1QVUA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvuA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvuA02
1QVUA 3B81A 1RR7A 2IU5A 3CRJA 3QKXA 5FLMJ 4A3BJ 4X6AJ 1EF4A 5IP7J 3CDLA 2CQXA 4FISA 4JL3A 3I4MJ 1BA5A 1WH7A 2F07A 4IHXA 3JRGA 1UMQA 2ID3A 2N8GA 1XC5A 3BCGA 1I3QJ 2QWTA 2NX4A 2E19A 5FKNA 1FIAA 2ZOZA 5E3LA 2DMUA 4AC6A 5FGLA 1H89C 5FJ8J 1T56A 3PASA 2VUMJ 4IHYA 5DTDA 2NP3A 3HBLA 4BY1J 4A3FJ 1X2MA 5FKMA 2X6OA 1OCTC 1BW5A 3NPIA 5EYRA 4FE4A 4W97A 3B6AA 2JMWA 4D7MA 3GTLJ 5D18A 5HBUA 2ECBA 2G0EA 2O8KA 4ABZA 3GTGJ 2R5YA 3HOUJ 4KWAA 3BR0A 1GUUA 2JWTA 3BTIA 2JA5J 4I76A 5C44J 1XG1A 2RASA 2EZLA 2DA3A 1TWHJ 3NARA 5EG0B 4M6VA 4JX5A 3CMYA 2Y9ZA 5HAWA 4B4CA 4B3AA 3BNIA 3LJLA 3K2AA 2ZCXA 2DA7A 2LVSA 4D5FA 3V6GA 4BKXA 2WAQN 4J19A 1NK2P 2GBYA 1IJWC 3HGYA 2VKEA 3BTCA 4A3IJ 3VW1A 5EG0A 2XGEA 2Y2ZA 1B8IB 5F08A 3LSJA 5EF6A 3GTOJ 2R5YB 1ENHA 2L7ZA 1SANA 1JTXA 1LFUP 2WUIA 1Q1VA 5J3LA 3TP3A 4C3IJ 1IGNA 2YVHA 2ECCA 3MKLA 2H8RA 2JA7J 2ZCMA 1F43A 3PO3J 1HDPA 3JRCA 5EEAA 3GZIA 2DA6A 1HF0A 1BW6A 3FK6A 2G3BA 1MBKA 2HXIA 3HEFA 2DG7A 2ZOYA 3GTKJ 3S14J 3BG9A 2CRGA 3MNLA 3VPRA 5EGOB 2FX0A 1HDDC 2KDZA 1RESA 2CUEA 2HOTA 2GENA 2XRLA 3Q3SA 3BHQA 3ZQLA 1XS9A 4BBSJ 2HOSA 3HOWJ 1AKHB 1ZQ3P 2D6YA 3HTIA 2ZCNA 1G2HA 3BG5A 2VPRA 2GLOA 2REKA 1MNMC 1O4XA 3NXCA 5GP9A 1GV2A 2EZIA 3VUQA 3F0CA 1ORKA 2DG8A 3IH2A 1GVDA 3FRQA 5EFYA 2KT0A 5F04A 4UUTA 2R92J 1ETQA 4D5CA 4ICHA 2M0CA 3GTQJ 1FTZA 1E3OC 5F1JA 1BL0A 2UXPA 1K61A 2UXIA 1LFBA 1U9OA 4Y7NJ 4M3GA 3VVXA 3BR3A 3D1NI 2XDNA 3NAUA 2P81A 1U8BA 5EDNA 1TWFJ 2OERA 2PZ9A 3G1OA 2CU7A 2DA5A 5EGOA 1Y1WJ 5FLVA 1ETOA 3CJDA 4JYKA 4A69C 1IDYA 5BNGA 2R5ZA 1YRNA 3RZOJ 5EZHA 3HIMA 3HM5A 3HDDA 2XGCA 4NDLA 3IV5A 3JRBA 1JJ8C 2B63J 3KZ9A 1TWCJ 4C3JJ 4L62A 1JKQC 4BBRJ 3C2BA 2AHQA 1ZGWA 3COLA 2K9NA 2XB0X 2QTQA 1MBEA 4MXMA 1OCPA 2NS8A 1MH3A 4X1EA 2K9QA 2HXOA 3OIOA 1HLVA 5JLXA 2G7SA 1I50J 3IH4A 2QKOA 2JA6J 1Z77A 4A3MJ 1UI5A 4DYCA 4MK6A 1ZK8A 2JN6A 1CQTA 1JGGA 1P7JA 1GDTA 1WI3A 3HGGA 4QIWN 3ANPA 4M3EA 2LY9A 2UXUA 4BXXJ 4PXIA 4JX6A 1HOMA 4RBOA 3UKGA 3DEWA 3ZQCA 3VOXA 2R0QC 2D5VA 2EBIA 3VIBA 2JJ7A 3ON4A 3JRHA 1A6IA 1FIPA 1AHDP 2JK3A 1B72B 4A3GJ 4XRSA 2QF7A 1LE8B 3S2DJ 3VW2A 2NVYJ 1OJLA 1FEXA 3Q0WA 4S0HB 3LOCA 2XSDC 2CQQA 3TEDA 3A01A 5DAJA 1T33A 3A02A 5CXGA 3BTJA 4DZJA 4A3CJ 3G7RA 1X2NA 1POGA 2FQ4A 5FKLA 5IYCJ 4GFBA 2DMPA 2PMZN 5J1RA 4FCYA 4A3LJ 3ZOBA 3VVYA 4XRSG 2DA4A 2X48A 3G1MA 4UUSA 3RZDJ 5FKKA 2EZHA 3S17J 1TC3C 3CWRA 3AQSA 3T6NA 5DS9A 2Y30A 5F0FA 2WV1A 3FISA 5FMPA 3A01B 1WH5A 5J1UA 1PUFA 3F1BA 4DYRA 2DMNA 1ZR4A 3S16J 5E3NA 4BY7J 4C3HJ 1MBJA 3TW6A 4JKZA 5HSZA 3LWJA 2HQ5A 1ETYA 2YU9J 1ZTRA 3QBMA 4A3EJ 3BR5A 5M3MJ 2WGBA 1X58A 5M5YJ 3BRUA 2DMQA 2O7OA 5FHPA 3Q0VA 2OPTA 3RH2A 2MSYA 3BJBA 2YS9A 4AUXA 1D5YA 3KNWA 1JKRC 2ME0A 4GFKA 5CXIA 3TP0A 3O60A 4LOCA 4W1UA 3SFIA 2Q24A 3HTHA 4JP0A 1VNDA 4A3DJ 5F0HA 3O8GA 2LFBA 5FKOA 3OOUA 3VW0A 1SFOJ 5K7ZA 3JRAA 2QOPA 2RHAA 2XGDA 3EGQA 1RKWA 3DCFA 4XIDA 2TCTA 3PO2J 1ETWA 1WCMJ 2HKUA 2GFNA 3VP5A 2NVTJ 2OF7A 1NK3P 2DMTA 1NTCA 1FJLA 2XPWA 3GTPJ 4MO7A 2YUSA 2JA8J 4M3BA 4IEJA 5M3FJ 1JKPC 3SDGA 1MSFC 5M5XJ 4C2MJ 5CW8A 3S1MJ 4FTHA 4EEFG 1TWAJ 2DA2A 5GPCA 2K40A 2EQRA 1GT0C 1IC8A 1JKOC 5C4XJ 1Z0XA 3G1LA 3LSRA 2NP5A 2ID6A 4V2GA 3ZQIA 2UXHA 5IPAA 2R7ZJ 3S15J 1P7IA 3BQZA 2L7FP 3CCYA 3C07A 5M5WJ 2FJ1A 2XB5A 3WHBA 4A3JJ 3JREA 1FTTA 2QIBA 3PM1A 2UXOA 1ZR2A 3RD3A 3CQZJ 2XPVA 4M3FA 5HODA 2IEKA 3NRGA 3QPLA 1SGMA 3VOKA 4XICA 2M34A 3HTAA 4DW6A 1UG2A 2W53A 3JRDA 4MLOA 4I6ZA 4IHVA 3OSGA 2WB1N 3O8HA 5E3MA 1PUFB 4IHWA 2Y9YA 3IUVA 2MW8A 4HNVA 2LP0A 5K7HA 1IUFA 3A03A 3E7LA 5F27A 2LK2A 2DJNA 3BT9A 3KKDA 4ACIA 2H1KA 4UUSB 5F0CA 1IRZA 5C4YA 3RKQA 4MIMA 1RKTA 1TWGJ 2DTZA 3LSPA 3M4OJ 1B8IA 1U9NA 1H88C 1ETXA 3K7AJ 3ANGA 4YZEA 1K83J 3JR9A 1S7EA 4FE7A 1LE8A 5IOYA 5GPAA 5D19A 4A93J 3OSFA 3BR1A 3FKIJ 2HYTA 5AQCA 2O7TA 2O9LA 5C4JJ 3JSJA 2CUFA 1IV6A 2LKXA 4RDUA 3GEUA 3BTLA 5D1RA 5K7FA 3SJMA 1MBFA 2VKVA 3HB9A 3V78A 1VI0A 2NVXJ 1UI6A 2TRTA 2L0KA 4NELA 3LSGA 5IYBJ 3JRIA 4G12A 2HOAA 2X9DA 3FIWA 3QPSA 4UDSA 2E2IJ 1AU7A 2NVQJ 1VF9A 3S1NJ 4HKUA 2OI8A 2RAEA 1RETA 4AF5A 5IP6A 4AC0A 3B6CA 2LLKA 1QPIA 3LNQA 4GFLA 3HOZJ 5IOZA 4GCLA 1H8AC 2Y0SN 3GBGA 3KKCA 3HOYJ 1JT6A 3MN2A 1APLC 4QTRA 2E2JJ 2M9HA 4B1RA 4MFDA 2V57A 5K58A 1JUPA 1U78A 1DU0A 3ZQFA 3PPBA 1GV5A 2AO9A 2R5ZB 2W48A 4DZPA 4AYBN 3HOXJ 4V2FA 1WPKA 2HYJA 2IAIA 2G7LA 4GCTA 1ETKA 2FD5A 3HOVJ 1ETVA 3NNRA 2L9RA 1JUSA 2LD5A 5H9TA 3WHCA 4DYQA 3S2HJ 3VVZA 2PBXA 2E1OA 1MBGA 1UHSA 2E2HJ 3AQTA 1B72A 2NOGA 4A3KJ 3EUPA 3W6VA 1W0TA 4D7NA 1JUMA 3G56A 2LTPA 1HCRA 2L7MP 1QRYA 2MG4A 2YVEA 3ZQGA 2COBA 3LHQA 3TW7A 2IBDA 1AKHA 4CGRA 2R93J 1WGXA 4CYCB 3M3YJ 3HTJA 4MFEA 1DU6A 2K9SA 3S1RJ 2VI6A 4QSHA 1ITYA 3IH3A 4XRMA 2QCOA 1IDZA 3L1PA 2ELKA 3HE0A 3ON2A 1ZKGA 4NN1A 3GTMJ 3S5RA 2EH3A 5J1YA 3GTJJ 2HDDA 2G7GA 3P9TA 2GM4A 2CJJA 2XPUA 2M8GX 3BR2A 3JRFA 3BQYA 1W0UA 1IG7A 2Y31A 2EZKA 1JT0A 5IYDJ 3HKZN 3S1QJ 2ME6A 5C3EJ 5E3OA 1YRNB 1JTYA 4M3DA 1MSEC 2DN0A 1R9TJ 2LR8A 3QQAA 5IP9J 4ME9A 4XK4A 5EZGA 3NI7A 3H0GJ 1F36A 1A5JA 2HI3A 2I10A 1QVTA 1BJZA 3FK7A 4CYCA 1I6HJ 4JNNA 2NS7A 4Y52J 4JX4A 2DA1A 1RPWA 3Q0UA 3BR6A 1JJ6C 3MVPA 5JLWA 3I4NJ 3E7QA 3RQIA 4GCKA 4L5EA 2GUHA 1OFCX 3BG3A 1VFCA 2M2EA 3H3VK 3DPJA 1MBHA 2MGQA 1Y1VJ 1MH4A 9ANTA 2FBQA 3ZQHA 2ZB9A
chains in the Genus database with same CATH superfamily
3B81A 3HZJA 1KONA 5E8IA 3CRJA 2X51A 4A3BJ 2CFXA 5IP7J 2L01A 2CQXA 3P5JA 1E17A 3R60A 2DK8A 3K0LA 3L2WA 4JL3A 2EV6A 3I4MJ 2H94A 1BA5A 2K4JA 4KN7X 4BEHA 2RREA 1JHHA 1YTYA 1VQKI 2GIZA 3K8PC 5J47A 2QQ9A 1I3QJ 4HA8A 3IAS2 3IRQA 1SD5A 1QA6A 2MH9A 2ZOZA 2CFOA 3LA2A 1TBXA 2DMUA 2J5OA 5FJ8J 1T56A 1P4WA 3HIFA 3RKWA 1QZEA 4RAFA 5DM7F 1X2MA 2X6OA 2LNBA 5DM6F 1MMAA 4XKCA 3NPIA 2K02A 2XGXA 4FE4A 4M74A 3B6AA 1JHFA 4HX7A 4D7MA 3K4LA 2A07F 5D18A 2ECBA 2HTSA 2IGKA 2XVCA 3BR0A 4RAYA 1GUUA 3PL8A 5HOOA 5FFZA 2R7RA 3I59A 5C44J 2RASA 1LDKB 1AWCA 1ZAOA 3W3CA 3WTWC 3JTHA 2ZXIA 4B4CA 4KIFA 4B3AA 3DKXA 3N05A 3MZHA 2V9PA 3CO7C 2XUBA 1G59A 3ZPLA 3LJLA 2X6WA 2ZXJA 1NK2P 3IL2A 4II2A 3KZYA 2F5EA 1YS6A 4HV6A 3BTCA 4EJUA 3VW1A 2X6YA 1TTYA 2HPIA 4KICA 3LA3A 3SYTA 4L0YB 4A5NA 2X1DA 1QQIA 4F92B 1WFXA 2L7ZA 3KEQA 5CKTA 2WUIA 5LGUA 4C3IJ 1YLFA 2W82A 4UVAA 1IGNA 3ABMH 1ONVA 3CC2I 2VXZA 2M5WA 1YJNI 4MEXF 1PP7U 2H09A 1A36A 3FK6A 3PNYA 2G3BA 2Z1DA 2Y0SA 2HXIA 5DYMA 3C1DA 2VOOA 4JQFA 3EYYA 3M8JA 1J7KA 2ZSHB 1YQAA 4BGDA 4EJTA 1FOYA 1HDDC 4CUGA 1RESA 2HOTA 1IN8A 2XAUA 3HXLA 3BHQA 3CCSI 4Y17A 1HW2A 2HOSA 1MW7A 5L3GA 2D6YA 2KIMA 1VTNC 1OISA 2FOKA 1PUEE 4JOMA 5JR3A 1T08B 1S29A 3F0CA 1G8XA 4IO9F 1GVDA 5EFYA 3PIPF 3AG3H 1ETQA 1SC7A 4PZJA 3ABKH 2M0CA 1CF7B 4PGGA 4BNCA 1K61A 3COAC 4XM3A 1SAXA 3GLLA 2R7OA 4UV8A 3H3ZA 4BJTA 5ICGA 3VVXA 2FNAA 2Q2EB 3D1NI 3B73A 3NAUA 1U8BA 2IJLA 2YVXA 1WHUA 2VL8A 1VQNI 3HHGA 2DA5A 3GXOA 5FRNA 3QYFA 4JYKA 4A69C 1IDYA 3PNTA 3RZOJ 3HIMA 2XGCA 3JRBA 2B63J 2IS1A 1BC8C 2WAFA 4C3JJ 2X0LA 3KCCA 2QA4I 4L62A 2KRCA 1ULYA 2AHQA 4B48A 2QTQA 3K9TA 3CMAI 2E1MB 4X1EA 3DPLC 2LY1A 3DBRB 3KIOA 2CW7A 3IH4A 5TRDA 4A3MJ 5LEJA 4MK6A 2JN6A 2P5VA 3QODA 4E7JA 5KAIC 1CQTA 2FUG2 1F9NA 2O61A 4U9LA 2X1CA 4RMNA 2DK5A 4JX6A 1FOKA 1XSVA 5J4VA 1HOMA 3DEWA 1XDSA 2MA3A 2CGPA 3V8LA 3VOXA 3QAHA 2D5VA 1BR2A 4UY8I 3KLNA 2DT7B 1FIPA 1SFEA 4LLLA 1QHHD 4GYGA 1DP3A 3HRMA 2CV1A 3J81Z 2NVYJ 1OJLA 2HYGD 4KMUX 3O6BB 1S72I 2F4MB 3SEQA 3A01A 3W6KB 5DAJA 3BTJA 2OUMA 2HVRA 1X2NA 1POGA 5AIQA 3I0TA 5L3DA 2E60A 1EA3A 2PMZN 4WX9A 4FCYA 4GFBA 2DODA 3NQOA 2BBYA 5D5VB 5HDGA 4AIKA 4UUSA 5HNHA 4MQVA 5CVIA 4OD4A 3S17J 1TC3C 3X2QH 1AOYA 1IRGA 3CWRA 3T6NA 2L02A 1W36D 3KX2A 5FMPA 1QNTA 2KL4A 1PUFA 2XASA 3F1BA 5E3NA 1KU9A 4PJNA 4G6DA 3RIRA 3QBMA 4YIFA 3M9AA 3GMEA 3C2HA 1DPRA 2O7OA 3CCJI 5ICFA 3BJBA 1KU7A 1LDJA 3LSIA 5JFRA 3CCMI 4EMSA 1WJAA 1V5FA 2QYOA 3T8RA 2GA1A 4LOCA 1ZRCA 4JP0A 2CQNA 3OV8A 4EJVA 4YFXF 5L3CA 4A3DJ 2IW5A 2HVSA 3GUDA 4NQWA 3K69A 5K7ZA 1ZARA 4FX0A 4LK1F 4L9TA 3PIOF 4XIDA 3OYLA 2EINH 2TCTA 3OYEA 1ETWA 3OR2C 1WCMJ 3CTAA 2GFNA 2RNGA 4GRIA 2OF7A 3S3OA 5EJCA 4YIIA 1NK3P 3SZTA 1NTCA 2P6SA 4IOCF 3LMMA 1P2FA 2JRTA 3GTPJ 2VBWA 2IPQX 1MSFC 1T8IA 5M5XJ 2K3FA 3HRUA 4C2MJ 2KKOA 4MQ9F 3QOEA 2OAZA 1LFPA 2NP5A 2HQAA 3TO7A 3ZQIA 2UXHA 2XDVA 1SAUA 2R7ZJ 2OQGA 3C7JA 3B02A 2L7FP 2OV7A 2WV0A 3CC7I 2VBXA 3DTIA 5CVVA 3ECOA 4HOBA 3TBIA 4EJWA 4F55A 2ZMEB 3LQRA 4JK1X 1I27A 2VT2A 1FYLA 2UXOA 3BCAA 3RD3A 2XPVA 3H3UA 2OBPA 2DQRA 2OQRA 2AXLA 2DOFA 4NC7A 1UG0A 3ZMUA 2VLAA 4MLOA 2WADA 2QUFA 3ABUA 3MQ0A 3O8HA 3HSEA 4IHWA 3BROA 2Y9YA 4ZYDA 3IUVA 3HSRA 3U21A 1XDUA 3A03A 3E7LA 3FM3A 2CH0A 1J5YA 4XKWA 5JVGF 4ACIA 3LAPA 2CMPA 3CJTB 1SFUA 1FNNA 5F0CA 3V8KA 4WK8F 3K4JA 1CGPA 1K78A 1IAWA 4MIMA 4F3QA 3FMSA 5KNLA 5F6FA 2P5LC 1MMNA 1WJFA 4KJZA 1UCRA 3M4OJ 3DU6A 3HRTA 2DCEA 1K83J 3JR9A 1SD6A 1S7EA 3TOAA 1QZYA 3UNGC 1LE8A 2EILH 5GPAA 2EIKH 3UR3C 4CICA 3OSFA 5BPIA 3BR1A 2HYTA 4EGYA 2O7TA 4EVIA 1OMIA 2VQHA 3OYNA 4RAZA 4L5IA 4LD5A 2QKLB 2PJRB 4RA2A 4EM1A 2FNPA 2KQRA 2Z5UA 3BTLA 3RPUA 4P9FA 1R5GA 4M73A 4A0XA 1SD7A 3KE2A 2KP6A 3LSGA 4DIQA 3QPSA 4I98B 3VTIA 1AU7A 2NVQJ 2PMHA 3PFYA 3OYCA 2XC7A 2OI8A 1RETA 2DFIA 3F8BA 3TL4X 1YJWI 3KFWX 1QPIA 2KRFA 3G6EI 2KIQA 1BM9A 3FWEA 3GBGA 3H36A 3VYUB 4KA4A 5CYVA 3HOYJ 4QTRA 3IKTA 5K58A 2V57A 1U78A 3DLAA 1DU0A 4UB6C 4N0BA 3PPBA 1FMWA 1PYVA 2AO9A 2GQQA 3BPVA 1B1BA 2K9MA 2WC2A 3CMEI 5A2QK 5J8FA 1TW2A 4YIRX 2R7XA 5A2QZ 4PJJA 2W48A 4HDVA 1R49A 4XL9A 2WBMA 1IN6A 1R5HA 3HOXJ 4OIPF 1J09A 2W85A 3K6GA 1W5TA 1JXSA 4OOIA 3HOVJ 2F5CA 2NXNB 3SEZA 4ANJA 1Y39A 4KYWA 2E1OA 2OU2A 4AIDA 2E2HJ 2E1NA 5K1YA 1IXSB 2LTPA 1HCRA 5JVTA 4ZTFA 2COBA 4KMFA 5K5OA 5HS7A 