5GPCA

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
190
structure length
190
Chain Sequence
KKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELRQSNTELRLKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, dna binding protein/dna
molecule keywords Transcriptional regulator (TetR/AcrR family)
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 69
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gpcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gpcA02
1SFOJ 3LSRA 2DA5A 5D19A 1I50J 5J1RA 3ZQIA 1S7EA 2X48A 2DMPA 3A01B 3VOKA 3Q0VA 1OCPA 4M6VA 3DEWA 4RDUA 1K83J 5E3LA 2R93J 1A6IA 3TW7A 3HEFA 3BR2A 3V78A 3CDLA 2Q24A 3JREA 1ZKGA 5HODA 3S1QJ 5FKKA 2LTPA 4MFEA 2D6YA 4J19A 1T33A 2ZOZA 3PPBA 2ZB9A 3OOUA 4BBSJ 3IV5A 5DAJA 3WHBA 1IRZA 3HTHA 4NELA 2YU9J 3VOXA 1GUUA 1FIAA 1AKHA 5F1JA 1BJZA 4A3KJ 1GT0C 2N8GA 1AU7A 4KWAA 2E1OA 5HAWA 5IYCJ 1TWFJ 2JA5J 3HE0A 2IU5A 3GTPJ 5EGOA 1XG1A 2DG7A 5FKOA 2R5ZB 1JJ8C 1MSFC 2JWTA 3BG5A 5F04A 1OCTC 4A3GJ 3S17J 3COLA 4QIWN 3MVPA 2CUEA 4I6ZA 4M3DA 3NARA 3VVYA 2OPTA 2WAQN 4IHVA 3A02A 4YZEA 3Q0UA 3FISA 4RBOA 2XGDA 4JYKA 1LFBA 3HKZN 4G12A 3SDGA 3ANPA 2K9QA 3HGGA 2DJNA 2G0EA 5GPCA 2K40A 2Y0SN 4JX5A 1MBJA 3ZQGA 4D7MA 1H89C 3PM1A 4JX4A 1TC3C 2L7MP 3WHCA 1LE8B 1ORKA 3RD3A 2JMWA 4GCKA 4A3JJ 3RKQA 4D5CA 3JRCA 2WV1A 4V2GA 2ZCXA 2M9HA 2OF7A 1D5YA 3QPLA 3BJBA 2XSDC 2ELKA 4FCYA 2NP5A 3VIBA 3BTJA 3BCGA 2ECBA 1ZR4A 3CRJA 1ETVA 4AYBN 4XIDA 2UXPA 3HIMA 2M2EA 3NI7A 5D1RA 4A3MJ 5K7FA 1HF0A 1GDTA 3BTLA 1H8AC 3HDDA 1ETQA 3BR6A 4JX6A 2HDDA 3GTJJ 1GV5A 4DYQA 3LJLA 4D7NA 2X6OA 3SFIA 3JSJA 3BT9A 3PO3J 4C3HJ 2LLKA 2NS7A 3LWJA 5IYDJ 4A3CJ 2E19A 2YUSA 3L1PA 3I4NJ 3VP5A 3CCYA 1Z77A 3VW1A 2W53A 1IUFA 2X9DA 1B72B 1FIPA 2E2IJ 4BKXA 3S1RJ 2R7ZJ 2GFNA 2LR8A 3I4MJ 1EF4A 4C2MJ 5GP9A 1ZGWA 4XICA 1ITYA 3DPJA 2L9RA 1MSEC 1BA5A 3C2BA 2DMTA 2ID6A 3CMYA 3NNRA 2XGEA 3LSPA 1AKHB 1QPIA 3RH2A 3PO2J 2ME0A 1H88C 3F1BA 1RESA 5FLVA 2VKVA 3NRGA 5EGOB 2MSYA 4XRSA 1OJLA 2EZHA 2AHQA 4FISA 3G56A 4NN1A 4A3BJ 3HTIA 5K7ZA 1MH4A 1U9OA 2M34A 1I3QJ 4M3BA 1JKRC 3G7RA 3GTQJ 4JNNA 5FMPA 1HLVA 2IEKA 1RPWA 5M3FJ 4M3FA 2YVHA 5EFYA 3JRBA 3BR0A 2JA6J 2UXOA 2NVXJ 3JRAA 3KNWA 3HTAA 1IDZA 2Y31A 1YRNA 4A3LJ 5FGLA 5DS9A 5IYBJ 1JJ6C 1JUPA 1Y1VJ 5M5XJ 3JRGA 3S2DJ 2QIBA 2LVSA 3FKIJ 1FJLA 3BR3A 4ABZA 1JUMA 3S1NJ 1Q1VA 2QTQA 2ZCMA 3G1MA 3LHQA 1JTXA 4NDLA 5FKLA 1NTCA 2UXUA 3M3YJ 4I76A 5CXIA 5IOYA 3HM5A 2GM4A 3GZIA 2LK2A 2HYTA 5FKNA 2DA2A 1JKPC 5C3EJ 1G2HA 5H9TA 1X58A 5M3MJ 5M5YJ 5EF6A 4B3AA 3B81A 2QWTA 2ME6A 1UI5A 1RETA 2LY9A 3LSJA 4A3FJ 2NX4A 2DA7A 1BW6A 2YVEA 3DCFA 4PXIA 1WPKA 2FD5A 3B6AA 1SGMA 3C07A 5J1YA 1LFUP 2O8KA 2E2JJ 1IV6A 4FE4A 2ECCA 1FEXA 3VPRA 3NXCA 2HXOA 3HBLA 3LSGA 3JRFA 2DMQA 1HDDC 4BXXJ 1TWGJ 3VVZA 5E3MA 3E7QA 5IPAA 2COBA 1QVTA 3HOVJ 2EZIA 2EZKA 2UXIA 3K2AA 1XC5A 3LOCA 4A69C 1I6HJ 2NVYJ 3ON2A 3G1LA 2JK3A 2LKXA 1RKWA 5E3OA 1K61A 3ZQFA 2WUIA 2FX0A 1IC8A 4JKZA 3GTOJ 1VF9A 2LFBA 1IJWC 1HCRA 5FJ8J 3Q0WA 5K58A 5EZGA 5F27A 2REKA 1CQTA 2P81A 2XGCA 3GBGA 4B4CA 2JN6A 2Y2ZA 3SJMA 1WH7A 2CU7A 3JRIA 2KDZA 1ETYA 1YRNB 2UXHA 2KT0A 1U9NA 3HOYJ 3NAUA 2XPWA 3BQYA 2OI8A 3BR5A 4V2FA 3P9TA 3QPSA 3MN2A 2MGQA 1GVDA 3CQZJ 3QQAA 2TRTA 2YS9A 4DZPA 4CYCA 5F0FA 5F08A 1WI3A 1U78A 3GTGJ 5F0CA 2FJ1A 2XDNA 2VKEA 2Y30A 4C3IJ 2DMNA 1JUSA 1F36A 2B63J 3JRDA 5J1UA 4C3JJ 3JR9A 1PUFA 1E3OC 1HDPA 3ANGA 3NPIA 1MBFA 4GFKA 2CQXA 4W1UA 3ON4A 4A3DJ 4FE7A 2MG4A 1MNMC 4QTRA 3HOXJ 1ZQ3P 4IHXA 2DA3A 2I10A 3MNLA 5K7HA 2WGBA 1OFCX 4MO7A 3ZQHA 1B8IA 4L62A 2DTZA 2K9NA 2XRLA 2M0CA 2G7LA 2IAIA 2LP0A 5GPAA 3HB9A 5E3NA 1X2NA 4L5EA 2PMZN 4W97A 1VFCA 1BL0A 1ZTRA 2W48A 3TP3A 2VPRA 4CGRA 1POGA 3ZQCA 1WH5A 1ETXA 1NK2P 2H8RA 2QOPA 3KKCA 3VW2A 5HSZA 3VW0A 3BG3A 4M3GA 1TWAJ 4IHWA 3O8HA 5DTDA 1IG7A 2NS8A 3GTKJ 5EZHA 3VUQA 5EEAA 1IDYA 2DN0A 4UUTA 3H0GJ 1UHSA 4IHYA 1MBGA 3FK6A 5AQCA 3FIWA 3OSFA 2ZCNA 5D18A 4AC6A 2EQRA 1ZK8A 5BNGA 5FHPA 2CUFA 3HOZJ 2DA1A 2EBIA 2M8GX 2HOAA 3TP0A 2NVQJ 3PASA 4ME9A 3IH2A 2ID3A 4UDSA 3GTLJ 5IP9J 3Q3SA 3TEDA 2HOTA 3BNIA 2DA6A 2JA8J 5C4JJ 1RKTA 3A03A 3VVXA 4HNVA 3QBMA 5C44J 4ICHA 3GEUA 1FTZA 2HOSA 3HOWJ 4CYCB 4GCTA 2L7FP 3RQIA 2G3BA 1B72A 4XRMA 1TWHJ 3EGQA 2JJ7A 5IP6A 1JKOC 2IBDA 1X2MA 3F0CA 1UMQA 4AC0A 4DW6A 2R5YA 1PUFB 2QF7A 1NK3P 3S15J 4UUSA 5CW8A 2HI3A 5C4YA 2Y9YA 4IEJA 3BG9A 3TW6A 3CJDA 3HGYA 2DG8A 2DMUA 1UG2A 1FTTA 4JL3A 5IOZA 1RR7A 4AF5A 1ETKA 2HYJA 1MBEA 1T56A 1Y1WJ 4MFDA 4A3IJ 2O7OA 1B8IB 5FLMJ 2R92J 4DYRA 2H1KA 2PBXA 2G7GA 1U8BA 3HOUJ 2FQ4A 2TCTA 3QKXA 4S0HB 2WB1N 2QCOA 4LOCA 1JGGA 5EG0A 3BR1A 2AO9A 4X1EA 2DA4A 5JLXA 2E2HJ 2F07A 5F0HA 1R9TJ 2VI6A 1DU6A 3HTJA 3K7AJ 1W0TA 3RZOJ 1JKQC 4ACIA 4MIMA 3B6CA 4HKUA 2RAEA 3FK7A 1P7IA 3O8GA 3UKGA 1XS9A 2XPUA 2O9LA 2GBYA 4MXMA 2CQQA 1JT0A 3S5RA 2HQ5A 1WGXA 3KKDA 1MBHA 3IH4A 3A01A 4BY7J 1P7JA 1GV2A 2K9SA 3S16J 3O60A 2GENA 1IGNA 1VNDA 3RZDJ 5C4XJ 3E7LA 1JT6A 2V57A 2CRGA 5CXGA 5M5WJ 2ZOYA 4FTHA 2GUHA 4BY1J 3FRQA 3V6GA 1A5JA 3S14J 4QSHA 2R0QC 1DU0A 2PZ9A 1TWCJ 4MLOA 4XK4A 2G7SA 2EZLA 2OERA 2GLOA 1MBKA 4DYCA 2QKOA 3IUVA 3ZOBA 4JP0A 1ENHA 1MH3A 3KZ9A 3BQZA 1AHDP 2R5ZA 3OSGA 4Y7NJ 2L7ZA 1ETOA 4DZJA 2O7TA 2RASA 4D5FA 4X6AJ 1BW5A 3GTMJ 5EYRA 4GCLA 1Z0XA 4XRSG 3H3VK 3T6NA 1ZR2A 2R5YB 1SANA 3BHQA 3S2HJ 5IP7J 1O4XA 4A93J 2XB0X 4UUSB 4AUXA 3BTCA 1W0UA 1VI0A 2NOGA 3EUPA 2LD5A 2XB5A 1F43A 2CJJA 3ZQLA 1QRYA 1LE8A 4A3EJ 4GFLA 2NP3A 4Y52J 4EEFG 3LNQA 2FBQA 3W6VA 2MW8A 5JLWA 1QVUA 4GFBA 2HXIA 1WCMJ 5FKMA 1APLC 1JTYA 2JA7J 4M3EA 2XPVA 3AQSA 3CWRA 2D5VA 4B1RA 3M4OJ 9ANTA 2Y9ZA 1UI6A 3BRUA 3S1MJ 2L0KA 5EG0B 5HBUA 1ETWA 3OIOA 5J3LA 3G1OA 4MK6A 5EDNA 2HKUA 4BBRJ 2NVTJ 2VUMJ 3JRHA 1HOMA 3D1NI 2RHAA 3MKLA 3AQTA 2EH3A 3IH3A 3BTIA
chains in the Genus database with same CATH superfamily
1Y0UA 1SFOJ 3OYJA 3F8BA 3ZQIA 1T0FC 3NS4A 3EUKL 1EH7A 1VQ6I 3VOKA 2OTJI 3DEWA 4KT6A 2EFWA 3H92A 5E3LA 1A6IA 4U88A 1W5SA 2DDAA 3FMSA 1T95A 2Q24A 4IVNA 1ZKGA 1YFHA 2ZMEA 4OD4A 2HOEA 4UY8I 2LTPA 5FFZA 1OCCH 3CC2I 4J19A 1T33A 2OA4A 3WHBA 2ZBKA 1O3QA 3HTHA 4NQWB 1AKHA 5F1JA 2XIGA 4RGUA 3BPXA 4ZYDA 4KWAA 2FEZA 1TWFJ 2R3SA 1S3JA 2KRCA 1R5GA 1XG1A 5EGOA 1R7JA 2QQ9A 2JWTA 2M4KA 4HA8A 4E7KA 1HC8A 5FD6A 4PJJA 1NG7A 2GQQA 3CJNA 4BS9A 4F93B 4WXCA 3I58A 2OPTA 2WAQN 4DJAA 3WTSC 1ZLJA 5HLTA 1MJBA 5LHIA 1OCOH 2DJNA 2G0EA 2K40A 2CV2A 3ZQGA 4HX4A 2VE8A 4JX4A 4ENKA 1DQUA 2Z33A 2LG4A 3ASNH 1BI0A 4KN4X 4ZTJA 1LQ1A 2HR3A 3FKJA 4KIFA 3DPTA 1G3TA 3CMMA 1FSEA 3ABMH 2NP5A 3BCGA 1SAUA 3EDPA 3TDUC 2ECBA 3HG9A 2QLZA 1ZR4A 3OYIA 1IO2A 3NI7A 1UHWA 2K3PA 3OS2A 3GX4X 2O03A 5K7FA 5ILVA 4GYIA 1GDTA 1P2FA 3P5JA 5F64A 3HDDA 4JX6A 2HDDA 2DT6A 4DYQA 2FA5A 3CDHA 2KJCA 5L3DA 3SFIA 3LWJA 2GA1A 5E8IA 2NAZA 4LFUA 2ZJPF 5IYDJ 3JSOA 4A3CJ 1FYLA 5ILSA 1MMGA 1IXRC 1VTNC 3I64A 2R7ZJ 1FIPA 3S1RJ 2ZMEB 2JUCA 3I4MJ 1QZEA 4ZZLA 3ZN1A 2DO7A 2EK5A 1MSEC 3WODF 3K4KA 3C2BA 2DMTA 4J01A 1AKHB 3CJTB 1QPIA 4U9LA 2RKHA 2ELJA 3WE2A 1H88C 3OYDA 2VKVA 4XSXF 5EGOB 2BY0A 1FOXA 3MFKA 2AHQA 4HV6A 3G56A 2X4HA 3PQKA 4I0AA 4HZFA 5HNHA 3EUHC 3HTIA 3TL4X 4GYGA 4BQOA 4L18B 4JNNA 3FHZA 3GTQJ 1C0WA 4I7HA 1HLVA 1X1PA 4A5MA 4M3FA 2HTSA 1MNDA 3JRBA 2MH9A 3BJAA 1V5EA 4OMZA 5DUKA 4CICA 2A5YB 4EM2A 4LJZF 1AOYA 3KNWA 2G7UA 1OQYA 1YRNA 4A3LJ 4BXUA 4DGWB 1IV8A 2HYGD 3ZCOA 5M5XJ 3PNVA 3GCMA 4WXHA 1YIOA 4GXOA 4ITVA 2QIBA 2LVSA 1I27A 1FJLA 2JQ7A 2IS1A 2ZCMA 3G1MA 3LHQA 2FBKA 1KQ9A 3HHHA 4I76A 5IOYA 3HM5A 3OYLA 5JR3A 2GM4A 1PDNC 5FKNA 2BY2A 5DD8A 1JHHA 4Y15A 5FRMA 2PBIA 3FMRA 4DOZA 1X58A 5JHUA 3LL7A 4B3AA 3C3WA 2QWTA 5K5OA 2Y0SA 1UI5A 2P8TA 1XTAA 2QVOA 1LEAA 3E6MA 1KGSA 1UJ8A 3S3NA 4XKCA 2DA7A 1BW6A 2LRDA 4F92B 1QU3A 1SD4A 3L2CA 1EH8A 5D8KB 2V79A 2FD5A 3SFZA 3C07A 1LFUP 3TO7A 1IV6A 4FE4A 1TW2A 2ECCA 4I2OA 1SFXA 2EIJH 2LSOA 3IKVA 3SHFA 1FEXA 3VPRA 1LVKA 2JUGA 2W24A 2HXOA 1OPCA 2MLKA 4NBQA 2DMQA 4FETA 1TWGJ 4YRVA 1BN5A 3FDYA 3HOVJ 1B59A 2COBA 2DODA 2ZXWH 4G6TB 4OIQF 4G8XA 1O3RA 4XL9A 1XC5A 3G73A 2H6BA 1S8NA 4U0YA 3CCUI 1ZG5A 3CJQB 3ON2A 2LKXA 4HX7A 5EEHA 4Z6YA 3FWEA 3V7CA 2X1EA 3QPHA 3PIOF 3IRRA 2P0WA 2ZSHB 3KP4A 2LFBA 1MW7A 3DFGA 1IJWC 3ISPA 2KHMA 2RNJA 1HCRA 4TV7A 3UNGC 3Q0WA 4A2UA 1D1AA 5EZGA 2VIXA 4PGGA 3F72A 5F27A 2KLOA 1MNEA 2JN6A 1BOAA 2CU7A 1YRNB 2ISYA 4RLFA 2Y48A 1TZLA 2ZSIB 1MMNA 2ESHA 3HOYJ 1WI9A 2LREA 1FWZA 3ABTA 3OYKA 1BBYA 1SD5A 2FNPA 3BR5A 4YFNF 2YX7A 5J8FA 2V9PA 3A0HC 4BE1A 4HQEA 3MMYB 3S2WA 1R36A 1GVDA 4II2A 3VYRB 4DZPA 2YS9A 3J7YJ 2PJPA 1R00A 5F08A 4ZYAA 2ZMEC 1IXCA 3TMOA 2X1CA 2XDNA 2VL8A 4OIOF 1JUSA 4D0PA 2BXZA 5J4VA 3WTYC 3KZIC 4N0BA 4F3QA 1KU9A 4PFPA 3VFZA 3BC8A 1HDPA 2ZFWA 3QPTA 1MBFA 2P6TA 1XSXA 2CQXA 4W1UA 2RHAA 3ON4A 5BQTA 5FLXK 2MG4A 4QTRA 3WU1B 1Y39A 4IHXA 2I10A 5GAHJ 2HDWA 4HDUA 1ZN2A 3FXJA 3W2VA 3GF2A 2CMPA 4MO7A 2KKOA 5E8GA 4BQNA 1YYVA 2Y75A 1P9QC 1B8IA 1XDSA 2DTZA 2JPBA 3K1PA 2G7LA 3KZZA 2M3AA 1X3WB 3GZ6A 5TJJA 4G6DA 4IO9F 3DEUA 1VFCA 4G7ZF 3K4LA 2VPRA 4CGRA 3I71A 3ZQCA 5L3GA 2H8RA 2QOPA 2IA2A 3VW0A 5TISC 3BG3A 5CQGA 2ZXJA 4HW0A 2XC7A 3AG4H 5JHFA 2IA0A 1IG7A 2QGUA 4FX0A 6PAXA 3B02A 4UHTA 2V1UA 5HS8A 1WFXA 1E17A 1PJRA 4HRIA 5CJ9A 2W4SA 5D18A 2RC4A 4AC6A 3E5XA 4RAFA 3Q5FA 2MD0A 1BI1A 1Z1DA 4DNCA 4YG2F 1ZRCA 2EBIA 2P6SA 2HOAA 3PASA 4M74A 3TEDA 2YR2A 4CCMA 1USSA 3KZYA 1OR7A 5C4JJ 2O3FA 3I56I 5LRSA 3VVXA 3CZ6A 4KMFA 5C44J 3DLLF 3BJOA 2E1MB 2X6WA 4UVCA 2ZCWA 1FTZA 2UXXA 3HOWJ 2XF6A 3KYDB 1OCZH 4E70A 2D45A 4CHUA 3RQIA 2XAFA 2PX9A 1LPQA 3ZPLA 4E7ZA 4X0GA 1VQMI 1B72A 2VQCA 1U2WA 3J81K 2FMLA 1WZ2A 4XKWA 2JJ7A 3ECOA 2F4MB 5AIPA 3L2RA 2BHYA 2MA3A 1G3SA 3H5RA 2QF7A 2HI3A 3CO7C 4LLNA 5CPRB 4OIPF 2DMUA 4JL3A 1LJ9A 3ERMA 4P96A 3SZPA 4PSXA 2ZXIA 1RR7A 1MBEA 1Y1WJ 4MFDA 4OAYA 4I99C 4B43A 4A3IJ 1B8IB 5H6QA 4OU0A 4KA4A 