4HKUA

The crystal structure of tetr transcriptional regulator (lmo2814) from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
174
structure length
174
Chain Sequence
ARLSQEIILNMAEKIIYEKGMEKTTLYDIASNLNVTHAALYKHYRNKEDLFQKLALRWLEETSREIFAWTQDAGQTPDDALHDWLWLLADTKKKRYKTDRKMFLLYTDYIEQNEELVKNHVAHLAQKAEEVSGRTNQGNAIITAFTYFHNPYFASRWEQAGYVDLFEDVWQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR transcriptional regulator
publication title The crystal structure of TetR transcriptional regulator (lmo2814) from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription
total genus 69
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17935 TetR_C_27 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4hkuA00
3G1MA 2HYTA 2RHAA 3ON4A 4D5CA 2DTZA 1A6IA 2QCOA 3ON2A 3IH4A 2ZCNA 3V6GA 4ICHA 3HIMA 4JYKA 3SDGA 2G7SA 3LSPA 4GFKA 2UXOA 1ORKA 2G7LA 3B6CA 3O60A 4MO7A 5F0FA 3SFIA 5J1RA 3BT9A 3BRUA 3EUPA 5IPAA 4G12A 2NX4A 4B1RA 3CWRA 3T6NA 3TP3A 1QVTA 2Y2ZA 2W53A 3LOCA 2VKEA 5DAJA 2NP5A 5GP9A 2IBDA 3FIWA 2OI8A 5D18A 2PZ9A 3QKXA 3G1OA 4M3EA 3Q0VA 3BNIA 2XDNA 2UXIA 4W97A 5C4YA 3VVYA 2FX0A 2DG7A 2JJ7A 3KNWA 2ZOYA 2O7OA 3BTJA 3VW0A 3CRJA 2Y30A 3BR0A 4YZEA 3ANPA 4CGRA 5FKMA 3VPRA 1JT0A 3B81A 1SGMA 3JSJA 3O8HA 1QVUA 3VP5A 3F0CA 4L62A 2UXHA 4JKZA 2I10A 3HTJA 3F1BA 2XGEA 5F0CA 3G1LA 2QIBA 3DEWA 5EZHA 5F08A 2G3BA 5FGLA 3MVPA 4V2GA 2X6OA 3PM1A 4MK6A 2FQ4A 3G7RA 4NELA 2JK3A 4NN1A 2GENA 3BTCA 5K7ZA 4PXIA 2HKUA 2HXOA 2XGCA 4AC6A 4W1UA 2XB5A 3HE0A 5K7FA 4I76A 3BJBA 2UXUA 2NS7A 3DPJA 3B6AA 2G7GA 5CXGA 3AQTA 5F27A 2ZCXA 3QBMA 4V2FA 3LJLA 3BQYA 2NP3A 2F07A 3CDLA 5HBUA 3NRGA 2GUHA 3FK7A 4X1EA 3PPBA 3BR6A 2D6YA 2HQ5A 4GCKA 2Q24A 3P9TA 4M3FA 5HAWA 2XRLA 3Q0UA 3NPIA 5IOYA 5K58A 5FKKA 3GEUA 2WGBA 2Y31A 2O7TA 4GFLA 2ID6A 2RAEA 2WV1A 2ZB9A 3KZ9A 4D5FA 4ACIA 1ZKGA 3HTIA 1RKTA 3COLA 3HGGA 2GFNA 4XK4A 3BQZA 4M3GA 3G56A 4ABZA 3QPSA 4JNNA 2PBXA 4DW6A 3KKDA 3BTIA 5FHPA 2VPRA 2UXPA 3NNRA 3C2BA 3QPLA 3CJDA 5D1RA 4GCLA 3BR2A 5F1JA 2TCTA 4D7MA 4AUXA 4ME9A 2XGDA 3WHBA 2QKOA 1JTXA 3ZQFA 4GCTA 1T56A 1U9NA 3E7QA 2YVHA 3EGQA 3KKCA 3HTHA 3C07A 5FKLA 5EYRA 1JUPA 4AF5A 2V57A 2XPVA 2TRTA 1JUMA 5AQCA 4JL3A 5J1YA 2OF7A 3VOKA 2GBYA 5GPCA 5J1UA 4M3DA 3WHCA 1RKWA 5IOZA 2NS8A 1JUSA 1Z77A 