2GENA

Structural genomics, the crystal structure of a probable transcriptional regulator from pseudomonas aeruginosa pao1
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
RKDEILQAALACFSEHGVDATTIEMIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQYAALLEAGFARARSAEETVRLLVTSYIDWVVANPDWARFILHSRGRVEAGELGERLRADNQAHFARIHAALAGYRAEGLFREMPDDCFASVVIGPAHDLARQWLAGRTRVALADCRELLAQVAWDSVRAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable transcriptional regulator
publication title The crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transcription
total genus 72
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2006-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2genA00
5K7ZA 4L62A 5HSZA 4ABZA 3VOXA 4D7NA 4GFLA 2RASA 3ON4A 3LHQA 2XRLA 5D18A 4M3EA 3BR2A 1ZK8A 4M3FA 5J1YA 2NP3A 3G7RA 2PBXA 4V2GA 3AQTA 3IH3A 3O8GA 2DG7A 3BJBA 3HGGA 3QPSA 5D19A 3QQAA 3CCYA 2HXOA 3CWRA 4B1RA 5J1RA 4I76A 3FK7A 3ON2A 3VW1A 2XPVA 2FBQA 3ZQHA 4JL3A 2QWTA 2REKA 4KWAA 5EFYA 4AC0A 1A6IA 3VVXA 4DW6A 3SFIA 2XGEA 3HE0A 3FK6A 2YVHA 3WHCA 3V78A 5IOZA 3LJLA 3EGQA 2I10A 4YZEA 3FRQA 1SGMA 3LOCA 5IP6A 5GPAA 5FKKA 1JT0A 3CRJA 5EZHA 3BTJA 3FIWA 3VUQA 3LSPA 3NXCA 2NX4A 3EUPA 3BRUA 3PM1A 3F1BA 2HYTA 4GFKA 5HAWA 4X1EA 3MVPA 2G3BA 2QKOA 3QKXA 2XB5A 3V6GA 2QCOA 3G1MA 3KKCA 3T6NA 3VOKA 2ID3A 4GCTA 3KNWA 2NP5A 2G7SA 3NNRA 4W97A 2NS8A 4M3DA 1RKTA 3DEWA 4NELA 5CXGA 2WGBA 2DG8A 5EZGA 3CJDA 2GBYA 5J1UA 3HIMA 3BHQA 3GEUA 5F04A 4B3AA 2F07A 3HTJA 2JK3A 2FX0A 1QVTA 4JNNA 1U9NA 1VI0A 3P9TA 2DTZA 2OI8A 4W1UA 5FHPA 3NPIA 4PXIA 4M3GA 3B6CA 2O7TA 3G56A 1JUSA 2G7GA 1QPIA 4MO7A 3JSJA 3G1OA 2UXPA 1UI5A 3ZQLA 1BJZA 5F0FA 2O7OA 3VIBA 3C07A 2IEKA 4AUXA 2IAIA 3Q0WA 3QPLA 5F27A 2XGCA 2OPTA 3O60A 5F0HA 3LSRA 5GP9A 3TP3A 2OF7A 5F08A 2Y2ZA 2UXOA 2Y30A 3DPJA 2IU5A 3IH2A 3VW2A 3PPBA 4ACIA 5C4YA 5CW8A 3BNIA 5FMPA 2XPWA 3BR3A 2FQ4A 2QTQA 3WHBA 3S5RA 2G0EA 4AC6A 3BTCA 5IOYA 3HTAA 3IUVA 3IH4A 4MK6A 3AQSA 4JYKA 3HGYA 2HQ5A 2WV1A 2ZCNA 4UDSA 5H9TA 4AF5A 2ZB9A 3G1LA 2XPUA 5GPCA 3BQYA 2RHAA 4D5FA 2QIBA 3BR0A 2ID6A 3C2BA 3KKDA 4D7MA 1Z77A 3BTLA 1JTXA 5IPAA 2RAEA 3O8HA 2ZCMA 1T56A 3VP5A 3TP0A 5K7HA 4HKUA 2GENA 4ME9A 3LWJA 4CGRA 2FJ1A 4XK4A 3ANGA 1T33A 3KZ9A 2X6OA 2HYJA 2JJ7A 3RH2A 5FKNA 2GFNA 