4HKUA

The crystal structure of tetr transcriptional regulator (lmo2814) from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
174
structure length
174
Chain Sequence
b'ARLSQEIILNMAEKIIYEKGMEKTTLYDIASNLNVTHAALYKHYRNKEDLFQKLALRWLEETSREIFAWTQDAGQTPDDALHDWLWLLADTKKKRYKTDRKMFLLYTDYIEQNEELVKNHVAHLAQKAEEVSGRTNQGNAIITAFTYFHNPYFASRWEQAGYVDLFEDVWQIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR transcriptional regulator
publication title The crystal structure of TetR transcriptional regulator (lmo2814) from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 69
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17935 TetR_C_27 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4hkuA00
1Z0XA 3HTAA 4M3GA 4ABZA 5HBUA 5D19A 3C2BA 1JT6A 3B6CA 2REKA 2RHAA 3DEWA 3HTHA 5IOZA 3KKDA 1RPWA 2HYTA 2Q24A 2HXOA 4D7NA 3BR1A 3ANPA 4ACIA 3EGQA 1VI0A 3G1LA 5DAJA 3BQYA 5IOYA 5J3LA 3NNRA 1T56A 2DG8A 2OPTA 5D1RA 2I10A 3LHQA 5EFYA 1RKWA 2GBYA 3BTLA 5EYRA 2NP3A 3BRUA 3ON2A 3LWJA 3BT9A 2JK3A 1BJZA 2XRLA 2X6OA 3NI7A 2W53A 2PBXA 4X1EA 3LSPA 4GCLA 1ORKA 3RD3A 3QQAA 3ZQGA 5F08A 1JTYA 3BHQA 2HYJA 3P9TA 4MXMA 3O8GA 4JL3A 3LSRA 2ZCNA 2DG7A 5F0CA 2UXHA 3EUPA 4UDSA 2QKOA 3QBMA 2VKVA 2X9DA 2QOPA 2FD5A 3PASA 2V57A 1A6IA 4W1UA 3V6GA 2NS8A 5EZGA 4L62A 5CW8A 1JUSA 3G7RA 3G1OA 1ZKGA 1JTXA 2ID6A 4GFKA 2TCTA 2WV1A 2NP5A 3Q0WA 1QVTA 5FKNA 3IH2A 5FKOA 3BJBA 4B1RA 2G7SA 4D5CA 5IP6A 3BR3A 2F07A 3ZQIA 3FK6A 5J1UA 3BCGA 5CXGA 2FJ1A 4V2GA 2O7OA 3O8HA 4CGRA 2XGCA 2FBQA 3O60A 3VVXA 5F0HA 2ZB9A 2IBDA 4D5FA 3BR5A 4ME9A 2VPRA 1SGMA 3VVYA 3BTJA 4GFLA 2WGBA 4KWAA 3VVZA 4V2FA 3AQSA 3LJLA 5F1JA 3WHBA 1UI5A 3IH3A 2QTQA 3MVPA 3WHCA 5FKMA 3G1MA 1U9NA 5GPCA 2XPWA 3ZQLA 1ZK8A 4JKZA 3BQZA 4M3BA 3B81A 3B6AA 5K7HA 2XDNA 4W97A 3F0CA 3HGGA 3MNLA 2IU5A 3G56A 2QWTA 4DW6A 5CXIA 2ZOYA 5K58A 4AC6A 3VW1A 1T33A 3LOCA 4YZEA 5FKLA 2OERA 5HSZA 4M3FA 3E7QA 4I6ZA 3F1BA 3S5RA 2EH3A 3NXCA 3LSJA 3PM1A 2FQ4A 3VP5A 5F04A 2D6YA 3PPBA 4I76A 2HKUA 3C07A 2DTZA 3QKXA 1RKTA 3HIMA 4MK6A 5F0FA 5GP9A 2UXUA 3HGYA 5GPAA 1QVUA 2ZCXA 3FIWA 3VOXA 4JNNA 5K7FA 2YVHA 3CRJA 3BR6A 5F27A 3VW2A 2JJ7A 2UXPA 4JYKA 4B3AA 3COLA 3KZ9A 3IH4A 5FMPA 2PZ9A 2XGEA 2Y30A 2FX0A 2QIBA 5K7ZA 3BTCA 4ICHA 3VPRA 3VIBA 3FRQA 5FHPA 2GFNA 4PXIA 