1QVTA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of the simultaneous binding of two drugs to a multidrug-binding protein
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
total genus 74
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1qvtA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1qvtA02
4JNNA 5F0CA 3DEWA 2JA5J 2JN6A 3BG5A 1D5YA 2OERA 5K7FA 4HNVA 4B3AA 1FIPA 1APLC 2CQXA 2QOPA 2DA2A 1P7JA 2HOSA 3L1PA 2IU5A 2MSYA 2P81A 3T6NA 3JRHA 1HDPA 1QVUA 3K2AA 2JK3A 2QCOA 2DG7A 3V6GA 4I76A 3JRCA 2KT0A 1F43A 1JKPC 4AC6A 2GENA 5H9TA 2CUEA 3GBGA 2D6YA 4A3GJ 2LLKA 1ORKA 1TC3C 1IDYA 2NP5A 4A93J 4FE7A 3BTJA 1JKQC 5IP9J 2OPTA 3NNRA 3IH3A 1RKTA 5FLMJ 2IAIA 3KKCA 2HOTA 3I4MJ 1MBEA 1I50J 4A69C 3A01A 1LE8B 3VVYA 2HOAA 1JTYA 3QQAA 1EF4A 2O7TA 1GUUA 1NK2P 5GPCA 2LFBA 2MW8A 2X9DA 4B4CA 5M3MJ 2ZCNA 1E3OC 1ETYA 4X6AJ 5E3NA 2NP3A 4ICHA 4A3IJ 1VNDA 4ME9A 3GTKJ 1Z77A 4CGRA 3WHCA 2E1OA 1SANA 3M3YJ 2CRGA 3S2DJ 2YUSA 3JRIA 4BY1J 1B72A 3MKLA 3DPJA 3JREA 2NS7A 1Q1VA 1IV6A 1HF0A 5DTDA 1H89C 2QIBA 4D7MA 3W6VA 1POGA 4Y52J 5EFYA 5F0FA 2D5VA 5F0HA 3G56A 4DYCA 3HE0A 1ZTRA 3HIMA 3ANGA 2CUFA 2O9LA 1WPKA 1JKOC 1GDTA 2YS9A 2M2EA 4JYKA 4HKUA 2ECBA 1JJ8C 4NDLA 5FKNA 3CJDA 1IGNA 4IHXA 3O60A 2M8GX 3FIWA 2REKA 2Y9YA 2ID6A 5GPAA 2LY9A 1TWAJ 1U9NA 2DA3A 4RDUA 1XC5A 3LSGA 3KZ9A 2FQ4A 2GFNA 1H8AC 4MIMA 3VP5A 5D18A 3VOXA 3SDGA 1BW5A 5EEAA 3G1OA 2IBDA 3KKDA 3ON2A 1O4XA 1XS9A 2K9QA 5FKMA 1NK3P 3EUPA 2DJNA 1B72B 3HTIA 2K9SA 1JKRC 4CYCB 3NXCA 1ETVA 2XRLA 2IEKA 4QIWN 1DU0A 3BTLA 4AF5A 1VFCA 2X6OA 2ECCA 2XB5A 1AU7A 2NS8A 3HEFA 1LE8A 1U78A 3CRJA 2WV1A 1HOMA 2ZOZA 2YVEA 2EZIA 2HYJA 4X1EA 1SFOJ 3FRQA 4AC0A 4M3BA 4UUSA 2XSDC 1TWGJ 1ENHA 5EDNA 2HYTA 2WB1N 3G1MA 5M5XJ 3ZOBA 2H1KA 3M4OJ 2WGBA 2TCTA 2PZ9A 1HLVA 3S1RJ 1OCPA 2H8RA 3CWRA 1JT6A 2Y2ZA 2K40A 3QBMA 5GP9A 4GCLA 1HDDC 4FISA 1JGGA 1AKHB 2XDNA 2VKEA 5C44J 2L7ZA 5JLXA 1GV2A 4M3FA 2COBA 3LSPA 2RHAA 2M0CA 1SGMA 2OF7A 1MSFC 3BJBA 2M34A 4QSHA 3PO2J 5JLWA 3UKGA 3BQZA 1LFBA 3QPLA 1BW6A 2HXIA 1A6IA 3BR1A 3H0GJ 3Q0WA 1X58A 3OOUA 4FE4A 4IHVA 2DMNA 2LKXA 3BNIA 3PPBA 4MO7A 3AQTA 3HGYA 2R93J 3S16J 4JL3A 1ZR2A 4YZEA 1GT0C 4FCYA 5FLVA 1UI6A 2UXOA 5CXIA 2R5ZB 5FHPA 3GTQJ 2ID3A 3BR6A 3E7QA 4XRMA 3H3VK 3RKQA 3GEUA 3RQIA 2DA4A 2NVTJ 5J1RA 2XGCA 2NX4A 4A3EJ 2R5YB 4L5EA 3ZQFA 4I6ZA 2LD5A 2AHQA 1ETQA 2G0EA 5C4XJ 4A3CJ 2PMZN 2N8GA 3BT9A 3MN2A 1NTCA 1RESA 1LFUP 4IHWA 2EBIA 3HOXJ 1Y1WJ 1AKHA 1QRYA 2DMQA 2AO9A 4XK4A 5AQCA 3SFIA 1MH4A 2FJ1A 4UDSA 3HOWJ 3G7RA 4NELA 5C4YA 2W48A 5J3LA 2L9RA 4XRSG 1U9OA 4QTRA 2EQRA 3RH2A 2LR8A 2QWTA 2VI6A 3VIBA 2O7OA 4Y7NJ 5IYDJ 5IP7J 4BY7J 3GTGJ 5J1YA 2RASA 3IH2A 1JTXA 2XB0X 4UUTA 3A02A 3LOCA 2EZKA 5D1RA 1OJLA 2JMWA 4DW6A 4XIDA 1BJZA 3JR9A 2DG8A 2Q24A 3G1LA 2G7LA 3RZOJ 4A3FJ 1A5JA 1CQTA 1S7EA 2I10A 2Y9ZA 4GFLA 5EG0A 4GFKA 1X2NA 1ZGWA 2G7SA 3HOYJ 4KWAA 1OFCX 2GM4A 2O8KA 2MGQA 1MBHA 3Q0UA 2HXOA 2R92J 3S14J 2JA7J 3PO3J 3S5RA 3WHBA 4AUXA 5IYBJ 3LSRA 2G7GA 3B6CA 3OSGA 1WH7A 1RETA 5HSZA 1DU6A 1QPIA 2R5ZA 4BBSJ 1JUPA 5DAJA 5DS9A 1ETOA 3ZQGA 3OSFA 5BNGA 3QKXA 2NVXJ 2Y0SN 2ZCMA 1WCMJ 5C3EJ 4NN1A 3GTOJ 2HDDA 2FD5A 3JRFA 3NPIA 4MXMA 4AYBN 2L0KA 2XPUA 3NARA 5F08A 5EF6A 9ANTA 2DMPA 3K7AJ 5FKLA 2X48A 3HM5A 3Q0VA 3FK7A 1P7IA 3GTMJ 1WH5A 3GZIA 3PASA 3ON4A 3VOKA 3S1MJ 2JA8J 2EZLA 1FTZA 3HDDA 1UMQA 2NOGA 3ZQCA 3EGQA 3ANPA 5F27A 3S15J 1FEXA 4M3EA 3LWJA 5K58A 3NAUA 1JUMA 4C2MJ 4D7NA 1Z0XA 1TWHJ 3VVXA 2VPRA 1UHSA 3HB9A 2LTPA 2UXIA 4JX6A 5HBUA 3C2BA 1F36A 4JX4A 3HGGA 4C3IJ 3SJMA 2PBXA 4MK6A 4A3MJ 1IG7A 3BR3A 3CCYA 3S1QJ 1MH3A 5D19A 3QPSA 1X2MA 1R9TJ 1T56A 2E19A 1JUSA 1UI5A 3O8GA 3JRGA 4JKZA 3VPRA 5IP6A 2TRTA 3GTJJ 1TWFJ 1MSEC 5EGOA 2DN0A 4V2FA 2WAQN 2OI8A 3JRDA 3OIOA 1JJ6C 3HOVJ 1MBKA 2EZHA 3IUVA 1RR7A 3S1NJ 1T33A 1WI3A 1RKWA 1W0UA 4A3LJ 4A3BJ 3CDLA 1FJLA 4LOCA 2E2JJ 2DA7A 2L7FP 2GLOA 3GTLJ 2LVSA 5EZHA 3BQYA 3VW0A 2DA5A 1PUFA 2B63J 3NRGA 4J19A 3VW1A 3FISA 3BR5A 1ITYA 3JSJA 5FMPA 1I3QJ 3B81A 4PXIA 3ZQLA 2KDZA 3D1NI 3RZDJ 3B6AA 3TW6A 3KNWA 3VVZA 2NVQJ 5EG0B 2DMTA 1BL0A 1ZQ3P 2XGEA 3F0CA 2K9NA 5FGLA 4M6VA 5M5YJ 3Q3SA 3ZQIA 4FTHA 5K7HA 5K7ZA 4EEFG 1U8BA 1W0TA 4W97A 5IOYA 4MLOA 4G12A 1HCRA 3A03A 3BG9A 1ZKGA 4JP0A 5E3MA 4BXXJ 4M3DA 3BTCA 5CW8A 4RBOA 1IDZA 5C4JJ 5EGOB 3MNLA 2EH3A 2DTZA 3TP3A 2E2IJ 2F07A 2FBQA 2GUHA 2FX0A 1GVDA 2Y30A 3FK6A 4D5FA 3BR0A 3PM1A 5HODA 1XG1A 1RPWA 4DZPA 2HI3A 5CXGA 1K83J 3TP0A 2Y31A 5EYRA 4L62A 5E3LA 1Y1VJ 3E7LA 1GV5A 4GCKA 3VW2A 3S17J 2M9HA 1IJWC 4A3KJ 2W53A 4GCTA 1WGXA 1TWCJ 1QVTA 2ME6A 2QF7A 4BBRJ 5F04A 3LNQA 4M3GA 4GFBA 4IEJA 2QKOA 4IHYA 4W1UA 3BRUA 2DMUA 4DYQA 4CYCA 2QTQA 3MVPA 3GTPJ 1ZR4A 2R7ZJ 1ETXA 1VI0A 3F1BA 2CQQA 3VUQA 4V2GA 2ZB9A 2UXUA 1IUFA 1K61A 3O8HA 5IYCJ 3NI7A 5IOZA 1YRNA 3HKZN 1BA5A 3RD3A 2R5YA 1IRZA 4S0HB 1ETWA 3HBLA 2MG4A 2ME0A 3COLA 3V78A 4JX5A 4D5CA 1AHDP 1ETKA 4A3JJ 1ZK8A 2E2HJ 1VF9A 1H88C 5F1JA 2ELKA 2R0QC 1FIAA 1I6HJ 3CQZJ 5FKKA 2XPVA 2WUIA 3IV5A 4B1RA 4XICA 1YRNB 5EZGA 2LK2A 5J1UA 1MBJA 3HTAA 3HTJA 4XRSA 2NVYJ 2XGDA 2XPWA 1MBGA 4MFEA 4C3HJ 5FJ8J 3S2HJ 4C3JJ 4A3DJ 5HAWA 1B8IA 3I4NJ 2L7MP 3LSJA 5IPAA 3BTIA 4ABZA 3IH4A 2LP0A 4MFDA 2RAEA 3A01B 2GBYA 3HOUJ 3CMYA 2YVHA 2JWTA 1FTTA 2VUMJ 3TW7A 1G2HA 1B8IB 3LJLA 2YU9J 2DA6A 3FKIJ 2UXPA 3JRAA 4ACIA 3P9TA 3ZQHA 4DZJA 1MBFA 4DYRA 2HKUA 3BR2A 3HTHA 1OCTC 3AQSA 2ZOYA 5FKOA 2HQ5A 1PUFB 3DCFA 3BG3A 1MNMC 4BKXA 3HOZJ 2UXHA 3JRBA 3BCGA 5M5WJ 3C07A 1UG2A 5E3OA 2ZCXA 3BHQA 2JJ7A 2CU7A 5M3FJ 3TEDA 2DA1A 2G3BA 1JT0A 3LHQA 2JA6J 2V57A 2VKVA 2CJJA 1IC8A 4UUSB
chains in the Genus database with same CATH superfamily
3MKWB 4DOZA 3CF5F 1XMXA 3P7NA 3GO5A 3IWFA 3SEQA 3IUOA 4HNVA 4J00A 2Z3YA 1APLC 1NHAA 4MHGA 2QOPA 2DA2A 1MJBA 1ONVA 4YFXF 3KP2A 2HOSA 4ZH4F 1AWCA 4HG2A 2DCEA 2P81A 3T6NA 3JCUC 1ON2A 1HDPA 1QVUA 1Z9CA 4EATA 2JK3A 3ASNH 2VQLA 5BPIA 2QCOA 3V6GA 2BY2A 4U0WA 2Z16A 3JRCA 1BOBA 3VSLA 3KLNA 1R5HA 1FY7A 1O3RA 2D6YA 2LLKA 3V4GA 1TC3C 3KYDB 4A93J 3S3OA 5HLGA 4HRIA 4UV9A 5TJJA 2OPTA 4IX7A 2DDBA 3NNRA 3KKCA 4LG0A 1QNTA 3FXJA 4ZYHA 2FMYA 1LE8B 3QQAA 4BYYA 1N75A 2LFBA 1FT9A 2MW8A 3K69A 5M3MJ 1E3OC 1X3WB 3HRSA 2K3PA 4XLHA 4YEJA 2V1UA 2HGCA 1VNDA 3CZ6A 2CFOA 1Z77A 2K4JA 2E1OA 1J2XA 3M3YJ 2CRGA 4HOBA 1ZELA 2K02A 3JRIA 3QU6A 3DQVC 1UAAA 3DPJA 3OS1A 4NBQA 5B5EC 2J5OA 2KIMA 3VYRB 3WTVC 1FBUA 2ESNA 1U3EM 4ENMA 1SAXA 4DVYP 4D7MA 3DF8A 4RGRA 4CCOA 2D5VA 1UFMA 1WHUA 4DYCA 3CP8A 4Q48A 3RYRA 4G7HF 3HIMA 2V1NA 2GOMA 4FT8A 2M0MA 1WPKA 4KT6A 3RCOA 1JKOC 2CV2A 3ASOH 2M2EA 3ECHA 1SVOA 4JYKA 2X4HA 2EIJH 2FOKA 2DOAA 4IHXA 2M8GX 1ZRDA 1FBQA 4XQFA 2LDUA 1TQPA 1X3UA 2E5ZA 3KZ9A 2FQ4A 1PYVA 1HKSA 1H8AC 3K4KA 2PMUA 1LEBA 3KP4A 5ICFA 3KKDA 1KU9A 2NRAC 1G3WA 4IHTA 4LK1F 4ZJZA 1I6XA 1JKRC 4IOCF 4IHSA 2X0LA 1B9MA 4RGSA 2IEKA 4ZYGA 3J7AO 2VXZA 1DU0A 5LLQA 3BTLA 2PG4A 3CC7I 5J8CA 4AF5A 2IGKA 2XB5A 1UG0A 3CCEI 1TBXA 3DLAA 2CWEA 1YFHA 1U78A 5HLTA 1R7JA 1UZCA 2WV1A 3L09A 1IRGA 2BV6A 4X1EA 1RI7A 5B1BH 5KVRA 1ENHA 2F5EA 2WB1N 5CKTA 4LLGF 5M5XJ 1JI8A 3M4OJ 4ZTJA 2WGBA 3E6BA 2PZ9A 2IS4A 3VTIA 2RQQA 2DI3A 3HOTA 3QBMA 1FPQA 2F5CA 4WF2A 4BGDA 2R7RA 4G7ZF 3GF2A 1JE8A 2XAHA 2VXDA 4AIJA 1JGGA 1GVJA 1AKHB 1FOKA 2XDNA 4Y13A 5JLXA 1GV2A 2OF7A 2WA0A 4KIFA 4PGHA 2QQ8A 4I2OA 2QVOA 2A5WA 3UKGA 1P4XA 4HAMA 5FO5A 1BI3A 1BW6A 1EH6A 2MYSA 2XAJA 2HXIA 4P55A 3UR3C 4A12A 3PL8A 4IO9F 4RM2A 5LHIA 2BY1A 1Z21A 1P4WA 3ZQ7A 3JAMK 1H9GA 3WE2A 2VB6A 4IHVA 1TNTA 3LSHA 2IS1A 3NWSA 1JXSA 5CPRB 3AQTA 2R93J 2ZY9A 1GT0C 1USSA 2IVMA 5FLVA 2K86A 3K4LA 2ZJRF 2VQCA 4PZJA 4XRMA 2BXYA 1BR2A 2RDPA 2X1EA 4M6XA 4AM3A 1BBYA 3GFLA 2DA4A 4JK1X 4ASNA 1G3TA 1VQPI 4A3EJ 3VWBA 5IT9Z 2FUG2 4L5EA 2NX4A 1NG7A 4I6ZA 2LD5A 1ETQA 1BI2A 2P5LC 3F21A 3BT9A 3MN2A 1JHHA 1VQ7I 1QRYA 4L5IA 2D45A 5AQCA 3L2VA 4UDSA 3HOWJ 4NELA 4WWCA 2QEXI 3CJTB 1FNNA 2EQRA 5FB2A 1PP7U 2CO5A 4I01A 3OYNA 2O7OA 3GTGJ 4BY7J 3CUQC 3GZ5A 3LSKA 2EFNA 2I8DA 4KICA 3CCMI 1YLFA 5CVJA 3PUBA 1KYZA 3TO6A 4UUTA 2ZNZA 4BDZA 3SDBA 4AYBA 1BJZA 3JR9A 1Q1HA 2L7KA 2IGMA 3RKWA 4L9VA 3DTKA 1YW9A 2H27A 4HLXA 2DPDA 2EA2A 1RR8C 3BP8A 1KZHA 4P9UA 1VTNC 3GW2A 3WTYC 1BR1A 2W24A 5BOXA 5JHFA 3K10A 2GM4A 2O8KA 3BCBA 1MBHA 4IQJA 5FROA 4DGWB 3Q0UA 2HXOA 5LD2C 3M1CA 3PO3J 3S5RA 3WHBA 3LSRA 2JUCA 3B6CA 5FLXK 1Z3XA 3P9CA 1ZRCA 2A07F 1DU6A 2E1MB 3C18A 4H0EA 1QPIA 4E7IA 1JUPA 3ABUA 1FMWA 4LJZF 1ETOA 3ZQGA 5BNGA 3NWTA 2NVXJ 2Y0SN 3H3UA 3S3NA 3GYHX 2E7WA 2OA4A 2KIUA 4OMYA 1OYIA 3GTOJ 5EJCA 2MLGA 2L0KA 2ZKZA 4EJTA 5FKLA 2K85A 3RQ4A 3Q0VA 3OYFA 2VT2A 3NS4A 3GZIA 1BJAA 4LLLA 2DT7B 5FD5A 2Y48A 4U9LA 1MIJA 1FTZA 2JQ7A 4E7KA 3HDDA 2NOGA 1R4MB 3E6MA 2OUMA 3F72A 3EGQA 1FEXA 3LWJA 4A6DA 5K58A 5KHDA 4C2MJ 2BY3A 1UHWA 2DYRH 3T5XA 3HPGA 3VVXA 2VPRA 1UHSA 2LTPA 3VYUB 5D8KB 2P5KA 2X6WA 5K5QA 1YW8A 2E1NA 5KAFC 2R7TA 3ZR8X 3V7RA 4U9NA 2PBXA 4IJAA 1IG7A 3CCYA 2VBZA 1FSHA 4XLEA 1X2MA 1XN7A 3K4BA 3W3CA 4DBRA 2Y69H 3O8GA 4I99C 2OQRA 1QZZA 4JKZA 2BE5F 4D9JA 2TRTA 2FEZA 2JTVA 5IP6A 1TWFJ 2G7HA 2P6TA 4BAYA 2DN0A 5E8GA 1FP1D 3NEUA 3DEEA 5FRNA 3HOVJ 3RKYA 1MBKA 2WB1A 1XTAA 3S1NJ 3EETA 4GCVA 1T33A 5L3CA 1WI9A 2G9WA 4B44A 1FJLA 2MH9A 3ZPLA 2VLAA 2L7FP 2R7XA 2LVSA 3VW0A 4OIRF 4XSXF 2B63J 3HYIA 1SAUA 5CVVA 3JSJA 5FMPA 1ITYA 4DBQA 3QPTA 4PXIA 1YW7A 1FC3A 5A2QZ 3RZDJ 2CG4A 1VQKI 2OCEA 3I71A 3B6AA 3TW6A 3KNWA 1T08B 1ZQ3P 2XGEA 5FGLA 2EV6A 4FTHA 5KCMA 3F8MA 5D6FA 5K7ZA 3OYJA 2ZXJA 4G6DA 3A03A 3WGIA 1ZKGA 2UXXA 1E17A 1SFEA 4PJMA 3J7YJ 2O6GE 3HUGB 4RBOA 3MNLA 5EGOB 2EH3A 1XCBA 2ZXIA 3BZKA 1E3HA 3BR0A 3PM1A 5AIPA 4PJ0C 4PFOA 2LNBA 1BIAA 1IV8A 3E1SA 3KZYA 1QBJA 4RB3C 5CXGA 1K83J 3OR1C 4XN3A 4ESJA 2GA1A 6PAXA 1IN4A 2LYCA 3OYCA 5H2FC 1R1VA 3HRUA 2W53A 1WGXA 5GAHJ 4IRHA 1VQNI 2QF7A 1UHMA 2P5VA 