4JKZA 3GZIA 2TCTA 2UXIA 3BCGA 4MXMA 2V57A 2WUIA 3DCFA 3MNLA 3LSJA 3ZQFA 2NS7A 3E7QA 3B6AA 2ZOZA 1RKWA 3ANPA 1QVUA 2Y31A 2ZCXA 3HTIA 2X9DA 3ZQGA 3VPRA 5FGLA 3Q3SA 1ZKGA 3BR6A 5K58A 3COLA 5DAJA 4D5CA 5J3LA 2GUHA 1UI6A 4ICHA 3QBMA 3PASA 4M3BA 3VVZA 5FKMA 2IBDA 5FKOA 2EH3A 3NI7A 4G12A 2OERA 3BQZA 3HTHA 5EYRA 3BTIA 5HBUA 5D1RA 5FKLA 1JUMA 2QOPA 2Q24A 2UXUA 3B81A 2W53A 3BR1A 5F1JA 5F0CA 3BR5A 1ORKA 2HXIA 3Q0UA 2XDNA 2YVEA 2XGDA 5CXIA 3ZQIA 1RPWA 2FD5A 3VVYA 5K7FA 2VKEA 2VPRA 3BT9A 2G7LA 3VW0A 4GCLA 2PZ9A 2TRTA 2VKVA 2UXHA 1JTYA 3NRGA 3SDGA 3Q0VA 2ZOYA 4V2FA 1JUPA 2HKUA 5AQCA 3F0CA 1JT6A 4I6ZA 4GCKA 2D6YA 1U9OA 1Z0XA 3CDLA 4NN1A 3RD3A
chains in the Genus database with same CATH superfamily
5K7ZA 4L62A 5HSZA 4ABZA 3VOXA 4D7NA 4GFLA 2RASA 3VTIA 3ON4A 3LHQA 2XRLA 5D18A 4M3EA 3BR2A 1ZK8A 4M3FA 5J1YA 2NP3A 3DU6A 3G7RA 2PBXA 4V2GA 2YVXA 3AQTA 3K8PC 3IH3A 3O8GA 2DG7A 3BJBA 4C2MA 3HGGA 3QPSA 5D19A 3QQAA 3CCYA 2HXOA 3CWRA 4B1RA 5J1RA 4DVYP 3SWHA 4I76A 3FK7A 3ON2A 2XPVA 3VW1A 2FBQA 2R7XA 3ZQHA 4JL3A 2QWTA 2REKA 4KWAA 5EFYA 4AC0A 1A6IA 3VVXA 4DW6A 3SFIA 2A2FX 2XGEA 3FHNA 3HE0A 3FK6A 2YVHA 3WHCA 3V78A 5IOZA 3LJLA 3EGQA 2I10A 4YZEA 3FRQA 2R7VA 1SGMA 3LOCA 5IP6A 5GPAA 5FKKA 1JT0A 3DU5A 3CRJA 5EZHA 3BTJA 3FIWA 3VUQA 3LSPA 3NXCA 2NX4A 3EUPA 3BRUA 3PM1A 3F1BA 2HYTA 4GFKA 5HAWA 4X1EA 3MVPA 2G3BA 2QKOA 3QKXA 2XB5A 3V6GA 2QCOA 3G1MA 3KKCA 3T6NA 3VOKA 2ID3A 4GCTA 3KNWA 2NP5A 2G7SA 3NNRA 4W97A 2NS8A 4M3DA 1RKTA 3DEWA 4NELA 5CXGA 2WGBA 2DG8A 5EZGA 3CJDA 2GBYA 5J1UA 2R7RA 3HIMA 3BHQA 3GEUA 5F04A 4B3AA 2F07A 3HTJA 2JK3A 2FX0A 1QVTA 4JNNA 1U9NA 4U9NA 1VI0A 3P9TA 2DTZA 2OI8A 4W1UA 5FHPA 3NPIA 4PXIA 2B1EA 2R7OA 4M3GA 3B6CA 2O7TA 3G56A 1JUSA 2G7GA 1QPIA 4MO7A 3JSJA 3G1OA 2UXPA 1UI5A 3ZQLA 1BJZA 5F0FA 2O7OA 3VIBA 3C07A 2IEKA 4AUXA 2IAIA 3Q0WA 3QPLA 5F27A 2XGCA 2OPTA 3O60A 5F0HA 3LSRA 5GP9A 3TP3A 2OF7A 5F08A 2Y2ZA 2UXOA 2Y30A 3DPJA 2IU5A 3IH2A 3VW2A 3PPBA 4ACIA 5C4YA 5CW8A 3BNIA 5FMPA 2FJI1 2XPWA 3BR3A 2FQ4A 2QTQA 3WHBA 3S5RA 2G0EA 4AC6A 3BTCA 5IOYA 3HTAA 3IUVA 3IH4A 4MK6A 3AQSA 4JYKA 3HGYA 2HQ5A 2WV1A 2ZCNA 4UDSA 5H9TA 4AF5A 2ZB9A 4WIBA 3G1LA 4OD4A 2XPUA 5GPCA 3BQYA 2RHAA 4D5FA 2QIBA 3KYLA 3BR0A 2ID6A 3C2BA 3KKDA 4D7MA 1Z77A 3BTLA 1JTXA 5IPAA 2RAEA 3O8HA 2R7TA 