4GCTA 5EZHA 2UXOA 2QCOA 3NRGA 2UXIA 3RH2A 3QPLA 4MO7A 3DCFA 3AQTA 2YVEA 2NX4A 4NN1A 5J1RA 1Z77A 3Q0VA 2XGDA 4M3DA 3QPSA 2GENA 5C4YA 2GUHA 2O7TA 3T6NA 3JSJA 2OF7A 2Y2ZA 1JUMA 3IUVA 2OI8A 2XB5A 3KKCA 2Y31A 4AF5A 2RAEA 3VOKA 3VUQA 2IEKA 5IPAA 2VKEA 3ON4A 3SFIA 2G7GA 3CCYA 5AQCA 3VW0A 3BNIA 3BR0A 2XPUA 3ZQHA 2ZOZA 2NS7A 3BTIA 3FK7A 1QPIA 4NELA 3HE0A 3ANGA 5FKKA 3HTJA 3NPIA 3HTIA 2HXIA 4G12A 1UI6A 3GZIA 2G0EA 2ID3A 2XPVA 3SDGA 2TRTA 2WUIA 3CJDA 2G7LA 3KNWA 3GEUA 3TP3A 3BR2A 2IAIA 4XK4A 4D7MA 2HQ5A 5J1YA 4GCKA 3ZQFA 1JUPA 4AC0A 3CDLA 1U9OA 5D18A 5HAWA 1JT0A 3CWRA 3Q3SA 5H9TA 4M3EA 4AUXA 3Q0UA 3DPJA 3TP0A 2RASA 5FGLA 2ZCMA 4HKUA 2G3BA 3V78A
chains in the Genus database with same CATH superfamily
1Z0XA 3HTAA 4M3GA 4ABZA 5HBUA 5D19A 3C2BA 1JT6A 3B6CA 2REKA 2RHAA 2B3WA 3DEWA 3HTHA 5IOZA 3KKDA 1RPWA 2HYTA 2Q24A 2HXOA 4D7NA 3BR1A 3ANPA 4ACIA 3EGQA 1VI0A 3G1LA 5DAJA 3BQYA 5IOYA 5J3LA 3SWHA 3NNRA 1T56A 2DG8A 2OPTA 2R7VA 5D1RA 2I10A 3LHQA 5EFYA 1RKWA 2GBYA 2R7QA 3BTLA 5EYRA 2NP3A 3BRUA 3ON2A 2R7WA 3LWJA 3BT9A 2JK3A 1BJZA 2XRLA 2X6OA 3NI7A 2W53A 2PBXA 4X1EA 3LSPA 4GCLA 1ORKA 3RD3A 3QQAA 3ZQGA 5F08A 1JTYA 3BHQA 2HYJA 3P9TA 4MXMA 3O8GA 4JL3A 3LSRA 2ZCNA 2DG7A 5F0CA 2ZY9A 2UXHA 3EUPA 4UDSA 2QKOA 3QBMA 2VKVA 2X9DA 2QOPA 2FD5A 3PASA 4U9LA 2V57A 1A6IA 3FHNA 4W1UA 3V6GA 2NS8A 5EZGA 4L62A 5CW8A 1JUSA 3G7RA 3G1OA 1ZKGA 1JTXA 2ID6A 4GFKA 2TCTA 2WV1A 4OD4A 2NP5A 3Q0WA 2R7OA 1QVTA 5FKNA 3IH2A 5FKOA 3BJBA 3VTIA 4B1RA 2G7SA 4D5CA 5IP6A 3BR3A 2F07A 3ZQIA 3FK6A 5J1UA 3BCGA 5CXGA 2FJ1A 4V2GA 2O7OA 3O8HA 3NS4A 4CGRA 4OD5A 2XGCA 2FBQA 3O60A 3VVXA 5F0HA 2ZB9A 2IBDA 4D5FA 3BR5A 4ME9A 2VPRA 1SGMA 3VVYA 4DVYP 3BTJA 4GFLA 2WGBA 4KWAA 3VVZA 4V2FA 3AQSA 3LJLA 5F1JA 3WHBA 1UI5A 3IH3A 2QTQA 3MVPA 3WHCA 5FKMA 3G1MA 1U9NA 5GPCA 2XPWA 3ZQLA 1ZK8A 4JKZA 3BQZA 4M3BA 3B81A 3B6AA 5K7HA 2XDNA 2A2FX 4W97A 3F0CA 3HGGA 3MNLA 2IU5A 3G56A 2QWTA 4DW6A 5CXIA 2ZOYA 5K58A 4AC6A 2YVXA 3VW1A 1T33A 3LOCA 4YZEA 5FKLA 2OERA 5HSZA 4M3FA 4C2MA 3E7QA 4I6ZA 3F1BA 3S5RA 2EH3A 3NXCA 3LSJA 3PM1A 2R7SA 2FQ4A 3VP5A 5F04A 2D6YA 3DU5A 3PPBA 4I76A 2HKUA 3C07A 2DTZA 3QKXA 1RKTA 3HIMA 4MK6A 5F0FA 5GP9A 2UXUA 3HGYA 5CQGA 5GPAA 1QVUA 2ZCXA 3FIWA 3VOXA 4JNNA 5K7FA 2YVHA 3CRJA 3BR6A 5F27A 3VW2A 2JJ7A 2UXPA 