2G7GA

The crystal structure of the putative transcriptional regulator rha04620 from rhodococcus sp. rha1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
197
structure length
197
Chain Sequence
LDRERIAEAALELVDRDGDFRMPDLARHLNVQVSSIYHHAKGRAAVVELVRHRVVREIDGSAFERLPWDEAFSEWARSYRAAFSRHPTAIRLLATETVRDPGSLSVYHSAAAGLRGAGFPDDHIMAVITAAENFLLGAALDAAAPEVMIEADSTTTDDALTRALAAAPRGPERAEQAFELGLAALLAGFHHLLQECG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Rha04620, Putative Transcriptional Regulator
publication title The Crystal Structure of the Putative Transcriptional Regulator Rha04620 from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
total genus 71
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2g7gA00
5GPAA 2W53A 2JK3A 4B3AA 5FHPA 2Q24A 4ME9A 2OERA 2ZOYA 4GFKA 2FBQA 3IUVA 3KKCA 3BTCA 5D19A 4V2GA 3VVYA 1UI6A 2RHAA 1Z0XA 2NS7A 5FKMA 3LOCA 3WHBA 2VKVA 5K7ZA 3WHCA 2HYTA 5F0FA 3B6AA 4D5FA 5J3LA 2X9DA 3VW2A 3CCYA 4M3GA 2ID3A 3EGQA 2IBDA 3DEWA 2XPWA 5J1YA 3KZ9A 5IOZA 3GEUA 4AF5A 5F0CA 2UXHA 2X6OA 2D6YA 4GCLA 3HTIA 3CDLA 2OF7A 4X1EA 4AUXA 3ZQLA 4GFLA 4M3BA 3SFIA 3BR0A 2QIBA 2GUHA 3B6CA 5HBUA 2ZCMA 3BTJA 1T33A 5DAJA 2ZCXA 3VUQA 2REKA 5FKLA 3V78A 2OPTA 5IPAA 2HXOA 2XDNA 2ZCNA 2XB5A 2FX0A 3Q0VA 4ICHA 2FJ1A 3Q0WA 3ANGA 2QWTA 3BCGA 4UDSA 3C2BA 3E7QA 5D18A 4ACIA 2F07A 3FK7A 2DTZA 3HTJA 2XPVA 5J1UA 3LHQA 2Y30A 4I76A 2QOPA 1JTYA 3AQTA 2QKOA 3ON4A 3TP3A 3BR2A 3ZQIA 2WUIA 3G56A 2HQ5A 4JYKA 1BJZA 1A6IA 4NN1A 3ZQGA 2YVHA 3CJDA 2RASA 2O7TA 3VIBA 3LSPA 3MVPA 2NX4A 3HTAA 4NELA 3BTLA 3Q3SA 3CWRA 3CRJA 3G1OA 2UXOA 2UXUA 2G7GA 3NNRA 2Y2ZA 3VVZA 3C07A 4GCTA 2NP5A 2IU5A 1JTXA 2HYJA 3G7RA 3FIWA 2ID6A 4I6ZA 2NS8A 3BT9A 5FKKA 3ON2A 3QPSA 1T56A 4AC6A 2ZB9A 2FQ4A 3VPRA 2UXIA 3BR5A 4W1UA 3VP5A 3BTIA 3BQYA 3AQSA 4JL3A 4XK4A 4M3FA 3MNLA 3F0CA 3RD3A 3LSRA 3QBMA 4MXMA 3NRGA 1U9NA 3COLA 2WGBA 2QCOA 1JUMA 1JT6A 3S5RA 2QTQA 4B1RA 5EZHA 4MO7A 4HKUA 4ABZA 2G3BA 2WV1A 5F0HA 5H9TA 2FD5A 4MK6A 5K7FA 3FK6A 2XRLA 5K7HA 3HGGA 2V57A 3BQZA 1ZK8A 3QKXA 3NI7A 3P9TA 3T6NA 5IP6A 5HAWA 3LJLA 3IH3A 5EYRA 2XPUA 2TRTA 2PZ9A 4GCKA 2Y31A 5IOYA 3NPIA 3IH4A 3ZQFA 2GBYA 2GFNA 2VKEA 2TCTA 3VVXA 3BR1A 3PASA 2UXPA 2XGCA 4L62A 3HE0A 3KKDA 5AQCA 3VW0A 3BR6A 2IEKA 3QPLA 3G1MA 5GP9A 5F04A 