5CXGA

Crystal structure of mycobacterium tuberculosis kstr in complex with peg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
SEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transcription regulator
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxgA00
2YVEA 5FMPA 5EFYA 2DTZA 3RH2A 2RASA 4CGRA 2FQ4A 2GFNA 5D19A 4GCKA 4NN1A 3CWRA 4AC0A 3NRGA 2QIBA 3BR5A 4JYKA 5IPAA 4W1UA 1Z77A 2HYTA 2G7GA 3LJLA 5F27A 3C2BA 3ZQIA 3Q0VA 5IOZA 2QTQA 3NI7A 4PXIA 3VOXA 4W97A 2UXIA 3ANPA 4YZEA 3VPRA 3BR1A 4ICHA 2TRTA 4D7NA 3ANGA 5J1RA 3VW2A 5IOYA 5F0CA 2REKA 3CRJA 4XK4A 2HKUA 2XDNA 3NPIA 1ORKA 2X9DA 3QQAA 2XGCA 2RHAA 5DAJA 2D6YA 3B6AA 3KNWA 5IP6A 2I10A 1UI6A 2NS8A 2ZB9A 4D5FA 1SGMA 2W53A 3IH4A 3BHQA 3G1OA 2VKEA 3ZQGA 3Q0WA 3QPSA 3EUPA 1JT0A 2JK3A 2HXOA 2G3BA 2X6OA 4JKZA 2WGBA 5K7ZA 2PZ9A 2VKVA 1JTXA 1A6IA 3Q0UA 3HTAA 4D7MA 5HSZA 1RKTA 2WV1A 3LHQA 3BRUA 1T56A 2FX0A 1U9NA 5GP9A 2OI8A 3BQZA 2VPRA 2O7TA 4JNNA 3HTHA 3WHCA 5HAWA 5D1RA 5F0FA 3F0CA 5D18A 4GFLA 3VVZA 4D5CA 2ID3A 3BTJA 1QVTA 3BCGA 3VW0A 2NS7A 3PPBA 5GPCA 3BJBA 3V78A 4GCLA 4G12A 3CCYA 2G7LA 1U9OA 5FKMA 3SDGA 3O8HA 3T6NA 2FD5A 3HTIA 2EH3A 3KKCA 5F04A 3IUVA 3BR2A 5EYRA 5EZGA 2XB5A 5F1JA 2XRLA 3CDLA 4ACIA 3BNIA 3ZQLA 2ID6A 3LOCA 3S5RA 1QVUA 3F1BA 3CJDA 4B1RA 4V2GA 2IAIA 2UXOA 3QPLA 2QWTA 3B81A 2GUHA 4M3FA 3FIWA 3B6CA 3MNLA 2O7OA 2FJ1A 5CXIA 3MVPA 3G1LA 3KZ9A 4M3GA 3IH2A 3AQTA 5FGLA 3BQYA 3FRQA 4AF5A 2QCOA 4B3AA 2DG7A 1Z0XA 5F08A 5C4YA 1ZK8A 5FKLA 2WUIA 3FK6A 3PASA 3LSJA 2TCTA 5J1UA 2OERA 2ZCMA 2G0EA 3V6GA 2HXIA 3DPJA 5AQCA 5J3LA 3HTJA 4AUXA 1RKWA 4GFKA 3NNRA 5FKNA 3TP3A 5FKOA 2ZOZA 3VIBA 1T33A 2UXUA 3BT9A 3G1MA 3PM1A 2UXHA 5K58A 3SFIA 2XGDA 4X1EA 3VVXA 4UDSA 2Q24A 3ZQFA 3O8GA 2Y2ZA 2GENA 3VVYA 4NELA 2OF7A 4I76A 2YVHA 2Y31A 3QKXA 4AC6A 3LWJA 3GEUA 3C07A 4HKUA 1JUPA 3BR3A 5CXGA 3HIMA 2Y30A 5FHPA 3BTLA 2XGEA 2ZOYA 5F0HA 1JTYA 3Q3SA 1QPIA 3DEWA 3RD3A 4M3EA 3G56A 4MO7A 1VI0A 2FBQA 3VOKA 3IH3A 3LSPA 4V2FA 2QOPA 4ME9A 4M3DA 3ZQHA 2XPVA 1JUMA 3BTIA 3DCFA 4MXMA 3P9TA 4MK6A 2PBXA 2IU5A 4ABZA 3BR6A 3G7RA 2ZCXA 1BJZA 3HE0A 4GCTA 1JT6A 5EZHA 1ZKGA 2DG8A 2HQ5A 3BR0A 2GBYA 3O60A 2NP3A 3QBMA 3ON4A 3TP0A 4DW6A 4JL3A 2IEKA 5GPAA 3HGGA 3VP5A 3COLA 2HYJA 3HGYA 3LSRA 2ZCNA 3EGQA 3JSJA 2G7SA 2QKOA 2RAEA 4M3BA 3BTCA 3GZIA 4KWAA 3ON2A 2XPUA 2JJ7A 2XPWA 2UXPA 3VUQA 5H9TA 3FK7A 5J1YA 3AQSA 3E7QA 2F07A 5K7FA 4L62A 4I6ZA 1UI5A 2OPTA 3NXCA 5HBUA 1RPWA 3KKDA 2NX4A 5CW8A 2V57A 3WHBA 3VW1A 1JUSA 2IBDA 5K7HA 5FKKA 2NP5A