4JYKA 4B3AA 3COLA 3KZ9A 3IH4A 5FMPA 2PZ9A 2XGEA 2Y30A 2FX0A 2QIBA 5K7ZA 3BTCA 4ICHA 3VPRA 3VIBA 3FRQA 5FHPA 2GFNA 4PXIA 4GCTA 5EZHA 2UXOA 2QCOA 3NRGA 2UXIA 3RH2A 3QPLA 4MO7A 3DCFA 3AQTA 2YVEA 2NX4A 4NN1A 5J1RA 4IRVA 1Z77A 3Q0VA 2XGDA 4M3DA 3QPSA 2GENA 5C4YA 2GUHA 2O7TA 2B1EA 3T6NA 3JSJA 4U9NA 2OF7A 2Y2ZA 1JUMA 3IUVA 2OI8A 3DU6A 2R7RA 2XB5A 3KKCA 2Y31A 4WIBA 4AF5A 2RAEA 3VOKA 3VUQA 2IEKA 5IPAA 3KYLA 2VKEA 3ON4A 3SFIA 2G7GA 3CCYA 5AQCA 3VW0A 3BNIA 3BR0A 3K8PC 2XPUA 3ZQHA 2ZOZA 2NS7A 3BTIA 3FK7A 1QPIA 4NELA 3HE0A 3ANGA 5FKKA 3HTJA 3NPIA 3HTIA 2HXIA 4G12A 1UI6A 3GZIA 2G0EA 2ID3A 2XPVA 3SDGA 2TRTA 2WUIA 2R7TA 3CJDA 2G7LA 3KNWA 3GEUA 2PFVA 3TP3A 3BR2A 2IAIA 4XK4A 4D7MA 2HQ5A 5J1YA 4GCKA 3ZQFA 1JUPA 4AC0A 3CDLA 1U9OA 5D18A 5HAWA 1JT0A 3CWRA 3Q3SA 5H9TA 4M3EA 2R7XA 4AUXA 3Q0UA 3DPJA 3TP0A 2FJI1 2RASA 5FGLA 2R7UA 2ZCMA 4HKUA 2G3BA 3V78A
chains in the Genus database with same CATH topology
1Z0XA 3HTAA 4M3GA 4ABZA 5HBUA 5D19A 3C2BA 1JT6A 3B6CA 2REKA 2RHAA 3DEWA 3HTHA 5IOZA 3KKDA 1RPWA 2HYTA 2Q24A 2HXOA 4D7NA 3BR1A 3ANPA 4ACIA 3EGQA 1VI0A 3G1LA 5DAJA 3BQYA 5IOYA 5J3LA 3NNRA 1T56A 2DG8A 2OPTA 5D1RA 2I10A 3LHQA 5EFYA 1RKWA 2GBYA 3BTLA 5EYRA 2NP3A 3BRUA 3ON2A 3LWJA 3BT9A 2JK3A 1BJZA 2XRLA 2X6OA 3NI7A 2W53A 2PBXA 4X1EA 3LSPA 4GCLA 1ORKA 3RD3A 3QQAA 3ZQGA 5F08A 1JTYA 3BHQA 2HYJA 3P9TA 4MXMA 3O8GA 4JL3A 3LSRA 2ZCNA 2DG7A 5F0CA 2UXHA 3EUPA 4UDSA 2QKOA 3QBMA 2VKVA 2X9DA 2QOPA 2FD5A 3PASA 2V57A 1A6IA 4W1UA 3V6GA 2NS8A 5EZGA 4L62A 5CW8A 1JUSA 3G7RA 3G1OA 1ZKGA 1JTXA 2ID6A 4GFKA 2TCTA 2WV1A 2NP5A 3Q0WA 1QVTA 5FKNA 3IH2A 5FKOA 3BJBA 4B1RA 2G7SA 4D5CA 5IP6A 3BR3A 2F07A 3ZQIA 3FK6A 5J1UA 3BCGA 5CXGA 2FJ1A 4V2GA 2O7OA 3O8HA 4CGRA 2XGCA 2FBQA 3O60A 3VVXA 5F0HA 2ZB9A 2IBDA 4D5FA 3BR5A 4ME9A 2VPRA 1SGMA 3VVYA 3BTJA 4GFLA 2WGBA 4KWAA 3VVZA 4V2FA 3AQSA 3LJLA 5F1JA 3WHBA 1UI5A 3IH3A 2QTQA 3MVPA 3WHCA 5FKMA 3G1MA 1U9NA 5GPCA 2XPWA 3ZQLA 1ZK8A 4JKZA 3BQZA 4M3BA 3B81A 3B6AA 5K7HA 2XDNA 4W97A 3F0CA 3HGGA 3MNLA 2IU5A 3G56A 2QWTA 4DW6A 5CXIA 2ZOYA 5K58A 4AC6A 3VW1A 1T33A 3LOCA 4YZEA 5FKLA 2OERA 5HSZA 4M3FA 3E7QA 4I6ZA 3F1BA 3S5RA 2EH3A 3NXCA 3LSJA 3PM1A 2FQ4A 3VP5A 5F04A 2D6YA 3PPBA 4I76A 2HKUA 3C07A 2DTZA 3QKXA 1RKTA 3HIMA 4MK6A 5F0FA 5GP9A 2UXUA 3HGYA 5GPAA 1QVUA 