2RAEA

Crystal structure of a tetr/acrr family transcriptional regulator from rhodococcus sp. rha1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
193
structure length
193
Chain Sequence
IGRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, AcrR family protein
publication title The crystal structure of a TetR/AcrR family transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
total genus 70
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2raeA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2raeA02
4M3FA 1CQTA 4GFBA 4GFLA 1JKOC 3BR2A 4DYQA 3Q0WA 3A02A 4BY7J 3ZOBA 3BR3A 3P9TA 2R7ZJ 2DA1A 1WH5A 2H8RA 2DMNA 3HOYJ 5D18A 2WAQN 4L62A 1LFBA 1K83J 5CXIA 3GTPJ 1RESA 4XK4A 2GM4A 5K7ZA 3IUVA 2H1KA 5HSZA 3KZ9A 5DS9A 3JRDA 1PUFA 9ANTA 5CXGA 5FKMA 2Q24A 1WCMJ 2DMPA 5D1RA 2ZCNA 1AU7A 4C2MJ 5J1RA 3WHBA 1HOMA 3JRBA 4QIWN 2R5ZA 5FLVA 1NK2P 3HM5A 1MBGA 4NELA 4MIMA 1U78A 2HQ5A 3BQZA 5F27A 2NVTJ 1YRNB 2W53A 3VVYA 1TWCJ 2DA7A 2ZB9A 2ZCXA 3AQTA 5C4XJ 5HODA 2NS7A 2GBYA 2E2HJ 1P7JA 4MXMA 2MW8A 3HB9A 2IEKA 1IRZA 1ZK8A 4MK6A 3IV5A 4UUTA 4B1RA 3PO2J 2JJ7A 4EEFG 2E2JJ 4XIDA 2RASA 5FKKA 2XB0X 4IHVA 4JL3A 4JP0A 4BBRJ 2JA6J 1UHSA 2ELKA 2LVSA 2F07A 3FIWA 4J19A 3PO3J 3ZQLA 1JJ6C 3S17J 3CRJA 1ZGWA 3IH4A 2X48A 3ON2A 4LOCA 1IDYA 5IYBJ 4A3JJ 4A69C 5EDNA 2V57A 1JJ8C 4G12A 1S7EA 2FD5A 2DA2A 2EZLA 4A3CJ 4A3LJ 4X6AJ 3CWRA 3GTQJ 4D5CA 2G7LA 2E1OA 3CDLA 4FISA 1MSEC 3TW6A 1ETQA 1AKHA 1WI3A 1JKRC 2DN0A 2CUEA 1E3OC 3TP0A 3HDDA 1XS9A 3S1NJ 3S5RA 3LNQA 2EH3A 1DU6A 1U8BA 1HDPA 3O8GA 1QVTA 5JLXA 1TWGJ 2WB1N 2DG8A 3VVZA 1EF4A 3ZQHA 3A01A 2CU7A 3LSJA 2GUHA 3VUQA 5FGLA 2O7TA 3W6VA 2EZIA 1G2HA 5EEAA 4GCLA 2L0KA 3D1NI 4MFEA 2HOAA 2EQRA 1D5YA 1IV6A 3CQZJ 2RHAA 5DTDA 4W97A 2HYTA 5EFYA 3KKDA 2CUFA 1JKQC 3DCFA 1F36A 1B72A 4S0HB 3VOXA 4UUSB 1ETOA 5C4YA 1HLVA 3PM1A 3JR9A 1R9TJ 3VW0A 3TP3A 4NDLA 5JLWA 1WPKA 2ID3A 3O8HA 2G3BA 2NP3A 3QPLA 2ZOZA 2QTQA 3FRQA 2DA6A 5BNGA 1RKWA 2HYJA 3JRHA 2HDDA 1A5JA 1UI6A 4M3GA 1GDTA 4YZEA 5F0FA 1JKPC 1QPIA 4D7MA 2JN6A 2ME6A 4DYRA 5CW8A 1JGGA 3VW1A 2KT0A 1ETVA 2K9NA 5F1JA 3ANGA 5EG0B 4HNVA 1POGA 5M5WJ 4MLOA 4BKXA 1I3QJ 1HDDC 2HOTA 4V2GA 3HTJA 5M3FJ 4AF5A 1UG2A 1UMQA 3S2HJ 1BJZA 4GFKA 5EGOA 3EGQA 4CYCA 1Z77A 2XGCA 2XGEA 1ENHA 4A3EJ 3HOUJ 3RKQA 2DTZA 3JREA 4HKUA 3MN2A 2WGBA 3TW7A 2K9QA 3E7LA 3GTLJ 2UXIA 2LLKA 4B3AA 4D7NA 3S1QJ 3GZIA 1H88C 3ZQFA 1BA5A 1IC8A 3K7AJ 3LSGA 3S2DJ 1DU0A 3HKZN 3GEUA 4C3JJ 3NRGA 2XPUA 1GV5A 3RZOJ 1FIPA 3G7RA 2M8GX 5K58A 3JSJA 4ACIA 2DJNA 1JUMA 3OSGA 1SGMA 2Y2ZA 4C3HJ 4XRSA 2JWTA 2FBQA 2DA5A 5IP6A 3LSPA 2P81A 4ICHA 4RBOA 1BW5A 1BL0A 2ID6A 3LWJA 2XGDA 2X6OA 1I50J 1MBFA 1W0UA 3C07A 3QBMA 2MGQA 3I4MJ 4ABZA 2B63J 3RD3A 2JMWA 3PASA 5M5XJ 1XC5A 1W0TA 3Q3SA 1JT0A 3HE0A 4DW6A 1APLC 3COLA 3NPIA 3SFIA 1ZQ3P 1ETXA 2X9DA 1NK3P 2JA8J 4FTHA 1MH4A 4W1UA 2DMTA 2ECBA 3BG5A 2IBDA 2MG4A 5J1UA 1B8IA 1ETKA 3A03A 1TWHJ 2LY9A 1QRYA 1T56A 5AQCA 3GTJJ 5F04A 4JX4A 1TWAJ 3ZQGA 2DMUA 4XICA 3L1PA 3H0GJ 1TWFJ 1WGXA 2G0EA 4A3KJ 1LE8B 3HOZJ 1VI0A 4PXIA 3F0CA 3BG9A 4MO7A 2M2EA 4A3DJ 2L7MP 3HIMA 1NTCA 3O60A 1ZKGA 3RH2A 3HOWJ 1X58A 1JT6A 3AQSA 4GCTA 3CMYA 2OF7A 2D5VA 2E2IJ 2JA7J 4BBSJ 1GT0C 1X2NA 4B4CA 5IP7J 3KKCA 1H8AC 4NN1A 1P7IA 1U9NA 5IOYA 3GTOJ 1HF0A 3BJBA 5DAJA 3I4NJ 2K9SA 2IAIA 2UXOA 2DMQA 2NS8A 2FX0A 2LFBA 5EF6A 3BCGA 3VW2A 3JRIA 3K2AA 3A01B 3JRGA 3RQIA 3S16J 3M4OJ 2I10A 5H9TA 3NI7A 2FJ1A 4IHWA 5M5YJ 3BHQA 1OCTC 2DG7A 2NVYJ 1MH3A 4L5EA 4C3IJ 3DPJA 2HXOA 2Y0SN 4I6ZA 3PPBA 3UKGA 3H3VK 4XRSG 3S15J 1FTZA 2IU5A 3BTJA 1F43A 2M9HA 2NOGA 1ETWA 1IG7A 2NP5A 1BW6A 4M3EA 2L7FP 1WH7A 3NAUA 2CJJA 1AHDP 2ZOYA 3V6GA 1FTTA 1JUSA 1Y1VJ 3G1LA 4BXXJ 3FISA 5GPCA 3S14J 5C4JJ 4DZPA 2GFNA 3HGGA 3GTMJ 2JK3A 3MNLA 4UUSA 5IPAA 5FLMJ 2R5YA 2R0QC 4A3MJ 4AYBN 3HTHA 1IJWC 3QPSA 2DA3A 2LTPA 4A3BJ 2G7SA 5EZGA 2PBXA 3ANPA 3Q0VA 3FKIJ 1OCPA 4FE4A 4M6VA 4IEJA 1VNDA 3BNIA 2QWTA 3F1BA 3JRCA 4AC0A 2QKOA 3CJDA 4KWAA 2O8KA 5FMPA 4CYCB 3BQYA 3IH2A 2CRGA 1Q1VA 2YVEA 3VOKA 2VKVA 1RR7A 5E3LA 4RDUA 3BRUA 3VPRA 1MBHA 1X2MA 1LFUP 5EG0A 1PUFB 2WUIA 5IYCJ 4GCKA 5F08A 4AC6A 2O9LA 1MBEA 2GENA 2TRTA 2XPWA 2AHQA 2LR8A 3MVPA 2HKUA 2L9RA 4JNNA 1ORKA 2QF7A 2R5ZB 1ZTRA 2D6YA 2AO9A 4JX6A 4D5FA 3BTLA 3S1MJ 2HOSA 4M3BA 5HAWA 1FIAA 1Z0XA 5IP9J 1ITYA 2OI8A 4A3GJ 4MFDA 1TC3C 2XPVA 3NARA 1RETA 2LK2A 3QQAA 3DEWA 5HBUA 2VI6A 4Y7NJ 1ZR2A 2WV1A 4XRMA 3RZDJ 4IHYA 1VFCA 3HOVJ 3NNRA 5FHPA 1H89C 3HTIA 2G7GA 2LD5A 2QCOA 3SDGA 4JKZA 1MBJA 2HXIA 3OOUA 1MNMC 1YRNA 5K7HA 3BR0A 2EBIA 5GPAA 1SFOJ 4UDSA 1UI5A 2PMZN 2N8GA 2M0CA 1ZR4A 3T6NA 1U9OA 2YU9J 3MKLA 2REKA 4M3DA 4A3FJ 5E3OA 1B8IB 2UXPA 2FQ4A 1SANA 3HGYA 2GLOA 5D19A 2MSYA 3HTAA 4A93J 5F0HA 2TCTA 1GVDA 2XSDC 3VP5A 3E7QA 3G1MA 4ME9A 3OIOA 3SJMA 5F0CA 3BR1A 5M3MJ 1AKHB 5EZHA 1IGNA 2NVQJ 3VVXA 2UXHA 1OJLA 2VPRA 2OPTA 3LJLA 5E3MA 2XRLA 2KDZA 3B81A 2QOPA 1VF9A 3BR5A 3FK6A 4JYKA 3LSRA 1FJLA 3KNWA 2QIBA 3EUPA 4A3IJ 3QKXA 1LE8A 1HCRA 2L7ZA 5FKLA 2XB5A 1ETYA 3GTKJ 2UXUA 3HOXJ 2M34A 3B6AA 4QTRA 2EZHA 1A6IA 3GTGJ 5IOZA 2RAEA 1MSFC 3VIBA 2ME0A 3GBGA 5C44J 3HBLA 1RKTA 1FEXA 1B72B 3BTIA 4DZJA 3LOCA 5K7FA 3ZQCA 2EZKA 2YS9A 2NX4A 5GP9A 3LHQA 2YVHA 2R93J 1RPWA 3C2BA 2Y31A 2YUSA 3JRFA 3HEFA 2E19A 1IUFA 2K40A 3G1OA 1GV2A 2W48A 4AUXA 5FJ8J 2XDNA 2ECCA 3JRAA 2COBA 3S1RJ 3OSFA 2VKEA 2LP0A 1T33A 3ON4A 3V78A 4IHXA 3FK7A 1GUUA 4I76A 2PZ9A 5FKOA 1O4XA 1I6HJ 2DA4A 2R5YB 4QSHA 2Y30A 3TEDA 1XG1A 5FKNA 2Y9ZA 3BTCA 3BT9A 1K61A 3B6CA 4Y52J 5E3NA 3IH3A 3BG3A 1IDZA 2O7OA 1JTYA 5J1YA 2OERA 2ZCMA 3M3YJ 1MBKA 4V2FA 3WHCA 2R92J 2VUMJ 5EGOB 2LKXA 4FCYA 3G56A 4CGRA 1JTXA 3BR6A 1Y1WJ 3NXCA 1JUPA 2HI3A 4FE7A 5EYRA 4BY1J 3CCYA 3Q0UA 2CQXA 5J3LA 2CQQA 5C3EJ 3ZQIA 2JA5J 1QVUA 4DYCA 4X1EA 1OFCX 2NVXJ 5IYDJ 2Y9YA 4JX5A
chains in the Genus database with same CATH superfamily
2L2OA 4FETA 4C2UA 3OIQA 4GFBA 2ESNA 3FM3A 3P7NA 4BYYA 1FX7A 4LMYA 2R7ZJ 2H8RA 3CLOA 5JI6A 1PP8F 1XN7A 4PFOA 3GTPJ 2E5NA 3IUVA 2LNBA 1Y56A 2EK5A 3KZ9A 3KYDB 1I39A 3OL3A 1PUFA 5CXGA 4HAMA 4ZYDA 2Q24A 1WCMJ 3OOPA 2ZCNA 1AU7A 4C2MJ 1G3TA 5TJJA 2BXZA 1BOBA 3E6CC 2R5ZA 4M74A 3J80K 3PIPF 4LG0A 5FLVA 3MZ8A 5DDGA 4NELA 2NVUB 2ISYA 2L7KA 4PGGA 3TO6A 1L3LA 1W5SA 1Z6RA 2NVTJ 4HZFA 4XORA 2PI0A 2BV6A 2W53A 2WC2A 2DA7A 1JHHA 3AQTA 4ZYHA 2NS7A 2J5PA 2W82A 2GBYA 3ONQA 3I0TA 5E1XA 2IEKA 2K9LA 5CQGA 2XAJA 5HS9A 2CO5A 1BR2A 5FFZA 2XAUA 5D6FA 4M9SA 2E2JJ 4EJUA 3K4JA 5L3GA 3R60A 3CUQA 4JL3A 5HLIA 1UHSA 2ELKA 2LVSA 4I99C 2QYOA 2LRDA 2QWWA 4MGRA 3WTWC 3SEQA 1YFHA 2ZJRF 1A04A 1FSEA 2G9WA 2DO7A 3AG1H 3K2ZA 3ON2A 5BPIA 5IYBJ 4R79A 1MMAA 2F5DA 3R0JA 2L9SA 4G12A 3OWTA 2DA2A 2EZLA 5TGTA 4OMZA 2QKMB 2E1OA 3CDLA 1MSEC 3F3XA 4A6EA 3C1DA 4AIKA 1WI3A 1JKRC 2R7FA 2CUEA 3F21A 3DWLE 3TP0A 3HC7A 3S1NJ 3S5RA 1FZPB 2M1BA 4CXFA 3DPUA 2ELHA 2K7LA 3PNYA 1QVTA 2E34A 2MA3A 3S32A 4F3QA 1W36D 1P92A 2CU7A 3LSJA 3M8EA 1YIJI 1O3TA 2M45A 3FZVA 1J5YA 3QP5A 3KFWX 2BHZA 5EEAA 2KL4A 3DPLC 3HRUA 2HVSA 3JAMZ 1UELB 3CQZJ 1IV6A 1D1AA 2WBMA 2V9PA 2QSFX 3QWLA 1IRXA 2DFHA 3JTHA 2JUGA 3GLLA 4YEJA 4QWQA 5C4YA 3CCVI 2GXGA 3JR9A 2O03A 4E7LA 4L9NA 1DP3A 2O61A 3RKWA 4L18B 2ID3A 2MABA 1KU2A 2NP3A 5D5VB 1UAAA 3CDIA 2JQ7A 2V9VA 2QTQA 1UI6A 2L4AA 3I5UA 4XONA 2RNJA 2VE9A 4N4OB 2KIQA 3H3ZA 3FXUA 4D7MA 2IGNA 3DF8A 5BOXA 4ZDPA 1JGSA 1O7LA 4DYRA 5CW8A 1JGGA 5FRNA 1ETVA 2K9NA 2ZXJA 5F1JA 2PLYA 1U6GA 2ELJA 3VWBA 5ICGA 4MLOA 1FBSA 4BKXA 4HLXA 3KP2A 4LFUA 3LAJA 1FY7A 1OKRA 3S2HJ 4GFKA 4E7KA 4CUGA 2MLGA 2XGCA 1HSTA 3JREA 4V19K 3M7GA 2EIJH 2F2EA 2K9QA 2DYSH 1B6AA 4OIOF 3S1QJ 2NYXA 2ICWG 4IPAA 5LEJA 4D1QA 1H88C 1V4RA 3LSGA 3S2DJ 2DLLA 1WJCA 3GEUA 2HQRA 5HNHA 3EYIA 3OY9A 4XN0A 4BHCA 5K58A 3G71I 3JSJA 2DJNA 1IO2A 4ACIA 1JUMA 2ACJA 1R1VA 3GZ5A 1KGSA 2Y2ZA 4XRSA 3MKZA 3F6OA 3CZ6A 4LG3A 3LSPA 2P81A 5CVIA 4X0GA 2HS5A 2FBHA 3NWTA 4UV9A 2OD5A 4ZTFA 2UXNA 2A5WA 2HU9A 2XGDA 3I9V2 2KISA 2VKDA 2PJRB 1MDMA 4IZZA 2BHYA 2KFDA 4ABZA 5HDGA 1JE8A 2STTA 3K1NA 3REOA 1XC5A 4XMYA 1UZCA 2JRTA 2JPBA 4HDUA 1JT0A 3COLA 1ZAOA 3SFIA 2K85A 2O0YA 4OD4A 1K4SA 1ZQ3P 2BOLA 1ETXA 3J80Z 2JA8J 1MH4A 2LBFB 3RSNA 1WVRA 2Z9OA 1SFXA 3GUDA 3W3CA 3LQRA 3ZGKA 4QPOA 4Z2YA 1ULYA 3A03A 1P4AA 2CQKA 4LK1F 3FXOA 1XGMA 1TWAJ 4XICA 2HWVA 4GDFA 1YW8A 2WB1A 3WTTC 4P96A 1W7PD 2DT5A 1NHAA 4ZH4F 2R7XA 2M2EA 4IHSA 4E6KG 2OTLI 1NTCA 1A36A 1X58A 3ABKH 2EIKH 2JA7J 2E1CA 4LLLA 4B4CA 1GXPA 1H8AC 3KKCA 2X0LA 1GXQA 3ABUA 4GRIA 5DM7F 3OYNA 3E6MA 5DAJA 4BQOA 2HDCA 2DMQA 3C2HA 4CDGA 3ROUA 5HVQC 2XKOA 2BY2A 2LFBA 2K4JA 3RDIA 4A6DA 5EF6A 3VW2A 3JRIA 1KYWA 3A01B 1XD7A 4M73A 1FPQA 1XCVA 5KAIC 1X4OA 1OYYA 5BQTA 2ZJQF 4YFKF 1XSVA 2XROA 2NVYJ 3E3VA 4EJVA 4F91B 1MH3A 3FXJA 2HZTA 4C3IJ 2B9SA 2HVQA 2Y0SN 3ERED 1ONVA 2A68F 1V55H 3D0SA 4ZYAA 4XRSG 4CSWA 3PPBA 5LLQA 1X1PA 5A2QK 2M9HA 3IAM2 2M5WA 2VONA 2A2FX 4ZZLA 1WRJA 4XKBA 2ZXHA 2DTRA 2X51A 3NAUA 2VC0A 1S29A 2ZOYA 3FMQA 5LD2C 1JUSA 1Y1VJ 3S14J 1UB9A 5C4JJ 2GFNA 3FF5A 3MNLA 3QU6A 2DT6A 2VT3A 3ZQQA 4BU2A 3E5QA 3IRRA 3IKTA 3DTEA 3L2RA 1IJWC 2LTPA 2PBXA 3PSFA 3OS1A 3FKIJ 2OU2A 3CTAA 3ASNH 1Z9CA 4CCMA 5J8CA 3HKZA 1ZG5A 3F1BA 3NQOA 4KMUX 2JZYA 2E5ZA 3WTYC 4N0BA 2O8KA 5FMPA 4EM1A 1E3PA 3VSLA 4CYCB 1Q1VA 2YVEA 4PFPA 5FD5A 3VOKA 3E5UA 3T1BA 3RTRA 1MJ9A 2OQGA 5E3LA 3VPRA 1MBHA 3BRUA 1X2MA 4B43A 3BCBA 2HGCA 4Y15A 4FASD 5FB2A 2CSOA 1JXSA 1QZYA 4H0EA 4AC6A 4B09A 2BW3B 3K8PC 1D8JA 2IXSA 3DU5A 2UZKA 3MVPA 2LR8A 3E5XA 5E79C 3V8KA 1J09A 1YX3A 2Y69H 4WXCA 3FHZA 2D6YA 3SDBA 3J81K 4JX6A 2HR3A 3BTLA 1F1ZA 1FIAA 1K4TA 1BC7C 1LB2A 1DPRA 1L0OC 4A3GJ 3TDZC 1TC3C 2F48A 2GQQA 2FNAA 4H4KC 4IL6C 2Z5UA 5HBUA 2QSGX 2X1EA 4Y7NJ 2IA1A 4MEXF 1G59A 4DGWB 2P7CB 4BEHB 1QA6A 1FOXA 3HTIA 1YLFA 3OYHA 2G7GA 3QU3A 1UG0A 4IQJA 1P2FA 4UDSA 1SFOJ 1Y8QB 2PJRA 