2G7GA

The crystal structure of the putative transcriptional regulator rha04620 from rhodococcus sp. rha1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
197
structure length
197
Chain Sequence
b'LDRERIAEAALELVDRDGDFRMPDLARHLNVQVSSIYHHAKGRAAVVELVRHRVVREIDGSAFERLPWDEAFSEWARSYRAAFSRHPTAIRLLATETVRDPGSLSVYHSAAAGLRGAGFPDDHIMAVITAAENFLLGAALDAAAPEVMIEADSTTTDDALTRALAAAPRGPERAEQAFELGLAALLAGFHHLLQECG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rha04620, Putative Transcriptional Regulator
publication title The Crystal Structure of the Putative Transcriptional Regulator Rha04620 from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
molecule tags Transcription
total genus 71
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2006-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2g7gA00
3Q0WA 4HKUA 2G7SA 4D7MA 2RHAA 3VPRA 3Q3SA 4MXMA 4MO7A 3HGGA 5IOYA 2GFNA 4D7NA 2WV1A 2QOPA 3PASA 3PM1A 4M3BA 2XDNA 3BQZA 4CGRA 3JSJA 3LSPA 4X1EA 3QKXA 2XPUA 2DTZA 5FHPA 3VP5A 2NX4A 3O8HA 3BR1A 3VVYA 2NS8A 2VKEA 3NPIA 3DEWA 2HKUA 2DG7A 4AC6A 1ORKA 2QIBA 1JUPA 2UXHA 3ON4A 3IUVA 2QWTA 3BTIA 2UXOA 2IU5A 2HQ5A 2XGDA 1ZKGA 5IPAA 1VI0A 3ANPA 3KZ9A 2HYJA 2FQ4A 3FIWA 3BCGA 3BR6A 3ZQFA 4GFKA 5CXIA 3LSRA 2NP3A 5FMPA 5IP6A 4W1UA 3RD3A 2W53A 3NXCA 3B6AA 1JT6A 3BNIA 3G1LA 4M3FA 3G56A 5FKLA 4JYKA 2YVHA 5K7HA 2ZOYA 5GP9A 3O8GA 4XK4A 5EYRA 2DG8A 3IH3A 2G0EA 1RPWA 3Q0VA 3GEUA 1A6IA 3EUPA 3G1OA 3T6NA 2ZOZA 5J1YA 3VVZA 4AF5A 4GCTA 2ID6A 5CXGA 3VVXA 2EH3A 2ID3A 2UXIA 3VW2A 2V57A 4YZEA 3LOCA 4M3DA 1UI5A 2XRLA 4V2GA 3HE0A 3VW1A 2O7TA 4I6ZA 5F0HA 2TRTA 3BR2A 5HSZA 3LJLA 3CDLA 2NP5A 4M3EA 3MNLA 3G7RA 1UI6A 3WHCA 1RKWA 5EZGA 3HTJA 4D5FA 3BJBA 5AQCA 3VIBA 2JK3A 4B3AA 1SGMA 2OPTA 2ZCXA 5DAJA 2WUIA 3QPSA 4B1RA 2RASA 1Z0XA 4AC0A 3QPLA 3CRJA 3HTIA 2IAIA 3C07A 4KWAA 2HXOA 3BHQA 2Q24A 2HYTA 4JKZA 3COLA 3AQTA 5D18A 2X9DA 3NNRA 3TP3A 2VKVA 3ZQLA 3FK6A 2NS7A 2IBDA 2FBQA 2FD5A 2FJ1A 3Q0UA 3LHQA 2WGBA 2Y31A 1QVUA 3LSJA 5J1UA 3FK7A 3ZQIA 3BR5A 4ABZA 2OF7A 3E7QA 3IH2A 2GBYA 1T56A 4I76A 2Y30A 3V78A 1T33A 1QPIA 2O7OA 5FKKA 3B6CA 1JTXA 3PPBA 5F08A 4GCLA 5F04A 3B81A 3FRQA 3CJDA 5EZHA 2YVEA 3KKCA 2PBXA 5GPAA 3BR0A 3ZQGA 5F27A 1QVTA 5CW8A 4V2FA 3SFIA 3HTHA 2UXPA 5F0FA 3VUQA 2ZCMA 2IEKA 3HIMA 