2CQ7A 2OCEA 2XF7A 3QKXA 2FQ4A 4G7OF 2BOLA 2QCOA 4LOCA 1ZG1A 5FLXZ 2XF5A 5LGUA 5J6XA 2E35A 3CCVI 1KU2A 3PSFA 5JLXA 3E0JB 1ACIA 1HSJA 3BG7A 4I98B 4BNCA 4XSZF 2EA2A 3RKWA 5D4RA 5DM6F 1XB4A 2Y69H 2XUBA 4ACIA 2KIUA 4MIMA 5CVUA 2WY8Q 3UKGA 1XS9A 2PJRA 3T0YA 4LK1F 2A05A 4XBFA 1WGXA 3KKDA 3ZN0A 2K86A 3OYEA 4S05A 3A01A 1W4MA 3G6EI 3CO6C 5KHDA 3F23A 2GENA 1IGNA 1STZA 1NHAA 4RM2A 3RZDJ 3DBRB 2BBYA 5ICCA 1H0MA 2A2FX 2STWA 3OIPA 2PMZA 4ESFA 3DTIA 4B09A 5L3CA 3PL8A 2IJLA 4XK4A 3KFWX 1J0RA 4U0WA 4IRVA 3BCAA 2XVCA 3IUVA 2K85A 3ZOBA 5FO5A 1ENHA 1MH3A 3FXUA 3EQLF 3IHUA 3OS0A 4Y7NJ 2VXDA 2WC2A 2XASA 2O7TA 4D5FA 4X6AJ 1BW5A 4NUBA 4R1HA 1IW7F 4Y4RA 1LDJA 4PZJA 1RUNA 3T6NA 1ZR2A 1SANA 3BHQA 3PIPF 3S2HJ 1O4XA 3R0JA 1FOWA 5IT3A 3BTCA 1NG6A 1VI0A 3C1DA 3ZQQA 3QOPA 1OISA 2DBBA 2LD5A 1V4RA 3M07A 2LKPA 2XB5A 3H9GA 5TGTA 4BEHA 3ZQLA 1KQ8A 3M7GA 3PNYA 4IRGA 3J81Z 2R7RA 4C2MA 2MW8A 5DM7F 3KP3A 2HXIA 2H6CA 3QU3A 1D0ZA 4LIVA 4KFCA 3S3OA 3HYIA 3K70C 3ESWB 4A6EA 1N78A 1BIAA 1E0EA 3PQJA 1B9NA 2OQGA 3Q9SA 3A4CA 1IAWA 1UI6A 2L0KA 1J7KA 5HBUA 3K1NA 1I3AA 3DQVC 3L9FA 2NXNB 5DEQA 1WVRA 1KQ0A 3HTSB 3ZMVA 2ZJ2A 2VUMJ 1R4NB 3JRHA 2DT5A 2PJRB 2ZNZA 2BZTA 3LSRA 1VQ5I 5D19A 2CQKA 2DI3A 5J1RA 5BOXA 1J59A 2Q0OA 1S7EA 2VOPA 2X48A 3A01B 4RDUA 4PFOA 3TW7A 4U7DA 3HEFA 3M8EA 3H36A 3BR2A 1JI8A 5FKKA 4E4HA 2FOWA 2F2EA 3MQ0A 1LKXA 4YFKF 2ZB9A 1DPRA 2E7WA 3IP4B 2WA0A 1IRZA 4NELA 2NNNA 3T5XA 1GUUA 4AIKA 3E6DA 4WX9A 2XHKA 3QP5A 1GT0C 2N8GA 1AU7A 2JPCA 2E1OA 2OJED 3AG3H 5IYCJ 3CCEI 2JA5J 2IU5A 3GTPJ 1KU7A 4AVZA 5FKOA 1MSFC 3BG5A 1RZ4A 4XLCA 1O7FA 2BGCA 4RS8A 2QKLB 3S17J 2YVXA 2H27A 3CLOA 3MVPA 1K78A 1R71A 1QNTA 2BEOA 2NYXA 3NWTA 4YZEA 3Q0UA 4RBOA 1UAAA 2XRNA 3AG1H 5EEGA 4G12A 4RB0A 3ANPA 2K9QA 3HGGA 4QPOA 1U8RA 4JOMA 2DYRH 3QODA 2PMUA 5GPCA 5D8LB 1MBJA 4NHJA 4D7MA 4IRIA 1H89C 4BHPA 4BEHB 3K6GA 3L2UA 1AWCA 2L7MP 1TC3C 1O57A 1LDDA 3NQOA 4LK0F 4HPQA 3I55I 5BS6A 2XAQA 4D5CA 1D5VA 3QWLA 1A36A 2WV1A 4V2GA 1OYIA 2ZCXA 3BJBA 2LKSA 3QPLA 4WXDA 1K6YA 2GIZA 3RPQA 3VIBA 1E3HA 4FCYA 3BTJA 4NC6A 3CD6I 3J7AO 2ADUA 1GXPA 3I0TA 2MFZA 3IWFA 5GTIC 1ETVA 3WTXC 2VQHA 2UXPA 1OR7C 1E3PA 2XSJC 3BTLA 3PNTA 3RDIA 3OYCA 1H8AC 3EYIA 4M72A 2BW3A 4DQ2A 3OV8A 2V1NA 4Z2YA 2X6OA 3QAHA 2K4JA 3JSJA 3BT9A 1YQAA 3PO3J 3MCZA 1FZPB 3HIFA 3P9CA 5CVVA 4RB3C 4BAYA 3OYFA 3PFYA 3VP5A 1W5TA 3CCYA 4CUGA 1Z77A 2CH0A 2W53A 2E2IJ 1X1DA 2EA4A 5A2QK 3V8JA 2LR8A 5B1BH 3ONQA 2IS4A 2L9RA 4LG3A 4FT8A 3G2BA 4I01A 2W1OA 5K5QA 1G6NA 2V9VA 1QZYA 3FXQA 3RH2A 4PK4A 5FGMA 3F1BA 1XPXA 5FLVA 4LGWA 5H2FC 4MQVA 4BHCA 1OJLA 1YW7A 3QOEA 4FISA 2A69F 3AG2H 1T8IA 4A3BJ 5HLGA 4M73A 5K7ZA 2HFHA 3G7RA 1JKRC 2CV1A 4AVPA 1K78B 4ANJA 5FMPA 2WAFA 1RPWA 2W85A 3V42A 1CF7A 1P4AA 1VQOI 3HHGA 1QHGA 1S72I 2NVXJ 3HTAA 2D2WA 1AA7A 3LA7A 2Y31A 3RYPA 1X4OA 1WJCA 5D5UB 5B3SH 2XROA 2DTRA 3TDZC 1JUPA 2DDBA 1ON2A 1Y1VJ 3JRGA 1N25A 3E6CC 4L0YB 1QO0D 1ZHFA 5ICFA 3ZGKA 3FKIJ 4BUPA 3QYFA 3E5UA 4MTEA 3C2GA 2DAOA 2XAGA 4NDLA 5H6RA 3OYHA 2UXUA 3LMMA 4P9UA 3RQ4A 3J7AY 2HU9A 2MC3A 3DXJF 2DA2A 1FP2A 2C6YA 5C3EJ 3DBLB 1Y0NA 2WAQA 4RB2C 1IN6A 4BE2A 2BW3B 2BXYA 1TLHB 4ESBA 5M5YJ 3OYAA 1FNNA 3B81A 3T1BA 1ZH5A 1RETA 3LSJA 3TGNA 4RGXA 2HNHA 1D1BA 4PXIA 1WPKA 2DU9A 1SGMA 2E71A 3B6AA 5J4YA 2ZFUA 3L2QA 2HQRA 2M4GA 3BROA 1O3SA 4HF2A 3GMEA 3DF8A 4IF4A 1BC7C 1HDDC 4AIHA 1Z91A 3E7QA 4AIDA 2GWRA 5LFAA 4B47A 4XMYA 1XGMA 1K4SA 5A2QZ 2E1NA 2QZ8A 1MJAA 3P7NA 3W6KB 3OR1C 3LAJA 1UCRA 3BZKA 2AXLA 2HYFA 4I02A 3GTOJ 1VF9A 1Q1HA 3RIRA 1WQ2A 3WTUC 5FJ8J 2QWWA 2UZKA 3MD2A 3R61A 1CF7B 1CQTA 2P81A 3GBGA 2WY7Q 3R0AA 1UELB 1NH3A 2E34A 2CW0F 1ZREA 4YEJA 3L00A 4AIJA 2EFPA 4HLXA 5L3BA 1W1WE 3ZP5A 3P9TA 3VSLA 5GTHC 1TL8A 3QQAA 3W2AA 4CYCA 5F0FA 4M9XA 3VODA 2FJ1A 3RJPA 5DD4A 2VKEA 1E2XA 1WJ5A 4L0ZB 3K4NA 1X1BA 1F36A 1S7AA 1UG0A 2QM3A 4C3JJ 5F1RA 1PUFA 1VQ9I 1X3UA 4E7SA 3NPIA 2HEOA 2X85A 4PCQA 2K9MA 1YS6A 1UB9A 1ON1A 2L4MA 2Q2EA 1F5TA 4FE7A 1MNMC 4A3DJ 1D0YA 1Z7LA 2L54A 1ZQ3P 1FX7A 2DA3A 2JRMA 3LSHA 1R1UA 1Y8RB 2HZDA 3V7SA 5D4SA 1A31A 4L62A 2DFEA 5HOOA 2K9NA 2XRLA 2IAIA 3CUQA 2TDXA 1DUXC 2LP0A 2GAUA 4E6KG 3WU0A 3ZMDA 5E3NA 2EV6A 1X2NA 2JRTA 4W97A 3IKTA 1FC3A 2W48A 3TP3A 2QBYA 1ZARA 2ZO4A 3WTVC 4UXNA 3VW2A 2YPRA 1WJFA 3LSMA 3CCJI 5DCMA 4IHWA 4KMUX 2NS8A 2M45A 1MDMA 2LDUA 5EEAA 2I8DA 1REPC 1IDYA 2L3DA 4UUTA 1S7OA 3H0GJ 3GYHX 4CGZA 3OSFA 4R79A 4U7BA 3DP7A 3L2WA 1ZK8A 2KRFA 1BR4A 1FMVA 1X1AA 2VN2A 4HX8A 5BNGA 4WK8F 1IZ1A 1G3WA 5FHPA 2DA1A 3BY6A 4K2EA 2VE9A 3RPUD 1VQPI 2ID3A 3GTLJ 1QZZA 2DA6A 3H35A 4ZYEA 3K1MA 2QKMB 3A03A 3B73A 1WJEA 3KIOA 1VQ7I 3QBMA 2V7FA 4NC7A 3VTIA 2I5UA 4U87A 3HKZA 4ZTFA 4ICHA 4EJWA 5DDGA 1LB2A 2VJ4A 3FXKA 2LY1A 2GA2A 2DFFA 4C2TA 2VBWA 2IS2A 5HS9A 4CYCB 2A3SA 1V3FA 2M87A 2G3BA 4N4NB 4MEYF 4OINF 4CCNA 2HDCA 4XQFA 2CV0A 1TWHJ 1ZAOA 3IUOA 3F0CA 1UMQA 3ASOH 2PEXA 1MD0A 2R5YA 1PUFB 2R7SA 4UUSA 5CW8A 5C4YA 4IEJA 3BG9A 3MKWB 4I09A 2KP6A 3GLXA 2DG8A 2Q2EB 4XM3A 1FTTA 1JGSA 1O3TA 3HSEA 1ETKA 2HYJA 2ZJQF 4YIFA 3P9IA 3ZMTA 1BM9A 2E7XA 5CLSA 3CUQB 3A1YA 1BOBA 3M8FA 3HOUJ 2CW8A 2TCTA 3LSKA 2WB1N 1ODDA 2ISZA 2VQGA 2NRAC 5EG0A 4X1EA 2FUG2 4KT5C 4EM1A 1DU6A 3HTJA 3DU5A 3OYNA 1W0TA 3RZOJ 5DCMB 2BHZA 4D1QA 4CCJA 4UV8A 5E17F 4EM0B 1RC9A 2Q1ZB 1MDMB 2OZ6A 2VT2A 1B9MA 3KP6A 2HQ5A 2VKDA 4L9VA 4MTDA 2EFOA 4BY7J 2STTA 1P7JA 3KLNA 1P92A 2K9SA 1HKSA 1K79A 3EUAA 1YW9A 2W25A 1BR1A 1TQMA 1VNDA 5C4XJ 1IN5A 2V57A 5CXGA 1Z21A 1YHQI 3OIQA 4BGDA 5M5WJ 2ZOYA 4FTHA 3V6GA 3RCOA 2R7QA 1A5JA 3S14J 4LMYA 4QSHA 2IPQX 4MLOA 3OYGA 4EGYA 2DXIA 2G7SA 3L7WA 2VJIA 3F3XA 3KYCB 2JA6J 1W5CC 3J80Z 2HPMA 3L09A 2R5ZA 3OSGA 3H3UA 1B6AA 4EATA 2R7XA 1GXQA 1IN7A 1BC8C 2ACJA 3GLLA 1EKEA 2VBZA 3GTMJ 4ZDOA 5EYRA 3V7RA 1WSUA 1U0JA 2B1EA 2R5YB 5IP7J 2F5VA 2XB0X 4UUSB 1HA8A 3LFKA 4EJUA 2R7WA 2WWYA 1W0UA 5CKTA 2NOGA 5FRNA 2HVSA 4IRHA 4HLYA 2NNYA 2YU3A 4KN7X 1F43A 2HS5A 4KICA 3KP7A 5B5EC 3G71I 3CC4I 5D5XB 1LE8A 1XMKA 3HPGA 3D5SC 4BQQA 2L2OA 2NP3A 3BJ6A 1FBQA 5JLWA 1QVUA 2XAJA 2HGCA 1DP7P 1W7PD 3DLAA 3W2WA 5BPIA 3A0BC 4RAGA 3CCMI 3CJRB 3VSKA 3K4CA 2R7OA 3M4OJ 4XORA 4BXFA 2Y9ZA 4V19K 4I0BA 4XRFA 3ROUA 4EMSA 5EG0B 3WTTC 2F4OB 5DCFA 1ETWA 5J3LA 3CP8A 5EDNA 2IRFG 1D1CA 2HKUA 3I54A 4BBRJ 1I5ZA 3ZMSA 1HOMA 3K4BA 2JSPA 1RR8C 5ICEA 3LSIA 1FYKA 3GVAA 2Z1DA 3X2QH 2EPFA 4UUVA 3IAM2 5J8CA 3R60A 1R5HA 4YIIA 4C9YA 2MABA 1OCPA 3Q0VA 2AS5F 2D1HA 1ZRFA 5ERIA 1KONA 2NVUB 2VPLA 4HYEA 3V78A 3JREA 5HODA 4Q5SF 3S1QJ 2HWVA 3LSTA 3LQQA 3OOUA 4BBSJ 5DAJA 3IV5A 3VOXA 4EJOA 1TBXA 4RAYA 1BJZA 5K5RA 2KIQA 4KIBA 3VB2A 4A3KJ 3GUDA 2X0LA 2Z99A 1HQCA 3K0LA 5E1XA 2HVRA 3K69A 1HW2A 2RDPA 1FT9A 4AM3A 1V54H 3VOEA 4II3A 3CUQC 2R5ZB 4EGZA 1JJ8C 3ELKA 4JBAA 2NS0A 4A3GJ 3COLA 3BCBA 3ULQB 1KU3A 3NARA 3VVYA 4IHVA 2EV5A 3A02A 3F8NA 3GFLA 2VJ5A 3FISA 4R8HA 2NOJB 4O3MA 2KZVA 1U6GA 4Q48A 4ZDLA 3SDGA 4GRIA 3DBHB 4JX5A 5KVRA 2R7VA 1KA8A 3KEQA 1GHCA 3PM1A 2KFDA 2G7HA 2LMDA 3JSPA 1LE8B 1ORKA 1PYVA 2ZXHA 2JMWA 5HLIA 3RD3A 3RKQA 5CVIA 1R4MB 3JRCA 2OF7A 1D5YA 2FJI1 2XSDC 5HVQC 2M30A 3CF5F 3V8KA 1YG2A 2ZNYA 4ENJA 3CRJA 1IRFA 1T98A 1EH6A 4AYBN 4XIDA 4A3MJ 1SAXA 3LWFA 1HF0A 2JZYA 5LEKA 3CMAI 1ETQA 2RGVA 2Z5UA 3WG7H 3GTJJ 3LJLA 4D7NA 3HRTA 2B7EA 4CCKA 3MZ8A 4L9JA 2E60A 2LLKA 2NS7A 4GGGA 5LLQA 4UV9A 5EJCA 4HF1A 2E19A 2YUSA 3HSRA 1TT5B 2UXNA 2VC0A 2XKOA 2XAUA 3DKWA 2QEXI 3I4NJ 1T0FA 3K4MA 4LB5A 1B72B 4ZYHA 3N97A 2X6YA 1WJDA 3DPJA 1ZGWA 4XICA 1PP7U 2OV7A 4Y17A 1SVLA 3DEEA 1S9HA 3CMYA 1XN7A 4IHSA 2XGEA 3LSPA 3DPLC 3NNRA 3KEOA 2Z3YA 2ESNA 3BDDA 4E7JA 3HJEA 2GXBA 2CWEA 2RN7A 3NRGA 2RQQA 2WTEA 2MSYA 5LGNA 3OY9A 3TOBA 3SYTA 1MMAA 2EZHA 1RIOH 4OD5A 2DOFA 2QSHX 1MH4A 2GXGA 1WJBA 2M34A 2V1XA 4YELA 5E1ZB 2JTVA 4HV5A 3ECHA 4BH9A 2IEKA 5M3FJ 2Q8KA 2YVHA 1EV7A 1T08B 2LF7A 2PMHA 3BR0A 1LDKB 4P1WA 4ZH4F 1YS7A 3NRVA 2EWNA 2EFQA 3JRAA 2F5DA 1RUOA 1A6QA 1OYYA 3C2HA 5H20A 3LA2A 2XAHA 5FGLA 2CG4A 5IYBJ 5DS9A 1JJ6C 2R7TA 2E1MC 2CSOA 1Z67A 4XONA 5FFXA 2YX4A 4KITB 3BR3A 4CSWA 2K5CA 2V6CA 4UB6C 5CYVA 2GOMA 3HTUA 1Q1VA 2DK8A 1ZRDA 2QTQA 1JTXA 2BE5F 5FKLA 1ZELA 3M3YJ 1X1CA 3GFMA 2QENA 1R23A 2A6TA 2V6EA 2HYTA 1EA3A 5BPDA 1G2HA 5H9TA 1IUYA 2F5EA 5LRRA 5HNFA 3N05A 5M3MJ 1T39A 2DPUA 5DYMA 1QGPA 1V5FA 2DOAA 2ME6A 4B44A 3ZMZA 2LY9A 4KJZA 2RNGA 4WIBA 2NX4A 2YVEA 3DCFA 2LBFA 3SXYA 2FNAA 4EV0A 2M1BA 3S93A 1YE9A 2RREA 3TO6A 3FBNB 2K02A 2EJRA 1J5YA 2DT7B 3IC7A 1SFEA 4HG2A 4O5VA 3NXCA 2XDVA 4XN3A 3HBLA 4HEA2 3PJRA 1FBUA 2KMUA 3HRSA 3LSGA 3JRFA 3CCLI 2L7KA 4E7IA 4BXXJ 3VVZA 1FOYA 4FQGA 2EZIA 2EZKA 3CMEI 2A6EF 3K2AA 3QP6A 3LOCA 1I6HJ 1F9NA 4M9SA 4XKBA 4DBQA 3F21A 3G1LA 1K6OA 3E5QA 4A0XA 1RKWA 5E3OA 4O6JA 3SZTA 2PN6A 2WUIA 3CF2A 4XR6A 2FX0A 2IGKA 1IC8A 1IRGA 2L02A 4JKZA 5E1WA 1FPQA 4BJ6C 3RPUA 1SEUA 3V8LA 2MC4A 1KYWA 1X4PA 5K58A 3VEPA 2UUZA 1XMAA 1PP8F 1HSTA 4B4CA 5JI6A 2Y2ZA 4Y3OA 2MLGA 3SJMA 1WH7A 2KDZA 1ETYA 2UXHA 3H5NA 4P5OA 2PFBA 4P55A 1SVMA 2BVMA 5J47A 1U9NA 5LHHA 2L9VA 2F5FA 3NAUA 2A07F 2XPWA 4RM3A 3BQYA 4HAMA 4ZC3A 1LEBA 2OI8A 2CQNA 3WGIA 2QQ8A 1MGTA 1JHFA 2MGQA 2ZC2A 3CLQA 2QQAA 2TRTA 3N4MA 2LY2A 2M7BA 1WI3A 3GTGJ 2Y30A 4C3IJ 4PJ0C 3HOTA 4UVBA 3JRDA 5J1UA 2VLAA 3G3ZA 4A0YA 2CYYA 1E3OC 1OMIA 4CDGA 1SMTA 1W36D 1IXSB 3ZR8X 1YO5C 3PUFA 2PI0A 1FSHA 3HOXJ 2G9WA 3GEZA 5K7HA 1RI7A 1X19A 4XNFA 4CZCA 4PGHA 3IL2A 2JA2A 4WWCA 4BACA 2LBFB 1Z3YA 3J7ZI 4OIRF 2M0CA 1MJ9A 2K4BA 3U9GA 1VQNI 4ZJZA 3DPUA 1DGRM 2O6GE 1OYWA 1GLNA 4L5EA 2VASA 1BL0A 3FXLA 3HXLA 5E20A 2Z2SB 5K1YA 3KX2A 4IJAA 1POGA 1Z6TA 3W3CA 2KL4A 1XX5A 1N77A 1NK2P 3KKCA 5HSZA 4MQ9F 2FOKA 1TWAJ 1OKRA 2R7DA 1H9GA 3O8HA 5DTDA 1CGPA 3WTZA 2ZKZA 3GTKJ 3VUQA 1K7AA 4ETSA 1HKQA 2BVLA 3FM5A 1UHSA 3M1CA 3P9KA 1J75A 2ZCNA 3W6JB 2EQRA 3VYUB 2P7CB 4HQMA 3IRQA 3HOZJ 4FASD 1M1EB 2M8GX 