1QVTA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 74
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvtA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvtA02
2K9QA 3HTHA 1TC3C 4A3FJ 3HOVJ 3DCFA 2LFBA 1AHDP 2HOAA 2CU7A 2R93J 4A69C 2WGBA 3B81A 3OSGA 1DU6A 1MBGA 4X1EA 5IP6A 3CDLA 1YRNA 4B3AA 1P7IA 2E2JJ 4HKUA 3IV5A 2YU9J 5FKNA 3S17J 4UDSA 2DA5A 4HNVA 4C3IJ 1R9TJ 3HTIA 2O7OA 4IEJA 4EEFG 4QTRA 1HF0A 5E3LA 1ZTRA 2CRGA 2G0EA 1IG7A 5DTDA 2Y9ZA 3TEDA 3QPSA 2ECBA 1IC8A 4JNNA 4M3EA 5FHPA 5EZGA 3TW7A 5H9TA 4BBSJ 4MO7A 3EGQA 3VVZA 4ICHA 3HGGA 2HYJA 4A3GJ 3BRUA 2K40A 3ZOBA 4A3LJ 1ETXA 3BR1A 2NOGA 1HLVA 3LSPA 3HIMA 1JTYA 5E3OA 1OCPA 4MXMA 2K9SA 2TRTA 4RDUA 4Y52J 3DEWA 2GENA 3TP0A 3HKZN 1APLC 4JYKA 3BQYA 1WH7A 1PUFB 3GEUA 3KKDA 3K2AA 1RESA 2Y9YA 3ZQIA 5M3FJ 2ID3A 5C4YA 3F0CA 5EG0A 2OPTA 5F04A 3HOWJ 3I4MJ 2NS7A 4QIWN 1POGA 1BA5A 2ELKA 2EZKA 5EFYA 2YVHA 4B4CA 2AO9A 2VKVA 2ID6A 3O8GA 1F36A 2ZCXA 1E3OC 4BXXJ 1I3QJ 1UI6A 1LE8B 4RBOA 2RASA 4BY7J 3S1MJ 2M0CA 5FJ8J 4NELA 1B8IB 3COLA 4V2FA 3I4NJ 1MBKA 3RKQA 2UXPA 2ECCA 4J19A 4I6ZA 2UXOA 1WH5A 4CGRA 4UUSB 2VKEA 2HXIA 1IGNA 2JA8J 2TCTA 1UMQA 4L5EA 3GTJJ 3NAUA 2QKOA 2CQQA 5F08A 2E1OA 4AC6A 3GBGA 3HOYJ 1FIPA 1U9OA 1Y1WJ 3HOUJ 1LFUP 2XB0X 1JGGA 2DJNA 2DG8A 2IAIA 3ZQHA 1RPWA 3QPLA 1MBFA 2EH3A 3MKLA 5E3MA 3G56A 3JRAA 9ANTA 1BW6A 4IHWA 3TP3A 1ETQA 3T6NA 1ETOA 5J1UA 1MH3A 3BTJA 2DMQA 1ORKA 2XRLA 3FKIJ 5JLXA 2XPWA 2ZOYA 2X48A 5HSZA 4JL3A 2OF7A 1GV5A 1ETYA 1YRNB 1ZGWA 2HXOA 4BKXA 3RQIA 1U9NA 4AF5A 3EUPA 2O8KA 1MNMC 3DPJA 1BJZA 5DS9A 1JTXA 4LOCA 3LHQA 2QCOA 2K9NA 1FTZA 4JKZA 2CQXA 2JN6A 2R5ZA 2OI8A 3V6GA 4UUTA 4FCYA 4X6AJ 2LR8A 3VW0A 1W0UA 3K7AJ 2AHQA 3LOCA 2M9HA 4D5CA 3B6AA 4BY1J 4M6VA 1TWFJ 1LFBA 3BHQA 1JUSA 4IHVA 2G7SA 2NVYJ 3BG9A 3IH3A 1RKWA 3S1NJ 2R5YA 2Y31A 2LP0A 1JT6A 3VOXA 2UXHA 1VNDA 4L62A 2WUIA 3ZQFA 4AC0A 1O4XA 1MH4A 3MNLA 4DYQA 2EZLA 3BNIA 5FMPA 3BR0A 2DMUA 3BQZA 5IP9J 4V2GA 1TWGJ 3MN2A 1GV2A 2I10A 3BR2A 3HE0A 2W48A 1ENHA 2JK3A 3ANGA 5HAWA 2P81A 3VOKA 2WB1N 4G12A 3SDGA 5EG0B 2HOTA 3A03A 3HTAA 2E19A 1IDZA 3RD3A 2XPUA 3FIWA 2WAQN 5GPCA 3NI7A 1GDTA 2D5VA 5EYRA 1ETKA 2JWTA 4M3BA 4MFDA 1ZR2A 1Q1VA 3HEFA 3NPIA 2EQRA 3JR9A 5D1RA 5HBUA 1FTTA 2HQ5A 3ZQLA 2COBA 2JJ7A 4YZEA 3OSFA 4DZPA 3S1QJ 5HODA 3JRBA 1SFOJ 1A6IA 1ZR4A 1HCRA 2XSDC 3NRGA 2QIBA 4C3JJ 2PZ9A 3HB9A 4IHYA 3NXCA 2DA6A 3JRIA 2NP5A 3AQTA 3P9TA 1JKPC 4A3DJ 4XRSG 3OOUA 2VUMJ 1UI5A 1RETA 3BR5A 2M2EA 4D7NA 2DA1A 1SANA 1FJLA 1XC5A 5EF6A 1IUFA 4KWAA 1ITYA 3JRGA 3S16J 3BR6A 4GCKA 3L1PA 5IP7J 2CJJA 5J3LA 4W1UA 1JT0A 2FJ1A 2XPVA 5F1JA 1OJLA 1QPIA 3VUQA 1IDYA 1HDPA 2KDZA 3GTKJ 5F27A 5EZHA 3O8HA 5GPAA 1T56A 2YUSA 2DTZA 2D6YA 4GCTA 2VPRA 4JP0A 3HOXJ 5IYBJ 2Y2ZA 2H8RA 2NS8A 2ZOZA 4Y7NJ 5M5XJ 4A3IJ 3LWJA 3FK6A 3PPBA 1X58A 3PM1A 2MG4A 4A3CJ 4GFLA 2GBYA 3V78A 3LSJA 5D19A 3FK7A 4XIDA 2F07A 2HDDA 1FEXA 1JUMA 1VI0A 2L7FP 1EF4A 2HYTA 2CUEA 1XG1A 2MSYA 3S5RA 3E7LA 1HDDC 2ZCMA 3KKCA 4W97A 2R5ZB 1AU7A 2G3BA 3OIOA 5CXIA 3GTGJ 3RH2A 2GUHA 1H88C 2HOSA 3VP5A 2EZHA 4D7MA 3VIBA 1IRZA 1Z0XA 1GUUA 4NDLA 4QSHA 3WHBA 2LLKA 2R5YB 4FTHA 4NN1A 4DYCA 1MBJA 4B1RA 3W6VA 2QOPA 1X2MA 2LD5A 5K7ZA 5FKKA 2M34A 5M3MJ 5C3EJ 4A3MJ 1BW5A 2HI3A 2PMZN 4AUXA 3CMYA 3JRCA 4I76A 1ETWA 1JKRC 2YS9A 3IH2A 2UXIA 2JMWA 1F43A 5EEAA 2Y30A 1SGMA 3BCGA 1H8AC 3Q0VA 2QTQA 2DA7A 2DMPA 3H3VK 3BG5A 3NNRA 2FQ4A 3LSGA 3RZOJ 1VF9A 3HM5A 2DG7A 1NTCA 3CCYA 3C2BA 3G1MA 3LNQA 2LVSA 1AKHA 1CQTA 5CXGA 2RHAA 2O9LA 3CJDA 2QF7A 3D1NI 2ME6A 2GFNA 2GM4A 3JRDA 2L0KA 4XK4A 4A3BJ 3VVXA 2M8GX 4GCLA 1GVDA 1RR7A 1TWHJ 3RZDJ 1HOMA 3G7RA 4MFEA 5D18A 2JA6J 3QKXA 1JJ6C 2FBQA 2RAEA 2FD5A 3S1RJ 5GP9A 2GLOA 5IYDJ 3KNWA 2NVTJ 3VPRA 4BBRJ 2V57A 1Z77A 2ZB9A 4IHXA 1JUPA 1U78A 5FKOA 3JRHA 1IV6A 2E2HJ 2NX4A 4A3JJ 3GTOJ 1D5YA 2XGDA 2XB5A 3M3YJ 1B72A 1K83J 3LJLA 1I6HJ 4MK6A 4ACIA 2X6OA 2N8GA 1VFCA 1XS9A 4M3FA 5K7HA 1ZKGA 4CYCA 3BTIA 2REKA 2YVEA 3VW1A 5EGOA 2H1KA 3BT9A 3GTPJ 4DZJA 5K7FA 1X2NA 3Q0UA 3QQAA 1Y1VJ 4S0HB 2B63J 1ZK8A 2MGQA 3BJBA 3IUVA 1MBHA 3A01A 1JJ8C 1BL0A 5CW8A 4JX4A 3JREA 3BR3A 5M5YJ 2Y0SN 4XICA 3HBLA 2XDNA 4GFBA 3GTMJ 3E7QA 2EBIA 2NVQJ 2HKUA 1FIAA 4A3EJ 4D5FA 2EZIA 4JX6A 1JKQC 3MVPA 4C3HJ 5FGLA 2JA7J 2DMTA 3ON2A 3PO3J 2IEKA 3O60A 2IU5A 5JLWA 5F0HA 4C2MJ 1QVUA 1QRYA 3CQZJ 3BG3A 2G7LA 3GTLJ 3WHCA 3HDDA 3ZQGA 3B6CA 5F0CA 2NP3A 2XGEA 4FISA 1NK3P 1W0TA 1ZQ3P 3PO2J 5IOYA 1WPKA 1IJWC 2LTPA 4JX5A 2VI6A 2R0QC 1H89C 2L7MP 2LY9A 2CUFA 3F1BA 2PBXA 3Q0WA 3Q3SA 2MW8A 4GFKA 3M4OJ 2DA2A 3HTJA 2KT0A 4FE4A 5M5WJ 1MSEC 2JA5J 5EDNA 2WV1A 5FLVA 4AYBN 3BTCA 2X9DA 1TWCJ 1MSFC 1JKOC 2ME0A 3S15J 4ABZA 2R7ZJ 3GZIA 3BTLA 2L7ZA 3LSRA 2UXUA 1PUFA 2OERA 4DYRA 1UHSA 3G1OA 3C07A 2LK2A 5IOZA 4XRSA 1QVTA 3PASA 4XRMA 1OCTC 4ME9A 1K61A 5FKMA 3FRQA 3CRJA 4MLOA 4MIMA 1GT0C 1AKHB 3VW2A 1WGXA 1S7EA 1OFCX 2O7TA 3NARA 4A3KJ 1WCMJ 2E2IJ 1MBEA 1T33A 4FE7A 1P7JA 3JRFA 5IPAA 4M3GA 5DAJA 2ZCNA 5C44J 2LKXA 1LE8A 3S2DJ 1U8BA 1B8IA 4PXIA 4M3DA 1UG2A 2W53A 2IBDA 5E3NA 3S2HJ 3FISA 5C4XJ 5AQCA 3TW6A 4A93J 1NK2P 2DMNA 5C4JJ 3G1LA 5BNGA 2G7GA 5K58A 1ETVA 1TWAJ 5J1RA 3IH4A 1WI3A 4UUSA 1B72B 3A02A 1G2HA 2DA4A 1DU0A 3QBMA 1A5JA 3HGYA 3AQSA 3CWRA 2R92J 1I50J 4CYCB 3S14J 2NVXJ 1RKTA 5F0FA 5FLMJ 5EGOB 2QWTA 2DN0A 3JSJA 3HOZJ 3VVYA 5IYCJ 2DA3A 3KZ9A 4DW6A 3GTQJ 3SJMA 3ZQCA 2Q24A 3A01B 2FX0A 5FKLA 3SFIA 2XGCA 3H0GJ 3ANPA 2L9RA 3UKGA 3ON4A 5J1YA
chains in the Genus database with same CATH superfamily
3P9IA 3HTHA 2DU9A 3H0DA 4A3FJ 4HLXA 2HOAA 4F91B 2FUG2 2FNAA 2ACJA 1S6LA 4XR6A 5IP6A 3C2HA 3TBIA 1I1SA 1J9IA 2IPQX 4UVCA 4UDSA 4HNVA 2V6CA 3CO7C 3KEOA 2M8EA 2O7OA 3I0TA 3L9FA 1R1TA 1FOYA 2IA1A 4ASNA 2R7QA 3ONQA 4HQEA 2DFFA 3HJEA 1HF0A 4J01A 4E70A 5L3DA 4ENKA 2Y9ZA 2R7TA 3TEDA 3LQQA 1IC8A 3E6BA 5FHPA 1YX3A 2WAEA 1IN6A 4KN4X 5K5QA 5FFZA 3OYKA 4ZZDA 1J2XA 4ICHA 2R7RA 2KQRA 2K40A 3ZPLA 2Z9OA 1AA7A 5FROA 1SFXA 2GWRA 2WV0A 2M1BA 4M9SA 1JTYA 2HVRA 1OCCH 2LC2A 1J5YA 5E3OA 1S29A 2XF5A 2PEXA 4YIIA 1IRXA 1X19A 2TRTA 4OIPF 3DTEA 4Y52J 4KIBA 2ESNA 2DPDA 2P6TA 3QU6A 4QPQA 2H09A 1VQKI 1J09A 4O3MA 3OL4A 2FMYA 1LUJB 2I5UA 3GEUA 3KKDA 3K2AA 5M3FJ 5C4YA 2BVMA 2F4OB 4XL9A 1HW1A 1OPCA 2NS7A 4QIWN 4HLYA 2KRCA 2WB1A 4D9JA 2DFIA 2EZKA 4IRIA 3ROUA 5EFYA 2CQ7A 3HUGA 2P0WA 4UB8C 3ZRGA 4O5VA 2FF4A 2WAQA 1Y39A 1E17A 1F36A 2ZCXA 2EFNA 4BL0B 3LWFA 3S1MJ 5FJ8J 2IRFG 4RGRA 5ICCA 4P55A 2CFOA 3CTAA 2Q2EA 3FKJA 2K7LA 2X85A 3RKQA 2VJJA 3V8JA 1X3UA 3TKYA 1YOVB 4I6ZA 4ETSA 2HXIA 1Y0UA 1YLFA 2XHKA 1T8IA 2K86A 1R49A 1MMAA 1XMXA 2W00A 1YE9A 2A69F 3EUHC 4CGZA 2DJNA 1B4AA 3QPLA 5H20A 1VQ8I 3G56A 2J5PA 3DEUA 1H0MA 1BW6A 3ERMA 1D1CA 4HQMA 2DDAA 2Z2SB 3TOBA 2DYRH 1YQAA 2HTSA 5J1UA 5CKTA 5E1WA 1S7OA 1RRJA 1S7AA 3WGIA 4A12A 1BC8C 2DMQA 1ORKA 2XRLA 4KISA 5JLXA 1XDUA 2BXZA 2XPWA 4AVPA 2ZOYA 2O0YA 2ETHA 2A6HF 1GV5A 5LGNA 1ETYA 4YIRX 4NB5A 3WU2C 3VWBA 3CDIA 1ZHFA 3ZN0A 4EM1A 4ZJZA 4RAZA 2DBBA 2CW8A 2PI0A 3Q5FA 1BJZA 4NC8A 5DS9A 3F8NA 4G8XA 2VC0A 3M1EA 2JN6A 1DGWY 2G7UA 2DOFA 2FNPA 3MWMA 2E36A 4FCYA 5EEHA 2EK5A 2LF7A 2LR8A 5ERIA 2XAGA 3TO7A 1XTAA 2O3FA 4TV7A 1TP4A 2RN7A 3K4BA 3SZTA 4NHJA 2FJI1 3CLQA 3ZMZA 2HPMA 5FO5A 1O3SA 2PFVA 3QAHA 4EJWA 2FMLA 4HV5A 1MKMA 3IH3A 4E7JA 2Z5UA 2WAFA 1EV7A 3EUAA 3IL2A 3O3KA 1L3LA 3VOXA 2UXHA 5CQGA 3F9KA 3V7RA 1KU2A 1YS7A 4IL6C 2QBYA 3ZQFA 1DPUA 4AC0A 1O4XA 2WUIA 3S2WA 4BJTA 4DYQA 5LGTA 3OYBA 1X1AA 4XLHA 2FOKA 1QZEA 2DO7A 2HQRA 3KCCA 3J7AO 2W48A 1ENHA 4BGDA 3C3WA 3CCUI 3J7YJ 2DPUA 5D4SA 4OAYA 3HTAA 2XV4S 4KITB 3TDZC 3RD3A 2FA5A 3DBLB 4S05A 3T8RA 1GLNA 2BE5F 4EM2A 2FBHA 2HQ5A 4PJJA 4KNYA 1V54H 5HODA 1ZRDA 2RNJA 3GZ5A 3LSHA 4XN0A 3ZMUA 4IHYA 3A4CA 3JRIA 2ZXHA 2XGXA 1K4TA 2X1DA 3P9TA 5FGMA 2UXNA 3F21A 1W5TA 3D5RC 5CVVA 3U21A 3W3CA 2VODA 1UI5A 2MH9A 3H36A 1Z3YA 2DA1A 1SANA 1FJLA 1MNEA 1WJDA 1MDMB 4UUVA 2XKPA 1ITYA 3ASOH 2FEZA 2R7VA 3BR6A 3MQ0A 2LNBA 2H1LA 3GMEA 1P92A 3ASNH 5IP7J 3L1PA 3M8FA 1AOYA 5J3LA 2FJ1A 1OJLA 2K27A 1IDYA 3WTWC 1HDPA 1ONVA 2K5CA 2P6SA 3DKWA 3O8HA 5GPAA 5ICFA 1S8NA 1T56A 4RAFA 2DTZA 3HOXJ 5IYBJ 1Y56A 2H8RA 2NS8A 2RKHA 1FP2A 2NNYA 1ZAOA 4M9XA 3L2QA 5CPRB 3KIOA 4GFLA 2GBYA 2XIGA 3OOPA 3JSPA 3LSJA 1X4OA 1HW2A 1FEXA 1JUMA 5FFXA 3QODA 1B59A 2L7FP 1EF4A 1MMGA 2V79A 1QPMA 3HTSB 4ZYHA 1XG1A 2BVLA 2Y0MA 1N78A 2J5OA 2BZTA 3QOPA 4I99C 2R7DA 3RPUD 1FT9A 2LKPA 2KISA 4JOMA 3RH2A 1MZBA 3CCLI 2OA4A 4D7MA 5AONA 2ZJPF 3DU5A 1Z0XA 2LY1A 4QSHA 3WHBA 1DP7P 2R5YB 2M7AA 3W6VA 2OZ6A 3FXJA 4WX9A 1PUEE 1ZRCA 1E2XA 2BYVE 5K7ZA 2QSGX 4CA0A 2M34A 2ZC2A 4MQ9F 1G59A 3UR3C 3JRCA 1W1WE 2Y30A 3CCSI 3Q0VA 1YJ9I 3KYLA 1R5GA 3EUHA 5DDGA 3HHGA 3H3VK 1OCZH 3NNRA 3HM5A 3HOTA 3C2BA 3G1MA 4BHBA 4HX4A 4ZDOA 2UUZA 4H4KC 5CVRA 1ON1A 2E7XA 2YPRA 3FXRA 2DDBA 4D0PA 3VSLA 1YITI 3WU0A 2GFNA 1O3RA 3H3ZA 3VVXA 2V9PA 2M8GX 3K4MA 1O57A 1QU3A 5DYMA 3RZDJ 4ESBA 3HC7A 1D8JA 3H3UA 2RAEA 2GLOA 3IWZA 3W6KB 1KU9A 3W2AA 3M8JA 1TTYA 3VPRA 4AD9A 3T5XA 4X0GA 1WFXA 3FF5A 1XX5A 2IT0A 3GTOJ 1UAAA 2XGDA 1FY7A 1YW8A 4BQAA 3M3YJ 5IY5H 4N4NB 3LJLA 4MK6A 4AIHA 1W4MA 4ACIA 4XLCA 3WTSC 2ELHA 2QWWA 2N8GA 3B73A 3RYPA 2EV5A 3ZMSA 1VFCA 1XS9A 5JVGF 1XGNA 4CYCA 2LH9A 2BEOA 2W57A 3G4SI 2H1KA 1H9GA 4A2UA 1BN5A 1RUNA 5DCFA 1FOWA 4LIUA 3PNYA 3VODA 5JHUA 2XROA 2MGQA 1ZN2A 4NQWA 5ILSA 5FLXK 2IGMA 2FSWA 2Y0SN 4U87A 5H6QA 4XICA 2R7FA 2AQEA 1WSUA 4EATA 4LMYA 1JI8A 2NVQJ 1FIAA 5DV5A 4PGGA 4GGGA 1STZA 4JX6A 3V8KA 3MVPA 4I7HA 2L3DA 2VIXA 4C3HJ 1WQ2A 3C1DA 5LRSA 5FGLA 3NS4A 2DMTA 4ENNA 3ON2A 4XLAA 2HTJA 3O60A 3I71A 2CSOA 3CQZJ 3PUBA 4JQFA 3BP8A 4AIDA 3P7NA 1LDJA 1G3TA 1EH6A 3WHCA 5BPDA 3HDDA 3B6CA 3GTLJ 4GDFA 3GFMA 2GZWA 1W0TA 1NK3P 4RB1A 4BAYA 1SC7A 5E8IA 2GIZA 2L7MP 2ZXIA 4EGZA 4V19K 3DLAA 3Q0WA 