2ZCXA 3FIWA 3VOXA 4JNNA 5K7FA 2YVHA 3CRJA 3BR6A 5F27A 3VW2A 2JJ7A 2UXPA 4JYKA 4B3AA 3COLA 3KZ9A 3IH4A 5FMPA 2PZ9A 2XGEA 2Y30A 2FX0A 2QIBA 5K7ZA 3BTCA 4ICHA 3VPRA 3VIBA 3FRQA 5FHPA 2GFNA 4PXIA 4GCTA 5EZHA 2UXOA 2QCOA 3NRGA 2UXIA 3RH2A 3QPLA 4MO7A 3DCFA 3AQTA 2YVEA 2NX4A 4NN1A 5J1RA 1Z77A 3Q0VA 2XGDA 4M3DA 3QPSA 2GENA 5C4YA 2GUHA 2O7TA 3T6NA 3JSJA 2OF7A 2Y2ZA 1JUMA 3IUVA 2OI8A 2XB5A 3KKCA 2Y31A 4AF5A 2RAEA 3VOKA 3VUQA 2IEKA 5IPAA 2VKEA 3ON4A 3SFIA 2G7GA 3CCYA 5AQCA 3VW0A 3BNIA 3BR0A 2XPUA 3ZQHA 2ZOZA 2NS7A 3BTIA 3FK7A 1QPIA 4NELA 3HE0A 3ANGA 5FKKA 3HTJA 3NPIA 3HTIA 2HXIA 4G12A 1UI6A 3GZIA 2G0EA 2ID3A 2XPVA 3SDGA 2TRTA 2WUIA 3CJDA 2G7LA 3KNWA 3GEUA 3TP3A 3BR2A 2IAIA 4XK4A 4D7MA 2HQ5A 5J1YA 4GCKA 3ZQFA 1JUPA 4AC0A 3CDLA 1U9OA 5D18A 5HAWA 1JT0A 3CWRA 3Q3SA 5H9TA 4M3EA 4AUXA 3Q0UA 3DPJA 3TP0A 2RASA 5FGLA 2ZCMA 4HKUA 2G3BA 3V78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0X A;  3HTA A;  4M3G A;  4ABZ A;  5HBU A;  5D19 A;  3C2B A;  1JT6 A;  3B6C A;  2REK A;  2RHA A;  3DEW A;  3HTH A;  5IOZ A;  3KKD A;  1RPW A;  2HYT A;  2Q24 A;  2HXO A;  4D7N A;  3BR1 A;  3ANP A;  4ACI A;  3EGQ A;  1VI0 A;  3G1L A;  5DAJ A;  3BQY A;  5IOY A;  5J3L A;  3NNR A;  1T56 A;  2DG8 A;  2OPT A;  5D1R A;  2I10 A;  3LHQ A;  5EFY A;  1RKW A;  2GBY A;  3BTL A;  5EYR A;  2NP3 A;  3BRU A;  3ON2 A;  3LWJ A;  3BT9 A;  2JK3 A;  1BJZ A;  2XRL A;  2X6O A;  3NI7 A;  2W53 A;  2PBX A;  4X1E A;  3LSP A;  4GCL A;  1ORK A;  3RD3 A;  3QQA A;  3ZQG A;  5F08 A;  1JTY A;  3BHQ A;  2HYJ A;  3P9T A;  4MXM A;  3O8G A;  4JL3 A;  3LSR A;  2ZCN A;  2DG7 A;  5F0C A;  2UXH A;  3EUP A;  4UDS A;  2QKO A;  3QBM A;  2VKV A;  2X9D A;  2QOP A;  2FD5 A;  3PAS A;  2V57 A;  1A6I A;  4W1U A;  3V6G A;  2NS8 A;  5EZG A;  4L62 A;  5CW8 A;  1JUS A;  3G7R A;  3G1O A;  1ZKG A;  1JTX A;  2ID6 A;  4GFK A;  2TCT A;  2WV1 A;  2NP5 A;  3Q0W A;  1QVT A;  5FKN A;  3IH2 A;  5FKO A;  3BJB A;  4B1R A;  2G7S A;  4D5C A;  5IP6 A;  3BR3 A;  2F07 A;  3ZQI A;  3FK6 A;  5J1U A;  3BCG A;  5CXG A;  2FJ1 A;  4V2G A;  2O7O A;  3O8H A;  4CGR A;  2XGC A;  2FBQ A;  3O60 A;  3VVX A;  5F0H A;  2ZB9 A;  2IBD A;  4D5F A;  3BR5 A;  4ME9 A;  2VPR A;  1SGM A;  3VVY A;  3BTJ A;  4GFL A;  2WGB A;  4KWA A;  3VVZ A;  4V2F A;  