3BTIA

Crystal structure of qacr(e58q) bound to berberine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 77
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btiA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btiA02
2F07A 3ANGA 4A3DJ 3C2BA 2M0CA 1LE8A 3G7RA 2L9RA 1GT0C 5CXIA 4MFDA 1SFOJ 3NNRA 1ENHA 3A02A 2VPRA 3ZQCA 3M4OJ 3AQSA 4GFKA 3IH4A 2QF7A 2EZKA 4JNNA 1X2MA 1GV2A 3GEUA 2KT0A 1S7EA 2CUEA 3LSRA 4IHXA 1LE8B 1ETQA 3SFIA 2M34A 3HGGA 3I4MJ 1PUFB 3TP3A 5E3NA 2IU5A 3OOUA 1HCRA 2K9NA 4A69C 4C2MJ 1ETVA 3HDDA 3JR9A 2M2EA 2RHAA 3V6GA 2DA2A 1HOMA 1B8IB 1DU0A 3BG3A 4L62A 4EEFG 3QBMA 3DPJA 3HKZN 1NK2P 4A3GJ 4GCLA 1RPWA 3BG9A 5HODA 1RESA 4DYRA 2L7MP 2X9DA 5FKKA 2YS9A 2I10A 4W1UA 3S1MJ 2CQXA 3JRBA 5C3EJ 1JKQC 3ON2A 4I6ZA 2JA7J 3P9TA 3LWJA 2NOGA 4JP0A 2W53A 5K7HA 1QPIA 5K58A 4DZPA 4B3AA 2ID6A 2FD5A 2AHQA 1D5YA 2YUSA 4V2GA 4XICA 2E2JJ 1BJZA 4MO7A 2WB1N 2HOTA 1ETOA 4UUSB 2ECCA 2LY9A 1T56A 3UKGA 1X2NA 1U8BA 3S1QJ 5M3FJ 2DA6A 2EBIA 2ZCNA 3LJLA 1A6IA 2V57A 4RDUA 2L7ZA 3JRCA 1MNMC 2Y9YA 5F04A 3L1PA 3MVPA 3Q0VA 3VUQA 2O7OA 5IYBJ 4A3LJ 2DA7A 2M8GX 2G3BA 1JKRC 1RETA 1JKOC 2VKEA 3HM5A 1A5JA 3LNQA 3ZQIA 2QIBA 1ZR2A 2GFNA 2XB0X 4IHWA 1B72A 3F1BA 3JRFA 1H88C 2NVQJ 2DG7A 1JUSA 5F1JA 3LOCA 2DA3A 5JLWA 5IOYA 3NAUA 2MW8A 5IYCJ 5EGOA 2ZCXA 3GTQJ 1ZKGA 4A3KJ 2DA1A 1JUPA 3HTHA 4AC6A 3BTLA 2LKXA 2FQ4A 2E2HJ 5CW8A 5FKMA 1G2HA 1NTCA 2DN0A 4M3EA 1JKPC 2R93J 5M5YJ 4A3CJ 2R5ZB 2H8RA 4FE7A 1TWHJ 4GCKA 4ABZA 3D1NI 3OSGA 3C07A 4IHVA 2IEKA 2CJJA 1POGA 2D6YA 1BW5A 4A3MJ 1IGNA 1WPKA 4D7MA 1K61A 3KKCA 1Z0XA 3RD3A 4IHYA 2LK2A 1OJLA 3LSPA 1VF9A 2Y9ZA 1MBEA 2KDZA 4PXIA 4M3GA 3BNIA 3JSJA 4NDLA 3WHCA 2EZIA 2OPTA 3FKIJ 3FRQA 1EF4A 3A03A 5D1RA 5DAJA 2AO9A 3BR0A 2Y0SN 1JJ6C 3AQTA 5IPAA 3JRHA 5IP9J 1HLVA 2QKOA 1K83J 4JKZA 1IRZA 4GCTA 2LP0A 4BY7J 3S1RJ 1QRYA 1ITYA 2XB5A 3BHQA 4XRMA 4DZJA 5FMPA 5F27A 4MFEA 1IUFA 5C4XJ 1YRNA 4GFLA 3DEWA 1JTYA 2TRTA 2G7LA 4NN1A 1CQTA 3O8HA 3NXCA 3VW0A 1IDYA 1QVUA 5F0HA 4Y52J 2XPUA 2NS8A 2QCOA 1VFCA 3NPIA 2MGQA 3JRAA 3HTJA 2HQ5A 5GPCA 3TEDA 1F36A 4M3DA 5C4JJ 5EGOB 3IV5A 1VI0A 5GP9A 3IH2A 2HOAA 4C3JJ 2WV1A 2P81A 3FK6A 4RBOA 2DMQA 2QOPA 3NRGA 2XPWA 3QPLA 2GUHA 4ACIA 2E19A 5AQCA 3O60A 1RR7A 3HOVJ 2HYTA 5HAWA 5F0FA 1XC5A 3S17J 3Q0UA 1DU6A 1IV6A 4D5CA 2M9HA 3CMYA 2CRGA 5HSZA 2ME6A 2VUMJ 3COLA 2EQRA 4XK4A 1APLC 3S2DJ 3S1NJ 1U78A 1I50J 2ME0A 5D18A 3O8GA 1RKTA 2LVSA 4JX4A 3MN2A 2FX0A 3S2HJ 4C3IJ 2PBXA 4ICHA 2OI8A 1MBFA 2ZOZA 5FHPA 3VOXA 2EZHA 2E2IJ 2G7GA 1BA5A 1HDDC 3KKDA 3MNLA 3LSGA 1XG1A 3Q3SA 1FIPA 4W97A 1QVTA 2XSDC 3E7LA 2K9SA 3WHBA 1H8AC 4JL3A 1JTXA 4Y7NJ 3M3YJ 1B8IA 2HXOA 2JJ7A 1MH3A 4J19A 1MBHA 4MLOA 4B4CA 2H1KA 3HGYA 5EFYA 2LR8A 2XGCA 4QSHA 5J3LA 3HBLA 5FLVA 4HKUA 3HOWJ 2YVHA 4B1RA 4A3EJ 4A3IJ 2DA4A 1JGGA 3NI7A 4JYKA 1X58A 2HXIA 3S16J 2WGBA 5JLXA 1WCMJ 3GTGJ 3BT9A 2X48A 4JX6A 5FKNA 3VIBA 1GVDA 2NX4A 1WH7A 2CQQA 1ZK8A 5EG0A 3JRIA 3ZQGA 1AHDP 3TP0A 2WUIA 3BTCA 3VOKA 3HOUJ 3B6AA 2R0QC 1JT6A 2PMZN 2R5YB 1TWGJ 3VP5A 3HIMA 3H0GJ 1AKHA 1RKWA 5EYRA 3HOYJ 1ZQ3P 3TW6A 3RKQA 3ZQFA 1O4XA 2UXUA 4IEJA 2K9QA 4UUSA 3LSJA 3H3VK 3G56A 1LFBA 4DYQA 3BR1A 2REKA 5EZGA 2LTPA 5M5XJ 2R5YA 5F0CA 1FEXA 4DW6A 3CCYA 1ORKA 3TW7A 2VI6A 4KWAA 1ZTRA 4MK6A 1MBGA 3RQIA 3BR6A 4MIMA 3JRDA 1MBKA 3BTJA 3QQAA 1ZR4A 2ID3A 5HBUA 1ETWA 2O8KA 5IP7J 4L5EA 2PZ9A 5J1RA 3RH2A 2JA6J 1OCTC 4JX5A 1GUUA 5EF6A 1ETKA 3GZIA 1UG2A 5M5WJ 4M6VA 5EEAA 2OERA 4NELA 3GTKJ 2ZB9A 3FIWA 4AF5A 4QIWN 3GTMJ 3W6VA 2O9LA 2UXHA 3CWRA 3HOXJ 2DA5A 2RAEA 1IDZA 5K7FA 2LLKA 2JK3A 3ZQHA 2DG8A 2XRLA 1VNDA 3F0CA 5CXGA 1JUMA 3BJBA 4BKXA 1MH4A 1MSFC 2GBYA 2JA5J 1WI3A 4CYCB 1IJWC 4X1EA 2Q24A 3RZDJ 2D5VA 2W48A 5DTDA 5J1UA 3JREA 2XGDA 3VW1A 5E3MA 2N8GA 1JJ8C 4FISA 3BTIA 1Q1VA 2EH3A 2DJNA 4D7NA 4A93J 5IOZA 1FTTA 5EZHA 2X6OA 3GBGA 5FJ8J 3DCFA 3EGQA 3BRUA 5FLMJ 3FISA 2QWTA 3K7AJ 2B63J 2L7FP 2UXIA 3B6CA 2GLOA 4CGRA 5BNGA 1E3OC 1T33A 3SDGA 2DMTA 5IP6A 2YU9J 2Y30A 4ME9A 1SGMA 4S0HB 4UDSA 4D5FA 2UXPA 2DMPA 1XS9A 1I6HJ 1UHSA 3VW2A 3VVYA 3PPBA 1WGXA 2L0KA 1AU7A 3A01B 1R9TJ 4XRSA 2DMNA 4V2FA 3OSFA 4QTRA 2LFBA 3PASA 4AC0A 3T6NA 2HI3A 2NVTJ 3BG5A 2MG4A 2G7SA 4BY1J 3Q0WA 2XPVA 4BXXJ 3GTOJ 1TWCJ 4AYBN 1B72B 3CJDA 3HE0A 2XDNA 3G1OA 4UUTA 1MBJA 9ANTA 1IG7A 4CYCA 2DMUA 2HOSA 1GV5A 5C44J 3KNWA 1P7JA 2ZCMA 1IC8A 2IAIA 2DTZA 1OCPA 3QPSA 4A3FJ 1HF0A 1ETYA 5C4YA 3FK7A 1LFUP 1UI6A 4DYCA 3HTIA 1F43A 2R5ZA 5F08A 2G0EA 1BL0A 1ETXA 3MKLA 2IBDA 4A3JJ 3RZOJ 2ZOYA 3VVXA 3IH3A 1FIAA 1ZGWA 1OFCX 2EZLA 4AUXA 2NP3A 3CQZJ 4GFBA 1Y1VJ 2HYJA 2NS7A 5M3MJ 3LHQA 2HDDA 2Y2ZA 4LOCA 2NP5A 2TCTA 5IYDJ 1W0UA 3G1LA 5D19A 5E3OA 3A01A 4BBRJ 1P7IA 3G1MA 3GTJJ 3VVZA 1HDPA 2GM4A 4M3FA 3BR2A 3K2AA 3S14J 3GTPJ 3VPRA 1Y1WJ 2FBQA 1I3QJ 5FGLA 4G12A 3NARA 2CU7A 2CUFA 2K40A 2Y31A 5FKOA 3HEFA 3ON4A 1WH5A 5K7ZA 3PO3J 1BW6A 3BR5A 5E3LA 3S5RA 4FTHA 2YVEA 3ZOBA 1H89C 1TWAJ 2WAQN 4XRSG 3ANPA 2ELKA 4FCYA 1GDTA 3GTLJ 3BQZA 1U9NA 2MSYA 5DS9A 1FJLA 3CDLA 3HTAA 2OF7A 3S15J 2JMWA 3V78A 3JRGA 1Z77A 5GPAA 2NVXJ 4YZEA 4BBSJ 5H9TA 2VKVA 2R7ZJ 5FKLA 3KZ9A 2UXOA 4X6AJ 3SJMA 3EUPA 1TC3C 2GENA 3IUVA 1YRNB 3BR3A 3CRJA 2JWTA 1JT0A 1PUFA 2JA8J 3BQYA 2LD5A 2R92J 3PO2J 1NK3P 3I4NJ 4XIDA 1W0TA 5EG0B 3PM1A 3OIOA 4A3BJ 3E7QA 2O7TA 1U9OA 1SANA 4M3BA 2FJ1A 2QTQA 3BCGA 3HOZJ 2COBA 4FE4A 2NVYJ 5EDNA 3ZQLA 5J1YA 2RASA 2ECBA 2HKUA 1UI5A 1TWFJ 3B81A 4HNVA 4MXMA 3HB9A 4C3HJ 2JN6A 2XGEA 3QKXA 1UMQA 1AKHB 1MSEC 1FTZA 2E1OA 4I76A
chains in the Genus database with same CATH superfamily
3HUGA 2F07A 3ANGA 4XRFA 2OQRA 2RKHA 3C2GA 4XOTA 4A3DJ 2K5CA 2VBYA 5LGTA 2R7XA 3HRSA 3KX2A 4PUSA 2HVRA 3GMEA 3U1KA 1WZ2A 3NNRA 2BW3B 2IA0A 2P5KA 1FYMA 5BS6A 2VPRA 4UXNA 3GF2A 4U7DA 4O3MA 4EATA 1VQ5I 2QF7A 2FUG2 4L9NA 3GLXA 2KT0A 1S7EA 1F4KA 4XM3A 3ABUA 3SFIA 4PDKA 3I4MJ 1PUFB 1J7KA 4KA4A 5E3NA 2IU5A 1B9MA 4XKCA 2LBFB 3MCZA 3O2PE 4C2MJ 1UG0A 2PJRB 2K3PA 2JTVA 3JR9A 1IXSB 4QPQA 1HOMA 4E7ZA 2LKPA 1B8IB 3BG3A 1YS6A 3QBMA 4AD9A 5HDNA 4HG2A 3E6DA 1BI2A 4E7IA 3M9AA 2W7NA 3CDHA 3K4LA 4GYIA 5HODA 5B1AH 5HS8A 4ITVA 2EILH 1G59A 2HR3A 5J47A 4LFUA 1JKQC 1U3EM 2XAUA 4LGWA 2IT0A 5GAHJ 4ESJA 4MEYF 4B3AA 3J7AY 3A2KA 2FD5A 2WADA 3CJRB 1U2WA 3BCBA 3VB2A 1XGMA 3ZMVA 1Z91A 2VBWA 2F4IA 4YFKF 1S5LC 3EDPA 1ETOA 3LSTA 5CYVA 2AXTC 3HKZA 2OJED 1U8BA 3S1QJ 2DA6A 3U2RA 2EBIA 2F6CA 3K1PA 3JRCA 1MNMC 2Y9YA 3FDYA 2FE3A 5IYBJ 2M8GX 1HKTA 1JKRC 1REPC 2ESHA 4C30A 4RGSA 1IUYA 2QIBA 3OYKA 1ERDA 3RJPA 3D0SA 3F1BA 2K27A 2MC3A 2NVQJ 1DP7P 2LF7A 3BP8A 2NAZA 3WTVC 5JLWA 5EGOA 4XN0A 3CMMA 4A3KJ 3KP2A 1JUPA 1LFPA 4LIUA 4AC6A 1O3SA 3RKYA 2FQ4A 1U5TC 2BHZA 2HQRA 3DBLB 3EUKL 4YFNF 2XROA 1I1SA 5CW8A 3FF5A 3GLLA 1R22A 2ZC2A 1A04A 1KU3A 2FF4A 5FKMA 3DPLC 3IL2A 2GXAA 1G2HA 2A2FX 2ADUA 4CGZA 1NTCA 5DUKA 2KRCA 1ZRDA 1T98A 2R5ZB 2EFOA 2WY8Q 4EM2A 2IPQX 4EGYA 3OSGA 1I3AA 2HNHA 3CCVI 2FXAA 2CJJA 2UWMA 1XPXA 4KT6A 3GFMA 2NOJB 4Y13A 3AG1H 3KFWX 3V8JA 3FWEA 5H6QA 4A3MJ 3KCCA 3RYRA 1K61A 2R7DA 3JW4A 3RD3A 3L7WA 2CG4A 1OJLA 2DU9A 4N9IA 2MC4A 3W6JB 3ERMA 5L3GA 3ZCOA 5HS7A 3BNIA 3N05A 3JSJA 3N97A 3WHCA 5D5VB 3BPVA 4BU2A 2OPTA 1SFEA 3FKIJ 3M7GA 1EF4A 3A03A 3EPZA 2R7UA 2DFIA 4ENNA 1VQ7I 1QQIA 2CUZA 2VBZA 3I0TA 2Y0SN 1M1EB 5FFZA 1HLVA 3H3UA 4XLPF 2QKOA 4JKZA 2QA4I 2XF6A 1OR7C 1BBYA 4RMNA 1BR1A 1IUFA 2Z2SB 3DEWA 2G7LA 1G6NA 1SD7A 2MFZA 3OV8A 3HL2A 5F0HA 1P9QC 2XPUA 3H9JA 2JA2A 1O7LA 3KP5A 4YIRX 3GFIA 1T8IA 4KIBA 1VFCA 2X51A 2NYXA 1R5HA 4GYGA 3HTJA 2VB6A 2KIMA 2KMUA 2FEZA 2Q8KA 4BQNA 3IV5A 4C2UA 3IH2A 4XMYA 1WRJA 4I7HA 2HOAA 3BZKA 3K10A 4LK1F 5B1BH 3FK6A 3ONQA 4DOZA 2DMQA 3DKXA 2X0LA 3QPLA 5LEJA 4OWRB 2DQRA 3U1DA 1W36D 1AWCA 4AIHA 1BC7C 1D0YA 2M0MA 4XONA 2XGXA 2HYTA 5HAWA 3WU2C 4TV7A 4CUGA 1DU6A 2R7QA 3CMYA 4HA8A 2JSPA 3CJNA 3E5UA 4RB2C 1ZN2A 3DQVC 3PIPF 3ZRGA 4XK4A 3S2DJ 4Q5SF 1WWXA 4E7JA 3VEPA 1U78A 1Z7LA 3O8GA 3L2UA 3S2HJ 4XLEA 1F5TA 2EZHA 4FHTA 2PI0A 3FXKA 3LSIA 2HPIA 3GX4X 4W97A 3DWLE 2MD5A 2XSDC 3PQKA 4RB0A 2PMHA 4KUMA 3WHBA 1JTXA 4I2OA 2XAGA 3KP6A 2JJ7A 4I98B 5E1ZB 1MBHA 4B4CA 4F91B 3HGYA 4F93B 4EJTA 2XGCA 1FP2A 3LWFA 3QOEA 3RI4A 4BYYA 4I01A 4KJZA 4RGUA 3TQNA 2DA4A 3DV8A 2HDCA 4FETA 5DCFA 4XORA 2HXIA 4Z2YA 5TJJA 4CCNA 5JLXA 1WCMJ 1VQPI 3GTGJ 1UZCA 3L2QA 2X48A 2E7XA 2XRNA 3H5AA 1QZEA 1YE9A 3L09A 4JX6A 2NX4A 3VIBA 3L00A 2STWA 1EH6A 1ZK8A 5CVUA 1RR8C 3ZQGA 2FMYA 3T0YA 3TP0A 3VOKA 2GAUA 3HOUJ 1YITI 1GXQA 2R5YB 2DOEA 1TWGJ 2LYCA 1FOKA 3H0GJ 3HOYJ 4HZFA 2M5WA 1O4XA 3K69A 5A2QK 2XAHA 4ZDOA 1K7AA 2KIUA 2K9QA 3I59B 1J9IA 1AA7A 4DYQA 1Y8QB 3OY9A 3WE2A 2CV0A 1KONA 1XMXA 1IN6A 1RZ4A 3OS2A 2ISYA 2R5YA 1ONVA 3JSPA 3P9IA 1FC3A 1YTYA 3DTKA 3FXOA 1TW3A 5K1YA 3CJQB 3T5XA 3J7ZI 2EFPA 4AWXB 1JI8A 1ETWA 3K4BA 3R61A 2M7AA 5EF6A 4KFCA 3GZIA 2GA2A 5M5WJ 3FHNA 1HKQA 1TL8A 3GTKJ 3SZTA 3PL8A 4LG3A 2GOMA 4P55A 2UZKA 3W6VA 2UXHA 3K70C 3LQQA 2ETHA 2JK3A 3ZQHA 2P7CB 3C1DA 2Y48A 4KISA 5ICGA 5DCMA 2CW0F 5L3DA 3J7AO 2R7OA 4IJAA 2QZ8A 1KU9A 1IJWC 4CYCB 1S3JA 2Z3YA 4X1EA 2AS5F 3K0LA 2ZJPF 3RZDJ 4B3XA 2DW4A 5DTDA 3AFHA 2KISA 1NH3A 3CCEI 3BTIA 1R71A 5L3FA 4A93J 4UVBA 3BPXA 4B8XA 1ZREA 3TDUC 1DUXC 1MIJA 4L9VA 3K7AJ 2KFDA 1LDKB 1OCRH 4CGRA 1E3OC 1YIOA 3SZPA 3W6KB 5IP6A 4ME9A 1SGMA 2QM3A 3HTUA 2VJ4A 4D5FA 2IS6A 3HRTA 4KT5C 1WGXA 1W5CC 3DTIA 3GO5A 2DCEA 1U0JA 4V2FA 3VTIA 1Y39A 1V4RA 3B02A 2LMDA 2R7WA 2DXIA 2V9VA 3IUOA 2PN6A 3VSKA 4CA0A 2H8WA 5FROA 2HI3A 2HS5A 2QENA 3E5QA 1H9TA 3WGIA 3ELKA 3CCLI 3Q0WA 2NS0A 4BXXJ 3GTOJ 1X3UA 3CUQC 1JHHA 1YJ9I 3CJDA 4XSXF 5D8LB 2RC4A 4ASNA 4N4OB 2A6HF 9ANTA 1P4AA 2DT7B 4PGHA 4OIQF 4E7SA 3ABLH 4XNFA 1KYZA 3JSOA 1IN4A 4PFPA 5E79C 4B48A 2DDAA 2PMZA 5E18F 5CVJA 3KIOA 1Y56A 3ABTA 3FK7A 1UI6A 2VE9A 4OIPF 5HLIA 4MTDA 4KNYA 1O57A 2G0EA 