3TP0A 2NVQJ 4HF0A 3JAMZ 1YJ9I 4UDSA 3IH2A 5IP9J 4HSTA 3LQRA 4BE0A 2HOTA 3CCSI 2JA8J 2H09A 4RLQA 4EVIA 1IF1A 1ZGAA 4IXAA 4EQQA 1H9TA 1X3ZB 3TOAA 2JSCA 2HOSA 4G6QA 2WBMA 3CTAA 2LNBA 2L7FP 1WJAA 3UR3C 4LIUA 1YI2I 2CUJA 3I3LA 2B0LA 3SQNA 1FOKA 2H8WA 2IBDA 3O3KA 2VODA 3MZYA 4AC0A 4DW6A 5ICGA 1IRXA 1BI2A 1PVEA 4B8XA 2K9LA 4IHTA 3CJDA 1D3YA 1UG2A 1VQLI 5GADJ 1W7PA 5IOZA 5D5WB 2KPMA 2ZJRF 4L5JA 2FE3A 1I1GA 5HDGA 1VQKI 1LNWA 4AF5A 1T56A 3K4JA 4KISA 2O7OA 5FLMJ 4BDZA 4DYRA 3AFHA 2H1KA 2G7GA 1G59A 1DPUA 4E7HA 3EPZA 2AQEA 2DOEA 3U2RA 4IZZA 1T6SA 1P6RA 1U8BA 2VT3A 1YLFA 2DQLA 4IQ4A 3HRMA 2FQ3A 1XMXA 3FXMA 3BR1A 2DA4A 4CCLA 1YW8A 1F1ZA 3IAS2 1SD7A 2B9SA 5F0HA 5DUIA 1R9TJ 3FZVA 2VI6A 4A6DA 2HZTA 2FBHA 4HKUA 4RGSA 4MXMA 2DPDA 2CQQA 3U21A 4CXFA 3S5RA 1EJ9A 3REOA 3K2ZA 1TQPA 4ZDPA 2ELHA 3IH4A 1I1SA 1A35A 1XSDA 2CGPA 3S16J 3O60A 1HW1A 2EFNA 4PJMA 1R1TA 3GW2A 5GAGJ 5BMZA 3E7LA 1JT6A 1BR2A 2IVMA 2K27A 2W7NA 2GUHA 3FRQA 3DKYA 3CDIA 2H94A 4PDKA 1TTYA 2EINH 2R0QC 1DU0A 1R6RA 1TWCJ 1G8XA 1MBKA 2KJBA 2O0YA 3AL0B 3KEYA 2A5WA 1R49A 3GXOA 3M8JA 5KCMA 2KISA 3G4SI 1ETOA 4NNJA 3ZXSA 3S32A 1Y8QB 4GCLA 2P5VA 3H3VK 2EB7A 4UNOA 5LGTA 3H1CA 2O61A 1FP1D 4AUXA 5LBQA 4UVAA 1BI3A 1ZYRF 1W7PB 2KRHA 3LAPA 2LC2A 5GAEJ 2LYCA 3MKZA 1QA6A 2HQAA 4Y52J 2A68F 3HSFA 3W6VA 1HW5A 1Z7UA 4GFBA 2UWMA 2R7UA 4XLFA 2P4WA 1APLC 4YFXF 5KNLA 2QA4I 2D5VA 4QPQA 4GDFA 1UZCA 2F48A 3BRUA 3S1MJ 4DBRA 3FX3A 3J80K 4KYWA 3KCCA 3OIOA 4MK6A 3G1OA 4XLEA 2R4GA 2GOXB 2X6XA 4GCVA 1J9IA 2RQPA 3D1NI 1WKMA 2V26A 3MKLA 5HDNA 3HRUA 2V9KA 3RSNA 4B48A 3IH3A 3BTIA 2W00A 3L1PA 2IP2A 4N9HA 2JT1A 2DA5A 1I50J 3E97A 1UHMA 2DMPA 3IWZA 1HXDA 4QWQA 3AAFA 4M6VA 2R93J 1K83J 1ZG3A 2Z16A 1V5GA 2P7VB 2HKXA 4CZZA 3CDLA 4BU2A 3F8CA 2IS6A 2OC6A 2DYSH 1R1VA 4MFEA 2D6YA 4E7LA 3E6BA 3WU2C 2ZOZA 5CVJA 2IGNA 1DGWY 3DU6A 3PPBA 3OYBA 2WB1A 2YU9J 1FIAA 2B3WA 4OOIA 3MAJA 2IXSA 5HAWA 1YOVB 2OTLI 4G9YA 4XLHA 5TRDA 3HE0A 2DG7A 3QYBA 1J09A 3ABKH 4HOBA 2OD5A 5F04A 1KYZA 1OCTC 1A04A 1B4AA 4QIWN 3E1SA 2ETHA 2CUEA 2MBFA 4I6ZA 4M3DA 2IA1A 3WG9A 3KYLA 2KZGA 3R4KA 2W84A 4CYDA 3GZNB 2XGDA 4JYKA 3VYSB 1LFBA 3HL2A 1DDNA 2AXTC 3HKZN 1TNTA 2QBYB 4IOAF 1YJNI 2Y0SN 2BY3A 3F8MA 2W82A 4U9NA 3M9AA 3WE3A 4XN0A 2FU4A 3WHCA 1YITI 1D8JA 3WTWC 2E5ZA 4GCKA 1T2KA 4A3JJ 2O5RA 1D8KA 5LHGA 5KAFC 4XLAA 5ED4A 3ABLH 2M9HA 2CFOA 5ILUA 1MKMA 4HSRA 2ELKA 4HDVA 3GO5A 4XLPF 2IGOA 3F6OA 3L2VA 3CCRI 1R22A 4BJTA 3RI4A 3MEXA 4KUMA 4D9JA 3HIMA 2M2EA 5D1RA 1U5TA 4MNUA 3QRFF 2BYVE 1FBSA 5CQEA 3BR6A 1GV5A 1SFKA 3AL0C 1R58A 4C3HJ 3SEQA 3D5RC 3H3ZA 1RRJA 5JFRA 2PQ8A 5DV5A 1FYMA 3BPVA 3VW1A 4CH7A 3MKYB 1IUFA 2X9DA 3FHNA 4BKXA 2EV0A 2VC1A 2GFNA 3I9V2 3OOPA 3EETA 3Q9VA 5E18F 5L3FA 3K9TA 3KPHA 4C2MJ 5GP9A 1EF4A 1ITYA 4A5NA 1BA5A 2EILH 2J5PA 2OUMA 5IT9K 2OU2A 2KQRA 4XLNF 3PO2J 4BHBA 2ME0A 1RESA 3S8PA 4LB6B 3BZCA 4XRSA 2EIKH 5F6FA 1G3YA 4NN1A 4EJVA 3OL4A 1QPMA 2HQNA 2VBXA 3KETA 2M7AA 1U9OA 4M3BA 1I3QJ 3KLOA 2OZUA 3KP2A 2F4IA 2FF4A 2VXZA 4M71A 5HS7A 4AD9A 2QSFX 5EFYA 3U1KA 1XCVA 1T38A 4NB5A 2ZY9A 5CVRA 3BWGA 2QSGX 2KDOA 3I5UA 2OQRA 1IDZA 3R6SA 1FY7A 4G94A 2QUFA 2OAZA 3ZQ7A 1VQ4I 2RV8A 4PJNA 5JVTA 3S2DJ 3NEUA 3DKXA 2PLYA 4RGRA 4ABZA 1JUMA 3FXOA 4A12A 3S1NJ 1QBJA 5AONA 2BV6A 4ENMA 1XDUA 3NWSA 2IT0A 1NTCA 4ZZDA 3GFIA 5CXIA 3SEZA 1RNLA 4RAZA 3BP8A 3GZIA 2LK2A 1IN4A 2J5OA 2Z9OA 1U5TB 1WRJA 1Z6RA 2MYSA 2X51A 4F55A 1JKPC 3FMQA 4RB1A 2GIVA 2E1CA 3V4GA 3LFUA 1BIBA 1OLTA 3O2PE 5EF6A 4EJTA 2JVHA 1SMYF 3H0DA 3DTEA 5E79C 2GZWA 1OCRH 4Y13A 4HNUA 4DVYP 4A3FJ 1S6LA 3QU6A 2UXOA 1XGOA 1L3LA 2A61A 2VKHA 2VJJA 4B3XA 2XKPA 5J1YA 2O8KA 2QYOA 3ABUA 2E2JJ 3I59A 1JXSA 5B66C 2FMYA 4HBLA 1TQIA 1YX3A 2VONA 3I53A 4IPAA 3TBIA 1SFUA 2EIMH 5E3MA 2K3FA 5IPAA 1QVTA 1YX5A 4GO1A 3F9KA 4AYBA 2UXIA 1I6XA 4A69C 1MZBA 2NVYJ 4RMNA 2JK3A 2V1DA 4AWXB 3ZQFA 1K61A 4BYYA 4MGRA 2L01A 1UFMA 3U1DA 3HPHA 3ZRGA 2PFVA 4PJLA 2DFIA 5IT9Z 5AIQA 3OMYA 4S04A 2REKA 2XGCA 2CFXA 2VOOA 1MMDA 4DIQA 3JRIA 2KT0A 4NC8A 4J00A 2X1DA 4LLGF 2LH9A 2IGMA 3CESA 4V2FA 1R5ID 2L4AA 3OYMA 1TNSA 3QPSA 2P5LC 1TP4A 3MN2A 3JW4A 3CQZJ 1Y6IA 4Y33A 4IKFA 5HDKA 1Z3XA 1S5LC 4ASNA 1K4TA 2VQLA 2XV4S 1VZ0A 1U78A 4ESJA 2H1LA 2ICWG 5F0CA 4KDPA 2WAEA 4L5IA 2DMNA 4WCGA 2B63J 3PSIA 3OWTA 1TT0A 3JR9A 3ERED 3ANGA 1PUEE 2W57A 4GFKA 4L9NA 1I39A 3RTRA 3RYRA 2L9SA 4LG0A 4WF2A 2KIMA 4BJ5C 3S3MA 3MNLA 1ERDA 3PFIA 2P5KA 2WGBA 2YSRA 4M6XA 1DP3A 1LUJB 1OFCX 3MWMA 3ZQHA 3BG6A 3D0SA 2FRHA 2DLLA 5GPAA 3HB9A 3I59B 1ONVA 3CUOA 1IN8A 2CO5A 4LD5A 2PMZN 1SD6A 4PUSA 1ZTRA 2OCCH 1G4DA 3CC7I 3HOSA 2M0MA 3H9QA 1WH5A 1ETXA 5JVGF 2DK5A 1GVJA 3DTKA 1HKTA 4M3GA 2VB6A 4H4KC 3T8RA 1JE8A 4MEXF 4C30A 4XOTA 3LA3A 2HVQA 1USTA 1ZGJA 5EZHA 2F6CA 4G7HF 2QQBA 1V55H 2DN0A 4IOCF 4IHYA 4OWRB 1MBGA 3FK6A 5AQCA 3FIWA 4BL0B 3JTGA 1O7LA 1U5TC 2CUFA 3ML6A 1Z05A 4LITA 4ME9A 4H0EA 1N75A 2DCEA 4OAZA 3E3VA 3Q3SA 5D6EA 3BNIA 3K70D 2MH2A 1RKTA 4XKVA 1YIJI 4HNVA 3CP2A 2M8EA 3KE2A 3AQTA 1XD7A 5LEJA 1B1BA 2VBYA 3GEUA 4ON0A 3C18A 2A6HF 3DV8A 1SC7A 4JK1X 4GCTA 2E36A 3KP5A 3RKYA 4PSWA 3VDXA 4XRMA 1YJWI 3EGQA 1P4WA 2WV0A 5IP6A 1JKOC 4OMYA 3O6BB 1X2MA 3EYYA 4Q47A 1TW3A 4M9ZA 1P4XA 2L9NA 2CUZA 3M1EA 3WGGA 1NK3P 3S15J 2LF8A 5KAIC 1QHHD 1XGNA 2Y9YA 3FM3A 3JTHA 3TW6A 3AKZA 3HGYA 3OR2C 4LG0B 5LD2C 2D1VA 2DW4A 3FXRA 4QLCU 2IW5A 4IQJA 1D0XA 3JAMK 2CW7A 2JVGA 2E5NA 2R92J 4A0ZA 2PBXA 3TQNA 5D5VB 4FHTA 5HLHA 4N9IA 3EUHA 3F22A 5FROA 1BJAA 4S0HB 2XGXA 3VWBA 4Q4ZF 5FB2A 1JGGA 4M6YA 1ZLKA 1KZHA 2E2HJ 2AO9A 4KNYA 3F8FA 1FMWA 2F07A 3BLYA 3HUGA 4KIGA 3A2KA 3K7AJ 2R7FA 1JKQC 3B6CA 4F91B 2RAEA 3FK7A 3SZGA 1P7IA 3O8GA 2O9LA 2XPUA 2GBYA 2O8XA 3DWLE 4XOPA 2DQRA 3K8PC 1JT0A 2HPIA 3HC7A 3FF5A 3FBIB 2BY1A 3BZ6A 2UV1A 1MBHA 5B1AH 3COAC 1W36C 1LVAA 1GV2A 1LFPA 4RA2A 3C7JA 3VYTB 2HTJA 2RVCA 3PUBA 4U0VA 2CRGA 3OS1A 1XGSA 3CCQI 4L9TA 3BOQA 1U3EM 4MHGA 4F52A 1YTYA 4BY1J 3JCUC 1ULYA 4NQWA 1WWXA 2PZ9A 1WHUA 2K7LA 4CO8A 2EZLA 4AU7A 4F7ZA 2GLOA 4DYCA 3HZJA 2OERA 2QKOA 2M5WA 2WADA 4JP0A 3SDBA 4IL6C 3KZ9A 3BQZA 1AHDP 4JQFA 1MMSA 4P9FA 2L7ZA 4LLLA 4DZJA 1F4KA 2PG4A 2GXAA 2RASA 3SWHA 2COMA 3F6VA 1Z0XA 4XRSG 3TO9A 3MZHA 1MIJA 2F5CA 3OL3A 3QYEA 4ZYGA 3H5AA 4IX7A 1XSVA 4A93J 2FBIA 1Y56A 2V4JC 1SVOA 2FSWA 2OBPA 3EUPA 2CJJA 5D6FA 1FLIA 5J40A 1QRYA 3ZMUA 2CS3A 3GFJA 5KK1A 5IY5H 4A3EJ 2LOOA 4GFLA 1QQIA 2DJIA 3K10A 4EEFG 3LNQA 2FBQA 2AQFA 2HKOA 1HBXG 4CA0A 3TKYA 1Z9CA 5FD5A 4CCOA 4BQAA 1WCMJ 1XCBA 2MD5A 1JTYA 1S29A 5FKMA 4M3EA 1VQ8I 4N4OB 2XPVA 3GZ5A 2JA7J 3AQSA 5L3EA 2Y0MA 3CWRA 1J2XA 4FX4A 4B1RA 3WGHA 9ANTA 4BDYA 4C2UA 1L0OC 2L5QA 3I4PA 4HNTA 3HUGB 3GWZA 3RKXA 4ENNA 2FXAA 3H9JA 3T8TA 4UB8C 4YIRX 2KIFA 2NVTJ 2EH3A 2ID6A 2DFHA 3D5LA
chains in the Genus database with same CATH topology
1SFOJ 3LSRA 2DA5A 5D19A 1I50J 5J1RA 3ZQIA 1S7EA 2X48A 2DMPA 3A01B 3VOKA 3Q0VA 1OCPA 4M6VA 3DEWA 4RDUA 1K83J 5E3LA 2R93J 1A6IA 3TW7A 3HEFA 3BR2A 3V78A 3CDLA 2Q24A 3JREA 1ZKGA 5HODA 3S1QJ 5FKKA 2LTPA 4MFEA 2D6YA 4J19A 1T33A 2ZOZA 3PPBA 2ZB9A 3OOUA 4BBSJ 3IV5A 5DAJA 3WHBA 1IRZA 3HTHA 4NELA 2YU9J 3VOXA 1GUUA 1FIAA 1AKHA 5F1JA 1BJZA 4A3KJ 1GT0C 2N8GA 1AU7A 4KWAA 2E1OA 5HAWA 5IYCJ 1TWFJ 2JA5J 3HE0A 2IU5A 3GTPJ 5EGOA 1XG1A 2DG7A 5FKOA 2R5ZB 1JJ8C 1MSFC 2JWTA 3BG5A 5F04A 1OCTC 4A3GJ 3S17J 3COLA 4QIWN 3MVPA 2CUEA 4I6ZA 4M3DA 3NARA 3VVYA 2OPTA 2WAQN 4IHVA 3A02A 4YZEA 3Q0UA 3FISA 4RBOA 2XGDA 4JYKA 1LFBA 3HKZN 4G12A 3SDGA 3ANPA 2K9QA 3HGGA 2DJNA 2G0EA 5GPCA 2K40A 2Y0SN 4JX5A 1MBJA 3ZQGA 4D7MA 1H89C 3PM1A 4JX4A 1TC3C 2L7MP 3WHCA 1LE8B 1ORKA 3RD3A 2JMWA 4GCKA 4A3JJ 3RKQA 4D5CA 3JRCA 2WV1A 4V2GA 2ZCXA 2M9HA 2OF7A 1D5YA 3QPLA 3BJBA 2XSDC 2ELKA 4FCYA 2NP5A 3VIBA 3BTJA 3BCGA 2ECBA 1ZR4A 3CRJA 1ETVA 4AYBN 4XIDA 2UXPA 3HIMA 2M2EA 3NI7A 5D1RA 4A3MJ 5K7FA 1HF0A 1GDTA 3BTLA 1H8AC 3HDDA 1ETQA 3BR6A 4JX6A 2HDDA 3GTJJ 1GV5A 4DYQA 3LJLA 4D7NA 2X6OA 3SFIA 3JSJA 3BT9A 3PO3J 4C3HJ 2LLKA 2NS7A 3LWJA 5IYDJ 4A3CJ 2E19A 2YUSA 3L1PA 3I4NJ 3VP5A 3CCYA 1Z77A 3VW1A 2W53A 1IUFA 2X9DA 1B72B 1FIPA 2E2IJ 4BKXA 3S1RJ 2R7ZJ 2GFNA 2LR8A 3I4MJ 1EF4A 4C2MJ 5GP9A 1ZGWA 4XICA 1ITYA 3DPJA 2L9RA 1MSEC 1BA5A 3C2BA 2DMTA 2ID6A 3CMYA 3NNRA 2XGEA 3LSPA 1AKHB 1QPIA 3RH2A 3PO2J 2ME0A 1H88C 3F1BA 1RESA 5FLVA 2VKVA 3NRGA 5EGOB 2MSYA 4XRSA 1OJLA 2EZHA 2AHQA 4FISA 3G56A 4NN1A 4A3BJ 3HTIA 5K7ZA 1MH4A 1U9OA 2M34A 1I3QJ 4M3BA 1JKRC 3G7RA 3GTQJ 4JNNA 5FMPA 1HLVA 2IEKA 1RPWA 5M3FJ 4M3FA 2YVHA 5EFYA 3JRBA 3BR0A 2JA6J 2UXOA 2NVXJ 3JRAA 3KNWA 3HTAA 1IDZA 2Y31A 1YRNA 4A3LJ 5FGLA 5DS9A 5IYBJ 1JJ6C 1JUPA 1Y1VJ 5M5XJ 3JRGA 3S2DJ 2QIBA 2LVSA 3FKIJ 1FJLA 3BR3A 4ABZA 1JUMA 3S1NJ 1Q1VA 2QTQA 2ZCMA 3G1MA 3LHQA 1JTXA 4NDLA 5FKLA 1NTCA 2UXUA 3M3YJ 4I76A 5CXIA 5IOYA 3HM5A 2GM4A 3GZIA 2LK2A 2HYTA 5FKNA 2DA2A 1JKPC 5C3EJ 1G2HA 5H9TA 1X58A 5M3MJ 5M5YJ 5EF6A 4B3AA 3B81A 2QWTA 2ME6A 1UI5A 1RETA 2LY9A 3LSJA 4A3FJ 2NX4A 2DA7A 1BW6A 2YVEA 3DCFA 4PXIA 1WPKA 2FD5A 3B6AA 1SGMA 3C07A 5J1YA 1LFUP 2O8KA 2E2JJ 1IV6A 4FE4A 2ECCA 1FEXA 3VPRA 3NXCA 2HXOA 3HBLA 3LSGA 3JRFA 2DMQA 1HDDC 4BXXJ 1TWGJ 3VVZA 5E3MA 3E7QA 5IPAA 2COBA 1QVTA 3HOVJ 2EZIA 2EZKA 2UXIA 3K2AA 1XC5A 3LOCA 4A69C 1I6HJ 2NVYJ 3ON2A 3G1LA 2JK3A 2LKXA 1RKWA 5E3OA 1K61A 3ZQFA 2WUIA 2FX0A 1IC8A 4JKZA 3GTOJ 1VF9A 2LFBA 1IJWC 1HCRA 5FJ8J 3Q0WA 5K58A 5EZGA 5F27A 2REKA 1CQTA 2P81A 2XGCA 3GBGA 4B4CA 2JN6A 2Y2ZA 3SJMA 1WH7A 2CU7A 3JRIA 2KDZA 1ETYA 1YRNB 2UXHA 2KT0A 1U9NA 3HOYJ 3NAUA 2XPWA 3BQYA 2OI8A 3BR5A 4V2FA 3P9TA 3QPSA 3MN2A 2MGQA 1GVDA 3CQZJ 3QQAA 2TRTA 2YS9A 4DZPA 4CYCA 5F0FA 5F08A 1WI3A 1U78A 3GTGJ 5F0CA 2FJ1A 2XDNA 2VKEA 2Y30A 4C3IJ 2DMNA 1JUSA 1F36A 2B63J 3JRDA 5J1UA 4C3JJ 3JR9A 1PUFA 1E3OC 1HDPA 3ANGA 3NPIA 1MBFA 4GFKA 2CQXA 4W1UA 3ON4A 4A3DJ 4FE7A 2MG4A 1MNMC 4QTRA 3HOXJ 1ZQ3P 4IHXA 