2I10A

Putative tetr transcriptional regulator from rhodococcus sp. rha1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
185
structure length
179
Chain Sequence
DDQVALQTAMELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYMCERTLQLEEAMVRPTAHEAVLDFLTGRVEVFTGCMTVQAGLASGEPHHEIVDLLTAAREQMRQTVLDRFEKALADGDLPAGTDCTALARYVMAAVYGLSVEAASGAPREELTAAAILAAQVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative TetR transcriptional regulator
publication title X-ray crystal structure of putative TetR transcriptional regulator from Rhodococcus sp. RHA1.
rcsb
source organism Rhodococcus sp.
total genus 58
structure length 179
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2i10A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2i10A02
3JRHA 4BXXJ 1H89C 4NN1A 3H0GJ 5FJ8J 5C4XJ 1JJ6C 4UUSB 5F0FA 3CQZJ 1UMQA 2HXOA 3BJBA 3S2DJ 1BA5A 1SGMA 4D5FA 3CCYA 2HYJA 3V78A 3ZQLA 1PUFA 4XK4A 1VFCA 4Y7NJ 1CQTA 4JP0A 5EGOA 1RESA 4V2FA 3JRIA 3S16J 2ZCMA 1MH3A 3BTCA 2JJ7A 1Q1VA 2DN0A 5J1RA 4A3MJ 2D6YA 2O7TA 1Y1WJ 1P7IA 1X58A 4DW6A 4A3CJ 4D7NA 4GFBA 5AQCA 1WH7A 1GDTA 1APLC 4BY1J 2FJ1A 4GFLA 5C4YA 1GV5A 2LR8A 4AC0A 4AC6A 2JWTA 4D5CA 2XGCA 1LE8A 1IJWC 2XPVA 1JJ8C 2HOSA 3AQSA 3HOZJ 3PO3J 2H1KA 2ZOYA 1BW6A 3M3YJ 4BY7J 1O4XA 2XGEA 4GFKA 1F36A 5HSZA 5M5YJ 4J19A 4FE7A 1H8AC 5IP7J 5IOZA 4FTHA 3K2AA 2XDNA 4RBOA 4YZEA 5JLXA 3S5RA 2HKUA 3NI7A 1VI0A 4AYBN 5C4JJ 1A6IA 5J1UA 2JN6A 2EZKA 3JRAA 1RR7A 4ME9A 1JTXA 2LVSA 4XIDA 3Q0WA 2HOTA 2Y9ZA 5K58A 1BL0A 2EH3A 1RETA 4I6ZA 9ANTA 3A02A 3BG5A 2QTQA 3VOXA 4A3EJ 3S1RJ 3Q0UA 1E3OC 2RASA 5FLMJ 3AQTA 1OCPA 2NVYJ 3JREA 3JRFA 2JA7J 2DMTA 5M5WJ 1RKTA 1WPKA 1JKOC 3RZOJ 5HBUA 4GCLA 2O9LA 1MBJA 3JRBA 2XPUA 1FIAA 1JT0A 4I76A 3HDDA 1B72B 5FKOA 5DS9A 2O8KA 4M6VA 3RQIA 1XS9A 1MH4A 3EUPA 2DMNA 2E1OA 3LSJA 3TEDA 1POGA 4HNVA 1WI3A 3FISA 3FK7A 5DAJA 1LFBA 2DMPA 1JKPC 1JUPA 2XB0X 2XGDA 1ZTRA 3OSFA 2UXUA 4IHVA 2WAQN 4XRSA 2NOGA 3Q3SA 3QPLA 2DJNA 2LFBA 3HTIA 1I6HJ 1SANA 4DYCA 3M4OJ 2R5YB 3B6CA 1ETXA 2MG4A 3WHCA 5EFYA 5HAWA 1TWGJ 2G3BA 4B1RA 1WH5A 5C44J 2ID3A 1TWFJ 2KDZA 5EEAA 5K7FA 1DU6A 1ETOA 2Q24A 3HEFA 4C3HJ 3GBGA 2W48A 4BBSJ 3RZDJ 1ZR4A 3S17J 3LWJA 4B4CA 3ANGA 2E2IJ 5EYRA 5IP6A 4ACIA 3GTLJ 4PXIA 3KKDA 3GTOJ 3CWRA 1Z0XA 3BG3A 2PZ9A 3VP5A 4AUXA 1MSEC 2K9QA 3C2BA 1S7EA 2YVEA 5EZHA 3DPJA 2M34A 2PMZN 2L9RA 2REKA 4MFDA 3VUQA 3UKGA 1GT0C 5CW8A 4GCTA 1JTYA 2EBIA 2NVXJ 4MLOA 1IV6A 3HTJA 3HOUJ 5GPCA 4W1UA 3SFIA 1ETVA 1BW5A 3CJDA 2DA2A 2RAEA 2JA6J 1OJLA 3HGGA 5K7HA 2CUEA 2KT0A 5F27A 2UXIA 4D7MA 2LK2A 2RHAA 2FQ4A 3GTGJ 3TW6A 1W0TA 2G0EA 1VNDA 3BTIA 1IGNA 3E7QA 3TP0A 2H8RA 1ZK8A 3LJLA 2DA4A 1FTZA 5DTDA 3F1BA 3BRUA 4AF5A 2OPTA 2E2JJ 2O7OA 3A03A 2LY9A 3C07A 2HOAA 1HDPA 1IC8A 1ITYA 2G7SA 4ABZA 3A01B 2OI8A 1RKWA 2LD5A 3RKQA 1U78A 3NNRA 2UXHA 5D19A 3HGYA 4XRMA 1TWCJ 1FJLA 2D5VA 3FKIJ 4IHYA 2XB5A 3QKXA 4M3EA 5F04A 3IUVA 3NXCA 4CGRA 4M3DA 3I4MJ 4V2GA 3SJMA 2DA5A 5IPAA 3TW7A 4A3BJ 2AO9A 4Y52J 3LHQA 1ETWA 4XRSG 1JUSA 1VF9A 4DZPA 4C2MJ 3VVXA 3IH3A 1TWHJ 1U8BA 4C3IJ 5M3FJ 5F1JA 4B3AA 3PPBA 2UXOA 3H3VK 2Y0SN 5D1RA 4DYQA 1YRNA 2CUFA 2XSDC 1AU7A 5FKLA 1WGXA 2DA6A 4A3DJ 3BG9A 2VKEA 4MO7A 3G56A 4G12A 5F0CA 3ON2A 4M3FA 4L62A 1TC3C 2PBXA 3IV5A 4QSHA 1AHDP 2IBDA 3BR1A 1PUFB 1QVUA 2M9HA 2R5ZA 4MXMA 3BR5A 5EGOB 3HOXJ 1B8IA 1UG2A 4MIMA 5M5XJ 5EG0A 3JRGA 5IYDJ 1ZKGA 1MBGA 4IHWA 5EDNA 2ZCNA 3ZQHA 5J1YA 2YS9A 3BQYA 1W0UA 2OF7A 1WCMJ 3JRCA 2NVQJ 1LE8B 1U9OA 4JX4A 2LKXA 1T56A 1UHSA 3GTKJ 5FKNA 4MK6A 2CU7A 2OERA 2WUIA 2DA7A 4LOCA 1Z77A 2ELKA 3WHBA 5E3LA 3LSPA 2NX4A 5CXIA 1JT6A 3E7LA 4A3KJ 2N8GA 2QF7A 3G1OA 2MSYA 4A3GJ 3V6GA 3GTJJ 5E3OA 3BHQA 3O60A 3JRDA 3GEUA 2I10A 2ECBA 1H88C 1IG7A 4EEFG 3GZIA 1ETYA 2HQ5A 3VVZA 2ME0A 3D1NI 2FBQA 4KWAA 3NRGA 4UDSA 4HKUA 3RH2A 2IEKA 3NAUA 3Q0VA 2K9SA 2JMWA 3VPRA 3HKZN 3KZ9A 2VUMJ 4A3JJ 4IHXA 2LP0A 2Y9YA 3PO2J 1MNMC 3ZQCA 1K83J 1XG1A 1DU0A 3W6VA 2NVTJ 3O8HA 2DG8A 3OIOA 2CQXA 4C3JJ 1ZR2A 2QOPA 2ID6A 5EG0B 2JK3A 4W97A 5FGLA 2R92J 1HCRA 1ENHA 2MGQA 3VIBA 1D5YA 1ETQA 2NS8A 2Y2ZA 1A5JA 3VVYA 2NP3A 2WV1A 2G7GA 4FE4A 2DTZA 2W53A 5BNGA 1P7JA 1MBEA 3OSGA 2XPWA 3S15J 4NDLA 1ETKA 2DA1A 3FIWA 1IRZA 3BR0A 3PASA 3FK6A 2X9DA 3BR3A 1GV2A 4A69C 3HOWJ 1JKRC 1IDZA 5GP9A 2YVHA 3KNWA 3HE0A 5E3NA 1IDYA 2IAIA 1F43A 3HBLA 2L0KA 4QIWN 4XICA 1X2MA 3OOUA 2XRLA 1Y1VJ 2GENA 5HODA 4DYRA 5IP9J 2Y30A 3BCGA 2CQQA 1GVDA 3GTPJ 3PM1A 1QPIA 2GLOA 3VW0A 2B63J 2UXPA 5EF6A 2QIBA 3HOYJ 2ECCA 4GCKA 3S2HJ 2P81A 1G2HA 3MN2A 1X2NA 5FHPA 4BKXA 2YU9J 3CRJA 1ZGWA 2Y31A 3BR2A 4X6AJ 2FX0A 5FMPA 1TWAJ 1K61A 2L7MP 1JUMA 3ZQFA 3DEWA 3LSRA 4JX5A 1IUFA 3VOKA 1ORKA 3EGQA 4ICHA 5FKMA 1OCTC 2FD5A 2VPRA 2CJJA 3TP3A 2CRGA 5M3MJ 3I4NJ 3LSGA 1B72A 2M8GX 3RD3A 2NP5A 3P9TA 2QCOA 5K7ZA 1AKHA 2G7LA 4A3LJ 2X6OA 5JLWA 2R0QC 3QPSA 5F0HA 3HIMA 1I50J 2HDDA 1RPWA 3S1NJ 4CYCA 2LLKA 2TRTA 4UUTA 3ON4A 1MSFC 2R5YA 3BTLA 1FEXA 4M3GA 4NELA 2GM4A 2DMQA 2R93J 1EF4A 3GTMJ 3NPIA 2NS7A 4MFEA 5IYCJ 3MNLA 3F0CA 5FKKA 2GUHA 2GBYA 2HI3A 1ZQ3P 1XC5A 5IYBJ 5E3MA 2MW8A 2R7ZJ 4L5EA 3NARA 3BTJA 5IOYA 3MVPA 2GFNA 3SDGA 2EQRA 2DMUA 3IH2A 3S1MJ 2LTPA 3VW1A 2EZHA 5F08A 1MBFA 1NK3P 1NK2P 4JL3A 4BBRJ 3QQAA 4X1EA 4M3BA 3BNIA 4DZJA 4JNNA 4A3FJ 3O8GA 3VW2A 1FIPA 2TCTA 4JX6A 3JR9A 2X48A 1HOMA 5D18A 2ZOZA 3ZOBA 2M2EA 2F07A 3COLA 3G1LA 3HOVJ 2E19A 2HXIA 1GUUA 2ZB9A 3LNQA 2ZCXA 1HLVA 3DCFA 3LOCA 2IU5A 3BT9A 2EZLA 2VI6A 1R9TJ 1SFOJ 2K40A 2COBA 1AKHB 3T6NA 3HB9A 4RDUA 3L1PA 1JGGA 1YRNB 2DA3A 1UI6A 3HM5A 5CXGA 2QWTA 1BJZA 1I3QJ 5C3EJ 1OFCX 2HYTA 3BR6A 4UUSA 4FISA 4FCYA 4CYCB 3K7AJ 2M0CA 2WGBA 2DG7A 2JA5J 2VKVA 4A3IJ 4A93J 2QKOA 2R5ZB 2ME6A 3CDLA 4S0HB 1B8IB 3KKCA 2L7FP 3BQZA 5GPAA 1MBKA 2WB1N 5FLVA 1U9NA 1FTTA 3JSJA 3A01A 3ANPA 3CMYA 4QTRA 3HTAA 1HDDC 1QVTA 1QRYA 3GTQJ 2YUSA 2EZIA 3G7RA 2JA8J 2K9NA 1JKQC 3QBMA 3G1MA 5EZGA 3ZQGA 1MBHA 1UI5A 1NTCA 5H9TA 3FRQA 2AHQA 4IEJA 1LFUP 3HTHA 3IH4A 1HF0A 2L7ZA 4JKZA 3ZQIA 3B81A 1T33A 2E2HJ 3S1QJ 5J3LA 3S14J 4JYKA 3B6AA 2V57A 3MKLA
chains in the Genus database with same CATH superfamily
3JRHA 3IKVA 5K1YA 5H6RA 5FJ8J 3ABMH 5C4XJ 3HOTA 4XOTA 4UUSB 1XDUA 2QVOA 4OMYA 4HX7A 2MLGA 3ABTA 3CTAA 2M5WA 3MWMA 2RKHA 3ZQLA 3GEZA 3CP2A 1PUFA 4XK4A 1VFCA 1FSHA 3KLOA 4BGDA 1RESA 1DDNA 5L3GA 5ED4A 1MH3A 2JJ7A 4XOPA 2DN0A 2R7WA 4A3MJ 2D6YA 2FRHA 3ABKH 1KQ9A 4GFBA 1WH7A 2OTJI 4E7ZA 4GFLA 3IHUA 4B47A 2PQ8A 4XKWA 2JWTA 4JOMA 2DTRA 1IO2A 1T6SA 3RKYA 3EYIA 1LE8A 2IGKA 3R61A 1E3PA 2VN2A 2NOJB 1RR8C 3ERMA 1BW6A 2QA4I 2P8TA 4ZTFA 3M3YJ 3CMEI 1ERDA 2XGEA 4GFKA 5HSZA 5M5YJ 2CW0F 3HRUA 3B73A 5LD2C 3M7GA 4FTHA 3H9QA 4NB5A 2HKUA 3TQNA 4BUPA 3NI7A 1SVMA 5DCFA 5C4JJ 1J59A 2DFEA 1X3WB 2EZKA 5K5QA 3PNVA 1J09A 3DFGA 4XIDA 3HRTA 2Y9ZA 5EEHA 1Z6TA 1ZELA 1RETA 2O8XA 1JHFA 2HZDA 3BG5A 1IRFA 2RASA 3OMYA 3PIOF 2HQRA 3AQTA 1EKEA 2JA7J 1X1AA 1VQ7I 1TT5B 3H92A 3QYFA 1JKOC 1EJ9A 5LLQA 2YX4A 3RZOJ 4A12A 2QQ9A 4GCLA 2XPUA 1FIAA 1SD5A 2V26A 2DCEA 1UB9A 3V7CA 1B72B 4UB6C 4OD5A 4EJWA 5DDGA 1LB2A 2VJ4A 3FISA 5DAJA 3W6KB 1Z05A 4G7OF 4IHVA 2WAQN 2OUMA 3Q3SA 2VQGA 2M30A 1I6HJ 3OS0A 5HAWA 3WHCA 3KP2A 3A4CA 2QLZA 1YW9A 1ZRCA 4KA4A 1D0YA 1ETOA 2Q24A 4DJAA 1R4NB 1YX3A 2ZCWA 3HEFA 4RGXA 2R7UA 1YFHA 3GBGA 4N4OB 4BBSJ 2XV4S 5A2QZ 3LWJA 4NQWB 1X3UA 4IQ4A 2E2IJ 3ANGA 2E1NA 4PXIA 3CUOA 3CWRA 2HWVA 1BOAA 3DLAA 3CP8A 1Z0XA 3RJPA 3F6OA 3BG3A 3RIRA 3TBIA 3VP5A 1MSEC 2K9QA 3DWLE 4PZJA 1S7EA 3DPJA 3U1DA 2ACJA 2VPLA 5HLGA 1Z7LA 4LG3A 1O3RA 3UKGA 1WJ5A 3J7ZI 4ESJA 2QZ8A 2VB6A 3P9KA 2NVXJ 1R1VA 3F22A 3GFLA 4O3MA 1OYWA 4G6DA 5GPCA 1TQMA 3FXOA 2K85A 3U21A 2ZSIB 5CKTA 3CJDA 4GXOA 4IRVA 2RAEA 1O3QA 3S3OA 4ANJA 5F27A 3WTUC 3T8TA 2UXIA 5L3BA 2QEXI 2BVMA 2FQ4A 3GTGJ 1V55H 5FO5A 3TW6A 2G0EA 4H4KC 3RKWA 4PJMA 4ZYDA 2VT3A 5E1WA 5F1RA 1IGNA 4KFCA 1S3JA 3E7QA 2A68F 5E8GA 1U5TC 1BR1A 1RIOH 1LQ1A 1K79A 2WA0A 5KK1A 5DTDA 5KCMA 1FTZA 3VEPA 2YSRA 2OPTA 3NWTA 3AKZA 2HOAA 4U0WA 5KAFC 3U2RA 1QA6A 2Z3YA 5BQTA 3CJTB 3RYPA 4ABZA 1TNTA 3QPTA 3BJ6A 4U88A 3BLYA 2LD5A 1UFMA 2HS5A 4N0BA 1FJLA 1W4MA 3FWEA 4HBLA 2UXXA 1U2WA 2R7RA 4M3EA 3MFKA 2I8DA 3JCUC 3GCMA 3R60A 1YJWI 4HF1A 5CVUA 2UUZA 3AG1H 2H94A 1H9GA 4BE1A 1WHUA 4ENJA 4CDGA 3LHQA 1VF9A 2QKLB 4C2MJ 4P5OA 2P7CB 2JRTA 2L54A 2ZSHB 2VONA 4EJVA 1OR7C 4R8HA 1SFEA 3DEEA 1R6RA 2UXOA 2A07F 3PPBA 3RTRA 2BZTA 2Y0SN 2D1HA 1R4MB 4DYQA 2E5ZA 3CLOA 2HVRA 5E17F 2DT5A 2VKEA 4PJ0C 2WTEA 4BHPA 2E34A 3G56A 2ELHA 3K70C 5FROA 3S93A 4BYYA 3BR1A 2HNHA 1QVUA 4A5NA 2M9HA 3F9KA 3HC7A 3E6BA 4ENKA 3PSIA 1R58A 5L3EA 1TL8A 3CJNA 5EDNA 2ZCNA 4TV7A 2V1XA 3ZQHA 2FNPA 3CC2I 2LY1A 2YS9A 4E70A 1VTNC 4BAYA 3IAS2 3OYHA 3OYEA 1QQIA 1D5VA 4JX4A 2LKXA 3GTKJ 5FKNA 1SVOA 1B1BA 5F64A 3CLQA 3OYKA 2A6EF 1Z77A 4XKCA 4E6KG 3D5SC 4UVBA 3WHBA 2NX4A 5CXIA 2CS3A 2N8GA 3G1OA 2X6WA 1MGTA 5E3OA 3GTJJ 3ZXSA 5HNHA 3GEUA 3FDYA 2ECBA 2VLAA 1GHCA 1VQLI 1IG7A 1PDNC 5FD5A 3GZIA 1ETYA 3HIFA 3K1NA 5L3CA 3GYHX 2A5YB 2FBQA 2OJED 3L2QA 3RH2A 3Q0VA 1ZLJA 3NAUA 5ICCA 3HKZN 1QHHD 3KZ9A 4BQOA 1BN5A 3G73A 4I0BA 2QQAA 1W36D 2A61A 2K9LA 3N97A 4C3JJ 2GZWA 3HG9A 4OIRF 3CD6I 5FGLA 1DGWY 4BACA 3IAM2 2X51A 3E0JB 2IXSA 3LA3A 4KYWA 1YIJI 3HHHA 1LFPA 1D5YA 1QPMA 3K1PA 3BG6A 2XVCA 4Q48A 3K4LA 5TJJA 2QM3A 3F72A 5BNGA 2OA4A 4NDLA 1ETKA 2ZNYA 1QZYA 2X9DA 2LF7A 3KEYA 4LIUA 4WXCA 1IDZA 1NG7A 3KNWA 2E35A 1MMNA 2L0KA 2H1LA 4BEHA 4QIWN 4XICA 4GYIA 2AXTC 1FC3A 1X2MA 3OOUA 4L5IA 4KDPA 4ASNA 1Y1VJ 4JQFA 5IT9K 3TOAA 2X1DA 1HKQA 5HDKA 4C2UA 5FRNA 1OCZH 2DU9A 2ESNA 3G3ZA 1DP3A 1HXDA 1GVDA 1V5GA 3PM1A 2GLOA 3QYBA 5EF6A 3WU1B 3HOYJ 4YIRX 5J8FA 3S2HJ 1G2HA 5DM6F 1G59A 2LH9A 4ITVA 3MN2A 5HNFA 2MLKA 2YU9J 3FX3A 2P5LC 1ZGWA 3CCVI 1VQPI 3PSFA 2LOOA 1TWAJ 2EINH 2HYFA 5CPRB 4C2TA 2L7MP 3ZQFA 1OKRA 1R1TA 3LSRA 1IUFA 4FASD 3BC8A 2DAOA 2MFZA 1TW2A 