5GPCA

Structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
190
structure length
190
Chain Sequence
b'KKGPKYDQIIDAAVQVIAEHGYHQAQVSKIAKAAGVADGTIYLYFNNKEDVLISLFQEKMGRFVDKIRSQMNEATDVEEKLKILVNMHFKQLAADHKLAIVTQLELRQSNTELRLKINEVLKGYLNLLDELLMEGKEKGYFFQELDTRLARQMIFGTLDEVVTNWVMKDCKYDLTALVKPVHQLLLGGLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator (TetR/AcrR family)
publication title Structural basis of operator sites recognition and effector binding in the TetR family transcription regulator FadR.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Transcription, dna binding protein/dna
total genus 69
structure length 190
sequence length 190
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5gpcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5gpcA02
1WGXA 1D5YA 4C3JJ 3S16J 4KWAA 2FX0A 3VVXA 4DYRA 3L1PA 2YVEA 4MO7A 1JUSA 3SDGA 2LK2A 2M9HA 3KKCA 2LFBA 3KKDA 4NELA 4JNNA 2ZOYA 3VP5A 2TRTA 3HGGA 3Q0VA 1Y1WJ 1WPKA 1RETA 2LTPA 3P9TA 1GV2A 2VPRA 5C4YA 1X2NA 1MH3A 2L7ZA 4A3BJ 2DMPA 1HLVA 4ACIA 3TW7A 1P7IA 4V2GA 2WGBA 1MBGA 3E7LA 3S1NJ 1BW5A 3NRGA 1TC3C 4X1EA 2PZ9A 3HE0A 2G7SA 2LR8A 4IHWA 1GUUA 5F0HA 4IHVA 3ANPA 2WB1N 4DZJA 2QCOA 2DA6A 1QPIA 3DEWA 1FJLA 3GTOJ 4MIMA 4A3FJ 4D5CA 2QTQA 1ETKA 2FJ1A 5E3OA 2O9LA 1NK3P 3WHCA 5M3FJ 1IGNA 2WUIA 2NP5A 1OCPA 3PM1A 4FE4A 2ZCNA 1ETVA 2CQXA 2H8RA 2Y2ZA 1JGGA 3F1BA 3JRAA 1W0TA 2DTZA 2IBDA 5CW8A 1JUPA 2K9QA 4D5FA 2CJJA 3O8HA 3MN2A 3BRUA 4JX6A 4MXMA 2DA7A 1OJLA 2YUSA 1IRZA 1JTYA 3G7RA 2ID3A 4UUSA 3RKQA 3HKZN 2UXHA 4M6VA 5C3EJ 1UHSA 1XC5A 2YS9A 2E2IJ 3HTIA 2EZIA 3H3VK 2QWTA 3G56A 1FTZA 1RKWA 1SGMA 5FHPA 1IJWC 2JMWA 3BNIA 2N8GA 2XPVA 2L7MP 3K7AJ 3S15J 4JX4A 4CYCA 1U9NA 3HEFA 4HKUA 3D1NI 3S1QJ 3BCGA 3FISA 1IUFA 2DA3A 3DPJA 4M3DA 2FD5A 1NTCA 3WHBA 5M5XJ 2NVXJ 2EZKA 4BKXA 5EGOB 2DMTA 2NS7A 3SFIA 4XRSG 1FEXA 2NVYJ 5EYRA 2GBYA 2VKVA 4RDUA 4FTHA 1POGA 3B6AA 2EH3A 3GTGJ 5FGLA 3JRCA 3FIWA 5HBUA 2XB5A 1BJZA 5C4XJ 2GM4A 1JKPC 1JUMA 1XG1A 1MNMC 2O8KA 5CXGA 1AU7A 1UI6A 1MBJA 3JRFA 2O7OA 2TCTA 5EZGA 4NN1A 4AYBN 1A5JA 3CJDA 2JK3A 5DTDA 4L5EA 1JKOC 3S5RA 3O60A 4DZPA 1S7EA 4UUTA 4A69C 1TWGJ 4Y52J 1JTXA 3HIMA 4A3GJ 3QPSA 2O7TA 3FRQA 2MGQA 4M3GA 3HTHA 3S1RJ 4W97A 4RBOA 4ABZA 2UXUA 2L9RA 3S2HJ 3OSGA 2COBA 3I4MJ 2R5YB 1F43A 1UI5A 2MW8A 1WI3A 4A3KJ 2DJNA 3RZOJ 3BTIA 1QRYA 1RR7A 3BT9A 3GZIA 2M2EA 3I4NJ 2DA2A 1H8AC 4X6AJ 5D19A 3FK6A 1FIAA 3VVYA 2R7ZJ 2Y31A 3MNLA 4M3BA 2Y0SN 1IC8A 2YVHA 3BR0A 2NVTJ 5C44J 2R92J 2LKXA 1XS9A 3AQTA 3QPLA 5E3NA 2UXPA 3A02A 4UUSB 3VPRA 1MBHA 3BG5A 2M0CA 1FTTA 2G7LA 5E3MA 3IH4A 4S0HB 1TWHJ 1LE8A 2VI6A 4V2FA 3KZ9A 1U9OA 2DA5A 1W0UA 3OSFA 1GV5A 5JLWA 2RAEA 1Z0XA 2EZLA 1MH4A 3ZQLA 3QQAA 1OFCX 3RZDJ 3C07A 1HDPA 4CYCB 3JRBA 5IOYA 3LJLA 3G1MA 3A01A 4J19A 2QOPA 5M5WJ 1IG7A 1ETQA 3GTPJ 1B8IA 5GP9A 2M34A 2R5YA 3VVZA 3CRJA 4GFKA 2DMNA 4QIWN 1BW6A 2HKUA 3VUQA 1HCRA 3LWJA 3K2AA 5EDNA 3RH2A 1E3OC 3PO2J 2JA5J 2XGDA 3BHQA 2XDNA 1ETOA 2E1OA 1BA5A 1U8BA 4ICHA 1BL0A 4BY7J 1QVUA 2HI3A 2HXIA 2ID6A 4I76A 4DW6A 3JREA 3AQSA 2IEKA 1U78A 3GTQJ 5AQCA 4YZEA 1MBFA 3LSJA 4XRMA 4A93J 2B63J 2HQ5A 3EGQA 5FKNA 2XSDC 3JR9A 2Y30A 4B3AA 3FKIJ 4IHXA 2W48A 4M3FA 3LSPA 2WAQN 2IU5A 5GPCA 5H9TA 1JT6A 2KT0A 2HXOA 3W6VA 1I6HJ 4FCYA 3JRDA 2P81A 1H88C 5K7FA 1AKHA 3CQZJ 3BTCA 5K7ZA 1O4XA 1APLC 3S14J 2I10A 3LSRA 3BR2A 3GTKJ 1T33A 5FJ8J 2MG4A 2E19A 2X6OA 3RD3A 1AHDP 3ZOBA 3KNWA 1ETXA 1ZR2A 2FBQA 1F36A 1JKQC 1ZTRA 2HYJA 5FKKA 1QVTA 5M5YJ 3Q0UA 1YRNA 3BQZA 2GFNA 5IP9J 3BG3A 1ORKA 2RHAA 1B72A 4ME9A 2ME6A 2HOAA 2R93J 2VUMJ 3V78A 2V57A 3HBLA 1CQTA 3OIOA 2F07A 2CRGA 4AC6A 1K83J 2DMQA 2K40A 3TP3A 1ETWA 3ZQGA 4C2MJ 1LE8B 5FKOA 5K58A 3MVPA 4AC0A 4BXXJ 3HOYJ 2JA7J 5DAJA 1H89C 1DU6A 2K9SA 2KDZA 1G2HA 1SANA 5F08A 2Y9ZA 3BQYA 3QBMA 3G1LA 1TWFJ 4B4CA 3A01B 4IHYA 5J3LA 3E7QA 3NI7A 3HM5A 1JJ6C 3TW6A 3EUPA 5FKMA 3ON4A 2CUEA 1B8IB 3H0GJ 1UG2A 4XK4A 2D6YA 1X2MA 2JJ7A 3SJMA 4MLOA 3GTLJ 1Z77A 5FLMJ 4BBSJ 4AF5A 2D5VA 3HOVJ 3M3YJ 2X9DA 3B6CA 3FK7A 5F1JA 1RKTA 3HB9A 1DU0A 2GLOA 5HSZA 4JKZA 4XRSA 4GCKA 5JLXA 2CU7A 2GUHA 5D1RA 2W53A 2R5ZB 1MSEC 3COLA 2UXIA 1RESA 3ZQHA 4AUXA 1GVDA 1IV6A 2OPTA 3BR6A 5IYBJ 5J1RA 5EF6A 4BY1J 3GEUA 1ENHA 4JP0A 3NXCA 3S17J 2DMUA 3RQIA 3BR3A 3S2DJ 2CUFA 2LP0A 5F0CA 3O8GA 2XGCA 5HODA 5BNGA 2QIBA 2XPUA 5K7HA 4FISA 5J1UA 3JRHA 1AKHB 5IYDJ 2M8GX 5FMPA 3VW1A 3VW2A 4A3CJ 1ETYA 2LLKA 4D7NA 2DN0A 3LSGA 2ECBA 2Q24A 3BR1A 3Q3SA 2L7FP 5IPAA 2ZCMA 2JN6A 4JL3A 3HDDA 4XIDA 9ANTA 5IOZA 1YRNB 1IDYA 4D7MA 2AHQA 2HOTA 4QTRA 3TEDA 5CXIA 2HYTA 1B72B 1MSFC 2ZB9A 2AO9A 3NARA 2RASA 2X48A 2LY9A 3VIBA 3HOUJ 2ELKA 4JYKA 3BR5A 3ZQIA 1LFBA 5EG0A 2DG8A 1PUFA 2REKA 2OF7A 1GT0C 2R5ZA 4C3HJ 2ECCA 2E2HJ 4CGRA 5EFYA 2VKEA 2K9NA 3ZQCA 4DYCA 2JA8J 2ZCXA 2DA4A 1WCMJ 3JRIA 4C3IJ 2HOSA 3OOUA 3BG9A 5FKLA 1TWAJ 4A3LJ 4NDLA 3PASA 1HDDC 3T6NA 4UDSA 2OI8A 3BJBA 2ME0A 2FQ4A 2XPWA 1ZKGA 4A3JJ 2UXOA 3CWRA 1ITYA 2NOGA 4GFLA 1ZK8A 3VW0A 5DS9A 1TWCJ 2IAIA 3NAUA 3UKGA 3NPIA 2DA1A 4G12A 3IH2A 4Y7NJ 3GBGA 2NX4A 5FLVA 2PBXA 2EBIA 2XGEA 1ZGWA 3LHQA 1UMQA 4MFEA 1VI0A 3CMYA 4HNVA 1VFCA 5IP6A 1GDTA 1A6IA 1LFUP 1JKRC 4QSHA 4A3IJ 1NK2P 3M4OJ 2OERA 4MK6A 3A03A 4M3EA 3Q0WA 4A3DJ 4A3EJ 3HGYA 4MFDA 2QKOA 1ZQ3P 2R0QC 5EZHA 3HOZJ 2NS8A 2G0EA 5F27A 1T56A 3HOWJ 1R9TJ 4L62A 1FIPA 2L0KA 3ZQFA 2LVSA 1HF0A 2WV1A 5E3LA 1HOMA 2JWTA 5IYCJ 3VOXA 3TP0A 4BBRJ 1I50J 5EEAA 2LD5A 5M3MJ 1I3QJ 4A3MJ 5HAWA 3G1OA 5D18A 1MBEA 4B1RA 2HDDA 3B81A 4DYQA 3CDLA 2GENA 3HOXJ 3F0CA 2CQQA 1ZR4A 1K61A 2NP3A 1P7JA 1Q1VA 3VOKA 1VF9A 3C2BA 2H1KA 2G3BA 2ZOZA 2G7GA 1JJ8C 4GCLA 3NNRA 3IH3A 3JSJA 3PO3J 4W1UA 3GTJJ 5IP7J 3BTLA 3GTMJ 3ANGA 5EG0B 3HTJA 1MBKA 1RPWA 3ON2A 1PUFB 2EZHA 2MSYA 4FE7A 5F0FA 5GPAA 4XICA 2Y9YA 3S1MJ 3MKLA 5C4JJ 2YU9J 1EF4A 4LOCA 4JX5A 3PPBA 2PMZN 1Y1VJ 3CCYA 1IDZA 3BTJA 3V6GA 1VNDA 2XB0X 1WH5A 5F04A 2JA6J 4GFBA 3QKXA 2DG7A 2XRLA 1OCTC 2NVQJ 4GCTA 3IUVA 5J1YA 4PXIA 1SFOJ 3HTAA 4EEFG 3LNQA 3LOCA 5EGOA 3JRGA 3DCFA 2QF7A 1JT0A 1WH7A 4I6ZA 2E2JJ 2EQRA 4IEJA 3IV5A 1X58A
chains in the Genus database with same CATH superfamily
3RDIA 1D3YA 2FU4A 2GOMA 3I3LA 1T8IA 3A0BC 3FBIB 3VVXA 4DYRA 3L1PA 1FBQA 2W82A 3KZZA 2M9HA 3KKCA 2LFBA 3K1NA 3OYKA 4NELA 2GXGA 4NUBA 3VP5A 2R4GA 3HGGA 1WPKA 2EFPA 1A6QA 1ZN2A 2BBYA 3JTGA 1HLVA 4ACIA 3TW7A 1O3SA 1O7LA 3FWEA 4NC7A 4XLNF 3C2GA 2X6XA 2WGBA 3S1NJ 5H6QA 4RGXA 4N4OB 5F0HA 4EJUA 1HKQA 4IHVA 3Q9VA 4F3QA 1XMAA 3BROA 4WX9A 4ASNA 3OYHA 3GTOJ 4A3FJ 3LQQA 1ETKA 2EV5A 1YHQI 5M3FJ 1V5FA 2MH9A 2GZWA 2F5VA 2VT3A 4L9JA 3K4BA 1W0TA 3F3XA 2OC6A 2IBDA 1G59A 1XGNA 4CO8A 4RAZA 3CD6I 2DA7A 4B43A 2KPMA 2YUSA 2VPLA 1JTYA 1QBJA 1NHAA 3M1EA 4RGUA 2CQ7A 2VT2A 4ZC3A 1XD7A 3KEQA 5HS9A 2V6EA 1LJ9A 5C3EJ 1UHSA 2YS9A 4ENNA 2QWTA 3G73A 1K78A 1SGMA 4UNOA 3PQKA 3BNIA 3ESWB 2XPVA 1XN7A 4JX4A 4CYCA 1YJ9I 2HFHA 2ETHA 1D1AA 3HEFA 2LY1A 3REOA 4CA0A 4OINF 3FISA 3ZP5A 1XDUA 4NQWA 1NTCA 3FKJA 2VOOA 2EFNA 4PGHA 2EZKA 3CUQA 2ESNA 4BKXA 2NVXJ 2DMTA 2NS7A 3SFIA 3TMOA 4XRSG 2NVYJ 5EYRA 1FEXA 2VKVA 3K1MA 3J7YJ 2E35A 5L3FA 4FTHA 2RGVA 3RPUA 4EJVA 3FIWA 3JRCA 1L0OC 2MD5A 5DEQA 1FMWA 3ERMA 1HW2A 3RYPA 4HF0A 2V1DA 4U7DA 1JUMA 1XG1A 3DPTA 5A2QK 2ZJQF 1FT9A 2O8KA 1UI6A 3SEQA 2LH9A 2BEOA 1YW8A 2J5PA 5EZGA 5H20A 2HR3A 1XMXA 2JK3A 3MFKA 3KEYA 3RTRA 4A6EA 3KP2A 3HJEA 3O60A 4IPAA 4LB6B 4A69C 3W3CA 1BR4A 5FB2A 2HEOA 2B7EA 3I9V2 3V7SA 2V1XA 5JVTA 1IN6A 3HOSA 4HNUA 1ZG1A 4ABZA 1Z05A 1FPQA 3I4MJ 1L3LA 2QLZA 1V4RA 3NQOA 1UJ8A 2FOKA 3H5AA 3QU3A 3IHUA 5KHDA 2E1NA 3BG6A 2R5YB 4EGYA 1F43A 1WI3A 2IGOA 2BYVE 3BDDA 1ACIA 5H2FC 3V4GA 3GZIA 5DCFA 3FZVA 3VDXA 5D19A 3FK6A 2QWWA 2KIQA 2M7BA 4HV5A 1VZ0A 3E5XA 4RLFA 4M3BA 1IC8A 2YVHA 4P96A 3MAJA 2ZXJA 2LG4A 4HOBA 1TL8A 1SVLA 2CW8A 2OBPA 2W00A 3BOQA 1GXPA 2F6CA 4FX0A 1XTAA 2PFBA 2M0CA 3D0SA 2G7LA 4V2FA 2OUMA 2BY0A 3CO7C 1HW1A 1W0UA 2FOWA 2IP2A 3QU6A 5JLWA 2X85A 4OU0A 1Z0XA 1K78B 1Z91A 2EZLA 3M8FA 1ON2A 2LSOA 3MWMA 2QUFA 4BH9A 4CYCB 5IOYA 1I39A 3FM3A 1AA7A 2DJIA 3BJ6A 2QOPA 1B1BA 4HF1A 2HQRA 5D4SA 3L09A 1HA8A 3CUQB 1B8IA 4U9LA 1T0FC 4LG3A 3S32A 3CRJA 2HYGD 1BN5A 4Y4RA 1A31A 4P9FA 1F5TA 1BW6A 3M07A 4CXFA 2HKUA 3IWZA 3OYCA 4OAZA 1HCRA 3RH2A 2ZY9A 3PO2J 1X1DA 5HNFA 4YELA 5B3SH 4HLYA 3FXKA 3AAFA 2HXIA 2ID6A 1VQNI 3TO9A 4LGWA 3T0YA 3BY6A 3LSJA 1J59A 1KQ8A 3EGQA 2HVQA 5FKNA 3CMMA 4MHGA 3FKIJ 2KISA 2VB6A 4LB5A 5E79C 2W48A 2WAQN 4L18B 1R5HA 2HXOA 4XSXF 3BP8A 3VOEA 3ZMVA 4BHCA 4R8HA 2DLLA 3BTCA 3JCUC 3S14J 2BE5F 4PCQA 3BR2A 1T33A 5FJ8J 4UVBA 1U5TA 2KJCA 2MG4A 2X6OA 4L5JA 4PJJA 3QODA 3ZN1A 3KNWA 2P7VB 3BLYA 3FDYA 3Q0UA 2JPBA 2F4MB 3BQZA 5IP9J 3BG3A 2GFNA 3AKZA 1Z21A 2CV1A 3JAMK 2ME6A 2WA0A 3KYCB 4EM2A 2GIVA 2WTEA 2DXIA 1UHMA 4FHTA 2CRGA 4LIVA 4JK1X 2DMQA 2K40A 2VQCA 3TP3A 4BE0A 3GZNB 2JZYA 2A6HF 3IKTA 2ADUA 5FFXA 5EEGA 2DO7A 4AC0A 2QA4I 1YI2I 3GVAA 4BXXJ 5DAJA 3FXMA 1KYZA 2KDZA 1G2HA 4V19K 2H27A 2YSRA 2P4WA 3QBMA 3NI7A 5CVJA 4LLNA 2IS2A 1S72I 3V8KA 2A6TA 1R49A 2OZUA 1E2XA 2CUEA 5DD8A 5ILUA 1X3WB 1B8IB 4II2A 2ZJRF 3JSOA 4XK4A 4Z2YA 4U7BA 2D6YA 2A6EF 3ASOH 3GTLJ 1P9QC 3SZGA 1I27A 1K4TA 3DPUA 4ZDLA 2A5YB 2EA4A 3HOVJ 2NYXA 1IN4A 4G8XA 3B6CA 3CP2A 5F1JA 1RKTA 5HSZA 4JKZA 3IWFA 1XB4A 4IHTA 1Z1DA 5JLXA 2V79A 2DK5A 2CU7A 5LRSA 1TQMA 5D1RA 5JHUA 2H94A 3KZYA 1OISA 2UXIA 3SEZA 2RNGA 2PFVA 3ZQHA 4AUXA 1VQLI 3GYHX 1VQMI 5J1RA 2QQ9A 2O03A 2IJLA 4JP0A 3ZMSA 2DMUA 5J47A 1DP3A 2EPFA 3O8GA 4ZZDA 4GXOA 5A2QZ 2VLAA 2QIBA 2XPUA 1TBXA 2XIGA 4FISA 3A4CA 1ETYA 1IRXA 2LLKA 1YX5A 5FFZA 1PVEA 4B09A 4P9UA 1U5TB 3K8PC 4ETSA 2XKPA 4I02A 2X1EA 4XQFA 4I98B 2RN7A 4FETA 2Z16A 1S3JA 3QYEA 5IPAA 2ACJA 3VYTB 5L3CA 9ANTA 4IRHA 3DF8A 1OCCH 2ZMEB 3WU2C 3DV8A 3SZPA 2HZDA 2L3DA 3W2AA 3CP8A 4Y13A 2DT5A 3MZHA 3TEDA 2E36A 3OL4A 5CXIA 4GCVA 4NC6A 3F72A 1D0XA 