2R7WA 2ZCMA 2ZY9A 1T56A 3VP5A 3TP0A 5K7HA 4HKUA 2GENA 4ME9A 3LWJA 2R7QA 4CGRA 2FJ1A 4XK4A 3ANGA 1T33A 3KZ9A 2X6OA 2HYJA 2JJ7A 3RH2A 5FKNA 2GFNA 4JKZA 3GZIA 2TCTA 2UXIA 3BCGA 4OD5A 4MXMA 2V57A 2WUIA 3DCFA 3MNLA 3LSJA 3ZQFA 2NS7A 3E7QA 3B6AA 2ZOZA 4IRVA 1RKWA 3ANPA 1QVUA 2Y31A 2ZCXA 3HTIA 2X9DA 3ZQGA 3VPRA 5FGLA 3Q3SA 1ZKGA 3BR6A 5K58A 3COLA 5DAJA 4D5CA 5J3LA 2GUHA 1UI6A 4ICHA 5CQGA 3QBMA 3PASA 4M3BA 3VVZA 5FKMA 2IBDA 5FKOA 2EH3A 3NI7A 4G12A 2OERA 3NS4A 3BQZA 3HTHA 5EYRA 3BTIA 5HBUA 5D1RA 5FKLA 1JUMA 2QOPA 2Q24A 2UXUA 3B81A 2W53A 3BR1A 5F1JA 5F0CA 3BR5A 1ORKA 2HXIA 2R7SA 3Q0UA 2XDNA 2YVEA 2XGDA 5CXIA 3ZQIA 1RPWA 2FD5A 3VVYA 5K7FA 2VKEA 2VPRA 3BT9A 2G7LA 3VW0A 4GCLA 2PZ9A 2B3WA 2R7UA 2TRTA 2VKVA 2UXHA 1JTYA 3NRGA 3SDGA 3Q0VA 2ZOYA 4V2FA 1JUPA 2HKUA 5AQCA 3F0CA 1JT6A 4I6ZA 4GCKA 2D6YA 1U9OA 1Z0XA 3CDLA 4U9LA 4NN1A 3RD3A 2PFVA
chains in the Genus database with same CATH topology
5K7ZA 4L62A 5HSZA 4ABZA 3VOXA 4D7NA 4GFLA 2RASA 3ON4A 3LHQA 2XRLA 5D18A 4M3EA 3BR2A 1ZK8A 4M3FA 5J1YA 2NP3A 3G7RA 2PBXA 4V2GA 3AQTA 3IH3A 3O8GA 2DG7A 3BJBA 3HGGA 3QPSA 5D19A 3QQAA 3CCYA 2HXOA 3CWRA 4B1RA 5J1RA 4I76A 3FK7A 3ON2A 3VW1A 2XPVA 2FBQA 3ZQHA 4JL3A 2QWTA 2REKA 4KWAA 5EFYA 4AC0A 1A6IA 3VVXA 4DW6A 3SFIA 2XGEA 3HE0A 3FK6A 2YVHA 3WHCA 3V78A 5IOZA 3LJLA 3EGQA 2I10A 4YZEA 3FRQA 1SGMA 3LOCA 5IP6A 5GPAA 5FKKA 1JT0A 3CRJA 5EZHA 3BTJA 3FIWA 3VUQA 3LSPA 3NXCA 2NX4A 3EUPA 3BRUA 3PM1A 3F1BA 2HYTA 4GFKA 5HAWA 4X1EA 3MVPA 2G3BA 2QKOA 3QKXA 2XB5A 3V6GA 2QCOA 3G1MA 3KKCA 3T6NA 3VOKA 2ID3A 4GCTA 3KNWA 2NP5A 2G7SA 3NNRA 4W97A 2NS8A 4M3DA 1RKTA 3DEWA 4NELA 5CXGA 2WGBA 2DG8A 5EZGA 3CJDA 2GBYA 5J1UA 3HIMA 3BHQA 3GEUA 5F04A 4B3AA 2F07A 3HTJA 2JK3A 2FX0A 1QVTA 4JNNA 1U9NA 1VI0A 3P9TA 2DTZA 2OI8A 4W1UA 5FHPA 3NPIA 4PXIA 4M3GA 3B6CA 2O7TA 3G56A 1JUSA 2G7GA 1QPIA 4MO7A 3JSJA 3G1OA 2UXPA 1UI5A 3ZQLA 1BJZA 5F0FA 2O7OA 3VIBA 3C07A 2IEKA 4AUXA 2IAIA 3Q0WA 3QPLA 5F27A 2XGCA 2OPTA 3O60A 5F0HA 3LSRA 5GP9A 3TP3A 2OF7A 5F08A 2Y2ZA 2UXOA 2Y30A 3DPJA 2IU5A 3IH2A 3VW2A 3PPBA 4ACIA 5C4YA 5CW8A 3BNIA 5FMPA 2XPWA 3BR3A 2FQ4A 2QTQA 3WHBA 3S5RA 2G0EA 4AC6A 3BTCA 5IOYA 3HTAA 3IUVA 3IH4A 4MK6A 3AQSA 4JYKA 3HGYA 2HQ5A 2WV1A 2ZCNA 4UDSA 5H9TA 4AF5A 2ZB9A 3G1LA 2XPUA 5GPCA 3BQYA 2RHAA 4D5FA 