4HKUA

The crystal structure of tetr transcriptional regulator (lmo2814) from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
174
structure length
174
Chain Sequence
ARLSQEIILNMAEKIIYEKGMEKTTLYDIASNLNVTHAALYKHYRNKEDLFQKLALRWLEETSREIFAWTQDAGQTPDDALHDWLWLLADTKKKRYKTDRKMFLLYTDYIEQNEELVKNHVAHLAQKAEEVSGRTNQGNAIITAFTYFHNPYFASRWEQAGYVDLFEDVWQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of TetR transcriptional regulator (lmo2814) from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords TetR transcriptional regulator
total genus 69
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17935 TetR_C_27 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4hkuA00
2GBYA 3DCFA 3CRJA 2IEKA 4V2FA 4HKUA 5EZGA 3GEUA 3HTAA 2Y2ZA 3ZQLA 3MNLA 3AQSA 1JUMA 3G1LA 4JL3A 3C07A 3FK6A 2QKOA 3RD3A 2Y30A 2FBQA 2JK3A 2DTZA 4X1EA 3ANPA 5FGLA 3QQAA 4GFLA 3ON4A 3BCGA 5HBUA 3BR3A 3HGGA 2RHAA 1QVUA 4M3EA 3V78A 5CW8A 2XRLA 3F0CA 5F0HA 3G1MA 3KKDA 3HTIA 1JTYA 3NI7A 3G1OA 5H9TA 3B6CA 1BJZA 1U9NA 3VP5A 2NS8A 2ZCMA 3BJBA 5F0FA 3NNRA 5IOYA 3O8HA 2XPWA 2NP3A 4JYKA 2ZCXA 5D1RA 4GCKA 4JNNA 4AUXA 3PM1A 3BTIA 5EFYA 4KWAA 2OI8A 1JUSA 3HIMA 3RH2A 3BR2A 3NXCA 3ZQHA 3EUPA 5K7HA 2X6OA 2ZOYA 4MK6A 3LWJA 5FKMA 3BR5A 3B6AA 3AQTA 5FKKA 2IU5A 3DPJA 2ZCNA 3QPLA 4ACIA 2FD5A 2WUIA 5F1JA 2HXIA 5IPAA 2O7OA 3V6GA 2PZ9A 4ABZA 3WHCA 2OERA 5IOZA 3BRUA 3O8GA 2GENA 2NP5A 3LHQA 3LOCA 5K7FA 5J1RA 4GCTA 2DG7A 3VOKA 3LSPA 2D6YA 5D18A 3CDLA 3KZ9A 5F08A 2YVHA 1U9OA 1VI0A 2G0EA 2QWTA 1JT0A 1JTXA 2GFNA 3T6NA 2ID6A 3HGYA 4I76A 2Q24A 3WHBA 1RPWA 5FKLA 2ID3A 2XGDA 3S5RA 3IUVA 2RASA 4I6ZA 3ANGA 2HYTA 4UDSA 3PPBA 5FMPA 5CXGA 3QPSA 2HQ5A 3VW2A 2XB5A 2OF7A 3HE0A 2XPVA 3IH3A 3VVXA 5J3LA 2REKA 3ZQIA 3B81A 2WV1A 3TP3A 3Q0UA 3NRGA 2VKEA 5CXIA 3HTJA 2EH3A 2G7SA 5FKOA 4D5FA 1T56A 2RAEA 2FJ1A 2QIBA 3PASA 3BNIA 2FQ4A 4NELA 4ICHA 2UXOA 3FIWA 2PBXA 2X9DA 4GFKA 3BR0A 2WGBA 4B3AA 1QPIA 5GP9A 4W1UA 5D19A 3TP0A 4M3DA 4MXMA 1Z77A 2IBDA 1ORKA 2UXPA 4ME9A 4V2GA 3BQZA 3ZQGA 4XK4A 2HXOA 5FKNA 2HKUA 4DW6A 3JSJA 2ZOZA 5DAJA 3VIBA 3LSRA 3C2BA 2G3BA 2G7GA 5C4YA 2XGEA 5FHPA 2JJ7A 1UI6A 5GPCA 5J1UA 1RKTA 3KNWA 3CWRA 2UXHA 5J1YA 2G7LA 2XPUA 1Z0XA 3VOXA 5EYRA 5K7ZA 1T33A 3IH2A 1ZKGA 4NN1A 2TRTA 1JT6A 3QKXA 2QOPA 