2GENA

Structural genomics, the crystal structure of a probable transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
RKDEILQAALACFSEHGVDATTIEMIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQYAALLEAGFARARSAEETVRLLVTSYIDWVVANPDWARFILHSRGRVEAGELGERLRADNQAHFARIHAALAGYRAEGLFREMPDDCFASVVIGPAHDLARQWLAGRTRVALADCRELLAQVAWDSVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transcription
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2genA00
1JUPA 2XRLA 3BTJA 4ME9A 3QPLA 2QWTA 2X6OA 2XDNA 3T6NA 3CCYA 3VW0A 5GPCA 2ZOYA 4YZEA 1ZKGA 2UXHA 3DEWA 3C2BA 4D5FA 3RD3A 2G7LA 4D7MA 4AUXA 3IH2A 1SGMA 3BR5A 3SDGA 3KKDA 2F07A 3FK6A 2D6YA 2RASA 5C4YA 2JK3A 1BJZA 2ZCNA 3HGYA 3LSJA 2DTZA 4JNNA 3E7QA 4JYKA 3FIWA 2G0EA 5FKNA 1U9OA 2OPTA 1RKWA 2UXPA 2TRTA 2HKUA 3HTHA 4MO7A 4PXIA 5EZGA 3EGQA 3O60A 4W1UA 1RPWA 2GBYA 1ORKA 2UXIA 4D5CA 2ZCXA 2REKA 1VI0A 3G56A 3PASA 3ZQLA 3BNIA 5HSZA 3WHCA 2V57A 3FRQA 3ZQFA 3HIMA 5F0FA 3NRGA 3PM1A 2NS8A 3HE0A 4GCTA 3LJLA 3NPIA 3QKXA 4GCKA 3Q3SA 2QTQA 3B81A 2XB5A 2VKVA 3BT9A 4X1EA 3BR3A 5FHPA 5FKKA 3C07A 3S5RA 5CW8A 4W97A 4V2GA 3G1MA 2HQ5A 5K7HA 2HYJA 3CJDA 2WGBA 2W53A 3MNLA 2HXIA 2G7SA 2XGCA 3CWRA 2NP5A 3VOKA 3F0CA 4I76A 3BR0A 4G12A 3ON2A 5FGLA 3HTAA 2UXOA 1ZK8A 2JJ7A 3BQZA 3VUQA 5F08A 2NX4A 2XPUA 3BHQA 1Z0XA 5FKOA 1U9NA 2IU5A 2XPWA 3F1BA 3O8GA 3V6GA 5F0HA 2WV1A 3SFIA 4B1RA 4CGRA 5IP6A 2IEKA 4B3AA 2IAIA 2FBQA 3BTIA 4M3GA 3AQSA 5IOZA 3DPJA 3P9TA 5D18A 3TP3A 2O7TA 3GEUA 1Z77A 2OF7A 3HTIA 4I6ZA 3ANPA 2FJ1A 2XPVA 3IH4A 2EH3A 5J1UA 4DW6A 2O7OA 3G1OA 4M3FA 3HGGA 4GFLA 3TP0A 3ZQGA 5K58A 5K7ZA 3Q0VA 1T56A 5GPAA 2OI8A 3G1LA 3Q0UA 2HYTA 4GCLA 2Y31A 2FX0A 1UI6A 3LWJA 4NN1A 5IOYA 4ABZA 1UI5A 2YVEA 3VPRA 2GENA 3G7RA 3KKCA 4M3BA 1A6IA 2FQ4A 4AC0A 3BTLA 2PBXA 1QVTA 3VIBA 3VW1A 3ZQHA 5CXGA 3DCFA 3ZQIA 5AQCA 3CDLA 3QPSA 5D19A 3BQYA 1QVUA 4KWAA 3KZ9A 3BR1A 1JT0A 4M3DA 4AF5A 4L62A 2GUHA 3PPBA 2FD5A 4GFKA 3B6AA 2ZCMA 5FMPA 2HXOA 2YVHA 2ZOZA 5F27A 3LHQA 3EUPA 3BCGA 4JKZA 5J1YA 1RKTA 3IUVA 2PZ9A 5HAWA 4ACIA 3VVYA 4JL3A 2G3BA 2DG8A 5J1RA 3QBMA 5F04A 2WUIA 4AC6A 5D1RA 2VKEA 5FKMA 3AQTA 5DAJA 4UDSA 3B6CA 2OERA 3KNWA 2IBDA 5F1JA 3BR6A 2RHAA 5EYRA 5HBUA 3BRUA 3FK7A 4D7NA 1JTXA 3VP5A 5FKLA 4V2FA 3WHBA 