2I10A

Putative tetr transcriptional regulator from rhodococcus sp. rha1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
185
structure length
179
Chain Sequence
b'DDQVALQTAMELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYMCERTLQLEEAMVRPTAHEAVLDFLTGRVEVFTGCMTVQAGLASGEPHHEIVDLLTAAREQMRQTVLDRFEKALADGDLPAGTDCTALARYVMAAVYGLSVEAASGAPREELTAAAILAAQVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR transcriptional regulator
publication title X-ray crystal structure of putative TetR transcriptional regulator from Rhodococcus sp. RHA1.
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
total genus 58
structure length 179
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2i10A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2i10A02
1UHSA 4DYRA 1BA5A 4HNVA 5C4YA 1Y1WJ 2XB0X 3Q3SA 1W0TA 2ECBA 5FJ8J 1WH7A 1P7JA 5J1UA 4ACIA 5J1YA 4GCKA 2X6OA 1LFUP 5BNGA 3FRQA 1BL0A 4BY7J 3OSGA 3NI7A 3JRFA 2XB5A 1IDYA 2B63J 2IU5A 2OERA 3F1BA 2PZ9A 2M0CA 1U78A 3LNQA 2TCTA 1VFCA 4G12A 5IOZA 5FLVA 4MIMA 4B4CA 3ANPA 1GV5A 4FISA 2KDZA 1I3QJ 1IGNA 3HOZJ 3JRCA 5C3EJ 2HOSA 5D18A 2EZKA 3A02A 1LE8A 1TWFJ 1TWGJ 4B1RA 2HYTA 5CW8A 3IH4A 5EZGA 4S0HB 4M3BA 4JX5A 5IOYA 1B72B 2QF7A 1G2HA 3G56A 3VP5A 3BG5A 4QIWN 5C4XJ 4I6ZA 3AQSA 3WHCA 4UUSA 4ABZA 1X2MA 1ETYA 1MBFA 1JJ6C 2ID6A 2W48A 3DEWA 2H8RA 3S17J 3MNLA 2AHQA 5EYRA 2DJNA 3CMYA 1NTCA 3BTJA 4YZEA 2CRGA 2HI3A 4M3EA 2JJ7A 4AYBN 3GTMJ 3S1NJ 1BW5A 1XG1A 2XGCA 1ETKA 3PM1A 3JRBA 3BTCA 3JRIA 3VVYA 2DTZA 3SDGA 3VVZA 3DCFA 9ANTA 5D19A 1TWCJ 4JX6A 1RR7A 5E3LA 2GLOA 3CCYA 5K58A 1W0UA 1S7EA 3MKLA 1D5YA 4FTHA 2XSDC 3EUPA 1MNMC 3QKXA 3B6AA 3DPJA 2CQXA 1TC3C 4D5FA 1I6HJ 1SFOJ 1GV2A 2RHAA 5K7HA 3O8HA 5HODA 3FISA 4J19A 2WB1N 5IP6A 2L0KA 3ON2A 2OF7A 2K9NA 1LFBA 1RKWA 2AO9A 2DA4A 3LOCA 1JT6A 2UXHA 1IRZA 5M5YJ 1ZGWA 2DG7A 2XPWA 3HDDA 3I4NJ 4RDUA 3BR6A 4D7MA 1GVDA 1ZK8A 1JTXA 4JKZA 2CQQA 4W97A 1VI0A 1PUFB 3S14J 2FQ4A 2JA7J 2R93J 1RKTA 3S5RA 3JREA 4D5CA 2HOAA 3HEFA 1T33A 2WAQN 5FLMJ 1IC8A 4I76A 4HKUA 3JRAA 2G0EA 3JRHA 3P9TA 3VW2A 3HGYA 1QVUA 2NVYJ 1ZKGA 2R5YB 2O7OA 2DMPA 1U9OA 1ZR4A 3GTPJ 2DG8A 3QQAA 3GTGJ 3T6NA 2VKVA 1F43A 2E19A 1UG2A 2NVXJ 3LJLA 5FGLA 2REKA 2CU7A 3BR0A 3F0CA 1A5JA 2N8GA 3K2AA 2QTQA 2HKUA 1WPKA 4PXIA 5EG0A 4CYCA 2DMQA 3Q0VA 4A3GJ 4EEFG 2GENA 4L5EA 4A3CJ 1JT0A 1MBGA 3G1MA 3HOVJ 5K7FA 3KZ9A 1ETWA 2ELKA 2YVEA 3H0GJ 4RBOA 1GUUA 2LTPA 4X1EA 3FK6A 5M3FJ 2JA6J 2JN6A 1E3OC 1YRNB 4MK6A 1JKQC 5CXIA 1X2NA 3W6VA 3EGQA 5F0HA 2ZCXA 1MBHA 2G7GA 2E1OA 1B8IA 3G1OA 4AF5A 3LSJA 3SJMA 3A01B 3IV5A 2G7LA 5DTDA 2NS8A 5F27A 3L1PA 2IAIA 2JA8J 4ME9A 5DAJA 2XRLA 3M3YJ 5GP9A 3HIMA 2EBIA 2MSYA 1AKHA 2H1KA 3E7QA 2ZOZA 2NS7A 3ON4A 3Q0WA 5M5WJ 2QKOA 3ZQGA 5FKOA 1QPIA 4MO7A 5FKKA 1MBEA 3RZOJ 2PMZN 2YUSA 3BR2A 4MFEA 2L7FP 2HQ5A 3HBLA 4GCLA 2D6YA 4UDSA 4A3LJ 2KT0A 2WGBA 4A3JJ 2HXOA 2DA7A 3S15J 3GTKJ 1K61A 2ZCNA 1K83J 3GEUA 4LOCA 5C44J 3BQZA 2K9QA 2GUHA 2OPTA 5CXGA 3HTJA 3PPBA 3VUQA 2JMWA 3RQIA 2DMTA 1JUPA 2MW8A 1T56A 5IYBJ 1H88C 3S2DJ 4NELA 2LK2A 3JSJA 4FE4A 3M4OJ 2UXPA 2LD5A 1ETVA 3B6CA 1MH4A 5E3OA 4DYCA 4V2FA 1BW6A 1QVTA 1JKRC 3I4MJ 2UXUA 3LSRA 4DYQA 2GBYA 5EFYA 1I50J 2R0QC 2NOGA 4ICHA 3BTLA 1ZQ3P 4B3AA 2ECCA 3QPSA 4NN1A 2LFBA 1POGA 2M34A 2JK3A 2Y2ZA 1HDPA 5H9TA 4IHWA 3O60A 4DZPA 1RETA 4GFBA 4XRSG 4QTRA 1JKOC 3BT9A 3OIOA 5F0FA 4C3HJ 2YS9A 2EZLA 2QCOA 3VVXA 1Y1VJ 1R9TJ 2R5ZB 3VIBA 2YVHA 2EZIA 4A3IJ 4C3IJ 5IP7J 1XC5A 2ME6A 2LY9A 3CJDA 2IBDA 3UKGA 1B72A 1A6IA 1HLVA 2O8KA 2ZCMA 4BBRJ 2L9RA 3BG9A 5AQCA 3NARA 2QIBA 4CGRA 3O8GA 2D5VA 3HGGA 1XS9A 2P81A 3QPLA 3HM5A 3D1NI 4D7NA 5F1JA 3HOWJ 2OI8A 3ANGA 1OFCX 3JRDA 3KKDA 1Q1VA 2Y31A 2O7TA 3BR5A 1H8AC 3BHQA 5JLXA 4GCTA 1FIPA 3HB9A 3VW1A 1RPWA 4IEJA 3KNWA 3BR3A 3QBMA 3MN2A 2E2JJ 2XPVA 5M5XJ 1APLC 3ZQHA 3RD3A 4JNNA 3IH3A 3NAUA 4XICA 3H3VK 4QSHA 2HOTA 3VW0A 5EDNA 3NNRA 2X48A 2LP0A 2DA2A 3FK7A 1ZTRA 1JUSA 1MSEC 3BRUA 4GFKA 1LE8B 2RAEA 5IYDJ 4A3FJ 2K9SA 1JJ8C 2Y30A 4M3FA 3IH2A 3TP0A 2Y0SN 5EZHA 3PO3J 2XDNA 3ZQCA 1HDDC 1ETQA 1MH3A 5J1RA 1VF9A 3BQYA 2QOPA 4UUSB 2ZB9A 5FHPA 3TW7A 1WI3A 1IG7A 2L7MP 1UI5A 5DS9A 3NXCA 5J3LA 4AC0A 3BR1A 4MXMA 1ITYA 2DMNA 5F0CA 1PUFA 2GM4A 5F08A 3GTLJ 2X9DA 2I10A 1JGGA 2Q24A 3SFIA 3PO2J 1F36A 1OCPA 2DA3A 1JTYA 5C4JJ 3HOUJ 3KKCA 2LKXA 4Y52J 3G1LA 2FX0A 1SGMA 2Y9YA 2K40A 2TRTA 3ZQFA 2ME0A 2HYJA 2ZOYA 2FD5A 4A69C 5FKMA 3NPIA 4XRMA 5FKLA 1HF0A 2R5YA 2XPUA 3CDLA 1IUFA 1MBKA 3BJBA 1FTTA 5HBUA 2CUEA 5EF6A 2NVQJ 1CQTA 3ZOBA 2CUFA 3A03A 1P7IA 3JRGA 4MLOA 4FE7A 3RZDJ 2E2HJ 2JWTA 1OCTC 5GPCA 2YU9J 1NK2P 3C07A 3COLA 3VOXA 3JR9A 2DN0A 1SANA 3WHBA 2DA6A 3HOXJ 1RESA 2M2EA 2XGEA 5K7ZA 2FJ1A 3OOUA 2JA5J 1HCRA 3CQZJ 3GTQJ 4IHVA 3HTHA 2NP3A 2DA5A 1FEXA 1JUMA 2RASA 1IDZA 2F07A 3Q0UA 1MBJA 4IHXA 4JP0A 1QRYA 2VKEA 4M3DA 4FCYA 1FTZA 1YRNA 1ETXA 1FIAA 5GPAA 3LSPA 5F04A 4DW6A 2WV1A 2WUIA 3A01A 5FMPA 5EGOB 2NX4A 3G7RA 2PBXA 3RH2A 2Y9ZA 4GFLA 4M3GA 2R92J 3AQTA 2E2IJ 4BXXJ 3BNIA 1WCMJ 4JL3A 4M6VA 3IUVA 4W1UA 1UI6A 4JX4A 1WGXA 2VI6A 2EZHA 1AHDP 2W53A 1U8BA 1GT0C 1BJZA 5M3MJ 4AUXA 1U9NA 2LR8A 3TEDA 4C3JJ 3CRJA 5IP9J 4DZJA 5D1RA 3S2HJ 2G7SA 2DA1A 3VPRA 1Z77A 3ZQLA 1GDTA 3OSFA 2HXIA 1ENHA 3LSGA 1AU7A 5EEAA 4A3EJ 4C2MJ 3PASA 2LLKA 5EG0B 2QWTA 4CYCB 3NRGA 5HAWA 2UXIA 1ORKA 1O4XA 3BCGA 3CWRA 2CJJA 3ZQIA 4XIDA 3S1MJ 1EF4A 2R7ZJ 1DU6A 4A3MJ 1JKPC 4Y7NJ 5IPAA 2VUMJ 3HTAA 3FKIJ 2IEKA 3K7AJ 3GTOJ 1WH5A 1ETOA 5IYCJ 2V57A 2MG4A 3C2BA 2NP5A 4NDLA 4XK4A 4UUTA 1TWHJ 2EQRA 1Z0XA 3LHQA 2L7ZA 4MFDA 5FKNA 1TWAJ 1VNDA 1B8IB 3S16J 1NK3P 3HTIA 2UXOA 5JLWA 2VPRA 3MVPA 2GFNA 5EGOA 1HOMA 3BTIA 3VOKA 4L62A 1DU0A 5E3MA 4XRSA 5HSZA 4A3KJ 3RKQA 2ID3A 3E7LA 2LVSA 1X58A 4V2GA 4JYKA 1OJLA 1UMQA 1AKHB 2R5ZA 3BG3A 4A3DJ 1MSFC 4A3BJ 3HOYJ 4KWAA 1H89C 2M8GX 2DMUA 2O9LA 4IHYA 3S1QJ 4AC6A 1IJWC 3LWJA 2MGQA 5E3NA 2NVTJ 3HKZN 4A93J 2XGDA 4X6AJ 2M9HA 2FBQA 3GZIA 3GTJJ 3HE0A 3V78A 3FIWA 4BBSJ 2COBA 2EH3A 3V6GA 3TW6A 2HDDA 3GBGA 3B81A 3TP3A 3S1RJ 1ZR2A 1IV6A 1FJLA 2G3BA 4BKXA 4BY1J
chains in the Genus database with same CATH superfamily
1S7AA 1Z05A 1MMGA 4G6DA 3VYSB 5FLXZ 1W4MA 3L2CA 5FJ8J 4G6TB 1P7JA 5AIQA 1FSEA 4ACIA 2IVMA 4BHCA 5LLQA 4GCKA 4J00A 1FOWA 1LKXA 5BOXA 2EIJH 3CC4I 3ECOA 5F1RA 4XOTA 3CO6C 2VL8A 3K0LA 1O7FA 2CQ7A 2GOMA 2DTRA 1ZRCA 3GX4X 4OAZA 3F1BA 1I3AA 2HWVA 1U78A 2L54A 2ZJRF 1X3UA 4XKCA 5IOZA 4ZC3A 4MIMA 2R7TA 1GV5A 3A4CA 1IGNA 4RGXA 3FMQA 3JAMZ 4PUSA 3HOZJ 2W00A 4BU2A 4I7HA 3OYKA 3GLXA 4S0HB 1G2HA 3BG5A 1LUJB 5C4XJ 2VT3A 2M45A 1TTYA 1ZLKA 5FO5A 4CGZA 3DPTA 2DI3A 3T8TA 3WHCA 3AQSA 3DLLF 1FLIA 1ETYA 3LA3A 1MBFA 1SAUA 2ID6A 1G4DA 2KIFA 1FJLA 1RNLA 2AHQA 5EYRA 2Z99A 2COMA 3DU5A 2DJNA 3CMYA 3QRFF 1NTCA 2JSCA 2HI3A 3QODA 4I99C 4H4KC 3S1NJ 1XG1A 3G6EI 2XGCA 1Z91A 3JRBA 1ZELA 1TT0A 4EMSA 3CF5F 3JRIA 3VVYA 2DTZA 1NG7A 2STWA 3ELKA 2F5DA 9ANTA 4BE0A 1C0WA 2DYRH 2VBYA 2ZBKA 2GLOA 2CV2A 4XL9A 3CCYA 4RLQA 3MKLA 4G6QA 3OYDA 3IHUA 4KT5C 3RKWA 1MNEA 1MNMC 3QKXA 5LHGA 2CQXA 3F3XA 1R5GA 2MLKA 1H9TA 3F8BA 4QPOA 2OZUA 5K7HA 3O3KA 3O8HA 4J19A 4LMYA 1IRFA 4EJOA 5D5WB 1W7PB 1IUYA 1YI2I 3W2AA 3QYBA 2Z9OA 2FNPA 3KP5A 1ZG5A 1N77A 4S05A 1S5LC 3V8KA 3NS4A 3HC7A 3LSMA 3L2WA 4KITB 2RC4A 5M5YJ 4DOZA 2CUZA 2P8TA 3OYHA 1XSVA 2LREA 1Z1DA 2XPWA 3CP2A 3OV8A 3HDDA 4RDUA 3CMAI 1ON2A 4HBLA 3DF8A 2W57A 4BQAA 1GVDA 4JKZA 2CQQA 3BZ6A 3KX2A 3S14J 3HG9A 2IP2A 3OS2A 4D0PA 2X6XA 3JREA 3VYUB 4L5IA 3R61A 1IXSB 2Y0SA 2WAQN 1IC8A 4I76A 5HDNA 1P4WA 1KU2A 4NQWB 4HKUA 2A6HF 4JOMA 3VW2A 1J09A 1X4PA 1QVUA 3IWZA 4RGUA 3H9QA 4A0ZA 5E1WA 2O7OA 2F5VA 3FMSA 3I59A 1ODDA 5B66C 3FDYA 2VT2A 2DFIA 2VKVA 3LSTA 1F43A 1Z21A 2R7SA 3T1BA 1R5HA 5FLXK 2NVXJ 2REKA 3BR0A 4AD9A 2EFNA 3K2AA 2Y69H 4PXIA 1FZPB 4UUVA 4MHGA 5LRSA 2Y0MA 5H6RA 2GQQA 2GENA 5LGNA 1MBGA 5HLHA 1ZLJA 2HYFA 4IZZA 3KZ9A 2WY8Q 3TO7A 5ILVA 4X1EA 2PFVA 2JA6J 1KQ9A 2JN6A 1YRNB 5CXIA 5F6FA 1JKQC 1X2NA 3W6VA 3ERED 1IRGA 1FWZA 4RLFA 3AL0C 2G7GA 3J80Z 3G1OA 4F91B 3JAMK 2J5OA 2ZXIA 3PNVA 1KZHA 1FYMA 2G7LA 3EUKL 3L1PA 3V4GA 2V9VA 2JA8J 4UV9A 2XRLA 3GO5A 1SAXA 1Z9CA 3M3YJ 1J5YA 2EBIA 2H1KA 3E7QA 3EYYA 2R7OA 3L9FA 3E5UA 2QKOA 4F7ZA 5JFRA 4XKBA 3RZOJ 3L2VA 2LOOA 3DLAA 4MFEA 2EFQA 2GXGA 1V55H 2L7FP 3HBLA 2RGVA 1T0FA 3HRUA 2QQ8A 4LG0A 3WE2A 2CH0A 3GZ5A 4I98B 3I55I 1T38A 3L2UA 4RA2A 4KIFA 5CPRB 2ZNZA 4HPQA 1BOBA 5CXGA 2OTJI 3VUQA 2KJCA 1JUPA 1T56A 1R00A 1XD7A 5GTIC 3J7ZI 4PJLA 2F4OB 2UXPA 1ETVA 2ZMEC 2BBYA 2BZTA 1BW6A 2QM3A 2UXNA 3WU1B 1JKRC 4HOBA 3I4MJ 2DJIA 4DYQA 2R0QC 3BTLA 1DDNA 4B3AA 4NN1A 2VIXA 2QSHX 1POGA 2M34A 2JK3A 3F23A 1HDPA 2KIUA 4IHWA 1YX3A 2HZDA 5DEQA 1JKOC 5HVQC 3OIOA 5LHIA 2GZWA 3M8FA 4DNCA 1S3JA 1J75A 3KPHA 3ABKH 1OKRA 5DUIA 4RB2C 4A3IJ 3OYLA 4C3IJ 4IOCF 3TDZC 2K86A 3QYFA 3HHGA 2IBDA 4XKWA 3VYRB 1Y0UA 2EA2A 2O8KA 1IW7F 1LDDA 2ZCMA 4KNYA 2F5FA 4HF2A 1HKTA 2ZKZA 2D5VA 3HGGA 1EA3A 1E3PA 1Z3XA 3WU0A 1JE8A 4M71A 3CJRB 4CH7A 3HOWJ 2HQNA 5J8FA 5ICGA 3JTGA 4E6KG 3KKDA 2CG4A 3HPHA 4P9FA 4UY8I 3E5XA 3GMEA 3HB9A 1RPWA 3RPQA 2E2JJ 5M5XJ 3AG4H 1KQ8A 1U2WA 3ZQHA 4JNNA 5CVRA 3CC7I 2ZXWH 4LD5A 4M6YA 4ZDPA 2Z33A 3BY6A 3CDIA 1IN7A 2A6EF 4GCVA 4O3MA 2WV0A 1WJAA 2DA2A 2G9WA 3P5JA 4RAZA 5K5RA 3COAC 1MSEC 1W7PA 3BRUA 2MFZA 1LE8B 5IYDJ 3C2HA 3ZGKA 3J80K 1OCZH 1USSA 3LL7A 3RCOA 3HPGA 2IA0A 1TZLA 3ZQCA 2CV1A 1ETQA 3LSIA 3K2ZA 4I0BA 3BQYA 3GFJA 1OMIA 4UUSB 3GYHX 2DU9A 2EV5A 1FX7A 1RR8C 5FHPA 4XR6A 4Y4RA 1WI3A 3DKXA 1IG7A 3NXCA 5DS9A 3N97A 3ZCOA 4MGRA 4MXMA 1RC9A 5F0CA 2AQFA 4Y17A 2Q0OA 3E0JB 3VSKA 1S9HA 2QQ9A 3JSPA 3REOA 1JGGA 1T6SA 3CP8A 2Q24A 4B47A 4UVBA 2XF7A 2KFDA 3TO9A 4YIIA 5C4JJ 3KKCA 2ESNA 3RYRA 2LSOA 2CO5A 1XTAA 2IGMA 3G1LA 3B02A 2E1CA 1SGMA 4NQWA 3ZQFA 4M73A 2ME0A 1SFUA 1SVMA 3KLOA 2GXAA 4F52A 4XRMA 5FKLA 2ZFWA 3I58A 2FJI1 4TV7A 1YTYA 2DK8A 