5J3LA 3LSJA 4KWAA 1QPIA 5D19A 5GPAA 3BHQA 3VVZA 3CCYA 1UI6A 2G0EA 3RH2A 2RASA 5FKOA 3BR1A 3HGYA 3Q0WA 3NXCA 5CW8A 2REKA 2X9DA 3S5RA 3HTAA 2EH3A 2ZOZA 2OPTA 3ZQIA 3NI7A 3ZQLA 4M3BA 4UDSA 3FK6A 2QOPA 3IUVA 5K7HA 3VUQA 3BR5A 3AQSA 5EFYA 2IU5A 2WUIA 5F0HA 3Q3SA 2XPUA 5F04A 2IAIA 3VIBA 4I6ZA 3BTLA 5CXIA 2OERA 3QQAA 5FKNA 2FD5A 3ANGA 1U9OA 3MNLA 3VVXA 3LHQA 2YVEA 2HYJA 3ZQGA 1JT6A 4B3AA 2ZCMA 2QTQA 2DG8A 2FJ1A 5EZGA 5H9TA 3LSRA 3RD3A 3BR3A 4D7NA 3V78A 3VW2A 3FRQA 2ID3A 3IH3A 1RPWA 3BCGA 5HSZA 3PASA 3VOXA 1BJZA 4MXMA 2HXIA 2QWTA 3ZQHA 2VKVA 2FBQA 3DCFA 1JTYA 1UI5A 4HKUA 1Z0XA 4AC0A 5FMPA 1VI0A 3O8GA 2XPWA 3LWJA 5IP6A 3GZIA 3VW1A 3TP0A 3IH2A 2IEKA 1T33A 1ZK8A
chains in the Genus database with same CATH superfamily
3G1MA 2HYTA 2RHAA 3ON4A 2FJI1 4D5CA 2DTZA 2B3WA 1A6IA 2QCOA 3K8PC 3ON2A 3IH4A 2ZCNA 3NS4A 3V6GA 4ICHA 2R7VA 3HIMA 4JYKA 3SDGA 2G7SA 3LSPA 4GFKA 2UXOA 1ORKA 2G7LA 3B6CA 4OD4A 3O60A 4MO7A 5F0FA 3SFIA 5J1RA 3BT9A 4U9NA 3BRUA 3EUPA 5IPAA 4G12A 2NX4A 4B1RA 3CWRA 2B1EA 3T6NA 3TP3A 1QVTA 2Y2ZA 2W53A 3LOCA 2VKEA 5DAJA 2NP5A 5GP9A 2IBDA 3FIWA 2OI8A 2R7QA 5D18A 2PZ9A 3QKXA 3VTIA 3G1OA 4M3EA 3Q0VA 3BNIA 2XDNA 2UXIA 4W97A 5C4YA 3VVYA 2FX0A 2DG7A 2JJ7A 3KNWA 2ZOYA 2O7OA 3BTJA 3VW0A 3CRJA 2Y30A 3BR0A 4YZEA 4C2MA 3ANPA 4CGRA 5FKMA 3VPRA 1JT0A 3B81A 1SGMA 3JSJA 3O8HA 1QVUA 3VP5A 3F0CA 4L62A 2UXHA 4JKZA 2I10A 3HTJA 3F1BA 2XGEA 5F0CA 3G1LA 2R7TA 2QIBA 3DU5A 3DEWA 5EZHA 5F08A 2G3BA 5FGLA 3MVPA 4V2GA 2X6OA 3PM1A 4MK6A 2FQ4A 3G7RA 4NELA 2R7WA 2JK3A 4NN1A 2GENA 3BTCA 5K7ZA 4PXIA 2HKUA 2HXOA 2XGCA 4AC6A 4W1UA 2XB5A 3HE0A 5K7FA 4I76A 3BJBA 2UXUA 2NS7A 3DPJA 3B6AA 2G7GA 5CXGA 3AQTA 5F27A 2ZCXA 3QBMA 4V2FA 3LJLA 3BQYA 2NP3A 2F07A 3CDLA 5HBUA 3NRGA 2GUHA 3FK7A 4X1EA 3PPBA 3BR6A 2D6YA 2HQ5A 4GCKA 2Q24A 3P9TA 4M3FA 3KYLA 5HAWA 2XRLA 3Q0UA 3NPIA 4U9LA 5IOYA 5K58A 5FKKA 3GEUA 2WGBA 2Y31A 2O7TA 4GFLA 2ID6A 2RAEA 2WV1A 2ZB9A 3KZ9A 4D5FA 4ACIA 1ZKGA 3HTIA 1RKTA 3COLA 3HGGA 2GFNA 4XK4A 3BQZA 4M3GA 3G56A 4ABZA 3QPSA 4JNNA 2PBXA 4DW6A 3KKDA 3BTIA 5FHPA 2VPRA 2UXPA 3NNRA 3C2BA 3QPLA 3CJDA 5D1RA 4GCLA 3BR2A 5F1JA 2TCTA 4D7MA 4AUXA 4ME9A 2XGDA 3WHBA 2QKOA 1JTXA 3ZQFA 4GCTA 1T56A 1U9NA 3E7QA 2YVHA 3EGQA 3KKCA 3DU6A 3HTHA 3C07A 5FKLA 5EYRA 1JUPA 4AF5A 2V57A 2XPVA 2ZY9A 