3LSRA 3ON4A 2TCTA 3BJBA 2XGDA 4M3EA 5EFYA 5F0CA 2ZB9A 2QCOA 3VVXA 4ICHA 1JT6A 2Y30A 3RH2A 3O8HA 2G7GA 3VOXA 3LSPA 3ANGA 3QQAA 2ID3A 1JUSA 2NP3A 3COLA 3V78A 2UXUA 5GP9A 2X9DA 3BTCA 3MVPA 2GFNA 3NI7A 3NNRA 2VPRA 2Q24A 4XK4A 2QOPA 5K7FA 3NXCA 3BR2A 2DG7A 3CRJA 3JSJA 3VVZA 5J3LA 3VW2A 1QPIA 2RAEA 2QKOA 4MXMA 4MK6A 2I10A 1T33A 5IPAA 2ID6A 1JTYA 4HKUA 4NELA 3Q0WA 1JUMA 2Y2ZA 3HTJA 3LOCA 5CXIA 2XGEA 5EZHA 2QIBA 3IH3A 2NS7A 5H9TA 3GZIA
chains in the Genus database with same CATH superfamily
1JUPA 2XRLA 3BTJA 4ME9A 3QPLA 2QWTA 2X6OA 2R7RA 2XDNA 3T6NA 3CCYA 3VW0A 5GPCA 2ZOYA 4YZEA 1ZKGA 2UXHA 3DEWA 3C2BA 4D5FA 3RD3A 2G7LA 4D7MA 4AUXA 3IH2A 1SGMA 3BR5A 3SDGA 3KKDA 2F07A 3FK6A 2D6YA 2RASA 5C4YA 2JK3A 1BJZA 2ZCNA 3HGYA 3LSJA 2DTZA 4JNNA 3E7QA 4DVYP 4JYKA 3FHNA 3FIWA 4IRVA 2G0EA 5FKNA 1U9OA 2OPTA 2PFVA 1RKWA 2UXPA 2R7XA 2TRTA 2HKUA 3HTHA 4MO7A 4PXIA 5EZGA 3EGQA 3O60A 2YVXA 4W1UA 2R7UA 1RPWA 3VTIA 2GBYA 1ORKA 2UXIA 4D5CA 2ZCXA 4OD4A 2REKA 1VI0A 3G56A 3PASA 3ZQLA 3BNIA 5HSZA 3WHCA 2V57A 3FRQA 3ZQFA 3HIMA 5F0FA 3NRGA 3PM1A 2NS8A 3HE0A 4GCTA 3LJLA 3NPIA 3QKXA 4GCKA 3Q3SA 2QTQA 3B81A 2XB5A 4WIBA 2VKVA 3BT9A 2R7WA 4X1EA 3BR3A 5FHPA 5FKKA 3C07A 3S5RA 5CW8A 4W97A 4V2GA 3G1MA 4C2MA 2HQ5A 5K7HA 2HYJA 3CJDA 2WGBA 3DU6A 2W53A 3MNLA 2HXIA 2G7SA 2XGCA 3CWRA 2NP5A 3VOKA 3F0CA 4I76A 3BR0A 4G12A 3ON2A 5FGLA 3HTAA 2UXOA 1ZK8A 2JJ7A 3BQZA 3VUQA 5F08A 2NX4A 2XPUA 3BHQA 1Z0XA 3K8PC 5FKOA 1U9NA 2IU5A 2XPWA 3F1BA 3O8GA 3V6GA 5F0HA 2WV1A 3SFIA 4B1RA 4CGRA 5IP6A 2IEKA 2A2FX 4B3AA 2FJI1 2IAIA 2FBQA 3BTIA 4M3GA 3AQSA 5IOZA 3DPJA 3P9TA 5D18A 3TP3A 2O7TA 3GEUA 1Z77A 2OF7A 3HTIA 4I6ZA 3ANPA 2FJ1A 2XPVA 3IH4A 2EH3A 5J1UA 4DW6A 2O7OA 3G1OA 4M3FA 3HGGA 4GFLA 3TP0A 3ZQGA 5K58A 2R7VA 5K7ZA 3Q0VA 1T56A 5GPAA 2OI8A 2R7TA 3G1LA 3Q0UA 2HYTA 4GCLA 2Y31A 2R7SA 2FX0A 1UI6A 3LWJA 4NN1A 5IOYA 4ABZA 1UI5A 2YVEA 3VPRA 2GENA 3G7RA 3KKCA 4M3BA 1A6IA 2FQ4A 4AC0A 3BTLA 2PBXA 1QVTA 3VIBA 3VW1A 3ZQHA 5CXGA 3DCFA 3ZQIA 2ZY9A 5AQCA 3CDLA 3QPSA 5D19A 3BQYA 1QVUA 4KWAA 3KZ9A 4U9LA 3BR1A 1JT0A 4M3DA 4AF5A 4L62A 2GUHA 3PPBA 3SWHA 2FD5A 4GFKA 3B6AA 2ZCMA 5FMPA 2HXOA 2YVHA 2ZOZA 5F27A 3LHQA 3EUPA 3BCGA 4JKZA 5J1YA 3KYLA 1RKTA 3IUVA 2PZ9A 5HAWA 4ACIA 3VVYA 4JL3A 2G3BA 