chains in the Genus database with same CATH superfamily
2YVEA 5FMPA 5EFYA 2DTZA 3RH2A 2RASA 4CGRA 2FQ4A 2GFNA 5D19A 4GCKA 4NN1A 3CWRA 4AC0A 3NRGA 2QIBA 3BR5A 4JYKA 5IPAA 4W1UA 5CQGA 1Z77A 2B3WA 4C2MA 2HYTA 2R7TA 2G7GA 3LJLA 5F27A 3SWHA 3C2BA 3ZQIA 3Q0VA 5IOZA 2QTQA 3NI7A 4PXIA 3VOXA 4W97A 2UXIA 3ANPA 2R7XA 4YZEA 3VPRA 3BR1A 4ICHA 2TRTA 4D7NA 3ANGA 5J1RA 3VW2A 2R7SA 5IOYA 5F0CA 2REKA 3CRJA 4XK4A 2HKUA 2XDNA 3NPIA 1ORKA 2X9DA 3KYLA 3QQAA 2XGCA 2RHAA 5DAJA 2D6YA 3B6AA 3KNWA 5IP6A 2R7VA 2I10A 1UI6A 2NS8A 2ZB9A 4D5FA 1SGMA 2W53A 3IH4A 3BHQA 3G1OA 2VKEA 3ZQGA 3Q0WA 3NS4A 3QPSA 3EUPA 1JT0A 2JK3A 2HXOA 2YVXA 2G3BA 2X6OA 4JKZA 2WGBA 3VTIA 5K7ZA 2PZ9A 2VKVA 1JTXA 1A6IA 3Q0UA 3HTAA 4D7MA 5HSZA 1RKTA 2WV1A 3LHQA 3BRUA 1T56A 2FX0A 1U9NA 4OD4A 5GP9A 4IRVA 2OI8A 3BQZA 3DU5A 2VPRA 2O7TA 4JNNA 3HTHA 3WHCA 5HAWA 5D1RA 5F0FA 4OD5A 3F0CA 5D18A 4GFLA 3VVZA 4D5CA 2ID3A 3BTJA 1QVTA 3BCGA 3VW0A 2NS7A 3PPBA 2A2FX 5GPCA 3BJBA 3V78A 4GCLA 4G12A 3CCYA 2G7LA 1U9OA 5FKMA 3SDGA 3O8HA 2PFVA 3T6NA 2FD5A 3HTIA 2EH3A 3DU6A 3KKCA 5F04A 3IUVA 3BR2A 5EYRA 2R7WA 5EZGA 2XB5A 5F1JA 2XRLA 3CDLA 4ACIA 3BNIA 3ZQLA 2ID6A 3LOCA 3S5RA 1QVUA 3F1BA 3CJDA 4U9LA 4B1RA 4V2GA 2IAIA 2ZY9A 2UXOA 3QPLA 2QWTA 3B81A 2GUHA 4M3FA 3FIWA 3B6CA 3MNLA 2O7OA 2FJ1A 5CXIA 3MVPA 3G1LA 3KZ9A 4M3GA 3IH2A 3AQTA 5FGLA 3BQYA 3FRQA 4U9NA 4AF5A 2QCOA 4DVYP 4B3AA 2DG7A 1Z0XA 5F08A 2R7UA 5C4YA 1ZK8A 5FKLA 2WUIA 3FK6A 3PASA 3LSJA 2TCTA 5J1UA 2OERA 2ZCMA 2G0EA 3V6GA 2HXIA 3DPJA 5AQCA 5J3LA 3HTJA 4AUXA 1RKWA 4GFKA 3NNRA 5FKNA 3TP3A 5FKOA 2ZOZA 3VIBA 1T33A 2UXUA 3BT9A 3K8PC 3G1MA 3PM1A 2UXHA 5K58A 3SFIA 2XGDA 4X1EA 3VVXA 3FHNA 4UDSA 2R7RA 2Q24A 3ZQFA 3O8GA 2Y2ZA 2GENA 3VVYA 4NELA 2OF7A 4I76A 2YVHA 2Y31A 3QKXA 4AC6A 3LWJA 3GEUA 2B1EA 3C07A 4HKUA 1JUPA 3BR3A 5CXGA 3HIMA 2Y30A 5FHPA 3BTLA 2XGEA 2ZOYA 4WIBA 5F0HA 1JTYA 3Q3SA 1QPIA 3DEWA 3RD3A 4M3EA 3G56A 4MO7A 1VI0A 2FBQA 3VOKA 3IH3A 3LSPA 4V2FA 