2RAEA

Crystal structure of a tetr/acrr family transcriptional regulator from rhodococcus sp. rha1
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
193
structure length
193
Chain Sequence
IGRRPSTTQDRISTVGIELFTEQGFDATSVDEVAEASGIARRTLFRYFPSKNAIPWGDFDAHLAEMRAQLAAQPDDIPIVDGLTAALLQFNAFPASEEINHRKRMGLILRVPALQAYSVVMYEGWRNVIAEYVASRLGTSPTDHVPRTVGYLLLGVAMSAYEQWLDDDSLELNELLASGMQSLYDGLSSLGEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, AcrR family protein
publication title The crystal structure of a TetR/AcrR family transcriptional regulator from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
total genus 70
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17754 TetR_C_14 MftR C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2raeA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2raeA02
1ZR4A 3UKGA 5E3OA 1ORKA 1IDZA 4DZJA 1Y1WJ 3JSJA 2X6OA 3GTKJ 4NN1A 1JKQC 3BR1A 2LLKA 5IYBJ 2OI8A 3VOKA 4KWAA 1PUFB 3BG3A 2K9NA 3JRBA 1XG1A 4MXMA 2ZOYA 1TWFJ 1AU7A 3O8GA 2XGDA 2DN0A 2LP0A 4A3KJ 3TEDA 3VW0A 1ZKGA 3S16J 1WH7A 3GBGA 2HOAA 4IHVA 5EEAA 2G7SA 5C44J 4EEFG 4CYCA 2AHQA 5F0CA 4A3MJ 3HKZN 5IYDJ 3HTIA 2N8GA 4AF5A 1K61A 3S1RJ 2ME0A 1JKPC 3AQSA 1NK3P 2CUFA 2L0KA 3KKDA 5D18A 1ZGWA 2VKVA 4J19A 2UXPA 3BJBA 2NP5A 1RKWA 2IEKA 1NK2P 1FIAA 3GTPJ 1I50J 2R92J 3OSGA 2HQ5A 2QF7A 3S5RA 3TP3A 1AKHA 2G0EA 3OIOA 2QWTA 2CQXA 3ANGA 4PXIA 4A3JJ 1O4XA 4JKZA 4QSHA 1B8IA 4IHXA 1VFCA 1UG2A 5J1RA 3BTIA 4MFDA 2UXIA 4V2GA 4M3FA 5F08A 1T56A 2X48A 3HOUJ 2CU7A 3S2HJ 3KNWA 1U9OA 3ZQLA 2K9SA 1CQTA 1AKHB 4JL3A 3L1PA 1UI5A 2HI3A 5IP6A 3H0GJ 1QVTA 2ME6A 1B8IB 5K58A 4ACIA 3BR6A 3BR5A 1JUMA 2CRGA 4Y7NJ 3JR9A 2NVQJ 4XRSG 2WV1A 1DU0A 5IP7J 4UUSA 2R5ZA 1BJZA 1GV5A 3ZQGA 3HTAA 3WHCA 1JGGA 4X1EA 3Q0VA 2FD5A 3RD3A 5FJ8J 2RHAA 2DA3A 2OF7A 3M3YJ 2JK3A 2Y9YA 3K2AA 2K9QA 3S1NJ 4UUSB 4JNNA 1GVDA 4S0HB 2HYJA 2RAEA 4GFKA 5HSZA 2WB1N 1G2HA 3S14J 3BR0A 2NVYJ 3DCFA 1E3OC 1F36A 5FLMJ 2HOTA 2W48A 2Y9ZA 1H88C 2KDZA 1XC5A 3WHBA 2MGQA 4L62A 4M3BA 4BY7J 1EF4A 1OFCX 2VKEA 3S1QJ 1ZTRA 2E19A 2E1OA 3B6AA 1F43A 4LOCA 4M3EA 1OCPA 5C4XJ 4XIDA 2ZCNA 5H9TA 1TWHJ 1WI3A 5IP9J 3BTJA 3SDGA 4D7MA 2GFNA 4C3IJ 4M3GA 4HKUA 1MBKA 1NTCA 4JX5A 1IJWC 1UMQA 4GCTA 4M6VA 1QPIA 3BR3A 3HTJA 2R5YA 1MSFC 3ZQIA 2LY9A 3RQIA 4DYCA 3GEUA 3RH2A 2YUSA 2DA7A 1RETA 5HBUA 2DA1A 3PM1A 2D5VA 3VW1A 2R5YB 2OPTA 4V2FA 1MBGA 3I4NJ 1BW6A 4A3LJ 1WCMJ 2PMZN 1MBEA 3F0CA 4FE4A 1IUFA 5DAJA 3A03A 4AC6A 2EZKA 3I4MJ 3HOWJ 3B81A 3VP5A 3CRJA 2MW8A 5D1RA 5FKOA 3CWRA 1X58A 5C3EJ 5EYRA 3A02A 1APLC 2UXOA 4GFLA 2R7ZJ 2XB0X 3DPJA 3HE0A 1K83J 3QBMA 2L7MP 3NRGA 2DMNA 1IG7A 3BTLA 1ETVA 3MVPA 2XB5A 3GTGJ 3F1BA 5M5XJ 3FRQA 5M3FJ 1ITYA 2EQRA 3MKLA 4A69C 2X9DA 3PO2J 2JA5J 2QIBA 3D1NI 5FKMA 2DMTA 4C3JJ 4NELA 2Y31A 2O7OA 1TWAJ 2DA2A 3IH3A 3E7QA 1VNDA 5FKNA 1UHSA 2ZB9A 5IPAA 3JRAA 2EH3A 5M5WJ 2HOSA 5IOZA 3JRFA 4GFBA 2NOGA 1W0UA 3G1LA 3LSJA 2XPVA 2DG8A 2LVSA 2TCTA 4ABZA 4A3GJ 4RBOA 1ETQA 3HB9A 3PO3J 2VI6A 1ZR2A 3FKIJ 4BBRJ 3C2BA 4M3DA 4B3AA 1A6IA 1WGXA 3HBLA 3LSGA 4B4CA 2FBQA 3GTMJ 5FHPA 2VPRA 1GUUA 2CUEA 1R9TJ 5DS9A 2ECCA 2AO9A 5EGOB 3DEWA 2KT0A 4HNVA 2LK2A 3HEFA 3CDLA 2VUMJ 1FTTA 1JTYA 1IV6A 4UDSA 3FIWA 2EZLA 2LTPA 3HM5A 2XPWA 4L5EA 5EDNA 5C4JJ 3HOXJ 5DTDA 1IGNA 5FKKA 4Y52J 1BL0A 3IH2A 4D7NA 2O8KA 3S15J 2L7FP 2YU9J 1JUPA 1MSEC 2K40A 3W6VA 1HDDC 5HODA 4MLOA 2XDNA 4ICHA 3FISA 1VI0A 3RZOJ 4ME9A 4BXXJ 1QRYA 2E2HJ 2TRTA 2DJNA 2DMQA 2O9LA 1ETOA 3CQZJ 1BA5A 3T6NA 1U9NA 5CXIA 2FQ4A 2M2EA 1HF0A 2L9RA 3VVXA 3OOUA 1ETWA 3H3VK 1Z0XA 4A3EJ 3CMYA 1TWCJ 3Q0WA 2NVTJ 2JA8J 3GTQJ 3S1MJ 5EFYA 1ETYA 2WUIA 1I6HJ 3EUPA 3P9TA 3CJDA 1OCTC 2GUHA 2UXUA 4W1UA 5GP9A 2E2IJ 2ID3A 3BHQA 5EZGA 1X2NA 5BNGA 5EF6A 1HLVA 2P81A 1Q1VA 3K7AJ 4JYKA 1JJ6C 3CCYA 5HAWA 2NP3A 2ZCMA 2QCOA 4QTRA 2MG4A 2DA5A 1OJLA 4AC0A 4IEJA 4A3FJ 2V57A 3C07A 1FTZA 5FKLA 2Y30A 3IUVA 2M0CA 2MSYA 2YVEA 1HDPA 3M4OJ 3E7LA 1MH3A 1FEXA 5M3MJ 5GPCA 4W97A 3NNRA 3RKQA 3BG5A 4C3HJ 3JRGA 1XS9A 1AHDP 3KZ9A 3VUQA 4FCYA 3PASA 3BCGA 4B1RA 1UI6A 1H8AC 4FISA 1LFBA 3BRUA 2HXOA 3LOCA 5J1YA 3S2DJ 2F07A 3LJLA 2REKA 4D5FA 4C2MJ 2YVHA 2DMUA 1U8BA 3V6GA 5AQCA 1JT0A 4CGRA 3BG9A 3B6CA 2NS8A 5EG0A 3MNLA 2M8GX 5F1JA 4AYBN 3JRCA 1SANA 3BTCA 3QPLA 2QOPA 2NX4A 2XPUA 2XGEA 4XRSA 5CXGA 5D19A 5FMPA 2LFBA 3ON4A 4XK4A 1DU6A 1Z77A 5EG0B 4AUXA 1WPKA 1JKOC 3VOXA 2GM4A 3GZIA 2ZOZA 1VF9A 4DW6A 2L7ZA 4A3BJ 5FLVA 1JKRC 5C4YA 2FJ1A 2NVXJ 1TC3C 3ZQFA 4GCLA 2UXHA 2CJJA 1ETXA 1SGMA 1HCRA 2JN6A 2RASA 3EGQA 1RKTA 1BW5A 2COBA 3VVYA 3GTLJ 3LHQA 2DG7A 4BBSJ 4I6ZA 3HOYJ 1HOMA 3HGGA 4MIMA 3LNQA 4JX4A 3LSPA 2DTZA 2G7GA 1MBHA 1IDYA 4XRMA 3O60A 1JT6A 2R93J 2EZIA 2ID6A 5K7HA 3S17J 2NS7A 3NARA 1GT0C 2Q24A 3PPBA 3BR2A 2LKXA 1JUSA 5EGOA 1P7IA 4YZEA 3FK6A 3NI7A 3BQZA 5CW8A 2JWTA 2JA7J 4BY1J 4FE7A 4JP0A 3GTJJ 1GV2A 1T33A 4CYCB 3JRIA 2E2JJ 1FJLA 4NDLA 3IV5A 1RR7A 1GDTA 1B72A 2Y2ZA 4MO7A 1POGA 3HDDA 4IHYA 1LE8A 1JTXA 2EBIA 2M34A 1FIPA 3FK7A 3LSRA 2LD5A 2GLOA 2G3BA 5JLWA 3A01A 1B72B 2WAQN 3SFIA 1P7JA 1LE8B 3G1OA 5JLXA 3JREA 5E3MA 5IYCJ 4X6AJ 3ZQHA 3KKCA 3HTHA 1TWGJ 3A01B 2D6YA 3TP0A 3MN2A 2B63J 4JX6A 3AQTA 1I3QJ 1A5JA 3NXCA 1MBFA 1U78A 2WGBA 4RDUA 3G1MA 2QKOA 2JMWA 1WH5A 1D5YA 1H89C 3BNIA 2GENA 2XRLA 2XGCA 1ZQ3P 3VPRA 2H8RA 3SJMA 2R0QC 2M9HA 3BQYA 2PBXA 2ELKA 5J1UA 5E3LA 4XICA 1MH4A 3Q3SA 5E3NA 4DZPA 4A93J 1ZK8A 4GCKA 2XSDC 2PZ9A 3LWJA 1RESA 2G7LA 2R5ZB 2LR8A 1MBJA 5F04A 1ENHA 2EZHA 1LFUP 2DA6A 2DA4A 4A3CJ 1X2MA 1SFOJ 2OERA 3HGYA 2HDDA 3COLA 2HKUA 2H1KA 3O8HA 1YRNA 2QTQA 4QIWN 5IOYA 1IC8A 2Y0SN 4G12A 3HOVJ 2O7TA 5J3LA 3Q0UA 3RZDJ 2IU5A 4MFEA 1S7EA 1ETKA 5F27A 3VVZA 9ANTA 1YRNB 3G56A 2DMPA 2HXIA 4MK6A 4FTHA 2IBDA 4UUTA 3QKXA 5M5YJ 3IH4A 2IAIA 2HYTA 2ECBA 2FX0A 1W0TA 3QQAA 3ZOBA 4DYQA 5F0FA 3JRHA 4IHWA 4A3DJ 2ZCXA 2JA6J 3TW7A 2GBYA 3TW6A 2W53A 3OSFA 1Y1VJ 2CQQA 4A3IJ 4BKXA 3QPSA 3GTOJ 3VIBA 3VW2A 5K7FA 4D5CA 3ZQCA 5F0HA 1IRZA 4I76A 3NPIA 3ON2A 5GPAA 3G7RA 2JJ7A 2I10A 3JRDA 5EZHA 3HOZJ 3ANPA 3NAUA 3V78A 1MNMC 3HIMA 2YS9A 1QVUA 1JJ8C 1RPWA 5K7ZA 3BT9A 5FGLA 4DYRA 1PUFA
chains in the Genus database with same CATH superfamily
2KZGA 2OV7A 2NVUB 3PQJA 5E3OA 1AWCA 2WAQA 4HZFA 1J09A 3ZXSA 4YIFA 1Y1WJ 3JAMZ 3JSJA 4ZH4F 1JKQC 3BR1A 4OMYA 3TQNA 3CUOA 4RLFA 1JKPC 2WA0A 3VOKA 5LHGA 4KWAA 1S5LC 1PUFB 3TOAA 2K9NA 1EH6A 3PIPF 2FSWA 4MXMA 1FZPB 1AU7A 3QWLA 2XDVA 3VW0A 2EWNA 2Z99A 3CCSI 4Y3OA 5D8LB 1WH7A 3DF8A 2I5UA 3CF5F 3WGIA 1XMKA 3U1DA 4PGGA 3RSNA 3VYSB 3HTIA 4ESFA 4L0YB 3K4KA 1KQ0A 4PJ0C 5D5WB 4AF5A 3LQRA 2R7VA 1TNTA 2L0KA 4HSTA 5GAEJ 4HAMA 4HPQA 1ZGWA 2VKVA 4PJLA 4FX4A 3BJBA 1Z7LA 2XAJA 2R7UA 2IEKA 3ZN1A 1QZYA 1R71A 2ZCWA 1PP7U 1VTNC 3H3ZA 1GHCA 3SDBA 3R4KA 2HQ5A 1U5TA 1X3WB 3T8TA 1REPC 4M73A 3S5RA 4M72A 1IXCA 4M71A 5DD4A 2W4SA 1JE8A 3ANGA 4WK8F 1B8IA 1I5ZA 1YX3A 4HDUA 2YR2A 4MFDA 5H6QA 2VBWA 2ZNYA 4GCVA 4V2GA 5DYMA 4F7ZA 3OY9A 3HOUJ 2KIUA 4ZC3A 2ZXIA 1CQTA 1AKHB 1YJWI 2K9MA 3H0GJ 5IP6A 2PFVA 2EIJH 5K58A 3OYJA 2F4MB 3BJOA 3BR5A 3CP8A 1WFXA 5ILVA 1XGSA 2RQPA 1O7LA 2BXYA 2R7SA 1S8NA 4XRSG 1BOAA 1MJ9A 2STWA 3R0AA 3HUGA 4CCKA 4XKVA 2O3FA 2R5ZA 2FMYA 1Z3YA 3HTAA 1JGGA 4KICA 3RD3A 2EFNA 2Q2EB 2VONA 1MKMA 2QKMB 2OF7A 4ZDLA 1WRJA 2Y9YA 2RHAA 3ROUA 1WWXA 4UHTA 3NEUA 4CCMA 2MFZA 1D3YA 3NRVA 3K8PC 1HW1A 3M8FA 3I56I 2D2WA 3DCFA 3WG7H 4BJ6C 1KU7A 4G7OF 3V7RA 4A6DA 5LHHA 1FPQA 1FY7A 3JAMK 2FMLA 4L62A 4HYEA 4AM3A 4Y13A 3S1QJ 1ZTRA 4C30A 2E1OA 2V9KA 4HBLA 1J0RA 1F43A 4AVZA 5E8IA 5H9TA 1T39A 1KQ8A 3W2VA 2M0MA 3BTJA 5JVGF 5FLXZ 2GFNA 4C3IJ 4LK1F 1SFUA 5FFZA 4A5MA 3HKZA 3NWSA 2R5YA 3JSPA 3PFYA 1R1VA 3RQIA 4DYCA 3CCJI 4IOCF 4Y17A 2QUFA 2XV4S 4II3A 2DA1A 2IS2A 5D5UB 3COAC 2KIFA 2YVXA 4EGZA 1IN6A 4OWRB 3WTVC 5D5VB 1KA8A 3VW1A 5KNLA 4V2FA 2FOKA 3DTKA 2VPLA 4N9IA 1SVLA 3OS1A 2VL8A 2W82A 4ZZDA 3MKWB 3DV8A 3S3OA 3VEPA 3S2WA 2HZTA 1MBEA 4LJZF 4E7ZA 5CJ9A 1U2WA 4N4NB 1I3AA 1H0MA 3HOWJ 1IV8A 3VP5A 2RREA 3LWFA 5B3SH 1FMVA 5ICGA 4C2TA 5D1RA 5LEKA 1X58A 1LJ9A 5EYRA 2UXOA 1LDJA 3LA2A 2QLZA 2R7ZJ 4FX0A 2UUZA 3HC7A 2PG4A 1KZHA 3O2PE 2O5RA 3DPTA 3F1BA 3K4LA 2A05A 4NELA 2K02A 3BJ6A 2O03A 5A2QZ 2Y31A 2Q0OA 3IH3A 2DJIA 3L2RA 4EJTA 5FKNA 4G7HF 1MMDA 2A6HF 1DDNA 4KUMA 1G4DA 2HOSA 3LSKA 2E35A 4ZYHA 1X1DA 2F5VA 4BDZA 2BVLA 1WJ5A 4F55A 3VDXA 2EV0A 5J6XA 2BYVE 5ERIA 3BCAA 3PO3J 4D0PA 4NBQA 1T0FC 3WU1B 1RUNA 4DQ2A 4BEHA 4CCLA 1Z7UA 3KP3A 3L00A 5H6RA 3GTMJ 2PFBA 2P5VA 1F4KA 2BBYA 4CYDA 3I54A 3OV8A 5EGOB 1X1BA 4JBAA 5FRMA 2HQAA 5GAGJ 5KVRA 4ZYDA 3QRFF 4IQJA 1BJAA 2LK2A 4I0AA 1XMAA 3CDLA 1FTTA 3VTIA 1JXSA 1IV6A 3MMYB 4UDSA 4HQMA 3DFGA 3I59A 2LTPA 5EDNA 5C4JJ 1WQ2A 1OISA 2VJ4A 3VSLA 2O8KA 3S15J 3G4SI 2L7FP 2BHYA 4XKBA 4X0GA 1T38A 5LEJA 2E1CA 2C6YA 3W6VA 2D1VA 3HHHA 2XDNA 4ICHA 3V7SA 4PCQA 2M87A 4G8XA 2E2HJ 1XGNA 3IHUA 2TRTA 2R7FA 2DJNA 5D4RA 4PDKA 3IWFA 2FQ4A 1J5YA 2RV8A 1ZG3A 4LLLA 2L9RA 5L3FA 3BJAA 3C18A 3M8JA 2A68F 1A31A 1DPUA 2NVTJ 1UB9A 3S1MJ 4RAZA 3M9AA 4M6YA 1ETYA 2DO7A 1I6HJ 4N0BA 4XOTA 1P4XA 3CJDA 1YI2I 3FXOA 4E7SA 4KIFA 2UXUA 1Y8RB 3BHQA 3F23A 2UXXA 3G3ZA 2IVMA 4UV8A 5EZGA 5BNGA 5CPRB 2EV6A 4MGRA 5EF6A 3GXOA 3REOA 5B1BH 2WAFA 3MZ8A 2QCOA 4UNOA 4IEJA 2V57A 2QA4I 3IUVA 3MQ0A 3M4OJ 3RPQA 5M3MJ 1EA3A 2Z5UA 2PJRB 1Z67A 1LEAA 1Y8QB 1B4AA 3LFUA 3RCOA 3BG5A 1SVMA 2F2EA 4MTEA 4FCYA 3CUQA 2ADUA 2F5EA 1T98A 2EK5A 4B1RA 2E1MC 3FBIB 3DU6A 4DVYP 4KIGA 3S2DJ 2CG4A 2XKPA 3LJLA 4C2MA 2JPBA 3EUHC 4KMUX 3BG9A 2B3WA 1QBJA 3B6CA 2M8GX 2H8WA 2M5WA 3DTEA 1V4RA 5FMPA 4L0ZB 1W5TA 4CXFA 2VBYA 3ON4A 2VASA 3AG2H 2LBFB 3JSOA 3KP6A 1WPKA 3VOXA 2M45A 2KRHA 4KYWA 3CJRB 1F1ZA 4DW6A 5FLVA 5C4YA 3E5XA 1TC3C 2IS4A 4H4KC 2UXHA 2DFFA 2XVCA 1SGMA 2RASA 2A07F 2X6XA 3AKZA 1VQ5I 1BW5A 2COBA 3HZJA 3VVYA 3OL4A 4HG2A 2HZDA 2DCEA 3LAJA 4CZCA 1HOMA 3LNQA 2XAQA 3BZCA 