2DG8A 5J1RA 3QBMA 5F04A 2WUIA 4AC6A 3NS4A 5D1RA 2VKEA 5FKMA 3AQTA 5DAJA 2B1EA 4UDSA 3B6CA 2OERA 3KNWA 2IBDA 5F1JA 3BR6A 2RHAA 5EYRA 5HBUA 3BRUA 3FK7A 4D7NA 1JTXA 2R7QA 3VP5A 5FKLA 4V2FA 3WHBA 3LSRA 3ON4A 2TCTA 3BJBA 2XGDA 4M3EA 5CQGA 5EFYA 5F0CA 2ZB9A 2QCOA 3VVXA 4ICHA 1JT6A 2Y30A 3RH2A 3O8HA 2G7GA 3VOXA 3LSPA 3ANGA 3QQAA 3DU5A 2ID3A 2B3WA 1JUSA 2NP3A 3COLA 3V78A 2UXUA 5GP9A 2X9DA 3BTCA 3MVPA 2GFNA 3NI7A 3NNRA 2VPRA 2Q24A 4XK4A 2QOPA 5K7FA 3NXCA 3BR2A 2DG7A 3CRJA 3JSJA 3VVZA 5J3LA 3VW2A 1QPIA 2RAEA 2QKOA 4MXMA 4MK6A 2I10A 1T33A 5IPAA 2ID6A 1JTYA 4HKUA 4NELA 3Q0WA 1JUMA 5EZHA 2Y2ZA 3HTJA 3LOCA 2XGEA 5CXIA 4U9NA 2QIBA 2R7OA 3IH3A 2NS7A 5H9TA 3GZIA 4OD5A
chains in the Genus database with same CATH topology
1JUPA 2XRLA 3BTJA 4ME9A 3QPLA 2QWTA 2X6OA 2XDNA 3T6NA 3CCYA 3VW0A 5GPCA 2ZOYA 4YZEA 1ZKGA 2UXHA 3DEWA 3C2BA 4D5FA 3RD3A 2G7LA 4D7MA 4AUXA 3IH2A 1SGMA 3BR5A 3SDGA 3KKDA 2F07A 3FK6A 2D6YA 2RASA 5C4YA 2JK3A 1BJZA 2ZCNA 3HGYA 3LSJA 2DTZA 4JNNA 3E7QA 4JYKA 3FIWA 2G0EA 5FKNA 1U9OA 2OPTA 1RKWA 2UXPA 2TRTA 2HKUA 3HTHA 4MO7A 4PXIA 5EZGA 3EGQA 3O60A 4W1UA 1RPWA 2GBYA 1ORKA 2UXIA 4D5CA 2ZCXA 2REKA 1VI0A 3G56A 3PASA 3ZQLA 3BNIA 5HSZA 3WHCA 2V57A 3FRQA 3ZQFA 3HIMA 5F0FA 3NRGA 3PM1A 2NS8A 3HE0A 4GCTA 3LJLA 3NPIA 3QKXA 4GCKA 3Q3SA 2QTQA 3B81A 2XB5A 2VKVA 3BT9A 4X1EA 3BR3A 5FHPA 5FKKA 3C07A 3S5RA 5CW8A 4W97A 4V2GA 3G1MA 2HQ5A 5K7HA 2HYJA 3CJDA 2WGBA 2W53A 3MNLA 2HXIA 2G7SA 2XGCA 3CWRA 2NP5A 3VOKA 3F0CA 4I76A 3BR0A 4G12A 3ON2A 5FGLA 3HTAA 2UXOA 1ZK8A 2JJ7A 3BQZA 3VUQA 5F08A 2NX4A 2XPUA 3BHQA 1Z0XA 5FKOA 1U9NA 2IU5A 2XPWA 3F1BA 3O8GA 3V6GA 5F0HA 2WV1A 3SFIA 4B1RA 4CGRA 5IP6A 2IEKA 4B3AA 2IAIA 2FBQA 3BTIA 4M3GA 3AQSA 5IOZA 3DPJA 3P9TA 5D18A 3TP3A 2O7TA 3GEUA 1Z77A 2OF7A 3HTIA 4I6ZA 3ANPA 2FJ1A 2XPVA 3IH4A 2EH3A 5J1UA 4DW6A 2O7OA 3G1OA 4M3FA 3HGGA 4GFLA 3TP0A 3ZQGA 5K58A 5K7ZA 3Q0VA 1T56A 5GPAA 2OI8A 3G1LA 3Q0UA 2HYTA 4GCLA 2Y31A 2FX0A 1UI6A 3LWJA 4NN1A 5IOYA 4ABZA 1UI5A 2YVEA 3VPRA 2GENA 3G7RA 3KKCA 4M3BA 1A6IA 2FQ4A 4AC0A 3BTLA 2PBXA 1QVTA 3VIBA 3VW1A 3ZQHA 5CXGA 3DCFA 3ZQIA 5AQCA 3CDLA 3QPSA 5D19A 3BQYA 1QVUA 4KWAA 3KZ9A 3BR1A 1JT0A 4M3DA 4AF5A 4L62A 2GUHA 3PPBA 2FD5A 4GFKA 3B6AA 2ZCMA 5FMPA 2HXOA 2YVHA 2ZOZA 5F27A 