1RPWA 5CW8A 2RAEA 1JUPA 3F1BA 3BHQA 2EH3A 5FKOA 3G1LA 3O8HA 3VOKA 3BRUA 2NP3A 4JKZA 3BJBA 5C4YA 3JSJA 2IAIA 2PBXA 3BR3A 3GZIA 2VPRA 1SGMA 1QVUA 4D5CA 3HGYA 1JUSA 3ANPA 4PXIA 3LSJA 4KWAA 3TP0A 4YZEA 3PM1A 1VI0A 2HKUA 5CXIA 1RKWA 5F27A 2G0EA 2I10A 2DG8A 1QVTA 3BNIA 3HTHA 2HXIA 5HSZA 5F08A 2G7LA 5CXGA 2YVEA 1QPIA 1ZKGA 3FRQA 5K58A 1U9OA 3VOXA 5F1JA 3ZQHA 2GENA 3NXCA 4G12A 1JT0A 1RKTA 2XGEA 2OI8A 3PPBA 3VW1A 4D7MA 3SDGA 4M3DA 4V2FA 1UI5A 4AC0A 3DPJA 5J1RA 5FMPA 5EFYA 5FKNA 3HIMA 3KNWA 2DG7A 4W97A 2JJ7A 3O60A 5EZGA 3LWJA 2XGDA 5GPCA 3Q0UA 5FGLA 4JNNA 4D7NA 4CGRA 5D1RA 3DCFA 3RH2A 2ZOZA 1ORKA 4DW6A 1Z77A 3IH2A 3EUPA 2G7SA 2O7OA 4M3EA 3O8GA 3QQAA 3V6GA 3B81A
chains in the Genus database with same CATH superfamily
5GPAA 4C2MA 2W53A 2JK3A 4B3AA 5FHPA 2Q24A 4ME9A 2OERA 2ZOYA 4GFKA 2FBQA 3IUVA 3KKCA 3BTCA 5D19A 4V2GA 3VVYA 1UI6A 2RHAA 1Z0XA 2NS7A 5FKMA 3K8PC 3LOCA 3WHBA 2VKVA 5K7ZA 3WHCA 2R7VA 2HYTA 5F0FA 3B6AA 4D5FA 5J3LA 2X9DA 3VW2A 3CCYA 4M3GA 3DU5A 2ID3A 3EGQA 2IBDA 3DEWA 2XPWA 5J1YA 3KZ9A 5IOZA 3GEUA 4AF5A 5F0CA 2UXHA 2X6OA 2D6YA 2FJI1 3NS4A 4GCLA 3HTIA 3CDLA 2OF7A 4X1EA 4AUXA 3ZQLA 4GFLA 4M3BA 3SFIA 3BR0A 2QIBA 2GUHA 3B6CA 5HBUA 2ZCMA 3BTJA 1T33A 5DAJA 2ZCXA 3VUQA 2REKA 3KYLA 5FKLA 3V78A 2OPTA 3VTIA 5IPAA 2HXOA 4IRVA 2XDNA 2ZCNA 2XB5A 2FX0A 3Q0VA 4ICHA 2FJ1A 3Q0WA 3ANGA 2QWTA 3BCGA 4UDSA 3C2BA 4DVYP 3E7QA 5D18A 4ACIA 2F07A 3FK7A 2DTZA 3HTJA 2XPVA 5J1UA 2ZY9A 3LHQA 2Y30A 4I76A 2QOPA 1JTYA 3AQTA 2QKOA 3ON4A 3TP3A 3BR2A 3ZQIA 2WUIA 3G56A 2HQ5A 4JYKA 1BJZA 1A6IA 4NN1A 3ZQGA 2YVHA 3CJDA 2RASA 2O7TA 3FHNA 3VIBA 3LSPA 4OD4A 3MVPA 2NX4A 2A2FX 3HTAA 4NELA 3BTLA 3Q3SA 3CWRA 3CRJA 3G1OA 2UXOA 2UXUA 2G7GA 3NNRA 2Y2ZA 3VVZA 3C07A 4GCTA 2NP5A 2IU5A 1JTXA 2R7XA 2HYJA 3G7RA 3FIWA 2ID6A 4I6ZA 2NS8A 3BT9A 2R7RA 5FKKA 3ON2A 3QPSA 1T56A 4AC6A 2ZB9A 2FQ4A 3VPRA 2UXIA 3BR5A 4W1UA 3VP5A 3BTIA 4OD5A 3BQYA 3AQSA 4JL3A 2R7UA 4XK4A 4M3FA 3MNLA 3F0CA 3RD3A 3LSRA 3QBMA 4MXMA 2B3WA 5CQGA 3NRGA 1U9NA 3COLA 2WGBA 2QCOA 1JUMA 1JT6A 3S5RA 2QTQA 4B1RA 5EZHA 4MO7A 4HKUA 4ABZA 2G3BA 2WV1A 5F0HA 5H9TA 2FD5A 4MK6A 5K7FA 3FK6A 2XRLA 5K7HA 3HGGA 2V57A 3BQZA 1ZK8A 3QKXA 3NI7A 3P9TA 3T6NA 5IP6A 5HAWA 3LJLA 3IH3A 5EYRA 2XPUA 2TRTA 2PZ9A 4GCKA 2Y31A 5IOYA 3NPIA 3DU6A 3IH4A 3ZQFA 