5CXGA

Crystal structure of mycobacterium tuberculosis kstr in complex with peg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
SEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transcription regulator
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxgA00
3ANPA 3QBMA 3DPJA 4MXMA 5EYRA 4XK4A 2HYTA 1ZKGA 2I10A 3BTCA 2HYJA 3VW2A 4YZEA 3DEWA 1QVTA 3BR0A 3QQAA 3QPSA 4V2GA 3BR1A 2NP5A 3LHQA 3QPLA 1SGMA 3BR6A 3KZ9A 3LSRA 2W53A 2HQ5A 3GEUA 2QWTA 4DW6A 1BJZA 2NX4A 2EH3A 2Y31A 5HBUA 3ON4A 4B3AA 4L62A 3PASA 3V78A 4M3FA 3AQSA 2HXOA 3WHBA 1JTXA 1T33A 1JUMA 4ME9A 3NXCA 3VW1A 5F27A 4NN1A 2FQ4A 3KKDA 5FKMA 5H9TA 3CCYA 1ORKA 4JL3A 3FK7A 2UXOA 3G1OA 3IH3A 3AQTA 3GZIA 3CRJA 1JUPA 5FKOA 3DCFA 2QOPA 4M3GA 3PPBA 2XGEA 2FD5A 3LJLA 4AC6A 3O8HA 3SDGA 2F07A 3TP3A 3CDLA 3V6GA 3HGGA 2IU5A 2GENA 3G7RA 3HGYA 2OERA 2FBQA 5D1RA 5K58A 2ZB9A 4MO7A 1RKTA 3VP5A 3HTJA 3BR2A 5C4YA 3Q0UA 3LWJA 2XPVA 3EGQA 2WUIA 2GFNA 2UXUA 3Q3SA 4AUXA 2XPWA 3LSPA 2DTZA 2JJ7A 3BCGA 2ID3A 2UXHA 3BT9A 4GFLA 5AQCA 5CXIA 5HAWA 3ZQIA 3B6AA 2X6OA 4GFKA 3ANGA 4ICHA 4GCKA 1RKWA 2XPUA 3WHCA 2RASA 3QKXA 2G3BA 3VOXA 5FKNA 4I76A 5F0CA 3TP0A 3MVPA 3LOCA 1RPWA 4I6ZA 1VI0A 2GBYA 3BTLA 4AC0A 2FJ1A 2NS8A 4CGRA 3ZQFA 3BQYA 4AF5A 4JYKA 2HXIA 5J1RA 4ABZA 4M3BA 1ZK8A 3E7QA 4D5CA 2OF7A 5F08A 5K7FA 3BTJA 5FMPA 4MK6A 3T6NA 2Y2ZA 3F0CA 3HTHA 3IH4A 5DAJA 2TRTA 4G12A 3RD3A 4KWAA 4JKZA 1Z0XA 5D18A 1Z77A 2G0EA 2XGCA 4W97A 4D5FA 4D7MA 2ID6A 3VPRA 3C07A 3SFIA 2XDNA 4ACIA 5IOZA 2DG7A 5K7ZA 2QIBA 2XRLA 2Q24A 4GCLA 4HKUA 5J3LA 3B6CA 1UI6A 5EZHA 3NNRA 3HE0A 3KKCA 1JTYA 3VOKA 2OPTA 3G1LA 2XB5A 2YVEA 3VUQA 3COLA 2YVHA 3RH2A 1JT0A 3BNIA 2NP3A 3HTIA 2JK3A 2DG8A 3BHQA 2Y30A 2IBDA 2FX0A 3BJBA 2G7SA 2GUHA 2G7GA 2VKVA 5F1JA 2HKUA 3FK6A 2PBXA 2WV1A 4NELA 5FKLA 5IOYA 4W1UA 3LSJA 2ZCMA 5FKKA 3MNLA 2UXPA 2REKA 2XGDA 1QPIA 2UXIA 2WGBA 3ZQHA 3BR3A 5GPAA 5K7HA 3VVZA 3VVYA 4M3EA 3P9TA 3VIBA 2IAIA 4UDSA 2V57A 4GCTA 5D19A 2G7LA 2QKOA 3VVXA 5F0FA 1QVUA 3JSJA 3CJDA 2VPRA 3S5RA 3VW0A 5EFYA 2VKEA 3B81A 2D6YA 2NS7A 5EZGA 1U9NA 5FHPA 4PXIA 3CWRA 1T56A 2ZOZA 3F1BA 3BTIA 5F04A 3FIWA 3IUVA 3ZQLA 2RAEA 2OI8A 3HTAA 1U9OA 5IPAA 3HIMA 2O7TA 3NPIA 1A6IA 1JT6A 3BR5A 3Q0WA 2X9DA 4JNNA 2ZCXA 2IEKA 5GPCA 5CW8A 5HSZA 3EUPA 3FRQA 5FGLA 3PM1A 3IH2A 3ON2A 5F0HA 3BQZA 4V2FA 3NRGA 3KNWA 2ZCNA 3O8GA 5GP9A 2PZ9A 3NI7A 2TCTA 2QTQA 4D7NA 3ZQGA 3BRUA 2RHAA 5J1UA 1JUSA 4M3DA 5CXGA 3C2BA 1UI5A 3Q0VA 5IP6A 2O7OA 2QCOA 3O60A 4X1EA 5J1YA 3G1MA 2ZOYA 4B1RA 3G56A