3LHQA 3EUPA 3BCGA 4JKZA 5J1YA 1RKTA 3IUVA 2PZ9A 5HAWA 4ACIA 3VVYA 4JL3A 2G3BA 2DG8A 5J1RA 3QBMA 5F04A 2WUIA 4AC6A 5D1RA 2VKEA 5FKMA 3AQTA 5DAJA 4UDSA 3B6CA 2OERA 3KNWA 2IBDA 5F1JA 3BR6A 2RHAA 5EYRA 5HBUA 3BRUA 3FK7A 4D7NA 1JTXA 3VP5A 5FKLA 4V2FA 3WHBA 3LSRA 3ON4A 2TCTA 3BJBA 2XGDA 4M3EA 5EFYA 5F0CA 2ZB9A 2QCOA 3VVXA 4ICHA 1JT6A 2Y30A 3RH2A 3O8HA 2G7GA 3VOXA 3LSPA 3ANGA 3QQAA 2ID3A 1JUSA 2NP3A 3COLA 3V78A 2UXUA 5GP9A 2X9DA 3BTCA 3MVPA 2GFNA 3NI7A 3NNRA 2VPRA 2Q24A 4XK4A 2QOPA 5K7FA 3NXCA 3BR2A 2DG7A 3CRJA 3JSJA 3VVZA 5J3LA 3VW2A 1QPIA 2RAEA 2QKOA 4MXMA 4MK6A 2I10A 1T33A 5IPAA 2ID6A 1JTYA 4HKUA 4NELA 3Q0WA 1JUMA 2Y2ZA 3HTJA 3LOCA 5CXIA 2XGEA 5EZHA 2QIBA 3IH3A 2NS7A 5H9TA 3GZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUP A;  2XRL A;  3BTJ A;  4ME9 A;  3QPL A;  2QWT A;  2X6O A;  2XDN A;  3T6N A;  3CCY A;  3VW0 A;  5GPC A;  2ZOY A;  4YZE A;  1ZKG A;  2UXH A;  3DEW A;  3C2B A;  4D5F A;  3RD3 A;  2G7L A;  4D7M A;  4AUX A;  3IH2 A;  1SGM A;  3BR5 A;  3SDG A;  3KKD A;  2F07 A;  3FK6 A;  2D6Y A;  2RAS A;  5C4Y A;  2JK3 A;  1BJZ A;  2ZCN A;  3HGY A;  3LSJ A;  2DTZ A;  4JNN A;  3E7Q A;  4JYK A;  3FIW A;  2G0E A;  5FKN A;  1U9O A;  2OPT A;  1RKW A;  2UXP A;  2TRT A;  2HKU A;  3HTH A;  4MO7 A;  4PXI A;  5EZG A;  3EGQ A;  3O60 A;  4W1U A;  1RPW A;  2GBY A;  1ORK A;  2UXI A;  4D5C A;  2ZCX A;  2REK A;  1VI0 A;  3G56 A;  3PAS A;  3ZQL A;  3BNI A;  5HSZ A;  3WHC A;  2V57 A;  3FRQ A;  3ZQF A;  3HIM A;  5F0F A;  3NRG A;  3PM1 A;  2NS8 A;  3HE0 A;  4GCT A;  3LJL A;  3NPI A;  3QKX A;  4GCK A;  3Q3S A;  2QTQ A;  3B81 A;  2XB5 A;  2VKV A;  3BT9 A;  4X1E A;  3BR3 A;  5FHP A;  5FKK A;  3C07 A;  3S5R A;  5CW8 A;  4W97 A;  4V2G A;  3G1M A;  2HQ5 A;  5K7H A;  2HYJ A;  3CJD A;  2WGB A;  2W53 A;  3MNL A;  2HXI A;  2G7S A;  2XGC A;  3CWR A;  2NP5 A;  3VOK A;  3F0C A;  4I76 A;  3BR0 A;  4G12 A;  3ON2 A;  5FGL A;  3HTA A;  2UXO A;  1ZK8 A;  2JJ7 A;  3BQZ A;  3VUQ A;  5F08 A;  2NX4 A;  2XPU A;  3BHQ A;  1Z0X A;  5FKO A;  1U9N A;  2IU5 A;  2XPW A;  3F1B A;  3O8G A;  3V6G A;  5F0H A;  2WV1 A;  3SFI A;  4B1R A;  4CGR A;  5IP6 A;  2IEK A;  4B3A A;  2IAI A;  2FBQ A;  3BTI A;  4M3G A;  3AQS A;  5IOZ A;  3DPJ A;  3P9T A;  5D18 