2TRTA 1JUMA 5AQCA 4JL3A 5J1YA 2OF7A 3VOKA 2GBYA 5GPCA 2R7UA 5J1UA 4M3DA 2R7XA 3WHCA 1RKWA 5IOZA 2NS8A 1JUSA 1Z77A 2R7OA 5J3LA 3LSJA 4KWAA 1QPIA 5D19A 2R7RA 5GPAA 3BHQA 3VVZA 3CCYA 2PFVA 1UI6A 2G0EA 3RH2A 2RASA 2A2FX 5FKOA 3BR1A 3HGYA 3Q0WA 2YVXA 3NXCA 3FHNA 5CW8A 2REKA 2X9DA 3S5RA 3HTAA 2EH3A 2ZOZA 2OPTA 3ZQIA 3NI7A 3ZQLA 4M3BA 4UDSA 2R7SA 3FK6A 2QOPA 3IUVA 5K7HA 3VUQA 3BR5A 3AQSA 5EFYA 2IU5A 2WUIA 5F0HA 3Q3SA 2XPUA 5F04A 2IAIA 3VIBA 4I6ZA 3BTLA 5CXIA 3SWHA 2OERA 3QQAA 5FKNA 2FD5A 3ANGA 1U9OA 3MNLA 3VVXA 3LHQA 2YVEA 2HYJA 3ZQGA 1JT6A 4B3AA 2ZCMA 2QTQA 2DG8A 2FJ1A 5EZGA 5H9TA 3LSRA 3RD3A 3BR3A 4D7NA 3V78A 3VW2A 3FRQA 2ID3A 3IH3A 5CQGA 4IRVA 1RPWA 3BCGA 5HSZA 3PASA 4DVYP 3VOXA 1BJZA 4MXMA 2HXIA 2QWTA 3ZQHA 2VKVA 2FBQA 3DCFA 1JTYA 1UI5A 4HKUA 1Z0XA 4OD5A 4AC0A 5FMPA 1VI0A 3O8GA 2XPWA 4WIBA 3LWJA 5IP6A 3GZIA 3VW1A 3TP0A 3IH2A 2IEKA 1T33A 1ZK8A
chains in the Genus database with same CATH topology
3G1MA 2HYTA 2RHAA 3ON4A 4D5CA 2DTZA 1A6IA 2QCOA 3ON2A 3IH4A 2ZCNA 3V6GA 4ICHA 3HIMA 4JYKA 3SDGA 2G7SA 3LSPA 4GFKA 2UXOA 1ORKA 2G7LA 3B6CA 3O60A 4MO7A 5F0FA 3SFIA 5J1RA 3BT9A 3BRUA 3EUPA 5IPAA 4G12A 2NX4A 4B1RA 3CWRA 3T6NA 3TP3A 1QVTA 2Y2ZA 2W53A 3LOCA 2VKEA 5DAJA 2NP5A 5GP9A 2IBDA 3FIWA 2OI8A 5D18A 2PZ9A 3QKXA 3G1OA 4M3EA 3Q0VA 3BNIA 2XDNA 2UXIA 4W97A 5C4YA 3VVYA 2FX0A 2DG7A 2JJ7A 3KNWA 2ZOYA 2O7OA 3BTJA 3VW0A 3CRJA 2Y30A 3BR0A 4YZEA 3ANPA 4CGRA 5FKMA 3VPRA 1JT0A 3B81A 1SGMA 3JSJA 3O8HA 1QVUA 3VP5A 3F0CA 4L62A 2UXHA 4JKZA 2I10A 3HTJA 3F1BA 2XGEA 5F0CA 3G1LA 2QIBA 3DEWA 5EZHA 5F08A 2G3BA 5FGLA 3MVPA 4V2GA 2X6OA 3PM1A 4MK6A 2FQ4A 3G7RA 4NELA 2JK3A 4NN1A 2GENA 3BTCA 5K7ZA 4PXIA 2HKUA 2HXOA 2XGCA 4AC6A 4W1UA 2XB5A 3HE0A 5K7FA 4I76A 3BJBA 2UXUA 2NS7A 3DPJA 3B6AA 2G7GA 5CXGA 3AQTA 5F27A 2ZCXA 3QBMA 4V2FA 3LJLA 3BQYA 2NP3A 2F07A 3CDLA 5HBUA 3NRGA 2GUHA 3FK7A 4X1EA 3PPBA 3BR6A 2D6YA 2HQ5A 4GCKA 2Q24A 3P9TA 4M3FA 5HAWA 2XRLA 3Q0UA 3NPIA 5IOYA 5K58A 5FKKA 3GEUA 2WGBA 2Y31A 2O7TA 4GFLA 2ID6A 2RAEA 2WV1A 2ZB9A 3KZ9A 4D5FA 4ACIA 1ZKGA 3HTIA 1RKTA 3COLA 3HGGA 2GFNA 4XK4A 3BQZA 4M3GA 3G56A 4ABZA 3QPSA 4JNNA 2PBXA 4DW6A 3KKDA 3BTIA 5FHPA 2VPRA 2UXPA 3NNRA 3C2BA 3QPLA 3CJDA 5D1RA 4GCLA 3BR2A 5F1JA 2TCTA 4D7MA 4AUXA 4ME9A 2XGDA 3WHBA 2QKOA 1JTXA 3ZQFA 4GCTA 