3GEZA 3O2PE 3TW7A 5HS9A 1AKHA 3ASNH 2RKHA 3H9GA 4BQQA 1YW9A 4CYCB 5ERIA 4MFEA 5IT9K 2JVGA 1FLIA 4XRMA 1BI1A 1S6LA 4A0ZA 3F23A 2ELKA 3HE0A 3LFKA 4NN1A 3OS1A 2CS3A 4HF0A 4AVPA 5HDKA 5CVJA 1JI8A 2KZVA 2HTJA 1ZLKA 3BJAA 2CJJA 2XPUA 3GF2A 2MD5A 4TV7A 4Y15A 2VONA 3H92A 2Y31A 2EZKA 3IAM2 1JT0A 1FP2A 2XF5A 3G71I 1K6YA 2IGMA 4XLAA 4Z2YA 5C3EJ 3MAJA 3CUQB 4FX4A 4P9UA 3PFIA 1NH3A 4B43A 4CA0A 5GTHC 5EZGA 3E5XA 5KCMA 4Q5SF 3E6CC 1I6HJ 1BJZA 2P0WA 2W57A 3R0AA 3OYFA 4JX4A 1X1DA 2DA1A 1GLNA 2EA4A 3PQJA 1R58A 3MVPA 4GCKA 3RQIA 3ZN0A 3S32A 3BG3A 1G3SA 3F6VA 4L9VA 4HLXA 3H3VK 1ZGJA 2VJIA 1MBHA 2ICWG 1Y8RB 2MGQA 4XLCA 2ZB9A 2IU5A 3E5QA 2IS6A 2HDCA 3ZQ7A 1QBJA 4UVCA 3N97A 3SXYA 1D8JA 1G3YA 2XHKA 2K7LA 2OJED 2ID3A 2N8GA 4FQGA 3W2VA 1XC5A 5D5XB 4OIOF 2ESHA 4HDUA 4CCLA 3T0YA 1QU3A 1UJ8A 2HDWA 2ZNZA 1EH6A 3VDXA 2HKOA 2VJ5A 4PJLA 5E3LA 2E1CA 2ZCWA 5FGLA 1H89C 5HLGA 1IO2A 2VUMJ 1W7PA 3LA7A 1BW5A 1S7AA 3ERED 5EYRA 2M7AA 4IF4A 4W97A 5HBUA 1IN5A 3SFZA 2G0EA 2O8KA 2R5YA 2VASA 2ZXWH 5CVRA 3ZMVA 4BXUA 1IZ1A 1E2XA 1TWHJ 1FSHA 3U9GA 1LQ1A 3SWHA 5HAWA 2CV0A 2LY2A 3BCBA 2FOWA 3K2AA 3U2RA 2HGCA 2XSJC 2ZCXA 4UHTA 3MMYB 2CW0F 4HEA2 4D5FA 3V6GA 4BKXA 2WAQN 4RLFA 1OYIA 4J19A 2OTJI 1FZPB 3HGYA 2V6CA 1VQ5I 1MNDA 1LVKA 2DDAA 2VKEA 2QSGX 3F9KA 4A3IJ 5EG0A 2HR3A 2XGEA 3OR1C 5H6RA 3P9KA 1V54H 3LSJA 3KYCB 1ZHFA 1OLTA 1SANA 3WG9A 3DWLE 3TP3A 2VN2A 2WTEA 2L9NA 3ZMZA 2H8RA 2OTLI 4S05A 3BY6A 1P4AA 3CMMA 3LL7A 1YJ9I 2DA6A 2VPLA 2EA2A 1BW6A 4RB3C 2LBFA 2EWNA 5FLXZ 5K5QA 2ZOYA 3GTKJ 3V4GA 4M71A 3S14J 1V55H 3BG9A 2JTVA 2CRGA 5HVQC 2QEXI 2D45A 3MNLA 3VPRA 4FASD 2FX0A 2Y69H 2KDZA 2UXXA 2GENA 3C3WA 2M87A 4LB5A 2XKOA 1XS9A 2OCCH 1WKMA 1YYVA 2ZC2A 2XKPA 4ITVA 3EUHA 4U0YA 1AKHB 4BAYA 1T0FC 3HTIA 5HLIA 1G2HA 2VPRA 4ZH4F 2GLOA 5GP9A 2PG4A 3K4MA 1DUXC 2EZIA 2XAGA 3F8NA 2JRMA 4UNOA 2W24A 5B66C 1I5ZA 5LD2C 3K4CA 4ICHA 2YSRA 3S2WA 3FXOA 1S7OA 3GTQJ 3VWBA 1FTZA 1E3OC 3SDBA 1VQ8I 2B1EA 1BL0A 2ESNA 3BJ6A 2UXPA 4KIBA 4M3GA 2Y75A 3BR3A 1IUYA 2XDNA 1MNEA 3CUQC 2KDOA 2PZ9A 2OERA 1Y1WJ 4Q4ZF 3FXRA 4IKFA 1J9IA 2XAQA 1YRNA 3CUQA 2Z3YA 2ZJPF 5EZHA 3HDDA 4P96A 1JJ8C 1YI2I 1TWCJ 5DEQA 2BHZA 1WJBA 1IW7F 4BBRJ 3R6SA 3C2BA 2B3WA 2A69F 4AU7A 2XB0X 1MBEA 4LMYA 1MJ9A 1MH3A 2NS8A 3CCRI 2STWA 2K9QA 4XLEA 2HXOA 1KYZA 1USSA 1BI3A 1MJAA 1I50J 5D5WB 4HQMA 2CO5A 1Z77A 3K4BA 3A0HC 4U0VA 3K70D 1ZK8A 3RDIA 5ILVA 4A12A 2PQ8A 1P7JA 1J75A 3HGGA 4HRIA 3ANPA 4M3EA 2P8TA 1TQMA 2HS5A 1JGSA 3I4PA 4RBOA 2JT1A 4IZZA 5ILUA 1KU3A 1IV8A 2QZ8A 3VIBA 2JJ7A 3ON4A 1Z3YA 4RB0A 2QQ8A 3WTSC 2DPUA 2JK3A 2ETHA 4B8XA 3FHNA 4D1QA 1SMTA 4PJ0C 3D0SA 4BE0A 2QLZA 1FEXA 2DPDA 2CQQA 3F8CA 3S8PA 1X3WB 4ZYGA 4FETA 6PAXA 2R7DA 3G7RA 1FOWA 1DP7P 2FQ4A 5IYCJ 2IT0A 3L09A 2DMPA 5J1RA 1DQUA 3HRSA 3ZOBA 1REPC 2JQ7A 2V26A 5HLHA 3G1MA 2M30A 2P7CB 3RZDJ 4HX8A 1HKTA 5HDNA 2LDUA 2E5ZA 2Y30A 5F0FA 3FISA 4CSWA 4L0ZB 1WH5A 2G7HA 4LK0F 3S16J 2I8DA 3KP4A 4XLHA 3N4MA 1EH7A 1MDMA 5HSZA 4E7LA 2JSCA 4BACA 2HQ5A 1ZTRA 2D2WA 3LSHA 4A3EJ 2UXNA 3FXUA 1ZG5A 3BZCA 3BR5A 3GLXA 2ZMEA 4PGHA 2DMQA 5LRRA 3Q0VA 2O3FA 1W36C 2A61A 4RLQA 2MSYA 2EFPA 1O3RA 4C2UA 1RRJA 1FPQA 2ME0A 2XRNA 4G6TB 1TQPA 2V4JC 4GFKA 4GYIA 4ENKA 1YE9A 1W5CC 3TP0A 4CCOA 1TLHB 3LQQA 3OY9A 3HOSA 3SFIA 1RC9A 3SZPA 1VNDA 2LRDA 5JHFA 3O8GA 2LFBA 1W5SA 4IL6C 2X6XA 3OYDA 1SFOJ 3JRAA 3Q9SA 2KISA 2DO7A 4AD9A 1RKWA 1ON2A 1T0FA 3DCFA 4Q47A 3D5RC 3I53A 4PJMA 1V3FA 5KK1A 2VOPA 3PUBA 2L4AA 3VP5A 2NVTJ 3L2VA 3GFJA 3I5UA 2HKXA 4IX7A 4XQFA 2V1UA 5TJJA 4BUPA 1WQ2A 3CF5F 2G9WA 2VE8A 3KP3A 2MC4A 4IEJA 4IVNA 4LIUA 3MFKA 3SDGA 3DF8A 5D4RA 5M3FJ 2PMZA 4G7ZF 4CO8A 3QPTA 3GX4X 2QVOA 4ZZDA 2DA2A 4ZYEA 2TDXA 1JKOC 1Z0XA 3LSRA 3VYRB 4IHSA 4IXAA 4RM3A 5IPAA 5DCMA 1P7IA 3S15J 3RPUD 1N75A 2R7SA 3BQZA 5LGNA 1Y0UA 3RKYA 1E3PA 1SEUA 3JCUC 5ICEA 4L18B 3DBHB 3C07A 4AWXB 3WG7H 1YX3A 2FJ1A 1Z7LA 4BHBA 3TGNA 3H35A 3ECHA 1FTTA 3PM1A 4ZZLA 1ZR2A 1Y6IA 3CQZJ 4M3FA 2IEKA 1BIAA 3VYTB 3MEXA 2VJ4A 3HTAA 2DFHA 4KT6A 4DBQA 2H6CA 3OYMA 1XGSA 2BVLA 1UG2A 4MGRA 2W53A 1Z6RA 4ESJA 2DT5A 2WB1N 4PDKA 5DUKA 3OSGA 4HSRA 5ICCA 2Z9OA 2LP0A 3M8FA 1R4NB 1HXDA 5K7HA 5F27A 4CCJA 1R22A 2O0YA 4RGRA 3BT9A 5DD4A 2VODA 3I3LA 2LBFB 5FLXK 3BDDA 3KKDA 3FKJA 2E7XA 2F48A 4N9HA 1BIBA 1O7LA 2HWVA 2K4BA 2ZO4A 2LF7A 4BH9A 4HQEA 4A2UA 1B9MA 1HA8A 1IRZA 5C4YA 1J59A 5HS8A 2P5KA 1MJBA 1MMGA 3EQLF 1JE8A 3LSPA 4F93B 3DKYA 3RSNA 3FHZA 3HL2A 1H88C 2BGCA 1ETXA 4NQWB 5BMZA 3HKZA 5DD8A 5F64A 2G7UA 4YZEA 1FYMA 4FE7A 4MTEA 1ACIA 5D19A 2WAEA 2IA1A 4M9SA 1B9NA 2CQKA 1D8KA 3OYBA 4KDPA 4Z6YA 2O9LA 4ENJA 3FM5A 1VZ0A 5D4SA 4RGSA 2LKXA 2PJRA 1X1BA 1XD7A 2FBIA 2E71A 3V78A 2OD5A 2VT3A 3C18A 4BQNA 1VI0A 2TRTA 3JRIA 2X9DA 1Z9CA 2UWMA 2EIMH 2BZTA 5ILSA 3ZQQA 2E2IJ 4LLNA 3D5LA 1WRJA 2ZKZA 3FXQA 1VF9A 4HKUA 3CCUI 1XSDA 1LKXA 1Z7UA 4AF5A 1K6OA 2EFWA 4AC0A 3P9CA 4R1HA 4GFLA 3CD6I 1HW1A 4GCLA 1H8AC 1GHCA 3KKCA 1JT6A 4HV5A 3KPHA 2E2JJ 4OU0A 2FE3A 3FMRA 4B1RA 4C9YA 4D0PA 2DJIA 2M45A 2HQNA 2PI0A 2XIGA 4ASNA 1YS7A 1IRXA 1RI7A 5DCFA 2ZJQF 4AYBN 3ZXSA 2FJI1 5EEHA 5DV5A 2DOAA 2IAIA 2XF6A 2FD5A 4D9JA 4HF1A 1ETVA 2JSPA 5E1ZB 4HPQA 4BXFA 1CF7A 5LBQA 5E79C 4CYDA 4N9IA 4XOTA 3WHCA 2PBIA 2A6HF 2W1OA 3AQTA 3SZGA 2NOGA 3NWTA 5AIPA 2JZYA 2RGVA 5H2FC 1MKMA 3WU0A 5L3BA 2L7MP 3F21A 2YVEA 3M1EA 4RGUA 2KZGA 1XX5A 3CDHA 5EEGA 2A5WA 4J00A 3CLOA 2DXIA 1F4KA 1Z05A 3OYIA 1DU6A 2K9SA 3CP2A 3KP7A 5B3SH 1A6QA 1XCBA 1KGSA 3L1PA 2Z33A 2BY3A 2E35A 3CZ6A 3ON2A 3GTMJ 3AL0B 4C2TA 3P9TA 1XSXA 4LJZF 1ZLJA 3T5XA 1RNLA 3U1KA 3JRFA 1H0MA 5LHGA 3KYDB 3QOPA 2X1EA 5BOXA 1VQLI 3S1QJ 2ME6A 2VE9A 2LG4A 2FSWA 1YRNB 1NG6A 4PK4A 5L3FA 2OA4A 4M3DA 4IRIA 3GZ5A 3AG4H 4CGZA 2DN0A 2LR8A 2AQFA 2DW4A 5CJ9A 3QU3A 4DGWB 4ME9A 3A1YA 4ZYHA 3ZGKA 3WU1B 2I5UA 3H0GJ 1A5JA 2HI3A 2Q2EA 1HSTA 2I10A 1O3TA 1OKRA 1OCRH 1W1WE 3WGGA 1I39A 4I02A 5JLWA 2QKMB 3ABLH 2IRFG 2R7TA 1VFCA 2BOLA 1P9QC 2M2EA 3DPJA 3T8TA 5ED4A 4WF2A 3R61A 4XNFA 4QPQA 1MH4A 1MZBA 3KLOA 2FBQA 1QVUA 5KHDA 3QKXA 5FLMJ 4X6AJ 1EF4A 1FY7A 1TZLA 3CDLA 1PVEA 3I9V2 3VSLA 4BHCA 2STTA 2EB7A 5F1RA 3LWFA 2F07A 1YIOA 5E1WA 3BCGA 3AG2H 5LHHA 2BXZA 4M72A 2E19A 3KZIC 2BE5F 5LLQA 4KITB 4AC6A 2WB1A 3A2KA 2MFZA 3PASA 4AYBA 2L2OA 3FX3A 1WWXA 1DPUA 3HBLA 3W2AA 4BY1J 2R7VA 4A3FJ 5FKMA 3J7ZI 3SHFA 3GTLJ 2JMWA 2M4GA 4WWCA 3CF2A 1KQ9A 2GWRA 4ABZA 2JWTA 3FF5A 3NEUA 3BTIA 1VQPI 4I76A 1R71A 2NOJB 2EZLA 2DA3A 3NARA 5EG0B 3FZVA 1ZH5A 4M6VA 3CMYA 2Y9ZA 4I0BA 4EQQA 3OS0A 3BNIA 2RVCA 3LSKA 1RZ4A 2DA7A 2LVSA 3WTXC 4JBAA 5LRSA 2GBYA 2ZSIB 1IJWC 3K2ZA 1C0WA 2A2FX 4G94A 1G3WA 4UB8C 2JPBA 2VC1A 5FD5A 1D1BA 3I59B 1BN5A 4PSWA 2K5CA 4CCKA 5EF6A 3GTOJ 2R5YB 1KU2A 3E1SA 1LFUP 1JTXA 4NNJA 1Q1VA 5J3LA 2FEZA 3V8JA 1P92A 3DLLF 2ECCA 2YVHA 2JA7J 2ZCMA 3K1NA 3OYGA 3PO3J 5E20A 3M07A 5EEAA 1W7PB 1HF0A 2MC3A 4F52A 2VQGA 4L9NA 1MBKA 4O3MA 2NS0A 3HEFA 1Z67A 4EJOA 2DBBA 3K10A 3GFLA 4OWRB 4H4KC 1NHAA 1BR1A 5EGOB 3L00A 3S3MA 4G9YA 1R4MB 2CUEA 4IPAA 2XRLA 2A6TA 2VKHA 3W2WA 1L3LA 1HBXG 4BBSJ 5J6XA 3CCQI 1XTAA 2DQLA 1FBUA 1PP8F 5FO5A 1ZQ3P 1EV7A 1MMDA 2ZCNA 5AONA 2REKA 3NXCA 3OYKA 2PMUA 1ZELA 5KVRA 2A6EF 4HYEA 5HNFA 3IH2A 5KAFC 2W4SA 2KT0A 3EYIA 1BR4A 4UUTA 5F04A 2R92J 1S9HA 1R7JA 1N25A 3DFGA 2IA2A 2HFHA 1EJ9A 3M8EA 3WGHA 2BY2A 1U9OA 4Y7NJ 4ESBA 3A4CA 2ADUA 2P81A 5EDNA 1TWFJ 4CH7A 3J80K 3G1OA 5FLVA 4IOAF 3CJDA 1ETOA 3GWZA 2YR2A 3F72A 3ERMA 4RM2A 1B59A 5BNGA 2R5ZA 3S93A 1U0JA 3HM5A 5K5RA 3I55I 2Z2SB 4EV0A 3IV5A 1E3HA 1ODDA 1DDNA 1JKQC 1OR7A 1IXCA 1ZGWA 2K9NA 2ZFUA 3GCMA 4MXMA 2GA2A 1OCPA 5J40A 3K4NA 3RYPA 4IHTA 5JLXA 2EV0A 4HX4A 1MIJA 2JA6J 1UI5A 2F5FA 5GADJ 4DYCA 4E70A 4IQJA 2MH2A 2E36A 3GYHX 5FROA 4EM0B 4EM2A 2YPRA 1WI3A 2A05A 3MCZA 3IHUA 4QIWN 2E34A 4BXXJ 2MBFA 2IGNA 1DGWY 4E7IA 4PXIA 3UKGA 3ROUA 3ZN1A 2QSHX 2AQEA 3ZQCA 3OYJA 1LUJB 4HAMA 2R0QC 2EBIA 4HBLA 4G7OF 2ZXHA 3HJEA 1A6IA 2DYSH 2L9SA 2H6BA 2BW3B 4A3GJ 1WSUA 2QF7A 1MDMB 1LE8B 3S2DJ 2OZ6A 4P5OA 4S0HB 2XSDC 1T33A 2DT6A 2F5VA 4F91B 3OYAA 1EKEA 3DKWA 3FDYA 4EGZA 2PFVA 4UV9A 1K4TA 2GOXB 1TT5B 1GXQA 5FKLA 4BHPA 3NRVA 3WTYC 2V9KA 1VQ7I 1D5VA 2XV4S 1F1ZA 1G6NA 1QGPA 4A3LJ 3GFIA 2PJPA 3H9JA 3WTTC 1Y8QB 5BPDA 1PDNC 2X48A 1R1TA 2JVHA 1X1AA 1QO0D 3RYRA 2AS5F 3BG7A 3AL0C 1O57A 5FKKA 2EZHA 2ELJA 4XSXF 3AQSA 4WXCA 5DS9A 3DPTA 1OR7C 3FMQA 3WE2A 5J1UA 3A01B 4DYRA 1FBSA 1ZR4A 1SFXA 4RB2C 3TW6A 1X3UA 3IC7A 4GCVA 1R36A 2RV8A 2DTRA 3MKYB 2F4OB 4B3XA 2YU9J 2HZTA 1T2KA 1SVMA 2C6YA 2DFEA 3BC8A 4IRHA 1LVAA 4BE2A 1LJ9A 2RQQA 3VODA 1BOAA 4IRGA 4QWQA 1BOBA 2YS9A 4AUXA 3QYBA 2IGOA 4NC8A 4DOZA 4BQAA 4GXOA 1RR8C 3O60A 1YO5C 2LF8A 2FRHA 1OCCH 3HC7A 1LNWA 3FXKA 2P6TA 5F0HA 2O6GE 3AFHA 3VW0A 4G6QA 3EGQA 3IP4B 4PSXA 3PO2J 1FWZA 2HKUA 1X4PA 2VBYA 3TMOA 2ZBKA 1F5TA 1FSEA 4AIJA 1N77A 1XMAA 1FJLA 1IXRC 2ISZA 3ML6A 4CZCA 3GZ6A 4UUVA 2YX4A 2BXYA 2K9LA 3IWFA 4BU2A 1LB2A 1YG2A 3WU2C 4FTHA 3H1CA 4EEFG 3S1MJ 2IS4A 1TWAJ 1G4DA 5GPCA 2K40A 2EQRA 3ELKA 1IC8A 3G1LA 2ID6A 1D0YA 1KQ8A 2Y48A 2HZDA 3CESA 3BPXA 2OCEA 4LB6B 3CCYA 4CHUA 4FT8A 1BI2A 5M5WJ 1S5LC 2LOOA 2XB5A 3WHBA 3ZP5A 3JREA 2XAJA 2QIBA 3DTKA 5LFAA 3NRGA 3VOKA 2M34A 4DW6A 5JHUA 4M9XA 2CQ7A 2BYVE 4I6ZA 4OMYA 4XBFA 1UAAA 4IHVA 2KFDA 5B5EC 5E3MA 1PUFB 1H9TA 2MW8A 4M6XA 4HNVA 2MYSA 5GAGJ 4XKBA 1Z91A 1R1UA 2QWWA 2CUZA 2HQRA 3KEYA 3F6OA 4L9JA 1WJDA 3C2GA 4NHJA 2H1KA 1Z6TA 4UUSB 4U9NA 3BJOA 3BZ6A 3GO5A 1S3JA 2O5RA 3IWZA 2W84A 1XB4A 2IS2A 1RKTA 1TWGJ 2V1XA 1VQ9I 2DTZA 2PN6A 1ZG1A 4Y13A 2YX7A 2NVUB 1WJCA 4ZDPA 4CXFA 2UV1A 5IOYA 2CSOA 4NC6A 3T1BA 4YFKF 4IRVA 3AAFA 1KA8A 2DAOA 3FKIJ 4KISA 5AQCA 1HC8A 2NAZA 3PSFA 4J01A 5B1AH 5D5UB 2L3DA 4OINF 4U7DA 2CUFA 2ZNYA 3OWTA 1VQMI 3GEUA 5D1RA 3H0DA 5K7FA 3P7NA 1MBFA 2VKVA 3H5NA 2NVXJ 1UI6A 