3BTIA

Crystal structure of qacr(e58q) bound to berberine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 77
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btiA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btiA02
2LR8A 2XPUA 4XRMA 2ECCA 1WH7A 4HNVA 1ETYA 4W97A 1QPIA 5C4YA 4JX5A 3ZQCA 4W1UA 3HTAA 5K7FA 2NP5A 1MH4A 2UXOA 3LSPA 2FD5A 2E2HJ 4IHXA 2NP3A 4AC0A 4JNNA 4C3HJ 5EF6A 1ETOA 3HEFA 3GZIA 2LD5A 1H89C 4JL3A 3SJMA 2DA3A 5K7HA 2EQRA 2YU9J 4G12A 1XS9A 2KDZA 1TWGJ 4LOCA 2QWTA 3IUVA 2AHQA 3QBMA 1JKPC 5EG0B 2G7SA 2ZOYA 4GCLA 1RETA 2LK2A 2R7ZJ 1CQTA 3E7QA 1AHDP 1ZQ3P 4GFLA 4A3MJ 1QVTA 2PZ9A 2Y31A 3B6CA 3DCFA 5CW8A 1T56A 3HGYA 3BTJA 4ABZA 4B1RA 4MK6A 2IAIA 4BKXA 1WI3A 2JK3A 2B63J 4A3BJ 2NS8A 4ME9A 2NVTJ 1GT0C 4UDSA 1FIAA 1K83J 3QQAA 1A5JA 4B4CA 2H1KA 2JA8J 2P81A 5M3MJ 3HOUJ 3HOWJ 3BG5A 3VIBA 1U9OA 4A93J 3PO2J 2CUFA 5FKMA 3MVPA 4DYCA 3HGGA 3W6VA 1R9TJ 3RZOJ 3BTCA 2HOTA 2IEKA 1JJ6C 5K7ZA 1H8AC 1HDDC 3G1LA 1IV6A 4V2GA 2Q24A 5IPAA 1NTCA 3S5RA 2Y0SN 4BBRJ 2YUSA 3FK6A 1MBFA 1XG1A 5F04A 2UXIA 1UI5A 4UUSA 5DTDA 2K9QA 1Z0XA 2MW8A 1D5YA 1B72A 1TWCJ 1AU7A 1IDZA 3QPLA 3BT9A 3PASA 1U8BA 2VKVA 2QIBA 5FLMJ 1U78A 2D6YA 4NN1A 2ZCNA 2HKUA 2DMTA 4JYKA 2NVQJ 3T6NA 4MXMA 4I76A 3HOVJ 2X9DA 3A02A 2R92J 2COBA 1FEXA 2JMWA 2DA2A 4ACIA 3JREA 3VW0A 2FBQA 1UHSA 1OCPA 1QRYA 4L5EA 2G7LA 3PO3J 3B6AA 3BG9A 4UUSB 5H9TA 1GV5A 5C3EJ 1BJZA 3FKIJ 1MBEA 1JKQC 1JKOC 1TWHJ 4QSHA 1HLVA 4GFKA 4QTRA 3S17J 5F08A 4FE4A 2WV1A 3ZOBA 5D1RA 1NK3P 3BNIA 2ZB9A 5F27A 4B3AA 1FTZA 4QIWN 2Y2ZA 2DA4A 2HQ5A 1RESA 3GTMJ 1JTXA 4M3GA 3TW7A 3S2HJ 2LY9A 4BBSJ 2RHAA 1JJ8C 5E3OA 2GENA 2WB1N 2R5YA 1MNMC 3RH2A 1QVUA 4KWAA 2YVEA 3VVXA 3VUQA 1HDPA 2IU5A 5F0CA 2VI6A 5JLXA 1ZR2A 3IH4A 1MBKA 1AKHA 1APLC 2EBIA 2O9LA 3Q0UA 4ICHA 2FQ4A 4AC6A 2WUIA 4MLOA 4MFDA 3RQIA 1POGA 5FKNA 2HOAA 1Y1VJ 1JUMA 3SFIA 5M5YJ 1LE8A 2FX0A 2R5YB 3F0CA 5IOZA 3DEWA 3Q0WA 3HIMA 1Z77A 4M6VA 3QPSA 3GTLJ 3GBGA 1AKHB 2ZCMA 2LVSA 2GLOA 5GPCA 2PMZN 4HKUA 2NOGA 1OJLA 5CXGA 5IP7J 2CUEA 4XIDA 3BHQA 5AQCA 5FMPA 1F43A 1Y1WJ 2UXUA 2VUMJ 4A3EJ 3TEDA 2HXIA 2OERA 1TWAJ 2DMNA 3S2DJ 3S16J 4XK4A 2NS7A 3I4MJ 2E2JJ 3A01A 5FGLA 4CYCA 1ETKA 5E3NA 3V6GA 2K9NA 3HM5A 1E3OC 1I6HJ 4A69C 2MSYA 2DJNA 4A3FJ 2X6OA 3H0GJ 3BCGA 2NX4A 2M34A 3OSFA 1T33A 3S1QJ 3VOKA 4AYBN 1F36A 3ZQGA 1IC8A 4JP0A 3G7RA 3E7LA 2M2EA 4NDLA 3JR9A 1YRNA 3NAUA 2X48A 3LNQA 1P7JA 1PUFA 3GTQJ 5C4XJ 2Y9ZA 3KKDA 2XGEA 4X1EA 4DYQA 1BW6A 4S0HB 3NI7A 1LFUP 2DMUA 5IOYA 1ETWA 2XPVA 3QKXA 1VNDA 3H3VK 2JA5J 2VPRA 2DN0A 3NXCA 2V57A 5J1RA 3HBLA 2YVHA 3I4NJ 2EZLA 1ZGWA 4A3KJ 1BW5A 1UG2A 2DA6A 4DW6A 4IHWA 4L62A 2REKA 2XPWA 4J19A 1TWFJ 2ME6A 5GP9A 2LKXA 1MSEC 1ORKA 2EZHA 4V2FA 1YRNB 3BRUA 4A3GJ 1DU0A 1HOMA 1PUFB 1GVDA 4M3EA 2YS9A 2HYTA 2R93J 1ETQA 4RDUA 2Y30A 4AUXA 2PBXA 3LWJA 4GCKA 3IH3A 4DZJA 2M0CA 5HSZA 5EZGA 3LHQA 2CQXA 3WHCA 3S1NJ 2L9RA 2LP0A 1I50J 2E1OA 4A3CJ 2XB5A 2NVYJ 1HF0A 3CCYA 1B8IA 3BTLA 3GTKJ 2ZOZA 2LFBA 3K2AA 2HDDA 5CXIA 3COLA 4X6AJ 3NRGA 5D19A 2IBDA 3BR3A 3GTJJ 4DYRA 5IP6A 2DG8A 4D5CA 2EZIA 3G1OA 2K9SA 1GDTA 2L0KA 4C2MJ 4A3LJ 1B72B 2F07A 3S1MJ 1RR7A 2G7GA 3MNLA 3LOCA 4JX4A 2ID3A 1I3QJ 1JTYA 3HB9A 4Y52J 4FCYA 3EUPA 1K61A 2R0QC 2JA6J 2GBYA 3RD3A 4RBOA 3BR6A 3S1RJ 2ID6A 3FRQA 5D18A 1RKTA 3FK7A 3D1NI 5F0FA 3HTJA 5M5WJ 1G2HA 2R5ZA 1JUSA 3L1PA 1WGXA 5EZHA 1OCTC 3G56A 4IHYA 3SDGA 3RZDJ 3KZ9A 5EEAA 5DS9A 1RPWA 4IEJA 3GEUA 3O60A 3IH2A 2CU7A 3KNWA 2HYJA 5BNGA 2RAEA 1IJWC 3TW6A 2MG4A 5J1YA 1ETXA 2XRLA 2JWTA 5IYCJ 1IUFA 1IDYA 3BQYA 1SFOJ 3O8HA 3OSGA 1OFCX 4D5FA 1MH3A 2E19A 4FE7A 3HOYJ 3NARA 4MFEA 3GTOJ 2L7ZA 2QOPA 3VOXA 1VFCA 4XRSG 1GV2A 2CRGA 3Q0VA 1LFBA 1JT0A 4JKZA 1JT6A 1FJLA 3CMYA 2GUHA 2DTZA 4D7MA 3K7AJ 2O7TA 1BA5A 5JLWA 1MBJA 1ZKGA 3JRAA 4I6ZA 1WPKA 3VVYA 2W53A 1X58A 5F1JA 4C3IJ 2DA7A 5EDNA 1MBHA 2WGBA 3VW1A 3Q3SA 5EGOA 2ME0A 5FKLA 3JRCA 1LE8B 2UXHA 2ECBA 2AO9A 5F0HA 3KKCA 2XDNA 3PPBA 1BL0A 2L7FP 1Q1VA 3S14J 5EFYA 5M5XJ 2DMPA 3ZQFA 5FKKA 5HBUA 3BR5A 2OPTA 2XSDC 3JRGA 2GM4A 3DPJA 2G0EA 5E3LA 3BR1A 2G3BA 4BXXJ 3ON4A 1ZR4A 2MGQA 3JRBA 2QKOA 4A3IJ 3M4OJ 4NELA 5FKOA 3UKGA 3G1MA 2E2IJ 2DMQA 5J1UA 4A3JJ 1A6IA 1S7EA 5EGOB 3M3YJ 2O7OA 2Y9YA 4XICA 1HCRA 3AQSA 2O8KA 2H8RA 3A01B 1W0TA 3VW2A 2DG7A 4CYCB 3EGQA 1ITYA 3VP5A 2LLKA 1VF9A 5C4JJ 4PXIA 4M3FA 2RASA 5IYBJ 3ZQLA 2OI8A 3CWRA 1SGMA 2K40A 2CJJA 4MIMA 4D7NA 3JRHA 4JX6A 3BR0A 2QCOA 3HOXJ 1WH5A 1XC5A 3CRJA 1P7IA 3A03A 1IGNA 3LSJA 3ZQHA 2QTQA 2EZKA 2UXPA 3HKZN 1UI6A 1ENHA 3BTIA 2M8GX 3AQTA 3F1BA 4M3BA 3ANPA 1X2MA 5GPAA 4IHVA 1ETVA 2EH3A 2LTPA 3VVZA 5J3LA 4BY7J 2XB0X 3C2BA 5EYRA 5C44J 5FHPA 4BY1J 4FTHA 4MO7A 3B81A 3JRIA 4A3DJ 1FTTA 1IG7A 5FJ8J 3FIWA 1TC3C 2XGCA 3PM1A 3JSJA 3GTPJ 2JN6A 3RKQA 2VKEA 4GCTA 4Y7NJ 3OIOA 1X2NA 3MKLA 2N8GA 1VI0A 2CQQA 3ZQIA 1O4XA 4GFBA 2XGDA 3CQZJ 3HDDA 5E3MA 3WHBA 2I10A 1JGGA 2TRTA 2HOSA 2ZCXA 1B8IB 3NPIA 4UUTA 4CGRA 1MSFC 3BR2A 2NVXJ 1SANA 3HE0A 3CDLA 4DZPA 3O8GA 3P9TA 2HXOA 1IRZA 3V78A 1W0UA 2L7MP 3HTIA 3JRDA 3LSRA 5IYDJ 5FLVA 2KT0A 1WCMJ 1DU6A 3C07A 2ELKA 2M9HA 4EEFG 2OF7A 3BQZA 3TP3A 5K58A 3TP0A 1ZTRA 1H88C 3OOUA 2JJ7A 2JA7J 9ANTA 5DAJA 3HOZJ 5IP9J 2WAQN 2R5ZB 4XRSA 2GFNA 3ANGA 1NK2P 1EF4A 1GUUA 2TCTA 2FJ1A 3ON2A 2HI3A 4M3DA 3JRFA 1RKWA 1MBGA 4C3JJ 3HTHA 4YZEA 3LSGA 2DA5A 3BJBA 3S15J 3BG3A 1FIPA 3CJDA 5HODA 2QF7A 3FISA 2DA1A 1JUPA 2W48A 5HAWA 3VPRA 1U9NA 3LJLA 4FISA 2D5VA 3IV5A 5M3FJ 1ZK8A 5EG0A 3GTGJ 4AF5A 1UMQA 1JKRC 3NNRA 3MN2A
chains in the Genus database with same CATH superfamily
1PJRA 2LR8A 2CYYA 5L3BA 1LVKA 2A5YB 5C4YA 3CF5F 5F6FA 1R22A 4W1UA 2H09A 5ILVA 1ZG5A 4YRVA 3S2WA 5B1AH 2K86A 2JSPA 5DUKA 4IHXA 3FBIB 3HRUA 5E18F 1VQ7I 3HEFA 4FX4A 2DA3A 5DEQA 1P92A 3CUQA 2YU9J 1G3SA 4HF2A 2KDZA 1TWGJ 4RB1A 1IF1A 4LMYA 4OAZA 4E7IA 2G7SA 4AIDA 1RETA 5GTIC 4II3A 2K3PA 3E7QA 4RAYA 2R7QA 1QVTA 1TLHB 3GZ5A 2VOPA 2PZ9A 3DCFA 3EUAA 1J0RA 4B1RA 1NH3A 1BR1A 4ZYAA 2OJED 2Q2EA 5KVRA 3AG4H 4CSWA 1K83J 2EV5A 4RA2A 3WTUC 2XASA 2H1KA 2P81A 3HOUJ 3N05A 3IHUA 3LA7A 4HV5A 3BG5A 1SFEA 2UXNA 3PO2J 4C2MA 5FKMA 2BYVE 2IEKA 2HKOA 5K7ZA 3CLOA 3FHNA 5HLGA 2L01A 3BG7A 5JFRA 1HSJA 1MBFA 1XG1A 3FBNB 4B43A 3F21A 3H92A 2K27A 2W00A 1YS6A 4GDFA 1P6RA 4DJAA 4YIRX 1W5CC 2WAEA 4H0EA 1B72A 2NVUB 4IHSA 1QHHD 1XSDA 1F1ZA 1TWCJ 3QPLA 4GXOA 2B3WA 3F3XA 1U8BA 4UNOA 2BOLA 3I0TA 4NN1A 3BROA 2HKUA 4UVBA 1YO5C 2DMTA 4JYKA 3COAC 2NVQJ 2YX4A 2DW4A 3WG7H 4MTDA 4I76A 2R92J 2COBA 4L9NA 2FBQA 1YIJI 1FC3A 1QRYA 5FD5A 3EETA 2VJ5A 5L3GA 2OUMA 1HQCA 2F2EA 2JZYA 3OYAA 1WJBA 1MDMB 2ELJA 3ZGKA 2OA4A 4AVPA 1TWHJ 2E1NA 4QSHA 4FE4A 3OS0A 2DYSH 1NK3P 2GZWA 2ZMEA 5F27A 1PUEE 1SAXA 2HQ5A 1RESA 4ZZLA 1JTXA 4M3GA 3CO6C 2RKHA 4ENMA 3S2HJ 2ZFUA 3ULQB 5E3OA 3KYLA 2GENA 1USSA 3RH2A 3KZZA 2XAHA 4LJZF 2J5OA 3TOBA 2ZJPF 3EPZA 1ULYA 5J4VA 5JLXA 2QUFA 2RQPA 3BG6A 1ZR2A 1MBKA 2M5WA 3T8RA 2LY2A 2R7SA 4ICHA 1KQ0A 2C6YA 2WUIA 3Q9SA 1B6AA 1IV8A 1A31A 3TO6A 2HOAA 4BGDA 5LLQA 2EA2A 2QBYB 5M5YJ 4XKBA 2EFOA 4MQVA 2HZDA 2EWNA 1JI8A 1PYVA 4YELA 1XGMA 1MNDA 3F0CA 4PGHA 1IN7A 2E1CA 2GOMA 3LQRA 5FFZA 2R7TA 2Q0OA 1AKHB 4NBQA 2ZCMA 2LVSA 2W25A 3C3WA 2LF7A 2PMZN 3V8LA 3WE2A 3I71A 3H9QA 5IP7J 3HTUA 5D5XB 1OR7C 4M6YA 3BHQA 3PJRA 3JTHA 4UVAA 3CCMI 2DAOA 3DEEA 3OMYA 2RVCA 3LFUA 3J80Z 1R1UA 3VYRB 4XLCA 2W7NA 4RLQA 5H6RA 3KYDB 4NC7A 3A01A 1DUXC 2IS1A 3HZJA 3V6GA 2K9NA 2L9SA 2DJNA 4HA8A 1R71A 4BDYA 1DDNA 3BCGA 3OSFA 3MD2A 3S1QJ 1F36A 2GA1A 3FF5A 3ZQGA 1KQ9A 4M73A 3K6GA 3IRRA 3G7RA 3BY6A 3NAUA 3LNQA 4J01A 2DI3A 4IKFA 1P7JA 1PUFA 3L00A 3WTTC 2XGEA 4X1EA 2O5RA 2Z5UA 1BW6A 1LDJA 4ZZDA 1ZLKA 4E7KA 2DMUA 3AFHA 4F55A 1ETWA 2XPVA 4YFXF 2HQAA 2PMZA 2KRCA 1WKMA 1T95A 1XDUA 4EGYA 2VOOA 5CVUA 4A2UA 1UCRA 2V57A 1BI1A 1FX7A 3HBLA 1OCOH 5J1RA 1QGPA 1ZGWA 5AIPA 5ICCA 2XPWA 3WU0A 3K69A 1X3UA 3S3NA 4V2FA 4GGGA 3BRUA 4A3GJ 3HIFA 2KKOA 2MA3A 2YS9A 2H6CA 2DT5A 1ETQA 2K7LA 4UB8C 4BJTA 1J09A 4YFNF 1CGPA 3IWZA 2O6GE 2E1MB 3LHQA 3I3LA 2KJCA 2BXYA 2CQXA 4HV6A 1HW2A 3WHCA 2LP0A 2FBIA 1G4DA 3LSIA 2GXBA 3N4MA 2OV7A 1HF0A 2OQRA 4XLEA 2DLLA 2VKHA 2Z33A 5ICFA 1TTYA 3K2AA 3KP6A 3CJRB 3GLXA 4DQ2A 5CXIA 2IBDA 3VTIA 4DYRA 5IP6A 1R1TA 1SD6A 2WV0A 3PFIA 4D5CA 4E7ZA 4WK8F 1GDTA 3DXJF 4C2MJ 4UHTA 3S1MJ 1XCBA 1MJBA 1RR7A 4NC8A 1Z9CA 2DJIA 2ID3A 3MFKA 1QBJA 5DCMA 1UHWA 3DPTA 1R00A 4BEHB 2MFZA 1IZ1A 3BR6A 3H5NA 3JSPA 1UAAA 3FRQA 3FK7A 4XMYA 4WIBA 1JUSA 3BPXA 3HTSB 2KP6A 2HEOA 2ACJA 1WGXA 2HPMA 1BI2A 3QP6A 3WU1B 1YTYA 3OYHA 4BL0B 2DOEA 4IXAA 3RZDJ 4IEJA 4OU0A 1K79A 1JHFA 4KDPA 3KNWA 2HYJA 3KE2A 3ZQQA 1VQMI 3CESA 1E3HA 4E7SA 1ZGAA 3TW6A 2XF5A 3WU2C 5A2QZ 3LA3A 3PIOF 3ZN0A 1EV7A 3ASNH 5HLTA 2WY8Q 5IYCJ 4ENNA 3ONQA 2DODA 4D5FA 2E19A 3DU6A 4II2A 4AM3A 2VKDA 3F8CA 1T98A 2QOPA 2L7ZA 4HBLA 3EDPA 5HVQC 1MNEA 4XRSG 4KITB 2QLZA 1FJLA 3CMYA 2EV0A 1HKQA 2CGPA 1EH6A 4A5NA 3IKVA 1WSUA 2DFFA 3A1YA 2XF6A 2HNHA 3K7AJ 2O7TA 1BA5A 5ILUA 1ZKGA 4I6ZA 2W53A 1X58A 4S05A 1ZG3A 4IPAA 4MEXF 4BE2A 1S7OA 2QM3A 4BJ6C 1JGSA 2OD5A 2VXZA 2FSWA 3N97A 1FWZA 2K02A 1XD7A 5FKLA 1VZ0A 2FOKA 5J8FA 3RTRA 2XIGA 4RAZA 2XDNA 1MMGA 1RIOH 3BZCA 5FLXK 1ZRCA 2G7UA 4RGRA 3PUFA 3V42A 3ZQFA 5FKKA 2XSDC 2G0EA 4YIFA 1YIOA 1LKXA 2G3BA 2LH9A 2LC2A 3LL7A 3G73A 3ON4A 2QKOA 2M3AA 5L3FA 3UKGA 2E2IJ 3E0JB 5CYVA 2WBMA 1I6XA 4A3JJ 4P5OA 1S7EA 1J59A 3QU3A 2Y9YA 2VC1A 4HRIA 5D4RA 4G7ZF 3CC4I 1W0TA 4F3QA 5D8KB 5D5WB 4JBAA 5DCFA 4LK1F 4M72A 2A07F 4L18B 3PNYA 3I54A 4A0ZA 1XMXA 4BU2A 3CWRA 2Z2SB 1O7FA 3MWMA 4BHBA 3JRHA 1HW5A 3MKZA 3FXQA 1EH8A 4NC6A 4Y3OA 5AONA 3ZQ7A 2IP2A 3CRJA 3A03A 3DFGA 2VQLA 4G7HF 2RC4A 3LSJA 4BDZA 2QTQA 5DM7F 2EILH 4RMNA 1G8XA 2UXPA 4DBQA 3H3ZA 3H5RA 3BTIA 2ETHA 3F1BA 4IHVA 1OCZH 1OCRH 2EH3A 1S3JA 3W3CA 3CCLI 1OPCA 3VVZA 3OYDA 