3FRQA 3O60A 3FK7A 4M3BA 3EGQA 2O7TA 3BTCA 3P9TA 4PXIA 2TCTA 2VPRA 1SGMA 3BR6A 2I10A 3BTLA 2F07A 2XGCA 2QCOA 4GCLA 5HAWA 3CJDA 4G12A 1RKWA 4AC0A 4D7NA 2Y31A 5AQCA 3E7QA 3IH4A 3Q3SA 2W53A 3VPRA 2QTQA 5F27A 3LSJA 2DG8A 3SDGA 3BHQA 2NX4A 3G7RA 5F04A 5IP6A 3Q0VA 1A6IA 2UXIA 3VW0A 1ZK8A 3DEWA 4AF5A 3BTJA 2VKVA 3Q0WA 4M3GA 4JKZA 2ZB9A 3HTHA 3SFIA 3LJLA 4L62A 3COLA 2NS7A 3VVZA 3F1BA 2HYJA 3VW1A 4B1RA 4M3FA 4W97A 4D7MA 5F0CA 5GPAA 4MO7A 5HSZA 3ZQFA 3VVYA 3MVPA 3BQYA 4AC6A 5K58A 3G56A 2YVEA 3QBMA 2XDNA 4YZEA 3ON2A 3BR1A 2FX0A 2OPTA 3BT9A 3GZIA 2V57A 1QVTA 4D5CA 3CCYA 1UI5A 5EZHA 3VUQA 2IAIA 4CGRA 1JUPA 2GUHA 2UXUA 3NPIA 3KKCA
chains in the Genus database with same CATH superfamily
2GBYA 3DCFA 3CRJA 2IEKA 4V2FA 4HKUA 5EZGA 3GEUA 3HTAA 5CQGA 2Y2ZA 3ZQLA 3MNLA 3AQSA 1JUMA 3G1LA 4JL3A 3C07A 3FK6A 2QKOA 3RD3A 2B3WA 2Y30A 2FBQA 2JK3A 2DTZA 4X1EA 3ANPA 5FGLA 3QQAA 4GFLA 3ON4A 4U9NA 3BCGA 5HBUA 3BR3A 3HGGA 2RHAA 1QVUA 4M3EA 3V78A 5CW8A 2XRLA 3F0CA 5F0HA 3G1MA 3KKDA 3HTIA 1JTYA 3NI7A 3G1OA 5H9TA 3B6CA 1BJZA 1U9NA 2R7UA 3VP5A 2NS8A 2ZCMA 3BJBA 5F0FA 3NNRA 5IOYA 3O8HA 2XPWA 2NP3A 4JYKA 2ZCXA 5D1RA 4GCKA 4JNNA 4AUXA 3PM1A 3BTIA 2YVXA 5EFYA 4KWAA 2OI8A 1JUSA 3HIMA 3NS4A 3RH2A 3BR2A 3NXCA 3ZQHA 3EUPA 5K7HA 2X6OA 2ZOYA 4MK6A 3DU6A 3LWJA 5FKMA 3BR5A 3B6AA 3AQTA 5FKKA 2IU5A 3DPJA 2ZCNA 4OD4A 3QPLA 4ACIA 2FD5A 2WUIA 5F1JA 2HXIA 5IPAA 2O7OA 3K8PC 3V6GA 2PZ9A 2R7OA 4ABZA 3WHCA 2OERA 5IOZA 3BRUA 3O8GA 2GENA 2NP5A 3LHQA 3LOCA 5K7FA 5J1RA 2R7QA 4GCTA 2DG7A 3VOKA 3LSPA 2D6YA 5D18A 3CDLA 3KZ9A 5F08A 2YVHA 1U9OA 1VI0A 2G0EA 2QWTA 1JT0A 1JTXA 2GFNA 3T6NA 2ID6A 3HGYA 4I76A 2Q24A 3WHBA 2R7VA 1RPWA 2R7RA 5FKLA 2ID3A 2XGDA 3S5RA 3IUVA 2RASA 4I6ZA 3ANGA 2HYTA 4UDSA 3PPBA 5FMPA 5CXGA 2PFVA 3QPSA 2HQ5A 3VW2A 2XB5A 2OF7A 3HE0A 2XPVA 3ZQIA 3IH3A 5J3LA 2REKA 3VVXA 3B81A 2A2FX 2WV1A 3TP3A 3Q0UA 3NRGA 2VKEA 5CXIA 3HTJA 2EH3A 4WIBA 2G7SA 5FKOA 4D5FA 1T56A 4U9LA 2RAEA 2FJ1A 2QIBA 4C2MA 3PASA 3BNIA 2FQ4A 4NELA 4ICHA 2UXOA 2B1EA 3FIWA 2PBXA 2X9DA 4GFKA 3BR0A 2WGBA 4B3AA 1QPIA 5GP9A 3DU5A 2R7SA 4W1UA 5D19A 3TP0A 4M3DA 4MXMA 1Z77A 2IBDA 1ORKA 2UXPA 4ME9A 3SWHA 4V2GA 3BQZA 3ZQGA 4XK4A 2HXOA 5FKNA 2HKUA 4DW6A 3JSJA 2ZOZA 5DAJA 3VIBA 3LSRA 3C2BA 2G3BA 2G7GA 5C4YA 2XGEA 5FHPA 2JJ7A 