2L0KA 3W6JB 2RN7A 3R0JA 4XORA 3TOBA 4G12A 2HOAA 3HPHA 3QPHA 2DI3A 1FP1D 1HSJA 2EFOA 4LG3A 2VIXA 4PCQA 1U5TC 3B6CA 2LLKA 3LNQA 2ISYA 1KYWA 3HOZJ 5IOZA 4KN4X 3IRRA 2Y0SN 2RQPA 5LGTA 3KZZA 4P55A 5TGTA 1APLC 3GW2A 1YW7A 2M9HA 4MFDA 1R1VA 4O6JA 2IXSA 3KP6A 3ZQFA 5E1XA 1GV5A 1XCVA 4B09A 2R3SA 1S8NA 4HLYA 2M1BA 3RTRA 2P7VB 2WWYA 2DU9A 2GXBA 4DZPA 1MD0A 3G3ZA 2EV5A 4V2FA 1TT0A 4ZYAA 1V5GA 3JSOA 1GXPA 1XN7A 2HYJA 4GO1A 2G7LA 4GCTA 1ETKA 1HQCA 4XLNF 5CVUA 3AKZA 1X19A 1N78A 3NNRA 1JUSA 2LD5A 1UB9A 5H9TA 5FD6A 5GTIC 3HG9A 3S2HJ 1ZREA 3KETA 2PBXA 1FYKA 1UHSA 2HYFA 4A3KJ 3EUPA 2D1VA 2H8WA 3ABTA 3GZNB 4D7NA 3G56A 4BJ6C 4KT5C 1B6AA 4I0AA 2E7WA 2QBYA 3CJNA 3KYLA 2BY0A 1Z21A 3L2UA 3LHQA 1YIJI 2IBDA 1R23A 4CGRA 2MLKA 2R93J 1D1AA 1HKSA 2K27A 3M3YJ 3HTJA 3E0JB 3LSMA 3L2QA 3NS4A 3PQKA 4XRFA 3GFMA 2QCOA 1XGNA 1L0OC 4M6YA 2JUCA 2UUZA 4DNCA 1ZKGA 3FXLA 5BS6A 5E17F 1A35A 2GZWA 5J1YA 3A0BC 3GTJJ 5BQTA 2ELHA 3SQNA 3IUOA 4RB1A 2VQLA 2M8GX 3DEUA 3BQYA 2L4MA 1QZZA 3V7RA 1WI9A 1QHGA 2CV2A 2Y0MA 1Z1DA 3J7AY 3CLQA 3V7CA 5E3OA 2GOMA 2EJRA 1MSEC 1D0XA 1ZN2A 2CUJA 3BG6A 1BC7C 1LDDA 3EPZA 3FXJA 3QQAA 3VYSB 2BEOA 4XK4A 5IY5H 4H0EA 1F36A 4Y4RA 3E6BA 3ONQA 1QVTA 4CYCA 3JSPA 4BDYA 2NS7A 5CQEA 2NRAC 2M7BA 1OCZH 1RPWA 3Q0UA 2R7QA 4MEYF 3BR6A 3S3NA 3E7QA 3I4NJ 2WY7Q 3F22A 4OIRF 2KLOA 3D5SC 4L5EA 2GUHA 1OFCX 2E1MC 2DFFA 4XLFA 2YU3A 2OZUA 1SMYF 3Q9VA 4YRVA 1Y1VJ 3RCOA 4LG0B 2Z16A 3ZQHA 1I1GA 2BHYA 1RR7A 2L9VA 5FGMA 4KNYA 2MABA 4FISA 4OAZA 1UELB 1WH7A 3FBNB 1OCOH 4IHXA 3M1CA 3VOEA 1UMQA 3JRGA 4ETSA 1ZYRF 2QSFX 3MD2A 2L5QA 2QWTA 2NX4A 2BV6A 5FKNA 1FIAA 2WA0A 4HW0A 2NYXA 3RPQA 2M8EA 4MNUA 2HEOA 4GGGA 1UZCA 4N4NB 4IHYA 5DTDA 2NP3A 3WTZA 2E5NA 2F5DA 1UHMA 3VFZA 4R79A 2IA0A 1OCTC 2R4GA 1IN4A 4MTDA 2H1LA 2CYYA 4Y33A 3DP7A 3HOUJ 3GTGJ 2R7FA 2RC4A 4KWAA 4RAGA 2AXTC 1RIOH 2M0MA 2JA5J 2FBHA 1XG1A 3BLYA 4UVBA 2M3AA 3H5RA 3ESWB 4JX5A 4P1WA 1U8RA 4LG0A 3V7SA 1QPMA 4I7HA 1D1CA 3LAJA 3HOTA 2COMA 3GVAA 2B0LA 4EATA 1X3ZB 1M1EB 2RNJA 2ZY9A 1AA7A 1RUOA 1A31A 1V5EA 3QU6A 2XAFA 3EETA 2A5YB 3ZMSA 2V6EA 3PNVA 1HKQA 2Y2ZA 4XKVA 3WGIA 1I1SA 1B8IB 4X0GA 5F08A 4HSTA 2K3PA 2LKSA 1ENHA 3DV8A 1ZGAA 5CLSA 3P9IA 3F8MA 1K78B 3I71A 1EH8A 4S04A 3MKLA 4HNTA 4E7ZA 1F43A 4ENMA 2IP2A 4QPOA 1HDPA 1OYWA 3VB2A 3JRCA 3GZIA 2P4WA 2QQBA 4BE1A 2DG7A 5TISC 2HVQA 1E0EA 1FX7A 1Q1HA 3HTSB 4IQ4A 5D8LB 4ESFA 1O3QA 3QWLA 2HNHA 5JI6A 2V1NA 2VXDA 3Q3SA 4BEHB 3ZQLA 1O3SA 3I58A 3TDZC 3HOWJ 3OOPA 4V19K 1IRFA 4BL0B 1USTA 3BG5A 4GDFA 1MNMC 1O4XA 2QBYB 1GV2A 3JW4A 2V79A 4L5JA 4ENNA 3RI4A 1T38A 3VUQA 2DDBA 1ORKA 4Q48A 1BJAA 5J8CA 2DG8A 4E7KA 3FRQA 4UXNA 1UHWA 4CCMA 2HU9A 1GVJA 4D5CA 1ON1A 3OMYA 1SVLA 2L54A 2HPMA 5GAHJ 3HTUA 2CG4A 5F1JA 3CP8A 5D6EA 2UXIA 1LFBA 4DQ2A 4NBQA 2NNNA 2XF7A 2ZMEC 4WXDA 4BS9A 4YFNF 2Z99A 5EGOA 2CU7A 3F3XA 4I01A 5H20A 4ZTJA 4XN0A 1WJEA 3ZMDA 2GXAA 1U2WA 3J80Z 2JUGA 1U5TB 4NDLA 4N4OB 2FU4A 3KZ9A 1T6SA 4U0WA 5FFXA 4B44A 4LITA 3QP5A 1YITI 3G2BA 1IF1A 1Y0NA 2F4IA 5IT3A 3COLA 1FBQA 2KHMA 3O3KA 3L9FA 1XGOA 4A0YA 3J7YJ 3OIOA 1HLVA 2G7SA 2QKOA 2O03A 1YOVB 4YG2F 3ZR8X 1P4XA 5DDGA 1JGGA 2RDPA 3ASOH 1GDTA 2HOEA 4PFOA 4XONA 1X4OA 3TO9A 2LY9A 2UXUA 2CW8A 1WJ5A 1KQ0A 2F6CA 4PUSA 2NNYA 1YFHA 5LEKA 3M7GA 4PFPA 3JRHA 3MKWB 1AHDP 3VSKA 2DYRH 2PFBA 4QLCU 1B72B 1R6RA 3K70C 4XRSA 5HLTA 3VW2A 2GIVA 3Q0WA 1ERDA 3LOCA 3TEDA 3JAMK 3A02A 1XPXA 5CXGA 3TDUC 2KIUA 4DZJA 4A3CJ 3JAMZ 3QP6A 4WIBA 2VKDA 4C2MA 2FMYA 2XAHA 4KIGA 2VB6A 3PUFA 3VVYA 4E6KG 3L2CA 4XRSG 2DA4A 2K85A 2LSOA 1SD4A 3RJPA 1TQIA 5CQGA 2ZFWA 1A04A 4FHTA 3HUGB 1D3YA 2MLGA 2JPCA 2B9SA 1O7FA 1ZRDA 3LSTA 4YEJA 2WV1A 4AIHA 4ZDOA 2LREA 5E8GA 2DMNA 2M4KA 4BY7J 2VC0A 4C3HJ 1MBJA 1FOXA 4LLGF 5IT9Z 4JKZA 3DTEA 3I56I 3LWJA 2V7FA 1I3AA 1SFKA 1ETYA 4RGXA 2KRHA 1W7PD 3PSIA 3CC4I 2EFNA 5M3MJ 4KFCA 2WGBA 1X58A 1Z3XA 2LC2A 2KMUA 5M5YJ 4AM3A 3BRUA 3BP8A 5FHPA 3WODF 2OPTA 3RH2A 2MD0A 2DOEA 3QYEA 2W25A 3AG1H 4I2OA 1D5YA 3KNWA 1JKRC 4BQOA 2R7WA 3ZMTA 5CXIA 2IVMA 2EPFA 4W1UA 2PEXA 2Q24A 3HTHA 2KPMA 3RQ4A 1BBYA 5FKOA 3OOUA 4CZZA 4HF2A 2KJCA 3OIQA 4K2EA 1X1PA 2QOPA 2RHAA 2XGDA 5D8KB 1NG7A 2W7NA 3MWMA 3EUHC 1LPQA 4A6DA 3V42A 1FC3A 2Q1ZB 3K1MA 4IJAA 1LEBA 1FMVA 4M9ZA 2QGUA 1KZHA 1RUNA 2DMTA 3KP5A 1P6RA 2QQAA 2BVMA 2XPWA 4MO7A 3CCEI 2YUSA 1J2XA 2JA8J 4M3BA 1JKPC 4E7SA 3CCLI 2CWEA 5CW8A 3BZKA 3BWGA 3E6MA 4U87A 3WTUC 1TW3A 5CPRB 5E18F 5DUIA 1GT0C 4XMYA 5C4XJ 3CO6C 4OIQF 4V2GA 4Y3OA 4U7BA 3MZYA 2F2EA 2L7KA 3NWSA 3EDPA 1DGRM 1R5ID 4NUBA 3HPGA 2H27A 2X4HA 4OAYA 1XMKA 4A3JJ 3CJRB 5HODA 2A68F 3QPLA 1SGMA 1LEAA 4XICA 2LYCA 3OS2A 5J4YA 3JRDA 4F7ZA 3L2RA 3E6DA 1H9GA 3ULQB 4II3A 2KIFA 4WXHA 3R4KA 1XMXA 4O5VA 3OYHA 2LKPA 3HSFA 1IUFA 4OD5A 2V9VA 2LK2A 2DJNA 3HUGA 1K7AA 2Q0OA 4XR6A 5LHIA 4ZDLA 3EUKL 3U1DA 2FXAA 4I99C 2B7EA 3E97A 3DXJF 3RKQA 4RS8A 1D0ZA 3J81K 3DBLB 3KP2A 3VEPA 1Y56A 1B8IA 2ACJA 4LIVA 1U9NA 3HYIA 3K7AJ 3G4SI 3MKZA 3ANGA 3RKXA 2PX9A 2BY1A 2UZKA 4A6EA 2BW3A 4BDZA 4E7HA 3FBIB 1OYYA 2K86A 4U88A 4A93J 4XN3A 4G7HF 1T98A 4HZFA 2QM3A 1V4RA 5C4JJ 3PJRA 4XOPA 3JSJA 2J5PA 2ZJ2A 1IV6A 4RDUA 3SJMA 5D6FA 3DEEA 3E5UA 1J0RA 1OPCA 3HB9A 4MHGA 1TP4A 5L3EA 4ON0A 3ISPA 4NELA 3OIPA 5IYBJ 3I64A 4LGWA 3FIWA 4UDSA 2W00A 4YELA 3S1NJ 2RAEA 4HG2A 2ZJRF 5IP6A 3BOQA 2LH9A 3TO6A 4ZC3A 4XLPF 3I54A 1STZA 1WVRA 4NB5A 3MN2A 2KJBA 3WE3A 3H9QA 1JUPA 1TNTA 1U5TA 3WTVC 2WY8Q 2R5ZB 1YW8A 4CDGA 3Q5FA 1MGTA 2GAUA 2FBKA 1G3TA 2V1DA 2VJJA 2X85A 1T39A 2FQ3A 1R00A 4R8HA 3QRFF 5B1BH 1VQ6I 1WPKA 4DBRA 1MMSA 1HW5A 1K4SA 1U3EM 3LFUA 2DLLA 1I6XA 2L9RA 3L7WA 3OL3A 2GXGA 4C30A 1YX5A 1ZG3A 3CUOA 4DYQA 1TL8A 3VVZA 1MBGA 1B72A 2FMLA 1WZ2A 3W6VA 3CJQB 1W0TA 1JUMA 3E3VA 1BI0A 1K79A 1QRYA 2MG4A 3DU5A 3ZQGA 4HNUA 3J7AO 3EUAA 4CCNA 2QENA 3DQVC 2Q8KA 1X1CA 3IKVA 2OC6A 3ZRGA 3CDIA 4BJ5C 1WGXA 3TQNA 5FRMA 5DCMB 4DJAA 2EIJH 4DVYP 3OL4A 3S1RJ 2VI6A 4QSHA 4OMZA 1ITYA 3IH3A 4XSZF 3KEOA 3REOA 2R7UA 1IDZA 1PJRA 3K1PA 4KUMA 3MZ8A 4BYYA 3S5RA 2EH3A 3CCVI 2HDDA 4A5MA 2G7GA 3F8FA 2LMDA 1YHQI 2GM4A 1VQ4I 3BR2A 1U6GA 2EFQA 1UFMA 1W0UA 4AVZA 1VQOI 1IG7A 3H5AA 4ZJZA 5IYDJ 1W4MA 3HKZN 2EK5A 1TNSA 1OQYA 1JTYA 3DPUA 1IN7A 2VQCA 1R9TJ 4WCGA 3TKYA 4G8XA 5GAEJ 4E4HA 1FT9A 5IP9J 1ZRFA 3NI7A 5FB2A 2O8XA 2VBZA 2A3SA 2PLYA 1T95A 3FK7A 4LFUA 4JNNA 3K4KA 3G73A 4Y52J 2D1HA 4B47A 1B4AA 2FA5A 1SVOA 4I09A 2WAQA 1JJ6C 1XGMA 2FF4A 3ZCOA 3FXMA 2XROA 2JA2A 5H6QA 3HHHA 9ANTA 3JTGA
chains in the Genus database with same CATH topology
1QVUA 3B81A 1RR7A 2IU5A 3CRJA 3QKXA 5FLMJ 4A3BJ 4X6AJ 1EF4A 5IP7J 3CDLA 2CQXA 4FISA 4JL3A 3I4MJ 1BA5A 1WH7A 2F07A 4IHXA 3JRGA 1UMQA 2ID3A 2N8GA 1XC5A 3BCGA 1I3QJ 2QWTA 2NX4A 2E19A 5FKNA 1FIAA 2ZOZA 5E3LA 2DMUA 4AC6A 5FGLA 1H89C 5FJ8J 1T56A 3PASA 2VUMJ 4IHYA 5DTDA 2NP3A 3HBLA 4BY1J 4A3FJ 1X2MA 5FKMA 2X6OA 1OCTC 1BW5A 3NPIA 5EYRA 4FE4A 4W97A 3B6AA 2JMWA 4D7MA 3GTLJ 5D18A 5HBUA 2ECBA 2G0EA 2O8KA 4ABZA 3GTGJ 2R5YA 3HOUJ 4KWAA 3BR0A 1GUUA 2JWTA 3BTIA 2JA5J 4I76A 5C44J 1XG1A 2RASA 2EZLA 2DA3A 1TWHJ 3NARA 5EG0B 4M6VA 4JX5A 3CMYA 2Y9ZA 5HAWA 4B4CA 4B3AA 3BNIA 3LJLA 3K2AA 2ZCXA 2DA7A 2LVSA 4D5FA 3V6GA 4BKXA 2WAQN 4J19A 1NK2P 2GBYA 1IJWC 3HGYA 2VKEA 3BTCA 4A3IJ 3VW1A 5EG0A 2XGEA 2Y2ZA 1B8IB 5F08A 3LSJA 5EF6A 3GTOJ 2R5YB 1ENHA 2L7ZA 1SANA 1JTXA 1LFUP 2WUIA 1Q1VA 5J3LA 3TP3A 4C3IJ 1IGNA 2YVHA 2ECCA 3MKLA 2H8RA 2JA7J 2ZCMA 1F43A 3PO3J 1HDPA 3JRCA 5EEAA 3GZIA 2DA6A 1HF0A 1BW6A 3FK6A 2G3BA 1MBKA 2HXIA 3HEFA 2DG7A 2ZOYA 3GTKJ 3S14J 3BG9A 2CRGA 3MNLA 3VPRA 5EGOB 2FX0A 1HDDC 2KDZA 1RESA 2CUEA 2HOTA 2GENA 2XRLA 3Q3SA 3BHQA 3ZQLA 1XS9A 4BBSJ 2HOSA 3HOWJ 1AKHB 1ZQ3P 2D6YA 3HTIA 2ZCNA 1G2HA 3BG5A 2VPRA 2GLOA 2REKA 1MNMC 1O4XA 3NXCA 5GP9A 1GV2A 2EZIA 3VUQA 3F0CA 1ORKA 2DG8A 3IH2A 1GVDA 3FRQA 5EFYA 2KT0A 5F04A 4UUTA 2R92J 1ETQA 4D5CA 4ICHA 2M0CA 3GTQJ 1FTZA 1E3OC 5F1JA 1BL0A 2UXPA 1K61A 2UXIA 1LFBA 1U9OA 4Y7NJ 4M3GA 3VVXA 3BR3A 3D1NI 2XDNA 3NAUA 2P81A 1U8BA 5EDNA 1TWFJ 2OERA 2PZ9A 3G1OA 2CU7A 2DA5A 5EGOA 1Y1WJ 5FLVA 1ETOA 3CJDA 4JYKA 4A69C 1IDYA 5BNGA 2R5ZA 1YRNA 3RZOJ 5EZHA 3HIMA 3HM5A 3HDDA 2XGCA 4NDLA 3IV5A 3JRBA 1JJ8C 2B63J 3KZ9A 1TWCJ 4C3JJ 4L62A 1JKQC 4BBRJ 3C2BA 2AHQA 1ZGWA 3COLA 2K9NA 2XB0X 2QTQA 1MBEA 4MXMA 1OCPA 2NS8A 1MH3A 4X1EA 2K9QA 2HXOA 3OIOA 1HLVA 5JLXA 2G7SA 1I50J 3IH4A 2QKOA 2JA6J 1Z77A 4A3MJ 1UI5A 4DYCA 4MK6A 1ZK8A 2JN6A 1CQTA 1JGGA 1P7JA 1GDTA 1WI3A 3HGGA 4QIWN 3ANPA 4M3EA 2LY9A 2UXUA 4BXXJ 4PXIA 4JX6A 1HOMA 4RBOA 3UKGA 3DEWA 3ZQCA 3VOXA 2R0QC 2D5VA 2EBIA 3VIBA 2JJ7A 3ON4A 3JRHA 1A6IA 1FIPA 1AHDP 2JK3A 1B72B 4A3GJ 4XRSA 2QF7A 1LE8B 3S2DJ 3VW2A 2NVYJ 1OJLA 1FEXA 3Q0WA 4S0HB 3LOCA 2XSDC 2CQQA 3TEDA 3A01A 5DAJA 1T33A 3A02A 5CXGA 3BTJA 4DZJA 4A3CJ 3G7RA 1X2NA 1POGA 2FQ4A 5FKLA 5IYCJ 4GFBA 2DMPA 2PMZN 5J1RA 4FCYA 4A3LJ 3ZOBA 3VVYA 4XRSG 2DA4A 2X48A 3G1MA 4UUSA 3RZDJ 5FKKA 2EZHA 3S17J 1TC3C 3CWRA 3AQSA 3T6NA 5DS9A 2Y30A 5F0FA 2WV1A 3FISA 5FMPA 3A01B 1WH5A 5J1UA 1PUFA 3F1BA 4DYRA 2DMNA 1ZR4A 3S16J 5E3NA 4BY7J 4C3HJ 1MBJA 3TW6A 4JKZA 5HSZA 3LWJA 2HQ5A 1ETYA 2YU9J 1ZTRA 3QBMA 4A3EJ 3BR5A 5M3MJ 2WGBA 1X58A 5M5YJ 3BRUA 2DMQA 2O7OA 5FHPA 3Q0VA 2OPTA 3RH2A 2MSYA 3BJBA 2YS9A 4AUXA 1D5YA 3KNWA 1JKRC 2ME0A 4GFKA 5CXIA 3TP0A 3O60A 4LOCA 4W1UA 3SFIA 2Q24A 3HTHA 4JP0A 1VNDA 4A3DJ 5F0HA 3O8GA 2LFBA 5FKOA 3OOUA 3VW0A 1SFOJ 5K7ZA 3JRAA 2QOPA 2RHAA 2XGDA 3EGQA 1RKWA 3DCFA 4XIDA 2TCTA 3PO2J 1ETWA 1WCMJ 2HKUA 2GFNA 3VP5A 2NVTJ 2OF7A 1NK3P 2DMTA 1NTCA 1FJLA 2XPWA 3GTPJ 4MO7A 2YUSA 2JA8J 4M3BA 4IEJA 5M3FJ 1JKPC 3SDGA 1MSFC 5M5XJ 4C2MJ 5CW8A 3S1MJ 4FTHA 4EEFG 1TWAJ 2DA2A 5GPCA 2K40A 2EQRA 1GT0C 1IC8A 1JKOC 5C4XJ 1Z0XA 3G1LA 3LSRA 2NP5A 2ID6A 4V2GA 3ZQIA 2UXHA 5IPAA 2R7ZJ 3S15J 1P7IA 3BQZA 2L7FP 3CCYA 3C07A 