4HKUA

The crystal structure of tetr transcriptional regulator (lmo2814) from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
174
structure length
174
Chain Sequence
ARLSQEIILNMAEKIIYEKGMEKTTLYDIASNLNVTHAALYKHYRNKEDLFQKLALRWLEETSREIFAWTQDAGQTPDDALHDWLWLLADTKKKRYKTDRKMFLLYTDYIEQNEELVKNHVAHLAQKAEEVSGRTNQGNAIITAFTYFHNPYFASRWEQAGYVDLFEDVWQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TetR transcriptional regulator
publication title The crystal structure of TetR transcriptional regulator (lmo2814) from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
total genus 69
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17935 TetR_C_27 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4hkuA00
2HKUA 2NP3A 3BR5A 5EYRA 5K58A 3DEWA 3QQAA 3F1BA 3T6NA 5HAWA 2G0EA 5CW8A 1ORKA 2TRTA 2REKA 3GZIA 3TP3A 5H9TA 3WHBA 2IEKA 3V6GA 2PBXA 5GP9A 3Q0VA 3CWRA 2X6OA 1SGMA 3HTIA 3GEUA 3FK6A 2QOPA 2XPVA 3BCGA 2XGDA 3VW2A 2Q24A 3Q0WA 3KKCA 5HSZA 3LSJA 2EH3A 2YVHA 2DG8A 3B81A 3DCFA 3FRQA 1ZK8A 2RAEA 5J1YA 3SFIA 2TCTA 5D19A 2V57A 1UI5A 3RD3A 2HYJA 5EZGA 1JUMA 2XRLA 2XB5A 3AQSA 1JT6A 2D6YA 3LJLA 4GCTA 4I6ZA 2FBQA 3BR1A 3MVPA 4GFKA 4D7MA 4MK6A 3O60A 3VW1A 4JNNA 5F1JA 5FKOA 5D1RA 3KKDA 2Y30A 3BT9A 4PXIA 1RPWA 4DW6A 4W97A 3NXCA 2OF7A 3HTAA 3HTJA 2QIBA 1JT0A 3S5RA 4JYKA 5K7FA 3LSRA 1QVTA 4AC0A 3V78A 3JSJA 2IBDA 3ANPA 3C2BA 3IH3A 3LHQA 5IP6A 3ON4A 5D18A 2NP5A 1BJZA 3ANGA 5GPCA 2WV1A 2HYTA 4MXMA 2RHAA 2IAIA 3VUQA 2OERA 2G7GA 3LOCA 3VOKA 1QVUA 5IOZA 3VVYA 1U9OA 2ZB9A 4M3FA 3Q3SA 4I76A 4M3BA 3F0CA 4M3EA 4B3AA 3PM1A 2FD5A 3B6AA 5FKLA 3BHQA 4JL3A 4HKUA 5EFYA 2XGCA 2XDNA 5K7HA 2NS7A 5FKKA 4D5CA 2FQ4A 5C4YA 2UXHA 5FMPA 1Z0XA 3HGYA 3VW0A 2G7LA 3BQZA 3CDLA 5GPAA 3G1LA 3QPLA 3EUPA 3E7QA 3TP0A 3LSPA 2XPUA 4D7NA 3ZQHA 2QCOA 3IH2A 4G12A 3LWJA 5EZHA 4X1EA 2XPWA 2QKOA 3C07A 4XK4A 2UXPA 3IH4A 2ID3A 4W1UA 3CCYA 3AQTA 3NNRA 2QWTA 5CXIA 2W53A 3BQYA 4D5FA 3BTCA 2FJ1A 3B6CA 2JJ7A 4JKZA 4L62A 3KZ9A 2ZCXA 2IU5A 2ZOZA 3KNWA 5J1RA 1VI0A 2Y31A 3BR2A 2WGBA 2GBYA 5FGLA 1RKWA 2NS8A 1T56A 3ZQIA 1JTXA 2OPTA 3HTHA 3ON2A 5DAJA 2X9DA 4ME9A 2OI8A 4KWAA 2ZCMA 2VPRA 5IPAA 3P9TA 5F27A 2DG7A 4ACIA 5IOYA 3NPIA 3O8GA 3MNLA 2PZ9A 4B1RA 3BNIA 3BR3A 3VPRA 3VVZA 2YVEA 4GCKA 5CXGA 3PASA 4NELA 