2LBFB 2VKDA 1P4XA 3QRFF 4HQMA 4ZC3A 2CRGA 3LSGA 3GFIA 2VJIA 2EB7A 3CUQA 4XL9A 2W25A 3NEUA 1AKHA 1TW3A 2Y0MA 2Y75A 1RI7A 2NXNB 4G94A 1RPWA 3O2PE 1ZG1A 3S1NJ 1LVKA 4ZDLA 3CF2A 5J47A 3SZTA 3ON4A 2TRTA 2MC3A 4UUTA 3K4MA 1UG0A 2NVUB 3KYLA 1T0FA 2UWMA 3BTLA 4IRGA 1R00A 4OOIA 5H20A 1FEXA 4NELA 2GM4A 3GTMJ 3RKXA 2ELJA 3MNLA 2STTA 2GBYA 2HI3A 1ZQ3P 5IYBJ 1UELB 1XCBA 4RM2A 4HRIA 4MHGA 4L5EA 4XSXF 4S05A 3MZYA 2GFNA 3SDGA 1HC8A 2Z16A 4JL3A 3VW1A 3I53A 1MBFA 4BBRJ 1S9HA 1ZLKA 2JSPA 1PP7U 5CJ9A 3HSRA 2XAQA 2GIZA 2HPMA 3BNIA 4DZJA 4WX9A 3GFJA 5D8KB 1FIPA 4IOCF 4JX6A 4OAZA 4O5VA 4XLPF 3JR9A 2BHYA 2X48A 4RAFA 1MDMA 3CJRB 3COLA 2XF7A 4Y13A 3VOEA 1D1BA 2ZCXA 3C2GA 4D0PA 3LOCA 2CFXA 2OU2A 4GDFA 1W5CC 1R9TJ 3ZMSA 2VODA 2DFHA 1F5TA 2K4JA 3DBLB 3O6BB 1Y8QB 3HB9A 1XD7A 5GTHC 3HM5A 3WTZA 1A31A 3FHNA 2QWTA 2HYTA 1Q1HA 2I5UA 3V42A 3K7AJ 3ZQ7A 4CYCB 2WGBA 2DG7A 3V7RA 1P2FA 2JA5J 2HDCA 4B09A 4RAZA 2ME6A 3E6CC 1B8IB 1Y56A 2JPBA 3KKCA 2L7FP 3NWSA 3C1DA 2V1DA 3BQZA 3FMQA 4UY8I 2O6GE 3CMMA 3OYGA 4K2EA 3A01A 3CMYA 4BQAA 3FBNB 4QTRA 4AYBA 1QRYA 3G7RA 4CICA 2EZIA 4RB2C 2JA8J 2A5WA 1JKQC 1J75A 4WCGA 3FMRA 2HDWA 5ICGA 2EWNA 1VQMI 1WJEA 1MBHA 1UI5A 3OL3A 2TDXA 5H9TA 5ILSA 1W5TA 1LFUP 3HTHA 3IH4A 2JRMA 2IGNA 3NRVA 1SAXA 3B81A 3S1QJ 2HKXA 2X1EA 5J3LA 3K9TA 2VL8A 4KN7X 1T38A 5GTIC 3MKLA 4D9JA 4BXXJ 1H89C 4NN1A 3H0GJ 3CCUI 2BW3B 1MNDA 2JZYA 3DTEA 2IA0A 3E3VA 4XMYA 5F0FA 1FBUA 1XCVA 1GXQA 1UMQA 3S2DJ 1SGMA 4D5FA 4UUVA 1ODDA 3WTYC 1TLHB 3V78A 3QYEA 1SFUA 1YOVB 3PNYA 4HDVA 4BQNA 2DQLA 3MEXA 1JHHA 4Y7NJ 4BL0B 4XLFA 2JT1A 1XDSA 2KDOA 4Y17A 4JP0A 4EJOA 1CQTA 3VODA 2LG4A 2HR3A 3BY6A 3TO9A 4Z2YA 3S3MA 1X58A 2K3FA 4D7NA 2EK5A 1OLTA 5B3SH 5IT9Z 2Z9OA 5AQCA 4BY1J 1EV7A 5C4YA 4MTDA 2L01A 1D0XA 1P4WA 2LR8A 4AC0A 4AC6A 2DOEA 1IJWC 1ACIA 2XAGA 2HOSA 2XUBA 3AFHA 2GXBA 4WXHA 2Q2EA 3KIOA 1F36A 4ESFA 4J19A 4YRVA 5J40A 5IOZA 5BPIA 2LF8A 3QU6A 2V6CA 1KZHA 4YZEA 2EPFA 3DF8A 3AG2H 3BOQA 1IRGA 1VI0A 2DDBA 1E2XA 3DXJF 5TISC 5J1UA 4BHBA 2W4SA 3GO5A 3JRAA 2IW5A 2JUCA 3WTVC 4MEYF 2IA2A 2LVSA 2XROA 1Z21A 3F8FA 2HOEA 2EH3A 4LIVA 2D45A 2M87A 2R7FA 3TDUC 5D5XB 4BNCA 2FBKA 3LWFA 9ANTA 3OYLA 2QTQA 3COAC 3O3KA 1BI1A 3S1RJ 2RNGA 3K4CA 3OV8A 4DOZA 5L3DA 1FOXA 1OCPA 3W6JB 1EH7A 2DMTA 3LFKA 3ZN0A 1WPKA 4ZYEA 3H1CA 4HEA2 1MNEA 3OIPA 5HBUA 3IWFA 3P9IA 2HEOA 3JRBA 4PGGA 2OZUA 2RGVA 3ASNH 2WADA 3HDDA 4ZYHA 2GOMA 5DS9A 1T8IA 2LKPA 2QSHX 1XS9A 3EUPA 2K9MA 2E1OA 2GA2A 3WTWC 3TEDA 5E1XA 1WI3A 2DT6A 1LFBA 2M0MA 5CLSA 1JUPA 1E17A 1J2XA 2C6YA 4XRSA 2KZVA 3HTIA 2VASA 3ISPA 1K7AA 2CQKA 1EA3A 3ROUA 5EFYA 1TWGJ 4G6QA 2G3BA 4HV6A 1LDKB 3DPTA 5EEAA 4KMUX 5LRSA 3CMAI 4Y4RA 1ON1A 3EUKL 3LMMA 4CXFA 3RZDJ 1ZR4A 1KU7A 3S17J 5JR3A 1FP1D 2ZO4A 2RV8A 3ELKA 5DCMB 1HQCA 3GTOJ 4IL6C 2ADUA 2R4GA 2RVCA 1SFKA 2P7VB 6PAXA 3JSPA 3SDBA 2XF6A 1XSXA 4DBRA 2AXLA 2E1MC 2EV0A 4CCMA 5CQEA 4XR6A 2MH9A 1HA8A 5CW8A 1JTYA 2EBIA 2FE3A 4E7SA 3CCEI 2VBZA 1YG2A 1L3LA 3HTJA 2X85A 4W1UA 1ETVA 2RNJA 1RNLA 4LG0A 2MBFA 5K5RA 4A5MA 1BW5A 5TRDA 3GXOA 1R23A 1WSUA 2JA6J 2PBIA 3HGGA 2CUEA 1ZN2A 1Z67A 1U0JA 2W00A 5IT3A 2ESHA 4L9JA 1N25A 4EM1A 1X3ZB 4PFOA 3TP0A 2IS2A 1W7PB 4NC6A 3LJLA 2NAZA 3W3CA 3IUOA 3H36A 4HNTA 2KIUA 3L2WA 3FXQA 5LGTA 1KU2A 2O7OA 1VQKI 2LY9A 4YIIA 4HPQA 3G4SI 1IC8A 2A69F 2ZY9A 4UHTA 2F5EA 1RKWA 3RKQA 2EFQA 3NNRA 2UXHA 2VJJA 4EV0A 4U87A 5LHIA 1S72I 3FKIJ 2R7SA 4B3XA 2XB5A 3QP6A 3QKXA 2DOAA 5F04A 1BIBA 4HLXA 1LVAA 4CGRA 3MD2A 4M3DA 3I4MJ 3ABUA 3E5QA 4YFKF 3KYDB 4OIPF 4V2GA 2R7VA 1R22A 4Y52J 2GWRA 2VXDA 4LFUA 2OCCH 1SD7A 2BV6A 2F6CA 2ZBKA 4XRSG 2KHMA 2F4IA 1VQ9I 3IH3A 1HKTA 4CH7A 1DP7P 5F1JA 2AQFA 4B3AA 1MMAA 2VE8A 1FLIA 2WB1A 4E7IA 5D1RA 1W5SA 1Y0UA 4BS9A 1YRNA 4AM3A 5B1AH 4PFPA 2XSDC 1R5HA 5FKLA 2WV0A 3DU6A 4BQQA 2XAFA 2DA6A 3BPXA 4A3DJ 2YR2A 1X4PA 5DV5A 3LAJA 1FX7A 4F55A 3ON2A 4HV5A 4PDKA 3RQ4A 1WKMA 2PBXA 2XAUA 2ZC2A 4QSHA 2QKMB 2R5ZA 1BI3A 4RA2A 1D8KA 4MXMA 4XLAA 1BIAA 3BR5A 3HHGA 3KP4A 5EGOB 1RUOA 1UG2A 4AIHA 3TGNA 5M5XJ 4OD4A 2DK5A 3JRGA 5IYDJ 1HW1A 2E1MB 1MBGA 2K86A 3LSKA 2VXZA 1FYKA 1ZREA 1YI2I 1Z91A 3BQYA 2BE5F 1W0UA 2OF7A 1USSA 1WCMJ 1UHMA 2ZNZA 1MJAA 1KGSA 2NVQJ 1U9OA 4QWQA 2MD5A 4N9IA 1UHSA 2VOPA 2M3AA 2CU7A 2OERA 1WWXA 3DTKA 4YIFA 1Y6IA 4HLYA 3HPHA 1P92A 4BE2A 1V5FA 2FEZA 1NH3A 1YW7A 1JT6A 4XSZF 1I1GA 1CF7A 3J80Z 4A3GJ 1O7FA 1QGPA 3V6GA 1XMAA 1ON2A 3VYRB 2I10A 3UR3C 1H88C 4LJZF 4KMFA 3S3NA 4EEFG 3RPUA 1Z6RA 3H3UA 3PFIA 3VVZA 3H35A 4DQ2A 1AWCA 3KCCA 4HW0A 2EIKH 4KWAA 4G6TB 3BCBA 4HKUA 4G7HF 2JMWA 3WTXC 2VUMJ 4A3JJ 1OCRH 3ZQCA 2EIMH 2M7AA 1K83J 3W6VA 4NHJA 2KZGA 1L0OC 3QWLA 3BDDA 3FXRA 5LHGA 2QOPA 1OCOH 4U0VA 2JK3A 3OYMA 2XKOA 4HA8A 2R92J 3GUDA 4XM3A 1J5YA 4IZZA 3C3WA 1XGSA 4F52A 1YE9A 1O3SA 1MZBA 3VVYA 4HYEA 5D4SA 1YJ9I 1BM9A 1CGPA 2W53A 2DT7B 3OSGA 1IRZA 2W1OA 3BR3A 4A69C 1JKRC 4U9LA 2LYCA 2IAIA 3CUQC 1KONA 1G6NA 1IXCA 2XRLA 1KYWA 1I39A 3NQOA 5HLIA 3DP7A 2CQQA 4BDZA 4P9FA 3EUHA 4GYGA 2B63J 4A0XA 2QIBA 4IKFA 2QSFX 4P9UA 3F8NA 5LEKA 3LSHA 3T1BA 4EM2A 3GZ5A 1N75A 1T0FC 3SZPA 4I98B 1QO0D 1WJCA 2IRFG 5FHPA 2ETHA 2Y31A 3KE2A 3MKYB 2FUG2 2FNAA 3PUBA 2RREA 3VOKA 1MMDA 1MW7A 5FKMA 4A2UA 1OCTC 4ICHA 3LAPA 2CW7A 2GXGA 3WGGA 1FPQA 3HRMA 2VPRA 3K4BA 1K78B 5M3MJ 1IXRC 4L0ZB 1B72A 2CO5A 1U3EM 2M8GX 4JBAA 2PJRA 4FX4A 4B43A 1VQ5I 1R5GA 3IKTA 4KIFA 1D8JA 4KT5C 1C0WA 1NHAA 4ZZDA 3B02A 3QPSA 5F0HA 3HIMA 1I50J 4KT6A 1T39A 2QBYA 1W1WE 1PUEE 2KIQA 2UXNA 4I01A 4M3GA 4BEHB 2DODA 1I3AA 2BY1A 2DMQA 2X6XA 2GXAA 2PLYA 2R93J 1BI2A 2NS7A 3F0CA 4P1WA 5AIPA 3QP5A 1HW5A 5FKKA 4E4HA 3I71A 2L4MA 2F4MB 2GUHA 1V4RA 5E3MA 3FM3A 2MW8A 1XTAA 4R1HA 2KP6A 1R5ID 2IPQX 3MVPA 1IV8A 5CVRA 2DMUA 3FXJA 4RGSA 2B9SA 2MABA 2Z99A 5F08A 1NK2P 3FXMA 3BG7A 2B0LA 2L9SA 3QQAA 4X1EA 1FYMA 5D5UB 2FMYA 5B66C 2IGMA 4QPOA 3O8GA 4IHSA 2MD0A 3K4NA 4LLNA 3DPLC 2JQ7A 2UV1A 5B1BH 3ZOBA 2RN7A 2DW4A 4C9YA 3KEQA 3LNQA 1Y0NA 5HS9A 1U5TB 1ONVA 2W24A 3CUQB 4F92B 2ICWG 1Z9CA 2QQ8A 2DI3A 1W36C 1SFOJ 3FM5A 1YYVA 2COBA 4E7LA 4I02A 1AKHB 4GO1A 1GLNA 2KL4A 2DA3A 4PK4A 5GAHJ 5CXGA 2AS5F 1I3QJ 5C3EJ 2JVGA 4RB3C 1WRJA 4FISA 2NYXA 1FP2A 5D6FA 2OD5A 4BE0A 4E7KA 4IHTA 4UV8A 2L3DA 4M9SA 2A05A 2MH2A 2VKVA 3BZCA 4A3IJ 2QKOA 3HYIA 2CFOA 3GZNB 4FX0A 3CCRI 4EQQA 3L2RA 4II2A 3DLLF 1NG6A 1GXPA 2DPUA 1LEBA 5BPDA 2V79A 4ENMA 5FLVA 2DDAA 4HZFA 3R6SA 1FTTA 2V4JC 4KITB 3JSJA 3ANPA 5IY5H 3HTAA 1QVTA 2LC2A 3EPZA 4N4NB 3GTQJ 2YUSA 2O3FA 3ASOH 1WFXA 3OR2C 4F7ZA 3QBMA 5GADJ 1T95A 5EZGA 2F5CA 4MGRA 3KZZA 2L9VA 4HSTA 2HTSA 1MDMB 2VBYA 3FRQA 1SVLA 4PSXA 4XONA 2AHQA 4XLNF 1V3FA 4U9NA 5LGUA 3V8LA 4A0YA 2A3SA 3HUGA 2L7ZA 4DVYP 3I59A 5LEJA 4U0YA 2ISZA 3I54A 1T33A 5BMZA 1S6LA 4EATA 2E2HJ 2GIVA 5ICEA 4DGWB 3S14J 2CSOA 1LKXA 2V57A 1O57A 1BBYA 2E7WA 3HJEA 3CQZJ 1VQ4I 3CCYA 2HYJA 1S5LC 1WVRA 1ZG3A 2DLLA 3P5JA 5DUKA 4UNOA 5EJCA 3J7AO 2LREA 4CCNA 1YS7A 1IAWA 3JRIA 3S16J 3KFWX 2ZCMA 3DKYA 3QPHA 2GA1A 5J1RA 2QGUA 4BDYA 4A3CJ 3QOPA 1LPQA 2JA2A 1H9TA 1GDTA 2XGXA 3H5NA 1XGMA 4RM3A 1APLC 2CQNA 2NRAC 1TT0A 3HTSB 5J8CA 4D5CA 2XGCA 5CVIA 1PP8F 1JJ8C 2G7UA 4IJAA 1QNTA 3F6VA 3FZVA 4X0GA 3PO3J 1B9MA 1X1PA 2KPMA 4IPAA 3E5XA 4RGUA 2YX7A 1H8AC 4HAMA 4G7ZF 2L2OA 3K2AA 4RBOA 2VQCA 3OYIA 2P4WA 1IN6A 3ULQB 4PUSA 3MKWB 4AYBN 4ZDOA 1UCRA 4XN0A 1A6IA 3RYRA 3FF5A 3DBHB 3FXKA 2XRNA 1DUXC 3AL0C 2HOTA 3K1MA 2ZMEA 3PQKA 4CSWA 4M6XA 5K58A 1HSJA 2ZXIA 1X1DA 3DKXA 3A02A 2DYSH 2CMPA 3DPUA 4DNCA 4A3EJ 4IF4A 1P6RA 2NVYJ 3JREA 1MMGA 2QUFA 1S7AA 5M5WJ 3GFMA 1IZ1A 3C18A 5E18F 2O9LA 3H5RA 4HX8A 2GQQA 1JT0A 5FKOA 2HFHA 3ZN1A 4M6VA 3RQIA 1MH4A 2FSWA 4AWXB 1POGA 3FK7A 2X4HA 4XORA 2W7NA 2XB0X 2XGDA 1SAUA 2A6HF 3OSFA 2UXUA 2NOGA 3BCAA 4EJUA 4OAYA 2DJNA 4LLGF 1SANA 3M07A 4NC8A 2R5YB 3B6CA 4KISA 2MG4A 2IP2A 2CUJA 2L9NA 4B1RA 5C44J 2KDZA 2FQ3A 2JPCA 3MCZA 5K7FA 1TP4A 1TQPA 2KISA 3H5AA 3LQRA 3M1CA 3VWBA 3JW4A 1FOYA 4M73A 2WWYA 3GWZA 2BYVE 2W48A 4BU2A 3DU5A 3UNGC 4BXUA 5J4YA 4IVNA 4MEXF 4Z6YA 3ML6A 3CC7I 5EYRA 5IP6A 3WTSC 4ACIA 3GTLJ 2XKPA 1KQ8A 3F8BA 3KKDA 3C2HA 2PZ9A 1FWZA 3OWTA 3TKYA 3L2UA 2A6TA 3ZMZA 3PUFA 2VT2A 2XAJA 3ZMDA 1K4SA 2VQLA 2M34A 1BC7C 2PMZN 2L9RA 2M4GA 2ZXWH 4KICA 5FRMA 3VUQA 2LBFA 1HSTA 1MKMA 4GCTA 1E0EA 3KP3A 4YFXF 4YFNF 4I2OA 1IV6A 3ESWB 2E71A 3TDZC 3ZMVA 3I0TA 2DFIA 2DA2A 1OJLA 5K7HA 4V19K 1BI0A 4D7MA 1IF1A 2ZKZA 1Z3XA 2O61A 2H8WA 3EYYA 2EJRA 1W0TA 5HVQC 2V9PA 3M8JA 3WU2C 3G2BA 2DA4A 1I6XA 4OIQF 3F1BA 4MNUA 4AF5A 2BBYA 4HX4A 2M45A 3A03A 4GCVA 2PG4A 3C07A 4G9YA 3SYTA 5AIQA 4ON0A 4ZTJA 2Z5UA 4AIJA 2G7SA 2OI8A 5B5EC 2CGPA 4MQVA 1U78A 3T0YA 1FNNA 5D19A 3HGYA 3SZGA 1ZG5A 1SEUA 1WI9A 2FBHA 3IUVA 3NXCA 3CDIA 5E20A 1FY7A 2XC7A 2OQGA 1MMSA 3N4MA 5IPAA 2AO9A 2EFPA 2L5QA 3PFYA 3W2VA 2B1EA 3WTTC 1ETWA 1YLFA 1JUSA 1N78A 2BY3A 2MA3A 3VVXA 1TWHJ 3GLLA 1U8BA 3OR1C 5FD6A 4C3IJ 5ILUA 4IQJA 3HSFA 2IGOA 4LG0B 1YQAA 3H3VK 5KVRA 2X0LA 4CHUA 2BY0A 3KEOA 2F2EA 4RB0A 1YW8A 1LJ9A 2CUFA 1AU7A 2EILH 4KIBA 3BG9A 4G12A 2D2WA 4M3FA 4L62A 4XLHA 1TC3C 1AHDP 1PUFB 1OYYA 3OYFA 3DV8A 1XMXA 2CYYA 2VC0A 4Q4ZF 3HOXJ 1B8IA 2R7OA 3E97A 4MIMA 2QQBA 4LK1F 5EG0A 2EFNA 5JHUA 1ZKGA 4IHWA 3OYCA 3Q9VA 5J1YA 1T2KA 5FGMA 4NUBA 3GZ6A 3JRCA 4CA0A 4UVCA 3D5LA 5LFAA 1LE8B 2P5KA 1T56A 1J0RA 4MK6A 2LNBA 3PNTA 1JE8A 3MZ8A 2DA7A 2ELKA 5E3LA 3V8JA 3DBRB 1B59A 3I56I 3F8CA 5ERIA 2V1NA 3E7LA 3HPGA 5A2QK 3ERED 3CF5F 4C2MA 4CYDA 2MSYA 4BH9A 2GOXB 5LHHA 3KP5A 1W7PD 3O60A 5JFRA 3JRDA 2V1UA 5FB2A 3PJRA 1LDJA 3OYJA 4M6YA 5HS7A 5GAGJ 1FYLA 3AG3H 2ME0A 3D1NI 4UDSA 2OCEA 2K9SA 4N9HA 4YG2F 2DPDA 1Y39A 2LRDA 2LP0A 2Y9YA 1SC7A 3PO2J 4P96A 2NVTJ 3O8HA 2YPRA 2DG8A 5LBQA 2CQXA 3EUHC 2RQPA 1VZ0A 3N05A 5HS8A 2ID6A 5DD8A 4I09A 3G71I 4EGYA 4R79A 5E8IA 1ENHA 4M71A 1ETQA 2NS8A 2PX9A 2Y2ZA 3HXLA 1A5JA 5KAIC 2G7GA 3ZCOA 3QAHA 3TO7A 2W85A 4FE4A 