5M5WJ 2FJ1A 2XB5A 3WHBA 4A3JJ 3JREA 1FTTA 2QIBA 3PM1A 2UXOA 1ZR2A 3RD3A 3CQZJ 2XPVA 4M3FA 5HODA 2IEKA 3NRGA 3QPLA 1SGMA 3VOKA 4XICA 2M34A 3HTAA 4DW6A 1UG2A 2W53A 3JRDA 4MLOA 4I6ZA 4IHVA 3OSGA 2WB1N 3O8HA 5E3MA 1PUFB 4IHWA 2Y9YA 3IUVA 2MW8A 4HNVA 2LP0A 5K7HA 1IUFA 3A03A 3E7LA 5F27A 2LK2A 2DJNA 3BT9A 3KKDA 4ACIA 2H1KA 4UUSB 5F0CA 1IRZA 5C4YA 3RKQA 4MIMA 1RKTA 1TWGJ 2DTZA 3LSPA 3M4OJ 1B8IA 1U9NA 1H88C 1ETXA 3K7AJ 3ANGA 4YZEA 1K83J 3JR9A 1S7EA 4FE7A 1LE8A 5IOYA 5GPAA 5D19A 4A93J 3OSFA 3BR1A 3FKIJ 2HYTA 5AQCA 2O7TA 2O9LA 5C4JJ 3JSJA 2CUFA 1IV6A 2LKXA 4RDUA 3GEUA 3BTLA 5D1RA 5K7FA 3SJMA 1MBFA 2VKVA 3HB9A 3V78A 1VI0A 2NVXJ 1UI6A 2TRTA 2L0KA 4NELA 3LSGA 5IYBJ 3JRIA 4G12A 2HOAA 2X9DA 3FIWA 3QPSA 4UDSA 2E2IJ 1AU7A 2NVQJ 1VF9A 3S1NJ 4HKUA 2OI8A 2RAEA 1RETA 4AF5A 5IP6A 4AC0A 3B6CA 2LLKA 1QPIA 3LNQA 4GFLA 3HOZJ 5IOZA 4GCLA 1H8AC 2Y0SN 3GBGA 3KKCA 3HOYJ 1JT6A 3MN2A 1APLC 4QTRA 2E2JJ 2M9HA 4B1RA 4MFDA 2V57A 5K58A 1JUPA 1U78A 1DU0A 3ZQFA 3PPBA 1GV5A 2AO9A 2R5ZB 2W48A 4DZPA 4AYBN 3HOXJ 4V2FA 1WPKA 2HYJA 2IAIA 2G7LA 4GCTA 1ETKA 2FD5A 3HOVJ 1ETVA 3NNRA 2L9RA 1JUSA 2LD5A 5H9TA 3WHCA 4DYQA 3S2HJ 3VVZA 2PBXA 2E1OA 1MBGA 1UHSA 2E2HJ 3AQTA 1B72A 2NOGA 4A3KJ 3EUPA 3W6VA 1W0TA 4D7NA 1JUMA 3G56A 2LTPA 1HCRA 2L7MP 1QRYA 2MG4A 2YVEA 3ZQGA 2COBA 3LHQA 3TW7A 2IBDA 1AKHA 4CGRA 2R93J 1WGXA 4CYCB 3M3YJ 3HTJA 4MFEA 1DU6A 2K9SA 3S1RJ 2VI6A 4QSHA 1ITYA 3IH3A 4XRMA 2QCOA 1IDZA 3L1PA 2ELKA 3HE0A 3ON2A 1ZKGA 4NN1A 3GTMJ 3S5RA 2EH3A 5J1YA 3GTJJ 2HDDA 2G7GA 3P9TA 2GM4A 2CJJA 2XPUA 2M8GX 3BR2A 3JRFA 3BQYA 1W0UA 1IG7A 2Y31A 2EZKA 1JT0A 5IYDJ 3HKZN 3S1QJ 2ME6A 5C3EJ 5E3OA 1YRNB 1JTYA 4M3DA 1MSEC 2DN0A 1R9TJ 2LR8A 3QQAA 5IP9J 4ME9A 4XK4A 5EZGA 3NI7A 3H0GJ 1F36A 1A5JA 2HI3A 2I10A 1QVTA 1BJZA 3FK7A 4CYCA 1I6HJ 4JNNA 2NS7A 4Y52J 4JX4A 2DA1A 1RPWA 3Q0UA 3BR6A 1JJ6C 3MVPA 5JLWA 3I4NJ 3E7QA 3RQIA 4GCKA 4L5EA 2GUHA 1OFCX 3BG3A 1VFCA 2M2EA 3H3VK 3DPJA 1MBHA 2MGQA 1Y1VJ 1MH4A 9ANTA 2FBQA 3ZQHA 2ZB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVU A;  3B81 A;  1RR7 A;  2IU5 A;  3CRJ A;  3QKX A;  5FLM J;  4A3B J;  4X6A J;  1EF4 A;  5IP7 J;  3CDL A;  2CQX A;  4FIS A;  4JL3 A;  3I4M J;  1BA5 A;  1WH7 A;  2F07 A;  4IHX A;  3JRG A;  1UMQ A;  2ID3 A;  2N8G A;  1XC5 A;  3BCG A;  1I3Q J;  2QWT A;  2NX4 A;  2E19 A;  5FKN A;  1FIA A;  2ZOZ A;  5E3L A;  2DMU A;  4AC6 A;  5FGL A;  1H89 C;  5FJ8 J;  1T56 A;  3PAS A;  2VUM J;  4IHY A;  5DTD A;  2NP3 A;  3HBL A;  4BY1 J;  4A3F J;  1X2M A;  5FKM A;  2X6O A;  1OCT C;  1BW5 A;  3NPI A;  5EYR A;  4FE4 A;  4W97 A;  3B6A A;  2JMW A;  4D7M A;  3GTL J;  5D18 A;  5HBU A;  2ECB A;  2G0E A;  2O8K A;  4ABZ A;  3GTG J;  2R5Y A;  3HOU J;  4KWA A;  3BR0 A;  1GUU A;  2JWT A;  3BTI A;  2JA5 J;  4I76 A;  5C44 J;  1XG1 A;  2RAS A;  2EZL A;  2DA3 A;  1TWH J;  3NAR A;  5EG0 B;  4M6V A;  4JX5 A;  3CMY A;  2Y9Z A;  5HAW A;  4B4C A;  4B3A A;  3BNI A;  3LJL A;  3K2A A;  2ZCX A;  2DA7 A;  2LVS A;  4D5F A;  3V6G A;  4BKX A;  2WAQ N;  4J19 A;  1NK2 P;  2GBY A;  1IJW C;  3HGY A;  2VKE A;  3BTC A;  4A3I J;  3VW1 A;  5EG0 A;  2XGE A;  2Y2Z A;  1B8I B;  5F08 A;  3LSJ A;  5EF6 A;  3GTO J;  2R5Y B;  1ENH A;  2L7Z A;  1SAN A;  1JTX A;  1LFU P;  2WUI A;  1Q1V A;  5J3L A;  3TP3 A;  4C3I J;  1IGN A;  2YVH A;  2ECC A;  3MKL A;  2H8R A;  2JA7 J;  2ZCM A;  1F43 A;  3PO3 J;  1HDP A;  3JRC A;  5EEA A;  3GZI A;  2DA6 A;  1HF0 A;  1BW6 A;  3FK6 A;  2G3B A;  1MBK A;  2HXI A;  3HEF A;  2DG7 A;  2ZOY A;  3GTK J;  3S14 J;  3BG9 A;  2CRG A;  3MNL A;  3VPR A;  5EGO B;  2FX0 A;  1HDD C;  2KDZ A;  1RES A;  2CUE A;  2HOT A;  2GEN A;  2XRL A;  3Q3S A;  3BHQ A;  3ZQL A;  1XS9 A;  4BBS J;  2HOS A;  3HOW J;  1AKH B;  1ZQ3 P;  2D6Y A;  3HTI A;  2ZCN A;  1G2H A;  3BG5 A;  2VPR A;  2GLO A;  2REK A;  1MNM C;  1O4X A;  3NXC A;  5GP9 A;  1GV2 A;  2EZI A;  3VUQ A;  3F0C A;  1ORK A;  2DG8 A;  3IH2 A;  1GVD A;  3FRQ A;  5EFY A;  2KT0 A;  5F04 A;  4UUT A;  2R92 J;  1ETQ A;  4D5C A;  4ICH A;  2M0C A;  3GTQ J;  1FTZ A;  1E3O C;  5F1J A;  1BL0 A;  2UXP A;  1K61 A;  2UXI A;  1LFB A;  1U9O A;  4Y7N J;  4M3G A;  3VVX A;  3BR3 A;  3D1N I;  2XDN A;  3NAU A;  2P81 A;  1U8B A;  5EDN A;  1TWF J;  2OER A;  2PZ9 A;  3G1O A;  2CU7 A;  2DA5 A;  5EGO A;  1Y1W J;  5FLV A;  1ETO A;  3CJD A;  4JYK A;  4A69 C;  1IDY A;  5BNG A;  2R5Z A;  1YRN A;  3RZO J;  5EZH A;  3HIM A;  3HM5 A;  3HDD A;  2XGC A;  4NDL A;  3IV5 A;  3JRB A;  1JJ8 C;  2B63 J;  3KZ9 A;  1TWC J;  4C3J J;  4L62 A;  1JKQ C;  4BBR J;  3C2B A;  2AHQ A;  1ZGW A;  3COL A;  2K9N A;  2XB0 X;  2QTQ A;  1MBE A;  4MXM A;  1OCP A;  2NS8 A;  1MH3 A;  4X1E A;  2K9Q A;  2HXO A;  3OIO A;  1HLV A;  5JLX A;  2G7S A;  1I50 J;  3IH4 A;  2QKO A;  2JA6 J;  1Z77 A;  4A3M J;  1UI5 A;  4DYC A;  4MK6 A;  1ZK8 A;  2JN6 A;  1CQT A;  1JGG A;  1P7J A;  1GDT A;  1WI3 A;  3HGG A;  4QIW N;  3ANP A;  4M3E A;  2LY9 A;  2UXU A;  4BXX J;  4PXI A;  4JX6 A;  1HOM A;  4RBO A;  3UKG A;  3DEW A;  3ZQC A;  3VOX A;  2R0Q C;  2D5V A;  2EBI A;  3VIB A;  2JJ7 A;  3ON4 A;  3JRH A;  1A6I A;  1FIP A;  1AHD P;  2JK3 A;  1B72 B;  4A3G J;  4XRS A;  2QF7 A;  1LE8 B;  3S2D J;  3VW2 A;  2NVY J;  1OJL A;  1FEX A;  3Q0W A;  4S0H B;  3LOC A;  2XSD C;  2CQQ A;  3TED A;  3A01 A;  5DAJ A;  1T33 A;  3A02 A;  5CXG A;  3BTJ A;  4DZJ A;  4A3C J;  3G7R A;  1X2N A;  1POG A;  2FQ4 A;  5FKL A;  5IYC J;  4GFB A;  2DMP A;  2PMZ N;  5J1R A;  4FCY A;  4A3L J;  3ZOB A;  3VVY A;  4XRS G;  2DA4 A;  2X48 A;  3G1M A;  4UUS A;  3RZD J;  5FKK A;  2EZH A;  3S17 J;  1TC3 C;  3CWR A;  3AQS A;  3T6N A;  5DS9 A;  2Y30 A;  5F0F A;  2WV1 A;  3FIS A;  5FMP A;  3A01 B;  1WH5 A;  5J1U A;  1PUF A;  3F1B A;  4DYR A;  2DMN A;  1ZR4 A;  3S16 J;  5E3N A;  4BY7 J;  4C3H J;  1MBJ A;  3TW6 A;  4JKZ A;  5HSZ A;  3LWJ A;  2HQ5 A;  1ETY A;  2YU9 J;  1ZTR A;  3QBM A;  4A3E J;  3BR5 A;  5M3M J;  2WGB A;  1X58 A;  5M5Y J;  3BRU A;  2DMQ A;  2O7O A;  5FHP A;  3Q0V A;  2OPT A;  3RH2 A;  2MSY A;  3BJB A;  2YS9 A;  4AUX A;  1D5Y A;  3KNW A;  1JKR C;  2ME0 A;  4GFK A;  5CXI A;  3TP0 A;  3O60 A;  4LOC A;  4W1U A;  3SFI A;  2Q24 A;  3HTH A;  4JP0 A;  1VND A;  4A3D J;  5F0H A;  3O8G A;  2LFB A;  5FKO A;  3OOU A;  3VW0 A;  1SFO J;  5K7Z A;  3JRA A;  2QOP A;  2RHA A;  2XGD A;  3EGQ A;  1RKW A;  3DCF A;  4XID A;  2TCT A;  3PO2 J;  1ETW A;  1WCM J;  2HKU A;  2GFN A;  3VP5 A;  2NVT J;  2OF7 A;  1NK3 P;  2DMT A;  1NTC A;  1FJL A;  2XPW A;  3GTP J;  4MO7 A;  2YUS A;  2JA8 J;  4M3B A;  4IEJ A;  5M3F J;  1JKP C;  3SDG A;  1MSF C;  5M5X J;  4C2M J;  5CW8 A;  3S1M J;  4FTH A;  4EEF G;  1TWA J;  2DA2 A;  5GPC A;  2K40 A;  2EQR A;  1GT0 C;  1IC8 A;  1JKO C;  5C4X J;  1Z0X A;  3G1L A;  3LSR A;  2NP5 A;  2ID6 A;  4V2G A;  3ZQI A;  2UXH A;  5IPA A;  2R7Z J;  3S15 J;  1P7I A;  3BQZ A;  2L7F P;  3CCY A;  3C07 A;  5M5W J;  2FJ1 A;  2XB5 A;  3WHB A;  4A3J J;  3JRE A;  1FTT A;  2QIB A;  3PM1 A;  2UXO A;  1ZR2 A;  3RD3 A;  3CQZ J;  2XPV A;  4M3F A;  5HOD A;  2IEK A;  3NRG A;  3QPL A;  1SGM A;  3VOK A;  4XIC A;  2M34 A;  3HTA A;  4DW6 A;  1UG2 A;  2W53 A;  3JRD A;  4MLO A;  4I6Z A;  4IHV A;  3OSG A;  2WB1 N;  3O8H A;  5E3M A;  1PUF B;  4IHW A;  2Y9Y A;  3IUV A;  2MW8 A;  4HNV A;  2LP0 A;  5K7H A;  1IUF A;  3A03 A;  3E7L A;  5F27 A;  2LK2 A;  2DJN A;  3BT9 A;  3KKD A;  4ACI A;  2H1K A;  4UUS B;  5F0C A;  1IRZ A;  5C4Y A;  3RKQ A;  4MIM A;  1RKT A;  1TWG J;  2DTZ A;  3LSP A;  3M4O J;  1B8I A;  1U9N A;  1H88 C;  1ETX A;  3K7A J;  3ANG A;  4YZE A;  1K83 J;  3JR9 A;  1S7E A;  4FE7 A;  1LE8 A;  5IOY A;  5GPA A;  5D19 A;  4A93 J;  3OSF A;  3BR1 A;  3FKI J;  2HYT A;  5AQC A;  2O7T A;  2O9L A;  5C4J J;  3JSJ A;  2CUF A;  1IV6 A;  2LKX A;  4RDU A;  3GEU A;  3BTL A;  5D1R A;  5K7F A;  3SJM A;  1MBF A;  2VKV A;  3HB9 A;  3V78 A;  1VI0 A;  2NVX J;  1UI6 A;  2TRT A;  2L0K A;  4NEL A;  3LSG A;  5IYB J;  3JRI A;  4G12 A;  2HOA A;  2X9D A;  3FIW A;  3QPS A;  4UDS A;  2E2I J;  1AU7 A;  2NVQ J;  1VF9 A;  3S1N J;  4HKU A;  2OI8 A;  2RAE A;  1RET A;  4AF5 A;  5IP6 A;  4AC0 A;  3B6C A;  2LLK A;  1QPI A;  3LNQ A;  4GFL A;  3HOZ J;  5IOZ A;  4GCL A;  1H8A C;  2Y0S N;  3GBG A;  3KKC A;  3HOY J;  1JT6 A;  3MN2 A;  1APL C;  4QTR A;  2E2J J;  2M9H A;  4B1R A;  4MFD A;  2V57 A;  5K58 A;  1JUP A;  1U78 A;  1DU0 A;  3ZQF A;  3PPB A;  1GV5 A;  2AO9 A;  2R5Z B;  2W48 A;  4DZP A;  4AYB N;  3HOX J;  4V2F A;  1WPK A;  2HYJ A;  2IAI A;  2G7L A;  4GCT A;  1ETK A;  2FD5 A;  3HOV J;  1ETV A;  3NNR A;  2L9R A;  1JUS A;  2LD5 A;  5H9T A;  3WHC A;  4DYQ A;  3S2H J;  3VVZ A;  2PBX A;  2E1O A;  1MBG A;  1UHS A;  2E2H J;  3AQT A;  1B72 A;  2NOG A;  4A3K J;  3EUP A;  3W6V A;  1W0T A;  4D7N A;  1JUM A;  3G56 A;  2LTP A;  1HCR A;  2L7M P;  1QRY A;  2MG4 A;  2YVE A;  3ZQG A;  2COB A;  3LHQ A;  3TW7 A;  2IBD A;  1AKH A;  4CGR A;  2R93 J;  1WGX A;  4CYC B;  3M3Y J;  3HTJ A;  4MFE A;  1DU6 A;  2K9S A;  3S1R J;  2VI6 A;  4QSH A;  1ITY A;  3IH3 A;  4XRM A;  2QCO A;  1IDZ A;  3L1P A;  2ELK A;  3HE0 A;  3ON2 A;  1ZKG A;  4NN1 A;  3GTM J;  3S5R A;  2EH3 A;  5J1Y A;  3GTJ J;  2HDD A;  2G7G A;  3P9T A;  2GM4 A;  2CJJ A;  2XPU A;  2M8G X;  3BR2 A;  3JRF A;  3BQY A;  1W0U A;  1IG7 A;  2Y31 A;  2EZK A;  1JT0 A;  5IYD J;  3HKZ N;  3S1Q J;  2ME6 A;  5C3E J;  5E3O A;  1YRN B;  1JTY A;  4M3D A;  1MSE C;  2DN0 A;  1R9T J;  2LR8 A;  3QQA A;  5IP9 J;  4ME9 A;  4XK4 A;  5EZG A;  3NI7 A;  3H0G J;  1F36 A;  1A5J A;  2HI3 A;  2I10 A;  1QVT A;  1BJZ A;  3FK7 A;  4CYC A;  1I6H J;  4JNN A;  2NS7 A;  4Y52 J;  4JX4 A;  2DA1 A;  1RPW A;  3Q0U A;  3BR6 A;  1JJ6 C;  3MVP A;  5JLW A;  3I4N J;  3E7Q A;  3RQI A;  4GCK A;  4L5E A;  2GUH A;  1OFC X;  3BG3 A;  1VFC A;  2M2E A;  3H3V K;  3DPJ A;  1MBH A;  2MGQ A;  1Y1V J;  1MH4 A;  9ANT A;  2FBQ A;  3ZQH A;  2ZB9 A; 
