2GENA

Structural genomics, the crystal structure of a probable transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
RKDEILQAALACFSEHGVDATTIEMIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQYAALLEAGFARARSAEETVRLLVTSYIDWVVANPDWARFILHSRGRVEAGELGERLRADNQAHFARIHAALAGYRAEGLFREMPDDCFASVVIGPAHDLARQWLAGRTRVALADCRELLAQVAWDSVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords probable transcriptional regulator
publication title The crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2genA00
2ZOZA 2WV1A 1UI5A 5FGLA 2O7TA 5FKLA 3ZQIA 3EGQA 3G1MA 5K7FA 3VOXA 3QPSA 3C2BA 4M3FA 3BNIA 3BCGA 3VOKA 4HKUA 2ZCNA 2G0EA 3GZIA 1ORKA 2GUHA 2XGDA 4ICHA 5J1UA 1Z77A 5J3LA 2W53A 3BR2A 2ID3A 4GFKA 2FQ4A 3DCFA 3HGYA 5D1RA 3BQYA 4MXMA 4M3EA 5GPCA 5FKOA 5AQCA 3BRUA 2RASA 5GPAA 3CJDA 2YVHA 2RAEA 5GP9A 5J1YA 2NP3A 1JUMA 3B81A 5FKNA 3CDLA 4AUXA 3ZQHA 3LSJA 2RHAA 1JT0A 4X1EA 4ACIA 1UI6A 3FRQA 3NI7A 4CGRA 2HQ5A 2NX4A 2IU5A 4B3AA 2QTQA 5FMPA 2IEKA 5IOYA 2VKEA 2UXHA 3NNRA 2VKVA 2NP5A 3VVYA 3EUPA 1QPIA 3NPIA 4KWAA 2NS7A 3PPBA 5FHPA 5F08A 3BT9A 4W1UA 2FJ1A 1JT6A 4M3GA 3S5RA 3Q0WA 3LSRA 2QKOA 2X9DA 5FKMA 2OF7A 1JUSA 3ANPA 4JYKA 3Q0UA 2QWTA 3QBMA 3COLA 3IH3A 2G7SA 3FIWA 1RKTA 1VI0A 3G1OA 3BR1A 2V57A 4MO7A 3O60A 3IH2A 2I10A 1RKWA 2HYJA 4PXIA 3B6AA 3HTAA 2ZCXA 2XDNA 3MNLA 5EFYA 3BR0A 3CRJA 4V2GA 3HGGA 2UXPA 2Y31A 2G7LA 2QIBA 5CW8A 3ZQFA 4AF5A 4NELA 5IP6A 2DG7A 4GCKA 2PZ9A 2G3BA 2DTZA 4V2FA 3KKCA 1RPWA 5K58A 3F0CA 4JL3A 1BJZA 3SDGA 2FD5A 5F1JA 4YZEA 3BR6A 3HIMA 2QCOA 3T6NA 2QOPA 5F0CA 1A6IA 5F04A 3LSPA 5CXGA 3MVPA 3P9TA 1Z0XA 5F0HA 3B6CA 3G7RA 2JJ7A 3AQSA 4MK6A 2X6OA 3HTIA 2PBXA 3NRGA 5HSZA 5HAWA 2UXUA 5CXIA 2UXOA 5EYRA 2O7OA 3QPLA 3HTJA 3VUQA 3KZ9A 4I76A 4GCTA 4D5CA 1QVUA 4GFLA 2TCTA 3SFIA 2G7GA 2GBYA 1T33A 2IAIA 2F07A 2TRTA 2XGEA 5IOZA 3ON2A 4G12A 3BHQA 3HE0A 4GCLA 1ZKGA 3BR5A 3DPJA 3NXCA 2HKUA 1SGMA 2Y30A 1JTXA 3G56A 4AC0A 2GENA 3FK6A 2XRLA 2UXIA 1U9OA 2FBQA 3C07A 5C4YA 5H9TA 3V78A 5DAJA 2ID6A 3ZQLA 3JSJA 2JK3A 3PM1A 5K7ZA 2DG8A 3VVXA 2ZB9A 3G1LA 3RD3A 3QQAA 3TP0A 3WHCA 3IUVA 3BTLA 4ME9A 3DEWA 3Q0VA 4D7MA 1JTYA 2XPUA 4D7NA 4UDSA 3KKDA 3LHQA 5IPAA 5FKKA 2D6YA 2IBDA 3RH2A 3BTJA 3CWRA 2Q24A 3VW0A 2WUIA 3LWJA 3Q3SA 3QKXA 3BR3A 