1QVUA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvuA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvuA02
1VI0A 3HOUJ 1D5YA 3M3YJ 3BR6A 1FEXA 3PO2J 1BJZA 5IP6A 3ON2A 5M5YJ 1APLC 3JREA 5EGOA 3S1RJ 1NK3P 2CUEA 5CXIA 3A01B 3H3VK 2DG7A 3D1NI 5F08A 3AQSA 3MKLA 2GUHA 3JRCA 1GV2A 4GFBA 3LHQA 3IH2A 2HDDA 3HM5A 4M3FA 3S1MJ 4QSHA 4JX4A 4ME9A 4W97A 3E7LA 2L0KA 3S15J 5IYDJ 3SFIA 3CQZJ 1X2NA 2WB1N 5K7HA 1GUUA 4BY7J 3GEUA 4XRSA 3ANPA 1OCPA 2Q24A 2M8GX 3BR5A 3T6NA 2E19A 4FISA 1T56A 4A3FJ 1JT0A 3BR2A 3HOZJ 2TCTA 2O8KA 2ELKA 5D19A 3Q0UA 1DU0A 4A69C 1YRNB 3HTAA 3VPRA 1F36A 3ON4A 1IGNA 4L5EA 2R5ZA 3O8GA 3OSGA 2PBXA 1RPWA 1I6HJ 3S14J 5FGLA 2JA7J 3EGQA 2MW8A 2NVYJ 1NTCA 2GLOA 1POGA 5F04A 4RDUA 2F07A 3F1BA 3BRUA 2QKOA 3TEDA 2LP0A 2DMPA 4D7MA 2N8GA 3HDDA 3Q0VA 4UUSA 1AHDP 4IHWA 3ZQFA 1PUFB 2HXIA 3GTOJ 4KWAA 1ZK8A 1IJWC 2XPWA 2LLKA 1SGMA 1MH4A 2VUMJ 5J1YA 2W53A 2ME6A 2E2HJ 1ITYA 5EG0A 1IV6A 2ZCMA 2YVHA 2JA6J 2AHQA 1IUFA 1FIAA 1RKWA 4AC0A 1FTTA 3W6VA 5C4YA 1B72B 5M3MJ 2WGBA 3K7AJ 5FKMA 3JRIA 3CRJA 4ICHA 5GPCA 4BKXA 1A6IA 1B8IA 1AU7A 2CQQA 2G7SA 2G7LA 3SJMA 5FHPA 2DTZA 4A3MJ 1LE8A 1LFBA 3LOCA 3K2AA 1TWAJ 3S16J 1AKHB 3CMYA 2ZOZA 5H9TA 1WGXA 2EZIA 2Y2ZA 2L7ZA 3S5RA 2NS8A 1YRNA 4BY1J 5M5XJ 3S2HJ 3WHBA 1IDZA 1ZTRA 3ZQHA 1H8AC 3LSGA 2DMTA 2XGDA 4ACIA 4GCLA 3JR9A 2NS7A 2Y31A 5FJ8J 3VP5A 1ETQA 1WPKA 3HBLA 1Z77A 2V57A 2CUFA 2QTQA 2DN0A 4BBSJ 4JNNA 1WH7A 2K9NA 5J3LA 3GTMJ 3LJLA 3HTIA 5FKKA 4D7NA 1ENHA 1MSEC 2GBYA 2Y9ZA 3HTHA 1HF0A 4B3AA 3ZQCA 3FKIJ 2JWTA 2GFNA 3MN2A 1VNDA 3S1NJ 2E1OA 2ZB9A 4C3HJ 2ID3A 3JRFA 3CWRA 3QQAA 1BL0A 5C4XJ 4MIMA 1OJLA 2QOPA 4JL3A 2G0EA 3KNWA 1HOMA 4B4CA 3FIWA 3V6GA 1TWCJ 3TP0A 4B1RA 2NOGA 3S17J 2HOTA 1W0TA 3L1PA 3RZOJ 3Q3SA 2K40A 2UXUA 5BNGA 4D5CA 4LOCA 4EEFG 5IYCJ 5C3EJ 4C2MJ 1XC5A 3BQZA 2FBQA 5F27A 4HNVA 4NELA 2OERA 2CU7A 2IBDA 2HXOA 2XGCA 1T33A 3LSJA 2IEKA 3C2BA 1Y1WJ 3G56A 2DA1A 3QBMA 2RAEA 2XB0X 2COBA 2LTPA 2EZKA 4Y7NJ 1U9NA 4XICA 2OPTA 3VVYA 4IHVA 3COLA 1MBFA 4CYCB 4MFDA 2HYTA 1JGGA 1NK2P 5IOYA 4DW6A 4MO7A 3NNRA 2Y0SN 2B63J 2K9SA 4GFLA 2IU5A 1P7IA 3O8HA 4JYKA 3A03A 1QRYA 1JJ8C 3GTKJ 1SANA 2G3BA 2CJJA 2R92J 4V2GA 4BXXJ 2GENA 3CDLA 3F0CA 4AUXA 4BBRJ 5E3OA 1MBKA 2KT0A 4M3EA 2DA5A 1MBGA 2ZCXA 3LSRA 4PXIA 2WUIA 4G12A 3FISA 3LSPA 3VVZA 1RETA 4C3JJ 4QIWN 4I6ZA 3UKGA 3DCFA 3NAUA 4S0HB 2ZCNA 2W48A 1JTXA 2XDNA 4V2FA 3E7QA 1WH5A 3G1LA 2ME0A 3A01A 3KKDA 2YU9J 1Q1VA 3VW1A 2DA3A 4UUTA 2DA7A 1VF9A 3MVPA 2VI6A 1DU6A 2EZHA 3BTJA 3NXCA 1S7EA 2R5YB 4A3CJ 3GTJJ 3O60A 2HQ5A 3PM1A 1E3OC 2YVEA 1QPIA 2O7OA 5FKOA 1ZQ3P 1IG7A 4FE7A 1XG1A 2YS9A 3RQIA 1ORKA 3S1QJ 3BNIA 4FCYA 1ETOA 1RESA 3ZQGA 1EF4A 2FJ1A 2NVTJ 5EYRA 3B6AA 5F0FA 2P81A 5GPAA 3CCYA 3BCGA 1P7JA 1ZGWA 4MLOA 2QWTA 1R9TJ 2XB5A 2M0CA 5IOZA 3JRAA 1H89C 4GCTA 3HTJA 1HCRA 5C44J 4DYCA 5E3NA 2JA8J 3QKXA 4MK6A 2LVSA 2Y30A 3AQTA 1K83J 4A3KJ 5EFYA 5FLVA 2VKVA 2G7GA 5D1RA 1WI3A 4XRSG 1TC3C 2FQ4A 2LD5A 1BW6A 2R93J 1ETXA 2VKEA 2Y9YA 4ABZA 3BTCA 3HGYA 2QIBA 1ZR2A 4X6AJ 1JUMA 1JKPC 2LKXA 4C3IJ 2XPUA 5EGOB 5CXGA 2RHAA 2HYJA 2UXOA 9ANTA 1PUFA 1JUSA 3BTLA 3IUVA 2MGQA 3NARA 5D18A 2REKA 5E3LA 5K7FA 2H8RA 1UI6A 3VIBA 2R5YA 1XS9A 1UHSA 2FX0A 4QTRA 5FMPA 3VW0A 3FK7A 2XPVA 5F1JA 2YUSA 1VFCA 2E2JJ 3NRGA 1B72A 4DYQA 1FIPA 5K7ZA 4RBOA 1U78A 3IH4A 1X2MA 4JX6A 1MSFC 5JLWA 2R0QC 2M9HA 2DJNA 3C07A 2E2IJ 3GTGJ 1GV5A 3IH3A 4A3BJ 5FKNA 1AKHA 1K61A 4M3BA 4A3DJ 3VVXA 2L7MP 2JK3A 1I3QJ 2XSDC 1MNMC 1TWGJ 2NVXJ 2CRGA 2O9LA 4DYRA 4A3LJ 2NP5A 1WCMJ 3PO3J 1F43A 2NP3A 1OCTC 2UXHA 3JSJA 1HDPA 1U9OA 2K9QA 3RKQA 2EZLA 1CQTA 3OSFA 4AF5A 1OFCX 3HE0A 3B6CA 4D5FA 2R5ZB 1FJLA 2D5VA 3HOWJ 1JKQC 2UXPA 3GZIA 2HOAA 3H0GJ 5EZGA 5EF6A 4DZPA 3BR1A 3S2DJ 1TWFJ 3TW6A 3HOXJ 5CW8A 2LFBA 4M3DA 3FRQA 1MBJA 1RKTA 4UUSB 4JP0A 1A5JA 5M5WJ 3ZQIA 2QCOA 2GM4A 1U8BA 1HLVA 3DPJA 1X58A 1JUPA 1HDDC 1RR7A 2XRLA 4M6VA 3TP3A 5F0CA 1JJ6C 1JKOC 2M34A 3Q0WA 3I4MJ 2L9RA 2LK2A 3TW7A 2X6OA 5EG0B 4AYBN 2PZ9A 1BA5A 5M3FJ 2RASA 5F0HA 4L62A 2EBIA 3BR3A 2L7FP 4MXMA 3DEWA 3HKZN 2PMZN 4XIDA 3LWJA 3P9TA 4JKZA 4XRMA 1GT0C 1B8IB 2EQRA 1JT6A 1LE8B 2DMUA 5IP9J 3VW2A 5DAJA 2DMQA 3OIOA 3NPIA 1GDTA 3OOUA 1I50J 2LR8A 5HODA 2D6YA 1BW5A 2I10A 2UXIA 2DMNA 4X1EA 3HOVJ 3ANGA 1ETKA 3BTIA 1Z0XA 5K58A 3BR0A 1MBHA 5IP7J 3RZDJ 2XGEA 2HI3A 3KKCA 2JA5J 1UI5A 4GFKA 3G1MA 1O4XA 1G2HA 2DA6A 4CYCA 2IAIA 2KDZA 5J1UA 3GTQJ 3V78A 3PPBA 5HBUA 1IDYA 2QF7A 3HGGA 1MBEA 3HB9A 5FLMJ 2JMWA 3BG3A 4IEJA 3BG5A 3QPSA 3KZ9A 1H88C 2DA2A 1UG2A 3BT9A 2O7TA 4NN1A 2ECBA 2MSYA 4A3IJ 3B81A 1ETWA 3ZOBA 5E3MA 3LNQA 2WV1A 5EDNA 4CGRA 2X48A 3I4NJ 3PASA 4A3JJ 2DG8A 1GVDA 2OF7A 2DA4A 3A02A 2NVQJ 4MFEA 3CJDA 3FK6A 4FE4A 4HKUA 4Y52J 2R7ZJ 4AC6A 3VOKA 5IYBJ 3M4OJ 3G1OA 3NI7A 3VOXA 3GBGA 3VUQA 4J19A 3ZQLA 5C4JJ 3HIMA 2JN6A 3GTLJ 2AO9A 4A93J 1MH3A 2ECCA 1SFOJ 3IV5A 2HKUA 3BHQA 3EUPA 2MG4A 4YZEA 3JRGA 3BQYA 1TWHJ 5HSZA 3QPLA 4DZJA 2H1KA 3BJBA 2WAQN 3BG9A 1W0UA 3WHCA 2M2EA 2JJ7A 1ZR4A 5HAWA 1UMQA 1JTYA 3HEFA 1ETYA 3GTPJ 1Y1VJ 2EH3A 5DTDA 4GCKA 4W1UA 1LFUP 2NX4A 5GP9A 3MNLA 4JX5A 1JKRC 1QVUA 4IHYA 3G7RA 3HOYJ 4I76A 3JRHA 1ETVA 2FD5A 3RH2A 4A3EJ 2TRTA 4FTHA 5EEAA 4M3GA 5DS9A 1IC8A 4A3GJ 1IRZA 3JRDA 4XK4A 3SDGA 2HOSA 4NDLA 1QVTA 4IHXA 2CQXA 2LY9A 5J1RA 2OI8A 2ID6A 2VPRA 2ZOYA 5FKLA 5JLXA 2X9DA 3JRBA 5AQCA 5IPAA 1FTZA 5EZHA 4UDSA 1ZKGA 3RD3A
chains in the Genus database with same CATH superfamily
5D6EA 4LITA 3CZ6A 2V9KA 1D5YA 3M3YJ 3DKXA 1ZN2A 4BDZA 4CH7A 3FF5A 3PO2J 3S3NA 2DPUA 5J47A 1NK3P 3S1RJ 4K2EA 5CXIA 5DD4A 5D5WB 1J2XA 2VOOA 1J5YA 3D1NI 3AQSA 3IHUA 1WWXA 2L9NA 3MKLA 1R58A 2D45A 3BLYA 4ZYDA 3TOBA 3HM5A 2DK8A 4M3FA 1K6OA 2VQHA 1SMTA 4ME9A 3L00A 4W97A 4H4KC 2M7AA 3E7LA 5GAGJ 2QKMB 4BHBA 4CZCA 5K7HA 1C0WA 5BOXA 2OQRA 3BJ6A 3RKWA 3FXOA 4F55A 2HYFA 4BEHB 1BJAA 4UV8A 3J7ZI 2Q24A 3T6NA 3ROUA 1T56A 4L9VA 4BE2A 4BNCA 4UHTA 3G3ZA 3U21A 3TO6A 3DBRB 3ERED 3HTAA 1SEUA 1F36A 3FMQA 1D8KA 1V55H 2F4MB 1X1CA 1IGNA 4LG0B 1MIJA 3A0HC 1BM9A 1HC8A 4L18B 3O8GA 2FSWA 3E3VA 1ZGAA 2A2FX 2MW8A 1U3EM 2KISA 2V4JC 5AIPA 1T0FC 4RDUA 2F07A 1XCBA 1UG0A 2ZO4A 2N8GA 3VYTB 5CLSA 3FXUA 3OYDA 3WTXC 1HBXG 2F5CA 2XHKA 2HXIA 4MNUA 5EEGA 1QZZA 2CH0A 2G7HA 1KQ0A 1UJ8A 2HGCA 2E5ZA 4L9TA 5J6XA 1ZRCA 4LIVA 4RLQA 1Z7LA 3FHNA 1UHWA 1D1AA 4AYBA 5HS9A 3HUGA 1L3LA 3W6VA 2BY0A 2WGBA 1D0ZA 3HKZA 1N25A 4E6KG 3DV8A 2Q1ZB 1B8IA 3PNTA 2CQQA 3I55I 1R5ID 1LE8A 1UELB 3LOCA 3ZMDA 3K2AA 2DW4A 1WJDA 1LKXA 3HRMA 3NS4A 3AG1H 1WGXA 2EZIA 2XAJA 1CF7A 2L7ZA 4ZZDA 4JQFA 2NS8A 1J59A 4BY1J 2RQQA 1IDZA 1Z91A 2XGDA 2KFDA 2EINH 4BQQA 2EIJH 3BC8A 3ECOA 1YLFA 3P7NA 4C2UA 2NS7A 2O5RA 3KP4A 3CJQB 3EQLF 3ISPA 1LEBA 1FNNA 1TNTA 1Z77A 2LF7A 1U5TB 2WAEA 4BXFA 2D1VA 5FKKA 2E71A 2RREA 1MSEC 2DFFA 4WXDA 4B3AA 2ESHA 4J00A 1I3AA 2QQ8A 3FKIJ 1ZELA 3QU3A 5DCMA 1D1CA 2MC3A 3TO9A 1VNDA 3S1NJ 3FMRA 3IKVA 3HTUA 1MMSA 3LAJA 2DK5A 4C3HJ 3JRFA 2QOPA 4X0GA 1G3WA 1HOMA 4WCGA 4R79A 2VKDA 3H9GA 3WTVC 2H09A 3CCLI 2H6BA 3DLAA 1W36C 4II3A 5BPIA 3W2AA 2BXYA 2HOTA 3L1PA 3OYBA 3Q3SA 5BNGA 3FKJA 4LOCA 5ILVA 4C2MJ 4RAGA 1XC5A 3GW2A 4QLCU 2DQRA 5E18F 2OERA 1WJFA 1MW7A 2JTVA 2IBDA 2HXOA 3G73A 3OWTA 4YFNF 3LSJA 2ADUA 2DA1A 4UVCA 4XORA 3QBMA 3AG4H 2COBA 4IXAA 4XOTA 5HDNA 1QZYA 3PFIA 3OIPA 1EH8A 2HVSA 3GWZA 1G59A 4XNFA 3DTIA 4IHVA 1MBFA 5JVGF 2KKOA 2H1LA 2L7KA 5CQGA 4IOAF 4EGZA 3NNRA 2K9SA 3J7AY 2VQGA 2CYYA 4GFLA 2OCCH 4XLNF 2IU5A 1P7IA 1VQOI 1X4OA 4OIRF 1BR2A 2DOAA 2AS5F 2G3BA 1SANA 2R92J 3ZMZA 4AUXA 4BBRJ 2KT0A 2ISYA 5CVVA 4UV9A 4P9UA 2A69F 4BQNA 1R5GA 1JHFA 1LUJB 2HEOA 4XOPA 4LG0A 3VVZA 3LSKA 4PSXA 4ZC3A 1UAAA 2LKSA 2W48A 3DTEA 4XSXF 1VQ8I 2M8EA 3F9KA 3M8EA 1SD4A 1G3TA 3JAMK 3V8LA 3KKDA 2YU9J 5A2QZ 3LSIA 2W82A 1K6YA 2FRHA 2LC2A 3T8RA 4BJ5C 2DA7A 4LGWA 3MVPA 1TQIA 3FXMA 4A6DA 1B4AA 2HPIA 4CCLA 3K8PC 2VLAA 3NXCA 2RGVA 3EYYA 5HLHA 2B7EA 2R5YB 2ZMEB 1ON1A 1WHUA 5FKOA 3SHFA 1IG7A 1QBJA 3PFYA 4FE7A 5FLXZ 1HQCA 2RC4A 1ORKA 1Y0UA 2OBPA 3S1QJ 3BNIA 1QHGA 2XAFA 1WVRA 3FXQA 2P81A 4UXNA 3RYPA 1IN5A 3CCYA 1P7JA 4BEHA 1FZPB 1S5LC 2MH9A 3JRAA 4HAMA 3HTJA 2R7OA 4GCTA 4DYCA 1LB2A 4MK6A 3M7GA 3AQTA 4XLAA 5EFYA 1NG7A 5FLVA 3PIOF 5D1RA 1ZGJA 4XRSG 2NRAC 1J75A 2QUFA 3CJNA 3A0BC 2GAUA 3IRRA 1ETXA 2FMYA 4ABZA 4OIPF 3AL0C 1MMGA 1B9NA 1LVAA 1BBYA 4KISA 4KT5C 1P92A 4F93B 1SFEA 5EGOB 1O7FA 5CXGA 2E60A 1Z3XA 2Z33A 3VTIA 2M30A 2OZUA 1WI9A 4AIDA 1JUSA 4Q47A 3IUVA 1YYVA 3C2HA 3OYLA 2OCEA 5K7FA 1CGPA 2W7NA 4KIGA 2YU3A 2Z2SB 3P9CA 2YR2A 3VIBA 2HDWA 2QSFX 4C2MA 5FMPA 5HNFA 3ML6A 2K3PA 2M0MA 2NNYA 2XPVA 1MDMB 2JSPA 2E2JJ 4EGYA 4BAYA 1O3QA 1JI8A 4RBOA 1U78A 1ZLJA 1X2MA 1SVLA 4JX6A 1HKQA 2JRMA 5JLWA 3M07A 3PQKA 4RM2A 3HSEA 1ZG5A 2ZJRF 3R6SA 2VXDA 1GV5A 3BZKA 2JA2A 3N05A 4GXOA 1XX5A 1NHAA 3B73A 3HPHA 1K7AA 1TWGJ 1GXQA 2NVXJ 3A4CA 3KP5A 4I0BA 4C2TA 1WCMJ 1PJRA 1OCTC 2UXHA 3BJOA 1G3YA 1QO0D 3RKQA 1CQTA 2B9SA 3OSFA 3HE0A 3KEOA 2JRTA 3DKWA 3L2RA 2R5ZB 1ZRDA 2ZXHA 2IA2A 2BXZA 1Z3YA 3HOWJ 2UXPA 3ULQB 2P7CB 3K10A 3CUQB 1OYYA 1R4NB 1TWFJ 2E7WA 1U5TA 4BH9A 5CW8A 1MKMA 3MWMA 1J7KA 1RKTA 1B6AA 2VBWA 2CV2A 4KMUX 1U8BA 5CYVA 5LHGA 2PG4A 1DPUA 2DODA 2EA2A 4B47A 2P6SA 2MC4A 4HEA2 1EH6A 1HDDC 3OS2A 1FP1D 4FX4A 2HWVA 1JJ6C 3CC7I 3H36A 3TW7A 1E3PA 1T08B 4AYBN 5KVRA 5ICGA 1PUEE 5M3FJ 1RIOH 4R8HA 3DEWA 3HKZN 2L02A 2CQNA 5F1RA 5GTHC 4ENJA 2XVCA 4KDPA 4UNOA 3H92A 3I71A 3F22A 1F5TA 5GTIC 1EA3A 5IP9J 2VE9A 4RB0A 3ZQ7A 1I50J 2X6XA 2GQQA 4DQ2A 5HODA 2ELHA 3I5UA 4LIUA 1KZHA 1ON2A 2DMNA 1V3FA 2W1OA 2R7FA 1F1ZA 2L4AA 2V7FA 2XF5A 5IP7J 1WKMA 2XGEA 4Y3OA 2MYSA 1I27A 5FRNA 3HC7A 4LLNA 1UI5A 1FX7A 4GFKA 2E1MC 2ZBKA 3VODA 2DA6A 4EQQA 2QGUA 3J81K 5FLMJ 3HGGA 2CW8A 1YW9A 2VJ4A 3BG3A 1IV8A 4O6JA 5E79C 4M72A 1V4RA 5IT9Z 