1QVUA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to two drugs: ethidium and proflavine
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
total genus 75
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvuA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvuA02
2R93J 3EUPA 3CDLA 4C2MJ 3KNWA 3W6VA 3BR3A 2FBQA 2X48A 1BJZA 5E3MA 2M9HA 1LE8A 4HNVA 1JKPC 4QTRA 1JKRC 2IBDA 1B72A 1HOMA 3HOWJ 3VVZA 5K7HA 3KZ9A 4MFDA 3HOUJ 2QF7A 3GTGJ 5K7FA 2I10A 4XRSA 5J1YA 2Y2ZA 1WH7A 4S0HB 4C3JJ 1MBHA 3M4OJ 3GTQJ 2LLKA 2EZLA 1FTZA 1AU7A 4M3FA 1FIPA 5HAWA 5F27A 4MIMA 4XK4A 4W1UA 2WV1A 2X9DA 4BY1J 3E7LA 1Z77A 2GFNA 3LSJA 2K40A 1A6IA 1NTCA 5M3MJ 4CYCA 5GP9A 2M34A 3T6NA 4GFBA 5D18A 1P7JA 2DA4A 5AQCA 4D7NA 3S1MJ 2HOSA 2NX4A 1AKHA 1AHDP 3GTMJ 2EH3A 3UKGA 3HGYA 5JLXA 5EG0B 3GBGA 1MSEC 4MXMA 3K2AA 1SANA 4X6AJ 5FKLA 1JUSA 3BR2A 4MK6A 5IYBJ 1IRZA 3Q3SA 3S1NJ 1X58A 3NXCA 4JNNA 5J1UA 2E2IJ 1PUFB 3B6CA 3S2DJ 1IGNA 1BA5A 2QKOA 2Y0SN 3CCYA 1JKQC 1JTYA 3JRDA 3MKLA 4A69C 2LTPA 2E1OA 2YS9A 5C4YA 4ME9A 4IHYA 2NP3A 2WGBA 2L9RA 1BW5A 2O7TA 5EDNA 4UUTA 2CRGA 3ZQCA 4GFLA 3HTIA 5C4JJ 3HOZJ 3BNIA 5EG0A 3VOXA 3TW7A 1E3OC 1MH3A 3HOXJ 3S2HJ 5DS9A 2NVYJ 1H8AC 3FRQA 1K61A 3B81A 1WPKA 5J3LA 3ANPA 3VVYA 1NK2P 3ANGA 2FD5A 5IP6A 1T56A 3ZOBA 1QRYA 4IHXA 2CUFA 2COBA 1WH5A 1VFCA 3BTIA 2JA7J 3S15J 2LR8A 1X2MA 2NS8A 2DA3A 4A3FJ 5D19A 3A03A 1FEXA 3IH3A 1O4XA 1HLVA 5F0CA 1A5JA 2DMUA 2L7FP 1I6HJ 2DN0A 4B4CA 3BTJA 1HDDC 3LHQA 4MLOA 3GEUA 2N8GA 1VF9A 2ELKA 5F0HA 2PMZN 2CU7A 4G12A 2HDDA 2JMWA 1QVTA 3GTKJ 1ZKGA 2PZ9A 3TP3A 3FISA 3LSRA 2YUSA 2XB5A 3S14J 2NVTJ 3IH4A 1SFOJ 1U9NA 2GLOA 3HKZN 4A3DJ 3BRUA 1HCRA 3IUVA 1H88C 3VW1A 1ZQ3P 3QPLA 3ZQFA 1FTTA 1T33A 2VI6A 2R7ZJ 3BHQA 2FJ1A 2OPTA 4ICHA 1JT0A 2XGEA 2KDZA 3WHCA 2YVEA 3PO2J 1ZR4A 1ETYA 4GFKA 1GDTA 5J1RA 1TWFJ 3LSPA 2YVHA 3DCFA 2CQXA 3QPSA 1ZTRA 4AF5A 1S7EA 3JRGA 2ZCNA 3G7RA 3AQSA 4M3BA 1TWGJ 1MSFC 3V6GA 1ETQA 2DA2A 5DTDA 2CUEA 4A3IJ 4DZPA 1MBGA 2G7GA 2DA5A 1RPWA 2VKEA 2R5YB 2QTQA 4JKZA 2EQRA 5EYRA 2HI3A 3C2BA 3VIBA 4AYBN 4BKXA 3QKXA 2RASA 3V78A 1IC8A 2XRLA 4DYQA 1TC3C 1VI0A 3VPRA 2B63J 3HTHA 3VW2A 2XDNA 2ME0A 2Y30A 2NS7A 2JJ7A 3BG9A 2DA1A 4XRMA 5CW8A 5FKOA 4DZJA 3KKCA 2IEKA 1OCTC 1ETVA 2CJJA 2FQ4A 2HKUA 5C4XJ 3BR1A 4X1EA 2DG7A 1ETWA 2K9QA 2R5YA 4YZEA 2CQQA 5HSZA 5FMPA 1QVUA 1TWAJ 1ENHA 3RZOJ 3S1QJ 1I50J 2E19A 3P9TA 5EEAA 2EZIA 5HODA 3A02A 4EEFG 4JP0A 1JT6A 2YU9J 4B1RA 4FCYA 1U8BA 1RKTA 3QBMA 4L62A 1K83J 4BBSJ 4CYCB 2Y9ZA 2UXHA 2UXIA 2NOGA 1MBFA 4LOCA 1RR7A 3VP5A 5IP9J 4V2GA 4DYCA 5EF6A 2R5ZB 4M3GA 4JX6A 3VOKA 2ZCXA 2HXIA 2XPUA 9ANTA 2G7LA 5EFYA 2VPRA 3JRBA 1JJ6C 3HIMA 5DAJA 2HQ5A 4FE4A 2H1KA 1RESA 3O8HA 1ETXA 3S17J 3EGQA 3RKQA 4ABZA 1APLC 3HTJA 2H8RA 3ON2A 1HF0A 3H0GJ 1UMQA 2LVSA 3JREA 2JWTA 4NDLA 4A3CJ 3I4MJ 3SDGA 3JR9A 3VW0A 3ON4A 4GCLA 2OERA 3HBLA 3SFIA 1Z0XA 1H89C 2G0EA 2ZCMA 1RKWA 3VVXA 3DEWA 2OI8A 3DPJA 1YRNB 3PASA 4AC0A 2O8KA 2FX0A 2XB0X 3BG3A 5EZGA 1GV5A 3HE0A 4JX5A 5M3FJ 3JSJA 2LFBA 4DW6A 2AHQA 2KT0A 5K7ZA 5M5YJ 4A3EJ 2QOPA 4MFEA 1BL0A 4M6VA 1AKHB 5IYCJ 2M8GX 5M5WJ 3GZIA 4FE7A 5GPCA 1ITYA 1R9TJ 5FLVA 3G1MA 5GPAA 2REKA 4GCTA 1ETOA 1LFBA 2F07A 2G3BA 3L1PA 1D5YA 1EF4A 2XGCA 1G2HA 2LP0A 3BTLA 2K9SA 1CQTA 1YRNA 1OCPA 1WGXA 2WAQN 2HYTA 5C3EJ 1OFCX 4UDSA 5K58A 1I3QJ 1FJLA 3LJLA 1HDPA 3HB9A 2DTZA 5EGOA 3KKDA 2JA5J 4A3JJ 3BQZA 1XG1A 1MBEA 2E2HJ 3HGGA 1B8IB 4A3GJ 2GBYA 1X2NA 3COLA 1TWCJ 3I4NJ 3C07A 4IHWA 1F43A 4GCKA 4Y7NJ 3H3VK 1LE8B 1IUFA 1B72B 1ZR2A 3D1NI 1BW6A 2ZOZA 3BQYA 3JRCA 5EGOB 1P7IA 3BCGA 2TCTA 1IJWC 4A3MJ 5BNGA 4D5FA 3FKIJ 3S5RA 2NP5A 2RHAA 2HXOA 1B8IA 4IEJA 4CGRA 3GTPJ 3HOVJ 2M2EA 1JKOC 4FISA 2DMNA 3BR6A 3LSGA 1NK3P 4A3BJ 3LWJA 2GM4A 4I76A 3MN2A 2QIBA 3WHBA 1ETKA 3MNLA 1OJLA 3BT9A 2DMTA 3BR5A 3BTCA 4IHVA 3E7QA 4Y52J 5IPAA 3VUQA 2ID3A 4A3KJ 1JUPA 5FKMA 1GUUA 2O9LA 2D6YA 5FGLA 3O8GA 2DA6A 3HTAA 2WB1N 4QSHA 2X6OA 3IH2A 4D7MA 1IG7A 4AUXA 5E3OA 5C44J 2K9NA 3CWRA 3Q0UA 4RBOA 3TP0A 3OOUA 2DA7A 1F36A 2DJNA 1ORKA 5H9TA 1PUFA 2ECBA 1GVDA 2JA6J 1JTXA 1W0UA 5F08A 2EZKA 3FK6A 2L7MP 5IOZA 3HEFA 4MO7A 2EZHA 4BY7J 2MG4A 3A01B 3NI7A 2QCOA 2MW8A 3JRIA 2JK3A 2LK2A 4W97A 1JGGA 3Q0WA 2L0KA 4KWAA 3HOYJ 4B3AA 4BBRJ 2UXUA 2GENA 4I6ZA 1ZGWA 1DU0A 4AC6A 3CJDA 3GTOJ 2R5ZA 3MVPA 2WUIA 5CXGA 3QQAA 2Q24A 3BJBA 3A01A 2IU5A 1MBJA 1JUMA 3G1OA 1U78A 4JYKA 1GT0C 2UXOA 2P81A 4C3HJ 5F0FA 2E2JJ 2ZB9A 4RDUA 3RH2A 3ZQIA 5FKNA 3ZQLA 3BR0A 3NARA 2VUMJ 4A93J 3F0CA 1MH4A 3OSGA 2XSDC 4DYRA 3CMYA 2HOAA 3Q0VA 1UI6A 2W53A 3OIOA 3LOCA 2ME6A 4XRSG 5IOYA 2LD5A 3JRFA 3JRHA 2MGQA 3K7AJ 1XC5A 2O7OA 2DMPA 4J19A 3NAUA 3F1BA 2QWTA 2VKVA 4D5CA 2GUHA 4M3EA 1LFUP 5EZHA 2DG8A 3NPIA 5D1RA 1IDYA 1MNMC 2HOTA 2ID6A 3G1LA 1ZK8A 2EBIA 3GTJJ 1TWHJ 5IP7J 2M0CA 3ZQHA 3JRAA 5HBUA 4UUSB 2PBXA 3NRGA 3BG5A 2V57A 1QPIA 2D5VA 1VNDA 3SJMA 1Y1WJ 4NELA 4NN1A 3S16J 3M3YJ 1IDZA 3PPBA 2AO9A 3CQZJ 2NVXJ 1GV2A 4JL3A 2TRTA 2IAIA 2Y31A 3B6AA 5F1JA 1XS9A 1UHSA 2LY9A 4ACIA 2RAEA 2JA8J 2HYJA 3PM1A 5FKKA 1Y1VJ 2XPWA 1JJ8C 1U9OA 4XIDA 3FIWA 5IYDJ 4XICA 1FIAA 4JX4A 5FLMJ 4UUSA 3RZDJ 1UI5A 5CXIA 4C3IJ 1IV6A 4BXXJ 2L7ZA 2Y9YA 3TEDA 5F04A 1RETA 3OSFA 2NVQJ 3PO3J 2DMQA 3FK7A 3GTLJ 3ZQGA 1POGA 3S1RJ 3RD3A 3LNQA 2UXPA 3IV5A 3NNRA 1Q1VA 2XPVA 2OF7A 4V2FA 4FTHA 5JLWA 2G7SA 4L5EA 2XGDA 5E3NA 3CRJA 2R0QC 2ECCA 5FJ8J 4PXIA 2JN6A 4M3DA 3AQTA 1UG2A 4A3LJ 3O60A 1DU6A 2W48A 2LKXA 3HDDA 1MBKA 3RQIA 4QIWN 2ZOYA 3TW6A 5E3LA 3HM5A 5FHPA 2MSYA 1WI3A 1WCMJ 5M5XJ 1W0TA 4HKUA 1SGMA 2R92J 3G56A
chains in the Genus database with same CATH superfamily
3TO6A 4NUBA 3EUPA 2VQGA 3FF5A 4I0AA 5E8GA 2HU9A 3A0BC 5E3MA 3C2GA 4MGRA 2M9HA 1MJAA 1B72A 1HOMA 4A2UA 2LMDA 3KZ9A 3HOUJ 1V5FA 1CF7A 4AU7A 4LLLA 2NAZA 3C1DA 4EM0B 2E5ZA 1MBHA 5D5XB 2Z1DA 3LSKA 2DT5A 3CJQB 2OAZA 4DBQA 1IRFA 1R4MB 1SVMA 4LB6B 1D1AA 4UB6C 3SWHA 1Y6IA 2K4BA 2WV1A 4BU2A 2EV5A 3E7LA 1S5LC 2K40A 3DTIA 5FD5A 2JRTA 1GXQA 2XGXA 3SXYA 5D5UB 1Z3YA 1S7OA 2M34A 3T6NA 1CF7B 5D18A 2HNHA 2V9KA 4KIGA 1XCVA 4KJZA 4IL6C 2IW5A 2ZC2A 4D7NA 3U2RA 1K4SA 1AHDP 4BE0A 2EV6A 2ESNA 3DLAA 4P5OA 3HGYA 5EG0B 1MSEC 2VL8A 4P1WA 1SANA 1MNDA 2PMZA 4BHCA 3QODA 5IYBJ 3RPUA 4BJ5C 1X4OA 2VKHA 3NXCA 2EIJH 2VN2A 1YQAA 1PUFB 3U1DA 4XKWA 4PGHA 4BGDA 1P4AA 4A69C 4CUGA 2YS9A 5C4YA 2LF7A 4PJNA 1MIJA 3RCOA 2L9RA 4EMSA 4KMFA 2QQ9A 5EDNA 4UUTA 4FX4A 1BW5A 3ZQCA 1ZG3A 4GFLA 3BNIA 5ERIA 3TW7A 1BBYA 1E3OC 3KEOA 1MH3A 3HOXJ 3CO6C 3VODA 3ZR8X 2L9SA 2NVYJ 5J47A 4OMZA 1H8AC 4Y13A 1TLHB 1UHMA 5L3CA 3MAJA 2Z2SB 2FD5A 4NB5A 1T56A 2LKSA 3ZOBA 5ILVA 2QVOA 2IRFG 2JA7J 3ZGKA 2VOOA 4A3FJ 5D19A 3CCUI 3W6KB 5L3FA 5HS8A 1HLVA 3NWTA 3WE3A 2KJBA 3FXRA 4B43A 2L4MA 4Y3OA 1T95A 4MLOA 3A0HC 2RQQA 3GF2A 5HNHA 1R1UA 1LFPA 4WX9A 3GEUA 5F0HA 4U0WA 4G12A 4YIRX 3OYJA 3GTKJ 2VC0A 1WJBA 4NC6A 4PFPA 3TP3A 3CJNA 3FISA 4OIOF 1KQ8A 1WJDA 3T8TA 1ULYA 2E1CA 1YX3A 1SFOJ 1XTAA 1U9NA 3LA7A 2GLOA 3KFWX 2CQ7A 4M9XA 4A3DJ 4M74A 3QPLA 4KYWA 3ZQFA 2LF8A 3FXOA 3K1NA 3BG7A 3PL8A 3QYBA 1PUEE 4F93B 2OD5A 2L2OA 4N9IA 5DEQA 2ETHA 2XGEA 3WHCA 4DOZA 3G3ZA 3PO2J 2OJED 2AS5F 3ASNH 4ZDPA 2XVCA 3FHZA 1TWFJ 3BCAA 2VOPA 2J5PA 1FOXA 4HF0A 1ZTRA 1FYMA 4PJJA 5HLHA 3BROA 3JRGA 4AF5A 2DO7A 4IPAA 1RR8C 3KZIC 2M5WA 4XN3A 1VQNI 1Y0UA 3BPXA 2E60A 3BWGA 3MQ0A 2M8EA 2R7TA 1ETQA 3TDZC 2DA2A 4HW0A 4CO8A 5CLSA 2PMHA 2QSGX 3W6JB 1REPC 3W2AA 2EFQA 2DA5A 3AG2H 2VKEA 2KIQA 4NBQA 3LAJA 2Q8KA 1LQ1A 3V78A 1PDNC 1SVOA 2K27A 2JQ7A 4ZZLA 1VI0A 2CG4A 3BZKA 2Z16A 2JJ7A 4ZZDA 2DA1A 2LNBA 2IEKA 1WJCA 2VONA 3SDBA 2B1EA 2HKUA 1VQ5I 5C4XJ 3C18A 4N4OB 3VYTB 1TP4A 1W5CC 1ETWA 1LUJB 1F1ZA 2RKHA 3ERMA 2CQQA 2X1CA 1QVUA 1TWAJ 1ENHA 3RZOJ 1VTNC 2E19A 4G9YA 5EEAA 4H0EA 1HA8A 2R7VA 2L4AA 5ICCA 1U5TB 3FXUA 3VYSB 2KL4A 4HPQA 1U8BA 2KJCA 4BBSJ 2QENA 5L3EA 1RR7A 2W82A 2PI0A 1IW7F 4M3GA 4RB3C 3LWFA 2R5ZB 1D3YA 3FXLA 5ED4A 9ANTA 5EFYA 2Y0SA 3COAC 4G8XA 4YG2F 2HQ5A 2A6HF 3ABMH 2H1KA 3L2WA 2DBBA 3S17J 1KGSA 3D5SC 3WTXC 1APLC 2V1DA 3SYTA 1T8IA 3PSIA 5CQEA 2K7LA 1IN7A 3HSRA 1UMQA 2DYSH 1A04A 2LVSA 1BR1A 2E34A 3JREA 1MMSA 4NDLA 4O6JA 2IT0A 2KDOA 3SDGA 3GVAA 3VW0A 4ETSA 3P9KA 1Z0XA 2LYCA 2ZJQF 1IO2A 4IZZA 1YHQI 2OTJI 1ZLJA 4YRVA 1FWZA 3K4LA 3I71A 1RKWA 3VVXA 1W4MA 2OI8A 4LB5A 1ON2A 1USSA 2L54A 1FOKA 4TV7A 5LLQA 2XB0X 3BG3A 1ZH5A 2L7KA 2LFBA 4IVNA 2AHQA 5K7ZA 4A3EJ 3JSJA 2WA0A 5CVUA 4L9JA 4Q48A 1D8JA 1AKHB 3WGGA 4OIPF 3HRTA 1Z05A 2K85A 3LA2A 1T39A 2B9SA 5FLVA 3ZMZA 1ETOA 3RQ4A 2BE5F 1G2HA 2K9SA 1OCPA 2WAQN 1WI9A 2ZXJA 4HZFA 1OFCX 5C3EJ 5K58A 3MEXA 3AL0B 1UFMA 2X4HA 5EGOA 1ZN2A 1XSVA 2WC2A 1R22A 2Y48A 2A6TA 4A3JJ 2M0MA 1XG1A 1MBEA 1U2WA 2E2HJ 2EJRA 3ZMSA 3GFJA 3COLA 1TWCJ 3C07A 5K5OA 3LSTA 3WU1B 2PJPA 1TQMA 1R36A 4Y7NJ 3EUHC 1E2XA 5D4SA 3H3VK 2DT7B 1B72B 1ZR2A 1X1CA 1WKMA 3DEEA 5EGOB 4H4KC 4F3QA 1T0FC 1O3QA 1BR2A 1TTYA 2O0YA 4CGRA 3BPVA 3EUKL 3HOVJ 4JQFA 2IA0A 3LWJA 2EINH 2M30A 2EFOA 4I76A 2BY1A 2M7AA 1X1BA 3MNLA 3U21A 4YIIA 4IX7A 4MEYF 5IPAA 3IP4B 4OWRB 4A3KJ 5FKMA 1GUUA 5FGLA 5TGTA 3NEUA 3IH2A 1KYZA 3HC7A 4AUXA 5E3OA 2K9NA 3H36A 4QPOA 2VE9A 3CCJI 3CWRA 1Z67A 2ZO4A 3JCUC 1T08B 4ZC3A 4AYBA 3HTUA 2DA7A 3AG1H 3MZYA 1ORKA 1PUFA 2Z99A 2QYOA 4G7OF 4ASNA 1FP2A 2AXTC 3ZN0A 5F08A 2EZKA 3DPLC 1LDDA 3K70C 3FK6A 1TL8A 1IN8A 3OL3A 3OYDA 4MO7A 4MTEA 2EZHA 4RS8A 4XOTA 2MW8A 1FMVA 1WHUA 4OINF 3L2RA 3IWFA 3J7YJ 4XR6A 3PQKA 2HYFA 3Q0WA 4M73A 3WGHA 5B1BH 5HLTA 4JBAA 4WWCA 4U87A 4XLAA 2OBPA 4I98B 2P6TA 2R5ZA 1TBXA 2Q24A 3BJBA 2FBIA 2IU5A 3G2BA 1F4KA 3PNTA 2OV7A 4S04A 4UVBA 3Q9VA 4F52A 4Y17A 4BXUA 4J01A 4R8HA 3F6VA 4C3HJ 2ZB9A 2ZFUA 4L18B 3CDIA 5LFAA 3GUDA 1G3SA 2VUMJ 4PJ0C 3OSGA 1QNTA 2O8XA 3QU3A 4M6XA 4HLYA 2HTJA 3V42A 2KRHA 3KEYA 3Q0VA 5CQGA 1OISA 1K6YA 2LRDA 3H9GA 1MZBA 