4B3XA 1U9OA 3P9KA 3MKLA 3QODA 5LEKA 3OYKA 2IA2A 1HXDA 5ILSA 2MSYA 4M6XA 1XDSA 4JK1X 3TKYA 4A93J 4JOMA 3VP5A 1R00A 3BPXA 2XSDC 3E7QA 1IF1A 3OIOA 2KMUA 5F0CA 1T0FC 5M3MJ 2IS4A 4HF0A 1AKHB 4IRIA 1R5ID 4XNFA 2IP2A 4I98B 4BHPA 1FYMA 1OJLA 5CYVA 1FBQA 2XDVA 2QOPA 1RZ4A 3OYGA 2BY3A 2V79A 2K4BA 4BACA 3CCMI 2DYRH 2IVMA 2FRHA 3KE2A 3ML6A 4MHGA 4A5NA 4BJTA 3QOPA 2L7ZA 2XB5A 4DOZA 3HOXJ 3DTIA 2M34A 3CCJI 4AIHA 3HSEA 5K5QA 2W84A 1PVEA 3GTGJ 3J7AY 1YJWI 3HSRA 2DODA 2FBIA 1YYVA 1S7AA 2OZ6A 1YJNI 3KCCA 3VIBA 5D5WB 1I5ZA 3M1EA 2JVGA 2CMPA 2VASA 3O6BB 3BTIA 1SC7A 2EZKA 3LHQA 1BIBA 2R93J 5D5UB 4Q5SF 3ECOA 1I27A 3GO5A 2M7AA 4OMYA 5KK1A 1QGPA 5L3FA 4MQVA 4BH9A 1IUFA 1WWXA 2W48A 5FJ8J 4IRHA 5K1YA 1UJ8A 5CVJA 5DCFA 1VTNC 2M87A 2Z16A 5CVRA 3HOSA 3ON4A 1ERDA 1LPQA 1KU7A 1R4MB 1GUUA 4Q4ZF 5KHDA 1O4XA 1I6HJ 1SAUA 2DA4A 2WTEA 2R5YB 3TEDA 3I58A 4LJZF 4NB5A 4NC8A 1HKQA 5FKNA 1T0FA 3FXMA 2JUCA 2UWMA 1A31A 3E0JB 5E3NA 1U5TC 1VQ6I 1LEBA 3I71A 1MNEA 3LSKA 1MBKA 1LFPA 4WWCA 2X6YA 4HNTA 1PDNC 4IQ4A 4KIFA 3GFJA 3BR6A 3HXLA 1Y1WJ 1JUPA 4G6QA 1OCRH 3LA3A 3MFKA 3F23A 1H9GA 2CQXA 2GIVA 2QQAA 2VBZA 3EUHC 2D2WA 5C3EJ 2E71A 2VN2A 3MWMA 4DYCA 2NVXJ 3L2VA 2XAGA 5BPDA 3TMOA 4G7OF 5FGMA 4XKVA 4DYQA 4CCJA 3Q0WA 3P9TA 1R7JA 1K83J 1RESA 4XK4A 2KRFA 3H5RA 5K7ZA 2GM4A 4I2OA 5HSZA 1IN7A 3T8TA 1SAXA 4HV6A 1AWCA 5E17F 9ANTA 4BDYA 3CJNA 2BE5F 2DMPA 2BW3A 1LQ1A 5D1RA 2L01A 3CO6C 4XN3A 3W2WA 2LG4A 3BJ6A 1HOMA 3CC4I 5KVRA 3SZPA 2ZXIA 5E8IA 2KIMA 2HQ5A 2A05A 1YI2I 4GYGA 3OMYA 3FDYA 1U5TA 3J7AO 1LDKB 2E7WA 4BS9A 4YFNF 4NQWB 1S7OA 5ED4A 3J81Z 1TWCJ 1SD7A 2ZCXA 5FROA 1QBJA 4HSTA 1FMVA 1MJAA 4EGYA 2H8WA 4Q48A 1P7JA 2E2HJ 3BP8A 3HB9A 1IN8A 2F5VA 1OYWA 2ZMEC 3ZQ7A 3RI4A 3IV5A 4UUTA 3EUHA 2D1HA 2ZJ2A 3H35A 1FP2A 4IOCF 2A5YB 1D5VA 5DYMA 3FBIB 4BBRJ 3F8CA 2JA6J 2WAEA 5HS7A 3H9GA 4J19A 3CRJA 3EUAA 2IGMA 2K27A 3IH4A 1RRJA 3B02A 1IDYA 4ON0A 4A3JJ 3V7SA 3FXLA 3R4KA 3S2WA 5CKTA 1HKTA 1JJ8C 1P4WA 4HA8A 3V7CA 2EILH 2V1DA 2XSJC 3K69A 3MCZA 4A3CJ 4CYDA 4D5CA 3M8JA 5E8GA 1XGSA 3WU2C 3TW6A 1AKHA 4CH7A 1OR7C 2EFNA 3DEUA 4DVYP 3C2GA 1G6NA 1XS9A 3DXJF 3HL2A 1BR1A 3LNQA 3M9AA 4G6DA 1U8BA 1HDPA 2H27A 3O8GA 2HTSA 1I3AA 4OU0A 1R1TA 1DGRM 3VVZA 3BROA 2GUHA 3W6VA 1T2KA 4KN4X 2L3DA 2HOAA 3OV8A 2P8TA 3V8JA 2WV0A 2VODA 1EKEA 1A6QA 2KIFA 1JKQC 2IT0A 3VOXA 2GWRA 4XBFA 5KAFC 1HLVA 4XLNF 5DCMB 1R9TJ 4ZJZA 1SEUA 3PFYA 4BQAA 2G3BA 1Y0UA 2B1EA 2I8DA 4AD9A 4I09A 4BHBA 2IA0A 1K7AA 2MFZA 3LQQA 3PQJA 3WTXC 1ZRCA 1RKWA 3MAJA 3JRHA 3HPGA 1EH7A 1K78B 2P0WA 2M8EA 1YIOA 4M3GA 1B1BA 4AVPA 4YZEA 1JKPC 1D8KA 4YIIA 1QPIA 2JN6A 1TNTA 3HRTA 2JRMA 2WAQA 3BC8A 3A0HC 3BOQA 3EQLF 2ME6A 1MNDA 1R23A 1LUJB 2XF7A 2KT0A 3CMMA 3TO7A 3TGNA 1MMSA 3CUQC 3IAS2 3LMMA 1D3YA 1OR7A 3VB2A 2HOTA 4HRIA 3PL8A 1UG2A 1MZBA 1WJEA 3MMYB 4FQGA 4GCVA 3SZGA 4E7HA 3FBNB 2ETHA 3JSOA 2QA4I 1Z77A 4A3EJ 1IAWA 2RKHA 3FHNA 4PZJA 2ZSIB 1WFXA 3TW7A 2LYCA 3BZKA 1XCBA 4F7ZA 2UXIA 2WWYA 1ZRDA 2FMYA 3GZIA 3ZQFA 1BA5A 3BJAA 1WHUA 1ZLJA 4RM2A 2W00A 2XF6A 1YOVB 1X1CA 4EJOA 3TBIA 2XPUA 4F92B 1H0MA 4A0ZA 3WG7H 1DP7P 4IVNA 4CZZA 2PMHA 3DFGA 3HG9A 1UCRA 3IHUA 3IRQA 5IP6A 3I64A 3N4MA 4ICHA 2PFVA 1V5GA 4E7JA 1BL0A 2FUG2 1I50J 1MBFA 4N9IA 1W0UA 1B9MA 2MGQA 5L3EA 1F9NA 1MMGA 3RD3A 3JCUC 1Z1DA 4PJ0C 1Y0NA 1TZLA 4DBRA 3AAFA 3A0BC 3NPIA 4ZC3A 2O6GE 2DK5A 3F9KA 3LSTA 3HJEA 4UY8I 4XLCA 1YX5A 2HFHA 4NQWA 3HSFA 4WIBA 2K3PA 2R7RA 2ECBA 2EV0A 3QOEA 3BG5A 1B8IA 1USTA 4GO1A 1FYKA 1ETKA 3FMSA 1TWHJ 4LK0F 3B73A 2GXBA 3L1PA 2BEOA 5LHHA 2QQBA 1YITI 3HOZJ 4OIPF 3O3KA 2XGXA 3F0CA 1EV7A 3DP7A 3A4CA 2M3AA 2MH9A 3HIMA 3O60A 1ZKGA 2X1CA 1GLNA 1WJ5A 2OF7A 2R3SA 1X2NA 4U88A 2IGOA 4R1HA 1LKXA 2FF4A 2P5LC 5E1ZB 3GTOJ 2BZTA 4XLAA 5J6XA 2IAIA 2OV7A 2UXOA 2R7OA 1A35A 2FX0A 2Y0SA 2KKOA 5J8FA 2K3FA 1K79A 3K2AA 3HOTA 2LKSA 3M4OJ 4N9HA 2FJ1A 5J4YA 4WCGA 4IHWA 3FXQA 5M5YJ 4BJ6C 2F4IA 4RGSA 3MEXA 1ZREA 2VJ4A 4TV7A 2VBWA 3AG2H 4F93B 3SQNA 2AXTC 2HYFA 2QEXI 4L5EA 3DPJA 1T98A 2HXOA 5HLTA 4MNUA 4I6ZA 1XDUA 1XSXA 1TBXA 3V42A 3WE2A 2IU5A 2XUBA 3HRMA 4NUBA 3CCEI 3L09A 4CGZA 3FX3A 2DFIA 2W25A 3LAPA 1ETWA 2NP5A 4M3EA 1WH7A 4PUSA 5B66C 1WJFA 3PIOF 1FTTA 1PJRA 4CCKA 4BXXJ 3FISA 5GPCA 1XB4A 1O3QA 2K9MA 2CW7A 1YS6A 1N77A 1N78A 4BL0B 2JK3A 3K4MA 3EPZA 4F55A 2R0QC 1W4MA 4CHUA 2ZKZA 5DCMA 4A3BJ 2DA3A 2G7SA 3ZN0A 4BQQA 3ANPA 3Q0VA 4IF4A 4I0BA 4M6VA 4IEJA 3AG3H 3HUGA 2XC7A 3DBHB 2EFWA 2QWTA 2Q1ZB 4XQFA 4E70A 3JRCA 2Z3YA 3RPQA 3K70C 2KHMA 3CJDA 2L9NA 1K78A 3PUFA 5AIPA 1IW7F 3BQYA 4KITB 1SMTA 2DOAA 2VKVA 1RR7A 1IXCA 4RDUA 4AIDA 4I02A 2LREA 4NBQA 2R7SA 3H3UA 1FLIA 4JBAA 2EA4A 2WUIA 3K4NA 5B5EC 2QZ8A 1SFKA 4GCKA 2WA0A 5F08A 2QVOA 1TQPA 1X1BA 2P4WA 1NG6A 1W7PB 5CPRB 2EB7A 2TRTA 2IJLA 2XPWA 3CESA 2HKUA 1P9QC 3DBLB 3ISPA 4PJMA 2LY1A 1SFEA 1ZTRA 2CH0A 1E0EA 2AO9A 2RREA 2X6XA 3G73A 1BN5A 3H36A 2G7HA 4XSZF 4M3BA 4G8XA 4A0YA 1Z0XA 5EEGA 4BAYA 4EM0B 5B1BH 1ITYA 2OI8A 1S8NA 3WODF 4S04A 3R6SA 3NARA 4IOAF 3FXKA 1RETA 2LK2A 3C3WA 3DEWA 2WV1A 3D5RC 3HOVJ 1IRFA 3NNRA 1FNNA 3LWFA 3GCMA 3QYEA 3GX4X 1H89C 5FHPA 1Z21A 3SDGA 4YRVA 3DQVC 1R5HA 4ESJA 3LA7A 1MNMC 2Q0OA 3BR0A 2EBIA 2A69F 2CG4A 2X4HA 2VL8A 2N8GA 5DM6F 1XSDA 1UI5A 2DFEA 3ZMSA 1VQ7I 1X1DA 1MMDA 2A6HF 3VYRB 3GFMA 3ZMDA 2YU9J 4KMFA 1HA8A 4M3DA 5E3OA 4PGHA 3E6BA 4CCLA 2KP6A 3PFIA 3ZMZA 1SANA 4J00A 4I7HA 2BXYA 4IKFA 2FU4A 3GVAA 4BE1A 3HTAA 4ENNA 2M30A 2GA2A 3G1MA 3DLLF 2L9VA 1VQ9I 2OC6A 2F4OB 2M0MA 4ITVA 2V4JC 4WF2A 2CQ7A 2FQ3A 3KLOA 1IGNA 2NVQJ 3VVXA 4R8HA 1SFUA 2STWA 2VPRA 3LJLA 5E3MA 2KDZA 3A1YA 3FK6A 1E3HA 4OIRF 4E7IA 2BVMA 3I54A 3P9CA 2FNPA 4AVZA 1FJLA 2QIBA 3EUPA 1HCRA 3FXRA 1XMXA 3B6AA 3CC7I 2EZHA 3OS0A 2P6SA 3CLQA 3SYTA 5IOZA 1UHWA 1LNWA 2RAEA 4Y17A 4YELA 4AWXB 4RGRA 2R7VA 5K7FA 3P5JA 3LOCA 2V26A 3OL4A 4DZJA 1VQOI 5GP9A 2NRAC 3GF2A 1RPWA 1U3EM 3KEOA 4CICA 4AYBA 3JRFA 4M72A 3GFLA 2CQNA 4D0PA 2UUZA 2K40A 1GV2A 2XDNA 2ECCA 3JRAA 1PUEE 2COBA 2AQFA 3U1KA 3FMRA 3OSFA 2V6EA 1D0XA 2LP0A 1D0YA 2OCCH 4XLEA 3WGHA 3AKZA 4HW0A 2WAFA 4IHXA 3V78A 3IWZA 2PZ9A 1Y6IA 4I76A 4I0AA 4BXFA 3I3LA 3WE3A 4EJTA 1XG1A 3NRVA 2Y9ZA 4L0YB 2GIZA 3O2PE 3RIRA 1YG2A 3SWHA 2CUJA 3B6CA 4KIGA 2R7UA 1IDZA 3BG3A 2Z33A 5J1YA 3RPUA 5TISC 4B8XA 5EGOB 2VQCA 4FCYA 1JTXA 2WADA 3PUBA 3RKXA 1Z3XA 4BY1J 3KPHA 3KX2A 1EH8A 4IRVA 3RYRA 4KDPA 3ZQIA 2ZBKA 4XSXF 4LIVA 1QVUA 2CWEA 4WXHA 4X1EA 5IYDJ 3CF2A 4JX5A 2OCEA 1NH3A 4M3FA 5ICEA 2FXAA 4GFLA 2LSOA 1LDJA 5DV5A 3BR2A 3SXYA 1FOKA 3KEYA 3D5SC 4BY7J 3ZOBA 3LA2A 2HKOA 3QRFF 1F4KA 5E20A 4EATA 3HOYJ 4A12A 3OYLA 4L62A 1LFBA 2VB6A 5CXIA 1QHHD 2V9KA 4P1WA 3GXOA 3TDUC 3JRDA 1BJAA 2HQAA 4DNCA 4LD5A 2PMZA 2E1NA 3ZCOA 1R36A 4II3A 4QIWN 4IJAA 4AM3A 2VT2A 1QZZA 1NK2P 2IS2A 3HM5A 1MBGA 4UUVA 1LVAA 4MIMA 1U78A 5H6RA 1HW5A 2PEXA 3OYEA 2R7WA 2YSRA 2IGKA 3HHGA 4HX7A 1J7KA 1YRNB 3VTIA 4UVBA 4NC6A 4KICA 4UXNA 5D5XB 2VLAA 5F1RA 5HLGA 5C4XJ 2OAZA 4BDZA 4RAZA 3WGIA 2MW8A 2Y75A 4K2EA 4EV0A 1Z7LA 2X85A 4MTEA 4B1RA 3PO2J 2FBKA 4EEFG 5GTHC 4XIDA 2RASA 5FKKA 2XB0X 2DDAA 4JP0A 2LBFA 3KP7A 1X3WB 1Z05A 2F07A 3OR2C 3AG4H 1KQ9A 1N25A 2EJRA 2OJED 4RAYA 3PO3J 1D0ZA 3BCAA 1JHFA 1T08B 4FT8A 2DBBA 1FOYA 1ZGWA 3Q5FA 3X2QH 2ZFUA 2K02A 1S7EA 2FD5A 4A3LJ 3NS4A 3V8LA 3GTQJ 2G7LA 2HZDA 1ETQA 4KUMA 3Q9VA 2JT1A 3GLXA 1E3OC 4EGZA 3S3NA 2VXDA 1RUNA 4XLFA 4P5OA 5JLXA 1TWGJ 2WB1N 3F8BA 2DG8A 2HPMA 3VDXA 2DFFA 1EF4A 3ZQHA 3ZMUA 2VBXA 3A01A 2FJI1 3QPTA 3VUQA 4D9JA 4KA4A 2L0KA 3D1NI 3N97A 2DQRA 3U1DA 1DDNA 4PSXA 4OIQF 1FC3A 3CJQB 3L2UA 2RHAA 2EFQA 3HHHA 2IPQX 4HV5A 1G4DA 3VYUB 3ZR8X 1K6OA 4S0HB 2RNGA 1MW7A 1H9TA 4XM3A 3CJTB 2PX9A 4WK8F 1ZELA 2M4GA 2YU3A 5FD6A 3VW0A 2HKXA 3TP3A 4NDLA 5JLWA 1WPKA 3QYBA 3I55I 3O8HA 4M9ZA 3OYMA 2P5VA 2QM3A 1FWZA 5A2QZ 4ETSA 1MGTA 3CCUI 1X19A 2DA6A 1MD0A 3K4KA 2HYJA 1A5JA 3FRQA 3FWEA 3H92A 4IO9F 2HYGD 5F0FA 1KA8A 5EJCA 2FEZA 1QO0D 3SHFA 3VW1A 2H94A 4U0VA 4BE2A 3A2KA 5EG0B 4PJNA 5EEHA 1POGA 1QQIA 2CW0F 4BXUA 1RNLA 5M5WJ 1HDDC 4V2GA 3L9FA 5M3FJ 3HTJA 1UMQA 5JR3A 2FE3A 1Y8RB 1T6SA 1BJZA 2IW5A 1WKMA 5JVTA 3AL0B 2ADUA 2LOOA 5L3BA 5EGOA 1LEAA 4CYCA 1HC8A 3EGQA 3BG7A 4JQFA 3BLYA 3ERMA 3RKQA 2DTZA 3HOUJ 4HKUA 3MN2A 2ZCWA 3E7LA 3GTLJ 2RGVA 2LLKA 4PJLA 4D7NA 2EINH 1IC8A 1SD5A 5DEQA 2NNNA 3HKZN 2BYVE 1KU3A 2J5OA 5JHFA 3L2QA 4C3JJ 1TL8A 2VOPA 4XOPA 5LRSA 3NRGA 2HNHA 1HBXG 4XR6A 3K1PA 3ECHA 1ACIA 3G7RA 1RIOH 2TDXA 4LG0B 2JWTA 1SVMA 2L4MA 2OTJI 1BC8C 3K10A 3J7ZI 3V4GA 1B4AA 3RQ4A 3LWJA 4HF2A 2X6OA 4II2A 3MKWB 4ENMA 2KJCA 5JFRA 3U2RA 1YE9A 1ZGJA 2E35A 1G8XA 2DPDA 3QBMA 3I4MJ 3SEZA 1RC9A 2B63J 3GWZA 4G7ZF 4BEHA 4ZYGA 1W0TA 1V5FA 4DW6A 1YO5C 1APLC 3CCQI 4YIFA 1QHGA 4U7BA 2ESHA 2LF7A 4A2UA 2GXAA 3Q9SA 2X9DA 1NK3P 1Z7UA 3JTGA 4FTHA 4W1UA 3H9QA 2WY7Q 1T39A 2IBDA 1OYIA 5B1AH 1X4PA 5J1UA 1XMKA 2XVCA 5KCMA 3WTVC 2VQGA 3TQNA 4ZDLA 4L0ZB 1UFMA 2LY9A 1QRYA 2Q2EB 3S3OA 3GTJJ 2AS5F 5AQCA 2HQNA 4JX4A 3ZQGA 4XKWA 3K1MA 4HX8A 4RM3A 4S05A 1HW2A 1WGXA 2QKLB 1Z6TA 4EM2A 3KP4A 1KU9A 3DLAA 2BVLA 3BG9A 4MO7A 4A3DJ 3M07A 3MKYB 3L00A 2X1DA 4GCTA 3HOWJ 1FMWA 1BI1A 1JT6A 2VJJA 2KRCA 3CMYA 2D5VA 1WSUA 4OINF 2JA2A 3E1SA 3G3ZA 2CFOA 4U0WA 5IOYA 3BJBA 2B7EA 3I4NJ 2K9SA 5AONA 1QNTA 3S93A 3OYDA 1JI8A 4E7ZA 1VQ5I 3KLNA 3HPHA 3WTSC 4Y33A 5J4VA 3JRGA 4LB5A 3S16J 5LGUA 3GZ6A 2I10A 5H9TA 1G3WA 2COMA 3WGGA 3BHQA 1E17A 2YX7A 2DG7A 4UHTA 1HW1A 1TT0A 2DDBA 3L2WA 2R7DA 3F8NA 1BI0A 3AL0C 4ENKA 1SD4A 3IWFA 1SVOA 3TL4X 3UKGA 3H3VK 4ZZDA 2MBFA 3S15J 1FTZA 3BTJA 1F43A 4KT6A 1Y39A 3CJRB 4A5MA 2DQLA 3RJPA 2IS6A 2L54A 2V1XA 3I53A 1R58A 1ON2A 1O3SA 1BW6A 1IG7A 2YVXA 3V6GA 3G1LA 5L3CA 4DZPA 3UR3C 1XGNA 1REPC 5IPAA 4C2MA 2R5YA 1YQAA 4A3MJ 1OPCA 3HTHA 1VQKI 3QPSA 4RB0A 5CVVA 1ZG1A 4C30A 1IXSB 3VOEA 4FE4A 4RMNA 2A6TA 3V7RA 1WQ2A 1VNDA 2KPMA 4CCNA 3BNIA 