chains in the Genus database with same CATH superfamily
3ANPA 3QBMA 3DPJA 4MXMA 5EYRA 4XK4A 2HYTA 1ZKGA 2I10A 2R7UA 3BTCA 2HYJA 3VW2A 4YZEA 3DEWA 1QVTA 3BR0A 3QQAA 3QPSA 4V2GA 3BR1A 2NP5A 3LHQA 3QPLA 1SGMA 3BR6A 3KZ9A 3LSRA 2W53A 2HQ5A 3GEUA 2QWTA 3SWHA 4DW6A 1BJZA 2NX4A 2EH3A 2Y31A 5HBUA 3K8PC 3ON4A 4B3AA 4L62A 3PASA 3V78A 4M3FA 3AQSA 2HXOA 3WHBA 1JTXA 1T33A 1JUMA 4ME9A 3NXCA 3VW1A 5F27A 4NN1A 2FQ4A 3KKDA 5FKMA 3KYLA 5H9TA 3CCYA 4C2MA 1ORKA 4JL3A 3FK7A 2UXOA 3G1OA 3IH3A 3AQTA 3GZIA 3CRJA 1JUPA 5FKOA 3DCFA 2QOPA 4M3GA 3PPBA 2XGEA 2FD5A 3LJLA 4AC6A 3O8HA 3SDGA 2F07A 3TP3A 3CDLA 3V6GA 3HGGA 2IU5A 2GENA 3G7RA 3HGYA 2OERA 2FBQA 5D1RA 2R7SA 5K58A 2ZB9A 4MO7A 1RKTA 3VP5A 3HTJA 3BR2A 5C4YA 3Q0UA 4IRVA 3LWJA 2XPVA 3EGQA 2WUIA 2GFNA 2UXUA 3Q3SA 3VTIA 4AUXA 2XPWA 3LSPA 2DTZA 2JJ7A 3BCGA 2ID3A 2UXHA 3BT9A 4GFLA 4OD5A 5AQCA 5CXIA 5HAWA 3ZQIA 2R7OA 3B6AA 2X6OA 4GFKA 3ANGA 4ICHA 4GCKA 1RKWA 2XPUA 3WHCA 2RASA 3QKXA 2G3BA 3VOXA 5FKNA 4I76A 5F0CA 3TP0A 3MVPA 2FJI1 3LOCA 1RPWA 4I6ZA 1VI0A 2GBYA 3BTLA 4AC0A 2A2FX 2FJ1A 3NS4A 2NS8A 4CGRA 3ZQFA 3BQYA 4AF5A 4JYKA 4U9LA 2HXIA 5J1RA 4ABZA 4M3BA 1ZK8A 3E7QA 4D5CA 2OF7A 5F08A 2R7VA 5K7FA 3BTJA 5FMPA 4MK6A 3T6NA 2Y2ZA 3F0CA 3HTHA 3IH4A 2R7TA 5DAJA 2TRTA 4G12A 5CQGA 3RD3A 4KWAA 4JKZA 1Z0XA 5D18A 1Z77A 2R7WA 2G0EA 2XGCA 4W97A 4D5FA 4D7MA 2ID6A 2B1EA 3VPRA 3C07A 3SFIA 2XDNA 4ACIA 5IOZA 2DG7A 5K7ZA 2QIBA 2B3WA 2XRLA 2Q24A 4GCLA 4HKUA 5J3LA 3B6CA 1UI6A 5EZHA 3NNRA 3HE0A 3KKCA 1JTYA 3VOKA 2OPTA 3G1LA 2XB5A 2YVEA 3VUQA 3COLA 2YVHA 3RH2A 1JT0A 3BNIA 2NP3A 2R7XA 3HTIA 2JK3A 2DG8A 3BHQA 2Y30A 2IBDA 2FX0A 3BJBA 2G7SA 4OD4A 2GUHA 2G7GA 2VKVA 5F1JA 2HKUA 3FK6A 4DVYP 2PBXA 2WV1A 4NELA 5FKLA 5IOYA 4W1UA 3LSJA 2ZCMA 5FKKA 3MNLA 2UXPA 2REKA 2XGDA 1QPIA 2UXIA 2WGBA 3ZQHA 3BR3A 5GPAA 5K7HA 3VVZA 3VVYA 2PFVA 4M3EA 3P9TA 3VIBA 2IAIA 4UDSA 2V57A 4GCTA 5D19A 2G7LA 2QKOA 3VVXA 5F0FA 1QVUA 3JSJA 3CJDA 2VPRA 3S5RA 2YVXA 3VW0A 5EFYA 2VKEA 3B81A 2D6YA 2NS7A 5EZGA 1U9NA 4WIBA 5FHPA 4PXIA 3CWRA 1T56A 2ZOZA 3F1BA 3BTIA 5F04A 3FIWA 3IUVA 3ZQLA 2RAEA 2OI8A 3HTAA 1U9OA 5IPAA 3HIMA 2R7RA 2O7TA 2R7QA 1A6IA 1JT6A 3NPIA 3BR5A 3Q0WA 2X9DA 4JNNA 2ZCXA 2IEKA 5GPCA 5CW8A 5HSZA 3EUPA 3FRQA 5FGLA 3PM1A 3IH2A 3FHNA 3ON2A 5F0HA 3BQZA 4V2FA 3NRGA 3KNWA 2ZCNA 3O8GA 5GP9A 2PZ9A 3NI7A 4U9NA 3DU5A 2TCTA 2QTQA 4D7NA 2ZY9A 3ZQGA 3BRUA 2RHAA 5J1UA 1JUSA 4M3DA 5CXGA 3C2BA 1UI5A 3Q0VA 5IP6A 2O7OA 2QCOA 3DU6A 3O60A 4X1EA 5J1YA 3G1MA 2ZOYA 4B1RA 3G56A
chains in the Genus database with same CATH topology
3ANPA 3QBMA 3DPJA 4MXMA 5EYRA 4XK4A 2HYTA 1ZKGA 2I10A 3BTCA 2HYJA 3VW2A 4YZEA 3DEWA 1QVTA 3BR0A 3QQAA 3QPSA 4V2GA 3BR1A 2NP5A 3LHQA 3QPLA 1SGMA 3BR6A 3KZ9A 3LSRA 2W53A 2HQ5A 3GEUA 2QWTA 4DW6A 1BJZA 2NX4A 2EH3A 2Y31A 5HBUA 3ON4A 4B3AA 4L62A 3PASA 3V78A 4M3FA 3AQSA 2HXOA 3WHBA 1JTXA 1T33A 1JUMA 4ME9A 3NXCA 3VW1A 5F27A 4NN1A 2FQ4A 3KKDA 5FKMA 5H9TA 3CCYA 1ORKA 4JL3A 3FK7A 2UXOA 3G1OA 3IH3A 3AQTA 3GZIA 3CRJA 1JUPA 5FKOA 3DCFA 2QOPA 4M3GA 3PPBA 2XGEA 2FD5A 3LJLA 4AC6A 3O8HA 3SDGA 2F07A 3TP3A 3CDLA 3V6GA 3HGGA 2IU5A 2GENA 3G7RA 3HGYA 2OERA 2FBQA 5D1RA 5K58A 2ZB9A 4MO7A 1RKTA 3VP5A 3HTJA 3BR2A 5C4YA 3Q0UA 3LWJA 2XPVA 3EGQA 2WUIA 2GFNA 2UXUA 3Q3SA 4AUXA 2XPWA 3LSPA 2DTZA 2JJ7A 3BCGA 2ID3A 2UXHA 3BT9A 4GFLA 5AQCA 5CXIA 5HAWA 3ZQIA 3B6AA 2X6OA 4GFKA 3ANGA 4ICHA 4GCKA 1RKWA 2XPUA 3WHCA 2RASA 3QKXA 2G3BA 3VOXA 5FKNA 4I76A 5F0CA 3TP0A 3MVPA 3LOCA 1RPWA 4I6ZA 1VI0A 2GBYA 3BTLA 4AC0A 2FJ1A 2NS8A 4CGRA 3ZQFA 3BQYA 4AF5A 4JYKA 2HXIA 5J1RA 4ABZA 4M3BA 1ZK8A 3E7QA 4D5CA 2OF7A 5F08A 5K7FA 3BTJA 5FMPA 4MK6A 3T6NA 2Y2ZA 3F0CA 3HTHA 3IH4A 5DAJA 2TRTA 4G12A 3RD3A 4KWAA 4JKZA 1Z0XA 5D18A 1Z77A 2G0EA 2XGCA 4W97A 4D5FA 4D7MA 2ID6A 3VPRA 3C07A 3SFIA 2XDNA 4ACIA 5IOZA 2DG7A 5K7ZA 2QIBA 2XRLA 2Q24A 4GCLA 4HKUA 5J3LA 3B6CA 1UI6A 5EZHA 3NNRA 3HE0A 3KKCA 1JTYA 3VOKA 2OPTA 3G1LA 2XB5A 2YVEA 3VUQA 3COLA 2YVHA 3RH2A 1JT0A 3BNIA 2NP3A 3HTIA 2JK3A 2DG8A 3BHQA 2Y30A 2IBDA 2FX0A 3BJBA 2G7SA 2GUHA 2G7GA 2VKVA 5F1JA 2HKUA 3FK6A 2PBXA 2WV1A 4NELA 5FKLA 5IOYA 4W1UA 3LSJA 2ZCMA 5FKKA 3MNLA 2UXPA 2REKA 2XGDA 1QPIA 2UXIA 2WGBA 3ZQHA 3BR3A 5GPAA 5K7HA 3VVZA 3VVYA 