A;  3TP3 A;  2O7T A;  3GEU A;  1Z77 A;  2OF7 A;  3HTI A;  4I6Z A;  3ANP A;  2FJ1 A;  2XPV A;  3IH4 A;  2EH3 A;  5J1U A;  4DW6 A;  2O7O A;  3G1O A;  4M3F A;  3HGG A;  4GFL A;  3TP0 A;  3ZQG A;  5K58 A;  5K7Z A;  3Q0V A;  1T56 A;  5GPA A;  2OI8 A;  3G1L A;  3Q0U A;  2HYT A;  4GCL A;  2Y31 A;  2FX0 A;  1UI6 A;  3LWJ A;  4NN1 A;  5IOY A;  4ABZ A;  1UI5 A;  2YVE A;  3VPR A;  2GEN A;  3G7R A;  3KKC A;  4M3B A;  1A6I A;  2FQ4 A;  4AC0 A;  3BTL A;  2PBX A;  1QVT A;  3VIB A;  3VW1 A;  3ZQH A;  5CXG A;  3DCF A;  3ZQI A;  5AQC A;  3CDL A;  3QPS A;  5D19 A;  3BQY A;  1QVU A;  4KWA A;  3KZ9 A;  3BR1 A;  1JT0 A;  4M3D A;  4AF5 A;  4L62 A;  2GUH A;  3PPB A;  2FD5 A;  4GFK A;  3B6A A;  2ZCM A;  5FMP A;  2HXO A;  2YVH A;  2ZOZ A;  5F27 A;  3LHQ A;  3EUP A;  3BCG A;  4JKZ A;  5J1Y A;  1RKT A;  3IUV A;  2PZ9 A;  5HAW A;  4ACI A;  3VVY A;  4JL3 A;  2G3B A;  2DG8 A;  5J1R A;  3QBM A;  5F04 A;  2WUI A;  4AC6 A;  5D1R A;  2VKE A;  5FKM A;  3AQT A;  5DAJ A;  4UDS A;  3B6C A;  2OER A;  3KNW A;  2IBD A;  5F1J A;  3BR6 A;  2RHA A;  5EYR A;  5HBU A;  3BRU A;  3FK7 A;  4D7N A;  1JTX A;  3VP5 A;  5FKL A;  4V2F A;  3WHB A;  3LSR A;  3ON4 A;  2TCT A;  3BJB A;  2XGD A;  4M3E A;  5EFY A;  5F0C A;  2ZB9 A;  2QCO A;  3VVX A;  4ICH A;  1JT6 A;  2Y30 A;  3RH2 A;  3O8H A;  2G7G A;  3VOX A;  3LSP A;  3ANG A;  3QQA A;  2ID3 A;  1JUS A;  2NP3 A;  3COL A;  3V78 A;  2UXU A;  5GP9 A;  2X9D A;  3BTC A;  3MVP A;  2GFN A;  3NI7 A;  3NNR A;  2VPR A;  2Q24 A;  4XK4 A;  2QOP A;  5K7F A;  3NXC A;  3BR2 A;  2DG7 A;  3CRJ A;  3JSJ A;  3VVZ A;  5J3L A;  3VW2 A;  1QPI A;  2RAE A;  2QKO A;  4MXM A;  4MK6 A;  2I10 A;  1T33 A;  5IPA A;  2ID6 A;  1JTY A;  4HKU A;  4NEL A;  3Q0W A;  1JUM A;  2Y2Z A;  3HTJ A;  3LOC A;  5CXI A;  2XGE A;  5EZH A;  2QIB A;  3IH3 A;  2NS7 A;  5H9T A;  3GZI A; 
#chains in the Genus database with same CATH topology
 1JUP A;  2XRL A;  3BTJ A;  4ME9 A;  3QPL A;  2QWT A;  2X6O A;  2R7R A;  2XDN A;  3T6N A;  3CCY A;  3VW0 A;  5GPC A;  2ZOY A;  4YZE A;  1ZKG A;  2UXH A;  3DEW A;  3C2B A;  4D5F A;  3RD3 A;  2G7L A;  4D7M A;  4AUX A;  3IH2 A;  1SGM A;  3BR5 A;  3SDG A;  3KKD A;  2F07 A;  3FK6 A;  2D6Y A;  2RAS A;  5C4Y A;  2JK3 A;  1BJZ A;  2ZCN A;  3HGY A;  3LSJ A;  2DTZ A;  4JNN A;  3E7Q A;  4DVY P;  4JYK A;  3FHN A;  3FIW A;  4IRV A;  2G0E A;  5FKN A;  1U9O A;  2OPT A;  2PFV A;  1RKW A;  2UXP A;  2R7X A;  2TRT A;  2HKU A;  3HTH A;  4MO7 A;  4PXI A;  5EZG A;  3EGQ A;  3O60 A;  2YVX A;  4W1U A;  2R7U A;  1RPW A;  3VTI A;  2GBY A;  1ORK A;  2UXI A;  4D5C A;  2ZCX A;  4OD4 A;  2REK A;  1VI0 A;  3G56 A;  3PAS A;  3ZQL A;  3BNI A;  5HSZ A;  3WHC A;  2V57 A;  3FRQ A;  3ZQF A;  3HIM A;  5F0F A;  3NRG A;  3PM1 A;  2NS8 A;  3HE0 A;  4GCT A;  3LJL A;  3NPI A;  3QKX A;  4GCK A;  3Q3S A;  2QTQ A;  3B81 A;  2XB5 A;  4WIB A;  2VKV A;  3BT9 A;  2R7W A;  4X1E A;  3BR3 A;  5FHP A;  5FKK A;  3C07 A;  3S5R A;  5CW8 A;  4W97 A;  4V2G A;  3G1M A;  4C2M A;  2HQ5 A;  5K7H A;  2HYJ A;  3CJD A;  2WGB A;  3DU6 A;  2W53 A;  3MNL A;  2HXI A;  2G7S A;  2XGC A;  3CWR A;  2NP5 A;  3VOK A;  3F0C A;  4I76 A;  3BR0 A;  4G12 A;  3ON2 A;  5FGL A;  3HTA A;  2UXO A;  1ZK8 A;  2JJ7 A;  3BQZ A;  3VUQ A;  5F08 A;  2NX4 A;  2XPU A;  3BHQ A;  1Z0X A;  3K8P C;  5FKO A;  1U9N A;  2IU5 A;  2XPW A;  3F1B A;  3O8G A;  3V6G A;  5F0H A;  2WV1 A;  3SFI A;  4B1R A;  4CGR A;  5IP6 A;  2IEK A;  2A2F X;  4B3A A;  2FJI 1;  2IAI A;  2FBQ A;  3BTI A;  4M3G A;  3AQS A;  5IOZ A;  3DPJ A;  3P9T A;  5D18 A;  3TP3 A;  2O7T A;  3GEU A;  1Z77 A;  2OF7 A;  3HTI A;  4I6Z A;  3ANP A;  2FJ1 A;  2XPV A;  3IH4 A;  2EH3 A;  5J1U A;  4DW6 A;  2O7O A;  3G1O A;  4M3F A;  3HGG A;  4GFL A;  3TP0 A;  3ZQG A;  5K58 A;  2R7V A;  5K7Z A;  3Q0V A;  1T56 A;  5GPA A;  2OI8 A;  2R7T A;  3G1L A;  3Q0U A;  2HYT A;  4GCL A;  2Y31 A;  2R7S A;  2FX0 A;  1UI6 A;  3LWJ A;  4NN1 A;  5IOY A;  4ABZ A;  1UI5 A;  2YVE A;  3VPR A;  2GEN A;  3G7R A;  3KKC A;  4M3B A;  1A6I A;  2FQ4 A;  4AC0 A;  3BTL A;  2PBX A;  1QVT A;  3VIB A;  3VW1 A;  3ZQH A;  5CXG A;  3DCF A;  3ZQI A;  2ZY9 A;  5AQC A;  3CDL A;  3QPS A;  5D19 A;  3BQY A;  1QVU A;  4KWA A;  3KZ9 A;  4U9L A;  3BR1 A;  1JT0 A;  4M3D A;  4AF5 A;  4L62 A;  2GUH A;  3PPB A;  3SWH A;  2FD5 A;  4GFK A;  3B6A A;  2ZCM A;  5FMP A;  2HXO A;  2YVH A;  2ZOZ A;  5F27 A;  3LHQ A;  3EUP A;  3BCG A;  4JKZ A;  5J1Y A;  3KYL A;  1RKT A;  3IUV A;  2PZ9 A;  5HAW A;  4ACI A;  3VVY A;  4JL3 