2DA3A 2I10A 3MNLA 5K7HA 2WGBA 1OFCX 4MO7A 3ZQHA 1B8IA 4L62A 2DTZA 2K9NA 2XRLA 2M0CA 2G7LA 2IAIA 2LP0A 5GPAA 3HB9A 5E3NA 1X2NA 4L5EA 2PMZN 4W97A 1VFCA 1BL0A 1ZTRA 2W48A 3TP3A 2VPRA 4CGRA 1POGA 3ZQCA 1WH5A 1ETXA 1NK2P 2H8RA 2QOPA 3KKCA 3VW2A 5HSZA 3VW0A 3BG3A 4M3GA 1TWAJ 4IHWA 3O8HA 5DTDA 1IG7A 2NS8A 3GTKJ 5EZHA 3VUQA 5EEAA 1IDYA 2DN0A 4UUTA 3H0GJ 1UHSA 4IHYA 1MBGA 3FK6A 5AQCA 3FIWA 3OSFA 2ZCNA 5D18A 4AC6A 2EQRA 1ZK8A 5BNGA 5FHPA 2CUFA 3HOZJ 2DA1A 2EBIA 2M8GX 2HOAA 3TP0A 2NVQJ 3PASA 4ME9A 3IH2A 2ID3A 4UDSA 3GTLJ 5IP9J 3Q3SA 3TEDA 2HOTA 3BNIA 2DA6A 2JA8J 5C4JJ 1RKTA 3A03A 3VVXA 4HNVA 3QBMA 5C44J 4ICHA 3GEUA 1FTZA 2HOSA 3HOWJ 4CYCB 4GCTA 2L7FP 3RQIA 2G3BA 1B72A 4XRMA 1TWHJ 3EGQA 2JJ7A 5IP6A 1JKOC 2IBDA 1X2MA 3F0CA 1UMQA 4AC0A 4DW6A 2R5YA 1PUFB 2QF7A 1NK3P 3S15J 4UUSA 5CW8A 2HI3A 5C4YA 2Y9YA 4IEJA 3BG9A 3TW6A 3CJDA 3HGYA 2DG8A 2DMUA 1UG2A 1FTTA 4JL3A 5IOZA 1RR7A 4AF5A 1ETKA 2HYJA 1MBEA 1T56A 1Y1WJ 4MFDA 4A3IJ 2O7OA 1B8IB 5FLMJ 2R92J 4DYRA 2H1KA 2PBXA 2G7GA 1U8BA 3HOUJ 2FQ4A 2TCTA 3QKXA 4S0HB 2WB1N 2QCOA 4LOCA 1JGGA 5EG0A 3BR1A 2AO9A 4X1EA 2DA4A 5JLXA 2E2HJ 2F07A 5F0HA 1R9TJ 2VI6A 1DU6A 3HTJA 3K7AJ 1W0TA 3RZOJ 1JKQC 4ACIA 4MIMA 3B6CA 4HKUA 2RAEA 3FK7A 1P7IA 3O8GA 3UKGA 1XS9A 2XPUA 2O9LA 2GBYA 4MXMA 2CQQA 1JT0A 3S5RA 2HQ5A 1WGXA 3KKDA 1MBHA 3IH4A 3A01A 4BY7J 1P7JA 1GV2A 2K9SA 3S16J 3O60A 2GENA 1IGNA 1VNDA 3RZDJ 5C4XJ 3E7LA 1JT6A 2V57A 2CRGA 5CXGA 5M5WJ 2ZOYA 4FTHA 2GUHA 4BY1J 3FRQA 3V6GA 1A5JA 3S14J 4QSHA 2R0QC 1DU0A 2PZ9A 1TWCJ 4MLOA 4XK4A 2G7SA 2EZLA 2OERA 2GLOA 1MBKA 4DYCA 2QKOA 3IUVA 3ZOBA 4JP0A 1ENHA 1MH3A 3KZ9A 3BQZA 1AHDP 2R5ZA 3OSGA 4Y7NJ 2L7ZA 1ETOA 4DZJA 2O7TA 2RASA 4D5FA 4X6AJ 1BW5A 3GTMJ 5EYRA 4GCLA 1Z0XA 4XRSG 3H3VK 3T6NA 1ZR2A 2R5YB 1SANA 3BHQA 3S2HJ 5IP7J 1O4XA 4A93J 2XB0X 4UUSB 4AUXA 3BTCA 1W0UA 1VI0A 2NOGA 3EUPA 2LD5A 2XB5A 1F43A 2CJJA 3ZQLA 1QRYA 1LE8A 4A3EJ 4GFLA 2NP3A 4Y52J 4EEFG 3LNQA 2FBQA 3W6VA 2MW8A 5JLWA 1QVUA 4GFBA 2HXIA 1WCMJ 5FKMA 1APLC 1JTYA 2JA7J 4M3EA 2XPVA 3AQSA 3CWRA 2D5VA 4B1RA 3M4OJ 9ANTA 2Y9ZA 1UI6A 3BRUA 3S1MJ 2L0KA 5EG0B 5HBUA 1ETWA 3OIOA 5J3LA 3G1OA 4MK6A 5EDNA 2HKUA 4BBRJ 2NVTJ 2VUMJ 3JRHA 1HOMA 3D1NI 2RHAA 3MKLA 3AQTA 2EH3A 3IH3A 3BTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO J;  3LSR A;  2DA5 A;  5D19 A;  1I50 J;  5J1R A;  3ZQI A;  1S7E A;  2X48 A;  2DMP A;  3A01 B;  3VOK A;  3Q0V A;  1OCP A;  4M6V A;  3DEW A;  4RDU A;  1K83 J;  5E3L A;  2R93 J;  1A6I A;  3TW7 A;  3HEF A;  3BR2 A;  3V78 A;  3CDL A;  2Q24 A;  3JRE A;  1ZKG A;  5HOD A;  3S1Q J;  5FKK A;  2LTP A;  4MFE A;  2D6Y A;  4J19 A;  1T33 A;  2ZOZ A;  3PPB A;  2ZB9 A;  3OOU A;  4BBS J;  3IV5 A;  5DAJ A;  3WHB A;  1IRZ A;  3HTH A;  4NEL A;  2YU9 J;  3VOX A;  1GUU A;  1FIA A;  1AKH A;  5F1J A;  1BJZ A;  4A3K J;  1GT0 C;  2N8G A;  1AU7 A;  4KWA A;  2E1O A;  5HAW A;  5IYC J;  1TWF J;  2JA5 J;  3HE0 A;  2IU5 A;  3GTP J;  5EGO A;  1XG1 A;  2DG7 A;  5FKO A;  2R5Z B;  1JJ8 C;  1MSF C;  2JWT A;  3BG5 A;  5F04 A;  1OCT C;  4A3G J;  3S17 J;  3COL A;  4QIW N;  3MVP A;  2CUE A;  4I6Z A;  4M3D A;  3NAR A;  3VVY A;  2OPT A;  2WAQ N;  4IHV A;  3A02 A;  4YZE A;  3Q0U A;  3FIS A;  4RBO A;  2XGD A;  4JYK A;  1LFB A;  3HKZ N;  4G12 A;  3SDG A;  3ANP A;  2K9Q A;  3HGG A;  2DJN A;  2G0E A;  5GPC A;  2K40 A;  2Y0S N;  4JX5 A;  1MBJ A;  3ZQG A;  4D7M A;  1H89 C;  3PM1 A;  4JX4 A;  1TC3 C;  2L7M P;  3WHC A;  1LE8 B;  1ORK A;  3RD3 A;  2JMW A;  4GCK A;  4A3J J;  3RKQ A;  4D5C A;  3JRC A;  2WV1 A;  4V2G A;  2ZCX A;  2M9H A;  2OF7 A;  1D5Y A;  3QPL A;  3BJB A;  2XSD C;  2ELK A;  4FCY A;  2NP5 A;  3VIB A;  3BTJ A;  3BCG A;  2ECB A;  1ZR4 A;  3CRJ A;  1ETV A;  4AYB N;  4XID A;  2UXP A;  3HIM A;  2M2E A;  3NI7 A;  5D1R A;  4A3M J;  5K7F A;  1HF0 A;  1GDT A;  3BTL A;  1H8A C;  3HDD A;  1ETQ A;  3BR6 A;  4JX6 A;  2HDD A;  3GTJ J;  1GV5 A;  4DYQ A;  3LJL A;  4D7N A;  2X6O A;  3SFI A;  3JSJ A;  3BT9 A;  3PO3 J;  4C3H J;  2LLK A;  2NS7 A;  3LWJ A;  5IYD J;  4A3C J;  2E19 A;  2YUS A;  3L1P A;  3I4N J;  3VP5 A;  3CCY A;  1Z77 A;  3VW1 A;  2W53 A;  1IUF A;  2X9D A;  1B72 B;  1FIP A;  2E2I J;  4BKX A;  3S1R J;  2R7Z J;  2GFN A;  2LR8 A;  3I4M J;  1EF4 A;  4C2M J;  5GP9 A;  1ZGW A;  4XIC A;  1ITY A;  3DPJ A;  2L9R A;  1MSE C;  1BA5 A;  3C2B A;  2DMT A;  2ID6 A;  3CMY A;  3NNR A;  2XGE A;  3LSP A;  1AKH B;  1QPI A;  3RH2 A;  3PO2 J;  2ME0 A;  1H88 C;  3F1B A;  1RES A;  5FLV A;  2VKV A;  3NRG A;  5EGO B;  2MSY A;  4XRS A;  1OJL A;  2EZH A;  2AHQ A;  4FIS A;  3G56 A;  4NN1 A;  4A3B J;  3HTI A;  5K7Z A;  1MH4 A;  1U9O A;  2M34 A;  1I3Q J;  4M3B A;  1JKR C;  3G7R A;  3GTQ J;  4JNN A;  5FMP A;  1HLV A;  2IEK A;  1RPW A;  5M3F J;  4M3F A;  2YVH A;  5EFY A;  3JRB A;  3BR0 A;  2JA6 J;  2UXO A;  2NVX J;  3JRA A;  3KNW A;  3HTA A;  1IDZ A;  2Y31 A;  1YRN A;  4A3L J;  5FGL A;  5DS9 A;  5IYB J;  1JJ6 C;  1JUP A;  1Y1V J;  5M5X J;  3JRG A;  3S2D J;  2QIB A;  2LVS A;  3FKI J;  1FJL A;  3BR3 A;  4ABZ A;  1JUM A;  3S1N J;  1Q1V A;  2QTQ A;  2ZCM A;  3G1M A;  3LHQ A;  1JTX A;  4NDL A;  5FKL A;  1NTC A;  2UXU A;  3M3Y J;  4I76 A;  5CXI A;  5IOY A;  3HM5 A;  2GM4 A;  3GZI A;  2LK2 A;  2HYT A;  5FKN A;  2DA2 A;  1JKP C;  5C3E J;  1G2H A;  5H9T A;  1X58 A;  5M3M J;  5M5Y J;  5EF6 A;  4B3A A;  3B81 A;  2QWT A;  2ME6 A;  1UI5 A;  1RET A;  2LY9 A;  3LSJ A;  4A3F J;  2NX4 A;  2DA7 A;  1BW6 A;  2YVE A;  3DCF A;  4PXI A;  1WPK A;  2FD5 A;  3B6A A;  1SGM A;  3C07 A;  5J1Y A;  1LFU P;  2O8K A;  2E2J J;  1IV6 A;  4FE4 A;  2ECC A;  1FEX A;  3VPR A;  3NXC A;  2HXO A;  3HBL A;  3LSG A;  3JRF A;  2DMQ A;  1HDD C;  4BXX J;  1TWG J;  3VVZ A;  5E3M A;  3E7Q A;  5IPA A;  2COB A;  1QVT A;  3HOV J;  2EZI A;  2EZK A;  2UXI A;  3K2A A;  1XC5 A;  3LOC A;  4A69 C;  1I6H J;  2NVY J;  3ON2 A;  3G1L A;  2JK3 A;  2LKX A;  1RKW A;  5E3O A;  1K61 A;  3ZQF A;  2WUI A;  2FX0 A;  1IC8 A;  4JKZ A;  3GTO J;  1VF9 A;  2LFB A;  1IJW C;  1HCR A;  5FJ8 J;  3Q0W A;  5K58 A;  5EZG A;  5F27 A;  2REK A;  1CQT A;  2P81 A;  2XGC A;  3GBG A;  4B4C A;  2JN6 A;  2Y2Z A;  3SJM A;  1WH7 A;  2CU7 A;  3JRI A;  2KDZ A;  1ETY A;  1YRN B;  2UXH A;  2KT0 A;  1U9N A;  3HOY J;  3NAU A;  2XPW A;  3BQY A;  2OI8 A;  3BR5 A;  4V2F A;  3P9T A;  3QPS A;  3MN2 A;  2MGQ A;  1GVD A;  3CQZ J;  3QQA A;  2TRT A;  2YS9 A;  4DZP A;  4CYC A;  5F0F A;  5F08 A;  1WI3 A;  1U78 A;  3GTG J;  5F0C A;  2FJ1 A;  2XDN A;  2VKE A;  2Y30 A;  4C3I J;  2DMN A;  1JUS A;  1F36 A;  2B63 J;  3JRD A;  5J1U A;  4C3J J;  3JR9 A;  1PUF A;  1E3O C;  1HDP A;  3ANG A;  3NPI A;  1MBF A;  4GFK A;  2CQX A;  4W1U A;  3ON4 A;  4A3D J;  4FE7 A;  2MG4 A;  1MNM C;  4QTR A;  3HOX J;  1ZQ3 P;  4IHX A;  2DA3 A;  2I10 A;  3MNL A;  5K7H A;  2WGB A;  1OFC X;  4MO7 A;  3ZQH A;  1B8I A;  4L62 A;  2DTZ A;  2K9N A;  2XRL A;  2M0C A;  2G7L A;  2IAI A;  2LP0 A;  5GPA A;  3HB9 A;  5E3N A;  1X2N A;  4L5E A;  2PMZ N;  4W97 A;  1VFC A;  1BL0 A;  1ZTR A;  2W48 A;  3TP3 A;  2VPR A;  4CGR A;  1POG A;  3ZQC A;  1WH5 A;  1ETX A;  1NK2 P;  2H8R A;  2QOP A;  3KKC A;  3VW2 A;  5HSZ A;  3VW0 A;  3BG3 A;  4M3G A;  1TWA J;  4IHW A;  3O8H A;  5DTD A;  1IG7 A;  2NS8 A;  3GTK J;  5EZH A;  3VUQ A;  5EEA A;  1IDY A;  2DN0 A;  4UUT A;  3H0G J;  1UHS A;  4IHY A;  1MBG A;  3FK6 A;  5AQC A;  3FIW A;  3OSF A;  2ZCN A;  5D18 A;  4AC6 A;  2EQR A;  1ZK8 A;  5BNG A;  5FHP A;  2CUF A;  3HOZ J;  2DA1 A;  2EBI A;  2M8G X;  2HOA A;  3TP0 A;  2NVQ J;  3PAS A;  4ME9 A;  3IH2 A;  2ID3 A;  4UDS A;  3GTL J;  5IP9 J;  3Q3S A;  3TED A;  2HOT A;  3BNI A;  2DA6 A;  2JA8 J;  5C4J J;  1RKT A;  3A03 A;  3VVX A;  4HNV A;  3QBM A;  5C44 J;  4ICH A;  3GEU A;  1FTZ A;  2HOS A;  3HOW J;  4CYC B;  4GCT A;  2L7F P;  3RQI A;  2G3B A;  1B72 A;  4XRM A;  1TWH J;  3EGQ A;  2JJ7 A;  5IP6 A;  1JKO C;  2IBD A;  1X2M A;  3F0C A;  1UMQ A;  4AC0 A;  4DW6 A;  2R5Y A;  1PUF B;  2QF7 A;  1NK3 P;  3S15 J;  4UUS A;  5CW8 A;  2HI3 A;  5C4Y A;  2Y9Y A;  4IEJ A;  3BG9 A;  3TW6 A;  3CJD A;  3HGY A;  2DG8 A;  2DMU A;  1UG2 A;  1FTT A;  4JL3 A;  5IOZ A;  1RR7 A;  4AF5 A;  1ETK A;  2HYJ A;  1MBE A;  1T56 A;  1Y1W J;  4MFD A;  4A3I J;  2O7O A;  1B8I B;  5FLM J;  2R92 J;  4DYR A;  2H1K A;  2PBX A;  2G7G A;  1U8B A;  3HOU J;  2FQ4 A;  2TCT A;  3QKX A;  4S0H B;  2WB1 N;  2QCO A;  4LOC A;  1JGG A;  5EG0 A;  3BR1 A;  2AO9 A;  4X1E A;  2DA4 A;  5JLX A;  2E2H J;  2F07 A;  5F0H A;  1R9T J;  2VI6 A;  1DU6 A;  3HTJ A;  3K7A J;  1W0T A;  3RZO J;  1JKQ C;  4ACI A;  4MIM A;  3B6C A;  4HKU A;  2RAE A;  3FK7 A;  1P7I A;  3O8G A;  3UKG A;  1XS9 A;  2XPU A;  2O9L A;  2GBY A;  4MXM A;  2CQQ A;  1JT0 A;  3S5R A;  2HQ5 A;  1WGX A;  3KKD A;  1MBH A;  3IH4 A;  3A01 A;  4BY7 J;  1P7J A;  1GV2 A;  2K9S A;  3S16 J;  3O60 A;  2GEN A;  1IGN A;  1VND A;  3RZD J;  5C4X J;  3E7L A;  1JT6 A;  2V57 A;  2CRG A;  5CXG A;  5M5W J;  2ZOY A;  4FTH A;  2GUH A;  4BY1 J;  3FRQ A;  3V6G A;  1A5J A;  3S14 J;  4QSH A;  2R0Q C;  1DU0 A;  2PZ9 A;  1TWC J;  4MLO A;  4XK4 A;  2G7S A;  2EZL A;  2OER A;  2GLO A;  1MBK A;  4DYC A;  2QKO A;  3IUV A;  3ZOB A;  4JP0 A;  1ENH A;  1MH3 A;  3KZ9 A;  3BQZ A;  1AHD P;  2R5Z A;  3OSG A;  4Y7N J;  2L7Z A;  1ETO A;  4DZJ A;  2O7T A;  2RAS A;  4D5F A;  4X6A J;  1BW5 A;  3GTM J;  5EYR A;  4GCL A;  1Z0X A;  4XRS G;  3H3V K;  3T6N A;  1ZR2 A;  2R5Y B;  1SAN A;  3BHQ A;  3S2H J;  5IP7 J;  1O4X A;  4A93 J;  2XB0 X;  4UUS B;  4AUX A;  3BTC A;  1W0U A;  1VI0 A;  2NOG A;  3EUP A;  2LD5 A;  2XB5 A;  1F43 A;  2CJJ A;  3ZQL A;  1QRY A;  1LE8 A;  4A3E J;  4GFL A;  2NP3 A;  4Y52 J;  4EEF G;  3LNQ A;  2FBQ A;  3W6V A;  2MW8 A;  5JLW A;  1QVU A;  4GFB A;  2HXI A;  1WCM J;  5FKM A;  1APL C;  1JTY A;  2JA7 J;  4M3E A;  2XPV A;  3AQS A;  3CWR A;  2D5V A;  4B1R A;  3M4O J;  9ANT A;  2Y9Z A;  1UI6 A;  3BRU A;  3S1M J;  2L0K A;  5EG0 B;  5HBU A;  1ETW A;  3OIO A;  5J3L A;  3G1O A;  4MK6 A;  5EDN A;  2HKU A;  4BBR J;  2NVT J;  2VUM J;  3JRH A;  1HOM A;  3D1N I;  2RHA A;  3MKL A;  3AQT A;  2EH3 A;  3IH3 A;  3BTI A; 