#chains in the Genus database with same CATH topology
 3B81 A;  3HZJ A;  1KON A;  5E8I A;  3CRJ A;  2X51 A;  4A3B J;  2CFX A;  5IP7 J;  2L01 A;  2CQX A;  3P5J A;  1E17 A;  3R60 A;  2DK8 A;  3K0L A;  3L2W A;  4JL3 A;  2EV6 A;  3I4M J;  2H94 A;  1BA5 A;  2K4J A;  4KN7 X;  4BEH A;  2RRE A;  1JHH A;  1YTY A;  1VQK I;  2GIZ A;  3K8P C;  5J47 A;  2QQ9 A;  1I3Q J;  4HA8 A;  3IAS 2;  3IRQ A;  1SD5 A;  1QA6 A;  2MH9 A;  2ZOZ A;  2CFO A;  3LA2 A;  1TBX A;  2DMU A;  2J5O A;  5FJ8 J;  1T56 A;  1P4W A;  3HIF A;  3RKW A;  1QZE A;  4RAF A;  5DM7 F;  1X2M A;  2X6O A;  2LNB A;  5DM6 F;  1MMA A;  4XKC A;  3NPI A;  2K02 A;  2XGX A;  4FE4 A;  4M74 A;  3B6A A;  1JHF A;  4HX7 A;  4D7M A;  3K4L A;  2A07 F;  5D18 A;  2ECB A;  2HTS A;  2IGK A;  2XVC A;  3BR0 A;  4RAY A;  1GUU A;  3PL8 A;  5HOO A;  5FFZ A;  2R7R A;  3I59 A;  5C44 J;  2RAS A;  1LDK B;  1AWC A;  1ZAO A;  3W3C A;  3WTW C;  3JTH A;  2ZXI A;  4B4C A;  4KIF A;  4B3A A;  3DKX A;  3N05 A;  3MZH A;  2V9P A;  3CO7 C;  2XUB A;  1G59 A;  3ZPL A;  3LJL A;  2X6W A;  2ZXJ A;  1NK2 P;  3IL2 A;  4II2 A;  3KZY A;  2F5E A;  1YS6 A;  4HV6 A;  3BTC A;  4EJU A;  3VW1 A;  2X6Y A;  1TTY A;  2HPI A;  4KIC A;  3LA3 A;  3SYT A;  4L0Y B;  4A5N A;  2X1D A;  1QQI A;  4F92 B;  1WFX A;  2L7Z A;  3KEQ A;  5CKT A;  2WUI A;  5LGU A;  4C3I J;  1YLF A;  2W82 A;  4UVA A;  1IGN A;  3ABM H;  1ONV A;  3CC2 I;  2VXZ A;  2M5W A;  1YJN I;  4MEX F;  1PP7 U;  2H09 A;  1A36 A;  3FK6 A;  3PNY A;  2G3B A;  2Z1D A;  2Y0S A;  2HXI A;  5DYM A;  3C1D A;  2VOO A;  4JQF A;  3EYY A;  3M8J A;  1J7K A;  2ZSH B;  1YQA A;  4BGD A;  4EJT A;  1FOY A;  1HDD C;  4CUG A;  1RES A;  2HOT A;  1IN8 A;  2XAU A;  3HXL A;  3BHQ A;  3CCS I;  4Y17 A;  1HW2 A;  2HOS A;  1MW7 A;  5L3G A;  2D6Y A;  2KIM A;  1VTN C;  1OIS A;  2FOK A;  1PUE E;  4JOM A;  5JR3 A;  1T08 B;  1S29 A;  3F0C A;  1G8X A;  4IO9 F;  1GVD A;  5EFY A;  3PIP F;  3AG3 H;  1ETQ A;  1SC7 A;  4PZJ A;  3ABK H;  2M0C A;  1CF7 B;  4PGG A;  4BNC A;  1K61 A;  3COA C;  4XM3 A;  1SAX A;  3GLL A;  2R7O A;  4UV8 A;  3H3Z A;  4BJT A;  5ICG A;  3VVX A;  2FNA A;  2Q2E B;  3D1N I;  3B73 A;  3NAU A;  1U8B A;  2IJL A;  2YVX A;  1WHU A;  2VL8 A;  1VQN I;  3HHG A;  2DA5 A;  3GXO A;  5FRN A;  3QYF A;  4JYK A;  4A69 C;  1IDY A;  3PNT A;  3RZO J;  3HIM A;  2XGC A;  3JRB A;  2B63 J;  2IS1 A;  1BC8 C;  2WAF A;  4C3J J;  2X0L A;  3KCC A;  2QA4 I;  4L62 A;  2KRC A;  1ULY A;  2AHQ A;  4B48 A;  2QTQ A;  3K9T A;  3CMA I;  2E1M B;  4X1E A;  3DPL C;  2LY1 A;  3DBR B;  3KIO A;  2CW7 A;  3IH4 A;  5TRD A;  4A3M J;  5LEJ A;  4MK6 A;  2JN6 A;  2P5V A;  3QOD A;  4E7J A;  5KAI C;  1CQT A;  2FUG 2;  1F9N A;  2O61 A;  4U9L A;  2X1C A;  4RMN A;  2DK5 A;  4JX6 A;  1FOK A;  1XSV A;  5J4V A;  1HOM A;  3DEW A;  1XDS A;  2MA3 A;  2CGP A;  3V8L A;  3VOX A;  3QAH A;  2D5V A;  1BR2 A;  4UY8 I;  3KLN A;  2DT7 B;  1FIP A;  1SFE A;  4LLL A;  1QHH D;  4GYG A;  1DP3 A;  3HRM A;  2CV1 A;  3J81 Z;  2NVY J;  1OJL A;  2HYG D;  4KMU X;  3O6B B;  1S72 I;  2F4M B;  3SEQ A;  3A01 A;  3W6K B;  5DAJ A;  3BTJ A;  2OUM A;  2HVR A;  1X2N A;  1POG A;  5AIQ A;  3I0T A;  5L3D A;  2E60 A;  1EA3 A;  2PMZ N;  4WX9 A;  4FCY A;  4GFB A;  2DOD A;  3NQO A;  2BBY A;  5D5V B;  5HDG A;  4AIK A;  4UUS A;  5HNH A;  4MQV A;  5CVI A;  4OD4 A;  3S17 J;  1TC3 C;  3X2Q H;  1AOY A;  1IRG A;  3CWR A;  3T6N A;  2L02 A;  1W36 D;  3KX2 A;  5FMP A;  1QNT A;  2KL4 A;  1PUF A;  2XAS A;  3F1B A;  5E3N A;  1KU9 A;  4PJN A;  4G6D A;  3RIR A;  3QBM A;  4YIF A;  3M9A A;  3GME A;  3C2H A;  1DPR A;  2O7O A;  3CCJ I;  5ICF A;  3BJB A;  1KU7 A;  1LDJ A;  3LSI A;  5JFR A;  3CCM I;  4EMS A;  1WJA A;  1V5F A;  2QYO A;  3T8R A;  2GA1 A;  4LOC A;  1ZRC A;  4JP0 A;  2CQN A;  3OV8 A;  4EJV A;  4YFX F;  5L3C A;  4A3D J;  2IW5 A;  2HVS A;  3GUD A;  4NQW A;  3K69 A;  5K7Z A;  1ZAR A;  4FX0 A;  4LK1 F;  4L9T A;  3PIO F;  4XID A;  3OYL A;  2EIN H;  2TCT A;  3OYE A;  1ETW A;  3OR2 C;  1WCM J;  3CTA A;  2GFN A;  2RNG A;  4GRI A;  2OF7 A;  3S3O A;  5EJC A;  4YII A;  1NK3 P;  3SZT A;  1NTC A;  2P6S A;  4IOC F;  3LMM A;  1P2F A;  2JRT A;  3GTP J;  2VBW A;  2IPQ X;  1MSF C;  1T8I A;  5M5X J;  2K3F A;  3HRU A;  4C2M J;  2KKO A;  4MQ9 F;  3QOE A;  2OAZ A;  1LFP A;  2NP5 A;  2HQA A;  3TO7 A;  3ZQI A;  2UXH A;  2XDV A;  1SAU A;  2R7Z J;  2OQG A;  3C7J A;  3B02 A;  2L7F P;  2OV7 A;  2WV0 A;  3CC7 I;  2VBX A;  3DTI A;  5CVV A;  3ECO A;  4HOB A;  3TBI A;  4EJW A;  4F55 A;  2ZME B;  3LQR A;  4JK1 X;  1I27 A;  2VT2 A;  1FYL A;  2UXO A;  3BCA A;  3RD3 A;  2XPV A;  3H3U A;  2OBP A;  2DQR A;  2OQR A;  2AXL A;  2DOF A;  4NC7 A;  1UG0 A;  3ZMU A;  2VLA A;  4MLO A;  2WAD A;  2QUF A;  3ABU A;  3MQ0 A;  3O8H A;  3HSE A;  4IHW A;  3BRO A;  2Y9Y A;  4ZYD A;  3IUV A;  3HSR A;  3U21 A;  1XDU A;  3A03 A;  3E7L A;  3FM3 A;  2CH0 A;  1J5Y A;  4XKW A;  5JVG F;  4ACI A;  3LAP A;  2CMP A;  3CJT B;  1SFU A;  1FNN A;  5F0C A;  3V8K A;  4WK8 F;  3K4J A;  1CGP A;  1K78 A;  1IAW A;  4MIM A;  4F3Q A;  3FMS A;  5KNL A;  5F6F A;  2P5L C;  1MMN A;  1WJF A;  4KJZ A;  1UCR A;  3M4O J;  3DU6 A;  3HRT A;  2DCE A;  1K83 J;  3JR9 A;  1SD6 A;  1S7E A;  3TOA A;  1QZY A;  3UNG C;  1LE8 A;  2EIL H;  5GPA A;  2EIK H;  3UR3 C;  4CIC A;  3OSF A;  5BPI A;  3BR1 A;  2HYT A;  4EGY A;  2O7T A;  4EVI A;  1OMI A;  2VQH A;  3OYN A;  4RAZ A;  4L5I A;  4LD5 A;  2QKL B;  2PJR B;  4RA2 A;  4EM1 A;  2FNP A;  2KQR A;  2Z5U A;  3BTL A;  3RPU A;  4P9F A;  1R5G A;  4M73 A;  4A0X A;  1SD7 A;  3KE2 A;  2KP6 A;  3LSG A;  4DIQ A;  3QPS A;  4I98 B;  3VTI A;  1AU7 A;  2NVQ J;  2PMH A;  3PFY A;  3OYC A;  2XC7 A;  2OI8 A;  1RET A;  2DFI A;  3F8B A;  3TL4 X;  1YJW I;  3KFW X;  1QPI A;  2KRF A;  3G6E I;  2KIQ A;  1BM9 A;  3FWE A;  3GBG A;  3H36 A;  3VYU B;  4KA4 A;  5CYV A;  3HOY J;  4QTR A;  3IKT A;  5K58 A;  2V57 A;  1U78 A;  3DLA A;  1DU0 A;  4UB6 C;  4N0B A;  3PPB A;  1FMW A;  1PYV A;  2AO9 A;  2GQQ A;  3BPV A;  1B1B A;  2K9M A;  2WC2 A;  3CME I;  5A2Q K;  5J8F A;  1TW2 A;  4YIR X;  2R7X A;  5A2Q Z;  4PJJ A;  2W48 A;  4HDV A;  1R49 A;  4XL9 A;  2WBM A;  1IN6 A;  1R5H A;  3HOX J;  4OIP F;  1J09 A;  2W85 A;  3K6G A;  1W5T A;  1JXS A;  4OOI A;  3HOV J;  2F5C A;  2NXN B;  3SEZ A;  4ANJ A;  1Y39 A;  4KYW A;  2E1O A;  2OU2 A;  4AID A;  2E2H J;  2E1N A;  5K1Y A;  1IXS B;  2LTP A;  1HCR A;  5JVT A;  4ZTF A;  2COB A;  4KMF A;  5K5O A;  5HS7 A;  3GEZ A;  3O2P E;  3TW7 A;  5HS9 A;  1AKH A;  3ASN H;  2RKH A;  3H9G A;  4BQQ A;  1YW9 A;  4CYC B;  5ERI A;  4MFE A;  5IT9 K;  2JVG A;  1FLI A;  4XRM A;  1BI1 A;  1S6L A;  4A0Z A;  3F23 A;  2ELK A;  3HE0 A;  3LFK A;  4NN1 A;  3OS1 A;  2CS3 A;  4HF0 A;  4AVP A;  5HDK A;  5CVJ A;  1JI8 A;  2KZV A;  2HTJ A;  1ZLK A;  3BJA A;  2CJJ A;  2XPU A;  3GF2 A;  2MD5 A;  4TV7 A;  4Y15 A;  2VON A;  3H92 A;  2Y31 A;  2EZK A;  3IAM 2;  1JT0 A;  1FP2 A;  2XF5 A;  3G71 I;  1K6Y A;  2IGM A;  4XLA A;  4Z2Y A;  5C3E J;  3MAJ A;  3CUQ B;  4FX4 A;  4P9U A;  3PFI A;  1NH3 A;  4B43 A;  4CA0 A;  5GTH C;  5EZG A;  3E5X A;  5KCM A;  4Q5S F;  3E6C C;  1I6H J;  1BJZ A;  2P0W A;  2W57 A;  3R0A A;  3OYF A;  4JX4 A;  1X1D A;  2DA1 A;  1GLN A;  2EA4 A;  3PQJ A;  1R58 A;  3MVP A;  4GCK A;  3RQI A;  3ZN0 A;  3S32 A;  3BG3 A;  1G3S A;  3F6V A;  4L9V A;  4HLX A;  3H3V K;  1ZGJ A;  2VJI A;  1MBH A;  2ICW G;  1Y8R B;  2MGQ A;  4XLC A;  2ZB9 A;  2IU5 A;  3E5Q A;  2IS6 A;  2HDC A;  3ZQ7 A;  1QBJ A;  4UVC A;  3N97 A;  3SXY A;  1D8J A;  1G3Y A;  2XHK A;  2K7L A;  2OJE D;  2ID3 A;  2N8G A;  4FQG A;  3W2V A;  1XC5 A;  5D5X B;  4OIO F;  2ESH A;  4HDU A;  4CCL A;  3T0Y A;  1QU3 A;  1UJ8 A;  2HDW A;  2ZNZ A;  1EH6 A;  3VDX A;  2HKO A;  2VJ5 A;  4PJL A;  5E3L A;  2E1C A;  2ZCW A;  5FGL A;  1H89 C;  5HLG A;  1IO2 A;  2VUM J;  1W7P A;  3LA7 A;  1BW5 A;  1S7A A;  3ERE D;  5EYR A;  2M7A A;  4IF4 A;  4W97 A;  5HBU A;  1IN5 A;  3SFZ A;  2G0E A;  2O8K A;  2R5Y A;  2VAS A;  2ZXW H;  5CVR A;  3ZMV A;  4BXU A;  1IZ1 A;  1E2X A;  1TWH J;  1FSH A;  3U9G A;  1LQ1 A;  3SWH A;  5HAW A;  2CV0 A;  2LY2 A;  3BCB A;  2FOW A;  3K2A A;  3U2R A;  2HGC A;  2XSJ C;  2ZCX A;  4UHT A;  3MMY B;  2CW0 F;  4HEA 2;  4D5F A;  3V6G A;  4BKX A;  2WAQ N;  4RLF A;  1OYI A;  4J19 A;  2OTJ I;  1FZP B;  3HGY A;  2V6C A;  1VQ5 I;  1MND A;  1LVK A;  2DDA A;  2VKE A;  2QSG X;  3F9K A;  4A3I J;  5EG0 A;  2HR3 A;  2XGE A;  3OR1 C;  5H6R A;  3P9K A;  1V54 H;  3LSJ A;  3KYC B;  1ZHF A;  1OLT A;  1SAN A;  3WG9 A;  3DWL E;  3TP3 A;  2VN2 A;  2WTE A;  2L9N A;  3ZMZ A;  2H8R A;  2OTL I;  4S05 A;  3BY6 A;  1P4A A;  3CMM A;  3LL7 A;  1YJ9 I;  2DA6 A;  2VPL A;  2EA2 A;  1BW6 A;  4RB3 C;  2LBF A;  2EWN A;  5FLX Z;  5K5Q A;  2ZOY A;  3GTK J;  3V4G A;  4M71 A;  3S14 J;  1V55 H;  3BG9 A;  2JTV A;  2CRG A;  5HVQ C;  2QEX I;  2D45 A;  3MNL A;  3VPR A;  4FAS D;  2FX0 A;  2Y69 H;  2KDZ A;  2UXX A;  2GEN A;  3C3W A;  2M87 A;  4LB5 A;  2XKO A;  1XS9 A;  2OCC H;  1WKM A;  1YYV A;  2ZC2 A;  2XKP A;  4ITV A;  3EUH A;  4U0Y A;  1AKH B;  4BAY A;  1T0F C;  3HTI A;  5HLI A;  1G2H A;  2VPR A;  4ZH4 F;  2GLO A;  5GP9 A;  2PG4 A;  3K4M A;  1DUX C;  2EZI A;  2XAG A;  3F8N A;  2JRM A;  4UNO A;  2W24 A;  5B66 C;  1I5Z A;  5LD2 C;  3K4C A;  4ICH A;  2YSR A;  3S2W A;  3FXO A;  1S7O A;  3GTQ J;  3VWB A;  1FTZ A;  1E3O C;  3SDB A;  1VQ8 I;  2B1E A;  1BL0 A;  2ESN A;  3BJ6 A;  2UXP A;  4KIB A;  4M3G A;  2Y75 A;  3BR3 