2GENA 5K7ZA 1ZKGA 1UI6A 4V2GA 2UXUA 3BR0A 2HXOA 2G7SA 1JUPA 4M3GA 5FKMA 2RASA 1Z77A 3ZQFA 2DTZA 2XGEA 2GFNA 1RKTA 3CRJA 3QPSA 2G3BA 4AC6A 2ID6A 3BJBA 3VP5A 2O7TA 3BTIA 3EGQA 3VOXA 2ZCNA 5F0CA 3PPBA 3Q0UA 1QPIA 2JK3A 4AUXA 2GUHA 3ZQGA 4YZEA 2FX0A 3ZQLA 2QTQA 3O8HA 3G56A 4AF5A 3QBMA 3G1MA 3BRUA 4V2FA 2UXOA 2I10A 3BR6A 3SDGA 3NI7A 3FIWA 3COLA 3HE0A 1JTYA 5FKNA 5F0FA 3BTJA 3HIMA 3FK7A 3NRGA 4ICHA 2VKVA 3QKXA 4CGRA 3CJDA 3VVXA 4ABZA 4GFLA 2VKEA 5J1UA 5AQCA 3WHCA 2O7OA 2NX4A 3HGGA 2Y2ZA 5FHPA 3IUVA 2F07A 2WUIA 2HXIA 5HBUA 4NN1A 1A6IA 3G1OA 5F08A 5F0HA 3BTLA 4M3DA 4UDSA 1U9NA 4GCLA 1JUSA 3RH2A 3VIBA 5F04A 2ZOYA 3G7RA 1T33A 4MO7A 3DPJA 2UXIA 5J3LA 2HQ5A
chains in the Genus database with same CATH superfamily
2HKUA 2NP3A 3BR5A 5EYRA 5K58A 3DEWA 3QQAA 3F1BA 3T6NA 5HAWA 2G0EA 5CW8A 1ORKA 2TRTA 2REKA 3GZIA 3TP3A 5H9TA 3WHBA 2R7WA 2IEKA 3V6GA 2PBXA 5GP9A 3Q0VA 3CWRA 2X6OA 1SGMA 3HTIA 3GEUA 3FK6A 2QOPA 2XPVA 3BCGA 2XGDA 3VW2A 2Q24A 3Q0WA 3KKCA 5HSZA 3LSJA 2EH3A 2YVHA 2DG8A 3B81A 3DCFA 3FRQA 3KYLA 4OD5A 1ZK8A 3VTIA 2RAEA 5J1YA 3SFIA 2TCTA 5D19A 2V57A 1UI5A 3RD3A 2HYJA 2R7QA 5EZGA 1JUMA 2XRLA 2XB5A 3AQSA 1JT6A 2D6YA 3LJLA 4GCTA 4I6ZA 2FBQA 3BR1A 3MVPA 4GFKA 4D7MA 4MK6A 3O60A 3VW1A 4JNNA 5F1JA 2R7OA 5FKOA 5D1RA 3KKDA 2Y30A 3BT9A 4PXIA 1RPWA 4DW6A 4W97A 2R7XA 5CQGA 3NXCA 2OF7A 3HTAA 3DU5A 3HTJA 2QIBA 1JT0A 3S5RA 4JYKA 2R7TA 5K7FA 3LSRA 1QVTA 4AC0A 3V78A 2A2FX 3JSJA 2IBDA 3ANPA 3C2BA 3IH3A 3LHQA 5IP6A 3ON4A 5D18A 2NP5A 1BJZA 3ANGA 5GPCA 2WV1A 2HYTA 4MXMA 2RHAA 2IAIA 3VUQA 2OERA 2G7GA 3LOCA 4OD4A 3VOKA 1QVUA 3SWHA 5IOZA 3VVYA 1U9OA 2ZB9A 4M3FA 3Q3SA 4I76A 4M3BA 3F0CA 4M3EA 4B3AA 3PM1A 2FD5A 3B6AA 5FKLA 3NS4A 2PFVA 3BHQA 4JL3A 4HKUA 5EFYA 2XGCA 2XDNA 4IRVA 5K7HA 2NS7A 5FKKA 4D5CA 2FQ4A 5C4YA 2UXHA 5FMPA 1Z0XA 4WIBA 3HGYA 3VW0A 2G7LA 3BQZA 3CDLA 5GPAA 3G1LA 3QPLA 3EUPA 3E7QA 3TP0A 3LSPA 2XPUA 4D7NA 3ZQHA 2QCOA 3IH2A 4G12A 3LWJA 5EZHA 4X1EA 2XPWA 2QKOA 3C07A 4XK4A 2UXPA 3IH4A 2ID3A 4W1UA 3CCYA 3AQTA 3NNRA 2QWTA 5CXIA 2W53A 3BQYA 4D5FA 3BTCA 2FJ1A 3B6CA 2YVXA 2JJ7A 4JKZA 4L62A 3KZ9A 2ZCXA 2IU5A 2ZOZA 3KNWA 5J1RA 1VI0A 2Y31A 3BR2A 2WGBA 2GBYA 5FGLA 1RKWA 2NS8A 1T56A 3ZQIA 1JTXA 2OPTA 3HTHA 3ON2A 5DAJA 2X9DA 4ME9A 2OI8A 4KWAA 2ZCMA 2VPRA 5IPAA 3DU6A 