1IW7F 2DTZA 3NS4A 4L9TA 1MBEA 5K5OA 3K6GA 4S04A 4NC7A 2F4OB 3D0SA 3K0LA 5H2FC 3CCLI 5D4RA 3BR0A 2G7HA 3FK6A 4FHTA 3HOWJ 5GP9A 2XSJC 4CCOA 3LA2A 3WG9A 4IRIA 3HE0A 3EDPA 3R0JA 1F43A 3JSOA 4ZJZA 3HBLA 1GVJA 4CCLA 1YHQI 4WIBA 5FLXK 5HODA 3WODF 5IP9J 3F23A 3GTPJ 1QPIA 1XMKA 2W57A 3KZYA 4U7BA 2YU3A 3GF2A 2OQRA 4GCKA 1IXSB 2P81A 1WQ2A 3E6DA 4A6EA 3I9V2 1X2NA 5HDGA 3CRJA 3I3LA 1DQUA 4EMSA 3HSEA 2ZJQF 1X19A 3IP4B 1QBJA 2FX0A 1VQOI 5ICFA 2FJI1 1B9NA 1XGOA 1JUMA 2E1CA 2KQRA 4JX5A 3ZPLA 1ORKA 2KMUA 4CCKA 2FD5A 4ZH4F 2H6CA 2B7EA 1RUNA 4OIOF 3TP3A 3J81K 1FOWA 2ISYA 3BJAA 1YITI 1TNSA 2HVSA 3P9TA 2QCOA 4QPQA 4BJ6C 5D6EA 4F3QA 1PVEA 3E6MA 2YVXA 2R3SA 2BHZA 5K7ZA 2G7LA 1H0MA 2EV5A 2X6OA 3CO6C 2G9WA 1USTA 5D8LB 2HDDA 3E5UA 2R7QA 3KPHA 2GAUA 3T8RA 1MSFC 3A1YA 3A2KA 2NNNA 2VOOA 2OV7A 1EF4A 2VJ5A 2COMA 2JSCA 2O0YA 4MFEA 3TO6A 1ZYRF 3TOBA 2Z2SB 4AVZA 2P6TA 3BJOA 2J5OA 1XC5A 1K6OA 4NNJA 1ULYA 4DIQA 4AD9A 2FOKA 2R7ZJ 2KRCA 3KP6A 4A0ZA 5IOYA 3EUAA 4CUGA 4NBQA 2EQRA 3IH2A 3LSTA 2LTPA 2DJIA 2XAHA 1I5ZA 2F5FA 3H0DA 1NK3P 5AONA 5DCMA 2FA5A 3SHFA 4M3BA 2D1VA 4PJJA 3KX2A 2DK8A 4JNNA 1AA7A 2TCTA 3DTIA 1LEAA 4Q5SF 5D18A 4CZZA 2STWA 2PI0A 4M72A 2M2EA 2F07A 3OOPA 3HOVJ 2HXIA 1GUUA 4Y3OA 4RS8A 4RLQA 3BT9A 2LMDA 1WJBA 2EZLA 3IC7A 4IXAA 2PJRB 1KU9A 2K40A 3G6EI 4IX7A 2O03A 3T5XA 4RDUA 2HGCA 3L1PA 3MZHA 1UI6A 1BR4A 1OCCH 1TQIA 4KJZA 3BR6A 4O6JA 4UUSA 1IRXA 1WJAA 1R71A 2QBYB 4FCYA 5E1ZB 2X6YA 2M0CA 1K6YA 3H9GA 1W7PA 2HTJA 2WY7Q 3S8PA 4A93J 3SEQA 1Y8RB 2HKOA 2V7FA 3CDLA 1QHGA 4S0HB 2AQEA 3DQVC 1D1CA 2X1CA 5GPAA 3CCJI 1U9NA 3SEZA 2E5NA 1O7LA 1QU3A 4RAGA 1STZA 1HDDC 3D5RC 1J7KA 1TZLA 4M9XA 1R7JA 3BP8A 5H6QA 1UAAA 2QSGX 2IS6A 3G1MA 2JVHA 3ZQGA 4PGHA 4A6DA 2M7BA 1M1EB 2NS0A 1NTCA 3LQQA 4RGRA 2PEXA 4RAYA 4CZCA 4YEJA 2IS4A 5LRRA 4CCJA 4PSWA 5E79C 3HOSA 2L4AA 1REPC 4JKZA 3OY9A 2QYOA 4KIGA 3ZQIA 1Z3YA 5L3FA 2WY8Q 3LL7A 2PMUA 2EFWA 3ABLH 3VB2A 3NRGA 2FMLA 1UZCA 2BOLA 1JJ6C 1FZPB 4FETA 3BJBA 2HXOA 5HLHA 1BA5A 5DEQA 3L00A 2ZXJA 3DEUA 3GX4X 3U1KA 1OMIA 1HBXG 5TGTA 1D1AA 4IRHA 2HQNA 5DUIA 4UB8C 2WAQA 2OC6A 5JVGF 4XLCA 2PFVA 2CUZA 5EGOA 4P55A 2ZMEC 4V2FA 3REOA 2ZXHA 3BTCA 1Q1VA 2WC2A 2E36A 2O7TA 1Y1WJ 1P7IA 4DW6A 3VSLA 5KNLA 3L9FA 5FLXZ 2DXIA 2FJ1A 1S7OA 1O3TA 1GV5A 3I5UA 1LUJB 2K5CA 4M9ZA 4ETSA 2MYSA 4G8XA 3EQLF 2Z1DA 4YELA 4MQ9F 3ZP5A 2XF5A 2XPVA 3AQSA 3HOZJ 3KP7A 2H1KA 2ZOYA 3CESA 3V8KA 4BY7J 1HKSA 1O4XA 1A04A 4FE7A 4WF2A 3H3ZA 3SWHA 5IP7J 2IT0A 2XDNA 2XDVA 3FXLA 3ZR8X 5JLXA 3HUGB 1FSEA 4H0EA 3EETA 2EIJH 3I59B 3S5RA 3LA7A 1R49A 4L5JA 4UVAA 3BWGA 2JN6A 1RR7A 4ME9A 4II3A 1JTXA 1ZAOA 1BJAA 1EH6A 3Q0WA 4NQWA 1FMWA 3J81Z 1D0ZA 2ZJRF 1BL0A 1A36A 4ZYAA 4KNYA 4I6ZA 1YJNI 4OWRB 1OYIA 5JI6A 3F21A 3VOXA 4AIDA 5D5WB 3Q0UA 3RI4A 3I55I 1E3OC 5FLMJ 3JRFA 2EV6A 1N77A 1RKTA 4ZDPA 2P6SA 4CGZA 3K8PC 2JTVA 1MBJA 1SD4A 4I76A 2DFFA 1OQYA 2J5PA 2FXAA 3L09A 4L9VA 2O8KA 1DGRM 4B48A 4LK0F 1XGNA 1DPUA 3DKWA 3A0HC 3K2ZA 5BOXA 2DMNA 1XN7A 3K70D 3LSJA 3K10A 4HNVA 1R1UA 4WK8F 2DMPA 1XB4A 1JKPC 2PN6A 3CZ6A 1ZTRA 1ZRFA 3MQ0A 2M8EA 3QPLA 3U9GA 2BXYA 2LFBA 3WU0A 4DYCA 3M4OJ 4LLLA 1WJFA 1ETXA 4FQGA 2DBBA 2ZFWA 4D1QA 1WH5A 4ZZLA 2ID3A 1X4OA 1TWFJ 2UZKA 1DU6A 4HF0A 1XSDA 1XX5A 4C3HJ 1LNWA 1VQNI 1UJ8A 4L18B 1OISA 4ENNA 1XSVA 3VFZA 1KYZA 2ZMEB 2R7TA 4B4CA 1IN5A 1X1CA 2KIMA 2Q0OA 2OTLI 2Y0SA 4AUXA 2RQQA 2HQAA 4OU0A 3M8FA 3ZMTA 3C2BA 3I4PA 2YVEA 1JXSA 5EZHA 2K4BA 4KUMA 1DPRA 3BZ6A 2KJBA 3QOEA 1PJRA 2REKA 1QZEA 4MFDA 2Y48A 3OS2A 1GT0C 2V6EA 1SMYF 3WE3A 1K78A 2DYRH 3WGHA 4MLOA 4UXNA 5GAEJ 3HOUJ 3RSNA 3SFIA 5CQGA 1E3HA 4GRIA 1P4AA 4BJTA 4XKBA 2V9VA 2A2FX 4LMYA 2KT0A 3R0AA 2LK2A 3RDIA 2RHAA 3VDXA 3L7WA 1VNDA 3BTIA 2H8RA 1ZK8A 2H6BA 3GW2A 4XQFA 1LDDA 4HF2A 1ZGAA 5EEGA 3BRUA 2E2JJ 3HZJA 4QLCU 1HDPA 3X2QH 1G3WA 1ITYA 5FFZA 3GVAA 3A01B 3IRRA 2P5VA 5CVJA 2O5RA 1TBXA 3S32A 4XRMA 1TWCJ 2D5VA 2CV1A 5F6FA 5CYVA 3RCOA 5HLTA 4IHYA 3F8MA 4B44A 5D5VB 1Z1DA 3IWZA 3SJMA 2FOWA 4XN3A 2DA5A 4A3BJ 4LB6B 3TW7A 3HKZA 2RDPA 4I99C 1AOYA 3VYUB 2VIXA 4DZPA 3FXUA 1U5TA 3A0BC 3KETA 2F5DA 5BS6A 5M3FJ 2ZJPF 5J4VA 2NNYA 1RZ4A 3Q5FA 3OS1A 5HOOA 3SFZA 1WGXA 2IJLA 1BOBA 1A6QA 3H9JA 4AVPA 3HL2A 1MD0A 4MO7A 2KFDA 5F0CA 2E7XA 3JTHA 5DM7F 3IV5A 1F4KA 2IBDA 2M1BA 3OIQA 3OYAA 2H09A 2HVQA 4KN4X 2BGCA 2IU5A 4J01A 1J9IA 4B8XA 3JAMK 1YTYA 2KIFA 4RMNA 3J7AY 2Z33A 1YS6A 4EM0B 3W2AA 3CJQB 1VQ8I 2EA2A 3C7JA 4F93B 2VQHA 1B6AA 1OR7A 3IRQA 3OYBA 2WAFA 3KLNA 1F1ZA 4J00A 2WUIA 2Q2EB 4LOCA 1T98A 3AAFA 3CCQI 4E7JA 1YO5C 1ZRDA 5DYMA 2KJCA 4XKVA 2Q1ZB 3LSPA 1S29A 1IN8A 2P0WA 2VBWA 4A3KJ 2V9KA 3QODA 3IL2A 1ZHFA 2QF7A 4I0AA 2FBIA 3V4GA 3BHQA 2E60A 4HOBA 2B3WA 4FT8A 3CC4I 1SFXA 2HQ5A 1P9QC 3PIPF 1TTYA 1IN4A 2XASA 1RC9A 3K4JA 1EH8A 4XNFA 2IEKA 1ZGJA 2L7KA 3HRSA 2VE9A 3OYDA 3VPRA 1U8RA 1D3YA 3MKZA 4IHXA 3HTUA 5FFXA 3M1EA 2LY2A 4HDUA 1MNMC 1DU0A 1XG1A 2OZ6A 3OIOA 1ZR2A 4BHCA 2K27A 2KRHA 3PL8A 4Y33A 3CDHA 5EG0B 3ZGKA 2LKSA 1V54H 4W97A 3WG7H 5JHFA 1KQ0A 1MJ9A 3V7SA 1HCRA 2MGQA 3VIBA 2LSOA 3LFUA 2NP3A 2WV1A 1HW2A 2F5VA 2QWWA 4PJLA 5HDNA 1QZZA 3CCMI 1P7JA 2XPWA 3VYTB 3AL0B 3ZMUA 2XIGA 3S15J 2DA1A 2BVLA 2KLOA 2CQ7A 3FIWA 2JUGA 2XHKA 5CVVA 5DD4A 1IUYA 1GV2A 3PASA 1SD6A 1YIOA 3F3XA 2YVHA 1B4AA 5E3NA 2M4KA 1IDYA 2F48A 3SQNA 2BY2A 1ZARA 4WXDA 2GENA 4UV9A 4DYRA 1FT9A 1X1BA 2Y30A 3K69A 3K4KA 3RPQA 3MMYB 4ESBA 4E7HA 3BCGA 2KKOA 2VBXA 4U7DA 4HSRA 2FU4A 1BC8C 2IVMA 3VW0A 2UXPA 4BXFA 3FHZA 2ECCA 1G3TA 3I58A 1PYVA 3P7NA 4RLFA 1F9NA 1A35A 5ILVA 4BKXA 2KRFA 3BR2A 4X6AJ 5FMPA 1S8NA 3E1SA 3KYCB 1K61A 1R36A 2VC1A 3FBIB 3DEWA 3WGIA 3EGQA 4JK1X 2DO7A 3SXYA 4XLEA 3VYSB 2H27A 4Y15A 2LDUA 2CJJA 3I4NJ 1JGSA 4XRFA 3RD3A 2CH0A 1KU3A 2NP5A 2DOFA 2MC4A 4F91B 3JTGA 4AIKA 4HNUA 1ZH5A 4A3LJ 1RRJA 5JLWA 2R0QC 4IOAF 2W84A 3GLXA 3ZRGA 2OBPA 1G4DA 2PJPA 1MJBA 2PMHA 4OMZA 2Y69H 4GGGA 1K4TA 2HPIA 2DQRA 4PJNA 4CYCA 2LLKA 4DBQA 1Z7UA 4C30A 2R5YA 3BPVA 4LITA 3VTIA 1WJDA 4EVIA 3NPIA 2K02A 5IYCJ 2R7XA 2L02A 1T08B 1XPXA 2PMZA 1I1SA 4BJ5C 4EJTA 5JVTA 1FOKA 2HYGD 3NARA 1SMTA 3BTJA 3AG4H 2CV2A 3P9CA 3FMSA 3L2VA 3S1MJ 2EZHA 4XBFA 3QU3A 1JI8A 1UHWA 3ZQQA 3KZIC 3PQJA 2W82A 4HG2A 3TL4X 4WWCA 3BZKA 5LGNA 4A3FJ 3VW2A 3ECHA 3J80K 3J7YJ 2ZFUA 4HQEA 1IN7A 1HOMA 1BR2A 2K7LA 3M8EA 2ZOZA 2HU9A 1U6GA 3G1LA 3LSMA 2E19A 1MIJA 2ZB9A 1HLVA 3DCFA 3CCSI 2BEOA 2VI6A 2Q8KA 3JAMZ 3T6NA 4RB1A 4M74A 1OPCA 2K3PA 2RC4A 1JGGA 3TMOA 1YRNB 1BJZA 4PCQA 1G3SA 2R7DA 2BW3A 1OFCX 2FF4A 2EFOA 3VSKA 3M9AA 4IO9F 3RPUD 3L2CA 2IS1A 3S2WA 3W2WA 3GMEA 3WE2A 4MTEA 2PFBA 2R5ZB 1FBQA 1VQ6I 2IA1A 3BROA 1G8XA 4I7HA 4LD5A 3Q9SA 4Q47A 1G3YA 1I27A 1MBKA 2WB1N 2WAEA 4CO8A 2HZTA 2OAZA 2CWEA 3ECOA 4OINF 2CW8A 2K9NA 1V5EA 4EGZA 5J6XA 3I64A 4L0YB 4AU7A 3MAJA 3R4KA 2EA4A 3LSIA 4L9NA 2WBMA 4IEJA 2CV0A 3FKJA 1CF7B 3OL4A 1FMVA 4LB5A 1WZ2A 1HF0A 2ZJ2A 3OYNA 3CO7C 2VKHA 5KHDA 2BXZA 2QENA 2CG4A 4LGWA 4ZYGA 1KA8A 3ONQA 4JYKA 1FBSA 1YX5A 3B6AA
chains in the Genus database with same CATH topology
3JRHA 4BXXJ 1H89C 4NN1A 3H0GJ 5FJ8J 5C4XJ 1JJ6C 4UUSB 5F0FA 3CQZJ 1UMQA 2HXOA 3BJBA 3S2DJ 1BA5A 1SGMA 4D5FA 3CCYA 2HYJA 3V78A 3ZQLA 1PUFA 4XK4A 1VFCA 4Y7NJ 1CQTA 4JP0A 5EGOA 1RESA 4V2FA 3JRIA 3S16J 2ZCMA 1MH3A 3BTCA 2JJ7A 1Q1VA 2DN0A 5J1RA 4A3MJ 2D6YA 2O7TA 1Y1WJ 1P7IA 1X58A 4DW6A 4A3CJ 4D7NA 4GFBA 5AQCA 1WH7A 1GDTA 1APLC 4BY1J 2FJ1A 4GFLA 5C4YA 1GV5A 2LR8A 4AC0A 4AC6A 2JWTA 4D5CA 2XGCA 1LE8A 1IJWC 2XPVA 1JJ8C 2HOSA 3AQSA 3HOZJ 3PO3J 2H1KA 2ZOYA 1BW6A 3M3YJ 4BY7J 1O4XA 2XGEA 4GFKA 1F36A 5HSZA 5M5YJ 4J19A 4FE7A 1H8AC 5IP7J 5IOZA 4FTHA 3K2AA 2XDNA 4RBOA 4YZEA 5JLXA 3S5RA 2HKUA 3NI7A 1VI0A 4AYBN 5C4JJ 1A6IA 5J1UA 2JN6A 2EZKA 3JRAA 1RR7A 4ME9A 1JTXA 2LVSA 4XIDA 3Q0WA 2HOTA 2Y9ZA 5K58A 1BL0A 2EH3A 1RETA 4I6ZA 9ANTA 3A02A 3BG5A 2QTQA 3VOXA 4A3EJ 3S1RJ 3Q0UA 1E3OC 2RASA 5FLMJ 3AQTA 1OCPA 2NVYJ 3JREA 3JRFA 2JA7J 2DMTA 5M5WJ 1RKTA 1WPKA 1JKOC 3RZOJ 5HBUA 4GCLA 2O9LA 1MBJA 3JRBA 2XPUA 1FIAA 1JT0A 4I76A 3HDDA 1B72B 5FKOA 5DS9A 2O8KA 4M6VA 3RQIA 1XS9A 1MH4A 3EUPA 2DMNA 2E1OA 3LSJA 3TEDA 1POGA 4HNVA 1WI3A 3FISA 3FK7A 5DAJA 1LFBA 2DMPA 1JKPC 1JUPA 2XB0X 2XGDA 1ZTRA 3OSFA 2UXUA 4IHVA 2WAQN 4XRSA 2NOGA 3Q3SA 3QPLA 2DJNA 2LFBA 3HTIA 1I6HJ 1SANA 4DYCA 3M4OJ 2R5YB 3B6CA 1ETXA 2MG4A 3WHCA 5EFYA 5HAWA 1TWGJ 2G3BA 4B1RA 1WH5A 5C44J 2ID3A 1TWFJ 2KDZA 5EEAA 5K7FA 1DU6A 1ETOA 2Q24A 3HEFA 4C3HJ 3GBGA 2W48A 4BBSJ 3RZDJ 1ZR4A 3S17J 3LWJA 4B4CA 3ANGA 2E2IJ 5EYRA 5IP6A 4ACIA 3GTLJ 4PXIA 3KKDA 3GTOJ 3CWRA 1Z0XA 3BG3A 2PZ9A 3VP5A 4AUXA 1MSEC 2K9QA 3C2BA 1S7EA 2YVEA 5EZHA 3DPJA 2M34A 2PMZN 2L9RA 2REKA 4MFDA 3VUQA 3UKGA 1GT0C 5CW8A 4GCTA 1JTYA 2EBIA 2NVXJ 4MLOA 1IV6A 3HTJA 3HOUJ 5GPCA 4W1UA 3SFIA 1ETVA 1BW5A 3CJDA 2DA2A 2RAEA 2JA6J 1OJLA 3HGGA 5K7HA 2CUEA 2KT0A 5F27A 2UXIA 4D7MA 2LK2A 2RHAA 2FQ4A 3GTGJ 3TW6A 1W0TA 2G0EA 1VNDA 3BTIA 1IGNA 3E7QA 3TP0A 2H8RA 1ZK8A 3LJLA 2DA4A 1FTZA 5DTDA 3F1BA 3BRUA 4AF5A 2OPTA 2E2JJ 2O7OA 3A03A 2LY9A 3C07A 2HOAA 1HDPA 1IC8A 1ITYA 2G7SA 4ABZA 3A01B 2OI8A 1RKWA 2LD5A 3RKQA 1U78A 3NNRA 2UXHA 5D19A 3HGYA 4XRMA 1TWCJ 1FJLA 2D5VA 3FKIJ 4IHYA 2XB5A 3QKXA 4M3EA 5F04A 3IUVA 3NXCA 4CGRA 4M3DA 3I4MJ 4V2GA 3SJMA 2DA5A 5IPAA 3TW7A 4A3BJ 2AO9A 4Y52J 3LHQA 1ETWA 4XRSG 1JUSA 1VF9A 4DZPA 4C2MJ 3VVXA 3IH3A 1TWHJ 1U8BA 4C3IJ 5M3FJ 5F1JA 4B3AA 3PPBA 2UXOA 3H3VK 2Y0SN 5D1RA 4DYQA 1YRNA 2CUFA 2XSDC 1AU7A 5FKLA 1WGXA 2DA6A 4A3DJ 3BG9A 2VKEA 4MO7A 3G56A 4G12A 5F0CA 3ON2A 4M3FA 4L62A 1TC3C 2PBXA 3IV5A 4QSHA 1AHDP 2IBDA 3BR1A 1PUFB 1QVUA 2M9HA 2R5ZA 4MXMA 3BR5A 5EGOB 3HOXJ 1B8IA 1UG2A 4MIMA 5M5XJ 5EG0A 3JRGA 5IYDJ 1ZKGA 1MBGA 4IHWA 5EDNA 2ZCNA 3ZQHA 5J1YA 2YS9A 3BQYA 1W0UA 2OF7A 1WCMJ 3JRCA 2NVQJ 1LE8B 1U9OA 4JX4A 2LKXA 1T56A 1UHSA 3GTKJ 5FKNA 4MK6A 2CU7A 2OERA 2WUIA 2DA7A 4LOCA 1Z77A 2ELKA 3WHBA 5E3LA 3LSPA 2NX4A 5CXIA 