1UI6A 5GPCA 5J1UA 1RKTA 3KNWA 4DVYP 3CWRA 2UXHA 5J1YA 2G7LA 2XPUA 2ZY9A 1Z0XA 3VOXA 2R7TA 5EYRA 5K7ZA 1T33A 3IH2A 2R7XA 1ZKGA 4NN1A 2TRTA 4IRVA 1JT6A 3QKXA 3VTIA 3FHNA 2QOPA 3FRQA 3O60A 3FK7A 4M3BA 3EGQA 2O7TA 3BTCA 3P9TA 4PXIA 2TCTA 2VPRA 1SGMA 3BR6A 2I10A 3BTLA 2F07A 2XGCA 2QCOA 4GCLA 5HAWA 3CJDA 4G12A 1RKWA 4AC0A 4D7NA 2Y31A 5AQCA 3E7QA 3IH4A 3Q3SA 2W53A 3VPRA 2QTQA 5F27A 3LSJA 2DG8A 3SDGA 3KYLA 3BHQA 2NX4A 3G7RA 5F04A 5IP6A 3Q0VA 1A6IA 2UXIA 3VW0A 1ZK8A 3DEWA 4AF5A 3BTJA 2VKVA 3Q0WA 2FJI1 4M3GA 4JKZA 2ZB9A 3HTHA 3SFIA 3LJLA 4L62A 3COLA 2NS7A 3VVZA 3F1BA 2HYJA 3VW1A 4B1RA 4M3FA 4W97A 4D7MA 5F0CA 5GPAA 4MO7A 4OD5A 2R7WA 5HSZA 3ZQFA 3VVYA 3MVPA 3BQYA 4AC6A 5K58A 3G56A 2YVEA 3QBMA 2XDNA 4YZEA 3ON2A 3BR1A 2FX0A 2OPTA 3BT9A 3GZIA 2V57A 1QVTA 4D5CA 3CCYA 1UI5A 5EZHA 3VUQA 2IAIA 4CGRA 1JUPA 2GUHA 2UXUA 3NPIA 3KKCA
chains in the Genus database with same CATH topology
2GBYA 3DCFA 3CRJA 2IEKA 4V2FA 4HKUA 5EZGA 3GEUA 3HTAA 2Y2ZA 3ZQLA 3MNLA 3AQSA 1JUMA 3G1LA 4JL3A 3C07A 3FK6A 2QKOA 3RD3A 2Y30A 2FBQA 2JK3A 2DTZA 4X1EA 3ANPA 5FGLA 3QQAA 4GFLA 3ON4A 3BCGA 5HBUA 3BR3A 3HGGA 2RHAA 1QVUA 4M3EA 3V78A 5CW8A 2XRLA 3F0CA 5F0HA 3G1MA 3KKDA 3HTIA 1JTYA 3NI7A 3G1OA 5H9TA 3B6CA 1BJZA 1U9NA 3VP5A 2NS8A 2ZCMA 3BJBA 5F0FA 3NNRA 5IOYA 3O8HA 2XPWA 2NP3A 4JYKA 2ZCXA 5D1RA 4GCKA 4JNNA 4AUXA 3PM1A 3BTIA 5EFYA 4KWAA 2OI8A 1JUSA 3HIMA 3RH2A 3BR2A 3NXCA 3ZQHA 3EUPA 5K7HA 2X6OA 2ZOYA 4MK6A 3LWJA 5FKMA 3BR5A 3B6AA 3AQTA 5FKKA 2IU5A 3DPJA 2ZCNA 3QPLA 4ACIA 2FD5A 2WUIA 5F1JA 2HXIA 5IPAA 2O7OA 3V6GA 2PZ9A 4ABZA 3WHCA 2OERA 5IOZA 3BRUA 3O8GA 2GENA 2NP5A 3LHQA 3LOCA 5K7FA 5J1RA 4GCTA 2DG7A 3VOKA 3LSPA 2D6YA 5D18A 3CDLA 3KZ9A 5F08A 2YVHA 1U9OA 1VI0A 2G0EA 2QWTA 1JT0A 1JTXA 2GFNA 3T6NA 2ID6A 3HGYA 4I76A 2Q24A 3WHBA 1RPWA 5FKLA 2ID3A 2XGDA 3S5RA 3IUVA 2RASA 4I6ZA 3ANGA 2HYTA 4UDSA 3PPBA 5FMPA 5CXGA 3QPSA 2HQ5A 3VW2A 2XB5A 2OF7A 3HE0A 2XPVA 3IH3A 3VVXA 5J3LA 2REKA 3ZQIA 3B81A 2WV1A 3TP3A 3Q0UA 3NRGA 2VKEA 5CXIA 3HTJA 2EH3A 2G7SA 5FKOA 4D5FA 1T56A 2RAEA 2FJ1A 2QIBA 3PASA 3BNIA 2FQ4A 4NELA 4ICHA 2UXOA 3FIWA 2PBXA 2X9DA 4GFKA 3BR0A 2WGBA 4B3AA 1QPIA 5GP9A 4W1UA 5D19A 3TP0A 4M3DA 4MXMA 1Z77A 2IBDA 1ORKA 2UXPA 4ME9A 4V2GA 3BQZA 3ZQGA 4XK4A 2HXOA 5FKNA 2HKUA 4DW6A 3JSJA 