1QVUA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvuA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvuA02
1ZR2A 1EF4A 1LFUP 3BR6A 4DYQA 3IH3A 2NP3A 3S17J 5HBUA 4AUXA 2QOPA 4DZJA 3JRCA 2K40A 2CU7A 5IPAA 1K83J 3S1QJ 3HGYA 2QF7A 3JSJA 3O8HA 1ETKA 2HOAA 2D6YA 2UXIA 2L7ZA 5M5YJ 1U9OA 2GUHA 1MBEA 2DMNA 1MH3A 2X48A 2TCTA 3SJMA 3FK7A 2UXHA 3GTLJ 1LFBA 1I50J 3KZ9A 2VI6A 4A3MJ 2WV1A 1UI5A 3KNWA 1ETQA 4D5CA 3S2DJ 2EZKA 3BJBA 2G3BA 2CQQA 2FBQA 4ICHA 5J3LA 4XIDA 5F1JA 4XRMA 5M5XJ 5K58A 4NDLA 2JK3A 2G0EA 5F27A 3A01B 1W0TA 2RAEA 1HF0A 2LK2A 4JX6A 3NXCA 2NS8A 5EFYA 1Z0XA 2HKUA 4J19A 2MW8A 3LSJA 3CWRA 2D5VA 3EUPA 2QWTA 1JKRC 3OSFA 2DA2A 2XB0X 4JYKA 3QKXA 1RESA 2Y2ZA 3WHBA 2HQ5A 1FIAA 2WGBA 1MBGA 3BTCA 3CCYA 4I76A 4A3DJ 1ZK8A 4CGRA 2YVHA 2MG4A 3HTAA 2EQRA 1Q1VA 3ZQFA 2W48A 3HIMA 1UI6A 4A3LJ 1ZTRA 3MN2A 2IEKA 2CRGA 3BG5A 5JLXA 1NK3P 3RQIA 2XSDC 1T33A 4GFBA 2VPRA 2NVYJ 4A3KJ 5EYRA 3S1MJ 4AYBN 1AHDP 5IYBJ 2YUSA 2H8RA 2AO9A 4DYCA 3LSPA 1WGXA 3T6NA 3S5RA 2PBXA 3QQAA 5K7ZA 2ELKA 1R9TJ 4JL3A 5EDNA 2ME6A 3VVZA 1YRNB 1T56A 3NPIA 3PPBA 3M4OJ 3G56A 2RHAA 2M8GX 5C4JJ 1JT6A 2FJ1A 4MFDA 3LJLA 5D1RA 2KT0A 4A3JJ 3C2BA 5D19A 2ECCA 4A3FJ 4A3BJ 4AC6A 3Q0WA 5DAJA 1WPKA 1F36A 2K9SA 2UXOA 2GM4A 2XDNA 2ECBA 4MXMA 1IJWC 4FE4A 2R5ZB 2R0QC 4D5FA 2JJ7A 2E2IJ 4LOCA 3E7QA 1P7IA 1HLVA 3VW1A 5DS9A 3O60A 2CJJA 1X2MA 5GPCA 2L7FP 3HB9A 4W1UA 2UXUA 1JJ8C 3VW2A 1Y1VJ 5EEAA 3NI7A 1GVDA 1WH7A 2ME0A 2NVXJ 3JRFA 1SFOJ 4ME9A 2HXOA 3BR5A 4M3EA 3S15J 5F0FA 3E7LA 4HKUA 3S1NJ 1JKOC 2XPVA 4FE7A 5HAWA 2NX4A 4NN1A 5IOZA 2E2JJ 3BNIA 2LLKA 2R93J 1BA5A 2G7GA 2Q24A 4XK4A 3KKCA 3CDLA 3GTGJ 3BT9A 4IHWA 3OOUA 5GP9A 1LE8A 2FD5A 5H9TA 3RH2A 3TP0A 1FJLA 2Y0SN 3OSGA 4D7NA 3VOKA 1BW5A 1MH4A 3PM1A 2HI3A 1HOMA 4Y7NJ 1H8AC 1JUMA 1Z77A 3OIOA 3GEUA 1QRYA 2WB1N 2LR8A 5IYCJ 4JX4A 1IDZA 4MO7A 1OCTC 3S1RJ 1ETOA 3BCGA 4CYCB 4C2MJ 3HOVJ 2OERA 1TWAJ 2MGQA 3S2HJ 2QKOA 1MSFC 2LVSA 3H0GJ 5BNGA 5E3LA 3CQZJ 3PO3J 2DA5A 4Y52J 4W97A 2XPUA 5J1YA 4ACIA 1O4XA 1UMQA 1OFCX 5F04A 3VOXA 2K9NA 1BW6A 1U8BA 3LSGA 1MBJA 1GT0C 5IOYA 3I4MJ 1WI3A 3QPSA 1QVTA 1UG2A 3G1OA 2KDZA 2L7MP 2VKVA 3DCFA 3HE0A 2OI8A 2HYTA 2LD5A 3ZOBA 2L0KA 4MFEA 5IP7J 3JRBA 1TWFJ 2OF7A 2GLOA 5J1UA 4KWAA 4RDUA 4IHVA 3BR0A 1AKHA 1ZR4A 4GCTA 3SFIA 3VUQA 3JRAA 3JRIA 3G1LA 4M3FA 4BKXA 1SANA 5CW8A 5F08A 1IGNA 3M3YJ 1A5JA 2GBYA 2GFNA 5DTDA 2E1OA 1MBKA 1ZKGA 3FK6A 3HKZN 1RR7A 1IV6A 3TW6A 3RZOJ 1ORKA 2JA6J 2IU5A 2ZCMA 2FQ4A 3BG9A 3HOXJ 2ZCNA 1U78A 4BXXJ 2REKA 5GPAA 2VUMJ 1ETVA 3JR9A 1XS9A 3EGQA 2PZ9A 3IV5A 4GFKA 5EGOB 3F1BA 4C3JJ 2XB5A 1B72B 4XRSA 3KKDA 3JRDA 2CUEA 1UHSA 3BRUA 3TP3A 3AQTA 1U9NA 2G7SA 4UDSA 3W6VA 3ANGA 3LWJA 1ETXA 4B1RA 1JUPA 3O8GA 2HOTA 4BY1J 3G7RA 5FKMA 2NVQJ 4IHXA 2DMPA 4FISA 2DJNA 2EZHA 3Q0UA 9ANTA 1H88C 1FTZA 2YU9J 2JA8J 3HOYJ 4RBOA 3G1MA 1ENHA 1GV2A 5FKKA 3BTIA 3GBGA 1JKPC 4B4CA 4MK6A 5FLMJ 2DA6A 3Q0VA 4XICA 1GUUA 4DW6A 5FGLA 1RETA 2N8GA 3IH2A 3QPLA 2WUIA 2LP0A 1OJLA 2AHQA 2YVEA 3BQYA 4M3BA 2M34A 2L9RA 5IYDJ 3PASA 4GCKA 2ID3A 1D5YA 1HDDC 2MSYA 4L62A 2LY9A 2XGEA 5HSZA 1WH5A 2DN0A 3WHCA 3BTLA 3MVPA 4PXIA 1XG1A 1AKHB 1MBFA 1NTCA 3ZQLA 2NVTJ 1IUFA 2K9QA 3TEDA 3HOWJ 3S16J 3ZQHA 2HXIA 4BBRJ 4S0HB 3GTPJ 2ZOYA 2HDDA 5FKOA 4C3HJ 1BL0A 3GTQJ 5CXIA 1FEXA 1IC8A 1DU6A 3VPRA 3UKGA 4QTRA 3LHQA 2DA4A 5EF6A 1OCPA 2X6OA 3JREA 3BTJA 4QIWN 4JP0A 3QBMA 2DA1A 3A01A 1JJ6C 2QIBA 5CXGA 4M3GA 4G12A 5IP6A 5HODA 3NAUA 3BR2A 3L1PA 2JWTA 2JA7J 2XGDA 5D18A 1VNDA 1I6HJ 3ZQGA 1RPWA 2CQXA 5EG0A 2JMWA 3JRHA 3GTMJ 3ZQIA 3CMYA 3GTKJ 2V57A 4JNNA 3COLA 4M6VA 2Y31A 5IP9J 2JN6A 3HTJA 4A69C 2COBA 5M3FJ 4HNVA 3HOZJ 3CJDA 1ZGWA 4I6ZA 3DPJA 2Y9YA 4FTHA 5E3OA 2NOGA 1JTYA 2EBIA 3RZDJ 2NP5A 3C07A 4DZPA 3NARA 5FJ8J 2QTQA 3GTJJ 3RD3A 4A3CJ 1ITYA 3Q3SA 5K7FA 1P7JA 2Y9ZA 2EH3A 4JX5A 5FMPA 5M3MJ 2JA5J 4UUTA 4D7MA 2P81A 1BJZA 1K61A 3RKQA 5FKLA 1YRNA 3HDDA 4MLOA 2LKXA 3HBLA 4V2FA 1JKQC 5JLWA 1DU0A 1POGA 4FCYA 4EEFG 3GZIA 5AQCA 5E3MA 5FLVA 1IRZA 1IDYA 4JKZA 2OPTA 3LSRA 3LNQA 2YS9A 1I3QJ 5C44J 3ZQCA 3BHQA 5J1RA 2R5ZA 2R5YA 3PO2J 3S14J 1G2HA 1B8IA 1S7EA 1QVUA 4A93J 4AF5A 2DA3A 1AU7A 5K7HA 1H89C 3CRJA 1TC3C 1VI0A 2E19A 1IG7A 1LE8B 3AQSA 3MNLA 2O9LA 4M3DA 5EG0B 3B6CA 4UUSA 2VKEA 5EZHA 2HOSA 3HTHA 5C4YA 3FIWA 4A3IJ 3TW7A 2XRLA 2LTPA 2IAIA 2O8KA 2X9DA 3FRQA 2IBDA 3HEFA 4B3AA 1GDTA 2M2EA 2WAQN 2HYJA 1FIPA 2RASA 2PMZN 1NK2P 3FISA 4X6AJ 5C3EJ 3VW0A 2QCOA 1JTXA 1TWHJ 2H1KA 2UXPA 1PUFA 3D1NI 4C3IJ 2R92J 4QSHA 3ON4A 2FX0A 3H3VK 1TWCJ 4MIMA 2I10A 1ZQ3P 4GCLA 2ZCXA 5FHPA 3B81A 4DYRA 2Y30A 4A3GJ 3V78A 4ABZA 1WCMJ 3ON2A 1JGGA 3A02A 1VFCA 1F43A 4BY7J 3FKIJ 2O7TA 4A3EJ 1JT0A 3HTIA 5F0HA 2ID6A 3P9TA 3VP5A 1APLC 2B63J 3BR1A 2DA7A 4L5EA 5FKNA 2M0CA 1MSEC 4CYCA 1JUSA 2F07A 4IHYA 2XGCA 1W0UA 4YZEA 4NELA 1HCRA 2DTZA 3VVYA 5F0CA 1XC5A 3HOUJ 3K2AA 3K7AJ 1HDPA 4BBSJ 2DG8A 4GFLA 3IH4A 3ANPA 2R5YB 3BR3A 1B8IB 2EZIA 3MKLA 5M5WJ 2O7OA 1GV5A 3BQZA 2GENA 2ZB9A 1QPIA 1MBHA 4X1EA 2G7LA 2W53A 2XPWA 2EZLA 1ETYA 3NRGA 2R7ZJ 3VIBA 2LFBA 3IUVA 1TWGJ 1RKWA 1A6IA 4UUSB 3VVXA 3GTOJ 1CQTA 1MNMC 3SDGA 1RKTA 2CUFA 1ETWA 3I4NJ 2DMQA 1Y1WJ 1SGMA 2DG7A 2ZOZA 1X2NA 3DEWA 2DMTA 5EZGA 2TRTA 5C4XJ 1X58A 3NNRA 4AC0A 5E3NA 3HM5A 1VF9A 3BG3A 2DMUA 4V2GA 3LOCA 4IEJA 1PUFB 1E3OC 3JRGA 1FTTA 5EGOA 2M9HA 3A03A 4XRSG 3V6GA 2E2HJ 2NS7A 3HGGA 3F0CA 3B6AA 1B72A
chains in the Genus database with same CATH superfamily
1I5ZA 1EF4A 2BBYA 2VONA 3IH3A 4ZYGA 2NP3A 4L5IA 3E5XA 1HC8A 3T8TA 2IGMA 2HR3A 5IPAA 2DYSH 3JSJA 3O8HA 1WJBA 5DEQA 2GXGA 3V7CA 1WJCA 3J81Z 2GUHA 2DMNA 2X48A 3IC7A 2G7HA 2V9PA 5HS8A 5L3BA 1Y56A 2KIUA 3K10A 1XGNA 1WJEA 2FF4A 3M1CA 1FBUA 2FE3A 2X1DA 1FYKA 3R61A 3ABTA 3S2DJ 4KT5C 3K0LA 5K58A 4XIDA 5M5XJ 1PP7U 1LPQA 4EMSA 1YOVB 2R7TA 2DDBA 3A01B 2RAEA 1W5SA 3O6BB 4F92B 1LFPA 2BY3A 3BPVA 3BROA 2NNYA 1K78B 4J19A 1YX3A 4LD5A 5BMZA 1IAWA 3EUPA 4HOBA 2QWTA 1H0MA 3VWBA 3OSFA 2DA2A 3U1KA 3RCOA 2Z16A 3MMYB 2DYRH 3WHBA 2UWMA 2PJRA 4RB2C 1MMSA 3S93A 4L9VA 3HIMA 1GHCA 2K4JA 3FM3A 4BJ6C 5LGNA 1ZTRA 4A3LJ 3MN2A 2IEKA 1JGSA 2BV6A 4GO1A 4Y4RA 2VPRA 2YSRA 3L2CA 2LYCA 3N97A 2EILH 3BG6A 2IGNA 5CLSA 1TW3A 1WGXA 2D1HA 3WTTC 1OISA 3K4BA 4XR6A 5K7ZA 3OYNA 1P92A 3K4KA 3E5QA 3HG9A 4I0BA 3KEOA 4OIRF 3LSMA 4ZDOA 2F6CA 1YW8A 2RQQA 4AIKA 3T0YA 4E6KG 1N78A 5A2QZ 2M8GX 3GYHX 5C4JJ 1AA7A 3QRFF 1A31A 3DU6A 2KT0A 3B02A 2R7RA 2Y0SA 4A3FJ 2W24A 4AC6A 3PUBA 4Y3OA 2ZKZA 3K1NA 4A6DA 1F36A 4HNTA 2OZUA 3B73A 4WCGA 2XDNA 4U9LA 4NC7A 1IJWC 5FLXK 4N4OB 2XKPA 5FB2A 4KIBA 2WB1A 1IN6A 5IT9K 3VW1A 3F0CA 1RR8C 3K8PC 2ELHA 1Y8RB 3CLOA 2UXUA 1G3WA 3FM5A 1VQ6I 1VQMI 2XDVA 1PJRA 2DAOA 2DI3A 3QP6A 1FMWA 2E34A 3MQ0A 1J9IA 1A04A 2HXOA 1IRFA 2QENA 5HAWA 1TNSA 1PP8F 3CO6C 3WU2C 5IOZA 4ZZDA 1Z9CA 3E6CC 4LG0A 3BNIA 1O3TA 4KN4X 4HX8A 3FXKA 4QPQA 2GAUA 2Q24A 5DDGA 2X6WA 2XAJA 4CZCA 3GTGJ 3C1DA 1S7AA 3CCUI 3CDHA 3BC8A 3BT9A 4HSTA 5GP9A 1VQ9I 4UHTA 2PLYA 1LE8A 2RKHA 2HPMA 3RH2A 5L3DA 3FMRA 2X1EA 4EVIA 3HKZA 4D1QA 3EETA 3W3CA 4AIHA 3H35A 2JTVA 1H8AC 1JUMA 3F6VA 3OIOA 1MJBA 1BBYA 2RQPA 3J7YJ 3H0DA 1OCTC 1XTAA 3R6SA 3BCGA 2K02A 5FRMA 2JSCA 3G4SI 4XRFA 3TL4X 5TISC 1QZYA 2P4WA 5E3LA 3VOEA 4UVCA 3PO3J 3N05A 2DA5A 4W97A 2HFHA 5F04A 3BCAA 1FOWA 2J5OA 1BW6A 1CF7A 3MKYB 1GT0C 2OCEA 3QPSA 1XN7A 3QYBA 4G9YA 2L7MP 4GGGA 1TQMA 1R4MB 4G6QA 2A61A 2F5DA 2ZXHA 3DCFA 3WE2A 4U0WA 2ZC2A 2HYTA 1HSTA 1P2FA 2R7OA 1MMAA 1TWFJ 2R7XA 4EV0A 3AKZA 3BJOA 3OYHA 2F5VA 2L7KA 5K1YA 1S3JA 4BKXA 4HG2A 1ZG3A 1IGNA 3M3YJ 4BHBA 2GBYA 2FQ3A 2KFDA 2NYXA 2GFNA 2E1OA 1XCVA 3PSFA 2R7QA 1BC7C 3J80Z 2NRAC 2XGXA 5CVUA 2DLLA 2XAFA 2IW5A 2CQ7A 4BXXJ 5F6FA 1LEAA 1ETVA 4DIQA 3EGQA 3H9QA 4ETSA 2QEXI 3MZHA 3AL0C 1QNTA 4E4HA 3SXYA 4PSXA 4HSRA 2DOAA 3SZGA 2EV5A 3AQTA 3CUQC 2A2FX 1U0JA 4UDSA 1D1CA 3W6VA 1YLFA 3CZ6A 4B1RA 3I4PA 1HW1A 3HOTA 3CCEI 2B0LA 3DKWA 4XKVA 1XMKA 3SHFA 2HOTA 3ABLH 2DMPA 2NVQJ 3G7RA 3V42A 9ANTA 4PGHA 1TLHB 4DGWB 3W6JB 3LFKA 2YU9J 2KISA 4KITB 3M1EA 3M8JA 4RB1A 3DKXA 4GXOA 5LD2C 1LKXA 3TO6A 4CCKA 1EJ9A 3Q0VA 4KMFA 4BXUA 1KQ9A 2W57A 4GCVA 2N8GA 2WADA 2Z3YA 3HRUA 2VXZA 1OJLA 3DBLB 3NS4A 2L9RA 3G3ZA 3MAJA 1LDJA 3HXLA 1T08B 2E7WA 5J4YA 5JFRA 4GCKA 1G3SA 3SQNA 2PI0A 3ECHA 1O7FA 5HSZA 4L0ZB 3WHCA 1XB4A 3BTLA 3GUDA 3MVPA 2ISZA 2XAUA 1DP7P 1MBFA 5LGUA 2EIMH 2K27A 2NVTJ 1R6RA 1LDKB 2EFQA 4KISA 3FBIB 5F64A 3HOWJ 3DXJF 3EYYA 1SFXA 5FKOA 2OTJI 5CXIA 2OJED 1DU6A 1FEXA 2GOMA 3UKGA 3LHQA 3NWSA 2DA4A 1FNNA 1BR1A 3BP8A 4JP0A 4IKFA 2DA1A 2DFHA 2AXTC 1VZ0A 4HV6A 5HDNA 5IP6A 2QKMB 4G12A 3A01A 1JJ6C 2QIBA 1FBQA 3OIQA 1LB2A 3W6KB 2MD0A 1A6QA 4NQWB 1UJ8A 3ZQGA 1RPWA 3RSNA 1C0WA 3DU5A 4E7ZA 1XDUA 1FOYA 5CKTA 2JMWA 3KLNA 2IA1A 3ZQ7A 3GTMJ 4G6DA 2BEOA 3CMYA 3GTKJ 3COLA 2GQQA 1WJFA 4ZDPA 4XONA 3RIRA 3S2WA 4A0ZA 2COBA 4A69C 4HNVA 5M3FJ 5HVQC 1ZGWA 1MD0A 4MTEA 2NOGA 1JTYA 2XHKA 3D5SC 5K5QA 1R49A 2YX4A 4DZPA 1RUOA 1W5TA 4WWCA 4XLEA 4G6TB 2P5KA 2XIGA 4XSXF 1T2KA 1W36C 5CPRB 2HGCA 2WAQA 2L9NA 2MH9A 4GYIA 4BQNA 4BU2A 5K5OA 3HRSA 1P4WA 5FMPA 3F8MA 1FT9A 4UUTA 5D6EA 5GTHC 3GZ6A 1BJZA 3LQQA 3CCLI 3RKQA 2VC1A 3HBLA 2E71A 4EEFG 3I58A 5LHGA 5JI6A 5FLVA 3F72A 3KFWX 4IX7A 2OPTA 1XGSA 2DDAA 3FHZA 4IZZA 3LNQA 2YS9A 5TGTA 1I3QJ 2XROA 5LBQA 5C44J 3ZQCA 1VQKI 4LIVA 3CMEI 2R5YA 2LH9A 1G2HA 1B8IA 1S7EA 1O3QA 3CRJA 4ZYHA 1BOAA 2Q1ZB 1IG7A 2XC7A 3AQSA 3K1PA 3MNLA 4MNUA 2O9LA 2STWA 2V4JC 4C9YA 4Q4ZF 3RKWA 3F8NA 5ICFA 2KJCA 2P0WA 1J75A 4EM0B 2CFOA 3QYFA 4A5NA 1LUJB 3FRQA 3HEFA 5L3EA 2CYYA 4IXAA 2M2EA 3RTRA 3JAMZ 1W5CC 1FIPA 2K9MA 3W2WA 1NK2P 3FISA 4MHGA 4AIJA 1KA8A 1XSXA 2QCOA 2HPIA 3HSFA 3IKVA 4MQ9F 2H1KA 1SVMA 1D3YA 3TQNA 2EA4A 2A69F 3QODA 2MLGA 4GCLA 4L5JA 3HPGA 1F5TA 3GZ5A 4DYRA 2Y30A 2GA1A 2YX7A 4ANJA 