4M3EA 3P9TA 3VIBA 2IAIA 4UDSA 2V57A 4GCTA 5D19A 2G7LA 2QKOA 3VVXA 5F0FA 1QVUA 3JSJA 3CJDA 2VPRA 3S5RA 3VW0A 5EFYA 2VKEA 3B81A 2D6YA 2NS7A 5EZGA 1U9NA 5FHPA 4PXIA 3CWRA 1T56A 2ZOZA 3F1BA 3BTIA 5F04A 3FIWA 3IUVA 3ZQLA 2RAEA 2OI8A 3HTAA 1U9OA 5IPAA 3HIMA 2O7TA 3NPIA 1A6IA 1JT6A 3BR5A 3Q0WA 2X9DA 4JNNA 2ZCXA 2IEKA 5GPCA 5CW8A 5HSZA 3EUPA 3FRQA 5FGLA 3PM1A 3IH2A 3ON2A 5F0HA 3BQZA 4V2FA 3NRGA 3KNWA 2ZCNA 3O8GA 5GP9A 2PZ9A 3NI7A 2TCTA 2QTQA 4D7NA 3ZQGA 3BRUA 2RHAA 5J1UA 1JUSA 4M3DA 5CXGA 3C2BA 1UI5A 3Q0VA 5IP6A 2O7OA 2QCOA 3O60A 4X1EA 5J1YA 3G1MA 2ZOYA 4B1RA 3G56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANP A;  3QBM A;  3DPJ A;  4MXM A;  5EYR A;  4XK4 A;  2HYT A;  1ZKG A;  2I10 A;  3BTC A;  2HYJ A;  3VW2 A;  4YZE A;  3DEW A;  1QVT A;  3BR0 A;  3QQA A;  3QPS A;  4V2G A;  3BR1 A;  2NP5 A;  3LHQ A;  3QPL A;  1SGM A;  3BR6 A;  3KZ9 A;  3LSR A;  2W53 A;  2HQ5 A;  3GEU A;  2QWT A;  4DW6 A;  1BJZ A;  2NX4 A;  2EH3 A;  2Y31 A;  5HBU A;  3ON4 A;  4B3A A;  4L62 A;  3PAS A;  3V78 A;  4M3F A;  3AQS A;  2HXO A;  3WHB A;  1JTX A;  1T33 A;  1JUM A;  4ME9 A;  3NXC A;  3VW1 A;  5F27 A;  4NN1 A;  2FQ4 A;  3KKD A;  5FKM A;  5H9T A;  3CCY A;  1ORK A;  4JL3 A;  3FK7 A;  2UXO A;  3G1O A;  3IH3 A;  3AQT A;  3GZI A;  3CRJ A;  1JUP A;  5FKO A;  3DCF A;  2QOP A;  4M3G A;  3PPB A;  2XGE A;  2FD5 A;  3LJL A;  4AC6 A;  3O8H A;  3SDG A;  2F07 A;  3TP3 A;  3CDL A;  3V6G A;  3HGG A;  2IU5 A;  2GEN A;  3G7R A;  3HGY A;  2OER A;  2FBQ A;  5D1R A;  5K58 A;  2ZB9 A;  4MO7 A;  1RKT A;  3VP5 A;  3HTJ A;  3BR2 A;  5C4Y A;  3Q0U A;  3LWJ A;  2XPV A;  3EGQ A;  2WUI A;  2GFN A;  2UXU A;  3Q3S A;  4AUX A;  2XPW A;  3LSP A;  2DTZ A;  2JJ7 A;  3BCG A;  2ID3 A;  2UXH A;  3BT9 A;  4GFL A;  5AQC A;  5CXI A;  5HAW A;  3ZQI A;  3B6A A;  2X6O A;  4GFK A;  3ANG A;  4ICH A;  4GCK A;  1RKW A;  2XPU A;  3WHC A;  2RAS A;  3QKX A;  2G3B A;  3VOX A;  5FKN A;  4I76 A;  5F0C A;  3TP0 A;  3MVP A;  3LOC A;  1RPW A;  4I6Z A;  1VI0 A;  2GBY A;  3BTL A;  4AC0 A;  2FJ1 A;  2NS8 A;  4CGR A;  3ZQF A;  3BQY A;  4AF5 A;  4JYK A;  2HXI A;  5J1R A;  4ABZ A;  4M3B A;  1ZK8 A;  3E7Q A;  4D5C A;  2OF7 A;  5F08 A;  5K7F A;  3BTJ A;  5FMP A;  