3BTIA

Crystal structure of qacr(e58q) bound to berberine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 77
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btiA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btiA02
1RKWA 3HTHA 1OJLA 2JA8J 1ZTRA 3MVPA 2XGDA 2JA6J 4MIMA 3GTLJ 5HSZA 5IYDJ 5IOYA 1ZK8A 4ABZA 4RBOA 1HCRA 1QRYA 4Y52J 3P9TA 3NNRA 4A3LJ 3KNWA 2E19A 2GUHA 5FGLA 1A6IA 2YS9A 1ETKA 2CU7A 3VVYA 5C4JJ 1GDTA 2WB1N 4MK6A 2UXHA 4D5FA 2DJNA 2K9NA 3AQTA 1MBGA 2CRGA 3FIWA 2JMWA 2ZB9A 3BR5A 1W0UA 3T6NA 4C3IJ 3MNLA 3JRIA 2RAEA 2DA2A 5EZGA 1XS9A 1SANA 2R5YA 4JX5A 5JLXA 2Y0SN 1IDYA 2RHAA 2NS8A 1SGMA 2XB0X 3GTMJ 3B6CA 1JKPC 5IPAA 5DTDA 5K7FA 3HTAA 1H8AC 1H88C 2WAQN 1XC5A 2GBYA 3K7AJ 3WHCA 2R7ZJ 1ZKGA 5K58A 3LSPA 1UMQA 5K7HA 5F0HA 4RDUA 2E2IJ 1Z77A 1APLC 3HBLA 4LOCA 4GFKA 1WH5A 2EH3A 4AYBN 2NP3A 1T33A 3Q3SA 4I76A 3A02A 4M6VA 2MW8A 1RETA 3D1NI 4DZPA 1I3QJ 1JGGA 3QKXA 1LE8A 5FKMA 4C2MJ 3VW1A 3IV5A 3HGGA 3H0GJ 4D7MA 3VUQA 2W48A 3E7QA 3S15J 2EZKA 2UXUA 2I10A 5EG0A 2L9RA 1WPKA 3TW6A 3WHBA 5M5XJ 3SJMA 1B8IB 3S5RA 4V2FA 3VVZA 1YRNB 4QTRA 1U9OA 2MG4A 3G1OA 4EEFG 4G12A 1UI6A 3K2AA 1WH7A 5FLVA 2N8GA 2D5VA 1Q1VA 5E3LA 4J19A 2Y31A 1I6HJ 1RR7A 1OCTC 1F43A 4GCKA 4QIWN 4NN1A 3JRCA 3BTLA 4M3EA 3JR9A 3KKCA 2DG8A 1G2HA 2JJ7A 2JK3A 5DS9A 3PO2J 2W53A 2FQ4A 1AHDP 1PUFA 2B63J 4B1RA 1ETYA 3GTJJ 2MSYA 5EYRA 2WUIA 2KT0A 2COBA 5K7ZA 3C2BA 3VVXA 3HTIA 2DA7A 3A01A 4JNNA 1IGNA 3NARA 4YZEA 4ACIA 3LSGA 4BY1J 2FBQA 1POGA 3OSFA 5AQCA 4GCTA 5EGOA 1X58A 2ECCA 3HM5A 1X2NA 1QVUA 4M3BA 5FKOA 1IJWC 1HLVA 3BG5A 3O8HA 1K61A 3ZQFA 4IHXA 3HOWJ 2X6OA 1ZR2A 3HB9A 2PZ9A 3BR2A 3AQSA 3VP5A 3TP3A 1VFCA 2G7GA 3G1MA 2DMUA 4S0HB 2CQQA 3BQYA 3BJBA 4W1UA 1JT0A 2LTPA 2LFBA 4BXXJ 3G56A 5M3MJ 3ON2A 2EQRA 2LLKA 1U8BA 4DYQA 3PO3J 1NTCA 2HKUA 2G3BA 3ZQCA 1DU0A 4DYCA 4UDSA 1P7JA 3GTKJ 2OERA 4GCLA 3OSGA 1B72A 2PMZN 3F1BA 4B3AA 4XRSA 5IOZA 1FTZA 3C07A 1VI0A 2YVHA 4AC0A 1BA5A 2FX0A 5F0FA 2HOAA 1ETQA 3HOVJ 4DW6A 5EDNA 2VPRA 5EZHA 2LKXA 2CQXA 5D1RA 3RH2A 1UI5A 3ANPA 1WCMJ 3QPLA 3DPJA 5EFYA 1TWAJ 4IEJA 3Q0UA 2TCTA 4MFDA 4IHYA 2HXIA 2XPVA 3GTPJ 1ETVA 2XPUA 2E2JJ 2R5ZA 2XPWA 4KWAA 1TWCJ 5JLWA 3FISA 2K9SA 2DTZA 3GTQJ 4L62A 1UHSA 2Y2ZA 3ZQIA 3HOUJ 4FISA 3L1PA 4A3EJ 3F0CA 3JRHA 4ICHA 1U78A 4AUXA 1SFOJ 1S7EA 2TRTA 2IAIA 1RESA 3DEWA 5FKLA 2ZCNA 3V6GA 2NS7A 1CQTA 3B81A 4JYKA 1U9NA 1JKQC 1RPWA 1ENHA 2LP0A 1HF0A 2CUFA 1A5JA 3OOUA 5EEAA 4A3FJ 4XICA 2M2EA 3BCGA 4A93J 2P81A 1GUUA 2ZOYA 3B6AA 3HOXJ 5IYCJ 3V78A 2DN0A 5E3MA 3QQAA 3NPIA 1LE8B 1OCPA 1WI3A 3IH2A 2DA4A 2REKA 3LJLA 3ZOBA 9ANTA 3CDLA 2XRLA 3JRFA 3BG9A 3TEDA 4Y7NJ 2M34A 1FIPA 5HBUA 1OFCX 4DZJA 1ZR4A 4HKUA 4GFLA 4ME9A 1VF9A 3JRAA 3S2HJ 4DYRA 5CXIA 1T56A 2Y9YA 3BTJA 1K83J 5IP9J 2LR8A 2LD5A 2RASA 2Y30A 1LFUP 2NX4A 2L7ZA 3BG3A 1GV2A 3GZIA 4IHWA 1W0TA 4MXMA 2ME0A 2CUEA 2NVQJ 2HXOA 3MKLA 5C4XJ 2VUMJ 2K40A 4UUTA 4A3IJ 1AKHB 2XGCA 5FMPA 3JRGA 4XRSG 1JT6A 1ZGWA 1MBKA 1IV6A 1MBHA 2G7SA 2UXIA 3BTIA 2JWTA 3DCFA 1JKRC 5HAWA 4HNVA 2QCOA 1QVTA 1B8IA 3I4NJ 3IUVA 3O60A 5D19A 2WV1A 5IYBJ 1PUFB 1JTXA 2ID3A 2DMNA 1GT0C 3BR3A 1JKOC 1YRNA 3HIMA 4C3HJ 1MSEC 5EF6A 2HI3A 1IG7A 1IRZA 2HYJA 3CQZJ 2O8KA 1BJZA 4UUSB 3NRGA 2DMTA 2JA7J 2DA5A 3PM1A 2OPTA 3S14J 4PXIA 5C4YA 3Q0VA 2XSDC 5FJ8J 5M3FJ 1BW6A 4I6ZA 5CW8A 5D18A 3A03A 3CCYA 1JJ6C 2ZCXA 1IDZA 1ORKA 4AF5A 3CRJA 4AC6A 1IUFA 5BNGA 2JN6A 3ZQGA 3HGYA 2UXPA 4QSHA 3BTCA 5J1RA 3NI7A 5IP7J 1HOMA 1JUSA 2PBXA 2ZOZA 3KKDA 3LOCA 4NDLA 3S1MJ 4M3FA 4GFBA 1LFBA 2XGEA 1MSFC 2LVSA 2M9HA 3BRUA 5GPCA 2EZIA 3FKIJ 4CYCA 2EZHA 2X9DA 3BR6A 1RKTA 1ETXA 1Y1WJ 2HQ5A 2M0CA 4A3BJ 2QF7A 3VPRA 3RZDJ 1TWHJ 2H8RA 4CGRA 2FJ1A 3HE0A 3BHQA 2WGBA 4BKXA 3JREA 2LY9A 2R92J 1EF4A 2HDDA 2FD5A 3S2DJ 2NP5A 3ANGA 3VOKA 3CJDA 1XG1A 4A3GJ 5F27A 2DA1A 4A3KJ 4D5CA 4XIDA 1JUPA 3BR1A 2IEKA 2QWTA 2MGQA 1ITYA 3NAUA 3S1QJ 2O9LA 2ME6A 3S16J 2DMPA 4FE7A 2GFNA 2YU9J 1R9TJ 1AU7A 2DA6A 2R5YB 3GBGA 1Z0XA 3IH3A 2NVXJ 5J1UA 2AO9A 3TP0A 5C44J 1QPIA 3GEUA 1NK3P 3KZ9A 2L0KA 5DAJA 4BY7J 2HOSA 5FHPA 3ZQHA 1O4XA 3G7RA 2VI6A 4JP0A 3IH4A 4C3JJ 3FK7A 5FKKA 2HYTA 3RD3A 3LSRA 4A3JJ 3HEFA 5IP6A 2G0EA 3BT9A 2HOTA 2NOGA 2Y9ZA 1UG2A 4MFEA 3H3VK 1ETWA 3SDGA 3RKQA 2DG7A 2QKOA 4A3MJ 1FJLA 1JTYA 3FK6A 1X2MA 2YUSA 4A3CJ 4NELA 1MBFA 3BQZA 1D5YA 2H1KA 3RQIA 2NVYJ 2DMQA 1IC8A 3SFIA 4MO7A 5EG0B 2R0QC 3HOZJ 3S1RJ 3E7LA 1ETOA 5HODA 3FRQA 3ON4A 3HKZN 3HOYJ 1JJ8C 3JSJA 2M8GX 5GPAA 1FEXA 3LSJA 2EZLA 3RZOJ 2GENA 4JX6A 3G1LA 3EUPA 3S1NJ 2OF7A 3PASA 5M5YJ 4IHVA 3JRDA 4BBRJ 2O7OA 2AHQA 5E3NA 5E3OA 1HDDC 4A3DJ 4BBSJ 5J3LA 3M3YJ 2YVEA 4B4CA 3HTJA 3BR0A 3VOXA 1NK2P 5C3EJ 4JX4A 2G7LA 2ZCMA 2F07A 4V2GA 2ELKA 5J1YA 5FLMJ 4FE4A 3TW7A 3CWRA 1FTTA 2OI8A 2V57A 3W6VA 3QBMA 4XK4A 3S17J 1BL0A 3MN2A 1FIAA 3A01B 2X48A 4M3GA 2GM4A 1GVDA 2LK2A 2QOPA 4FTHA 5F1JA 5EGOB 1AKHA 3VW2A 2E1OA 5CXGA 3VW0A 2VKVA 2R93J 2D6YA 2VKEA 5M5WJ 3GTOJ 1TC3C 2QTQA 3EGQA 4W97A 2L7MP 4MLOA 4XRMA 5GP9A 3BNIA 2IU5A 2IBDA 4JKZA 2E2HJ 2L7FP 2K9QA 3ZQLA 1MBJA 1MH3A 2ECBA 3QPSA 4X1EA 5F0CA 3VIBA 5H9TA 2O7TA 1Y1VJ 2XDNA 1JUMA 3PPBA 1HDPA 1DU6A 1MBEA 3LNQA 1TWGJ 4UUSA 3O8GA 1VNDA 3UKGA 3NXCA 1GV5A 5F04A 3OIOA 4FCYA 1H89C 4CYCB 2Q24A 3LWJA 4A69C 2DA3A 3Q0WA 3M4OJ 2CJJA 2EBIA 1B72B 3COLA 1P7IA 4L5EA 3HDDA 2NVTJ 2UXOA 2GLOA 2KDZA 4D7NA 4JL3A 4X6AJ 1I50J 2QIBA 2JA5J 1MNMC 5F08A 3GTGJ 4M3DA 1BW5A 3LHQA 1E3OC 1F36A 2ID6A 1TWFJ 3CMYA 2XB5A 1ZQ3P 1MH4A 5FKNA 1WGXA 2R5ZB 3I4MJ 3JRBA
chains in the Genus database with same CATH superfamily
3CP2A 1L0OC 1J9IA 1DP3A 3HTHA 3W3CA 3TOBA 5F6FA 3AL0C 4Q4ZF 2XGDA 5FFXA 2OAZA 4Z2YA 3WTVC 2AS5F 5HSZA 1Y39A 5IYDJ 3NNRA 2A6TA 3KNWA 2E19A 2V6CA 1KQ8A 1WJFA 3K4BA 1Q1HA 2KJBA 2M8EA 3FKJA 2CU7A 2QSFX 4M9XA 4RAYA 1OCZH 2UUZA 2UXHA 3E5XA 1BR1A 1TP4A 3FIWA 1VQ6I 2V1NA 3MNLA 2VJ5A 2RAEA 3H92A 5DM7F 1XS9A 3G2BA 3QRFF 4PGHA 5LLQA 1R36A 1R5GA 2F4IA 2JUCA 2Y0SN 4M74A 2PJRB 2E36A 2NS8A 3GTMJ 3B6CA 1HQCA 5CJ9A 5F1RA 4WK8F 2IGMA 4XORA 5DTDA 4IKFA 3VODA 1ULYA 1O3TA 3BZ6A 3D5RC 3K7AJ 3WHCA 3LSPA 5F0HA 1AA7A 3HBLA 4XKWA 2GXAA 1Z6TA 2XC7A 3CP8A 2DPDA 4AYBN 2NP3A 2OD5A 2I5UA 3CUQC 4CCOA 1LFPA 3OIPA 2GXGA 3WTTC 1WJDA 3A02A 3CJQB 1RETA 3D1NI 4E7HA 2Y0SA 2XAFA 1JGGA 2LNBA 3R6SA 4XOPA 3IV5A 3M1CA 3IWFA 3OYFA 2G7HA 3E7QA 3RPQA 2YX4A 2DOFA 2L9RA 4QLCU 2B3WA 3GVAA 3MD2A 3J80K 4YG2F 3VVZA 1KQ0A 1KU7A 4ESJA 4QTRA 1B6AA 4KDPA 1U9OA 4MQ9F 4ZDLA 4AYBA 2EFQA 1PJRA 1Z3XA 3VWBA 1RZ4A 3G4SI 1UI6A 4DQ2A 5FLVA 1WH7A 3VTIA 2W7NA 3CF2A 4RM3A 4EATA 3JCUC 4MNUA 5E3LA 2E1MB 1RR7A 4RGSA 2HDCA 3JRCA 3COAC 3JR9A 1BI0A 4M3EA 5D8LB 3CCUI 4UUVA 3SWHA 1VQ7I 1G2HA 2JJ7A 4L9TA 1V5EA 3L2RA 1KYZA 1AHDP 3KP7A 1G6NA 2OUMA 1MIJA 2B63J 4B1RA 2JQ7A 2OV7A 3OR2C 2HVRA 5K1YA 1WKMA 2GOXB 3DTIA 1TW3A 2DA7A 1G3SA 2KRCA 3A01A 2HZTA 4JNNA 3VOEA 4ETSA 5L3FA 1POGA 2M7AA 3FXMA 5AQCA 3JAMK 3M8JA 4GCTA 5EGOA 3DPTA 1R5HA 3BLYA 3FXUA 1LEBA 1X2NA 2CUJA 2E7WA 4Q5SF 4DIQA 3ZMSA 1HLVA 5H2FC 4XSXF 3EYYA 1DDNA 2STTA 2W24A 1ZR2A 4MEXF 4M73A 4HRIA 1SD5A 3AQSA 2HWVA 2GA1A 4IX7A 3TO6A 4NQWB 2BHZA 3N05A 2CQQA 2NXNB 1JT0A 3JTHA 2ZMEC 1W5TA 1NH3A 1O3QA 2GOMA 3ON2A 2LLKA 4DYQA 2HKUA 1IN5A 4CCNA 1P7JA 1SD4A 1D0ZA 3GTKJ 1HSTA 1YS7A 2OERA 3WGIA 4J01A 1B72A 2OZ6A 1Z7UA 1H0MA 1LQ1A 4XRSA 2OTJI 1FOYA 1QZEA 1XDSA 1VI0A 1BA5A 4BEHA 1EH6A 4M72A 1YIJI 2ZJQF 3HOVJ 4DW6A 2LKXA 2VPRA 2L2OA 1UI5A 1R1UA 1OLTA 3ANPA 3RH2A 3QPLA 3DPJA 1TWAJ 3C7JA 4IEJA 1D3YA 2CFOA 2HXIA 2ISZA 3GTPJ 3OYEA 3FM3A 4LFUA 2K9MA 2R7TA 2R5ZA 3T5XA 4HOBA 1ZGAA 1VQ8I 3WODF 1EV7A 1R49A 1B9NA 3FISA 3UR3C 4B09A 3BPXA 4BQNA 4KMUX 3GTQJ 4RB1A 1LDDA 3FDYA 2ETHA 4A3EJ 3F0CA 4FASD 4ICHA 2CW8A 4A2UA 1S7EA 3RI4A 4ZTJA 4ZYHA 2NS7A 2LC2A 1AOYA 2PG4A 1YG2A 1JKQC 1RPWA 1ENHA 4RLFA 3KLOA 2FBIA 4A12A 2CQKA 4A3FJ 2M2EA 3VSLA 4GYIA 3BCGA 4XN3A 4ZH4F 2P81A 3B6AA 3H1CA 3ABTA 2ISYA 3QOEA 3HOXJ 2MABA 2UXNA 2JVHA 3CMMA 2CUZA 3QQAA 3TO9A 4ESBA 4JOMA 1X19A 2DDBA 3OL4A 9ANTA 4II2A 3I54A 4E70A 3LSHA 3JRFA 3TEDA 3GLXA 3EUAA 3JSOA 1D8KA 4P96A 1ZR4A 4HKUA 4ME9A 1VF9A 2RV8A 3BTJA 2LR8A 4CA0A 4BACA 2RASA 1LFUP 2L7ZA 3BG3A 2BY3A 3GZIA 3K4MA 4MXMA 4N4NB 2E5NA 3ESWB 3VDXA 1X1CA 2NVQJ 1XN7A 4UUTA 4A3IJ 5FMPA 2BHYA 1VQ5I 2P6TA 2X1CA 2XV4S 1G59A 1MBKA 1IV6A 2E34A 2R3SA 2QCOA 1B8IA 1FC3A 1P4XA 3KEOA 4NBQA 1B59A 4C30A 2BE5F 1JKOC 5AIPA 1K78A 5EF6A 5D5XB 1IRZA 2NAZA 4XOTA 3BPVA 4NUBA 2DTRA 4UUSB 2PJPA 4U0VA 2HQNA 1Y0UA 3FXOA 3S14J 4F91B 2M1BA 1ACIA 2XSDC 5FJ8J 2K7LA 4I6ZA 1WJEA 3FX3A 5CW8A 5D18A 1YQAA 1TQPA 1IDZA 3TKYA 2OCEA 1TT5B 1XMAA 2WADA 1C0WA 2NNNA 5BNGA 5GAEJ 3ZQGA 2FMYA 4HF2A 1J75A 3HPHA 2P5KA 2NOJB 5IP7J 4BQAA 1JUSA 3KKDA 3LOCA 3HOTA 3L2UA 4GFBA 3P9IA 2LVSA 2M9HA 1F4KA 5GPCA 2MD0A 4CSWA 2Z5UA 3C2GA 2X9DA 4ZC3A 1LDJA 3CO6C 2FNPA 1QHGA 3K6GA 4M6YA 1TWHJ 2H8RA 5B66C 2CYYA 1LVAA 4D0PA 2HYFA 2EFWA 2D1HA 5TGTA 1W1WE 1IZ1A 4IRIA 3R0AA 4FX4A 1EH8A 4D5CA 1YS6A 1FSHA 2LDUA 1JUPA 4OU0A 4Q48A 3BR1A 4LLGF 1WJBA 3RYPA 2FBKA 2WA0A 3CCQI 2MGQA 2UZKA 4KISA 3DKXA 2O9LA 1SFKA 2ME6A 3IAM2 3I0TA 1IN7A 2YU9J 4B43A 2H1LA 3ASOH 1STZA 2F2EA 4PFOA 4XL9A 3U1DA 3LAPA 3GBGA 4KNYA 5IT9Z 1E17A 4OAYA 1DGWY 1W7PD 2MH2A 3IH3A 2AO9A 5C44J 1QPIA 3VYUB 3KZ9A 4Q47A 1DQUA 4BY7J 5FHPA 4IOCF 2FEZA 2VI6A 3CC2I 3ZCOA 3RD3A 2BOLA 2X6XA 3IL2A 3BT9A 1V5GA 5DYMA 3WU0A 4AIHA 1YW9A 3IP4B 1UG2A 2QENA 4HV5A 4KIGA 3IRQA 2Y9ZA 5E1XA 2IS2A 1X2MA 4LJZF 2RGVA 2VC1A 3CTAA 2E1CA 2VXDA 1U8RA 5E20A 1FOWA 2VQGA 4E7IA 3WTSC 1W5SA 2A6EF 2R0QC 2DK8A 1Z1DA 3SDBA 5HODA 3FRQA 4XMYA 3WG9A 3HOYJ 3JSJA 1SVOA 5GPAA 2Y69H 3D0SA 4UVCA 3ASNH 2IS1A 3RZOJ 4ITVA 4I01A 2LOOA 3G1LA 4LG3A 2ZKZA 1UELB 3E97A 2KP6A 4A0XA 5B1BH 5KHDA 1HDDC 4PK4A 3G6EI 3ISPA 5J3LA 2A69F 3DQVC 3BR0A 1JXSA 4HLXA 1F1ZA 