3NWSA 2ADUA 1SAUA 5HLGA 3PJRA 4FT8A 4ZYAA 4HRIA 4PGGA 2E36A 4LK1F 2IS2A 5DUIA 3K7AJ 2IJLA 4I99C 3OIQA 3NAUA 4EGZA 2H27A 1IV8A 2QQBA 2VKVA 4BE2A 4D5CA 3V7SA 3D5RC 1XD7A 2KIUA 1MD0A 2P8TA 2ID6A 3L2QA 5HS9A 1O3RA 4F7ZA 4RAZA 4WXHA 5IP7J 3HRMA 2M45A 2F5EA 4IHSA 1S29A 2JUCA 2DYRH 3DBHB 3JRAA 5HBUA 1AWCA 4BAYA 1R5HA 4XOPA 5F6FA 2KMUA 1X19A 1Y1WJ 2D5VA 5D6FA 1XX5A 1PP7U 3PPBA 2AO9A 3CQZJ 4JL3A 5FRNA 1XS9A 4FHTA 1UHSA 3WTTC 2GIZA 2LY9A 3IUOA 3CF5F 4XKVA 2RAEA 3PM1A 2WY8Q 3KP6A 2MLKA 1J7KA 1Y1VJ 3ZQ7A 2H94A 1ZGAA 3J80Z 1U9OA 5IYDJ 1FIAA 2X6XA 4IRVA 3HHGA 1LNWA 1MGTA 1U0JA 4C3IJ 1BOAA 3P9IA 1IV6A 4XQFA 1FNNA 5FB2A 2QUFA 2Y9YA 2XHKA 1H9TA 1RETA 4HG2A 2NVQJ 3PO3J 2XAUA 3FK7A 4BJ6C 3FWEA 4EM2A 1J9IA 1HSTA 5LEJA 3H3ZA 3ISPA 2QA4I 1XGMA 1V55H 1VQ9I 5JLWA 1OCCH 4D0PA 4ZH4F 3CRJA 2VQLA 2ECCA 2Q2EB 2XKPA 2ZKZA 1D0YA 1TT0A 4M3DA 2HPIA 3MWMA 2WY7Q 5FLXK 1UG2A 2D1HA 2R7SA 4Q5SF 3O60A 2LKXA 3HDDA 5GAGJ 2DODA 1WWXA 4FQGA 3NQOA 3TW6A 4EM1A 2MSYA 1WI3A 2KPMA 3WGIA 3MKZA 1W0TA 2QBYA 1KQ0A 2R92J 2GQQA 2R93J 1W36C 2QQ8A 3KNWA 5A2QZ 2ZNZA 3W6VA 3CCMI 3EUHA 2M87A 1LE8A 3CF2A 4HNVA 4NNJA 3RYRA 2FOKA 3MCZA 4MTDA 3VVZA 4PSWA 3E5QA 1AOYA 4MFDA 3V4GA 3E6MA 3GTGJ 1RRJA 1YIOA 3RPQA 5K7FA 2I10A 1W5SA 4XL9A 2Y75A 2QBYB 3M4OJ 3GTQJ 1EV7A 2LLKA 3ABLH 1FTZA 3VSLA 4HLXA 5LEKA 2O61A 4MIMA 2MFZA 4XK4A 2OCEA 4BY1J 2GFNA 1Z77A 3KETA 1YG2A 2MBFA 3LSJA 1A6IA 2MH9A 5M3MJ 1YI2I 3TKYA 5DYMA 2DU9A 2H6BA 1SMYF 1P7JA 2DA4A 3OYMA 1NG7A 3FXJA 2R7UA 2NX4A 3CCVI 1B1BA 1AKHA 5J8CA 5TRDA 3I5UA 4XORA 3CMEI 2W7NA 3GTMJ 3B73A 3UKGA 5JLXA 1LVKA 3DU5A 4MXMA 4RLFA 1UAAA 3S3MA 5HNFA 1TZLA 3HOTA 4MK6A 1SC7A 1IRZA 2BGCA 2G7HA 1FC3A 5CPRB 3AKZA 1Z3XA 1BA5A 5LGNA 2O3FA 2E71A 3DTKA 3K1PA 2X1DA 4UV9A 1FYKA 1EH7A 2X85A 3MKLA 1MKMA 5LHIA 4IHYA 2WGBA 2O7TA 1C0WA 4UVCA 5C4JJ 3F21A 3HOZJ 2DFIA 3KP2A 2LBFB 1DPUA 3WTSC 5HOOA 4KNYA 3S2HJ 5DS9A 3CJRB 5KVRA 3FRQA 2O6GE 2VT3A 4I09A 1USTA 2XC7A 3ECHA 2L9NA 3IC7A 3V8KA 2CUFA 3HZJA 3ZN1A 1VFCA 3DF8A 5JI6A 1O7FA 2LR8A 1X2MA 3OS2A 2DA3A 1G4DA 1FEXA 3DQVC 3BLYA 2EFNA 4GRIA 4B4CA 1VQ8I 3LHQA 2BHZA 2ELKA 2KIMA 1P4WA 5E20A 4A12A 2PZ9A 2VXDA 1EKEA 4D1QA 4EV0A 3LSRA 1Y0NA 1X3UA 2CW8A 1Z9CA 2XB5A 3S14J 4ANJA 5JVTA 3PQJA 5ICGA 4RB1A 5BS6A 1W7PD 5HLIA 5D4RA 3K8PC 4CHUA 3I0TA 4RGRA 3FHNA 4V19K 2F4OB 3VW1A 2IS4A 3JAMK 3F3XA 1T33A 3QWLA 4HV5A 2VI6A 1I39A 4B8XA 2HGCA 1JT0A 5CVRA 1ETYA 4LMYA 2KKOA 3H3UA 5GTIC 3LSPA 3DCFA 2CQXA 4OD4A 4CZCA 2DXIA 4HX4A 2ZCNA 1J75A 1NHAA 3WTWC 3G7RA 1DGRM 1IAWA 4XLFA 3CMAI 2Q2EA 3HL2A 4II3A 2ISYA 1S8NA 2JA2A 3HPHA 5AIPA 4HV6A 3SHFA 3J7AO 1Z7UA 2G7GA 1ZRCA 1RPWA 3MFKA 3A4CA 4JKZA 2EQRA 2DPDA 2HI3A 3C2BA 3QKXA 1LKXA 3CDHA 2RASA 1STZA 1U5TA 3WTZA 2OZ6A 3OL4A 3BP8A 3VW2A 3JTGA 2XDNA 1FBQA 2ME0A 3I55I 2B3WA 3BC8A 5LBQA 4PFOA 2KRFA 1OCTC 1ETVA 4CCLA 3H5NA 2WB1A 1FPQA 3BR1A 4X1EA 2L9VA 2RQPA 2Z3YA 2K9QA 4LJZF 4E7SA 2VC1A 4E7LA 1RC9A 2A2FX 1IZ1A 4BYYA 5FRMA 2NNNA 1ZREA 3S1QJ 1I50J 4ZDLA 2KRCA 3FBIB 5L3BA 3VTIA 1UJ8A 3A02A 2MA3A 4EEFG 2P4WA 3TBIA 1JT6A 4JP0A 6PAXA 3QBMA 1K83J 1RUOA 1BI1A 2Y9ZA 2UZKA 3VFZA 3N05A 4LOCA 1G3WA 3UNGC 4EJWA 5IP9J 4DYCA 4O5VA 1VQOI 1KYWA 1A6QA 2CO5A 2ZCXA 1W1WE 1JJ6C 3HIMA 5DAJA 3SFZA 4FE4A 3M1EA 1RESA 3O8HA 1B4AA 4ABZA 4IOCF 3J80K 1J59A 2LG4A 2RN7A 5JVGF 4OIQF 3H0GJ 4HNUA 4AIJA 2HFHA 2VBYA 3GWZA 3ON4A 2PG4A 1H89C 2G0EA 1FOWA 4BH9A 2DPUA 2R7WA 2HOEA 2ZCMA 2ZJPF 3GO5A 5L3DA 4YFNF 4BQAA 2C6YA 2O8KA 2LBFA 4EJVA 1R5GA 4BJTA 4DW6A 2KT0A 1ZGJA 2QOPA 4MFEA 2QKMB 1BL0A 2VJIA 1OYYA 1P9QC 2DQRA 4FX0A 3CCRI 1D8KA 3CJTB 2ZXIA 1YLFA 2PBIA 3GZIA 4FE7A 1R1VA 2HQAA 3G1MA 5GPAA 4NC7A 4GCTA 4YELA 1R58A 2G3BA 1TW3A 1B59A 5FGMA 1EF4A 1EH8A 1ZRFA 4F92B 1YRNA 1R1TA 2QSHX 2RNGA 4A6EA 1O3SA 3H5RA 1XGNA 1FLIA 4UDSA 1I3QJ 1JE8A 2W85A 3OYAA 4XSZF 4LG3A 4GO1A 5IT3A 1X1DA 2JA5J 5ICEA 3CC4I 3QAHA 3P9CA 3PSFA 3R0JA 3HGGA 1B8IB 1SFXA 4XKBA 3KEQA 1MNEA 4IO9F 3K10A 1LE8B 4WF2A 1IUFA 2E1NA 3E3VA 2LH9A 2VE8A 4I01A 2W4SA 3BCGA 2TCTA 2XUBA 1ZELA 2EWNA 5TJJA 3KYDB 5DM7F 4D5FA 2DDAA 2IGNA 3FKIJ 4IHTA 2RHAA 2CW0F 2HXOA 3DPUA 1XDUA 4KFCA 1B8IA 1FOYA 1UG0A 2YVXA 3NRVA 2LOOA 4QPQA 4XLNF 3FMQA 4FISA 3KP3A 2CV1A 3WTYC 1W7PB 4A3BJ 1Z21A 2IPQX 4K2EA 3H1CA 1OJLA 3BR5A 3BTCA 1IF1A 2BW3A 3HG9A 4IHVA 1B6AA 1KU2A 4Q47A 4ZTJA 3O6BB 4Y52J 5TISC 2D45A 1RIOH 1X3ZB 1JUPA 2H8WA 1YITI 5E1WA 1FP1D 2O9LA 4CH7A 2DA6A 1SFUA 1V54H 3T8RA 4C2UA 4U88A 2R7FA 3ZMTA 3KP5A 2YX7A 3Q0UA 3K6GA 2CMPA 2Y69H 1R49A 3OOUA 3EDPA 1F36A 3SZTA 2AXLA 5H9TA 1FBSA 1MW7A 2ECBA 4CXFA 4YEJA 1N25A 1VQPI 2JA6J 1HW1A 2ZMEB 1BC7C 2EIKH 2L7MP 3FDYA 5IOZA 1TQIA 3F9KA 1KA8A 2KZVA 4DBRA 3CMMA 1OCRH 5DCFA 2P7VB 1QQIA 3RPUD 4WCGA 1FYLA 1JHFA 1FZPB 3PIOF 2MG4A 2QCOA 2Z5UA 2FU4A 4W97A 2R4GA 1VQKI 2OC6A 3PUFA 2FF4A 4KWAA 3VB2A 3HOYJ 1BIAA 4NHJA 2PEXA 2UXNA 4BBRJ 4E7ZA 2GENA 4I6ZA 1XN7A 1ZGWA 4HF2A 3I54A 3GTOJ 3CJDA 4AC6A 1I27A 4YFXF 3LMMA 3KZYA 1MBJA 1JUMA 2UWMA 2VJ5A 1N77A 4G7ZF 2HKXA 4XLPF 4KN4X 4CA0A 1GT0C 2F2EA 2UXOA 5JFRA 4RGXA 2V4JC 2ZJRF 5IT9K 3OYGA 5FKNA 2HVQA 2KP6A 3V8JA 3NARA 1HKTA 1YTYA 4A93J 3F0CA 1D0XA 1QGPA 2VJ4A 2V6EA 2CUJA 2KLOA 3FMRA 3CMYA 2RGVA 4ZTFA 1GHCA 4ENKA 2W53A 3FM5A 3FMSA 2ME6A 2LD5A 3JRFA 5BOXA 2E1MC 4R79A 2MC3A 2MGQA 3HRSA 2NOJB 5DV5A 4HDVA 2O7OA 2HQRA 2DMPA 5AONA 3K9TA 2P5LC 4E7HA 3W3CA 4KISA 2GXGA 2MYSA 3JSOA 2QWTA 1LFUP 2FJI1 4E7KA 5D1RA 5BQTA 1WFXA 4L9TA 3G1LA 3GTJJ 1TWHJ 1O7LA 2L3DA 2DQLA 1R7JA 2M3AA 2ZXHA 2HWVA 3BG5A 2V9VA 4BQOA 1WJ5A 1QPIA 5ICFA 3SJMA 1IXRC 1LEBA 1GV2A 2TRTA 2IAIA 2Y31A 1LPQA 2PLYA 3A1YA 3C7JA 4E7IA 4ACIA 2FEZA 2EIMH 2JA8J 2HYJA 2XPWA 1JI8A 3O3KA 2IGMA 1OLTA 2VODA 1WQ2A 3FIWA 3LFKA 5FD6A 1SVLA 5FLMJ 2GZWA 2E7XA 2IS1A 1UI5A 1BJAA 5CXIA 3H35A 4BXXJ 5JR3A 5KAFC 2CUZA 4LK0F 3P5JA 4XN0A 5F04A 2PFBA 2F5DA 3E6BA 4HX7A 3GTLJ 3ZQGA 1BN5A 1DPRA 3S1RJ 5ILUA 4DQ2A 2IGOA 4P96A 1QZEA 4CCMA 4V2FA 1XMAA 2TDXA 5KK1A 2DLLA 2XROA 4IJAA 4BE1A 1RUNA 3ECOA 1G6NA 2BHYA 1G3TA 4Y15A 3MZ8A 5FHPA 2HVRA 1RNLA 3BOQA 3R0AA 1OCOH 4RMNA 5B1AH 3LA3A 3QOEA 3ZRGA 2DI3A 2R7RA 5DD8A 1YJNI 4LIVA 1WJAA 3J7AY 1SD6A 3CDLA 1OQYA 4C2MJ 3MKYB 4M72A 2HDWA 2WAQA 3BR3A 2X48A 2XF5A 3TOBA 4LG0A 2FBQA 1ZARA 1JKRC 3ZCOA 3I64A 3GZ5A 4GCVA 2Q0OA 3J81K 3HOWJ 3GW2A 5KCMA 5K7HA 2V7FA 5J8FA 4MEXF 1QA6A 2O03A 1G8XA 2ZMEA 1X3WB 4M6YA 4KUMA 4C3JJ 3SQNA 3PFYA 2ELJA 1W5TA 2MD0A 2V9PA 5KNLA 2EZLA 2VQCA 1FIPA 5F27A 1VQLI 1OR7C 2VT2A 2X9DA 2LSOA 4KN7X 5CVVA 1ZG5A 1NTCA 4PJLA 2K9LA 3C2HA 4CYCA 4OMYA 2ZY9A 5GP9A 1SD7A 2BY2A 3CCSI 3HSFA 4N9HA 3S1MJ 3GFIA 5AQCA 1HXDA 3QYEA 2HOSA 3L2CA 1I1GA 3W2WA 1LDKB 3WG9A 1V5EA 3R61A 3HKZA 2EH3A 1JHHA 3ONQA 5DDGA 3M1CA 1TW2A 2DFEA 4X6AJ 1K79A 2A07F 1JUSA 3DBRB 3Q3SA 3S1NJ 2EILH 3C3WA 5J1UA 2NS0A 2E2IJ 5E18F 3S2DJ 4BQNA 2QKOA 5ILSA 3CCYA 3LQQA 1RZ4A 3K4CA 4A5MA 1JKQC 1U8RA 1YW7A 2OTLI 3IL2A 2E1OA 2GAUA 3OYBA 4ME9A 1AA7A 3I9V2 2FMYA 2CRGA 4HEA2 4PZJA 3HTIA 1PJRA 4UY8I 3VOXA 2CW7A 2CQNA 4AIDA 4G6QA 2QZ8A 3VSKA 2H6CA 4KMUX 1XCBA 4M9ZA 2HQNA 2HDCA 2FA5A 3ANPA 3VVYA 3VWBA 2R7XA 2KIFA 4OU0A 3I3LA 5CVIA 3TL4X 3F8FA 2NS8A 2VJJA 4LLGF 2NNYA 2R7OA 2R7DA 2UV1A 3A03A 3IH3A 3IRQA 3WU0A 3R60A 1O4XA 1TT5B 2HTSA 5F0CA 1A5JA 2DMUA 1W7PA 3QP6A 2IA1A 1I6HJ 2DN0A 1UZCA 3BTJA 3X2QH 1VF9A 1U5TC 2CU7A 2PMZN 2ICWG 4N0BA 2HVSA 2JMWA 1SFKA 4RLQA 4HQEA 3ZP5A 2STTA 4G6TB 1D0ZA 2CS3A 2NXNB 2YUSA 3QP5A 5EJCA 2A5YB 3OMYA 3OYIA 2NVTJ 3F72A 1P2FA 4LIUA 1KONA 4EATA 2ACJA 3OS0A 5LRRA 2FRHA 3BHQA 2OPTA 1YJWI 2HZDA 2LC2A 1KU9A 1U3EM 3OYFA 2KDZA 2YVEA 1GXPA 1BR4A 3EQLF 4WXDA 4OAZA 2YVHA 2W25A 4P9FA 1I1SA 1PVEA 3ROUA 2VBZA 2MH2A 1B9NA 4UVAA 4XM3A 5D6EA 4UB8C 4UV8A 3N97A 3OYKA 2OA4A 1D1BA 3AQSA 4M3BA 1HC8A 1TWGJ 3ZMDA 1MSFC 3V6GA 2NRAC 2IGKA 5DTDA 1L3LA 2QWWA 5HDNA 4DZPA 4UUVA 1XGSA 2CYYA 1EJ9A 2GXAA 3IWZA 2QTQA 3WG7H 5LGTA 4PJMA 4UNOA 3VIBA 4HNTA 4ZYHA 4LFUA 3I53A 4GDFA 3E5XA 1G3YA 1ZLKA 1IC8A 2XRLA 3OV8A 4DYQA 2A69F 3BZCA 3HTHA 2Y30A 2NS7A 2Z9OA 2XAHA 2PMUA 3LSHA 4XRMA 5BMZA 5FKOA 3S3NA 2I5UA 4MQ9F 2RVCA 2QGUA 3LL7A 4ZJZA 2CJJA 1ERDA 1QPMA 2XV4S 4YZEA 2JTVA 1FSEA 4YFKF 2LKPA 2BEOA 3EYIA 5HSZA 4IRIA 1TNTA 4D9JA 3P9TA 1IRXA 2EZIA 3F8MA 5HODA 2Y0MA 1N78A 4IKFA 1KQ9A 4AIKA 4ZYGA 1W36D 2YU9J 4FCYA 3E0JB 4MNUA 1E3HA 4L62A 4CYCB 2R7QA 2UXIA 1FMWA 5E1ZB 4BDYA 3VP5A 1OCZH 3ABKH 4V2GA 4JX6A 3VOKA 2W1OA 2IXSA 2VASA 2HXIA 2J5OA 4UHTA 3OOPA 4RB2C 3CESA 1H9GA 4BACA 2QQAA 4I2OA 3V7RA 1SD4A 2PN6A 3BDDA 3DFGA 3F8BA 4KT6A 4CDGA 5J40A 3RKQA 3WTUC 2H8RA 1G59A 2A05A 2EFWA 4HSRA 1UI6A 1H0MA 1XMXA 3M7GA 4PCQA 5GADJ 2JWTA 1LB2A 3I4MJ 1S3JA 1A35A 2IA2A 1SEUA 2K86A 3HBLA 5BPIA 3T0YA 3SFIA 1SFEA 3SEQA 2CV0A 1XPXA 1OR7A 2ZSHB 5H2FC 3CCQI 2FUG2 1YRNB 1T0FA 3HE0A 1GV5A 4JX5A 3OYCA 5M5YJ 1BI2A 2ESHA 3IRRA 2Q1ZB 5IT9Z 1YO5C 4M6VA 4I0BA 5M5WJ 1IN4A 2NYXA 2O5RA 3W2VA 5GPCA 2STWA 2K3FA 1ITYA 1YOVB 2XIGA 1R9TJ 1ZAOA 2QM3A 2F07A 4HA8A 4A5NA 3TOAA 4BHBA 2WADA 1UELB 2XGCA 1D5YA 4P55A 3BTLA 1WGXA 3S3OA 4DJAA 2A68F 2DOEA 3HB9A 2M7BA 1VQ4I 5CYVA 2DTZA 3KKDA 3RJPA 3M07A 1EA3A 3JTHA 2EB7A 1Y56A 3GFLA 2CSOA 2GBYA 1X2NA 3VOEA 3L7WA 3I4NJ 2BZTA 5HDKA 1Q1HA 1F43A 4GCKA 1J5YA 1TQPA 4QLCU 5D8KB 1I6XA 5J4YA 2BW3B 4EJUA 1X1AA 5GAHJ 4EGYA 1IJWC 3RSNA 3LSIA 2XAGA 3DKXA 3GFMA 5BNGA 3S5RA 2L01A 1YE9A 3GLXA 3DLLF 2ZXWH 4PUSA 3GTPJ 1WZ2A 2M2EA 3M8JA 1JKOC 1ZYRF 3LSGA 3F23A 1NK3P 2FE3A 3T5XA 3OYLA 2JUGA 2B7EA 2R7ZJ 2GM4A 4B3XA 3VEPA 2QIBA 2DJIA 5K5RA 3FXQA 1ETKA 1PYVA 3BT9A 3E7QA 4KDPA 2B0LA 4U0YA 2DTRA 3VUQA 3H5AA 4RAYA 1KZHA 4XNFA 2D6YA 1X4PA 3B02A 2HS5A 3IHUA 2WB1N 4BEHB 1IG7A 4YIFA 2A3SA 1BI3A 1J09A 4KT5C 5K5QA 2FBKA 4AD9A 2DT6A 4ZYDA 3HXLA 3NS4A 4RBOA 3IAS2 3TP0A 2JRMA 3JW4A 4HQMA 1A31A 3R6SA 2GIVA 2ZSIB 3BJOA 3MMYB 2ZBKA 3K70D 1JTXA 