2R7RA 3P9TA 5F27A 2DG7A 4ACIA 5IOYA 3NPIA 3O8GA 3MNLA 2PZ9A 4B1RA 3BNIA 3BR3A 3VPRA 3VVZA 2YVEA 4GCKA 5CXGA 3PASA 4NELA 2GENA 5K7ZA 1ZKGA 1UI6A 4V2GA 2UXUA 3BR0A 2HXOA 2G7SA 1JUPA 4M3GA 5FKMA 2RASA 1Z77A 2R7VA 3ZQFA 2DTZA 2XGEA 2GFNA 2R7UA 1RKTA 3CRJA 3QPSA 3FHNA 2G3BA 4AC6A 2ID6A 3BJBA 3VP5A 2R7SA 2O7TA 3BTIA 3EGQA 3VOXA 2ZCNA 5F0CA 3PPBA 3Q0UA 1QPIA 2JK3A 4AUXA 2GUHA 3ZQGA 4YZEA 2FX0A 3ZQLA 2QTQA 3O8HA 4DVYP 3G56A 4AF5A 3QBMA 3G1MA 2B1EA 3BRUA 4V2FA 2UXOA 2I10A 3BR6A 3SDGA 3NI7A 3FIWA 3COLA 3HE0A 1JTYA 5FKNA 5F0FA 2FJI1 3BTJA 3HIMA 3FK7A 3NRGA 4ICHA 3K8PC 2VKVA 3QKXA 4CGRA 3CJDA 3VVXA 4ABZA 4GFLA 2VKEA 5J1UA 5AQCA 3WHCA 2O7OA 2NX4A 3HGGA 2Y2ZA 4U9NA 4U9LA 5FHPA 3IUVA 2B3WA 2F07A 2WUIA 2HXIA 5HBUA 4NN1A 1A6IA 3G1OA 5F08A 5F0HA 3BTLA 2ZY9A 4M3DA 4UDSA 1U9NA 4GCLA 1JUSA 3RH2A 3VIBA 5F04A 2ZOYA 3G7RA 1T33A 4C2MA 4MO7A 3DPJA 2UXIA 5J3LA 2HQ5A
chains in the Genus database with same CATH topology
2HKUA 2NP3A 3BR5A 5EYRA 5K58A 3DEWA 3QQAA 3F1BA 3T6NA 5HAWA 2G0EA 5CW8A 1ORKA 2TRTA 2REKA 3GZIA 3TP3A 5H9TA 3WHBA 2IEKA 3V6GA 2PBXA 5GP9A 3Q0VA 3CWRA 2X6OA 1SGMA 3HTIA 3GEUA 3FK6A 2QOPA 2XPVA 3BCGA 2XGDA 3VW2A 2Q24A 3Q0WA 3KKCA 5HSZA 3LSJA 2EH3A 2YVHA 2DG8A 3B81A 3DCFA 3FRQA 1ZK8A 2RAEA 5J1YA 3SFIA 2TCTA 5D19A 2V57A 1UI5A 3RD3A 2HYJA 5EZGA 1JUMA 2XRLA 2XB5A 3AQSA 1JT6A 2D6YA 3LJLA 4GCTA 4I6ZA 2FBQA 3BR1A 3MVPA 4GFKA 4D7MA 4MK6A 3O60A 3VW1A 4JNNA 5F1JA 5FKOA 5D1RA 3KKDA 2Y30A 3BT9A 4PXIA 1RPWA 4DW6A 4W97A 3NXCA 2OF7A 3HTAA 3HTJA 2QIBA 1JT0A 3S5RA 4JYKA 5K7FA 3LSRA 1QVTA 4AC0A 3V78A 3JSJA 2IBDA 3ANPA 3C2BA 3IH3A 3LHQA 5IP6A 3ON4A 5D18A 2NP5A 1BJZA 3ANGA 5GPCA 2WV1A 2HYTA 4MXMA 2RHAA 2IAIA 3VUQA 2OERA 2G7GA 3LOCA 3VOKA 1QVUA 5IOZA 3VVYA 1U9OA 2ZB9A 4M3FA 3Q3SA 4I76A 4M3BA 3F0CA 4M3EA 4B3AA 3PM1A 2FD5A 3B6AA 5FKLA 3BHQA 4JL3A 4HKUA 5EFYA 2XGCA 2XDNA 5K7HA 2NS7A 5FKKA 4D5CA 2FQ4A 5C4YA 2UXHA 5FMPA 1Z0XA 3HGYA 3VW0A 2G7LA 3BQZA 3CDLA 5GPAA 3G1LA 3QPLA 3EUPA 3E7QA 3TP0A 3LSPA 2XPUA 4D7NA 3ZQHA 2QCOA 3IH2A 4G12A 3LWJA 5EZHA 4X1EA 2XPWA 2QKOA 3C07A 4XK4A 2UXPA 3IH4A 2ID3A 4W1UA 3CCYA 3AQTA 3NNRA 2QWTA 5CXIA 2W53A 3BQYA 4D5FA 3BTCA 2FJ1A 3B6CA 2JJ7A 4JKZA 4L62A 3KZ9A 2ZCXA 2IU5A 2ZOZA 3KNWA 5J1RA 1VI0A 2Y31A 3BR2A 2WGBA 2GBYA 5FGLA 1RKWA 2NS8A 1T56A 