1VQNI 3IP4B 1B59A 4RM3A 3VVXA 4A3JJ 2ZSIB 1EA3A 1FIAA 2K3FA 4LLLA 3KYCB 3L2RA 3L9FA 2HDDA 3HPGA 2A61A 4LOCA 4WCGA 4CCOA 5IYDJ 3TGNA 3M8EA 4BJ5C 2Z1DA 2LG4A 4BBRJ 1ZGAA 1P7IA 4M3FA 1R4MB 3BR2A 3S14J 2K9LA 2EIMH 2VN2A 2ZO4A 3VPRA 2DFEA 1SFKA 1I3QJ 1X1BA 3CCMI 1FY7A 1SAXA 1VQKI 3ESWB 1FNNA 4HNUA 1FLIA 1N75A 5FKOA 5K7ZA 1IRFA 3I54A 2J5PA 1BW6A 1IRGA 2L3DA 1WJBA 4B09A 2B9SA 3S5RA 2KJBA 1H89C 1TWAJ 5BMZA 2BXZA 2XASA 4NC8A 4EMSA 3OYGA 1GDTA 2K4JA 5D5WB 2MSYA 5DS9A 1FJLA 3I4PA 3HTAA 2OF7A 4YFXF 4BNCA 3S15J 2DOFA 5DUIA 4DGWB 1CF7A 1LKXA 3V78A 2M1BA 3K9TA 1Z77A 2NVXJ 2F5CA 1ZYRF 2FBKA 3GWZA 5FB2A 5A2QZ 2UXOA 1FSHA 5GAGJ 3KZ9A 4FASD 2GENA 1YRNB 3MQ0A 2JWTA 1SD6A 3RKWA 3RSNA 5GAEJ 2JA8J 1QNTA 3WTTC 1USSA 2WA0A 2OBPA 2KRHA 3DEEA 5LLQA 2EFWA 2ZFUA 2ELJA 1W0TA 5EG0B 4BDYA 3OIOA 1ZRCA 2C6YA 3E7QA 1YJWI 1U9OA 1SANA 2O7TA 4BGDA 2JZYA 2ZMEA 2A68F 2HEOA 1SAUA 2NVYJ 2RASA 2ZNYA 2ECBA 5KAFC 2HKUA 1FPQA 1TWFJ 2IW5A 3DKWA 1XCVA 3HB9A 1KA8A 2XGEA 3DXJF 1Y8RB 4O5VA 1MSEC 2ZXHA 3F21A 2EK5A 3TMOA 1T95A 3S8PA 4M6YA 1LEAA 4U9NA 3C2BA 2M0CA 3OIPA 4HPQA 2MYSA 1GT0C 4MFDA 1PYVA 2QVOA 2W1OA 2GZWA 2BE5F 3CUOA 2EWNA 3FZVA 4GFKA 2KDOA 2K02A 5J40A 4YELA 3DU5A 4P1WA 4HDUA 1K79A 2M34A 5D5XB 3D5SC 1HCRA 2ZMEC 3H5NA 2Y0SA 3A1YA 2Z16A 5LEKA 3HDDA 2M2EA 1MJ9A 2RHAA 1D8KA 3V6GA 2DA2A 4RB1A 4L62A 5CJ9A 4AIDA 4EEFG 2JRTA 1D1AA 5D6EA 5HLGA 1MKMA 2UV1A 5JFRA 4HLYA 1Z67A 3PUBA 2L9NA 4GCLA 3BG9A 4CHUA 3HHGA 3RPUA 2L7MP 5FKKA 5HNFA 1S8NA 3KEOA 1TP4A 2W4SA 2CQXA 2ZKZA 2PEXA 2BHYA 2EV5A 3ON2A 2STTA 1R1VA 4JP0A 3K8PC 1QPIA 5B66C 1JHFA 2ID6A 3BOQA 1STZA 2AHQA 1R5ID 5JR3A 4RS8A 4XLFA 2QEXI 4OIOF 4HRIA 5J4VA 2ZJ2A 1TQPA 1HW2A 2OCEA 4UUSB 3CP2A 3CCSI 2HPMA 2FQ3A 1T56A 1TNSA 3K4NA 4U88A 2IGOA 2EFQA 3WU1B 3UNGC 5KVRA 2CSOA 3RPQA 1KU2A 4RDUA 4A2UA 2Y75A 2QQ9A 3MVPA 3LA2A 3Q0VA 3L1PA 3CC7I 2O7OA 3VUQA 4RGXA 4CCMA 4IRIA 1RRJA 2G3BA 2Z9OA 2VKEA 1Y0UA 3BY6A 1A5JA 3LNQA 3UR3C 4ESBA 1UCRA 1Z3YA 4IHWA 2W85A 3I5UA 3WTWC 1H88C 1V55H 2CQKA 4NC6A 1JUSA 2WWYA 1RUNA 2DA3A 3H9QA 2EINH 2DYRH 1T08B 3NAUA 3CMEI 2A07F 3GTQJ 3FXLA 4JBAA 3FMRA 4HEA2 5DDGA 4DVYP 3MWMA 3BTLA 1W36C 4II3A 3OYAA 2RGVA 4G8XA 5JHFA 2E2HJ 4ZYEA 1P6RA 4ETSA 1LUJB 4M3EA 1VQ4I 1N77A 2Z33A 2BV6A 4PSXA 4Q48A 3K2ZA 3J81Z 2JSCA 3CDIA 3IWZA 3OIQA 3TOBA 3D1NI 2DPDA 3C07A 4IHVA 4CZZA 2IEKA 1PP7U 3DEUA 4WF2A 5LD2C 1BN5A 2LF8A 5HVQC 3I71A 4ZH4F 2CO5A 4IHYA 2DFFA 2LK2A 4QWQA 1W1WE 1GHCA 4Q4ZF 3E6BA 1X1PA 3E1SA 2WY7Q 1U5TA 2EZIA 2EIKH 1B9NA 3EYIA 3P7NA 4IX7A 5D1RA 1X3WB 2AO9A 2E35A 2LREA 1LB2A 3AQTA 4IRVA 1MD0A 1V3FA 4MNUA 4D9JA 3ROUA 1K83J 1TT0A 1XB4A 2CFXA 1IRZA 4EM1A 1ITYA 2XB5A 1EV7A 4XRMA 3MKZA 4DZJA 3BHQA 4MQVA 3OYJA 2TRTA 3OL4A 3QP6A 1CQTA 1YG2A 3NXCA 5H2FC 1NG7A 3VW0A 2EPFA 3JTGA 2B3WA 3FX3A 4IHSA 2NS8A 1I1GA 2QCOA 3NWSA 2L01A 2EB7A 1O3TA 2H09A 1OR7A 4AVZA 3TEDA 4G7OF 2O61A 4LIVA 5EGOB 2OD5A 2XAJA 3EUAA 2HWVA 1OMIA 2VOPA 3FHZA 2P81A 1I5ZA 3LL7A 4RBOA 3VWBA 4A6DA 4HV6A 4I0AA 4LD5A 4XOPA 2A5WA 1R5GA 3NS4A 3QOPA 4XLAA 4O6JA 1MZBA 4QLCU 1WJFA 1XC5A 3S17J 1IV6A 4OMZA 4D5CA 3F8MA 2HZTA 2P4WA 2VUMJ 2EQRA 4AM3A 3S1NJ 2LNBA 2F5EA 1I50J 2ME0A 2IS1A 3GEZA 4JX4A 2OCCH 2FX0A 2OI8A 2ZOZA 2EJRA 3EYYA 1MJAA 4H0EA 1T39A 4EM0B 2J5OA 1HDDC 2PX9A 2L4MA 2IA1A 1DPUA 2ESNA 3LSGA 3Q3SA 2EA2A 3E7LA 2K9SA 2R7SA 4LJZF 3H5RA 4FQGA 5EEGA 5FD5A 4AU7A 4Y7NJ 1HXDA 3A0HC 2HDWA 1USTA 5BQTA 2H1KA 3O6BB 4CSWA 2V26A 1YW8A 2LR8A 3TOAA 2VBXA 1MNDA 2O3FA 3WTXC 4XN3A 5J3LA 3S3OA 2O8XA 1AOYA 4A3EJ 4BACA 4RAZA 2QUFA 3VYTB 2QSHX 3NI7A 1JGGA 4KICA 4OD4A 1OPCA 4U0VA 2DTRA 4M9XA 4L5IA 1X58A 2H6BA 3ISPA 3U21A 2WGBA 1ZELA 3BT9A 3MD2A 4XQFA 3CMAI 2IRFG 1SVMA 3ZMTA 5CQGA 2KIQA 1Z6RA 2WUIA 3BTCA 3C2HA 3AL0B 2CS3A 2PMZN 4YIIA 3VP5A 3HIMA 1V5FA 2V7FA 4ZZDA 1WSUA 5DM7F 1WHUA 1RNLA 3F6OA 4IEJA 3S2WA 4UUSA 1PVEA 2GIZA 2P0WA 2X4HA 3MZYA 1VQ6I 3G56A 4CICA 1OISA 2DT5A 4N9HA 4C9YA 2REKA 2PQ8A 2LTPA 3H3ZA 5HDGA 3G4SI 4DW6A 3CCYA 4S05A 2VQGA 2R7RA 3WE3A 2VI6A 4KWAA 5ILVA 2EV6A 1J09A 2D2WA 4MIMA 2XSJC 2E5ZA 2RVCA 1SVOA 1VTNC 5CLSA 3BTJA 1K78A 4L9JA 2RNGA 3QQAA 4RAFA 5DV5A 4R1HA 2ID3A 3CO7C 5HBUA 2G7HA 4NUBA 1VQ9I 4HYEA 1NHAA 2FA5A 4KMUX 4OOIA 2F5VA 2O8KA 2PZ9A 5J1RA 1FX7A 5F64A 2DPUA 3HJEA 3FM3A 4NELA 1GLNA 4A5NA 4DNCA 3FIWA 1KQ8A 5KNLA 3BROA 2A5YB 4ZZLA 3GTMJ 2EV0A 2Q1ZB 1IDZA 5K7FA 1Q1HA 2O03A 3DFGA 1VNDA 3F0CA 3OWTA 1JUMA 1W5SA 1GVJA 1S7AA 3JCUC 2GBYA 1D5VA 4ZC3A 2BW3A 1R4NB 1SEUA 1P92A 2Q24A 3GXOA 2XGDA 2Y0MA 4EJOA 1JJ8C 2PBIA 2A05A 3I59A 2ELHA 1RIOH 4P9UA 4IF4A 2Y69H 1FTTA 5EZHA 3GBGA 3BJ6A 3EGQA 2FOWA 3AAFA 5BPDA 2Q0OA 4RAGA 2NNNA 4HX7A 3B6CA 3I9V2 3H0DA 5FLXZ 1YHQI 5BNGA 3TBIA 1O3QA 3K6GA 2KKOA 4S0HB 2DJIA 4HSRA 2DMPA 4OAYA 1U5TB 2UXPA 2HVQA 1PDNC 3VVYA 1R23A 3PPBA 5E1XA 1T0FC 3A01B 1BOBA 1FOYA 2BBYA 3E3VA 3MKYB 2DAOA 4M72A 2M30A 5LHGA 1R49A 5HS9A 4Z6YA 4GDFA 2B1EA 3FBNB 4AIKA 3T6NA 2NVTJ 1XSVA 1IF1A 4BY1J 1XSXA 4WXDA 2F5FA 3EQLF 3FMSA 5J6XA 3TKYA 4B43A 3WTZA 5D4SA 1IN8A 4UUTA 4L18B 1E2XA 3I58A 4XSZF 4CYCA 2DMUA 2ZCWA 1GV5A 1R58A 5C44J 3WGHA 1HKSA 3ZN1A 3KNWA 1QHHD 4IHTA 2CQ7A 1V5GA 2DTZA 5LHIA 5ERIA 5BPIA 1HF0A 1ETYA 1XGNA 4IZZA 2KP6A 4OAZA 3TO7A 3HTIA 3DU6A 3H35A 5E8GA 3F3XA 1ZG5A 3DLLF 2HVSA 2R7VA 2FSWA 2LKSA 3IH3A 2P5LC 3FBIB 1OFCX 2EZLA 4CZCA 4XR6A 1VQ8I 1Y1VJ 3AG4H 4BE0A 1G3SA 4BE2A 4NBQA 2EIJH 1W0UA 1K6YA 2VASA 3A01A 4M9SA 3VVZA 1HDPA 2NVUB 3LSMA 4DBQA 3OMYA 3K2AA 4ENMA 3SEQA 2ZFWA 3LSHA 3M8JA 3QPHA 1MW7A 1X1DA 2CFOA 3S32A 5LGUA 4NB5A 2MH9A 3HEFA 5CKTA 1FOXA 1WH5A 2BOLA 5D5UB 1XSDA 3BR5A 5E3LA 1KGSA 1VZ0A 4EJUA 4FTHA 1TLHB 2KQRA 3RCOA 4XRSG 3ANPA 3HXLA 1MMGA 1U9NA 5LRRA 2OTLI 2VE8A 3CESA 3IHUA 2NNYA 3WTYC 3EETA 2HZDA 4BQQA 4YZEA 5H9TA 3GFJA 1Z05A 4Y15A 2VKVA 2R7ZJ 3QYBA 5FKLA 2VXZA 1FSEA 4IXAA 3CRJA 1WVRA 2MABA 1F9NA 3RYPA 1L0OC 1P2FA 1YS7A 4LG0B 4EV0A 2R92J 3LA7A 3PM1A 3HC7A 4A3BJ 4G7ZF 1ACIA 3REOA 4ZYAA 3JTHA 5JI6A 3HOZJ 2VT3A 4FE4A 4GRIA 5EDNA 3ZQLA 2E71A 2FNAA 1UI5A 2NXNB 3B81A 1CGPA 4E70A 4U7BA 6PAXA 5IY5H 3J80Z 3W3CA 1XDSA 3BG7A 1VQOI 1FWZA 5LFAA 1UMQA 2GIVA 1XMKA 2AQFA 3CP8A 1FTZA 1X1CA 1J75A 2L2OA 4CO8A 3R0JA 3ABKH 3CF5F 5BOXA 3I64A 2RN7A 3TO6A 1LE8A 2L9RA 5HOOA 3HG9A 1WQ2A 3A02A 4LB6B 2XDVA 1Z6TA 3KLOA 3ZQCA 3M4OJ 1OYIA 4IOAF 4P9FA 3IH4A 4JNNA 1GV2A 1X2MA 3GEUA 2WBMA 3LSRA 4IHXA 1LE8B 1V5EA 3ZN0A 1KYWA 2QQAA 3HPHA 1O3RA 2OU2A 2VC0A 3OOUA 4NC7A 5TISC 2K9NA 1ZAOA 1ETVA 1BR2A 4UB6C 3IRRA 1DU0A 4HF2A 2HYGD 1HC8A 3ZGKA 3DPJA 3IAM2 5KK1A 2CUJA 5LBQA 4UNOA 4A3GJ 1IRXA 1ZARA 2QKMB 4WIBA 1RPWA 3CUQA 4KIFA 4QPOA 1S72I 3FXQA 1RESA 2GA1A 4DYRA 2PFBA 1MMNA 2X9DA 2YS9A 2I10A 1UJ8A 3M1CA 1W4MA 4W1UA 3S1MJ 3JRBA 3QWLA 4L0YB 3SHFA 3P9TA 4BJ6C 2XAFA 1YIJI 3ZQ7A 4DZPA 3GYHX 1S29A 3DPTA 4EGZA 4IVNA 3SEZA 1TNTA 4K2EA 1KU7A 2DDBA 2E2JJ 1BJZA 1MJBA 2KLOA 3K70D 1I39A 2LY9A 2MD0A 1OCZH 3AL0C 1S6LA 3UKGA 1SC7A 2VJJA 3G2BA 1UFMA 3VOEA 3K4KA 5EJCA 5M3FJ 1Z7UA 3LJLA 1A6IA 2OAZA 2V57A 4M71A 4OD5A 1T6SA 2I5UA 3CLOA 2RV8A 3QAHA 2DODA 2GXGA 2JT1A 2XV4S 5CVIA 5D8KB 3QP5A 2V1DA 2GFNA 1B72A 1N25A 3SZGA 2DG7A 4M9ZA 5F1JA 3J7YJ 1B6AA 1W5TA 2L7KA 3LOCA 5IOYA 2MW8A 1HW1A 2TDXA 2LDUA 2GXBA 4RGRA 1D1CA 1ZKGA 3MZ8A 3RKXA 2K7LA 2VPLA 1IO2A 3ZMDA 2LKXA 5L3EA 5IT9K 1RI7A 4RLFA 2X6YA 4BXFA 3PSFA 2FOKA 2Q2EB 1MDMA 3PQJA 3TDZC 2X85A 3SFZA 2R93J 2L02A 4BUPA 3GVAA 5M5YJ 2PMUA 2H8RA 1QBJA 2FBIA 2JPBA 2D6YA 1BI0A 4IQ4A 5ICEA 1BW5A 5ILSA 4D7MA 3KKCA 4IOCF 3D5RC 3FXUA 1GXPA 3LSPA 1VF9A 3BLYA 2XF5A 1HA8A 1P4XA 4KITB 4G6TB 4NDLA 1KZHA 1EJ9A 3IKVA 3FXMA 1TQMA 3BR0A 3LMMA 3M8FA 3FM5A 4N0BA 2E7WA 3E0JB 3JRHA 5IP9J 2X1DA 2E60A 2GOXB 1XDUA 4BQAA 2M7BA 4GCTA 3F72A 2LP0A 2GWRA 3BJOA 5B3SH 1QRYA 3S1RJ 2XVCA 5F27A 1XD7A 4BHCA 3HUGB 5J8FA 4F3QA 5C4XJ 3IWFA 1MMAA 4PSWA 1LEBA 1JTYA 1X1AA 4NN1A 3U9GA 1FYLA 3O8HA 2UXNA 2MA3A 1IDYA 1QVUA 2WAFA 4Y52J 4PZJA 4LG0A 3DKYA 4PGGA 3WG7H 5HDKA 4KDPA 1YLFA 3GCMA 3F9KA 4RA2A 2MGQA 2LH9A 1N78A 2HQ5A 3P9CA 1F36A 3ASNH 1WJDA 5GP9A 2LBFA 4C3JJ 2CW7A 5FGMA 5AONA 1YJNI 2PJRA 1ZLJA 1DP3A 2QOPA 4E7LA 3NRGA 1LDJA 2HQNA 2XPWA 4AVPA 4ACIA 2E19A 5AQCA 2R7FA 3O60A 5KHDA 4S04A 3HOVJ 2ZSHB 1DGWY 4BL0B 3ZR8X 2DFHA 5F0FA 1BJAA 2M9HA 2MLKA 2LRDA 2WC2A 2CRGA 1C0WA 5HSZA 2ICWG 2VT2A 3A4CA 4OMYA 3COLA 5D18A 4HX4A 1RKTA 3GW2A 2COMA 3MN2A 4C3IJ 2PBXA 3VOXA 5FHPA 3RDIA 3VFZA 2RQPA 1SFUA 4CCLA 1WFXA 1DQUA 4C2MA 1EH7A 5F1RA 3MNLA 2CWEA 3KP7A 5GTIC 3BZCA 1EH8A 2W57A 1Y0NA 5DEQA 1QVTA 2AQEA 1H8AC 3OYNA 3ZMUA 3DBRB 5E8IA 1G3YA 2KL4A 1B8IA 2DLLA 4J19A 1MH3A 1YYVA 3K1NA 5ICCA 4I99C 1LDDA 4MLOA 4XLCA 1QO0D 5EFYA 2HTSA 4I09A 4QSHA 3HBLA 4MGRA 3C3WA 1D3YA 4HKUA 4V19K 4B1RA 2YVHA 2QQBA 4P5OA 5ILUA 2O6GE 4JYKA 4WX9A 3WG9A 2QSGX 2XC7A 3S16J 4UVAA 1B4AA 4E7KA 2CGPA 5FKNA 2XKPA 1WJCA 1WH7A 2CQQA 5EG0A 2DK5A 1FBUA 1Z21A 1HSJA 3SYTA 2IA2A 3B6AA 2R0QC 1QU3A 4RB3C 3F6VA 2V9PA 4P96A 2BXYA 1AKHA 1E3HA 2QGUA 5EYRA 4XKBA 3TW6A 3RKQA 3ZQFA 3HRUA 4HDVA 2OA4A 2VKHA 2KJCA 2KZGA 2YSRA 1F1ZA 3KETA 1TW2A 2QQ8A 3LSJA 1LJ9A 4CCJA 3H3VK 5D4RA 4PCQA 4J01A 1ZLKA 2IJLA 3R6SA 5M5XJ 4A0XA 4BH9A 1FEXA 1UHMA 1MBGA 3RQIA 3BR6A 1MBKA 1BI1A 1ZR4A 1J0RA 3QYEA 3OYLA 4NQWA 5KAIC 3V8KA 4GGGA 3RH2A 5AIQA 2JA6J 2A69F 1OCTC 1GUUA 3QRFF 1UG2A 2QBYA 5EEAA 2VQLA 2ZB9A 3M1EA 2IXSA 2XAQA 2BY0A 3CLQA 2X1CA 3KE2A 4XLNF 3QPTA 4QIWN 2B0LA 1DPRA 1Z1DA 4ANJA 2O9LA 4CDGA 3KP3A 2M45A 4U0WA 2DI3A 1X4PA 3P9KA 2DG8A 2X6XA 1R36A 4NQWB 2Q2EA 1MDMB 1MH4A 3V8LA 4BQOA 1MSFC 1TTYA 3GUDA 3K4MA 4EQQA 3LSKA 4NHJA 1WI3A 1FMVA 5K5QA 2QBYB 5DYMA 2D5VA 2W48A 5D6FA 5J1UA 3JREA 3VW1A 4MHGA 4ZYGA 4RLQA 2N8GA 4HOBA 4FISA 4XKWA 3OYHA 1E17A 4B44A 3ZMZA 2EH3A 1HW5A 2DJNA 4BEHB 5IOZA 2Z5UA 2BY2A 4MTEA 2X6OA 3B73A 3BJAA 5FJ8J 2PJPA 2UXIA 