4JKZA 1JUPA 2FX0A 3V6GA 5D19A 5J1RA 2OERA 2HXIA 3LOCA 4AC6A 4L62A 1T56A 3ON4A 3FK7A 2ZCMA 2XPVA 5EZGA 5K7HA 3CCYA 4M3BA 5F27A 2Y2ZA 3LJLA 1U9NA 3VVZA 4ABZA 3TP3A 4W97A 3KNWA 2HXOA 3PASA 2GFNA 3AQTA 3ZQGA 2VPRA 4D5FA 2HYTA 3VPRA 3VW1A 3BQZA 3IH4A 1QVTA 3BTIA 4XK4A 4B1RA 3GEUA 4NN1A 4M3DA 2XGCA 4DW6A 2XB5A 4JNNA 3O8GA 3VIBA 2REKA 4I6ZA 1ZK8A 5D18A 5HBUA 2XPWA 3E7QA 3VP5A 3VW2A 2OI8A 3O8HA 3F1BA 2NS8A 5F0FA 2YVEA 5EZHA 3BJBA 3HTHA 2EH3A 3BTCA 2OPTA 2WGBA 3ANGA 3WHBA 2ZOYA
chains in the Genus database with same CATH superfamily
2ZOZA 2WV1A 1UI5A 5FGLA 3FHNA 2O7TA 5FKLA 3ZQIA 3EGQA 3G1MA 5K7FA 3VOXA 3QPSA 3C2BA 4M3FA 3BNIA 3BCGA 3VOKA 4HKUA 2ZCNA 2G0EA 2B3WA 3GZIA 1ORKA 2GUHA 2XGDA 4ICHA 5J1UA 1Z77A 5J3LA 2W53A 3BR2A 2ID3A 4GFKA 2FQ4A 3DCFA 3HGYA 5D1RA 3BQYA 2FJI1 4MXMA 4M3EA 5GPCA 5FKOA 5AQCA 3BRUA 2RASA 4DVYP 5GPAA 3CJDA 2YVHA 2RAEA 2R7RA 5GP9A 5J1YA 2NP3A 2R7WA 1JUMA 3B81A 5FKNA 3CDLA 4AUXA 3ZQHA 3LSJA 2RHAA 1JT0A 4X1EA 4ACIA 1UI6A 3FRQA 3NI7A 4CGRA 4U9NA 2HQ5A 2NX4A 2IU5A 2R7QA 4B3AA 2QTQA 5FMPA 2IEKA 5IOYA 2VKEA 2UXHA 3NNRA 2VKVA 2NP5A 3VVYA 3EUPA 1QPIA 3NPIA 4KWAA 2NS7A 3PPBA 5FHPA 5F08A 4OD5A 2R7SA 3BT9A 4W1UA 3K8PC 2FJ1A 1JT6A 4M3GA 3S5RA 3Q0WA 3LSRA 2QKOA 2R7VA 2X9DA 5FKMA 2OF7A 1JUSA 3ANPA 4JYKA 3Q0UA 2QWTA 3QBMA 3COLA 3IH3A 2G7SA 3FIWA 1RKTA 1VI0A 3G1OA 3BR1A 2V57A 4MO7A 3O60A 3IH2A 2I10A 2R7TA 1RKWA 2HYJA 4PXIA 3B6AA 3HTAA 2ZCXA 2XDNA 3MNLA 3DU5A 5EFYA 3BR0A 3CRJA 4V2GA 3HGGA 2UXPA 2Y31A 2G7LA 2QIBA 5CW8A 3ZQFA 4AF5A 4NELA 5IP6A 2DG7A 4GCKA 2PZ9A 2G3BA 2DTZA 4V2FA 3SWHA 3KKCA 1RPWA 5K58A 3F0CA 3NS4A 4JL3A 1BJZA 3SDGA 2FD5A 5F1JA 4YZEA 3BR6A 3HIMA 2QCOA 3T6NA 2QOPA 5F0CA 1A6IA 5F04A 3LSPA 5CXGA 3MVPA 3P9TA 1Z0XA 4IRVA 3KYLA 5F0HA 3B6CA 4U9LA 3G7RA 2JJ7A 3AQSA 4WIBA 4MK6A 2X6OA 5CQGA 3HTIA 2PBXA 3NRGA 5HSZA 5HAWA 2UXUA 5CXIA 2UXOA 5EYRA 2O7OA 3QPLA 3HTJA 3VUQA 3KZ9A 4I76A 4GCTA 4D5CA 1QVUA 4GFLA 2TCTA 3SFIA 2G7GA 2ZY9A 2GBYA 1T33A 2IAIA 2F07A 2TRTA 2XGEA 5IOZA 3ON2A 4G12A 2B1EA 3BHQA 3HE0A 4GCLA 1ZKGA 3BR5A 3DPJA 3NXCA 2HKUA 1SGMA 2Y30A 1JTXA 3G56A 4AC0A 2GENA 3FK6A 2XRLA 2UXIA 1U9OA 2FBQA 3C07A 5C4YA 2YVXA 5H9TA 3V78A 5DAJA 2ID6A 3ZQLA 3JSJA 2JK3A 3PM1A 5K7ZA 2DG8A 3VVXA 2ZB9A 3G1LA 3RD3A 3QQAA 