2ZOZA 5DAJA 3VIBA 3LSRA 3C2BA 2G3BA 2G7GA 5C4YA 2XGEA 5FHPA 2JJ7A 1UI6A 5GPCA 5J1UA 1RKTA 3KNWA 3CWRA 2UXHA 5J1YA 2G7LA 2XPUA 1Z0XA 3VOXA 5EYRA 5K7ZA 1T33A 3IH2A 1ZKGA 4NN1A 2TRTA 1JT6A 3QKXA 2QOPA 3FRQA 3O60A 3FK7A 4M3BA 3EGQA 2O7TA 3BTCA 3P9TA 4PXIA 2TCTA 2VPRA 1SGMA 3BR6A 2I10A 3BTLA 2F07A 2XGCA 2QCOA 4GCLA 5HAWA 3CJDA 4G12A 1RKWA 4AC0A 4D7NA 2Y31A 5AQCA 3E7QA 3IH4A 3Q3SA 2W53A 3VPRA 2QTQA 5F27A 3LSJA 2DG8A 3SDGA 3BHQA 2NX4A 3G7RA 5F04A 5IP6A 3Q0VA 1A6IA 2UXIA 3VW0A 1ZK8A 3DEWA 4AF5A 3BTJA 2VKVA 3Q0WA 4M3GA 4JKZA 2ZB9A 3HTHA 3SFIA 3LJLA 4L62A 3COLA 2NS7A 3VVZA 3F1BA 2HYJA 3VW1A 4B1RA 4M3FA 4W97A 4D7MA 5F0CA 5GPAA 4MO7A 5HSZA 3ZQFA 3VVYA 3MVPA 3BQYA 4AC6A 5K58A 3G56A 2YVEA 3QBMA 2XDNA 4YZEA 3ON2A 3BR1A 2FX0A 2OPTA 3BT9A 3GZIA 2V57A 1QVTA 4D5CA 3CCYA 1UI5A 5EZHA 3VUQA 2IAIA 4CGRA 1JUPA 2GUHA 2UXUA 3NPIA 3KKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBY A;  3DCF A;  3CRJ A;  2IEK A;  4V2F A;  4HKU A;  5EZG A;  3GEU A;  3HTA A;  2Y2Z A;  3ZQL A;  3MNL A;  3AQS A;  1JUM A;  3G1L A;  4JL3 A;  3C07 A;  3FK6 A;  2QKO A;  3RD3 A;  2Y30 A;  2FBQ A;  2JK3 A;  2DTZ A;  4X1E A;  3ANP A;  5FGL A;  3QQA A;  4GFL A;  3ON4 A;  3BCG A;  5HBU A;  3BR3 A;  3HGG A;  2RHA A;  1QVU A;  4M3E A;  3V78 A;  5CW8 A;  2XRL A;  3F0C A;  5F0H A;  3G1M A;  3KKD A;  3HTI A;  1JTY A;  3NI7 A;  3G1O A;  5H9T A;  3B6C A;  1BJZ A;  1U9N A;  3VP5 A;  2NS8 A;  2ZCM A;  3BJB A;  5F0F A;  3NNR A;  5IOY A;  3O8H A;  2XPW A;  2NP3 A;  4JYK A;  2ZCX A;  5D1R A;  4GCK A;  4JNN A;  4AUX A;  3PM1 A;  3BTI A;  5EFY A;  4KWA A;  2OI8 A;  1JUS A;  3HIM A;  3RH2 A;  3BR2 A;  3NXC A;  3ZQH A;  3EUP A;  5K7H A;  2X6O A;  2ZOY A;  4MK6 A;  3LWJ A;  5FKM A;  3BR5 A;  3B6A A;  3AQT A;  5FKK A;  2IU5 A;  3DPJ A;  2ZCN A;  3QPL A;  4ACI A;  2FD5 A;  2WUI A;  5F1J A;  2HXI A;  5IPA A;  2O7O A;  3V6G A;  2PZ9 A;  4ABZ A;  3WHC A;  2OER A;  5IOZ A;  3BRU A;  3O8G A;  2GEN A;  2NP5 A;  3LHQ A;  3LOC A;  5K7F A;  5J1R A;  4GCT A;  2DG7 A;  3VOK A;  3LSP A;  2D6Y A;  5D18 A;  3CDL A;  3KZ9 A;  5F08 A;  2YVH A;  1U9O A;  1VI0 A;  2G0E A;  2QWT A;  1JT0 A;  1JTX A;  2GFN A;  3T6N A;  2ID6 A;  3HGY A;  4I76 A;  2Q24 A;  3WHB A;  1RPW A;  5FKL A;  2ID3 A;  2XGD A;  3S5R A;  3IUV