5CXGA

Crystal structure of mycobacterium tuberculosis kstr in complex with peg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
b'SEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR
molecule tags Transcription regulator
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxgA00
5AQCA 2ZCXA 2JJ7A 2TRTA 4CGRA 3ZQGA 5K7FA 5EZGA 2XPUA 3C2BA 2G0EA 3B81A 3EUPA 3VUQA 3IH3A 3Q0VA 2REKA 4ACIA 2QKOA 2DG7A 3QBMA 4AC0A 3QPLA 3RD3A 3ON4A 2UXPA 3HTAA 5FKKA 5C4YA 2UXOA 2XDNA 4I6ZA 5IPAA 2NP3A 2Y31A 3QQAA 4DW6A 5CW8A 2XGDA 1U9NA 2Q24A 5F04A 5IOYA 1T33A 3VVYA 4GFLA 3BQZA 3IH4A 3Q0UA 3LSJA 3LSPA 1T56A 1VI0A 4NELA 2ZCMA 3TP0A 3B6AA 4ABZA 1JUSA 2W53A 3VW2A 3BQYA 2IAIA 3G56A 3LHQA 2PZ9A 2GUHA 2O7OA 1UI5A 4GCTA 3RH2A 5CXGA 5IP6A 1RKWA 2UXHA 4XK4A 3G1LA 3CRJA 2ZOZA 4JKZA 3HTIA 2FJ1A 3WHBA 3VVZA 3V78A 4D5FA 2HYJA 3QPSA 2ZOYA 3JSJA 3PPBA 2G7GA 4GCLA 4L62A 5GP9A 4G12A 2OPTA 2HXOA 5EFYA 5J1RA 1JT6A 1RPWA 3HE0A 2V57A 3DEWA 3F0CA 3BR0A 2FQ4A 3CDLA 5F1JA 4D5CA 4X1EA 5FKNA 4B3AA 5IOZA 5J3LA 3HGYA 5K7ZA 2PBXA 4V2FA 4JYKA 3KZ9A 4YZEA 3ANGA 3LWJA 3MNLA 2GBYA 2D6YA 3BJBA 1JUMA 2OI8A 5FKOA 5F0FA 1JTXA 2HYTA 4GCKA 4D7MA 3BR5A 3O60A 2Y2ZA 4PXIA 3FK7A 5FKLA 2OERA 2X6OA 4JL3A 3SFIA 2G7SA 1QVTA 3BTIA 4MO7A 1A6IA 2YVEA 3F1BA 3CWRA 5HSZA 1JT0A 1ZK8A 4I76A 3KKDA 5FGLA 1UI6A 3BR2A 4MK6A 3BT9A 1Z0XA 4M3GA 2QOPA 1JUPA 4AUXA 3NI7A 3HIMA 3NPIA 2HXIA 3PASA 2G7LA 3LSRA 4GFKA 5K58A 2OF7A 4ME9A 5D18A 3ZQIA 2GENA 5DAJA 4AC6A 2VKVA 3E7QA 5K7HA 4W97A 4B1RA 2NS7A 4V2GA 2VPRA 3GEUA 3LOCA 2DTZA 3BNIA 3ZQHA 1JTYA 2EH3A 5FKMA 3VOXA 4ICHA 3ON2A 2YVHA 5EYRA 2G3BA 2XRLA 3IUVA 5J1UA 4JNNA 1U9OA 1Z77A 3HTJA 3VW0A 1RKTA 3FRQA 5HBUA 1SGMA 2XPVA 2DG8A 5FHPA 3BTCA 2NX4A 3CJDA 2NS8A 3KNWA 1QVUA 3ZQLA 3SDGA 5F08A 2I10A 2IEKA 1ORKA 3P9TA 2FBQA 2XGEA 3ANPA 3LJLA 3EGQA 4HKUA 3O8HA 2FX0A 2JK3A 5D19A 2VKEA 3HTHA 2XB5A 3PM1A 2ZB9A 3NRGA 4D7NA 4M3FA 2F07A 2TCTA 2XPWA 5D1RA 3VW1A 4NN1A 2RASA 3Q3SA 1BJZA 3BHQA 3BTJA 3T6NA 3G7RA 3C07A 2HKUA 3CCYA 3G1OA 4M3EA 3KKCA 3WHCA 5F0HA 3Q0WA 3FIWA 3O8GA 2IU5A 2QTQA 3QKXA 4UDSA 3VIBA 5F27A 3TP3A 1QPIA 3MVPA 3HGGA 3NNRA 3FK6A 3G1MA 2Y30A 2WV1A 2ZCNA 5FMPA 2O7TA 2ID3A 3VOKA 2GFNA 3DCFA 2UXUA 3BR6A 2FD5A 2RAEA 3V6GA 2WUIA 2RHAA 4M3DA 3GZIA 3BRUA 3NXCA 2IBDA 2QWTA 5GPAA 5H9TA 3BTLA 2X9DA 3COLA 3DPJA 3IH2A 5CXIA 5GPCA 2WGBA 3B6CA 2XGCA 5EZHA 3ZQFA 3S5RA 3AQSA 2HQ5A 4KWAA 1ZKGA 4W1UA 5J1YA 3AQTA 4AF5A 2QCOA 5HAWA 3BR1A 3VPRA 2NP5A 4M3BA 3BCGA 3BR3A 4MXMA 2UXIA 3VP5A 2ID6A 2QIBA 5F0CA 3VVXA