3TP0A 3WHCA 3IUVA 3BTLA 4ME9A 3DEWA 3Q0VA 4D7MA 1JTYA 2XPUA 4D7NA 4UDSA 3KKDA 3LHQA 5IPAA 5FKKA 2D6YA 2IBDA 3RH2A 3BTJA 3CWRA 2Q24A 3VW0A 2WUIA 3LWJA 3Q3SA 3QKXA 3BR3A 4JKZA 1JUPA 2FX0A 3V6GA 5D19A 5J1RA 2OERA 2HXIA 3LOCA 4AC6A 4L62A 1T56A 3ON4A 3FK7A 2ZCMA 2XPVA 5EZGA 5K7HA 3CCYA 4M3BA 5F27A 4C2MA 2Y2ZA 3LJLA 1U9NA 3VVZA 4ABZA 3TP3A 4W97A 3KNWA 2R7UA 2HXOA 3PASA 2GFNA 3AQTA 3ZQGA 2VPRA 3VTIA 4D5FA 2HYTA 3VPRA 3VW1A 3BQZA 3IH4A 4OD4A 2R7OA 1QVTA 3BTIA 4XK4A 4B1RA 3GEUA 4NN1A 4M3DA 2XGCA 4DW6A 2XB5A 4JNNA 3O8GA 3VIBA 2REKA 4I6ZA 1ZK8A 5D18A 5HBUA 3DU6A 2XPWA 3E7QA 3VP5A 3VW2A 2OI8A 3O8HA 3F1BA 2NS8A 2PFVA 5F0FA 2YVEA 5EZHA 3BJBA 3HTHA 2R7XA 2EH3A 3BTCA 2OPTA 2WGBA 2A2FX 3ANGA 3WHBA 2ZOYA
chains in the Genus database with same CATH topology
2ZOZA 2WV1A 1UI5A 5FGLA 2O7TA 5FKLA 3ZQIA 3EGQA 3G1MA 5K7FA 3VOXA 3QPSA 3C2BA 4M3FA 3BNIA 3BCGA 3VOKA 4HKUA 2ZCNA 2G0EA 3GZIA 1ORKA 2GUHA 2XGDA 4ICHA 5J1UA 1Z77A 5J3LA 2W53A 3BR2A 2ID3A 4GFKA 2FQ4A 3DCFA 3HGYA 5D1RA 3BQYA 4MXMA 4M3EA 5GPCA 5FKOA 5AQCA 3BRUA 2RASA 5GPAA 3CJDA 2YVHA 2RAEA 5GP9A 5J1YA 2NP3A 1JUMA 3B81A 5FKNA 3CDLA 4AUXA 3ZQHA 3LSJA 2RHAA 1JT0A 4X1EA 4ACIA 1UI6A 3FRQA 3NI7A 4CGRA 2HQ5A 2NX4A 2IU5A 4B3AA 2QTQA 5FMPA 2IEKA 5IOYA 2VKEA 2UXHA 3NNRA 2VKVA 2NP5A 3VVYA 3EUPA 1QPIA 3NPIA 4KWAA 2NS7A 3PPBA 5FHPA 5F08A 3BT9A 4W1UA 2FJ1A 1JT6A 4M3GA 3S5RA 3Q0WA 3LSRA 2QKOA 2X9DA 5FKMA 2OF7A 1JUSA 3ANPA 4JYKA 3Q0UA 2QWTA 3QBMA 3COLA 3IH3A 2G7SA 3FIWA 1RKTA 1VI0A 3G1OA 3BR1A 2V57A 4MO7A 3O60A 3IH2A 2I10A 1RKWA 2HYJA 4PXIA 3B6AA 3HTAA 2ZCXA 2XDNA 3MNLA 5EFYA 3BR0A 3CRJA 4V2GA 3HGGA 2UXPA 2Y31A 2G7LA 2QIBA 5CW8A 3ZQFA 4AF5A 4NELA 5IP6A 2DG7A 4GCKA 2PZ9A 2G3BA 2DTZA 4V2FA 3KKCA 1RPWA 5K58A 3F0CA 4JL3A 1BJZA 3SDGA 2FD5A 5F1JA 4YZEA 3BR6A 3HIMA 2QCOA 3T6NA 2QOPA 5F0CA 1A6IA 5F04A 3LSPA 5CXGA 3MVPA 3P9TA 1Z0XA 5F0HA 3B6CA 3G7RA 2JJ7A 3AQSA 4MK6A 2X6OA 3HTIA 2PBXA 3NRGA 5HSZA 5HAWA 2UXUA 5CXIA 2UXOA 5EYRA 2O7OA 3QPLA 3HTJA 3VUQA 3KZ9A 4I76A 4GCTA 4D5CA 1QVUA 4GFLA 2TCTA 3SFIA 2G7GA 2GBYA 1T33A 2IAIA 2F07A 2TRTA 2XGEA 5IOZA 3ON2A 4G12A 3BHQA 3HE0A 4GCLA 1ZKGA 3BR5A 3DPJA 3NXCA 2HKUA 1SGMA 2Y30A 1JTXA 3G56A 4AC0A 2GENA 3FK6A 2XRLA 2UXIA 1U9OA 2FBQA 3C07A 5C4YA 5H9TA 3V78A 5DAJA 