3ON2A 5LRRA 4FASD 1VFCA 1F43A 2O7TA 3ONQA 4IOCF 2CW7A 3L09A 4YIFA 3L2WA 3P9TA 3GO5A 2CQNA 1D8KA 2HNHA 3BR1A 4L5EA 1MSEC 1V54H 3L9FA 1I3AA 5ILUA 1IN4A 2O0YA 4G94A 2V9VA 4R8HA 1KQ8A 1YX5A 3EQLF 2JRMA 2UXXA 5FD6A 4BBSJ 3IAS2 1HDPA 3K7AJ 4BQQA 4GFLA 2L02A 5EEHA 2FBIA 4RLFA 3DV8A 4EM1A 3PNYA 1RC9A 4F55A 3BQZA 2ZB9A 5DD4A 1MBHA 3DTIA 1T95A 3KZIC 4X1EA 1HKTA 1I39A 3EPZA 1R5HA 3ZMTA 2W84A 3NRGA 3UNGC 4ASNA 3RI4A 1RKWA 5BS6A 3VVXA 4A12A 5DCMB 2DU9A 4QLCU 4CICA 3DEWA 2DMTA 3PNTA 2A6EF 4BYYA 2TRTA 5DV5A 5C4XJ 4HF0A 3H9JA 1PUEE 3CCJI 1X58A 1HBXG 3CCQI 1OMIA 4IRVA 4C2UA 4AC0A 2M87A 2ZSIB 3HM5A 1E2XA 1IRGA 2VJIA 3GZNB 2DMUA 2L01A 3OYJA 2A05A 2JRTA 2XASA 4IQJA 3H5NA 2BY0A 4RB3C 3HGGA 4KIGA 3CC4I 4AF5A 5TRDA 2D2WA 1LFUP 4BH9A 3WG7H 2VKHA 4F93B 1OYWA 3GXOA 4DNCA 1SFEA 4DZJA 2K40A 3C18A 4YIIA 1F9NA 4LG3A 3HGYA 2QF7A 4PGGA 4OOIA 1ETKA 2HOAA 1WHUA 2L7ZA 5M5YJ 3AL0B 1JE8A 4PJJA 3D5LA 1YHQI 2ZJRF 1WFXA 3K4LA 2QLZA 3RKXA 3SJMA 2MYSA 3F8BA 1I50J 3CUQB 4A3MJ 2WV1A 1UI5A 1EKEA 3KPHA 3FWEA 2FBQA 2EINH 4ICHA 1R23A 2R7WA 4RGRA 3QAHA 4NDLA 2R7SA 2LK2A 4F91B 3PSIA 1FX7A 1E3PA 4RGUA 2HKUA 2EWNA 2EK5A 5HS7A 1A36A 1YO5C 2D5VA 2Q0OA 1RUNA 3WTUC 1QZEA 2EIKH 4E7KA 1T0FC 3BOQA 3LQRA 2QQ9A 1MBGA 2ADUA 1FWZA 4A3DJ 5D8LB 4CGRA 3ZRGA 4M73A 4B09A 2HQAA 5KHDA 1QA6A 3SZPA 1Q1VA 2Z5UA 1UB9A 1UI6A 5KAIC 2E60A 2M7AA 2DT7B 4NC8A 2CRGA 1UHWA 5JLXA 1Q1HA 4Y33A 2L9SA 1DPUA 2ZSHB 3FF5A 3S1MJ 2OQRA 2QYOA 4NQWA 1AHDP 2GA2A 2YUSA 3KEYA 4C30A 2AO9A 1R5ID 5CVIA 3J7AO 3KYDB 1BIBA 4XORA 1TQPA 3DTEA 1R9TJ 4JL3A 3JCUC 2KRFA 5D5UB 2VOPA 3NPIA 3WTZA 5LEKA 4R1HA 2QM3A 3M4OJ 3G56A 1OCCH 5J40A 4ESFA 1XPXA 2FJ1A 3LAJA 4MFDA 3LJLA 2BXZA 4OD4A 5D1RA 1A35A 2G9WA 1U5TC 2ECCA 4XKCA 3WTWC 3Q0WA 4B44A 2E1CA 2K9SA 1ZGAA 3LSTA 3KP5A 4NBQA 4MXMA 4FE4A 3RDIA 3AG2H 4GYGA 1R7JA 5GAEJ 2E2IJ 3A0HC 4RGXA 4P1WA 1HLVA 3RJPA 3IUOA 2H94A 3O60A 2X0LA 2CJJA 5GPCA 1YJ9I 4G8XA 1ZHFA 2M45A 2P7VB 2Y75A 1GVDA 2QUFA 2WC2A 1DUXC 2UV1A 2HDCA 4YFKF 3S15J 3PQKA 1EA3A 2CH0A 4HKUA 2HU9A 3S1NJ 4OIPF 3P5JA 4Z2YA 2NNNA 2NVUB 3WG9A 2NX4A 5CVRA 3BZKA 1OLTA 1YIOA 2KZGA 3M8FA 3IAM2 4BAYA 3G2BA 2R93J 4XK4A 1BA5A 3KKCA 3CDLA 3EUAA 3L2QA 2W85A 2Z9OA 5BOXA 3PQJA 3IRRA 3AAFA 1UG0A 4MEXF 4UV8A 1IN7A 4CCMA 4CSWA 5H9TA 4EQQA 3OV8A 4AWXB 1WJ5A 2KPMA 1K6OA 4CO8A 1MJ9A 1Y0NA 2A6TA 3ZQQA 3ZMUA 4U7BA 1MH4A 1YIJI 3K70C 1HOMA 2BW3B 2HQRA 2K3FA 2F4OB 4CYDA 1FMVA 3GEUA 3GVAA 1IDZA 4MO7A 2CS3A 4CYCB 3H1CA 3IHUA 3OYKA 2L4AA 3HOVJ 2VN2A 2MGQA 4XN0A 2LVSA 3H0GJ 5BNGA 3O2PE 3A0BC 3EUHA 5DUIA 1TW2A 5H2FC 4ACIA 1OFCX 4BACA 2VBXA 3VDXA 1U8BA 1MBJA 2XAHA 1KU9A 4HDVA 1QVTA 1UG2A 2VKVA 4IL6C 4UNOA 2IGKA 3WU0A 1SD6A 1CGPA 2V1XA 2X1CA 1USTA 5LRSA 4MFEA 4KWAA 2OF7A 1WJDA 3C3WA 4RDUA 1FOXA 1FOKA 4KUMA 4GCTA 2KQRA 1STZA 4NUBA 1KU7A 5CQGA 4RAYA 1SANA 3ECOA 5E8IA 2VXDA 4AVZA 2Z1DA 3CP2A 1LQ1A 3G73A 1RR7A 2OD5A 4JQFA 1KYZA 3I59A 2JSPA 2IU5A 3BG9A 1FC3A 2VQLA 2CQKA 5GPAA 2VUMJ 4BHCA 4L0YB 1FSHA 3IV5A 5EGOB 1J2XA 2PQ8A 1B72B 2JQ7A 2E35A 3VTIA 3OWTA 2GXBA 3KKDA 1FP1D 5HLTA 3V7SA 1U9NA 2WAFA 1VTNC 3OY9A 2CV0A 2HYFA 2VB6A 4BY1J 1Z67A 4U0VA 4CXFA 4A6EA 5A2QK 2DJNA 3I54A 1OKRA 2EV0A 2XF6A 1H88C 3I64A 3V8KA 3H36A 1FTZA 4ZYAA 4KIFA 4LK0F 4I09A 1ZG5A 3PUFA 3CTAA 3DP7A 2W4SA 4XQFA 4WX9A 4B4CA 1QU3A 3U2RA 2VE9A 2F5EA 5FGLA 5GADJ 2LBFB 2ZMEB 4CH7A 3ELKA 2XVCA 3PFIA 2B9SA 2FOWA 2L54A 5IYDJ 2WY8Q 3ULQB 2FU4A 4BGDA 3F8FA 4OWRB 3DPUA 1HDDC 4FX4A 2LY9A 2P5VA 3RKYA 1ZG1A 1JHHA 4BEHB 2A5YB 1AKHB 4RS8A 1VQOI 1BJAA 2B7EA 2K85A 5ICGA 3ZQLA 1O3RA 3FXUA 4BBRJ 2HXIA 3ABMH 4S0HB 3KP4A 1IXRC 4WXHA 4C3HJ 2Q2EB 1BL0A 2JPBA 2WV0A 3OMYA 1UAAA 4IOAF 2X6OA 4KMUX 3QBMA 2FEZA 2A6HF 1TTYA 5E1WA 3Q9SA 1DPRA 5FLXZ 3E97A 1ZN2A 3SEZA 2IS1A 4HQMA 4LJZF 5K5RA 1Z1DA 3KLOA 1TP4A 2DTRA 2JVHA 2KRCA 2QGUA 4E7IA 3I9V2 4HEA2 4J01A 4YFXF 3DPTA 5CJ9A 2QZ8A 2C6YA 3FXOA 2CQXA 5HLIA 3JRHA 3GX4X 1TT0A 3DBHB 3CCSI 1JI8A 3FXMA 3CCVI 2V57A 4M6VA 2RC4A 2Y31A 2RDPA 1J09A 3BJAA 1UZCA 3HOZJ 4HRIA 4HQEA 3FKJA 4AIDA 4OAZA 1T98A 3JTHA 2PMUA 4I6ZA 1ON2A 4OU0A 2Y9YA 3V8JA 3I3LA 2O03A 2EA2A 1EH6A 3AG3H 4KJZA 3FMQA 4ZYDA 3OYCA 2ZJQF 2KJBA 2NP5A 5KCMA 4LGWA 4XSZF 4QPOA 4HZFA 3NARA 5D8KB 5FJ8J 2QTQA 3RD3A 3NQOA 2KHMA 1Y8QB 1S9HA 2IRFG 3Q3SA 1P7JA 1BR2A 2Y9ZA 2G7UA 3R0AA 4DOZA 2VBZA 2O8XA 3FX3A 5M3MJ 4D7MA 4E7JA 2P81A 2Z33A 4BE2A 1G59A 3HDDA 4NHJA 1FBSA 2HS5A 2LKXA 1DU0A 3ZMDA 3GZIA 5AQCA 1IRZA 2V6EA 4DVYP 1IDYA 4JKZA 2CMPA 2W00A 3KP6A 1B59A 2FOKA 2X85A 2E36A 3QYEA 4II3A 3BHQA 4WK8F 3RYRA 4BS9A 2W25A 2OBPA 5KAFC 1UELB 1WQ2A 2PG4A 3OS1A 2OQGA 4A5MA 3QPTA 2KP6A 3NWTA 1AU7A 1YW7A 2QSFX 1VI0A 4LB6B 4EM2A 3QU3A 1LEBA 2WA0A 2MD5A 2QWWA 4UVAA 4BE1A 5FD5A 5EG0B 3HTHA 4UUSA 2VKEA 5E20A 1N75A 3CD6I 5C4YA 3MCZA 2LTPA 2X4HA 2RN7A 3KZZA 2IBDA 4B3AA 3TBIA 1BI3A 2ZBKA 3COAC 1U8RA 2XF7A 2Y48A 4YEJA 3VW0A 1X3UA 2LF7A 1JTXA 1YQAA 1PUFA 1VQ8I 3KP7A 2QQAA 3D1NI 4H4KC 4K2EA 2R92J 3ON4A 1P4AA 2FX0A 4MIMA 2HYGD 3NEUA 1AWCA 5BPDA 4CCNA 2GIVA 3V78A 2F4MB 4P96A 1WCMJ 5H20A 2VL8A 3V4GA 4ABZA 2IS4A 3A02A 1JT0A 1R5GA 5F0HA 3HHGA 4EATA 2IA0A 4GDFA 3C2HA 1V3FA 2HKOA 2XAQA 4RA2A 1APLC 3VP5A 3P7NA 2E1MC 4CYCA 2PJPA 3L7WA 4IHYA 3I53A 1RZ4A 2B1EA 1I27A 4PJ0C 3IRQA 4NELA 5FGMA 1HCRA 2D1VA 4XLCA 3VVYA 1XC5A 3EDPA 2CO5A 1J59A 3X2QH 3HOUJ 4CZZA 2DG8A 3BLYA 3ANPA 4Y13A 3BR3A 3CP8A 1O3SA 3W2VA 2HDWA 1X4OA 2EZIA 1BIAA 2O7OA 2Q8KA 2JUCA 3R4KA 3OYBA 2EZLA 1Z7UA 1ETYA 1Z7LA 3ZPLA 1K78A 4BQAA 4MTDA 4XNFA 1TWGJ 1X1CA 3SWHA 3L2VA 3SDGA 4RM2A 1ONVA 1DDNA 1SGMA 5ILSA 2ZOZA 1R00A 2ZJ2A 2KKOA 3LFUA 2ZNZA 1K4TA 4DBRA 3DFGA 2XSJC 3TDUC 1WJAA 2DODA 3CJNA 3LAPA 2VPLA 1S8NA 3WGGA 4QWQA 4V2GA 3LOCA 1IXSB 1FTTA 4CUGA 5EGOA 4CDGA 3KX2A 4A3IJ 2E2HJ 1IUYA 3V6GA 4E70A 1ZR2A 1B72A 5LGTA 2CWEA 1YS6A 1IF1A 3S17J 5HBUA 1SAUA 3BWGA 1YTYA 3F6OA 1KONA 2V1NA 2JT1A 2VE8A 2DQRA 2QOPA 2W1OA 3S1QJ 2OUMA 4N4NB 4B3XA 2VLAA 1U3EM 1B4AA 2FXAA 2UXIA 3GEZA 4FHTA 1EH8A 1MDMB 1HSJA 2CW8A 5FFXA 1ERDA 1HA8A 3ZN1A 2TCTA 3Q9VA 1DGWY 3GTLJ 2COMA 3KZ9A 2HEOA 4RAGA 1W7PB 5DM6F 2DFIA 2HTSA 2EZKA 3I55I 2KRHA 3E6MA 3HZJA 3BJBA 1SEUA 2G3BA 1U2WA 5B5EC 2LBFA 3K6GA 4NNJA 2ZMEA 5J3LA 3CJRB 5F1JA 4XRMA 3CJQB 2LC2A 1W36D 5E18F 5BQTA 2P8TA 4ZJZA 2JK3A 1SMTA 2VBYA 2G0EA 3WU1B 5F27A 1W0TA 5ERIA 4JX6A 2VKDA 1RRJA 1DGRM 4O5VA 2NS8A 5EFYA 1Z0XA 1VQ7I 5LHHA 3CC2I 3LSJA 4YG2F 3KE2A 4BEHA 2F48A 1JKRC 3S3MA 3JAMK 1OCRH 4JYKA 4EJWA 3FBNB 2HVRA 4LIUA 2HQ5A 1E3HA 1MIJA 4I76A 2YVHA 5KVRA 4PJNA 2EQRA 2W48A 2BVMA 1IRXA 1XGOA 2OCCH 4IHSA 2XSDC 1T33A 3BG7A 2NVYJ 3QOPA 5EYRA 4AYBN 2DPUA 3AG4H 5ICCA 2JPCA 5IYBJ 2R7DA 4YRVA 4X0GA 4G7OF 4DYCA 2ZJPF 3S5RA 2PBXA 2MC3A 3AFHA 3QQAA 1HKQA 2HVQA 4ENJA 3ML6A 2K3PA 2OA4A 2YPRA 4WF2A 5EDNA 3OS2A 3DBRB 3VVZA 1BI0A 1KZHA 3M07A 2BHZA 2OZ6A 3PPBA 3U9GA 3QU6A 3V8LA 1G6NA 1JT6A 4EJTA 2ZNYA 2NAZA 2LKPA 4IPAA 2DK5A 4XBFA 2QSHX 3VYRB 1K7AA 5DAJA 2UXOA 2VBWA 2GM4A 2PN6A 3VSLA 2HVSA 2ECBA 3FXRA 5EEGA 2DCEA 2R5ZB 4CGZA 2R0QC 2P7CB 2JJ7A 1PYVA 4KYWA 1P7IA 5DS9A 3DQVC 3FXLA 3CCRI 1X2MA 2L7FP 4U87A 1OQYA 3TMOA 4M71A 3VW2A 2WY7Q 1Y1VJ 3S32A 1JXSA 4OIQF 5EEAA 4I02A 1O7LA 1FYLA 2ME0A 1R1VA 3HOSA 3A2KA 2BY1A 1D8JA 2RREA 3KP2A 1SFOJ 1YFHA 4ME9A 2PJRB 3F3XA 1Z3YA 3BR5A 3KETA 5LFAA 3E7LA 1S5LC 3TOBA 5KNLA 4OD5A 2XPVA 3DLAA 3CF5F 2XRNA 3HRMA 4UVBA 3MKWB 2E2JJ 4A2UA 4BXFA 3KYLA 3I5UA 3K69A 1MMNA 1BM9A 2K9LA 3MFKA 2FD5A 4DBQA 1P9QC 2VT2A 1EV7A 2EIJH 3TP0A 4ZTJA 3OSGA 4HW0A 4Z6YA 2O5RA 2M4KA 1BW5A 2FNAA 4AVPA 1OR7A 3OYFA 2F5CA 2HI3A 1VQ4I 4Y7NJ 2LF8A 4IO9F 2M30A 2QKLB 3CLQA 1Z77A 1KYWA 2L4MA 2I5UA 2LR8A 2KIMA 3MD2A 4JX4A 4I98B 2IA2A 2Z99A 3IKTA 3S1RJ 4FX0A 3WGHA 3WTYC 4HPQA 2ZCWA 2OAZA 4XOPA 1B1BA 3S2HJ 1J0RA 3CQZJ 4RMNA 2V79A 2M7BA 4E7LA 2IS6A 1Y0UA 2XPUA 3U21A 1QQIA 2K9NA 2O6GE 3VFZA 2PMZA 2JA2A 4BE0A 5IOYA 5AIQA 1WI3A 4UV9A 3G1OA 2M3AA 2KDZA 3P9IA 4UUVA 3H92A 1QO0D 3E5UA 2DXIA 1ZH5A 3HE0A 2OI8A 1QGPA 2IXSA 2DOFA 2L0KA 1WI9A 4C2MA 1ZR4A 1D1BA 3VUQA 1S7OA 2QQBA 3JRAA 4CA0A 3G1LA 4M3FA 2DPDA 5F08A 4O6JA 1FLIA 2B3WA 2Z2SB 1MBKA 5TJJA 1VQNI 3RYPA 3M8EA 2HOEA 1IV6A 1ODDA 1L0OC 4WXCA 3RZOJ 3FXQA 2JA6J 2ZCMA 2E1MB 3HHHA 2FQ4A 4RB0A 3HOXJ 1U78A 3KP3A 4PDKA 3JR9A 1KGSA 3T5XA 2PZ9A 4GFKA 3FHNA 4IRHA 2H27A 2MABA 1XMAA 4C3JJ 4HF1A 3OR2C 3CJTB 2ACJA 3J7AY 4KA4A 2RGVA 2V26A 3JRDA 2M1BA 2KL4A 3TP3A 3REOA 2ISYA 4HA8A 2EFPA 2G7SA 3LWJA 3ANGA 4ZH4F 1ETXA 1LNWA 2QBYB 3F23A 3NRVA 4AM3A 4IHXA 1D5VA 3SZTA 3CC7I 1TBXA 3CESA 2EZHA 3LA7A 2BYVE 2ESHA 1F1ZA 3HOYJ 4RBOA 3G1MA 4LMYA 4I2OA 1GV2A 5FKKA 5EJCA 4N0BA 5DUKA 2IT0A 3T1BA 4MK6A 2O3FA 5FLMJ 3FZVA 2DA6A 3OYMA 4BQOA 4XICA 4DW6A 3GCMA 3GMEA 4B47A 5L3GA 3IH2A 4FT8A 3QPLA 3OYEA 2VODA 2I8DA 6PAXA 1CF7B 3BQYA 2IS2A 1USSA 3GF2A 2A07F 2M8EA 3TOAA 4RGSA 1SVLA 3IWFA 5L3CA 1ZLKA 5J47A 1M1EB 1H9GA 1ZRDA 3PASA 2ID3A 1MDMA 2MSYA 5J8FA 3OYIA 4L62A 5LLQA 1WH5A 2DN0A 4R79A 2LKSA 3S3NA 3ASOH 4H0EA 1S29A 4ESJA 1NTCA 2JVGA 3DTKA 2LSOA 2PFVA 3F9KA 1HKSA 1ZARA 1XSVA 3TEDA 3S16J 2RNJA 3ZQHA 3GLLA 4HAMA 5L3FA 1MKMA 2ZXJA 2HDDA 1G8XA 1KU2A 3CMMA 1ULYA 4NB5A 4QTRA 1OR7C 5AIPA 4OMYA 3MZYA 1OCPA 2VQHA 5CVJA 3RPUD 4QIWN 5EF6A 4L9NA 3JREA 2CV1A 3DF8A 3BZCA 4YELA 5HLGA 2GZWA 3NAUA 5DM7F 2R7VA 2JWTA 4KICA 2XGDA 4G7HF 3I71A 2CFXA 3LA2A 3HTSB 4LK1F 4HF2A 1QZZA 2H09A 2LOOA 3J81K 2DBBA 3HC7A 4JNNA 3CUOA 5IP9J 1LVAA 1XCBA 2BHYA 3BZ6A 4DJAA 1VQPI 2BE5F 4BDYA 1GVJA 4M9SA 1XSDA 2FJI1 4F7ZA 3DPJA 1MNDA 4FTHA 1I1GA 5E3OA 5HOOA 2EBIA 4XKWA 2KDOA 1QPMA 3L2RA 3RZDJ 2ETHA 3C07A 3GTJJ 3P9CA 5E79C 1RI7A 3ZN0A 3CDIA 3ERMA 3OYGA 4A3CJ 1HW2A 3BPXA 4PFOA 5B3SH 3PNVA 5K7FA 3OYDA 1PDNC 3IWZA 2EH3A 2JA5J 1XDSA 5GAGJ 3K70D 1V5GA 1YW9A 5FKLA 1B6AA 4Y17A 2CSOA 4WIBA 4IQ4A 1SD5A 