chains in the Genus database with same CATH superfamily
5AQCA 2ZCXA 2JJ7A 2TRTA 4CGRA 3ZQGA 5K7FA 5EZGA 2XPUA 3C2BA 2G0EA 3B81A 3EUPA 3DU5A 3VUQA 3IH3A 3Q0VA 2R7RA 2REKA 4ACIA 2QKOA 2DG7A 4DVYP 3QBMA 4AC0A 3QPLA 3RD3A 3ON4A 2UXPA 3HTAA 5FKKA 5C4YA 3KYLA 2UXOA 2XDNA 4I6ZA 5IPAA 2NP3A 2Y31A 3QQAA 4DW6A 5CW8A 2XGDA 1U9NA 2Q24A 2B1EA 5F04A 5IOYA 1T33A 3VVYA 4GFLA 3BQZA 3IH4A 3Q0UA 2YVXA 3LSJA 3LSPA 1T56A 1VI0A 4NELA 2ZCMA 3TP0A 3B6AA 4ABZA 1JUSA 2W53A 3VTIA 3VW2A 3BQYA 2IAIA 3G56A 3LHQA 2PZ9A 2R7XA 2GUHA 4WIBA 2O7OA 1UI5A 4GCTA 3RH2A 5CXGA 5IP6A 1RKWA 4OD4A 2UXHA 2R7SA 4XK4A 3G1LA 3CRJA 2ZOZA 2PFVA 4JKZA 3HTIA 2FJ1A 3WHBA 3VVZA 3V78A 4D5FA 2HYJA 3QPSA 2ZOYA 3JSJA 2R7OA 2A2FX 3PPBA 3DU6A 2G7GA 4GCLA 4L62A 5GP9A 4G12A 2OPTA 2HXOA 5EFYA 5J1RA 3K8PC 1JT6A 1RPWA 3HE0A 2V57A 3DEWA 3F0CA 3BR0A 2FQ4A 3CDLA 5F1JA 4D5CA 4X1EA 5FKNA 4B3AA 5IOZA 5J3LA 3HGYA 5K7ZA 2PBXA 4V2FA 4C2MA 4JYKA 3KZ9A 4YZEA 3ANGA 3LWJA 3MNLA 2GBYA 2D6YA 3BJBA 1JUMA 2OI8A 5FKOA 5F0FA 4IRVA 1JTXA 2HYTA 4GCKA 5CQGA 4D7MA 3BR5A 3O60A 2Y2ZA 4PXIA 2R7UA 3FK7A 5FKLA 2OERA 2X6OA 4JL3A 3SFIA 2G7SA 1QVTA 3BTIA 4MO7A 1A6IA 2R7WA 2YVEA 3F1BA 3CWRA 5HSZA 1JT0A 1ZK8A 4I76A 3KKDA 5FGLA 1UI6A 3NS4A 3BR2A 4MK6A 3BT9A 1Z0XA 4M3GA 2QOPA 1JUPA 4AUXA 3NI7A 3HIMA 3NPIA 2HXIA 3PASA 2G7LA 3LSRA 2R7VA 4GFKA 5K58A 2OF7A 2ZY9A 4ME9A 5D18A 3ZQIA 2GENA 5DAJA 4AC6A 2VKVA 3E7QA 5K7HA 4U9NA 4W97A 4B1RA 2NS7A 4V2GA 2VPRA 3GEUA 3LOCA 2DTZA 3BNIA 3ZQHA 1JTYA 2EH3A 5FKMA 3VOXA 4ICHA 3ON2A 2YVHA 5EYRA 2G3BA 2XRLA 3IUVA 5J1UA 4JNNA 1U9OA 1Z77A 3HTJA 3VW0A 1RKTA 3FRQA 5HBUA 1SGMA 2XPVA 2DG8A 2R7QA 5FHPA 3BTCA 2NX4A 3CJDA 2NS8A 3KNWA 1QVUA 3ZQLA 3SDGA 5F08A 2I10A 2IEKA 1ORKA 3P9TA 2FBQA 2XGEA 3ANPA 3FHNA 3LJLA 3EGQA 4HKUA 3O8HA 2FX0A 2JK3A 5D19A 2VKEA 3HTHA 2XB5A 3PM1A 2ZB9A 3NRGA 4D7NA 4M3FA 2F07A 2TCTA 2XPWA 5D1RA 3VW1A 4NN1A 2RASA 3Q3SA 1BJZA 3BHQA 4OD5A 2R7TA 3BTJA 3T6NA 