4HX7A 1H9TA 2MC4A 5L3GA 5D8LB 2V79A 3QODA 1D1BA 3QWLA 4W1UA 1FLIA 3L2WA 3DKXA 4DYQA 2VASA 5IT3A 2QTQA 2H6CA 3GTPJ 5HS9A 5KNLA 4CZZA 4V2GA 3PIOF 2V9VA 4IF4A 4RLQA 5IYCJ 3NI7A 4CSWA 1T0FA 4GGGA 4BE2A 2HVQA 4S0HB 2PLYA 1ETWA 4G94A 2M4KA 2LBFA 2VL8A 3IP4B 4M73A 4ZYDA 1SFXA 2WY7Q 3EUKL 3V78A 4M9ZA 3PFYA 3WG7H 1TT0A 4QLCU 3OYMA 1AHDP 1WJ5A 1ZK8A 3R0AA 2IGOA 3TGNA 1DPUA 1SEUA 4BHBA 3A1YA 2IS2A 1MDMA 3CCLI 4E7JA 2RVCA 4ZDOA 2QBYB 2XASA 4B1RA 1IXCA 1P4AA 1PJRA 1ZARA 1K79A 2R7SA 4XRSA 4MTEA 4CDGA 5FJ8J 3KP6A 3DV8A 3S2HJ 2VOPA 1B8IA 2V6EA 3LSJA 5LHGA 3IL2A 3R4KA 5FLXZ 4LG0B 3S32A 4O5VA 1RC9A 1ZYRF 2BVMA 2VQHA 3HTSB 5DM6F 2YVHA 4PJNA 4Y3OA 1FTTA 1VQOI 1BN5A 4BL0B 2F4IA 3V42A 3JRAA 3VODA 3B73A 3ZQHA 4DYRA 3BR2A 1OCTC 3KEQA 5E1XA 4OMZA 2HQ5A 2LOOA 2DYSH 2DJIA 1XMKA 2XAFA 4M9XA 1X3ZB 2EIMH 1U5TB 1IRFA 3MKZA 3CCQI 3C07A 3O3KA 4M74A 3D5RC 4HLYA 2JJ7A 3TEDA 3K1NA 1P6RA 2JPBA 2DDAA 1JT0A 3LHQA 3ABLH 2V57A 2CJJA 3DP7A 3ZQQA 3GVAA 3AG1H 3OL3A 3F3XA 1B1BA 5F0CA 1D5YA 3BG5A 5CVIA 2OERA 1FIPA 1O7LA 1P7JA 2CSOA 1T95A 2GQQA 1P92A 4E7SA 3C2HA 2X1DA 4E4HA 3ERED 4GRIA 4I76A 1S9HA 4CCJA 2KT0A 3FXQA 3OIPA 1JKPC 3KX2A 1K7AA 1T98A 5CVUA 2EFWA 2FBKA 2WADA 1ORKA 2KL4A 4OOIA 1IN8A 2NP5A 1F9NA 5K5OA 4HDVA 4FE7A 2E34A 2ZFUA 5LFAA 1JKQC 3E5XA 2CS3A 5LHHA 2CFXA 5FLMJ 2YX7A 2PMHA 4H4KC 3DXJF 2M1BA 3R61A 2AQEA 3I4MJ 1MBEA 1I50J 4UY8I 4N9HA 4A69C 2O7TA 4BQQA 2MD0A 1LFPA 1GUUA 3D0SA 1B59A 4LB6B 1EF4A 3LSTA 1D8JA 1QZEA 4ZTFA 3KETA 1ETYA 3PIPF 4ICHA 5FFXA 2ETHA 4BS9A 3B02A 1FOYA 1SANA 2IXSA 3QAHA 2QSFX 2YUSA 1WVRA 3FM3A 4BY1J 1B72A 1OR7A 3MKLA 3JREA 4CCLA 2CMPA 2KMUA 4MGRA 1C0WA 1Q1VA 1IV6A 2M8EA 2QQ9A 3DBLB 4DIQA 1YTYA 3KYLA 4OIQF 5HOOA 3J7AY 1XDUA 2F5FA 5F6FA 5EFYA 2OJED 5F0FA 2HR3A 4PDKA 4KN7X 3DKWA 3ZMZA 1EV7A 2RKHA 4BXFA 3ANGA 2O9LA 1DPRA 2ELHA 2OAZA 4I98B 1OCCH 1SFUA 3HUGA 4EMSA 3J81K 5ICGA 4OAYA 3CJDA 5HLHA 4I02A 3FIWA 2REKA 2OCCH 4G8XA 1M1EB 2LY9A 4LG3A 1HKTA 1XC5A 2FRHA 4RAYA 3KZZA 5LBQA 3VOXA 2IW5A 1BW5A 2IBDA 3ON2A 1XS9A 1IZ1A 2K9QA 5FKMA 3R6SA 1NK3P 2DJNA 3WU1B 4U0VA 1Y8QB 1B72B 3PFIA 4CYCB 3U1KA 2F2EA 3NXCA 1ETVA 2EB7A 2Y0MA 2ACJA 4TV7A 3LA2A 3OR2C 2FQ3A 2W82A 4P5OA 2PJPA 2WTEA 2CQNA 2Z9OA 2EPFA 3WTTC 1VFCA 2DT6A 1HXDA 1AU7A 2E36A 2NS8A 1XDSA 2MFZA 1HSTA 4B8XA 3ZXSA 3CRJA 1X4OA 5H6RA 2ZOZA 2YVEA 2EZIA 2L4AA 2JRMA 3FRQA 2XSDC 1TWGJ 2XDVA 4Y17A 5EEGA 1KQ8A 3G1MA 4F55A 1YS6A 4IOAF 3OYBA 2IT0A 2H1KA 3U1DA 1BC7C 3DFGA 1PVEA 3CCVI 2BVLA 4U7BA 3ONQA 5LEJA 3RI4A 1R1UA 2FSWA 2Z5UA 1LDJA 4HX8A 3FMRA 5J4YA 3CWRA 3I4PA 2Y2ZA 3FDYA 4QPOA 4G7OF 1QHGA 2X51A 2A6HF 5GP9A 3RPUD 3T8RA 4P1WA 5HLIA 1HDDC 1WRJA 2CH0A 2VKEA 1BIBA 1T2KA 2COMA 4GO1A 5C44J 2L7ZA 4M3FA 3BJBA 1MSFC 1XCVA 2M34A 2PFVA 1GXPA 3PO2J 3BY6A 3BQZA 3QPLA 1A36A 4MQVA 3BJOA 5ICEA 1B4AA 1Y39A 3H0GJ 2OZUA 3Q0WA 1X58A 3OOUA 2DMNA 3BNIA 2W00A 4WCGA 2QQBA 4RMNA 4XORA 3HGYA 4E7ZA 4EGZA 3PSFA 3S16J 3MAJA 1B6AA 1GXQA 3H0DA 2ESHA 3V7SA 3CD6I 1OPCA 3LSIA 3W2AA 3F8BA 3GTQJ 2JSCA 2ID3A 3BR6A 3QOPA 4RAZA 3RPUA 5E1ZB 3EPZA 3KLOA 4PUSA 3ZP5A 1VQLI 3GEUA 1FYMA 1O57A 5AONA 5J1RA 4BJTA 2B7EA 3FWEA 3CCRI 3ZQFA 3RTRA 5C4XJ 3K70C 2PMZN 2EK5A 4U87A 1RESA 2VKDA 4RB1A 2EBIA 3TOAA 4N0BA 3HOXJ 2GOXB 2K9LA 2DMQA 3VFZA 2XV4S 3U2RA 1D1CA 1F1ZA 3HRTA 1E2XA 5C4YA 2L4MA 2W48A 4XLCA 5J3LA 2L9RA 4QTRA 3RH2A 2LR8A 3FBNB 3HZJA 4Y7NJ 1DP3A 1IN5A 5JHUA 3IAS2 3V8KA 3IH2A 2KKOA 3IWZA 4K2EA 2RN7A 2XB0X 4XLFA 5LRSA 3A02A 3LOCA 4L0ZB 1OJLA 1VZ0A 5L3DA 1YI2I 3IKVA 2MABA 1S7AA 2O03A 1YIJI 4NC6A 3I3LA 1FP2A 1OLTA 1S3JA 1HQCA 4B48A 1DQUA 4MEYF 2G7LA 4BNCA 3RZOJ 1FX7A 1ZGAA 4GFLA 4GFKA 1X2NA 4HW0A 5CYVA 2E60A 3DWLE 2G7SA 2IP2A 3HOYJ 4PFPA 2HYFA 3BG6A 3H9QA 5GTHC 2EJRA 1TQIA 2DTRA 2CW8A 3M1EA 3BPXA 2R92J 3HHHA 4AVZA 3S14J 4GYGA 2HQNA 1XPXA 2QKMB 3H5RA 2HVSA 1ERDA 5IYBJ 1XGSA 2KQRA 3EYYA 3L7WA 3DBHB 3K4NA 1A6QA 1WH7A 4MQ9F 3F9KA 1KQ0A 3ML6A 2R5ZA 3KFWX 3L2CA 5DS9A 1T6SA 1J0RA 3M9AA 4P96A 5AIQA 3C1DA 2PN6A 1DDNA 1I1SA 2Q8KA 2HDDA 4MXMA 3NPIA 3M7GA 2V7FA 3ZCOA 2XPUA 5F08A 2GXBA 1OR7C 4Y33A 1D8KA 3KP5A 3ON4A 4Q47A 3R0JA 2ISYA 5LGTA 3CCJI 2ICWG 3OWTA 3CTAA 4YFKF 3S15J 4M3EA 3VDXA 3MQ0A 4LGWA 4D7NA 1Z0XA 3GWZA 4LB5A 1WJFA 2DLLA 2UXIA 1S29A 1MMGA 3P5JA 4JX4A 5D5XB 2RNGA 2TDXA 3HGGA 4C3IJ 3KZIC 1ZG3A 3BR3A 3OY9A 3S1QJ 1W7PA 3EDPA 1FWZA 1T56A 1K6OA 3KE2A 1L0OC 1W5CC 2DT5A 1WQ2A 3JTHA 3VYSB 1LVKA 2P4WA 3ZMUA 2WBMA 4BJ6C 2DOEA 2KZVA 3VPRA 2P7VB 1MSEC 5EGOA 3GMEA 3M8JA 4R79A 3FHZA 2WAQN 4L18B 2L9VA 3AG2H 2BEOA 1G59A 2WAFA 2V4JC 4CICA 4YIFA 4XLNF 4Q4ZF 1BM9A 2WY8Q 2GXAA 1WI3A 2NVUB 3PUFA 3PQKA 1U5TA 2D1HA 2E2JJ 2YR2A 4DNCA 4RB2C 1YE9A 5EZHA 3BQYA 2DA5A 1PUFA 2DAOA 4EM2A 4KJZA 5E1WA 2PMZA 1I3QJ 2YPRA 4AU7A 4HSRA 1Z3YA 3ZQLA 3LSMA 2QBYA 3ROUA 1V54H 2PI0A 3D1NI 3H35A 5DM7F 5F64A 2H1LA 2NVQJ 2DMTA 2XAGA 3CO7C 2K9MA 4EQQA 4PCQA 3OV8A 2M3AA 3V8LA 4EEFG 1U8BA 3H92A 3FKJA 5IOYA 1LVAA 4HBLA 1TW3A 3I0TA 2KDOA 2F4OB 1OQYA 4M3DA 4BXXJ 3HXLA 5CW8A 1IDZA 4PJJA 2IA0A 4CO8A 2WV0A 2EIKH 1EJ9A 2FBQA 4CXFA 2GUHA 4EVIA 1GVDA 1EH7A 1N78A 4AD9A 2RC4A 3G71I 4DZPA 2XF7A 3HG9A 4BU2A 2A6TA 2YVXA 3TP0A 2STWA 3HL2A 3LAJA 4KMUX 4CYDA 4YRVA 1MD0A 5E3LA 3E7LA 1Z6RA 2W85A 2KP6A 2M9HA 5D4RA 1IJWC 3ZMSA 4GCTA 3S2WA 2ME6A 4KITB 3CC2I 3W2VA 2LC2A 3WG9A 3OYKA 4EJOA 4CA0A 1ZG1A 2FJI1 3DLLF 2VBWA 2QKOA 3QOEA 4F3QA 1G4DA 1I3AA 4EM0B 1WJDA 4BEHB 2R7ZJ 4HF0A 1ETXA 1VI0A 4P9FA 3I53A 2UWMA 5ICCA 2ZB9A 4N4OB 4IQ4A 4UB6C 3O8HA 1K61A 3GCMA 2ISZA 1VQMI 4A5MA 2PJRA 3RD3A 1R22A 2R5YA 1QQIA 2QLZA 2UUZA 2QGUA 2MG4A 1WJCA 4PSWA 1IXRC 5JVGF 4A3JJ 4UXNA 5KAIC 4OU0A 3RJPA 1XD7A 1VF9A 2VODA 1K4SA 2ELKA 3I64A 4ENKA 1KGSA 1FIAA 2QWWA 4ENJA 1I6HJ 3CMMA 2DQRA 1G3YA 1D0XA 4EM1A 5EZGA 3GFMA 2R3SA 3RSNA 3HTJA 1Z67A 2GIZA 2XGDA 2XPWA 5L3EA 3H5NA 4MFEA 4A3DJ 2B1EA 5HAWA 3OS2A 4HF2A 2R7UA 3GEZA 3IH4A 1OCOH 4II2A 3K4JA 4MFDA 1EKEA 1MZBA 1YJNI 2RGVA 3ABTA 3E6CC 2VUMJ 3LJLA 1RUOA 3FKIJ 3E5UA 1R6RA 1QPMA 2NP3A 4KISA 1X19A 3I5UA 4GXOA 3SWHA 3VYTB 4E7LA 3CLOA 5FKOA 2ZOYA 1RNLA 2DODA 5FRMA 3BG3A 3RYPA 2NOJB 1AOYA 1F5TA 3Q9SA 3H9JA 4BKXA 2UXHA 3BCGA 3W6JB 4HPQA 5E3OA 2ZCXA 2CUJA 1LJ9A 5K1YA 4V19K 4FASD 2VOOA 2LRDA 4BQAA 4I0BA 3OYAA 2VC0A 1D1AA 1SVMA 3SQNA 3SZTA 4ETSA 4QPQA 1MW7A 4ZC3A 2GZWA 3X2QH 3OYIA 3S1RJ 4JNNA 3NRVA 2DW4A 1G3SA 3I55I 4UNOA 3LWFA 1KYWA 5J6XA 5K7FA 2ELJA 2L9NA 3H9GA 2FBIA 3RIRA 2CQXA 1J75A 2DBBA 1W4MA 4XLPF 1LUJB 1SMYF 3FXRA 2IU5A 2MSYA 3V8JA 5IY5H 3JRHA 1XGNA 2VIXA 3K2AA 2BW3A 3T1BA 5H9TA 2ZJ2A 2K5CA 3E3VA 5HDGA 2AQFA 2ZFWA 3BTJA 1MDMB 2PBIA 1IO2A 1X1BA 2LSOA 2A2FX 1SD6A 5D5UB 4BE0A 2IAIA 2HVRA 4KN4X 4ZYAA 3KEYA 1NK2P 5GPCA 2X9DA 4N4NB 4B4CA 5ILUA 4NHJA 4NNJA 1ZLJA 2STTA 4X6AJ 4CCMA 3GTKJ 4CGRA 3C3WA 3WHCA 5DCFA 1QGPA 4B47A 5K5RA 3HOSA 2MH2A 3ERMA 3SEZA 2WAEA 2KIQA 1UELB 2HTJA 2V26A 3FF5A 2KJBA 4IRVA 5DTDA 2EWNA 2XRNA 3F23A 3IAM2 5J40A 3Q5FA 3W6VA 2ZNYA 4Y52J 1YOVB 2OBPA 2XUBA 5F0HA 5FGMA 2P0WA 2ZJQF 1H0MA 4S05A 2CUFA 1S8NA 2KRFA 2RNJA 1T8IA 4HKUA 3OOPA 2ECBA 4NDLA 2W1OA 1HW1A 3O60A 2Z99A 3I54A 2ID6A 1TWAJ 2DA3A 4DJAA 4AVPA 2Q2EB 4WXHA 2GFNA 3VP5A 5D18A 3SDGA 5HS8A 2WAQA 2JPCA 3WTSC 4YELA 2A05A 3LMMA 5CQEA 3EUPA 5DUKA 4Y15A 4EV0A 2K9SA 2L9SA 2XGXA 1W5SA 3WGHA 5GAEJ 2GIVA 4F52A 2CV0A 2R4GA 3IHUA 3C7JA 1ON1A 4QIWN 4Y4RA 2VBYA 1IAWA 2ECCA 2X6OA 1RRJA 2HEOA 1I1GA 1LE8A 3TO7A 3GZ6A 1VQ9I 4II3A 3GUDA 4MNUA 1HOMA 2GWRA 1D0YA 2MA3A 2IA2A 3JSPA 4IXAA 4CH7A 5EDNA 4IL6C 2LF7A 3ZOBA 2DFIA 4B09A 2EILH 3K0LA 4OD5A 2DK5A 1SFKA 2TCTA 2K3FA 5HDNA 1SMTA 3MKYB 5ILVA 4HA8A 2K40A 3IRRA 1TLHB 2JA2A 4UUVA 5TISC 1XSXA 2ADUA 1ZH5A 5LRRA 4D1QA 1YQAA 2RHAA 2M0CA 3CP2A 1SGMA 5JLWA 3KCCA 3LFKA 3I56I 4MEXF 1LEAA 1UJ8A 2VT3A 2JZYA 2YU3A 3MCZA 4M72A 4OAZA 4UHTA 2BW3B 2FBHA 4PK4A 1XB4A 2LKXA 4XKVA 2BY0A 3O6BB 2HPIA 4I7HA 4JL3A 1ZR2A 4YZEA 4U88A 4FCYA 1UI6A 2R5ZB 5FHPA 3E7QA 3G73A 4KNYA 3F6VA 2CW0F 2QENA 3TKYA 4HNUA 3HC7A 1YHQI 3TBIA 4HV6A 5ERIA 3ULQB 3ZMTA 1SD7A 4BHPA 4IHWA 1LFUP 3PJRA 3MZ8A 1Y1WJ 2H6BA 3SFIA 1MH4A 3CUQA 3AG4H 3K1PA 5HNFA 2L01A 3G7RA 5D5VB 3AKZA 3A2KA 1U9OA 1WZ2A 1SD4A 1FSEA 2VI6A 2W84A 5GADJ 2DFEA 1HW2A 5IYDJ 2EV5A 4RA2A 3HIFA 1ZREA 3ELKA 5J1YA 3V7CA 2RASA 3FXOA 3LFUA 2EINH 3CESA 3HSRA 1GLNA 1Z7UA 2EZKA 4U0YA 2XF6A 2JMWA 1SD5A 2KJCA 5L3FA 4G6QA 1YG2A 2IA1A 3G1LA 2W7NA 1W7PB 2A68F 1V4RA 2L02A 3BOQA 2ZMEB 1ZN2A 1CQTA 3ZRGA 2E71A 3KPHA 2Y9ZA 2M7BA 5DDGA 5EG0A 2JVGA 3GTJJ 2GXGA 4PGGA 3IKTA 1T0FC 4AWXB 3EUHA 2H94A 1ZG5A 1FOXA 3T0YA 1U0JA 4KWAA 1OFCX 1QHHD 2MGQA 1HSJA 2KHMA 2G7UA 5HNHA 3KYCB 4EJWA 2FF4A 3OSGA 2G7GA 1RETA 5HSZA 2M4GA 3BC8A 2E1CA 4HF1A 4BBSJ 3FXLA 1DP7P 1J09A 3QPHA 3OMYA 3SFZA 3OSFA 2NS0A 1R71A 1OYWA 3WTZA 3QKXA 4R1HA 5DV5A 4AIHA 3F22A 1LNWA 2ZCMA 4CCKA 5C3EJ 4BE1A 4NN1A 3JRFA 4UVCA 2GAUA 4AYBN 5EF6A 2DMPA 1Z1DA 1O7FA 3K7AJ 4CUGA 2X48A 3L2QA 2FXAA 2HWVA 3GTMJ 1WH5A 3U21A 2VONA 3G2BA 3PASA 3VOKA 2K27A 2ZSHB 3LA3A 3S1MJ 4Q5SF 1LQ1A 4FX4A 4RAFA 3SXYA 3E6DA 4F92B 1EH8A 3E0JB 3ANPA 4NB5A 5F27A 4IRIA 4X0GA 3HRMA 3LQRA 3QYEA 2FU4A 1TWHJ 4LMYA 2KLOA 3TDUC 4KT5C 1ZHFA 2KRHA 4BQOA 2EFPA 1MKMA 5HBUA 1F36A 2L54A 3IC7A 2L3DA 3SJMA 3ZN0A 3DTIA 4MK6A 1FBSA 3NQOA 4ANJA 1GHCA 1OKRA 5D19A 4LLNA 1CF7A 3P9KA 2XKPA 1FZPB 2LMDA 2E19A 3AFHA 2K7LA 4KUMA 1JUSA 5J8FA 2VBXA 2A3SA 2OC6A 2QYOA 2ZSIB 3CUQB 1WFXA 3CDIA 3J80Z 4V2FA 1ZAOA 5JI6A 3GZNB 1HW5A 2QQAA 4JQFA 2OI8A 4ZDPA 4M6YA 3IUVA 1RR7A 1TL8A 5B1AH 1RKWA 1Y0NA 1W0UA 4A3BJ 3CDLA 1T38A 2RQPA 3WU2C 3RPQA 1JGSA 2JVHA 2OTLI 4LOCA 4LIUA 4E6KG 1W36C 2DA7A 2W25A 2KPMA 2L2OA 4WXDA 4A0YA 3NRGA 3VW1A 3FISA 3K8PC 3D5LA 2A5YB 2V9PA 2WC2A 2RV8A 2ZMEA 3D5SC 3OL4A 5EG0B 3SHFA 2FMLA 5BPDA 2D2WA 2V6CA 2CYYA 2OQGA 1IXSB 3F0CA 4N9IA 4M6VA 3ZQIA 5K7HA 2VE9A 