2GLOA 2DMTA 1X3ZB 2Y30A 5J8CA 4F55A 3D5LA 1XS9A 2RNJA 1UHSA 4HSTA 1I6HJ 1QHGA 4HW0A 3V42A 5K5RA 2FMLA 3BWGA 2DMNA 4ENJA 3HRMA 4HBLA 4AC0A 1V54H 3J81K 2VJIA 1NG6A 3NEUA 2BVMA 4M73A 3ULQB 3PNTA 4MEXF 1LVKA 3LAPA 1TWCJ 2RQQA 4MQ9F 5HLTA 3DTEA 3G1OA 2WV0A 1MBJA 2E36A 1QZZA 3F8NA 1IG7A 5F6FA 3OS1A 2BZTA 1R6RA 2L54A 2RDPA 3AG3H 4U0YA 1P7JA 3GZ6A 2OTJI 4ZYHA 1IC8A 4JK1X 3QPSA 4A3FJ 3ASOH 1OYYA 2OC6A 5C4YA 1FBQA 3EUHA 3C7JA 3VSLA 1F43A 2L4AA 4XLHA 3HIFA 1ETXA 3MKLA 5FO5A 3PUFA 2WAQA 3CJTB 3X2QH 2LY2A 2HKOA 3RZOJ 1J2XA 2NP3A 2X6WA 3TO9A 3CQZJ 5K5OA 1LQ1A 3LHQA 2HYFA 4IO9F 3BZ6A 1K4SA 1PUEE 2NP5A 3OYIA 2TCTA 4Y33A 3G1LA 2B7EA 3F23A 2CV1A 4AIJA 3G1MA 2A6TA 4U9LA 1Y1WJ 2FBQA 3WGGA 4R8HA 2JUCA 1D0XA 5FGLA 2X1EA 2CU7A 1JGSA 2CUFA 2K40A 2Y31A 3NARA 3V7CA 4G7HF 1T0FA 2DO7A 1FBSA 1B1BA 3PO3J 2QSFX 2QLZA 3KZZA 3FXRA 2DYSH 2MH2A 4G94A 4IRGA 3ZOBA 4M74A 2DOAA 2ELKA 3O3KA 4FCYA 3GTLJ 3F22A 3BQZA 2BGCA 2UUZA 3TL4X 2JMWA 2OV7A 3W2WA 1IW7F 1I27A 3SXYA 1L3LA 2JVGA 2VONA 3PFYA 3V4GA 1Y6IA 1SD5A 3SJMA 4X6AJ 2ZY9A 3EUPA 1T2KA 3IUVA 3BR3A 1YX5A 3CO6C 1JT0A 5AIPA 2F4MB 2F48A 4HAMA 4UHTA 4UV8A 2BEOA 1W7PB 2LD5A 3I4NJ 2BY1A 3K1MA 1SVLA 4JQFA 1A36A 3LFKA 3QU6A 4F92B 4PJNA 3PIOF 3IAS2 2FJ1A 3BCGA 4A6EA 4HV5A 1HQCA 4LLNA 2V1NA 4MXMA 5GTHC 4HF1A 2VIXA 2JN6A 2WB1A 5JHUA 1YW7A 4HX8A 3SQNA 1FZPB 2IGNA 3L2WA 1R1TA 2AXLA 1AKHB 1IV8A 4UVCA 2E1OA 2W00A 1XGSA 4A12A 5TGTA 5L3CA 3G3ZA 1WJAA 5LHHA 2WAEA 3G7RA 1YW9A 4HLXA 2VQHA 4LITA 2VOOA 5CXIA 1YX3A 1SFOJ 1ENHA 1XMAA 2CMPA 4WXHA 3PNYA 1WJ5A 2VXDA 4WWCA 3A0BC 2OUMA 1XN7A 4B47A 3AQSA 3OYMA 1R00A 2EZKA 2FJI1 2UXXA 2CUEA 4YEJA 4WK8F 3R4KA 4DQ2A 1ETQA 2ZBKA 3OR2C 1KQ9A 2YX7A 3HGGA 1MMSA 3ZMSA 1K4TA 3TP3A 1W7PA 1G4DA 1PJRA 2XIGA 2D1HA 1LVAA 4A69C 2G9WA 4HQMA 4G9YA 1SFXA 2V4JC 4RAYA 3G71I 1QA6A 4XL9A 5DCMB 3OS0A 1FP1D 2V6CA 2F4OB 1VQMI 4UB8C 3HKZN 3KZIC 1NK2P 2IS2A 3I53A 2R3SA 4KN4X 1YQAA 3BCAA 3R0AA 1IXCA 5C3EJ 5LRSA 2QWWA 1A35A 4I6ZA 1OCCH 2JA7J 4D0PA 3R60A 5DD8A 5H6RA 2NOGA 3DF8A 1WKMA 5IT9Z 2ISZA 5K7HA 2CV2A 2W53A 3LWJA 5K58A 3VYUB 4H4KC 2M3AA 1D5YA 2YUSA 4JOMA 3ABMH 3BDDA 4V2GA 4XICA 4BS9A 4MO7A 4A5MA 1RC9A 3AG2H 3KEYA 2WB1N 2HOTA 2ECCA 2BY3A 3WTSC 4F52A 1X2NA 3F8BA 3VODA 3FMQA 2KPMA 2ZCNA 4PJ0C 3CZ6A 2HFHA 1IAWA 2L7ZA 2CW8A 2HGCA 3M07A 5F04A 2HOEA 3LAJA 1FMWA 4U87A 2V1UA 4A3LJ 2DA7A 2H6CA 1ZG1A 3PFIA 1RETA 3DLAA 1JKOC 1KQ0A 3OYCA 3HM5A 5L3BA 3ZQIA 1ZR2A 2XB0X 4ZDPA 2VODA 2W25A 3JRFA 2YVXA 4YIFA 5IYCJ 4X0GA 2ZCXA 1J5YA 2PFVA 2DA1A 3MKWB 5TRDA 3HTHA 2K4BA 3OR1C 4BHBA 2M87A 4FX4A 3H9GA 2VJ5A 4Y3OA 3E6CC 3E5XA 2BVLA 2I8DA 1OQYA 1I6XA 2E1NA 4BE1A 1UELB 2DN0A 1JKPC 2D45A 4M6XA 4A3CJ 3FXJA 4FE7A 1TWHJ 1BIAA 2V79A 2WTEA 4GCKA 1QZYA 4ABZA 4IL6C 2ZXWH 3IKTA 1POGA 2HQAA 3MMYB 1K78B 1J59A 3CCRI 3MZHA 1IGNA 1WPKA 4IPAA 2P5VA 1Z0XA 3BC8A 4HNTA 2O0YA 1TZLA 3OYFA 3QODA 3CCUI 3I56I 5ED4A 2XUBA 1A31A 2Y9ZA 4A0ZA 1MBEA 5FFXA 3I55I 4M3GA 2KDZA 4PXIA 4AYBA 2JPCA 3OYDA 2H1LA 2DK8A 4I0BA 5E20A 5ICFA 3FRQA 2R7TA 5HLHA 4L5JA 3HSEA 3EUHC 2KRFA 3ZP5A 4GO1A 5DAJA 2E1MC 2M4KA 3KPHA 3RQ4A 1JJ6C 5IPAA 1OLTA 1U6GA 3NWTA 4BHPA 2VC1A 1MMDA 4L9TA 3AKZA 4BY7J 3V7RA 4F7ZA 4ESFA 4J00A 4PK4A 1XGOA 1P4WA 1FOWA 1O7FA 2VKDA 1HBXG 5FMPA 3S93A 1K6OA 4BXUA 4MFEA 1BC8C 5JVTA 5CPRB 3N4MA 1YRNA 2O5RA 4GFLA 3KZYA 4XKVA 3K4CA 3DPUA 1ZG3A 1BM9A 1ON2A 5HNHA 1ON1A 1OYWA 3ML6A 5DD4A 1YOVB 4OIRF 2L9SA 4DIQA 3H92A 3KEQA 4LLGF 3BG6A 3FKJA 2ZJRF 3NPIA 3HYIA 4YRVA 2FNPA 5E1WA 2IP2A 3JRAA 5GPCA 4ZTJA 5C4JJ 4M3DA 3CCQI 2JRMA 2P7VB 1VI0A 4LMYA 2KIFA 2WV1A 2XKOA 4PJJA 2JQ7A 1UB9A 3HOTA 1XCBA 2HTJA 4ON0A 4EJVA 2ACJA 2GUHA 3MEXA 4G6DA 1RR7A 2HU9A 2OQGA 3CTAA 3CC4I 4DBRA 2L5QA 1T38A 3Q0UA 3VYSB 4CXFA 2GQQA 5CVVA 1Z9CA 2ME6A 1W7PD 3RIRA 1APLC 2YPRA 4CYDA 1YFHA 2KZVA 2R4GA 4XBFA 2LVSA 1R1UA 1DGRM 4IKFA 5FLXK 4ICHA 1JE8A 1MBFA 2E2IJ 1Z3XA 2G7GA 1BA5A 4FX0A 3KKDA 1XG1A 1FIPA 2EFNA 1IZ1A 3ECHA 3PJRA 4JL3A 2V9KA 2G7UA 2JVHA 3RPUD 3WODF 3SDBA 2LOOA 2M8EA 4BDZA 3JAMK 4D1QA 3M3YJ 5GADJ 2HXOA 1JXSA 2A6EF 3PNVA 1BOAA 3OYBA 2VLAA 2LC2A 5FLVA 3HOWJ 1SMTA 4A3IJ 4ZJZA 4KIGA 1QPMA 3QYFA 1FYKA 2YU3A 5FRMA 1WI9A 1GVDA 4Y17A 1MGTA 3JRIA 1AHDP 3IC7A 4RM2A 3HSRA 4OINF 1G8XA 2LSOA 1OCOH 2CQNA 1JT6A 2MBFA 4PJLA 2JUGA 4HQEA 2ZNZA 1RKWA 1ZQ3P 2PG4A 4HF0A 3L2VA 4ZDLA 2UXUA 3VDXA 3Q9SA 4E4HA 2RREA 4WXCA 2A3SA 3LA3A 3CCJI 1LFBA 3DBHB 4OU0A 1LNWA 3BR1A 3COAC 1RUOA 5EZGA 1D8JA 5F0CA 1ORKA 2IGKA 3TW7A 1BR4A 1ZTRA 4MK6A 1SMYF 1D1BA 1TQIA 4DJAA 1BI3A 3JRDA 3G6EI 4C2TA 3GZNB 4PJMA 2E1MB 2Z99A 2EA4A 2LY1A 3IRQA 2IGMA 5IP7J 4L5EA 1ODDA 3HSFA 2KHMA 4JX5A 2IS4A 1ETKA 1G3WA 2OERA 4M6VA 2P8TA 4UUVA 1XTAA 4CCKA 1UHWA 5FRNA 4AF5A 3CWRA 5KCMA 3HOXJ 2DA5A 2RAEA 1D0ZA 2LLKA 4PFOA 5CVRA 1SD4A 2XRLA 3F8CA 5CXGA 3BJBA 2E5NA 2VQCA 4BKXA 2CYYA 4IRHA 2JA5J 3MAJA 2DT6A 2ZXIA 3CUQB 5B5EC 1IN7A 4EVIA 1UAAA 5E3MA 1R7JA 4G6QA 3T8TA 1Q1VA 4D7NA 2K9MA 1E0EA 1IN5A 2IVMA 3DCFA 3OL3A 4I02A 4Y4RA 5FLMJ 3FISA 3CC2I 3BRUA 1TBXA 2QWTA 2B63J 3H1CA 4ENKA 2L7FP 2K85A 2HKXA 1T33A 3T8RA 2L9VA 3V7SA 3SDGA 4YG2F 3J80K 2YU9J 3HTSB 2DBBA 4LB5A 3SWHA 4UDSA 4KMFA 2NRAC 3VW2A 2L0KA 1AU7A 3KYDB 1R9TJ 4XRSA 1X19A 3OSFA 4QTRA 5LGNA 2XHKA 2LFBA 3PASA 3E97A 3OYEA 2E1CA 3NQOA 2E34A 2BYVE 3KYLA 3BG5A 2H94A 2MG4A 3VYRB 2G7SA 2V6EA 2ZJQF 2XPVA 1EKEA 4N4NB 4AYBN 1B72B 3ZXSA 3Q9VA 3HE0A 2XDNA 3LQRA 2HOSA 2PLYA 4A0YA 4IQJA 2QKLB 1CF7B 5CQEA 2ZCMA 2DQLA 2IAIA 3GFLA 1OCPA 5JVGF 5H20A 3I3LA 3CF2A 3NRVA 4CH7A 3ERED 1LFUP 4DYCA 2R5ZA 5F08A 1ZRFA 1BL0A 3W2VA 1G3TA 3WU0A 2D1VA 5FD6A 2ZXJA 4ZYDA 2IBDA 3ZQQA 2ZOYA 2W82A 1ZGWA 3Q5FA 4AUXA 1S9HA 4GFBA 5EEHA 4BAYA 2HYJA 2NS7A 5M3MJ 5DM6F 2Y2ZA 3ECOA 3LFUA 1DDNA 5E17F 4GCVA 1YI2I 3HZJA 2ZMEB 3CD6I 3DP7A 5D19A 5E3OA 1H0MA 1MNEA 3P5JA 3GTJJ 2H27A 2GM4A 3K4JA 3GTPJ 3KLNA 1VQLI 1OKRA 4G12A 3WTUC 4BJTA 1U8RA 2W84A 3ON4A 1YO5C 3MFKA 1ZHFA 3S3MA 5J4YA 2YX4A 1ULYA 4LK0F 2YVEA 2XF7A 1IXRC 2CH0A 2WAQN 2K86A 3RTRA 1BIBA 3F8FA 4GXOA 2P6SA 3ZPLA 4KYWA 3L2CA 3G73A 2FRHA 3CDLA 1ZGJA 3H36A 4ZTFA 4UV9A 3C18A 5IT3A 1QGPA 1ZH5A 4E7HA 2F2EA 3JRGA 2QYOA 4EJWA 5GPAA 2OZ6A 4BBSJ 4L0ZB 3HHHA 4R79A 3T1BA 1TC3C 3QU3A 2FU4A 2W24A 3S3NA 3HOSA 1PUFA 2M4GA 4KN7X 3BQYA 4UY8I 3PO2J 1NK3P 4XIDA 2MLGA 1XX5A 3E6MA 1X4OA 2V1XA 3OOPA 2P6TA 2F5DA 1S7OA 4BEHA 1FT9A 4M3BA 2OZUA 4II2A 2FBHA 3KP4A 1LPQA 4NNJA 2QTQA 1WJEA 2COBA 1H9GA 3W2AA 5J1YA 2VL8A 2YR2A 4Q47A 4HNVA 3GZ5A 1HSTA 3JAMZ 4C3HJ 1PP8F 3QKXA 1A6QA 1TT5B 1E3PA 3PSIA 4FT8A 4E6KG 4I76A
chains in the Genus database with same CATH topology
2F07A 3ANGA 4A3DJ 3C2BA 2M0CA 1LE8A 3G7RA 2L9RA 1GT0C 5CXIA 4MFDA 1SFOJ 3NNRA 1ENHA 3A02A 2VPRA 3ZQCA 3M4OJ 3AQSA 4GFKA 3IH4A 2QF7A 2EZKA 4JNNA 1X2MA 1GV2A 3GEUA 2KT0A 1S7EA 2CUEA 3LSRA 4IHXA 1LE8B 1ETQA 3SFIA 2M34A 3HGGA 3I4MJ 1PUFB 3TP3A 5E3NA 2IU5A 3OOUA 1HCRA 2K9NA 4A69C 4C2MJ 1ETVA 3HDDA 3JR9A 2M2EA 2RHAA 3V6GA 2DA2A 1HOMA 1B8IB 1DU0A 3BG3A 4L62A 4EEFG 3QBMA 3DPJA 3HKZN 1NK2P 4A3GJ 4GCLA 1RPWA 3BG9A 5HODA 1RESA 4DYRA 2L7MP 2X9DA 5FKKA 2YS9A 2I10A 4W1UA 3S1MJ 2CQXA 3JRBA 5C3EJ 1JKQC 3ON2A 4I6ZA 2JA7J 3P9TA 3LWJA 2NOGA 4JP0A 2W53A 5K7HA 1QPIA 5K58A 4DZPA 4B3AA 2ID6A 2FD5A 2AHQA 1D5YA 2YUSA 4V2GA 4XICA 2E2JJ 1BJZA 4MO7A 2WB1N 2HOTA 1ETOA 4UUSB 2ECCA 2LY9A 1T56A 3UKGA 1X2NA 1U8BA 3S1QJ 5M3FJ 2DA6A 2EBIA 2ZCNA 3LJLA 1A6IA 2V57A 4RDUA 2L7ZA 3JRCA 1MNMC 2Y9YA 5F04A 3L1PA 3MVPA 3Q0VA 3VUQA 2O7OA 5IYBJ 4A3LJ 2DA7A 2M8GX 2G3BA 1JKRC 1RETA 1JKOC 2VKEA 3HM5A 1A5JA 3LNQA 3ZQIA 2QIBA 1ZR2A 2GFNA 2XB0X 4IHWA 1B72A 3F1BA 3JRFA 1H88C 2NVQJ 2DG7A 1JUSA 5F1JA 3LOCA 2DA3A 5JLWA 5IOYA 3NAUA 2MW8A 5IYCJ 5EGOA 2ZCXA 3GTQJ 1ZKGA 4A3KJ 2DA1A 1JUPA 3HTHA 4AC6A 3BTLA 2LKXA 2FQ4A 2E2HJ 5CW8A 5FKMA 1G2HA 1NTCA 2DN0A 4M3EA 1JKPC 2R93J 5M5YJ 4A3CJ 2R5ZB 2H8RA 4FE7A 1TWHJ 4GCKA 4ABZA 3D1NI 3OSGA 3C07A 4IHVA 2IEKA 2CJJA 1POGA 2D6YA 1BW5A 4A3MJ 1IGNA 1WPKA 4D7MA 1K61A 3KKCA 1Z0XA 3RD3A 4IHYA 2LK2A 1OJLA 3LSPA 1VF9A 2Y9ZA 1MBEA 2KDZA 4PXIA 4M3GA 3BNIA 3JSJA 4NDLA 3WHCA 2EZIA 2OPTA 3FKIJ 3FRQA 1EF4A 3A03A 5D1RA 5DAJA 2AO9A 3BR0A 2Y0SN 1JJ6C 3AQTA 5IPAA 3JRHA 5IP9J 1HLVA 2QKOA 1K83J 4JKZA 1IRZA 4GCTA 2LP0A 4BY7J 3S1RJ 1QRYA 1ITYA 2XB5A 3BHQA 4XRMA 4DZJA 5FMPA 5F27A 4MFEA 1IUFA 5C4XJ 1YRNA 4GFLA 3DEWA 1JTYA 2TRTA 2G7LA 4NN1A 1CQTA 3O8HA 3NXCA 3VW0A 1IDYA 1QVUA 5F0HA 4Y52J 2XPUA 2NS8A 2QCOA 1VFCA 3NPIA 2MGQA 3JRAA 3HTJA 2HQ5A 5GPCA 3TEDA 1F36A 4M3DA 5C4JJ 5EGOB 3IV5A 1VI0A 5GP9A 3IH2A 2HOAA 4C3JJ 2WV1A 2P81A 3FK6A 4RBOA 2DMQA 2QOPA 3NRGA 2XPWA 3QPLA 2GUHA 4ACIA 2E19A 5AQCA 3O60A 1RR7A 3HOVJ 2HYTA 5HAWA 5F0FA 1XC5A 3S17J 3Q0UA 1DU6A 1IV6A 4D5CA 2M9HA 3CMYA 2CRGA 5HSZA 2ME6A 2VUMJ 3COLA 2EQRA 4XK4A 1APLC 3S2DJ 3S1NJ 1U78A 1I50J 2ME0A 5D18A 3O8GA 1RKTA 2LVSA 4JX4A 3MN2A 2FX0A 3S2HJ 4C3IJ 2PBXA 4ICHA 2OI8A 1MBFA 2ZOZA 5FHPA 3VOXA 2EZHA 2E2IJ 2G7GA 1BA5A 1HDDC 3KKDA 3MNLA 3LSGA 1XG1A 3Q3SA 1FIPA 4W97A 1QVTA 2XSDC 3E7LA 2K9SA 3WHBA 1H8AC 4JL3A 1JTXA 4Y7NJ 3M3YJ 1B8IA 2HXOA 2JJ7A 1MH3A 4J19A 1MBHA 4MLOA 4B4CA 2H1KA 3HGYA 5EFYA 2LR8A 2XGCA 4QSHA 5J3LA 3HBLA 5FLVA 4HKUA 3HOWJ 2YVHA 4B1RA 4A3EJ 4A3IJ 2DA4A 1JGGA 3NI7A 4JYKA 1X58A 2HXIA 3S16J 2WGBA 5JLXA 1WCMJ 3GTGJ 3BT9A 2X48A 4JX6A 5FKNA 3VIBA 1GVDA 2NX4A 1WH7A 2CQQA 1ZK8A 5EG0A 3JRIA 3ZQGA 1AHDP 3TP0A 2WUIA 3BTCA 3VOKA 3HOUJ 3B6AA 2R0QC 1JT6A 2PMZN 2R5YB 1TWGJ 3VP5A 3HIMA 3H0GJ 1AKHA 1RKWA 5EYRA 3HOYJ 1ZQ3P 3TW6A 3RKQA 3ZQFA 1O4XA 2UXUA 4IEJA 2K9QA 4UUSA 3LSJA 3H3VK 3G56A 1LFBA 4DYQA 3BR1A 2REKA 5EZGA 2LTPA 5M5XJ 2R5YA 5F0CA 1FEXA 4DW6A 3CCYA 1ORKA 3TW7A 2VI6A 4KWAA 1ZTRA 4MK6A 1MBGA 3RQIA 3BR6A 4MIMA 3JRDA 1MBKA 3BTJA 3QQAA 1ZR4A 2ID3A 5HBUA 1ETWA 2O8KA 5IP7J 4L5EA 2PZ9A 5J1RA 3RH2A 2JA6J 1OCTC 4JX5A 