9A 3DCFA 1MH4A 3BJBA 2G7GA 3VVZA 2ECCA 3BTIA 3OOUA 3UKGA 2XGEA 5M5XJ 2LR8A 1TWFJ 2KDZA 4AYBN 2EQRA 2QOPA 2R0QC 1ETVA 3KNWA 4J19A 2DG8A 2NP5A 1ETYA 5HBUA 1U9OA 3K2AA 2CQXA 3G1LA 1IDYA 2XPVA 2DA5A 1JUPA 3GTKJ 2LTPA 3V78A 1B8IA 1JJ6C 1QVTA 5E3LA 3IV5A 1HF0A 5J3LA 5E3OA 2NVXJ 2FJ1A 1MSEC 4PXIA 1WCMJ 5IOYA 3Q0VA 5D1RA 2CJJA 3G7RA 3ZQCA 5H9TA 2NOGA 4M6VA 4A3MJ 2EZLA 4XRMA 2ECBA 3GBGA 1AKHB 1X2MA 5F0HA 4QIWN 3L1PA 2MGQA 3JR9A 2NP3A 2K9QA 1POGA 3JRAA 3VOKA 3H0GJ 3VVYA 2DTZA 1T33A 2XPUA 2LKXA 3M4OJ 3A02A 3ZQIA 1ZK8A 3ZQHA 2HXOA 3RKQA 4M3DA 2EBIA 4A3CJ 1JTYA 3WHBA 4NDLA 1A6IA 1AHDP 1F36A 1ETOA 3HIMA 2XPWA 3HTAA 2NS8A 5BNGA 3M3YJ 3JREA 3K7AJ 2M8GX 3G56A 1QPIA 3GEUA 2ME0A 2G7LA 1NK2P 4MFEA 2FBQA 2IU5A 5K58A 4I6ZA 3HGGA 1NTCA 4JX6A 4AF5A 4LOCA 1Y1VJ 4A3EJ 1Y1WJ 1WH5A 3BTLA 3HOWJ 3NARA 5K7ZA 1HOMA 3QPLA 1DU0A 2O7TA 3S17J 1B72A 3RZDJ 2CUFA 3GTLJ 4XRSA 2N8GA 4KWAA 4CGRA 3Q0WA 1TWHJ 2DA3A 1X58A 3WHCA 5C4XJ 5C4JJ 2Q24A 1MBKA 3G1MA 2GBYA 1MBHA 2DA2A 4CYCA 5F04A 2HDDA 2R5YB 2B63J 1DU6A 2QTQA 1TWCJ 5JLWA 1JUMA 4JX4A 3GTOJ 3BG9A 1JT6A 1OCTC 2EZIA 1X2NA 5IP7J 3HM5A 4S0HB 4BKXA 4RDUA 1IDZA 3PASA 2EZKA 2M34A 1ENHA 4AC6A 2M9HA 3TP0A 2L7MP 4C3HJ 2K9NA 2HOSA 3LOCA 3HTJA 2DJNA 2Y9YA 4IHXA 2DMTA 1GDTA 1JKQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y31 A;  2HOT A;  1H89 C;  3VIB A;  4MO7 A;  1BW6 A;  1VI0 A;  4M3F A;  3VW2 A;  5C3E J;  1UMQ A;  1JKR C;  5FKO A;  1MBG A;  2Y0S N;  3O8G A;  2GEN A;  2LY9 A;  3O60 A;  3HOY J;  4W97 A;  1P7I A;  1NK3 P;  1TWA J;  3BR5 A;  4BXX J;  2OER A;  3E7Q A;  1ZKG A;  3S16 J;  3A01 B;  5FKL A;  2MG4 A;  1IUF A;  3ANP A;  1QRY A;  2QF7 A;  4IHY A;  1A5J A;  3HTI A;  5IYC J;  1YRN A;  2QKO A;  5D18 A;  3KKC A;  3BRU A;  2GFN A;  3NXC A;  5M5Y J;  2L7F P;  4DZJ A;  2GUH A;  1LE8 B;  2AHQ A;  2WAQ N;  2K9S A;  2JA6 J;  3S14 J;  2IAI A;  3NAU A;  2ZOY A;  4JP0 A;  2W48 A;  2XB0 X;  3SFI A;  1RKT A;  5IP9 J;  1IV6 A;  2G0E A;  2WB1 N;  2JN6 A;  3FIW A;  4DYC A;  1TC3 C;  2ZOZ A;  1O4X A;  4M3B A;  2F07 A;  1ZGW A;  3BG5 A;  1MBF A;  2COB A;  2ID6 A;  1RKW A;  1K61 A;  4A3G J;  3ON4 A;  5J1R A;  1VF9 A;  2HYJ A;  2NVT J;  4A69 C;  3A03 A;  3CRJ A;  3EGQ A;  3GZI A;  1RR7 A;  5DTD A;  1I6H J;  3NPI A;  3FKI J;  3LSR A;  1FTZ A;  3KKD A;  4B3A A;  2VUM J;  1QVU A;  3HBL A;  5EEA A;  3B81 A;  3TED A;  3NNR A;  2DA7 A;  1PUF B;  1TWG J;  4IHW A;  1RPW A;  3Q0U A;  3NRG A;  5FKK A;  3BR3 A;  3ON2 A;  3BCG A;  4GCT A;  3CCY A;  3MKL A;  3SJM A;  3S1M J;  2WV1 A;  3O8H A;  4FE7 A;  2D5V A;  2E2J J;  3S2D J;  2RAE A;  2E2I J;  2V57 A;  3VP5 A;  4ACI A;  2TCT A;  5FJ8 J;  5GPA A;  3FIS A;  1E3O C;  3VPR A;  3LSP A;  2JWT A;  2ID3 A;  3BTJ A;  1ORK A;  3IH4 A;  1U8B A;  3HOZ J;  3I4N J;  4GFK A;  5EFY A;  3E7L A;  2JA8 J;  3ZQF A;  4V2F A;  2VKV A;  1MBE A;  2UXP A;  4X6A J;  2QIB A;  5F1J A;  3ANG A;  4A3D J;  2R5Z A;  2W53 A;  4UDS A;  5CXG A;  2DA1 A;  1UG2 A;  3GTM J;  3Q3S A;  1MNM C;  4BBS J;  3HEF A;  5IOZ A;  3CWR A;  1ZQ3 P;  3TP3 A;  4A3J J;  5HAW A;  1UHS A;  1FEX A;  2HOA A;  1HDD C;  5J1Y A;  4GCK A;  4A3F J;  4M3G A;  1U78 A;  3VVX A;  1Q1V A;  3JRF A;  4JYK A;  5EG0 A;  3QPS A;  2XGD A;  5FKM A;  1ZTR A;  1WPK A;  4DZP A;  1EF4 A;  2Y30 A;  1AU7 A;  2KT0 A;  3C07 A;  4QSH A;  1IRZ A;  5EGO B;  2HQ5 A;  3LNQ A;  2JA5 J;  4Y7N J;  5GP9 A;  1I3Q J;  2LFB A;  2YS9 A;  4UUT A;  2DMP A;  2X6O A;  3OSF A;  3OIO A;  1HLV A;  1SAN A;  4C3J J;  2R93 J;  3HOV J;  1UI5 A;  1RES A;  3HB9 A;  5JLX A;  1BW5 A;  1F43 A;  2VPR A;  3BNI A;  4FTH A;  5EYR A;  4JNN A;  2DN0 A;  2ELK A;  5FLM J;  3VW0 A;  1IG7 A;  5C4Y A;  4XIC A;  4UUS B;  4D7N A;  1AKH A;  5E3M A;  1CQT A;  2UXI A;  2GLO A;  5F27 A;  2O8K A;  4YZE A;  4HKU A;  1LFB A;  3BG3 A;  4AC0 A;  2LK2 A;  3BR1 A;  3FK7 A;  5EZG A;  2UXU A;  4A3K J;  3S1Q J;  2Y9Z A;  4NN1 A;  1T56 A;  3BQZ A;  2RHA A;  3JRB A;  1WI3 A;  1ETK A;  2TRT A;  2CQQ A;  3VOX A;  1UI6 A;  1B8I B;  3C2B A;  2PBX A;  1XG1 A;  3S15 J;  1XC5 A;  4FE4 A;  4B1R A;  3AQS A;  1G2H A;  5FKN A;  4BY7 J;  2DMQ A;  2O7O A;  4EEF G;  3FK6 A;  1WH7 A;  2QCO A;  1ETW A;  1R9T J;  2WUI A;  3QBM A;  3V6G A;  2K40 A;  5C44 J;  2NVQ J;  4V2G A;  1BJZ A;  1OJL A;  3IH2 A;  3LJL A;  1H8A C;  3BT9 A;  2H1K A;  2E1O A;  2HKU A;  4DW6 A;  4JKZ A;  3RD3 A;  3P9T A;  3QKX A;  4MLO A;  5IPA A;  1SGM A;  2NX4 A;  3KZ9 A;  2EH3 A;  2XSD C;  3BQY A;  1GVD A;  1LFU P;  3DEW A;  1IJW C;  2DMU A;  3SDG A;  1JKO C;  2WGB A;  1GT0 C;  3GTQ J;  4AUX A;  2CU7 A;  5F08 A;  4MIM A;  2DMN A;  2P81 A;  3EUP A;  2JMW A;  2FX0 A;  5EF6 A;  4IEJ A;  2M2E A;  3ZQL A;  2R5Y A;  2X48 A;  1P7J A;  3G1O A;  4Y52 J;  4GCL A;  1BL0 A;  4A3I J;  3VW1 A;  5FMP A;  1SFO J;  1S7E A;  3IH3 A;  4UUS A;  5IYD J;  3AQT A;  5EDN A;  3JSJ A;  1APL C;  4M3E A;  4A3L J;  3LSG A;  3BR6 A;  2L9R A;  9ANT A;  4A93 J;  3LWJ A;  3H3V K;  3MN2 A;  3S1N J;  3ZOB A;  2MSY A;  2OI8 A;  4X1E A;  5CXI A;  5D19 A;  4D7M A;  1FTT A;  3HE0 A;  2MW8 A;  1K83 J;  3MVP A;  1B72 B;  4D5C A;  4DYR A;  1IC8 A;  1U9N A;  2UXH A;  3CMY A;  2FD5 A;  4A3B J;  4MXM A;  3LSJ A;  2HYT A;  2XDN A;  5F0F A;  2YUS A;  1GV2 A;  2REK A;  2I10 A;  4G12 A;  3TW6 A;  4CYC B;  4MK6 A;  1H88 C;  5HSZ A;  5AQC A;  3A01 A;  1JTX A;  4MFD A;  3BTC A;  1ZR2 A;  2XB5 A;  3CJD A;  1BA5 A;  5M3M J;  2CUE A;  1GUU A;  3JRG A;  1W0T A;  1MSF C;  1JKP C;  5F0C A;  2NVY J;  3S5R A;  1LE8 A;  4C2M J;  2LLK A;  2YVH A;  2JA7 J;  3JRC A;  2IBD A;  2XGC A;  3D1N I;  5M3F J;  5FLV A;  2RAS A;  4GFL A;  2EZH A;  2FQ4 A;  4RBO A;  1VND A;  3HKZ N;  4ICH A;  2E19 A;  1WGX A;  2OF7 A;  3GTJ J;  5M5W J;  5DS9 A;  2CRG A;  3GTP J;  5K7H A;  4L5E A;  1JJ8 C;  1I50 J;  3JRI A;  3BR2 A;  1XS9 A;  1JT0 A;  4XK4 A;  2M0C A;  3ZQG A;  2O9L A;  4GFB A;  1ITY A;  1D5Y A;  2HI3 A;  3COL A;  2LVS A;  2YU9 