2LMDA 2XAJA 2W00A 1SAXA 3F21A 4JX4A 2MD5A 2F07A 2ICWG 4FE4A 3GZNB 3FM5A 5FFZA 3PIPF 1FTTA 1K78B 2V57A 3W6VA 4U87A 2A5WA 5FO5A 4O3MA 4M3GA 3BZCA 4CUGA 1X3UA 1YX5A 4FTHA 2VQCA 2O6GE 1JHHA 1AKHA 3VW2A 2E1OA 2GAUA 2QTQA 1ERDA 2IA1A 2IGNA 2L7MP 4MLOA 2HPIA 2EIJH 1ON2A 2X51A 2A5YB 3L7WA 4EJWA 2XROA 1K79A 2E2HJ 2K9QA 4Z6YA 3H9JA 3VIBA 2JRTA 5AIQA 2MFZA 4PSXA 2XDNA 1QZYA 3PPBA 1R6RA 1DU6A 1TWGJ 2R7DA 3L2WA 2B0LA 1X1DA 5E18F 3UKGA 4RM2A 3F8MA 1LB2A 5DV5A 2E5ZA 2E1MC 4ZYDA 2O5RA 6PAXA 1F9NA 2HDWA 3ZMUA 4IJAA 4F55A 3OYMA 1XX5A 1TQMA 2VE9A 2EBIA 3IKTA 1OPCA 1N78A 1YITI 2ELHA 2XF6A 2ZCWA 3HDDA 2NVTJ 2EPFA 4ASNA 2A2FX 2UXXA 4J00A 4JL3A 2R7FA 2GIZA 2FA5A 1N25A 4HBLA 5AONA 1Y0NA 5B1AH 4YFXF 3ZGKA 3LHQA 1TWFJ 3CMYA 2XB5A 3KPHA 3B73A 5CLSA 3ERED 3BOQA 5A2QK 2CG4A 2K86A 1RKWA 1EA3A 4Y4RA 3MVPA 3HHGA 2D1VA 2W1OA 2JA6J 4ENJA 4G8XA 2A6HF 3PNYA 3UNGC 3DLAA 4RBOA 1G3TA 1QRYA 3P9TA 4A3LJ 3G73A 2GUHA 3KP3A 5FGLA 1FT9A 3A1YA 3H35A 3PFYA 1MDMB 3GCMA 1ETKA 3CJTB 2HPMA 5C4JJ 1S5LC 5D4SA 4I0AA 2DAOA 3ROUA 3OS1A 2LBFB 1R5ID 2DXIA 4DBRA 2VODA 3E1SA 3ECHA 3KLNA 4KN4X 1FOKA 3ZPLA 2DA2A 5EZGA 2R5YA 3KFWX 4KYWA 3TOAA 1IDYA 4FX0A 4UVBA 4XLAA 1JKPC 3FXLA 5D5VB 2X4HA 3HTAA 3EUHC 1H88C 4GCVA 2GBYA 2R7ZJ 3S3OA 1ZKGA 1ZELA 4M6XA 2RN7A 2E2IJ 1Z77A 3A0HC 4B3XA 4GFKA 2RNGA 3AAFA 4CZCA 1T33A 3Q3SA 3L9FA 4I76A 4YFNF 3HRSA 2BY1A 2ZNZA 1I3QJ 5ILSA 4D9JA 2MLKA 2GXBA 1LE8A 3VUQA 2HQAA 2M4GA 2RDPA 4L9VA 4D7MA 5IT3A 2WAEA 1JE8A 3VW1A 1E3HA 2W48A 1I39A 5DCFA 2EZKA 2I10A 5EG0A 2P6SA 1S3JA 4XKVA 1TL8A 4LB5A 1O3SA 1WPKA 3WHBA 3RSNA 2A68F 2VT2A 4OAZA 5B3SH 4I99C 2V26A 3FXQA 3PUFA 2N8GA 3CO7C 4CO8A 1KGSA 1KQ9A 1BJAA 1Q1VA 4Y33A 4IRGA 4RAGA 4J19A 1HKSA 1OCTC 4JBAA 1BC8C 3I4PA 4R79A 4HX7A 4LIVA 5K5QA 4ESFA 1MMSA 4LITA 2CS3A 1QNTA 3GX4X 2L9VA 2QQBA 3RJPA 4XNFA 3PO2J 2W53A 1G4DA 2L4MA 5DCMA 4E7LA 1PUFA 1IN6A 3OYGA 2WUIA 2MSYA 2CSOA 2COBA 5K7ZA 4HQEA 4XLHA 4EMSA 3VVXA 1N77A 3HTIA 3OYNA 3DKWA 2OCCH 4YIRX 4EJOA 4KITB 3LSGA 1H9GA 4DOZA 3D5LA 3J7YJ 3OSFA 5CYVA 3TBIA 4EGZA 3OOPA 2DFHA 1X58A 3HM5A 5HS7A 2HFHA 1J7KA 2WBMA 2L5QA 5FKOA 4ZTFA 1UG0A 1SMTA 4KMFA 1YW8A 5L3DA 4LG0A 1BC7C 1LVKA 3GXOA 3CLQA 3A4CA 3F8FA 1W7PA 3B02A 2NVUB 3HB9A 4L9NA 1O57A 5FROA 3VP5A 3HXLA 3BJ6A 1TLHB 3E6DA 4BXXJ 1XGNA 3G56A 5J47A 5M3MJ 1U8BA 2OA4A 3PO3J 2D45A 2IVMA 3ZQCA 2G3BA 3L2QA 2VB6A 3NWTA 4H4KC 2VKHA 2QUFA 4HG2A 4B3AA 1BM9A 5IOZA 4BU2A 3LA2A 3U21A 3C07A 4B48A 2OBPA 3TL4X 2EIMH 2Z9OA 4NHJA 1MNEA 1FOXA 5F0FA 4AIDA 1ETQA 4XM3A 2P7CB 3GYHX 5EZHA 2IA2A 1GHCA 3LMMA 2OTLI 4C2MA 3AG4H 5CVJA 4XKBA 5EFYA 3CCRI 5CVUA 1R00A 3WTZA 2XPVA 2XPUA 2E2JJ 2XAUA 2J5PA 2XPWA 1ZN2A 1J0RA 1T39A 5J8FA 2E71A 4S05A 1UHSA 2Y2ZA 2QQAA 3M9AA 1RR8C 1B1BA 1EKEA 3KP6A 3K70D 3JRHA 3ABKH 1U78A 4IZZA 2Q0OA 2IAIA 4HF0A 1P9QC 3V6GA 5BPIA 1J59A 5KVRA 3B81A 5BS6A 1U9NA 2LP0A 2ZJ2A 1HF0A 1R1TA 4XICA 1RI7A 2BGCA 2LSOA 2Z3YA 3BC8A 2AQFA 4PJNA 3EETA 4F52A 3V78A 3T8TA 2DN0A 2NS0A 3H36A 5E3MA 3KIOA 1J5YA 5J4VA 1LE8B 3K4NA 2V7FA 3OYDA 1WI3A 2DA4A 4HDUA 1R4MB 3LJLA 3ZOBA 3CDLA 2LF7A 2OZUA 2WY7Q 3ZMDA 2XRLA 1GXPA 2NRAC 2MLGA 2M34A 1FIPA 3H5NA 1KU3A 3JRAA 1X4OA 3REOA 4HPQA 1T95A 1T56A 4BS9A 5IP9J 3J80Z 3RKYA 2FNAA 1YJWI 3TQNA 1BOBA 4IHWA 1XGSA 1V54H 1BI2A 3I5UA 4HV6A 3PIOF 2K40A 3DV8A 3E6MA 2L54A 1HW2A 5HS9A 1YTYA 4U9NA 3K1NA 3V8LA 1JT6A 3EDPA 4H0EA 1MBHA 1X3ZB 1PDNC 2XRNA 2I8DA 3VYSB 2JWTA 3DCFA 1RRJA 5HAWA 4HNVA 2PQ8A 4HX4A 4A6DA 3I4NJ 3IUVA 3O60A 2KIUA 5DCMB 2HQRA 3SZPA 1PUFB 1A35A 5D19A 5JHFA 1YRNA 2BBYA 3LQQA 4OMYA 1MSEC 1YI2I 5E79C 3EPZA 3CQZJ 2AXTC 2J5OA 3SXYA 2EK5A 2DA5A 3PM1A 1VQ4I 2EV5A 2OPTA 3GW2A 2XSJC 4B8XA 1U5TC 2JUGA 2ZNYA 3Q0VA 3HJEA 3RQ4A 1Z67A 3QWLA 1GLNA 3I9V2 3MZ8A 3CCYA 3OMYA 1OCOH 4KIBA 4A5MA 1FX7A 1ORKA 3V4GA 2PLYA 5J8CA 2IA0A 2DQRA 4RA2A 3HGYA 4RGRA 1K4TA 2UXPA 3T8RA 2KZVA 3MEXA 3RDIA 1HOMA 3IAS2 4NDLA 2K3PA 4U0WA 3S1MJ 2V79A 3WTXC 2XGEA 1MSFC 4IHTA 3F8NA 3H9GA 2ELJA 1W4MA 3DLLF 1ZLKA 1I3AA 2EZIA 5H6RA 2EZHA 2R7QA 1WVRA 1RKTA 1ETXA 2DDAA 3PQJA 2M0CA 4JK1X 2BEOA 2RC4A 5BPDA 1S6LA 4ENNA 2VN2A 2DPUA 2WGBA 5JHUA 2LY9A 4HZFA 4BH9A 2R92J 3K70C 2M4KA 1EF4A 4YIIA 2A61A 2VBWA 3TDZC 1VTNC 1SFXA 5F27A 5E8GA 1WZ2A 3H5RA 3F22A 4XIDA 3GLLA 3N4MA 1DUXC 1ITYA 1QA6A 4MGRA 3NAUA 4ANJA 3OYAA 1SFUA 3S16J 1SVMA 2QKMB 4FE7A 2GFNA 1WJAA 5KNLA 1R9TJ 2K4BA 2DA6A 2Y48A 3GMEA 5J1UA 3TP0A 3GEUA 2QQ8A 1KYWA 5FGMA 1O4XA 2G7UA 3FK7A 2XUBA 2HYTA 4HF1A 4IOAF 1ON1A 2K9LA 3LSRA 1VQ9I 4A3JJ 3HEFA 3CJNA 4UV8A 3T0YA 3GUDA 4LIUA 1TW2A 4MFEA 3H3VK 3CUQA 3RKQA 4GRIA 4A3MJ 1FJLA 3OYIA 2H6BA 1K4SA 4NELA 1MBFA 1K6YA 2QLZA 4ZYAA 3BWGA 3OYKA 3CUOA 4KIFA 4R8HA 2RQQA 4MO7A 3HOZJ 2A05A 4M9SA 3FXJA 4OIQF 3ABLH 4QPQA 2R7RA 2K4JA 1V55H 3S1RJ 3E7LA 3NS4A 3DF8A 5KCMA 3BROA 2K5CA 1RNLA 3CLOA 2M8GX 4I02A 1ODDA 3F6VA 1LPQA 1FEXA 4CXFA 3BCAA 3LSJA 1DPUA 3ZQQA 2EZLA 2GENA 3WGHA 1FWZA 3OYBA 4BBRJ 4CCLA 4DBQA 2AHQA 2BZTA 5CQEA 4RGUA 1CGPA 1FMVA 1Y8QB 3Q9VA 3NQOA 3U9GA 1T8IA 3M3YJ 1VQNI 5F64A 2M5WA 1NK2P 4KT5C 3DPLC 3U2RA 3I55I 3RCOA 4BE0A 4L0ZB 3H3ZA 3I71A 4XLFA 4WXDA 1PUEE 2IPQX 1FYMA 3K4CA 2KRFA 3WU2C 1L3LA 2BW3A 4GDFA 3BP8A 2IP2A 3NRVA 3S17J 3EQLF 3MN2A 3A01B 2X48A 4MTEA 1W5CC 3LFKA 5DDGA 2V9PA 2GWRA 1GVDA 1U5TA 5EGOB 1OISA 3SHFA 2CO5A 5DUKA 3VW0A 2VXZA 3DFGA 2ZSHB 3GZ6A 2FUG2 3PJRA 2D6YA 1MJ9A 1QO0D 3R4KA 1OR7C 5GP9A 4XRMA 2WAFA 2YX7A 3J7ZI 2JZYA 5JI6A 2L7FP 3E5QA 4BYYA 2P5LC 2F6CA 5H9TA 4X1EA 3QPSA 3BY6A 2QQ9A 1YJNI 3PUBA 2FOKA 1MBEA 3LNQA 2ZMEA 1VNDA 4XSZF 3L2CA 3MKWB 2LYCA 1T6SA 5LHHA 3CMEI 3ZR8X 2EV0A 3P9KA 4JQFA 3LWJA 2ZXIA 3RTRA 4NC6A 3AL0B 4E7JA 1B72B 1IAWA 2HZDA 3OV8A 4L5EA 3S3NA 4I2OA 2IJLA 1REPC 4RB2C 4CYDA 1A31A 3W6KB 4EM2A 3KEYA 4X6AJ 4BEHB 3IRRA 3E6BA 2DOAA 4IHSA 2QIBA 2KDOA 1I5ZA 5F08A 4RAZA 4OWRB 2ZFWA 4KUMA 1BW5A 3I56I 4C2UA 3TDUC 1SVLA 2XAGA 2QKLB 2DJIA 2ESHA 4S04A 4UNOA 1MH4A 5FLXZ 3HRMA 2X6YA 3FBIB 2Z16A 2R5ZB 2OC6A 2K3FA 3I4MJ 3JRBA 2O0YA 4U88A 4CCJA 4XN0A 1OJLA 2JA8J 1ZTRA 1A04A 2F5CA 2XKPA 3Q9SA 5HS8A 4G6TB 4MIMA 3GTLJ 3ERMA 2VBYA 2X0LA 4UHTA 1ZK8A 1HCRA 3HUGA 5K5OA 1ZHFA 4PJLA 3DPUA 4O6JA 2O03A 4IPAA 2YS9A 3Q5FA 2EWNA 4EV0A 4G6DA 2W85A 4EVIA 3LA3A 2WWYA 2WB1N 2LY2A 4PJJA 1XSDA 4MK6A 4U7BA 2K9NA 3FZVA 5H6QA 1MBGA 2CRGA 3CCMI 3BJAA 5TISC 2R7OA 4ZZDA 5LHGA 3F23A 5IT9K 3BJOA 5KAFC 3I3LA 3JRIA 1XPXA 1Y56A 3KCCA 3H0DA 1SANA 3DBHB 2ZJPF 4JX5A 5JLXA 4LLNA 2RHAA 1SGMA 2LF8A 3CCLI 1EH7A 2GQQA 1S72I 2IRFG 2HKOA 4RLQA 3CCVI 1HKQA 2ZFUA 4E4HA 2WAQN 4XONA 5K58A 2WB1A 4FT8A 1UMQA 4I7HA 5ICFA 1IF1A 1OYYA 2ZBKA 1WH5A 1WHUA 2EH3A 2R7UA 1R58A 2ACJA 4HYEA 5LEKA 5J4YA 1PYVA 3QKXA 1KZHA 2JPBA 4BHPA 3H0GJ 4IXAA 3OYCA 4II3A 3SFZA 2UXUA 1WRJA 3M8EA 5LGNA 3JSPA 3J81Z 3SJMA 1B8IB 2V1XA 2P4WA 1G3YA 1GXQA 1MMDA 1Z21A 2BW3B 3BDDA 3QP5A 3W6JB 3FHNA 2QA4I 1MMGA 5CPRB 5JVGF 3G1OA 1P92A 4G12A 1Y6IA 2P8TA 4K2EA 1FBUA 3QYEA 2D5VA 4WF2A 2QGUA 4GCKA 3DU5A 3SYTA 4QIWN 2XGXA 1AWCA 4NN1A 1PP7U 1I1GA 2R4GA 1YE9A 1V4RA 3KKCA 2DG8A 2LG4A 5HLHA 2IXSA 2FQ4A 3I59A 1YW7A 2DCEA 2OQRA 3KYCB 2XVCA 3QYBA 1FY7A 3DTKA 3WTUC 5EYRA 3GTJJ 3MCZA 3PFIA 4WIBA 3C2BA 3IWZA 4KT6A 1HW5A 4CZZA 5DM6F 3GEZA 1YFHA 4BDZA 3N97A 2Q2EA 3ONQA 1XGOA 1ZH5A 4YZEA 3LA7A 4ACIA 1HBXG 3FXKA 1ZG5A 2O61A 2VE8A 2VT3A 3RKWA 1IN4A 1SAUA 4D1QA 3V7SA 4N9HA 2W4SA 3SQNA 2QBYA 1G8XA 3BG5A 1T0FC 4P9UA 1K61A 4RAFA 2V9VA 2P0WA 3S2WA 3ZQFA 4IHXA 3HOWJ 2PZ9A 3RPUD 3TP3A 2G7GA 3G1MA 2DMUA 4S0HB 3BQYA 1Z7LA 4W1UA 4DNCA 2EIKH 4KICA 2LTPA 1UJ8A 1YLFA 2ZXHA 3SZGA 3MKZA 4G94A 2JT1A 3FMRA 1OYIA 4DYCA 4UDSA 1UCRA 2LREA 4GCLA 2IW5A 3OSGA 3E0JB 3QP6A 2ZJRF 2BV6A 2PMZN 4YFKF 3F1BA 4UB8C 2HNHA 2M45A 2RKHA 1FTZA 2FOWA 1IXSB 2YVHA 2VJJA 5BMZA 2FX0A 1X4PA 3HUGB 2L4AA 2KIFA 1D8JA 2HOAA 5D1RA 5EDNA 1O7FA 2CQXA 2IGKA 3RYRA 2HGCA 1ZRDA 3C1DA 3AKZA 2VJIA 2FU4A 4MFDA 3V7CA 3M07A 4MQVA 1ETVA 2VL8A 3OR1C 4OIRF 3PNTA 4ENMA 4N0BA 4KWAA 2K85A 4NB5A 2PMZA 4OIOF 1SEUA 1T38A 2DTZA 4RB0A 2HOEA 3L2VA 3ABUA 2X1DA 5DD8A 3K4KA 3ZQIA 3HOUJ 3KZIC 3L1PA 4OD4A 2CQ7A 3TGNA 5FKLA 2ZCNA 5D8KB 4BHBA 5D4RA 4I09A 1IUYA 2EILH 3CC7I 3QPTA 4IF4A 2IT0A 3KZZA 1DPRA 2F5FA 1MW7A 1N75A 5EEAA 1VQOI 4CDGA 2LY1A 4AIJA 1ZREA 1BOAA 4PGGA 2HVSA 4C2TA 5LBQA 1CF7A 2WY8Q 2ZOYA 2OJED 4NC8A 3MKYB 2QM3A 5E17F 5LEJA 5IYCJ 1SD6A 1XMXA 1ZG3A 1SMYF 3WG7H 2FJI1 3NPIA 4HW0A 2MBFA 1YHQI 4X0GA 1V5FA 1OCPA 2Z99A 2REKA 2Y75A 5ICEA 2COMA 2PBIA 3IC7A 4IVNA 3CDHA 1PVEA 2CMPA 3QYFA 4LLLA 3G3ZA 3CCEI 2UWMA 1A6QA 1Z3YA 2EV6A 4HA8A 2Y9YA 4ZJZA 1K83J 3W2AA 5CXIA 3KP2A 2Y30A 1LDKB 3K2ZA 3ZMVA 1GV2A 3SEQA 4L0YB 1W0TA 5H20A 2CUEA 5LGUA 3CZ6A 3H3UA 5C4XJ 2CW0F 1AKHB 2XGCA 1QHHD 2HTJA 4LK1F 4EJVA 4XRSG 2XKOA 3JRGA 1ZGWA 2QWWA 1I27A 2AQEA 3QU3A 3BTIA 3OYHA 2ID3A 2O3FA 3CF5F 1WJCA 3BR3A 1U3EM 1GT0C 3HIMA 1WQ2A 4C3HJ 5FD5A 2QVOA 2HI3A 2HR3A 2HYJA 2DK5A 4HSRA 5J40A 1BJZA 2FRHA 3F72A 3LAJA 1S29A 3DXJF 2HYGD 1S9HA 3CESA 4BJTA 4FHTA 4UV9A 3WE3A 1XDUA 1E3PA 1XSXA 5C4YA 2L3DA 1BBYA 1EJ9A 3A03A 1JJ6C 2DT6A 2HEOA 2ZCXA 3CRJA 4AC6A 4EM1A 3CD6I 1IUFA 3V7RA 2OQGA 2JN6A 2EJRA 2ZY9A 3PQKA 4QSHA 3MAJA 5J1RA 1RUNA 1S8NA 5HLGA 3W2WA 2ZOZA 2MC4A 3EYIA 4M3FA 1LFBA 2ESNA 3HSFA 1LJ9A 2MYSA 1TT0A 2WC2A 2Z1DA 4ENKA 3RKXA 3GO5A 2OU2A 4CYCA 3FKIJ 4EJTA 2GIVA 2JTVA 1Y1WJ 3K69A 5CKTA 1TBXA 2DYSH 2QF7A 3RZDJ 3HTSB 4CGRA 1RUOA 3V8KA 2FJ1A 3HE0A 4G6QA 3P9CA 1UZCA 2F4MB 4L5JA 3FMSA 2HDDA 1ZRCA 2FD5A 4BJ5C 4ZZLA 3CCJI 3S2DJ 2NP5A 4NQWA 3ANGA 1X1PA 1USTA 1ZYRF 3DTEA 4PJ0C 2Q1ZB 5ED4A 4B47A 2CGPA 4OMZA 1P4AA 4YEJA 2B1EA 2IEKA 2UV1A 3HHHA 2QWTA 3V42A 4KJZA 4R1HA 3A2KA 5LD2C 2AXLA 2P7VB 5KAIC 5E1ZB 3FHZA 3S1QJ 3MFKA 2V4JC 4OD5A 4IO9F 2DMPA 3FXRA 2FBHA 1OQYA 4NNJA 3KETA 1QQIA 1F5TA 4P9FA 2R5YB 1Z0XA 2FF4A 2VBZA 