2IA0A 2R7OA 3L00A 3BJAA 2I8DA 2RASA 4I2OA 4RGRA 3VIBA 3HOUJ 2EA2A 4YFXF 3WGHA 1C0WA 2DG8A 2TDXA 4EJTA 1SD6A 2AQFA 2EIKH 4O6JA 4Y15A 2QSHX 2ECCA 1XGMA 2DBBA 1FBSA 2YPRA 4HPQA 4CGRA 3DBHB 3KPHA 4FT8A 2M0MA 4M73A 3EETA 1DDNA 3DTKA 3JRIA 2XDVA 1W4MA 3OOUA 3BG9A 2OAZA 1TWAJ 4A3LJ 4UB8C 2B3WA 2O3FA 4NDLA 4KMUX 1HDDC 3CO6C 2O61A 3T6NA 5DUIA 5HNHA 3BJBA 1VTNC 4RB1A 2ME0A 3FHZA 2LKSA 1U5TC 4A3JJ 1ZKGA 2DFIA 2IXSA 1ITYA 2NOGA 1XX5A 5D8LB 1Y6IA 2FE3A 5ED4A 4HA8A 4RS8A 1OQYA 2VONA 4ENJA 2DOEA 3B73A 3F6OA 1QU3A 2ISZA 3SZTA 4RB0A 3NPIA 3IH2A 2HU9A 2NX4A 2MH2A 5ILVA 1IXSB 2VBZA 4CCLA 1STZA 1MD0A 1V54H 3FXQA 1ZGWA 4OMYA 3LHQA 4GYGA 3C18A 2WAEA 3CCQI 1VFCA 4RAYA 2JSCA 3F8BA 4L9NA 4OOIA 5BMZA 2DTRA 2WV0A 4P5OA 3OYEA 3M4OJ 3PFIA 4M3EA 3HGYA 5JI6A 4KICA 2QKOA 2LMDA 1MNEA 2YU3A 1ZQ3P 1HKTA 2DCEA 5EZHA 2Y48A 2NS8A 2GA1A 1T56A 2ZXIA 3GMEA 4IZZA 1FIPA 3ZQFA 1HOMA 3BZ6A 1ZGJA 2WADA 3CF2A 3VB2A 5DDGA 3VOXA 1EA3A 4EMSA 4XMYA 4XLAA 1MKMA 2LD5A 2PMZA 1MMNA 3KE2A 1KU7A 1ZGAA 3F9KA 4XNFA 4IKFA 1DGRM 5HAWA 3J7AO 1KU3A 2O8XA 3G1OA 2K5CA 2YVXA 5GAEJ 5DM7F 2UV1A 4Y3OA 2GENA 3CJNA 3SWHA 3M8JA 5CPRB 5HS8A 4S05A 4WK8F 4MEYF 1IN8A 4XKWA 4DQ2A 3C2BA 2H1KA 5IY5H 2KJBA 1MMDA 4RB2C 3NNRA 1P2FA 3PO3J 1MMAA 3OR1C 1O3RA 1MBKA 4CUGA 4PUSA 1RPWA 3I58A 2DQRA 3FBNB 1D1BA 2HGCA 1W36D 5GPAA 4LLLA 2ZFUA 3A2KA 2YU9J 4U9NA 1P4WA 2VBXA 3BTJA 4K2EA 1VNDA 1R5ID 2XKOA 3JAMZ 4XLPF 5HDKA 1OCTC 5GAHJ 2QM3A 3TKYA 1LQ1A 4MNUA 5J1YA 2BVLA 1R00A 3BJOA 1XGOA 3TQNA 3HTAA 1O3TA 3KYDB 4RAFA 3MKZA 5EGOA 2Z3YA 4UUVA 1X19A 1WH7A 5GTHC 2CFXA 2MBFA 4HX7A 3SFZA 2OA4A 3OYNA 5FLXK 3IV5A 1KGSA 4BXUA 3R0JA 4O3MA 1D5YA 2R7WA 3LWFA 1P4AA 2DODA 2V7FA 1DGWY 2L4MA 2XRNA 4BQQA 4IRIA 3TOBA 3ZCOA 1LKXA 1USTA 2XHKA 3KKDA 4YIRX 2NVUB 1DPUA 2M4GA 1WRJA 4F55A 3O2PE 1GV2A 2VIXA 1MH3A 3OV8A 3BCAA 3L7WA 4CCNA 4A3BJ 1B6AA 3MZYA 4QWQA 2YR2A 3RIRA 2V9VA 4V2GA 3I56I 3VEPA 3KP3A 1UFMA 4MEXF 4KDPA 1MBGA 5CJ9A 4KA4A 1WZ2A 4CYDA 3NRGA 1TC3C 2PZ9A 2K7LA 3OYJA 3HE0A 2QKLB 1PYVA 2LR8A 4ZYHA 1GUUA 3K70C 3HRTA 4IHWA 5DM6F 4XL9A 5F1RA 3K4LA 1K7AA 2QCOA 4KITB 3IL2A 2FNAA 3ABLH 3GFIA 3DEWA 5LGUA 5IT9Z 3JTHA 1SD5A 2V4JC 4Y17A 5E3OA 4ESJA 2RQPA 2Q8KA 3WHCA 1IGNA 3HOTA 1VQ5I 4UHTA 3PM1A 1FOWA 2H8RA 5BPIA 2Y2ZA 3PSIA 3F1BA 2CGPA 4D1QA 2K9QA 4D5FA 1N25A 1X3ZB 3BRUA 2K4BA 4JX6A 1DQUA 2VJIA 4IRGA 4ZDPA 3L9FA 3SYTA 3KP7A 1ZRFA 3VSLA 4HQEA 1D5VA 4M6VA 1E3HA 3W2VA 2E2IJ 2LF7A 3HTIA 2EZIA 1OMIA 3P9IA 5TGTA 2RV8A 4KFCA 1FTZA 5L3DA 3S3OA 3GCMA 3K7AJ 3S15J 1EH6A 1U9NA 4HKUA 1XSXA 3VFZA 2A5WA 1W7PA 4M3DA 4A5NA 4F93B 1N77A 2EIJH 4UVCA 5CVVA 5M5XJ 3ABTA 5EGOB 4BDZA 1LB2A 3QWLA 3KYLA 3V42A 1R6RA 1QZZA 3CF5F 2IW5A 4WXCA 1BJZA 1Z3YA 3ZQ7A 1JKPC 2ICWG 1MNMC 1AU7A 1MBJA 4ZYDA 1TQIA 2Q2EB 1JKOC 3GUDA 2F2EA 1U2WA 1OYIA 2FXAA 3S5RA 1WJCA 3UNGC 4M72A 2QENA 4LMYA 2VJ4A 2M4KA 2MC3A 4Y52J 1JTXA 1Y0UA 4I01A 2PI0A 3RCOA 2FBKA 1Y0NA 2Z9OA 1OCZH 2HOEA 3FRQA 4E4HA 3ONQA 3C3WA 1R4NB 4HX4A 4MGRA 4W97A 4RBOA 2E7XA 3OIPA 4ZH4F 1MJAA 4BAYA 1BC7C 1SD7A 4PZJA 4EM0B 1UI5A 3RJPA 4A3KJ 2DJNA 2M8EA 3E5UA 5GADJ 1XSVA 3F8FA 1RR7A 1QZYA 5KK1A 4IOCF 2X1CA 3S8PA 4BXFA 4X6AJ 3DKYA 1EH7A 2UUZA 5J4YA 5J8FA 1YO5C 2E1MC 2M7AA 3MNLA 1FZPB 2P6SA 3BR0A 3I71A 5C44J 2WAFA 2F5EA 2ZJPF 2LKXA 1XS9A 3QPLA 3TDZC 4Q47A 5E3NA 1ERDA 3VPRA 4HNTA 3DEEA 1X4OA 1JI8A 1LE8A 2DPDA 2KDOA 3CUOA 3FXOA 3DQVC 3HPHA 1OFCX 2H1LA 3C07A 5FO5A 1KA8A 3JRBA 1W7PB 2ZJ2A 2D45A 5M5WJ 4N9IA 3WTTC 2WAQA 3GFJA 1BIBA 2E1CA 3R4KA 3QP6A 5GP9A 2R5YA 2DPUA 2KMUA 3K1PA 2KIFA 2PBIA 3P9KA 1WSUA 3U1DA 2VE8A 4XLEA 4BJTA 3EUHC 2V1UA 2CW7A 3RKXA 3KZIC 3H9JA 3WTXC 2QBYB 5HLTA 2HDWA 2XF6A 3I59B 1BL0A 1MJ9A 2HKXA 3W6JB 1Y8QB 2HI3A 3LFUA 4I76A 4MTDA 3AQSA 5AQCA 3GTQJ 4XRMA 2B63J 1XCVA 3R6SA 5HVQC 4YEJA 5CVRA 2Y30A 4KISA 3DEUA 4B3AA 4IHXA 5FLXZ 4F92B 4AD9A 4GRIA 3CDHA 5GPCA 2KT0A 2CS3A 3ULQB 1Z6TA 1BR2A 2H6CA 2P81A 1H88C 5HLIA 1O4XA 2M5WA 1OR7C 4RM3A 2VC1A 3CCRI 3VYSB 2XAQA 4Q48A 1BBYA 1SMTA 1AHDP 1K4SA 3ZOBA 1MDMA 4PFPA 5EEHA 1IO2A 1T6SA 1LDDA 3V8JA 2RREA 2ZCWA 2Z99A 3AG2H 1T98A 2QZ8A 3PL8A 1B72A 2LOOA 3HTUA 2HOAA 2VUMJ 3V78A 2QQAA 4PJ0C 4BL0B 3GZ5A 3OIOA 2K9LA 1SFXA 1VQ8I 4XLHA 3OS0A 4AC6A 1LE8B 3CJTB 5FKOA 3J7AY 3TOAA 2R7TA 5K58A 2JA7J 3HSEA 1H89C 1YFHA 1G8XA 1LUJB 1SFUA 5LHIA 3DWLE 4ESBA 5E18F 3BQYA 5TISC 4E7SA 3G1LA 2BXZA 2UWMA 1R71A 1A04A 1MGTA 4XORA 3OYAA 2MYSA 5B1AH 3HM5A 2B1EA 3HYIA 5FKMA 3EUPA 2ZSIB 3ON4A 3X2QH 1Y8RB 2IRFG 5BQTA 1LFPA 1D8KA 5LEKA 3G4SI 2DK8A 3CLOA 4MLOA 1Z77A 5FLMJ 1G3WA 1R1UA 4BBSJ 3OYIA 1MMGA 2BVMA 2CFOA 4KMFA 3FHNA 3M7GA 4LD5A 2QQ8A 5TJJA 1VQOI 2W53A 2R5ZB 3W2WA 1MSEC 4BJ5C 5K5RA 3QP5A 4HW0A 1RESA 4BE1A 3RI4A 3G3ZA 1GVDA 3DPLC 2XGXA 1LVKA 4B47A 1T2KA 2OPTA 3LL7A 5IYBJ 3E1SA 2HTSA 3WTUC 3QYFA 1N78A 3OY9A 2BY1A 4XOPA 4H0EA 4D0PA 2BHYA 2R7XA 3M1CA 1FLIA 5BNGA 3S3MA 1RUOA 2LDUA 5FMPA 5HLHA 3KP6A 3RPQA 3DKXA 2DN0A 2VQLA 3ABMH 1X1BA 2NAZA 3IUOA 4HV6A 4HX8A 4MQ9F 1WJAA 3Q3SA 2BV6A 1YQAA 4BQNA 1MDMB 3HTSB 2DAOA 4L0YB 2ZC2A 1TLHB 3D5SC 4JL3A 1QHGA 4XIDA 4C9YA 1YIJI 1B9NA 5IOZA 4M6YA 3S93A 1LEBA 2GAUA 4D7MA 1B72B 1MSFC 2ZB9A 1V5GA 2AO9A 3ABKH 3WTSC 3AG4H 3WGIA 3RKYA 3ZQIA 3ROUA 2NRAC 5AIPA 4XN0A 3ECOA 5E1WA 2OF7A 3K4MA 3U1KA 2OV7A 3Q5FA 4XKCA 2VKEA 4Z6YA 3V7RA 2JA8J 5FD5A 1TNTA 2L54A 3GO5A 3WG7H 1EH8A 2OCEA 3EYIA 2JTVA 2F4OB 4B8XA 4C3IJ 4YFKF 2F48A 2Z33A 3H9QA 2X6YA 1R36A 4S04A 4CHUA 2OI8A 5KVRA 2FQ4A 2UXOA 2ZXHA 3CWRA 5IT3A 4PJLA 3KFWX 4GFLA 5ERIA 4E7KA 1TWCJ 2M87A 1VQ6I 3CJQB 3NAUA 3CUQC 3UKGA 2K86A 2J5OA 3OIQA 5DD4A 4KN7X 2GXAA 3GBGA 4OD5A 2ESHA 5FLVA 2CO5A 2ZMEA 2P7CB 2EBIA 2PBXA 2XVCA 2EFWA 1T08B 4MFEA 4F52A 5ILSA 1OKRA 3OS2A 1LPQA 4A3IJ 2KKOA 4IJAA 4AYBA 2MABA 3L2RA 2NNNA 4A3EJ 4KIBA 1J2XA 5F27A 3ZMUA 5FROA 3QRFF 1FX7A 1R9TJ 4L62A 5CVUA 1HF0A 2RNJA 2ZSHB 5IYCJ 3LAPA 3E97A 3K70D 1X58A 1FBUA 1I3QJ 1FOKA 3CC7I 3E6MA 3HSFA 3C2HA 4ZTFA 1FWZA 3BZKA 3IAM2 3KP5A 4E6KG 4DYQA 2A61A 2VN2A 1ZR4A 2EK5A 1K61A 2NP3A 1P7JA 3ABUA 3VOKA 4HG2A 5D5XB 2G3BA 1JJ8C 4GCLA 3KIOA 4IHSA 2X0LA 3JSJA 4PSWA 4OIOF 3Q9SA 3GTMJ 2KP6A 3H92A 3ANGA 4YRVA 4BU2A 1IF1A 4DOZA 3DU6A 1IN5A 2EZHA 5L3GA 2MSYA 3CCUI 1OLTA 4XICA 1ZRCA 3HPGA 3MKLA 4LOCA 2FMYA 1RR8C 1GHCA 4OMZA 2OD5A 4FASD 4WF2A 2K02A 3R61A 2NNYA 2XB0X 1WH5A 5FRNA 2RC4A 1BI3A 4CGZA 4BDYA 3QKXA 3HUGB 2XRLA 2L01A 5HDGA 3SHFA 4ENMA 3VYUB 2JVGA 2CG4A 3T5XA 2KZVA 2QGUA 3E6CC 2HVRA 2NVQJ 3IUVA 3DKWA 4PXIA 2NS0A 1G3YA 2V9KA 5TRDA 2XV4S 5DUKA 3OYLA 2M45A 1H9GA 4XKVA 2JQ7A 5LD2C 4BYYA 5K1YA 2LF8A 1S7OA 1S6LA 4C3JJ 2CSOA 3S16J 3KCCA 4KWAA 3HIFA 2JPCA 2R7RA 2FX0A 1PDNC 4IQJA 2GQQA 3GLXA 3WE2A 4U88A 2CV2A 1D1CA 1JUSA 3R60A 4XN3A 3SDGA 1ZG3A 3AL0B 2VBWA 5H6RA 4UVAA 4RMNA 2ZOYA 5EJCA 2TRTA 2A07F 1F9NA 3E6DA 3PUBA 3Q0VA 4HYEA 2LTPA 1XGSA 5C4YA 1IZ1A 5LFAA 3HXLA 2L7ZA 1IN7A 2XAJA 3BG7A 1KQ0A 2LRDA 3FXJA 5BS6A 4HDUA 3ZMTA 1ZELA 1WWXA 3E7LA 2CUZA 4ZYGA 1BW5A 1HC8A 4X1EA 1HXDA 2G7SA 2BZTA 1FNNA 3ANPA 3N97A 4C2UA 2W57A 2WB1N 1TQPA 2DA6A 4L9VA 3CC2I 1QPIA 1FJLA 4MIMA 1TT0A 4ANJA 2FJ1A 2W1OA 1NK3P 1HW5A 2RDPA 4A0XA 4FE4A 4OIQF 2ZCNA 2CQXA 1JGGA 4JBAA 3JRAA 2DTZA 1Z6RA 3OMYA 3NWSA 2B9SA 3AG1H 1O57A 2CJJA 3F22A 2D2WA 4U87A 1N75A 2LBFA 2ZMEC 4C2MA 3AFHA 4EV0A 2QVOA 1MMSA 3VTIA 2KL4A 3LSIA 4BQOA 2GOXB 1X4PA 4I09A 4OIRF 3CCJI 3JSPA 3OYBA 3H3VK 4I0BA 3F21A 3LFKA 2HDCA 1RKWA 3H36A 1Z3XA 2G7HA 2JMWA 1IJWC 5JFRA 2EWNA 2LKPA 4E7JA 3D1NI 3S1QJ 1RIOH 3BCGA 4NHJA 1B59A 2A69F 2DA3A 3QAHA 2FD5A 5CVIA 2DT7B 2K3FA 3IAS2 2GBYA 2L2OA 2V1NA 3DTEA 4RDUA 1POGA 3B6AA 3GTGJ 5HBUA 2FBHA 2KQRA 4N4NB 2FSWA 4UXNA 4EQQA 5CYVA 2FRHA 5C4XJ 2GM4A 1FP1D 4PGGA 1KU2A 4GGGA 2ZXWH 1GVJA 2PMHA 3JRFA 4DJAA 2O7OA 3C1DA 4WWCA 3PQJA 4AYBN 1ULYA 1H9TA 3RYRA 4L5EA 5LRRA 3ZGKA 4J01A 4NB5A 4UV8A 3PSFA 3TO7A 1S7EA 4DZPA 3GX4X 3KEOA 1TWGJ 3HIMA 4A3GJ 1LDJA 3ZXSA 3QPSA 5D5UB 2KIMA 4HLXA 1ZLJA 4L0ZB 3S1RJ 4DBRA 4PFOA 3HRSA 2W84A 2UXUA 3FXUA 3S2HJ 4LITA 5LGTA 1WHUA 5KAIC 4M9SA 1UAAA 2P8TA 1FYMA 1IW7F 1W5SA 2F4IA 4YG2F 5LHHA 3RZOJ 4OD4A 3VODA 5E8IA 3LQRA 2JA2A 1I5ZA 4KT5C 2GIZA 4ZDOA 3I4NJ 2DA2A 1H8AC 2JRTA 2UZKA 2FJI1 1R7JA 1X1CA 4EVIA 1UCRA 2R7ZJ 3VVYA 1VQ7I 4E7LA 3E6BA 3TGNA 2Y0SN 2CH0A 2R3SA 3KLOA 2R92J 2LBFB 3AQTA 4U0YA 1YJNI 1PP7U 1J5YA 3LSHA 3COAC 1BR1A 1J9IA 1UELB 1QPMA 3BG5A 4YIIA 5D5WB 1VQ9I 1FTTA 5E3MA 1NH3A 4S0HB 2Q2EA 3EPZA 2VI6A 3ZR8X 1U9OA 2DFHA 5LGNA 3ZMDA 2BXYA 1PP8F 3HSRA 1ZRDA 1U8RA 2Z2SB 2KLOA 2JT1A 3RZDJ 1W1WE 2L02A 1HDPA 1MIJA 3BPXA 3KETA 4AVZA 1YE9A 3L2WA 3A01A 1B9MA 1AWCA 1I3AA 2KRCA 4MQVA 2IA1A 3GTPJ 2QKMB 1X3UA 1Z67A 4KIGA 1RI7A 1IXRC 4YFNF 4UY8I 1MJBA 4GFKA 3LWJA 5AONA 5EDNA 4HEA2 3ERED 1E3OC 2JA5J 4TV7A 2XGDA 1VQ4I 1EKEA 2XDNA 2P5LC 3A1YA 2E1OA 1BA5A 4AM3A 3K4NA 1T39A 1E17A 4BY7J 4HF2A 2PEXA 3CDIA 1K6OA 4EJWA 1U78A 3DXJF 4YZEA 4A93J 2ELJA 1I6XA 2CMPA 2G7UA 4BNCA 2IU5A 5H9TA 2HZTA 4E70A 3W6VA 3HZJA 2H8WA 5ICEA 1AKHA 5K7FA 3J7ZI 1APLC 5B66C 2IS6A 2I10A 3LA7A 3LSRA 4LK1F 1E3PA 4KIFA 2E19A 3WTVC 2HQNA 3RD3A 4ZZLA 1ETXA 2G9WA 2FBQA 2HYJA 5FKKA 1SAUA 2X1DA 5M5YJ 5J4VA 3H3ZA 3ELKA 1DP7P 2BW3A 1Z7LA 2M1BA 1ORKA 2RHAA 1K6YA 4CZCA 4ME9A 4QPQA 3PNTA 3MKWB 2V57A 4OAYA 3CMAI 2CW0F 2QQBA 1WFXA 4BACA 3FXRA 2QBYA 3I59A 2F07A 2CV0A 1K83J 1BOAA 1OCRH 3QPHA 4M6XA 1ETWA 2FEZA 4M74A 4C2MJ 4Y33A 3QPTA 2JSPA 2F5CA 1ZREA 2DOAA 2OQGA 2ZNYA 1JGSA 2Y9ZA 4JOMA 2MA3A 4B44A 3IRQA 1P6RA 3A01B 4CICA 5J3LA 4EM1A 3LSMA 1J7KA 1E0EA 1JJ6C 3TW6A 3PNYA 3PIOF 2AQEA 2VKDA 3H0GJ 2IA2A 1YW7A 4G7HF 3KP4A 4P1WA 4X0GA 1YS6A 1X2MA 5J40A 2STWA 2X4HA 3ZPLA 1MNDA 2CQKA 3M3YJ 3DP7A 5F6FA 5ICCA 2X9DA 1DU0A 4UV9A 3HB9A 2GLOA 1WJ5A 4XRSA 2XAGA 4ZJZA 4QLCU 3RPUD 4FQGA 3SDBA 3COLA 2Q1ZB 2D1HA 2XF7A 1OYYA 3GFLA 2LNBA 1IAWA 3FMQA 5FD6A 2MFZA 3BR6A 4BY1J 3GEUA 3NXCA 3F8CA 3RQIA 3F8MA 5ICFA 