J;  4JX5 A;  3PPB A;  2L7Z A;  4JL3 A;  1PUF A;  1YRN B;  2PMZ N;  5FHP A;  2D6Y A;  1ZR4 A;  1GV5 A;  3T6N A;  3RZO J;  2UXO A;  1JUS A;  2DG7 A;  2QWT A;  5DAJ A;  3F1B A;  4XRS G;  1RET A;  3TW7 A;  1HCR A;  5EZH A;  3B6C A;  5IYB J;  3FRQ A;  4IHV A;  2LD5 A;  1FIP A;  1MH3 A;  5K7F A;  1FJL A;  2L0K A;  2ME6 A;  2R7Z J;  3S1R J;  1ETX A;  1JGG A;  1VFC A;  3VUQ A;  3JRH A;  2H8R A;  3HOX J;  4NEL A;  5FGL A;  4HNV A;  1MBJ A;  3PO2 J;  2ZCM A;  3NI7 A;  3HDD A;  5GPC A;  4D5F A;  4C3I J;  3RH2 A;  4DYQ A;  3MNL A;  1OCP A;  3I4M J;  3S2H J;  3IUV A;  3HTH A;  2GM4 A;  4BY1 J;  3QQA A;  5HOD A;  1OFC X;  2HXI A;  2OPT A;  3HGY A;  2E2H J;  2R92 J;  3F0C A;  5CW8 A;  3CQZ J;  3GTG J;  5IP6 A;  1HDP A;  2NS7 A;  2G7S A;  5E3N A;  4BBR J;  3B6A A;  2ZB9 A;  2DA6 A;  3W6V A;  4XID A;  5EGO A;  4L62 A;  4FCY A;  2X9D A;  4ABZ A;  1W0U A;  2R5Z B;  2DA4 A;  3BHQ A;  5J1U A;  2G3B A;  2VI6 A;  2AO9 A;  2ZCX A;  4I76 A;  3HOU J;  1Z0X A;  2ZCN A;  1Z77 A;  3DPJ A;  4ME9 A;  3CDL A;  2VKE A;  4W1U A;  4QTR A;  3JRD A;  2JJ7 A;  3LHQ A;  2YVE A;  3OSG A;  3PM1 A;  1FIA A;  4FIS A;  2JK3 A;  2Y2Z A;  2IEK A;  3PO3 J;  2XRL A;  5EG0 B;  2LP0 A;  4B4C A;  3BR0 A;  1ETQ A;  1IGN A;  3RQI A;  2PZ9 A;  3DCF A;  1MH4 A;  3BJB A;  2G7G A;  3VVZ A;  2ECC A;  3BTI A;  3OOU A;  3UKG A;  2XGE A;  5M5X J;  2LR8 A;  1TWF J;  2KDZ A;  4AYB N;  2EQR A;  2QOP A;  2R0Q C;  1ETV A;  3KNW A;  4J19 A;  2DG8 A;  2NP5 A;  1ETY A;  5HBU A;  1U9O A;  3K2A A;  2CQX A;  3G1L A;  1IDY A;  2XPV A;  2DA5 A;  1JUP A;  3GTK J;  2LTP A;  3V78 A;  1B8I A;  1JJ6 C;  1QVT A;  5E3L A;  3IV5 A;  1HF0 A;  5J3L A;  5E3O A;  2NVX J;  2FJ1 A;  1MSE C;  4PXI A;  1WCM J;  5IOY A;  3Q0V A;  5D1R A;  2CJJ A;  3G7R A;  3ZQC A;  5H9T A;  2NOG A;  4M6V A;  4A3M J;  2EZL A;  4XRM A;  2ECB A;  3GBG A;  1AKH B;  1X2M A;  5F0H A;  4QIW N;  3L1P A;  2MGQ A;  3JR9 A;  2NP3 A;  2K9Q A;  1POG A;  3JRA A;  3VOK A;  3H0G J;  3VVY A;  2DTZ A;  1T33 A;  2XPU A;  2LKX A;  3M4O J;  3A02 A;  3ZQI A;  1ZK8 A;  3ZQH A;  2HXO A;  3RKQ A;  4M3D A;  2EBI A;  4A3C J;  1JTY A;  3WHB A;  4NDL A;  1A6I A;  1AHD P;  1F36 A;  1ETO A;  3HIM A;  2XPW A;  3HTA A;  2NS8 A;  5BNG A;  3M3Y J;  3JRE A;  3K7A J;  2M8G X;  3G56 A;  1QPI A;  3GEU A;  2ME0 A;  2G7L A;  1NK2 P;  4MFE A;  2FBQ A;  2IU5 A;  5K58 A;  4I6Z A;  3HGG A;  1NTC A;  4JX6 A;  4AF5 A;  4LOC A;  1Y1V J;  4A3E J;  1Y1W J;  1WH5 A;  3BTL A;  3HOW J;  3NAR A;  5K7Z A;  1HOM A;  3QPL A;  1DU0 A;  2O7T A;  3S17 J;  1B72 A;  3RZD J;  2CUF A;  3GTL J;  4XRS A;  2N8G A;  4KWA A;  4CGR A;  3Q0W A;  1TWH J;  2DA3 A;  1X58 A;  3WHC A;  5C4X J;  5C4J J;  2Q24 A;  1MBK A;  3G1M A;  2GBY A;  1MBH A;  2DA2 A;  4CYC A;  5F04 A;  2HDD A;  2R5Y B;  2B63 J;  1DU6 A;  2QTQ A;  1TWC J;  5JLW A;  1JUM A;  4JX4 A;  3GTO J;  3BG9 A;  1JT6 A;  1OCT C;  2EZI A;  1X2N A;  5IP7 J;  3HM5 A;  4S0H B;  4BKX A;  4RDU A;  1IDZ A;  3PAS A;  2EZK A;  2M34 A;  1ENH A;  4AC6 A;  2M9H A;  3TP0 A;  2L7M P;  4C3H J;  2K9N A;  2HOS A;  3LOC A;  3HTJ A;  2DJN A;  2Y9Y A;  4IHX A;  2DMT A;  1GDT A;  1JKQ C; 
#chains in the Genus database with same CATH topology
 2XUB A;  3DEE A;  3MQ0 A;  3QOD A;  1VI0 A;  2HTS A;  2OC6 A;  1WZ2 A;  1UMQ A;  1B4A A;  2NYX A;  1XGS A;  3I59 A;  4NUB A;  5GTI C;  1R23 A;  3QP6 A;  1BN5 A;  4FT8 A;  1R6R A;  2OBP A;  1IN7 A;  1XGN A;  2YX4 A;  4LK1 F;  2FRH A;  3HOY J;  3E7Q A;  1ZKG A;  3S16 J;  1KQ9 A;  1S9H A;  2EWN A;  1WKM A;  1W36 D;  4NHJ A;  2LY2 A;  3GEZ A;  2QF7 A;  4RM2 A;  1Z7U A;  3KP5 A;  2DU9 A;  1A5J A;  2KKO A;  1YRN A;  2QKO A;  3DTI A;  2GUH A;  2K9M A;  1O7L A;  2DDB A;  5E17 F;  4ON0 A;  2QSH X;  3M9A A;  3FHN A;  2H09 A;  2VOO A;  3LAJ A;  2ZOY A;  2E1M B;  2W48 A;  2F5F A;  2RNG A;  2V26 A;  1RKT A;  4G94 A;  2RRE A;  4LJZ F;  2WB1 N;  2ZOZ A;  3FIW A;  3G3Z A;  4HV5 A;  3MKW B;  2F07 A;  2ADU A;  3BG5 A;  2ID6 A;  1RKW A;  1K61 A;  3LST A;  2MLG A;  5HVQ C;  1DPU A;  5J1R A;  1VF9 A;  4YEJ A;  3F22 A;  2XF7 A;  2L3D A;  1WI9 A;  3CME I;  1ERD A;  3LSR A;  3CC7 I;  4B3A A;  3ZXS A;  4AIK A;  3CJQ B;  3B81 A;  3NNR A;  4OU0 A;  1IRX A;  1PUF B;  4A0Y A;  1RPW A;  2WBM A;  2QEN A;  5J40 A;  5D8K B;  3RSN A;  5B5E C;  1FYL A;  1WQ2 A;  4U7B A;  1XD7 A;  4HNU A;  3S1M J;  3I5U A;  3O8H A;  4FE7 A;  2D5V A;  2QZ8 A;  1IXR C;  4ACI A;  2VXZ A;  2F4O B;  3ONQ A;  5FO5 A;  5TRD A;  4CO8 A;  3K4C A;  3LSP A;  4EGY A;  2ID3 A;  3BTJ A;  1ORK A;  5KHD A;  1E3O C;  3HOZ J;  1PJR A;  5HLH A;  1SD7 A;  2PQ8 A;  1KON A;  1TQI A;  4RB1 A;  4G7Z F;  3W2V A;  4GYI A;  1WJF A;  1T0F C;  3HSE A;  3DEU A;  3ZN1 A;  3G73 A;  2O8X A;  1W5C C;  3SWH A;  2HS5 A;  1EA3 A;  2FBH A;  2W53 A;  2JZY A;  3IWF A;  2P8T A;  2UZK A;  5CXG A;  2KL4 A;  3PUB A;  3Q3S A;  1MNM C;  4BBS J;  5IOZ A;  1P9Q C;  4KIT B;  5F1R A;  3CO7 C;  3CCQ I;  1ZQ3 P;  1HA8 A;  4KIC A;  1DGR M;  4BYY A;  2B3W A;  5H2F C;  2JSC A;  3OMY A;  4ZC3 A;  1LB2 A;  4M3G A;  2ETH A;  3VVX A;  5CQG A;  3JRF A;  4HX7 A;  1Z21 A;  1MDM B;  3VTI A;  2A6T A;  3CZ6 A;  1X4P A;  5FKM A;  2E1M C;  4PJN A;  5D4S A;  2Y30 A;  2K5C A;  1AU7 A;  2HZD A;  2KT0 A;  3EDP A;  3HKZ A;  1SFE A;  5EGO B;  2MAB A;  1GXQ A;  2X6O A;  3H9J A;  3L00 A;  2BYV E;  1SAN A;  4ZTJ A;  2G9W A;  3K1N A;  2M30 A;  2R7O A;  4PZJ A;  2R93 J;  2BOL A;  2LBF A;  2Q0O A;  3VOD A;  5JLX A;  2VPR A;  2V79 A;  3WE3 A;  2ELK A;  2JRT A;  4ENK A;  1IG7 A;  4XIC A;  4D7N A;  4ZYD A;  2UXI A;  2GLO A;  5F27 A;  1BIB A;  1U0J A;  4F3Q A;  1KYW A;  4ETS A;  1YJ9 I;  2O8K A;  5JFR A;  4YZE A;  3S8P A;  4AC0 A;  2X51 A;  1D1B A;  2IW5 A;  1X19 A;  2UXN A;  1BI2 A;  1IN6 A;  3FXR A;  2ZME A;  3L2W A;  4A3K J;  2QGU A;  1YYV A;  2Y9Z A;  2RHA A;  1KA8 A;  1BBY A;  4Q48 A;  2QQA A;  4XOR A;  4EJW A;  1R71 A;  1XB4 A;  1ETK