2QIBA 3BR0A 2ID6A 3C2BA 3KKDA 4D7MA 1Z77A 3BTLA 1JTXA 5IPAA 2RAEA 3O8HA 2ZCMA 1T56A 3VP5A 3TP0A 5K7HA 4HKUA 2GENA 4ME9A 3LWJA 4CGRA 2FJ1A 4XK4A 3ANGA 1T33A 3KZ9A 2X6OA 2HYJA 2JJ7A 3RH2A 5FKNA 2GFNA 4JKZA 3GZIA 2TCTA 2UXIA 3BCGA 4MXMA 2V57A 2WUIA 3DCFA 3MNLA 3LSJA 3ZQFA 2NS7A 3E7QA 3B6AA 2ZOZA 1RKWA 3ANPA 1QVUA 2Y31A 2ZCXA 3HTIA 2X9DA 3ZQGA 3VPRA 5FGLA 3Q3SA 1ZKGA 3BR6A 5K58A 3COLA 5DAJA 4D5CA 5J3LA 2GUHA 1UI6A 4ICHA 3QBMA 3PASA 4M3BA 3VVZA 5FKMA 2IBDA 5FKOA 2EH3A 3NI7A 4G12A 2OERA 3BQZA 3HTHA 5EYRA 3BTIA 5HBUA 5D1RA 5FKLA 1JUMA 2QOPA 2Q24A 2UXUA 3B81A 2W53A 3BR1A 5F1JA 5F0CA 3BR5A 1ORKA 2HXIA 3Q0UA 2XDNA 2YVEA 2XGDA 5CXIA 3ZQIA 1RPWA 2FD5A 3VVYA 5K7FA 2VKEA 2VPRA 3BT9A 2G7LA 3VW0A 4GCLA 2PZ9A 2TRTA 2VKVA 2UXHA 1JTYA 3NRGA 3SDGA 3Q0VA 2ZOYA 4V2FA 1JUPA 2HKUA 5AQCA 3F0CA 1JT6A 4I6ZA 4GCKA 2D6YA 1U9OA 1Z0XA 3CDLA 4NN1A 3RD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7Z A;  4L62 A;  5HSZ A;  4ABZ A;  3VOX A;  4D7N A;  4GFL A;  2RAS A;  3ON4 A;  3LHQ A;  2XRL A;  5D18 A;  4M3E A;  3BR2 A;  1ZK8 A;  4M3F A;  5J1Y A;  2NP3 A;  3G7R A;  2PBX A;  4V2G A;  3AQT A;  3IH3 A;  3O8G A;  2DG7 A;  3BJB A;  3HGG A;  3QPS A;  5D19 A;  3QQA A;  3CCY A;  2HXO A;  3CWR A;  4B1R A;  5J1R A;  4I76 A;  3FK7 A;  3ON2 A;  3VW1 A;  2XPV A;  2FBQ A;  3ZQH A;  4JL3 A;  2QWT A;  2REK A;  4KWA A;  5EFY A;  4AC0 A;  1A6I A;  3VVX A;  4DW6 A;  3SFI A;  2XGE A;  3HE0 A;  3FK6 A;  2YVH A;  3WHC A;  3V78 A;  5IOZ A;  3LJL A;  3EGQ A;  2I10 A;  4YZE A;  3FRQ A;  1SGM A;  3LOC A;  5IP6 A;  5GPA A;  5FKK A;  1JT0 A;  3CRJ A;  5EZH A;  3BTJ A;  3FIW A;  3VUQ A;  3LSP A;  3NXC A;  2NX4 A;  3EUP A;  3BRU A;  3PM1 A;  3F1B A;  2HYT A;  4GFK A;  5HAW A;  4X1E A;  3MVP A;  2G3B A;  2QKO A;  3QKX A;  2XB5 A;  3V6G A;  2QCO A;  3G1M A;  3KKC A;  3T6N A;  3VOK A;  2ID3 A;  4GCT A;  3KNW A;  2NP5 A;  2G7S A;  3NNR A;  4W97 A;  2NS8 A;  4M3D A;  1RKT A;  3DEW A;  4NEL A;  5CXG A;  2WGB A;  2DG8 A;  5EZG A;  3CJD A;  2GBY A;  5J1U A;  3HIM A;  3BHQ A;  3GEU A;  5F04 A;  4B3A A;  2F07 A;  3HTJ A;  2JK3 A;  2FX0 A;  1QVT A;  4JNN A;  1U9N A;  1VI0 A;  3P9T A;  2DTZ A;  2OI8 A;  4W1U A;  5FHP A;  3NPI A;  4PXI A;  4M3G A;  3B6C A;  2O7T A;  3G56 A;  1JUS A;  2G7G A;  1QPI