4P55A 4G7HF 2R7XA 3F3XA 5DAJA 3HRUA 2L0KA 4A0ZA 4Y3OA 3AG1H 2YSRA 2FQ3A 3EUHA 3ZRGA 2HOSA 3ZQHA 2VIXA 3G7RA 3E5UA 4JP0A 4PUSA 5FKKA 3MWMA 2H6CA 4GXOA 1NG6A 1DP7P 2G9WA 5CVIA 4Y17A 2KPMA 5IP6A 1MNDA 2G0EA 2W57A 1CF7B 1E2XA 1ETWA 1D5VA 3SDGA 3K8PC 2DG7A 4BXUA 2H94A 3FK6A 3S32A 2CV1A 3VEPA 1D5YA 2H1KA 3T6NA 1R23A 5K5RA 1BIBA 2C6YA 2NVYJ 5ERIA 1IC8A 5EG0B 1V3FA 1OCCH 1MMAA 4P5OA 2RREA 1ETOA 3ON4A 3H9QA 1JJ8C 2E35A 1HXDA 2DLLA 4DJAA 2EA2A 4XLEA 3KEQA 1DGRM 3S1NJ 3R60A 2DT7B 3K9TA 4PJMA 5M5YJ 3JRDA 3HOSA 1QGPA 1XMKA 4B44A 4A3DJ 3SEZA 3IUOA 4BBSJ 3HTJA 4KN7X 2YVEA 3VOXA 2F5VA 1YYVA 4C9YA 5GAGJ 5ILVA 2G7LA 4LD5A 2PN6A 2ZCMA 1USSA 5J1YA 4BXFA 3RPUA 3IKVA 1FSEA 3CWRA 2WV0A 3DBRB 1D1AA 3HG9A 3QBMA 4XK4A 2RVCA 3PL8A 1BL0A 3S3MA 4U0YA 2E7XA 1ZARA 3K4LA 3LL7A 2L02A 2LK2A 2QOPA 3DU6A 5F1JA 3ZXSA 2JPCA 5TJJA 5CXGA 3LSMA 3K1PA 1WSUA 1R71A 3LSIA 3EGQA 1TC3C 4W97A 3O2PE 3JAMZ 3J7AO 3BNIA 1KU2A 4LG0B 4N9IA 2F4OB 3GWZA 1W7PB 4UVAA 1MBJA 1MH3A 2ECBA 2JVGA 2O7TA 3FF5A 1MJAA 2CV2A 4CICA 1Y1VJ 2DI3A 1JUMA 2KLOA 5JR3A 5ICCA 4UUSA 3O8GA 2EFNA 2BVMA 4E7ZA 3NXCA 1GV5A 1FZPB 2GZWA 3OIOA 3T1BA 4CYCB 3GFJA 1RC9A 3KX2A 2Q24A 4XBFA 5LHIA 3Q0WA 1ZRFA 2CJJA 1VQPI 1HC8A 4XLCA 3COLA 1P7IA 3ZN1A 2CW7A 2A3SA 2HS5A 4ZYGA 3WTWC 2WTEA 1FBSA 1G3WA 4ON0A 2CQNA 1FLIA 1J2XA 1I50J 1Y8RB 2M87A 3TO7A 4Y13A 1LUJB 2R7SA 2JA5J 3AG3H 1VQLI 5HLIA 1YO5C 4M3DA 1E3OC 2JA2A 2ID6A 3K0LA 1W36D 1ZQ3P 5FKNA 2HVQA 1JGSA 1WGXA 1MD0A 1A36A 3ZN0A 2QSGX 2XDVA 4IRHA 3HC7A 5BQTA 1BIAA 5FB2A 3K10A 2D2WA 2VC0A 5IOYA 4ABZA 4Y52J 4M9ZA 2YU3A 3PSFA 2KIQA 4PZJA 3L00A 3I53A 3LSKA 3M1EA 2EB7A 1WFXA 1A6IA 1ZLJA 3R61A 4IQJA 2VASA 2JSCA 3E6CC 3GZ5A 3VVYA 2DT5A 1YX3A 1GDTA 4L9JA 3E3VA 2QEXI 4D5FA 2DJNA 1IRFA 1OCRH 4OIPF 2BXYA 1KU9A 1TTYA 3AQTA 2DO7A 2JMWA 2ZB9A 2DFEA 3BR5A 2L7KA 3O3KA 4NC7A 3ULQB 4C3IJ 1W0UA 4A5NA 3HSRA 2Y0MA 4CCMA 2DODA 1VZ0A 2M0MA 4I0BA 1YIOA 2XB0X 3C3WA 5FD6A 2B9SA 4HNTA 5IPAA 4CCKA 2KFDA 2RNJA 5K7FA 1OYWA 2PMHA 1H8AC 3F8CA 1XC5A 5B5EC 4M71A 3OY9A 2HTSA 4ZYEA 3CC4I 5K7HA 5LFAA 1LKXA 4RDUA 4BDYA 1APLC 4LOCA 1J09A 2CH0A 4U9LA 4KFCA 2XAHA 3JW4A 1S7OA 5HDGA 1K6OA 2CWEA 1LEAA 4ZDPA 1ONVA 1M1EB 4M6VA 4YIFA 2MW8A 5HDKA 4UY8I 4HAMA 3OYJA 4DZPA 2O8XA 1FBQA 5FKMA 4C2MJ 1UB9A 3BZKA 3HGGA 2EINH 1OKRA 3FWEA 3S15J 2L01A 2FMLA 2ZXWH 4BAYA 2PX9A 5M5XJ 1Z05A 4HQMA 3TW6A 2VBXA 2NNYA 3S5RA 4N4OB 4V2FA 2VKDA 2LRDA 1X1BA 1HW1A 4BJ6C 1YRNB 2DOEA 1U2WA 2MG4A 5E1WA 4F7ZA 2XIGA 1YOVB 4EEFG 3R0JA 2BY2A 3ZP5A 1D0YA 3VYRB 3K2AA 3KYLA 5FRNA 4WXHA 2LH9A 1P6RA 5HOOA 2Y31A 1I6HJ 1F43A 1UFMA 2KJCA 5L3EA 3BTLA 2VOPA 3QAHA 2R7VA 2LKSA 1QBJA 2JK3A 5DS9A 2H09A 5EJCA 4FQGA 4AIKA 5JVTA 3PNVA 3ECOA 4MTDA 1ETYA 1LNWA 3L09A 4G7OF 2KT0A 4ZDOA 4BE1A 1T2KA 2YVXA 3TMOA 2R7WA 1IGNA 3ZMTA 1BR2A 3NARA 4BY1J 2FBQA 1R4NB 1T98A 5HLTA 1FPQA 2Q8KA 3G71I 1W36C 1H9TA 2ECCA 1QVUA 4M3BA 3KE2A 3HL2A 1IJWC 2XAQA 4AVPA 2VLAA 3O8HA 3CCSI 5HNHA 1U6GA 5CVVA 1TNTA 1BN5A 2PI0A 1O3RA 2X6OA 3LWFA 3BR2A 3VSKA 1VFCA 5L3CA 2YR2A 3FBNB 3SZTA 3BJBA 3OL3A 2LFBA 2EQRA 4G9YA 1VQMI 5BOXA 3M8FA 1NTCA 1SC7A 4BL0B 1DU0A 3ML6A 1K7AA 4QWQA 1R22A 2ZO4A 4L5IA 5EEHA 2K02A 1FYKA 2XF5A 4HEA2 1P2FA 2KZGA 4OOIA 4HLYA 4XRFA 1FP2A 4IQ4A 1ZGJA 2VQHA 4AC0A 5GTIC 1HSJA 1JI8A 2MH9A 3GFIA 3AG2H 1S7AA 3OWTA 3KP4A 5JFRA 2DFFA 5FLXK 1WCMJ 3DEUA 4UB6C 1KONA 3Q0UA 2TCTA 4IHYA 4FETA 3DKYA 1TNSA 4LB6B 3S8PA 3V8JA 4G7ZF 2F5EA 3HPGA 1XD7A 1TWCJ 5JLWA 2JRMA 2K9SA 3CUQB 4L62A 2X85A 3P7NA 2DBBA 4FISA 2KMUA 3P5JA 2KQRA 4XLNF 1BI3A 4OINF 3U1KA 1IXCA 2EFOA 2F48A 4UXNA 3WE2A 4AUXA 1SFOJ 2KISA 2NYXA 2TRTA 1RESA 3DEWA 4BGDA 1MDMA 1CQTA 4JYKA 1A5JA 2CUFA 3OOUA 1XSVA 3OS2A 4BQOA 5TRDA 4PSWA 2V1UA 2LBFA 3MQ0A 3PSIA 1ZAOA 4A93J 3OIQA 1GUUA 1E0EA 2CFXA 2K27A 3ZQ7A 1PP8F 2VJ4A 4LMYA 2H27A 2DYRH 2MA3A 3DEEA 3F6OA 2B7EA 4I98B 3BCBA 5D6EA 4XLPF 3KZYA 3IH2A 1IRGA 4U7DA 3F8BA 3HZJA 2WAQA 1FNNA 3HSEA 3BG9A 2LKPA 4BE2A 4Y7NJ 5HBUA 3LSTA 2ZC2A 1D0XA 1OFCX 3FMQA 4DZJA 4GFLA 2RQPA 3F9KA 4BUPA 3S2HJ 4DYRA 1D1CA 2LD5A 2XHKA 1O7LA 3DP7A 2FXAA 2EFPA 4RGXA 2ADUA 2ME0A 4BHCA 1KA8A 1TQIA 2HXOA 3MKLA 4E6KG 1U5TB 2W84A 3J81K 4BNCA 2VUMJ 5HVQC 2XASA 4YRVA 2E60A 5EEGA 2G7SA 2UXIA 1OR7A 1IV8A 3BG6A 3EUKL 1JKRC 1QVTA 4RS8A 5HDNA 2WV1A 5IYBJ 4QPOA 1R1VA 1JTXA 5DD4A 2L9NA 1B4AA 2DMNA 1NG7A 5CQGA 2DW4A 1IG7A 2O8KA 3VB2A 1BR4A 4EM0B 3BG7A 5IY5H 3WTYC 2ZMEB 2KRHA 1VQKI 4PCQA 5E8IA 3NRGA 2PMUA 2DMTA 2A07F 2KKOA 2W25A 2JA7J 1T08B 2V6EA 4EGYA 4MHGA 4PXIA 4WXCA 3LQRA 5M3FJ 3DBLB 3QPHA 3WGGA 1BW6A 3HIFA 1ZG1A 5GAHJ 2IS4A 1Z91A 1BI1A 3NWSA 1RIOH 4AF5A 1IW7F 1WJ5A 3HRTA 4F93B 1I1SA 4PDKA 4PFPA 3BTCA 3NI7A 4O5VA 3QODA 2PBXA 4GYGA 1B9MA 3KP5A 2F5DA 4A6EA 4AM3A 3BRUA 3VFZA 5D5UB 1UHWA 2ZXJA 3BR6A 4E7KA 2HQ5A 3K4JA 1IXRC 4P1WA 3M7GA 4A3BJ 2DFIA 1XCBA 3VPRA 4HNUA 3OS0A 2QZ8A 1P4WA 4IL6C 2P5VA 5A2QZ 3BHQA 3GFLA 1Z9CA 3VYTB 4BKXA 3JREA 1FYLA 5L3BA 1IRXA 2W82A 3MMYB 4CHUA 3VOKA 2BVLA 1UAAA 5KK1A 3CJDA 1WI9A 1XG1A 1YJ9I 4MEYF 4A3GJ 2DA1A 2IGOA 4A3KJ 4HDVA 4DGWB 4IRVA 2BXZA 1X3WB 2EA4A 2VQLA 4DVYP 2X6WA 4HX8A 4F92B 1AU7A 4RMNA 2PEXA 2E1NA 4AVZA 2NVXJ 1NK3P 1FP1D 3IHUA 5D6FA 5J6XA 3S93A 3IH4A 2M7BA 4C3JJ 1SFEA 1XCVA 3KYDB 2PFVA 2YPRA 2HOTA 2NOGA 1QU3A 2MC3A 3H5AA 3QOPA 3GFMA 2QKOA 2FE3A 1JTYA 2DU9A 2YUSA 4A3CJ 4XR6A 4TV7A 5LRRA 3BQZA 1R7JA 3OYLA 2PJRA 3RQIA 2DMQA 2HU9A 4F3QA 2VONA 2BYVE 3SFIA 1X1AA 2FSWA 3QU6A 5GTHC 4RB3C 1MJBA 4YELA 4WX9A 3MZYA 3X2QH 4AWXB 5DUIA 2KIMA 1WWXA 3HKZN 5DEQA 2QSHX 1NHAA 2QYOA 3ABMH 5ILUA 2XF7A 2Z2SB 3GF2A 4JX6A 3EUPA 5D5WB 2OF7A 1U0JA 3PASA 1GVJA 4IHVA 1MMNA 2O7OA 5E3NA 4KA4A 1MGTA 1XGMA 5E3OA 4CGZA 4B4CA 1IO2A 1OMIA 5C3EJ 4EQQA 1Z6RA 3LFUA 1QPMA 3HKZA 3I59B 4V2GA 2ELKA 5FLMJ 3TW7A 5LRSA 4WCGA 1TZLA 4BQQA 2OI8A 3W2VA 3ZMZA 2JSPA 1D1BA 1I6XA 2V9KA 4AU7A 3MZHA 1XB4A 3CMAI 3D5SC 1FIAA 2PFBA 2Q2EB 2ZSIB 3K1MA 2GM4A 2M30A 2STWA 2VOOA 2DQLA 5LGTA 2VKVA 1IN8A 2R93J 2VKEA 5M5WJ 3I64A 3CDIA 3WU1B 4L18B 4XKCA 1UHMA 3GTOJ 3A0BC 4LGWA 4E7SA 2BY0A 4A0YA 2QBYB 1XTAA 1T0FA 1HKTA 2IBDA 2IU5A 4JKZA 1QZZA 3HTUA 4XQFA 3C2HA 3ZQLA 5F0CA 4GGGA 2KL4A 1HA8A 5HNFA 4Y15A 1HDPA 2IS6A 1JHFA 2M3AA 3C18A 5F04A 5GADJ 1H89C 4FCYA 3HYIA 3CJRB 4A69C 1FMWA 2DA3A 3J7AY 1MKMA 1SD7A 4EJUA 3ELKA 2Z33A 3M4OJ 5L3GA 5CVRA 2CV0A 3AFHA 2X1EA 4GO1A 1MZBA 3JTGA 2UXOA 3O6BB 2GLOA 4WWCA 2KDZA 2VPLA 4D7NA 2H8WA 2TDXA 2L9SA 4V19K 2KHMA 4CH7A 1MNMC 3RIRA 2V1DA 2HKXA 3DWLE 3I58A 1F36A 4AD9A 5ICGA 5FRMA 2GA2A 4HSTA 4LK0F 3GTGJ 3NEUA 2NX4A
chains in the Genus database with same CATH topology
1RKWA 3HTHA 1OJLA 2JA8J 1ZTRA 3MVPA 2XGDA 2JA6J 4MIMA 3GTLJ 5HSZA 5IYDJ 5IOYA 1ZK8A 4ABZA 4RBOA 1HCRA 1QRYA 4Y52J 3P9TA 3NNRA 4A3LJ 3KNWA 2E19A 2GUHA 5FGLA 1A6IA 2YS9A 1ETKA 2CU7A 3VVYA 5C4JJ 1GDTA 2WB1N 4MK6A 2UXHA 4D5FA 2DJNA 2K9NA 3AQTA 1MBGA 2CRGA 3FIWA 2JMWA 2ZB9A 3BR5A 1W0UA 3T6NA 4C3IJ 3MNLA 3JRIA 2RAEA 2DA2A 5EZGA 1XS9A 1SANA 2R5YA 4JX5A 5JLXA 2Y0SN 1IDYA 2RHAA 2NS8A 1SGMA 2XB0X 3GTMJ 3B6CA 1JKPC 5IPAA 5DTDA 5K7FA 3HTAA 1H8AC 1H88C 2WAQN 1XC5A 2GBYA 3K7AJ 3WHCA 2R7ZJ 1ZKGA 5K58A 3LSPA 1UMQA 5K7HA 5F0HA 4RDUA 2E2IJ 1Z77A 1APLC 3HBLA 4LOCA 4GFKA 1WH5A 2EH3A 4AYBN 2NP3A 1T33A 3Q3SA 4I76A 3A02A 4M6VA 2MW8A 1RETA 3D1NI 4DZPA 1I3QJ 1JGGA 3QKXA 1LE8A 5FKMA 4C2MJ 3VW1A 3IV5A 3HGGA 3H0GJ 4D7MA 3VUQA 2W48A 3E7QA 3S15J 2EZKA 2UXUA 2I10A 5EG0A 2L9RA 1WPKA 3TW6A 3WHBA 5M5XJ 3SJMA 1B8IB 3S5RA 4V2FA 3VVZA 1YRNB 4QTRA 1U9OA 2MG4A 3G1OA 4EEFG 4G12A 1UI6A 3K2AA 1WH7A 5FLVA 2N8GA 2D5VA 1Q1VA 5E3LA 4J19A 2Y31A 1I6HJ 1RR7A 1OCTC 1F43A 4GCKA 4QIWN 4NN1A 3JRCA 3BTLA 4M3EA 3JR9A 3KKCA 2DG8A 1G2HA 2JJ7A 2JK3A 5DS9A 3PO2J 2W53A 2FQ4A 1AHDP 1PUFA 2B63J 4B1RA 1ETYA 3GTJJ 2MSYA 5EYRA 2WUIA 2KT0A 2COBA 5K7ZA 3C2BA 3VVXA 3HTIA 2DA7A 3A01A 4JNNA 1IGNA 3NARA 4YZEA 4ACIA 3LSGA 4BY1J 2FBQA 1POGA 3OSFA 5AQCA 4GCTA 5EGOA 1X58A 2ECCA 3HM5A 1X2NA 1QVUA 4M3BA 5FKOA 1IJWC 1HLVA 3BG5A 3O8HA 1K61A 3ZQFA 4IHXA 3HOWJ 2X6OA 1ZR2A 3HB9A 2PZ9A 3BR2A 3AQSA 3VP5A 3TP3A 1VFCA 2G7GA 3G1MA 2DMUA 4S0HB 2CQQA 3BQYA 3BJBA 4W1UA 1JT0A 2LTPA 2LFBA 4BXXJ 3G56A 5M3MJ 3ON2A 2EQRA 2LLKA 1U8BA 4DYQA 3PO3J 1NTCA 2HKUA 2G3BA 3ZQCA 1DU0A 4DYCA 4UDSA 1P7JA 3GTKJ 2OERA 4GCLA 3OSGA 1B72A 2PMZN 3F1BA 4B3AA 4XRSA 5IOZA 1FTZA 3C07A 1VI0A 2YVHA 4AC0A 1BA5A 2FX0A 5F0FA 2HOAA 1ETQA 3HOVJ 4DW6A 5EDNA 2VPRA 5EZHA 2LKXA 2CQXA 5D1RA 3RH2A 1UI5A 3ANPA 1WCMJ 3QPLA 3DPJA 5EFYA 1TWAJ 4IEJA 3Q0UA 2TCTA 4MFDA 4IHYA 2HXIA 2XPVA 3GTPJ 1ETVA 2XPUA 2E2JJ 2R5ZA 2XPWA 4KWAA 1TWCJ 5JLWA 3FISA 2K9SA 2DTZA 3GTQJ 4L62A 1UHSA 2Y2ZA 3ZQIA 3HOUJ 4FISA 3L1PA 4A3EJ 3F0CA 3JRHA 4ICHA 1U78A 4AUXA 1SFOJ 1S7EA 2TRTA 2IAIA 1RESA 3DEWA 5FKLA 2ZCNA 3V6GA 2NS7A 1CQTA 3B81A 4JYKA 1U9NA 1JKQC 1RPWA 1ENHA 2LP0A 1HF0A 2CUFA 1A5JA 3OOUA 5EEAA 4A3FJ 4XICA 2M2EA 3BCGA 4A93J 2P81A 1GUUA 2ZOYA 3B6AA 3HOXJ 5IYCJ 3V78A 2DN0A 5E3MA 3QQAA 3NPIA 1LE8B 1OCPA 1WI3A 3IH2A 2DA4A 2REKA 3LJLA 3ZOBA 9ANTA 3CDLA 2XRLA 3JRFA 3BG9A 3TEDA 4Y7NJ 2M34A 1FIPA 5HBUA 1OFCX 4DZJA 1ZR4A 4HKUA 4GFLA 4ME9A 1VF9A 3JRAA 3S2HJ 4DYRA 5CXIA 1T56A 2Y9YA 3BTJA 1K83J 5IP9J 2LR8A 2LD5A 2RASA 2Y30A 1LFUP 2NX4A 2L7ZA 3BG3A 1GV2A 3GZIA 4IHWA 1W0TA 4MXMA 2ME0A 2CUEA 2NVQJ 2HXOA 3MKLA 5C4XJ 2VUMJ 2K40A 4UUTA 4A3IJ 1AKHB 2XGCA 5FMPA 3JRGA 4XRSG 1JT6A 1ZGWA 1MBKA 1IV6A 1MBHA 2G7SA 2UXIA 3BTIA 2JWTA 3DCFA 1JKRC 5HAWA 4HNVA 2QCOA 1QVTA 1B8IA 3I4NJ 3IUVA 3O60A 5D19A 2WV1A 5IYBJ 1PUFB 1JTXA 2ID3A 2DMNA 1GT0C 3BR3A 1JKOC 1YRNA 3HIMA 4C3HJ 1MSEC 5EF6A 2HI3A 1IG7A 1IRZA 2HYJA 3CQZJ 2O8KA 1BJZA 4UUSB 3NRGA 2DMTA 2JA7J 2DA5A 3PM1A 2OPTA 3S14J 4PXIA 5C4YA 3Q0VA 2XSDC 5FJ8J 5M3FJ 1BW6A 4I6ZA 5CW8A 5D18A 3A03A 3CCYA 1JJ6C 2ZCXA 1IDZA 1ORKA 4AF5A 3CRJA 4AC6A 1IUFA 5BNGA 