1JT6A 3E7LA 4A3KJ 2N8GA 2QF7A 3G1OA 2MSYA 4A3GJ 3V6GA 3GTJJ 5E3OA 3BHQA 3O60A 3JRDA 3GEUA 2I10A 2ECBA 1H88C 1IG7A 4EEFG 3GZIA 1ETYA 2HQ5A 3VVZA 2ME0A 3D1NI 2FBQA 4KWAA 3NRGA 4UDSA 4HKUA 3RH2A 2IEKA 3NAUA 3Q0VA 2K9SA 2JMWA 3VPRA 3HKZN 3KZ9A 2VUMJ 4A3JJ 4IHXA 2LP0A 2Y9YA 3PO2J 1MNMC 3ZQCA 1K83J 1XG1A 1DU0A 3W6VA 2NVTJ 3O8HA 2DG8A 3OIOA 2CQXA 4C3JJ 1ZR2A 2QOPA 2ID6A 5EG0B 2JK3A 4W97A 5FGLA 2R92J 1HCRA 1ENHA 2MGQA 3VIBA 1D5YA 1ETQA 2NS8A 2Y2ZA 1A5JA 3VVYA 2NP3A 2WV1A 2G7GA 4FE4A 2DTZA 2W53A 5BNGA 1P7JA 1MBEA 3OSGA 2XPWA 3S15J 4NDLA 1ETKA 2DA1A 3FIWA 1IRZA 3BR0A 3PASA 3FK6A 2X9DA 3BR3A 1GV2A 4A69C 3HOWJ 1JKRC 1IDZA 5GP9A 2YVHA 3KNWA 3HE0A 5E3NA 1IDYA 2IAIA 1F43A 3HBLA 2L0KA 4QIWN 4XICA 1X2MA 3OOUA 2XRLA 1Y1VJ 2GENA 5HODA 4DYRA 5IP9J 2Y30A 3BCGA 2CQQA 1GVDA 3GTPJ 3PM1A 1QPIA 2GLOA 3VW0A 2B63J 2UXPA 5EF6A 2QIBA 3HOYJ 2ECCA 4GCKA 3S2HJ 2P81A 1G2HA 3MN2A 1X2NA 5FHPA 4BKXA 2YU9J 3CRJA 1ZGWA 2Y31A 3BR2A 4X6AJ 2FX0A 5FMPA 1TWAJ 1K61A 2L7MP 1JUMA 3ZQFA 3DEWA 3LSRA 4JX5A 1IUFA 3VOKA 1ORKA 3EGQA 4ICHA 5FKMA 1OCTC 2FD5A 2VPRA 2CJJA 3TP3A 2CRGA 5M3MJ 3I4NJ 3LSGA 1B72A 2M8GX 3RD3A 2NP5A 3P9TA 2QCOA 5K7ZA 1AKHA 2G7LA 4A3LJ 2X6OA 5JLWA 2R0QC 3QPSA 5F0HA 3HIMA 1I50J 2HDDA 1RPWA 3S1NJ 4CYCA 2LLKA 2TRTA 4UUTA 3ON4A 1MSFC 2R5YA 3BTLA 1FEXA 4M3GA 4NELA 2GM4A 2DMQA 2R93J 1EF4A 3GTMJ 3NPIA 2NS7A 4MFEA 5IYCJ 3MNLA 3F0CA 5FKKA 2GUHA 2GBYA 2HI3A 1ZQ3P 1XC5A 5IYBJ 5E3MA 2MW8A 2R7ZJ 4L5EA 3NARA 3BTJA 5IOYA 3MVPA 2GFNA 3SDGA 2EQRA 2DMUA 3IH2A 3S1MJ 2LTPA 3VW1A 2EZHA 5F08A 1MBFA 1NK3P 1NK2P 4JL3A 4BBRJ 3QQAA 4X1EA 4M3BA 3BNIA 4DZJA 4JNNA 4A3FJ 3O8GA 3VW2A 1FIPA 2TCTA 4JX6A 3JR9A 2X48A 1HOMA 5D18A 2ZOZA 3ZOBA 2M2EA 2F07A 3COLA 3G1LA 3HOVJ 2E19A 2HXIA 1GUUA 2ZB9A 3LNQA 2ZCXA 1HLVA 3DCFA 3LOCA 2IU5A 3BT9A 2EZLA 2VI6A 1R9TJ 1SFOJ 2K40A 2COBA 1AKHB 3T6NA 3HB9A 4RDUA 3L1PA 1JGGA 1YRNB 2DA3A 1UI6A 3HM5A 5CXGA 2QWTA 1BJZA 1I3QJ 5C3EJ 1OFCX 2HYTA 3BR6A 4UUSA 4FISA 4FCYA 4CYCB 3K7AJ 2M0CA 2WGBA 2DG7A 2JA5J 2VKVA 4A3IJ 4A93J 2QKOA 2R5ZB 2ME6A 3CDLA 4S0HB 1B8IB 3KKCA 2L7FP 3BQZA 5GPAA 1MBKA 2WB1N 5FLVA 1U9NA 1FTTA 3JSJA 3A01A 3ANPA 3CMYA 4QTRA 3HTAA 1HDDC 1QVTA 1QRYA 3GTQJ 2YUSA 2EZIA 3G7RA 2JA8J 2K9NA 1JKQC 3QBMA 3G1MA 5EZGA 3ZQGA 1MBHA 1UI5A 1NTCA 5H9TA 3FRQA 2AHQA 4IEJA 1LFUP 3HTHA 3IH4A 1HF0A 2L7ZA 4JKZA 3ZQIA 3B81A 1T33A 2E2HJ 3S1QJ 5J3LA 3S14J 4JYKA 3B6AA 2V57A 3MKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRH A;  4BXX J;  1H89 C;  4NN1 A;  3H0G J;  5FJ8 J;  5C4X J;  1JJ6 C;  4UUS B;  5F0F A;  3CQZ J;  1UMQ A;  2HXO A;  3BJB A;  3S2D J;  1BA5 A;  1SGM A;  4D5F A;  3CCY A;  2HYJ A;  3V78 A;  3ZQL A;  1PUF A;  4XK4 A;  1VFC A;  4Y7N J;  1CQT A;  4JP0 A;  5EGO A;  1RES A;  4V2F A;  3JRI A;  3S16 J;  2ZCM A;  1MH3 A;  3BTC A;  2JJ7 A;  1Q1V A;  2DN0 A;  5J1R A;  4A3M J;  2D6Y A;  2O7T A;  1Y1W J;  1P7I A;  1X58 A;  4DW6 A;  4A3C J;  4D7N A;  4GFB A;  5AQC A;  1WH7 A;  1GDT A;  1APL C;  4BY1 J;  2FJ1 A;  4GFL A;  5C4Y A;  1GV5 A;  2LR8 A;  4AC0 A;  4AC6 A;  2JWT A;  4D5C A;  2XGC A;  1LE8 A;  1IJW C;  2XPV A;  1JJ8 C;  2HOS A;  3AQS A;  3HOZ J;  3PO3 J;  2H1K A;  2ZOY A;  1BW6 A;  3M3Y J;  4BY7 J;  1O4X A;  2XGE A;  4GFK A;  1F36 A;  5HSZ A;  5M5Y J;  4J19 A;  4FE7 A;  1H8A C;  5IP7 J;  5IOZ A;  4FTH A;  3K2A A;  2XDN A;  4RBO A;  4YZE A;  5JLX A;  3S5R A;  2HKU A;  3NI7 A;  1VI0 A;  4AYB N;  5C4J J;  1A6I A;  5J1U A;  2JN6 A;  2EZK A;  3JRA A;  1RR7 A;  4ME9 A;  1JTX A;  2LVS A;  4XID A;  3Q0W A;  2HOT A;  2Y9Z A;  5K58 A;  1BL0 A;  2EH3 A;  1RET A;  4I6Z A;  9ANT A;  3A02 A;  3BG5 A;  2QTQ A;  3VOX A;  4A3E J;  3S1R J;  3Q0U A;  1E3O C;  2RAS A;  5FLM J;  3AQT A;  1OCP A;  2NVY J;  3JRE A;  3JRF A;  2JA7 J;  2DMT A;  5M5W J;  1RKT A;  1WPK A;  1JKO C;  3RZO J;  5HBU A;  4GCL A;  2O9L A;  1MBJ A;  3JRB A;  2XPU A;  1FIA A;  1JT0 A;  4I76 A;  3HDD A;  1B72 B;  5FKO A;  5DS9 A;  2O8K A;  4M6V A;  3RQI A;  1XS9 A;  1MH4 A;  3EUP A;  2DMN A;  2E1O A;  3LSJ A;  3TED A;  1POG A;  4HNV A;  1WI3 A;  3FIS A;  3FK7 A;  5DAJ A;  1LFB A;  2DMP A;  1JKP C;  1JUP A;  2XB0 X;  2XGD A;  1ZTR A;  3OSF A;  2UXU A;  4IHV A;  2WAQ N;  4XRS A;  2NOG A;  3Q3S A;  3QPL A;  2DJN A;  2LFB A;  3HTI A;  1I6H J;  1SAN A;  4DYC A;  3M4O J;  2R5Y B;  3B6C A;  1ETX A;  2MG4 A;  3WHC A;  5EFY A;  5HAW A;  1TWG J;  2G3B A;  4B1R A;  1WH5 A;  5C44 J;  2ID3 A;  1TWF J;  2KDZ A;  5EEA A;  5K7F A;  1DU6 A;  1ETO A;  2Q24 A;  3HEF A;  4C3H J;  3GBG A;  2W48 A;  4BBS J;  3RZD J;  1ZR4 A;  3S17 J;  3LWJ A;  4B4C A;  3ANG A;  2E2I J;  5EYR A;  5IP6 A;  4ACI A;  3GTL J;  4PXI A;  3KKD A;  3GTO J;  3CWR A;  1Z0X A;  3BG3 A;  2PZ9 A;  3VP5 A;  4AUX A;  1MSE C;  2K9Q A;  3C2B A;  1S7E A;  2YVE A;  5EZH A;  3DPJ A;  2M34 A;  2PMZ N;  2L9R A;  2REK A;  4MFD A;  3VUQ A;  3UKG A;  1GT0 C;  5CW8 A;  4GCT A;  1JTY A;  2EBI A;  2NVX J;  4MLO A;  1IV6 A;  3HTJ A;  3HOU J;  5GPC A;  4W1U A;  3SFI A;  1ETV A;  1BW5 A;  3CJD A;  2DA2 A;  2RAE A;  2JA6 J;  1OJL A;  3HGG A;  5K7H A;  2CUE A;  2KT0 A;  5F27 A;  2UXI A;  4D7M A;  2LK2 A;  2RHA A;  2FQ4 A;  3GTG J;  3TW6 A;  1W0T A;  2G0E A;  1VND A;  3BTI A;  1IGN A;  3E7Q A;  3TP0 A;  2H8R A;  1ZK8 A;  3LJL A;  2DA4 A;  1FTZ A;  5DTD A;  3F1B A;  3BRU A;  4AF5 A;  2OPT A;  2E2J J;  2O7O A;  3A03 A;  2LY9 A;  3C07 A;  2HOA A;  1HDP A;  1IC8 A;  1ITY A;  2G7S A;  4ABZ A;  3A01 B;  2OI8 A;  1RKW A;  2LD5 A;  3RKQ A;  1U78 A;  3NNR A;  2UXH A;  5D19 A;  3HGY A;  4XRM A;  1TWC J;  1FJL A;  2D5V A;  3FKI J;  4IHY A;  2XB5 A;  3QKX A;  4M3E A;  5F04 A;  3IUV A;  3NXC A;  4CGR A;  4M3D A;  3I4M J;  4V2G A;  3SJM A;  2DA5 A;  5IPA A;  3TW7 A;  4A3B J;  2AO9 A;  4Y52 J;  3LHQ A;  1ETW A;  4XRS G;  1JUS A;  1VF9 A;  4DZP A;  4C2M J;  3VVX A;  3IH3 A;  1TWH J;  1U8B A;  4C3I J;  5M3F J;  5F1J A;  4B3A A;  3PPB A;  2UXO A;  3H3V K;  2Y0S N;  5D1R A;  4DYQ A;  1YRN A;  2CUF A;  2XSD C;  1AU7 A;  5FKL A;  1WGX A;  2DA6 A;  4A3D J;  3BG9 A;  2VKE A;  4MO7 A;  3G56 A;  4G12 A;  5F0C A;  3ON2 A;  4M3F A;  4L62 A;  1TC3 C;  2PBX A;  3IV5 A;  4QSH A;  1AHD P;  2IBD A;  3BR1 A;  1PUF B;  1QVU A;  2M9H A;  2R5Z A;  4MXM A;  3BR5 A;  5EGO B;  3HOX J;  1B8I A;  1UG2 A;  4MIM A;  5M5X J;  5EG0 A;  3JRG A;  5IYD J;  1ZKG A;  1MBG A;  4IHW A;  5EDN A;  2ZCN A;  3ZQH A;  5J1Y A;  2YS9 A;  3BQY A;  1W0U A;  2OF7 A;  1WCM J;  3JRC A;  2NVQ J;  1LE8 B;  1U9O A;  4JX4 A;  2LKX A;  1T56 A;  1UHS A;  3GTK J;  5FKN A;  4MK6 A;  2CU7 A;  2OER A;  2WUI A;  2DA7 A;  4LOC A;  1Z77 A;  2ELK A;  3WHB A;  5E3L A;  3LSP A;  2NX4 A;  5CXI A;  1JT6 A;  3E7L A;  4A3K J;  2N8G A;  2QF7 A;  3G1O A;  2MSY A;  4A3G J;  3V6G A;  3GTJ J;  5E3O A;  3BHQ A;  3O60 A;  3JRD A;  3GEU A;  2I10 A;  2ECB A;  1H88 C;  1IG7 A;  4EEF G;  3GZI A;  1ETY A;  2HQ5 A;  3VVZ A;  2ME0 A;  3D1N I;  2FBQ A;  4KWA A;  3NRG A;  4UDS A;  4HKU A;  3RH2 A;  2IEK A;  3NAU A;  3Q0V A;  2K9S A;  2JMW A;  3VPR A;  3HKZ N;  3KZ9 A;  2VUM J;  4A3J J;  4IHX A;  2LP0 A;  2Y9Y A;  3PO2 J;  1MNM C;  3ZQC A;  1K83 J;  1XG1 A;  1DU0 A;  3W6V A;  2NVT J;  3O8H A;  2DG8 A;  3OIO A;  2CQX A;  4C3J J;  1ZR2 A;  2QOP A;  2ID6 A;  5EG0 B;  2JK3 A;  4W97 A;  5FGL A;  2R92 J;  1HCR A;  1ENH A;  2MGQ A;  3VIB A;  1D5Y A;  1ETQ A;  2NS8 A;  2Y2Z A;  1A5J A;  3VVY A;  2NP3 A;  2WV1 A;  2G7G A;  4FE4 A;  2DTZ A;  2W53 A;  5BNG A;  1P7J A;  1MBE A;  3OSG A;  2XPW A;  3S15 J;  4NDL A;  1ETK A;  2DA1 A;  3FIW A;  1IRZ A;  3BR0 A;  3PAS A;  3FK6 A;  2X9D A;  3BR3 A;  1GV2 A;  4A69 C;  3HOW J;  1JKR C;  1IDZ A;  5GP9 A;  2YVH A;  3KNW A;  3HE0 A;  5E3N A;  1IDY A;  2IAI A;  1F43 A;  3HBL A;  2L0K A;  4QIW N;  4XIC A;  1X2M A;  3OOU A;  2XRL A;  1Y1V J;  2GEN A;  5HOD A;  4DYR A;  5IP9 J;  2Y30 A;  3BCG A;  2CQQ A;  1GVD A;  3GTP J;  3PM1 A;  1QPI A;  2GLO A;  3VW0 A;  2B63 J;  2UXP A;  5EF6 A;  2QIB A;  3HOY J;  2ECC A;  4GCK A;  3S2H J;  2P81 A;  1G2H A;  3MN2 A;  1X2N A;  5FHP A;  4BKX A;  2YU9 J;  3CRJ A;  1ZGW A;  2Y31 A;  3BR2 A;  4X6A J;  2FX0 A;  5FMP A;  1TWA J;  1K61 A;  2L7M P;  1JUM A;  3ZQF A;  3DEW A;  3LSR A;  4JX5 A;  1IUF A;  3VOK A;  1ORK A;  3EGQ A;  4ICH A;  5FKM A;  1OCT C;  2FD5 A;  2VPR A;  2CJJ A;  3TP3 A;  2CRG A;  5M3M J;  3I4N J;  3LSG A;  1B72 A;  2M8G X;  3RD3 A;  2NP5 A;  3P9T A;  2QCO A;  5K7Z A;  1AKH A;  2G7L A;  4A3L J;  2X6O A;  5JLW A;  2R0Q C;  3QPS A;  5F0H A;  3HIM A;  1I50 J;  2HDD A;  1RPW A;  3S1N J;  4CYC A;  2LLK A;  2TRT A;  4UUT A;  3ON4 A;  1MSF C;  2R5Y A;  3BTL A;  1FEX A;  4M3G A;  4NEL A;  2GM4 A;  2DMQ A;  2R93 J;  1EF4 A;  3GTM J;  3NPI A;  2NS7 A;  4MFE A;  5IYC J;  3MNL A;  3F0C A;  5FKK A;  2GUH A;  2GBY A;  2HI3 A;  1ZQ3 P;  1XC5 A;  5IYB J;  5E3M A;  2MW8 A;  2R7Z J;  4L5E A;  3NAR A;  3BTJ A;  5IOY A;  3MVP A;  2GFN A;  3SDG A;  2EQR A;  2DMU A;  3IH2 A;  3S1M J;  2LTP A;  3VW1 A;  2EZH A;  5F08 A;  1MBF A;  1NK3 P;  1NK2 P;  4JL3 A;  4BBR J;  3QQA A;  4X1E A;  4M3B A;  3BNI A;  4DZJ A;  4JNN A;  4A3F J;  3O8G A;  3VW2 A;  1FIP A;  2TCT A;  4JX6 A;  3JR9 A;  2X48 A;  1HOM A;  5D18 A;  2ZOZ A;  3ZOB A;  2M2E A;  2F07 A;  3COL A;  3G1L A;  3HOV J;  2E19 A;  2HXI A;  1GUU A;  2ZB9 A;  3LNQ A;  2ZCX A;  1HLV A;  3DCF A;  3LOC A;  2IU5 A;  3BT9 A;  2EZL A;  2VI6 A;  1R9T J;  1SFO J;  2K40 A;  2COB A;  1AKH B;  3T6N A;  3HB9 A;  4RDU A;  3L1P A;  1JGG A;  1YRN B;  2DA3 A;  1UI6 A;  3HM5 A;  5CXG A;  2QWT A;  1BJZ A;  1I3Q J;  5C3E J;  1OFC X;  2HYT A;  3BR6 A;  4UUS A;  4FIS A;  4FCY A;  4CYC B;  3K7A J;  2M0C A;  2WGB A;  2DG7 A;  2JA5 J;  2VKV A;  4A3I J;  4A93 J;  2QKO A;  2R5Z B;  2ME6 A;  3CDL A;  4S0H B;  1B8I B;  3KKC A;  2L7F P;  3BQZ A;  5GPA A;  1MBK A;  2WB1 N;  5FLV A;  1U9N A;  1FTT A;  3JSJ A;  3A01 A;  3ANP A;  3CMY A;  4QTR A;  3HTA A;  1HDD C;  1QVT A;  1QRY A;  3GTQ J;  2YUS A;  2EZI A;  3G7R A;  2JA8 J;  2K9N A;  1JKQ C;  3QBM A;  3G1M A;  5EZG A;  3ZQG A;  1MBH A;  1UI5 A;  1NTC A;  5H9T A;  3FRQ A;  2AHQ A;  4IEJ A;  1LFU P;  3HTH A;  3IH4 A;  1HF0 A;  2L7Z A;  4JKZ A;  3ZQI A;  3B81 A;  1T33 A;  2E2H J;  3S1Q J;  5J3L A;  3S14 J;  4JYK A;  3B6A A;  2V57 A;  3MKL A; 