3ZQIA 1JTXA 2OPTA 3HTHA 3ON2A 5DAJA 2X9DA 4ME9A 2OI8A 4KWAA 2ZCMA 2VPRA 5IPAA 3P9TA 5F27A 2DG7A 4ACIA 5IOYA 3NPIA 3O8GA 3MNLA 2PZ9A 4B1RA 3BNIA 3BR3A 3VPRA 3VVZA 2YVEA 4GCKA 5CXGA 3PASA 4NELA 2GENA 5K7ZA 1ZKGA 1UI6A 4V2GA 2UXUA 3BR0A 2HXOA 2G7SA 1JUPA 4M3GA 5FKMA 2RASA 1Z77A 3ZQFA 2DTZA 2XGEA 2GFNA 1RKTA 3CRJA 3QPSA 2G3BA 4AC6A 2ID6A 3BJBA 3VP5A 2O7TA 3BTIA 3EGQA 3VOXA 2ZCNA 5F0CA 3PPBA 3Q0UA 1QPIA 2JK3A 4AUXA 2GUHA 3ZQGA 4YZEA 2FX0A 3ZQLA 2QTQA 3O8HA 3G56A 4AF5A 3QBMA 3G1MA 3BRUA 4V2FA 2UXOA 2I10A 3BR6A 3SDGA 3NI7A 3FIWA 3COLA 3HE0A 1JTYA 5FKNA 5F0FA 3BTJA 3HIMA 3FK7A 3NRGA 4ICHA 2VKVA 3QKXA 4CGRA 3CJDA 3VVXA 4ABZA 4GFLA 2VKEA 5J1UA 5AQCA 3WHCA 2O7OA 2NX4A 3HGGA 2Y2ZA 5FHPA 3IUVA 2F07A 2WUIA 2HXIA 5HBUA 4NN1A 1A6IA 3G1OA 5F08A 5F0HA 3BTLA 4M3DA 4UDSA 1U9NA 4GCLA 1JUSA 3RH2A 3VIBA 5F04A 2ZOYA 3G7RA 1T33A 4MO7A 3DPJA 2UXIA 5J3LA 2HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKU A;  2NP3 A;  3BR5 A;  5EYR A;  5K58 A;  3DEW A;  3QQA A;  3F1B A;  3T6N A;  5HAW A;  2G0E A;  5CW8 A;  1ORK A;  2TRT A;  2REK A;  3GZI A;  3TP3 A;  5H9T A;  3WHB A;  2IEK A;  3V6G A;  2PBX A;  5GP9 A;  3Q0V A;  3CWR A;  2X6O A;  1SGM A;  3HTI A;  3GEU A;  3FK6 A;  2QOP A;  2XPV A;  3BCG A;  2XGD A;  3VW2 A;  2Q24 A;  3Q0W A;  3KKC A;  5HSZ A;  3LSJ A;  2EH3 A;  2YVH A;  2DG8 A;  3B81 A;  3DCF A;  3FRQ A;  1ZK8 A;  2RAE A;  5J1Y A;  3SFI A;  2TCT A;  5D19 A;  2V57 A;  1UI5 A;  3RD3 A;  2HYJ A;  5EZG A;  1JUM A;  2XRL A;  2XB5 A;  3AQS A;  1JT6 A;  2D6Y A;  3LJL A;  4GCT A;  4I6Z A;  2FBQ A;  3BR1 A;  3MVP A;  4GFK A;  4D7M A;  4MK6 A;  3O60 A;  3VW1 A;  4JNN A;  5F1J A;  5FKO A;  5D1R A;  3KKD A;  2Y30 A;  3BT9 A;  4PXI A;  1RPW A;  4DW6 A;  4W97 A;  3NXC A;  2OF7 A;  3HTA A;  3HTJ A;  2QIB A;  1JT0 A;  3S5R A;  4JYK A;  5K7F A;  3LSR A;  1QVT A;  4AC0 A;  3V78 A;  3JSJ A;  2IBD A;  3ANP A;  3C2B A;  3IH3 A;  3LHQ A;  5IP6 A;  3ON4 A;  5D18 A;  2NP5 A;  1BJZ A;  3ANG A;  5GPC A;  2WV1 A;  2HYT A;  4MXM A;  2RHA A;  2IAI A;  3VUQ A;  2OER A;  2G7G A;  3LOC A;  3VOK A;  1QVU A;  5IOZ A;  3VVY A;  1U9O A;  2ZB9 A;  4M3F A;  3Q3S A;  4I76 A;  4M3B A;  3F0C A;  4M3E A;  4B3A A;  3PM1 A;  2FD5 A;  3B6A A;  5FKL A;  3BHQ A;  4JL3 A;  4HKU A;  5EFY A;  2XGC