3AQS A;  3LJL A;  5F1J A;  3WHB A;  1UI5 A;  3IH3 A;  2QTQ A;  3MVP A;  3WHC A;  5FKM A;  3G1M A;  1U9N A;  5GPC A;  2XPW A;  3ZQL A;  1ZK8 A;  4JKZ A;  3BQZ A;  4M3B A;  3B81 A;  3B6A A;  5K7H A;  2XDN A;  4W97 A;  3F0C A;  3HGG A;  3MNL A;  2IU5 A;  3G56 A;  2QWT A;  4DW6 A;  5CXI A;  2ZOY A;  5K58 A;  4AC6 A;  3VW1 A;  1T33 A;  3LOC A;  4YZE A;  5FKL A;  2OER A;  5HSZ A;  4M3F A;  3E7Q A;  4I6Z A;  3F1B A;  3S5R A;  2EH3 A;  3NXC A;  3LSJ A;  3PM1 A;  2FQ4 A;  3VP5 A;  5F04 A;  2D6Y A;  3PPB A;  4I76 A;  2HKU A;  3C07 A;  2DTZ A;  3QKX A;  1RKT A;  3HIM A;  4MK6 A;  5F0F A;  5GP9 A;  2UXU A;  3HGY A;  5GPA A;  1QVU A;  2ZCX A;  3FIW A;  3VOX A;  4JNN A;  5K7F A;  2YVH A;  3CRJ A;  3BR6 A;  5F27 A;  3VW2 A;  2JJ7 A;  2UXP A;  4JYK A;  4B3A A;  3COL A;  3KZ9 A;  3IH4 A;  5FMP A;  2PZ9 A;  2XGE A;  2Y30 A;  2FX0 A;  2QIB A;  5K7Z A;  3BTC A;  4ICH A;  3VPR A;  3VIB A;  3FRQ A;  5FHP A;  2GFN A;  4PXI A;  4GCT A;  5EZH A;  2UXO A;  2QCO A;  3NRG A;  2UXI A;  3RH2 A;  3QPL A;  4MO7 A;  3DCF A;  3AQT A;  2YVE A;  2NX4 A;  4NN1 A;  5J1R A;  1Z77 A;  3Q0V A;  2XGD A;  4M3D A;  3QPS A;  2GEN A;  5C4Y A;  2GUH A;  2O7T A;  3T6N A;  3JSJ A;  2OF7 A;  2Y2Z A;  1JUM A;  3IUV A;  2OI8 A;  2XB5 A;  3KKC A;  2Y31 A;  4AF5 A;  2RAE A;  3VOK A;  3VUQ A;  2IEK A;  5IPA A;  2VKE A;  3ON4 A;  3SFI A;  2G7G A;  3CCY A;  5AQC A;  3VW0 A;  3BNI A;  3BR0 A;  2XPU A;  3ZQH A;  2ZOZ A;  2NS7 A;  3BTI A;  3FK7 A;  1QPI A;  4NEL A;  3HE0 A;  3ANG A;  5FKK A;  3HTJ A;  3NPI A;  3HTI A;  2HXI A;  4G12 A;  1UI6 A;  3GZI A;  2G0E A;  2ID3 A;  2XPV A;  3SDG A;  2TRT A;  2WUI A;  3CJD A;  2G7L A;  3KNW A;  3GEU A;  3TP3 A;  3BR2 A;  2IAI A;  4XK4 A;  4D7M A;  2HQ5 A;  5J1Y A;  4GCK A;  3ZQF A;  1JUP A;  4AC0 A;  3CDL A;  1U9O A;  5D18 A;  5HAW A;  1JT0 A;  3CWR A;  3Q3S A;  5H9T A;  4M3E A;  4AUX A;  3Q0U A;  3DPJ A;  3TP0 A;  2RAS A;  5FGL A;  2ZCM A;  4HKU A;  2G3B A;  3V78 A; 
#chains in the Genus database with same CATH topology