4JX4A 2DTZA 4B3XA 2EZIA 2NS7A 1GT0C 4R79A 1JUSA 3I5UA 2LMDA 1R22A 5CYVA 4AIDA 1O3TA 1USSA 2ZXWH 3LSTA 2JWTA 2XIGA 2NRAC 3AG3H 4IVNA 4CSWA 5E18F 4BY1J 3GTJJ 1T33A 3JRIA 2E2JJ 3OL3A 3SHFA 4NDLA 2HU9A 4EQQA 1GDTA 2P7CB 3FXKA 2LY2A 3FK7A 1A6QA 3K10A 2DOAA 3IC7A 5D6FA 2G3BA 3H5NA 2VXDA 2UWMA 2YPRA 1B72B 2WAQN 3SFIA 1FX7A 3BWGA 2O6GE 4CHUA 1QU3A 2AQEA 3C1DA 3JTGA 2CSOA 1D1BA 5JLXA 4PSWA 5IYCJ 2ZXHA 3WTWC 1B59A 3A01B 1GXQA 2D6YA 3TP0A 3C7JA 4OIQF 1XCVA 2L9SA 4LD5A 1FOXA 5K5QA 1HW5A 1U78A 2WGBA 4GYIA 2B0LA 1XPXA 3G1MA 3QYEA 2JMWA 3BNIA 2HKXA 2XUBA 2FA5A 3DU5A 3TDUC 1CGPA 4UVBA 3VPRA 2H8RA 1UAAA 5DV5A 3SJMA 1OCRH 2M9HA 2VOPA 1MW7A 4AVPA 5E3LA 3HPGA 4XICA 4A12A 3VYTB 1D1AA 2ZY9A 1EH7A 1SD7A 2VC0A 2X0LA 4L9NA 2HPMA 3HUGB 5EJCA 4XSXF 1RESA 2G7LA 1USTA 4YRVA 2R5ZB 4DJAA 4I7HA 2JVHA 3FBNB 3T1BA 3TOBA 2E36A 3IAS2 2HDCA 2IT0A 2DA6A 1R5HA 3HGYA 5KK1A 4HQEA 2H1KA 4KFCA 3O8HA 4FQGA 1AA7A 4QIWN 4AD9A 3HOVJ 5ED4A 5E8GA 3P7NA 2Z16A 4P9FA 2XROA 3CCMI 4A0XA 2VQGA 4MFEA 1C0WA 1S7EA 4P9UA 2MABA 9ANTA 4ENKA 2OTJI 2UXNA 3RPUD 1HKSA 3BLYA 3IUOA 1YYVA 2DMPA 4MK6A 2K27A 4G9YA 4RGRA 3S8PA 3BZKA 5CVRA 2A5WA 4UUTA 1V55H 4RB2C 4AIKA 4EJWA 1U5TC 3IP4B 4C2UA 2BW3A 1P6RA 2CUZA 4A3DJ 5F0FA 3ZQ7A 3JRHA 3CO6C 3GLXA 2JA6J 1DP3A 1U0JA 4LGWA 3ERMA 4XM3A 5L3CA 1V3FA 1TQIA 1Y1VJ 2CQQA 3QPSA 3GTOJ 4A6EA 1UZCA 1YW9A 1BR2A 2OU2A 5F0HA 3ON2A 5GPAA 2JJ7A 3ANPA 3JRDA 3OOPA 3W6JB 2WY7Q 2E5ZA 2EV5A 1XGOA 2WV0A 3DQVC 4LIUA 1IZ1A 1IDZA 2LRDA 1Y39A 4IPAA 1Z21A 3RJPA 3BG3A 3JRBA 1FYKA 2FXAA 4ESJA 2XGDA 2GXBA 4A3KJ 1ZKGA 1B1BA 3S16J 2OZ6A 4LMYA 1IAWA 2KZVA 3FM3A 5EEAA 5C44J 2W7NA 2IGKA 1S3JA 1E3HA 2KL4A 3HKZN 3OYNA 1MD0A 3ZMVA 4DOZA 1X1AA 2Q8KA 3S1RJ 2ME0A 2ZFWA 1K61A 1VQNI 2HR3A 3BPVA 1D8JA 3KKDA 3CLQA 4EM1A 1SD5A 4E7JA 4J19A 2Z33A 2VT2A 4HRIA 2HS5A 1QGPA 2NP5A 1FIAA 5AIQA 1BIBA 2R92J 3OSGA 3OMYA 3GZ6A 1GLNA 1ZLJA 1IW7F 2GXAA 2DFEA 3TP3A 2CUJA 3OIOA 2I8DA 4LITA 4B09A 4PXIA 4QSHA 4IHXA 3AL0B 4B8XA 1VQMI 1VFCA 2L5QA 5FROA 4XLPF 2BY2A 1ON2A 2EA2A 2K7LA 3IWZA 2PJPA 2GOXB 3S2HJ 2XRNA 1U9OA 2K9SA 1SFXA 5BMZA 4UVCA 4U0VA 2BY1A 3BZ6A 5J8FA 2HI3A 4ON0A 3OR2C 1UI5A 4ACIA 1I39A 1J9IA 2VOOA 1JUMA 4F52A 3VB2A 5HDNA 2CRGA 4P5OA 2IRFG 3R0JA 3JR9A 1V5GA 1BIAA 2OCEA 4KT5C 5LGUA 3CO7C 4BACA 5IP7J 4IX7A 4Q47A 2HVSA 2BE5F 1A36A 1S29A 5E79C 3ZN0A 1ZN2A 4X1EA 1ON1A 1CF7B 4YG2F 3M3YJ 2K9QA 1S7OA 2F48A 4I09A 4UUSB 4JNNA 1GVDA 4S0HB 1NH3A 2HYJA 4GFKA 5HSZA 2WB1N 3KP7A 3S14J 3OYBA 2X1DA 2IXSA 5FO5A 1ODDA 4XN0A 3SZGA 3SEQA 2HOTA 2W48A 2Y9ZA 1H88C 1XC5A 5CVJA 5DCFA 2ZMEA 3WHBA 3C2HA 4RS8A 4FASD 4M3BA 2Y48A 2CFOA 2DFHA 2VKEA 5ICFA 3CC2I 1EF4A 2E19A 1T8IA 4C9YA 4LOCA 4M3EA 3K70D 3KP2A 5C4XJ 4CA0A 1TW2A 1TWHJ 1WI3A 2NOJB 3IRQA 2FQ3A 1IJWC 3OYAA 4GCTA 2DQLA 5GTIC 3S32A 3DEUA 3TO7A 2VLAA 2LY9A 2R3SA 3CDIA 4WXCA 4BJ5C 2DPDA 2F5CA 2K3PA 5HBUA 3BY6A 3PM1A 4LB6B 3CD6I 4EJUA 2K4JA 3UNGC 1YS6A 1O3RA 1ACIA 3CMAI 5AONA 2A3SA 3A0BC 1YX5A 3X2QH 1VQ4I 5B1AH 2RNJA 4A3LJ 5H2FC 2ZXJA 4ENMA 1FNNA 1Z1DA 3A03A 3ZGKA 3K4NA 3I55I 3DBHB 3I4MJ 2K9LA 2OUMA 3K0LA 3CRJA 3OYLA 3JCUC 1W7PA 1IF1A 4GFLA 3DPJA 1H9GA 3PL8A 4IZZA 2HFHA 3WTTC 2L7MP 1B9NA 1ETVA 3MVPA 1FT9A 1FBSA 3KLOA 5M5XJ 3S3NA 2EQRA 3MKLA 2QIBA 3D1NI 1BI3A 2MYSA 3OYGA 4G6DA 1W7PD 1SD6A 1SAXA 4XOPA 2DA2A 1YIJI 2HKOA 1BI0A 1QHHD 2Y0MA 1UHSA 3JRAA 1MMAA 3M07A 5HLTA 4PUSA 3RYPA 3P9IA 4EATA 1T6SA 1N75A 1HQCA 2GA1A 4YELA 2YX7A 3ECHA 3I53A 3OIPA 3MFKA 3H0DA 2NOGA 3LFKA 3R60A 4I99C 4F92B 1W0UA 3G1LA 1MJBA 3LSJA 3T8RA 3TKYA 2DG8A 2TCTA 2V9PA 3VWBA 1FBUA 2LOOA 1ETQA 4YEJA 1D8KA 1PJRA 4M3DA 3QU3A 4RAYA 2FEZA 4OAZA 1A6IA 4B4CA 3HBLA 2DDBA 3LSGA 2B9SA 4LIVA 2HVRA 2FBQA 1GUUA 2CUEA 1PYVA 3KP4A 2PN6A 3BC8A 5DS9A 3OYKA 4BGDA 3GUDA 1I6XA 2KT0A 1DGWY 4HNVA 5CVVA 3HEFA 2VUMJ 4O3MA 5DDGA 1JTYA 3CUQC 1KONA 1E17A 2EZLA 3K4CA 3OWTA 4ZTFA 5DTDA 1XN7A 2LC2A 1BL0A 2A61A 3TBIA 3MWMA 1MSEC 3HSRA 4MLOA 5J4YA 3F22A 4WWCA 2EINH 1OPCA 2AXLA 3LA3A 3FISA 4YIRX 1D1CA 2XASA 4BXXJ 4I98B 3CQZJ 2O0YA 4LG0A 3T6NA 1R5ID 2M2EA 3ZMUA 2QENA 3M8EA 3H3VK 4LFUA 3PSFA 1VQKI 2VQLA 3KCCA 4RLQA 4HF2A 4II2A 3PQKA 3CMYA 2OD5A 2R7WA 1Y56A 1XSVA 2HYFA 3L9FA 3K1PA 3F8CA 1V5FA 2A6EF 4PFOA 2CH0A 3P9TA 2BY3A 3KPHA 3DBLB 1QZZA 1SVOA 1V54H 4W1UA 2ZJRF 4UXNA 1X4PA 2F4OB 2JSPA 3CESA 1X2NA 5ILUA 2P81A 3M1CA 5J8CA 3K7AJ 5CQGA 3CCYA 2RQQA 2NP3A 2ZCMA 5HDGA 3OYCA 3KZZA 2MG4A 2LF8A 2QBYA 4A3FJ 3PUFA 3C07A 1TQMA 1HKQA 3GZNB 2MSYA 4M74A 3WE3A 5TISC 1QO0D 3ZQQA 1RNLA 3FXMA 4W97A 4C3HJ 1XS9A 1AHDP 2QSHX 2L01A 4RB3C 3A1YA 3KZ9A 3VUQA 1OMIA 4BE1A 3BCGA 1BI2A 3CLOA 3MAJA 4IOAF 4XKCA 2WAEA 1UHWA 3HRSA 1UHMA 5J1YA 2QYOA 1N77A 1E3PA 2F07A 2HYGD 2REKA 1I27A 2XHKA 2YVHA 4JQFA 1U8BA 3EETA 4B44A 1STZA 1RR8C 1RRJA 1UCRA 3SYTA 3SZTA 2QQ8A 3I64A 3MKYB 3MNLA 1IUYA 1WJBA 3JRCA 2QOPA 3QPLA 3BTCA 2BW3B 2NX4A 4XRSA 1MJAA 5CXGA 2L3DA 4OIPF 5DUIA 4WX9A 4ENJA 3I71A 4XK4A 2ZBKA 5EG0B 2DAOA 1FC3A 1W5CC 3I58A 3CC7I 2ZOZA 3H9GA 5JR3A 2HEOA 2HOEA 3DWLE 2FJ1A 4D1QA 3ZQFA 4G6TB 4GCLA 3LSHA 4XR6A 4OIOF 2Z1DA 1FP1D 2O8XA 2JN6A 3KYDB 3MEXA 1DUXC 3F8MA 3GTLJ 3LHQA 1TBXA 1RI7A 2GIVA 2L4MA 2H6CA 3HGGA 1L0OC 3LSPA 1K78B 2G7GA 4OOIA 3PSIA 1JT6A 1Y6IA 2FE3A 3TO9A 3GX4X 2R93J 2OJED 1LKXA 3E97A 4G6QA 3I9V2 4GYGA 5DCMA 2WB1A 1NG6A 4ETSA 2LKXA 3DXJF 1P7IA 4BHCA 3WU2C 3FK6A 3G2BA 3BQZA 3H1CA 3HIFA 3P5JA 5CW8A 4FE7A 1U6GA 1LVKA 2L2OA 1FJLA 3FZVA 1F5TA 3HDDA 1POGA 4XLCA 3ZRGA 1U3EM 4GGGA 3IKTA 3LSRA 2QEXI 1MDMA 1ZG5A 2KMUA 5CVIA 2MA3A 3ASOH 5FLXK 1LE8B 3G1OA 2JRTA 3GMEA 4UY8I 4PZJA 2FBKA 2E1MB 4KN4X 3ZQHA 2R7OA 3HTHA 1ZARA 5ICEA 1H9TA 3MN2A 2B63J 3JW4A 5L3DA 4JX6A 1I3QJ 1A5JA 3NXCA 2FU4A 1MBFA 3RYRA 1WH5A 3J80Z 4HLYA 2H27A 3BP8A 3PNVA 1H89C 2FOWA 2XRLA 2XGCA 4BJTA 1UJ8A 4Q5SF 3TMOA 1Z3XA 2M7BA 2LF7A 3BQYA 3V7CA 5BOXA 5J1UA 1VQLI 2P5LC 3ABTA 1YHQI 4RAFA 3K69A 3FX3A 4DZPA 4MTDA 1ZK8A 3HYIA 1FOYA 1TP4A 5F64A 2XSDC 1I1SA 3ABKH 3AAFA 4U7DA 4EGYA 2PZ9A 4YFXF 1S72I 1MBJA 2EZHA 5HOOA 5E1ZB 1P92A 3TGNA 2DA4A 4ZYGA 4A3CJ 1W4MA 1X2MA 3VSKA 1YRNA 5A2QK 3FHZA 1QZEA 2QTQA 5IOYA 1TL8A 1R00A 2JPCA 2IU5A 3QPHA 1R23A 3ISPA 1ETKA 5F27A 1D0ZA 4CDGA 2LSOA 2CGPA 2E60A 4XRFA 4FTHA 3P9CA 3QKXA 5M5YJ 1LFPA 2HYTA 4UUVA 2ECBA 2FX0A 3AFHA 2ICWG 2VQHA 3ZOBA 4Q4ZF 1PVEA 2ZCXA 3WTZA 2OBPA 2DFIA 2BZTA 1OYWA 3TW6A 4E70A 2W53A 3F3XA 1BR1A 3OSFA 1XCBA 2DU9A 2FRHA 4BKXA 4HNUA 3E6DA 4D5CA 1W36D 3KEYA 1IRZA 3NPIA 3RQ4A 2I10A 3HOZJ 3CCUI 5HNFA 3V78A 1MNMC 2YS9A 1MMSA 1WJEA 1FSHA 2IA1A 3EUAA 1PUFA 1ONVA 2X51A 1LNWA 3MZYA 1VQ9I 4IL6C 3H36A 1ORKA 4U9LA 4DZJA 2A69F 1BN5A 2X6OA 2W00A 2QQAA 4NN1A 1P4WA 2NAZA 4XORA 5IYBJ 3A4CA 2YU3A 4NB5A 3CDHA 5K1YA 2M1BA 1XG1A 3GO5A 1UELB 2WC2A 2ZOYA 3WODF 2VC1A 3H9JA 3O8GA 2VBZA 2LP0A 2LNBA 1OCCH 2QSGX 3K70C 2G7SA 2W84A 3ESWB 1QHGA 2KP6A 4A3MJ 2GQQA 3J80K 2N8GA 4HV5A 4UV9A 5KAIC 5ICCA 2VB6A 2ZMEC 2P6SA 1D0YA 2OAZA 3U21A 3V8KA 1NK3P 3AQSA 5D18A 2FUG2 1WJAA 2XSJC 5HS8A 4GRIA 2UXPA 3RTRA 3ML6A 2MLKA 1OCOH 2KRCA 3L2UA 3OYIA 1NK2P 2MH9A 1YITI 3D5RC 4HV6A 2L54A 1I50J 3GTPJ 4J00A 4M6XA 1EJ9A 3DKYA 3GF2A 3HRUA 2QF7A 1AKHA 2G0EA 1ZHFA 1HKTA 4DYRA 1LUJB 3OS0A 4PJJA 1R4MB 2HPIA 2QQBA 4JKZA 5L3BA 3MZHA 1UG2A 5J1RA 2NNNA 3J7AY 2G9WA 1U5TB 2UXIA 4ZDOA 4M3FA 5F08A 3KNWA 4L18B 4EM2A 4JL3A 3L1PA 3GLLA 1LPQA 2P0WA 1B8IB 2ME6A 4XSZF 2KHMA 4YIIA 3E6MA 3A0HC 2KFDA 2R4GA 4P55A 5EEHA 4I01A 1YLFA 4Y7NJ 2Q2EA 1IRGA 2NVQJ 5FGMA 1K4SA 2BOLA 2WV1A 1DU0A 1J2XA 3C2GA 2X1CA 2PX9A 1BJZA 1GV5A 2CW0F 5F1RA 3WHCA 1B6AA 2RVCA 4M9XA 1BI1A 3F6VA 5FJ8J 2V7FA 2JK3A 3HTSB 3IAM2 3K2AA 4Y33A 1YG2A 2KJBA 4B48A 3CZ6A 3QOEA 4HF1A 3Q5FA 1ZYRF 2XAFA 1YE9A 1X1CA 3MCZA 3ZMZA 4RB1A 1G2HA 5J47A 2HDWA 2PEXA 4RM3A 3RPUA 2NVYJ 2TDXA 4ZTJA 1MZBA 2LKPA 4BAYA 1F36A 1E3OC 4LG0B 1R36A 1OYYA 3WG9A 4HA8A 2DK8A 5E20A 5LD2C 3N05A 2MGQA 2OA4A 2EFWA 2E7XA 2PQ8A 1QA6A 1I1GA 5CLSA 3B6AA 4XMYA 4S04A 1G3WA 1TLHB 2DT6A 4RMNA 1SEUA 1E0EA 2IS6A 2ZCNA 1XGMA 2Y75A 2JT1A 3V4GA 3QYFA 3GWZA 4D7MA 4HKUA 4M3GA 1YJNI 2X4HA 4FETA 4F93B 2X85A 2XF5A 2CWEA 1QPIA 3DKWA 3BR3A 4UVAA 4V19K 1MSFC 2NNYA 4OINF 2YUSA 1RETA 1SMYF 1P4AA 1MNEA 5DD8A 1K7AA 5JVTA 2DQRA 2R5YB 1MBGA 1OLTA 3OYHA 3W2AA 1ZRDA 2DYRH 1WCMJ 4L5JA 4Y15A 4IJAA 4FE4A 1ZREA 4BDYA 2BHZA 5DAJA 3DPUA 5AIPA 2KLOA 1MMGA 4HSRA 4ANJA 4YFNF 3J7YJ 1XTAA 2OTLI 3GCMA 1G59A 3G73A 1JHHA 2MW8A 3CWRA 3A02A 1APLC 5HDKA 1IN7A 4B43A 3B02A 3TL4X 4XLFA 1RIOH 4A2UA 1Z05A 2CYYA 3NRGA 2DMNA 1IG7A 3GTGJ 2DODA 4WXDA 2KQRA 1ITYA 3PO2J 4A69C 2X9DA 2JA5J 1WI9A 4ESBA 2DMTA 2ZSHB 2GOMA 2O7OA 5KAFC 1YW7A 2Z2SB 2ZB9A 2EJRA 3ABLH 2R7XA 3O3KA 4CO8A 1WZ2A 5LRSA 3CP2A 1R5GA 4BUPA 5M5WJ 5IOZA 3E5QA 2ZJ2A 2CQKA 3SEZA 1T2KA 2IPQX 2DT7B 3FXQA 4GFBA 4U9NA 4Z6YA 1OQYA 4UB6C 1L3LA 2XPVA 2Z9OA 1TW3A 2E71A 3EYIA 4RBOA 2CMPA 2VI6A 1ZR2A 2P7VB 2X6YA 3FKIJ 4BBRJ 3C2BA 2P4WA 1YJ9I 2PLYA 3FHNA 4B3AA 1BC8C 5IT9Z 2AQFA 4S05A 2ZJQF 4HDVA 1IXSB 2XF6A 5FHPA 1IN5A 2RKHA 1UFMA 2EFPA 3PIOF 2ECCA 3P9KA 3DEWA 2VE9A 5GAHJ 4NQWA 3E5UA 5HS7A 1ZLKA 3BDDA 1SFEA 4KDPA 3F6OA 4BEHB 4AIHA 3K4MA 1R7JA 4UB8C 1X19A 1Y0UA 2ELJA 4RA2A 4CCNA 3FIWA 3HM5A 2XPWA 3F8BA 3HOXJ 5FKKA 2A2FX 4D7NA 3GFJA 1FOKA 1JUPA 2IGOA 1LEBA 2YX4A 2DK5A 4HEA2 1HDDC 2RN7A 2D45A 3I59B 4N4OB 2K85A 2BVMA 3QP5A 2FF4A 1BA5A 4XL9A 1U9NA 1QNTA 1TT0A 1HF0A 1R4NB 4LLNA 1ETWA 1Z0XA 3I0TA 1TTYA 4PGHA 1FMWA 2OQRA 2JA8J 3H3UA 3GTQJ 5EFYA 3BOQA 2WUIA 1WJCA 4CCOA 1LDDA 1BOBA 4PJMA 2ZNZA 3NS4A 4F3QA 2X1EA 4OIRF 4XNFA 3NQOA 4JYKA 5HAWA 4NC6A 2PJRA 4QTRA 1OJLA 2V1XA 2MBFA 4AC0A 1ZELA 1MMNA 2V79A 2M0CA 5LGTA 2YVEA 2JSCA 6PAXA 1HDPA 3E7LA 2V6CA 1MH3A 1FEXA 4CCJA 5DUKA 3OYFA 1D0XA 4BQOA 3ONQA 3NNRA 2O61A 2LYCA 3QU6A 3SXYA 3ZP5A 2UZKA 3OIQA 2XF7A 5LHIA 3N97A 3LSIA 2Y69H 4FISA 3BRUA 3QPTA 3F21A 3LOCA 2E7WA 1YQAA 4U88A 4XLEA 2ELHA 3KFWX 2R7RA 