3VB2A 3VSKA 4V2FA 5D4SA 5JLWA 3DEEA 3HL2A 2UXNA 1IXCA 3KZYA 5FO5A 3TKYA 3RQ4A 3LSRA 1V5FA 1TQIA 4LFUA 3SEQA 3JW4A 4IRIA 5J1RA 2R5ZA 1S72I 3PO2J 3JTGA 2CGPA 1KU3A 4BUPA 2O61A 5K7HA 1H89C 1VQ5I 4P5OA 3KCCA 4B8XA 3OR1C 1FP2A 2V1UA 4KDPA 5JHUA 3ZR8X 2EFNA 1FSEA 3F21A 5ED4A 4M3DA 3B6CA 4IRGA 2V1DA 3K4MA 5EZHA 2X6XA 5DCMA 3FIWA 3TW7A 3H9GA 2MH2A 4M9ZA 2X9DA 2ZFUA 2LDUA 1BI1A 4ITVA 2FRHA 2PMZN 1BR4A 4X6AJ 5C3EJ 3FMSA 4D9JA 3FDYA 4II2A 2UXPA 2HZDA 1OYYA 1YYVA 5B1BH 2KMUA 3EYIA 2UZKA 1OYIA 4C3IJ 4QSHA 1BC8C 1TWCJ 3LWFA 2ZCXA 3SYTA 5FHPA 3B81A 3KYCB 2VASA 4XN3A 2AS5F 2R4GA 1YS7A 1SC7A 2K5CA 1JGGA 3QWLA 4BHPA 4I7HA 1W7PD 2L9VA 3FKIJ 2LNBA 3GFJA 4A3EJ 3HTIA 2NS0A 2ID6A 5J6XA 3A1YA 2B63J 1IW7F 2DA7A 3C7JA 2M0CA 3ESWB 3ZP5A 2IVMA 1FPQA 4ZYEA 2IPQX 2XGCA 4OINF 3Q5FA 4EJVA 3CUQA 4EGZA 1IZ1A 2L5QA 4HX7A 2AQFA 2V9KA 3MKZA 2QA4I 4IF4A 3K2AA 3QOEA 4P9FA 2RNGA 3IH4A 4XMYA 2R5YB 4BJTA 1B8IB 4PZJA 3MKLA 1X4PA 1GV5A 2DFEA 2IP2A 4I01A 4ON0A 2G7LA 1W1WE 3ZMZA 2W53A 2VIXA 3WGIA 2GXAA 5IT9Z 2LFBA 1X1AA 4PFPA 2PFBA 2MFZA 4EJOA 4HX4A 4PSWA 3GTOJ 1CQTA 3M9AA 3R60A 3W2AA 1XGMA 1RKTA 2CUFA 1ETWA 2STTA 2DMQA 1OPCA 2PX9A 5GAHJ 3EUHC 1TNTA 1XD7A 5CYVA 3NNRA 5E3NA 5FFZA 1VF9A 3RPQA 3VODA 3BG3A 3F8CA 4S04A 4IVNA 4M72A 1W4MA 4LB5A 1MJAA 1R58A 1R4NB 2R7UA 4XRSG 2E1NA 5HDKA 4IJAA 2NS7A 1HXDA 3B6AA 2V7FA 1N77A 3BR6A 2HKXA 4DYQA 2IGOA 3VEPA 2GIZA 3CCMI 4AUXA 3HTUA 2EB7A 2XF5A 3JRCA 2CU7A 2FNPA 2KIFA 1K83J 5CVVA 2VQCA 1SMYF 2QBYA 2QQ8A 2J5PA 2VOOA 2D6YA 1V4RA 1MMGA 1U9OA 1MBEA 3CF2A 1QBJA 1MH3A 3QP5A 4EJUA 2R7FA 2RVCA 3E0JB 1KQ0A 3FK7A 2UXHA 4AYBA 4IHTA 1LFBA 3OOPA 3K2ZA 3TDZC 2X51A 1NG7A 2CW0F 2OV7A 3ROUA 2YVXA 1YE9A 2VI6A 3E1SA 4L9JA 4Y15A 5LHIA 2V6CA 3J80K 3KNWA 1ETQA 1ZGJA 4D5CA 5HNHA 1WKMA 1GXQA 1IV8A 4LITA 1MW7A 2CQQA 4CCJA 1UFMA 1F4KA 1FYMA 2EPFA 1T6SA 4BJ5C 1PVEA 5ILVA 3PIOF 1ACIA 4I0AA 1HF0A 2BY2A 3NXCA 3ZCOA 5JHFA 5LEJA 4E7HA 1U5TB 1X1PA 1Y6IA 2MW8A 3G6EI 3K4NA 4ENKA 1ZAOA 3H3ZA 3CWRA 3VYUB 4L18B 1RNLA 1R36A 1ZRCA 3GFMA 2XB0X 3QKXA 1RESA 2Y2ZA 5HLHA 2WGBA 1FIAA 2P5LC 1J5YA 5FROA 1LDDA 3BTCA 3CCYA 3SFZA 1ZK8A 4KT6A 2MG4A 1Z05A 3HTAA 3UR3C 3ZQFA 1FZPB 4DQ2A 5BPIA 4OMZA 3E6BA 4B48A 1GXPA 4JK1X 3BG5A 1NK3P 3RQIA 2DT6A 1ZREA 5H6RA 4GFBA 1BN5A 5DCFA 4A3KJ 4UY8I 3PJRA 2HQNA 3ERED 1IN5A 4M6XA 3H5RA 2H8RA 3LSPA 1WVRA 3ZXSA 3T6NA 1P6RA 2ELKA 2BXYA 4U88A 2ICWG 3BDDA 1D0XA 2HZTA 2ME6A 2BW3A 3HRTA 1YRNB 1T56A 4LLNA 3LSIA 3JSOA 1MZBA 1BOBA 4A0YA 4ENNA 3ABUA 2HWVA 1D0YA 3TGNA 1P4XA 3DKYA 2RHAA 1SD7A 1OCOH 1XX5A 2E7XA 4JOMA 3DLLF 1Y39A 4CHUA 4A3JJ 3C2BA 5D19A 2M4GA 1R71A 2FBKA 4A3BJ 2GWRA 2KLOA 3PFYA 1WPKA 1WZ2A 2JZYA 2M0MA 3FXJA 2WBMA 1S6LA 3GLXA 4D5FA 2ZFWA 4LOCA 3P9KA 3E7QA 1QHGA 1OCZH 2MA3A 4UB6C 1LVKA 3HB9A 4W1UA 2FA5A 4XL9A 1JJ8C 4Q5SF 4HNUA 2PBIA 4MQVA 4N9IA 5JVGF 3NI7A 1WH7A 2NVXJ 4CCOA 5B66C 3JRFA 3WTSC 4CCLA 4M3EA 4O3MA 2W82A 5F0FA 1G3YA 2HTJA 1JKOC 4FE7A 3HYIA 3HUGB 4V19K 2QVOA 4NN1A 4HYEA 3I56I 3H3UA 2F5FA 2K86A 1G4DA 1HQCA 2LLKA 2G7GA 1SD4A 3OYAA 3WE3A 4NC6A 2LMDA 3BCBA 4RAFA 1L3LA 4IHWA 3OOUA 4PJLA 5D5VB 2F2EA 2M5WA 1FJLA 2Y0SN 4D0PA 1YJWI 4D7NA 3JSPA 3VOKA 4UXNA 1HW5A 3L00A 3PM1A 2IJLA 4HV5A 1ZYRF 3BJ6A 3WODF 1YG2A 1QRYA 2WB1N 1IO2A 2NXNB 3I0TA 4ZTFA 3GW2A 5IYCJ 1X19A 2XKOA 3H5AA 3DWLE 3U1DA 1WSUA 4P9UA 1ETOA 3CO7C 3T8RA 4C2MJ 2OERA 1V55H 1TWAJ 4PK4A 2DQLA 2QKOA 4XLNF 1MSFC 4MGRA 5CQEA 4Y52J 4AU7A 2DOEA 5J1YA 2VQGA 1O4XA 1UMQA 2DFFA 3VOXA 3D5RC 2E5ZA 3LSGA 4U9NA 3I4MJ 5JVTA 2A3SA 4M6YA 1SFKA 1NHAA 2BZTA 2YR2A 1ON1A 4ENMA 1EH7A 3QPHA 2LD5A 3ZOBA 5D4RA 5IP7J 5JR3A 1UCRA 3JRBA 3HSEA 2GLOA 5J1UA 4IHVA 2AXLA 3BR0A 4Q48A 1AKHA 2YU3A 3SFIA 3GFIA 1VQLI 4LLGF 3JRIA 4GRIA 4C2TA 5CW8A 1A5JA 1T39A 1DQUA 3HJEA 5DTDA 2KIQA 1K6YA 5E17F 1ZKGA 3FK6A 3HKZN 2H8WA 1WRJA 2TDXA 2Q2EA 3TW6A 1ORKA 4PJMA 2LG4A 2K4BA 5AONA 3LSHA 2ZCNA 2REKA 1XS9A 2WTEA 1TL8A 1H9TA 1G3TA 3ISPA 3IP4B 3F1BA 5D6FA 2XB5A 2CV2A 1FY7A 2XUBA 4XRSA 5J8CA 3OL3A 5DYMA 4G7ZF 3BRUA 2CUEA 1UHSA 4ESBA 2ELJA 3EUKL 2R3SA 2W7NA 1JUPA 3O8GA 1NH3A 5FKMA 4FISA 3K4JA 3Q0UA 5B1AH 3OL4A 1Z21A 2JA8J 5H6QA 1ENHA 2LY2A 3G71I 1R22A 1IN8A 3BTIA 3GBGA 5HS9A 1JKPC 1T0FA 1XMXA 4BNCA 2ESNA 5IT3A 1J7KA 4RM3A 1GUUA 1ZLJA 2L3DA 1RETA 1SFUA 4I99C 3AG1H 1JHFA 2WUIA 2LP0A 4HLXA 3K4CA 2AHQA 3HSRA 2YVEA 4M3BA 4HBLA 2M34A 2FMLA 2EJRA 2D45A 1D1AA 2PMHA 1ZRFA 1Z6RA 2LRDA 4JBAA 2AQEA 2RV8A 2DJIA 1D5YA 4MEYF 5GTIC 2VT3A 2XGEA 3DPLC 5J4VA 4PXIA 1XG1A 1I1SA 5F1RA 1IUFA 2L2OA 1TZLA 2JUGA 2OU2A 1O57A 2K9QA 2ZOYA 3S3OA 3GTPJ 4XOTA 3HIFA 3GTQJ 1WWXA 1IC8A 5KK1A 3VPRA 3I59B 1GLNA 4U0YA 1YITI 4XM3A 4BDZA 3BTJA 1MMDA 2EFOA 3K9TA 3E6DA 3LMMA 5CXGA 4M3GA 5HODA 1YI2I 3BR2A 3S8PA 3L1PA 2QSGX 2JA7J 5D18A 1U5TA 1VNDA 4ZZLA 2VJ5A 1I6HJ 2CUJA 2E5NA 5EG0A 3RPUA 4BL0B 3VYSB 4PCQA 4XLPF 3ZQIA 3MWMA 3HPHA 3HTJA 2JN6A 2K7LA 2F4IA 2ZMEC 3CJDA 1AOYA 2MLKA 2A68F 2H6BA 2CUZA 4ZDLA 2XV4S 3K1MA 1BI2A 4M74A 2UUZA 2WAEA 1QHHD 4FETA 1ITYA 2BGCA 2PEXA 4JX5A 3MZ8A 2ZXIA 4RAZA 4TV7A 4B43A 1K61A 1YRNA 2LY1A 4MLOA 3R0JA 4XKBA 3D0SA 3V7RA 1JKQC 3O3KA 1POGA 4FCYA 2BOLA 2Y0MA 1Z91A 3GFLA 4EGYA 4KN7X 5ICEA 4HLYA 1UHMA 3VYTB 1K79A 2KZVA 3PIPF 1R1TA 1R1UA 4LG0B 4PUSA 1T38A 3L2UA 3S14J 1N25A 1QVUA 4N9HA 2DO7A 4A93J 2DA3A 5D5WB 5E1ZB 3DEUA 1TC3C 2E19A 2Y69H 3F22A 2XAGA 3GWZA 1E17A 4Q47A 1LE8B 3OIPA 1Z3XA 3TO9A 4YFNF 2ZY9A 3N4MA 3ZGKA 2HOSA 2DW4A 2XRLA 4UB8C 3MEXA 1T8IA 4E7SA 2MBFA 2IAIA 2O8KA 1E0EA 2DT5A 5D5XB 2FBHA 4F52A 3J7ZI 2P6SA 1GDTA 1SVOA 2WAQN 2HYJA 3HUGA 3LA3A 2RASA 3CMAI 2EFWA 4KNYA 4KFCA 2FUG2 1RIOH 1TWHJ 3M7GA 3LL7A 4FQGA 2CG4A 4YIRX 4ZC3A 1B9NA 3H3VK 2H1LA 2I10A 3SDBA 1ZQ3P 1I6XA 1X1DA 2VC0A 3ASNH 3OS0A 5DD8A 4XLFA 4A3GJ 1LJ9A 2OC6A 4BY7J 1U6GA 5HDGA 3PL8A 1ZELA 4AD9A 1SAXA 4P55A 2MC4A 5FRNA 2ZO4A 3KIOA 4RLQA 5FKNA 3OYLA 1JUSA 1K4SA 1YJNI 2F07A 1W0UA 1REPC 1X1BA 3ABKH 4YZEA 2VJ4A 2LREA 1W7PA 2DTZA 1MGTA 3BY6A 4XLHA 5F0CA 3WTVC 4S05A 4HDUA 2NOJB 4U7DA 4OAYA 1V5EA 4LLLA 2BVLA 3WTXC 5M5WJ 5E1XA 2GENA 4M9XA 4L9TA 1QPIA 1Z6TA 2FMYA 1B9MA 2XPWA 3VIBA 2R7ZJ 1DP3A 3ZMVA 3IUVA 4F3QA 3ZMSA 2OTLI 1A6IA 4XLAA 4UUSB 3LSKA 3KEQA 1MNMC 1D0ZA 5IY5H 4J00A 3I4NJ 2DG7A 1Y1WJ 1X2NA 1X3WB 5HNFA 1NG6A 1X3ZB 2A5WA 5EZGA 4A0XA 2H6CA 2EV6A 3E3VA 1MNEA 5E8GA 2X6YA 3IL2A 2FSWA 2WWYA 4OIOF 4IEJA 1PUFB 2ZXWH 1E3OC 3JRGA 3TO7A 2GOXB 2M9HA 2VJJA 3A03A 2DK8A 3C2GA 5E3MA 3A4CA 2P6TA 1TT5B 4WXDA
chains in the Genus database with same CATH topology
1ZR2A 1EF4A 1LFUP 3BR6A 4DYQA 3IH3A 2NP3A 3S17J 5HBUA 4AUXA 2QOPA 4DZJA 3JRCA 2K40A 2CU7A 5IPAA 1K83J 3S1QJ 3HGYA 2QF7A 3JSJA 3O8HA 1ETKA 2HOAA 2D6YA 2UXIA 2L7ZA 5M5YJ 1U9OA 2GUHA 1MBEA 2DMNA 1MH3A 2X48A 2TCTA 3SJMA 3FK7A 2UXHA 3GTLJ 1LFBA 1I50J 3KZ9A 2VI6A 4A3MJ 2WV1A 1UI5A 3KNWA 1ETQA 4D5CA 3S2DJ 2EZKA 3BJBA 2G3BA 2CQQA 2FBQA 4ICHA 5J3LA 4XIDA 5F1JA 4XRMA 5M5XJ 5K58A 4NDLA 2JK3A 2G0EA 5F27A 3A01B 1W0TA 2RAEA 1HF0A 2LK2A 4JX6A 3NXCA 2NS8A 5EFYA 1Z0XA 2HKUA 4J19A 2MW8A 3LSJA 3CWRA 2D5VA 3EUPA 2QWTA 1JKRC 3OSFA 2DA2A 2XB0X 4JYKA 3QKXA 1RESA 2Y2ZA 3WHBA 2HQ5A 1FIAA 2WGBA 1MBGA 3BTCA 3CCYA 4I76A 4A3DJ 1ZK8A 4CGRA 2YVHA 2MG4A 3HTAA 2EQRA 1Q1VA 3ZQFA 2W48A 3HIMA 1UI6A 4A3LJ 1ZTRA 3MN2A 2IEKA 2CRGA 3BG5A 5JLXA 1NK3P 3RQIA 2XSDC 1T33A 4GFBA 2VPRA 2NVYJ 4A3KJ 5EYRA 3S1MJ 4AYBN 1AHDP 5IYBJ 2YUSA 2H8RA 2AO9A 4DYCA 3LSPA 1WGXA 3T6NA 3S5RA 2PBXA 3QQAA 5K7ZA 2ELKA 1R9TJ 4JL3A 5EDNA 2ME6A 3VVZA 1YRNB 1T56A 3NPIA 3PPBA 3M4OJ 3G56A 2RHAA 2M8GX 5C4JJ 1JT6A 2FJ1A 4MFDA 3LJLA 5D1RA 2KT0A 4A3JJ 3C2BA 5D19A 2ECCA 4A3FJ 4A3BJ 4AC6A 3Q0WA 5DAJA 1WPKA 1F36A 2K9SA 2UXOA 2GM4A 2XDNA 2ECBA 4MXMA 1IJWC 4FE4A 2R5ZB 2R0QC 4D5FA 2JJ7A 2E2IJ 4LOCA 3E7QA 1P7IA 1HLVA 3VW1A 5DS9A 3O60A 2CJJA 1X2MA 5GPCA 2L7FP 3HB9A 4W1UA 2UXUA 1JJ8C 3VW2A 1Y1VJ 5EEAA 3NI7A 1GVDA 1WH7A 2ME0A 2NVXJ 3JRFA 1SFOJ 4ME9A 2HXOA 3BR5A 4M3EA 3S15J 5F0FA 3E7LA 4HKUA 3S1NJ 1JKOC 2XPVA 4FE7A 5HAWA 2NX4A 4NN1A 5IOZA 2E2JJ 3BNIA 2LLKA 2R93J 1BA5A 2G7GA 2Q24A 4XK4A 3KKCA 3CDLA 3GTGJ 3BT9A 4IHWA 3OOUA 5GP9A 1LE8A 2FD5A 5H9TA 3RH2A 3TP0A 1FJLA 2Y0SN 3OSGA 4D7NA 3VOKA 1BW5A 1MH4A 3PM1A 2HI3A 1HOMA 4Y7NJ 1H8AC 1JUMA 1Z77A 3OIOA 3GEUA 1QRYA 2WB1N 2LR8A 5IYCJ 4JX4A 1IDZA 4MO7A 1OCTC 3S1RJ 1ETOA 3BCGA 4CYCB 4C2MJ 3HOVJ 2OERA 1TWAJ 2MGQA 3S2HJ 2QKOA 1MSFC 2LVSA 3H0GJ 5BNGA 5E3LA 3CQZJ 3PO3J 2DA5A 4Y52J 4W97A 2XPUA 5J1YA 4ACIA 1O4XA 1UMQA 1OFCX 5F04A 3VOXA 2K9NA 1BW6A 1U8BA 3LSGA 1MBJA 1GT0C 5IOYA 3I4MJ 1WI3A 3QPSA 1QVTA 1UG2A 3G1OA 2KDZA 2L7MP 2VKVA 3DCFA 3HE0A 2OI8A 2HYTA 2LD5A 3ZOBA 2L0KA 4MFEA 5IP7J 3JRBA 1TWFJ 2OF7A 2GLOA 5J1UA 4KWAA 4RDUA 4IHVA 3BR0A 1AKHA 1ZR4A 4GCTA 3SFIA 3VUQA 3JRAA 3JRIA 3G1LA 4M3FA 4BKXA 1SANA 5CW8A 5F08A 1IGNA 3M3YJ 1A5JA 2GBYA 2GFNA 5DTDA 2E1OA 1MBKA 1ZKGA 3FK6A 3HKZN 1RR7A 1IV6A 3TW6A 3RZOJ 1ORKA 2JA6J 2IU5A 2ZCMA 2FQ4A 3BG9A 3HOXJ 2ZCNA 1U78A 4BXXJ 2REKA 5GPAA 2VUMJ 1ETVA 3JR9A 1XS9A 3EGQA 2PZ9A 3IV5A 4GFKA 5EGOB 3F1BA 4C3JJ 2XB5A 1B72B 4XRSA 3KKDA 3JRDA 2CUEA 1UHSA 3BRUA 3TP3A 3AQTA 1U9NA 2G7SA 4UDSA 3W6VA 3ANGA 3LWJA 1ETXA 4B1RA 1JUPA 3O8GA 2HOTA 4BY1J 3G7RA 5FKMA 2NVQJ 4IHXA 2DMPA 4FISA 2DJNA 2EZHA 3Q0UA 9ANTA 1H88C 1FTZA 2YU9J 2JA8J 3HOYJ 4RBOA 3G1MA 1ENHA 1GV2A 5FKKA 3BTIA 3GBGA 1JKPC 4B4CA 4MK6A 5FLMJ 2DA6A 3Q0VA 4XICA 1GUUA 4DW6A 5FGLA 1RETA 2N8GA 3IH2A 3QPLA 2WUIA 2LP0A 1OJLA 2AHQA 2YVEA 3BQYA 4M3BA 2M34A 2L9RA 5IYDJ 3PASA 4GCKA 2ID3A 1D5YA 1HDDC 2MSYA 4L62A 2LY9A 2XGEA 5HSZA 1WH5A 2DN0A 3WHCA 3BTLA 3MVPA 4PXIA 1XG1A 1AKHB 1MBFA 1NTCA 3ZQLA 2NVTJ 1IUFA 2K9QA 3TEDA 3HOWJ 3S16J 3ZQHA 2HXIA 4BBRJ 4S0HB 3GTPJ 2ZOYA 2HDDA 5FKOA 4C3HJ 1BL0A 3GTQJ 5CXIA 1FEXA 1IC8A 1DU6A 3VPRA 3UKGA 4QTRA 3LHQA 2DA4A 5EF6A 1OCPA 2X6OA 