4NN1A 5L3BA 2ETHA 5TJJA 3TL4X 4BHPA 4NC8A 1BIBA 3ZOBA 4DBQA 5E3MA 1VQKI 3GFMA 2XKPA 3SZGA 5HOOA 4NUBA 3GZ6A 1GVDA 3F3XA 3SQNA 1A36A 1SD7A 2NVQJ 1W5SA 2QQBA 1FBQA 2CUJA 4XN0A 2HDCA 4Y52J 4AC6A 1P6RA 3FXKA 1A04A 2KIUA 2XAHA 2H8WA 3VOXA 4J19A 3ZQLA 5HS7A 2CMPA 3V7CA 4U7DA 3CMAI 1MH3A 2HKXA 3ECHA 1Z7UA 4XLCA 3FWEA 3IV5A 3MKYB 2HKUA 2CV0A 3EUPA 3BWGA 4YZEA 1T38A 3JRGA 3DXJF 1DGRM 2ZMEA 3ZMUA 2DYSH 4ENKA 4DZJA 4HSRA 4I99C 3K4MA 3BG9A 1XB4A 1SC7A 1W0UA 1ONVA 2DTRA 1ZR4A 5HAWA 3FZVA 2BHYA 2EH3A 4GCKA 2NX4A 3MNLA 4JX5A 2K27A 1JHHA 2B0LA 1RRJA 1JKRC 4EJTA 3HOYJ 4I76A 2FD5A 5KNLA 1T6SA 4A3EJ 1IRZA 4M3GA 5DS9A 3I59B 2EWNA 4YRVA 3SDGA 3OYKA 3I58A 3CCMI 4M9ZA 5E1ZB 2OI8A 3GO5A 4IPAA 5L3DA 2LBFB 4NNJA 5IPAA 3I3LA 3MZ8A 2IS1A 5GAEJ 4RB3C 1QGPA 2OA4A 3EYIA 1FEXA 1R6RA 1KQ9A 2ZNZA 5M5YJ 2KQRA 4IHSA 2YVXA 5EGOA 2QQ9A 4KUMA 3J80Z 2FA5A 2MFZA 1K4TA 1Z67A 3GLXA 4II2A 1YQAA 2HQAA 4RB2C 4IQJA 4GO1A 2HQRA 2CGPA 1MGTA 2K9LA 1GV2A 3BPXA 4BACA 2HDDA 1FOWA 2DLLA 2EIMH 4ZTFA 4E4HA 4QSHA 4DJAA 1ZREA 4ZDOA 2M87A 3VOEA 3QPHA 4ZTJA 1MDMA 3HUGB 2L0KA 1MJBA 4I98B 3SFIA 4BHCA 5CVRA 4PJMA 3KE2A 1SFUA 4BQOA 3FX3A 3CJRB 4UVAA 1OCPA 2RNJA 2E19A 4FISA 1JT0A 1CF7B 2TCTA 1BC8C 2Z9OA 3K70D 1UCRA 4DOZA 4IOCF 2O8KA 2ELKA 4ASNA 3VPRA 2M5WA 2PN6A 4L5EA 2R5ZA 3CC4I 2HFHA 4GCVA 4BE1A 3PUFA 3TBIA 5LD2C 4KFCA 3EETA 5FGLA 3EGQA 3DPLC 2IP2A 3CUQA 3L2WA 4KMFA 3CCSI 1FPQA 4PFOA 3TEDA 2M3AA 3DLLF 4D7MA 5LHHA 2V26A 1KONA 1AOYA 3AAFA 4IHWA 3ZQFA 1LDDA 2F6CA 4I01A 3KEYA 4LK0F 3COAC 3QOPA 1MH4A 2HTJA 4CCNA 4M6XA 3WGIA 2IT0A 2VUMJ 2W4SA 3W3CA 3W6JB 5LGNA 3L7WA 1ZG3A 5EEHA 2YVHA 2JA6J 1IUFA 1FIAA 1RKWA 3BZCA 3P5JA 4AC0A 3BCAA 3K7AJ 3QP6A 3KP7A 5GPCA 4FQGA 1IN6A 4BKXA 1Z1DA 1SAUA 4UB6C 2G7LA 2F5DA 4A3MJ 1KYZA 3U1KA 1AWCA 1LFBA 1XMAA 2ZOZA 3S16J 1AKHB 2UWMA 2DFHA 2Y2ZA 3OY9A 3FM5A 3S5RA 3KCCA 2DT5A 1S7OA 1YTYA 1YRNA 3WTUC 2DPDA 3S2HJ 3RI4A 3WHBA 3WE3A 1ZRFA 1ZTRA 2QSHX 4ZDPA 1ODDA 3J7AO 2HU9A 3IC7A 3VP5A 3MKWB 1YIOA 1ETQA 3HG9A 1SD5A 3GZ5A 4MHGA 1F9NA 1YJNI 3QRFF 4EVIA 3LJLA 3HTIA 1ENHA 1BR4A 2OTLI 2R4GA 2Y9ZA 3HTHA 3ABLH 3KP6A 4OD5A 1VQPI 2Y75A 3GFJA 5ERIA 4B8XA 3FBIB 4XL9A 2L4MA 3MN2A 2BE5F 5HVQC 1YE9A 2FNAA 3ZQQA 1MZBA 3ASNH 4PGHA 1FOXA 1RNLA 4MIMA 3CD6I 1J9IA 4B4CA 3H1CA 1TWCJ 4CUGA 3A1YA 3IWZA 4G6QA 5K5QA 3S17J 3KETA 1HA8A 2VBZA 4ZH4F 1OR7C 4EEFG 5IYCJ 2EB7A 3HYIA 3CF2A 3H3UA 4HF0A 4M6YA 3JTGA 3BQZA 2PFBA 3F21A 5F27A 4HNVA 2FBQA 4L5IA 4CCJA 1LPQA 3PJRA 1T33A 2K9MA 2VJJA 1Y1WJ 1YJWI 1K78B 1GXPA 3WU2C 3PIPF 1YO5C 1LDJA 2G7UA 2GXBA 4HW0A 3RDIA 3GFLA 1U9NA 4HNUA 4XICA 1XDSA 3VVYA 2FU4A 1FC3A 2XAGA 2DYRH 1IRXA 4HZFA 1JGGA 1IF1A 2E7XA 3BP8A 3WE2A 5D5VB 2Y0SN 3R61A 4PZJA 2VODA 4P55A 3CCVI 5ED4A 4EJVA 3M8FA 2O0YA 4E7LA 4KIBA 1O7LA 1ZLKA 3O8HA 3A03A 2KP6A 3ZP5A 1IRFA 3AL0B 3VEPA 2R7TA 3I59A 4BXXJ 4AVZA 4F52A 2HPMA 5E3OA 4B09A 1MBKA 2GOMA 1T0FA 1Q1HA 3KYLA 1QPMA 2VJIA 1MNDA 3RQ4A 2LBFA 4HRIA 2GIVA 4I0AA 1YW7A 4PXIA 4G12A 1IXCA 1DPRA 3LSPA 1RETA 3LL7A 4B3XA 4C3JJ 4QIWN 4RAZA 2VOPA 1TQPA 4XM3A 3RIRA 3G6EI 5LEKA 2IVMA 2L5QA 2P6TA 4AM3A 1JTXA 4V2FA 1WH5A 2ZFUA 3G1LA 2HZTA 1FMWA 2XRNA 4EATA 1UZCA 1Q1VA 2PBIA 1I39A 3HXLA 2EILH 1HXDA 2F2EA 4QWQA 2VI6A 1DU6A 3BTJA 3LWFA 5IY5H 3LA7A 4LMYA 3GTJJ 1TQMA 1R7JA 2E36A 1N77A 1E3OC 2OC6A 3H5RA 2YVEA 3M9AA 1ZQ3P 3F6OA 1WJAA 3FM3A 5ICCA 4KICA 1RESA 3ZQGA 1EF4A 1S6LA 2KRFA 3IWFA 3BCGA 2QWTA 3ASOH 3I4PA 4ITVA 4DBRA 2JA8J 1IN7A 2LVSA 5CVJA 1VQ9I 2Y30A 3JCUC 3S93A 4A3KJ 4Y4RA 3ZCOA 4OMYA 4IF4A 3MAJA 3HSFA 4E7HA 1SFKA 1S8NA 2VKEA 1QNTA 3E6DA 2M4GA 4U87A 3WTTC 3OOPA 1QU3A 3A2KA 2YPRA 4RA2A 4X6AJ 4RAFA 2XPUA 2RHAA 1R1TA 2FOWA 2HYJA 2CQKA 2V6CA 3BTLA 4A5NA 1UFMA 3NARA 5FFZA 3SFZA 4RM3A 5E3LA 4CXFA 1O3RA 2H8RA 1E3HA 1BC7C 2A6TA 2FX0A 1YX3A 3MEXA 4MQVA 5F1JA 2YUSA 2QZ8A 2J5PA 3NRGA 4BE0A 3EUAA 4HF1A 3NQOA 4RLFA 5HLGA 1BI2A 2VJ5A 3GF2A 4KA4A 2P5KA 4D1QA 2MD5A 1MSFC 2M9HA 2O8XA 4HPQA 2MD0A 1KQ8A 5E17F 3IH3A 5D8LB 2WADA 1AKHA 3DWLE 3VVXA 3NRVA 4EMSA 1MNMC 3TGNA 3L9FA 2NP5A 1H9TA 2E1MB 3I54A 1YJ9I 1F43A 4L0ZB 1HDPA 3HZJA 2KZGA 4AF5A 5KCMA 2P8TA 5DUKA 4HYEA 3B6CA 4D5FA 3S32A 4RGUA 3GZIA 1MMDA 2HOAA 3H0GJ 2BGCA 4ZZLA 5EF6A 2LNBA 3GXOA 3CESA 3OYCA 3BR1A 3K4KA 3TW6A 3HOXJ 3S2DJ 4MGRA 4GDFA 3FRQA 2IS4A 4XQFA 4OWRB 2BYVE 4JP0A 4OAYA 1A5JA 1IXRC 2DQLA 4Y17A 2ICWG 2IGMA 2GM4A 1WJBA 2QQAA 1X58A 3CCRI 1RR7A 2XRLA 4M6VA 3OYEA 5F0CA 2VASA 2KIMA 3Q0WA 2ZFWA 2PZ9A 1BA5A 3JAMZ 5F0HA 2Z3YA 3DPUA 2HKOA 2VONA 4L62A 2WC2A 2IS2A 4E7ZA 3GYHX 4XIDA 1VTNC 4YFKF 4MXMA 1LFPA 3H9QA 2RN7A 2RDPA 3OYAA 3L2QA 4ESBA 1JT6A 1FOYA 2HS5A 5DAJA 2DMQA 1FBSA 2VL8A 2OV7A 1PYVA 3OOUA 2CUZA 5LBQA 1FYMA 2NYXA 2UXIA 3ZN0A 1K78A 2R7UA 4X1EA 2XSJC 2PLYA 4OOIA 3BTIA 1ETKA 5CJ9A 2R7RA 3ANGA 3RZDJ 1MBHA 4DIQA 2RQPA 2HI3A 2KDOA 2HVQA 1FP2A 1TNSA 3FHZA 2LRDA 4GYIA 2JA5J 2L2OA 1X3UA 3JTHA 2IGOA 2X1DA 3GUDA 2IAIA 3BOQA 4FETA 2VIXA 1IDYA 3PSFA 4LJZF 1MBEA 4MEYF 2JMWA 3BG5A 1P9QC 4ANJA 3KZ9A 1H88C 3BT9A 4O3MA 3QAHA 2ECBA 2LMDA 2MSYA 4A3IJ 2LH9A 3CDHA 3VYUB 1JE8A 3Q9SA 4CGRA 2DXIA 3I4NJ 3PASA 2ZKZA 3IRQA 2K86A 2CFOA 3EUKL 2DG8A 2DA4A 4U88A 1REPC 4MFEA 4I2OA 1MJ9A 4FE4A 2GA2A 1GLNA 2FF4A 3DKYA 4PSWA 5BMZA 3HHHA 4HKUA 1XGSA 3ONQA 3VOKA 2RVCA 1WFXA 1DGWY 2Q2EB 4ESFA 3V8KA 4ENMA 3ZMVA 1B9MA 3HIMA 2JN6A 4DVYP 3GTLJ 2VC0A 2AO9A 4A93J 2OZ6A 2JUCA 5KAIC 4L9NA 2ECCA 4CICA 1SFOJ 2MG4A 2IXSA 3GZNB 4MEXF 2IA0A 3BQYA 4WIBA 5HSZA 3DBHB 3CCQI 2XV4S 2M2EA 3HEFA 2GIZA 2DCEA 1O3SA 4EJWA 5JR3A 2ZNYA 4TV7A 3W6KB 4W1UA 1DDNA 3EUHC 3E0JB 3CCJI 1TZLA 3BCBA 1KU3A 2QBYB 3G7RA 4G7OF 2AXTC 1TL8A 2TRTA 4FTHA 5FB2A 3V7RA 2HOSA 4NDLA 1X19A 1A35A 2ID6A 2ZOYA 2NVUB 5L3EA 5D5XB 3OL4A 3IL2A 3CMMA 1W36D 2XAUA 5HLIA 3S8PA 1VI0A 3H9JA 2H6CA 3RJPA 1OPCA 1HW2A 2DFIA 4I09A 1FBUA 4OIOF 1BJZA 1I5ZA 1USTA 1XMXA 5IP6A 3JSOA 4A12A 1APLC 3GX4X 1LDKB 2CUEA 4I02A 4A2UA 3A01B 3E6CC 1X1BA 2V1XA 5F08A 1YG2A 2W25A 2GUHA 4RAYA 3H35A 3BZ6A 2G9WA 3IH2A 1K79A 3S1MJ 2VKHA 4JX4A 4RMNA 1DQUA 4G7HF 2DT7B 5HLTA 1TW2A 1IN4A 2IJLA 5BPDA 5IYDJ 3MQ0A 3CQZJ 4EJUA 3GLLA 4N9IA 4BYYA 1MMNA 1GUUA 4BY7J 2UUZA 5JFRA 2KJCA 1OCZH 1J0RA 2OU2A 3J7YJ 5FFXA 1BI3A 4XRSA 3CTAA 1Y39A 3X2QH 1R22A 4BDYA 3HOZJ 3E6MA 3QODA 3LFKA 3ZMTA 2VN2A 1YRNB 3UNGC 4IJAA 5FRMA 4I7HA 4XBFA 1N75A 5TRDA 4E7JA 2HVRA 3OSGA 1U2WA 2BHZA 2KMUA 2QENA 1NTCA 3BY6A 2GLOA 1POGA 5F04A 3QWLA 4QPQA 3BRUA 2QKOA 1V5GA 2LP0A 5ICFA 6PAXA 1EH7A 2DMPA 1D0XA 2A6EF 4WXHA 1RUNA 4HQEA 5LFAA 2Y69H 2F4IA 2K3FA 3GTOJ 3E5UA 4KWAA 1ZK8A 2IA1A 1IJWC 2JZYA 2GOXB 2LLKA 3EDPA 1BI1A 4FX0A 5J1YA 2W53A 1R71A 4HNTA 5K1YA 2ME6A 1ITYA 3CJTB 1IV6A 2ZCMA 3KYDB 2AHQA 2UXNA 5C4YA 1B72B 5FROA 2F5EA 3CRJA 4ICHA 3CJDA 1WQ2A 1A6IA 2G7SA 4MTDA 3SJMA 5FHPA 3L2UA 5JHFA 1KU7A 2FMLA 3O3KA 1YX5A 1WSUA 3WU1B 1H9GA 2IRFG 2UXXA 2V1UA 3SZTA 4IRIA 2MH2A 3KP3A 2DOFA 4WX9A 2K85A 1B59A 1XPXA 3CDIA 1WJEA 1NG6A 5M5XJ 3HL2A 3OYIA 1D1BA 2LY1A 3ZQHA 1H8AC 2DMTA 4ACIA 4GCLA 5ILSA 1W7PA 2YSRA 3VDXA 3JR9A 3CC2I 3QPTA 2Y31A 2JT1A 3DBLB 5FJ8J 4ZYHA 3OYJA 2Y48A 3RSNA 2GXGA 2V57A 2CUFA 4U9NA 2DN0A 4JNNA 2LOOA 2OJED 4IRGA 3AG3H 4U0YA 3GTMJ 4L9JA 2VE8A 4D7NA 4P9FA 2IGNA 2GBYA 4OIQF 1XGOA 1D0YA 5F6FA 3ZQCA 2JWTA 2GFNA 2E1OA 2ZB9A 3C7JA 1XTAA 2LYCA 1BL0A 4BQAA 3FBNB 3R0JA 3N97A 4B43A 1R5HA 4XLPF 2X1EA 1HKTA 3C18A 2QLZA 4HDUA 1ZARA 1WZ2A 3B02A 1XSVA 2YX7A 3ZXSA 5B5EC 1IAWA 1W0TA 3RZOJ 2NAZA 2K40A 3IUOA 4D5CA 1IW7F 2Q2EA 1YI2I 1E17A 4NELA 2O03A 4HF2A 1BR1A 2JPCA 3HSRA 3I56I 2XGCA 1QHHD 3C2BA 1S29A 2MLGA 3D5LA 3MFKA 2VXZA 2RAEA 4IKFA 2XB0X 2LTPA 2EZKA 1I6XA 4Y7NJ 4ZYGA 1X1PA 1ZAOA 5H6QA 2OPTA 2A61A 1PDNC 3O6BB 1VQ5I 2DU9A 4RGXA 5LGTA 2WAQA 1Z21A 1I1GA 4YIRX 2HYTA 2GXAA 5HDGA 4MO7A 2V1DA 1B1BA 1XD7A 2Z5UA 4NC6A 2B63J 1U6GA 3JW4A 5H6RA 2M7BA 2X1CA 2QBYA 2HYGD 4WXCA 4JYKA 4HSTA 3W2VA 3RKXA 2CW7A 1Z9CA 4Z2YA 1XDUA 2F5FA 4PCQA 4U7BA 1VQMI 1JJ8C 5AONA 1P2FA 1Z05A 2CO5A 4V2GA 4WWCA 5FO5A 5JHUA 2GWRA 3F0CA 1P4XA 3K2ZA 4LFUA 2R7QA 4M3EA 2P5LC 3QYFA 2DA5A 1AA7A 4HA8A 5D8KB 2WUIA 4ON0A 3FISA 1X3WB 3KEQA 1Y8RB 3UKGA 2X0LA 4NHJA 2CWEA 2LKPA 2ZJQF 4C30A 3M1EA 5EJCA 2KRCA 4N4OB 3ELKA 5TGTA 3A01A 5CKTA 2QKLB 2QWWA 1EKEA 2BBYA 3VW1A 1VF9A 1FMVA 2BY2A 4RS8A 2EPFA 2EZHA 4OU0A 1S7EA 3O60A 2QVOA 2JUGA 2I8DA 1V5EA 1QPIA 3SDBA 4M9SA 4P5OA 2FXAA 3MKZA 2UZKA 3RQIA 2WB1A 1OCRH 3QYEA 3E1SA 4XLEA 2FJ1A 2NVTJ 3HPGA 2BW3B 3B6AA 2K7LA 5F0FA 2M1BA 2KZVA 1SVMA 1OYWA 1T95A 3EPZA 1R9TJ 2XB5A 3VYSB 2HQNA 4AVPA 4NC7A 2BY1A 5IOZA 2EFWA 1H89C 2DT6A 2E1CA 1JGSA 3KZIC 3K4CA 4Y15A 5E3NA 3QKXA 1LVKA 1S7AA 2L54A 5CVUA 3CCUI 1Y8QB 2G7GA 2O3FA 1WI3A 2RNGA 1O3TA 1OKRA 2FUG2 3ZMSA 2FBHA 2FQ4A 2ZXIA 2LD5A 1BW6A 1X4PA 3CLQA 3HGYA 4N9HA 5LLQA 4IO9F 1KYWA 1RR8C 2ZCWA 2Z99A 1OCOH 2NS0A 4B44A 2LKXA 4C3IJ 3REOA 3QOEA 1W5TA 1XSDA 2IGKA 2PEXA 2UXOA 2VT3A 4DNCA 3K1NA 5D18A 1R4MB 1K4SA 1UI6A 1S3JA 2XROA 1UHSA 2FBKA 2VBXA 5LRSA 3VYRB 3U9GA 1FY7A 1OLTA 1XN7A 3FK7A 1VFCA 1OR7A 1B72A 2C6YA 3LA2A 3TOAA 1L0OC 3I64A 4D9JA 4DYQA 1W7PD 1OMIA 4ZYAA 3LMMA 3CLOA 1SAXA 4IRVA 3ZGKA 1DP7P 2D1HA 3SEQA 2QM3A 3RKYA 3WGGA 2E2IJ 4A3BJ 5FKNA 3S2WA 1K61A 4A3DJ 4AIHA 2JK3A 1I3QJ 2XSDC 2O9LA 5DDGA 2CRGA 2MLKA 3L09A 4XN3A 4DYRA 4NQWB 4A3LJ 3Q9VA 2GZWA 3PO3J 2NP3A 4PFPA 1OCCH 2A5YB 3JSJA 1SD6A 3K4BA 2K9QA 2HZDA 3OIQA 1OFCX 4A0ZA 3L2VA 5EZGA 2BZTA 3OYNA 5J4YA 4FHTA 4DZPA 1PP8F 5DD8A 1D8JA 5B1BH 4BUPA 4PGGA 5HS8A 3P9KA 2V9PA 3NEUA 5D4RA 1FYKA 1MBJA 1XGMA 3DTKA 3FDYA 3CP8A 4UUSB 2ZY9A 2KJBA 4AU7A 2R7SA 3DPJA 2EK5A 3BG6A 1LNWA 3OYFA 1JKOC 3LSMA 2M34A 3I4MJ 1E0EA 1W1WE 2L9RA 4DGWB 3ZPLA 5EG0B 2X6OA 5DUIA 5LEJA 4EV0A 3ABUA 1IO2A 5J4VA 5KHDA 2K02A 2L7FP 2H94A 1WJ5A 4JKZA 2F4OB 4XRMA 2XAQA 2A6HF 2XASA 2EFPA 