1T56A 1U9NA 3E7QA 2YVHA 3EGQA 3KKCA 3HTHA 3C07A 5FKLA 5EYRA 1JUPA 4AF5A 2V57A 2XPVA 2TRTA 1JUMA 5AQCA 4JL3A 5J1YA 2OF7A 3VOKA 2GBYA 5GPCA 5J1UA 4M3DA 3WHCA 1RKWA 5IOZA 2NS8A 1JUSA 1Z77A 5J3LA 3LSJA 4KWAA 1QPIA 5D19A 5GPAA 3BHQA 3VVZA 3CCYA 1UI6A 2G0EA 3RH2A 2RASA 5FKOA 3BR1A 3HGYA 3Q0WA 3NXCA 5CW8A 2REKA 2X9DA 3S5RA 3HTAA 2EH3A 2ZOZA 2OPTA 3ZQIA 3NI7A 3ZQLA 4M3BA 4UDSA 3FK6A 2QOPA 3IUVA 5K7HA 3VUQA 3BR5A 3AQSA 5EFYA 2IU5A 2WUIA 5F0HA 3Q3SA 2XPUA 5F04A 2IAIA 3VIBA 4I6ZA 3BTLA 5CXIA 2OERA 3QQAA 5FKNA 2FD5A 3ANGA 1U9OA 3MNLA 3VVXA 3LHQA 2YVEA 2HYJA 3ZQGA 1JT6A 4B3AA 2ZCMA 2QTQA 2DG8A 2FJ1A 5EZGA 5H9TA 3LSRA 3RD3A 3BR3A 4D7NA 3V78A 3VW2A 3FRQA 2ID3A 3IH3A 1RPWA 3BCGA 5HSZA 3PASA 3VOXA 1BJZA 4MXMA 2HXIA 2QWTA 3ZQHA 2VKVA 2FBQA 3DCFA 1JTYA 1UI5A 4HKUA 1Z0XA 4AC0A 5FMPA 1VI0A 3O8GA 2XPWA 3LWJA 5IP6A 3GZIA 3VW1A 3TP0A 3IH2A 2IEKA 1T33A 1ZK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1M A;  2HYT A;  2RHA A;  3ON4 A;  4D5C A;  2DTZ A;  1A6I A;  2QCO A;  3ON2 A;  3IH4 A;  2ZCN A;  3V6G A;  4ICH A;  3HIM A;  4JYK A;  3SDG A;  2G7S A;  3LSP A;  4GFK A;  2UXO A;  1ORK A;  2G7L A;  3B6C A;  3O60 A;  4MO7 A;  5F0F A;  3SFI A;  5J1R A;  3BT9 A;  3BRU A;  3EUP A;  5IPA A;  4G12 A;  2NX4 A;  4B1R A;  3CWR A;  3T6N A;  3TP3 A;  1QVT A;  2Y2Z A;  2W53 A;  3LOC A;  2VKE A;  5DAJ A;  2NP5 A;  5GP9 A;  2IBD A;  3FIW A;  2OI8 A;  5D18 A;  2PZ9 A;  3QKX A;  3G1O A;  4M3E A;  3Q0V A;  3BNI A;  2XDN A;  2UXI A;  4W97 A;  5C4Y A;  3VVY A;  2FX0 A;  2DG7 A;  2JJ7 A;  3KNW A;  2ZOY A;  2O7O A;  3BTJ A;  3VW0 A;  3CRJ A;  2Y30 A;  3BR0 A;  4YZE A;  3ANP A;  4CGR A;  5FKM A;  3VPR A;  1JT0 A;  3B81 A;  1SGM A;  3JSJ A;  3O8H A;  1QVU A;  3VP5 A;  3F0C A;  4L62 A;  2UXH A;  4JKZ A;  2I10 A;  3HTJ A;  3F1B A;  2XGE A;  5F0C A;  3G1L A;  2QIB A;  3DEW A;  5EZH A;  5F08 A;  2G3B A;  5FGL A;  3MVP A;  4V2G A;  2X6O A;  3PM1 A;  4MK6 A;  2FQ4 A;  3G7R A;  4NEL A;  2JK3 A;  4NN1 A;  2GEN A;  3BTC A;  5K7Z A;  4PXI A;  2HKU A;  2HXO A;  2XGC A;  4AC6 A;  4W1U A;  2XB5 A;  3HE0 A;  5K7F A;  4I76 A;  3BJB A;  2UXU A;  2NS7 A;  3DPJ A;  3B6A A;  2G7G A;  5CXG A;  3AQT A;  5F27 A;  2ZCX A;  3QBM A;  4V2F A;  3LJL A;  3BQY A;  2NP3 A;  2F07 A;  3CDL A;  5HBU A;  3NRG