#chains in the Genus database with same CATH topology
 1Y0U A;  1SFO J;  3OYJ A;  3F8B A;  3ZQI A;  1T0F C;  3NS4 A;  3EUK L;  1EH7 A;  1VQ6 I;  3VOK A;  2OTJ I;  3DEW A;  4KT6 A;  2EFW A;  3H92 A;  5E3L A;  1A6I A;  4U88 A;  1W5S A;  2DDA A;  3FMS A;  1T95 A;  2Q24 A;  4IVN A;  1ZKG A;  1YFH A;  2ZME A;  4OD4 A;  2HOE A;  4UY8 I;  2LTP A;  5FFZ A;  1OCC H;  3CC2 I;  4J19 A;  1T33 A;  2OA4 A;  3WHB A;  2ZBK A;  1O3Q A;  3HTH A;  4NQW B;  1AKH A;  5F1J A;  2XIG A;  4RGU A;  3BPX A;  4ZYD A;  4KWA A;  2FEZ A;  1TWF J;  2R3S A;  1S3J A;  2KRC A;  1R5G A;  1XG1 A;  5EGO A;  1R7J A;  2QQ9 A;  2JWT A;  2M4K A;  4HA8 A;  4E7K A;  1HC8 A;  5FD6 A;  4PJJ A;  1NG7 A;  2GQQ A;  3CJN A;  4BS9 A;  4F93 B;  4WXC A;  3I58 A;  2OPT A;  2WAQ N;  4DJA A;  3WTS C;  1ZLJ A;  5HLT A;  1MJB A;  5LHI A;  1OCO H;  2DJN A;  2G0E A;  2K40 A;  2CV2 A;  3ZQG A;  4HX4 A;  2VE8 A;  4JX4 A;  4ENK A;  1DQU A;  2Z33 A;  2LG4 A;  3ASN H;  1BI0 A;  4KN4 X;  4ZTJ A;  1LQ1 A;  2HR3 A;  3FKJ A;  4KIF A;  3DPT A;  1G3T A;  3CMM A;  1FSE A;  3ABM H;  2NP5 A;  3BCG A;  1SAU A;  3EDP A;  3TDU C;  2ECB A;  3HG9 A;  2QLZ A;  1ZR4 A;  3OYI A;  1IO2 A;  3NI7 A;  1UHW A;  2K3P A;  3OS2 A;  3GX4 X;  2O03 A;  5K7F A;  5ILV A;  4GYI A;  1GDT A;  1P2F A;  3P5J A;  5F64 A;  3HDD A;  4JX6 A;  2HDD A;  2DT6 A;  4DYQ A;  2FA5 A;  3CDH A;  2KJC A;  5L3D A;  3SFI A;  3LWJ A;  2GA1 A;  5E8I A;  2NAZ A;  4LFU A;  2ZJP F;  5IYD J;  3JSO A;  4A3C J;  1FYL A;  5ILS A;  1MMG A;  1IXR C;  1VTN C;  3I64 A;  2R7Z J;  1FIP A;  3S1R J;  2ZME B;  2JUC A;  3I4M J;  1QZE A;  4ZZL A;  3ZN1 A;  2DO7 A;  2EK5 A;  1MSE C;  3WOD F;  3K4K A;  3C2B A;  2DMT A;  4J01 A;  1AKH B;  3CJT B;  1QPI A;  4U9L A;  2RKH A;  2ELJ A;  3WE2 A;  1H88 C;  3OYD A;  2VKV A;  4XSX F;  5EGO B;  2BY0 A;  1FOX A;  3MFK A;  2AHQ A;  4HV6 A;  3G56 A;  2X4H A;  3PQK A;  4I0A A;  4HZF A;  5HNH A;  3EUH C;  3HTI A;  3TL4 X;  4GYG A;  4BQO A;  4L18 B;  4JNN A;  3FHZ A;  3GTQ J;  1C0W A;  4I7H A;  1HLV A;  1X1P A;  4A5M A;  4M3F A;  2HTS A;  1MND A;  3JRB A;  2MH9 A;  3BJA A;  1V5E A;  4OMZ A;  5DUK A;  4CIC A;  2A5Y B;  4EM2 A;  4LJZ F;  1AOY A;  3KNW A;  2G7U A;  1OQY A;  1YRN A;  4A3L J;  4BXU A;  4DGW B;  1IV8 A;  2HYG D;  3ZCO A;  5M5X J;  3PNV A;  3GCM A;  4WXH A;  1YIO A;  4GXO A;  4ITV A;  2QIB A;  2LVS A;  1I27 A;  1FJL A;  2JQ7 A;  2IS1 A;  2ZCM A;  3G1M A;  3LHQ A;  2FBK A;  1KQ9 A;  3HHH A;  4I76 A;  5IOY A;  3HM5 A;  3OYL A;  5JR3 A;  2GM4 A;  1PDN C;  5FKN A;  2BY2 A;  5DD8 A;  1JHH A;  4Y15 A;  5FRM A;  2PBI A;  3FMR A;  4DOZ A;  1X58 A;  5JHU A;  3LL7 A;  4B3A A;  3C3W A;  2QWT A;  5K5O A;  2Y0S A;  1UI5 A;  2P8T A;  1XTA A;  2QVO A;  1LEA A;  3E6M A;  1KGS A;  1UJ8 A;  3S3N A;  4XKC A;  2DA7 A;  1BW6 A;  2LRD A;  4F92 B;  1QU3 A;  1SD4 A;  3L2C A;  1EH8 A;  5D8K B;  2V79 A;  2FD5 A;  3SFZ A;  3C07 A;  1LFU P;  3TO7 A;  1IV6 A;  4FE4 A;  1TW2 A;  2ECC A;  4I2O A;  1SFX A;  2EIJ H;  2LSO A;  3IKV A;  3SHF A;  1FEX A;  3VPR A;  1LVK A;  2JUG A;  2W24 A;  2HXO A;  1OPC A;  2MLK A;  4NBQ A;  2DMQ A;  4FET A;  1TWG J;  4YRV A;  1BN5 A;  3FDY A;  3HOV J;  1B59 A;  2COB A;  2DOD A;  2ZXW H;  4G6T B;  4OIQ F;  4G8X A;  1O3R A;  4XL9 A;  1XC5 A;  3G73 A;  2H6B A;  1S8N A;  4U0Y A;  3CCU I;  1ZG5 A;  3CJQ B;  3ON2 A;  2LKX A;  4HX7 A;  5EEH A;  4Z6Y A;  3FWE A;  3V7C A;  2X1E A;  3QPH A;  3PIO F;  3IRR A;  2P0W A;  2ZSH B;  3KP4 A;  2LFB A;  1MW7 A;  3DFG A;  1IJW C;  3ISP A;  2KHM A;  2RNJ A;  1HCR A;  4TV7 A;  3UNG C;  3Q0W A;  4A2U A;  1D1A A;  5EZG A;  2VIX A;  4PGG A;  3F72 A;  5F27 A;  2KLO A;  1MNE A;  2JN6 A;  1BOA A;  2CU7 A;  1YRN B;  2ISY A;  4RLF A;  2Y48 A;  1TZL A;  2ZSI B;  1MMN A;  2ESH A;  3HOY J;  1WI9 A;  2LRE A;  1FWZ A;  3ABT A;  3OYK A;  1BBY A;  1SD5 A;  2FNP A;  3BR5 A;  4YFN F;  2YX7 A;  5J8F A;  2V9P A;  3A0H C;  4BE1 A;  4HQE A;  3MMY B;  3S2W A;  1R36 A;  1GVD A;  4II2 A;  3VYR B;  4DZP A;  2YS9 A;  3J7Y J;  2PJP A;  1R00 A;  5F08 A;  4ZYA A;  2ZME C;  1IXC A;  3TMO A;  2X1C A;  2XDN A;  2VL8 A;  4OIO F;  1JUS A;  4D0P A;  2BXZ A;  5J4V A;  3WTY C;  3KZI C;  4N0B A;  4F3Q A;  1KU9 A;  4PFP A;  3VFZ A;  3BC8 A;  1HDP A;  2ZFW A;  3QPT A;  1MBF A;  2P6T A;  1XSX A;  2CQX A;  4W1U A;  2RHA A;  3ON4 A;  5BQT A;  5FLX K;  2MG4 A;  4QTR A;  3WU1 B;  1Y39 A;  4IHX A;  2I10 A;  5GAH J;  2HDW A;  4HDU A;  1ZN2 A;  3FXJ A;  3W2V A;  3GF2 A;  2CMP A;  4MO7 A;  2KKO A;  5E8G A;  4BQN A;  1YYV A;  2Y75 A;  1P9Q C;  1B8I A;  1XDS A;  2DTZ A;  2JPB A;  3K1P A;  2G7L A;  3KZZ A;  2M3A A;  1X3W B;  3GZ6 A;  5TJJ A;  4G6D A;  4IO9 F;  3DEU A;  1VFC A;  4G7Z F;  3K4L A;  2VPR A;  4CGR A;  3I71 A;  3ZQC A;  5L3G A;  2H8R A;  2QOP A;  2IA2 A;  3VW0 A;  5TIS C;  3BG3 A;  5CQG A;  2ZXJ A;  4HW0 A;  2XC7 A;  3AG4 H;  5JHF A;  2IA0 A;  1IG7 A;  2QGU A;  4FX0 A;  6PAX A;  3B02 A;  4UHT A;  2V1U A;  5HS8 A;  1WFX A;  1E17 A;  1PJR A;  4HRI A;  5CJ9 A;  2W4S A;  5D18 A;  2RC4 A;  4AC6 A;  3E5X A;  4RAF A;  3Q5F A;  2MD0 A;  1BI1 A;  1Z1D A;  4DNC A;  4YG2 F;  1ZRC A;  2EBI A;  2P6S A;  2HOA A;  3PAS A;  4M74 A;  3TED A;  2YR2 A;  4CCM A;  1USS A;  3KZY A;  1OR7 A;  5C4J J;  2O3F A;  3I56 I;  5LRS A;  3VVX A;  3CZ6 A;  4KMF A;  5C44 J;  3DLL F;  3BJO A;  2E1M B;  2X6W A;  4UVC A;  2ZCW A;  1FTZ A;  2UXX A;  3HOW J;  2XF6 A;  3KYD B;  1OCZ H;  4E70 A;  2D45 A;  4CHU A;  3RQI A;  2XAF A;  2PX9 A;  1LPQ A;  3ZPL A;  4E7Z A;  4X0G A;  1VQM I;  1B72 A;  2VQC A;  1U2W A;  3J81 K;  2FML A;  1WZ2 A;  4XKW A;  2JJ7 A;  3ECO A;  2F4M B;  5AIP A;  3L2R A;  2BHY A;  2MA3 A;  1G3S A;  3H5R A;  2QF7 A;  2HI3 A;  3CO7 C;  4LLN A;  5CPR B;  4OIP F;  2DMU A;  4JL3 A;  1LJ9 A;  3ERM A;  4P96 A;  3SZP A;  4PSX A;  2ZXI A;  1RR7 A;  1MBE A;  1Y1W J;  4MFD A;  4OAY A;  4I99 C;  4B43 A;  4A3I J;  1B8I B;  5H6Q A;  4OU0 A;  4KA4 A;  2CQ7 A;  2OCE A;  2XF7 A;  3QKX A;  2FQ4 A;  4G7O F;  2BOL A;  2QCO A;  4LOC A;  1ZG1 A;  5FLX Z;  2XF5 A;  5LGU A;  5J6X A;  2E35 A;  3CCV I;  1KU2 A;  3PSF A;  5JLX A;  3E0J B;  1ACI A;  1HSJ A;  3BG7 A;  4I98 B;  4BNC A;  4XSZ F;  2EA2 A;  3RKW A;  5D4R A;  5DM6 F;  1XB4 A;  2Y69 H;  2XUB A;  4ACI A;  2KIU A;  4MIM A;  5CVU A;  2WY8 Q;  3UKG A;  1XS9 A;  2PJR A;  3T0Y A;  4LK1 F;  2A05 A;  4XBF A;  1WGX A;  3KKD A;  3ZN0 A;  2K86 A;  3OYE A;  4S05 A;  3A01 A;  1W4M A;  3G6E I;  3CO6 C;  5KHD A;  3F23 A;  2GEN A;  1IGN A;  1STZ A;  1NHA A;  4RM2 A;  3RZD J;  3DBR B;  2BBY A;  5ICC A;  1H0M A;  2A2F X;  2STW A;  3OIP A;  2PMZ A;  4ESF A;  3DTI A;  4B09 A;  5L3C A;  3PL8 A;  2IJL A;  4XK4 A;  3KFW X;  1J0R A;  4U0W A;  4IRV A;  3BCA A;  2XVC A;  3IUV A;  2K85 A;  3ZOB A;  5FO5 A;  1ENH A;  1MH3 A;  3FXU A;  3EQL F;  3IHU A;  3OS0 A;  4Y7N J;  2VXD A;  2WC2 A;  2XAS A;  2O7T A;  4D5F A;  4X6A J;  1BW5 A;  4NUB A;  4R1H A;  1IW7 F;  4Y4R A;  1LDJ A;  4PZJ A;  1RUN A;  3T6N A;  1ZR2 A;  1SAN A;  3BHQ A;  3PIP F;  3S2H J;  1O4X A;  3R0J A;  1FOW A;  5IT3 A;  3BTC A;  1NG6 A;  1VI0 A;  3C1D A;  3ZQQ A;  3QOP A;  1OIS A;  2DBB A;  2LD5 A;  1V4R A;  3M07 A;  2LKP A;  2XB5 A;  3H9G A;  5TGT A;  4BEH A;  3ZQL A;  1KQ8 A;  3M7G A;  3PNY A;  4IRG A;  3J81 Z;  2R7R A;  4C2M A;  2MW8 A;  5DM7 F;  3KP3 A;  2HXI A;  2H6C A;  3QU3 A;  1D0Z A;  4LIV A;  4KFC A;  3S3O A;  3HYI A;  3K70 C;  3ESW B;  4A6E A;  1N78 A;  1BIA A;  1E0E A;  3PQJ A;  1B9N A;  2OQG A;  3Q9S A;  3A4C A;  1IAW A;  1UI6 A;  2L0K A;  1J7K A;  5HBU A;  3K1N A;  1I3A A;  3DQV C;  3L9F A;  2NXN B;  5DEQ A;  1WVR A;  1KQ0 A;  3HTS B;  3ZMV A;  2ZJ2 A;  2VUM J;  1R4N B;  3JRH A;  2DT5 A;  2PJR B;  2ZNZ A;  2BZT A;  3LSR A;  1VQ5 I;  5D19 A;  2CQK A;  2DI3 A;  5J1R A;  5BOX A;  1J59 A;  2Q0O A;  1S7E A;  2VOP A;  2X48 A;  3A01 B;  4RDU A;  4PFO A;  3TW7 A;  4U7D A;  3HEF A;  3M8E A;  3H36 A;  3BR2 A;  1JI8 A;  5FKK A;  4E4H A;  2FOW A;  2F2E A;  3MQ0 A;  1LKX A;  4YFK F;  2ZB9 A;  1DPR A;  2E7W A;  3IP4 B;  2WA0 A;  1IRZ A;  4NEL A;  2NNN A;  3T5X A;  1GUU A;  4AIK A;  3E6D A;  4WX9 A;  2XHK A;  3QP5 A;  1GT0 C;  2N8G A;  1AU7 A;  2JPC A;  2E1O A;  2OJE D;  3AG3 H;  5IYC J;  3CCE I;  2JA5 J;  2IU5 A;  3GTP J;  1KU7 A;  4AVZ A;  5FKO A;  1MSF C;  3BG5 A;  1RZ4 A;  4XLC A;  1O7F A;  2BGC A;  4RS8 A;  2QKL B;  3S17 J;  2YVX A;  2H27 A;  3CLO A;  3MVP A;  1K78 A;  1R71 A;  1QNT A;  2BEO A;  2NYX A;  3NWT A;  4YZE A;  3Q0U A;  4RBO A;  1UAA A;  2XRN A;  3AG1 H;  5EEG A;  4G12 A;  4RB0 A;  3ANP A;  2K9Q A;  3HGG A;  4QPO A;  1U8R A;  4JOM A;  2DYR H;  3QOD A;  2PMU A;  5GPC A;  5D8L B;  1MBJ A;  4NHJ A;  4D7M A;  4IRI A;  1H89 C;  4BHP A;  4BEH B;  3K6G A;  3L2U A;  1AWC A;  2L7M P;  1TC3 C;  1O57 A;  1LDD A;  3NQO A;  4LK0 F;  4HPQ A;  3I55 I;  5BS6 A;  2XAQ A;  4D5C A;  1D5V A;  3QWL A;  1A36 A;  2WV1 A;  4V2G A;  1OYI A;  2ZCX A;  3BJB A;  2LKS A;  3QPL A;  4WXD A;  1K6Y A;  2GIZ A;  3RPQ A;  3VIB A;  1E3H A;  4FCY A;  3BTJ A;  4NC6 A;  3CD6 I;  3J7A O;  2ADU A;  1GXP A;  3I0T A;  2MFZ A;  3IWF A;  5GTI C;  1ETV A;  3WTX C;  2VQH A;  2UXP A;  1OR7 C;  1E3P A;  2XSJ C;  3BTL A;  3PNT A;  3RDI A;  3OYC A;  1H8A C;  3EYI A;  4M72 A;  2BW3 A;  4DQ2 A;  3OV8 A;  2V1N A;  4Z2Y A;  