2ID6A 3ZQLA 3JSJA 2JK3A 3PM1A 5K7ZA 2DG8A 3VVXA 2ZB9A 3G1LA 3RD3A 3QQAA 3TP0A 3WHCA 3IUVA 3BTLA 4ME9A 3DEWA 3Q0VA 4D7MA 1JTYA 2XPUA 4D7NA 4UDSA 3KKDA 3LHQA 5IPAA 5FKKA 2D6YA 2IBDA 3RH2A 3BTJA 3CWRA 2Q24A 3VW0A 2WUIA 3LWJA 3Q3SA 3QKXA 3BR3A 4JKZA 1JUPA 2FX0A 3V6GA 5D19A 5J1RA 2OERA 2HXIA 3LOCA 4AC6A 4L62A 1T56A 3ON4A 3FK7A 2ZCMA 2XPVA 5EZGA 5K7HA 3CCYA 4M3BA 5F27A 2Y2ZA 3LJLA 1U9NA 3VVZA 4ABZA 3TP3A 4W97A 3KNWA 2HXOA 3PASA 2GFNA 3AQTA 3ZQGA 2VPRA 4D5FA 2HYTA 3VPRA 3VW1A 3BQZA 3IH4A 1QVTA 3BTIA 4XK4A 4B1RA 3GEUA 4NN1A 4M3DA 2XGCA 4DW6A 2XB5A 4JNNA 3O8GA 3VIBA 2REKA 4I6ZA 1ZK8A 5D18A 5HBUA 2XPWA 3E7QA 3VP5A 3VW2A 2OI8A 3O8HA 3F1BA 2NS8A 5F0FA 2YVEA 5EZHA 3BJBA 3HTHA 2EH3A 3BTCA 2OPTA 2WGBA 3ANGA 3WHBA 2ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOZ A;  2WV1 A;  1UI5 A;  5FGL A;  2O7T A;  5FKL A;  3ZQI A;  3EGQ A;  3G1M A;  5K7F A;  3VOX A;  3QPS A;  3C2B A;  4M3F A;  3BNI A;  3BCG A;  3VOK A;  4HKU A;  2ZCN A;  2G0E A;  3GZI A;  1ORK A;  2GUH A;  2XGD A;  4ICH A;  5J1U A;  1Z77 A;  5J3L A;  2W53 A;  3BR2 A;  2ID3 A;  4GFK A;  2FQ4 A;  3DCF A;  3HGY A;  5D1R A;  3BQY A;  4MXM A;  4M3E A;  5GPC A;  5FKO A;  5AQC A;  3BRU A;  2RAS A;  5GPA A;  3CJD A;  2YVH A;  2RAE A;  5GP9 A;  5J1Y A;  2NP3 A;  1JUM A;  3B81 A;  5FKN A;  3CDL A;  4AUX A;  3ZQH A;  3LSJ A;  2RHA A;  1JT0 A;  4X1E A;  4ACI A;  1UI6 A;  3FRQ A;  3NI7 A;  4CGR A;  2HQ5 A;  2NX4 A;  2IU5 A;  4B3A A;  2QTQ A;  5FMP A;  2IEK A;  5IOY A;  2VKE A;  2UXH A;  3NNR A;  2VKV A;  2NP5 A;  3VVY A;  3EUP A;  1QPI A;  3NPI A;  4KWA A;  2NS7 A;  3PPB A;  5FHP A;  5F08 A;  3BT9 A;  4W1U A;  2FJ1 A;  1JT6 A;  4M3G A;  3S5R A;  3Q0W A;  3LSR A;  2QKO A;  2X9D A;  5FKM A;  2OF7 A;  1JUS A;  3ANP A;  4JYK A;  3Q0U A;  2QWT A;  3QBM A;  3COL A;  3IH3 A;  2G7S A;  3FIW A;  1RKT A;  1VI0 A;  3G1O A;  3BR1 A;  2V57 A;  4MO7 A;  3O60 A;  3IH2 A;  2I10 A;  1RKW A;  2HYJ A;  4PXI A;  3B6A A;  3HTA A;  2ZCX A;  2XDN A;  3MNL A;  5EFY A;  3BR0 A;  3CRJ A;  4V2G A;  3HGG A;  2UXP A;  2Y31 A;  2G7L A;  2QIB A;  5CW8 A;  3ZQF A;  4AF5 A;  4NEL A;  5IP6 A;  2DG7 A;  4GCK A;  2PZ9 A;  2G3B A;  2DTZ A;  4V2F A;  3KKC A;  1RPW A;  5K58 A;  3F0C A;  4JL3 A;  1BJZ A;  