A;  2G3B A;  2DG8 A;  5J1R A;  3QBM A;  5F04 A;  2WUI A;  4AC6 A;  3NS4 A;  5D1R A;  2VKE A;  5FKM A;  3AQT A;  5DAJ A;  2B1E A;  4UDS A;  3B6C A;  2OER A;  3KNW A;  2IBD A;  5F1J A;  3BR6 A;  2RHA A;  5EYR A;  5HBU A;  3BRU A;  3FK7 A;  4D7N A;  1JTX A;  2R7Q A;  3VP5 A;  5FKL A;  4V2F A;  3WHB A;  3LSR A;  3ON4 A;  2TCT A;  3BJB A;  2XGD A;  4M3E A;  5CQG A;  5EFY A;  5F0C A;  2ZB9 A;  2QCO A;  3VVX A;  4ICH A;  1JT6 A;  2Y30 A;  3RH2 A;  3O8H A;  2G7G A;  3VOX A;  3LSP A;  3ANG A;  3QQA A;  3DU5 A;  2ID3 A;  2B3W A;  1JUS A;  2NP3 A;  3COL A;  3V78 A;  2UXU A;  5GP9 A;  2X9D A;  3BTC A;  3MVP A;  2GFN A;  3NI7 A;  3NNR A;  2VPR A;  2Q24 A;  4XK4 A;  2QOP A;  5K7F A;  3NXC A;  3BR2 A;  2DG7 A;  3CRJ A;  3JSJ A;  3VVZ A;  5J3L A;  3VW2 A;  1QPI A;  2RAE A;  2QKO A;  4MXM A;  4MK6 A;  2I10 A;  1T33 A;  5IPA A;  2ID6 A;  1JTY A;  4HKU A;  4NEL A;  3Q0W A;  1JUM A;  5EZH A;  2Y2Z A;  3HTJ A;  3LOC A;  2XGE A;  5CXI A;  4U9N A;  2QIB A;  2R7O A;  3IH3 A;  2NS7 A;  5H9T A;  3GZI A;  4OD5 A; 
#chains in the Genus database with same CATH homology
 1JUP A;  2XRL A;  3BTJ A;  4ME9 A;  3QPL A;  2QWT A;  2X6O A;  2XDN A;  3T6N A;  3CCY A;  3VW0 A;  5GPC A;  2ZOY A;  4YZE A;  1ZKG A;  2UXH A;  3DEW A;  3C2B A;  4D5F A;  3RD3 A;  2G7L A;  4D7M A;  4AUX A;  3IH2 A;  1SGM A;  3BR5 A;  3SDG A;  3KKD A;  2F07 A;  3FK6 A;  2D6Y A;  2RAS A;  5C4Y A;  2JK3 A;  1BJZ A;  2ZCN A;  3HGY A;  3LSJ A;  2DTZ A;  4JNN A;  3E7Q A;  4JYK A;  3FIW A;  2G0E A;  5FKN A;  1U9O A;  2OPT A;  1RKW A;  2UXP A;  2TRT A;  2HKU A;  3HTH A;  4MO7 A;  4PXI A;  5EZG A;  3EGQ A;  3O60 A;  4W1U A;  1RPW A;  2GBY A;  1ORK A;  2UXI A;  4D5C A;  2ZCX A;  2REK A;  1VI0 A;  3G56 A;  3PAS A;  3ZQL A;  3BNI A;  5HSZ A;  3WHC A;  2V57 A;  3FRQ A;  3ZQF A;  3HIM A;  5F0F A;  3NRG A;  3PM1 A;  2NS8 A;  3HE0 A;  4GCT A;  3LJL A;  3NPI A;  3QKX A;  4GCK A;  3Q3S A;  2QTQ A;  3B81 A;  2XB5 A;  2VKV A;  3BT9 A;  4X1E A;  3BR3 A;  5FHP A;  5FKK A;  3C07 A;  3S5R A;  5CW8 A;  4W97 A;  4V2G A;  3G1M A;  2HQ5 A;  5K7H A;  2HYJ A;  3CJD A;  2WGB A;  2W53 A;  3MNL A;  2HXI A;  2G7S A;  2XGC A;  3CWR A;  2NP5 A;  3VOK A;  3F0C A;  4I76 A;  3BR0 A;  4G12 A;  3ON2 