2KHMA 2VQHA 2KIQA 1IRGA 4IRVA 2K9LA 3WTUC 2HKOA 3IAM2 2DAOA 4HW0A 3D5LA 1WJFA 3CMAI 4O6JA 5M5WJ 1MIJA 2E7WA 1LFPA 2YSRA 2XVCA 2JA5J 4KA4A 3G3ZA 3P5JA 2ELJA 4IRGA 4ABZA 2R7ZJ 2OZUA 4B3XA 2DW4A 2ZJ2A 3M7GA 1K7AA 4DYRA 4M9ZA 1ZRFA 4XRSA 2RNGA 2XASA 3HKZA 4XRMA 4A0ZA 1K61A 3FRQA 2WWYA 2AS5F 3H9JA 3OR1C 1WGXA 5LHHA 2YU3A 4A3KJ 3MZHA 2W1OA 3CD6I 3BJOA 1P7JA 4G6TB 5JI6A 4LJZF 5IPAA 3KLOA 2VJ4A 2X0LA 2JZYA 4A6DA 1W36D 1D1BA 3ZCOA 2H6CA 2Z33A 3Q9VA 4XLPF 4HSTA 4RLQA 4PXIA 5E20A 3FISA 5C4XJ 5AQCA 2DQLA 5C4JJ 3F3XA 2P5VA 3BOQA 3DF8A 5BNGA 5J1RA 1O3QA 5K58A 3I56I 3RKXA 3K8PC 4BE0A 2DA4A 3KP7A 3N4MA 2QENA 4ESJA 4LITA 3CWRA 4BQOA 2JA2A 2CUJA 3BY6A 1MMNA 3CESA 2NVXJ 4KIFA 3S32A 4BXUA 4ENMA 3E3VA 1Y0NA 4DW6A 2W25A 4MEXF 4B44A 2ZMEB 1MNDA 4MQVA 1VQ5I 2Q24A 3CC2I 3A01B 2RQPA 4YFKF 1G3WA 1LJ9A 3H0GJ 2FXAA 3ANPA 2K9QA 3K1NA 2KPMA 2RQQA 2BGCA 2O03A 2XAJA 3K4NA 4U88A 3OS0A 3CCJI 3DCFA 2CU7A 4A69C 5EJCA 2WGBA 3OSGA 1ERDA 1YYVA 3Q9SA 1DU6A 4QWQA 1YRNA 3FXQA 1B1BA 1ACIA 4HKUA 4YIFA 3S17J 4C3IJ 1IXCA 3PNTA 4FX0A 2IP2A 2QA4I 4EEFG 2GAUA 4QTRA 2Z16A 3QYEA 5E3LA 1ZTRA 3DP7A 3GO5A 1T0FC 3HG9A 4U0YA 4AM3A 3HPGA 2PMZA 3HYIA 1X1BA 5EZGA 3K4KA 4BBSJ 1WJBA 2BV6A 3H9QA 4MO7A 4HF1A 1WVRA 1H9TA 4A5MA 2K9MA 3BRUA 3WTXC 2CO5A 3ZOBA 1LVKA 4A3LJ 2X1CA 3BR1A 2B0LA 4ENJA 4CCMA 3VDXA 3OV8A 4MXMA 2K9SA 2JVGA 1W7PA 5DD4A 4RDUA 1HBXG 2GENA 4II2A 1W5CC 1OLTA 1XD7A 5L3GA 1APLC 1T98A 4HSRA 4BE1A 1PUFB 3BQYA 1WH7A 5KK1A 2BY0A 2LDUA 1RESA 3V7SA 3ZQIA 1ZGAA 2OPTA 4HRIA 3E97A 4EJUA 3RDIA 3QP5A 3N05A 4DOZA 2AO9A 3W6JB 2KJBA 1Y6IA 1QO0D 4RS8A 1E3OC 1I3QJ 3CCQI 4PFPA 3FWEA 4BY7J 4E4HA 3IP4B 4NELA 4EM0B 3OIPA 1B8IB 3PSFA 1FZPB 2OTJI 3SEQA 3I4NJ 2HZTA 1FBSA 1I27A 1HKQA 1XMAA 2HQAA 5IT3A 5DM7F 4J19A 2UXOA 3DWLE 4HPQA 4HF0A 2VKEA 4FX4A 4FETA 2DFEA 2F6CA 5LD2C 3OYGA 2E1OA 2ZSHB 4AC6A 3GBGA 4PK4A 3HOUJ 2VBYA 5J6XA 1JGGA 1U0JA 1YW9A 1V5GA 1EA3A 4PFOA 1V5EA 3ZQHA 1RPWA 4E7SA 2DG8A 3CO6C 2EH3A 3KE2A 3MKLA 5E3MA 2XDVA 1VQ4I 3JRAA 1ZH5A 2A07F 4L9JA 2WTEA 2DK5A 5CVJA 3TP3A 3ECHA 2CH0A 1F1ZA 4NC7A 3WTYC 3F8MA 1ETOA 3ERED 3NWSA 1MH3A 1IN8A 1BI3A 3GEZA 2VC1A 3J80Z 2DT6A 3V7CA 2PN6A 2DT7B 2HXOA 3RQIA 3ZXSA 1U9NA 1G3SA 2O8KA 1MNMC 3DKXA 5LHIA 4D1QA 1R36A 1KQ8A 3K1PA 1P4AA 4LOCA 2QCOA 3LHQA 4JKZA 2FRHA 1IUYA 4OU0A 2R5ZA 4KJZA 3V6GA 3L00A 4X6AJ 3VW0A 2C6YA 4AYBA 3DXJF 1E3HA 2CQKA 4AVZA 3B6AA 4G9YA 4M6VA 5B1BH 3BHQA 1GXPA 1MMDA 4BUPA 2LY2A 3WG7H 1Z91A 3S1NJ 2LP0A 4IOAF 3OYDA 2E71A 4LK0F 5BS6A 3AL0B 2COMA 4KN7X 4JK1X 2FE3A 4ZYDA 3BNIA 3BG6A 2DMUA 1RC9A 3A0HC 3BQZA 3BR0A 3BR2A 4UNOA 3FBNB 3HE0A 5HAWA 3G2BA 2PLYA 2WB1N 2MD5A 3H35A 5JVTA 3AL0C 4GYIA 3CCEI 5EG0B 2HEOA 4WCGA 4P96A 2B9SA 3TQNA 1IDZA 4XM3A 3FIWA 2WAQN 3NI7A 5K5OA 5EYRA 2Z3YA 1ETKA 4M3BA 4MFDA 3DV8A 1U2WA 3NPIA 2HGCA 3HSRA 4OIRF 4EJVA 1ZYRF 4IXAA 4UY8I 2WC2A 1DP3A 2HS5A 3OSFA 4C2MA 3CUQB 1A6IA 4RB3C 3L09A 3KX2A 3AG3H 4C3JJ 1KYWA 5LLQA 1JHHA 3REOA 3HB9A 4UVAA 3I55I 2BOLA 2DA6A 4XRFA 5FB2A 4OMYA 1KZHA 1CGPA 3EPZA 3JTHA 1JKPC 2ZJQF 1CF7B 1OCRH 4CZCA 2VUMJ 1RETA 4BEHA 2IS4A 3FHZA 1QZZA 3R4KA 5EF6A 3L2UA 1R1VA 3OYHA 3JRGA 1FMWA 3S16J 2ZXJA 2DCEA 3E0JB 3GW2A 1A6QA 4L62A 2CJJA 4J00A 1JT0A 3ZQ7A 5F1JA 1QPIA 1N25A 3V4GA 3GTKJ 3MKZA 3U9GA 2EA2A 4RGXA 5FRNA 2YUSA 5BOXA 4Y13A 4GCTA 2ADUA 4JP0A 4XSZF 3ULQB 4C9YA 2VPLA 2ZOZA 3OYIA 1TQMA 1Z21A 3LWJA 2CS3A 3ESWB 3LA2A 4ANJA 2K02A 4E7KA 1ZLKA 4A3CJ 2FBIA 4PSWA 3R6SA 1WJ5A 2PJRB 2RREA 4XIDA 1D0ZA 2LRDA 2F07A 2A68F 2IA0A 1TBXA 2VT2A 2HYTA 4C2TA 2MSYA 2KDOA 3HTUA 3S5RA 3C7JA 3E5UA 1HDDC 2ZCMA 2LOOA 2A6TA 2AQFA 1AU7A 4IKFA 2G3BA 2DFHA 4FT8A 5CXIA 1SFKA 1RZ4A 4I2OA 4WF2A 5D5VB 2IW5A 2HOSA 3VP5A 3PQJA 4IQJA 1WJCA 2WY7Q 2NVUB 3ZMDA 2LLKA 3K4CA 3HOSA 4DYCA 1MBJA 4Z2YA 2M0MA 4B1RA 4PCQA 4XNFA 4NN1A 1X2MA 2MABA 4Y15A 3QOEA 5M3MJ 3CF2A 5C3EJ 1QNTA 2X4HA 4A3MJ 1YHQI 1BW5A 2YS9A 2ZKZA 2UXIA 1XCBA 5EEAA 1SGMA 3ZMVA 2IS1A 3BJ6A 5JHFA 2DMPA 1HC8A 4ZYEA 1KONA 2ISYA 2IGOA 2HPIA 2DOEA 3LSGA 4PZJA 3ZQQA 2DG7A 3CC4I 3SDBA 3ABKH 3LNQA 2LBFA 3WTZA 1Z6RA 4XBFA 1CQTA 1ZLJA 1KQ0A 2VN2A 5D8KB 2O9LA 4EJOA 1EJ9A 2PMHA 3CMEI 3M8EA 4CCJA 3DFGA 4EVIA 4BDYA 1RR7A 1TWHJ 3MZYA 3RIRA 3OIQA 2GOXB 3QKXA 2FBQA 1NH3A 1PYVA 3DPLC 4LG0B 4UV9A 2ZB9A 2W82A 5GAGJ 4IHXA 2XAHA 2IS6A 1U78A 1IV6A 2E2HJ 2R4GA 2V4JC 2VASA 3JW4A 3K10A 1D5YA 1LDDA 2OTLI 4AIJA 1B72A 3H5NA 4I0AA 4RAGA 5GAHJ 5K7HA 1ZKGA 3VW1A 2WBMA 2MC3A 1K78B 1X4PA 3GTPJ 4NNJA 1QZYA 4DZJA 2EIJH 1X2NA 2D2WA 1Y1VJ 2QQAA 1ZK8A 4XKCA 3BJBA 2E1MB 2WADA 1JJ8C 2V1DA 5HOOA 3JREA 5EEGA 4WXHA 3U1KA 4A6EA 2XDNA 1R7JA 2L7KA 4GFBA 3GTMJ 2E35A 2VB6A 2ZFWA 2P8TA 4L5IA 4A3EJ 4C30A 2E1MC 3I59B 1S5LC 4RAYA 5E79C 1SMTA 4HZFA 3CJNA 3CMMA 1G6NA 5F0HA 4KDPA 1QVUA 1QRYA 1TNSA 3VYSB 5D5UB 3CF5F 1SFUA 2XAFA 1T95A 2HKXA 3BG3A 1TQPA 5F0CA 4G94A 2V6EA 3B02A 1XGMA 2MYSA 3LSTA 3VB2A 2VI6A 4CHUA 3F1BA 1FPQA 2VQCA 3GFJA 2MW8A 4GFKA 3IWFA 1R4MB 2DA2A 1SMYF 2CQNA 4XQFA 2FU4A 4FHTA 5J8FA 2UWMA 4BHPA 3I9V2 3BTCA 4WIBA 1VQNI 4XMYA 2M30A 1R71A 2ME0A 5HLHA 3WE2A 3LA7A 3BTLA 5DD8A 1XB4A 4N0BA 4EQQA 2O6GE 2RGVA 1A36A 2D1HA 2HZDA 1FOKA 5IOZA 4R8HA 1QVTA 2JUGA 5E1ZB 5J8CA 3WE3A 3HRTA 2OCEA 4L0ZB 1BR1A 2EIMH 3U1DA 3CCMI 1AKHB 1PP7U 1ZREA 1FYMA 4A0YA 3VW2A 1FBUA 4HA8A 4L9TA 2GA2A 1Y8RB 4Y3OA 1X3ZB 1FC3A 1IXRC 3COAC 4FE7A 1JE8A 3SXYA 4BHCA 5HVQC 1TT5B 3CC7I 3GCMA 4UV8A 3BG7A 1E0EA 2ZCNA 5DAJA 1MJAA 3IAS2 4HNTA 4N4OB 3OYLA 5B1AH 2IGNA 2UV1A 3S2DJ 3CJRB 5BPIA 5E3NA 3S2HJ 2YR2A 1YTYA 1PVEA 4A93J 1NK2P 3W2WA 3TO9A 3G1LA 2H94A 1MJ9A 2XF6A 4G6DA 3MZ8A 2IXSA 5KAIC 3E5QA 2R7OA 3A02A 2VT3A 1G2HA 1JGSA 1VQOI 3ML6A 3MKWB 4E7HA 2LSOA 1A5JA 3AQSA 3E5XA 4P1WA 1D8KA 3S14J 5F0FA 5EGOB 1R5HA 5FLMJ 3JSJA 2F5CA 2DJIA 4HDVA 5E18F 3BROA 3T8TA 2BW3B 3GZNB 4NC6A 3ZQCA 1O7FA 1R23A 2MC4A 2CFXA 4XLFA 5FKLA 3SFIA 2XGCA 4EJTA 4IPAA 2ZO4A 3UKGA 2CV0A 3VTIA 2O8XA 3C18A 4M6XA 3AG1H 4UXNA 2LFBA 3GFLA 5B3SH 5A2QK 1AHDP 4DVYP 2QSFX 4P9UA 3B81A 2QGUA 2QQ8A 4UHTA 1AWCA 1MBGA 4X1EA 3HSFA 4CCKA 2X51A 4B3AA 2F5EA 1NHAA 2P5KA 2V1XA 4I0BA 5HLIA 5FKNA 2MH2A 4CH7A 2EFPA 3IRRA 1VQMI 4U0VA 2YU9J 2Z99A 1R9TJ 3HTIA 4KT6A 2K4BA 4ZZLA 4IEJA 3E1SA 4FQGA 2G0EA 2CRGA 2QKMB 5DCMB 3GXOA 3ZR8X 3GLXA 2NNNA 4YELA 2HDCA 2KJCA 5DTDA 2OQRA 1U5TB 1KU7A 3K1MA 2L4MA 3TW7A 5TJJA 2XF7A 3OMYA 3KYCB 3QRFF 3VVZA 3BZKA 4ZTFA 2HYJA 2X6WA 4P9FA 1J59A 3MCZA 3V8LA 1FYKA 5H6RA 4IOCF 1V3FA 3LSPA 1X1PA 1U5TC 1F9NA 3RKYA 4QLCU 2M45A 2PQ8A 4B09A 4PJ0C 4BDZA 3W2VA 2NYXA 3HKZN 2XAUA 3QPTA 1BBYA 3F6VA 4JYKA 4RGUA 4Q5SF 3RSNA 3KEYA 3SEZA 4M74A 1MMSA 2Y9YA 2ID3A 2LREA 3F0CA 2ZJRF 4LD5A 2BY2A 2K3FA 2OUMA 3PUFA 3HOWJ 2KIFA 3M9AA 3JSOA 3I4MJ 3I58A 3CZ6A 1BA5A 3OYJA 4ZYAA 3CCRI 4OOIA 2YVHA 4B4CA 2VKVA 4PJLA 2W7NA 4R1HA 2ID6A 1UFMA 2GQQA 1QQIA 4BXXJ 1UI6A 1LE8B 4RBOA 2Y48A 2LKSA 2M0CA 3NQOA 4LIVA 2EA4A 3I54A 4U0WA 3COLA 1T39A 1B9NA 1W5SA 1MBKA 1IW7F 1S9HA 3ELKA 2UXPA 4CGRA 3KPHA 2O61A 4UUSB 2R7WA 1IGNA 5FD6A 2TCTA 1UMQA 4MNUA 3GTJJ 3RJPA 2QKOA 1BM9A 2CMPA 2JSCA 5F08A 1MDMA 5JR3A 3HOYJ 1FIPA 1U9OA 4I09A 4YEJA 1LFUP 2NRAC 4ZYGA 5CVIA 1MBFA 3F8FA 2P7CB 1X3WB 9ANTA 2V9VA 4IHWA 5E1XA 2M7BA 1Z3XA 3M07A 4PSXA 1ODDA 2VBWA 1F5TA 1OCOH 1UZCA 2VQLA 1JXSA 2F2EA 1WHUA 3FKIJ 1IN7A 1OR7C 5HSZA 4JL3A 3IRQA 1ZGWA 4AF5A 4ZC3A 3RTRA 3IKTA 2L9VA 4OMZA 3LQRA 3DPJA 2HDWA 2XRNA 1UJ8A 3S3OA 5D5XB 4NBQA 1FNNA 3DLLF 1R00A 2CQXA 3WGHA 1N75A 2OI8A 4UUTA 4ZDLA 1J75A 4HNUA 1W0UA 3LA3A 1R58A 3FXOA 4KYWA 4D5CA 3I53A 3LSIA 4BY1J 1WKMA 2F5DA 1TWFJ 1LFBA 2F5VA 3NRVA 4I98B 3SQNA 2G7SA 4N9HA 2ZMEC 3BG9A 1S72I 1E3PA 1XGOA 1FP1D 2CUZA 2R5YA 4OD4A 3AG2H 2QM3A 3FDYA 3WTVC 2JT1A 1K79A 1OYYA 1VNDA 3H92A 4OIOF 3RKWA 1MH4A 1RI7A 3SWHA 2EZLA 3MN2A 1GV2A 2I10A 3F6OA 2M87A 1K6YA 3OS2A 3FXUA 1YIOA 4CCNA 3ANGA 2RDPA 2P4WA 1EH8A 2VE8A 3P9CA 2EILH 3S93A 5GADJ 3A03A 1GXQA 4HV6A 4YRVA 1SAUA 2Y69H 1P4XA 5D8LB 4F93B 3K70D 1Q1VA 2PFBA 3HUGB 1V5FA 3J81K 2EQRA 2ZNZA 3JR9A 5D1RA 1TNTA 1V55H 3MAJA 1FTTA 3ZQLA 1SVLA 2KIUA 4BJ5C 4YZEA 1LNWA 3DBRB 1SFOJ 4RLFA 1ZR4A 1W36C 4BYYA 4OD5A 2XSDC 3O2PE 1KQ9A 2QIBA 3ECOA 4U9NA 2ISZA 4M71A 1U3EM 2Q2EB 1G8XA 2VXZA 1I3AA 2KL4A 5KNLA 3AQTA 2KIMA 2UZKA 2DK8A 1BR4A 3K2ZA 4A3DJ 4XRSG 3OOUA 3S8PA 3BR5A 3WODF 5D5WB 1DQUA 3K6GA 1XC5A 2E5ZA 1IUFA 3RPUA 4KWAA 5HNHA 3P9KA 4RM2A 4GCKA 3HRUA 2LYCA 1OYWA 3IHUA 5E8GA 2XPVA 2ICWG 3AAFA 3LL7A 3ABMH 2K4JA 3VUQA 1YG2A 2ZNYA 1QBJA 2STWA 5F27A 1XSXA 5EZHA 2PG4A 3L2VA 4IZZA 2D6YA 2VPRA 4LG3A 2BHZA 2Y2ZA 4Y7NJ 5M5XJ 2IJLA 1A04A 2EV0A 3PPBA 3PM1A 2MLGA 2DLLA 2MG4A 2X6XA 2HNHA 3HIFA 5D19A 2EJRA 2QQBA 1DUXC 5B5EC 2HDDA 2Q8KA 2FBKA 1OQYA 1VI0A 2BHYA 2BXYA 2OD5A 4KFCA 2ZCWA 3E7LA 3ABUA 3LAJA 4W97A 3G71I 1KGSA 3OIOA 2L01A 3GTGJ 5CVUA 2GUHA 5CJ9A 2KKOA 2ZBKA 2EZHA 1Z7LA 2QUFA 4DQ2A 1JHFA 2YX7A 5GTIC 2QZ8A 5LEJA 2ZFUA 3MMYB 4HDUA 1A31A 2QBYB 4BE2A 1NG7A 2H27A 2DYSH 3KEQA 2HI3A 1JKRC 3CMYA 4XLEA 3IH2A 1H8AC 4WK8F 2LG4A 2A2FX 5D4RA 4M6YA 2DA7A 4IF4A 3BZCA 3KFWX 1BI1A 4ESFA 2F4IA 1NTCA 3CCYA 5LEKA 1HA8A 1VTNC 1K6OA 5L3EA 3RI4A 3KP4A 2VE9A 5CXGA 1J7KA 2RHAA 3AFHA 3QP6A 3L2WA 3GX4X 4E7ZA 4E7LA 3CJDA 3D1NI 1XDSA 2ME6A 1VQ9I 2L9SA 2CYYA 5CYVA 3OYNA 4KIGA 2KRHA 3VEPA 4ZH4F 3JRDA 4XK4A 4A3BJ 3EYIA 1OR7A 5BQTA 1IV8A 2R3SA 4XN3A 3AG4H 3BWGA 3G7RA 4MFEA 5D18A 2JA6J 2FD5A 3S1RJ 5GP9A 1SD4A 4RB2C 5IYDJ 3KNWA 4BBRJ 2V57A 1JUPA 1HSJA 2IA2A 2NX4A 1I5ZA 2MD0A 4CICA 2XB5A 5F6FA 3R0AA 2HU9A 1K83J 2X6OA 1TQIA 3QWLA 1X1CA 4M3FA 4FASD 1BOAA 4Q48A 5L3BA 2REKA 4Z6YA 2B3WA 3BT9A 4CO8A 2L5QA 4DGWB 3GWZA 3QQAA 2B63J 3TDUC 5A2QZ 2ZMEA 3NWTA 1FLIA 1ON2A 1MBHA 2L2OA 3A01A 1OYIA 3CJTB 1BL0A 4E7IA 5CW8A 1SD7A 3FM5A 4N9IA 3RPQA 2V26A 1C0WA 1TZLA 3DEEA 3HBLA 3E7QA 4PJMA 2EBIA 2JQ7A 2HQNA 