A;  4MO7 A;  3JSJ A;  3G1O A;  2UXP A;  1UI5 A;  3ZQL A;  1BJZ A;  5F0F A;  2O7O A;  3VIB A;  3C07 A;  2IEK A;  4AUX A;  2IAI A;  3Q0W A;  3QPL A;  5F27 A;  2XGC A;  2OPT A;  3O60 A;  5F0H A;  3LSR A;  5GP9 A;  3TP3 A;  2OF7 A;  5F08 A;  2Y2Z A;  2UXO A;  2Y30 A;  3DPJ A;  2IU5 A;  3IH2 A;  3VW2 A;  3PPB A;  4ACI A;  5C4Y A;  5CW8 A;  3BNI A;  5FMP A;  2XPW A;  3BR3 A;  2FQ4 A;  2QTQ A;  3WHB A;  3S5R A;  2G0E A;  4AC6 A;  3BTC A;  5IOY A;  3HTA A;  3IUV A;  3IH4 A;  4MK6 A;  3AQS A;  4JYK A;  3HGY A;  2HQ5 A;  2WV1 A;  2ZCN A;  4UDS A;  5H9T A;  4AF5 A;  2ZB9 A;  3G1L A;  2XPU A;  5GPC A;  3BQY A;  2RHA A;  4D5F A;  2QIB A;  3BR0 A;  2ID6 A;  3C2B A;  3KKD A;  4D7M A;  1Z77 A;  3BTL A;  1JTX A;  5IPA A;  2RAE A;  3O8H A;  2ZCM A;  1T56 A;  3VP5 A;  3TP0 A;  5K7H A;  4HKU A;  2GEN A;  4ME9 A;  3LWJ A;  4CGR A;  2FJ1 A;  4XK4 A;  3ANG A;  1T33 A;  3KZ9 A;  2X6O A;  2HYJ A;  2JJ7 A;  3RH2 A;  5FKN A;  2GFN A;  4JKZ A;  3GZI A;  2TCT A;  2UXI A;  3BCG A;  4MXM A;  2V57 A;  2WUI A;  3DCF A;  3MNL A;  3LSJ A;  3ZQF A;  2NS7 A;  3E7Q A;  3B6A A;  2ZOZ A;  1RKW A;  3ANP A;  1QVU A;  2Y31 A;  2ZCX A;  3HTI A;  2X9D A;  3ZQG A;  3VPR A;  5FGL A;  3Q3S A;  1ZKG A;  3BR6 A;  5K58 A;  3COL A;  5DAJ A;  4D5C A;  5J3L A;  2GUH A;  1UI6 A;  4ICH A;  3QBM A;  3PAS A;  4M3B A;  3VVZ A;  5FKM A;  2IBD A;  5FKO A;  2EH3 A;  3NI7 A;  4G12 A;  2OER A;  3BQZ A;  3HTH A;  5EYR A;  3BTI A;  5HBU A;  5D1R A;  5FKL A;  1JUM A;  2QOP A;  2Q24 A;  2UXU A;  3B81 A;  2W53 A;  3BR1 A;  5F1J A;  5F0C A;  3BR5 A;  1ORK A;  2HXI A;  3Q0U A;  2XDN A;  2YVE A;  2XGD A;  5CXI A;  3ZQI A;  1RPW A;  2FD5 A;  3VVY A;  5K7F A;  2VKE A;  2VPR A;  3BT9 A;  2G7L A;  3VW0 A;  4GCL A;  2PZ9 A;  2TRT A;  2VKV A;  2UXH A;  1JTY A;  3NRG A;  3SDG A;  3Q0V A;  2ZOY A;  4V2F A;  1JUP A;  2HKU A;  5AQC A;  3F0C A;  1JT6 A;  4I6Z A;  4GCK A;  2D6Y A;  1U9O A;  1Z0X A;  3CDL A;  4NN1 A;  3RD3 A; 
#chains in the Genus database with same CATH topology