5J3LA 2R7OA 5JR3A 2MLKA 5FHPA 2E36A 4UV8A 3V4GA 3CD6I 3JRIA 4A3DJ 2OTJI 1IG7A 3FIWA 2XGCA 3JSJA 2HQNA 3M7GA 3L09A 5LFAA 2JRTA 1F5TA 1BBYA 2VJ4A 3CTAA 3CQZJ 4JQFA 5ERIA 2F4IA 5E3MA 1X3ZB 3W2AA 1DPUA 1UJ8A 5BQTA 4IOCF 2FMYA 4ZH4F 2ZJ2A 1FP1D 3NPIA 3RDIA 3BCAA 4IQ4A 1ONVA 1SANA 3IAM2 2ZY9A 4CHUA 4DZPA 3P9TA 3O8GA 4IX7A 1IRZA 4UV9A 2P0WA 3TO7A 3HTIA 4EMSA 3GVAA 1XB4A 2OBPA 2RNGA 4RB0A 1DU6A 2M9HA 1WI9A 3I59B 2DK5A 3KP7A 4KUMA 4XN3A 4RB3C 1R7JA 2OF7A 3GFLA 2D1HA 2JJ7A 2JA7J 9ANTA 4ZDPA 4F52A 1KU3A 1R49A 3HOZJ 3M9AA 2WAQN 2GFNA 1NK2P 4P1WA 3DLAA 1UHMA 2TCTA 2HS5A 1WRJA 2KRFA 3K2ZA 1IUYA 4IJAA 2R4GA 3G2BA 1RKWA 3NQOA 2XKPA 4ZC3A 1ZHFA 1SD4A 4YZEA 3A0HC 2ESHA 2QENA 3BJBA 1Q1HA 3S15J 4DVYP 3BG3A 1FIPA 1ZN2A 1GVJA 3CJDA 1HKSA 2X0LA 1XGNA 2QF7A 6PAXA 3FISA 1SFKA 2LYCA 3OWTA 5HAWA 3DTKA 2PJPA 3GZ6A 4FISA 3T1BA 2VBXA 3RPUD 4Y4RA 5EG0A 4GO1A 3VYUB 4XR6A 4AF5A 1UMQA 2HU9A 2A6HF 4U7BA 1RUNA 3AAFA 4RGSA 4Y33A 2XPUA 1ZAOA 2ECCA 4PJNA 1ETYA 1MMAA 4W97A 1LUJB 3HTAA 5K7FA 1Y56A 2NP5A 2K3FA 1ZGJA 3SYTA 1MH4A 3LSPA 1ZRFA 4JNNA 3ZR8X 3GZIA 1ETOA 2LD5A 4PUSA 4A0XA 1XS9A 4KJZA 1Y8RB 5K5QA 2QQ8A 3QBMA 4GCLA 2QQ9A 3S93A 5JHFA 3SFZA 1S7AA 1YI2I 4GFLA 2M7BA 5HDKA 4A3MJ 3HXLA 3H9GA 5LRSA 3B6CA 2EFPA 5CW8A 1T56A 3HGYA 4ABZA 2UV1A 1WI3A 2HWVA 3MZHA 4UDSA 4B4CA 1ZG1A 1W5SA 2JA8J 2GXGA 3GFIA 3HOWJ 2A69F 5JHUA 3CUQB 3RYRA 1X4OA 3KPHA 4LITA 3MVPA 1V5GA 4DYCA 1VQOI 4LLNA 3RZOJ 4PFOA 1UG0A 1HSTA 2CO5A 3E5QA 1WJAA 1JJ6C 1H8AC 3K1MA 1PP8F 1P9QC 3G4SI 3OYLA 2LG4A 1K4TA 4U87A 2EFNA 4FASD 1UI5A 3LA2A 4UUSA 2K9QA 2JUGA 1Z0XA 1KU7A 1OQYA 2MW8A 2Q2EB 2HDCA 3RPQA 1IDZA 2EPFA 1X1DA 3AL0B 4XQFA 3IWFA 3F6OA 2VKVA 5J6XA 2R7UA 2UXXA 1F4KA 4EJVA 2STTA 2ZCNA 1KQ8A 1UELB 5LEKA 3GFJA 4G94A 2WAFA 4LIVA 4N9IA 2ZJRF 3CLQA 2IRFG 1FEXA 2JMWA 2DA2A 1E2XA 4ACIA 4FETA 5GAGJ 2A6TA 3A4CA 1UHSA 3C18A 4CUGA 3I56I 1X3WB 3OYJA 3PO3J 1B9MA 2BBYA 1QU3A 5C3EJ 2VE9A 3CP2A 1BJZA 2X1CA 1MBEA 3FKIJ 1R4NB 4HX4A 2LKSA 5DV5A 1JKOC 4BUPA 2GXAA 4AD9A 3QOEA 1N77A 4QTRA 4X0GA 3CCUI 2BGCA 4LLGF 1MGTA 3ZOBA 3MKWB 4BXUA 3OYFA 2PJRA 2DA4A 2HGCA 4D1QA 3GTMJ 3F8MA 3KFWX 3J80K 3HOTA 3ECHA 4BBSJ 4WF2A 1BJAA 4L9JA 2CQKA 2R5YA 2CWEA 1MNMC 4U0WA 2P7VB 1QVUA 3K0LA 2YVEA 3CMMA 5F0CA 4LG0A 2YPRA 1JHHA 3E6DA 5HLHA 1XCVA 3NEUA 1IXCA 1OMIA 3M07A 1RI7A 1Z6TA 4P9UA 2H27A 2EJRA 2FQ4A 3DEUA 5FKNA 3IRQA 5K5RA 2HR3A 4IQJA 4M74A 2ISZA 2RREA 2FX0A 1D0XA 4RS8A 3SWHA 4A6DA 2R7WA 4G6TB 2PMHA 2XROA 1FNNA 2PX9A 5IOZA 3Q0WA 2JQ7A 4KISA 3GWZA 2Y0MA 4BQAA 2VN2A 3QPSA 3GTLJ 2PG4A 3GBGA 1XX5A 1U2WA 4E4HA 1XMKA 1Y6IA 5HDGA 2PMUA 1WZ2A 5CXGA 1Z6RA 1OJLA 2CW7A 2KZGA 1T8IA 2KJBA 3P7NA 3VB2A 1F43A 5FMPA 1T0FA 3C2GA 4A3EJ 2HXIA 1U6GA 2OERA 2AQFA 3ABUA 1FP2A 3EYYA 3S2DJ 3PUBA 3S16J 4XK4A 2M8EA 2PFVA 5CVIA 3VSKA 2NS7A 2E2JJ 4C9YA 4IO9F 3C2HA 5EJCA 4CYCA 3CJNA 1ETKA 1E3OC 1I6HJ 3P5JA 4A3FJ 4OIPF 1IW7F 4B44A 3K4MA 1W7PA 3I53A 2M34A 3R4KA 1OR7A 5LD2C 2G7HA 3CCQI 2UWMA 4AYBN 4JP0A 5E8IA 2L4MA 3E7LA 3KZIC 1JE8A 1YRNA 3BJOA 1K6YA 1QA6A 4Q4ZF 2OCCH 2RV8A 4BAYA 2TDXA 5DDGA 1LFUP 3V8JA 3GXOA 2KIUA 2Z9OA 1VNDA 2F5EA 5DD8A 5CVRA 4F7ZA 2CS3A 3H3VK 5HS8A 2VPRA 2Z3YA 5L3DA 4I0AA 1YFHA 1KYWA 4B48A 5FD6A 4FX0A 4IRGA 5D6FA 3K4BA 3I4NJ 2EZLA 4XOPA 4A3KJ 1QZYA 2V1UA 4DW6A 2IA1A 2R7VA 1TWFJ 1V5FA 1J9IA 4CCOA 5GP9A 1MSEC 2R7DA 3PNTA 1DGRM 1V54H 4BH9A 1PUFB 5LHGA 2ZXWH 5JVGF 2HYTA 4G8XA 4AYBA 2R93J 3VODA 1Z91A 3D0SA 5A2QK 2PBXA 3LWJA 4GCKA 4DZJA 2M0CA 1IXSB 3BZKA 2FJI1 3FXJA 4KT6A 3C7JA 2L9RA 2KISA 4A3CJ 1O7LA 1XDSA 4DGWB 3CCYA 3CDHA 3BTLA 2HDDA 1U5TB 3FM3A 3GX4X 2AS5F 1YHQI 3UNGC 3GTJJ 1Y39A 3GF2A 1TNSA 4XLHA 3OYMA 4A3LJ 1X1PA 2KL4A 3MNLA 2H1LA 4JX4A 2IS6A 1I3QJ 1JTYA 4Y52J 4FCYA 2K85A 1L0OC 2VB6A 3NRVA 4OMZA 3RD3A 4XKCA 4Q47A 3S1RJ 2RNJA 3WGIA 2ID6A 5D18A 1RKTA 2BVLA 3D1NI 3WG9A 4DOZA 5M5WJ 1G2HA 2O03A 3OIPA 3L1PA 3CF2A 3BJ6A 3G56A 1I39A 1K6OA 2XAUA 3SEQA 3KZ9A 5EEAA 5DS9A 1RPWA 4IOAF 1X1BA 4PJMA 1YW9A 1FSHA 3LSTA 5KK1A 1FT9A 1C0WA 3E5XA 4I01A 2GWRA 3GYHX 4XSXF 2JPCA 1IJWC 1REPC 5J1YA 3FXUA 5DCMB 1OYWA 1W5TA 2R7XA 1IDYA 3HSEA 1SFOJ 2IW5A 3NARA 3P9KA 4MFEA 1T38A 3GTOJ 1ZELA 2XUBA 4RAGA 3VOXA 1T0FC 2K9LA 1GV2A 1LFBA 1S29A 4JK1X 4I02A 5BOXA 1YX5A 4GCVA 1O3QA 3KP2A 1RR8C 3OYBA 3BDDA 2V4JC 3F23A 3DV8A 3JRAA 3VVYA 2ZJQF 2BV6A 4XN0A 2XV4S 3L2UA 4C3IJ 3TDZC 3KEOA 3GMEA 2GQQA 3VW1A 5E8GA 2OC6A 3Q3SA 5EGOA 4U9LA 3KCCA 1LE8B 2DQRA 3SZGA 5F0HA 3O6BB 3KKCA 1XGOA 1BN5A 2GIVA 2EINH 4KICA 1BL0A 3OYCA 3PPBA 5LGTA 1XN7A 3CJTB 2DMPA 1VQPI 2V9PA 3M1CA 4CA0A 2GM4A 4PGGA 2YSRA 1FBQA 2X6YA 4QWQA 3ERED 3P9CA 4KT5C 3OIQA 1KZHA 3FMQA 1DP7P 2XSJC 1O3TA 2LBFB 4HLXA 1ZR4A 3FHZA 2CMPA 3JRBA 4NELA 2A68F 4A3IJ 3M4OJ 1R1VA 3BJAA 1RZ4A 3OL4A 2DPDA 3F6VA 3FZVA 1A6IA 3V7SA 1LDKB 2M7AA 3AQSA 3LFKA 2IGOA 3WGGA 2H8RA 2VT3A 5DD4A 2E34A 3RI4A 4KMFA 1ITYA 1AA7A 2LRDA 3E1SA 2GOXB 2LLKA 5C4JJ 3H0DA 1MMNA 4PXIA 1JXSA 3FXRA 2PN6A 3DPUA 3G71I 1YW7A 2Y69H 2IXSA 4A6EA 2O3FA 5E17F 2QEXI 4JX6A 2QSHX 3BR0A 2QCOA 3HOXJ 1YE9A 1V4RA 3SXYA 1P7IA 4ESJA 2X85A 2O8XA 2X1EA 2IS2A 1K78B 1W7PD 4KA4A 2DTRA 1Z7UA 1SMTA 1TNTA 2RN7A 3K9TA 1WQ2A 1ENHA 1OCCH 2FUG2 4EGZA 1A35A 2VPLA 1UI6A 5GTHC 1ON1A 2G9WA 5GPAA 1ETVA 2L54A 4PSXA 2ZSHB 4O6JA 1A04A 2HYGD 4LB5A 3UR3C 5ILSA 4FQGA 2DU9A 5EYRA 1MDMA 3E6MA 3SHFA 4HNTA 4BY1J 2JUCA 1FTTA 4EVIA 1TC3C 2VIXA 4FT8A 5J47A 3ECOA 5E79C 3WGHA 2ESNA 3PL8A 3OIOA 2CV0A 2E60A 3MKLA 4PK4A 1D1CA 1VI0A 2RQQA 2NYXA 3ZQIA 4GFBA 1IRGA 1CF7A 1QZZA 3GO5A 2VC0A 2XGDA 1XTAA 3HDDA 5F64A 1A6QA 1GXPA 2LF8A 3WHBA 4NNJA 4N0BA 5LGUA 2HOSA 1B8IB 1J7KA 3OYIA 1R58A 3E6BA 1MSFC 3RPUA 3LAPA 1T6SA 5F1RA 3I55I 3CDLA 2WY7Q 3WTWC 2VONA 3JRDA 4EM0B 5IYDJ 1E3PA 4CCMA 5FLVA 3VYSB 2EB7A 2DDBA 1WCMJ 2JRMA 2L9NA 2DOAA 2QBYA 2DO7A 1S72I 2L5QA 4MEYF 4N9HA 4EEFG 3BQZA 3TP3A 4Y15A 2MC3A 2X51A 1VQ6I 5TRDA 1OYYA 2P8TA 1QQIA 2KIFA 3IL2A 4R79A 4CZCA 2R5ZB 5IT9Z 1EF4A 3ROUA 1GUUA 4KIBA 2OZ6A 3K70C 4M3DA 2CV1A 1MBGA 3H3UA 1D8KA 1BM9A 5EEHA 2DBBA 4EV0A 3KIOA 1O3SA 2CQNA 3HRMA 4CICA 2DA1A 2QSGX 2W48A 3GZNB 4UY8I 3VPRA 1U9NA 4E70A 2JVHA 1R5ID 1LQ1A 2D5VA 1FOWA 3K4KA 3HRSA 1ZK8A 1H9GA 3GTGJ 3I5UA 2GA2A 3S32A 2OCEA 4LLLA 3NNRA 3MN2A 4BACA 5FB2A 4XRMA 1IAWA 4EJWA 3FDYA 5B66C 4IRIA 4JX5A 1P4WA 3ZQCA 3GUDA 4ZTJA 5GAEJ 4YFKF 1LPQA 2MLGA 2FD5A 4PSWA 2XAGA 3HOSA 2E2HJ 2NP3A 3X2QH 4AC0A 1TT0A 1YJWI 1Y0UA 4MHGA 4C3HJ 3WTVC 3DLLF 1Z3YA 4AWXB 1H89C 3HPGA 2F5FA 4P55A 3L2VA 2ZNYA 2EQRA 3GW2A 4G12A 2Q8KA 3WTZA 4XNFA 4LOCA 3IUVA 4UB6C 2AHQA 4OIRF 1JKPC 5EG0B 4CH7A 2D2WA 2R7ZJ 1AHDP 1ZQ3P 2CW8A 2DT7B 1EA3A 4NQWA 5HNFA 2VBZA 2Y31A 2V26A 3LWFA 3TGNA 2CSOA 1XGSA 3BTJA 2IAIA 2LY1A 4PDKA 4BKXA 4A3BJ 1LVAA 2NS8A 3R6SA 1GT0C 2NVTJ 3QQAA 1P4AA 3ZRGA 3PSFA 3K70D 2PBIA 4PJ0C 4XOTA 1FBSA 4BQNA 2O61A 2OZUA 1STZA 1U9OA 1WFXA 3HGGA 3W6VA 2E35A 4HX8A 3BTCA 5LEJA 2HOTA 1MIJA 4XSZF 4D9JA 1HDDC 1ZLJA 4L9VA 3WE3A 3S5RA 2Y0SN 1UZCA 2YUSA 3HL2A 3VFZA 2UXIA 2VL8A 5LHHA 1X19A 2L9VA 2ZXHA 1D5YA 3QPHA 3EUHC 5BPIA 2OAZA 3RJPA 3CCSI 1V3FA 1AU7A 3BT9A 1S6LA 1DQUA 4HF0A 3PASA 1D3YA 2EFQA 5FLMJ 2HVRA 4O5VA 4XKWA 1U3EM 1RRJA 2RDPA 1O57A 2B0LA 2P5VA 2V1NA 1OKRA 2XGXA 3W6JB 3U2RA 3J7ZI 4MXMA 4KN4X 4B47A 2X9DA 3A02A 1Z67A 4LFUA 3E5UA 1OCPA 4BE1A 3KEQA 2G7LA 4AU7A 3B6AA 3BG9A 4UUSB 5H9TA 1NG7A 1W36C 2Y0SA 3M1EA 4ESBA 4Q5SF 2FA5A 4GFKA 5KHDA 3S17J 2EK5A 2YR2A 2VQHA 4E7HA 5D1RA 2QKMB 1MD0A 2QWWA 2ZB9A 3FMSA 4B3AA 1FTZA 4QIWN 4L9TA 3DBRB 3ZCOA 1U0JA 3TW7A 1SVMA 2LY9A 2ELHA 4DNCA 2RHAA 3OV8A 5KCMA 2DCEA 2FRHA 5HLIA 1SVOA 3SQNA 3ZN1A 4KWAA 4CCNA 3VVXA 1HDPA 4WCGA 4OIQF 2IU5A 5HDNA 2VI6A 2DT6A 4R1HA 3Q5FA 2OQGA 3FXOA 3ZMSA 1Z1DA 2L02A 2LREA 5H20A 3AG3H 2X1DA 3WTYC 2O9LA 4XLNF 1J5YA 3HYIA 4XM3A 4WXDA 2HTJA 2B9SA 3V8KA 1POGA 3DTIA 5LGNA 1LJ9A 3BZ6A 1JUMA 2FBHA 4KFCA 3SFIA 2PJRB 3HUGA 2HFHA 4M71A 4B09A 1WJCA 4GYIA 4F92B 3ASOH 2R5YB 4ENJA 1I1SA 1ZARA 3JCUC 4O3MA 3DEWA 3HIMA 1SFUA 2AQEA 1Z77A 4N4NB 3L7WA 2M87A 3OYNA 2L4AA 1PP7U 1BI3A 1VQLI 5GPCA 1G59A 1BR4A 3K4NA 4XIDA 2NXNB 1ACIA 1Y1WJ 1W36D 4I7HA 1QZEA 4C2UA 2L7KA 4DIQA 1E17A 4OINF 2UXUA 1R5GA 3OS1A 2W24A 2VASA 5FGLA 3K4JA 4CDGA 2XC7A 2KRHA 3HM5A 5BPDA 4A69C 2MSYA 3B73A 3EQLF 2E1MC 2QSFX 2P5LC 3GLLA 1YX3A 4ON0A 2KQRA 2IVMA 1IRFA 4NDLA 4BHPA 5L3CA 4KMUX 4GRIA 3GTQJ 2Y9ZA 3KKDA 5D6EA 4A0YA 2YU3A 3W6KB 4S0HB 3NI7A 3FXLA 4CCLA 1KGSA 1WHUA 3U9GA 4G6QA 4BJ5C 3SZPA 4HAMA 1N78A 2LOOA 3TO9A 3OYGA 3L2QA 2BW3A 2PLYA 2DN0A 3NXCA 1KU9A 1YQAA 4HLYA 1V5EA 2XVCA 2YVHA 1VQNI 4FHTA 2A3SA 2BEOA 2WADA 4M9XA 1BW5A 1UG2A 2W84A 3L9FA 2REKA 2HYFA 4CCJA 4J19A 4QPOA 5CQEA 1MZBA 3NWTA 4XLPF 1ORKA 2EZHA 1PDNC 2MBFA 2DFHA 3WODF 1YRNB 2FEZA 1DU0A 1HOMA 4HX7A 1GVDA 2P6TA 1K4SA 1YYVA 3BC8A 3LQQA 3CC2I 2Y30A 4AUXA 4BQQA 3QYEA 5HSZA 5BMZA 2DFEA 3R0JA 3E3VA 2X6XA 1IXRC 2XRNA 1W1WE 2V1DA 1I50J 2KPMA 2E1OA 2XAQA 3JSOA 2W4SA 2NVYJ 2XB5A 4HG2A 2NOJB 3REOA 1FOKA 1Y8QB 3D5SC 3MQ0A 2LFBA 1KA8A 4X6AJ 3NRGA 5D19A 4CGZA 2VJIA 1DGWY 1BOBA 1B72B 2F07A 2BXZA 2G7GA 4ZDOA 2XDVA 1K61A 4ANJA 4C2TA 2JA6J 2GBYA 2M4KA 5BS6A 4XRFA 4RBOA 5DM6F 4J00A 3O2PE 5F0FA 3HTJA 4XKVA 3RQ4A 2NRAC 1XMAA 1IO2A 5EZHA 4OMYA 1BC8C 3L2WA 3M8EA 1TQIA 2VE8A 4LB6B 5LBQA 3QP5A 5J40A 3R60A 3IH2A 4HOBA 3GEUA 4BS9A 2CU7A 2OTLI 2RAEA 2VQCA 3QRFF 1V55H 3HSFA 2MG4A 1ETXA 2LSOA 3DKXA 2JWTA 1LB2A 2FU4A 3CJQB 4HW0A 5GAHJ 3QWLA 4ZJZA 2ZMEB 1OFCX 3OSGA 3HOYJ 3KP4A 1DPRA 5HBUA 4PCQA 2H94A 2K4JA 1IN4A 3Q0VA 4E6KG 3H5AA 5LRRA 3TBIA 3HC7A 1JT6A 4PZJA 2XAFA 4IZZA 2VXDA 2ZXJA 2QZ8A 4BXFA 4D7MA 3AKZA 1N75A 2FE3A 4F91B 5JLWA 4I98B 1WPKA 4U9NA 4E7JA 2F6CA 1LEAA 5F1JA 3KP5A 1XSXA 5EDNA 1KONA 1MBHA 2NNNA 4XLFA 2XKOA 2ME0A 4M9ZA 2ECBA 3W2WA 2AO9A 2BY2A 5DYMA 4M9SA 2AXLA 3U21A 1FYLA 