A;  2GUH A;  3FK7 A;  4X1E A;  3PPB A;  3BR6 A;  2D6Y A;  2HQ5 A;  4GCK A;  2Q24 A;  3P9T A;  4M3F A;  5HAW A;  2XRL A;  3Q0U A;  3NPI A;  5IOY A;  5K58 A;  5FKK A;  3GEU A;  2WGB A;  2Y31 A;  2O7T A;  4GFL A;  2ID6 A;  2RAE A;  2WV1 A;  2ZB9 A;  3KZ9 A;  4D5F A;  4ACI A;  1ZKG A;  3HTI A;  1RKT A;  3COL A;  3HGG A;  2GFN A;  4XK4 A;  3BQZ A;  4M3G A;  3G56 A;  4ABZ A;  3QPS A;  4JNN A;  2PBX A;  4DW6 A;  3KKD A;  3BTI A;  5FHP A;  2VPR A;  2UXP A;  3NNR A;  3C2B A;  3QPL A;  3CJD A;  5D1R A;  4GCL A;  3BR2 A;  5F1J A;  2TCT A;  4D7M A;  4AUX A;  4ME9 A;  2XGD A;  3WHB A;  2QKO A;  1JTX A;  3ZQF A;  4GCT A;  1T56 A;  1U9N A;  3E7Q A;  2YVH A;  3EGQ A;  3KKC A;  3HTH A;  3C07 A;  5FKL A;  5EYR A;  1JUP A;  4AF5 A;  2V57 A;  2XPV A;  2TRT A;  1JUM A;  5AQC A;  4JL3 A;  5J1Y A;  2OF7 A;  3VOK A;  2GBY A;  5GPC A;  5J1U A;  4M3D A;  3WHC A;  1RKW A;  5IOZ A;  2NS8 A;  1JUS A;  1Z77 A;  5J3L A;  3LSJ A;  4KWA A;  1QPI A;  5D19 A;  5GPA A;  3BHQ A;  3VVZ A;  3CCY A;  1UI6 A;  2G0E A;  3RH2 A;  2RAS A;  5FKO A;  3BR1 A;  3HGY A;  3Q0W A;  3NXC A;  5CW8 A;  2REK A;  2X9D A;  3S5R A;  3HTA A;  2EH3 A;  2ZOZ A;  2OPT A;  3ZQI A;  3NI7 A;  3ZQL A;  4M3B A;  4UDS A;  3FK6 A;  2QOP A;  3IUV A;  5K7H A;  3VUQ A;  3BR5 A;  3AQS A;  5EFY A;  2IU5 A;  2WUI A;  5F0H A;  3Q3S A;  2XPU A;  5F04 A;  2IAI A;  3VIB A;  4I6Z A;  3BTL A;  5CXI A;  2OER A;  3QQA A;  5FKN A;  2FD5 A;  3ANG A;  1U9O A;  3MNL A;  3VVX A;  3LHQ A;  2YVE A;  2HYJ A;  3ZQG A;  1JT6 A;  4B3A A;  2ZCM A;  2QTQ A;  2DG8 A;  2FJ1 A;  5EZG A;  5H9T A;  3LSR A;  3RD3 A;  3BR3 A;  4D7N A;  3V78 A;  3VW2 A;  3FRQ A;  2ID3 A;  3IH3 A;  1RPW A;  3BCG A;  5HSZ A;  3PAS A;  3VOX A;  1BJZ A;  4MXM A;  2HXI A;  2QWT A;  3ZQH A;  2VKV A;  2FBQ A;  3DCF A;  1JTY A;  1UI5 A;  4HKU A;  1Z0X A;  4AC0 A;  5FMP A;  1VI0 A;  3O8G A;  2XPW A;  3LWJ A;  5IP6 A;  3GZI A;  3VW1 A;  3TP0 A;  3IH2 A;  2IEK A;  1T33 A;  1ZK8 A; 
#chains in the Genus database with same CATH topology