2QOPA 2R7OA 4ME9A 2R7QA 4M3DA 3ZQHA 2XPVA 2FJI1 1JUMA 3BTIA 3DCFA 4MXMA 3P9TA 4MK6A 2PBXA 2IU5A 4ABZA 3BR6A 3G7RA 2ZCXA 1BJZA 3HE0A 4GCTA 1JT6A 5EZHA 1ZKGA 2DG8A 2HQ5A 3BR0A 2GBYA 3O60A 2NP3A 3QBMA 3ON4A 3TP0A 4DW6A 4JL3A 2IEKA 5GPAA 3HGGA 3VP5A 3COLA 2HYJA 3HGYA 3LSRA 2ZCNA 3EGQA 3JSJA 2G7SA 2QKOA 2RAEA 4M3BA 3BTCA 3GZIA 4KWAA 3ON2A 2XPUA 2JJ7A 2XPWA 2UXPA 3VUQA 5H9TA 3FK7A 5J1YA 3AQSA 3E7QA 2F07A 5K7FA 4L62A 4I6ZA 1UI5A 2OPTA 3NXCA 5HBUA 1RPWA 3KKDA 2NX4A 5CW8A 2V57A 3WHBA 3VW1A 1JUSA 2IBDA 5K7HA 5FKKA 2NP5A
chains in the Genus database with same CATH topology
2YVEA 5FMPA 5EFYA 2DTZA 3RH2A 2RASA 4CGRA 2FQ4A 2GFNA 5D19A 4GCKA 4NN1A 3CWRA 4AC0A 3NRGA 2QIBA 3BR5A 4JYKA 5IPAA 4W1UA 1Z77A 2HYTA 2G7GA 3LJLA 5F27A 3C2BA 3ZQIA 3Q0VA 5IOZA 2QTQA 3NI7A 4PXIA 3VOXA 4W97A 2UXIA 3ANPA 4YZEA 3VPRA 3BR1A 4ICHA 2TRTA 4D7NA 3ANGA 5J1RA 3VW2A 5IOYA 5F0CA 2REKA 3CRJA 4XK4A 2HKUA 2XDNA 3NPIA 1ORKA 2X9DA 3QQAA 2XGCA 2RHAA 5DAJA 2D6YA 3B6AA 3KNWA 5IP6A 2I10A 1UI6A 2NS8A 2ZB9A 4D5FA 1SGMA 2W53A 3IH4A 3BHQA 3G1OA 2VKEA 3ZQGA 3Q0WA 3QPSA 3EUPA 1JT0A 2JK3A 2HXOA 2G3BA 2X6OA 4JKZA 2WGBA 5K7ZA 2PZ9A 2VKVA 1JTXA 1A6IA 3Q0UA 3HTAA 4D7MA 5HSZA 1RKTA 2WV1A 3LHQA 3BRUA 1T56A 2FX0A 1U9NA 5GP9A 2OI8A 3BQZA 2VPRA 2O7TA 4JNNA 3HTHA 3WHCA 5HAWA 5D1RA 5F0FA 3F0CA 5D18A 4GFLA 3VVZA 4D5CA 2ID3A 3BTJA 1QVTA 3BCGA 3VW0A 2NS7A 3PPBA 5GPCA 3BJBA 3V78A 4GCLA 4G12A 3CCYA 2G7LA 1U9OA 5FKMA 3SDGA 3O8HA 3T6NA 2FD5A 3HTIA 2EH3A 3KKCA 5F04A 3IUVA 3BR2A 5EYRA 5EZGA 2XB5A 5F1JA 2XRLA 3CDLA 4ACIA 3BNIA 3ZQLA 2ID6A 3LOCA 3S5RA 1QVUA 3F1BA 3CJDA 4B1RA 4V2GA 2IAIA 2UXOA 3QPLA 2QWTA 3B81A 2GUHA 4M3FA 3FIWA 3B6CA 3MNLA 2O7OA 2FJ1A 5CXIA 3MVPA 3G1LA 3KZ9A 4M3GA 3IH2A 3AQTA 5FGLA 3BQYA 3FRQA 4AF5A 2QCOA 4B3AA 2DG7A 1Z0XA 5F08A 5C4YA 1ZK8A 5FKLA 2WUIA 3FK6A 3PASA 3LSJA 2TCTA 5J1UA 2OERA 2ZCMA 2G0EA 3V6GA 2HXIA 3DPJA 5AQCA 5J3LA 3HTJA 4AUXA 1RKWA 4GFKA 3NNRA 5FKNA 3TP3A 5FKOA 2ZOZA 3VIBA 1T33A 2UXUA 3BT9A 3G1MA 3PM1A 2UXHA 5K58A 3SFIA 2XGDA 4X1EA 3VVXA 4UDSA 2Q24A 3ZQFA 3O8GA 2Y2ZA 2GENA 3VVYA 4NELA 2OF7A 4I76A 2YVHA 2Y31A 3QKXA 4AC6A 3LWJA 3GEUA 3C07A 4HKUA 1JUPA 3BR3A 5CXGA 3HIMA 2Y30A 5FHPA 3BTLA 2XGEA 2ZOYA 5F0HA 1JTYA 3Q3SA 1QPIA 