2FNPA 3CC7I 2RV8A 4BDZA 1XDSA 2X51A 1XMKA 3KX2A 2X6WA 4BY7J 1HBXG 2BXZA 3VYRB 4ESBA 3RDIA 2LK2A 2W57A 1B9MA 1BI0A 3MD2A 4A0XA 4B3AA 3GZNB 2RNJA 2YU3A 5A2QK 4N4NB 1D5VA 1YX5A 1DU0A 2WUIA 5CXGA 4XLHA 2F4MB 3WODF 2F5VA 3QU6A 4CCNA 4S05A 2ISZA 4JYKA 2XAFA 3G73A 1R6RA 5L3GA 4NC8A 4OOIA 1BIBA 2M1BA 4RDUA 2EA2A 4QWQA 1MMNA 4CZZA 3ZQLA 2Z33A 1U6GA 1K4TA 3BR0A 2XRNA 2GA2A 3TDUC 1DDNA 4OIRF 3JAMZ 3REOA 2XSDC 1T6SA 4OD5A 5GTHC 3R4KA 1PP8F 3RYPA 1OYWA 4IQ4A 3LOCA 3BZ6A 4XRSG 5IOYA 3TGNA 2P0WA 3JRHA 2DOAA 2VQHA 3M8EA 1XC5A 4J19A 3AG4H 2HZTA 3ERED 2HKOA 5EEGA 2GUHA 2KHMA 3IAM2 3NPIA 2HOTA 2QLZA 2IVMA 1YW8A 1ZK8A 2EBIA 4AVZA 3PIPF 4BHPA 2M0CA 2BXYA 2PBXA 3I59B 3NRGA 1FT9A 3JSPA 2CFXA 4HX8A 3OIPA 1YIJI 2OUMA 2BVMA 3P7NA 3B6AA 3QPHA 3CUOA 4O3MA 2XDVA 4GYGA 5FKKA 1Y8RB 1NH3A 1JJ8C 1YFHA 4JX4A 3UR3C 4B47A 2JPCA 3GZ6A 5J4VA 4UUSA 3RZDJ 1FBUA 2VIXA 1LJ9A 3FKJA 3KE2A 4L5IA 3DU6A 3DKWA 3TO7A 1LDJA 1UCRA 2BOLA 5E8IA 4IOAF 1OMIA 2DMQA 1R71A 2E35A 1K7AA 2R3SA 2XF6A 3CZ6A 1R5ID 3PUBA 4HF1A 3RD3A 3DEUA 3E5UA 3G4SI 3IV5A 3E6CC 1Q1VA 2XPVA 2UUZA 2OF7A 4FTHA 4AM3A 4LG0B 4L5EA 5E3NA 2G7UA 4E70A 1XB4A 2VB6A 4IQJA 1N75A 2BVLA 4PXIA 2H09A 2JN6A 1MMGA 3K1MA 4M9SA 4NQWA 3AQTA 4A3LJ 2DOFA 1ON1A 1QHGA 2W48A 4XLCA 1MBKA 3FX3A 3RQIA 4QIWN 3KYCB 5E3LA 3HHHA 3A2KA 5M5XJ 1XSDA 5CJ9A 3MZHA 5E79C 3IKTA 2VBWA 3G56A 1J2XA 2K3PA 3KYLA 4Z6YA 4FASD 5KHDA 3CCLI 1BJZA 1P6RA 4ZYEA 1L0OC 3K4KA 5B3SH 1JKPC 2PFVA 4QTRA 1ONVA 2IBDA 4DGWB 4HYEA 4XBFA 2K4JA 2XAQA 3HPGA 2QF7A 4EQQA 4XRSA 3TMOA 5J1YA 2Y2ZA 1WH7A 4HSTA 4S0HB 1FY7A 3HTSB 4WXCA 1AU7A 4M3FA 5HAWA 5D8LB 3DTEA 3G71I 2VBXA 4W1UA 3K4BA 3RKYA 4OAYA 4ON0A 3EYYA 1RI7A 1XSXA 1E0EA 5H6QA 3ABTA 3ZPLA 3K2ZA 2DAOA 4GFBA 4ESFA 3I56I 3K4MA 2V79A 1DP7P 3HOSA 2IP2A 2QKLB 5JHFA 1MJBA 3GBGA 2AQFA 1DGWY 3K2AA 5FKLA 4E4HA 3BR2A 3SZGA 4DIQA 5B5EC 4R1HA 3M9AA 1X58A 2BV6A 4KIBA 4JNNA 1ZHFA 3Q9SA 2DK8A 3B6CA 1IGNA 2P6SA 3WTVC 4ESJA 4U9NA 1A36A 2Y0SN 3KIOA 4IXAA 1JTYA 3RIRA 3JRDA 1Z6TA 2LTPA 3DPTA 2I8DA 3TQNA 2NP3A 2K9MA 2WV0A 1HKSA 3BJAA 3H9JA 2FXAA 2RC4A 2YPRA 4KIFA 5EG0A 5HDGA 2ZMEC 2DFHA 1E17A 4ITVA 2CH0A 1R4NB 3RI4A 5DCMA 1K61A 3B81A 1WPKA 5J3LA 2F6CA 4LITA 1R00A 1NK2P 1ZG1A 3ANGA 5IP6A 2OCCH 3ZXSA 4X0GA 1QRYA 2JZYA 2VPLA 4IHXA 2COBA 1WH5A 3BTIA 3S15J 1E3PA 2EK5A 5LD2C 3LQRA 1F5TA 3H9QA 2PQ8A 3ULQB 2EPFA 3I59A 5F1RA 2F48A 3OWTA 2L7FP 5FROA 1HDDC 2F5CA 1S6LA 2N8GA 1O57A 5LHGA 2P5KA 1MDMA 3FXMA 2X1EA 5FFXA 2HDDA 4Z2YA 1QVTA 1DP3A 1ZKGA 3E1SA 3K0LA 3E97A 5LRSA 3CLOA 1Y8QB 4G6DA 5FO5A 4HOBA 4L9VA 3IH4A 4JOMA 3OR2C 3HKZN 3BRUA 2FNAA 1HCRA 2A61A 3ASOH 4BL0B 2HEOA 4C2TA 2ZCWA 1H88C 1Y39A 3IUVA 1ZQ3P 2QSFX 5JHUA 3HYIA 3CP2A 3CUQA 1FTTA 3H92A 1MDMB 4L5JA 5H6RA 2FJ1A 3OY9A 1VQMI 3PNYA 4CGZA 2ZNYA 4ICHA 1GVJA 1ZR4A 3IKVA 3ZMUA 4GFKA 1GDTA 1BOBA 1TNSA 5J1RA 1SAXA 2V1XA 3ZQQA 4GYIA 3QPSA 1T2KA 1MJ9A 2KQRA 4LD5A 1HW2A 4XLEA 3EETA 1ACIA 1WJFA 1S7EA 5B66C 3PNVA 2K02A 2JPBA 4ENJA 3BG6A 3QRFF 3CUQB 4C2MA 1KU3A 2JVGA 4C9YA 5GAEJ 3CD6I 4IF4A 2CUEA 3OYNA 3I4PA 4NQWB 1WSUA 2ELHA 4A3IJ 5CKTA 2K5CA 1MBGA 1ODDA 1YW9A 1XGOA 1M1EB 1IUYA 4B09A 3CC2I 2R5YB 2FSWA 3O2PE 5EYRA 1BC8C 4AYBN 4BKXA 4I02A 1QZYA 1TC3C 2B63J 3VPRA 3H0DA 3FBNB 3BG9A 3K69A 1BM9A 3AFHA 5CW8A 4DZJA 3KKCA 2CQKA 2E5NA 2FQ4A 3I58A 4RB0A 2BYVE 2DG7A 3HSEA 2G9WA 5LGUA 3D5LA 2R5YA 2V6CA 5D5WB 5FMPA 1J0RA 2UXXA 3CUQC 3K4NA 4BUPA 2COMA 1X1PA 3QYFA 1EH6A 2DFFA 1I3AA 3E6DA 3CO7C 1VZ0A 3HJEA 4B1RA 1YYVA 1RKTA 2E7WA 2QEXI 5DUKA 2UXHA 4A0ZA 4B48A 2GOXB 2NOGA 1MBFA 4II2A 2NVUB 3GEZA 3F8CA 2WWYA 4EJOA 1IN6A 4F55A 2MLGA 3N4MA 5EF6A 2EFPA 2XAJA 4MQVA 2LY1A 1O3TA 3RKWA 2BY0A 3SEZA 1QU3A 2XPUA 2XSJC 2G7LA 2VPRA 2W84A 3JRBA 3OS1A 2YX4A 4PK4A 3GCMA 2DCEA 5KAIC 1ETXA 3EGQA 4IRHA 3HTJA 4U7DA 4ENNA 3ON2A 4L9NA 1HF0A 2LDUA 3LFUA 4I7HA 3V7CA 4M71A 1IRGA 2XKOA 1SMTA 4A3CJ 3JR9A 3BCBA 4UXNA 4GCLA 2OERA 2HYGD 1QHHD 2CV2A 3DP7A 4CYDA 3VDXA 1Z91A 5E17F 2WAFA 3DEWA 1P92A 3DPJA 1IXCA 3PASA 4AC0A 2FX0A 1S7AA 5EZGA 3U1KA 3KLNA 4U7BA 5M3FJ 4U9LA 5FFZA 4EJTA 2VLAA 1QO0D 3CLQA 4Y33A 1OPCA 4G94A 1K6OA 4RGUA 5IYCJ 2M8GX 4CSWA 3QOPA 3FXKA 4RM2A 1UB9A 3RTRA 1Z1DA 3GX4X 3GYHX 4CCJA 3AG3H 2REKA 1LFBA 2YSRA 1JXSA 3L1PA 3GMEA 2LP0A 1CQTA 3HIFA 2HYTA 2XASA 1FJLA 3LJLA 1HDPA 2JSPA 3AL0C 4KICA 1S9HA 2EA4A 3L09A 4RAGA 2V26A 2P5VA 3ELKA 4HBLA 4E7JA 2FOWA 2XF7A 3BQZA 4KITB 2OU2A 3J81Z 4LLNA 2M4GA 5EEHA 2X0LA 4MHGA 4A3GJ 2ZFWA 3BJ6A 2GWRA 2JSCA 3KLOA 1V3FA 2BY3A 4IHWA 1WVRA 3OR1C 2VKDA 3WU2C 2W24A 3D1NI 1BW6A 2V1UA 3BQYA 2D1VA 2ZOZA 3JRCA 2CGPA 1P7IA 4LGWA 4A6DA 4WIBA 4A3MJ 4IRGA 3S93A 2LREA 1YS6A 3OYHA 1WRJA 2NP5A 4BEHA 1V5GA 4IEJA 3GLLA 2F5FA 4U0VA 2DMNA 1QZZA 3BR6A 1MMDA 2BBYA 3MN2A 5HVQC 1FX7A 5H20A 3WHBA 2A6EF 2DMTA 4DNCA 2V1NA 3J7ZI 3LSMA 3F6OA 2ID3A 3S2WA 5D5VB 2VXZA 3O8GA 5F64A 3HTAA 4QSHA 3KCCA 2X6OA 4D7MA 4Q4ZF 2ZJ2A 1V4RA 3DV8A 5C44J 5DM6F 1T38A 5CVJA 4KA4A 1I5ZA 3ABUA 1Z6RA 3L9FA 2MD5A 3S32A 3ESWB 2MC4A 4BQQA 2DJNA 4XSXF 3ZMVA 2LY2A 3EPZA 4RGSA 1GVDA 2GA1A 2DK5A 3GXOA 1W0UA 4XRFA 2DDBA 2CWEA 3HEFA 3FZVA 3A01B 3NI7A 2KISA 3JRIA 1OYIA 2JK3A 1HSJA 4E6KG 1KU7A 3U9GA 3T1BA 2P7CB 2L02A 1JGGA 2YR2A 2L5QA 2M4KA 2L0KA 4L0ZB 1HKQA 5DCMB 1K78A 2UXUA 2HR3A 3DXJF 4F91B 3CTAA 3FM3A 3KP4A 3MVPA 1WJEA 3QQAA 2OZUA 3WE2A 3KZZA 3A01A 2FBHA 3L00A 4Y4RA 1P4XA 3F8NA 4BNCA 3K4JA 3G1OA 1U78A 2PJRA 4ENMA 4RM3A 2P81A 1UHWA 5F0FA 2E2JJ 1K78B 4CCOA 4JK1X 4XMYA 3RH2A 3ZQIA 3VYUB 5IY5H 4WK8F 4RA2A 3BY6A 1MH4A 4XKCA 1IXSB 4DYRA 1IN5A 4G7HF 3D0SA 2HOAA 4PDKA 5HS7A 2RREA 2HPMA 1VQ6I 2PJRB 3OIOA 2EV0A 1YJ9I 2E1MB 1CGPA 4A0YA 2H1LA 5FLXZ 4GXOA 3F1BA 3TO9A 3HUGB 4ZDOA 4M3EA 5EZHA 4RAFA 2DG8A 1IDYA 1T98A 3PFIA 4BS9A 5E1XA 1MNMC 3HRUA 1D1CA 2KZGA 2OQGA 3CP8A 4J00A 4PSXA 3EUAA 2OQRA 5LHHA 3ZQHA 4UUSB 3F22A 4L0YB 2JVHA 4P9UA 2V57A 1VNDA 4NN1A 4NELA 4DVYP 3S16J 3HUGA 3MKWB 4FETA 2AQEA 3M3YJ 2NVXJ 3V8LA 1IDZA 3M8FA 2RDPA 1OKRA 5F1JA 3L2UA 2D2WA 4AVPA 3L2VA 1S72I 3QPTA 2WBMA 1ZRDA 1HW5A 4BXFA 2X6YA 1GLNA 4AIHA 1LEAA 4XIDA 1JGSA 4XICA 2FQ3A 3OYEA 2KFDA 2W00A 4C30A 3DKYA 1NG6A 1DQUA 3ML6A 3G6EI 1DUXC 1SD5A 1YS7A 2L7ZA 3TEDA 3OSFA 5DD4A 4XONA 2GXBA 1VQ7I 1MMAA 4CCKA 2FMLA 5AIQA 3AAFA 1POGA 1QBJA 3LNQA 3KP7A 2WAEA 2JT1A 4B44A 5J6XA 4HDUA 5BPDA 3DWLE 1HQCA 2UXPA 3NNRA 4HAMA 1FSHA 1R23A 5K1YA 4AWXB 2G7SA 1Z7LA 2XGDA 2GOMA 2R0QC 4GGGA 3SZPA 3RKXA 5FJ8J 3Q5FA 2CFOA 4CICA 2A5WA 1LVAA 3DBLB 3KPHA 4EVIA 1DU6A 2MABA 1F9NA 2ZOYA 3CCEI 3HM5A 2IS6A 2F4IA 1WCMJ 3LAPA 2DW4A 2WTEA 4HKUA 2PX9A 1SGMA 3S8PA
chains in the Genus database with same CATH topology
2R93J 3EUPA 3CDLA 4C2MJ 3KNWA 3W6VA 3BR3A 2FBQA 2X48A 1BJZA 5E3MA 2M9HA 1LE8A 4HNVA 1JKPC 4QTRA 1JKRC 2IBDA 1B72A 1HOMA 3HOWJ 3VVZA 5K7HA 3KZ9A 4MFDA 3HOUJ 2QF7A 3GTGJ 5K7FA 2I10A 4XRSA 5J1YA 2Y2ZA 1WH7A 4S0HB 4C3JJ 1MBHA 3M4OJ 3GTQJ 2LLKA 2EZLA 1FTZA 1AU7A 4M3FA 1FIPA 5HAWA 5F27A 4MIMA 4XK4A 4W1UA 2WV1A 2X9DA 4BY1J 3E7LA 1Z77A 2GFNA 3LSJA 2K40A 1A6IA 1NTCA 5M3MJ 4CYCA 5GP9A 2M34A 3T6NA 4GFBA 5D18A 1P7JA 2DA4A 5AQCA 4D7NA 3S1MJ 2HOSA 2NX4A 1AKHA 1AHDP 3GTMJ 2EH3A 3UKGA 3HGYA 5JLXA 5EG0B 3GBGA 1MSEC 4MXMA 3K2AA 1SANA 4X6AJ 5FKLA 1JUSA 3BR2A 4MK6A 5IYBJ 1IRZA 3Q3SA 3S1NJ 1X58A 3NXCA 4JNNA 5J1UA 2E2IJ 1PUFB 3B6CA 3S2DJ 1IGNA 1BA5A 2QKOA 2Y0SN 3CCYA 1JKQC 1JTYA 3JRDA 3MKLA 4A69C 2LTPA 2E1OA 2YS9A 5C4YA 4ME9A 4IHYA 2NP3A 2WGBA 2L9RA 1BW5A 2O7TA 5EDNA 4UUTA 2CRGA 3ZQCA 4GFLA 3HTIA 5C4JJ 3HOZJ 3BNIA 5EG0A 3VOXA 3TW7A 1E3OC 1MH3A 3HOXJ 3S2HJ 5DS9A 2NVYJ 1H8AC 3FRQA 1K61A 3B81A 1WPKA 5J3LA 3ANPA 3VVYA 1NK2P 3ANGA 2FD5A 5IP6A 1T56A 3ZOBA 1QRYA 4IHXA 2CUFA 2COBA 1WH5A 1VFCA 3BTIA 2JA7J 3S15J 2LR8A 1X2MA 2NS8A 2DA3A 4A3FJ 5D19A 3A03A 1FEXA 3IH3A 1O4XA 1HLVA 5F0CA 1A5JA 2DMUA 2L7FP 1I6HJ 2DN0A 4B4CA 3BTJA 1HDDC 3LHQA 4MLOA 3GEUA 2N8GA 1VF9A 2ELKA 5F0HA 2PMZN 2CU7A 4G12A 2HDDA 2JMWA 1QVTA 3GTKJ 1ZKGA 2PZ9A 3TP3A 3FISA 3LSRA 2YUSA 2XB5A 3S14J 2NVTJ 3IH4A 1SFOJ 1U9NA 2GLOA 3HKZN 4A3DJ 3BRUA 1HCRA 3IUVA 1H88C 3VW1A 1ZQ3P 3QPLA 3ZQFA 1FTTA 1T33A 2VI6A 2R7ZJ 3BHQA 2FJ1A 2OPTA 4ICHA 1JT0A 2XGEA 2KDZA 3WHCA 2YVEA 3PO2J 1ZR4A 1ETYA 4GFKA 1GDTA 5J1RA 1TWFJ 3LSPA 2YVHA 3DCFA 2CQXA 3QPSA 1ZTRA 4AF5A 1S7EA 3JRGA 2ZCNA 3G7RA 3AQSA 4M3BA 1TWGJ 1MSFC 3V6GA 1ETQA 2DA2A 5DTDA 2CUEA 4A3IJ 4DZPA 1MBGA 2G7GA 2DA5A 1RPWA 2VKEA 2R5YB 2QTQA 4JKZA 2EQRA 5EYRA 2HI3A 3C2BA 3VIBA 4AYBN 4BKXA 3QKXA 2RASA 3V78A 1IC8A 2XRLA 4DYQA 1TC3C 1VI0A 3VPRA 2B63J 3HTHA 3VW2A 2XDNA 2ME0A 2Y30A 2NS7A 2JJ7A 3BG9A 2DA1A 4XRMA 5CW8A 5FKOA 4DZJA 3KKCA 2IEKA 1OCTC 1ETVA 2CJJA 2FQ4A 2HKUA 5C4XJ 3BR1A 4X1EA 2DG7A 1ETWA 2K9QA 2R5YA 4YZEA 2CQQA 5HSZA 5FMPA 1QVUA 1TWAJ 1ENHA 3RZOJ 3S1QJ 1I50J 2E19A 3P9TA 5EEAA 2EZIA 5HODA 3A02A 4EEFG 4JP0A 1JT6A 2YU9J 4B1RA 4FCYA 1U8BA 1RKTA 3QBMA 4L62A 1K83J 4BBSJ 4CYCB 2Y9ZA 2UXHA 2UXIA 2NOGA 1MBFA 4LOCA 1RR7A 3VP5A 5IP9J 4V2GA 4DYCA 5EF6A 2R5ZB 4M3GA 4JX6A 3VOKA 2ZCXA 2HXIA 2XPUA 9ANTA 2G7LA 5EFYA 2VPRA 3JRBA 1JJ6C 3HIMA 5DAJA 2HQ5A 4FE4A 2H1KA 1RESA 3O8HA 1ETXA 3S17J 3EGQA 3RKQA 4ABZA 1APLC 3HTJA 2H8RA 3ON2A 1HF0A 3H0GJ 1UMQA 2LVSA 3JREA 2JWTA 4NDLA 4A3CJ 3I4MJ 3SDGA 3JR9A 3VW0A 3ON4A 4GCLA 2OERA 3HBLA 3SFIA 1Z0XA 1H89C 2G0EA 2ZCMA 1RKWA 3VVXA 3DEWA 2OI8A 3DPJA 1YRNB 3PASA 4AC0A 2O8KA 2FX0A 2XB0X 3BG3A 5EZGA 1GV5A 3HE0A 4JX5A 5M3FJ 3JSJA 2LFBA 4DW6A 2AHQA 2KT0A 5K7ZA 5M5YJ 4A3EJ 2QOPA 4MFEA 1BL0A 4M6VA 1AKHB 5IYCJ 2M8GX 5M5WJ 3GZIA 4FE7A 5GPCA 1ITYA 1R9TJ 5FLVA 3G1MA 5GPAA 2REKA 4GCTA 1ETOA 1LFBA 2F07A 2G3BA 3L1PA 1D5YA 1EF4A 2XGCA 1G2HA 2LP0A 3BTLA 2K9SA 1CQTA 1YRNA 1OCPA 1WGXA 2WAQN 2HYTA 5C3EJ 1OFCX 4UDSA 5K58A 1I3QJ 1FJLA 3LJLA 1HDPA 3HB9A 2DTZA 5EGOA 3KKDA 2JA5J 4A3JJ 3BQZA 1XG1A 1MBEA 2E2HJ 3HGGA 1B8IB 