2X6O A;  3QAH A;  2K4J A;  3JSJ A;  3BT9 A;  1YQA A;  3PO3 J;  3MCZ A;  1FZP B;  3HIF A;  3P9C A;  5CVV A;  4RB3 C;  4BAY A;  3OYF A;  3PFY A;  3VP5 A;  1W5T A;  3CCY A;  4CUG A;  1Z77 A;  2CH0 A;  2W53 A;  2E2I J;  1X1D A;  2EA4 A;  5A2Q K;  3V8J A;  2LR8 A;  5B1B H;  3ONQ A;  2IS4 A;  2L9R A;  4LG3 A;  4FT8 A;  3G2B A;  4I01 A;  2W1O A;  5K5Q A;  1G6N A;  2V9V A;  1QZY A;  3FXQ A;  3RH2 A;  4PK4 A;  5FGM A;  3F1B A;  1XPX A;  5FLV A;  4LGW A;  5H2F C;  4MQV A;  4BHC A;  1OJL A;  1YW7 A;  3QOE A;  4FIS A;  2A69 F;  3AG2 H;  1T8I A;  4A3B J;  5HLG A;  4M73 A;  5K7Z A;  2HFH A;  3G7R A;  1JKR C;  2CV1 A;  4AVP A;  1K78 B;  4ANJ A;  5FMP A;  2WAF A;  1RPW A;  2W85 A;  3V42 A;  1CF7 A;  1P4A A;  1VQO I;  3HHG A;  1QHG A;  1S72 I;  2NVX J;  3HTA A;  2D2W A;  1AA7 A;  3LA7 A;  2Y31 A;  3RYP A;  1X4O A;  1WJC A;  5D5U B;  5B3S H;  2XRO A;  2DTR A;  3TDZ C;  1JUP A;  2DDB A;  1ON2 A;  1Y1V J;  3JRG A;  1N25 A;  3E6C C;  4L0Y B;  1QO0 D;  1ZHF A;  5ICF A;  3ZGK A;  3FKI J;  4BUP A;  3QYF A;  3E5U A;  4MTE A;  3C2G A;  2DAO A;  2XAG A;  4NDL A;  5H6R A;  3OYH A;  2UXU A;  3LMM A;  4P9U A;  3RQ4 A;  3J7A Y;  2HU9 A;  2MC3 A;  3DXJ F;  2DA2 A;  1FP2 A;  2C6Y A;  5C3E J;  3DBL B;  1Y0N A;  2WAQ A;  4RB2 C;  1IN6 A;  4BE2 A;  2BW3 B;  2BXY A;  1TLH B;  4ESB A;  5M5Y J;  3OYA A;  1FNN A;  3B81 A;  3T1B A;  1ZH5 A;  1RET A;  3LSJ A;  3TGN A;  4RGX A;  2HNH A;  1D1B A;  4PXI A;  1WPK A;  2DU9 A;  1SGM A;  2E71 A;  3B6A A;  5J4Y A;  2ZFU A;  3L2Q A;  2HQR A;  2M4G A;  3BRO A;  1O3S A;  4HF2 A;  3GME A;  3DF8 A;  4IF4 A;  1BC7 C;  1HDD C;  4AIH A;  1Z91 A;  3E7Q A;  4AID A;  2GWR A;  5LFA A;  4B47 A;  4XMY A;  1XGM A;  1K4S A;  5A2Q Z;  2E1N A;  2QZ8 A;  1MJA A;  3P7N A;  3W6K B;  3OR1 C;  3LAJ A;  1UCR A;  3BZK A;  2AXL A;  2HYF A;  4I02 A;  3GTO J;  1VF9 A;  1Q1H A;  3RIR A;  1WQ2 A;  3WTU C;  5FJ8 J;  2QWW A;  2UZK A;  3MD2 A;  3R61 A;  1CF7 B;  1CQT A;  2P81 A;  3GBG A;  2WY7 Q;  3R0A A;  1UEL B;  1NH3 A;  2E34 A;  2CW0 F;  1ZRE A;  4YEJ A;  3L00 A;  4AIJ A;  2EFP A;  4HLX A;  5L3B A;  1W1W E;  3ZP5 A;  3P9T A;  3VSL A;  5GTH C;  1TL8 A;  3QQA A;  3W2A A;  4CYC A;  5F0F A;  4M9X A;  3VOD A;  2FJ1 A;  3RJP A;  5DD4 A;  2VKE A;  1E2X A;  1WJ5 A;  4L0Z B;  3K4N A;  1X1B A;  1F36 A;  1S7A A;  1UG0 A;  2QM3 A;  4C3J J;  5F1R A;  1PUF A;  1VQ9 I;  1X3U A;  4E7S A;  3NPI A;  2HEO A;  2X85 A;  4PCQ A;  2K9M A;  1YS6 A;  1UB9 A;  1ON1 A;  2L4M A;  2Q2E A;  1F5T A;  4FE7 A;  1MNM C;  4A3D J;  1D0Y A;  1Z7L A;  2L54 A;  1ZQ3 P;  1FX7 A;  2DA3 A;  2JRM A;  3LSH A;  1R1U A;  1Y8R B;  2HZD A;  3V7S A;  5D4S A;  1A31 A;  4L62 A;  2DFE A;  5HOO A;  2K9N A;  2XRL A;  2IAI A;  3CUQ A;  2TDX A;  1DUX C;  2LP0 A;  2GAU A;  4E6K G;  3WU0 A;  3ZMD A;  5E3N A;  2EV6 A;  1X2N A;  2JRT A;  4W97 A;  3IKT A;  1FC3 A;  2W48 A;  3TP3 A;  2QBY A;  1ZAR A;  2ZO4 A;  3WTV C;  4UXN A;  3VW2 A;  2YPR A;  1WJF A;  3LSM A;  3CCJ I;  5DCM A;  4IHW A;  4KMU X;  2NS8 A;  2M45 A;  1MDM A;  2LDU A;  5EEA A;  2I8D A;  1REP C;  1IDY A;  2L3D A;  4UUT A;  1S7O A;  3H0G J;  3GYH X;  4CGZ A;  3OSF A;  4R79 A;  4U7B A;  3DP7 A;  3L2W A;  1ZK8 A;  2KRF A;  1BR4 A;  1FMV A;  1X1A A;  2VN2 A;  4HX8 A;  5BNG A;  4WK8 F;  1IZ1 A;  1G3W A;  5FHP A;  2DA1 A;  3BY6 A;  4K2E A;  2VE9 A;  3RPU D;  1VQP I;  2ID3 A;  3GTL J;  1QZZ A;  2DA6 A;  3H35 A;  4ZYE A;  3K1M A;  2QKM B;  3A03 A;  3B73 A;  1WJE A;  3KIO A;  1VQ7 I;  3QBM A;  2V7F A;  4NC7 A;  3VTI A;  2I5U A;  4U87 A;  3HKZ A;  4ZTF A;  4ICH A;  4EJW A;  5DDG A;  1LB2 A;  2VJ4 A;  3FXK A;  2LY1 A;  2GA2 A;  2DFF A;  4C2T A;  2VBW A;  2IS2 A;  5HS9 A;  4CYC B;  2A3S A;  1V3F A;  2M87 A;  2G3B A;  4N4N B;  4MEY F;  4OIN F;  4CCN A;  2HDC A;  4XQF A;  2CV0 A;  1TWH J;  1ZAO A;  3IUO A;  3F0C A;  1UMQ A;  3ASO H;  2PEX A;  1MD0 A;  2R5Y A;  1PUF B;  2R7S A;  4UUS A;  5CW8 A;  5C4Y A;  4IEJ A;  3BG9 A;  3MKW B;  4I09 A;  2KP6 A;  3GLX A;  2DG8 A;  2Q2E B;  4XM3 A;  1FTT A;  1JGS A;  1O3T A;  3HSE A;  1ETK A;  2HYJ A;  2ZJQ F;  4YIF A;  3P9I A;  3ZMT A;  1BM9 A;  2E7X A;  5CLS A;  3CUQ B;  3A1Y A;  1BOB A;  3M8F A;  3HOU J;  2CW8 A;  2TCT A;  3LSK A;  2WB1 N;  1ODD A;  2ISZ A;  2VQG A;  2NRA C;  5EG0 A;  4X1E A;  2FUG 2;  4KT5 C;  4EM1 A;  1DU6 A;  3HTJ A;  3DU5 A;  3OYN A;  1W0T A;  3RZO J;  5DCM B;  2BHZ A;  4D1Q A;  4CCJ A;  4UV8 A;  5E17 F;  4EM0 B;  1RC9 A;  2Q1Z B;  1MDM B;  2OZ6 A;  2VT2 A;  1B9M A;  3KP6 A;  2HQ5 A;  2VKD A;  4L9V A;  4MTD A;  2EFO A;  4BY7 J;  2STT A;  1P7J A;  3KLN A;  1P92 A;  2K9S A;  1HKS A;  1K79 A;  3EUA A;  1YW9 A;  2W25 A;  1BR1 A;  1TQM A;  1VND A;  5C4X J;  1IN5 A;  2V57 A;  5CXG A;  1Z21 A;  1YHQ I;  3OIQ A;  4BGD A;  5M5W J;  2ZOY A;  4FTH A;  3V6G A;  3RCO A;  2R7Q A;  1A5J A;  3S14 J;  4LMY A;  4QSH A;  2IPQ X;  4MLO A;  3OYG A;  4EGY A;  2DXI A;  2G7S A;  3L7W A;  2VJI A;  3F3X A;  3KYC B;  2JA6 J;  1W5C C;  3J80 Z;  2HPM A;  3L09 A;  2R5Z A;  3OSG A;  3H3U A;  1B6A A;  4EAT A;  2R7X A;  1GXQ A;  1IN7 A;  1BC8 C;  2ACJ A;  3GLL A;  1EKE A;  2VBZ A;  3GTM J;  4ZDO A;  5EYR A;  3V7R A;  1WSU A;  1U0J A;  2B1E A;  2R5Y B;  5IP7 J;  2F5V A;  2XB0 X;  4UUS B;  1HA8 A;  3LFK A;  4EJU A;  2R7W A;  2WWY A;  1W0U A;  5CKT A;  2NOG A;  5FRN A;  2HVS A;  4IRH A;  4HLY A;  2NNY A;  2YU3 A;  4KN7 X;  1F43 A;  2HS5 A;  4KIC A;  3KP7 A;  5B5E C;  3G71 I;  3CC4 I;  5D5X B;  1LE8 A;  1XMK A;  3HPG A;  3D5S C;  4BQQ A;  2L2O A;  2NP3 A;  3BJ6 A;  1FBQ A;  5JLW A;  1QVU A;  2XAJ A;  2HGC A;  1DP7 P;  1W7P D;  3DLA A;  3W2W A;  5BPI A;  3A0B C;  4RAG A;  3CCM I;  3CJR B;  3VSK A;  3K4C A;  2R7O A;  3M4O J;  4XOR A;  4BXF A;  2Y9Z A;  4V19 K;  4I0B A;  4XRF A;  3ROU A;  4EMS A;  5EG0 B;  3WTT C;  2F4O B;  5DCF A;  1ETW A;  5J3L A;  3CP8 A;  5EDN A;  2IRF G;  1D1C A;  2HKU A;  3I54 A;  4BBR J;  1I5Z A;  3ZMS A;  1HOM A;  3K4B A;  2JSP A;  1RR8 C;  5ICE A;  3LSI A;  1FYK A;  3GVA A;  2Z1D A;  3X2Q H;  2EPF A;  4UUV A;  3IAM 2;  5J8C A;  3R60 A;  1R5H A;  4YII A;  4C9Y A;  2MAB A;  1OCP A;  3Q0V A;  2AS5 F;  2D1H A;  1ZRF A;  5ERI A;  1KON A;  2NVU B;  2VPL A;  4HYE A;  3V78 A;  3JRE A;  5HOD A;  4Q5S F;  3S1Q J;  2HWV A;  3LST A;  3LQQ A;  3OOU A;  4BBS J;  5DAJ A;  3IV5 A;  3VOX A;  4EJO A;  1TBX A;  4RAY A;  1BJZ A;  5K5R A;  2KIQ A;  4KIB A;  3VB2 A;  4A3K J;  3GUD A;  2X0L A;  2Z99 A;  1HQC A;  3K0L A;  5E1X A;  2HVR A;  3K69 A;  1HW2 A;  2RDP A;  1FT9 A;  4AM3 A;  1V54 H;  3VOE A;  4II3 A;  3CUQ C;  2R5Z B;  4EGZ A;  1JJ8 C;  3ELK A;  4JBA A;  2NS0 A;  4A3G J;  3COL A;  3BCB A;  3ULQ B;  1KU3 A;  3NAR A;  3VVY A;  4IHV A;  2EV5 A;  3A02 A;  3F8N A;  3GFL A;  2VJ5 A;  3FIS A;  4R8H A;  2NOJ B;  4O3M A;  2KZV A;  1U6G A;  4Q48 A;  4ZDL A;  3SDG A;  4GRI A;  3DBH B;  4JX5 A;  5KVR A;  2R7V A;  1KA8 A;  3KEQ A;  1GHC A;  3PM1 A;  2KFD A;  2G7H A;  2LMD A;  3JSP A;  1LE8 B;  1ORK A;  1PYV A;  2ZXH A;  2JMW A;  5HLI A;  3RD3 A;  3RKQ A;  5CVI A;  1R4M B;  3JRC A;  2OF7 A;  1D5Y A;  2FJI 1;  2XSD C;  5HVQ C;  2M30 A;  3CF5 F;  3V8K A;  1YG2 A;  2ZNY A;  4ENJ A;  3CRJ A;  1IRF A;  1T98 A;  1EH6 A;  4AYB N;  4XID A;  4A3M J;  1SAX A;  3LWF A;  1HF0 A;  2JZY A;  5LEK A;  3CMA I;  1ETQ A;  2RGV A;  2Z5U A;  3WG7 H;  3GTJ J;  3LJL A;  4D7N A;  3HRT A;  2B7E A;  4CCK A;  3MZ8 A;  4L9J A;  2E60 A;  2LLK A;  2NS7 A;  4GGG A;  5LLQ A;  4UV9 A;  5EJC A;  4HF1 A;  2E19 A;  2YUS A;  3HSR A;  1TT5 B;  2UXN A;  2VC0 A;  2XKO A;  2XAU A;  3DKW A;  2QEX I;  3I4N J;  1T0F A;  3K4M A;  4LB5 A;  1B72 B;  4ZYH A;  3N97 A;  2X6Y A;  1WJD A;  3DPJ A;  1ZGW A;  4XIC A;  1PP7 U;  2OV7 A;  4Y17 A;  1SVL A;  3DEE A;  1S9H A;  3CMY A;  1XN7 A;  4IHS A;  2XGE A;  3LSP A;  3DPL C;  3NNR A;  3KEO A;  2Z3Y A;  2ESN A;  3BDD A;  4E7J A;  3HJE A;  2GXB A;  2CWE A;  2RN7 A;  3NRG A;  2RQQ A;  2WTE A;  2MSY A;  5LGN A;  3OY9 A;  3TOB A;  3SYT A;  1MMA A;  2EZH A;  1RIO H;  4OD5 A;  2DOF A;  2QSH X;  1MH4 A;  2GXG A;  1WJB A;  2M34 A;  2V1X A;  4YEL A;  5E1Z B;  2JTV A;  4HV5 A;  3ECH A;  4BH9 A;  2IEK A;  5M3F J;  2Q8K A;  2YVH A;  1EV7 A;  1T08 B;  2LF7 A;  2PMH A;  3BR0 A;  1LDK B;  4P1W A;  4ZH4 F;  1YS7 A;  3NRV A;  2EWN A;  2EFQ A;  3JRA A;  2F5D A;  1RUO A;  1A6Q A;  1OYY A;  3C2H A;  5H20 A;  3LA2 A;  2XAH A;  5FGL A;  2CG4 A;  5IYB J;  5DS9 A;  1JJ6 C;  2R7T A;  2E1M C;  2CSO A;  1Z67 A;  4XON A;  5FFX A;  2YX4 A;  4KIT B;  3BR3 A;  4CSW A;  2K5C A;  2V6C A;  4UB6 C;  5CYV A;  2GOM A;  3HTU A;  1Q1V A;  2DK8 A;  1ZRD A;  2QTQ A;  1JTX A;  2BE5 F;  5FKL A;  1ZEL A;  3M3Y J;  1X1C A;  3GFM A;  2QEN A;  1R23 A;  2A6T A;  2V6E A;  2HYT A;  1EA3 A;  5BPD A;  1G2H A;  5H9T A;  1IUY A;  2F5E A;  5LRR A;  5HNF A;  3N05 A;  5M3M J;  1T39 A;  2DPU A;  5DYM A;  1QGP A;  1V5F A;  2DOA A;  2ME6 A;  4B44 A;  3ZMZ A;  2LY9 A;  4KJZ A;  2RNG A;  4WIB A;  2NX4 A;  2YVE A;  3DCF A;  2LBF A;  3SXY A;  2FNA A;  4EV0 A;  2M1B A;  3S93 A;  1YE9 A;  2RRE A;  3TO6 A;  3FBN B;  2K02 A;  2EJR A;  1J5Y A;  2DT7 B;  3IC7 A;  1SFE A;  4HG2 A;  4O5V A;  3NXC A;  2XDV A;  4XN3 A;  3HBL A;  4HEA 2;  3PJR A;  1FBU A;  2KMU A;  3HRS A;  3LSG A;  3JRF A;  3CCL I;  2L7K A;  4E7I A;  4BXX J;  3VVZ A;  1FOY A;  4FQG A;  2EZI A;  2EZK A;  3CME I;  2A6E F;  3K2A A;  3QP6 A;  3LOC A;  1I6H J;  1F9N A;  4M9S A;  4XKB A;  4DBQ A;  3F21 A;  3G1L A;  1K6O A;  3E5Q A;  4A0X A;  1RKW A;  5E3O A;  4O6J A;  3SZT A;  2PN6 A;  2WUI A;  3CF2 A;  4XR6 A;  2FX0 A;  2IGK A;  1IC8 A;  1IRG A;  2L02 A;  4JKZ A;  5E1W A;  1FPQ A;  4BJ6 C;  3RPU A;  1SEU A;  3V8L A;  2MC4 