5F0CA 2HQAA 2XGCA 3MQ0A 5HODA 4RA2A 1AKHB 4N9HA 5J1UA 3FXLA 2IGMA 4WXDA 3VW1A 1FY7A 4A3CJ 2HVSA 1REPC 3GW2A 3LSGA 2ZKZA 4CCOA 2Q24A 4C2TA 4E7IA 2JN6A 3K2ZA 4HSRA 3W6KB 1BJAA 1YJWI 5D8KB 4G6TB 1ZARA 4IRVA 2BW3B 1IDYA 2H6BA 4QTRA 3EUAA 1BM9A 1JHFA 2IPQX 1V5EA 2AXLA 3WE3A 2Z1DA 4XLCA 3E0JB 3SXYA 4IO9F 4HRIA 3JW4A 1OPCA 2I5UA 1LFBA 4LJZF 2HWVA 2R5ZA 4HSTA 5E17F 4XLFA 3HKZA 2Z5UA 3N05A 1WQ2A 2K9NA 1YIOA 2VJJA 2ZCXA 2DA4A 3I53A 2DT6A 4ZYEA 1WCMJ 1W5CC 2ISYA 3K4CA 1T0FA 3GFMA 5FKLA 4R79A 3VYRB 3PASA 3J81K 2WC2A 2FF4A 1ON1A 2OQRA 4A0YA 3EQLF 3OYMA 4UDSA 3PFYA 1RRJA 1TW2A 2XPWA 3BPVA 2L9NA 2MLKA 4A6DA 3D5LA 5BPDA 1ZK8A 3VW0A 3P9CA 3H1CA 4BUPA 2EV0A 4II3A 5K5QA 4Q4ZF 3P5JA 2HPIA 1JE8A 3BWGA 4KT6A 2L4AA 1W36C 3T1BA 1KU9A 2JRMA 4BS9A 1FSHA 2XSJC 4O5VA 1IXCA 3CESA 3R0AA 3NEUA 4G9YA 2GA2A 5IP6A 1NK2P 1JKRC 4QSHA 2DDAA 1KQ9A 2OERA 3A03A 3L2QA 3Q0WA 4A3DJ 3LSKA 3CCLI 2R0QC 1QNTA 4AWXB 3HOZJ 2B0LA 2G0EA 1Y39A 3HOWJ 2BHZA 3CZ6A 3ZQQA 2L0KA 2LVSA 1QO0D 2BY2A 5E3LA 2LY2A 4ZYAA 4Q5SF 1MZBA 2NXNB 3TP0A 4BBRJ 4A3MJ 1S29A 5M3MJ 1TNSA 4L5IA 3ML6A 5BOXA 2XAHA 4I99C 1T38A 5D18A 4B1RA 3ASNH 1FOYA 1QHHD 3WGGA 3RQ4A 5KAFC 4BE2A 3CDLA 2EB7A 3K4KA 4RGSA 2KRHA 3HOXJ 3I4PA 1F1ZA 2ZBKA 1Q1VA 2CWEA 3T8TA 3I55I 2G7GA 5F64A 2V26A 4EATA 4W1UA 1ZHFA 2XUBA 1SFEA 1YG2A 2M3AA 3BTLA 3GTJJ 3HTJA 2QYOA 1P4XA 4KNYA 1A36A 2E34A 4FE7A 5F0FA 3GZ6A 3S1MJ 1EF4A 5C4JJ 3PPBA 4WIBA 4JX5A 4XM3A 3CMEI 4BEHA 5JVGF 1Y1VJ 2DFEA 4CCMA 1S5LC 5KCMA 2R7VA 2JA6J 2R7FA 4GFBA 2DG7A 3K69A 2EFOA 1LDKB 5DV5A 1BI2A 1SFOJ 4EEFG 3LNQA 4BHPA 2M30A 2W4SA 4AU7A 4IXAA 3JRGA 1JT0A 1F4KA 3N4MA 2L7KA 2X6WA 1HBXG 4IEJA 2DDBA 5CKTA 1WGXA 2WB1A 1DUXC 5D5VB 3KLNA 1BOBA 5B5EC 5D6FA 2IS1A 2YVEA 4MO7A 1GLNA 2LK2A 3ZRGA 4C30A 4JNNA 1Y1WJ 2XASA 1FYKA 1R1VA 1RETA 3P9TA 2VPRA 1X2NA 2EINH 4HBLA 2DMPA 4XOTA 3F8NA 2VL8A 3O6BB 1P7IA 3BZCA 1T95A 2F5DA 3DLAA 2XROA 4NQWB 1WJBA 3F23A 3MMYB 2RKHA 3J80K 2DFFA 4KUMA 4DZJA 1FYLA 4PK4A 3HUGA 5AIQA 5HOOA 4M9XA 1M1EB 3QOPA 1Z9CA 4D5CA 2NOJB 3CC4I 2QTQA 1P92A 1AOYA 2O9LA 4G7ZF 2WUIA 2NP5A 1OCPA 3FMSA 4QPOA 1ETVA 1S9HA 1EV7A 2GWRA 2PJPA 5CW8A 1JUPA 3K9TA 1UZCA 3MN2A 3O8HA 4MXMA 1ONVA 5B1BH 3B02A 1OJLA 1IRZA 3G7RA 2ID3A 4UUSA 3RKQA 3HKZN 1VQPI 1D8JA 2UXHA 1XC5A 1YITI 1D0ZA 4BEHB 1FSEA 2OJED 3G56A 1RZ4A 1IRGA 5FHPA 2ZNZA 2N8GA 2L7MP 1O3QA 4HQMA 3TO6A 2PG4A 3L2UA 3KX2A 3TBIA 1IUFA 2DQLA 4G6DA 3DPJA 3TL4X 1ZYRF 2ZO4A 3WHBA 3P7NA 1EJ9A 3L2VA 2XAUA 3I0TA 4CH7A 5FGMA 1WI9A 2IVMA 1FC3A 2VXDA 3PUFA 4NNJA 2CQNA 2EH3A 3M9AA 3WTWC 2QSGX 5FGLA 3LA2A 2XB5A 2AS5F 2VOPA 4CSWA 3BC8A 2EIMH 2XAFA 5E8GA 2E5ZA 2DYSH 1A35A 2RQQA 4IF4A 5KNLA 5CXGA 3GWZA 3WG9A 2FQ3A 2W85A 2TCTA 5J6XA 4ITVA 4NN1A 3PNVA 1JHHA 3J81Z 4NC8A 1A5JA 3CJDA 5DTDA 4BGDA 6PAXA 2PJRA 3H35A 5HLGA 2R7DA 2PX9A 4UUTA 5LHGA 3MD2A 2Y0SA 1WJEA 2CUJA 1VQKI 3HG9A 3S2WA 4G94A 2O7TA 2E5NA 3HTHA 2MGQA 2VBYA 4M3GA 1PJRA 5GTIC 1ZG5A 2ELHA 1ODDA 2VQHA 3G6EI 2L9RA 3F6VA 4D9JA 3U2RA 3OSGA 2COBA 3K6GA 2L9SA 3OS1A 2VJ5A 5D4RA 2P5KA 2MW8A 4I0AA 3GLLA 1U6GA 3BTIA 3HHGA 1QRYA 2KZGA 3BT9A 1UHWA 2M2EA 3WODF 1FIAA 4F91B 5DCMA 2Y75A 2Y31A 1DPRA 3CCVI 2V6CA 2WWYA 2P0WA 5E1XA 1MW7A 3IP4B 2NVTJ 3DFGA 1CGPA 1BI1A 3GEZA 5L3EA 2UXPA 5IT9K 2P5VA 3A02A 4UUSB 4E7HA 1MBHA 1IUYA 3HL2A 5LBQA 4H4KC 2O0YA 3IH4A 1TWHJ 4I7HA 4IVNA 2H09A 3OYFA 2QSFX 1X1PA 3WTYC 1SVMA 2DA5A 3V8LA 1ZH5A 3KZ9A 2YX7A 3DBRB 4HAMA 1R58A 3OSFA 3H0DA 1GV5A 2RAEA 4G6QA 1MH4A 2MC4A 3QQAA 3ZQLA 4A12A 3I5UA 1KZHA 5E20A 1R4MB 4XSZF 3LJLA 5ICGA 3G1MA 4AIHA 5JHFA 1CF7A 2OTLI 4J19A 1IG7A 2GXBA 1ETQA 1WVRA 5J8CA 3CCEI 2VE9A 2HS5A 3CTAA 2M34A 5E1ZB 3VVZA 1IV8A 4LIUA 3OYDA 2DMNA 4QIWN 3DBLB 3VUQA 3K2AA 2EFQA 2IGNA 1SMYF 3S3NA 3LA3A 3WU0A 4BHBA 3BHQA 1R23A 1ETOA 3E3VA 4ICHA 4B3XA 1U8BA 2LREA 2WY8Q 3BCBA 1JXSA 4U0WA 1NG6A 3HC7A 2PJRB 1QVUA 4DW6A 1SC7A 4GCKA 4N0BA 3JREA 2IEKA 1MBFA 1ZAOA 3PJRA 2HQ5A 1ZLKA 2XSDC 3JR9A 5K5OA 3PIPF 1XMKA 3FF5A 3AL0C 4AIJA 4M3FA 5L3BA 3LSPA 2HYFA 1JT6A 2K85A 1FP2A 1USSA 4CZZA 1I6HJ 4FCYA 4CCJA 3JRDA 5CLSA 3CQZJ 5GAGJ 3CJRB 5K7ZA 1J09A 3D5RC 3LMMA 2DU9A 1TW3A 4GYIA 4A2UA 3CCSI 3GTKJ 2AXTC 2L9VA 3RSNA 4ESFA 4XKBA 2O5RA 1W5TA 1QGPA 1ZR2A 3K4JA 1F36A 2UXNA 3SQNA 1JKQC 1ZTRA 3CLQA 1QVTA 3GF2A 4EGZA 1YLFA 2FBIA 2FUG2 4PJMA 4BJ6C 5DCMB 3MCZA 1QA6A 4E7ZA 4RLQA 1XCBA 1YRNA 1LEAA 1YS7A 2R7UA 1XPXA 3LAJA 1PUEE 2R7SA 2W25A 5FRMA 4DNCA 3AG3H 3M8EA 4CCKA 3J80Z 2R93J 2HTJA 1LVAA 3FMRA 2Q0OA 3HBLA 1CQTA 4DIQA 5CQEA 1HKSA 2PLYA 3ZMZA 5LEJA 3HRUA 1RC9A 3MEXA 3ZQGA 2XF5A 4IOAF 2XC7A 2OCCH 3MVPA 3HOYJ 3LSTA 1DU6A 2K9SA 3I54A 1SANA 2RVCA 5F08A 2OTJI 5HS7A 4ZTJA 1G4DA 2KHMA 1TWFJ 4B4CA 1CF7B 4IHYA 2JUCA 3E7QA 3GXOA 1WJDA 2E71A 2JUGA 4YIFA 4XR6A 3EYYA 3C7JA 1O7FA 5HDNA 1UG2A 4XONA 2JJ7A 3SJMA 4LK0F 1W7PD 1B4AA 4L9TA 4OWRB 3OYGA 4AVPA 2D5VA 3OL3A 4AF5A 4KYWA 3FK7A 1BI0A 1YYVA 1S8NA 2LC2A 4HDVA 1HQCA 2GUHA 1U0JA 2OZ6A 4M9ZA 1YOVB 3IKVA 2DW4A 2EILH 2PMUA 1Q1HA 1IV6A 4DGWB 3QOEA 5EF6A 1ENHA 2D1VA 1X1AA 3OWTA 4B48A 3S17J 2F5FA 3BR3A 3S2DJ 2CUFA 2LP0A 3ECHA 1WKMA 4JQFA 3DU5A 3E5QA 4HZFA 2STTA 4ON0A 2MLGA 5K7HA 1FOXA 3JRHA 5IYDJ 2M8GX 4PJNA 3VW2A 1J75A 4BQAA 4R1HA 4GO1A 2Y69H 4D7NA 5JR3A 5CQGA 2CYYA 2ECBA 3UR3C 3BR1A 1V55H 2DI3A 2A05A 4U0VA 4RB3C 1NG7A 4J00A 2R7QA 4A5MA 2W7NA 2KRFA 3H9GA 2L7FP 2P6TA 2PQ8A 2ZCMA 3HDDA 2FNPA 3O3KA 2ZFWA 4OIPF 4G7OF 1YRNB 3ZN0A 2OU2A 2HOTA 2AHQA 2FMLA 3HHHA 2E60A 2HYTA 2C6YA 2QEXI 5DYMA 3FM5A 3NARA 2L5QA 2X48A 3H5NA 2HNHA 2LY9A 1G3TA 2ELKA 4JYKA 3BR5A 3NS4A 1UB9A 3RKWA 3U9GA 5EG0A 1PUFA 2REKA 1GT0C 4C3HJ 1BC8C 4DBQA 2E2HJ 1G6NA 1SFKA 1HSTA 2VODA 5EFYA 3ZQCA 1HSJA 4DYCA 3G71I 4P55A 2Y0MA 4RM2A 2K9MA 2VC0A 1FMVA 3A0HC 1R22A 2DOFA 4PSXA 2HOSA 1YW9A 2VASA 2YX4A 4PDKA 2WBMA 3K0LA 2COMA 3CCMI 4LG0A 4WXHA 2X51A 3EUHA 2VXZA 4UB6C 5D6EA 4XBFA 3FX3A 1D0YA 4LLGF 2EV6A 3DLLF 3MKYB 1V3FA 2IGKA 4LFUA 2A68F 3U21A 5DS9A 2IAIA 3H3UA 3V7CA 2VKHA 2IS4A 2DA1A 2UXXA 4G12A 4Y7NJ 1SAXA 4IX7A 4DVYP 3IRRA 3G2BA 2XGEA 1I1GA 2K4JA 4IL6C 1BIAA 1UMQA 4XRFA 1VI0A 3CMYA 4HNVA 1QQIA 4WCGA 1U3EM 1GDTA 1A6IA 3WTZA 1LFUP 3K10A 2A3SA 2HKOA 1R1TA 3IC7A 4MK6A 4A0ZA 4GDFA 1TTYA 4MFDA 1UG0A 2HPMA 1OR7A 4AIDA 1XSDA 1KONA 2BGCA 2WV1A 2DYRH 1YTYA 2KIUA 2JWTA 3HRMA 1KYWA 2K27A 1I50J 1Y56A 4EJOA 5EEAA 3H5RA 4CDGA 1SVOA 2E1MB 1RUNA 3VWBA 5LLQA 3ISPA 1MBEA 3VSKA 2HDDA 1LNWA 1YX3A 1Z7UA 2K3PA 2VQGA 3OOPA 3B81A 1TZLA 2EJRA 3F0CA 4FX4A 2CQQA 1J0RA 1TP4A 3NRVA 4NBQA 3I64A 1VF9A 2O6GE 2ZOZA 3EUKL 4ENKA 1OYWA 3OR2C 3IH3A 1RNLA 2V9PA 4F7ZA 1OCOH 1S7AA 4AIKA 2A2FX 1R5GA 3MZ8A 5IP7J 1QZEA 1XDSA 5EG0B 3DTIA 3ON2A 3T8RA 1K79A 1PUFB 1IRFA 2W24A 2FA5A 3NWTA 2Y9YA 2BOLA 2KFDA 2PMZN 2WY7Q 1WJFA 3CCYA 1IDZA 2PN6A 3EDPA 3QYBA 3V6GA 5F04A 1SEUA 1SD4A 4MTEA 3TDUC 2IT0A 1I1SA 2BY3A 4KJZA 1TT5B 2MD0A 4LG0B 4GCTA 2LYCA 3L2CA 1H0MA 3WU1B 1GXQA 4IQ4A 3LOCA 4RAGA 3DCFA 2QF7A 4KN4X 4I6ZA 2E2JJ 2EQRA 4M71A 2E7WA 1G3SA 2JVHA
chains in the Genus database with same CATH topology
1WGXA 1D5YA 4C3JJ 3S16J 4KWAA 2FX0A 3VVXA 4DYRA 3L1PA 2YVEA 4MO7A 1JUSA 3SDGA 2LK2A 2M9HA 3KKCA 2LFBA 3KKDA 4NELA 4JNNA 2ZOYA 3VP5A 2TRTA 3HGGA 3Q0VA 1Y1WJ 1WPKA 1RETA 2LTPA 3P9TA 1GV2A 2VPRA 5C4YA 1X2NA 1MH3A 2L7ZA 4A3BJ 2DMPA 1HLVA 4ACIA 3TW7A 1P7IA 4V2GA 2WGBA 1MBGA 3E7LA 3S1NJ 1BW5A 3NRGA 1TC3C 4X1EA 2PZ9A 3HE0A 2G7SA 2LR8A 4IHWA 1GUUA 5F0HA 4IHVA 3ANPA 2WB1N 4DZJA 2QCOA 2DA6A 1QPIA 3DEWA 1FJLA 3GTOJ 4MIMA 4A3FJ 4D5CA 2QTQA 1ETKA 2FJ1A 5E3OA 2O9LA 1NK3P 3WHCA 5M3FJ 1IGNA 2WUIA 2NP5A 1OCPA 3PM1A 4FE4A 2ZCNA 1ETVA 2CQXA 2H8RA 2Y2ZA 1JGGA 3F1BA 3JRAA 1W0TA 2DTZA 2IBDA 5CW8A 1JUPA 2K9QA 4D5FA 2CJJA 3O8HA 3MN2A 3BRUA 4JX6A 4MXMA 2DA7A 1OJLA 2YUSA 1IRZA 1JTYA 3G7RA 2ID3A 4UUSA 3RKQA 3HKZN 2UXHA 4M6VA 5C3EJ 1UHSA 1XC5A 2YS9A 2E2IJ 3HTIA 2EZIA 3H3VK 2QWTA 3G56A 1FTZA 1RKWA 1SGMA 5FHPA 1IJWC 2JMWA 3BNIA 2N8GA 2XPVA 2L7MP 3K7AJ 3S15J 4JX4A 4CYCA 1U9NA 3HEFA 4HKUA 3D1NI 3S1QJ 3BCGA 3FISA 1IUFA 2DA3A 3DPJA 4M3DA 2FD5A 1NTCA 3WHBA 5M5XJ 2NVXJ 2EZKA 4BKXA 5EGOB 2DMTA 2NS7A 3SFIA 4XRSG 1FEXA 2NVYJ 5EYRA 2GBYA 2VKVA 4RDUA 4FTHA 1POGA 3B6AA 2EH3A 3GTGJ 5FGLA 3JRCA 3FIWA 5HBUA 2XB5A 1BJZA 5C4XJ 2GM4A 1JKPC 1JUMA 1XG1A 1MNMC 2O8KA 5CXGA 1AU7A 1UI6A 1MBJA 3JRFA 2O7OA 2TCTA 5EZGA 4NN1A 4AYBN 1A5JA 3CJDA 2JK3A 5DTDA 4L5EA 1JKOC 3S5RA 3O60A 4DZPA 1S7EA 4UUTA 4A69C 1TWGJ 4Y52J 1JTXA 3HIMA 4A3GJ 3QPSA 2O7TA 3FRQA 2MGQA 4M3GA 3HTHA 3S1RJ 4W97A 4RBOA 4ABZA 2UXUA 2L9RA 3S2HJ 3OSGA 2COBA 3I4MJ 2R5YB 1F43A 1UI5A 2MW8A 1WI3A 4A3KJ 2DJNA 3RZOJ 3BTIA 1QRYA 1RR7A 3BT9A 3GZIA 2M2EA 3I4NJ 2DA2A 1H8AC 4X6AJ 5D19A 3FK6A 1FIAA 3VVYA 2R7ZJ 2Y31A 3MNLA 4M3BA 2Y0SN 1IC8A 2YVHA 3BR0A 2NVTJ 5C44J 2R92J 2LKXA 1XS9A 3AQTA 3QPLA 5E3NA 2UXPA 3A02A 4UUSB 3VPRA 1MBHA 3BG5A 2M0CA 1FTTA 2G7LA 5E3MA 3IH4A 4S0HB 1TWHJ 1LE8A 2VI6A 4V2FA 3KZ9A 1U9OA 2DA5A 1W0UA 3OSFA 1GV5A 5JLWA 2RAEA 1Z0XA 2EZLA 1MH4A 3ZQLA 3QQAA 1OFCX 3RZDJ 3C07A 1HDPA 4CYCB 3JRBA 5IOYA 3LJLA 3G1MA 3A01A 4J19A 2QOPA 5M5WJ 1IG7A 1ETQA 3GTPJ 1B8IA 5GP9A 2M34A 2R5YA 3VVZA 3CRJA 4GFKA 2DMNA 4QIWN 1BW6A 2HKUA 3VUQA 1HCRA 3LWJA 3K2AA 5EDNA 3RH2A 1E3OC 3PO2J 2JA5J 2XGDA 3BHQA 2XDNA 1ETOA 2E1OA 1BA5A 1U8BA 4ICHA 1BL0A 4BY7J 1QVUA 2HI3A 2HXIA 2ID6A 4I76A 4DW6A 3JREA 3AQSA 2IEKA 1U78A 3GTQJ 5AQCA 4YZEA 1MBFA 3LSJA 4XRMA 4A93J 2B63J 2HQ5A 3EGQA 5FKNA 2XSDC 3JR9A 2Y30A 4B3AA 3FKIJ 4IHXA 2W48A 4M3FA 3LSPA 2WAQN 2IU5A 5GPCA 5H9TA 1JT6A 2KT0A 2HXOA 3W6VA 1I6HJ 4FCYA 3JRDA 2P81A 1H88C 5K7FA 1AKHA 3CQZJ 3BTCA 5K7ZA 1O4XA 1APLC 3S14J 2I10A 3LSRA 3BR2A 3GTKJ 1T33A 5FJ8J 2MG4A 2E19A 2X6OA 3RD3A 1AHDP 3ZOBA 3KNWA 1ETXA 1ZR2A 2FBQA 1F36A 1JKQC 1ZTRA 2HYJA 5FKKA 1QVTA 5M5YJ 3Q0UA 1YRNA 3BQZA 2GFNA 5IP9J 3BG3A 1ORKA 2RHAA 1B72A 4ME9A 2ME6A 2HOAA 2R93J 2VUMJ 3V78A 2V57A 3HBLA 1CQTA 