1R58A 1W0TA 3F8FA 2VC1A 3WTWC 4G12A 1L3LA 3BZ6A 5E3MA 2A61A 5B66C 2XHKA 1CGPA 1PDNC 4C2UA 1U5TC 3J7ZI 3H3ZA 2XROA 1STZA 3TP3A 4KA4A 2FX0A 3VOEA 2Y30A 4E70A 2R7FA 2HS5A 1XG1A 2HI3A 4HX4A 4OIOF 3H36A 1YITI 4ESBA 4OD4A 3VSKA 2Y31A 3L00A 3K70D 2CQ7A 3A4CA 4O6JA 3L2RA 3DTEA 2DOFA 2BYVE 2XSJC 2GA2A 5DD4A 1GV5A 3CJQB 5DUIA 3S17J 4IRGA 4A3KJ 2EV0A 3L2UA 1TWCJ 5IT9K 2P6SA 3VB2A 2B9SA 3CO6C 3JTGA 1I5ZA 1U2WA 4EJUA 5F04A 4GFBA 4IEJA 2M45A 2F4MB 2O3FA 5J4VA 2ZJPF 1K4TA 3TOBA 1QA6A 4IHYA 3BRUA 2Q1ZB 4CYCA 1R1TA 3RDIA 3MVPA 2HQRA 2VKHA 2X6XA 1ZR4A 1ACIA 2VE8A 4FX0A 3F1BA 4L5JA 3VUQA 4ENNA 2B0LA 2EFQA 5IOZA 1YRNA 4A5NA 3N4MA 4HSTA 1JHFA 5DEQA 2VN2A 4LITA 5JR3A 2AXLA 4JX5A 4D5CA 3CCUI 2DPUA 2CW7A 4CGZA 2YX4A 5ED4A 4OINF 4C2MA 3AL0B 2WUIA 2XAQA 3IV5A 3U9GA 1BR4A 4L9JA 1BI1A 5J47A 1YRNB 1D5VA 1S5LC 1A04A 5DD8A 4WK8F 2F6CA 2LK2A 1MBJA 3HTAA 1IW7F 3IRQA 3TL4X 3EYIA 4KFCA 2M87A 3I4NJ 3OIQA 2MLKA 2L7MP 4BACA 4IVNA 3BTIA 4ABZA 4ZDLA 4A6EA 2OU2A 1MJAA 1X1PA 2RAEA 1ZLKA 4L9NA 2GBYA 4I09A 3DPUA 4ESFA 4KIGA 4HNTA 3CMYA 2UV1A 3AG3H 2JWTA 3TW7A 3OYHA 1G2HA 1B8IB 1IUYA 2YU9J 4ACIA 1K6YA 2E5NA 3P9TA 2BHZA 3K2ZA 1MBFA 2HKUA 3HTHA 3P9IA 1X1CA 3AQSA 2A69F 1PUFB 1ZRFA 1VQ6I 4XLAA 2Z2SB 3FZVA 3K1MA 4LFUA 3HOZJ 4KYWA 1S7OA 2E7XA 4C2TA 1UG2A 3HPHA 3BHQA 1YIOA 5M3FJ 1R4NB 1YX5A 4QWQA 2G3BA 4B3XA 2MBFA 4I0AA 5DCMB 2JA6J 2VKVA 1IC8A 2KZGA 2Q2EA 4ZZDA 4UUSB 1O4XA 1YX3A 1K78B 3OS0A 2LREA 3DEWA 2JA5J 2JN6A 1I39A 1XSVA 3ZGKA 4B3AA 1QU3A 1J5YA 2X85A 3L1PA 3M8EA 4OIPF 5FD6A 3HKZA 3GFJA 1E3PA 3W6KB 2DG7A 4ITVA 1FYKA 1F43A 4AC6A 2XKOA 2GENA 2CUEA 3H1CA 2OD5A 3GBGA 3J80K 4A3GJ 3QP6A 3KIOA 3F8NA 1IDYA 5D4SA 3PNVA 4DQ2A 5E18F 3COAC 4XKBA 5IP9J 3AAFA 4CZCA 1YJWI 3IH3A 1RKTA 3BLYA 4LK0F 3WGGA 2HOTA 2HQAA 4FQGA 4WIBA 3CUOA 1UB9A 5CQGA 3A01A 2HOAA 1JTYA 1VQ8I 1V55H 2XF5A 3FBIB 3VVYA 1X1DA 3E97A 2B3WA 2ZCNA 1G6NA 1HC8A 1IN6A 1YS7A 2LKPA 5LGUA 1WJAA 2ZXWH 5E3NA 4Z6YA 2HKXA 3O2PE 1XGOA 5A2QK 2PEXA 1R36A 4FHTA 4A3IJ 2BOLA 2HPMA 2ZC2A 4ME9A 4KMFA 4G6TB 2DFFA 4S04A 3S2DJ 1J7KA 3EUAA 2OTJI 3CLQA 1UI5A 3SZGA 4IZZA 2NS7A 4WXCA 4Z2YA 2I5UA 1HF0A 2BBYA 4L9TA 1OCZH 1H89C 5D5WB 2QIBA 3G4SI 2CGPA 1POGA 4RS8A 1X4PA 4HQEA 5CJ9A 3G56A 1OMIA 4NC8A 3HE0A 1YYVA 1ZTRA 2O0YA 2R7QA 5TRDA 2HU9A 2OZ6A 1LB2A 2R7OA 3LQQA 2UZKA 1GDTA 2C6YA 2YS9A 3HTUA 2PJRB 1SVLA 1V3FA 3LL7A 1JJ8C 2ZBKA 5FKNA 3F8CA 4C30A 1IGNA 4YFNF 3BDDA 2M5WA 2Y9YA 3FMSA 1G8XA 2O61A 4M71A 5GPAA 3W2WA 1U9NA 4RDUA 3LSGA 1OISA 3N05A 5BS6A 3ESWB 3G3ZA 4MIMA 2W4SA 2NAZA 4UB8C 3G1OA 5EEAA 1S6LA 1SC7A 2R7VA 1R23A 3L9FA 4AIKA 3HTIA 3S3MA 5CVRA 4YIRX 2QSHX 3WTXC 1QZYA 4HZFA 2DQLA 4XRFA 2XRLA 4XSZF 4KDPA 3EUHC 5JVTA 1N77A 1BI0A 3ABKH 4NQWA 1XX5A 3GFIA 1NG6A 3HEFA 2PFBA 1USTA 2Z1DA 3QU3A 1TW2A 4A0XA 2HYJA 1N25A 2LF8A 2VJIA 4XKCA 1Z05A 1SFOJ 4AC0A 4M3BA 4UUSA 1K78A 2HYTA 2VJ4A 2P7CB 4RB0A 1AA7A 4F91B 5LEKA 1NH3A 2LG4A 4BDYA 1O3SA 3BWGA 1Z7LA 3K6GA 1HLVA 4A0ZA 1OCPA 5E79C 2H8RA 2QA4I 4IKFA 1JT6A 2V1XA 2XAUA 3FX3A 3A0HC 2KISA 2FE3A 4GCLA 4FISA 1Z91A 3SYTA 1DUXC 3S8PA 1MNDA 3LSPA 2COBA 3FHNA 1TQMA 2YSRA 4QSHA 1U8RA 2KIFA 1KU7A 2CV1A 1LFBA 1MNEA 4GDFA 5HVQC 1A6IA 3BR1A 3HSFA 1R5GA 3CDHA 3I9V2 1V5EA 4ZZLA 2LH9A 5HS7A 4RLFA 2DK8A 3A0BC 4FE4A 2WWYA 4YIIA 3K4MA 3PPBA 4MO7A 2AXTC 4BEHA 5JFRA 3WTUC 1Y0UA 3PNYA 1RIOH 2UXOA 5CXIA 1KONA 4YG2F 1W36D 2QSGX 4UVAA 2HYGD 4A2UA 2BZTA 2JRTA 4XN0A 3RKQA 3H3VK 3RQIA 2NVTJ 3CMEI 2XGCA 2R5YB 2NXNB 2AHQA 2G0EA 5EEHA 4A3CJ 2XIGA 2F48A 2N8GA 1NTCA 4M9SA 4F93B 1BOAA 1AKHA 4XL9A 2AO9A 3ISPA 4XK4A 3SZPA 5BQTA 2FJ1A 1W5TA 2IRFG 3KP3A 4XRSG 2LKSA 2XVCA 2QWTA 1LDDA 3VIBA 2Z33A 3MEXA 3S93A 3BCAA 5IP7J 5D6EA 3HHGA 2NNYA 2QM3A 1MMAA 1JTXA 2LY1A 3DU6A 2V1DA 3R60A 5D1RA 2M7AA 3MZHA 3QRFF 1RUNA 4CHUA 4DW6A 4EJVA 1P9QC 5TGTA 3ZMDA 4XIDA 1A31A 1PP8F 2DG8A 2Q24A 2NYXA 1DGRM 2Y75A 1TT5B 3E5QA 2E35A 2NNNA 5LGNA 1ODDA 1Y8RB 4A3FJ 1A5JA 1S7EA 2I10A 3PSIA 5L3BA 1ZGWA 3TMOA 1LPQA 1KQ9A 1PUEE 4BHCA 3ABMH 2FNAA 2Q0OA 3HSEA 1XSDA 1J59A 3M07A 2JA7J 4AUXA 2LY2A 2CUZA 3BZCA 4BH9A 1MMNA 1IF1A 5KK1A 4HV5A 3TQNA 5DAJA 2R7WA 3CMAI 1TP4A 4OWRB 4XMYA 4U7DA 2X1CA 1FMVA 2EA4A 5GTIC 3F6OA 1WCMJ 2CQKA 4CCNA 2ZCWA 2IS6A 4PJLA 1WKMA 2FD5A 4XR6A 3NARA 9ANTA 3HM5A 3FK7A 1P7IA 3J81Z 4XONA 3KEOA 1WJBA 1XGMA 2JUGA 2JA8J 2EZLA 3BJAA 3FXUA 1YO5C 1UMQA 3K4CA 3ZQCA 1A35A 5DCMA 4NC7A 2JSPA 3JW4A 3NAUA 4NUBA 1JUMA 1S72I 5F1RA 3QYFA 4ZYEA 1VQ4I 2DXIA 3HB9A 3H5AA 3LAPA 2F5DA 3DBRB 4GYIA 4JX6A 3JSOA 4XOPA 3C2BA 2VJ5A 3GXOA 3BROA 1Y56A 2P8TA 2ZXHA 4A3MJ 2EFOA 3CF2A 1MH3A 4KIBA 4XOTA 3QPSA 4B43A 3CJNA 5BMZA 1R9TJ 2HTSA 3BJ6A 2F5VA 1IRXA 3WU0A 3OYGA 3JRGA 1O3TA 1V5GA 5E20A 2VPLA 3JRDA 3OIOA 1JJ6C 3OYLA 2EZHA 2L5QA 4A3LJ 3QYBA 2DO7A 1R5ID 3N97A 2JT1A 2PQ8A 2GLOA 3GTLJ 1X1AA 2IPQX 2O8XA 3MWMA 4GCKA 4J19A 3BR5A 5H6QA 2QUFA 4BUPA 3B81A 1KU3A 2BGCA 2HDWA 2H09A 2KDZA 1TZLA 1ZGJA 1P2FA 3I59B 1W7PD 2XC7A 1CF7B 4AIDA 3VVZA 2UXNA 3ECOA 1BL0A 2MC3A 4R8HA 3C2GA 2K9NA 3QP5A 3CCSI 4EGYA 5M5YJ 3Q3SA 1HKQA 4PSXA 1KU2A 1U6GA 1DGWY 2W57A 4W97A 4MLOA 1HCRA 3BG9A 3UNGC 4JP0A 2DFHA 1O3QA 3BPVA 3MZYA 1REPC 3BTCA 1D0ZA 4LIVA 4C9YA 5C4JJ 2DTZA 2E2IJ 3AL0C 2HDCA 2HFHA 3T8TA 2IJLA 2F07A 3FK6A 2HZTA 4D5FA 3LA7A 5HODA 3I58A 1RPWA 1D3YA 4RAGA 3VEPA 2FNPA 4NQWB 5EYRA 4BQNA 1XMAA 2ZMEC 5FFZA 1VQ5I 1W1WE 2V9KA 2HKOA 4JBAA 4G9YA 5B3SH 4L62A 1Y1VJ 1KA8A 4XKWA 3VW2A 4ON0A 2X6YA 3FXMA 3DKYA 1QVTA 1UCRA 1RZ4A 3EQLF 3PQJA 3DPLC 4D0PA 2R7DA 3HJEA 3KP7A 4BBRJ 3BG7A 2H8WA 3LNQA 4M3GA 2PX9A 1HA8A 4XBFA 4O3MA 4WX9A 2FOWA 4HEA2 3OYDA 3FMQA 2DMUA 3TDZC 2DU9A 3MFKA 1FYLA 1T39A 5DYMA 4E7HA 1QO0D 2ZO4A 1Y6IA 3FM5A 2CQQA 2QZ8A 1EA3A 2BHYA 3FXKA 3GX4X 2UXUA 1IUFA 2O5RA 2HNHA 5E8IA 5HDKA 1FOWA 3HKZN 1BA5A 2RREA 1IRZA 3GLLA 2FA5A 2HOEA 2OV7A 3I59A 2MD5A 2QKLB 3HBLA 1TTYA 2Y0SA 3CC4I 2VQGA 3DU5A 2ME0A 1HBXG 3COLA 1ETKA 3M8FA 4UV8A 4XM3A 1ULYA 2VJJA 4HQMA 2E2HJ 3PNTA 1BC8C 3ZN1A 1H88C 1MMSA 5F1JA 4F7ZA 2HZDA 2E1MC 3WODF 3G6EI 2R0QC 3TO9A 3RKXA 1B9NA 3OYEA 2J5PA 3CQZJ 5FKKA 2XPVA 1E0EA 4HYEA 4XICA 4BXUA 2IGNA 3Q9VA 1WSUA 5J1UA 1IN7A 3ZMVA 4XNFA 1R49A 2NVYJ 2BXZA 2KFDA 2LBFB 1MBGA 3DEUA 4C3HJ 1R00A 4C3JJ 1V5FA 4HDUA 1F4KA 4J01A 3GLXA 5IPAA 1MJ9A 3REOA 2K4BA 2LP0A 2AS5F 3A01B 1WJEA 4IPAA 3HOUJ 5GAGJ 4RM3A 2DA6A 2KRCA 4JOMA 5CLSA 1LDKB 2UXPA 1MMDA 1OCRH 1TNSA 4DZJA 4L0YB 1WWXA 4RGUA 4MTDA 2D1VA 3JAMZ 1OYYA 4BJ5C 5E17F 4LD5A 3DCFA 1J9IA 3K9TA 1MNMC 1YJ9I 5ILSA 3MMYB 3JRBA 5M5WJ 4RGXA 1MGTA 4FETA 2M30A 1LKXA 5H20A 2A6EF 2CU7A 3CJRB 2DA1A 3MD2A 1Z6TA 3WE3A 3DPTA 1I27A 4UVBA
chains in the Genus database with same CATH topology
4JNNA 5F0CA 3DEWA 2JA5J 2JN6A 3BG5A 1D5YA 2OERA 5K7FA 4HNVA 4B3AA 1FIPA 1APLC 2CQXA 2QOPA 2DA2A 1P7JA 2HOSA 3L1PA 2IU5A 2MSYA 2P81A 3T6NA 3JRHA 1HDPA 1QVUA 3K2AA 2JK3A 2QCOA 2DG7A 3V6GA 4I76A 3JRCA 2KT0A 1F43A 1JKPC 4AC6A 2GENA 5H9TA 2CUEA 3GBGA 2D6YA 4A3GJ 2LLKA 1ORKA 1TC3C 1IDYA 2NP5A 4A93J 4FE7A 3BTJA 1JKQC 5IP9J 2OPTA 3NNRA 3IH3A 1RKTA 5FLMJ 2IAIA 3KKCA 2HOTA 3I4MJ 1MBEA 1I50J 4A69C 3A01A 1LE8B 3VVYA 2HOAA 1JTYA 3QQAA 1EF4A 2O7TA 1GUUA 1NK2P 5GPCA 2LFBA 2MW8A 2X9DA 4B4CA 5M3MJ 2ZCNA 1E3OC 1ETYA 4X6AJ 5E3NA 2NP3A 4ICHA 4A3IJ 1VNDA 4ME9A 3GTKJ 1Z77A 4CGRA 3WHCA 2E1OA 1SANA 3M3YJ 2CRGA 3S2DJ 2YUSA 3JRIA 4BY1J 1B72A 3MKLA 3DPJA 3JREA 2NS7A 1Q1VA 1IV6A 1HF0A 5DTDA 1H89C 2QIBA 4D7MA 3W6VA 1POGA 4Y52J 5EFYA 5F0FA 2D5VA 5F0HA 3G56A 4DYCA 3HE0A 1ZTRA 3HIMA 3ANGA 2CUFA 2O9LA 1WPKA 1JKOC 1GDTA 2YS9A 2M2EA 4JYKA 4HKUA 2ECBA 1JJ8C 4NDLA 5FKNA 3CJDA 1IGNA 4IHXA 3O60A 2M8GX 3FIWA 2REKA 2Y9YA 2ID6A 5GPAA 2LY9A 1TWAJ 1U9NA 2DA3A 4RDUA 1XC5A 3LSGA 3KZ9A 2FQ4A 2GFNA 1H8AC 4MIMA 3VP5A 5D18A 3VOXA 3SDGA 1BW5A 5EEAA 3G1OA 2IBDA 3KKDA 3ON2A 1O4XA 1XS9A 2K9QA 5FKMA 1NK3P 3EUPA 2DJNA 1B72B 3HTIA 2K9SA 1JKRC 4CYCB 3NXCA 1ETVA 2XRLA 2IEKA 4QIWN 1DU0A 3BTLA 4AF5A 1VFCA 2X6OA 2ECCA 2XB5A 1AU7A 2NS8A 3HEFA 1LE8A 1U78A 3CRJA 2WV1A 1HOMA 2ZOZA 2YVEA 2EZIA 2HYJA 4X1EA 1SFOJ 3FRQA 4AC0A 4M3BA 4UUSA 2XSDC 1TWGJ 1ENHA 5EDNA 2HYTA 2WB1N 3G1MA 5M5XJ 3ZOBA 2H1KA 3M4OJ 2WGBA 2TCTA 2PZ9A 1HLVA 3S1RJ 1OCPA 2H8RA 3CWRA 1JT6A 2Y2ZA 2K40A 3QBMA 5GP9A 4GCLA 1HDDC 4FISA 1JGGA 1AKHB 2XDNA 2VKEA 5C44J 2L7ZA 5JLXA 1GV2A 4M3FA 2COBA 3LSPA 2RHAA 2M0CA 1SGMA 2OF7A 1MSFC 3BJBA 2M34A 4QSHA 3PO2J 5JLWA 3UKGA 3BQZA 1LFBA 3QPLA 1BW6A 2HXIA 1A6IA 3BR1A 3H0GJ 3Q0WA 1X58A 3OOUA 4FE4A 4IHVA 2DMNA 2LKXA 3BNIA 3PPBA 4MO7A 3AQTA 3HGYA 2R93J 3S16J 4JL3A 1ZR2A 4YZEA 1GT0C 4FCYA 5FLVA 1UI6A 2UXOA 5CXIA 2R5ZB 5FHPA 3GTQJ 2ID3A 3BR6A 3E7QA 4XRMA 3H3VK 3RKQA 3GEUA 3RQIA 2DA4A 2NVTJ 5J1RA 2XGCA 2NX4A 4A3EJ 2R5YB 4L5EA 3ZQFA 4I6ZA 2LD5A 2AHQA 1ETQA 2G0EA 5C4XJ 4A3CJ 2PMZN 2N8GA 3BT9A 3MN2A 1NTCA 1RESA 1LFUP 4IHWA 2EBIA 3HOXJ 1Y1WJ 1AKHA 1QRYA 2DMQA 2AO9A 4XK4A 5AQCA 3SFIA 1MH4A 2FJ1A 4UDSA 3HOWJ 3G7RA 4NELA 5C4YA 2W48A 5J3LA 2L9RA 4XRSG 1U9OA 4QTRA 2EQRA 3RH2A 2LR8A 2QWTA 2VI6A 3VIBA 2O7OA 4Y7NJ 5IYDJ 5IP7J 4BY7J 3GTGJ 5J1YA 2RASA 3IH2A 1JTXA 2XB0X 4UUTA 3A02A 3LOCA 2EZKA 5D1RA 1OJLA 2JMWA 4DW6A 4XIDA 1BJZA 3JR9A 2DG8A 2Q24A 3G1LA 2G7LA 3RZOJ 4A3FJ 1A5JA 1CQTA 1S7EA 2I10A 2Y9ZA 4GFLA 5EG0A 4GFKA 1X2NA 1ZGWA 2G7SA 3HOYJ 4KWAA 1OFCX 2GM4A 2O8KA 2MGQA 1MBHA 3Q0UA 2HXOA 2R92J 3S14J 2JA7J 3PO3J 3S5RA 3WHBA 4AUXA 5IYBJ 3LSRA 2G7GA 3B6CA 3OSGA 1WH7A 1RETA 5HSZA 1DU6A 1QPIA 2R5ZA 4BBSJ 1JUPA 5DAJA 5DS9A 1ETOA 3ZQGA 3OSFA 5BNGA 3QKXA 2NVXJ 2Y0SN 2ZCMA 1WCMJ 5C3EJ 4NN1A 3GTOJ 2HDDA 2FD5A 3JRFA 3NPIA 4MXMA 4AYBN 2L0KA 2XPUA 3NARA 5F08A 5EF6A 9ANTA 2DMPA 3K7AJ 5FKLA 2X48A 3HM5A 3Q0VA 3FK7A 1P7IA 3GTMJ 1WH5A 3GZIA 3PASA 3ON4A 3VOKA 3S1MJ 2JA8J 2EZLA 1FTZA 3HDDA 1UMQA 2NOGA 3ZQCA 3EGQA 3ANPA 5F27A 3S15J 1FEXA 4M3EA 3LWJA 5K58A 3NAUA 1JUMA 