3DEWA 3RD3A 4M3EA 3G56A 4MO7A 1VI0A 2FBQA 3VOKA 3IH3A 3LSPA 4V2FA 2QOPA 4ME9A 4M3DA 3ZQHA 2XPVA 1JUMA 3BTIA 3DCFA 4MXMA 3P9TA 4MK6A 2PBXA 2IU5A 4ABZA 3BR6A 3G7RA 2ZCXA 1BJZA 3HE0A 4GCTA 1JT6A 5EZHA 1ZKGA 2DG8A 2HQ5A 3BR0A 2GBYA 3O60A 2NP3A 3QBMA 3ON4A 3TP0A 4DW6A 4JL3A 2IEKA 5GPAA 3HGGA 3VP5A 3COLA 2HYJA 3HGYA 3LSRA 2ZCNA 3EGQA 3JSJA 2G7SA 2QKOA 2RAEA 4M3BA 3BTCA 3GZIA 4KWAA 3ON2A 2XPUA 2JJ7A 2XPWA 2UXPA 3VUQA 5H9TA 3FK7A 5J1YA 3AQSA 3E7QA 2F07A 5K7FA 4L62A 4I6ZA 1UI5A 2OPTA 3NXCA 5HBUA 1RPWA 3KKDA 2NX4A 5CW8A 2V57A 3WHBA 3VW1A 1JUSA 2IBDA 5K7HA 5FKKA 2NP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVE A;  5FMP A;  5EFY A;  2DTZ A;  3RH2 A;  2RAS A;  4CGR A;  2FQ4 A;  2GFN A;  5D19 A;  4GCK A;  4NN1 A;  3CWR A;  4AC0 A;  3NRG A;  2QIB A;  3BR5 A;  4JYK A;  5IPA A;  4W1U A;  1Z77 A;  2HYT A;  2G7G A;  3LJL A;  5F27 A;  3C2B A;  3ZQI A;  3Q0V A;  5IOZ A;  2QTQ A;  3NI7 A;  4PXI A;  3VOX A;  4W97 A;  2UXI A;  3ANP A;  4YZE A;  3VPR A;  3BR1 A;  4ICH A;  2TRT A;  4D7N A;  3ANG A;  5J1R A;  3VW2 A;  5IOY A;  5F0C A;  2REK A;  3CRJ A;  4XK4 A;  2HKU A;  2XDN A;  3NPI A;  1ORK A;  2X9D A;  3QQA A;  2XGC A;  2RHA A;  5DAJ A;  2D6Y A;  3B6A A;  3KNW A;  5IP6 A;  2I10 A;  1UI6 A;  2NS8 A;  2ZB9 A;  4D5F A;  1SGM A;  2W53 A;  3IH4 A;  3BHQ A;  3G1O A;  2VKE A;  3ZQG A;  3Q0W A;  3QPS A;  3EUP A;  1JT0 A;  2JK3 A;  2HXO A;  2G3B A;  2X6O A;  4JKZ A;  2WGB A;  5K7Z A;  2PZ9 A;  2VKV A;  1JTX A;  1A6I A;  3Q0U A;  3HTA A;  4D7M A;  5HSZ A;  1RKT A;  2WV1 A;  3LHQ A;  3BRU A;  1T56 A;  2FX0 A;  1U9N A;  5GP9 A;  2OI8 A;  3BQZ A;  2VPR A;  2O7T A;  4JNN A;  3HTH A;  3WHC A;  5HAW A;  5D1R A;  5F0F A;  3F0C A;  5D18 A;  4GFL A;  3VVZ A;  4D5C A;  2ID3 A;  3BTJ A;  1QVT A;  3BCG A;  3VW0 A;  2NS7 A;  3PPB A;  5GPC A;  3BJB A;  3V78 A;  4GCL A;  4G12 A;  3CCY A;  2G7L A;  1U9O A;  5FKM A;  3SDG A;  3O8H A;  3T6N A;  2FD5 A;  3HTI A;  2EH3 A;  3KKC A;  5F04 A;  3IUV A;  3BR2 A;  5EYR A;  5EZG A;  2XB5 A;  5F1J A;  2XRL A;  3CDL A;  4ACI A;  3BNI A;  3ZQL A;  2ID6 A;  3LOC A;  3S5R A;  1QVU A;  3F1B A;  3CJD A;  4B1R A;  4V2G A;  2IAI A;  2UXO A;  3QPL A;  2QWT A;  3B81 A;  2GUH A;  