1GT0C 4HDVA 3TQNA 2EQRA 1D5VA 2DMUA 5TISC 3ABMH 2KIQA 3WU0A 1Y56A 3OIOA 2ZC2A 3NPIA 3V42A 1R23A 5L3FA 1EV7A 2LR8A 2EV5A 1J09A 3GMEA 3KFWX 4G6DA 3TDUC 3V7SA 4F3QA 2D6YA 3RYRA 2W85A 2LY2A 3BJAA 3HOVJ 3K0LA 3LFUA 2K4JA 5KK1A 5K58A 3BR0A 4IL6C 4LLGF 2JQ7A 3RPQA 3F6VA 2Z16A 4A6EA 1KGSA 2E34A 3KKCA 3G1MA 1G2HA 2PJRB 1KA8A 3K69A 3FXRA 3CMEI 3GTQJ 3PPBA 3HB9A 3L2CA 2CQ7A 3HRTA 2DFEA 1P4WA 1XGNA 2CS3A 4IEJA 3CCEI 4PDKA 2DA2A 2FOKA 2VC1A 3MZYA 2VQLA 1FYLA 4P96A 1RUOA 1ZHFA 3GVAA 3OV8A 1T2KA 5FD6A 2COMA 3LNQA 5B3SH 5EDNA 4G94A 2VQCA 2X48A 1U0JA 4U9LA 4N0BA 1TBXA 4A3JJ 1FWZA 3QYBA 3RD3A 5H2FC 3A02A 1D3YA 2WAFA 1STZA 3IKTA 2I5UA 3FK6A 2WY8Q 3E5QA 3HHGA 1Z6RA 4XLFA 2P0WA 5IYBJ 3M4OJ 3G1OA 1TTYA 3D5SC 1S72I 2DI3A 2ZJ2A 4G9YA 4H0EA 1VQ4I 5HNHA 1W5CC 3T8TA 1UB9A 1SVOA 3PL8A 1V5FA 5B66C 3BHQA 3MD2A 3PQJA 3OMYA 2ISZA 3KP2A 4A5MA 3HJEA 4CCOA 1PP7U 4ZJZA 3F72A 1TWHJ 4UVBA 3QPLA 3HOTA 2H1KA 2WAQN 4L5JA 4YFXF 1QZEA 2JJ7A 3LSTA 1UMQA 5CQEA 1IUYA 2F48A 4JK1X 2R7DA 2BW3A 4GYGA 3R0AA 4HV6A 1QVUA 2B3WA 5LRRA 2OUMA 5H20A 4HX8A 1DP3A 4KNYA 4A3GJ 1BI0A 3JRDA 2R3SA 4XRFA 1QVTA 2UV1A 3FXLA 4IHXA 2LY9A 3JSPA 3P9IA 4CCMA 2VPRA 2V9VA 3K9TA 5FKLA 2X9DA 4V19K 4EM2A 1ZH5A 1ZKGA 3I9V2 3HOUJ 2FNPA 3VB2A 3DF8A 3BR6A 3TMOA 1HSTA 1IN8A 1R36A 5E1WA 2V6EA 3ON2A 4P1WA 3JREA 4UY8I 3H3VK 4BL0B 1BOAA 2DG7A 4ETSA 2HOEA 3JRCA 4GFBA 3WTWC 3LHQA 2EV6A 1A6QA 4G7ZF 4YIIA 2A5WA 1HSJA 5LHIA 4JOMA 3TO7A 3MCZA 3S15J 1X2NA 1YS6A 2TDXA 2WB1N 3CO7C 2YX4A 3LQQA 1KU2A 2LDUA 3TKYA 4LG3A 2K4BA 2PQ8A 4XR6A 3GEUA 3ANPA 2M8GX 3BR5A 2BEOA 3ZN1A 1ZYRF 4PJNA 3BR2A 3E5XA 4A3FJ 2ACJA 2FBIA 1BOBA 2PX9A 2MA3A 2JVHA 4CSWA 3W2WA 4IRHA 1TLHB 4NQWA 5D19A 3Q0UA 2EFQA 1GVJA 3ABKH 4A69C 4ENNA 1DU0A 3OS0A 5CVIA 1ACIA 4NB5A 4QPOA 3ON4A 1W7PB 1WJCA 4RGSA 1EJ9A 2PBXA 1RPWA 1I6HJ 1G4DA 3HIFA 3S14J 3OL3A 2JA7J 3H5AA 4Q4ZF 4LB6B 2NVYJ 1MMAA 2L9SA 3NWTA 4CDGA 2DBBA 3F1BA 3WTYC 2HR3A 2L01A 2L9VA 3HDDA 3Q0VA 4UUSA 2EA4A 3DPTA 1XCVA 5FD5A 2ZJPF 1AHDP 1PUFB 1XSXA 2NOJB 1OQYA 3C1DA 4E7SA 2XPWA 3HOSA 4ZDLA 3V8JA 1SGMA 1FSHA 4EM0B 2E2HJ 5EG0A 3WG9A 3KX2A 4CHUA 4MTEA 1IRGA 2CG4A 1FTTA 3O2PE 4Z6YA 5M3MJ 2F5VA 4CZZA 3CF5F 5FKMA 5A2QK 1UHMA 3JRIA 1YITI 2PMZA 1TP4A 2K5CA 1AU7A 2VB6A 2DTZA 2KLOA 1YS7A 4XKBA 4YELA 1TWAJ 5H9TA 3CMYA 3LA3A 3QU6A 3KZZA 5BQTA 3OYMA 1LJ9A 3HTSB 4IVNA 3TDZC 4PJ0C 3SEZA 2LREA 3GCMA 5FLXK 2J5OA 3C3WA 5CPRB 4E70A 3LSGA 3F8FA 3EUHA 2ZSHB 4A0XA 3F8CA 2WBMA 5BS6A 1SFXA 2LG4A 2PJRA 1WPKA 4PK4A 1TT5B 3HBLA 2EV0A 4LK1F 4HV5A 3SYTA 1IXSB 3VSLA 2QTQA 2OQGA 4BBSJ 2BVMA 2PFVA 1WH7A 2K9NA 5J3LA 2DOEA 2A05A 1ULYA 3I53A 5D4SA 2XDVA 1R1VA 3GEZA 1HF0A 4BU2A 3BROA 2BOLA 4IHTA 2PI0A 3SZPA 2PJPA 1P4AA 5AIQA 5E20A 1GHCA 2ID3A 2EFNA 3UR3C 3QQAA 3CWRA 2LF8A 5C4XJ 4F92B 2EJRA 1OJLA 1A31A 4JL3A 2L3DA 1Y0NA 2G0EA 3KNWA 3U1DA 3FIWA 1U8RA 1G3SA 3V6GA 3TP0A 4B1RA 2OD5A 3PNYA 1T98A 2OAZA 2NOGA 2R7XA 3RPUA 1Y6IA 2DJIA 2UXUA 4Y13A 1LQ1A 1RC9A 2IPQX 4GRIA 2OTJI 2W00A 3CUOA 5DV5A 2Q8KA 5C3EJ 4UUVA 2RKHA 4D0PA 3SWHA 3KIOA 1IZ1A 2CU7A 4KIFA 3T5XA 2IEKA 3G56A 3KPHA 1X3ZB 1T39A 2MBFA 3H0DA 2XC7A 1X1DA 2E1NA 4J01A 1HW1A 3WGHA 5E1XA 2LSOA 1PVEA 3K4LA 5FGMA 1DUXC 1Z6TA 2DO7A 2JVGA 3LAPA 3COLA 5JI6A 4CYCB 3F8BA 2RV8A 2QYOA 4MFDA 1NK2P 5IOYA 4YG2F 4DW6A 4R1HA 1OYIA 1FSEA 1G6NA 1QQIA 3M8JA 1I1SA 4RB1A 1QRYA 3ERMA 2O6GE 1U5TC 3J81Z 3HRSA 2AXLA 3GTKJ 2CJJA 2GENA 3CDLA 3K70C 4PUSA 1YW8A 2KIFA 2VT2A 2ELJA 4XONA 1OISA 2WY7Q 4M71A 3K1PA 4XKWA 1MBGA 3SXYA 5DM7F 2ZCXA 5HDKA 3LSRA 4HX7A 2QEXI 3GFIA 2IS6A 3RCOA 2WWYA 3KYCB 4AIJA 4WF2A 4I6ZA 5DEQA 3OR1C 4MQ9F 3DCFA 3NAUA 1BN5A 1RZ4A 4S0HB 4OAZA 4ESJA 4L0YB 2ZCNA 2XDNA 2O61A 3E7QA 3Q5FA 2ME0A 4F7ZA 2EFOA 2HNHA 4KN7X 1WRJA 2DA3A 4UUTA 3LQRA 2H27A 4AWXB 4OINF 3OS1A 4AIKA 1MD0A 4HX4A 3VWBA 4A3CJ 4EJOA 1VQ7I 1O57A 2HQ5A 3PM1A 3D5RC 4XKVA 2O7OA 2W57A 4IQ4A 1FOKA 2ESNA 1XG1A 2YS9A 3G4SI 3HRUA 4FCYA 1ETOA 2FQ3A 1MNEA 2X85A 1TW3A 5EYRA 2Z1DA 2Y0SA 2BVLA 5GPAA 3WODF 1ZGWA 2XF7A 4MLOA 5D6FA 2M0CA 4KYWA 1HCRA 5C44J 4YIFA 2D2WA 4S05A 2KPMA 3T1BA 4RGRA 4E7IA 1K83J 4Q5SF 3MZHA 3AFHA 4CGZA 2VKVA 5K5OA 1TC3C 3I0TA 2R93J 2Y9YA 2A3SA 2AQFA 3BTCA 3VFZA 3QP5A 5IT9K 5DCFA 2VPLA 2QIBA 2P7VB 2MABA 4NBQA 3V4GA 3ZR8X 1VQLI 1ZR2A 4LB5A 1JUMA 1JKPC 2CFXA 2DDBA 5K5RA 3BDDA 9ANTA 1PUFA 4U0VA 2MGQA 1YHQI 2B1EA 1R00A 2REKA 2XGXA 4A0YA 2R5YA 1XS9A 4QTRA 4KT6A 4IX7A 3VW0A 3AG2H 3M1CA 4EM1A 2P4WA 3BG7A 2CV1A 1FIPA 5K7ZA 3IH4A 5JVTA 1BIAA 1VZ0A 2ZMEC 2WA0A 2BV6A 2R0QC 1HW5A 4N4NB 4HBLA 2DJNA 3C07A 1R1UA 3GTGJ 4OD4A 1TT0A 2V1NA 2ZSIB 3ESWB 4UB8C 1H0MA 3G71I 4M3BA 4BGDA 4HLXA 2L7MP 3KLOA 2PMHA 4KJZA 1ERDA 1S9HA 4LLLA 3LSHA 3PNVA 5ICEA 2STWA 1U9OA 3F23A 2EZLA 3DU6A 3FXJA 4YEJA 3RTRA 1FJLA 2KL4A 2D5VA 1JKQC 3H3ZA 5DYMA 5E8GA 5D5UB 1FLIA 1VQ6I 2LFBA 4M3DA 2EIKH 2ZXJA 4S04A 1HKSA 3C2GA 5M5WJ 3RPUD 3ZQIA 2QCOA 1YOVB 2XUBA 1HLVA 2JPBA 3S3OA 2E35A 1JUPA 2GA1A 3K6GA 3TP3A 2X6YA 1SMYF 2CW0F 5L3GA 2LK2A 3K4JA 3DP7A 2M4KA 2KHMA 2RASA 2EBIA 2AQEA 3BR3A 4KITB 3J80K 2P5VA 2PMUA 2V79A 2PMZN 3CP2A 2A07F 3LWJA 3P9TA 3N4MA 1E2XA 2STTA 5GAHJ 5B1AH 1B8IB 5J40A 4LD5A 1LE8B 1ZG1A 4PJLA 2R7VA 3VW2A 5LGUA 3E97A 3OYHA 4GGGA 1FT9A 4Y33A 1GDTA 2Q0OA 3MMYB 2XKOA 2NNNA 2X4HA 5J8CA 3DEEA 1G8XA 1BW5A 2FEZA 2I10A 3IP4B 4M73A 1YFHA 2IW5A 3DQVC 4CA0A 1W4MA 1Z0XA 1VQNI 4Q48A 3DU5A 2FJI1 3E6BA 4F91B 3F8NA 4WK8F 4E7KA 3WG7H 4O5VA 5E8IA 1O4XA 3IAS2 1X1AA 4CO8A 4C9YA 4CYCA 2E5NA 2KDZA 4HG2A 5ILUA 5J1UA 3V78A 5HBUA 2QF7A 2R7WA 3WTZA 4HQMA 1JXSA 2FE3A 2NXNB 5J8FA 4G6TB 5IT3A 3QPSA 4ZYEA 4M74A 1UG2A 3ABTA 3CUQC 2O7TA 3PSIA 3B81A 5DCMB 4FT8A 1ETWA 4XLHA 4FASD 3IAM2 2WV1A 3PUBA 1QA6A 3AKZA 2JSCA 4BS9A 5KAFC 1F4KA 2QA4I 1RI7A 2OF7A 3CO6C 2DAOA 4M9XA 4BJ6C 4IZZA 4HLYA 2R7ZJ 1MJAA 3F8MA 3NWSA 3K1MA 4PJJA 2XF6A 4CYDA 3BPVA 4B48A 2XIGA 3NI7A 4XKCA 2A68F 3DFGA 3D0SA 3GBGA 3VUQA 5C4JJ 3FMSA 2HTSA 1R49A 3R60A 2W84A 2WV0A 2Y0MA 1NH3A 2M45A 4OMZA 4HOBA 1LEAA 1KU9A 3G2BA 2W24A 4XMYA 3H5NA 4CCKA 2BY3A 2KRHA 2X6WA 1USSA 2DDAA 5F64A 4KN4X 4G8XA 3U2RA 3BJBA 3OR2C 2VBYA 4XSZF 3WHCA 1JTYA 1ETYA 3GTPJ 1Y1VJ 2ZXWH 5DTDA 1YIJI 1LFUP 5GP9A 2CSOA 3WTSC 4IHYA 5DM6F 5GADJ 3S3MA 3JRHA 1ETVA 3RH2A 1XMKA 4AD9A 3K4NA 3T0YA 5EEAA 1IC8A 2QSGX 4XK4A 4BJTA 4BXUA 4U0WA 1M1EB 1V54H 5L3CA 2CQXA 5J1RA 1N78A 3R4KA 3ZRGA 5JLXA 1T8IA 2X51A 3JRBA 3VSKA 5AQCA 3OYGA 1FTZA 5EZHA 4JBAA 4UDSA 3KZYA 3KLNA 2WTEA 3DEUA
chains in the Genus database with same CATH topology
1VI0A 3HOUJ 1D5YA 3M3YJ 3BR6A 1FEXA 3PO2J 1BJZA 5IP6A 3ON2A 5M5YJ 1APLC 3JREA 5EGOA 3S1RJ 1NK3P 2CUEA 5CXIA 3A01B 3H3VK 2DG7A 3D1NI 5F08A 3AQSA 3MKLA 2GUHA 3JRCA 1GV2A 4GFBA 3LHQA 3IH2A 2HDDA 3HM5A 4M3FA 3S1MJ 4QSHA 4JX4A 4ME9A 4W97A 3E7LA 2L0KA 3S15J 5IYDJ 3SFIA 3CQZJ 1X2NA 2WB1N 5K7HA 1GUUA 4BY7J 3GEUA 4XRSA 3ANPA 1OCPA 2Q24A 2M8GX 3BR5A 3T6NA 2E19A 4FISA 1T56A 4A3FJ 1JT0A 3BR2A 3HOZJ 2TCTA 2O8KA 2ELKA 5D19A 3Q0UA 1DU0A 4A69C 1YRNB 3HTAA 3VPRA 1F36A 3ON4A 1IGNA 4L5EA 2R5ZA 3O8GA 3OSGA 2PBXA 1RPWA 1I6HJ 3S14J 5FGLA 2JA7J 3EGQA 2MW8A 2NVYJ 1NTCA 2GLOA 1POGA 5F04A 4RDUA 2F07A 3F1BA 3BRUA 2QKOA 3TEDA 2LP0A 2DMPA 4D7MA 2N8GA 3HDDA 3Q0VA 4UUSA 1AHDP 4IHWA 3ZQFA 1PUFB 2HXIA 3GTOJ 4KWAA 1ZK8A 1IJWC 2XPWA 2LLKA 1SGMA 1MH4A 2VUMJ 5J1YA 2W53A 2ME6A 2E2HJ 1ITYA 5EG0A 1IV6A 2ZCMA 2YVHA 2JA6J 2AHQA 1IUFA 1FIAA 1RKWA 4AC0A 1FTTA 3W6VA 5C4YA 1B72B 5M3MJ 2WGBA 3K7AJ 5FKMA 3JRIA 3CRJA 4ICHA 5GPCA 4BKXA 1A6IA 1B8IA 1AU7A 2CQQA 2G7SA 2G7LA 3SJMA 5FHPA 2DTZA 4A3MJ 1LE8A 1LFBA 3LOCA 3K2AA 1TWAJ 3S16J 1AKHB 3CMYA 2ZOZA 5H9TA 1WGXA 2EZIA 2Y2ZA 2L7ZA 3S5RA 2NS8A 1YRNA 4BY1J 5M5XJ 3S2HJ 3WHBA 1IDZA 1ZTRA 3ZQHA 1H8AC 3LSGA 2DMTA 2XGDA 4ACIA 4GCLA 3JR9A 2NS7A 2Y31A 5FJ8J 3VP5A 1ETQA 1WPKA 3HBLA 1Z77A 2V57A 2CUFA 2QTQA 2DN0A 4BBSJ 4JNNA 1WH7A 2K9NA 5J3LA 3GTMJ 3LJLA 3HTIA 5FKKA 4D7NA 1ENHA 1MSEC 2GBYA 2Y9ZA 3HTHA 1HF0A 4B3AA 3ZQCA 3FKIJ 2JWTA 2GFNA 3MN2A 1VNDA 3S1NJ 2E1OA 2ZB9A 4C3HJ 2ID3A 3JRFA 3CWRA 3QQAA 1BL0A 5C4XJ 4MIMA 1OJLA 2QOPA 4JL3A 2G0EA 3KNWA 1HOMA 4B4CA 3FIWA 3V6GA 1TWCJ 3TP0A 4B1RA 2NOGA 3S17J 2HOTA 1W0TA 3L1PA 3RZOJ 3Q3SA 2K40A 2UXUA 5BNGA 4D5CA 4LOCA 4EEFG 5IYCJ 5C3EJ 4C2MJ 1XC5A 3BQZA 2FBQA 5F27A 4HNVA 4NELA 2OERA 2CU7A 2IBDA 2HXOA 2XGCA 1T33A 3LSJA 2IEKA 3C2BA 1Y1WJ 3G56A 2DA1A 3QBMA 2RAEA 2XB0X 2COBA 2LTPA 2EZKA 4Y7NJ 1U9NA 4XICA 2OPTA 3VVYA 4IHVA 3COLA 1MBFA 4CYCB 4MFDA 2HYTA 1JGGA 1NK2P 5IOYA 4DW6A 4MO7A 3NNRA 2Y0SN 2B63J 2K9SA 4GFLA 2IU5A 1P7IA 3O8HA 4JYKA 3A03A 1QRYA 1JJ8C 3GTKJ 1SANA 2G3BA 2CJJA 2R92J 4V2GA 4BXXJ 2GENA 3CDLA 3F0CA 4AUXA 4BBRJ 5E3OA 1MBKA 2KT0A 4M3EA 2DA5A 1MBGA 2ZCXA 3LSRA 4PXIA 2WUIA 4G12A 3FISA 3LSPA 3VVZA 1RETA 4C3JJ 4QIWN 4I6ZA 3UKGA 3DCFA 3NAUA 4S0HB 2ZCNA 2W48A 1JTXA 2XDNA 4V2FA 3E7QA 1WH5A 3G1LA 2ME0A 3A01A 3KKDA 2YU9J 1Q1VA 3VW1A 2DA3A 4UUTA 2DA7A 1VF9A 3MVPA 2VI6A 1DU6A 2EZHA 3BTJA 3NXCA 1S7EA 2R5YB 4A3CJ 3GTJJ 3O60A 2HQ5A 3PM1A 1E3OC 2YVEA 1QPIA 2O7OA 5FKOA 1ZQ3P 1IG7A 4FE7A 1XG1A 2YS9A 3RQIA 1ORKA 3S1QJ 3BNIA 4FCYA 1ETOA 1RESA 3ZQGA 1EF4A 2FJ1A 2NVTJ 5EYRA 3B6AA 5F0FA 2P81A 5GPAA 3CCYA 3BCGA 1P7JA 1ZGWA 4MLOA 2QWTA 1R9TJ 2XB5A 2M0CA 5IOZA 3JRAA 1H89C 4GCTA 3HTJA 1HCRA 5C44J 4DYCA 5E3NA 2JA8J 3QKXA 4MK6A 2LVSA 2Y30A 3AQTA 1K83J 4A3KJ 5EFYA 5FLVA 2VKVA 2G7GA 5D1RA 1WI3A 4XRSG 1TC3C 2FQ4A 2LD5A 1BW6A 2R93J 1ETXA 2VKEA 2Y9YA 4ABZA 3BTCA 3HGYA 2QIBA 1ZR2A 4X6AJ 1JUMA 1JKPC 2LKXA 4C3IJ 2XPUA 5EGOB 5CXGA 2RHAA 2HYJA 2UXOA 9ANTA 1PUFA 1JUSA 3BTLA 3IUVA 2MGQA 3NARA 5D18A 2REKA 5E3LA 5K7FA 2H8RA 1UI6A 3VIBA 2R5YA 1XS9A 1UHSA 2FX0A 4QTRA 5FMPA 3VW0A 3FK7A 2XPVA 5F1JA 2YUSA 1VFCA 2E2JJ 3NRGA 1B72A 4DYQA 1FIPA 5K7ZA 4RBOA 1U78A 3IH4A 1X2MA 4JX6A 1MSFC 5JLWA 2R0QC 