3CDLA 1A36A 2E5NA 2ZFUA 1FTTA 1K79A 2M87A 1OCRH 1K6YA 3GFMA 4ZDLA 2CUFA 3I0TA 1P7IA 4ON0A 3JRGA 3C07A 4MEXF 2VLAA 1OCTC 3VOXA 4HF0A 5GPCA 3COLA 5FFZA 3JR9A 3LMMA 3KP4A 2PEXA 4U88A 1WJFA 2XGEA 5K7ZA 2FJ1A 3OOUA 2E71A 4AIDA 2L7KA 3KLNA 1G3TA 4IHVA 1FEXA 1WQ2A 3Q0UA 1XCVA 4IHXA 4CICA 1EV7A 1WFXA 4KA4A 4BE2A 4G8XA 3T0YA 4IRHA 1YRNA 2EB7A 1R7JA 5GPAA 3LSPA 4DW6A 2HEOA 3RIRA 3D0SA 2A5YB 3OYEA 3G7RA 3RH2A 4KN4X 2NYXA 2XC7A 2IS1A 4CA0A 1Z3YA 3JTHA 4DGWB 5KK1A 3BNIA 2CWEA 4HA8A 4JL3A 4EVIA 4M6VA 1VQ8I 4FHTA 4W1UA 1UI6A 3K4JA 2L2OA 1FMVA 4JX4A 4BACA 3TOAA 1F4KA 2WAFA 2DQLA 4OIOF 3I5UA 1BIBA 4XRFA 5M3MJ 3SQNA 2VN2A 3V7CA 1HSJA 3TDUC 1MKMA 4DZJA 5D8KB 3S2HJ 2DOEA 3KP3A 1AU7A 3NWSA 1ULYA 2OJED 4MQVA 2AS5F 2Q2EB 2LLKA 2QWTA 3ECHA 4CYCB 4A3DJ 5HAWA 1YIOA 1Z7UA 2X4HA 1O3QA 1ORKA 1NG6A 3HL2A 3ZQIA 4XIDA 2KISA 4BNCA 3I64A 3WTZA 3M9AA 2VUMJ 3HTAA 3GTOJ 1WH5A 2ETHA 4XLHA 2IA1A 3WTYC 2PBIA 1XGMA 2NP5A 4NDLA 4XK4A 4OIPF 1FNNA 4MFDA 5FKNA 1TWAJ 1V54H 1E3HA 3HYIA 5GAHJ 1UB9A 1RI7A 5FGMA 3MVPA 2VE9A 1F5TA 3QPTA 2VPLA 3QP6A 3BTIA 1PDNC 4IQ4A 2JUGA 2Z5UA 3SHFA 2FMYA 3L2QA 4A3KJ 2VKHA 2ID3A 3E7LA 2FOWA 4OMZA 1LDKB 4ENKA 1UMQA 1AKHB 3HOYJ 4NC8A 1I5ZA 2DMUA 2ELHA 5EEGA 4L18B 1LB2A 4AC6A 1GLNA 3P9CA 1FPQA 3HSEA 4A93J 1HKSA 4MTEA 4AVZA 3I53A 1YW8A 1I1SA 1WJDA 3GUDA 3VOEA 3HE0A 3FIWA 3WU2C 3HRMA 2COBA 3V78A 4LITA 1O57A 4B48A 3TW6A 1USTA 2DW4A 1GVJA 2EIKH 2K5CA 3TP3A 5LBQA 3S1RJ 1JXSA 4OIQF 3LAJA 3LHQA 3PUFA 5H6QA 1KONA 1UHSA 4DYRA 3LSHA 5A2QK 2XB0X 3Q3SA 2PMZA 4RAFA 2ECBA 3DWLE 2EINH 1TW2A 4BJ5C 5B3SH 2ZJ2A 2X6OA 4B44A 4BYYA 2MH9A 2A5WA 2QQAA 1BL0A 1MW7A 1J7KA 3KP2A 2CFXA 3NI7A 1WSUA 1Y39A 2XB5A 1IDYA 4PZJA 3EQLF 1H0MA 1JI8A 4KIGA 2OERA 5L3BA 2M0CA 5CVUA 4Q5SF 2ESHA 2TCTA 4G12A 4ESJA 2IS2A 3ANPA 2KDZA 2STTA 3DU6A 3LWFA 3IRQA 1LE8A 3FF5A 2W25A 1TWFJ 2H94A 5CW8A 5EZGA 1B72B 4M3BA 4U0VA 2CS3A 3ZR8X 1TP4A 2HNHA 4G94A 3EETA 3TBIA 3FXQA 3HZJA 5E1ZB 2HQRA 2P7CB 4UUSA 4HNUA 3WTTC 4MQ9F 4LIUA 3FM3A 2W48A 2J5PA 3DEWA 2HTJA 1JJ6C 2H8RA 1ACIA 2VC1A 3I3LA 4ZH4F 2WB1A 4O6JA 4CCJA 2KIMA 3BTJA 4YZEA 3SWHA 3KZYA 4M3EA 1N78A 2D45A 4AIHA 4AYBN 5L3CA 1BW5A 1MGTA 2RREA 4L9JA 3PFYA 2VODA 3ZXSA 3VVZA 3DCFA 1QNTA 2I5UA 2KZVA 3O2PE 3L2RA 1RR7A 2PLYA 2AQEA 1D5YA 4GYGA 4U9LA 4B8XA 2FBHA 3DTEA 1ON1A 4BJ6C 1S72I 3R0JA 2F48A 2KZGA 2XHKA 4BXFA 1TC3C 4D5FA 2PI0A 1SFOJ 1GV2A 2EFWA 5DV5A 3X2QH 1KQ0A 4G7HF 2RVCA 3R60A 5DYMA 1B1BA 1KU7A 2DFHA 3PFIA 5IP6A 4BXUA 2K9NA 2O8XA 2DA4A 3LOCA 1BI1A 2UXHA 3KYCB 2RNGA 1YG2A 3TMOA 3EUHC 2VJIA 1PUEE 3ASOH 2VQGA 5D6EA 3I4NJ 3F72A 5HLTA 3QOEA 1XSXA 4JBAA 2HDCA 1OCOH 3DP7A 4W97A 1PUFB 2K02A 3HTUA 2FQ4A 1YJ9I 3B73A 4KIBA 1YW9A 2VXDA 2X1CA 3RTRA 4HX8A 2K7LA 1T33A 4ITVA 4U7BA 3LQRA 4M6XA 1U5TB 3OS1A 2BE5F 1X1DA 1RZ4A 4WX9A 3A0HC 3ABLH 2WA0A 3HGYA 3IKVA 3E1SA 5HS7A 2YVXA 2KRFA 1ZKGA 2R5YB 4WXCA 2DMPA 4NNJA 2VXZA 1U9OA 2GWRA 1D3YA 1FP2A 4LGWA 5H2FC 1QU3A 5AONA 3BC8A 4OIRF 1SD7A 3F0CA 4Y33A 2HKXA 3ZP5A 1O3TA 1WPKA 1I1GA 2BOLA 5ILSA 2OBPA 2Q2EA 4CYCA 4LK0F 2Y75A 3H36A 4A3CJ 2L4MA 4O5VA 2FNAA 5LEKA 3G1MA 4A6EA 5K7FA 4E7HA 3CLOA 5DM6F 4G9YA 2YVEA 2R3SA 3FXOA 3H0GJ 3G73A 2LTPA 2OTLI 2BY3A 2DBBA 5F0HA 1BI3A 2E1OA 3LSJA 3J7YJ 2DODA 1SFKA 3MFKA 3IV5A 4HV5A 1WWXA 2NS8A 5DTDA 4A2UA 3ABUA 4CCNA 1IRXA 2XVCA 3RKXA 5DCFA 3ISPA 3HIMA 3S3NA 1AKHA 1TBXA 2E7XA 2NS7A 2P6SA 3NWTA 5D8LB 4EJUA 4AVPA 2NNYA 1T8IA 3Q0WA 1VQLI 3TO6A 5M5WJ 4K2EA 4R79A 2L9NA 5FKOA 4BE1A 2QSGX 1U8RA 2YUSA 4E7IA 4GCLA 3M1EA 2VONA 2KRCA 5IT3A 1W36C 2XAQA 2RNJA 3F8MA 3IAM2 4ENMA 4L5JA 3GTKJ 1R71A 1K61A 1W36D 2KP6A 5H20A 4LOCA 3H3UA 4OAYA 2V1XA 4BEHB 3PPBA 2DMTA 4P96A 2MW8A 1L3LA 4NELA 1H88C 3DKWA 5HOOA 3S2DJ 3JSJA 1W1WE 1O7LA 2F6CA 1MH4A 5E3OA 4DYCA 3WODF 5ILUA 4N9IA 4V19K 1QVTA 2M5WA 5KHDA 4YFKF 2P4WA 2NOGA 2XF5A 2QA4I 1QA6A 1O3RA 5H9TA 4DZPA 4GFBA 3K8PC 2A68F 2OV7A 2ISYA 2JTVA 2E1MC 4L9VA 4QTRA 3VTIA 1Y8QB 3GFLA 2ELJA 4DJAA 2YX4A 4FETA 1Y1VJ 1R9TJ 2R5ZB 1N75A 4DIQA 1YOVB 3K70D 4LB5A 1WZ2A 2GA2A 4A5NA 1M1EB 2LY2A 2ME6A 2K4JA 4HEA2 2LY9A 3CJDA 3UKGA 1B72A 2L9RA 5AQCA 3GW2A 2DDAA 2X85A 3MD2A 3ERMA 3BCBA 3NARA 4PSXA 2QIBA 4U7DA 2BY1A 1SMYF 3Q9VA 4M9SA 2JT1A 5K5OA 1D5VA 4CGRA 2MBFA 3QPHA 2A2FX 3QPLA 2ZJPF 3CCQI 2IXSA 5F1JA 4NBQA 2OI8A 3ANGA 3S93A 3FBIB 3CMMA 1RUOA 1Q1VA 2O7TA 3FX3A 2P0WA 1YJNI 1H8AC 3H9JA 3BPXA 1QHHD 3KP6A 4GCTA 1IV8A 1FIPA 4P1WA 1WRJA 3BR3A 4E7KA 3H1CA 3MN2A 1APLC 1AOYA 2GIVA 3S3MA 3PQKA 4XICA 1V5FA 4XLPF 2HOTA 1OYIA 3VW0A 2L02A 2I8DA 2LBFB 3MKYB 2GIZA 1UJ8A 3MZ8A 2X48A 2ADUA 2FA5A 3J81Z 3CESA 2VBZA 2ZSHB 1VQ9I 4IF4A 3FK7A 2W84A 1TL8A 1ZTRA 1XGSA 1FT9A 4M9XA 1P4AA 3V7SA 2LG4A 2RAEA 3J7AO 4RAYA 4DBRA 3H9GA 4M3FA 2E35A 3OL3A 3TP0A 3PO3J 1V3FA 3UNGC 1HDDC 2XIGA 5B5EC 2DT7B 5J47A 2YU3A 4C2TA 3OYCA 1XGNA 3FXMA 2GM4A 1PUFA 2BXYA 1R49A 3GTLJ 2X9DA 3CCMI 2I10A 5DM7F 4BQQA 1JTYA 3HOUJ 2B7EA 3W3CA 3PSIA 2O5RA 2XUBA 2W82A 2NAZA 1LQ1A 1ZG3A 2FX0A 3IKTA 1U5TA 1OR7C 3T8RA 2ZOYA 4A69C 2HVRA 5FKMA 4GDFA 1FC3A 1HF0A 3GCMA 2R5YA 2HKOA 3A0BC 5DCMB 1UZCA 2F4IA 4HNTA 1X1PA 1VQ7I 3Q9SA 5EF6A 2FUG2 1CQTA 2FRHA 3ZOBA 2X6YA 4MLOA 4FE7A 2JWTA 4IHTA 2H6BA 3NQOA 2DA6A 5DD8A 3H92A 2DPDA 3K9TA 1HCRA 3CQZJ 4CHUA 2H27A 3HTHA 5HDGA 2O03A 5D5XB 3IWFA 3QWLA 3U1DA 1KYWA 2F07A 2RASA 3VODA 1QRYA 2A61A 2VKEA 3K4BA 5L3GA 4FCYA 3WTSC 3BG7A 3W6KB 4CZZA 2JPBA 3ZRGA 3ONQA 3FHZA 1J9IA 3NRVA 1SMTA 4EJWA 5FMPA 2JPCA 2XF6A 4B3XA 4OWRB 2NOJB 4KJZA 4M3GA 2HOEA 3RPUA 3AQTA 2V6EA 2B1EA 1LJ9A 1WCMJ 2XDVA 2L9VA 4PSWA 3E5QA 3IUVA 3SYTA 1Y56A 1R6RA 3V7RA 3SDBA 1WGXA 4KT6A 1L0OC 2EZHA 3MAJA 2W53A 1U8BA 1GT0C 1BJZA 3AL0B 1TQMA 2HVQA 4AUXA 2LR8A 3K1NA 2ACJA 3TEDA 1Z67A 3CUQC 4IRIA 4L0YB 1EJ9A 4C3JJ 1TQPA 4PJMA 5IP9J 3IP4B 3HTSB 2DA1A 2JVHA 4NUBA 3L00A 3VPRA 2HXIA 5LGTA 3LSGA 5EEAA 5BPIA 5TGTA 4A3EJ 2WAQA 1QZEA 3OL4A 4ENJA 4BEHA 2G7HA 3K4LA 4OINF 2UXIA 1O4XA 3BCGA 4M74A 2CJJA 4D1QA 2BHYA 3CF2A 1T39A 1DU6A 4A3MJ 3FM5A 5IPAA 3GEZA 2IEKA 3MZHA 5IY5H 5CVIA 3G71I 4AIKA 2V57A 3J81K 2MG4A 3C2BA 3FBNB 5L3EA 3KFWX 2L7ZA 1TW3A 3MKZA 4D9JA 1D0ZA 3HTIA 2W4SA 3GVAA 4L9TA 2MD5A 4M72A 5EGOA 2LF8A 3VOKA 4L62A 2V1UA 2BV6A 1FSHA 1X58A 4V2GA 1HW2A 3KP7A 1YLFA 2DO7A 4ZYHA 3BG3A 3P9IA 4Q48A 2ZMEB 3RDIA 3SZTA 2R5ZA 2MH2A 1VQ5I 2AXLA 4CCMA 2M8GX 3AG1H 3ASNH 4EM2A 2V9PA 5E3NA 2L5QA 5EJCA 3GXOA 2L9SA 1B9NA 4U9NA 2FXAA 2EIMH 2FBQA 5JHFA 3ZPLA 1VQNI 3V42A 2CSOA 1MMNA 2X6WA 3V6GA 1OLTA 3GBGA 4LG3A 5BMZA 1A6QA 1FP1D 1PP7U 2KLOA 1IXRC 3OMYA 3QOPA 4BY1J 2JUCA 2BW3B 3E6DA 4HNVA 1Y1WJ 1LEBA 4R1HA 1BC8C 1NH3A 2NRAC 2VOPA 1W0TA 3HIFA 3FWEA 1WH7A 2DXIA 5J1UA 5L3DA 2L4AA 2YR2A 1LFUP 2O6GE 3FRQA 4MTDA 3QAHA 1DP3A 3AG2H 4QWQA 4BY7J 5A2QZ 1PVEA 2FOKA 2LBFA 3JRFA 1DPRA 2DAOA 2HPIA 2B63J 3K1MA 4FX4A 2EWNA 4PCQA 2PZ9A 3BZKA 3OYNA 3H5RA 4IQJA 2O61A 5FLVA 4KUMA 3SZPA 2MA3A 2LYCA 1I3QJ 5FB2A 3PL8A 3S2WA 5C3EJ 2HOSA 3ZN1A 1WJEA 2KKOA 3A02A 4RMNA 2CGPA 1LEAA 3IH4A 3D5RC 2R7WA 2K27A 1UELB 3ZQQA 2QF7A 5IOYA 3G56A 3VP5A 4BGDA 4I6ZA 4E7LA 4ABZA 4YG2F 4OD5A 1X2MA 2H8WA 1Z6RA 3ZMVA 3MNLA 2F4MB 4HYEA 1DPUA 2VE8A 4HF1A 4IXAA 4DQ2A 2DFEA 1IO2A 3GZNB 1OPCA 3KETA 1T98A 3RJPA 2JJ7A 3DPLC 4HAMA 3GTMJ 2VOOA 1R22A 1ETKA 3PM1A 2W85A 4WIBA 2VASA 3OY9A 1D8KA 4XSXF 5DDGA 2BYVE 2IW5A 1BOAA 4ESFA 4JX6A 5E3LA 5K58A 4HDVA 3MWMA 1S7EA 1A35A 1V5GA 5HDKA 4FTHA 2LDUA 3HXLA 3SEZA 1X1BA 5DCMA 5CYVA 1I6HJ 3CJQB 1JHFA 3ZMZA 3DEEA 3S32A 3FISA 2MABA 4X0GA 2LMDA 3W6JB 2A3SA 4ZDOA 2OUMA 4WCGA 1QZZA 2WB1N 2PX9A 1FYLA 4DVYP 1A04A 2L0KA 4RB1A 1RKWA 5KAFC 1IRZA 3S3OA 1YQAA 2FF4A 2H6CA 1ZGWA 2OQGA 1U3EM 1S8NA 3FHNA 4D7MA 2VC0A 2JSPA 1ZK8A 1MDMB 1JTXA 1G8XA 1B4AA 1U6GA 1SD4A 1WKMA 4FQGA 4E7JA 2EPFA 2W24A 3CCJI 2HS5A 1RKTA 4U0YA 2RQPA 4RAGA 4Y13A 2ZSIB 3S5RA 3OYMA 5FLMJ 2D1VA 2Z1DA 1QQIA 2R7FA 3M07A 2G0EA 4UB8C 5D5VB 4ZZDA 2A69F 4XOPA 3P9TA 1ZRDA 4AU7A 4GO1A 2E7WA 4UB6C 2YX7A 3ML6A 1ZR4A 2DG8A 5LRRA 5JI6A 1IF1A 2V6CA 2E19A 4IO9F 1UG2A 2IA2A 2X1DA 1PP8F 4XLFA 2VBWA 3D5SC 2CU7A 1D1CA 2HKUA 2E34A 2UZKA 2DMQA 3Q0VA 2XRNA 4L5EA 3CJNA 4A6DA 1B9MA 1JT0A 3V8LA 3HOVJ 3E97A 2ELKA 2M30A 3N05A 1W5SA 2X0LA 4QLCU 4EJTA 1F9NA 1E3OC 2EFOA 3EGQA 2RKHA 2P5VA 5ED4A 4AF5A 3A01B 2WWYA 5EEHA 1G3WA 2CW7A 4CCOA 1ONVA 5F27A 1IN6A 2IAIA 4XLCA 3KCCA 4ME9A 4J01A 1ERDA 5E20A 5GP9A 1XCBA 4U87A 2ZMEA 3WGIA 2MC3A 4FT8A 1GXPA 2EA4A 2XROA 4IVNA 2JA2A 2JRTA 4B09A 3LA7A 1QPIA 1XX5A 5FKKA 2E36A 2OAZA 3WE3A 3G3ZA 4Z6YA 3DEUA 3BR2A 1YS7A 2CMPA 2LY1A 2Z2SB 1QO0D 4UDSA 2EV6A 2VKDA 4A3LJ 5DUKA 2QENA 3MKWB 4A3JJ 3EUAA 2DA7A 4OMYA 3S15J 2R7UA 1K83J 4ZTFA 2OA4A 3LA2A 3BQZA 2K9QA 4XLNF 2IS6A 2BVMA 5ICEA 2JMWA 3RQIA 3HTJA 4ENNA 4XQFA 3K1PA 5JR3A 1VQPI 3KYDB 4XBFA 1SC7A 2ZCWA 2BW3A 3BROA 2QYOA 3B6CA 2QGUA 4MNUA 4CCKA 4P55A 4V2FA 1K7AA 2UXUA 1GHCA 2GBYA 5EFYA 1I50J 2M4GA 1PJRA 1DP7P 3QPSA 2LFBA 2AXTC 5TRDA 2Y2ZA 3CO7C 1YYVA 4P9UA 2HTSA 1RETA 2HZTA 3I9V2 1T0FC 3ZMSA 3BT9A 3F9KA 2YS9A 4HDUA 3F6OA 3F8FA 4N4NB 5BS6A 2MLGA 2QCOA 3VVXA 3GLLA 3VIBA 1R5ID 3BJAA 2VJ5A 4C30A 2YVHA 3FXRA 2WTEA 4WWCA 4ANJA 1VQOI 4BQNA 5IP7J 1XC5A 2WAEA 2DYSH 1KYZA 3GWZA 1SD5A 2XGXA 3SFZA 4A12A 3WTVC 1WHUA 4BBRJ 1MIJA 1DQUA 4C9YA 3L09A 3VYTB 3D5LA 4ZJZA 2A6TA 3DPUA 3O8GA 4LFUA 5JHUA 2GXBA 2P81A 1BM9A 3U2RA 4CZCA 4AIJA 3BDDA 3HM5A 4M9ZA 3W2WA 4D7NA 2OQRA 2WC2A 3PIOF 1OFCX 2Y31A 4BS9A 4IKFA 1BI2A 2MC4A 4XMYA 2DCEA 2XAGA 3VW1A 5GTHC 4IEJA 4EGYA 4DBQA 3M7GA 2K3PA 3OOPA 5D6FA 2RDPA 2BEOA 4XKVA 2XPVA 3EPZA 2E60A 2QLZA 1VTNC 5E17F 3IH3A 3NAUA 2VQHA 3CMEI 3H3VK 1F1ZA 4ASNA 1ZRFA 1J0RA 1WI9A 2EILH 3H5NA 3A1YA 5IT9K 1R36A 1EH6A 2PG4A 2PMHA 3UR3C 3PNTA 1ZYRF 1D0XA 3AAFA 4XONA 3TOBA 1D8JA 1XDUA 3HUGB 5FD5A 1JUSA 3JSOA 1STZA 2JVGA 3TQNA 4GFKA 1G3SA 4A3FJ 1JJ8C 4GRIA 2Y30A 3IH2A 1FOKA 2M0MA 2O0YA 2XAFA 2Y0SN 5E8IA 4Q4ZF 