 3G1M A;  2HYT A;  2RHA A;  3ON4 A;  2FJI 1;  4D5C A;  2DTZ A;  2B3W A;  1A6I A;  2QCO A;  3K8P C;  3ON2 A;  3IH4 A;  2ZCN A;  3NS4 A;  3V6G A;  4ICH A;  2R7V A;  3HIM A;  4JYK A;  3SDG A;  2G7S A;  3LSP A;  4GFK A;  2UXO A;  1ORK A;  2G7L A;  3B6C A;  4OD4 A;  3O60 A;  4MO7 A;  5F0F A;  3SFI A;  5J1R A;  3BT9 A;  4U9N A;  3BRU A;  3EUP A;  5IPA A;  4G12 A;  2NX4 A;  4B1R A;  3CWR A;  2B1E A;  3T6N A;  3TP3 A;  1QVT A;  2Y2Z A;  2W53 A;  3LOC A;  2VKE A;  5DAJ A;  2NP5 A;  5GP9 A;  2IBD A;  3FIW A;  2OI8 A;  2R7Q A;  5D18 A;  2PZ9 A;  3QKX A;  3VTI A;  3G1O A;  4M3E A;  3Q0V A;  3BNI A;  2XDN A;  2UXI A;  4W97 A;  5C4Y A;  3VVY A;  2FX0 A;  2DG7 A;  2JJ7 A;  3KNW A;  2ZOY A;  2O7O A;  3BTJ A;  3VW0 A;  3CRJ A;  2Y30 A;  3BR0 A;  4YZE A;  4C2M A;  3ANP A;  4CGR A;  5FKM A;  3VPR A;  1JT0 A;  3B81 A;  1SGM A;  3JSJ A;  3O8H A;  1QVU A;  3VP5 A;  3F0C A;  4L62 A;  2UXH A;  4JKZ A;  2I10 A;  3HTJ A;  3F1B A;  2XGE A;  5F0C A;  3G1L A;  2R7T A;  2QIB A;  3DU5 A;  3DEW A;  5EZH A;  5F08 A;  2G3B A;  5FGL A;  3MVP A;  4V2G A;  2X6O A;  3PM1 A;  4MK6 A;  2FQ4 A;  3G7R A;  4NEL A;  2R7W A;  2JK3 A;  4NN1 A;  2GEN A;  3BTC A;  5K7Z A;  4PXI A;  2HKU A;  2HXO A;  2XGC A;  4AC6 A;  4W1U A;  2XB5 A;  3HE0 A;  5K7F A;  4I76 A;  3BJB A;  2UXU A;  2NS7 A;  3DPJ A;  3B6A A;  2G7G A;  5CXG A;  3AQT A;  5F27 A;  2ZCX A;  3QBM A;  4V2F A;  3LJL A;  3BQY A;  2NP3 A;  2F07 A;  3CDL A;  5HBU A;  3NRG A;  2GUH A;  3FK7 A;  4X1E A;  3PPB A;  3BR6 A;  2D6Y A;  2HQ5 A;  4GCK A;  2Q24 A;  3P9T A;  4M3F A;  3KYL A;  5HAW A;  2XRL A;  3Q0U A;  3NPI A;  4U9L A;  5IOY A;  5K58 A;  5FKK A;  3GEU A;  2WGB A;  2Y31 A;  2O7T A;  4GFL A;  2ID6 A;  2RAE A;  2WV1 A;  2ZB9 A;  3KZ9 A;  4D5F A;  4ACI A;  1ZKG A;  3HTI A;  1RKT A;  3COL A;  3HGG A;  2GFN A;  4XK4 A;  3BQZ A;  4M3G A;  3G56 A;  4ABZ A;  3QPS A;  4JNN A;  2PBX A;  4DW6 A;  3KKD A;  3BTI A;  5FHP A;  2VPR A;  2UXP A;  3NNR A;  3C2B A;  3QPL A;  3CJD A;  5D1R A;  4GCL A;  3BR2 A;  5F1J A;  2TCT A;  4D7M A;  4AUX A;  4ME9 A;  2XGD A;  3WHB A;  2QKO A;  1JTX A;  3ZQF A;  4GCT A;  1T56 A;  1U9N A;  3E7Q A;  2YVH A;  3EGQ A;  3KKC A;  3DU6 A;  3HTH A;  3C07 A;  5FKL A;  5EYR A;  1JUP A;  4AF5 A;  2V57 A;  2XPV A;  2ZY9 A;  2TRT A;  1JUM A;  5AQC A;  4JL3 A;  5J1Y A;  2OF7 A;  3VOK A;  2GBY A;  5GPC A;  2R7U A;  5J1U A;  4M3D A;  2R7X A;  3WHC A;  1RKW A;  5IOZ A;  2NS8 A;  1JUS A;  1Z77 A;  2R7O A;  5J3L A;  3LSJ A;  4KWA A;  1QPI