2JN6A 3ZQGA 3HGYA 2UXPA 4QSHA 3BTCA 5J1RA 3NI7A 5IP7J 1HOMA 1JUSA 2PBXA 2ZOZA 3KKDA 3LOCA 4NDLA 3S1MJ 4M3FA 4GFBA 1LFBA 2XGEA 1MSFC 2LVSA 2M9HA 3BRUA 5GPCA 2EZIA 3FKIJ 4CYCA 2EZHA 2X9DA 3BR6A 1RKTA 1ETXA 1Y1WJ 2HQ5A 2M0CA 4A3BJ 2QF7A 3VPRA 3RZDJ 1TWHJ 2H8RA 4CGRA 2FJ1A 3HE0A 3BHQA 2WGBA 4BKXA 3JREA 2LY9A 2R92J 1EF4A 2HDDA 2FD5A 3S2DJ 2NP5A 3ANGA 3VOKA 3CJDA 1XG1A 4A3GJ 5F27A 2DA1A 4A3KJ 4D5CA 4XIDA 1JUPA 3BR1A 2IEKA 2QWTA 2MGQA 1ITYA 3NAUA 3S1QJ 2O9LA 2ME6A 3S16J 2DMPA 4FE7A 2GFNA 2YU9J 1R9TJ 1AU7A 2DA6A 2R5YB 3GBGA 1Z0XA 3IH3A 2NVXJ 5J1UA 2AO9A 3TP0A 5C44J 1QPIA 3GEUA 1NK3P 3KZ9A 2L0KA 5DAJA 4BY7J 2HOSA 5FHPA 3ZQHA 1O4XA 3G7RA 2VI6A 4JP0A 3IH4A 4C3JJ 3FK7A 5FKKA 2HYTA 3RD3A 3LSRA 4A3JJ 3HEFA 5IP6A 2G0EA 3BT9A 2HOTA 2NOGA 2Y9ZA 1UG2A 4MFEA 3H3VK 1ETWA 3SDGA 3RKQA 2DG7A 2QKOA 4A3MJ 1FJLA 1JTYA 3FK6A 1X2MA 2YUSA 4A3CJ 4NELA 1MBFA 3BQZA 1D5YA 2H1KA 3RQIA 2NVYJ 2DMQA 1IC8A 3SFIA 4MO7A 5EG0B 2R0QC 3HOZJ 3S1RJ 3E7LA 1ETOA 5HODA 3FRQA 3ON4A 3HKZN 3HOYJ 1JJ8C 3JSJA 2M8GX 5GPAA 1FEXA 3LSJA 2EZLA 3RZOJ 2GENA 4JX6A 3G1LA 3EUPA 3S1NJ 2OF7A 3PASA 5M5YJ 4IHVA 3JRDA 4BBRJ 2O7OA 2AHQA 5E3NA 5E3OA 1HDDC 4A3DJ 4BBSJ 5J3LA 3M3YJ 2YVEA 4B4CA 3HTJA 3BR0A 3VOXA 1NK2P 5C3EJ 4JX4A 2G7LA 2ZCMA 2F07A 4V2GA 2ELKA 5J1YA 5FLMJ 4FE4A 3TW7A 3CWRA 1FTTA 2OI8A 2V57A 3W6VA 3QBMA 4XK4A 3S17J 1BL0A 3MN2A 1FIAA 3A01B 2X48A 4M3GA 2GM4A 1GVDA 2LK2A 2QOPA 4FTHA 5F1JA 5EGOB 1AKHA 3VW2A 2E1OA 5CXGA 3VW0A 2VKVA 2R93J 2D6YA 2VKEA 5M5WJ 3GTOJ 1TC3C 2QTQA 3EGQA 4W97A 2L7MP 4MLOA 4XRMA 5GP9A 3BNIA 2IU5A 2IBDA 4JKZA 2E2HJ 2L7FP 2K9QA 3ZQLA 1MBJA 1MH3A 2ECBA 3QPSA 4X1EA 5F0CA 3VIBA 5H9TA 2O7TA 1Y1VJ 2XDNA 1JUMA 3PPBA 1HDPA 1DU6A 1MBEA 3LNQA 1TWGJ 4UUSA 3O8GA 1VNDA 3UKGA 3NXCA 1GV5A 5F04A 3OIOA 4FCYA 1H89C 4CYCB 2Q24A 3LWJA 4A69C 2DA3A 3Q0WA 3M4OJ 2CJJA 2EBIA 1B72B 3COLA 1P7IA 4L5EA 3HDDA 2NVTJ 2UXOA 2GLOA 2KDZA 4D7NA 4JL3A 4X6AJ 1I50J 2QIBA 2JA5J 1MNMC 5F08A 3GTGJ 4M3DA 1BW5A 3LHQA 1E3OC 1F36A 2ID6A 1TWFJ 3CMYA 2XB5A 1ZQ3P 1MH4A 5FKNA 1WGXA 2R5ZB 3I4MJ 3JRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKW A;  3HTH A;  1OJL A;  2JA8 J;  1ZTR A;  3MVP A;  2XGD A;  2JA6 J;  4MIM A;  3GTL J;  5HSZ A;  5IYD J;  5IOY A;  1ZK8 A;  4ABZ A;  4RBO A;  1HCR A;  1QRY A;  4Y52 J;  3P9T A;  3NNR A;  4A3L J;  3KNW A;  2E19 A;  2GUH A;  5FGL A;  1A6I A;  2YS9 A;  1ETK A;  2CU7 A;  3VVY A;  5C4J J;  1GDT A;  2WB1 N;  4MK6 A;  2UXH A;  4D5F A;  2DJN A;  2K9N A;  3AQT A;  1MBG A;  2CRG A;  3FIW A;  2JMW A;  2ZB9 A;  3BR5 A;  1W0U A;  3T6N A;  4C3I J;  3MNL A;  3JRI A;  2RAE A;  2DA2 A;  5EZG A;  1XS9 A;  1SAN A;  2R5Y A;  4JX5 A;  5JLX A;  2Y0S N;  1IDY A;  2RHA A;  2NS8 A;  1SGM A;  2XB0 X;  3GTM J;  3B6C A;  1JKP C;  5IPA A;  5DTD A;  5K7F A;  3HTA A;  1H8A C;  1H88 C;  2WAQ N;  1XC5 A;  2GBY A;  3K7A J;  3WHC A;  2R7Z J;  1ZKG A;  5K58 A;  3LSP A;  1UMQ A;  5K7H A;  5F0H A;  4RDU A;  2E2I J;  1Z77 A;  1APL C;  3HBL A;  4LOC A;  4GFK A;  1WH5 A;  2EH3 A;  4AYB N;  2NP3 A;  1T33 A;  3Q3S A;  4I76 A;  3A02 A;  4M6V A;  2MW8 A;  1RET A;  3D1N I;  4DZP A;  1I3Q J;  1JGG A;  3QKX A;  1LE8 A;  5FKM A;  4C2M J;  3VW1 A;  3IV5 A;  3HGG A;  3H0G J;  4D7M A;  3VUQ A;  2W48 A;  3E7Q A;  3S15 J;  2EZK A;  2UXU A;  2I10 A;  5EG0 A;  2L9R A;  1WPK A;  3TW6 A;  3WHB A;  5M5X J;  3SJM A;  1B8I B;  3S5R A;  4V2F A;  3VVZ A;  1YRN B;  4QTR A;  1U9O A;  2MG4 A;  3G1O A;  4EEF G;  4G12 A;  1UI6 A;  3K2A A;  1WH7 A;  5FLV A;  2N8G A;  2D5V A;  1Q1V A;  5E3L A;  4J19 A;  2Y31 A;  1I6H J;  1RR7 A;  1OCT C;  1F43 A;  4GCK A;  4QIW N;  4NN1 A;  3JRC A;  3BTL A;  4M3E A;  3JR9 A;  3KKC A;  2DG8 A;  1G2H A;  2JJ7 A;  2JK3 A;  5DS9 A;  3PO2 J;  2W53 A;  2FQ4 A;  1AHD P;  1PUF A;  2B63 J;  4B1R A;  1ETY A;  3GTJ J;  2MSY A;  5EYR A;  2WUI A;  2KT0 A;  2COB A;  5K7Z A;  3C2B A;  3VVX A;  3HTI A;  2DA7 A;  3A01 A;  4JNN A;  1IGN A;  3NAR A;  4YZE A;  4ACI A;  3LSG A;  4BY1 J;  2FBQ A;  1POG A;  3OSF A;  5AQC A;  4GCT A;  5EGO A;  1X58 A;  2ECC A;  3HM5 A;  1X2N A;  1QVU A;  4M3B A;  5FKO A;  1IJW C;  1HLV A;  3BG5 A;  3O8H A;  1K61 A;  3ZQF A;  4IHX A;  3HOW J;  2X6O A;  1ZR2 A;  3HB9 A;  2PZ9 A;  3BR2 A;  3AQS A;  3VP5 A;  3TP3 A;  1VFC A;  2G7G A;  3G1M A;  2DMU A;  4S0H B;  2CQQ A;  3BQY A;  3BJB A;  4W1U A;  1JT0 A;  2LTP A;  2LFB A;  4BXX J;  3G56 A;  5M3M J;  3ON2 A;  2EQR A;  2LLK A;  1U8B A;  4DYQ A;  3PO3 J;  1NTC A;  2HKU A;  2G3B A;  3ZQC A;  1DU0 A;  4DYC A;  4UDS A;  1P7J A;  3GTK J;  2OER A;  4GCL A;  3OSG A;  1B72 A;  2PMZ N;  3F1B A;  4B3A A;  4XRS A;  5IOZ A;  1FTZ A;  3C07 A;  1VI0 A;  2YVH A;  4AC0 A;  1BA5 A;  2FX0 A;  5F0F A;  2HOA A;  1ETQ A;  3HOV J;  4DW6 A;  5EDN A;  2VPR A;  5EZH A;  2LKX A;  2CQX A;  5D1R A;  3RH2 A;  1UI5 A;  3ANP A;  1WCM J;  3QPL A;  3DPJ A;  5EFY A;  1TWA J;  4IEJ A;  3Q0U A;  2TCT A;  4MFD A;  4IHY A;  2HXI A;  2XPV A;  3GTP J;  1ETV A;  2XPU A;  2E2J J;  2R5Z A;  2XPW A;  4KWA A;  1TWC J;  5JLW A;  3FIS A;  2K9S A;  2DTZ A;  3GTQ J;  4L62 A;  1UHS A;  2Y2Z A;  3ZQI A;  3HOU J;  4FIS A;  3L1P A;  4A3E J;  3F0C A;  3JRH A;  4ICH A;  1U78 A;  4AUX A;  1SFO J;  1S7E A;  2TRT A;  2IAI A;  1RES A;  3DEW A;  5FKL A;  2ZCN A;  3V6G A;  2NS7 A;  1CQT A;  3B81 A;  4JYK A;  1U9N A;  1JKQ C;  1RPW A;  1ENH A;  2LP0 A;  1HF0 A;  2CUF A;  1A5J A;  3OOU A;  5EEA A;  4A3F J;  4XIC A;  2M2E A;  3BCG A;  4A93 J;  2P81 A;  1GUU A;  2ZOY A;  3B6A A;  3HOX J;  5IYC J;  3V78 A;  2DN0 A;  5E3M A;  3QQA A;  3NPI A;  1LE8 B;  1OCP A;  1WI3 A;  3IH2 A;  2DA4 A;  2REK A;  3LJL A;  3ZOB A;  9ANT A;  3CDL A;  2XRL A;  3JRF A;  3BG9 A;  3TED A;  4Y7N J;  2M34 A;  1FIP A;  5HBU A;  1OFC X;  4DZJ A;  1ZR4 A;  4HKU A;  4GFL A;  4ME9 A;  1VF9 A;  3JRA A;  3S2H J;  4DYR A;  5CXI A;  1T56 A;  2Y9Y A;  3BTJ A;  1K83 J;  5IP9 J;  2LR8 A;  2LD5 A;  2RAS A;  2Y30 A;  1LFU P;  2NX4 A;  2L7Z A;  3BG3 A;  1GV2 A;  3GZI A;  4IHW A;  1W0T A;  4MXM A;  2ME0 A;  2CUE A;  2NVQ J;  2HXO A;  3MKL A;  5C4X J;  2VUM J;  2K40 A;  4UUT A;  4A3I J;  1AKH B;  2XGC A;  5FMP A;  3JRG A;  4XRS G;  1JT6 A;  1ZGW A;  1MBK A;  1IV6 A;  1MBH A;  2G7S A;  2UXI A;  3BTI A;  2JWT A;  3DCF A;  1JKR C;  5HAW A;  4HNV A;  2QCO A;  1QVT A;  1B8I A;  3I4N J;  3IUV A;  3O60 A;  5D19 A;  2WV1 A;  5IYB J;  1PUF B;  1JTX A;  2ID3 A;  2DMN A;  1GT0 C;  3BR3 A;  1JKO C;  1YRN A;  3HIM A;  4C3H J;  1MSE C;  5EF6 A;  2HI3 A;  1IG7 A;  1IRZ A;  2HYJ A;  3CQZ J;  2O8K A;  1BJZ A;  4UUS B;  3NRG A;  2DMT A;  2JA7 J;  2DA5 A;  3PM1 A;  2OPT A;  3S14 J;  4PXI A;  5C4Y A;  3Q0V A;  2XSD C;  5FJ8 J;  5M3F J;  1BW6 A;  4I6Z A;  5CW8 A;  5D18 A;  3A03 A;  3CCY A;  1JJ6 C;  2ZCX A;  1IDZ A;  1ORK A;  4AF5 A;  3CRJ A;  4AC6 A;  1IUF A;  5BNG A;  2JN6 A;  3ZQG A;  3HGY A;  2UXP A;  4QSH A;  3BTC A;  5J1R A;  3NI7 A;  5IP7 J;  1HOM A;  1JUS A;  2PBX A;  2ZOZ A;  3KKD A;  3LOC A;  4NDL A;  3S1M J;  4M3F A;  4GFB A;  1LFB A;  2XGE A;  1MSF C;  2LVS A;  2M9H A;  3BRU A;  5GPC A;  2EZI A;  3FKI J;  4CYC A;  2EZH A;  2X9D A;  3BR6 A;  1RKT A;  1ETX A;  1Y1W J;  2HQ5 A;  2M0C A;  4A3B J;  2QF7 A;  3VPR A;  3RZD J;  1TWH J;  2H8R A;  4CGR A;  2FJ1 A;  3HE0 A;  3BHQ A;  2WGB A;  4BKX A;  3JRE A;  2LY9 A;  2R92 J;  1EF4 A;  2HDD A;  2FD5 A;  3S2D J;  2NP5 A;  3ANG A;  3VOK A;  3CJD A;  1XG1 A;  4A3G J;  5F27 A;  2DA1 A;  4A3K J;  4D5C A;  4XID A;  1JUP A;  3BR1 A;  2IEK A;  2QWT A;  2MGQ A;  1ITY A;  3NAU A;  3S1Q J;  2O9L A;  2ME6 A;  3S16 J;  2DMP A;  4FE7 A;  2GFN A;  2YU9 J;  1R9T J;  1AU7 A;  2DA6 A;  2R5Y B;  3GBG A;  1Z0X A;  3IH3 A;  2NVX J;  5J1U A;  2AO9 A;  3TP0 A;  5C44 J;  1QPI A;  3GEU A;  1NK3 P;  3KZ9 A;  2L0K A;  5DAJ A;  4BY7 J;  2HOS A;  5FHP A;  3ZQH A;  1O4X A;  3G7R A;  2VI6 A;  4JP0 A;  3IH4 A;  4C3J J;  3FK7 A;  5FKK A;  2HYT A;  3RD3 A;  3LSR A;  4A3J J;  3HEF A;  5IP6 A;  2G0E A;  3BT9 A;  2HOT A;  2NOG A;  2Y9Z A;  1UG2 A;  4MFE A;  3H3V K;  1ETW A;  3SDG A;  3RKQ A;  2DG7 A;  2QKO A;  4A3M J;  1FJL A;  1JTY A;  3FK6 A;  1X2M A;  2YUS A;  4A3C J;  4NEL A;  1MBF A;  3BQZ A;  1D5Y A;  2H1K A;  3RQI A;  2NVY J;  2DMQ A;  1IC8 A;  3SFI A;  4MO7 A;  5EG0 B;  2R0Q C;  3HOZ J;  3S1R J;  3E7L A;  1ETO A;  5HOD A;  3FRQ A;  3ON4 A;  3HKZ N;  3HOY J;  1JJ8 C;  3JSJ A;  2M8G X;  5GPA A;  1FEX A;  3LSJ A;  2EZL A;  3RZO J;  2GEN A;  4JX6 A;  3G1L A;  3EUP A;  3S1N J;  2OF7 A;  3PAS A;  5M5Y J;  4IHV A;  3JRD A;  4BBR J;  2O7O A;  2AHQ A;  5E3N A;  5E3O A;  1HDD C;  4A3D J;  4BBS J;  5J3L A;  3M3Y J;  2YVE A;  4B4C A;  3HTJ A;  3BR0 A;  3VOX A;  1NK2 P;  5C3E J;  4JX4 A;  2G7L A;  2ZCM A;  2F07 A;  4V2G A;  2ELK A;  5J1Y A;  5FLM J;  4FE4 A;  3TW7 A;  3CWR A;  1FTT A;  2OI8 A;  2V57 A;  3W6V A;  3QBM A;  4XK4 A;  3S17 J;  1BL0 A;  3MN2 A;  1FIA A;  3A01 B;  2X48 A;  4M3G A;  2GM4 A;  1GVD A;  2LK2 A;  2QOP A;  4FTH A;  5F1J A;  5EGO B;  1AKH A;  3VW2 A;  2E1O A;  5CXG A;  3VW0 A;  2VKV A;  2R93 J;  2D6Y A;  2VKE A;  5M5W J;  3GTO J;  1TC3 C;  2QTQ A;  3EGQ A;  4W97 A;  2L7M P;  4MLO A;  4XRM A;  5GP9 A;  3BNI A;  2IU5 A;  2IBD A;  4JKZ A;  2E2H J;  2L7F P;  2K9Q A;  3ZQL A;  1MBJ A;  1MH3 A;  2ECB A;  3QPS A;  4X1E A;  5F0C A;  3VIB A;  5H9T A;  2O7T A;  1Y1V J;  2XDN A;  1JUM A;  3PPB A;  1HDP A;  1DU6 A;  1MBE A;  3LNQ A;  1TWG J;  4UUS A;  3O8G A;  1VND A;  3UKG A;  3NXC A;  1GV5 A;  5F04 A;  3OIO A;  4FCY A;  1H89 C;  4CYC B;  2Q24 A;  3LWJ A;  4A69 C;  2DA3 A;  3Q0W A;  3M4O J;  2CJJ A;  2EBI A;  1B72 B;  3COL A;  1P7I A;  4L5E A;  3HDD A;  2NVT J;  2UXO A;  2GLO A;  2KDZ A;  4D7N A;  4JL3 A;  4X6A J;  1I50 J;  2QIB A;  2JA5 J;  1MNM C;  5F08 A;  3GTG J;  4M3D A;  1BW5 A;  3LHQ A;  1E3O C;  1F36 A;  2ID6 A;  1TWF J;  3CMY A;  2XB5 A;  1ZQ3 P;  1MH4 A;  5FKN A;  1WGX A;  2R5Z B;  3I4M J;  3JRB A; 