2RV8A 3AFHA 3CZ6A 4PGHA 3WG9A 2IJLA 1X1AA 4IL6C 2ZB9A 3CCEI 2QBYB 3PQJA 3TW7A 2ISZA 2BY2A 4G7OF 5J4YA 2DLLA 4HX4A 4UVAA 4E70A 3F21A 1MDMA 4AC0A 1BJAA 2DMNA 5KNLA 5F08A 2XAHA 2ZXJA 1KU3A 3SFIA 1BR1A 1F36A 1OCPA 2CUJA 3FKJA 3J7AY 4RB3C 2XASA 3VEPA 5HS9A 2LKXA 4FX0A 1ZN2A 1CGPA 4Y52J 3ULQB 2Y9YA 2K40A 3C7JA 3M1CA 1W7PD 2HYJA 3R4KA 1P92A 1UHWA 2K9MA 4L0ZB 3H35A 4HSTA 5TJJA 5LEJA 1FYKA 1HSTA 4HLXA 4EGZA 3C2GA 1ZH5A 1IUFA 1MBKA 4EQQA 4IX7A 2UXXA 3CD6I 2CUEA 3IL2A 2GAUA 2R7QA 2NVQJ 5K5QA 4XLEA 2YU9J 3RZDJ 2E2HJ 4AYBA 2KJBA 1Y8RB 2HQAA 3FXLA 3ZMDA 2M8EA 5LD2C 1YS6A 1DGRM 2IS4A 2KIQA 4I02A 3E6BA 3WG7H 4Z2YA 1X3WB 1YX5A 2DA5A 1IDZA 2VB6A 4E4HA 4JP0A 1XMXA 4KMUX 4IHSA 1FTZA 3RKYA 1N25A 1ETXA 1OCCH 2M7AA 2WV1A 5ICFA 3A01A 5EGOB 5CLSA 2DOFA 2Y9ZA 4GFLA 1ZGJA 1SEUA 3CCRI 2LF7A 1VQ6I 2R92J 2E2IJ 1BBYA 3K70C 2V9KA 3P9KA 2ZJQF 3Q5FA 4OU0A 2CV0A 3L7WA 4UV8A 2LKSA 1UFMA 1YHQI 2VI6A 2D2WA 4BUPA 1YITI 1BIAA 1UCRA 2GA1A 1FBUA 2K4BA 3I71A 5KAIC 5K1YA 1R1TA 1YO5C 1IAWA 4BAYA 3GF2A 1SFXA 5HNHA 2FMLA 3OYGA 2OCCH 1Z77A 3OSFA 1R4NB 2EK5A 5EG0B 3NRGA 3ABMH 3CWRA 1MJBA 3CLQA 1B59A 4CSWA 3S8PA 1FOYA 2XAJA 1JKPC 3G2BA 3HKZA 3K7AJ 4PDKA 1A31A 5IYCJ 1O3SA 3QYEA 1FY7A 4UUTA 1OYYA 1TWHJ 2EQRA 5J4VA 1B8IB 2C6YA 2XKOA 3HRTA 2UXOA 2VPRA 2L3DA 3FXUA 4A0XA 2GFNA 3MZYA 1GXQA 2CW8A 1BI0A 3KE2A 5L3FA 2KRHA 3BJ6A 4XRSA 5HSZA 3RKQA 1YW7A 3C1DA 1ZREA 2CFOA 4UXNA 3E6CC 5BQTA 1OJLA 4PJJA 4RM2A 2L01A 4A3BJ 1MSFC 4LB6B 3C3WA 3OYAA 3JW4A 1H89C 3R0AA 3A2KA 2O9LA 3S1QJ 3VB2A 3LWJA 1QGPA 2NVTJ 1D0YA 3I4PA 1CF7B 4BHBA 4XN3A 2XGDA 4IOAF 2NS0A 4CO8A 1R1UA 3U9GA 2E1MB 2HPMA 2NNNA 4EV0A 4RM3A 3KZIC 2M9HA 3ROUA 2DK5A 3MCZA 3GTJJ 4BBSJ 2JZYA 3PNYA 2EH3A 4LLLA 2HVSA 3DBLB 2HDDA 3B81A 1JGSA 4CXFA 1ZR2A 2G3BA 2BGCA 4BKXA 5ERIA 1BA5A 5C4YA 3RSNA 2B3WA 3IC7A 4PJNA 1EH7A 1X19A 1HXDA 2V79A 3M8JA 3OYJA 2WADA 4II2A 1W5TA 5J1YA 3ZN0A 2IGOA 5BNGA 1REPC 2PJPA 3N4MA 3ABTA 1K6OA 3H0DA 3OSGA 3F8CA 1HW5A 2KQRA 3OWTA 2ZC2A 4HLYA 2IU5A 2UWMA 5J40A 5CVVA 2W1OA 3LNQA 1VFCA 4B4CA 3HUGA 4FISA 1QHGA 1ZAOA 1ZARA 2UV1A 3JRCA 5D18A 2EZKA 1MNDA 3K69A 1TWGJ 4GYIA 4HX7A 4B1RA 1FOXA 1R1VA 2HGCA 2HYTA 4JX5A 2IGKA 5D5UB 2CYYA 3TGNA 4QIWN 3TKYA 1I27A 3QP5A 1LVAA 2W7NA 2RN7A 2XKPA 4FASD 2QBYA 3FZVA 4Q47A 3G4SI 2F5CA 3F6VA 2Z16A 3S17J 1Y0NA 5LGUA 1HBXG 4LLGF 4H0EA 2DT6A 2CRGA 2X51A 3SXYA 3OS0A 3AG3H 1R58A 3BTCA 1P4XA 5LHHA 2OD5A 4CCLA 1EH8A 3SDGA 4U0WA 5D19A 3EUHA 3KZZA 2K85A 3WGGA 2VQCA 1TWCJ 2P6TA 1VZ0A 5AIPA 1W0UA 2D1HA 2CQNA 1SD6A 2E1NA 2V7FA 2XSDC 1MJAA 2DQRA 2FBKA 2VBXA 3BCAA 3EUPA 5HS8A 3B6AA 3GZ6A 3DPJA 1ZG1A 3CCLI 2RHAA 3P7NA 1YFHA 5E79C 5HODA 1R4MB 3M8EA 4KDPA 1W5CC 1WVRA 3BJOA 3U1KA 1K78B 1U0JA 3KIOA 3FXJA 3ON2A 4ZYGA 2OF7A 3HHHA 4ESBA 1LFBA 2AO9A 1FMWA 1JT6A 2DOAA 3LQQA 1HQCA 2ZNYA 2XAUA 2DG7A 3RI4A 4LIVA 3DTIA 2WY7Q 2X1EA 1OISA 3BR6A 3QU3A 4IPAA 3AKZA 3KYLA 2BVLA 1VI0A 1MJ9A 3CTAA 4P5OA 3E6MA 5E8GA 1T08B 4BDZA 4N9HA 3F8NA 2JA7J 3K10A 2R93J 2P5LC 2JQ7A 4D5CA 5D4SA 2HOAA 3HEFA 1XB4A 4KYWA 2PJRB 2Z3YA 2OC6A 4PFOA 4XNFA 3JRAA 1XGOA 3WTUC 1LVKA 4XORA 3JRHA 1LPQA 3MQ0A 4OD4A 2LRDA 2NVYJ 1XDSA 2RQQA 1WJCA 2OCEA 4IRVA 2M3AA 3OIPA 3GTPJ 3QQAA 3GTGJ 2LC2A 3T6NA 1J59A 4UVCA 1HW1A 3LJLA 5FGLA 4RGRA 1XN7A 3HJEA 2N8GA 4BH9A 5J8CA 1A5JA 2QTQA 2JRMA 4LK1F 5EG0A 1VQKI 4A3GJ 4EEFG 1RRJA 2XV4S 4I01A 3I56I 3ZMUA 4E7ZA 1ETWA 2F5EA 4XM3A 2EJRA 3CUQB 2P5KA 1UAAA 1KA8A 4RBOA 1GUUA 3ZQ7A 3FK6A 5M3FJ 3LAPA 2IGNA 1KU9A 4MK6A 2LNBA 2ZCXA 1S7OA 3K4CA 4WXDA 1MBHA 4F3QA 1MMAA 1B8IA 3SJMA 1S29A 1LNWA 4KN7X 2FSWA 2ZXHA 2QUFA 2ICWG 3CCUI 2HYGD 5DAJA 5B1AH 3H5AA 4AM3A 2FE3A 4BHPA 3VFZA 4CUGA 3TL4X 1MD0A 2DDBA 1I6XA 1D1BA 2MSYA 3BZCA 4A5MA 1VQMI 2V4JC 5ICCA 2ZOZA 4WF2A 3OYIA 3ON4A 3LSKA 1G6NA 2H09A 3ZQGA 1IN4A 2R7RA 4MO7A 3DBHB 1MBEA 2BY0A 2Q8KA 3T5XA 2PMZN 1CF7A 4UHTA 2HQ5A 2D6YA 4YFNF 2KT0A 2WGBA 2HXOA 3RQ4A 3ZMTA 2MD0A 1MMDA 2ZCNA 3OYBA 3GEUA 4F93B 4KICA 2VJJA 5C44J 1E17A 2GUHA 1JHHA 1V5EA 1XMAA 2OPTA 2YPRA 4ZTJA 4HQMA 1ZGAA 4HQEA 4CDGA 2G7UA 5HLGA 5IYBJ 2BXZA 2LK2A 5GADJ 4FE4A 3O6BB 2HR3A 5E18F 3M4OJ 4BL0B 2NXNB 4F92B 2LD5A 1T2KA 3BOQA 1RIOH 5CQEA 3LSRA 3HSFA 4NB5A 1ZQ3P 4ICHA 1E2XA 2ECCA 2CW0F 2FQ3A 4MEYF 1HA8A 3O60A 4XRSG 2OU2A 5F0FA 3HRSA 1IZ1A 1K4TA 4C3HJ 1LFPA 5CKTA 4OOIA 4UNOA 2EZLA 2KHMA 5FD6A 2A07F 2EZIA 1BC7C 2TDXA 3KEYA 3OR2C 2F2EA 1A6IA 1HLVA 1Q1HA 1YJWI 4I0AA 3BG9A 3DBRB 1SVLA 3IAS2 4I09A 2DFFA 4YIFA 4YEJA 1I39A 1BN5A 2OZ6A 3KEQA 1XS9A 1H9GA 4HRIA 4EM0B 1BR2A 1QPMA 3D1NI 2HFHA 4G7ZF 2B0LA 3DV8A 3JRDA 2DPUA 5CQGA 3EYIA 3BR5A 3BHQA 4I2OA 1RUNA 5JLXA 3DTKA 3KNWA 1K4SA 3IRRA 3QBMA 4A0YA 4NC6A 2KDOA 3W2VA 3HOTA 1X4OA 4JQFA 4XN0A 4ZYAA 5CVJA 3RD3A 5D4RA 5KCMA 4WXHA 4XLAA 2QKLB 4QSHA 4HZFA 5HLIA 2Q1ZB 1YIJI 5EDNA 3KEOA 1P9QC 4RB0A 3MMYB 1LDJA 5J6XA 3NNRA 2IT0A 3BLYA 2QWWA 4ZZLA 2V1NA 2KL4A 2LKPA 2LP0A 4BJTA 4EATA 4NHJA 4KISA 3WTXC 4L9NA 2IPQX 5GAGJ 5E1XA 4GGGA 3CCSI 1OQYA 3OIQA 2M1BA 3BPVA 1K78A 2PN6A 1OR7A 3JCUC 5IT9Z 2K9SA 2P7VB 5LFAA 3IUOA 4EM1A 2E5ZA 5EZHA 2XDNA 4C2MA 1MH3A 1X1CA 1VF9A 2EFPA 5J1RA 3WTWC 1IN5A 2QOPA 5FRNA 1R23A 2XSJC 4YELA 5HNFA 3PJRA 4YRVA 4B43A 4E7SA 2L7MP 1UI5A 4CYDA 5J3LA 3BR1A 4PK4A 4KMFA 2FEZA 3VSLA 1ITYA 1Z6TA 1PYVA 2EV0A 4HW0A 2DT5A 1UHMA 4PGGA 2WBMA 2O3FA 4R8HA 1XSDA 3PO2J 2DA3A 3FMRA 3H3ZA 2V26A 4QPQA 3DKYA 2MYSA 3C18A 4HSRA 2ZO4A 2PQ8A 3NEUA 2PJRA 3HOSA 1P6RA 2TRTA 2R7VA 3PUBA 1IN8A 4RGSA 2FD5A 3CC2I 1TQIA 3FXKA 3NPIA 4JK1X 1TLHB 5BPDA 1SVOA 1V4RA 2XPUA 3VDXA 3BJBA 6PAXA 5HBUA 1FBSA 4PFPA 4AWXB 4F55A 2BHZA 2V1DA 3A03A 4YIRX 1QZYA 2VQLA 2IRFG 2QSFX 1D1AA 2PFBA 3DQVC 3I54A 1NK2P 3SZGA 2Y48A 2FBIA 4GXOA 1TT5B 2DN0A 1SANA 3WHBA 4HV6A 3HOXJ 3CUOA 1RESA 2M2EA 2QQBA 2JA5J 2A05A 2QEXI 3GTQJ 3EDPA 2NP3A 4NC7A 1JUMA 5KVRA 1U5TC 4HG2A 1BR4A 1MBJA 1T95A 3CUQA 5DD4A 1QBJA 3DXJF 2UUZA 4M3DA 4ZYEA 1E0EA 1TNSA 4N4OB 2FU4A 4XSZF 3PSFA 1FIAA 4S04A 5F04A 5B1BH 1VQ4I 2WUIA 2QKMB 2NX4A 2K9LA 2PBXA 2M7BA 2ZY9A 4PJ0C 3PIPF 3BP8A 1Y6IA 4BXXJ 2LH9A 4RS8A 1DUXC 3K4NA 4Y3OA 3HSRA 1UG0A 4LLNA 3OR1C 5FRMA 4BQOA 3OYFA 1AHDP 1ZHFA 1B6AA 1HC8A 1Z7LA 3I59B 1P2FA 1U9NA 1YE9A 2B9SA 3QU6A 4Y15A 4ZYDA 5F64A 3CRJA 5D1RA 4LJZF 3SEQA 2G7SA 2K3FA 3ZQLA 1GDTA 2R7DA 1ENHA 3E3VA 3DFGA 2H1LA 4C2MJ 4BDYA 3PASA 4II3A 3V8JA 1XPXA 3U21A 3LFUA 3RPUD 3S1MJ 5TISC 1EF4A 2R7ZJ 2M4KA 4Y7NJ 2CQKA 1SFEA 3FKIJ 1EKEA 3K4MA 4ETSA 1KGSA 2R4GA 2NVUB 4C2UA 3R6SA 1ETOA 1X3ZB 1AA7A 5JVTA 1Z0XA 3CCVI 1VNDA 2GOXB 2KMUA 1G3YA 3S16J 1G59A 1NK3P 1WJ5A 1HKQA 5JLWA 2KPMA 4IJAA 1HOMA 1IXCA 2HU9A 4KFCA 1DU0A 5E3MA 1TNTA 2LVSA 4JYKA 2QVOA 1NHAA 2YSRA 1DGWY 4KWAA 3F22A 2VJ4A 3CJTB 3K6GA 2HDWA 4IHYA 4YFXF 3ESWB 3LFKA 1MMSA 1IJWC 1S6LA 2MGQA 5JVGF 3WGHA 3HKZN 1XMKA 2R7XA 5FROA 3BWGA 4LG0B 5GAEJ 1FBQA 4X6AJ 3GFIA 5FFXA 3GZIA 2PMUA 4WK8F 1OYWA 1MZBA 5CJ9A 3RYPA 3MEXA 1J2XA 3CDHA 3BG6A 1AWCA 2QZ8A 1WJBA 4N0BA 3VWBA 1IV6A 3K4KA 4IRGA 4EJVA
chains in the Genus database with same CATH topology
1UHSA 4DYRA 1BA5A 4HNVA 5C4YA 1Y1WJ 2XB0X 3Q3SA 1W0TA 2ECBA 5FJ8J 1WH7A 1P7JA 5J1UA 4ACIA 5J1YA 4GCKA 2X6OA 1LFUP 5BNGA 3FRQA 1BL0A 4BY7J 3OSGA 3NI7A 3JRFA 2XB5A 1IDYA 2B63J 2IU5A 2OERA 3F1BA 2PZ9A 2M0CA 1U78A 3LNQA 2TCTA 1VFCA 4G12A 5IOZA 5FLVA 4MIMA 4B4CA 3ANPA 1GV5A 4FISA 2KDZA 1I3QJ 1IGNA 3HOZJ 3JRCA 5C3EJ 2HOSA 5D18A 2EZKA 3A02A 1LE8A 1TWFJ 1TWGJ 4B1RA 2HYTA 5CW8A 3IH4A 5EZGA 4S0HB 4M3BA 4JX5A 5IOYA 1B72B 2QF7A 1G2HA 3G56A 3VP5A 3BG5A 4QIWN 5C4XJ 4I6ZA 3AQSA 3WHCA 4UUSA 4ABZA 1X2MA 1ETYA 1MBFA 1JJ6C 2ID6A 2W48A 3DEWA 2H8RA 3S17J 3MNLA 2AHQA 5EYRA 2DJNA 3CMYA 1NTCA 3BTJA 4YZEA 2CRGA 2HI3A 4M3EA 2JJ7A 4AYBN 3GTMJ 3S1NJ 1BW5A 1XG1A 2XGCA 1ETKA 3PM1A 3JRBA 3BTCA 3JRIA 3VVYA 2DTZA 3SDGA 3VVZA 3DCFA 9ANTA 5D19A 1TWCJ 4JX6A 1RR7A 5E3LA 2GLOA 3CCYA 5K58A 1W0UA 1S7EA 3MKLA 1D5YA 4FTHA 2XSDC 3EUPA 1MNMC 3QKXA 3B6AA 3DPJA 2CQXA 1TC3C 4D5FA 1I6HJ 1SFOJ 1GV2A 2RHAA 5K7HA 3O8HA 5HODA 3FISA 4J19A 2WB1N 5IP6A 2L0KA 3ON2A 2OF7A 2K9NA 1LFBA 1RKWA 2AO9A 2DA4A 3LOCA 1JT6A 2UXHA 1IRZA 5M5YJ 1ZGWA 2DG7A 2XPWA 3HDDA 3I4NJ 4RDUA 3BR6A 4D7MA 1GVDA 1ZK8A 1JTXA 4JKZA 2CQQA 4W97A 1VI0A 1PUFB 3S14J 2FQ4A 2JA7J 2R93J 1RKTA 3S5RA 3JREA 4D5CA 2HOAA 3HEFA 1T33A 2WAQN 5FLMJ 1IC8A 4I76A 4HKUA 3JRAA 2G0EA 3JRHA 3P9TA 3VW2A 3HGYA 1QVUA 2NVYJ 1ZKGA 2R5YB 2O7OA 2DMPA 1U9OA 1ZR4A 3GTPJ 2DG8A 3QQAA 3GTGJ 3T6NA 2VKVA 1F43A 2E19A 1UG2A 2NVXJ 3LJLA 5FGLA 2REKA 2CU7A 3BR0A 3F0CA 1A5JA 2N8GA 3K2AA 2QTQA 2HKUA 1WPKA 4PXIA 5EG0A 4CYCA 2DMQA 3Q0VA 4A3GJ 4EEFG 2GENA 4L5EA 4A3CJ 1JT0A 1MBGA 3G1MA 3HOVJ 5K7FA 3KZ9A 1ETWA 2ELKA 2YVEA 3H0GJ 4RBOA 1GUUA 2LTPA 4X1EA 3FK6A 5M3FJ 2JA6J 2JN6A 1E3OC 1YRNB 4MK6A 1JKQC 5CXIA 1X2NA 3W6VA 3EGQA 5F0HA 2ZCXA 1MBHA 2G7GA 2E1OA 1B8IA 3G1OA 4AF5A 3LSJA 3SJMA 3A01B 3IV5A 2G7LA 5DTDA 2NS8A 5F27A 3L1PA 2IAIA 2JA8J 4ME9A 5DAJA 2XRLA 3M3YJ 5GP9A 3HIMA 2EBIA 2MSYA 1AKHA 2H1KA 3E7QA 2ZOZA 2NS7A 3ON4A 3Q0WA 5M5WJ 2QKOA 3ZQGA 5FKOA 1QPIA 4MO7A 5FKKA 1MBEA 3RZOJ 2PMZN 2YUSA 3BR2A 4MFEA 2L7FP 2HQ5A 3HBLA 4GCLA 2D6YA 4UDSA 4A3LJ 2KT0A 2WGBA 4A3JJ 2HXOA 2DA7A 3S15J 3GTKJ 1K61A 2ZCNA 1K83J 3GEUA 4LOCA 5C44J 3BQZA 2K9QA 2GUHA 2OPTA 5CXGA 3HTJA 3PPBA 3VUQA 2JMWA 3RQIA 2DMTA 1JUPA 2MW8A 1T56A 5IYBJ 1H88C 3S2DJ 4NELA 2LK2A 3JSJA 4FE4A 3M4OJ 2UXPA 2LD5A 1ETVA 3B6CA 1MH4A 5E3OA 4DYCA 4V2FA 1BW6A 1QVTA 1JKRC 3I4MJ 2UXUA 3LSRA 4DYQA 2GBYA 5EFYA 1I50J 2R0QC 2NOGA 4ICHA 3BTLA 1ZQ3P 4B3AA 2ECCA 3QPSA 4NN1A 2LFBA 1POGA 2M34A 2JK3A 2Y2ZA 1HDPA 5H9TA 4IHWA 3O60A 4DZPA 1RETA 4GFBA 4XRSG 4QTRA 1JKOC 3BT9A 3OIOA 5F0FA 4C3HJ 2YS9A 2EZLA 2QCOA 3VVXA 1Y1VJ 1R9TJ 2R5ZB 3VIBA 2YVHA 2EZIA 4A3IJ 4C3IJ 5IP7J 1XC5A 2ME6A 2LY9A 3CJDA 2IBDA 3UKGA 1B72A 1A6IA 1HLVA 2O8KA 2ZCMA 4BBRJ 2L9RA 3BG9A 5AQCA 3NARA 2QIBA 4CGRA 3O8GA 2D5VA 3HGGA 1XS9A 