4A3GJ 2GBYA 1X2NA 3COLA 1TWCJ 3I4NJ 3C07A 4IHWA 1F43A 4GCKA 4Y7NJ 3H3VK 1LE8B 1IUFA 1B72B 1ZR2A 3D1NI 1BW6A 2ZOZA 3BQYA 3JRCA 5EGOB 1P7IA 3BCGA 2TCTA 1IJWC 4A3MJ 5BNGA 4D5FA 3FKIJ 3S5RA 2NP5A 2RHAA 2HXOA 1B8IA 4IEJA 4CGRA 3GTPJ 3HOVJ 2M2EA 1JKOC 4FISA 2DMNA 3BR6A 3LSGA 1NK3P 4A3BJ 3LWJA 2GM4A 4I76A 3MN2A 2QIBA 3WHBA 1ETKA 3MNLA 1OJLA 3BT9A 2DMTA 3BR5A 3BTCA 4IHVA 3E7QA 4Y52J 5IPAA 3VUQA 2ID3A 4A3KJ 1JUPA 5FKMA 1GUUA 2O9LA 2D6YA 5FGLA 3O8GA 2DA6A 3HTAA 2WB1N 4QSHA 2X6OA 3IH2A 4D7MA 1IG7A 4AUXA 5E3OA 5C44J 2K9NA 3CWRA 3Q0UA 4RBOA 3TP0A 3OOUA 2DA7A 1F36A 2DJNA 1ORKA 5H9TA 1PUFA 2ECBA 1GVDA 2JA6J 1JTXA 1W0UA 5F08A 2EZKA 3FK6A 2L7MP 5IOZA 3HEFA 4MO7A 2EZHA 4BY7J 2MG4A 3A01B 3NI7A 2QCOA 2MW8A 3JRIA 2JK3A 2LK2A 4W97A 1JGGA 3Q0WA 2L0KA 4KWAA 3HOYJ 4B3AA 4BBRJ 2UXUA 2GENA 4I6ZA 1ZGWA 1DU0A 4AC6A 3CJDA 3GTOJ 2R5ZA 3MVPA 2WUIA 5CXGA 3QQAA 2Q24A 3BJBA 3A01A 2IU5A 1MBJA 1JUMA 3G1OA 1U78A 4JYKA 1GT0C 2UXOA 2P81A 4C3HJ 5F0FA 2E2JJ 2ZB9A 4RDUA 3RH2A 3ZQIA 5FKNA 3ZQLA 3BR0A 3NARA 2VUMJ 4A93J 3F0CA 1MH4A 3OSGA 2XSDC 4DYRA 3CMYA 2HOAA 3Q0VA 1UI6A 2W53A 3OIOA 3LOCA 2ME6A 4XRSG 5IOYA 2LD5A 3JRFA 3JRHA 2MGQA 3K7AJ 1XC5A 2O7OA 2DMPA 4J19A 3NAUA 3F1BA 2QWTA 2VKVA 4D5CA 2GUHA 4M3EA 1LFUP 5EZHA 2DG8A 3NPIA 5D1RA 1IDYA 1MNMC 2HOTA 2ID6A 3G1LA 1ZK8A 2EBIA 3GTJJ 1TWHJ 5IP7J 2M0CA 3ZQHA 3JRAA 5HBUA 4UUSB 2PBXA 3NRGA 3BG5A 2V57A 1QPIA 2D5VA 1VNDA 3SJMA 1Y1WJ 4NELA 4NN1A 3S16J 3M3YJ 1IDZA 3PPBA 2AO9A 3CQZJ 2NVXJ 1GV2A 4JL3A 2TRTA 2IAIA 2Y31A 3B6AA 5F1JA 1XS9A 1UHSA 2LY9A 4ACIA 2RAEA 2JA8J 2HYJA 3PM1A 5FKKA 1Y1VJ 2XPWA 1JJ8C 1U9OA 4XIDA 3FIWA 5IYDJ 4XICA 1FIAA 4JX4A 5FLMJ 4UUSA 3RZDJ 1UI5A 5CXIA 4C3IJ 1IV6A 4BXXJ 2L7ZA 2Y9YA 3TEDA 5F04A 1RETA 3OSFA 2NVQJ 3PO3J 2DMQA 3FK7A 3GTLJ 3ZQGA 1POGA 3S1RJ 3RD3A 3LNQA 2UXPA 3IV5A 3NNRA 1Q1VA 2XPVA 2OF7A 4V2FA 4FTHA 5JLWA 2G7SA 4L5EA 2XGDA 5E3NA 3CRJA 2R0QC 2ECCA 5FJ8J 4PXIA 2JN6A 4M3DA 3AQTA 1UG2A 4A3LJ 3O60A 1DU6A 2W48A 2LKXA 3HDDA 1MBKA 3RQIA 4QIWN 2ZOYA 3TW6A 5E3LA 3HM5A 5FHPA 2MSYA 1WI3A 1WCMJ 5M5XJ 1W0TA 4HKUA 1SGMA 2R92J 3G56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 J;  3EUP A;  3CDL A;  4C2M J;  3KNW A;  3W6V A;  3BR3 A;  2FBQ A;  2X48 A;  1BJZ A;  5E3M A;  2M9H A;  1LE8 A;  4HNV A;  1JKP C;  4QTR A;  1JKR C;  2IBD A;  1B72 A;  1HOM A;  3HOW J;  3VVZ A;  5K7H A;  3KZ9 A;  4MFD A;  3HOU J;  2QF7 A;  3GTG J;  5K7F A;  2I10 A;  4XRS A;  5J1Y A;  2Y2Z A;  1WH7 A;  4S0H B;  4C3J J;  1MBH A;  3M4O J;  3GTQ J;  2LLK A;  2EZL A;  1FTZ A;  1AU7 A;  4M3F A;  1FIP A;  5HAW A;  5F27 A;  4MIM A;  4XK4 A;  4W1U A;  2WV1 A;  2X9D A;  4BY1 J;  3E7L A;  1Z77 A;  2GFN A;  3LSJ A;  2K40 A;  1A6I A;  1NTC A;  5M3M J;  4CYC A;  5GP9 A;  2M34 A;  3T6N A;  4GFB A;  5D18 A;  1P7J A;  2DA4 A;  5AQC A;  4D7N A;  3S1M J;  2HOS A;  2NX4 A;  1AKH A;  1AHD P;  3GTM J;  2EH3 A;  3UKG A;  3HGY A;  5JLX A;  5EG0 B;  3GBG A;  1MSE C;  4MXM A;  3K2A A;  1SAN A;  4X6A J;  5FKL A;  1JUS A;  3BR2 A;  4MK6 A;  5IYB J;  1IRZ A;  3Q3S A;  3S1N J;  1X58 A;  3NXC A;  4JNN A;  5J1U A;  2E2I J;  1PUF B;  3B6C A;  3S2D J;  1IGN A;  1BA5 A;  2QKO A;  2Y0S N;  3CCY A;  1JKQ C;  1JTY A;  3JRD A;  3MKL A;  4A69 C;  2LTP A;  2E1O A;  2YS9 A;  5C4Y A;  4ME9 A;  4IHY A;  2NP3 A;  2WGB A;  2L9R A;  1BW5 A;  2O7T A;  5EDN A;  4UUT A;  2CRG A;  3ZQC A;  4GFL A;  3HTI A;  5C4J J;  3HOZ J;  3BNI A;  5EG0 A;  3VOX A;  3TW7 A;  1E3O C;  1MH3 A;  3HOX J;  3S2H J;  5DS9 A;  2NVY J;  1H8A C;  3FRQ A;  1K61 A;  3B81 A;  1WPK A;  5J3L A;  3ANP A;  3VVY A;  1NK2 P;  3ANG A;  2FD5 A;  5IP6 A;  1T56 A;  3ZOB A;  1QRY A;  4IHX A;  2CUF A;  2COB A;  1WH5 A;  1VFC A;  3BTI A;  2JA7 J;  3S15 J;  2LR8 A;  1X2M A;  2NS8 A;  2DA3 A;  4A3F J;  5D19 A;  3A03 A;  1FEX A;  3IH3 A;  1O4X A;  1HLV A;  5F0C A;  1A5J A;  2DMU A;  2L7F P;  1I6H J;  2DN0 A;  4B4C A;  3BTJ A;  1HDD C;  3LHQ A;  4MLO A;  3GEU A;  2N8G A;  1VF9 A;  2ELK A;  5F0H A;  2PMZ N;  2CU7 A;  4G12 A;  2HDD A;  2JMW A;  1QVT A;  3GTK J;  1ZKG A;  2PZ9 A;  3TP3 A;  3FIS A;  3LSR A;  2YUS A;  2XB5 A;  3S14 J;  2NVT J;  3IH4 A;  1SFO J;  1U9N A;  2GLO A;  3HKZ N;  4A3D J;  3BRU A;  1HCR A;  3IUV A;  1H88 C;  3VW1 A;  1ZQ3 P;  3QPL A;  3ZQF A;  1FTT A;  1T33 A;  2VI6 A;  2R7Z J;  3BHQ A;  2FJ1 A;  2OPT A;  4ICH A;  1JT0 A;  2XGE A;  2KDZ A;  3WHC A;  2YVE A;  3PO2 J;  1ZR4 A;  1ETY A;  4GFK A;  1GDT A;  5J1R A;  1TWF J;  3LSP A;  2YVH A;  3DCF A;  2CQX A;  3QPS A;  1ZTR A;  4AF5 A;  1S7E A;  3JRG A;  2ZCN A;  3G7R A;  3AQS A;  4M3B A;  1TWG J;  1MSF C;  3V6G A;  1ETQ A;  2DA2 A;  5DTD A;  2CUE A;  4A3I J;  4DZP A;  1MBG A;  2G7G A;  2DA5 A;  1RPW A;  2VKE A;  2R5Y B;  2QTQ A;  4JKZ A;  2EQR A;  5EYR A;  2HI3 A;  3C2B A;  3VIB A;  4AYB N;  4BKX A;  3QKX A;  2RAS A;  3V78 A;  1IC8 A;  2XRL A;  4DYQ A;  1TC3 C;  1VI0 A;  3VPR A;  2B63 J;  3HTH A;  3VW2 A;  2XDN A;  2ME0 A;  2Y30 A;  2NS7 A;  2JJ7 A;  3BG9 A;  2DA1 A;  4XRM A;  5CW8 A;  5FKO A;  4DZJ A;  3KKC A;  2IEK A;  1OCT C;  1ETV A;  2CJJ A;  2FQ4 A;  2HKU A;  5C4X J;  3BR1 A;  4X1E A;  2DG7 A;  1ETW A;  2K9Q A;  2R5Y A;  4YZE A;  2CQQ A;  5HSZ A;  5FMP A;  1QVU A;  1TWA J;  1ENH A;  3RZO J;  3S1Q J;  1I50 J;  2E19 A;  3P9T A;  5EEA A;  2EZI A;  5HOD A;  3A02 A;  4EEF G;  4JP0 A;  1JT6 A;  2YU9 J;  4B1R A;  4FCY A;  1U8B A;  1RKT A;  3QBM A;  4L62 A;  1K83 J;  4BBS J;  4CYC B;  2Y9Z A;  2UXH A;  2UXI A;  2NOG A;  1MBF A;  4LOC A;  1RR7 A;  3VP5 A;  5IP9 J;  4V2G A;  4DYC A;  5EF6 A;  2R5Z B;  4M3G A;  4JX6 A;  3VOK A;  2ZCX A;  2HXI A;  2XPU A;  9ANT A;  2G7L A;  5EFY A;  2VPR A;  3JRB A;  1JJ6 C;  3HIM A;  5DAJ A;  2HQ5 A;  4FE4 A;  2H1K A;  1RES A;  3O8H A;  1ETX A;  3S17 J;  3EGQ A;  3RKQ A;  4ABZ A;  1APL C;  3HTJ A;  2H8R A;  3ON2 A;  1HF0 A;  3H0G J;  1UMQ A;  2LVS A;  3JRE A;  2JWT A;  4NDL A;  4A3C J;  3I4M J;  3SDG A;  3JR9 A;  3VW0 A;  3ON4 A;  4GCL A;  2OER A;  3HBL A;  3SFI A;  1Z0X A;  1H89 C;  2G0E A;  2ZCM A;  1RKW A;  3VVX A;  3DEW A;  2OI8 A;  3DPJ A;  1YRN B;  3PAS A;  4AC0 A;  2O8K A;  2FX0 A;  2XB0 X;  3BG3 A;  5EZG A;  1GV5 A;  3HE0 A;  4JX5 A;  5M3F J;  3JSJ A;  2LFB A;  4DW6 A;  2AHQ A;  2KT0 A;  5K7Z A;  5M5Y J;  4A3E J;  2QOP A;  4MFE A;  1BL0 A;  4M6V A;  1AKH B;  5IYC J;  2M8G X;  5M5W J;  3GZI A;  4FE7 A;  5GPC A;  1ITY A;  1R9T J;  5FLV A;  3G1M A;  5GPA A;  2REK A;  4GCT A;  1ETO A;  1LFB A;  2F07 A;  2G3B A;  3L1P A;  1D5Y A;  1EF4 A;  2XGC A;  1G2H A;  2LP0 A;  3BTL A;  2K9S A;  1CQT A;  1YRN A;  1OCP A;  1WGX A;  2WAQ N;  2HYT A;  5C3E J;  1OFC X;  4UDS A;  5K58 A;  1I3Q J;  1FJL A;  3LJL A;  1HDP A;  3HB9 A;  2DTZ A;  5EGO A;  3KKD A;  2JA5 J;  4A3J J;  3BQZ A;  1XG1 A;  1MBE A;  2E2H J;  3HGG A;  1B8I B;  4A3G J;  2GBY A;  1X2N A;  3COL A;  1TWC J;  3I4N J;  3C07 A;  4IHW A;  1F43 A;  4GCK A;  4Y7N J;  3H3V K;  1LE8 B;  1IUF A;  1B72 B;  1ZR2 A;  3D1N I;  1BW6 A;  2ZOZ A;  3BQY A;  3JRC A;  5EGO B;  1P7I A;  3BCG A;  2TCT A;  1IJW C;  4A3M J;  5BNG A;  4D5F A;  3FKI J;  3S5R A;  2NP5 A;  2RHA A;  2HXO A;  1B8I A;  4IEJ A;  4CGR A;  3GTP J;  3HOV J;  2M2E A;  1JKO C;  4FIS A;  2DMN A;  3BR6 A;  3LSG A;  1NK3 P;  4A3B J;  3LWJ A;  2GM4 A;  4I76 A;  3MN2 A;  2QIB A;  3WHB A;  1ETK A;  3MNL A;  1OJL A;  3BT9 A;  2DMT A;  3BR5 A;  3BTC A;  4IHV A;  3E7Q A;  4Y52 J;  5IPA A;  3VUQ A;  2ID3 A;  4A3K J;  1JUP A;  5FKM A;  1GUU A;  2O9L A;  2D6Y A;  5FGL A;  3O8G A;  2DA6 A;  3HTA A;  2WB1 N;  4QSH A;  2X6O A;  3IH2 A;  4D7M A;  1IG7 A;  4AUX A;  5E3O A;  5C44 J;  2K9N A;  3CWR A;  3Q0U A;  4RBO A;  3TP0 A;  3OOU A;  2DA7 A;  1F36 A;  2DJN A;  1ORK A;  5H9T A;  1PUF A;  2ECB A;  1GVD A;  2JA6 J;  1JTX A;  1W0U A;  5F08 A;  2EZK A;  3FK6 A;  2L7M P;  5IOZ A;  3HEF A;  4MO7 A;  2EZH A;  4BY7 J;  2MG4 A;  3A01 B;  3NI7 A;  2QCO A;  2MW8 A;  3JRI A;  2JK3 A;  2LK2 A;  4W97 A;  1JGG A;  3Q0W A;  2L0K A;  4KWA A;  3HOY J;  4B3A A;  4BBR J;  2UXU A;  2GEN A;  4I6Z A;  1ZGW A;  1DU0 A;  4AC6 A;  3CJD A;  3GTO J;  2R5Z A;  3MVP A;  2WUI A;  5CXG A;  3QQA A;  2Q24 A;  3BJB A;  3A01 A;  2IU5 A;  1MBJ A;  1JUM A;  3G1O A;  1U78 A;  4JYK A;  1GT0 C;  2UXO A;  2P81 A;  4C3H J;  5F0F A;  2E2J J;  2ZB9 A;  4RDU A;  3RH2 A;  3ZQI A;  5FKN A;  3ZQL A;  3BR0 A;  3NAR A;  2VUM J;  4A93 J;  3F0C A;  1MH4 A;  3OSG A;  2XSD C;  4DYR A;  3CMY A;  2HOA A;  3Q0V A;  1UI6 A;  2W53 A;  3OIO A;  3LOC A;  2ME6 A;  4XRS G;  5IOY A;  2LD5 A;  3JRF A;  3JRH A;  2MGQ A;  3K7A J;  1XC5 A;  2O7O A;  2DMP A;  4J19 A;  3NAU A;  3F1B A;  2QWT A;  2VKV A;  4D5C A;  2GUH A;  4M3E A;  1LFU P;  5EZH A;  2DG8 A;  3NPI A;  5D1R A;  1IDY A;  1MNM C;  2HOT A;  2ID6 A;  3G1L A;  1ZK8 A;  2EBI A;  3GTJ J;  1TWH J;  5IP7 J;  2M0C A;  3ZQH A;  3JRA A;  5HBU A;  4UUS B;  2PBX A;  3NRG A;  3BG5 A;  2V57 A;  1QPI A;  2D5V A;  1VND A;  3SJM A;  1Y1W J;  4NEL A;  4NN1 A;  3S16 J;  3M3Y J;  1IDZ A;  3PPB A;  2AO9 A;  3CQZ J;  2NVX J;  1GV2 A;  4JL3 A;  2TRT A;  2IAI A;  2Y31 A;  3B6A A;  5F1J A;  1XS9 A;  1UHS A;  2LY9 A;  4ACI A;  2RAE A;  2JA8 J;  2HYJ A;  3PM1 A;  5FKK A;  1Y1V J;  2XPW A;  1JJ8 C;  1U9O A;  4XID A;  3FIW A;  5IYD J;  4XIC A;  1FIA A;  4JX4 A;  5FLM J;  4UUS A;  3RZD J;  1UI5 A;  5CXI A;  4C3I J;  1IV6 A;  4BXX J;  2L7Z A;  2Y9Y A;  3TED A;  5F04 A;  1RET A;  3OSF A;  2NVQ J;  3PO3 J;  2DMQ A;  3FK7 A;  3GTL J;  3ZQG A;  1POG A;  3S1R J;  3RD3 A;  3LNQ A;  2UXP A;  3IV5 A;  3NNR A;  1Q1V A;  2XPV A;  2OF7 A;  4V2F A;  4FTH A;  5JLW A;  2G7S A;  4L5E A;  2XGD A;  5E3N A;  3CRJ A;  2R0Q C;  2ECC A;  5FJ8 J;  4PXI A;  2JN6 A;  4M3D A;  3AQT A;  1UG2 A;  4A3L J;  3O60 A;  1DU6 A;  2W48 A;  2LKX A;  3HDD A;  1MBK A;  3RQI A;  4QIW N;  2ZOY A;  3TW6 A;  5E3L A;  3HM5 A;  5FHP A;  2MSY A;  1WI3 A;  1WCM J;  5M5X J;  1W0T A;  4HKU A;  1SGM A;  2R92 J;  3G56 A; 