3SWHA 2GBYA 2GFNA 2VKEA 2TCTA 3VVXA 3BR1A 3PASA 2UXPA 2XGCA 4L62A 3HE0A 2R7WA 3KKDA 2YVXA 5AQCA 3VW0A 3BR6A 2B1EA 2IEKA 3QPLA 3G1MA 5GP9A 5F04A 1RPWA 5CW8A 2RAEA 1JUPA 3F1BA 3BHQA 2EH3A 5FKOA 3G1LA 3O8HA 3VOKA 3BRUA 2NP3A 4JKZA 3BJBA 5C4YA 3JSJA 2IAIA 4U9NA 2PBXA 3BR3A 3GZIA 2VPRA 1SGMA 1QVUA 4D5CA 3HGYA 1JUSA 3ANPA 4PXIA 3LSJA 4KWAA 3TP0A 4YZEA 3PM1A 4U9LA 1VI0A 2HKUA 5CXIA 1RKWA 5F27A 2G0EA 2I10A 2DG8A 1QVTA 3BNIA 3HTHA 2HXIA 5HSZA 5F08A 2G7LA 5CXGA 2YVEA 1QPIA 1ZKGA 3FRQA 5K58A 1U9OA 3VOXA 5F1JA 3ZQHA 2GENA 3NXCA 4G12A 1JT0A 1RKTA 2XGEA 2OI8A 3PPBA 3VW1A 4D7MA 3SDGA 4M3DA 4V2FA 1UI5A 4AC0A 3DPJA 2R7SA 5J1RA 5FMPA 5EFYA 5FKNA 3HIMA 3KNWA 2DG7A 2R7QA 4W97A 2JJ7A 3O60A 5EZGA 3LWJA 2XGDA 5GPCA 3Q0UA 5FGLA 4JNNA 4D7NA 4CGRA 5D1RA 3DCFA 3RH2A 2ZOZA 1ORKA 4DW6A 2PFVA 1Z77A 3IH2A 3EUPA 4WIBA 2R7OA 2G7SA 2O7OA 4M3EA 3O8GA 2R7TA 3QQAA 3V6GA 3B81A
chains in the Genus database with same CATH topology
5GPAA 2W53A 2JK3A 4B3AA 5FHPA 2Q24A 4ME9A 2OERA 2ZOYA 4GFKA 2FBQA 3IUVA 3KKCA 3BTCA 5D19A 4V2GA 3VVYA 1UI6A 2RHAA 1Z0XA 2NS7A 5FKMA 3LOCA 3WHBA 2VKVA 5K7ZA 3WHCA 2HYTA 5F0FA 3B6AA 4D5FA 5J3LA 2X9DA 3VW2A 3CCYA 4M3GA 2ID3A 3EGQA 2IBDA 3DEWA 2XPWA 5J1YA 3KZ9A 5IOZA 3GEUA 4AF5A 5F0CA 2UXHA 2X6OA 2D6YA 4GCLA 3HTIA 3CDLA 2OF7A 4X1EA 4AUXA 3ZQLA 4GFLA 4M3BA 3SFIA 3BR0A 2QIBA 2GUHA 3B6CA 5HBUA 2ZCMA 3BTJA 1T33A 5DAJA 2ZCXA 3VUQA 2REKA 5FKLA 3V78A 2OPTA 5IPAA 2HXOA 2XDNA 2ZCNA 2XB5A 2FX0A 3Q0VA 4ICHA 2FJ1A 3Q0WA 3ANGA 2QWTA 3BCGA 4UDSA 3C2BA 3E7QA 5D18A 4ACIA 2F07A 3FK7A 2DTZA 3HTJA 2XPVA 5J1UA 3LHQA 2Y30A 4I76A 2QOPA 1JTYA 3AQTA 2QKOA 3ON4A 3TP3A 3BR2A 3ZQIA 2WUIA 3G56A 2HQ5A 4JYKA 1BJZA 1A6IA 4NN1A 3ZQGA 2YVHA 3CJDA 2RASA 2O7TA 3VIBA 3LSPA 3MVPA 2NX4A 3HTAA 4NELA 3BTLA 3Q3SA 3CWRA 3CRJA 3G1OA 2UXOA 2UXUA 2G7GA 3NNRA 2Y2ZA 3VVZA 3C07A 4GCTA 2NP5A 2IU5A 1JTXA 2HYJA 3G7RA 3FIWA 2ID6A 4I6ZA 2NS8A 3BT9A 5FKKA 3ON2A 3QPSA 1T56A 4AC6A 2ZB9A 2FQ4A 3VPRA 2UXIA 3BR5A 4W1UA 3VP5A 3BTIA 3BQYA 3AQSA 4JL3A 4XK4A 4M3FA 3MNLA 3F0CA 3RD3A 3LSRA 3QBMA 4MXMA 3NRGA 1U9NA 3COLA 2WGBA 2QCOA 1JUMA 1JT6A 3S5RA 2QTQA 4B1RA 5EZHA 4MO7A 4HKUA 4ABZA 2G3BA 2WV1A 5F0HA 5H9TA 2FD5A 4MK6A 5K7FA 3FK6A 2XRLA 5K7HA 3HGGA 2V57A 3BQZA 1ZK8A 3QKXA 3NI7A 3P9TA 3T6NA 5IP6A 5HAWA 3LJLA 