3BR3A 4D5CA 4JL3A 2D6YA 3MVPA 3BTCA 2QKOA 1U9OA 2I10A 2Y2ZA 2XB5A 3HTAA 1JTYA 2VPRA 2X6OA 3SDGA 4JNNA 2OERA 5IOZA 5FKMA 4L62A 4DW6A 3ANGA 4PXIA 3BRUA 5FGLA 2PZ9A 3BT9A 3DCFA 4UDSA 1JUMA 3VOXA 3O60A 5FKOA 5J1RA 3ZQHA 5H9TA 1U9NA 3BTJA 3KKDA 5J3LA 5F1JA 3HGYA 3GZIA 4ME9A 5K7FA 2G7GA 5C4YA 4ACIA 3LWJA 5EFYA 1RKTA 4G12A 2QCOA 3QQAA 3NRGA 2XPWA 3EGQA 4ICHA 2OI8A 2UXUA 4AUXA 1JUSA 3IH4A 3RH2A 1ZK8A 3VW0A 3KNWA 2G7LA 5D19A 5FKNA 3WHBA 1Z77A 4M3GA 2JJ7A 3V6GA 3P9TA 3QBMA 5HBUA 2XGCA 4W97A 3CWRA 4GFLA 3F0CA 4MK6A 3F1BA 1BJZA 3G1MA 5D1RA 2QTQA 1JT0A 2ZCNA 3NI7A 4NELA 5HAWA 5K7ZA 2G3BA 3ON2A 3BTLA 3C2BA 3AQSA 2GENA 5K58A 3DPJA 4NN1A 2XGEA 2ZB9A 2TCTA 5GPCA 3BQYA 2XPVA 2HXIA 3CCYA 2FX0A 2RAEA 2F07A 2REKA 2GUHA 3S5RA 5F0CA 3VOKA 4GCKA 3TP0A
chains in the Genus database with same CATH superfamily
3Q0WA 4HKUA 2G7SA 4D7MA 2RHAA 3VPRA 3Q3SA 4MXMA 4MO7A 3HGGA 5IOYA 2GFNA 4D7NA 2WV1A 2QOPA 3PASA 3PM1A 4M3BA 2XDNA 3BQZA 4U9LA 3JSJA 4CGRA 3LSPA 4X1EA 2ZY9A 3QKXA 2XPUA 2DTZA 5FHPA 3VP5A 2NX4A 3O8HA 3BR1A 3VVYA 2NS8A 2VKEA 3NPIA 3DEWA 2HKUA 2DG7A 4AC6A 1ORKA 2QIBA 1JUPA 2UXHA 3ON4A 3IUVA 2QWTA 3BTIA 2UXOA 2IU5A 2HQ5A 2XGDA 1ZKGA 5IPAA 1VI0A 3ANPA 3KZ9A 2HYJA 2FQ4A 2R7SA 3FIWA 3BCGA 3BR6A 3ZQFA 4GFKA 5CXIA 3LSRA 2NP3A 5FMPA 5IP6A 4W1UA 2YVXA 3RD3A 2W53A 3NXCA 3B6AA 1JT6A 3BNIA 3G1LA 4M3FA 3G56A 5FKLA 4JYKA 2YVHA 5K7HA 2ZOYA 5GP9A 3O8GA 4XK4A 4C2MA 5EYRA 2DG8A 3IH3A 2G0EA 1RPWA 3Q0VA 3GEUA 1A6IA 3EUPA 3G1OA 3T6NA 2ZOZA 5J1YA 3VVZA 4AF5A 4GCTA 2ID6A 5CXGA 3VVXA 2EH3A 2ID3A 2UXIA 4IRVA 3VW2A 2V57A 4YZEA 3LOCA 4M3DA 1UI5A 2XRLA 4V2GA 3HE0A 3VW1A 2O7TA 4I6ZA 5F0HA 2TRTA 3BR2A 5HSZA 3LJLA 3CDLA 2NP5A 4M3EA 3MNLA 3G7RA 1UI6A 3VTIA 3WHCA 1RKWA 5EZGA 4U9NA 3HTJA 4D5FA 3BJBA 5AQCA 3VIBA 2JK3A 4B3AA 1SGMA 2OPTA 3K8PC 2ZCXA 5DAJA 2WUIA 3QPSA 4B1RA 2RASA 2R7VA 3DU6A 2R7XA 1Z0XA 4AC0A 3QPLA 3CRJA 3HTIA 2IAIA 3C07A 4KWAA 3KYLA 2HXOA 3BHQA 5CQGA 2Q24A 2HYTA 4JKZA 3COLA 3AQTA 5D18A 2X9DA 3NNRA 3TP3A 2VKVA 3ZQLA 3FK6A 2NS7A 2IBDA 2FBQA 2FD5A 2FJ1A 3Q0UA 3LHQA 2WGBA 2Y31A 1QVUA 3LSJA 2B3WA 5J1UA 3FK7A 3ZQIA 3BR5A 4ABZA 2OF7A 3E7QA 3IH2A 3FHNA 4OD4A 2GBYA 1T56A 4I76A 2Y30A 3V78A 1T33A 1QPIA 2O7OA 5FKKA 3B6CA 1JTXA 3PPBA 5F08A 4GCLA 5F04A 3B81A 3FRQA 3CJDA 5EZHA 2YVEA 3KKCA 2PBXA 5GPAA 