4MK6 A;  3T6N A;  2Y2Z A;  3F0C A;  3HTH A;  3IH4 A;  5DAJ A;  2TRT A;  4G12 A;  3RD3 A;  4KWA A;  4JKZ A;  1Z0X A;  5D18 A;  1Z77 A;  2G0E A;  2XGC A;  4W97 A;  4D5F A;  4D7M A;  2ID6 A;  3VPR A;  3C07 A;  3SFI A;  2XDN A;  4ACI A;  5IOZ A;  2DG7 A;  5K7Z A;  2QIB A;  2XRL A;  2Q24 A;  4GCL A;  4HKU A;  5J3L A;  3B6C A;  1UI6 A;  5EZH A;  3NNR A;  3HE0 A;  3KKC A;  1JTY A;  3VOK A;  2OPT A;  3G1L A;  2XB5 A;  2YVE A;  3VUQ A;  3COL A;  2YVH A;  3RH2 A;  1JT0 A;  3BNI A;  2NP3 A;  3HTI A;  2JK3 A;  2DG8 A;  3BHQ A;  2Y30 A;  2IBD A;  2FX0 A;  3BJB A;  2G7S A;  2GUH A;  2G7G A;  2VKV A;  5F1J A;  2HKU A;  3FK6 A;  2PBX A;  2WV1 A;  4NEL A;  5FKL A;  5IOY A;  4W1U A;  3LSJ A;  2ZCM A;  5FKK A;  3MNL A;  2UXP A;  2REK A;  2XGD A;  1QPI A;  2UXI A;  2WGB A;  3ZQH A;  3BR3 A;  5GPA A;  5K7H A;  3VVZ A;  3VVY A;  4M3E A;  3P9T A;  3VIB A;  2IAI A;  4UDS A;  2V57 A;  4GCT A;  5D19 A;  2G7L A;  2QKO A;  3VVX A;  5F0F A;  1QVU A;  3JSJ A;  3CJD A;  2VPR A;  3S5R A;  3VW0 A;  5EFY A;  2VKE A;  3B81 A;  2D6Y A;  2NS7 A;  5EZG A;  1U9N A;  5FHP A;  4PXI A;  3CWR A;  1T56 A;  2ZOZ A;  3F1B A;  3BTI A;  5F04 A;  3FIW A;  3IUV A;  3ZQL A;  2RAE A;  2OI8 A;  3HTA A;  1U9O A;  5IPA A;  3HIM A;  2O7T A;  3NPI A;  1A6I A;  1JT6 A;  3BR5 A;  3Q0W A;  2X9D A;  4JNN A;  2ZCX A;  2IEK A;  5GPC A;  5CW8 A;  5HSZ A;  3EUP A;  3FRQ A;  5FGL A;  3PM1 A;  3IH2 A;  3ON2 A;  5F0H A;  3BQZ A;  4V2F A;  3NRG A;  3KNW A;  2ZCN A;  3O8G A;  5GP9 A;  2PZ9 A;  3NI7 A;  2TCT A;  2QTQ A;  4D7N A;  3ZQG A;  3BRU A;  2RHA A;  5J1U A;  1JUS A;  4M3D A;  5CXG A;  3C2B A;  1UI5 A;  3Q0V A;  5IP6 A;  2O7O A;  2QCO A;  3O60 A;  4X1E A;  5J1Y A;  3G1M A;  2ZOY A;  4B1R A;  3G56 A; 
#chains in the Genus database with same CATH topology
 3ANP A;  3QBM A;  3DPJ A;  4MXM A;  5EYR A;  4XK4 A;  2HYT A;  1ZKG A;  2I10 A;  2R7U A;  3BTC A;  2HYJ A;  3VW2 A;  4YZE A;  3DEW A;  1QVT A;  3BR0 A;  3QQA A;  3QPS A;  4V2G A;  3BR1 A;  2NP5 A;  3LHQ A;  3QPL A;  1SGM A;  3BR6 A;  3KZ9 A;  3LSR A;  2W53 A;  2HQ5 A;  3GEU A;  2QWT A;  3SWH A;  4DW6 A;  1BJZ A;  2NX4 A;  2EH3 A;  2Y31 A;  5HBU A;  3K8P C;  3ON4 A;  4B3A A;  4L62 A;  3PAS