4M3F A;  3FIW A;  3B6C A;  3MNL A;  2O7O A;  2FJ1 A;  5CXI A;  3MVP A;  3G1L A;  3KZ9 A;  4M3G A;  3IH2 A;  3AQT A;  5FGL A;  3BQY A;  3FRQ A;  4AF5 A;  2QCO A;  4B3A A;  2DG7 A;  1Z0X A;  5F08 A;  5C4Y A;  1ZK8 A;  5FKL A;  2WUI A;  3FK6 A;  3PAS A;  3LSJ A;  2TCT A;  5J1U A;  2OER A;  2ZCM A;  2G0E A;  3V6G A;  2HXI A;  3DPJ A;  5AQC A;  5J3L A;  3HTJ A;  4AUX A;  1RKW A;  4GFK A;  3NNR A;  5FKN A;  3TP3 A;  5FKO A;  2ZOZ A;  3VIB A;  1T33 A;  2UXU A;  3BT9 A;  3G1M A;  3PM1 A;  2UXH A;  5K58 A;  3SFI A;  2XGD A;  4X1E A;  3VVX A;  4UDS A;  2Q24 A;  3ZQF A;  3O8G A;  2Y2Z A;  2GEN A;  3VVY A;  4NEL A;  2OF7 A;  4I76 A;  2YVH A;  2Y31 A;  3QKX A;  4AC6 A;  3LWJ A;  3GEU A;  3C07 A;  4HKU A;  1JUP A;  3BR3 A;  5CXG A;  3HIM A;  2Y30 A;  5FHP A;  3BTL A;  2XGE A;  2ZOY A;  5F0H A;  1JTY A;  3Q3S A;  1QPI A;  3DEW A;  3RD3 A;  4M3E A;  3G56 A;  4MO7 A;  1VI0 A;  2FBQ A;  3VOK A;  3IH3 A;  3LSP A;  4V2F A;  2QOP A;  4ME9 A;  4M3D A;  3ZQH A;  2XPV A;  1JUM A;  3BTI A;  3DCF A;  4MXM A;  3P9T A;  4MK6 A;  2PBX A;  2IU5 A;  4ABZ A;  3BR6 A;  3G7R A;  2ZCX A;  1BJZ A;  3HE0 A;  4GCT A;  1JT6 A;  5EZH A;  1ZKG A;  2DG8 A;  2HQ5 A;  3BR0 A;  2GBY A;  3O60 A;  2NP3 A;  3QBM A;  3ON4 A;  3TP0 A;  4DW6 A;  4JL3 A;  2IEK A;  5GPA A;  3HGG A;  3VP5 A;  3COL A;  2HYJ A;  3HGY A;  3LSR A;  2ZCN A;  3EGQ A;  3JSJ A;  2G7S A;  2QKO A;  2RAE A;  4M3B A;  3BTC A;  3GZI A;  4KWA A;  3ON2 A;  2XPU A;  2JJ7 A;  2XPW A;  2UXP A;  3VUQ A;  5H9T A;  3FK7 A;  5J1Y A;  3AQS A;  3E7Q A;  2F07 A;  5K7F A;  4L62 A;  4I6Z A;  1UI5 A;  2OPT A;  3NXC A;  5HBU A;  1RPW A;  3KKD A;  2NX4 A;  5CW8 A;  2V57 A;  3WHB A;  3VW1 A;  1JUS A;  2IBD A;  5K7H A;  5FKK A;  2NP5 A; 
#chains in the Genus database with same CATH topology
 2YVE A;  5FMP A;  5EFY A;  2DTZ A;  3RH2 A;  2RAS A;  4CGR A;  2FQ4 A;  2GFN A;  5D19 A;  4GCK A;  4NN1 A;  3CWR A;  4AC0 A;  3NRG A;  2QIB A;  3BR5 A;  4JYK A;  5IPA A;  4W1U A;  5CQG A;  1Z77 A;  2B3W A;  4C2M A;  2HYT A;  2R7T A;  2G7G A;  3LJL A;  5F27 A;  3SWH A;  3C2B A;  3ZQI A;  3Q0V A;  5IOZ A;  2QTQ A;  3NI7 A;  4PXI A;  3VOX A;  4W97 A;  2UXI A;  3ANP A;  2R7X A;  4YZE A;  3VPR