2M9HA 2DJNA 3C07A 2E2IJ 3GTGJ 1GV5A 3IH3A 4A3BJ 5FKNA 1AKHA 1K61A 4M3BA 4A3DJ 3VVXA 2L7MP 2JK3A 1I3QJ 2XSDC 1MNMC 1TWGJ 2NVXJ 2CRGA 2O9LA 4DYRA 4A3LJ 2NP5A 1WCMJ 3PO3J 1F43A 2NP3A 1OCTC 2UXHA 3JSJA 1HDPA 1U9OA 2K9QA 3RKQA 2EZLA 1CQTA 3OSFA 4AF5A 1OFCX 3HE0A 3B6CA 4D5FA 2R5ZB 1FJLA 2D5VA 3HOWJ 1JKQC 2UXPA 3GZIA 2HOAA 3H0GJ 5EZGA 5EF6A 4DZPA 3BR1A 3S2DJ 1TWFJ 3TW6A 3HOXJ 5CW8A 2LFBA 4M3DA 3FRQA 1MBJA 1RKTA 4UUSB 4JP0A 1A5JA 5M5WJ 3ZQIA 2QCOA 2GM4A 1U8BA 1HLVA 3DPJA 1X58A 1JUPA 1HDDC 1RR7A 2XRLA 4M6VA 3TP3A 5F0CA 1JJ6C 1JKOC 2M34A 3Q0WA 3I4MJ 2L9RA 2LK2A 3TW7A 2X6OA 5EG0B 4AYBN 2PZ9A 1BA5A 5M3FJ 2RASA 5F0HA 4L62A 2EBIA 3BR3A 2L7FP 4MXMA 3DEWA 3HKZN 2PMZN 4XIDA 3LWJA 3P9TA 4JKZA 4XRMA 1GT0C 1B8IB 2EQRA 1JT6A 1LE8B 2DMUA 5IP9J 3VW2A 5DAJA 2DMQA 3OIOA 3NPIA 1GDTA 3OOUA 1I50J 2LR8A 5HODA 2D6YA 1BW5A 2I10A 2UXIA 2DMNA 4X1EA 3HOVJ 3ANGA 1ETKA 3BTIA 1Z0XA 5K58A 3BR0A 1MBHA 5IP7J 3RZDJ 2XGEA 2HI3A 3KKCA 2JA5J 1UI5A 4GFKA 3G1MA 1O4XA 1G2HA 2DA6A 4CYCA 2IAIA 2KDZA 5J1UA 3GTQJ 3V78A 3PPBA 5HBUA 1IDYA 2QF7A 3HGGA 1MBEA 3HB9A 5FLMJ 2JMWA 3BG3A 4IEJA 3BG5A 3QPSA 3KZ9A 1H88C 2DA2A 1UG2A 3BT9A 2O7TA 4NN1A 2ECBA 2MSYA 4A3IJ 3B81A 1ETWA 3ZOBA 5E3MA 3LNQA 2WV1A 5EDNA 4CGRA 2X48A 3I4NJ 3PASA 4A3JJ 2DG8A 1GVDA 2OF7A 2DA4A 3A02A 2NVQJ 4MFEA 3CJDA 3FK6A 4FE4A 4HKUA 4Y52J 2R7ZJ 4AC6A 3VOKA 5IYBJ 3M4OJ 3G1OA 3NI7A 3VOXA 3GBGA 3VUQA 4J19A 3ZQLA 5C4JJ 3HIMA 2JN6A 3GTLJ 2AO9A 4A93J 1MH3A 2ECCA 1SFOJ 3IV5A 2HKUA 3BHQA 3EUPA 2MG4A 4YZEA 3JRGA 3BQYA 1TWHJ 5HSZA 3QPLA 4DZJA 2H1KA 3BJBA 2WAQN 3BG9A 1W0UA 3WHCA 2M2EA 2JJ7A 1ZR4A 5HAWA 1UMQA 1JTYA 3HEFA 1ETYA 3GTPJ 1Y1VJ 2EH3A 5DTDA 4GCKA 4W1UA 1LFUP 2NX4A 5GP9A 3MNLA 4JX5A 1JKRC 1QVUA 4IHYA 3G7RA 3HOYJ 4I76A 3JRHA 1ETVA 2FD5A 3RH2A 4A3EJ 2TRTA 4FTHA 5EEAA 4M3GA 5DS9A 1IC8A 4A3GJ 1IRZA 3JRDA 4XK4A 3SDGA 2HOSA 4NDLA 1QVTA 4IHXA 2CQXA 2LY9A 5J1RA 2OI8A 2ID6A 2VPRA 2ZOYA 5FKLA 5JLXA 2X9DA 3JRBA 5AQCA 5IPAA 1FTZA 5EZHA 4UDSA 1ZKGA 3RD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI0 A;  3HOU J;  1D5Y A;  3M3Y J;  3BR6 A;  1FEX A;  3PO2 J;  1BJZ A;  5IP6 A;  3ON2 A;  5M5Y J;  1APL C;  3JRE A;  5EGO A;  3S1R J;  1NK3 P;  2CUE A;  5CXI A;  3A01 B;  3H3V K;  2DG7 A;  3D1N I;  5F08 A;  3AQS A;  3MKL A;  2GUH A;  3JRC A;  1GV2 A;  4GFB A;  3LHQ A;  3IH2 A;  2HDD A;  3HM5 A;  4M3F A;  3S1M J;  4QSH A;  4JX4 A;  4ME9 A;  4W97 A;  3E7L A;  2L0K A;  3S15 J;  5IYD J;  3SFI A;  3CQZ J;  1X2N A;  2WB1 N;  5K7H A;  1GUU A;  4BY7 J;  3GEU A;  4XRS A;  3ANP A;  1OCP A;  2Q24 A;  2M8G X;  3BR5 A;  3T6N A;  2E19 A;  4FIS A;  1T56 A;  4A3F J;  1JT0 A;  3BR2 A;  3HOZ J;  2TCT A;  2O8K A;  2ELK A;  5D19 A;  3Q0U A;  1DU0 A;  4A69 C;  1YRN B;  3HTA A;  3VPR A;  1F36 A;  3ON4 A;  1IGN A;  4L5E A;  2R5Z A;  3O8G A;  3OSG A;  2PBX A;  1RPW A;  1I6H J;  3S14 J;  5FGL A;  2JA7 J;  3EGQ A;  2MW8 A;  2NVY J;  1NTC A;  2GLO A;  1POG A;  5F04 A;  4RDU A;  2F07 A;  3F1B A;  3BRU A;  2QKO A;  3TED A;  2LP0 A;  2DMP A;  4D7M A;  2N8G A;  3HDD A;  3Q0V A;  4UUS A;  1AHD P;  4IHW A;  3ZQF A;  1PUF B;  2HXI A;  3GTO J;  4KWA A;  1ZK8 A;  1IJW C;  2XPW A;  2LLK A;  1SGM A;  1MH4 A;  2VUM J;  5J1Y A;  2W53 A;  2ME6 A;  2E2H J;  1ITY A;  5EG0 A;  1IV6 A;  2ZCM A;  2YVH A;  2JA6 J;  2AHQ A;  1IUF A;  1FIA A;  1RKW A;  4AC0 A;  1FTT A;  3W6V A;  5C4Y A;  1B72 B;  5M3M J;  2WGB A;  3K7A J;  5FKM A;  3JRI A;  3CRJ A;  4ICH A;  5GPC A;  4BKX A;  1A6I A;  1B8I A;  1AU7 A;  2CQQ A;  2G7S A;  2G7L A;  3SJM A;  5FHP A;  2DTZ A;  4A3M J;  1LE8 A;  1LFB A;  3LOC A;  3K2A A;  1TWA J;  3S16 J;  1AKH B;  3CMY A;  2ZOZ A;  5H9T A;  1WGX A;  2EZI A;  2Y2Z A;  2L7Z A;  3S5R A;  2NS8 A;  1YRN A;  4BY1 J;  5M5X J;  3S2H J;  3WHB A;  1IDZ A;  1ZTR A;  3ZQH A;  1H8A C;  3LSG A;  2DMT A;  2XGD A;  4ACI A;  4GCL A;  3JR9 A;  2NS7 A;  2Y31 A;  5FJ8 J;  3VP5 A;  1ETQ A;  1WPK A;  3HBL A;  1Z77 A;  2V57 A;  2CUF A;  2QTQ A;  2DN0 A;  4BBS J;  4JNN A;  1WH7 A;  2K9N A;  5J3L A;  3GTM J;  3LJL A;  3HTI A;  5FKK A;  4D7N A;  1ENH A;  1MSE C;  2GBY A;  2Y9Z A;  3HTH A;  1HF0 A;  4B3A A;  3ZQC A;  3FKI J;  2JWT A;  2GFN A;  3MN2 A;  1VND A;  3S1N J;  2E1O A;  2ZB9 A;  4C3H J;  2ID3 A;  3JRF A;  3CWR A;  3QQA A;  1BL0 A;  5C4X J;  4MIM A;  1OJL A;  2QOP A;  4JL3 A;  2G0E A;  3KNW A;  1HOM A;  4B4C A;  3FIW A;  3V6G A;  1TWC J;  3TP0 A;  4B1R A;  2NOG A;  3S17 J;  2HOT A;  1W0T A;  3L1P A;  3RZO J;  3Q3S A;  2K40 A;  2UXU A;  5BNG A;  4D5C A;  4LOC A;  4EEF G;  5IYC J;  5C3E J;  4C2M J;  1XC5 A;  3BQZ A;  2FBQ A;  5F27 A;  4HNV A;  4NEL A;  2OER A;  2CU7 A;  2IBD A;  2HXO A;  2XGC A;  1T33 A;  3LSJ A;  2IEK A;  3C2B A;  1Y1W J;  3G56 A;  2DA1 A;  3QBM A;  2RAE A;  2XB0 X;  2COB A;  2LTP A;  2EZK A;  4Y7N J;  1U9N A;  4XIC A;  2OPT A;  3VVY A;  4IHV A;  3COL A;  1MBF A;  4CYC B;  4MFD A;  2HYT A;  1JGG A;  1NK2 P;  5IOY A;  4DW6 A;  4MO7 A;  3NNR A;  2Y0S N;  2B63 J;  2K9S A;  4GFL A;  2IU5 A;  1P7I A;  3O8H A;  4JYK A;  3A03 A;  1QRY A;  1JJ8 C;  3GTK J;  1SAN A;  2G3B A;  2CJJ A;  2R92 J;  4V2G A;  4BXX J;  2GEN A;  3CDL A;  3F0C A;  4AUX A;  4BBR J;  5E3O A;  1MBK A;  2KT0 A;  4M3E A;  2DA5 A;  1MBG A;  2ZCX A;  3LSR A;  4PXI A;  2WUI A;  4G12 A;  3FIS A;  3LSP A;  3VVZ A;  1RET A;  4C3J J;  4QIW N;  4I6Z A;  3UKG A;  3DCF A;  3NAU A;  4S0H B;  2ZCN A;  2W48 A;  1JTX A;  2XDN A;  4V2F A;  3E7Q A;  1WH5 A;  3G1L A;  2ME0 A;  3A01 A;  3KKD A;  2YU9 J;  1Q1V A;  3VW1 A;  2DA3 A;  4UUT A;  2DA7 A;  1VF9 A;  3MVP A;  2VI6 A;  1DU6 A;  2EZH A;  3BTJ A;  3NXC A;  1S7E A;  2R5Y B;  4A3C J;  3GTJ J;  3O60 A;  2HQ5 A;  3PM1 A;  1E3O C;  2YVE A;  1QPI A;  2O7O A;  5FKO A;  1ZQ3 P;  1IG7 A;  4FE7 A;  1XG1 A;  2YS9 A;  3RQI A;  1ORK A;  3S1Q J;  3BNI A;  4FCY A;  1ETO A;  1RES A;  3ZQG A;  1EF4 A;  2FJ1 A;  2NVT J;  5EYR A;  3B6A A;  5F0F A;  2P81 A;  5GPA A;  3CCY A;  3BCG A;  1P7J A;  1ZGW A;  4MLO A;  2QWT A;  1R9T J;  2XB5 A;  2M0C A;  5IOZ A;  3JRA A;  1H89 C;  4GCT A;  3HTJ A;  1HCR A;  5C44 J;  4DYC A;  5E3N A;  2JA8 J;  3QKX A;  4MK6 A;  2LVS A;  2Y30 A;  3AQT A;  1K83 J;  4A3K J;  5EFY A;  5FLV A;  2VKV A;  2G7G A;  5D1R A;  1WI3 A;  4XRS G;  1TC3 C;  2FQ4 A;  2LD5 A;  1BW6 A;  2R93 J;  1ETX A;  2VKE A;  2Y9Y A;  4ABZ A;  3BTC A;  3HGY A;  2QIB A;  1ZR2 A;  4X6A J;  1JUM A;  1JKP C;  2LKX A;  4C3I J;  2XPU A;  5EGO B;  5CXG A;  2RHA A;  2HYJ A;  2UXO A;  9ANT A;  1PUF A;  1JUS A;  3BTL A;  3IUV A;  2MGQ A;  3NAR A;  5D18 A;  2REK A;  5E3L A;  5K7F A;  2H8R A;  1UI6 A;  3VIB A;  2R5Y A;  1XS9 A;  1UHS A;  2FX0 A;  4QTR A;  5FMP A;  3VW0 A;  3FK7 A;  2XPV A;  5F1J A;  2YUS A;  1VFC A;  2E2J J;  3NRG A;  1B72 A;  4DYQ A;  1FIP A;  5K7Z A;  4RBO A;  1U78 A;  3IH4 A;  1X2M A;  4JX6 A;  1MSF C;  5JLW A;  2R0Q C;  2M9H A;  2DJN A;  3C07 A;  2E2I J;  3GTG J;  1GV5 A;  3IH3 A;  4A3B J;  5FKN A;  1AKH A;  1K61 A;  4M3B A;  4A3D J;  3VVX A;  2L7M P;  2JK3 A;  1I3Q J;  2XSD C;  1MNM C;  1TWG J;  2NVX J;  2CRG A;  2O9L A;  4DYR A;  4A3L J;  2NP5 A;  1WCM J;  3PO3 J;  1F43 A;  2NP3 A;  1OCT C;  2UXH A;  3JSJ A;  1HDP A;  1U9O A;  2K9Q A;  3RKQ A;  2EZL A;  1CQT A;  3OSF A;  4AF5 A;  1OFC X;  3HE0 A;  3B6C A;  4D5F A;  2R5Z B;  1FJL A;  2D5V A;  3HOW J;  1JKQ C;  2UXP A;  3GZI A;  2HOA A;  3H0G J;  5EZG A;  5EF6 A;  4DZP A;  3BR1 A;  3S2D J;  1TWF J;  3TW6 A;  3HOX J;  5CW8 A;  2LFB A;  4M3D A;  3FRQ A;  1MBJ A;  1RKT A;  4UUS B;  4JP0 A;  1A5J A;  5M5W J;  3ZQI A;  2QCO A;  2GM4 A;  1U8B A;  1HLV A;  3DPJ A;  1X58 A;  1JUP A;  1HDD C;  1RR7 A;  2XRL A;  4M6V A;  3TP3 A;  5F0C A;  1JJ6 C;  1JKO C;  2M34 A;  3Q0W A;  3I4M J;  2L9R A;  2LK2 A;  3TW7 A;  2X6O A;  5EG0 B;  4AYB N;  2PZ9 A;  1BA5 A;  5M3F J;  2RAS A;  5F0H A;  4L62 A;  2EBI A;  3BR3 A;  2L7F P;  4MXM A;  3DEW A;  3HKZ N;  2PMZ N;  4XID A;  3LWJ A;  3P9T A;  4JKZ A;  4XRM A;  1GT0 C;  1B8I B;  2EQR A;  1JT6 A;  1LE8 B;  2DMU A;  5IP9 J;  3VW2 A;  5DAJ A;  2DMQ A;  3OIO A;  3NPI A;  1GDT A;  3OOU A;  1I50 J;  2LR8 A;  5HOD A;  2D6Y A;  1BW5 A;  2I10 A;  2UXI A;  2DMN A;  4X1E A;  3HOV J;  3ANG A;  1ETK A;  3BTI A;  1Z0X A;  5K58 A;  3BR0 A;  1MBH A;  5IP7 J;  3RZD J;  2XGE A;  2HI3 A;  3KKC A;  2JA5 J;  1UI5 A;  4GFK A;  3G1M A;  1O4X A;  1G2H A;  2DA6 A;  4CYC A;  2IAI A;  2KDZ A;  5J1U A;  3GTQ J;  3V78 A;  3PPB A;  5HBU A;  1IDY A;  2QF7 A;  3HGG A;  1MBE A;  3HB9 A;  5FLM J;  2JMW A;  3BG3 A;  4IEJ A;  3BG5 A;  3QPS A;  3KZ9 A;  1H88 C;  2DA2 A;  1UG2 A;  3BT9 A;  2O7T A;  4NN1 A;  2ECB A;  2MSY A;  4A3I J;  3B81 A;  1ETW A;  3ZOB A;  5E3M A;  3LNQ A;  2WV1 A;  5EDN A;  4CGR A;  2X48 A;  3I4N J;  3PAS A;  4A3J J;  2DG8 A;  1GVD A;  2OF7 A;  2DA4 A;  3A02 A;  2NVQ J;  4MFE A;  3CJD A;  3FK6 A;  4FE4 A;  4HKU A;  4Y52 J;  2R7Z J;  4AC6 A;  3VOK A;  5IYB J;  3M4O J;  3G1O A;  3NI7 A;  3VOX A;  3GBG A;  3VUQ A;  4J19 A;  3ZQL A;  5C4J J;  3HIM A;  2JN6 A;  3GTL J;  2AO9 A;  4A93 J;  1MH3 A;  2ECC A;  1SFO J;  3IV5 A;  2HKU A;  3BHQ A;  3EUP A;  2MG4 A;  4YZE A;  3JRG A;  3BQY A;  1TWH J;  5HSZ A;  3QPL A;  4DZJ A;  2H1K A;  3BJB A;  2WAQ N;  3BG9 A;  1W0U A;  3WHC A;  2M2E A;  2JJ7 A;  1ZR4 A;  5HAW A;  1UMQ A;  1JTY A;  3HEF A;  1ETY A;  3GTP J;  1Y1V J;  2EH3 A;  5DTD A;  4GCK A;  4W1U A;  1LFU P;  2NX4 A;  5GP9 A;  3MNL A;  4JX5 A;  1JKR C;  1QVU A;  4IHY A;  3G7R A;  3HOY J;  4I76 A;  3JRH A;  1ETV A;  2FD5 A;  3RH2 A;  4A3E J;  2TRT A;  4FTH A;  5EEA A;  4M3G A;  5DS9 A;  1IC8 A;  4A3G J;  1IRZ A;  3JRD A;  4XK4 A;  3SDG A;  2HOS A;  4NDL A;  1QVT A;  4IHX A;  2CQX A;  2LY9 A;  5J1R A;  2OI8 A;  2ID6 A;  2VPR A;  2ZOY A;  5FKL A;  5JLX A;  2X9D A;  3JRB A;  5AQC A;  5IPA A;  1FTZ A;  5EZH A;  4UDS A;  1ZKG A;  3RD3 A; 