 5K7Z A;  4L62 A;  5HSZ A;  4ABZ A;  3VOX A;  4D7N A;  4GFL A;  2RAS A;  3VTI A;  3ON4 A;  3LHQ A;  2XRL A;  5D18 A;  4M3E A;  3BR2 A;  1ZK8 A;  4M3F A;  5J1Y A;  2NP3 A;  3DU6 A;  3G7R A;  2PBX A;  4V2G A;  2YVX A;  3AQT A;  3K8P C;  3IH3 A;  3O8G A;  2DG7 A;  3BJB A;  4C2M A;  3HGG A;  3QPS A;  5D19 A;  3QQA A;  3CCY A;  2HXO A;  3CWR A;  4B1R A;  5J1R A;  4DVY P;  3SWH A;  4I76 A;  3FK7 A;  3ON2 A;  2XPV A;  3VW1 A;  2FBQ A;  2R7X A;  3ZQH A;  4JL3 A;  2QWT A;  2REK A;  4KWA A;  5EFY A;  4AC0 A;  1A6I A;  3VVX A;  4DW6 A;  3SFI A;  2A2F X;  2XGE A;  3FHN A;  3HE0 A;  3FK6 A;  2YVH A;  3WHC A;  3V78 A;  5IOZ A;  3LJL A;  3EGQ A;  2I10 A;  4YZE A;  3FRQ A;  2R7V A;  1SGM A;  3LOC A;  5IP6 A;  5GPA A;  5FKK A;  1JT0 A;  3DU5 A;  3CRJ A;  5EZH A;  3BTJ A;  3FIW A;  3VUQ A;  3LSP A;  3NXC A;  2NX4 A;  3EUP A;  3BRU A;  3PM1 A;  3F1B A;  2HYT A;  4GFK A;  5HAW A;  4X1E A;  3MVP A;  2G3B A;  2QKO A;  3QKX A;  2XB5 A;  3V6G A;  2QCO A;  3G1M A;  3KKC A;  3T6N A;  3VOK A;  2ID3 A;  4GCT A;  3KNW A;  2NP5 A;  2G7S A;  3NNR A;  4W97 A;  2NS8 A;  4M3D A;  1RKT A;  3DEW A;  4NEL A;  5CXG A;  2WGB A;  2DG8 A;  5EZG A;  3CJD A;  2GBY A;  5J1U A;  2R7R A;  3HIM A;  3BHQ A;  3GEU A;  5F04 A;  4B3A A;  2F07 A;  3HTJ A;  2JK3 A;  2FX0 A;  1QVT A;  4JNN A;  1U9N A;  4U9N A;  1VI0 A;  3P9T A;  2DTZ A;  2OI8 A;  4W1U A;  5FHP A;  3NPI A;  4PXI A;  2B1E A;  2R7O A;  4M3G A;  3B6C A;  2O7T A;  3G56 A;  1JUS A;  2G7G A;  1QPI A;  4MO7 A;  3JSJ A;  3G1O A;  2UXP A;  1UI5 A;  3ZQL A;  1BJZ A;  5F0F A;  2O7O A;  3VIB A;  3C07 A;  2IEK A;  4AUX A;  2IAI A;  3Q0W A;  3QPL A;  5F27 A;  2XGC A;  2OPT A;  3O60 A;  5F0H A;  3LSR A;  5GP9 A;  3TP3 A;  2OF7 A;  5F08 A;  2Y2Z A;  2UXO A;  2Y30 A;  3DPJ A;  2IU5 A;  3IH2 A;  3VW2 A;  3PPB A;  4ACI A;  5C4Y A;  5CW8 A;  3BNI A;  5FMP A;  2FJI 1;  2XPW A;  3BR3 A;  2FQ4 A;  2QTQ A;  3WHB A;  3S5R A;  2G0E A;  4AC6 A;  3BTC A;  5IOY A;  3HTA A;  3IUV A;  3IH4 A;  4MK6 A;  3AQS A;  4JYK A;  3HGY A;  2HQ5 A;  2WV1 A;  2ZCN A;  4UDS A;  5H9T A;  4AF5 A;  2ZB9 A;  4WIB A;  3G1L A;  4OD4 A;  2XPU A;  5GPC A;  3BQY A;  2RHA A;  4D5F A;  2QIB A;  3KYL A;  3BR0 A;  2ID6 A;  3C2B A;  3KKD A;  4D7M A;  1Z77 A;  3BTL A;  1JTX A;  5IPA A;  2RAE A;  3O8H A;  2R7T A;  2R7W A;  2ZCM A;  2ZY9 A;  1T56 A;  3VP5 A;  3TP0 A;  5K7H A;  4HKU A;  2GEN A;  4ME9 A;  3LWJ A;  2R7Q A;  4CGR A;  2FJ1 A;  4XK4 A;  3ANG A;  1T33 A;  3KZ9 A;  2X6O A;  2HYJ A;  2JJ7 A;  