3IH3A 5EYRA 2XPUA 2TRTA 2PZ9A 4GCKA 2Y31A 5IOYA 3NPIA 3IH4A 3ZQFA 2GBYA 2GFNA 2VKEA 2TCTA 3VVXA 3BR1A 3PASA 2UXPA 2XGCA 4L62A 3HE0A 3KKDA 5AQCA 3VW0A 3BR6A 2IEKA 3QPLA 3G1MA 5GP9A 5F04A 1RPWA 5CW8A 2RAEA 1JUPA 3F1BA 3BHQA 2EH3A 5FKOA 3G1LA 3O8HA 3VOKA 3BRUA 2NP3A 4JKZA 3BJBA 5C4YA 3JSJA 2IAIA 2PBXA 3BR3A 3GZIA 2VPRA 1SGMA 1QVUA 4D5CA 3HGYA 1JUSA 3ANPA 4PXIA 3LSJA 4KWAA 3TP0A 4YZEA 3PM1A 1VI0A 2HKUA 5CXIA 1RKWA 5F27A 2G0EA 2I10A 2DG8A 1QVTA 3BNIA 3HTHA 2HXIA 5HSZA 5F08A 2G7LA 5CXGA 2YVEA 1QPIA 1ZKGA 3FRQA 5K58A 1U9OA 3VOXA 5F1JA 3ZQHA 2GENA 3NXCA 4G12A 1JT0A 1RKTA 2XGEA 2OI8A 3PPBA 3VW1A 4D7MA 3SDGA 4M3DA 4V2FA 1UI5A 4AC0A 3DPJA 5J1RA 5FMPA 5EFYA 5FKNA 3HIMA 3KNWA 2DG7A 4W97A 2JJ7A 3O60A 5EZGA 3LWJA 2XGDA 5GPCA 3Q0UA 5FGLA 4JNNA 4D7NA 4CGRA 5D1RA 3DCFA 3RH2A 2ZOZA 1ORKA 4DW6A 1Z77A 3IH2A 3EUPA 2G7SA 2O7OA 4M3EA 3O8GA 3QQAA 3V6GA 3B81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GPA A;  2W53 A;  2JK3 A;  4B3A A;  5FHP A;  2Q24 A;  4ME9 A;  2OER A;  2ZOY A;  4GFK A;  2FBQ A;  3IUV A;  3KKC A;  3BTC A;  5D19 A;  4V2G A;  3VVY A;  1UI6 A;  2RHA A;  1Z0X A;  2NS7 A;  5FKM A;  3LOC A;  3WHB A;  2VKV A;  5K7Z A;  3WHC A;  2HYT A;  5F0F A;  3B6A A;  4D5F A;  5J3L A;  2X9D A;  3VW2 A;  3CCY A;  4M3G A;  2ID3 A;  3EGQ A;  2IBD A;  3DEW A;  2XPW A;  5J1Y A;  3KZ9 A;  5IOZ A;  3GEU A;  4AF5 A;  5F0C A;  2UXH A;  2X6O A;  2D6Y A;  4GCL A;  3HTI A;  3CDL A;  2OF7 A;  4X1E A;  4AUX A;  3ZQL A;  4GFL A;  4M3B A;  3SFI A;  3BR0 A;  2QIB A;  2GUH A;  3B6C A;  5HBU A;  2ZCM A;  3BTJ A;  1T33 A;  5DAJ A;  2ZCX A;  3VUQ A;  2REK A;  5FKL A;  3V78 A;  2OPT A;  5IPA A;  2HXO A;  2XDN A;  2ZCN A;  2XB5 A;  2FX0 A;  3Q0V A;  4ICH A;  2FJ1 A;  3Q0W A;  3ANG A;  2QWT A;  3BCG A;  4UDS A;  3C2B A;  3E7Q A;  5D18 A;  4ACI A;  2F07 A;  3FK7 A;  2DTZ A;  3HTJ A;  2XPV A;  5J1U A;  3LHQ A;  2Y30 A;  4I76 A;  2QOP A;  1JTY A;  3AQT A;  2QKO A;  3ON4 A;  3TP3 A;  3BR2 A;  3ZQI A;  2WUI A;  3G56 A;  2HQ5 A;  4JYK A;  1BJZ A;  1A6I A;  4NN1 A;  3ZQG A;  2YVH A;  3CJD A;  2RAS A;  2O7T A;  3VIB A;  3LSP A;  3MVP A;  2NX4 A;  3HTA A;  4NEL A;  3BTL A;  3Q3S A;  3CWR A;  3CRJ A;  3G1O A;  2UXO A;  2UXU A;  2G7G A;  3NNR A;  2Y2Z A;  3VVZ A;  3C07 A;  4GCT A;  