3ASOH 4XKCA 1VQ4I 2D1VA 2QKOA 4KWAA 1NG7A 3IH2A 4U9LA 5FLXK 2CRGA 4Q47A 4HEA2 4OAZA 2LKPA 4RS8A 2DT7B 1LFUP 4GXOA 5EG0A 3IL2A 4L5IA 5DUKA 1V54H 4ZDOA 2D45A 5J40A 2XRNA 2GENA 1DPUA 2AHQA 4OAYA 2YPRA 4KNYA 3FM5A 4WXDA 3CD6I 1ORKA 2FMLA 5DD4A 3CMAI 4L9JA 4AU7A 1KYZA 1XTAA 2Z99A 3HTUA 3WU0A 4B47A 3OYIA 3CCSI 2HOSA 2VIXA 1U8RA 4MFDA 3D5LA 3CUOA 2XAQA 3QQAA 3ZN1A 5BMZA 1ZR2A 4FX0A 3T8RA 4XRMA 3ZXSA 3RZDJ 1MDMB 1VFCA 4KISA 1FOWA 2FSWA 2MH2A 3DU6A 2LD5A 1S6LA 4ENJA 2HXIA 2W4SA 4XOTA 1BOAA 2VE8A 1IN6A 1U2WA 2L5QA 5K7HA 3CF5F 5GPAA 1D1BA 5K5RA 1MMNA 2M0CA 5LGNA 1ZR4A 1CGPA 4HQEA 3HIFA 2JSCA 2QENA 3WG9A 2LDUA 4A3FJ 1TP4A 1I1SA 2NS0A 2FA5A 2G7UA 2GLOA 4PDKA 2R4GA 3JW4A 2PFBA 5F0HA 1GVDA 3W6JB 3IC7A 3W2AA 3BR1A 3LSMA 4UV8A 2DK8A 5HLHA 1IXRC 4O6JA 5CLSA 2UXHA 2OPTA 3VYTB 1U0JA 1VF9A 2BY1A 2F5CA 2Q2EA 4P55A 3LSRA 1E2XA 1X3ZB 3KNWA 3K9TA 3I56I 3CP2A 1BM9A 2OA4A 5D8KB 3K4LA 5FKLA 1ETYA 3G6EI 2UXUA 3G2BA 1V3FA 4QTRA 3QPHA 1Z91A 2H6CA 2M4KA 1BR4A 3LSIA 3GEZA 1OCCH 3RCOA 3GW2A 4CA0A 2CUZA 1DUXC 2CW8A 1VZ0A 3GBGA 5C44J 3HBLA 1FEXA 1WZ2A 1B72B 2NX4A 2EIMH 2PMUA 2RDPA 2DJIA 4MEYF 1LJ9A 1TLHB 4FHTA 2Y31A 2XF5A 3CCRI 3BJOA 1J59A 3AFHA 1C0WA 3K70D 4XL9A 1YHQI 4FX4A 4LLNA 2P5KA 4IXAA 5IY5H 1J9IA 4NHJA 2VXZA 3S1RJ 2ISZA 3FK7A 4IX7A 3F72A 5FKOA 3EUKL 3KETA 1ZGAA 4M9XA 4QSHA 2W57A 1XPXA 2VJ5A 4BQNA 1K61A 3CC2I 4KT5C 3I4PA 4QLCU 3WTUC 3U21A 2F5EA 4L5JA 2O7OA 1JTYA 2VQHA 2JTVA 4NNJA 1W36C 2OERA 4G6TB 2VQLA 3M3YJ 5CVUA 3WHCA 2GOXB 2R92J 1FYLA 4HX4A 4E4HA 2XV4S 3EDPA 1FSHA 3G56A 3DV8A 2HI3A 2QQ9A 5EYRA 4HDVA 1TW3A 1Z67A 2H6BA 5HS8A 2RQQA 2R7QA 3ZP5A 3CCYA 1IV8A 5J3LA 4IHTA 1UHMA 2O8XA 4A0XA 2H1LA 5DUIA 2JA5J 4RAFA 4XLHA 1OFCX 2Y9YA 1DQUA 5D8LB 3LFUA 4PJJA 3TOAA 3WTZA 2LF8A 4RGXA 4C9YA 1CQTA 3DKYA 1JKOC 2K5CA 4CCOA 5D4RA 4O3MA 3A02A 1ZYRF 3BR3A 3KZZA 5FRMA 2DA1A 1WH5A 5GTIC 2DMNA 5H6QA 1B9NA 5D18A 2WAQN 3N05A 2V1UA 2PG4A 2H1KA 2RQPA 2B0LA 3RKYA 2XKPA 5DS9A 3L2CA 2ZSHB 5FLXZ 2ZXWH 5FKMA 2E1MB 2PN6A 5IT9K 4HPQA 5J1RA 3WHBA 2MC3A 4KN7X 4B48A 3JRBA 3HTSB 2FOWA 5LRRA 3NEUA 5F27A 3BQZA 2ZNZA 1OLTA 3OS2A 2JPCA 1ZN2A 2KJBA 3RPUD 2GOMA 3GYHX 3W6KB 1KQ0A 3VVYA 4M6YA 1R71A 2HDWA 2ZB9A 5HODA 4HBLA 2P6TA 3DEEA 4LLGF 4MXMA 1R6RA 3M1CA 3H1CA 1IRZA 1ZK8A 1ZH5A 1GVJA 4RB3C 4MK6A 2E60A 5D4SA 2XHKA 4RLFA 2QGUA 2JJ7A 2PQ8A 4IHVA 4Z6YA 3C18A 3M8FA 2L02A 3FIWA 3OYCA 2ZFWA 1OISA 3ZQLA 4ASNA 1JJ6C 2CGPA 3S17J 3ESWB 4HG2A 4KJZA 4OWRB 1KQ8A 3R0AA 2OUMA 3CDHA 1I1GA 5ICFA 2X48A 2DOFA 4LOCA 4A69C 5EDNA 3P9IA 2F5FA 1AA7A 2V57A 2RV8A 1QU3A 5CJ9A 4G9YA 4X6AJ 4IRGA 3CWRA 1K6YA 1TQMA 4FISA 2HTJA 3VSKA 2DN0A 4LGWA 3HDDA 1HQCA 2NNYA 3EYYA 2DCEA 2EH3A 1DU6A 3H9JA 3E6DA 4DIQA 1P4XA 1YW7A 2F6CA 2DPUA 2BY0A 1ZLKA 5FGLA 4YFXF 2O7TA 2EZIA 1G2HA 4GCLA 3IKVA 3S3MA 5FFXA 2DOEA 4MFEA 2EV5A 5LHGA 2EQRA 1D5YA 5DTDA 5E1WA 1SD6A 4HOBA 4W97A 2YR2A 2HYTA 3KKDA 5EFYA 2CUFA 4BNCA 3DCFA 1F36A 1B72A 4UUSB 4YIRX 1ETOA 2AXLA 1N75A 5BS6A 3PM1A 3E97A 4I01A 4KYWA 1AOYA 2OBPA 3CP8A 3QYFA 1PYVA 3H5AA 2P7VB 2WY8Q 3RYPA 2PBIA 5J47A 3TO9A 3QPLA 2ZOZA 3U9GA 5BNGA 2E1MC 3KYLA 1Z3YA 2HDDA 5ERIA 1R4NB 5LHIA 3DPTA 2A3SA 2Y48A 1YW9A 2A6EF 1D1CA 1TTYA 1EA3A 4BJ5C 1GDTA 4B44A 3F22A 4MQ9F 2DXIA 3ANGA 4Y3OA 4HNVA 1X3UA 4AF5A 5TRDA 1I3QJ 2BBYA 1M1EB 3CMEI 2VKHA 5ICCA 5KNLA 4UNOA 1DGWY 2XGEA 1ENHA 3MD2A 3WU1B 4KFCA 5FO5A 2WGBA 4L9VA 4BGDA 5LFAA 3VYSB 1MJBA 1EH6A 5HOOA 4B3AA 3DKWA 2XAHA 2AQEA 3K7AJ 3I59B 4DBQA 1DU0A 4RA2A 3PJRA 3OYAA 1W7PA 1IZ1A 1YJ9I 3SZTA 3T5XA 1WJBA 1GV5A 3RZOJ 1FIPA 2M8GX 3ZRGA 4AIJA 1T38A 3DKXA 3OSGA 1SGMA 4C3HJ 1P6RA 2FBQA 2KRHA 2DA5A 1CF7B 2UXXA 2RVCA 4RBOA 2CS3A 2YX4A 1U5TB 1BW5A 2ID6A 3ABMH 4WX9A 4Y13A 3C07A 3R61A 1TQIA 1J2XA 3PNVA 3PQKA 1S9HA 5GAGJ 1G3YA 3KEQA 4L9TA 1T8IA 2JMWA 3PASA 5M5XJ 2C6YA 3HE0A 3Q3SA 1R1UA 2B3WA 3VEPA 2H09A 1VQPI 2ZC2A 4RGUA 2QUFA 3JSPA 5IT9Z 2MD0A 3BDDA 3F6VA 2KQRA 2VJIA 1G3SA 4ANJA 4CZCA 1QZEA 1SVLA 2KIUA 3BWGA 2ZY9A 2DMTA 3FKJA 2CV1A 1FT9A 1R49A 4HF1A 1FBUA 2EFPA 2MG4A 3MZYA 3OYFA 1WJAA 3KYCB 5DD8A 2KLOA 2RN7A 4RB1A 1T56A 5F04A 2DMUA 4OD5A 3H0GJ 4P9FA 1TWFJ 2W1OA 2G0EA 3BZCA 4A3KJ 2VBYA 3QAHA 1OCZH 1LE8B 1IRGA 1VQLI 1VI0A 4PXIA 1ZARA 2L7MP 1WJDA 1IUYA 3NWSA 3RH2A 4HSRA 3AQSA 2E2IJ 4BBSJ 4OOIA 5IP7J 1GT0C 2CFXA 4NN1A 1P7IA 1U9NA 1STZA 2EA2A 1HF0A 3K4CA 5L3DA 3ZMVA 2K86A 2DW4A 2NS8A 1RR8C 1WI9A 4U0YA 3GFIA 2QBYB 3BCGA 2NAZA 2OQRA 3DBRB 1ZHFA 3RQIA 5IT3A 3KP3A 2UV1A 3H5NA 2A61A 3NI7A 2HPIA 1R22A 4PK4A 4GYIA 5ILVA 1OCTC 3BPVA 1IN5A 4LIUA 1S3JA 2ZMEB 4Y4RA 5F6FA 4MTDA 3GZNB 4G94A 3OYJA 2HOEA 3DTKA 1J75A 3BZ6A 3KIOA 3C7JA 2ZNYA 2QQ8A 2EFOA 3PSIA 2XAFA 2LY2A 4O5VA 2NOGA 1O3RA 3ZPLA 3KZYA 2L7FP 5AIQA 2CJJA 2LMDA 5GAHJ 1AHDP 2Z2SB 4PSWA 1GHCA 3HGGA 1MIJA 3GTMJ 2VC1A 1TNSA 2Q8KA 2GZWA 3ZMTA 4UUSA 1BI3A 4RLQA 5FLMJ 2DAOA 3CCLI 1YS7A 3EETA 4F52A 4AYBN 1HSJA 2KZGA 4ZYEA 3J7YJ 4EVIA 5EZGA 2W24A 1ON1A 1OCPA 2Z1DA 2CV2A 4PCQA 4P9UA 5HNFA 4BUPA 3LFKA 1W5TA 2EWNA 4AC0A 5ILUA 1I6XA 2ZJPF 2X6WA 3BY6A 1VQNI 5HDNA 1YTYA 3PNTA 2IS1A 3HZJA 1S5LC 1S72I 5B3SH 4YG2F 4U7DA 1VQ8I 3TOBA 2LH9A 1EJ9A 1ZRFA 2DU9A 3F8MA 4DJAA 4UB6C 1PUFB 5IYCJ 2V7FA 1USSA 2O9LA 1IN4A 1MBEA 4ESBA 3L7WA 5GADJ 2L9RA 4JNNA 2VOOA 2QF7A 2R5ZB 3IP4B 1LDDA 1BIAA 1Q1HA 2Y0MA 3S8PA 4D5FA 3HYIA 4U9NA 3S1MJ 3GMEA 5HAWA 3QP6A 5IP9J 2JSPA 2HEOA 3LSHA 5GAEJ 4KIBA 2XPVA 4BE0A 3I59A 3ULQB 1W1WE 2O5RA 2VI6A 4C2TA 4LITA 4UB8C 4HNUA 4IHYA 1O7FA 5H20A 3H0DA 2LC2A 3VFZA 3KP6A 1HKSA 2RC4A 3F8FA 1X1AA 4GGGA 5HDKA 4HLYA 3HRSA 2QCOA 5H2FC 4JKZA 1RI7A 4EQQA 1MBJA 2KZVA 3CO7C 1CF7A 2MD5A 4UVCA 5K5OA 3OOUA 1YRNA 5D6EA 3CUQB 1R5GA 2JVHA 3OIPA 5CQEA 4ZTJA 1PP7U 2PMZN 3T0YA 2R7TA 2NXNB 3ELKA 3T6NA 1OQYA 1V5EA 1OCOH 1XMAA 4XLPF 2A07F 2REKA 2ZO4A 2UXPA 1B8IB 2GAUA 2FQ4A 2MYSA 2EV6A 4XRFA 1KONA 3HGYA 2EPFA 4CO8A 4HYEA 3OYBA 5D19A 2DI3A 2TCTA 2E36A 1LVKA 3K6GA 2XASA 4ME9A 3SJMA 5F64A 1W5CC 3K4BA 2PJPA 1KZHA 5EZHA 1J0RA 2V6CA 2O3FA 2FOKA 1TT5B 2XRLA 3VODA 3B81A 1B59A 1OMIA 3BR5A 4JYKA 1MKMA 2NOJB 3ABLH 4UVAA 4A3IJ 3JAMK 3QKXA 1LE8A 1XGOA 3W2VA 3GTKJ 1BBYA 1QPMA 4G7HF 4EJWA 1A6IA 3UNGC 6PAXA 2MC4A 3ABTA 2QLZA 1TW2A 3LL7A 1MSFC 2ME0A 1RKTA 4M71A 2M7BA 1ODDA 2YVHA 1RUOA 3ZQCA 2YS9A 3OR1C 5LBQA 3C2BA 2QBYA 3BG6A 2YUSA 2KDOA 3HEFA 2E19A 2IRFG 3MQ0A 5E18F 3G1OA 2W7NA 2V1NA 1ZG3A 4AUXA 5JVGF 3MZHA 3COAC 1O57A 2F4MB 2VPLA 2E7XA 2GA1A 2QSHX 2ZMEA 4J01A 4E7SA 2VKEA 1T33A 2XIGA 4LB6B 1SMYF 4QPQA 2BGCA 3KZIC 2Y30A 4U87A 3KP5A 2HVRA 3BTCA 2W85A 3BT9A 4HQMA 3IUOA 2MLKA 2I5UA 3K0LA 4ESFA 5JHUA 4Y52J 3IH3A 5LGTA 3HUGB 1BI2A 2ZCMA 1T95A 2OZUA 4V2FA 2VUMJ 2LKXA 4CGRA 4NC7A 3SFZA 3NXCA 4EMSA 4FE7A 2CYYA 4RB2C 2CV0A 1FP1D 3G4SI 1VQMI 3Q0UA 4DQ2A 1XX5A 1F5TA 2CQQA 4N4NB 4RAGA
chains in the Genus database with same CATH topology
4M3FA 1CQTA 4GFBA 4GFLA 1JKOC 3BR2A 4DYQA 3Q0WA 3A02A 4BY7J 3ZOBA 3BR3A 3P9TA 2R7ZJ 2DA1A 1WH5A 2H8RA 2DMNA 3HOYJ 5D18A 2WAQN 4L62A 1LFBA 1K83J 5CXIA 3GTPJ 1RESA 4XK4A 2GM4A 5K7ZA 3IUVA 2H1KA 5HSZA 3KZ9A 5DS9A 3JRDA 1PUFA 9ANTA 5CXGA 5FKMA 2Q24A 1WCMJ 2DMPA 5D1RA 2ZCNA 1AU7A 4C2MJ 5J1RA 3WHBA 1HOMA 3JRBA 4QIWN 2R5ZA 5FLVA 1NK2P 3HM5A 1MBGA 4NELA 4MIMA 1U78A 2HQ5A 3BQZA 5F27A 2NVTJ 1YRNB 2W53A 3VVYA 1TWCJ 2DA7A 2ZB9A 2ZCXA 3AQTA 5C4XJ 5HODA 2NS7A 2GBYA 2E2HJ 1P7JA 4MXMA 2MW8A 3HB9A 2IEKA 1IRZA 1ZK8A 4MK6A 3IV5A 4UUTA 4B1RA 3PO2J 2JJ7A 4EEFG 2E2JJ 4XIDA 2RASA 5FKKA 2XB0X 4IHVA 4JL3A 4JP0A 4BBRJ 2JA6J 1UHSA 2ELKA 2LVSA 2F07A 3FIWA 4J19A 3PO3J 3ZQLA 1JJ6C 3S17J 3CRJA 1ZGWA 3IH4A 2X48A 3ON2A 4LOCA 1IDYA 5IYBJ 4A3JJ 4A69C 5EDNA 2V57A 1JJ8C 4G12A 1S7EA 2FD5A 2DA2A 2EZLA 4A3CJ 4A3LJ 4X6AJ 3CWRA 3GTQJ 4D5CA 2G7LA 2E1OA 3CDLA 4FISA 1MSEC 3TW6A 1ETQA 1AKHA 1WI3A 1JKRC 2DN0A 2CUEA 1E3OC 3TP0A 3HDDA 1XS9A 3S1NJ 3S5RA 3LNQA 2EH3A 1DU6A 1U8BA 1HDPA 3O8GA 1QVTA 5JLXA 1TWGJ 2WB1N 2DG8A 3VVZA 1EF4A 3ZQHA 3A01A 2CU7A 3LSJA 2GUHA 3VUQA 5FGLA 2O7TA 3W6VA 2EZIA 1G2HA 5EEAA 4GCLA 2L0KA 3D1NI 4MFEA 2HOAA 2EQRA 1D5YA 1IV6A 3CQZJ 2RHAA 5DTDA 4W97A 2HYTA 5EFYA 3KKDA 2CUFA 1JKQC 3DCFA 1F36A 1B72A 4S0HB 3VOXA 4UUSB 1ETOA 5C4YA 1HLVA 3PM1A 3JR9A 1R9TJ 3VW0A 3TP3A 4NDLA 5JLWA 1WPKA 2ID3A 3O8HA 2G3BA 2NP3A 3QPLA 2ZOZA 2QTQA 3FRQA 2DA6A 5BNGA 1RKWA 2HYJA 3JRHA 2HDDA 1A5JA 1UI6A 4M3GA 1GDTA 4YZEA 5F0FA 1JKPC 1QPIA 4D7MA 2JN6A 2ME6A 4DYRA 5CW8A 1JGGA 3VW1A 2KT0A 1ETVA 2K9NA 5F1JA 3ANGA 5EG0B 4HNVA 1POGA 5M5WJ 4MLOA 4BKXA 1I3QJ 1HDDC 2HOTA 4V2GA 3HTJA 5M3FJ 4AF5A 1UG2A 1UMQA 3S2HJ 1BJZA 4GFKA 5EGOA 3EGQA 4CYCA 1Z77A 2XGCA 2XGEA 1ENHA 4A3EJ 3HOUJ 3RKQA 2DTZA 3JREA 4HKUA 3MN2A 2WGBA 3TW7A 2K9QA 3E7LA 3GTLJ 2UXIA 2LLKA 4B3AA 4D7NA 3S1QJ 3GZIA 1H88C 3ZQFA 1BA5A 1IC8A 3K7AJ 3LSGA 3S2DJ 1DU0A 3HKZN 3GEUA 4C3JJ 3NRGA 2XPUA 1GV5A 3RZOJ 1FIPA 3G7RA 2M8GX 5K58A 3JSJA 4ACIA 2DJNA 1JUMA 3OSGA 1SGMA 2Y2ZA 4C3HJ 4XRSA 2JWTA 2FBQA 2DA5A 5IP6A 3LSPA 2P81A 4ICHA 4RBOA 1BW5A 1BL0A 2ID6A 3LWJA 2XGDA 2X6OA 1I50J 1MBFA 1W0UA 3C07A 3QBMA 2MGQA 3I4MJ 4ABZA 2B63J 3RD3A 2JMWA 3PASA 5M5XJ 1XC5A 1W0TA 3Q3SA 1JT0A 3HE0A 4DW6A 1APLC 3COLA 3NPIA 3SFIA 1ZQ3P 1ETXA 2X9DA 1NK3P 2JA8J 4FTHA 1MH4A 4W1UA 2DMTA 2ECBA 3BG5A 2IBDA 2MG4A 5J1UA 1B8IA 1ETKA 3A03A 1TWHJ 2LY9A 1QRYA 1T56A 5AQCA 3GTJJ 5F04A 4JX4A 1TWAJ 3ZQGA 2DMUA 4XICA 3L1PA 3H0GJ 1TWFJ 1WGXA 2G0EA 4A3KJ 1LE8B 3HOZJ 1VI0A 4PXIA 3F0CA 3BG9A 4MO7A 2M2EA 4A3DJ 2L7MP 3HIMA 1NTCA 3O60A 1ZKGA 3RH2A 3HOWJ 1X58A 1JT6A 3AQSA 4GCTA 3CMYA 2OF7A 2D5VA 2E2IJ 2JA7J 4BBSJ 1GT0C 1X2NA 4B4CA 5IP7J 3KKCA 1H8AC 4NN1A 1P7IA 1U9NA 5IOYA 3GTOJ 1HF0A 3BJBA 5DAJA 3I4NJ 2K9SA 2IAIA 2UXOA 2DMQA 2NS8A 2FX0A 2LFBA 5EF6A 3BCGA 3VW2A 3JRIA 3K2AA 3A01B 3JRGA 3RQIA 3S16J 3M4OJ 2I10A 5H9TA 3NI7A 2FJ1A 4IHWA 5M5YJ 3BHQA 1OCTC 2DG7A 2NVYJ 1MH3A 4L5EA 4C3IJ 3DPJA 2HXOA 2Y0SN 