A;  3BR1 A;  4ICH A;  2TRT A;  4D7N A;  3ANG A;  5J1R A;  3VW2 A;  2R7S A;  5IOY A;  5F0C A;  2REK A;  3CRJ A;  4XK4 A;  2HKU A;  2XDN A;  3NPI A;  1ORK A;  2X9D A;  3KYL A;  3QQA A;  2XGC A;  2RHA A;  5DAJ A;  2D6Y A;  3B6A A;  3KNW A;  5IP6 A;  2R7V A;  2I10 A;  1UI6 A;  2NS8 A;  2ZB9 A;  4D5F A;  1SGM A;  2W53 A;  3IH4 A;  3BHQ A;  3G1O A;  2VKE A;  3ZQG A;  3Q0W A;  3NS4 A;  3QPS A;  3EUP A;  1JT0 A;  2JK3 A;  2HXO A;  2YVX A;  2G3B A;  2X6O A;  4JKZ A;  2WGB A;  3VTI A;  5K7Z A;  2PZ9 A;  2VKV A;  1JTX A;  1A6I A;  3Q0U A;  3HTA A;  4D7M A;  5HSZ A;  1RKT A;  2WV1 A;  3LHQ A;  3BRU A;  1T56 A;  2FX0 A;  1U9N A;  4OD4 A;  5GP9 A;  4IRV A;  2OI8 A;  3BQZ A;  3DU5 A;  2VPR A;  2O7T A;  4JNN A;  3HTH A;  3WHC A;  5HAW A;  5D1R A;  5F0F A;  4OD5 A;  3F0C A;  5D18 A;  4GFL A;  3VVZ A;  4D5C A;  2ID3 A;  3BTJ A;  1QVT A;  3BCG A;  3VW0 A;  2NS7 A;  3PPB A;  2A2F X;  5GPC A;  3BJB A;  3V78 A;  4GCL A;  4G12 A;  3CCY A;  2G7L A;  1U9O A;  5FKM A;  3SDG A;  3O8H A;  2PFV A;  3T6N A;  2FD5 A;  3HTI A;  2EH3 A;  3DU6 A;  3KKC A;  5F04 A;  3IUV A;  3BR2 A;  5EYR A;  2R7W A;  5EZG A;  2XB5 A;  5F1J A;  2XRL A;  3CDL A;  4ACI A;  3BNI A;  3ZQL A;  2ID6 A;  3LOC A;  3S5R A;  1QVU A;  3F1B A;  3CJD A;  4U9L A;  4B1R A;  4V2G A;  2IAI A;  2ZY9 A;  2UXO A;  3QPL A;  2QWT A;  3B81 A;  2GUH A;  4M3F A;  3FIW A;  3B6C A;  3MNL A;  2O7O A;  2FJ1 A;  5CXI A;  3MVP A;  3G1L A;  3KZ9 A;  4M3G A;  3IH2 A;  3AQT A;  5FGL A;  3BQY A;  3FRQ A;  4U9N A;  4AF5 A;  2QCO A;  4DVY P;  4B3A A;  2DG7 A;  1Z0X A;  5F08 A;  2R7U A;  5C4Y A;  1ZK8 A;  5FKL A;  2WUI A;  3FK6 A;  3PAS A;  3LSJ A;  2TCT A;  5J1U A;  2OER A;  2ZCM A;  2G0E A;  3V6G A;  2HXI A;  3DPJ A;  5AQC A;  5J3L A;  3HTJ A;  4AUX A;  1RKW A;  4GFK A;  3NNR A;  5FKN A;  3TP3 A;  5FKO A;  2ZOZ A;  3VIB A;  1T33 A;  2UXU A;  3BT9 A;  3K8P C;  3G1M A;  3PM1 A;  2UXH A;  5K58 A;  3SFI A;  2XGD A;  4X1E A;  3VVX A;  3FHN A;  4UDS A;  2R7R A;  2Q24 A;  3ZQF A;  3O8G A;  2Y2Z A;  2GEN A;  3VVY A;  4NEL A;  2OF7 A;  4I76 A;  2YVH A;  2Y31 A;  3QKX A;  4AC6 A;  3LWJ A;  3GEU A;  2B1E A;  3C07 A;  4HKU A;  1JUP A;  3BR3 A;  5CXG A;  3HIM A;  2Y30 A;  