5AQCA 1JT0A 3V6GA 3CUQB 4CGRA 1WHUA 3Q9SA 2KJCA 3CCEI 1BR4A 4AYBN 2P6TA 2XPUA 1OCZH 4RGXA 4RM2A 2LFBA 1R49A 1R1TA 1DU6A 4AUXA 1JKOC 2M8EA 2AS5F 2GM4A 3C3WA 1FSEA 5E1XA 3ZR8X 4EM0B 5JHFA 4A3BJ 2X6WA 3IRRA 1WJDA 1WKMA 3I3LA 4IRIA 3K4JA 1ETXA 2LREA 3RKXA 1IRXA 4AU7A 1HCRA 3EGQA 2WTEA 5HS9A 5BPIA 4LG3A 4A0YA 4BBSJ 4I6ZA 3HSEA 1A35A 4PFPA 1OR7A 1IDYA 2OZUA 4XRMA 3O60A 3R6SA 3RDIA 2Z3YA 3NARA 2EA4A 2Q24A 3WTXC 3V42A 3GFLA 4YZEA 1A04A 4HOBA 3RI4A 3CCVI 1OKRA 1D5VA 1J75A 4JP0A 1GV2A 4ZZLA 5KHDA 1U8RA 2OCCH 4EMSA 3R61A 2JRMA 3IV5A 1B72A 4IHYA 4MO7A 3FWEA 1JTXA 3BROA 2M34A 1FIPA 3FKJA 4NNJA 2HWVA 2ISZA 1K6YA 2LD5A 1W36C 5BS6A 2ESHA 1EV7A 2HNHA 4P1WA 3A01A 1PDNC 1GVJA 4IRVA 2STTA 2F4IA 3JREA 1YO5C 2JTVA 2QM3A 1MIJA 4X6AJ 1FYLA 3KKCA 4U7BA 4ZYAA 2VXZA 4XQFA 1MGTA 2IJLA 3CC4I 4U0YA 3J7ZI 4WCGA 1VQOI 1SMTA 2HTJA 3K4BA 2QKOA 4DBRA 2H1LA 3TO6A 3IL2A 1PUEE 1WVRA 4DNCA 2FJI1 3VYUB 5JI6A 2R0QC 4O5VA 3HXLA 5IT3A 4OD5A 1J59A 5CVUA 3ZMDA 1MH4A 3Q3SA 1BC7C 1W5SA 5E3NA 2K86A 4OAYA 3RKWA 3OYMA 4XKWA 4GCKA 1JI8A 2NS0A 5B5EC 1YFHA 5E1WA 3CMEI 4KISA 3GVAA 2JQ7A 5F04A 1ENHA 1YW8A 2JUCA 5LRRA 1LFUP 2CV0A 3L7WA 2PBIA 4BE2A 2F5FA 1SFOJ 3COLA 2HKUA 2XC7A 2M4KA 4A5NA 4IO9F 1HSTA 2DYSH 3FMQA 4G12A 1P9QC 2J5OA 3Q0UA 2VKHA 5J40A 1KU9A 4WF2A 3RZDJ 1RZ4A 3PJRA 2LY1A 2V26A 2W25A 3DEEA 5EEGA 2VJJA 1XX5A 3KP5A 3QAHA 3HRMA 3G56A 4KMFA 2K3FA 3B73A 2IBDA 4HF0A 3FXUA 3IH4A 2IAIA 4MEYF 2W85A 4XLAA 2FBHA 2VN2A 2GXGA 1JHFA 4FT8A 1W0TA 3QQAA 2M4GA 2JA2A 4DYQA 3LA7A 2AXTC 2GBYA 2ISYA 1E2XA 2CO5A 5DEQA 4A3IJ 3VIBA 5FD5A 5K7FA 3HL2A 3L09A 1S9HA 4ITVA 3HOSA 4I76A 1DP7P 4QPQA 2H94A 2VBXA 3NAUA 5K5RA 3HJEA 2B1EA 4AIJA 2LH9A 2RGVA 5FB2A 3KEQA 1G6NA 3BT9A 2V1DA 2EFOA 1ZR4A 2HQRA 3UKGA 3FXRA 4JK1X 3ZMSA 3GTKJ 4Q48A 2LLKA 1DGRM 4Z2YA 4D9JA 2OI8A 1Q1HA 1IN8A 2DI3A 3S3MA 1VQ8I 1X1PA 1FWZA 5IY5H 1TWFJ 1LQ1A 5LLQA 5L3EA 1G8XA 3LL7A 5E17F 2DN0A 3HRTA 3VODA 1HW2A 3TEDA 1V5EA 4L9VA 2R7DA 4ZYEA 1WSUA 5FRNA 3CCRI 3GBGA 2HOAA 1IO2A 1SAUA 3EYYA 4IHVA 1G3YA 3FDYA 2AHQA 5F0CA 1SFKA 2MC3A 4EEFG 5HLGA 4CYCA 4JOMA 2G7UA 4CICA 5IYDJ 1T08B 4IF4A 2RDPA 3W3CA 3WGGA 3AG1H 5HLHA 4BL0B 1XSDA 2CUFA 4FHTA 1TNSA 4KITB 4BS9A 2F5DA 4GXOA 4RAGA 3BG6A 3JTHA 4MHGA 1X3ZB 1RKWA 1NHAA 2CW7A 2H09A 4XN3A 4BE0A 2NYXA 2QWWA 3H5RA 4BYYA 1M1EB 5BQTA 4BHBA 2B7EA 5J4VA 4L5IA 2KRFA 1ZG1A 3L2CA 4MQ9F 2CS3A 1FLIA 3KZYA 4KN7X 3BCBA 2QWTA 2CQXA 4A3JJ 1O4XA 4HX8A 4KJZA 1IXRC 3BTIA 2Y0SA 3QOPA 1T56A 2X48A 1R58A 2CU7A 3HHGA 3ZQLA 4LLGF 2DPUA 1QVTA 3H9QA 2KIQA 3VOEA 3BR6A 4E7LA 4U87A 4NQWB 2H6BA 3V8JA 1CF7A 2GAUA 2W57A 4PK4A 2ZSIB 3WTSC 5BPDA 3ZMTA 4UUSA 1LB2A 4R8HA 2WY8Q 3ZQGA 1K79A 3K6GA 4IHTA 3Q0VA 2FD5A 2G7HA 1XB4A 2DA3A 4AYBA 1S7AA 4KT6A 3FF5A 4HLXA 3LMMA 1KU3A 1QPMA 1SC7A 3S1NJ 3OS2A 2XAHA 3PFIA 3LQQA 2GZWA 3FXLA 1TT5B 2RAEA 3WTUC 1UG0A 3BR0A 3CJNA 5FLMJ 2KDZA 3KIOA 3K9TA 5K5OA 3CJQB 2VODA 2ZJPF 4IQ4A 3E6BA 3K2ZA 3W6KB 4BY7J 1OFCX 2R7TA 1ERDA 1VQPI 1Z91A 3U2RA 2BY0A 3CF2A 1OCPA 4IXAA 4XIDA 2ZMEB 3KZIC 3EPZA 1O3QA 3DTIA 5IP9J 3SDGA 5H20A 2VJ5A 1MBKA 1NTCA 4JX5A 4NC8A 1UMQA 3G71I 3L2VA 2F6CA 3GW2A 4M6VA 3HTJA 4CH7A 5DM6F 3ZQIA 4DBQA 4G7ZF 4I2OA 3GEUA 1GXPA 3RH2A 4HNTA 2IS1A 2QKLB 2DA7A 2MD5A 3CTAA 2WWYA 4BU2A 2CV2A 4NC7A 2LG4A 2D5VA 2OPTA 2FNPA 3DKXA 1XD7A 3I4NJ 1BW6A 1HBXG 1Z6TA 4RB0A 2PMZN 3F0CA 1VZ0A 1IUFA 4G94A 3F8NA 4AC6A 2CQ7A 2EZKA 2IA0A 1X4OA 1NG7A 3H35A 2V4JC 1R6RA 2VIXA 3RIRA 3B81A 3E3VA 4L9JA 5FKOA 3SZPA 5C3EJ 3K1NA 4CUGA 3QP6A 1JGSA 2XB0X 2CW8A 4MNUA 1LVAA 3WU0A 2V1UA 3HE0A 1K83J 2M3AA 2HQNA 1N25A 5CKTA 3QBMA 3A2KA 3BTLA 1O57A 4KA4A 5FGLA 1W7PB 2XB5A 1RUOA 5L3GA 3FRQA 5M3FJ 5D4SA 2OC6A 2EIKH 5FKMA 3ABUA 2XAUA 4C3JJ 1XSXA 2FBIA 3PNYA 2HVQA 1S6LA 5TJJA 5F6FA 1TWAJ 3HOTA 3E7QA 3M1EA 1VNDA 2A6TA 4EV0A 1FYMA 4K2EA 4ASNA 5IPAA 4IRGA 2EH3A 5CQEA 2GIZA 4RGUA 4PSXA 2KPMA 3FM5A 3JRFA 4HX4A 3O6BB 4XBFA 4OU0A 3WGHA 2BV6A 2MH2A 4A0ZA 1ZRFA 2LVSA 4ABZA 3ABMH 4A3GJ 4E7HA 3HB9A 2P8TA 4EVIA 2L9VA 1ZRCA 5HNHA 2VT3A 1WGXA 3NWTA 2GA2A 3VYRB 2VPRA 1R9TJ 2IGMA 2PMHA 2AO9A 3ZPLA 2LKSA 3EUKL 3M7GA 3QODA 3U9GA 3E0JB 1SD4A 3V8LA 5LGNA 1VQ7I 4L5EA 2EIMH 1IGNA 2PI0A 4Y52J 3OR1C 3IH2A 2QQ9A 2M7AA 2YU9J 2L02A 3OYEA 1EKEA 2KKOA 2K40A 2K4BA 5HODA 5TRDA 2BEOA 3WE2A 1YIOA 3F72A 5GADJ 3LAPA 4E7IA 5B66C 1K4TA 1VI0A 3RZOJ 4ME9A 1QRYA 2OQGA 1HA8A 2DMQA 2WADA 2O9LA 1ETOA 2L7KA 5FFXA 4XONA 5CXIA 1TZLA 4HX7A 5JHUA 3L2QA 5DM7F 5GTHC 3VVXA 3OOUA 1HC8A 2M30A 1XDSA 4A3EJ 1FBQA 2QVOA 3OYDA 4E4HA 3F9KA 1TWCJ 1XMXA 3Q0WA 2XAGA 3D5LA 4M9SA 4I02A 3E6CC 4KIBA 5KCMA 3EUPA 1YS7A 4L9TA 2KDOA 3KE2A 1VQ6I 1OCTC 3K1MA 3FMSA 3ERED 4LB5A 2GUHA 3FXJA 2KIMA 3UR3C 5LBQA 5GP9A 3BG7A 2ID3A 2E2IJ 1OR7C 1HLVA 1Q1VA 2D1HA 1AOYA 1JJ6C 2CFXA 4HW0A 2ZC2A 4J01A 2DA5A 2V6EA 1LDKB 3GFMA 1T0FA 2DTRA 1WJFA 3D5SC 1YOVB 5TGTA 3T5XA 3RKYA 1FTZA 5FKLA 4I0BA 2Y30A 3G6EI 3DP7A 5LFAA 4MQVA 4O6JA 2IGNA 3GZ5A 5GPCA 2QBYB 1Y0NA 3N4MA 3RKQA 3JRGA 3DLAA 1HXDA 3IKVA 5D5XB 3PASA 4NHJA 2LDUA 1UI6A 3TDZC 3U1KA 1H8AC 2ZKZA 1LFBA 2HXOA 5JFRA 2EB7A 2DXIA 4D5FA 1IN4A 4C2MJ 2E5NA 2DMUA 2L9NA 5FD6A 2NS8A 5EG0A 3KX2A 3SWHA 1Z6RA 3ASNH 5F1JA 1KGSA 1SANA 3CCQI 1K6OA 2XGEA 2DLLA 1TQPA 5D19A 1J7KA 3ELKA 2NXNB 2QGUA 4DGWB 5HLIA 1Z77A 4P96A 3S93A 3SQNA 2GWRA 3GZIA 3PNTA 4ZJZA 4F91B 1VF9A 2ZO4A 3AG4H 2L7ZA 3KYLA 1JKRC 2K5CA 2NVXJ 2L4AA 2JZYA 3DPLC 1ULYA 2ACJA 1K78A 2CJJA 2W1OA 4M9ZA 2KISA 1RKTA 4WXHA 1KQ9A 4E7KA 3E1SA 1ZAOA 4GDFA 2DG7A 3HOYJ 3J81Z 4N9HA 4MIMA 2VKDA 2VJIA 3KEOA 3CCLI 1MBHA 4QPOA 2W24A 3H5AA 4KNYA 2ID6A 1OYIA 4XLNF 4XLHA 5K7HA 3S17J 3KETA 2JUGA 3BR2A 5HVQC 3PPBA 5EGOA 3ZCOA 3NI7A 2WBMA 2XKOA 4QWQA 3D0SA 1G3TA 2JA7J 3HG9A 3L2WA 5DCMB 1ZGJA 3MD2A 1YTYA 2RNGA 4CYCB 4BXUA 2IW5A 3LSMA 2EILH 4CGZA 3HSFA 2P5KA 1RR7A 4CZZA 2Y2ZA 2QZ8A 1FOWA 2RC4A 2YSRA 2EBIA 1LE8A 2GLOA 3PUBA 4U0WA 3KYCB 5D6EA 1O3SA 3VFZA 5JLWA 1W1WE 1ZH5A 2BXZA 3DBRB 1BM9A 1P7JA 2MLGA 4EJOA 1KYWA 2COMA 4OD4A 2CQNA 3EUHA 4LK0F 1MDMB 4BNCA 3GEZA 4E6KG 3HTUA 5E3MA 1HSJA 4RGSA 4DIQA 3ULQB 1TWGJ 4WIBA 2R7QA 4QLCU 3AQTA 4GO1A 4RDUA 3DLLF 2DT5A 1ZGAA 2IA2A 2V9VA 3CMMA 3EDPA 2J5PA 3J7AO 2Q1ZB 1D5YA 3SFZA 1R1UA 2PMZA 3Q9VA 2GENA 2QSFX 4H0EA 2DOFA 2EFQA 2VQCA 3W2WA 1ZQ3P 4IKFA 1QQIA 2XGXA 3QYBA 2PBXA 2ELKA 2V1NA 2E1NA 5ILSA 4NUBA 3WTYC 4PJNA 4R1HA 2MC4A 4A93J 4YFKF 4MEXF 2HTSA 1MNDA 2UV1A 4BXFA 3GFIA 2HGCA 3LWJA 1PP8F 2LR8A 4AWXB 2CV1A 2MD0A 2JVGA 2ZFUA 2A5YB 2BGCA 3GYHX 2DBBA 2OERA 4Y4RA 1EH8A 4EJVA 1FP2A 2HDDA 2DOEA 2E34A 1RC9A 1Z9CA 3BPXA 3ECOA 1KYZA 2EPFA 2Y0SN 1KU2A 3EQLF 1IC8A 5J3LA 3T0YA 4ENNA 2O7TA 2DW4A 4B47A 1F9NA 1B9MA 1G3SA 3VVZA 2IP2A 1IRFA 3I4PA 4BQNA 1YRNB 3J81K 2HXIA 4OMZA 4ZDPA 2ETHA 4IRHA 5D8KB 1N78A 3AL0C 4BHPA 2DDAA 1DPRA 4IHSA 1XDUA 3HPHA 3FMRA 1O7FA 2ESNA 3CJTB 3F8FA 4IHWA 1X3UA 3TW7A 5IT9K 2LBFA 3VW2A 4TV7A 3ZQCA 3H92A 4BH9A 1P2FA 4BQQA 3G7RA 5EZHA 2VE8A 3MKZA 4BQAA 3HIMA 1DQUA 1QVUA 1BBYA 1RPWA 1T95A 2FNAA 5K7ZA 1JJ8C 3KLNA 2PMUA
chains in the Genus database with same CATH topology
1ZR4A 3UKGA 5E3OA 1ORKA 1IDZA 4DZJA 1Y1WJ 3JSJA 2X6OA 3GTKJ 4NN1A 1JKQC 3BR1A 2LLKA 5IYBJ 2OI8A 3VOKA 4KWAA 1PUFB 3BG3A 2K9NA 3JRBA 1XG1A 4MXMA 2ZOYA 1TWFJ 1AU7A 3O8GA 2XGDA 2DN0A 2LP0A 4A3KJ 3TEDA 3VW0A 1ZKGA 3S16J 1WH7A 3GBGA 2HOAA 4IHVA 5EEAA 2G7SA 5C44J 4EEFG 4CYCA 2AHQA 5F0CA 4A3MJ 3HKZN 5IYDJ 3HTIA 2N8GA 4AF5A 1K61A 3S1RJ 2ME0A 1JKPC 3AQSA 1NK3P 2CUFA 2L0KA 3KKDA 5D18A 1ZGWA 2VKVA 4J19A 2UXPA 3BJBA 2NP5A 1RKWA 2IEKA 1NK2P 1FIAA 3GTPJ 1I50J 2R92J 3OSGA 2HQ5A 2QF7A 3S5RA 3TP3A 1AKHA 2G0EA 3OIOA 2QWTA 2CQXA 3ANGA 4PXIA 4A3JJ 1O4XA 4JKZA 4QSHA 1B8IA 4IHXA 1VFCA 1UG2A 5J1RA 3BTIA 4MFDA 2UXIA 4V2GA 4M3FA 5F08A 1T56A 2X48A 3HOUJ 2CU7A 3S2HJ 3KNWA 1U9OA 3ZQLA 2K9SA 1CQTA 1AKHB 4JL3A 3L1PA 1UI5A 2HI3A 5IP6A 3H0GJ 1QVTA 2ME6A 1B8IB 5K58A 4ACIA 3BR6A 3BR5A 1JUMA 2CRGA 4Y7NJ 3JR9A 2NVQJ 4XRSG 2WV1A 1DU0A 5IP7J 4UUSA 2R5ZA 1BJZA 1GV5A 3ZQGA 3HTAA 3WHCA 1JGGA 4X1EA 3Q0VA 2FD5A 3RD3A 5FJ8J 2RHAA 2DA3A 2OF7A 3M3YJ 2JK3A 2Y9YA 3K2AA 2K9QA 3S1NJ 4UUSB 4JNNA 1GVDA 4S0HB 2HYJA 2RAEA 4GFKA 5HSZA 2WB1N 1G2HA 3S14J 3BR0A 2NVYJ 3DCFA 1E3OC 1F36A 5FLMJ 2HOTA 2W48A 2Y9ZA 1H88C 2KDZA 1XC5A 3WHBA 2MGQA 4L62A 4M3BA 4BY7J 1EF4A 1OFCX 2VKEA 3S1QJ 1ZTRA 2E19A 2E1OA 3B6AA 1F43A 4LOCA 4M3EA 1OCPA 5C4XJ 4XIDA 2ZCNA 5H9TA 1TWHJ 1WI3A 5IP9J 3BTJA 3SDGA 4D7MA 2GFNA 4C3IJ 4M3GA 4HKUA 1MBKA 1NTCA 4JX5A 1IJWC 1UMQA 4GCTA 4M6VA 1QPIA 3BR3A 3HTJA 2R5YA 1MSFC 3ZQIA 2LY9A 3RQIA 4DYCA 3GEUA 3RH2A 2YUSA 2DA7A 1RETA 5HBUA 2DA1A 3PM1A 2D5VA 3VW1A 2R5YB 2OPTA 4V2FA 1MBGA 3I4NJ 1BW6A 4A3LJ 1WCMJ 2PMZN 1MBEA 3F0CA 4FE4A 1IUFA 5DAJA 3A03A 4AC6A 2EZKA 3I4MJ 3HOWJ 3B81A 3VP5A 3CRJA 2MW8A 5D1RA 5FKOA 3CWRA 1X58A 5C3EJ 5EYRA 3A02A 1APLC 2UXOA 4GFLA 2R7ZJ 2XB0X 3DPJA 3HE0A 1K83J 3QBMA 2L7MP 3NRGA 2DMNA 1IG7A 3BTLA 1ETVA 3MVPA 2XB5A 3GTGJ 3F1BA 5M5XJ 3FRQA 5M3FJ 1ITYA 2EQRA 3MKLA 4A69C 2X9DA 3PO2J 2JA5J 2QIBA 3D1NI 5FKMA 2DMTA 4C3JJ 4NELA 2Y31A 2O7OA 1TWAJ 2DA2A 3IH3A 3E7QA 1VNDA 5FKNA 1UHSA 2ZB9A 5IPAA 3JRAA 2EH3A 5M5WJ 2HOSA 5IOZA 3JRFA 4GFBA 2NOGA 1W0UA 3G1LA 3LSJA 2XPVA 2DG8A 2LVSA 2TCTA 4ABZA 4A3GJ 4RBOA 1ETQA 3HB9A 3PO3J 2VI6A 1ZR2A 3FKIJ 4BBRJ 3C2BA 4M3DA 4B3AA 1A6IA 1WGXA 3HBLA 3LSGA 4B4CA 2FBQA 3GTMJ 5FHPA 2VPRA 1GUUA 2CUEA 1R9TJ 5DS9A 2ECCA 2AO9A 5EGOB 3DEWA 2KT0A 4HNVA 2LK2A 3HEFA 3CDLA 2VUMJ 1FTTA 1JTYA 1IV6A 4UDSA 3FIWA 2EZLA 2LTPA 3HM5A 2XPWA 4L5EA 5EDNA 5C4JJ 3HOXJ 5DTDA 1IGNA 5FKKA 4Y52J 1BL0A 3IH2A 4D7NA 2O8KA 3S15J 2L7FP 2YU9J 1JUPA 1MSEC 2K40A 3W6VA 1HDDC 5HODA 4MLOA 2XDNA 4ICHA 3FISA 1VI0A 3RZOJ 4ME9A 4BXXJ 1QRYA 2E2HJ 2TRTA 2DJNA 2DMQA 2O9LA 1ETOA 3CQZJ 1BA5A 3T6NA 1U9NA 5CXIA 2FQ4A 2M2EA 1HF0A 2L9RA 3VVXA 3OOUA 1ETWA 3H3VK 1Z0XA 4A3EJ 3CMYA 1TWCJ 3Q0WA 2NVTJ 2JA8J 3GTQJ 3S1MJ 5EFYA 