3OIOA 2F07A 2CRGA 4AC6A 1K83J 2DMQA 2K40A 3TP3A 1ETWA 3ZQGA 4C2MJ 1LE8B 5FKOA 5K58A 3MVPA 4AC0A 4BXXJ 3HOYJ 2JA7J 5DAJA 1H89C 1DU6A 2K9SA 2KDZA 1G2HA 1SANA 5F08A 2Y9ZA 3BQYA 3QBMA 3G1LA 1TWFJ 4B4CA 3A01B 4IHYA 5J3LA 3E7QA 3NI7A 3HM5A 1JJ6C 3TW6A 3EUPA 5FKMA 3ON4A 2CUEA 1B8IB 3H0GJ 1UG2A 4XK4A 2D6YA 1X2MA 2JJ7A 3SJMA 4MLOA 3GTLJ 1Z77A 5FLMJ 4BBSJ 4AF5A 2D5VA 3HOVJ 3M3YJ 2X9DA 3B6CA 3FK7A 5F1JA 1RKTA 3HB9A 1DU0A 2GLOA 5HSZA 4JKZA 4XRSA 4GCKA 5JLXA 2CU7A 2GUHA 5D1RA 2W53A 2R5ZB 1MSEC 3COLA 2UXIA 1RESA 3ZQHA 4AUXA 1GVDA 1IV6A 2OPTA 3BR6A 5IYBJ 5J1RA 5EF6A 4BY1J 3GEUA 1ENHA 4JP0A 3NXCA 3S17J 2DMUA 3RQIA 3BR3A 3S2DJ 2CUFA 2LP0A 5F0CA 3O8GA 2XGCA 5HODA 5BNGA 2QIBA 2XPUA 5K7HA 4FISA 5J1UA 3JRHA 1AKHB 5IYDJ 2M8GX 5FMPA 3VW1A 3VW2A 4A3CJ 1ETYA 2LLKA 4D7NA 2DN0A 3LSGA 2ECBA 2Q24A 3BR1A 3Q3SA 2L7FP 5IPAA 2ZCMA 2JN6A 4JL3A 3HDDA 4XIDA 9ANTA 5IOZA 1YRNB 1IDYA 4D7MA 2AHQA 2HOTA 4QTRA 3TEDA 5CXIA 2HYTA 1B72B 1MSFC 2ZB9A 2AO9A 3NARA 2RASA 2X48A 2LY9A 3VIBA 3HOUJ 2ELKA 4JYKA 3BR5A 3ZQIA 1LFBA 5EG0A 2DG8A 1PUFA 2REKA 2OF7A 1GT0C 2R5ZA 4C3HJ 2ECCA 2E2HJ 4CGRA 5EFYA 2VKEA 2K9NA 3ZQCA 4DYCA 2JA8J 2ZCXA 2DA4A 1WCMJ 3JRIA 4C3IJ 2HOSA 3OOUA 3BG9A 5FKLA 1TWAJ 4A3LJ 4NDLA 3PASA 1HDDC 3T6NA 4UDSA 2OI8A 3BJBA 2ME0A 2FQ4A 2XPWA 1ZKGA 4A3JJ 2UXOA 3CWRA 1ITYA 2NOGA 4GFLA 1ZK8A 3VW0A 5DS9A 1TWCJ 2IAIA 3NAUA 3UKGA 3NPIA 2DA1A 4G12A 3IH2A 4Y7NJ 3GBGA 2NX4A 5FLVA 2PBXA 2EBIA 2XGEA 1ZGWA 3LHQA 1UMQA 4MFEA 1VI0A 3CMYA 4HNVA 1VFCA 5IP6A 1GDTA 1A6IA 1LFUP 1JKRC 4QSHA 4A3IJ 1NK2P 3M4OJ 2OERA 4MK6A 3A03A 4M3EA 3Q0WA 4A3DJ 4A3EJ 3HGYA 4MFDA 2QKOA 1ZQ3P 2R0QC 5EZHA 3HOZJ 2NS8A 2G0EA 5F27A 1T56A 3HOWJ 1R9TJ 4L62A 1FIPA 2L0KA 3ZQFA 2LVSA 1HF0A 2WV1A 5E3LA 1HOMA 2JWTA 5IYCJ 3VOXA 3TP0A 4BBRJ 1I50J 5EEAA 2LD5A 5M3MJ 1I3QJ 4A3MJ 5HAWA 3G1OA 5D18A 1MBEA 4B1RA 2HDDA 3B81A 4DYQA 3CDLA 2GENA 3HOXJ 3F0CA 2CQQA 1ZR4A 1K61A 2NP3A 1P7JA 1Q1VA 3VOKA 1VF9A 3C2BA 2H1KA 2G3BA 2ZOZA 2G7GA 1JJ8C 4GCLA 3NNRA 3IH3A 3JSJA 3PO3J 4W1UA 3GTJJ 5IP7J 3BTLA 3GTMJ 3ANGA 5EG0B 3HTJA 1MBKA 1RPWA 3ON2A 1PUFB 2EZHA 2MSYA 4FE7A 5F0FA 5GPAA 4XICA 2Y9YA 3S1MJ 3MKLA 5C4JJ 2YU9J 1EF4A 4LOCA 4JX5A 3PPBA 2PMZN 1Y1VJ 3CCYA 1IDZA 3BTJA 3V6GA 1VNDA 2XB0X 1WH5A 5F04A 2JA6J 4GFBA 3QKXA 2DG7A 2XRLA 1OCTC 2NVQJ 4GCTA 3IUVA 5J1YA 4PXIA 1SFOJ 3HTAA 4EEFG 3LNQA 3LOCA 5EGOA 3JRGA 3DCFA 2QF7A 1JT0A 1WH7A 4I6ZA 2E2JJ 2EQRA 4IEJA 3IV5A 1X58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGX A;  1D5Y A;  4C3J J;  3S16 J;  4KWA A;  2FX0 A;  3VVX A;  4DYR A;  3L1P A;  2YVE A;  4MO7 A;  1JUS A;  3SDG A;  2LK2 A;  2M9H A;  3KKC A;  2LFB A;  3KKD A;  4NEL A;  4JNN A;  2ZOY A;  3VP5 A;  2TRT A;  3HGG A;  3Q0V A;  1Y1W J;  1WPK A;  1RET A;  2LTP A;  3P9T A;  1GV2 A;  2VPR A;  5C4Y A;  1X2N A;  1MH3 A;  2L7Z A;  4A3B J;  2DMP A;  1HLV A;  4ACI A;  3TW7 A;  1P7I A;  4V2G A;  2WGB A;  1MBG A;  3E7L A;  3S1N J;  1BW5 A;  3NRG A;  1TC3 C;  4X1E A;  2PZ9 A;  3HE0 A;  2G7S A;  2LR8 A;  4IHW A;  1GUU A;  5F0H A;  4IHV A;  3ANP A;  2WB1 N;  4DZJ A;  2QCO A;  2DA6 A;  1QPI A;  3DEW A;  1FJL A;  3GTO J;  4MIM A;  4A3F J;  4D5C A;  2QTQ A;  1ETK A;  2FJ1 A;  5E3O A;  2O9L A;  1NK3 P;  3WHC A;  5M3F J;  1IGN A;  2WUI A;  2NP5 A;  1OCP A;  3PM1 A;  4FE4 A;  2ZCN A;  1ETV A;  2CQX A;  2H8R A;  2Y2Z A;  1JGG A;  3F1B A;  3JRA A;  1W0T A;  2DTZ A;  2IBD A;  5CW8 A;  1JUP A;  2K9Q A;  4D5F A;  2CJJ A;  3O8H A;  3MN2 A;  3BRU A;  4JX6 A;  4MXM A;  2DA7 A;  1OJL A;  2YUS A;  1IRZ A;  1JTY A;  3G7R A;  2ID3 A;  4UUS A;  3RKQ A;  3HKZ N;  2UXH A;  4M6V A;  5C3E J;  1UHS A;  1XC5 A;  2YS9 A;  2E2I J;  3HTI A;  2EZI A;  3H3V K;  2QWT A;  3G56 A;  1FTZ A;  1RKW A;  1SGM A;  5FHP A;  1IJW C;  2JMW A;  3BNI A;  2N8G A;  2XPV A;  2L7M P;  3K7A J;  3S15 J;  4JX4 A;  4CYC A;  1U9N A;  3HEF A;  4HKU A;  3D1N I;  3S1Q J;  3BCG A;  3FIS A;  1IUF A;  2DA3 A;  3DPJ A;  4M3D A;  2FD5 A;  1NTC A;  3WHB A;  5M5X J;  2NVX J;  2EZK A;  4BKX A;  5EGO B;  2DMT A;  2NS7 A;  3SFI A;  4XRS G;  1FEX A;  2NVY J;  5EYR A;  2GBY A;  2VKV A;  4RDU A;  4FTH A;  1POG A;  3B6A A;  2EH3 A;  3GTG J;  5FGL A;  3JRC A;  3FIW A;  5HBU A;  2XB5 A;  1BJZ A;  5C4X J;  2GM4 A;  1JKP C;  1JUM A;  1XG1 A;  1MNM C;  2O8K A;  5CXG A;  1AU7 A;  1UI6 A;  1MBJ A;  3JRF A;  2O7O A;  2TCT A;  5EZG A;  4NN1 A;  4AYB N;  1A5J A;  3CJD A;  2JK3 A;  5DTD A;  4L5E A;  1JKO C;  3S5R A;  3O60 A;  4DZP A;  1S7E A;  4UUT A;  4A69 C;  1TWG J;  4Y52 J;  1JTX A;  3HIM A;  4A3G J;  3QPS A;  2O7T A;  3FRQ A;  2MGQ A;  4M3G A;  3HTH A;  3S1R J;  4W97 A;  4RBO A;  4ABZ A;  2UXU A;  2L9R A;  3S2H J;  3OSG A;  2COB A;  3I4M J;  2R5Y B;  1F43 A;  1UI5 A;  2MW8 A;  1WI3 A;  4A3K J;  2DJN A;  3RZO J;  3BTI A;  1QRY A;  1RR7 A;  3BT9 A;  3GZI A;  2M2E A;  3I4N J;  2DA2 A;  1H8A C;  4X6A J;  5D19 A;  3FK6 A;  1FIA A;  3VVY A;  2R7Z J;  2Y31 A;  3MNL A;  4M3B A;  2Y0S N;  1IC8 A;  2YVH A;  3BR0 A;  2NVT J;  5C44 J;  2R92 J;  2LKX A;  1XS9 A;  3AQT A;  3QPL A;  5E3N A;  2UXP A;  3A02 A;  4UUS B;  3VPR A;  1MBH A;  3BG5 A;  2M0C A;  1FTT A;  2G7L A;  5E3M A;  3IH4 A;  4S0H B;  1TWH J;  1LE8 A;  2VI6 A;  4V2F A;  3KZ9 A;  1U9O A;  2DA5 A;  1W0U A;  3OSF A;  1GV5 A;  5JLW A;  2RAE A;  1Z0X A;  2EZL A;  1MH4 A;  3ZQL A;  3QQA A;  1OFC X;  3RZD J;  3C07 A;  1HDP A;  4CYC B;  3JRB A;  5IOY A;  3LJL A;  3G1M A;  3A01 A;  4J19 A;  2QOP A;  5M5W J;  1IG7 A;  1ETQ A;  3GTP J;  1B8I A;  5GP9 A;  2M34 A;  2R5Y A;  3VVZ A;  3CRJ A;  4GFK A;  2DMN A;  4QIW N;  1BW6 A;  2HKU A;  3VUQ A;  1HCR A;  3LWJ A;  3K2A A;  5EDN A;  3RH2 A;  1E3O C;  3PO2 J;  2JA5 J;  2XGD A;  3BHQ A;  2XDN A;  1ETO A;  2E1O A;  1BA5 A;  1U8B A;  4ICH A;  1BL0 A;  4BY7 J;  1QVU A;  2HI3 A;  2HXI A;  2ID6 A;  4I76 A;  4DW6 A;  3JRE A;  3AQS A;  2IEK A;  1U78 A;  3GTQ J;  5AQC A;  4YZE A;  1MBF A;  3LSJ A;  4XRM A;  4A93 J;  2B63 J;  2HQ5 A;  3EGQ A;  5FKN A;  2XSD C;  3JR9 A;  2Y30 A;  4B3A A;  3FKI J;  4IHX A;  2W48 A;  4M3F A;  3LSP A;  2WAQ N;  2IU5 A;  5GPC A;  5H9T A;  1JT6 A;  2KT0 A;  2HXO A;  3W6V A;  1I6H J;  4FCY A;  3JRD A;  2P81 A;  1H88 C;  5K7F A;  1AKH A;  3CQZ J;  3BTC A;  5K7Z A;  1O4X A;  1APL C;  3S14 J;  2I10 A;  3LSR A;  3BR2 A;  3GTK J;  1T33 A;  5FJ8 J;  2MG4 A;  2E19 A;  2X6O A;  3RD3 A;  1AHD P;  3ZOB A;  3KNW A;  1ETX A;  1ZR2 A;  2FBQ A;  1F36 A;  1JKQ C;  1ZTR A;  2HYJ A;  5FKK A;  1QVT A;  5M5Y J;  3Q0U A;  1YRN A;  3BQZ A;  2GFN A;  5IP9 J;  3BG3 A;  1ORK A;  2RHA A;  1B72 A;  4ME9 A;  2ME6 A;  2HOA A;  2R93 J;  2VUM J;  3V78 A;  2V57 A;  3HBL A;  1CQT A;  3OIO A;  2F07 A;  2CRG A;  4AC6 A;  1K83 J;  2DMQ A;  2K40 A;  3TP3 A;  1ETW A;  3ZQG A;  4C2M J;  1LE8 B;  5FKO A;  5K58 A;  3MVP A;  4AC0 A;  4BXX J;  3HOY J;  2JA7 J;  5DAJ A;  1H89 C;  1DU6 A;  2K9S A;  2KDZ A;  1G2H A;  1SAN A;  5F08 A;  2Y9Z A;  3BQY A;  3QBM A;  3G1L A;  1TWF J;  4B4C A;  3A01 B;  4IHY A;  5J3L A;  3E7Q A;  3NI7 A;  3HM5 A;  1JJ6 C;  3TW6 A;  3EUP A;  5FKM A;  3ON4 A;  2CUE A;  1B8I B;  3H0G J;  1UG2 A;  4XK4 A;  2D6Y A;  1X2M A;  2JJ7 A;  3SJM A;  4MLO A;  3GTL J;  1Z77 A;  5FLM J;  4BBS J;  4AF5 A;  2D5V A;  3HOV J;  3M3Y J;  2X9D A;  3B6C A;  3FK7 A;  5F1J A;  1RKT A;  3HB9 A;  1DU0 A;  2GLO A;  5HSZ A;  4JKZ A;  4XRS A;  4GCK A;  5JLX A;  2CU7 A;  2GUH A;  5D1R A;  2W53 A;  2R5Z B;  1MSE C;  3COL A;  2UXI A;  1RES A;  3ZQH A;  4AUX A;  1GVD A;  1IV6 A;  2OPT A;  3BR6 A;  5IYB J;  5J1R A;  5EF6 A;  4BY1 J;  3GEU A;  1ENH A;  4JP0 A;  3NXC A;  3S17 J;  2DMU A;  3RQI A;  3BR3 A;  3S2D J;  2CUF A;  2LP0 A;  5F0C A;  3O8G A;  2XGC A;  5HOD A;  5BNG A;  2QIB A;  2XPU A;  5K7H A;  4FIS A;  5J1U A;  3JRH A;  1AKH B;  5IYD J;  2M8G X;  5FMP A;  3VW1 A;  3VW2 A;  4A3C J;  1ETY A;  2LLK A;  4D7N A;  2DN0 A;  3LSG A;  2ECB A;  2Q24 A;  3BR1 A;  3Q3S A;  2L7F P;  5IPA A;  2ZCM A;  2JN6 A;  4JL3 A;  3HDD A;  4XID A;  9ANT A;  5IOZ A;  1YRN B;  1IDY A;  4D7M A;  2AHQ A;  2HOT A;  4QTR A;  3TED A;  5CXI A;  2HYT A;  1B72 B;  1MSF C;  2ZB9 A;  2AO9 A;  3NAR A;  2RAS A;  2X48 A;  2LY9 A;  3VIB A;  3HOU J;  2ELK A;  4JYK A;  3BR5 A;  3ZQI A;  1LFB A;  5EG0 A;  2DG8 A;  1PUF A;  2REK A;  2OF7 A;  1GT0 C;  2R5Z A;  4C3H J;  2ECC A;  2E2H J;  4CGR A;  5EFY A;  2VKE A;  2K9N A;  3ZQC A;  4DYC A;  2JA8 J;  2ZCX A;  2DA4 A;  1WCM J;  3JRI A;  4C3I J;  2HOS A;  3OOU A;  3BG9 A;  5FKL A;  1TWA J;  4A3L J;  4NDL A;  3PAS A;  1HDD C;  3T6N A;  4UDS A;  2OI8 A;  3BJB A;  2ME0 A;  2FQ4 A;  2XPW A;  1ZKG A;  4A3J J;  2UXO A;  3CWR A;  1ITY A;  2NOG A;  4GFL A;  1ZK8 A;  3VW0 A;  5DS9 A;  1TWC J;  2IAI A;  3NAU A;  3UKG A;  3NPI A;  2DA1 A;  4G12 A;  3IH2 A;  4Y7N J;  3GBG A;  2NX4 A;  5FLV A;  2PBX A;  2EBI A;  2XGE A;  1ZGW A;  3LHQ A;  1UMQ A;  4MFE A;  1VI0 A;  3CMY A;  4HNV A;  1VFC A;  5IP6 A;  1GDT A;  1A6I A;  1LFU P;  1JKR C;  4QSH A;  4A3I J;  1NK2 P;  3M4O J;  2OER A;  4MK6 A;  3A03 A;  4M3E A;  3Q0W A;  4A3D J;  4A3E J;  3HGY A;  4MFD A;  2QKO A;  1ZQ3 P;  2R0Q C;  5EZH A;  3HOZ J;  2NS8 A;  2G0E A;  5F27 A;  1T56 A;  3HOW J;  1R9T J;  4L62 A;  1FIP A;  2L0K A;  3ZQF A;  2LVS A;  1HF0 A;  2WV1 A;  5E3L A;  1HOM A;  2JWT A;  5IYC J;  3VOX A;  3TP0 A;  4BBR J;  1I50 J;  5EEA A;  2LD5 A;  5M3M J;  1I3Q J;  4A3M J;  5HAW A;  3G1O A;  5D18 A;  1MBE A;  4B1R A;  2HDD A;  3B81 A;  4DYQ A;  3CDL A;  2GEN A;  3HOX J;  3F0C A;  2CQQ A;  1ZR4 A;  1K61 A;  2NP3 A;  1P7J A;  1Q1V A;  3VOK A;  1VF9 A;  3C2B A;  2H1K A;  2G3B A;  2ZOZ A;  2G7G A;  1JJ8 C;  4GCL A;  3NNR A;  3IH3 A;  3JSJ A;  3PO3 J;  4W1U A;  3GTJ J;  5IP7 J;  3BTL A;  3GTM J;  3ANG A;  5EG0 B;  3HTJ A;  1MBK A;  1RPW A;  3ON2 A;  1PUF B;  2EZH A;  2MSY A;  4FE7 A;  5F0F A;  5GPA A;  4XIC A;  2Y9Y A;  3S1M J;  3MKL A;  5C4J J;  2YU9 J;  1EF4 A;  4LOC A;  4JX5 A;  3PPB A;  2PMZ N;  1Y1V J;  3CCY A;  1IDZ A;  3BTJ A;  3V6G A;  1VND A;  2XB0 X;  1WH5 A;  5F04 A;  2JA6 J;  4GFB A;  3QKX A;  2DG7 A;  2XRL A;  1OCT C;  2NVQ J;  4GCT A;  3IUV A;  5J1Y A;  4PXI A;  1SFO J;  3HTA A;  4EEF G;  3LNQ A;  3LOC A;  5EGO A;  3JRG A;  3DCF A;  2QF7 A;  1JT0 A;  1WH7 A;  4I6Z A;  2E2J J;  2EQR A;  4IEJ A;  3IV5 A;  1X58 A; 