A;  1IUY A;  2XDN A;  1MNE A;  3CUQ C;  2KDO A;  2PZ9 A;  2OER A;  1Y1W J;  4Q4Z F;  3FXR A;  4IKF A;  1J9I A;  2XAQ A;  1YRN A;  3CUQ A;  2Z3Y A;  2ZJP F;  5EZH A;  3HDD A;  4P96 A;  1JJ8 C;  1YI2 I;  1TWC J;  5DEQ A;  2BHZ A;  1WJB A;  1IW7 F;  4BBR J;  3R6S A;  3C2B A;  2B3W A;  2A69 F;  4AU7 A;  2XB0 X;  1MBE A;  4LMY A;  1MJ9 A;  1MH3 A;  2NS8 A;  3CCR I;  2STW A;  2K9Q A;  4XLE A;  2HXO A;  1KYZ A;  1USS A;  1BI3 A;  1MJA A;  1I50 J;  5D5W B;  4HQM A;  2CO5 A;  1Z77 A;  3K4B A;  3A0H C;  4U0V A;  3K70 D;  1ZK8 A;  3RDI A;  5ILV A;  4A12 A;  2PQ8 A;  1P7J A;  1J75 A;  3HGG A;  4HRI A;  3ANP A;  4M3E A;  2P8T A;  1TQM A;  2HS5 A;  1JGS A;  3I4P A;  4RBO A;  2JT1 A;  4IZZ A;  5ILU A;  1KU3 A;  1IV8 A;  2QZ8 A;  3VIB A;  2JJ7 A;  3ON4 A;  1Z3Y A;  4RB0 A;  2QQ8 A;  3WTS C;  2DPU A;  2JK3 A;  2ETH A;  4B8X A;  3FHN A;  4D1Q A;  1SMT A;  4PJ0 C;  3D0S A;  4BE0 A;  2QLZ A;  1FEX A;  2DPD A;  2CQQ A;  3F8C A;  3S8P A;  1X3W B;  4ZYG A;  4FET A;  6PAX A;  2R7D A;  3G7R A;  1FOW A;  1DP7 P;  2FQ4 A;  5IYC J;  2IT0 A;  3L09 A;  2DMP A;  5J1R A;  1DQU A;  3HRS A;  3ZOB A;  1REP C;  2JQ7 A;  2V26 A;  5HLH A;  3G1M A;  2M30 A;  2P7C B;  3RZD J;  4HX8 A;  1HKT A;  5HDN A;  2LDU A;  2E5Z A;  2Y30 A;  5F0F A;  3FIS A;  4CSW A;  4L0Z B;  1WH5 A;  2G7H A;  4LK0 F;  3S16 J;  2I8D A;  3KP4 A;  4XLH A;  3N4M A;  1EH7 A;  1MDM A;  5HSZ A;  4E7L A;  2JSC A;  4BAC A;  2HQ5 A;  1ZTR A;  2D2W A;  3LSH A;  4A3E J;  2UXN A;  3FXU A;  1ZG5 A;  3BZC A;  3BR5 A;  3GLX A;  2ZME A;  4PGH A;  2DMQ A;  5LRR A;  3Q0V A;  2O3F A;  1W36 C;  2A61 A;  4RLQ A;  2MSY A;  2EFP A;  1O3R A;  4C2U A;  1RRJ A;  1FPQ A;  2ME0 A;  2XRN A;  4G6T B;  1TQP A;  2V4J C;  4GFK A;  4GYI A;  4ENK A;  1YE9 A;  1W5C C;  3TP0 A;  4CCO A;  1TLH B;  3LQQ A;  3OY9 A;  3HOS A;  3SFI A;  1RC9 A;  3SZP A;  1VND A;  2LRD A;  5JHF A;  3O8G A;  2LFB A;  1W5S A;  4IL6 C;  2X6X A;  3OYD A;  1SFO J;  3JRA A;  3Q9S A;  2KIS A;  2DO7 A;  4AD9 A;  1RKW A;  1ON2 A;  1T0F A;  3DCF A;  4Q47 A;  3D5R C;  3I53 A;  4PJM A;  1V3F A;  5KK1 A;  2VOP A;  3PUB A;  2L4A A;  3VP5 A;  2NVT J;  3L2V A;  3GFJ A;  3I5U A;  2HKX A;  4IX7 A;  4XQF A;  2V1U A;  5TJJ A;  4BUP A;  1WQ2 A;  3CF5 F;  2G9W A;  2VE8 A;  3KP3 A;  2MC4 A;  4IEJ A;  4IVN A;  4LIU A;  3MFK A;  3SDG A;  3DF8 A;  5D4R A;  5M3F J;  2PMZ A;  4G7Z F;  4CO8 A;  3QPT A;  3GX4 X;  2QVO A;  4ZZD A;  2DA2 A;  4ZYE A;  2TDX A;  1JKO C;  1Z0X A;  3LSR A;  3VYR B;  4IHS A;  4IXA A;  4RM3 A;  5IPA A;  5DCM A;  1P7I A;  3S15 J;  3RPU D;  1N75 A;  2R7S A;  3BQZ A;  5LGN A;  1Y0U A;  3RKY A;  1E3P A;  1SEU A;  3JCU C;  5ICE A;  4L18 B;  3DBH B;  3C07 A;  4AWX B;  3WG7 H;  1YX3 A;  2FJ1 A;  1Z7L A;  4BHB A;  3TGN A;  3H35 A;  3ECH A;  1FTT A;  3PM1 A;  4ZZL A;  1ZR2 A;  1Y6I A;  3CQZ J;  4M3F A;  2IEK A;  1BIA A;  3VYT B;  3MEX A;  2VJ4 A;  3HTA A;  2DFH A;  4KT6 A;  4DBQ A;  2H6C A;  3OYM A;  1XGS A;  2BVL A;  1UG2 A;  4MGR A;  2W53 A;  1Z6R A;  4ESJ A;  2DT5 A;  2WB1 N;  4PDK A;  5DUK A;  3OSG A;  4HSR A;  5ICC A;  2Z9O A;  2LP0 A;  3M8F A;  1R4N B;  1HXD A;  5K7H A;  5F27 A;  4CCJ A;  1R22 A;  2O0Y A;  4RGR A;  3BT9 A;  5DD4 A;  2VOD A;  3I3L A;  2LBF B;  5FLX K;  3BDD A;  3KKD A;  3FKJ A;  2E7X A;  2F48 A;  4N9H A;  1BIB A;  1O7L A;  2HWV A;  2K4B A;  2ZO4 A;  2LF7 A;  4BH9 A;  4HQE A;  4A2U A;  1B9M A;  1HA8 A;  1IRZ A;  5C4Y A;  1J59 A;  5HS8 A;  2P5K A;  1MJB A;  1MMG A;  3EQL F;  1JE8 A;  3LSP A;  4F93 B;  3DKY A;  3RSN A;  3FHZ A;  3HL2 A;  1H88 C;  2BGC A;  1ETX A;  4NQW B;  5BMZ A;  3HKZ A;  5DD8 A;  5F64 A;  2G7U A;  4YZE A;  1FYM A;  4FE7 A;  4MTE A;  1ACI A;  5D19 A;  2WAE A;  2IA1 A;  4M9S A;  1B9N A;  2CQK A;  1D8K A;  3OYB A;  4KDP A;  4Z6Y A;  2O9L A;  4ENJ A;  3FM5 A;  1VZ0 A;  5D4S A;  4RGS A;  2LKX A;  2PJR A;  1X1B A;  1XD7 A;  2FBI A;  2E71 A;  3V78 A;  2OD5 A;  2VT3 A;  3C18 A;  4BQN A;  1VI0 A;  2TRT A;  3JRI A;  2X9D A;  1Z9C A;  2UWM A;  2EIM H;  2BZT A;  5ILS A;  3ZQQ A;  2E2I J;  4LLN A;  3D5L A;  1WRJ A;  2ZKZ A;  3FXQ A;  1VF9 A;  4HKU A;  3CCU I;  1XSD A;  1LKX A;  1Z7U A;  4AF5 A;  1K6O A;  2EFW A;  4AC0 A;  3P9C A;  4R1H A;  4GFL A;  3CD6 I;  1HW1 A;  4GCL A;  1H8A C;  1GHC A;  3KKC A;  1JT6 A;  4HV5 A;  3KPH A;  2E2J J;  4OU0 A;  2FE3 A;  3FMR A;  4B1R A;  4C9Y A;  4D0P A;  2DJI A;  2M45 A;  2HQN A;  2PI0 A;  2XIG A;  4ASN A;  1YS7 A;  1IRX A;  1RI7 A;  5DCF A;  2ZJQ F;  4AYB N;  3ZXS A;  2FJI 1;  5EEH A;  5DV5 A;  2DOA A;  2IAI A;  2XF6 A;  2FD5 A;  4D9J A;  4HF1 A;  1ETV A;  2JSP A;  5E1Z B;  4HPQ A;  4BXF A;  1CF7 A;  5LBQ A;  5E79 C;  4CYD A;  4N9I A;  4XOT A;  3WHC A;  2PBI A;  2A6H F;  2W1O A;  3AQT A;  3SZG A;  2NOG A;  3NWT A;  5AIP A;  2JZY A;  2RGV A;  5H2F C;  1MKM A;  3WU0 A;  5L3B A;  2L7M P;  3F21 A;  2YVE A;  3M1E A;  4RGU A;  2KZG A;  1XX5 A;  3CDH A;  5EEG A;  2A5W A;  4J00 A;  3CLO A;  2DXI A;  1F4K A;  1Z05 A;  3OYI A;  1DU6 A;  2K9S A;  3CP2 A;  3KP7 A;  5B3S H;  1A6Q A;  1XCB A;  1KGS A;  3L1P A;  2Z33 A;  2BY3 A;  2E35 A;  3CZ6 A;  3ON2 A;  3GTM J;  3AL0 B;  4C2T A;  3P9T A;  1XSX A;  4LJZ F;  1ZLJ A;  3T5X A;  1RNL A;  3U1K A;  3JRF A;  1H0M A;  5LHG A;  3KYD B;  3QOP A;  2X1E A;  5BOX A;  1VQL I;  3S1Q J;  2ME6 A;  2VE9 A;  2LG4 A;  2FSW A;  1YRN B;  1NG6 A;  4PK4 A;  5L3F A;  2OA4 A;  4M3D A;  4IRI A;  3GZ5 A;  3AG4 H;  4CGZ A;  2DN0 A;  2LR8 A;  2AQF A;  2DW4 A;  5CJ9 A;  3QU3 A;  4DGW B;  4ME9 A;  3A1Y A;  4ZYH A;  3ZGK A;  3WU1 B;  2I5U A;  3H0G J;  1A5J A;  2HI3 A;  2Q2E A;  1HST A;  2I10 A;  1O3T A;  1OKR A;  1OCR H;  1W1W E;  3WGG A;  1I39 A;  4I02 A;  5JLW A;  2QKM B;  3ABL H;  2IRF G;  2R7T A;  1VFC A;  2BOL A;  1P9Q C;  2M2E A;  3DPJ A;  3T8T A;  5ED4 A;  4WF2 A;  3R61 A;  4XNF A;  4QPQ A;  1MH4 A;  1MZB A;  3KLO A;  2FBQ A;  1QVU A;  5KHD A;  3QKX A;  5FLM J;  4X6A J;  1EF4 A;  1FY7 A;  1TZL A;  3CDL A;  1PVE A;  3I9V 2;  3VSL A;  4BHC A;  2STT A;  2EB7 A;  5F1R A;  3LWF A;  2F07 A;  1YIO A;  5E1W A;  3BCG A;  3AG2 H;  5LHH A;  2BXZ A;  4M72 A;  2E19 A;  3KZI C;  2BE5 F;  5LLQ A;  4KIT B;  4AC6 A;  2WB1 A;  3A2K A;  2MFZ A;  3PAS A;  4AYB A;  2L2O A;  3FX3 A;  1WWX A;  1DPU A;  3HBL A;  3W2A A;  4BY1 J;  2R7V A;  4A3F J;  5FKM A;  3J7Z I;  3SHF A;  3GTL J;  2JMW A;  2M4G A;  4WWC A;  3CF2 A;  1KQ9 A;  2GWR A;  4ABZ A;  2JWT A;  3FF5 A;  3NEU A;  3BTI A;  1VQP I;  4I76 A;  1R71 A;  2NOJ B;  2EZL A;  2DA3 A;  3NAR A;  5EG0 B;  3FZV A;  1ZH5 A;  4M6V A;  3CMY A;  2Y9Z A;  4I0B A;  4EQQ A;  3OS0 A;  3BNI A;  2RVC A;  3LSK A;  1RZ4 A;  2DA7 A;  2LVS A;  3WTX C;  4JBA A;  5LRS A;  2GBY A;  2ZSI B;  1IJW C;  3K2Z A;  1C0W A;  2A2F X;  4G94 A;  1G3W A;  4UB8 C;  2JPB A;  2VC1 A;  5FD5 A;  1D1B A;  3I59 B;  1BN5 A;  4PSW A;  2K5C A;  4CCK A;  5EF6 A;  3GTO J;  2R5Y B;  1KU2 A;  3E1S A;  1LFU P;  1JTX A;  4NNJ A;  1Q1V A;  5J3L A;  2FEZ A;  3V8J A;  1P92 A;  3DLL F;  2ECC A;  2YVH A;  2JA7 J;  2ZCM A;  3K1N A;  3OYG A;  3PO3 J;  5E20 A;  3M07 A;  5EEA A;  1W7P B;  1HF0 A;  2MC3 A;  4F52 A;  2VQG A;  4L9N A;  1MBK A;  4O3M A;  2NS0 A;  3HEF A;  1Z67 A;  4EJO A;  2DBB A;  3K10 A;  3GFL A;  4OWR B;  4H4K C;  1NHA A;  1BR1 A;  5EGO B;  3L00 A;  3S3M A;  4G9Y A;  1R4M B;  2CUE A;  4IPA A;  2XRL A;  2A6T A;  2VKH A;  3W2W A;  1L3L A;  1HBX G;  4BBS J;  5J6X A;  3CCQ I;  1XTA A;  2DQL A;  1FBU A;  1PP8 F;  5FO5 A;  1ZQ3 P;  1EV7 A;  1MMD A;  2ZCN A;  5AON A;  2REK A;  3NXC A;  3OYK A;  2PMU A;  1ZEL A;  5KVR A;  2A6E F;  4HYE A;  5HNF A;  3IH2 A;  5KAF C;  2W4S A;  2KT0 A;  3EYI A;  1BR4 A;  4UUT A;  5F04 A;  2R92 J;  1S9H A;  1R7J A;  1N25 A;  3DFG A;  2IA2 A;  2HFH A;  1EJ9 A;  3M8E A;  3WGH A;  2BY2 A;  1U9O A;  4Y7N J;  4ESB A;  3A4C A;  2ADU A;  2P81 A;  5EDN A;  1TWF J;  4CH7 A;  3J80 K;  3G1O A;  5FLV A;  4IOA F;  3CJD A;  1ETO A;  3GWZ A;  2YR2 A;  3F72 A;  3ERM A;  4RM2 A;  1B59 A;  5BNG A;  2R5Z A;  3S93 A;  1U0J A;  3HM5 A;  5K5R A;  3I55 I;  2Z2S B;  4EV0 A;  3IV5 A;  1E3H A;  1ODD A;  1DDN A;  1JKQ C;  1OR7 A;  1IXC A;  1ZGW A;  2K9N A;  2ZFU A;  3GCM A;  4MXM A;  2GA2 A;  1OCP A;  5J40 A;  3K4N A;  3RYP A;  4IHT A;  5JLX A;  2EV0 A;  4HX4 A;  1MIJ A;  2JA6 J;  1UI5 A;  2F5F A;  5GAD J;  4DYC A;  4E70 A;  4IQJ A;  2MH2 A;  2E36 A;  3GYH X;  5FRO A;  4EM0 B;  4EM2 A;  2YPR A;  1WI3 A;  2A05 A;  3MCZ A;  3IHU A;  4QIW N;  2E34 A;  4BXX J;  2MBF A;  2IGN A;  1DGW Y;  4E7I A;  4PXI A;  3UKG A;  3ROU A;  3ZN1 A;  2QSH X;  2AQE A;  3ZQC A;  3OYJ A;  1LUJ B;  4HAM A;  2R0Q C;  2EBI A;  4HBL A;  4G7O F;  2ZXH A;  3HJE A;  1A6I A;  2DYS H;  2L9S A;  2H6B A;  2BW3 B;  4A3G J;  1WSU A;  2QF7 A;  1MDM B;  1LE8 B;  3S2D J;  2OZ6 A;  4P5O A;  4S0H B;  2XSD C;  1T33 A;  2DT6 A;  2F5V A;  4F91 B;  3OYA A;  1EKE A;  3DKW A;  3FDY A;  4EGZ A;  2PFV A;  4UV9 A;  1K4T A;  2GOX B;  1TT5 B;  1GXQ A;  5FKL A;  4BHP A;  3NRV A;  3WTY C;  2V9K A;  1VQ7 I;  1D5V A;  2XV4 S;  1F1Z A;  1G6N A;  1QGP A;  4A3L J;  3GFI A;  2PJP A;  3H9J A;  3WTT C;  1Y8Q B;  5BPD A;  1PDN C;  2X48 A;  1R1T A;  2JVH A;  1X1A A;  1QO0 D;  3RYR A;  2AS5 F;  3BG7 A;  3AL0 C;  1O57 A;  5FKK A;  2EZH A;  2ELJ A;  4XSX F;  3AQS A;  4WXC A;  5DS9 A;  3DPT A;  1OR7 C;  3FMQ A;  3WE2 A;  5J1U A;  3A01 B;  4DYR A;  1FBS A;  1ZR4 A;  1SFX A;  4RB2 C;  3TW6 A;  1X3U A;  3IC7 A;  4GCV A;  1R36 A;  2RV8 A;  2DTR A;  3MKY B;  2F4O B;  4B3X A;  2YU9 J;  2HZT A;  1T2K A;  1SVM A;  2C6Y A;  2DFE A;  3BC8 A;  4IRH A;  1LVA A;  4BE2 A;  1LJ9 A;  2RQQ A;  3VOD A;  1BOA