4C2MJ 4D7NA 1Z0XA 1TWHJ 3VVXA 2VPRA 1UHSA 3HB9A 2LTPA 2UXIA 4JX6A 5HBUA 3C2BA 1F36A 4JX4A 3HGGA 4C3IJ 3SJMA 2PBXA 4MK6A 4A3MJ 1IG7A 3BR3A 3CCYA 3S1QJ 1MH3A 5D19A 3QPSA 1X2MA 1R9TJ 1T56A 2E19A 1JUSA 1UI5A 3O8GA 3JRGA 4JKZA 3VPRA 5IP6A 2TRTA 3GTJJ 1TWFJ 1MSEC 5EGOA 2DN0A 4V2FA 2WAQN 2OI8A 3JRDA 3OIOA 1JJ6C 3HOVJ 1MBKA 2EZHA 3IUVA 1RR7A 3S1NJ 1T33A 1WI3A 1RKWA 1W0UA 4A3LJ 4A3BJ 3CDLA 1FJLA 4LOCA 2E2JJ 2DA7A 2L7FP 2GLOA 3GTLJ 2LVSA 5EZHA 3BQYA 3VW0A 2DA5A 1PUFA 2B63J 3NRGA 4J19A 3VW1A 3FISA 3BR5A 1ITYA 3JSJA 5FMPA 1I3QJ 3B81A 4PXIA 3ZQLA 2KDZA 3D1NI 3RZDJ 3B6AA 3TW6A 3KNWA 3VVZA 2NVQJ 5EG0B 2DMTA 1BL0A 1ZQ3P 2XGEA 3F0CA 2K9NA 5FGLA 4M6VA 5M5YJ 3Q3SA 3ZQIA 4FTHA 5K7HA 5K7ZA 4EEFG 1U8BA 1W0TA 4W97A 5IOYA 4MLOA 4G12A 1HCRA 3A03A 3BG9A 1ZKGA 4JP0A 5E3MA 4BXXJ 4M3DA 3BTCA 5CW8A 4RBOA 1IDZA 5C4JJ 5EGOB 3MNLA 2EH3A 2DTZA 3TP3A 2E2IJ 2F07A 2FBQA 2GUHA 2FX0A 1GVDA 2Y30A 3FK6A 4D5FA 3BR0A 3PM1A 5HODA 1XG1A 1RPWA 4DZPA 2HI3A 5CXGA 1K83J 3TP0A 2Y31A 5EYRA 4L62A 5E3LA 1Y1VJ 3E7LA 1GV5A 4GCKA 3VW2A 3S17J 2M9HA 1IJWC 4A3KJ 2W53A 4GCTA 1WGXA 1TWCJ 1QVTA 2ME6A 2QF7A 4BBRJ 5F04A 3LNQA 4M3GA 4GFBA 4IEJA 2QKOA 4IHYA 4W1UA 3BRUA 2DMUA 4DYQA 4CYCA 2QTQA 3MVPA 3GTPJ 1ZR4A 2R7ZJ 1ETXA 1VI0A 3F1BA 2CQQA 3VUQA 4V2GA 2ZB9A 2UXUA 1IUFA 1K61A 3O8HA 5IYCJ 3NI7A 5IOZA 1YRNA 3HKZN 1BA5A 3RD3A 2R5YA 1IRZA 4S0HB 1ETWA 3HBLA 2MG4A 2ME0A 3COLA 3V78A 4JX5A 4D5CA 1AHDP 1ETKA 4A3JJ 1ZK8A 2E2HJ 1VF9A 1H88C 5F1JA 2ELKA 2R0QC 1FIAA 1I6HJ 3CQZJ 5FKKA 2XPVA 2WUIA 3IV5A 4B1RA 4XICA 1YRNB 5EZGA 2LK2A 5J1UA 1MBJA 3HTAA 3HTJA 4XRSA 2NVYJ 2XGDA 2XPWA 1MBGA 4MFEA 4C3HJ 5FJ8J 3S2HJ 4C3JJ 4A3DJ 5HAWA 1B8IA 3I4NJ 2L7MP 3LSJA 5IPAA 3BTIA 4ABZA 3IH4A 2LP0A 4MFDA 2RAEA 3A01B 2GBYA 3HOUJ 3CMYA 2YVHA 2JWTA 1FTTA 2VUMJ 3TW7A 1G2HA 1B8IB 3LJLA 2YU9J 2DA6A 3FKIJ 2UXPA 3JRAA 4ACIA 3P9TA 3ZQHA 4DZJA 1MBFA 4DYRA 2HKUA 3BR2A 3HTHA 1OCTC 3AQSA 2ZOYA 5FKOA 2HQ5A 1PUFB 3DCFA 3BG3A 1MNMC 4BKXA 3HOZJ 2UXHA 3JRBA 3BCGA 5M5WJ 3C07A 1UG2A 5E3OA 2ZCXA 3BHQA 2JJ7A 2CU7A 5M3FJ 3TEDA 2DA1A 2G3BA 1JT0A 3LHQA 2JA6J 2V57A 2VKVA 2CJJA 1IC8A 4UUSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNN A;  5F0C A;  3DEW A;  2JA5 J;  2JN6 A;  3BG5 A;  1D5Y A;  2OER A;  5K7F A;  4HNV A;  4B3A A;  1FIP A;  1APL C;  2CQX A;  2QOP A;  2DA2 A;  1P7J A;  2HOS A;  3L1P A;  2IU5 A;  2MSY A;  2P81 A;  3T6N A;  3JRH A;  1HDP A;  1QVU A;  3K2A A;  2JK3 A;  2QCO A;  2DG7 A;  3V6G A;  4I76 A;  3JRC A;  2KT0 A;  1F43 A;  1JKP C;  4AC6 A;  2GEN A;  5H9T A;  2CUE A;  3GBG A;  2D6Y A;  4A3G J;  2LLK A;  1ORK A;  1TC3 C;  1IDY A;  2NP5 A;  4A93 J;  4FE7 A;  3BTJ A;  1JKQ C;  5IP9 J;  2OPT A;  3NNR A;  3IH3 A;  1RKT A;  5FLM J;  2IAI A;  3KKC A;  2HOT A;  3I4M J;  1MBE A;  1I50 J;  4A69 C;  3A01 A;  1LE8 B;  3VVY A;  2HOA A;  1JTY A;  3QQA A;  1EF4 A;  2O7T A;  1GUU A;  1NK2 P;  5GPC A;  2LFB A;  2MW8 A;  2X9D A;  4B4C A;  5M3M J;  2ZCN A;  1E3O C;  1ETY A;  4X6A J;  5E3N A;  2NP3 A;  4ICH A;  4A3I J;  1VND A;  4ME9 A;  3GTK J;  1Z77 A;  4CGR A;  3WHC A;  2E1O A;  1SAN A;  3M3Y J;  2CRG A;  3S2D J;  2YUS A;  3JRI A;  4BY1 J;  1B72 A;  3MKL A;  3DPJ A;  3JRE A;  2NS7 A;  1Q1V A;  1IV6 A;  1HF0 A;  5DTD A;  1H89 C;  2QIB A;  4D7M A;  3W6V A;  1POG A;  4Y52 J;  5EFY A;  5F0F A;  2D5V A;  5F0H A;  3G56 A;  4DYC A;  3HE0 A;  1ZTR A;  3HIM A;  3ANG A;  2CUF A;  2O9L A;  1WPK A;  1JKO C;  1GDT A;  2YS9 A;  2M2E A;  4JYK A;  4HKU A;  2ECB A;  1JJ8 C;  4NDL A;  5FKN A;  3CJD A;  1IGN A;  4IHX A;  3O60 A;  2M8G X;  3FIW A;  2REK A;  2Y9Y A;  2ID6 A;  5GPA A;  2LY9 A;  1TWA J;  1U9N A;  2DA3 A;  4RDU A;  1XC5 A;  3LSG A;  3KZ9 A;  2FQ4 A;  2GFN A;  1H8A C;  4MIM A;  3VP5 A;  5D18 A;  3VOX A;  3SDG A;  1BW5 A;  5EEA A;  3G1O A;  2IBD A;  3KKD A;  3ON2 A;  1O4X A;  1XS9 A;  2K9Q A;  5FKM A;  1NK3 P;  3EUP A;  2DJN A;  1B72 B;  3HTI A;  2K9S A;  1JKR C;  4CYC B;  3NXC A;  1ETV A;  2XRL A;  2IEK A;  4QIW N;  1DU0 A;  3BTL A;  4AF5 A;  1VFC A;  2X6O A;  2ECC A;  2XB5 A;  1AU7 A;  2NS8 A;  3HEF A;  1LE8 A;  1U78 A;  3CRJ A;  2WV1 A;  1HOM A;  2ZOZ A;  2YVE A;  2EZI A;  2HYJ A;  4X1E A;  1SFO J;  3FRQ A;  4AC0 A;  4M3B A;  4UUS A;  2XSD C;  1TWG J;  1ENH A;  5EDN A;  2HYT A;  2WB1 N;  3G1M A;  5M5X J;  3ZOB A;  2H1K A;  3M4O J;  2WGB A;  2TCT A;  2PZ9 A;  1HLV A;  3S1R J;  1OCP A;  2H8R A;  3CWR A;  1JT6 A;  2Y2Z A;  2K40 A;  3QBM A;  5GP9 A;  4GCL A;  1HDD C;  4FIS A;  1JGG A;  1AKH B;  2XDN A;  2VKE A;  5C44 J;  2L7Z A;  5JLX A;  1GV2 A;  4M3F A;  2COB A;  3LSP A;  2RHA A;  2M0C A;  1SGM A;  2OF7 A;  1MSF C;  3BJB A;  2M34 A;  4QSH A;  3PO2 J;  5JLW A;  3UKG A;  3BQZ A;  1LFB A;  3QPL A;  1BW6 A;  2HXI A;  1A6I A;  3BR1 A;  3H0G J;  3Q0W A;  1X58 A;  3OOU A;  4FE4 A;  4IHV A;  2DMN A;  2LKX A;  3BNI A;  3PPB A;  4MO7 A;  3AQT A;  3HGY A;  2R93 J;  3S16 J;  4JL3 A;  1ZR2 A;  4YZE A;  1GT0 C;  4FCY A;  5FLV A;  1UI6 A;  2UXO A;  5CXI A;  2R5Z B;  5FHP A;  3GTQ J;  2ID3 A;  3BR6 A;  3E7Q A;  4XRM A;  3H3V K;  3RKQ A;  3GEU A;  3RQI A;  2DA4 A;  2NVT J;  5J1R A;  2XGC A;  2NX4 A;  4A3E J;  2R5Y B;  4L5E A;  3ZQF A;  4I6Z A;  2LD5 A;  2AHQ A;  1ETQ A;  2G0E A;  5C4X J;  4A3C J;  2PMZ N;  2N8G A;  3BT9 A;  3MN2 A;  1NTC A;  1RES A;  1LFU P;  4IHW A;  2EBI A;  3HOX J;  1Y1W J;  1AKH A;  1QRY A;  2DMQ A;  2AO9 A;  4XK4 A;  5AQC A;  3SFI A;  1MH4 A;  2FJ1 A;  4UDS A;  3HOW J;  3G7R A;  4NEL A;  5C4Y A;  2W48 A;  5J3L A;  2L9R A;  4XRS G;  1U9O A;  4QTR A;  2EQR A;  3RH2 A;  2LR8 A;  2QWT A;  2VI6 A;  3VIB A;  2O7O A;  4Y7N J;  5IYD J;  5IP7 J;  4BY7 J;  3GTG J;  5J1Y A;  2RAS A;  3IH2 A;  1JTX A;  2XB0 X;  4UUT A;  3A02 A;  3LOC A;  2EZK A;  5D1R A;  1OJL A;  2JMW A;  4DW6 A;  4XID A;  1BJZ A;  3JR9 A;  2DG8 A;  2Q24 A;  3G1L A;  2G7L A;  3RZO J;  4A3F J;  1A5J A;  1CQT A;  1S7E A;  2I10 A;  2Y9Z A;  4GFL A;  5EG0 A;  4GFK A;  1X2N A;  1ZGW A;  2G7S A;  3HOY J;  4KWA A;  1OFC X;  2GM4 A;  2O8K A;  2MGQ A;  1MBH A;  3Q0U A;  2HXO A;  2R92 J;  3S14 J;  2JA7 J;  3PO3 J;  3S5R A;  3WHB A;  4AUX A;  5IYB J;  3LSR A;  2G7G A;  3B6C A;  3OSG A;  1WH7 A;  1RET A;  5HSZ A;  1DU6 A;  1QPI A;  2R5Z A;  4BBS J;  1JUP A;  5DAJ A;  5DS9 A;  1ETO A;  3ZQG A;  3OSF A;  5BNG A;  3QKX A;  2NVX J;  2Y0S N;  2ZCM A;  1WCM J;  5C3E J;  4NN1 A;  3GTO J;  2HDD A;  2FD5 A;  3JRF A;  3NPI A;  4MXM A;  4AYB N;  2L0K A;  2XPU A;  3NAR A;  5F08 A;  5EF6 A;  9ANT A;  2DMP A;  3K7A J;  5FKL A;  2X48 A;  3HM5 A;  3Q0V A;  3FK7 A;  1P7I A;  3GTM J;  1WH5 A;  3GZI A;  3PAS A;  3ON4 A;  3VOK A;  3S1M J;  2JA8 J;  2EZL A;  1FTZ A;  3HDD A;  1UMQ A;  2NOG A;  3ZQC A;  3EGQ A;  3ANP A;  5F27 A;  3S15 J;  1FEX A;  4M3E A;  3LWJ A;  5K58 A;  3NAU A;  1JUM A;  4C2M J;  4D7N A;  1Z0X A;  1TWH J;  3VVX A;  2VPR A;  1UHS A;  3HB9 A;  2LTP A;  2UXI A;  4JX6 A;  5HBU A;  3C2B A;  1F36 A;  4JX4 A;  3HGG A;  4C3I J;  3SJM A;  2PBX A;  4MK6 A;  4A3M J;  1IG7 A;  3BR3 A;  3CCY A;  3S1Q J;  1MH3 A;  5D19 A;  3QPS A;  1X2M A;  1R9T J;  1T56 A;  2E19 A;  1JUS A;  1UI5 A;  3O8G A;  3JRG A;  4JKZ A;  3VPR A;  5IP6 A;  2TRT A;  3GTJ J;  1TWF J;  1MSE C;  5EGO A;  2DN0 A;  4V2F A;  2WAQ N;  2OI8 A;  3JRD A;  3OIO A;  1JJ6 C;  3HOV J;  1MBK A;  2EZH A;  3IUV A;  1RR7 A;  3S1N J;  1T33 A;  1WI3 A;  1RKW A;  1W0U A;  4A3L J;  4A3B J;  3CDL A;  1FJL A;  4LOC A;  2E2J J;  2DA7 A;  2L7F P;  2GLO A;  3GTL J;  2LVS A;  5EZH A;  3BQY A;  3VW0 A;  2DA5 A;  1PUF A;  2B63 J;  3NRG A;  4J19 A;  3VW1 A;  3FIS A;  3BR5 A;  1ITY A;  3JSJ A;  5FMP A;  1I3Q J;  3B81 A;  4PXI A;  3ZQL A;  2KDZ A;  3D1N I;  3RZD J;  3B6A A;  3TW6 A;  3KNW A;  3VVZ A;  2NVQ J;  5EG0 B;  2DMT A;  1BL0 A;  1ZQ3 P;  2XGE A;  3F0C A;  2K9N A;  5FGL A;  4M6V A;  5M5Y J;  3Q3S A;  3ZQI A;  4FTH A;  5K7H A;  5K7Z A;  4EEF G;  1U8B A;  1W0T A;  4W97 A;  5IOY A;  4MLO A;  4G12 A;  1HCR A;  3A03 A;  3BG9 A;  1ZKG A;  4JP0 A;  5E3M A;  4BXX J;  4M3D A;  3BTC A;  5CW8 A;  4RBO A;  1IDZ A;  5C4J J;  5EGO B;  3MNL A;  2EH3 A;  2DTZ A;  3TP3 A;  2E2I J;  2F07 A;  2FBQ A;  2GUH A;  2FX0 A;  1GVD A;  2Y30 A;  3FK6 A;  4D5F A;  3BR0 A;  3PM1 A;  5HOD A;  1XG1 A;  1RPW A;  4DZP A;  2HI3 A;  5CXG A;  1K83 J;  3TP0 A;  2Y31 A;  5EYR A;  4L62 A;  5E3L A;  1Y1V J;  3E7L A;  1GV5 A;  4GCK A;  3VW2 A;  3S17 J;  2M9H A;  1IJW C;  4A3K J;  2W53 A;  4GCT A;  1WGX A;  1TWC J;  1QVT A;  2ME6 A;  2QF7 A;  4BBR J;  5F04 A;  3LNQ A;  4M3G A;  4GFB A;  4IEJ A;  2QKO A;  4IHY A;  4W1U A;  3BRU A;  2DMU A;  4DYQ A;  4CYC A;  2QTQ A;  3MVP A;  3GTP J;  1ZR4 A;  2R7Z J;  1ETX A;  1VI0 A;  3F1B A;  2CQQ A;  3VUQ A;  4V2G A;  2ZB9 A;  2UXU A;  1IUF A;  1K61 A;  3O8H A;  5IYC J;  3NI7 A;  5IOZ A;  1YRN A;  3HKZ N;  1BA5 A;  3RD3 A;  2R5Y A;  1IRZ A;  4S0H B;  1ETW A;  3HBL A;  2MG4 A;  2ME0 A;  3COL A;  3V78 A;  4JX5 A;  4D5C A;  1AHD P;  1ETK A;  4A3J J;  1ZK8 A;  2E2H J;  1VF9 A;  1H88 C;  5F1J A;  2ELK A;  2R0Q C;  1FIA A;  1I6H J;  3CQZ J;  5FKK A;  2XPV A;  2WUI A;  3IV5 A;  4B1R A;  4XIC A;  1YRN B;  5EZG A;  2LK2 A;  5J1U A;  1MBJ A;  3HTA A;  3HTJ A;  4XRS A;  2NVY J;  2XGD A;  2XPW A;  1MBG A;  4MFE A;  4C3H J;  5FJ8 J;  3S2H J;  4C3J J;  4A3D J;  5HAW A;  1B8I A;  3I4N J;  2L7M P;  3LSJ A;  5IPA A;  3BTI A;  4ABZ A;  3IH4 A;  2LP0 A;  4MFD A;  2RAE A;  3A01 B;  2GBY A;  3HOU J;  3CMY A;  2YVH A;  2JWT A;  1FTT A;  2VUM J;  3TW7 A;  1G2H A;  1B8I B;  3LJL A;  2YU9 J;  2DA6 A;  3FKI J;  2UXP A;  3JRA A;  4ACI A;  3P9T A;  3ZQH A;  4DZJ A;  1MBF A;  4DYR A;  2HKU A;  3BR2 A;  3HTH A;  1OCT C;  3AQS A;  2ZOY A;  5FKO A;  2HQ5 A;  1PUF B;  3DCF A;  3BG3 A;  1MNM C;  4BKX A;  3HOZ J;  2UXH A;  3JRB A;  3BCG A;  5M5W J;  3C07 A;  1UG2 A;  5E3O A;  2ZCX A;  3BHQ A;  2JJ7 A;  2CU7 A;  5M3F J;  3TED A;  2DA1 A;  2G3B A;  1JT0 A;  3LHQ A;  2JA6 J;  2V57 A;  2VKV A;  2CJJ A;  1IC8 A;  4UUS B; 