3JREA 3BTJA 4QIWN 4JP0A 3QBMA 2DA1A 3A01A 1JJ6C 2QIBA 5CXGA 4M3GA 4G12A 5IP6A 5HODA 3NAUA 3BR2A 3L1PA 2JWTA 2JA7J 2XGDA 5D18A 1VNDA 1I6HJ 3ZQGA 1RPWA 2CQXA 5EG0A 2JMWA 3JRHA 3GTMJ 3ZQIA 3CMYA 3GTKJ 2V57A 4JNNA 3COLA 4M6VA 2Y31A 5IP9J 2JN6A 3HTJA 4A69C 2COBA 5M3FJ 4HNVA 3HOZJ 3CJDA 1ZGWA 4I6ZA 3DPJA 2Y9YA 4FTHA 5E3OA 2NOGA 1JTYA 2EBIA 3RZDJ 2NP5A 3C07A 4DZPA 3NARA 5FJ8J 2QTQA 3GTJJ 3RD3A 4A3CJ 1ITYA 3Q3SA 5K7FA 1P7JA 2Y9ZA 2EH3A 4JX5A 5FMPA 5M3MJ 2JA5J 4UUTA 4D7MA 2P81A 1BJZA 1K61A 3RKQA 5FKLA 1YRNA 3HDDA 4MLOA 2LKXA 3HBLA 4V2FA 1JKQC 5JLWA 1DU0A 1POGA 4FCYA 4EEFG 3GZIA 5AQCA 5E3MA 5FLVA 1IRZA 1IDYA 4JKZA 2OPTA 3LSRA 3LNQA 2YS9A 1I3QJ 5C44J 3ZQCA 3BHQA 5J1RA 2R5ZA 2R5YA 3PO2J 3S14J 1G2HA 1B8IA 1S7EA 1QVUA 4A93J 4AF5A 2DA3A 1AU7A 5K7HA 1H89C 3CRJA 1TC3C 1VI0A 2E19A 1IG7A 1LE8B 3AQSA 3MNLA 2O9LA 4M3DA 5EG0B 3B6CA 4UUSA 2VKEA 5EZHA 2HOSA 3HTHA 5C4YA 3FIWA 4A3IJ 3TW7A 2XRLA 2LTPA 2IAIA 2O8KA 2X9DA 3FRQA 2IBDA 3HEFA 4B3AA 1GDTA 2M2EA 2WAQN 2HYJA 1FIPA 2RASA 2PMZN 1NK2P 3FISA 4X6AJ 5C3EJ 3VW0A 2QCOA 1JTXA 1TWHJ 2H1KA 2UXPA 1PUFA 3D1NI 4C3IJ 2R92J 4QSHA 3ON4A 2FX0A 3H3VK 1TWCJ 4MIMA 2I10A 1ZQ3P 4GCLA 2ZCXA 5FHPA 3B81A 4DYRA 2Y30A 4A3GJ 3V78A 4ABZA 1WCMJ 3ON2A 1JGGA 3A02A 1VFCA 1F43A 4BY7J 3FKIJ 2O7TA 4A3EJ 1JT0A 3HTIA 5F0HA 2ID6A 3P9TA 3VP5A 1APLC 2B63J 3BR1A 2DA7A 4L5EA 5FKNA 2M0CA 1MSEC 4CYCA 1JUSA 2F07A 4IHYA 2XGCA 1W0UA 4YZEA 4NELA 1HCRA 2DTZA 3VVYA 5F0CA 1XC5A 3HOUJ 3K2AA 3K7AJ 1HDPA 4BBSJ 2DG8A 4GFLA 3IH4A 3ANPA 2R5YB 3BR3A 1B8IB 2EZIA 3MKLA 5M5WJ 2O7OA 1GV5A 3BQZA 2GENA 2ZB9A 1QPIA 1MBHA 4X1EA 2G7LA 2W53A 2XPWA 2EZLA 1ETYA 3NRGA 2R7ZJ 3VIBA 2LFBA 3IUVA 1TWGJ 1RKWA 1A6IA 4UUSB 3VVXA 3GTOJ 1CQTA 1MNMC 3SDGA 1RKTA 2CUFA 1ETWA 3I4NJ 2DMQA 1Y1WJ 1SGMA 2DG7A 2ZOZA 1X2NA 3DEWA 2DMTA 5EZGA 2TRTA 5C4XJ 1X58A 3NNRA 4AC0A 5E3NA 3HM5A 1VF9A 3BG3A 2DMUA 4V2GA 3LOCA 4IEJA 1PUFB 1E3OC 3JRGA 1FTTA 5EGOA 2M9HA 3A03A 4XRSG 3V6GA 2E2HJ 2NS7A 3HGGA 3F0CA 3B6AA 1B72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR2 A;  1EF4 A;  1LFU P;  3BR6 A;  4DYQ A;  3IH3 A;  2NP3 A;  3S17 J;  5HBU A;  4AUX A;  2QOP A;  4DZJ A;  3JRC A;  2K40 A;  2CU7 A;  5IPA A;  1K83 J;  3S1Q J;  3HGY A;  2QF7 A;  3JSJ A;  3O8H A;  1ETK A;  2HOA A;  2D6Y A;  2UXI A;  2L7Z A;  5M5Y J;  1U9O A;  2GUH A;  1MBE A;  2DMN A;  1MH3 A;  2X48 A;  2TCT A;  3SJM A;  3FK7 A;  2UXH A;  3GTL J;  1LFB A;  1I50 J;  3KZ9 A;  2VI6 A;  4A3M J;  2WV1 A;  1UI5 A;  3KNW A;  1ETQ A;  4D5C A;  3S2D J;  2EZK A;  3BJB A;  2G3B A;  2CQQ A;  2FBQ A;  4ICH A;  5J3L A;  4XID A;  5F1J A;  4XRM A;  5M5X J;  5K58 A;  4NDL A;  2JK3 A;  2G0E A;  5F27 A;  3A01 B;  1W0T A;  2RAE A;  1HF0 A;  2LK2 A;  4JX6 A;  3NXC A;  2NS8 A;  5EFY A;  1Z0X A;  2HKU A;  4J19 A;  2MW8 A;  3LSJ A;  3CWR A;  2D5V A;  3EUP A;  2QWT A;  1JKR C;  3OSF A;  2DA2 A;  2XB0 X;  4JYK A;  3QKX A;  1RES A;  2Y2Z A;  3WHB A;  2HQ5 A;  1FIA A;  2WGB A;  1MBG A;  3BTC A;  3CCY A;  4I76 A;  4A3D J;  1ZK8 A;  4CGR A;  2YVH A;  2MG4 A;  3HTA A;  2EQR A;  1Q1V A;  3ZQF A;  2W48 A;  3HIM A;  1UI6 A;  4A3L J;  1ZTR A;  3MN2 A;  2IEK A;  2CRG A;  3BG5 A;  5JLX A;  1NK3 P;  3RQI A;  2XSD C;  1T33 A;  4GFB A;  2VPR A;  2NVY J;  4A3K J;  5EYR A;  3S1M J;  4AYB N;  1AHD P;  5IYB J;  2YUS A;  2H8R A;  2AO9 A;  4DYC A;  3LSP A;  1WGX A;  3T6N A;  3S5R A;  2PBX A;  3QQA A;  5K7Z A;  2ELK A;  1R9T J;  4JL3 A;  5EDN A;  2ME6 A;  3VVZ A;  1YRN B;  1T56 A;  3NPI A;  3PPB A;  3M4O J;  3G56 A;  2RHA A;  2M8G X;  5C4J J;  1JT6 A;  2FJ1 A;  4MFD A;  3LJL A;  5D1R A;  2KT0 A;  4A3J J;  3C2B A;  5D19 A;  2ECC A;  4A3F J;  4A3B J;  4AC6 A;  3Q0W A;  5DAJ A;  1WPK A;  1F36 A;  2K9S A;  2UXO A;  2GM4 A;  2XDN A;  2ECB A;  4MXM A;  1IJW C;  4FE4 A;  2R5Z B;  2R0Q C;  4D5F A;  2JJ7 A;  2E2I J;  4LOC A;  3E7Q A;  1P7I A;  1HLV A;  3VW1 A;  5DS9 A;  3O60 A;  2CJJ A;  1X2M A;  5GPC A;  2L7F P;  3HB9 A;  4W1U A;  2UXU A;  1JJ8 C;  3VW2 A;  1Y1V J;  5EEA A;  3NI7 A;  1GVD A;  1WH7 A;  2ME0 A;  2NVX J;  3JRF A;  1SFO J;  4ME9 A;  2HXO A;  3BR5 A;  4M3E A;  3S15 J;  5F0F A;  3E7L A;  4HKU A;  3S1N J;  1JKO C;  2XPV A;  4FE7 A;  5HAW A;  2NX4 A;  4NN1 A;  5IOZ A;  2E2J J;  3BNI A;  2LLK A;  2R93 J;  1BA5 A;  2G7G A;  2Q24 A;  4XK4 A;  3KKC A;  3CDL A;  3GTG J;  3BT9 A;  4IHW A;  3OOU A;  5GP9 A;  1LE8 A;  2FD5 A;  5H9T A;  3RH2 A;  3TP0 A;  1FJL A;  2Y0S N;  3OSG A;  4D7N A;  3VOK A;  1BW5 A;  1MH4 A;  3PM1 A;  2HI3 A;  1HOM A;  4Y7N J;  1H8A C;  1JUM A;  1Z77 A;  3OIO A;  3GEU A;  1QRY A;  2WB1 N;  2LR8 A;  5IYC J;  4JX4 A;  1IDZ A;  4MO7 A;  1OCT C;  3S1R J;  1ETO A;  3BCG A;  4CYC B;  4C2M J;  3HOV J;  2OER A;  1TWA J;  2MGQ A;  3S2H J;  2QKO A;  1MSF C;  2LVS A;  3H0G J;  5BNG A;  5E3L A;  3CQZ J;  3PO3 J;  2DA5 A;  4Y52 J;  4W97 A;  2XPU A;  5J1Y A;  4ACI A;  1O4X A;  1UMQ A;  1OFC X;  5F04 A;  3VOX A;  2K9N A;  1BW6 A;  1U8B A;  3LSG A;  1MBJ A;  1GT0 C;  5IOY A;  3I4M J;  1WI3 A;  3QPS A;  1QVT A;  1UG2 A;  3G1O A;  2KDZ A;  2L7M P;  2VKV A;  3DCF A;  3HE0 A;  2OI8 A;  2HYT A;  2LD5 A;  3ZOB A;  2L0K A;  4MFE A;  5IP7 J;  3JRB A;  1TWF J;  2OF7 A;  2GLO A;  5J1U A;  4KWA A;  4RDU A;  4IHV A;  3BR0 A;  1AKH A;  1ZR4 A;  4GCT A;  3SFI A;  3VUQ A;  3JRA A;  3JRI A;  3G1L A;  4M3F A;  4BKX A;  1SAN A;  5CW8 A;  5F08 A;  1IGN A;  3M3Y J;  1A5J A;  2GBY A;  2GFN A;  5DTD A;  2E1O A;  1MBK A;  1ZKG A;  3FK6 A;  3HKZ N;  1RR7 A;  1IV6 A;  3TW6 A;  3RZO J;  1ORK A;  2JA6 J;  2IU5 A;  2ZCM A;  2FQ4 A;  3BG9 A;  3HOX J;  2ZCN A;  1U78 A;  4BXX J;  2REK A;  5GPA A;  2VUM J;  1ETV A;  3JR9 A;  1XS9 A;  3EGQ A;  2PZ9 A;  3IV5 A;  4GFK A;  5EGO B;  3F1B A;  4C3J J;  2XB5 A;  1B72 B;  4XRS A;  3KKD A;  3JRD A;  2CUE A;  1UHS A;  3BRU A;  3TP3 A;  3AQT A;  1U9N A;  2G7S A;  4UDS A;  3W6V A;  3ANG A;  3LWJ A;  1ETX A;  4B1R A;  1JUP A;  3O8G A;  2HOT A;  4BY1 J;  3G7R A;  5FKM A;  2NVQ J;  4IHX A;  2DMP A;  4FIS A;  2DJN A;  2EZH A;  3Q0U A;  9ANT A;  1H88 C;  1FTZ A;  2YU9 J;  2JA8 J;  3HOY J;  4RBO A;  3G1M A;  1ENH A;  1GV2 A;  5FKK A;  3BTI A;  3GBG A;  1JKP C;  4B4C A;  4MK6 A;  5FLM J;  2DA6 A;  3Q0V A;  4XIC A;  1GUU A;  4DW6 A;  5FGL A;  1RET A;  2N8G A;  3IH2 A;  3QPL A;  2WUI A;  2LP0 A;  1OJL A;  2AHQ A;  2YVE A;  3BQY A;  4M3B A;  2M34 A;  2L9R A;  5IYD J;  3PAS A;  4GCK A;  2ID3 A;  1D5Y A;  1HDD C;  2MSY A;  4L62 A;  2LY9 A;  2XGE A;  5HSZ A;  1WH5 A;  2DN0 A;  3WHC A;  3BTL A;  3MVP A;  4PXI A;  1XG1 A;  1AKH B;  1MBF A;  1NTC A;  3ZQL A;  2NVT J;  1IUF A;  2K9Q A;  3TED A;  3HOW J;  3S16 J;  3ZQH A;  2HXI A;  4BBR J;  4S0H B;  3GTP J;  2ZOY A;  2HDD A;  5FKO A;  4C3H J;  1BL0 A;  3GTQ J;  5CXI A;  1FEX A;  1IC8 A;  1DU6 A;  3VPR A;  3UKG A;  4QTR A;  3LHQ A;  2DA4 A;  5EF6 A;  1OCP A;  2X6O A;  3JRE A;  3BTJ A;  4QIW N;  4JP0 A;  3QBM A;  2DA1 A;  3A01 A;  1JJ6 C;  2QIB A;  5CXG A;  4M3G A;  4G12 A;  5IP6 A;  5HOD A;  3NAU A;  3BR2 A;  3L1P A;  2JWT A;  2JA7 J;  2XGD A;  5D18 A;  1VND A;  1I6H J;  3ZQG A;  1RPW A;  2CQX A;  5EG0 A;  2JMW A;  3JRH A;  3GTM J;  3ZQI A;  3CMY A;  3GTK J;  2V57 A;  4JNN A;  3COL A;  4M6V A;  2Y31 A;  5IP9 J;  2JN6 A;  3HTJ A;  4A69 C;  2COB A;  5M3F J;  4HNV A;  3HOZ J;  3CJD A;  1ZGW A;  4I6Z A;  3DPJ A;  2Y9Y A;  4FTH A;  5E3O A;  2NOG A;  1JTY A;  2EBI A;  3RZD J;  2NP5 A;  3C07 A;  4DZP A;  3NAR A;  5FJ8 J;  2QTQ A;  3GTJ J;  3RD3 A;  4A3C J;  1ITY A;  3Q3S A;  5K7F A;  1P7J A;  2Y9Z A;  2EH3 A;  4JX5 A;  5FMP A;  5M3M J;  2JA5 J;  4UUT A;  4D7M A;  2P81 A;  1BJZ A;  1K61 A;  3RKQ A;  5FKL A;  1YRN A;  3HDD A;  4MLO A;  2LKX A;  3HBL A;  4V2F A;  1JKQ C;  5JLW A;  1DU0 A;  1POG A;  4FCY A;  4EEF G;  3GZI A;  5AQC A;  5E3M A;  5FLV A;  1IRZ A;  1IDY A;  4JKZ A;  2OPT A;  3LSR A;  3LNQ A;  2YS9 A;  1I3Q J;  5C44 J;  3ZQC A;  3BHQ A;  5J1R A;  2R5Z A;  2R5Y A;  3PO2 J;  3S14 J;  1G2H A;  1B8I A;  1S7E A;  1QVU A;  4A93 J;  4AF5 A;  2DA3 A;  1AU7 A;  5K7H A;  1H89 C;  3CRJ A;  1TC3 C;  1VI0 A;  2E19 A;  1IG7 A;  1LE8 B;  3AQS A;  3MNL A;  2O9L A;  4M3D A;  5EG0 B;  3B6C A;  4UUS A;  2VKE A;  5EZH A;  2HOS A;  3HTH A;  5C4Y A;  3FIW A;  4A3I J;  3TW7 A;  2XRL A;  2LTP A;  2IAI A;  2O8K A;  2X9D A;  3FRQ A;  2IBD A;  3HEF A;  4B3A A;  1GDT A;  2M2E A;  2WAQ N;  2HYJ A;  1FIP A;  2RAS A;  2PMZ N;  1NK2 P;  3FIS A;  4X6A J;  5C3E J;  3VW0 A;  2QCO A;  1JTX A;  1TWH J;  2H1K A;  2UXP A;  1PUF A;  3D1N I;  4C3I J;  2R92 J;  4QSH A;  3ON4 A;  2FX0 A;  3H3V K;  1TWC J;  4MIM A;  2I10 A;  1ZQ3 P;  4GCL A;  2ZCX A;  5FHP A;  3B81 A;  4DYR A;  2Y30 A;  4A3G J;  3V78 A;  4ABZ A;  1WCM J;  3ON2 A;  1JGG A;  3A02 A;  1VFC A;  1F43 A;  4BY7 J;  3FKI J;  2O7T A;  4A3E J;  1JT0 A;  3HTI A;  5F0H A;  2ID6 A;  3P9T A;  3VP5 A;  1APL C;  2B63 J;  3BR1 A;  2DA7 A;  4L5E A;  5FKN A;  2M0C A;  1MSE C;  4CYC A;  1JUS A;  2F07 A;  4IHY A;  2XGC A;  1W0U A;  4YZE A;  4NEL A;  1HCR A;  2DTZ A;  3VVY A;  5F0C A;  1XC5 A;  3HOU J;  3K2A A;  3K7A J;  1HDP A;  4BBS J;  2DG8 A;  4GFL A;  3IH4 A;  3ANP A;  2R5Y B;  3BR3 A;  1B8I B;  2EZI A;  3MKL A;  5M5W J;  2O7O A;  1GV5 A;  3BQZ A;  2GEN A;  2ZB9 A;  1QPI A;  1MBH A;  4X1E A;  2G7L A;  2W53 A;  2XPW A;  2EZL A;  1ETY A;  3NRG A;  2R7Z J;  3VIB A;  2LFB A;  3IUV A;  1TWG J;  1RKW A;  1A6I A;  4UUS B;  3VVX A;  3GTO J;  1CQT A;  1MNM C;  3SDG A;  1RKT A;  2CUF A;  1ETW A;  3I4N J;  2DMQ A;  1Y1W J;  1SGM A;  2DG7 A;  2ZOZ A;  1X2N A;  3DEW A;  2DMT A;  5EZG A;  2TRT A;  5C4X J;  1X58 A;  3NNR A;  4AC0 A;  5E3N A;  3HM5 A;  1VF9 A;  3BG3 A;  2DMU A;  4V2G A;  3LOC A;  4IEJ A;  1PUF B;  1E3O C;  3JRG A;  1FTT A;  5EGO A;  2M9H A;  3A03 A;  4XRS G;  3V6G A;  2E2H J;  2NS7 A;  3HGG A;  3F0C A;  3B6A A;  1B72 A; 