2P81A 3QPLA 3HM5A 3D1NI 4D7NA 5F1JA 3HOWJ 2OI8A 3ANGA 1OFCX 3JRDA 3KKDA 1Q1VA 2Y31A 2O7TA 3BR5A 1H8AC 3BHQA 5JLXA 4GCTA 1FIPA 3HB9A 3VW1A 1RPWA 4IEJA 3KNWA 3BR3A 3QBMA 3MN2A 2E2JJ 2XPVA 5M5XJ 1APLC 3ZQHA 3RD3A 4JNNA 3IH3A 3NAUA 4XICA 3H3VK 4QSHA 2HOTA 3VW0A 5EDNA 3NNRA 2X48A 2LP0A 2DA2A 3FK7A 1ZTRA 1JUSA 1MSEC 3BRUA 4GFKA 1LE8B 2RAEA 5IYDJ 4A3FJ 2K9SA 1JJ8C 2Y30A 4M3FA 3IH2A 3TP0A 2Y0SN 5EZHA 3PO3J 2XDNA 3ZQCA 1HDDC 1ETQA 1MH3A 5J1RA 1VF9A 3BQYA 2QOPA 4UUSB 2ZB9A 5FHPA 3TW7A 1WI3A 1IG7A 2L7MP 1UI5A 5DS9A 3NXCA 5J3LA 4AC0A 3BR1A 4MXMA 1ITYA 2DMNA 5F0CA 1PUFA 2GM4A 5F08A 3GTLJ 2X9DA 2I10A 1JGGA 2Q24A 3SFIA 3PO2J 1F36A 1OCPA 2DA3A 1JTYA 5C4JJ 3HOUJ 3KKCA 2LKXA 4Y52J 3G1LA 2FX0A 1SGMA 2Y9YA 2K40A 2TRTA 3ZQFA 2ME0A 2HYJA 2ZOYA 2FD5A 4A69C 5FKMA 3NPIA 4XRMA 5FKLA 1HF0A 2R5YA 2XPUA 3CDLA 1IUFA 1MBKA 3BJBA 1FTTA 5HBUA 2CUEA 5EF6A 2NVQJ 1CQTA 3ZOBA 2CUFA 3A03A 1P7IA 3JRGA 4MLOA 4FE7A 3RZDJ 2E2HJ 2JWTA 1OCTC 5GPCA 2YU9J 1NK2P 3C07A 3COLA 3VOXA 3JR9A 2DN0A 1SANA 3WHBA 2DA6A 3HOXJ 1RESA 2M2EA 2XGEA 5K7ZA 2FJ1A 3OOUA 2JA5J 1HCRA 3CQZJ 3GTQJ 4IHVA 3HTHA 2NP3A 2DA5A 1FEXA 1JUMA 2RASA 1IDZA 2F07A 3Q0UA 1MBJA 4IHXA 4JP0A 1QRYA 2VKEA 4M3DA 4FCYA 1FTZA 1YRNA 1ETXA 1FIAA 5GPAA 3LSPA 5F04A 4DW6A 2WV1A 2WUIA 3A01A 5FMPA 5EGOB 2NX4A 3G7RA 2PBXA 3RH2A 2Y9ZA 4GFLA 4M3GA 2R92J 3AQTA 2E2IJ 4BXXJ 3BNIA 1WCMJ 4JL3A 4M6VA 3IUVA 4W1UA 1UI6A 4JX4A 1WGXA 2VI6A 2EZHA 1AHDP 2W53A 1U8BA 1GT0C 1BJZA 5M3MJ 4AUXA 1U9NA 2LR8A 3TEDA 4C3JJ 3CRJA 5IP9J 4DZJA 5D1RA 3S2HJ 2G7SA 2DA1A 3VPRA 1Z77A 3ZQLA 1GDTA 3OSFA 2HXIA 1ENHA 3LSGA 1AU7A 5EEAA 4A3EJ 4C2MJ 3PASA 2LLKA 5EG0B 2QWTA 4CYCB 3NRGA 5HAWA 2UXIA 1ORKA 1O4XA 3BCGA 3CWRA 2CJJA 3ZQIA 4XIDA 3S1MJ 1EF4A 2R7ZJ 1DU6A 4A3MJ 1JKPC 4Y7NJ 5IPAA 2VUMJ 3HTAA 3FKIJ 2IEKA 3K7AJ 3GTOJ 1WH5A 1ETOA 5IYCJ 2V57A 2MG4A 3C2BA 2NP5A 4NDLA 4XK4A 4UUTA 1TWHJ 2EQRA 1Z0XA 3LHQA 2L7ZA 4MFDA 5FKNA 1TWAJ 1VNDA 1B8IB 3S16J 1NK3P 3HTIA 2UXOA 5JLWA 2VPRA 3MVPA 2GFNA 5EGOA 1HOMA 3BTIA 3VOKA 4L62A 1DU0A 5E3MA 4XRSA 5HSZA 4A3KJ 3RKQA 2ID3A 3E7LA 2LVSA 1X58A 4V2GA 4JYKA 1OJLA 1UMQA 1AKHB 2R5ZA 3BG3A 4A3DJ 1MSFC 4A3BJ 3HOYJ 4KWAA 1H89C 2M8GX 2DMUA 2O9LA 4IHYA 3S1QJ 4AC6A 1IJWC 3LWJA 2MGQA 5E3NA 2NVTJ 3HKZN 4A93J 2XGDA 4X6AJ 2M9HA 2FBQA 3GZIA 3GTJJ 3HE0A 3V78A 3FIWA 4BBSJ 2COBA 2EH3A 3V6GA 3TW6A 2HDDA 3GBGA 3B81A 3TP3A 3S1RJ 1ZR2A 1IV6A 1FJLA 2G3BA 4BKXA 4BY1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHS A;  4DYR A;  1BA5 A;  4HNV A;  5C4Y A;  1Y1W J;  2XB0 X;  3Q3S A;  1W0T A;  2ECB A;  5FJ8 J;  1WH7 A;  1P7J A;  5J1U A;  4ACI A;  5J1Y A;  4GCK A;  2X6O A;  1LFU P;  5BNG A;  3FRQ A;  1BL0 A;  4BY7 J;  3OSG A;  3NI7 A;  3JRF A;  2XB5 A;  1IDY A;  2B63 J;  2IU5 A;  2OER A;  3F1B A;  2PZ9 A;  2M0C A;  1U78 A;  3LNQ A;  2TCT A;  1VFC A;  4G12 A;  5IOZ A;  5FLV A;  4MIM A;  4B4C A;  3ANP A;  1GV5 A;  4FIS A;  2KDZ A;  1I3Q J;  1IGN A;  3HOZ J;  3JRC A;  5C3E J;  2HOS A;  5D18 A;  2EZK A;  3A02 A;  1LE8 A;  1TWF J;  1TWG J;  4B1R A;  2HYT A;  5CW8 A;  3IH4 A;  5EZG A;  4S0H B;  4M3B A;  4JX5 A;  5IOY A;  1B72 B;  2QF7 A;  1G2H A;  3G56 A;  3VP5 A;  3BG5 A;  4QIW N;  5C4X J;  4I6Z A;  3AQS A;  3WHC A;  4UUS A;  4ABZ A;  1X2M A;  1ETY A;  1MBF A;  1JJ6 C;  2ID6 A;  2W48 A;  3DEW A;  2H8R A;  3S17 J;  3MNL A;  2AHQ A;  5EYR A;  2DJN A;  3CMY A;  1NTC A;  3BTJ A;  4YZE A;  2CRG A;  2HI3 A;  4M3E A;  2JJ7 A;  4AYB N;  3GTM J;  3S1N J;  1BW5 A;  1XG1 A;  2XGC A;  1ETK A;  3PM1 A;  3JRB A;  3BTC A;  3JRI A;  3VVY A;  2DTZ A;  3SDG A;  3VVZ A;  3DCF A;  9ANT A;  5D19 A;  1TWC J;  4JX6 A;  1RR7 A;  5E3L A;  2GLO A;  3CCY A;  5K58 A;  1W0U A;  1S7E A;  3MKL A;  1D5Y A;  4FTH A;  2XSD C;  3EUP A;  1MNM C;  3QKX A;  3B6A A;  3DPJ A;  2CQX A;  1TC3 C;  4D5F A;  1I6H J;  1SFO J;  1GV2 A;  2RHA A;  5K7H A;  3O8H A;  5HOD A;  3FIS A;  4J19 A;  2WB1 N;  5IP6 A;  2L0K A;  3ON2 A;  2OF7 A;  2K9N A;  1LFB A;  1RKW A;  2AO9 A;  2DA4 A;  3LOC A;  1JT6 A;  2UXH A;  1IRZ A;  5M5Y J;  1ZGW A;  2DG7 A;  2XPW A;  3HDD A;  3I4N J;  4RDU A;  3BR6 A;  4D7M A;  1GVD A;  1ZK8 A;  1JTX A;  4JKZ A;  2CQQ A;  4W97 A;  1VI0 A;  1PUF B;  3S14 J;  2FQ4 A;  2JA7 J;  2R93 J;  1RKT A;  3S5R A;  3JRE A;  4D5C A;  2HOA A;  3HEF A;  1T33 A;  2WAQ N;  5FLM J;  1IC8 A;  4I76 A;  4HKU A;  3JRA A;  2G0E A;  3JRH A;  3P9T A;  3VW2 A;  3HGY A;  1QVU A;  2NVY J;  1ZKG A;  2R5Y B;  2O7O A;  2DMP A;  1U9O A;  1ZR4 A;  3GTP J;  2DG8 A;  3QQA A;  3GTG J;  3T6N A;  2VKV A;  1F43 A;  2E19 A;  1UG2 A;  2NVX J;  3LJL A;  5FGL A;  2REK A;  2CU7 A;  3BR0 A;  3F0C A;  1A5J A;  2N8G A;  3K2A A;  2QTQ A;  2HKU A;  1WPK A;  4PXI A;  5EG0 A;  4CYC A;  2DMQ A;  3Q0V A;  4A3G J;  4EEF G;  2GEN A;  4L5E A;  4A3C J;  1JT0 A;  1MBG A;  3G1M A;  3HOV J;  5K7F A;  3KZ9 A;  1ETW A;  2ELK A;  2YVE A;  3H0G J;  4RBO A;  1GUU A;  2LTP A;  4X1E A;  3FK6 A;  5M3F J;  2JA6 J;  2JN6 A;  1E3O C;  1YRN B;  4MK6 A;  1JKQ C;  5CXI A;  1X2N A;  3W6V A;  3EGQ A;  5F0H A;  2ZCX A;  1MBH A;  2G7G A;  2E1O A;  1B8I A;  3G1O A;  4AF5 A;  3LSJ A;  3SJM A;  3A01 B;  3IV5 A;  2G7L A;  5DTD A;  2NS8 A;  5F27 A;  3L1P A;  2IAI A;  2JA8 J;  4ME9 A;  5DAJ A;  2XRL A;  3M3Y J;  5GP9 A;  3HIM A;  2EBI A;  2MSY A;  1AKH A;  2H1K A;  3E7Q A;  2ZOZ A;  2NS7 A;  3ON4 A;  3Q0W A;  5M5W J;  2QKO A;  3ZQG A;  5FKO A;  1QPI A;  4MO7 A;  5FKK A;  1MBE A;  3RZO J;  2PMZ N;  2YUS A;  3BR2 A;  4MFE A;  2L7F P;  2HQ5 A;  3HBL A;  4GCL A;  2D6Y A;  4UDS A;  4A3L J;  2KT0 A;  2WGB A;  4A3J J;  2HXO A;  2DA7 A;  3S15 J;  3GTK J;  1K61 A;  2ZCN A;  1K83 J;  3GEU A;  4LOC A;  5C44 J;  3BQZ A;  2K9Q A;  2GUH A;  2OPT A;  5CXG A;  3HTJ A;  3PPB A;  3VUQ A;  2JMW A;  3RQI A;  2DMT A;  1JUP A;  2MW8 A;  1T56 A;  5IYB J;  1H88 C;  3S2D J;  4NEL A;  2LK2 A;  3JSJ A;  4FE4 A;  3M4O J;  2UXP A;  2LD5 A;  1ETV A;  3B6C A;  1MH4 A;  5E3O A;  4DYC A;  4V2F A;  1BW6 A;  1QVT A;  1JKR C;  3I4M J;  2UXU A;  3LSR A;  4DYQ A;  2GBY A;  5EFY A;  1I50 J;  2R0Q C;  2NOG A;  4ICH A;  3BTL A;  1ZQ3 P;  4B3A A;  2ECC A;  3QPS A;  4NN1 A;  2LFB A;  1POG A;  2M34 A;  2JK3 A;  2Y2Z A;  1HDP A;  5H9T A;  4IHW A;  3O60 A;  4DZP A;  1RET A;  4GFB A;  4XRS G;  4QTR A;  1JKO C;  3BT9 A;  3OIO A;  5F0F A;  4C3H J;  2YS9 A;  2EZL A;  2QCO A;  3VVX A;  1Y1V J;  1R9T J;  2R5Z B;  3VIB A;  2YVH A;  2EZI A;  4A3I J;  4C3I J;  5IP7 J;  1XC5 A;  2ME6 A;  2LY9 A;  3CJD A;  2IBD A;  3UKG A;  1B72 A;  1A6I A;  1HLV A;  2O8K A;  2ZCM A;  4BBR J;  2L9R A;  3BG9 A;  5AQC A;  3NAR A;  2QIB A;  4CGR A;  3O8G A;  2D5V A;  3HGG A;  1XS9 A;  2P81 A;  3QPL A;  3HM5 A;  3D1N I;  4D7N A;  5F1J A;  3HOW J;  2OI8 A;  3ANG A;  1OFC X;  3JRD A;  3KKD A;  1Q1V A;  2Y31 A;  2O7T A;  3BR5 A;  1H8A C;  3BHQ A;  5JLX A;  4GCT A;  1FIP A;  3HB9 A;  3VW1 A;  1RPW A;  4IEJ A;  3KNW A;  3BR3 A;  3QBM A;  3MN2 A;  2E2J J;  2XPV A;  5M5X J;  1APL C;  3ZQH A;  3RD3 A;  4JNN A;  3IH3 A;  3NAU A;  4XIC A;  3H3V K;  4QSH A;  2HOT A;  3VW0 A;  5EDN A;  3NNR A;  2X48 A;  2LP0 A;  2DA2 A;  3FK7 A;  1ZTR A;  1JUS A;  1MSE C;  3BRU A;  4GFK A;  1LE8 B;  2RAE A;  5IYD J;  4A3F J;  2K9S A;  1JJ8 C;  2Y30 A;  4M3F A;  3IH2 A;  3TP0 A;  2Y0S N;  5EZH A;  3PO3 J;  2XDN A;  3ZQC A;  1HDD C;  1ETQ A;  1MH3 A;  5J1R A;  1VF9 A;  3BQY A;  2QOP A;  4UUS B;  2ZB9 A;  5FHP A;  3TW7 A;  1WI3 A;  1IG7 A;  2L7M P;  1UI5 A;  5DS9 A;  3NXC A;  5J3L A;  4AC0 A;  3BR1 A;  4MXM A;  1ITY A;  2DMN A;  5F0C A;  1PUF A;  2GM4 A;  5F08 A;  3GTL J;  2X9D A;  2I10 A;  1JGG A;  2Q24 A;  3SFI A;  3PO2 J;  1F36 A;  1OCP A;  2DA3 A;  1JTY A;  5C4J J;  3HOU J;  3KKC A;  2LKX A;  4Y52 J;  3G1L A;  2FX0 A;  1SGM A;  2Y9Y A;  2K40 A;  2TRT A;  3ZQF A;  2ME0 A;  2HYJ A;  2ZOY A;  2FD5 A;  4A69 C;  5FKM A;  3NPI A;  4XRM A;  5FKL A;  1HF0 A;  2R5Y A;  2XPU A;  3CDL A;  1IUF A;  1MBK A;  3BJB A;  1FTT A;  5HBU A;  2CUE A;  5EF6 A;  2NVQ J;  1CQT A;  3ZOB A;  2CUF A;  3A03 A;  1P7I A;  3JRG A;  4MLO A;  4FE7 A;  3RZD J;  2E2H J;  2JWT A;  1OCT C;  5GPC A;  2YU9 J;  1NK2 P;  3C07 A;  3COL A;  3VOX A;  3JR9 A;  2DN0 A;  1SAN A;  3WHB A;  2DA6 A;  3HOX J;  1RES A;  2M2E A;  2XGE A;  5K7Z A;  2FJ1 A;  3OOU A;  2JA5 J;  1HCR A;  3CQZ J;  3GTQ J;  4IHV A;  3HTH A;  2NP3 A;  2DA5 A;  1FEX A;  1JUM A;  2RAS A;  1IDZ A;  2F07 A;  3Q0U A;  1MBJ A;  4IHX A;  4JP0 A;  1QRY A;  2VKE A;  4M3D A;  4FCY A;  1FTZ A;  1YRN A;  1ETX A;  1FIA A;  5GPA A;  3LSP A;  5F04 A;  4DW6 A;  2WV1 A;  2WUI A;  3A01 A;  5FMP A;  5EGO B;  2NX4 A;  3G7R A;  2PBX A;  3RH2 A;  2Y9Z A;  4GFL A;  4M3G A;  2R92 J;  3AQT A;  2E2I J;  4BXX J;  3BNI A;  1WCM J;  4JL3 A;  4M6V A;  3IUV A;  4W1U A;  1UI6 A;  4JX4 A;  1WGX A;  2VI6 A;  2EZH A;  1AHD P;  2W53 A;  1U8B A;  1GT0 C;  1BJZ A;  5M3M J;  4AUX A;  1U9N A;  2LR8 A;  3TED A;  4C3J J;  3CRJ A;  5IP9 J;  4DZJ A;  5D1R A;  3S2H J;  2G7S A;  2DA1 A;  3VPR A;  1Z77 A;  3ZQL A;  1GDT A;  3OSF A;  2HXI A;  1ENH A;  3LSG A;  1AU7 A;  5EEA A;  4A3E J;  4C2M J;  3PAS A;  2LLK A;  5EG0 B;  2QWT A;  4CYC B;  3NRG A;  5HAW A;  2UXI A;  1ORK A;  1O4X A;  3BCG A;  3CWR A;  2CJJ A;  3ZQI A;  4XID A;  3S1M J;  1EF4 A;  2R7Z J;  1DU6 A;  4A3M J;  1JKP C;  4Y7N J;  5IPA A;  2VUM J;  3HTA A;  3FKI J;  2IEK A;  3K7A J;  3GTO J;  1WH5 A;  1ETO A;  5IYC J;  2V57 A;  2MG4 A;  3C2B A;  2NP5 A;  4NDL A;  4XK4 A;  4UUT A;  1TWH J;  2EQR A;  1Z0X A;  3LHQ A;  2L7Z A;  4MFD A;  5FKN A;  1TWA J;  1VND A;  1B8I B;  3S16 J;  1NK3 P;  3HTI A;  2UXO A;  5JLW A;  2VPR A;  3MVP A;  2GFN A;  5EGO A;  1HOM A;  3BTI A;  3VOK A;  4L62 A;  1DU0 A;  5E3M A;  4XRS A;  5HSZ A;  4A3K J;  3RKQ A;  2ID3 A;  3E7L A;  2LVS A;  1X58 A;  4V2G A;  4JYK A;  1OJL A;  1UMQ A;  1AKH B;  2R5Z A;  3BG3 A;  4A3D J;  1MSF C;  4A3B J;  3HOY J;  4KWA A;  1H89 C;  2M8G X;  2DMU A;  2O9L A;  4IHY A;  3S1Q J;  4AC6 A;  1IJW C;  3LWJ A;  2MGQ A;  5E3N A;  2NVT J;  3HKZ N;  4A93 J;  2XGD A;  4X6A J;  2M9H A;  2FBQ A;  3GZI A;  3GTJ J;  3HE0 A;  3V78 A;  3FIW A;  4BBS J;  2COB A;  2EH3 A;  3V6G A;  3TW6 A;  2HDD A;  3GBG A;  3B81 A;  3TP3 A;  3S1R J;  1ZR2 A;  1IV6 A;  1FJL A;  2G3B A;  4BKX A;  4BY1 J; 