3BR0A 3ZQGA 5F27A 1QVTA 2R7QA 5CW8A 4V2FA 3NS4A 3SFIA 3HTHA 2UXPA 5F0FA 3VUQA 2ZCMA 2IEKA 3HIMA 3BR3A 4D5CA 4JL3A 2D6YA 3MVPA 3BTCA 2QKOA 2A2FX 1U9OA 2I10A 2R7RA 2Y2ZA 2XB5A 3HTAA 1JTYA 2VPRA 2X6OA 3SDGA 4JNNA 2OERA 5IOZA 5FKMA 4L62A 4DW6A 3ANGA 4PXIA 3BRUA 5FGLA 2PZ9A 3BT9A 3DCFA 4UDSA 1JUMA 3VOXA 2R7UA 3O60A 5FKOA 5J1RA 2PFVA 3ZQHA 5H9TA 1U9NA 3BTJA 3KKDA 2R7WA 5J3LA 5F1JA 3HGYA 3GZIA 4ME9A 3SWHA 5K7FA 2G7GA 5C4YA 4OD5A 4ACIA 3LWJA 2R7TA 2R7OA 5EFYA 1RKTA 4G12A 2QCOA 3QQAA 3NRGA 2XPWA 3EGQA 4ICHA 2OI8A 2UXUA 4AUXA 1JUSA 3IH4A 3RH2A 1ZK8A 3VW0A 4DVYP 3KNWA 2G7LA 2FJI1 5D19A 5FKNA 3WHBA 1Z77A 4M3GA 2JJ7A 3V6GA 3P9TA 3QBMA 5HBUA 2XGCA 4W97A 3CWRA 4GFLA 3F0CA 4MK6A 3F1BA 1BJZA 3G1MA 5D1RA 2QTQA 1JT0A 2ZCNA 3NI7A 4NELA 5HAWA 5K7ZA 2G3BA 3ON2A 3BTLA 3C2BA 3AQSA 2GENA 5K58A 3DPJA 4NN1A 2XGEA 2ZB9A 2TCTA 5GPCA 3BQYA 2XPVA 2HXIA 4WIBA 3CCYA 3DU5A 2FX0A 2RAEA 2F07A 2REKA 2GUHA 3S5RA 2B1EA 5F0CA 3VOKA 4GCKA 3TP0A
chains in the Genus database with same CATH topology
3Q0WA 4HKUA 2G7SA 4D7MA 2RHAA 3VPRA 3Q3SA 4MXMA 4MO7A 3HGGA 5IOYA 2GFNA 4D7NA 2WV1A 2QOPA 3PASA 3PM1A 4M3BA 2XDNA 3BQZA 4CGRA 3JSJA 3LSPA 4X1EA 3QKXA 2XPUA 2DTZA 5FHPA 3VP5A 2NX4A 3O8HA 3BR1A 3VVYA 2NS8A 2VKEA 3NPIA 3DEWA 2HKUA 2DG7A 4AC6A 1ORKA 2QIBA 1JUPA 2UXHA 3ON4A 3IUVA 2QWTA 3BTIA 2UXOA 2IU5A 2HQ5A 2XGDA 1ZKGA 5IPAA 1VI0A 3ANPA 3KZ9A 2HYJA 2FQ4A 3FIWA 3BCGA 3BR6A 3ZQFA 4GFKA 5CXIA 3LSRA 2NP3A 5FMPA 5IP6A 4W1UA 3RD3A 2W53A 3NXCA 3B6AA 1JT6A 3BNIA 3G1LA 4M3FA 3G56A 5FKLA 4JYKA 2YVHA 5K7HA 2ZOYA 5GP9A 3O8GA 4XK4A 5EYRA 2DG8A 3IH3A 2G0EA 1RPWA 3Q0VA 3GEUA 1A6IA 3EUPA 3G1OA 3T6NA 2ZOZA 5J1YA 3VVZA 4AF5A 4GCTA 2ID6A 5CXGA 3VVXA 2EH3A 2ID3A 2UXIA 3VW2A 2V57A 4YZEA 3LOCA 4M3DA 1UI5A 2XRLA 4V2GA 3HE0A 3VW1A 2O7TA 4I6ZA 5F0HA 2TRTA 3BR2A 5HSZA 3LJLA 3CDLA 2NP5A 4M3EA 3MNLA 3G7RA 1UI6A 3WHCA 1RKWA 5EZGA 3HTJA 4D5FA 3BJBA 5AQCA 3VIBA 2JK3A 4B3AA 1SGMA 2OPTA 2ZCXA 5DAJA 2WUIA 3QPSA 4B1RA 2RASA 1Z0XA 4AC0A 3QPLA 3CRJA 3HTIA 2IAIA 3C07A 4KWAA 2HXOA 3BHQA 2Q24A 2HYTA 4JKZA 3COLA 3AQTA 5D18A 2X9DA 3NNRA 3TP3A 2VKVA 3ZQLA 3FK6A 2NS7A 2IBDA 2FBQA 2FD5A 2FJ1A 3Q0UA 3LHQA 2WGBA 2Y31A 1QVUA 3LSJA 5J1UA 3FK7A 3ZQIA 3BR5A 4ABZA 2OF7A 3E7QA 3IH2A 2GBYA 1T56A 4I76A 2Y30A 3V78A 1T33A 1QPIA 2O7OA 5FKKA 3B6CA 