1GUUA 5EF6A 1ETKA 3GZIA 1UG2A 5M5WJ 4M6VA 5EEAA 2OERA 4NELA 3GTKJ 2ZB9A 3FIWA 4AF5A 4QIWN 3GTMJ 3W6VA 2O9LA 2UXHA 3CWRA 3HOXJ 2DA5A 2RAEA 1IDZA 5K7FA 2LLKA 2JK3A 3ZQHA 2DG8A 2XRLA 1VNDA 3F0CA 5CXGA 1JUMA 3BJBA 4BKXA 1MH4A 1MSFC 2GBYA 2JA5J 1WI3A 4CYCB 1IJWC 4X1EA 2Q24A 3RZDJ 2D5VA 2W48A 5DTDA 5J1UA 3JREA 2XGDA 3VW1A 5E3MA 2N8GA 1JJ8C 4FISA 3BTIA 1Q1VA 2EH3A 2DJNA 4D7NA 4A93J 5IOZA 1FTTA 5EZHA 2X6OA 3GBGA 5FJ8J 3DCFA 3EGQA 3BRUA 5FLMJ 3FISA 2QWTA 3K7AJ 2B63J 2L7FP 2UXIA 3B6CA 2GLOA 4CGRA 5BNGA 1E3OC 1T33A 3SDGA 2DMTA 5IP6A 2YU9J 2Y30A 4ME9A 1SGMA 4S0HB 4UDSA 4D5FA 2UXPA 2DMPA 1XS9A 1I6HJ 1UHSA 3VW2A 3VVYA 3PPBA 1WGXA 2L0KA 1AU7A 3A01B 1R9TJ 4XRSA 2DMNA 4V2FA 3OSFA 4QTRA 2LFBA 3PASA 4AC0A 3T6NA 2HI3A 2NVTJ 3BG5A 2MG4A 2G7SA 4BY1J 3Q0WA 2XPVA 4BXXJ 3GTOJ 1TWCJ 4AYBN 1B72B 3CJDA 3HE0A 2XDNA 3G1OA 4UUTA 1MBJA 9ANTA 1IG7A 4CYCA 2DMUA 2HOSA 1GV5A 5C44J 3KNWA 1P7JA 2ZCMA 1IC8A 2IAIA 2DTZA 1OCPA 3QPSA 4A3FJ 1HF0A 1ETYA 5C4YA 3FK7A 1LFUP 1UI6A 4DYCA 3HTIA 1F43A 2R5ZA 5F08A 2G0EA 1BL0A 1ETXA 3MKLA 2IBDA 4A3JJ 3RZOJ 2ZOYA 3VVXA 3IH3A 1FIAA 1ZGWA 1OFCX 2EZLA 4AUXA 2NP3A 3CQZJ 4GFBA 1Y1VJ 2HYJA 2NS7A 5M3MJ 3LHQA 2HDDA 2Y2ZA 4LOCA 2NP5A 2TCTA 5IYDJ 1W0UA 3G1LA 5D19A 5E3OA 3A01A 4BBRJ 1P7IA 3G1MA 3GTJJ 3VVZA 1HDPA 2GM4A 4M3FA 3BR2A 3K2AA 3S14J 3GTPJ 3VPRA 1Y1WJ 2FBQA 1I3QJ 5FGLA 4G12A 3NARA 2CU7A 2CUFA 2K40A 2Y31A 5FKOA 3HEFA 3ON4A 1WH5A 5K7ZA 3PO3J 1BW6A 3BR5A 5E3LA 3S5RA 4FTHA 2YVEA 3ZOBA 1H89C 1TWAJ 2WAQN 4XRSG 3ANPA 2ELKA 4FCYA 1GDTA 3GTLJ 3BQZA 1U9NA 2MSYA 5DS9A 1FJLA 3CDLA 3HTAA 2OF7A 3S15J 2JMWA 3V78A 3JRGA 1Z77A 5GPAA 2NVXJ 4YZEA 4BBSJ 5H9TA 2VKVA 2R7ZJ 5FKLA 3KZ9A 2UXOA 4X6AJ 3SJMA 3EUPA 1TC3C 2GENA 3IUVA 1YRNB 3BR3A 3CRJA 2JWTA 1JT0A 1PUFA 2JA8J 3BQYA 2LD5A 2R92J 3PO2J 1NK3P 3I4NJ 4XIDA 1W0TA 5EG0B 3PM1A 3OIOA 4A3BJ 3E7QA 2O7TA 1U9OA 1SANA 4M3BA 2FJ1A 2QTQA 3BCGA 3HOZJ 2COBA 4FE4A 2NVYJ 5EDNA 3ZQLA 5J1YA 2RASA 2ECBA 2HKUA 1UI5A 1TWFJ 3B81A 4HNVA 4MXMA 3HB9A 4C3HJ 2JN6A 2XGEA 3QKXA 1UMQA 1AKHB 1MSEC 1FTZA 2E1OA 4I76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F07 A;  3ANG A;  4A3D J;  3C2B A;  2M0C A;  1LE8 A;  3G7R A;  2L9R A;  1GT0 C;  5CXI A;  4MFD A;  1SFO J;  3NNR A;  1ENH A;  3A02 A;  2VPR A;  3ZQC A;  3M4O J;  3AQS A;  4GFK A;  3IH4 A;  2QF7 A;  2EZK A;  4JNN A;  1X2M A;  1GV2 A;  3GEU A;  2KT0 A;  1S7E A;  2CUE A;  3LSR A;  4IHX A;  1LE8 B;  1ETQ A;  3SFI A;  2M34 A;  3HGG A;  3I4M J;  1PUF B;  3TP3 A;  5E3N A;  2IU5 A;  3OOU A;  1HCR A;  2K9N A;  4A69 C;  4C2M J;  1ETV A;  3HDD A;  3JR9 A;  2M2E A;  2RHA A;  3V6G A;  2DA2 A;  1HOM A;  1B8I B;  1DU0 A;  3BG3 A;  4L62 A;  4EEF G;  3QBM A;  3DPJ A;  3HKZ N;  1NK2 P;  4A3G J;  4GCL A;  1RPW A;  3BG9 A;  5HOD A;  1RES A;  4DYR A;  2L7M P;  2X9D A;  5FKK A;  2YS9 A;  2I10 A;  4W1U A;  3S1M J;  2CQX A;  3JRB A;  5C3E J;  1JKQ C;  3ON2 A;  4I6Z A;  2JA7 J;  3P9T A;  3LWJ A;  2NOG A;  4JP0 A;  2W53 A;  5K7H A;  1QPI A;  5K58 A;  4DZP A;  4B3A A;  2ID6 A;  2FD5 A;  2AHQ A;  1D5Y A;  2YUS A;  4V2G A;  4XIC A;  2E2J J;  1BJZ A;  4MO7 A;  2WB1 N;  2HOT A;  1ETO A;  4UUS B;  2ECC A;  2LY9 A;  1T56 A;  3UKG A;  1X2N A;  1U8B A;  3S1Q J;  5M3F J;  2DA6 A;  2EBI A;  2ZCN A;  3LJL A;  1A6I A;  2V57 A;  4RDU A;  2L7Z A;  3JRC A;  1MNM C;  2Y9Y A;  5F04 A;  3L1P A;  3MVP A;  3Q0V A;  3VUQ A;  2O7O A;  5IYB J;  4A3L J;  2DA7 A;  2M8G X;  2G3B A;  1JKR C;  1RET A;  1JKO C;  2VKE A;  3HM5 A;  1A5J A;  3LNQ A;  3ZQI A;  2QIB A;  1ZR2 A;  2GFN A;  2XB0 X;  4IHW A;  1B72 A;  3F1B A;  3JRF A;  1H88 C;  2NVQ J;  2DG7 A;  1JUS A;  5F1J A;  3LOC A;  2DA3 A;  5JLW A;  5IOY A;  3NAU A;  2MW8 A;  5IYC J;  5EGO A;  2ZCX A;  3GTQ J;  1ZKG A;  4A3K J;  2DA1 A;  1JUP A;  3HTH A;  4AC6 A;  3BTL A;  2LKX A;  2FQ4 A;  2E2H J;  5CW8 A;  5FKM A;  1G2H A;  1NTC A;  2DN0 A;  4M3E A;  1JKP C;  2R93 J;  5M5Y J;  4A3C J;  2R5Z B;  2H8R A;  4FE7 A;  1TWH J;  4GCK A;  4ABZ A;  3D1N I;  3OSG A;  3C07 A;  4IHV A;  2IEK A;  2CJJ A;  1POG A;  2D6Y A;  1BW5 A;  4A3M J;  1IGN A;  1WPK A;  4D7M A;  1K61 A;  3KKC A;  1Z0X A;  3RD3 A;  4IHY A;  2LK2 A;  1OJL A;  3LSP A;  1VF9 A;  2Y9Z A;  1MBE A;  2KDZ A;  4PXI A;  4M3G A;  3BNI A;  3JSJ A;  4NDL A;  3WHC A;  2EZI A;  2OPT A;  3FKI J;  3FRQ A;  1EF4 A;  3A03 A;  5D1R A;  5DAJ A;  2AO9 A;  3BR0 A;  2Y0S N;  1JJ6 C;  3AQT A;  5IPA A;  3JRH A;  5IP9 J;  1HLV A;  2QKO A;  1K83 J;  4JKZ A;  1IRZ A;  4GCT A;  2LP0 A;  4BY7 J;  3S1R J;  1QRY A;  1ITY A;  2XB5 A;  3BHQ A;  4XRM A;  4DZJ A;  5FMP A;  5F27 A;  4MFE A;  1IUF A;  5C4X J;  1YRN A;  4GFL A;  3DEW A;  1JTY A;  2TRT A;  2G7L A;  4NN1 A;  1CQT A;  3O8H A;  3NXC A;  3VW0 A;  1IDY A;  1QVU A;  5F0H A;  4Y52 J;  2XPU A;  2NS8 A;  2QCO A;  1VFC A;  3NPI A;  2MGQ A;  3JRA A;  3HTJ A;  2HQ5 A;  5GPC A;  3TED A;  1F36 A;  4M3D A;  5C4J J;  5EGO B;  3IV5 A;  1VI0 A;  5GP9 A;  3IH2 A;  2HOA A;  4C3J J;  2WV1 A;  2P81 A;  3FK6 A;  4RBO A;  2DMQ A;  2QOP A;  3NRG A;  2XPW A;  3QPL A;  2GUH A;  4ACI A;  2E19 A;  5AQC A;  3O60 A;  1RR7 A;  3HOV J;  2HYT A;  5HAW A;  5F0F A;  1XC5 A;  3S17 J;  3Q0U A;  1DU6 A;  1IV6 A;  4D5C A;  2M9H A;  3CMY A;  2CRG A;  5HSZ A;  2ME6 A;  2VUM J;  3COL A;  2EQR A;  4XK4 A;  1APL C;  3S2D J;  3S1N J;  1U78 A;  1I50 J;  2ME0 A;  5D18 A;  3O8G A;  1RKT A;  2LVS A;  4JX4 A;  3MN2 A;  2FX0 A;  3S2H J;  4C3I J;  2PBX A;  4ICH A;  2OI8 A;  1MBF A;  2ZOZ A;  5FHP A;  3VOX A;  2EZH A;  2E2I J;  2G7G A;  1BA5 A;  1HDD C;  3KKD A;  3MNL A;  3LSG A;  1XG1 A;  3Q3S A;  1FIP A;  4W97 A;  1QVT A;  2XSD C;  3E7L A;  2K9S A;  3WHB A;  1H8A C;  4JL3 A;  1JTX A;  4Y7N J;  3M3Y J;  1B8I A;  2HXO A;  2JJ7 A;  1MH3 A;  4J19 A;  1MBH A;  4MLO A;  4B4C A;  2H1K A;  3HGY A;  5EFY A;  2LR8 A;  2XGC A;  4QSH A;  5J3L A;  3HBL A;  5FLV A;  4HKU A;  3HOW J;  2YVH A;  4B1R A;  4A3E J;  4A3I J;  2DA4 A;  1JGG A;  3NI7 A;  4JYK A;  1X58 A;  2HXI A;  3S16 J;  2WGB A;  5JLX A;  1WCM J;  3GTG J;  3BT9 A;  2X48 A;  4JX6 A;  5FKN A;  3VIB A;  1GVD A;  2NX4 A;  1WH7 A;  2CQQ A;  1ZK8 A;  5EG0 A;  3JRI A;  3ZQG A;  1AHD P;  3TP0 A;  2WUI A;  3BTC A;  3VOK A;  3HOU J;  3B6A A;  2R0Q C;  1JT6 A;  2PMZ N;  2R5Y B;  1TWG J;  3VP5 A;  3HIM A;  3H0G J;  1AKH A;  1RKW A;  5EYR A;  3HOY J;  1ZQ3 P;  3TW6 A;  3RKQ A;  3ZQF A;  1O4X A;  2UXU A;  4IEJ A;  2K9Q A;  4UUS A;  3LSJ A;  3H3V K;  3G56 A;  1LFB A;  4DYQ A;  3BR1 A;  2REK A;  5EZG A;  2LTP A;  5M5X J;  2R5Y A;  5F0C A;  1FEX A;  4DW6 A;  3CCY A;  1ORK A;  3TW7 A;  2VI6 A;  4KWA A;  1ZTR A;  4MK6 A;  1MBG A;  3RQI A;  3BR6 A;  4MIM A;  3JRD A;  1MBK A;  3BTJ A;  3QQA A;  1ZR4 A;  2ID3 A;  5HBU A;  1ETW A;  2O8K A;  5IP7 J;  4L5E A;  2PZ9 A;  5J1R A;  3RH2 A;  2JA6 J;  1OCT C;  4JX5 A;  1GUU A;  5EF6 A;  1ETK A;  3GZI A;  1UG2 A;  5M5W J;  4M6V A;  5EEA A;  2OER A;  4NEL A;  3GTK J;  2ZB9 A;  3FIW A;  4AF5 A;  4QIW N;  3GTM J;  3W6V A;  2O9L A;  2UXH A;  3CWR A;  3HOX J;  2DA5 A;  2RAE A;  1IDZ A;  5K7F A;  2LLK A;  2JK3 A;  3ZQH A;  2DG8 A;  2XRL A;  1VND A;  3F0C A;  5CXG A;  1JUM A;  3BJB A;  4BKX A;  1MH4 A;  1MSF C;  2GBY A;  2JA5 J;  1WI3 A;  4CYC B;  1IJW C;  4X1E A;  2Q24 A;  3RZD J;  2D5V A;  2W48 A;  5DTD A;  5J1U A;  3JRE A;  2XGD A;  3VW1 A;  5E3M A;  2N8G A;  1JJ8 C;  4FIS A;  3BTI A;  1Q1V A;  2EH3 A;  2DJN A;  4D7N A;  4A93 J;  5IOZ A;  1FTT A;  5EZH A;  2X6O A;  3GBG A;  5FJ8 J;  3DCF A;  3EGQ A;  3BRU A;  5FLM J;  3FIS A;  2QWT A;  3K7A J;  2B63 J;  2L7F P;  2UXI A;  3B6C A;  2GLO A;  4CGR A;  5BNG A;  1E3O C;  1T33 A;  3SDG A;  2DMT A;  5IP6 A;  2YU9 J;  2Y30 A;  4ME9 A;  1SGM A;  4S0H B;  4UDS A;  4D5F A;  2UXP A;  2DMP A;  1XS9 A;  1I6H J;  1UHS A;  3VW2 A;  3VVY A;  3PPB A;  1WGX A;  2L0K A;  1AU7 A;  3A01 B;  1R9T J;  4XRS A;  2DMN A;  4V2F A;  3OSF A;  4QTR A;  2LFB A;  3PAS A;  4AC0 A;  3T6N A;  2HI3 A;  2NVT J;  3BG5 A;  2MG4 A;  2G7S A;  4BY1 J;  3Q0W A;  2XPV A;  4BXX J;  3GTO J;  1TWC J;  4AYB N;  1B72 B;  3CJD A;  3HE0 A;  2XDN A;  3G1O A;  4UUT A;  1MBJ A;  9ANT A;  1IG7 A;  4CYC A;  2DMU A;  2HOS A;  1GV5 A;  5C44 J;  3KNW A;  1P7J A;  2ZCM A;  1IC8 A;  2IAI A;  2DTZ A;  1OCP A;  3QPS A;  4A3F J;  1HF0 A;  1ETY A;  5C4Y A;  3FK7 A;  1LFU P;  1UI6 A;  4DYC A;  3HTI A;  1F43 A;  2R5Z A;  5F08 A;  2G0E A;  1BL0 A;  1ETX A;  3MKL A;  2IBD A;  4A3J J;  3RZO J;  2ZOY A;  3VVX A;  3IH3 A;  1FIA A;  1ZGW A;  1OFC X;  2EZL A;  4AUX A;  2NP3 A;  3CQZ J;  4GFB A;  1Y1V J;  2HYJ A;  2NS7 A;  5M3M J;  3LHQ A;  2HDD A;  2Y2Z A;  4LOC A;  2NP5 A;  2TCT A;  5IYD J;  1W0U A;  3G1L A;  5D19 A;  5E3O A;  3A01 A;  4BBR J;  1P7I A;  3G1M A;  3GTJ J;  3VVZ A;  1HDP A;  2GM4 A;  4M3F A;  3BR2 A;  3K2A A;  3S14 J;  3GTP J;  3VPR A;  1Y1W J;  2FBQ A;  1I3Q J;  5FGL A;  4G12 A;  3NAR A;  2CU7 A;  2CUF A;  2K40 A;  2Y31 A;  5FKO A;  3HEF A;  3ON4 A;  1WH5 A;  5K7Z A;  3PO3 J;  1BW6 A;  3BR5 A;  5E3L A;  3S5R A;  4FTH A;  2YVE A;  3ZOB A;  1H89 C;  1TWA J;  2WAQ N;  4XRS G;  3ANP A;  2ELK A;  4FCY A;  1GDT A;  3GTL J;  3BQZ A;  1U9N A;  2MSY A;  5DS9 A;  1FJL A;  3CDL A;  3HTA A;  2OF7 A;  3S15 J;  2JMW A;  3V78 A;  3JRG A;  1Z77 A;  5GPA A;  2NVX J;  4YZE A;  4BBS J;  5H9T A;  2VKV A;  2R7Z J;  5FKL A;  3KZ9 A;  2UXO A;  4X6A J;  3SJM A;  3EUP A;  1TC3 C;  2GEN A;  3IUV A;  1YRN B;  3BR3 A;  3CRJ A;  2JWT A;  1JT0 A;  1PUF A;  2JA8 J;  3BQY A;  2LD5 A;  2R92 J;  3PO2 J;  1NK3 P;  3I4N J;  4XID A;  1W0T A;  5EG0 B;  3PM1 A;  3OIO A;  4A3B J;  3E7Q A;  2O7T A;  1U9O A;  1SAN A;  4M3B A;  2FJ1 A;  2QTQ A;  3BCG A;  3HOZ J;  2COB A;  4FE4 A;  2NVY J;  5EDN A;  3ZQL A;  5J1Y A;  2RAS A;  2ECB A;  2HKU A;  1UI5 A;  1TWF J;  3B81 A;  4HNV A;  4MXM A;  3HB9 A;  4C3H J;  2JN6 A;  2XGE A;  3QKX A;  1UMQ A;  1AKH B;  1MSE C;  1FTZ A;  2E1O A;  4I76 A; 