A;  2O61 A;  2CQQ A;  3VOX A;  1UI6 A;  4YII A;  2L54 A;  3VOE A;  3E5X A;  2QSF X;  5ERI A;  3CF2 A;  5DUI A;  4O6J A;  1G2H A;  4OIP F;  2NAZ A;  2DMQ A;  2O7O A;  3KLN A;  4P1W A;  3TOA A;  4BJ5 C;  4I09 A;  1MDM A;  1OJL A;  3IH2 A;  4XKV A;  1OR7 C;  2LG4 A;  2KFD A;  2NRA C;  4II3 A;  4MLO A;  2QQB A;  1SGM A;  3CCM I;  2RC4 A;  1A36 A;  4PDK A;  1X1B A;  4MQ9 F;  1TL8 A;  2Y48 A;  5LRS A;  1DPR A;  1XCB A;  1K4T A;  1JKO C;  3R0J A;  4M73 A;  3L2R A;  3IRQ A;  3PIO F;  4BL0 B;  4XLC A;  1XMX A;  1R49 A;  2JMW A;  2FX0 A;  2MD0 A;  3ZMV A;  1HBX G;  4B09 A;  2L02 A;  1P7J A;  4CYD A;  4ANJ A;  3TL4 X;  3VW1 A;  2DO7 A;  2M4G A;  1S7E A;  3LA2 A;  2M7B A;  3MZH A;  5IYD J;  3KZY A;  5EDN A;  2EIM H;  1APL C;  3L09 A;  3BR6 A;  3NWS A;  3GCM A;  9ANT A;  1KU2 A;  1WWX A;  4EQQ A;  2HOE A;  1XGO A;  4UB6 C;  2Z99 A;  2DOF A;  3EUH C;  4OMZ A;  4D9J A;  2GXB A;  2OI8 A;  2EB7 A;  3I56 I;  1K83 J;  3CMY A;  4O5V A;  3BJA A;  2V1N A;  3C1D A;  3SZT A;  4YIF A;  2YUS A;  4X0G A;  5JVT A;  5KVR A;  4AYB A;  4G12 A;  4XSX F;  3TW6 A;  3WTT C;  3LAP A;  1W7P B;  4MFD A;  4UV8 A;  1YW9 A;  1MNE A;  3BTC A;  3RPU A;  3KEO A;  4WX9 A;  4RAG A;  3GZN B;  1U5T B;  5M3M J;  2CUE A;  1GLN A;  1DUX C;  4Y33 A;  5K5Q A;  3WE2 A;  2K27 A;  1JKP C;  4F93 B;  1O3Q A;  2DJI A;  4H4K C;  4YFK F;  3G2B A;  4A5M A;  2LLK A;  2IXS A;  4BGD A;  3J7A Y;  2HGC A;  4PJM A;  3KIO A;  4RGR A;  3TMO A;  2DQL A;  2E36 A;  4B43 A;  2A6E F;  1YS6 A;  3GTJ J;  1ON2 A;  2RN7 A;  3ECO A;  4FQG A;  5LBQ A;  3OYL A;  5K7H A;  3WU1 B;  3ABM H;  3BR2 A;  5HLG A;  2CSO A;  1JT0 A;  1R36 A;  2A2F X;  3ZQG A;  2O9L A;  2MYS A;  1ITY A;  1D5Y A;  2ZJQ F;  2LVS A;  4JL3 A;  1X1D A;  4G6D A;  1P4A A;  1P4X A;  3VSL A;  2PMZ N;  3OL3 A;  3L2Q A;  2BW3 A;  3LFU A;  1ZR4 A;  1LEA A;  2P5L C;  2QWT A;  3JSP A;  4QPO A;  3I53 A;  4BHB A;  4WWC A;  4XLN F;  3R6S A;  1V54 H;  1Q1H A;  3PNV A;  5BPD A;  1ZH5 A;  4IHV A;  1FIP A;  1TBX A;  1MH3 A;  4GCV A;  3HRU A;  2JT1 A;  3HYI A;  1HQC A;  2NNY A;  5H6Q A;  4WIB A;  4UY8 I;  4A5N A;  2IGN A;  2VC0 A;  2JPC A;  5KK1 A;  3FDY A;  2AXT C;  2EJR A;  4L9J A;  4PCQ A;  2RNJ A;  4LGW A;  3JRH A;  2H8R A;  3HOX J;  4BQN A;  5AIQ A;  4IKF A;  5FGL A;  1MBJ A;  2X6X A;  1U5T C;  5CVU A;  2ZY9 A;  2XSJ C;  5HLI A;  3HDD A;  3QRF F;  3MMY B;  3PSF A;  4DYQ A;  4OAY A;  2ZXW H;  1BR4 A;  3V8J A;  1JHF A;  3SQN A;  3KX2 A;  4S04 A;  4WCG A;  4BXF A;  3L2V A;  3N97 A;  2X4H A;  1RRJ A;  2F6C A;  4KNY A;  5B3S H;  4Y15 A;  3WGI A;  4BY1 J;  3S3O A;  2OPT A;  2R92 J;  3PNT A;  1KU3 A;  3HOT A;  2L4A A;  4RGX A;  5E3N A;  3B6A A;  3LA3 A;  4L18 B;  2ZB9 A;  1P4W A;  4ZZL A;  3W6V A;  2D1V A;  3ML6 A;  2XKO A;  3KP4 A;  1A04 A;  3HRM A;  1IF1 A;  3L7W A;  2DCE A;  1W5T A;  4PJ0 C;  2R5Z B;  2DI3 A;  2KJC A;  5J1U A;  4BNC A;  2ZCX A;  5ILV A;  4RM3 A;  2HTJ A;  2Y69 H;  1Y8R B;  3JRD A;  1DP7 P;  2JJ7 A;  3PM1 A;  4I98 B;  5TJJ A;  1LVK A;  5K1Y A;  4KJZ A;  1ZLK A;  5EG0 B;  2IP2 A;  2Z5U A;  1MW7 A;  1Y8Q B;  4FAS D;  3W3C A;  4B4C A;  4MK6 A;  3RQI A;  3DCF A;  3UKG A;  2XGE A;  2LR8 A;  3FMS A;  1IRG A;  3WTZ A;  2EQR A;  5AIP A;  4CXF A;  2HKX A;  4J19 A;  2KP6 A;  2TDX A;  2IRF G;  1U9O A;  3G1L A;  1IN5 A;  2DA5 A;  1YX5 A;  1K78 B;  5HS8 A;  3MKY B;  3HSF A;  1FX7 A;  3SEQ A;  1QVT A;  2MFZ A;  3DKW A;  3M1E A;  2UUZ A;  4BEH B;  4XLH A;  2KZG A;  2PX9 A;  4CA0 A;  3Q0V A;  3G7R A;  3ZQC A;  1FP1 D;  5H9T A;  3F21 A;  2EZL A;  4XRM A;  3BZC A;  2DBB A;  2PMH A;  3JR9 A;  2M5W A;  2KIM A;  4E6K G;  2P4W A;  2GXG A;  4XOT A;  2E34 A;  1MMD A;  2KJB A;  1N77 A;  2HVR A;  5CPR B;  4ZH4 F;  1BR2 A;  1LJ9 A;  2COM A;  2LF7 A;  3L2C A;  2NS0 A;  3D5R C;  5L3C A;  3ZMS A;  3M4O J;  2GAU A;  2QQ9 A;  4HDU A;  1XSX A;  3ZQI A;  3ZQH A;  2HXO A;  5LGN A;  5D5W B;  2EBI A;  1JTY A;  3WHB A;  3AKZ A;  1FYK A;  1A6I A;  1R58 A;  1OLT A;  3WOD F;  1GXP A;  3HTA A;  1WJD A;  2HQR A;  5DCF A;  2ZXH A;  2XAF A;  3M3Y J;  2VC1 A;  2QBY B;  3G56 A;  4LG0 B;  4Y17 A;  3TDU C;  2E7W A;  3P9I A;  3REO A;  4ASN A;  3SFZ A;  1Y0N A;  1ONV A;  4LG3 A;  1MD0 A;  1BI1 A;  3TO7 A;  4XQF A;  2IU5 A;  3CC4 I;  5K58 A;  4F92 B;  4E7J A;  3J7Y J;  3OYF A;  5A2Q K;  1IN8 A;  4RB0 A;  4LOC A;  1Y1V J;  2IA0 A;  3BTL A;  4LFU A;  3EPZ A;  1HOM A;  3IRR A;  2XDV A;  4PJJ A;  4IOC F;  1B72 A;  4ZYE A;  3S17 J;  1XSV A;  1RNL A;  1G8X A;  5JVG F;  4BQA A;  2A6H F;  2DFE A;  5C4J J;  1MBK A;  3G1M A;  1X3Z B;  2VBW A;  3CF5 F;  1DGW Y;  1X1A A;  2DA2 A;  2LF8 A;  1ZG3 A;  4BEH A;  3H35 A;  2QTQ A;  4ESF A;  1TWC J;  3AG2 H;  1YS7 A;  3GTO J;  1SEU A;  1OCT C;  4PGH A;  4RB3 C;  1YHQ I;  2KRC A;  6PAX A;  4RDU A;  5HNF A;  2M34 A;  4LLL A;  2ZJ2 A;  2MC3 A;  2OZU A;  2OQR A;  2HOS A;  2K9N A;  3EYI A;  2NXN B;  2DXI A;  1YIO A;  3Q5F A;  1YJN I;  2XF6 A;  2JQ7 A;  2DMT A;  1BIA A;  3W6K B;  2Y31 A;  1HXD A;  1H89 C;  2HOT A;  4M3F A;  3ZPL A;  5FLX Z;  3SZG A;  1T98 A;  1JKR C;  5FKO A;  1MBG A;  1QHH D;  1WSU A;  2HQN A;  4IRV A;  3K4K A;  4IQJ A;  1O7F A;  4BXX J;  1P7I A;  3MWM A;  1TWA J;  1ZHF A;  4BJT A;  1NK3 P;  2QBY A;  2OER A;  4U9L A;  1FPQ A;  2Y0S A;  1QO0 D;  3E5U A;  3ANP A;  2STW A;  3OYN A;  4IHY A;  3BPX A;  4OIR F;  1I6X A;  4DBR A;  5LEJ A;  2IS4 A;  3NXC A;  2L7F P;  2DAO A;  4G7H F;  2K9S A;  3S14 J;  1BM9 A;  1MMN A;  3K4L A;  3NAU A;  5FGM A;  1VTN C;  2CFX A;  4G9Y A;  1F1Z A;  3SFI A;  4B47 A;  5IP9 J;  1IV6 A;  2ESN A;  2JN6 A;  4HA8 A;  4DYC A;  1O4X A;  1T95 A;  1ZGW A;  1SVM A;  4AIJ A;  2J5P A;  1QU3 A;  1AA7 A;  1MBF A;  3SEZ A;  2COB A;  3M8J A;  1KQ8 A;  2EPF A;  5L3B A;  4A3G J;  5J8F A;  1V5G A;  1PP7 U;  2F4M B;  1HW1 A;  3DKY A;  2NVT J;  3CRJ A;  2IJL A;  3EGQ A;  3GZI A;  1T8I A;  3NPI A;  5E79 C;  1FTZ A;  1E2X A;  