2NP5 A;  2IU5 A;  1JTX A;  2HYJ A;  3G7R A;  3FIW A;  2ID6 A;  4I6Z A;  2NS8 A;  3BT9 A;  5FKK A;  3ON2 A;  3QPS A;  1T56 A;  4AC6 A;  2ZB9 A;  2FQ4 A;  3VPR A;  2UXI A;  3BR5 A;  4W1U A;  3VP5 A;  3BTI A;  3BQY A;  3AQS A;  4JL3 A;  4XK4 A;  4M3F A;  3MNL A;  3F0C A;  3RD3 A;  3LSR A;  3QBM A;  4MXM A;  3NRG A;  1U9N A;  3COL A;  2WGB A;  2QCO A;  1JUM A;  1JT6 A;  3S5R A;  2QTQ A;  4B1R A;  5EZH A;  4MO7 A;  4HKU A;  4ABZ A;  2G3B A;  2WV1 A;  5F0H A;  5H9T A;  2FD5 A;  4MK6 A;  5K7F A;  3FK6 A;  2XRL A;  5K7H A;  3HGG A;  2V57 A;  3BQZ A;  1ZK8 A;  3QKX A;  3NI7 A;  3P9T A;  3T6N A;  5IP6 A;  5HAW A;  3LJL A;  3IH3 A;  5EYR A;  2XPU A;  2TRT A;  2PZ9 A;  4GCK A;  2Y31 A;  5IOY A;  3NPI A;  3IH4 A;  3ZQF A;  2GBY A;  2GFN A;  2VKE A;  2TCT A;  3VVX A;  3BR1 A;  3PAS A;  2UXP A;  2XGC A;  4L62 A;  3HE0 A;  3KKD A;  5AQC A;  3VW0 A;  3BR6 A;  2IEK A;  3QPL A;  3G1M A;  5GP9 A;  5F04 A;  1RPW A;  5CW8 A;  2RAE A;  1JUP A;  3F1B A;  3BHQ A;  2EH3 A;  5FKO A;  3G1L A;  3O8H A;  3VOK A;  3BRU A;  2NP3 A;  4JKZ A;  3BJB A;  5C4Y A;  3JSJ A;  2IAI A;  2PBX A;  3BR3 A;  3GZI A;  2VPR A;  1SGM A;  1QVU A;  4D5C A;  3HGY A;  1JUS A;  3ANP A;  4PXI A;  3LSJ A;  4KWA A;  3TP0 A;  4YZE A;  3PM1 A;  1VI0 A;  2HKU A;  5CXI A;  1RKW A;  5F27 A;  2G0E A;  2I10 A;  2DG8 A;  1QVT A;  3BNI A;  3HTH A;  2HXI A;  5HSZ A;  5F08 A;  2G7L A;  5CXG A;  2YVE A;  1QPI A;  1ZKG A;  3FRQ A;  5K58 A;  1U9O A;  3VOX A;  5F1J A;  3ZQH A;  2GEN A;  3NXC A;  4G12 A;  1JT0 A;  1RKT A;  2XGE A;  2OI8 A;  3PPB A;  3VW1 A;  4D7M A;  3SDG A;  4M3D A;  4V2F A;  1UI5 A;  4AC0 A;  3DPJ A;  5J1R A;  5FMP A;  5EFY A;  5FKN A;  3HIM A;  3KNW A;  2DG7 A;  4W97 A;  2JJ7 A;  3O60 A;  5EZG A;  3LWJ A;  2XGD A;  5GPC A;  3Q0U A;  5FGL A;  4JNN A;  4D7N A;  4CGR A;  5D1R A;  3DCF A;  3RH2 A;  2ZOZ A;  1ORK A;  4DW6 A;  1Z77 A;  3IH2 A;  3EUP A;  2G7S A;  2O7O A;  4M3E A;  3O8G A;  3QQA A;  3V6G A;  3B81 A; 
#chains in the Genus database with same CATH topology