1JTXA 3PPBA 5F08A 4GCLA 5F04A 3B81A 3FRQA 3CJDA 5EZHA 2YVEA 3KKCA 2PBXA 5GPAA 3BR0A 3ZQGA 5F27A 1QVTA 5CW8A 4V2FA 3SFIA 3HTHA 2UXPA 5F0FA 3VUQA 2ZCMA 2IEKA 3HIMA 3BR3A 4D5CA 4JL3A 2D6YA 3MVPA 3BTCA 2QKOA 1U9OA 2I10A 2Y2ZA 2XB5A 3HTAA 1JTYA 2VPRA 2X6OA 3SDGA 4JNNA 2OERA 5IOZA 5FKMA 4L62A 4DW6A 3ANGA 4PXIA 3BRUA 5FGLA 2PZ9A 3BT9A 3DCFA 4UDSA 1JUMA 3VOXA 3O60A 5FKOA 5J1RA 3ZQHA 5H9TA 1U9NA 3BTJA 3KKDA 5J3LA 5F1JA 3HGYA 3GZIA 4ME9A 5K7FA 2G7GA 5C4YA 4ACIA 3LWJA 5EFYA 1RKTA 4G12A 2QCOA 3QQAA 3NRGA 2XPWA 3EGQA 4ICHA 2OI8A 2UXUA 4AUXA 1JUSA 3IH4A 3RH2A 1ZK8A 3VW0A 3KNWA 2G7LA 5D19A 5FKNA 3WHBA 1Z77A 4M3GA 2JJ7A 3V6GA 3P9TA 3QBMA 5HBUA 2XGCA 4W97A 3CWRA 4GFLA 3F0CA 4MK6A 3F1BA 1BJZA 3G1MA 5D1RA 2QTQA 1JT0A 2ZCNA 3NI7A 4NELA 5HAWA 5K7ZA 2G3BA 3ON2A 3BTLA 3C2BA 3AQSA 2GENA 5K58A 3DPJA 4NN1A 2XGEA 2ZB9A 2TCTA 5GPCA 3BQYA 2XPVA 2HXIA 3CCYA 2FX0A 2RAEA 2F07A 2REKA 2GUHA 3S5RA 5F0CA 3VOKA 4GCKA 3TP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0W A;  4HKU A;  2G7S A;  4D7M A;  2RHA A;  3VPR A;  3Q3S A;  4MXM A;  4MO7 A;  3HGG A;  5IOY A;  2GFN A;  4D7N A;  2WV1 A;  2QOP A;  3PAS A;  3PM1 A;  4M3B A;  2XDN A;  3BQZ A;  4CGR A;  3JSJ A;  3LSP A;  4X1E A;  3QKX A;  2XPU A;  2DTZ A;  5FHP A;  3VP5 A;  2NX4 A;  3O8H A;  3BR1 A;  3VVY A;  2NS8 A;  2VKE A;  3NPI A;  3DEW A;  2HKU A;  2DG7 A;  4AC6 A;  1ORK A;  2QIB A;  1JUP A;  2UXH A;  3ON4 A;  3IUV A;  2QWT A;  3BTI A;  2UXO A;  2IU5 A;  2HQ5 A;  2XGD A;  1ZKG A;  5IPA A;  1VI0 A;  3ANP A;  3KZ9 A;  2HYJ A;  2FQ4 A;  3FIW A;  3BCG A;  3BR6 A;  3ZQF A;  4GFK A;  5CXI A;  3LSR A;  2NP3 A;  5FMP A;  5IP6 A;  4W1U A;  3RD3 A;  2W53 A;  3NXC A;  3B6A A;  1JT6 A;  3BNI A;  3G1L A;  4M3F A;  3G56 A;  5FKL A;  4JYK A;  2YVH A;  5K7H A;  2ZOY A;  5GP9 A;  3O8G A;  4XK4 A;  5EYR A;  2DG8 A;  3IH3 A;  2G0E A;  1RPW A;  3Q0V A;  3GEU A;  1A6I A;  3EUP A;  3G1O A;  3T6N A;  2ZOZ A;  5J1Y A;  3VVZ A;  4AF5 A;  4GCT A;  2ID6 A;  5CXG A;  3VVX A;  2EH3 A;  2ID3 A;  2UXI A;  3VW2 A;  2V57 A;  4YZE A;  3LOC A;  4M3D A;  1UI5 A;  2XRL A;  4V2G A;  3HE0 A;  3VW1 A;  2O7T A;  4I6Z A;  5F0H A;  2TRT A;  3BR2 A;  5HSZ A;  3LJL A;  3CDL A;  2NP5 A;  4M3E A;  3MNL A;  3G7R A;  1UI6 A;  3WHC A;  1RKW A;  5EZG A;  3HTJ A;  4D5F