#chains in the Genus database with same CATH topology
 3JRH A;  3IKV A;  5K1Y A;  5H6R A;  5FJ8 J;  3ABM H;  5C4X J;  3HOT A;  4XOT A;  4UUS B;  1XDU A;  2QVO A;  4OMY A;  4HX7 A;  2MLG A;  3ABT A;  3CTA A;  2M5W A;  3MWM A;  2RKH A;  3ZQL A;  3GEZ A;  3CP2 A;  1PUF A;  4XK4 A;  1VFC A;  1FSH A;  3KLO A;  4BGD A;  1RES A;  1DDN A;  5L3G A;  5ED4 A;  1MH3 A;  2JJ7 A;  4XOP A;  2DN0 A;  2R7W A;  4A3M J;  2D6Y A;  2FRH A;  3ABK H;  1KQ9 A;  4GFB A;  1WH7 A;  2OTJ I;  4E7Z A;  4GFL A;  3IHU A;  4B47 A;  2PQ8 A;  4XKW A;  2JWT A;  4JOM A;  2DTR A;  1IO2 A;  1T6S A;  3RKY A;  3EYI A;  1LE8 A;  2IGK A;  3R61 A;  1E3P A;  2VN2 A;  2NOJ B;  1RR8 C;  3ERM A;  1BW6 A;  2QA4 I;  2P8T A;  4ZTF A;  3M3Y J;  3CME I;  1ERD A;  2XGE A;  4GFK A;  5HSZ A;  5M5Y J;  2CW0 F;  3HRU A;  3B73 A;  5LD2 C;  3M7G A;  4FTH A;  3H9Q A;  4NB5 A;  2HKU A;  3TQN A;  4BUP A;  3NI7 A;  1SVM A;  5DCF A;  5C4J J;  1J59 A;  2DFE A;  1X3W B;  2EZK A;  5K5Q A;  3PNV A;  1J09 A;  3DFG A;  4XID A;  3HRT A;  2Y9Z A;  5EEH A;  1Z6T A;  1ZEL A;  1RET A;  2O8X A;  1JHF A;  2HZD A;  3BG5 A;  1IRF A;  2RAS A;  3OMY A;  3PIO F;  2HQR A;  3AQT A;  1EKE A;  2JA7 J;  1X1A A;  1VQ7 I;  1TT5 B;  3H92 A;  3QYF A;  1JKO C;  1EJ9 A;  5LLQ A;  2YX4 A;  3RZO J;  4A12 A;  2QQ9 A;  4GCL A;  2XPU A;  1FIA A;  1SD5 A;  2V26 A;  2DCE A;  1UB9 A;  3V7C A;  1B72 B;  4UB6 C;  4OD5 A;  4EJW A;  5DDG A;  1LB2 A;  2VJ4 A;  3FIS A;  5DAJ A;  3W6K B;  1Z05 A;  4G7O F;  4IHV A;  2WAQ N;  2OUM A;  3Q3S A;  2VQG A;  2M30 A;  1I6H J;  3OS0 A;  5HAW A;  3WHC A;  3KP2 A;  3A4C A;  2QLZ A;  1YW9 A;  1ZRC A;  4KA4 A;  1D0Y A;  1ETO A;  2Q24 A;  4DJA A;  1R4N B;  1YX3 A;  2ZCW A;  3HEF A;  4RGX A;  2R7U A;  1YFH A;  3GBG A;  4N4O B;  4BBS J;  2XV4 S;  5A2Q Z;  3LWJ A;  4NQW B;  1X3U A;  4IQ4 A;  2E2I J;  3ANG A;  2E1N A;  4PXI A;  3CUO A;  3CWR A;  2HWV A;  1BOA A;  3DLA A;  3CP8 A;  1Z0X A;  3RJP A;  3F6O A;  3BG3 A;  3RIR A;  3TBI A;  3VP5 A;  1MSE C;  2K9Q A;  3DWL E;  4PZJ A;  1S7E A;  3DPJ A;  3U1D A;  2ACJ A;  2VPL A;  5HLG A;  1Z7L A;  4LG3 A;  1O3R A;  3UKG A;  1WJ5 A;  3J7Z I;  4ESJ A;  2QZ8 A;  2VB6 A;  3P9K A;  2NVX J;  1R1V A;  3F22 A;  3GFL A;  4O3M A;  1OYW A;  4G6D A;  5GPC A;  1TQM A;  3FXO A;  2K85 A;  3U21 A;  2ZSI B;  5CKT A;  3CJD A;  4GXO A;  4IRV A;  2RAE A;  1O3Q A;  3S3O A;  4ANJ A;  5F27 A;  3WTU C;  3T8T A;  2UXI A;  5L3B A;  2QEX I;  2BVM A;  2FQ4 A;  3GTG J;  1V55 H;  5FO5 A;  3TW6 A;  2G0E A;  4H4K C;  3RKW A;  4PJM A;  4ZYD A;  2VT3 A;  5E1W A;  5F1R A;  1IGN A;  4KFC A;  1S3J A;  3E7Q A;  2A68 F;  5E8G A;  1U5T C;  1BR1 A;  1RIO H;  1LQ1 A;  1K79 A;  2WA0 A;  5KK1 A;  5DTD A;  5KCM A;  1FTZ A;  3VEP A;  2YSR A;  2OPT A;  3NWT A;  3AKZ A;  2HOA A;  4U0W A;  5KAF C;  3U2R A;  1QA6 A;  2Z3Y A;  5BQT A;  3CJT B;  3RYP A;  4ABZ A;  1TNT A;  3QPT A;  3BJ6 A;  4U88 A;  3BLY A;  2LD5 A;  1UFM A;  2HS5 A;  4N0B A;  1FJL A;  1W4M A;  3FWE A;  4HBL A;  2UXX A;  1U2W A;  2R7R A;  4M3E A;  3MFK A;  2I8D A;  3JCU C;  3GCM A;  3R60 A;  1YJW I;  4HF1 A;  5CVU A;  2UUZ A;  3AG1 H;  2H94 A;  1H9G A;  4BE1 A;  1WHU A;  4ENJ A;  4CDG A;  3LHQ A;  1VF9 A;  2QKL B;  4C2M J;  4P5O A;  2P7C B;  2JRT A;  2L54 A;  2ZSH B;  2VON A;  4EJV A;  1OR7 C;  4R8H A;  1SFE A;  3DEE A;  1R6R A;  2UXO A;  2A07 F;  3PPB A;  3RTR A;  2BZT A;  2Y0S N;  2D1H A;  1R4M B;  4DYQ A;  2E5Z A;  3CLO A;  2HVR A;  5E17 F;  2DT5 A;  2VKE A;  4PJ0 C;  2WTE A;  4BHP A;  2E34 A;  3G56 A;  2ELH A;  3K70 C;  5FRO A;  3S93 A;  4BYY A;  3BR1 A;  2HNH A;  1QVU A;  4A5N A;  2M9H A;  3F9K A;  3HC7 A;  3E6B A;  4ENK A;  3PSI A;  1R58 A;  5L3E A;  1TL8 A;  3CJN A;  5EDN A;  2ZCN A;  4TV7 A;  2V1X A;  3ZQH A;  2FNP A;  3CC2 I;  2LY1 A;  2YS9 A;  4E70 A;  1VTN C;  4BAY A;  3IAS 2;  3OYH A;  3OYE A;  1QQI A;  1D5V A;  4JX4 A;  2LKX A;  3GTK J;  5FKN A;  1SVO A;  1B1B A;  5F64 A;  3CLQ A;  3OYK A;  2A6E F;  1Z77 A;  4XKC A;  4E6K G;  3D5S C;  4UVB A;  3WHB A;  2NX4 A;  5CXI A;  2CS3 A;  2N8G A;  3G1O A;  2X6W A;  1MGT A;  5E3O A;  3GTJ J;  3ZXS A;  5HNH A;  3GEU A;  3FDY A;  2ECB A;  2VLA A;  1GHC A;  1VQL I;  1IG7 A;  1PDN C;  5FD5 A;  3GZI A;  1ETY A;  3HIF A;  3K1N A;  5L3C A;  3GYH X;  2A5Y B;  2FBQ A;  2OJE D;  3L2Q A;  3RH2 A;  3Q0V A;  1ZLJ A;  3NAU A;  5ICC A;  3HKZ N;  1QHH D;  3KZ9 A;  4BQO A;  1BN5 A;  3G73 A;  4I0B A;  2QQA A;  1W36 D;  2A61 A;  2K9L A;  3N97 A;  4C3J J;  2GZW A;  3HG9 A;  4OIR F;  3CD6 I;  5FGL A;  1DGW Y;  4BAC A;  3IAM 2;  2X51 A;  3E0J B;  2IXS A;  3LA3 A;  4KYW A;  1YIJ I;  3HHH A;  1LFP A;  1D5Y A;  1QPM A;  3K1P A;  3BG6 A;  2XVC A;  4Q48 A;  3K4L A;  5TJJ A;  2QM3 A;  3F72 A;  5BNG A;  2OA4 A;  4NDL A;  1ETK A;  2ZNY A;  1QZY A;  2X9D A;  2LF7 A;  3KEY A;  4LIU A;  4WXC A;  1IDZ A;  1NG7 A;  3KNW A;  2E35 A;  1MMN A;  2L0K A;  2H1L A;  4BEH A;  4QIW N;  4XIC A;  4GYI A;  2AXT C;  1FC3 A;  1X2M A;  3OOU A;  4L5I A;  4KDP A;  4ASN A;  1Y1V J;  4JQF A;  5IT9 K;  3TOA A;  2X1D A;  1HKQ A;  5HDK A;  4C2U A;  5FRN A;  1OCZ H;  2DU9 A;  2ESN A;  3G3Z A;  1DP3 A;  1HXD A;  1GVD A;  1V5G A;  3PM1 A;  2GLO A;  3QYB A;  5EF6 A;  3WU1 B;  3HOY J;  4YIR X;  5J8F A;  3S2H J;  1G2H A;  5DM6 F;  1G59 A;  2LH9 A;  4ITV A;  3MN2 A;  5HNF A;  2MLK A;  2YU9 J;  3FX3 A;  2P5L C;  1ZGW A;  3CCV I;  1VQP I;  3PSF A;  2LOO A;  1TWA J;  2EIN H;  2HYF A;  5CPR B;  4C2T A;  2L7M P;  3ZQF A;  1OKR A;  1R1T A;  3LSR A;  1IUF A;  4FAS D;  3BC8 A;  2DAO A;  2MFZ A;  1TW2 A;  2LBF B;  2VKD A;  1P4X A;  3QRF F;  4HQM A;  4ZC3 A;  2CRG A;  3LSG A;  3GFI A;  2VJI A;  2EB7 A;  3CUQ A;  4XL9 A;  2W25 A;  3NEU A;  1AKH A;  1TW3 A;  2Y0M A;  2Y75 A;  1RI7 A;  2NXN B;  4G94 A;  1RPW A;  3O2P E;  1ZG1 A;  3S1N J;  1LVK A;  4ZDL A;  3CF2 A;  5J47 A;  3SZT A;  3ON4 A;  2TRT A;  2MC3 A;  4UUT A;  3K4M A;  1UG0 A;  2NVU B;  3KYL A;  1T0F A;  2UWM A;  3BTL A;  4IRG A;  1R00 A;  4OOI A;  5H20 A;  1FEX A;  4NEL A;  2GM4 A;  3GTM J;  3RKX A;  2ELJ A;  3MNL A;  2STT A;  2GBY A;  2HI3 A;  1ZQ3 P;  5IYB J;  1UEL B;  1XCB A;  4RM2 A;  4HRI A;  4MHG A;  4L5E A;  4XSX F;  4S05 A;  3MZY A;  2GFN A;  3SDG A;  1HC8 A;  2Z16 A;  4JL3 A;  3VW1 A;  3I53 A;  1MBF A;  4BBR J;  1S9H A;  1ZLK A;  2JSP A;  1PP7 U;  5CJ9 A;  3HSR A;  2XAQ A;  2GIZ A;  2HPM A;  3BNI A;  4DZJ A;  4WX9 A;  3GFJ A;  5D8K B;  1FIP A;  4IOC F;  4JX6 A;  4OAZ A;  4O5V A;  4XLP F;  3JR9 A;  2BHY A;  2X48 A;  4RAF A;  1MDM A;  3CJR B;  3COL A;  2XF7 A;  4Y13 A;  3VOE A;  1D1B A;  2ZCX A;  3C2G A;  4D0P A;  3LOC A;  2CFX A;  2OU2 A;  4GDF A;  1W5C C;  1R9T J;  3ZMS A;  2VOD A;  2DFH A;  1F5T A;  2K4J A;  3DBL B;  3O6B B;  1Y8Q B;  3HB9 A;  1XD7 A;  5GTH C;  3HM5 A;  3WTZ A;  1A31 A;  3FHN A;  2QWT A;  2HYT A;  1Q1H A;  2I5U A;  3V42 A;  3K7A J;  3ZQ7 A;  4CYC B;  2WGB A;  2DG7 A;  3V7R A;  1P2F A;  2JA5 J;  2HDC A;  4B09 A;  4RAZ A;  2ME6 A;  3E6C C;  1B8I B;  1Y56 A;  2JPB A;  3KKC A;  2L7F P;  3NWS A;  3C1D A;  2V1D A;  3BQZ A;  3FMQ A;  4UY8 I;  2O6G E;  3CMM A;  3OYG A;  4K2E A;  3A01 A;  3CMY A;  4BQA A;  3FBN B;  4QTR A;  4AYB A;  1QRY A;  3G7R A;  4CIC A;  2EZI A;  4RB2 C;  2JA8 J;  2A5W A;  1JKQ C;  1J75 A;  4WCG A;  3FMR A;  2HDW A;  5ICG A;  2EWN A;  1VQM I;  1WJE A;  1MBH A;  1UI5 A;  3OL3 A;  2TDX A;  5H9T A;  5ILS A;  1W5T A;  1LFU P;  3HTH A;  3IH4 A;  2JRM A;  2IGN A;  3NRV A;  1SAX A;  3B81 A;  3S1Q J;  2HKX A;  2X1E A;  5J3L A;  3K9T A;  2VL8 A;  4KN7 X;  1T38 A;  5GTI C;  3MKL A;  4D9J A;  4BXX J;  1H89 C;  4NN1 A;  3H0G J;  3CCU I;  2BW3 B;  1MND A;  2JZY A;  3DTE A;  2IA0 A;  3E3V A;  4XMY A;  5F0F A;  1FBU A;  1XCV A;  1GXQ A;  1UMQ A;  3S2D J;  1SGM A;  4D5F A;  4UUV A;  1ODD A;  3WTY C;  1TLH B;  3V78 A;  3QYE A;  1SFU A;  1YOV B;  3PNY A;  4HDV A;  4BQN A;  2DQL A;  3MEX A;  1JHH A;  4Y7N J;  4BL0 B;  4XLF A;  2JT1 A;  1XDS A;  2KDO A;  4Y17 A;  4JP0 A;  4EJO A;  1CQT A;  3VOD A;  2LG4 A;  2HR3 A;  3BY6 A;  3TO9 A;  4Z2Y A;  3S3M A;  1X58 A;  2K3F A;  4D7N A;  2EK5 A;  1OLT A;  5B3S H;  5IT9 Z;  2Z9O A;  5AQC A;  4BY1 J;  1EV7 A;  5C4Y A;  4MTD A;  2L01 A;  1D0X A;  1P4W A;  2LR8 A;  4AC0 A;  4AC6 A;  2DOE A;  1IJW C;  1ACI A;  2XAG A;  2HOS A;  2XUB A;  3AFH A;  2GXB A;  4WXH A;  2Q2E A;  3KIO A;  1F36 A;  4ESF A;  4J19 A;  4YRV A;  5J40 A;  5IOZ A;  5BPI A;  2LF8 A;  3QU6 A;  2V6C A;  1KZH A;  4YZE A;  2EPF A;  3DF8 A;  3AG2 H;  3BOQ A;  1IRG A;  1VI0 A;  2DDB A;  1E2X A;  3DXJ F;  5TIS C;  5J1U A;  4BHB A;  2W4S A;  3GO5 A;  3JRA A;  2IW5 A;  2JUC A;  3WTV C;  4MEY F;  2IA2 A;  2LVS A;  2XRO A;  1Z21 A;  3F8F A;  2HOE A;  2EH3 A;  4LIV A;  2D45 A;  2M87 A;  2R7F A;  3TDU C;  5D5X B;  4BNC A;  2FBK A;  3LWF A;  9ANT A;  3OYL A;  2QTQ A;  3COA C;  3O3K A;  1BI1 A;  3S1R J;  2RNG A;  3K4C A;  3OV8 A;  4DOZ A;  5L3D A;  1FOX A;  1OCP A;  3W6J B;  1EH7 A;  2DMT A;  3LFK A;  3ZN0 A;  1WPK A;  4ZYE A;  3H1C A;  4HEA 2;  1MNE A;  3OIP A;  5HBU A;  3IWF A;  3P9I A;  2HEO A;  3JRB A;  4PGG A;  2OZU A;  2RGV A;  3ASN H;  2WAD A;  3HDD A;  4ZYH A;  2GOM A;  5DS9 A;  1T8I A;  2LKP A;  