 5GPA A;  4C2M A;  2W53 A;  2JK3 A;  4B3A A;  5FHP A;  2Q24 A;  4ME9 A;  2OER A;  2ZOY A;  4GFK A;  2FBQ A;  3IUV A;  3KKC A;  3BTC A;  5D19 A;  4V2G A;  3VVY A;  1UI6 A;  2RHA A;  1Z0X A;  2NS7 A;  5FKM A;  3K8P C;  3LOC A;  3WHB A;  2VKV A;  5K7Z A;  3WHC A;  2R7V A;  2HYT A;  5F0F A;  3B6A A;  4D5F A;  5J3L A;  2X9D A;  3VW2 A;  3CCY A;  4M3G A;  3DU5 A;  2ID3 A;  3EGQ A;  2IBD A;  3DEW A;  2XPW A;  5J1Y A;  3KZ9 A;  5IOZ A;  3GEU A;  4AF5 A;  5F0C A;  2UXH A;  2X6O A;  2D6Y A;  2FJI 1;  3NS4 A;  4GCL A;  3HTI A;  3CDL A;  2OF7 A;  4X1E A;  4AUX A;  3ZQL A;  4GFL A;  4M3B A;  3SFI A;  3BR0 A;  2QIB A;  2GUH A;  3B6C A;  5HBU A;  2ZCM A;  3BTJ A;  1T33 A;  5DAJ A;  2ZCX A;  3VUQ A;  2REK A;  3KYL A;  5FKL A;  3V78 A;  2OPT A;  3VTI A;  5IPA A;  2HXO A;  4IRV A;  2XDN A;  2ZCN A;  2XB5 A;  2FX0 A;  3Q0V A;  4ICH A;  2FJ1 A;  3Q0W A;  3ANG A;  2QWT A;  3BCG A;  4UDS A;  3C2B A;  4DVY P;  3E7Q A;  5D18 A;  4ACI A;  2F07 A;  3FK7 A;  2DTZ A;  3HTJ A;  2XPV A;  5J1U A;  2ZY9 A;  3LHQ A;  2Y30 A;  4I76 A;  2QOP A;  1JTY A;  3AQT A;  2QKO A;  3ON4 A;  3TP3 A;  3BR2 A;  3ZQI A;  2WUI A;  3G56 A;  2HQ5 A;  4JYK A;  1BJZ A;  1A6I A;  4NN1 A;  3ZQG A;  2YVH A;  3CJD A;  2RAS A;  2O7T A;  3FHN A;  3VIB A;  3LSP A;  4OD4 A;  3MVP A;  2NX4 A;  2A2F X;  3HTA A;  4NEL A;  3BTL A;  3Q3S A;  3CWR A;  3CRJ A;  3G1O A;  2UXO A;  2UXU A;  2G7G A;  3NNR A;  2Y2Z A;  3VVZ A;  3C07 A;  4GCT A;  2NP5 A;  2IU5 A;  1JTX A;  2R7X A;  2HYJ A;  3G7R A;  3FIW A;  2ID6 A;  4I6Z A;  2NS8 A;  3BT9 A;  2R7R A;  5FKK A;  3ON2 A;  3QPS A;  1T56 A;  4AC6 A;  2ZB9 A;  2FQ4 A;  3VPR A;  2UXI A;  3BR5 A;  4W1U A;  3VP5 A;  3BTI A;  4OD5 A;  3BQY A;  3AQS A;  4JL3 A;  2R7U A;  4XK4 A;  4M3F A;  3MNL A;  3F0C A;  3RD3 A;  3LSR A;  3QBM A;  4MXM A;  2B3W A;  5CQG A;  3NRG A;  1U9N A;  3COL A;  2WGB A;  2QCO A;  1JUM A;  1JT6 A;  3S5R A;  2QTQ A;  4B1R A;  5EZH A;  4MO7 A;  4HKU A;  4ABZ A;  2G3B A;  2WV1 A;  5F0H A;  5H9T A;  2FD5 A;  4MK6 A;  5K7F A;  3FK6 A;  2XRL A;  5K7H A;  3HGG A;  2V57 A;  3BQZ A;  1ZK8 A;  3QKX A;  3NI7 A;  3P9T A;  3T6N A;  5IP6 A;  5HAW A;  3LJL A;  3IH3 A;  5EYR A;  2XPU A;  2TRT A;  2PZ9 A;  4GCK A;  2Y31 A;  5IOY A;  3NPI A;  3DU6 A;  3IH4 A;  3ZQF A;  3SWH A;  2GBY A;  2GFN A;  2VKE A;  2TCT A;  3VVX A;  3BR1 A;  3PAS A;  2UXP A;  2XGC A;  4L62 A;  3HE0 A;  2R7W A;  3KKD A;  2YVX A;  5AQC A;  3VW0 A;  3BR6 A;  2B1E A;  2IEK A;  3QPL A;  3G1M A;  5GP9 A;  5F04 