A;  3V78 A;  4M3F A;  3AQS A;  2HXO A;  3WHB A;  1JTX A;  1T33 A;  1JUM A;  4ME9 A;  3NXC A;  3VW1 A;  5F27 A;  4NN1 A;  2FQ4 A;  3KKD A;  5FKM A;  3KYL A;  5H9T A;  3CCY A;  4C2M A;  1ORK A;  4JL3 A;  3FK7 A;  2UXO A;  3G1O A;  3IH3 A;  3AQT A;  3GZI A;  3CRJ A;  1JUP A;  5FKO A;  3DCF A;  2QOP A;  4M3G A;  3PPB A;  2XGE A;  2FD5 A;  3LJL A;  4AC6 A;  3O8H A;  3SDG A;  2F07 A;  3TP3 A;  3CDL A;  3V6G A;  3HGG A;  2IU5 A;  2GEN A;  3G7R A;  3HGY A;  2OER A;  2FBQ A;  5D1R A;  2R7S A;  5K58 A;  2ZB9 A;  4MO7 A;  1RKT A;  3VP5 A;  3HTJ A;  3BR2 A;  5C4Y A;  3Q0U A;  4IRV A;  3LWJ A;  2XPV A;  3EGQ A;  2WUI A;  2GFN A;  2UXU A;  3Q3S A;  3VTI A;  4AUX A;  2XPW A;  3LSP A;  2DTZ A;  2JJ7 A;  3BCG A;  2ID3 A;  2UXH A;  3BT9 A;  4GFL A;  4OD5 A;  5AQC A;  5CXI A;  5HAW A;  3ZQI A;  2R7O A;  3B6A A;  2X6O A;  4GFK A;  3ANG A;  4ICH A;  4GCK A;  1RKW A;  2XPU A;  3WHC A;  2RAS A;  3QKX A;  2G3B A;  3VOX A;  5FKN A;  4I76 A;  5F0C A;  3TP0 A;  3MVP A;  2FJI 1;  3LOC A;  1RPW A;  4I6Z A;  1VI0 A;  2GBY A;  3BTL A;  4AC0 A;  2A2F X;  2FJ1 A;  3NS4 A;  2NS8 A;  4CGR A;  3ZQF A;  3BQY A;  4AF5 A;  4JYK A;  4U9L A;  2HXI A;  5J1R A;  4ABZ A;  4M3B A;  1ZK8 A;  3E7Q A;  4D5C A;  2OF7 A;  5F08 A;  2R7V A;  5K7F A;  3BTJ A;  5FMP A;  4MK6 A;  3T6N A;  2Y2Z A;  3F0C A;  3HTH A;  3IH4 A;  2R7T A;  5DAJ A;  2TRT A;  4G12 A;  5CQG A;  3RD3 A;  4KWA A;  4JKZ A;  1Z0X A;  5D18 A;  1Z77 A;  2R7W A;  2G0E A;  2XGC A;  4W97 A;  4D5F A;  4D7M A;  2ID6 A;  2B1E A;  3VPR A;  3C07 A;  3SFI A;  2XDN A;  4ACI A;  5IOZ A;  2DG7 A;  5K7Z A;  2QIB A;  2B3W A;  2XRL A;  2Q24 A;  4GCL A;  4HKU A;  5J3L A;  3B6C A;  1UI6 A;  5EZH A;  3NNR A;  3HE0 A;  3KKC A;  1JTY A;  3VOK A;  2OPT A;  3G1L A;  2XB5 A;  2YVE A;  3VUQ A;  3COL A;  2YVH A;  3RH2 A;  1JT0 A;  3BNI A;  2NP3 A;  2R7X A;  3HTI A;  2JK3 A;  2DG8 A;  3BHQ A;  2Y30 A;  2IBD A;  2FX0 A;  3BJB A;  2G7S A;  4OD4 A;  2GUH A;  2G7G A;  2VKV A;  5F1J A;  2HKU A;  3FK6 A;  4DVY P;  2PBX A;  2WV1 A;  4NEL A;  5FKL A;  5IOY A;  4W1U A;  3LSJ A;  2ZCM A;  5FKK A;  3MNL A;  2UXP A;  2REK A;  2XGD A;  1QPI A;  2UXI A;  2WGB A;  3ZQH A;  3BR3 A;  5GPA A;  5K7H A;  