A;  5D19 A;  2R7R A;  5GPA A;  3BHQ A;  3VVZ A;  3CCY A;  2PFV A;  1UI6 A;  2G0E A;  3RH2 A;  2RAS A;  2A2F X;  5FKO A;  3BR1 A;  3HGY A;  3Q0W A;  2YVX A;  3NXC A;  3FHN A;  5CW8 A;  2REK A;  2X9D A;  3S5R A;  3HTA A;  2EH3 A;  2ZOZ A;  2OPT A;  3ZQI A;  3NI7 A;  3ZQL A;  4M3B A;  4UDS A;  2R7S A;  3FK6 A;  2QOP A;  3IUV A;  5K7H A;  3VUQ A;  3BR5 A;  3AQS A;  5EFY A;  2IU5 A;  2WUI A;  5F0H A;  3Q3S A;  2XPU A;  5F04 A;  2IAI A;  3VIB A;  4I6Z A;  3BTL A;  5CXI A;  3SWH A;  2OER A;  3QQA A;  5FKN A;  2FD5 A;  3ANG A;  1U9O A;  3MNL A;  3VVX A;  3LHQ A;  2YVE A;  2HYJ A;  3ZQG A;  1JT6 A;  4B3A A;  2ZCM A;  2QTQ A;  2DG8 A;  2FJ1 A;  5EZG A;  5H9T A;  3LSR A;  3RD3 A;  3BR3 A;  4D7N A;  3V78 A;  3VW2 A;  3FRQ A;  2ID3 A;  3IH3 A;  5CQG A;  4IRV A;  1RPW A;  3BCG A;  5HSZ A;  3PAS A;  4DVY P;  3VOX A;  1BJZ A;  4MXM A;  2HXI A;  2QWT A;  3ZQH A;  2VKV A;  2FBQ A;  3DCF A;  1JTY A;  1UI5 A;  4HKU A;  1Z0X A;  4OD5 A;  4AC0 A;  5FMP A;  1VI0 A;  3O8G A;  2XPW A;  4WIB A;  3LWJ A;  5IP6 A;  3GZI A;  3VW1 A;  3TP0 A;  3IH2 A;  2IEK A;  1T33 A;  1ZK8 A; 
#chains in the Genus database with same CATH homology
 3G1M A;  2HYT A;  2RHA A;  3ON4 A;  4D5C A;  2DTZ A;  1A6I A;  2QCO A;  3ON2 A;  3IH4 A;  2ZCN A;  3V6G A;  4ICH A;  3HIM A;  4JYK A;  3SDG A;  2G7S A;  3LSP A;  4GFK A;  2UXO A;  1ORK A;  2G7L A;  3B6C A;  3O60 A;  4MO7 A;  5F0F A;  3SFI A;  5J1R A;  3BT9 A;  3BRU A;  3EUP A;  5IPA A;  4G12 A;  2NX4 A;  4B1R A;  3CWR A;  3T6N A;  3TP3 A;  1QVT A;  2Y2Z A;  2W53 A;  3LOC A;  2VKE A;  5DAJ A;  2NP5 A;  5GP9 A;  2IBD A;  3FIW A;  2OI8 A;  5D18 A;  2PZ9 A;  3QKX A;  3G1O A;  4M3E A;  3Q0V A;  3BNI A;  2XDN A;  2UXI A;  4W97 A;  5C4Y A;  3VVY A;  2FX0 A;  2DG7 A;  2JJ7 A;  3KNW A;  2ZOY A;  2O7O A;  3BTJ A;  3VW0 A;  3CRJ A;  2Y30 A;  3BR0 A;  4YZE A;  3ANP A;  4CGR A;  5FKM A;  3VPR A;  1JT0 A;  3B81 A;  1SGM A;  3JSJ A;  3O8H A;  1QVU A;  3VP5 A;  3F0C A;  4L62 A;  2UXH A;  4JKZ A;  2I10 A;  3HTJ A;  3F1B A;  2XGE A;  5F0C A;  3G1L A;  2QIB A;  3DEW A;  5EZH A;  5F08 A;  2G3B A;  5FGL A;  3MVP A;  4V2G A;  2X6O A;  3PM1 A;  4MK6 A;  2FQ4 A;  3G7R A;  4NEL A;  2JK3 A;  4NN1 A;  2GEN A;  3BTC A;  5K7Z A;  4PXI A;  2HKU A;  2HXO A;  