#chains in the Genus database with same CATH topology
 3CP2 A;  1L0O C;  1J9I A;  1DP3 A;  3HTH A;  3W3C A;  3TOB A;  5F6F A;  3AL0 C;  4Q4Z F;  2XGD A;  5FFX A;  2OAZ A;  4Z2Y A;  3WTV C;  2AS5 F;  5HSZ A;  1Y39 A;  5IYD J;  3NNR A;  2A6T A;  3KNW A;  2E19 A;  2V6C A;  1KQ8 A;  1WJF A;  3K4B A;  1Q1H A;  2KJB A;  2M8E A;  3FKJ A;  2CU7 A;  2QSF X;  4M9X A;  4RAY A;  1OCZ H;  2UUZ A;  2UXH A;  3E5X A;  1BR1 A;  1TP4 A;  3FIW A;  1VQ6 I;  2V1N A;  3MNL A;  2VJ5 A;  2RAE A;  3H92 A;  5DM7 F;  1XS9 A;  3G2B A;  3QRF F;  4PGH A;  5LLQ A;  1R36 A;  1R5G A;  2F4I A;  2JUC A;  2Y0S N;  4M74 A;  2PJR B;  2E36 A;  2NS8 A;  3GTM J;  3B6C A;  1HQC A;  5CJ9 A;  5F1R A;  4WK8 F;  2IGM A;  4XOR A;  5DTD A;  4IKF A;  3VOD A;  1ULY A;  1O3T A;  3BZ6 A;  3D5R C;  3K7A J;  3WHC A;  3LSP A;  5F0H A;  1AA7 A;  3HBL A;  4XKW A;  2GXA A;  1Z6T A;  2XC7 A;  3CP8 A;  2DPD A;  4AYB N;  2NP3 A;  2OD5 A;  2I5U A;  3CUQ C;  4CCO A;  1LFP A;  3OIP A;  2GXG A;  3WTT C;  1WJD A;  3A02 A;  3CJQ B;  1RET A;  3D1N I;  4E7H A;  2Y0S A;  2XAF A;  1JGG A;  2LNB A;  3R6S A;  4XOP A;  3IV5 A;  3M1C A;  3IWF A;  3OYF A;  2G7H A;  3E7Q A;  3RPQ A;  2YX4 A;  2DOF A;  2L9R A;  4QLC U;  2B3W A;  3GVA A;  3MD2 A;  3J80 K;  4YG2 F;  3VVZ A;  1KQ0 A;  1KU7 A;  4ESJ A;  4QTR A;  1B6A A;  4KDP A;  1U9O A;  4MQ9 F;  4ZDL A;  4AYB A;  2EFQ A;  1PJR A;  1Z3X A;  3VWB A;  1RZ4 A;  3G4S I;  1UI6 A;  4DQ2 A;  5FLV A;  1WH7 A;  3VTI A;  2W7N A;  3CF2 A;  4RM3 A;  4EAT A;  3JCU C;  4MNU A;  5E3L A;  2E1M B;  1RR7 A;  4RGS A;  2HDC A;  3JRC A;  3COA C;  3JR9 A;  1BI0 A;  4M3E A;  5D8L B;  3CCU I;  4UUV A;  3SWH A;  1VQ7 I;  1G2H A;  2JJ7 A;  4L9T A;  1V5E A;  3L2R A;  1KYZ A;  1AHD P;  3KP7 A;  1G6N A;  2OUM A;  1MIJ A;  2B63 J;  4B1R A;  2JQ7 A;  2OV7 A;  3OR2 C;  2HVR A;  5K1Y A;  1WKM A;  2GOX B;  3DTI A;  1TW3 A;  2DA7 A;  1G3S A;  2KRC A;  3A01 A;  2HZT A;  4JNN A;  3VOE A;  4ETS A;  5L3F A;  1POG A;  2M7A A;  3FXM A;  5AQC A;  3JAM K;  3M8J A;  4GCT A;  5EGO A;  3DPT A;  1R5H A;  3BLY A;  3FXU A;  1LEB A;  1X2N A;  2CUJ A;  2E7W A;  4Q5S F;  4DIQ A;  3ZMS A;  1HLV A;  5H2F C;  4XSX F;  3EYY A;  1DDN A;  2STT A;  2W24 A;  1ZR2 A;  4MEX F;  4M73 A;  4HRI A;  1SD5 A;  3AQS A;  2HWV A;  2GA1 A;  4IX7 A;  3TO6 A;  4NQW B;  2BHZ A;  3N05 A;  2CQQ A;  2NXN B;  1JT0 A;  3JTH A;  2ZME C;  1W5T A;  1NH3 A;  1O3Q A;  2GOM A;  3ON2 A;  2LLK A;  4DYQ A;  2HKU A;  1IN5 A;  4CCN A;  1P7J A;  1SD4 A;  1D0Z A;  3GTK J;  1HST A;  1YS7 A;  2OER A;  3WGI A;  4J01 A;  1B72 A;  2OZ6 A;  1Z7U A;  1H0M A;  1LQ1 A;  4XRS A;  2OTJ I;  1FOY A;  1QZE A;  1XDS A;  1VI0 A;  1BA5 A;  4BEH A;  1EH6 A;  4M72 A;  1YIJ I;  2ZJQ F;  3HOV J;  4DW6 A;  2LKX A;  2VPR A;  2L2O A;  1UI5 A;  1R1U A;  1OLT A;  3ANP A;  3RH2 A;  3QPL A;  3DPJ A;  1TWA J;  3C7J A;  4IEJ A;  1D3Y A;  2CFO A;  2HXI A;  2ISZ A;  3GTP J;  3OYE A;  3FM3 A;  4LFU A;  2K9M A;  2R7T A;  2R5Z A;  3T5X A;  4HOB A;  1ZGA A;  1VQ8 I;  3WOD F;  1EV7 A;  1R49 A;  1B9N A;  3FIS A;  3UR3 C;  4B09 A;  3BPX A;  4BQN A;  4KMU X;  3GTQ J;  4RB1 A;  1LDD A;  3FDY A;  2ETH A;  4A3E J;  3F0C A;  4FAS D;  4ICH A;  2CW8 A;  4A2U A;  1S7E A;  3RI4 A;  4ZTJ A;  4ZYH A;  2NS7 A;  2LC2 A;  1AOY A;  2PG4 A;  1YG2 A;  1JKQ C;  1RPW A;  1ENH A;  4RLF A;  3KLO A;  2FBI A;  4A12 A;  2CQK A;  4A3F J;  2M2E A;  3VSL A;  4GYI A;  3BCG A;  4XN3 A;  4ZH4 F;  2P81 A;  3B6A A;  3H1C A;  3ABT A;  2ISY A;  3QOE A;  3HOX J;  2MAB A;  2UXN A;  2JVH A;  3CMM A;  2CUZ A;  3QQA A;  3TO9 A;  4ESB A;  4JOM A;  1X19 A;  2DDB A;  3OL4 A;  9ANT A;  4II2 A;  3I54 A;  4E70 A;  3LSH A;  3JRF A;  3TED A;  3GLX A;  3EUA A;  3JSO A;  1D8K A;  4P96 A;  1ZR4 A;  4HKU A;  4ME9 A;  1VF9 A;  2RV8 A;  3BTJ A;  2LR8 A;  4CA0 A;  4BAC A;  2RAS A;  1LFU P;  2L7Z A;  3BG3 A;  2BY3 A;  3GZI A;  3K4M A;  4MXM A;  4N4N B;  2E5N A;  3ESW B;  3VDX A;  1X1C A;  2NVQ J;  1XN7 A;  4UUT A;  4A3I J;  5FMP A;  2BHY A;  1VQ5 I;  2P6T A;  2X1C A;  2XV4 S;  1G59 A;  1MBK A;  1IV6 A;  2E34 A;  2R3S A;  2QCO A;  1B8I A;  1FC3 A;  1P4X A;  3KEO A;  4NBQ A;  1B59 A;  4C30 A;  2BE5 F;  1JKO C;  5AIP A;  1K78 A;  5EF6 A;  5D5X B;  1IRZ A;  2NAZ A;  4XOT A;  3BPV A;  4NUB A;  2DTR A;  4UUS B;  2PJP A;  4U0V A;  2HQN A;  1Y0U A;  3FXO A;  3S14 J;  4F91 B;  2M1B A;  1ACI A;  2XSD C;  5FJ8 J;  2K7L A;  4I6Z A;  1WJE A;  3FX3 A;  5CW8 A;  5D18 A;  1YQA A;  1TQP A;  1IDZ A;  3TKY A;  2OCE A;  1TT5 B;  1XMA A;  2WAD A;  1C0W A;  2NNN A;  5BNG A;  5GAE J;  3ZQG A;  2FMY A;  4HF2 A;  1J75 A;  3HPH A;  2P5K A;  2NOJ B;  5IP7 J;  4BQA A;  1JUS A;  3KKD A;  3LOC A;  3HOT A;  3L2U A;  4GFB A;  3P9I A;  2LVS A;  2M9H A;  1F4K A;  5GPC A;  2MD0 A;  4CSW A;  2Z5U A;  3C2G A;  2X9D A;  4ZC3 A;  1LDJ A;  3CO6 C;  2FNP A;  1QHG A;  3K6G A;  4M6Y A;  1TWH J;  2H8R A;  5B66 C;  2CYY A;  1LVA A;  4D0P A;  2HYF A;  2EFW A;  2D1H A;  5TGT A;  1W1W E;  1IZ1 A;  4IRI A;  3R0A A;  4FX4 A;  1EH8 A;  4D5C A;  1YS6 A;  1FSH A;  2LDU A;  1JUP A;  4OU0 A;  4Q48 A;  3BR1 A;  4LLG F;  1WJB A;  3RYP A;  2FBK A;  2WA0 A;  3CCQ I;  2MGQ A;  2UZK A;  4KIS A;  3DKX A;  2O9L A;  1SFK A;  2ME6 A;  3IAM 2;  3I0T A;  1IN7 A;  2YU9 J;  4B43 A;  2H1L A;  3ASO H;  1STZ A;  2F2E A;  4PFO A;  4XL9 A;  3U1D A;  3LAP A;  3GBG A;  4KNY A;  5IT9 Z;  1E17 A;  4OAY A;  1DGW Y;  1W7P D;  2MH2 A;  3IH3 A;  2AO9 A;  5C44 J;  1QPI A;  3VYU B;  3KZ9 A;  4Q47 A;  1DQU A;  4BY7 J;  5FHP A;  4IOC F;  2FEZ A;  2VI6 A;  3CC2 I;  3ZCO A;  3RD3 A;  2BOL A;  2X6X A;  3IL2 A;  3BT9 A;  1V5G A;  5DYM A;  3WU0 A;  4AIH A;  1YW9 A;  3IP4 B;  1UG2 A;  2QEN A;  4HV5 A;  4KIG A;  3IRQ A;  2Y9Z A;  5E1X A;  2IS2 A;  1X2M A;  4LJZ F;  2RGV A;  2VC1 A;  3CTA A;  2E1C A;  2VXD A;  1U8R A;  5E20 A;  1FOW A;  2VQG A;  4E7I A;  3WTS C;  1W5S A;  2A6E F;  2R0Q C;  2DK8 A;  1Z1D A;  3SDB A;  5HOD A;  3FRQ A;  4XMY A;  3WG9 A;  3HOY J;  3JSJ A;  1SVO A;  5GPA A;  2Y69 H;  3D0S A;  4UVC A;  3ASN H;  2IS1 A;  3RZO J;  4ITV A;  4I01 A;  2LOO A;  3G1L A;  4LG3 A;  2ZKZ A;  1UEL B;  3E97 A;  2KP6 A;  4A0X A;  5B1B H;  5KHD A;  1HDD C;  4PK4 A;  3G6E I;  3ISP A;  5J3L A;  2A69 F;  3DQV C;  3BR0 A;  1JXS A;  4HLX A;  1F1Z A;  2LMD A;  2XAJ A;  2W00 A;  1SAX A;  3F21 A;  4JX4 A;  2MD5 A;  2F07 A;  2ICW G;  4FE4 A;  3GZN B;  3FM5 A;  5FFZ A;  3PIP F;  1FTT A;  1K78 B;  2V57 A;  3W6V A;  4U87 A;  2A5W A;  5FO5 A;  4O3M A;  4M3G A;  3BZC A;  4CUG A;  1X3U A;  1YX5 A;  4FTH A;  2VQC A;  2O6G E;  1JHH A;  1AKH A;  3VW2 A;  2E1O A;  2GAU A;  2QTQ A;  1ERD A;  2IA1 A;  2IGN A;  2L7M P;  4MLO A;  2HPI A;  2EIJ H;  1ON2 A;  2X51 A;  2A5Y B;  3L7W A;  4EJW A;  2XRO A;  1K79 A;  2E2H J;  2K9Q A;  4Z6Y A;  3H9J A;  3VIB A;  2JRT A;  5AIQ A;  2MFZ A;  4PSX A;  2XDN A;  1QZY A;  3PPB A;  1R6R A;  1DU6 A;  1TWG J;  2R7D A;  3L2W A;  2B0L A;  1X1D A;  5E18 F;  3UKG A;  4RM2 A;  3F8M A;  1LB2 A;  5DV5 A;  2E5Z A;  2E1M C;  4ZYD A;  2O5R A;  6PAX A;  1F9N A;  2HDW A;  3ZMU A;  4IJA A;  4F55 A;  3OYM A;  1XX5 A;  1TQM A;  2VE9 A;  2EBI A;  3IKT A;  1OPC A;  1N78 A;  1YIT I;  2ELH A;  2XF6 A;  2ZCW A;  3HDD A;  2NVT J;  2EPF A;  4ASN A;  2A2F X;  2UXX A;  4J00 A;  4JL3 A;  2R7F A;  2GIZ A;  2FA5 A;  1N25 A;  4HBL A;  5AON A;  1Y0N A;  5B1A H;  4YFX F;  3ZGK A;  3LHQ A;  1TWF J;  3CMY A;  2XB5 A;  3KPH A;  3B73 A;  5CLS A;  3ERE D;  3BOQ A;  5A2Q K;  2CG4 A;  2K86 A;  1RKW A;  1EA3 A;  4Y4R A;  3MVP A;  3HHG A;  2D1V A;  2W1O A;  2JA6 J;  4ENJ A;  4G8X A;  2A6H F;  3PNY A;  3UNG C;  3DLA A;  4RBO A;  1G3T A;  1QRY A;  3P9T A;  4A3L J;  3G73 A;  2GUH A;  3KP3 A;  5FGL A;  1FT9 A;  3A1Y A;  3H35 A;  3PFY A;  1MDM B;  3GCM A;  1ETK A;  3CJT B;  2HPM A;  5C4J J;  1S5L C;  5D4S A;  4I0A A;  2DAO A;  3ROU A;  3OS1 A;  2LBF B;  1R5I D;  2DXI A;  4DBR A;  2VOD A;  3E1S A;  3ECH A;  3KLN A;  4KN4 X;  1FOK A;  3ZPL A;  2DA2 A;  5EZG A;  2R5Y A;  3KFW X;  4KYW A;  3TOA A;  1IDY A;  4FX0 A;  4UVB A;  4XLA A;  1JKP C;  3FXL A;  5D5V B;  2X4H A;  3HTA A;  3EUH C;  1H88 C;  4GCV A;  2GBY A;  2R7Z J;  3S3O A;  1ZKG A;  1ZEL A;  4M6X A;  2RN7 A;  2E2I J;  1Z77 A;  3A0H C;  4B3X A;  4GFK A;  2RNG A;  3AAF A;  4CZC A;  1T33 A;  3Q3S A;  3L9F A;  4I76 A;  4YFN F;  3HRS A;  2BY1 A;  2ZNZ A;  1I3Q J;  5ILS A;  4D9J A;  2MLK A;  2GXB A;  1LE8 A;  3VUQ A;  2HQA A;  2M4G A;  2RDP A;  4L9V A;  4D7M A;  5IT3 A;  2WAE A;  1JE8 A;  3VW1 A;  1E3H A;  2W48 A;  1I39 A;  5DCF A;  2EZK A;  2I10 A;  5EG0 A;  2P6S A;  1S3J A;  4XKV A;  1TL8 A;  4LB5 A;  1O3S A;  1WPK A;  3WHB A;  3RSN A;  2A68 F;  2VT2 A;  4OAZ A;  5B3S H;  4I99 C;  2V26 A;  3FXQ A;  3PUF A;  2N8G A;  3CO7 C;  4CO8 A;  1KGS A;  1KQ9 A;  1BJA A;  1Q1V A;  4Y33 A;  4IRG A;  4RAG A;  4J19 A;  1HKS A;  1OCT C;  4JBA A;  1BC8 C;  3I4P A;  4R79 A;  4HX7 A;  4LIV A;  5K5Q A;  4ESF A;  1MMS A;  4LIT A;  2CS3 A;  1QNT A;  3GX4 X;  2L9V A;  2QQB A;  3RJP A;  4XNF A;  3PO2 J;  2W53 A;  1G4D A;  2L4M A;  5DCM A;  4E7L A;  1PUF A;  1IN6 A;  3OYG A;  2WUI A;  2MSY A;  2CSO A;  2COB A;  5K7Z A;  4HQE A;  4XLH A;  4EMS A;  3VVX A;  1N77 A;  3HTI A;  3OYN A;  3DKW A;  2OCC H;  4YIR X;  4EJO A;  4KIT B;  3LSG A;  1H9G A;  4DOZ A;  3D5L A;  3J7Y J;  3OSF A;  5CYV A;  3TBI A;  4EGZ A;  3OOP A;  2DFH A;  1X58 A;  3HM5 