4I6ZA 3PPBA 3UKGA 3H3VK 4XRSG 3S15J 1FTZA 2IU5A 3BTJA 1F43A 2M9HA 2NOGA 1ETWA 1IG7A 2NP5A 1BW6A 4M3EA 2L7FP 1WH7A 3NAUA 2CJJA 1AHDP 2ZOYA 3V6GA 1FTTA 1JUSA 1Y1VJ 3G1LA 4BXXJ 3FISA 5GPCA 3S14J 5C4JJ 4DZPA 2GFNA 3HGGA 3GTMJ 2JK3A 3MNLA 4UUSA 5IPAA 5FLMJ 2R5YA 2R0QC 4A3MJ 4AYBN 3HTHA 1IJWC 3QPSA 2DA3A 2LTPA 4A3BJ 2G7SA 5EZGA 2PBXA 3ANPA 3Q0VA 3FKIJ 1OCPA 4FE4A 4M6VA 4IEJA 1VNDA 3BNIA 2QWTA 3F1BA 3JRCA 4AC0A 2QKOA 3CJDA 4KWAA 2O8KA 5FMPA 4CYCB 3BQYA 3IH2A 2CRGA 1Q1VA 2YVEA 3VOKA 2VKVA 1RR7A 5E3LA 4RDUA 3BRUA 3VPRA 1MBHA 1X2MA 1LFUP 5EG0A 1PUFB 2WUIA 5IYCJ 4GCKA 5F08A 4AC6A 2O9LA 1MBEA 2GENA 2TRTA 2XPWA 2AHQA 2LR8A 3MVPA 2HKUA 2L9RA 4JNNA 1ORKA 2QF7A 2R5ZB 1ZTRA 2D6YA 2AO9A 4JX6A 4D5FA 3BTLA 3S1MJ 2HOSA 4M3BA 5HAWA 1FIAA 1Z0XA 5IP9J 1ITYA 2OI8A 4A3GJ 4MFDA 1TC3C 2XPVA 3NARA 1RETA 2LK2A 3QQAA 3DEWA 5HBUA 2VI6A 4Y7NJ 1ZR2A 2WV1A 4XRMA 3RZDJ 4IHYA 1VFCA 3HOVJ 3NNRA 5FHPA 1H89C 3HTIA 2G7GA 2LD5A 2QCOA 3SDGA 4JKZA 1MBJA 2HXIA 3OOUA 1MNMC 1YRNA 5K7HA 3BR0A 2EBIA 5GPAA 1SFOJ 4UDSA 1UI5A 2PMZN 2N8GA 2M0CA 1ZR4A 3T6NA 1U9OA 2YU9J 3MKLA 2REKA 4M3DA 4A3FJ 5E3OA 1B8IB 2UXPA 2FQ4A 1SANA 3HGYA 2GLOA 5D19A 2MSYA 3HTAA 4A93J 5F0HA 2TCTA 1GVDA 2XSDC 3VP5A 3E7QA 3G1MA 4ME9A 3OIOA 3SJMA 5F0CA 3BR1A 5M3MJ 1AKHB 5EZHA 1IGNA 2NVQJ 3VVXA 2UXHA 1OJLA 2VPRA 2OPTA 3LJLA 5E3MA 2XRLA 2KDZA 3B81A 2QOPA 1VF9A 3BR5A 3FK6A 4JYKA 3LSRA 1FJLA 3KNWA 2QIBA 3EUPA 4A3IJ 3QKXA 1LE8A 1HCRA 2L7ZA 5FKLA 2XB5A 1ETYA 3GTKJ 2UXUA 3HOXJ 2M34A 3B6AA 4QTRA 2EZHA 1A6IA 3GTGJ 5IOZA 2RAEA 1MSFC 3VIBA 2ME0A 3GBGA 5C44J 3HBLA 1RKTA 1FEXA 1B72B 3BTIA 4DZJA 3LOCA 5K7FA 3ZQCA 2EZKA 2YS9A 2NX4A 5GP9A 3LHQA 2YVHA 2R93J 1RPWA 3C2BA 2Y31A 2YUSA 3JRFA 3HEFA 2E19A 1IUFA 2K40A 3G1OA 1GV2A 2W48A 4AUXA 5FJ8J 2XDNA 2ECCA 3JRAA 2COBA 3S1RJ 3OSFA 2VKEA 2LP0A 1T33A 3ON4A 3V78A 4IHXA 3FK7A 1GUUA 4I76A 2PZ9A 5FKOA 1O4XA 1I6HJ 2DA4A 2R5YB 4QSHA 2Y30A 3TEDA 1XG1A 5FKNA 2Y9ZA 3BTCA 3BT9A 1K61A 3B6CA 4Y52J 5E3NA 3IH3A 3BG3A 1IDZA 2O7OA 1JTYA 5J1YA 2OERA 2ZCMA 3M3YJ 1MBKA 4V2FA 3WHCA 2R92J 2VUMJ 5EGOB 2LKXA 4FCYA 3G56A 4CGRA 1JTXA 3BR6A 1Y1WJ 3NXCA 1JUPA 2HI3A 4FE7A 5EYRA 4BY1J 3CCYA 3Q0UA 2CQXA 5J3LA 2CQQA 5C3EJ 3ZQIA 2JA5J 1QVUA 4DYCA 4X1EA 1OFCX 2NVXJ 5IYDJ 2Y9YA 4JX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3F A;  1CQT A;  4GFB A;  4GFL A;  1JKO C;  3BR2 A;  4DYQ A;  3Q0W A;  3A02 A;  4BY7 J;  3ZOB A;  3BR3 A;  3P9T A;  2R7Z J;  2DA1 A;  1WH5 A;  2H8R A;  2DMN A;  3HOY J;  5D18 A;  2WAQ N;  4L62 A;  1LFB A;  1K83 J;  5CXI A;  3GTP J;  1RES A;  4XK4 A;  2GM4 A;  5K7Z A;  3IUV A;  2H1K A;  5HSZ A;  3KZ9 A;  5DS9 A;  3JRD A;  1PUF A;  9ANT A;  5CXG A;  5FKM A;  2Q24 A;  1WCM J;  2DMP A;  5D1R A;  2ZCN A;  1AU7 A;  4C2M J;  5J1R A;  3WHB A;  1HOM A;  3JRB A;  4QIW N;  2R5Z A;  5FLV A;  1NK2 P;  3HM5 A;  1MBG A;  4NEL A;  4MIM A;  1U78 A;  2HQ5 A;  3BQZ A;  5F27 A;  2NVT J;  1YRN B;  2W53 A;  3VVY A;  1TWC J;  2DA7 A;  2ZB9 A;  2ZCX A;  3AQT A;  5C4X J;  5HOD A;  2NS7 A;  2GBY A;  2E2H J;  1P7J A;  4MXM A;  2MW8 A;  3HB9 A;  2IEK A;  1IRZ A;  1ZK8 A;  4MK6 A;  3IV5 A;  4UUT A;  4B1R A;  3PO2 J;  2JJ7 A;  4EEF G;  2E2J J;  4XID A;  2RAS A;  5FKK A;  2XB0 X;  4IHV A;  4JL3 A;  4JP0 A;  4BBR J;  2JA6 J;  1UHS A;  2ELK A;  2LVS A;  2F07 A;  3FIW A;  4J19 A;  3PO3 J;  3ZQL A;  1JJ6 C;  3S17 J;  3CRJ A;  1ZGW A;  3IH4 A;  2X48 A;  3ON2 A;  4LOC A;  1IDY A;  5IYB J;  4A3J J;  4A69 C;  5EDN A;  2V57 A;  1JJ8 C;  4G12 A;  1S7E A;  2FD5 A;  2DA2 A;  2EZL A;  4A3C J;  4A3L J;  4X6A J;  3CWR A;  3GTQ J;  4D5C A;  2G7L A;  2E1O A;  3CDL A;  4FIS A;  1MSE C;  3TW6 A;  1ETQ A;  1AKH A;  1WI3 A;  1JKR C;  2DN0 A;  2CUE A;  1E3O C;  3TP0 A;  3HDD A;  1XS9 A;  3S1N J;  3S5R A;  3LNQ A;  2EH3 A;  1DU6 A;  1U8B A;  1HDP A;  3O8G A;  1QVT A;  5JLX A;  1TWG J;  2WB1 N;  2DG8 A;  3VVZ A;  1EF4 A;  3ZQH A;  3A01 A;  2CU7 A;  3LSJ A;  2GUH A;  3VUQ A;  5FGL A;  2O7T A;  3W6V A;  2EZI A;  1G2H A;  5EEA A;  4GCL A;  2L0K A;  3D1N I;  4MFE A;  2HOA A;  2EQR A;  1D5Y A;  1IV6 A;  3CQZ J;  2RHA A;  5DTD A;  4W97 A;  2HYT A;  5EFY A;  3KKD A;  2CUF A;  1JKQ C;  3DCF A;  1F36 A;  1B72 A;  4S0H B;  3VOX A;  4UUS B;  1ETO A;  5C4Y A;  1HLV A;  3PM1 A;  3JR9 A;  1R9T J;  3VW0 A;  3TP3 A;  4NDL A;  5JLW A;  1WPK A;  2ID3 A;  3O8H A;  2G3B A;  2NP3 A;  3QPL A;  2ZOZ A;  2QTQ A;  3FRQ A;  2DA6 A;  5BNG A;  1RKW A;  2HYJ A;  3JRH A;  2HDD A;  1A5J A;  1UI6 A;  4M3G A;  1GDT A;  4YZE A;  5F0F A;  1JKP C;  1QPI A;  4D7M A;  2JN6 A;  2ME6 A;  4DYR A;  5CW8 A;  1JGG A;  3VW1 A;  2KT0 A;  1ETV A;  2K9N A;  5F1J A;  3ANG A;  5EG0 B;  4HNV A;  1POG A;  5M5W J;  4MLO A;  4BKX A;  1I3Q J;  1HDD C;  2HOT A;  4V2G A;  3HTJ A;  5M3F J;  4AF5 A;  1UG2 A;  1UMQ A;  3S2H J;  1BJZ A;  4GFK A;  5EGO A;  3EGQ A;  4CYC A;  1Z77 A;  2XGC A;  2XGE A;  1ENH A;  4A3E J;  3HOU J;  3RKQ A;  2DTZ A;  3JRE A;  4HKU A;  3MN2 A;  2WGB A;  3TW7 A;  2K9Q A;  3E7L A;  3GTL J;  2UXI A;  2LLK A;  4B3A A;  4D7N A;  3S1Q J;  3GZI A;  1H88 C;  3ZQF A;  1BA5 A;  1IC8 A;  3K7A J;  3LSG A;  3S2D J;  1DU0 A;  3HKZ N;  3GEU A;  4C3J J;  3NRG A;  2XPU A;  1GV5 A;  3RZO J;  1FIP A;  3G7R A;  2M8G X;  5K58 A;  3JSJ A;  4ACI A;  2DJN A;  1JUM A;  3OSG A;  1SGM A;  2Y2Z A;  4C3H J;  4XRS A;  2JWT A;  2FBQ A;  2DA5 A;  5IP6 A;  3LSP A;  2P81 A;  4ICH A;  4RBO A;  1BW5 A;  1BL0 A;  2ID6 A;  3LWJ A;  2XGD A;  2X6O A;  1I50 J;  1MBF A;  1W0U A;  3C07 A;  3QBM A;  2MGQ A;  3I4M J;  4ABZ A;  2B63 J;  3RD3 A;  2JMW A;  3PAS A;  5M5X J;  1XC5 A;  1W0T A;  3Q3S A;  1JT0 A;  3HE0 A;  4DW6 A;  1APL C;  3COL A;  3NPI A;  3SFI A;  1ZQ3 P;  1ETX A;  2X9D A;  1NK3 P;  2JA8 J;  4FTH A;  1MH4 A;  4W1U A;  2DMT A;  2ECB A;  3BG5 A;  2IBD A;  2MG4 A;  5J1U A;  1B8I A;  1ETK A;  3A03 A;  1TWH J;  2LY9 A;  1QRY A;  1T56 A;  5AQC A;  3GTJ J;  5F04 A;  4JX4 A;  1TWA J;  3ZQG A;  2DMU A;  4XIC A;  3L1P A;  3H0G J;  1TWF J;  1WGX A;  2G0E A;  4A3K J;  1LE8 B;  3HOZ J;  1VI0 A;  4PXI A;  3F0C A;  3BG9 A;  4MO7 A;  2M2E A;  4A3D J;  2L7M P;  3HIM A;  1NTC A;  3O60 A;  1ZKG A;  3RH2 A;  3HOW J;  1X58 A;  1JT6 A;  3AQS A;  4GCT A;  3CMY A;  2OF7 A;  2D5V A;  2E2I J;  2JA7 J;  4BBS J;  1GT0 C;  1X2N A;  4B4C A;  5IP7 J;  3KKC A;  1H8A C;  4NN1 A;  1P7I A;  1U9N A;  5IOY A;  3GTO J;  1HF0 A;  3BJB A;  5DAJ A;  3I4N J;  2K9S A;  2IAI A;  2UXO A;  2DMQ A;  2NS8 A;  2FX0 A;  2LFB A;  5EF6 A;  3BCG A;  3VW2 A;  3JRI A;  3K2A A;  3A01 B;  3JRG A;  3RQI A;  3S16 J;  3M4O J;  2I10 A;  5H9T A;  3NI7 A;  2FJ1 A;  4IHW A;  5M5Y J;  3BHQ A;  1OCT C;  2DG7 A;  2NVY J;  1MH3 A;  4L5E A;  4C3I J;  3DPJ A;  2HXO A;  2Y0S N;  4I6Z A;  3PPB A;  3UKG A;  3H3V K;  4XRS G;  3S15 J;  1FTZ A;  2IU5 A;  3BTJ A;  1F43 A;  2M9H A;  2NOG A;  1ETW A;  1IG7 A;  2NP5 A;  1BW6 A;  4M3E A;  2L7F P;  1WH7 A;  3NAU A;  2CJJ A;  1AHD P;  2ZOY A;  3V6G A;  1FTT A;  1JUS A;  1Y1V J;  3G1L A;  4BXX J;  3FIS A;  5GPC A;  3S14 J;  5C4J J;  4DZP A;  2GFN A;  3HGG A;  3GTM J;  2JK3 A;  3MNL A;  4UUS A;  5IPA A;  5FLM J;  2R5Y A;  2R0Q C;  4A3M J;  4AYB N;  3HTH A;  1IJW C;  3QPS A;  2DA3 A;  2LTP A;  4A3B J;  2G7S A;  5EZG A;  2PBX A;  3ANP A;  3Q0V A;  3FKI J;  1OCP A;  4FE4 A;  4M6V A;  4IEJ A;  1VND A;  3BNI A;  2QWT A;  3F1B A;  3JRC A;  4AC0 A;  2QKO A;  3CJD A;  4KWA A;  2O8K A;  5FMP A;  4CYC B;  3BQY A;  3IH2 A;  2CRG A;  1Q1V A;  2YVE A;  3VOK A;  2VKV A;  1RR7 A;  5E3L A;  4RDU A;  3BRU A;  3VPR A;  1MBH A;  1X2M A;  1LFU P;  5EG0 A;  1PUF B;  2WUI A;  5IYC J;  4GCK A;  5F08 A;  4AC6 A;  2O9L A;  1MBE A;  2GEN A;  2TRT A;  2XPW A;  2AHQ A;  2LR8 A;  3MVP A;  2HKU A;  2L9R A;  4JNN A;  1ORK A;  2QF7 A;  2R5Z B;  1ZTR A;  2D6Y A;  2AO9 A;  4JX6 A;  4D5F A;  3BTL A;  3S1M J;  2HOS A;  4M3B A;  5HAW A;  1FIA A;  1Z0X A;  5IP9 J;  1ITY A;  2OI8 A;  4A3G J;  4MFD A;  1TC3 C;  2XPV A;  3NAR A;  1RET A;  2LK2 A;  3QQA A;  3DEW A;  5HBU A;  2VI6 A;  4Y7N J;  1ZR2 A;  2WV1 A;  4XRM A;  3RZD J;  4IHY A;  1VFC A;  3HOV J;  3NNR A;  5FHP A;  1H89 C;  3HTI A;  2G7G A;  2LD5 A;  2QCO A;  3SDG A;  4JKZ A;  1MBJ A;  2HXI A;  3OOU A;  1MNM C;  1YRN A;  5K7H A;  3BR0 A;  2EBI A;  5GPA A;  1SFO J;  4UDS A;  1UI5 A;  2PMZ N;  2N8G A;  2M0C A;  1ZR4 A;  3T6N A;  1U9O A;  2YU9 J;  3MKL A;  2REK A;  4M3D A;  4A3F J;  5E3O A;  1B8I B;  2UXP A;  2FQ4 A;  1SAN A;  3HGY A;  2GLO A;  5D19 A;  2MSY A;  3HTA A;  4A93 J;  5F0H A;  2TCT A;  1GVD A;  2XSD C;  3VP5 A;  3E7Q A;  3G1M A;  4ME9 A;  3OIO A;  3SJM A;  5F0C A;  3BR1 A;  5M3M J;  1AKH B;  5EZH A;  1IGN A;  2NVQ J;  3VVX A;  2UXH A;  1OJL A;  2VPR A;  2OPT A;  3LJL A;  5E3M A;  2XRL A;  2KDZ A;  3B81 A;  2QOP A;  1VF9 A;  3BR5 A;  3FK6 A;  4JYK A;  3LSR A;  1FJL A;  3KNW A;  2QIB A;  3EUP A;  4A3I J;  3QKX A;  1LE8 A;  1HCR A;  2L7Z A;  5FKL A;  2XB5 A;  1ETY A;  3GTK J;  2UXU A;  3HOX J;  2M34 A;  3B6A A;  4QTR A;  2EZH A;  1A6I A;  3GTG J;  5IOZ A;  2RAE A;  1MSF C;  3VIB A;  2ME0 A;  3GBG A;  5C44 J;  3HBL A;  1RKT A;  1FEX A;  1B72 B;  3BTI A;  4DZJ A;  3LOC A;  5K7F A;  3ZQC A;  2EZK A;  2YS9 A;  2NX4 A;  5GP9 A;  3LHQ A;  2YVH A;  2R93 J;  1RPW A;  3C2B A;  2Y31 A;  2YUS A;  3JRF A;  3HEF A;  2E19 A;  1IUF A;  2K40 A;  3G1O A;  1GV2 A;  2W48 A;  4AUX A;  5FJ8 J;  2XDN A;  2ECC A;  3JRA A;  2COB A;  3S1R J;  3OSF A;  2VKE A;  2LP0 A;  1T33 A;  3ON4 A;  3V78 A;  4IHX A;  3FK7 A;  1GUU A;  4I76 A;  2PZ9 A;  5FKO A;  1O4X A;  1I6H J;  2DA4 A;  2R5Y B;  4QSH A;  2Y30 A;  3TED A;  1XG1 A;  5FKN A;  2Y9Z A;  3BTC A;  3BT9 A;  1K61 A;  3B6C A;  4Y52 J;  5E3N A;  3IH3 A;  3BG3 A;  1IDZ A;  2O7O A;  1JTY A;  5J1Y A;  2OER A;  2ZCM A;  3M3Y J;  1MBK A;  4V2F A;  3WHC A;  2R92 J;  2VUM J;  5EGO B;  2LKX A;  4FCY A;  3G56 A;  4CGR A;  1JTX A;  3BR6 A;  1Y1W J;  3NXC A;  1JUP A;  2HI3 A;  4FE7 A;  5EYR A;  4BY1 J;  3CCY A;  3Q0U A;  2CQX A;  5J3L A;  2CQQ A;  5C3E J;  3ZQI A;  2JA5 J;  1QVU A;  4DYC A;  4X1E A;  1OFC X;  2NVX J;  5IYD J;  2Y9Y A;  4JX5 A; 