4U7DA 5ED4A 3VYTB 4YEJA 3BR5A 1T2KA 1LDDA 4ZDLA 1MMDA 5CLSA 1TW2A 5KAFC 2ZSIB 3GCMA 2P6SA 5E3LA 3BR1A 5H2FC 1FLIA 1BIAA 3M8JA 1ERDA 5FKOA 1AOYA 2HVSA 3G1MA 2WWYA 2DMQA 1FMVA 4CO8A 5EGOB 4KIFA 3RKWA 2O7OA 1HCRA 4XICA 1LNWA 1HW1A 3MZYA 4BQOA 1RUOA 2O8KA 3A01B 2PFBA 3VP5A 3VEPA 4M3FA 2RASA 4RM2A 4R8HA 3CCRI 2W57A 3F22A 2CJJA 2JT1A 4MIMA 4D7NA 5FROA 3CUOA 3MKYB 1YS7A 3V7RA 4LGWA 1D0ZA 1XC5A 2ZBKA 3RCOA 4MGRA 2IA0A 2JVGA 2ZC2A 5HS7A 1KU2A 1YJNI 1IGNA 1WJEA 2BHZA 4G9YA 2EZKA 2QGUA 3HKZN 4K2EA 4G6DA 2HKXA 2M8GX 4RGUA 3AQTA 4M3BA 2V7FA 2CH0A 3MZ8A 5KNLA 5IT9K 2LTPA 2QQBA 3SZTA 5C44J 2V6CA 3A0BC 3FWEA 4MO7A 2V6EA 2BE5F 3B81A 2W1OA 3HRTA 1J75A 2VLAA 4LIUA 3HPHA 3F8BA 3GFMA 4ZYDA 1S5LC 2BY1A 3PM1A 3WTXC 3GTPJ 3RKQA 2VKEA 4ZYEA 3QYFA 4PJLA 5HOOA 2BVMA 4OIOF 3HSRA 5D5VB 4EM1A 1HXDA 4YIIA 1GHCA 2I10A 2F5CA 3B02A 1JGGA 2TRTA 2EIMH 3HKZA 4CGRA 1MJAA 3LMMA 3R61A 3HE0A 3JAMZ 1VQ4I 3V78A 4AIKA 2D45A 2K4BA 3RKYA 2WA0A 3CCJI 3MAJA 2M30A 3C07A 2ELKA 2I5UA 3T0YA 5GADJ 3PFYA 5K58A 4B8XA 4GYGA 1ZTRA 1H88C 3OOUA 1A36A 1CF7B 3CO7C 1SEUA 3H1CA 3ESWB 1S8NA 3ANGA 3J81Z 5FGMA 2H8WA 2FJ1A 3ON2A 2FNPA 4P96A 3KZYA 3IC7A 2H6BA 3NWSA 3TMOA 1XSVA 1W4MA 1WVRA 2L2OA 1X4PA 2DA5A 3KEYA 5TJJA 1NG6A 3E97A 4EM2A 2L3DA 2WTEA 4OD4A 1TZLA 4HQMA 1FYKA 2EFWA 2IS4A 1FYMA 1J2XA 1JUPA 2DPUA 4M6XA 2YX7A 1FBUA 2Z1DA 1MW7A 5M3FJ 2Z99A 1Z3XA 5E1WA 3ZPLA 4ZTFA 4V19K 3MMYB 1JKRC 3CUQC 2QVOA 2LMDA 2DQLA 4S04A 1WH7A 4HNVA 1QPIA 2UUZA 1K7AA 2V9KA 1R36A 1X1AA 2R7FA 3AG2H 4L5JA 4HSTA 1USTA 3W2VA 2UXOA 3QOPA 4AIJA 2V1XA 4Q48A 5EF6A 3IUOA 5J8CA 1MJ9A 3LSKA 3SJMA 4JL3A 5K7HA 2QWTA 3AL0C 1B4AA 2ZOYA 2LK2A 1B9NA 1FSEA 2BY3A 5FFXA 1CQTA 4HDVA 1DP3A 2KFDA 3TL4X 4F93B 4ZYHA 1R6RA 3JTGA 4U0VA 3VDXA 3IKTA 4MK6A 1IRXA 2JTVA 1R5HA 2AXTC 2JK3A 2QQAA 2B63J 1HKTA 4ME9A 4HDUA 1FIAA 1BIBA 2VBWA 3ERMA 1A5JA 5E1ZB 4XBFA 3F72A 5M3MJ 3DKYA 4MNUA 2ZFWA 3ZP5A 4IVNA 1D1AA 3ML6A 2CG4A 4XORA 3RKXA 3VIBA 1H9TA 2FBKA 4A93J 2CUFA 4HSRA 1MMSA 1R9TJ 3KYCB 4BNCA 3QODA 2RGVA 3G1LA 1IV6A 4V2GA 2Q24A 1H0MA 5IPAA 1NTCA 5IY5H 4NQWB 1WJ5A 1U5TA 2VT2A 3ISPA 4BBRJ 3FK6A 4LK0F 5F04A 2Z16A 3TOAA 5DTDA 4ASNA 5CJ9A 2ICWG 3NS4A 2MH9A 3HHHA 2W85A 3OR2C 2K5CA 2JSCA 1LFPA 3JW4A 3DTEA 2QYOA 2QIBA 4Y13A 1U78A 2D6YA 2VQGA 4I0BA 4EATA 5K5OA 1TBXA 1P4XA 1FY7A 2A2FX 3T6NA 5HS9A 3ZXSA 2QA4I 2FNAA 2EIKH 3HOVJ 2F4MB 2ZMEC 3EUHA 5HNHA 2KDOA 3JREA 3HHGA 3VW0A 2XAJA 4L5EA 1QO0D 3H36A 1P2FA 5CKTA 1GV5A 2HZTA 5L3EA 3BP8A 2STWA 1EH7A 4KIGA 1JKQC 1TL8A 3FX3A 5B3SH 1HLVA 1LEBA 2Q1ZB 3C1DA 5F08A 2IPQX 5E1XA 3RSNA 2WV1A 5E20A 2IGNA 1AWCA 2F4OB 3CDIA 1YJ9I 3MEXA 4B3XA 1SFXA 3BNIA 2X6WA 3U1KA 2Y2ZA 1B59A 1TQPA 4HPQA 1BC7C 2D1VA 3OYEA 1JJ8C 2WB1N 3AG1H 4L5IA 3IAS2 3VUQA 2XHKA 4JOMA 2F5VA 5D8LB 4Y17A 3IH4A 3VOEA 1AKHA 1APLC 1IN8A 4U0YA 2EBIA 5JVTA 3OY9A 2BHYA 1QPMA 3Q0UA 4AC6A 2HOEA 5CQGA 4HYEA 2PI0A 4MLOA 4MFDA 3RQIA 3K8PC 3ZMZA 3I64A 3FKJA 1Y1VJ 1L3LA 3T8TA 2NAZA 3DP7A 5KAIC 1LE8A 3O3KA 2E7WA 4WXHA 3L2CA 3H35A 2ZCWA 3L2RA 4Z2YA 5CVVA 4M6VA 5TISC 2WB1A 4XLAA 4UUVA 2GLOA 1N25A 4HKUA 2NOGA 2NS0A 3CZ6A 1GLNA 2LBFA 4QLCU 2DXIA 2CUEA 4QPQA 4WWCA 2ZXIA 3K10A 2V9VA 5AQCA 3FM5A 1U8RA 1F9NA 1S9HA 2JA2A 3S3MA 3TEDA 2VUMJ 2EV6A 1TWAJ 2DMNA 2JPBA 4P9FA 5DUIA 3HUGB 1IN6A 4NHJA 4YG2F 3I4MJ 3DKWA 4WX9A 2KMUA 5E3NA 1M1EB 1TQMA 2X6OA 3H0GJ 4MTEA 1I27A 2NX4A 3LSMA 1T33A 3S3OA 3VOKA 4KN7X 1IC8A 4H4KC 2M2EA 2MH2A 3JR9A 2MD5A 1UFMA 1PVEA 2FMLA 2X48A 3OS2A 4L0YB 5C4XJ 1BR2A 1GXQA 1U5TC 3S8PA 4DYQA 2ZO4A 4I2OA 4TV7A 5IOYA 4HEA2 1K78A 3ZMVA 1D5VA 3QKXA 3ABMH 2CUJA 1QHGA 3DF8A 1XPXA 2YVXA 2JA5J 1ZREA 3ABTA 2HDWA 3KLOA 1QNTA 2DK8A 2WC2A 5J4YA 2FQ3A 4BYYA 5ICEA 5D4SA 2V79A 3BCBA 1ON2A 3ZMDA 2DA6A 4IHWA 4L62A 2ISYA 2ME6A 4NUBA 2LKXA 1FZPB 3GEZA 1G3YA 4XL9A 2O0YA 4ENKA 3KP3A 4M3EA 2EIJH 2PQ8A 4C30A 3K4LA 1OISA 2EA4A 2COMA 2CV2A 2KZVA 3RIRA 3KETA 4RDUA 2F5DA 3OR1C 4BEHA 3IH3A 2W82A 5EZGA 3G6EI 1X1CA 3TKYA 3CCVI 4CXFA 1Z21A 2J5PA 2BW3B 3S1NJ 3CC7I 3Q9VA 2M4GA 5B5EC 1D8JA 1TP4A 5CPRB 3KX2A 1B8IA 3GTKJ 2ZOZA 1R4MB 3COLA 4CYDA 1B1BA 3BR3A 2DG8A 3IP4B 3EYIA 2EZIA 3G1OA 2K9SA 2L0KA 4AVZA 4ETSA 3HG9A 2Y48A 3OOPA 3LOCA 4ZYGA 1FOYA 3HB9A 2P7CB 5AIQA 2K9MA 3EUPA 2DFIA 2R0QC 3VSLA 3ABKH 5H6QA 1VQ8I 1Y0NA 4HNUA 3E6CC 2ADUA 3I9V2 3BWGA 5CVJA 2UZKA 2R5ZA 1FPQA 3T5XA 1OCTC 4IHYA 3SDGA 4E7LA 1ODDA 3LSHA 3O60A 3U1DA 1SVLA 4UXNA 4LG3A 3F8FA 3OYKA 3PNVA 4NB5A 4BHCA 4KNYA 5BNGA 1T08B 1I3AA 3FMRA 2CUZA 1D0YA 2XRLA 1IUFA 3K4CA 3BQYA 2A05A 2CFXA 3O8HA 1MH3A 4FE7A 1SMYF 2OU2A 4HQEA 4BE0A 1VFCA 2CRGA 4A12A 1I1GA 2E5NA 1ZH5A 2KIQA 3CCEI 4IL6C 1JT0A 4JKZA 3J7AY 2GUHA 3M8FA 2KIMA 3SDBA 2GIZA 4LG0B 3DWLE 2DTZA 1G6NA 2M0MA 2FOWA 2MC4A 3EUKL 1MBJA 2HTSA 4RM3A 4AIHA 3CMEI 4IRHA 4U88A 2DA7A 3F8NA 5TGTA 3BPVA 3PIPF 3J7YJ 1TT5B 2WGBA 2CW0F 4RLFA 3JRCA 2IJLA 2UXHA 1YOVB 2MYSA 4MQ9F 1ZYRF 1R23A 5EEGA 2L7FP 3VWBA 1VQ5I 3J7AO 3QPTA 1BOAA 1Q1VA 2P4WA 3V7CA 5M5XJ 3S14J 5EFYA 1RC9A 2CQ7A 2WAQA 2OPTA 2A6EF 4RGXA 2GAUA 5K1YA 1KYZA 3PQKA 3JRGA 3DPJA 3FXMA 4HZFA 3ZMTA 1SAUA 4BXXJ 2X4HA 3D5RC 3H9JA 2NNYA 2MGQA 2DDAA 2ZNZA 4PJJA 4EJTA 2DOFA 3F9KA 5J1UA 1EKEA 2LDUA 2E5ZA 3M3YJ 1MKMA 1Z7LA 4Z6YA 4I09A 4OWRB 1EJ9A 4ITVA 1VQ9I 4D0PA 2IA2A 3VW2A 1SD5A 2F48A 1G3TA 2DG7A 4CYCB 3QAHA 3EGQA 1G3WA 1WWXA 3ELKA 3KLNA 1VF9A 1TW3A 5B1BH 2FXAA 5FRMA 5IYBJ 1W7PB 3ZQLA 4DBRA 2OI8A 2A5WA 1SGMA 3D5LA 5FRNA 2DYRH 2K40A 4IHTA 2I8DA 3HJEA 2KLOA 3JAMK 3OL3A 2IT0A 1FMWA 2HQRA 3ABLH 1WH5A 4EJOA 1SD7A 3QU6A 2LNBA 2VJJA 3TDUC 5D5UB 3ZQHA 4UVCA 4I99C 3R0AA 1WJDA 1ZRDA 3I4PA 3DQVC 3DBHB 5FLXZ 2VBYA 2P5KA 3ANPA 1X2MA 1VQKI 2IGMA 3J81K 1VTNC 2R7RA 4BY7J 4G7OF 2XB0X 3PQJA 3C2BA 4RB2C 4KYWA 3I58A 4N4OB 1UB9A 4FTHA 5FO5A 3K1PA 3P9IA 3LAJA 4OAYA 4XONA 5FJ8J 4IF4A 4LD5A 3RYPA 3CP8A 2JN6A 3I59A 4GCTA 4Y7NJ 1D1BA 1E0EA 1X2NA 3G3ZA 2N8GA 2CQQA 2B7EA 1O4XA 5LHIA 1O3RA 1HBXG 2E7XA 5JI6A 3ZMUA 2VODA 4WXCA 2ZCXA 2A61A 4UUTA 3BR2A 4EJUA 2NVXJ 2E71A 1RNLA 2R3SA 2M45A 2HXOA 4RAFA 2IGKA 1W0UA 2L7MP 3LSRA 1YG2A 1I5ZA 2KT0A 1OLTA 1YITI 4A5MA 4L0ZB 4IRVA 1BI0A 2CFOA 1WJFA 3TP0A 3WTSC 2FF4A 4CZZA 2ZKZA 5DAJA 3BOQA 2BZTA 2LKPA 5IP9J 2XF7A 4XRSA 3DBLB 3CMAI 2M1BA 2B1EA 1YLFA 4OD5A 3K1NA 1NHAA 2HVQA 2QKLB 2HI3A 4HF1A 3JRFA 3BLYA 4PFPA 3TQNA 1T39A 2HPIA 4C3JJ 3HTHA 3DPLC 1IN5A 3LSGA 1FOXA 3QYBA 3SEZA 1Z05A 2KHMA 5IT3A 1OYIA 5HODA 4EQQA 3A2KA 1HA8A 2Y75A 3LJLA 2MABA 1SC7A 5ICGA 2PEXA 4OOIA 1YW8A 3FXKA 2MD0A 4CCKA 2BY0A 3IV5A 3PSIA 4ESFA 3DU5A 3MCZA 1HC8A
chains in the Genus database with same CATH topology
2LR8A 2XPUA 4XRMA 2ECCA 1WH7A 4HNVA 1ETYA 4W97A 1QPIA 5C4YA 4JX5A 3ZQCA 4W1UA 3HTAA 5K7FA 2NP5A 1MH4A 2UXOA 3LSPA 2FD5A 2E2HJ 4IHXA 2NP3A 4AC0A 4JNNA 4C3HJ 5EF6A 1ETOA 3HEFA 3GZIA 2LD5A 1H89C 4JL3A 3SJMA 2DA3A 5K7HA 2EQRA 2YU9J 4G12A 1XS9A 2KDZA 1TWGJ 4LOCA 2QWTA 3IUVA 2AHQA 3QBMA 1JKPC 5EG0B 2G7SA 2ZOYA 4GCLA 1RETA 2LK2A 2R7ZJ 1CQTA 3E7QA 1AHDP 1ZQ3P 4GFLA 4A3MJ 1QVTA 2PZ9A 2Y31A 3B6CA 3DCFA 5CW8A 1T56A 3HGYA 3BTJA 4ABZA 4B1RA 4MK6A 2IAIA 4BKXA 1WI3A 2JK3A 2B63J 4A3BJ 2NS8A 4ME9A 2NVTJ 1GT0C 4UDSA 1FIAA 1K83J 3QQAA 1A5JA 4B4CA 2H1KA 2JA8J 2P81A 5M3MJ 3HOUJ 3HOWJ 3BG5A 3VIBA 1U9OA 4A93J 3PO2J 2CUFA 5FKMA 3MVPA 4DYCA 3HGGA 3W6VA 1R9TJ 3RZOJ 3BTCA 2HOTA 2IEKA 1JJ6C 5K7ZA 1H8AC 1HDDC 3G1LA 1IV6A 4V2GA 2Q24A 5IPAA 1NTCA 3S5RA 2Y0SN 4BBRJ 2YUSA 3FK6A 1MBFA 1XG1A 5F04A 2UXIA 1UI5A 4UUSA 5DTDA 2K9QA 1Z0XA 2MW8A 1D5YA 1B72A 1TWCJ 1AU7A 1IDZA 3QPLA 3BT9A 3PASA 1U8BA 2VKVA 2QIBA 5FLMJ 1U78A 2D6YA 4NN1A 2ZCNA 2HKUA 2DMTA 4JYKA 2NVQJ 3T6NA 4MXMA 4I76A 3HOVJ 2X9DA 3A02A 2R92J 2COBA 1FEXA 2JMWA 2DA2A 4ACIA 3JREA 3VW0A 2FBQA 1UHSA 1OCPA 1QRYA 4L5EA 2G7LA 3PO3J 3B6AA 3BG9A 4UUSB 5H9TA 1GV5A 5C3EJ 1BJZA 3FKIJ 1MBEA 1JKQC 1JKOC 1TWHJ 4QSHA 1HLVA 4GFKA 4QTRA 3S17J 5F08A 4FE4A 2WV1A 3ZOBA 5D1RA 1NK3P 3BNIA 2ZB9A 5F27A 4B3AA 1FTZA 4QIWN 2Y2ZA 2DA4A 2HQ5A 1RESA 3GTMJ 1JTXA 4M3GA 3TW7A 3S2HJ 2LY9A 4BBSJ 2RHAA 1JJ8C 5E3OA 2GENA 2WB1N 2R5YA 1MNMC 3RH2A 1QVUA 4KWAA 2YVEA 3VVXA 3VUQA 1HDPA 2IU5A 5F0CA 2VI6A 5JLXA 1ZR2A 3IH4A 1MBKA 1AKHA 1APLC 2EBIA 2O9LA 3Q0UA 4ICHA 2FQ4A 4AC6A 2WUIA 4MLOA 4MFDA 3RQIA 1POGA 5FKNA 2HOAA 1Y1VJ 1JUMA 3SFIA 5M5YJ 1LE8A 2FX0A 2R5YB 3F0CA 5IOZA 3DEWA 3Q0WA 3HIMA 1Z77A 4M6VA 3QPSA 3GTLJ 3GBGA 1AKHB 2ZCMA 2LVSA 2GLOA 5GPCA 2PMZN 4HKUA 2NOGA 1OJLA 5CXGA 5IP7J 2CUEA 4XIDA 3BHQA 5AQCA 5FMPA 1F43A 1Y1WJ 2UXUA 2VUMJ 4A3EJ 3TEDA 2HXIA 2OERA 1TWAJ 2DMNA 3S2DJ 3S16J 4XK4A 2NS7A 3I4MJ 2E2JJ 3A01A 5FGLA 4CYCA 1ETKA 5E3NA 3V6GA 2K9NA 3HM5A 1E3OC 1I6HJ 4A69C 2MSYA 2DJNA 4A3FJ 2X6OA 3H0GJ 3BCGA 2NX4A 2M34A 3OSFA 1T33A 3S1QJ 3VOKA 4AYBN 1F36A 3ZQGA 1IC8A 4JP0A 3G7RA 3E7LA 2M2EA 4NDLA 3JR9A 1YRNA 3NAUA 2X48A 3LNQA 1P7JA 1PUFA 3GTQJ 5C4XJ 2Y9ZA 3KKDA 2XGEA 4X1EA 4DYQA 1BW6A 4S0HB 3NI7A 1LFUP 2DMUA 5IOYA 1ETWA 2XPVA 3QKXA 1VNDA 3H3VK 2JA5J 2VPRA 2DN0A 3NXCA 2V57A 5J1RA 3HBLA 2YVHA 3I4NJ 2EZLA 1ZGWA 4A3KJ 1BW5A 1UG2A 2DA6A 4DW6A 4IHWA 4L62A 2REKA 2XPWA 4J19A 1TWFJ 2ME6A 5GP9A 2LKXA 1MSEC 1ORKA 2EZHA 4V2FA 1YRNB 3BRUA 4A3GJ 1DU0A 1HOMA 1PUFB 1GVDA 4M3EA 2YS9A 2HYTA 2R93J 1ETQA 4RDUA 2Y30A 4AUXA 2PBXA 3LWJA 4GCKA 3IH3A 4DZJA 2M0CA 5HSZA 5EZGA 3LHQA 2CQXA 3WHCA 3S1NJ 2L9RA 2LP0A 1I50J 2E1OA 4A3CJ 2XB5A 2NVYJ 1HF0A 3CCYA 1B8IA 3BTLA 3GTKJ 2ZOZA 2LFBA 3K2AA 2HDDA 5CXIA 3COLA 4X6AJ 3NRGA 5D19A 2IBDA 3BR3A 3GTJJ 4DYRA 5IP6A 2DG8A 4D5CA 2EZIA 3G1OA 2K9SA 1GDTA 2L0KA 4C2MJ 4A3LJ 1B72B 2F07A 3S1MJ 1RR7A 2G7GA 3MNLA 3LOCA 4JX4A 2ID3A 1I3QJ 1JTYA 3HB9A 4Y52J 4FCYA 3EUPA 1K61A 2R0QC 2JA6J 2GBYA 3RD3A 4RBOA 3BR6A 3S1RJ 2ID6A 3FRQA 5D18A 1RKTA 3FK7A 3D1NI 5F0FA 3HTJA 5M5WJ 1G2HA 2R5ZA 1JUSA 3L1PA 1WGXA 5EZHA 1OCTC 3G56A 4IHYA 3SDGA 3RZDJ 3KZ9A 