3SDG A;  2FD5 A;  5F1J A;  4YZE A;  3BR6 A;  3HIM A;  2QCO A;  3T6N A;  2QOP A;  5F0C A;  1A6I A;  5F04 A;  3LSP A;  5CXG A;  3MVP A;  3P9T A;  1Z0X A;  5F0H A;  3B6C A;  3G7R A;  2JJ7 A;  3AQS A;  4MK6 A;  2X6O A;  3HTI A;  2PBX A;  3NRG A;  5HSZ A;  5HAW A;  2UXU A;  5CXI A;  2UXO A;  5EYR A;  2O7O A;  3QPL A;  3HTJ A;  3VUQ A;  3KZ9 A;  4I76 A;  4GCT A;  4D5C A;  1QVU A;  4GFL A;  2TCT A;  3SFI A;  2G7G A;  2GBY A;  1T33 A;  2IAI A;  2F07 A;  2TRT A;  2XGE A;  5IOZ A;  3ON2 A;  4G12 A;  3BHQ A;  3HE0 A;  4GCL A;  1ZKG A;  3BR5 A;  3DPJ A;  3NXC A;  2HKU A;  1SGM A;  2Y30 A;  1JTX A;  3G56 A;  4AC0 A;  2GEN A;  3FK6 A;  2XRL A;  2UXI A;  1U9O A;  2FBQ A;  3C07 A;  5C4Y A;  5H9T A;  3V78 A;  5DAJ A;  2ID6 A;  3ZQL A;  3JSJ A;  2JK3 A;  3PM1 A;  5K7Z A;  2DG8 A;  3VVX A;  2ZB9 A;  3G1L A;  3RD3 A;  3QQA A;  3TP0 A;  3WHC A;  3IUV A;  3BTL A;  4ME9 A;  3DEW A;  3Q0V A;  4D7M A;  1JTY A;  2XPU A;  4D7N A;  4UDS A;  3KKD A;  3LHQ A;  5IPA A;  5FKK A;  2D6Y A;  2IBD A;  3RH2 A;  3BTJ A;  3CWR A;  2Q24 A;  3VW0 A;  2WUI A;  3LWJ A;  3Q3S A;  3QKX A;  3BR3 A;  4JKZ A;  1JUP A;  2FX0 A;  3V6G A;  5D19 A;  5J1R A;  2OER A;  2HXI A;  3LOC A;  4AC6 A;  4L62 A;  1T56 A;  3ON4 A;  3FK7 A;  2ZCM A;  2XPV A;  5EZG A;  5K7H A;  3CCY A;  4M3B A;  5F27 A;  2Y2Z A;  3LJL A;  1U9N A;  3VVZ A;  4ABZ A;  3TP3 A;  4W97 A;  3KNW A;  2HXO A;  3PAS A;  2GFN A;  3AQT A;  3ZQG A;  2VPR A;  4D5F A;  2HYT A;  3VPR A;  3VW1 A;  3BQZ A;  3IH4 A;  1QVT A;  3BTI A;  4XK4 A;  4B1R A;  3GEU A;  4NN1 A;  4M3D A;  2XGC A;  4DW6 A;  2XB5 A;  4JNN A;  3O8G A;  3VIB A;  2REK A;  4I6Z A;  1ZK8 A;  5D18 A;  5HBU A;  2XPW A;  3E7Q A;  3VP5 A;  3VW2 A;  2OI8 A;  3O8H A;  3F1B A;  2NS8 A;  5F0F A;  2YVE A;  5EZH A;  3BJB A;  3HTH A;  2EH3 A;  3BTC A;  2OPT A;  2WGB A;  3ANG A;  3WHB A;  2ZOY A; 
#chains in the Genus database with same CATH topology