#chains in the Genus database with same CATH topology
 2L2O A;  4FET A;  4C2U A;  3OIQ A;  4GFB A;  2ESN A;  3FM3 A;  3P7N A;  4BYY A;  1FX7 A;  4LMY A;  2R7Z J;  2H8R A;  3CLO A;  5JI6 A;  1PP8 F;  1XN7 A;  4PFO A;  3GTP J;  2E5N A;  3IUV A;  2LNB A;  1Y56 A;  2EK5 A;  3KZ9 A;  3KYD B;  1I39 A;  3OL3 A;  1PUF A;  5CXG A;  4HAM A;  4ZYD A;  2Q24 A;  1WCM J;  3OOP A;  2ZCN A;  1AU7 A;  4C2M J;  1G3T A;  5TJJ A;  2BXZ A;  1BOB A;  3E6C C;  2R5Z A;  4M74 A;  3J80 K;  3PIP F;  4LG0 A;  5FLV A;  3MZ8 A;  5DDG A;  4NEL A;  2NVU B;  2ISY A;  2L7K A;  4PGG A;  3TO6 A;  1L3L A;  1W5S A;  1Z6R A;  2NVT J;  4HZF A;  4XOR A;  2PI0 A;  2BV6 A;  2W53 A;  2WC2 A;  2DA7 A;  1JHH A;  3AQT A;  4ZYH A;  2NS7 A;  2J5P A;  2W82 A;  2GBY A;  3ONQ A;  3I0T A;  5E1X A;  2IEK A;  2K9L A;  5CQG A;  2XAJ A;  5HS9 A;  2CO5 A;  1BR2 A;  5FFZ A;  2XAU A;  5D6F A;  4M9S A;  2E2J J;  4EJU A;  3K4J A;  5L3G A;  3R60 A;  3CUQ A;  4JL3 A;  5HLI A;  1UHS A;  2ELK A;  2LVS A;  4I99 C;  2QYO A;  2LRD A;  2QWW A;  4MGR A;  3WTW C;  3SEQ A;  1YFH A;  2ZJR F;  1A04 A;  1FSE A;  2G9W A;  2DO7 A;  3AG1 H;  3K2Z A;  3ON2 A;  5BPI A;  5IYB J;  4R79 A;  1MMA A;  2F5D A;  3R0J A;  2L9S A;  4G12 A;  3OWT A;  2DA2 A;  2EZL A;  5TGT A;  4OMZ A;  2QKM B;  2E1O A;  3CDL A;  1MSE C;  3F3X A;  4A6E A;  3C1D A;  4AIK A;  1WI3 A;  1JKR C;  2R7F A;  2CUE A;  3F21 A;  3DWL E;  3TP0 A;  3HC7 A;  3S1N J;  3S5R A;  1FZP B;  2M1B A;  4CXF A;  3DPU A;  2ELH A;  2K7L A;  3PNY A;  1QVT A;  2E34 A;  2MA3 A;  3S32 A;  4F3Q A;  1W36 D;  1P92 A;  2CU7 A;  3LSJ A;  3M8E A;  1YIJ I;  1O3T A;  2M45 A;  3FZV A;  1J5Y A;  3QP5 A;  3KFW X;  2BHZ A;  5EEA A;  2KL4 A;  3DPL C;  3HRU A;  2HVS A;  3JAM Z;  1UEL B;  3CQZ J;  1IV6 A;  1D1A A;  2WBM A;  2V9P A;  2QSF X;  3QWL A;  1IRX A;  2DFH A;  3JTH A;  2JUG A;  3GLL A;  4YEJ A;  4QWQ A;  5C4Y A;  3CCV I;  2GXG A;  3JR9 A;  2O03 A;  4E7L A;  4L9N A;  1DP3 A;  2O61 A;  3RKW A;  4L18 B;  2ID3 A;  2MAB A;  1KU2 A;  2NP3 A;  5D5V B;  1UAA A;  3CDI A;  2JQ7 A;  2V9V A;  2QTQ A;  1UI6 A;  2L4A A;  3I5U A;  4XON A;  2RNJ A;  2VE9 A;  4N4O B;  2KIQ A;  3H3Z A;  3FXU A;  4D7M A;  2IGN A;  3DF8 A;  5BOX A;  4ZDP A;  1JGS A;  1O7L A;  4DYR A;  5CW8 A;  1JGG A;  5FRN A;  1ETV A;  2K9N A;  2ZXJ A;  5F1J A;  2PLY A;  1U6G A;  2ELJ A;  3VWB A;  5ICG A;  4MLO A;  1FBS A;  4BKX A;  4HLX A;  3KP2 A;  4LFU A;  3LAJ A;  1FY7 A;  1OKR A;  3S2H J;  4GFK A;  4E7K A;  4CUG A;  2MLG A;  2XGC A;  1HST A;  3JRE A;  4V19 K;  3M7G A;  2EIJ H;  2F2E A;  2K9Q A;  2DYS H;  1B6A A;  4OIO F;  3S1Q J;  2NYX A;  2ICW G;  4IPA A;  5LEJ A;  4D1Q A;  1H88 C;  1V4R A;  3LSG A;  3S2D J;  2DLL A;  1WJC A;  3GEU A;  2HQR A;  5HNH A;  3EYI A;  3OY9 A;  4XN0 A;  4BHC A;  5K58 A;  3G71 I;  3JSJ A;  2DJN A;  1IO2 A;  4ACI A;  1JUM A;  2ACJ A;  1R1V A;  3GZ5 A;  1KGS A;  2Y2Z A;  4XRS A;  3MKZ A;  3F6O A;  3CZ6 A;  4LG3 A;  3LSP A;  2P81 A;  5CVI A;  4X0G A;  2HS5 A;  2FBH A;  3NWT A;  4UV9 A;  2OD5 A;  4ZTF A;  2UXN A;  2A5W A;  2HU9 A;  2XGD A;  3I9V 2;  2KIS A;  2VKD A;  2PJR B;  1MDM A;  4IZZ A;  2BHY A;  2KFD A;  4ABZ A;  5HDG A;  1JE8 A;  2STT A;  3K1N A;  3REO A;  1XC5 A;  4XMY A;  1UZC A;  2JRT A;  2JPB A;  4HDU A;  1JT0 A;  3COL A;  1ZAO A;  3SFI A;  2K85 A;  2O0Y A;  4OD4 A;  1K4S A;  1ZQ3 P;  2BOL A;  1ETX A;  3J80 Z;  2JA8 J;  1MH4 A;  2LBF B;  3RSN A;  1WVR A;  2Z9O A;  1SFX A;  3GUD A;  3W3C A;  3LQR A;  3ZGK A;  4QPO A;  4Z2Y A;  1ULY A;  3A03 A;  1P4A A;  2CQK A;  4LK1 F;  3FXO A;  1XGM A;  1TWA J;  4XIC A;  2HWV A;  4GDF A;  1YW8 A;  2WB1 A;  3WTT C;  4P96 A;  1W7P D;  2DT5 A;  1NHA A;  4ZH4 F;  2R7X A;  2M2E A;  4IHS A;  4E6K G;  2OTL I;  1NTC A;  1A36 A;  1X58 A;  3ABK H;  2EIK H;  2JA7 J;  2E1C A;  4LLL A;  4B4C A;  1GXP A;  1H8A C;  3KKC A;  2X0L A;  1GXQ A;  3ABU A;  4GRI A;  5DM7 F;  3OYN A;  3E6M A;  5DAJ A;  4BQO A;  2HDC A;  2DMQ A;  3C2H A;  4CDG A;  3ROU A;  5HVQ C;  2XKO A;  2BY2 A;  2LFB A;  2K4J A;  3RDI A;  4A6D A;  5EF6 A;  3VW2 A;  3JRI A;  1KYW A;  3A01 B;  1XD7 A;  4M73 A;  1FPQ A;  1XCV A;  5KAI C;  1X4O A;  1OYY A;  5BQT A;  2ZJQ F;  4YFK F;  1XSV A;  2XRO A;  2NVY J;  3E3V A;  4EJV A;  4F91 B;  1MH3 A;  3FXJ A;  2HZT A;  4C3I J;  2B9S A;  2HVQ A;  2Y0S N;  3ERE D;  1ONV A;  2A68 F;  1V55 H;  3D0S A;  4ZYA A;  4XRS G;  4CSW A;  3PPB A;  5LLQ A;  1X1P A;  5A2Q K;  2M9H A;  3IAM 2;  2M5W A;  2VON A;  2A2F X;  4ZZL A;  1WRJ A;  4XKB A;  2ZXH A;  2DTR A;  2X51 A;  3NAU A;  2VC0 A;  1S29 A;  2ZOY A;  3FMQ A;  5LD2 C;  1JUS A;  1Y1V J;  3S14 J;  1UB9 A;  5C4J J;  2GFN A;  3FF5 A;  3MNL A;  3QU6 A;  2DT6 A;  2VT3 A;  3ZQQ A;  4BU2 A;  3E5Q A;  3IRR A;  3IKT A;  3DTE A;  3L2R A;  1IJW C;  2LTP A;  2PBX A;  3PSF A;  3OS1 A;  3FKI J;  2OU2 A;  3CTA A;  3ASN H;  1Z9C A;  4CCM A;  5J8C A;  3HKZ A;  1ZG5 A;  3F1B A;  3NQO A;  4KMU X;  2JZY A;  2E5Z A;  3WTY C;  4N0B A;  2O8K A;  5FMP A;  4EM1 A;  1E3P A;  3VSL A;  4CYC B;  1Q1V A;  2YVE A;  4PFP A;  5FD5 A;  3VOK A;  3E5U A;  3T1B A;  3RTR A;  1MJ9 A;  2OQG A;  5E3L A;  3VPR A;  1MBH A;  3BRU A;  1X2M A;  4B43 A;  3BCB A;  2HGC A;  4Y15 A;  4FAS D;  5FB2 A;  2CSO A;  1JXS A;  1QZY A;  4H0E A;  4AC6 A;  4B09 A;  2BW3 B;  3K8P C;  1D8J A;  2IXS A;  3DU5 A;  2UZK A;  3MVP A;  2LR8 A;  3E5X A;  5E79 C;  3V8K A;  1J09 A;  1YX3 A;  2Y69 H;  4WXC A;  3FHZ A;  2D6Y A;  3SDB A;  3J81 K;  4JX6 A;  2HR3 A;  3BTL A;  1F1Z A;  1FIA A;  1K4T A;  1BC7 C;  1LB2 A;  1DPR A;  1L0O C;  4A3G J;  3TDZ C;  1TC3 C;  2F48 A;  2GQQ A;  2FNA A;  4H4K C;  4IL6 C;  2Z5U A;  5HBU A;  2QSG X;  2X1E A;  4Y7N J;  2IA1 A;  4MEX F;  1G59 A;  4DGW B;  2P7C B;  4BEH B;  1QA6 A;  1FOX A;  3HTI A;  1YLF A;  3OYH A;  2G7G A;  3QU3 A;  1UG0 A;  4IQJ A;  1P2F A;  4UDS A;  1SFO J;  1Y8Q B;  2PJR A;  4B3X A;  1U9O A;  3P9K A;  3MKL A;  3QOD A;  5LEK A;  3OYK A;  2IA2 A;  1HXD A;  5ILS A;  2MSY A;  4M6X A;  1XDS A;  4JK1 X;  3TKY A;  4A93 J;  4JOM A;  3VP5 A;  1R00 A;  3BPX A;  2XSD C;  3E7Q A;  1IF1 A;  3OIO A;  2KMU A;  5F0C A;  1T0F C;  5M3M J;  2IS4 A;  4HF0 A;  1AKH B;  4IRI A;  1R5I D;  4XNF A;  2IP2 A;  4I98 B;  4BHP A;  1FYM A;  1OJL A;  5CYV A;  1FBQ A;  2XDV A;  2QOP A;  1RZ4 A;  3OYG A;  2BY3 A;  2V79 A;  2K4B A;  4BAC A;  3CCM I;  2DYR H;  2IVM A;  2FRH A;  3KE2 A;  3ML6 A;  4MHG A;  4A5N A;  4BJT A;  3QOP A;  2L7Z A;  2XB5 A;  4DOZ A;  3HOX J;  3DTI A;  2M34 A;  3CCJ I;  4AIH A;  3HSE A;  5K5Q A;  2W84 A;  1PVE A;  3GTG J;  3J7A Y;  1YJW I;  3HSR A;  2DOD A;  2FBI A;  1YYV A;  1S7A A;  2OZ6 A;  1YJN I;  3KCC A;  3VIB A;  5D5W B;  1I5Z A;  3M1E A;  2JVG A;  2CMP A;  2VAS A;  3O6B B;  3BTI A;  1SC7 A;  2EZK A;  3LHQ A;  1BIB A;  2R93 J;  5D5U B;  4Q5S F;  3ECO A;  1I27 A;  3GO5 A;  2M7A A;  4OMY A;  5KK1 A;  1QGP A;  5L3F A;  4MQV A;  4BH9 A;  1IUF A;  1WWX A;  2W48 A;  5FJ8 J;  4IRH A;  5K1Y A;  1UJ8 A;  5CVJ A;  5DCF A;  1VTN C;  2M87 A;  2Z16 A;  5CVR A;  3HOS A;  3ON4 A;  1ERD A;  1LPQ A;  1KU7 A;  1R4M B;  1GUU A;  4Q4Z F;  5KHD A;  1O4X A;  1I6H J;  1SAU A;  2DA4 A;  2WTE A;  2R5Y B;  3TED A;  3I58 A;  4LJZ F;  4NB5 A;  4NC8 A;  1HKQ A;  5FKN A;  1T0F A;  3FXM A;  2JUC A;  2UWM A;  1A31 A;  3E0J B;  5E3N A;  1U5T C;  1VQ6 I;  1LEB A;  3I71 A;  1MNE A;  3LSK A;  1MBK A;  1LFP A;  4WWC A;  2X6Y A;  4HNT A;  1PDN C;  4IQ4 A;  4KIF A;  3GFJ A;  3BR6 A;  3HXL A;  1Y1W J;  1JUP A;  4G6Q A;  1OCR H;  3LA3 A;  3MFK A;  3F23 A;  1H9G A;  2CQX A;  2GIV A;  2QQA A;  2VBZ A;  3EUH C;  2D2W A;  5C3E J;  2E71 A;  2VN2 A;  3MWM A;  4DYC A;  2NVX J;  3L2V A;  2XAG A;  5BPD A;  3TMO A;  4G7O F;  5FGM A;  4XKV A;  4DYQ A;  4CCJ A;  3Q0W A;  3P9T A;  1R7J A;  1K83 J;  1RES A;  4XK4 A;  2KRF A;  3H5R A;  5K7Z A;  2GM4 A;  4I2O A;  5HSZ A;  1IN7 A;  3T8T A;  1SAX A;  4HV6 A;  1AWC A;  5E17 F;  9ANT A;  4BDY A;  3CJN A;  2BE5 F;  2DMP A;  2BW3 A;  1LQ1 A;  5D1R A;  2L01 A;  3CO6 C;  4XN3 A;  3W2W A;  2LG4 A;  3BJ6 A;  1HOM A;  3CC4 I;  5KVR A;  3SZP A;  2ZXI A;  5E8I A;  2KIM A;  2HQ5 A;  2A05 A;  1YI2 I;  4GYG A;  3OMY A;  3FDY A;  1U5T A;  3J7A O;  1LDK B;  2E7W A;  4BS9 A;  4YFN F;  4NQW B;  1S7O A;  5ED4 A;  3J81 Z;  1TWC J;  1SD7 A;  2ZCX A;  5FRO A;  1QBJ A;  4HST A;  1FMV A;  1MJA A;  4EGY A;  2H8W A;  4Q48 A;  1P7J A;  2E2H J;  3BP8 A;  3HB9 A;  1IN8 A;  2F5V A;  1OYW A;  2ZME C;  3ZQ7 A;  3RI4 A;  3IV5 A;  4UUT A;  3EUH A;  2D1H A;  2ZJ2 A;  3H35 A;  1FP2 A;  4IOC F;  2A5Y B;  1D5V A;  5DYM A;  3FBI B;  4BBR J;  3F8C A;  2JA6 J;  2WAE A;  5HS7 A;  3H9G A;  4J19 A;  3CRJ A;  3EUA A;  2IGM A;  2K27 A;  3IH4 A;  1RRJ A;  3B02 A;  1IDY A;  4ON0 A;  4A3J J;  3V7S A;  3FXL A;  3R4K A;  3S2W A;  5CKT A;  1HKT A;  1JJ8 C;  1P4W A;  4HA8 A;  3V7C A;  2EIL H;  2V1D A;  2XSJ C;  3K69 A;  3MCZ A;  4A3C J;  4CYD A;  4D5C A;  3M8J A;  5E8G A;  1XGS A;  3WU2 C;  3TW6 A;  1AKH A;  4CH7 A;  1OR7 C;  2EFN A;  3DEU A;  4DVY P;  3C2G A;  1G6N A;  1XS9 A;  3DXJ F;  3HL2 A;  1BR1 A;  3LNQ A;  3M9A A;  4G6D A;  1U8B A;  1HDP A;  2H27 A;  3O8G A;  2HTS A;  1I3A A;  4OU0 A;  1R1T A;  1DGR M;  3VVZ A;  3BRO A;  2GUH A;  3W6V A;  1T2K A;  4KN4 X;  2L3D A;  2HOA A;  3OV8 A;  2P8T