2QSH X;  1XS9 A;  3EUP A;  2K9M A;  2E1O A;  2GA2 A;  3WTW C;  3TED A;  5E1X A;  1WI3 A;  2DT6 A;  1LFB A;  2M0M A;  5CLS A;  1JUP A;  1E17 A;  1J2X A;  2C6Y A;  4XRS A;  2KZV A;  3HTI A;  2VAS A;  3ISP A;  1K7A A;  2CQK A;  1EA3 A;  3ROU A;  5EFY A;  1TWG J;  4G6Q A;  2G3B A;  4HV6 A;  1LDK B;  3DPT A;  5EEA A;  4KMU X;  5LRS A;  3CMA I;  4Y4R A;  1ON1 A;  3EUK L;  3LMM A;  4CXF A;  3RZD J;  1ZR4 A;  1KU7 A;  3S17 J;  5JR3 A;  1FP1 D;  2ZO4 A;  2RV8 A;  3ELK A;  5DCM B;  1HQC A;  3GTO J;  4IL6 C;  2ADU A;  2R4G A;  2RVC A;  1SFK A;  2P7V B;  6PAX A;  3JSP A;  3SDB A;  2XF6 A;  1XSX A;  4DBR A;  2AXL A;  2E1M C;  2EV0 A;  4CCM A;  5CQE A;  4XR6 A;  2MH9 A;  1HA8 A;  5CW8 A;  1JTY A;  2EBI A;  2FE3 A;  4E7S A;  3CCE I;  2VBZ A;  1YG2 A;  1L3L A;  3HTJ A;  2X85 A;  4W1U A;  1ETV A;  2RNJ A;  1RNL A;  4LG0 A;  2MBF A;  5K5R A;  4A5M A;  1BW5 A;  5TRD A;  3GXO A;  1R23 A;  1WSU A;  2JA6 J;  2PBI A;  3HGG A;  2CUE A;  1ZN2 A;  1Z67 A;  1U0J A;  2W00 A;  5IT3 A;  2ESH A;  4L9J A;  1N25 A;  4EM1 A;  1X3Z B;  4PFO A;  3TP0 A;  2IS2 A;  1W7P B;  4NC6 A;  3LJL A;  2NAZ A;  3W3C A;  3IUO A;  3H36 A;  4HNT A;  2KIU A;  3L2W A;  3FXQ A;  5LGT A;  1KU2 A;  2O7O A;  1VQK I;  2LY9 A;  4YII A;  4HPQ A;  3G4S I;  1IC8 A;  2A69 F;  2ZY9 A;  4UHT A;  2F5E A;  1RKW A;  3RKQ A;  2EFQ A;  3NNR A;  2UXH A;  2VJJ A;  4EV0 A;  4U87 A;  5LHI A;  1S72 I;  3FKI J;  2R7S A;  4B3X A;  2XB5 A;  3QP6 A;  3QKX A;  2DOA A;  5F04 A;  1BIB A;  4HLX A;  1LVA A;  4CGR A;  3MD2 A;  4M3D A;  3I4M J;  3ABU A;  3E5Q A;  4YFK F;  3KYD B;  4OIP F;  4V2G A;  2R7V A;  1R22 A;  4Y52 J;  2GWR A;  2VXD A;  4LFU A;  2OCC H;  1SD7 A;  2BV6 A;  2F6C A;  2ZBK A;  4XRS G;  2KHM A;  2F4I A;  1VQ9 I;  3IH3 A;  1HKT A;  4CH7 A;  1DP7 P;  5F1J A;  2AQF A;  4B3A A;  1MMA A;  2VE8 A;  1FLI A;  2WB1 A;  4E7I A;  5D1R A;  1W5S A;  1Y0U A;  4BS9 A;  1YRN A;  4AM3 A;  5B1A H;  4PFP A;  2XSD C;  1R5H A;  5FKL A;  2WV0 A;  3DU6 A;  4BQQ A;  2XAF A;  2DA6 A;  3BPX A;  4A3D J;  2YR2 A;  1X4P A;  5DV5 A;  3LAJ A;  1FX7 A;  4F55 A;  3ON2 A;  4HV5 A;  4PDK A;  3RQ4 A;  1WKM A;  2PBX A;  2XAU A;  2ZC2 A;  4QSH A;  2QKM B;  2R5Z A;  1BI3 A;  4RA2 A;  1D8K A;  4MXM A;  4XLA A;  1BIA A;  3BR5 A;  3HHG A;  3KP4 A;  5EGO B;  1RUO A;  1UG2 A;  4AIH A;  3TGN A;  5M5X J;  4OD4 A;  2DK5 A;  3JRG A;  5IYD J;  1HW1 A;  2E1M B;  1MBG A;  2K86 A;  3LSK A;  2VXZ A;  1FYK A;  1ZRE A;  1YI2 I;  1Z91 A;  3BQY A;  2BE5 F;  1W0U A;  2OF7 A;  1USS A;  1WCM J;  1UHM A;  2ZNZ A;  1MJA A;  1KGS A;  2NVQ J;  1U9O A;  4QWQ A;  2MD5 A;  4N9I A;  1UHS A;  2VOP A;  2M3A A;  2CU7 A;  2OER A;  1WWX A;  3DTK A;  4YIF A;  1Y6I A;  4HLY A;  3HPH A;  1P92 A;  4BE2 A;  1V5F A;  2FEZ A;  1NH3 A;  1YW7 A;  1JT6 A;  4XSZ F;  1I1G A;  1CF7 A;  3J80 Z;  4A3G J;  1O7F A;  1QGP A;  3V6G A;  1XMA A;  1ON2 A;  3VYR B;  2I10 A;  3UR3 C;  1H88 C;  4LJZ F;  4KMF A;  3S3N A;  4EEF G;  3RPU A;  1Z6R A;  3H3U A;  3PFI A;  3VVZ A;  3H35 A;  4DQ2 A;  1AWC A;  3KCC A;  4HW0 A;  2EIK H;  4KWA A;  4G6T B;  3BCB A;  4HKU A;  4G7H F;  2JMW A;  3WTX C;  2VUM J;  4A3J J;  1OCR H;  3ZQC A;  2EIM H;  2M7A A;  1K83 J;  3W6V A;  4NHJ A;  2KZG A;  1L0O C;  3QWL A;  3BDD A;  3FXR A;  5LHG A;  2QOP A;  1OCO H;  4U0V A;  2JK3 A;  3OYM A;  2XKO A;  4HA8 A;  2R92 J;  3GUD A;  4XM3 A;  1J5Y A;  4IZZ A;  3C3W A;  1XGS A;  4F52 A;  1YE9 A;  1O3S A;  1MZB A;  3VVY A;  4HYE A;  5D4S A;  1YJ9 I;  1BM9 A;  1CGP A;  2W53 A;  2DT7 B;  3OSG A;  1IRZ A;  2W1O A;  3BR3 A;  4A69 C;  1JKR C;  4U9L A;  2LYC A;  2IAI A;  3CUQ C;  1KON A;  1G6N A;  1IXC A;  2XRL A;  1KYW A;  1I39 A;  3NQO A;  5HLI A;  3DP7 A;  2CQQ A;  4BDZ A;  4P9F A;  3EUH A;  4GYG A;  2B63 J;  4A0X A;  2QIB A;  4IKF A;  2QSF X;  4P9U A;  3F8N A;  5LEK A;  3LSH A;  3T1B A;  4EM2 A;  3GZ5 A;  1N75 A;  1T0F C;  3SZP A;  4I98 B;  1QO0 D;  1WJC A;  2IRF G;  5FHP A;  2ETH A;  2Y31 A;  3KE2 A;  3MKY B;  2FUG 2;  2FNA A;  3PUB A;  2RRE A;  3VOK A;  1MMD A;  1MW7 A;  5FKM A;  4A2U A;  1OCT C;  4ICH A;  3LAP A;  2CW7 A;  2GXG A;  3WGG A;  1FPQ A;  3HRM A;  2VPR A;  3K4B A;  1K78 B;  5M3M J;  1IXR C;  4L0Z B;  1B72 A;  2CO5 A;  1U3E M;  2M8G X;  4JBA A;  2PJR A;  4FX4 A;  4B43 A;  1VQ5 I;  1R5G A;  3IKT A;  4KIF A;  1D8J A;  4KT5 C;  1C0W A;  1NHA A;  4ZZD A;  3B02 A;  3QPS A;  5F0H A;  3HIM A;  1I50 J;  4KT6 A;  1T39 A;  2QBY A;  1W1W E;  1PUE E;  2KIQ A;  2UXN A;  4I01 A;  4M3G A;  4BEH B;  2DOD A;  1I3A A;  2BY1 A;  2DMQ A;  2X6X A;  2GXA A;  2PLY A;  2R93 J;  1BI2 A;  2NS7 A;  3F0C A;  4P1W A;  5AIP A;  3QP5 A;  1HW5 A;  5FKK A;  4E4H A;  3I71 A;  2L4M A;  2F4M B;  2GUH A;  1V4R A;  5E3M A;  3FM3 A;  2MW8 A;  1XTA A;  4R1H A;  2KP6 A;  1R5I D;  2IPQ X;  3MVP A;  1IV8 A;  5CVR A;  2DMU A;  3FXJ A;  4RGS A;  2B9S A;  2MAB A;  2Z99 A;  5F08 A;  1NK2 P;  3FXM A;  3BG7 A;  2B0L A;  2L9S A;  3QQA A;  4X1E A;  1FYM A;  5D5U B;  2FMY A;  5B66 C;  2IGM A;  4QPO A;  3O8G A;  4IHS A;  2MD0 A;  3K4N A;  4LLN A;  3DPL C;  2JQ7 A;  2UV1 A;  5B1B H;  3ZOB A;  2RN7 A;  2DW4 A;  4C9Y A;  3KEQ A;  3LNQ A;  1Y0N A;  5HS9 A;  1U5T B;  1ONV A;  2W24 A;  3CUQ B;  4F92 B;  2ICW G;  1Z9C A;  2QQ8 A;  2DI3 A;  1W36 C;  1SFO J;  3FM5 A;  1YYV A;  2COB A;  4E7L A;  4I02 A;  1AKH B;  4GO1 A;  1GLN A;  2KL4 A;  2DA3 A;  4PK4 A;  5GAH J;  5CXG A;  2AS5 F;  1I3Q J;  5C3E J;  2JVG A;  4RB3 C;  1WRJ A;  4FIS A;  2NYX A;  1FP2 A;  5D6F A;  2OD5 A;  4BE0 A;  4E7K A;  4IHT A;  4UV8 A;  2L3D A;  4M9S A;  2A05 A;  2MH2 A;  2VKV A;  3BZC A;  4A3I J;  2QKO A;  3HYI A;  2CFO A;  3GZN B;  4FX0 A;  3CCR I;  4EQQ A;  3L2R A;  4II2 A;  3DLL F;  1NG6 A;  1GXP A;  2DPU A;  1LEB A;  5BPD A;  2V79 A;  4ENM A;  5FLV A;  2DDA A;  4HZF A;  3R6S A;  1FTT A;  2V4J C;  4KIT B;  3JSJ A;  3ANP A;  5IY5 H;  3HTA A;  1QVT A;  2LC2 A;  3EPZ A;  4N4N B;  3GTQ J;  2YUS A;  2O3F A;  3ASO H;  1WFX A;  3OR2 C;  4F7Z A;  3QBM A;  5GAD J;  1T95 A;  5EZG A;  2F5C A;  4MGR A;  3KZZ A;  2L9V A;  4HST A;  2HTS A;  1MDM B;  2VBY A;  3FRQ A;  1SVL A;  4PSX A;  4XON A;  2AHQ A;  4XLN F;  1V3F A;  4U9N A;  5LGU A;  3V8L A;  4A0Y A;  2A3S A;  3HUG A;  2L7Z A;  4DVY P;  3I59 A;  5LEJ A;  4U0Y A;  2ISZ A;  3I54 A;  1T33 A;  5BMZ A;  1S6L A;  4EAT A;  2E2H J;  2GIV A;  5ICE A;  4DGW B;  3S14 J;  2CSO A;  1LKX A;  2V57 A;  1O57 A;  1BBY A;  2E7W A;  3HJE A;  3CQZ J;  1VQ4 I;  3CCY A;  2HYJ A;  1S5L C;  1WVR A;  1ZG3 A;  2DLL A;  3P5J A;  5DUK A;  4UNO A;  5EJC A;  3J7A O;  2LRE A;  4CCN A;  1YS7 A;  1IAW A;  3JRI A;  3S16 J;  3KFW X;  2ZCM A;  3DKY A;  3QPH A;  2GA1 A;  5J1R A;  2QGU A;  4BDY A;  4A3C J;  3QOP A;  1LPQ A;  2JA2 A;  1H9T A;  1GDT A;  2XGX A;  3H5N A;  1XGM A;  4RM3 A;  1APL C;  2CQN A;  2NRA C;  1TT0 A;  3HTS B;  5J8C A;  4D5C A;  2XGC A;  5CVI A;  1PP8 F;  1JJ8 C;  2G7U A;  4IJA A;  1QNT A;  3F6V A;  3FZV A;  4X0G A;  3PO3 J;  1B9M A;  1X1P A;  2KPM A;  4IPA A;  3E5X A;  4RGU A;  2YX7 A;  1H8A C;  4HAM A;  4G7Z F;  2L2O A;  3K2A A;  4RBO A;  2VQC A;  3OYI A;  2P4W A;  1IN6 A;  3ULQ B;  4PUS A;  3MKW B;  4AYB N;  4ZDO A;  1UCR A;  4XN0 A;  1A6I A;  3RYR A;  3FF5 A;  3DBH B;  3FXK A;  2XRN A;  1DUX C;  3AL0 C;  2HOT A;  3K1M A;  2ZME A;  3PQK A;  4CSW A;  4M6X A;  5K58 A;  1HSJ A;  2ZXI A;  1X1D A;  3DKX A;  3A02 A;  2DYS H;  2CMP A;  3DPU A;  4DNC A;  4A3E J;  4IF4 A;  1P6R A;  2NVY J;  3JRE A;  1MMG A;  2QUF A;  1S7A A;  5M5W J;  3GFM A;  1IZ1 A;  3C18 A;  5E18 F;  2O9L A;  3H5R A;  4HX8 A;  2GQQ A;  1JT0 A;  5FKO A;  2HFH A;  3ZN1 A;  4M6V A;  3RQI A;  1MH4 A;  2FSW A;  4AWX B;  1POG A;  3FK7 A;  2X4H A;  4XOR A;  2W7N A;  2XB0 X;  2XGD A;  1SAU A;  2A6H F;  3OSF A;  2UXU A;  2NOG A;  3BCA A;  4EJU A;  4OAY A;  2DJN A;  4LLG F;  1SAN A;  3M07 A;  4NC8 A;  2R5Y B;  3B6C A;  4KIS A;  2MG4 A;  2IP2 A;  2CUJ A;  2L9N A;  4B1R A;  5C44 J;  2KDZ A;  2FQ3 A;  2JPC A;  3MCZ A;  5K7F A;  1TP4 A;  1TQP A;  2KIS A;  3H5A A;  3LQR A;  3M1C A;  3VWB A;  3JW4 A;  1FOY A;  4M73 A;  2WWY A;  3GWZ A;  2BYV E;  2W48 A;  4BU2 A;  3DU5 A;  3UNG C;  4BXU A;  5J4Y A;  4IVN A;  4MEX F;  4Z6Y A;  3ML6 A;  3CC7 I;  5EYR A;  5IP6 A;  3WTS C;  4ACI A;  3GTL J;  2XKP A;  1KQ8 A;  3F8B A;  3KKD A;  3C2H A;  2PZ9 A;  1FWZ A;  3OWT A;  3TKY A;  3L2U A;  2A6T A;  3ZMZ A;  3PUF A;  2VT2 A;  2XAJ A;  3ZMD A;  1K4S A;  2VQL A;  2M34 A;  1BC7 C;  2PMZ N;  2L9R A;  2M4G A;  2ZXW H;  4KIC A;  5FRM A;  3VUQ A;  2LBF A;  1HST A;  1MKM A;  4GCT A;  1E0E A;  3KP3 A;  4YFX F;  4YFN F;  4I2O A;  1IV6 A;  3ESW B;  2E71 A;  3TDZ C;  3ZMV A;  3I0T A;  2DFI A;  2DA2 A;  1OJL A;  5K7H A;  4V19 K;  1BI0 A;  4D7M A;  1IF1 A;  2ZKZ A;  1Z3X A;  2O61 A;  2H8W A;  3EYY A;  2EJR A;  1W0T A;  5HVQ C;  2V9P A;  3M8J A;  3WU2 C;  3G2B A;  2DA4 A;  1I6X A;  4OIQ F;  3F1B A;  4MNU A;  4AF5 A;  2BBY A;  4HX4 A;  2M45 A;  3A03 A;  4GCV A;  2PG4 A;  3C07 A;  4G9Y A;  3SYT A;  5AIQ A;  4ON0 A;  4ZTJ A;  2Z5U A;  4AIJ A;  2G7S A;  2OI8 A;  5B5E C;  2CGP A;  4MQV A;  1U78 A;  3T0Y A;  1FNN A;  5D19 A;  3HGY A;  3SZG A;  1ZG5 A;  1SEU A;  1WI9 A;  2FBH A;  3IUV A;  3NXC A;  3CDI A;  5E20 A;  1FY7 A;  2XC7 A;  2OQG A;  1MMS A;  3N4M A;  5IPA A;  2AO9 A;  2EFP A;  2L5Q A;  3PFY A;  3W2V A;  2B1E A;  3WTT C;  1ETW A;  1YLF A;  1JUS A;  1N78 A;  2BY3 A;  2MA3 A;  3VVX A;  1TWH J;  3GLL A;  1U8B A;  3OR1 C;  5FD6 A;  4C3I J;  5ILU A;  4IQJ A;  3HSF A;  2IGO A;  4LG0 B;  1YQA A;  3H3V K;  5KVR A;  2X0L A;  4CHU A;  2BY0 A;  3KEO A;  2F2E A;  4RB0 A;  1YW8 A;  1LJ9 A;  2CUF A;  1AU7 A;  2EIL H;  4KIB A;  3BG9 A;  4G12 A;  2D2W A;  4M3F A;  