5EEAA 5DS9A 1RPWA 4IEJA 3GEUA 3O60A 3IH2A 2CU7A 3KNWA 2HYJA 5BNGA 2RAEA 1IJWC 3TW6A 2MG4A 5J1YA 1ETXA 2XRLA 2JWTA 5IYCJ 1IUFA 1IDYA 3BQYA 1SFOJ 3O8HA 3OSGA 1OFCX 4D5FA 1MH3A 2E19A 4FE7A 3HOYJ 3NARA 4MFEA 3GTOJ 2L7ZA 2QOPA 3VOXA 1VFCA 4XRSG 1GV2A 2CRGA 3Q0VA 1LFBA 1JT0A 4JKZA 1JT6A 1FJLA 3CMYA 2GUHA 2DTZA 4D7MA 3K7AJ 2O7TA 1BA5A 5JLWA 1MBJA 1ZKGA 3JRAA 4I6ZA 1WPKA 3VVYA 2W53A 1X58A 5F1JA 4C3IJ 2DA7A 5EDNA 1MBHA 2WGBA 3VW1A 3Q3SA 5EGOA 2ME0A 5FKLA 3JRCA 1LE8B 2UXHA 2ECBA 2AO9A 5F0HA 3KKCA 2XDNA 3PPBA 1BL0A 2L7FP 1Q1VA 3S14J 5EFYA 5M5XJ 2DMPA 3ZQFA 5FKKA 5HBUA 3BR5A 2OPTA 2XSDC 3JRGA 2GM4A 3DPJA 2G0EA 5E3LA 3BR1A 2G3BA 4BXXJ 3ON4A 1ZR4A 2MGQA 3JRBA 2QKOA 4A3IJ 3M4OJ 4NELA 5FKOA 3UKGA 3G1MA 2E2IJ 2DMQA 5J1UA 4A3JJ 1A6IA 1S7EA 5EGOB 3M3YJ 2O7OA 2Y9YA 4XICA 1HCRA 3AQSA 2O8KA 2H8RA 3A01B 1W0TA 3VW2A 2DG7A 4CYCB 3EGQA 1ITYA 3VP5A 2LLKA 1VF9A 5C4JJ 4PXIA 4M3FA 2RASA 5IYBJ 3ZQLA 2OI8A 3CWRA 1SGMA 2K40A 2CJJA 4MIMA 4D7NA 3JRHA 4JX6A 3BR0A 2QCOA 3HOXJ 1WH5A 1XC5A 3CRJA 1P7IA 3A03A 1IGNA 3LSJA 3ZQHA 2QTQA 2EZKA 2UXPA 3HKZN 1UI6A 1ENHA 3BTIA 2M8GX 3AQTA 3F1BA 4M3BA 3ANPA 1X2MA 5GPAA 4IHVA 1ETVA 2EH3A 2LTPA 3VVZA 5J3LA 4BY7J 2XB0X 3C2BA 5EYRA 5C44J 5FHPA 4BY1J 4FTHA 4MO7A 3B81A 3JRIA 4A3DJ 1FTTA 1IG7A 5FJ8J 3FIWA 1TC3C 2XGCA 3PM1A 3JSJA 3GTPJ 2JN6A 3RKQA 2VKEA 4GCTA 4Y7NJ 3OIOA 1X2NA 3MKLA 2N8GA 1VI0A 2CQQA 3ZQIA 1O4XA 4GFBA 2XGDA 3CQZJ 3HDDA 5E3MA 3WHBA 2I10A 1JGGA 2TRTA 2HOSA 2ZCXA 1B8IB 3NPIA 4UUTA 4CGRA 1MSFC 3BR2A 2NVXJ 1SANA 3HE0A 3CDLA 4DZPA 3O8GA 3P9TA 2HXOA 1IRZA 3V78A 1W0UA 2L7MP 3HTIA 3JRDA 3LSRA 5IYDJ 5FLVA 2KT0A 1WCMJ 1DU6A 3C07A 2ELKA 2M9HA 4EEFG 2OF7A 3BQZA 3TP3A 5K58A 3TP0A 1ZTRA 1H88C 3OOUA 2JJ7A 2JA7J 9ANTA 5DAJA 3HOZJ 5IP9J 2WAQN 2R5ZB 4XRSA 2GFNA 3ANGA 1NK2P 1EF4A 1GUUA 2TCTA 2FJ1A 3ON2A 2HI3A 4M3DA 3JRFA 1RKWA 1MBGA 4C3JJ 3HTHA 4YZEA 3LSGA 2DA5A 3BJBA 3S15J 3BG3A 1FIPA 3CJDA 5HODA 2QF7A 3FISA 2DA1A 1JUPA 2W48A 5HAWA 3VPRA 1U9NA 3LJLA 4FISA 2D5VA 3IV5A 5M3FJ 1ZK8A 5EG0A 3GTGJ 4AF5A 1UMQA 1JKRC 3NNRA 3MN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LR8 A;  2XPU A;  4XRM A;  2ECC A;  1WH7 A;  4HNV A;  1ETY A;  4W97 A;  1QPI A;  5C4Y A;  4JX5 A;  3ZQC A;  4W1U A;  3HTA A;  5K7F A;  2NP5 A;  1MH4 A;  2UXO A;  3LSP A;  2FD5 A;  2E2H J;  4IHX A;  2NP3 A;  4AC0 A;  4JNN A;  4C3H J;  5EF6 A;  1ETO A;  3HEF A;  3GZI A;  2LD5 A;  1H89 C;  4JL3 A;  3SJM A;  2DA3 A;  5K7H A;  2EQR A;  2YU9 J;  4G12 A;  1XS9 A;  2KDZ A;  1TWG J;  4LOC A;  2QWT A;  3IUV A;  2AHQ A;  3QBM A;  1JKP C;  5EG0 B;  2G7S A;  2ZOY A;  4GCL A;  1RET A;  2LK2 A;  2R7Z J;  1CQT A;  3E7Q A;  1AHD P;  1ZQ3 P;  4GFL A;  4A3M J;  1QVT A;  2PZ9 A;  2Y31 A;  3B6C A;  3DCF A;  5CW8 A;  1T56 A;  3HGY A;  3BTJ A;  4ABZ A;  4B1R A;  4MK6 A;  2IAI A;  4BKX A;  1WI3 A;  2JK3 A;  2B63 J;  4A3B J;  2NS8 A;  4ME9 A;  2NVT J;  1GT0 C;  4UDS A;  1FIA A;  1K83 J;  3QQA A;  1A5J A;  4B4C A;  2H1K A;  2JA8 J;  2P81 A;  5M3M J;  3HOU J;  3HOW J;  3BG5 A;  3VIB A;  1U9O A;  4A93 J;  3PO2 J;  2CUF A;  5FKM A;  3MVP A;  4DYC A;  3HGG A;  3W6V A;  1R9T J;  3RZO J;  3BTC A;  2HOT A;  2IEK A;  1JJ6 C;  5K7Z A;  1H8A C;  1HDD C;  3G1L A;  1IV6 A;  4V2G A;  2Q24 A;  5IPA A;  1NTC A;  3S5R A;  2Y0S N;  4BBR J;  2YUS A;  3FK6 A;  1MBF A;  1XG1 A;  5F04 A;  2UXI A;  1UI5 A;  4UUS A;  5DTD A;  2K9Q A;  1Z0X A;  2MW8 A;  1D5Y A;  1B72 A;  1TWC J;  1AU7 A;  1IDZ A;  3QPL A;  3BT9 A;  3PAS A;  1U8B A;  2VKV A;  2QIB A;  5FLM J;  1U78 A;  2D6Y A;  4NN1 A;  2ZCN A;  2HKU A;  2DMT A;  4JYK A;  2NVQ J;  3T6N A;  4MXM A;  4I76 A;  3HOV J;  2X9D A;  3A02 A;  2R92 J;  2COB A;  1FEX A;  2JMW A;  2DA2 A;  4ACI A;  3JRE A;  3VW0 A;  2FBQ A;  1UHS A;  1OCP A;  1QRY A;  4L5E A;  2G7L A;  3PO3 J;  3B6A A;  3BG9 A;  4UUS B;  5H9T A;  1GV5 A;  5C3E J;  1BJZ A;  3FKI J;  1MBE A;  1JKQ C;  1JKO C;  1TWH J;  4QSH A;  1HLV A;  4GFK A;  4QTR A;  3S17 J;  5F08 A;  4FE4 A;  2WV1 A;  3ZOB A;  5D1R A;  1NK3 P;  3BNI A;  2ZB9 A;  5F27 A;  4B3A A;  1FTZ A;  4QIW N;  2Y2Z A;  2DA4 A;  2HQ5 A;  1RES A;  3GTM J;  1JTX A;  4M3G A;  3TW7 A;  3S2H J;  2LY9 A;  4BBS J;  2RHA A;  1JJ8 C;  5E3O A;  2GEN A;  2WB1 N;  2R5Y A;  1MNM C;  3RH2 A;  1QVU A;  4KWA A;  2YVE A;  3VVX A;  3VUQ A;  1HDP A;  2IU5 A;  5F0C A;  2VI6 A;  5JLX A;  1ZR2 A;  3IH4 A;  1MBK A;  1AKH A;  1APL C;  2EBI A;  2O9L A;  3Q0U A;  4ICH A;  2FQ4 A;  4AC6 A;  2WUI A;  4MLO A;  4MFD A;  3RQI A;  1POG A;  5FKN A;  2HOA A;  1Y1V J;  1JUM A;  3SFI A;  5M5Y J;  1LE8 A;  2FX0 A;  2R5Y B;  3F0C A;  5IOZ A;  3DEW A;  3Q0W A;  3HIM A;  1Z77 A;  4M6V A;  3QPS A;  3GTL J;  3GBG A;  1AKH B;  2ZCM A;  2LVS A;  2GLO A;  5GPC A;  2PMZ N;  4HKU A;  2NOG A;  1OJL A;  5CXG A;  5IP7 J;  2CUE A;  4XID A;  3BHQ A;  5AQC A;  5FMP A;  1F43 A;  1Y1W J;  2UXU A;  2VUM J;  4A3E J;  3TED A;  2HXI A;  2OER A;  1TWA J;  2DMN A;  3S2D J;  3S16 J;  4XK4 A;  2NS7 A;  3I4M J;  2E2J J;  3A01 A;  5FGL A;  4CYC A;  1ETK A;  5E3N A;  3V6G A;  2K9N A;  3HM5 A;  1E3O C;  1I6H J;  4A69 C;  2MSY A;  2DJN A;  4A3F J;  2X6O A;  3H0G J;  3BCG A;  2NX4 A;  2M34 A;  3OSF A;  1T33 A;  3S1Q J;  3VOK A;  4AYB N;  1F36 A;  3ZQG A;  1IC8 A;  4JP0 A;  3G7R A;  3E7L A;  2M2E A;  4NDL A;  3JR9 A;  1YRN A;  3NAU A;  2X48 A;  3LNQ A;  1P7J A;  1PUF A;  3GTQ J;  5C4X J;  2Y9Z A;  3KKD A;  2XGE A;  4X1E A;  4DYQ A;  1BW6 A;  4S0H B;  3NI7 A;  1LFU P;  2DMU A;  5IOY A;  1ETW A;  2XPV A;  3QKX A;  1VND A;  3H3V K;  2JA5 J;  2VPR A;  2DN0 A;  3NXC A;  2V57 A;  5J1R A;  3HBL A;  2YVH A;  3I4N J;  2EZL A;  1ZGW A;  4A3K J;  1BW5 A;  1UG2 A;  2DA6 A;  4DW6 A;  4IHW A;  4L62 A;  2REK A;  2XPW A;  4J19 A;  1TWF J;  2ME6 A;  5GP9 A;  2LKX A;  1MSE C;  1ORK A;  2EZH A;  4V2F A;  1YRN B;  3BRU A;  4A3G J;  1DU0 A;  1HOM A;  1PUF B;  1GVD A;  4M3E A;  2YS9 A;  2HYT A;  2R93 J;  1ETQ A;  4RDU A;  2Y30 A;  4AUX A;  2PBX A;  3LWJ A;  4GCK A;  3IH3 A;  4DZJ A;  2M0C A;  5HSZ A;  5EZG A;  3LHQ A;  2CQX A;  3WHC A;  3S1N J;  2L9R A;  2LP0 A;  1I50 J;  2E1O A;  4A3C J;  2XB5 A;  2NVY J;  1HF0 A;  3CCY A;  1B8I A;  3BTL A;  3GTK J;  2ZOZ A;  2LFB A;  3K2A A;  2HDD A;  5CXI A;  3COL A;  4X6A J;  3NRG A;  5D19 A;  2IBD A;  3BR3 A;  3GTJ J;  4DYR A;  5IP6 A;  2DG8 A;  4D5C A;  2EZI A;  3G1O A;  2K9S A;  1GDT A;  2L0K A;  4C2M J;  4A3L J;  1B72 B;  2F07 A;  3S1M J;  1RR7 A;  2G7G A;  3MNL A;  3LOC A;  4JX4 A;  2ID3 A;  1I3Q J;  1JTY A;  3HB9 A;  4Y52 J;  4FCY A;  3EUP A;  1K61 A;  2R0Q C;  2JA6 J;  2GBY A;  3RD3 A;  4RBO A;  3BR6 A;  3S1R J;  2ID6 A;  3FRQ A;  5D18 A;  1RKT A;  3FK7 A;  3D1N I;  5F0F A;  3HTJ A;  5M5W J;  1G2H A;  2R5Z A;  1JUS A;  3L1P A;  1WGX A;  5EZH A;  1OCT C;  3G56 A;  4IHY A;  3SDG A;  3RZD J;  3KZ9 A;  5EEA A;  5DS9 A;  1RPW A;  4IEJ A;  3GEU A;  3O60 A;  3IH2 A;  2CU7 A;  3KNW A;  2HYJ A;  5BNG A;  2RAE A;  1IJW C;  3TW6 A;  2MG4 A;  5J1Y A;  1ETX A;  2XRL A;  2JWT A;  5IYC J;  1IUF A;  1IDY A;  3BQY A;  1SFO J;  3O8H A;  3OSG A;  1OFC X;  4D5F A;  1MH3 A;  2E19 A;  4FE7 A;  3HOY J;  3NAR A;  4MFE A;  3GTO J;  2L7Z A;  2QOP A;  3VOX A;  1VFC A;  4XRS G;  1GV2 A;  2CRG A;  3Q0V A;  1LFB A;  1JT0 A;  4JKZ A;  1JT6 A;  1FJL A;  3CMY A;  2GUH A;  2DTZ A;  4D7M A;  3K7A J;  2O7T A;  1BA5 A;  5JLW A;  1MBJ A;  1ZKG A;  3JRA A;  4I6Z A;  1WPK A;  3VVY A;  2W53 A;  1X58 A;  5F1J A;  4C3I J;  2DA7 A;  5EDN A;  1MBH A;  2WGB A;  3VW1 A;  3Q3S A;  5EGO A;  2ME0 A;  5FKL A;  3JRC A;  1LE8 B;  2UXH A;  2ECB A;  2AO9 A;  5F0H A;  3KKC A;  2XDN A;  3PPB A;  1BL0 A;  2L7F P;  1Q1V A;  3S14 J;  5EFY A;  5M5X J;  2DMP A;  3ZQF A;  5FKK A;  5HBU A;  3BR5 A;  2OPT A;  2XSD C;  3JRG A;  2GM4 A;  3DPJ A;  2G0E A;  5E3L A;  3BR1 A;  2G3B A;  4BXX J;  3ON4 A;  1ZR4 A;  2MGQ A;  3JRB A;  2QKO A;  4A3I J;  3M4O J;  4NEL A;  5FKO A;  3UKG A;  3G1M A;  2E2I J;  2DMQ A;  5J1U A;  4A3J J;  1A6I A;  1S7E A;  5EGO B;  3M3Y J;  2O7O A;  2Y9Y A;  4XIC A;  1HCR A;  3AQS A;  2O8K A;  2H8R A;  3A01 B;  1W0T A;  3VW2 A;  2DG7 A;  4CYC B;  3EGQ A;  1ITY A;  3VP5 A;  2LLK A;  1VF9 A;  5C4J J;  4PXI A;  4M3F A;  2RAS A;  5IYB J;  3ZQL A;  2OI8 A;  3CWR A;  1SGM A;  2K40 A;  2CJJ A;  4MIM A;  4D7N A;  3JRH A;  4JX6 A;  3BR0 A;  2QCO A;  3HOX J;  1WH5 A;  1XC5 A;  3CRJ A;  1P7I A;  3A03 A;  1IGN A;  3LSJ A;  3ZQH A;  2QTQ A;  2EZK A;  2UXP A;  3HKZ N;  1UI6 A;  1ENH A;  3BTI A;  2M8G X;  3AQT A;  3F1B A;  4M3B A;  3ANP A;  1X2M A;  5GPA A;  4IHV A;  1ETV A;  2EH3 A;  2LTP A;  3VVZ A;  5J3L A;  4BY7 J;  2XB0 X;  3C2B A;  5EYR A;  5C44 J;  5FHP A;  4BY1 J;  4FTH A;  4MO7 A;  3B81 A;  3JRI A;  4A3D J;  1FTT A;  1IG7 A;  5FJ8 J;  3FIW A;  1TC3 C;  2XGC A;  3PM1 A;  3JSJ A;  3GTP J;  2JN6 A;  3RKQ A;  2VKE A;  4GCT A;  4Y7N J;  3OIO A;  1X2N A;  3MKL A;  2N8G A;  1VI0 A;  2CQQ A;  3ZQI A;  1O4X A;  4GFB A;  2XGD A;  3CQZ J;  3HDD A;  5E3M A;  3WHB A;  2I10 A;  1JGG A;  2TRT A;  2HOS A;  2ZCX A;  1B8I B;  3NPI A;  4UUT A;  4CGR A;  1MSF C;  3BR2 A;  2NVX J;  1SAN A;  3HE0 A;  3CDL A;  4DZP A;  3O8G A;  3P9T A;  2HXO A;  1IRZ A;  3V78 A;  1W0U A;  2L7M P;  3HTI A;  3JRD A;  3LSR A;  5IYD J;  5FLV A;  2KT0 A;  1WCM J;  1DU6 A;  3C07 A;  2ELK A;  2M9H A;  4EEF G;  2OF7 A;  3BQZ A;  3TP3 A;  5K58 A;  3TP0 A;  1ZTR A;  1H88 C;  3OOU A;  2JJ7 A;  2JA7 J;  9ANT A;  5DAJ A;  3HOZ J;  5IP9 J;  2WAQ N;  2R5Z B;  4XRS A;  2GFN A;  3ANG A;  1NK2 P;  1EF4 A;  1GUU A;  2TCT A;  2FJ1 A;  3ON2 A;  2HI3 A;  4M3D A;  3JRF A;  1RKW A;  1MBG A;  4C3J J;  3HTH A;  4YZE A;  3LSG A;  2DA5 A;  3BJB A;  3S15 J;  3BG3 A;  1FIP A;  3CJD A;  5HOD A;  2QF7 A;  3FIS A;  2DA1 A;  1JUP A;  2W48 A;  5HAW A;  3VPR A;  1U9N A;  3LJL A;  4FIS A;  2D5V A;  3IV5 A;  5M3F J;  1ZK8 A;  5EG0 A;  3GTG J;  4AF5 A;  1UMQ A;  1JKR C;  3NNR A;  3MN2 A; 