 2ZOZ A;  2WV1 A;  1UI5 A;  5FGL A;  3FHN A;  2O7T A;  5FKL A;  3ZQI A;  3EGQ A;  3G1M A;  5K7F A;  3VOX A;  3QPS A;  3C2B A;  4M3F A;  3BNI A;  3BCG A;  3VOK A;  4HKU A;  2ZCN A;  2G0E A;  2B3W A;  3GZI A;  1ORK A;  2GUH A;  2XGD A;  4ICH A;  5J1U A;  1Z77 A;  5J3L A;  2W53 A;  3BR2 A;  2ID3 A;  4GFK A;  2FQ4 A;  3DCF A;  3HGY A;  5D1R A;  3BQY A;  2FJI 1;  4MXM A;  4M3E A;  5GPC A;  5FKO A;  5AQC A;  3BRU A;  2RAS A;  4DVY P;  5GPA A;  3CJD A;  2YVH A;  2RAE A;  2R7R A;  5GP9 A;  5J1Y A;  2NP3 A;  2R7W A;  1JUM A;  3B81 A;  5FKN A;  3CDL A;  4AUX A;  3ZQH A;  3LSJ A;  2RHA A;  1JT0 A;  4X1E A;  4ACI A;  1UI6 A;  3FRQ A;  3NI7 A;  4CGR A;  4U9N A;  2HQ5 A;  2NX4 A;  2IU5 A;  2R7Q A;  4B3A A;  2QTQ A;  5FMP A;  2IEK A;  5IOY A;  2VKE A;  2UXH A;  3NNR A;  2VKV A;  2NP5 A;  3VVY A;  3EUP A;  1QPI A;  3NPI A;  4KWA A;  2NS7 A;  3PPB A;  5FHP A;  5F08 A;  4OD5 A;  2R7S A;  3BT9 A;  4W1U A;  3K8P C;  2FJ1 A;  1JT6 A;  4M3G A;  3S5R A;  3Q0W A;  3LSR A;  2QKO A;  2R7V A;  2X9D A;  5FKM A;  2OF7 A;  1JUS A;  3ANP A;  4JYK A;  3Q0U A;  2QWT A;  3QBM A;  3COL A;  3IH3 A;  2G7S A;  3FIW A;  1RKT A;  1VI0 A;  3G1O A;  3BR1 A;  2V57 A;  4MO7 A;  3O60 A;  3IH2 A;  2I10 A;  2R7T A;  1RKW A;  2HYJ A;  4PXI A;  3B6A A;  3HTA A;  2ZCX A;  2XDN A;  3MNL A;  3DU5 A;  5EFY A;  3BR0 A;  3CRJ A;  4V2G A;  3HGG A;  2UXP A;  2Y31 A;  2G7L A;  2QIB A;  5CW8 A;  3ZQF A;  4AF5 A;  4NEL A;  5IP6 A;  2DG7 A;  4GCK A;  2PZ9 A;  2G3B A;  2DTZ A;  4V2F A;  3SWH A;  3KKC A;  1RPW A;  5K58 A;  3F0C A;  3NS4 A;  4JL3 A;  1BJZ A;  3SDG A;  2FD5 A;  5F1J A;  4YZE A;  3BR6 A;  3HIM A;  2QCO A;  3T6N A;  2QOP A;  5F0C A;  1A6I A;  5F04 A;  3LSP A;  5CXG A;  3MVP A;  3P9T A;  1Z0X A;  4IRV A;  3KYL A;  5F0H A;  3B6C A;  4U9L A;  3G7R A;  2JJ7 A;  3AQS A;  4WIB A;  4MK6 A;  2X6O A;  5CQG A;  3HTI A;  2PBX A;  3NRG A;  5HSZ A;  5HAW A;  2UXU A;  5CXI A;  2UXO A;  5EYR A;  2O7O A;  3QPL A;  3HTJ A;  3VUQ A;  3KZ9 A;  4I76 A;  4GCT A;  4D5C A;  1QVU A;  4GFL A;  2TCT A;  3SFI A;  2G7G A;  2ZY9 A;  2GBY A;  1T33 A;  2IAI A;  2F07 A;  2TRT A;  2XGE A;  5IOZ A;  3ON2 A;  4G12 A;  2B1E A;  3BHQ A;  3HE0 A;  4GCL A;  1ZKG A;  3BR5 A;  3DPJ A;  3NXC A;  2HKU A;  1SGM A;  2Y30 A;  1JTX A;  3G56 A;  4AC0 A;  2GEN A;  3FK6 A;  2XRL A;  2UXI A;  1U9O A;  2FBQ A;  3C07 A;  5C4Y A;  2YVX A;  5H9T A;  3V78 A;  5DAJ A;  2ID6 A;  3ZQL A;  3JSJ A;  2JK3 A;  3PM1 A;  5K7Z A;  2DG8 A;  3VVX A;  2ZB9 A;  3G1L A;  3RD3 A;  3QQA A;  3TP0 A;  3WHC A;  3IUV A;  