3VVZ A;  3VVY A;  2PFV A;  4M3E A;  3P9T A;  3VIB A;  2IAI A;  4UDS A;  2V57 A;  4GCT A;  5D19 A;  2G7L A;  2QKO A;  3VVX A;  5F0F A;  1QVU A;  3JSJ A;  3CJD A;  2VPR A;  3S5R A;  2YVX A;  3VW0 A;  5EFY A;  2VKE A;  3B81 A;  2D6Y A;  2NS7 A;  5EZG A;  1U9N A;  4WIB A;  5FHP A;  4PXI A;  3CWR A;  1T56 A;  2ZOZ A;  3F1B A;  3BTI A;  5F04 A;  3FIW A;  3IUV A;  3ZQL A;  2RAE A;  2OI8 A;  3HTA A;  1U9O A;  5IPA A;  3HIM A;  2R7R A;  2O7T A;  2R7Q A;  1A6I A;  1JT6 A;  3NPI A;  3BR5 A;  3Q0W A;  2X9D A;  4JNN A;  2ZCX A;  2IEK A;  5GPC A;  5CW8 A;  5HSZ A;  3EUP A;  3FRQ A;  5FGL A;  3PM1 A;  3IH2 A;  3FHN A;  3ON2 A;  5F0H A;  3BQZ A;  4V2F A;  3NRG A;  3KNW A;  2ZCN A;  3O8G A;  5GP9 A;  2PZ9 A;  3NI7 A;  4U9N A;  3DU5 A;  2TCT A;  2QTQ A;  4D7N A;  2ZY9 A;  3ZQG A;  3BRU A;  2RHA A;  5J1U A;  1JUS A;  4M3D A;  5CXG A;  3C2B A;  1UI5 A;  3Q0V A;  5IP6 A;  2O7O A;  2QCO A;  3DU6 A;  3O60 A;  4X1E A;  5J1Y A;  3G1M A;  2ZOY A;  4B1R A;  3G56 A; 
#chains in the Genus database with same CATH homology
 3ANP A;  3QBM A;  3DPJ A;  4MXM A;  5EYR A;  4XK4 A;  2HYT A;  1ZKG A;  2I10 A;  3BTC A;  2HYJ A;  3VW2 A;  4YZE A;  3DEW A;  1QVT A;  3BR0 A;  3QQA A;  3QPS A;  4V2G A;  3BR1 A;  2NP5 A;  3LHQ A;  3QPL A;  1SGM A;  3BR6 A;  3KZ9 A;  3LSR A;  2W53 A;  2HQ5 A;  3GEU A;  2QWT A;  4DW6 A;  1BJZ A;  2NX4 A;  2EH3 A;  2Y31 A;  5HBU A;  3ON4 A;  4B3A A;  4L62 A;  3PAS A;  3V78 A;  4M3F A;  3AQS A;  2HXO A;  3WHB A;  1JTX A;  1T33 A;  1JUM A;  4ME9 A;  3NXC A;  3VW1 A;  5F27 A;  4NN1 A;  2FQ4 A;  3KKD A;  5FKM A;  5H9T A;  3CCY A;  1ORK A;  4JL3 A;  3FK7 A;  2UXO A;  3G1O A;  3IH3 A;  3AQT A;  3GZI A;  3CRJ A;  1JUP A;  5FKO A;  3DCF A;  2QOP A;  4M3G A;  3PPB A;  2XGE A;  2FD5 A;  3LJL A;  4AC6 A;  3O8H A;  3SDG A;  2F07 A;  3TP3 A;  3CDL A;  3V6G A;  3HGG A;  2IU5 A;  2GEN A;  3G7R A;  3HGY A;  2OER A;  2FBQ A;  5D1R A;  5K58 A;  2ZB9 A;  4MO7 A;  1RKT A;  3VP5 A;  3HTJ A;  3BR2 A;  5C4Y A;  3Q0U A;  3LWJ A;  2XPV A;  3EGQ A;  2WUI A;  2GFN A;  2UXU A;  3Q3S A;  4AUX A;  2XPW A;  3LSP A;  2DTZ A;  2JJ7 A;  3BCG A;  2ID3 A;  2UXH A;  3BT9 A;  4GFL A;  5AQC A;  5CXI A;  5HAW A;  3ZQI A;  