2A05A 3CUQC 3EUKL 5TGTA 2HKUA 2DI3A 4OIQF 1HQCA 1I1GA 1T0FA 3CJQB 3E6MA 3KZYA 4CDGA 4EV0A 3F8BA 3VYUB 3BJAA 1O3TA 1QA6A 4AWXB 5LBQA 3PO3J 2EPFA 5FLXZ 2IU5A 5JLWA 3EETA 3DU6A 4IX7A 3QU3A 1ZG3A 4LK1F 3WTTC 3ZQGA 4G7ZF 1SD5A 2NP3A 4FISA 3DBHB 3QYFA 4LLGF 5IOYA 5DM6F 1IJWC 4M73A 2LTPA 3PFYA 1R5ID 2EB7A 1H89C 2EFQA 2LY9A 2CUFA 2GIVA 2DXIA 4IHSA 4CUGA 1YS6A 2EFOA 3M4OJ 4BJ6C 3JTGA 3AKZA 3OYCA 5EDNA 5FLVA 3DPUA 2GXGA 4YFNF 1TWCJ 2E60A 1ZG1A 4S04A 2G9WA 3S15J 2L7ZA 5LRRA 3LSRA 2UXUA 1PUFA 4MTDA 3KLNA 5GTHC 5LGUA 4OWRB 4RM3A 2P5LC 3C07A 2VQGA 2QSHX 3PASA 3LSKA 1OCTC 2VONA 3OS1A 4MLOA 3L2RA 3VYTB 3M1CA 1R1UA 1OFCX 3D5SC 2KLOA 1BI0A 1WCMJ 3BZ6A 4WWCA 1T33A 2E2IJ 4WXDA 2HWVA 1BIBA 2GXAA 4F7ZA 5ILUA 1USTA 1QGPA 2E1NA 4ITVA 3UNGC 2MFZA 1HSTA 4G7HF 1B8IA 4M3DA 1L0OC 1UG2A 4I01A 3KP5A 4XOTA 4L5JA 3TW6A 5HS9A 1MD0A 2KRFA 1KA8A 1PJRA 4L18B 3J7ZI 1TWAJ 2FOWA 2BY3A 3IH4A 4B47A 1WI3A 4IQ4A 3GYHX 5K1YA 1DU0A 3QBMA 3BPXA 1LB2A 3IKVA 4IVNA 2R92J 1I50J 2VBXA 4CYCB 4HYEA 1RKTA 1F4KA 2QWTA 2DN0A 3R61A 2RVCA 2P7VB 1QHGA 5IYCJ 3VVYA 3WGGA 3GTQJ 3SJMA 5K5RA 4QPOA 4B48A 1LPQA 2X6YA 3JAMK 4Q4ZF 3S3NA 1RR8C 2MBFA 4NQWB 1I39A 2AXLA 2BY1A 2FX0A 3FM3A 3VSKA 2VOPA 2OBPA 4DNCA 5B66C 2L9RA 1D0YA 3ON4A 4KMFA 1TC3C 2PBIA 1UCRA 3HOVJ 5HS8A 2R93J 1ZGJA 4GYGA 4F3QA 3C2GA 3SZGA 1XMKA 1WJEA 3CDLA 3PSIA 4RA2A 2H6BA 1P7IA 2W24A 3KP2A 2E2JJ 1A35A 3IV5A 2R7UA 2ESHA 2DA5A 4CZZA 2PMUA 5H2FC 4YG2F 3BCBA 1USSA 3WG9A 1FSHA 1YW7A 3FXLA 2E34A 4BU2A 1IG7A 2ZY9A 4JNNA 2AXTC 3QPSA 2ECBA 4M3EA 3ABLH 5H9TA 3FX3A 3HSEA 3BC8A 3EGQA 3MEXA 4F52A 3J7AY 2MA3A 4G6QA 5KVRA 1MGTA 3DQVC 3HGGA 2VJ5A 4A3GJ 1ETXA 1HLVA 2NOGA 5L3CA 5DEQA 3HIMA 1XSVA 4L0YB 2IGKA 4KUMA 2XUBA 1OCPA 3FBIB 2L54A 1PP8F 5F1RA 3DEWA 3H5AA 4BNCA 3TP0A 4U9LA 4AU7A 1XSDA 4HG2A 1R22A 2W85A 5AIQA 3NEUA 2VLAA 3KP3A 5KAFC 3J81Z 2H8WA 4PUSA 4KT5C 5EG0A 1YI2I 3FXKA 5F04A 1OKRA 3QPHA 1POGA 2A6EF 2ELKA 3K4LA 2A61A 1Q1HA 2VOOA 1SEUA 4GO1A 4IRHA 4WXCA 3O8GA 2QKLB 1FOXA 2R7SA 3S3MA 2Q1ZB 3CUQA 2RASA 2VXDA 5JFRA 3CP2A 3KYDB 1NG6A 3SYTA 4V2FA 1D5VA 2ECCA 5KHDA 1WH5A 4LFUA 1D1AA 4RB0A 3O6BB 1G4DA 1CF7A 2JA8J 4L5EA 1OISA 4B43A 1W7PD 3NAUA 1P6RA 2CQQA 5CLSA 3K4JA 1D3YA 1Z7UA 1Y1WJ 2KP6A 2XB0X 3J80K 1SVOA 2NAZA 2IAIA 2ZXWH 1N77A 4GCVA 5J47A 4Y4RA 1ZARA 3ABTA 1BR2A 2W84A 5HNFA 1YJNI 1FSEA 1T6SA 1ETQA 3GF2A 3T6NA 1RIOH 2F4MB 3D0SA 2HVSA 1Z67A 1KYZA 2F5FA 2VJIA 3MD2A 3BTJA 1UHMA 5IT9K 1B6AA 3ZMTA 2X48A 2WA0A 2OF7A 1YRNB 1HKSA 3EDPA 4BKXA 3RQ4A 2K85A 1WWXA 2HVQA 3A0BC 3V42A 5HDKA 5LFAA 2O5RA 3BDDA 2OCCH 1IAWA 2PJRA 3L7WA 2A5YB 2A5WA 2UXXA 5HDNA 2EWNA 1P4WA 2HYGD 1JTXA 4OINF 1U6GA 2K9NA 3K9TA 1FTZA 1XN7A 4IJAA 1K4SA 2XC7A 2EIKH 3SHFA 4CYDA 2B7EA 3K7AJ 2AHQA 3LOCA 1S3JA 2JRMA 1D0XA 2M9HA 2RC4A 1T2KA 3ZN1A 2XAQA 3VFZA 5GAEJ 1JUSA 2JPCA 4MGRA 4IHVA 4JBAA 2ZSIB 1LQ1A 4LB5A 2NVYJ 2NXNB 2GA1A 1RKWA 3PQKA 2Y31A 1YJWI 1JT6A 1T38A 3OYMA 3TOAA 3TMOA 3MNLA 2OV7A 2DOAA 5FMPA 1W7PB 5IP9J 4V2GA 1TWGJ 3VYRB 3HL2A 1IXSB 1SVMA 3I5UA 2JK3A 3GUDA 2STTA 2P81A 3DTKA 3VOKA 2DTRA 3QYBA 1IO2A 2L9NA 4G12A 3PJRA 4CCOA 3SDGA 2HOTA 2E19A 1X1DA 4BQQA 2XPUA 2JVHA 5GPCA 3LMMA 3WU1B 1GDTA 3GFIA 4OAZA 1WI9A 4IO9F 2D5VA 3BPVA 1R4NB 1FMVA 2JWTA 5L3FA 1ZR2A 3HEFA 5ICEA 2GXBA 1T08B 3LFUA 3FMRA 1ZELA 4DIQA 5HBUA 2QLZA 4C2UA 2COBA 2DT5A 2JJ7A 3MKYB 1Z05A 4DZPA 3S1QJ 3SZPA 3JRBA 2EFWA 2CGPA 1HCRA 3NRGA 2PZ9A 5KCMA 3OWTA 4LG0A 3NXCA 1P2FA 1TLHB 1KU3A 4II3A 3PL8A 2BBYA 2VL8A 2NP5A 3RCOA 1R6RA 4ZTJA 4YFXF 4CSWA 5LHGA 1LKXA 2OAZA 1LEBA 2M2EA 4D7NA 1WZ2A 4LLLA 3LSMA 2HOEA 2V7FA 4BACA 2W4SA 2MLKA 2TDXA 3E6CC 1P9QC 1K78A 3TO6A 3R0JA 1Z9CA 2VKHA 3BLYA 4W1UA 4Y17A 1MJBA 1ULYA 5HDGA 5HLTA 3F8CA 3DKYA 4UB6C 2OU2A 2QVOA 4ZDPA 2WY8Q 4U7BA 2KDZA 4HBLA 1IF1A 3F23A 5HS7A 3OYEA 4EMSA 1B9MA 1UG0A 5TISC 1TL8A 4A3IJ 1LEAA 3FK6A 3HHHA 1J0RA 1X58A 2OQGA 3T0YA 1XCVA 2Z1DA 1UB9A 2CW7A 1SAXA 2Y0SA 5ILVA 4HEA2 2HR3A 3HRMA 2GOMA 3FK7A 3I59A 5CQEA 3V78A 3A2KA 2M3AA 1HXDA 3OR2C 4XKWA 4XOPA 3FHNA 2CUEA 2L02A 2CV2A 4EGYA 3I3LA 3EYYA 3KKCA 1XGSA 2R5ZB 1TT0A 2XSJC 2DQRA 3K69A 4BS9A 4L9VA 1LVAA 3EQLF 4LB6B 1Z6TA 5J40A 3ZGKA 1H88C 1OMIA 1EH7A 1FYLA 4DBQA 4B8XA 2KZVA 3VIBA 5DUKA 1IRZA 5J4VA 3OYFA 1GUUA 2JSPA 2KZGA 1WRJA 3RYRA 1VQ7I 3TL4X 4NDLA 4M72A 3LAPA 1REPC 3CLOA 1BOBA 3CUOA 3ZP5A 4FTHA 2R7XA 2QOPA 2LD5A 3KP6A 1I6XA 4XONA 5FKKA 5FD5A 3HPHA 2YVXA 3IUOA 4HF2A 3DPTA 3EUPA 1DDNA 2PMZN 4AUXA 4IHTA 4XLNF 2DODA 1ETWA 4I76A 4AIKA 2G7HA 2JMWA 1F43A 3BCGA 1VQPI 3T1BA 4BH9A 2QTQA 4GRIA 2L4AA 2XKOA 3IC7A 2RV8A 3BG5A 2F48A 2FQ4A 3RZOJ 1VF9A 4CXFA 2CV1A 1IRFA 3OL3A 2QYOA 2LVSA 4ON0A 1AKHA 2CG4A 4E6KG 2QF7A 3CCVI 3N97A 3MFKA 3BCAA 2GM4A 2L0KA 1YO5C 2JPBA 1GVDA 2B1EA 4GCLA 3U2RA 1HOMA 3GZ6A 5BMZA 5E17F 1RNLA 2JTVA 1JJ6C 1O7LA 2NVTJ 1Z77A 2M5WA 4U7DA 1GVJA 1UHWA 1V4RA 5FKOA 4MEYF 3JRHA 3KETA 4A3JJ 4F55A 1BIAA 2V9KA 4BEHB 1VQ6I 1I6HJ 4LGWA 2NS0A 4XSXF 2A3SA 3R60A 3JAMZ 2V1NA 4P5OA 3I4PA 2HYFA 3BTIA 3L2CA 1UELB 1IZ1A 2YVEA 4RMNA 3GLLA 5EGOA 4KICA 1FX7A 4F92B 5ED4A 1IN5A 3H5RA 5K7FA 3VOEA 3Q0UA 4S0HB 1FBQA 3GVAA 2CWEA 2D1VA 2QQ9A 2BW3A 2X1EA 4K2EA 4RGSA 2Y75A 1XPXA 2YX4A 3IUVA 1YFHA 3X2QH 4JX4A 4BXFA 4DJAA 3OY9A 1YIJI 3BR3A 5M5YJ 3K0LA 3HRSA 5FRMA 3FMSA 1SD6A 3CP8A 2NOJB 4GXOA 4HX7A 1EKEA 1SFEA 1DPRA 5DUIA 4D5FA 2EZIA 4Y33A 1JKQC 1VQLI 4DBRA 3KZIC 2KMUA 4I02A 3HZJA 2JA7J 1HW5A 2IEKA 1BC7C 3FXMA 2JRTA 1IN4A 5D6FA 3F72A 5F64A 4C2MJ 3PFIA 4UVBA 1BI2A 2OC6A 5DCMA 4HOBA 3FZVA 4NUBA 2M4GA 2G7LA 1TW2A 3H9GA 4L9NA 4A5NA 2XGEA 3FMQA 1U5TA 1M1EB 1ZQ3P 3PO2J 4XKBA 4R79A 2V1UA 4G7OF 1FWZA 1WPKA 2VKDA 2EINH 4JX5A 2R0QC 5HLGA 2PBXA 1LDKB 1MW7A 3Q3SA 2K3PA 2Q0OA 3HTJA 2E1CA 5ICGA 4A0XA 1GHCA 1Z1DA 2KT0A 4FE4A 1MSEC 1DGRM 2WV1A 3PIOF 4AYBN 2X9DA 1MSFC 3LFKA 1JKOC 2PJPA 3GZIA 2E5NA 2OERA 2M4KA 1UHSA 1G3YA 3G1OA 2LK2A 1QHHD 3A1YA 3I64A 4ME9A 5FKMA 2PX9A 4LLNA 4HAMA 2LBFB 3H1CA 2OJED 4MIMA 1GT0C 3CRJA 1S7EA 1VZ0A 2O7TA 3NARA 3TGNA 3K70C 1MBEA 3PNVA 3KZZA 1ZG5A 3JRFA 1WJAA 2I8DA 3E6DA 4M3GA 3HXLA 3DTIA 4PJNA 5C44J 2LKXA 2D45A 1LE8A 5J4YA 2QEXI 1BJAA 2JUCA 1U8BA 2IVMA 2W53A 2IBDA 2KFDA 4BQNA 2LMDA 5D6EA 1Y8QB 2DMNA 4CCLA 2FQ3A 3CDHA 1RUOA 3G6EI 2G7GA 1ETVA 4PDKA 4UUSA 1B72B 6PAXA 3ISPA 4HX8A 2LF8A 3G73A 4PGHA 4XKVA 3HGYA 3JCUC 3F22A 3OYAA 2CW0F 3HOZJ 2HFHA 2DA3A 3SFZA 1U8RA 3KZ9A 4MTEA 1TW3A 4XORA 2VBZA 1HKTA 4Q47A 4H0EA 5IT9Z 5TRDA 5AIPA 4KMUX 2IS2A 1YX5A 3PIPF 2EV6A 4MHGA 1PDNC 5J1YA
chains in the Genus database with same CATH topology
2K9QA 3HTHA 1TC3C 4A3FJ 3HOVJ 3DCFA 2LFBA 1AHDP 2HOAA 2CU7A 2R93J 4A69C 2WGBA 3B81A 3OSGA 1DU6A 1MBGA 4X1EA 5IP6A 3CDLA 1YRNA 4B3AA 1P7IA 2E2JJ 4HKUA 3IV5A 2YU9J 5FKNA 3S17J 4UDSA 2DA5A 4HNVA 4C3IJ 1R9TJ 3HTIA 2O7OA 4IEJA 4EEFG 4QTRA 1HF0A 5E3LA 1ZTRA 2CRGA 2G0EA 1IG7A 5DTDA 2Y9ZA 3TEDA 3QPSA 2ECBA 1IC8A 4JNNA 4M3EA 5FHPA 5EZGA 3TW7A 5H9TA 4BBSJ 4MO7A 3EGQA 3VVZA 4ICHA 3HGGA 2HYJA 4A3GJ 3BRUA 2K40A 3ZOBA 4A3LJ 1ETXA 3BR1A 2NOGA 1HLVA 3LSPA 3HIMA 1JTYA 5E3OA 1OCPA 4MXMA 2K9SA 2TRTA 4RDUA 4Y52J 3DEWA 2GENA 3TP0A 3HKZN 1APLC 4JYKA 3BQYA 1WH7A 1PUFB 3GEUA 3KKDA 3K2AA 1RESA 2Y9YA 3ZQIA 5M3FJ 2ID3A 5C4YA 3F0CA 5EG0A 2OPTA 5F04A 3HOWJ 3I4MJ 2NS7A 4QIWN 1POGA 1BA5A 2ELKA 2EZKA 5EFYA 2YVHA 4B4CA 2AO9A 2VKVA 2ID6A 3O8GA 1F36A 2ZCXA 1E3OC 4BXXJ 1I3QJ 1UI6A 1LE8B 4RBOA 2RASA 4BY7J 3S1MJ 2M0CA 5FJ8J 4NELA 1B8IB 3COLA 4V2FA 3I4NJ 1MBKA 3RKQA 2UXPA 2ECCA 4J19A 4I6ZA 2UXOA 1WH5A 4CGRA 4UUSB 2VKEA 2HXIA 1IGNA 2JA8J 2TCTA 1UMQA 4L5EA 3GTJJ 3NAUA 2QKOA 2CQQA 5F08A 2E1OA 4AC6A 3GBGA 3HOYJ 1FIPA 1U9OA 1Y1WJ 3HOUJ 1LFUP 2XB0X 1JGGA 2DJNA 2DG8A 2IAIA 3ZQHA 1RPWA 3QPLA 1MBFA 2EH3A 3MKLA 5E3MA 3G56A 3JRAA 9ANTA 1BW6A 4IHWA 3TP3A 1ETQA 3T6NA 1ETOA 5J1UA 1MH3A 3BTJA 2DMQA 1ORKA 2XRLA 3FKIJ 5JLXA 2XPWA 2ZOYA 2X48A 5HSZA 4JL3A 2OF7A 1GV5A 1ETYA 1YRNB 1ZGWA 2HXOA 4BKXA 3RQIA 1U9NA 4AF5A 3EUPA 2O8KA 1MNMC 3DPJA 1BJZA 5DS9A 1JTXA 4LOCA 3LHQA 2QCOA 2K9NA 1FTZA 4JKZA 2CQXA 2JN6A 2R5ZA 2OI8A 3V6GA 4UUTA 4FCYA 4X6AJ 2LR8A 3VW0A 1W0UA 3K7AJ 2AHQA 3LOCA 2M9HA 4D5CA 3B6AA 4BY1J 4M6VA 1TWFJ 1LFBA 3BHQA 1JUSA 4IHVA 2G7SA 2NVYJ 3BG9A 3IH3A 1RKWA 3S1NJ 2R5YA 2Y31A 2LP0A 1JT6A 3VOXA 2UXHA 1VNDA 4L62A 2WUIA 3ZQFA 4AC0A 1O4XA 1MH4A 3MNLA 4DYQA 2EZLA 3BNIA 5FMPA 3BR0A 2DMUA 3BQZA 5IP9J 4V2GA 1TWGJ 3MN2A 1GV2A 2I10A 3BR2A 3HE0A 2W48A 1ENHA 2JK3A 3ANGA 5HAWA 2P81A 3VOKA 2WB1N 4G12A 3SDGA 5EG0B 2HOTA 3A03A 3HTAA 2E19A 1IDZA 3RD3A 2XPUA 3FIWA 2WAQN 5GPCA 3NI7A 1GDTA 2D5VA 5EYRA 1ETKA 2JWTA 4M3BA 4MFDA 1ZR2A 1Q1VA 3HEFA 3NPIA 2EQRA 3JR9A 5D1RA 5HBUA 1FTTA 2HQ5A 3ZQLA 2COBA 2JJ7A 4YZEA 3OSFA 4DZPA 3S1QJ 5HODA 3JRBA 1SFOJ 1A6IA 1ZR4A 1HCRA 2XSDC 3NRGA 2QIBA 4C3JJ 2PZ9A 3HB9A 4IHYA 3NXCA 2DA6A 3JRIA 2NP5A 3AQTA 3P9TA 1JKPC 4A3DJ 4XRSG 3OOUA 2VUMJ 1UI5A 1RETA 3BR5A 2M2EA 4D7NA 2DA1A 1SANA 1FJLA 1XC5A 5EF6A 1IUFA 4KWAA 1ITYA 3JRGA 3S16J 3BR6A 4GCKA 3L1PA 5IP7J 2CJJA 5J3LA 4W1UA 1JT0A 2FJ1A 2XPVA 5F1JA 1OJLA 1QPIA 3VUQA 1IDYA 1HDPA 2KDZA 3GTKJ 5F27A 5EZHA 3O8HA 5GPAA 1T56A 2YUSA 2DTZA 2D6YA 4GCTA 2VPRA 4JP0A 3HOXJ 5IYBJ 2Y2ZA 2H8RA 2NS8A 2ZOZA 4Y7NJ 5M5XJ 4A3IJ 3LWJA 3FK6A 3PPBA 1X58A 3PM1A 2MG4A 4A3CJ 4GFLA 2GBYA 3V78A 3LSJA 5D19A 3FK7A 4XIDA 2F07A 2HDDA 1FEXA 1JUMA 1VI0A 2L7FP 1EF4A 2HYTA 2CUEA 1XG1A 2MSYA 3S5RA 3E7LA 1HDDC 2ZCMA 3KKCA 4W97A 2R5ZB 1AU7A 2G3BA 3OIOA 5CXIA 3GTGJ 3RH2A 2GUHA 1H88C 2HOSA 3VP5A 2EZHA 4D7MA 3VIBA 1IRZA 1Z0XA 1GUUA 4NDLA 4QSHA 3WHBA 2LLKA 2R5YB 4FTHA 4NN1A 4DYCA 1MBJA 4B1RA 3W6VA 2QOPA 1X2MA 2LD5A 5K7ZA 5FKKA 2M34A 5M3MJ 5C3EJ 4A3MJ 1BW5A 2HI3A 2PMZN 4AUXA 3CMYA 3JRCA 4I76A 1ETWA 1JKRC 2YS9A 3IH2A 2UXIA 2JMWA 1F43A 5EEAA 2Y30A 1SGMA 3BCGA 1H8AC 3Q0VA 2QTQA 2DA7A 2DMPA 