#chains in the Genus database with same CATH topology
 3MKW B;  4DOZ A;  3CF5 F;  1XMX A;  3P7N A;  3GO5 A;  3IWF A;  3SEQ A;  3IUO A;  4HNV A;  4J00 A;  2Z3Y A;  1APL C;  1NHA A;  4MHG A;  2QOP A;  2DA2 A;  1MJB A;  1ONV A;  4YFX F;  3KP2 A;  2HOS A;  4ZH4 F;  1AWC A;  4HG2 A;  2DCE A;  2P81 A;  3T6N A;  3JCU C;  1ON2 A;  1HDP A;  1QVU A;  1Z9C A;  4EAT A;  2JK3 A;  3ASN H;  2VQL A;  5BPI A;  2QCO A;  3V6G A;  2BY2 A;  4U0W A;  2Z16 A;  3JRC A;  1BOB A;  3VSL A;  3KLN A;  1R5H A;  1FY7 A;  1O3R A;  2D6Y A;  2LLK A;  3V4G A;  1TC3 C;  3KYD B;  4A93 J;  3S3O A;  5HLG A;  4HRI A;  4UV9 A;  5TJJ A;  2OPT A;  4IX7 A;  2DDB A;  3NNR A;  3KKC A;  4LG0 A;  1QNT A;  3FXJ A;  4ZYH A;  2FMY A;  1LE8 B;  3QQA A;  4BYY A;  1N75 A;  2LFB A;  1FT9 A;  2MW8 A;  3K69 A;  5M3M J;  1E3O C;  1X3W B;  3HRS A;  2K3P A;  4XLH A;  4YEJ A;  2V1U A;  2HGC A;  1VND A;  3CZ6 A;  2CFO A;  1Z77 A;  2K4J A;  2E1O A;  1J2X A;  3M3Y J;  2CRG A;  4HOB A;  1ZEL A;  2K02 A;  3JRI A;  3QU6 A;  3DQV C;  1UAA A;  3DPJ A;  3OS1 A;  4NBQ A;  5B5E C;  2J5O A;  2KIM A;  3VYR B;  3WTV C;  1FBU A;  2ESN A;  1U3E M;  4ENM A;  1SAX A;  4DVY P;  4D7M A;  3DF8 A;  4RGR A;  4CCO A;  2D5V A;  1UFM A;  1WHU A;  4DYC A;  3CP8 A;  4Q48 A;  3RYR A;  4G7H F;  3HIM A;  2V1N A;  2GOM A;  4FT8 A;  2M0M A;  1WPK A;  4KT6 A;  3RCO A;  1JKO C;  2CV2 A;  3ASO H;  2M2E A;  3ECH A;  1SVO A;  4JYK A;  2X4H A;  2EIJ H;  2FOK A;  2DOA A;  4IHX A;  2M8G X;  1ZRD A;  1FBQ A;  4XQF A;  2LDU A;  1TQP A;  1X3U A;  2E5Z A;  3KZ9 A;  2FQ4 A;  1PYV A;  1HKS A;  1H8A C;  3K4K A;  2PMU A;  1LEB A;  3KP4 A;  5ICF A;  3KKD A;  1KU9 A;  2NRA C;  1G3W A;  4IHT A;  4LK1 F;  4ZJZ A;  1I6X A;  1JKR C;  4IOC F;  4IHS A;  2X0L A;  1B9M A;  4RGS A;  2IEK A;  4ZYG A;  3J7A O;  2VXZ A;  1DU0 A;  5LLQ A;  3BTL A;  2PG4 A;  3CC7 I;  5J8C A;  4AF5 A;  2IGK A;  2XB5 A;  1UG0 A;  3CCE I;  1TBX A;  3DLA A;  2CWE A;  1YFH A;  1U78 A;  5HLT A;  1R7J A;  1UZC A;  2WV1 A;  3L09 A;  1IRG A;  2BV6 A;  4X1E A;  1RI7 A;  5B1B H;  5KVR A;  1ENH A;  2F5E A;  2WB1 N;  5CKT A;  4LLG F;  5M5X J;  1JI8 A;  3M4O J;  4ZTJ A;  2WGB A;  3E6B A;  2PZ9 A;  2IS4 A;  3VTI A;  2RQQ A;  2DI3 A;  3HOT A;  3QBM A;  1FPQ A;  2F5C A;  4WF2 A;  4BGD A;  2R7R A;  4G7Z F;  3GF2 A;  1JE8 A;  2XAH A;  2VXD A;  4AIJ A;  1JGG A;  1GVJ A;  1AKH B;  1FOK A;  2XDN A;  4Y13 A;  5JLX A;  1GV2 A;  2OF7 A;  2WA0 A;  4KIF A;  4PGH A;  2QQ8 A;  4I2O A;  2QVO A;  2A5W A;  3UKG A;  1P4X A;  4HAM A;  5FO5 A;  1BI3 A;  1BW6 A;  1EH6 A;  2MYS A;  2XAJ A;  2HXI A;  4P55 A;  3UR3 C;  4A12 A;  3PL8 A;  4IO9 F;  4RM2 A;  5LHI A;  2BY1 A;  1Z21 A;  1P4W A;  3ZQ7 A;  3JAM K;  1H9G A;  3WE2 A;  2VB6 A;  4IHV A;  1TNT A;  3LSH A;  2IS1 A;  3NWS A;  1JXS A;  5CPR B;  3AQT A;  2R93 J;  2ZY9 A;  1GT0 C;  1USS A;  2IVM A;  5FLV A;  2K86 A;  3K4L A;  2ZJR F;  2VQC A;  4PZJ A;  4XRM A;  2BXY A;  1BR2 A;  2RDP A;  2X1E A;  4M6X A;  4AM3 A;  1BBY A;  3GFL A;  2DA4 A;  4JK1 X;  4ASN A;  1G3T A;  1VQP I;  4A3E J;  3VWB A;  5IT9 Z;  2FUG 2;  4L5E A;  2NX4 A;  1NG7 A;  4I6Z A;  2LD5 A;  1ETQ A;  1BI2 A;  2P5L C;  3F21 A;  3BT9 A;  3MN2 A;  1JHH A;  1VQ7 I;  1QRY A;  4L5I A;  2D45 A;  5AQC A;  3L2V A;  4UDS A;  3HOW J;  4NEL A;  4WWC A;  2QEX I;  3CJT B;  1FNN A;  2EQR A;  5FB2 A;  1PP7 U;  2CO5 A;  4I01 A;  3OYN A;  2O7O A;  3GTG J;  4BY7 J;  3CUQ C;  3GZ5 A;  3LSK A;  2EFN A;  2I8D A;  4KIC A;  3CCM I;  1YLF A;  5CVJ A;  3PUB A;  1KYZ A;  3TO6 A;  4UUT A;  2ZNZ A;  4BDZ A;  3SDB A;  4AYB A;  1BJZ A;  3JR9 A;  1Q1H A;  2L7K A;  2IGM A;  3RKW A;  4L9V A;  3DTK A;  1YW9 A;  2H27 A;  4HLX A;  2DPD A;  2EA2 A;  1RR8 C;  3BP8 A;  1KZH A;  4P9U A;  1VTN C;  3GW2 A;  3WTY C;  1BR1 A;  2W24 A;  5BOX A;  5JHF A;  3K10 A;  2GM4 A;  2O8K A;  3BCB A;  1MBH A;  4IQJ A;  5FRO A;  4DGW B;  3Q0U A;  2HXO A;  5LD2 C;  3M1C A;  3PO3 J;  3S5R A;  3WHB A;  3LSR A;  2JUC A;  3B6C A;  5FLX K;  1Z3X A;  3P9C A;  1ZRC A;  2A07 F;  1DU6 A;  2E1M B;  3C18 A;  4H0E A;  1QPI A;  4E7I A;  1JUP A;  3ABU A;  1FMW A;  4LJZ F;  1ETO A;  3ZQG A;  5BNG A;  3NWT A;  2NVX J;  2Y0S N;  3H3U A;  3S3N A;  3GYH X;  2E7W A;  2OA4 A;  2KIU A;  4OMY A;  1OYI A;  3GTO J;  5EJC A;  2MLG A;  2L0K A;  2ZKZ A;  4EJT A;  5FKL A;  2K85 A;  3RQ4 A;  3Q0V A;  3OYF A;  2VT2 A;  3NS4 A;  3GZI A;  1BJA A;  4LLL A;  2DT7 B;  5FD5 A;  2Y48 A;  4U9L A;  1MIJ A;  1FTZ A;  2JQ7 A;  4E7K A;  3HDD A;  2NOG A;  1R4M B;  3E6M A;  2OUM A;  3F72 A;  3EGQ A;  1FEX A;  3LWJ A;  4A6D A;  5K58 A;  5KHD A;  4C2M J;  2BY3 A;  1UHW A;  2DYR H;  3T5X A;  3HPG A;  3VVX A;  2VPR A;  1UHS A;  2LTP A;  3VYU B;  5D8K B;  2P5K A;  2X6W A;  5K5Q A;  1YW8 A;  2E1N A;  5KAF C;  2R7T A;  3ZR8 X;  3V7R A;  4U9N A;  2PBX A;  4IJA A;  1IG7 A;  3CCY A;  2VBZ A;  1FSH A;  4XLE A;  1X2M A;  1XN7 A;  3K4B A;  3W3C A;  4DBR A;  2Y69 H;  3O8G A;  4I99 C;  2OQR A;  1QZZ A;  4JKZ A;  2BE5 F;  4D9J A;  2TRT A;  2FEZ A;  2JTV A;  5IP6 A;  1TWF J;  2G7H A;  2P6T A;  4BAY A;  2DN0 A;  5E8G A;  1FP1 D;  3NEU A;  3DEE A;  5FRN A;  3HOV J;  3RKY A;  1MBK A;  2WB1 A;  1XTA A;  3S1N J;  3EET A;  4GCV A;  1T33 A;  5L3C A;  1WI9 A;  2G9W A;  4B44 A;  1FJL A;  2MH9 A;  3ZPL A;  2VLA A;  2L7F P;  2R7X A;  2LVS A;  3VW0 A;  4OIR F;  4XSX F;  2B63 J;  3HYI A;  1SAU A;  5CVV A;  3JSJ A;  5FMP A;  1ITY A;  4DBQ A;  3QPT A;  4PXI A;  1YW7 A;  1FC3 A;  5A2Q Z;  3RZD J;  2CG4 A;  1VQK I;  2OCE A;  3I71 A;  3B6A A;  3TW6 A;  3KNW A;  1T08 B;  1ZQ3 P;  2XGE A;  5FGL A;  2EV6 A;  4FTH A;  5KCM A;  3F8M A;  5D6F A;  5K7Z A;  3OYJ A;  2ZXJ A;  4G6D A;  3A03 A;  3WGI A;  1ZKG A;  2UXX A;  1E17 A;  1SFE A;  4PJM A;  3J7Y J;  2O6G E;  3HUG B;  4RBO A;  3MNL A;  5EGO B;  2EH3 A;  1XCB A;  2ZXI A;  3BZK A;  1E3H A;  3BR0 A;  3PM1 A;  5AIP A;  4PJ0 C;  4PFO A;  2LNB A;  1BIA A;  1IV8 A;  3E1S A;  3KZY A;  1QBJ A;  4RB3 C;  5CXG A;  1K83 J;  3OR1 C;  4XN3 A;  4ESJ A;  2GA1 A;  6PAX A;  1IN4 A;  2LYC A;  3OYC A;  5H2F C;  1R1V A;  3HRU A;  2W53 A;  1WGX A;  5GAH J;  4IRH A;  1VQN I;  2QF7 A;  1UHM A;  2P5V A;  4HX7 A;  1H9T A;  2MC4 A;  5L3G A;  5D8L B;  2V79 A;  3QOD A;  1D1B A;  3QWL A;  4W1U A;  1FLI A;  3L2W A;  3DKX A;  4DYQ A;  2VAS A;  5IT3 A;  2QTQ A;  2H6C A;  3GTP J;  5HS9 A;  5KNL A;  4CZZ A;  4V2G A;  3PIO F;  2V9V A;  4IF4 A;  4RLQ A;  5IYC J;  3NI7 A;  4CSW A;  1T0F A;  4GGG A;  4BE2 A;  2HVQ A;  4S0H B;  2PLY A;  1ETW A;  4G94 A;  2M4K A;  2LBF A;  2VL8 A;  3IP4 B;  4M73 A;  4ZYD A;  1SFX A;  2WY7 Q;  3EUK L;  3V78 A;  4M9Z A;  3PFY A;  3WG7 H;  1TT0 A;  4QLC U;  3OYM A;  1AHD P;  1WJ5 A;  1ZK8 A;  3R0A A;  2IGO A;  3TGN A;  1DPU A;  1SEU A;  4BHB A;  3A1Y A;  2IS2 A;  1MDM A;  3CCL I;  4E7J A;  2RVC A;  4ZDO A;  2QBY B;  2XAS A;  4B1R A;  1IXC A;  1P4A A;  1PJR A;  1ZAR A;  1K79 A;  2R7S A;  4XRS A;  4MTE A;  4CDG A;  5FJ8 J;  3KP6 A;  3DV8 A;  3S2H J;  2VOP A;  1B8I A;  2V6E A;  3LSJ A;  5LHG A;  3IL2 A;  3R4K A;  5FLX Z;  4LG0 B;  3S32 A;  4O5V A;  1RC9 A;  1ZYR F;  2BVM A;  2VQH A;  3HTS B;  5DM6 F;  2YVH A;  4PJN A;  4Y3O A;  1FTT A;  1VQO I;  1BN5 A;  4BL0 B;  2F4I A;  3V42 A;  3JRA A;  3VOD A;  3B73 A;  3ZQH A;  4DYR A;  3BR2 A;  1OCT C;  3KEQ A;  5E1X A;  4OMZ A;  2HQ5 A;  2LOO A;  2DYS H;  2DJI A;  1XMK A;  2XAF A;  4M9X A;  1X3Z B;  2EIM H;  1U5T B;  1IRF A;  3MKZ A;  3CCQ I;  3C07 A;  3O3K A;  4M74 A;  3D5R C;  4HLY A;  2JJ7 A;  3TED A;  3K1N A;  1P6R A;  2JPB A;  2DDA A;  1JT0 A;  3LHQ A;  3ABL H;  2V57 A;  2CJJ A;  3DP7 A;  3ZQQ A;  3GVA A;  3AG1 H;  3OL3 A;  3F3X A;  1B1B A;  5F0C A;  1D5Y A;  3BG5 A;  5CVI A;  2OER A;  1FIP A;  1O7L A;  1P7J A;  2CSO A;  1T95 A;  2GQQ A;  1P92 A;  4E7S A;  3C2H A;  2X1D A;  4E4H A;  3ERE D;  4GRI A;  4I76 A;  1S9H A;  4CCJ A;  2KT0 A;  3FXQ A;  3OIP A;  1JKP C;  3KX2 A;  1K7A A;  1T98 A;  5CVU A;  2EFW A;  2FBK A;  2WAD A;  1ORK A;  2KL4 A;  4OOI A;  1IN8 A;  2NP5 A;  1F9N A;  5K5O A;  4HDV A;  4FE7 A;  2E34 A;  2ZFU A;  5LFA A;  1JKQ C;  3E5X A;  2CS3 A;  5LHH A;  2CFX A;  5FLM J;  2YX7 A;  2PMH A;  4H4K C;  3DXJ F;  2M1B A;  3R61 A;  2AQE A;  3I4M J;  1MBE A;  1I50 J;  4UY8 I;  4N9H A;  4A69 C;  2O7T A;  4BQQ A;  2MD0 A;  1LFP A;  1GUU A;  3D0S A;  1B59 A;  4LB6 B;  1EF4 A;  3LST A;  1D8J A;  1QZE A;  4ZTF A;  3KET A;  1ETY A;  3PIP F;  4ICH A;  5FFX A;  2ETH A;  4BS9 A;  3B02 A;  1FOY A;  1SAN A;  2IXS A;  3QAH A;  2QSF X;  2YUS A;  1WVR A;  3FM3 A;  4BY1 J;  1B72 A;  1OR7 A;  3MKL A;  3JRE A;  4CCL A;  2CMP A;  2KMU A;  4MGR A;  1C0W A;  1Q1V A;  1IV6 A;  2M8E A;  2QQ9 A;  3DBL B;  4DIQ A;  1YTY A;  3KYL A;  4OIQ F;  5HOO A;  3J7A Y;  1XDU A;  2F5F A;  5F6F A;  5EFY A;  2OJE D;  5F0F A;  2HR3 A;  4PDK A;  4KN7 X;  3DKW A;  3ZMZ A;  1EV7 A;  2RKH A;  4BXF A;  3ANG A;  2O9L A;  1DPR A;  2ELH A;  2OAZ A;  4I98 B;  1OCC H;  1SFU A;  3HUG A;  4EMS A;  3J81 K;  5ICG A;  4OAY A;  3CJD A;  5HLH A;  4I02 A;  3FIW A;  2REK A;  2OCC H;  4G8X A;  1M1E B;  2LY9 A;  4LG3 A;  1HKT A;  1XC5 A;  2FRH A;  4RAY A;  3KZZ A;  5LBQ A;  3VOX A;  2IW5 A;  1BW5 A;  2IBD A;  3ON2 A;  1XS9 A;  1IZ1 A;  2K9Q A;  5FKM A;  3R6S A;  1NK3 P;  2DJN A;  3WU1 B;  4U0V A;  1Y8Q B;  1B72 B;  3PFI A;  4CYC B;  3U1K A;  2F2E A;  3NXC A;  1ETV A;  