#chains in the Genus database with same CATH topology
 3TO6 A;  4NUB A;  3EUP A;  2VQG A;  3FF5 A;  4I0A A;  5E8G A;  2HU9 A;  3A0B C;  5E3M A;  3C2G A;  4MGR A;  2M9H A;  1MJA A;  1B72 A;  1HOM A;  4A2U A;  2LMD A;  3KZ9 A;  3HOU J;  1V5F A;  1CF7 A;  4AU7 A;  4LLL A;  2NAZ A;  3C1D A;  4EM0 B;  2E5Z A;  1MBH A;  5D5X B;  2Z1D A;  3LSK A;  2DT5 A;  3CJQ B;  2OAZ A;  4DBQ A;  1IRF A;  1R4M B;  1SVM A;  4LB6 B;  1D1A A;  4UB6 C;  3SWH A;  1Y6I A;  2K4B A;  2WV1 A;  4BU2 A;  2EV5 A;  3E7L A;  1S5L C;  2K40 A;  3DTI A;  5FD5 A;  2JRT A;  1GXQ A;  2XGX A;  3SXY A;  5D5U B;  1Z3Y A;  1S7O A;  2M34 A;  3T6N A;  1CF7 B;  5D18 A;  2HNH A;  2V9K A;  4KIG A;  1XCV A;  4KJZ A;  4IL6 C;  2IW5 A;  2ZC2 A;  4D7N A;  3U2R A;  1K4S A;  1AHD P;  4BE0 A;  2EV6 A;  2ESN A;  3DLA A;  4P5O A;  3HGY A;  5EG0 B;  1MSE C;  2VL8 A;  4P1W A;  1SAN A;  1MND A;  2PMZ A;  4BHC A;  3QOD A;  5IYB J;  3RPU A;  4BJ5 C;  1X4O A;  2VKH A;  3NXC A;  2EIJ H;  2VN2 A;  1YQA A;  1PUF B;  3U1D A;  4XKW A;  4PGH A;  4BGD A;  1P4A A;  4A69 C;  4CUG A;  2YS9 A;  5C4Y A;  2LF7 A;  4PJN A;  1MIJ A;  3RCO A;  2L9R A;  4EMS A;  4KMF A;  2QQ9 A;  5EDN A;  4UUT A;  4FX4 A;  1BW5 A;  3ZQC A;  1ZG3 A;  4GFL A;  3BNI A;  5ERI A;  3TW7 A;  1BBY A;  1E3O C;  3KEO A;  1MH3 A;  3HOX J;  3CO6 C;  3VOD A;  3ZR8 X;  2L9S A;  2NVY J;  5J47 A;  4OMZ A;  1H8A C;  4Y13 A;  1TLH B;  1UHM A;  5L3C A;  3MAJ A;  2Z2S B;  2FD5 A;  4NB5 A;  1T56 A;  2LKS A;  3ZOB A;  5ILV A;  2QVO A;  2IRF G;  2JA7 J;  3ZGK A;  2VOO A;  4A3F J;  5D19 A;  3CCU I;  3W6K B;  5L3F A;  5HS8 A;  1HLV A;  3NWT A;  3WE3 A;  2KJB A;  3FXR A;  4B43 A;  2L4M A;  4Y3O A;  1T95 A;  4MLO A;  3A0H C;  2RQQ A;  3GF2 A;  5HNH A;  1R1U A;  1LFP A;  4WX9 A;  3GEU A;  5F0H A;  4U0W A;  4G12 A;  4YIR X;  3OYJ A;  3GTK J;  2VC0 A;  1WJB A;  4NC6 A;  4PFP A;  3TP3 A;  3CJN A;  3FIS A;  4OIO F;  1KQ8 A;  1WJD A;  3T8T A;  1ULY A;  2E1C A;  1YX3 A;  1SFO J;  1XTA A;  1U9N A;  3LA7 A;  2GLO A;  3KFW X;  2CQ7 A;  4M9X A;  4A3D J;  4M74 A;  3QPL A;  4KYW A;  3ZQF A;  2LF8 A;  3FXO A;  3K1N A;  3BG7 A;  3PL8 A;  3QYB A;  1PUE E;  4F93 B;  2OD5 A;  2L2O A;  4N9I A;  5DEQ A;  2ETH A;  2XGE A;  3WHC A;  4DOZ A;  3G3Z A;  3PO2 J;  2OJE D;  2AS5 F;  3ASN H;  4ZDP A;  2XVC A;  3FHZ A;  1TWF J;  3BCA A;  2VOP A;  2J5P A;  1FOX A;  4HF0 A;  1ZTR A;  1FYM A;  4PJJ A;  5HLH A;  3BRO A;  3JRG A;  4AF5 A;  2DO7 A;  4IPA A;  1RR8 C;  3KZI C;  2M5W A;  4XN3 A;  1VQN I;  1Y0U A;  3BPX A;  2E60 A;  3BWG A;  3MQ0 A;  2M8E A;  2R7T A;  1ETQ A;  3TDZ C;  2DA2 A;  4HW0 A;  4CO8 A;  5CLS A;  2PMH A;  2QSG X;  3W6J B;  1REP C;  3W2A A;  2EFQ A;  2DA5 A;  3AG2 H;  2VKE A;  2KIQ A;  4NBQ A;  3LAJ A;  2Q8K A;  1LQ1 A;  3V78 A;  1PDN C;  1SVO A;  2K27 A;  2JQ7 A;  4ZZL A;  1VI0 A;  2CG4 A;  3BZK A;  2Z16 A;  2JJ7 A;  4ZZD A;  2DA1 A;  2LNB A;  2IEK A;  1WJC A;  2VON A;  3SDB A;  2B1E A;  2HKU A;  1VQ5 I;  5C4X J;  3C18 A;  4N4O B;  3VYT B;  1TP4 A;  1W5C C;  1ETW A;  1LUJ B;  1F1Z A;  2RKH A;  3ERM A;  2CQQ A;  2X1C A;  1QVU A;  1TWA J;  1ENH A;  3RZO J;  1VTN C;  2E19 A;  4G9Y A;  5EEA A;  4H0E A;  1HA8 A;  2R7V A;  2L4A A;  5ICC A;  1U5T B;  3FXU A;  3VYS B;  2KL4 A;  4HPQ A;  1U8B A;  2KJC A;  4BBS J;  2QEN A;  5L3E A;  1RR7 A;  2W82 A;  2PI0 A;  1IW7 F;  4M3G A;  4RB3 C;  3LWF A;  2R5Z B;  1D3Y A;  3FXL A;  5ED4 A;  9ANT A;  5EFY A;  2Y0S A;  3COA C;  4G8X A;  4YG2 F;  2HQ5 A;  2A6H F;  3ABM H;  2H1K A;  3L2W A;  2DBB A;  3S17 J;  1KGS A;  3D5S C;  3WTX C;  1APL C;  2V1D A;  3SYT A;  1T8I A;  3PSI A;  5CQE A;  2K7L A;  1IN7 A;  3HSR A;  1UMQ A;  2DYS H;  1A04 A;  2LVS A;  1BR1 A;  2E34 A;  3JRE A;  1MMS A;  4NDL A;  4O6J A;  2IT0 A;  2KDO A;  3SDG A;  3GVA A;  3VW0 A;  4ETS A;  3P9K A;  1Z0X A;  2LYC A;  2ZJQ F;  1IO2 A;  4IZZ A;  1YHQ I;  2OTJ I;  1ZLJ A;  4YRV A;  1FWZ A;  3K4L A;  3I71 A;  1RKW A;  3VVX A;  1W4M A;  2OI8 A;  4LB5 A;  1ON2 A;  1USS A;  2L54 A;  1FOK A;  4TV7 A;  5LLQ A;  2XB0 X;  3BG3 A;  1ZH5 A;  2L7K A;  2LFB A;  4IVN A;  2AHQ A;  5K7Z A;  4A3E J;  3JSJ A;  2WA0 A;  5CVU A;  4L9J A;  4Q48 A;  1D8J A;  1AKH B;  3WGG A;  4OIP F;  3HRT A;  1Z05 A;  2K85 A;  3LA2 A;  1T39 A;  2B9S A;  5FLV A;  3ZMZ A;  1ETO A;  3RQ4 A;  2BE5 F;  1G2H A;  2K9S A;  1OCP A;  2WAQ N;  1WI9 A;  2ZXJ A;  4HZF A;  1OFC X;  5C3E J;  5K58 A;  3MEX A;  3AL0 B;  1UFM A;  2X4H A;  5EGO A;  1ZN2 A;  1XSV A;  2WC2 A;  1R22 A;  2Y48 A;  2A6T A;  4A3J J;  2M0M A;  1XG1 A;  1MBE A;  1U2W A;  2E2H J;  2EJR A;  3ZMS A;  3GFJ A;  3COL A;  1TWC J;  3C07 A;  5K5O A;  3LST A;  3WU1 B;  2PJP A;  1TQM A;  1R36 A;  4Y7N J;  3EUH C;  1E2X A;  5D4S A;  3H3V K;  2DT7 B;  1B72 B;  1ZR2 A;  1X1C A;  1WKM A;  3DEE A;  5EGO B;  4H4K C;  4F3Q A;  1T0F C;  1O3Q A;  1BR2 A;  1TTY A;  2O0Y A;  4CGR A;  3BPV A;  3EUK L;  3HOV J;  4JQF A;  2IA0 A;  3LWJ A;  2EIN H;  2M30 A;  2EFO A;  4I76 A;  2BY1 A;  2M7A A;  1X1B A;  3MNL A;  3U21 A;  4YII A;  4IX7 A;  4MEY F;  5IPA A;  3IP4 B;  4OWR B;  4A3K J;  5FKM A;  1GUU A;  5FGL A;  5TGT A;  3NEU A;  3IH2 A;  1KYZ A;  3HC7 A;  4AUX A;  5E3O A;  2K9N A;  3H36 A;  4QPO A;  2VE9 A;  3CCJ I;  3CWR A;  1Z67 A;  2ZO4 A;  3JCU C;  1T08 B;  4ZC3 A;  4AYB A;  3HTU A;  2DA7 A;  3AG1 H;  3MZY A;  1ORK A;  1PUF A;  2Z99 A;  2QYO A;  4G7O F;  4ASN A;  1FP2 A;  2AXT C;  3ZN0 A;  5F08 A;  2EZK A;  3DPL C;  1LDD A;  3K70 C;  3FK6 A;  1TL8 A;  1IN8 A;  3OL3 A;  3OYD A;  4MO7 A;  4MTE A;  2EZH A;  4RS8 A;  4XOT A;  2MW8 A;  1FMV A;  1WHU A;  4OIN F;  3L2R A;  3IWF A;  3J7Y J;  4XR6 A;  3PQK A;  2HYF A;  3Q0W A;  4M73 A;  3WGH A;  5B1B H;  5HLT A;  4JBA A;  4WWC A;  4U87 A;  4XLA A;  2OBP A;  4I98 B;  2P6T A;  2R5Z A;  1TBX A;  2Q24 A;  3BJB A;  2FBI A;  2IU5 A;  3G2B A;  1F4K A;  3PNT A;  2OV7 A;  4S04 A;  4UVB A;  3Q9V A;  4F52 A;  4Y17 A;  4BXU A;  4J01 A;  4R8H A;  3F6V A;  4C3H J;  2ZB9 A;  2ZFU A;  4L18 B;  3CDI A;  5LFA A;  3GUD A;  1G3S A;  2VUM J;  4PJ0 C;  3OSG A;  1QNT A;  2O8X A;  3QU3 A;  4M6X A;  4HLY A;  2HTJ A;  3V42 A;  2KRH A;  3KEY A;  3Q0V A;  5CQG A;  1OIS A;  1K6Y A;  2LRD A;  3H9G A;  1MZB A;  3NWS A;  2ADU A;  1SAU A;  5HLG A;  3PJR A;  4FT8 A;  4ZYA A;  4HRI A;  4PGG A;  2E36 A;  4LK1 F;  2IS2 A;  5DUI A;  3K7A J;  2IJL A;  4I99 C;  3OIQ A;  3NAU A;  4EGZ A;  2H27 A;  1IV8 A;  2QQB A;  2VKV A;  4BE2 A;  4D5C A;  3V7S A;  3D5R C;  1XD7 A;  2KIU A;  1MD0 A;  2P8T A;  2ID6 A;  3L2Q A;  5HS9 A;  1O3R A;  4F7Z A;  4RAZ A;  4WXH A;  5IP7 J;  3HRM A;  2M45 A;  2F5E A;  4IHS A;  1S29 A;  2JUC A;  2DYR H;  3DBH B;  3JRA A;  5HBU A;  1AWC A;  4BAY A;  1R5H A;  4XOP A;  5F6F A;  2KMU A;  1X19 A;  1Y1W J;  2D5V A;  5D6F A;  1XX5 A;  1PP7 U;  3PPB A;  2AO9 A;  3CQZ J;  4JL3 A;  5FRN A;  1XS9 A;  4FHT A;  1UHS A;  3WTT C;  2GIZ A;  2LY9 A;  3IUO A;  3CF5 F;  4XKV A;  2RAE A;  3PM1 A;  2WY8 Q;  3KP6 A;  2MLK A;  1J7K A;  1Y1V J;  3ZQ7 A;  2H94 A;  1ZGA A;  3J80 Z;  1U9O A;  5IYD J;  1FIA A;  2X6X A;  4IRV A;  3HHG A;  1LNW A;  1MGT A;  1U0J A;  4C3I J;  1BOA A;  3P9I A;  1IV6 A;  4XQF A;  1FNN A;  5FB2 A;  2QUF A;  2Y9Y A;  2XHK A;  1H9T A;  1RET A;  4HG2 A;  2NVQ J;  3PO3 J;  2XAU A;  3FK7 A;  4BJ6 C;  3FWE A;  4EM2 A;  1J9I A;  1HST A;  5LEJ A;  3H3Z A;  3ISP A;  2QA4 I;  1XGM A;  1V55 H;  1VQ9 I;  5JLW A;  1OCC H;  4D0P A;  4ZH4 F;  3CRJ A;  2VQL A;  2ECC A;  2Q2E B;  2XKP A;  2ZKZ A;  1D0Y A;  1TT0 A;  4M3D A;  2HPI A;  3MWM A;  2WY7 Q;  5FLX K;  1UG2 A;  2D1H A;  2R7S A;  4Q5S F;  3O60 A;  2LKX A;  3HDD A;  5GAG J;  2DOD A;  1WWX A;  4FQG A;  3NQO A;  3TW6 A;  4EM1 A;  2MSY A;  1WI3 A;  2KPM A;  3WGI A;  3MKZ A;  1W0T A;  2QBY A;  1KQ0 A;  2R92 J;  2GQQ A;  2R93 J;  1W36 C;  2QQ8 A;  3KNW A;  5A2Q Z;  2ZNZ A;  3W6V A;  3CCM I;  3EUH A;  2M87 A;  1LE8 A;  3CF2 A;  4HNV A;  4NNJ A;  3RYR A;  2FOK A;  3MCZ A;  4MTD A;  3VVZ A;  4PSW A;  3E5Q A;  1AOY A;  4MFD A;  3V4G A;  3E6M A;  3GTG J;  1RRJ A;  1YIO A;  3RPQ A;  5K7F A;  2I10 A;  1W5S A;  4XL9 A;  2Y75 A;  2QBY B;  3M4O J;  3GTQ J;  1EV7 A;  2LLK A;  3ABL H;  1FTZ A;  3VSL A;  4HLX A;  5LEK A;  2O61 A;  4MIM A;  2MFZ A;  4XK4 A;  2OCE A;  4BY1 J;  2GFN A;  1Z77 A;  3KET A;  1YG2 A;  2MBF A;  3LSJ A;  1A6I A;  2MH9 A;  5M3M J;  1YI2 I;  3TKY A;  5DYM A;  2DU9 A;  2H6B A;  1SMY F;  1P7J A;  2DA4 A;  3OYM A;  1NG7 A;  3FXJ A;  2R7U A;  2NX4 A;  3CCV I;  1B1B A;  1AKH A;  5J8C A;  5TRD A;  3I5U A;  4XOR A;  3CME I;  2W7N A;  3GTM J;  3B73 A;  3UKG A;  5JLX A;  1LVK A;  3DU5 A;  4MXM A;  4RLF A;  1UAA A;  3S3M A;  5HNF A;  1TZL A;  3HOT A;  4MK6 A;  1SC7 A;  1IRZ A;  2BGC A;  2G7H A;  1FC3 A;  5CPR B;  3AKZ A;  1Z3X A;  1BA5 A;  5LGN A;  2O3F A;  2E71 A;  3DTK A;  3K1P A;  2X1D A;  4UV9 A;  1FYK A;  1EH7 A;  2X85 A;  3MKL A;  1MKM A;  5LHI A;  4IHY A;  2WGB A;  2O7T A;  1C0W A;  4UVC A;  5C4J J;  3F21 A;  3HOZ J;  2DFI A;  3KP2 A;  2LBF B;  1DPU A;  3WTS C;  5HOO A;  4KNY A;  3S2H J;  5DS9 A;  3CJR B;  5KVR A;  3FRQ A;  2O6G E;  2VT3 A;  4I09 A;  1UST A;  2XC7 A;  3ECH A;  2L9N A;  3IC7 A;  3V8K A;  2CUF A;  3HZJ A;  3ZN1 A;  1VFC A;  3DF8 A;  5JI6 A;  1O7F A;  2LR8 A;  1X2M A;  3OS2 A;  2DA3 A;  1G4D A;  1FEX A;  3DQV C;  3BLY A;  2EFN A;  4GRI A;  4B4C A;  1VQ8 I;  3LHQ A;  2BHZ A;  2ELK