3BTL A;  4ME9 A;  3DEW A;  3Q0V A;  4D7M A;  1JTY A;  2XPU A;  4D7N A;  4UDS A;  3KKD A;  3LHQ A;  5IPA A;  5FKK A;  2D6Y A;  2IBD A;  3RH2 A;  3BTJ A;  3CWR A;  2Q24 A;  3VW0 A;  2WUI A;  3LWJ A;  3Q3S A;  3QKX A;  3BR3 A;  4JKZ A;  1JUP A;  2FX0 A;  3V6G A;  5D19 A;  5J1R A;  2OER A;  2HXI A;  3LOC A;  4AC6 A;  4L62 A;  1T56 A;  3ON4 A;  3FK7 A;  2ZCM A;  2XPV A;  5EZG A;  5K7H A;  3CCY A;  4M3B A;  5F27 A;  4C2M A;  2Y2Z A;  3LJL A;  1U9N A;  3VVZ A;  4ABZ A;  3TP3 A;  4W97 A;  3KNW A;  2R7U A;  2HXO A;  3PAS A;  2GFN A;  3AQT A;  3ZQG A;  2VPR A;  3VTI A;  4D5F A;  2HYT A;  3VPR A;  3VW1 A;  3BQZ A;  3IH4 A;  4OD4 A;  2R7O A;  1QVT A;  3BTI A;  4XK4 A;  4B1R A;  3GEU A;  4NN1 A;  4M3D A;  2XGC A;  4DW6 A;  2XB5 A;  4JNN A;  3O8G A;  3VIB A;  2REK A;  4I6Z A;  1ZK8 A;  5D18 A;  5HBU A;  3DU6 A;  2XPW A;  3E7Q A;  3VP5 A;  3VW2 A;  2OI8 A;  3O8H A;  3F1B A;  2NS8 A;  2PFV A;  5F0F A;  2YVE A;  5EZH A;  3BJB A;  3HTH A;  2R7X A;  2EH3 A;  3BTC A;  2OPT A;  2WGB A;  2A2F X;  3ANG A;  3WHB A;  2ZOY A; 
#chains in the Genus database with same CATH homology
 2ZOZ A;  2WV1 A;  1UI5 A;  5FGL A;  2O7T A;  5FKL A;  3ZQI A;  3EGQ A;  3G1M A;  5K7F A;  3VOX A;  3QPS A;  3C2B A;  4M3F A;  3BNI A;  3BCG A;  3VOK A;  4HKU A;  2ZCN A;  2G0E A;  3GZI A;  1ORK A;  2GUH A;  2XGD A;  4ICH A;  5J1U A;  1Z77 A;  5J3L A;  2W53 A;  3BR2 A;  2ID3 A;  4GFK A;  2FQ4 A;  3DCF A;  3HGY A;  5D1R A;  3BQY A;  4MXM A;  4M3E A;  5GPC A;  5FKO A;  5AQC A;  3BRU A;  2RAS A;  5GPA A;  3CJD A;  2YVH A;  2RAE A;  5GP9 A;  5J1Y A;  2NP3 A;  1JUM A;  3B81 A;  5FKN A;  3CDL A;  4AUX A;  3ZQH A;  3LSJ A;  2RHA A;  1JT0 A;  4X1E A;  4ACI A;  1UI6 A;  3FRQ A;  3NI7 A;  4CGR A;  2HQ5 A;  2NX4 A;  2IU5 A;  4B3A A;  2QTQ A;  5FMP A;  2IEK A;  5IOY A;  2VKE A;  2UXH A;  3NNR A;  2VKV A;  2NP5 A;  3VVY A;  3EUP A;  1QPI A;  3NPI A;  4KWA A;  2NS7 A;  3PPB A;  5FHP A;  5F08 A;  3BT9 A;  4W1U A;  2FJ1 A;  1JT6 A;  4M3G A;  3S5R A;  3Q0W A;  3LSR A;  2QKO A;  2X9D A;  5FKM A;  2OF7 A;  1JUS A;  3ANP A;  4JYK A;  3Q0U A;  2QWT A;  3QBM A;  3COL A;  3IH3 A;  2G7S A;  3FIW A;  1RKT A;  1VI0 A;  3G1O A;  3BR1 A;  2V57 A;  4MO7 A;  3O60 A;  3IH2 A;  2I10 