A;  1RPW A;  5CW8 A;  2RAE A;  1JUP A;  3F1B A;  3BHQ A;  2EH3 A;  5FKO A;  3G1L A;  3O8H A;  3VOK A;  3BRU A;  2NP3 A;  4JKZ A;  3BJB A;  5C4Y A;  3JSJ A;  2IAI A;  4U9N A;  2PBX A;  3BR3 A;  3GZI A;  2VPR A;  1SGM A;  1QVU A;  4D5C A;  3HGY A;  1JUS A;  3ANP A;  4PXI A;  3LSJ A;  4KWA A;  3TP0 A;  4YZE A;  3PM1 A;  4U9L A;  1VI0 A;  2HKU A;  5CXI A;  1RKW A;  5F27 A;  2G0E A;  2I10 A;  2DG8 A;  1QVT A;  3BNI A;  3HTH A;  2HXI A;  5HSZ A;  5F08 A;  2G7L A;  5CXG A;  2YVE A;  1QPI A;  1ZKG A;  3FRQ A;  5K58 A;  1U9O A;  3VOX A;  5F1J A;  3ZQH A;  2GEN A;  3NXC A;  4G12 A;  1JT0 A;  1RKT A;  2XGE A;  2OI8 A;  3PPB A;  3VW1 A;  4D7M A;  3SDG A;  4M3D A;  4V2F A;  1UI5 A;  4AC0 A;  3DPJ A;  2R7S A;  5J1R A;  5FMP A;  5EFY A;  5FKN A;  3HIM A;  3KNW A;  2DG7 A;  2R7Q A;  4W97 A;  2JJ7 A;  3O60 A;  5EZG A;  3LWJ A;  2XGD A;  5GPC A;  3Q0U A;  5FGL A;  4JNN A;  4D7N A;  4CGR A;  5D1R A;  3DCF A;  3RH2 A;  2ZOZ A;  1ORK A;  4DW6 A;  2PFV A;  1Z77 A;  3IH2 A;  3EUP A;  4WIB A;  2R7O A;  2G7S A;  2O7O A;  4M3E A;  3O8G A;  2R7T A;  3QQA A;  3V6G A;  3B81 A; 
#chains in the Genus database with same CATH homology
 5GPA A;  2W53 A;  2JK3 A;  4B3A A;  5FHP A;  2Q24 A;  4ME9 A;  2OER A;  2ZOY A;  4GFK A;  2FBQ A;  3IUV A;  3KKC A;  3BTC A;  5D19 A;  4V2G A;  3VVY A;  1UI6 A;  2RHA A;  1Z0X A;  2NS7 A;  5FKM A;  3LOC A;  3WHB A;  2VKV A;  5K7Z A;  3WHC A;  2HYT A;  5F0F A;  3B6A A;  4D5F A;  5J3L A;  2X9D A;  3VW2 A;  3CCY A;  4M3G A;  2ID3 A;  3EGQ A;  2IBD A;  3DEW A;  2XPW A;  5J1Y A;  3KZ9 A;  5IOZ A;  3GEU A;  4AF5 A;  5F0C A;  2UXH A;  2X6O A;  2D6Y A;  4GCL A;  3HTI A;  3CDL A;  2OF7 A;  4X1E A;  4AUX A;  3ZQL A;  4GFL A;  4M3B A;  3SFI A;  3BR0 A;  2QIB A;  2GUH A;  3B6C A;  5HBU A;  2ZCM A;  3BTJ A;  1T33 A;  5DAJ A;  2ZCX A;  3VUQ A;  2REK A;  5FKL A;  3V78 A;  2OPT A;  5IPA A;  2HXO A;  2XDN A;  2ZCN A;  2XB5 A;  2FX0 A;  3Q0V A;  4ICH A;  2FJ1 A;  3Q0W A;  3ANG A;  2QWT A;  3BCG A;  4UDS A;  3C2B A;  3E7Q A;  5D18 A;  4ACI A;  2F07 A;  3FK7 A;  2DTZ A;  3HTJ A;  2XPV A;  5J1U A;  3LHQ A;  2Y30 A;  4I76 A;  2QOP A;  1JTY A;  3AQT A;  2QKO A;  3ON4 A;  3TP3 A;  3BR2 A;  3ZQI A;  2WUI A;  3G56 A;  2HQ5 A;  4JYK A;  1BJZ A;  1A6I A;  