1ETYA 2WUIA 1I6HJ 3EUPA 3P9TA 3CJDA 1OCTC 2GUHA 2UXUA 4W1UA 5GP9A 2E2IJ 2ID3A 3BHQA 5EZGA 1X2NA 5BNGA 5EF6A 1HLVA 2P81A 1Q1VA 3K7AJ 4JYKA 1JJ6C 3CCYA 5HAWA 2NP3A 2ZCMA 2QCOA 4QTRA 2MG4A 2DA5A 1OJLA 4AC0A 4IEJA 4A3FJ 2V57A 3C07A 1FTZA 5FKLA 2Y30A 3IUVA 2M0CA 2MSYA 2YVEA 1HDPA 3M4OJ 3E7LA 1MH3A 1FEXA 5M3MJ 5GPCA 4W97A 3NNRA 3RKQA 3BG5A 4C3HJ 3JRGA 1XS9A 1AHDP 3KZ9A 3VUQA 4FCYA 3PASA 3BCGA 4B1RA 1UI6A 1H8AC 4FISA 1LFBA 3BRUA 2HXOA 3LOCA 5J1YA 3S2DJ 2F07A 3LJLA 2REKA 4D5FA 4C2MJ 2YVHA 2DMUA 1U8BA 3V6GA 5AQCA 1JT0A 4CGRA 3BG9A 3B6CA 2NS8A 5EG0A 3MNLA 2M8GX 5F1JA 4AYBN 3JRCA 1SANA 3BTCA 3QPLA 2QOPA 2NX4A 2XPUA 2XGEA 4XRSA 5CXGA 5D19A 5FMPA 2LFBA 3ON4A 4XK4A 1DU6A 1Z77A 5EG0B 4AUXA 1WPKA 1JKOC 3VOXA 2GM4A 3GZIA 2ZOZA 1VF9A 4DW6A 2L7ZA 4A3BJ 5FLVA 1JKRC 5C4YA 2FJ1A 2NVXJ 1TC3C 3ZQFA 4GCLA 2UXHA 2CJJA 1ETXA 1SGMA 1HCRA 2JN6A 2RASA 3EGQA 1RKTA 1BW5A 2COBA 3VVYA 3GTLJ 3LHQA 2DG7A 4BBSJ 4I6ZA 3HOYJ 1HOMA 3HGGA 4MIMA 3LNQA 4JX4A 3LSPA 2DTZA 2G7GA 1MBHA 1IDYA 4XRMA 3O60A 1JT6A 2R93J 2EZIA 2ID6A 5K7HA 3S17J 2NS7A 3NARA 1GT0C 2Q24A 3PPBA 3BR2A 2LKXA 1JUSA 5EGOA 1P7IA 4YZEA 3FK6A 3NI7A 3BQZA 5CW8A 2JWTA 2JA7J 4BY1J 4FE7A 4JP0A 3GTJJ 1GV2A 1T33A 4CYCB 3JRIA 2E2JJ 1FJLA 4NDLA 3IV5A 1RR7A 1GDTA 1B72A 2Y2ZA 4MO7A 1POGA 3HDDA 4IHYA 1LE8A 1JTXA 2EBIA 2M34A 1FIPA 3FK7A 3LSRA 2LD5A 2GLOA 2G3BA 5JLWA 3A01A 1B72B 2WAQN 3SFIA 1P7JA 1LE8B 3G1OA 5JLXA 3JREA 5E3MA 5IYCJ 4X6AJ 3ZQHA 3KKCA 3HTHA 1TWGJ 3A01B 2D6YA 3TP0A 3MN2A 2B63J 4JX6A 3AQTA 1I3QJ 1A5JA 3NXCA 1MBFA 1U78A 2WGBA 4RDUA 3G1MA 2QKOA 2JMWA 1WH5A 1D5YA 1H89C 3BNIA 2GENA 2XRLA 2XGCA 1ZQ3P 3VPRA 2H8RA 3SJMA 2R0QC 2M9HA 3BQYA 2PBXA 2ELKA 5J1UA 5E3LA 4XICA 1MH4A 3Q3SA 5E3NA 4DZPA 4A93J 1ZK8A 4GCKA 2XSDC 2PZ9A 3LWJA 1RESA 2G7LA 2R5ZB 2LR8A 1MBJA 5F04A 1ENHA 2EZHA 1LFUP 2DA6A 2DA4A 4A3CJ 1X2MA 1SFOJ 2OERA 3HGYA 2HDDA 3COLA 2HKUA 2H1KA 3O8HA 1YRNA 2QTQA 4QIWN 5IOYA 1IC8A 2Y0SN 4G12A 3HOVJ 2O7TA 5J3LA 3Q0UA 3RZDJ 2IU5A 4MFEA 1S7EA 1ETKA 5F27A 3VVZA 9ANTA 1YRNB 3G56A 2DMPA 2HXIA 4MK6A 4FTHA 2IBDA 4UUTA 3QKXA 5M5YJ 3IH4A 2IAIA 2HYTA 2ECBA 2FX0A 1W0TA 3QQAA 3ZOBA 4DYQA 5F0FA 3JRHA 4IHWA 4A3DJ 2ZCXA 2JA6J 3TW7A 2GBYA 3TW6A 2W53A 3OSFA 1Y1VJ 2CQQA 4A3IJ 4BKXA 3QPSA 3GTOJ 3VIBA 3VW2A 5K7FA 4D5CA 3ZQCA 5F0HA 1IRZA 4I76A 3NPIA 3ON2A 5GPAA 3G7RA 2JJ7A 2I10A 3JRDA 5EZHA 3HOZJ 3ANPA 3NAUA 3V78A 1MNMC 3HIMA 2YS9A 1QVUA 1JJ8C 1RPWA 5K7ZA 3BT9A 5FGLA 4DYRA 1PUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR4 A;  3UKG A;  5E3O A;  1ORK A;  1IDZ A;  4DZJ A;  1Y1W J;  3JSJ A;  2X6O A;  3GTK J;  4NN1 A;  1JKQ C;  3BR1 A;  2LLK A;  5IYB J;  2OI8 A;  3VOK A;  4KWA A;  1PUF B;  3BG3 A;  2K9N A;  3JRB A;  1XG1 A;  4MXM A;  2ZOY A;  1TWF J;  1AU7 A;  3O8G A;  2XGD A;  2DN0 A;  2LP0 A;  4A3K J;  3TED A;  3VW0 A;  1ZKG A;  3S16 J;  1WH7 A;  3GBG A;  2HOA A;  4IHV A;  5EEA A;  2G7S A;  5C44 J;  4EEF G;  4CYC A;  2AHQ A;  5F0C A;  4A3M J;  3HKZ N;  5IYD J;  3HTI A;  2N8G A;  4AF5 A;  1K61 A;  3S1R J;  2ME0 A;  1JKP C;  3AQS A;  1NK3 P;  2CUF A;  2L0K A;  3KKD A;  5D18 A;  1ZGW A;  2VKV A;  4J19 A;  2UXP A;  3BJB A;  2NP5 A;  1RKW A;  2IEK A;  1NK2 P;  1FIA A;  3GTP J;  1I50 J;  2R92 J;  3OSG A;  2HQ5 A;  2QF7 A;  3S5R A;  3TP3 A;  1AKH A;  2G0E A;  3OIO A;  2QWT A;  2CQX A;  3ANG A;  4PXI A;  4A3J J;  1O4X A;  4JKZ A;  4QSH A;  1B8I A;  4IHX A;  1VFC A;  1UG2 A;  5J1R A;  3BTI A;  4MFD A;  2UXI A;  4V2G A;  4M3F A;  5F08 A;  1T56 A;  2X48 A;  3HOU J;  2CU7 A;  3S2H J;  3KNW A;  1U9O A;  3ZQL A;  2K9S A;  1CQT A;  1AKH B;  4JL3 A;  3L1P A;  1UI5 A;  2HI3 A;  5IP6 A;  3H0G J;  1QVT A;  2ME6 A;  1B8I B;  5K58 A;  4ACI A;  3BR6 A;  3BR5 A;  1JUM A;  2CRG A;  4Y7N J;  3JR9 A;  2NVQ J;  4XRS G;  2WV1 A;  1DU0 A;  5IP7 J;  4UUS A;  2R5Z A;  1BJZ A;  1GV5 A;  3ZQG A;  3HTA A;  3WHC A;  1JGG A;  4X1E A;  3Q0V A;  2FD5 A;  3RD3 A;  5FJ8 J;  2RHA A;  2DA3 A;  2OF7 A;  3M3Y J;  2JK3 A;  2Y9Y A;  3K2A A;  2K9Q A;  3S1N J;  4UUS B;  4JNN A;  1GVD A;  4S0H B;  2HYJ A;  2RAE A;  4GFK A;  5HSZ A;  2WB1 N;  1G2H A;  3S14 J;  3BR0 A;  2NVY J;  3DCF A;  1E3O C;  1F36 A;  5FLM J;  2HOT A;  2W48 A;  2Y9Z A;  1H88 C;  2KDZ A;  1XC5 A;  3WHB A;  2MGQ A;  4L62 A;  4M3B A;  4BY7 J;  1EF4 A;  1OFC X;  2VKE A;  3S1Q J;  1ZTR A;  2E19 A;  2E1O A;  3B6A A;  1F43 A;  4LOC A;  4M3E A;  1OCP A;  5C4X J;  4XID A;  2ZCN A;  5H9T A;  1TWH J;  1WI3 A;  5IP9 J;  3BTJ A;  3SDG A;  4D7M A;  2GFN A;  4C3I J;  4M3G A;  4HKU A;  1MBK A;  1NTC A;  4JX5 A;  1IJW C;  1UMQ A;  4GCT A;  4M6V A;  1QPI A;  3BR3 A;  3HTJ A;  2R5Y A;  1MSF C;  3ZQI A;  2LY9 A;  3RQI A;  4DYC A;  3GEU A;  3RH2 A;  2YUS A;  2DA7 A;  1RET A;  5HBU A;  2DA1 A;  3PM1 A;  2D5V A;  3VW1 A;  2R5Y B;  2OPT A;  4V2F A;  1MBG A;  3I4N J;  1BW6 A;  4A3L J;  1WCM J;  2PMZ N;  1MBE A;  3F0C A;  4FE4 A;  1IUF A;  5DAJ A;  3A03 A;  4AC6 A;  2EZK A;  3I4M J;  3HOW J;  3B81 A;  3VP5 A;  3CRJ A;  2MW8 A;  5D1R A;  5FKO A;  3CWR A;  1X58 A;  5C3E J;  5EYR A;  3A02 A;  1APL C;  2UXO A;  4GFL A;  2R7Z J;  2XB0 X;  3DPJ A;  3HE0 A;  1K83 J;  3QBM A;  2L7M P;  3NRG A;  2DMN A;  1IG7 A;  3BTL A;  1ETV A;  3MVP A;  2XB5 A;  3GTG J;  3F1B A;  5M5X J;  3FRQ A;  5M3F J;  1ITY A;  2EQR A;  3MKL A;  4A69 C;  2X9D A;  3PO2 J;  2JA5 J;  2QIB A;  3D1N I;  5FKM A;  2DMT A;  4C3J J;  4NEL A;  2Y31 A;  2O7O A;  1TWA J;  2DA2 A;  3IH3 A;  3E7Q A;  1VND A;  5FKN A;  1UHS A;  2ZB9 A;  5IPA A;  3JRA A;  2EH3 A;  5M5W J;  2HOS A;  5IOZ A;  3JRF A;  4GFB A;  2NOG A;  1W0U A;  3G1L A;  3LSJ A;  2XPV A;  2DG8 A;  2LVS A;  2TCT A;  4ABZ A;  4A3G J;  4RBO A;  1ETQ A;  3HB9 A;  3PO3 J;  2VI6 A;  1ZR2 A;  3FKI J;  4BBR J;  3C2B A;  4M3D A;  4B3A A;  1A6I A;  1WGX A;  3HBL A;  3LSG A;  4B4C A;  2FBQ A;  3GTM J;  5FHP A;  2VPR A;  1GUU A;  2CUE A;  1R9T J;  5DS9 A;  2ECC A;  2AO9 A;  5EGO B;  3DEW A;  2KT0 A;  4HNV A;  2LK2 A;  3HEF A;  3CDL A;  2VUM J;  1FTT A;  1JTY A;  1IV6 A;  4UDS A;  3FIW A;  2EZL A;  2LTP A;  3HM5 A;  2XPW A;  4L5E A;  5EDN A;  5C4J J;  3HOX J;  5DTD A;  1IGN A;  5FKK A;  4Y52 J;  1BL0 A;  3IH2 A;  4D7N A;  2O8K A;  3S15 J;  2L7F P;  2YU9 J;  1JUP A;  1MSE C;  2K40 A;  3W6V A;  1HDD C;  5HOD A;  4MLO A;  2XDN A;  4ICH A;  3FIS A;  1VI0 A;  3RZO J;  4ME9 A;  4BXX J;  1QRY A;  2E2H J;  2TRT A;  2DJN A;  2DMQ A;  2O9L A;  1ETO A;  3CQZ J;  1BA5 A;  3T6N A;  1U9N A;  5CXI A;  2FQ4 A;  2M2E A;  1HF0 A;  2L9R A;  3VVX A;  3OOU A;  1ETW A;  3H3V K;  1Z0X A;  4A3E J;  3CMY A;  1TWC J;  3Q0W A;  2NVT J;  2JA8 J;  3GTQ J;  3S1M J;  5EFY A;  1ETY A;  2WUI A;  1I6H J;  3EUP A;  3P9T A;  3CJD A;  1OCT C;  2GUH A;  2UXU A;  4W1U A;  5GP9 A;  2E2I J;  2ID3 A;  3BHQ A;  5EZG A;  1X2N A;  5BNG A;  5EF6 A;  1HLV A;  2P81 A;  1Q1V A;  3K7A J;  4JYK A;  1JJ6 C;  3CCY A;  5HAW A;  2NP3 A;  2ZCM A;  2QCO A;  4QTR A;  2MG4 A;  2DA5 A;  1OJL A;  4AC0 A;  4IEJ A;  4A3F J;  2V57 A;  3C07 A;  1FTZ A;  5FKL A;  2Y30 A;  3IUV A;  2M0C A;  2MSY A;  2YVE A;  1HDP A;  3M4O J;  3E7L A;  1MH3 A;  1FEX A;  5M3M J;  5GPC A;  4W97 A;  3NNR A;  3RKQ A;  3BG5 A;  4C3H J;  3JRG A;  1XS9 A;  1AHD P;  3KZ9 A;  3VUQ A;  4FCY A;  3PAS A;  3BCG A;  4B1R A;  1UI6 A;  1H8A C;  4FIS A;  1LFB A;  3BRU A;  2HXO A;  3LOC A;  5J1Y A;  3S2D J;  2F07 A;  3LJL A;  2REK A;  4D5F A;  4C2M J;  2YVH A;  2DMU A;  1U8B A;  3V6G A;  5AQC A;  1JT0 A;  4CGR A;  3BG9 A;  3B6C A;  2NS8 A;  5EG0 A;  3MNL A;  2M8G X;  5F1J A;  4AYB N;  3JRC A;  1SAN A;  3BTC A;  3QPL A;  2QOP A;  2NX4 A;  2XPU A;  2XGE A;  4XRS A;  5CXG A;  5D19 A;  5FMP A;  2LFB A;  3ON4 A;  4XK4 A;  1DU6 A;  1Z77 A;  5EG0 B;  4AUX A;  1WPK A;  1JKO C;  3VOX A;  2GM4 A;  3GZI A;  2ZOZ A;  1VF9 A;  4DW6 A;  2L7Z A;  4A3B J;  5FLV A;  1JKR C;  5C4Y A;  2FJ1 A;  2NVX J;  1TC3 C;  3ZQF A;  4GCL A;  2UXH A;  2CJJ A;  1ETX A;  1SGM A;  1HCR A;  2JN6 A;  2RAS A;  3EGQ A;  1RKT A;  1BW5 A;  2COB A;  3VVY A;  3GTL J;  3LHQ A;  2DG7 A;  4BBS J;  4I6Z A;  3HOY J;  1HOM A;  3HGG A;  4MIM A;  3LNQ A;  4JX4 A;  3LSP A;  2DTZ A;  2G7G A;  1MBH A;  1IDY A;  4XRM A;  3O60 A;  1JT6 A;  2R93 J;  2EZI A;  2ID6 A;  5K7H A;  3S17 J;  2NS7 A;  3NAR A;  1GT0 C;  2Q24 A;  3PPB A;  3BR2 A;  2LKX A;  1JUS A;  5EGO A;  1P7I A;  4YZE A;  3FK6 A;  3NI7 A;  3BQZ A;  5CW8 A;  2JWT A;  2JA7 J;  4BY1 J;  4FE7 A;  4JP0 A;  3GTJ J;  1GV2 A;  1T33 A;  4CYC B;  3JRI A;  2E2J J;  1FJL A;  4NDL A;  3IV5 A;  1RR7 A;  1GDT A;  1B72 A;  2Y2Z A;  4MO7 A;  1POG A;  3HDD A;  4IHY A;  1LE8 A;  1JTX A;  2EBI A;  2M34 A;  1FIP A;  3FK7 A;  3LSR A;  2LD5 A;  2GLO A;  2G3B A;  5JLW A;  3A01 A;  1B72 B;  2WAQ N;  3SFI A;  1P7J A;  1LE8 B;  3G1O A;  5JLX A;  3JRE A;  5E3M A;  5IYC J;  4X6A J;  3ZQH A;  3KKC A;  3HTH A;  1TWG J;  3A01 B;  2D6Y A;  3TP0 A;  3MN2 A;  2B63 J;  4JX6 A;  3AQT A;  1I3Q J;  1A5J A;  3NXC A;  1MBF A;  1U78 A;  2WGB A;  4RDU A;  3G1M A;  2QKO A;  2JMW A;  1WH5 A;  1D5Y A;  1H89 C;  3BNI A;  2GEN A;  2XRL A;  2XGC A;  1ZQ3 P;  3VPR A;  2H8R A;  3SJM A;  2R0Q C;  2M9H A;  3BQY A;  2PBX A;  2ELK A;  5J1U A;  5E3L A;  4XIC A;  1MH4 A;  3Q3S A;  5E3N A;  4DZP A;  4A93 J;  1ZK8 A;  4GCK A;  2XSD C;  2PZ9 A;  3LWJ A;  1RES A;  2G7L A;  2R5Z B;  2LR8 A;  1MBJ A;  5F04 A;  1ENH A;  2EZH A;  1LFU P;  2DA6 A;  2DA4 A;  4A3C J;  1X2M A;  1SFO J;  2OER A;  3HGY A;  2HDD A;  3COL A;  2HKU A;  2H1K A;  3O8H A;  1YRN A;  2QTQ A;  4QIW N;  5IOY A;  1IC8 A;  2Y0S N;  4G12 A;  3HOV J;  2O7T A;  5J3L A;  3Q0U A;  3RZD J;  2IU5 A;  4MFE A;  1S7E A;  1ETK A;  5F27 A;  3VVZ A;  9ANT A;  1YRN B;  3G56 A;  2DMP A;  2HXI A;  4MK6 A;  4FTH A;  2IBD A;  4UUT A;  3QKX A;  5M5Y J;  3IH4 A;  2IAI A;  2HYT A;  2ECB A;  2FX0 A;  1W0T A;  3QQA A;  3ZOB A;  4DYQ A;  5F0F A;  3JRH A;  4IHW A;  4A3D J;  2ZCX A;  2JA6 J;  3TW7 A;  2GBY A;  3TW6 A;  2W53 A;  3OSF A;  1Y1V J;  2CQQ A;  4A3I J;  4BKX A;  3QPS A;  3GTO J;  3VIB A;  3VW2 A;  5K7F A;  4D5C A;  3ZQC A;  5F0H A;  1IRZ A;  4I76 A;  3NPI A;  3ON2 A;  5GPA A;  3G7R A;  2JJ7 A;  2I10 A;  3JRD A;  5EZH A;  3HOZ J;  3ANP A;  3NAU A;  3V78 A;  1MNM C;  3HIM A;  2YS9 A;  1QVU A;  1JJ8 C;  1RPW A;  5K7Z A;  3BT9 A;  5FGL A;  4DYR A;  1PUF A; 