 1Z0X A;  3HTA A;  4M3G A;  4ABZ A;  5HBU A;  5D19 A;  3C2B A;  1JT6 A;  3B6C A;  2REK A;  2RHA A;  2B3W A;  3DEW A;  3HTH A;  5IOZ A;  3KKD A;  1RPW A;  2HYT A;  2Q24 A;  2HXO A;  4D7N A;  3BR1 A;  3ANP A;  4ACI A;  3EGQ A;  1VI0 A;  3G1L A;  5DAJ A;  3BQY A;  5IOY A;  5J3L A;  3SWH A;  3NNR A;  1T56 A;  2DG8 A;  2OPT A;  2R7V A;  5D1R A;  2I10 A;  3LHQ A;  5EFY A;  1RKW A;  2GBY A;  2R7Q A;  3BTL A;  5EYR A;  2NP3 A;  3BRU A;  3ON2 A;  2R7W A;  3LWJ A;  3BT9 A;  2JK3 A;  1BJZ A;  2XRL A;  2X6O A;  3NI7 A;  2W53 A;  2PBX A;  4X1E A;  3LSP A;  4GCL A;  1ORK A;  3RD3 A;  3QQA A;  3ZQG A;  5F08 A;  1JTY A;  3BHQ A;  2HYJ A;  3P9T A;  4MXM A;  3O8G A;  4JL3 A;  3LSR A;  2ZCN A;  2DG7 A;  5F0C A;  2ZY9 A;  2UXH A;  3EUP A;  4UDS A;  2QKO A;  3QBM A;  2VKV A;  2X9D A;  2QOP A;  2FD5 A;  3PAS A;  4U9L A;  2V57 A;  1A6I A;  3FHN A;  4W1U A;  3V6G A;  2NS8 A;  5EZG A;  4L62 A;  5CW8 A;  1JUS A;  3G7R A;  3G1O A;  1ZKG A;  1JTX A;  2ID6 A;  4GFK A;  2TCT A;  2WV1 A;  4OD4 A;  2NP5 A;  3Q0W A;  2R7O A;  1QVT A;  5FKN A;  3IH2 A;  5FKO A;  3BJB A;  3VTI A;  4B1R A;  2G7S A;  4D5C A;  5IP6 A;  3BR3 A;  2F07 A;  3ZQI A;  3FK6 A;  5J1U A;  3BCG A;  5CXG A;  2FJ1 A;  4V2G A;  2O7O A;  3O8H A;  3NS4 A;  4CGR A;  4OD5 A;  2XGC A;  2FBQ A;  3O60 A;  3VVX A;  5F0H A;  2ZB9 A;  2IBD A;  4D5F A;  3BR5 A;  4ME9 A;  2VPR A;  1SGM A;  3VVY A;  4DVY P;  3BTJ A;  4GFL A;  2WGB A;  4KWA A;  3VVZ A;  4V2F A;  3AQS A;  3LJL A;  5F1J A;  3WHB A;  1UI5 A;  3IH3 A;  2QTQ A;  3MVP A;  3WHC A;  5FKM A;  3G1M A;  1U9N A;  5GPC A;  2XPW A;  3ZQL A;  1ZK8 A;  4JKZ A;  3BQZ A;  4M3B A;  3B81 A;  3B6A A;  5K7H A;  2XDN A;  2A2F X;  4W97 A;  3F0C A;  3HGG A;  3MNL A;  2IU5 A;  3G56 A;  2QWT A;  4DW6 A;  5CXI A;  2ZOY A;  5K58 A;  4AC6 A;  2YVX A;  3VW1 A;  1T33 A;  3LOC A;  4YZE A;  5FKL A;  2OER A;  5HSZ A;  4M3F A;  4C2M A;  3E7Q A;  4I6Z A;  3F1B A;  3S5R A;  2EH3 A;  3NXC A;  3LSJ A;  3PM1 A;  2R7S A;  2FQ4 A;  3VP5 A;  5F04 A;  2D6Y A;  3DU5 A;  3PPB A;  4I76 A;  2HKU A;  3C07 A;  2DTZ A;  3QKX A;  1RKT A;  3HIM A;  4MK6 A;  5F0F A;  5GP9 A;  2UXU A;  3HGY A;  5CQG A;  5GPA A;  1QVU A;  2ZCX A;  3FIW A;  3VOX A;  4JNN A;  5K7F A;  2YVH A;  3CRJ A;  3BR6 A;  5F27 A;  3VW2 A;  2JJ7 A;  2UXP A;  4JYK A;  4B3A A;  3COL A;  3KZ9 A;  3IH4 A;  5FMP A;  2PZ9 A;  2XGE A;  2Y30 A;  2FX0 A;  2QIB A;  5K7Z A;  3BTC A;  4ICH A;  3VPR A;  3VIB A;  3FRQ A;  5FHP A;  2GFN A;  4PXI A;  4GCT A;  5EZH A;  