#chains in the Genus database with same CATH topology
 5D6E A;  4LIT A;  3CZ6 A;  2V9K A;  1D5Y A;  3M3Y J;  3DKX A;  1ZN2 A;  4BDZ A;  4CH7 A;  3FF5 A;  3PO2 J;  3S3N A;  2DPU A;  5J47 A;  1NK3 P;  3S1R J;  4K2E A;  5CXI A;  5DD4 A;  5D5W B;  1J2X A;  2VOO A;  1J5Y A;  3D1N I;  3AQS A;  3IHU A;  1WWX A;  2L9N A;  3MKL A;  1R58 A;  2D45 A;  3BLY A;  4ZYD A;  3TOB A;  3HM5 A;  2DK8 A;  4M3F A;  1K6O A;  2VQH A;  1SMT A;  4ME9 A;  3L00 A;  4W97 A;  4H4K C;  2M7A A;  3E7L A;  5GAG J;  2QKM B;  4BHB A;  4CZC A;  5K7H A;  1C0W A;  5BOX A;  2OQR A;  3BJ6 A;  3RKW A;  3FXO A;  4F55 A;  2HYF A;  4BEH B;  1BJA A;  4UV8 A;  3J7Z I;  2Q24 A;  3T6N A;  3ROU A;  1T56 A;  4L9V A;  4BE2 A;  4BNC A;  4UHT A;  3G3Z A;  3U21 A;  3TO6 A;  3DBR B;  3ERE D;  3HTA A;  1SEU A;  1F36 A;  3FMQ A;  1D8K A;  1V55 H;  2F4M B;  1X1C A;  1IGN A;  4LG0 B;  1MIJ A;  3A0H C;  1BM9 A;  1HC8 A;  4L18 B;  3O8G A;  2FSW A;  3E3V A;  1ZGA A;  2A2F X;  2MW8 A;  1U3E M;  2KIS A;  2V4J C;  5AIP A;  1T0F C;  4RDU A;  2F07 A;  1XCB A;  1UG0 A;  2ZO4 A;  2N8G A;  3VYT B;  5CLS A;  3FXU A;  3OYD A;  3WTX C;  1HBX G;  2F5C A;  2XHK A;  2HXI A;  4MNU A;  5EEG A;  1QZZ A;  2CH0 A;  2G7H A;  1KQ0 A;  1UJ8 A;  2HGC A;  2E5Z A;  4L9T A;  5J6X A;  1ZRC A;  4LIV A;  4RLQ A;  1Z7L A;  3FHN A;  1UHW A;  1D1A A;  4AYB A;  5HS9 A;  3HUG A;  1L3L A;  3W6V A;  2BY0 A;  2WGB A;  1D0Z A;  3HKZ A;  1N25 A;  4E6K G;  3DV8 A;  2Q1Z B;  1B8I A;  3PNT A;  2CQQ A;  3I55 I;  1R5I D;  1LE8 A;  1UEL B;  3LOC A;  3ZMD A;  3K2A A;  2DW4 A;  1WJD A;  1LKX A;  3HRM A;  3NS4 A;  3AG1 H;  1WGX A;  2EZI A;  2XAJ A;  1CF7 A;  2L7Z A;  4ZZD A;  4JQF A;  2NS8 A;  1J59 A;  4BY1 J;  2RQQ A;  1IDZ A;  1Z91 A;  2XGD A;  2KFD A;  2EIN H;  4BQQ A;  2EIJ H;  3BC8 A;  3ECO A;  1YLF A;  3P7N A;  4C2U A;  2NS7 A;  2O5R A;  3KP4 A;  3CJQ B;  3EQL F;  3ISP A;  1LEB A;  1FNN A;  1TNT A;  1Z77 A;  2LF7 A;  1U5T B;  2WAE A;  4BXF A;  2D1V A;  5FKK A;  2E71 A;  2RRE A;  1MSE C;  2DFF A;  4WXD A;  4B3A A;  2ESH A;  4J00 A;  1I3A A;  2QQ8 A;  3FKI J;  1ZEL A;  3QU3 A;  5DCM A;  1D1C A;  2MC3 A;  3TO9 A;  1VND A;  3S1N J;  3FMR A;  3IKV A;  3HTU A;  1MMS A;  3LAJ A;  2DK5 A;  4C3H J;  3JRF A;  2QOP A;  4X0G A;  1G3W A;  1HOM A;  4WCG A;  4R79 A;  2VKD A;  3H9G A;  3WTV C;  2H09 A;  3CCL I;  2H6B A;  3DLA A;  1W36 C;  4II3 A;  5BPI A;  3W2A A;  2BXY A;  2HOT A;  3L1P A;  3OYB A;  3Q3S A;  5BNG A;  3FKJ A;  4LOC A;  5ILV A;  4C2M J;  4RAG A;  1XC5 A;  3GW2 A;  4QLC U;  2DQR A;  5E18 F;  2OER A;  1WJF A;  1MW7 A;  2JTV A;  2IBD A;  2HXO A;  3G73 A;  3OWT A;  4YFN F;  3LSJ A;  2ADU A;  2DA1 A;  4UVC A;  4XOR A;  3QBM A;  3AG4 H;  2COB A;  4IXA A;  4XOT A;  5HDN A;  1QZY A;  3PFI A;  3OIP A;  1EH8 A;  2HVS A;  3GWZ A;  1G59 A;  4XNF A;  3DTI A;  4IHV A;  1MBF A;  5JVG F;  2KKO A;  2H1L A;  2L7K A;  5CQG A;  4IOA F;  4EGZ A;  3NNR A;  2K9S A;  3J7A Y;  2VQG A;  2CYY A;  4GFL A;  2OCC H;  4XLN F;  2IU5 A;  1P7I A;  1VQO I;  1X4O A;  4OIR F;  1BR2 A;  2DOA A;  2AS5 F;  2G3B A;  1SAN A;  2R92 J;  3ZMZ A;  4AUX A;  4BBR J;  2KT0 A;  2ISY A;  5CVV A;  4UV9 A;  4P9U A;  2A69 F;  4BQN A;  1R5G A;  1JHF A;  1LUJ B;  2HEO A;  4XOP A;  4LG0 A;  3VVZ A;  3LSK A;  4PSX A;  4ZC3 A;  1UAA A;  2LKS A;  2W48 A;  3DTE A;  4XSX F;  1VQ8 I;  2M8E A;  3F9K A;  3M8E A;  1SD4 A;  1G3T A;  3JAM K;  3V8L A;  3KKD A;  2YU9 J;  5A2Q Z;  3LSI A;  2W82 A;  1K6Y A;  2FRH A;  2LC2 A;  3T8R A;  4BJ5 C;  2DA7 A;  4LGW A;  3MVP A;  1TQI A;  3FXM A;  4A6D A;  1B4A A;  2HPI A;  4CCL A;  3K8P C;  2VLA A;  3NXC A;  2RGV A;  3EYY A;  5HLH A;  2B7E A;  2R5Y B;  2ZME B;  1ON1 A;  1WHU A;  5FKO A;  3SHF A;  1IG7 A;  1QBJ A;  3PFY A;  4FE7 A;  5FLX Z;  1HQC A;  2RC4 A;  1ORK A;  1Y0U A;  2OBP A;  3S1Q J;  3BNI A;  1QHG A;  2XAF A;  1WVR A;  3FXQ A;  2P81 A;  4UXN A;  3RYP A;  1IN5 A;  3CCY A;  1P7J A;  4BEH A;  1FZP B;  1S5L C;  2MH9 A;  3JRA A;  4HAM A;  3HTJ A;  2R7O A;  4GCT A;  4DYC A;  1LB2 A;  4MK6 A;  3M7G A;  3AQT A;  4XLA A;  5EFY A;  1NG7 A;  5FLV A;  3PIO F;  5D1R A;  1ZGJ A;  4XRS G;  2NRA C;  1J75 A;  2QUF A;  3CJN A;  3A0B C;  2GAU A;  3IRR A;  1ETX A;  2FMY A;  4ABZ A;  4OIP F;  3AL0 C;  1MMG A;  1B9N A;  1LVA A;  1BBY A;  4KIS A;  4KT5 C;  1P92 A;  4F93 B;  1SFE A;  5EGO B;  1O7F A;  5CXG A;  2E60 A;  1Z3X A;  2Z33 A;  3VTI A;  2M30 A;  2OZU A;  1WI9 A;  4AID A;  1JUS A;  4Q47 A;  3IUV A;  1YYV A;  3C2H A;  3OYL A;  2OCE A;  5K7F A;  1CGP A;  2W7N A;  4KIG A;  2YU3 A;  2Z2S B;  3P9C A;  2YR2 A;  3VIB A;  2HDW A;  2QSF X;  4C2M A;  5FMP A;  5HNF A;  3ML6 A;  2K3P A;  2M0M A;  2NNY A;  2XPV A;  1MDM B;  2JSP A;  2E2J J;  4EGY A;  4BAY A;  1O3Q A;  1JI8 A;  4RBO A;  1U78 A;  1ZLJ A;  1X2M A;  1SVL A;  4JX6 A;  1HKQ A;  2JRM A;  5JLW A;  3M07 A;  3PQK A;  4RM2 A;  3HSE A;  1ZG5 A;  2ZJR F;  3R6S A;  2VXD A;  1GV5 A;  3BZK A;  2JA2 A;  3N05 A;  4GXO A;  1XX5 A;  1NHA A;  3B73 A;  3HPH A;  1K7A A;  1TWG J;  1GXQ A;  2NVX J;  3A4C A;  3KP5 A;  4I0B A;  4C2T A;  1WCM J;  1PJR A;  1OCT C;  2UXH A;  3BJO A;  1G3Y A;  1QO0 D;  3RKQ A;  1CQT A;  2B9S A;  3OSF A;  3HE0 A;  3KEO A;  2JRT A;  3DKW A;  3L2R A;  2R5Z B;  1ZRD A;  2ZXH A;  2IA2 A;  2BXZ A;  1Z3Y A;  3HOW J;  2UXP A;  3ULQ B;  2P7C B;  3K10 A;  3CUQ B;  1OYY A;  1R4N B;  1TWF J;  2E7W A;  1U5T A;  4BH9 A;  5CW8 A;  1MKM A;  3MWM A;  1J7K A;  1RKT A;  1B6A A;  2VBW A;  2CV2 A;  4KMU X;  1U8B A;  5CYV A;  5LHG A;  2PG4 A;  1DPU A;  2DOD A;  2EA2 A;  4B47 A;  2P6S A;  2MC4 A;  4HEA 2;  1EH6 A;  1HDD C;  3OS2 A;  1FP1 D;  4FX4 A;  2HWV A;  1JJ6 C;  3CC7 I;  3H36 A;  3TW7 A;  1E3P A;  1T08 B;  4AYB N;  5KVR A;  5ICG A;  1PUE E;  5M3F J;  1RIO H;  4R8H A;  3DEW A;  3HKZ N;  2L02 A;  2CQN A;  5F1R A;  5GTH C;  4ENJ A;  2XVC A;  4KDP A;  4UNO A;  3H92 A;  3I71 A;  3F22 A;  1F5T A;  5GTI C;  1EA3 A;  5IP9 J;  2VE9 A;  4RB0 A;  3ZQ7 A;  1I50 J;  2X6X A;  2GQQ A;  4DQ2 A;  5HOD A;  2ELH A;  3I5U A;  4LIU A;  1KZH A;  1ON2 A;  2DMN A;  1V3F A;  2W1O A;  2R7F A;  1F1Z A;  2L4A A;  2V7F A;  2XF5 A;  5IP7 J;  1WKM A;  2XGE A;  4Y3O A;  2MYS A;  1I27 A;  5FRN A;  3HC7 A;  4LLN A;  1UI5 A;  1FX7 A;  4GFK A;  2E1M C;  2ZBK A;  3VOD A;  2DA6 A;  4EQQ A;  2QGU A;  3J81 K;  5FLM J;  3HGG A;  2CW8 A;  1YW9 A;  2VJ4 A;  3BG3 A;  1IV8 A;  4O6J A;  5E79 C;  4M72 A;  1V4R A;  5IT9 Z;  4NN1 A;  5L3B A;  2ETH A;  5TJJ A;  3TL4 X;  4BHP A;  4NC8 A;  1BIB A;  3ZOB A;  4DBQ A;  5E3M A;  1VQK I;  3GFM A;  2XKP A;  3SZG A;  5HOO A;  4NUB A;  3GZ6 A;  1GVD A;  3F3X A;  3SQN A;  1A36 A;  1SD7 A;  2NVQ J;  1W5S A;  2QQB A;  1FBQ A;  2CUJ A;  4XN0 A;  2HDC A;  4Y52 J;  4AC6 A;  1P6R A;  3FXK A;  1A04 A;  2KIU A;  2XAH A;  2H8W A;  3VOX A;  4J19 A;  3ZQL A;  5HS7 A;  2CMP A;  3V7C A;  4U7D A;  3CMA I;  1MH3 A;  2HKX A;  3ECH A;  1Z7U A;  4XLC A;  3FWE A;  3IV5 A;  3MKY B;  2HKU A;  2CV0 A;  3EUP A;  3BWG A;  4YZE A;  1T38 A;  3JRG A;  3DXJ F;  1DGR M;  2ZME A;  3ZMU A;  2DYS H;  4ENK A;  4DZJ A;  4HSR A;  4I99 C;  3K4M A;  3BG9 A;  1XB4 A;  1SC7 A;  1W0U A;  1ONV A;  2DTR A;  1ZR4 A;  5HAW A;  3FZV A;  2BHY A;  2EH3 A;  4GCK A;  2NX4 A;  3MNL A;  4JX5 A;  2K27 A;  1JHH A;  2B0L A;  1RRJ A;  1JKR C;  4EJT A;  3HOY J;  4I76 A;  2FD5 A;  5KNL A;  1T6S A;  4A3E J;  1IRZ A;  4M3G A;  5DS9 A;  3I59 B;  2EWN A;  4YRV A;  3SDG A;  3OYK A;  3I58 A;  3CCM I;  4M9Z A;  5E1Z B;  2OI8 A;  3GO5 A;  4IPA A;  5L3D A;  2LBF B;  4NNJ A;  5IPA A;  3I3L A;  3MZ8 A;  2IS1 A;  5GAE J;  4RB3 C;  1QGP A;  2OA4 A;  3EYI A;  1FEX A;  1R6R A;  1KQ9 A;  2ZNZ A;  5M5Y J;  2KQR A;  4IHS A;  2YVX A;  5EGO A;  2QQ9 A;  4KUM A;  3J80 Z;  2FA5 A;  2MFZ A;  1K4T A;  1Z67 A;  3GLX A;  4II2 A;  1YQA A;  2HQA A;  4RB2 C;  4IQJ A;  4GO1 A;  2HQR A;  2CGP A;  1MGT A;  2K9L A;  1GV2 A;  3BPX A;  4BAC A;  2HDD A;  1FOW A;  2DLL A;  2EIM H;  4ZTF A;  4E4H A;  4QSH A;  4DJA A;  1ZRE A;  4ZDO A;  2M87 A;  3VOE A;  3QPH A;  4ZTJ A;  1MDM A;  3HUG B;  2L0K A;  1MJB A;  4I98 B;  3SFI A;  4BHC A;  5CVR A;  4PJM A;  3KE2 A;  1SFU A;  4BQO A;  3FX3 A;  3CJR B;  4UVA A;  1OCP A;  2RNJ A;  2E19 A;  4FIS A;  1JT0 A;  1CF7 B;  2TCT A;  1BC8 C;  2Z9O A;  3K70 D;  1UCR A;  4DOZ A;  4IOC F;  2O8K A;  2ELK A;  4ASN A;  3VPR A;  2M5W A;  2PN6 A;  4L5E A;  2R5Z A;  3CC4 I;  2HFH A;  4GCV A;  4BE1 A;  3PUF A;  3TBI A;  5LD2 C;  4KFC A;  3EET A;  5FGL A;  3EGQ A;  3DPL C;  2IP2 A;  3CUQ A;  3L2W A;  4KMF A;  3CCS I;  1FPQ A;  4PFO A;  3TED A;  2M3A A;  3DLL F;  4D7M A;  5LHH A;  2V26 A;  1KON A;  1AOY A;  3AAF A;  4IHW A;  3ZQF A;  1LDD A;  2F6C A;  4I01 A;  3KEY A;  4LK0 F;  3COA C;  3QOP A;  1MH4 A;  2HTJ A;  4CCN A;  4M6X A;  3WGI A;  2IT0 A;  2VUM J;  2W4S A;  3W3C A;  3W6J B;  5LGN A;  3L7W A;  1ZG3 A;  5EEH A;  2YVH A;  2JA6 J;  1IUF A;  1FIA A;  1RKW A;  3BZC A;  3P5J A;  4AC0 A;  3BCA A;  3K7A J;  3QP6 A;  3KP7 A;  5GPC A;  4FQG A;  1IN6 A;  4BKX A;  1Z1D A;  1SAU A;  4UB6 C;  2G7L A;  2F5D A;  4A3M J;  1KYZ A;  3U1K A;  1AWC A;  1LFB A;  1XMA A;  2ZOZ A;  3S16 J;  1AKH B;  2UWM A;  2DFH A;  2Y2Z A;  3OY9 A;  3FM5 A;  3S5R A;  3KCC A;  2DT5 A;  1S7O A;  1YTY A;  1YRN A;  3WTU C;  2DPD A;  3S2H J;  3RI4 A;  3WHB A;  3WE3 A;  1ZRF A;  1ZTR A;  2QSH X;  4ZDP A;  1ODD A;  3J7A O;  2HU9 A;  3IC7 A;  3VP5 A;  3MKW B;  1YIO A;  1ETQ A;  3HG9 