#chains in the Genus database with same CATH topology
 2KZG A;  2OV7 A;  2NVU B;  3PQJ A;  5E3O A;  1AWC A;  2WAQ A;  4HZF A;  1J09 A;  3ZXS A;  4YIF A;  1Y1W J;  3JAM Z;  3JSJ A;  4ZH4 F;  1JKQ C;  3BR1 A;  4OMY A;  3TQN A;  3CUO A;  4RLF A;  1JKP C;  2WA0 A;  3VOK A;  5LHG A;  4KWA A;  1S5L C;  1PUF B;  3TOA A;  2K9N A;  1EH6 A;  3PIP F;  2FSW A;  4MXM A;  1FZP B;  1AU7 A;  3QWL A;  2XDV A;  3VW0 A;  2EWN A;  2Z99 A;  3CCS I;  4Y3O A;  5D8L B;  1WH7 A;  3DF8 A;  2I5U A;  3CF5 F;  3WGI A;  1XMK A;  3U1D A;  4PGG A;  3RSN A;  3VYS B;  3HTI A;  4ESF A;  4L0Y B;  3K4K A;  1KQ0 A;  4PJ0 C;  5D5W B;  4AF5 A;  3LQR A;  2R7V A;  1TNT A;  2L0K A;  4HST A;  5GAE J;  4HAM A;  4HPQ A;  1ZGW A;  2VKV A;  4PJL A;  4FX4 A;  3BJB A;  1Z7L A;  2XAJ A;  2R7U A;  2IEK A;  3ZN1 A;  1QZY A;  1R71 A;  2ZCW A;  1PP7 U;  1VTN C;  3H3Z A;  1GHC A;  3SDB A;  3R4K A;  2HQ5 A;  1U5T A;  1X3W B;  3T8T A;  1REP C;  4M73 A;  3S5R A;  4M72 A;  1IXC A;  4M71 A;  5DD4 A;  2W4S A;  1JE8 A;  3ANG A;  4WK8 F;  1B8I A;  1I5Z A;  1YX3 A;  4HDU A;  2YR2 A;  4MFD A;  5H6Q A;  2VBW A;  2ZNY A;  4GCV A;  4V2G A;  5DYM A;  4F7Z A;  3OY9 A;  3HOU J;  2KIU A;  4ZC3 A;  2ZXI A;  1CQT A;  1AKH B;  1YJW I;  2K9M A;  3H0G J;  5IP6 A;  2PFV A;  2EIJ H;  5K58 A;  3OYJ A;  2F4M B;  3BJO A;  3BR5 A;  3CP8 A;  1WFX A;  5ILV A;  1XGS A;  2RQP A;  1O7L A;  2BXY A;  2R7S A;  1S8N A;  4XRS G;  1BOA A;  1MJ9 A;  2STW A;  3R0A A;  3HUG A;  4CCK A;  4XKV A;  2O3F A;  2R5Z A;  2FMY A;  1Z3Y A;  3HTA A;  1JGG A;  4KIC A;  3RD3 A;  2EFN A;  2Q2E B;  2VON A;  1MKM A;  2QKM B;  2OF7 A;  4ZDL A;  1WRJ A;  2Y9Y A;  2RHA A;  3ROU A;  1WWX A;  4UHT A;  3NEU A;  4CCM A;  2MFZ A;  1D3Y A;  3NRV A;  3K8P C;  1HW1 A;  3M8F A;  3I56 I;  2D2W A;  3DCF A;  3WG7 H;  4BJ6 C;  1KU7 A;  4G7O F;  3V7R A;  4A6D A;  5LHH A;  1FPQ A;  1FY7 A;  3JAM K;  2FML A;  4L62 A;  4HYE A;  4AM3 A;  4Y13 A;  3S1Q J;  1ZTR A;  4C30 A;  2E1O A;  2V9K A;  4HBL A;  1J0R A;  1F43 A;  4AVZ A;  5E8I A;  5H9T A;  1T39 A;  1KQ8 A;  3W2V A;  2M0M A;  3BTJ A;  5JVG F;  5FLX Z;  2GFN A;  4C3I J;  4LK1 F;  1SFU A;  5FFZ A;  4A5M A;  3HKZ A;  3NWS A;  2R5Y A;  3JSP A;  3PFY A;  1R1V A;  3RQI A;  4DYC A;  3CCJ I;  4IOC F;  4Y17 A;  2QUF A;  2XV4 S;  4II3 A;  2DA1 A;  2IS2 A;  5D5U B;  3COA C;  2KIF A;  2YVX A;  4EGZ A;  1IN6 A;  4OWR B;  3WTV C;  5D5V B;  1KA8 A;  3VW1 A;  5KNL A;  4V2F A;  2FOK A;  3DTK A;  2VPL A;  4N9I A;  1SVL A;  3OS1 A;  2VL8 A;  2W82 A;  4ZZD A;  3MKW B;  3DV8 A;  3S3O A;  3VEP A;  3S2W A;  2HZT A;  1MBE A;  4LJZ F;  4E7Z A;  5CJ9 A;  1U2W A;  4N4N B;  1I3A A;  1H0M A;  3HOW J;  1IV8 A;  3VP5 A;  2RRE A;  3LWF A;  5B3S H;  1FMV A;  5ICG A;  4C2T A;  5D1R A;  5LEK A;  1X58 A;  1LJ9 A;  5EYR A;  2UXO A;  1LDJ A;  3LA2 A;  2QLZ A;  2R7Z J;  4FX0 A;  2UUZ A;  3HC7 A;  2PG4 A;  1KZH A;  3O2P E;  2O5R A;  3DPT A;  3F1B A;  3K4L A;  2A05 A;  4NEL A;  2K02 A;  3BJ6 A;  2O03 A;  5A2Q Z;  2Y31 A;  2Q0O A;  3IH3 A;  2DJI A;  3L2R A;  4EJT A;  5FKN A;  4G7H F;  1MMD A;  2A6H F;  1DDN A;  4KUM A;  1G4D A;  2HOS A;  3LSK A;  2E35 A;  4ZYH A;  1X1D A;  2F5V A;  4BDZ A;  2BVL A;  1WJ5 A;  4F55 A;  3VDX A;  2EV0 A;  5J6X A;  2BYV E;  5ERI A;  3BCA A;  3PO3 J;  4D0P A;  4NBQ A;  1T0F C;  3WU1 B;  1RUN A;  4DQ2 A;  4BEH A;  4CCL A;  1Z7U A;  3KP3 A;  3L00 A;  5H6R A;  3GTM J;  2PFB A;  2P5V A;  1F4K A;  2BBY A;  4CYD A;  3I54 A;  3OV8 A;  5EGO B;  1X1B A;  4JBA A;  5FRM A;  2HQA A;  5GAG J;  5KVR A;  4ZYD A;  3QRF F;  4IQJ A;  1BJA A;  2LK2 A;  4I0A A;  1XMA A;  3CDL A;  1FTT A;  3VTI A;  1JXS A;  1IV6 A;  3MMY B;  4UDS A;  4HQM A;  3DFG A;  3I59 A;  2LTP A;  5EDN A;  5C4J J;  1WQ2 A;  1OIS A;  2VJ4 A;  3VSL A;  2O8K A;  3S15 J;  3G4S I;  2L7F P;  2BHY A;  4XKB A;  4X0G A;  1T38 A;  5LEJ A;  2E1C A;  2C6Y A;  3W6V A;  2D1V A;  3HHH A;  2XDN A;  4ICH A;  3V7S A;  4PCQ A;  2M87 A;  4G8X A;  2E2H J;  1XGN A;  3IHU A;  2TRT A;  2R7F A;  2DJN A;  5D4R A;  4PDK A;  3IWF A;  2FQ4 A;  1J5Y A;  2RV8 A;  1ZG3 A;  4LLL A;  2L9R A;  5L3F A;  3BJA A;  3C18 A;  3M8J A;  2A68 F;  1A31 A;  1DPU A;  2NVT J;  1UB9 A;  3S1M J;  4RAZ A;  3M9A A;  4M6Y A;  1ETY A;  2DO7 A;  1I6H J;  4N0B A;  4XOT A;  1P4X A;  3CJD A;  1YI2 I;  3FXO A;  4E7S A;  4KIF A;  2UXU A;  1Y8R B;  3BHQ A;  3F23 A;  2UXX A;  3G3Z A;  2IVM A;  4UV8 A;  5EZG A;  5BNG A;  5CPR B;  2EV6 A;  4MGR A;  5EF6 A;  3GXO A;  3REO A;  5B1B H;  2WAF A;  3MZ8 A;  2QCO A;  4UNO A;  4IEJ A;  2V57 A;  2QA4 I;  3IUV A;  3MQ0 A;  3M4O J;  3RPQ A;  5M3M J;  1EA3 A;  2Z5U A;  2PJR B;  1Z67 A;  1LEA A;  1Y8Q B;  1B4A A;  3LFU A;  3RCO A;  3BG5 A;  1SVM A;  2F2E A;  4MTE A;  4FCY A;  3CUQ A;  2ADU A;  2F5E A;  1T98 A;  2EK5 A;  4B1R A;  2E1M C;  3FBI B;  3DU6 A;  4DVY P;  4KIG A;  3S2D J;  2CG4 A;  2XKP A;  3LJL A;  4C2M A;  2JPB A;  3EUH C;  4KMU X;  3BG9 A;  2B3W A;  1QBJ A;  3B6C A;  2M8G X;  2H8W A;  2M5W A;  3DTE A;  1V4R A;  5FMP A;  4L0Z B;  1W5T A;  4CXF A;  2VBY A;  3ON4 A;  2VAS A;  3AG2 H;  2LBF B;  3JSO A;  3KP6 A;  1WPK A;  3VOX A;  2M45 A;  2KRH A;  4KYW A;  3CJR B;  1F1Z A;  4DW6 A;  5FLV A;  5C4Y A;  3E5X A;  1TC3 C;  2IS4 A;  4H4K C;  2UXH A;  2DFF A;  2XVC A;  1SGM A;  2RAS A;  2A07 F;  2X6X A;  3AKZ A;  1VQ5 I;  1BW5 A;  2COB A;  3HZJ A;  3VVY A;  3OL4 A;  4HG2 A;  2HZD A;  2DCE A;  3LAJ A;  4CZC A;  1HOM A;  3LNQ A;  2XAQ A;  3BZC A;  4JX4 A;  2DTZ A;  4B3X A;  2EZI A;  2NS7 A;  1GT0 C;  4R79 A;  1JUS A;  3I5U A;  2LMD A;  1R22 A;  5CYV A;  4AID A;  1O3T A;  1USS A;  2ZXW H;  3LST A;  2JWT A;  2XIG A;  2NRA C;  3AG3 H;  4IVN A;  4CSW A;  5E18 F;  4BY1 J;  3GTJ J;  1T33 A;  3JRI A;  2E2J J;  3OL3 A;  3SHF A;  4NDL A;  2HU9 A;  4EQQ A;  1GDT A;  2P7C B;  3FXK A;  2LY2 A;  3FK7 A;  1A6Q A;  3K10 A;  2DOA A;  3IC7 A;  5D6F A;  2G3B A;  3H5N A;  2VXD A;  2UWM A;  2YPR A;  1B72 B;  2WAQ N;  3SFI A;  1FX7 A;  3BWG A;  2O6G E;  4CHU A;  1QU3 A;  2AQE A;  3C1D A;  3JTG A;  2CSO A;  1D1B A;  5JLX A;  4PSW A;  5IYC J;  2ZXH A;  3WTW C;  1B59 A;  3A01 B;  1GXQ A;  2D6Y A;  3TP0 A;  3C7J A;  4OIQ F;  1XCV A;  2L9S A;  4LD5 A;  1FOX A;  5K5Q A;  1HW5 A;  1U78 A;  2WGB A;  4GYI A;  2B0L A;  1XPX A;  3G1M A;  3QYE A;  2JMW A;  3BNI A;  2HKX A;  2XUB A;  2FA5 A;  3DU5 A;  3TDU C;  1CGP A;  4UVB A;  3VPR A;  2H8R A;  1UAA A;  5DV5 A;  3SJM A;  1OCR H;  2M9H A;  2VOP A;  1MW7 A;  4AVP A;  5E3L A;  3HPG A;  4XIC A;  4A12 A;  3VYT B;  1D1A A;  2ZY9 A;  1EH7 A;  1SD7 A;  2VC0 A;  2X0L A;  4L9N A;  2HPM A;  3HUG B;  5EJC A;  4XSX F;  1RES A;  2G7L A;  1UST A;  4YRV A;  2R5Z B;  4DJA A;  4I7H A;  2JVH A;  3FBN B;  3T1B A;  3TOB A;  2E36 A;  3IAS 2;  2HDC A;  2IT0 A;  2DA6 A;  1R5H A;  3HGY A;  5KK1 A;  4HQE A;  2H1K A;  4KFC A;  3O8H A;  4FQG A;  1AA7 A;  4QIW N;  4AD9 A;  3HOV J;  5ED4 A;  5E8G A;  3P7N A;  2Z16 A;  4P9F A;  2XRO A;  3CCM I;  4A0X A;  2VQG A;  4MFE A;  1C0W A;  1S7E A;  4P9U A;  2MAB A;  9ANT A;  4ENK A;  2OTJ I;  2UXN A;  3RPU D;  1HKS A;  3BLY A;  3IUO A;  1YYV A;  2DMP A;  4MK6 A;  2K27 A;  4G9Y A;  4RGR A;  3S8P A;  3BZK A;  5CVR A;  2A5W A;  4UUT A;  1V55 H;  4RB2 C;  4AIK A;  4EJW A;  1U5T C;  3IP4 B;  4C2U A;  2BW3 A;  1P6R A;  2CUZ A;  4A3D J;  5F0F A;  3ZQ7 A;  3JRH A;  3CO6 C;  3GLX A;  2JA6 J;  1DP3 A;  1U0J A;  4LGW A;  3ERM A;  4XM3 A;  5L3C A;  1V3F A;  1TQI A;  1Y1V J;  2CQQ A;  3QPS A;  3GTO J;  4A6E A;  1UZC A;  1YW9 A;  1BR2 A;  2OU2 A;  5F0H A;  3ON2 A;  5GPA A;  2JJ7 A;  3ANP A;  3JRD A;  3OOP A;  3W6J B;  2WY7 Q;  2E5Z A;  2EV5 A;  1XGO A;  2WV0 A;  3DQV C;  4LIU A;  1IZ1 A;  1IDZ A;  2LRD A;  1Y39 A;  4IPA A;  1Z21 A;  3RJP A;  3BG3 A;  3JRB A;  1FYK A;  2FXA A;  4ESJ A;  2XGD A;  2GXB A;  4A3K J;  1ZKG A;  1B1B A;  3S16 J;  2OZ6 A;  4LMY A;  1IAW A;  2KZV A;  3FM3 A;  5EEA A;  5C44 J;  2W7N A;  2IGK A;  1S3J A;  1E3H A;  2KL4 A;  3HKZ N;  3OYN A;  1MD0 A;  3ZMV A;  4DOZ A;  1X1A A;  2Q8K A;  3S1R J;  2ME0 A;  2ZFW A;  1K61 A;  1VQN I;  2HR3 A;  3BPV A;  1D8J A;  3KKD A;  3CLQ A;  4EM1 A;  1SD5 A;  4E7J A;  4J19 A;  2Z33 A;  2VT2 A;  4HRI A;  2HS5 A;  1QGP A;  2NP5 A;  1FIA A;  5AIQ A;  1BIB A;  2R92 J;  3OSG A;  3OMY A;  3GZ6 A;  1GLN A;  1ZLJ A;  1IW7 F;  2GXA A;  2DFE A;  3TP3 A;  2CUJ A;  3OIO A;  2I8D A;  4LIT A;  4B09 A;  4PXI A;  4QSH A;  4IHX A;  3AL0 B;  4B8X A;  1VQM I;  1VFC A;  2L5Q A;  5FRO A;  4XLP F;  2BY2 A;  1ON2 A;  2EA2 A;  2K7L A;  3IWZ A;  2PJP A;  2GOX B;  3S2H J;  2XRN A;  1U9O A;  2K9S A;  1SFX A;  5BMZ A;  4UVC A;  4U0V A;  2BY1 A;  3BZ6 A;  5J8F A;  2HI3 A;  4ON0 A;  3OR2 C;  1UI5 A;  4ACI A;  1I39 A;  1J9I A;  2VOO A;  1JUM A;  4F52 A;  3VB2 A;  5HDN A;  2CRG A;  4P5O A;  2IRF G;  3R0J A;  3JR9 A;  1V5G A;  1BIA A;  2OCE A;  4KT5 C;  5LGU A;  3CO7 C;  4BAC A;  5IP7 J;  4IX7 A;  4Q47 A;  2HVS A;  2BE5 F;  1A36 A;  1S29 A;  5E79 C;  3ZN0 A;  1ZN2 A;  4X1E A;  1ON1 A;  1CF7 B;  4YG2 F;  3M3Y J;  2K9Q A;  1S7O A;  2F48 A;  4I09 A;  4UUS B;  4JNN A;  1GVD A;  4S0H B;  1NH3 A;  2HYJ A;  4GFK A;  5HSZ A;  2WB1 N;  3KP7 A;  3S14 