A;  1RKW A;  2HYJ A;  4PXI A;  3B6A A;  3HTA A;  2ZCX A;  2XDN A;  3MNL A;  5EFY A;  3BR0 A;  3CRJ A;  4V2G A;  3HGG A;  2UXP A;  2Y31 A;  2G7L A;  2QIB A;  5CW8 A;  3ZQF A;  4AF5 A;  4NEL A;  5IP6 A;  2DG7 A;  4GCK A;  2PZ9 A;  2G3B A;  2DTZ A;  4V2F A;  3KKC A;  1RPW A;  5K58 A;  3F0C A;  4JL3 A;  1BJZ A;  3SDG A;  2FD5 A;  5F1J A;  4YZE A;  3BR6 A;  3HIM A;  2QCO A;  3T6N A;  2QOP A;  5F0C A;  1A6I A;  5F04 A;  3LSP A;  5CXG A;  3MVP A;  3P9T A;  1Z0X A;  5F0H A;  3B6C A;  3G7R A;  2JJ7 A;  3AQS A;  4MK6 A;  2X6O A;  3HTI A;  2PBX A;  3NRG A;  5HSZ A;  5HAW A;  2UXU A;  5CXI A;  2UXO A;  5EYR A;  2O7O A;  3QPL A;  3HTJ A;  3VUQ A;  3KZ9 A;  4I76 A;  4GCT A;  4D5C A;  1QVU A;  4GFL A;  2TCT A;  3SFI A;  2G7G A;  2GBY A;  1T33 A;  2IAI A;  2F07 A;  2TRT A;  2XGE A;  5IOZ A;  3ON2 A;  4G12 A;  3BHQ A;  3HE0 A;  4GCL A;  1ZKG A;  3BR5 A;  3DPJ A;  3NXC A;  2HKU A;  1SGM A;  2Y30 A;  1JTX A;  3G56 A;  4AC0 A;  2GEN A;  3FK6 A;  2XRL A;  2UXI A;  1U9O A;  2FBQ A;  3C07 A;  5C4Y A;  5H9T A;  3V78 A;  5DAJ A;  2ID6 A;  3ZQL A;  3JSJ A;  2JK3 A;  3PM1 A;  5K7Z A;  2DG8 A;  3VVX A;  2ZB9 A;  3G1L A;  3RD3 A;  3QQA A;  3TP0 A;  3WHC A;  3IUV A;  3BTL A;  4ME9 A;  3DEW A;  3Q0V A;  4D7M A;  1JTY A;  2XPU A;  4D7N A;  4UDS A;  3KKD A;  3LHQ A;  5IPA A;  5FKK A;  2D6Y A;  2IBD A;  3RH2 A;  3BTJ A;  3CWR A;  2Q24 A;  3VW0 A;  2WUI A;  3LWJ A;  3Q3S A;  3QKX A;  3BR3 A;  4JKZ A;  1JUP A;  2FX0 A;  3V6G A;  5D19 A;  5J1R A;  2OER A;  2HXI A;  3LOC A;  4AC6 A;  4L62 A;  1T56 A;  3ON4 A;  3FK7 A;  2ZCM A;  2XPV A;  5EZG A;  5K7H A;  3CCY A;  4M3B A;  5F27 A;  2Y2Z A;  3LJL A;  1U9N A;  3VVZ A;  4ABZ A;  3TP3 A;  4W97 A;  3KNW A;  2HXO A;  3PAS A;  2GFN A;  3AQT A;  3ZQG A;  2VPR A;  4D5F A;  2HYT A;  3VPR A;  3VW1 A;  3BQZ A;  3IH4 A;  1QVT A;  3BTI A;  4XK4 A;  4B1R A;  3GEU A;  4NN1 A;  4M3D A;  2XGC A;  4DW6 A;  2XB5 A;  4JNN A;  3O8G A;  3VIB A;  2REK A;  4I6Z A;  1ZK8 A;  5D18 A;  5HBU A;  2XPW A;  3E7Q A;  3VP5 A;  3VW2 A;  2OI8 A;  3O8H A;  3F1B A;  2NS8 A;  5F0F A;  2YVE A;  5EZH A;  3BJB A;  3HTH A;  2EH3 A;  3BTC A;  2OPT A;  2WGB A;  3ANG A;  3WHB A;  2ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...