A;  1SD5 A;  3GZ5 A;  4MHG A;  1F9N A;  1YJN I;  3QRF F;  4EVI A;  3LJL A;  3HTI A;  1ENH A;  1BR4 A;  2OTL I;  2R4G A;  2Y9Z A;  3HTH A;  3ABL H;  3KP6 A;  4OD5 A;  1VQP I;  2Y75 A;  3GFJ A;  5ERI A;  4B8X A;  3FBI B;  4XL9 A;  2L4M A;  3MN2 A;  2BE5 F;  5HVQ C;  1YE9 A;  2FNA A;  3ZQQ A;  1MZB A;  3ASN H;  4PGH A;  1FOX A;  1RNL A;  4MIM A;  3CD6 I;  1J9I A;  4B4C A;  3H1C A;  1TWC J;  4CUG A;  3A1Y A;  3IWZ A;  4G6Q A;  5K5Q A;  3S17 J;  3KET A;  1HA8 A;  2VBZ A;  4ZH4 F;  1OR7 C;  4EEF G;  5IYC J;  2EB7 A;  3HYI A;  3CF2 A;  3H3U A;  4HF0 A;  4M6Y A;  3JTG A;  3BQZ A;  2PFB A;  3F21 A;  5F27 A;  4HNV A;  2FBQ A;  4L5I A;  4CCJ A;  1LPQ A;  3PJR A;  1T33 A;  2K9M A;  2VJJ A;  1Y1W J;  1YJW I;  1K78 B;  1GXP A;  3WU2 C;  3PIP F;  1YO5 C;  1LDJ A;  2G7U A;  2GXB A;  4HW0 A;  3RDI A;  3GFL A;  1U9N A;  4HNU A;  4XIC A;  1XDS A;  3VVY A;  2FU4 A;  1FC3 A;  2XAG A;  2DYR H;  1IRX A;  4HZF A;  1JGG A;  1IF1 A;  2E7X A;  3BP8 A;  3WE2 A;  5D5V B;  2Y0S N;  3R61 A;  4PZJ A;  2VOD A;  4P55 A;  3CCV I;  5ED4 A;  4EJV A;  3M8F A;  2O0Y A;  4E7L A;  4KIB A;  1O7L A;  1ZLK A;  3O8H A;  3A03 A;  2KP6 A;  3ZP5 A;  1IRF A;  3AL0 B;  3VEP A;  2R7T A;  3I59 A;  4BXX J;  4AVZ A;  4F52 A;  2HPM A;  5E3O A;  4B09 A;  1MBK A;  2GOM A;  1T0F A;  1Q1H A;  3KYL A;  1QPM A;  2VJI A;  1MND A;  3RQ4 A;  2LBF A;  4HRI A;  2GIV A;  4I0A A;  1YW7 A;  4PXI A;  4G12 A;  1IXC A;  1DPR A;  3LSP A;  1RET A;  3LL7 A;  4B3X A;  4C3J J;  4QIW N;  4RAZ A;  2VOP A;  1TQP A;  4XM3 A;  3RIR A;  3G6E I;  5LEK A;  2IVM A;  2L5Q A;  2P6T A;  4AM3 A;  1JTX A;  4V2F A;  1WH5 A;  2ZFU A;  3G1L A;  2HZT A;  1FMW A;  2XRN A;  4EAT A;  1UZC A;  1Q1V A;  2PBI A;  1I39 A;  3HXL A;  2EIL H;  1HXD A;  2F2E A;  4QWQ A;  2VI6 A;  1DU6 A;  3BTJ A;  3LWF A;  5IY5 H;  3LA7 A;  4LMY A;  3GTJ J;  1TQM A;  1R7J A;  2E36 A;  1N77 A;  1E3O C;  2OC6 A;  3H5R A;  2YVE A;  3M9A A;  1ZQ3 P;  3F6O A;  1WJA A;  3FM3 A;  5ICC A;  4KIC A;  1RES A;  3ZQG A;  1EF4 A;  1S6L A;  2KRF A;  3IWF A;  3BCG A;  2QWT A;  3ASO H;  3I4P A;  4ITV A;  4DBR A;  2JA8 J;  1IN7 A;  2LVS A;  5CVJ A;  1VQ9 I;  2Y30 A;  3JCU C;  3S93 A;  4A3K J;  4Y4R A;  3ZCO A;  4OMY A;  4IF4 A;  3MAJ A;  3HSF A;  4E7H A;  1SFK A;  1S8N A;  2VKE A;  1QNT A;  3E6D A;  2M4G A;  4U87 A;  3WTT C;  3OOP A;  1QU3 A;  3A2K A;  2YPR A;  4RA2 A;  4X6A J;  4RAF A;  2XPU A;  2RHA A;  1R1T A;  2FOW A;  2HYJ A;  2CQK A;  2V6C A;  3BTL A;  4A5N A;  1UFM A;  3NAR A;  5FFZ A;  3SFZ A;  4RM3 A;  5E3L A;  4CXF A;  1O3R A;  2H8R A;  1E3H A;  1BC7 C;  2A6T A;  2FX0 A;  1YX3 A;  3MEX A;  4MQV A;  5F1J A;  2YUS A;  2QZ8 A;  2J5P A;  3NRG A;  4BE0 A;  3EUA A;  4HF1 A;  3NQO A;  4RLF A;  5HLG A;  1BI2 A;  2VJ5 A;  3GF2 A;  4KA4 A;  2P5K A;  4D1Q A;  2MD5 A;  1MSF C;  2M9H A;  2O8X A;  4HPQ A;  2MD0 A;  1KQ8 A;  5E17 F;  3IH3 A;  5D8L B;  2WAD A;  1AKH A;  3DWL E;  3VVX A;  3NRV A;  4EMS A;  1MNM C;  3TGN A;  3L9F A;  2NP5 A;  1H9T A;  2E1M B;  3I54 A;  1YJ9 I;  1F43 A;  4L0Z B;  1HDP A;  3HZJ A;  2KZG A;  4AF5 A;  5KCM A;  2P8T A;  5DUK A;  4HYE A;  3B6C A;  4D5F A;  3S32 A;  4RGU A;  3GZI A;  1MMD A;  2HOA A;  3H0G J;  2BGC A;  4ZZL A;  5EF6 A;  2LNB A;  3GXO A;  3CES A;  3OYC A;  3BR1 A;  3K4K A;  3TW6 A;  3HOX J;  3S2D J;  4MGR A;  4GDF A;  3FRQ A;  2IS4 A;  4XQF A;  4OWR B;  2BYV E;  4JP0 A;  4OAY A;  1A5J A;  1IXR C;  2DQL A;  4Y17 A;  2ICW G;  2IGM A;  2GM4 A;  1WJB A;  2QQA A;  1X58 A;  3CCR I;  1RR7 A;  2XRL A;  4M6V A;  3OYE A;  5F0C A;  2VAS A;  2KIM A;  3Q0W A;  2ZFW A;  2PZ9 A;  1BA5 A;  3JAM Z;  5F0H A;  2Z3Y A;  3DPU A;  2HKO A;  2VON A;  4L62 A;  2WC2 A;  2IS2 A;  4E7Z A;  3GYH X;  4XID A;  1VTN C;  4YFK F;  4MXM A;  1LFP A;  3H9Q A;  2RN7 A;  2RDP A;  3OYA A;  3L2Q A;  4ESB A;  1JT6 A;  1FOY A;  2HS5 A;  5DAJ A;  2DMQ A;  1FBS A;  2VL8 A;  2OV7 A;  1PYV A;  3OOU A;  2CUZ A;  5LBQ A;  1FYM A;  2NYX A;  2UXI A;  3ZN0 A;  1K78 A;  2R7U A;  4X1E A;  2XSJ C;  2PLY A;  4OOI A;  3BTI A;  1ETK A;  5CJ9 A;  2R7R A;  3ANG A;  3RZD J;  1MBH A;  4DIQ A;  2RQP A;  2HI3 A;  2KDO A;  2HVQ A;  1FP2 A;  1TNS A;  3FHZ A;  2LRD A;  4GYI A;  2JA5 J;  2L2O A;  1X3U A;  3JTH A;  2IGO A;  2X1D A;  3GUD A;  2IAI A;  3BOQ A;  4FET A;  2VIX A;  1IDY A;  3PSF A;  4LJZ F;  1MBE A;  4MEY F;  2JMW A;  3BG5 A;  1P9Q C;  4ANJ A;  3KZ9 A;  1H88 C;  3BT9 A;  4O3M A;  3QAH A;  2ECB A;  2LMD A;  2MSY A;  4A3I J;  2LH9 A;  3CDH A;  3VYU B;  1JE8 A;  3Q9S A;  4CGR A;  2DXI A;  3I4N J;  3PAS A;  2ZKZ A;  3IRQ A;  2K86 A;  2CFO A;  3EUK L;  2DG8 A;  2DA4 A;  4U88 A;  1REP C;  4MFE A;  4I2O A;  1MJ9 A;  4FE4 A;  2GA2 A;  1GLN A;  2FF4 A;  3DKY A;  4PSW A;  5BMZ A;  3HHH A;  4HKU A;  1XGS A;  3ONQ A;  3VOK A;  2RVC A;  1WFX A;  1DGW Y;  2Q2E B;  4ESF A;  3V8K A;  4ENM A;  3ZMV A;  1B9M A;  3HIM A;  2JN6 A;  4DVY P;  3GTL J;  2VC0 A;  2AO9 A;  4A93 J;  2OZ6 A;  2JUC A;  5KAI C;  4L9N A;  2ECC A;  4CIC A;  1SFO J;  2MG4 A;  2IXS A;  3GZN B;  4MEX F;  2IA0 A;  3BQY A;  4WIB A;  5HSZ A;  3DBH B;  3CCQ I;  2XV4 S;  2M2E A;  3HEF A;  2GIZ A;  2DCE A;  1O3S A;  4EJW A;  5JR3 A;  2ZNY A;  4TV7 A;  3W6K B;  4W1U A;  1DDN A;  3EUH C;  3E0J B;  3CCJ I;  1TZL A;  3BCB A;  1KU3 A;  2QBY B;  3G7R A;  4G7O F;  2AXT C;  1TL8 A;  2TRT A;  4FTH A;  5FB2 A;  3V7R A;  2HOS A;  4NDL A;  1X19 A;  1A35 A;  2ID6 A;  2ZOY A;  2NVU B;  5L3E A;  5D5X B;  3OL4 A;  3IL2 A;  3CMM A;  1W36 D;  2XAU A;  5HLI A;  3S8P A;  1VI0 A;  3H9J A;  2H6C A;  3RJP A;  1OPC A;  1HW2 A;  2DFI A;  4I09 A;  1FBU A;  4OIO F;  1BJZ A;  1I5Z A;  1UST A;  1XMX A;  5IP6 A;  3JSO A;  4A12 A;  1APL C;  3GX4 X;  1LDK B;  2CUE A;  4I02 A;  4A2U A;  3A01 B;  3E6C C;  1X1B A;  2V1X A;  5F08 A;  1YG2 A;  2W25 A;  2GUH A;  4RAY A;  3H35 A;  3BZ6 A;  2G9W A;  3IH2 A;  1K79 A;  3S1M J;  2VKH A;  4JX4 A;  4RMN A;  1DQU A;  4G7H F;  2DT7 B;  5HLT A;  1TW2 A;  1IN4 A;  2IJL A;  5BPD A;  5IYD J;  3MQ0 A;  3CQZ J;  4EJU A;  3GLL A;  4N9I A;  4BYY A;  1MMN A;  1GUU A;  4BY7 J;  2UUZ A;  5JFR A;  2KJC A;  1OCZ H;  1J0R A;  2OU2 A;  3J7Y J;  5FFX A;  1BI3 A;  4XRS A;  3CTA A;  1Y39 A;  3X2Q H;  1R22 A;  4BDY A;  3HOZ J;  3E6M A;  3QOD A;  3LFK A;  3ZMT A;  2VN2 A;  1YRN B;  3UNG C;  4IJA A;  5FRM A;  4I7H A;  4XBF A;  1N75 A;  5TRD A;  4E7J A;  2HVR A;  3OSG A;  1U2W A;  2BHZ A;  2KMU A;  2QEN A;  1NTC A;  3BY6 A;  2GLO A;  1POG A;  5F04 A;  3QWL A;  4QPQ A;  3BRU A;  2QKO A;  1V5G A;  2LP0 A;  5ICF A;  6PAX A;  1EH7 A;  2DMP A;  1D0X A;  2A6E F;  4WXH A;  1RUN A;  4HQE A;  5LFA A;  2Y69 H;  2F4I A;  2K3F A;  3GTO J;  3E5U A;  4KWA A;  1ZK8 A;  2IA1 A;  1IJW C;  2JZY A;  2GOX B;  2LLK A;  3EDP A;  1BI1 A;  4FX0 A;  5J1Y A;  2W53 A;  1R71 A;  4HNT A;  5K1Y A;  2ME6 A;  1ITY A;  3CJT B;  1IV6 A;  2ZCM A;  3KYD B;  2AHQ A;  2UXN A;  5C4Y A;  1B72 B;  5FRO A;  2F5E A;  3CRJ A;  4ICH A;  3CJD A;  1WQ2 A;  1A6I A;  2G7S A;  4MTD A;  3SJM A;  5FHP A;  3L2U A;  5JHF A;  1KU7 A;  2FML A;  3O3K A;  1YX5 A;  1WSU A;  3WU1 B;  1H9G A;  2IRF G;  2UXX A;  2V1U A;  3SZT A;  4IRI A;  2MH2 A;  3KP3 A;  2DOF A;  4WX9 A;  2K85 A;  1B59 A;  1XPX A;  3CDI A;  1WJE A;  1NG6 A;  5M5X J;  3HL2 A;  3OYI A;  1D1B A;  2LY1 A;  3ZQH A;  1H8A C;  2DMT A;  4ACI A;  4GCL A;  5ILS A;  1W7P A;  2YSR A;  3VDX A;  3JR9 A;  3CC2 I;  3QPT A;  2Y31 A;  2JT1 A;  3DBL B;  5FJ8 J;  4ZYH A;  3OYJ A;  2Y48 A;  3RSN A;  2GXG A;  2V57 A;  2CUF A;  4U9N A;  2DN0 A;  4JNN A;  2LOO A;  2OJE D;  4IRG A;  3AG3 H;  4U0Y A;  3GTM J;  4L9J A;  2VE8 A;  4D7N A;  4P9F A;  2IGN A;  2GBY A;  4OIQ F;  1XGO A;  1D0Y A;  5F6F A;  3ZQC A;  2JWT A;  2GFN A;  2E1O A;  2ZB9 A;  3C7J A;  1XTA A;  2LYC A;  1BL0 A;  4BQA A;  3FBN B;  3R0J A;  3N97 A;  4B43 A;  1R5H A;  4XLP F;  2X1E A;  1HKT A;  3C18 A;  2QLZ A;  4HDU A;  1ZAR A;  1WZ2 A;  3B02 A;  1XSV A;  2YX7 A;  3ZXS A;  5B5E C;  1IAW A;  1W0T A;  3RZO J;  2NAZ A;  2K40 A;  3IUO A;  4D5C A;  1IW7 F;  2Q2E A;  1YI2 I;  1E17 A;  4NEL A;  2O03 A;  4HF2 A;  1BR1 A;  2JPC A;  3HSR A;  3I56 I;  2XGC A;  1QHH D;  3C2B A;  1S29 A;  2MLG A;  3D5L A;  3MFK A;  2VXZ A;  2RAE A;  4IKF A;  2XB0 X;  2LTP A;  2EZK A;  1I6X A;  4Y7N J;  4ZYG A;  1X1P A;  1ZAO A;  5H6Q A;  2OPT A;  2A61 A;  1PDN C;  3O6B B;  1VQ5 I;  2DU9 A;  4RGX A;  5LGT A;  2WAQ A;  1Z21 A;  1I1G A;  4YIR X;  2HYT A;  2GXA A;  5HDG A;  4MO7 A;  2V1D A;  1B1B A;  1XD7 A;  2Z5U A;  4NC6 A;  2B63 J;  1U6G A;  3JW4 A;  5H6R A;  2M7B A;  2X1C A;  2QBY A;  2HYG D;  4WXC A;  4JYK A;  4HST A;  3W2V A;  3RKX A;  2CW7 A;  1Z9C A;  4Z2Y A;  1XDU A;  2F5F A;  4PCQ A;  4U7B A;  1VQM I;  1JJ8 C;  5AON A;  1P2F A;  1Z05 A;  2CO5 A;  4V2G A;  4WWC A;  5FO5 A;  5JHU A;  2GWR A;  3F0C A;  1P4X A;  3K2Z A;  4LFU A;  2R7Q A;  4M3E A;  2P5L C;  3QYF A;  2DA5 A;  1AA7 A;  4HA8 A;  5D8K B;  2WUI A;  4ON0 A;  3FIS A;  1X3W B;  3KEQ A;  1Y8R B;  3UKG A;  2X0L A;  4NHJ A;  2CWE A;  2LKP A;  2ZJQ F;  4C30 A;  3M1E A;  5EJC A;  2KRC A;  4N4O B;  3ELK A;  5TGT A;  3A01 A;  5CKT A;  2QKL B;  2QWW A;  1EKE A;  2BBY A;  3VW1 A;  1VF9 A;  1FMV A;  2BY2 A;  4RS8 A;  2EPF A;  2EZH A;  4OU0 A;  1S7E A;  3O60 A;  2QVO A;  2JUG A;  2I8D A;  1V5E A;  1QPI A;  3SDB A;  4M9S A;  4P5O A;  2FXA A;  3MKZ A;  2UZK A;  3RQI A;  2WB1 A;  1OCR H;  3QYE A;  3E1S A;  4XLE A;  2FJ1 A;  2NVT J;  3HPG A;  2BW3 B;  3B6A A;  2K7L A;  5F0F A;  2M1B A;  2KZV A;  1SVM A;  1OYW A;  1T95 A;  3EPZ A;  1R9T J;  2XB5 A;  3VYS B;  2HQN A;  4AVP A;  4NC7 A;  2BY1 A;  5IOZ A;  2EFW