2EB7 A;  2Y0M A;  2ACJ A;  4TV7 A;  3LA2 A;  3OR2 C;  2FQ3 A;  2W82 A;  4P5O A;  2PJP A;  2WTE A;  2CQN A;  2Z9O A;  2EPF A;  3WTT C;  1VFC A;  2DT6 A;  1HXD A;  1AU7 A;  2E36 A;  2NS8 A;  1XDS A;  2MFZ A;  1HST A;  4B8X A;  3ZXS A;  3CRJ A;  1X4O A;  5H6R A;  2ZOZ A;  2YVE A;  2EZI A;  2L4A A;  2JRM A;  3FRQ A;  2XSD C;  1TWG J;  2XDV A;  4Y17 A;  5EEG A;  1KQ8 A;  3G1M A;  4F55 A;  1YS6 A;  4IOA F;  3OYB A;  2IT0 A;  2H1K A;  3U1D A;  1BC7 C;  3DFG A;  1PVE A;  3CCV I;  2BVL A;  4U7B A;  3ONQ A;  5LEJ A;  3RI4 A;  1R1U A;  2FSW A;  2Z5U A;  1LDJ A;  4HX8 A;  3FMR A;  5J4Y A;  3CWR A;  3I4P A;  2Y2Z A;  3FDY A;  4QPO A;  4G7O F;  1QHG A;  2X51 A;  2A6H F;  5GP9 A;  3RPU D;  3T8R A;  4P1W A;  5HLI A;  1HDD C;  1WRJ A;  2CH0 A;  2VKE A;  1BIB A;  1T2K A;  2COM A;  4GO1 A;  5C44 J;  2L7Z A;  4M3F A;  3BJB A;  1MSF C;  1XCV A;  2M34 A;  2PFV A;  1GXP A;  3PO2 J;  3BY6 A;  3BQZ A;  3QPL A;  1A36 A;  4MQV A;  3BJO A;  5ICE A;  1B4A A;  1Y39 A;  3H0G J;  2OZU A;  3Q0W A;  1X58 A;  3OOU A;  2DMN A;  3BNI A;  2W00 A;  4WCG A;  2QQB A;  4RMN A;  4XOR A;  3HGY A;  4E7Z A;  4EGZ A;  3PSF A;  3S16 J;  3MAJ A;  1B6A A;  1GXQ A;  3H0D A;  2ESH A;  3V7S A;  3CD6 I;  1OPC A;  3LSI A;  3W2A A;  3F8B A;  3GTQ J;  2JSC A;  2ID3 A;  3BR6 A;  3QOP A;  4RAZ A;  3RPU A;  5E1Z B;  3EPZ A;  3KLO A;  4PUS A;  3ZP5 A;  1VQL I;  3GEU A;  1FYM A;  1O57 A;  5AON A;  5J1R A;  4BJT A;  2B7E A;  3FWE A;  3CCR I;  3ZQF A;  3RTR A;  5C4X J;  3K70 C;  2PMZ N;  2EK5 A;  4U87 A;  1RES A;  2VKD A;  4RB1 A;  2EBI A;  3TOA A;  4N0B A;  3HOX J;  2GOX B;  2K9L A;  2DMQ A;  3VFZ A;  2XV4 S;  3U2R A;  1D1C A;  1F1Z A;  3HRT A;  1E2X A;  5C4Y A;  2L4M A;  2W48 A;  4XLC A;  5J3L A;  2L9R A;  4QTR A;  3RH2 A;  2LR8 A;  3FBN B;  3HZJ A;  4Y7N J;  1DP3 A;  1IN5 A;  5JHU A;  3IAS 2;  3V8K A;  3IH2 A;  2KKO A;  3IWZ A;  4K2E A;  2RN7 A;  2XB0 X;  4XLF A;  5LRS A;  3A02 A;  3LOC A;  4L0Z B;  1OJL A;  1VZ0 A;  5L3D A;  1YI2 I;  3IKV A;  2MAB A;  1S7A A;  2O03 A;  1YIJ I;  4NC6 A;  3I3L A;  1FP2 A;  1OLT A;  1S3J A;  1HQC A;  4B48 A;  1DQU A;  4MEY F;  2G7L A;  4BNC A;  3RZO J;  1FX7 A;  1ZGA A;  4GFL A;  4GFK A;  1X2N A;  4HW0 A;  5CYV A;  2E60 A;  3DWL E;  2G7S A;  2IP2 A;  3HOY J;  4PFP A;  2HYF A;  3BG6 A;  3H9Q A;  5GTH C;  2EJR A;  1TQI A;  2DTR A;  2CW8 A;  3M1E A;  3BPX A;  2R92 J;  3HHH A;  4AVZ A;  3S14 J;  4GYG A;  2HQN A;  1XPX A;  2QKM B;  3H5R A;  2HVS A;  1ERD A;  5IYB J;  1XGS A;  2KQR A;  3EYY A;  3L7W A;  3DBH B;  3K4N A;  1A6Q A;  1WH7 A;  4MQ9 F;  3F9K A;  1KQ0 A;  3ML6 A;  2R5Z A;  3KFW X;  3L2C A;  5DS9 A;  1T6S A;  1J0R A;  3M9A A;  4P96 A;  5AIQ A;  3C1D A;  2PN6 A;  1DDN A;  1I1S A;  2Q8K A;  2HDD A;  4MXM A;  3NPI A;  3M7G A;  2V7F A;  3ZCO A;  2XPU A;  5F08 A;  2GXB A;  1OR7 C;  4Y33 A;  1D8K A;  3KP5 A;  3ON4 A;  4Q47 A;  3R0J A;  2ISY A;  5LGT A;  3CCJ I;  2ICW G;  3OWT A;  3CTA A;  4YFK F;  3S15 J;  4M3E A;  3VDX A;  3MQ0 A;  4LGW A;  4D7N A;  1Z0X A;  3GWZ A;  4LB5 A;  1WJF A;  2DLL A;  2UXI A;  1S29 A;  1MMG A;  3P5J A;  4JX4 A;  5D5X B;  2RNG A;  2TDX A;  3HGG A;  4C3I J;  3KZI C;  1ZG3 A;  3BR3 A;  3OY9 A;  3S1Q J;  1W7P A;  3EDP A;  1FWZ A;  1T56 A;  1K6O A;  3KE2 A;  1L0O C;  1W5C C;  2DT5 A;  1WQ2 A;  3JTH A;  3VYS B;  1LVK A;  2P4W A;  3ZMU A;  2WBM A;  4BJ6 C;  2DOE A;  2KZV A;  3VPR A;  2P7V B;  1MSE C;  5EGO A;  3GME A;  3M8J A;  4R79 A;  3FHZ A;  2WAQ N;  4L18 B;  2L9V A;  3AG2 H;  2BEO A;  1G59 A;  2WAF A;  2V4J C;  4CIC A;  4YIF A;  4XLN F;  4Q4Z F;  1BM9 A;  2WY8 Q;  2GXA A;  1WI3 A;  2NVU B;  3PUF A;  3PQK A;  1U5T A;  2D1H A;  2E2J J;  2YR2 A;  4DNC A;  4RB2 C;  1YE9 A;  5EZH A;  3BQY A;  2DA5 A;  1PUF A;  2DAO A;  4EM2 A;  4KJZ A;  5E1W A;  2PMZ A;  1I3Q J;  2YPR A;  4AU7 A;  4HSR A;  1Z3Y A;  3ZQL A;  3LSM A;  2QBY A;  3ROU A;  1V54 H;  2PI0 A;  3D1N I;  3H35 A;  5DM7 F;  5F64 A;  2H1L A;  2NVQ J;  2DMT A;  2XAG A;  3CO7 C;  2K9M A;  4EQQ A;  4PCQ A;  3OV8 A;  2M3A A;  3V8L A;  4EEF G;  1U8B A;  3H92 A;  3FKJ A;  5IOY A;  1LVA A;  4HBL A;  1TW3 A;  3I0T A;  2KDO A;  2F4O B;  1OQY A;  4M3D A;  4BXX J;  3HXL A;  5CW8 A;  1IDZ A;  4PJJ A;  2IA0 A;  4CO8 A;  2WV0 A;  2EIK H;  1EJ9 A;  2FBQ A;  4CXF A;  2GUH A;  4EVI A;  1GVD A;  1EH7 A;  1N78 A;  4AD9 A;  2RC4 A;  3G71 I;  4DZP A;  2XF7 A;  3HG9 A;  4BU2 A;  2A6T A;  2YVX A;  3TP0 A;  2STW A;  3HL2 A;  3LAJ A;  4KMU X;  4CYD A;  4YRV A;  1MD0 A;  5E3L A;  3E7L A;  1Z6R A;  2W85 A;  2KP6 A;  2M9H A;  5D4R A;  1IJW C;  3ZMS A;  4GCT A;  3S2W A;  2ME6 A;  4KIT B;  3CC2 I;  3W2V A;  2LC2 A;  3WG9 A;  3OYK A;  4EJO A;  4CA0 A;  1ZG1 A;  2FJI 1;  3DLL F;  2VBW A;  2QKO A;  3QOE A;  4F3Q A;  1G4D A;  1I3A A;  4EM0 B;  1WJD A;  4BEH B;  2R7Z J;  4HF0 A;  1ETX A;  1VI0 A;  4P9F A;  3I53 A;  2UWM A;  5ICC A;  2ZB9 A;  4N4O B;  4IQ4 A;  4UB6 C;  3O8H A;  1K61 A;  3GCM A;  2ISZ A;  1VQM I;  4A5M A;  2PJR A;  3RD3 A;  1R22 A;  2R5Y A;  1QQI A;  2QLZ A;  2UUZ A;  2QGU A;  2MG4 A;  1WJC A;  4PSW A;  1IXR C;  5JVG F;  4A3J J;  4UXN A;  5KAI C;  4OU0 A;  3RJP A;  1XD7 A;  1VF9 A;  2VOD A;  1K4S A;  2ELK A;  3I64 A;  4ENK A;  1KGS A;  1FIA A;  2QWW A;  4ENJ A;  1I6H J;  3CMM A;  2DQR A;  1G3Y A;  1D0X A;  4EM1 A;  5EZG A;  3GFM A;  2R3S A;  3RSN A;  3HTJ A;  1Z67 A;  2GIZ A;  2XGD A;  2XPW A;  5L3E A;  3H5N A;  4MFE A;  4A3D J;  2B1E A;  5HAW A;  3OS2 A;  4HF2 A;  2R7U A;  3GEZ A;  3IH4 A;  1OCO H;  4II2 A;  3K4J A;  4MFD A;  1EKE A;  1MZB A;  1YJN I;  2RGV A;  3ABT A;  3E6C C;  2VUM J;  3LJL A;  1RUO A;  3FKI J;  3E5U A;  1R6R A;  1QPM A;  2NP3 A;  4KIS A;  1X19 A;  3I5U A;  4GXO A;  3SWH A;  3VYT B;  4E7L A;  3CLO A;  5FKO A;  2ZOY A;  1RNL A;  2DOD A;  5FRM A;  3BG3 A;  3RYP A;  2NOJ B;  1AOY A;  1F5T A;  3Q9S A;  3H9J A;  4BKX A;  2UXH A;  3BCG A;  3W6J B;  4HPQ A;  5E3O A;  2ZCX A;  2CUJ A;  1LJ9 A;  5K1Y A;  4V19 K;  4FAS D;  2VOO A;  2LRD A;  4BQA A;  4I0B A;  3OYA A;  2VC0 A;  1D1A A;  1SVM A;  3SQN A;  3SZT A;  4ETS A;  4QPQ A;  1MW7 A;  4ZC3 A;  2GZW A;  3X2Q H;  3OYI A;  3S1R J;  4JNN A;  3NRV A;  2DW4 A;  1G3S A;  3I55 I;  4UNO A;  3LWF A;  1KYW A;  5J6X A;  5K7F A;  2ELJ A;  2L9N A;  3H9G A;  2FBI A;  3RIR A;  2CQX A;  1J75 A;  2DBB A;  1W4M A;  4XLP F;  1LUJ B;  1SMY F;  3FXR A;  2IU5 A;  2MSY A;  3V8J A;  5IY5 H;  3JRH A;  1XGN A;  2VIX A;  3K2A A;  2BW3 A;  3T1B A;  5H9T A;  2ZJ2 A;  2K5C A;  3E3V A;  5HDG A;  2AQF A;  2ZFW A;  3BTJ A;  1MDM B;  2PBI A;  1IO2 A;  1X1B A;  2LSO A;  2A2F X;  1SD6 A;  5D5U B;  4BE0 A;  2IAI A;  2HVR A;  4KN4 X;  4ZYA A;  3KEY A;  1NK2 P;  5GPC A;  2X9D A;  4N4N B;  4B4C A;  5ILU A;  4NHJ A;  4NNJ A;  1ZLJ A;  2STT A;  4X6A J;  4CCM A;  3GTK J;  4CGR A;  3C3W A;  3WHC A;  5DCF A;  1QGP A;  4B47 A;  5K5R A;  3HOS A;  2MH2 A;  3ERM A;  3SEZ A;  2WAE A;  2KIQ A;  1UEL B;  2HTJ A;  2V26 A;  3FF5 A;  2KJB A;  4IRV A;  5DTD A;  2EWN A;  2XRN A;  3F23 A;  3IAM 2;  5J40 A;  3Q5F A;  3W6V A;  2ZNY A;  4Y52 J;  1YOV B;  2OBP A;  2XUB A;  5F0H A;  5FGM A;  2P0W A;  2ZJQ F;  1H0M A;  4S05 A;  2CUF A;  1S8N A;  2KRF A;  2RNJ A;  1T8I A;  4HKU A;  3OOP A;  2ECB A;  4NDL A;  2W1O A;  1HW1 A;  3O60 A;  2Z99 A;  3I54 A;  2ID6 A;  1TWA J;  2DA3 A;  4DJA A;  4AVP A;  2Q2E B;  4WXH A;  2GFN A;  3VP5 A;  5D18 A;  3SDG A;  5HS8 A;  2WAQ A;  2JPC A;  3WTS C;  4YEL A;  2A05 A;  3LMM A;  5CQE A;  3EUP A;  5DUK A;  4Y15 A;  4EV0 A;  2K9S A;  2L9S A;  2XGX A;  1W5S A;  3WGH A;  5GAE J;  2GIV A;  4F52 A;  2CV0 A;  2R4G A;  3IHU A;  3C7J A;  1ON1 A;  4QIW N;  4Y4R A;  2VBY A;  1IAW A;  2ECC A;  2X6O A;  1RRJ A;  2HEO A;  1I1G A;  1LE8 A;  3TO7 A;  3GZ6 A;  1VQ9 I;  4II3 A;  3GUD A;  4MNU A;  1HOM A;  2GWR A;  1D0Y A;  2MA3 A;  2IA2 A;  3JSP A;  4IXA A;  4CH7 A;  5EDN A;  4IL6 C;  2LF7 A;  3ZOB A;  2DFI A;  4B09 A;  2EIL H;  3K0L A;  4OD5 A;  2DK5 A;  1SFK A;  2TCT A;  2K3F A;  5HDN A;  1SMT A;  3MKY B;  5ILV A;  4HA8 A;  2K40 A;  3IRR A;  1TLH B;  2JA2 A;  4UUV A;  5TIS C;  1XSX A;  2ADU A;  1ZH5 A;  5LRR A;  4D1Q A;  1YQA A;  2RHA A;  2M0C A;  3CP2 A;  1SGM A;  5JLW A;  3KCC A;  3LFK A;  3I56 I;  4MEX F;  1LEA A;  1UJ8 A;  2VT3 A;  2JZY A;  2YU3 A;  3MCZ A;  4M72 A;  4OAZ A;  4UHT A;  2BW3 B;  2FBH A;  4PK4 A;  1XB4 A;  2LKX A;  4XKV A;  2BY0 A;  3O6B B;  2HPI A;  4I7H A;  4JL3 A;  1ZR2 A;  4YZE A;  4U88 A;  4FCY A;  1UI6 A;  2R5Z B;  5FHP A;  3E7Q A;  3G73 A;  4KNY A;  3F6V A;  2CW0 F;  2QEN A;  3TKY A;  4HNU A;  3HC7 A;  1YHQ I;  3TBI A;  4HV6 A;  5ERI A;  3ULQ B;  3ZMT A;  1SD7 A;  4BHP A;  4IHW A;  1LFU P;  3PJR A;  3MZ8 A;  1Y1W J;  2H6B A;  3SFI A;  1MH4 A;  3CUQ A;  3AG4 H;  3K1P A;  5HNF A;  2L01 A;  3G7R A;  5D5V B;  3AKZ A;  3A2K A;  1U9O A;  1WZ2 A;  1SD4 A;  1FSE A;  2VI6 A;  2W84 A;  5GAD J;  2DFE A;  1HW2 A;  5IYD J;  2EV5 A;  4RA2 A;  3HIF A;  1ZRE A;  3ELK A;  5J1Y A;  3V7C A;  2RAS A;  3FXO A;  3LFU A;  2EIN H;  3CES A;  3HSR A;  1GLN A;  1Z7U A;  2EZK A;  4U0Y A;  2XF6 A;  2JMW A;  1SD5 A;  2KJC A;  5L3F A;  4G6Q A;  1YG2 A;  2IA1 A;  3G1L A;  2W7N A;  1W7P B;  2A68 F;  1V4R A;  2L02 A;  3BOQ A;  2ZME B;  1ZN2 A;  1CQT A;  3ZRG A;  2E71 A;  3KPH A;  2Y9Z A;  2M7B A;  5DDG A;  5EG0 A;  2JVG A;  3GTJ J;  2GXG A;  4PGG A;  3IKT A;  1T0F C;  4AWX B;  3EUH A;  2H94 A;  1ZG5 A;  1FOX A;  3T0Y A;  1U0J A;  4KWA A;  1OFC X;  1QHH D;  2MGQ A;  1HSJ A;  2KHM A;  2G7U A;  5HNH A;  3KYC B;  4EJW A;  2FF4 A;  3OSG A;  2G7G A;  1RET A;  5HSZ A;  2M4G A;  3BC8 A;  2E1C A;  4HF1 A;  4BBS J;  3FXL A;  1DP7 P;  1J09 A;  