#chains in the Genus database with same CATH topology
 1I5Z A;  1EF4 A;  2BBY A;  2VON A;  3IH3 A;  4ZYG A;  2NP3 A;  4L5I A;  3E5X A;  1HC8 A;  3T8T A;  2IGM A;  2HR3 A;  5IPA A;  2DYS H;  3JSJ A;  3O8H A;  1WJB A;  5DEQ A;  2GXG A;  3V7C A;  1WJC A;  3J81 Z;  2GUH A;  2DMN A;  2X48 A;  3IC7 A;  2G7H A;  2V9P A;  5HS8 A;  5L3B A;  1Y56 A;  2KIU A;  3K10 A;  1XGN A;  1WJE A;  2FF4 A;  3M1C A;  1FBU A;  2FE3 A;  2X1D A;  1FYK A;  3R61 A;  3ABT A;  3S2D J;  4KT5 C;  3K0L A;  5K58 A;  4XID A;  5M5X J;  1PP7 U;  1LPQ A;  4EMS A;  1YOV B;  2R7T A;  2DDB A;  3A01 B;  2RAE A;  1W5S A;  3O6B B;  4F92 B;  1LFP A;  2BY3 A;  3BPV A;  3BRO A;  2NNY A;  1K78 B;  4J19 A;  1YX3 A;  4LD5 A;  5BMZ A;  1IAW A;  3EUP A;  4HOB A;  2QWT A;  1H0M A;  3VWB A;  3OSF A;  2DA2 A;  3U1K A;  3RCO A;  2Z16 A;  3MMY B;  2DYR H;  3WHB A;  2UWM A;  2PJR A;  4RB2 C;  1MMS A;  3S93 A;  4L9V A;  3HIM A;  1GHC A;  2K4J A;  3FM3 A;  4BJ6 C;  5LGN A;  1ZTR A;  4A3L J;  3MN2 A;  2IEK A;  1JGS A;  2BV6 A;  4GO1 A;  4Y4R A;  2VPR A;  2YSR A;  3L2C A;  2LYC A;  3N97 A;  2EIL H;  3BG6 A;  2IGN A;  5CLS A;  1TW3 A;  1WGX A;  2D1H A;  3WTT C;  1OIS A;  3K4B A;  4XR6 A;  5K7Z A;  3OYN A;  1P92 A;  3K4K A;  3E5Q A;  3HG9 A;  4I0B A;  3KEO A;  4OIR F;  3LSM A;  4ZDO A;  2F6C A;  1YW8 A;  2RQQ A;  4AIK A;  3T0Y A;  4E6K G;  1N78 A;  5A2Q Z;  2M8G X;  3GYH X;  5C4J J;  1AA7 A;  3QRF F;  1A31 A;  3DU6 A;  2KT0 A;  3B02 A;  2R7R A;  2Y0S A;  4A3F J;  2W24 A;  4AC6 A;  3PUB A;  4Y3O A;  2ZKZ A;  3K1N A;  4A6D A;  1F36 A;  4HNT A;  2OZU A;  3B73 A;  4WCG A;  2XDN A;  4U9L A;  4NC7 A;  1IJW C;  5FLX K;  4N4O B;  2XKP A;  5FB2 A;  4KIB A;  2WB1 A;  1IN6 A;  5IT9 K;  3VW1 A;  3F0C A;  1RR8 C;  3K8P C;  2ELH A;  1Y8R B;  3CLO A;  2UXU A;  1G3W A;  3FM5 A;  1VQ6 I;  1VQM I;  2XDV A;  1PJR A;  2DAO A;  2DI3 A;  3QP6 A;  1FMW A;  2E34 A;  3MQ0 A;  1J9I A;  1A04 A;  2HXO A;  1IRF A;  2QEN A;  5HAW A;  1TNS A;  1PP8 F;  3CO6 C;  3WU2 C;  5IOZ A;  4ZZD A;  1Z9C A;  3E6C C;  4LG0 A;  3BNI A;  1O3T A;  4KN4 X;  4HX8 A;  3FXK A;  4QPQ A;  2GAU A;  2Q24 A;  5DDG A;  2X6W A;  2XAJ A;  4CZC A;  3GTG J;  3C1D A;  1S7A A;  3CCU I;  3CDH A;  3BC8 A;  3BT9 A;  4HST A;  5GP9 A;  1VQ9 I;  4UHT A;  2PLY A;  1LE8 A;  2RKH A;  2HPM A;  3RH2 A;  5L3D A;  3FMR A;  2X1E A;  4EVI A;  3HKZ A;  4D1Q A;  3EET A;  3W3C A;  4AIH A;  3H35 A;  2JTV A;  1H8A C;  1JUM A;  3F6V A;  3OIO A;  1MJB A;  1BBY A;  2RQP A;  3J7Y J;  3H0D A;  1OCT C;  1XTA A;  3R6S A;  3BCG A;  2K02 A;  5FRM A;  2JSC A;  3G4S I;  4XRF A;  3TL4 X;  5TIS C;  1QZY A;  2P4W A;  5E3L A;  3VOE A;  4UVC A;  3PO3 J;  3N05 A;  2DA5 A;  4W97 A;  2HFH A;  5F04 A;  3BCA A;  1FOW A;  2J5O A;  1BW6 A;  1CF7 A;  3MKY B;  1GT0 C;  2OCE A;  3QPS A;  1XN7 A;  3QYB A;  4G9Y A;  2L7M P;  4GGG A;  1TQM A;  1R4M B;  4G6Q A;  2A61 A;  2F5D A;  2ZXH A;  3DCF A;  3WE2 A;  4U0W A;  2ZC2 A;  2HYT A;  1HST A;  1P2F A;  2R7O A;  1MMA A;  1TWF J;  2R7X A;  4EV0 A;  3AKZ A;  3BJO A;  3OYH A;  2F5V A;  2L7K A;  5K1Y A;  1S3J A;  4BKX A;  4HG2 A;  1ZG3 A;  1IGN A;  3M3Y J;  4BHB A;  2GBY A;  2FQ3 A;  2KFD A;  2NYX A;  2GFN A;  2E1O A;  1XCV A;  3PSF A;  2R7Q A;  1BC7 C;  3J80 Z;  2NRA C;  2XGX A;  5CVU A;  2DLL A;  2XAF A;  2IW5 A;  2CQ7 A;  4BXX J;  5F6F A;  1LEA A;  1ETV A;  4DIQ A;  3EGQ A;  3H9Q A;  4ETS A;  2QEX I;  3MZH A;  3AL0 C;  1QNT A;  4E4H A;  3SXY A;  4PSX A;  4HSR A;  2DOA A;  3SZG A;  2EV5 A;  3AQT A;  3CUQ C;  2A2F X;  1U0J A;  4UDS A;  1D1C A;  3W6V A;  1YLF A;  3CZ6 A;  4B1R A;  3I4P A;  1HW1 A;  3HOT A;  3CCE I;  2B0L A;  3DKW A;  4XKV A;  1XMK A;  3SHF A;  2HOT A;  3ABL H;  2DMP A;  2NVQ J;  3G7R A;  3V42 A;  9ANT A;  4PGH A;  1TLH B;  4DGW B;  3W6J B;  3LFK A;  2YU9 J;  2KIS A;  4KIT B;  3M1E A;  3M8J A;  4RB1 A;  3DKX A;  4GXO A;  5LD2 C;  1LKX A;  3TO6 A;  4CCK A;  1EJ9 A;  3Q0V A;  4KMF A;  4BXU A;  1KQ9 A;  2W57 A;  4GCV A;  2N8G A;  2WAD A;  2Z3Y A;  3HRU A;  2VXZ A;  1OJL A;  3DBL B;  3NS4 A;  2L9R A;  3G3Z A;  3MAJ A;  1LDJ A;  3HXL A;  1T08 B;  2E7W A;  5J4Y A;  5JFR A;  4GCK A;  1G3S A;  3SQN A;  2PI0 A;  3ECH A;  1O7F A;  5HSZ A;  4L0Z B;  3WHC A;  1XB4 A;  3BTL A;  3GUD A;  3MVP A;  2ISZ A;  2XAU A;  1DP7 P;  1MBF A;  5LGU A;  2EIM H;  2K27 A;  2NVT J;  1R6R A;  1LDK B;  2EFQ A;  4KIS A;  3FBI B;  5F64 A;  3HOW J;  3DXJ F;  3EYY A;  1SFX A;  5FKO A;  2OTJ I;  5CXI A;  2OJE D;  1DU6 A;  1FEX A;  2GOM A;  3UKG A;  3LHQ A;  3NWS A;  2DA4 A;  1FNN A;  1BR1 A;  3BP8 A;  4JP0 A;  4IKF A;  2DA1 A;  2DFH A;  2AXT C;  1VZ0 A;  4HV6 A;  5HDN A;  5IP6 A;  2QKM B;  4G12 A;  3A01 A;  1JJ6 C;  2QIB A;  1FBQ A;  3OIQ A;  1LB2 A;  3W6K B;  2MD0 A;  1A6Q A;  4NQW B;  1UJ8 A;  3ZQG A;  1RPW A;  3RSN A;  1C0W A;  3DU5 A;  4E7Z A;  1XDU A;  1FOY A;  5CKT A;  2JMW A;  3KLN A;  2IA1 A;  3ZQ7 A;  3GTM J;  4G6D A;  2BEO A;  3CMY A;  3GTK J;  3COL A;  2GQQ A;  1WJF A;  4ZDP A;  4XON A;  3RIR A;  3S2W A;  4A0Z A;  2COB A;  4A69 C;  4HNV A;  5M3F J;  5HVQ C;  1ZGW A;  1MD0 A;  4MTE A;  2NOG A;  1JTY A;  2XHK A;  3D5S C;  5K5Q A;  1R49 A;  2YX4 A;  4DZP A;  1RUO A;  1W5T A;  4WWC A;  4XLE A;  4G6T B;  2P5K A;  2XIG A;  4XSX F;  1T2K A;  1W36 C;  5CPR B;  2HGC A;  2WAQ A;  2L9N A;  2MH9 A;  4GYI A;  4BQN A;  4BU2 A;  5K5O A;  3HRS A;  1P4W A;  5FMP A;  3F8M A;  1FT9 A;  4UUT A;  5D6E A;  5GTH C;  3GZ6 A;  1BJZ A;  3LQQ A;  3CCL I;  3RKQ A;  2VC1 A;  3HBL A;  2E71 A;  4EEF G;  3I58 A;  5LHG A;  5JI6 A;  5FLV A;  3F72 A;  3KFW X;  4IX7 A;  2OPT A;  1XGS A;  2DDA A;  3FHZ A;  4IZZ A;  3LNQ A;  2YS9 A;  5TGT A;  1I3Q J;  2XRO A;  5LBQ A;  5C44 J;  3ZQC A;  1VQK I;  4LIV A;  3CME I;  2R5Y A;  2LH9 A;  1G2H A;  1B8I A;  1S7E A;  1O3Q A;  3CRJ A;  4ZYH A;  1BOA A;  2Q1Z B;  1IG7 A;  2XC7 A;  3AQS A;  3K1P A;  3MNL A;  4MNU A;  2O9L A;  2STW A;  2V4J C;  4C9Y A;  4Q4Z F;  3RKW A;  3F8N A;  5ICF A;  2KJC A;  2P0W A;  1J75 A;  4EM0 B;  2CFO A;  3QYF A;  4A5N A;  1LUJ B;  3FRQ A;  3HEF A;  5L3E A;  2CYY A;  4IXA A;  2M2E A;  3RTR A;  3JAM Z;  1W5C C;  1FIP A;  2K9M A;  3W2W A;  1NK2 P;  3FIS A;  4MHG A;  4AIJ A;  1KA8 A;  1XSX A;  2QCO A;  2HPI A;  3HSF A;  3IKV A;  4MQ9 F;  2H1K A;  1SVM A;  1D3Y A;  3TQN A;  2EA4 A;  2A69 F;  3QOD A;  2MLG A;  4GCL A;  4L5J A;  3HPG A;  1F5T A;  3GZ5 A;  4DYR A;  2Y30 A;  2GA1 A;  2YX7 A;  4ANJ A;  3ON2 A;  5LRR A;  4FAS D;  1VFC A;  1F43 A;  2O7T A;  3ONQ A;  4IOC F;  2CW7 A;  3L09 A;  4YIF A;  3L2W A;  3P9T A;  3GO5 A;  2CQN A;  1D8K A;  2HNH A;  3BR1 A;  4L5E A;  1MSE C;  1V54 H;  3L9F A;  1I3A A;  5ILU A;  1IN4 A;  2O0Y A;  4G94 A;  2V9V A;  4R8H A;  1KQ8 A;  1YX5 A;  3EQL F;  2JRM A;  2UXX A;  5FD6 A;  4BBS J;  3IAS 2;  1HDP A;  3K7A J;  4BQQ A;  4GFL A;  2L02 A;  5EEH A;  2FBI A;  4RLF A;  3DV8 A;  4EM1 A;  3PNY A;  1RC9 A;  4F55 A;  3BQZ A;  2ZB9 A;  5DD4 A;  1MBH A;  3DTI A;  1T95 A;  3KZI C;  4X1E A;  1HKT A;  1I39 A;  3EPZ A;  1R5H A;  3ZMT A;  2W84 A;  3NRG A;  3UNG C;  4ASN A;  3RI4 A;  1RKW A;  5BS6 A;  3VVX A;  4A12 A;  5DCM B;  2DU9 A;  4QLC U;  4CIC A;  3DEW A;  2DMT A;  3PNT A;  2A6E F;  4BYY A;  2TRT A;  5DV5 A;  5C4X J;  4HF0 A;  3H9J A;  1PUE E;  3CCJ I;  1X58 A;  1HBX G;  3CCQ I;  1OMI A;  4IRV A;  4C2U A;  4AC0 A;  2M87 A;  2ZSI B;  3HM5 A;  1E2X A;  1IRG A;  2VJI A;  3GZN B;  2DMU A;  2L01 A;  3OYJ A;  2A05 A;  2JRT A;  2XAS A;  4IQJ A;  3H5N A;  2BY0 A;  4RB3 C;  3HGG A;  4KIG A;  3CC4 I;  4AF5 A;  5TRD A;  2D2W A;  1LFU P;  4BH9 A;  3WG7 H;  2VKH A;  4F93 B;  1OYW A;  3GXO A;  4DNC A;  1SFE A;  4DZJ A;  2K40 A;  3C18 A;  4YII A;  1F9N A;  4LG3 A;  3HGY A;  2QF7 A;  4PGG A;  4OOI A;  1ETK A;  2HOA A;  1WHU A;  2L7Z A;  5M5Y J;  3AL0 B;  1JE8 A;  4PJJ A;  3D5L A;  1YHQ I;  2ZJR F;  1WFX A;  3K4L A;  2QLZ A;  3RKX A;  3SJM A;  2MYS A;  3F8B A;  1I50 J;  3CUQ B;  4A3M J;  2WV1 A;  1UI5 A;  1EKE A;  3KPH A;  3FWE A;  2FBQ A;  2EIN H;  4ICH A;  1R23 A;  2R7W A;  4RGR A;  3QAH A;  4NDL A;  2R7S A;  2LK2 A;  4F91 B;  3PSI A;  1FX7 A;  1E3P A;  4RGU A;  2HKU A;  2EWN A;  2EK5 A;  5HS7 A;  1A36 A;  1YO5 C;  2D5V A;  2Q0O A;  1RUN A;  3WTU C;  1QZE A;  2EIK H;  4E7K A;  1T0F C;  3BOQ A;  3LQR A;  2QQ9 A;  1MBG A;  2ADU A;  1FWZ A;  4A3D J;  5D8L B;  4CGR A;  3ZRG A;  4M73 A;  4B09 A;  2HQA A;  5KHD A;  1QA6 A;  3SZP A;  1Q1V A;  2Z5U A;  1UB9 A;  1UI6 A;  5KAI C;  2E60 A;  2M7A A;  2DT7 B;  4NC8 A;  2CRG A;  1UHW A;  5JLX A;  1Q1H A;  4Y33 A;  2L9S A;  1DPU A;  2ZSH B;  3FF5 A;  3S1M J;  2OQR A;  2QYO A;  4NQW A;  1AHD P;  2GA2 A;  2YUS A;  3KEY A;  4C30 A;  2AO9 A;  1R5I D;  5CVI A;  3J7A O;  3KYD B;  1BIB A;  4XOR A;  1TQP A;  3DTE A;  1R9T J;  4JL3 A;  3JCU C;  2KRF A;  5D5U B;  2VOP A;  3NPI A;  3WTZ A;  5LEK A;  4R1H A;  2QM3 A;  3M4O J;  3G56 A;  1OCC H;  5J40 A;  4ESF A;  1XPX A;  2FJ1 A;  3LAJ A;  4MFD A;  3LJL A;  2BXZ A;  4OD4 A;  5D1R A;  1A35 A;  2G9W A;  1U5T C;  2ECC A;  4XKC A;  3WTW C;  3Q0W A;  4B44 A;  2E1C A;  2K9S A;  1ZGA A;  3LST A;  3KP5 A;  4NBQ A;  4MXM A;  4FE4 A;  3RDI A;  3AG2 H;  4GYG A;  1R7J A;  5GAE J;  2E2I J;  3A0H C;  4RGX A;  4P1W A;  1HLV A;  3RJP A;  3IUO A;  2H94 A;  3O60 A;  2X0L A;  2CJJ A;  5GPC A;  1YJ9 I;  4G8X A;  1ZHF A;  2M45 A;  2P7V B;  2Y75 A;  1GVD A;  2QUF A;  2WC2 A;  1DUX C;  2UV1 A;  2HDC A;  4YFK F;  3S15 