#chains in the Genus database with same CATH topology
 3HUG A;  2F07 A;  3ANG A;  4XRF A;  2OQR A;  2RKH A;  3C2G A;  4XOT A;  4A3D J;  2K5C A;  2VBY A;  5LGT A;  2R7X A;  3HRS A;  3KX2 A;  4PUS A;  2HVR A;  3GME A;  3U1K A;  1WZ2 A;  3NNR A;  2BW3 B;  2IA0 A;  2P5K A;  1FYM A;  5BS6 A;  2VPR A;  4UXN A;  3GF2 A;  4U7D A;  4O3M A;  4EAT A;  1VQ5 I;  2QF7 A;  2FUG 2;  4L9N A;  3GLX A;  2KT0 A;  1S7E A;  1F4K A;  4XM3 A;  3ABU A;  3SFI A;  4PDK A;  3I4M J;  1PUF B;  1J7K A;  4KA4 A;  5E3N A;  2IU5 A;  1B9M A;  4XKC A;  2LBF B;  3MCZ A;  3O2P E;  4C2M J;  1UG0 A;  2PJR B;  2K3P A;  2JTV A;  3JR9 A;  1IXS B;  4QPQ A;  1HOM A;  4E7Z A;  2LKP A;  1B8I B;  3BG3 A;  1YS6 A;  3QBM A;  4AD9 A;  5HDN A;  4HG2 A;  3E6D A;  1BI2 A;  4E7I A;  3M9A A;  2W7N A;  3CDH A;  3K4L A;  4GYI A;  5HOD A;  5B1A H;  5HS8 A;  4ITV A;  2EIL H;  1G59 A;  2HR3 A;  5J47 A;  4LFU A;  1JKQ C;  1U3E M;  2XAU A;  4LGW A;  2IT0 A;  5GAH J;  4ESJ A;  4MEY F;  4B3A A;  3J7A Y;  3A2K A;  2FD5 A;  2WAD A;  3CJR B;  1U2W A;  3BCB A;  3VB2 A;  1XGM A;  3ZMV A;  1Z91 A;  2VBW A;  2F4I A;  4YFK F;  1S5L C;  3EDP A;  1ETO A;  3LST A;  5CYV A;  2AXT C;  3HKZ A;  2OJE D;  1U8B A;  3S1Q J;  2DA6 A;  3U2R A;  2EBI A;  2F6C A;  3K1P A;  3JRC A;  1MNM C;  2Y9Y A;  3FDY A;  2FE3 A;  5IYB J;  2M8G X;  1HKT A;  1JKR C;  1REP C;  2ESH A;  4C30 A;  4RGS A;  1IUY A;  2QIB A;  3OYK A;  1ERD A;  3RJP A;  3D0S A;  3F1B A;  2K27 A;  2MC3 A;  2NVQ J;  1DP7 P;  2LF7 A;  3BP8 A;  2NAZ A;  3WTV C;  5JLW A;  5EGO A;  4XN0 A;  3CMM A;  4A3K J;  3KP2 A;  1JUP A;  1LFP A;  4LIU A;  4AC6 A;  1O3S A;  3RKY A;  2FQ4 A;  1U5T C;  2BHZ A;  2HQR A;  3DBL B;  3EUK L;  4YFN F;  2XRO A;  1I1S A;  5CW8 A;  3FF5 A;  3GLL A;  1R22 A;  2ZC2 A;  1A04 A;  1KU3 A;  2FF4 A;  5FKM A;  3DPL C;  3IL2 A;  2GXA A;  1G2H A;  2A2F X;  2ADU A;  4CGZ A;  1NTC A;  5DUK A;  2KRC A;  1ZRD A;  1T98 A;  2R5Z B;  2EFO A;  2WY8 Q;  4EM2 A;  2IPQ X;  4EGY A;  3OSG A;  1I3A A;  2HNH A;  3CCV I;  2FXA A;  2CJJ A;  2UWM A;  1XPX A;  4KT6 A;  3GFM A;  2NOJ B;  4Y13 A;  3AG1 H;  3KFW X;  3V8J A;  3FWE A;  5H6Q A;  4A3M J;  3KCC A;  3RYR A;  1K61 A;  2R7D A;  3JW4 A;  3RD3 A;  3L7W A;  2CG4 A;  1OJL A;  2DU9 A;  4N9I A;  2MC4 A;  3W6J B;  3ERM A;  5L3G A;  3ZCO A;  5HS7 A;  3BNI A;  3N05 A;  3JSJ A;  3N97 A;  3WHC A;  5D5V B;  3BPV A;  4BU2 A;  2OPT A;  1SFE A;  3FKI J;  3M7G A;  1EF4 A;  3A03 A;  3EPZ A;  2R7U A;  2DFI A;  4ENN A;  1VQ7 I;  1QQI A;  2CUZ A;  2VBZ A;  3I0T A;  2Y0S N;  1M1E B;  5FFZ A;  1HLV A;  3H3U A;  4XLP F;  2QKO A;  4JKZ A;  2QA4 I;  2XF6 A;  1OR7 C;  1BBY A;  4RMN A;  1BR1 A;  1IUF A;  2Z2S B;  3DEW A;  2G7L A;  1G6N A;  1SD7 A;  2MFZ A;  3OV8 A;  3HL2 A;  5F0H A;  1P9Q C;  2XPU A;  3H9J A;  2JA2 A;  1O7L A;  3KP5 A;  4YIR X;  3GFI A;  1T8I A;  4KIB A;  1VFC A;  2X51 A;  2NYX A;  1R5H A;  4GYG A;  3HTJ A;  2VB6 A;  2KIM A;  2KMU A;  2FEZ A;  2Q8K A;  4BQN A;  3IV5 A;  4C2U A;  3IH2 A;  4XMY A;  1WRJ A;  4I7H A;  2HOA A;  3BZK A;  3K10 A;  4LK1 F;  5B1B H;  3FK6 A;  3ONQ A;  4DOZ A;  2DMQ A;  3DKX A;  2X0L A;  3QPL A;  5LEJ A;  4OWR B;  2DQR A;  3U1D A;  1W36 D;  1AWC A;  4AIH A;  1BC7 C;  1D0Y A;  2M0M A;  4XON A;  2XGX A;  2HYT A;  5HAW A;  3WU2 C;  4TV7 A;  4CUG A;  1DU6 A;  2R7Q A;  3CMY A;  4HA8 A;  2JSP A;  3CJN A;  3E5U A;  4RB2 C;  1ZN2 A;  3DQV C;  3PIP F;  3ZRG A;  4XK4 A;  3S2D J;  4Q5S F;  1WWX A;  4E7J A;  3VEP A;  1U78 A;  1Z7L A;  3O8G A;  3L2U A;  3S2H J;  4XLE A;  1F5T A;  2EZH A;  4FHT A;  2PI0 A;  3FXK A;  3LSI A;  2HPI A;  3GX4 X;  4W97 A;  3DWL E;  2MD5 A;  2XSD C;  3PQK A;  4RB0 A;  2PMH A;  4KUM A;  3WHB A;  1JTX A;  4I2O A;  2XAG A;  3KP6 A;  2JJ7 A;  4I98 B;  5E1Z B;  1MBH A;  4B4C A;  4F91 B;  3HGY A;  4F93 B;  4EJT A;  2XGC A;  1FP2 A;  3LWF A;  3QOE A;  3RI4 A;  4BYY A;  4I01 A;  4KJZ A;  4RGU A;  3TQN A;  2DA4 A;  3DV8 A;  2HDC A;  4FET A;  5DCF A;  4XOR A;  2HXI A;  4Z2Y A;  5TJJ A;  4CCN A;  5JLX A;  1WCM J;  1VQP I;  3GTG J;  1UZC A;  3L2Q A;  2X48 A;  2E7X A;  2XRN A;  3H5A A;  1QZE A;  1YE9 A;  3L09 A;  4JX6 A;  2NX4 A;  3VIB A;  3L00 A;  2STW A;  1EH6 A;  1ZK8 A;  5CVU A;  1RR8 C;  3ZQG A;  2FMY A;  3T0Y A;  3TP0 A;  3VOK A;  2GAU A;  3HOU J;  1YIT I;  1GXQ A;  2R5Y B;  2DOE A;  1TWG J;  2LYC A;  1FOK A;  3H0G J;  3HOY J;  4HZF A;  2M5W A;  1O4X A;  3K69 A;  5A2Q K;  2XAH A;  4ZDO A;  1K7A A;  2KIU A;  2K9Q A;  3I59 B;  1J9I A;  1AA7 A;  4DYQ A;  1Y8Q B;  3OY9 A;  3WE2 A;  2CV0 A;  1KON A;  1XMX A;  1IN6 A;  1RZ4 A;  3OS2 A;  2ISY A;  2R5Y A;  1ONV A;  3JSP A;  3P9I A;  1FC3 A;  1YTY A;  3DTK A;  3FXO A;  1TW3 A;  5K1Y A;  3CJQ B;  3T5X A;  3J7Z I;  2EFP A;  4AWX B;  1JI8 A;  1ETW A;  3K4B A;  3R61 A;  2M7A A;  5EF6 A;  4KFC A;  3GZI A;  2GA2 A;  5M5W J;  3FHN A;  1HKQ A;  1TL8 A;  3GTK J;  3SZT A;  3PL8 A;  4LG3 A;  2GOM A;  4P55 A;  2UZK A;  3W6V A;  2UXH A;  3K70 C;  3LQQ A;  2ETH A;  2JK3 A;  3ZQH A;  2P7C B;  3C1D A;  2Y48 A;  4KIS A;  5ICG A;  5DCM A;  2CW0 F;  5L3D A;  3J7A O;  2R7O A;  4IJA A;  2QZ8 A;  1KU9 A;  1IJW C;  4CYC B;  1S3J A;  2Z3Y A;  4X1E A;  2AS5 F;  3K0L A;  2ZJP F;  3RZD J;  4B3X A;  2DW4 A;  5DTD A;  3AFH A;  2KIS A;  1NH3 A;  3CCE I;  3BTI A;  1R71 A;  5L3F A;  4A93 J;  4UVB A;  3BPX A;  4B8X A;  1ZRE A;  3TDU C;  1DUX C;  1MIJ A;  4L9V A;  3K7A J;  2KFD A;  1LDK B;  1OCR H;  4CGR A;  1E3O C;  1YIO A;  3SZP A;  3W6K B;  5IP6 A;  4ME9 A;  1SGM A;  2QM3 A;  3HTU A;  2VJ4 A;  4D5F A;  2IS6 A;  3HRT A;  4KT5 C;  1WGX A;  1W5C C;  3DTI A;  3GO5 A;  2DCE A;  1U0J A;  4V2F A;  3VTI A;  1Y39 A;  1V4R A;  3B02 A;  2LMD A;  2R7W A;  2DXI A;  2V9V A;  3IUO A;  2PN6 A;  3VSK A;  4CA0 A;  2H8W A;  5FRO A;  2HI3 A;  2HS5 A;  2QEN A;  3E5Q A;  1H9T A;  3WGI A;  3ELK A;  3CCL I;  3Q0W A;  2NS0 A;  4BXX J;  3GTO J;  1X3U A;  3CUQ C;  1JHH A;  1YJ9 I;  3CJD A;  4XSX F;  5D8L B;  2RC4 A;  4ASN A;  4N4O B;  2A6H F;  9ANT A;  1P4A A;  2DT7 B;  4PGH A;  4OIQ F;  4E7S A;  3ABL H;  4XNF A;  1KYZ A;  3JSO A;  1IN4 A;  4PFP A;  5E79 C;  4B48 A;  2DDA A;  2PMZ A;  5E18 F;  5CVJ A;  3KIO A;  1Y56 A;  3ABT A;  3FK7 A;  1UI6 A;  2VE9 A;  4OIP F;  5HLI A;  4MTD A;  4KNY A;  1O57 A;  2G0E A;  1VQN I;  3IP4 B;  1B59 A;  4RM3 A;  3VVX A;  4A3J J;  2ZSI B;  1EA3 A;  1FIA A;  2K3F A;  4LLL A;  3KYC B;  3L2R A;  3L9F A;  2HDD A;  3HPG A;  2A61 A;  4LOC A;  4WCG A;  4CCO A;  5IYD J;  3TGN A;  3M8E A;  4BJ5 C;  2Z1D A;  2LG4 A;  4BBR J;  1ZGA A;  1P7I A;  4M3F A;  1R4M B;  3BR2 A;  3S14 J;  2K9L A;  2EIM H;  2VN2 A;  2ZO4 A;  3VPR A;  2DFE A;  1SFK A;  1I3Q J;  1X1B A;  3CCM I;  1FY7 A;  1SAX A;  1VQK I;  3ESW B;  1FNN A;  4HNU A;  1FLI A;  1N75 A;  5FKO A;  5K7Z A;  1IRF A;  3I54 A;  2J5P A;  1BW6 A;  1IRG A;  2L3D A;  1WJB A;  4B09 A;  2B9S A;  3S5R A;  2KJB A;  1H89 C;  1TWA J;  5BMZ A;  2BXZ A;  2XAS A;  4NC8 A;  4EMS A;  3OYG A;  1GDT A;  2K4J A;  5D5W B;  2MSY A;  5DS9 A;  1FJL A;  3I4P A;  3HTA A;  2OF7 A;  4YFX F;  4BNC A;  3S15 J;  2DOF A;  5DUI A;  4DGW B;  1CF7 A;  1LKX A;  3V78 A;  2M1B A;  3K9T A;  1Z77 A;  2NVX J;  2F5C A;  1ZYR F;  2FBK A;  3GWZ A;  5FB2 A;  5A2Q Z;  2UXO A;  1FSH A;  5GAG J;  3KZ9 A;  4FAS D;  2GEN A;  1YRN B;  3MQ0 A;  2JWT A;  1SD6 A;  3RKW A;  3RSN A;  5GAE J;  2JA8 J;  1QNT A;  3WTT C;  1USS A;  2WA0 A;  2OBP A;  2KRH A;  3DEE A;  5LLQ A;  2EFW A;  2ZFU A;  2ELJ A;  1W0T A;  5EG0 B;  4BDY A;  3OIO A;  1ZRC A;  2C6Y A;  3E7Q A;  1YJW I;  1U9O A;  1SAN A;  2O7T A;  4BGD A;  2JZY A;  2ZME A;  2A68 F;  2HEO A;  1SAU A;  2NVY J;  2RAS A;  2ZNY A;  2ECB A;  5KAF C;  2HKU A;  1FPQ A;  1TWF J;  2IW5 A;  3DKW A;  1XCV A;  3HB9 A;  1KA8 A;  2XGE A;  3DXJ F;  1Y8R B;  4O5V A;  1MSE C;  2ZXH A;  3F21 A;  2EK5 A;  3TMO A;  1T95 A;  3S8P A;  4M6Y A;  1LEA A;  4U9N A;  3C2B A;  2M0C A;  3OIP A;  4HPQ A;  2MYS A;  1GT0 C;  4MFD A;  1PYV A;  2QVO A;  2W1O A;  2GZW A;  2BE5 F;  3CUO A;  2EWN A;  3FZV A;  4GFK A;  2KDO A;  2K02 A;  5J40 A;  4YEL A;  3DU5 A;  4P1W A;  4HDU A;  1K79 A;  2M34 A;  5D5X B;  3D5S C;  1HCR A;  2ZME C;  3H5N A;  2Y0S A;  3A1Y A;  2Z16 A;  5LEK A;  3HDD A;  2M2E A;  1MJ9 A;  2RHA A;  1D8K A;  3V6G A;  2DA2 A;  4RB1 A;  4L62 A;  5CJ9 A;  4AID A;  4EEF G;  2JRT A;  1D1A A;  5D6E A;  5HLG A;  1MKM A;  2UV1 A;  5JFR A;  4HLY A;  1Z67 A;  3PUB A;  2L9N A;  4GCL A;  3BG9 A;  4CHU A;  3HHG A;  3RPU A;  2L7M P;  5FKK A;  5HNF A;  1S8N A;  3KEO A;  1TP4 A;  2W4S A;  2CQX A;  2ZKZ A;  2PEX A;  2BHY A;  2EV5 A;  3ON2 A;  2STT A;  1R1V A;  4JP0 A;  3K8P C;  1QPI A;  5B66 C;  1JHF A;  2ID6 A;  3BOQ A;  1STZ A;  2AHQ A;  1R5I D;  5JR3 A;  4RS8 A;  4XLF A;  2QEX I;  4OIO F;  4HRI A;  5J4V A;  2ZJ2 A;  1TQP A;  1HW2 A;  2OCE A;  4UUS B;  3CP2 A;  3CCS I;  2HPM A;  2FQ3 A;  1T56 A;  1TNS A;  3K4N A;  4U88 A;  2IGO A;  2EFQ A;  3WU1 B;  3UNG C;  5KVR A;  2CSO A;  3RPQ A;  1KU2 A;  4RDU A;  4A2U A;  2Y75 A;  2QQ9 A;  3MVP A;  3LA2 A;  3Q0V A;  3L1P A;  3CC7 I;  2O7O A;  3VUQ A;  4RGX A;  4CCM A;  4IRI A;  1RRJ A;  2G3B A;  2Z9O A;  2VKE A;  1Y0U A;  3BY6 A;  1A5J A;  3LNQ A;  3UR3 C;  4ESB A;  1UCR A;  1Z3Y A;  4IHW A;  2W85 A;  3I5U A;  3WTW C;  1H88 C;  1V55 H;  2CQK A;  4NC6 A;  1JUS A;  2WWY A;  1RUN A;  2DA3 A;  3H9Q A;  2EIN H;  2DYR H;  1T08 B;  3NAU