3QPH A;  3OMY A;  3SFZ A;  3OSF A;  2NS0 A;  1R71 A;  1OYW A;  3WTZ A;  3QKX A;  4R1H A;  5DV5 A;  4AIH A;  3F22 A;  1LNW A;  2ZCM A;  4CCK A;  5C3E J;  4BE1 A;  4NN1 A;  3JRF A;  4UVC A;  2GAU A;  4AYB N;  5EF6 A;  2DMP A;  1Z1D A;  1O7F A;  3K7A J;  4CUG A;  2X48 A;  3L2Q A;  2FXA A;  2HWV A;  3GTM J;  1WH5 A;  3U21 A;  2VON A;  3G2B A;  3PAS A;  3VOK A;  2K27 A;  2ZSH B;  3LA3 A;  3S1M J;  4Q5S F;  1LQ1 A;  4FX4 A;  4RAF A;  3SXY A;  3E6D A;  4F92 B;  1EH8 A;  3E0J B;  3ANP A;  4NB5 A;  5F27 A;  4IRI A;  4X0G A;  3HRM A;  3LQR A;  3QYE A;  2FU4 A;  1TWH J;  4LMY A;  2KLO A;  3TDU C;  4KT5 C;  1ZHF A;  2KRH A;  4BQO A;  2EFP A;  1MKM A;  5HBU A;  1F36 A;  2L54 A;  3IC7 A;  2L3D A;  3SJM A;  3ZN0 A;  3DTI A;  4MK6 A;  1FBS A;  3NQO A;  4ANJ A;  1GHC A;  1OKR A;  5D19 A;  4LLN A;  1CF7 A;  3P9K A;  2XKP A;  1FZP B;  2LMD A;  2E19 A;  3AFH A;  2K7L A;  4KUM A;  1JUS A;  5J8F A;  2VBX A;  2A3S A;  2OC6 A;  2QYO A;  2ZSI B;  3CUQ B;  1WFX A;  3CDI A;  3J80 Z;  4V2F A;  1ZAO A;  5JI6 A;  3GZN B;  1HW5 A;  2QQA A;  4JQF A;  2OI8 A;  4ZDP A;  4M6Y A;  3IUV A;  1RR7 A;  1TL8 A;  5B1A H;  1RKW A;  1Y0N A;  1W0U A;  4A3B J;  3CDL A;  1T38 A;  2RQP A;  3WU2 C;  3RPQ A;  1JGS A;  2JVH A;  2OTL I;  4LOC A;  4LIU A;  4E6K G;  1W36 C;  2DA7 A;  2W25 A;  2KPM A;  2L2O A;  4WXD A;  4A0Y A;  3NRG A;  3VW1 A;  3FIS A;  3K8P C;  3D5L A;  2A5Y B;  2V9P A;  2WC2 A;  2RV8 A;  2ZME A;  3D5S C;  3OL4 A;  5EG0 B;  3SHF A;  2FML A;  5BPD A;  2D2W A;  2V6C A;  2CYY A;  2OQG A;  1IXS B;  3F0C A;  4N9I A;  4M6V A;  3ZQI A;  5K7H A;  2VE9 A;  1R58 A;  1W0T A;  3F8F A;  2VC1 A;  3WTW C;  4G12 A;  1L3L A;  3BZ6 A;  5E3M A;  2A61 A;  5B66 C;  2XHK A;  1CGP A;  1PDN C;  4C2U A;  1U5T C;  3J7Z I;  3H3Z A;  2XRO A;  1STZ A;  3TP3 A;  4KA4 A;  2FX0 A;  3VOE A;  2Y30 A;  4E70 A;  2R7F A;  2HS5 A;  1XG1 A;  2HI3 A;  4HX4 A;  4OIO F;  3H36 A;  1YIT I;  4ESB A;  4OD4 A;  3VSK A;  2Y31 A;  3L00 A;  3K70 D;  2CQ7 A;  3A4C A;  4O6J A;  3L2R A;  3DTE A;  2DOF A;  2BYV E;  2XSJ C;  2GA2 A;  5DD4 A;  1GV5 A;  3CJQ B;  5DUI A;  3S17 J;  4IRG A;  4A3K J;  2EV0 A;  3L2U A;  1TWC J;  5IT9 K;  2P6S A;  3VB2 A;  2B9S A;  3CO6 C;  3JTG A;  1I5Z A;  1U2W A;  4EJU A;  5F04 A;  4GFB A;  4IEJ A;  2M45 A;  2F4M B;  2O3F A;  5J4V A;  2ZJP F;  1K4T A;  3TOB A;  1QA6 A;  4IHY A;  3BRU A;  2Q1Z B;  4CYC A;  1R1T A;  3RDI A;  3MVP A;  2HQR A;  2VKH A;  2X6X A;  1ZR4 A;  1ACI A;  2VE8 A;  4FX0 A;  3F1B A;  4L5J A;  3VUQ A;  4ENN A;  2B0L A;  2EFQ A;  5IOZ A;  1YRN A;  4A5N A;  3N4M A;  4HST A;  1JHF A;  5DEQ A;  2VN2 A;  4LIT A;  5JR3 A;  2AXL A;  4JX5 A;  4D5C A;  3CCU I;  2DPU A;  2CW7 A;  4CGZ A;  2YX4 A;  5ED4 A;  4OIN F;  4C2M A;  3AL0 B;  2WUI A;  2XAQ A;  3IV5 A;  3U9G A;  1BR4 A;  4L9J A;  1BI1 A;  5J47 A;  1YRN B;  1D5V A;  1S5L C;  1A04 A;  5DD8 A;  4WK8 F;  2F6C A;  2LK2 A;  1MBJ A;  3HTA A;  1IW7 F;  3IRQ A;  3TL4 X;  3EYI A;  4KFC A;  2M87 A;  3I4N J;  3OIQ A;  2MLK A;  2L7M P;  4BAC A;  4IVN A;  3BTI A;  4ABZ A;  4ZDL A;  4A6E A;  2OU2 A;  1MJA A;  1X1P A;  2RAE A;  1ZLK A;  4L9N A;  2GBY A;  4I09 A;  3DPU A;  4ESF A;  4KIG A;  4HNT A;  3CMY A;  2UV1 A;  3AG3 H;  2JWT A;  3TW7 A;  3OYH A;  1G2H A;  1B8I B;  1IUY A;  2YU9 J;  4ACI A;  1K6Y A;  2E5N A;  3P9T A;  2BHZ A;  3K2Z A;  1MBF A;  2HKU A;  3HTH A;  3P9I A;  1X1C A;  3AQS A;  2A69 F;  1PUF B;  1ZRF A;  1VQ6 I;  4XLA A;  2Z2S B;  3FZV A;  3K1M A;  4LFU A;  3HOZ J;  4KYW A;  1S7O A;  2E7X A;  4C2T A;  1UG2 A;  3HPH A;  3BHQ A;  1YIO A;  5M3F J;  1R4N B;  1YX5 A;  4QWQ A;  2G3B A;  4B3X A;  2MBF A;  4I0A A;  5DCM B;  2JA6 J;  2VKV A;  1IC8 A;  2KZG A;  2Q2E A;  4ZZD A;  4UUS B;  1O4X A;  1YX3 A;  1K78 B;  3OS0 A;  2LRE A;  3DEW A;  2JA5 J;  2JN6 A;  1I39 A;  1XSV A;  3ZGK A;  4B3A A;  1QU3 A;  1J5Y A;  2X85 A;  3L1P A;  3M8E A;  4OIP F;  5FD6 A;  3HKZ A;  3GFJ A;  1E3P A;  3W6K B;  2DG7 A;  4ITV A;  1FYK A;  1F43 A;  4AC6 A;  2XKO A;  2GEN A;  2CUE A;  3H1C A;  2OD5 A;  3GBG A;  3J80 K;  4A3G J;  3QP6 A;  3KIO A;  3F8N A;  1IDY A;  5D4S A;  3PNV A;  4DQ2 A;  5E18 F;  3COA C;  4XKB A;  5IP9 J;  3AAF A;  4CZC A;  1YJW I;  3IH3 A;  1RKT A;  3BLY A;  4LK0 F;  3WGG A;  2HOT A;  2HQA A;  4FQG A;  4WIB A;  3CUO A;  1UB9 A;  5CQG A;  3A01 A;  2HOA A;  1JTY A;  1VQ8 I;  1V55 H;  2XF5 A;  3FBI B;  3VVY A;  1X1D A;  3E97 A;  2B3W A;  2ZCN A;  1G6N A;  1HC8 A;  1IN6 A;  1YS7 A;  2LKP A;  5LGU A;  1WJA A;  2ZXW H;  5E3N A;  4Z6Y A;  2HKX A;  3O2P E;  1XGO A;  5A2Q K;  2PEX A;  1R36 A;  4FHT A;  4A3I J;  2BOL A;  2HPM A;  2ZC2 A;  4ME9 A;  4KMF A;  4G6T B;  2DFF A;  4S04 A;  3S2D J;  1J7K A;  3EUA A;  2OTJ I;  3CLQ A;  1UI5 A;  3SZG A;  4IZZ A;  2NS7 A;  4WXC A;  4Z2Y A;  2I5U A;  1HF0 A;  2BBY A;  4L9T A;  1OCZ H;  1H89 C;  5D5W B;  2QIB A;  3G4S I;  2CGP A;  1POG A;  4RS8 A;  1X4P A;  4HQE A;  5CJ9 A;  3G56 A;  1OMI A;  4NC8 A;  3HE0 A;  1YYV A;  1ZTR A;  2O0Y A;  2R7Q A;  5TRD A;  2HU9 A;  2OZ6 A;  1LB2 A;  2R7O A;  3LQQ A;  2UZK A;  1GDT A;  2C6Y A;  2YS9 A;  3HTU A;  2PJR B;  1SVL A;  1V3F A;  3LL7 A;  1JJ8 C;  2ZBK A;  5FKN A;  3F8C A;  4C30 A;  1IGN A;  4YFN F;  3BDD A;  2M5W A;  2Y9Y A;  3FMS A;  1G8X A;  2O61 A;  4M71 A;  5GPA A;  3W2W A;  1U9N A;  4RDU A;  3LSG A;  1OIS A;  3N05 A;  5BS6 A;  3ESW B;  3G3Z A;  4MIM A;  2W4S A;  2NAZ A;  4UB8 C;  3G1O A;  5EEA A;  1S6L A;  1SC7 A;  2R7V A;  1R23 A;  3L9F A;  4AIK A;  3HTI A;  3S3M A;  5CVR A;  4YIR X;  2QSH X;  3WTX C;  1QZY A;  4HZF A;  2DQL A;  4XRF A;  2XRL A;  4XSZ F;  4KDP A;  3EUH C;  5JVT A;  1N77 A;  1BI0 A;  3ABK H;  4NQW A;  1XX5 A;  3GFI A;  1NG6 A;  3HEF A;  2PFB A;  1UST A;  2Z1D A;  3QU3 A;  1TW2 A;  4A0X A;  2HYJ A;  1N25 A;  2LF8 A;  2VJI A;  4XKC A;  1Z05 A;  1SFO J;  4AC0 A;  4M3B A;  4UUS A;  1K78 A;  2HYT A;  2VJ4 A;  2P7C B;  4RB0 A;  1AA7 A;  4F91 B;  5LEK A;  1NH3 A;  2LG4 A;  4BDY A;  1O3S A;  3BWG A;  1Z7L A;  3K6G A;  1HLV A;  4A0Z A;  1OCP A;  5E79 C;  2H8R A;  2QA4 I;  4IKF A;  1JT6 A;  2V1X A;  2XAU A;  3FX3 A;  3A0H C;  2KIS A;  2FE3 A;  4GCL A;  4FIS A;  1Z91 A;  3SYT A;  1DUX C;  3S8P A;  1MND A;  3LSP A;  2COB A;  3FHN A;  1TQM A;  2YSR A;  4QSH A;  1U8R A;  2KIF A;  1KU7 A;  2CV1 A;  1LFB A;  1MNE A;  4GDF A;  5HVQ C;  1A6I A;  3BR1 A;  3HSF A;  1R5G A;  3CDH A;  3I9V 2;  1V5E A;  4ZZL A;  2LH9 A;  5HS7 A;  4RLF A;  2DK8 A;  3A0B C;  4FE4 A;  2WWY A;  4YII A;  3K4M A;  3PPB A;  4MO7 A;  2AXT C;  4BEH A;  5JFR A;  3WTU C;  1Y0U A;  3PNY A;  1RIO H;  2UXO A;  5CXI A;  1KON A;  4YG2 F;  1W36 D;  2QSG X;  4UVA A;  2HYG D;  4A2U A;  2BZT A;  2JRT A;  4XN0 A;  3RKQ A;  3H3V K;  3RQI A;  2NVT J;  3CME I;  2XGC A;  2R5Y B;  2NXN B;  2AHQ A;  2G0E A;  5EEH A;  4A3C J;  2XIG A;  2F48 A;  2N8G A;  1NTC A;  4M9S A;  4F93 B;  1BOA A;  1AKH A;  4XL9 A;  2AO9 A;  3ISP A;  4XK4 A;  3SZP A;  5BQT A;  2FJ1 A;  1W5T A;  2IRF G;  3KP3 A;  4XRS G;  2LKS A;  2XVC A;  2QWT A;  1LDD A;  3VIB A;  2Z33 A;  3MEX A;  3S93 A;  3BCA A;  5IP7 J;  5D6E A;  3HHG A;  2NNY A;  2QM3 A;  1MMA A;  1JTX A;  2LY1 A;  3DU6 A;  2V1D A;  3R60 A;  5D1R A;  2M7A A;  3MZH A;  3QRF F;  1RUN A;  4CHU A;  4DW6 A;  4EJV A;  1P9Q C;  5TGT A;  3ZMD A;  4XID A;  1A31 A;  1PP8 F;  2DG8 A;  2Q24 A;  2NYX A;  1DGR M;  2Y75 A;  1TT5 B;  3E5Q A;  2E35 A;  2NNN A;  5LGN A;  1ODD A;  1Y8R B;  4A3F J;  1A5J A;  1S7E A;  2I10 A;  3PSI A;  5L3B A;  1ZGW A;  3TMO A;  1LPQ A;  1KQ9 A;  1PUE E;  4BHC A;  3ABM H;  2FNA A;  2Q0O A;  3HSE A;  1XSD A;  1J59 A;  3M07 A;  2JA7 J;  4AUX A;  2LY2 A;  2CUZ A;  3BZC A;  4BH9 A;  1MMN A;  1IF1 A;  5KK1 A;  4HV5 A;  3TQN A;  5DAJ A;  2R7W A;  3CMA I;  1TP4 A;  4OWR B;  4XMY A;  4U7D A;  2X1C A;  1FMV A;  2EA4 A;  5GTI C;  3F6O A;  1WCM J;  2CQK A;  4CCN A;  2ZCW A;  2IS6 A;  4PJL A;  1WKM A;  2FD5 A;  4XR6 A;  3NAR A;  9ANT A;  3HM5 A;  3FK7 A;  1P7I A;  3J81 Z;  4XON A;  3KEO A;  1WJB A;  1XGM A;  2JUG A;  2JA8 J;  2EZL A;  3BJA A;  3FXU A;  1YO5 C;  1UMQ A;  3K4C A;  3ZQC A;  1A35 A;  5DCM A;  4NC7 A;  2JSP A;  3JW4 A;  3NAU A;  4NUB A;  1JUM A;  1S72 I;  5F1R A;  3QYF A;  4ZYE A;  1VQ4 I;  2DXI A;  3HB9 A;  3H5A A;  3LAP A;  2F5D A;  3DBR B;  4GYI A;  4JX6 A;  3JSO A;  4XOP A;  3C2B A;  2VJ5 A;  3GXO A;  3BRO A;  1Y56 A;  2P8T A;  2ZXH A;  4A3M J;  2EFO A;  3CF2 A;  1MH3 A;  4KIB A;  4XOT A;  3QPS A;  4B43 A;  3CJN A;  5BMZ A;  1R9T J;  2HTS A;  3BJ6 A;  2F5V A;  1IRX A;  3WU0 A;  3OYG A;  3JRG A;  1O3T A;  1V5G A;  5E20 A;  2VPL A;  3JRD A;  3OIO A;  1JJ6 C;  3OYL A;  2EZH A;  2L5Q A;  4A3L J;  3QYB A;  2DO7 A;  1R5I D;  3N97 A;  2JT1 A;  2PQ8 A;  2GLO A;  3GTL J;  1X1A A;  2IPQ X;  2O8X A;  3MWM A;  4GCK A;  4J19 A;  3BR5 A;  5H6Q A;  2QUF A;  4BUP A;  3B81 A;  1KU3 A;  2BGC A;  2HDW A;  2H09 A;  2KDZ A;  1TZL A;  1ZGJ A;  1P2F A;  3I59 B;  1W7P D;  2XC7 A;  1CF7 B;  4AID A;  3VVZ A;  2UXN A;  3ECO A;  1BL0 A;  2MC3 A;  4R8H A;  3C2G A;  2K9N A;  3QP5 A;  3CCS I;  4EGY A;  5M5Y J;  3Q3S A;  1HKQ A;  4PSX A;  1KU2 A;  1U6G A;  1DGW Y;  2W57 A;  4W97 A;  4MLO A;  1HCR A;  3BG9 A;  3UNG C;  4JP0 A;  2DFH A;  1O3Q A;  3BPV A;  3MZY A;  1REP C;  3BTC A;  1D0Z A;  4LIV A;  4C9Y A;  5C4J J;  2DTZ A;  2E2I J;  3AL0 C;  2HDC A;  2HFH A;  3T8T A;  2IJL A;  2F07 A;  3FK6 A;  2HZT A;  4D5F A;  3LA7 A;  5HOD A;  3I58 A;  1RPW A;  1D3Y A;  4RAG A;  3VEP A;  2FNP A;  4NQW B;  5EYR A;  4BQN A;  1XMA A;  2ZME C;  5FFZ A;  1VQ5 I;  1W1W E;  2V9K A;  2HKO A;  4JBA A;  4G9Y A;  5B3S H;  4L62 A;  1Y1V J;  1KA8 A;  4XKW A;  