A;  4IRG A;  4QWQ A;  1BOB A;  2YS9 A;  4AUX A;  3QYB A;  2IGO A;  4NC8 A;  4DOZ A;  4BQA A;  4GXO A;  1RR8 C;  3O60 A;  1YO5 C;  2LF8 A;  2FRH A;  1OCC H;  3HC7 A;  1LNW A;  3FXK A;  2P6T A;  5F0H A;  2O6G E;  3AFH A;  3VW0 A;  4G6Q A;  3EGQ A;  3IP4 B;  4PSX A;  3PO2 J;  1FWZ A;  2HKU A;  1X4P A;  2VBY A;  3TMO A;  2ZBK A;  1F5T A;  1FSE A;  4AIJ A;  1N77 A;  1XMA A;  1FJL A;  1IXR C;  2ISZ A;  3ML6 A;  4CZC A;  3GZ6 A;  4UUV A;  2YX4 A;  2BXY A;  2K9L A;  3IWF A;  4BU2 A;  1LB2 A;  1YG2 A;  3WU2 C;  4FTH A;  3H1C A;  4EEF G;  3S1M J;  2IS4 A;  1TWA J;  1G4D A;  5GPC A;  2K40 A;  2EQR A;  3ELK A;  1IC8 A;  3G1L A;  2ID6 A;  1D0Y A;  1KQ8 A;  2Y48 A;  2HZD A;  3CES A;  3BPX A;  2OCE A;  4LB6 B;  3CCY A;  4CHU A;  4FT8 A;  1BI2 A;  5M5W J;  1S5L C;  2LOO A;  2XB5 A;  3WHB A;  3ZP5 A;  3JRE A;  2XAJ A;  2QIB A;  3DTK A;  5LFA A;  3NRG A;  3VOK A;  2M34 A;  4DW6 A;  5JHU A;  4M9X A;  2CQ7 A;  2BYV E;  4I6Z A;  4OMY A;  4XBF A;  1UAA A;  4IHV A;  2KFD A;  5B5E C;  5E3M A;  1PUF B;  1H9T A;  2MW8 A;  4M6X A;  4HNV A;  2MYS A;  5GAG J;  4XKB A;  1Z91 A;  1R1U A;  2QWW A;  2CUZ A;  2HQR A;  3KEY A;  3F6O A;  4L9J A;  1WJD A;  3C2G A;  4NHJ A;  2H1K A;  1Z6T A;  4UUS B;  4U9N A;  3BJO A;  3BZ6 A;  3GO5 A;  1S3J A;  2O5R A;  3IWZ A;  2W84 A;  1XB4 A;  2IS2 A;  1RKT A;  1TWG J;  2V1X A;  1VQ9 I;  2DTZ A;  2PN6 A;  1ZG1 A;  4Y13 A;  2YX7 A;  2NVU B;  1WJC A;  4ZDP A;  4CXF A;  2UV1 A;  5IOY A;  2CSO A;  4NC6 A;  3T1B A;  4YFK F;  4IRV A;  3AAF A;  1KA8 A;  2DAO A;  3FKI J;  4KIS A;  5AQC A;  1HC8 A;  2NAZ A;  3PSF A;  4J01 A;  5B1A H;  5D5U B;  2L3D A;  4OIN F;  4U7D A;  2CUF A;  2ZNY A;  3OWT A;  1VQM I;  3GEU A;  5D1R A;  3H0D A;  5K7F A;  3P7N A;  1MBF A;  2VKV A;  3H5N A;  2NVX J;  1UI6 A;  2L0K A;  3W6J B;  2RN7 A;  3R0J A;  4XOR A;  3TOB A;  4G12 A;  2HOA A;  3HPH A;  3QPH A;  2DI3 A;  1FP1 D;  1HSJ A;  2EFO A;  4LG3 A;  2VIX A;  4PCQ A;  1U5T C;  3B6C A;  2LLK A;  3LNQ A;  2ISY A;  1KYW A;  3HOZ J;  5IOZ A;  4KN4 X;  3IRR A;  2Y0S N;  2RQP A;  5LGT A;  3KZZ A;  4P55 A;  5TGT A;  1APL C;  3GW2 A;  1YW7 A;  2M9H A;  4MFD A;  1R1V A;  4O6J A;  2IXS A;  3KP6 A;  3ZQF A;  5E1X A;  1GV5 A;  1XCV A;  4B09 A;  2R3S A;  1S8N A;  4HLY A;  2M1B A;  3RTR A;  2P7V B;  2WWY A;  2DU9 A;  2GXB A;  4DZP A;  1MD0 A;  3G3Z A;  2EV5 A;  4V2F A;  1TT0 A;  4ZYA A;  1V5G A;  3JSO A;  1GXP A;  1XN7 A;  2HYJ A;  4GO1 A;  2G7L A;  4GCT A;  1ETK A;  1HQC A;  4XLN F;  5CVU A;  3AKZ A;  1X19 A;  1N78 A;  3NNR A;  1JUS A;  2LD5 A;  1UB9 A;  5H9T A;  5FD6 A;  5GTI C;  3HG9 A;  3S2H J;  1ZRE A;  3KET A;  2PBX A;  1FYK A;  1UHS A;  2HYF A;  4A3K J;  3EUP A;  2D1V A;  2H8W A;  3ABT A;  3GZN B;  4D7N A;  3G56 A;  4BJ6 C;  4KT5 C;  1B6A A;  4I0A A;  2E7W A;  2QBY A;  3CJN A;  3KYL A;  2BY0 A;  1Z21 A;  3L2U A;  3LHQ A;  1YIJ I;  2IBD A;  1R23 A;  4CGR A;  2MLK A;  2R93 J;  1D1A A;  1HKS A;  2K27 A;  3M3Y J;  3HTJ A;  3E0J B;  3LSM A;  3L2Q A;  3NS4 A;  3PQK A;  4XRF A;  3GFM A;  2QCO A;  1XGN A;  1L0O C;  4M6Y A;  2JUC A;  2UUZ A;  4DNC A;  1ZKG A;  3FXL A;  5BS6 A;  5E17 F;  1A35 A;  2GZW A;  5J1Y A;  3A0B C;  3GTJ J;  5BQT A;  2ELH A;  3SQN A;  3IUO A;  4RB1 A;  2VQL A;  2M8G X;  3DEU A;  3BQY A;  2L4M A;  1QZZ A;  3V7R A;  1WI9 A;  1QHG A;  2CV2 A;  2Y0M A;  1Z1D A;  3J7A Y;  3CLQ A;  3V7C A;  5E3O A;  2GOM A;  2EJR A;  1MSE C;  1D0X A;  1ZN2 A;  2CUJ A;  3BG6 A;  1BC7 C;  1LDD A;  3EPZ A;  3FXJ A;  3QQA A;  3VYS B;  2BEO A;  4XK4 A;  5IY5 H;  4H0E A;  1F36 A;  4Y4R A;  3E6B A;  3ONQ A;  1QVT A;  4CYC A;  3JSP A;  4BDY A;  2NS7 A;  5CQE A;  2NRA C;  2M7B A;  1OCZ H;  1RPW A;  3Q0U A;  2R7Q A;  4MEY F;  3BR6 A;  3S3N A;  3E7Q A;  3I4N J;  2WY7 Q;  3F22 A;  4OIR F;  2KLO A;  3D5S C;  4L5E A;  2GUH A;  1OFC X;  2E1M C;  2DFF A;  4XLF A;  2YU3 A;  2OZU A;  1SMY F;  3Q9V A;  4YRV A;  1Y1V J;  3RCO A;  4LG0 B;  2Z16 A;  3ZQH A;  1I1G A;  2BHY A;  1RR7 A;  2L9V A;  5FGM A;  4KNY A;  2MAB A;  4FIS A;  4OAZ A;  1UEL B;  1WH7 A;  3FBN B;  1OCO H;  4IHX A;  3M1C A;  3VOE A;  1UMQ A;  3JRG A;  4ETS A;  1ZYR F;  2QSF X;  3MD2 A;  2L5Q A;  2QWT A;  2NX4 A;  2BV6 A;  5FKN A;  1FIA A;  2WA0 A;  4HW0 A;  2NYX A;  3RPQ A;  2M8E A;  4MNU A;  2HEO A;  4GGG A;  1UZC A;  4N4N B;  4IHY A;  5DTD A;  2NP3 A;  3WTZ A;  2E5N A;  2F5D A;  1UHM A;  3VFZ A;  4R79 A;  2IA0 A;  1OCT C;  2R4G A;  1IN4 A;  4MTD A;  2H1L A;  2CYY A;  4Y33 A;  3DP7 A;  3HOU J;  3GTG J;  2R7F A;  2RC4 A;  4KWA A;  4RAG A;  2AXT C;  1RIO H;  2M0M A;  2JA5 J;  2FBH A;  1XG1 A;  3BLY A;  4UVB A;  2M3A A;  3H5R A;  3ESW B;  4JX5 A;  4P1W A;  1U8R A;  4LG0 A;  3V7S A;  1QPM A;  4I7H A;  1D1C A;  3LAJ A;  3HOT A;  2COM A;  3GVA A;  2B0L A;  4EAT A;  1X3Z B;  1M1E B;  2RNJ A;  2ZY9 A;  1AA7 A;  1RUO A;  1A31 A;  1V5E A;  3QU6 A;  2XAF A;  3EET A;  2A5Y B;  3ZMS A;  2V6E A;  3PNV A;  1HKQ A;  2Y2Z A;  4XKV A;  3WGI A;  1I1S A;  1B8I B;  4X0G A;  5F08 A;  4HST A;  2K3P A;  2LKS A;  1ENH A;  3DV8 A;  1ZGA A;  5CLS A;  3P9I A;  3F8M A;  1K78 B;  3I71 A;  1EH8 A;  4S04 A;  3MKL A;  4HNT A;  4E7Z A;  1F43 A;  4ENM A;  2IP2 A;  4QPO A;  1HDP A;  1OYW A;  3VB2 A;  3JRC A;  3GZI A;  2P4W A;  2QQB A;  4BE1 A;  2DG7 A;  5TIS C;  2HVQ A;  1E0E A;  1FX7 A;  1Q1H A;  3HTS B;  4IQ4 A;  5D8L B;  4ESF A;  1O3Q A;  3QWL A;  2HNH A;  5JI6 A;  2V1N A;  2VXD A;  3Q3S A;  4BEH B;  3ZQL A;  1O3S A;  3I58 A;  3TDZ C;  3HOW J;  3OOP A;  4V19 K;  1IRF A;  4BL0 B;  1UST A;  3BG5 A;  4GDF A;  1MNM C;  1O4X A;  2QBY B;  1GV2 A;  3JW4 A;  2V79 A;  4L5J A;  4ENN A;  3RI4 A;  1T38 A;  3VUQ A;  2DDB A;  1ORK A;  4Q48 A;  1BJA A;  5J8C A;  2DG8 A;  4E7K A;  3FRQ A;  4UXN A;  1UHW A;  4CCM A;  2HU9 A;  1GVJ A;  4D5C A;  1ON1 A;  3OMY A;  1SVL A;  2L54 A;  2HPM A;  5GAH J;  3HTU A;  2CG4 A;  5F1J A;  3CP8 A;  5D6E A;  2UXI A;  1LFB A;  4DQ2 A;  4NBQ A;  2NNN A;  2XF7 A;  2ZME C;  4WXD A;  4BS9 A;  4YFN F;  2Z99 A;  5EGO A;  2CU7 A;  3F3X A;  4I01 A;  5H20 A;  4ZTJ A;  4XN0 A;  1WJE A;  3ZMD A;  2GXA A;  1U2W A;  3J80 Z;  2JUG A;  1U5T B;  4NDL A;  4N4O B;  2FU4 A;  3KZ9 A;  1T6S A;  4U0W A;  5FFX A;  4B44 A;  4LIT A;  3QP5 A;  1YIT I;  3G2B A;  1IF1 A;  1Y0N A;  2F4I A;  5IT3 A;  3COL A;  1FBQ A;  2KHM A;  3O3K A;  3L9F A;  1XGO A;  4A0Y A;  3J7Y J;  3OIO A;  1HLV A;  2G7S A;  2QKO A;  2O03 A;  1YOV B;  4YG2 F;  3ZR8 X;  1P4X A;  5DDG A;  1JGG A;  2RDP A;  3ASO H;  1GDT A;  2HOE A;  4PFO A;  4XON A;  1X4O A;  3TO9 A;  2LY9 A;  2UXU A;  2CW8 A;  1WJ5 A;  1KQ0 A;  2F6C A;  4PUS A;  2NNY A;  1YFH A;  5LEK A;  3M7G A;  4PFP A;  3JRH A;  3MKW B;  1AHD P;  3VSK A;  2DYR H;  2PFB A;  4QLC U;  1B72 B;  1R6R A;  3K70 C;  4XRS A;  5HLT A;  3VW2 A;  2GIV A;  3Q0W A;  1ERD A;  3LOC A;  3TED A;  3JAM K;  3A02 A;  1XPX A;  5CXG A;  3TDU C;  2KIU A;  4DZJ A;  4A3C J;  3JAM Z;  3QP6 A;  4WIB A;  2VKD A;  4C2M A;  2FMY A;  2XAH A;  4KIG A;  2VB6 A;  3PUF A;  3VVY A;  4E6K G;  3L2C A;  4XRS G;  2DA4 A;  2K85 A;  2LSO A;  1SD4 A;  3RJP A;  1TQI A;  5CQG A;  2ZFW A;  1A04 A;  4FHT A;  3HUG B;  1D3Y A;  2MLG A;  2JPC A;  2B9S A;  1O7F A;  1ZRD A;  3LST A;  4YEJ A;  2WV1 A;  4AIH A;  4ZDO A;  2LRE A;  5E8G A;  2DMN A;  2M4K A;  4BY7 J;  2VC0 A;  4C3H J;  1MBJ A;  1FOX A;  4LLG F;  5IT9 Z;  4JKZ A;  3DTE A;  3I56 I;  3LWJ A;  2V7F A;  1I3A A;  1SFK A;  1ETY A;  4RGX A;  2KRH A;  1W7P D;  3PSI A;  3CC4 I;  2EFN A;  5M3M J;  4KFC A;  2WGB A;  1X58 A;  1Z3X A;  2LC2 A;  2KMU A;  5M5Y J;  4AM3 A;  3BRU A;  3BP8 A;  5FHP A;  3WOD F;  2OPT A;  3RH2 A;  2MD0 A;  2DOE A;  3QYE A;  2W25 A;  3AG1 H;  4I2O A;  1D5Y A;  3KNW A;  1JKR C;  4BQO A;  2R7W A;  3ZMT A;  5CXI A;  2IVM A;  2EPF A;  4W1U A;  2PEX A;  2Q24 A;  3HTH A;  2KPM A;  3RQ4 A;  1BBY A;  5FKO A;  3OOU A;  4CZZ A;  4HF2 A;  2KJC A;  3OIQ A;  4K2E A;  1X1P A;  2QOP A;  2RHA A;  2XGD A;  5D8K B;  1NG7 A;  2W7N A;  3MWM A;  3EUH C;  1LPQ A;  4A6D A;  3V42 A;  1FC3 A;  2Q1Z B;  3K1M A;  4IJA A;  1LEB A;  1FMV A;  4M9Z A;  2QGU A;  1KZH A;  1RUN A;  2DMT A;  3KP5 A;  1P6R A;  2QQA A;  2BVM A;  2XPW A;  4MO7 A;  3CCE I;  2YUS A;  1J2X A;  2JA8 J;  4M3B A;  1JKP C;  4E7S A;  3CCL I;  2CWE A;  5CW8 A;  3BZK A;  3BWG A;  3E6M A;  4U87 A;  3WTU C;  1TW3 A;  5CPR B;  5E18 F;  5DUI A;  1GT0 C;  4XMY A;  5C4X J;  3CO6 C;  4OIQ F;  4V2G A;  4Y3O A;  4U7B A;  3MZY A;  2F2E A;  2L7K A;  3NWS A;  3EDP A;  1DGR M;  1R5I D;  4NUB A;  3HPG A;  2H27 A;  2X4H A;  4OAY A;  1XMK A;  4A3J J;  3CJR B;  5HOD A;  2A68 F;  3QPL A;  1SGM A;  1LEA A;  4XIC A;  2LYC A;  3OS2 A;  5J4Y A;  3JRD A;  4F7Z A;  3L2R A;  3E6D A;  1H9G A;  3ULQ B;  4II3 A;  2KIF A;  4WXH A;  3R4K A;  1XMX A;  4O5V A;  3OYH A;  2LKP A;  3HSF A;  1IUF A;  4OD5 A;  2V9V A;  2LK2 A;  2DJN A;  3HUG A;  1K7A A;  2Q0O A;  4XR6 A;  5LHI A;  4ZDL A;  3EUK L;  3U1D A;  2FXA A;  4I99 C;  2B7E A;  3E97 A;  3DXJ F;  3RKQ A;  4RS8 A;  1D0Z A;  3J81 K;  3DBL B;  3KP2 A;  3VEP A;  1Y56 A;  1B8I A;  2ACJ A;  4LIV A;  1U9N A;  3HYI A;  3K7A J;  3G4S I;  3MKZ A;  3ANG A;  3RKX A;  2PX9 A;  2BY1 A;  2UZK A;  4A6E A;  2BW3 A;  4BDZ A;  4E7H A;  3FBI B;  1OYY A;  2K86 A;  4U88 A;  4A93 J;  4XN3 A;  4G7H F;  1T98 A;  4HZF A;  2QM3 A;  1V4R A;  5C4J J;  3PJR A;  4XOP A;  3JSJ A;  2J5P A;  2ZJ2 A;  1IV6 A;  4RDU A;  3SJM A;  5D6F A;  3DEE A;  3E5U A;  1J0R A;  1OPC A;  3HB9 A;  4MHG A;  1TP4 A;  5L3E A;  4ON0 A;  3ISP A;  4NEL A;  3OIP A;  5IYB J;  3I64 A;  4LGW A;  3FIW A;  4UDS A;  2W00 A;  4YEL A;  3S1N J;  2RAE