2UXO A;  2QCO A;  3NRG A;  2UXI A;  3RH2 A;  3QPL A;  4MO7 A;  3DCF A;  3AQT A;  2YVE A;  2NX4 A;  4NN1 A;  5J1R A;  4IRV A;  1Z77 A;  3Q0V A;  2XGD A;  4M3D A;  3QPS A;  2GEN A;  5C4Y A;  2GUH A;  2O7T A;  2B1E A;  3T6N A;  3JSJ A;  4U9N A;  2OF7 A;  2Y2Z A;  1JUM A;  3IUV A;  2OI8 A;  3DU6 A;  2R7R A;  2XB5 A;  3KKC A;  2Y31 A;  4WIB A;  4AF5 A;  2RAE A;  3VOK A;  3VUQ A;  2IEK A;  5IPA A;  3KYL A;  2VKE A;  3ON4 A;  3SFI A;  2G7G A;  3CCY A;  5AQC A;  3VW0 A;  3BNI A;  3BR0 A;  3K8P C;  2XPU A;  3ZQH A;  2ZOZ A;  2NS7 A;  3BTI A;  3FK7 A;  1QPI A;  4NEL A;  3HE0 A;  3ANG A;  5FKK A;  3HTJ A;  3NPI A;  3HTI A;  2HXI A;  4G12 A;  1UI6 A;  3GZI A;  2G0E A;  2ID3 A;  2XPV A;  3SDG A;  2TRT A;  2WUI A;  2R7T A;  3CJD A;  2G7L A;  3KNW A;  3GEU A;  2PFV A;  3TP3 A;  3BR2 A;  2IAI A;  4XK4 A;  4D7M A;  2HQ5 A;  5J1Y A;  4GCK A;  3ZQF A;  1JUP A;  4AC0 A;  3CDL A;  1U9O A;  5D18 A;  5HAW A;  1JT0 A;  3CWR A;  3Q3S A;  5H9T A;  4M3E A;  2R7X A;  4AUX A;  3Q0U A;  3DPJ A;  3TP0 A;  2FJI 1;  2RAS A;  5FGL A;  2R7U A;  2ZCM A;  4HKU A;  2G3B A;  3V78 A; 
#chains in the Genus database with same CATH homology
 1Z0X A;  3HTA A;  4M3G A;  4ABZ A;  5HBU A;  5D19 A;  3C2B A;  1JT6 A;  3B6C A;  2REK A;  2RHA A;  3DEW A;  3HTH A;  5IOZ A;  3KKD A;  1RPW A;  2HYT A;  2Q24 A;  2HXO A;  4D7N A;  3BR1 A;  3ANP A;  4ACI A;  3EGQ A;  1VI0 A;  3G1L A;  5DAJ A;  3BQY A;  5IOY A;  5J3L A;  3NNR A;  1T56 A;  2DG8 A;  2OPT A;  5D1R A;  2I10 A;  3LHQ A;  5EFY A;  1RKW A;  2GBY A;  3BTL A;  5EYR A;  2NP3 A;  3BRU A;  3ON2 A;  3LWJ A;  3BT9 A;  2JK3 A;  1BJZ A;  2XRL A;  2X6O A;  3NI7 A;  2W53 A;  2PBX A;  4X1E A;  3LSP A;  4GCL A;  1ORK A;  3RD3 A;  3QQA A;  3ZQG A;  5F08 A;  1JTY A;  3BHQ A;  2HYJ A;  3P9T A;  4MXM A;  3O8G A;  4JL3 A;  3LSR A;  2ZCN A;  2DG7 A;  5F0C A;  2UXH A;  3EUP A;  4UDS A;  2QKO A;  3QBM A;  2VKV A;  2X9D A;  2QOP A;  2FD5 A;  3PAS A;  2V57 A;  1A6I A;  4W1U A;  3V6G A;  2NS8 A;  5EZG A;  4L62 A;  5CW8 A;  1JUS A;  3G7R A;  3G1O A;  1ZKG A;  1JTX A;  2ID6 A;  4GFK A;  2TCT A;  2WV1 A;  2NP5 A;  3Q0W A;  1QVT A;  5FKN A;  3IH2 A;  5FKO A;  3BJB A;  4B1R A;  2G7S A;  4D5C A;  5IP6 A;  3BR3 A;  2F07 A;  3ZQI A;  3FK6 A;  5J1U A;  