4L62 A;  4XLH A;  1TC3 C;  1AHD P;  1PUF B;  1OYY A;  3OYF A;  3DV8 A;  1XMX A;  2CYY A;  2VC0 A;  4Q4Z F;  3HOX J;  1B8I A;  2R7O A;  3E97 A;  4MIM A;  2QQB A;  4LK1 F;  5EG0 A;  2EFN A;  5JHU A;  1ZKG A;  4IHW A;  3OYC A;  3Q9V A;  5J1Y A;  1T2K A;  5FGM A;  4NUB A;  3GZ6 A;  3JRC A;  4CA0 A;  4UVC A;  3D5L A;  5LFA A;  1LE8 B;  2P5K A;  1T56 A;  1J0R A;  4MK6 A;  2LNB A;  3PNT A;  1JE8 A;  3MZ8 A;  2DA7 A;  2ELK A;  5E3L A;  3V8J A;  3DBR B;  1B59 A;  3I56 I;  3F8C A;  5ERI A;  2V1N A;  3E7L A;  3HPG A;  5A2Q K;  3ERE D;  3CF5 F;  4C2M A;  4CYD A;  2MSY A;  4BH9 A;  2GOX B;  5LHH A;  3KP5 A;  1W7P D;  3O60 A;  5JFR A;  3JRD A;  2V1U A;  5FB2 A;  3PJR A;  1LDJ A;  3OYJ A;  4M6Y A;  5HS7 A;  5GAG J;  1FYL A;  3AG3 H;  2ME0 A;  3D1N I;  4UDS A;  2OCE A;  2K9S A;  4N9H A;  4YG2 F;  2DPD A;  1Y39 A;  2LRD A;  2LP0 A;  2Y9Y A;  1SC7 A;  3PO2 J;  4P96 A;  2NVT J;  3O8H A;  2YPR A;  2DG8 A;  5LBQ A;  2CQX A;  3EUH C;  2RQP A;  1VZ0 A;  3N05 A;  5HS8 A;  2ID6 A;  5DD8 A;  4I09 A;  3G71 I;  4EGY A;  4R79 A;  5E8I A;  1ENH A;  4M71 A;  1ETQ A;  2NS8 A;  2PX9 A;  2Y2Z A;  3HXL A;  1A5J A;  5KAI C;  2G7G A;  3ZCO A;  3QAH A;  3TO7 A;  2W85 A;  4FE4 A;  1IW7 F;  2DTZ A;  3NS4 A;  4L9T A;  1MBE A;  5K5O A;  3K6G A;  4S04 A;  4NC7 A;  2F4O B;  3D0S A;  3K0L A;  5H2F C;  3CCL I;  5D4R A;  3BR0 A;  2G7H A;  3FK6 A;  4FHT A;  3HOW J;  5GP9 A;  2XSJ C;  4CCO A;  3LA2 A;  3WG9 A;  4IRI A;  3HE0 A;  3EDP A;  3R0J A;  1F43 A;  3JSO A;  4ZJZ A;  3HBL A;  1GVJ A;  4CCL A;  1YHQ I;  4WIB A;  5FLX K;  5HOD A;  3WOD F;  5IP9 J;  3F23 A;  3GTP J;  1QPI A;  1XMK A;  2W57 A;  3KZY A;  4U7B A;  2YU3 A;  3GF2 A;  2OQR A;  4GCK A;  1IXS B;  2P81 A;  1WQ2 A;  3E6D A;  4A6E A;  3I9V 2;  1X2N A;  5HDG A;  3CRJ A;  3I3L A;  1DQU A;  4EMS A;  3HSE A;  2ZJQ F;  1X19 A;  3IP4 B;  1QBJ A;  2FX0 A;  1VQO I;  5ICF A;  2FJI 1;  1B9N A;  1XGO A;  1JUM A;  2E1C A;  2KQR A;  4JX5 A;  3ZPL A;  1ORK A;  2KMU A;  4CCK A;  2FD5 A;  4ZH4 F;  2H6C A;  2B7E A;  1RUN A;  4OIO F;  3TP3 A;  3J81 K;  1FOW A;  2ISY A;  3BJA A;  1YIT I;  1TNS A;  2HVS A;  3P9T A;  2QCO A;  4QPQ A;  4BJ6 C;  5D6E A;  4F3Q A;  1PVE A;  3E6M A;  2YVX A;  2R3S A;  2BHZ A;  5K7Z A;  2G7L A;  1H0M A;  2EV5 A;  2X6O A;  3CO6 C;  2G9W A;  1UST A;  5D8L B;  2HDD A;  3E5U A;  2R7Q A;  3KPH A;  2GAU A;  3T8R A;  1MSF C;  3A1Y A;  3A2K A;  2NNN A;  2VOO A;  2OV7 A;  1EF4 A;  2VJ5 A;  2COM A;  2JSC A;  2O0Y A;  4MFE A;  3TO6 A;  1ZYR F;  3TOB A;  2Z2S B;  4AVZ A;  2P6T A;  3BJO A;  2J5O A;  1XC5 A;  1K6O A;  4NNJ A;  1ULY A;  4DIQ A;  4AD9 A;  2FOK A;  2R7Z J;  2KRC A;  3KP6 A;  4A0Z A;  5IOY A;  3EUA A;  4CUG A;  4NBQ A;  2EQR A;  3IH2 A;  3LST A;  2LTP A;  2DJI A;  2XAH A;  1I5Z A;  2F5F A;  3H0D A;  1NK3 P;  5AON A;  5DCM A;  2FA5 A;  3SHF A;  4M3B A;  2D1V A;  4PJJ A;  3KX2 A;  2DK8 A;  4JNN A;  1AA7 A;  2TCT A;  3DTI A;  1LEA A;  4Q5S F;  5D18 A;  4CZZ A;  2STW A;  2PI0 A;  4M72 A;  2M2E A;  2F07 A;  3OOP A;  3HOV J;  2HXI A;  1GUU A;  4Y3O A;  4RS8 A;  4RLQ A;  3BT9 A;  2LMD A;  1WJB A;  2EZL A;  3IC7 A;  4IXA A;  2PJR B;  1KU9 A;  2K40 A;  3G6E I;  4IX7 A;  2O03 A;  3T5X A;  4RDU A;  2HGC A;  3L1P A;  3MZH A;  1UI6 A;  1BR4 A;  1OCC H;  1TQI A;  4KJZ A;  3BR6 A;  4O6J A;  4UUS A;  1IRX A;  1WJA A;  1R71 A;  2QBY B;  4FCY A;  5E1Z B;  2X6Y A;  2M0C A;  1K6Y A;  3H9G A;  1W7P A;  2HTJ A;  2WY7 Q;  3S8P A;  4A93 J;  3SEQ A;  1Y8R B;  2HKO A;  2V7F A;  3CDL A;  1QHG A;  4S0H B;  2AQE A;  3DQV C;  1D1C A;  2X1C A;  5GPA A;  3CCJ I;  1U9N A;  3SEZ A;  2E5N A;  1O7L A;  1QU3 A;  4RAG A;  1STZ A;  1HDD C;  3D5R C;  1J7K A;  1TZL A;  4M9X A;  1R7J A;  3BP8 A;  5H6Q A;  1UAA A;  2QSG X;  2IS6 A;  3G1M A;  2JVH A;  3ZQG A;  4PGH A;  4A6D A;  2M7B A;  1M1E B;  2NS0 A;  1NTC A;  3LQQ A;  4RGR A;  2PEX A;  4RAY A;  4CZC A;  4YEJ A;  2IS4 A;  5LRR A;  4CCJ A;  4PSW A;  5E79 C;  3HOS A;  2L4A A;  1REP C;  4JKZ A;  3OY9 A;  2QYO A;  4KIG A;  3ZQI A;  1Z3Y A;  5L3F A;  2WY8 Q;  3LL7 A;  2PMU A;  2EFW A;  3ABL H;  3VB2 A;  3NRG A;  2FML A;  1UZC A;  2BOL A;  1JJ6 C;  1FZP B;  4FET A;  3BJB A;  2HXO A;  5HLH A;  1BA5 A;  5DEQ A;  3L00 A;  2ZXJ A;  3DEU A;  3GX4 X;  3U1K A;  1OMI A;  1HBX G;  5TGT A;  1D1A A;  4IRH A;  2HQN A;  5DUI A;  4UB8 C;  2WAQ A;  2OC6 A;  5JVG F;  4XLC A;  2PFV A;  2CUZ A;  5EGO A;  4P55 A;  2ZME C;  4V2F A;  3REO A;  2ZXH A;  3BTC A;  1Q1V A;  2WC2 A;  2E36 A;  2O7T A;  1Y1W J;  1P7I A;  4DW6 A;  3VSL A;  5KNL A;  3L9F A;  5FLX Z;  2DXI A;  2FJ1 A;  1S7O A;  1O3T A;  1GV5 A;  3I5U A;  1LUJ B;  2K5C A;  4M9Z A;  4ETS A;  2MYS A;  4G8X A;  3EQL F;  2Z1D A;  4YEL A;  4MQ9 F;  3ZP5 A;  2XF5 A;  2XPV A;  3AQS A;  3HOZ J;  3KP7 A;  2H1K A;  2ZOY A;  3CES A;  3V8K A;  4BY7 J;  1HKS A;  1O4X A;  1A04 A;  4FE7 A;  4WF2 A;  3H3Z A;  3SWH A;  5IP7 J;  2IT0 A;  2XDN A;  2XDV A;  3FXL A;  3ZR8 X;  5JLX A;  3HUG B;  1FSE A;  4H0E A;  3EET A;  2EIJ H;  3I59 B;  3S5R A;  3LA7 A;  1R49 A;  4L5J A;  4UVA A;  3BWG A;  2JN6 A;  1RR7 A;  4ME9 A;  4II3 A;  1JTX A;  1ZAO A;  1BJA A;  1EH6 A;  3Q0W A;  4NQW A;  1FMW A;  3J81 Z;  1D0Z A;  2ZJR F;  1BL0 A;  1A36 A;  4ZYA A;  4KNY A;  4I6Z A;  1YJN I;  4OWR B;  1OYI A;  5JI6 A;  3F21 A;  3VOX A;  4AID A;  5D5W B;  3Q0U A;  3RI4 A;  3I55 I;  1E3O C;  5FLM J;  3JRF A;  2EV6 A;  1N77 A;  1RKT A;  4ZDP A;  2P6S A;  4CGZ A;  3K8P C;  2JTV A;  1MBJ A;  1SD4 A;  4I76 A;  2DFF A;  1OQY A;  2J5P A;  2FXA A;  3L09 A;  4L9V A;  2O8K A;  1DGR M;  4B48 A;  4LK0 F;  1XGN A;  1DPU A;  3DKW A;  3A0H C;  3K2Z A;  5BOX A;  2DMN A;  1XN7 A;  3K70 D;  3LSJ A;  3K10 A;  4HNV A;  1R1U A;  4WK8 F;  2DMP A;  1XB4 A;  1JKP C;  2PN6 A;  3CZ6 A;  1ZTR A;  1ZRF A;  3MQ0 A;  2M8E A;  3QPL A;  3U9G A;  2BXY A;  2LFB A;  3WU0 A;  4DYC A;  3M4O J;  4LLL A;  1WJF A;  1ETX A;  4FQG A;  2DBB A;  2ZFW A;  4D1Q A;  1WH5 A;  4ZZL A;  2ID3 A;  1X4O A;  1TWF J;  2UZK A;  1DU6 A;  4HF0 A;  1XSD A;  1XX5 A;  4C3H J;  1LNW A;  1VQN I;  1UJ8 A;  4L18 B;  1OIS A;  4ENN A;  1XSV A;  3VFZ A;  1KYZ A;  2ZME B;  2R7T A;  4B4C A;  1IN5 A;  1X1C A;  2KIM A;  2Q0O A;  2OTL I;  2Y0S A;  4AUX A;  2RQQ A;  2HQA A;  4OU0 A;  3M8F A;  3ZMT A;  3C2B A;  3I4P A;  2YVE A;  1JXS A;  5EZH A;  2K4B A;  4KUM A;  1DPR A;  3BZ6 A;  2KJB A;  3QOE A;  1PJR A;  2REK A;  1QZE A;  4MFD A;  2Y48 A;  3OS2 A;  1GT0 C;  2V6E A;  1SMY F;  3WE3 A;  1K78 A;  2DYR H;  3WGH A;  4MLO A;  4UXN A;  5GAE J;  3HOU J;  3RSN A;  3SFI A;  5CQG A;  1E3H A;  4GRI A;  1P4A A;  4BJT A;  4XKB A;  2V9V A;  2A2F X;  4LMY A;  2KT0 A;  3R0A A;  2LK2 A;  3RDI A;  2RHA A;  3VDX A;  3L7W A;  1VND A;  3BTI A;  2H8R A;  1ZK8 A;  2H6B A;  3GW2 A;  4XQF A;  1LDD A;  4HF2 A;  1ZGA A;  5EEG A;  3BRU A;  2E2J J;  3HZJ A;  4QLC U;  1HDP A;  3X2Q H;  1G3W A;  1ITY A;  5FFZ A;  3GVA A;  3A01 B;  3IRR A;  2P5V A;  5CVJ A;  2O5R A;  1TBX A;  3S32 A;  4XRM A;  1TWC J;  2D5V A;  2CV1 A;  5F6F A;  5CYV A;  3RCO A;  5HLT A;  4IHY A;  3F8M A;  4B44 A;  5D5V B;  1Z1D A;  3IWZ A;  3SJM A;  2FOW A;  4XN3 A;  2DA5 A;  4A3B J;  4LB6 B;  3TW7 A;  3HKZ A;  2RDP A;  4I99 C;  1AOY A;  3VYU B;  2VIX A;  4DZP A;  3FXU A;  1U5T A;  3A0B C;  3KET A;  2F5D A;  5BS6 A;  5M3F J;  2ZJP F;  5J4V A;  2NNY A;  1RZ4 A;  3Q5F A;  3OS1 A;  5HOO A;  3SFZ A;  1WGX A;  2IJL A;  1BOB A;  1A6Q A;  3H9J A;  4AVP A;  3HL2 A;  1MD0 A;  4MO7 A;  2KFD A;  5F0C A;  2E7X A;  3JTH A;  5DM7 F;  3IV5 A;  1F4K A;  2IBD A;  2M1B A;  3OIQ A;  3OYA A;  2H09 A;  2HVQ A;  4KN4 X;  2BGC A;  2IU5 A;  4J01 A;  1J9I A;  4B8X A;  3JAM K;  1YTY A;  2KIF A;  4RMN A;  3J7A Y;  2Z33 A;  1YS6 A;  4EM0 B;  3W2A A;  3CJQ B;  1VQ8 I;  2EA2 A;  3C7J A;  4F93 B;  2VQH A;  1B6A A;  1OR7 A;  3IRQ A;  3OYB A;  2WAF A;  3KLN A;  1F1Z A;  4J00 A;  2WUI A;  2Q2E B;  4LOC A;  1T98 A;  3AAF A;  3CCQ I;  4E7J A;  1YO5 C;  1ZRD A;  5DYM A;  2KJC A;  4XKV A;  2Q1Z B;  3LSP A;  1S29 A;  1IN8 A;  2P0W A;  2VBW A;  4A3K J;  2V9K A;  3QOD A;  3IL2 A;  1ZHF A;  2QF7 A;  4I0A A;  2FBI A;  3V4G A;  3BHQ A;  2E60 A;  4HOB A;  2B3W A;  4FT8 A;  3CC4 I;  1SFX A;  2HQ5 A;  1P9Q C;  3PIP F;  1TTY A;  1IN4 A;  2XAS A;  1RC9 A;  3K4J A;  1EH8 A;  4XNF A;  2IEK A;  1ZGJ A;  2L7K A;  3HRS A;  2VE9 A;  3OYD A;  3VPR A;  1U8R A;  1D3Y A;  3MKZ A;  4IHX A;  3HTU A;  5FFX A;  3M1E A;  2LY2 A;  4HDU A;  1MNM C;  1DU0 A;  1XG1 A;  2OZ6 A;  3OIO A;  1ZR2 A;  4BHC A;  2K27 A;  2KRH A;  3PL8 A;  4Y33 A;  3CDH A;  5EG0 B;  3ZGK A;  2LKS A;  1V54 H;  4W97 A;  3WG7 H;  5JHF A;  1KQ0 A;  1MJ9 A;  3V7S A;  1HCR A;  2MGQ A;  3VIB A;  2LSO A;  3LFU A;  2NP3 A;  2WV1 A;  1HW2 A;  2F5V A;  2QWW A;  4PJL A;  5HDN A;  1QZZ A;  3CCM I;  1P7J A;  2XPW A;  3VYT B;  3AL0 B;  3ZMU A;  2XIG A;  3S15 J;  2DA1 A;  2BVL A;  2KLO A;  2CQ7 A;  3FIW A;  2JUG A;  2XHK A;  5CVV A;  5DD4 A;  1IUY A;  1GV2 A;  3PAS A;  1SD6 A;  1YIO A;  3F3X A;  2YVH A;  1B4A A;  5E3N A;  2M4K A;  1IDY A;  2F48 A;  3SQN A;  2BY2 A;  1ZAR A;  4WXD A;  2GEN A;  4UV9 A;  4DYR A;  1FT9 A;  1X1B A;  2Y30 A;  3K69 A;  3K4K A;  3RPQ A;  3MMY B;  4ESB A;  4E7H A;  3BCG A;  2KKO A;  2VBX A;  4U7D A;  4HSR A;  2FU4 A;  1BC8 C;  2IVM A;  3VW0 A;  2UXP A;  4BXF A;  3FHZ A;  2ECC A;  1G3T A;  3I58 A;  1PYV A;  3P7N A;  4RLF A;  1F9N A;  1A35 A;  5ILV A;  4BKX A;  2KRF A;  3BR2 A;  4X6A J;  5FMP A;  1S8N A;  3E1S A;  3KYC B;  1K61 A;  1R36 A;  2VC1 A;  3FBI B;  3DEW A;  3WGI A;  3EGQ A;  4JK1 X;  2DO7 A;  3SXY A;  4XLE A;  3VYS B;  2H27 A;  4Y15 A;  2LDU A;  2CJJ A;  3I4N J;  1JGS A;  4XRF A;  3RD3 A;  2CH0 A;  1KU3 A;  2NP5 A;  