4NN1 A;  3ZQG A;  2YVH A;  3CJD A;  2RAS A;  2O7T A;  3VIB A;  3LSP A;  3MVP A;  2NX4 A;  3HTA A;  4NEL A;  3BTL A;  3Q3S A;  3CWR A;  3CRJ A;  3G1O A;  2UXO A;  2UXU A;  2G7G A;  3NNR A;  2Y2Z A;  3VVZ A;  3C07 A;  4GCT A;  2NP5 A;  2IU5 A;  1JTX A;  2HYJ A;  3G7R A;  3FIW A;  2ID6 A;  4I6Z A;  2NS8 A;  3BT9 A;  5FKK A;  3ON2 A;  3QPS A;  1T56 A;  4AC6 A;  2ZB9 A;  2FQ4 A;  3VPR A;  2UXI A;  3BR5 A;  4W1U A;  3VP5 A;  3BTI A;  3BQY A;  3AQS A;  4JL3 A;  4XK4 A;  4M3F A;  3MNL A;  3F0C A;  3RD3 A;  3LSR A;  3QBM A;  4MXM A;  3NRG A;  1U9N A;  3COL A;  2WGB A;  2QCO A;  1JUM A;  1JT6 A;  3S5R A;  2QTQ A;  4B1R A;  5EZH A;  4MO7 A;  4HKU A;  4ABZ A;  2G3B A;  2WV1 A;  5F0H A;  5H9T A;  2FD5 A;  4MK6 A;  5K7F A;  3FK6 A;  2XRL A;  5K7H A;  3HGG A;  2V57 A;  3BQZ A;  1ZK8 A;  3QKX A;  3NI7 A;  3P9T A;  3T6N A;  5IP6 A;  5HAW A;  3LJL A;  3IH3 A;  5EYR A;  2XPU A;  2TRT A;  2PZ9 A;  4GCK A;  2Y31 A;  5IOY A;  3NPI A;  3IH4 A;  3ZQF A;  2GBY A;  2GFN A;  2VKE A;  2TCT A;  3VVX A;  3BR1 A;  3PAS A;  2UXP A;  2XGC A;  4L62 A;  3HE0 A;  3KKD A;  5AQC A;  3VW0 A;  3BR6 A;  2IEK A;  3QPL A;  3G1M A;  5GP9 A;  5F04 A;  1RPW A;  5CW8 A;  2RAE A;  1JUP A;  3F1B A;  3BHQ A;  2EH3 A;  5FKO A;  3G1L A;  3O8H A;  3VOK A;  3BRU A;  2NP3 A;  4JKZ A;  3BJB A;  5C4Y A;  3JSJ A;  2IAI A;  2PBX A;  3BR3 A;  3GZI A;  2VPR A;  1SGM A;  1QVU A;  4D5C A;  3HGY A;  1JUS A;  3ANP A;  4PXI A;  3LSJ A;  4KWA A;  3TP0 A;  4YZE A;  3PM1 A;  1VI0 A;  2HKU A;  5CXI A;  1RKW A;  5F27 A;  2G0E A;  2I10 A;  2DG8 A;  1QVT A;  3BNI A;  3HTH A;  2HXI A;  5HSZ A;  5F08 A;  2G7L A;  5CXG A;  2YVE A;  1QPI A;  1ZKG A;  3FRQ A;  5K58 A;  1U9O A;  3VOX A;  5F1J A;  3ZQH A;  2GEN A;  3NXC A;  4G12 A;  1JT0 A;  1RKT A;  2XGE A;  2OI8 A;  3PPB A;  3VW1 A;  4D7M A;  3SDG A;  4M3D A;  4V2F A;  1UI5 A;  4AC0 A;  3DPJ A;  5J1R A;  5FMP A;  5EFY A;  5FKN A;  3HIM A;  3KNW A;  2DG7 A;  4W97 A;  2JJ7 A;  3O60 A;  5EZG A;  3LWJ A;  2XGD A;  5GPC A;  3Q0U A;  5FGL A;  4JNN A;  4D7N A;  4CGR A;  5D1R A;  3DCF A;  3RH2 A;  2ZOZ A;  1ORK A;  4DW6 A;  1Z77 A;  3IH2 A;  3EUP A;  2G7S A;  2O7O A;  4M3E A;  3O8G A;  3QQA A;  3V6G A;  3B81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...