A;  2XDN A;  5K7H A;  2NS7 A;  5FKK A;  4D5C A;  2FQ4 A;  5C4Y A;  2UXH A;  5FMP A;  1Z0X A;  3HGY A;  3VW0 A;  2G7L A;  3BQZ A;  3CDL A;  5GPA A;  3G1L A;  3QPL A;  3EUP A;  3E7Q A;  3TP0 A;  3LSP A;  2XPU A;  4D7N A;  3ZQH A;  2QCO A;  3IH2 A;  4G12 A;  3LWJ A;  5EZH A;  4X1E A;  2XPW A;  2QKO A;  3C07 A;  4XK4 A;  2UXP A;  3IH4 A;  2ID3 A;  4W1U A;  3CCY A;  3AQT A;  3NNR A;  2QWT A;  5CXI A;  2W53 A;  3BQY A;  4D5F A;  3BTC A;  2FJ1 A;  3B6C A;  2JJ7 A;  4JKZ A;  4L62 A;  3KZ9 A;  2ZCX A;  2IU5 A;  2ZOZ A;  3KNW A;  5J1R A;  1VI0 A;  2Y31 A;  3BR2 A;  2WGB A;  2GBY A;  5FGL A;  1RKW A;  2NS8 A;  1T56 A;  3ZQI A;  1JTX A;  2OPT A;  3HTH A;  3ON2 A;  5DAJ A;  2X9D A;  4ME9 A;  2OI8 A;  4KWA A;  2ZCM A;  2VPR A;  5IPA A;  3P9T A;  5F27 A;  2DG7 A;  4ACI A;  5IOY A;  3NPI A;  3O8G A;  3MNL A;  2PZ9 A;  4B1R A;  3BNI A;  3BR3 A;  3VPR A;  3VVZ A;  2YVE A;  4GCK A;  5CXG A;  3PAS A;  4NEL A;  2GEN A;  5K7Z A;  1ZKG A;  1UI6 A;  4V2G A;  2UXU A;  3BR0 A;  2HXO A;  2G7S A;  1JUP A;  4M3G A;  5FKM A;  2RAS A;  1Z77 A;  3ZQF A;  2DTZ A;  2XGE A;  2GFN A;  1RKT A;  3CRJ A;  3QPS A;  2G3B A;  4AC6 A;  2ID6 A;  3BJB A;  3VP5 A;  2O7T A;  3BTI A;  3EGQ A;  3VOX A;  2ZCN A;  5F0C A;  3PPB A;  3Q0U A;  1QPI A;  2JK3 A;  4AUX A;  2GUH A;  3ZQG A;  4YZE A;  2FX0 A;  3ZQL A;  2QTQ A;  3O8H A;  3G56 A;  4AF5 A;  3QBM A;  3G1M A;  3BRU A;  4V2F A;  2UXO A;  2I10 A;  3BR6 A;  3SDG A;  3NI7 A;  3FIW A;  3COL A;  3HE0 A;  1JTY A;  5FKN A;  5F0F A;  3BTJ A;  3HIM A;  3FK7 A;  3NRG A;  4ICH A;  2VKV A;  3QKX A;  4CGR A;  3CJD A;  3VVX A;  4ABZ A;  4GFL A;  2VKE A;  5J1U A;  5AQC A;  3WHC A;  2O7O A;  2NX4 A;  3HGG A;  2Y2Z A;  5FHP A;  3IUV A;  2F07 A;  2WUI A;  2HXI A;  5HBU A;  4NN1 A;  1A6I A;  3G1O A;  5F08 A;  5F0H A;  3BTL A;  4M3D A;  4UDS A;  1U9N A;  4GCL A;  1JUS A;  3RH2 A;  3VIB A;  5F04 A;  2ZOY A;  3G7R A;  1T33 A;  4MO7 A;  3DPJ A;  2UXI A;  5J3L A;  2HQ5 A; 
#chains in the Genus database with same CATH topology