A;  2KIM A;  1P4W A;  5E20 A;  4A12 A;  2PZ9 A;  2VXD A;  1EKE A;  4D1Q A;  4EV0 A;  3LSR A;  1Y0N A;  1X3U A;  2CW8 A;  1Z9C A;  2XB5 A;  3S14 J;  4ANJ A;  5JVT A;  3PQJ A;  5ICG A;  4RB1 A;  5BS6 A;  1W7P D;  5HLI A;  5D4R A;  3K8P C;  4CHU A;  3I0T A;  4RGR A;  3FHN A;  4V19 K;  2F4O B;  3VW1 A;  2IS4 A;  3JAM K;  3F3X A;  1T33 A;  3QWL A;  4HV5 A;  2VI6 A;  1I39 A;  4B8X A;  2HGC A;  1JT0 A;  5CVR A;  1ETY A;  4LMY A;  2KKO A;  3H3U A;  5GTI C;  3LSP A;  3DCF A;  2CQX A;  4OD4 A;  4CZC A;  2DXI A;  4HX4 A;  2ZCN A;  1J75 A;  1NHA A;  3WTW C;  3G7R A;  1DGR M;  1IAW A;  4XLF A;  3CMA I;  2Q2E A;  3HL2 A;  4II3 A;  2ISY A;  1S8N A;  2JA2 A;  3HPH A;  5AIP A;  4HV6 A;  3SHF A;  3J7A O;  1Z7U A;  2G7G A;  1ZRC A;  1RPW A;  3MFK A;  3A4C A;  4JKZ A;  2EQR A;  2DPD A;  2HI3 A;  3C2B A;  3QKX A;  1LKX A;  3CDH A;  2RAS A;  1STZ A;  1U5T A;  3WTZ A;  2OZ6 A;  3OL4 A;  3BP8 A;  3VW2 A;  3JTG A;  2XDN A;  1FBQ A;  2ME0 A;  3I55 I;  2B3W A;  3BC8 A;  5LBQ A;  4PFO A;  2KRF A;  1OCT C;  1ETV A;  4CCL A;  3H5N A;  2WB1 A;  1FPQ A;  3BR1 A;  4X1E A;  2L9V A;  2RQP A;  2Z3Y A;  2K9Q A;  4LJZ F;  4E7S A;  2VC1 A;  4E7L A;  1RC9 A;  2A2F X;  1IZ1 A;  4BYY A;  5FRM A;  2NNN A;  1ZRE A;  3S1Q J;  1I50 J;  4ZDL A;  2KRC A;  3FBI B;  5L3B A;  3VTI A;  1UJ8 A;  3A02 A;  2MA3 A;  4EEF G;  2P4W A;  3TBI A;  1JT6 A;  4JP0 A;  6PAX A;  3QBM A;  1K83 J;  1RUO A;  1BI1 A;  2Y9Z A;  2UZK A;  3VFZ A;  3N05 A;  4LOC A;  1G3W A;  3UNG C;  4EJW A;  5IP9 J;  4DYC A;  4O5V A;  1VQO I;  1KYW A;  1A6Q A;  2CO5 A;  2ZCX A;  1W1W E;  1JJ6 C;  3HIM A;  5DAJ A;  3SFZ A;  4FE4 A;  3M1E A;  1RES A;  3O8H A;  1B4A A;  4ABZ A;  4IOC F;  3J80 K;  1J59 A;  2LG4 A;  2RN7 A;  5JVG F;  4OIQ F;  3H0G J;  4HNU A;  4AIJ A;  2HFH A;  2VBY A;  3GWZ A;  3ON4 A;  2PG4 A;  1H89 C;  2G0E A;  1FOW A;  4BH9 A;  2DPU A;  2R7W A;  2HOE A;  2ZCM A;  2ZJP F;  3GO5 A;  5L3D A;  4YFN F;  4BQA A;  2C6Y A;  2O8K A;  2LBF A;  4EJV A;  1R5G A;  4BJT A;  4DW6 A;  2KT0 A;  1ZGJ A;  2QOP A;  4MFE A;  2QKM B;  1BL0 A;  2VJI A;  1OYY A;  1P9Q C;  2DQR A;  4FX0 A;  3CCR I;  1D8K A;  3CJT B;  2ZXI A;  1YLF A;  2PBI A;  3GZI A;  4FE7 A;  1R1V A;  2HQA A;  3G1M A;  5GPA A;  4NC7 A;  4GCT A;  4YEL A;  1R58 A;  2G3B A;  1TW3 A;  1B59 A;  5FGM A;  1EF4 A;  1EH8 A;  1ZRF A;  4F92 B;  1YRN A;  1R1T A;  2QSH X;  2RNG A;  4A6E A;  1O3S A;  3H5R A;  1XGN A;  1FLI A;  4UDS A;  1I3Q J;  1JE8 A;  2W85 A;  3OYA A;  4XSZ F;  4LG3 A;  4GO1 A;  5IT3 A;  1X1D A;  2JA5 J;  5ICE A;  3CC4 I;  3QAH A;  3P9C A;  3PSF A;  3R0J A;  3HGG A;  1B8I B;  1SFX A;  4XKB A;  3KEQ A;  1MNE A;  4IO9 F;  3K10 A;  1LE8 B;  4WF2 A;  1IUF A;  2E1N A;  3E3V A;  2LH9 A;  2VE8 A;  4I01 A;  2W4S A;  3BCG A;  2TCT A;  2XUB A;  1ZEL A;  2EWN A;  5TJJ A;  3KYD B;  5DM7 F;  4D5F A;  2DDA A;  2IGN A;  3FKI J;  4IHT A;  2RHA A;  2CW0 F;  2HXO A;  3DPU A;  1XDU A;  4KFC A;  1B8I A;  1FOY A;  1UG0 A;  2YVX A;  3NRV A;  2LOO A;  4QPQ A;  4XLN F;  3FMQ A;  4FIS A;  3KP3 A;  2CV1 A;  3WTY C;  1W7P B;  4A3B J;  1Z21 A;  2IPQ X;  4K2E A;  3H1C A;  1OJL A;  3BR5 A;  3BTC A;  1IF1 A;  2BW3 A;  3HG9 A;  4IHV A;  1B6A A;  1KU2 A;  4Q47 A;  4ZTJ A;  3O6B B;  4Y52 J;  5TIS C;  2D45 A;  1RIO H;  1X3Z B;  1JUP A;  2H8W A;  1YIT I;  5E1W A;  1FP1 D;  2O9L A;  4CH7 A;  2DA6 A;  1SFU A;  1V54 H;  3T8R A;  4C2U A;  4U88 A;  2R7F A;  3ZMT A;  3KP5 A;  2YX7 A;  3Q0U A;  3K6G A;  2CMP A;  2Y69 H;  1R49 A;  3OOU A;  3EDP A;  1F36 A;  3SZT A;  2AXL A;  5H9T A;  1FBS A;  1MW7 A;  2ECB A;  4CXF A;  4YEJ A;  1N25 A;  1VQP I;  2JA6 J;  1HW1 A;  2ZME B;  1BC7 C;  2EIK H;  2L7M P;  3FDY A;  5IOZ A;  1TQI A;  3F9K A;  1KA8 A;  2KZV A;  4DBR A;  3CMM A;  1OCR H;  5DCF A;  2P7V B;  1QQI A;  3RPU D;  4WCG A;  1FYL A;  1JHF A;  1FZP B;  3PIO F;  2MG4 A;  2QCO A;  2Z5U A;  2FU4 A;  4W97 A;  2R4G A;  1VQK I;  2OC6 A;  3PUF A;  2FF4 A;  4KWA A;  3VB2 A;  3HOY J;  1BIA A;  4NHJ A;  2PEX A;  2UXN A;  4BBR J;  4E7Z A;  2GEN A;  4I6Z A;  1XN7 A;  1ZGW A;  4HF2 A;  3I54 A;  3GTO J;  3CJD A;  4AC6 A;  1I27 A;  4YFX F;  3LMM A;  3KZY A;  1MBJ A;  1JUM A;  2UWM A;  2VJ5 A;  1N77 A;  4G7Z F;  2HKX A;  4XLP F;  4KN4 X;  4CA0 A;  1GT0 C;  2F2E A;  2UXO A;  5JFR A;  4RGX A;  2V4J C;  2ZJR F;  5IT9 K;  3OYG A;  5FKN A;  2HVQ A;  2KP6 A;  3V8J A;  3NAR A;  1HKT A;  1YTY A;  4A93 J;  3F0C A;  1D0X A;  1QGP A;  2VJ4 A;  2V6E A;  2CUJ A;  2KLO A;  3FMR A;  3CMY A;  2RGV A;  4ZTF A;  1GHC A;  4ENK A;  2W53 A;  3FM5 A;  3FMS A;  2ME6 A;  2LD5 A;  3JRF A;  5BOX A;  2E1M C;  4R79 A;  2MC3 A;  2MGQ A;  3HRS A;  2NOJ B;  5DV5 A;  4HDV A;  2O7O A;  2HQR A;  2DMP A;  5AON A;  3K9T A;  2P5L C;  4E7H A;  3W3C A;  4KIS A;  2GXG A;  2MYS A;  3JSO A;  2QWT A;  1LFU P;  2FJI 1;  4E7K A;  5D1R A;  5BQT A;  1WFX A;  4L9T A;  3G1L A;  3GTJ J;  1TWH J;  1O7L A;  2L3D A;  2DQL A;  1R7J A;  2M3A A;  2ZXH A;  2HWV A;  3BG5 A;  2V9V A;  4BQO A;  1WJ5 A;  1QPI A;  5ICF A;  3SJM A;  1IXR C;  1LEB A;  1GV2 A;  2TRT A;  2IAI A;  2Y31 A;  1LPQ A;  2PLY A;  3A1Y A;  3C7J A;  4E7I A;  4ACI A;  2FEZ A;  2EIM H;  2JA8 J;  2HYJ A;  2XPW A;  1JI8 A;  3O3K A;  2IGM A;  1OLT A;  2VOD A;  1WQ2 A;  3FIW A;  3LFK A;  5FD6 A;  1SVL A;  5FLM J;  2GZW A;  2E7X A;  2IS1 A;  1UI5 A;  1BJA A;  5CXI A;  3H35 A;  4BXX J;  5JR3 A;  5KAF C;  2CUZ A;  4LK0 F;  3P5J A;  4XN0 A;  5F04 A;  2PFB A;  2F5D A;  3E6B A;  4HX7 A;  3GTL J;  3ZQG A;  1BN5 A;  1DPR A;  3S1R J;  5ILU A;  4DQ2 A;  2IGO A;  4P96 A;  1QZE A;  4CCM A;  4V2F A;  1XMA A;  2TDX A;  5KK1 A;  2DLL A;  2XRO A;  4IJA A;  4BE1 A;  1RUN A;  3ECO A;  1G6N A;  2BHY A;  1G3T A;  4Y15 A;  3MZ8 A;  5FHP A;  2HVR A;  1RNL A;  3BOQ A;  3R0A A;  1OCO H;  4RMN A;  5B1A H;  3LA3 A;  3QOE A;  3ZRG A;  2DI3 A;  2R7R A;  5DD8 A;  1YJN I;  4LIV A;  1WJA A;  3J7A Y;  1SD6 A;  3CDL A;  1OQY A;  4C2M J;  3MKY B;  4M72 A;  2HDW A;  2WAQ A;  3BR3 A;  2X48 A;  2XF5 A;  3TOB A;  4LG0 A;  2FBQ A;  1ZAR A;  1JKR C;  3ZCO A;  3I64 A;  3GZ5 A;  4GCV A;  2Q0O A;  3J81 K;  3HOW J;  3GW2 A;  5KCM A;  5K7H A;  2V7F A;  5J8F A;  4MEX F;  1QA6 A;  2O03 A;  1G8X A;  2ZME A;  1X3W B;  4M6Y A;  4KUM A;  4C3J J;  3SQN A;  3PFY A;  2ELJ A;  1W5T A;  2MD0 A;  2V9P A;  5KNL A;  2EZL A;  2VQC A;  1FIP A;  5F27 A;  1VQL I;  1OR7 C;  2VT2 A;  2X9D A;  2LSO A;  4KN7 X;  5CVV A;  1ZG5 A;  1NTC A;  4PJL A;  2K9L A;  3C2H A;  4CYC A;  4OMY A;  2ZY9 A;  5GP9 A;  1SD7 A;  2BY2 A;  3CCS I;  3HSF A;  4N9H A;  3S1M J;  3GFI A;  5AQC A;  1HXD A;  3QYE A;  2HOS A;  3L2C A;  1I1G A;  3W2W A;  1LDK B;  3WG9 A;  1V5E A;  3R61 A;  3HKZ A;  2EH3 A;  1JHH A;  3ONQ A;  5DDG A;  3M1C A;  1TW2 A;  2DFE A;  4X6A J;  1K79 A;  2A07 F;  1JUS A;  3DBR B;  3Q3S A;  3S1N J;  2EIL H;  3C3W A;  5J1U A;  2NS0 A;  2E2I J;  5E18 F;  3S2D J;  4BQN A;  2QKO A;  5ILS A;  3CCY A;  3LQQ A;  1RZ4 A;  3K4C A;  4A5M A;  1JKQ C;  1U8R A;  1YW7 A;  2OTL I;  3IL2 A;  2E1O A;  2GAU A;  3OYB A;  4ME9 A;  1AA7 A;  3I9V 2;  2FMY A;  2CRG A;  4HEA 2;  4PZJ A;  3HTI A;  1PJR A;  4UY8 I;  3VOX A;  2CW7 A;  2CQN A;  4AID A;  4G6Q A;  2QZ8 A;  3VSK A;  2H6C A;  4KMU X;  1XCB A;  4M9Z A;  2HQN A;  2HDC A;  2FA5 A;  3ANP A;  3VVY A;  3VWB A;  2R7X A;  2KIF A;  4OU0 A;  3I3L A;  5CVI A;  3TL4 X;  3F8F A;  2NS8 A;  2VJJ A;  4LLG F;  2NNY A;  2R7O A;  2R7D A;  2UV1 A;  3A03 A;  3IH3 A;  3IRQ A;  3WU0 A;  3R60 A;  1O4X A;  1TT5 B;  2HTS A;  5F0C A;  1A5J A;  2DMU A;  1W7P A;  3QP6 A;  2IA1 A;  1I6H J;  2DN0 A;  1UZC A;  3BTJ A;  3X2Q H;  1VF9 A;  1U5T C;  2CU7 A;  2PMZ N;  2ICW G;  4N0B A;  2HVS A;  2JMW A;  1SFK A;  4RLQ A;  4HQE A;  3ZP5 A;  2STT A;  4G6T B;  1D0Z A;  2CS3 A;  2NXN B;  2YUS A;  3QP5 A;  5EJC A;  2A5Y B;  3OMY A;  3OYI A;  2NVT J;  3F72 A;  1P2F A;  4LIU A;  1KON A;  4EAT A;  2ACJ A;  3OS0 A;  5LRR A;  2FRH A;  3BHQ A;  2OPT A;  1YJW I;  2HZD A;  2LC2 A;  1KU9 A;  1U3E M;  3OYF A;  2KDZ A;  2YVE A;  1GXP A;  1BR4 A;  3EQL F;  4WXD A;  4OAZ A;  2YVH A;  2W25 A;  4P9F A;  1I1S A;  1PVE A;  3ROU A;  2VBZ A;  2MH2 A;  1B9N A;  4UVA A;  4XM3 A;  5D6E A;  4UB8 C;  4UV8 A;  3N97 A;  3OYK A;  2OA4 A;  1D1B A;  3AQS A;  4M3B A;  1HC8 A;  1TWG J;  3ZMD A;  1MSF C;  3V6G A;  2NRA C;  2IGK A;  5DTD A;  1L3L A;  2QWW A;  5HDN A;  4DZP A;  4UUV A;  1XGS A;  2CYY A;  1EJ9 A;  2GXA A;  3IWZ A;  2QTQ A;  3WG7 H;  5LGT A;  4PJM A;  4UNO A;  3VIB A;  4HNT A;  4ZYH A;  4LFU A;  3I53 A;  4GDF A;  3E5X A;  1G3Y A;  1ZLK A;  1IC8 A;  2XRL A;  3OV8 A;  4DYQ A;  2A69 F;  3BZC A;  3HTH A;  2Y30 A;  2NS7 A;  2Z9O A;  2XAH A;  2PMU A;  3LSH A;  4XRM A;  5BMZ A;  5FKO A;  3S3N A;  2I5U A;  4MQ9 F;  2RVC A;  2QGU A;  3LL7 A;  4ZJZ A;  2CJJ A;  1ERD A;  1QPM A;  2XV4 S;  4YZE A;  2JTV A;  1FSE A;  4YFK F;  2LKP A;  2BEO A;  3EYI A;  5HSZ A;  4IRI A;  1TNT A;  4D9J A;  3P9T A;  1IRX A;  2EZI A;  3F8M A;  5HOD A;  2Y0M A;  1N78 A;  4IKF A;  1KQ9 A;  4AIK A;  4ZYG A;  1W36 D;  2YU9 J;  4FCY A;  3E0J B;  4MNU A;  1E3H A;  4L62 A;  4CYC B;  2R7Q A;  2UXI A;  1FMW A;  5E1Z B;  4BDY A;  3VP5 A;  1OCZ H;  3ABK H;  4V2G A;  4JX6 A;  3VOK A;  2W1O A;  2IXS A;  2VAS A;  2HXI A;  2J5O A;  4UHT A;  3OOP A;  4RB2 C;  3CES A;  1H9G A;  4BAC A;  2QQA A;  4I2O A;  3V7R A;  1SD4 A;  2PN6 A;  3BDD A;  3DFG A;  3F8B A;  4KT6 A;  4CDG A;  5J40 A;  3RKQ A;  3WTU C;  2H8R A;  1G59 A;  2A05 A;  2EFW A;  4HSR A;  1UI6 A;  1H0M A;  1XMX A;  3M7G A;  4PCQ A;  5GAD J;  2JWT A;  1LB2 A;  3I4M J;  1S3J A;  1A35 A;  2IA2 A;  1SEU A;  2K86 A;  3HBL A;  5BPI A;  