A;  2RAS A;  4I6Z A;  3ANG A;  2HYT A;  4UDS A;  3PPB A;  5FMP A;  5CXG A;  3QPS A;  2HQ5 A;  3VW2 A;  2XB5 A;  2OF7 A;  3HE0 A;  2XPV A;  3IH3 A;  3VVX A;  5J3L A;  2REK A;  3ZQI A;  3B81 A;  2WV1 A;  3TP3 A;  3Q0U A;  3NRG A;  2VKE A;  5CXI A;  3HTJ A;  2EH3 A;  2G7S A;  5FKO A;  4D5F A;  1T56 A;  2RAE A;  2FJ1 A;  2QIB A;  3PAS A;  3BNI A;  2FQ4 A;  4NEL A;  4ICH A;  2UXO A;  3FIW A;  2PBX A;  2X9D A;  4GFK A;  3BR0 A;  2WGB A;  4B3A A;  1QPI A;  5GP9 A;  4W1U A;  5D19 A;  3TP0 A;  4M3D A;  4MXM A;  1Z77 A;  2IBD A;  1ORK A;  2UXP A;  4ME9 A;  4V2G A;  3BQZ A;  3ZQG A;  4XK4 A;  2HXO A;  5FKN A;  2HKU A;  4DW6 A;  3JSJ A;  2ZOZ A;  5DAJ A;  3VIB A;  3LSR A;  3C2B A;  2G3B A;  2G7G A;  5C4Y A;  2XGE A;  5FHP A;  2JJ7 A;  1UI6 A;  5GPC A;  5J1U A;  1RKT A;  3KNW A;  3CWR A;  2UXH A;  5J1Y A;  2G7L A;  2XPU A;  1Z0X A;  3VOX A;  5EYR A;  5K7Z A;  1T33 A;  3IH2 A;  1ZKG A;  4NN1 A;  2TRT A;  1JT6 A;  3QKX A;  2QOP A;  3FRQ A;  3O60 A;  3FK7 A;  4M3B A;  3EGQ A;  2O7T A;  3BTC A;  3P9T A;  4PXI A;  2TCT A;  2VPR A;  1SGM A;  3BR6 A;  2I10 A;  3BTL A;  2F07 A;  2XGC A;  2QCO A;  4GCL A;  5HAW A;  3CJD A;  4G12 A;  1RKW A;  4AC0 A;  4D7N A;  2Y31 A;  5AQC A;  3E7Q A;  3IH4 A;  3Q3S A;  2W53 A;  3VPR A;  2QTQ A;  5F27 A;  3LSJ A;  2DG8 A;  3SDG A;  3BHQ A;  2NX4 A;  3G7R A;  5F04 A;  5IP6 A;  3Q0V A;  1A6I A;  2UXI A;  3VW0 A;  1ZK8 A;  3DEW A;  4AF5 A;  3BTJ A;  2VKV A;  3Q0W A;  4M3G A;  4JKZ A;  2ZB9 A;  3HTH A;  3SFI A;  3LJL A;  4L62 A;  3COL A;  2NS7 A;  3VVZ A;  3F1B A;  2HYJ A;  3VW1 A;  4B1R A;  4M3F A;  4W97 A;  4D7M A;  5F0C A;  5GPA A;  4MO7 A;  5HSZ A;  3ZQF A;  3VVY A;  3MVP A;  3BQY A;  4AC6 A;  5K58 A;  3G56 A;  2YVE A;  3QBM A;  2XDN A;  4YZE A;  3ON2 A;  3BR1 A;  2FX0 A;  2OPT A;  3BT9 A;  3GZI A;  2V57 A;  1QVT A;  4D5C A;  3CCY A;  1UI5 A;  5EZH A;  3VUQ A;  2IAI A;  4CGR A;  1JUP A;  2GUH A;  2UXU A;  3NPI A;  3KKC A; 
#chains in the Genus database with same CATH topology
 2GBY A;  3DCF A;  3CRJ A;  2IEK A;  4V2F A;  4HKU A;  5EZG A;  3GEU A;  3HTA A;  5CQG A;  2Y2Z A;  3ZQL A;  3MNL A;  3AQS A;  1JUM A;  3G1L A;  4JL3 A;  3C07 A;  3FK6 A;  2QKO A;  3RD3 A;  2B3W A;  2Y30 A;  2FBQ A;  2JK3 A;  2DTZ A;  4X1E A;  3ANP A;  5FGL A;  3QQA A;  4GFL A;  3ON4 A;  4U9N A;  3BCG A;  5HBU A;  3BR3 A;  3HGG A;  2RHA A;  1QVU A;  4M3E A;  3V78 A;  5CW8 A;  2XRL A;  3F0C A;  5F0H A;  3G1M A;  3KKD A;  3HTI A;  1JTY A;  3NI7 A;  3G1O A;  5H9T A;  3B6C A;  1BJZ A;  1U9N A;  2R7U A;  3VP5 A;  2NS8 A;  2ZCM A;  3BJB A;  5F0F A;  3NNR A;  5IOY A;  3O8H A;  2XPW A;  2NP3 A;  4JYK A;  2ZCX A;  5D1R A;  4GCK A;  4JNN A;  4AUX A;  3PM1 A;  3BTI A;  2YVX A;  5EFY A;  4KWA A;  2OI8 A;  1JUS A;  3HIM A;  3NS4 A;  3RH2 A;  3BR2 A;  3NXC A;  3ZQH A;  3EUP A;  5K7H A;  2X6O A;  2ZOY A;  4MK6 A;  3DU6 A;  3LWJ A;  5FKM A;  3BR5 A;  3B6A A;  3AQT A;  5FKK A;  2IU5 A;  3DPJ A;  2ZCN A;  4OD4 A;  3QPL A;  4ACI A;  2FD5 A;  2WUI A;  5F1J A;  2HXI A;  5IPA A;  2O7O A;  3K8P C;  3V6G A;  2PZ9 A;  2R7O A;  4ABZ A;  3WHC A;  2OER A;  5IOZ A;  3BRU A;  3O8G A;  2GEN A;  2NP5 A;  3LHQ A;  3LOC A;  5K7F A;  5J1R A;  2R7Q A;  4GCT A;  2DG7 A;  3VOK A;  3LSP A;  2D6Y A;  5D18 A;  3CDL A;  3KZ9 A;  5F08 A;  2YVH A;  1U9O A;  1VI0 A;  2G0E A;  2QWT A;  1JT0 A;  1JTX A;  2GFN A;  3T6N A;  2ID6 A;  3HGY A;  4I76 A;  2Q24 A;  3WHB A;  2R7V A;  1RPW A;  2R7R A;  5FKL A;  2ID3 A;  2XGD A;  3S5R A;  3IUV A;  2RAS A;  4I6Z A;  3ANG A;  2HYT A;  4UDS A;  3PPB A;  5FMP A;  5CXG A;  2PFV A;  3QPS A;  2HQ5 A;  3VW2 A;  2XB5 A;  2OF7 A;  3HE0 A;  2XPV A;  3ZQI A;  3IH3 A;  5J3L A;  2REK A;  3VVX A;  3B81 A;  2A2F X;  2WV1 A;  3TP3 A;  3Q0U A;  3NRG A;  2VKE A;  5CXI A;  3HTJ A;  2EH3 A;  4WIB A;  2G7S A;  5FKO A;  4D5F A;  1T56 A;  4U9L A;  2RAE A;  2FJ1 A;  2QIB A;  4C2M A;  3PAS A;  3BNI A;  2FQ4 A;  4NEL A;  4ICH A;  2UXO A;  2B1E A;  3FIW A;  2PBX A;  2X9D A;  4GFK A;  3BR0 A;  2WGB A;  4B3A A;  1QPI A;  5GP9 A;  3DU5 A;  2R7S A;  4W1U A;  5D19 A;  3TP0 A;  4M3D A;  4MXM A;  1Z77 A;  2IBD A;  1ORK A;  2UXP A;  4ME9 A;  3SWH A;  4V2G A;  3BQZ A;  3ZQG A;  4XK4 A;  2HXO A;  5FKN A;  2HKU A;  4DW6 A;  3JSJ A;  2ZOZ A;  5DAJ A;  3VIB A;  3LSR A;  3C2B A;  2G3B A;  2G7G A;  5C4Y A;  2XGE A;  5FHP A;  2JJ7 A;  1UI6 A;  5GPC A;  5J1U A;  1RKT A;  3KNW A;  4DVY P;  3CWR A;  2UXH A;  5J1Y A;  2G7L A;  2XPU A;  2ZY9 A;  1Z0X A;  3VOX A;  2R7T A;  5EYR A;  5K7Z A;  1T33 A;  3IH2 A;  2R7X