5FHP A;  3BTL A;  2XGE A;  2ZOY A;  4WIB A;  5F0H A;  1JTY A;  3Q3S A;  1QPI A;  3DEW A;  3RD3 A;  4M3E A;  3G56 A;  4MO7 A;  1VI0 A;  2FBQ A;  3VOK A;  3IH3 A;  3LSP A;  4V2F A;  2QOP A;  2R7O A;  4ME9 A;  2R7Q A;  4M3D A;  3ZQH A;  2XPV A;  2FJI 1;  1JUM A;  3BTI A;  3DCF A;  4MXM A;  3P9T A;  4MK6 A;  2PBX A;  2IU5 A;  4ABZ A;  3BR6 A;  3G7R A;  2ZCX A;  1BJZ A;  3HE0 A;  4GCT A;  1JT6 A;  5EZH A;  1ZKG A;  2DG8 A;  2HQ5 A;  3BR0 A;  2GBY A;  3O60 A;  2NP3 A;  3QBM A;  3ON4 A;  3TP0 A;  4DW6 A;  4JL3 A;  2IEK A;  5GPA A;  3HGG A;  3VP5 A;  3COL A;  2HYJ A;  3HGY A;  3LSR A;  2ZCN A;  3EGQ A;  3JSJ A;  2G7S A;  2QKO A;  2RAE A;  4M3B A;  3BTC A;  3GZI A;  4KWA A;  3ON2 A;  2XPU A;  2JJ7 A;  2XPW A;  2UXP A;  3VUQ A;  5H9T A;  3FK7 A;  5J1Y A;  3AQS A;  3E7Q A;  2F07 A;  5K7F A;  4L62 A;  4I6Z A;  1UI5 A;  2OPT A;  3NXC A;  5HBU A;  1RPW A;  3KKD A;  2NX4 A;  5CW8 A;  2V57 A;  3WHB A;  3VW1 A;  1JUS A;  2IBD A;  5K7H A;  5FKK A;  2NP5 A; 
#chains in the Genus database with same CATH homology
 2YVE A;  5FMP A;  5EFY A;  2DTZ A;  3RH2 A;  2RAS A;  4CGR A;  2FQ4 A;  2GFN A;  5D19 A;  4GCK A;  4NN1 A;  3CWR A;  4AC0 A;  3NRG A;  2QIB A;  3BR5 A;  4JYK A;  5IPA A;  4W1U A;  1Z77 A;  2HYT A;  2G7G A;  3LJL A;  5F27 A;  3C2B A;  3ZQI A;  3Q0V A;  5IOZ A;  2QTQ A;  3NI7 A;  4PXI A;  3VOX A;  4W97 A;  2UXI A;  3ANP A;  4YZE A;  3VPR A;  3BR1 A;  4ICH A;  2TRT A;  4D7N A;  3ANG A;  5J1R A;  3VW2 A;  5IOY A;  5F0C A;  2REK A;  3CRJ A;  4XK4 A;  2HKU A;  2XDN A;  3NPI A;  1ORK A;  2X9D A;  3QQA A;  2XGC A;  2RHA A;  5DAJ A;  2D6Y A;  3B6A A;  3KNW A;  5IP6 A;  2I10 A;  1UI6 A;  2NS8 A;  2ZB9 A;  4D5F A;  1SGM A;  2W53 A;  3IH4 A;  3BHQ A;  3G1O A;  2VKE A;  3ZQG A;  3Q0W A;  3QPS A;  3EUP A;  1JT0 A;  2JK3 A;  2HXO A;  2G3B A;  2X6O A;  4JKZ A;  2WGB A;  5K7Z A;  2PZ9 A;  2VKV A;  1JTX A;  1A6I A;  3Q0U A;  3HTA A;  4D7M A;  5HSZ A;  1RKT A;  2WV1 A;  3LHQ A;  3BRU A;  1T56 A;  2FX0 A;  1U9N A;  5GP9 A;  2OI8 A;  3BQZ A;  2VPR A;  2O7T A;  4JNN A;  3HTH A;  3WHC A;  5HAW A;  5D1R A;  5F0F A;  3F0C A;  5D18 A;  4GFL A;  3VVZ A;  4D5C A;  2ID3 A;  3BTJ A;  1QVT A;  3BCG A;  3VW0 A;  