#chains in the Genus database with same CATH topology
 3RDI A;  1D3Y A;  2FU4 A;  2GOM A;  3I3L A;  1T8I A;  3A0B C;  3FBI B;  3VVX A;  4DYR A;  3L1P A;  1FBQ A;  2W82 A;  3KZZ A;  2M9H A;  3KKC A;  2LFB A;  3K1N A;  3OYK A;  4NEL A;  2GXG A;  4NUB A;  3VP5 A;  2R4G A;  3HGG A;  1WPK A;  2EFP A;  1A6Q A;  1ZN2 A;  2BBY A;  3JTG A;  1HLV A;  4ACI A;  3TW7 A;  1O3S A;  1O7L A;  3FWE A;  4NC7 A;  4XLN F;  3C2G A;  2X6X A;  2WGB A;  3S1N J;  5H6Q A;  4RGX A;  4N4O B;  5F0H A;  4EJU A;  1HKQ A;  4IHV A;  3Q9V A;  4F3Q A;  1XMA A;  3BRO A;  4WX9 A;  4ASN A;  3OYH A;  3GTO J;  4A3F J;  3LQQ A;  1ETK A;  2EV5 A;  1YHQ I;  5M3F J;  1V5F A;  2MH9 A;  2GZW A;  2F5V A;  2VT3 A;  4L9J A;  3K4B A;  1W0T A;  3F3X A;  2OC6 A;  2IBD A;  1G59 A;  1XGN A;  4CO8 A;  4RAZ A;  3CD6 I;  2DA7 A;  4B43 A;  2KPM A;  2YUS A;  2VPL A;  1JTY A;  1QBJ A;  1NHA A;  3M1E A;  4RGU A;  2CQ7 A;  2VT2 A;  4ZC3 A;  1XD7 A;  3KEQ A;  5HS9 A;  2V6E A;  1LJ9 A;  5C3E J;  1UHS A;  2YS9 A;  4ENN A;  2QWT A;  3G73 A;  1K78 A;  1SGM A;  4UNO A;  3PQK A;  3BNI A;  3ESW B;  2XPV A;  1XN7 A;  4JX4 A;  4CYC A;  1YJ9 I;  2HFH A;  2ETH A;  1D1A A;  3HEF A;  2LY1 A;  3REO A;  4CA0 A;  4OIN F;  3FIS A;  3ZP5 A;  1XDU A;  4NQW A;  1NTC A;  3FKJ A;  2VOO A;  2EFN A;  4PGH A;  2EZK A;  3CUQ A;  2ESN A;  4BKX A;  2NVX J;  2DMT A;  2NS7 A;  3SFI A;  3TMO A;  4XRS G;  2NVY J;  5EYR A;  1FEX A;  2VKV A;  3K1M A;  3J7Y J;  2E35 A;  5L3F A;  4FTH A;  2RGV A;  3RPU A;  4EJV A;  3FIW A;  3JRC A;  1L0O C;  2MD5 A;  5DEQ A;  1FMW A;  3ERM A;  1HW2 A;  3RYP A;  4HF0 A;  2V1D A;  4U7D A;  1JUM A;  1XG1 A;  3DPT A;  5A2Q K;  2ZJQ F;  1FT9 A;  2O8K A;  1UI6 A;  3SEQ A;  2LH9 A;  2BEO A;  1YW8 A;  2J5P A;  5EZG A;  5H20 A;  2HR3 A;  1XMX A;  2JK3 A;  3MFK A;  3KEY A;  3RTR A;  4A6E A;  3KP2 A;  3HJE A;  3O60 A;  4IPA A;  4LB6 B;  4A69 C;  3W3C A;  1BR4 A;  5FB2 A;  2HEO A;  2B7E A;  3I9V 2;  3V7S A;  2V1X A;  5JVT A;  1IN6 A;  3HOS A;  4HNU A;  1ZG1 A;  4ABZ A;  1Z05 A;  1FPQ A;  3I4M J;  1L3L A;  2QLZ A;  1V4R A;  3NQO A;  1UJ8 A;  2FOK A;  3H5A A;  3QU3 A;  3IHU A;  5KHD A;  2E1N A;  3BG6 A;  2R5Y B;  4EGY A;  1F43 A;  1WI3 A;  2IGO A;  2BYV E;  3BDD A;  1ACI A;  5H2F C;  3V4G A;  3GZI A;  5DCF A;  3FZV A;  3VDX A;  5D19 A;  3FK6 A;  2QWW A;  2KIQ A;  2M7B A;  4HV5 A;  1VZ0 A;  3E5X A;  4RLF A;  4M3B A;  1IC8 A;  2YVH A;  4P96 A;  3MAJ A;  2ZXJ A;  2LG4 A;  4HOB A;  1TL8 A;  1SVL A;  2CW8 A;  2OBP A;  2W00 A;  3BOQ A;  1GXP A;  2F6C A;  4FX0 A;  1XTA A;  2PFB A;  2M0C A;  3D0S A;  2G7L A;  4V2F A;  2OUM A;  2BY0 A;  3CO7 C;  1HW1 A;  1W0U A;  2FOW A;  2IP2 A;  3QU6 A;  5JLW A;  2X85 A;  4OU0 A;  1Z0X A;  1K78 B;  1Z91 A;  2EZL A;  3M8F A;  1ON2 A;  2LSO A;  3MWM A;  2QUF A;  4BH9 A;  4CYC B;  5IOY A;  1I39 A;  3FM3 A;  1AA7 A;  2DJI A;  3BJ6 A;  2QOP A;  1B1B A;  4HF1 A;  2HQR A;  5D4S A;  3L09 A;  1HA8 A;  3CUQ B;  1B8I A;  4U9L A;  1T0F C;  4LG3 A;  3S32 A;  3CRJ A;  2HYG D;  1BN5 A;  4Y4R A;  1A31 A;  4P9F A;  1F5T A;  1BW6 A;  3M07 A;  4CXF A;  2HKU A;  3IWZ A;  3OYC A;  4OAZ A;  1HCR A;  3RH2 A;  2ZY9 A;  3PO2 J;  1X1D A;  5HNF A;  4YEL A;  5B3S H;  4HLY A;  3FXK A;  3AAF A;  2HXI A;  2ID6 A;  1VQN I;  3TO9 A;  4LGW A;  3T0Y A;  3BY6 A;  3LSJ A;  1J59 A;  1KQ8 A;  3EGQ A;  2HVQ A;  5FKN A;  3CMM A;  4MHG A;  3FKI J;  2KIS A;  2VB6 A;  4LB5 A;  5E79 C;  2W48 A;  2WAQ N;  4L18 B;  1R5H A;  2HXO A;  4XSX F;  3BP8 A;  3VOE A;  3ZMV A;  4BHC A;  4R8H A;  2DLL A;  3BTC A;  3JCU C;  3S14 J;  2BE5 F;  4PCQ A;  3BR2 A;  1T33 A;  5FJ8 J;  4UVB A;  1U5T A;  2KJC A;  2MG4 A;  2X6O A;  4L5J A;  4PJJ A;  3QOD A;  3ZN1 A;  3KNW A;  2P7V B;  3BLY A;  3FDY A;  3Q0U A;  2JPB A;  2F4M B;  3BQZ A;  5IP9 J;  3BG3 A;  2GFN A;  3AKZ A;  1Z21 A;  2CV1 A;  3JAM K;  2ME6 A;  2WA0 A;  3KYC B;  4EM2 A;  2GIV A;  2WTE A;  2DXI A;  1UHM A;  4FHT A;  2CRG A;  4LIV A;  4JK1 X;  2DMQ A;  2K40 A;  2VQC A;  3TP3 A;  4BE0 A;  3GZN B;  2JZY A;  2A6H F;  3IKT A;  2ADU A;  5FFX A;  5EEG A;  2DO7 A;  4AC0 A;  2QA4 I;  1YI2 I;  3GVA A;  4BXX J;  5DAJ A;  3FXM A;  1KYZ A;  2KDZ A;  1G2H A;  4V19 K;  2H27 A;  2YSR A;  2P4W A;  3QBM A;  3NI7 A;  5CVJ A;  4LLN A;  2IS2 A;  1S72 I;  3V8K A;  2A6T A;  1R49 A;  2OZU A;  1E2X A;  2CUE A;  5DD8 A;  5ILU A;  1X3W B;  1B8I B;  4II2 A;  2ZJR F;  3JSO A;  4XK4 A;  4Z2Y A;  4U7B A;  2D6Y A;  2A6E F;  3ASO H;  3GTL J;  1P9Q C;  3SZG A;  1I27 A;  1K4T A;  3DPU A;  4ZDL A;  2A5Y B;  2EA4 A;  3HOV J;  2NYX A;  1IN4 A;  4G8X A;  3B6C A;  3CP2 A;  5F1J A;  1RKT A;  5HSZ A;  4JKZ A;  3IWF A;  1XB4 A;  4IHT A;  1Z1D A;  5JLX A;  2V79 A;  2DK5 A;  2CU7 A;  5LRS A;  1TQM A;  5D1R A;  5JHU A;  2H94 A;  3KZY A;  1OIS A;  2UXI A;  3SEZ A;  2RNG A;  2PFV A;  3ZQH A;  4AUX A;  1VQL I;  3GYH X;  1VQM I;  5J1R A;  2QQ9 A;  2O03 A;  2IJL A;  4JP0 A;  3ZMS A;  2DMU A;  5J47 A;  1DP3 A;  2EPF A;  3O8G A;  4ZZD A;  4GXO A;  5A2Q Z;  2VLA A;  2QIB A;  2XPU A;  1TBX A;  2XIG A;  4FIS A;  3A4C A;  1ETY A;  1IRX A;  2LLK A;  1YX5 A;  5FFZ A;  1PVE A;  4B09 A;  4P9U A;  1U5T B;  3K8P C;  4ETS A;  2XKP A;  4I02 A;  2X1E A;  4XQF A;  4I98 B;  2RN7 A;  4FET A;  2Z16 A;  1S3J A;  3QYE A;  5IPA A;  2ACJ A;  3VYT B;  5L3C A;  9ANT A;  4IRH A;  3DF8 A;  1OCC H;  2ZME B;  3WU2 C;  3DV8 A;  3SZP A;  2HZD A;  2L3D A;  3W2A A;  3CP8 A;  4Y13 A;  2DT5 A;  3MZH A;  3TED A;  2E36 A;  3OL4 A;  5CXI A;  4GCV A;  4NC6 A;  3F72 A;  1D0X A;  2IA0 A;  2R7O A;  3L00 A;  3BJA A;  2I8D A;  2RAS A;  4I2O A;  4RGR A;  3VIB A;  3HOU J;  2EA2 A;  4YFX F;  3WGH A;  1C0W A;  2DG8 A;  2TDX A;  4EJT A;  1SD6 A;  2AQF A;  2EIK H;  4O6J A;  4Y15 A;  2QSH X;  2ECC A;  1XGM A;  2DBB A;  1FBS A;  2YPR A;  4HPQ A;  4CGR A;  3DBH B;  3KPH A;  4FT8 A;  2M0M A;  4M73 A;  3EET A;  1DDN A;  3DTK A;  3JRI A;  2XDV A;  1W4M A;  3OOU A;  3BG9 A;  2OAZ A;  1TWA J;  4A3L J;  4UB8 C;  2B3W A;  2O3F A;  4NDL A;  4KMU X;  1HDD C;  3CO6 C;  2O61 A;  3T6N A;  5DUI A;  5HNH A;  3BJB A;  1VTN C;  4RB1 A;  2ME0 A;  3FHZ A;  2LKS A;  1U5T C;  4A3J J;  1ZKG A;  2DFI A;  2IXS A;  1ITY A;  2NOG A;  1XX5 A;  5D8L B;  1Y6I A;  2FE3 A;  5ED4 A;  4HA8 A;  4RS8 A;  1OQY A;  2VON A;  4ENJ A;  2DOE A;  3B73 A;  3F6O A;  1QU3 A;  2ISZ A;  3SZT A;  4RB0 A;  3NPI A;  3IH2 A;  2HU9 A;  2NX4 A;  2MH2 A;  5ILV A;  1IXS B;  2VBZ A;  4CCL A;  1STZ A;  1MD0 A;  1V54 H;  3FXQ A;  1ZGW A;  4OMY A;  3LHQ A;  4GYG A;  3C18 A;  2WAE A;  3CCQ I;  1VFC A;  4RAY A;  2JSC A;  3F8B A;  4L9N A;  4OOI A;  5BMZ A;  2DTR A;  2WV0 A;  4P5O A;  3OYE A;  3M4O J;  3PFI A;  4M3E A;  3HGY A;  5JI6 A;  4KIC A;  2QKO A;  2LMD A;  1MNE A;  2YU3 A;  1ZQ3 P;  1HKT A;  2DCE A;  5EZH A;  2Y48 A;  2NS8 A;  2GA1 A;  1T56 A;  2ZXI A;  3GME A;  4IZZ A;  1FIP A;  3ZQF A;  1HOM A;  3BZ6 A;  1ZGJ A;  2WAD A;  3CF2 A;  3VB2 A;  5DDG A;  3VOX A;  1EA3 A;  4EMS A;  4XMY A;  4XLA A;  1MKM A;  2LD5 A;  2PMZ A;  1MMN A;  3KE2 A;  1KU7 A;  1ZGA A;  3F9K A;  4XNF A;  4IKF A;  1DGR M;  5HAW A;  3J7A O;  1KU3 A;  2O8X A;  3G1O A;  2K5C A;  2YVX A;  5GAE J;  5DM7 F;  2UV1 A;  4Y3O A;  2GEN A;  3CJN A;  3SWH A;  3M8J A;  5CPR B;  5HS8 A;  4S05 A;  4WK8 F;  4MEY F;  1IN8 A;  4XKW A;  4DQ2 A;  3C2B A;  2H1K A;  5IY5 H;  2KJB A;  1MMD A;  4RB2 C;  3NNR A;  1P2F A;  3PO3 J;  1MMA A;  3OR1 C;  1O3R A;  1MBK A;  4CUG A;  4PUS A;  1RPW A;  3I58 A;  2DQR A;  3FBN B;  1D1B A;  2HGC A;  1W36 D;  5GPA A;  4LLL A;  2ZFU A;  3A2K A;  2YU9 J;  4U9N A;  1P4W A;  2VBX A;  3BTJ A;  4K2E A;  1VND A;  1R5I D;  2XKO A;  3JAM Z;  4XLP F;  5HDK A;  1OCT C;  5GAH J;  2QM3 A;  3TKY A;  1LQ1 A;  4MNU A;  5J1Y A;  2BVL A;  1R00 A;  3BJO A;  1XGO A;  3TQN A;  3HTA A;  1O3T A;  3KYD B;  4RAF A;  3MKZ A;  5EGO A;  2Z3Y A;  4UUV A;  1X19 A;  1WH7 A;  5GTH C;  2CFX A;  2MBF A;  4HX7 A;  3SFZ A;  2OA4 A;  3OYN A;  5FLX K;  3IV5 A;  1KGS A;  4BXU A;  3R0J A;  4O3M A;  1D5Y A;  2R7W A;  3LWF A;  1P4A A;  2DOD A;  2V7F A;  1DGW Y;  2L4M A;  2XRN A;  4BQQ A;  4IRI A;  3TOB A;  3ZCO A;  1LKX A;  1UST A;  2XHK A;  3KKD A;  4YIR X;  2NVU B;  1DPU A;  2M4G A;  1WRJ A;  4F55 A;  3O2P E;  1GV2 A;  2VIX A;  1MH3 A;  3OV8 A;  3BCA A;  3L7W A;  4CCN A;  4A3B J;  1B6A A;  3MZY A;  4QWQ A;  2YR2 A;  3RIR A;  2V9V A;  4V2G A;  3I56 I;  3VEP A;  3KP3 A;  1UFM A;  4MEX F;  4KDP A;  1MBG A;  5CJ9 A;  4KA4 A;  1WZ2 A;  4CYD A;  3NRG A;  1TC3 C;  2PZ9 A;  2K7L A;  3OYJ A;  3HE0 A;  2QKL B;  1PYV A;  2LR8 A;  4ZYH A;  1GUU A;  3K70 C;  3HRT A;  4IHW A;  5DM6 F;  4XL9 A;  5F1R A;  3K4L A;  1K7A A;  2QCO A;  4KIT B;  3IL2 A;  2FNA A;  3ABL H;  3GFI A;  3DEW A;  5LGU A;  5IT9 Z;  3JTH A;  1SD5 A;  2V4J C;  4Y17 A;  5E3O A;  4ESJ A;  2RQP A;  2Q8K A;  3WHC A;  1IGN A;  3HOT A;  1VQ5 I;  4UHT A;  3PM1 A;  1FOW A;  2H8R A;  5BPI A;  2Y2Z A;  3PSI A;  3F1B A;  2CGP A;  4D1Q A;  2K9Q A;  4D5F A;  1N25 A;  1X3Z B;  3BRU A;  2K4B A;  4JX6 A;  1DQU A;  2VJI A;  4IRG A;  4ZDP A;  3L9F A;  3SYT A;  3KP7 A;  1ZRF A;  3VSL A;  4HQE A;  1D5V A;  4M6V A;  1E3H A;  3W2V A;  2E2I J;  2LF7 A;  3HTI A;  