A;  3BJB A;  5AQC A;  3VIB A;  2JK3 A;  4B3A A;  1SGM A;  2OPT A;  2ZCX A;  5DAJ A;  2WUI A;  3QPS A;  4B1R A;  2RAS A;  1Z0X A;  4AC0 A;  3QPL A;  3CRJ A;  3HTI A;  2IAI A;  3C07 A;  4KWA A;  2HXO A;  3BHQ A;  2Q24 A;  2HYT A;  4JKZ A;  3COL A;  3AQT A;  5D18 A;  2X9D A;  3NNR A;  3TP3 A;  2VKV A;  3ZQL A;  3FK6 A;  2NS7 A;  2IBD A;  2FBQ A;  2FD5 A;  2FJ1 A;  3Q0U A;  3LHQ A;  2WGB A;  2Y31 A;  1QVU A;  3LSJ A;  5J1U A;  3FK7 A;  3ZQI A;  3BR5 A;  4ABZ A;  2OF7 A;  3E7Q A;  3IH2 A;  2GBY A;  1T56 A;  4I76 A;  2Y30 A;  3V78 A;  1T33 A;  1QPI A;  2O7O A;  5FKK A;  3B6C A;  1JTX A;  3PPB A;  5F08 A;  4GCL A;  5F04 A;  3B81 A;  3FRQ A;  3CJD A;  5EZH A;  2YVE A;  3KKC A;  2PBX A;  5GPA A;  3BR0 A;  3ZQG A;  5F27 A;  1QVT A;  5CW8 A;  4V2F A;  3SFI A;  3HTH A;  2UXP A;  5F0F A;  3VUQ A;  2ZCM A;  2IEK A;  3HIM A;  3BR3 A;  4D5C A;  4JL3 A;  2D6Y A;  3MVP A;  3BTC A;  2QKO A;  1U9O A;  2I10 A;  2Y2Z A;  2XB5 A;  3HTA A;  1JTY A;  2VPR A;  2X6O A;  3SDG A;  4JNN A;  2OER A;  5IOZ A;  5FKM A;  4L62 A;  4DW6 A;  3ANG A;  4PXI A;  3BRU A;  5FGL A;  2PZ9 A;  3BT9 A;  3DCF A;  4UDS A;  1JUM A;  3VOX A;  3O60 A;  5FKO A;  5J1R A;  3ZQH A;  5H9T A;  1U9N A;  3BTJ A;  3KKD A;  5J3L A;  5F1J A;  3HGY A;  3GZI A;  4ME9 A;  5K7F A;  2G7G A;  5C4Y A;  4ACI A;  3LWJ A;  5EFY A;  1RKT A;  4G12 A;  2QCO A;  3QQA A;  3NRG A;  2XPW A;  3EGQ A;  4ICH A;  2OI8 A;  2UXU A;  4AUX A;  1JUS A;  3IH4 A;  3RH2 A;  1ZK8 A;  3VW0 A;  3KNW A;  2G7L A;  5D19 A;  5FKN A;  3WHB A;  1Z77 A;  4M3G A;  2JJ7 A;  3V6G A;  3P9T A;  3QBM A;  5HBU A;  2XGC A;  4W97 A;  3CWR A;  4GFL A;  3F0C A;  4MK6 A;  3F1B A;  1BJZ A;  3G1M A;  5D1R A;  2QTQ A;  1JT0 A;  2ZCN A;  3NI7 A;  4NEL A;  5HAW A;  5K7Z A;  2G3B A;  3ON2 A;  3BTL A;  3C2B A;  3AQS A;  2GEN A;  5K58 A;  3DPJ A;  4NN1 A;  2XGE A;  2ZB9 A;  2TCT A;  5GPC A;  3BQY A;  2XPV A;  2HXI A;  3CCY A;  2FX0 A;  2RAE A;  2F07 A;  2REK A;  2GUH A;  3S5R A;  5F0C A;  3VOK A;  4GCK A;  3TP0 A; 
#chains in the Genus database with same CATH topology