3G7RA 3C07A 2HKUA 3CCYA 3G1OA 4M3EA 3KKCA 3WHCA 5F0HA 3Q0WA 3FIWA 3O8GA 2IU5A 2QTQA 3QKXA 4U9LA 4UDSA 3VIBA 5F27A 3TP3A 1QPIA 3MVPA 3HGGA 3NNRA 3FK6A 3G1MA 2Y30A 2WV1A 2ZCNA 5FMPA 2O7TA 2ID3A 3VOKA 2GFNA 3DCFA 2UXUA 3BR6A 2FD5A 2RAEA 3V6GA 2WUIA 2B3WA 2RHAA 4M3DA 3GZIA 3BRUA 3NXCA 2IBDA 2QWTA 5GPAA 5H9TA 3BTLA 2X9DA 3COLA 3DPJA 3IH2A 5CXIA 5GPCA 2WGBA 3B6CA 2XGCA 2FJI1 5EZHA 3ZQFA 3S5RA 3AQSA 2HQ5A 4KWAA 1ZKGA 4W1UA 3AQTA 5J1YA 4AF5A 2QCOA 5HAWA 3BR1A 3VPRA 2NP5A 4M3BA 3BCGA 3BR3A 3SWHA 4MXMA 2UXIA 3VP5A 2ID6A 2QIBA 5F0CA 3VVXA
chains in the Genus database with same CATH topology
5AQCA 2ZCXA 2JJ7A 2TRTA 4CGRA 3ZQGA 5K7FA 5EZGA 2XPUA 3C2BA 2G0EA 3B81A 3EUPA 3VUQA 3IH3A 3Q0VA 2REKA 4ACIA 2QKOA 2DG7A 3QBMA 4AC0A 3QPLA 3RD3A 3ON4A 2UXPA 3HTAA 5FKKA 5C4YA 2UXOA 2XDNA 4I6ZA 5IPAA 2NP3A 2Y31A 3QQAA 4DW6A 5CW8A 2XGDA 1U9NA 2Q24A 5F04A 5IOYA 1T33A 3VVYA 4GFLA 3BQZA 3IH4A 3Q0UA 3LSJA 3LSPA 1T56A 1VI0A 4NELA 2ZCMA 3TP0A 3B6AA 4ABZA 1JUSA 2W53A 3VW2A 3BQYA 2IAIA 3G56A 3LHQA 2PZ9A 2GUHA 2O7OA 1UI5A 4GCTA 3RH2A 5CXGA 5IP6A 1RKWA 2UXHA 4XK4A 3G1LA 3CRJA 2ZOZA 4JKZA 3HTIA 2FJ1A 3WHBA 3VVZA 3V78A 4D5FA 2HYJA 3QPSA 2ZOYA 3JSJA 3PPBA 2G7GA 4GCLA 4L62A 5GP9A 4G12A 2OPTA 2HXOA 5EFYA 5J1RA 1JT6A 1RPWA 3HE0A 2V57A 3DEWA 3F0CA 3BR0A 2FQ4A 3CDLA 5F1JA 4D5CA 4X1EA 5FKNA 4B3AA 5IOZA 5J3LA 3HGYA 5K7ZA 2PBXA 4V2FA 4JYKA 3KZ9A 4YZEA 3ANGA 3LWJA 3MNLA 2GBYA 2D6YA 3BJBA 1JUMA 2OI8A 5FKOA 5F0FA 1JTXA 2HYTA 4GCKA 4D7MA 3BR5A 3O60A 2Y2ZA 4PXIA 3FK7A 5FKLA 2OERA 2X6OA 4JL3A 3SFIA 2G7SA 1QVTA 3BTIA 4MO7A 1A6IA 2YVEA 3F1BA 3CWRA 5HSZA 1JT0A 1ZK8A 4I76A 3KKDA 5FGLA 1UI6A 3BR2A 4MK6A 3BT9A 1Z0XA 4M3GA 2QOPA 1JUPA 4AUXA 3NI7A 3HIMA 3NPIA 2HXIA 3PASA 2G7LA 3LSRA 4GFKA 5K58A 2OF7A 4ME9A 5D18A 3ZQIA 2GENA 5DAJA 4AC6A 2VKVA 3E7QA 5K7HA 4W97A 4B1RA 2NS7A 4V2GA 2VPRA 3GEUA 3LOCA 2DTZA 3BNIA 3ZQHA 1JTYA 2EH3A 5FKMA 3VOXA 4ICHA 3ON2A 2YVHA 5EYRA 2G3BA 2XRLA 3IUVA 5J1UA 4JNNA 1U9OA 1Z77A 3HTJA 3VW0A 1RKTA 3FRQA 5HBUA 1SGMA 2XPVA 2DG8A 5FHPA 3BTCA 2NX4A 3CJDA 2NS8A 3KNWA 1QVUA 3ZQLA 3SDGA 5F08A 2I10A 2IEKA 1ORKA 3P9TA 2FBQA 2XGEA 3ANPA 3LJLA 3EGQA 4HKUA 3O8HA 2FX0A 2JK3A 5D19A 2VKEA 3HTHA 2XB5A 3PM1A 2ZB9A 3NRGA 4D7NA 4M3FA 2F07A 