 2HKU A;  2NP3 A;  3BR5 A;  5EYR A;  5K58 A;  3DEW A;  3QQA A;  3F1B A;  3T6N A;  5HAW A;  2G0E A;  5CW8 A;  1ORK A;  2TRT A;  2REK A;  3GZI A;  3TP3 A;  5H9T A;  3WHB A;  2R7W A;  2IEK A;  3V6G A;  2PBX A;  5GP9 A;  3Q0V A;  3CWR A;  2X6O A;  1SGM A;  3HTI A;  3GEU A;  3FK6 A;  2QOP A;  2XPV A;  3BCG A;  2XGD A;  3VW2 A;  2Q24 A;  3Q0W A;  3KKC A;  5HSZ A;  3LSJ A;  2EH3 A;  2YVH A;  2DG8 A;  3B81 A;  3DCF A;  3FRQ A;  3KYL A;  4OD5 A;  1ZK8 A;  3VTI A;  2RAE A;  5J1Y A;  3SFI A;  2TCT A;  5D19 A;  2V57 A;  1UI5 A;  3RD3 A;  2HYJ A;  2R7Q A;  5EZG A;  1JUM A;  2XRL A;  2XB5 A;  3AQS A;  1JT6 A;  2D6Y A;  3LJL A;  4GCT A;  4I6Z A;  2FBQ A;  3BR1 A;  3MVP A;  4GFK A;  4D7M A;  4MK6 A;  3O60 A;  3VW1 A;  4JNN A;  5F1J A;  2R7O A;  5FKO A;  5D1R A;  3KKD A;  2Y30 A;  3BT9 A;  4PXI A;  1RPW A;  4DW6 A;  4W97 A;  2R7X A;  5CQG A;  3NXC A;  2OF7 A;  3HTA A;  3DU5 A;  3HTJ A;  2QIB A;  1JT0 A;  3S5R A;  4JYK A;  2R7T A;  5K7F A;  3LSR A;  1QVT A;  4AC0 A;  3V78 A;  2A2F X;  3JSJ A;  2IBD A;  3ANP A;  3C2B A;  3IH3 A;  3LHQ A;  5IP6 A;  3ON4 A;  5D18 A;  2NP5 A;  1BJZ A;  3ANG A;  5GPC A;  2WV1 A;  2HYT A;  4MXM A;  2RHA A;  2IAI A;  3VUQ A;  2OER A;  2G7G A;  3LOC A;  4OD4 A;  3VOK A;  1QVU A;  3SWH A;  5IOZ A;  3VVY A;  1U9O A;  2ZB9 A;  4M3F A;  3Q3S A;  4I76 A;  4M3B A;  3F0C A;  4M3E A;  4B3A A;  3PM1 A;  2FD5 A;  3B6A A;  5FKL A;  3NS4 A;  2PFV A;  3BHQ A;  4JL3 A;  4HKU A;  5EFY A;  2XGC A;  2XDN A;  4IRV A;  5K7H A;  2NS7 A;  5FKK A;  4D5C A;  2FQ4 A;  5C4Y A;  2UXH A;  5FMP A;  1Z0X A;  4WIB A;  3HGY A;  3VW0 A;  2G7L A;  3BQZ A;  3CDL A;  5GPA A;  3G1L A;  3QPL A;  3EUP A;  3E7Q A;  3TP0 A;  3LSP A;  2XPU A;  4D7N A;  3ZQH A;  2QCO A;  3IH2 A;  4G12 A;  3LWJ A;  5EZH A;  4X1E A;  2XPW A;  2QKO A;  3C07 A;  4XK4 A;  2UXP A;  3IH4 A;  2ID3 A;  4W1U A;  3CCY A;  3AQT A;  3NNR A;  2QWT A;  5CXI A;  2W53 A;  3BQY A;  4D5F A;  3BTC A;  2FJ1 A;  3B6C A;  2YVX A;  2JJ7 A;  4JKZ A;  4L62 A;  3KZ9 A;  2ZCX A;  2IU5 A;  2ZOZ A;  3KNW A;  5J1R A;  1VI0 A;  2Y31 A;  3BR2 A;  2WGB A;  2GBY A;  5FGL A;  1RKW A;  2NS8 A;  1T56 A;  3ZQI A;  1JTX A;  2OPT A;  3HTH A;  3ON2 A;  5DAJ A;  2X9D A;  4ME9 A;  2OI8 A;  4KWA A;  2ZCM A;  2VPR A;  5IPA A;  3DU6 A;  2R7R A;  3P9T A;  5F27 A;  2DG7 A;  4ACI A;  5IOY A;  3NPI A;  3O8G A;  3MNL A;  2PZ9 A;  4B1R A;  3BNI A;  3BR3 A;  3VPR A;  3VVZ A;  2YVE A;  4GCK A;  5CXG A;  3PAS A;  4NEL A;  2GEN A;  5K7Z A;  1ZKG A;  1UI6 