#chains in the Genus database with same CATH topology
 1S7A A;  1Z05 A;  1MMG A;  4G6D A;  3VYS B;  5FLX Z;  1W4M A;  3L2C A;  5FJ8 J;  4G6T B;  1P7J A;  5AIQ A;  1FSE A;  4ACI A;  2IVM A;  4BHC A;  5LLQ A;  4GCK A;  4J00 A;  1FOW A;  1LKX A;  5BOX A;  2EIJ H;  3CC4 I;  3ECO A;  5F1R A;  4XOT A;  3CO6 C;  2VL8 A;  3K0L A;  1O7F A;  2CQ7 A;  2GOM A;  2DTR A;  1ZRC A;  3GX4 X;  4OAZ A;  3F1B A;  1I3A A;  2HWV A;  1U78 A;  2L54 A;  2ZJR F;  1X3U A;  4XKC A;  5IOZ A;  4ZC3 A;  4MIM A;  2R7T A;  1GV5 A;  3A4C A;  1IGN A;  4RGX A;  3FMQ A;  3JAM Z;  4PUS A;  3HOZ J;  2W00 A;  4BU2 A;  4I7H A;  3OYK A;  3GLX A;  4S0H B;  1G2H A;  3BG5 A;  1LUJ B;  5C4X J;  2VT3 A;  2M45 A;  1TTY A;  1ZLK A;  5FO5 A;  4CGZ A;  3DPT A;  2DI3 A;  3T8T A;  3WHC A;  3AQS A;  3DLL F;  1FLI A;  1ETY A;  3LA3 A;  1MBF A;  1SAU A;  2ID6 A;  1G4D A;  2KIF A;  1FJL A;  1RNL A;  2AHQ A;  5EYR A;  2Z99 A;  2COM A;  3DU5 A;  2DJN A;  3CMY A;  3QRF F;  1NTC A;  2JSC A;  2HI3 A;  3QOD A;  4I99 C;  4H4K C;  3S1N J;  1XG1 A;  3G6E I;  2XGC A;  1Z91 A;  3JRB A;  1ZEL A;  1TT0 A;  4EMS A;  3CF5 F;  3JRI A;  3VVY A;  2DTZ A;  1NG7 A;  2STW A;  3ELK A;  2F5D A;  9ANT A;  4BE0 A;  1C0W A;  2DYR H;  2VBY A;  2ZBK A;  2GLO A;  2CV2 A;  4XL9 A;  3CCY A;  4RLQ A;  3MKL A;  4G6Q A;  3OYD A;  3IHU A;  4KT5 C;  3RKW A;  1MNE A;  1MNM C;  3QKX A;  5LHG A;  2CQX A;  3F3X A;  1R5G A;  2MLK A;  1H9T A;  3F8B A;  4QPO A;  2OZU A;  5K7H A;  3O3K A;  3O8H A;  4J19 A;  4LMY A;  1IRF A;  4EJO A;  5D5W B;  1W7P B;  1IUY A;  1YI2 I;  3W2A A;  3QYB A;  2Z9O A;  2FNP A;  3KP5 A;  1ZG5 A;  1N77 A;  4S05 A;  1S5L C;  3V8K A;  3NS4 A;  3HC7 A;  3LSM A;  3L2W A;  4KIT B;  2RC4 A;  5M5Y J;  4DOZ A;  2CUZ A;  2P8T A;  3OYH A;  1XSV A;  2LRE A;  1Z1D A;  2XPW A;  3CP2 A;  3OV8 A;  3HDD A;  4RDU A;  3CMA I;  1ON2 A;  4HBL A;  3DF8 A;  2W57 A;  4BQA A;  1GVD A;  4JKZ A;  2CQQ A;  3BZ6 A;  3KX2 A;  3S14 J;  3HG9 A;  2IP2 A;  3OS2 A;  4D0P A;  2X6X A;  3JRE A;  3VYU B;  4L5I A;  3R61 A;  1IXS B;  2Y0S A;  2WAQ N;  1IC8 A;  4I76 A;  5HDN A;  1P4W A;  1KU2 A;  4NQW B;  4HKU A;  2A6H F;  4JOM A;  3VW2 A;  1J09 A;  1X4P A;  1QVU A;  3IWZ A;  4RGU A;  3H9Q A;  4A0Z A;  5E1W A;  2O7O A;  2F5V A;  3FMS A;  3I59 A;  1ODD A;  5B66 C;  3FDY A;  2VT2 A;  2DFI A;  2VKV A;  3LST A;  1F43 A;  1Z21 A;  2R7S A;  3T1B A;  1R5H A;  5FLX K;  2NVX J;  2REK A;  3BR0 A;  4AD9 A;  2EFN A;  3K2A A;  2Y69 H;  4PXI A;  1FZP B;  4UUV A;  4MHG A;  5LRS A;  2Y0M A;  5H6R A;  2GQQ A;  2GEN A;  5LGN A;  1MBG A;  5HLH A;  1ZLJ A;  2HYF A;  4IZZ A;  3KZ9 A;  2WY8 Q;  3TO7 A;  5ILV A;  4X1E A;  2PFV A;  2JA6 J;  1KQ9 A;  2JN6 A;  1YRN B;  5CXI A;  5F6F A;  1JKQ C;  1X2N A;  3W6V A;  3ERE D;  1IRG A;  1FWZ A;  4RLF A;  3AL0 C;  2G7G A;  3J80 Z;  3G1O A;  4F91 B;  3JAM K;  2J5O A;  2ZXI A;  3PNV A;  1KZH A;  1FYM A;  2G7L A;  3EUK L;  3L1P A;  3V4G A;  2V9V A;  2JA8 J;  4UV9 A;  2XRL A;  3GO5 A;  1SAX A;  1Z9C A;  3M3Y J;  1J5Y A;  2EBI A;  2H1K A;  3E7Q A;  3EYY A;  2R7O A;  3L9F A;  3E5U A;  2QKO A;  4F7Z A;  5JFR A;  4XKB A;  3RZO J;  3L2V A;  2LOO A;  3DLA A;  4MFE A;  2EFQ A;  2GXG A;  1V55 H;  2L7F P;  3HBL A;  2RGV A;  1T0F A;  3HRU A;  2QQ8 A;  4LG0 A;  3WE2 A;  2CH0 A;  3GZ5 A;  4I98 B;  3I55 I;  1T38 A;  3L2U A;  4RA2 A;  4KIF A;  5CPR B;  2ZNZ A;  4HPQ A;  1BOB A;  5CXG A;  2OTJ I;  3VUQ A;  2KJC A;  1JUP A;  1T56 A;  1R00 A;  1XD7 A;  5GTI C;  3J7Z I;  4PJL A;  2F4O B;  2UXP A;  1ETV A;  2ZME C;  2BBY A;  2BZT A;  1BW6 A;  2QM3 A;  2UXN A;  3WU1 B;  1JKR C;  4HOB A;  3I4M J;  2DJI A;  4DYQ A;  2R0Q C;  3BTL A;  1DDN A;  4B3A A;  4NN1 A;  2VIX A;  2QSH X;  1POG A;  2M34 A;  2JK3 A;  3F23 A;  1HDP A;  2KIU A;  4IHW A;  1YX3 A;  2HZD A;  5DEQ A;  1JKO C;  5HVQ C;  3OIO A;  5LHI A;  2GZW A;  3M8F A;  4DNC A;  1S3J A;  1J75 A;  3KPH A;  3ABK H;  1OKR A;  5DUI A;  4RB2 C;  4A3I J;  3OYL A;  4C3I J;  4IOC F;  3TDZ C;  2K86 A;  3QYF A;  3HHG A;  2IBD A;  4XKW A;  3VYR B;  1Y0U A;  2EA2 A;  2O8K A;  1IW7 F;  1LDD A;  2ZCM A;  4KNY A;  2F5F A;  4HF2 A;  1HKT A;  2ZKZ A;  2D5V A;  3HGG A;  1EA3 A;  1E3P A;  1Z3X A;  3WU0 A;  1JE8 A;  4M71 A;  3CJR B;  4CH7 A;  3HOW J;  2HQN A;  5J8F A;  5ICG A;  3JTG A;  4E6K G;  3KKD A;  2CG4 A;  3HPH A;  4P9F A;  4UY8 I;  3E5X A;  3GME A;  3HB9 A;  1RPW A;  3RPQ A;  2E2J J;  5M5X J;  3AG4 H;  1KQ8 A;  1U2W A;  3ZQH A;  4JNN A;  5CVR A;  3CC7 I;  2ZXW H;  4LD5 A;  4M6Y A;  4ZDP A;  2Z33 A;  3BY6 A;  3CDI A;  1IN7 A;  2A6E F;  4GCV A;  4O3M A;  2WV0 A;  1WJA A;  2DA2 A;  2G9W A;  3P5J A;  4RAZ A;  5K5R A;  3COA C;  1MSE C;  1W7P A;  3BRU A;  2MFZ A;  1LE8 B;  5IYD J;  3C2H A;  3ZGK A;  3J80 K;  1OCZ H;  1USS A;  3LL7 A;  3RCO A;  3HPG A;  2IA0 A;  1TZL A;  3ZQC A;  2CV1 A;  1ETQ A;  3LSI A;  3K2Z A;  4I0B A;  3BQY A;  3GFJ A;  1OMI A;  4UUS B;  3GYH X;  2DU9 A;  2EV5 A;  1FX7 A;  1RR8 C;  5FHP A;  4XR6 A;  4Y4R A;  1WI3 A;  3DKX A;  1IG7 A;  3NXC A;  5DS9 A;  3N97 A;  3ZCO A;  4MGR A;  4MXM A;  1RC9 A;  5F0C A;  2AQF A;  4Y17 A;  2Q0O A;  3E0J B;  3VSK A;  1S9H A;  2QQ9 A;  3JSP A;  3REO A;  1JGG A;  1T6S A;  3CP8 A;  2Q24 A;  4B47 A;  4UVB A;  2XF7 A;  2KFD A;  3TO9 A;  4YII A;  5C4J J;  3KKC A;  2ESN A;  3RYR A;  2LSO A;  2CO5 A;  1XTA A;  2IGM A;  3G1L A;  3B02 A;  2E1C A;  1SGM A;  4NQW A;  3ZQF A;  4M73 A;  2ME0 A;  1SFU A;  1SVM A;  3KLO A;  2GXA A;  4F52 A;  4XRM A;  5FKL A;  2ZFW A;  3I58 A;  2FJI 1;  4TV7 A;  1YTY A;  2DK8 A;  3CDL A;  1A36 A;  2E5N A;  2ZFU A;  1FTT A;  1K79 A;  2M87 A;  1OCR H;  1K6Y A;  3GFM A;  4ZDL A;  2CUF A;  3I0T A;  1P7I A;  4ON0 A;  3JRG A;  3C07 A;  4MEX F;  2VLA A;  1OCT C;  3VOX A;  4HF0 A;  5GPC A;  3COL A;  5FFZ A;  3JR9 A;  3LMM A;  3KP4 A;  2PEX A;  4U88 A;  1WJF A;  2XGE A;  5K7Z A;  2FJ1 A;  3OOU A;  2E71 A;  4AID A;  2L7K A;  3KLN A;  1G3T A;  4IHV A;  1FEX A;  1WQ2 A;  3Q0U A;  1XCV A;  4IHX A;  4CIC A;  1EV7 A;  1WFX A;  4KA4 A;  4BE2 A;  4G8X A;  3T0Y A;  4IRH A;  1YRN A;  2EB7 A;  1R7J A;  5GPA A;  3LSP A;  4DW6 A;  2HEO A;  3RIR A;  3D0S A;  2A5Y B;  3OYE A;  3G7R A;  3RH2 A;  4KN4 X;  2NYX A;  2XC7 A;  2IS1 A;  4CA0 A;  1Z3Y A;  3JTH A;  4DGW B;  5KK1 A;  3BNI A;  2CWE A;  4HA8 A;  4JL3 A;  4EVI A;  4M6V A;  1VQ8 I;  4FHT A;  4W1U A;  1UI6 A;  3K4J A;  2L2O A;  1FMV A;  4JX4 A;  4BAC A;  3TOA A;  1F4K A;  2WAF A;  2DQL A;  4OIO F;  3I5U A;  1BIB A;  4XRF A;  5M3M J;  3SQN A;  2VN2 A;  3V7C A;  1HSJ A;  3TDU C;  1MKM A;  4DZJ A;  5D8K B;  3S2H J;  2DOE A;  3KP3 A;  1AU7 A;  3NWS A;  1ULY A;  2OJE D;  4MQV A;  2AS5 F;  2Q2E B;  2LLK A;  2QWT A;  3ECH A;  4CYC B;  4A3D J;  5HAW A;  1YIO A;  1Z7U A;  2X4H A;  1O3Q A;  1ORK A;  1NG6 A;  3HL2 A;  3ZQI A;  4XID A;  2KIS A;  4BNC A;  3I64 A;  3WTZ A;  3M9A A;  2VUM J;  3HTA A;  3GTO J;  1WH5 A;  2ETH A;  4XLH A;  2IA1 A;  3WTY C;  2PBI A;  1XGM A;  2NP5 A;  4NDL A;  4XK4 A;  4OIP F;  1FNN A;  4MFD A;  5FKN A;  1TWA J;  1V54 H;  1E3H A;  3HYI A;  5GAH J;  1UB9 A;  1RI7 A;  5FGM A;  3MVP A;  2VE9 A;  1F5T A;  3QPT A;  2VPL A;  3QP6 A;  3BTI A;  1PDN C;  4IQ4 A;  2JUG A;  2Z5U A;  3SHF A;  2FMY A;  3L2Q A;  4A3K J;  2VKH A;  2ID3 A;  3E7L A;  2FOW A;  4OMZ A;  1LDK B;  4ENK A;  1UMQ A;  1AKH B;  3HOY J;  4NC8 A;  1I5Z A;  2DMU A;  2ELH A;  5EEG A;  4L18 B;  1LB2 A;  4AC6 A;  1GLN A;  3P9C A;  1FPQ A;  3HSE A;  4A93 J;  1HKS A;  4MTE A;  4AVZ A;  3I53 A;  1YW8 A;  1I1S A;  1WJD A;  3GUD A;  3VOE A;  3HE0 A;  3FIW A;  3WU2 C;  3HRM A;  2COB A;  3V78 A;  4LIT A;  1O57 A;  4B48 A;  3TW6 A;  1UST A;  2DW4 A;  1GVJ A;  2EIK H;  2K5C A;  3TP3 A;  5LBQ A;  3S1R J;  1JXS A;  4OIQ F;  3LAJ A;  3LHQ A;  3PUF A;  5H6Q A;  1KON A;  1UHS A;  4DYR A;  3LSH A;  5A2Q K;  2XB0 X;  3Q3S A;  2PMZ A;  4RAF A;  2ECB A;  3DWL E;  2EIN H;  1TW2 A;  4BJ5 C;  5B3S H;  2ZJ2 A;  2X6O A;  4B44 A;  4BYY A;  2MH9 A;  2A5W A;  2QQA A;  1BL0 A;  1MW7 A;  1J7K A;  3KP2 A;  2CFX A;  3NI7 A;  1WSU A;  1Y39 A;  2XB5 A;  1IDY A;  4PZJ A;  3EQL F;  1H0M A;  1JI8 A;  4KIG A;  2OER A;  5L3B A;  2M0C A;  5CVU A;  4Q5S F;  2ESH A;  2TCT A;  4G12 A;  4ESJ A;  2IS2 A;  3ANP A;  2KDZ A;  2STT A;  3DU6 A;  3LWF A;  3IRQ A;  1LE8 A;  3FF5 A;  2W25 A;  1TWF J;  2H94 A;  5CW8 A;  5EZG A;  1B72 B;  4M3B A;  4U0V A;  2CS3 A;  3ZR8 X;  1TP4 A;  2HNH A;  4G94 A;  3EET A;  3TBI A;  3FXQ A;  3HZJ A;  5E1Z B;  2HQR A;  2P7C B;  4UUS A;  4HNU A;  3WTT C;  4MQ9 F;  4LIU A;  3FM3 A;  2W48 A;  2J5P A;  3DEW A;  2HTJ A;  1JJ6 C;  2H8R A;  1ACI A;  2VC1 A;  3I3L A;  4ZH4 F;  2WB1 A;  4O6J A;  4CCJ A;  2KIM A;  3BTJ A;  4YZE A;  3SWH A;  3KZY A;  4M3E A;  1N78 A;  2D45 A;  4AIH A;  4AYB N;  5L3C A;  1BW5 A;  1MGT A;  2RRE A;  4L9J A;  3PFY A;  2VOD A;  3ZXS A;  3VVZ A;  3DCF A;  1QNT A;  2I5U A;  2KZV A;  3O2P E;  3L2R A;  1RR7 A;  2PLY A;  2AQE A;  1D5Y A;  4GYG A;  4U9L A;  4B8X A;  2FBH A;  3DTE A;  1ON1 A;  4BJ6 C;  1S72 I;  3R0J A;  2F48 A;  2KZG A;  2XHK A;  4BXF A;  1TC3 C;  4D5F A;  2PI0 A;  1SFO J;  1GV2 A;  2EFW A;  5DV5 A;  3X2Q H;  1KQ0 A;  4G7H F;  2RVC A;  3R60 A;  5DYM A;  1B1B A;  1KU7 A;  2DFH A;  3PFI A;  5IP6 A;  4BXU A;  2K9N A;  2O8X A;  2DA4 A;  3LOC A;  1BI1 A;  2UXH A;  3KYC B;  2RNG A;  1YG2 A;  3TMO A;  3EUH C;  2VJI A;  1PUE E;  3ASO H;  2VQG A;  5D6E A;  3I4N J;  3F72 A;  5HLT A;  3QOE A;  1XSX A;  4JBA A;  2HDC A;  1OCO H;  3DP7 A;  4W97 A;  1PUF B;  2K02 A;  3HTU A;  2FQ4 A;  1YJ9 I;  3B73 A;  4KIB A;  1YW9 A;  2VXD A;  2X1C A;  3RTR A;  4HX8 A;  2K7L A;  1T33 A;  4ITV A;  4U7B A;  3LQR A;  4M6X A;  1U5T B;  3OS1 A;  2BE5 F;  1X1D A;  1RZ4 A;  4WX9 A;  3A0H C;  3ABL H;  2WA0 A;  3HGY A;  3IKV A;  3E1S A;  5HS7 A;  2YVX A;  2KRF A;  1ZKG A;  2R5Y B;  4WXC A;  2DMP A;  4NNJ A;  2VXZ A;  1U9O A;  2GWR A;  1D3Y A;  1FP2 A;  4LGW A;  5H2F C;  1QU3 A;  5AON A;  3BC8 A;  4OIR F;  1SD7 A;  3F0C A;  4Y33 A;  2HKX A;  3ZP5 A;  1O3T A;  1WPK A;  1I1G A;  2BOL A;  5ILS A;  2OBP A;  2Q2E A;  4CYC A;  4LK0 F;  2Y75 A;  3H36 A;  4A3C J;  2L4M A;  4O5V A;  2FNA A;  5LEK A;  3G1M A;  4A6E A;  5K7F A;  4E7H A;  3CLO A;  5DM6 F;  4G9Y A;  2YVE A;  2R3S A;  3FXO A;  3H0G J;  3G73 A;  2LTP A;  2OTL I;  2BY3 A;  2DBB A;  5F0H A;  1BI3 A;  2E1O A;  3LSJ A;  3J7Y J;  2DOD A;  1SFK A;  3MFK A;  3IV5 A;  4HV5 A;  1WWX A;  2NS8 A;  5DTD A;  4A2U A;  3ABU A;  4CCN A;  1IRX A;  2XVC A;  3RKX A;  5DCF A;  3ISP A;  3HIM A;  3S3N A;  1AKH A;  1TBX A;  2E7X A;  2NS7 A;  2P6S A;  3NWT A;  5D8L B;  4EJU A;  4AVP A;  2NNY A;  1T8I A;  3Q0W A;  1VQL I;  3TO6 A;  5M5W J;  4K2E A;  4R79 A;  2L9N A;  5FKO A;  4BE1 A;  2QSG X;  1U8R A;  2YUS A;  4E7I A;  4GCL A;  3M1E A;  2VON A;  2KRC A;  5IT3 A;  1W36 C;  2XAQ A;  2RNJ A;  3F8M A;  3IAM 2;  4ENM A;  4L5J A;  3GTK J;  1R71 A;  1K61 A;  1W36 D;  2KP6 A;  5H20 A;  4LOC A;  3H3U A;  4OAY A;  2V1X A;  4BEH B;  3PPB A;  2DMT A;  4P96 A;  2MW8 A;  1L3L A;  4NEL A;  1H88 C;  3DKW A;  5HOO A;  3S2D J;  3JSJ A;  1W1W E;  1O7L A;  2F6C A;  1MH4 A;  5E3O A;  4DYC A;  3WOD F;  5ILU A;  4N9I A;  4V19 K;  1QVT A;  2M5W A;  5KHD A;  4YFK F;  2P4W A;  2NOG A;  2XF5 A;  2QA4 I;  1QA6 A;  1O3R A;  5H9T A;  4DZP A;  4GFB A;  3K8P C;  2A68 F;  2OV7 A;  2ISY A;  2JTV A;  2E1M C;  4L9V A;  4QTR A;  3VTI A;  1Y8Q B;  3GFL A;  2ELJ A;  4DJA A;  2YX4 A;  4FET A;  1Y1V J;  1R9T J;  2R5Z B;  1N75 A;  4DIQ A;  1YOV B;  3K70 D;  4LB5 A;  1WZ2 A;  2GA2 A;  4A5N A;  1M1E B;  2LY2 A;  2ME6 A;  2K4J A;  4HEA 2;  2LY9 A;  3CJD A;  3UKG A;  1B72 A;  2L9R A;  5AQC A;  3GW2 A;  2DDA A;  2X85 A;  3MD2 A;  3ERM A;  3BCB A;  3NAR A;  4PSX A;  2QIB A;  4U7D A;  2BY1 A;  1SMY F;  3Q9V A;  4M9S A;  2JT1 A;  5K5O A;  1D5V A;  4CGR A;  2MBF A;  3QPH A;  2A2F X;  3QPL A;  2ZJP F;  3CCQ I;  2IXS A;  5F1J A;  4NBQ A;  2OI8 A;  3ANG A;  3S93 A;  3FBI B;  3CMM A;  1RUO A;  1Q1V A;  2O7T A;  3FX3 A;  2P0W A;  1YJN I;  1H8A C;  3H9J A;  3BPX A;  1QHH D;  3KP6 A;  4GCT A;  1IV8 A;  1FIP A;  4P1W A;  1WRJ A;  3BR3 A;  4E7K A;  3H1C A;  3MN2 A;  1APL C;  1AOY A;  2GIV A;  3S3M A;  3PQK A;  4XIC A;  1V5F A;  4XLP F;  2HOT A;  1OYI A;  3VW0 A;  2L02 A;  2I8D A;  2LBF B;  3MKY B;  2GIZ A;  1UJ8 A;  3MZ8 A;  2X48 A;  2ADU A;  2FA5 A;  3J81 Z;  3CES A;  2VBZ A;  2ZSH B;  1VQ9 I;  4IF4 A;  3FK7 A;  2W84 A;  1TL8 A;  1ZTR A;  1XGS A;  1FT9 A;  4M9X A;  1P4A A;  3V7S A;  2LG4 A;  2RAE A;  3J7A O;  4RAY A;  4DBR A;  3H9G A;  4M3F A;  2E35 A;  3OL3 A;  3TP0 A;  3PO3 J;  1V3F A;  3UNG C;  1HDD C;  2XIG A;  5B5E C;  2DT7 B;  5J47 A;  2YU3 A;  4C2T A;  3OYC A;  1XGN A;  3FXM A;  2GM4 A;  1PUF A;  2BXY A;  1R49 A;  3GTL J;  2X9D A;  3CCM I;  2I10 A;  5DM7 F;  4BQQ A;  1JTY A;  3HOU J;  2B7E A;  3W3C A;  3PSI A;  2O5R A;  2XUB A;  2W82 A;  2NAZ A;  1LQ1 A;  1ZG3 A;  2FX0 A;  3IKT A;  1U5T A;  1OR7 C;  3T8R A;  2ZOY A;  4A69 C;  2HVR A;  5FKM A;  4GDF A;  1FC3 A;  1HF0 A;  3GCM A;  2R5Y A;  2HKO A;  3A0B C;  5DCM B;  1UZC A;  2F4I A;  4HNT A;  1X1P A;  1VQ7 I;  3Q9S A;  5EF6 A;  2FUG 2;  1CQT A;  2FRH A;  3ZOB A;  2X6Y A;  4MLO A;  4FE7 A;  2JWT A;  4IHT A;  2H6B A;  3NQO A;  2DA6 A;  5DD8 A;  3H92 A;  2DPD A;  3K9T A;  1HCR A;  3CQZ J;  4CHU A;  2H27 A;  3HTH A;  5HDG A;  2O03 A;  5D5X B;  3IWF A;  3QWL A;  3U1D A;  1KYW A;  2F07 A;  2RAS A;  3VOD A;  1QRY A;  2A61 A;  2VKE A;  3K4B A;  5L3G A;  4FCY A;  3WTS C;  3BG7 A;  3W6K B;  4CZZ A;  2JPB A;  3ZRG A;  3ONQ A;  3FHZ A;  1J9I A;  3NRV A;  1SMT A;  4EJW A;  5FMP A;  2JPC A;  2XF6 A;  4B3X A;  4OWR B;  2NOJ B;  4KJZ A;  4M3G A;  2HOE A;  3RPU A;  3AQT A;  2V6E A;  2B1E A;  1LJ9 A;  1WCM J;  2XDV A;  2L9V A;  4PSW A;  3E5Q A;  3IUV A;  3SYT A;  1Y56 A;  1R6R A;  3V7R A;  3SDB A;  1WGX A;  4KT6 A;  1L0O C;  2EZH A;  3MAJ A;  2W53 A;  1U8B A;  1GT0 C;  1BJZ A;  3AL0 B;  1TQM A;  2HVQ A;  4AUX A;  2LR8 A;  3K1N A;  2ACJ A;  3TED A;  1Z67 A;  3CUQ C;  4IRI A;  4L0Y B;  1EJ9 A;  4C3J J;  1TQP A;  4PJM A;  5IP9 J;  3IP4 B;  3HTS B;  2DA1 A;  2JVH A;  4NUB A;  3L00 A;  3VPR A;  2HXI A;  5LGT A;  3LSG A;  5EEA A;  5BPI A;  5TGT A;  4A3E J;  2WAQ A;  1QZE A;  3OL4 A;  4ENJ A;  4BEH A;  2G7H A;  3K4L A;  4OIN F;  2UXI A;  1O4X A;  3BCG A;  4M74 A;  2CJJ A;  4D1Q A;  2BHY A;  3CF2 A;  1T39 A;  1DU6 A;  4A3M J;  3FM5 A;  5IPA A;  3GEZ A;  2IEK A;  3MZH A;  5IY5 H;  5CVI A;  3G71 I;  4AIK A;  2V57 A;  3J81 K;  2MG4 A;  3C2B A;  3FBN B;  5L3E A;  3KFW X;  2L7Z A;  1TW3 A;  3MKZ A;  4D9J A;  1D0Z A;  3HTI A;  2W4S A;  3GVA A;  4L9T A;  2MD5 A;  4M72 A;  5EGO A;  2LF8 A;  3VOK A;  4L62 A;  2V1U A;  2BV6 A;  1FSH A;  1X58 A;  4V2G A;  1HW2 A;  3KP7 A;  1YLF A;  2DO7 A;  4ZYH A;  3BG3 A;  3P9I A;  4Q48 A;  2ZME B;  3RDI A;  3SZT A;  2R5Z A;  2MH2 A;  1VQ5 I;  2AXL A;  4CCM A;  2M8G X;  3AG1 H;  3ASN H;  4EM2 A;  2V9P A;  5E3N A;  2L5Q A;  5EJC A;  3GXO A;  2L9S A;  1B9N A;  4U9N A;  2FXA A;  2EIM H;  2FBQ A;  5JHF A;  3ZPL A;  1VQN I;  3V42 A;  2CSO A;  1MMN A;  2X6W A;  3V6G A;  1OLT A;  3GBG A;  4LG3 A;  5BMZ A;  1A6Q A;  1FP1 D;  1PP7 U;  2KLO A;  1IXR C;  3OMY A;  3QOP A;  4BY1 J;  2JUC A;  2BW3 B;  3E6D A;  4HNV A;  1Y1W J;  1LEB A;  4R1H A;  1BC8 C;  1NH3 A;  2NRA C;  2VOP A;  1W0T A;  3HIF A;  3FWE A;  1WH7 A;  2DXI A;  5J1U A;  5L3D A;  2L4A A;  2YR2 A;  1LFU P;  2O6G E;  3FRQ A;  4MTD A;  3QAH A;  1DP3 A;  3AG2 H;  4QWQ A;  4BY7 J;  5A2Q Z;  1PVE A;  2FOK A;  2LBF A;  3JRF A;  1DPR A;  2DAO A;  2HPI A;  2B63 J;  3K1M A;  4FX4 A;  2EWN A;  4PCQ A;  2PZ9 A;  3BZK A;  3OYN A;  3H5R A;  4IQJ A;  2O61 A;  5FLV A;  4KUM A;  3SZP A;  2MA3 A;  2LYC A;  1I3Q J;  5FB2 A;  3PL8 A;  3S2W A;  5C3E J;  2HOS A;  3ZN1 A;  1WJE A;  2KKO A;  3A02 A;  4RMN A;  2CGP A;  1LEA A;  3IH4 A;  3D5R C;  2R7W A;  2K27 A;  1UEL B;  3ZQQ A;  2QF7 A;  5IOY A;  3G56 A;  3VP5 A;  4BGD A;  4I6Z A;  4E7L A;  4ABZ A;  4YG2 F;  4OD5 A;  1X2M A;  2H8W A;  1Z6R A;  3ZMV A;  3MNL A;  2F4M B;  4HYE A;  1DPU A;  2VE8 A;  4HF1 A;  4IXA A;  4DQ2 A;  2DFE A;  1IO2 A;  3GZN B;  1OPC A;  3KET A;  1T98 A;  3RJP A;  2JJ7 A;  3DPL C;  4HAM A;  3GTM J;  2VOO A;  1R22 A;  1ETK A;  3PM1 A;  2W85 A;  4WIB A;  2VAS A;  3OY9 A;  1D8K A;  4XSX F;  5DDG A;  2BYV E;  2IW5 A;  1BOA A;  4ESF A;  4JX6 A;  5E3L A;  5K58 A;  4HDV A;  3MWM A;  1S7E A;  1A35 A;  1V5G A;  5HDK A;  4FTH A;  2LDU A;  3HXL A;  3SEZ A;  1X1B A;  5DCM A;  5CYV A;  1I6H J;  3CJQ B;  1JHF A;  3ZMZ A;  3DEE A;  3S32 A;  3FIS A;  2MAB A;  4X0G A;  2LMD A;  3W6J B;  2A3S A;  4ZDO A;  2OUM A;  4WCG A;  1QZZ A;  2WB1 N;  2PX9 A;  1FYL A;  4DVY P;  1A04 A;  2L0K A;  4RB1 A;  1RKW A;  5KAF C;  1IRZ A;  3S3O A;  1YQA A;  2FF4 A;  2H6C A;  1ZGW A;  2OQG A;  1U3E M;  1S8N A;  3FHN A;  4D7M A;  2VC0 A;  2JSP A;  1ZK8 A;  1MDM B;  1JTX A;  1G8X A;  1B4A A;  1U6G A;  1SD4 A;  1WKM A;  4FQG A;  4E7J A;  2EPF A;  2W24 A;  3CCJ I;  2HS5 A;  1RKT A;  4U0Y A;  2RQP A;  4RAG A;  4Y13 A;  2ZSI B;  3S5R A;  3OYM A;  5FLM J;  2D1V A;  2Z1D A;  1QQI A;  2R7F A;  3M07 A;  2G0E A;  4UB8 C;  5D5V B;  4ZZD A;  2A69 F;  4XOP A;  3P9T A;  1ZRD A;  4AU7 A;  4GO1 A;  2E7W A;  4UB6 C;  2YX7 A;  3ML6 A;  1ZR4 A;  2DG8 A;  5LRR A;  5JI6 A;  1IF1 A;  2V6C A;  2E19 A;  4IO9 F;  1UG2 A;  2IA2 A;  2X1D A;  1PP8 F;  4XLF A;  2VBW A;  3D5S C;  2CU7 A;  1D1C A;  2HKU A;  2E34 A;  2UZK A;  2DMQ A;  3Q0V A;  2XRN A;  4L5E A;  3CJN A;  4A6D A;  1B9M A;  1JT0 A;  3V8L A;  3HOV J;  3E97 A;  2ELK A;  2M30 A;  3N05 A;  1W5S A;  2X0L A;  4QLC U;  4EJT A;  1F9N A;  1E3O C;  2EFO A;  3EGQ A;  2RKH A;  2P5V A;  5ED4 A;  4AF5 A;  3A01 B;  2WWY A;  5EEH A;  1G3W A;  2CW7 A;  4CCO A;  1ONV A;  5F27 A;  1IN6 A;  2IAI A;  4XLC A;  3KCC A;  4ME9 A;  4J01 A;  1ERD A;  5E20 A;  5GP9 A;  1XCB A;  4U87 A;  2ZME A;  3WGI A;  2MC3 A;  4FT8 A;  1GXP A;  2EA4 A;  2XRO A;  4IVN A;  2JA2 A;  2JRT A;  4B09 A;  3LA7 A;  1QPI A;  1XX5 A;  5FKK A;  2E36 A;  2OAZ A;  3WE3 A;  3G3Z A;  4Z6Y A;  3DEU A;  3BR2 A;  1YS7 A;  2CMP A;  2LY1 A;  2Z2S B;  1QO0 D;  4UDS A;  2EV6 A;  2VKD A;  4A3L J;  5DUK A;  2QEN A;  3MKW B;  4A3J J;  3EUA A;  2DA7 A;  4OMY A;  3S15 J;  2R7U A;  1K83 J;  4ZTF A;  2OA4 A;  3LA2 A;  3BQZ A;  2K9Q A;  4XLN F;  2IS6 A;  2BVM A;  5ICE A;  2JMW A;  3RQI A;  3HTJ A;  4ENN A;  4XQF A;  3K1P A;  5JR3 A;  1VQP I;  3KYD B;  4XBF A;  1SC7 A;  2ZCW A;  2BW3 A;  3BRO A;  2QYO A;  3B6C A;  2QGU A;  4MNU A;  4CCK A;  4P55 A;  4V2F A;  1K7A A;  2UXU A;  1GHC A;  2GBY A;  5EFY A;  1I50 J;  2M4G A;  1PJR A;  1DP7 P;  3QPS A;  2LFB A;  2AXT C;  5TRD A;  2Y2Z A;  3CO7 C;  1YYV A;  4P9U A;  2HTS A;  1RET A;  2HZT A;  3I9V 2;  1T0F C;  3ZMS A;  3BT9 A;  3F9K A;  2YS9 A;  4HDU A;  3F6O A;  3F8F A;  4N4N B;  5BS6 A;  2MLG A;  2QCO