#chains in the Genus database with same CATH topology
 1PJR A;  2LR8 A;  2CYY A;  5L3B A;  1LVK A;  2A5Y B;  5C4Y A;  3CF5 F;  5F6F A;  1R22 A;  4W1U A;  2H09 A;  5ILV A;  1ZG5 A;  4YRV A;  3S2W A;  5B1A H;  2K86 A;  2JSP A;  5DUK A;  4IHX A;  3FBI B;  3HRU A;  5E18 F;  1VQ7 I;  3HEF A;  4FX4 A;  2DA3 A;  5DEQ A;  1P92 A;  3CUQ A;  2YU9 J;  1G3S A;  4HF2 A;  2KDZ A;  1TWG J;  4RB1 A;  1IF1 A;  4LMY A;  4OAZ A;  4E7I A;  2G7S A;  4AID A;  1RET A;  5GTI C;  4II3 A;  2K3P A;  3E7Q A;  4RAY A;  2R7Q A;  1QVT A;  1TLH B;  3GZ5 A;  2VOP A;  2PZ9 A;  3DCF A;  3EUA A;  1J0R A;  4B1R A;  1NH3 A;  1BR1 A;  4ZYA A;  2OJE D;  2Q2E A;  5KVR A;  3AG4 H;  4CSW A;  1K83 J;  2EV5 A;  4RA2 A;  3WTU C;  2XAS A;  2H1K A;  2P81 A;  3HOU J;  3N05 A;  3IHU A;  3LA7 A;  4HV5 A;  3BG5 A;  1SFE A;  2UXN A;  3PO2 J;  4C2M A;  5FKM A;  2BYV E;  2IEK A;  2HKO A;  5K7Z A;  3CLO A;  3FHN A;  5HLG A;  2L01 A;  3BG7 A;  5JFR A;  1HSJ A;  1MBF A;  1XG1 A;  3FBN B;  4B43 A;  3F21 A;  3H92 A;  2K27 A;  2W00 A;  1YS6 A;  4GDF A;  1P6R A;  4DJA A;  4YIR X;  1W5C C;  2WAE A;  4H0E A;  1B72 A;  2NVU B;  4IHS A;  1QHH D;  1XSD A;  1F1Z A;  1TWC J;  3QPL A;  4GXO A;  2B3W A;  3F3X A;  1U8B A;  4UNO A;  2BOL A;  3I0T A;  4NN1 A;  3BRO A;  2HKU A;  4UVB A;  1YO5 C;  2DMT A;  4JYK A;  3COA C;  2NVQ J;  2YX4 A;  2DW4 A;  3WG7 H;  4MTD A;  4I76 A;  2R92 J;  2COB A;  4L9N A;  2FBQ A;  1YIJ I;  1FC3 A;  1QRY A;  5FD5 A;  3EET A;  2VJ5 A;  5L3G A;  2OUM A;  1HQC A;  2F2E A;  2JZY A;  3OYA A;  1WJB A;  1MDM B;  2ELJ A;  3ZGK A;  2OA4 A;  4AVP A;  1TWH J;  2E1N A;  4QSH A;  4FE4 A;  3OS0 A;  2DYS H;  1NK3 P;  2GZW A;  2ZME A;  5F27 A;  1PUE E;  1SAX A;  2HQ5 A;  1RES A;  4ZZL A;  1JTX A;  4M3G A;  3CO6 C;  2RKH A;  4ENM A;  3S2H J;  2ZFU A;  3ULQ B;  5E3O A;  3KYL A;  2GEN A;  1USS A;  3RH2 A;  3KZZ A;  2XAH A;  4LJZ F;  2J5O A;  3TOB A;  2ZJP F;  3EPZ A;  1ULY A;  5J4V A;  5JLX A;  2QUF A;  2RQP A;  3BG6 A;  1ZR2 A;  1MBK A;  2M5W A;  3T8R A;  2LY2 A;  2R7S A;  4ICH A;  1KQ0 A;  2C6Y A;  2WUI A;  3Q9S A;  1B6A A;  1IV8 A;  1A31 A;  3TO6 A;  2HOA A;  4BGD A;  5LLQ A;  2EA2 A;  2QBY B;  5M5Y J;  4XKB A;  2EFO A;  4MQV A;  2HZD A;  2EWN A;  1JI8 A;  1PYV A;  4YEL A;  1XGM A;  1MND A;  3F0C A;  4PGH A;  1IN7 A;  2E1C A;  2GOM A;  3LQR A;  5FFZ A;  2R7T A;  2Q0O A;  1AKH B;  4NBQ A;  2ZCM A;  2LVS A;  2W25 A;  3C3W A;  2LF7 A;  2PMZ N;  3V8L A;  3WE2 A;  3I71 A;  3H9Q A;  5IP7 J;  3HTU A;  5D5X B;  1OR7 C;  4M6Y A;  3BHQ A;  3PJR A;  3JTH A;  4UVA A;  3CCM I;  2DAO A;  3DEE A;  3OMY A;  2RVC A;  3LFU A;  3J80 Z;  1R1U A;  3VYR B;  4XLC A;  2W7N A;  4RLQ A;  5H6R A;  3KYD B;  4NC7 A;  3A01 A;  1DUX C;  2IS1 A;  3HZJ A;  3V6G A;  2K9N A;  2L9S A;  2DJN A;  4HA8 A;  1R71 A;  4BDY A;  1DDN A;  3BCG A;  3OSF A;  3MD2 A;  3S1Q J;  1F36 A;  2GA1 A;  3FF5 A;  3ZQG A;  1KQ9 A;  4M73 A;  3K6G A;  3IRR A;  3G7R A;  3BY6 A;  3NAU A;  3LNQ A;  4J01 A;  2DI3 A;  4IKF A;  1P7J A;  1PUF A;  3L00 A;  3WTT C;  2XGE A;  4X1E A;  2O5R A;  2Z5U A;  1BW6 A;  1LDJ A;  4ZZD A;  1ZLK A;  4E7K A;  2DMU A;  3AFH A;  4F55 A;  1ETW A;  2XPV A;  4YFX F;  2HQA A;  2PMZ A;  2KRC A;  1WKM A;  1T95 A;  1XDU A;  4EGY A;  2VOO A;  5CVU A;  4A2U A;  1UCR A;  2V57 A;  1BI1 A;  1FX7 A;  3HBL A;  1OCO H;  5J1R A;  1QGP A;  1ZGW A;  5AIP A;  5ICC A;  2XPW A;  3WU0 A;  3K69 A;  1X3U A;  3S3N A;  4V2F A;  4GGG A;  3BRU A;  4A3G J;  3HIF A;  2KKO A;  2MA3 A;  2YS9 A;  2H6C A;  2DT5 A;  1ETQ A;  2K7L A;  4UB8 C;  4BJT A;  1J09 A;  4YFN F;  1CGP A;  3IWZ A;  2O6G E;  2E1M B;  3LHQ A;  3I3L A;  2KJC A;  2BXY A;  2CQX A;  4HV6 A;  1HW2 A;  3WHC A;  2LP0 A;  2FBI A;  1G4D A;  3LSI A;  2GXB A;  3N4M A;  2OV7 A;  1HF0 A;  2OQR A;  4XLE A;  2DLL A;  2VKH A;  2Z33 A;  5ICF A;  1TTY A;  3K2A A;  3KP6 A;  3CJR B;  3GLX A;  4DQ2 A;  5CXI A;  2IBD A;  3VTI A;  4DYR A;  5IP6 A;  1R1T A;  1SD6 A;  2WV0 A;  3PFI A;  4D5C A;  4E7Z A;  4WK8 F;  1GDT A;  3DXJ F;  4C2M J;  4UHT A;  3S1M J;  1XCB A;  1MJB A;  1RR7 A;  4NC8 A;  1Z9C A;  2DJI A;  2ID3 A;  3MFK A;  1QBJ A;  5DCM A;  1UHW A;  3DPT A;  1R00 A;  4BEH B;  2MFZ A;  1IZ1 A;  3BR6 A;  3H5N A;  3JSP A;  1UAA A;  3FRQ A;  3FK7 A;  4XMY A;  4WIB A;  1JUS A;  3BPX A;  3HTS B;  2KP6 A;  2HEO A;  2ACJ A;  1WGX A;  2HPM A;  1BI2 A;  3QP6 A;  3WU1 B;  1YTY A;  3OYH A;  4BL0 B;  2DOE A;  4IXA A;  3RZD J;  4IEJ A;  4OU0 A;  1K79 A;  1JHF A;  4KDP A;  3KNW A;  2HYJ A;  3KE2 A;  3ZQQ A;  1VQM I;  3CES A;  1E3H A;  4E7S A;  1ZGA A;  3TW6 A;  2XF5 A;  3WU2 C;  5A2Q Z;  3LA3 A;  3PIO F;  3ZN0 A;  1EV7 A;  3ASN H;  5HLT A;  2WY8 Q;  5IYC J;  4ENN A;  3ONQ A;  2DOD A;  4D5F A;  2E19 A;  3DU6 A;  4II2 A;  4AM3 A;  2VKD A;  3F8C A;  1T98 A;  2QOP A;  2L7Z A;  4HBL A;  3EDP A;  5HVQ C;  1MNE A;  4XRS G;  4KIT B;  2QLZ A;  1FJL A;  3CMY A;  2EV0 A;  1HKQ A;  2CGP A;  1EH6 A;  4A5N A;  3IKV A;  1WSU A;  2DFF A;  3A1Y A;  2XF6 A;  2HNH A;  3K7A J;  2O7T A;  1BA5 A;  5ILU A;  1ZKG A;  4I6Z A;  2W53 A;  1X58 A;  4S05 A;  1ZG3 A;  4IPA A;  4MEX F;  4BE2 A;  1S7O A;  2QM3 A;  4BJ6 C;  1JGS A;  2OD5 A;  2VXZ A;  2FSW A;  3N97 A;  1FWZ A;  2K02 A;  1XD7 A;  5FKL A;  1VZ0 A;  2FOK A;  5J8F A;  3RTR A;  2XIG A;  4RAZ A;  2XDN A;  1MMG A;  1RIO H;  3BZC A;  5FLX K;  1ZRC A;  2G7U A;  4RGR A;  3PUF A;  3V42 A;  3ZQF A;  5FKK A;  2XSD C;  2G0E A;  4YIF A;  1YIO A;  1LKX A;  2G3B A;  2LH9 A;  2LC2 A;  3LL7 A;  3G73 A;  3ON4 A;  2QKO A;  2M3A A;  5L3F A;  3UKG A;  2E2I J;  3E0J B;  5CYV A;  2WBM A;  1I6X A;  4A3J J;  4P5O A;  1S7E A;  1J59 A;  3QU3 A;  2Y9Y A;  2VC1 A;  4HRI A;  5D4R A;  4G7Z F;  3CC4 I;  1W0T A;  4F3Q A;  5D8K B;  5D5W B;  4JBA A;  5DCF A;  4LK1 F;  4M72 A;  2A07 F;  4L18 B;  3PNY A;  3I54 A;  4A0Z A;  1XMX A;  4BU2 A;  3CWR A;  2Z2S B;  1O7F A;  3MWM A;  4BHB A;  3JRH A;  1HW5 A;  3MKZ A;  3FXQ A;  1EH8 A;  4NC6 A;  4Y3O A;  5AON A;  3ZQ7 A;  2IP2 A;  3CRJ A;  3A03 A;  3DFG A;  2VQL A;  4G7H F;  2RC4 A;  3LSJ A;  4BDZ A;  2QTQ A;  5DM7 F;  2EIL H;  4RMN A;  1G8X A;  2UXP A;  4DBQ A;  3H3Z A;  3H5R A;  3BTI A;  2ETH A;  3F1B A;  4IHV A;  1OCZ H;  1OCR H;  2EH3 A;  1S3J A;  3W3C A;  3CCL I;  1OPC A;  3VVZ A;  3OYD A;  5J3L A;  2R7O A;  5JR3 A;  2MLK A;  5FHP A;  2E36 A;  4UV8 A;  3V4G A;  3CD6 I;  3JRI A;  4A3D J;  2OTJ I;  1IG7 A;  3FIW A;  2XGC A;  3JSJ A;  2HQN A;  3M7G A;  3L09 A;  5LFA A;  2JRT A;  1F5T A;  1BBY A;  2VJ4 A;  3CTA A;  3CQZ J;  4JQF A;  5ERI A;  2F4I A;  5E3M A;  1X3Z B;  3W2A A;  1DPU A;  1UJ8 A;  5BQT A;  4IOC F;  2FMY A;  4ZH4 F;  2ZJ2 A;  1FP1 D;  3NPI A;  3RDI A;  3BCA A;  4IQ4 A;  1ONV A;  1SAN A;  3IAM 2;  2ZY9 A;  4CHU A;  4DZP A;  3P9T A;  3O8G A;  4IX7 A;  1IRZ A;  4UV9 A;  2P0W A;  3TO7 A;  3HTI A;  4EMS A;  3GVA A;  1XB4 A;  2OBP A;  2RNG A;  4RB0 A;  1DU6 A;  2M9H A;  1WI9 A;  3I59 B;  2DK5 A;  3KP7 A;  4KUM A;  4XN3 A;  4RB3 C;  1R7J A;  2OF7 A;  3GFL A;  2D1H A;  2JJ7 A;  2JA7 J;  9ANT A;  4ZDP A;  4F52 A;  1KU3 A;  1R49 A;  3HOZ J;  3M9A A;  2WAQ N;  2GFN A;  1NK2 P;  4P1W A;  3DLA A;  1UHM A;  2TCT A;  2HS5 A;  1WRJ A;  2KRF A;  3K2Z A;  1IUY A;  4IJA A;  2R4G A;  3G2B A;  1RKW A;  3NQO A;  2XKP A;  4ZC3 A;  1ZHF A;  1SD4 A;  4YZE A;  3A0H C;  2ESH A;  2QEN A;  3BJB A;  1Q1H A;  3S15 J;  4DVY P;  3BG3 A;  1FIP A;  1ZN2 A;  1GVJ A;  3CJD A;  1HKS A;  2X0L A;  1XGN A;  2QF7 A;  6PAX A;  3FIS A;  1SFK A;  2LYC A;  3OWT A;  5HAW A;  3DTK A;  2PJP A;  3GZ6 A;  4FIS A;  3T1B A;  2VBX A;  3RPU D;  4Y4R A;  5EG0 A;  4GO1 A;  3VYU B;  4XR6 A;  4AF5 A;  1UMQ A;  2HU9 A;  2A6H F;  4U7B A;  1RUN A;  3AAF A;  4RGS A;  4Y33 A;  2XPU A;  1ZAO A;  2ECC A;  4PJN A;  1ETY A;  1MMA A;  4W97 A;  1LUJ B;  3HTA A;  5K7F A;  1Y56 A;  2NP5 A;  2K3F A;  1ZGJ A;  3SYT A;  1MH4 A;  3LSP A;  1ZRF A;  4JNN A;  3ZR8 X;  3GZI A;  1ETO A;  2LD5 A;  4PUS A;  4A0X A;  1XS9 A;  4KJZ A;  1Y8R B;  5K5Q A;  2QQ8 A;  3QBM A;  4GCL A;  2QQ9 A;  3S93 A;  5JHF A;  3SFZ A;  1S7A A;  1YI2 I;  4GFL A;  2M7B A;  5HDK A;  4A3M J;  3HXL A;  3H9G A;  5LRS A;  3B6C A;  2EFP A;  5CW8 A;  1T56 A;  3HGY A;  4ABZ A;  2UV1 A;  1WI3 A;  2HWV A;  3MZH A;  4UDS A;  4B4C A;  1ZG1 A;  1W5S A;  2JA8 J;  2GXG A;  3GFI A;  3HOW J;  2A69 F;  5JHU A;  3CUQ B;  3RYR A;  1X4O A;  3KPH A;  4LIT A;  3MVP A;  1V5G A;  4DYC A;  1VQO I;  4LLN A;  3RZO J;  4PFO A;  1UG0 A;  1HST A;  2CO5 A;  3E5Q A;  1WJA A;  1JJ6 C;  1H8A C;  3K1M A;  1PP8 F;  1P9Q C;  3G4S I;  3OYL A;  2LG4 A;  1K4T A;  4U87 A;  2EFN A;  4FAS D;  1UI5 A;  3LA2 A;  4UUS A;  2K9Q A;  2JUG A;  1Z0X A;  1KU7 A;  1OQY A;  2MW8 A;  2Q2E B;  2HDC A;  3RPQ A;  1IDZ A;  2EPF A;  1X1D A;  3AL0 B;  4XQF A;  3IWF A;  3F6O A;  2VKV A;  5J6X A;  2R7U A;  2UXX A;  1F4K A;  4EJV A;  2STT A;  2ZCN A;  1KQ8 A;  1UEL B;  5LEK A;  3GFJ A;  4G94 A;  2WAF A;  4LIV A;  4N9I A;  2ZJR F;  3CLQ A;  2IRF G;  1FEX A;  2JMW A;  2DA2 A;  1E2X A;  4ACI A;  4FET A;  5GAG J;  2A6T A;  3A4C A;  1UHS A;  3C18 A;  4CUG A;  3I56 I;  1X3W B;  3OYJ A;  3PO3 J;  1B9M A;  2BBY A;  1QU3 A;  5C3E J;  2VE9 A;  3CP2 A;  1BJZ A;  2X1C A;  1MBE A;  3FKI J;  1R4N B;  4HX4 A;  2LKS A;  5DV5 A;  1JKO C;  4BUP A;  2GXA A;  4AD9 A;  3QOE A;  1N77 A;  4QTR A;  4X0G A;  3CCU I;  2BGC A;  4LLG F;  1MGT A;  3ZOB A;  3MKW