A;  4V2G A;  2UXU A;  3BR0 A;  2HXO A;  2G7S A;  1JUP A;  4M3G A;  5FKM A;  2RAS A;  1Z77 A;  2R7V A;  3ZQF A;  2DTZ A;  2XGE A;  2GFN A;  2R7U A;  1RKT A;  3CRJ A;  3QPS A;  3FHN A;  2G3B A;  4AC6 A;  2ID6 A;  3BJB A;  3VP5 A;  2R7S A;  2O7T A;  3BTI A;  3EGQ A;  3VOX A;  2ZCN A;  5F0C A;  3PPB A;  3Q0U A;  1QPI A;  2JK3 A;  4AUX A;  2GUH A;  3ZQG A;  4YZE A;  2FX0 A;  3ZQL A;  2QTQ A;  3O8H A;  4DVY P;  3G56 A;  4AF5 A;  3QBM A;  3G1M A;  2B1E A;  3BRU A;  4V2F A;  2UXO A;  2I10 A;  3BR6 A;  3SDG A;  3NI7 A;  3FIW A;  3COL A;  3HE0 A;  1JTY A;  5FKN A;  5F0F A;  2FJI 1;  3BTJ A;  3HIM A;  3FK7 A;  3NRG A;  4ICH A;  3K8P C;  2VKV A;  3QKX A;  4CGR A;  3CJD A;  3VVX A;  4ABZ A;  4GFL A;  2VKE A;  5J1U A;  5AQC A;  3WHC A;  2O7O A;  2NX4 A;  3HGG A;  2Y2Z A;  4U9N A;  4U9L A;  5FHP A;  3IUV A;  2B3W A;  2F07 A;  2WUI A;  2HXI A;  5HBU A;  4NN1 A;  1A6I A;  3G1O A;  5F08 A;  5F0H A;  3BTL A;  2ZY9 A;  4M3D A;  4UDS A;  1U9N A;  4GCL A;  1JUS A;  3RH2 A;  3VIB A;  5F04 A;  2ZOY A;  3G7R A;  1T33 A;  4C2M A;  4MO7 A;  3DPJ A;  2UXI A;  5J3L A;  2HQ5 A; 
#chains in the Genus database with same CATH homology
 2HKU A;  2NP3 A;  3BR5 A;  5EYR A;  5K58 A;  3DEW A;  3QQA A;  3F1B A;  3T6N A;  5HAW A;  2G0E A;  5CW8 A;  1ORK A;  2TRT A;  2REK A;  3GZI A;  3TP3 A;  5H9T A;  3WHB A;  2IEK A;  3V6G A;  2PBX A;  5GP9 A;  3Q0V A;  3CWR A;  2X6O A;  1SGM A;  3HTI A;  3GEU A;  3FK6 A;  2QOP A;  2XPV A;  3BCG A;  2XGD A;  3VW2 A;  2Q24 A;  3Q0W A;  3KKC A;  5HSZ A;  3LSJ A;  2EH3 A;  2YVH A;  2DG8 A;  3B81 A;  3DCF A;  3FRQ A;  1ZK8 A;  2RAE A;  5J1Y A;  3SFI A;  2TCT A;  5D19 A;  2V57 A;  1UI5 A;  3RD3 A;  2HYJ A;  5EZG A;  1JUM A;  2XRL A;  2XB5 A;  3AQS A;  1JT6 A;  2D6Y A;  3LJL A;  4GCT A;  4I6Z A;  2FBQ A;  3BR1 A;  3MVP A;  4GFK A;  4D7M A;  4MK6 A;  3O60 A;  3VW1 A;  4JNN A;  5F1J A;  5FKO A;  5D1R A;  3KKD A;  2Y30 A;  3BT9 A;  4PXI A;  1RPW A;  4DW6 A;  4W97 A;  3NXC A;  2OF7 A;  3HTA A;  3HTJ A;  2QIB A;  1JT0 A;  3S5R A;  4JYK A;  5K7F A;  3LSR A;  1QVT A;  4AC0 A;  3V78 A;  3JSJ A;  2IBD A;  3ANP A;  3C2B A;  3IH3 A;  3LHQ A;  5IP6 A;  3ON4 A;  5D18 A;  2NP5 A;  1BJZ A;  3ANG A;  5GPC A;  2WV1 A;  2HYT A;  4MXM A;  2RHA A;  2IAI A;  