J;  3OYB A;  2X1D A;  2IXS A;  5FO5 A;  1ODD A;  4XN0 A;  3SZG A;  3SEQ A;  2HOT A;  2W48 A;  2Y9Z A;  1H88 C;  1XC5 A;  5CVJ A;  5DCF A;  2ZME A;  3WHB A;  3C2H A;  4RS8 A;  4FAS D;  4M3B A;  2Y48 A;  2CFO A;  2DFH A;  2VKE A;  5ICF A;  3CC2 I;  1EF4 A;  2E19 A;  1T8I A;  4C9Y A;  4LOC A;  4M3E A;  3K70 D;  3KP2 A;  5C4X J;  4CA0 A;  1TW2 A;  1TWH J;  1WI3 A;  2NOJ B;  3IRQ A;  2FQ3 A;  1IJW C;  3OYA A;  4GCT A;  2DQL A;  5GTI C;  3S32 A;  3DEU A;  3TO7 A;  2VLA A;  2LY9 A;  2R3S A;  3CDI A;  4WXC A;  4BJ5 C;  2DPD A;  2F5C A;  2K3P A;  5HBU A;  3BY6 A;  3PM1 A;  4LB6 B;  3CD6 I;  4EJU A;  2K4J A;  3UNG C;  1YS6 A;  1O3R A;  1ACI A;  3CMA I;  5AON A;  2A3S A;  3A0B C;  1YX5 A;  3X2Q H;  1VQ4 I;  5B1A H;  2RNJ A;  4A3L J;  5H2F C;  2ZXJ A;  4ENM A;  1FNN A;  1Z1D A;  3A03 A;  3ZGK A;  3K4N A;  3I55 I;  3DBH B;  3I4M J;  2K9L A;  2OUM A;  3K0L A;  3CRJ A;  3OYL A;  3JCU C;  1W7P A;  1IF1 A;  4GFL A;  3DPJ A;  1H9G A;  3PL8 A;  4IZZ A;  2HFH A;  3WTT C;  2L7M P;  1B9N A;  1ETV A;  3MVP A;  1FT9 A;  1FBS A;  3KLO A;  5M5X J;  3S3N A;  2EQR A;  3MKL A;  2QIB A;  3D1N I;  1BI3 A;  2MYS A;  3OYG A;  4G6D A;  1W7P D;  1SD6 A;  1SAX A;  4XOP A;  2DA2 A;  1YIJ I;  2HKO A;  1BI0 A;  1QHH D;  2Y0M A;  1UHS A;  3JRA A;  1MMA A;  3M07 A;  5HLT A;  4PUS A;  3RYP A;  3P9I A;  4EAT A;  1T6S A;  1N75 A;  1HQC A;  2GA1 A;  4YEL A;  2YX7 A;  3ECH A;  3I53 A;  3OIP A;  3MFK A;  3H0D A;  2NOG A;  3LFK A;  3R60 A;  4I99 C;  4F92 B;  1W0U A;  3G1L A;  1MJB A;  3LSJ A;  3T8R A;  3TKY A;  2DG8 A;  2TCT A;  2V9P A;  3VWB A;  1FBU A;  2LOO A;  1ETQ A;  4YEJ A;  1D8K A;  1PJR A;  4M3D A;  3QU3 A;  4RAY A;  2FEZ A;  4OAZ A;  1A6I A;  4B4C A;  3HBL A;  2DDB A;  3LSG A;  2B9S A;  4LIV A;  2HVR A;  2FBQ A;  1GUU A;  2CUE A;  1PYV A;  3KP4 A;  2PN6 A;  3BC8 A;  5DS9 A;  3OYK A;  4BGD A;  3GUD A;  1I6X A;  2KT0 A;  1DGW Y;  4HNV A;  5CVV A;  3HEF A;  2VUM J;  4O3M A;  5DDG A;  1JTY A;  3CUQ C;  1KON A;  1E17 A;  2EZL A;  3K4C A;  3OWT A;  4ZTF A;  5DTD A;  1XN7 A;  2LC2 A;  1BL0 A;  2A61 A;  3TBI A;  3MWM A;  1MSE C;  3HSR A;  4MLO A;  5J4Y A;  3F22 A;  4WWC A;  2EIN H;  1OPC A;  2AXL A;  3LA3 A;  3FIS A;  4YIR X;  1D1C A;  2XAS A;  4BXX J;  4I98 B;  3CQZ J;  2O0Y A;  4LG0 A;  3T6N A;  1R5I D;  2M2E A;  3ZMU A;  2QEN A;  3M8E A;  3H3V K;  4LFU A;  3PSF A;  1VQK I;  2VQL A;  3KCC A;  4RLQ A;  4HF2 A;  4II2 A;  3PQK A;  3CMY A;  2OD5 A;  2R7W A;  1Y56 A;  1XSV A;  2HYF A;  3L9F A;  3K1P A;  3F8C A;  1V5F A;  2A6E F;  4PFO A;  2CH0 A;  3P9T A;  2BY3 A;  3KPH A;  3DBL B;  1QZZ A;  1SVO A;  1V54 H;  4W1U A;  2ZJR F;  4UXN A;  1X4P A;  2F4O B;  2JSP A;  3CES A;  1X2N A;  5ILU A;  2P81 A;  3M1C A;  5J8C A;  3K7A J;  5CQG A;  3CCY A;  2RQQ A;  2NP3 A;  2ZCM A;  5HDG A;  3OYC A;  3KZZ A;  2MG4 A;  2LF8 A;  2QBY A;  4A3F J;  3PUF A;  3C07 A;  1TQM A;  1HKQ A;  3GZN B;  2MSY A;  4M74 A;  3WE3 A;  5TIS C;  1QO0 D;  3ZQQ A;  1RNL A;  3FXM A;  4W97 A;  4C3H J;  1XS9 A;  1AHD P;  2QSH X;  2L01 A;  4RB3 C;  3A1Y A;  3KZ9 A;  3VUQ A;  1OMI A;  4BE1 A;  3BCG A;  1BI2 A;  3CLO A;  3MAJ A;  4IOA F;  4XKC A;  2WAE A;  1UHW A;  3HRS A;  1UHM A;  5J1Y A;  2QYO A;  1N77 A;  1E3P A;  2F07 A;  2HYG D;  2REK A;  1I27 A;  2XHK A;  2YVH A;  4JQF A;  1U8B A;  3EET A;  4B44 A;  1STZ A;  1RR8 C;  1RRJ A;  1UCR A;  3SYT A;  3SZT A;  2QQ8 A;  3I64 A;  3MKY B;  3MNL A;  1IUY A;  1WJB A;  3JRC A;  2QOP A;  3QPL A;  3BTC A;  2BW3 B;  2NX4 A;  4XRS A;  1MJA A;  5CXG A;  2L3D A;  4OIP F;  5DUI A;  4WX9 A;  4ENJ A;  3I71 A;  4XK4 A;  2ZBK A;  5EG0 B;  2DAO A;  1FC3 A;  1W5C C;  3I58 A;  3CC7 I;  2ZOZ A;  3H9G A;  5JR3 A;  2HEO A;  2HOE A;  3DWL E;  2FJ1 A;  4D1Q A;  3ZQF A;  4G6T B;  4GCL A;  3LSH A;  4XR6 A;  4OIO F;  2Z1D A;  1FP1 D;  2O8X A;  2JN6 A;  3KYD B;  3MEX A;  1DUX C;  3F8M A;  3GTL J;  3LHQ A;  1TBX A;  1RI7 A;  2GIV A;  2L4M A;  2H6C A;  3HGG A;  1L0O C;  3LSP A;  1K78 B;  2G7G A;  4OOI A;  3PSI A;  1JT6 A;  1Y6I A;  2FE3 A;  3TO9 A;  3GX4 X;  2R93 J;  2OJE D;  1LKX A;  3E97 A;  4G6Q A;  3I9V 2;  4GYG A;  5DCM A;  2WB1 A;  1NG6 A;  4ETS A;  2LKX A;  3DXJ F;  1P7I A;  4BHC A;  3WU2 C;  3FK6 A;  3G2B A;  3BQZ A;  3H1C A;  3HIF A;  3P5J A;  5CW8 A;  4FE7 A;  1U6G A;  1LVK A;  2L2O A;  1FJL A;  3FZV A;  1F5T A;  3HDD A;  1POG A;  4XLC A;  3ZRG A;  1U3E M;  4GGG A;  3IKT A;  3LSR A;  2QEX I;  1MDM A;  1ZG5 A;  2KMU A;  5CVI A;  2MA3 A;  3ASO H;  5FLX K;  1LE8 B;  3G1O A;  2JRT A;  3GME A;  4UY8 I;  4PZJ A;  2FBK A;  2E1M B;  4KN4 X;  3ZQH A;  2R7O A;  3HTH A;  1ZAR A;  5ICE A;  1H9T A;  3MN2 A;  2B63 J;  3JW4 A;  5L3D A;  4JX6 A;  1I3Q J;  1A5J A;  3NXC A;  2FU4 A;  1MBF A;  3RYR A;  1WH5 A;  3J80 Z;  4HLY A;  2H27 A;  3BP8 A;  3PNV A;  1H89 C;  2FOW A;  2XRL A;  2XGC A;  4BJT A;  1UJ8 A;  4Q5S F;  3TMO A;  1Z3X A;  2M7B A;  2LF7 A;  3BQY A;  3V7C A;  5BOX A;  5J1U A;  1VQL I;  2P5L C;  3ABT A;  1YHQ I;  4RAF A;  3K69 A;  3FX3 A;  4DZP A;  4MTD A;  1ZK8 A;  3HYI A;  1FOY A;  1TP4 A;  5F64 A;  2XSD C;  1I1S A;  3ABK H;  3AAF A;  4U7D A;  4EGY A;  2PZ9 A;  4YFX F;  1S72 I;  1MBJ A;  2EZH A;  5HOO A;  5E1Z B;  1P92 A;  3TGN A;  2DA4 A;  4ZYG A;  4A3C J;  1W4M A;  1X2M A;  3VSK A;  1YRN A;  5A2Q K;  3FHZ A;  1QZE A;  2QTQ A;  5IOY A;  1TL8 A;  1R00 A;  2JPC A;  2IU5 A;  3QPH A;  1R23 A;  3ISP A;  1ETK A;  5F27 A;  1D0Z A;  4CDG A;  2LSO A;  2CGP A;  2E60 A;  4XRF A;  4FTH A;  3P9C A;  3QKX A;  5M5Y J;  1LFP A;  2HYT A;  4UUV A;  2ECB A;  2FX0 A;  3AFH A;  2ICW G;  2VQH A;  3ZOB A;  4Q4Z F;  1PVE A;  2ZCX A;  3WTZ A;  2OBP A;  2DFI A;  2BZT A;  1OYW A;  3TW6 A;  4E70 A;  2W53 A;  3F3X A;  1BR1 A;  3OSF A;  1XCB A;  2DU9 A;  2FRH A;  4BKX A;  4HNU A;  3E6D A;  4D5C A;  1W36 D;  3KEY A;  1IRZ A;  3NPI A;  3RQ4 A;  2I10 A;  3HOZ J;  3CCU I;  5HNF A;  3V78 A;  1MNM C;  2YS9 A;  1MMS A;  1WJE A;  1FSH A;  2IA1 A;  3EUA A;  1PUF A;  1ONV A;  2X51 A;  1LNW A;  3MZY A;  1VQ9 I;  4IL6 C;  3H36 A;  1ORK A;  4U9L A;  4DZJ A;  2A69 F;  1BN5 A;  2X6O A;  2W00 A;  2QQA A;  4NN1 A;  1P4W A;  2NAZ A;  4XOR A;  5IYB J;  3A4C A;  2YU3 A;  4NB5 A;  3CDH A;  5K1Y A;  2M1B A;  1XG1 A;  3GO5 A;  1UEL B;  2WC2 A;  2ZOY A;  3WOD F;  2VC1 A;  3H9J A;  3O8G A;  2VBZ A;  2LP0 A;  2LNB A;  1OCC H;  2QSG X;  3K70 C;  2G7S A;  2W84 A;  3ESW B;  1QHG A;  2KP6 A;  4A3M J;  2GQQ A;  3J80 K;  2N8G A;  4HV5 A;  4UV9 A;  5KAI C;  5ICC A;  2VB6 A;  2ZME C;  2P6S A;  1D0Y A;  2OAZ A;  3U21 A;  3V8K A;  1NK3 P;  3AQS A;  5D18 A;  2FUG 2;  1WJA A;  2XSJ C;  5HS8 A;  4GRI A;  2UXP A;  3RTR A;  3ML6 A;  2MLK A;  1OCO H;  2KRC A;  3L2U A;  3OYI A;  1NK2 P;  2MH9 A;  1YIT I;  3D5R C;  4HV6 A;  2L54 A;  1I50 J;  3GTP J;  4J00 A;  4M6X A;  1EJ9 A;  3DKY A;  3GF2 A;  3HRU A;  2QF7 A;  1AKH A;  2G0E A;  1ZHF A;  1HKT A;  4DYR A;  1LUJ B;  3OS0 A;  4PJJ A;  1R4M B;  2HPI A;  2QQB A;  4JKZ A;  5L3B A;  3MZH A;  1UG2 A;  5J1R A;  2NNN A;  3J7A Y;  2G9W A;  1U5T B;  2UXI A;  4ZDO A;  4M3F A;  5F08 A;  3KNW A;  4L18 B;  4EM2 A;  4JL3 A;  3L1P A;  3GLL A;  1LPQ A;  2P0W A;  1B8I B;  2ME6 A;  4XSZ F;  2KHM A;  4YII A;  3E6M A;  3A0H C;  2KFD A;  2R4G A;  4P55 A;  5EEH A;  4I01 A;  1YLF A;  4Y7N J;  2Q2E A;  1IRG A;  2NVQ J;  5FGM A;  1K4S A;  2BOL A;  2WV1 A;  1DU0 A;  1J2X A;  3C2G A;  2X1C A;  2PX9 A;  1BJZ A;  1GV5 A;  2CW0 F;  5F1R A;  3WHC A;  1B6A A;  2RVC A;  4M9X A;  1BI1 A;  3F6V A;  5FJ8 J;  2V7F A;  2JK3 A;  3HTS B;  3IAM 2;  3K2A A;  4Y33 A;  1YG2 A;  2KJB A;  4B48 A;  3CZ6 A;  3QOE A;  4HF1 A;  3Q5F A;  1ZYR F;  2XAF A;  1YE9 A;  1X1C A;  3MCZ A;  3ZMZ A;  4RB1 A;  1G2H A;  5J47 A;  2HDW A;  2PEX A;  4RM3 A;  3RPU A;  2NVY J;  2TDX A;  4ZTJ A;  1MZB A;  2LKP A;  4BAY A;  1F36 A;  1E3O C;  4LG0 B;  1R36 A;  1OYY A;  3WG9 A;  4HA8 A;  2DK8 A;  5E20 A;  5LD2 C;  3N05 A;  2MGQ A;  2OA4 A;  2EFW A;  2E7X A;  2PQ8 A;  1QA6 A;  1I1G A;  5CLS A;  3B6A A;  4XMY A;  4S04 A;  1G3W A;  1TLH B;  2DT6 A;  4RMN A;  1SEU A;  1E0E A;  2IS6 A;  2ZCN A;  1XGM A;  2Y75 A;  2JT1 A;  3V4G A;  3QYF A;  3GWZ A;  4D7M A;  4HKU A;  4M3G A;  1YJN I;  2X4H A;  4FET A;  4F93 B;  2X85 A;  2XF5 A;  2CWE A;  1QPI A;  3DKW A;  3BR3 A;  4UVA A;  4V19 K;  1MSF C;  2NNY A;  4OIN F;  2YUS A;  1RET A;  1SMY F;  1P4A A;  1MNE A;  5DD8 A;  1K7A A;  5JVT A;  2DQR A;  2R5Y B;  1MBG A;  1OLT A;  3OYH A;  3W2A A;  1ZRD A;  2DYR H;  1WCM J;  4L5J A;  4Y15 A;  4IJA A;  4FE4 A;  1ZRE A;  4BDY A;  2BHZ A;  5DAJ A;  3DPU A;  5AIP A;  2KLO A;  1MMG A;  4HSR A;  4ANJ A;  4YFN F;  3J7Y J;  1XTA A;  2OTL I;  3GCM A;  1G59 A;  3G73 A;  1JHH A;  2MW8 A;  3CWR A;  3A02 A;  1APL C;  5HDK A;  1IN7 A;  4B43 A;  3B02 A;  3TL4 X;  4XLF A;  1RIO H;  4A2U A;  1Z05 A;  2CYY A;  3NRG A;  2DMN A;  1IG7 A;  3GTG J;  2DOD A;  4WXD A;  2KQR A;  1ITY A;  3PO2 J;  4A69 C;  2X9D A;  2JA5 J;  1WI9 A;  4ESB A;  2DMT A;  2ZSH B;  2GOM A;  2O7O A;  5KAF C;  1YW7 A;  2Z2S B;  2ZB9 A;  2EJR A;  3ABL H;  2R7X A;  3O3K A;  4CO8 A;  1WZ2 A;  5LRS A;  3CP2 A;  1R5G A;  4BUP A;  5M5W J;  5IOZ A;  3E5Q A;  2ZJ2 A;  2CQK A;  3SEZ A;  1T2K A;  2IPQ X;  2DT7 B;  3FXQ A;  4GFB A;  4U9N A;  4Z6Y A;  1OQY A;  4UB6 C;  1L3L A;  2XPV A;  2Z9O A;  1TW3 A;  2E71 A;  3EYI A;  4RBO A;  2CMP A;  2VI6 A;  1ZR2 A;  2P7V B;  2X6Y A;  3FKI J;  4BBR J;  3C2B A;  2P4W A;  1YJ9 I;  2PLY A;  3FHN A;  4B3A A;  1BC8 C;  5IT9 Z;  2AQF A;  4S05 A;  2ZJQ F;  4HDV A;  1IXS B;  2XF6 A;  5FHP A;  1IN5 A;  2RKH A;  1UFM A;  2EFP A;  3PIO F;  2ECC A;  3P9K A;  3DEW A;  2VE9 A;  5GAH J;  4NQW A;  3E5U A;  5HS7 A;  1ZLK A;  3BDD A;  1SFE A;  