A;  5HS7 A;  2HFH A;  1J7K A;  2WBM A;  2L5Q A;  5FKO A;  4ZTF A;  1UG0 A;  1SMT A;  4KMF A;  1YW8 A;  5L3D A;  4LG0 A;  1BC7 C;  1LVK A;  3GXO A;  3CLQ A;  3A4C A;  3F8F A;  1W7P A;  3B02 A;  2NVU B;  3HB9 A;  4L9N A;  1O57 A;  5FRO A;  3VP5 A;  3HXL A;  3BJ6 A;  1TLH B;  3E6D A;  4BXX J;  1XGN A;  3G56 A;  5J47 A;  5M3M J;  1U8B A;  2OA4 A;  3PO3 J;  2D45 A;  2IVM A;  3ZQC A;  2G3B A;  3L2Q A;  2VB6 A;  3NWT A;  4H4K C;  2VKH A;  2QUF A;  4HG2 A;  4B3A A;  1BM9 A;  5IOZ A;  4BU2 A;  3LA2 A;  3U21 A;  3C07 A;  4B48 A;  2OBP A;  3TL4 X;  2EIM H;  2Z9O A;  4NHJ A;  1MNE A;  1FOX A;  5F0F A;  4AID A;  1ETQ A;  4XM3 A;  2P7C B;  3GYH X;  5EZH A;  2IA2 A;  1GHC A;  3LMM A;  2OTL I;  4C2M A;  3AG4 H;  5CVJ A;  4XKB A;  5EFY A;  3CCR I;  5CVU A;  1R00 A;  3WTZ A;  2XPV A;  2XPU A;  2E2J J;  2XAU A;  2J5P A;  2XPW A;  1ZN2 A;  1J0R A;  1T39 A;  5J8F A;  2E71 A;  4S05 A;  1UHS A;  2Y2Z A;  2QQA A;  3M9A A;  1RR8 C;  1B1B A;  1EKE A;  3KP6 A;  3K70 D;  3JRH A;  3ABK H;  1U78 A;  4IZZ A;  2Q0O A;  2IAI A;  4HF0 A;  1P9Q C;  3V6G A;  5BPI A;  1J59 A;  5KVR A;  3B81 A;  5BS6 A;  1U9N A;  2LP0 A;  2ZJ2 A;  1HF0 A;  1R1T A;  4XIC A;  1RI7 A;  2BGC A;  2LSO A;  2Z3Y A;  3BC8 A;  2AQF A;  4PJN A;  3EET A;  4F52 A;  3V78 A;  3T8T A;  2DN0 A;  2NS0 A;  3H36 A;  5E3M A;  3KIO A;  1J5Y A;  5J4V A;  1LE8 B;  3K4N A;  2V7F A;  3OYD A;  1WI3 A;  2DA4 A;  4HDU A;  1R4M B;  3LJL A;  3ZOB A;  3CDL A;  2LF7 A;  2OZU A;  2WY7 Q;  3ZMD A;  2XRL A;  1GXP A;  2NRA C;  2MLG A;  2M34 A;  1FIP A;  3H5N A;  1KU3 A;  3JRA A;  1X4O A;  3REO A;  4HPQ A;  1T95 A;  1T56 A;  4BS9 A;  5IP9 J;  3J80 Z;  3RKY A;  2FNA A;  1YJW I;  3TQN A;  1BOB A;  4IHW A;  1XGS A;  1V54 H;  1BI2 A;  3I5U A;  4HV6 A;  3PIO F;  2K40 A;  3DV8 A;  3E6M A;  2L54 A;  1HW2 A;  5HS9 A;  1YTY A;  4U9N A;  3K1N A;  3V8L A;  1JT6 A;  3EDP A;  4H0E A;  1MBH A;  1X3Z B;  1PDN C;  2XRN A;  2I8D A;  3VYS B;  2JWT A;  3DCF A;  1RRJ A;  5HAW A;  4HNV A;  2PQ8 A;  4HX4 A;  4A6D A;  3I4N J;  3IUV A;  3O60 A;  2KIU A;  5DCM B;  2HQR A;  3SZP A;  1PUF B;  1A35 A;  5D19 A;  5JHF A;  1YRN A;  2BBY A;  3LQQ A;  4OMY A;  1MSE C;  1YI2 I;  5E79 C;  3EPZ A;  3CQZ J;  2AXT C;  2J5O A;  3SXY A;  2EK5 A;  2DA5 A;  3PM1 A;  1VQ4 I;  2EV5 A;  2OPT A;  3GW2 A;  2XSJ C;  4B8X A;  1U5T C;  2JUG A;  2ZNY A;  3Q0V A;  3HJE A;  3RQ4 A;  1Z67 A;  3QWL A;  1GLN A;  3I9V 2;  3MZ8 A;  3CCY A;  3OMY A;  1OCO H;  4KIB A;  4A5M A;  1FX7 A;  1ORK A;  3V4G A;  2PLY A;  5J8C A;  2IA0 A;  2DQR A;  4RA2 A;  3HGY A;  4RGR A;  1K4T A;  2UXP A;  3T8R A;  2KZV A;  3MEX A;  3RDI A;  1HOM A;  3IAS 2;  4NDL A;  2K3P A;  4U0W A;  3S1M J;  2V79 A;  3WTX C;  2XGE A;  1MSF C;  4IHT A;  3F8N A;  3H9G A;  2ELJ A;  1W4M A;  3DLL F;  1ZLK A;  1I3A A;  2EZI A;  5H6R A;  2EZH A;  2R7Q A;  1WVR A;  1RKT A;  1ETX A;  2DDA A;  3PQJ A;  2M0C A;  4JK1 X;  2BEO A;  2RC4 A;  5BPD A;  1S6L A;  4ENN A;  2VN2 A;  2DPU A;  2WGB A;  5JHU A;  2LY9 A;  4HZF A;  4BH9 A;  2R92 J;  3K70 C;  2M4K A;  1EF4 A;  4YII A;  2A61 A;  2VBW A;  3TDZ C;  1VTN C;  1SFX A;  5F27 A;  5E8G A;  1WZ2 A;  3H5R A;  3F22 A;  4XID A;  3GLL A;  3N4M A;  1DUX C;  1ITY A;  1QA6 A;  4MGR A;  3NAU A;  4ANJ A;  3OYA A;  1SFU A;  3S16 J;  1SVM A;  2QKM B;  4FE7 A;  2GFN A;  1WJA A;  5KNL A;  1R9T J;  2K4B A;  2DA6 A;  2Y48 A;  3GME A;  5J1U A;  3TP0 A;  3GEU A;  2QQ8 A;  1KYW A;  5FGM A;  1O4X A;  2G7U A;  3FK7 A;  2XUB A;  2HYT A;  4HF1 A;  4IOA F;  1ON1 A;  2K9L A;  3LSR A;  1VQ9 I;  4A3J J;  3HEF A;  3CJN A;  4UV8 A;  3T0Y A;  3GUD A;  4LIU A;  1TW2 A;  4MFE A;  3H3V K;  3CUQ A;  3RKQ A;  4GRI A;  4A3M J;  1FJL A;  3OYI A;  2H6B A;  1K4S A;  4NEL A;  1MBF A;  1K6Y A;  2QLZ A;  4ZYA A;  3BWG A;  3OYK A;  3CUO A;  4KIF A;  4R8H A;  2RQQ A;  4MO7 A;  3HOZ J;  2A05 A;  4M9S A;  3FXJ A;  4OIQ F;  3ABL H;  4QPQ A;  2R7R A;  2K4J A;  1V55 H;  3S1R J;  3E7L A;  3NS4 A;  3DF8 A;  5KCM A;  3BRO A;  2K5C A;  1RNL A;  3CLO A;  2M8G X;  4I02 A;  1ODD A;  3F6V A;  1LPQ A;  1FEX A;  4CXF A;  3BCA A;  3LSJ A;  1DPU A;  3ZQQ A;  2EZL A;  2GEN A;  3WGH A;  1FWZ A;  3OYB A;  4BBR J;  4CCL A;  4DBQ A;  2AHQ A;  2BZT A;  5CQE A;  4RGU A;  1CGP A;  1FMV A;  1Y8Q B;  3Q9V A;  3NQO A;  3U9G A;  1T8I A;  3M3Y J;  1VQN I;  5F64 A;  2M5W A;  1NK2 P;  4KT5 C;  3DPL C;  3U2R A;  3I55 I;  3RCO A;  4BE0 A;  4L0Z B;  3H3Z A;  3I71 A;  4XLF A;  4WXD A;  1PUE E;  2IPQ X;  1FYM A;  3K4C A;  2KRF A;  3WU2 C;  1L3L A;  2BW3 A;  4GDF A;  3BP8 A;  2IP2 A;  3NRV A;  3S17 J;  3EQL F;  3MN2 A;  3A01 B;  2X48 A;  4MTE A;  1W5C C;  3LFK A;  5DDG A;  2V9P A;  2GWR A;  1GVD A;  1U5T A;  5EGO B;  1OIS A;  3SHF A;  2CO5 A;  5DUK A;  3VW0 A;  2VXZ A;  3DFG A;  2ZSH B;  3GZ6 A;  2FUG 2;  3PJR A;  2D6Y A;  1MJ9 A;  1QO0 D;  3R4K A;  1OR7 C;  5GP9 A;  4XRM A;  2WAF A;  2YX7 A;  3J7Z I;  2JZY A;  5JI6 A;  2L7F P;  3E5Q A;  4BYY A;  2P5L C;  2F6C A;  5H9T A;  4X1E A;  3QPS A;  3BY6 A;  2QQ9 A;  1YJN I;  3PUB A;  2FOK A;  1MBE A;  3LNQ A;  2ZME A;  1VND A;  4XSZ F;  3L2C A;  3MKW B;  2LYC A;  1T6S A;  5LHH A;  3CME I;  3ZR8 X;  2EV0 A;  3P9K A;  4JQF A;  3LWJ A;  2ZXI A;  3RTR A;  4NC6 A;  3AL0 B;  4E7J A;  1B72 B;  1IAW A;  2HZD A;  3OV8 A;  4L5E A;  3S3N A;  4I2O A;  2IJL A;  1REP C;  4RB2 C;  4CYD A;  1A31 A;  3W6K B;  4EM2 A;  3KEY A;  4X6A J;  4BEH B;  3IRR A;  3E6B A;  2DOA A;  4IHS A;  2QIB A;  2KDO A;  1I5Z A;  5F08 A;  4RAZ A;  4OWR B;  2ZFW A;  4KUM A;  1BW5 A;  3I56 I;  4C2U A;  3TDU C;  1SVL A;  2XAG A;  2QKL B;  2DJI A;  2ESH A;  4S04 A;  4UNO A;  1MH4 A;  5FLX Z;  3HRM A;  2X6Y A;  3FBI B;  2Z16 A;  2R5Z B;  2OC6 A;  2K3F A;  3I4M J;  3JRB A;  2O0Y A;  4U88 A;  4CCJ A;  4XN0 A;  1OJL A;  2JA8 J;  1ZTR A;  1A04 A;  2F5C A;  2XKP A;  3Q9S A;  5HS8 A;  4G6T B;  4MIM A;  3GTL J;  3ERM A;  2VBY A;  2X0L A;  4UHT A;  1ZK8 A;  1HCR A;  3HUG A;  5K5O A;  1ZHF A;  4PJL A;  3DPU A;  4O6J A;  2O03 A;  4IPA A;  2YS9 A;  3Q5F A;  2EWN A;  4EV0 A;  4G6D A;  2W85 A;  4EVI A;  3LA3 A;  2WWY A;  2WB1 N;  2LY2 A;  4PJJ A;  1XSD A;  4MK6 A;  4U7B A;  2K9N A;  3FZV A;  5H6Q A;  1MBG A;  2CRG A;  3CCM I;  3BJA A;  5TIS C;  2R7O A;  4ZZD A;  5LHG A;  3F23 A;  5IT9 K;  3BJO A;  5KAF C;  3I3L A;  3JRI A;  1XPX A;  1Y56 A;  3KCC A;  3H0D A;  1SAN A;  3DBH B;  2ZJP F;  4JX5 A;  5JLX A;  4LLN A;  2RHA A;  1SGM A;  2LF8 A;  3CCL I;  1EH7 A;  2GQQ A;  1S72 I;  2IRF G;  2HKO A;  4RLQ A;  3CCV I;  1HKQ A;  2ZFU A;  4E4H A;  2WAQ N;  4XON A;  5K58 A;  2WB1 A;  4FT8 A;  1UMQ A;  4I7H A;  5ICF A;  1IF1 A;  1OYY A;  2ZBK A;  1WH5 A;  1WHU A;  2EH3 A;  2R7U A;  1R58 A;  2ACJ A;  4HYE A;  5LEK A;  5J4Y A;  1PYV A;  3QKX A;  1KZH A;  2JPB A;  4BHP A;  3H0G J;  4IXA A;  3OYC A;  4II3 A;  3SFZ A;  2UXU A;  1WRJ A;  3M8E A;  5LGN A;  3JSP A;  3J81 Z;  3SJM A;  1B8I B;  2V1X A;  2P4W A;  1G3Y A;  1GXQ A;  1MMD A;  1Z21 A;  2BW3 B;  3BDD A;  3QP5 A;  3W6J B;  3FHN A;  2QA4 I;  1MMG A;  5CPR B;  5JVG F;  3G1O A;  1P92 A;  4G12 A;  1Y6I A;  2P8T A;  4K2E A;  1FBU A;  3QYE A;  2D5V A;  4WF2 A;  2QGU A;  4GCK A;  3DU5 A;  3SYT A;  4QIW N;  2XGX A;  1AWC A;  4NN1 A;  1PP7 U;  1I1G A;  2R4G A;  1YE9 A;  1V4R A;  3KKC A;  2DG8 A;  2LG4 A;  5HLH A;  2IXS A;  2FQ4 A;  3I59 A;  1YW7 A;  2DCE A;  2OQR A;  3KYC B;  2XVC A;  3QYB A;  1FY7 A;  3DTK A;  3WTU C;  5EYR A;  3GTJ J;  3MCZ A;  3PFI A;  4WIB A;  3C2B A;  3IWZ A;  4KT6 A;  1HW5 A;  4CZZ A;  5DM6 F;  3GEZ A;  1YFH A;  4BDZ A;  3N97 A;  2Q2E A;  3ONQ A;  1XGO A;  1ZH5 A;  4YZE A;  3LA7 A;  4ACI A;  1HBX G;  3FXK A;  1ZG5 A;  2O61 A;  2VE8 A;  2VT3 A;  3RKW A;  1IN4 A;  1SAU A;  4D1Q A;  3V7S A;  4N9H A;  2W4S A;  3SQN A;  2QBY A;  1G8X A;  3BG5 A;  1T0F C;  4P9U A;  1K61 A;  4RAF A;  2V9V A;  2P0W A;  3S2W A;  3ZQF A;  4IHX A;  3HOW J;  2PZ9 A;  3RPU D;  3TP3 A;  2G7G A;  3G1M A;  2DMU A;  4S0H B;  3BQY A;  1Z7L A;  4W1U A;  4DNC A;  2EIK H;  4KIC A;  2LTP A;  1UJ8 A;  1YLF A;  2ZXH A;  3SZG A;  3MKZ A;  4G94 A;  2JT1 A;  3FMR A;  1OYI A;  4DYC A;  4UDS A;  1UCR A;  2LRE A;  4GCL A;  2IW5 A;  3OSG A;  3E0J B;  3QP6 A;  2ZJR F;  2BV6 A;  2PMZ N;  4YFK F;  3F1B A;  4UB8 C;  2HNH A;  2M45 A;  2RKH A;  1FTZ A;  2FOW A;  1IXS B;  2YVH A;  2VJJ A;  5BMZ A;  2FX0 A;  1X4P A;  3HUG B;  2L4A A;  2KIF A;  1D8J A;  2HOA A;  5D1R A;  5EDN A;  1O7F A;  2CQX A;  2IGK A;  3RYR A;  2HGC A;  1ZRD A;  3C1D A;  3AKZ A;  2VJI A;  2FU4 A;  4MFD A;  3V7C A;  3M07 A;  4MQV A;  1ETV A;  2VL8 A;  3OR1 C;  4OIR F;  3PNT A;  4ENM A;  4N0B A;  4KWA A;  2K85 A;  4NB5 A;  2PMZ A;  4OIO F;  1SEU A;  1T38 A;  2DTZ A;  4RB0 A;  2HOE A;  3L2V A;  3ABU A;  2X1D A;  5DD8 A;  3K4K A;  3ZQI A;  3HOU J;  3KZI C;  3L1P A;  4OD4 A;  2CQ7 A;  3TGN A;  5FKL A;  2ZCN A;  5D8K B;  4BHB A;  5D4R A;  4I09 A;  1IUY A;  2EIL H;  3CC7 I;  3QPT A;  4IF4 A;  2IT0 A;  3KZZ A;  1DPR A;  2F5F A;  1MW7 A;  1N75 A;  5EEA A;  1VQO I;  4CDG A;  2LY1 A;  4AIJ A;  1ZRE A;  1BOA A;  4PGG A;  2HVS A;  4C2T A;  5LBQ A;  1CF7 A;  2WY8 Q;  2ZOY A;  2OJE D;  4NC8 A;  3MKY B;  2QM3 A;  5E17 F;  5LEJ A;  5IYC J;  1SD6 A;  1XMX A;  1ZG3 A;  1SMY F;  3WG7 H;  2FJI 1;  3NPI A;  4HW0 A;  2MBF A;  1YHQ I;  4X0G A;  1V5F A;  1OCP A;  2Z99 A;  2REK A;  2Y75 A;  5ICE A;  2COM A;  2PBI A;  3IC7 A;  4IVN A;  3CDH A;  1PVE A;  2CMP A;  3QYF A;  4LLL A;  3G3Z A;  3CCE I;  2UWM A;  1A6Q A;  1Z3Y A;  2EV6 A;  4HA8 A;  2Y9Y A;  4ZJZ A;  1K83 J;  3W2A A;  5CXI A;  3KP2 A;  2Y30 A;  1LDK B;  3K2Z A;  3ZMV A;  1GV2 A;  3SEQ A;  4L0Y B;  1W0T