A;  1ZKG A;  4NN1 A;  2TRT A;  4IRV A;  1JT6 A;  3QKX A;  3VTI A;  3FHN A;  2QOP A;  3FRQ A;  3O60 A;  3FK7 A;  4M3B A;  3EGQ A;  2O7T A;  3BTC A;  3P9T A;  4PXI A;  2TCT A;  2VPR A;  1SGM A;  3BR6 A;  2I10 A;  3BTL A;  2F07 A;  2XGC A;  2QCO A;  4GCL A;  5HAW A;  3CJD A;  4G12 A;  1RKW A;  4AC0 A;  4D7N A;  2Y31 A;  5AQC A;  3E7Q A;  3IH4 A;  3Q3S A;  2W53 A;  3VPR A;  2QTQ A;  5F27 A;  3LSJ A;  2DG8 A;  3SDG A;  3KYL A;  3BHQ A;  2NX4 A;  3G7R A;  5F04 A;  5IP6 A;  3Q0V A;  1A6I A;  2UXI A;  3VW0 A;  1ZK8 A;  3DEW A;  4AF5 A;  3BTJ A;  2VKV A;  3Q0W A;  2FJI 1;  4M3G A;  4JKZ A;  2ZB9 A;  3HTH A;  3SFI A;  3LJL A;  4L62 A;  3COL A;  2NS7 A;  3VVZ A;  3F1B A;  2HYJ A;  3VW1 A;  4B1R A;  4M3F A;  4W97 A;  4D7M A;  5F0C A;  5GPA A;  4MO7 A;  4OD5 A;  2R7W A;  5HSZ A;  3ZQF A;  3VVY A;  3MVP A;  3BQY A;  4AC6 A;  5K58 A;  3G56 A;  2YVE A;  3QBM A;  2XDN A;  4YZE A;  3ON2 A;  3BR1 A;  2FX0 A;  2OPT A;  3BT9 A;  3GZI A;  2V57 A;  1QVT A;  4D5C A;  3CCY A;  1UI5 A;  5EZH A;  3VUQ A;  2IAI A;  4CGR A;  1JUP A;  2GUH A;  2UXU A;  3NPI A;  3KKC A; 
#chains in the Genus database with same CATH homology
 2GBY A;  3DCF A;  3CRJ A;  2IEK A;  4V2F A;  4HKU A;  5EZG A;  3GEU A;  3HTA A;  2Y2Z A;  3ZQL A;  3MNL A;  3AQS A;  1JUM A;  3G1L A;  4JL3 A;  3C07 A;  3FK6 A;  2QKO A;  3RD3 A;  2Y30 A;  2FBQ A;  2JK3 A;  2DTZ A;  4X1E A;  3ANP A;  5FGL A;  3QQA A;  4GFL A;  3ON4 A;  3BCG A;  5HBU A;  3BR3 A;  3HGG A;  2RHA A;  1QVU A;  4M3E A;  3V78 A;  5CW8 A;  2XRL A;  3F0C A;  5F0H A;  3G1M A;  3KKD A;  3HTI A;  1JTY A;  3NI7 A;  3G1O A;  5H9T A;  3B6C A;  1BJZ A;  1U9N A;  3VP5 A;  2NS8 A;  2ZCM A;  3BJB A;  5F0F A;  3NNR A;  5IOY A;  3O8H A;  2XPW A;  2NP3 A;  4JYK A;  2ZCX A;  5D1R A;  4GCK A;  4JNN A;  4AUX A;  3PM1 A;  3BTI A;  5EFY A;  4KWA A;  2OI8 A;  1JUS A;  3HIM A;  3RH2 A;  3BR2 A;  3NXC A;  3ZQH A;  3EUP A;  5K7H A;  2X6O A;  2ZOY A;  4MK6 A;  3LWJ A;  5FKM A;  3BR5 A;  3B6A A;  3AQT A;  5FKK A;  2IU5 A;  3DPJ A;  2ZCN A;  3QPL A;  4ACI A;  2FD5 A;  2WUI A;  5F1J A;  2HXI A;  5IPA A;  2O7O A;  3V6G A;  2PZ9 A;  4ABZ A;  3WHC A;  2OER A;  5IOZ A;  3BRU A;  3O8G A;  2GEN A;  2NP5 A;  3LHQ A;  3LOC A;  5K7F A;  5J1R A;  4GCT A;  2DG7 