3H3VK 3BG5A 3NNRA 2FQ4A 3LSGA 3RZOJ 1VF9A 3HM5A 2DG7A 1NTCA 3CCYA 3C2BA 3G1MA 3LNQA 2LVSA 1AKHA 1CQTA 5CXGA 2RHAA 2O9LA 3CJDA 2QF7A 3D1NI 2ME6A 2GFNA 2GM4A 3JRDA 2L0KA 4XK4A 4A3BJ 3VVXA 2M8GX 4GCLA 1GVDA 1RR7A 1TWHJ 3RZDJ 1HOMA 3G7RA 4MFEA 5D18A 2JA6J 3QKXA 1JJ6C 2FBQA 2RAEA 2FD5A 3S1RJ 5GP9A 2GLOA 5IYDJ 3KNWA 2NVTJ 3VPRA 4BBRJ 2V57A 1Z77A 2ZB9A 4IHXA 1JUPA 1U78A 5FKOA 3JRHA 1IV6A 2E2HJ 2NX4A 4A3JJ 3GTOJ 1D5YA 2XGDA 2XB5A 3M3YJ 1B72A 1K83J 3LJLA 1I6HJ 4MK6A 4ACIA 2X6OA 2N8GA 1VFCA 1XS9A 4M3FA 5K7HA 1ZKGA 4CYCA 3BTIA 2REKA 2YVEA 3VW1A 5EGOA 2H1KA 3BT9A 3GTPJ 4DZJA 5K7FA 1X2NA 3Q0UA 3QQAA 1Y1VJ 4S0HB 2B63J 1ZK8A 2MGQA 3BJBA 3IUVA 1MBHA 3A01A 1JJ8C 1BL0A 5CW8A 4JX4A 3JREA 3BR3A 5M5YJ 2Y0SN 4XICA 3HBLA 2XDNA 4GFBA 3GTMJ 3E7QA 2EBIA 2NVQJ 2HKUA 1FIAA 4A3EJ 4D5FA 2EZIA 4JX6A 1JKQC 3MVPA 4C3HJ 5FGLA 2JA7J 2DMTA 3ON2A 3PO3J 2IEKA 3O60A 2IU5A 5JLWA 5F0HA 4C2MJ 1QVUA 1QRYA 3CQZJ 3BG3A 2G7LA 3GTLJ 3WHCA 3HDDA 3ZQGA 3B6CA 5F0CA 2NP3A 2XGEA 4FISA 1NK3P 1W0TA 1ZQ3P 3PO2J 5IOYA 1WPKA 1IJWC 2LTPA 4JX5A 2VI6A 2R0QC 1H89C 2L7MP 2LY9A 2CUFA 3F1BA 2PBXA 3Q0WA 3Q3SA 2MW8A 4GFKA 3M4OJ 2DA2A 3HTJA 2KT0A 4FE4A 5M5WJ 1MSEC 2JA5J 5EDNA 2WV1A 5FLVA 4AYBN 3BTCA 2X9DA 1TWCJ 1MSFC 1JKOC 2ME0A 3S15J 4ABZA 2R7ZJ 3GZIA 3BTLA 2L7ZA 3LSRA 2UXUA 1PUFA 2OERA 4DYRA 1UHSA 3G1OA 3C07A 2LK2A 5IOZA 4XRSA 1QVTA 3PASA 4XRMA 1OCTC 4ME9A 1K61A 5FKMA 3FRQA 3CRJA 4MLOA 4MIMA 1GT0C 1AKHB 3VW2A 1WGXA 1S7EA 1OFCX 2O7TA 3NARA 4A3KJ 1WCMJ 2E2IJ 1MBEA 1T33A 4FE7A 1P7JA 3JRFA 5IPAA 4M3GA 5DAJA 2ZCNA 5C44J 2LKXA 1LE8A 3S2DJ 1U8BA 1B8IA 4PXIA 4M3DA 1UG2A 2W53A 2IBDA 5E3NA 3S2HJ 3FISA 5C4XJ 5AQCA 3TW6A 4A93J 1NK2P 2DMNA 5C4JJ 3G1LA 5BNGA 2G7GA 5K58A 1ETVA 1TWAJ 5J1RA 3IH4A 1WI3A 4UUSA 1B72B 3A02A 1G2HA 2DA4A 1DU0A 3QBMA 1A5JA 3HGYA 3AQSA 3CWRA 2R92J 1I50J 4CYCB 3S14J 2NVXJ 1RKTA 5F0FA 5FLMJ 5EGOB 2QWTA 2DN0A 3JSJA 3HOZJ 3VVYA 5IYCJ 2DA3A 3KZ9A 4DW6A 3GTQJ 3SJMA 3ZQCA 2Q24A 3A01B 2FX0A 5FKLA 3SFIA 2XGCA 3H0GJ 3ANPA 2L9RA 3UKGA 3ON4A 5J1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Q A;  3HTH A;  1TC3 C;  4A3F J;  3HOV J;  3DCF A;  2LFB A;  1AHD P;  2HOA A;  2CU7 A;  2R93 J;  4A69 C;  2WGB A;  3B81 A;  3OSG A;  1DU6 A;  1MBG A;  4X1E A;  5IP6 A;  3CDL A;  1YRN A;  4B3A A;  1P7I A;  2E2J J;  4HKU A;  3IV5 A;  2YU9 J;  5FKN A;  3S17 J;  4UDS A;  2DA5 A;  4HNV A;  4C3I J;  1R9T J;  3HTI A;  2O7O A;  4IEJ A;  4EEF G;  4QTR A;  1HF0 A;  5E3L A;  1ZTR A;  2CRG A;  2G0E A;  1IG7 A;  5DTD A;  2Y9Z A;  3TED A;  3QPS A;  2ECB A;  1IC8 A;  4JNN A;  4M3E A;  5FHP A;  5EZG A;  3TW7 A;  5H9T A;  4BBS J;  4MO7 A;  3EGQ A;  3VVZ A;  4ICH A;  3HGG A;  2HYJ A;  4A3G J;  3BRU A;  2K40 A;  3ZOB A;  4A3L J;  1ETX A;  3BR1 A;  2NOG A;  1HLV A;  3LSP A;  3HIM A;  1JTY A;  5E3O A;  1OCP A;  4MXM A;  2K9S A;  2TRT A;  4RDU A;  4Y52 J;  3DEW A;  2GEN A;  3TP0 A;  3HKZ N;  1APL C;  4JYK A;  3BQY A;  1WH7 A;  1PUF B;  3GEU A;  3KKD A;  3K2A A;  1RES A;  2Y9Y A;  3ZQI A;  5M3F J;  2ID3 A;  5C4Y A;  3F0C A;  5EG0 A;  2OPT A;  5F04 A;  3HOW J;  3I4M J;  2NS7 A;  4QIW N;  1POG A;  1BA5 A;  2ELK A;  2EZK A;  5EFY A;  2YVH A;  4B4C A;  2AO9 A;  2VKV A;  2ID6 A;  3O8G A;  1F36 A;  2ZCX A;  1E3O C;  4BXX J;  1I3Q J;  1UI6 A;  1LE8 B;  4RBO A;  2RAS A;  4BY7 J;  3S1M J;  2M0C A;  5FJ8 J;  4NEL A;  1B8I B;  3COL A;  4V2F A;  3I4N J;  1MBK A;  3RKQ A;  2UXP A;  2ECC A;  4J19 A;  4I6Z A;  2UXO A;  1WH5 A;  4CGR A;  4UUS B;  2VKE A;  2HXI A;  1IGN A;  2JA8 J;  2TCT A;  1UMQ A;  4L5E A;  3GTJ J;  3NAU A;  2QKO A;  2CQQ A;  5F08 A;  2E1O A;  4AC6 A;  3GBG A;  3HOY J;  1FIP A;  1U9O A;  1Y1W J;  3HOU J;  1LFU P;  2XB0 X;  1JGG A;  2DJN A;  2DG8 A;  2IAI A;  3ZQH A;  1RPW A;  3QPL A;  1MBF A;  2EH3 A;  3MKL A;  5E3M A;  3G56 A;  3JRA A;  9ANT A;  1BW6 A;  4IHW A;  3TP3 A;  1ETQ A;  3T6N A;  1ETO A;  5J1U A;  1MH3 A;  3BTJ A;  2DMQ A;  1ORK A;  2XRL A;  3FKI J;  5JLX A;  2XPW A;  2ZOY A;  2X48 A;  5HSZ A;  4JL3 A;  2OF7 A;  1GV5 A;  1ETY A;  1YRN B;  1ZGW A;  2HXO A;  4BKX A;  3RQI A;  1U9N A;  4AF5 A;  3EUP A;  2O8K A;  1MNM C;  3DPJ A;  1BJZ A;  5DS9 A;  1JTX A;  4LOC A;  3LHQ A;  2QCO A;  2K9N A;  1FTZ A;  4JKZ A;  2CQX A;  2JN6 A;  2R5Z A;  2OI8 A;  3V6G A;  4UUT A;  4FCY A;  4X6A J;  2LR8 A;  3VW0 A;  1W0U A;  3K7A J;  2AHQ A;  3LOC A;  2M9H A;  4D5C A;  3B6A A;  4BY1 J;  4M6V A;  1TWF J;  1LFB A;  3BHQ A;  1JUS A;  4IHV A;  2G7S A;  2NVY J;  3BG9 A;  3IH3 A;  1RKW A;  3S1N J;  2R5Y A;  2Y31 A;  2LP0 A;  1JT6 A;  3VOX A;  2UXH A;  1VND A;  4L62 A;  2WUI A;  3ZQF A;  4AC0 A;  1O4X A;  1MH4 A;  3MNL A;  4DYQ A;  2EZL A;  3BNI A;  5FMP A;  3BR0 A;  2DMU A;  3BQZ A;  5IP9 J;  4V2G A;  1TWG J;  3MN2 A;  1GV2 A;  2I10 A;  3BR2 A;  3HE0 A;  2W48 A;  1ENH A;  2JK3 A;  3ANG A;  5HAW A;  2P81 A;  3VOK A;  2WB1 N;  4G12 A;  3SDG A;  5EG0 B;  2HOT A;  3A03 A;  3HTA A;  2E19 A;  1IDZ A;  3RD3 A;  2XPU A;  3FIW A;  2WAQ N;  5GPC A;  3NI7 A;  1GDT A;  2D5V A;  5EYR A;  1ETK A;  2JWT A;  4M3B A;  4MFD A;  1ZR2 A;  1Q1V A;  3HEF A;  3NPI A;  2EQR A;  3JR9 A;  5D1R A;  5HBU A;  1FTT A;  2HQ5 A;  3ZQL A;  2COB A;  2JJ7 A;  4YZE A;  3OSF A;  4DZP A;  3S1Q J;  5HOD A;  3JRB A;  1SFO J;  1A6I A;  1ZR4 A;  1HCR A;  2XSD C;  3NRG A;  2QIB A;  4C3J J;  2PZ9 A;  3HB9 A;  4IHY A;  3NXC A;  2DA6 A;  3JRI A;  2NP5 A;  3AQT A;  3P9T A;  1JKP C;  4A3D J;  4XRS G;  3OOU A;  2VUM J;  1UI5 A;  1RET A;  3BR5 A;  2M2E A;  4D7N A;  2DA1 A;  1SAN A;  1FJL A;  1XC5 A;  5EF6 A;  1IUF A;  4KWA A;  1ITY A;  3JRG A;  3S16 J;  3BR6 A;  4GCK A;  3L1P A;  5IP7 J;  2CJJ A;  5J3L A;  4W1U A;  1JT0 A;  2FJ1 A;  2XPV A;  5F1J A;  1OJL A;  1QPI A;  3VUQ A;  1IDY A;  1HDP A;  2KDZ A;  3GTK J;  5F27 A;  5EZH A;  3O8H A;  5GPA A;  1T56 A;  2YUS A;  2DTZ A;  2D6Y A;  4GCT A;  2VPR A;  4JP0 A;  3HOX J;  5IYB J;  2Y2Z A;  2H8R A;  2NS8 A;  2ZOZ A;  4Y7N J;  5M5X J;  4A3I J;  3LWJ A;  3FK6 A;  3PPB A;  1X58 A;  3PM1 A;  2MG4 A;  4A3C J;  4GFL A;  2GBY A;  3V78 A;  3LSJ A;  5D19 A;  3FK7 A;  4XID A;  2F07 A;  2HDD A;  1FEX A;  1JUM A;  1VI0 A;  2L7F P;  1EF4 A;  2HYT A;  2CUE A;  1XG1 A;  2MSY A;  3S5R A;  3E7L A;  1HDD C;  2ZCM A;  3KKC A;  4W97 A;  2R5Z B;  1AU7 A;  2G3B A;  3OIO A;  5CXI A;  3GTG J;  3RH2 A;  2GUH A;  1H88 C;  2HOS A;  3VP5 A;  2EZH A;  4D7M A;  3VIB A;  1IRZ A;  1Z0X A;  1GUU A;  4NDL A;  4QSH A;  3WHB A;  2LLK A;  2R5Y B;  4FTH A;  4NN1 A;  4DYC A;  1MBJ A;  4B1R A;  3W6V A;  2QOP A;  1X2M A;  2LD5 A;  5K7Z A;  5FKK A;  2M34 A;  5M3M J;  5C3E J;  4A3M J;  1BW5 A;  2HI3 A;  2PMZ N;  4AUX A;  3CMY A;  3JRC A;  4I76 A;  1ETW A;  1JKR C;  2YS9 A;  3IH2 A;  2UXI A;  2JMW A;  1F43 A;  5EEA A;  2Y30 A;  1SGM A;  3BCG A;  1H8A C;  3Q0V A;  2QTQ A;  2DA7 A;  2DMP A;  3H3V K;  3BG5 A;  3NNR A;  2FQ4 A;  3LSG A;  3RZO J;  1VF9 A;  3HM5 A;  2DG7 A;  1NTC A;  3CCY A;  3C2B A;  3G1M A;  3LNQ A;  2LVS A;  1AKH A;  1CQT A;  5CXG A;  2RHA A;  2O9L A;  3CJD A;  2QF7 A;  3D1N I;  2ME6 A;  2GFN A;  2GM4 A;  3JRD A;  2L0K A;  4XK4 A;  4A3B J;  3VVX A;  2M8G X;  4GCL A;  1GVD A;  1RR7 A;  1TWH J;  3RZD J;  1HOM A;  3G7R A;  4MFE A;  5D18 A;  2JA6 J;  3QKX A;  1JJ6 C;  2FBQ A;  2RAE A;  2FD5 A;  3S1R J;  5GP9 A;  2GLO A;  5IYD J;  3KNW A;  2NVT J;  3VPR A;  4BBR J;  2V57 A;  1Z77 A;  2ZB9 A;  4IHX A;  1JUP A;  1U78 A;  5FKO A;  3JRH A;  1IV6 A;  2E2H J;  2NX4 A;  4A3J J;  3GTO J;  1D5Y A;  2XGD A;  2XB5 A;  3M3Y J;  1B72 A;  1K83 J;  3LJL A;  1I6H J;  4MK6 A;  4ACI A;  2X6O A;  2N8G A;  1VFC A;  1XS9 A;  4M3F A;  5K7H A;  1ZKG A;  4CYC A;  3BTI A;  2REK A;  2YVE A;  3VW1 A;  5EGO A;  2H1K A;  3BT9 A;  3GTP J;  4DZJ A;  5K7F A;  1X2N A;  3Q0U A;  3QQA A;  1Y1V J;  4S0H B;  2B63 J;  1ZK8 A;  2MGQ A;  3BJB A;  3IUV A;  1MBH A;  3A01 A;  1JJ8 C;  1BL0 A;  5CW8 A;  4JX4 A;  3JRE A;  3BR3 A;  5M5Y J;  2Y0S N;  4XIC A;  3HBL A;  2XDN A;  4GFB A;  3GTM J;  3E7Q A;  2EBI A;  2NVQ J;  2HKU A;  1FIA A;  4A3E J;  4D5F A;  2EZI A;  4JX6 A;  1JKQ C;  3MVP A;  4C3H J;  5FGL A;  2JA7 J;  2DMT A;  3ON2 A;  3PO3 J;  2IEK A;  3O60 A;  2IU5 A;  5JLW A;  5F0H A;  4C2M J;  1QVU A;  1QRY A;  3CQZ J;  3BG3 A;  2G7L A;  3GTL J;  3WHC A;  3HDD A;  3ZQG A;  3B6C A;  5F0C A;  2NP3 A;  2XGE A;  4FIS A;  1NK3 P;  1W0T A;  1ZQ3 P;  3PO2 J;  5IOY A;  1WPK A;  1IJW C;  2LTP A;  4JX5 A;  2VI6 A;  2R0Q C;  1H89 C;  2L7M P;  2LY9 A;  2CUF A;  3F1B A;  2PBX A;  3Q0W A;  3Q3S A;  2MW8 A;  4GFK A;  3M4O J;  2DA2 A;  3HTJ A;  2KT0 A;  4FE4 A;  5M5W J;  1MSE C;  2JA5 J;  5EDN A;  2WV1 A;  5FLV A;  4AYB N;  3BTC A;  2X9D A;  1TWC J;  1MSF C;  1JKO C;  2ME0 A;  3S15 J;  4ABZ A;  2R7Z J;  3GZI A;  3BTL A;  2L7Z A;  3LSR A;  2UXU A;  1PUF A;  2OER A;  4DYR A;  1UHS A;  3G1O A;  3C07 A;  2LK2 A;  5IOZ A;  4XRS A;  1QVT A;  3PAS A;  4XRM A;  1OCT C;  4ME9 A;  1K61 A;  5FKM A;  3FRQ A;  3CRJ A;  4MLO A;  4MIM A;  1GT0 C;  1AKH B;  3VW2 A;  1WGX A;  1S7E A;  1OFC X;  2O7T A;  3NAR A;  4A3K J;  1WCM J;  2E2I J;  1MBE A;  1T33 A;  4FE7 A;  1P7J A;  3JRF A;  5IPA A;  4M3G A;  5DAJ A;  2ZCN A;  5C44 J;  2LKX A;  1LE8 A;  3S2D J;  1U8B A;  1B8I A;  4PXI A;  4M3D A;  1UG2 A;  2W53 A;  2IBD A;  5E3N A;  3S2H J;  3FIS A;  5C4X J;  5AQC A;  3TW6 A;  4A93 J;  1NK2 P;  2DMN A;  5C4J J;  3G1L A;  5BNG A;  2G7G A;  5K58 A;  1ETV A;  1TWA J;  5J1R A;  3IH4 A;  1WI3 A;  4UUS A;  1B72 B;  3A02 A;  1G2H A;  2DA4 A;  1DU0 A;  3QBM A;  1A5J A;  3HGY A;  3AQS A;  3CWR A;  2R92 J;  1I50 J;  4CYC B;  3S14 J;  2NVX J;  1RKT A;  5F0F A;  5FLM J;  5EGO B;  2QWT A;  2DN0 A;  3JSJ A;  3HOZ J;  3VVY A;  5IYC J;  2DA3 A;  3KZ9 A;  4DW6 A;  3GTQ J;  3SJM A;  3ZQC A;  2Q24 A;  3A01 B;  2FX0 A;  5FKL A;  3SFI A;  2XGC A;  3H0G J;  3ANP A;  2L9R A;  3UKG A;  3ON4 A;  5J1Y A; 