3VUQ A;  2OER A;  2G7G A;  3LOC A;  3VOK A;  1QVU A;  5IOZ A;  3VVY A;  1U9O A;  2ZB9 A;  4M3F A;  3Q3S A;  4I76 A;  4M3B A;  3F0C A;  4M3E A;  4B3A A;  3PM1 A;  2FD5 A;  3B6A A;  5FKL A;  3BHQ A;  4JL3 A;  4HKU A;  5EFY A;  2XGC A;  2XDN A;  5K7H A;  2NS7 A;  5FKK A;  4D5C A;  2FQ4 A;  5C4Y A;  2UXH A;  5FMP A;  1Z0X A;  3HGY A;  3VW0 A;  2G7L A;  3BQZ A;  3CDL A;  5GPA A;  3G1L A;  3QPL A;  3EUP A;  3E7Q A;  3TP0 A;  3LSP A;  2XPU A;  4D7N A;  3ZQH A;  2QCO A;  3IH2 A;  4G12 A;  3LWJ A;  5EZH A;  4X1E A;  2XPW A;  2QKO A;  3C07 A;  4XK4 A;  2UXP A;  3IH4 A;  2ID3 A;  4W1U A;  3CCY A;  3AQT A;  3NNR A;  2QWT A;  5CXI A;  2W53 A;  3BQY A;  4D5F A;  3BTC A;  2FJ1 A;  3B6C A;  2JJ7 A;  4JKZ A;  4L62 A;  3KZ9 A;  2ZCX A;  2IU5 A;  2ZOZ A;  3KNW A;  5J1R A;  1VI0 A;  2Y31 A;  3BR2 A;  2WGB A;  2GBY A;  5FGL A;  1RKW A;  2NS8 A;  1T56 A;  3ZQI A;  1JTX A;  2OPT A;  3HTH A;  3ON2 A;  5DAJ A;  2X9D A;  4ME9 A;  2OI8 A;  4KWA A;  2ZCM A;  2VPR A;  5IPA A;  3P9T A;  5F27 A;  2DG7 A;  4ACI A;  5IOY A;  3NPI A;  3O8G A;  3MNL A;  2PZ9 A;  4B1R A;  3BNI A;  3BR3 A;  3VPR A;  3VVZ A;  2YVE A;  4GCK A;  5CXG A;  3PAS A;  4NEL A;  2GEN A;  5K7Z A;  1ZKG A;  1UI6 A;  4V2G A;  2UXU A;  3BR0 A;  2HXO A;  2G7S A;  1JUP A;  4M3G A;  5FKM A;  2RAS A;  1Z77 A;  3ZQF A;  2DTZ A;  2XGE A;  2GFN A;  1RKT A;  3CRJ A;  3QPS A;  2G3B A;  4AC6 A;  2ID6 A;  3BJB A;  3VP5 A;  2O7T A;  3BTI A;  3EGQ A;  3VOX A;  2ZCN A;  5F0C A;  3PPB A;  3Q0U A;  1QPI A;  2JK3 A;  4AUX A;  2GUH A;  3ZQG A;  4YZE A;  2FX0 A;  3ZQL A;  2QTQ A;  3O8H A;  3G56 A;  4AF5 A;  3QBM A;  3G1M A;  3BRU A;  4V2F A;  2UXO A;  2I10 A;  3BR6 A;  3SDG A;  3NI7 A;  3FIW A;  3COL A;  3HE0 A;  1JTY A;  5FKN A;  5F0F A;  3BTJ A;  3HIM A;  3FK7 A;  3NRG A;  4ICH A;  2VKV A;  3QKX A;  4CGR A;  3CJD A;  3VVX A;  4ABZ A;  4GFL A;  2VKE A;  5J1U A;  5AQC A;  3WHC A;  2O7O A;  2NX4 A;  3HGG A;  2Y2Z A;  5FHP A;  3IUV A;  2F07 A;  2WUI A;  2HXI A;  5HBU A;  4NN1 A;  1A6I A;  3G1O A;  5F08 A;  5F0H A;  3BTL A;  4M3D A;  4UDS A;  1U9N A;  4GCL A;  1JUS A;  3RH2 A;  3VIB A;  5F04 A;  2ZOY A;  3G7R A;  1T33 A;  4MO7 A;  3DPJ A;  2UXI A;  5J3L A;  2HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...