A;  5FGL A;  3HTA A;  2UXO A;  1ZK8 A;  2JJ7 A;  3BQZ A;  3VUQ A;  5F08 A;  2NX4 A;  2XPU A;  3BHQ A;  1Z0X A;  5FKO A;  1U9N A;  2IU5 A;  2XPW A;  3F1B A;  3O8G A;  3V6G A;  5F0H A;  2WV1 A;  3SFI A;  4B1R A;  4CGR A;  5IP6 A;  2IEK A;  4B3A A;  2IAI A;  2FBQ A;  3BTI A;  4M3G A;  3AQS A;  5IOZ A;  3DPJ A;  3P9T A;  5D18 A;  3TP3 A;  2O7T A;  3GEU A;  1Z77 A;  2OF7 A;  3HTI A;  4I6Z A;  3ANP A;  2FJ1 A;  2XPV A;  3IH4 A;  2EH3 A;  5J1U A;  4DW6 A;  2O7O A;  3G1O A;  4M3F A;  3HGG A;  4GFL A;  3TP0 A;  3ZQG A;  5K58 A;  5K7Z A;  3Q0V A;  1T56 A;  5GPA A;  2OI8 A;  3G1L A;  3Q0U A;  2HYT A;  4GCL A;  2Y31 A;  2FX0 A;  1UI6 A;  3LWJ A;  4NN1 A;  5IOY A;  4ABZ A;  1UI5 A;  2YVE A;  3VPR A;  2GEN A;  3G7R A;  3KKC A;  4M3B A;  1A6I A;  2FQ4 A;  4AC0 A;  3BTL A;  2PBX A;  1QVT A;  3VIB A;  3VW1 A;  3ZQH A;  5CXG A;  3DCF A;  3ZQI A;  5AQC A;  3CDL A;  3QPS A;  5D19 A;  3BQY A;  1QVU A;  4KWA A;  3KZ9 A;  3BR1 A;  1JT0 A;  4M3D A;  4AF5 A;  4L62 A;  2GUH A;  3PPB A;  2FD5 A;  4GFK A;  3B6A A;  2ZCM A;  5FMP A;  2HXO A;  2YVH A;  2ZOZ A;  5F27 A;  3LHQ A;  3EUP A;  3BCG A;  4JKZ A;  5J1Y A;  1RKT A;  3IUV A;  2PZ9 A;  5HAW A;  4ACI A;  3VVY A;  4JL3 A;  2G3B A;  2DG8 A;  5J1R A;  3QBM A;  5F04 A;  2WUI A;  4AC6 A;  5D1R A;  2VKE A;  5FKM A;  3AQT A;  5DAJ A;  4UDS A;  3B6C A;  2OER A;  3KNW A;  2IBD A;  5F1J A;  3BR6 A;  2RHA A;  5EYR A;  5HBU A;  3BRU A;  3FK7 A;  4D7N A;  1JTX A;  3VP5 A;  5FKL A;  4V2F A;  3WHB A;  3LSR A;  3ON4 A;  2TCT A;  3BJB A;  2XGD A;  4M3E A;  5EFY A;  5F0C A;  2ZB9 A;  2QCO A;  3VVX A;  4ICH A;  1JT6 A;  2Y30 A;  3RH2 A;  3O8H A;  2G7G A;  3VOX A;  3LSP A;  3ANG A;  3QQA A;  2ID3 A;  1JUS A;  2NP3 A;  3COL A;  3V78 A;  2UXU A;  5GP9 A;  2X9D A;  3BTC A;  3MVP A;  2GFN A;  3NI7 A;  3NNR A;  2VPR A;  2Q24 A;  4XK4 A;  2QOP A;  5K7F A;  3NXC A;  3BR2 A;  2DG7 A;  3CRJ A;  3JSJ A;  3VVZ A;  5J3L A;  3VW2 A;  1QPI A;  2RAE A;  2QKO A;  4MXM A;  4MK6 A;  2I10 A;  1T33 A;  5IPA A;  2ID6 A;  1JTY A;  4HKU A;  4NEL A;  3Q0W A;  1JUM A;  2Y2Z A;  3HTJ A;  3LOC A;  5CXI A;  2XGE A;  5EZH A;  2QIB A;  3IH3 A;  2NS7 A;  5H9T A;  3GZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...