#chains in the Genus database with same CATH topology
 3P9I A;  3HTH A;  2DU9 A;  3H0D A;  4A3F J;  4HLX A;  2HOA A;  4F91 B;  2FUG 2;  2FNA A;  2ACJ A;  1S6L A;  4XR6 A;  5IP6 A;  3C2H A;  3TBI A;  1I1S A;  1J9I A;  2IPQ X;  4UVC A;  4UDS A;  4HNV A;  2V6C A;  3CO7 C;  3KEO A;  2M8E A;  2O7O A;  3I0T A;  3L9F A;  1R1T A;  1FOY A;  2IA1 A;  4ASN A;  2R7Q A;  3ONQ A;  4HQE A;  2DFF A;  3HJE A;  1HF0 A;  4J01 A;  4E70 A;  5L3D A;  4ENK A;  2Y9Z A;  2R7T A;  3TED A;  3LQQ A;  1IC8 A;  3E6B A;  5FHP A;  1YX3 A;  2WAE A;  1IN6 A;  4KN4 X;  5K5Q A;  5FFZ A;  3OYK A;  4ZZD A;  1J2X A;  4ICH A;  2R7R A;  2KQR A;  2K40 A;  3ZPL A;  2Z9O A;  1AA7 A;  5FRO A;  1SFX A;  2GWR A;  2WV0 A;  2M1B A;  4M9S A;  1JTY A;  2HVR A;  1OCC H;  2LC2 A;  1J5Y A;  5E3O A;  1S29 A;  2XF5 A;  2PEX A;  4YII A;  1IRX A;  1X19 A;  2TRT A;  4OIP F;  3DTE A;  4Y52 J;  4KIB A;  2ESN A;  2DPD A;  2P6T A;  3QU6 A;  4QPQ A;  2H09 A;  1VQK I;  1J09 A;  4O3M A;  3OL4 A;  2FMY A;  1LUJ B;  2I5U A;  3GEU A;  3KKD A;  3K2A A;  5M3F J;  5C4Y A;  2BVM A;  2F4O B;  4XL9 A;  1HW1 A;  1OPC A;  2NS7 A;  4QIW N;  4HLY A;  2KRC A;  2WB1 A;  4D9J A;  2DFI A;  2EZK A;  4IRI A;  3ROU A;  5EFY A;  2CQ7 A;  3HUG A;  2P0W A;  4UB8 C;  3ZRG A;  4O5V A;  2FF4 A;  2WAQ A;  1Y39 A;  1E17 A;  1F36 A;  2ZCX A;  2EFN A;  4BL0 B;  3LWF A;  3S1M J;  5FJ8 J;  2IRF G;  4RGR A;  5ICC A;  4P55 A;  2CFO A;  3CTA A;  2Q2E A;  3FKJ A;  2K7L A;  2X85 A;  3RKQ A;  2VJJ A;  3V8J A;  1X3U A;  3TKY A;  1YOV B;  4I6Z A;  4ETS A;  2HXI A;  1Y0U A;  1YLF A;  2XHK A;  1T8I A;  2K86 A;  1R49 A;  1MMA A;  1XMX A;  2W00 A;  1YE9 A;  2A69 F;  3EUH C;  4CGZ A;  2DJN A;  1B4A A;  3QPL A;  5H20 A;  1VQ8 I;  3G56 A;  2J5P A;  3DEU A;  1H0M A;  1BW6 A;  3ERM A;  1D1C A;  4HQM A;  2DDA A;  2Z2S B;  3TOB A;  2DYR H;  1YQA A;  2HTS A;  5J1U A;  5CKT A;  5E1W A;  1S7O A;  1RRJ A;  1S7A A;  3WGI A;  4A12 A;  1BC8 C;  2DMQ A;  1ORK A;  2XRL A;  4KIS A;  5JLX A;  1XDU A;  2BXZ A;  2XPW A;  4AVP A;  2ZOY A;  2O0Y A;  2ETH A;  2A6H F;  1GV5 A;  5LGN A;  1ETY A;  4YIR X;  4NB5 A;  3WU2 C;  3VWB A;  3CDI A;  1ZHF A;  3ZN0 A;  4EM1 A;  4ZJZ A;  4RAZ A;  2DBB A;  2CW8 A;  2PI0 A;  3Q5F A;  1BJZ A;  4NC8 A;  5DS9 A;  3F8N A;  4G8X A;  2VC0 A;  3M1E A;  2JN6 A;  1DGW Y;  2G7U A;  2DOF A;  2FNP A;  3MWM A;  2E36 A;  4FCY A;  5EEH A;  2EK5 A;  2LF7 A;  2LR8 A;  5ERI A;  2XAG A;  3TO7 A;  1XTA A;  2O3F A;  4TV7 A;  1TP4 A;  2RN7 A;  3K4B A;  3SZT A;  4NHJ A;  2FJI 1;  3CLQ A;  3ZMZ A;  2HPM A;  5FO5 A;  1O3S A;  2PFV A;  3QAH A;  4EJW A;  2FML A;  4HV5 A;  1MKM A;  3IH3 A;  4E7J A;  2Z5U A;  2WAF A;  1EV7 A;  3EUA A;  3IL2 A;  3O3K A;  1L3L A;  3VOX A;  2UXH A;  5CQG A;  3F9K A;  3V7R A;  1KU2 A;  1YS7 A;  4IL6 C;  2QBY A;  3ZQF A;  1DPU A;  4AC0 A;  1O4X A;  2WUI A;  3S2W A;  4BJT A;  4DYQ A;  5LGT A;  3OYB A;  1X1A A;  4XLH A;  2FOK A;  1QZE A;  2DO7 A;  2HQR A;  3KCC A;  3J7A O;  2W48 A;  1ENH A;  4BGD A;  3C3W A;  3CCU I;  3J7Y J;  2DPU A;  5D4S A;  4OAY A;  3HTA A;  2XV4 S;  4KIT B;  3TDZ C;  3RD3 A;  2FA5 A;  3DBL B;  4S05 A;  3T8R A;  1GLN A;  2BE5 F;  4EM2 A;  2FBH A;  2HQ5 A;  4PJJ A;  4KNY A;  1V54 H;  5HOD A;  1ZRD A;  2RNJ A;  3GZ5 A;  3LSH A;  4XN0 A;  3ZMU A;  4IHY A;  3A4C A;  3JRI A;  2ZXH A;  2XGX A;  1K4T A;  2X1D A;  3P9T A;  5FGM A;  2UXN A;  3F21 A;  1W5T A;  3D5R C;  5CVV A;  3U21 A;  3W3C A;  2VOD A;  1UI5 A;  2MH9 A;  3H36 A;  1Z3Y A;  2DA1 A;  1SAN A;  1FJL A;  1MNE A;  1WJD A;  1MDM B;  4UUV A;  2XKP A;  1ITY A;  3ASO H;  2FEZ A;  2R7V A;  3BR6 A;  3MQ0 A;  2LNB A;  2H1L A;  3GME A;  1P92 A;  3ASN H;  5IP7 J;  3L1P A;  3M8F A;  1AOY A;  5J3L A;  2FJ1 A;  1OJL A;  2K27 A;  1IDY A;  3WTW C;  1HDP A;  1ONV A;  2K5C A;  2P6S A;  3DKW A;  3O8H A;  5GPA A;  5ICF A;  1S8N A;  1T56 A;  4RAF A;  2DTZ A;  3HOX J;  5IYB J;  1Y56 A;  2H8R A;  2NS8 A;  2RKH A;  1FP2 A;  2NNY A;  1ZAO A;  4M9X A;  3L2Q A;  5CPR B;  3KIO A;  4GFL A;  2GBY A;  2XIG A;  3OOP A;  3JSP A;  3LSJ A;  1X4O A;  1HW2 A;  1FEX A;  1JUM A;  5FFX A;  3QOD A;  1B59 A;  2L7F P;  1EF4 A;  1MMG A;  2V79 A;  1QPM A;  3HTS B;  4ZYH A;  1XG1 A;  2BVL A;  2Y0M A;  1N78 A;  2J5O A;  2BZT A;  3QOP A;  4I99 C;  2R7D A;  3RPU D;  1FT9 A;  2LKP A;  2KIS A;  4JOM A;  3RH2 A;  1MZB A;  3CCL I;  2OA4 A;  4D7M A;  5AON A;  2ZJP F;  3DU5 A;  1Z0X A;  2LY1 A;  4QSH A;  3WHB A;  1DP7 P;  2R5Y B;  2M7A A;  3W6V A;  2OZ6 A;  3FXJ A;  4WX9 A;  1PUE E;  1ZRC A;  1E2X A;  2BYV E;  5K7Z A;  2QSG X;  4CA0 A;  2M34 A;  2ZC2 A;  4MQ9 F;  1G59 A;  3UR3 C;  3JRC A;  1W1W E;  2Y30 A;  3CCS I;  3Q0V A;  1YJ9 I;  3KYL A;  1R5G A;  3EUH A;  5DDG A;  3HHG A;  3H3V K;  1OCZ H;  3NNR A;  3HM5 A;  3HOT A;  3C2B A;  3G1M A;  4BHB A;  4HX4 A;  4ZDO A;  2UUZ A;  4H4K C;  5CVR A;  1ON1 A;  2E7X A;  2YPR A;  3FXR A;  2DDB A;  4D0P A;  3VSL A;  1YIT I;  3WU0 A;  2GFN A;  1O3R A;  3H3Z A;  3VVX A;  2V9P A;  2M8G X;  3K4M A;  1O57 A;  1QU3 A;  5DYM A;  3RZD J;  4ESB A;  3HC7 A;  1D8J A;  3H3U A;  2RAE A;  2GLO A;  3IWZ A;  3W6K B;  1KU9 A;  3W2A A;  3M8J A;  1TTY A;  3VPR A;  4AD9 A;  3T5X A;  4X0G A;  1WFX A;  3FF5 A;  1XX5 A;  2IT0 A;  3GTO J;  1UAA A;  2XGD A;  1FY7 A;  1YW8 A;  4BQA A;  3M3Y J;  5IY5 H;  4N4N B;  3LJL A;  4MK6 A;  4AIH A;  1W4M A;  4ACI A;  4XLC A;  3WTS C;  2ELH A;  2QWW A;  2N8G A;  3B73 A;  3RYP A;  2EV5 A;  3ZMS A;  1VFC A;  1XS9 A;  5JVG F;  1XGN A;  4CYC A;  2LH9 A;  2BEO A;  2W57 A;  3G4S I;  2H1K A;  1H9G A;  4A2U A;  1BN5 A;  1RUN A;  5DCF A;  1FOW A;  4LIU A;  3PNY A;  3VOD A;  5JHU A;  2XRO A;  2MGQ A;  1ZN2 A;  4NQW A;  5ILS A;  5FLX K;  2IGM A;  2FSW A;  2Y0S N;  4U87 A;  5H6Q A;  4XIC A;  2R7F A;  2AQE A;  1WSU A;  4EAT A;  4LMY A;  1JI8 A;  2NVQ J;  1FIA A;  5DV5 A;  4PGG A;  4GGG A;  1STZ A;  4JX6 A;  3V8K A;  3MVP A;  4I7H A;  2L3D A;  2VIX A;  4C3H J;  1WQ2 A;  3C1D A;  5LRS A;  5FGL A;  3NS4 A;  2DMT A;  4ENN A;  3ON2 A;  4XLA A;  2HTJ A;  3O60 A;  3I71 A;  2CSO A;  3CQZ J;  3PUB A;  4JQF A;  3BP8 A;  4AID A;  3P7N A;  1LDJ A;  1G3T A;  1EH6 A;  3WHC A;  5BPD A;  3HDD A;  3B6C A;  3GTL J;  4GDF A;  3GFM A;  2GZW A;  1W0T A;  1NK3 P;  4RB1 A;  4BAY A;  1SC7 A;  5E8I A;  2GIZ A;  2L7M P;  2ZXI A;  4EGZ A;  4V19 K;  3DLA A;  3Q0W A;  2KHM A;  2VQH A;  2KIQ A;  1IRG A;  4IRV A;  2K9L A;  3WTU C;  2HKO A;  3IAM 2;  2DAO A;  4HW0 A;  3D5L A;  1WJF A;  3CMA I;  4O6J A;  5M5W J;  1MIJ A;  2E7W A;  1LFP A;  2YSR A;  2XVC A;  2JA5 J;  4KA4 A;  3G3Z A;  3P5J A;  2ELJ A;  4IRG A;  4ABZ A;  2R7Z J;  2OZU A;  4B3X A;  2DW4 A;  2ZJ2 A;  3M7G A;  1K7A A;  4DYR A;  4M9Z A;  1ZRF A;  4XRS A;  2RNG A;  2XAS A;  3HKZ A;  4XRM A;  4A0Z A;  1K61 A;  3FRQ A;  2WWY A;  2AS5 F;  3H9J A;  3OR1 C;  1WGX A;  5LHH A;  2YU3 A;  4A3K J;  3MZH A;  2W1O A;  3CD6 I;  3BJO A;  1P7J A;  4G6T B;  5JI6 A;  4LJZ F;  5IPA A;  3KLO A;  2VJ4 A;  2X0L A;  2JZY A;  4A6D A;  1W36 D;  1D1B A;  3ZCO A;  2H6C A;  2Z33 A;  3Q9V A;  4XLP F;  4HST A;  4RLQ A;  4PXI A;  5E20 A;  3FIS A;  5C4X J;  5AQC A;  2DQL A;  5C4J J;  3F3X A;  2P5V A;  3BOQ A;  3DF8 A;  5BNG A;  5J1R A;  1O3Q A;  5K58 A;  3I56 I;  3RKX A;  3K8P C;  4BE0 A;  2DA4 A;  3KP7 A;  3N4M A;  2QEN A;  4ESJ A;  4LIT A;  3CWR A;  4BQO A;  2JA2 A;  2CUJ A;  3BY6 A;  1MMN A;  3CES A;  2NVX J;  4KIF A;  3S32 A;  4BXU A;  4ENM A;  3E3V A;  1Y0N A;  4DW6 A;  2W25 A;  4MEX F;  4B44 A;  2ZME B;  1MND A;  4MQV A;  1VQ5 I;  2Q24 A;  3CC2 I;  3A01 B;  2RQP A;  4YFK F;  1G3W A;  1LJ9 A;  3H0G J;  2FXA A;  3ANP A;  2K9Q A;  3K1N A;  2KPM A;  2RQQ A;  2BGC A;  2O03 A;  2XAJ A;  3K4N A;  4U88 A;  3OS0 A;  3CCJ I;  3DCF A;  2CU7 A;  4A69 C;  5EJC A;  2WGB A;  3OSG A;  1ERD A;  1YYV A;  3Q9S A;  1DU6 A;  4QWQ A;  1YRN A;  3FXQ A;  1B1B A;  1ACI A;  4HKU A;  4YIF A;  3S17 J;  4C3I J;  1IXC A;  3PNT A;  4FX0 A;  2IP2 A;  2QA4 I;  4EEF G;  2GAU A;  4QTR A;  2Z16 A;  3QYE A;  5E3L A;  1ZTR A;  3DP7 A;  3GO5 A;  1T0F C;  3HG9 A;  4U0Y A;  4AM3 A;  3HPG A;  2PMZ A;  3HYI A;  1X1B A;  5EZG A;  3K4K A;  4BBS J;  1WJB A;  2BV6 A;  3H9Q A;  4MO7 A;  4HF1 A;  1WVR A;  1H9T A;  4A5M A;  2K9M A;  3BRU A;  3WTX C;  2CO5 A;  3ZOB A;  1LVK A;  4A3L J;  2X1C A;  3BR1 A;  2B0L A;  4ENJ A;  4CCM A;  3VDX A;  3OV8 A;  4MXM A;  2K9S A;  2JVG A;  1W7P A;  5DD4 A;  4RDU A;  1HBX G;  2GEN A;  4II2 A;  1W5C C;  1OLT A;  1XD7 A;  5L3G A;  1APL C;  1T98 A;  4HSR A;  4BE1 A;  1PUF B;  3BQY A;  1WH7 A;  5KK1 A;  2BY0 A;  2LDU A;  1RES A;  3V7S A;  3ZQI A;  1ZGA A;  2OPT A;  4HRI A;  3E97 A;  4EJU A;  3RDI A;  3QP5 A;  3N05 A;  4DOZ A;  2AO9 A;  3W6J B;  2KJB A;  1Y6I A;  1QO0 D;  4RS8 A;  1E3O C;  1I3Q J;  3CCQ I;  4PFP A;  3FWE A;  4BY7 J;  4E4H A;  3IP4 B;  4NEL A;  4EM0 B;  3OIP A;  1B8I B;  3PSF A;  1FZP B;  2OTJ I;  3SEQ A;  3I4N J;  2HZT A;  1FBS A;  1I27 A;  1HKQ A;  1XMA A;  2HQA A;  5IT3 A;  5DM7 F;  4J19 A;  2UXO A;  3DWL E;  4HPQ A;  4HF0 A;  2VKE A;  4FX4 A;  4FET A;  2DFE A;  2F6C A;  5LD2 C;  3OYG A;  2E1O A;  2ZSH B;  4AC6 A;  3GBG A;  4PK4 A;  3HOU J;  2VBY A;  5J6X A;  1JGG A;  1U0J A;  1YW9 A;  1V5G A;  1EA3 A;  4PFO A;  1V5E A;  3ZQH A;  1RPW A;  4E7S A;  2DG8 A;  3CO6 C;  2EH3 A;  3KE2 A;  3MKL A;  5E3M A;  2XDV A;  1VQ4 I;  3JRA A;  1ZH5 A;  2A07 F;  4L9J A;  2WTE A;  2DK5 A;  5CVJ A;  