2EZI A;  1OMI A;  3P9I A;  5TGT A;  2RV8 A;  4KFC A;  1FTZ A;  5L3D A;  3S3O A;  3GCM A;  3K7A J;  3S15 J;  1EH6 A;  1U9N A;  4HKU A;  1XSX A;  3VFZ A;  2A5W A;  1W7P A;  4M3D A;  4A5N A;  4F93 B;  1N77 A;  2EIJ H;  4UVC A;  5CVV A;  5M5X J;  3ABT A;  5EGO B;  4BDZ A;  1LB2 A;  3QWL A;  3KYL A;  3V42 A;  1R6R A;  1QZZ A;  3CF5 F;  2IW5 A;  4WXC A;  1BJZ A;  1Z3Y A;  3ZQ7 A;  1JKP C;  2ICW G;  1MNM C;  1AU7 A;  1MBJ A;  4ZYD A;  1TQI A;  2Q2E B;  1JKO C;  3GUD A;  2F2E A;  1U2W A;  1OYI A;  2FXA A;  3S5R A;  1WJC A;  3UNG C;  4M72 A;  2QEN A;  4LMY A;  2VJ4 A;  2M4K A;  2MC3 A;  4Y52 J;  1JTX A;  1Y0U A;  4I01 A;  2PI0 A;  3RCO A;  2FBK A;  1Y0N A;  2Z9O A;  1OCZ H;  2HOE A;  3FRQ A;  4E4H A;  3ONQ A;  3C3W A;  1R4N B;  4HX4 A;  4MGR A;  4W97 A;  4RBO A;  2E7X A;  3OIP A;  4ZH4 F;  1MJA A;  4BAY A;  1BC7 C;  1SD7 A;  4PZJ A;  4EM0 B;  1UI5 A;  3RJP A;  4A3K J;  2DJN A;  2M8E A;  3E5U A;  5GAD J;  1XSV A;  3F8F A;  1RR7 A;  1QZY A;  5KK1 A;  4IOC F;  2X1C A;  3S8P A;  4BXF A;  4X6A J;  3DKY A;  1EH7 A;  2UUZ A;  5J4Y A;  5J8F A;  1YO5 C;  2E1M C;  2M7A A;  3MNL A;  1FZP B;  2P6S A;  3BR0 A;  3I71 A;  5C44 J;  2WAF A;  2F5E A;  2ZJP F;  2LKX A;  1XS9 A;  3QPL A;  3TDZ C;  4Q47 A;  5E3N A;  1ERD A;  3VPR A;  4HNT A;  3DEE A;  1X4O A;  1JI8 A;  1LE8 A;  2DPD A;  2KDO A;  3CUO A;  3FXO A;  3DQV C;  3HPH A;  1OFC X;  2H1L A;  3C07 A;  5FO5 A;  1KA8 A;  3JRB A;  1W7P B;  2ZJ2 A;  2D45 A;  5M5W J;  4N9I A;  3WTT C;  2WAQ A;  3GFJ A;  1BIB A;  2E1C A;  3R4K A;  3QP6 A;  5GP9 A;  2R5Y A;  2DPU A;  2KMU A;  3K1P A;  2KIF A;  2PBI A;  3P9K A;  1WSU A;  3U1D A;  2VE8 A;  4XLE A;  4BJT A;  3EUH C;  2V1U A;  2CW7 A;  3RKX A;  3KZI C;  3H9J A;  3WTX C;  2QBY B;  5HLT A;  2HDW A;  2XF6 A;  3I59 B;  1BL0 A;  1MJ9 A;  2HKX A;  3W6J B;  1Y8Q B;  2HI3 A;  3LFU A;  4I76 A;  4MTD A;  3AQS A;  5AQC A;  3GTQ J;  4XRM A;  2B63 J;  1XCV A;  3R6S A;  5HVQ C;  4YEJ A;  5CVR A;  2Y30 A;  4KIS A;  3DEU A;  4B3A A;  4IHX A;  5FLX Z;  4F92 B;  4AD9 A;  4GRI A;  3CDH A;  5GPC A;  2KT0 A;  2CS3 A;  3ULQ B;  1Z6T A;  1BR2 A;  2H6C A;  2P81 A;  1H88 C;  5HLI A;  1O4X A;  2M5W A;  1OR7 C;  4RM3 A;  2VC1 A;  3CCR I;  3VYS B;  2XAQ A;  4Q48 A;  1BBY A;  1SMT A;  1AHD P;  1K4S A;  3ZOB A;  1MDM A;  4PFP A;  5EEH A;  1IO2 A;  1T6S A;  1LDD A;  3V8J A;  2RRE A;  2ZCW A;  2Z99 A;  3AG2 H;  1T98 A;  2QZ8 A;  3PL8 A;  1B72 A;  2LOO A;  3HTU A;  2HOA A;  2VUM J;  3V78 A;  2QQA A;  4PJ0 C;  4BL0 B;  3GZ5 A;  3OIO A;  2K9L A;  1SFX A;  1VQ8 I;  4XLH A;  3OS0 A;  4AC6 A;  1LE8 B;  3CJT B;  5FKO A;  3J7A Y;  3TOA A;  2R7T A;  5K58 A;  2JA7 J;  3HSE A;  1H89 C;  1YFH A;  1G8X A;  1LUJ B;  1SFU A;  5LHI A;  3DWL E;  4ESB A;  5E18 F;  3BQY A;  5TIS C;  4E7S A;  3G1L A;  2BXZ A;  2UWM A;  1R71 A;  1A04 A;  1MGT A;  4XOR A;  3OYA A;  2MYS A;  5B1A H;  3HM5 A;  2B1E A;  3HYI A;  5FKM A;  3EUP A;  2ZSI B;  3ON4 A;  3X2Q H;  1Y8R B;  2IRF G;  5BQT A;  1LFP A;  1D8K A;  5LEK A;  3G4S I;  2DK8 A;  3CLO A;  4MLO A;  1Z77 A;  5FLM J;  1G3W A;  1R1U A;  4BBS J;  3OYI A;  1MMG A;  2BVM A;  2CFO A;  4KMF A;  3FHN A;  3M7G A;  4LD5 A;  2QQ8 A;  5TJJ A;  1VQO I;  2W53 A;  2R5Z B;  3W2W A;  1MSE C;  4BJ5 C;  5K5R A;  3QP5 A;  4HW0 A;  1RES A;  4BE1 A;  3RI4 A;  3G3Z A;  1GVD A;  3DPL C;  2XGX A;  1LVK A;  4B47 A;  1T2K A;  2OPT A;  3LL7 A;  5IYB J;  3E1S A;  2HTS A;  3WTU C;  3QYF A;  1N78 A;  3OY9 A;  2BY1 A;  4XOP A;  4H0E A;  4D0P A;  2BHY A;  2R7X A;  3M1C A;  1FLI A;  5BNG A;  3S3M A;  1RUO A;  2LDU A;  5FMP A;  5HLH A;  3KP6 A;  3RPQ A;  3DKX A;  2DN0 A;  2VQL A;  3ABM H;  1X1B A;  2NAZ A;  3IUO A;  4HV6 A;  4HX8 A;  4MQ9 F;  1WJA A;  3Q3S A;  2BV6 A;  1YQA A;  4BQN A;  1MDM B;  3HTS B;  2DAO A;  4L0Y B;  2ZC2 A;  1TLH B;  3D5S C;  4JL3 A;  1QHG A;  4XID A;  4C9Y A;  1YIJ I;  1B9N A;  5IOZ A;  4M6Y A;  3S93 A;  1LEB A;  2GAU A;  4D7M A;  1B72 B;  1MSF C;  2ZB9 A;  1V5G A;  2AO9 A;  3ABK H;  3WTS C;  3AG4 H;  3WGI A;  3RKY A;  3ZQI A;  3ROU A;  2NRA C;  5AIP A;  4XN0 A;  3ECO A;  5E1W A;  2OF7 A;  3K4M A;  3U1K A;  2OV7 A;  3Q5F A;  4XKC A;  2VKE A;  4Z6Y A;  3V7R A;  2JA8 J;  5FD5 A;  1TNT A;  2L54 A;  3GO5 A;  3WG7 H;  1EH8 A;  2OCE A;  3EYI A;  2JTV A;  2F4O B;  4B8X A;  4C3I J;  4YFK F;  2F48 A;  2Z33 A;  3H9Q A;  2X6Y A;  1R36 A;  4S04 A;  4CHU A;  2OI8 A;  5KVR A;  2FQ4 A;  2UXO A;  2ZXH A;  3CWR A;  5IT3 A;  4PJL A;  3KFW X;  4GFL A;  5ERI A;  4E7K A;  1TWC J;  2M87 A;  1VQ6 I;  3CJQ B;  3NAU A;  3CUQ C;  3UKG A;  2K86 A;  2J5O A;  3OIQ A;  5DD4 A;  4KN7 X;  2GXA A;  3GBG A;  4OD5 A;  2ESH A;  5FLV A;  2CO5 A;  2ZME A;  2P7C B;  2EBI A;  2PBX A;  2XVC A;  2EFW A;  1T08 B;  4MFE A;  4F52 A;  5ILS A;  1OKR A;  3OS2 A;  1LPQ A;  4A3I J;  2KKO A;  4IJA A;  4AYB A;  2MAB A;  3L2R A;  2NNN A;  4A3E J;  4KIB A;  1J2X A;  5F27 A;  3ZMU A;  5FRO A;  3QRF F;  1FX7 A;  1R9T J;  4L62 A;  5CVU A;  1HF0 A;  2RNJ A;  2ZSH B;  5IYC J;  3LAP A;  3E97 A;  3K70 D;  1X58 A;  1FBU A;  1I3Q J;  1FOK A;  3CC7 I;  3E6M A;  3HSF A;  3C2H A;  4ZTF A;  1FWZ A;  3BZK A;  3IAM 2;  3KP5 A;  4E6K G;  4DYQ A;  2A61 A;  2VN2 A;  1ZR4 A;  2EK5 A;  1K61 A;  2NP3 A;  1P7J A;  3ABU A;  3VOK A;  4HG2 A;  5D5X B;  2G3B A;  1JJ8 C;  4GCL A;  3KIO A;  4IHS A;  2X0L A;  3JSJ A;  4PSW A;  4OIO F;  3Q9S A;  3GTM J;  2KP6 A;  3H92 A;  3ANG A;  4YRV A;  4BU2 A;  1IF1 A;  4DOZ A;  3DU6 A;  1IN5 A;  2EZH A;  5L3G A;  2MSY A;  3CCU I;  1OLT A;  4XIC A;  1ZRC A;  3HPG A;  3MKL A;  4LOC A;  2FMY A;  1RR8 C;  1GHC A;  4OMZ A;  2OD5 A;  4FAS D;  4WF2 A;  2K02 A;  3R61 A;  2NNY A;  2XB0 X;  1WH5 A;  5FRN A;  2RC4 A;  1BI3 A;  4CGZ A;  4BDY A;  3QKX A;  3HUG B;  2XRL A;  2L01 A;  5HDG A;  3SHF A;  4ENM A;  3VYU B;  2JVG A;  2CG4 A;  3T5X A;  2KZV A;  2QGU A;  3E6C C;  2HVR A;  2NVQ J;  3IUV A;  3DKW A;  4PXI A;  2NS0 A;  1G3Y A;  2V9K A;  5TRD A;  2XV4 S;  5DUK A;  3OYL A;  2M45 A;  1H9G A;  4XKV A;  2JQ7 A;  5LD2 C;  4BYY A;  5K1Y A;  2LF8 A;  1S7O A;  1S6L A;  4C3J J;  2CSO A;  3S16 J;  3KCC A;  4KWA A;  3HIF A;  2JPC A;  2R7R A;  2FX0 A;  1PDN C;  4IQJ A;  2GQQ A;  3GLX A;  3WE2 A;  4U88 A;  2CV2 A;  1D1C A;  1JUS A;  3R60 A;  4XN3 A;  3SDG A;  1ZG3 A;  3AL0 B;  2VBW A;  5H6R A;  4UVA A;  4RMN A;  2ZOY A;  5EJC A;  2TRT A;  2A07 F;  1F9N A;  3E6D A;  3PUB A;  3Q0V A;  4HYE A;  2LTP A;  1XGS A;  5C4Y A;  1IZ1 A;  5LFA A;  3HXL A;  2L7Z A;  1IN7 A;  2XAJ A;  3BG7 A;  1KQ0 A;  2LRD A;  3FXJ A;  5BS6 A;  4HDU A;  3ZMT A;  1ZEL A;  1WWX A;  3E7L A;  2CUZ A;  4ZYG A;  1BW5 A;  1HC8 A;  4X1E A;  1HXD A;  2G7S A;  2BZT A;  1FNN A;  3ANP A;  3N97 A;  4C2U A;  2W57 A;  2WB1 N;  1TQP A;  2DA6 A;  4L9V A;  3CC2 I;  1QPI A;  1FJL A;  4MIM A;  1TT0 A;  4ANJ A;  2FJ1 A;  2W1O A;  1NK3 P;  1HW5 A;  2RDP A;  4A0X A;  4FE4 A;  4OIQ F;  2ZCN A;  2CQX A;  1JGG A;  4JBA A;  3JRA A;  2DTZ A;  1Z6R A;  3OMY A;  3NWS A;  2B9S A;  3AG1 H;  1O57 A;  2CJJ A;  3F22 A;  2D2W A;  4U87 A;  1N75 A;  2LBF A;  2ZME C;  4C2M A;  3AFH A;  4EV0 A;  2QVO A;  1MMS A;  3VTI A;  2KL4 A;  3LSI A;  4BQO A;  2GOX B;  1X4P A;  4I09 A;  4OIR F;  3CCJ I;  3JSP A;  3OYB A;  3H3V K;  4I0B A;  3F21 A;  3LFK A;  2HDC A;  1RKW A;  3H36 A;  1Z3X A;  2G7H A;  2JMW A;  1IJW C;  5JFR A;  2EWN A;  2LKP A;  4E7J A;  3D1N I;  3S1Q J;  1RIO H;  3BCG A;  4NHJ A;  1B59 A;  2A69 F;  2DA3 A;  3QAH A;  2FD5 A;  5CVI A;  2DT7 B;  2K3F A;  3IAS 2;  2GBY A;  2L2O A;  2V1N A;  3DTE A;  4RDU A;  1POG A;  3B6A A;  3GTG J;  5HBU A;  2FBH A;  2KQR A;  4N4N B;  2FSW A;  4UXN A;  4EQQ A;  5CYV A;  2FRH A;  5C4X J;  2GM4 A;  1FP1 D;  4PGG A;  1KU2 A;  4GGG A;  2ZXW H;  1GVJ A;  2PMH A;  3JRF A;  4DJA A;  2O7O A;  3C1D A;  4WWC A;  3PQJ A;  4AYB N;  1ULY A;  1H9T A;  3RYR A;  4L5E A;  5LRR A;  3ZGK A;  4J01 A;  4NB5 A;  4UV8 A;  3PSF A;  3TO7 A;  1S7E A;  4DZP A;  3GX4 X;  3KEO A;  1TWG J;  3HIM A;  4A3G J;  1LDJ A;  3ZXS A;  3QPS A;  5D5U B;  2KIM A;  4HLX A;  1ZLJ A;  4L0Z B;  3S1R J;  4DBR A;  4PFO A;  3HRS A;  2W84 A;  2UXU A;  3FXU A;  3S2H J;  4LIT A;  5LGT A;  1WHU A;  5KAI C;  4M9S A;  1UAA A;  2P8T A;  1FYM A;  1IW7 F;  1W5S A;  2F4I A;  4YG2 F;  5LHH A;  3RZO J;  4OD4 A;  3VOD A;  5E8I A;  3LQR A;  2JA2 A;  1I5Z A;  4KT5 C;  2GIZ A;  4ZDO A;  3I4N J;  2DA2 A;  1H8A C;  2JRT A;  2UZK A;  2FJI 1;  1R7J A;  1X1C A;  4EVI A;  1UCR A;  2R7Z J;  3VVY A;  1VQ7 I;  4E7L A;  3E6B A;  3TGN A;  2Y0S N;  2CH0 A;  2R3S A;  3KLO A;  2R92 J;  2LBF B;  3AQT A;  4U0Y A;  1YJN I;  1PP7 U;  1J5Y A;  3LSH A;  3COA C;  1BR1 A;  1J9I A;  1UEL B;  1QPM A;  3BG5 A;  4YII A;  5D5W B;  1VQ9 I;  1FTT A;  5E3M A;  1NH3 A;  4S0H B;  2Q2E A;  3EPZ A;  2VI6 A;  3ZR8 X;  1U9O A;  2DFH A;  5LGN A;  3ZMD A;  2BXY A;  1PP8 F;  3HSR A;  1ZRD A;  1U8R A;  2Z2S B;  2KLO A;  2JT1 A;  3RZD J;  1W1W E;  2L02 A;  1HDP A;  1MIJ A;  3BPX A;  3KET A;  4AVZ A;  1YE9 A;  3L2W A;  3A01 A;  1B9M A;  1AWC A;  1I3A A;  2KRC A;  4MQV A;  2IA1 A;  3GTP J;  2QKM B;  1X3U A;  1Z67 A;  4KIG A;  1RI7 A;  1IXR C;  4YFN F;  4UY8 I;  1MJB A;  4GFK A;  3LWJ A;  5AON A;  5EDN A;  4HEA 2;  3ERE D;  1E3O C;  2JA5 J;  4TV7 A;  2XGD A;  1VQ4 I;  1EKE A;  2XDN A;  2P5L C;  3A1Y A;  2E1O A;  1BA5 A;  4AM3 A;  3K4N A;  1T39 A;  1E17 A;  4BY7 J;  4HF2 A;  2PEX A;  3CDI A;  1K6O A;  4EJW A;  1U78 A;  3DXJ F;  4YZE A;  4A93 J;  2ELJ A;  1I6X A;  2CMP A;  2G7U A;  4BNC A;  2IU5 A;  5H9T A;  2HZT A;  4E70 A;  3W6V A;  3HZJ A;  2H8W A;  5ICE A;  1AKH A;  5K7F A;  3J7Z I;  1APL C;  5B66 C;  2IS6 A;  2I10 A;  3LA7 A;  3LSR A;  4LK1 F;  1E3P A;  4KIF A;  2E19 A;  3WTV