3RH2 A;  5FKN A;  2GFN A;  4JKZ A;  3GZI A;  2TCT A;  2UXI A;  3BCG A;  4OD5 A;  4MXM A;  2V57 A;  2WUI A;  3DCF A;  3MNL A;  3LSJ A;  3ZQF A;  2NS7 A;  3E7Q A;  3B6A A;  2ZOZ A;  4IRV A;  1RKW A;  3ANP A;  1QVU A;  2Y31 A;  2ZCX A;  3HTI A;  2X9D A;  3ZQG A;  3VPR A;  5FGL A;  3Q3S A;  1ZKG A;  3BR6 A;  5K58 A;  3COL A;  5DAJ A;  4D5C A;  5J3L A;  2GUH A;  1UI6 A;  4ICH A;  5CQG A;  3QBM A;  3PAS A;  4M3B A;  3VVZ A;  5FKM A;  2IBD A;  5FKO A;  2EH3 A;  3NI7 A;  4G12 A;  2OER A;  3NS4 A;  3BQZ A;  3HTH A;  5EYR A;  3BTI A;  5HBU A;  5D1R A;  5FKL A;  1JUM A;  2QOP A;  2Q24 A;  2UXU A;  3B81 A;  2W53 A;  3BR1 A;  5F1J A;  5F0C A;  3BR5 A;  1ORK A;  2HXI A;  2R7S A;  3Q0U A;  2XDN A;  2YVE A;  2XGD A;  5CXI A;  3ZQI A;  1RPW A;  2FD5 A;  3VVY A;  5K7F A;  2VKE A;  2VPR A;  3BT9 A;  2G7L A;  3VW0 A;  4GCL A;  2PZ9 A;  2B3W A;  2R7U A;  2TRT A;  2VKV A;  2UXH A;  1JTY A;  3NRG A;  3SDG A;  3Q0V A;  2ZOY A;  4V2F A;  1JUP A;  2HKU A;  5AQC A;  3F0C A;  1JT6 A;  4I6Z A;  4GCK A;  2D6Y A;  1U9O A;  1Z0X A;  3CDL A;  4U9L A;  4NN1 A;  3RD3 A;  2PFV A; 
#chains in the Genus database with same CATH homology
 5K7Z A;  4L62 A;  5HSZ A;  4ABZ A;  3VOX A;  4D7N A;  4GFL A;  2RAS A;  3ON4 A;  3LHQ A;  2XRL A;  5D18 A;  4M3E A;  3BR2 A;  1ZK8 A;  4M3F A;  5J1Y A;  2NP3 A;  3G7R A;  2PBX A;  4V2G A;  3AQT A;  3IH3 A;  3O8G A;  2DG7 A;  3BJB A;  3HGG A;  3QPS A;  5D19 A;  3QQA A;  3CCY A;  2HXO A;  3CWR A;  4B1R A;  5J1R A;  4I76 A;  3FK7 A;  3ON2 A;  3VW1 A;  2XPV A;  2FBQ A;  3ZQH A;  4JL3 A;  2QWT A;  2REK A;  4KWA A;  5EFY A;  4AC0 A;  1A6I A;  3VVX A;  4DW6 A;  3SFI A;  2XGE A;  3HE0 A;  3FK6 A;  2YVH A;  3WHC A;  3V78 A;  5IOZ A;  3LJL A;  3EGQ A;  2I10 A;  4YZE A;  3FRQ A;  1SGM A;  3LOC A;  5IP6 A;  5GPA A;  5FKK A;  1JT0 A;  3CRJ A;  5EZH A;  3BTJ A;  3FIW A;  3VUQ A;  3LSP A;  3NXC A;  2NX4 A;  3EUP A;  3BRU A;  3PM1 A;  3F1B A;  2HYT A;  4GFK A;  5HAW A;  4X1E A;  3MVP A;  2G3B A;  2QKO A;  3QKX A;  2XB5 A;  3V6G A;  2QCO A;  3G1M A;  3KKC A;  3T6N A;  3VOK A;  2ID3 A;  4GCT A;  3KNW A;  2NP5 A;  2G7S A;  3NNR A;  4W97 A;  2NS8 A;  4M3D A;  1RKT A;  3DEW A;  4NEL A;  5CXG A;  2WGB A;  2DG8 A;  5EZG A;  3CJD A;  2GBY A;  5J1U A;  