3B6A A;  2X6O A;  4GFK A;  3ANG A;  4ICH A;  4GCK A;  1RKW A;  2XPU A;  3WHC A;  2RAS A;  3QKX A;  2G3B A;  3VOX A;  5FKN A;  4I76 A;  5F0C A;  3TP0 A;  3MVP A;  3LOC A;  1RPW A;  4I6Z A;  1VI0 A;  2GBY A;  3BTL A;  4AC0 A;  2FJ1 A;  2NS8 A;  4CGR A;  3ZQF A;  3BQY A;  4AF5 A;  4JYK A;  2HXI A;  5J1R A;  4ABZ A;  4M3B A;  1ZK8 A;  3E7Q A;  4D5C A;  2OF7 A;  5F08 A;  5K7F A;  3BTJ A;  5FMP A;  4MK6 A;  3T6N A;  2Y2Z A;  3F0C A;  3HTH A;  3IH4 A;  5DAJ A;  2TRT A;  4G12 A;  3RD3 A;  4KWA A;  4JKZ A;  1Z0X A;  5D18 A;  1Z77 A;  2G0E A;  2XGC A;  4W97 A;  4D5F A;  4D7M A;  2ID6 A;  3VPR A;  3C07 A;  3SFI A;  2XDN A;  4ACI A;  5IOZ A;  2DG7 A;  5K7Z A;  2QIB A;  2XRL A;  2Q24 A;  4GCL A;  4HKU A;  5J3L A;  3B6C A;  1UI6 A;  5EZH A;  3NNR A;  3HE0 A;  3KKC A;  1JTY A;  3VOK A;  2OPT A;  3G1L A;  2XB5 A;  2YVE A;  3VUQ A;  3COL A;  2YVH A;  3RH2 A;  1JT0 A;  3BNI A;  2NP3 A;  3HTI A;  2JK3 A;  2DG8 A;  3BHQ A;  2Y30 A;  2IBD A;  2FX0 A;  3BJB A;  2G7S A;  2GUH A;  2G7G A;  2VKV A;  5F1J A;  2HKU A;  3FK6 A;  2PBX A;  2WV1 A;  4NEL A;  5FKL A;  5IOY A;  4W1U A;  3LSJ A;  2ZCM A;  5FKK A;  3MNL A;  2UXP A;  2REK A;  2XGD A;  1QPI A;  2UXI A;  2WGB A;  3ZQH A;  3BR3 A;  5GPA A;  5K7H A;  3VVZ A;  3VVY A;  4M3E A;  3P9T A;  3VIB A;  2IAI A;  4UDS A;  2V57 A;  4GCT A;  5D19 A;  2G7L A;  2QKO A;  3VVX A;  5F0F A;  1QVU A;  3JSJ A;  3CJD A;  2VPR A;  3S5R A;  3VW0 A;  5EFY A;  2VKE A;  3B81 A;  2D6Y A;  2NS7 A;  5EZG A;  1U9N A;  5FHP A;  4PXI A;  3CWR A;  1T56 A;  2ZOZ A;  3F1B A;  3BTI A;  5F04 A;  3FIW A;  3IUV A;  3ZQL A;  2RAE A;  2OI8 A;  3HTA A;  1U9O A;  5IPA A;  3HIM A;  2O7T A;  3NPI A;  1A6I A;  1JT6 A;  3BR5 A;  3Q0W A;  2X9D A;  4JNN A;  2ZCX A;  2IEK A;  5GPC A;  5CW8 A;  5HSZ A;  3EUP A;  3FRQ A;  5FGL A;  3PM1 A;  3IH2 A;  3ON2 A;  5F0H A;  3BQZ A;  4V2F A;  3NRG A;  3KNW A;  2ZCN A;  3O8G A;  5GP9 A;  2PZ9 A;  3NI7 A;  2TCT A;  2QTQ A;  4D7N A;  3ZQG A;  3BRU A;  2RHA A;  5J1U A;  1JUS A;  4M3D A;  5CXG A;  3C2B A;  1UI5 A;  3Q0V A;  5IP6 A;  2O7O A;  2QCO A;  3O60 A;  4X1E A;  5J1Y A;  3G1M A;  2ZOY A;  4B1R A;  3G56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...