A;  1KYW A;  1X4P A;  5K58 A;  3VEP A;  2UUZ A;  1XMA A;  1PP8 F;  1HST A;  4B4C A;  5JI6 A;  2Y2Z A;  4Y3O A;  2MLG A;  3SJM A;  1WH7 A;  2KDZ A;  1ETY A;  2UXH A;  3H5N A;  4P5O A;  2PFB A;  4P55 A;  1SVM A;  2BVM A;  5J47 A;  1U9N A;  5LHH A;  2L9V A;  2F5F A;  3NAU A;  2A07 F;  2XPW A;  4RM3 A;  3BQY A;  4HAM A;  4ZC3 A;  1LEB A;  2OI8 A;  2CQN A;  3WGI A;  2QQ8 A;  1MGT A;  1JHF A;  2MGQ A;  2ZC2 A;  3CLQ A;  2QQA A;  2TRT A;  3N4M A;  2LY2 A;  2M7B A;  1WI3 A;  3GTG J;  2Y30 A;  4C3I J;  4PJ0 C;  3HOT A;  4UVB A;  3JRD A;  5J1U A;  2VLA A;  3G3Z A;  4A0Y A;  2CYY A;  1E3O C;  1OMI A;  4CDG A;  1SMT A;  1W36 D;  1IXS B;  3ZR8 X;  1YO5 C;  3PUF A;  2PI0 A;  1FSH A;  3HOX J;  2G9W A;  3GEZ A;  5K7H A;  1RI7 A;  1X19 A;  4XNF A;  4CZC A;  4PGH A;  3IL2 A;  2JA2 A;  4WWC A;  4BAC A;  2LBF B;  1Z3Y A;  3J7Z I;  4OIR F;  2M0C A;  1MJ9 A;  2K4B A;  3U9G A;  1VQN I;  4ZJZ A;  3DPU A;  1DGR M;  2O6G E;  1OYW A;  1GLN A;  4L5E A;  2VAS A;  1BL0 A;  3FXL A;  3HXL A;  5E20 A;  2Z2S B;  5K1Y A;  3KX2 A;  4IJA A;  1POG A;  1Z6T A;  3W3C A;  2KL4 A;  1XX5 A;  1N77 A;  1NK2 P;  3KKC A;  5HSZ A;  4MQ9 F;  2FOK A;  1TWA J;  1OKR A;  2R7D A;  1H9G A;  3O8H A;  5DTD A;  1CGP A;  3WTZ A;  2ZKZ A;  3GTK J;  3VUQ A;  1K7A A;  4ETS A;  1HKQ A;  2BVL A;  3FM5 A;  1UHS A;  3M1C A;  3P9K A;  1J75 A;  2ZCN A;  3W6J B;  2EQR A;  3VYU B;  2P7C B;  4HQM A;  3IRQ A;  3HOZ J;  4FAS D;  1M1E B;  2M8G X;  3TP0 A;  2NVQ J;  4HF0 A;  3JAM Z;  1YJ9 I;  4UDS A;  3IH2 A;  5IP9 J;  4HST A;  3LQR A;  4BE0 A;  2HOT A;  3CCS I;  2JA8 J;  2H09 A;  4RLQ A;  4EVI A;  1IF1 A;  1ZGA A;  4IXA A;  4EQQ A;  1H9T A;  1X3Z B;  3TOA A;  2JSC A;  2HOS A;  4G6Q A;  2WBM A;  3CTA A;  2LNB A;  2L7F P;  1WJA A;  3UR3 C;  4LIU A;  1YI2 I;  2CUJ A;  3I3L A;  2B0L A;  3SQN A;  1FOK A;  2H8W A;  2IBD A;  3O3K A;  2VOD A;  3MZY A;  4AC0 A;  4DW6 A;  5ICG A;  1IRX A;  1BI2 A;  1PVE A;  4B8X A;  2K9L A;  4IHT A;  3CJD A;  1D3Y A;  1UG2 A;  1VQL I;  5GAD J;  1W7P A;  5IOZ A;  5D5W B;  2KPM A;  2ZJR F;  4L5J A;  2FE3 A;  1I1G A;  5HDG A;  1VQK I;  1LNW A;  4AF5 A;  1T56 A;  3K4J A;  4KIS A;  2O7O A;  5FLM J;  4BDZ A;  4DYR A;  3AFH A;  2H1K A;  2G7G A;  1G59 A;  1DPU A;  4E7H A;  3EPZ A;  2AQE A;  2DOE A;  3U2R A;  4IZZ A;  1T6S A;  1P6R A;  1U8B A;  2VT3 A;  1YLF A;  2DQL A;  4IQ4 A;  3HRM A;  2FQ3 A;  1XMX A;  3FXM A;  3BR1 A;  2DA4 A;  4CCL A;  1YW8 A;  1F1Z A;  3IAS 2;  1SD7 A;  2B9S A;  5F0H A;  5DUI A;  1R9T J;  3FZV A;  2VI6 A;  4A6D A;  2HZT A;  2FBH A;  4HKU A;  4RGS A;  4MXM A;  2DPD A;  2CQQ A;  3U21 A;  4CXF A;  3S5R A;  1EJ9 A;  3REO A;  3K2Z A;  1TQP A;  4ZDP A;  2ELH A;  3IH4 A;  1I1S A;  1A35 A;  1XSD A;  2CGP A;  3S16 J;  3O60 A;  1HW1 A;  2EFN A;  4PJM A;  1R1T A;  3GW2 A;  5GAG J;  5BMZ A;  3E7L A;  1JT6 A;  1BR2 A;  2IVM A;  2K27 A;  2W7N A;  2GUH A;  3FRQ A;  3DKY A;  3CDI A;  2H94 A;  4PDK A;  1TTY A;  2EIN H;  2R0Q C;  1DU0 A;  1R6R A;  1TWC J;  1G8X A;  1MBK A;  2KJB A;  2O0Y A;  3AL0 B;  3KEY A;  2A5W A;  1R49 A;  3GXO A;  3M8J A;  5KCM A;  2KIS A;  3G4S I;  1ETO A;  4NNJ A;  3ZXS A;  3S32 A;  1Y8Q B;  4GCL A;  2P5V A;  3H3V K;  2EB7 A;  4UNO A;  5LGT A;  3H1C A;  2O61 A;  1FP1 D;  4AUX A;  5LBQ A;  4UVA A;  1BI3 A;  1ZYR F;  1W7P B;  2KRH A;  3LAP A;  2LC2 A;  5GAE J;  2LYC A;  3MKZ A;  1QA6 A;  2HQA A;  4Y52 J;  2A68 F;  3HSF A;  3W6V A;  1HW5 A;  1Z7U A;  4GFB A;  2UWM A;  2R7U A;  4XLF A;  2P4W A;  1APL C;  4YFX F;  5KNL A;  2QA4 I;  2D5V A;  4QPQ A;  4GDF A;  1UZC A;  2F48 A;  3BRU A;  3S1M J;  4DBR A;  3FX3 A;  3J80 K;  4KYW A;  3KCC A;  3OIO A;  4MK6 A;  3G1O A;  4XLE A;  2R4G A;  2GOX B;  2X6X A;  4GCV A;  1J9I A;  2RQP A;  3D1N I;  1WKM A;  2V26 A;  3MKL A;  5HDN A;  3HRU A;  2V9K A;  3RSN A;  4B48 A;  3IH3 A;  3BTI A;  2W00 A;  3L1P A;  2IP2 A;  4N9H A;  2JT1 A;  2DA5 A;  1I50 J;  3E97 A;  1UHM A;  2DMP A;  3IWZ A;  1HXD A;  4QWQ A;  3AAF A;  4M6V A;  2R93 J;  1K83 J;  1ZG3 A;  2Z16 A;  1V5G A;  2P7V B;  2HKX A;  4CZZ A;  3CDL A;  4BU2 A;  3F8C A;  2IS6 A;  2OC6 A;  2DYS H;  1R1V A;  4MFE A;  2D6Y A;  4E7L A;  3E6B A;  3WU2 C;  2ZOZ A;  5CVJ A;  2IGN A;  1DGW Y;  3DU6 A;  3PPB A;  3OYB A;  2WB1 A;  2YU9 J;  1FIA A;  2B3W A;  4OOI A;  3MAJ A;  2IXS A;  5HAW A;  1YOV B;  2OTL I;  4G9Y A;  4XLH A;  5TRD A;  3HE0 A;  2DG7 A;  3QYB A;  1J09 A;  3ABK H;  4HOB A;  2OD5 A;  5F04 A;  1KYZ A;  1OCT C;  1A04 A;  1B4A A;  4QIW N;  3E1S A;  2ETH A;  2CUE A;  2MBF A;  4I6Z A;  4M3D A;  2IA1 A;  3WG9 A;  3KYL A;  2KZG A;  3R4K A;  2W84 A;  4CYD A;  3GZN B;  2XGD A;  4JYK A;  3VYS B;  1LFB A;  3HL2 A;  1DDN A;  2AXT C;  3HKZ N;  1TNT A;  2QBY B;  4IOA F;  1YJN I;  2Y0S N;  2BY3 A;  3F8M A;  2W82 A;  4U9N A;  3M9A A;  3WE3 A;  4XN0 A;  2FU4 A;  3WHC A;  1YIT I;  1D8J A;  3WTW C;  2E5Z A;  4GCK A;  1T2K A;  4A3J J;  2O5R A;  1D8K A;  5LHG A;  5KAF C;  4XLA A;  5ED4 A;  3ABL H;  2M9H A;  2CFO A;  5ILU A;  1MKM A;  4HSR A;  2ELK A;  4HDV A;  3GO5 A;  4XLP F;  2IGO A;  3F6O A;  3L2V A;  3CCR I;  1R22 A;  4BJT A;  3RI4 A;  3MEX A;  4KUM A;  4D9J A;  3HIM A;  2M2E A;  5D1R A;  1U5T A;  4MNU A;  3QRF F;  2BYV E;  1FBS A;  5CQE A;  3BR6 A;  1GV5 A;  1SFK A;  3AL0 C;  1R58 A;  4C3H J;  3SEQ A;  3D5R C;  3H3Z A;  1RRJ A;  5JFR A;  2PQ8 A;  5DV5 A;  1FYM A;  3BPV A;  3VW1 A;  4CH7 A;  3MKY B;  1IUF A;  2X9D A;  3FHN A;  4BKX A;  2EV0 A;  2VC1 A;  2GFN A;  3I9V 2;  3OOP A;  3EET A;  3Q9V A;  5E18 F;  5L3F A;  3K9T A;  3KPH A;  4C2M J;  5GP9 A;  1EF4 A;  1ITY A;  4A5N A;  1BA5 A;  2EIL H;  2J5P A;  2OUM A;  5IT9 K;  2OU2 A;  2KQR A;  4XLN F;  3PO2 J;  4BHB A;  2ME0 A;  1RES A;  3S8P A;  4LB6 B;  3BZC A;  4XRS A;  2EIK H;  5F6F A;  1G3Y A;  4NN1 A;  4EJV A;  3OL4 A;  1QPM A;  2HQN A;  2VBX A;  3KET A;  2M7A A;  1U9O A;  4M3B A;  1I3Q J;  3KLO A;  2OZU A;  3KP2 A;  2F4I A;  2FF4 A;  2VXZ A;  4M71 A;  5HS7 A;  4AD9 A;  2QSF X;  5EFY A;  3U1K A;  1XCV A;  1T38 A;  4NB5 A;  2ZY9 A;  5CVR A;  3BWG A;  2QSG X;  2KDO A;  3I5U A;  2OQR A;  1IDZ A;  3R6S A;  1FY7 A;  4G94 A;  2QUF A;  2OAZ A;  3ZQ7 A;  1VQ4 I;  2RV8 A;  4PJN A;  5JVT A;  3S2D J;  3NEU A;  3DKX A;  2PLY A;  4RGR A;  4ABZ A;  1JUM A;  3FXO A;  4A12 A;  3S1N J;  1QBJ A;  5AON A;  2BV6 A;  4ENM A;  1XDU A;  3NWS A;  2IT0 A;  1NTC A;  4ZZD A;  3GFI A;  5CXI A;  3SEZ A;  1RNL A;  4RAZ A;  3BP8 A;  3GZI A;  2LK2 A;  1IN4 A;  2J5O A;  2Z9O A;  1U5T B;  1WRJ A;  1Z6R A;  2MYS A;  2X51 A;  4F55 A;  1JKP C;  3FMQ A;  4RB1 A;  2GIV A;  2E1C A;  3V4G A;  3LFU A;  1BIB A;  1OLT A;  3O2P E;  5EF6 A;  4EJT A;  2JVH A;  1SMY F;  3H0D A;  3DTE A;  5E79 C;  2GZW A;  1OCR H;  4Y13 A;  4HNU A;  4DVY P;  4A3F J;  1S6L A;  3QU6 A;  2UXO A;  1XGO A;  1L3L A;  2A61 A;  2VKH A;  2VJJ A;  4B3X A;  2XKP A;  5J1Y A;  2O8K A;  2QYO A;  3ABU A;  2E2J J;  3I59 A;  1JXS A;  5B66 C;  2FMY A;  4HBL A;  1TQI A;  1YX3 A;  2VON A;  3I53 A;  4IPA A;  3TBI A;  1SFU A;  2EIM H;  5E3M A;  2K3F A;  5IPA A;  1QVT A;  1YX5 A;  4GO1 A;  3F9K A;  4AYB A;  2UXI A;  1I6X A;  4A69 C;  1MZB A;  2NVY J;  4RMN A;  2JK3 A;  2V1D A;  4AWX B;  3ZQF A;  1K61 A;  4BYY A;  4MGR A;  2L01 A;  1UFM A;  3U1D A;  3HPH A;  3ZRG A;  2PFV A;  4PJL A;  2DFI A;  5IT9 Z;  5AIQ A;  3OMY A;  4S04 A;  2REK A;  2XGC A;  2CFX A;  2VOO A;  1MMD A;  4DIQ A;  3JRI A;  2KT0 A;  4NC8 A;  4J00 A;  2X1D A;  4LLG F;  2LH9 A;  2IGM A;  3CES A;  4V2F A;  1R5I D;  2L4A A;  3OYM A;  1TNS A;  3QPS A;  2P5L C;  1TP4 A;  3MN2 A;  3JW4 A;  3CQZ J;  1Y6I A;  4Y33 A;  4IKF A;  5HDK A;  1Z3X A;  1S5L C;  4ASN A;  1K4T A;  2VQL A;  2XV4 S;  1VZ0 A;  1U78 A;  4ESJ A;  2H1L A;  2ICW G;  5F0C A;  4KDP A;  2WAE A;  4L5I A;  2DMN A;  4WCG A;  2B63 J;  3PSI A;  3OWT A;  1TT0 A;  3JR9 A;  3ERE D;  3ANG A;  1PUE E;  2W57 A;  4GFK A;  4L9N A;  1I39 A;  3RTR A;  3RYR A;  2L9S A;  4LG0 A;  4WF2 A;  2KIM A;  4BJ5 C;  3S3M A;  3MNL A;  1ERD A;  3PFI A;  2P5K A;  2WGB A;  2YSR A;  4M6X A;  1DP3 A;  1LUJ B;  1OFC X;  3MWM A;  3ZQH A;  3BG6 A;  3D0S A;  2FRH A;  2DLL A;  5GPA A;  3HB9 A;  3I59 B;  1ONV A;  3CUO A;  1IN8 A;  2CO5 A;  4LD5 A;  2PMZ N;  1SD6 A;  4PUS A;  1ZTR A;  2OCC H;  1G4D A;  3CC7 I;  3HOS A;  2M0M A;  3H9Q A;  1WH5 A;  1ETX A;  5JVG F;  2DK5 A;  1GVJ A;  3DTK A;  1HKT A;  4M3G A;  2VB6 A;  4H4K C;  3T8R A;  1JE8 A;  4MEX F;  4C30 A;  4XOT A;  3LA3 A;  2HVQ A;  1UST A;  1ZGJ A;  5EZH A;  2F6C A;  4G7H F;  2QQB A;  1V55 H;  2DN0 A;  4IOC F;  4IHY A;  4OWR B;  1MBG A;  3FK6 A;  5AQC A;  3FIW A;  4BL0 B;  3JTG A;  1O7L A;  1U5T C;  2CUF A;  3ML6 A;  1Z05 A;  4LIT A;  4ME9 A;  4H0E A;  1N75 A;  2DCE A;  4OAZ A;  3E3V A;  3Q3S A;  5D6E A;  3BNI A;  3K70 D;  2MH2 A;  1RKT A;  4XKV A;  1YIJ I;  4HNV A;  3CP2 A;  2M8E A;  3KE2 A;  3AQT A;  1XD7 A;  5LEJ A;  1B1B A;  2VBY A;  3GEU A;  4ON0 A;  3C18 A;  2A6H F;  3DV8 A;  1SC7 A;  4JK1 X;  4GCT A;  2E36 A;  3KP5 A;  3RKY A;  4PSW A;  3VDX A;  4XRM A;  1YJW I;  3EGQ A;  1P4W A;  2WV0 A;  5IP6 A;  1JKO C;  4OMY A;  3O6B B;  1X2M A;  3EYY A;  4Q47 A;  1TW3 A;  4M9Z A;  1P4X A;  2L9N A;  2CUZ A;  3M1E A;  3WGG A;  1NK3 P;  3S15 J;  2LF8 A;  5KAI C;  1QHH D;  1XGN A;  2Y9Y A;  3FM3 A;  3JTH A;  3TW6 A;  3AKZ A;  3HGY A;  3OR2 C;  4LG0 B;  5LD2 C;  2D1V A;  2DW4 A;  3FXR A;  4QLC U;  2IW5 A;  4IQJ A;  1D0X A;  3JAM K;  2CW7 A;  2JVG A;  2E5N A;  2R92 J;  4A0Z A;  2PBX A;  3TQN A;  5D5V B;  4FHT A;  5HLH A;  4N9I A;  3EUH A;  3F22 A;  5FRO A;  1BJA A;  4S0H B;  2XGX A;  3VWB A;  4Q4Z F;  5FB2 A;  1JGG A;  4M6Y A;  1ZLK A;  1KZH A;  2E2H