B;  4BXU A;  3OYF A;  2PJR A;  2DA4 A;  2HGC A;  4D1Q A;  3GTM J;  3F8M A;  3KFW X;  3J80 K;  3HOT A;  3ECH A;  4BBS J;  4WF2 A;  1BJA A;  4L9J A;  2CQK A;  2R5Y A;  2CWE A;  1MNM C;  4U0W A;  2P7V B;  1QVU A;  3K0L A;  2YVE A;  3CMM A;  5F0C A;  4LG0 A;  2YPR A;  1JHH A;  3E6D A;  5HLH A;  1XCV A;  3NEU A;  1IXC A;  1OMI A;  3M07 A;  1RI7 A;  1Z6T A;  4P9U A;  2H27 A;  2EJR A;  2FQ4 A;  3DEU A;  5FKN A;  3IRQ A;  5K5R A;  2HR3 A;  4IQJ A;  4M74 A;  2ISZ A;  2RRE A;  2FX0 A;  1D0X A;  4RS8 A;  3SWH A;  4A6D A;  2R7W A;  4G6T B;  2PMH A;  2XRO A;  1FNN A;  2PX9 A;  5IOZ A;  3Q0W A;  2JQ7 A;  4KIS A;  3GWZ A;  2Y0M A;  4BQA A;  2VN2 A;  3QPS A;  3GTL J;  2PG4 A;  3GBG A;  1XX5 A;  1U2W A;  4E4H A;  1XMK A;  1Y6I A;  5HDG A;  2PMU A;  1WZ2 A;  5CXG A;  1Z6R A;  1OJL A;  2CW7 A;  2KZG A;  1T8I A;  2KJB A;  3P7N A;  3VB2 A;  1F43 A;  5FMP A;  1T0F A;  3C2G A;  4A3E J;  2HXI A;  1U6G A;  2OER A;  2AQF A;  3ABU A;  1FP2 A;  3EYY A;  3S2D J;  3PUB A;  3S16 J;  4XK4 A;  2M8E A;  2PFV A;  5CVI A;  3VSK A;  2NS7 A;  2E2J J;  4C9Y A;  4IO9 F;  3C2H A;  5EJC A;  4CYC A;  3CJN A;  1ETK A;  1E3O C;  1I6H J;  3P5J A;  4A3F J;  4OIP F;  1IW7 F;  4B44 A;  3K4M A;  1W7P A;  3I53 A;  2M34 A;  3R4K A;  1OR7 A;  5LD2 C;  2G7H A;  3CCQ I;  2UWM A;  4AYB N;  4JP0 A;  5E8I A;  2L4M A;  3E7L A;  3KZI C;  1JE8 A;  1YRN A;  3BJO A;  1K6Y A;  1QA6 A;  4Q4Z F;  2OCC H;  2RV8 A;  4BAY A;  2TDX A;  5DDG A;  1LFU P;  3V8J A;  3GXO A;  2KIU A;  2Z9O A;  1VND A;  2F5E A;  5DD8 A;  5CVR A;  4F7Z A;  2CS3 A;  3H3V K;  5HS8 A;  2VPR A;  2Z3Y A;  5L3D A;  4I0A A;  1YFH A;  1KYW A;  4B48 A;  5FD6 A;  4FX0 A;  4IRG A;  5D6F A;  3K4B A;  3I4N J;  2EZL A;  4XOP A;  4A3K J;  1QZY A;  2V1U A;  4DW6 A;  2IA1 A;  2R7V A;  1TWF J;  1V5F A;  1J9I A;  4CCO A;  5GP9 A;  1MSE C;  2R7D A;  3PNT A;  1DGR M;  1V54 H;  4BH9 A;  1PUF B;  5LHG A;  2ZXW H;  5JVG F;  2HYT A;  4G8X A;  4AYB A;  2R93 J;  3VOD A;  1Z91 A;  3D0S A;  5A2Q K;  2PBX A;  3LWJ A;  4GCK A;  4DZJ A;  2M0C A;  1IXS B;  3BZK A;  2FJI 1;  3FXJ A;  4KT6 A;  3C7J A;  2L9R A;  2KIS A;  4A3C J;  1O7L A;  1XDS A;  4DGW B;  3CCY A;  3CDH A;  3BTL A;  2HDD A;  1U5T B;  3FM3 A;  3GX4 X;  2AS5 F;  1YHQ I;  3UNG C;  3GTJ J;  1Y39 A;  3GF2 A;  1TNS A;  4XLH A;  3OYM A;  4A3L J;  1X1P A;  2KL4 A;  3MNL A;  2H1L A;  4JX4 A;  2IS6 A;  1I3Q J;  1JTY A;  4Y52 J;  4FCY A;  2K85 A;  1L0O C;  2VB6 A;  3NRV A;  4OMZ A;  3RD3 A;  4XKC A;  4Q47 A;  3S1R J;  2RNJ A;  3WGI A;  2ID6 A;  5D18 A;  1RKT A;  2BVL A;  3D1N I;  3WG9 A;  4DOZ A;  5M5W J;  1G2H A;  2O03 A;  3OIP A;  3L1P A;  3CF2 A;  3BJ6 A;  3G56 A;  1I39 A;  1K6O A;  2XAU A;  3SEQ A;  3KZ9 A;  5EEA A;  5DS9 A;  1RPW A;  4IOA F;  1X1B A;  4PJM A;  1YW9 A;  1FSH A;  3LST A;  5KK1 A;  1FT9 A;  1C0W A;  3E5X A;  4I01 A;  2GWR A;  3GYH X;  4XSX F;  2JPC A;  1IJW C;  1REP C;  5J1Y A;  3FXU A;  5DCM B;  1OYW A;  1W5T A;  2R7X A;  1IDY A;  3HSE A;  1SFO J;  2IW5 A;  3NAR A;  3P9K A;  4MFE A;  1T38 A;  3GTO J;  1ZEL A;  2XUB A;  4RAG A;  3VOX A;  1T0F C;  2K9L A;  1GV2 A;  1LFB A;  1S29 A;  4JK1 X;  4I02 A;  5BOX A;  1YX5 A;  4GCV A;  1O3Q A;  3KP2 A;  1RR8 C;  3OYB A;  3BDD A;  2V4J C;  3F23 A;  3DV8 A;  3JRA A;  3VVY A;  2ZJQ F;  2BV6 A;  4XN0 A;  2XV4 S;  3L2U A;  4C3I J;  3TDZ C;  3KEO A;  3GME A;  2GQQ A;  3VW1 A;  5E8G A;  2OC6 A;  3Q3S A;  5EGO A;  4U9L A;  3KCC A;  1LE8 B;  2DQR A;  3SZG A;  5F0H A;  3O6B B;  3KKC A;  1XGO A;  1BN5 A;  2GIV A;  2EIN H;  4KIC A;  1BL0 A;  3OYC A;  3PPB A;  5LGT A;  1XN7 A;  3CJT B;  2DMP A;  1VQP I;  2V9P A;  3M1C A;  4CA0 A;  2GM4 A;  4PGG A;  2YSR A;  1FBQ A;  2X6Y A;  4QWQ A;  3ERE D;  3P9C A;  4KT5 C;  3OIQ A;  1KZH A;  3FMQ A;  1DP7 P;  2XSJ C;  1O3T A;  2LBF B;  4HLX A;  1ZR4 A;  3FHZ A;  2CMP A;  3JRB A;  4NEL A;  2A68 F;  4A3I J;  3M4O J;  1R1V A;  3BJA A;  1RZ4 A;  3OL4 A;  2DPD A;  3F6V A;  3FZV A;  1A6I A;  3V7S A;  1LDK B;  2M7A A;  3AQS A;  3LFK A;  2IGO A;  3WGG A;  2H8R A;  2VT3 A;  5DD4 A;  2E34 A;  3RI4 A;  4KMF A;  1ITY A;  1AA7 A;  2LRD A;  3E1S A;  2GOX B;  2LLK A;  5C4J J;  3H0D A;  1MMN A;  4PXI A;  1JXS A;  3FXR A;  2PN6 A;  3DPU A;  3G71 I;  1YW7 A;  2Y69 H;  2IXS A;  4A6E A;  2O3F A;  5E17 F;  2QEX I;  4JX6 A;  2QSH X;  3BR0 A;  2QCO A;  3HOX J;  1YE9 A;  1V4R A;  3SXY A;  1P7I A;  4ESJ A;  2X85 A;  2O8X A;  2X1E A;  2IS2 A;  1K78 B;  1W7P D;  4KA4 A;  2DTR A;  1Z7U A;  1SMT A;  1TNT A;  2RN7 A;  3K9T A;  1WQ2 A;  1ENH A;  1OCC H;  2FUG 2;  4EGZ A;  1A35 A;  2VPL A;  1UI6 A;  5GTH C;  1ON1 A;  2G9W A;  5GPA A;  1ETV A;  2L54 A;  4PSX A;  2ZSH B;  4O6J A;  1A04 A;  2HYG D;  4LB5 A;  3UR3 C;  5ILS A;  4FQG A;  2DU9 A;  5EYR A;  1MDM A;  3E6M A;  3SHF A;  4HNT A;  4BY1 J;  2JUC A;  1FTT A;  4EVI A;  1TC3 C;  2VIX A;  4FT8 A;  5J47 A;  3ECO A;  5E79 C;  3WGH A;  2ESN A;  3PL8 A;  3OIO A;  2CV0 A;  2E60 A;  3MKL A;  4PK4 A;  1D1C A;  1VI0 A;  2RQQ A;  2NYX A;  3ZQI A;  4GFB A;  1IRG A;  1CF7 A;  1QZZ A;  3GO5 A;  2VC0 A;  2XGD A;  1XTA A;  3HDD A;  5F64 A;  1A6Q A;  1GXP A;  2LF8 A;  3WHB A;  4NNJ A;  4N0B A;  5LGU A;  2HOS A;  1B8I B;  1J7K A;  3OYI A;  1R58 A;  3E6B A;  1MSF C;  3RPU A;  3LAP A;  1T6S A;  5F1R A;  3I55 I;  3CDL A;  2WY7 Q;  3WTW C;  2VON A;  3JRD A;  4EM0 B;  5IYD J;  1E3P A;  4CCM A;  5FLV A;  3VYS B;  2EB7 A;  2DDB A;  1WCM J;  2JRM A;  2L9N A;  2DOA A;  2QBY A;  2DO7 A;  1S72 I;  2L5Q A;  4MEY F;  4N9H A;  4EEF G;  3BQZ A;  3TP3 A;  4Y15 A;  2MC3 A;  2X51 A;  1VQ6 I;  5TRD A;  1OYY A;  2P8T A;  1QQI A;  2KIF A;  3IL2 A;  4R79 A;  4CZC A;  2R5Z B;  5IT9 Z;  1EF4 A;  3ROU A;  1GUU A;  4KIB A;  2OZ6 A;  3K70 C;  4M3D A;  2CV1 A;  1MBG A;  3H3U A;  1D8K A;  1BM9 A;  5EEH A;  2DBB A;  4EV0 A;  3KIO A;  1O3S A;  2CQN A;  3HRM A;  4CIC A;  2DA1 A;  2QSG X;  2W48 A;  3GZN B;  4UY8 I;  3VPR A;  1U9N A;  4E70 A;  2JVH A;  1R5I D;  1LQ1 A;  2D5V A;  1FOW A;  3K4K A;  3HRS A;  1ZK8 A;  1H9G A;  3GTG J;  3I5U A;  2GA2 A;  3S32 A;  2OCE A;  4LLL A;  3NNR A;  3MN2 A;  4BAC A;  5FB2 A;  4XRM A;  1IAW A;  4EJW A;  3FDY A;  5B66 C;  4IRI A;  4JX5 A;  1P4W A;  3ZQC A;  3GUD A;  4ZTJ A;  5GAE J;  4YFK F;  1LPQ A;  2MLG A;  2FD5 A;  4PSW A;  2XAG A;  3HOS A;  2E2H J;  2NP3 A;  3X2Q H;  4AC0 A;  1TT0 A;  1YJW I;  1Y0U A;  4MHG A;  4C3H J;  3WTV C;  3DLL F;  1Z3Y A;  4AWX B;  1H89 C;  3HPG A;  2F5F A;  4P55 A;  3L2V A;  2ZNY A;  2EQR A;  3GW2 A;  4G12 A;  2Q8K A;  3WTZ A;  4XNF A;  4LOC A;  3IUV A;  4UB6 C;  2AHQ A;  4OIR F;  1JKP C;  5EG0 B;  4CH7 A;  2D2W A;  2R7Z J;  1AHD P;  1ZQ3 P;  2CW8 A;  2DT7 B;  1EA3 A;  4NQW A;  5HNF A;  2VBZ A;  2Y31 A;  2V26 A;  3LWF A;  3TGN A;  2CSO A;  1XGS A;  3BTJ A;  2IAI A;  2LY1 A;  4PDK A;  4BKX A;  4A3B J;  1LVA A;  2NS8 A;  3R6S A;  1GT0 C;  2NVT J;  3QQA A;  1P4A A;  3ZRG A;  3PSF A;  3K70 D;  2PBI A;  4PJ0 C;  4XOT A;  1FBS A;  4BQN A;  2O61 A;  2OZU A;  1STZ A;  1U9O A;  1WFX A;  3HGG A;  3W6V A;  2E35 A;  4HX8 A;  3BTC A;  5LEJ A;  2HOT A;  1MIJ A;  4XSZ F;  4D9J A;  1HDD C;  1ZLJ A;  4L9V A;  3WE3 A;  3S5R A;  2Y0S N;  1UZC A;  2YUS A;  3HL2 A;  3VFZ A;  2UXI A;  2VL8 A;  5LHH A;  1X19 A;  2L9V A;  2ZXH A;  1D5Y A;  3QPH A;  3EUH C;  5BPI A;  2OAZ A;  3RJP A;  3CCS I;  1V3F A;  1AU7 A;  3BT9 A;  1S6L A;  1DQU A;  4HF0 A;  3PAS A;  1D3Y A;  2EFQ A;  5FLM J;  2HVR A;  4O5V A;  4XKW A;  1U3E M;  1RRJ A;  2RDP A;  1O57 A;  2B0L A;  2P5V A;  2V1N A;  1OKR A;  2XGX A;  3W6J B;  3U2R A;  3J7Z I;  4MXM A;  4KN4 X;  4B47 A;  2X9D A;  3A02 A;  1Z67 A;  4LFU A;  3E5U A;  1OCP A;  4BE1 A;  3KEQ A;  2G7L A;  4AU7 A;  3B6A A;  3BG9 A;  4UUS B;  5H9T A;  1NG7 A;  1W36 C;  2Y0S A;  3M1E A;  4ESB A;  4Q5S F;  2FA5 A;  4GFK A;  5KHD A;  3S17 J;  2EK5 A;  2YR2 A;  2VQH A;  4E7H A;  5D1R A;  2QKM B;  1MD0 A;  2QWW A;  2ZB9 A;  3FMS A;  4B3A A;  1FTZ A;  4QIW N;  4L9T A;  3DBR B;  3ZCO A;  1U0J A;  3TW7 A;  1SVM A;  2LY9 A;  2ELH A;  4DNC A;  2RHA A;  3OV8 A;  5KCM A;  2DCE A;  2FRH A;  5HLI A;  1SVO A;  3SQN A;  3ZN1 A;  4KWA A;  4CCN A;  3VVX A;  1HDP A;  4WCG A;  4OIQ F;  2IU5 A;  5HDN A;  2VI6 A;  2DT6 A;  4R1H A;  3Q5F A;  2OQG A;  3FXO A;  3ZMS A;  1Z1D A;  2L02 A;  2LRE A;  5H20 A;  3AG3 H;  2X1D A;  3WTY C;  2O9L A;  4XLN F;  1J5Y A;  3HYI A;  4XM3 A;  4WXD A;  2HTJ A;  2B9S A;  3V8K A;  1POG A;  3DTI A;  5LGN A;  1LJ9 A;  3BZ6 A;  1JUM A;  2FBH A;  4KFC A;  3SFI A;  2PJR B;  3HUG A;  2HFH A;  4M71 A;  4B09 A;  1WJC A;  4GYI A;  4F92 B;  3ASO H;  2R5Y B;  4ENJ A;  1I1S A;  1ZAR A;  3JCU C;  4O3M A;  3DEW A;  3HIM A;  1SFU A;  2AQE A;  1Z77 A;  4N4N B;  3L7W A;  2M87 A;  3OYN A;  2L4A A;  1PP7 U;  1BI3 A;  1VQL I;  5GPC A;  1G59 A;  1BR4 A;  3K4N A;  4XID A;  2NXN B;  1ACI A;  1Y1W J;  1W36 D;  4I7H A;  1QZE A;  4C2U A;  2L7K A;  4DIQ A;  1E17 A;  4OIN F;  2UXU A;  1R5G A;  3OS1 A;  2W24 A;  2VAS A;  5FGL A;  3K4J A;  4CDG A;  2XC7 A;  2KRH A;  3HM5 A;  5BPD A;  4A69 C;  2MSY A;  3B73 A;  3EQL F;  2E1M C;  2QSF X;  2P5L C;  3GLL A;  1YX3 A;  4ON0 A;  2KQR A;  2IVM A;  1IRF A;  4NDL A;  4BHP A;  5L3C A;  4KMU X;  4GRI A;  3GTQ J;  2Y9Z A;  3KKD A;  5D6E A;  4A0Y A;  2YU3 A;  3W6K B;  4S0H B;  3NI7 A;  3FXL A;  4CCL A;  1KGS A;  1WHU A;  3U9G A;  4G6Q A;  4BJ5 C;  3SZP A;  4HAM A;  1N78 A;  2LOO A;  3TO9 A;  3OYG A;  3L2Q A;  2BW3 A;  2PLY A;  2DN0 A;  3NXC A;  1KU9 A;  1YQA A;  4HLY A;  1V5E A;  2XVC A;  2YVH A;  1VQN I;  4FHT A;  2A3S A;  2BEO A;  2WAD A;  4M9X A;  1BW5 A;  1UG2 A;  2W84 A;  3L9F A;  2REK A;  2HYF A;  4CCJ A;  4J19 A;  4QPO A;  5CQE A;  1MZB A;  3NWT A;  4XLP F;  1ORK A;  2EZH A;  1PDN C;  2MBF A;  2DFH A;  3WOD F;  1YRN B;  2FEZ A;  1DU0 A;  1HOM A;  4HX7 A;  1GVD A;  2P6T A;  1K4S A;  1YYV A;  3BC8 A;  3LQQ A;  3CC2 I;  2Y30 A;  4AUX A;  4BQQ A;  3QYE A;  5HSZ A;  5BMZ A;  2DFE A;  3R0J A;  3E3V A;  2X6X A;  1IXR C;  2XRN A;  1W1W E;  2V1D A;  1I50 J;  2KPM A;  2E1O A;  2XAQ A;  3JSO A;  2W4S A;  2NVY J;  2XB5 A;  4HG2 A;  2NOJ B;  3REO A;  1FOK A;  1Y8Q B;  3D5S C;  3MQ0 A;  2LFB A;  1KA8 A;  4X6A J;  3NRG A;  5D19 A;  4CGZ A;  2VJI A;  1DGW Y;  1BOB A;  1B72 B;  2F07 A;  2BXZ A;  2G7G A;  4ZDO A;  2XDV A;  1K61 A;  4ANJ A;  4C2T A;  2JA6 J;  2GBY A;  2M4K A;  5BS6 A;  4XRF A;  4RBO A;  5DM6 F;  4J00 A;  3O2P E;  5F0F A;  3HTJ A;  4XKV A;  3RQ4 A;  2NRA C;  1XMA A;  1IO2 A;  5EZH A;  4OMY A;  1BC8 C;  3L2W A;  3M8E A;  1TQI A;  2VE8 A;  4LB6 B;  5LBQ A;  3QP5 A;  5J40 A;  3R60 A;  3IH2 A;  4HOB A;  3GEU A;  4BS9 A;  2CU7 A;  2OTL I;  2RAE A;  2VQC A;  3QRF F;  1V55 H;  3HSF A;  2MG4 A;  1ETX A;  2LSO A;  3DKX A;  2JWT A;  1LB2 A;  2FU4 A;  3CJQ B;  4HW0 A;  5GAH J;  3QWL A;  4ZJZ A;  2ZME B;  1OFC X;  3OSG A;  3HOY J;  3KP4 A;  1DPR A;  5HBU A;  4PCQ A;  2H94 A;  2K4J A;  1IN4 A;  3Q0V A;  4E6K G;  3H5A A;  5LRR A;  3TBI A;  3HC7 A;  1JT6 A;  4PZJ A;  2XAF A;  4IZZ A;  2VXD A;  2ZXJ A;  2QZ8 A;  4BXF A;  4D7M A;  3AKZ A;  1N75 A;  2FE3 A;  4F91 B;  5JLW A;  4I98 B;  1WPK A;  4U9N A;  4E7J A;  2F6C A;  1LEA A;  5F1J A;  3KP5 A;  1XSX A;  5EDN A;  1KON A;  1MBH A;  2NNN A;  4XLF A;  2XKO A;  2ME0 A;  4M9Z A;  2ECB A;  3W2W A;  2AO9 A;  2BY2 A;  5DYM A;  4M9S A;  2AXL A;  3U21 A;  1FYL A;  4U7D A;  5ED4 A;  3VYT B;  4YEJ A;  3BR5 A;  1T2K A;  1LDD A;  4ZDL A;  1MMD A;  5CLS A;  1TW2 A;  5KAF C;  2ZSI B;  3GCM A;  2P6S A;  5E3L A;  3BR1 A;  5H2F C;  1FLI A;  1BIA A;  3M8J A;  1ERD A;  5FKO A;  1AOY A;  2HVS A;  3G1M A;  2WWY A;  2DMQ A;  1FMV A;  4CO8 A;  5EGO B;  4KIF A;  3RKW A;  2O7O A;  1HCR A;  4XIC A;  1LNW A;  1HW1 A;  3MZY A;  4BQO A;  1RUO A;  2O8K A;  3A01 B;  2PFB A;  3VP5 A;  3VEP A;  4M3F A;  2RAS A;  4RM2 A;  4R8H A;  3CCR I;  2W57 A;  3F22 A;  2CJJ A;  2JT1 A;  4MIM A;  4D7N A;  5FRO A;  3CUO A;  3MKY B;  1YS7 A;  3V7R A;  4LGW A;  1D0Z A;  1XC5 A;  2ZBK A;  3RCO A;  4MGR A;  2IA0 A;  2JVG A;  2ZC2 A;  5HS7 A;  1KU2 A;  1YJN I;  1IGN A;  1WJE A;  2BHZ A;  4G9Y A;  2EZK A;  2QGU A;  3HKZ N;  4K2E A;  4G6D A;  2HKX A;  2M8G X;  4RGU A;  3AQT A;  4M3B A;  2V7F A;  2CH0 A;  3MZ8 A;  5KNL A;  5IT9 K;  2LTP A;  2QQB A;  3SZT A;  5C44 J;  2V6C A;  3A0B C;  3FWE A;  4MO7 A;  2V6E A;  2BE5 F;  3B81 A;  2W1O A;  3HRT A;  1J75 A;  2VLA A;  4LIU A;  3HPH A;  3F8B A;  3GFM A;  4ZYD A;  1S5L C;  2BY1 A;  3PM1 A;  3WTX C;  3GTP J;  3RKQ A;  2VKE A;  4ZYE A;  3QYF A;  4PJL A;  5HOO A;  2BVM A;  4OIO F;  3HSR A;  5D5V B;  4EM1 A;  1HXD A;  4YII A;  1GHC A;  2I10 A;  2F5C A;  3B02 A;  1JGG A;  2TRT A;  2EIM H;  3HKZ A;  4CGR A;  1MJA A;  3LMM A;  3R61 A;  3HE0 A;  3JAM Z;  1VQ4 I;  3V78 A;  4AIK A;  2D45 A;  2K4B A;  3RKY A;  2WA0 A;  3CCJ I;  3MAJ A;  2M30 A;  3C07 A;  2ELK A;  2I5U A;  3T0Y A;  5GAD J;  3PFY A;  5K58 A;  4B8X A;  4GYG A;  1ZTR A;  1H88 C;  3OOU A;  1A36 A;  1CF7 B;  3CO7 C;  1SEU A;  3H1C A;  3ESW B;  1S8N A;  3ANG A;  3J81 Z;  5FGM A;  2H8W A;  2FJ1 A;  3ON2 A;  2FNP A;  4P96 A;  3KZY A;  3IC7 A;  2H6B A;  3NWS A;  3TMO A;  1XSV A;  1W4M A;  1WVR A;  2L2O A;  1X4P A;  2DA5 A;  3KEY A;  5TJJ A;  1NG6 A;  3E97 A;  4EM2 A;  2L3D A;  2WTE A;  4OD4 A;  1TZL A;  4HQM A;  1FYK A;  2EFW A;  2IS4 A;  1FYM A;  1J2X A;  1JUP A;  2DPU A;  4M6X A;  2YX7 A;  1FBU A;  2Z1D A;  1MW7 A;  5M3F J;  2Z99 A;  1Z3X A;  5E1W A;  3ZPL A;  4ZTF A;  4V19 K;  3MMY B;  1JKR C;  3CUQ C;  2QVO A;  2LMD A;  2DQL A;  4S04 A;  1WH7 A;  4HNV A;  1QPI A;  2UUZ A;  1K7A A;  2V9K A;  1R36 A;  1X1A A;  2R7F A;  3AG2 H;  4L5J A;  4HST A;  1UST A;  3W2V A;  2UXO A;  3QOP A;  4AIJ A;  2V1X A;  4Q48 A;  5EF6 A;  3IUO A;  5J8C A;  1MJ9 A;  3LSK A;  3SJM A;  4JL3 A;  5K7H A;  2QWT A;  3AL0 C;  1B4A A;  2ZOY A;  2LK2 A;  1B9N A;  1FSE A;  2BY3 A;  5FFX A;  1CQT A;  4HDV A;  1DP3 A;  2KFD A;  3TL4 X;  4F93 B;  4ZYH A;  1R6R A;  3JTG A;  4U0V A;  3VDX A;  3IKT A;  4MK6 A;  1IRX A;  2JTV A;  1R5H A;  2AXT C;  2JK3 A;  2QQA A;  2B63 J;  1HKT A;  4ME9 A;  4HDU A;  1FIA A;  1BIB A;  2VBW A;  3ERM A;  1A5J A;  5E1Z B;  4XBF A;  3F72 A;  5M3M J;  3DKY A;  4MNU A;  2ZFW A;  3ZP5 A;  4IVN A;  1D1A A;  3ML6 A;  2CG4 A;  4XOR A;  3RKX A;  3VIB A;  1H9T A;  2FBK A;  4A93 J;  2CUF A;  4HSR A;  1MMS A;  1R9T J;  3KYC B;  4BNC A;  3QOD A;  2RGV A;  3G1L A;  1IV6 A;  4V2G A;  2Q24 A;  1H0M A;  5IPA A;  1NTC A;  5IY5 H;  4NQW B;  1WJ5 A;  1U5T A;  2VT2 A;  3ISP A;  4BBR J;  3FK6 A;  4LK0 F;  5F04 A;  2Z16 A;  3TOA A;  5DTD A;  4ASN A;  5CJ9 A;  2ICW G;  3NS4 A;  2MH9 A;  3HHH A;  2W85 A;  3OR2 C;  2K5C A;  2JSC A;  1LFP A;  3JW4 A;  3DTE A;  2QYO A;  2QIB A;  4Y13 A;  1U78 A;  2D6Y A;  2VQG A;  4I0B A;  4EAT A;  5K5O A;  1TBX A;  1P4X A;  1FY7 A;  2A2F X;  3T6N A;  5HS9 A;  3ZXS A;  2QA4 I;  2FNA A;  2EIK H;  3HOV J;  2F4M B;  2ZME C;  3EUH A;  5HNH A;  2KDO A;  3JRE A;  3HHG A;  3VW0 A;  2XAJ A;  4L5E A;  1QO0 D;  3H36 A;  1P2F A;  5CKT A;  1GV5 A;  2HZT A;  5L3E A;  3BP8 A;  2STW A;  1EH7 A;  4KIG A;  1JKQ C;  1TL8 A;  3FX3 A;  5B3S H;  1HLV A;  1LEB A;  2Q1Z B;  3C1D A;  5F08 A;  2IPQ X;  5E1X A;  3RSN A;  2WV1 A;  5E20 A;  2IGN A;  1AWC A;  2F4O B;  3CDI A;  1YJ9 I;  3MEX A;  4B3X A;  1SFX A;  3BNI A;  2X6W A;  3U1K A;  2Y2Z A;  1B59 A;  1TQP A;  4HPQ A;  1BC7 C;  2D1V A;  3OYE A;  1JJ8 C;  2WB1 N;  3AG1 H;  4L5I A;  3IAS 2;  3VUQ A;  2XHK A;  4JOM A;  2F5V A;  5D8L B;  4Y17 A;  3IH4 A;  3VOE A;  1AKH A;  1APL C;  1IN8 A;  4U0Y A;  2EBI A;  5JVT A;  3OY9 A;  2BHY A;  1QPM A;  3Q0U A;  4AC6 A;  2HOE A;  5CQG A;  4HYE A;  2PI0 A;  4MLO A;  4MFD A;  3RQI A;  3K8P C;  3ZMZ A;  3I64 A;  3FKJ A;  1Y1V J;  1L3L A;  3T8T A;  2NAZ A;  3DP7 A;  5KAI C;  1LE8 A;  3O3K A;  2E7W A;  4WXH A;  3L2C A;  3H35 A;  2ZCW A;  3L2R A;  4Z2Y A;  5CVV A;  4M6V A;  5TIS C;  2WB1 A;  4XLA A;  4UUV A;  2GLO A;  1N25 A;  4HKU A;  2NOG A;  2NS0 A;  3CZ6 A;  1GLN A;  2LBF A;  4QLC U;  2DXI A;  2CUE A;  4QPQ A;  4WWC A;  2ZXI A;  3K10 A;  2V9V A;  5AQC A;  3FM5 A;  1U8R A;  1F9N A;  1S9H A;  2JA2 A;  3S3M A;  3TED A;  2VUM J;  2EV6 A;  1TWA J;  2DMN A;  2JPB A;  4P9F A;  5DUI A;  3HUG B;  1IN6 A;  4NHJ A;  4YG2 F;  3I4M J;  3DKW A;  4WX9 A;  2KMU A;  5E3N A;  1M1E B;  1TQM A;  2X6O A;  3H0G J;  4MTE A;  1I27 A;  2NX4 A;  3LSM A;  1T33 A;  3S3O A;  3VOK A;  4KN7 X;  1IC8 A;  4H4K C;  2M2E A;  2MH2 A;  3JR9 A;  2MD5 A;  1UFM A;  1PVE A;  2FML A;  2X48 A;  3OS2 A;  4L0Y B;  5C4X J;  1BR2 A;  1GXQ A;  1U5T C;  3S8P A;  4DYQ A;  2ZO4 A;  4I2O A;  4TV7 A;  5IOY A;  4HEA 2;  1K78 A;  3ZMV A;  1D5V A;  3QKX A;  3ABM H;  2CUJ A;  1QHG A;  3DF8 A;  1XPX A;  2YVX A;  2JA5 J;  1ZRE A;  3ABT A;  2HDW A;  3KLO A;  1QNT A;  2DK8 A;  2WC2 A;  5J4Y A;  2FQ3 A;  4BYY A;  5ICE A;  5D4S A;  2V79 A;  3BCB A;  1ON2 A;  3ZMD A;  2DA6 A;  4IHW A;  4L62 A;  2ISY A;  2ME6 A;  4NUB A;  2LKX A;  1FZP B;  3GEZ A;  1G3Y A;  4XL9 A;  2O0Y A;  4ENK A;  3KP3 A;  4M3E A;  2EIJ H;  2PQ8 A;  4C30 A;  3K4L A;  1OIS A;  2EA4 A;  2COM A;  2CV2 A;  2KZV A;  3RIR A;  3KET A;  4RDU A;  2F5D A;  3OR1 C;  4BEH A;  3IH3 A;  2W82 A;  5EZG A;  3G6E I;  1X1C A;  3TKY A;  3CCV I;  4CXF A;  1Z21 A;  2J5P A;  2BW3 B;  3S1N J;  3CC7 I;  3Q9V A;  2M4G A;  5B5E C;  1D8J A;  1TP4 A;  5CPR B;  3KX2 A;  1B8I A;  3GTK J;  2ZOZ A;  1R4M B;  3COL A;  4CYD A;  1B1B A;  3BR3 A;  2DG8 A;  3IP4 B;  3EYI A;  2EZI A;  3G1O A;  2K9S A;  2L0K A;  4AVZ A;  4ETS A;  3HG9 A;  2Y48 A;  3OOP A;  3LOC A;  4ZYG A;  1FOY A;  3HB9 A;  2P7C B;  5AIQ A;  2K9M A;  3EUP A;  2DFI A;  2R0Q C;  3VSL A;  3ABK H;  5H6Q A;  1VQ8 I;  1Y0N A;  4HNU A;  3E6C C;  2ADU A;  3I9V 2;  3BWG A;  5CVJ A;  2UZK A;  2R5Z A;  1FPQ A;  3T5X A;  1OCT C;  4IHY A;  3SDG A;  4E7L A;  1ODD A;  3LSH A;  3O60 A;  3U1D A;  1SVL A;  4UXN A;  4LG3 A;  3F8F A;  3OYK A;  3PNV A;  4NB5 A;  4BHC A;  4KNY A;  5BNG A;  1T08 B;  1I3A A;  3FMR A;  2CUZ A;  1D0Y A;  2XRL A;  1IUF A;  3K4C A;  3BQY A;  2A05 A;  2CFX A;  3O8H A;  1MH3 A;  4FE7 A;  1SMY F;  2OU2 A;  4HQE A;  4BE0 A;  1VFC A;  2CRG A;  4A12 A;  1I1G A;  2E5N A;  1ZH5 A;  2KIQ A;  3CCE I;  4IL6 C;  1JT0 A;  4JKZ A;  3J7A Y;  2GUH A;  3M8F A;  2KIM A;  3SDB A;  2GIZ A;  4LG0 B;  3DWL E;  2DTZ A;  1G6N A;  2M0M A;  2FOW A;  2MC4 A;  3EUK L;  1MBJ A;  2HTS A;  4RM3 A;  4AIH A;  3CME I;  4IRH A;  4U88 A;  2DA7 A;  3F8N A;  5TGT A;  3BPV A;  3PIP F;  3J7Y J;  1TT5 B;  2WGB A;  2CW0 F;  4RLF A;  3JRC A;  2IJL A;  2UXH A;  1YOV B;  2MYS A;  4MQ9 F;  1ZYR F;  1R23 A;  5EEG A;  2L7F P;  3VWB A;  1VQ5 I;  3J7A O;  3QPT A;  1BOA A;  1Q1V A;  2P4W A;  3V7C A;  5M5X J;  3S14 J;  5EFY A;  1RC9 A;  2CQ7 A;  2WAQ A;  2OPT A;  2A6E F;  4RGX A;  2GAU A;  5K1Y A;  1KYZ A;  3PQK A;  3JRG A;  3DPJ A;  3FXM A;  4HZF A;  3ZMT A;  1SAU A;  4BXX J;  2X4H A;  3D5R C;  3H9J A;  2NNY A;  2MGQ A;  2DDA A;  2ZNZ A;  4PJJ A;  4EJT A;  2DOF A;  3F9K A;  5J1U A;  1EKE A;  2LDU A;  2E5Z A;  3M3Y J;  1MKM A;  1Z7L A;  4Z6Y A;  4I09 A;  4OWR B;  1EJ9 A;  4ITV A;  1VQ9 I;  4D0P A;  2IA2 A;  3VW2 A;  1SD5 A;  2F48 A;  1G3T A;  2DG7 A;  4CYC B;  3QAH A;  3EGQ A;  1G3W A;  1WWX A;  3ELK A;  3KLN A;  1VF9 A;  1TW3 A;  