4KDP A;  3F6O A;  4BEH B;  4AIH A;  3K4M A;  1R7J A;  4UB8 C;  1X19 A;  1Y0U A;  2ELJ A;  4RA2 A;  4CCN A;  3FIW A;  3HM5 A;  2XPW A;  3F8B A;  3HOX J;  5FKK A;  2A2F X;  4D7N A;  3GFJ A;  1FOK A;  1JUP A;  2IGO A;  1LEB A;  2YX4 A;  2DK5 A;  4HEA 2;  1HDD C;  2RN7 A;  2D45 A;  3I59 B;  4N4O B;  2K85 A;  2BVM A;  3QP5 A;  2FF4 A;  1BA5 A;  4XL9 A;  1U9N A;  1QNT A;  1TT0 A;  1HF0 A;  1R4N B;  4LLN A;  1ETW A;  1Z0X A;  3I0T A;  1TTY A;  4PGH A;  1FMW A;  2OQR A;  2JA8 J;  3H3U A;  3GTQ J;  5EFY A;  3BOQ A;  2WUI A;  1WJC A;  4CCO A;  1LDD A;  1BOB A;  4PJM A;  2ZNZ A;  3NS4 A;  4F3Q A;  2X1E A;  4OIR F;  4XNF A;  3NQO A;  4JYK A;  5HAW A;  4NC6 A;  2PJR A;  4QTR A;  1OJL A;  2V1X A;  2MBF A;  4AC0 A;  1ZEL A;  1MMN A;  2V79 A;  2M0C A;  5LGT A;  2YVE A;  2JSC A;  6PAX A;  1HDP A;  3E7L A;  2V6C A;  1MH3 A;  1FEX A;  4CCJ A;  5DUK A;  3OYF A;  1D0X A;  4BQO A;  3ONQ A;  3NNR A;  2O61 A;  2LYC A;  3QU6 A;  3SXY A;  3ZP5 A;  2UZK A;  3OIQ A;  2XF7 A;  5LHI A;  3N97 A;  3LSI A;  2Y69 H;  4FIS A;  3BRU A;  3QPT A;  3F21 A;  3LOC A;  2E7W A;  1YQA A;  4U88 A;  4XLE A;  2ELH A;  3KFW X;  2R7R A;  5AQC A;  1JT0 A;  3V6G A;  3CUQ B;  4CGR A;  1WHU A;  3Q9S A;  2KJC A;  3CCE I;  1BR4 A;  4AYB N;  2P6T A;  2XPU A;  1OCZ H;  4RGX A;  4RM2 A;  2LFB A;  1R49 A;  1R1T A;  1DU6 A;  4AUX A;  1JKO C;  2M8E A;  2AS5 F;  2GM4 A;  3C3W A;  1FSE A;  5E1X A;  3ZR8 X;  4EM0 B;  5JHF A;  4A3B J;  2X6W A;  3IRR A;  1WJD A;  1WKM A;  3I3L A;  4IRI A;  3K4J A;  1ETX A;  2LRE A;  3RKX A;  1IRX A;  4AU7 A;  1HCR A;  3EGQ A;  2WTE A;  5HS9 A;  5BPI A;  4LG3 A;  4A0Y A;  4BBS J;  4I6Z A;  3HSE A;  1A35 A;  4PFP A;  1OR7 A;  1IDY A;  2OZU A;  4XRM A;  3O60 A;  3R6S A;  3RDI A;  2Z3Y A;  3NAR A;  2EA4 A;  2Q24 A;  3WTX C;  3V42 A;  3GFL A;  4YZE A;  1A04 A;  4HOB A;  3RI4 A;  3CCV I;  1OKR A;  1D5V A;  1J75 A;  4JP0 A;  1GV2 A;  4ZZL A;  5KHD A;  1U8R A;  2OCC H;  4EMS A;  3R61 A;  2JRM A;  3IV5 A;  1B72 A;  4IHY A;  4MO7 A;  3FWE A;  1JTX A;  3BRO A;  2M34 A;  1FIP A;  3FKJ A;  4NNJ A;  2HWV A;  2ISZ A;  1K6Y A;  2LD5 A;  1W36 C;  5BS6 A;  2ESH A;  1EV7 A;  2HNH A;  4P1W A;  3A01 A;  1PDN C;  1GVJ A;  4IRV A;  2STT A;  2F4I A;  3JRE A;  1YO5 C;  2JTV A;  2QM3 A;  1MIJ A;  4X6A J;  1FYL A;  3KKC A;  4U7B A;  4ZYA A;  2VXZ A;  4XQF A;  1MGT A;  2IJL A;  3CC4 I;  4U0Y A;  3J7Z I;  4WCG A;  1VQO I;  1SMT A;  2HTJ A;  3K4B A;  2QKO A;  4DBR A;  2H1L A;  3TO6 A;  3IL2 A;  1PUE E;  1WVR A;  4DNC A;  2FJI 1;  3VYU B;  5JI6 A;  2R0Q C;  4O5V A;  3HXL A;  5IT3 A;  4OD5 A;  1J59 A;  5CVU A;  3ZMD A;  1MH4 A;  3Q3S A;  1BC7 C;  1W5S A;  5E3N A;  2K86 A;  4OAY A;  3RKW A;  3OYM A;  4XKW A;  4GCK A;  1JI8 A;  2NS0 A;  5B5E C;  1YFH A;  5E1W A;  3CME I;  4KIS A;  3GVA A;  2JQ7 A;  5F04 A;  1ENH A;  1YW8 A;  2JUC A;  5LRR A;  1LFU P;  2CV0 A;  3L7W A;  2PBI A;  4BE2 A;  2F5F A;  1SFO J;  3COL A;  2HKU A;  2XC7 A;  2M4K A;  4A5N A;  4IO9 F;  1HST A;  2DYS H;  3FMQ A;  4G12 A;  1P9Q C;  2J5O A;  3Q0U A;  2VKH A;  5J40 A;  1KU9 A;  4WF2 A;  3RZD J;  1RZ4 A;  3PJR A;  2LY1 A;  2V26 A;  2W25 A;  3DEE A;  5EEG A;  2VJJ A;  1XX5 A;  3KP5 A;  3QAH A;  3HRM A;  3G56 A;  4KMF A;  2K3F A;  3B73 A;  2IBD A;  4HF0 A;  3FXU A;  3IH4 A;  2IAI A;  4MEY F;  2W85 A;  4XLA A;  2FBH A;  2VN2 A;  2GXG A;  1JHF A;  4FT8 A;  1W0T A;  3QQA A;  2M4G A;  2JA2 A;  4DYQ A;  3LA7 A;  2AXT C;  2GBY A;  2ISY A;  1E2X A;  2CO5 A;  5DEQ A;  4A3I J;  3VIB A;  5FD5 A;  5K7F A;  3HL2 A;  3L09 A;  1S9H A;  4ITV A;  3HOS A;  4I76 A;  1DP7 P;  4QPQ A;  2H94 A;  2VBX A;  3NAU A;  5K5R A;  3HJE A;  2B1E A;  4AIJ A;  2LH9 A;  2RGV A;  5FB2 A;  3KEQ A;  1G6N A;  3BT9 A;  2V1D A;  2EFO A;  1ZR4 A;  2HQR A;  3UKG A;  3FXR A;  4JK1 X;  3ZMS A;  3GTK J;  4Q48 A;  2LLK A;  1DGR M;  4Z2Y A;  4D9J A;  2OI8 A;  1Q1H A;  1IN8 A;  2DI3 A;  3S3M A;  1VQ8 I;  1X1P A;  1FWZ A;  5IY5 H;  1TWF J;  1LQ1 A;  5LLQ A;  5L3E A;  1G8X A;  3LL7 A;  5E17 F;  2DN0 A;  3HRT A;  3VOD A;  1HW2 A;  3TED A;  1V5E A;  4L9V A;  2R7D A;  4ZYE A;  1WSU A;  5FRN A;  3CCR I;  3GBG A;  2HOA A;  1IO2 A;  1SAU A;  3EYY A;  4IHV A;  1G3Y A;  3FDY A;  2AHQ A;  5F0C A;  1SFK A;  2MC3 A;  4EEF G;  5HLG A;  4CYC A;  4JOM A;  2G7U A;  4CIC A;  5IYD J;  1T08 B;  4IF4 A;  2RDP A;  3W3C A;  3WGG A;  3AG1 H;  5HLH A;  4BL0 B;  1XSD A;  2CUF A;  4FHT A;  1TNS A;  4KIT B;  4BS9 A;  2F5D A;  4GXO A;  4RAG A;  3BG6 A;  3JTH A;  4MHG A;  1X3Z B;  1RKW A;  1NHA A;  2CW7 A;  2H09 A;  4XN3 A;  4BE0 A;  2NYX A;  2QWW A;  3H5R A;  4BYY A;  1M1E B;  5BQT A;  4BHB A;  2B7E A;  5J4V A;  4L5I A;  2KRF A;  1ZG1 A;  3L2C A;  4MQ9 F;  2CS3 A;  1FLI A;  3KZY A;  4KN7 X;  3BCB A;  2QWT A;  2CQX A;  4A3J J;  1O4X A;  4HX8 A;  4KJZ A;  1IXR C;  3BTI A;  2Y0S A;  3QOP A;  1T56 A;  2X48 A;  1R58 A;  2CU7 A;  3HHG A;  3ZQL A;  4LLG F;  2DPU A;  1QVT A;  3H9Q A;  2KIQ A;  3VOE A;  3BR6 A;  4E7L A;  4U87 A;  4NQW B;  2H6B A;  3V8J A;  1CF7 A;  2GAU A;  2W57 A;  4PK4 A;  2ZSI B;  3WTS C;  5BPD A;  3ZMT A;  4UUS A;  1LB2 A;  4R8H A;  2WY8 Q;  3ZQG A;  1K79 A;  3K6G A;  4IHT A;  3Q0V A;  2FD5 A;  2G7H A;  1XB4 A;  2DA3 A;  4AYB A;  1S7A A;  4KT6 A;  3FF5 A;  4HLX A;  3LMM A;  1KU3 A;  1QPM A;  1SC7 A;  3S1N J;  3OS2 A;  2XAH A;  3PFI A;  3LQQ A;  2GZW A;  3FXL A;  1TT5 B;  2RAE A;  3WTU C;  1UG0 A;  3BR0 A;  3CJN A;  5FLM J;  2KDZ A;  3KIO A;  3K9T A;  5K5O A;  3CJQ B;  2VOD A;  2ZJP F;  4IQ4 A;  3E6B A;  3K2Z A;  3W6K B;  4BY7 J;  1OFC X;  2R7T A;  1ERD A;  1VQP I;  1Z91 A;  3U2R A;  2BY0 A;  3CF2 A;  1OCP A;  4IXA A;  4XID A;  2ZME B;  3KZI C;  3EPZ A;  1O3Q A;  3DTI A;  5IP9 J;  3SDG A;  5H20 A;  2VJ5 A;  1MBK A;  1NTC A;  4JX5 A;  4NC8 A;  1UMQ A;  3G71 I;  3L2V A;  2F6C A;  3GW2 A;  4M6V A;  3HTJ A;  4CH7 A;  5DM6 F;  3ZQI A;  4DBQ A;  4G7Z F;  4I2O A;  3GEU A;  1GXP A;  3RH2 A;  4HNT A;  2IS1 A;  2QKL B;  2DA7 A;  2MD5 A;  3CTA A;  2WWY A;  4BU2 A;  2CV2 A;  4NC7 A;  2LG4 A;  2D5V A;  2OPT A;  2FNP A;  3DKX A;  1XD7 A;  3I4N J;  1BW6 A;  1HBX G;  1Z6T A;  4RB0 A;  2PMZ N;  3F0C A;  1VZ0 A;  1IUF A;  4G94 A;  3F8N A;  4AC6 A;  2CQ7 A;  2EZK A;  2IA0 A;  1X4O A;  1NG7 A;  3H35 A;  2V4J C;  1R6R A;  2VIX A;  3RIR A;  3B81 A;  3E3V A;  4L9J A;  5FKO A;  3SZP A;  5C3E J;  3K1N A;  4CUG A;  3QP6 A;  1JGS A;  2XB0 X;  2CW8 A;  4MNU A;  1LVA A;  3WU0 A;  2V1U A;  3HE0 A;  1K83 J;  2M3A A;  2HQN A;  1N25 A;  5CKT A;  3QBM A;  3A2K A;  3BTL A;  1O57 A;  4KA4 A;  5FGL A;  1W7P B;  2XB5 A;  1RUO A;  5L3G A;  3FRQ A;  5M3F J;  5D4S A;  2OC6 A;  2EIK H;  5FKM A;  3ABU A;  2XAU A;  4C3J J;  1XSX A;  2FBI A;  3PNY A;  2HVQ A;  1S6L A;  5TJJ A;  5F6F A;  1TWA J;  3HOT A;  3E7Q A;  3M1E A;  1VND A;  2A6T A;  4EV0 A;  1FYM A;  4K2E A;  4ASN A;  5IPA A;  4IRG A;  2EH3 A;  5CQE A;  2GIZ A;  4RGU A;  4PSX A;  2KPM A;  3FM5 A;  3JRF A;  4HX4 A;  3O6B B;  4XBF A;  4OU0 A;  3WGH A;  2BV6 A;  2MH2 A;  4A0Z A;  1ZRF A;  2LVS A;  4ABZ A;  3ABM H;  4A3G J;  4E7H A;  3HB9 A;  2P8T A;  4EVI A;  2L9V A;  1ZRC A;  5HNH A;  2VT3 A;  1WGX A;  3NWT A;  2GA2 A;  3VYR B;  2VPR A;  1R9T J;  2IGM A;  2PMH A;  2AO9 A;  3ZPL A;  2LKS A;  3EUK L;  3M7G A;  3QOD A;  3U9G A;  3E0J B;  1SD4 A;  3V8L A;  5LGN A;  1VQ7 I;  4L5E A;  2EIM H;  1IGN A;  2PI0 A;  4Y52 J;  3OR1 C;  3IH2 A;  2QQ9 A;  2M7A A;  2YU9 J;  2L02 A;  3OYE A;  1EKE A;  2KKO A;  2K40 A;  2K4B A;  5HOD A;  5TRD A;  2BEO A;  3WE2 A;  1YIO A;  3F72 A;  5GAD J;  3LAP A;  4E7I A;  5B66 C;  1K4T A;  1VI0 A;  3RZO J;  4ME9 A;  1QRY A;  2OQG A;  1HA8 A;  2DMQ A;  2WAD A;  2O9L A;  1ETO A;  2L7K A;  5FFX A;  4XON A;  5CXI A;  1TZL A;  4HX7 A;  5JHU A;  3L2Q A;  5DM7 F;  5GTH C;  3VVX A;  3OOU A;  1HC8 A;  2M30 A;  1XDS A;  4A3E J;  1FBQ A;  2QVO A;  3OYD A;  4E4H A;  3F9K A;  1TWC J;  1XMX A;  3Q0W A;  2XAG A;  3D5L A;  4M9S A;  4I02 A;  3E6C C;  4KIB A;  5KCM A;  3EUP A;  1YS7 A;  4L9T A;  2KDO A;  3KE2 A;  1VQ6 I;  1OCT C;  3K1M A;  3FMS A;  3ERE D;  4LB5 A;  2GUH A;  3FXJ A;  2KIM A;  3UR3 C;  5LBQ A;  5GP9 A;  3BG7 A;  2ID3 A;  2E2I J;  1OR7 C;  1HLV A;  1Q1V A;  2D1H A;  1AOY A;  1JJ6 C;  2CFX A;  4HW0 A;  2ZC2 A;  4J01 A;  2DA5 A;  2V6E A;  1LDK B;  3GFM A;  1T0F A;  2DTR A;  1WJF A;  3D5S C;  1YOV B;  5TGT A;  3T5X A;  3RKY A;  1FTZ A;  5FKL A;  4I0B A;  2Y30 A;  3G6E I;  3DP7 A;  5LFA A;  4MQV A;  4O6J A;  2IGN A;  3GZ5 A;  5GPC A;  2QBY B;  1Y0N A;  3N4M A;  3RKQ A;  3JRG A;  3DLA A;  1HXD A;  3IKV A;  5D5X B;  3PAS A;  4NHJ A;  2LDU A;  1UI6 A;  3TDZ C;  3U1K A;  1H8A C;  2ZKZ A;  1LFB A;  2HXO A;  5JFR A;  2EB7 A;  2DXI A;  4D5F A;  1IN4 A;  4C2M J;  2E5N A;  2DMU A;  2L9N A;  5FD6 A;  2NS8 A;  5EG0 A;  3KX2 A;  3SWH A;  1Z6R A;  3ASN H;  5F1J A;  1KGS A;  1SAN A;  3CCQ I;  1K6O A;  2XGE A;  2DLL A;  1TQP A;  5D19 A;  1J7K A;  3ELK A;  2NXN B;  2QGU A;  4DGW B;  5HLI A;  1Z77 A;  4P96 A;  3S93 A;  3SQN A;  2GWR A;  3GZI A;  3PNT A;  4ZJZ A;  4F91 B;  1VF9 A;  2ZO4 A;  3AG4 H;  2L7Z A;  3KYL A;  1JKR C;  2K5C A;  2NVX J;  2L4A A;  2JZY A;  3DPL C;  1ULY A;  2ACJ A;  1K78 A;  2CJJ A;  2W1O A;  4M9Z A;  2KIS A;  1RKT A;  4WXH A;  1KQ9 A;  4E7K A;  3E1S A;  1ZAO A;  4GDF A;  2DG7 A;  3HOY J;  3J81 Z;  4N9H A;  4MIM A;  2VKD A;  2VJI A;  3KEO A;  3CCL I;  1MBH A;  4QPO A;  2W24 A;  3H5A A;  4KNY A;  2ID6 A;  1OYI A;  4XLN F;  4XLH A;  5K7H A;  3S17 J;  3KET A;  2JUG A;  3BR2 A;  5HVQ C;  3PPB A;  5EGO A;  3ZCO A;  3NI7 A;  2WBM A;  2XKO A;  4QWQ A;  3D0S A;  1G3T A;  2JA7 J;  3HG9 A;  3L2W A;  5DCM B;  1ZGJ A;  3MD2 A;  1YTY A;  2RNG A;  4CYC B;  4BXU A;  2IW5 A;  