2NS7 A;  3PPB A;  5GPC A;  3BJB A;  3V78 A;  4GCL A;  4G12 A;  3CCY A;  2G7L A;  1U9O A;  5FKM A;  3SDG A;  3O8H A;  3T6N A;  2FD5 A;  3HTI A;  2EH3 A;  3KKC A;  5F04 A;  3IUV A;  3BR2 A;  5EYR A;  5EZG A;  2XB5 A;  5F1J A;  2XRL A;  3CDL A;  4ACI A;  3BNI A;  3ZQL A;  2ID6 A;  3LOC A;  3S5R A;  1QVU A;  3F1B A;  3CJD A;  4B1R A;  4V2G A;  2IAI A;  2UXO A;  3QPL A;  2QWT A;  3B81 A;  2GUH A;  4M3F A;  3FIW A;  3B6C A;  3MNL A;  2O7O A;  2FJ1 A;  5CXI A;  3MVP A;  3G1L A;  3KZ9 A;  4M3G A;  3IH2 A;  3AQT A;  5FGL A;  3BQY A;  3FRQ A;  4AF5 A;  2QCO A;  4B3A A;  2DG7 A;  1Z0X A;  5F08 A;  5C4Y A;  1ZK8 A;  5FKL A;  2WUI A;  3FK6 A;  3PAS A;  3LSJ A;  2TCT A;  5J1U A;  2OER A;  2ZCM A;  2G0E A;  3V6G A;  2HXI A;  3DPJ A;  5AQC A;  5J3L A;  3HTJ A;  4AUX A;  1RKW A;  4GFK A;  3NNR A;  5FKN A;  3TP3 A;  5FKO A;  2ZOZ A;  3VIB A;  1T33 A;  2UXU A;  3BT9 A;  3G1M A;  3PM1 A;  2UXH A;  5K58 A;  3SFI A;  2XGD A;  4X1E A;  3VVX A;  4UDS A;  2Q24 A;  3ZQF A;  3O8G A;  2Y2Z A;  2GEN A;  3VVY A;  4NEL A;  2OF7 A;  4I76 A;  2YVH A;  2Y31 A;  3QKX A;  4AC6 A;  3LWJ A;  3GEU A;  3C07 A;  4HKU A;  1JUP A;  3BR3 A;  5CXG A;  3HIM A;  2Y30 A;  5FHP A;  3BTL A;  2XGE A;  2ZOY A;  5F0H A;  1JTY A;  3Q3S A;  1QPI A;  3DEW A;  3RD3 A;  4M3E A;  3G56 A;  4MO7 A;  1VI0 A;  2FBQ A;  3VOK A;  3IH3 A;  3LSP A;  4V2F A;  2QOP A;  4ME9 A;  4M3D A;  3ZQH A;  2XPV A;  1JUM A;  3BTI A;  3DCF A;  4MXM A;  3P9T A;  4MK6 A;  2PBX A;  2IU5 A;  4ABZ A;  3BR6 A;  3G7R A;  2ZCX A;  1BJZ A;  3HE0 A;  4GCT A;  1JT6 A;  5EZH A;  1ZKG A;  2DG8 A;  2HQ5 A;  3BR0 A;  2GBY A;  3O60 A;  2NP3 A;  3QBM A;  3ON4 A;  3TP0 A;  4DW6 A;  4JL3 A;  2IEK A;  5GPA A;  3HGG A;  3VP5 A;  3COL A;  2HYJ A;  3HGY A;  3LSR A;  2ZCN A;  3EGQ A;  3JSJ A;  2G7S A;  2QKO A;  2RAE A;  4M3B A;  3BTC A;  3GZI A;  4KWA A;  3ON2 A;  2XPU A;  2JJ7 A;  2XPW A;  2UXP A;  3VUQ A;  5H9T A;  3FK7 A;  5J1Y A;  3AQS A;  3E7Q A;  2F07 A;  5K7F A;  4L62 A;  4I6Z A;  1UI5 A;  2OPT A;  3NXC A;  5HBU A;  1RPW A;  3KKD A;  2NX4 A;  5CW8 A;  2V57 A;  3WHB A;  3VW1 A;  1JUS A;  2IBD A;  5K7H A;  5FKK A;  2NP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...