2DOF A;  2MC4 A;  4F91 B;  3JTG A;  4AIK A;  4HNU A;  1ZH5 A;  4A3L J;  1RRJ A;  5JLW A;  2R0Q C;  4IOA F;  2W84 A;  3GLX A;  3ZRG A;  2OBP A;  1G4D A;  2PJP A;  1MJB A;  2PMH A;  4OMZ A;  2Y69 H;  4GGG A;  1K4T A;  2HPI A;  2DQR A;  4PJN A;  4CYC A;  2LLK A;  4DBQ A;  1Z7U A;  4C30 A;  2R5Y A;  3BPV A;  4LIT A;  3VTI A;  1WJD A;  4EVI A;  3NPI A;  2K02 A;  5IYC J;  2R7X A;  2L02 A;  1T08 B;  1XPX A;  2PMZ A;  1I1S A;  4BJ5 C;  4EJT A;  5JVT A;  1FOK A;  2HYG D;  3NAR A;  1SMT A;  3BTJ A;  3AG4 H;  2CV2 A;  3P9C A;  3FMS A;  3L2V A;  3S1M J;  2EZH A;  4XBF A;  3QU3 A;  1JI8 A;  1UHW A;  3ZQQ A;  3KZI C;  3PQJ A;  2W82 A;  4HG2 A;  3TL4 X;  4WWC A;  3BZK A;  5LGN A;  4A3F J;  3VW2 A;  3ECH A;  3J80 K;  3J7Y J;  2ZFU A;  4HQE A;  1IN7 A;  1HOM A;  1BR2 A;  2K7L A;  3M8E A;  2ZOZ A;  2HU9 A;  1U6G A;  3G1L A;  3LSM A;  2E19 A;  1MIJ A;  2ZB9 A;  1HLV A;  3DCF A;  3CCS I;  2BEO A;  2VI6 A;  2Q8K A;  3JAM Z;  3T6N A;  4RB1 A;  4M74 A;  1OPC A;  2K3P A;  2RC4 A;  1JGG A;  3TMO A;  1YRN B;  1BJZ A;  4PCQ A;  1G3S A;  2R7D A;  2BW3 A;  1OFC X;  2FF4 A;  2EFO A;  3VSK A;  3M9A A;  4IO9 F;  3RPU D;  3L2C A;  2IS1 A;  3S2W A;  3W2W A;  3GME A;  3WE2 A;  4MTE A;  2PFB A;  2R5Z B;  1FBQ A;  1VQ6 I;  2IA1 A;  3BRO A;  1G8X A;  4I7H A;  4LD5 A;  3Q9S A;  4Q47 A;  1G3Y A;  1I27 A;  1MBK A;  2WB1 N;  2WAE A;  4CO8 A;  2HZT A;  2OAZ A;  2CWE A;  3ECO A;  4OIN F;  2CW8 A;  2K9N A;  1V5E A;  4EGZ A;  5J6X A;  3I64 A;  4L0Y B;  4AU7 A;  3MAJ A;  3R4K A;  2EA4 A;  3LSI A;  4L9N A;  2WBM A;  4IEJ A;  2CV0 A;  3FKJ A;  1CF7 B;  3OL4 A;  1FMV A;  4LB5 A;  1WZ2 A;  1HF0 A;  2ZJ2 A;  3OYN A;  3CO7 C;  2VKH A;  5KHD A;  2BXZ A;  2QEN A;  2CG4 A;  4LGW A;  4ZYG A;  1KA8 A;  3ONQ A;  4JYK A;  1FBS A;  1YX5 A;  3B6A A; 
#chains in the Genus database with same CATH homology
 3JRH A;  4BXX J;  1H89 C;  4NN1 A;  3H0G J;  5FJ8 J;  5C4X J;  1JJ6 C;  4UUS B;  5F0F A;  3CQZ J;  1UMQ A;  2HXO A;  3BJB A;  3S2D J;  1BA5 A;  1SGM A;  4D5F A;  3CCY A;  2HYJ A;  3V78 A;  3ZQL A;  1PUF A;  4XK4 A;  1VFC A;  4Y7N J;  1CQT A;  4JP0 A;  5EGO A;  1RES A;  4V2F A;  3JRI A;  3S16 J;  2ZCM A;  1MH3 A;  3BTC A;  2JJ7 A;  1Q1V A;  2DN0 A;  5J1R A;  4A3M J;  2D6Y A;  2O7T A;  1Y1W J;  1P7I A;  1X58 A;  4DW6 A;  4A3C J;  4D7N A;  4GFB A;  5AQC A;  1WH7 A;  1GDT A;  1APL C;  4BY1 J;  2FJ1 A;  4GFL A;  5C4Y A;  1GV5 A;  2LR8 A;  4AC0 A;  4AC6 A;  2JWT A;  4D5C A;  2XGC A;  1LE8 A;  1IJW C;  2XPV A;  1JJ8 C;  2HOS A;  3AQS A;  3HOZ J;  3PO3 J;  2H1K A;  2ZOY A;  1BW6 A;  3M3Y J;  4BY7 J;  1O4X A;  2XGE A;  4GFK A;  1F36 A;  5HSZ A;  5M5Y J;  4J19 A;  4FE7 A;  1H8A C;  5IP7 J;  5IOZ A;  4FTH A;  3K2A A;  2XDN A;  4RBO A;  4YZE A;  5JLX A;  3S5R A;  2HKU A;  3NI7 A;  1VI0 A;  4AYB N;  5C4J J;  1A6I A;  5J1U A;  2JN6 A;  2EZK A;  3JRA A;  1RR7 A;  4ME9 A;  1JTX A;  2LVS A;  4XID A;  3Q0W A;  2HOT A;  2Y9Z A;  5K58 A;  1BL0 A;  2EH3 A;  1RET A;  4I6Z A;  9ANT A;  3A02 A;  3BG5 A;  2QTQ A;  3VOX A;  4A3E J;  3S1R J;  3Q0U A;  1E3O C;  2RAS A;  5FLM J;  3AQT A;  1OCP A;  2NVY J;  3JRE A;  3JRF A;  2JA7 J;  2DMT A;  5M5W J;  1RKT A;  1WPK A;  1JKO C;  3RZO J;  5HBU A;  4GCL A;  2O9L A;  1MBJ A;  3JRB A;  2XPU A;  1FIA A;  1JT0 A;  4I76 A;  3HDD A;  1B72 B;  5FKO A;  5DS9 A;  2O8K A;  4M6V A;  3RQI A;  1XS9 A;  1MH4 A;  3EUP A;  2DMN A;  2E1O A;  3LSJ A;  3TED A;  1POG A;  4HNV A;  1WI3 A;  3FIS A;  3FK7 A;  5DAJ A;  1LFB A;  2DMP A;  1JKP C;  1JUP A;  2XB0 X;  2XGD A;  1ZTR A;  3OSF A;  2UXU A;  4IHV A;  2WAQ N;  4XRS A;  2NOG A;  3Q3S A;  3QPL A;  2DJN A;  2LFB A;  3HTI A;  1I6H J;  1SAN A;  4DYC A;  3M4O J;  2R5Y B;  3B6C A;  1ETX A;  2MG4 A;  3WHC A;  5EFY A;  5HAW A;  1TWG J;  2G3B A;  4B1R A;  1WH5 A;  5C44 J;  2ID3 A;  1TWF J;  2KDZ A;  5EEA A;  5K7F A;  1DU6 A;  1ETO A;  2Q24 A;  3HEF A;  4C3H J;  3GBG A;  2W48 A;  4BBS J;  3RZD J;  1ZR4 A;  3S17 J;  3LWJ A;  4B4C A;  3ANG A;  2E2I J;  5EYR A;  5IP6 A;  4ACI A;  3GTL J;  4PXI A;  3KKD A;  3GTO J;  3CWR A;  1Z0X A;  3BG3 A;  2PZ9 A;  3VP5 A;  4AUX A;  1MSE C;  2K9Q A;  3C2B A;  1S7E A;  2YVE A;  5EZH A;  3DPJ A;  2M34 A;  2PMZ N;  2L9R A;  2REK A;  4MFD A;  3VUQ A;  3UKG A;  1GT0 C;  5CW8 A;  4GCT A;  1JTY A;  2EBI A;  2NVX J;  4MLO A;  1IV6 A;  3HTJ A;  3HOU J;  5GPC A;  4W1U A;  3SFI A;  1ETV A;  1BW5 A;  3CJD A;  2DA2 A;  2RAE A;  2JA6 J;  1OJL A;  3HGG A;  5K7H A;  2CUE A;  2KT0 A;  5F27 A;  2UXI A;  4D7M A;  2LK2 A;  2RHA A;  2FQ4 A;  3GTG J;  3TW6 A;  1W0T A;  2G0E A;  1VND A;  3BTI A;  1IGN A;  3E7Q A;  3TP0 A;  2H8R A;  1ZK8 A;  3LJL A;  2DA4 A;  1FTZ A;  5DTD A;  3F1B A;  3BRU A;  4AF5 A;  2OPT A;  2E2J J;  2O7O A;  3A03 A;  2LY9 A;  3C07 A;  2HOA A;  1HDP A;  1IC8 A;  1ITY A;  2G7S A;  4ABZ A;  3A01 B;  2OI8 A;  1RKW A;  2LD5 A;  3RKQ A;  1U78 A;  3NNR A;  2UXH A;  5D19 A;  3HGY A;  4XRM A;  1TWC J;  1FJL A;  2D5V A;  3FKI J;  4IHY A;  2XB5 A;  3QKX A;  4M3E A;  5F04 A;  3IUV A;  3NXC A;  4CGR A;  4M3D A;  3I4M J;  4V2G A;  3SJM A;  2DA5 A;  5IPA A;  3TW7 A;  4A3B J;  2AO9 A;  4Y52 J;  3LHQ A;  1ETW A;  4XRS G;  1JUS A;  1VF9 A;  4DZP A;  4C2M J;  3VVX A;  3IH3 A;  1TWH J;  1U8B A;  4C3I J;  5M3F J;  5F1J A;  4B3A A;  3PPB A;  2UXO A;  3H3V K;  2Y0S N;  5D1R A;  4DYQ A;  1YRN A;  2CUF A;  2XSD C;  1AU7 A;  5FKL A;  1WGX A;  2DA6 A;  4A3D J;  3BG9 A;  2VKE A;  4MO7 A;  3G56 A;  4G12 A;  5F0C A;  3ON2 A;  4M3F A;  4L62 A;  1TC3 C;  2PBX A;  3IV5 A;  4QSH A;  1AHD P;  2IBD A;  3BR1 A;  1PUF B;  1QVU A;  2M9H A;  2R5Z A;  4MXM A;  3BR5 A;  5EGO B;  3HOX J;  1B8I A;  1UG2 A;  4MIM A;  5M5X J;  5EG0 A;  3JRG A;  5IYD J;  1ZKG A;  1MBG A;  4IHW A;  5EDN A;  2ZCN A;  3ZQH A;  5J1Y A;  2YS9 A;  3BQY A;  1W0U A;  2OF7 A;  1WCM J;  3JRC A;  2NVQ J;  1LE8 B;  1U9O A;  4JX4 A;  2LKX A;  1T56 A;  1UHS A;  3GTK J;  5FKN A;  4MK6 A;  2CU7 A;  2OER A;  2WUI A;  2DA7 A;  4LOC A;  1Z77 A;  2ELK A;  3WHB A;  5E3L A;  3LSP A;  2NX4 A;  5CXI A;  1JT6 A;  3E7L A;  4A3K J;  2N8G A;  2QF7 A;  3G1O A;  2MSY A;  4A3G J;  3V6G A;  3GTJ J;  5E3O A;  3BHQ A;  3O60 A;  3JRD A;  3GEU A;  2I10 A;  2ECB A;  1H88 C;  1IG7 A;  4EEF G;  3GZI A;  1ETY A;  2HQ5 A;  3VVZ A;  2ME0 A;  3D1N I;  2FBQ A;  4KWA A;  3NRG A;  4UDS A;  4HKU A;  3RH2 A;  2IEK A;  3NAU A;  3Q0V A;  2K9S A;  2JMW A;  3VPR A;  3HKZ N;  3KZ9 A;  2VUM J;  4A3J J;  4IHX A;  2LP0 A;  2Y9Y A;  3PO2 J;  1MNM C;  3ZQC A;  1K83 J;  1XG1 A;  1DU0 A;  3W6V A;  2NVT J;  3O8H A;  2DG8 A;  3OIO A;  2CQX A;  4C3J J;  1ZR2 A;  2QOP A;  2ID6 A;  5EG0 B;  2JK3 A;  4W97 A;  5FGL A;  2R92 J;  1HCR A;  1ENH A;  2MGQ A;  3VIB A;  1D5Y A;  1ETQ A;  2NS8 A;  2Y2Z A;  1A5J A;  3VVY A;  2NP3 A;  2WV1 A;  2G7G A;  4FE4 A;  2DTZ A;  2W53 A;  5BNG A;  1P7J A;  1MBE A;  3OSG A;  2XPW A;  3S15 J;  4NDL A;  1ETK A;  2DA1 A;  3FIW A;  1IRZ A;  3BR0 A;  3PAS A;  3FK6 A;  2X9D A;  3BR3 A;  1GV2 A;  4A69 C;  3HOW J;  1JKR C;  1IDZ A;  5GP9 A;  2YVH A;  3KNW A;  3HE0 A;  5E3N A;  1IDY A;  2IAI A;  1F43 A;  3HBL A;  2L0K A;  4QIW N;  4XIC A;  1X2M A;  3OOU A;  2XRL A;  1Y1V J;  2GEN A;  5HOD A;  4DYR A;  5IP9 J;  2Y30 A;  3BCG A;  2CQQ A;  1GVD A;  3GTP J;  3PM1 A;  1QPI A;  2GLO A;  3VW0 A;  2B63 J;  2UXP A;  5EF6 A;  2QIB A;  3HOY J;  2ECC A;  4GCK A;  3S2H J;  2P81 A;  1G2H A;  3MN2 A;  1X2N A;  5FHP A;  4BKX A;  2YU9 J;  3CRJ A;  1ZGW A;  2Y31 A;  3BR2 A;  4X6A J;  2FX0 A;  5FMP A;  1TWA J;  1K61 A;  2L7M P;  1JUM A;  3ZQF A;  3DEW A;  3LSR A;  4JX5 A;  1IUF A;  3VOK A;  1ORK A;  3EGQ A;  4ICH A;  5FKM A;  1OCT C;  2FD5 A;  2VPR A;  2CJJ A;  3TP3 A;  2CRG A;  5M3M J;  3I4N J;  3LSG A;  1B72 A;  2M8G X;  3RD3 A;  2NP5 A;  3P9T A;  2QCO A;  5K7Z A;  1AKH A;  2G7L A;  4A3L J;  2X6O A;  5JLW A;  2R0Q C;  3QPS A;  5F0H A;  3HIM A;  1I50 J;  2HDD A;  1RPW A;  3S1N J;  4CYC A;  2LLK A;  2TRT A;  4UUT A;  3ON4 A;  1MSF C;  2R5Y A;  3BTL A;  1FEX A;  4M3G A;  4NEL A;  2GM4 A;  2DMQ A;  2R93 J;  1EF4 A;  3GTM J;  3NPI A;  2NS7 A;  4MFE A;  5IYC J;  3MNL A;  3F0C A;  5FKK A;  2GUH A;  2GBY A;  2HI3 A;  1ZQ3 P;  1XC5 A;  5IYB J;  5E3M A;  2MW8 A;  2R7Z J;  4L5E A;  3NAR A;  3BTJ A;  5IOY A;  3MVP A;  2GFN A;  3SDG A;  2EQR A;  2DMU A;  3IH2 A;  3S1M J;  2LTP A;  3VW1 A;  2EZH A;  5F08 A;  1MBF A;  1NK3 P;  1NK2 P;  4JL3 A;  4BBR J;  3QQA A;  4X1E A;  4M3B A;  3BNI A;  4DZJ A;  4JNN A;  4A3F J;  3O8G A;  3VW2 A;  1FIP A;  2TCT A;  4JX6 A;  3JR9 A;  2X48 A;  1HOM A;  5D18 A;  2ZOZ A;  3ZOB A;  2M2E A;  2F07 A;  3COL A;  3G1L A;  3HOV J;  2E19 A;  2HXI A;  1GUU A;  2ZB9 A;  3LNQ A;  2ZCX A;  1HLV A;  3DCF A;  3LOC A;  2IU5 A;  3BT9 A;  2EZL A;  2VI6 A;  1R9T J;  1SFO J;  2K40 A;  2COB A;  1AKH B;  3T6N A;  3HB9 A;  4RDU A;  3L1P A;  1JGG A;  1YRN B;  2DA3 A;  1UI6 A;  3HM5 A;  5CXG A;  2QWT A;  1BJZ A;  1I3Q J;  5C3E J;  1OFC X;  2HYT A;  3BR6 A;  4UUS A;  4FIS A;  4FCY A;  4CYC B;  3K7A J;  2M0C A;  2WGB A;  2DG7 A;  2JA5 J;  2VKV A;  4A3I J;  4A93 J;  2QKO A;  2R5Z B;  2ME6 A;  3CDL A;  4S0H B;  1B8I B;  3KKC A;  2L7F P;  3BQZ A;  5GPA A;  1MBK A;  2WB1 N;  5FLV A;  1U9N A;  1FTT A;  3JSJ A;  3A01 A;  3ANP A;  3CMY A;  4QTR A;  3HTA A;  1HDD C;  1QVT A;  1QRY A;  3GTQ J;  2YUS A;  2EZI A;  3G7R A;  2JA8 J;  2K9N A;  1JKQ C;  3QBM A;  3G1M A;  5EZG A;  3ZQG A;  1MBH A;  1UI5 A;  1NTC A;  5H9T A;  3FRQ A;  2AHQ A;  4IEJ A;  1LFU P;  3HTH A;  3IH4 A;  1HF0 A;  2L7Z A;  4JKZ A;  3ZQI A;  3B81 A;  1T33 A;  2E2H J;  3S1Q J;  5J3L A;  3S14 J;  4JYK A;  3B6A A;  2V57 A;  3MKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...