C;  2HQN A;  3RD3 A;  4ZZL A;  1ETX A;  2G9W A;  2FBQ A;  2HYJ A;  5FKK A;  1SAU A;  2X1D A;  5M5Y J;  5J4V A;  3H3Z A;  3ELK A;  1DP7 P;  2BW3 A;  1Z7L A;  2M1B A;  1ORK A;  2RHA A;  1K6Y A;  4CZC A;  4ME9 A;  4QPQ A;  3PNT A;  3MKW B;  2V57 A;  4OAY A;  3CMA I;  2CW0 F;  2QQB A;  1WFX A;  4BAC A;  3FXR A;  2QBY A;  3I59 A;  2F07 A;  2CV0 A;  1K83 J;  1BOA A;  1OCR H;  3QPH A;  4M6X A;  1ETW A;  2FEZ A;  4M74 A;  4C2M J;  4Y33 A;  3QPT A;  2JSP A;  2F5C A;  1ZRE A;  2DOA A;  2OQG A;  2ZNY A;  1JGS A;  2Y9Z A;  4JOM A;  2MA3 A;  4B44 A;  3IRQ A;  1P6R A;  3A01 B;  4CIC A;  5J3L A;  4EM1 A;  3LSM A;  1J7K A;  1E0E A;  1JJ6 C;  3TW6 A;  3PNY A;  3PIO F;  2AQE A;  2VKD A;  3H0G J;  2IA2 A;  1YW7 A;  4G7H F;  3KP4 A;  4P1W A;  4X0G A;  1YS6 A;  1X2M A;  5J40 A;  2STW A;  2X4H A;  3ZPL A;  1MND A;  2CQK A;  3M3Y J;  3DP7 A;  5F6F A;  5ICC A;  2X9D A;  1DU0 A;  4UV9 A;  3HB9 A;  2GLO A;  1WJ5 A;  4XRS A;  2XAG A;  4ZJZ A;  4QLC U;  3RPU D;  4FQG A;  3SDB A;  3COL A;  2Q1Z B;  2D1H A;  2XF7 A;  1OYY A;  3GFL A;  2LNB A;  1IAW A;  3FMQ A;  5FD6 A;  2MFZ A;  3BR6 A;  4BY1 J;  3GEU A;  3NXC A;  3F8C A;  3RQI A;  3F8M A;  5ICF A;  5F0C A;  2HQA A;  2XGC A;  3MQ0 A;  5HOD A;  4RA2 A;  1AKH B;  4N9H A;  5J1U A;  3FXL A;  2IGM A;  4WXD A;  3VW1 A;  1FY7 A;  4A3C J;  2HVS A;  1REP C;  3GW2 A;  3LSG A;  2ZKZ A;  4CCO A;  2Q24 A;  4C2T A;  4E7I A;  2JN6 A;  3K2Z A;  4HSR A;  3W6K B;  1BJA A;  1YJW I;  5D8K B;  4G6T B;  1ZAR A;  4IRV A;  2BW3 B;  1IDY A;  2H6B A;  4QTR A;  3EUA A;  1BM9 A;  1JHF A;  2IPQ X;  1V5E A;  2AXL A;  3WE3 A;  2Z1D A;  4XLC A;  3E0J B;  3SXY A;  4IO9 F;  4HRI A;  3JW4 A;  1OPC A;  2I5U A;  1LFB A;  4LJZ F;  2HWV A;  2R5Z A;  4HST A;  5E17 F;  4XLF A;  3HKZ A;  2Z5U A;  3N05 A;  1WQ2 A;  2K9N A;  1YIO A;  2VJJ A;  2ZCX A;  2DA4 A;  3I53 A;  2DT6 A;  4ZYE A;  1WCM J;  1W5C C;  2ISY A;  3K4C A;  1T0F A;  3GFM A;  5FKL A;  4R79 A;  3VYR B;  3PAS A;  3J81 K;  2WC2 A;  2FF4 A;  1ON1 A;  2OQR A;  4A0Y A;  3EQL F;  3OYM A;  4UDS A;  3PFY A;  1RRJ A;  1TW2 A;  2XPW A;  3BPV A;  2L9N A;  2MLK A;  4A6D A;  3D5L A;  5BPD A;  1ZK8 A;  3VW0 A;  3P9C A;  3H1C A;  4BUP A;  2EV0 A;  4II3 A;  5K5Q A;  4Q4Z F;  3P5J A;  2HPI A;  1JE8 A;  3BWG A;  4KT6 A;  2L4A A;  1W36 C;  3T1B A;  1KU9 A;  2JRM A;  4BS9 A;  1FSH A;  2XSJ C;  4O5V A;  1IXC A;  3CES A;  3R0A A;  3NEU A;  4G9Y A;  2GA2 A;  5IP6 A;  1NK2 P;  1JKR C;  4QSH A;  2DDA A;  1KQ9 A;  2OER A;  3A03 A;  3L2Q A;  3Q0W A;  4A3D J;  3LSK A;  3CCL I;  2R0Q C;  1QNT A;  4AWX B;  3HOZ J;  2B0L A;  2G0E A;  1Y39 A;  3HOW J;  2BHZ A;  3CZ6 A;  3ZQQ A;  2L0K A;  2LVS A;  1QO0 D;  2BY2 A;  5E3L A;  2LY2 A;  4ZYA A;  4Q5S F;  1MZB A;  2NXN B;  3TP0 A;  4BBR J;  4A3M J;  1S29 A;  5M3M J;  1TNS A;  4L5I A;  3ML6 A;  5BOX A;  2XAH A;  4I99 C;  1T38 A;  5D18 A;  4B1R A;  3ASN H;  1FOY A;  1QHH D;  3WGG A;  3RQ4 A;  5KAF C;  4BE2 A;  3CDL A;  2EB7 A;  3K4K A;  4RGS A;  2KRH A;  3HOX J;  3I4P A;  1F1Z A;  2ZBK A;  1Q1V A;  2CWE A;  3T8T A;  3I55 I;  2G7G A;  5F64 A;  2V26 A;  4EAT A;  4W1U A;  1ZHF A;  2XUB A;  1SFE A;  1YG2 A;  2M3A A;  3BTL A;  3GTJ J;  3HTJ A;  2QYO A;  1P4X A;  4KNY A;  1A36 A;  2E34 A;  4FE7 A;  5F0F A;  3GZ6 A;  3S1M J;  1EF4 A;  5C4J J;  3PPB A;  4WIB A;  4JX5 A;  4XM3 A;  3CME I;  4BEH A;  5JVG F;  1Y1V J;  2DFE A;  4CCM A;  1S5L C;  5KCM A;  2R7V A;  2JA6 J;  2R7F A;  4GFB A;  2DG7 A;  3K69 A;  2EFO A;  1LDK B;  5DV5 A;  1BI2 A;  1SFO J;  4EEF G;  3LNQ A;  4BHP A;  2M30 A;  2W4S A;  4AU7 A;  4IXA A;  3JRG A;  1JT0 A;  1F4K A;  3N4M A;  2L7K A;  2X6W A;  1HBX G;  4IEJ A;  2DDB A;  5CKT A;  1WGX A;  2WB1 A;  1DUX C;  5D5V B;  3KLN A;  1BOB A;  5B5E C;  5D6F A;  2IS1 A;  2YVE A;  4MO7 A;  1GLN A;  2LK2 A;  3ZRG A;  4C30 A;  4JNN A;  1Y1W J;  2XAS A;  1FYK A;  1R1V A;  1RET A;  3P9T A;  2VPR A;  1X2N A;  2EIN H;  4HBL A;  2DMP A;  4XOT A;  3F8N A;  2VL8 A;  3O6B B;  1P7I A;  3BZC A;  1T95 A;  2F5D A;  3DLA A;  2XRO A;  4NQW B;  1WJB A;  3F23 A;  3MMY B;  2RKH A;  3J80 K;  2DFF A;  4KUM A;  4DZJ A;  1FYL A;  4PK4 A;  3HUG A;  5AIQ A;  5HOO A;  4M9X A;  1M1E B;  3QOP A;  1Z9C A;  4D5C A;  2NOJ B;  3CC4 I;  2QTQ A;  1P92 A;  1AOY A;  2O9L A;  4G7Z F;  2WUI A;  2NP5 A;  1OCP A;  3FMS A;  4QPO A;  1ETV A;  1S9H A;  1EV7 A;  2GWR A;  2PJP A;  5CW8 A;  1JUP A;  3K9T A;  1UZC A;  3MN2 A;  3O8H A;  4MXM A;  1ONV A;  5B1B H;  3B02 A;  1OJL A;  1IRZ A;  3G7R A;  2ID3 A;  4UUS A;  3RKQ A;  3HKZ N;  1VQP I;  1D8J A;  2UXH A;  1XC5 A;  1YIT I;  1D0Z A;  4BEH B;  1FSE A;  2OJE D;  3G56 A;  1RZ4 A;  1IRG A;  5FHP A;  2ZNZ A;  2N8G A;  2L7M P;  1O3Q A;  4HQM A;  3TO6 A;  2PG4 A;  3L2U A;  3KX2 A;  3TBI A;  1IUF A;  2DQL A;  4G6D A;  3DPJ A;  3TL4 X;  1ZYR F;  2ZO4 A;  3WHB A;  3P7N A;  1EJ9 A;  3L2V A;  2XAU A;  3I0T A;  4CH7 A;  5FGM A;  1WI9 A;  2IVM A;  1FC3 A;  2VXD A;  3PUF A;  4NNJ A;  2CQN A;  2EH3 A;  3M9A A;  3WTW C;  2QSG X;  5FGL A;  3LA2 A;  2XB5 A;  2AS5 F;  2VOP A;  4CSW A;  3BC8 A;  2EIM H;  2XAF A;  5E8G A;  2E5Z A;  2DYS H;  1A35 A;  2RQQ A;  4IF4 A;  5KNL A;  5CXG A;  3GWZ A;  3WG9 A;  2FQ3 A;  2W85 A;  2TCT A;  5J6X A;  4ITV A;  4NN1 A;  3PNV A;  1JHH A;  3J81 Z;  4NC8 A;  1A5J A;  3CJD A;  5DTD A;  4BGD A;  6PAX A;  2PJR A;  3H35 A;  5HLG A;  2R7D A;  2PX9 A;  4UUT A;  5LHG A;  3MD2 A;  2Y0S A;  1WJE A;  2CUJ A;  1VQK I;  3HG9 A;  3S2W A;  4G94 A;  2O7T A;  2E5N A;  3HTH A;  2MGQ A;  2VBY A;  4M3G A;  1PJR A;  5GTI C;  1ZG5 A;  2ELH A;  1ODD A;  2VQH A;  3G6E I;  2L9R A;  3F6V A;  4D9J A;  3U2R A;  3OSG A;  2COB A;  3K6G A;  2L9S A;  3OS1 A;  2VJ5 A;  5D4R A;  2P5K A;  2MW8 A;  4I0A A;  3GLL A;  1U6G A;  3BTI A;  3HHG A;  1QRY A;  2KZG A;  3BT9 A;  1UHW A;  2M2E A;  3WOD F;  1FIA A;  4F91 B;  5DCM A;  2Y75 A;  2Y31 A;  1DPR A;  3CCV I;  2V6C A;  2WWY A;  2P0W A;  5E1X A;  1MW7 A;  3IP4 B;  2NVT J;  3DFG A;  1CGP A;  1BI1 A;  3GEZ A;  5L3E A;  2UXP A;  5IT9 K;  2P5V A;  3A02 A;  4UUS B;  4E7H A;  1MBH A;  1IUY A;  3HL2 A;  5LBQ A;  4H4K C;  2O0Y A;  3IH4 A;  1TWH J;  4I7H A;  4IVN A;  2H09 A;  3OYF A;  2QSF X;  1X1P A;  3WTY C;  1SVM A;  2DA5 A;  3V8L A;  1ZH5 A;  3KZ9 A;  2YX7 A;  3DBR B;  4HAM A;  1R58 A;  3OSF A;  3H0D A;  1GV5 A;  2RAE A;  4G6Q A;  1MH4 A;  2MC4 A;  3QQA A;  3ZQL A;  4A12 A;  3I5U A;  1KZH A;  5E20 A;  1R4M B;  4XSZ F;  3LJL A;  5ICG A;  3G1M A;  4AIH A;  5JHF A;  1CF7 A;  2OTL I;  4J19 A;  1IG7 A;  2GXB A;  1ETQ A;  1WVR A;  5J8C A;  3CCE I;  2VE9 A;  2HS5 A;  3CTA A;  2M34 A;  5E1Z B;  3VVZ A;  1IV8 A;  4LIU A;  3OYD A;  2DMN A;  4QIW N;  3DBL B;  3VUQ A;  3K2A A;  2EFQ A;  2IGN A;  1SMY F;  3S3N A;  3LA3 A;  3WU0 A;  4BHB A;  3BHQ A;  1R23 A;  1ETO A;  3E3V A;  4ICH A;  4B3X A;  1U8B A;  2LRE A;  2WY8 Q;  3BCB A;  1JXS A;  4U0W A;  1NG6 A;  3HC7 A;  2PJR B;  1QVU A;  4DW6 A;  1SC7 A;  4GCK A;  4N0B A;  3JRE A;  2IEK A;  1MBF A;  1ZAO A;  3PJR A;  2HQ5 A;  1ZLK A;  2XSD C;  3JR9 A;  5K5O A;  3PIP F;  1XMK A;  3FF5 A;  3AL0 C;  4AIJ A;  4M3F A;  5L3B A;  3LSP A;  2HYF A;  1JT6 A;  2K85 A;  1FP2 A;  1USS A;  4CZZ A;  1I6H J;  4FCY A;  4CCJ A;  3JRD A;  5CLS A;  3CQZ J;  5GAG J;  3CJR B;  5K7Z A;  1J09 A;  3D5R C;  3LMM A;  2DU9 A;  1TW3 A;  4GYI A;  4A2U A;  3CCS I;  3GTK J;  2AXT C;  2L9V A;  3RSN A;  4ESF A;  4XKB A;  2O5R A;  1W5T A;  1QGP A;  1ZR2 A;  3K4J A;  1F36 A;  2UXN A;  3SQN A;  1JKQ C;  1ZTR A;  3CLQ A;  1QVT A;  3GF2 A;  4EGZ A;  1YLF A;  2FBI A;  2FUG 2;  4PJM A;  4BJ6 C;  5DCM B;  3MCZ A;  1QA6 A;  4E7Z A;  4RLQ A;  1XCB A;  1YRN A;  1LEA A;  1YS7 A;  2R7U A;  1XPX A;  3LAJ A;  1PUE E;  2R7S A;  2W25 A;  5FRM A;  4DNC A;  3AG3 H;  3M8E A;  4CCK A;  3J80 Z;  2R93 J;  2HTJ A;  1LVA A;  3FMR A;  2Q0O A;  3HBL A;  1CQT A;  4DIQ A;  5CQE A;  1HKS A;  2PLY A;  3ZMZ A;  5LEJ A;  3HRU A;  1RC9 A;  3MEX A;  3ZQG A;  2XF5 A;  4IOA F;  2XC7 A;  2OCC H;  3MVP A;  3HOY J;  3LST A;  1DU6 A;  2K9S A;  3I54 A;  1SAN A;  2RVC A;  5F08 A;  2OTJ I;  5HS7 A;  4ZTJ A;  1G4D A;  2KHM A;  1TWF J;  4B4C A;  1CF7 B;  4IHY A;  2JUC A;  3E7Q A;  3GXO A;  1WJD A;  2E71 A;  2JUG A;  4YIF A;  4XR6 A;  3EYY A;  3C7J A;  1O7F A;  5HDN A;  1UG2 A;  4XON A;  2JJ7 A;  3SJM A;  4LK0 F;  1W7P D;  1B4A A;  4L9T A;  4OWR B;  3OYG A;  4AVP A;  2D5V A;  3OL3 A;  4AF5 A;  4KYW A;  3FK7 A;  1BI0 A;  1YYV A;  1S8N A;  2LC2 A;  4HDV A;  1HQC A;  2GUH A;  1U0J A;  2OZ6 A;  4M9Z A;  1YOV B;  3IKV A;  2DW4 A;  2EIL H;  2PMU A;  1Q1H A;  1IV6 A;  4DGW B;  3QOE A;  5EF6 A;  1ENH A;  2D1V A;  1X1A A;  3OWT A;  4B48 A;  3S17 J;  2F5F A;  3BR3 A;  3S2D J;  2CUF A;  2LP0 A;  3ECH A;  1WKM A;  4JQF A;  3DU5 A;  3E5Q A;  4HZF A;  2STT A;  4ON0 A;  2MLG A;  5K7H A;  1FOX A;  3JRH A;  5IYD J;  2M8G X;  4PJN A;  3VW2 A;  1J75 A;  4BQA A;  4R1H A;  4GO1 A;  2Y69 H;  4D7N A;  5JR3 A;  5CQG A;  2CYY A;  2ECB A;  3UR3 C;  3BR1 A;  1V55 H;  2DI3 A;  2A05 A;  4U0V A;  4RB3 C;  1NG7 A;  4J00 A;  2R7Q A;  4A5M A;  2W7N A;  2KRF A;  3H9G A;  2L7F P;  2P6T A;  2PQ8 A;  2ZCM A;  3HDD A;  2FNP A;  3O3K A;  2ZFW A;  4OIP F;  4G7O F;  1YRN B;  3ZN0 A;  2OU2 A;  2HOT A;  2AHQ A;  2FML A;  3HHH A;  2E60 A;  2HYT A;  2C6Y A;  2QEX I;  5DYM A;  3FM5 A;  3NAR A;  2L5Q A;  2X48 A;  3H5N A;  2HNH A;  2LY9 A;  1G3T A;  2ELK A;  4JYK A;  3BR5 A;  3NS4 A;  1UB9 A;  3RKW A;  3U9G A;  5EG0 A;  1PUF A;  2REK A;  1GT0 C;  4C3H J;  1BC8 C;  4DBQ A;  2E2H J;  1G6N A;  1SFK A;  1HST A;  2VOD A;  5EFY A;  3ZQC A;  1HSJ A;  4DYC A;  3G71 I;  4P55 A;  2Y0M A;  4RM2 A;  2K9M A;  2VC0 A;  1FMV A;  3A0H C;  1R22 A;  2DOF