A;  1H89 C;  2DT6 A;  2E1C A;  1JGS A;  3KZI C;  3K4C A;  4Y15 A;  5E3N A;  3QKX A;  1LVK A;  1S7A A;  2L54 A;  5CVU A;  3CCU I;  1Y8Q B;  2G7G A;  2O3F A;  1WI3 A;  2RNG A;  1O3T A;  1OKR A;  2FUG 2;  3ZMS A;  2FBH A;  2FQ4 A;  2ZXI A;  2LD5 A;  1BW6 A;  1X4P A;  3CLQ A;  3HGY A;  4N9H A;  5LLQ A;  4IO9 F;  1KYW A;  1RR8 C;  2ZCW A;  2Z99 A;  1OCO H;  2NS0 A;  4B44 A;  2LKX A;  4C3I J;  3REO A;  3QOE A;  1W5T A;  1XSD A;  2IGK A;  2PEX A;  2UXO A;  2VT3 A;  4DNC A;  3K1N A;  5D18 A;  1R4M B;  1K4S A;  1UI6 A;  1S3J A;  2XRO A;  1UHS A;  2FBK A;  2VBX A;  5LRS A;  3VYR B;  3U9G A;  1FY7 A;  1OLT A;  1XN7 A;  3FK7 A;  1VFC A;  1OR7 A;  1B72 A;  2C6Y A;  3LA2 A;  3TOA A;  1L0O C;  3I64 A;  4D9J A;  4DYQ A;  1W7P D;  1OMI A;  4ZYA A;  3LMM A;  3CLO A;  1SAX A;  4IRV A;  3ZGK A;  1DP7 P;  2D1H A;  3SEQ A;  2QM3 A;  3RKY A;  3WGG A;  2E2I J;  4A3B J;  5FKN A;  3S2W A;  1K61 A;  4A3D J;  4AIH A;  2JK3 A;  1I3Q J;  2XSD C;  2O9L A;  5DDG A;  2CRG A;  2MLK A;  3L09 A;  4XN3 A;  4DYR A;  4NQW B;  4A3L J;  3Q9V A;  2GZW A;  3PO3 J;  2NP3 A;  4PFP A;  1OCC H;  2A5Y B;  3JSJ A;  1SD6 A;  3K4B A;  2K9Q A;  2HZD A;  3OIQ A;  1OFC X;  4A0Z A;  3L2V A;  5EZG A;  2BZT A;  3OYN A;  5J4Y A;  4FHT A;  4DZP A;  1PP8 F;  5DD8 A;  1D8J A;  5B1B H;  4BUP A;  4PGG A;  5HS8 A;  3P9K A;  2V9P A;  3NEU A;  5D4R A;  1FYK A;  1MBJ A;  1XGM A;  3DTK A;  3FDY A;  3CP8 A;  4UUS B;  2ZY9 A;  2KJB A;  4AU7 A;  2R7S A;  3DPJ A;  2EK5 A;  3BG6 A;  1LNW A;  3OYF A;  1JKO C;  3LSM A;  2M34 A;  3I4M J;  1E0E A;  1W1W E;  2L9R A;  4DGW B;  3ZPL A;  5EG0 B;  2X6O A;  5DUI A;  5LEJ A;  4EV0 A;  3ABU A;  1IO2 A;  5J4V A;  5KHD A;  2K02 A;  2L7F P;  2H94 A;  1WJ5 A;  4JKZ A;  2F4O B;  4XRM A;  2XAQ A;  2A6H F;  2XAS A;  2EFP A;  1GT0 C;  4HDV A;  3TQN A;  2EQR A;  1D5V A;  2DMU A;  5TIS C;  3ABM H;  2KIQ A;  3WU0 A;  1Y56 A;  3OIO A;  2ZC2 A;  3NPI A;  3V42 A;  1R23 A;  5L3F A;  1EV7 A;  2LR8 A;  2EV5 A;  1J09 A;  3GME A;  3KFW X;  4G6D A;  3TDU C;  3V7S A;  4F3Q A;  2D6Y A;  3RYR A;  2W85 A;  2LY2 A;  3BJA A;  3HOV J;  3K0L A;  3LFU A;  2K4J A;  5KK1 A;  5K58 A;  3BR0 A;  4IL6 C;  4LLG F;  2JQ7 A;  3RPQ A;  3F6V A;  2Z16 A;  4A6E A;  1KGS A;  2E34 A;  3KKC A;  3G1M A;  1G2H A;  2PJR B;  1KA8 A;  3K69 A;  3FXR A;  3CME I;  3GTQ J;  3PPB A;  3HB9 A;  3L2C A;  2CQ7 A;  3HRT A;  2DFE A;  1P4W A;  1XGN A;  2CS3 A;  4IEJ A;  3CCE I;  4PDK A;  2DA2 A;  2FOK A;  2VC1 A;  3MZY A;  2VQL A;  1FYL A;  4P96 A;  1RUO A;  1ZHF A;  3GVA A;  3OV8 A;  1T2K A;  5FD6 A;  2COM A;  3LNQ A;  5B3S H;  5EDN A;  4G94 A;  2VQC A;  2X48 A;  1U0J A;  4U9L A;  4N0B A;  1TBX A;  4A3J J;  1FWZ A;  3QYB A;  3RD3 A;  5H2F C;  3A02 A;  1D3Y A;  2WAF A;  1STZ A;  3IKT A;  2I5U A;  3FK6 A;  2WY8 Q;  3E5Q A;  3HHG A;  1Z6R A;  4XLF A;  2P0W A;  5IYB J;  3M4O J;  3G1O A;  1TTY A;  3D5S C;  1S72 I;  2DI3 A;  2ZJ2 A;  4G9Y A;  4H0E A;  1VQ4 I;  5HNH A;  1W5C C;  3T8T A;  1UB9 A;  1SVO A;  3PL8 A;  1V5F A;  5B66 C;  3BHQ A;  3MD2 A;  3PQJ A;  3OMY A;  2ISZ A;  3KP2 A;  4A5M A;  3HJE A;  4CCO A;  1PP7 U;  4ZJZ A;  3F72 A;  1TWH J;  4UVB A;  3QPL A;  3HOT A;  2H1K A;  2WAQ N;  4L5J A;  4YFX F;  1QZE A;  2JJ7 A;  3LST A;  1UMQ A;  5CQE A;  1IUY A;  2F48 A;  4JK1 X;  2R7D A;  2BW3 A;  4GYG A;  3R0A A;  4HV6 A;  1QVU A;  2B3W A;  5LRR A;  2OUM A;  5H20 A;  4HX8 A;  1DP3 A;  4KNY A;  4A3G J;  1BI0 A;  3JRD A;  2R3S A;  4XRF A;  1QVT A;  2UV1 A;  3FXL A;  4IHX A;  2LY9 A;  3JSP A;  3P9I A;  4CCM A;  2VPR A;  2V9V A;  3K9T A;  5FKL A;  2X9D A;  4V19 K;  4EM2 A;  1ZH5 A;  1ZKG A;  3I9V 2;  3HOU J;  2FNP A;  3VB2 A;  3DF8 A;  3BR6 A;  3TMO A;  1HST A;  1IN8 A;  1R36 A;  5E1W A;  2V6E A;  3ON2 A;  4P1W A;  3JRE A;  4UY8 I;  3H3V K;  4BL0 B;  1BOA A;  2DG7 A;  4ETS A;  2HOE A;  3JRC A;  4GFB A;  3WTW C;  3LHQ A;  2EV6 A;  1A6Q A;  4G7Z F;  4YII A;  2A5W A;  1HSJ A;  5LHI A;  4JOM A;  3TO7 A;  3MCZ A;  3S15 J;  1X2N A;  1YS6 A;  2TDX A;  2WB1 N;  3CO7 C;  2YX4 A;  3LQQ A;  1KU2 A;  2LDU A;  3TKY A;  4LG3 A;  2K4B A;  2PQ8 A;  4XR6 A;  3GEU A;  3ANP A;  2M8G X;  3BR5 A;  2BEO A;  3ZN1 A;  1ZYR F;  4PJN A;  3BR2 A;  3E5X A;  4A3F J;  2ACJ A;  2FBI A;  1BOB A;  2PX9 A;  2MA3 A;  2JVH A;  4CSW A;  3W2W A;  4IRH A;  1TLH B;  4NQW A;  5D19 A;  3Q0U A;  2EFQ A;  1GVJ A;  3ABK H;  4A69 C;  4ENN A;  1DU0 A;  3OS0 A;  5CVI A;  1ACI A;  4NB5 A;  4QPO A;  3ON4 A;  1W7P B;  1WJC A;  4RGS A;  1EJ9 A;  2PBX A;  1RPW A;  1I6H J;  1G4D A;  3HIF A;  3S14 J;  3OL3 A;  2JA7 J;  3H5A A;  4Q4Z F;  4LB6 B;  2NVY J;  1MMA A;  2L9S A;  3NWT A;  4CDG A;  2DBB A;  3F1B A;  3WTY C;  2HR3 A;  2L01 A;  2L9V A;  3HDD A;  3Q0V A;  4UUS A;  2EA4 A;  3DPT A;  1XCV A;  5FD5 A;  2ZJP F;  1AHD P;  1PUF B;  1XSX A;  2NOJ B;  1OQY A;  3C1D A;  4E7S A;  2XPW A;  3HOS A;  4ZDL A;  3V8J A;  1SGM A;  1FSH A;  4EM0 B;  2E2H J;  5EG0 A;  3WG9 A;  3KX2 A;  4CHU A;  4MTE A;  1IRG A;  2CG4 A;  1FTT A;  3O2P E;  4Z6Y A;  5M3M J;  2F5V A;  4CZZ A;  3CF5 F;  5FKM A;  5A2Q K;  1UHM A;  3JRI A;  1YIT I;  2PMZ A;  1TP4 A;  2K5C A;  1AU7 A;  2VB6 A;  2DTZ A;  2KLO A;  1YS7 A;  4XKB A;  4YEL A;  1TWA J;  5H9T A;  3CMY A;  3LA3 A;  3QU6 A;  3KZZ A;  5BQT A;  3OYM A;  1LJ9 A;  3HTS B;  4IVN A;  3TDZ C;  4PJ0 C;  3SEZ A;  2LRE A;  3GCM A;  5FLX K;  2J5O A;  3C3W A;  5CPR B;  4E70 A;  3LSG A;  3F8F A;  3EUH A;  2ZSH B;  4A0X A;  3F8C A;  2WBM A;  5BS6 A;  1SFX A;  2LG4 A;  2PJR A;  1WPK A;  4PK4 A;  1TT5 B;  3HBL A;  2EV0 A;  4LK1 F;  4HV5 A;  3SYT A;  1IXS B;  3VSL A;  2QTQ A;  2OQG A;  4BBS J;  2BVM A;  2PFV A;  1WH7 A;  2K9N A;  5J3L A;  2DOE A;  2A05 A;  1ULY A;  3I53 A;  5D4S A;  2XDV A;  1R1V A;  3GEZ A;  1HF0 A;  4BU2 A;  3BRO A;  2BOL A;  4IHT A;  2PI0 A;  3SZP A;  2PJP A;  1P4A A;  5AIQ A;  5E20 A;  1GHC A;  2ID3 A;  2EFN A;  3UR3 C;  3QQA A;  3CWR A;  2LF8 A;  5C4X J;  4F92 B;  2EJR A;  1OJL A;  1A31 A;  4JL3 A;  2L3D A;  1Y0N A;  2G0E A;  3KNW A;  3U1D A;  3FIW A;  1U8R A;  1G3S A;  3V6G A;  3TP0 A;  4B1R A;  2OD5 A;  3PNY A;  1T98 A;  2OAZ A;  2NOG A;  2R7X A;  3RPU A;  1Y6I A;  2DJI A;  2UXU A;  4Y13 A;  1LQ1 A;  1RC9 A;  2IPQ X;  4GRI A;  2OTJ I;  2W00 A;  3CUO A;  5DV5 A;  2Q8K A;  5C3E J;  4UUV A;  2RKH A;  4D0P A;  3SWH A;  3KIO A;  1IZ1 A;  2CU7 A;  4KIF A;  3T5X A;  2IEK A;  3G56 A;  3KPH A;  1X3Z B;  1T39 A;  2MBF A;  3H0D A;  2XC7 A;  1X1D A;  2E1N A;  4J01 A;  1HW1 A;  3WGH A;  5E1X A;  2LSO A;  1PVE A;  3K4L A;  5FGM A;  1DUX C;  1Z6T A;  2DO7 A;  2JVG A;  3LAP A;  3COL A;  5JI6 A;  4CYC B;  3F8B A;  2RV8 A;  2QYO A;  4MFD A;  1NK2 P;  5IOY A;  4YG2 F;  4DW6 A;  4R1H A;  1OYI A;  1FSE A;  1G6N A;  1QQI A;  3M8J A;  1I1S A;  4RB1 A;  1QRY A;  3ERM A;  2O6G E;  1U5T C;  3J81 Z;  3HRS A;  2AXL A;  3GTK J;  2CJJ A;  2GEN A;  3CDL A;  3K70 C;  4PUS A;  1YW8 A;  2KIF A;  2VT2 A;  2ELJ A;  4XON A;  1OIS A;  2WY7 Q;  4M71 A;  3K1P A;  4XKW A;  1MBG A;  3SXY A;  5DM7 F;  2ZCX A;  5HDK A;  3LSR A;  4HX7 A;  2QEX I;  3GFI A;  2IS6 A;  3RCO A;  2WWY A;  3KYC B;  4AIJ A;  4WF2 A;  4I6Z A;  5DEQ A;  3OR1 C;  4MQ9 F;  3DCF A;  3NAU A;  1BN5 A;  1RZ4 A;  4S0H B;  4OAZ A;  4ESJ A;  4L0Y B;  2ZCN A;  2XDN A;  2O61 A;  3E7Q A;  3Q5F A;  2ME0 A;  4F7Z A;  2EFO A;  2HNH A;  4KN7 X;  1WRJ A;  2DA3 A;  4UUT A;  3LQR A;  2H27 A;  4AWX B;  4OIN F;  3OS1 A;  4AIK A;  1MD0 A;  4HX4 A;  3VWB A;  4A3C J;  4EJO A;  1VQ7 I;  1O57 A;  2HQ5 A;  3PM1 A;  3D5R C;  4XKV A;  2O7O A;  2W57 A;  4IQ4 A;  1FOK A;  2ESN A;  1XG1 A;  2YS9 A;  3G4S I;  3HRU A;  4FCY A;  1ETO A;  2FQ3 A;  1MNE A;  2X85 A;  1TW3 A;  5EYR A;  2Z1D A;  2Y0S A;  2BVL A;  5GPA A;  3WOD F;  1ZGW A;  2XF7 A;  4MLO A;  5D6F A;  2M0C A;  4KYW A;  1HCR A;  5C44 J;  4YIF A;  2D2W A;  4S05 A;  2KPM A;  3T1B A;  4RGR A;  4E7I A;  1K83 J;  4Q5S F;  3MZH A;  3AFH A;  4CGZ A;  2VKV A;  5K5O A;  1TC3 C;  3I0T A;  2R93 J;  2Y9Y A;  2A3S A;  2AQF A;  3BTC A;  3VFZ A;  3QP5 A;  5IT9 K;  5DCF A;  2VPL A;  2QIB A;  2P7V B;  2MAB A;  4NBQ A;  3V4G A;  3ZR8 X;  1VQL I;  1ZR2 A;  4LB5 A;  1JUM A;  1JKP C;  2CFX A;  2DDB A;  5K5R A;  3BDD A;  9ANT A;  1PUF A;  4U0V A;  2MGQ A;  1YHQ I;  2B1E A;  1R00 A;  2REK A;  2XGX A;  4A0Y A;  2R5Y A;  1XS9 A;  4QTR A;  4KT6 A;  4IX7 A;  3VW0 A;  3AG2 H;  3M1C A;  4EM1 A;  2P4W A;  3BG7 A;  2CV1 A;  1FIP A;  5K7Z A;  3IH4 A;  5JVT A;  1BIA A;  1VZ0 A;  2ZME C;  2WA0 A;  2BV6 A;  2R0Q C;  1HW5 A;  4N4N B;  4HBL A;  2DJN A;  3C07 A;  1R1U A;  3GTG J;  4OD4 A;  1TT0 A;  2V1N A;  2ZSI B;  3ESW B;  4UB8 C;  1H0M A;  3G71 I;  4M3B A;  4BGD A;  4HLX A;  2L7M P;  3KLO A;  2PMH A;  4KJZ A;  1ERD A;  1S9H A;  4LLL A;  3LSH A;  3PNV A;  5ICE A;  2STW A;  1U9O A;  3F23 A;  2EZL A;  3DU6 A;  3FXJ A;  4YEJ A;  3RTR A;  1FJL A;  2KL4 A;  2D5V A;  1JKQ C;  3H3Z A;  5DYM A;  5E8G A;  5D5U B;  1FLI A;  1VQ6 I;  2LFB A;  4M3D A;  2EIK H;  2ZXJ A;  4S04 A;  1HKS A;  3C2G A;  5M5W J;  3RPU D;  3ZQI A;  2QCO A;  1YOV B;  2XUB A;  1HLV A;  2JPB A;  3S3O A;  2E35 A;  1JUP A;  2GA1 A;  3K6G A;  3TP3 A;  2X6Y A;  1SMY F;  2CW0 F;  5L3G A;  2LK2 A;  3K4J A;  3DP7 A;  2M4K A;  2KHM A;  2RAS A;  2EBI A;  2AQE A;  3BR3 A;  4KIT B;  3J80 K;  2P5V A;  2PMU A;  2V79 A;  2PMZ N;  3CP2 A;  2A07 F;  3LWJ A;  3P9T A;  3N4M A;  1E2X A;  2STT A;  5GAH J;  5B1A H;  1B8I B;  5J40 A;  4LD5 A;  1LE8 B;  1ZG1 A;  4PJL A;  2R7V A;  3VW2 A;  5LGU A;  3E97 A;  3OYH A;  4GGG A;  1FT9 A;  4Y33 A;  1GDT A;  2Q0O A;  3MMY B;  2XKO A;  2NNN A;  2X4H A;  5J8C A;  3DEE