3LSM A;  2EIL H;  4CGZ A;  3HSF A;  2P5K A;  1RR7 A;  4CZZ A;  2Y2Z A;  2QZ8 A;  1FOW A;  2RC4 A;  2YSR A;  2EBI A;  1LE8 A;  2GLO A;  3PUB A;  4U0W A;  3KYC B;  5D6E A;  1O3S A;  3VFZ A;  5JLW A;  1W1W E;  1ZH5 A;  2BXZ A;  3DBR B;  1BM9 A;  1P7J A;  2MLG A;  4EJO A;  1KYW A;  2COM A;  4OD4 A;  2CQN A;  3EUH A;  4LK0 F;  1MDM B;  4BNC A;  3GEZ A;  4E6K G;  3HTU A;  5E3M A;  1HSJ A;  4RGS A;  4DIQ A;  3ULQ B;  1TWG J;  4WIB A;  2R7Q A;  4QLC U;  3AQT A;  4GO1 A;  4RDU A;  3DLL F;  2DT5 A;  1ZGA A;  2IA2 A;  2V9V A;  3CMM A;  3EDP A;  2J5P A;  3J7A O;  2Q1Z B;  1D5Y A;  3SFZ A;  1R1U A;  2PMZ A;  3Q9V A;  2GEN A;  2QSF X;  4H0E A;  2DOF A;  2EFQ A;  2VQC A;  3W2W A;  1ZQ3 P;  4IKF A;  1QQI A;  2XGX A;  3QYB A;  2PBX A;  2ELK A;  2V1N A;  2E1N A;  5ILS A;  4NUB A;  3WTY C;  4PJN A;  4R1H A;  2MC4 A;  4A93 J;  4YFK F;  4MEX F;  2HTS A;  1MND A;  2UV1 A;  4BXF A;  3GFI A;  2HGC A;  3LWJ A;  1PP8 F;  2LR8 A;  4AWX B;  2CV1 A;  2MD0 A;  2JVG A;  2ZFU A;  2A5Y B;  2BGC A;  3GYH X;  2DBB A;  2OER A;  4Y4R A;  1EH8 A;  4EJV A;  1FP2 A;  2HDD A;  2DOE A;  2E34 A;  1RC9 A;  1Z9C A;  3BPX A;  3ECO A;  1KYZ A;  2EPF A;  2Y0S N;  1KU2 A;  3EQL F;  1IC8 A;  5J3L A;  3T0Y A;  4ENN A;  2O7T A;  2DW4 A;  4B47 A;  1F9N A;  1B9M A;  1G3S A;  3VVZ A;  2IP2 A;  1IRF A;  3I4P A;  4BQN A;  1YRN B;  3J81 K;  2HXI A;  4OMZ A;  4ZDP A;  2ETH A;  4IRH A;  5D8K B;  1N78 A;  3AL0 C;  4BHP A;  2DDA A;  1DPR A;  4IHS A;  1XDU A;  3HPH A;  3FMR A;  1O7F A;  2ESN A;  3CJT B;  3F8F A;  4IHW A;  1X3U A;  3TW7 A;  5IT9 K;  2LBF A;  3VW2 A;  4TV7 A;  3ZQC A;  3H92 A;  4BH9 A;  1P2F A;  4BQQ A;  3G7R A;  5EZH A;  2VE8 A;  3MKZ A;  4BQA A;  3HIM A;  1DQU A;  1QVU A;  1BBY A;  1RPW A;  1T95 A;  2FNA A;  5K7Z A;  1JJ8 C;  3KLN A;  2PMU A; 
#chains in the Genus database with same CATH homology
 1ZR4 A;  3UKG A;  5E3O A;  1ORK A;  1IDZ A;  4DZJ A;  1Y1W J;  3JSJ A;  2X6O A;  3GTK J;  4NN1 A;  1JKQ C;  3BR1 A;  2LLK A;  5IYB J;  2OI8 A;  3VOK A;  4KWA A;  1PUF B;  3BG3 A;  2K9N A;  3JRB A;  1XG1 A;  4MXM A;  2ZOY A;  1TWF J;  1AU7 A;  3O8G A;  2XGD A;  2DN0 A;  2LP0 A;  4A3K J;  3TED A;  3VW0 A;  1ZKG A;  3S16 J;  1WH7 A;  3GBG A;  2HOA A;  4IHV A;  5EEA A;  2G7S A;  5C44 J;  4EEF G;  4CYC A;  2AHQ A;  5F0C A;  4A3M J;  3HKZ N;  5IYD J;  3HTI A;  2N8G A;  4AF5 A;  1K61 A;  3S1R J;  2ME0 A;  1JKP C;  3AQS A;  1NK3 P;  2CUF A;  2L0K A;  3KKD A;  5D18 A;  1ZGW A;  2VKV A;  4J19 A;  2UXP A;  3BJB A;  2NP5 A;  1RKW A;  2IEK A;  1NK2 P;  1FIA A;  3GTP J;  1I50 J;  2R92 J;  3OSG A;  2HQ5 A;  2QF7 A;  3S5R A;  3TP3 A;  1AKH A;  2G0E A;  3OIO A;  2QWT A;  2CQX A;  3ANG A;  4PXI A;  4A3J J;  1O4X A;  4JKZ A;  4QSH A;  1B8I A;  4IHX A;  1VFC A;  1UG2 A;  5J1R A;  3BTI A;  4MFD A;  2UXI A;  4V2G A;  4M3F A;  5F08 A;  1T56 A;  2X48 A;  3HOU J;  2CU7 A;  3S2H J;  3KNW A;  1U9O A;  3ZQL A;  2K9S A;  1CQT A;  1AKH B;  4JL3 A;  3L1P A;  1UI5 A;  2HI3 A;  5IP6 A;  3H0G J;  1QVT A;  2ME6 A;  1B8I B;  5K58 A;  4ACI A;  3BR6 A;  3BR5 A;  1JUM A;  2CRG A;  4Y7N J;  3JR9 A;  2NVQ J;  4XRS G;  2WV1 A;  1DU0 A;  5IP7 J;  4UUS A;  2R5Z A;  1BJZ A;  1GV5 A;  3ZQG A;  3HTA A;  3WHC A;  1JGG A;  4X1E A;  3Q0V A;  2FD5 A;  3RD3 A;  5FJ8 J;  2RHA A;  2DA3 A;  2OF7 A;  3M3Y J;  2JK3 A;  2Y9Y A;  3K2A A;  2K9Q A;  3S1N J;  4UUS B;  4JNN A;  1GVD A;  4S0H B;  2HYJ A;  2RAE A;  4GFK A;  5HSZ A;  2WB1 N;  1G2H A;  3S14 J;  3BR0 A;  2NVY J;  3DCF A;  1E3O C;  1F36 A;  5FLM J;  2HOT A;  2W48 A;  2Y9Z A;  1H88 C;  2KDZ A;  1XC5 A;  3WHB A;  2MGQ A;  4L62 A;  4M3B A;  4BY7 J;  1EF4 A;  1OFC X;  2VKE A;  3S1Q J;  1ZTR A;  2E19 A;  2E1O A;  3B6A A;  1F43 A;  4LOC A;  4M3E A;  1OCP A;  5C4X J;  4XID A;  2ZCN A;  5H9T A;  1TWH J;  1WI3 A;  5IP9 J;  3BTJ A;  3SDG A;  4D7M A;  2GFN A;  4C3I J;  4M3G A;  4HKU A;  1MBK A;  1NTC A;  4JX5 A;  1IJW C;  1UMQ A;  4GCT A;  4M6V A;  1QPI A;  3BR3 A;  3HTJ A;  2R5Y A;  1MSF C;  3ZQI A;  2LY9 A;  3RQI A;  4DYC A;  3GEU A;  3RH2 A;  2YUS A;  2DA7 A;  1RET A;  5HBU A;  2DA1 A;  3PM1 A;  2D5V A;  3VW1 A;  2R5Y B;  2OPT A;  4V2F A;  1MBG A;  3I4N J;  1BW6 A;  4A3L J;  1WCM J;  2PMZ N;  1MBE A;  3F0C A;  4FE4 A;  1IUF A;  5DAJ A;  3A03 A;  4AC6 A;  2EZK A;  3I4M J;  3HOW J;  3B81 A;  3VP5 A;  3CRJ A;  2MW8 A;  5D1R A;  5FKO A;  3CWR A;  1X58 A;  5C3E J;  5EYR A;  3A02 A;  1APL C;  2UXO A;  4GFL A;  2R7Z J;  2XB0 X;  3DPJ A;  3HE0 A;  1K83 J;  3QBM A;  2L7M P;  3NRG A;  2DMN A;  1IG7 A;  3BTL A;  1ETV A;  3MVP A;  2XB5 A;  3GTG J;  3F1B A;  5M5X J;  3FRQ A;  5M3F J;  1ITY A;  2EQR A;  3MKL A;  4A69 C;  2X9D A;  3PO2 J;  2JA5 J;  2QIB A;  3D1N I;  5FKM A;  2DMT A;  4C3J J;  4NEL A;  2Y31 A;  2O7O A;  1TWA J;  2DA2 A;  3IH3 A;  3E7Q A;  1VND A;  5FKN A;  1UHS A;  2ZB9 A;  5IPA A;  3JRA A;  2EH3 A;  5M5W J;  2HOS A;  5IOZ A;  3JRF A;  4GFB A;  2NOG A;  1W0U A;  3G1L A;  3LSJ A;  2XPV A;  2DG8 A;  2LVS A;  2TCT A;  4ABZ A;  4A3G J;  4RBO A;  1ETQ A;  3HB9 A;  3PO3 J;  2VI6 A;  1ZR2 A;  3FKI J;  4BBR J;  3C2B A;  4M3D A;  4B3A A;  1A6I A;  1WGX A;  3HBL A;  3LSG A;  4B4C A;  2FBQ A;  3GTM J;  5FHP A;  2VPR A;  1GUU A;  2CUE A;  1R9T J;  5DS9 A;  2ECC A;  2AO9 A;  5EGO B;  3DEW A;  2KT0 A;  4HNV A;  2LK2 A;  3HEF A;  3CDL A;  2VUM J;  1FTT A;  1JTY A;  1IV6 A;  4UDS A;  3FIW A;  2EZL A;  2LTP A;  3HM5 A;  2XPW A;  4L5E A;  5EDN A;  5C4J J;  3HOX J;  5DTD A;  1IGN A;  5FKK A;  4Y52 J;  1BL0 A;  3IH2 A;  4D7N A;  2O8K A;  3S15 J;  2L7F P;  2YU9 J;  1JUP A;  1MSE C;  2K40 A;  3W6V A;  1HDD C;  5HOD A;  4MLO A;  2XDN A;  4ICH A;  3FIS A;  1VI0 A;  3RZO J;  4ME9 A;  4BXX J;  1QRY A;  2E2H J;  2TRT A;  2DJN A;  2DMQ A;  2O9L A;  1ETO A;  3CQZ J;  1BA5 A;  3T6N A;  1U9N A;  5CXI A;  2FQ4 A;  2M2E A;  1HF0 A;  2L9R A;  3VVX A;  3OOU A;  1ETW A;  3H3V K;  1Z0X A;  4A3E J;  3CMY A;  1TWC J;  3Q0W A;  2NVT J;  2JA8 J;  3GTQ J;  3S1M J;  5EFY A;  1ETY A;  2WUI A;  1I6H J;  3EUP A;  3P9T A;  3CJD A;  1OCT C;  2GUH A;  2UXU A;  4W1U A;  5GP9 A;  2E2I J;  2ID3 A;  3BHQ A;  5EZG A;  1X2N A;  5BNG A;  5EF6 A;  1HLV A;  2P81 A;  1Q1V A;  3K7A J;  4JYK A;  1JJ6 C;  3CCY A;  5HAW A;  2NP3 A;  2ZCM A;  2QCO A;  4QTR A;  2MG4 A;  2DA5 A;  1OJL A;  4AC0 A;  4IEJ A;  4A3F J;  2V57 A;  3C07 A;  1FTZ A;  5FKL A;  2Y30 A;  3IUV A;  2M0C A;  2MSY A;  2YVE A;  1HDP A;  3M4O J;  3E7L A;  1MH3 A;  1FEX A;  5M3M J;  5GPC A;  4W97 A;  3NNR A;  3RKQ A;  3BG5 A;  4C3H J;  3JRG A;  1XS9 A;  1AHD P;  3KZ9 A;  3VUQ A;  4FCY A;  3PAS A;  3BCG A;  4B1R A;  1UI6 A;  1H8A C;  4FIS A;  1LFB A;  3BRU A;  2HXO A;  3LOC A;  5J1Y A;  3S2D J;  2F07 A;  3LJL A;  2REK A;  4D5F A;  4C2M J;  2YVH A;  2DMU A;  1U8B A;  3V6G A;  5AQC A;  1JT0 A;  4CGR A;  3BG9 A;  3B6C A;  2NS8 A;  5EG0 A;  3MNL A;  2M8G X;  5F1J A;  4AYB N;  3JRC A;  1SAN A;  3BTC A;  3QPL A;  2QOP A;  2NX4 A;  2XPU A;  2XGE A;  4XRS A;  5CXG A;  5D19 A;  5FMP A;  2LFB A;  3ON4 A;  4XK4 A;  1DU6 A;  1Z77 A;  5EG0 B;  4AUX A;  1WPK A;  1JKO C;  3VOX A;  2GM4 A;  3GZI A;  2ZOZ A;  1VF9 A;  4DW6 A;  2L7Z A;  4A3B J;  5FLV A;  1JKR C;  5C4Y A;  2FJ1 A;  2NVX J;  1TC3 C;  3ZQF A;  4GCL A;  2UXH A;  2CJJ A;  1ETX A;  1SGM A;  1HCR A;  2JN6 A;  2RAS A;  3EGQ A;  1RKT A;  1BW5 A;  2COB A;  3VVY A;  3GTL J;  3LHQ A;  2DG7 A;  4BBS J;  4I6Z A;  3HOY J;  1HOM A;  3HGG A;  4MIM A;  3LNQ A;  4JX4 A;  3LSP A;  2DTZ A;  2G7G A;  1MBH A;  1IDY A;  4XRM A;  3O60 A;  1JT6 A;  2R93 J;  2EZI A;  2ID6 A;  5K7H A;  3S17 J;  2NS7 A;  3NAR A;  1GT0 C;  2Q24 A;  3PPB A;  3BR2 A;  2LKX A;  1JUS A;  5EGO A;  1P7I A;  4YZE A;  3FK6 A;  3NI7 A;  3BQZ A;  5CW8 A;  2JWT A;  2JA7 J;  4BY1 J;  4FE7 A;  4JP0 A;  3GTJ J;  1GV2 A;  1T33 A;  4CYC B;  3JRI A;  2E2J J;  1FJL A;  4NDL A;  3IV5 A;  1RR7 A;  1GDT A;  1B72 A;  2Y2Z A;  4MO7 A;  1POG A;  3HDD A;  4IHY A;  1LE8 A;  1JTX A;  2EBI A;  2M34 A;  1FIP A;  3FK7 A;  3LSR A;  2LD5 A;  2GLO A;  2G3B A;  5JLW A;  3A01 A;  1B72 B;  2WAQ N;  3SFI A;  1P7J A;  1LE8 B;  3G1O A;  5JLX A;  3JRE A;  5E3M A;  5IYC J;  4X6A J;  3ZQH A;  3KKC A;  3HTH A;  1TWG J;  3A01 B;  2D6Y A;  3TP0 A;  3MN2 A;  2B63 J;  4JX6 A;  3AQT A;  1I3Q J;  1A5J A;  3NXC A;  1MBF A;  1U78 A;  2WGB A;  4RDU A;  3G1M A;  2QKO A;  2JMW A;  1WH5 A;  1D5Y A;  1H89 C;  3BNI A;  2GEN A;  2XRL A;  2XGC A;  1ZQ3 P;  3VPR A;  2H8R A;  3SJM A;  2R0Q C;  2M9H A;  3BQY A;  2PBX A;  2ELK A;  5J1U A;  5E3L A;  4XIC A;  1MH4 A;  3Q3S A;  5E3N A;  4DZP A;  4A93 J;  1ZK8 A;  4GCK A;  2XSD C;  2PZ9 A;  3LWJ A;  1RES A;  2G7L A;  2R5Z B;  2LR8 A;  1MBJ A;  5F04 A;  1ENH A;  2EZH A;  1LFU P;  2DA6 A;  2DA4 A;  4A3C J;  1X2M A;  1SFO J;  2OER A;  3HGY A;  2HDD A;  3COL A;  2HKU A;  2H1K A;  3O8H A;  1YRN A;  2QTQ A;  4QIW N;  5IOY A;  1IC8 A;  2Y0S N;  4G12 A;  3HOV J;  2O7T A;  5J3L A;  3Q0U A;  3RZD J;  2IU5 A;  4MFE A;  1S7E A;  1ETK A;  5F27 A;  3VVZ A;  9ANT A;  1YRN B;  3G56 A;  2DMP A;  2HXI A;  4MK6 A;  4FTH A;  2IBD A;  4UUT A;  3QKX A;  5M5Y J;  3IH4 A;  2IAI A;  2HYT A;  2ECB A;  2FX0 A;  1W0T A;  3QQA A;  3ZOB A;  4DYQ A;  5F0F A;  3JRH A;  4IHW A;  4A3D J;  2ZCX A;  2JA6 J;  3TW7 A;  2GBY A;  3TW6 A;  2W53 A;  3OSF A;  1Y1V J;  2CQQ A;  4A3I J;  4BKX A;  3QPS A;  3GTO J;  3VIB A;  3VW2 A;  5K7F A;  4D5C A;  3ZQC A;  5F0H A;  1IRZ A;  4I76 A;  3NPI A;  3ON2 A;  5GPA A;  3G7R A;  2JJ7 A;  2I10 A;  3JRD A;  5EZH A;  3HOZ J;  3ANP A;  3NAU A;  3V78 A;  1MNM C;  3HIM A;  2YS9 A;  1QVU A;  1JJ8 C;  1RPW A;  5K7Z A;  3BT9 A;  5FGL A;  4DYR A;  1PUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...