A;  3V8J A;  2WV0 A;  2VOD A;  1EKE A;  1A6Q A;  2KIF A;  1JKQ C;  2IT0 A;  3VOX A;  2GWR A;  4XBF A;  5KAF C;  1HLV A;  4XLN F;  5DCM B;  1R9T J;  4ZJZ A;  1SEU A;  3PFY A;  4BQA A;  2G3B A;  1Y0U A;  2B1E A;  2I8D A;  4AD9 A;  4I09 A;  4BHB A;  2IA0 A;  1K7A A;  2MFZ A;  3LQQ A;  3PQJ A;  3WTX C;  1ZRC A;  1RKW A;  3MAJ A;  3JRH A;  3HPG A;  1EH7 A;  1K78 B;  2P0W A;  2M8E A;  1YIO A;  4M3G A;  1B1B A;  4AVP A;  4YZE A;  1JKP C;  1D8K A;  4YII A;  1QPI A;  2JN6 A;  1TNT A;  3HRT A;  2JRM A;  2WAQ A;  3BC8 A;  3A0H C;  3BOQ A;  3EQL F;  2ME6 A;  1MND A;  1R23 A;  1LUJ B;  2XF7 A;  2KT0 A;  3CMM A;  3TO7 A;  3TGN A;  1MMS A;  3CUQ C;  3IAS 2;  3LMM A;  1D3Y A;  1OR7 A;  3VB2 A;  2HOT A;  4HRI A;  3PL8 A;  1UG2 A;  1MZB A;  1WJE A;  3MMY B;  4FQG A;  4GCV A;  3SZG A;  4E7H A;  3FBN B;  2ETH A;  3JSO A;  2QA4 I;  1Z77 A;  4A3E J;  1IAW A;  2RKH A;  3FHN A;  4PZJ A;  2ZSI B;  1WFX A;  3TW7 A;  2LYC A;  3BZK A;  1XCB A;  4F7Z A;  2UXI A;  2WWY A;  1ZRD A;  2FMY A;  3GZI A;  3ZQF A;  1BA5 A;  3BJA A;  1WHU A;  1ZLJ A;  4RM2 A;  2W00 A;  2XF6 A;  1YOV B;  1X1C A;  4EJO A;  3TBI A;  2XPU A;  4F92 B;  1H0M A;  4A0Z A;  3WG7 H;  1DP7 P;  4IVN A;  4CZZ A;  2PMH A;  3DFG A;  3HG9 A;  1UCR A;  3IHU A;  3IRQ A;  5IP6 A;  3I64 A;  3N4M A;  4ICH A;  2PFV A;  1V5G A;  4E7J A;  1BL0 A;  2FUG 2;  1I50 J;  1MBF A;  4N9I A;  1W0U A;  1B9M A;  2MGQ A;  5L3E A;  1F9N A;  1MMG A;  3RD3 A;  3JCU C;  1Z1D A;  4PJ0 C;  1Y0N A;  1TZL A;  4DBR A;  3AAF A;  3A0B C;  3NPI A;  4ZC3 A;  2O6G E;  2DK5 A;  3F9K A;  3LST A;  3HJE A;  4UY8 I;  4XLC A;  1YX5 A;  2HFH A;  4NQW A;  3HSF A;  4WIB A;  2K3P A;  2R7R A;  2ECB A;  2EV0 A;  3QOE A;  3BG5 A;  1B8I A;  1UST A;  4GO1 A;  1FYK A;  1ETK A;  3FMS A;  1TWH J;  4LK0 F;  3B73 A;  2GXB A;  3L1P A;  2BEO A;  5LHH A;  2QQB A;  1YIT I;  3HOZ J;  4OIP F;  3O3K A;  2XGX A;  3F0C A;  1EV7 A;  3DP7 A;  3A4C A;  2M3A A;  2MH9 A;  3HIM A;  3O60 A;  1ZKG A;  2X1C A;  1GLN A;  1WJ5 A;  2OF7 A;  2R3S A;  1X2N A;  4U88 A;  2IGO A;  4R1H A;  1LKX A;  2FF4 A;  2P5L C;  5E1Z B;  3GTO J;  2BZT A;  4XLA A;  5J6X A;  2IAI A;  2OV7 A;  2UXO A;  2R7O A;  1A35 A;  2FX0 A;  2Y0S A;  2KKO A;  5J8F A;  2K3F A;  1K79 A;  3K2A A;  3HOT A;  2LKS A;  3M4O J;  4N9H A;  2FJ1 A;  5J4Y A;  4WCG A;  4IHW A;  3FXQ A;  5M5Y J;  4BJ6 C;  2F4I A;  4RGS A;  3MEX A;  1ZRE A;  2VJ4 A;  4TV7 A;  2VBW A;  3AG2 H;  4F93 B;  3SQN A;  2AXT C;  2HYF A;  2QEX I;  4L5E A;  3DPJ A;  1T98 A;  2HXO A;  5HLT A;  4MNU A;  4I6Z A;  1XDU A;  1XSX A;  1TBX A;  3V42 A;  3WE2 A;  2IU5 A;  2XUB A;  3HRM A;  4NUB A;  3CCE I;  3L09 A;  4CGZ A;  3FX3 A;  2DFI A;  2W25 A;  3LAP A;  1ETW A;  2NP5 A;  4M3E A;  1WH7 A;  4PUS A;  5B66 C;  1WJF A;  3PIO F;  1FTT A;  1PJR A;  4CCK A;  4BXX J;  3FIS A;  5GPC A;  1XB4 A;  1O3Q A;  2K9M A;  2CW7 A;  1YS6 A;  1N77 A;  1N78 A;  4BL0 B;  2JK3 A;  3K4M A;  3EPZ A;  4F55 A;  2R0Q C;  1W4M A;  4CHU A;  2ZKZ A;  5DCM A;  4A3B J;  2DA3 A;  2G7S A;  3ZN0 A;  4BQQ A;  3ANP A;  3Q0V A;  4IF4 A;  4I0B A;  4M6V A;  4IEJ A;  3AG3 H;  3HUG A;  2XC7 A;  3DBH B;  2EFW A;  2QWT A;  2Q1Z B;  4XQF A;  4E70 A;  3JRC A;  2Z3Y A;  3RPQ A;  3K70 C;  2KHM A;  3CJD A;  2L9N A;  1K78 A;  3PUF A;  5AIP A;  1IW7 F;  3BQY A;  4KIT B;  1SMT A;  2DOA A;  2VKV A;  1RR7 A;  1IXC A;  4RDU A;  4AID A;  4I02 A;  2LRE A;  4NBQ A;  2R7S A;  3H3U A;  1FLI A;  4JBA A;  2EA4 A;  2WUI A;  3K4N A;  5B5E C;  2QZ8 A;  1SFK A;  4GCK A;  2WA0 A;  5F08 A;  2QVO A;  1TQP A;  1X1B A;  2P4W A;  1NG6 A;  1W7P B;  5CPR B;  2EB7 A;  2TRT A;  2IJL A;  2XPW A;  3CES A;  2HKU A;  1P9Q C;  3DBL B;  3ISP A;  4PJM A;  2LY1 A;  1SFE A;  1ZTR A;  2CH0 A;  1E0E A;  2AO9 A;  2RRE A;  2X6X A;  3G73 A;  1BN5 A;  3H36 A;  2G7H A;  4XSZ F;  4M3B A;  4G8X A;  4A0Y A;  1Z0X A;  5EEG A;  4BAY A;  4EM0 B;  5B1B H;  1ITY A;  2OI8 A;  1S8N A;  3WOD F;  4S04 A;  3R6S A;  3NAR A;  4IOA F;  3FXK A;  1RET A;  2LK2 A;  3C3W A;  3DEW A;  2WV1 A;  3D5R C;  3HOV J;  1IRF A;  3NNR A;  1FNN A;  3LWF A;  3GCM A;  3QYE A;  3GX4 X;  1H89 C;  5FHP A;  1Z21 A;  3SDG A;  4YRV A;  3DQV C;  1R5H A;  4ESJ A;  3LA7 A;  1MNM C;  2Q0O A;  3BR0 A;  2EBI A;  2A69 F;  2CG4 A;  2X4H A;  2VL8 A;  2N8G A;  5DM6 F;  1XSD A;  1UI5 A;  2DFE A;  3ZMS A;  1VQ7 I;  1X1D A;  1MMD A;  2A6H F;  3VYR B;  3GFM A;  3ZMD A;  2YU9 J;  4KMF A;  1HA8 A;  4M3D A;  5E3O A;  4PGH A;  3E6B A;  4CCL A;  2KP6 A;  3PFI A;  3ZMZ A;  1SAN A;  4J00 A;  4I7H A;  2BXY A;  4IKF A;  2FU4 A;  3GVA A;  4BE1 A;  3HTA A;  4ENN A;  2M30 A;  2GA2 A;  3G1M A;  3DLL F;  2L9V A;  1VQ9 I;  2OC6 A;  2F4O B;  2M0M A;  4ITV A;  2V4J C;  4WF2 A;  2CQ7 A;  2FQ3 A;  3KLO A;  1IGN A;  2NVQ J;  3VVX A;  4R8H A;  1SFU A;  2STW A;  2VPR A;  3LJL A;  5E3M A;  2KDZ A;  3A1Y A;  3FK6 A;  1E3H A;  4OIR F;  4E7I A;  2BVM A;  3I54 A;  3P9C A;  2FNP A;  4AVZ A;  1FJL A;  2QIB A;  3EUP A;  1HCR A;  3FXR A;  1XMX A;  3B6A A;  3CC7 I;  2EZH A;  3OS0 A;  2P6S A;  3CLQ A;  3SYT A;  5IOZ A;  1UHW A;  1LNW A;  2RAE A;  4Y17 A;  4YEL A;  4AWX B;  4RGR A;  2R7V A;  5K7F A;  3P5J A;  3LOC A;  2V26 A;  3OL4 A;  4DZJ A;  1VQO I;  5GP9 A;  2NRA C;  3GF2 A;  1RPW A;  1U3E M;  3KEO A;  4CIC A;  4AYB A;  3JRF A;  4M72 A;  3GFL A;  2CQN A;  4D0P A;  2UUZ A;  2K40 A;  1GV2 A;  2XDN A;  2ECC A;  3JRA A;  1PUE E;  2COB A;  2AQF A;  3U1K A;  3FMR A;  3OSF A;  2V6E A;  1D0X A;  2LP0 A;  1D0Y A;  2OCC H;  4XLE A;  3WGH A;  3AKZ A;  4HW0 A;  2WAF A;  4IHX A;  3V78 A;  3IWZ A;  2PZ9 A;  1Y6I A;  4I76 A;  4I0A A;  4BXF A;  3I3L A;  3WE3 A;  4EJT A;  1XG1 A;  3NRV A;  2Y9Z A;  4L0Y B;  2GIZ A;  3O2P E;  3RIR A;  1YG2 A;  3SWH A;  2CUJ A;  3B6C A;  4KIG A;  2R7U A;  1IDZ A;  3BG3 A;  2Z33 A;  5J1Y A;  3RPU A;  5TIS C;  4B8X A;  5EGO B;  2VQC A;  4FCY A;  1JTX A;  2WAD A;  3PUB A;  3RKX A;  1Z3X A;  4BY1 J;  3KPH A;  3KX2 A;  1EH8 A;  4IRV A;  3RYR A;  4KDP A;  3ZQI A;  2ZBK A;  4XSX F;  4LIV A;  1QVU A;  2CWE A;  4WXH A;  4X1E A;  5IYD J;  3CF2 A;  4JX5 A;  2OCE A;  1NH3 A;  4M3F A;  5ICE A;  2FXA A;  4GFL A;  2LSO A;  1LDJ A;  5DV5 A;  3BR2 A;  3SXY A;  1FOK A;  3KEY A;  3D5S C;  4BY7 J;  3ZOB A;  3LA2 A;  2HKO A;  3QRF F;  1F4K A;  5E20 A;  4EAT A;  3HOY J;  4A12 A;  3OYL A;  4L62 A;  1LFB A;  2VB6 A;  5CXI A;  1QHH D;  2V9K A;  4P1W A;  3GXO A;  3TDU C;  3JRD A;  1BJA A;  2HQA A;  4DNC A;  4LD5 A;  2PMZ A;  2E1N A;  3ZCO A;  1R36 A;  4II3 A;  4QIW N;  4IJA A;  4AM3 A;  2VT2 A;  1QZZ A;  1NK2 P;  2IS2 A;  3HM5 A;  1MBG A;  4UUV A;  1LVA A;  4MIM A;  1U78 A;  5H6R A;  1HW5 A;  2PEX A;  3OYE A;  2R7W A;  2YSR A;  2IGK A;  3HHG A;  4HX7 A;  1J7K A;  1YRN B;  3VTI A;  4UVB A;  4NC6 A;  4KIC A;  4UXN A;  5D5X B;  2VLA A;  5F1R A;  5HLG A;  5C4X J;  2OAZ A;  4BDZ A;  4RAZ A;  3WGI A;  2MW8 A;  2Y75 A;  4K2E A;  4EV0 A;  1Z7L A;  2X85 A;  4MTE A;  4B1R A;  3PO2 J;  2FBK A;  4EEF G;  5GTH C;  4XID A;  2RAS A;  5FKK A;  2XB0 X;  2DDA A;  4JP0 A;  2LBF A;  3KP7 A;  1X3W B;  1Z05 A;  2F07 A;  3OR2 C;  3AG4 H;  1KQ9 A;  1N25 A;  2EJR A;  2OJE D;  4RAY A;  3PO3 J;  1D0Z A;  3BCA A;  1JHF A;  1T08 B;  4FT8 A;  2DBB A;  1FOY A;  1ZGW A;  3Q5F A;  3X2Q H;  2ZFU A;  2K02 A;  1S7E A;  2FD5 A;  4A3L J;  3NS4 A;  3V8L A;  3GTQ J;  2G7L A;  2HZD A;  1ETQ A;  4KUM A;  3Q9V A;  2JT1 A;  3GLX A;  1E3O C;  4EGZ A;  3S3N A;  2VXD A;  1RUN A;  4XLF A;  4P5O A;  5JLX A;  1TWG J;  2WB1 N;  3F8B A;  2DG8 A;  2HPM A;  3VDX A;  2DFF A;  1EF4 A;  3ZQH A;  3ZMU A;  2VBX A;  3A01 A;  2FJI 1;  3QPT A;  3VUQ A;  4D9J A;  4KA4 A;  2L0K A;  3D1N I;  3N97 A;  2DQR A;  3U1D A;  1DDN A;  4PSX A;  4OIQ F;  1FC3 A;  3CJQ B;  3L2U A;  2RHA A;  2EFQ A;  3HHH A;  2IPQ X;  4HV5 A;  1G4D A;  3VYU B;  3ZR8 X;  1K6O A;  4S0H B;  2RNG A;  1MW7 A;  1H9T A;  4XM3 A;  3CJT B;  2PX9 A;  4WK8 F;  1ZEL A;  2M4G A;  2YU3 A;  5FD6 A;  3VW0 A;  2HKX A;  3TP3 A;  4NDL A;  5JLW A;  1WPK A;  3QYB A;  3I55 I;  3O8H A;  4M9Z A;  3OYM A;  2P5V A;  2QM3 A;  1FWZ A;  5A2Q Z;  4ETS A;  1MGT A;  3CCU I;  1X19 A;  2DA6 A;  1MD0 A;  3K4K A;  2HYJ A;  1A5J A;  3FRQ A;  3FWE A;  3H92 A;  4IO9 F;  2HYG D;  5F0F A;  1KA8 A;  5EJC A;  2FEZ A;  1QO0 D;  3SHF A;  3VW1 A;  2H94 A;  4U0V A;  4BE2 A;  3A2K A;  5EG0 B;  4PJN A;  5EEH A;  1POG A;  1QQI A;  2CW0 F;  4BXU A;  1RNL A;  5M5W J;  1HDD C;  4V2G A;  3L9F A;  5M3F J;  3HTJ A;  1UMQ A;  5JR3 A;  2FE3 A;  1Y8R B;  1T6S A;  1BJZ A;  2IW5 A;  1WKM A;  5JVT A;  3AL0 B;  2ADU A;  2LOO A;  5L3B A;  5EGO A;  1LEA A;  4CYC A;  1HC8 A;  3EGQ A;  3BG7 A;  4JQF A;  3BLY A;  3ERM A;  3RKQ A;  2DTZ A;  3HOU J;  4HKU A;  3MN2 A;  2ZCW A;  3E7L A;  3GTL J;  2RGV A;  2LLK A;  4PJL A;  4D7N A;  2EIN H;  1IC8 A;  1SD5 A;  5DEQ A;  2NNN A;  3HKZ N;  2BYV E;  1KU3 A;  2J5O A;  5JHF A;  3L2Q A;  4C3J J;  1TL8 A;  2VOP A;  4XOP A;  5LRS A;  3NRG A;  2HNH A;  1HBX G;  4XR6 A;  3K1P A;  3ECH A;  1ACI A;  3G7R A;  1RIO H;  2TDX A;  4LG0 B;  2JWT A;  1SVM A;  2L4M A;  2OTJ I;  1BC8 C;  3K10 A;  3J7Z I;  3V4G A;  1B4A A;  3RQ4 A;  3LWJ A;  4HF2 A;  2X6O A;  4II2 A;  3MKW B;  4ENM A;  2KJC A;  5JFR A;  3U2R A;  1YE9 A;  1ZGJ A;  2E35 A;  1G8X A;  2DPD A;  3QBM A;  3I4M J;  3SEZ A;  1RC9 A;  2B63 J;  3GWZ A;  4G7Z F;  4BEH A;  4ZYG A;  1W0T A;  1V5F A;  4DW6 A;  1YO5 C;  1APL C;  3CCQ I;  4YIF A;  1QHG A;  4U7B A;  2ESH A;  2LF7 A;  4A2U A;  2GXA A;  3Q9S A;  2X9D A;  1NK3 P;  1Z7U A;  3JTG A;  4FTH A;  4W1U A;  3H9Q A;  2WY7 Q;  1T39 A;  2IBD A;  1OYI A;  5B1A H;  1X4P A;  5J1U A;  1XMK A;  2XVC A;  5KCM A;  3WTV C;  2VQG A;  