3TP3 A;  3ECH A;  2CH0 A;  1F1Z A;  4NC7 A;  3WTY C;  3F8M A;  1ETO A;  3ERE D;  3NWS A;  1MH3 A;  1IN8 A;  1BI3 A;  3GEZ A;  2VC1 A;  3J80 Z;  2DT6 A;  3V7C A;  2PN6 A;  2DT7 B;  2HXO A;  3RQI A;  3ZXS A;  1U9N A;  1G3S A;  2O8K A;  1MNM C;  3DKX A;  5LHI A;  4D1Q A;  1R36 A;  1KQ8 A;  3K1P A;  1P4A A;  4LOC A;  2QCO A;  3LHQ A;  4JKZ A;  2FRH A;  1IUY A;  4OU0 A;  2R5Z A;  4KJZ A;  3V6G A;  3L00 A;  4X6A J;  3VW0 A;  2C6Y A;  4AYB A;  3DXJ F;  1E3H A;  2CQK A;  4AVZ A;  3B6A A;  4G9Y A;  4M6V A;  5B1B H;  3BHQ A;  1GXP A;  1MMD A;  4BUP A;  2LY2 A;  3WG7 H;  1Z91 A;  3S1N J;  2LP0 A;  4IOA F;  3OYD A;  2E71 A;  4LK0 F;  5BS6 A;  3AL0 B;  2COM A;  4KN7 X;  4JK1 X;  2FE3 A;  4ZYD A;  3BNI A;  3BG6 A;  2DMU A;  1RC9 A;  3A0H C;  3BQZ A;  3BR0 A;  3BR2 A;  4UNO A;  3FBN B;  3HE0 A;  5HAW A;  3G2B A;  2PLY A;  2WB1 N;  2MD5 A;  3H35 A;  5JVT A;  3AL0 C;  4GYI A;  3CCE I;  5EG0 B;  2HEO A;  4WCG A;  4P96 A;  2B9S A;  3TQN A;  1IDZ A;  4XM3 A;  3FIW A;  2WAQ N;  3NI7 A;  5K5O A;  5EYR A;  2Z3Y A;  1ETK A;  4M3B A;  4MFD A;  3DV8 A;  1U2W A;  3NPI A;  2HGC A;  3HSR A;  4OIR F;  4EJV A;  1ZYR F;  4IXA A;  4UY8 I;  2WC2 A;  1DP3 A;  2HS5 A;  3OSF A;  4C2M A;  3CUQ B;  1A6I A;  4RB3 C;  3L09 A;  3KX2 A;  3AG3 H;  4C3J J;  1KYW A;  5LLQ A;  1JHH A;  3REO A;  3HB9 A;  4UVA A;  3I55 I;  2BOL A;  2DA6 A;  4XRF A;  5FB2 A;  4OMY A;  1KZH A;  1CGP A;  3EPZ A;  3JTH A;  1JKP C;  2ZJQ F;  1CF7 B;  1OCR H;  4CZC A;  2VUM J;  1RET A;  4BEH A;  2IS4 A;  3FHZ A;  1QZZ A;  3R4K A;  5EF6 A;  3L2U A;  1R1V A;  3OYH A;  3JRG A;  1FMW A;  3S16 J;  2ZXJ A;  2DCE A;  3E0J B;  3GW2 A;  1A6Q A;  4L62 A;  2CJJ A;  4J00 A;  1JT0 A;  3ZQ7 A;  5F1J A;  1QPI A;  1N25 A;  3V4G A;  3GTK J;  3MKZ A;  3U9G A;  2EA2 A;  4RGX A;  5FRN A;  2YUS A;  5BOX A;  4Y13 A;  4GCT A;  2ADU A;  4JP0 A;  4XSZ F;  3ULQ B;  4C9Y A;  2VPL A;  2ZOZ A;  3OYI A;  1TQM A;  1Z21 A;  3LWJ A;  2CS3 A;  3ESW B;  3LA2 A;  4ANJ A;  2K02 A;  4E7K A;  1ZLK A;  4A3C J;  2FBI A;  4PSW A;  3R6S A;  1WJ5 A;  2PJR B;  2RRE A;  4XID A;  1D0Z A;  2LRD A;  2F07 A;  2A68 F;  2IA0 A;  1TBX A;  2VT2 A;  2HYT A;  4C2T A;  2MSY A;  2KDO A;  3HTU A;  3S5R A;  3C7J A;  3E5U A;  1HDD C;  2ZCM A;  2LOO A;  2A6T A;  2AQF A;  1AU7 A;  4IKF A;  2G3B A;  2DFH A;  4FT8 A;  5CXI A;  1SFK A;  1RZ4 A;  4I2O A;  4WF2 A;  5D5V B;  2IW5 A;  2HOS A;  3VP5 A;  3PQJ A;  4IQJ A;  1WJC A;  2WY7 Q;  2NVU B;  3ZMD A;  2LLK A;  3K4C A;  3HOS A;  4DYC A;  1MBJ A;  4Z2Y A;  2M0M A;  4B1R A;  4PCQ A;  4XNF A;  4NN1 A;  1X2M A;  2MAB A;  4Y15 A;  3QOE A;  5M3M J;  3CF2 A;  5C3E J;  1QNT A;  2X4H A;  4A3M J;  1YHQ I;  1BW5 A;  2YS9 A;  2ZKZ A;  2UXI A;  1XCB A;  5EEA A;  1SGM A;  3ZMV A;  2IS1 A;  3BJ6 A;  5JHF A;  2DMP A;  1HC8 A;  4ZYE A;  1KON A;  2ISY A;  2IGO A;  2HPI A;  2DOE A;  3LSG A;  4PZJ A;  3ZQQ A;  2DG7 A;  3CC4 I;  3SDB A;  3ABK H;  3LNQ A;  2LBF A;  3WTZ A;  1Z6R A;  4XBF A;  1CQT A;  1ZLJ A;  1KQ0 A;  2VN2 A;  5D8K B;  2O9L A;  4EJO A;  1EJ9 A;  2PMH A;  3CME I;  3M8E A;  4CCJ A;  3DFG A;  4EVI A;  4BDY A;  1RR7 A;  1TWH J;  3MZY A;  3RIR A;  3OIQ A;  2GOX B;  3QKX A;  2FBQ A;  1NH3 A;  1PYV A;  3DPL C;  4LG0 B;  4UV9 A;  2ZB9 A;  2W82 A;  5GAG J;  4IHX A;  2XAH A;  2IS6 A;  1U78 A;  1IV6 A;  2E2H J;  2R4G A;  2V4J C;  2VAS A;  3JW4 A;  3K10 A;  1D5Y A;  1LDD A;  2OTL I;  4AIJ A;  1B72 A;  3H5N A;  4I0A A;  4RAG A;  5GAH J;  5K7H A;  1ZKG A;  3VW1 A;  2WBM A;  2MC3 A;  1K78 B;  1X4P A;  3GTP J;  4NNJ A;  1QZY A;  4DZJ A;  2EIJ H;  1X2N A;  2D2W A;  1Y1V J;  2QQA A;  1ZK8 A;  4XKC A;  3BJB A;  2E1M B;  2WAD A;  1JJ8 C;  2V1D A;  5HOO A;  3JRE A;  5EEG A;  4WXH A;  3U1K A;  4A6E A;  2XDN A;  1R7J A;  2L7K A;  4GFB A;  3GTM J;  2E35 A;  2VB6 A;  2ZFW A;  2P8T A;  4L5I A;  4A3E J;  4C30 A;  2E1M C;  3I59 B;  1S5L C;  4RAY A;  5E79 C;  1SMT A;  4HZF A;  3CJN A;  3CMM A;  1G6N A;  5F0H A;  4KDP A;  1QVU A;  1QRY A;  1TNS A;  3VYS B;  5D5U B;  3CF5 F;  1SFU A;  2XAF A;  1T95 A;  2HKX A;  3BG3 A;  1TQP A;  5F0C A;  4G94 A;  2V6E A;  3B02 A;  1XGM A;  2MYS A;  3LST A;  3VB2 A;  2VI6 A;  4CHU A;  3F1B A;  1FPQ A;  2VQC A;  3GFJ A;  2MW8 A;  4GFK A;  3IWF A;  1R4M B;  2DA2 A;  1SMY F;  2CQN A;  4XQF A;  2FU4 A;  4FHT A;  5J8F A;  2UWM A;  4BHP A;  3I9V 2;  3BTC A;  4WIB A;  1VQN I;  4XMY A;  2M30 A;  1R71 A;  2ME0 A;  5HLH A;  3WE2 A;  3LA7 A;  3BTL A;  5DD8 A;  1XB4 A;  4N0B A;  4EQQ A;  2O6G E;  2RGV A;  1A36 A;  2D1H A;  2HZD A;  1FOK A;  5IOZ A;  4R8H A;  1QVT A;  2JUG A;  5E1Z B;  5J8C A;  3WE3 A;  3HRT A;  2OCE A;  4L0Z B;  1BR1 A;  2EIM H;  3U1D A;  3CCM I;  1AKH B;  1PP7 U;  1ZRE A;  1FYM A;  4A0Y A;  3VW2 A;  1FBU A;  4HA8 A;  4L9T A;  2GA2 A;  1Y8R B;  4Y3O A;  1X3Z B;  1FC3 A;  1IXR C;  3COA C;  4FE7 A;  1JE8 A;  3SXY A;  4BHC A;  5HVQ C;  1TT5 B;  3CC7 I;  3GCM A;  4UV8 A;  3BG7 A;  1E0E A;  2ZCN A;  5DAJ A;  1MJA A;  3IAS 2;  4HNT A;  4N4O B;  3OYL A;  5B1A H;  2IGN A;  2UV1 A;  3S2D J;  3CJR B;  5BPI A;  5E3N A;  3S2H J;  2YR2 A;  1YTY A;  1PVE A;  4A93 J;  1NK2 P;  3W2W A;  3TO9 A;  3G1L A;  2H94 A;  1MJ9 A;  2XF6 A;  4G6D A;  3MZ8 A;  2IXS A;  5KAI C;  3E5Q A;  2R7O A;  3A02 A;  2VT3 A;  1G2H A;  1JGS A;  1VQO I;  3ML6 A;  3MKW B;  4E7H A;  2LSO A;  1A5J A;  3AQS A;  3E5X A;  4P1W A;  1D8K A;  3S14 J;  5F0F A;  5EGO B;  1R5H A;  5FLM J;  3JSJ A;  2F5C A;  2DJI A;  4HDV A;  5E18 F;  3BRO A;  3T8T A;  2BW3 B;  3GZN B;  4NC6 A;  3ZQC A;  1O7F A;  1R23 A;  2MC4 A;  2CFX A;  4XLF A;  5FKL A;  3SFI A;  2XGC A;  4EJT A;  4IPA A;  2ZO4 A;  3UKG A;  2CV0 A;  3VTI A;  2O8X A;  3C18 A;  4M6X A;  3AG1 H;  4UXN A;  2LFB A;  3GFL A;  5B3S H;  5A2Q K;  1AHD P;  4DVY P;  2QSF X;  4P9U A;  3B81 A;  2QGU A;  2QQ8 A;  4UHT A;  1AWC A;  1MBG A;  4X1E A;  3HSF A;  4CCK A;  2X51 A;  4B3A A;  2F5E A;  1NHA A;  2P5K A;  2V1X A;  4I0B A;  5HLI A;  5FKN A;  2MH2 A;  4CH7 A;  2EFP A;  3IRR A;  1VQM I;  4U0V A;  2YU9 J;  2Z99 A;  1R9T J;  3HTI A;  4KT6 A;  2K4B A;  4ZZL A;  4IEJ A;  3E1S A;  4FQG A;  2G0E A;  2CRG A;  2QKM B;  5DCM B;  3GXO A;  3ZR8 X;  3GLX A;  2NNN A;  4YEL A;  2HDC A;  2KJC A;  5DTD A;  2OQR A;  1U5T B;  1KU7 A;  3K1M A;  2L4M A;  3TW7 A;  5TJJ A;  2XF7 A;  3OMY A;  3KYC B;  3QRF F;  3VVZ A;  3BZK A;  4ZTF A;  2HYJ A;  2X6W A;  4P9F A;  1J59 A;  3MCZ A;  3V8L A;  1FYK A;  5H6R A;  4IOC F;  1V3F A;  3LSP A;  1X1P A;  1U5T C;  1F9N A;  3RKY A;  4QLC U;  2M45 A;  2PQ8 A;  4B09 A;  4PJ0 C;  4BDZ A;  3W2V A;  2NYX A;  3HKZ N;  2XAU A;  3QPT A;  1BBY A;  3F6V A;  4JYK A;  4RGU A;  4Q5S F;  3RSN A;  3KEY A;  3SEZ A;  4M74 A;  1MMS A;  2Y9Y A;  2ID3 A;  2LRE A;  3F0C A;  2ZJR F;  4LD5 A;  2BY2 A;  2K3F A;  2OUM A;  3PUF A;  3HOW J;  2KIF A;  3M9A A;  3JSO A;  3I4M J;  3I58 A;  3CZ6 A;  1BA5 A;  3OYJ A;  4ZYA A;  3CCR I;  4OOI A;  2YVH A;  4B4C A;  2VKV A;  4PJL A;  2W7N A;  4R1H A;  2ID6 A;  1UFM A;  2GQQ A;  1QQI A;  4BXX J;  1UI6 A;  1LE8 B;  4RBO A;  2Y48 A;  2LKS A;  2M0C A;  3NQO A;  4LIV A;  2EA4 A;  3I54 A;  4U0W A;  3COL A;  1T39 A;  1B9N A;  1W5S A;  1MBK A;  1IW7 F;  1S9H A;  3ELK A;  2UXP A;  4CGR A;  3KPH A;  2O61 A;  4UUS B;  2R7W A;  1IGN A;  5FD6 A;  2TCT A;  1UMQ A;  4MNU A;  3GTJ J;  3RJP A;  2QKO A;  1BM9 A;  2CMP A;  2JSC A;  5F08 A;  1MDM A;  5JR3 A;  3HOY J;  1FIP A;  1U9O A;  4I09 A;  4YEJ A;  1LFU P;  2NRA C;  4ZYG A;  5CVI A;  1MBF A;  3F8F A;  2P7C B;  1X3W B;  9ANT A;  2V9V A;  4IHW A;  5E1X A;  2M7B A;  1Z3X A;  3M07 A;  4PSX A;  1ODD A;  2VBW A;  1F5T A;  1OCO H;  1UZC A;  2VQL A;  1JXS A;  2F2E A;  1WHU A;  3FKI J;  1IN7 A;  1OR7 C;  5HSZ A;  4JL3 A;  3IRQ A;  1ZGW A;  4AF5 A;  4ZC3 A;  3RTR A;  3IKT A;  2L9V A;  4OMZ A;  3LQR A;  3DPJ A;  2HDW A;  2XRN A;  1UJ8 A;  3S3O A;  5D5X B;  4NBQ A;  1FNN A;  3DLL F;  1R00 A;  2CQX A;  3WGH A;  1N75 A;  2OI8 A;  4UUT A;  4ZDL A;  1J75 A;  4HNU A;  1W0U A;  3LA3 A;  1R58 A;  3FXO A;  4KYW A;  4D5C A;  3I53 A;  3LSI A;  4BY1 J;  1WKM A;  2F5D A;  1TWF J;  1LFB A;  2F5V A;  3NRV A;  4I98 B;  3SQN A;  2G7S A;  4N9H A;  2ZME C;  3BG9 A;  1S72 I;  1E3P A;  1XGO A;  1FP1 D;  2CUZ A;  2R5Y A;  4OD4 A;  3AG2 H;  2QM3 A;  3FDY A;  3WTV C;  2JT1 A;  1K79 A;  1OYY A;  1VND A;  3H92 A;  4OIO F;  3RKW A;  1MH4 A;  1RI7 A;  3SWH A;  2EZL A;  3MN2 A;  1GV2 A;  2I10 A;  3F6O A;  2M87 A;  1K6Y A;  3OS2 A;  3FXU A;  1YIO A;  4CCN A;  3ANG A;  2RDP A;  2P4W A;  1EH8 A;  2VE8 A;  3P9C A;  2EIL H;  3S93 A;  5GAD J;  3A03 A;  1GXQ A;  4HV6 A;  4YRV A;  1SAU A;  2Y69 H;  1P4X A;  5D8L B;  4F93 B;  3K70 D;  1Q1V A;  2PFB A;  3HUG B;  1V5F A;  3J81 K;  2EQR A;  2ZNZ A;  3JR9 A;  5D1R A;  1TNT A;  1V55 H;  3MAJ A;  1FTT A;  3ZQL A;  1SVL A;  2KIU A;  4BJ5 C;  4YZE A;  1LNW A;  3DBR B;  1SFO J;  4RLF A;  1ZR4 A;  1W36 C;  4BYY A;  4OD5 A;  2XSD C;  3O2P E;  1KQ9 A;  2QIB A;  3ECO A;  4U9N A;  2ISZ A;  4M71 A;  1U3E M;  2Q2E B;  1G8X A;  2VXZ A;  1I3A A;  2KL4 A;  5KNL A;  3AQT A;  2KIM A;  2UZK A;  2DK8 A;  1BR4 A;  3K2Z A;  4A3D J;  4XRS G;  3OOU A;  3S8P A;  3BR5 A;  3WOD F;  5D5W B;  1DQU A;  3K6G A;  1XC5 A;  2E5Z A;  1IUF A;  3RPU A;  4KWA A;  5HNH A;  3P9K A;  4RM2 A;  4GCK A;  3HRU A;  2LYC A;  1OYW A;  3IHU A;  5E8G A;  2XPV A;  2ICW G;  3AAF A;  3LL7 A;  3ABM H;  2K4J A;  3VUQ A;  1YG2 A;  2ZNY A;  1QBJ A;  2STW A;  5F27 A;  1XSX A;  5EZH A;  2PG4 A;  3L2V A;  4IZZ A;  2D6Y A;  2VPR A;  4LG3 A;  2BHZ A;  2Y2Z A;  4Y7N J;  5M5X J;  2IJL A;  1A04 A;  2EV0 A;  3PPB A;  3PM1 A;  2MLG A;  2DLL A;  