2TCTA 2XPWA 5D1RA 3VW1A 4NN1A 2RASA 3Q3SA 1BJZA 3BHQA 3BTJA 3T6NA 3G7RA 3C07A 2HKUA 3CCYA 3G1OA 4M3EA 3KKCA 3WHCA 5F0HA 3Q0WA 3FIWA 3O8GA 2IU5A 2QTQA 3QKXA 4UDSA 3VIBA 5F27A 3TP3A 1QPIA 3MVPA 3HGGA 3NNRA 3FK6A 3G1MA 2Y30A 2WV1A 2ZCNA 5FMPA 2O7TA 2ID3A 3VOKA 2GFNA 3DCFA 2UXUA 3BR6A 2FD5A 2RAEA 3V6GA 2WUIA 2RHAA 4M3DA 3GZIA 3BRUA 3NXCA 2IBDA 2QWTA 5GPAA 5H9TA 3BTLA 2X9DA 3COLA 3DPJA 3IH2A 5CXIA 5GPCA 2WGBA 3B6CA 2XGCA 5EZHA 3ZQFA 3S5RA 3AQSA 2HQ5A 4KWAA 1ZKGA 4W1UA 5J1YA 3AQTA 4AF5A 2QCOA 5HAWA 3BR1A 3VPRA 2NP5A 4M3BA 3BCGA 3BR3A 4MXMA 2UXIA 3VP5A 2ID6A 2QIBA 5F0CA 3VVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQC A;  2ZCX A;  2JJ7 A;  2TRT A;  4CGR A;  3ZQG A;  5K7F A;  5EZG A;  2XPU A;  3C2B A;  2G0E A;  3B81 A;  3EUP A;  3VUQ A;  3IH3 A;  3Q0V A;  2REK A;  4ACI A;  2QKO A;  2DG7 A;  3QBM A;  4AC0 A;  3QPL A;  3RD3 A;  3ON4 A;  2UXP A;  3HTA A;  5FKK A;  5C4Y A;  2UXO A;  2XDN A;  4I6Z A;  5IPA A;  2NP3 A;  2Y31 A;  3QQA A;  4DW6 A;  5CW8 A;  2XGD A;  1U9N A;  2Q24 A;  5F04 A;  5IOY A;  1T33 A;  3VVY A;  4GFL A;  3BQZ A;  3IH4 A;  3Q0U A;  3LSJ A;  3LSP A;  1T56 A;  1VI0 A;  4NEL A;  2ZCM A;  3TP0 A;  3B6A A;  4ABZ A;  1JUS A;  2W53 A;  3VW2 A;  3BQY A;  2IAI A;  3G56 A;  3LHQ A;  2PZ9 A;  2GUH A;  2O7O A;  1UI5 A;  4GCT A;  3RH2 A;  5CXG A;  5IP6 A;  1RKW A;  2UXH A;  4XK4 A;  3G1L A;  3CRJ A;  2ZOZ A;  4JKZ A;  3HTI A;  2FJ1 A;  3WHB A;  3VVZ A;  3V78 A;  4D5F A;  2HYJ A;  3QPS A;  2ZOY A;  3JSJ A;  3PPB A;  2G7G A;  4GCL A;  4L62 A;  5GP9 A;  4G12 A;  2OPT A;  2HXO A;  5EFY A;  5J1R A;  1JT6 A;  1RPW A;  3HE0 A;  2V57 A;  3DEW A;  3F0C A;  3BR0 A;  2FQ4 A;  3CDL A;  5F1J A;  4D5C A;  4X1E A;  5FKN A;  4B3A A;  5IOZ A;  5J3L A;  3HGY A;  5K7Z A;  2PBX A;  4V2F A;  4JYK A;  3KZ9 A;  4YZE A;  3ANG A;  3LWJ A;  3MNL A;  2GBY A;  2D6Y A;  3BJB A;  1JUM A;  2OI8 A;  5FKO A;  5F0F A;  1JTX A;  2HYT A;  4GCK A;  4D7M A;  3BR5 A;  3O60 A;  2Y2Z A;  4PXI A;  3FK7 A;  5FKL A;  2OER A;  2X6O A;  4JL3 A;  3SFI A;  2G7S A;  1QVT A;  3BTI A;  4MO7 A;  1A6I A;  2YVE A;  3F1B A;  3CWR A;  5HSZ A;  1JT0 A;  1ZK8 A;  4I76 A;  3KKD A;  5FGL A;  1UI6 A;  3BR2 A;  4MK6 A;  3BT9 A;  