A;  3VOK A;  3LSP A;  2D6Y A;  5D18 A;  3CDL A;  3KZ9 A;  5F08 A;  2YVH A;  1U9O A;  1VI0 A;  2G0E A;  2QWT A;  1JT0 A;  1JTX A;  2GFN A;  3T6N A;  2ID6 A;  3HGY A;  4I76 A;  2Q24 A;  3WHB A;  1RPW A;  5FKL A;  2ID3 A;  2XGD A;  3S5R A;  3IUV A;  2RAS A;  4I6Z A;  3ANG A;  2HYT A;  4UDS A;  3PPB A;  5FMP A;  5CXG A;  3QPS A;  2HQ5 A;  3VW2 A;  2XB5 A;  2OF7 A;  3HE0 A;  2XPV A;  3IH3 A;  3VVX A;  5J3L A;  2REK A;  3ZQI A;  3B81 A;  2WV1 A;  3TP3 A;  3Q0U A;  3NRG A;  2VKE A;  5CXI A;  3HTJ A;  2EH3 A;  2G7S A;  5FKO A;  4D5F A;  1T56 A;  2RAE A;  2FJ1 A;  2QIB A;  3PAS A;  3BNI A;  2FQ4 A;  4NEL A;  4ICH A;  2UXO A;  3FIW A;  2PBX A;  2X9D A;  4GFK A;  3BR0 A;  2WGB A;  4B3A A;  1QPI A;  5GP9 A;  4W1U A;  5D19 A;  3TP0 A;  4M3D A;  4MXM A;  1Z77 A;  2IBD A;  1ORK A;  2UXP A;  4ME9 A;  4V2G A;  3BQZ A;  3ZQG A;  4XK4 A;  2HXO A;  5FKN A;  2HKU A;  4DW6 A;  3JSJ A;  2ZOZ A;  5DAJ A;  3VIB A;  3LSR A;  3C2B A;  2G3B A;  2G7G A;  5C4Y A;  2XGE A;  5FHP A;  2JJ7 A;  1UI6 A;  5GPC A;  5J1U A;  1RKT A;  3KNW A;  3CWR A;  2UXH A;  5J1Y A;  2G7L A;  2XPU A;  1Z0X A;  3VOX A;  5EYR A;  5K7Z A;  1T33 A;  3IH2 A;  1ZKG A;  4NN1 A;  2TRT A;  1JT6 A;  3QKX A;  2QOP A;  3FRQ A;  3O60 A;  3FK7 A;  4M3B A;  3EGQ A;  2O7T A;  3BTC A;  3P9T A;  4PXI A;  2TCT A;  2VPR A;  1SGM A;  3BR6 A;  2I10 A;  3BTL A;  2F07 A;  2XGC A;  2QCO A;  4GCL A;  5HAW A;  3CJD A;  4G12 A;  1RKW A;  4AC0 A;  4D7N A;  2Y31 A;  5AQC A;  3E7Q A;  3IH4 A;  3Q3S A;  2W53 A;  3VPR A;  2QTQ A;  5F27 A;  3LSJ A;  2DG8 A;  3SDG A;  3BHQ A;  2NX4 A;  3G7R A;  5F04 A;  5IP6 A;  3Q0V A;  1A6I A;  2UXI A;  3VW0 A;  1ZK8 A;  3DEW A;  4AF5 A;  3BTJ A;  2VKV A;  3Q0W A;  4M3G A;  4JKZ A;  2ZB9 A;  3HTH A;  3SFI A;  3LJL A;  4L62 A;  3COL A;  2NS7 A;  3VVZ A;  3F1B A;  2HYJ A;  3VW1 A;  4B1R A;  4M3F A;  4W97 A;  4D7M A;  5F0C A;  5GPA A;  4MO7 A;  5HSZ A;  3ZQF A;  3VVY A;  3MVP A;  3BQY A;  4AC6 A;  5K58 A;  3G56 A;  2YVE A;  3QBM A;  2XDN A;  4YZE A;  3ON2 A;  3BR1 A;  2FX0 A;  2OPT A;  3BT9 A;  3GZI A;  2V57 A;  1QVT A;  4D5C A;  3CCY A;  1UI5 A;  5EZH A;  3VUQ A;  2IAI A;  4CGR A;  1JUP A;  2GUH A;  2UXU A;  3NPI A;  3KKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...