3KEY A;  2VUM J;  3CUQ B;  4L0Z B;  5K5O A;  1CF7 B;  2JA2 A;  3A2K A;  3TED A;  3CES A;  2JTV A;  3JAM Z;  3G4S I;  3HIF A;  3NRG A;  4LLN A;  4LD5 A;  3F8F A;  1MZB A;  3JW4 A;  3M1C A;  3CCY A;  4GCT A;  2AQE A;  3EYY A;  4AU7 A;  2RAE A;  5FJ8 J;  3FIS A;  2JWT A;  3IH4 A;  2ZBK A;  4HPQ A;  4U0Y A;  4GFK A;  3E7L A;  1EH6 A;  2JA8 J;  3FXK A;  4HG2 A;  3ZQF A;  3CCJ I;  3DBR B;  3VYR B;  2QWW A;  4EAT A;  1KGS A;  2X1E A;  3G6E I;  5F1J A;  3ANG A;  4A3D J;  3BJ6 A;  1Y6I A;  4UDS A;  1VZ0 A;  1HW5 A;  2CS3 A;  4MHG A;  4BQO A;  4PFO A;  5HOO A;  1YJW I;  3K70 C;  4MEX F;  2BY0 A;  3KP2 A;  1XMK A;  4HRI A;  3TP3 A;  5HAW A;  3CLO A;  1HDD C;  5J1Y A;  2PBI A;  4CDG A;  1U78 A;  1HLV A;  4D0P A;  1TQM A;  1HST A;  2KRH A;  1K4S A;  1VQ6 I;  3RPU D;  2W57 A;  2DQR A;  2XGD A;  1ZTR A;  4U7D A;  3K4J A;  4EM2 A;  5LHH A;  4CCJ A;  1WPK A;  1EF4 A;  2H1L A;  1QNT A;  3WTW C;  3I71 A;  4YEL A;  4E7I A;  1VQK I;  5JR3 A;  3C07 A;  3IHU A;  2X1C A;  1IRZ A;  3UR3 C;  2HQ5 A;  2HZT A;  5GAD J;  4XLA A;  4UUT A;  5BOX A;  2XHK A;  1S5L C;  1R7J A;  5CQE A;  1KQ0 A;  2UXX A;  3HOV J;  3GZ6 A;  3CUQ C;  3HB9 A;  1MMS A;  4FTH A;  3F6V A;  3E97 A;  1XDU A;  3V7R A;  3L9F A;  1AKH A;  1W4M A;  5E3M A;  2XRN A;  1ZGJ A;  2LMD A;  3RQ4 A;  1IRF A;  1F4K A;  1Z91 A;  1MKM A;  2IGM A;  2F5D A;  3BG3 A;  3I9V 2;  1F9N A;  3BR1 A;  4WF2 A;  1H9T A;  3S1Q J;  5FRM A;  4JK1 X;  4E7Z A;  2YX7 A;  4YRV A;  1D8J A;  2CH0 A;  3VYS B;  4O3M A;  3J81 K;  2EIJ H;  2FNA A;  4IJA A;  4MTE A;  3K4N A;  1B8I B;  1XG1 A;  4XN3 A;  5DM6 F;  3S15 J;  2PBX A;  3OYE A;  4B1R A;  3CTA A;  1UB9 A;  3F9K A;  3HG9 A;  4IZZ A;  3DTE A;  4BY7 J;  5K5R A;  4OMY A;  2L01 A;  4RGS A;  1FOW A;  1QZE A;  2QCO A;  3IUO A;  3R0A A;  2WUI A;  3FM3 A;  3HUG A;  3E0J B;  4AVP A;  3QBM A;  2XKP A;  3V6G A;  4KIG A;  3WG7 H;  5FD6 A;  1BJZ A;  2EV0 A;  4KIS A;  1EH8 A;  4EVI A;  2H1K A;  2DOA A;  4UNO A;  4JKZ A;  2BY2 A;  3P9T A;  4HV6 A;  2O5R A;  3KZ9 A;  1R4N B;  2K9L A;  4ZZD A;  2EH3 A;  2XSD C;  1YLF A;  2DFI A;  1BI3 A;  3C2G A;  1QGP A;  1U6G A;  1GVD A;  2X0L A;  3BQY A;  3O2P E;  3NEU A;  1MMA A;  1R22 A;  3DEW A;  1FOX A;  4NNJ A;  3SDG A;  4XM3 A;  3GFL A;  4A6E A;  3CDI A;  1YE9 A;  4AUX A;  4HQE A;  3OR2 C;  2K4J A;  2KIS A;  2DMN A;  4IEJ A;  1R5H A;  3DF8 A;  4HX4 A;  2X48 A;  4RAZ A;  3Q9V A;  1MGT A;  4Y52 J;  1TLH B;  3NWT A;  2E7X A;  3LFK A;  3CJR B;  4P5O A;  4HF1 A;  1SFO J;  3LSK A;  4EJU A;  3VWB A;  4CCO A;  3ZGK A;  3FWE A;  4II2 A;  3AQT A;  3JSJ A;  3RKY A;  4M3E A;  3LSG A;  2L7K A;  1YW8 A;  4GGG A;  2Z9O A;  3E5Q A;  3AG4 H;  4A93 J;  3H3V K;  1ZAO A;  2A61 A;  1S29 A;  1A6Q A;  3K0L A;  2MSY A;  3QU6 A;  5LHG A;  1EKE A;  1OYI A;  3TGN A;  2O6G E;  2QA4 I;  2MW8 A;  4D5C A;  4DYR A;  1IC8 A;  3B73 A;  2CW0 F;  4A3B J;  2F5V A;  1FY7 A;  2FU4 A;  3ESW B;  1T0F A;  1ZAR A;  2BBY A;  4DIQ A;  5F0F A;  4XSZ F;  5D8L B;  4XLP F;  1GV2 A;  3WU2 C;  2VB6 A;  3BZ6 A;  4CYC B;  1NG6 A;  1PUE E;  3DU5 A;  5HSZ A;  4KDP A;  1B59 A;  1FSH A;  4XKC A;  2H27 A;  5AQC A;  2FJI 1;  2A68 F;  2XAU A;  1ZR2 A;  2CO5 A;  2XB5 A;  3DU6 A;  1S72 I;  3CJD A;  1TNT A;  1DQU A;  1Z1D A;  2FQ3 A;  3JRG A;  4P55 A;  4CCM A;  1W0T A;  4TV7 A;  3N05 A;  4MTD A;  4MGR A;  4P9F A;  3P7N A;  3K69 A;  2YR2 A;  3GME A;  2JA7 J;  3JRC A;  2E5N A;  2FEZ A;  1O57 A;  1YX3 A;  2GOX B;  3C18 A;  3GLL A;  1VND A;  4ICH A;  1Z6R A;  1L3L A;  5D5V B;  1WJA A;  5M5W J;  1V55 H;  4F91 B;  1YG2 A;  4L5E A;  1QZY A;  2AQF A;  1OCC H;  1XS9 A;  3LSH A;  5HLT A;  4BS9 A;  1XX5 A;  2BY3 A;  2XGX A;  2CUZ A;  3RKX A;  5KAF C;  3GFI A;  5BMZ A;  3GO5 A;  3K6G A;  3COL A;  3PPB A;  5L3G A;  2L7Z A;  1LDJ A;  3O3K A;  1PUF A;  3N4M A;  3T6N A;  2L9S A;  2DG7 A;  1ULY A;  5DAJ A;  2KPM A;  3TW7 A;  2DYR H;  2IGK A;  5EZH A;  3FZV A;  5BQT A;  2K7L A;  1ZLJ A;  2RGV A;  2X85 A;  4Z2Y A;  2R7T A;  3FRQ A;  1PVE A;  5J4Y A;  2FOK A;  2FBI A;  4E7L A;  3FXQ A;  2KIF A;  3FMR A;  5AON A;  4C2U A;  4EGZ A;  3DFG A;  2ZNY A;  4BDY A;  1HKS A;  2R7Z J;  3S1R J;  2EV6 A;  2NNN A;  2BVL A;  3E6D A;  1ETX A;  3WGG A;  4OD4 A;  4U87 A;  2JVG A;  1VFC A;  2K3P A;  2Y75 A;  3VUQ A;  2B1E A;  1SD5 A;  3KP7 A;  4I7H A;  4NEL A;  2VJ5 A;  1UHM A;  4IL6 C;  1IUY A;  3QWL A;  4HX8 A;  2BHZ A;  2KQR A;  2ZXI A;  2LRD A;  2QLZ A;  1OR7 A;  5DCM B;  5E20 A;  4Q4Z F;  4C2T A;  3CUO A;  3ZRG A;  2MH9 A;  2JRM A;  3ROU A;  4IOA F;  3QQA A;  1BJA A;  2HXI A;  4G8X A;  3HGY A;  5CYV A;  3F0C A;  3CQZ J;  2M4K A;  1KYZ A;  3ZMT A;  3GTG J;  4I02 A;  4P96 A;  4UUV A;  5EGO A;  5D5U B;  4L62 A;  2IA1 A;  3D5S C;  5D4R A;  3S2W A;  4KT5 C;  4XON A;  4NBQ A;  3ZQQ A;  3PQK A;  4ABZ A;  2E1C A;  3H36 A;  1REP C;  2A69 F;  1PP8 F;  2MA3 A;  2ZSH B;  3HOU J;  5HS9 A;  3E6B A;  5ILU A;  5LRR A;  1Z77 A;  3DPJ A;  4ME9 A;  3MD2 A;  3H5A A;  3PUF A;  4A12 A;  4PK4 A;  1SFU A;  3LHQ A;  3EUK L;  3OSG A;  2F48 A;  2Y2Z A;  2VXD A;  2L9V A;  4JOM A;  1SMY F;  3OOP A;  2O3F A;  2XRL A;  2QYO A;  3EUH A;  2HYF A;  3BR0 A;  5LLQ A;  2G7G A;  1S8N A;  1WHU A;  3OYK A;  5M5X J;  1NG7 A;  2Q2E B;  4DJA A;  4V19 K;  2QOP A;  2R0Q C;  1QA6 A;  4HLY A;  1I1S A;  3DPT A;  3U1D A;  2NP5 A;  2H94 A;  2WB1 A;  5HBU A;  1IDY A;  3KCC A;  4NQW B;  2K86 A;  2G7H A;  3FM5 A;  3WGH A;  1JI8 A;  3V78 A;  2HYG D;  1JJ6 C;  2OTL I;  2KIU A;  5E3L A;  3IV5 A;  1ZRE A;  3DP7 A;  4N0B A;  1VQ8 I;  2FJ1 A;  3V4G A;  4PXI A;  5IOY A;  5D1R A;  1ZRC A;  1MJ9 A;  3I4P A;  1D5V A;  5F0H A;  5LD2 C;  1WJE A;  4QIW N;  3WTY C;  3JRA A;  3VOK A;  3VVY A;  3I55 I;  1T33 A;  2XPU A;  5GAE J;  2Q1Z B;  1LPQ A;  4M9X A;  1A31 A;  1D8K A;  2HKO A;  1HC8 A;  4HNT A;  1ZK8 A;  5GAG J;  2IS1 A;  3GZ5 A;  1P6R A;  2VJ4 A;  4A3C J;  2OV7 A;  1S7A A;  