A;  3CME I;  2A07 F;  3GTQ J;  3FXL A;  4JBA A;  3FMR A;  4HEA 2;  5DDG A;  4DVY P;  3MWM A;  3BTL A;  1W36 C;  4II3 A;  3OYA A;  2RGV A;  4G8X A;  5JHF A;  2E2H J;  4ZYE A;  1P6R A;  4ETS A;  1LUJ B;  4M3E A;  1VQ4 I;  1N77 A;  2Z33 A;  2BV6 A;  4PSX A;  4Q48 A;  3K2Z A;  3J81 Z;  2JSC A;  3CDI A;  3IWZ A;  3OIQ A;  3TOB A;  3D1N I;  2DPD A;  3C07 A;  4IHV A;  4CZZ A;  2IEK A;  1PP7 U;  3DEU A;  4WF2 A;  5LD2 C;  1BN5 A;  2LF8 A;  5HVQ C;  3I71 A;  4ZH4 F;  2CO5 A;  4IHY A;  2DFF A;  2LK2 A;  4QWQ A;  1W1W E;  1GHC A;  4Q4Z F;  3E6B A;  1X1P A;  3E1S A;  2WY7 Q;  1U5T A;  2EZI A;  2EIK H;  1B9N A;  3EYI A;  3P7N A;  4IX7 A;  5D1R A;  1X3W B;  2AO9 A;  2E35 A;  2LRE A;  1LB2 A;  3AQT A;  4IRV A;  1MD0 A;  1V3F A;  4MNU A;  4D9J A;  3ROU A;  1K83 J;  1TT0 A;  1XB4 A;  2CFX A;  1IRZ A;  4EM1 A;  1ITY A;  2XB5 A;  1EV7 A;  4XRM A;  3MKZ A;  4DZJ A;  3BHQ A;  4MQV A;  3OYJ A;  2TRT A;  3OL4 A;  3QP6 A;  1CQT A;  1YG2 A;  3NXC A;  5H2F C;  1NG7 A;  3VW0 A;  2EPF A;  3JTG A;  2B3W A;  3FX3 A;  4IHS A;  2NS8 A;  1I1G A;  2QCO A;  3NWS A;  2L01 A;  2EB7 A;  1O3T A;  2H09 A;  1OR7 A;  4AVZ A;  3TED A;  4G7O F;  2O61 A;  4LIV A;  5EGO B;  2OD5 A;  2XAJ A;  3EUA A;  2HWV A;  1OMI A;  2VOP A;  3FHZ A;  2P81 A;  1I5Z A;  3LL7 A;  4RBO A;  3VWB A;  4A6D A;  4HV6 A;  4I0A A;  4LD5 A;  4XOP A;  2A5W A;  1R5G A;  3NS4 A;  3QOP A;  4XLA A;  4O6J A;  1MZB A;  4QLC U;  1WJF A;  1XC5 A;  3S17 J;  1IV6 A;  4OMZ A;  4D5C A;  3F8M A;  2HZT A;  2P4W A;  2VUM J;  2EQR A;  4AM3 A;  3S1N J;  2LNB A;  2F5E A;  1I50 J;  2ME0 A;  2IS1 A;  3GEZ A;  4JX4 A;  2OCC H;  2FX0 A;  2OI8 A;  2ZOZ A;  2EJR A;  3EYY A;  1MJA A;  4H0E A;  1T39 A;  4EM0 B;  2J5O A;  1HDD C;  2PX9 A;  2L4M A;  2IA1 A;  1DPU A;  2ESN A;  3LSG A;  3Q3S A;  2EA2 A;  3E7L A;  2K9S A;  2R7S A;  4LJZ F;  3H5R A;  4FQG A;  5EEG A;  5FD5 A;  4AU7 A;  4Y7N J;  1HXD A;  3A0H C;  2HDW A;  1UST A;  5BQT A;  2H1K A;  3O6B B;  4CSW A;  2V26 A;  1YW8 A;  2LR8 A;  3TOA A;  2VBX A;  1MND A;  2O3F A;  3WTX C;  4XN3 A;  5J3L A;  3S3O A;  2O8X A;  1AOY A;  4A3E J;  4BAC A;  4RAZ A;  2QUF A;  3VYT B;  2QSH X;  3NI7 A;  1JGG A;  4KIC A;  4OD4 A;  1OPC A;  4U0V A;  2DTR A;  4M9X A;  4L5I A;  1X58 A;  2H6B A;  3ISP A;  3U21 A;  2WGB A;  1ZEL A;  3BT9 A;  3MD2 A;  4XQF A;  3CMA I;  2IRF G;  1SVM A;  3ZMT A;  5CQG A;  2KIQ A;  1Z6R A;  2WUI A;  3BTC A;  3C2H A;  3AL0 B;  2CS3 A;  2PMZ N;  4YII A;  3VP5 A;  3HIM A;  1V5F A;  2V7F A;  4ZZD A;  1WSU A;  5DM7 F;  1WHU A;  1RNL A;  3F6O A;  4IEJ A;  3S2W A;  4UUS A;  1PVE A;  2GIZ A;  2P0W A;  2X4H A;  3MZY A;  1VQ6 I;  3G56 A;  4CIC A;  1OIS A;  2DT5 A;  4N9H A;  4C9Y A;  2REK A;  2PQ8 A;  2LTP A;  3H3Z A;  5HDG A;  3G4S I;  4DW6 A;  3CCY A;  4S05 A;  2VQG A;  2R7R A;  3WE3 A;  2VI6 A;  4KWA A;  5ILV A;  2EV6 A;  1J09 A;  2D2W A;  4MIM A;  2XSJ C;  2E5Z A;  2RVC A;  1SVO A;  1VTN C;  5CLS A;  3BTJ A;  1K78 A;  4L9J A;  2RNG A;  3QQA A;  4RAF A;  5DV5 A;  4R1H A;  2ID3 A;  3CO7 C;  5HBU A;  2G7H A;  4NUB A;  1VQ9 I;  4HYE A;  1NHA A;  2FA5 A;  4KMU X;  4OOI A;  2F5V A;  2O8K A;  2PZ9 A;  5J1R A;  1FX7 A;  5F64 A;  2DPU A;  3HJE A;  3FM3 A;  4NEL A;  1GLN A;  4A5N A;  4DNC A;  3FIW A;  1KQ8 A;  5KNL A;  3BRO A;  2A5Y B;  4ZZL A;  3GTM J;  2EV0 A;  2Q1Z B;  1IDZ A;  5K7F A;  1Q1H A;  2O03 A;  3DFG A;  1VND A;  3F0C A;  3OWT A;  1JUM A;  1W5S A;  1GVJ A;  1S7A A;  3JCU C;  2GBY A;  1D5V A;  4ZC3 A;  2BW3 A;  1R4N B;  1SEU A;  1P92 A;  2Q24 A;  3GXO A;  2XGD A;  2Y0M A;  4EJO A;  1JJ8 C;  2PBI A;  2A05 A;  3I59 A;  2ELH A;  1RIO H;  4P9U A;  4IF4 A;  2Y69 H;  1FTT A;  5EZH A;  3GBG A;  3BJ6 A;  3EGQ A;  2FOW A;  3AAF A;  5BPD A;  2Q0O A;  4RAG A;  2NNN A;  4HX7 A;  3B6C A;  3I9V 2;  3H0D A;  5FLX Z;  1YHQ I;  5BNG A;  3TBI A;  1O3Q A;  3K6G A;  2KKO A;  4S0H B;  2DJI A;  4HSR A;  2DMP A;  4OAY A;  1U5T B;  2UXP A;  2HVQ A;  1PDN C;  3VVY A;  1R23 A;  3PPB A;  5E1X A;  1T0F C;  3A01 B;  1BOB A;  1FOY A;  2BBY A;  3E3V A;  3MKY B;  2DAO A;  4M72 A;  2M30 A;  5LHG A;  1R49 A;  5HS9 A;  4Z6Y A;  4GDF A;  2B1E A;  3FBN B;  4AIK A;  3T6N A;  2NVT J;  1XSV A;  1IF1 A;  4BY1 J;  1XSX A;  4WXD A;  2F5F A;  3EQL F;  3FMS A;  5J6X A;  3TKY A;  4B43 A;  3WTZ A;  5D4S A;  1IN8 A;  4UUT A;  4L18 B;  1E2X A;  3I58 A;  4XSZ F;  4CYC A;  2DMU A;  2ZCW A;  1GV5 A;  1R58 A;  5C44 J;  3WGH A;  1HKS A;  3ZN1 A;  3KNW A;  1QHH D;  4IHT A;  2CQ7 A;  1V5G A;  2DTZ A;  5LHI A;  5ERI A;  5BPI A;  1HF0 A;  1ETY A;  1XGN A;  4IZZ A;  2KP6 A;  4OAZ A;  3TO7 A;  3HTI A;  3DU6 A;  3H35 A;  5E8G A;  3F3X A;  1ZG5 A;  3DLL F;  2HVS A;  2R7V A;  2FSW A;  2LKS A;  3IH3 A;  2P5L C;  3FBI B;  1OFC X;  2EZL A;  4CZC A;  4XR6 A;  1VQ8 I;  1Y1V J;  3AG4 H;  4BE0 A;  1G3S A;  4BE2 A;  4NBQ A;  2EIJ H;  1W0U A;  1K6Y A;  2VAS A;  3A01 A;  4M9S A;  3VVZ A;  1HDP A;  2NVU B;  3LSM A;  4DBQ A;  3OMY A;  3K2A A;  4ENM A;  3SEQ A;  2ZFW A;  3LSH A;  3M8J A;  3QPH A;  1MW7 A;  1X1D A;  2CFO A;  3S32 A;  5LGU A;  4NB5 A;  2MH9 A;  3HEF A;  5CKT A;  1FOX A;  1WH5 A;  2BOL A;  5D5U B;  1XSD A;  3BR5 A;  5E3L A;  1KGS A;  1VZ0 A;  4EJU A;  4FTH A;  1TLH B;  2KQR A;  3RCO A;  4XRS G;  3ANP A;  3HXL A;  1MMG A;  1U9N A;  5LRR A;  2OTL I;  2VE8 A;  3CES A;  3IHU A;  2NNY A;  3WTY C;  3EET A;  2HZD A;  4BQQ A;  4YZE A;  5H9T A;  3GFJ A;  1Z05 A;  4Y15 A;  2VKV A;  2R7Z J;  3QYB A;  5FKL A;  2VXZ A;  1FSE A;  4IXA A;  3CRJ A;  1WVR A;  2MAB A;  1F9N A;  3RYP A;  1L0O C;  1P2F A;  1YS7 A;  4LG0 B;  4EV0 A;  2R92 J;  3LA7 A;  3PM1 A;  3HC7 A;  4A3B J;  4G7Z F;  1ACI A;  3REO A;  4ZYA A;  3JTH A;  5JI6 A;  3HOZ J;  2VT3 A;  4FE4 A;  4GRI A;  5EDN A;  3ZQL A;  2E71 A;  2FNA A;  1UI5 A;  2NXN B;  3B81 A;  1CGP A;  4E70 A;  4U7B A;  6PAX A;  5IY5 H;  3J80 Z;  3W3C A;  1XDS A;  3BG7 A;  1VQO I;  1FWZ A;  5LFA A;  1UMQ A;  2GIV A;  1XMK A;  2AQF A;  3CP8 A;  1FTZ A;  1X1C A;  1J75 A;  2L2O A;  4CO8 A;  3R0J A;  3ABK H;  3CF5 F;  5BOX A;  3I64 A;  2RN7 A;  3TO6 A;  1LE8 A;  2L9R A;  5HOO A;  3HG9 A;  1WQ2 A;  3A02 A;  4LB6 B;  2XDV A;  1Z6T A;  3KLO A;  3ZQC A;  3M4O J;  1OYI A;  4IOA F;  4P9F A;  3IH4 A;  4JNN A;  1GV2 A;  1X2M A;  3GEU A;  2WBM A;  3LSR A;  4IHX A;  1LE8 B;  1V5E A;  3ZN0 A;  1KYW A;  2QQA A;  3HPH A;  1O3R A;  2OU2 A;  2VC0 A;  3OOU A;  4NC7 A;  5TIS C;  2K9N A;  1ZAO A;  1ETV A;  1BR2 A;  4UB6 C;  3IRR A;  1DU0 A;  4HF2 A;  2HYG D;  1HC8 A;  3ZGK A;  3DPJ A;  3IAM 2;  5KK1 A;  2CUJ A;  5LBQ A;  4UNO A;  4A3G J;  1IRX A;  1ZAR A;  2QKM B;  4WIB A;  1RPW A;  3CUQ A;  4KIF A;  4QPO A;  1S72 I;  3FXQ A;  1RES A;  2GA1 A;  4DYR A;  2PFB A;  1MMN A;  2X9D A;  2YS9 A;  2I10 A;  1UJ8 A;  3M1C A;  1W4M A;  4W1U A;  3S1M J;  3JRB A;  3QWL A;  4L0Y B;  3SHF A;  3P9T A;  4BJ6 C;  2XAF A;  1YIJ I;  3ZQ7 A;  4DZP A;  3GYH X;  1S29 A;  3DPT A;  4EGZ A;  4IVN A;  3SEZ A;  1TNT A;  4K2E A;  1KU7 A;  2DDB A;  2E2J J;  1BJZ A;  1MJB A;  2KLO A;  3K70 D;  1I39 A;  2LY9 A;  2MD0 A;  1OCZ H;  3AL0 C;  1S6L A;  3UKG A;  1SC7 A;  2VJJ A;  3G2B A;  1UFM A;  3VOE A;  3K4K A;  5EJC A;  5M3F J;  1Z7U A;  3LJL A;  1A6I A;  2OAZ A;  2V57 A;  4M71 A;  4OD5 A;  1T6S A;  2I5U A;  3CLO A;  2RV8 A;  3QAH A;  2DOD A;  2GXG A;  2JT1 A;  2XV4 S;  5CVI A;  5D8K B;  3QP5 A;  2V1D A;  2GFN A;  1B72 A;  1N25 A;  3SZG A;  2DG7 A;  4M9Z A;  5F1J A;  3J7Y J;  1B6A A;  1W5T A;  2L7K A;  3LOC A;  5IOY A;  2MW8 A;  1HW1 A;  2TDX A;  2LDU A;  2GXB A;  4RGR A;  1D1C A;  1ZKG A;  3MZ8 A;  3RKX A;  2K7L A;  2VPL A;  1IO2 A;  3ZMD A;  2LKX A;  5L3E A;  5IT9 K;  1RI7 A;  4RLF A;  2X6Y A;  4BXF A;  3PSF A;  2FOK A;  2Q2E B;  1MDM A;  3PQJ A;  3TDZ C;  2X85 A;  3SFZ A;  2R93 J;  2L02 A;  4BUP A;  3GVA A;  5M5Y J;  2PMU A;  2H8R A;  1QBJ A;  2FBI A;  2JPB A;  2D6Y A;  1BI0 A;  4IQ4 A;  5ICE A;  1BW5 A;  5ILS A;  4D7M A;  3KKC A;  4IOC F;  3D5R C;  3FXU A;  1GXP A;  3LSP A;  1VF9 A;  3BLY A;  2XF5 A;  1HA8 A;  1P4X A;  4KIT B;  4G6T B;  4NDL A;  1KZH A;  1EJ9 A;  3IKV A;  3FXM A;  1TQM A;  3BR0 A;  3LMM A;  3M8F A;  3FM5 A;  4N0B A;  2E7W A;  3E0J B;  3JRH A;  5IP9 J;  2X1D A;  2E60 A;  2GOX B;  1XDU A;  4BQA A;  2M7B A;  4GCT A;  3F72 A;  2LP0 A;  2GWR A;  3BJO A;  5B3S H;  1QRY A;  3S1R J;  2XVC A;  5F27 A;  1XD7 A;  4BHC A;  3HUG B;  5J8F A;  4F3Q A;  5C4X J;  3IWF A;  1MMA A;  4PSW A;  1LEB A;  1JTY A;  1X1A A;  4NN1 A;  3U9G A;  1FYL A;  3O8H A;  2UXN A;  2MA3 A;  1IDY A;  1QVU A;  2WAF A;  4Y52 J;  4PZJ A;  4LG0 A;  3DKY A;  4PGG A;  3WG7 H;  5HDK A;  4KDP A;  1YLF A;  3GCM A;  3F9K A;  4RA2 A;  2MGQ A;  2LH9 A;  1N78 A;  2HQ5 A;  3P9C A;  1F36 A;  3ASN H;  1WJD A;  5GP9 A;  2LBF A;  4C3J J;  2CW7 A;  5FGM A;  5AON A;  1YJN I;  2PJR A;  1ZLJ A;  1DP3 A;  2QOP A;  4E7L A;  3NRG A;  1LDJ A;  2HQN A;  2XPW A;  4AVP A;  4ACI A;  2E19 A;  5AQC A;  2R7F A;  3O60 A;  5KHD A;  4S04 A;  3HOV J;  2ZSH B;  1DGW Y;  4BL0 B;  3ZR8 X;  2DFH A;  5F0F A;  1BJA A;  2M9H A;  2MLK A;  2LRD A;  2WC2 A;  2CRG A;  1C0W A;  5HSZ A;  2ICW G;  2VT2 A;  3A4C A;  4OMY A;  3COL A;  5D18 A;  4HX4 A;  1RKT A;  3GW2 A;  2COM A;  3MN2 A;  4C3I J;  2PBX A;  3VOX A;  5FHP A;  3RDI A;  3VFZ A;  2RQP A;  1SFU A;  4CCL A;  1WFX A;  1DQU A;  4C2M A;  1EH7 A;  5F1R A;  3MNL A;  2CWE A;  3KP7 A;  5GTI C;  3BZC A;  1EH8 A;  2W57 A;  1Y0N A;  5DEQ A;  1QVT A;  2AQE A;  1H8A C;  3OYN A;  3ZMU A;  3DBR B;  5E8I A;  1G3Y A;  2KL4 A;  1B8I A;  2DLL A;  4J19 A;  1MH3 A;  1YYV A;  3K1N A;  5ICC A;  4I99 C;  1LDD A;  4MLO A;  4XLC A;  1QO0 