 3Q0W A;  4HKU A;  2G7S A;  4D7M A;  2RHA A;  3VPR A;  3Q3S A;  4MXM A;  4MO7 A;  3HGG A;  5IOY A;  2GFN A;  4D7N A;  2WV1 A;  2QOP A;  3PAS A;  3PM1 A;  4M3B A;  2XDN A;  3BQZ A;  4U9L A;  3JSJ A;  4CGR A;  3LSP A;  4X1E A;  2ZY9 A;  3QKX A;  2XPU A;  2DTZ A;  5FHP A;  3VP5 A;  2NX4 A;  3O8H A;  3BR1 A;  3VVY A;  2NS8 A;  2VKE A;  3NPI A;  3DEW A;  2HKU A;  2DG7 A;  4AC6 A;  1ORK A;  2QIB A;  1JUP A;  2UXH A;  3ON4 A;  3IUV A;  2QWT A;  3BTI A;  2UXO A;  2IU5 A;  2HQ5 A;  2XGD A;  1ZKG A;  5IPA A;  1VI0 A;  3ANP A;  3KZ9 A;  2HYJ A;  2FQ4 A;  2R7S A;  3FIW A;  3BCG A;  3BR6 A;  3ZQF A;  4GFK A;  5CXI A;  3LSR A;  2NP3 A;  5FMP A;  5IP6 A;  4W1U A;  2YVX A;  3RD3 A;  2W53 A;  3NXC A;  3B6A A;  1JT6 A;  3BNI A;  3G1L A;  4M3F A;  3G56 A;  5FKL A;  4JYK A;  2YVH A;  5K7H A;  2ZOY A;  5GP9 A;  3O8G A;  4XK4 A;  4C2M A;  5EYR A;  2DG8 A;  3IH3 A;  2G0E A;  1RPW A;  3Q0V A;  3GEU A;  1A6I A;  3EUP A;  3G1O A;  3T6N A;  2ZOZ A;  5J1Y A;  3VVZ A;  4AF5 A;  4GCT A;  2ID6 A;  5CXG A;  3VVX A;  2EH3 A;  2ID3 A;  2UXI A;  4IRV A;  3VW2 A;  2V57 A;  4YZE A;  3LOC A;  4M3D A;  1UI5 A;  2XRL A;  4V2G A;  3HE0 A;  3VW1 A;  2O7T A;  4I6Z A;  5F0H A;  2TRT A;  3BR2 A;  5HSZ A;  3LJL A;  3CDL A;  2NP5 A;  4M3E A;  3MNL A;  3G7R A;  1UI6 A;  3VTI A;  3WHC A;  1RKW A;  5EZG A;  4U9N A;  3HTJ A;  4D5F A;  3BJB A;  5AQC A;  3VIB A;  2JK3 A;  4B3A A;  1SGM A;  2OPT A;  3K8P C;  2ZCX A;  5DAJ A;  2WUI A;  3QPS A;  4B1R A;  2RAS A;  2R7V A;  3DU6 A;  2R7X A;  1Z0X A;  4AC0 A;  3QPL A;  3CRJ A;  3HTI A;  2IAI A;  3C07 A;  4KWA A;  3KYL A;  2HXO A;  3BHQ A;  5CQG A;  2Q24 A;  2HYT A;  4JKZ A;  3COL A;  3AQT A;  5D18 A;  2X9D A;  3NNR A;  3TP3 A;  2VKV A;  3ZQL A;  3FK6 A;  2NS7 A;  2IBD A;  2FBQ A;  2FD5 A;  2FJ1 A;  3Q0U A;  3LHQ A;  2WGB A;  2Y31 A;  1QVU A;  3LSJ A;  2B3W A;  5J1U A;  3FK7 A;  3ZQI A;  3BR5 A;  4ABZ A;  2OF7 A;  3E7Q A;  3IH2 A;  3FHN A;  4OD4 A;  2GBY A;  1T56 A;  4I76 A;  2Y30 A;  3V78 A;  1T33 A;  1QPI A;  2O7O A;  5FKK A;  3B6C A;  1JTX A;  3PPB A;  5F08 A;  4GCL A;  5F04 A;  3B81 A;  3FRQ A;  3CJD A;  5EZH A;  2YVE A;  3KKC A;  2PBX A;  5GPA A;  3BR0 A;  3ZQG A;  5F27 A;  1QVT A;  2R7Q A;  5CW8 A;  4V2F A;  3NS4 A;  3SFI A;  3HTH A;  2UXP A;  5F0F A;  3VUQ A;  2ZCM A;  2IEK A;  3HIM A;  3BR3 A;  4D5C A;  4JL3 A;  2D6Y A;  3MVP A;  3BTC A;  2QKO A;  2A2F X;  1U9O A;  2I10 A;  2R7R A;  2Y2Z A;  2XB5 A;  3HTA A;  1JTY A;  2VPR A;  