3OY9 A;  1ETO A;  3ZR8 X;  3HIM A;  2NS8 A;  2YSR A;  4I01 A;  4IPA A;  5D5X B;  5BNG A;  2AS5 F;  3ABU A;  3JRE A;  3K7A J;  2Q8K A;  3H0D A;  2L9N A;  1OKR A;  2ZFW A;  1QPI A;  3FXL A;  4IO9 F;  1NK2 P;  2DW4 A;  1TW3 A;  4MFE A;  5B66 C;  5CVR A;  2R7Q A;  3HGG A;  4I6Z A;  3IAM 2;  3GF2 A;  4ZDL A;  4A3E J;  1SVO A;  2IPQ X;  1Y1W J;  3WTX C;  2Z3Y A;  1WH5 A;  2R7U A;  3HOW J;  5K7Z A;  4ITV A;  3RI4 A;  5DD4 A;  3TOB A;  4JQF A;  5HDG A;  4DGW B;  3OS1 A;  4KT6 A;  5HNH A;  3RZD J;  4CGR A;  1TWH J;  4XNF A;  2WAF A;  3WHC A;  1VQM I;  5C4X J;  4FET A;  3GVA A;  2GBY A;  5F04 A;  2R5Y B;  1W7P A;  1JUM A;  4JX4 A;  2OD5 A;  2UV1 A;  4RS8 A;  1UFM A;  2EZI A;  3WU0 A;  2LDU A;  1U5T A;  1VQ5 I;  1IDZ A;  3PAS A;  4IXA A;  4UXN A;  1ENH A;  3IWZ A;  3TP0 A;  2L7M P;  2I8D A;  1T38 A;  2K02 A;  2Y9Y A;  3WTS C;  4AIH A;  2R4G A;  4IHX A;  1QPM A;  1GDT A;  4Q47 A;  1N75 A;  5D6F A;  1S7O A;  1SMT A;  3VIB A;  4MO7 A;  1LQ1 A;  3BC8 A;  5C3E J;  1W36 C;  3IKT A;  1PYV A;  2PFB A;  3HC7 A;  3F8N A;  2NVU B;  3M07 A;  2Y0S N;  3VB2 A;  3A0B C;  1YIJ I;  1ZG1 A;  2GEN A;  2LY9 A;  1JXS A;  4DBQ A;  2XC7 A;  1G59 A;  3BR5 A;  2FUG 2;  4DQ2 A;  3ZN0 A;  3A01 B;  4HST A;  3M7G A;  3SDB A;  5FKL A;  2MG4 A;  3KYC B;  3ULQ B;  4NC7 A;  1QRY A;  2VQC A;  3OYG A;  5IYC J;  4F7Z A;  4IHS A;  5D18 A;  2Z2S B;  2IA2 A;  4DZJ A;  5M5Y J;  4RLQ A;  2FML A;  4UVA A;  3HXL A;  1LE8 B;  2AHQ A;  3HTU A;  2RV8 A;  3ZCO A;  4G6Q A;  2O0Y A;  1B9M A;  4Z6Y A;  2P7V B;  4JP0 A;  3CCU I;  1SD6 A;  1SAU A;  1T08 B;  1MIJ A;  2G0E A;  2MD5 A;  1TC3 C;  4MNU A;  2ZO4 A;  4M3B A;  4CIC A;  4PSW A;  2WAQ A;  1HW2 A;  3ASO H;  1QBJ A;  2HVS A;  2DDA A;  2CQK A;  1QZZ A;  2VQH A;  4L5J A;  2WWY A;  1RR7 A;  5DTD A;  2PJP A;  5ED4 A;  1MMG A;  5KCM A;  3R60 A;  4B44 A;  4S05 A;  3HBL A;  1VQN I;  3V8L A;  4BAY A;  3U21 A;  2A3S A;  1R5I D;  1TWG J;  3Q0U A;  1IXC A;  3BR3 A;  3ON2 A;  3U2R A;  5A2Q Z;  3SJM A;  2CV2 A;  4I99 C;  3PJR A;  2WV1 A;  3BJO A;  4N4N B;  2JVH A;  2X6Y A;  2XAH A;  2V57 A;  2E2I J;  3VP5 A;  1FBU A;  2TCT A;  3FXJ A;  3IP4 B;  3BP8 A;  3VPR A;  1VQ4 I;  4N9H A;  2R7S A;  2HNH A;  1XCV A;  3RDI A;  4M9S A;  1LKX A;  2QQ8 A;  2P5K A;  3ABL H;  1TT5 B;  4BAC A;  4V2F A;  2UXP A;  2ELJ A;  3D0S A;  2PI0 A;  4OWR B;  4X6A J;  2QIB A;  1S3J A;  3BY6 A;  3IKV A;  2V6E A;  2R5Z A;  1QHG A;  4BE0 A;  2DA1 A;  4IQ4 A;  4L9T A;  5EJC A;  2DFF A;  3HEF A;  3CWR A;  2V1D A;  1B6A A;  4BE1 A;  4A3J J;  1TQP A;  1UHS A;  1RIO H;  1BOB A;  3W6J B;  4XRF A;  3MCZ A;  4BU2 A;  1XDS A;  3BPV A;  3HOS A;  2KZV A;  5EG0 A;  2R7W A;  2PJR B;  3J7A O;  1R1T A;  1OYW A;  2WY8 Q;  3MZ8 A;  5DM7 F;  2A05 A;  4KFC A;  5ILS A;  2CUJ A;  3CMA I;  2ISZ A;  3MAJ A;  4N9I A;  4DZP A;  3OYI A;  2V1U A;  3GWZ A;  2EA2 A;  2KHM A;  3LMM A;  3A4C A;  4QSH A;  5B1A H;  2JA5 J;  1TP4 A;  3LWF A;  4Y7N J;  1I3Q J;  4C30 A;  2YS9 A;  2DMP A;  1K78 A;  3OSF A;  3OIO A;  1P92 A;  1J7K A;  3E3V A;  5J47 A;  2DT5 A;  1MJA A;  2DN0 A;  4WXD A;  4UUS B;  3GUD A;  1G3S A;  3PIP F;  1A35 A;  3KE2 A;  4ZYG A;  3HHH A;  4I0A A;  4HF2 A;  2OUM A;  4HKU A;  5FFZ A;  3HSR A;  1M1E B;  2ZFU A;  2LK2 A;  4U0W A;  1U3E M;  2KLO A;  3FMQ A;  2W82 A;  3R61 A;  4XMY A;  1JGS A;  5EZG A;  2UXU A;  1TNS A;  5IT9 K;  1I1G A;  4WXH A;  4ZYA A;  2ZSI B;  1U2W A;  2MLK A;  3BQZ A;  2ESH A;  3OYC A;  3KZI C;  1J9I A;  2DK8 A;  3WTV C;  3JRB A;  1FT9 A;  2IS6 A;  4LB6 B;  3P9C A;  1BI0 A;  1V5E A;  3KYL A;  5TIS C;  1W5S A;  4LG0 A;  5KNL A;  2LRE A;  1ZN2 A;  3KP6 A;  1WH7 A;  3AL0 B;  4FX0 A;  1ETW A;  1V3F A;  2K40 A;  3V42 A;  3CP2 A;  1OCR H;  4PFP A;  4V2G A;  3MEX A;  2K4B A;  2FNP A;  4NC6 A;  3WG9 A;  3CJN A;  3LJL A;  2FMY A;  3E6M A;  3BT9 A;  2E1O A;  2HKU A;  3RD3 A;  3QKX A;  5LFA A;  2YPR A;  1XN7 A;  1T2K A;  4N4O B;  2DK5 A;  2EA4 A;  1C0W A;  2F5E A;  2RQP A;  1RI7 A;  1IJW C;  2DMU A;  3SXY A;  2M0M A;  1GT0 C;  1SAX A;  2H8W A;  3GTQ J;  2CU7 A;  2LKS A;  1G6N A;  4PJL A;  3J80 Z;  2BY1 A;  1OCZ H;  3CJT B;  2J5O A;  4MIM A;  3A1Y A;  2P81 A;  3EUP A;  5EF6 A;  2M2E A;  3ZQL A;  3S32 A;  4H0E A;  3G1O A;  1N25 A;  5J8C A;  1TZL A;  1E3P A;  5FMP A;  2MBF A;  3IH3 A;  5FD5 A;  4UUS A;  2WC2 A;  4ZDO A;  2W7N A;  2ZXJ A;  4XKW A;  1TT0 A;  2CW7 A;  2HPM A;  1S6L A;  2KIQ A;  2L9R A;  3KPH A;  3GFM A;  2R7R A;  3MN2 A;  1G3Y A;  3S1N J;  4GO1 A;  3ZOB A;  2WTE A;  4C9Y A;  1J0R A;  5TGT A;  2BXY A;  4D7M A;  2R7X A;  2AXL A;  4JBA A;  3TKY A;  1FTT A;  3F3X A;  2UXH A;  1U9N A;  2D1H A;  2Y0M A;  4AID A;  2FD5 A;  1E3H A;  2DOE A;  1FLI A;  3QAH A;  3LSJ A;  4RMN A;  5CVI A;  5LGU A;  2HYT A;  2BEO A;  3DBL B;  4UV9 A;  4R1H A;  3T1B A;  1H88 C;  2HR3 A;  4AWX B;  4Q5S F;  3WTU C;  3K4B A;  3NS4 A;  1LDD A;  3F8M A;  4PUS A;  3HZJ A;  1U8R A;  3QYF A;  1IV8 A;  3ERM A;  5HDN A;  3FXU A;  3BG6 A;  2VE9 A;  1GUU A;  3AL0 C;  3BRO A;  3P9K A;  4OIO F;  5E1Z B;  4A6D A;  2FBK A;  1J09 A;  3SHF A;  3S5R A;  1K79 A;  4KN7 X;  4DNC A;  3H9G A;  1YOV B;  4C2M J;  2YVH A;  3F8C A;  3VSK A;  3H5N A;  5FLV A;  4CZC A;  4GFL A;  3BZK A;  2EZH A;  3F23 A;  1D3Y A;  2XF5 A;  3HKZ N;  3PL8 A;  4RBO A;  2B9S A;  4OD5 A;  4M71 A;  2LH9 A;  5DD8 A;  4E7K A;  5DS9 A;  2QM3 A;  3I59 B;  3GTP J;  4EJV A;  1EJ9 A;  3O6B B;  4PGG A;  2XAG A;  3HTS B;  3U9G A;  3J81 Z;  3QU3 A;  2PFV A;  2M0C A;  5J6X A;  3HJE A;  2GZW A;  1RUN A;  3CUQ A;  4GFB A;  2XAJ A;  1CF7 A;  3CLQ A;  5HS7 A;  4LB5 A;  2R7D A;  3LQR A;  3DXJ F;  2FF4 A;  1YRN B;  5FHP A;  3T8T A;  4GDF A;  3DV8 A;  1FOK A;  4L0Y B;  2BZT A;  3PNY A;  1GV5 A;  4GYG A;  2NOJ B;  2BE5 F;  4UB8 C;  3CCL I;  3F1B A;  4XRS G;  1RET A;  2A5W A;  1G3T A;  1HCR A;  2HPI A;  1J2X A;  4A0Z A;  4OIN F;  3BCA A;  4F55 A;  1DDN A;  