A;  3VVX A;  3GLL A;  3VIB A;  1R5I D;  3BJA A;  2VJ5 A;  4C30 A;  2YVH A;  3FXR A;  2WTE A;  4WWC A;  4ANJ A;  1VQO I;  4BQN A;  5IP7 J;  1XC5 A;  2WAE A;  2DYS H;  1KYZ A;  3GWZ A;  1SD5 A;  2XGX A;  3SFZ A;  4A12 A;  3WTV C;  1WHU A;  4BBR J;  1MIJ A;  1DQU A;  4C9Y A;  3L09 A;  3VYT B;  3D5L A;  4ZJZ A;  2A6T A;  3DPU A;  3O8G A;  4LFU A;  5JHU A;  2GXB A;  2P81 A;  1BM9 A;  3U2R A;  4CZC A;  4AIJ A;  3BDD A;  3HM5 A;  4M9Z A;  3W2W A;  4D7N A;  2OQR A;  2WC2 A;  3PIO F;  1OFC X;  2Y31 A;  4BS9 A;  4IKF A;  1BI2 A;  2MC4 A;  4XMY A;  2DCE A;  2XAG A;  3VW1 A;  5GTH C;  4IEJ A;  4EGY A;  4DBQ A;  3M7G A;  2K3P A;  3OOP A;  5D6F A;  2RDP A;  2BEO A;  4XKV A;  2XPV A;  3EPZ A;  2E60 A;  2QLZ A;  1VTN C;  5E17 F;  3IH3 A;  3NAU A;  2VQH A;  3CME I;  3H3V K;  1F1Z A;  4ASN A;  1ZRF A;  1J0R A;  1WI9 A;  2EIL H;  3H5N A;  3A1Y A;  5IT9 K;  1R36 A;  1EH6 A;  2PG4 A;  2PMH A;  3UR3 C;  3PNT A;  1ZYR F;  1D0X A;  3AAF A;  4XON A;  3TOB A;  1D8J A;  1XDU A;  3HUG B;  5FD5 A;  1JUS A;  3JSO A;  1STZ A;  2JVG A;  3TQN A;  4GFK A;  1G3S A;  4A3F J;  1JJ8 C;  4GRI A;  2Y30 A;  3IH2 A;  1FOK A;  2M0M A;  2O0Y A;  2XAF A;  2Y0S N;  5E8I A;  4Q4Z F;  2RV8 A;  3AFH A;  3CZ6 A;  4PGH A;  3WG9 A;  2IJL A;  1X1A A;  4IL6 C;  2ZB9 A;  3CCE I;  2QBY B;  3PQJ A;  3TW7 A;  2ISZ A;  2BY2 A;  4G7O F;  5J4Y A;  2DLL A;  4HX4 A;  4UVA A;  4E70 A;  3F21 A;  1MDM A;  4AC0 A;  1BJA A;  2DMN A;  5KNL A;  5F08 A;  2XAH A;  2ZXJ A;  1KU3 A;  3SFI A;  1BR1 A;  1F36 A;  1OCP A;  2CUJ A;  3FKJ A;  3J7A Y;  4RB3 C;  2XAS A;  3VEP A;  5HS9 A;  2LKX A;  4FX0 A;  1ZN2 A;  1CGP A;  4Y52 J;  3ULQ B;  2Y9Y A;  2K40 A;  3C7J A;  3M1C A;  1W7P D;  2HYJ A;  3R4K A;  1P92 A;  1UHW A;  2K9M A;  4L0Z B;  3H35 A;  4HST A;  5TJJ A;  5LEJ A;  1FYK A;  1HST A;  4HLX A;  4EGZ A;  3C2G A;  1ZH5 A;  1IUF A;  1MBK A;  4EQQ A;  4IX7 A;  2UXX A;  3CD6 I;  2CUE A;  3IL2 A;  2GAU A;  2R7Q A;  2NVQ J;  5K5Q A;  4XLE A;  2YU9 J;  3RZD J;  2E2H J;  4AYB A;  2KJB A;  1Y8R B;  2HQA A;  3FXL A;  3ZMD A;  2M8E A;  5LD2 C;  1YS6 A;  1DGR M;  2IS4 A;  2KIQ A;  4I02 A;  3E6B A;  3WG7 H;  4Z2Y A;  1X3W B;  1YX5 A;  2DA5 A;  1IDZ A;  2VB6 A;  4E4H A;  4JP0 A;  1XMX A;  4KMU X;  4IHS A;  1FTZ A;  3RKY A;  1N25 A;  1ETX A;  1OCC H;  2M7A A;  2WV1 A;  5ICF A;  3A01 A;  5EGO B;  5CLS A;  2DOF A;  2Y9Z A;  4GFL A;  1ZGJ A;  1SEU A;  3CCR I;  2LF7 A;  1VQ6 I;  2R92 J;  2E2I J;  1BBY A;  3K70 C;  2V9K A;  3P9K A;  2ZJQ F;  3Q5F A;  4OU0 A;  2CV0 A;  3L7W A;  4UV8 A;  2LKS A;  1UFM A;  1YHQ I;  2VI6 A;  2D2W A;  4BUP A;  1YIT I;  1BIA A;  1UCR A;  2GA1 A;  1FBU A;  2K4B A;  3I71 A;  5KAI C;  5K1Y A;  1R1T A;  1YO5 C;  1IAW A;  4BAY A;  3GF2 A;  1SFX A;  5HNH A;  2FML A;  3OYG A;  2OCC H;  1Z77 A;  3OSF A;  1R4N B;  2EK5 A;  5EG0 B;  3NRG A;  3ABM H;  3CWR A;  1MJB A;  3CLQ A;  1B59 A;  4CSW A;  3S8P A;  1FOY A;  2XAJ A;  1JKP C;  3G2B A;  3HKZ A;  3K7A J;  4PDK A;  1A31 A;  5IYC J;  1O3S A;  3QYE A;  1FY7 A;  4UUT A;  1OYY A;  1TWH J;  2EQR A;  5J4V A;  1B8I B;  2C6Y A;  2XKO A;  3HRT A;  2UXO A;  2VPR A;  2L3D A;  3FXU A;  4A0X A;  2GFN A;  3MZY A;  1GXQ A;  2CW8 A;  1BI0 A;  3KE2 A;  5L3F A;  2KRH A;  3BJ6 A;  4XRS A;  5HSZ A;  3RKQ A;  1YW7 A;  3C1D A;  1ZRE A;  2CFO A;  4UXN A;  3E6C C;  5BQT A;  1OJL A;  4PJJ A;  4RM2 A;  2L01 A;  4A3B J;  1MSF C;  4LB6 B;  3C3W A;  3OYA A;  3JW4 A;  1H89 C;  3R0A A;  3A2K A;  2O9L A;  3S1Q J;  3VB2 A;  3LWJ A;  1QGP A;  2NVT J;  1D0Y A;  3I4P A;  1CF7 B;  4BHB A;  4XN3 A;  2XGD A;  4IOA F;  2NS0 A;  4CO8 A;  1R1U A;  3U9G A;  2E1M B;  2HPM A;  2NNN A;  4EV0 A;  4RM3 A;  3KZI C;  2M9H A;  3ROU A;  2DK5 A;  3MCZ A;  3GTJ J;  4BBS J;  2JZY A;  3PNY A;  2EH3 A;  4LLL A;  2HVS A;  3DBL B;  2HDD A;  3B81 A;  1JGS A;  4CXF A;  1ZR2 A;  2G3B A;  2BGC A;  4BKX A;  5ERI A;  1BA5 A;  5C4Y A;  3RSN A;  2B3W A;  3IC7 A;  4PJN A;  1EH7 A;  1X19 A;  1HXD A;  2V79 A;  3M8J A;  3OYJ A;  2WAD A;  4II2 A;  1W5T A;  5J1Y A;  3ZN0 A;  2IGO A;  5BNG A;  1REP C;  2PJP A;  3N4M A;  3ABT A;  1K6O A;  3H0D A;  3OSG A;  3F8C A;  1HW5 A;  2KQR A;  3OWT A;  2ZC2 A;  4HLY A;  2IU5 A;  2UWM A;  5J40 A;  5CVV A;  2W1O A;  3LNQ A;  1VFC A;  4B4C A;  3HUG A;  4FIS A;  1QHG A;  1ZAO A;  1ZAR A;  2UV1 A;  3JRC A;  5D18 A;  2EZK A;  1MND A;  3K69 A;  1TWG J;  4GYI A;  4HX7 A;  4B1R A;  1FOX A;  1R1V A;  2HGC A;  2HYT A;  4JX5 A;  2IGK A;  5D5U B;  2CYY A;  3TGN A;  4QIW N;  3TKY A;  1I27 A;  3QP5 A;  1LVA A;  2W7N A;  2RN7 A;  2XKP A;  4FAS D;  2QBY A;  3FZV A;  4Q47 A;  3G4S I;  2F5C A;  3F6V A;  2Z16 A;  3S17 J;  1Y0N A;  5LGU A;  1HBX G;  4LLG F;  4H0E A;  2DT6 A;  2CRG A;  2X51 A;  3SXY A;  3OS0 A;  3AG3 H;  1R58 A;  3BTC A;  1P4X A;  5LHH A;  2OD5 A;  4CCL A;  1EH8 A;  3SDG A;  4U0W A;  5D19 A;  3EUH A;  3KZZ A;  2K85 A;  3WGG A;  2VQC A;  1TWC J;  2P6T A;  1VZ0 A;  5AIP A;  1W0U A;  2D1H A;  2CQN A;  1SD6 A;  2E1N A;  2V7F A;  2XSD C;  1MJA A;  2DQR A;  2FBK A;  2VBX A;  3BCA A;  3EUP A;  5HS8 A;  3B6A A;  3GZ6 A;  3DPJ A;  1ZG1 A;  3CCL I;  2RHA A;  3P7N A;  1YFH A;  5E79 C;  5HOD A;  1R4M B;  3M8E A;  4KDP A;  1W5C C;  1WVR A;  3BJO A;  3U1K A;  1K78 B;  1U0J A;  3KIO A;  3FXJ A;  3ON2 A;  4ZYG A;  2OF7 A;  3HHH A;  4ESB A;  1LFB A;  2AO9 A;  1FMW A;  1JT6 A;  2DOA A;  3LQQ A;  1HQC A;  2ZNY A;  2XAU A;  2DG7 A;  3RI4 A;  4LIV A;  3DTI A;  2WY7 Q;  2X1E A;  1OIS A;  3BR6 A;  3QU3 A;  4IPA A;  3AKZ A;  3KYL A;  2BVL A;  1VI0 A;  1MJ9 A;  3CTA A;  4P5O A;  3E6M A;  5E8G A;  1T08 B;  4BDZ A;  4N9H A;  3F8N A;  2JA7 J;  3K10 A;  2R93 J;  2P5L C;  2JQ7 A;  4D5C A;  5D4S A;  2HOA A;  3HEF A;  1XB4 A;  4KYW A;  2PJR B;  2Z3Y A;  2OC6 A;  4PFO A;  4XNF A;  3JRA A;  1XGO A;  3WTU C;  1LVK A;  4XOR A;  3JRH A;  1LPQ A;  3MQ0 A;  4OD4 A;  2LRD A;  2NVY J;  1XDS A;  2RQQ A;  1WJC A;  2OCE A;  4IRV A;  2M3A A;  3OIP A;  3GTP J;  3QQA A;  3GTG J;  2LC2 A;  3T6N A;  1J59 A;  4UVC A;  1HW1 A;  3LJL A;  5FGL A;  4RGR A;  1XN7 A;  3HJE A;  2N8G A;  4BH9 A;  5J8C A;  1A5J A;  2QTQ A;  2JRM A;  4LK1 F;  5EG0 A;  1VQK I;  4A3G J;  4EEF G;  1RRJ A;  2XV4 S;  4I01 A;  3I56 I;  3ZMU A;  4E7Z A;  1ETW A;  2F5E A;  4XM3 A;  2EJR A;  3CUQ B;  2P5K A;  1UAA A;  1KA8 A;  4RBO A;  1GUU A;  3ZQ7 A;  3FK6 A;  5M3F J;  3LAP A;  2IGN A;  1KU9 A;  4MK6 A;  2LNB A;  2ZCX A;  1S7O A;  3K4C A;  4WXD A;  1MBH A;  4F3Q A;  1MMA A;  1B8I A;  3SJM A;  1S29 A;  1LNW A;  4KN7 X;  2FSW A;  2ZXH A;  2QUF A;  2ICW G;  3CCU I;  2HYG D;  5DAJ A;  5B1A H;  3H5A A;  4AM3 A;  2FE3 A;  4BHP A;  3VFZ A;  4CUG A;  3TL4 X;  1MD0 A;  2DDB A;  1I6X A;  1D1B A;  2MSY A;  3BZC A;  4A5M A;  1VQM I;  2V4J C;  5ICC A;  2ZOZ A;  4WF2 A;  3OYI A;  3ON4 A;  3LSK A;  1G6N A;  2H09 A;  3ZQG A;  1IN4 A;  2R7R A;  4MO7 A;  3DBH B;  1MBE A;  2BY0 A;  2Q8K A;  3T5X A;  2PMZ N;  1CF7 A;  4UHT A;  2HQ5 A;  2D6Y A;  4YFN F;  2KT0 A;  2WGB A;  2HXO A;  3RQ4 A;  3ZMT A;  2MD0 A;  1MMD A;  2ZCN A;  3OYB A;  3GEU A;  4F93 B;  4KIC A;  2VJJ A;  5C44 J;  1E17 A;  2GUH A;  1JHH A;  1V5E A;  1XMA A;  2OPT A;  2YPR A;  4ZTJ A;  4HQM A;  1ZGA A;  4HQE A;  4CDG A;  2G7U A;  5HLG A;  5IYB J;  2BXZ A;  2LK2 A;  5GAD J;  4FE4 A;  3O6B B;  2HR3 A;  5E18 F;  3M4O J;  4BL0 B;  2NXN B;  4F92 B;  2LD5 A;  1T2K A;  3BOQ A;  1RIO H;  5CQE A;  3LSR A;  3HSF A;  4NB5 A;  1ZQ3 P;  4ICH A;  1E2X A;  2ECC A;  2CW0 F;  2FQ3 A;  4MEY F;  1HA8 A;  3O60 A;  4XRS G;  2OU2 A;  5F0F A;  3HRS A;  1IZ1 A;  1K4T A;  4C3H J;  1LFP A;  5CKT A;  4OOI A;  4UNO A;  2EZL A;  2KHM A;  5FD6 A;  2A07 F;  2EZI A;  1BC7 C;  2TDX A;  3KEY A;  3OR2 C;  2F2E A;  1A6I A;  1HLV A;  1Q1H A;  1YJW I;  4I0A A;  3BG9 A;  3DBR B;  1SVL A;  3IAS 2;  4I09 A;  2DFF A;  4YIF A;  4YEJ A;  1I39 A;  1BN5 A;  2OZ6 A;  3KEQ A;  1XS9 A;  1H9G A;  4HRI A;  4EM0 B;  1BR2 A;  1QPM A;  3D1N I;  2HFH A;  4G7Z F;  2B0L A;  3DV8 A;  3JRD A;  2DPU A;  5CQG A;  3EYI A;  3BR5 A;  3BHQ A;  4I2O A;  1RUN A;  5JLX A;  3DTK A;  3KNW A;  1K4S A;  3IRR A;  3QBM A;  4A0Y A;  4NC6 A;  2KDO A;  3W2V A;  3HOT A;  1X4O A;  4JQF A;  4XN0 A;  4ZYA A;  5CVJ A;  3RD3 A;  5D4R A;  5KCM A;  4WXH A;  4XLA A;  2QKL B;  4QSH A;  4HZF A;  5HLI A;  2Q1Z B;  1YIJ I;  5EDN A;  3KEO A;  1P9Q C;  4RB0 A;  3MMY B;  1LDJ A;  5J6X A;  3NNR A;  2IT0 A;  3BLY A;  2QWW A;  4ZZL A;  2V1N A;  2KL4 A;  2LKP A;  2LP0 A;  4BJT A;  4EAT A;  4NHJ A;  4KIS A;  3WTX C;  4L9N A;  2IPQ X;  5GAG J;  5E1X A;  4GGG A;  3CCS I;  1OQY A;  3OIQ A;  2M1B A;  3BPV A;  1K78 A;  2PN6 A;  1OR7 A;  3JCU C;  5IT9 Z;  2K9S A;  2P7V B;  5LFA A;  3IUO A;  4EM1 A;  2E5Z A;  5EZH A;  2XDN A;  4C2M A;  1MH3 A;  1X1C A;  1VF9 A;  2EFP A;  5J1R A;  3WTW C;  1IN5 A;  2QOP A;  5FRN A;  1R23 A;  2XSJ C;  4YEL A;  5HNF A;  3PJR A;  4YRV A;  4B43 A;  4E7S A;  2L7M P;  1UI5 A;  4CYD A;  5J3L A;  3BR1 A;  4PK4 A;  4KMF A;  2FEZ A;  3VSL A;  1ITY A;  1Z6T A;  1PYV A;  2EV0 A;  4HW0 A;  2DT5 A;  1UHM A;  4PGG A;  2WBM A;  2O3F A;  4R8H A;  1XSD A;  3PO2 J;  2DA3 A;  3FMR A;  3H3Z A;  2V26 A;  4QPQ A;  3DKY A;  2MYS A;  3C18 A;  4HSR A;  2ZO4 A;  2PQ8 A;  3NEU A;  2PJR A;  3HOS A;  1P6R A;  2TRT A;  2R7V A;  3PUB A;  1IN8 A;  4RGS A;  2FD5 A;  3CC2 I;  1TQI A;  3FXK A;  3NPI A;  4JK1 X;  1TLH B;  5BPD A;  1SVO A;  1V4R A;  2XPU A;  3VDX A;  3BJB A;  6PAX A;  5HBU A;  1FBS A;  4PFP A;  4AWX B;  4F55 A;  2BHZ A;  2V1D A;  3A03 A;  4YIR X;  1QZY A;  2VQL A;  2IRF G;  2QSF X;  1D1A A;  2PFB A;  3DQV C;  3I54 A;  1NK2 P;  3SZG A;  2Y48 A;  2FBI A;  4GXO A;  1TT5 B;  2DN0 A;  1SAN A;  3WHB A;  4HV6 A;  3HOX