J;  2AO9 A;  4KNY A;  3F8F A;  1FMW A;  2F07 A;  3BLY A;  3HUG A;  4KIG A;  3A2K A;  3K7A J;  2R7F A;  1JKQ C;  3B6C A;  4F91 B;  2RAE A;  3FK7 A;  3SZG A;  1P7I A;  3O8G A;  2O9L A;  2XPU A;  2GBY A;  2O8X A;  3DWL E;  4XOP A;  2DQR A;  3K8P C;  1JT0 A;  2HPI A;  3HC7 A;  3FF5 A;  3FBI B;  2BY1 A;  3BZ6 A;  2UV1 A;  1MBH A;  5B1A H;  3COA C;  1W36 C;  1LVA A;  1GV2 A;  1LFP A;  4RA2 A;  3C7J A;  3VYT B;  2HTJ A;  2RVC A;  3PUB A;  4U0V A;  2CRG A;  3OS1 A;  1XGS A;  3CCQ I;  4L9T A;  3BOQ A;  1U3E M;  4MHG A;  4F52 A;  1YTY A;  4BY1 J;  3JCU C;  1ULY A;  4NQW A;  1WWX A;  2PZ9 A;  1WHU A;  2K7L A;  4CO8 A;  2EZL A;  4AU7 A;  4F7Z A;  2GLO A;  4DYC A;  3HZJ A;  2OER A;  2QKO A;  2M5W A;  2WAD A;  4JP0 A;  3SDB A;  4IL6 C;  3KZ9 A;  3BQZ A;  1AHD P;  4JQF A;  1MMS A;  4P9F A;  2L7Z A;  4LLL A;  4DZJ A;  1F4K A;  2PG4 A;  2GXA A;  2RAS A;  3SWH A;  2COM A;  3F6V A;  1Z0X A;  4XRS G;  3TO9 A;  3MZH A;  1MIJ A;  2F5C A;  3OL3 A;  3QYE A;  4ZYG A;  3H5A A;  4IX7 A;  1XSV A;  4A93 J;  2FBI A;  1Y56 A;  2V4J C;  1SVO A;  2FSW A;  2OBP A;  3EUP A;  2CJJ A;  5D6F A;  1FLI A;  5J40 A;  1QRY A;  3ZMU A;  2CS3 A;  3GFJ A;  5KK1 A;  5IY5 H;  4A3E J;  2LOO A;  4GFL A;  1QQI A;  2DJI A;  3K10 A;  4EEF G;  3LNQ A;  2FBQ A;  2AQF A;  2HKO A;  1HBX G;  4CA0 A;  3TKY A;  1Z9C A;  5FD5 A;  4CCO A;  4BQA A;  1WCM J;  1XCB A;  2MD5 A;  1JTY A;  1S29 A;  5FKM A;  4M3E A;  1VQ8 I;  4N4O B;  2XPV A;  3GZ5 A;  2JA7 J;  3AQS A;  5L3E A;  2Y0M A;  3CWR A;  1J2X A;  4FX4 A;  4B1R A;  3WGH A;  9ANT A;  4BDY A;  4C2U A;  1L0O C;  2L5Q A;  3I4P A;  4HNT A;  3HUG B;  3GWZ A;  3RKX A;  4ENN A;  2FXA A;  3H9J A;  3T8T A;  4UB8 C;  4YIR X;  2KIF A;  2NVT J;  2EH3 A;  2ID6 A;  2DFH A;  3D5L A; 
#chains in the Genus database with same CATH homology
 1SFO J;  3LSR A;  2DA5 A;  5D19 A;  1I50 J;  5J1R A;  3ZQI A;  1S7E A;  2X48 A;  2DMP A;  3A01 B;  3VOK A;  3Q0V A;  1OCP A;  4M6V A;  3DEW A;  4RDU A;  1K83 J;  5E3L A;  2R93 J;  1A6I A;  3TW7 A;  3HEF A;  3BR2 A;  3V78 A;  3CDL A;  2Q24 A;  3JRE A;  1ZKG A;  5HOD A;  3S1Q J;  5FKK A;  2LTP A;  4MFE A;  2D6Y A;  4J19 A;  1T33 A;  2ZOZ A;  3PPB A;  2ZB9 A;  3OOU A;  4BBS J;  3IV5 A;  5DAJ A;  3WHB A;  1IRZ A;  3HTH A;  4NEL A;  2YU9 J;  3VOX A;  1GUU A;  1FIA A;  1AKH A;  5F1J A;  1BJZ A;  4A3K J;  1GT0 C;  2N8G A;  1AU7 A;  4KWA A;  2E1O A;  5HAW A;  5IYC J;  1TWF J;  2JA5 J;  3HE0 A;  2IU5 A;  3GTP J;  5EGO A;  1XG1 A;  2DG7 A;  5FKO A;  2R5Z B;  1JJ8 C;  1MSF C;  2JWT A;  3BG5 A;  5F04 A;  1OCT C;  4A3G J;  3S17 J;  3COL A;  4QIW N;  3MVP A;  2CUE A;  4I6Z A;  4M3D A;  3NAR A;  3VVY A;  2OPT A;  2WAQ N;  4IHV A;  3A02 A;  4YZE A;  3Q0U A;  3FIS A;  4RBO A;  2XGD A;  4JYK A;  1LFB A;  3HKZ N;  4G12 A;  3SDG A;  3ANP A;  2K9Q A;  3HGG A;  2DJN A;  2G0E A;  5GPC A;  2K40 A;  2Y0S N;  4JX5 A;  1MBJ A;  3ZQG A;  4D7M A;  1H89 C;  3PM1 A;  4JX4 A;  1TC3 C;  2L7M P;  3WHC A;  1LE8 B;  1ORK A;  3RD3 A;  2JMW A;  4GCK A;  4A3J J;  3RKQ A;  4D5C A;  3JRC A;  2WV1 A;  4V2G A;  2ZCX A;  2M9H A;  2OF7 A;  1D5Y A;  3QPL A;  3BJB A;  2XSD C;  2ELK A;  4FCY A;  2NP5 A;  3VIB A;  3BTJ A;  3BCG A;  2ECB A;  1ZR4 A;  3CRJ A;  1ETV A;  4AYB N;  4XID A;  2UXP A;  3HIM A;  2M2E A;  3NI7 A;  5D1R A;  4A3M J;  5K7F A;  1HF0 A;  1GDT A;  3BTL A;  1H8A C;  3HDD A;  1ETQ A;  3BR6 A;  4JX6 A;  2HDD A;  3GTJ J;  1GV5 A;  4DYQ A;  3LJL A;  4D7N A;  2X6O A;  3SFI A;  3JSJ A;  3BT9 A;  3PO3 J;  4C3H J;  2LLK A;  2NS7 A;  3LWJ A;  5IYD J;  4A3C J;  2E19 A;  2YUS A;  3L1P A;  3I4N J;  3VP5 A;  3CCY A;  1Z77 A;  3VW1 A;  2W53 A;  1IUF A;  2X9D A;  1B72 B;  1FIP A;  2E2I J;  4BKX A;  3S1R J;  2R7Z J;  2GFN A;  2LR8 A;  3I4M J;  1EF4 A;  4C2M J;  5GP9 A;  1ZGW A;  4XIC A;  1ITY A;  3DPJ A;  2L9R A;  1MSE C;  1BA5 A;  3C2B A;  2DMT A;  2ID6 A;  3CMY A;  3NNR A;  2XGE A;  3LSP A;  1AKH B;  1QPI A;  3RH2 A;  3PO2 J;  2ME0 A;  1H88 C;  3F1B A;  1RES A;  5FLV A;  2VKV A;  3NRG A;  5EGO B;  2MSY A;  4XRS A;  1OJL A;  2EZH A;  2AHQ A;  4FIS A;  3G56 A;  4NN1 A;  4A3B J;  3HTI A;  5K7Z A;  1MH4 A;  1U9O A;  2M34 A;  1I3Q J;  4M3B A;  1JKR C;  3G7R A;  3GTQ J;  4JNN A;  5FMP A;  1HLV A;  2IEK A;  1RPW A;  5M3F J;  4M3F A;  2YVH A;  5EFY A;  3JRB A;  3BR0 A;  2JA6 J;  2UXO A;  2NVX J;  3JRA A;  3KNW A;  3HTA A;  1IDZ A;  2Y31 A;  1YRN A;  4A3L J;  5FGL A;  5DS9 A;  5IYB J;  1JJ6 C;  1JUP A;  1Y1V J;  5M5X J;  3JRG A;  3S2D J;  2QIB A;  2LVS A;  3FKI J;  1FJL A;  3BR3 A;  4ABZ A;  1JUM A;  3S1N J;  1Q1V A;  2QTQ A;  2ZCM A;  3G1M A;  3LHQ A;  1JTX A;  4NDL A;  5FKL A;  1NTC A;  2UXU A;  3M3Y J;  4I76 A;  5CXI A;  5IOY A;  3HM5 A;  2GM4 A;  3GZI A;  2LK2 A;  2HYT A;  5FKN A;  2DA2 A;  1JKP C;  5C3E J;  1G2H A;  5H9T A;  1X58 A;  5M3M J;  5M5Y J;  5EF6 A;  4B3A A;  3B81 A;  2QWT A;  2ME6 A;  1UI5 A;  1RET A;  2LY9 A;  3LSJ A;  4A3F J;  2NX4 A;  2DA7 A;  1BW6 A;  2YVE A;  3DCF A;  4PXI A;  1WPK A;  2FD5 A;  3B6A A;  1SGM A;  3C07 A;  5J1Y A;  1LFU P;  2O8K A;  2E2J J;  1IV6 A;  4FE4 A;  2ECC A;  1FEX A;  3VPR A;  3NXC A;  2HXO A;  3HBL A;  3LSG A;  3JRF A;  2DMQ A;  1HDD C;  4BXX J;  1TWG J;  3VVZ A;  5E3M A;  3E7Q A;  5IPA A;  2COB A;  1QVT A;  3HOV J;  2EZI A;  2EZK A;  2UXI A;  3K2A A;  1XC5 A;  3LOC A;  4A69 C;  1I6H J;  2NVY J;  3ON2 A;  3G1L A;  2JK3 A;  2LKX A;  1RKW A;  5E3O A;  1K61 A;  3ZQF A;  2WUI A;  2FX0 A;  1IC8 A;  4JKZ A;  3GTO J;  1VF9 A;  2LFB A;  1IJW C;  1HCR A;  5FJ8 J;  3Q0W A;  5K58 A;  5EZG A;  5F27 A;  2REK A;  1CQT A;  2P81 A;  2XGC A;  3GBG A;  4B4C A;  2JN6 A;  2Y2Z A;  3SJM A;  1WH7 A;  2CU7 A;  3JRI A;  2KDZ A;  1ETY A;  1YRN B;  2UXH A;  2KT0 A;  1U9N A;  3HOY J;  3NAU A;  2XPW A;  3BQY A;  2OI8 A;  3BR5 A;  4V2F A;  3P9T A;  3QPS A;  3MN2 A;  2MGQ A;  1GVD A;  3CQZ J;  3QQA A;  2TRT A;  2YS9 A;  4DZP A;  4CYC A;  5F0F A;  5F08 A;  1WI3 A;  1U78 A;  3GTG J;  5F0C A;  2FJ1 A;  2XDN A;  2VKE A;  2Y30 A;  4C3I J;  2DMN A;  1JUS A;  1F36 A;  2B63 J;  3JRD A;  5J1U A;  4C3J J;  3JR9 A;  1PUF A;  1E3O C;  1HDP A;  3ANG A;  3NPI A;  1MBF A;  4GFK A;  2CQX A;  4W1U A;  3ON4 A;  4A3D J;  4FE7 A;  2MG4 A;  1MNM C;  4QTR A;  3HOX J;  1ZQ3 P;  4IHX A;  2DA3 A;  2I10 A;  3MNL A;  5K7H A;  2WGB A;  1OFC X;  4MO7 A;  3ZQH A;  1B8I A;  4L62 A;  2DTZ A;  2K9N A;  2XRL A;  2M0C A;  2G7L A;  2IAI A;  2LP0 A;  5GPA A;  3HB9 A;  5E3N A;  1X2N A;  4L5E A;  2PMZ N;  4W97 A;  1VFC A;  1BL0 A;  1ZTR A;  2W48 A;  3TP3 A;  2VPR A;  4CGR A;  1POG A;  3ZQC A;  1WH5 A;  1ETX A;  1NK2 P;  2H8R A;  2QOP A;  3KKC A;  3VW2 A;  5HSZ A;  3VW0 A;  3BG3 A;  4M3G A;  1TWA J;  4IHW A;  3O8H A;  5DTD A;  1IG7 A;  2NS8 A;  3GTK J;  5EZH A;  3VUQ A;  5EEA A;  1IDY A;  2DN0 A;  4UUT A;  3H0G J;  1UHS A;  4IHY A;  1MBG A;  3FK6 A;  5AQC A;  3FIW A;  3OSF A;  2ZCN A;  5D18 A;  4AC6 A;  2EQR A;  1ZK8 A;  5BNG A;  5FHP A;  2CUF A;  3HOZ J;  2DA1 A;  2EBI A;  2M8G X;  2HOA A;  3TP0 A;  2NVQ J;  3PAS A;  4ME9 A;  3IH2 A;  2ID3 A;  4UDS A;  3GTL J;  5IP9 J;  3Q3S A;  3TED A;  2HOT A;  3BNI A;  2DA6 A;  2JA8 J;  5C4J J;  1RKT A;  3A03 A;  3VVX A;  4HNV A;  3QBM A;  5C44 J;  4ICH A;  3GEU A;  1FTZ A;  2HOS A;  3HOW J;  4CYC B;  4GCT A;  2L7F P;  3RQI A;  2G3B A;  1B72 A;  4XRM A;  1TWH J;  3EGQ A;  2JJ7 A;  5IP6 A;  1JKO C;  2IBD A;  1X2M A;  3F0C A;  1UMQ A;  4AC0 A;  4DW6 A;  2R5Y A;  1PUF B;  2QF7 A;  1NK3 P;  3S15 J;  4UUS A;  5CW8 A;  2HI3 A;  5C4Y A;  2Y9Y A;  4IEJ A;  3BG9 A;  3TW6 A;  3CJD A;  3HGY A;  2DG8 A;  2DMU A;  1UG2 A;  1FTT A;  4JL3 A;  5IOZ A;  1RR7 A;  4AF5 A;  1ETK A;  2HYJ A;  1MBE A;  1T56 A;  1Y1W J;  4MFD A;  4A3I J;  2O7O A;  1B8I B;  5FLM J;  2R92 J;  4DYR A;  2H1K A;  2PBX A;  2G7G A;  1U8B A;  3HOU J;  2FQ4 A;  2TCT A;  3QKX A;  4S0H B;  2WB1 N;  2QCO A;  4LOC A;  1JGG A;  5EG0 A;  3BR1 A;  2AO9 A;  4X1E A;  2DA4 A;  5JLX A;  2E2H J;  2F07 A;  5F0H A;  1R9T J;  2VI6 A;  1DU6 A;  3HTJ A;  3K7A J;  1W0T A;  3RZO J;  1JKQ C;  4ACI A;  4MIM A;  3B6C A;  4HKU A;  2RAE A;  3FK7 A;  1P7I A;  3O8G A;  3UKG A;  1XS9 A;  2XPU A;  2O9L A;  2GBY A;  4MXM A;  2CQQ A;  1JT0 A;  3S5R A;  2HQ5 A;  1WGX A;  3KKD A;  1MBH A;  3IH4 A;  3A01 A;  4BY7 J;  1P7J A;  1GV2 A;  2K9S A;  3S16 J;  3O60 A;  2GEN A;  1IGN A;  1VND A;  3RZD J;  5C4X J;  3E7L A;  1JT6 A;  2V57 A;  2CRG A;  5CXG A;  5M5W J;  2ZOY A;  4FTH A;  2GUH A;  4BY1 J;  3FRQ A;  3V6G A;  1A5J A;  3S14 J;  4QSH A;  2R0Q C;  1DU0 A;  2PZ9 A;  1TWC J;  4MLO A;  4XK4 A;  2G7S A;  2EZL A;  2OER A;  2GLO A;  1MBK A;  4DYC A;  2QKO A;  3IUV A;  3ZOB A;  4JP0 A;  1ENH A;  1MH3 A;  3KZ9 A;  3BQZ A;  1AHD P;  2R5Z A;  3OSG A;  4Y7N J;  2L7Z A;  1ETO A;  4DZJ A;  2O7T A;  2RAS A;  4D5F A;  4X6A J;  1BW5 A;  3GTM J;  5EYR A;  4GCL A;  1Z0X A;  4XRS G;  3H3V K;  3T6N A;  1ZR2 A;  2R5Y B;  1SAN A;  3BHQ A;  3S2H J;  5IP7 J;  1O4X A;  4A93 J;  2XB0 X;  4UUS B;  4AUX A;  3BTC A;  1W0U A;  1VI0 A;  2NOG A;  3EUP A;  2LD5 A;  2XB5 A;  1F43 A;  2CJJ A;  3ZQL A;  1QRY A;  1LE8 A;  4A3E J;  4GFL A;  2NP3 A;  4Y52 J;  4EEF G;  3LNQ A;  2FBQ A;  3W6V A;  2MW8 A;  5JLW A;  1QVU A;  4GFB A;  2HXI A;  1WCM J;  5FKM A;  1APL C;  1JTY A;  2JA7 J;  4M3E A;  2XPV A;  3AQS A;  3CWR A;  2D5V A;  4B1R A;  3M4O J;  9ANT A;  2Y9Z A;  1UI6 A;  3BRU A;  3S1M J;  2L0K A;  5EG0 B;  5HBU A;  1ETW A;  3OIO A;  5J3L A;  3G1O A;  4MK6 A;  5EDN A;  2HKU A;  4BBR J;  2NVT J;  2VUM J;  3JRH A;  1HOM A;  3D1N I;  2RHA A;  3MKL A;  3AQT A;  2EH3 A;  3IH3 A;  3BTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...