2MC4 A;  3F72 A;  1WJ5 A;  4Y4R A;  3G71 I;  2EFW A;  2PLY A;  2VPL A;  2ACJ A;  3V7S A;  3ABT A;  4LIU A;  2V6C A;  1GHC A;  2FXA A;  1USS A;  3COA C;  1FBS A;  4U0V A;  1XSD A;  1L0O C;  2GQQ A;  1SD4 A;  1HKQ A;  2P0W A;  4Y13 A;  4MQV A;  5GPC A;  4CCN A;  4D5F A;  4C3I J;  3RH2 A;  1W7P D;  5CLS A;  1O3S A;  1X4O A;  3DTK A;  4HBL A;  2VAS A;  4BUP A;  4D1Q A;  3MNL A;  4EM1 A;  3I4M J;  3KLO A;  3HTH A;  1D1A A;  5HOD A;  1OFC X;  2VQL A;  4HAM A;  5HDK A;  1BC8 C;  5CW8 A;  3CCE I;  4ZTF A;  5IP6 A;  1HDP A;  2G7S A;  2GWR A;  2DYS H;  2XIG A;  3LSI A;  5L3D A;  2HFH A;  5FRO A;  1F5T A;  2OTJ I;  5LHI A;  2DA6 A;  1ZRD A;  2VT2 A;  3UNG C;  2WAE A;  2F2E A;  4FCY A;  4HSR A;  4KA4 A;  2PMU A;  3CCV I;  2DA4 A;  2L5Q A;  3V8K A;  5DDG A;  1UJ8 A;  4HF0 A;  3ZMU A;  1Z0X A;  2VIX A;  5EEH A;  1Y39 A;  4FIS A;  1BR1 A;  4WK8 F;  3PO3 J;  3EET A;  1R1U A;  1T39 A;  3E6C C;  3K1M A;  1ETQ A;  1OCO H;  2PZ9 A;  1MH4 A;  3AFH A;  2QKM B;  4HW0 A;  4AM3 A;  3HPG A;  2OAZ A;  4L9N A;  3S93 A;  4AYB N;  2KDZ A;  3TO6 A;  4E7H A;  5H20 A;  1ETV A;  1TTY A;  3KNW A;  1UG0 A;  4BXU A;  5DV5 A;  2DG8 A;  1ETY A;  4UVC A;  2Z16 A;  2DTR A;  2XPV A;  1FP2 A;  1JUP A;  2CW8 A;  1ZRF A;  1B8I A;  2P5V A;  2STT A;  2NVX J;  3FX3 A;  2LBF B;  3BOQ A;  1MSE C;  1E17 A;  2NOG A;  4M6V A;  5CKT A;  1NH3 A;  2ECB A;  4RAF A;  3GBG A;  1VQ7 I;  4R79 A;  1X2M A;  2HDW A;  3L1P A;  1IN4 A;  1POG A;  2DT7 B;  4A0X A;  3VYU B;  2DTZ A;  1FWZ A;  3K2Z A;  1W1W E;  2BVM A;  1SC7 A;  4J01 A;  2ZME B;  4YFN F;  2DOD A;  2W85 A;  1T6S A;  2C6Y A;  3RKQ A;  3RKW A;  4E70 A;  1FNN A;  4KUM A;  4NDL A;  1V5F A;  4EJO A;  1F36 A;  4AVZ A;  3EUA A;  1YW7 A;  1D0Z A;  3AG1 H;  2M8G X;  2QSG X;  2E60 A;  2O03 A;  5F64 A;  2V4J C;  3DKX A;  4A2U A;  5FRN A;  3TDZ C;  3GEU A;  1FC3 A;  3CP8 A;  4FHT A;  4LK0 F;  2G7L A;  2VKD A;  3HRS A;  1N78 A;  3H3U A;  2E71 A;  1NTC A;  3OL4 A;  4AF5 A;  1ZYR F;  3KYD B;  3ABK H;  4K2E A;  3QPL A;  3IC7 A;  1DU0 A;  3P5J A;  2ZCW A;  2BGC A;  2O7T A;  4KWA A;  2CUF A;  3GTL J;  4XRS A;  1LEB A;  1RUO A;  1ODD A;  1WJC A;  1LVA A;  2DA3 A;  2M45 A;  2GA1 A;  1O3T A;  5GAH J;  1MBH A;  4CYC A;  3VEP A;  5JLW A;  3DPU A;  1MJB A;  1VQO I;  3BG9 A;  2VOD A;  5IY5 H;  4C2M A;  5IP7 J;  5EEG A;  4M9Z A;  1Y0U A;  3NRV A;  2EZK A;  4XOP A;  3CCR I;  1XPX A;  1ZG5 A;  2M9H A;  1K6O A;  1MND A;  4XR6 A;  3KET A;  4BH9 A;  2DJN A;  2EFN A;  3OV8 A;  2Q24 A;  1I27 A;  2KDO A;  3OYJ A;  1JKQ C;  2DPD A;  3DLA A;  1G4D A;  3VW2 A;  1BW6 A;  3OS2 A;  2IT0 A;  5CVJ A;  4E4H A;  2ZME C;  1B1B A;  3OIP A;  3OR1 C;  4ENM A;  4XL9 A;  3F8B A;  3O8G A;  2KRF A;  2RKH A;  3O60 A;  2EFQ A;  4W97 A;  2LY1 A;  2EIN H;  2XV4 S;  4YG2 F;  4HZF A;  3MKZ A;  2LKP A;  1IUF A;  3Q9S A;  2ZNZ A;  4ESB A;  3K9T A;  4QPQ A;  4U88 A;  3HTI A;  5DYM A;  1JE8 A;  1HSJ A;  3KKC A;  3BRU A;  2GFN A;  2B0L A;  1WJB A;  3GLX A;  3ZQ7 A;  2WAQ N;  1WRJ A;  2JA6 J;  1Z9C A;  2IAI A;  2GIZ A;  2ICW G;  2XB0 X;  4M74 A;  2Z33 A;  2VBZ A;  3PSI A;  3IAS 2;  3H5R A;  1Z7L A;  1VQP I;  1IW7 F;  3OYM A;  4B48 A;  3QYB A;  4M6X A;  1X1P A;  5ICF A;  2HDC A;  3I58 A;  3TQN A;  4B8X A;  3ON4 A;  1HKT A;  2HYJ A;  3BWG A;  3A03 A;  1SVL A;  4A69 C;  3K10 A;  3NQO A;  3RJP A;  2L2O A;  5ICG A;  3FKI J;  3H1C A;  1I6H J;  3KKD A;  1QVU A;  3OYB A;  3KFW X;  5EEA A;  2DA7 A;  1I39 A;  5D6E A;  2VOP A;  2KMU A;  4IHW A;  2BW3 B;  2HVQ A;  1YQA A;  1BC7 C;  5FKK A;  4CGZ A;  1KU7 A;  2W84 A;  3BCG A;  3TO9 A;  5DCM A;  3MKL A;  2HQA A;  1P2F A;  4R8H A;  4P9U A;  1TW2 A;  2E2J J;  1R1V A;  3S2D J;  5GPA A;  2V1X A;  5EFY A;  2EK5 A;  1U8B A;  3I4N J;  1QQI A;  4EV0 A;  2YVX A;  5B1B H;  2IVM A;  2FOW A;  1MBE A;  2VKV A;  4IVN A;  2P7C B;  1VQL I;  1XMA A;  4CCL A;  1UG2 A;  3GTM J;  1D0X A;  4YIR X;  3QOE A;  4B3X A;  1FEX A;  2HOA A;  2I5U A;  2OJE D;  2XAQ A;  4GCK A;  4BQQ A;  2WV0 A;  2EFP A;  3RCO A;  4A3F J;  1Q1V A;  4DOZ A;  4JYK A;  5CJ9 A;  2M87 A;  3K70 D;  3QPS A;  2F5C A;  3T5X A;  3ISP A;  3CDH A;  2R7F A;  1ZEL A;  2R3S A;  3M8E A;  3PFI A;  3LA7 A;  3FF5 A;  2Q2E A;  4UVB A;  3K4M A;  2OCC H;  1NHA A;  3DQV C;  4NQW A;  3LNQ A;  3GYH X;  2VLA A;  5GP9 A;  2LFB A;  4IRI A;  3FBI B;  3OYA A;  4HEA 2;  4C3J J;  1UI5 A;  1OYY A;  1RES A;  5E18 F;  3CO6 C;  1SFX A;  2PEX A;  1BW5 A;  2X6W A;  1F43 A;  3BNI A;  5EYR A;  4JNN A;  5FLM J;  3VW0 A;  5C4Y A;  2PN6 A;  3OWT A;  4Y3O A;  3M8F A;  2JPB A;  4RGU A;  1CQT A;  4L9V A;  3DPL C;  3JCU C;  1I3A A;  2VBX A;  3VDX A;  3RIR A;  4KMU X;  2CYY A;  1LFB A;  4RA2 A;  2LOO A;  3ZMD A;  2RQQ A;  2JSP A;  3FK7 A;  4CZZ A;  3AAF A;  1YFH A;  3D5L A;  1I5Z A;  2PG4 A;  1FMW A;  4NN1 A;  1T56 A;  2DPU A;  4RLF A;  1WI3 A;  3LQQ A;  4IRH A;  2TRT A;  1J5Y A;  3OS0 A;  4ENN A;  3C2B A;  3DBH B;  1XC5 A;  4FE4 A;  4XLE A;  3AQS A;  2H6C A;  4HLX A;  2VBY A;  5FKN A;  4EEF G;  3FK6 A;  4BDZ A;  1STZ A;  1R9T J;  1O3R A;  1FZP B;  5C44 J;  2NVQ J;  4EMS A;  2XAS A;  2DLL A;  3U1K A;  1WFX A;  2CFO A;  3KZZ A;  4ZYH A;  5BPI A;  4M6Y A;  1H8A C;  1OPC A;  2ZJR F;  4XKB A;  4DW6 A;  1Z3Y A;  5F6F A;  5IPA A;  4RB2 C;  3OYH A;  4KN4 X;  2NX4 A;  1LFU P;  3JTH A;  2IGO A;  1FMV A;  2QUF A;  2WGB A;  4WXC A;  5ICC A;  2DFH A;  5F08 A;  3C3W A;  2E5Z A;  2R7V A;  2VN2 A;  2R5Y A;  4UHT A;  1LUJ B;  1RR8 C;  4GCL A;  5ICE A;  2OZ6 A;  2WY7 Q;  1BL0 A;  4A3I J;  5KAI C;  1D1C A;  1LNW A;  1UCR A;  4IF4 A;  3OIQ A;  5E1W A;  3SZP A;  1B9N A;  1UAA A;  2EIK H;  4A3L J;  4QWQ A;  2G7U A;  3PFY A;  3LWJ A;  3IL2 A;  2P6S A;  3H9Q A;  3T8R A;  1KU9 A;  3QYE A;  4KIB A;  2W24 A;  2WAD A;  2L4M A;  2OU2 A;  3H92 A;  4X1E A;  4E7S A;  5CXI A;  5D19 A;  5GTH C;  3HE0 A;  3MVP A;  1B72 B;  1AOY A;  5JHU A;  2D2W A;  2HEO A;  4ENJ A;  2ZC2 A;  4MXM A;  2XDN A;  4LMY A;  1E0E A;  2REK A;  2I10 A;  1IXS B;  2VJI A;  2FA5 A;  1LDK B;  3A01 A;  1JTX A;  1OIS A;  1Z6T A;  2LC2 A;  2V9V A;  2IS2 A;  2ISY A;  3QPT A;  1BA5 A;  1MSF C;  1EV7 A;  3QPH A;  3J7Z I;  3HL2 A;  1JHH A;  4XBF A;  5F0C A;  2H6B A;  2NVY J;  3ELK A;  1LE8 A;  2LNB A;  1K6Y A;  3ERE D;  1X3W B;  4BHC A;  1R4M B;  4IHT A;  2IBD A;  2XGC A;  1XTA A;  3H3Z A;  3DWL E;  3D1N I;  5M3F J;  1VQ9 I;  2RAS A;  2FQ4 A;  2K3F A;  1FYM A;  2E19 A;  1WGX A;  5IT9 Z;  2OF7 A;  1LFP A;  1FOY A;  3W2A A;  1UHW A;  2CRG A;  3C7J A;  1IO2 A;  1FSE A;  4HQM A;  2M7A A;  3T0Y A;  3I0T A;  1JJ8 C;  2GXA A;  1I50 J;  3JRI A;  1J59 A;  4XK4 A;  1Z3X A;  2VKH A;  4FX4 A;  2CV1 A;  2VJJ A;  4I0B A;  2XVC A;  2HI3 A;  4IX7 A;  1G3W A;  1ON1 A;  2YU9 J;  4JX5 A;  2VT3 A;  2CWE A;  2ZKZ A;  2UWM A;  1X3U A;  1SFK A;  4G6T B;  2D6Y A;  3TBI A;  4J00 A;  3RZO J;  2UXO A;  1JUS A;  3CD6 I;  2K85 A;  3F6O A;  1WVR A;  4F52 A;  1X1C A;  3V7C A;  3BDD A;  3VYT B;  2PMZ A;  4M72 A;  1PDN C;  4OIQ F;  3B6C A;  2JUG A;  5IYB J;  3CC2 I;  3QOP A;  2M3A A;  2P6T A;  2LD5 A;  2V9K A;  2VQG A;  2MH2 A;  2VL8 A;  3FXO A;  2VE8 A;  4U9N A;  5K7F A;  1FJL A;  2L0K A;  2ME6 A;  2VON A;  3RYP A;  1JGG A;  3CCS I;  3AG3 H;  4BHP A;  2QEX I;  2CV0 A;  2QVO A;  4OOI A;  1H9G A;  4CCK A;  4HNV A;  3PO2 J;  4EM0 B;  5DEQ A;  2ZCM A;  5L3E A;  3GX4 X;  3NI7 A;  2BV6 A;  2E1N A;  4YFX F;  1Z67 A;  4BE2 A;  2W1O A;  3JTG A;  2PJR A;  4KMF A;  1OCP A;  2FE3 A;  5JHF A;  4BJ6 C;  3S2H J;  2B7E A;  3IUV A;  2GM4 A;  3HHG A;  3ZMZ A;  3FKJ A;  1R5G A;  4HDV A;  2E2H J;  1RZ4 A;  1FBQ A;  1OMI A;  5FFX A;  2NS7 A;  5JI6 A;  3DLL F;  4OAZ A;  4BBR J;  5DUK A;  2GIV A;  1AWC A;  4XID A;  2X9D A;  2A07 F;  2XRO A;  1W0U A;  5FB2 A;  2F4I A;  1R00 A;  3BHQ A;  2G3B A;  3EQL F;  2VI6 A;  2AO9 A;  1RC9 A;  4I76 A;  4LIV A;  2BHY A;  1UST A;  1K7A A;  2ZCN A;  1UEL B;  3CDL A;  2VKE A;  4W1U A;  3MFK A;  4QTR A;  3JSO A;  2OCE A;  1BOA A;  4CH7 A;  2YVE A;  1FIA A;  2EFO A;  2GA2 A;  2JK3 A;  3FBN B;  2IEK A;  3E1S A;  3LL7 A;  5LGT A;  4LIT A;  1DP3 A;  4I2O A;  2RVC A;  1YO5 C;  2LP0 A;  1IAW A;  5E8I A;  1XGM A;  5CVV A;  1IGN A;  3BJB A;  3I54 A;  3RYR A;  3VVZ A;  4CSW A;  2ECC A;  3BTI A;  3OOU A;  5LEK A;  3X2Q H;  5FLX K;  4QLC U;  1TWF J;  4XLF A;  3K2A A;  2CQX A;  5BS6 A;  2FSW A;  4XN0 A;  3GTK J;  2ELH A;  1YI2 I;  2W25 A;  4IRG A;  2LTP A;  1ACI A;  3RTR A;  2V7F A;  4RAY A;  1HF0 A;  3BCB A;  5J3L A;  5E3O A;  4DVY P;  2CQ7 A;  1KZH A;  2D45 A;  1WCM J;  2RDP A;  1IZ1 A;  4G7O F;  2CJJ A;  3PQJ A;  4HYE A;  4ESJ A;  4A3M J;  3B02 A;  4AD9 A;  1AKH B;  5IT3 A;  4MEY F;  3A0H C;  2MGQ A;  2W00 A;  3CMM A;  3QP5 A;  2K9Q A;  1YIT I;  2NP3 A;  2CQN A;  4KIF A;  1J75 A;  3K8P C;  3H0G J;  2DT6 A;  3LSM A;  5E8G A;  1GVJ A;  2LKX A;  3S3N A;  2QKL B;  2V9P A;  3OYD A;  3R4K A;  3A02 A;  3BLY A;  2LYC A;  3BG7 A;  4NC8 A;  3HPH A;  5H6R A;  3RPQ A;  3J80 K;  2CMP A;  1EH7 A;  2CG4 A;  1ZGA A;  4M3D A;  3W2W A;  2JUC A;  3K1P A;  1AHD P;  1Z05 A;  2HWV A;  2XPW A;  1D0Y A;  4LLG F;  1Y56 A;  5L3F A;  2HU9 A;  2OA4 A;  2CGP A;  3C2H A;  4L5I A;  3MZY A;  4HOB A;  4PSX A;  2A5Y B;  3GW2 A;  2EIL H;  3ASN H;  3HUG B;  2ME0 A;  3JAM K;  3L2U A;  2FBQ A;  2EV5 A;  4JX6 A;  3I64 A;  3S3M A;  5E1X A;  4GXO A;  2Z1D A;  4CHU A;  2BXZ A;  2GOM A;  3I3L A;  4ZJZ A;  1CGP A;  3NAR A;  4NB5 A;  3GFJ A;  2OQG A;  2E35 A;  3SYT A;  3GXO A;  2M1B A;  2LSO A;  1UZC A;  2N8G A;  2M8E A;  3Q0W A;  4ZDP A;  4EJT A;  1X58 A;  3ZP5 A;  3KEQ A;  4GRI A;  3FHZ A;  2HDD A;  2B63 J;  1DU6 A;  1H0M A;  3KP3 A;  3ECH A;  4CUG A;  1JT6 A;  2X1D A;  1X2N A;  3HM5 A;  3HRT A;  4S0H B;  4BKX A;  2ZJP F;  5J4V A;  4AC6 A;  1OQY A;  2WA0 A;  3FXM A;  3VFZ A;  4C3H J;  1V4R A;  3HTJ A;  3LOC A;  2W4S A;  4KYW A;  1YTY A;  2YU3 A; 
#chains in the Genus database with same CATH homology
 2Y31 A;  2HOT A;  1H89 C;  3VIB A;  4MO7 A;  1BW6 A;  1VI0 A;  4M3F A;  3VW2 A;  5C3E J;  1UMQ A;  1JKR C;  5FKO A;  1MBG A;  2Y0S N;  3O8G A;  2GEN A;  2LY9 A;  3O60 A;  3HOY J;  4W97 A;  1P7I A;  1NK3 P;  1TWA J;  3BR5 A;  4BXX J;  2OER A;  3E7Q A;  1ZKG A;  3S16 J;  3A01 B;  5FKL A;  2MG4 A;  1IUF A;  3ANP A;  1QRY A;  2QF7 A;  4IHY A;  1A5J A;  3HTI A;  5IYC J;  1YRN A;  2QKO A;  5D18 A;  3KKC A;  3BRU A;  2GFN A;  3NXC A;  5M5Y J;  2L7F P;  4DZJ A;  2GUH A;  1LE8 B;  2AHQ A;  2WAQ N;  2K9S A;  2JA6 J;  3S14 J;  2IAI A;  3NAU A;  2ZOY A;  4JP0 A;  2W48 A;  2XB0 X;  3SFI A;  1RKT A;  5IP9 J;  1IV6 A;  2G0E A;  2WB1 N;  2JN6 A;  3FIW A;  4DYC A;  1TC3 C;  2ZOZ A;  1O4X A;  4M3B A;  2F07 A;  1ZGW A;  3BG5 A;  1MBF A;  2COB A;  2ID6 A;  1RKW A;  1K61 A;  4A3G J;  3ON4 A;  5J1R A;  1VF9 A;  2HYJ A;  2NVT J;  4A69 C;  3A03 A;  3CRJ A;  3EGQ A;  3GZI A;  1RR7 A;  5DTD A;  1I6H J;  3NPI A;  3FKI J;  3LSR A;  1FTZ A;  3KKD A;  4B3A A;  2VUM J;  1QVU A;  3HBL A;  5EEA A;  3B81 A;  3TED A;  3NNR A;  2DA7 A;  1PUF B;  1TWG J;  4IHW A;  1RPW A;  3Q0U A;  3NRG A;  5FKK A;  3BR3 A;  3ON2 A;  3BCG A;  4GCT A;  3CCY A;  3MKL A;  3SJM A;  3S1M J;  2WV1 A;  3O8H A;  4FE7 A;  2D5V A;  2E2J J;  3S2D J;  2RAE A;  2E2I J;  2V57 A;  3VP5 A;  4ACI A;  2TCT A;  5FJ8 J;  5GPA A;  3FIS A;  1E3O C;  3VPR A;  3LSP A;  2JWT A;  2ID3 A;  3BTJ A;  1ORK A;  3IH4 A;  1U8B A;  3HOZ J;  3I4N J;  4GFK A;  5EFY A;  3E7L A;  2JA8 J;  3ZQF A;  4V2F A;  2VKV A;  1MBE A;  2UXP A;  4X6A J;  2QIB A;  5F1J A;  3ANG A;  4A3D J;  2R5Z A;  2W53 A;  4UDS A;  5CXG A;  2DA1 A;  1UG2 A;  3GTM J;  3Q3S A;  1MNM C;  4BBS J;  3HEF A;  5IOZ A;  3CWR A;  1ZQ3 P;  3TP3 A;  4A3J J;  5HAW A;  1UHS A;  1FEX A;  2HOA A;  1HDD C;  5J1Y A;  4GCK A;  4A3F J;  4M3G A;  1U78 A;  3VVX A;  1Q1V A;  3JRF A;  4JYK A;  5EG0 A;  3QPS A;  2XGD