3T0Y A;  3SFI A;  1SFE A;  3SEQ A;  2CV0 A;  1XPX A;  1OR7 A;  2ZSH B;  5H2F C;  3CCQ I;  2FUG 2;  1YRN B;  1T0F A;  3HE0 A;  1GV5 A;  4JX5 A;  3OYC A;  5M5Y J;  1BI2 A;  2ESH A;  3IRR A;  2Q1Z B;  5IT9 Z;  1YO5 C;  4M6V A;  4I0B A;  5M5W J;  1IN4 A;  2NYX A;  2O5R A;  3W2V A;  5GPC A;  2STW A;  2K3F A;  1ITY A;  1YOV B;  2XIG A;  1R9T J;  1ZAO A;  2QM3 A;  2F07 A;  4HA8 A;  4A5N A;  3TOA A;  4BHB A;  2WAD A;  1UEL B;  2XGC A;  1D5Y A;  4P55 A;  3BTL A;  1WGX A;  3S3O A;  4DJA A;  2A68 F;  2DOE A;  3HB9 A;  2M7B A;  1VQ4 I;  5CYV A;  2DTZ A;  3KKD A;  3RJP A;  3M07 A;  1EA3 A;  3JTH A;  2EB7 A;  1Y56 A;  3GFL A;  2CSO A;  2GBY A;  1X2N A;  3VOE A;  3L7W A;  3I4N J;  2BZT A;  5HDK A;  1Q1H A;  1F43 A;  4GCK A;  1J5Y A;  1TQP A;  4QLC U;  5D8K B;  1I6X A;  5J4Y A;  2BW3 B;  4EJU A;  1X1A A;  5GAH J;  4EGY A;  1IJW C;  3RSN A;  3LSI A;  2XAG A;  3DKX A;  3GFM A;  5BNG A;  3S5R A;  2L01 A;  1YE9 A;  3GLX A;  3DLL F;  2ZXW H;  4PUS A;  3GTP J;  1WZ2 A;  2M2E A;  3M8J A;  1JKO C;  1ZYR F;  3LSG A;  3F23 A;  1NK3 P;  2FE3 A;  3T5X A;  3OYL A;  2JUG A;  2B7E A;  2R7Z J;  2GM4 A;  4B3X A;  3VEP A;  2QIB A;  2DJI A;  5K5R A;  3FXQ A;  1ETK A;  1PYV A;  3BT9 A;  3E7Q A;  4KDP A;  2B0L A;  4U0Y A;  2DTR A;  3VUQ A;  3H5A A;  4RAY A;  1KZH A;  4XNF A;  2D6Y A;  1X4P A;  3B02 A;  2HS5 A;  3IHU A;  2WB1 N;  4BEH B;  1IG7 A;  4YIF A;  2A3S A;  1BI3 A;  1J09 A;  4KT5 C;  5K5Q A;  2FBK A;  4AD9 A;  2DT6 A;  4ZYD A;  3HXL A;  3NS4 A;  4RBO A;  3IAS 2;  3TP0 A;  2JRM A;  3JW4 A;  4HQM A;  1A31 A;  3R6S A;  2GIV A;  2ZSI B;  3BJO A;  3MMY B;  2ZBK A;  3K70 D;  1JTX A;  2FNP A;  3CC7 I;  2RV8 A;  4BDZ A;  1XDS A;  2X51 A;  1XMK A;  3KX2 A;  2X6W A;  4BY7 J;  1HBX G;  2BXZ A;  3VYR B;  4ESB A;  3RDI A;  2LK2 A;  2W57 A;  1B9M A;  1BI0 A;  3MD2 A;  4A0X A;  4B3A A;  3GZN B;  2RNJ A;  2YU3 A;  5A2Q K;  4N4N B;  1D5V A;  1YX5 A;  1DU0 A;  2WUI A;  5CXG A;  4XLH A;  2F4M B;  3WOD F;  2F5V A;  3QU6 A;  4CCN A;  4S05 A;  2ISZ A;  4JYK A;  2XAF A;  3G73 A;  1R6R A;  5L3G A;  4NC8 A;  4OOI A;  1BIB A;  2M1B A;  4RDU A;  2EA2 A;  4QWQ A;  1MMN A;  4CZZ A;  3ZQL A;  2Z33 A;  1U6G A;  1K4T A;  3BR0 A;  2XRN A;  2GA2 A;  3TDU C;  1DDN A;  4OIR F;  3JAM Z;  3REO A;  2XSD C;  1T6S A;  4OD5 A;  5GTH C;  3R4K A;  1PP8 F;  3RYP A;  1OYW A;  4IQ4 A;  3LOC A;  3BZ6 A;  4XRS G;  5IOY A;  3TGN A;  2P0W A;  3JRH A;  2DOA A;  2VQH A;  3M8E A;  1XC5 A;  4J19 A;  3AG4 H;  2HZT A;  3ERE D;  2HKO A;  5EEG A;  2GUH A;  2KHM A;  3IAM 2;  3NPI A;  2HOT A;  2QLZ A;  2IVM A;  1YW8 A;  1ZK8 A;  2EBI A;  4AVZ A;  3PIP F;  4BHP A;  2M0C A;  2BXY A;  2PBX A;  3I59 B;  3NRG A;  1FT9 A;  3JSP A;  2CFX A;  4HX8 A;  3OIP A;  1YIJ I;  2OUM A;  2BVM A;  3P7N A;  3B6A A;  3QPH A;  3CUO A;  4O3M A;  2XDV A;  4GYG A;  5FKK A;  1Y8R B;  1NH3 A;  1JJ8 C;  1YFH A;  4JX4 A;  3UR3 C;  4B47 A;  2JPC A;  3GZ6 A;  5J4V A;  4UUS A;  3RZD J;  1FBU A;  2VIX A;  1LJ9 A;  3FKJ A;  3KE2 A;  4L5I A;  3DU6 A;  3DKW A;  3TO7 A;  1LDJ A;  1UCR A;  2BOL A;  5E8I A;  4IOA F;  1OMI A;  2DMQ A;  1R71 A;  2E35 A;  1K7A A;  2R3S A;  2XF6 A;  3CZ6 A;  1R5I D;  3PUB A;  4HF1 A;  3RD3 A;  3DEU A;  3E5U A;  3G4S I;  3IV5 A;  3E6C C;  1Q1V A;  2XPV A;  2UUZ A;  2OF7 A;  4FTH A;  4AM3 A;  4LG0 B;  4L5E A;  5E3N A;  2G7U A;  4E70 A;  1XB4 A;  2VB6 A;  4IQJ A;  1N75 A;  2BVL A;  4PXI A;  2H09 A;  2JN6 A;  1MMG A;  3K1M A;  4M9S A;  4NQW A;  3AQT A;  4A3L J;  2DOF A;  1ON1 A;  1QHG A;  2W48 A;  4XLC A;  1MBK A;  3FX3 A;  3RQI A;  4QIW N;  3KYC B;  5E3L A;  3HHH A;  3A2K A;  5M5X J;  1XSD A;  5CJ9 A;  3MZH A;  5E79 C;  3IKT A;  2VBW A;  3G56 A;  1J2X A;  2K3P A;  3KYL A;  4Z6Y A;  4FAS D;  5KHD A;  3CCL I;  1BJZ A;  1P6R A;  4ZYE A;  1L0O C;  3K4K A;  5B3S H;  1JKP C;  2PFV A;  4QTR A;  1ONV A;  2IBD A;  4DGW B;  4HYE A;  4XBF A;  2K4J A;  2XAQ A;  3HPG A;  2QF7 A;  4EQQ A;  4XRS A;  3TMO A;  5J1Y A;  2Y2Z A;  1WH7 A;  4HST A;  4S0H B;  1FY7 A;  3HTS B;  4WXC A;  1AU7 A;  4M3F A;  5HAW A;  5D8L B;  3DTE A;  3G71 I;  2VBX A;  4W1U A;  3K4B A;  3RKY A;  4OAY A;  4ON0 A;  3EYY A;  1RI7 A;  1XSX A;  1E0E A;  5H6Q A;  3ABT A;  3ZPL A;  3K2Z A;  2DAO A;  4GFB A;  4ESF A;  3I56 I;  3K4M A;  2V79 A;  1DP7 P;  3HOS A;  2IP2 A;  2QKL B;  5JHF A;  1MJB A;  3GBG A;  2AQF A;  1DGW Y;  3K2A A;  5FKL A;  4E4H A;  3BR2 A;  3SZG A;  4DIQ A;  5B5E C;  4R1H A;  3M9A A;  1X58 A;  2BV6 A;  4KIB A;  4JNN A;  1ZHF A;  3Q9S A;  2DK8 A;  3B6C A;  1IGN A;  2P6S A;  3WTV C;  4ESJ A;  4U9N A;  1A36 A;  2Y0S N;  3KIO A;  4IXA A;  1JTY A;  3RIR A;  3JRD A;  1Z6T A;  2LTP A;  3DPT A;  2I8D A;  3TQN A;  2NP3 A;  2K9M A;  2WV0 A;  1HKS A;  3BJA A;  3H9J A;  2FXA A;  2RC4 A;  2YPR A;  4KIF A;  5EG0 A;  5HDG A;  2ZME C;  2DFH A;  1E17 A;  4ITV A;  2CH0 A;  1R4N B;  3RI4 A;  5DCM A;  1K61 A;  3B81 A;  1WPK A;  5J3L A;  2F6C A;  4LIT A;  1R00 A;  1NK2 P;  1ZG1 A;  3ANG A;  5IP6 A;  2OCC H;  3ZXS A;  4X0G A;  1QRY A;  2JZY A;  2VPL A;  4IHX A;  2COB A;  1WH5 A;  3BTI A;  3S15 J;  1E3P A;  2EK5 A;  5LD2 C;  3LQR A;  1F5T A;  3H9Q A;  2PQ8 A;  3ULQ B;  2EPF A;  3I59 A;  5F1R A;  2F48 A;  3OWT A;  2L7F P;  5FRO A;  1HDD C;  2F5C A;  1S6L A;  2N8G A;  1O57 A;  5LHG A;  2P5K A;  1MDM A;  3FXM A;  2X1E A;  5FFX A;  2HDD A;  4Z2Y A;  1QVT A;  1DP3 A;  1ZKG A;  3E1S A;  3K0L A;  3E97 A;  5LRS A;  3CLO A;  1Y8Q B;  4G6D A;  5FO5 A;  4HOB A;  4L9V A;  3IH4 A;  4JOM A;  3OR2 C;  3HKZ N;  3BRU A;  2FNA A;  1HCR A;  2A61 A;  3ASO H;  4BL0 B;  2HEO A;  4C2T A;  2ZCW A;  1H88 C;  1Y39 A;  3IUV A;  1ZQ3 P;  2QSF X;  5JHU A;  3HYI A;  3CP2 A;  3CUQ A;  1FTT A;  3H92 A;  1MDM B;  4L5J A;  5H6R A;  2FJ1 A;  3OY9 A;  1VQM I;  3PNY A;  4CGZ A;  2ZNY A;  4ICH A;  1GVJ A;  1ZR4 A;  3IKV A;  3ZMU A;  4GFK A;  1GDT A;  1BOB A;  1TNS A;  5J1R A;  1SAX A;  2V1X A;  3ZQQ A;  4GYI A;  3QPS A;  1T2K A;  1MJ9 A;  2KQR A;  4LD5 A;  1HW2 A;  4XLE A;  3EET A;  1ACI A;  1WJF A;  1S7E A;  5B66 C;  3PNV A;  2K02 A;  2JPB A;  4ENJ A;  3BG6 A;  3QRF F;  3CUQ B;  4C2M A;  1KU3 A;  2JVG A;  4C9Y A;  5GAE J;  3CD6 I;  4IF4 A;  2CUE A;  3OYN A;  3I4P A;  4NQW B;  1WSU A;  2ELH A;  4A3I J;  5CKT A;  2K5C A;  1MBG A;  1ODD A;  1YW9 A;  1XGO A;  1M1E B;  1IUY A;  4B09 A;  3CC2 I;  2R5Y B;  2FSW A;  3O2P E;  5EYR A;  1BC8 C;  4AYB N;  4BKX A;  4I02 A;  1QZY A;  1TC3 C;  2B63 J;  3VPR A;  3H0D A;  3FBN B;  3BG9 A;  3K69 A;  1BM9 A;  3AFH A;  5CW8 A;  4DZJ A;  3KKC A;  2CQK A;  2E5N A;  2FQ4 A;  3I58 A;  4RB0 A;  2BYV E;  2DG7 A;  3HSE A;  2G9W A;  5LGU A;  3D5L A;  2R5Y A;  2V6C A;  5D5W B;  5FMP A;  1J0R A;  2UXX A;  3CUQ C;  3K4N A;  4BUP A;  2COM A;  1X1P A;  3QYF A;  1EH6 A;  2DFF A;  1I3A A;  3E6D A;  3CO7 C;  1VZ0 A;  3HJE A;  4B1R A;  1YYV A;  1RKT A;  2E7W A;  2QEX I;  5DUK A;  2UXH A;  4A0Z A;  4B48 A;  2GOX B;  2NOG A;  1MBF A;  4II2 A;  2NVU B;  3GEZ A;  3F8C A;  2WWY A;  4EJO A;  1IN6 A;  4F55 A;  2MLG A;  3N4M A;  5EF6 A;  2EFP A;  2XAJ A;  4MQV A;  2LY1 A;  1O3T A;  3RKW A;  2BY0 A;  3SEZ A;  1QU3 A;  2XPU A;  2XSJ C;  2G7L A;  2VPR A;  2W84 A;  3JRB A;  3OS1 A;  2YX4 A;  4PK4 A;  3GCM A;  2DCE A;  5KAI C;  1ETX A;  3EGQ A;  4IRH A;  3HTJ A;  4U7D A;  4ENN A;  3ON2 A;  4L9N A;  1HF0 A;  2LDU A;  3LFU A;  4I7H A;  3V7C A;  4M71 A;  1IRG A;  2XKO A;  1SMT A;  4A3C J;  3JR9 A;  3BCB A;  4UXN A;  4GCL A;  2OER A;  2HYG D;  1QHH D;  2CV2 A;  3DP7 A;  4CYD A;  3VDX A;  1Z91 A;  5E17 F;  2WAF A;  3DEW A;  1P92 A;  3DPJ A;  1IXC A;  3PAS A;  4AC0 A;  2FX0 A;  1S7A A;  5EZG A;  3U1K A;  3KLN A;  4U7B A;  5M3F J;  4U9L A;  5FFZ A;  4EJT A;  2VLA A;  1QO0 D;  3CLQ A;  4Y33 A;  1OPC A;  4G94 A;  1K6O A;  4RGU A;  5IYC J;  2M8G X;  4CSW A;  3QOP A;  3FXK A;  4RM2 A;  1UB9 A;  3RTR A;  1Z1D A;  3GX4 X;  3GYH X;  4CCJ A;  3AG3 H;  2REK A;  1LFB A;  2YSR A;  1JXS A;  3L1P A;  3GME A;  2LP0 A;  1CQT A;  3HIF A;  2HYT A;  2XAS A;  1FJL A;  3LJL A;  1HDP A;  2JSP A;  3AL0 C;  4KIC A;  1S9H A;  2EA4 A;  3L09 A;  4RAG A;  2V26 A;  2P5V A;  3ELK A;  4HBL A;  4E7J A;  2FOW A;  2XF7 A;  3BQZ A;  4KIT B;  2OU2 A;  3J81 Z;  4LLN A;  2M4G A;  5EEH A;  2X0L A;  4MHG A;  4A3G J;  2ZFW A;  3BJ6 A;  2GWR A;  2JSC A;  3KLO A;  1V3F A;  2BY3 A;  4IHW A;  1WVR A;  3OR1 C;  2VKD A;  3WU2 C;  2W24 A;  3D1N I;  1BW6 A;  2V1U A;  3BQY A;  2D1V A;  2ZOZ A;  3JRC A;  2CGP A;  1P7I A;  4LGW A;  4A6D A;  4WIB A;  4A3M J;  4IRG A;  3S93 A;  2LRE A;  1YS6 A;  3OYH A;  1WRJ A;  2NP5 A;  4BEH A;  1V5G A;  4IEJ A;  3GLL A;  2F5F A;  4U0V A;  2DMN A;  1QZZ A;  3BR6 A;  1MMD A;  2BBY A;  3MN2 A;  5HVQ C;  1FX7 A;  5H20 A;  3WHB A;  2A6E F;  2DMT A;  4DNC A;  2V1N A;  3J7Z I;  3LSM A;  3F6O A;  2ID3 A;  3S2W A;  5D5V B;  2VXZ A;  3O8G A;  5F64 A;  3HTA A;  4QSH A;  3KCC A;  2X6O A;  4D7M A;  4Q4Z F;  2ZJ2 A;  1V4R A;  3DV8 A;  5C44 J;  5DM6 F;  1T38 A;  5CVJ A;  4KA4 A;  1I5Z A;  3ABU A;  1Z6R A;  3L9F A;  2MD5 A;  3S32 A;  3ESW B;  2MC4 A;  4BQQ A;  2DJN A;  4XSX F;  3ZMV A;  2LY2 A;  3EPZ A;  4RGS A;  1GVD A;  2GA1 A;  2DK5 A;  3GXO A;  1W0U A;  4XRF A;  2DDB A;  2CWE A;  3HEF A;  3FZV A;  3A01 B;  3NI7 A;  2KIS A;  3JRI A;  1OYI A;  2JK3 A;  1HSJ A;  4E6K G;  1KU7 A;  3U9G A;  3T1B A;  2P7C B;  2L02 A;  1JGG A;  2YR2 A;  2L5Q A;  2M4K A;  2L0K A;  4L0Z B;  1HKQ A;  5DCM B;  1K78 A;  2UXU A;  2HR3 A;  3DXJ F;  4F91 B;  3CTA A;  3FM3 A;  3KP4 A;  3MVP A;  1WJE A;  3QQA A;  2OZU A;  3WE2 A;  3KZZ A;  3A01 A;  2FBH A;  3L00 A;  4Y4R A;  1P4X A;  3F8N A;  4BNC A;  3K4J A;  3G1O