A;  5H20 A;  2CUE A;  5LGU A;  3CZ6 A;  3H3U A;  5C4X J;  2CW0 F;  1AKH B;  2XGC A;  1QHH D;  2HTJ A;  4LK1 F;  4EJV A;  4XRS G;  2XKO A;  3JRG A;  1ZGW A;  2QWW A;  1I27 A;  2AQE A;  3QU3 A;  3BTI A;  3OYH A;  2ID3 A;  2O3F A;  3CF5 F;  1WJC A;  3BR3 A;  1U3E M;  1GT0 C;  3HIM A;  1WQ2 A;  4C3H J;  5FD5 A;  2QVO A;  2HI3 A;  2HR3 A;  2HYJ A;  2DK5 A;  4HSR A;  5J40 A;  1BJZ A;  2FRH A;  3F72 A;  3LAJ A;  1S29 A;  3DXJ F;  2HYG D;  1S9H A;  3CES A;  4BJT A;  4FHT A;  4UV9 A;  3WE3 A;  1XDU A;  1E3P A;  1XSX A;  5C4Y A;  2L3D A;  1BBY A;  1EJ9 A;  3A03 A;  1JJ6 C;  2DT6 A;  2HEO A;  2ZCX A;  3CRJ A;  4AC6 A;  4EM1 A;  3CD6 I;  1IUF A;  3V7R A;  2OQG A;  2JN6 A;  2EJR A;  2ZY9 A;  3PQK A;  4QSH A;  3MAJ A;  5J1R A;  1RUN A;  1S8N A;  5HLG A;  3W2W A;  2ZOZ A;  2MC4 A;  3EYI A;  4M3F A;  1LFB A;  2ESN A;  3HSF A;  1LJ9 A;  2MYS A;  1TT0 A;  2WC2 A;  2Z1D A;  4ENK A;  3RKX A;  3GO5 A;  2OU2 A;  4CYC A;  3FKI J;  4EJT A;  2GIV A;  2JTV A;  1Y1W J;  3K69 A;  5CKT A;  1TBX A;  2DYS H;  2QF7 A;  3RZD J;  3HTS B;  4CGR A;  1RUO A;  3V8K A;  2FJ1 A;  3HE0 A;  4G6Q A;  3P9C A;  1UZC A;  2F4M B;  4L5J A;  3FMS A;  2HDD A;  1ZRC A;  2FD5 A;  4BJ5 C;  4ZZL A;  3CCJ I;  3S2D J;  2NP5 A;  4NQW A;  3ANG A;  1X1P A;  1UST A;  1ZYR F;  3DTE A;  4PJ0 C;  2Q1Z B;  5ED4 A;  4B47 A;  2CGP A;  4OMZ A;  1P4A A;  4YEJ A;  2B1E A;  2IEK A;  2UV1 A;  3HHH A;  2QWT A;  3V42 A;  4KJZ A;  4R1H A;  3A2K A;  5LD2 C;  2AXL A;  2P7V B;  5KAI C;  5E1Z B;  3FHZ A;  3S1Q J;  3MFK A;  2V4J C;  4OD5 A;  4IO9 F;  2DMP A;  3FXR A;  2FBH A;  1OQY A;  4NNJ A;  3KET A;  1QQI A;  1F5T A;  4P9F A;  2R5Y B;  1Z0X A;  2FF4 A;  2VBZ A;  4P55 A;  4G7H F;  2R7X A;  3F3X A;  5DAJ A;  3HRU A;  2L0K A;  4A0Z A;  4Y3O A;  3AG1 H;  2YSR A;  2FQ3 A;  3EUH A;  3ZRG A;  2HOS A;  3ZQH A;  2VIX A;  3G7R A;  3E5U A;  4JP0 A;  4PUS A;  5FKK A;  3MWM A;  2H6C A;  4GXO A;  1NG6 A;  1DP7 P;  2G9W A;  5CVI A;  4Y17 A;  2KPM A;  5IP6 A;  1MND A;  2G0E A;  2W57 A;  1CF7 B;  1E2X A;  1ETW A;  1D5V A;  3SDG A;  3K8P C;  2DG7 A;  4BXU A;  2H94 A;  3FK6 A;  3S32 A;  2CV1 A;  3VEP A;  1D5Y A;  2H1K A;  3T6N A;  1R23 A;  5K5R A;  1BIB A;  2C6Y A;  2NVY J;  5ERI A;  1IC8 A;  5EG0 B;  1V3F A;  1OCC H;  1MMA A;  4P5O A;  2RRE A;  1ETO A;  3ON4 A;  3H9Q A;  1JJ8 C;  2E35 A;  1HXD A;  2DLL A;  4DJA A;  2EA2 A;  4XLE A;  3KEQ A;  1DGR M;  3S1N J;  3R60 A;  2DT7 B;  3K9T A;  4PJM A;  5M5Y J;  3JRD A;  3HOS A;  1QGP A;  1XMK A;  4B44 A;  4A3D J;  3SEZ A;  3IUO A;  4BBS J;  3HTJ A;  4KN7 X;  2YVE A;  3VOX A;  2F5V A;  1YYV A;  4C9Y A;  5GAG J;  5ILV A;  2G7L A;  4LD5 A;  2PN6 A;  2ZCM A;  1USS A;  5J1Y A;  4BXF A;  3RPU A;  3IKV A;  1FSE A;  3CWR A;  2WV0 A;  3DBR B;  1D1A A;  3HG9 A;  3QBM A;  4XK4 A;  2RVC A;  3PL8 A;  1BL0 A;  3S3M A;  4U0Y A;  2E7X A;  1ZAR A;  3K4L A;  3LL7 A;  2L02 A;  2LK2 A;  2QOP A;  3DU6 A;  5F1J A;  3ZXS A;  2JPC A;  5TJJ A;  5CXG A;  3LSM A;  3K1P A;  1WSU A;  1R71 A;  3LSI A;  3EGQ A;  1TC3 C;  4W97 A;  3O2P E;  3JAM Z;  3J7A O;  3BNI A;  1KU2 A;  4LG0 B;  4N9I A;  2F4O B;  3GWZ A;  1W7P B;  4UVA A;  1MBJ A;  1MH3 A;  2ECB A;  2JVG A;  2O7T A;  3FF5 A;  1MJA A;  2CV2 A;  4CIC A;  1Y1V J;  2DI3 A;  1JUM A;  2KLO A;  5JR3 A;  5ICC A;  4UUS A;  3O8G A;  2EFN A;  2BVM A;  4E7Z A;  3NXC A;  1GV5 A;  1FZP B;  2GZW A;  3OIO A;  3T1B A;  4CYC B;  3GFJ A;  1RC9 A;  3KX2 A;  2Q24 A;  4XBF A;  5LHI A;  3Q0W A;  1ZRF A;  2CJJ A;  1VQP I;  1HC8 A;  4XLC A;  3COL A;  1P7I A;  3ZN1 A;  2CW7 A;  2A3S A;  2HS5 A;  4ZYG A;  3WTW C;  2WTE A;  1FBS A;  1G3W A;  4ON0 A;  2CQN A;  1FLI A;  1J2X A;  1I50 J;  1Y8R B;  2M87 A;  3TO7 A;  4Y13 A;  1LUJ B;  2R7S A;  2JA5 J;  3AG3 H;  1VQL I;  5HLI A;  1YO5 C;  4M3D A;  1E3O C;  2JA2 A;  2ID6 A;  3K0L A;  1W36 D;  1ZQ3 P;  5FKN A;  2HVQ A;  1JGS A;  1WGX A;  1MD0 A;  1A36 A;  3ZN0 A;  2QSG X;  2XDV A;  4IRH A;  3HC7 A;  5BQT A;  1BIA A;  5FB2 A;  3K10 A;  2D2W A;  2VC0 A;  5IOY A;  4ABZ A;  4Y52 J;  4M9Z A;  2YU3 A;  3PSF A;  2KIQ A;  4PZJ A;  3L00 A;  3I53 A;  3LSK A;  3M1E A;  2EB7 A;  1WFX A;  1A6I A;  1ZLJ A;  3R61 A;  4IQJ A;  2VAS A;  2JSC A;  3E6C C;  3GZ5 A;  3VVY A;  2DT5 A;  1YX3 A;  1GDT A;  4L9J A;  3E3V A;  2QEX I;  4D5F A;  2DJN A;  1IRF A;  1OCR H;  4OIP F;  2BXY A;  1KU9 A;  1TTY A;  3AQT A;  2DO7 A;  2JMW A;  2ZB9 A;  2DFE A;  3BR5 A;  2L7K A;  3O3K A;  4NC7 A;  3ULQ B;  4C3I J;  1W0U A;  4A5N A;  3HSR A;  2Y0M A;  4CCM A;  2DOD A;  1VZ0 A;  2M0M A;  4I0B A;  1YIO A;  2XB0 X;  3C3W A;  5FD6 A;  2B9S A;  4HNT A;  5IPA A;  4CCK A;  2KFD A;  2RNJ A;  5K7F A;  1OYW A;  2PMH A;  1H8A C;  3F8C A;  1XC5 A;  5B5E C;  4M71 A;  3OY9 A;  2HTS A;  4ZYE A;  3CC4 I;  5K7H A;  5LFA A;  1LKX A;  4RDU A;  4BDY A;  1APL C;  4LOC A;  1J09 A;  2CH0 A;  4U9L A;  4KFC A;  2XAH A;  3JW4 A;  1S7O A;  5HDG A;  1K6O A;  2CWE A;  1LEA A;  4ZDP A;  1ONV A;  1M1E B;  4M6V A;  4YIF A;  2MW8 A;  5HDK A;  4UY8 I;  4HAM A;  3OYJ A;  4DZP A;  2O8X A;  1FBQ A;  5FKM A;  4C2M J;  1UB9 A;  3BZK A;  3HGG A;  2EIN H;  1OKR A;  3FWE A;  3S15 J;  2L01 A;  2FML A;  2ZXW H;  4BAY A;  2PX9 A;  5M5X J;  1Z05 A;  4HQM A;  3TW6 A;  2VBX A;  2NNY A;  3S5R A;  4N4O B;  4V2F A;  2VKD A;  2LRD A;  1X1B A;  1HW1 A;  4BJ6 C;  1YRN B;  2DOE A;  1U2W A;  2MG4 A;  5E1W A;  4F7Z A;  2XIG A;  1YOV B;  4EEF G;  3R0J A;  2BY2 A;  3ZP5 A;  1D0Y A;  3VYR B;  3K2A A;  3KYL A;  5FRN A;  4WXH A;  2LH9 A;  1P6R A;  5HOO A;  2Y31 A;  1I6H J;  1F43 A;  1UFM A;  2KJC A;  5L3E A;  3BTL A;  2VOP A;  3QAH A;  2R7V A;  2LKS A;  1QBJ A;  2JK3 A;  5DS9 A;  2H09 A;  5EJC A;  4FQG A;  4AIK A;  5JVT A;  3PNV A;  3ECO A;  4MTD A;  1ETY A;  1LNW A;  3L09 A;  4G7O F;  2KT0 A;  4ZDO A;  4BE1 A;  1T2K A;  2YVX A;  3TMO A;  2R7W A;  1IGN A;  3ZMT A;  1BR2 A;  3NAR A;  4BY1 J;  2FBQ A;  1R4N B;  1T98 A;  5HLT A;  1FPQ A;  2Q8K A;  3G71 I;  1W36 C;  1H9T A;  2ECC A;  1QVU A;  4M3B A;  3KE2 A;  3HL2 A;  1IJW C;  2XAQ A;  4AVP A;  2VLA A;  3O8H A;  3CCS I;  5HNH A;  1U6G A;  5CVV A;  1TNT A;  1BN5 A;  2PI0 A;  1O3R A;  2X6O A;  3LWF A;  3BR2 A;  3VSK A;  1VFC A;  5L3C A;  2YR2 A;  3FBN B;  3SZT A;  3BJB A;  3OL3 A;  2LFB A;  2EQR A;  4G9Y A;  1VQM I;  5BOX A;  3M8F A;  1NTC A;  1SC7 A;  4BL0 B;  1DU0 A;  3ML6 A;  1K7A A;  4QWQ A;  1R22 A;  2ZO4 A;  4L5I A;  5EEH A;  2K02 A;  1FYK A;  2XF5 A;  4HEA 2;  1P2F A;  2KZG A;  4OOI A;  4HLY A;  4XRF A;  1FP2 A;  4IQ4 A;  1ZGJ A;  2VQH A;  4AC0 A;  5GTI C;  1HSJ A;  1JI8 A;  2MH9 A;  3GFI A;  3AG2 H;  1S7A A;  3OWT A;  3KP4 A;  5JFR A;  2DFF A;  5FLX K;  1WCM J;  3DEU A;  4UB6 C;  1KON A;  3Q0U A;  2TCT A;  4IHY A;  4FET A;  3DKY A;  1TNS A;  4LB6 B;  3S8P A;  3V8J A;  4G7Z F;  2F5E A;  3HPG A;  1XD7 A;  1TWC J;  5JLW A;  2JRM A;  2K9S A;  3CUQ B;  4L62 A;  2X85 A;  3P7N A;  2DBB A;  4FIS A;  2KMU A;  3P5J A;  2KQR A;  4XLN F;  1BI3 A;  4OIN F;  3U1K A;  1IXC A;  2EFO A;  2F48 A;  4UXN A;  3WE2 A;  4AUX A;  1SFO J;  2KIS A;  2NYX A;  2TRT A;  1RES A;  3DEW A;  4BGD A;  1MDM A;  1CQT A;  4JYK A;  1A5J A;  2CUF A;  3OOU A;  1XSV A;  3OS2 A;  4BQO A;  5TRD A;  4PSW A;  2V1U A;  2LBF A;  3MQ0 A;  3PSI A;  1ZAO A;  4A93 J;  3OIQ A;  1GUU A;  1E0E A;  2CFX A;  2K27 A;  3ZQ7 A;  1PP8 F;  2VJ4 A;  4LMY A;  2H27 A;  2DYR H;  2MA3 A;  3DEE A;  3F6O A;  2B7E A;  4I98 B;  3BCB A;  5D6E A;  4XLP F;  3KZY A;  3IH2 A;  1IRG A;  4U7D A;  3F8B A;  3HZJ A;  2WAQ A;  1FNN A;  3HSE A;  3BG9 A;  2LKP A;  4BE2 A;  4Y7N J;  5HBU A;  3LST A;  2ZC2 A;  1D0X A;  1OFC X;  3FMQ A;  4DZJ A;  4GFL A;  2RQP A;  3F9K A;  4BUP A;  3S2H J;  4DYR A;  1D1C A;  2LD5 A;  2XHK A;  1O7L A;  3DP7 A;  2FXA A;  2EFP A;  4RGX A;  2ADU A;  2ME0 A;  4BHC A;  1KA8 A;  1TQI A;  2HXO A;  3MKL A;  4E6K G;  1U5T B;  2W84 A;  3J81 K;  4BNC A;  2VUM J;  5HVQ C;  2XAS A;  4YRV A;  2E60 A;  5EEG A;  2G7S A;  2UXI A;  1OR7 A;  1IV8 A;  3BG6 A;  3EUK L;  1JKR C;  1QVT A;  4RS8 A;  5HDN A;  2WV1 A;  5IYB J;  4QPO A;  1R1V A;  1JTX A;  5DD4 A;  2L9N A;  1B4A A;  2DMN A;  1NG7 A;  5CQG A;  2DW4 A;  1IG7 A;  2O8K A;  3VB2 A;  1BR4 A;  4EM0 B;  3BG7 A;  5IY5 H;  3WTY C;  2ZME B;  2KRH A;  1VQK I;  4PCQ A;  5E8I A;  3NRG A;  2PMU A;  2DMT A;  2A07 F;  2KKO A;  2W25 A;  2JA7 J;  1T08 B;  2V6E A;  4EGY A;  4MHG A;  4PXI A;  4WXC A;  3LQR A;  5M3F J;  3DBL B;  3QPH A;  3WGG A;  1BW6 A;  3HIF A;  1ZG1 A;  5GAH J;  2IS4 A;  1Z91 A;  1BI1 A;  3NWS A;  1RIO H;  4AF5 A;  1IW7 F;  1WJ5 A;  3HRT A;  4F93 B;  1I1S A;  4PDK A;  4PFP A;  3BTC A;  3NI7 A;  4O5V A;  3QOD A;  2PBX A;  4GYG A;  1B9M A;  3KP5 A;  2F5D A;  4A6E A;  4AM3 A;  3BRU A;  3VFZ A;  5D5U B;  1UHW A;  2ZXJ A;  3BR6 A;  4E7K A;  2HQ5 A;  3K4J A;  1IXR C;  4P1W A;  3M7G A;  4A3B J;  2DFI A;  1XCB A;  3VPR A;  4HNU A;  3OS0 A;  2QZ8 A;  1P4W A;  4IL6 C;  2P5V A;  5A2Q Z;  3BHQ A;  3GFL A;  1Z9C A;  3VYT B;  4BKX A;  3JRE A;  1FYL A;  5L3B A;  1IRX A;  2W82 A;  3MMY B;  4CHU A;  3VOK A;  2BVL A;  1UAA A;  5KK1 A;  3CJD A;  1WI9 A;  1XG1 A;  1YJ9 I;  4MEY F;  4A3G J;  2DA1 A;  2IGO A;  4A3K J;  4HDV A;  4DGW B;  4IRV A;  2BXZ A;  1X3W B;  2EA4 A;  2VQL A;  4DVY P;  2X6W A;  4HX8 A;  4F92 B;  1AU7 A;  4RMN A;  2PEX A;  2E1N A;  4AVZ A;  2NVX J;  1NK3 P;  1FP1 D;  3IHU A;  5D6F A;  5J6X A;  3S93 A;  3IH4 A;  2M7B A;  4C3J J;  1SFE A;  1XCV A;  3KYD B;  2PFV A;  2YPR A;  2HOT A;  2NOG A;  1QU3 A;  2MC3 A;  3H5A A;  3QOP A;  3GFM A;  2QKO A;  2FE3 A;  1JTY A;  2DU9 A;  2YUS A;  4A3C J;  4XR6 A;  4TV7 A;  5LRR A;  3BQZ A;  