1Z0X A;  4M3G A;  2QOP A;  1JUP A;  4AUX A;  3NI7 A;  3HIM A;  3NPI A;  2HXI A;  3PAS A;  2G7L A;  3LSR A;  4GFK A;  5K58 A;  2OF7 A;  4ME9 A;  5D18 A;  3ZQI A;  2GEN A;  5DAJ A;  4AC6 A;  2VKV A;  3E7Q A;  5K7H A;  4W97 A;  4B1R A;  2NS7 A;  4V2G A;  2VPR A;  3GEU A;  3LOC A;  2DTZ A;  3BNI A;  3ZQH A;  1JTY A;  2EH3 A;  5FKM A;  3VOX A;  4ICH A;  3ON2 A;  2YVH A;  5EYR A;  2G3B A;  2XRL A;  3IUV A;  5J1U A;  4JNN A;  1U9O A;  1Z77 A;  3HTJ A;  3VW0 A;  1RKT A;  3FRQ A;  5HBU A;  1SGM A;  2XPV A;  2DG8 A;  5FHP A;  3BTC A;  2NX4 A;  3CJD A;  2NS8 A;  3KNW A;  1QVU A;  3ZQL A;  3SDG A;  5F08 A;  2I10 A;  2IEK A;  1ORK A;  3P9T A;  2FBQ A;  2XGE A;  3ANP A;  3LJL A;  3EGQ A;  4HKU A;  3O8H A;  2FX0 A;  2JK3 A;  5D19 A;  2VKE A;  3HTH A;  2XB5 A;  3PM1 A;  2ZB9 A;  3NRG A;  4D7N A;  4M3F A;  2F07 A;  2TCT A;  2XPW A;  5D1R A;  3VW1 A;  4NN1 A;  2RAS A;  3Q3S A;  1BJZ A;  3BHQ A;  3BTJ A;  3T6N A;  3G7R A;  3C07 A;  2HKU A;  3CCY A;  3G1O A;  4M3E A;  3KKC A;  3WHC A;  5F0H A;  3Q0W A;  3FIW A;  3O8G A;  2IU5 A;  2QTQ A;  3QKX A;  4UDS A;  3VIB A;  5F27 A;  3TP3 A;  1QPI A;  3MVP A;  3HGG A;  3NNR A;  3FK6 A;  3G1M A;  2Y30 A;  2WV1 A;  2ZCN A;  5FMP A;  2O7T A;  2ID3 A;  3VOK A;  2GFN A;  3DCF A;  2UXU A;  3BR6 A;  2FD5 A;  2RAE A;  3V6G A;  2WUI A;  2RHA A;  4M3D A;  3GZI A;  3BRU A;  3NXC A;  2IBD A;  2QWT A;  5GPA A;  5H9T A;  3BTL A;  2X9D A;  3COL A;  3DPJ A;  3IH2 A;  5CXI A;  5GPC A;  2WGB A;  3B6C A;  2XGC A;  5EZH A;  3ZQF A;  3S5R A;  3AQS A;  2HQ5 A;  4KWA A;  1ZKG A;  4W1U A;  5J1Y A;  3AQT A;  4AF5 A;  2QCO A;  5HAW A;  3BR1 A;  3VPR A;  2NP5 A;  4M3B A;  3BCG A;  3BR3 A;  4MXM A;  2UXI A;  3VP5 A;  2ID6 A;  2QIB A;  5F0C A;  3VVX A; 
#chains in the Genus database with same CATH topology
 5AQC A;  2ZCX A;  2JJ7 A;  2TRT A;  4CGR A;  3ZQG A;  5K7F A;  5EZG A;  2XPU A;  3C2B A;  2G0E A;  3B81 A;  3EUP A;  3DU5 A;  3VUQ A;  3IH3 A;  3Q0V A;  2R7R A;  2REK A;  4ACI A;  2QKO A;  2DG7 A;  4DVY P;  3QBM A;  4AC0 A;  3QPL A;  3RD3 A;  3ON4 A;  2UXP A;  3HTA A;  5FKK A;  5C4Y A;  3KYL A;  2UXO A;  2XDN A;  4I6Z A;  5IPA A;  2NP3 A;  2Y31 A;  3QQA A;  4DW6 A;  5CW8 A;  2XGD