J;  3PQK A;  1EA3 A;  2CH0 A;  4HKU A;  2HU9 A;  3S1N J;  4OIP F;  3P5J A;  4Z2Y A;  2NNN A;  2NVU B;  3WG9 A;  2NX4 A;  5CVR A;  3BZK A;  1OLT A;  1YIO A;  2KZG A;  3M8F A;  3IAM 2;  4BAY A;  3G2B A;  2R93 J;  4XK4 A;  1BA5 A;  3KKC A;  3CDL A;  3EUA A;  3L2Q A;  2W85 A;  2Z9O A;  5BOX A;  3PQJ A;  3IRR A;  3AAF A;  1UG0 A;  4MEX F;  4UV8 A;  1IN7 A;  4CCM A;  4CSW A;  5H9T A;  4EQQ A;  3OV8 A;  4AWX B;  1WJ5 A;  2KPM A;  1K6O A;  4CO8 A;  1MJ9 A;  1Y0N A;  2A6T A;  3ZQQ A;  3ZMU A;  4U7B A;  1MH4 A;  1YIJ I;  3K70 C;  1HOM A;  2BW3 B;  2HQR A;  2K3F A;  2F4O B;  4CYD A;  1FMV A;  3GEU A;  3GVA A;  1IDZ A;  4MO7 A;  2CS3 A;  4CYC B;  3H1C A;  3IHU A;  3OYK A;  2L4A A;  3HOV J;  2VN2 A;  2MGQ A;  4XN0 A;  2LVS A;  3H0G J;  5BNG A;  3O2P E;  3A0B C;  3EUH A;  5DUI A;  1TW2 A;  5H2F C;  4ACI A;  1OFC X;  4BAC A;  2VBX A;  3VDX A;  1U8B A;  1MBJ A;  2XAH A;  1KU9 A;  4HDV A;  1QVT A;  1UG2 A;  2VKV A;  4IL6 C;  4UNO A;  2IGK A;  3WU0 A;  1SD6 A;  1CGP A;  2V1X A;  2X1C A;  1UST A;  5LRS A;  4MFE A;  4KWA A;  2OF7 A;  1WJD A;  3C3W A;  4RDU A;  1FOX A;  1FOK A;  4KUM A;  4GCT A;  2KQR A;  1STZ A;  4NUB A;  1KU7 A;  5CQG A;  4RAY A;  1SAN A;  3ECO A;  5E8I A;  2VXD A;  4AVZ A;  2Z1D A;  3CP2 A;  1LQ1 A;  3G73 A;  1RR7 A;  2OD5 A;  4JQF A;  1KYZ A;  3I59 A;  2JSP A;  2IU5 A;  3BG9 A;  1FC3 A;  2VQL A;  2CQK A;  5GPA A;  2VUM J;  4BHC A;  4L0Y B;  1FSH A;  3IV5 A;  5EGO B;  1J2X A;  2PQ8 A;  1B72 B;  2JQ7 A;  2E35 A;  3VTI A;  3OWT A;  2GXB A;  3KKD A;  1FP1 D;  5HLT A;  3V7S A;  1U9N A;  2WAF A;  1VTN C;  3OY9 A;  2CV0 A;  2HYF A;  2VB6 A;  4BY1 J;  1Z67 A;  4U0V A;  4CXF A;  4A6E A;  5A2Q K;  2DJN A;  3I54 A;  1OKR A;  2EV0 A;  2XF6 A;  1H88 C;  3I64 A;  3V8K A;  3H36 A;  1FTZ A;  4ZYA A;  4KIF A;  4LK0 F;  4I09 A;  1ZG5 A;  3PUF A;  3CTA A;  3DP7 A;  2W4S A;  4XQF A;  4WX9 A;  4B4C A;  1QU3 A;  3U2R A;  2VE9 A;  2F5E A;  5FGL A;  5GAD J;  2LBF B;  2ZME B;  4CH7 A;  3ELK A;  2XVC A;  3PFI A;  2B9S A;  2FOW A;  2L54 A;  5IYD J;  2WY8 Q;  3ULQ B;  2FU4 A;  4BGD A;  3F8F A;  4OWR B;  3DPU A;  1HDD C;  4FX4 A;  2LY9 A;  2P5V A;  3RKY A;  1ZG1 A;  1JHH A;  4BEH B;  2A5Y B;  1AKH B;  4RS8 A;  1VQO I;  1BJA A;  2B7E A;  2K85 A;  5ICG A;  3ZQL A;  1O3R A;  3FXU A;  4BBR J;  2HXI A;  3ABM H;  4S0H B;  3KP4 A;  1IXR C;  4WXH A;  4C3H J;  2Q2E B;  1BL0 A;  2JPB A;  2WV0 A;  3OMY A;  1UAA A;  4IOA F;  2X6O A;  4KMU X;  3QBM A;  2FEZ A;  2A6H F;  1TTY A;  5E1W A;  3Q9S A;  1DPR A;  5FLX Z;  3E97 A;  1ZN2 A;  3SEZ A;  2IS1 A;  4HQM A;  4LJZ F;  5K5R A;  1Z1D A;  3KLO A;  1TP4 A;  2DTR A;  2JVH A;  2KRC A;  2QGU A;  4E7I A;  3I9V 2;  4HEA 2;  4J01 A;  4YFX F;  3DPT A;  5CJ9 A;  2QZ8 A;  2C6Y A;  3FXO A;  2CQX A;  5HLI A;  3JRH A;  3GX4 X;  1TT0 A;  3DBH B;  3CCS I;  1JI8 A;  3FXM A;  3CCV I;  2V57 A;  4M6V A;  2RC4 A;  2Y31 A;  2RDP A;  1J09 A;  3BJA A;  1UZC A;  3HOZ J;  4HRI A;  4HQE A;  3FKJ A;  4AID A;  4OAZ A;  1T98 A;  3JTH A;  2PMU A;  4I6Z A;  1ON2 A;  4OU0 A;  2Y9Y A;  3V8J A;  3I3L A;  2O03 A;  2EA2 A;  1EH6 A;  3AG3 H;  4KJZ A;  3FMQ A;  4ZYD A;  3OYC A;  2ZJQ F;  2KJB A;  2NP5 A;  5KCM A;  4LGW A;  4XSZ F;  4QPO A;  4HZF A;  3NAR A;  5D8K B;  5FJ8 J;  2QTQ A;  3RD3 A;  3NQO A;  2KHM A;  1Y8Q B;  1S9H A;  2IRF G;  3Q3S A;  1P7J A;  1BR2 A;  2Y9Z A;  2G7U A;  3R0A A;  4DOZ A;  2VBZ A;  2O8X A;  3FX3 A;  5M3M J;  4D7M A;  4E7J A;  2P81 A;  2Z33 A;  4BE2 A;  1G59 A;  3HDD A;  4NHJ A;  1FBS A;  2HS5 A;  2LKX A;  1DU0 A;  3ZMD A;  3GZI A;  5AQC A;  1IRZ A;  2V6E A;  4DVY P;  1IDY A;  4JKZ A;  2CMP A;  2W00 A;  3KP6 A;  1B59 A;  2FOK A;  2X85 A;  2E36 A;  3QYE A;  4II3 A;  3BHQ A;  4WK8 F;  3RYR A;  4BS9 A;  2W25 A;  2OBP A;  5KAF C;  1UEL B;  1WQ2 A;  2PG4 A;  3OS1 A;  2OQG A;  4A5M A;  3QPT A;  2KP6 A;  3NWT A;  1AU7 A;  1YW7 A;  2QSF X;  1VI0 A;  4LB6 B;  4EM2 A;  3QU3 A;  1LEB A;  2WA0 A;  2MD5 A;  2QWW A;  4UVA A;  4BE1 A;  5FD5 A;  5EG0 B;  3HTH A;  4UUS A;  2VKE A;  5E20 A;  1N75 A;  3CD6 I;  5C4Y A;  3MCZ A;  2LTP A;  2X4H A;  2RN7 A;  3KZZ A;  2IBD A;  4B3A A;  3TBI A;  1BI3 A;  2ZBK A;  3COA C;  1U8R A;  2XF7 A;  2Y48 A;  4YEJ A;  3VW0 A;  1X3U A;  2LF7 A;  1JTX A;  1YQA A;  1PUF A;  1VQ8 I;  3KP7 A;  2QQA A;  3D1N I;  4H4K C;  4K2E A;  2R92 J;  3ON4 A;  1P4A A;  2FX0 A;  4MIM A;  2HYG D;  3NEU A;  1AWC A;  5BPD A;  4CCN A;  2GIV A;  3V78 A;  2F4M B;  4P96 A;  1WCM J;  5H20 A;  2VL8 A;  3V4G A;  4ABZ A;  2IS4 A;  3A02 A;  1JT0 A;  1R5G A;  5F0H A;  3HHG A;  4EAT A;  2IA0 A;  4GDF A;  3C2H A;  1V3F A;  2HKO A;  2XAQ A;  4RA2 A;  1APL C;  3VP5 A;  3P7N A;  2E1M C;  4CYC A;  2PJP A;  3L7W A;  4IHY A;  3I53 A;  1RZ4 A;  2B1E A;  1I27 A;  4PJ0 C;  3IRQ A;  4NEL A;  5FGM A;  1HCR A;  2D1V A;  4XLC A;  3VVY A;  1XC5 A;  3EDP A;  2CO5 A;  1J59 A;  3X2Q H;  3HOU J;  4CZZ A;  2DG8 A;  3BLY A;  3ANP A;  4Y13 A;  3BR3 A;  3CP8 A;  1O3S A;  3W2V A;  2HDW A;  1X4O A;  2EZI A;  1BIA A;  2O7O A;  2Q8K A;  2JUC A;  3R4K A;  3OYB A;  2EZL A;  1Z7U A;  1ETY A;  1Z7L A;  3ZPL A;  1K78 A;  4BQA A;  4MTD A;  4XNF A;  1TWG J;  1X1C A;  3SWH A;  3L2V A;  3SDG A;  4RM2 A;  1ONV A;  1DDN A;  1SGM A;  5ILS A;  2ZOZ A;  1R00 A;  2ZJ2 A;  2KKO A;  3LFU A;  2ZNZ A;  1K4T A;  4DBR A;  3DFG A;  2XSJ C;  3TDU C;  1WJA A;  2DOD A;  3CJN A;  3LAP A;  2VPL A;  1S8N A;  3WGG A;  4QWQ A;  4V2G A;  3LOC A;  1IXS B;  1FTT A;  4CUG A;  5EGO A;  4CDG A;  3KX2 A;  4A3I J;  2E2H J;  1IUY A;  3V6G A;  4E70 A;  1ZR2 A;  1B72 A;  5LGT A;  2CWE A;  1YS6 A;  1IF1 A;  3S17 J;  5HBU A;  1SAU A;  3BWG A;  1YTY A;  3F6O A;  1KON A;  2V1N A;  2JT1 A;  2VE8 A;  2DQR A;  2QOP A;  2W1O A;  3S1Q J;  2OUM A;  4N4N B;  4B3X A;  2VLA A;  1U3E M;  1B4A A;  2FXA A;  2UXI A;  3GEZ A;  4FHT A;  1EH8 A;  1MDM B;  1HSJ A;  2CW8 A;  5FFX A;  1ERD A;  1HA8 A;  3ZN1 A;  2TCT A;  3Q9V A;  1DGW Y;  3GTL J;  2COM A;  3KZ9 A;  2HEO A;  4RAG A;  1W7P B;  5DM6 F;  2DFI A;  2HTS A;  2EZK A;  3I55 I;  2KRH A;  3E6M A;  3HZJ A;  3BJB A;  1SEU A;  2G3B A;  1U2W A;  5B5E C;  2LBF A;  3K6G A;  4NNJ A;  2ZME A;  5J3L A;  3CJR B;  5F1J A;  4XRM A;  3CJQ B;  2LC2 A;  1W36 D;  5E18 F;  5BQT A;  2P8T A;  4ZJZ A;  2JK3 A;  1SMT A;  2VBY A;  2G0E A;  3WU1 B;  5F27 A;  1W0T A;  5ERI A;  4JX6 A;  2VKD A;  1RRJ A;  1DGR M;  4O5V A;  2NS8 A;  5EFY A;  1Z0X A;  1VQ7 I;  5LHH A;  3CC2 I;  3LSJ A;  4YG2 F;  3KE2 A;  4BEH A;  2F48 A;  1JKR C;  3S3M A;  3JAM K;  1OCR H;  4JYK A;  4EJW A;  3FBN B;  2HVR A;  4LIU A;  2HQ5 A;  1E3H A;  1MIJ A;  4I76 A;  2YVH A;  5KVR A;  4PJN A;  2EQR A;  2W48 A;  2BVM A;  1IRX A;  1XGO A;  2OCC H;  4IHS A;  2XSD C;  1T33 A;  3BG7 A;  2NVY J;  3QOP A;  5EYR A;  4AYB N;  2DPU A;  3AG4 H;  5ICC A;  2JPC A;  5IYB J;  2R7D A;  4YRV A;  4X0G A;  4G7O F;  4DYC A;  2ZJP F;  3S5R A;  2PBX A;  2MC3 A;  3AFH A;  3QQA A;  1HKQ A;  2HVQ A;  4ENJ A;  3ML6 A;  2K3P A;  2OA4 A;  2YPR A;  4WF2 A;  5EDN A;  3OS2 A;  3DBR B;  3VVZ A;  1BI0 A;  1KZH A;  3M07 A;  2BHZ A;  2OZ6 A;  3PPB A;  3U9G A;  3QU6 A;  3V8L A;  1G6N A;  1JT6 A;  4EJT A;  2ZNY A;  2NAZ A;  2LKP A;  4IPA A;  2DK5 A;  4XBF A;  2QSH X;  3VYR B;  1K7A A;  5DAJ A;  2UXO A;  2VBW A;  2GM4 A;  2PN6 A;  3VSL A;  2HVS A;  2ECB A;  3FXR A;  5EEG A;  2DCE A;  2R5Z B;  4CGZ A;  2R0Q C;  2P7C B;  2JJ7 A;  1PYV A;  4KYW A;  1P7I A;  5DS9 A;  3DQV C;  3FXL A;  3CCR I;  1X2M A;  2L7F P;  4U87 A;  1OQY A;  3TMO A;  4M71 A;  3VW2 A;  2WY7 Q;  1Y1V J;  3S32 A;  1JXS A;  4OIQ F;  5EEA A;  4I02 A;  1O7L A;  1FYL A;  2ME0 A;  1R1V A;  3HOS A;  3A2K A;  2BY1 A;  1D8J A;  2RRE A;  3KP2 A;  1SFO J;  1YFH A;  4ME9 A;  2PJR B;  3F3X A;  1Z3Y A;  3BR5 A;  3KET A;  5LFA A;  3E7L A;  1S5L C;  3TOB A;  5KNL A;  4OD5 A;  2XPV A;  3DLA A;  3CF5 F;  2XRN A;  3HRM A;  4UVB A;  3MKW B;  2E2J J;  4A2U A;  4BXF A;  3KYL A;  3I5U A;  3K69 A;  1MMN A;  1BM9 A;  2K9L A;  3MFK A;  2FD5 A;  4DBQ A;  1P9Q C;  2VT2 A;  1EV7 A;  2EIJ H;  3TP0 A;  4ZTJ A;  3OSG A;  4HW0 A;  4Z6Y A;  2O5R A;  2M4K A;  1BW5 A;  2FNA A;  4AVP A;  1OR7 A;  3OYF A;  2F5C A;  2HI3 A;  1VQ4 I;  4Y7N J;  2LF8 A;  4IO9 F;  2M30 A;  2QKL B;  3CLQ A;  1Z77 A;  1KYW A;  2L4M A;  2I5U A;  2LR8 A;  2KIM A;  3MD2 A;  4JX4 A;  4I98 B;  2IA2 A;  2Z99 A;  3IKT A;  3S1R J;  4FX0 A;  3WGH A;  3WTY C;  4HPQ A;  2ZCW A;  2OAZ A;  4XOP A;  1B1B A;  3S2H J;  1J0R A;  3CQZ J;  4RMN A;  2V79 A;  2M7B A;  4E7L A;  2IS6 A;  1Y0U A;  2XPU A;  3U21 A;  1QQI A;  2K9N A;  2O6G E;  3VFZ A;  2PMZ A;  2JA2 A;  4BE0 A;  5IOY A;  5AIQ A;  1WI3 A;  4UV9 A;  3G1O A;  2M3A A;  2KDZ A;  3P9I A;  4UUV A;  3H92 A;  1QO0 D;  3E5U A;  2DXI A;  1ZH5 A;  3HE0 A;  2OI8 A;  1QGP A;  2IXS A;  2DOF A;  2L0K A;  1WI9 A;  4C2M A;  1ZR4 A;  1D1B A;  3VUQ A;  1S7O A;  2QQB A;  3JRA A;  4CA0 A;  3G1L A;  4M3F A;  2DPD A;  5F08 A;  4O6J A;  1FLI A;  2B3W A;  2Z2S B;  1MBK A;  5TJJ A;  1VQN I;  3RYP A;  3M8E A;  2HOE A;  1IV6 A;  1ODD A;  1L0O C;  4WXC A;  3RZO J;  3FXQ A;  2JA6 J;  2ZCM A;  2E1M B;  3HHH A;  2FQ4 A;  4RB0 A;  3HOX J;  1U78 A;  3KP3 A;  4PDK A;  3JR9 A;  1KGS A;  3T5X A;  2PZ9 A;  4GFK A;  3FHN A;  4IRH A;  2H27 A;  2MAB A;  1XMA A;  4C3J J;  4HF1 A;  3OR2 C;  3CJT B;  2ACJ A;  3J7A Y;  4KA4 A;  2RGV A;  2V26 A;  3JRD A;  2M1B A;  2KL4 A;  3TP3 A;  3REO A;  2ISY A;  4HA8 A;  2EFP A;  2G7S A;  3LWJ A;  3ANG A;  4ZH4 F;  1ETX A;  1LNW A;  2QBY B;  3F23 A;  3NRV A;  4AM3 A;  4IHX A;  1D5V A;  3SZT A;  3CC7 I;  1TBX A;  3CES A;  2EZH A;  3LA7 A;  2BYV E;  2ESH