A;  4PSX A;  2HOS A;  1YW9 A;  2VAS A;  2YX4 A;  4PDK A;  2WBM A;  3K0L A;  2COM A;  3CCM I;  4LG0 A;  4WXH A;  2X51 A;  3EUH A;  2VXZ A;  4UB6 C;  5D6E A;  4XBF A;  3FX3 A;  1D0Y A;  4LLG F;  2EV6 A;  3DLL F;  3MKY B;  1V3F A;  2IGK A;  4LFU A;  2A68 F;  3U21 A;  5DS9 A;  2IAI A;  3H3U A;  3V7C A;  2VKH A;  2IS4 A;  2DA1 A;  2UXX A;  4G12 A;  4Y7N J;  1SAX A;  4IX7 A;  4DVY P;  3IRR A;  3G2B A;  2XGE A;  1I1G A;  2K4J A;  4IL6 C;  1BIA A;  1UMQ A;  4XRF A;  1VI0 A;  3CMY A;  4HNV A;  1QQI A;  4WCG A;  1U3E M;  1GDT A;  1A6I A;  3WTZ A;  1LFU P;  3K10 A;  2A3S A;  2HKO A;  1R1T A;  3IC7 A;  4MK6 A;  4A0Z A;  4GDF A;  1TTY A;  4MFD A;  1UG0 A;  2HPM A;  1OR7 A;  4AID A;  1XSD A;  1KON A;  2BGC A;  2WV1 A;  2DYR H;  1YTY A;  2KIU A;  2JWT A;  3HRM A;  1KYW A;  2K27 A;  1I50 J;  1Y56 A;  4EJO A;  5EEA A;  3H5R A;  4CDG A;  1SVO A;  2E1M B;  1RUN A;  3VWB A;  5LLQ A;  3ISP A;  1MBE A;  3VSK A;  2HDD A;  1LNW A;  1YX3 A;  1Z7U A;  2K3P A;  2VQG A;  3OOP A;  3B81 A;  1TZL A;  2EJR A;  3F0C A;  4FX4 A;  2CQQ A;  1J0R A;  1TP4 A;  3NRV A;  4NBQ A;  3I64 A;  1VF9 A;  2O6G E;  2ZOZ A;  3EUK L;  4ENK A;  1OYW A;  3OR2 C;  3IH3 A;  1RNL A;  2V9P A;  4F7Z A;  1OCO H;  1S7A A;  4AIK A;  2A2F X;  1R5G A;  3MZ8 A;  5IP7 J;  1QZE A;  1XDS A;  5EG0 B;  3DTI A;  3ON2 A;  3T8R A;  1K79 A;  1PUF B;  1IRF A;  2W24 A;  2FA5 A;  3NWT A;  2Y9Y A;  2BOL A;  2KFD A;  2PMZ N;  2WY7 Q;  1WJF A;  3CCY A;  1IDZ A;  2PN6 A;  3EDP A;  3QYB A;  3V6G A;  5F04 A;  1SEU A;  1SD4 A;  4MTE A;  3TDU C;  2IT0 A;  1I1S A;  2BY3 A;  4KJZ A;  1TT5 B;  2MD0 A;  4LG0 B;  4GCT A;  2LYC A;  3L2C A;  1H0M A;  3WU1 B;  1GXQ A;  4IQ4 A;  3LOC A;  4RAG A;  3DCF A;  2QF7 A;  4KN4 X;  4I6Z A;  2E2J J;  2EQR A;  4M71 A;  2E7W A;  1G3S A;  2JVH A; 
#chains in the Genus database with same CATH homology
 1WGX A;  1D5Y A;  4C3J J;  3S16 J;  4KWA A;  2FX0 A;  3VVX A;  4DYR A;  3L1P A;  2YVE A;  4MO7 A;  1JUS A;  3SDG A;  2LK2 A;  2M9H A;  3KKC A;  2LFB A;  3KKD A;  4NEL A;  4JNN A;  2ZOY A;  3VP5 A;  2TRT A;  3HGG A;  3Q0V A;  1Y1W J;  1WPK A;  1RET A;  2LTP A;  3P9T A;  1GV2 A;  2VPR A;  5C4Y A;  1X2N A;  1MH3 A;  2L7Z A;  4A3B J;  2DMP A;  1HLV A;  4ACI A;  3TW7 A;  1P7I A;  4V2G A;  2WGB A;  1MBG A;  3E7L A;  3S1N J;  1BW5 A;  3NRG A;  1TC3 C;  4X1E A;  2PZ9 A;  3HE0 A;  2G7S A;  2LR8 A;  4IHW A;  1GUU A;  5F0H A;  4IHV A;  3ANP A;  2WB1 N;  4DZJ A;  2QCO A;  2DA6 A;  1QPI A;  3DEW A;  1FJL A;  3GTO J;  4MIM A;  4A3F J;  4D5C A;  2QTQ A;  1ETK A;  2FJ1 A;  5E3O A;  2O9L A;  1NK3 P;  3WHC A;  5M3F J;  1IGN A;  2WUI A;  2NP5 A;  1OCP A;  3PM1 A;  4FE4 A;  2ZCN A;  1ETV A;  2CQX A;  2H8R A;  2Y2Z A;  1JGG A;  3F1B A;  3JRA A;  1W0T A;  2DTZ A;  2IBD A;  5CW8 A;  1JUP A;  2K9Q A;  4D5F A;  2CJJ A;  3O8H A;  3MN2 A;  3BRU A;  4JX6 A;  4MXM A;  2DA7 A;  1OJL A;  2YUS A;  1IRZ A;  1JTY A;  3G7R A;  2ID3 A;  4UUS A;  3RKQ A;  3HKZ N;  2UXH A;  4M6V A;  5C3E J;  1UHS A;  1XC5 A;  2YS9 A;  2E2I J;  3HTI A;  2EZI A;  3H3V K;  2QWT A;  3G56 A;  1FTZ A;  1RKW A;  1SGM A;  5FHP A;  1IJW C;  2JMW A;  3BNI A;  2N8G A;  2XPV A;  2L7M P;  3K7A J;  3S15 J;  4JX4 A;  4CYC A;  1U9N A;  3HEF A;  4HKU A;  3D1N I;  3S1Q J;  3BCG A;  3FIS A;  1IUF A;  2DA3 A;  3DPJ A;  4M3D A;  2FD5 A;  1NTC A;  3WHB A;  5M5X J;  2NVX J;  2EZK A;  4BKX A;  5EGO B;  2DMT A;  2NS7 A;  3SFI A;  4XRS G;  1FEX A;  2NVY J;  5EYR A;  2GBY A;  2VKV A;  4RDU A;  4FTH A;  1POG A;  3B6A A;  2EH3 A;  3GTG J;  5FGL A;  3JRC A;  3FIW A;  5HBU A;  2XB5 A;  1BJZ A;  5C4X J;  2GM4 A;  1JKP C;  1JUM A;  1XG1 A;  1MNM C;  2O8K A;  5CXG A;  1AU7 A;  1UI6 A;  1MBJ A;  3JRF A;  2O7O A;  2TCT A;  5EZG A;  4NN1 A;  4AYB N;  1A5J A;  3CJD A;  2JK3 A;  5DTD A;  4L5E A;  1JKO C;  3S5R A;  3O60 A;  4DZP A;  1S7E A;  4UUT A;  4A69 C;  1TWG J;  4Y52 J;  1JTX A;  3HIM A;  4A3G J;  3QPS A;  2O7T A;  3FRQ A;  2MGQ A;  4M3G A;  3HTH A;  3S1R J;  4W97 A;  4RBO A;  4ABZ A;  2UXU A;  2L9R A;  3S2H J;  3OSG A;  2COB A;  3I4M J;  2R5Y B;  1F43 A;  1UI5 A;  2MW8 A;  1WI3 A;  4A3K J;  2DJN A;  3RZO J;  3BTI A;  1QRY A;  1RR7 A;  3BT9 A;  3GZI A;  2M2E A;  3I4N J;  2DA2 A;  1H8A C;  4X6A J;  5D19 A;  3FK6 A;  1FIA A;  3VVY A;  2R7Z J;  2Y31 A;  3MNL A;  4M3B A;  2Y0S N;  1IC8 A;  2YVH A;  3BR0 A;  2NVT J;  5C44 J;  2R92 J;  2LKX A;  1XS9 A;  3AQT A;  3QPL A;  5E3N A;  2UXP A;  3A02 A;  4UUS B;  3VPR A;  1MBH A;  3BG5 A;  2M0C A;  1FTT A;  2G7L A;  5E3M A;  3IH4 A;  4S0H B;  1TWH J;  1LE8 A;  2VI6 A;  4V2F A;  3KZ9 A;  1U9O A;  2DA5 A;  1W0U A;  3OSF A;  1GV5 A;  5JLW A;  2RAE A;  1Z0X A;  2EZL A;  1MH4 A;  3ZQL A;  3QQA A;  1OFC X;  3RZD J;  3C07 A;  1HDP A;  4CYC B;  3JRB A;  5IOY A;  3LJL A;  3G1M A;  3A01 A;  4J19 A;  2QOP A;  5M5W J;  1IG7 A;  1ETQ A;  3GTP J;  1B8I A;  5GP9 A;  2M34 A;  2R5Y A;  3VVZ A;  3CRJ A;  4GFK A;  2DMN A;  4QIW N;  1BW6 A;  2HKU A;  3VUQ A;  1HCR A;  3LWJ A;  3K2A A;  5EDN A;  3RH2 A;  1E3O C;  3PO2 J;  2JA5 J;  2XGD A;  3BHQ A;  2XDN A;  1ETO A;  2E1O A;  1BA5 A;  1U8B A;  4ICH A;  1BL0 A;  4BY7 J;  1QVU A;  2HI3 A;  2HXI A;  2ID6 A;  4I76 A;  4DW6 A;  3JRE A;  3AQS A;  2IEK A;  1U78 A;  3GTQ J;  5AQC A;  4YZE A;  1MBF A;  3LSJ A;  4XRM A;  4A93 J;  2B63 J;  2HQ5 A;  3EGQ A;  5FKN A;  2XSD C;  3JR9 A;  2Y30 A;  4B3A A;  3FKI J;  4IHX A;  2W48 A;  4M3F A;  3LSP A;  2WAQ N;  2IU5 A;  5GPC A;  5H9T A;  1JT6 A;  2KT0 A;  2HXO A;  3W6V A;  1I6H J;  4FCY A;  3JRD A;  2P81 A;  1H88 C;  5K7F A;  1AKH A;  3CQZ J;  3BTC A;  5K7Z A;  1O4X A;  1APL C;  3S14 J;  2I10 A;  3LSR A;  3BR2 A;  3GTK J;  1T33 A;  5FJ8 J;  2MG4 A;  2E19 A;  2X6O A;  3RD3 A;  1AHD P;  3ZOB A;  3KNW A;  1ETX A;  1ZR2 A;  2FBQ A;  1F36 A;  1JKQ C;  1ZTR A;  2HYJ A;  5FKK A;  1QVT A;  5M5Y J;  3Q0U A;  1YRN A;  3BQZ A;  2GFN A;  5IP9 J;  3BG3 A;  1ORK A;  2RHA A;  1B72 A;  4ME9 A;  2ME6 A;  2HOA A;  2R93 J;  2VUM J;  3V78 A;  2V57 A;  3HBL A;  1CQT A;  3OIO A;  2F07 A;  2CRG A;  4AC6 A;  1K83 J;  2DMQ A;  2K40 A;  3TP3 A;  1ETW A;  3ZQG A;  4C2M J;  1LE8 B;  5FKO A;  5K58 A;  3MVP A;  4AC0 A;  4BXX J;  3HOY J;  2JA7 J;  5DAJ A;  1H89 C;  1DU6 A;  2K9S A;  2KDZ A;  1G2H A;  1SAN A;  5F08 A;  2Y9Z A;  3BQY A;  3QBM A;  3G1L A;  1TWF J;  4B4C A;  3A01 B;  4IHY A;  5J3L A;  3E7Q A;  3NI7 A;  3HM5 A;  1JJ6 C;  3TW6 A;  3EUP A;  5FKM A;  3ON4 A;  2CUE A;  1B8I B;  3H0G J;  1UG2 A;  4XK4 A;  2D6Y A;  1X2M A;  2JJ7 A;  3SJM A;  4MLO A;  3GTL J;  1Z77 A;  5FLM J;  4BBS J;  4AF5 A;  2D5V A;  3HOV J;  3M3Y J;  2X9D A;  3B6C A;  3FK7 A;  5F1J A;  1RKT A;  3HB9 A;  1DU0 A;  2GLO A;  5HSZ A;  4JKZ A;  4XRS A;  4GCK A;  5JLX A;  2CU7 A;  2GUH A;  5D1R A;  2W53 A;  2R5Z B;  1MSE C;  3COL A;  2UXI A;  1RES A;  3ZQH A;  4AUX A;  1GVD A;  1IV6 A;  2OPT A;  3BR6 A;  5IYB J;  5J1R A;  5EF6 A;  4BY1 J;  3GEU A;  1ENH A;  4JP0 A;  3NXC A;  3S17 J;  2DMU A;  3RQI A;  3BR3 A;  3S2D J;  2CUF A;  2LP0 A;  5F0C A;  3O8G A;  2XGC A;  5HOD A;  5BNG A;  2QIB A;  2XPU A;  5K7H A;  4FIS A;  5J1U A;  3JRH A;  1AKH B;  5IYD J;  2M8G X;  5FMP A;  3VW1 A;  3VW2 A;  4A3C J;  1ETY A;  2LLK A;  4D7N A;  2DN0 A;  3LSG A;  2ECB A;  2Q24 A;  3BR1 A;  3Q3S A;  2L7F P;  5IPA A;  2ZCM A;  2JN6 A;  4JL3 A;  3HDD A;  4XID A;  9ANT A;  5IOZ A;  1YRN B;  1IDY A;  4D7M A;  2AHQ A;  2HOT A;  4QTR A;  3TED A;  5CXI A;  2HYT A;  1B72 B;  1MSF C;  2ZB9 A;  2AO9 A;  3NAR A;  2RAS A;  2X48 A;  2LY9 A;  3VIB A;  3HOU J;  2ELK A;  4JYK A;  3BR5 A;  3ZQI A;  1LFB A;  5EG0 A;  2DG8 A;  1PUF A;  2REK A;  2OF7 A;  1GT0 C;  2R5Z A;  4C3H J;  2ECC A;  2E2H J;  4CGR A;  5EFY A;  2VKE A;  2K9N A;  3ZQC A;  4DYC A;  2JA8 J;  2ZCX A;  2DA4 A;  1WCM J;  3JRI A;  4C3I J;  2HOS A;  3OOU A;  3BG9 A;  5FKL A;  1TWA J;  4A3L J;  4NDL A;  3PAS A;  1HDD C;  3T6N A;  4UDS A;  2OI8 A;  3BJB A;  2ME0 A;  2FQ4 A;  2XPW A;  1ZKG A;  4A3J J;  2UXO A;  3CWR A;  1ITY A;  2NOG A;  4GFL A;  1ZK8 A;  3VW0 A;  5DS9 A;  1TWC J;  2IAI A;  3NAU A;  3UKG A;  3NPI A;  2DA1 A;  4G12 A;  3IH2 A;  4Y7N J;  3GBG A;  2NX4 A;  5FLV A;  2PBX A;  2EBI A;  2XGE A;  1ZGW A;  3LHQ A;  1UMQ A;  4MFE A;  1VI0 A;  3CMY A;  4HNV A;  1VFC A;  5IP6 A;  1GDT A;  1A6I A;  1LFU P;  1JKR C;  4QSH A;  4A3I J;  1NK2 P;  3M4O J;  2OER A;  4MK6 A;  3A03 A;  4M3E A;  3Q0W A;  4A3D J;  4A3E J;  3HGY A;  4MFD A;  2QKO A;  1ZQ3 P;  2R0Q C;  5EZH A;  3HOZ J;  2NS8 A;  2G0E A;  5F27 A;  1T56 A;  3HOW J;  1R9T J;  4L62 A;  1FIP A;  2L0K A;  3ZQF A;  2LVS A;  1HF0 A;  2WV1 A;  5E3L A;  1HOM A;  2JWT A;  5IYC J;  3VOX A;  3TP0 A;  4BBR J;  1I50 J;  5EEA A;  2LD5 A;  5M3M J;  1I3Q J;  4A3M J;  5HAW A;  3G1O A;  5D18 A;  1MBE A;  4B1R A;  2HDD A;  3B81 A;  4DYQ A;  3CDL A;  2GEN A;  3HOX J;  3F0C A;  2CQQ A;  1ZR4 A;  1K61 A;  2NP3 A;  1P7J A;  1Q1V A;  3VOK A;  1VF9 A;  3C2B A;  2H1K A;  2G3B A;  2ZOZ A;  2G7G A;  1JJ8 C;  4GCL A;  3NNR A;  3IH3 A;  3JSJ A;  3PO3 J;  4W1U A;  3GTJ J;  5IP7 J;  3BTL A;  3GTM J;  3ANG A;  5EG0 B;  3HTJ A;  1MBK A;  1RPW A;  3ON2 A;  1PUF B;  2EZH A;  2MSY A;  4FE7 A;  5F0F A;  5GPA A;  4XIC A;  2Y9Y A;  3S1M J;  3MKL A;  5C4J J;  2YU9 J;  1EF4 A;  4LOC A;  4JX5 A;  3PPB A;  2PMZ N;  1Y1V J;  3CCY A;  1IDZ A;  3BTJ A;  3V6G A;  1VND A;  2XB0 X;  1WH5 A;  5F04 A;  2JA6 J;  4GFB A;  3QKX A;  2DG7 A;  2XRL A;  1OCT C;  2NVQ J;  4GCT A;  3IUV A;  5J1Y A;  4PXI A;  1SFO J;  3HTA A;  4EEF G;  3LNQ A;  3LOC A;  5EGO A;  3JRG A;  3DCF A;  2QF7 A;  1JT0 A;  1WH7 A;  4I6Z A;  2E2J J;  2EQR A;  4IEJ A;  3IV5 A;  1X58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...