D;  5EFY A;  2HTS A;  4I09 A;  4QSH A;  3HBL A;  4MGR A;  3C3W A;  1D3Y A;  4HKU A;  4V19 K;  4B1R A;  2YVH A;  2QQB A;  4P5O A;  5ILU A;  2O6G E;  4JYK A;  4WX9 A;  3WG9 A;  2QSG X;  2XC7 A;  3S16 J;  4UVA A;  1B4A A;  4E7K A;  2CGP A;  5FKN A;  2XKP A;  1WJC A;  1WH7 A;  2CQQ A;  5EG0 A;  2DK5 A;  1FBU A;  1Z21 A;  1HSJ A;  3SYT A;  2IA2 A;  3B6A A;  2R0Q C;  1QU3 A;  4RB3 C;  3F6V A;  2V9P A;  4P96 A;  2BXY A;  1AKH A;  1E3H A;  2QGU A;  5EYR A;  4XKB A;  3TW6 A;  3RKQ A;  3ZQF A;  3HRU A;  4HDV A;  2OA4 A;  2VKH A;  2KJC A;  2KZG A;  2YSR A;  1F1Z A;  3KET A;  1TW2 A;  2QQ8 A;  3LSJ A;  1LJ9 A;  4CCJ A;  3H3V K;  5D4R A;  4PCQ A;  4J01 A;  1ZLK A;  2IJL A;  3R6S A;  5M5X J;  4A0X A;  4BH9 A;  1FEX A;  1UHM A;  1MBG A;  3RQI A;  3BR6 A;  1MBK A;  1BI1 A;  1ZR4 A;  1J0R A;  3QYE A;  3OYL A;  4NQW A;  5KAI C;  3V8K A;  4GGG A;  3RH2 A;  5AIQ A;  2JA6 J;  2A69 F;  1OCT C;  1GUU A;  3QRF F;  1UG2 A;  2QBY A;  5EEA A;  2VQL A;  2ZB9 A;  3M1E A;  2IXS A;  2XAQ A;  2BY0 A;  3CLQ A;  2X1C A;  3KE2 A;  4XLN F;  3QPT A;  4QIW N;  2B0L A;  1DPR A;  1Z1D A;  4ANJ A;  2O9L A;  4CDG A;  3KP3 A;  2M45 A;  4U0W A;  2DI3 A;  1X4P A;  3P9K A;  2DG8 A;  2X6X A;  1R36 A;  4NQW B;  2Q2E A;  1MDM B;  1MH4 A;  3V8L A;  4BQO A;  1MSF C;  1TTY A;  3GUD A;  3K4M A;  4EQQ A;  3LSK A;  4NHJ A;  1WI3 A;  1FMV A;  5K5Q A;  2QBY B;  5DYM A;  2D5V A;  2W48 A;  5D6F A;  5J1U A;  3JRE A;  3VW1 A;  4MHG A;  4ZYG A;  4RLQ A;  2N8G A;  4HOB A;  4FIS A;  4XKW A;  3OYH A;  1E17 A;  4B44 A;  3ZMZ A;  2EH3 A;  1HW5 A;  2DJN A;  4BEH B;  5IOZ A;  2Z5U A;  2BY2 A;  4MTE A;  2X6O A;  3B73 A;  3BJA A;  5FJ8 J;  2PJP A;  2UXI A;  2GLO A;  2DMT A;  1X3Z B;  2Y30 A;  5J8C A;  4F55 A;  3D5L A;  1XS9 A;  2RNJ A;  1UHS A;  4HST A;  1I6H J;  1QHG A;  4HW0 A;  3V42 A;  5K5R A;  2FML A;  3BWG A;  2DMN A;  4ENJ A;  3HRM A;  4HBL A;  4AC0 A;  1V54 H;  3J81 K;  2VJI A;  1NG6 A;  3NEU A;  2BVM A;  4M73 A;  3ULQ B;  3PNT A;  4MEX F;  1LVK A;  3LAP A;  1TWC J;  2RQQ A;  4MQ9 F;  5HLT A;  3DTE A;  3G1O A;  2WV0 A;  1MBJ A;  2E36 A;  1QZZ A;  3F8N A;  1IG7 A;  5F6F A;  3OS1 A;  2BZT A;  1R6R A;  2L54 A;  2RDP A;  3AG3 H;  4U0Y A;  1P7J A;  3GZ6 A;  2OTJ I;  4ZYH A;  1IC8 A;  4JK1 X;  3QPS A;  4A3F J;  3ASO H;  1OYY A;  2OC6 A;  5C4Y A;  1FBQ A;  3EUH A;  3C7J A;  3VSL A;  1F43 A;  2L4A A;  4XLH A;  3HIF A;  1ETX A;  3MKL A;  5FO5 A;  3PUF A;  2WAQ A;  3CJT B;  3X2Q H;  2LY2 A;  2HKO A;  3RZO J;  1J2X A;  2NP3 A;  2X6W A;  3TO9 A;  3CQZ J;  5K5O A;  1LQ1 A;  3LHQ A;  2HYF A;  4IO9 F;  3BZ6 A;  1K4S A;  1PUE E;  2NP5 A;  3OYI A;  2TCT A;  4Y33 A;  3G1L A;  2B7E A;  3F23 A;  2CV1 A;  4AIJ A;  3G1M A;  2A6T A;  4U9L A;  1Y1W J;  2FBQ A;  3WGG A;  4R8H A;  2JUC A;  1D0X A;  5FGL A;  2X1E A;  2CU7 A;  1JGS A;  2CUF A;  2K40 A;  2Y31 A;  3NAR A;  3V7C A;  4G7H F;  1T0F A;  2DO7 A;  1FBS A;  1B1B A;  3PO3 J;  2QSF X;  2QLZ A;  3KZZ A;  3FXR A;  2DYS H;  2MH2 A;  4G94 A;  4IRG A;  3ZOB A;  4M74 A;  2DOA A;  2ELK A;  3O3K A;  4FCY A;  3GTL J;  3F22 A;  3BQZ A;  2BGC A;  2UUZ A;  3TL4 X;  2JMW A;  2OV7 A;  3W2W A;  1IW7 F;  1I27 A;  3SXY A;  1L3L A;  2JVG A;  2VON A;  3PFY A;  3V4G A;  1Y6I A;  1SD5 A;  3SJM A;  4X6A J;  2ZY9 A;  3EUP A;  1T2K A;  3IUV A;  3BR3 A;  1YX5 A;  3CO6 C;  1JT0 A;  5AIP A;  2F4M B;  2F48 A;  4HAM A;  4UHT A;  4UV8 A;  2BEO A;  1W7P B;  2LD5 A;  3I4N J;  2BY1 A;  3K1M A;  1SVL A;  4JQF A;  1A36 A;  3LFK A;  3QU6 A;  4F92 B;  4PJN A;  3PIO F;  3IAS 2;  2FJ1 A;  3BCG A;  4A6E A;  4HV5 A;  1HQC A;  4LLN A;  2V1N A;  4MXM A;  5GTH C;  4HF1 A;  2VIX A;  2JN6 A;  2WB1 A;  5JHU A;  1YW7 A;  4HX8 A;  3SQN A;  1FZP B;  2IGN A;  3L2W A;  1R1T A;  2AXL A;  1AKH B;  1IV8 A;  4UVC A;  2E1O A;  2W00 A;  1XGS A;  4A12 A;  5TGT A;  5L3C A;  3G3Z A;  1WJA A;  5LHH A;  2WAE A;  3G7R A;  1YW9 A;  4HLX A;  2VQH A;  4LIT A;  2VOO A;  5CXI A;  1YX3 A;  1SFO J;  1ENH A;  1XMA A;  2CMP A;  4WXH A;  3PNY A;  1WJ5 A;  2VXD A;  4WWC A;  3A0B C;  2OUM A;  1XN7 A;  4B47 A;  3AQS A;  3OYM A;  1R00 A;  2EZK A;  2FJI 1;  2UXX A;  2CUE A;  4YEJ A;  4WK8 F;  3R4K A;  4DQ2 A;  1ETQ A;  2ZBK A;  3OR2 C;  1KQ9 A;  2YX7 A;  3HGG A;  1MMS A;  3ZMS A;  1K4T A;  3TP3 A;  1W7P A;  1G4D A;  1PJR A;  2XIG A;  2D1H A;  1LVA A;  4A69 C;  2G9W A;  4HQM A;  4G9Y A;  1SFX A;  2V4J C;  4RAY A;  3G71 I;  1QA6 A;  4XL9 A;  5DCM B;  3OS0 A;  1FP1 D;  2V6C A;  2F4O B;  1VQM I;  4UB8 C;  3HKZ N;  3KZI C;  1NK2 P;  2IS2 A;  3I53 A;  2R3S A;  4KN4 X;  1YQA A;  3BCA A;  3R0A A;  1IXC A;  5C3E J;  5LRS A;  2QWW A;  1A35 A;  4I6Z A;  1OCC H;  2JA7 J;  4D0P A;  3R60 A;  5DD8 A;  5H6R A;  2NOG A;  3DF8 A;  1WKM A;  5IT9 Z;  2ISZ A;  5K7H A;  2CV2 A;  2W53 A;  3LWJ A;  5K58 A;  3VYU B;  4H4K C;  2M3A A;  1D5Y A;  2YUS A;  4JOM A;  3ABM H;  3BDD A;  4V2G A;  4XIC A;  4BS9 A;  4MO7 A;  4A5M A;  1RC9 A;  3AG2 H;  3KEY A;  2WB1 N;  2HOT A;  2ECC A;  2BY3 A;  3WTS C;  4F52 A;  1X2N A;  3F8B A;  3VOD A;  3FMQ A;  2KPM A;  2ZCN A;  4PJ0 C;  3CZ6 A;  2HFH A;  1IAW A;  2L7Z A;  2CW8 A;  2HGC A;  3M07 A;  5F04 A;  2HOE A;  3LAJ A;  1FMW A;  4U87 A;  2V1U A;  4A3L J;  2DA7 A;  2H6C A;  1ZG1 A;  3PFI A;  1RET A;  3DLA A;  1JKO C;  1KQ0 A;  3OYC A;  3HM5 A;  5L3B A;  3ZQI A;  1ZR2 A;  2XB0 X;  4ZDP A;  2VOD A;  2W25 A;  3JRF A;  2YVX A;  4YIF A;  5IYC J;  4X0G A;  2ZCX A;  1J5Y A;  2PFV A;  2DA1 A;  3MKW B;  5TRD A;  3HTH A;  2K4B A;  3OR1 C;  4BHB A;  2M87 A;  4FX4 A;  3H9G A;  2VJ5 A;  4Y3O A;  3E6C C;  3E5X A;  2BVL A;  2I8D A;  1OQY A;  1I6X A;  2E1N A;  4BE1 A;  1UEL B;  2DN0 A;  1JKP C;  2D45 A;  4M6X A;  4A3C J;  3FXJ A;  4FE7 A;  1TWH J;  1BIA A;  2V79 A;  2WTE A;  4GCK A;  1QZY A;  4ABZ A;  4IL6 C;  2ZXW H;  3IKT A;  1POG A;  2HQA A;  3MMY B;  1K78 B;  1J59 A;  3CCR I;  3MZH A;  1IGN A;  1WPK A;  4IPA A;  2P5V A;  1Z0X A;  3BC8 A;  4HNT A;  2O0Y A;  1TZL A;  3OYF A;  3QOD A;  3CCU I;  3I56 I;  5ED4 A;  2XUB A;  1A31 A;  2Y9Z A;  4A0Z A;  1MBE A;  5FFX A;  3I55 I;  4M3G A;  2KDZ A;  4PXI A;  4AYB A;  2JPC A;  3OYD A;  2H1L A;  2DK8 A;  4I0B A;  5E20 A;  5ICF A;  3FRQ A;  2R7T A;  5HLH A;  4L5J A;  3HSE A;  3EUH C;  2KRF A;  3ZP5 A;  4GO1 A;  5DAJ A;  2E1M C;  2M4K A;  3KPH A;  3RQ4 A;  1JJ6 C;  5IPA A;  1OLT A;  1U6G A;  3NWT A;  4BHP A;  2VC1 A;  1MMD A;  4L9T A;  3AKZ A;  4BY7 J;  3V7R A;  4F7Z A;  4ESF A;  4J00 A;  4PK4 A;  1XGO A;  1P4W A;  1FOW A;  1O7F A;  2VKD A;  1HBX G;  5FMP A;  3S93 A;  1K6O A;  4BXU A;  4MFE A;  1BC8 C;  5JVT A;  5CPR B;  3N4M A;  1YRN A;  2O5R A;  4GFL A;  3KZY A;  4XKV A;  3K4C A;  3DPU A;  1ZG3 A;  1BM9 A;  1ON2 A;  5HNH A;  1ON1 A;  1OYW A;  3ML6 A;  5DD4 A;  1YOV B;  4OIR F;  2L9S A;  4DIQ A;  3H92 A;  3KEQ A;  4LLG F;  3BG6 A;  3FKJ A;  2ZJR F;  3NPI A;  3HYI A;  4YRV A;  2FNP A;  5E1W A;  2IP2 A;  3JRA A;  5GPC A;  4ZTJ A;  5C4J J;  4M3D A;  3CCQ I;  2JRM A;  2P7V B;  1VI0 A;  4LMY A;  2KIF A;  2WV1 A;  2XKO A;  4PJJ A;  2JQ7 A;  1UB9 A;  3HOT A;  1XCB A;  2HTJ A;  4ON0 A;  4EJV A;  2ACJ A;  2GUH A;  3MEX A;  4G6D A;  1RR7 A;  2HU9 A;  2OQG A;  3CTA A;  3CC4 I;  4DBR A;  2L5Q A;  1T38 A;  3Q0U A;  3VYS B;  4CXF A;  2GQQ A;  5CVV A;  1Z9C A;  2ME6 A;  1W7P D;  3RIR A;  1APL C;  2YPR A;  4CYD A;  1YFH A;  2KZV A;  2R4G A;  4XBF A;  2LVS A;  1R1U A;  1DGR M;  4IKF A;  5FLX K;  4ICH A;  1JE8 A;  1MBF A;  2E2I J;  1Z3X A;  2G7G A;  1BA5 A;  4FX0 A;  3KKD A;  1XG1 A;  1FIP A;  2EFN A;  1IZ1 A;  3ECH A;  3PJR A;  4JL3 A;  2V9K A;  2G7U A;  2JVH A;  3RPU D;  3WOD F;  3SDB A;  2LOO A;  2M8E A;  4BDZ A;  3JAM K;  4D1Q A;  3M3Y J;  5GAD J;  2HXO A;  1JXS A;  2A6E F;  3PNV A;  1BOA A;  3OYB A;  2VLA A;  2LC2 A;  5FLV A;  3HOW J;  1SMT A;  4A3I J;  4ZJZ A;  4KIG A;  1QPM A;  3QYF A;  1FYK A;  2YU3 A;  5FRM A;  1WI9 A;  1GVD A;  4Y17 A;  1MGT A;  3JRI A;  1AHD P;  3IC7 A;  4RM2 A;  3HSR A;  4OIN F;  1G8X A;  2LSO A;  1OCO H;  2CQN A;  1JT6 A;  2MBF A;  4PJL A;  2JUG A;  4HQE A;  2ZNZ A;  1RKW A;  1ZQ3 P;  2PG4 A;  4HF0 A;  3L2V A;  4ZDL A;  2UXU A;  3VDX A;  3Q9S A;  4E4H A;  2RRE A;  4WXC A;  2A3S A;  3LA3 A;  3CCJ I;  1LFB A;  3DBH B;  4OU0 A;  1LNW A;  3BR1 A;  3COA C;  1RUO A;  5EZG A;  1D8J A;  5F0C A;  1ORK A;  2IGK A;  3TW7 A;  1BR4 A;  1ZTR A;  4MK6 A;  1SMY F;  1D1B A;  1TQI A;  4DJA A;  1BI3 A;  3JRD A;  3G6E I;  4C2T A;  3GZN B;  4PJM A;  2E1M B;  2Z99 A;  2EA4 A;  2LY1 A;  3IRQ A;  2IGM A;  5IP7 J;  4L5E A;  1ODD A;  3HSF A;  2KHM A;  4JX5 A;  2IS4 A;  1ETK A;  1G3W A;  2OER A;  4M6V A;  2P8T A;  4UUV A;  1XTA A;  4CCK A;  1UHW A;  5FRN A;  4AF5 A;  3CWR A;  5KCM A;  3HOX J;  2DA5 A;  2RAE A;  1D0Z A;  2LLK A;  4PFO A;  5CVR A;  1SD4 A;  2XRL A;  3F8C A;  5CXG A;  3BJB A;  2E5N A;  2VQC A;  4BKX A;  2CYY A;  4IRH A;  2JA5 J;  3MAJ A;  2DT6 A;  2ZXI A;  3CUQ B;  5B5E C;  1IN7 A;  4EVI A;  1UAA A;  5E3M A;  1R7J A;  4G6Q A;  3T8T A;  1Q1V A;  4D7N A;  2K9M A;  1E0E A;  1IN5 A;  2IVM A;  3DCF A;  3OL3 A;  4I02 A;  4Y4R A;  5FLM J;  3FIS A;  3CC2 I;  3BRU A;  1TBX A;  2QWT A;  2B63 J;  3H1C A;  4ENK A;  2L7F P;  2K85 A;  2HKX A;  1T33 A;  3T8R A;  2L9V A;  3V7S A;  3SDG A;  4YG2 F;  3J80 K;  2YU9 J;  3HTS B;  2DBB A;  4LB5 A;  3SWH A;  4UDS A;  4KMF A;  2NRA C;  3VW2 A;  2L0K A;  1AU7 A;  3KYD B;  1R9T J;  4XRS A;  1X19 A;  3OSF A;  4QTR A;  5LGN A;  2XHK A;  2LFB A;  3PAS A;  3E97 A;  3OYE A;  2E1C A;  3NQO A;  2E34 A;  2BYV E;  3KYL A;  3BG5 A;  2H94 A;  2MG4 A;  3VYR B;  2G7S A;  2V6E A;  2ZJQ F;  2XPV A;  1EKE A;  4N4N B;  