2XGC A;  4AC6 A;  4W1U A;  2XB5 A;  3HE0 A;  5K7F A;  4I76 A;  3BJB A;  2UXU A;  2NS7 A;  3DPJ A;  3B6A A;  2G7G A;  5CXG A;  3AQT A;  5F27 A;  2ZCX A;  3QBM A;  4V2F A;  3LJL A;  3BQY A;  2NP3 A;  2F07 A;  3CDL A;  5HBU A;  3NRG A;  2GUH A;  3FK7 A;  4X1E A;  3PPB A;  3BR6 A;  2D6Y A;  2HQ5 A;  4GCK A;  2Q24 A;  3P9T A;  4M3F A;  5HAW A;  2XRL A;  3Q0U A;  3NPI A;  5IOY A;  5K58 A;  5FKK A;  3GEU A;  2WGB A;  2Y31 A;  2O7T A;  4GFL A;  2ID6 A;  2RAE A;  2WV1 A;  2ZB9 A;  3KZ9 A;  4D5F A;  4ACI A;  1ZKG A;  3HTI A;  1RKT A;  3COL A;  3HGG A;  2GFN A;  4XK4 A;  3BQZ A;  4M3G A;  3G56 A;  4ABZ A;  3QPS A;  4JNN A;  2PBX A;  4DW6 A;  3KKD A;  3BTI A;  5FHP A;  2VPR A;  2UXP A;  3NNR A;  3C2B A;  3QPL A;  3CJD A;  5D1R A;  4GCL A;  3BR2 A;  5F1J A;  2TCT A;  4D7M A;  4AUX A;  4ME9 A;  2XGD A;  3WHB A;  2QKO A;  1JTX A;  3ZQF A;  4GCT A;  1T56 A;  1U9N A;  3E7Q A;  2YVH A;  3EGQ A;  3KKC A;  3HTH A;  3C07 A;  5FKL A;  5EYR A;  1JUP A;  4AF5 A;  2V57 A;  2XPV A;  2TRT A;  1JUM A;  5AQC A;  4JL3 A;  5J1Y A;  2OF7 A;  3VOK A;  2GBY A;  5GPC A;  5J1U A;  4M3D A;  3WHC A;  1RKW A;  5IOZ A;  2NS8 A;  1JUS A;  1Z77 A;  5J3L A;  3LSJ A;  4KWA A;  1QPI A;  5D19 A;  5GPA A;  3BHQ A;  3VVZ A;  3CCY A;  1UI6 A;  2G0E A;  3RH2 A;  2RAS A;  5FKO A;  3BR1 A;  3HGY A;  3Q0W A;  3NXC A;  5CW8 A;  2REK A;  2X9D A;  3S5R A;  3HTA A;  2EH3 A;  2ZOZ A;  2OPT A;  3ZQI A;  3NI7 A;  3ZQL A;  4M3B A;  4UDS A;  3FK6 A;  2QOP A;  3IUV A;  5K7H A;  3VUQ A;  3BR5 A;  3AQS A;  5EFY A;  2IU5 A;  2WUI A;  5F0H A;  3Q3S A;  2XPU A;  5F04 A;  2IAI A;  3VIB A;  4I6Z A;  3BTL A;  5CXI A;  2OER A;  3QQA A;  5FKN A;  2FD5 A;  3ANG A;  1U9O A;  3MNL A;  3VVX A;  3LHQ A;  2YVE A;  2HYJ A;  3ZQG A;  1JT6 A;  4B3A A;  2ZCM A;  2QTQ A;  2DG8 A;  2FJ1 A;  5EZG A;  5H9T A;  3LSR A;  3RD3 A;  3BR3 A;  4D7N A;  3V78 A;  3VW2 A;  3FRQ A;  2ID3 A;  3IH3 A;  1RPW A;  3BCG A;  5HSZ A;  3PAS A;  3VOX A;  1BJZ A;  4MXM A;  2HXI A;  2QWT A;  3ZQH A;  2VKV A;  2FBQ A;  3DCF A;  1JTY A;  1UI5 A;  4HKU A;  1Z0X A;  4AC0 A;  5FMP A;  1VI0 A;  3O8G A;  2XPW A;  3LWJ A;  5IP6 A;  3GZI A;  3VW1 A;  3TP0 A;  3IH2 A;  2IEK A;  1T33 A;  1ZK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...