A;  1U9N A;  2Q24 A;  2B1E A;  5F04 A;  5IOY A;  1T33 A;  3VVY A;  4GFL A;  3BQZ A;  3IH4 A;  3Q0U A;  2YVX A;  3LSJ A;  3LSP A;  1T56 A;  1VI0 A;  4NEL A;  2ZCM A;  3TP0 A;  3B6A A;  4ABZ A;  1JUS A;  2W53 A;  3VTI A;  3VW2 A;  3BQY A;  2IAI A;  3G56 A;  3LHQ A;  2PZ9 A;  2R7X A;  2GUH A;  4WIB A;  2O7O A;  1UI5 A;  4GCT A;  3RH2 A;  5CXG A;  5IP6 A;  1RKW A;  4OD4 A;  2UXH A;  2R7S A;  4XK4 A;  3G1L A;  3CRJ A;  2ZOZ A;  2PFV A;  4JKZ A;  3HTI A;  2FJ1 A;  3WHB A;  3VVZ A;  3V78 A;  4D5F A;  2HYJ A;  3QPS A;  2ZOY A;  3JSJ A;  2R7O A;  2A2F X;  3PPB A;  3DU6 A;  2G7G A;  4GCL A;  4L62 A;  5GP9 A;  4G12 A;  2OPT A;  2HXO A;  5EFY A;  5J1R A;  3K8P C;  1JT6 A;  1RPW A;  3HE0 A;  2V57 A;  3DEW A;  3F0C A;  3BR0 A;  2FQ4 A;  3CDL A;  5F1J A;  4D5C A;  4X1E A;  5FKN A;  4B3A A;  5IOZ A;  5J3L A;  3HGY A;  5K7Z A;  2PBX A;  4V2F A;  4C2M A;  4JYK A;  3KZ9 A;  4YZE A;  3ANG A;  3LWJ A;  3MNL A;  2GBY A;  2D6Y A;  3BJB A;  1JUM A;  2OI8 A;  5FKO A;  5F0F A;  4IRV A;  1JTX A;  2HYT A;  4GCK A;  5CQG A;  4D7M A;  3BR5 A;  3O60 A;  2Y2Z A;  4PXI A;  2R7U A;  3FK7 A;  5FKL A;  2OER A;  2X6O A;  4JL3 A;  3SFI A;  2G7S A;  1QVT A;  3BTI A;  4MO7 A;  1A6I A;  2R7W A;  2YVE A;  3F1B A;  3CWR A;  5HSZ A;  1JT0 A;  1ZK8 A;  4I76 A;  3KKD A;  5FGL A;  1UI6 A;  3NS4 A;  3BR2 A;  4MK6 A;  3BT9 A;  1Z0X A;  4M3G A;  2QOP A;  1JUP A;  4AUX A;  3NI7 A;  3HIM A;  3NPI A;  2HXI A;  3PAS A;  2G7L A;  3LSR A;  2R7V A;  4GFK A;  5K58 A;  2OF7 A;  2ZY9 A;  4ME9 A;  5D18 A;  3ZQI A;  2GEN A;  5DAJ A;  4AC6 A;  2VKV A;  3E7Q A;  5K7H A;  4U9N A;  4W97 A;  4B1R A;  2NS7 A;  4V2G A;  2VPR A;  3GEU A;  3LOC A;  2DTZ A;  3BNI A;  3ZQH A;  1JTY A;  2EH3 A;  5FKM A;  3VOX A;  4ICH A;  3ON2 A;  2YVH A;  5EYR A;  2G3B A;  2XRL A;  3IUV A;  5J1U A;  4JNN A;  1U9O A;  1Z77 A;  3HTJ A;  3VW0 A;  1RKT A;  3FRQ A;  5HBU A;  1SGM A;  2XPV A;  2DG8 A;  2R7Q A;  5FHP A;  3BTC A;  2NX4 A;  3CJD A;  2NS8 A;  3KNW A;  1QVU A;  3ZQL A;  3SDG A;  5F08 A;  2I10 A;  2IEK A;  1ORK A;  3P9T A;  2FBQ A;  2XGE A;  3ANP A;  3FHN A;  3LJL A;  3EGQ A;  4HKU A;  3O8H A;  2FX0 A;  2JK3 A;  5D19 A;  2VKE A;  3HTH A;  2XB5 A;  3PM1 A;  2ZB9 