A;  4HG2 A;  2ZJR F;  5IP6 A;  3BOQ A;  2LH9 A;  3TO6 A;  4ZC3 A;  4XLP F;  3I54 A;  1STZ A;  1WVR A;  4NB5 A;  3MN2 A;  2KJB A;  3WE3 A;  3H9Q A;  1JUP A;  1TNT A;  1U5T A;  3WTV C;  2WY8 Q;  2R5Z B;  1YW8 A;  4CDG A;  3Q5F A;  1MGT A;  2GAU A;  2FBK A;  1G3T A;  2V1D A;  2VJJ A;  2X85 A;  1T39 A;  2FQ3 A;  1R00 A;  4R8H A;  3QRF F;  5B1B H;  1VQ6 I;  1WPK A;  4DBR A;  1MMS A;  1HW5 A;  1K4S A;  1U3E M;  3LFU A;  2DLL A;  1I6X A;  2L9R A;  3L7W A;  3OL3 A;  2GXG A;  4C30 A;  1YX5 A;  1ZG3 A;  3CUO A;  4DYQ A;  1TL8 A;  3VVZ A;  1MBG A;  1B72 A;  2FML A;  1WZ2 A;  3W6V A;  3CJQ B;  1W0T A;  1JUM A;  3E3V A;  1BI0 A;  1K79 A;  1QRY A;  2MG4 A;  3DU5 A;  3ZQG A;  4HNU A;  3J7A O;  3EUA A;  4CCN A;  2QEN A;  3DQV C;  2Q8K A;  1X1C A;  3IKV A;  2OC6 A;  3ZRG A;  3CDI A;  4BJ5 C;  1WGX A;  3TQN A;  5FRM A;  5DCM B;  4DJA A;  2EIJ H;  4DVY P;  3OL4 A;  3S1R J;  2VI6 A;  4QSH A;  4OMZ A;  1ITY A;  3IH3 A;  4XSZ F;  3KEO A;  3REO A;  2R7U A;  1IDZ A;  1PJR A;  3K1P A;  4KUM A;  3MZ8 A;  4BYY A;  3S5R A;  2EH3 A;  3CCV I;  2HDD A;  4A5M A;  2G7G A;  3F8F A;  2LMD A;  1YHQ I;  2GM4 A;  1VQ4 I;  3BR2 A;  1U6G A;  2EFQ A;  1UFM A;  1W0U A;  4AVZ A;  1VQO I;  1IG7 A;  3H5A A;  4ZJZ A;  5IYD J;  1W4M A;  3HKZ N;  2EK5 A;  1TNS A;  1OQY A;  1JTY A;  3DPU A;  1IN7 A;  2VQC A;  1R9T J;  4WCG A;  3TKY A;  4G8X A;  5GAE J;  4E4H A;  1FT9 A;  5IP9 J;  1ZRF A;  3NI7 A;  5FB2 A;  2O8X A;  2VBZ A;  2A3S A;  2PLY A;  1T95 A;  3FK7 A;  4LFU A;  4JNN A;  3K4K A;  3G73 A;  4Y52 J;  2D1H A;  4B47 A;  1B4A A;  2FA5 A;  1SVO A;  4I09 A;  2WAQ A;  1JJ6 C;  1XGM A;  2FF4 A;  3ZCO A;  3FXM A;  2XRO A;  2JA2 A;  5H6Q A;  3HHH A;  9ANT A;  3JTG A; 
#chains in the Genus database with same CATH homology
 1QVU A;  3B81 A;  1RR7 A;  2IU5 A;  3CRJ A;  3QKX A;  5FLM J;  4A3B J;  4X6A J;  1EF4 A;  5IP7 J;  3CDL A;  2CQX A;  4FIS A;  4JL3 A;  3I4M J;  1BA5 A;  1WH7 A;  2F07 A;  4IHX A;  3JRG A;  1UMQ A;  2ID3 A;  2N8G A;  1XC5 A;  3BCG A;  1I3Q J;  2QWT A;  2NX4 A;  2E19 A;  5FKN A;  1FIA A;  2ZOZ A;  5E3L A;  2DMU A;  4AC6 A;  5FGL A;  1H89 C;  5FJ8 J;  1T56 A;  3PAS A;  2VUM J;  4IHY A;  5DTD A;  2NP3 A;  3HBL A;  4BY1 J;  4A3F J;  1X2M A;  5FKM A;  2X6O A;  1OCT C;  1BW5 A;  3NPI A;  5EYR A;  4FE4 A;  4W97 A;  3B6A A;  2JMW A;  4D7M A;  3GTL J;  5D18 A;  5HBU A;  2ECB A;  2G0E A;  2O8K A;  4ABZ A;  3GTG J;  2R5Y A;  3HOU J;  4KWA A;  3BR0 A;  1GUU A;  2JWT A;  3BTI A;  2JA5 J;  4I76 A;  5C44 J;  1XG1 A;  2RAS A;  2EZL A;  2DA3 A;  1TWH J;  3NAR A;  5EG0 B;  4M6V A;  4JX5 A;  3CMY A;  2Y9Z A;  5HAW A;  4B4C A;  4B3A A;  3BNI A;  3LJL A;  3K2A A;  2ZCX A;  2DA7 A;  2LVS A;  4D5F A;  3V6G A;  4BKX A;  2WAQ N;  4J19 A;  1NK2 P;  2GBY A;  1IJW C;  3HGY A;  2VKE A;  3BTC A;  4A3I J;  3VW1 A;  5EG0 A;  2XGE A;  2Y2Z A;  1B8I B;  5F08 A;  3LSJ A;  5EF6 A;  3GTO J;  2R5Y B;  1ENH A;  2L7Z A;  1SAN A;  1JTX A;  1LFU P;  2WUI A;  1Q1V A;  5J3L A;  3TP3 A;  4C3I J;  1IGN A;  2YVH A;  2ECC A;  3MKL A;  2H8R A;  2JA7 J;  2ZCM A;  1F43 A;  3PO3 J;  1HDP A;  3JRC A;  5EEA A;  3GZI A;  2DA6 A;  1HF0 A;  1BW6 A;  3FK6 A;  2G3B A;  1MBK A;  2HXI A;  3HEF A;  2DG7 A;  2ZOY A;  3GTK J;  3S14 J;  3BG9 A;  2CRG A;  3MNL A;  3VPR A;  5EGO B;  2FX0 A;  1HDD C;  2KDZ A;  1RES A;  2CUE A;  2HOT A;  2GEN A;  2XRL A;  3Q3S A;  3BHQ A;  3ZQL A;  1XS9 A;  4BBS J;  2HOS A;  3HOW J;  1AKH B;  1ZQ3 P;  2D6Y A;  3HTI A;  2ZCN A;  1G2H A;  3BG5 A;  2VPR A;  2GLO A;  2REK A;  1MNM C;  1O4X A;  3NXC A;  5GP9 A;  1GV2 A;  2EZI A;  3VUQ A;  3F0C A;  1ORK A;  2DG8 A;  3IH2 A;  1GVD A;  3FRQ A;  5EFY A;  2KT0 A;  5F04 A;  4UUT A;  2R92 J;  1ETQ A;  4D5C A;  4ICH A;  2M0C A;  3GTQ J;  1FTZ A;  1E3O C;  5F1J A;  1BL0 A;  2UXP A;  1K61 A;  2UXI A;  1LFB A;  1U9O A;  4Y7N J;  4M3G A;  3VVX A;  3BR3 A;  3D1N I;  2XDN A;  3NAU A;  2P81 A;  1U8B A;  5EDN A;  1TWF J;  2OER A;  2PZ9 A;  3G1O A;  2CU7 A;  2DA5 A;  5EGO A;  1Y1W J;  5FLV A;  1ETO A;  3CJD A;  4JYK A;  4A69 C;  1IDY A;  5BNG A;  2R5Z A;  1YRN A;  3RZO J;  5EZH A;  3HIM A;  3HM5 A;  3HDD A;  2XGC A;  4NDL A;  3IV5 A;  3JRB A;  1JJ8 C;  2B63 J;  3KZ9 A;  1TWC J;  4C3J J;  4L62 A;  1JKQ C;  4BBR J;  3C2B A;  2AHQ A;  1ZGW A;  3COL A;  2K9N A;  2XB0 X;  2QTQ A;  1MBE A;  4MXM A;  1OCP A;  2NS8 A;  1MH3 A;  4X1E A;  2K9Q A;  2HXO A;  3OIO A;  1HLV A;  5JLX A;  2G7S A;  1I50 J;  3IH4 A;  2QKO A;  2JA6 J;  1Z77 A;  4A3M J;  1UI5 A;  4DYC A;  4MK6 A;  1ZK8 A;  2JN6 A;  1CQT A;  1JGG A;  1P7J A;  1GDT A;  1WI3 A;  3HGG A;  4QIW N;  3ANP A;  4M3E A;  2LY9 A;  2UXU A;  4BXX J;  4PXI A;  4JX6 A;  1HOM A;  4RBO A;  3UKG A;  3DEW A;  3ZQC A;  3VOX A;  2R0Q C;  2D5V A;  2EBI A;  3VIB A;  2JJ7 A;  3ON4 A;  3JRH A;  1A6I A;  1FIP A;  1AHD P;  2JK3 A;  1B72 B;  4A3G J;  4XRS A;  2QF7 A;  1LE8 B;  3S2D J;  3VW2 A;  2NVY J;  1OJL A;  1FEX A;  3Q0W A;  4S0H B;  3LOC A;  2XSD C;  2CQQ A;  3TED A;  3A01 A;  5DAJ A;  1T33 A;  3A02 A;  5CXG A;  3BTJ A;  4DZJ A;  4A3C J;  3G7R A;  1X2N A;  1POG A;  2FQ4 A;  5FKL A;  5IYC J;  4GFB A;  2DMP A;  2PMZ N;  5J1R A;  4FCY A;  4A3L J;  3ZOB A;  3VVY A;  4XRS G;  2DA4 A;  2X48 A;  3G1M A;  4UUS A;  3RZD J;  5FKK A;  2EZH A;  3S17 J;  1TC3 C;  3CWR A;  3AQS A;  3T6N A;  5DS9 A;  2Y30 A;  5F0F A;  2WV1 A;  3FIS A;  5FMP A;  3A01 B;  1WH5 A;  5J1U A;  1PUF A;  3F1B A;  4DYR A;  2DMN A;  1ZR4 A;  3S16 J;  5E3N A;  4BY7 J;  4C3H J;  1MBJ A;  3TW6 A;  4JKZ A;  5HSZ A;  3LWJ A;  2HQ5 A;  1ETY A;  2YU9 J;  1ZTR A;  3QBM A;  4A3E J;  3BR5 A;  5M3M J;  2WGB A;  1X58 A;  5M5Y J;  3BRU A;  2DMQ A;  2O7O A;  5FHP A;  3Q0V A;  2OPT A;  3RH2 A;  2MSY A;  3BJB A;  2YS9 A;  4AUX A;  1D5Y A;  3KNW A;  1JKR C;  2ME0 A;  4GFK A;  5CXI A;  3TP0 A;  3O60 A;  4LOC A;  4W1U A;  3SFI A;  2Q24 A;  3HTH A;  4JP0 A;  1VND A;  4A3D J;  5F0H A;  3O8G A;  2LFB A;  5FKO A;  3OOU A;  3VW0 A;  1SFO J;  5K7Z A;  3JRA A;  2QOP A;  2RHA A;  2XGD A;  3EGQ A;  1RKW A;  3DCF A;  4XID A;  2TCT A;  3PO2 J;  1ETW A;  1WCM J;  2HKU A;  2GFN A;  3VP5 A;  2NVT J;  2OF7 A;  1NK3 P;  2DMT A;  1NTC A;  1FJL A;  2XPW A;  3GTP J;  4MO7 A;  2YUS A;  2JA8 J;  4M3B A;  4IEJ A;  5M3F J;  1JKP C;  3SDG A;  1MSF C;  5M5X J;  4C2M J;  5CW8 A;  3S1M J;  4FTH A;  4EEF G;  1TWA J;  2DA2 A;  5GPC A;  2K40 A;  2EQR A;  1GT0 C;  1IC8 A;  1JKO C;  5C4X J;  1Z0X A;  3G1L A;  3LSR A;  2NP5 A;  2ID6 A;  4V2G A;  3ZQI A;  2UXH A;  5IPA A;  2R7Z J;  3S15 J;  1P7I A;  3BQZ A;  2L7F P;  3CCY A;  3C07 A;  5M5W J;  2FJ1 A;  2XB5 A;  3WHB A;  4A3J J;  3JRE A;  1FTT A;  2QIB A;  3PM1 A;  2UXO A;  1ZR2 A;  3RD3 A;  3CQZ J;  2XPV A;  4M3F A;  5HOD A;  2IEK A;  3NRG A;  3QPL A;  1SGM A;  3VOK A;  4XIC A;  2M34 A;  3HTA A;  4DW6 A;  1UG2 A;  2W53 A;  3JRD A;  4MLO A;  4I6Z A;  4IHV A;  3OSG A;  2WB1 N;  3O8H A;  5E3M A;  1PUF B;  4IHW A;  2Y9Y A;  3IUV A;  2MW8 A;  4HNV A;  2LP0 A;  5K7H A;  1IUF A;  3A03 A;  3E7L A;  5F27 A;  2LK2 A;  2DJN A;  3BT9 A;  3KKD A;  4ACI A;  2H1K A;  4UUS B;  5F0C A;  1IRZ A;  5C4Y A;  3RKQ A;  4MIM A;  1RKT A;  1TWG J;  2DTZ A;  3LSP A;  3M4O J;  1B8I A;  1U9N A;  1H88 C;  1ETX A;  3K7A J;  3ANG A;  4YZE A;  1K83 J;  3JR9 A;  1S7E A;  4FE7 A;  1LE8 A;  5IOY A;  5GPA A;  5D19 A;  4A93 J;  3OSF A;  3BR1 A;  3FKI J;  2HYT A;  5AQC A;  2O7T A;  2O9L A;  5C4J J;  3JSJ A;  2CUF A;  1IV6 A;  2LKX A;  4RDU A;  3GEU A;  3BTL A;  5D1R A;  5K7F A;  3SJM A;  1MBF A;  2VKV A;  3HB9 A;  3V78 A;  1VI0 A;  2NVX J;  1UI6 A;  2TRT A;  2L0K A;  4NEL A;  3LSG A;  5IYB J;  3JRI A;  4G12 A;  2HOA A;  2X9D A;  3FIW A;  3QPS A;  4UDS A;  2E2I J;  1AU7 A;  2NVQ J;  1VF9 A;  3S1N J;  4HKU A;  2OI8 A;  2RAE A;  1RET A;  4AF5 A;  5IP6 A;  4AC0 A;  3B6C A;  2LLK A;  1QPI A;  3LNQ A;  4GFL A;  3HOZ J;  5IOZ A;  4GCL A;  1H8A C;  2Y0S N;  3GBG A;  3KKC A;  3HOY J;  1JT6 A;  3MN2 A;  1APL C;  4QTR A;  2E2J J;  2M9H A;  4B1R A;  4MFD A;  2V57 A;  5K58 A;  1JUP A;  1U78 A;  1DU0 A;  3ZQF A;  3PPB A;  1GV5 A;  2AO9 A;  2R5Z B;  2W48 A;  4DZP A;  4AYB N;  3HOX J;  4V2F A;  1WPK A;  2HYJ A;  2IAI A;  2G7L A;  4GCT A;  1ETK A;  2FD5 A;  3HOV J;  1ETV A;  3NNR A;  2L9R A;  1JUS A;  2LD5 A;  5H9T A;  3WHC A;  4DYQ A;  3S2H J;  3VVZ A;  2PBX A;  2E1O A;  1MBG A;  1UHS A;  2E2H J;  3AQT A;  1B72 A;  2NOG A;  4A3K J;  3EUP A;  3W6V A;  1W0T A;  4D7N A;  1JUM A;  3G56 A;  2LTP A;  1HCR A;  2L7M P;  1QRY A;  2MG4 A;  2YVE A;  3ZQG A;  2COB A;  3LHQ A;  3TW7 A;  2IBD A;  1AKH A;  4CGR A;  2R93 J;  1WGX A;  4CYC B;  3M3Y J;  3HTJ A;  4MFE A;  1DU6 A;  2K9S A;  3S1R J;  2VI6 A;  4QSH A;  1ITY A;  3IH3 A;  4XRM A;  2QCO A;  1IDZ A;  3L1P A;  2ELK A;  3HE0 A;  3ON2 A;  1ZKG A;  4NN1 A;  3GTM J;  3S5R A;  2EH3 A;  5J1Y A;  3GTJ J;  2HDD A;  2G7G A;  3P9T A;  2GM4 A;  2CJJ A;  2XPU A;  2M8G X;  3BR2 A;  3JRF A;  3BQY A;  1W0U A;  1IG7 A;  2Y31 A;  2EZK A;  1JT0 A;  5IYD J;  3HKZ N;  3S1Q J;  2ME6 A;  5C3E J;  5E3O A;  1YRN B;  1JTY A;  4M3D A;  1MSE C;  2DN0 A;  1R9T J;  2LR8 A;  3QQA A;  5IP9 J;  4ME9 A;  4XK4 A;  5EZG A;  3NI7 A;  3H0G J;  1F36 A;  1A5J A;  2HI3 A;  2I10 A;  1QVT A;  1BJZ A;  3FK7 A;  4CYC A;  1I6H J;  4JNN A;  2NS7 A;  4Y52 J;  4JX4 A;  2DA1 A;  1RPW A;  3Q0U A;  3BR6 A;  1JJ6 C;  3MVP A;  5JLW A;  3I4N J;  3E7Q A;  3RQI A;  4GCK A;  4L5E A;  2GUH A;  1OFC X;  3BG3 A;  1VFC A;  2M2E A;  3H3V K;  3DPJ A;  1MBH A;  2MGQ A;  1Y1V J;  1MH4 A;  9ANT A;  2FBQ A;  3ZQH A;  2ZB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...