A;  1U78 A;  2PJR A;  4ENM A;  4RM3 A;  2P81 A;  1UHW A;  5F0F A;  2E2J J;  1K78 B;  4CCO A;  4JK1 X;  4XMY A;  3RH2 A;  3ZQI A;  3VYU B;  5IY5 H;  4WK8 F;  4RA2 A;  3BY6 A;  1MH4 A;  4XKC A;  1IXS B;  4DYR A;  1IN5 A;  4G7H F;  3D0S A;  2HOA A;  4PDK A;  5HS7 A;  2RRE A;  2HPM A;  1VQ6 I;  2PJR B;  3OIO A;  2EV0 A;  1YJ9 I;  2E1M B;  1CGP A;  4A0Y A;  2H1L A;  5FLX Z;  4GXO A;  3F1B A;  3TO9 A;  3HUG B;  4ZDO A;  4M3E A;  5EZH A;  4RAF A;  2DG8 A;  1IDY A;  1T98 A;  3PFI A;  4BS9 A;  5E1X A;  1MNM C;  3HRU A;  1D1C A;  2KZG A;  2OQG A;  3CP8 A;  4J00 A;  4PSX A;  3EUA A;  2OQR A;  5LHH A;  3ZQH A;  4UUS B;  3F22 A;  4L0Y B;  2JVH A;  4P9U A;  2V57 A;  1VND A;  4NN1 A;  4NEL A;  4DVY P;  3S16 J;  3HUG A;  3MKW B;  4FET A;  2AQE A;  3M3Y J;  2NVX J;  3V8L A;  1IDZ A;  3M8F A;  2RDP A;  1OKR A;  5F1J A;  3L2U A;  2D2W A;  4AVP A;  3L2V A;  1S72 I;  3QPT A;  2WBM A;  1ZRD A;  1HW5 A;  4BXF A;  2X6Y A;  1GLN A;  4AIH A;  1LEA A;  4XID A;  1JGS A;  4XIC A;  2FQ3 A;  3OYE A;  2KFD A;  2W00 A;  4C30 A;  3DKY A;  1NG6 A;  1DQU A;  3ML6 A;  3G6E I;  1DUX C;  1SD5 A;  1YS7 A;  2L7Z A;  3TED A;  3OSF A;  5DD4 A;  4XON A;  2GXB A;  1VQ7 I;  1MMA A;  4CCK A;  2FML A;  5AIQ A;  3AAF A;  1POG A;  1QBJ A;  3LNQ A;  3KP7 A;  2WAE A;  2JT1 A;  4B44 A;  5J6X A;  4HDU A;  5BPD A;  3DWL E;  1HQC A;  2UXP A;  3NNR A;  4HAM A;  1FSH A;  1R23 A;  5K1Y A;  4AWX B;  2G7S A;  1Z7L A;  2XGD A;  2GOM A;  2R0Q C;  4GGG A;  3SZP A;  3RKX A;  5FJ8 J;  3Q5F A;  2CFO A;  4CIC A;  2A5W A;  1LVA A;  3DBL B;  3KPH A;  4EVI A;  1DU6 A;  2MAB A;  1F9N A;  2ZOY A;  3CCE I;  3HM5 A;  2IS6 A;  2F4I A;  1WCM J;  3LAP A;  2DW4 A;  2WTE A;  4HKU A;  2PX9 A;  1SGM A;  3S8P A; 
#chains in the Genus database with same CATH homology
 2R93 J;  3EUP A;  3CDL A;  4C2M J;  3KNW A;  3W6V A;  3BR3 A;  2FBQ A;  2X48 A;  1BJZ A;  5E3M A;  2M9H A;  1LE8 A;  4HNV A;  1JKP C;  4QTR A;  1JKR C;  2IBD A;  1B72 A;  1HOM A;  3HOW J;  3VVZ A;  5K7H A;  3KZ9 A;  4MFD A;  3HOU J;  2QF7 A;  3GTG J;  5K7F A;  2I10 A;  4XRS A;  5J1Y A;  2Y2Z A;  1WH7 A;  4S0H B;  4C3J J;  1MBH A;  3M4O J;  3GTQ J;  2LLK A;  2EZL A;  1FTZ A;  1AU7 A;  4M3F A;  1FIP A;  5HAW A;  5F27 A;  4MIM A;  4XK4 A;  4W1U A;  2WV1 A;  2X9D A;  4BY1 J;  3E7L A;  1Z77 A;  2GFN A;  3LSJ A;  2K40 A;  1A6I A;  1NTC A;  5M3M J;  4CYC A;  5GP9 A;  2M34 A;  3T6N A;  4GFB A;  5D18 A;  1P7J A;  2DA4 A;  5AQC A;  4D7N A;  3S1M J;  2HOS A;  2NX4 A;  1AKH A;  1AHD P;  3GTM J;  2EH3 A;  3UKG A;  3HGY A;  5JLX A;  5EG0 B;  3GBG A;  1MSE C;  4MXM A;  3K2A A;  1SAN A;  4X6A J;  5FKL A;  1JUS A;  3BR2 A;  4MK6 A;  5IYB J;  1IRZ A;  3Q3S A;  3S1N J;  1X58 A;  3NXC A;  4JNN A;  5J1U A;  2E2I J;  1PUF B;  3B6C A;  3S2D J;  1IGN A;  1BA5 A;  2QKO A;  2Y0S N;  3CCY A;  1JKQ C;  1JTY A;  3JRD A;  3MKL A;  4A69 C;  2LTP A;  2E1O A;  2YS9 A;  5C4Y A;  4ME9 A;  4IHY A;  2NP3 A;  2WGB A;  2L9R A;  1BW5 A;  2O7T A;  5EDN A;  4UUT A;  2CRG A;  3ZQC A;  4GFL A;  3HTI A;  5C4J J;  3HOZ J;  3BNI A;  5EG0 A;  3VOX A;  3TW7 A;  1E3O C;  1MH3 A;  3HOX J;  3S2H J;  5DS9 A;  2NVY J;  1H8A C;  3FRQ A;  1K61 A;  3B81 A;  1WPK A;  5J3L A;  3ANP A;  3VVY A;  1NK2 P;  3ANG A;  2FD5 A;  5IP6 A;  1T56 A;  3ZOB A;  1QRY A;  4IHX A;  2CUF A;  2COB A;  1WH5 A;  1VFC A;  3BTI A;  2JA7 J;  3S15 J;  2LR8 A;  1X2M A;  2NS8 A;  2DA3 A;  4A3F J;  5D19 A;  3A03 A;  1FEX A;  3IH3 A;  1O4X A;  1HLV A;  5F0C A;  1A5J A;  2DMU A;  2L7F P;  1I6H J;  2DN0 A;  4B4C A;  3BTJ A;  1HDD C;  3LHQ A;  4MLO A;  3GEU A;  2N8G A;  1VF9 A;  2ELK A;  5F0H A;  2PMZ N;  2CU7 A;  4G12 A;  2HDD A;  2JMW A;  1QVT A;  3GTK J;  1ZKG A;  2PZ9 A;  3TP3 A;  3FIS A;  3LSR A;  2YUS A;  2XB5 A;  3S14 J;  2NVT J;  3IH4 A;  1SFO J;  1U9N A;  2GLO A;  3HKZ N;  4A3D J;  3BRU A;  1HCR A;  3IUV A;  1H88 C;  3VW1 A;  1ZQ3 P;  3QPL A;  3ZQF A;  1FTT A;  1T33 A;  2VI6 A;  2R7Z J;  3BHQ A;  2FJ1 A;  2OPT A;  4ICH A;  1JT0 A;  2XGE A;  2KDZ A;  3WHC A;  2YVE A;  3PO2 J;  1ZR4 A;  1ETY A;  4GFK A;  1GDT A;  5J1R A;  1TWF J;  3LSP A;  2YVH A;  3DCF A;  2CQX A;  3QPS A;  1ZTR A;  4AF5 A;  1S7E A;  3JRG A;  2ZCN A;  3G7R A;  3AQS A;  4M3B A;  1TWG J;  1MSF C;  3V6G A;  1ETQ A;  2DA2 A;  5DTD A;  2CUE A;  4A3I J;  4DZP A;  1MBG A;  2G7G A;  2DA5 A;  1RPW A;  2VKE A;  2R5Y B;  2QTQ A;  4JKZ A;  2EQR A;  5EYR A;  2HI3 A;  3C2B A;  3VIB A;  4AYB N;  4BKX A;  3QKX A;  2RAS A;  3V78 A;  1IC8 A;  2XRL A;  4DYQ A;  1TC3 C;  1VI0 A;  3VPR A;  2B63 J;  3HTH A;  3VW2 A;  2XDN A;  2ME0 A;  2Y30 A;  2NS7 A;  2JJ7 A;  3BG9 A;  2DA1 A;  4XRM A;  5CW8 A;  5FKO A;  4DZJ A;  3KKC A;  2IEK A;  1OCT C;  1ETV A;  2CJJ A;  2FQ4 A;  2HKU A;  5C4X J;  3BR1 A;  4X1E A;  2DG7 A;  1ETW A;  2K9Q A;  2R5Y A;  4YZE A;  2CQQ A;  5HSZ A;  5FMP A;  1QVU A;  1TWA J;  1ENH A;  3RZO J;  3S1Q J;  1I50 J;  2E19 A;  3P9T A;  5EEA A;  2EZI A;  5HOD A;  3A02 A;  4EEF G;  4JP0 A;  1JT6 A;  2YU9 J;  4B1R A;  4FCY A;  1U8B A;  1RKT A;  3QBM A;  4L62 A;  1K83 J;  4BBS J;  4CYC B;  2Y9Z A;  2UXH A;  2UXI A;  2NOG A;  1MBF A;  4LOC A;  1RR7 A;  3VP5 A;  5IP9 J;  4V2G A;  4DYC A;  5EF6 A;  2R5Z B;  4M3G A;  4JX6 A;  3VOK A;  2ZCX A;  2HXI A;  2XPU A;  9ANT A;  2G7L A;  5EFY A;  2VPR A;  3JRB A;  1JJ6 C;  3HIM A;  5DAJ A;  2HQ5 A;  4FE4 A;  2H1K A;  1RES A;  3O8H A;  1ETX A;  3S17 J;  3EGQ A;  3RKQ A;  4ABZ A;  1APL C;  3HTJ A;  2H8R A;  3ON2 A;  1HF0 A;  3H0G J;  1UMQ A;  2LVS A;  3JRE A;  2JWT A;  4NDL A;  4A3C J;  3I4M J;  3SDG A;  3JR9 A;  3VW0 A;  3ON4 A;  4GCL A;  2OER A;  3HBL A;  3SFI A;  1Z0X A;  1H89 C;  2G0E A;  2ZCM A;  1RKW A;  3VVX A;  3DEW A;  2OI8 A;  3DPJ A;  1YRN B;  3PAS A;  4AC0 A;  2O8K A;  2FX0 A;  2XB0 X;  3BG3 A;  5EZG A;  1GV5 A;  3HE0 A;  4JX5 A;  5M3F J;  3JSJ A;  2LFB A;  4DW6 A;  2AHQ A;  2KT0 A;  5K7Z A;  5M5Y J;  4A3E J;  2QOP A;  4MFE A;  1BL0 A;  4M6V A;  1AKH B;  5IYC J;  2M8G X;  5M5W J;  3GZI A;  4FE7 A;  5GPC A;  1ITY A;  1R9T J;  5FLV A;  3G1M A;  5GPA A;  2REK A;  4GCT A;  1ETO A;  1LFB A;  2F07 A;  2G3B A;  3L1P A;  1D5Y A;  1EF4 A;  2XGC A;  1G2H A;  2LP0 A;  3BTL A;  2K9S A;  1CQT A;  1YRN A;  1OCP A;  1WGX A;  2WAQ N;  2HYT A;  5C3E J;  1OFC X;  4UDS A;  5K58 A;  1I3Q J;  1FJL A;  3LJL A;  1HDP A;  3HB9 A;  2DTZ A;  5EGO A;  3KKD A;  2JA5 J;  4A3J J;  3BQZ A;  1XG1 A;  1MBE A;  2E2H J;  3HGG A;  1B8I B;  4A3G J;  2GBY A;  1X2N A;  3COL A;  1TWC J;  3I4N J;  3C07 A;  4IHW A;  1F43 A;  4GCK A;  4Y7N J;  3H3V K;  1LE8 B;  1IUF A;  1B72 B;  1ZR2 A;  3D1N I;  1BW6 A;  2ZOZ A;  3BQY A;  3JRC A;  5EGO B;  1P7I A;  3BCG A;  2TCT A;  1IJW C;  4A3M J;  5BNG A;  4D5F A;  3FKI J;  3S5R A;  2NP5 A;  2RHA A;  2HXO A;  1B8I A;  4IEJ A;  4CGR A;  3GTP J;  3HOV J;  2M2E A;  1JKO C;  4FIS A;  2DMN A;  3BR6 A;  3LSG A;  1NK3 P;  4A3B J;  3LWJ A;  2GM4 A;  4I76 A;  3MN2 A;  2QIB A;  3WHB A;  1ETK A;  3MNL A;  1OJL A;  3BT9 A;  2DMT A;  3BR5 A;  3BTC A;  4IHV A;  3E7Q A;  4Y52 J;  5IPA A;  3VUQ A;  2ID3 A;  4A3K J;  1JUP A;  5FKM A;  1GUU A;  2O9L A;  2D6Y A;  5FGL A;  3O8G A;  2DA6 A;  3HTA A;  2WB1 N;  4QSH A;  2X6O A;  3IH2 A;  4D7M A;  1IG7 A;  4AUX A;  5E3O A;  5C44 J;  2K9N A;  3CWR A;  3Q0U A;  4RBO A;  3TP0 A;  3OOU A;  2DA7 A;  1F36 A;  2DJN A;  1ORK A;  5H9T A;  1PUF A;  2ECB A;  1GVD A;  2JA6 J;  1JTX A;  1W0U A;  5F08 A;  2EZK A;  3FK6 A;  2L7M P;  5IOZ A;  3HEF A;  4MO7 A;  2EZH A;  4BY7 J;  2MG4 A;  3A01 B;  3NI7 A;  2QCO A;  2MW8 A;  3JRI A;  2JK3 A;  2LK2 A;  4W97 A;  1JGG A;  3Q0W A;  2L0K A;  4KWA A;  3HOY J;  4B3A A;  4BBR J;  2UXU A;  2GEN A;  4I6Z A;  1ZGW A;  1DU0 A;  4AC6 A;  3CJD A;  3GTO J;  2R5Z A;  3MVP A;  2WUI A;  5CXG A;  3QQA A;  2Q24 A;  3BJB A;  3A01 A;  2IU5 A;  1MBJ A;  1JUM A;  3G1O A;  1U78 A;  4JYK A;  1GT0 C;  2UXO A;  2P81 A;  4C3H J;  5F0F A;  2E2J J;  2ZB9 A;  4RDU A;  3RH2 A;  3ZQI A;  5FKN A;  3ZQL A;  3BR0 A;  3NAR A;  2VUM J;  4A93 J;  3F0C A;  1MH4 A;  3OSG A;  2XSD C;  4DYR A;  3CMY A;  2HOA A;  3Q0V A;  1UI6 A;  2W53 A;  3OIO A;  3LOC A;  2ME6 A;  4XRS G;  5IOY A;  2LD5 A;  3JRF A;  3JRH A;  2MGQ A;  3K7A J;  1XC5 A;  2O7O A;  2DMP A;  4J19 A;  3NAU A;  3F1B A;  2QWT A;  2VKV A;  4D5C A;  2GUH A;  4M3E A;  1LFU P;  5EZH A;  2DG8 A;  3NPI A;  5D1R A;  1IDY A;  1MNM C;  2HOT A;  2ID6 A;  3G1L A;  1ZK8 A;  2EBI A;  3GTJ J;  1TWH J;  5IP7 J;  2M0C A;  3ZQH A;  3JRA A;  5HBU A;  4UUS B;  2PBX A;  3NRG A;  3BG5 A;  2V57 A;  1QPI A;  2D5V A;  1VND A;  3SJM A;  1Y1W J;  4NEL A;  4NN1 A;  3S16 J;  3M3Y J;  1IDZ A;  3PPB A;  2AO9 A;  3CQZ J;  2NVX J;  1GV2 A;  4JL3 A;  2TRT A;  2IAI A;  2Y31 A;  3B6A A;  5F1J A;  1XS9 A;  1UHS A;  2LY9 A;  4ACI A;  2RAE A;  2JA8 J;  2HYJ A;  3PM1 A;  5FKK A;  1Y1V J;  2XPW A;  1JJ8 C;  1U9O A;  4XID A;  3FIW A;  5IYD J;  4XIC A;  1FIA A;  4JX4 A;  5FLM J;  4UUS A;  3RZD J;  1UI5 A;  5CXI A;  4C3I J;  1IV6 A;  4BXX J;  2L7Z A;  2Y9Y A;  3TED A;  5F04 A;  1RET A;  3OSF A;  2NVQ J;  3PO3 J;  2DMQ A;  3FK7 A;  3GTL J;  3ZQG A;  1POG A;  3S1R J;  3RD3 A;  3LNQ A;  2UXP A;  3IV5 A;  3NNR A;  1Q1V A;  2XPV A;  2OF7 A;  4V2F A;  4FTH A;  5JLW A;  2G7S A;  4L5E A;  2XGD A;  5E3N A;  3CRJ A;  2R0Q C;  2ECC A;  5FJ8 J;  4PXI A;  2JN6 A;  4M3D A;  3AQT A;  1UG2 A;  4A3L J;  3O60 A;  1DU6 A;  2W48 A;  2LKX A;  3HDD A;  1MBK A;  3RQI A;  4QIW N;  2ZOY A;  3TW6 A;  5E3L A;  3HM5 A;  5FHP A;  2MSY A;  1WI3 A;  1WCM J;  5M5X J;  1W0T A;  4HKU A;  1SGM A;  2R92 J;  3G56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...