A;  1F1Z A;  3HOY J;  4RBO A;  3G1M A;  4LMY A;  4I2O A;  1GV2 A;  5FKK A;  5EJC A;  4N0B A;  5DUK A;  2IT0 A;  3T1B A;  4MK6 A;  2O3F A;  5FLM J;  3FZV A;  2DA6 A;  3OYM A;  4BQO A;  4XIC A;  4DW6 A;  3GCM A;  3GME A;  4B47 A;  5L3G A;  3IH2 A;  4FT8 A;  3QPL A;  3OYE A;  2VOD A;  2I8D A;  6PAX A;  1CF7 B;  3BQY A;  2IS2 A;  1USS A;  3GF2 A;  2A07 F;  2M8E A;  3TOA A;  4RGS A;  1SVL A;  3IWF A;  5L3C A;  1ZLK A;  5J47 A;  1M1E B;  1H9G A;  1ZRD A;  3PAS A;  2ID3 A;  1MDM A;  2MSY A;  5J8F A;  3OYI A;  4L62 A;  5LLQ A;  1WH5 A;  2DN0 A;  4R79 A;  2LKS A;  3S3N A;  3ASO H;  4H0E A;  1S29 A;  4ESJ A;  1NTC A;  2JVG A;  3DTK A;  2LSO A;  2PFV A;  3F9K A;  1HKS A;  1ZAR A;  1XSV A;  3TED A;  3S16 J;  2RNJ A;  3ZQH A;  3GLL A;  4HAM A;  5L3F A;  1MKM A;  2ZXJ A;  2HDD A;  1G8X A;  1KU2 A;  3CMM A;  1ULY A;  4NB5 A;  4QTR A;  1OR7 C;  5AIP A;  4OMY A;  3MZY A;  1OCP A;  2VQH A;  5CVJ A;  3RPU D;  4QIW N;  5EF6 A;  4L9N A;  3JRE A;  2CV1 A;  3DF8 A;  3BZC A;  4YEL A;  5HLG A;  2GZW A;  3NAU A;  5DM7 F;  2R7V A;  2JWT A;  4KIC A;  2XGD A;  4G7H F;  3I71 A;  2CFX A;  3LA2 A;  3HTS B;  4LK1 F;  4HF2 A;  1QZZ A;  2H09 A;  2LOO A;  3J81 K;  2DBB A;  3HC7 A;  4JNN A;  3CUO A;  5IP9 J;  1LVA A;  1XCB A;  2BHY A;  3BZ6 A;  4DJA A;  1VQP I;  2BE5 F;  4BDY A;  1GVJ A;  4M9S A;  1XSD A;  2FJI 1;  4F7Z A;  3DPJ A;  1MND A;  4FTH A;  1I1G A;  5E3O A;  5HOO A;  2EBI A;  4XKW A;  2KDO A;  1QPM A;  3L2R A;  3RZD J;  2ETH A;  3C07 A;  3GTJ J;  3P9C A;  5E79 C;  1RI7 A;  3ZN0 A;  3CDI A;  3ERM A;  3OYG A;  4A3C J;  1HW2 A;  3BPX A;  4PFO A;  5B3S H;  3PNV A;  5K7F A;  3OYD A;  1PDN C;  3IWZ A;  2EH3 A;  2JA5 J;  1XDS A;  5GAG J;  3K70 D;  1V5G A;  1YW9 A;  5FKL A;  1B6A A;  4Y17 A;  2CSO A;  4WIB A;  4IQ4 A;  1SD5 A;  3VB2 A;  3VSK A;  4V2F A;  5D4S A;  5JLW A;  3DEE A;  3HL2 A;  2UXN A;  1IXC A;  3KZY A;  5FO5 A;  3TKY A;  3RQ4 A;  3LSR A;  1V5F A;  1TQI A;  4LFU A;  3SEQ A;  3JW4 A;  4IRI A;  5J1R A;  2R5Z A;  1S72 I;  3PO2 J;  3JTG A;  2CGP A;  1KU3 A;  4BUP A;  2O61 A;  5K7H A;  1H89 C;  1VQ5 I;  4P5O A;  3KCC A;  4B8X A;  3OR1 C;  1FP2 A;  2V1U A;  4KDP A;  5JHU A;  3ZR8 X;  2EFN A;  1FSE A;  3F21 A;  5ED4 A;  4M3D A;  3B6C A;  4IRG A;  2V1D A;  3K4M A;  5EZH A;  2X6X A;  5DCM A;  3FIW A;  3TW7 A;  3H9G A;  2MH2 A;  4M9Z A;  2X9D A;  2ZFU A;  2LDU A;  1BI1 A;  4ITV A;  2FRH A;  2PMZ N;  1BR4 A;  4X6A J;  5C3E J;  3FMS A;  4D9J A;  3FDY A;  4II2 A;  2UXP A;  2HZD A;  1OYY A;  1YYV A;  5B1B H;  2KMU A;  3EYI A;  2UZK A;  1OYI A;  4C3I J;  4QSH A;  1BC8 C;  1TWC J;  3LWF A;  2ZCX A;  3SYT A;  5FHP A;  3B81 A;  3KYC B;  2VAS A;  4XN3 A;  2AS5 F;  2R4G A;  1YS7 A;  1SC7 A;  2K5C A;  1JGG A;  3QWL A;  4BHP A;  4I7H A;  1W7P D;  2L9V A;  3FKI J;  2LNB A;  3GFJ A;  4A3E J;  3HTI A;  2NS0 A;  2ID6 A;  5J6X A;  3A1Y A;  2B63 J;  1IW7 F;  2DA7 A;  3C7J A;  2M0C A;  3ESW B;  3ZP5 A;  2IVM A;  1FPQ A;  4ZYE A;  2IPQ X;  2XGC A;  4OIN F;  3Q5F A;  4EJV A;  3CUQ A;  4EGZ A;  1IZ1 A;  2L5Q A;  4HX7 A;  2AQF A;  2V9K A;  3MKZ A;  2QA4 I;  4IF4 A;  3K2A A;  3QOE A;  4P9F A;  2RNG A;  3IH4 A;  4XMY A;  2R5Y B;  4BJT A;  1B8I B;  4PZJ A;  3MKL A;  1X4P A;  1GV5 A;  2DFE A;  2IP2 A;  4I01 A;  4ON0 A;  2G7L A;  1W1W E;  3ZMZ A;  2W53 A;  2VIX A;  3WGI A;  2GXA A;  5IT9 Z;  2LFB A;  1X1A A;  4PFP A;  2PFB A;  2MFZ A;  4EJO A;  4HX4 A;  4PSW A;  3GTO J;  1CQT A;  3M9A A;  3R60 A;  3W2A A;  1XGM A;  1RKT A;  2CUF A;  1ETW A;  2STT A;  2DMQ A;  1OPC A;  2PX9 A;  5GAH J;  3EUH C;  1TNT A;  1XD7 A;  5CYV A;  3NNR A;  5E3N A;  5FFZ A;  1VF9 A;  3RPQ A;  3VOD A;  3BG3 A;  3F8C A;  4S04 A;  4IVN A;  4M72 A;  1W4M A;  4LB5 A;  1MJA A;  1R58 A;  1R4N B;  2R7U A;  4XRS G;  2E1N A;  5HDK A;  4IJA A;  2NS7 A;  1HXD A;  3B6A A;  2V7F A;  1N77 A;  3BR6 A;  2HKX A;  4DYQ A;  2IGO A;  3VEP A;  2GIZ A;  3CCM I;  4AUX A;  3HTU A;  2EB7 A;  2XF5 A;  3JRC A;  2CU7 A;  2FNP A;  2KIF A;  1K83 J;  5CVV A;  2VQC A;  1SMY F;  2QBY A;  2QQ8 A;  2J5P A;  2VOO A;  2D6Y A;  1V4R A;  1MMG A;  1U9O A;  1MBE A;  3CF2 A;  1QBJ A;  1MH3 A;  3QP5 A;  4EJU A;  2R7F A;  2RVC A;  3E0J B;  1KQ0 A;  3FK7 A;  2UXH A;  4AYB A;  4IHT A;  1LFB A;  3OOP A;  3K2Z A;  3TDZ C;  2X51 A;  1NG7 A;  2CW0 F;  2OV7 A;  3ROU A;  2YVX A;  1YE9 A;  2VI6 A;  3E1S A;  4L9J A;  4Y15 A;  5LHI A;  2V6C A;  3J80 K;  3KNW A;  1ETQ A;  1ZGJ A;  4D5C A;  5HNH A;  1WKM A;  1GXQ A;  1IV8 A;  4LIT A;  1MW7 A;  2CQQ A;  4CCJ A;  1UFM A;  1F4K A;  1FYM A;  2EPF A;  1T6S A;  4BJ5 C;  1PVE A;  5ILV A;  3PIO F;  1ACI A;  4I0A A;  1HF0 A;  2BY2 A;  3NXC A;  3ZCO A;  5JHF A;  5LEJ A;  4E7H A;  1U5T B;  1X1P A;  1Y6I A;  2MW8 A;  3G6E I;  3K4N A;  4ENK A;  1ZAO A;  3H3Z A;  3CWR A;  3VYU B;  4L18 B;  1RNL A;  1R36 A;  1ZRC A;  3GFM A;  2XB0 X;  3QKX A;  1RES A;  2Y2Z A;  5HLH A;  2WGB A;  1FIA A;  2P5L C;  1J5Y A;  5FRO A;  1LDD A;  3BTC A;  3CCY A;  3SFZ A;  1ZK8 A;  4KT6 A;  2MG4 A;  1Z05 A;  3HTA A;  3UR3 C;  3ZQF A;  1FZP B;  4DQ2 A;  5BPI A;  4OMZ A;  3E6B A;  4B48 A;  1GXP A;  4JK1 X;  3BG5 A;  1NK3 P;  3RQI A;  2DT6 A;  1ZRE A;  5H6R A;  4GFB A;  1BN5 A;  5DCF A;  4A3K J;  4UY8 I;  3PJR A;  2HQN A;  3ERE D;  1IN5 A;  4M6X A;  3H5R A;  2H8R A;  3LSP A;  1WVR A;  3ZXS A;  3T6N A;  1P6R A;  2ELK A;  2BXY A;  4U88 A;  2ICW G;  3BDD A;  1D0X A;  2HZT A;  2ME6 A;  2BW3 A;  3HRT A;  1YRN B;  1T56 A;  4LLN A;  3LSI A;  3JSO A;  1MZB A;  1BOB A;  4A0Y A;  4ENN A;  3ABU A;  2HWV A;  1D0Y A;  3TGN A;  1P4X A;  3DKY A;  2RHA A;  1SD7 A;  1OCO H;  1XX5 A;  2E7X A;  4JOM A;  3DLL F;  1Y39 A;  4CHU A;  4A3J J;  3C2B A;  5D19 A;  2M4G A;  1R71 A;  2FBK A;  4A3B J;  2GWR A;  2KLO A;  3PFY A;  1WPK A;  1WZ2 A;  2JZY A;  2M0M A;  3FXJ A;  2WBM A;  1S6L A;  3GLX A;  4D5F A;  2ZFW A;  4LOC A;  3P9K A;  3E7Q A;  1QHG A;  1OCZ H;  2MA3 A;  4UB6 C;  1LVK A;  3HB9 A;  4W1U A;  2FA5 A;  4XL9 A;  1JJ8 C;  4Q5S F;  4HNU A;  2PBI A;  4MQV A;  4N9I A;  5JVG F;  3NI7 A;  1WH7 A;  2NVX J;  4CCO A;  5B66 C;  3JRF A;  3WTS C;  4CCL A;  4M3E A;  4O3M A;  2W82 A;  5F0F A;  1G3Y A;  2HTJ A;  1JKO C;  4FE7 A;  3HYI A;  3HUG B;  4V19 K;  2QVO A;  4NN1 A;  4HYE A;  3I56 I;  3H3U A;  2F5F A;  2K86 A;  1G4D A;  1HQC A;  2LLK A;  2G7G A;  1SD4 A;  3OYA A;  3WE3 A;  4NC6 A;  2LMD A;  3BCB A;  4RAF A;  1L3L A;  4IHW A;  3OOU A;  4PJL A;  5D5V B;  2F2E A;  2M5W A;  1FJL A;  2Y0S N;  4D0P A;  1YJW I;  4D7N A;  3JSP A;  3VOK A;  4UXN A;  1HW5 A;  3L00 A;  3PM1 A;  2IJL A;  4HV5 A;  1ZYR F;  3BJ6 A;  3WOD F;  1YG2 A;  1QRY A;  2WB1 N;  1IO2 A;  2NXN B;  3I0T A;  4ZTF A;  3GW2 A;  5IYC J;  1X19 A;  2XKO A;  3H5A A;  3DWL E;  3U1D A;  1WSU A;  4P9U A;  1ETO A;  3CO7 C;  3T8R A;  4C2M J;  2OER A;  1V55 H;  1TWA J;  4PK4 A;  2DQL A;  2QKO A;  4XLN F;  1MSF C;  4MGR A;  5CQE A;  4Y52 J;  4AU7 A;  2DOE A;  5J1Y A;  2VQG A;  1O4X A;  1UMQ A;  2DFF A;  3VOX A;  3D5R C;  2E5Z A;  3LSG A;  4U9N A;  3I4M J;  5JVT A;  2A3S A;  4M6Y A;  1SFK A;  1NHA A;  2BZT A;  2YR2 A;  1ON1 A;  4ENM A;  1EH7 A;  3QPH A;  2LD5 A;  3ZOB A;  5D4R A;  5IP7 J;  5JR3 A;  1UCR A;  3JRB A;  3HSE A;  2GLO A;  5J1U A;  4IHV A;  2AXL A;  3BR0 A;  4Q48 A;  1AKH A;  2YU3 A;  3SFI A;  3GFI A;  1VQL I;  4LLG F;  3JRI A;  4GRI A;  4C2T A;  5CW8 A;  1A5J A;  1T39 A;  1DQU A;  3HJE A;  5DTD A;  2KIQ A;  1K6Y A;  5E17 F;  1ZKG A;  3FK6 A;  3HKZ N;  2H8W A;  1WRJ A;  2TDX A;  2Q2E A;  3TW6 A;  1ORK A;  4PJM A;  2LG4 A;  2K4B A;  5AON A;  3LSH A;  2ZCN A;  2REK A;  1XS9 A;  2WTE A;  1TL8 A;  1H9T A;  1G3T A;  3ISP A;  3IP4 B;  3F1B A;  5D6F A;  2XB5 A;  2CV2 A;  1FY7 A;  2XUB A;  4XRS A;  5J8C A;  3OL3 A;  5DYM A;  4G7Z F;  3BRU A;  2CUE A;  1UHS A;  4ESB A;  2ELJ A;  3EUK L;  2R3S A;  2W7N A;  1JUP A;  3O8G A;  1NH3 A;  5FKM A;  4FIS A;  3K4J A;  3Q0U A;  5B1A H;  3OL4 A;  1Z21 A;  2JA8 J;  5H6Q A;  1ENH A;  2LY2 A;  3G71 I;  1R22 A;  1IN8 A;  3BTI A;  3GBG A;  5HS9 A;  1JKP C;  1T0F A;  1XMX A;  4BNC A;  2ESN A;  5IT3 A;  1J7K A;  4RM3 A;  1GUU A;  1ZLJ A;  2L3D A;  1RET A;  1SFU A;  4I99 C;  3AG1 H;  1JHF A;  2WUI A;  2LP0 A;  4HLX A;  3K4C A;  2AHQ A;  3HSR A;  2YVE A;  4M3B A;  4HBL A;  2M34 A;  2FML A;  2EJR A;  2D45 A;  1D1A A;  2PMH A;  1ZRF A;  1Z6R A;  2LRD A;  4JBA A;  2AQE A;  2RV8 A;  2DJI A;  1D5Y A;  4MEY F;  5GTI C;  2VT3 A;  2XGE A;  3DPL C;  5J4V A;  4PXI A;  1XG1 A;  1I1S A;  5F1R A;  1IUF A;  2L2O A;  1TZL A;  2JUG A;  2OU2 A;  1O57 A;  2K9Q A;  2ZOY A;  3S3O A;  3GTP J;  4XOT A;  3HIF A;  3GTQ J;  1WWX A;  1IC8 A;  5KK1 A;  3VPR A;  3I59 B;  1GLN A;  4U0Y A;  1YIT I;  4XM3 A;  4BDZ A;  3BTJ A;  1MMD A;  2EFO A;  3K9T A;  3E6D A;  3LMM A;  5CXG A;  4M3G A;  5HOD A;  1YI2 I;  3BR2 A;  3S8P A;  3L1P A;  2QSG X;  2JA7 J;  5D18 A;  1U5T A;  1VND A;  4ZZL A;  2VJ5 A;  1I6H J;  2CUJ A;  2E5N A;  5EG0 A;  3RPU A;  4BL0 B;  3VYS B;  4PCQ A;  4XLP F;  3ZQI A;  3MWM A;  3HPH A;  3HTJ A;  2JN6 A;  2K7L A;  2F4I A;  2ZME C;  3CJD A;  1AOY A;  2MLK A;  2A68 F;  2H6B A;  2CUZ A;  4ZDL A;  2XV4 S;  3K1M A;  1BI2 A;  4M74 A;  2UUZ A;  2WAE A;  1QHH D;  4FET A;  1ITY A;  2BGC A;  2PEX A;  4JX5 A;  3MZ8 A;  2ZXI A;  4RAZ A;  4TV7 A;  4B43 A;  1K61 A;  1YRN A;  2LY1 A;  4MLO A;  3R0J A;  4XKB A;  3D0S A;  3V7R A;  1JKQ C;  3O3K A;  1POG A;  4FCY A;  2BOL A;  2Y0M A;  1Z91 A;  3GFL A;  4EGY A;  4KN7 X;  5ICE A;  4HLY A;  1UHM A;  3VYT B;  1K79 A;  2KZV A;  3PIP F;  1R1T A;  1R1U A;  4LG0 B;  4PUS A;  1T38 A;  3L2U A;  3S14 J;  1N25 A;  1QVU