3TQN A;  4ZDL A;  4L0Z B;  1UFM A;  2LY9 A;  1QRY A;  2Q2E B;  3S3O A;  3GTJ J;  2AS5 F;  5AQC A;  2HQN A;  4JX4 A;  3ZQG A;  4XKW A;  3K1M A;  4HX8 A;  4RM3 A;  4S05 A;  1HW2 A;  1WGX A;  2QKL B;  1Z6T A;  4EM2 A;  3KP4 A;  1KU9 A;  3DLA A;  2BVL A;  3BG9 A;  4MO7 A;  4A3D J;  3M07 A;  3MKY B;  3L00 A;  2X1D A;  4GCT A;  3HOW J;  1FMW A;  1BI1 A;  1JT6 A;  2VJJ A;  2KRC A;  3CMY A;  2D5V A;  1WSU A;  4OIN F;  2JA2 A;  3E1S A;  3G3Z A;  2CFO A;  4U0W A;  5IOY A;  3BJB A;  2B7E A;  3I4N J;  2K9S A;  5AON A;  1QNT A;  3S93 A;  3OYD A;  1JI8 A;  4E7Z A;  1VQ5 I;  3KLN A;  3HPH A;  3WTS C;  4Y33 A;  5J4V A;  3JRG A;  4LB5 A;  3S16 J;  5LGU A;  3GZ6 A;  2I10 A;  5H9T A;  1G3W A;  2COM A;  3WGG A;  3BHQ A;  1E17 A;  2YX7 A;  2DG7 A;  4UHT A;  1HW1 A;  1TT0 A;  2DDB A;  3L2W A;  2R7D A;  3F8N A;  1BI0 A;  3AL0 C;  4ENK A;  1SD4 A;  3IWF A;  1SVO A;  3TL4 X;  3UKG A;  3H3V K;  4ZZD A;  2MBF A;  3S15 J;  1FTZ A;  3BTJ A;  1F43 A;  4KT6 A;  1Y39 A;  3CJR B;  4A5M A;  2DQL A;  3RJP A;  2IS6 A;  2L54 A;  2V1X A;  3I53 A;  1R58 A;  1ON2 A;  1O3S A;  1BW6 A;  1IG7 A;  2YVX A;  3V6G A;  3G1L A;  5L3C A;  4DZP A;  3UR3 C;  1XGN A;  1REP C;  5IPA A;  4C2M A;  2R5Y A;  1YQA A;  4A3M J;  1OPC A;  3HTH A;  1VQK I;  3QPS A;  4RB0 A;  5CVV A;  1ZG1 A;  4C30 A;  1IXS B;  3VOE A;  4FE4 A;  4RMN A;  2A6T A;  3V7R A;  1WQ2 A;  1VND A;  2KPM A;  4CCN A;  3BNI A;  3ASO H;  4XKC A;  1VQ4 I;  2D1V A;  2QKO A;  4KWA A;  1NG7 A;  3IH2 A;  4U9L A;  5FLX K;  2CRG A;  4Q47 A;  4HEA 2;  4OAZ A;  2LKP A;  4RS8 A;  2DT7 B;  1LFU P;  4GXO A;  5EG0 A;  3IL2 A;  4L5I A;  5DUK A;  1V54 H;  4ZDO A;  2D45 A;  5J40 A;  2XRN A;  2GEN A;  1DPU A;  2AHQ A;  4OAY A;  2YPR A;  4KNY A;  3FM5 A;  4WXD A;  3CD6 I;  1ORK A;  2FML A;  5DD4 A;  3CMA I;  4L9J A;  4AU7 A;  1KYZ A;  1XTA A;  2Z99 A;  3HTU A;  3WU0 A;  4B47 A;  3OYI A;  3CCS I;  2HOS A;  2VIX A;  1U8R A;  4MFD A;  3D5L A;  3CUO A;  2XAQ A;  3QQA A;  3ZN1 A;  5BMZ A;  1ZR2 A;  4FX0 A;  3T8R A;  4XRM A;  3ZXS A;  3RZD J;  1MDM B;  1VFC A;  4KIS A;  1FOW A;  2FSW A;  2MH2 A;  3DU6 A;  2LD5 A;  1S6L A;  4ENJ A;  2HXI A;  2W4S A;  4XOT A;  1BOA A;  2VE8 A;  1IN6 A;  1U2W A;  2L5Q A;  5K7H A;  3CF5 F;  5GPA A;  1D1B A;  5K5R A;  1MMN A;  2M0C A;  5LGN A;  1ZR4 A;  1CGP A;  4HQE A;  3HIF A;  2JSC A;  2QEN A;  3WG9 A;  2LDU A;  4A3F J;  1TP4 A;  1I1S A;  2NS0 A;  2FA5 A;  2G7U A;  2GLO A;  4PDK A;  2R4G A;  3JW4 A;  2PFB A;  5F0H A;  1GVD A;  3W6J B;  3IC7 A;  3W2A A;  3BR1 A;  3LSM A;  4UV8 A;  2DK8 A;  5HLH A;  1IXR C;  4O6J A;  5CLS A;  2UXH A;  2OPT A;  3VYT B;  1U0J A;  1VF9 A;  2BY1 A;  2F5C A;  2Q2E A;  4P55 A;  3LSR A;  1E2X A;  1X3Z B;  3KNW A;  3K9T A;  3I56 I;  3CP2 A;  1BM9 A;  2OA4 A;  5D8K B;  3K4L A;  5FKL A;  1ETY A;  3G6E I;  2UXU A;  3G2B A;  1V3F A;  4QTR A;  3QPH A;  1Z91 A;  2H6C A;  2M4K A;  1BR4 A;  3LSI A;  3GEZ A;  1OCC H;  3RCO A;  3GW2 A;  4CA0 A;  2CUZ A;  1DUX C;  2CW8 A;  1VZ0 A;  3GBG A;  5C44 J;  3HBL A;  1FEX A;  1WZ2 A;  1B72 B;  2NX4 A;  2EIM H;  2PMU A;  2RDP A;  2DJI A;  4MEY F;  1LJ9 A;  1TLH B;  4FHT A;  2Y31 A;  2XF5 A;  3CCR I;  3BJO A;  1J59 A;  3AFH A;  1C0W A;  3K70 D;  4XL9 A;  1YHQ I;  4FX4 A;  4LLN A;  2P5K A;  4IXA A;  5IY5 H;  1J9I A;  4NHJ A;  2VXZ A;  3S1R J;  2ISZ A;  3FK7 A;  4IX7 A;  3F72 A;  5FKO A;  3EUK L;  3KET A;  1ZGA A;  4M9X A;  4QSH A;  2W57 A;  1XPX A;  2VJ5 A;  4BQN A;  1K61 A;  3CC2 I;  4KT5 C;  3I4P A;  4QLC U;  3WTU C;  3U21 A;  2F5E A;  4L5J A;  2O7O A;  1JTY A;  2VQH A;  2JTV A;  4NNJ A;  1W36 C;  2OER A;  4G6T B;  2VQL A;  3M3Y J;  5CVU A;  3WHC A;  2GOX B;  2R92 J;  1FYL A;  4HX4 A;  4E4H A;  2XV4 S;  3EDP A;  1FSH A;  3G56 A;  3DV8 A;  2HI3 A;  2QQ9 A;  5EYR A;  4HDV A;  1TW3 A;  1Z67 A;  2H6B A;  5HS8 A;  2RQQ A;  2R7Q A;  3ZP5 A;  3CCY A;  1IV8 A;  5J3L A;  4IHT A;  1UHM A;  2O8X A;  4A0X A;  2H1L A;  5DUI A;  2JA5 J;  4RAF A;  4XLH A;  1OFC X;  2Y9Y A;  1DQU A;  5D8L B;  3LFU A;  4PJJ A;  3TOA A;  3WTZ A;  2LF8 A;  4RGX A;  4C9Y A;  1CQT A;  3DKY A;  1JKO C;  2K5C A;  4CCO A;  5D4R A;  4O3M A;  3A02 A;  1ZYR F;  3BR3 A;  3KZZ A;  5FRM A;  2DA1 A;  1WH5 A;  5GTI C;  2DMN A;  5H6Q A;  1B9N A;  5D18 A;  2WAQ N;  3N05 A;  2V1U A;  2PG4 A;  2H1K A;  2RQP A;  2B0L A;  3RKY A;  2XKP A;  5DS9 A;  3L2C A;  2ZSH B;  5FLX Z;  2ZXW H;  5FKM A;  2E1M B;  2PN6 A;  5IT9 K;  4HPQ A;  5J1R A;  3WHB A;  2MC3 A;  4KN7 X;  4B48 A;  3JRB A;  3HTS B;  2FOW A;  5LRR A;  3NEU A;  5F27 A;  3BQZ A;  2ZNZ A;  1OLT A;  3OS2 A;  2JPC A;  1ZN2 A;  2KJB A;  3RPU D;  2GOM A;  3GYH X;  3W6K B;  1KQ0 A;  3VVY A;  4M6Y A;  1R71 A;  2HDW A;  2ZB9 A;  5HOD A;  4HBL A;  2P6T A;  3DEE A;  4LLG F;  4MXM A;  1R6R A;  3M1C A;  3H1C A;  1IRZ A;  1ZK8 A;  1ZH5 A;  1GVJ A;  4RB3 C;  4MK6 A;  2E60 A;  5D4S A;  2XHK A;  4RLF A;  2QGU A;  2JJ7 A;  2PQ8 A;  4IHV A;  4Z6Y A;  3C18 A;  3M8F A;  2L02 A;  3FIW A;  3OYC A;  2ZFW A;  1OIS A;  3ZQL A;  4ASN A;  1JJ6 C;  2CGP A;  3S17 J;  3ESW B;  4HG2 A;  4KJZ A;  4OWR B;  1KQ8 A;  3R0A A;  2OUM A;  3CDH A;  1I1G A;  5ICF A;  2X48 A;  2DOF A;  4LOC A;  4A69 C;  5EDN A;  3P9I A;  2F5F A;  1AA7 A;  2V57 A;  2RV8 A;  1QU3 A;  5CJ9 A;  4G9Y A;  4X6A J;  4IRG A;  3CWR A;  1K6Y A;  1TQM A;  4FIS A;  2HTJ A;  3VSK A;  2DN0 A;  4LGW A;  3HDD A;  1HQC A;  2NNY A;  3EYY A;  2DCE A;  2EH3 A;  1DU6 A;  3H9J A;  3E6D A;  4DIQ A;  1P4X A;  1YW7 A;  2F6C A;  2DPU A;  2BY0 A;  1ZLK A;  5FGL A;  4YFX F;  2O7T A;  2EZI A;  1G2H A;  4GCL A;  3IKV A;  3S3M A;  5FFX A;  2DOE A;  4MFE A;  2EV5 A;  5LHG A;  2EQR A;  1D5Y A;  5DTD A;  5E1W A;  1SD6 A;  4HOB A;  4W97 A;  2YR2 A;  2HYT A;  3KKD A;  5EFY A;  2CUF A;  4BNC A;  3DCF A;  1F36 A;  1B72 A;  4UUS B;  4YIR X;  1ETO A;  2AXL A;  1N75 A;  5BS6 A;  3PM1 A;  3E97 A;  4I01 A;  4KYW A;  1AOY A;  2OBP A;  3CP8 A;  3QYF A;  1PYV A;  3H5A A;  2P7V B;  2WY8 Q;  3RYP A;  2PBI A;  5J47 A;  3TO9 A;  3QPL A;  2ZOZ A;  3U9G A;  5BNG A;  2E1M C;  3KYL A;  1Z3Y A;  2HDD A;  5ERI A;  1R4N B;  5LHI A;  3DPT A;  2A3S A;  2Y48 A;  1YW9 A;  2A6E F;  1D1C A;  1TTY A;  1EA3 A;  4BJ5 C;  1GDT A;  4B44 A;  3F22 A;  4MQ9 F;  2DXI A;  3ANG A;  4Y3O A;  4HNV A;  1X3U A;  4AF5 A;  5TRD A;  1I3Q J;  2BBY A;  1M1E B;  3CME I;  2VKH A;  5ICC A;  5KNL A;  4UNO A;  1DGW Y;  2XGE A;  1ENH A;  3MD2 A;  3WU1 B;  4KFC A;  5FO5 A;  2WGB A;  4L9V A;  4BGD A;  5LFA A;  3VYS B;  1MJB A;  1EH6 A;  5HOO A;  4B3A A;  3DKW A;  2XAH A;  2AQE A;  3K7A J;  3I59 B;  4DBQ A;  1DU0 A;  4RA2 A;  3PJR A;  3OYA A;  1W7P A;  1IZ1 A;  1YJ9 I;  3SZT A;  3T5X A;  1WJB A;  1GV5 A;  3RZO J;  1FIP A;  2M8G X;  3ZRG A;  4AIJ A;  1T38 A;  3DKX A;  3OSG A;  1SGM A;  4C3H J;  1P6R A;  2FBQ A;  2KRH A;  2DA5 A;  1CF7 B;  2UXX A;  2RVC A;  4RBO A;  2CS3 A;  2YX4 A;  1U5T B;  1BW5 A;  2ID6 A;  3ABM H;  4WX9 A;  4Y13 A;  3C07 A;  3R61 A;  1TQI A;  1J2X A;  3PNV A;  3PQK A;  1S9H A;  5GAG J;  1G3Y A;  3KEQ A;  4L9T A;  1T8I A;  2JMW A;  3PAS A;  5M5X J;  2C6Y A;  3HE0 A;  3Q3S A;  1R1U A;  2B3W A;  3VEP A;  2H09 A;  1VQP I;  2ZC2 A;  4RGU A;  2QUF A;  3JSP A;  5IT9 Z;  2MD0 A;  3BDD A;  3F6V A;  2KQR A;  2VJI A;  1G3S A;  4ANJ A;  4CZC A;  1QZE A;  1SVL A;  2KIU A;  3BWG A;  2ZY9 A;  2DMT A;  3FKJ A;  2CV1 A;  1FT9 A;  1R49 A;  4HF1 A;  1FBU A;  2EFP A;  2MG4 A;  3MZY A;  3OYF A;  1WJA A;  3KYC B;  5DD8 A;  2KLO A;  2RN7 A;  4RB1 A;  1T56 A;  5F04 A;  2DMU A;  4OD5 A;  3H0G J;  4P9F A;  1TWF J;  2W1O A;  2G0E A;  3BZC A;  4A3K J;  2VBY A;  3QAH A;  1OCZ H;  1LE8 B;  1IRG A;  1VQL I;  1VI0 A;  4PXI A;  1ZAR A;  2L7M P;  1WJD A;  1IUY A;  3NWS A;  3RH2 A;  4HSR A;  3AQS A;  2E2I J;  4BBS J;  4OOI A;  5IP7 J;  1GT0 C;  2CFX A;  4NN1 A;  1P7I A;  1U9N A;  1STZ A;  2EA2 A;  1HF0 A;  3K4C A;  5L3D A;  3ZMV A;  2K86 A;  2DW4 A;  2NS8 A;  1RR8 C;  1WI9 A;  4U0Y A;  3GFI A;  2QBY B;  3BCG A;  2NAZ A;  2OQR A;  3DBR B;  1ZHF A;  3RQI A;  5IT3 A;  3KP3 A;  2UV1 A;  3H5N A;  2A61 A;  3NI7 A;  2HPI A;  1R22 A;  4PK4 A;  4GYI A;  5ILV A;  1OCT C;  3BPV A;  1IN5 A;  4LIU A;  1S3J A;  2ZME B;  4Y4R A;  5F6F A;  4MTD A;  3GZN B;  4G94 A;  3OYJ A;  2HOE A;  3DTK A;  1J75 A;  3BZ6 A;  3KIO A;  3C7J A;  2ZNY A;  2QQ8 A;  2EFO A;  3PSI A;  2XAF A;  2LY2 A;  4O5V A;  2NOG A;  1O3R A;  3ZPL A;  3KZY A;  2L7F P;  5AIQ A;  2CJJ A;  2LMD A;  5GAH J;  1AHD P;  2Z2S B;  4PSW A;  1GHC A;  3HGG A;  1MIJ A;  3GTM J;  2VC1 A;  1TNS A;  2Q8K A;  2GZW A;  3ZMT A;  4UUS A;  1BI3 A;  4RLQ A;  5FLM J;  2DAO A;  3CCL I;  1YS7 A;  3EET A;  4F52 A;  4AYB N;  1HSJ A;  2KZG A;  4ZYE A;  3J7Y J;  4EVI A;  5EZG A;  2W24 A;  1ON1 A;  1OCP A;  2Z1D A;  2CV2 A;  4PCQ A;  4P9U A;  5HNF A;  4BUP A;  3LFK A;  1W5T A;  2EWN A;  4AC0 A;  5ILU A;  1I6X A;  2ZJP F;  2X6W A;  3BY6 A;  1VQN I;  5HDN A;  1YTY A;  3PNT A;  2IS1 A;  3HZJ A;  1S5L C;  1S72 I;  5B3S H;  4YG2 F;  4U7D A;  1VQ8 I;  3TOB A;  2LH9 A;  1EJ9 A;  1ZRF A;  2DU9 A;  3F8M A;  4DJA A;  4UB6 C;  1PUF B;  5IYC J;  2V7F A;  1USS A;  2O9L A;  1IN4 A;  1MBE A;  4ESB A;  3L7W A;  5GAD J;  2L9R A;  4JNN A;  2VOO A;  2QF7 A;  2R5Z B;  3IP4 B;  1LDD A;  1BIA A;  1Q1H A;  2Y0M A;  3S8P A;  4D5F A;  3HYI A;  4U9N A;  3S1M J;  3GME A;  5HAW A;  3QP6 A;  5IP9 J;  2JSP A;  2HEO A;  3LSH A;  5GAE J;  4KIB A;  2XPV A;  4BE0 A;  3I59 A;  3ULQ B;  1W1W E;  2O5R A;  2VI6 A;  4C2T A;  4LIT A;  4UB8 C;  4HNU A;  4IHY A;  1O7F A;  5H20 A;  3H0D A;  2LC2 A;  3VFZ A;  3KP6 A;  1HKS A;  2RC4 A;  3F8F A;  1X1A A;  4GGG A;  5HDK A;  4HLY A;  3HRS A;  2QCO A;  5H2F C;  