A;  3NRG A;  4D7N A;  4M3F A;  2F07 A;  2TCT A;  2XPW A;  5D1R A;  3VW1 A;  4NN1 A;  2RAS A;  3Q3S A;  1BJZ A;  3BHQ A;  4OD5 A;  2R7T A;  3BTJ A;  3T6N A;  3G7R A;  3C07 A;  2HKU A;  3CCY A;  3G1O A;  4M3E A;  3KKC A;  3WHC A;  5F0H A;  3Q0W A;  3FIW A;  3O8G A;  2IU5 A;  2QTQ A;  3QKX A;  4U9L A;  4UDS A;  3VIB A;  5F27 A;  3TP3 A;  1QPI A;  3MVP A;  3HGG A;  3NNR A;  3FK6 A;  3G1M A;  2Y30 A;  2WV1 A;  2ZCN A;  5FMP A;  2O7T A;  2ID3 A;  3VOK A;  2GFN A;  3DCF A;  2UXU A;  3BR6 A;  2FD5 A;  2RAE A;  3V6G A;  2WUI A;  2B3W A;  2RHA A;  4M3D A;  3GZI A;  3BRU A;  3NXC A;  2IBD A;  2QWT A;  5GPA A;  5H9T A;  3BTL A;  2X9D A;  3COL A;  3DPJ A;  3IH2 A;  5CXI A;  5GPC A;  2WGB A;  3B6C A;  2XGC A;  2FJI 1;  5EZH A;  3ZQF A;  3S5R A;  3AQS A;  2HQ5 A;  4KWA A;  1ZKG A;  4W1U A;  3AQT A;  5J1Y A;  4AF5 A;  2QCO A;  5HAW A;  3BR1 A;  3VPR A;  2NP5 A;  4M3B A;  3BCG A;  3BR3 A;  3SWH A;  4MXM A;  2UXI A;  3VP5 A;  2ID6 A;  2QIB A;  5F0C A;  3VVX A; 
#chains in the Genus database with same CATH homology
 5AQC A;  2ZCX A;  2JJ7 A;  2TRT A;  4CGR A;  3ZQG A;  5K7F A;  5EZG A;  2XPU A;  3C2B A;  2G0E A;  3B81 A;  3EUP A;  3VUQ A;  3IH3 A;  3Q0V A;  2REK A;  4ACI A;  2QKO A;  2DG7 A;  3QBM A;  4AC0 A;  3QPL A;  3RD3 A;  3ON4 A;  2UXP A;  3HTA A;  5FKK A;  5C4Y A;  2UXO A;  2XDN A;  4I6Z A;  5IPA A;  2NP3 A;  2Y31 A;  3QQA A;  4DW6 A;  5CW8 A;  2XGD A;  1U9N A;  2Q24 A;  5F04 A;  5IOY A;  1T33 A;  3VVY A;  4GFL A;  3BQZ A;  3IH4 A;  3Q0U A;  3LSJ A;  3LSP A;  1T56 A;  1VI0 A;  4NEL A;  2ZCM A;  3TP0 A;  3B6A A;  4ABZ A;  1JUS A;  2W53 A;  3VW2 A;  3BQY A;  2IAI A;  3G56 A;  3LHQ A;  2PZ9 A;  2GUH A;  2O7O A;  1UI5 A;  4GCT A;  3RH2 A;  5CXG A;  5IP6 A;  1RKW A;  2UXH A;  4XK4 A;  3G1L A;  3CRJ A;  2ZOZ A;  4JKZ A;  3HTI A;  2FJ1 A;  3WHB A;  3VVZ A;  3V78 A;  4D5F A;  2HYJ A;  3QPS A;  2ZOY A;  3JSJ A;  3PPB A;  2G7G A;  4GCL A;  4L62 A;  5GP9 A;  4G12 A;  2OPT A;  2HXO A;  5EFY A;  5J1R A;  1JT6 A;  1RPW A;  3HE0 A;  2V57 A;  3DEW A;  3F0C A;  3BR0 A;  2FQ4 A;  3CDL A;  5F1J A;  4D5C A;  4X1E A;  5FKN A;  4B3A A;  5IOZ A;  5J3L A;  3HGY A;  5K7Z A;  2PBX A;  4V2F A;  4JYK A;  3KZ9 A;  