3BCG A;  5CXG A;  2FJ1 A;  4V2G A;  2O7O A;  3O8H A;  4CGR A;  2XGC A;  2FBQ A;  3O60 A;  3VVX A;  5F0H A;  2ZB9 A;  2IBD A;  4D5F A;  3BR5 A;  4ME9 A;  2VPR A;  1SGM A;  3VVY A;  3BTJ A;  4GFL A;  2WGB A;  4KWA A;  3VVZ A;  4V2F A;  3AQS A;  3LJL A;  5F1J A;  3WHB A;  1UI5 A;  3IH3 A;  2QTQ A;  3MVP A;  3WHC A;  5FKM A;  3G1M A;  1U9N A;  5GPC A;  2XPW A;  3ZQL A;  1ZK8 A;  4JKZ A;  3BQZ A;  4M3B A;  3B81 A;  3B6A A;  5K7H A;  2XDN A;  4W97 A;  3F0C A;  3HGG A;  3MNL A;  2IU5 A;  3G56 A;  2QWT A;  4DW6 A;  5CXI A;  2ZOY A;  5K58 A;  4AC6 A;  3VW1 A;  1T33 A;  3LOC A;  4YZE A;  5FKL A;  2OER A;  5HSZ A;  4M3F A;  3E7Q A;  4I6Z A;  3F1B A;  3S5R A;  2EH3 A;  3NXC A;  3LSJ A;  3PM1 A;  2FQ4 A;  3VP5 A;  5F04 A;  2D6Y A;  3PPB A;  4I76 A;  2HKU A;  3C07 A;  2DTZ A;  3QKX A;  1RKT A;  3HIM A;  4MK6 A;  5F0F A;  5GP9 A;  2UXU A;  3HGY A;  5GPA A;  1QVU A;  2ZCX A;  3FIW A;  3VOX A;  4JNN A;  5K7F A;  2YVH A;  3CRJ A;  3BR6 A;  5F27 A;  3VW2 A;  2JJ7 A;  2UXP A;  4JYK A;  4B3A A;  3COL A;  3KZ9 A;  3IH4 A;  5FMP A;  2PZ9 A;  2XGE A;  2Y30 A;  2FX0 A;  2QIB A;  5K7Z A;  3BTC A;  4ICH A;  3VPR A;  3VIB A;  3FRQ A;  5FHP A;  2GFN A;  4PXI A;  4GCT A;  5EZH A;  2UXO A;  2QCO A;  3NRG A;  2UXI A;  3RH2 A;  3QPL A;  4MO7 A;  3DCF A;  3AQT A;  2YVE A;  2NX4 A;  4NN1 A;  5J1R A;  1Z77 A;  3Q0V A;  2XGD A;  4M3D A;  3QPS A;  2GEN A;  5C4Y A;  2GUH A;  2O7T A;  3T6N A;  3JSJ A;  2OF7 A;  2Y2Z A;  1JUM A;  3IUV A;  2OI8 A;  2XB5 A;  3KKC A;  2Y31 A;  4AF5 A;  2RAE A;  3VOK A;  3VUQ A;  2IEK A;  5IPA A;  2VKE A;  3ON4 A;  3SFI A;  2G7G A;  3CCY A;  5AQC A;  3VW0 A;  3BNI A;  3BR0 A;  2XPU A;  3ZQH A;  2ZOZ A;  2NS7 A;  3BTI A;  3FK7 A;  1QPI A;  4NEL A;  3HE0 A;  3ANG A;  5FKK A;  3HTJ A;  3NPI A;  3HTI A;  2HXI A;  4G12 A;  1UI6 A;  3GZI A;  2G0E A;  2ID3 A;  2XPV A;  3SDG A;  2TRT A;  2WUI A;  3CJD A;  2G7L A;  3KNW A;  3GEU A;  3TP3 A;  3BR2 A;  2IAI A;  4XK4 A;  4D7M A;  2HQ5 A;  5J1Y A;  4GCK A;  3ZQF A;  1JUP A;  4AC0 A;  3CDL A;  1U9O A;  5D18 A;  5HAW A;  1JT0 A;  3CWR A;  3Q3S A;  5H9T A;  4M3E A;  4AUX A;  3Q0U A;  3DPJ A;  3TP0 A;  2RAS A;  5FGL A;  2ZCM A;  4HKU A;  2G3B A;  3V78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...