5B1B H;  2FXA A;  5FRM A;  5IYB J;  1W7P B;  3ZQL A;  4DBR A;  2OI8 A;  2A5W A;  1SGM A;  3D5L A;  5FRN A;  2DYR H;  2K40 A;  4IHT A;  2I8D A;  3HJE A;  2KLO A;  3JAM K;  3OL3 A;  2IT0 A;  1FMW A;  2HQR A;  3ABL H;  1WH5 A;  4EJO A;  1SD7 A;  3QU6 A;  2LNB A;  2VJJ A;  3TDU C;  5D5U B;  3ZQH A;  4UVC A;  4I99 C;  3R0A A;  1WJD A;  1ZRD A;  3I4P A;  3DQV C;  3DBH B;  5FLX Z;  2VBY A;  2P5K A;  3ANP A;  1X2M A;  1VQK I;  2IGM A;  3J81 K;  1VTN C;  2R7R A;  4BY7 J;  4G7O F;  2XB0 X;  3PQJ A;  3C2B A;  4RB2 C;  4KYW A;  3I58 A;  4N4O B;  1UB9 A;  4FTH A;  5FO5 A;  3K1P A;  3P9I A;  3LAJ A;  4OAY A;  4XON A;  5FJ8 J;  4IF4 A;  4LD5 A;  3RYP A;  3CP8 A;  2JN6 A;  3I59 A;  4GCT A;  4Y7N J;  1D1B A;  1E0E A;  1X2N A;  3G3Z A;  2N8G A;  2CQQ A;  2B7E A;  1O4X A;  5LHI A;  1O3R A;  1HBX G;  2E7X A;  5JI6 A;  3ZMU A;  2VOD A;  4WXC A;  2ZCX A;  2A61 A;  4UUT A;  3BR2 A;  4EJU A;  2NVX J;  2E71 A;  1RNL A;  2R3S A;  2M45 A;  2HXO A;  4RAF A;  2IGK A;  1W0U A;  2L7M P;  3LSR A;  1YG2 A;  1I5Z A;  2KT0 A;  1OLT A;  1YIT I;  4A5M A;  4L0Z B;  4IRV A;  1BI0 A;  2CFO A;  1WJF A;  3TP0 A;  3WTS C;  2FF4 A;  4CZZ A;  2ZKZ A;  5DAJ A;  3BOQ A;  2BZT A;  2LKP A;  5IP9 J;  2XF7 A;  4XRS A;  3DBL B;  3CMA I;  2M1B A;  2B1E A;  1YLF A;  4OD5 A;  3K1N A;  1NHA A;  2HVQ A;  2QKL B;  2HI3 A;  4HF1 A;  3JRF A;  3BLY A;  4PFP A;  3TQN A;  1T39 A;  2HPI A;  4C3J J;  3HTH A;  3DPL C;  1IN5 A;  3LSG A;  1FOX A;  3QYB A;  3SEZ A;  1Z05 A;  2KHM A;  5IT3 A;  1OYI A;  5HOD A;  4EQQ A;  3A2K A;  1HA8 A;  2Y75 A;  3LJL A;  2MAB A;  1SC7 A;  5ICG A;  2PEX A;  4OOI A;  1YW8 A;  3FXK A;  2MD0 A;  4CCK A;  2BY0 A;  3IV5 A;  3PSI A;  4ESF A;  3DU5 A;  3MCZ A;  1HC8 A; 
#chains in the Genus database with same CATH homology
 2LR8 A;  2XPU A;  4XRM A;  2ECC A;  1WH7 A;  4HNV A;  1ETY A;  4W97 A;  1QPI A;  5C4Y A;  4JX5 A;  3ZQC A;  4W1U A;  3HTA A;  5K7F A;  2NP5 A;  1MH4 A;  2UXO A;  3LSP A;  2FD5 A;  2E2H J;  4IHX A;  2NP3 A;  4AC0 A;  4JNN A;  4C3H J;  5EF6 A;  1ETO A;  3HEF A;  3GZI A;  2LD5 A;  1H89 C;  4JL3 A;  3SJM A;  2DA3 A;  5K7H A;  2EQR A;  2YU9 J;  4G12 A;  1XS9 A;  2KDZ A;  1TWG J;  4LOC A;  2QWT A;  3IUV A;  2AHQ A;  3QBM A;  1JKP C;  5EG0 B;  2G7S A;  2ZOY A;  4GCL A;  1RET A;  2LK2 A;  2R7Z J;  1CQT A;  3E7Q A;  1AHD P;  1ZQ3 P;  4GFL A;  4A3M J;  1QVT A;  2PZ9 A;  2Y31 A;  3B6C A;  3DCF A;  5CW8 A;  1T56 A;  3HGY A;  3BTJ A;  4ABZ A;  4B1R A;  4MK6 A;  2IAI A;  4BKX A;  1WI3 A;  2JK3 A;  2B63 J;  4A3B J;  2NS8 A;  4ME9 A;  2NVT J;  1GT0 C;  4UDS A;  1FIA A;  1K83 J;  3QQA A;  1A5J A;  4B4C A;  2H1K A;  2JA8 J;  2P81 A;  5M3M J;  3HOU J;  3HOW J;  3BG5 A;  3VIB A;  1U9O A;  4A93 J;  3PO2 J;  2CUF A;  5FKM A;  3MVP A;  4DYC A;  3HGG A;  3W6V A;  1R9T J;  3RZO J;  3BTC A;  2HOT A;  2IEK A;  1JJ6 C;  5K7Z A;  1H8A C;  1HDD C;  3G1L A;  1IV6 A;  4V2G A;  2Q24 A;  5IPA A;  1NTC A;  3S5R A;  2Y0S N;  4BBR J;  2YUS A;  3FK6 A;  1MBF A;  1XG1 A;  5F04 A;  2UXI A;  1UI5 A;  4UUS A;  5DTD A;  2K9Q A;  1Z0X A;  2MW8 A;  1D5Y A;  1B72 A;  1TWC J;  1AU7 A;  1IDZ A;  3QPL A;  3BT9 A;  3PAS A;  1U8B A;  2VKV A;  2QIB A;  5FLM J;  1U78 A;  2D6Y A;  4NN1 A;  2ZCN A;  2HKU A;  2DMT A;  4JYK A;  2NVQ J;  3T6N A;  4MXM A;  4I76 A;  3HOV J;  2X9D A;  3A02 A;  2R92 J;  2COB A;  1FEX A;  2JMW A;  2DA2 A;  4ACI A;  3JRE A;  3VW0 A;  2FBQ A;  1UHS A;  1OCP A;  1QRY A;  4L5E A;  2G7L A;  3PO3 J;  3B6A A;  3BG9 A;  4UUS B;  5H9T A;  1GV5 A;  5C3E J;  1BJZ A;  3FKI J;  1MBE A;  1JKQ C;  1JKO C;  1TWH J;  4QSH A;  1HLV A;  4GFK A;  4QTR A;  3S17 J;  5F08 A;  4FE4 A;  2WV1 A;  3ZOB A;  5D1R A;  1NK3 P;  3BNI A;  2ZB9 A;  5F27 A;  4B3A A;  1FTZ A;  4QIW N;  2Y2Z A;  2DA4 A;  2HQ5 A;  1RES A;  3GTM J;  1JTX A;  4M3G A;  3TW7 A;  3S2H J;  2LY9 A;  4BBS J;  2RHA A;  1JJ8 C;  5E3O A;  2GEN A;  2WB1 N;  2R5Y A;  1MNM C;  3RH2 A;  1QVU A;  4KWA A;  2YVE A;  3VVX A;  3VUQ A;  1HDP A;  2IU5 A;  5F0C A;  2VI6 A;  5JLX A;  1ZR2 A;  3IH4 A;  1MBK A;  1AKH A;  1APL C;  2EBI A;  2O9L A;  3Q0U A;  4ICH A;  2FQ4 A;  4AC6 A;  2WUI A;  4MLO A;  4MFD A;  3RQI A;  1POG A;  5FKN A;  2HOA A;  1Y1V J;  1JUM A;  3SFI A;  5M5Y J;  1LE8 A;  2FX0 A;  2R5Y B;  3F0C A;  5IOZ A;  3DEW A;  3Q0W A;  3HIM A;  1Z77 A;  4M6V A;  3QPS A;  3GTL J;  3GBG A;  1AKH B;  2ZCM A;  2LVS A;  2GLO A;  5GPC A;  2PMZ N;  4HKU A;  2NOG A;  1OJL A;  5CXG A;  5IP7 J;  2CUE A;  4XID A;  3BHQ A;  5AQC A;  5FMP A;  1F43 A;  1Y1W J;  2UXU A;  2VUM J;  4A3E J;  3TED A;  2HXI A;  2OER A;  1TWA J;  2DMN A;  3S2D J;  3S16 J;  4XK4 A;  2NS7 A;  3I4M J;  2E2J J;  3A01 A;  5FGL A;  4CYC A;  1ETK A;  5E3N A;  3V6G A;  2K9N A;  3HM5 A;  1E3O C;  1I6H J;  4A69 C;  2MSY A;  2DJN A;  4A3F J;  2X6O A;  3H0G J;  3BCG A;  2NX4 A;  2M34 A;  3OSF A;  1T33 A;  3S1Q J;  3VOK A;  4AYB N;  1F36 A;  3ZQG A;  1IC8 A;  4JP0 A;  3G7R A;  3E7L A;  2M2E A;  4NDL A;  3JR9 A;  1YRN A;  3NAU A;  2X48 A;  3LNQ A;  1P7J A;  1PUF A;  3GTQ J;  5C4X J;  2Y9Z A;  3KKD A;  2XGE A;  4X1E A;  4DYQ A;  1BW6 A;  4S0H B;  3NI7 A;  1LFU P;  2DMU A;  5IOY A;  1ETW A;  2XPV A;  3QKX A;  1VND A;  3H3V K;  2JA5 J;  2VPR A;  2DN0 A;  3NXC A;  2V57 A;  5J1R A;  3HBL A;  2YVH A;  3I4N J;  2EZL A;  1ZGW A;  4A3K J;  1BW5 A;  1UG2 A;  2DA6 A;  4DW6 A;  4IHW A;  4L62 A;  2REK A;  2XPW A;  4J19 A;  1TWF J;  2ME6 A;  5GP9 A;  2LKX A;  1MSE C;  1ORK A;  2EZH A;  4V2F A;  1YRN B;  3BRU A;  4A3G J;  1DU0 A;  1HOM A;  1PUF B;  1GVD A;  4M3E A;  2YS9 A;  2HYT A;  2R93 J;  1ETQ A;  4RDU A;  2Y30 A;  4AUX A;  2PBX A;  3LWJ A;  4GCK A;  3IH3 A;  4DZJ A;  2M0C A;  5HSZ A;  5EZG A;  3LHQ A;  2CQX A;  3WHC A;  3S1N J;  2L9R A;  2LP0 A;  1I50 J;  2E1O A;  4A3C J;  2XB5 A;  2NVY J;  1HF0 A;  3CCY A;  1B8I A;  3BTL A;  3GTK J;  2ZOZ A;  2LFB A;  3K2A A;  2HDD A;  5CXI A;  3COL A;  4X6A J;  3NRG A;  5D19 A;  2IBD A;  3BR3 A;  3GTJ J;  4DYR A;  5IP6 A;  2DG8 A;  4D5C A;  2EZI A;  3G1O A;  2K9S A;  1GDT A;  2L0K A;  4C2M J;  4A3L J;  1B72 B;  2F07 A;  3S1M J;  1RR7 A;  2G7G A;  3MNL A;  3LOC A;  4JX4 A;  2ID3 A;  1I3Q J;  1JTY A;  3HB9 A;  4Y52 J;  4FCY A;  3EUP A;  1K61 A;  2R0Q C;  2JA6 J;  2GBY A;  3RD3 A;  4RBO A;  3BR6 A;  3S1R J;  2ID6 A;  3FRQ A;  5D18 A;  1RKT A;  3FK7 A;  3D1N I;  5F0F A;  3HTJ A;  5M5W J;  1G2H A;  2R5Z A;  1JUS A;  3L1P A;  1WGX A;  5EZH A;  1OCT C;  3G56 A;  4IHY A;  3SDG A;  3RZD J;  3KZ9 A;  5EEA A;  5DS9 A;  1RPW A;  4IEJ A;  3GEU A;  3O60 A;  3IH2 A;  2CU7 A;  3KNW A;  2HYJ A;  5BNG A;  2RAE A;  1IJW C;  3TW6 A;  2MG4 A;  5J1Y A;  1ETX A;  2XRL A;  2JWT A;  5IYC J;  1IUF A;  1IDY A;  3BQY A;  1SFO J;  3O8H A;  3OSG A;  1OFC X;  4D5F A;  1MH3 A;  2E19 A;  4FE7 A;  3HOY J;  3NAR A;  4MFE A;  3GTO J;  2L7Z A;  2QOP A;  3VOX A;  1VFC A;  4XRS G;  1GV2 A;  2CRG A;  3Q0V A;  1LFB A;  1JT0 A;  4JKZ A;  1JT6 A;  1FJL A;  3CMY A;  2GUH A;  2DTZ A;  4D7M A;  3K7A J;  2O7T A;  1BA5 A;  5JLW A;  1MBJ A;  1ZKG A;  3JRA A;  4I6Z A;  1WPK A;  3VVY A;  2W53 A;  1X58 A;  5F1J A;  4C3I J;  2DA7 A;  5EDN A;  1MBH A;  2WGB A;  3VW1 A;  3Q3S A;  5EGO A;  2ME0 A;  5FKL A;  3JRC A;  1LE8 B;  2UXH A;  2ECB A;  2AO9 A;  5F0H A;  3KKC A;  2XDN A;  3PPB A;  1BL0 A;  2L7F P;  1Q1V A;  3S14 J;  5EFY A;  5M5X J;  2DMP A;  3ZQF A;  5FKK A;  5HBU A;  3BR5 A;  2OPT A;  2XSD C;  3JRG A;  2GM4 A;  3DPJ A;  2G0E A;  5E3L A;  3BR1 A;  2G3B A;  4BXX J;  3ON4 A;  1ZR4 A;  2MGQ A;  3JRB A;  2QKO A;  4A3I J;  3M4O J;  4NEL A;  5FKO A;  3UKG A;  3G1M A;  2E2I J;  2DMQ A;  5J1U A;  4A3J J;  1A6I A;  1S7E A;  5EGO B;  3M3Y J;  2O7O A;  2Y9Y A;  4XIC A;  1HCR A;  3AQS A;  2O8K A;  2H8R A;  3A01 B;  1W0T A;  3VW2 A;  2DG7 A;  4CYC B;  3EGQ A;  1ITY A;  3VP5 A;  2LLK A;  1VF9 A;  5C4J J;  4PXI A;  4M3F A;  2RAS A;  5IYB J;  3ZQL A;  2OI8 A;  3CWR A;  1SGM A;  2K40 A;  2CJJ A;  4MIM A;  4D7N A;  3JRH A;  4JX6 A;  3BR0 A;  2QCO A;  3HOX J;  1WH5 A;  1XC5 A;  3CRJ A;  1P7I A;  3A03 A;  1IGN A;  3LSJ A;  3ZQH A;  2QTQ A;  2EZK A;  2UXP A;  3HKZ N;  1UI6 A;  1ENH A;  3BTI A;  2M8G X;  3AQT A;  3F1B A;  4M3B A;  3ANP A;  1X2M A;  5GPA A;  4IHV A;  1ETV A;  2EH3 A;  2LTP A;  3VVZ A;  5J3L A;  4BY7 J;  2XB0 X;  3C2B A;  5EYR A;  5C44 J;  5FHP A;  4BY1 J;  4FTH A;  4MO7 A;  3B81 A;  3JRI A;  4A3D J;  1FTT A;  1IG7 A;  5FJ8 J;  3FIW A;  1TC3 C;  2XGC A;  3PM1 A;  3JSJ A;  3GTP J;  2JN6 A;  3RKQ A;  2VKE A;  4GCT A;  4Y7N J;  3OIO A;  1X2N A;  3MKL A;  2N8G A;  1VI0 A;  2CQQ A;  3ZQI A;  1O4X A;  4GFB A;  2XGD A;  3CQZ J;  3HDD A;  5E3M A;  3WHB A;  2I10 A;  1JGG A;  2TRT A;  2HOS A;  2ZCX A;  1B8I B;  3NPI A;  4UUT A;  4CGR A;  1MSF C;  3BR2 A;  2NVX J;  1SAN A;  3HE0 A;  3CDL A;  4DZP A;  3O8G A;  3P9T A;  2HXO A;  1IRZ A;  3V78 A;  1W0U A;  2L7M P;  3HTI A;  3JRD A;  3LSR A;  5IYD J;  5FLV A;  2KT0 A;  1WCM J;  1DU6 A;  3C07 A;  2ELK A;  2M9H A;  4EEF G;  2OF7 A;  3BQZ A;  3TP3 A;  5K58 A;  3TP0 A;  1ZTR A;  1H88 C;  3OOU A;  2JJ7 A;  2JA7 J;  9ANT A;  5DAJ A;  3HOZ J;  5IP9 J;  2WAQ N;  2R5Z B;  4XRS A;  2GFN A;  3ANG A;  1NK2 P;  1EF4 A;  1GUU A;  2TCT A;  2FJ1 A;  3ON2 A;  2HI3 A;  4M3D A;  3JRF A;  1RKW A;  1MBG A;  4C3J J;  3HTH A;  4YZE A;  3LSG A;  2DA5 A;  3BJB A;  3S15 J;  3BG3 A;  1FIP A;  3CJD A;  5HOD A;  2QF7 A;  3FIS A;  2DA1 A;  1JUP A;  2W48 A;  5HAW A;  3VPR A;  1U9N A;  3LJL A;  4FIS A;  2D5V A;  3IV5 A;  5M3F J;  1ZK8 A;  5EG0 A;  3GTG J;  4AF5 A;  1UMQ A;  1JKR C;  3NNR A;  3MN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...