4AYB N;  1B72 B;  3ZXS A;  3Q9V A;  3HE0 A;  2XDN A;  3LQR A;  2HOS A;  2PLY A;  4A0Y A;  4IQJ A;  2QKL B;  1CF7 B;  5CQE A;  2ZCM A;  2DQL A;  2IAI A;  3GFL A;  1OCP A;  5JVG F;  5H20 A;  3I3L A;  3CF2 A;  3NRV A;  4CH7 A;  3ERE D;  1LFU P;  4DYC A;  2R5Z A;  5F08 A;  1ZRF A;  1BL0 A;  3W2V A;  1G3T A;  3WU0 A;  2D1V A;  5FD6 A;  2ZXJ A;  4ZYD A;  2IBD A;  3ZQQ A;  2ZOY A;  2W82 A;  1ZGW A;  3Q5F A;  4AUX A;  1S9H A;  4GFB A;  5EEH A;  4BAY A;  2HYJ A;  2NS7 A;  5M3M J;  5DM6 F;  2Y2Z A;  3ECO A;  3LFU A;  1DDN A;  5E17 F;  4GCV A;  1YI2 I;  3HZJ A;  2ZME B;  3CD6 I;  3DP7 A;  5D19 A;  5E3O A;  1H0M A;  1MNE A;  3P5J A;  3GTJ J;  2H27 A;  2GM4 A;  3K4J A;  3GTP J;  3KLN A;  1VQL I;  1OKR A;  4G12 A;  3WTU C;  4BJT A;  1U8R A;  2W84 A;  3ON4 A;  1YO5 C;  3MFK A;  1ZHF A;  3S3M A;  5J4Y A;  2YX4 A;  1ULY A;  4LK0 F;  2YVE A;  2XF7 A;  1IXR C;  2CH0 A;  2WAQ N;  2K86 A;  3RTR A;  1BIB A;  3F8F A;  4GXO A;  2P6S A;  3ZPL A;  4KYW A;  3L2C A;  3G73 A;  2FRH A;  3CDL A;  1ZGJ A;  3H36 A;  4ZTF A;  4UV9 A;  3C18 A;  5IT3 A;  1QGP A;  1ZH5 A;  4E7H A;  2F2E A;  3JRG A;  2QYO A;  4EJW A;  5GPA A;  2OZ6 A;  4BBS J;  4L0Z B;  3HHH A;  4R79 A;  3T1B A;  1TC3 C;  3QU3 A;  2FU4 A;  2W24 A;  3S3N A;  3HOS A;  1PUF A;  2M4G A;  4KN7 X;  3BQY A;  4UY8 I;  3PO2 J;  1NK3 P;  4XID A;  2MLG A;  1XX5 A;  3E6M A;  1X4O A;  2V1X A;  3OOP A;  2P6T A;  2F5D A;  1S7O A;  4BEH A;  1FT9 A;  4M3B A;  2OZU A;  4II2 A;  2FBH A;  3KP4 A;  1LPQ A;  4NNJ A;  2QTQ A;  1WJE A;  2COB A;  1H9G A;  3W2A A;  5J1Y A;  2VL8 A;  2YR2 A;  4Q47 A;  4HNV A;  3GZ5 A;  1HST A;  3JAM Z;  4C3H J;  1PP8 F;  3QKX A;  1A6Q A;  1TT5 B;  1E3P A;  3PSI A;  4FT8 A;  4E6K G;  4I76 A; 
#chains in the Genus database with same CATH homology
 2F07 A;  3ANG A;  4A3D J;  3C2B A;  2M0C A;  1LE8 A;  3G7R A;  2L9R A;  1GT0 C;  5CXI A;  4MFD A;  1SFO J;  3NNR A;  1ENH A;  3A02 A;  2VPR A;  3ZQC A;  3M4O J;  3AQS A;  4GFK A;  3IH4 A;  2QF7 A;  2EZK A;  4JNN A;  1X2M A;  1GV2 A;  3GEU A;  2KT0 A;  1S7E A;  2CUE A;  3LSR A;  4IHX A;  1LE8 B;  1ETQ A;  3SFI A;  2M34 A;  3HGG A;  3I4M J;  1PUF B;  3TP3 A;  5E3N A;  2IU5 A;  3OOU A;  1HCR A;  2K9N A;  4A69 C;  4C2M J;  1ETV A;  3HDD A;  3JR9 A;  2M2E A;  2RHA A;  3V6G A;  2DA2 A;  1HOM A;  1B8I B;  1DU0 A;  3BG3 A;  4L62 A;  4EEF G;  3QBM A;  3DPJ A;  3HKZ N;  1NK2 P;  4A3G J;  4GCL A;  1RPW A;  3BG9 A;  5HOD A;  1RES A;  4DYR A;  2L7M P;  2X9D A;  5FKK A;  2YS9 A;  2I10 A;  4W1U A;  3S1M J;  2CQX A;  3JRB A;  5C3E J;  1JKQ C;  3ON2 A;  4I6Z A;  2JA7 J;  3P9T A;  3LWJ A;  2NOG A;  4JP0 A;  2W53 A;  5K7H A;  1QPI A;  5K58 A;  4DZP A;  4B3A A;  2ID6 A;  2FD5 A;  2AHQ A;  1D5Y A;  2YUS A;  4V2G A;  4XIC A;  2E2J J;  1BJZ A;  4MO7 A;  2WB1 N;  2HOT A;  1ETO A;  4UUS B;  2ECC A;  2LY9 A;  1T56 A;  3UKG A;  1X2N A;  1U8B A;  3S1Q J;  5M3F J;  2DA6 A;  2EBI A;  2ZCN A;  3LJL A;  1A6I A;  2V57 A;  4RDU A;  2L7Z A;  3JRC A;  1MNM C;  2Y9Y A;  5F04 A;  3L1P A;  3MVP A;  3Q0V A;  3VUQ A;  2O7O A;  5IYB J;  4A3L J;  2DA7 A;  2M8G X;  2G3B A;  1JKR C;  1RET A;  1JKO C;  2VKE A;  3HM5 A;  1A5J A;  3LNQ A;  3ZQI A;  2QIB A;  1ZR2 A;  2GFN A;  2XB0 X;  4IHW A;  1B72 A;  3F1B A;  3JRF A;  1H88 C;  2NVQ J;  2DG7 A;  1JUS A;  5F1J A;  3LOC A;  2DA3 A;  5JLW A;  5IOY A;  3NAU A;  2MW8 A;  5IYC J;  5EGO A;  2ZCX A;  3GTQ J;  1ZKG A;  4A3K J;  2DA1 A;  1JUP A;  3HTH A;  4AC6 A;  3BTL A;  2LKX A;  2FQ4 A;  2E2H J;  5CW8 A;  5FKM A;  1G2H A;  1NTC A;  2DN0 A;  4M3E A;  1JKP C;  2R93 J;  5M5Y J;  4A3C J;  2R5Z B;  2H8R A;  4FE7 A;  1TWH J;  4GCK A;  4ABZ A;  3D1N I;  3OSG A;  3C07 A;  4IHV A;  2IEK A;  2CJJ A;  1POG A;  2D6Y A;  1BW5 A;  4A3M J;  1IGN A;  1WPK A;  4D7M A;  1K61 A;  3KKC A;  1Z0X A;  3RD3 A;  4IHY A;  2LK2 A;  1OJL A;  3LSP A;  1VF9 A;  2Y9Z A;  1MBE A;  2KDZ A;  4PXI A;  4M3G A;  3BNI A;  3JSJ A;  4NDL A;  3WHC A;  2EZI A;  2OPT A;  3FKI J;  3FRQ A;  1EF4 A;  3A03 A;  5D1R A;  5DAJ A;  2AO9 A;  3BR0 A;  2Y0S N;  1JJ6 C;  3AQT A;  5IPA A;  3JRH A;  5IP9 J;  1HLV A;  2QKO A;  1K83 J;  4JKZ A;  1IRZ A;  4GCT A;  2LP0 A;  4BY7 J;  3S1R J;  1QRY A;  1ITY A;  2XB5 A;  3BHQ A;  4XRM A;  4DZJ A;  5FMP A;  5F27 A;  4MFE A;  1IUF A;  5C4X J;  1YRN A;  4GFL A;  3DEW A;  1JTY A;  2TRT A;  2G7L A;  4NN1 A;  1CQT A;  3O8H A;  3NXC A;  3VW0 A;  1IDY A;  1QVU A;  5F0H A;  4Y52 J;  2XPU A;  2NS8 A;  2QCO A;  1VFC A;  3NPI A;  2MGQ A;  3JRA A;  3HTJ A;  2HQ5 A;  5GPC A;  3TED A;  1F36 A;  4M3D A;  5C4J J;  5EGO B;  3IV5 A;  1VI0 A;  5GP9 A;  3IH2 A;  2HOA A;  4C3J J;  2WV1 A;  2P81 A;  3FK6 A;  4RBO A;  2DMQ A;  2QOP A;  3NRG A;  2XPW A;  3QPL A;  2GUH A;  4ACI A;  2E19 A;  5AQC A;  3O60 A;  1RR7 A;  3HOV J;  2HYT A;  5HAW A;  5F0F A;  1XC5 A;  3S17 J;  3Q0U A;  1DU6 A;  1IV6 A;  4D5C A;  2M9H A;  3CMY A;  2CRG A;  5HSZ A;  2ME6 A;  2VUM J;  3COL A;  2EQR A;  4XK4 A;  1APL C;  3S2D J;  3S1N J;  1U78 A;  1I50 J;  2ME0 A;  5D18 A;  3O8G A;  1RKT A;  2LVS A;  4JX4 A;  3MN2 A;  2FX0 A;  3S2H J;  4C3I J;  2PBX A;  4ICH A;  2OI8 A;  1MBF A;  2ZOZ A;  5FHP A;  3VOX A;  2EZH A;  2E2I J;  2G7G A;  1BA5 A;  1HDD C;  3KKD A;  3MNL A;  3LSG A;  1XG1 A;  3Q3S A;  1FIP A;  4W97 A;  1QVT A;  2XSD C;  3E7L A;  2K9S A;  3WHB A;  1H8A C;  4JL3 A;  1JTX A;  4Y7N J;  3M3Y J;  1B8I A;  2HXO A;  2JJ7 A;  1MH3 A;  4J19 A;  1MBH A;  4MLO A;  4B4C A;  2H1K A;  3HGY A;  5EFY A;  2LR8 A;  2XGC A;  4QSH A;  5J3L A;  3HBL A;  5FLV A;  4HKU A;  3HOW J;  2YVH A;  4B1R A;  4A3E J;  4A3I J;  2DA4 A;  1JGG A;  3NI7 A;  4JYK A;  1X58 A;  2HXI A;  3S16 J;  2WGB A;  5JLX A;  1WCM J;  3GTG J;  3BT9 A;  2X48 A;  4JX6 A;  5FKN A;  3VIB A;  1GVD A;  2NX4 A;  1WH7 A;  2CQQ A;  1ZK8 A;  5EG0 A;  3JRI A;  3ZQG A;  1AHD P;  3TP0 A;  2WUI A;  3BTC A;  3VOK A;  3HOU J;  3B6A A;  2R0Q C;  1JT6 A;  2PMZ N;  2R5Y B;  1TWG J;  3VP5 A;  3HIM A;  3H0G J;  1AKH A;  1RKW A;  5EYR A;  3HOY J;  1ZQ3 P;  3TW6 A;  3RKQ A;  3ZQF A;  1O4X A;  2UXU A;  4IEJ A;  2K9Q A;  4UUS A;  3LSJ A;  3H3V K;  3G56 A;  1LFB A;  4DYQ A;  3BR1 A;  2REK A;  5EZG A;  2LTP A;  5M5X J;  2R5Y A;  5F0C A;  1FEX A;  4DW6 A;  3CCY A;  1ORK A;  3TW7 A;  2VI6 A;  4KWA A;  1ZTR A;  4MK6 A;  1MBG A;  3RQI A;  3BR6 A;  4MIM A;  3JRD A;  1MBK A;  3BTJ A;  3QQA A;  1ZR4 A;  2ID3 A;  5HBU A;  1ETW A;  2O8K A;  5IP7 J;  4L5E A;  2PZ9 A;  5J1R A;  3RH2 A;  2JA6 J;  1OCT C;  4JX5 A;  1GUU A;  5EF6 A;  1ETK A;  3GZI A;  1UG2 A;  5M5W J;  4M6V A;  5EEA A;  2OER A;  4NEL A;  3GTK J;  2ZB9 A;  3FIW A;  4AF5 A;  4QIW N;  3GTM J;  3W6V A;  2O9L A;  2UXH A;  3CWR A;  3HOX J;  2DA5 A;  2RAE A;  1IDZ A;  5K7F A;  2LLK A;  2JK3 A;  3ZQH A;  2DG8 A;  2XRL A;  1VND A;  3F0C A;  5CXG A;  1JUM A;  3BJB A;  4BKX A;  1MH4 A;  1MSF C;  2GBY A;  2JA5 J;  1WI3 A;  4CYC B;  1IJW C;  4X1E A;  2Q24 A;  3RZD J;  2D5V A;  2W48 A;  5DTD A;  5J1U A;  3JRE A;  2XGD A;  3VW1 A;  5E3M A;  2N8G A;  1JJ8 C;  4FIS A;  3BTI A;  1Q1V A;  2EH3 A;  2DJN A;  4D7N A;  4A93 J;  5IOZ A;  1FTT A;  5EZH A;  2X6O A;  3GBG A;  5FJ8 J;  3DCF A;  3EGQ A;  3BRU A;  5FLM J;  3FIS A;  2QWT A;  3K7A J;  2B63 J;  2L7F P;  2UXI A;  3B6C A;  2GLO A;  4CGR A;  5BNG A;  1E3O C;  1T33 A;  3SDG A;  2DMT A;  5IP6 A;  2YU9 J;  2Y30 A;  4ME9 A;  1SGM A;  4S0H B;  4UDS A;  4D5F A;  2UXP A;  2DMP A;  1XS9 A;  1I6H J;  1UHS A;  3VW2 A;  3VVY A;  3PPB A;  1WGX A;  2L0K A;  1AU7 A;  3A01 B;  1R9T J;  4XRS A;  2DMN A;  4V2F A;  3OSF A;  4QTR A;  2LFB A;  3PAS A;  4AC0 A;  3T6N A;  2HI3 A;  2NVT J;  3BG5 A;  2MG4 A;  2G7S A;  4BY1 J;  3Q0W A;  2XPV A;  4BXX J;  3GTO J;  1TWC J;  4AYB N;  1B72 B;  3CJD A;  3HE0 A;  2XDN A;  3G1O A;  4UUT A;  1MBJ A;  9ANT A;  1IG7 A;  4CYC A;  2DMU A;  2HOS A;  1GV5 A;  5C44 J;  3KNW A;  1P7J A;  2ZCM A;  1IC8 A;  2IAI A;  2DTZ A;  1OCP A;  3QPS A;  4A3F J;  1HF0 A;  1ETY A;  5C4Y A;  3FK7 A;  1LFU P;  1UI6 A;  4DYC A;  3HTI A;  1F43 A;  2R5Z A;  5F08 A;  2G0E A;  1BL0 A;  1ETX A;  3MKL A;  2IBD A;  4A3J J;  3RZO J;  2ZOY A;  3VVX A;  3IH3 A;  1FIA A;  1ZGW A;  1OFC X;  2EZL A;  4AUX A;  2NP3 A;  3CQZ J;  4GFB A;  1Y1V J;  2HYJ A;  2NS7 A;  5M3M J;  3LHQ A;  2HDD A;  2Y2Z A;  4LOC A;  2NP5 A;  2TCT A;  5IYD J;  1W0U A;  3G1L A;  5D19 A;  5E3O A;  3A01 A;  4BBR J;  1P7I A;  3G1M A;  3GTJ J;  3VVZ A;  1HDP A;  2GM4 A;  4M3F A;  3BR2 A;  3K2A A;  3S14 J;  3GTP J;  3VPR A;  1Y1W J;  2FBQ A;  1I3Q J;  5FGL A;  4G12 A;  3NAR A;  2CU7 A;  2CUF A;  2K40 A;  2Y31 A;  5FKO A;  3HEF A;  3ON4 A;  1WH5 A;  5K7Z A;  3PO3 J;  1BW6 A;  3BR5 A;  5E3L A;  3S5R A;  4FTH A;  2YVE A;  3ZOB A;  1H89 C;  1TWA J;  2WAQ N;  4XRS G;  3ANP A;  2ELK A;  4FCY A;  1GDT A;  3GTL J;  3BQZ A;  1U9N A;  2MSY A;  5DS9 A;  1FJL A;  3CDL A;  3HTA A;  2OF7 A;  3S15 J;  2JMW A;  3V78 A;  3JRG A;  1Z77 A;  5GPA A;  2NVX J;  4YZE A;  4BBS J;  5H9T A;  2VKV A;  2R7Z J;  5FKL A;  3KZ9 A;  2UXO A;  4X6A J;  3SJM A;  3EUP A;  1TC3 C;  2GEN A;  3IUV A;  1YRN B;  3BR3 A;  3CRJ A;  2JWT A;  1JT0 A;  1PUF A;  2JA8 J;  3BQY A;  2LD5 A;  2R92 J;  3PO2 J;  1NK3 P;  3I4N J;  4XID A;  1W0T A;  5EG0 B;  3PM1 A;  3OIO A;  4A3B J;  3E7Q A;  2O7T A;  1U9O A;  1SAN A;  4M3B A;  2FJ1 A;  2QTQ A;  3BCG A;  3HOZ J;  2COB A;  4FE4 A;  2NVY J;  5EDN A;  3ZQL A;  5J1Y A;  2RAS A;  2ECB A;  2HKU A;  1UI5 A;  1TWF J;  3B81 A;  4HNV A;  4MXM A;  3HB9 A;  4C3H J;  2JN6 A;  2XGE A;  3QKX A;  1UMQ A;  1AKH B;  1MSE C;  1FTZ A;  2E1O A;  4I76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...