2X6O A;  3SDG A;  4JNN A;  2OER A;  5IOZ A;  5FKM A;  4L62 A;  4DW6 A;  3ANG A;  4PXI A;  3BRU A;  5FGL A;  2PZ9 A;  3BT9 A;  3DCF A;  4UDS A;  1JUM A;  3VOX A;  2R7U A;  3O60 A;  5FKO A;  5J1R A;  2PFV A;  3ZQH A;  5H9T A;  1U9N A;  3BTJ A;  3KKD A;  2R7W A;  5J3L A;  5F1J A;  3HGY A;  3GZI A;  4ME9 A;  3SWH A;  5K7F A;  2G7G A;  5C4Y A;  4OD5 A;  4ACI A;  3LWJ A;  2R7T A;  2R7O A;  5EFY A;  1RKT A;  4G12 A;  2QCO A;  3QQA A;  3NRG A;  2XPW A;  3EGQ A;  4ICH A;  2OI8 A;  2UXU A;  4AUX A;  1JUS A;  3IH4 A;  3RH2 A;  1ZK8 A;  3VW0 A;  4DVY P;  3KNW A;  2G7L A;  2FJI 1;  5D19 A;  5FKN A;  3WHB A;  1Z77 A;  4M3G A;  2JJ7 A;  3V6G A;  3P9T A;  3QBM A;  5HBU A;  2XGC A;  4W97 A;  3CWR A;  4GFL A;  3F0C A;  4MK6 A;  3F1B A;  1BJZ A;  3G1M A;  5D1R A;  2QTQ A;  1JT0 A;  2ZCN A;  3NI7 A;  4NEL A;  5HAW A;  5K7Z A;  2G3B A;  3ON2 A;  3BTL A;  3C2B A;  3AQS A;  2GEN A;  5K58 A;  3DPJ A;  4NN1 A;  2XGE A;  2ZB9 A;  2TCT A;  5GPC A;  3BQY A;  2XPV A;  2HXI A;  4WIB A;  3CCY A;  3DU5 A;  2FX0 A;  2RAE A;  2F07 A;  2REK A;  2GUH A;  3S5R A;  2B1E A;  5F0C A;  3VOK A;  4GCK A;  3TP0 A; 
#chains in the Genus database with same CATH homology
 3Q0W A;  4HKU A;  2G7S A;  4D7M A;  2RHA A;  3VPR A;  3Q3S A;  4MXM A;  4MO7 A;  3HGG A;  5IOY A;  2GFN A;  4D7N A;  2WV1 A;  2QOP A;  3PAS A;  3PM1 A;  4M3B A;  2XDN A;  3BQZ A;  4CGR A;  3JSJ A;  3LSP A;  4X1E A;  3QKX A;  2XPU A;  2DTZ A;  5FHP A;  3VP5 A;  2NX4 A;  3O8H A;  3BR1 A;  3VVY A;  2NS8 A;  2VKE A;  3NPI A;  3DEW A;  2HKU A;  2DG7 A;  4AC6 A;  1ORK A;  2QIB A;  1JUP A;  2UXH A;  3ON4 A;  3IUV A;  2QWT A;  3BTI A;  2UXO A;  2IU5 A;  2HQ5 A;  2XGD A;  1ZKG A;  5IPA A;  1VI0 A;  3ANP A;  3KZ9 A;  2HYJ A;  2FQ4 A;  3FIW A;  3BCG A;  3BR6 A;  3ZQF A;  4GFK A;  5CXI A;  3LSR A;  2NP3 A;  5FMP A;  5IP6 A;  4W1U A;  3RD3 A;  2W53 A;  3NXC A;  3B6A A;  1JT6 A;  3BNI A;  3G1L A;  4M3F A;  3G56 A;  5FKL A;  4JYK A;  2YVH A;  5K7H A;  2ZOY A;  5GP9 A;  3O8G A;  4XK4 A;  5EYR A;  2DG8 A;  3IH3 A;  2G0E A;  1RPW A;  3Q0V A;  3GEU A;  1A6I A;  3EUP A;  3G1O A;  3T6N A;  2ZOZ A;  5J1Y A;  3VVZ A;  4AF5 A;  4GCT A;  2ID6 A;  5CXG A;  3VVX A;  2EH3 A;  2ID3 A;  2UXI A;  3VW2 A;  2V57 A;  4YZE A;  3LOC A;  4M3D A;  1UI5 