2MG4 A;  2X6X A;  2HNH A;  3HIF A;  5D19 A;  2EJR A;  2QQB A;  1DUX C;  5B5E C;  2HDD A;  2Q8K A;  2FBK A;  1OQY A;  1VI0 A;  2BHY A;  2BXY A;  2OD5 A;  4KFC A;  2ZCW A;  3E7L A;  3ABU A;  3LAJ A;  4W97 A;  3G71 I;  1KGS A;  3OIO A;  2L01 A;  3GTG J;  5CVU A;  2GUH A;  5CJ9 A;  2KKO A;  2ZBK A;  2EZH A;  1Z7L A;  2QUF A;  4DQ2 A;  1JHF A;  2YX7 A;  5GTI C;  2QZ8 A;  5LEJ A;  2ZFU A;  3MMY B;  4HDU A;  1A31 A;  2QBY B;  4BE2 A;  1NG7 A;  2H27 A;  2DYS H;  3KEQ A;  2HI3 A;  1JKR C;  3CMY A;  4XLE A;  3IH2 A;  1H8A C;  4WK8 F;  2LG4 A;  2A2F X;  5D4R A;  4M6Y A;  2DA7 A;  4IF4 A;  3BZC A;  3KFW X;  1BI1 A;  4ESF A;  2F4I A;  1NTC A;  3CCY A;  5LEK A;  1HA8 A;  1VTN C;  1K6O A;  5L3E A;  3RI4 A;  3KP4 A;  2VE9 A;  5CXG A;  1J7K A;  2RHA A;  3AFH A;  3QP6 A;  3L2W A;  3GX4 X;  4E7Z A;  4E7L A;  3CJD A;  3D1N I;  1XDS A;  2ME6 A;  1VQ9 I;  2L9S A;  2CYY A;  5CYV A;  3OYN A;  4KIG A;  2KRH A;  3VEP A;  4ZH4 F;  3JRD A;  4XK4 A;  4A3B J;  3EYI A;  1OR7 A;  5BQT A;  1IV8 A;  2R3S A;  4XN3 A;  3AG4 H;  3BWG A;  3G7R A;  4MFE A;  5D18 A;  2JA6 J;  2FD5 A;  3S1R J;  5GP9 A;  1SD4 A;  4RB2 C;  5IYD J;  3KNW A;  4BBR J;  2V57 A;  1JUP A;  1HSJ A;  2IA2 A;  2NX4 A;  1I5Z A;  2MD0 A;  4CIC A;  2XB5 A;  5F6F A;  3R0A A;  2HU9 A;  1K83 J;  2X6O A;  1TQI A;  3QWL A;  1X1C A;  4M3F A;  4FAS D;  1BOA A;  4Q48 A;  5L3B A;  2REK A;  4Z6Y A;  2B3W A;  3BT9 A;  4CO8 A;  2L5Q A;  4DGW B;  3GWZ A;  3QQA A;  2B63 J;  3TDU C;  5A2Q Z;  2ZME A;  3NWT A;  1FLI A;  1ON2 A;  1MBH A;  2L2O A;  3A01 A;  1OYI A;  3CJT B;  1BL0 A;  4E7I A;  5CW8 A;  1SD7 A;  3FM5 A;  4N9I A;  3RPQ A;  2V26 A;  1C0W A;  1TZL A;  3DEE A;  3HBL A;  3E7Q A;  4PJM A;  2EBI A;  2JQ7 A;  2HQN A;  2A05 A;  3CUQ C;  3EUK L;  5TGT A;  2HKU A;  2DI3 A;  4OIQ F;  1HQC A;  1I1G A;  1T0F A;  3CJQ B;  3E6M A;  3KZY A;  4CDG A;  4EV0 A;  3F8B A;  3VYU B;  3BJA A;  1O3T A;  1QA6 A;  4AWX B;  5LBQ A;  3PO3 J;  2EPF A;  5FLX Z;  2IU5 A;  5JLW A;  3EET A;  3DU6 A;  4IX7 A;  3QU3 A;  1ZG3 A;  4LK1 F;  3WTT C;  3ZQG A;  4G7Z F;  1SD5 A;  2NP3 A;  4FIS A;  3DBH B;  3QYF A;  4LLG F;  5IOY A;  5DM6 F;  1IJW C;  4M73 A;  2LTP A;  3PFY A;  1R5I D;  2EB7 A;  1H89 C;  2EFQ A;  2LY9 A;  2CUF A;  2GIV A;  2DXI A;  4IHS A;  4CUG A;  1YS6 A;  2EFO A;  3M4O J;  4BJ6 C;  3JTG A;  3AKZ A;  3OYC A;  5EDN A;  5FLV A;  3DPU A;  2GXG A;  4YFN F;  1TWC J;  2E60 A;  1ZG1 A;  4S04 A;  2G9W A;  3S15 J;  2L7Z A;  5LRR A;  3LSR A;  2UXU A;  1PUF A;  4MTD A;  3KLN A;  5GTH C;  5LGU A;  4OWR B;  4RM3 A;  2P5L C;  3C07 A;  2VQG A;  2QSH X;  3PAS A;  3LSK A;  1OCT C;  2VON A;  3OS1 A;  4MLO A;  3L2R A;  3VYT B;  3M1C A;  1R1U A;  1OFC X;  3D5S C;  2KLO A;  1BI0 A;  1WCM J;  3BZ6 A;  4WWC A;  1T33 A;  2E2I J;  4WXD A;  2HWV A;  1BIB A;  2GXA A;  4F7Z A;  5ILU A;  1UST A;  1QGP A;  2E1N A;  4ITV A;  3UNG C;  2MFZ A;  1HST A;  4G7H F;  1B8I A;  4M3D A;  1L0O C;  1UG2 A;  4I01 A;  3KP5 A;  4XOT A;  4L5J A;  3TW6 A;  5HS9 A;  1MD0 A;  2KRF A;  1KA8 A;  1PJR A;  4L18 B;  3J7Z I;  1TWA J;  2FOW A;  2BY3 A;  3IH4 A;  4B47 A;  1WI3 A;  4IQ4 A;  3GYH X;  5K1Y A;  1DU0 A;  3QBM A;  3BPX A;  1LB2 A;  3IKV A;  4IVN A;  2R92 J;  1I50 J;  2VBX A;  4CYC B;  4HYE A;  1RKT A;  1F4K A;  2QWT A;  2DN0 A;  3R61 A;  2RVC A;  2P7V B;  1QHG A;  5IYC J;  3VVY A;  3WGG A;  3GTQ J;  3SJM A;  5K5R A;  4QPO A;  4B48 A;  1LPQ A;  2X6Y A;  3JAM K;  4Q4Z F;  3S3N A;  1RR8 C;  2MBF A;  4NQW B;  1I39 A;  2AXL A;  2BY1 A;  2FX0 A;  3FM3 A;  3VSK A;  2VOP A;  2OBP A;  4DNC A;  5B66 C;  2L9R A;  1D0Y A;  3ON4 A;  4KMF A;  1TC3 C;  2PBI A;  1UCR A;  3HOV J;  5HS8 A;  2R93 J;  1ZGJ A;  4GYG A;  4F3Q A;  3C2G A;  3SZG A;  1XMK A;  1WJE A;  3CDL A;  3PSI A;  4RA2 A;  2H6B A;  1P7I A;  2W24 A;  3KP2 A;  2E2J J;  1A35 A;  3IV5 A;  2R7U A;  2ESH A;  2DA5 A;  4CZZ A;  2PMU A;  5H2F C;  4YG2 F;  3BCB A;  1USS A;  3WG9 A;  1FSH A;  1YW7 A;  3FXL A;  2E34 A;  4BU2 A;  1IG7 A;  2ZY9 A;  4JNN A;  2AXT C;  3QPS A;  2ECB A;  4M3E A;  3ABL H;  5H9T A;  3FX3 A;  3HSE A;  3BC8 A;  3EGQ A;  3MEX A;  4F52 A;  3J7A Y;  2MA3 A;  4G6Q A;  5KVR A;  1MGT A;  3DQV C;  3HGG A;  2VJ5 A;  4A3G J;  1ETX A;  1HLV A;  2NOG A;  5L3C A;  5DEQ A;  3HIM A;  1XSV A;  4L0Y B;  2IGK A;  4KUM A;  2XUB A;  1OCP A;  3FBI B;  2L54 A;  1PP8 F;  5F1R A;  3DEW A;  3H5A A;  4BNC A;  3TP0 A;  4U9L A;  4AU7 A;  1XSD A;  4HG2 A;  1R22 A;  2W85 A;  5AIQ A;  3NEU A;  2VLA A;  3KP3 A;  5KAF C;  3J81 Z;  2H8W A;  4PUS A;  4KT5 C;  5EG0 A;  1YI2 I;  3FXK A;  5F04 A;  1OKR A;  3QPH A;  1POG A;  2A6E F;  2ELK A;  3K4L A;  2A61 A;  1Q1H A;  2VOO A;  1SEU A;  4GO1 A;  4IRH A;  4WXC A;  3O8G A;  2QKL B;  1FOX A;  2R7S A;  3S3M A;  2Q1Z B;  3CUQ A;  2RAS A;  2VXD A;  5JFR A;  3CP2 A;  3KYD B;  1NG6 A;  3SYT A;  4V2F A;  1D5V A;  2ECC A;  5KHD A;  1WH5 A;  4LFU A;  1D1A A;  4RB0 A;  3O6B B;  1G4D A;  1CF7 A;  2JA8 J;  4L5E A;  1OIS A;  4B43 A;  1W7P D;  3NAU A;  1P6R A;  2CQQ A;  5CLS A;  3K4J A;  1D3Y A;  1Z7U A;  1Y1W J;  2KP6 A;  2XB0 X;  3J80 K;  1SVO A;  2NAZ A;  2IAI A;  2ZXW H;  1N77 A;  4GCV A;  5J47 A;  4Y4R A;  1ZAR A;  3ABT A;  1BR2 A;  2W84 A;  5HNF A;  1YJN I;  1FSE A;  1T6S A;  1ETQ A;  3GF2 A;  3T6N A;  1RIO H;  2F4M B;  3D0S A;  2HVS A;  1Z67 A;  1KYZ A;  2F5F A;  2VJI A;  3MD2 A;  3BTJ A;  1UHM A;  5IT9 K;  1B6A A;  3ZMT A;  2X48 A;  2WA0 A;  2OF7 A;  1YRN B;  1HKS A;  3EDP A;  4BKX A;  3RQ4 A;  2K85 A;  1WWX A;  2HVQ A;  3A0B C;  3V42 A;  5HDK A;  5LFA A;  2O5R A;  3BDD A;  2OCC H;  1IAW A;  2PJR A;  3L7W A;  2A5Y B;  2A5W A;  2UXX A;  5HDN A;  2EWN A;  1P4W A;  2HYG D;  1JTX A;  4OIN F;  1U6G A;  2K9N A;  3K9T A;  1FTZ A;  1XN7 A;  4IJA A;  1K4S A;  2XC7 A;  2EIK H;  3SHF A;  4CYD A;  2B7E A;  3K7A J;  2AHQ A;  3LOC A;  1S3J A;  2JRM A;  1D0X A;  2M9H A;  2RC4 A;  1T2K A;  3ZN1 A;  2XAQ A;  3VFZ A;  5GAE J;  1JUS A;  2JPC A;  4MGR A;  4IHV A;  4JBA A;  2ZSI B;  1LQ1 A;  4LB5 A;  2NVY J;  2NXN B;  2GA1 A;  1RKW A;  3PQK A;  2Y31 A;  1YJW I;  1JT6 A;  1T38 A;  3OYM A;  3TOA A;  3TMO A;  3MNL A;  2OV7 A;  2DOA A;  5FMP A;  1W7P B;  5IP9 J;  4V2G A;  1TWG J;  3VYR B;  3HL2 A;  1IXS B;  1SVM A;  3I5U A;  2JK3 A;  3GUD A;  2STT A;  2P81 A;  3DTK A;  3VOK A;  2DTR A;  3QYB A;  1IO2 A;  2L9N A;  4G12 A;  3PJR A;  4CCO A;  3SDG A;  2HOT A;  2E19 A;  1X1D A;  4BQQ A;  2XPU A;  2JVH A;  5GPC A;  3LMM A;  3WU1 B;  1GDT A;  3GFI A;  4OAZ A;  1WI9 A;  4IO9 F;  2D5V A;  3BPV A;  1R4N B;  1FMV A;  2JWT A;  5L3F A;  1ZR2 A;  3HEF A;  5ICE A;  2GXB A;  1T08 B;  3LFU A;  3FMR A;  1ZEL A;  4DIQ A;  5HBU A;  2QLZ A;  4C2U A;  2COB A;  2DT5 A;  2JJ7 A;  3MKY B;  1Z05 A;  4DZP A;  3S1Q J;  3SZP A;  3JRB A;  2EFW A;  2CGP A;  1HCR A;  3NRG A;  2PZ9 A;  5KCM A;  3OWT A;  4LG0 A;  3NXC A;  1P2F A;  1TLH B;  1KU3 A;  4II3 A;  3PL8 A;  2BBY A;  2VL8 A;  2NP5 A;  3RCO A;  1R6R A;  4ZTJ A;  4YFX F;  4CSW A;  5LHG A;  1LKX A;  2OAZ A;  1LEB A;  2M2E A;  4D7N A;  1WZ2 A;  4LLL A;  3LSM A;  2HOE A;  2V7F A;  4BAC A;  2W4S A;  2MLK A;  2TDX A;  3E6C C;  1P9Q C;  1K78 A;  3TO6 A;  3R0J A;  1Z9C A;  2VKH A;  3BLY A;  4W1U A;  4Y17 A;  1MJB A;  1ULY A;  5HDG A;  5HLT A;  3F8C A;  3DKY A;  4UB6 C;  2OU2 A;  2QVO A;  4ZDP A;  2WY8 Q;  4U7B A;  2KDZ A;  4HBL A;  1IF1 A;  3F23 A;  5HS7 A;  3OYE A;  4EMS A;  1B9M A;  1UG0 A;  5TIS C;  1TL8 A;  4A3I J;  1LEA A;  3FK6 A;  3HHH A;  1J0R A;  1X58 A;  2OQG A;  3T0Y A;  1XCV A;  2Z1D A;  1UB9 A;  2CW7 A;  1SAX A;  2Y0S A;  5ILV A;  4HEA 2;  2HR3 A;  3HRM A;  2GOM A;  3FK7 A;  3I59 A;  5CQE A;  3V78 A;  3A2K A;  2M3A A;  1HXD A;  3OR2 C;  4XKW A;  4XOP A;  3FHN A;  2CUE A;  2L02 A;  2CV2 A;  4EGY A;  3I3L A;  3EYY A;  3KKC A;  1XGS A;  2R5Z B;  1TT0 A;  2XSJ C;  2DQR A;  3K69 A;  4BS9 A;  4L9V A;  1LVA A;  3EQL F;  4LB6 B;  1Z6T A;  5J40 A;  3ZGK A;  1H88 C;  1OMI A;  1EH7 A;  1FYL A;  4DBQ A;  4B8X A;  2KZV A;  3VIB A;  5DUK A;  1IRZ A;  5J4V A;  3OYF A;  1GUU A;  2JSP A;  2KZG A;  1WRJ A;  3RYR A;  1VQ7 I;  3TL4 X;  4NDL A;  4M72 A;  3LAP A;  1REP C;  3CLO A;  1BOB A;  3CUO A;  3ZP5 A;  4FTH A;  2R7X A;  2QOP A;  2LD5 A;  3KP6 A;  1I6X A;  4XON A;  5FKK A;  5FD5 A;  3HPH A;  2YVX A;  3IUO A;  4HF2 A;  3DPT A;  3EUP A;  1DDN A;  2PMZ N;  4AUX A;  4IHT A;  4XLN F;  2DOD A;  1ETW A;  4I76 A;  4AIK A;  2G7H A;  2JMW A;  1F43 A;  3BCG A;  1VQP I;  3T1B A;  4BH9 A;  2QTQ A;  4GRI A;  2L4A A;  2XKO A;  3IC7 A;  2RV8 A;  3BG5 A;  2F48 A;  2FQ4 A;  3RZO J;  1VF9 A;  4CXF A;  2CV1 A;  1IRF A;  3OL3 A;  2QYO A;  2LVS A;  4ON0 A;  1AKH A;  2CG4 A;  4E6K G;  2QF7 A;  3CCV I;  3N97 A;  3MFK A;  3BCA A;  2GM4 A;  2L0K A;  1YO5 C;  2JPB A;  1GVD A;  2B1E A;  4GCL A;  3U2R A;  1HOM A;  3GZ6 A;  5BMZ A;  5E17 F;  1RNL A;  2JTV A;  1JJ6 C;  1O7L A;  2NVT J;  1Z77 A;  2M5W A;  4U7D A;  1GVJ A;  1UHW A;  1V4R A;  5FKO A;  4MEY F;  3JRH A;  3KET A;  4A3J J;  4F55 A;  1BIA A;  2V9K A;  4BEH B;  1VQ6 I;  1I6H J;  4LGW A;  2NS0 A;  4XSX F;  2A3S A;  3R60 A;  3JAM Z;  2V1N A;  4P5O A;  3I4P A;  2HYF A;  3BTI A;  3L2C A;  1UEL B;  1IZ1 A;  2YVE A;  4RMN A;  3GLL A;  5EGO A;  4KIC A;  1FX7 A;  4F92 B;  5ED4 A;  1IN5 A;  3H5R A;  5K7F A;  3VOE A;  3Q0U A;  4S0H B;  1FBQ A;  3GVA A;  2CWE A;  2D1V A;  2QQ9 A;  2BW3 A;  2X1E A;  4K2E A;  4RGS A;  2Y75 A;  1XPX A;  2YX4 A;  3IUV A;  1YFH A;  3X2Q H;  4JX4 A;  4BXF A;  4DJA A;  3OY9 A;  1YIJ I;  3BR3 A;  5M5Y J;  3K0L A;  3HRS A;  5FRM A;  3FMS A;  1SD6 A;  3CP8 A;  2NOJ B;  4GXO A;  4HX7 A;  1EKE