A;  4N9H A;  2DO7 A;  4A93 J;  2DA3 A;  5D5W B;  5E1Z B;  3DEU A;  1TC3 C;  2E19 A;  2Y69 H;  3F22 A;  2XAG A;  3GWZ A;  1E17 A;  4Q47 A;  1LE8 B;  3OIP A;  1Z3X A;  3TO9 A;  4YFN F;  2ZY9 A;  3N4M A;  3ZGK A;  2HOS A;  2DW4 A;  2XRL A;  4UB8 C;  3MEX A;  1T8I A;  4E7S A;  2MBF A;  2IAI A;  2O8K A;  1E0E A;  2DT5 A;  5D5X B;  2FBH A;  4F52 A;  3J7Z I;  2P6S A;  1GDT A;  1SVO A;  2WAQ N;  2HYJ A;  3HUG A;  3LA3 A;  2RAS A;  3CMA I;  2EFW A;  4KNY A;  4KFC A;  2FUG 2;  1RIO H;  1TWH J;  3M7G A;  3LL7 A;  4FQG A;  2CG4 A;  4YIR X;  4ZC3 A;  1B9N A;  3H3V K;  2H1L A;  2I10 A;  3SDB A;  1ZQ3 P;  1I6X A;  1X1D A;  2VC0 A;  3ASN H;  3OS0 A;  5DD8 A;  4XLF A;  4A3G J;  1LJ9 A;  2OC6 A;  4BY7 J;  1U6G A;  5HDG A;  3PL8 A;  1ZEL A;  4AD9 A;  1SAX A;  4P55 A;  2MC4 A;  5FRN A;  2ZO4 A;  3KIO A;  4RLQ A;  5FKN A;  3OYL A;  1JUS A;  1K4S A;  1YJN I;  2F07 A;  1W0U A;  1REP C;  1X1B A;  3ABK H;  4YZE A;  2VJ4 A;  2LRE A;  1W7P A;  2DTZ A;  1MGT A;  3BY6 A;  4XLH A;  5F0C A;  3WTV C;  4S05 A;  4HDU A;  2NOJ B;  4U7D A;  4OAY A;  1V5E A;  4LLL A;  2BVL A;  3WTX C;  5M5W J;  5E1X A;  2GEN A;  4M9X A;  4L9T A;  1QPI A;  1Z6T A;  2FMY A;  1B9M A;  2XPW A;  3VIB A;  2R7Z J;  1DP3 A;  3ZMV A;  3IUV A;  4F3Q A;  3ZMS A;  2OTL I;  1A6I A;  4XLA A;  4UUS B;  3LSK A;  3KEQ A;  1MNM C;  1D0Z A;  5IY5 H;  4J00 A;  3I4N J;  2DG7 A;  1Y1W J;  1X2N A;  1X3W B;  5HNF A;  1NG6 A;  1X3Z B;  2A5W A;  5EZG A;  4A0X A;  2H6C A;  2EV6 A;  3E3V A;  1MNE A;  5E8G A;  2X6Y A;  3IL2 A;  2FSW A;  2WWY A;  4OIO F;  4IEJ A;  1PUF B;  2ZXW H;  1E3O C;  3JRG A;  3TO7 A;  2GOX B;  2M9H A;  2VJJ A;  3A03 A;  2DK8 A;  3C2G A;  5E3M A;  3A4C A;  2P6T A;  1TT5 B;  4WXD A; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  1EF4 A;  1LFU P;  3BR6 A;  4DYQ A;  3IH3 A;  2NP3 A;  3S17 J;  5HBU A;  4AUX A;  2QOP A;  4DZJ A;  3JRC A;  2K40 A;  2CU7 A;  5IPA A;  1K83 J;  3S1Q J;  3HGY A;  2QF7 A;  3JSJ A;  3O8H A;  1ETK A;  2HOA A;  2D6Y A;  2UXI A;  2L7Z A;  5M5Y J;  1U9O A;  2GUH A;  1MBE A;  2DMN A;  1MH3 A;  2X48 A;  2TCT A;  3SJM A;  3FK7 A;  2UXH A;  3GTL J;  1LFB A;  1I50 J;  3KZ9 A;  2VI6 A;  4A3M J;  2WV1 A;  1UI5 A;  3KNW A;  1ETQ A;  4D5C A;  3S2D J;  2EZK A;  3BJB A;  2G3B A;  2CQQ A;  2FBQ A;  4ICH A;  5J3L A;  4XID A;  5F1J A;  4XRM A;  5M5X J;  5K58 A;  4NDL A;  2JK3 A;  2G0E A;  5F27 A;  3A01 B;  1W0T A;  2RAE A;  1HF0 A;  2LK2 A;  4JX6 A;  3NXC A;  2NS8 A;  5EFY A;  1Z0X A;  2HKU A;  4J19 A;  2MW8 A;  3LSJ A;  3CWR A;  2D5V A;  3EUP A;  2QWT A;  1JKR C;  3OSF A;  2DA2 A;  2XB0 X;  4JYK A;  3QKX A;  1RES A;  2Y2Z A;  3WHB A;  2HQ5 A;  1FIA A;  2WGB A;  1MBG A;  3BTC A;  3CCY A;  4I76 A;  4A3D J;  1ZK8 A;  4CGR A;  2YVH A;  2MG4 A;  3HTA A;  2EQR A;  1Q1V A;  3ZQF A;  2W48 A;  3HIM A;  1UI6 A;  4A3L J;  1ZTR A;  3MN2 A;  2IEK A;  2CRG A;  3BG5 A;  5JLX A;  1NK3 P;  3RQI A;  2XSD C;  1T33 A;  4GFB A;  2VPR A;  2NVY J;  4A3K J;  5EYR A;  3S1M J;  4AYB N;  1AHD P;  5IYB J;  2YUS A;  2H8R A;  2AO9 A;  4DYC A;  3LSP A;  1WGX A;  3T6N A;  3S5R A;  2PBX A;  3QQA A;  5K7Z A;  2ELK A;  1R9T J;  4JL3 A;  5EDN A;  2ME6 A;  3VVZ A;  1YRN B;  1T56 A;  3NPI A;  3PPB A;  3M4O J;  3G56 A;  2RHA A;  2M8G X;  5C4J J;  1JT6 A;  2FJ1 A;  4MFD A;  3LJL A;  5D1R A;  2KT0 A;  4A3J J;  3C2B A;  5D19 A;  2ECC A;  4A3F J;  4A3B J;  4AC6 A;  3Q0W A;  5DAJ A;  1WPK A;  1F36 A;  2K9S A;  2UXO A;  2GM4 A;  2XDN A;  2ECB A;  4MXM A;  1IJW C;  4FE4 A;  2R5Z B;  2R0Q C;  4D5F A;  2JJ7 A;  2E2I J;  4LOC A;  3E7Q A;  1P7I A;  1HLV A;  3VW1 A;  5DS9 A;  3O60 A;  2CJJ A;  1X2M A;  5GPC A;  2L7F P;  3HB9 A;  4W1U A;  2UXU A;  1JJ8 C;  3VW2 A;  1Y1V J;  5EEA A;  3NI7 A;  1GVD A;  1WH7 A;  2ME0 A;  2NVX J;  3JRF A;  1SFO J;  4ME9 A;  2HXO A;  3BR5 A;  4M3E A;  3S15 J;  5F0F A;  3E7L A;  4HKU A;  3S1N J;  1JKO C;  2XPV A;  4FE7 A;  5HAW A;  2NX4 A;  4NN1 A;  5IOZ A;  2E2J J;  3BNI A;  2LLK A;  2R93 J;  1BA5 A;  2G7G A;  2Q24 A;  4XK4 A;  3KKC A;  3CDL A;  3GTG J;  3BT9 A;  4IHW A;  3OOU A;  5GP9 A;  1LE8 A;  2FD5 A;  5H9T A;  3RH2 A;  3TP0 A;  1FJL A;  2Y0S N;  3OSG A;  4D7N A;  3VOK A;  1BW5 A;  1MH4 A;  3PM1 A;  2HI3 A;  1HOM A;  4Y7N J;  1H8A C;  1JUM A;  1Z77 A;  3OIO A;  3GEU A;  1QRY A;  2WB1 N;  2LR8 A;  5IYC J;  4JX4 A;  1IDZ A;  4MO7 A;  1OCT C;  3S1R J;  1ETO A;  3BCG A;  4CYC B;  4C2M J;  3HOV J;  2OER A;  1TWA J;  2MGQ A;  3S2H J;  2QKO A;  1MSF C;  2LVS A;  3H0G J;  5BNG A;  5E3L A;  3CQZ J;  3PO3 J;  2DA5 A;  4Y52 J;  4W97 A;  2XPU A;  5J1Y A;  4ACI A;  1O4X A;  1UMQ A;  1OFC X;  5F04 A;  3VOX A;  2K9N A;  1BW6 A;  1U8B A;  3LSG A;  1MBJ A;  1GT0 C;  5IOY A;  3I4M J;  1WI3 A;  3QPS A;  1QVT A;  1UG2 A;  3G1O A;  2KDZ A;  2L7M P;  2VKV A;  3DCF A;  3HE0 A;  2OI8 A;  2HYT A;  2LD5 A;  3ZOB A;  2L0K A;  4MFE A;  5IP7 J;  3JRB A;  1TWF J;  2OF7 A;  2GLO A;  5J1U A;  4KWA A;  4RDU A;  4IHV A;  3BR0 A;  1AKH A;  1ZR4 A;  4GCT A;  3SFI A;  3VUQ A;  3JRA A;  3JRI A;  3G1L A;  4M3F A;  4BKX A;  1SAN A;  5CW8 A;  5F08 A;  1IGN A;  3M3Y J;  1A5J A;  2GBY A;  2GFN A;  5DTD A;  2E1O A;  1MBK A;  1ZKG A;  3FK6 A;  3HKZ N;  1RR7 A;  1IV6 A;  3TW6 A;  3RZO J;  1ORK A;  2JA6 J;  2IU5 A;  2ZCM A;  2FQ4 A;  3BG9 A;  3HOX J;  2ZCN A;  1U78 A;  4BXX J;  2REK A;  5GPA A;  2VUM J;  1ETV A;  3JR9 A;  1XS9 A;  3EGQ A;  2PZ9 A;  3IV5 A;  4GFK A;  5EGO B;  3F1B A;  4C3J J;  2XB5 A;  1B72 B;  4XRS A;  3KKD A;  3JRD A;  2CUE A;  1UHS A;  3BRU A;  3TP3 A;  3AQT A;  1U9N A;  2G7S A;  4UDS A;  3W6V A;  3ANG A;  3LWJ A;  1ETX A;  4B1R A;  1JUP A;  3O8G A;  2HOT A;  4BY1 J;  3G7R A;  5FKM A;  2NVQ J;  4IHX A;  2DMP A;  4FIS A;  2DJN A;  2EZH A;  3Q0U A;  9ANT A;  1H88 C;  1FTZ A;  2YU9 J;  2JA8 J;  3HOY J;  4RBO A;  3G1M A;  1ENH A;  1GV2 A;  5FKK A;  3BTI A;  3GBG A;  1JKP C;  4B4C A;  4MK6 A;  5FLM J;  2DA6 A;  3Q0V A;  4XIC A;  1GUU A;  4DW6 A;  5FGL A;  1RET A;  2N8G A;  3IH2 A;  3QPL A;  2WUI A;  2LP0 A;  1OJL A;  2AHQ A;  2YVE A;  3BQY A;  4M3B A;  2M34 A;  2L9R A;  5IYD J;  3PAS A;  4GCK A;  2ID3 A;  1D5Y A;  1HDD C;  2MSY A;  4L62 A;  2LY9 A;  2XGE A;  5HSZ A;  1WH5 A;  2DN0 A;  3WHC A;  3BTL A;  3MVP A;  4PXI A;  1XG1 A;  1AKH B;  1MBF A;  1NTC A;  3ZQL A;  2NVT J;  1IUF A;  2K9Q A;  3TED A;  3HOW J;  3S16 J;  3ZQH A;  2HXI A;  4BBR J;  4S0H B;  3GTP J;  2ZOY A;  2HDD A;  5FKO A;  4C3H J;  1BL0 A;  3GTQ J;  5CXI A;  1FEX A;  1IC8 A;  1DU6 A;  3VPR A;  3UKG A;  4QTR A;  3LHQ A;  2DA4 A;  5EF6 A;  1OCP A;  2X6O A;  3JRE A;  3BTJ A;  4QIW N;  4JP0 A;  3QBM A;  2DA1 A;  3A01 A;  1JJ6 C;  2QIB A;  5CXG A;  4M3G A;  4G12 A;  5IP6 A;  5HOD A;  3NAU A;  3BR2 A;  3L1P A;  2JWT A;  2JA7 J;  2XGD A;  5D18 A;  1VND A;  1I6H J;  3ZQG A;  1RPW A;  2CQX A;  5EG0 A;  2JMW A;  3JRH A;  3GTM J;  3ZQI A;  3CMY A;  3GTK J;  2V57 A;  4JNN A;  3COL A;  4M6V A;  2Y31 A;  5IP9 J;  2JN6 A;  3HTJ A;  4A69 C;  2COB A;  5M3F J;  4HNV A;  3HOZ J;  3CJD A;  1ZGW A;  4I6Z A;  3DPJ A;  2Y9Y A;  4FTH A;  5E3O A;  2NOG A;  1JTY A;  2EBI A;  3RZD J;  2NP5 A;  3C07 A;  4DZP A;  3NAR A;  5FJ8 J;  2QTQ A;  3GTJ J;  3RD3 A;  4A3C J;  1ITY A;  3Q3S A;  5K7F A;  1P7J A;  2Y9Z A;  2EH3 A;  4JX5 A;  5FMP A;  5M3M J;  2JA5 J;  4UUT A;  4D7M A;  2P81 A;  1BJZ A;  1K61 A;  3RKQ A;  5FKL A;  1YRN A;  3HDD A;  4MLO A;  2LKX A;  3HBL A;  4V2F A;  1JKQ C;  5JLW A;  1DU0 A;  1POG A;  4FCY A;  4EEF G;  3GZI A;  5AQC A;  5E3M A;  5FLV A;  1IRZ A;  1IDY A;  4JKZ A;  2OPT A;  3LSR A;  3LNQ A;  2YS9 A;  1I3Q J;  5C44 J;  3ZQC A;  3BHQ A;  5J1R A;  2R5Z A;  2R5Y A;  3PO2 J;  3S14 J;  1G2H A;  1B8I A;  1S7E A;  1QVU A;  4A93 J;  4AF5 A;  2DA3 A;  1AU7 A;  5K7H A;  1H89 C;  3CRJ A;  1TC3 C;  1VI0 A;  2E19 A;  1IG7 A;  1LE8 B;  3AQS A;  3MNL A;  2O9L A;  4M3D A;  5EG0 B;  3B6C A;  4UUS A;  2VKE A;  5EZH A;  2HOS A;  3HTH A;  5C4Y A;  3FIW A;  4A3I J;  3TW7 A;  2XRL A;  2LTP A;  2IAI A;  2O8K A;  2X9D A;  3FRQ A;  2IBD A;  3HEF A;  4B3A A;  1GDT A;  2M2E A;  2WAQ N;  2HYJ A;  1FIP A;  2RAS A;  2PMZ N;  1NK2 P;  3FIS A;  4X6A J;  5C3E J;  3VW0 A;  2QCO A;  1JTX A;  1TWH J;  2H1K A;  2UXP A;  1PUF A;  3D1N I;  4C3I J;  2R92 J;  4QSH A;  3ON4 A;  2FX0 A;  3H3V K;  1TWC J;  4MIM A;  2I10 A;  1ZQ3 P;  4GCL A;  2ZCX A;  5FHP A;  3B81 A;  4DYR A;  2Y30 A;  4A3G J;  3V78 A;  4ABZ A;  1WCM J;  3ON2 A;  1JGG A;  3A02 A;  1VFC A;  1F43 A;  4BY7 J;  3FKI J;  2O7T A;  4A3E J;  1JT0 A;  3HTI A;  5F0H A;  2ID6 A;  3P9T A;  3VP5 A;  1APL C;  2B63 J;  3BR1 A;  2DA7 A;  4L5E A;  5FKN A;  2M0C A;  1MSE C;  4CYC A;  1JUS A;  2F07 A;  4IHY A;  2XGC A;  1W0U A;  4YZE A;  4NEL A;  1HCR A;  2DTZ A;  3VVY A;  5F0C A;  1XC5 A;  3HOU J;  3K2A A;  3K7A J;  1HDP A;  4BBS J;  2DG8 A;  4GFL A;  3IH4 A;  3ANP A;  2R5Y B;  3BR3 A;  1B8I B;  2EZI A;  3MKL A;  5M5W J;  2O7O A;  1GV5 A;  3BQZ A;  2GEN A;  2ZB9 A;  1QPI A;  1MBH A;  4X1E A;  2G7L A;  2W53 A;  2XPW A;  2EZL A;  1ETY A;  3NRG A;  2R7Z J;  3VIB A;  2LFB A;  3IUV A;  1TWG J;  1RKW A;  1A6I A;  4UUS B;  3VVX A;  3GTO J;  1CQT A;  1MNM C;  3SDG A;  1RKT A;  2CUF A;  1ETW A;  3I4N J;  2DMQ A;  1Y1W J;  1SGM A;  2DG7 A;  2ZOZ A;  1X2N A;  3DEW A;  2DMT A;  5EZG A;  2TRT A;  5C4X J;  1X58 A;  3NNR A;  4AC0 A;  5E3N A;  3HM5 A;  1VF9 A;  3BG3 A;  2DMU A;  4V2G A;  3LOC A;  4IEJ A;  1PUF B;  1E3O C;  3JRG A;  1FTT A;  5EGO A;  2M9H A;  3A03 A;  4XRS G;  3V6G A;  2E2H J;  2NS7 A;  3HGG A;  3F0C A;  3B6A A;  1B72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...