3VW2 A;  4ON0 A;  2X6Y A;  3FXM A;  3DKY A;  1QVT A;  1UCR A;  1RZ4 A;  3EQL F;  3PQJ A;  3DPL C;  4D0P A;  2R7D A;  3HJE A;  3KP7 A;  4BBR J;  3BG7 A;  2H8W A;  3LNQ A;  4M3G A;  2PX9 A;  1HA8 A;  4XBF A;  4O3M A;  4WX9 A;  2FOW A;  4HEA 2;  3OYD A;  3FMQ A;  2DMU A;  3TDZ C;  2DU9 A;  3MFK A;  1FYL A;  1T39 A;  5DYM A;  4E7H A;  1QO0 D;  2ZO4 A;  1Y6I A;  3FM5 A;  2CQQ A;  2QZ8 A;  1EA3 A;  2BHY A;  3FXK A;  3GX4 X;  2UXU A;  1IUF A;  2O5R A;  2HNH A;  5E8I A;  5HDK A;  1FOW A;  3HKZ N;  1BA5 A;  2RRE A;  1IRZ A;  3GLL A;  2FA5 A;  2HOE A;  2OV7 A;  3I59 A;  2MD5 A;  2QKL B;  3HBL A;  1TTY A;  2Y0S A;  3CC4 I;  2VQG A;  3DU5 A;  2ME0 A;  1HBX G;  3COL A;  1ETK A;  3M8F A;  4UV8 A;  4XM3 A;  1ULY A;  2VJJ A;  4HQM A;  2E2H J;  3PNT A;  1BC8 C;  3ZN1 A;  1H88 C;  1MMS A;  5F1J A;  4F7Z A;  2HZD A;  2E1M C;  3WOD F;  3G6E I;  2R0Q C;  3TO9 A;  3RKX A;  1B9N A;  3OYE A;  2J5P A;  3CQZ J;  5FKK A;  2XPV A;  1E0E A;  4HYE A;  4XIC A;  4BXU A;  2IGN A;  3Q9V A;  1WSU A;  5J1U A;  1IN7 A;  3ZMV A;  4XNF A;  1R49 A;  2NVY J;  2BXZ A;  2KFD A;  2LBF B;  1MBG A;  3DEU A;  4C3H J;  1R00 A;  4C3J J;  1V5F A;  4HDU A;  1F4K A;  4J01 A;  3GLX A;  5IPA A;  1MJ9 A;  3REO A;  2K4B A;  2LP0 A;  2AS5 F;  3A01 B;  1WJE A;  4IPA A;  3HOU J;  5GAG J;  4RM3 A;  2DA6 A;  2KRC A;  4JOM A;  5CLS A;  1LDK B;  2UXP A;  1MMD A;  1OCR H;  1TNS A;  4DZJ A;  4L0Y B;  1WWX A;  4RGU A;  4MTD A;  2D1V A;  3JAM Z;  1OYY A;  4BJ5 C;  5E17 F;  4LD5 A;  3DCF A;  1J9I A;  3K9T A;  1MNM C;  1YJ9 I;  5ILS A;  3MMY B;  3JRB A;  5M5W J;  4RGX A;  1MGT A;  4FET A;  2M30 A;  1LKX A;  5H20 A;  2A6E F;  2CU7 A;  3CJR B;  2DA1 A;  3MD2 A;  1Z6T A;  3WE3 A;  3DPT A;  1I27 A;  4UVB A; 
#chains in the Genus database with same CATH homology
 4JNN A;  5F0C A;  3DEW A;  2JA5 J;  2JN6 A;  3BG5 A;  1D5Y A;  2OER A;  5K7F A;  4HNV A;  4B3A A;  1FIP A;  1APL C;  2CQX A;  2QOP A;  2DA2 A;  1P7J A;  2HOS A;  3L1P A;  2IU5 A;  2MSY A;  2P81 A;  3T6N A;  3JRH A;  1HDP A;  1QVU A;  3K2A A;  2JK3 A;  2QCO A;  2DG7 A;  3V6G A;  4I76 A;  3JRC A;  2KT0 A;  1F43 A;  1JKP C;  4AC6 A;  2GEN A;  5H9T A;  2CUE A;  3GBG A;  2D6Y A;  4A3G J;  2LLK A;  1ORK A;  1TC3 C;  1IDY A;  2NP5 A;  4A93 J;  4FE7 A;  3BTJ A;  1JKQ C;  5IP9 J;  2OPT A;  3NNR A;  3IH3 A;  1RKT A;  5FLM J;  2IAI A;  3KKC A;  2HOT A;  3I4M J;  1MBE A;  1I50 J;  4A69 C;  3A01 A;  1LE8 B;  3VVY A;  2HOA A;  1JTY A;  3QQA A;  1EF4 A;  2O7T A;  1GUU A;  1NK2 P;  5GPC A;  2LFB A;  2MW8 A;  2X9D A;  4B4C A;  5M3M J;  2ZCN A;  1E3O C;  1ETY A;  4X6A J;  5E3N A;  2NP3 A;  4ICH A;  4A3I J;  1VND A;  4ME9 A;  3GTK J;  1Z77 A;  4CGR A;  3WHC A;  2E1O A;  1SAN A;  3M3Y J;  2CRG A;  3S2D J;  2YUS A;  3JRI A;  4BY1 J;  1B72 A;  3MKL A;  3DPJ A;  3JRE A;  2NS7 A;  1Q1V A;  1IV6 A;  1HF0 A;  5DTD A;  1H89 C;  2QIB A;  4D7M A;  3W6V A;  1POG A;  4Y52 J;  5EFY A;  5F0F A;  2D5V A;  5F0H A;  3G56 A;  4DYC A;  3HE0 A;  1ZTR A;  3HIM A;  3ANG A;  2CUF A;  2O9L A;  1WPK A;  1JKO C;  1GDT A;  2YS9 A;  2M2E A;  4JYK A;  4HKU A;  2ECB A;  1JJ8 C;  4NDL A;  5FKN A;  3CJD A;  1IGN A;  4IHX A;  3O60 A;  2M8G X;  3FIW A;  2REK A;  2Y9Y A;  2ID6 A;  5GPA A;  2LY9 A;  1TWA J;  1U9N A;  2DA3 A;  4RDU A;  1XC5 A;  3LSG A;  3KZ9 A;  2FQ4 A;  2GFN A;  1H8A C;  4MIM A;  3VP5 A;  5D18 A;  3VOX A;  3SDG A;  1BW5 A;  5EEA A;  3G1O A;  2IBD A;  3KKD A;  3ON2 A;  1O4X A;  1XS9 A;  2K9Q A;  5FKM A;  1NK3 P;  3EUP A;  2DJN A;  1B72 B;  3HTI A;  2K9S A;  1JKR C;  4CYC B;  3NXC A;  1ETV A;  2XRL A;  2IEK A;  4QIW N;  1DU0 A;  3BTL A;  4AF5 A;  1VFC A;  2X6O A;  2ECC A;  2XB5 A;  1AU7 A;  2NS8 A;  3HEF A;  1LE8 A;  1U78 A;  3CRJ A;  2WV1 A;  1HOM A;  2ZOZ A;  2YVE A;  2EZI A;  2HYJ A;  4X1E A;  1SFO J;  3FRQ A;  4AC0 A;  4M3B A;  4UUS A;  2XSD C;  1TWG J;  1ENH A;  5EDN A;  2HYT A;  2WB1 N;  3G1M A;  5M5X J;  3ZOB A;  2H1K A;  3M4O J;  2WGB A;  2TCT A;  2PZ9 A;  1HLV A;  3S1R J;  1OCP A;  2H8R A;  3CWR A;  1JT6 A;  2Y2Z A;  2K40 A;  3QBM A;  5GP9 A;  4GCL A;  1HDD C;  4FIS A;  1JGG A;  1AKH B;  2XDN A;  2VKE A;  5C44 J;  2L7Z A;  5JLX A;  1GV2 A;  4M3F A;  2COB A;  3LSP A;  2RHA A;  2M0C A;  1SGM A;  2OF7 A;  1MSF C;  3BJB A;  2M34 A;  4QSH A;  3PO2 J;  5JLW A;  3UKG A;  3BQZ A;  1LFB A;  3QPL A;  1BW6 A;  2HXI A;  1A6I A;  3BR1 A;  3H0G J;  3Q0W A;  1X58 A;  3OOU A;  4FE4 A;  4IHV A;  2DMN A;  2LKX A;  3BNI A;  3PPB A;  4MO7 A;  3AQT A;  3HGY A;  2R93 J;  3S16 J;  4JL3 A;  1ZR2 A;  4YZE A;  1GT0 C;  4FCY A;  5FLV A;  1UI6 A;  2UXO A;  5CXI A;  2R5Z B;  5FHP A;  3GTQ J;  2ID3 A;  3BR6 A;  3E7Q A;  4XRM A;  3H3V K;  3RKQ A;  3GEU A;  3RQI A;  2DA4 A;  2NVT J;  5J1R A;  2XGC A;  2NX4 A;  4A3E J;  2R5Y B;  4L5E A;  3ZQF A;  4I6Z A;  2LD5 A;  2AHQ A;  1ETQ A;  2G0E A;  5C4X J;  4A3C J;  2PMZ N;  2N8G A;  3BT9 A;  3MN2 A;  1NTC A;  1RES A;  1LFU P;  4IHW A;  2EBI A;  3HOX J;  1Y1W J;  1AKH A;  1QRY A;  2DMQ A;  2AO9 A;  4XK4 A;  5AQC A;  3SFI A;  1MH4 A;  2FJ1 A;  4UDS A;  3HOW J;  3G7R A;  4NEL A;  5C4Y A;  2W48 A;  5J3L A;  2L9R A;  4XRS G;  1U9O A;  4QTR A;  2EQR A;  3RH2 A;  2LR8 A;  2QWT A;  2VI6 A;  3VIB A;  2O7O A;  4Y7N J;  5IYD J;  5IP7 J;  4BY7 J;  3GTG J;  5J1Y A;  2RAS A;  3IH2 A;  1JTX A;  2XB0 X;  4UUT A;  3A02 A;  3LOC A;  2EZK A;  5D1R A;  1OJL A;  2JMW A;  4DW6 A;  4XID A;  1BJZ A;  3JR9 A;  2DG8 A;  2Q24 A;  3G1L A;  2G7L A;  3RZO J;  4A3F J;  1A5J A;  1CQT A;  1S7E A;  2I10 A;  2Y9Z A;  4GFL A;  5EG0 A;  4GFK A;  1X2N A;  1ZGW A;  2G7S A;  3HOY J;  4KWA A;  1OFC X;  2GM4 A;  2O8K A;  2MGQ A;  1MBH A;  3Q0U A;  2HXO A;  2R92 J;  3S14 J;  2JA7 J;  3PO3 J;  3S5R A;  3WHB A;  4AUX A;  5IYB J;  3LSR A;  2G7G A;  3B6C A;  3OSG A;  1WH7 A;  1RET A;  5HSZ A;  1DU6 A;  1QPI A;  2R5Z A;  4BBS J;  1JUP A;  5DAJ A;  5DS9 A;  1ETO A;  3ZQG A;  3OSF A;  5BNG A;  3QKX A;  2NVX J;  2Y0S N;  2ZCM A;  1WCM J;  5C3E J;  4NN1 A;  3GTO J;  2HDD A;  2FD5 A;  3JRF A;  3NPI A;  4MXM A;  4AYB N;  2L0K A;  2XPU A;  3NAR A;  5F08 A;  5EF6 A;  9ANT A;  2DMP A;  3K7A J;  5FKL A;  2X48 A;  3HM5 A;  3Q0V A;  3FK7 A;  1P7I A;  3GTM J;  1WH5 A;  3GZI A;  3PAS A;  3ON4 A;  3VOK A;  3S1M J;  2JA8 J;  2EZL A;  1FTZ A;  3HDD A;  1UMQ A;  2NOG A;  3ZQC A;  3EGQ A;  3ANP A;  5F27 A;  3S15 J;  1FEX A;  4M3E A;  3LWJ A;  5K58 A;  3NAU A;  1JUM A;  4C2M J;  4D7N A;  1Z0X A;  1TWH J;  3VVX A;  2VPR A;  1UHS A;  3HB9 A;  2LTP A;  2UXI A;  4JX6 A;  5HBU A;  3C2B A;  1F36 A;  4JX4 A;  3HGG A;  4C3I J;  3SJM A;  2PBX A;  4MK6 A;  4A3M J;  1IG7 A;  3BR3 A;  3CCY A;  3S1Q J;  1MH3 A;  5D19 A;  3QPS A;  1X2M A;  1R9T J;  1T56 A;  2E19 A;  1JUS A;  1UI5 A;  3O8G A;  3JRG A;  4JKZ A;  3VPR A;  5IP6 A;  2TRT A;  3GTJ J;  1TWF J;  1MSE C;  5EGO A;  2DN0 A;  4V2F A;  2WAQ N;  2OI8 A;  3JRD A;  3OIO A;  1JJ6 C;  3HOV J;  1MBK A;  2EZH A;  3IUV A;  1RR7 A;  3S1N J;  1T33 A;  1WI3 A;  1RKW A;  1W0U A;  4A3L J;  4A3B J;  3CDL A;  1FJL A;  4LOC A;  2E2J J;  2DA7 A;  2L7F P;  2GLO A;  3GTL J;  2LVS A;  5EZH A;  3BQY A;  3VW0 A;  2DA5 A;  1PUF A;  2B63 J;  3NRG A;  4J19 A;  3VW1 A;  3FIS A;  3BR5 A;  1ITY A;  3JSJ A;  5FMP A;  1I3Q J;  3B81 A;  4PXI A;  3ZQL A;  2KDZ A;  3D1N I;  3RZD J;  3B6A A;  3TW6 A;  3KNW A;  3VVZ A;  2NVQ J;  5EG0 B;  2DMT A;  1BL0 A;  1ZQ3 P;  2XGE A;  3F0C A;  2K9N A;  5FGL A;  4M6V A;  5M5Y J;  3Q3S A;  3ZQI A;  4FTH A;  5K7H A;  5K7Z A;  4EEF G;  1U8B A;  1W0T A;  4W97 A;  5IOY A;  4MLO A;  4G12 A;  1HCR A;  3A03 A;  3BG9 A;  1ZKG A;  4JP0 A;  5E3M A;  4BXX J;  4M3D A;  3BTC A;  5CW8 A;  4RBO A;  1IDZ A;  5C4J J;  5EGO B;  3MNL A;  2EH3 A;  2DTZ A;  3TP3 A;  2E2I J;  2F07 A;  2FBQ A;  2GUH A;  2FX0 A;  1GVD A;  2Y30 A;  3FK6 A;  4D5F A;  3BR0 A;  3PM1 A;  5HOD A;  1XG1 A;  1RPW A;  4DZP A;  2HI3 A;  5CXG A;  1K83 J;  3TP0 A;  2Y31 A;  5EYR A;  4L62 A;  5E3L A;  1Y1V J;  3E7L A;  1GV5 A;  4GCK A;  3VW2 A;  3S17 J;  2M9H A;  1IJW C;  4A3K J;  2W53 A;  4GCT A;  1WGX A;  1TWC J;  1QVT A;  2ME6 A;  2QF7 A;  4BBR J;  5F04 A;  3LNQ A;  4M3G A;  4GFB A;  4IEJ A;  2QKO A;  4IHY A;  4W1U A;  3BRU A;  2DMU A;  4DYQ A;  4CYC A;  2QTQ A;  3MVP A;  3GTP J;  1ZR4 A;  2R7Z J;  1ETX A;  1VI0 A;  3F1B A;  2CQQ A;  3VUQ A;  4V2G A;  2ZB9 A;  2UXU A;  1IUF A;  1K61 A;  3O8H A;  5IYC J;  3NI7 A;  5IOZ A;  1YRN A;  3HKZ N;  1BA5 A;  3RD3 A;  2R5Y A;  1IRZ A;  4S0H B;  1ETW A;  3HBL A;  2MG4 A;  2ME0 A;  3COL A;  3V78 A;  4JX5 A;  4D5C A;  1AHD P;  1ETK A;  4A3J J;  1ZK8 A;  2E2H J;  1VF9 A;  1H88 C;  5F1J A;  2ELK A;  2R0Q C;  1FIA A;  1I6H J;  3CQZ J;  5FKK A;  2XPV A;  2WUI A;  3IV5 A;  4B1R A;  4XIC A;  1YRN B;  5EZG A;  2LK2 A;  5J1U A;  1MBJ A;  3HTA A;  3HTJ A;  4XRS A;  2NVY J;  2XGD A;  2XPW A;  1MBG A;  4MFE A;  4C3H J;  5FJ8 J;  3S2H J;  4C3J J;  4A3D J;  5HAW A;  1B8I A;  3I4N J;  2L7M P;  3LSJ A;  5IPA A;  3BTI A;  4ABZ A;  3IH4 A;  2LP0 A;  4MFD A;  2RAE A;  3A01 B;  2GBY A;  3HOU J;  3CMY A;  2YVH A;  2JWT A;  1FTT A;  2VUM J;  3TW7 A;  1G2H A;  1B8I B;  3LJL A;  2YU9 J;  2DA6 A;  3FKI J;  2UXP A;  3JRA A;  4ACI A;  3P9T A;  3ZQH A;  4DZJ A;  1MBF A;  4DYR A;  2HKU A;  3BR2 A;  3HTH A;  1OCT C;  3AQS A;  2ZOY A;  5FKO A;  2HQ5 A;  1PUF B;  3DCF A;  3BG3 A;  1MNM C;  4BKX A;  3HOZ J;  2UXH A;  3JRB A;  3BCG A;  5M5W J;  3C07 A;  1UG2 A;  5E3O A;  2ZCX A;  3BHQ A;  2JJ7 A;  2CU7 A;  5M3F J;  3TED A;  2DA1 A;  2G3B A;  1JT0 A;  3LHQ A;  2JA6 J;  2V57 A;  2VKV A;  2CJJ A;  1IC8 A;  4UUS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...