4JKZ A;  1RI7 A;  4EQQ A;  1MBJ A;  2KZV A;  3CO7 C;  1CF7 A;  2MD5 A;  4UVC A;  5K5O A;  3OOU A;  1YRN A;  5D6E A;  3CUQ B;  1R5G A;  2JVH A;  3OIP A;  5CQE A;  4ZTJ A;  1PP7 U;  2PMZ N;  3T0Y A;  2R7T A;  2NXN B;  3ELK A;  3T6N A;  1OQY A;  1V5E A;  1OCO H;  1XMA A;  4XLP F;  2A07 F;  2REK A;  2ZO4 A;  2UXP A;  1B8I B;  2GAU A;  2FQ4 A;  2MYS A;  2EV6 A;  4XRF A;  1KON A;  3HGY A;  2EPF A;  4CO8 A;  4HYE A;  3OYB A;  5D19 A;  2DI3 A;  2TCT A;  2E36 A;  1LVK A;  3K6G A;  2XAS A;  4ME9 A;  3SJM A;  5F64 A;  1W5C C;  3K4B A;  2PJP A;  1KZH A;  5EZH A;  1J0R A;  2V6C A;  2O3F A;  2FOK A;  1TT5 B;  2XRL A;  3VOD A;  3B81 A;  1B59 A;  1OMI A;  3BR5 A;  4JYK A;  1MKM A;  2NOJ B;  3ABL H;  4UVA A;  4A3I J;  3JAM K;  3QKX A;  1LE8 A;  1XGO A;  3W2V A;  3GTK J;  1BBY A;  1QPM A;  4G7H F;  4EJW A;  1A6I A;  3UNG C;  6PAX A;  2MC4 A;  3ABT A;  2QLZ A;  1TW2 A;  3LL7 A;  1MSF C;  2ME0 A;  1RKT A;  4M71 A;  2M7B A;  1ODD A;  2YVH A;  1RUO A;  3ZQC A;  2YS9 A;  3OR1 C;  5LBQ A;  3C2B A;  2QBY A;  3BG6 A;  2YUS A;  2KDO A;  3HEF A;  2E19 A;  2IRF G;  3MQ0 A;  5E18 F;  3G1O A;  2W7N A;  2V1N A;  1ZG3 A;  4AUX A;  5JVG F;  3MZH A;  3COA C;  1O57 A;  2F4M B;  2VPL A;  2E7X A;  2GA1 A;  2QSH X;  2ZME A;  4J01 A;  4E7S A;  2VKE A;  1T33 A;  2XIG A;  4LB6 B;  1SMY F;  4QPQ A;  2BGC A;  3KZI C;  2Y30 A;  4U87 A;  3KP5 A;  2HVR A;  3BTC A;  2W85 A;  3BT9 A;  4HQM A;  3IUO A;  2MLK A;  2I5U A;  3K0L A;  4ESF A;  5JHU A;  4Y52 J;  3IH3 A;  5LGT A;  3HUG B;  1BI2 A;  2ZCM A;  1T95 A;  2OZU A;  4V2F A;  2VUM J;  2LKX A;  4CGR A;  4NC7 A;  3SFZ A;  3NXC A;  4EMS A;  4FE7 A;  2CYY A;  4RB2 C;  2CV0 A;  1FP1 D;  3G4S I;  1VQM I;  3Q0U A;  4DQ2 A;  1XX5 A;  1F5T A;  2CQQ A;  4N4N B;  4RAG A; 
#chains in the Genus database with same CATH homology
 4M3F A;  1CQT A;  4GFB A;  4GFL A;  1JKO C;  3BR2 A;  4DYQ A;  3Q0W A;  3A02 A;  4BY7 J;  3ZOB A;  3BR3 A;  3P9T A;  2R7Z J;  2DA1 A;  1WH5 A;  2H8R A;  2DMN A;  3HOY J;  5D18 A;  2WAQ N;  4L62 A;  1LFB A;  1K83 J;  5CXI A;  3GTP J;  1RES A;  4XK4 A;  2GM4 A;  5K7Z A;  3IUV A;  2H1K A;  5HSZ A;  3KZ9 A;  5DS9 A;  3JRD A;  1PUF A;  9ANT A;  5CXG A;  5FKM A;  2Q24 A;  1WCM J;  2DMP A;  5D1R A;  2ZCN A;  1AU7 A;  4C2M J;  5J1R A;  3WHB A;  1HOM A;  3JRB A;  4QIW N;  2R5Z A;  5FLV A;  1NK2 P;  3HM5 A;  1MBG A;  4NEL A;  4MIM A;  1U78 A;  2HQ5 A;  3BQZ A;  5F27 A;  2NVT J;  1YRN B;  2W53 A;  3VVY A;  1TWC J;  2DA7 A;  2ZB9 A;  2ZCX A;  3AQT A;  5C4X J;  5HOD A;  2NS7 A;  2GBY A;  2E2H J;  1P7J A;  4MXM A;  2MW8 A;  3HB9 A;  2IEK A;  1IRZ A;  1ZK8 A;  4MK6 A;  3IV5 A;  4UUT A;  4B1R A;  3PO2 J;  2JJ7 A;  4EEF G;  2E2J J;  4XID A;  2RAS A;  5FKK A;  2XB0 X;  4IHV A;  4JL3 A;  4JP0 A;  4BBR J;  2JA6 J;  1UHS A;  2ELK A;  2LVS A;  2F07 A;  3FIW A;  4J19 A;  3PO3 J;  3ZQL A;  1JJ6 C;  3S17 J;  3CRJ A;  1ZGW A;  3IH4 A;  2X48 A;  3ON2 A;  4LOC A;  1IDY A;  5IYB J;  4A3J J;  4A69 C;  5EDN A;  2V57 A;  1JJ8 C;  4G12 A;  1S7E A;  2FD5 A;  2DA2 A;  2EZL A;  4A3C J;  4A3L J;  4X6A J;  3CWR A;  3GTQ J;  4D5C A;  2G7L A;  2E1O A;  3CDL A;  4FIS A;  1MSE C;  3TW6 A;  1ETQ A;  1AKH A;  1WI3 A;  1JKR C;  2DN0 A;  2CUE A;  1E3O C;  3TP0 A;  3HDD A;  1XS9 A;  3S1N J;  3S5R A;  3LNQ A;  2EH3 A;  1DU6 A;  1U8B A;  1HDP A;  3O8G A;  1QVT A;  5JLX A;  1TWG J;  2WB1 N;  2DG8 A;  3VVZ A;  1EF4 A;  3ZQH A;  3A01 A;  2CU7 A;  3LSJ A;  2GUH A;  3VUQ A;  5FGL A;  2O7T A;  3W6V A;  2EZI A;  1G2H A;  5EEA A;  4GCL A;  2L0K A;  3D1N I;  4MFE A;  2HOA A;  2EQR A;  1D5Y A;  1IV6 A;  3CQZ J;  2RHA A;  5DTD A;  4W97 A;  2HYT A;  5EFY A;  3KKD A;  2CUF A;  1JKQ C;  3DCF A;  1F36 A;  1B72 A;  4S0H B;  3VOX A;  4UUS B;  1ETO A;  5C4Y A;  1HLV A;  3PM1 A;  3JR9 A;  1R9T J;  3VW0 A;  3TP3 A;  4NDL A;  5JLW A;  1WPK A;  2ID3 A;  3O8H A;  2G3B A;  2NP3 A;  3QPL A;  2ZOZ A;  2QTQ A;  3FRQ A;  2DA6 A;  5BNG A;  1RKW A;  2HYJ A;  3JRH A;  2HDD A;  1A5J A;  1UI6 A;  4M3G A;  1GDT A;  4YZE A;  5F0F A;  1JKP C;  1QPI A;  4D7M A;  2JN6 A;  2ME6 A;  4DYR A;  5CW8 A;  1JGG A;  3VW1 A;  2KT0 A;  1ETV A;  2K9N A;  5F1J A;  3ANG A;  5EG0 B;  4HNV A;  1POG A;  5M5W J;  4MLO A;  4BKX A;  1I3Q J;  1HDD C;  2HOT A;  4V2G A;  3HTJ A;  5M3F J;  4AF5 A;  1UG2 A;  1UMQ A;  3S2H J;  1BJZ A;  4GFK A;  5EGO A;  3EGQ A;  4CYC A;  1Z77 A;  2XGC A;  2XGE A;  1ENH A;  4A3E J;  3HOU J;  3RKQ A;  2DTZ A;  3JRE A;  4HKU A;  3MN2 A;  2WGB A;  3TW7 A;  2K9Q A;  3E7L A;  3GTL J;  2UXI A;  2LLK A;  4B3A A;  4D7N A;  3S1Q J;  3GZI A;  1H88 C;  3ZQF A;  1BA5 A;  1IC8 A;  3K7A J;  3LSG A;  3S2D J;  1DU0 A;  3HKZ N;  3GEU A;  4C3J J;  3NRG A;  2XPU A;  1GV5 A;  3RZO J;  1FIP A;  3G7R A;  2M8G X;  5K58 A;  3JSJ A;  4ACI A;  2DJN A;  1JUM A;  3OSG A;  1SGM A;  2Y2Z A;  4C3H J;  4XRS A;  2JWT A;  2FBQ A;  2DA5 A;  5IP6 A;  3LSP A;  2P81 A;  4ICH A;  4RBO A;  1BW5 A;  1BL0 A;  2ID6 A;  3LWJ A;  2XGD A;  2X6O A;  1I50 J;  1MBF A;  1W0U A;  3C07 A;  3QBM A;  2MGQ A;  3I4M J;  4ABZ A;  2B63 J;  3RD3 A;  2JMW A;  3PAS A;  5M5X J;  1XC5 A;  1W0T A;  3Q3S A;  1JT0 A;  3HE0 A;  4DW6 A;  1APL C;  3COL A;  3NPI A;  3SFI A;  1ZQ3 P;  1ETX A;  2X9D A;  1NK3 P;  2JA8 J;  4FTH A;  1MH4 A;  4W1U A;  2DMT A;  2ECB A;  3BG5 A;  2IBD A;  2MG4 A;  5J1U A;  1B8I A;  1ETK A;  3A03 A;  1TWH J;  2LY9 A;  1QRY A;  1T56 A;  5AQC A;  3GTJ J;  5F04 A;  4JX4 A;  1TWA J;  3ZQG A;  2DMU A;  4XIC A;  3L1P A;  3H0G J;  1TWF J;  1WGX A;  2G0E A;  4A3K J;  1LE8 B;  3HOZ J;  1VI0 A;  4PXI A;  3F0C A;  3BG9 A;  4MO7 A;  2M2E A;  4A3D J;  2L7M P;  3HIM A;  1NTC A;  3O60 A;  1ZKG A;  3RH2 A;  3HOW J;  1X58 A;  1JT6 A;  3AQS A;  4GCT A;  3CMY A;  2OF7 A;  2D5V A;  2E2I J;  2JA7 J;  4BBS J;  1GT0 C;  1X2N A;  4B4C A;  5IP7 J;  3KKC A;  1H8A C;  4NN1 A;  1P7I A;  1U9N A;  5IOY A;  3GTO J;  1HF0 A;  3BJB A;  5DAJ A;  3I4N J;  2K9S A;  2IAI A;  2UXO A;  2DMQ A;  2NS8 A;  2FX0 A;  2LFB A;  5EF6 A;  3BCG A;  3VW2 A;  3JRI A;  3K2A A;  3A01 B;  3JRG A;  3RQI A;  3S16 J;  3M4O J;  2I10 A;  5H9T A;  3NI7 A;  2FJ1 A;  4IHW A;  5M5Y J;  3BHQ A;  1OCT C;  2DG7 A;  2NVY J;  1MH3 A;  4L5E A;  4C3I J;  3DPJ A;  2HXO A;  2Y0S N;  4I6Z A;  3PPB A;  3UKG A;  3H3V K;  4XRS G;  3S15 J;  1FTZ A;  2IU5 A;  3BTJ A;  1F43 A;  2M9H A;  2NOG A;  1ETW A;  1IG7 A;  2NP5 A;  1BW6 A;  4M3E A;  2L7F P;  1WH7 A;  3NAU A;  2CJJ A;  1AHD P;  2ZOY A;  3V6G A;  1FTT A;  1JUS A;  1Y1V J;  3G1L A;  4BXX J;  3FIS A;  5GPC A;  3S14 J;  5C4J J;  4DZP A;  2GFN A;  3HGG A;  3GTM J;  2JK3 A;  3MNL A;  4UUS A;  5IPA A;  5FLM J;  2R5Y A;  2R0Q C;  4A3M J;  4AYB N;  3HTH A;  1IJW C;  3QPS A;  2DA3 A;  2LTP A;  4A3B J;  2G7S A;  5EZG A;  2PBX A;  3ANP A;  3Q0V A;  3FKI J;  1OCP A;  4FE4 A;  4M6V A;  4IEJ A;  1VND A;  3BNI A;  2QWT A;  3F1B A;  3JRC A;  4AC0 A;  2QKO A;  3CJD A;  4KWA A;  2O8K A;  5FMP A;  4CYC B;  3BQY A;  3IH2 A;  2CRG A;  1Q1V A;  2YVE A;  3VOK A;  2VKV A;  1RR7 A;  5E3L A;  4RDU A;  3BRU A;  3VPR A;  1MBH A;  1X2M A;  1LFU P;  5EG0 A;  1PUF B;  2WUI A;  5IYC J;  4GCK A;  5F08 A;  4AC6 A;  2O9L A;  1MBE A;  2GEN A;  2TRT A;  2XPW A;  2AHQ A;  2LR8 A;  3MVP A;  2HKU A;  2L9R A;  4JNN A;  1ORK A;  2QF7 A;  2R5Z B;  1ZTR A;  2D6Y A;  2AO9 A;  4JX6 A;  4D5F A;  3BTL A;  3S1M J;  2HOS A;  4M3B A;  5HAW A;  1FIA A;  1Z0X A;  5IP9 J;  1ITY A;  2OI8 A;  4A3G J;  4MFD A;  1TC3 C;  2XPV A;  3NAR A;  1RET A;  2LK2 A;  3QQA A;  3DEW A;  5HBU A;  2VI6 A;  4Y7N J;  1ZR2 A;  2WV1 A;  4XRM A;  3RZD J;  4IHY A;  1VFC A;  3HOV J;  3NNR A;  5FHP A;  1H89 C;  3HTI A;  2G7G A;  2LD5 A;  2QCO A;  3SDG A;  4JKZ A;  1MBJ A;  2HXI A;  3OOU A;  1MNM C;  1YRN A;  5K7H A;  3BR0 A;  2EBI A;  5GPA A;  1SFO J;  4UDS A;  1UI5 A;  2PMZ N;  2N8G A;  2M0C A;  1ZR4 A;  3T6N A;  1U9O A;  2YU9 J;  3MKL A;  2REK A;  4M3D A;  4A3F J;  5E3O A;  1B8I B;  2UXP A;  2FQ4 A;  1SAN A;  3HGY A;  2GLO A;  5D19 A;  2MSY A;  3HTA A;  4A93 J;  5F0H A;  2TCT A;  1GVD A;  2XSD C;  3VP5 A;  3E7Q A;  3G1M A;  4ME9 A;  3OIO A;  3SJM A;  5F0C A;  3BR1 A;  5M3M J;  1AKH B;  5EZH A;  1IGN A;  2NVQ J;  3VVX A;  2UXH A;  1OJL A;  2VPR A;  2OPT A;  3LJL A;  5E3M A;  2XRL A;  2KDZ A;  3B81 A;  2QOP A;  1VF9 A;  3BR5 A;  3FK6 A;  4JYK A;  3LSR A;  1FJL A;  3KNW A;  2QIB A;  3EUP A;  4A3I J;  3QKX A;  1LE8 A;  1HCR A;  2L7Z A;  5FKL A;  2XB5 A;  1ETY A;  3GTK J;  2UXU A;  3HOX J;  2M34 A;  3B6A A;  4QTR A;  2EZH A;  1A6I A;  3GTG J;  5IOZ A;  2RAE A;  1MSF C;  3VIB A;  2ME0 A;  3GBG A;  5C44 J;  3HBL A;  1RKT A;  1FEX A;  1B72 B;  3BTI A;  4DZJ A;  3LOC A;  5K7F A;  3ZQC A;  2EZK A;  2YS9 A;  2NX4 A;  5GP9 A;  3LHQ A;  2YVH A;  2R93 J;  1RPW A;  3C2B A;  2Y31 A;  2YUS A;  3JRF A;  3HEF A;  2E19 A;  1IUF A;  2K40 A;  3G1O A;  1GV2 A;  2W48 A;  4AUX A;  5FJ8 J;  2XDN A;  2ECC A;  3JRA A;  2COB A;  3S1R J;  3OSF A;  2VKE A;  2LP0 A;  1T33 A;  3ON4 A;  3V78 A;  4IHX A;  3FK7 A;  1GUU A;  4I76 A;  2PZ9 A;  5FKO A;  1O4X A;  1I6H J;  2DA4 A;  2R5Y B;  4QSH A;  2Y30 A;  3TED A;  1XG1 A;  5FKN A;  2Y9Z A;  3BTC A;  3BT9 A;  1K61 A;  3B6C A;  4Y52 J;  5E3N A;  3IH3 A;  3BG3 A;  1IDZ A;  2O7O A;  1JTY A;  5J1Y A;  2OER A;  2ZCM A;  3M3Y J;  1MBK A;  4V2F A;  3WHC A;  2R92 J;  2VUM J;  5EGO B;  2LKX A;  4FCY A;  3G56 A;  4CGR A;  1JTX A;  3BR6 A;  1Y1W J;  3NXC A;  1JUP A;  2HI3 A;  4FE7 A;  5EYR A;  4BY1 J;  3CCY A;  3Q0U A;  2CQX A;  5J3L A;  2CQQ A;  5C3E J;  3ZQI A;  2JA5 J;  1QVU A;  4DYC A;  4X1E A;  1OFC X;  2NVX J;  5IYD J;  2Y9Y A;  4JX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...