A;  1G8X A;  1BW5 A;  2FEZ A;  2I10 A;  3IP4 B;  4M73 A;  1YFH A;  2IW5 A;  3DQV C;  4CA0 A;  1W4M A;  1Z0X A;  1VQN I;  4Q48 A;  3DU5 A;  2FJI 1;  3E6B A;  4F91 B;  3F8N A;  4WK8 F;  4E7K A;  3WG7 H;  4O5V A;  5E8I A;  1O4X A;  3IAS 2;  1X1A A;  4CO8 A;  4C9Y A;  4CYC A;  2E5N A;  2KDZ A;  4HG2 A;  5ILU A;  5J1U A;  3V78 A;  5HBU A;  2QF7 A;  2R7W A;  3WTZ A;  4HQM A;  1JXS A;  2FE3 A;  2NXN B;  5J8F A;  4G6T B;  5IT3 A;  3QPS A;  4ZYE A;  4M74 A;  1UG2 A;  3ABT A;  3CUQ C;  2O7T A;  3PSI A;  3B81 A;  5DCM B;  4FT8 A;  1ETW A;  4XLH A;  4FAS D;  3IAM 2;  2WV1 A;  3PUB A;  1QA6 A;  3AKZ A;  2JSC A;  4BS9 A;  5KAF C;  1F4K A;  2QA4 I;  1RI7 A;  2OF7 A;  3CO6 C;  2DAO A;  4M9X A;  4BJ6 C;  4IZZ A;  4HLY A;  2R7Z J;  1MJA A;  3F8M A;  3NWS A;  3K1M A;  4PJJ A;  2XF6 A;  4CYD A;  3BPV A;  4B48 A;  2XIG A;  3NI7 A;  4XKC A;  2A68 F;  3DFG A;  3D0S A;  3GBG A;  3VUQ A;  5C4J J;  3FMS A;  2HTS A;  1R49 A;  3R60 A;  2W84 A;  2WV0 A;  2Y0M A;  1NH3 A;  2M45 A;  4OMZ A;  4HOB A;  1LEA A;  1KU9 A;  3G2B A;  2W24 A;  4XMY A;  3H5N A;  4CCK A;  2BY3 A;  2KRH A;  2X6W A;  1USS A;  2DDA A;  5F64 A;  4KN4 X;  4G8X A;  3U2R A;  3BJB A;  3OR2 C;  2VBY A;  4XSZ F;  3WHC A;  1JTY A;  1ETY A;  3GTP J;  1Y1V J;  2ZXW H;  5DTD A;  1YIJ I;  1LFU P;  5GP9 A;  2CSO A;  3WTS C;  4IHY A;  5DM6 F;  5GAD J;  3S3M A;  3JRH A;  1ETV A;  3RH2 A;  1XMK A;  4AD9 A;  3K4N A;  3T0Y A;  5EEA A;  1IC8 A;  2QSG X;  4XK4 A;  4BJT A;  4BXU A;  4U0W A;  1M1E B;  1V54 H;  5L3C A;  2CQX A;  5J1R A;  1N78 A;  3R4K A;  3ZRG A;  5JLX A;  1T8I A;  2X51 A;  3JRB A;  3VSK A;  5AQC A;  3OYG A;  1FTZ A;  5EZH A;  4JBA A;  4UDS A;  3KZY A;  3KLN A;  2WTE A;  3DEU A; 
#chains in the Genus database with same CATH homology
 1VI0 A;  3HOU J;  1D5Y A;  3M3Y J;  3BR6 A;  1FEX A;  3PO2 J;  1BJZ A;  5IP6 A;  3ON2 A;  5M5Y J;  1APL C;  3JRE A;  5EGO A;  3S1R J;  1NK3 P;  2CUE A;  5CXI A;  3A01 B;  3H3V K;  2DG7 A;  3D1N I;  5F08 A;  3AQS A;  3MKL A;  2GUH A;  3JRC A;  1GV2 A;  4GFB A;  3LHQ A;  3IH2 A;  2HDD A;  3HM5 A;  4M3F A;  3S1M J;  4QSH A;  4JX4 A;  4ME9 A;  4W97 A;  3E7L A;  2L0K A;  3S15 J;  5IYD J;  3SFI A;  3CQZ J;  1X2N A;  2WB1 N;  5K7H A;  1GUU A;  4BY7 J;  3GEU A;  4XRS A;  3ANP A;  1OCP A;  2Q24 A;  2M8G X;  3BR5 A;  3T6N A;  2E19 A;  4FIS A;  1T56 A;  4A3F J;  1JT0 A;  3BR2 A;  3HOZ J;  2TCT A;  2O8K A;  2ELK A;  5D19 A;  3Q0U A;  1DU0 A;  4A69 C;  1YRN B;  3HTA A;  3VPR A;  1F36 A;  3ON4 A;  1IGN A;  4L5E A;  2R5Z A;  3O8G A;  3OSG A;  2PBX A;  1RPW A;  1I6H J;  3S14 J;  5FGL A;  2JA7 J;  3EGQ A;  2MW8 A;  2NVY J;  1NTC A;  2GLO A;  1POG A;  5F04 A;  4RDU A;  2F07 A;  3F1B A;  3BRU A;  2QKO A;  3TED A;  2LP0 A;  2DMP A;  4D7M A;  2N8G A;  3HDD A;  3Q0V A;  4UUS A;  1AHD P;  4IHW A;  3ZQF A;  1PUF B;  2HXI A;  3GTO J;  4KWA A;  1ZK8 A;  1IJW C;  2XPW A;  2LLK A;  1SGM A;  1MH4 A;  2VUM J;  5J1Y A;  2W53 A;  2ME6 A;  2E2H J;  1ITY A;  5EG0 A;  1IV6 A;  2ZCM A;  2YVH A;  2JA6 J;  2AHQ A;  1IUF A;  1FIA A;  1RKW A;  4AC0 A;  1FTT A;  3W6V A;  5C4Y A;  1B72 B;  5M3M J;  2WGB A;  3K7A J;  5FKM A;  3JRI A;  3CRJ A;  4ICH A;  5GPC A;  4BKX A;  1A6I A;  1B8I A;  1AU7 A;  2CQQ A;  2G7S A;  2G7L A;  3SJM A;  5FHP A;  2DTZ A;  4A3M J;  1LE8 A;  1LFB A;  3LOC A;  3K2A A;  1TWA J;  3S16 J;  1AKH B;  3CMY A;  2ZOZ A;  5H9T A;  1WGX A;  2EZI A;  2Y2Z A;  2L7Z A;  3S5R A;  2NS8 A;  1YRN A;  4BY1 J;  5M5X J;  3S2H J;  3WHB A;  1IDZ A;  1ZTR A;  3ZQH A;  1H8A C;  3LSG A;  2DMT A;  2XGD A;  4ACI A;  4GCL A;  3JR9 A;  2NS7 A;  2Y31 A;  5FJ8 J;  3VP5 A;  1ETQ A;  1WPK A;  3HBL A;  1Z77 A;  2V57 A;  2CUF A;  2QTQ A;  2DN0 A;  4BBS J;  4JNN A;  1WH7 A;  2K9N A;  5J3L A;  3GTM J;  3LJL A;  3HTI A;  5FKK A;  4D7N A;  1ENH A;  1MSE C;  2GBY A;  2Y9Z A;  3HTH A;  1HF0 A;  4B3A A;  3ZQC A;  3FKI J;  2JWT A;  2GFN A;  3MN2 A;  1VND A;  3S1N J;  2E1O A;  2ZB9 A;  4C3H J;  2ID3 A;  3JRF A;  3CWR A;  3QQA A;  1BL0 A;  5C4X J;  4MIM A;  1OJL A;  2QOP A;  4JL3 A;  2G0E A;  3KNW A;  1HOM A;  4B4C A;  3FIW A;  3V6G A;  1TWC J;  3TP0 A;  4B1R A;  2NOG A;  3S17 J;  2HOT A;  1W0T A;  3L1P A;  3RZO J;  3Q3S A;  2K40 A;  2UXU A;  5BNG A;  4D5C A;  4LOC A;  4EEF G;  5IYC J;  5C3E J;  4C2M J;  1XC5 A;  3BQZ A;  2FBQ A;  5F27 A;  4HNV A;  4NEL A;  2OER A;  2CU7 A;  2IBD A;  2HXO A;  2XGC A;  1T33 A;  3LSJ A;  2IEK A;  3C2B A;  1Y1W J;  3G56 A;  2DA1 A;  3QBM A;  2RAE A;  2XB0 X;  2COB A;  2LTP A;  2EZK A;  4Y7N J;  1U9N A;  4XIC A;  2OPT A;  3VVY A;  4IHV A;  3COL A;  1MBF A;  4CYC B;  4MFD A;  2HYT A;  1JGG A;  1NK2 P;  5IOY A;  4DW6 A;  4MO7 A;  3NNR A;  2Y0S N;  2B63 J;  2K9S A;  4GFL A;  2IU5 A;  1P7I A;  3O8H A;  4JYK A;  3A03 A;  1QRY A;  1JJ8 C;  3GTK J;  1SAN A;  2G3B A;  2CJJ A;  2R92 J;  4V2G A;  4BXX J;  2GEN A;  3CDL A;  3F0C A;  4AUX A;  4BBR J;  5E3O A;  1MBK A;  2KT0 A;  4M3E A;  2DA5 A;  1MBG A;  2ZCX A;  3LSR A;  4PXI A;  2WUI A;  4G12 A;  3FIS A;  3LSP A;  3VVZ A;  1RET A;  4C3J J;  4QIW N;  4I6Z A;  3UKG A;  3DCF A;  3NAU A;  4S0H B;  2ZCN A;  2W48 A;  1JTX A;  2XDN A;  4V2F A;  3E7Q A;  1WH5 A;  3G1L A;  2ME0 A;  3A01 A;  3KKD A;  2YU9 J;  1Q1V A;  3VW1 A;  2DA3 A;  4UUT A;  2DA7 A;  1VF9 A;  3MVP A;  2VI6 A;  1DU6 A;  2EZH A;  3BTJ A;  3NXC A;  1S7E A;  2R5Y B;  4A3C J;  3GTJ J;  3O60 A;  2HQ5 A;  3PM1 A;  1E3O C;  2YVE A;  1QPI A;  2O7O A;  5FKO A;  1ZQ3 P;  1IG7 A;  4FE7 A;  1XG1 A;  2YS9 A;  3RQI A;  1ORK A;  3S1Q J;  3BNI A;  4FCY A;  1ETO A;  1RES A;  3ZQG A;  1EF4 A;  2FJ1 A;  2NVT J;  5EYR A;  3B6A A;  5F0F A;  2P81 A;  5GPA A;  3CCY A;  3BCG A;  1P7J A;  1ZGW A;  4MLO A;  2QWT A;  1R9T J;  2XB5 A;  2M0C A;  5IOZ A;  3JRA A;  1H89 C;  4GCT A;  3HTJ A;  1HCR A;  5C44 J;  4DYC A;  5E3N A;  2JA8 J;  3QKX A;  4MK6 A;  2LVS A;  2Y30 A;  3AQT A;  1K83 J;  4A3K J;  5EFY A;  5FLV A;  2VKV A;  2G7G A;  5D1R A;  1WI3 A;  4XRS G;  1TC3 C;  2FQ4 A;  2LD5 A;  1BW6 A;  2R93 J;  1ETX A;  2VKE A;  2Y9Y A;  4ABZ A;  3BTC A;  3HGY A;  2QIB A;  1ZR2 A;  4X6A J;  1JUM A;  1JKP C;  2LKX A;  4C3I J;  2XPU A;  5EGO B;  5CXG A;  2RHA A;  2HYJ A;  2UXO A;  9ANT A;  1PUF A;  1JUS A;  3BTL A;  3IUV A;  2MGQ A;  3NAR A;  5D18 A;  2REK A;  5E3L A;  5K7F A;  2H8R A;  1UI6 A;  3VIB A;  2R5Y A;  1XS9 A;  1UHS A;  2FX0 A;  4QTR A;  5FMP A;  3VW0 A;  3FK7 A;  2XPV A;  5F1J A;  2YUS A;  1VFC A;  2E2J J;  3NRG A;  1B72 A;  4DYQ A;  1FIP A;  5K7Z A;  4RBO A;  1U78 A;  3IH4 A;  1X2M A;  4JX6 A;  1MSF C;  5JLW A;  2R0Q C;  2M9H A;  2DJN A;  3C07 A;  2E2I J;  3GTG J;  1GV5 A;  3IH3 A;  4A3B J;  5FKN A;  1AKH A;  1K61 A;  4M3B A;  4A3D J;  3VVX A;  2L7M P;  2JK3 A;  1I3Q J;  2XSD C;  1MNM C;  1TWG J;  2NVX J;  2CRG A;  2O9L A;  4DYR A;  4A3L J;  2NP5 A;  1WCM J;  3PO3 J;  1F43 A;  2NP3 A;  1OCT C;  2UXH A;  3JSJ A;  1HDP A;  1U9O A;  2K9Q A;  3RKQ A;  2EZL A;  1CQT A;  3OSF A;  4AF5 A;  1OFC X;  3HE0 A;  3B6C A;  4D5F A;  2R5Z B;  1FJL A;  2D5V A;  3HOW J;  1JKQ C;  2UXP A;  3GZI A;  2HOA A;  3H0G J;  5EZG A;  5EF6 A;  4DZP A;  3BR1 A;  3S2D J;  1TWF J;  3TW6 A;  3HOX J;  5CW8 A;  2LFB A;  4M3D A;  3FRQ A;  1MBJ A;  1RKT A;  4UUS B;  4JP0 A;  1A5J A;  5M5W J;  3ZQI A;  2QCO A;  2GM4 A;  1U8B A;  1HLV A;  3DPJ A;  1X58 A;  1JUP A;  1HDD C;  1RR7 A;  2XRL A;  4M6V A;  3TP3 A;  5F0C A;  1JJ6 C;  1JKO C;  2M34 A;  3Q0W A;  3I4M J;  2L9R A;  2LK2 A;  3TW7 A;  2X6O A;  5EG0 B;  4AYB N;  2PZ9 A;  1BA5 A;  5M3F J;  2RAS A;  5F0H A;  4L62 A;  2EBI A;  3BR3 A;  2L7F P;  4MXM A;  3DEW A;  3HKZ N;  2PMZ N;  4XID A;  3LWJ A;  3P9T A;  4JKZ A;  4XRM A;  1GT0 C;  1B8I B;  2EQR A;  1JT6 A;  1LE8 B;  2DMU A;  5IP9 J;  3VW2 A;  5DAJ A;  2DMQ A;  3OIO A;  3NPI A;  1GDT A;  3OOU A;  1I50 J;  2LR8 A;  5HOD A;  2D6Y A;  1BW5 A;  2I10 A;  2UXI A;  2DMN A;  4X1E A;  3HOV J;  3ANG A;  1ETK A;  3BTI A;  1Z0X A;  5K58 A;  3BR0 A;  1MBH A;  5IP7 J;  3RZD J;  2XGE A;  2HI3 A;  3KKC A;  2JA5 J;  1UI5 A;  4GFK A;  3G1M A;  1O4X A;  1G2H A;  2DA6 A;  4CYC A;  2IAI A;  2KDZ A;  5J1U A;  3GTQ J;  3V78 A;  3PPB A;  5HBU A;  1IDY A;  2QF7 A;  3HGG A;  1MBE A;  3HB9 A;  5FLM J;  2JMW A;  3BG3 A;  4IEJ A;  3BG5 A;  3QPS A;  3KZ9 A;  1H88 C;  2DA2 A;  1UG2 A;  3BT9 A;  2O7T A;  4NN1 A;  2ECB A;  2MSY A;  4A3I J;  3B81 A;  1ETW A;  3ZOB A;  5E3M A;  3LNQ A;  2WV1 A;  5EDN A;  4CGR A;  2X48 A;  3I4N J;  3PAS A;  4A3J J;  2DG8 A;  1GVD A;  2OF7 A;  2DA4 A;  3A02 A;  2NVQ J;  4MFE A;  3CJD A;  3FK6 A;  4FE4 A;  4HKU A;  4Y52 J;  2R7Z J;  4AC6 A;  3VOK A;  5IYB J;  3M4O J;  3G1O A;  3NI7 A;  3VOX A;  3GBG A;  3VUQ A;  4J19 A;  3ZQL A;  5C4J J;  3HIM A;  2JN6 A;  3GTL J;  2AO9 A;  4A93 J;  1MH3 A;  2ECC A;  1SFO J;  3IV5 A;  2HKU A;  3BHQ A;  3EUP A;  2MG4 A;  4YZE A;  3JRG A;  3BQY A;  1TWH J;  5HSZ A;  3QPL A;  4DZJ A;  2H1K A;  3BJB A;  2WAQ N;  3BG9 A;  1W0U A;  3WHC A;  2M2E A;  2JJ7 A;  1ZR4 A;  5HAW A;  1UMQ A;  1JTY A;  3HEF A;  1ETY A;  3GTP J;  1Y1V J;  2EH3 A;  5DTD A;  4GCK A;  4W1U A;  1LFU P;  2NX4 A;  5GP9 A;  3MNL A;  4JX5 A;  1JKR C;  1QVU A;  4IHY A;  3G7R A;  3HOY J;  4I76 A;  3JRH A;  1ETV A;  2FD5 A;  3RH2 A;  4A3E J;  2TRT A;  4FTH A;  5EEA A;  4M3G A;  5DS9 A;  1IC8 A;  4A3G J;  1IRZ A;  3JRD A;  4XK4 A;  3SDG A;  2HOS A;  4NDL A;  1QVT A;  4IHX A;  2CQX A;  2LY9 A;  5J1R A;  2OI8 A;  2ID6 A;  2VPR A;  2ZOY A;  5FKL A;  5JLX A;  2X9D A;  3JRB A;  5AQC A;  5IPA A;  1FTZ A;  5EZH A;  4UDS A;  1ZKG A;  3RD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...