J;  3CUO A;  1RES A;  2M2E A;  2QQB A;  2JA5 J;  2A05 A;  2QEX I;  3GTQ J;  3EDP A;  2NP3 A;  4NC7 A;  1JUM A;  5KVR A;  1U5T C;  4HG2 A;  1BR4 A;  1MBJ A;  1T95 A;  3CUQ A;  5DD4 A;  1QBJ A;  3DXJ F;  2UUZ A;  4M3D A;  4ZYE A;  1E0E A;  1TNS A;  4N4O B;  2FU4 A;  4XSZ F;  3PSF A;  1FIA A;  4S04 A;  5F04 A;  5B1B H;  1VQ4 I;  2WUI A;  2QKM B;  2NX4 A;  2K9L A;  2PBX A;  2M7B A;  2ZY9 A;  4PJ0 C;  3PIP F;  3BP8 A;  1Y6I A;  4BXX J;  2LH9 A;  4RS8 A;  1DUX C;  3K4N A;  4Y3O A;  3HSR A;  1UG0 A;  4LLN A;  3OR1 C;  5FRM A;  4BQO A;  3OYF A;  1AHD P;  1ZHF A;  1B6A A;  1HC8 A;  1Z7L A;  3I59 B;  1P2F A;  1U9N A;  1YE9 A;  2B9S A;  3QU6 A;  4Y15 A;  4ZYD A;  5F64 A;  3CRJ A;  5D1R A;  4LJZ F;  3SEQ A;  2G7S A;  2K3F A;  3ZQL A;  1GDT A;  2R7D A;  1ENH A;  3E3V A;  3DFG A;  2H1L A;  4C2M J;  4BDY A;  3PAS A;  4II3 A;  3V8J A;  1XPX A;  3U21 A;  3LFU A;  3RPU D;  3S1M J;  5TIS C;  1EF4 A;  2R7Z J;  2M4K A;  4Y7N J;  2CQK A;  1SFE A;  3FKI J;  1EKE A;  3K4M A;  4ETS A;  1KGS A;  2R4G A;  2NVU B;  4C2U A;  3R6S A;  1ETO A;  1X3Z B;  1AA7 A;  5JVT A;  1Z0X A;  3CCV I;  1VND A;  2GOX B;  2KMU A;  1G3Y A;  3S16 J;  1G59 A;  1NK3 P;  1WJ5 A;  1HKQ A;  5JLW A;  2KPM A;  4IJA A;  1HOM A;  1IXC A;  2HU9 A;  4KFC A;  1DU0 A;  5E3M A;  1TNT A;  2LVS A;  4JYK A;  2QVO A;  1NHA A;  2YSR A;  1DGW Y;  4KWA A;  3F22 A;  2VJ4 A;  3CJT B;  3K6G A;  2HDW A;  4IHY A;  4YFX F;  3ESW B;  3LFK A;  1MMS A;  1IJW C;  1S6L A;  2MGQ A;  5JVG F;  3WGH A;  3HKZ N;  1XMK A;  2R7X A;  5FRO A;  3BWG A;  4LG0 B;  5GAE J;  1FBQ A;  4X6A J;  3GFI A;  5FFX A;  3GZI A;  2PMU A;  4WK8 F;  1OYW A;  1MZB A;  5CJ9 A;  3RYP A;  3MEX A;  1J2X A;  3CDH A;  3BG6 A;  1AWC A;  2QZ8 A;  1WJB A;  4N0B A;  3VWB A;  1IV6 A;  3K4K A;  4IRG A;  4EJV A; 
#chains in the Genus database with same CATH homology
 1UHS A;  4DYR A;  1BA5 A;  4HNV A;  5C4Y A;  1Y1W J;  2XB0 X;  3Q3S A;  1W0T A;  2ECB A;  5FJ8 J;  1WH7 A;  1P7J A;  5J1U A;  4ACI A;  5J1Y A;  4GCK A;  2X6O A;  1LFU P;  5BNG A;  3FRQ A;  1BL0 A;  4BY7 J;  3OSG A;  3NI7 A;  3JRF A;  2XB5 A;  1IDY A;  2B63 J;  2IU5 A;  2OER A;  3F1B A;  2PZ9 A;  2M0C A;  1U78 A;  3LNQ A;  2TCT A;  1VFC A;  4G12 A;  5IOZ A;  5FLV A;  4MIM A;  4B4C A;  3ANP A;  1GV5 A;  4FIS A;  2KDZ A;  1I3Q J;  1IGN A;  3HOZ J;  3JRC A;  5C3E J;  2HOS A;  5D18 A;  2EZK A;  3A02 A;  1LE8 A;  1TWF J;  1TWG J;  4B1R A;  2HYT A;  5CW8 A;  3IH4 A;  5EZG A;  4S0H B;  4M3B A;  4JX5 A;  5IOY A;  1B72 B;  2QF7 A;  1G2H A;  3G56 A;  3VP5 A;  3BG5 A;  4QIW N;  5C4X J;  4I6Z A;  3AQS A;  3WHC A;  4UUS A;  4ABZ A;  1X2M A;  1ETY A;  1MBF A;  1JJ6 C;  2ID6 A;  2W48 A;  3DEW A;  2H8R A;  3S17 J;  3MNL A;  2AHQ A;  5EYR A;  2DJN A;  3CMY A;  1NTC A;  3BTJ A;  4YZE A;  2CRG A;  2HI3 A;  4M3E A;  2JJ7 A;  4AYB N;  3GTM J;  3S1N J;  1BW5 A;  1XG1 A;  2XGC A;  1ETK A;  3PM1 A;  3JRB A;  3BTC A;  3JRI A;  3VVY A;  2DTZ A;  3SDG A;  3VVZ A;  3DCF A;  9ANT A;  5D19 A;  1TWC J;  4JX6 A;  1RR7 A;  5E3L A;  2GLO A;  3CCY A;  5K58 A;  1W0U A;  1S7E A;  3MKL A;  1D5Y A;  4FTH A;  2XSD C;  3EUP A;  1MNM C;  3QKX A;  3B6A A;  3DPJ A;  2CQX A;  1TC3 C;  4D5F A;  1I6H J;  1SFO J;  1GV2 A;  2RHA A;  5K7H A;  3O8H A;  5HOD A;  3FIS A;  4J19 A;  2WB1 N;  5IP6 A;  2L0K A;  3ON2 A;  2OF7 A;  2K9N A;  1LFB A;  1RKW A;  2AO9 A;  2DA4 A;  3LOC A;  1JT6 A;  2UXH A;  1IRZ A;  5M5Y J;  1ZGW A;  2DG7 A;  2XPW A;  3HDD A;  3I4N J;  4RDU A;  3BR6 A;  4D7M A;  1GVD A;  1ZK8 A;  1JTX A;  4JKZ A;  2CQQ A;  4W97 A;  1VI0 A;  1PUF B;  3S14 J;  2FQ4 A;  2JA7 J;  2R93 J;  1RKT A;  3S5R A;  3JRE A;  4D5C A;  2HOA A;  3HEF A;  1T33 A;  2WAQ N;  5FLM J;  1IC8 A;  4I76 A;  4HKU A;  3JRA A;  2G0E A;  3JRH A;  3P9T A;  3VW2 A;  3HGY A;  1QVU A;  2NVY J;  1ZKG A;  2R5Y B;  2O7O A;  2DMP A;  1U9O A;  1ZR4 A;  3GTP J;  2DG8 A;  3QQA A;  3GTG J;  3T6N A;  2VKV A;  1F43 A;  2E19 A;  1UG2 A;  2NVX J;  3LJL A;  5FGL A;  2REK A;  2CU7 A;  3BR0 A;  3F0C A;  1A5J A;  2N8G A;  3K2A A;  2QTQ A;  2HKU A;  1WPK A;  4PXI A;  5EG0 A;  4CYC A;  2DMQ A;  3Q0V A;  4A3G J;  4EEF G;  2GEN A;  4L5E A;  4A3C J;  1JT0 A;  1MBG A;  3G1M A;  3HOV J;  5K7F A;  3KZ9 A;  1ETW A;  2ELK A;  2YVE A;  3H0G J;  4RBO A;  1GUU A;  2LTP A;  4X1E A;  3FK6 A;  5M3F J;  2JA6 J;  2JN6 A;  1E3O C;  1YRN B;  4MK6 A;  1JKQ C;  5CXI A;  1X2N A;  3W6V A;  3EGQ A;  5F0H A;  2ZCX A;  1MBH A;  2G7G A;  2E1O A;  1B8I A;  3G1O A;  4AF5 A;  3LSJ A;  3SJM A;  3A01 B;  3IV5 A;  2G7L A;  5DTD A;  2NS8 A;  5F27 A;  3L1P A;  2IAI A;  2JA8 J;  4ME9 A;  5DAJ A;  2XRL A;  3M3Y J;  5GP9 A;  3HIM A;  2EBI A;  2MSY A;  1AKH A;  2H1K A;  3E7Q A;  2ZOZ A;  2NS7 A;  3ON4 A;  3Q0W A;  5M5W J;  2QKO A;  3ZQG A;  5FKO A;  1QPI A;  4MO7 A;  5FKK A;  1MBE A;  3RZO J;  2PMZ N;  2YUS A;  3BR2 A;  4MFE A;  2L7F P;  2HQ5 A;  3HBL A;  4GCL A;  2D6Y A;  4UDS A;  4A3L J;  2KT0 A;  2WGB A;  4A3J J;  2HXO A;  2DA7 A;  3S15 J;  3GTK J;  1K61 A;  2ZCN A;  1K83 J;  3GEU A;  4LOC A;  5C44 J;  3BQZ A;  2K9Q A;  2GUH A;  2OPT A;  5CXG A;  3HTJ A;  3PPB A;  3VUQ A;  2JMW A;  3RQI A;  2DMT A;  1JUP A;  2MW8 A;  1T56 A;  5IYB J;  1H88 C;  3S2D J;  4NEL A;  2LK2 A;  3JSJ A;  4FE4 A;  3M4O J;  2UXP A;  2LD5 A;  1ETV A;  3B6C A;  1MH4 A;  5E3O A;  4DYC A;  4V2F A;  1BW6 A;  1QVT A;  1JKR C;  3I4M J;  2UXU A;  3LSR A;  4DYQ A;  2GBY A;  5EFY A;  1I50 J;  2R0Q C;  2NOG A;  4ICH A;  3BTL A;  1ZQ3 P;  4B3A A;  2ECC A;  3QPS A;  4NN1 A;  2LFB A;  1POG A;  2M34 A;  2JK3 A;  2Y2Z A;  1HDP A;  5H9T A;  4IHW A;  3O60 A;  4DZP A;  1RET A;  4GFB A;  4XRS G;  4QTR A;  1JKO C;  3BT9 A;  3OIO A;  5F0F A;  4C3H J;  2YS9 A;  2EZL A;  2QCO A;  3VVX A;  1Y1V J;  1R9T J;  2R5Z B;  3VIB A;  2YVH A;  2EZI A;  4A3I J;  4C3I J;  5IP7 J;  1XC5 A;  2ME6 A;  2LY9 A;  3CJD A;  2IBD A;  3UKG A;  1B72 A;  1A6I A;  1HLV A;  2O8K A;  2ZCM A;  4BBR J;  2L9R A;  3BG9 A;  5AQC A;  3NAR A;  2QIB A;  4CGR A;  3O8G A;  2D5V A;  3HGG A;  1XS9 A;  2P81 A;  3QPL A;  3HM5 A;  3D1N I;  4D7N A;  5F1J A;  3HOW J;  2OI8 A;  3ANG A;  1OFC X;  3JRD A;  3KKD A;  1Q1V A;  2Y31 A;  2O7T A;  3BR5 A;  1H8A C;  3BHQ A;  5JLX A;  4GCT A;  1FIP A;  3HB9 A;  3VW1 A;  1RPW A;  4IEJ A;  3KNW A;  3BR3 A;  3QBM A;  3MN2 A;  2E2J J;  2XPV A;  5M5X J;  1APL C;  3ZQH A;  3RD3 A;  4JNN A;  3IH3 A;  3NAU A;  4XIC A;  3H3V K;  4QSH A;  2HOT A;  3VW0 A;  5EDN A;  3NNR A;  2X48 A;  2LP0 A;  2DA2 A;  3FK7 A;  1ZTR A;  1JUS A;  1MSE C;  3BRU A;  4GFK A;  1LE8 B;  2RAE A;  5IYD J;  4A3F J;  2K9S A;  1JJ8 C;  2Y30 A;  4M3F A;  3IH2 A;  3TP0 A;  2Y0S N;  5EZH A;  3PO3 J;  2XDN A;  3ZQC A;  1HDD C;  1ETQ A;  1MH3 A;  5J1R A;  1VF9 A;  3BQY A;  2QOP A;  4UUS B;  2ZB9 A;  5FHP A;  3TW7 A;  1WI3 A;  1IG7 A;  2L7M P;  1UI5 A;  5DS9 A;  3NXC A;  5J3L A;  4AC0 A;  3BR1 A;  4MXM A;  1ITY A;  2DMN A;  5F0C A;  1PUF A;  2GM4 A;  5F08 A;  3GTL J;  2X9D A;  2I10 A;  1JGG A;  2Q24 A;  3SFI A;  3PO2 J;  1F36 A;  1OCP A;  2DA3 A;  1JTY A;  5C4J J;  3HOU J;  3KKC A;  2LKX A;  4Y52 J;  3G1L A;  2FX0 A;  1SGM A;  2Y9Y A;  2K40 A;  2TRT A;  3ZQF A;  2ME0 A;  2HYJ A;  2ZOY A;  2FD5 A;  4A69 C;  5FKM A;  3NPI A;  4XRM A;  5FKL A;  1HF0 A;  2R5Y A;  2XPU A;  3CDL A;  1IUF A;  1MBK A;  3BJB A;  1FTT A;  5HBU A;  2CUE A;  5EF6 A;  2NVQ J;  1CQT A;  3ZOB A;  2CUF A;  3A03 A;  1P7I A;  3JRG A;  4MLO A;  4FE7 A;  3RZD J;  2E2H J;  2JWT A;  1OCT C;  5GPC A;  2YU9 J;  1NK2 P;  3C07 A;  3COL A;  3VOX A;  3JR9 A;  2DN0 A;  1SAN A;  3WHB A;  2DA6 A;  3HOX J;  1RES A;  2M2E A;  2XGE A;  5K7Z A;  2FJ1 A;  3OOU A;  2JA5 J;  1HCR A;  3CQZ J;  3GTQ J;  4IHV A;  3HTH A;  2NP3 A;  2DA5 A;  1FEX A;  1JUM A;  2RAS A;  1IDZ A;  2F07 A;  3Q0U A;  1MBJ A;  4IHX A;  4JP0 A;  1QRY A;  2VKE A;  4M3D A;  4FCY A;  1FTZ A;  1YRN A;  1ETX A;  1FIA A;  5GPA A;  3LSP A;  5F04 A;  4DW6 A;  2WV1 A;  2WUI A;  3A01 A;  5FMP A;  5EGO B;  2NX4 A;  3G7R A;  2PBX A;  3RH2 A;  2Y9Z A;  4GFL A;  4M3G A;  2R92 J;  3AQT A;  2E2I J;  4BXX J;  3BNI A;  1WCM J;  4JL3 A;  4M6V A;  3IUV A;  4W1U A;  1UI6 A;  4JX4 A;  1WGX A;  2VI6 A;  2EZH A;  1AHD P;  2W53 A;  1U8B A;  1GT0 C;  1BJZ A;  5M3M J;  4AUX A;  1U9N A;  2LR8 A;  3TED A;  4C3J J;  3CRJ A;  5IP9 J;  4DZJ A;  5D1R A;  3S2H J;  2G7S A;  2DA1 A;  3VPR A;  1Z77 A;  3ZQL A;  1GDT A;  3OSF A;  2HXI A;  1ENH A;  3LSG A;  1AU7 A;  5EEA A;  4A3E J;  4C2M J;  3PAS A;  2LLK A;  5EG0 B;  2QWT A;  4CYC B;  3NRG A;  5HAW A;  2UXI A;  1ORK A;  1O4X A;  3BCG A;  3CWR A;  2CJJ A;  3ZQI A;  4XID A;  3S1M J;  1EF4 A;  2R7Z J;  1DU6 A;  4A3M J;  1JKP C;  4Y7N J;  5IPA A;  2VUM J;  3HTA A;  3FKI J;  2IEK A;  3K7A J;  3GTO J;  1WH5 A;  1ETO A;  5IYC J;  2V57 A;  2MG4 A;  3C2B A;  2NP5 A;  4NDL A;  4XK4 A;  4UUT A;  1TWH J;  2EQR A;  1Z0X A;  3LHQ A;  2L7Z A;  4MFD A;  5FKN A;  1TWA J;  1VND A;  1B8I B;  3S16 J;  1NK3 P;  3HTI A;  2UXO A;  5JLW A;  2VPR A;  3MVP A;  2GFN A;  5EGO A;  1HOM A;  3BTI A;  3VOK A;  4L62 A;  1DU0 A;  5E3M A;  4XRS A;  5HSZ A;  4A3K J;  3RKQ A;  2ID3 A;  3E7L A;  2LVS A;  1X58 A;  4V2G A;  4JYK A;  1OJL A;  1UMQ A;  1AKH B;  2R5Z A;  3BG3 A;  4A3D J;  1MSF C;  4A3B J;  3HOY J;  4KWA A;  1H89 C;  2M8G X;  2DMU A;  2O9L A;  4IHY A;  3S1Q J;  4AC6 A;  1IJW C;  3LWJ A;  2MGQ A;  5E3N A;  2NVT J;  3HKZ N;  4A93 J;  2XGD A;  4X6A J;  2M9H A;  2FBQ A;  3GZI A;  3GTJ J;  3HE0 A;  3V78 A;  3FIW A;  4BBS J;  2COB A;  2EH3 A;  3V6G A;  3TW6 A;  2HDD A;  3GBG A;  3B81 A;  3TP3 A;  3S1R J;  1ZR2 A;  1IV6 A;  1FJL A;  2G3B A;  4BKX A;  4BY1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...