4YZE A;  3ANG A;  3LWJ A;  3MNL A;  2GBY A;  2D6Y A;  3BJB A;  1JUM A;  2OI8 A;  5FKO A;  5F0F A;  1JTX A;  2HYT A;  4GCK A;  4D7M A;  3BR5 A;  3O60 A;  2Y2Z A;  4PXI A;  3FK7 A;  5FKL A;  2OER A;  2X6O A;  4JL3 A;  3SFI A;  2G7S A;  1QVT A;  3BTI A;  4MO7 A;  1A6I A;  2YVE A;  3F1B A;  3CWR A;  5HSZ A;  1JT0 A;  1ZK8 A;  4I76 A;  3KKD A;  5FGL A;  1UI6 A;  3BR2 A;  4MK6 A;  3BT9 A;  1Z0X A;  4M3G A;  2QOP A;  1JUP A;  4AUX A;  3NI7 A;  3HIM A;  3NPI A;  2HXI A;  3PAS A;  2G7L A;  3LSR A;  4GFK A;  5K58 A;  2OF7 A;  4ME9 A;  5D18 A;  3ZQI A;  2GEN A;  5DAJ A;  4AC6 A;  2VKV A;  3E7Q A;  5K7H A;  4W97 A;  4B1R A;  2NS7 A;  4V2G A;  2VPR A;  3GEU A;  3LOC A;  2DTZ A;  3BNI A;  3ZQH A;  1JTY A;  2EH3 A;  5FKM A;  3VOX A;  4ICH A;  3ON2 A;  2YVH A;  5EYR A;  2G3B A;  2XRL A;  3IUV A;  5J1U A;  4JNN A;  1U9O A;  1Z77 A;  3HTJ A;  3VW0 A;  1RKT A;  3FRQ A;  5HBU A;  1SGM A;  2XPV A;  2DG8 A;  5FHP A;  3BTC A;  2NX4 A;  3CJD A;  2NS8 A;  3KNW A;  1QVU A;  3ZQL A;  3SDG A;  5F08 A;  2I10 A;  2IEK A;  1ORK A;  3P9T A;  2FBQ A;  2XGE A;  3ANP A;  3LJL A;  3EGQ A;  4HKU A;  3O8H A;  2FX0 A;  2JK3 A;  5D19 A;  2VKE A;  3HTH A;  2XB5 A;  3PM1 A;  2ZB9 A;  3NRG A;  4D7N A;  4M3F A;  2F07 A;  2TCT A;  2XPW A;  5D1R A;  3VW1 A;  4NN1 A;  2RAS A;  3Q3S A;  1BJZ A;  3BHQ A;  3BTJ A;  3T6N A;  3G7R A;  3C07 A;  2HKU A;  3CCY A;  3G1O A;  4M3E A;  3KKC A;  3WHC A;  5F0H A;  3Q0W A;  3FIW A;  3O8G A;  2IU5 A;  2QTQ A;  3QKX A;  4UDS A;  3VIB A;  5F27 A;  3TP3 A;  1QPI A;  3MVP A;  3HGG A;  3NNR A;  3FK6 A;  3G1M A;  2Y30 A;  2WV1 A;  2ZCN A;  5FMP A;  2O7T A;  2ID3 A;  3VOK A;  2GFN A;  3DCF A;  2UXU A;  3BR6 A;  2FD5 A;  2RAE A;  3V6G A;  2WUI A;  2RHA A;  4M3D A;  3GZI A;  3BRU A;  3NXC A;  2IBD A;  2QWT A;  5GPA A;  5H9T A;  3BTL A;  2X9D A;  3COL A;  3DPJ A;  3IH2 A;  5CXI A;  5GPC A;  2WGB A;  3B6C A;  2XGC A;  5EZH A;  3ZQF A;  3S5R A;  3AQS A;  2HQ5 A;  4KWA A;  1ZKG A;  4W1U A;  5J1Y A;  3AQT A;  4AF5 A;  2QCO A;  5HAW A;  3BR1 A;  3VPR A;  2NP5 A;  4M3B A;  3BCG A;  3BR3 A;  4MXM A;  2UXI A;  3VP5 A;  2ID6 A;  2QIB A;  5F0C A;  3VVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...