3HIM A;  3BHQ A;  3GEU A;  5F04 A;  4B3A A;  2F07 A;  3HTJ A;  2JK3 A;  2FX0 A;  1QVT A;  4JNN A;  1U9N A;  1VI0 A;  3P9T A;  2DTZ A;  2OI8 A;  4W1U A;  5FHP A;  3NPI A;  4PXI A;  4M3G A;  3B6C A;  2O7T A;  3G56 A;  1JUS A;  2G7G A;  1QPI A;  4MO7 A;  3JSJ A;  3G1O A;  2UXP A;  1UI5 A;  3ZQL A;  1BJZ A;  5F0F A;  2O7O A;  3VIB A;  3C07 A;  2IEK A;  4AUX A;  2IAI A;  3Q0W A;  3QPL A;  5F27 A;  2XGC A;  2OPT A;  3O60 A;  5F0H A;  3LSR A;  5GP9 A;  3TP3 A;  2OF7 A;  5F08 A;  2Y2Z A;  2UXO A;  2Y30 A;  3DPJ A;  2IU5 A;  3IH2 A;  3VW2 A;  3PPB A;  4ACI A;  5C4Y A;  5CW8 A;  3BNI A;  5FMP A;  2XPW A;  3BR3 A;  2FQ4 A;  2QTQ A;  3WHB A;  3S5R A;  2G0E A;  4AC6 A;  3BTC A;  5IOY A;  3HTA A;  3IUV A;  3IH4 A;  4MK6 A;  3AQS A;  4JYK A;  3HGY A;  2HQ5 A;  2WV1 A;  2ZCN A;  4UDS A;  5H9T A;  4AF5 A;  2ZB9 A;  3G1L A;  2XPU A;  5GPC A;  3BQY A;  2RHA A;  4D5F A;  2QIB A;  3BR0 A;  2ID6 A;  3C2B A;  3KKD A;  4D7M A;  1Z77 A;  3BTL A;  1JTX A;  5IPA A;  2RAE A;  3O8H A;  2ZCM A;  1T56 A;  3VP5 A;  3TP0 A;  5K7H A;  4HKU A;  2GEN A;  4ME9 A;  3LWJ A;  4CGR A;  2FJ1 A;  4XK4 A;  3ANG A;  1T33 A;  3KZ9 A;  2X6O A;  2HYJ A;  2JJ7 A;  3RH2 A;  5FKN A;  2GFN A;  4JKZ A;  3GZI A;  2TCT A;  2UXI A;  3BCG A;  4MXM A;  2V57 A;  2WUI A;  3DCF A;  3MNL A;  3LSJ A;  3ZQF A;  2NS7 A;  3E7Q A;  3B6A A;  2ZOZ A;  1RKW A;  3ANP A;  1QVU A;  2Y31 A;  2ZCX A;  3HTI A;  2X9D A;  3ZQG A;  3VPR A;  5FGL A;  3Q3S A;  1ZKG A;  3BR6 A;  5K58 A;  3COL A;  5DAJ A;  4D5C A;  5J3L A;  2GUH A;  1UI6 A;  4ICH A;  3QBM A;  3PAS A;  4M3B A;  3VVZ A;  5FKM A;  2IBD A;  5FKO A;  2EH3 A;  3NI7 A;  4G12 A;  2OER A;  3BQZ A;  3HTH A;  5EYR A;  3BTI A;  5HBU A;  5D1R A;  5FKL A;  1JUM A;  2QOP A;  2Q24 A;  2UXU A;  3B81 A;  2W53 A;  3BR1 A;  5F1J A;  5F0C A;  3BR5 A;  1ORK A;  2HXI A;  3Q0U A;  2XDN A;  2YVE A;  2XGD A;  5CXI A;  3ZQI A;  1RPW A;  2FD5 A;  3VVY A;  5K7F A;  2VKE A;  2VPR A;  3BT9 A;  2G7L A;  3VW0 A;  4GCL A;  2PZ9 A;  2TRT A;  2VKV A;  2UXH A;  1JTY A;  3NRG A;  3SDG A;  3Q0V A;  2ZOY A;  4V2F A;  1JUP A;  2HKU A;  5AQC A;  3F0C A;  1JT6 A;  4I6Z A;  4GCK A;  2D6Y A;  1U9O A;  1Z0X A;  3CDL A;  4NN1 A;  3RD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...