A;  5FKM A;  1ZTR A;  1WPK A;  4DZP A;  1EF4 A;  2Y30 A;  1AU7 A;  2KT0 A;  3C07 A;  4QSH A;  1IRZ A;  5EGO B;  2HQ5 A;  3LNQ A;  2JA5 J;  4Y7N J;  5GP9 A;  1I3Q J;  2LFB A;  2YS9 A;  4UUT A;  2DMP A;  2X6O A;  3OSF A;  3OIO A;  1HLV A;  1SAN A;  4C3J J;  2R93 J;  3HOV J;  1UI5 A;  1RES A;  3HB9 A;  5JLX A;  1BW5 A;  1F43 A;  2VPR A;  3BNI A;  4FTH A;  5EYR A;  4JNN A;  2DN0 A;  2ELK A;  5FLM J;  3VW0 A;  1IG7 A;  5C4Y A;  4XIC A;  4UUS B;  4D7N A;  1AKH A;  5E3M A;  1CQT A;  2UXI A;  2GLO A;  5F27 A;  2O8K A;  4YZE A;  4HKU A;  1LFB A;  3BG3 A;  4AC0 A;  2LK2 A;  3BR1 A;  3FK7 A;  5EZG A;  2UXU A;  4A3K J;  3S1Q J;  2Y9Z A;  4NN1 A;  1T56 A;  3BQZ A;  2RHA A;  3JRB A;  1WI3 A;  1ETK A;  2TRT A;  2CQQ A;  3VOX A;  1UI6 A;  1B8I B;  3C2B A;  2PBX A;  1XG1 A;  3S15 J;  1XC5 A;  4FE4 A;  4B1R A;  3AQS A;  1G2H A;  5FKN A;  4BY7 J;  2DMQ A;  2O7O A;  4EEF G;  3FK6 A;  1WH7 A;  2QCO A;  1ETW A;  1R9T J;  2WUI A;  3QBM A;  3V6G A;  2K40 A;  5C44 J;  2NVQ J;  4V2G A;  1BJZ A;  1OJL A;  3IH2 A;  3LJL A;  1H8A C;  3BT9 A;  2H1K A;  2E1O A;  2HKU A;  4DW6 A;  4JKZ A;  3RD3 A;  3P9T A;  3QKX A;  4MLO A;  5IPA A;  1SGM A;  2NX4 A;  3KZ9 A;  2EH3 A;  2XSD C;  3BQY A;  1GVD A;  1LFU P;  3DEW A;  1IJW C;  2DMU A;  3SDG A;  1JKO C;  2WGB A;  1GT0 C;  3GTQ J;  4AUX A;  2CU7 A;  5F08 A;  4MIM A;  2DMN A;  2P81 A;  3EUP A;  2JMW A;  2FX0 A;  5EF6 A;  4IEJ A;  2M2E A;  3ZQL A;  2R5Y A;  2X48 A;  1P7J A;  3G1O A;  4Y52 J;  4GCL A;  1BL0 A;  4A3I J;  3VW1 A;  5FMP A;  1SFO J;  1S7E A;  3IH3 A;  4UUS A;  5IYD J;  3AQT A;  5EDN A;  3JSJ A;  1APL C;  4M3E A;  4A3L J;  3LSG A;  3BR6 A;  2L9R A;  9ANT A;  4A93 J;  3LWJ A;  3H3V K;  3MN2 A;  3S1N J;  3ZOB A;  2MSY A;  2OI8 A;  4X1E A;  5CXI A;  5D19 A;  4D7M A;  1FTT A;  3HE0 A;  2MW8 A;  1K83 J;  3MVP A;  1B72 B;  4D5C A;  4DYR A;  1IC8 A;  1U9N A;  2UXH A;  3CMY A;  2FD5 A;  4A3B J;  4MXM A;  3LSJ A;  2HYT A;  2XDN A;  5F0F A;  2YUS A;  1GV2 A;  2REK A;  2I10 A;  4G12 A;  3TW6 A;  4CYC B;  4MK6 A;  1H88 C;  5HSZ A;  5AQC A;  3A01 A;  1JTX A;  4MFD A;  3BTC A;  1ZR2 A;  2XB5 A;  3CJD A;  1BA5 A;  5M3M J;  2CUE A;  1GUU A;  3JRG A;  1W0T A;  1MSF C;  1JKP C;  5F0C A;  2NVY J;  3S5R A;  1LE8 A;  4C2M J;  2LLK A;  2YVH A;  2JA7 J;  3JRC A;  2IBD A;  2XGC A;  3D1N I;  5M3F J;  5FLV A;  2RAS A;  4GFL A;  2EZH A;  2FQ4 A;  4RBO A;  1VND A;  3HKZ N;  4ICH A;  2E19 A;  1WGX A;  2OF7 A;  3GTJ J;  5M5W J;  5DS9 A;  2CRG A;  3GTP J;  5K7H A;  4L5E A;  1JJ8 C;  1I50 J;  3JRI A;  3BR2 A;  1XS9 A;  1JT0 A;  4XK4 A;  2M0C A;  3ZQG A;  2O9L A;  4GFB A;  1ITY A;  1D5Y A;  2HI3 A;  3COL A;  2LVS A;  2YU9 J;  4JX5 A;  3PPB A;  2L7Z A;  4JL3 A;  1PUF A;  1YRN B;  2PMZ N;  5FHP A;  2D6Y A;  1ZR4 A;  1GV5 A;  3T6N A;  3RZO J;  2UXO A;  1JUS A;  2DG7 A;  2QWT A;  5DAJ A;  3F1B A;  4XRS G;  1RET A;  3TW7 A;  1HCR A;  5EZH A;  3B6C A;  5IYB J;  3FRQ A;  4IHV A;  2LD5 A;  1FIP A;  1MH3 A;  5K7F A;  1FJL A;  2L0K A;  2ME6 A;  2R7Z J;  3S1R J;  1ETX A;  1JGG A;  1VFC A;  3VUQ A;  3JRH A;  2H8R A;  3HOX J;  4NEL A;  5FGL A;  4HNV A;  1MBJ A;  3PO2 J;  2ZCM A;  3NI7 A;  3HDD A;  5GPC A;  4D5F A;  4C3I J;  3RH2 A;  4DYQ A;  3MNL A;  1OCP A;  3I4M J;  3S2H J;  3IUV A;  3HTH A;  2GM4 A;  4BY1 J;  3QQA A;  5HOD A;  1OFC X;  2HXI A;  2OPT A;  3HGY A;  2E2H J;  2R92 J;  3F0C A;  5CW8 A;  3CQZ J;  3GTG J;  5IP6 A;  1HDP A;  2NS7 A;  2G7S A;  5E3N A;  4BBR J;  3B6A A;  2ZB9 A;  2DA6 A;  3W6V A;  4XID A;  5EGO A;  4L62 A;  4FCY A;  2X9D A;  4ABZ A;  1W0U A;  2R5Z B;  2DA4 A;  3BHQ A;  5J1U A;  2G3B A;  2VI6 A;  2AO9 A;  2ZCX A;  4I76 A;  3HOU J;  1Z0X A;  2ZCN A;  1Z77 A;  3DPJ A;  4ME9 A;  3CDL A;  2VKE A;  4W1U A;  4QTR A;  3JRD A;  2JJ7 A;  3LHQ A;  2YVE A;  3OSG A;  3PM1 A;  1FIA A;  4FIS A;  2JK3 A;  2Y2Z A;  2IEK A;  3PO3 J;  2XRL A;  5EG0 B;  2LP0 A;  4B4C A;  3BR0 A;  1ETQ A;  1IGN A;  3RQI A;  2PZ9 A;  3DCF A;  1MH4 A;  3BJB A;  2G7G A;  3VVZ A;  2ECC A;  3BTI A;  3OOU A;  3UKG A;  2XGE A;  5M5X J;  2LR8 A;  1TWF J;  2KDZ A;  4AYB N;  2EQR A;  2QOP A;  2R0Q C;  1ETV A;  3KNW A;  4J19 A;  2DG8 A;  2NP5 A;  1ETY A;  5HBU A;  1U9O A;  3K2A A;  2CQX A;  3G1L A;  1IDY A;  2XPV A;  2DA5 A;  1JUP A;  3GTK J;  2LTP A;  3V78 A;  1B8I A;  1JJ6 C;  1QVT A;  5E3L A;  3IV5 A;  1HF0 A;  5J3L A;  5E3O A;  2NVX J;  2FJ1 A;  1MSE C;  4PXI A;  1WCM J;  5IOY A;  3Q0V A;  5D1R A;  2CJJ A;  3G7R A;  3ZQC A;  5H9T A;  2NOG A;  4M6V A;  4A3M J;  2EZL A;  4XRM A;  2ECB A;  3GBG A;  1AKH B;  1X2M A;  5F0H A;  4QIW N;  3L1P A;  2MGQ A;  3JR9 A;  2NP3 A;  2K9Q A;  1POG A;  3JRA A;  3VOK A;  3H0G J;  3VVY A;  2DTZ A;  1T33 A;  2XPU A;  2LKX A;  3M4O J;  3A02 A;  3ZQI A;  1ZK8 A;  3ZQH A;  2HXO A;  3RKQ A;  4M3D A;  2EBI A;  4A3C J;  1JTY A;  3WHB A;  4NDL A;  1A6I A;  1AHD P;  1F36 A;  1ETO A;  3HIM A;  2XPW A;  3HTA A;  2NS8 A;  5BNG A;  3M3Y J;  3JRE A;  3K7A J;  2M8G X;  3G56 A;  1QPI A;  3GEU A;  2ME0 A;  2G7L A;  1NK2 P;  4MFE A;  2FBQ A;  2IU5 A;  5K58 A;  4I6Z A;  3HGG A;  1NTC A;  4JX6 A;  4AF5 A;  4LOC A;  1Y1V J;  4A3E J;  1Y1W J;  1WH5 A;  3BTL A;  3HOW J;  3NAR A;  5K7Z A;  1HOM A;  3QPL A;  1DU0 A;  2O7T A;  3S17 J;  1B72 A;  3RZD J;  2CUF A;  3GTL J;  4XRS A;  2N8G A;  4KWA A;  4CGR A;  3Q0W A;  1TWH J;  2DA3 A;  1X58 A;  3WHC A;  5C4X J;  5C4J J;  2Q24 A;  1MBK A;  3G1M A;  2GBY A;  1MBH A;  2DA2 A;  4CYC A;  5F04 A;  2HDD A;  2R5Y B;  2B63 J;  1DU6 A;  2QTQ A;  1TWC J;  5JLW A;  1JUM A;  4JX4 A;  3GTO J;  3BG9 A;  1JT6 A;  1OCT C;  2EZI A;  1X2N A;  5IP7 J;  3HM5 A;  4S0H B;  4BKX A;  4RDU A;  1IDZ A;  3PAS A;  2EZK A;  2M34 A;  1ENH A;  4AC6 A;  2M9H A;  3TP0 A;  2L7M P;  4C3H J;  2K9N A;  2HOS A;  3LOC A;  3HTJ A;  2DJN A;  2Y9Y A;  4IHX A;  2DMT A;  1GDT A;  1JKQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...