1R7J A;  3OYL A;  2PJR A;  3RQI A;  2DMQ A;  2HU9 A;  4F3Q A;  2VON A;  2BYV E;  3SFI A;  1X1A A;  2FSW A;  3QU6 A;  5GTH C;  4RB3 C;  1MJB A;  4YEL A;  4WX9 A;  3MZY A;  3X2Q H;  4AWX B;  5DUI A;  2KIM A;  1WWX A;  3HKZ N;  5DEQ A;  2QSH X;  1NHA A;  2QYO A;  3ABM H;  5ILU A;  2XF7 A;  2Z2S B;  3GF2 A;  4JX6 A;  3EUP A;  5D5W B;  2OF7 A;  1U0J A;  3PAS A;  1GVJ A;  4IHV A;  1MMN A;  2O7O A;  5E3N A;  4KA4 A;  1MGT A;  1XGM A;  5E3O A;  4CGZ A;  4B4C A;  1IO2 A;  1OMI A;  5C3E J;  4EQQ A;  1Z6R A;  3LFU A;  1QPM A;  3HKZ A;  3I59 B;  4V2G A;  2ELK A;  5FLM J;  3TW7 A;  5LRS A;  4WCG A;  1TZL A;  4BQQ A;  2OI8 A;  3W2V A;  3ZMZ A;  2JSP A;  1D1B A;  1I6X A;  2V9K A;  4AU7 A;  3MZH A;  1XB4 A;  3CMA I;  3D5S C;  1FIA A;  2PFB A;  2Q2E B;  2ZSI B;  3K1M A;  2GM4 A;  2M30 A;  2STW A;  2VOO A;  2DQL A;  5LGT A;  2VKV A;  1IN8 A;  2R93 J;  2VKE A;  5M5W J;  3I64 A;  3CDI A;  3WU1 B;  4L18 B;  4XKC A;  1UHM A;  3GTO J;  3A0B C;  4LGW A;  4E7S A;  2BY0 A;  4A0Y A;  2QBY B;  1XTA A;  1T0F A;  1HKT A;  2IBD A;  2IU5 A;  4JKZ A;  1QZZ A;  3HTU A;  4XQF A;  3C2H A;  3ZQL A;  5F0C A;  4GGG A;  2KL4 A;  1HA8 A;  5HNF A;  4Y15 A;  1HDP A;  2IS6 A;  1JHF A;  2M3A A;  3C18 A;  5F04 A;  5GAD J;  1H89 C;  4FCY A;  3HYI A;  3CJR B;  4A69 C;  1FMW A;  2DA3 A;  3J7A Y;  1MKM A;  1SD7 A;  4EJU A;  3ELK A;  2Z33 A;  3M4O J;  5L3G A;  5CVR A;  2CV0 A;  3AFH A;  2X1E A;  4GO1 A;  1MZB A;  3JTG A;  2UXO A;  3O6B B;  2GLO A;  4WWC A;  2KDZ A;  2VPL A;  4D7N A;  2H8W A;  2TDX A;  2L9S A;  4V19 K;  2KHM A;  4CH7 A;  1MNM C;  3RIR A;  2V1D A;  2HKX A;  3DWL E;  3I58 A;  1F36 A;  4AD9 A;  5ICG A;  5FRM A;  2GA2 A;  4HST A;  4LK0 F;  3GTG J;  3NEU A;  2NX4 A; 
#chains in the Genus database with same CATH homology
 1RKW A;  3HTH A;  1OJL A;  2JA8 J;  1ZTR A;  3MVP A;  2XGD A;  2JA6 J;  4MIM A;  3GTL J;  5HSZ A;  5IYD J;  5IOY A;  1ZK8 A;  4ABZ A;  4RBO A;  1HCR A;  1QRY A;  4Y52 J;  3P9T A;  3NNR A;  4A3L J;  3KNW A;  2E19 A;  2GUH A;  5FGL A;  1A6I A;  2YS9 A;  1ETK A;  2CU7 A;  3VVY A;  5C4J J;  1GDT A;  2WB1 N;  4MK6 A;  2UXH A;  4D5F A;  2DJN A;  2K9N A;  3AQT A;  1MBG A;  2CRG A;  3FIW A;  2JMW A;  2ZB9 A;  3BR5 A;  1W0U A;  3T6N A;  4C3I J;  3MNL A;  3JRI A;  2RAE A;  2DA2 A;  5EZG A;  1XS9 A;  1SAN A;  2R5Y A;  4JX5 A;  5JLX A;  2Y0S N;  1IDY A;  2RHA A;  2NS8 A;  1SGM A;  2XB0 X;  3GTM J;  3B6C A;  1JKP C;  5IPA A;  5DTD A;  5K7F A;  3HTA A;  1H8A C;  1H88 C;  2WAQ N;  1XC5 A;  2GBY A;  3K7A J;  3WHC A;  2R7Z J;  1ZKG A;  5K58 A;  3LSP A;  1UMQ A;  5K7H A;  5F0H A;  4RDU A;  2E2I J;  1Z77 A;  1APL C;  3HBL A;  4LOC A;  4GFK A;  1WH5 A;  2EH3 A;  4AYB N;  2NP3 A;  1T33 A;  3Q3S A;  4I76 A;  3A02 A;  4M6V A;  2MW8 A;  1RET A;  3D1N I;  4DZP A;  1I3Q J;  1JGG A;  3QKX A;  1LE8 A;  5FKM A;  4C2M J;  3VW1 A;  3IV5 A;  3HGG A;  3H0G J;  4D7M A;  3VUQ A;  2W48 A;  3E7Q A;  3S15 J;  2EZK A;  2UXU A;  2I10 A;  5EG0 A;  2L9R A;  1WPK A;  3TW6 A;  3WHB A;  5M5X J;  3SJM A;  1B8I B;  3S5R A;  4V2F A;  3VVZ A;  1YRN B;  4QTR A;  1U9O A;  2MG4 A;  3G1O A;  4EEF G;  4G12 A;  1UI6 A;  3K2A A;  1WH7 A;  5FLV A;  2N8G A;  2D5V A;  1Q1V A;  5E3L A;  4J19 A;  2Y31 A;  1I6H J;  1RR7 A;  1OCT C;  1F43 A;  4GCK A;  4QIW N;  4NN1 A;  3JRC A;  3BTL A;  4M3E A;  3JR9 A;  3KKC A;  2DG8 A;  1G2H A;  2JJ7 A;  2JK3 A;  5DS9 A;  3PO2 J;  2W53 A;  2FQ4 A;  1AHD P;  1PUF A;  2B63 J;  4B1R A;  1ETY A;  3GTJ J;  2MSY A;  5EYR A;  2WUI A;  2KT0 A;  2COB A;  5K7Z A;  3C2B A;  3VVX A;  3HTI A;  2DA7 A;  3A01 A;  4JNN A;  1IGN A;  3NAR A;  4YZE A;  4ACI A;  3LSG A;  4BY1 J;  2FBQ A;  1POG A;  3OSF A;  5AQC A;  4GCT A;  5EGO A;  1X58 A;  2ECC A;  3HM5 A;  1X2N A;  1QVU A;  4M3B A;  5FKO A;  1IJW C;  1HLV A;  3BG5 A;  3O8H A;  1K61 A;  3ZQF A;  4IHX A;  3HOW J;  2X6O A;  1ZR2 A;  3HB9 A;  2PZ9 A;  3BR2 A;  3AQS A;  3VP5 A;  3TP3 A;  1VFC A;  2G7G A;  3G1M A;  2DMU A;  4S0H B;  2CQQ A;  3BQY A;  3BJB A;  4W1U A;  1JT0 A;  2LTP A;  2LFB A;  4BXX J;  3G56 A;  5M3M J;  3ON2 A;  2EQR A;  2LLK A;  1U8B A;  4DYQ A;  3PO3 J;  1NTC A;  2HKU A;  2G3B A;  3ZQC A;  1DU0 A;  4DYC A;  4UDS A;  1P7J A;  3GTK J;  2OER A;  4GCL A;  3OSG A;  1B72 A;  2PMZ N;  3F1B A;  4B3A A;  4XRS A;  5IOZ A;  1FTZ A;  3C07 A;  1VI0 A;  2YVH A;  4AC0 A;  1BA5 A;  2FX0 A;  5F0F A;  2HOA A;  1ETQ A;  3HOV J;  4DW6 A;  5EDN A;  2VPR A;  5EZH A;  2LKX A;  2CQX A;  5D1R A;  3RH2 A;  1UI5 A;  3ANP A;  1WCM J;  3QPL A;  3DPJ A;  5EFY A;  1TWA J;  4IEJ A;  3Q0U A;  2TCT A;  4MFD A;  4IHY A;  2HXI A;  2XPV A;  3GTP J;  1ETV A;  2XPU A;  2E2J J;  2R5Z A;  2XPW A;  4KWA A;  1TWC J;  5JLW A;  3FIS A;  2K9S A;  2DTZ A;  3GTQ J;  4L62 A;  1UHS A;  2Y2Z A;  3ZQI A;  3HOU J;  4FIS A;  3L1P A;  4A3E J;  3F0C A;  3JRH A;  4ICH A;  1U78 A;  4AUX A;  1SFO J;  1S7E A;  2TRT A;  2IAI A;  1RES A;  3DEW A;  5FKL A;  2ZCN A;  3V6G A;  2NS7 A;  1CQT A;  3B81 A;  4JYK A;  1U9N A;  1JKQ C;  1RPW A;  1ENH A;  2LP0 A;  1HF0 A;  2CUF A;  1A5J A;  3OOU A;  5EEA A;  4A3F J;  4XIC A;  2M2E A;  3BCG A;  4A93 J;  2P81 A;  1GUU A;  2ZOY A;  3B6A A;  3HOX J;  5IYC J;  3V78 A;  2DN0 A;  5E3M A;  3QQA A;  3NPI A;  1LE8 B;  1OCP A;  1WI3 A;  3IH2 A;  2DA4 A;  2REK A;  3LJL A;  3ZOB A;  9ANT A;  3CDL A;  2XRL A;  3JRF A;  3BG9 A;  3TED A;  4Y7N J;  2M34 A;  1FIP A;  5HBU A;  1OFC X;  4DZJ A;  1ZR4 A;  4HKU A;  4GFL A;  4ME9 A;  1VF9 A;  3JRA A;  3S2H J;  4DYR A;  5CXI A;  1T56 A;  2Y9Y A;  3BTJ A;  1K83 J;  5IP9 J;  2LR8 A;  2LD5 A;  2RAS A;  2Y30 A;  1LFU P;  2NX4 A;  2L7Z A;  3BG3 A;  1GV2 A;  3GZI A;  4IHW A;  1W0T A;  4MXM A;  2ME0 A;  2CUE A;  2NVQ J;  2HXO A;  3MKL A;  5C4X J;  2VUM J;  2K40 A;  4UUT A;  4A3I J;  1AKH B;  2XGC A;  5FMP A;  3JRG A;  4XRS G;  1JT6 A;  1ZGW A;  1MBK A;  1IV6 A;  1MBH A;  2G7S A;  2UXI A;  3BTI A;  2JWT A;  3DCF A;  1JKR C;  5HAW A;  4HNV A;  2QCO A;  1QVT A;  1B8I A;  3I4N J;  3IUV A;  3O60 A;  5D19 A;  2WV1 A;  5IYB J;  1PUF B;  1JTX A;  2ID3 A;  2DMN A;  1GT0 C;  3BR3 A;  1JKO C;  1YRN A;  3HIM A;  4C3H J;  1MSE C;  5EF6 A;  2HI3 A;  1IG7 A;  1IRZ A;  2HYJ A;  3CQZ J;  2O8K A;  1BJZ A;  4UUS B;  3NRG A;  2DMT A;  2JA7 J;  2DA5 A;  3PM1 A;  2OPT A;  3S14 J;  4PXI A;  5C4Y A;  3Q0V A;  2XSD C;  5FJ8 J;  5M3F J;  1BW6 A;  4I6Z A;  5CW8 A;  5D18 A;  3A03 A;  3CCY A;  1JJ6 C;  2ZCX A;  1IDZ A;  1ORK A;  4AF5 A;  3CRJ A;  4AC6 A;  1IUF A;  5BNG A;  2JN6 A;  3ZQG A;  3HGY A;  2UXP A;  4QSH A;  3BTC A;  5J1R A;  3NI7 A;  5IP7 J;  1HOM A;  1JUS A;  2PBX A;  2ZOZ A;  3KKD A;  3LOC A;  4NDL A;  3S1M J;  4M3F A;  4GFB A;  1LFB A;  2XGE A;  1MSF C;  2LVS A;  2M9H A;  3BRU A;  5GPC A;  2EZI A;  3FKI J;  4CYC A;  2EZH A;  2X9D A;  3BR6 A;  1RKT A;  1ETX A;  1Y1W J;  2HQ5 A;  2M0C A;  4A3B J;  2QF7 A;  3VPR A;  3RZD J;  1TWH J;  2H8R A;  4CGR A;  2FJ1 A;  3HE0 A;  3BHQ A;  2WGB A;  4BKX A;  3JRE A;  2LY9 A;  2R92 J;  1EF4 A;  2HDD A;  2FD5 A;  3S2D J;  2NP5 A;  3ANG A;  3VOK A;  3CJD A;  1XG1 A;  4A3G J;  5F27 A;  2DA1 A;  4A3K J;  4D5C A;  4XID A;  1JUP A;  3BR1 A;  2IEK A;  2QWT A;  2MGQ A;  1ITY A;  3NAU A;  3S1Q J;  2O9L A;  2ME6 A;  3S16 J;  2DMP A;  4FE7 A;  2GFN A;  2YU9 J;  1R9T J;  1AU7 A;  2DA6 A;  2R5Y B;  3GBG A;  1Z0X A;  3IH3 A;  2NVX J;  5J1U A;  2AO9 A;  3TP0 A;  5C44 J;  1QPI A;  3GEU A;  1NK3 P;  3KZ9 A;  2L0K A;  5DAJ A;  4BY7 J;  2HOS A;  5FHP A;  3ZQH A;  1O4X A;  3G7R A;  2VI6 A;  4JP0 A;  3IH4 A;  4C3J J;  3FK7 A;  5FKK A;  2HYT A;  3RD3 A;  3LSR A;  4A3J J;  3HEF A;  5IP6 A;  2G0E A;  3BT9 A;  2HOT A;  2NOG A;  2Y9Z A;  1UG2 A;  4MFE A;  3H3V K;  1ETW A;  3SDG A;  3RKQ A;  2DG7 A;  2QKO A;  4A3M J;  1FJL A;  1JTY A;  3FK6 A;  1X2M A;  2YUS A;  4A3C J;  4NEL A;  1MBF A;  3BQZ A;  1D5Y A;  2H1K A;  3RQI A;  2NVY J;  2DMQ A;  1IC8 A;  3SFI A;  4MO7 A;  5EG0 B;  2R0Q C;  3HOZ J;  3S1R J;  3E7L A;  1ETO A;  5HOD A;  3FRQ A;  3ON4 A;  3HKZ N;  3HOY J;  1JJ8 C;  3JSJ A;  2M8G X;  5GPA A;  1FEX A;  3LSJ A;  2EZL A;  3RZO J;  2GEN A;  4JX6 A;  3G1L A;  3EUP A;  3S1N J;  2OF7 A;  3PAS A;  5M5Y J;  4IHV A;  3JRD A;  4BBR J;  2O7O A;  2AHQ A;  5E3N A;  5E3O A;  1HDD C;  4A3D J;  4BBS J;  5J3L A;  3M3Y J;  2YVE A;  4B4C A;  3HTJ A;  3BR0 A;  3VOX A;  1NK2 P;  5C3E J;  4JX4 A;  2G7L A;  2ZCM A;  2F07 A;  4V2G A;  2ELK A;  5J1Y A;  5FLM J;  4FE4 A;  3TW7 A;  3CWR A;  1FTT A;  2OI8 A;  2V57 A;  3W6V A;  3QBM A;  4XK4 A;  3S17 J;  1BL0 A;  3MN2 A;  1FIA A;  3A01 B;  2X48 A;  4M3G A;  2GM4 A;  1GVD A;  2LK2 A;  2QOP A;  4FTH A;  5F1J A;  5EGO B;  1AKH A;  3VW2 A;  2E1O A;  5CXG A;  3VW0 A;  2VKV A;  2R93 J;  2D6Y A;  2VKE A;  5M5W J;  3GTO J;  1TC3 C;  2QTQ A;  3EGQ A;  4W97 A;  2L7M P;  4MLO A;  4XRM A;  5GP9 A;  3BNI A;  2IU5 A;  2IBD A;  4JKZ A;  2E2H J;  2L7F P;  2K9Q A;  3ZQL A;  1MBJ A;  1MH3 A;  2ECB A;  3QPS A;  4X1E A;  5F0C A;  3VIB A;  5H9T A;  2O7T A;  1Y1V J;  2XDN A;  1JUM A;  3PPB A;  1HDP A;  1DU6 A;  1MBE A;  3LNQ A;  1TWG J;  4UUS A;  3O8G A;  1VND A;  3UKG A;  3NXC A;  1GV5 A;  5F04 A;  3OIO A;  4FCY A;  1H89 C;  4CYC B;  2Q24 A;  3LWJ A;  4A69 C;  2DA3 A;  3Q0W A;  3M4O J;  2CJJ A;  2EBI A;  1B72 B;  3COL A;  1P7I A;  4L5E A;  3HDD A;  2NVT J;  2UXO A;  2GLO A;  2KDZ A;  4D7N A;  4JL3 A;  4X6A J;  1I50 J;  2QIB A;  2JA5 J;  1MNM C;  5F08 A;  3GTG J;  4M3D A;  1BW5 A;  3LHQ A;  1E3O C;  1F36 A;  2ID6 A;  1TWF J;  3CMY A;  2XB5 A;  1ZQ3 P;  1MH4 A;  5FKN A;  1WGX A;  2R5Z B;  3I4M J;  3JRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...