A;  2XRL A;  4V2G A;  3HE0 A;  3VW1 A;  2O7T A;  4I6Z A;  5F0H A;  2TRT A;  3BR2 A;  5HSZ A;  3LJL A;  3CDL A;  2NP5 A;  4M3E A;  3MNL A;  3G7R A;  1UI6 A;  3WHC A;  1RKW A;  5EZG A;  3HTJ A;  4D5F A;  3BJB A;  5AQC A;  3VIB A;  2JK3 A;  4B3A A;  1SGM A;  2OPT A;  2ZCX A;  5DAJ A;  2WUI A;  3QPS A;  4B1R A;  2RAS A;  1Z0X A;  4AC0 A;  3QPL A;  3CRJ A;  3HTI A;  2IAI A;  3C07 A;  4KWA A;  2HXO A;  3BHQ A;  2Q24 A;  2HYT A;  4JKZ A;  3COL A;  3AQT A;  5D18 A;  2X9D A;  3NNR A;  3TP3 A;  2VKV A;  3ZQL A;  3FK6 A;  2NS7 A;  2IBD A;  2FBQ A;  2FD5 A;  2FJ1 A;  3Q0U A;  3LHQ A;  2WGB A;  2Y31 A;  1QVU A;  3LSJ A;  5J1U A;  3FK7 A;  3ZQI A;  3BR5 A;  4ABZ A;  2OF7 A;  3E7Q A;  3IH2 A;  2GBY A;  1T56 A;  4I76 A;  2Y30 A;  3V78 A;  1T33 A;  1QPI A;  2O7O A;  5FKK A;  3B6C A;  1JTX A;  3PPB A;  5F08 A;  4GCL A;  5F04 A;  3B81 A;  3FRQ A;  3CJD A;  5EZH A;  2YVE A;  3KKC A;  2PBX A;  5GPA A;  3BR0 A;  3ZQG A;  5F27 A;  1QVT A;  5CW8 A;  4V2F A;  3SFI A;  3HTH A;  2UXP A;  5F0F A;  3VUQ A;  2ZCM A;  2IEK A;  3HIM A;  3BR3 A;  4D5C A;  4JL3 A;  2D6Y A;  3MVP A;  3BTC A;  2QKO A;  1U9O A;  2I10 A;  2Y2Z A;  2XB5 A;  3HTA A;  1JTY A;  2VPR A;  2X6O A;  3SDG A;  4JNN A;  2OER A;  5IOZ A;  5FKM A;  4L62 A;  4DW6 A;  3ANG A;  4PXI A;  3BRU A;  5FGL A;  2PZ9 A;  3BT9 A;  3DCF A;  4UDS A;  1JUM A;  3VOX A;  3O60 A;  5FKO A;  5J1R A;  3ZQH A;  5H9T A;  1U9N A;  3BTJ A;  3KKD A;  5J3L A;  5F1J A;  3HGY A;  3GZI A;  4ME9 A;  5K7F A;  2G7G A;  5C4Y A;  4ACI A;  3LWJ A;  5EFY A;  1RKT A;  4G12 A;  2QCO A;  3QQA A;  3NRG A;  2XPW A;  3EGQ A;  4ICH A;  2OI8 A;  2UXU A;  4AUX A;  1JUS A;  3IH4 A;  3RH2 A;  1ZK8 A;  3VW0 A;  3KNW A;  2G7L A;  5D19 A;  5FKN A;  3WHB A;  1Z77 A;  4M3G A;  2JJ7 A;  3V6G A;  3P9T A;  3QBM A;  5HBU A;  2XGC A;  4W97 A;  3CWR A;  4GFL A;  3F0C A;  4MK6 A;  3F1B A;  1BJZ A;  3G1M A;  5D1R A;  2QTQ A;  1JT0 A;  2ZCN A;  3NI7 A;  4NEL A;  5HAW A;  5K7Z A;  2G3B A;  3ON2 A;  3BTL A;  3C2B A;  3AQS A;  2GEN A;  5K58 A;  3DPJ A;  4NN1 A;  2XGE A;  2ZB9 A;  2TCT A;  5GPC A;  3BQY A;  2XPV A;  2HXI A;  3CCY A;  2FX0 A;  2RAE A;  2F07 A;  2REK A;  2GUH A;  3S5R A;  5F0C A;  3VOK A;  4GCK A;  3TP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...