A;  1SFE A;  1DPR A;  5DUI A;  4D5F A;  2EZI A;  4Y33 A;  1JKQ C;  1VQL I;  4DBR A;  3KZI C;  2KMU A;  4I02 A;  3HZJ A;  2JA7 J;  1HW5 A;  2IEK A;  1BC7 C;  3FXM A;  2JRT A;  1IN4 A;  5D6F A;  3F72 A;  5F64 A;  4C2M J;  3PFI A;  4UVB A;  1BI2 A;  2OC6 A;  5DCM A;  4HOB A;  3FZV A;  4NUB A;  2M4G A;  2G7L A;  1TW2 A;  3H9G A;  4L9N A;  4A5N A;  2XGE A;  3FMQ A;  1U5T A;  1M1E B;  1ZQ3 P;  3PO2 J;  4XKB A;  4R79 A;  2V1U A;  4G7O F;  1FWZ A;  1WPK A;  2VKD A;  2EIN H;  4JX5 A;  2R0Q C;  5HLG A;  2PBX A;  1LDK B;  1MW7 A;  3Q3S A;  2K3P A;  2Q0O A;  3HTJ A;  2E1C A;  5ICG A;  4A0X A;  1GHC A;  1Z1D A;  2KT0 A;  4FE4 A;  1MSE C;  1DGR M;  2WV1 A;  3PIO F;  4AYB N;  2X9D A;  1MSF C;  3LFK A;  1JKO C;  2PJP A;  3GZI A;  2E5N A;  2OER A;  2M4K A;  1UHS A;  1G3Y A;  3G1O A;  2LK2 A;  1QHH D;  3A1Y A;  3I64 A;  4ME9 A;  5FKM A;  2PX9 A;  4LLN A;  4HAM A;  2LBF B;  3H1C A;  2OJE D;  4MIM A;  1GT0 C;  3CRJ A;  1S7E A;  1VZ0 A;  2O7T A;  3NAR A;  3TGN A;  3K70 C;  1MBE A;  3PNV A;  3KZZ A;  1ZG5 A;  3JRF A;  1WJA A;  2I8D A;  3E6D A;  4M3G A;  3HXL A;  3DTI A;  4PJN A;  5C44 J;  2LKX A;  2D45 A;  1LE8 A;  5J4Y A;  2QEX I;  1BJA A;  2JUC A;  1U8B A;  2IVM A;  2W53 A;  2IBD A;  2KFD A;  4BQN A;  2LMD A;  5D6E A;  1Y8Q B;  2DMN A;  4CCL A;  2FQ3 A;  3CDH A;  1RUO A;  3G6E I;  2G7G A;  1ETV A;  4PDK A;  4UUS A;  1B72 B;  6PAX A;  3ISP A;  4HX8 A;  2LF8 A;  3G73 A;  4PGH A;  4XKV A;  3HGY A;  3JCU C;  3F22 A;  3OYA A;  2CW0 F;  3HOZ J;  2HFH A;  2DA3 A;  3SFZ A;  1U8R A;  3KZ9 A;  4MTE A;  1TW3 A;  4XOR A;  2VBZ A;  1HKT A;  4Q47 A;  4H0E A;  5IT9 Z;  5TRD A;  5AIP A;  4KMU X;  2IS2 A;  1YX5 A;  3PIP F;  2EV6 A;  4MHG A;  1PDN C;  5J1Y A; 
#chains in the Genus database with same CATH homology
 2K9Q A;  3HTH A;  1TC3 C;  4A3F J;  3HOV J;  3DCF A;  2LFB A;  1AHD P;  2HOA A;  2CU7 A;  2R93 J;  4A69 C;  2WGB A;  3B81 A;  3OSG A;  1DU6 A;  1MBG A;  4X1E A;  5IP6 A;  3CDL A;  1YRN A;  4B3A A;  1P7I A;  2E2J J;  4HKU A;  3IV5 A;  2YU9 J;  5FKN A;  3S17 J;  4UDS A;  2DA5 A;  4HNV A;  4C3I J;  1R9T J;  3HTI A;  2O7O A;  4IEJ A;  4EEF G;  4QTR A;  1HF0 A;  5E3L A;  1ZTR A;  2CRG A;  2G0E A;  1IG7 A;  5DTD A;  2Y9Z A;  3TED A;  3QPS A;  2ECB A;  1IC8 A;  4JNN A;  4M3E A;  5FHP A;  5EZG A;  3TW7 A;  5H9T A;  4BBS J;  4MO7 A;  3EGQ A;  3VVZ A;  4ICH A;  3HGG A;  2HYJ A;  4A3G J;  3BRU A;  2K40 A;  3ZOB A;  4A3L J;  1ETX A;  3BR1 A;  2NOG A;  1HLV A;  3LSP A;  3HIM A;  1JTY A;  5E3O A;  1OCP A;  4MXM A;  2K9S A;  2TRT A;  4RDU A;  4Y52 J;  3DEW A;  2GEN A;  3TP0 A;  3HKZ N;  1APL C;  4JYK A;  3BQY A;  1WH7 A;  1PUF B;  3GEU A;  3KKD A;  3K2A A;  1RES A;  2Y9Y A;  3ZQI A;  5M3F J;  2ID3 A;  5C4Y A;  3F0C A;  5EG0 A;  2OPT A;  5F04 A;  3HOW J;  3I4M J;  2NS7 A;  4QIW N;  1POG A;  1BA5 A;  2ELK A;  2EZK A;  5EFY A;  2YVH A;  4B4C A;  2AO9 A;  2VKV A;  2ID6 A;  3O8G A;  1F36 A;  2ZCX A;  1E3O C;  4BXX J;  1I3Q J;  1UI6 A;  1LE8 B;  4RBO A;  2RAS A;  4BY7 J;  3S1M J;  2M0C A;  5FJ8 J;  4NEL A;  1B8I B;  3COL A;  4V2F A;  3I4N J;  1MBK A;  3RKQ A;  2UXP A;  2ECC A;  4J19 A;  4I6Z A;  2UXO A;  1WH5 A;  4CGR A;  4UUS B;  2VKE A;  2HXI A;  1IGN A;  2JA8 J;  2TCT A;  1UMQ A;  4L5E A;  3GTJ J;  3NAU A;  2QKO A;  2CQQ A;  5F08 A;  2E1O A;  4AC6 A;  3GBG A;  3HOY J;  1FIP A;  1U9O A;  1Y1W J;  3HOU J;  1LFU P;  2XB0 X;  1JGG A;  2DJN A;  2DG8 A;  2IAI A;  3ZQH A;  1RPW A;  3QPL A;  1MBF A;  2EH3 A;  3MKL A;  5E3M A;  3G56 A;  3JRA A;  9ANT A;  1BW6 A;  4IHW A;  3TP3 A;  1ETQ A;  3T6N A;  1ETO A;  5J1U A;  1MH3 A;  3BTJ A;  2DMQ A;  1ORK A;  2XRL A;  3FKI J;  5JLX A;  2XPW A;  2ZOY A;  2X48 A;  5HSZ A;  4JL3 A;  2OF7 A;  1GV5 A;  1ETY A;  1YRN B;  1ZGW A;  2HXO A;  4BKX A;  3RQI A;  1U9N A;  4AF5 A;  3EUP A;  2O8K A;  1MNM C;  3DPJ A;  1BJZ A;  5DS9 A;  1JTX A;  4LOC A;  3LHQ A;  2QCO A;  2K9N A;  1FTZ A;  4JKZ A;  2CQX A;  2JN6 A;  2R5Z A;  2OI8 A;  3V6G A;  4UUT A;  4FCY A;  4X6A J;  2LR8 A;  3VW0 A;  1W0U A;  3K7A J;  2AHQ A;  3LOC A;  2M9H A;  4D5C A;  3B6A A;  4BY1 J;  4M6V A;  1TWF J;  1LFB A;  3BHQ A;  1JUS A;  4IHV A;  2G7S A;  2NVY J;  3BG9 A;  3IH3 A;  1RKW A;  3S1N J;  2R5Y A;  2Y31 A;  2LP0 A;  1JT6 A;  3VOX A;  2UXH A;  1VND A;  4L62 A;  2WUI A;  3ZQF A;  4AC0 A;  1O4X A;  1MH4 A;  3MNL A;  4DYQ A;  2EZL A;  3BNI A;  5FMP A;  3BR0 A;  2DMU A;  3BQZ A;  5IP9 J;  4V2G A;  1TWG J;  3MN2 A;  1GV2 A;  2I10 A;  3BR2 A;  3HE0 A;  2W48 A;  1ENH A;  2JK3 A;  3ANG A;  5HAW A;  2P81 A;  3VOK A;  2WB1 N;  4G12 A;  3SDG A;  5EG0 B;  2HOT A;  3A03 A;  3HTA A;  2E19 A;  1IDZ A;  3RD3 A;  2XPU A;  3FIW A;  2WAQ N;  5GPC A;  3NI7 A;  1GDT A;  2D5V A;  5EYR A;  1ETK A;  2JWT A;  4M3B A;  4MFD A;  1ZR2 A;  1Q1V A;  3HEF A;  3NPI A;  2EQR A;  3JR9 A;  5D1R A;  5HBU A;  1FTT A;  2HQ5 A;  3ZQL A;  2COB A;  2JJ7 A;  4YZE A;  3OSF A;  4DZP A;  3S1Q J;  5HOD A;  3JRB A;  1SFO J;  1A6I A;  1ZR4 A;  1HCR A;  2XSD C;  3NRG A;  2QIB A;  4C3J J;  2PZ9 A;  3HB9 A;  4IHY A;  3NXC A;  2DA6 A;  3JRI A;  2NP5 A;  3AQT A;  3P9T A;  1JKP C;  4A3D J;  4XRS G;  3OOU A;  2VUM J;  1UI5 A;  1RET A;  3BR5 A;  2M2E A;  4D7N A;  2DA1 A;  1SAN A;  1FJL A;  1XC5 A;  5EF6 A;  1IUF A;  4KWA A;  1ITY A;  3JRG A;  3S16 J;  3BR6 A;  4GCK A;  3L1P A;  5IP7 J;  2CJJ A;  5J3L A;  4W1U A;  1JT0 A;  2FJ1 A;  2XPV A;  5F1J A;  1OJL A;  1QPI A;  3VUQ A;  1IDY A;  1HDP A;  2KDZ A;  3GTK J;  5F27 A;  5EZH A;  3O8H A;  5GPA A;  1T56 A;  2YUS A;  2DTZ A;  2D6Y A;  4GCT A;  2VPR A;  4JP0 A;  3HOX J;  5IYB J;  2Y2Z A;  2H8R A;  2NS8 A;  2ZOZ A;  4Y7N J;  5M5X J;  4A3I J;  3LWJ A;  3FK6 A;  3PPB A;  1X58 A;  3PM1 A;  2MG4 A;  4A3C J;  4GFL A;  2GBY A;  3V78 A;  3LSJ A;  5D19 A;  3FK7 A;  4XID A;  2F07 A;  2HDD A;  1FEX A;  1JUM A;  1VI0 A;  2L7F P;  1EF4 A;  2HYT A;  2CUE A;  1XG1 A;  2MSY A;  3S5R A;  3E7L A;  1HDD C;  2ZCM A;  3KKC A;  4W97 A;  2R5Z B;  1AU7 A;  2G3B A;  3OIO A;  5CXI A;  3GTG J;  3RH2 A;  2GUH A;  1H88 C;  2HOS A;  3VP5 A;  2EZH A;  4D7M A;  3VIB A;  1IRZ A;  1Z0X A;  1GUU A;  4NDL A;  4QSH A;  3WHB A;  2LLK A;  2R5Y B;  4FTH A;  4NN1 A;  4DYC A;  1MBJ A;  4B1R A;  3W6V A;  2QOP A;  1X2M A;  2LD5 A;  5K7Z A;  5FKK A;  2M34 A;  5M3M J;  5C3E J;  4A3M J;  1BW5 A;  2HI3 A;  2PMZ N;  4AUX A;  3CMY A;  3JRC A;  4I76 A;  1ETW A;  1JKR C;  2YS9 A;  3IH2 A;  2UXI A;  2JMW A;  1F43 A;  5EEA A;  2Y30 A;  1SGM A;  3BCG A;  1H8A C;  3Q0V A;  2QTQ A;  2DA7 A;  2DMP A;  3H3V K;  3BG5 A;  3NNR A;  2FQ4 A;  3LSG A;  3RZO J;  1VF9 A;  3HM5 A;  2DG7 A;  1NTC A;  3CCY A;  3C2B A;  3G1M A;  3LNQ A;  2LVS A;  1AKH A;  1CQT A;  5CXG A;  2RHA A;  2O9L A;  3CJD A;  2QF7 A;  3D1N I;  2ME6 A;  2GFN A;  2GM4 A;  3JRD A;  2L0K A;  4XK4 A;  4A3B J;  3VVX A;  2M8G X;  4GCL A;  1GVD A;  1RR7 A;  1TWH J;  3RZD J;  1HOM A;  3G7R A;  4MFE A;  5D18 A;  2JA6 J;  3QKX A;  1JJ6 C;  2FBQ A;  2RAE A;  2FD5 A;  3S1R J;  5GP9 A;  2GLO A;  5IYD J;  3KNW A;  2NVT J;  3VPR A;  4BBR J;  2V57 A;  1Z77 A;  2ZB9 A;  4IHX A;  1JUP A;  1U78 A;  5FKO A;  3JRH A;  1IV6 A;  2E2H J;  2NX4 A;  4A3J J;  3GTO J;  1D5Y A;  2XGD A;  2XB5 A;  3M3Y J;  1B72 A;  1K83 J;  3LJL A;  1I6H J;  4MK6 A;  4ACI A;  2X6O A;  2N8G A;  1VFC A;  1XS9 A;  4M3F A;  5K7H A;  1ZKG A;  4CYC A;  3BTI A;  2REK A;  2YVE A;  3VW1 A;  5EGO A;  2H1K A;  3BT9 A;  3GTP J;  4DZJ A;  5K7F A;  1X2N A;  3Q0U A;  3QQA A;  1Y1V J;  4S0H B;  2B63 J;  1ZK8 A;  2MGQ A;  3BJB A;  3IUV A;  1MBH A;  3A01 A;  1JJ8 C;  1BL0 A;  5CW8 A;  4JX4 A;  3JRE A;  3BR3 A;  5M5Y J;  2Y0S N;  4XIC A;  3HBL A;  2XDN A;  4GFB A;  3GTM J;  3E7Q A;  2EBI A;  2NVQ J;  2HKU A;  1FIA A;  4A3E J;  4D5F A;  2EZI A;  4JX6 A;  1JKQ C;  3MVP A;  4C3H J;  5FGL A;  2JA7 J;  2DMT A;  3ON2 A;  3PO3 J;  2IEK A;  3O60 A;  2IU5 A;  5JLW A;  5F0H A;  4C2M J;  1QVU A;  1QRY A;  3CQZ J;  3BG3 A;  2G7L A;  3GTL J;  3WHC A;  3HDD A;  3ZQG A;  3B6C A;  5F0C A;  2NP3 A;  2XGE A;  4FIS A;  1NK3 P;  1W0T A;  1ZQ3 P;  3PO2 J;  5IOY A;  1WPK A;  1IJW C;  2LTP A;  4JX5 A;  2VI6 A;  2R0Q C;  1H89 C;  2L7M P;  2LY9 A;  2CUF A;  3F1B A;  2PBX A;  3Q0W A;  3Q3S A;  2MW8 A;  4GFK A;  3M4O J;  2DA2 A;  3HTJ A;  2KT0 A;  4FE4 A;  5M5W J;  1MSE C;  2JA5 J;  5EDN A;  2WV1 A;  5FLV A;  4AYB N;  3BTC A;  2X9D A;  1TWC J;  1MSF C;  1JKO C;  2ME0 A;  3S15 J;  4ABZ A;  2R7Z J;  3GZI A;  3BTL A;  2L7Z A;  3LSR A;  2UXU A;  1PUF A;  2OER A;  4DYR A;  1UHS A;  3G1O A;  3C07 A;  2LK2 A;  5IOZ A;  4XRS A;  1QVT A;  3PAS A;  4XRM A;  1OCT C;  4ME9 A;  1K61 A;  5FKM A;  3FRQ A;  3CRJ A;  4MLO A;  4MIM A;  1GT0 C;  1AKH B;  3VW2 A;  1WGX A;  1S7E A;  1OFC X;  2O7T A;  3NAR A;  4A3K J;  1WCM J;  2E2I J;  1MBE A;  1T33 A;  4FE7 A;  1P7J A;  3JRF A;  5IPA A;  4M3G A;  5DAJ A;  2ZCN A;  5C44 J;  2LKX A;  1LE8 A;  3S2D J;  1U8B A;  1B8I A;  4PXI A;  4M3D A;  1UG2 A;  2W53 A;  2IBD A;  5E3N A;  3S2H J;  3FIS A;  5C4X J;  5AQC A;  3TW6 A;  4A93 J;  1NK2 P;  2DMN A;  5C4J J;  3G1L A;  5BNG A;  2G7G A;  5K58 A;  1ETV A;  1TWA J;  5J1R A;  3IH4 A;  1WI3 A;  4UUS A;  1B72 B;  3A02 A;  1G2H A;  2DA4 A;  1DU0 A;  3QBM A;  1A5J A;  3HGY A;  3AQS A;  3CWR A;  2R92 J;  1I50 J;  4CYC B;  3S14 J;  2NVX J;  1RKT A;  5F0F A;  5FLM J;  5EGO B;  2QWT A;  2DN0 A;  3JSJ A;  3HOZ J;  3VVY A;  5IYC J;  2DA3 A;  3KZ9 A;  4DW6 A;  3GTQ J;  3SJM A;  3ZQC A;  2Q24 A;  3A01 B;  2FX0 A;  5FKL A;  3SFI A;  2XGC A;  3H0G J;  3ANP A;  2L9R A;  3UKG A;  3ON4 A;  5J1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...