5CXGA

Crystal structure of mycobacterium tuberculosis kstr in complex with peg
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
SEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxgA00
5EZGA 3HTAA 4ICHA 4I76A 2IBDA 4GFKA 3COLA 3KNWA 2FQ4A 5K7ZA 3HTIA 3BQZA 3RH2A 2FX0A 4UDSA 2ZOZA 4M3DA 3HGGA 2IU5A 5HAWA 3BR5A 2F07A 3MVPA 4KWAA 5HBUA 1U9NA 3B81A 2HXIA 2TCTA 1JT0A 2VPRA 4AF5A 3VOKA 3QQAA 3F1BA 2G7LA 2X9DA 3EUPA 2GBYA 4D7NA 5EZHA 3BTJA 5D19A 2UXUA 2UXHA 4GCLA 3S5RA 4L62A 2HYTA 3Q3SA 2O7TA 3Q0WA 1SGMA 3BTIA 3LOCA 3ON2A 3TP0A 4JKZA 5FHPA 3QPSA 3V6GA 1T56A 3WHCA 3EGQA 4GFLA 5CW8A 3QPLA 3CRJA 5F04A 3B6CA 3CCYA 4B1RA 2HKUA 1JTXA 2RAEA 5J1RA 3V78A 3MNLA 5J1UA 1Z0XA 3LWJA 2ID6A 2QKOA 5IPAA 3PPBA 4I6ZA 1JUSA 1JUPA 5FKOA 3ZQGA 2ZCXA 2XGDA 4V2GA 1BJZA 4HKUA 2GFNA 5FGLA 2WV1A 5IOZA 3HIMA 3LJLA 3BR3A 3FRQA 3BCGA 2D6YA 4AC0A 3VUQA 3O8GA 1VI0A 2XPUA 3AQTA 3IH4A 5IOYA 4XK4A 2QCOA 5J1YA 4JNNA 3LHQA 5D18A 2YVHA 5F0CA 1UI5A 2NX4A 2Y31A 5GPAA 5FKLA 4DW6A 5F0FA 3VIBA 2QOPA 5AQCA 3C07A 3BRUA 3DEWA 3BR0A 3BTLA 2HYJA 4GCKA 3VPRA 3VOXA 3DCFA 5FKMA 3JSJA 3G7RA 4CGRA 2DTZA 2NS8A 3ZQHA 2JJ7A 3HGYA 3NNRA 5F08A 3HTHA 5GPCA 5D1RA 2I10A 2FJ1A 2OF7A 3ZQLA 3Q0VA 3IH2A 2NP5A 2X6OA 3LSPA 2XRLA 3BR2A 3ZQFA 1ORKA 4M3FA 5CXGA 4D7MA 2ZB9A 3BTCA 2QIBA 2GENA 3RD3A 2PZ9A 2IEKA 5K7FA 4ME9A 2HXOA 2Y30A 3CJDA 3KKCA 3CWRA 4AC6A 4M3EA 5EYRA 1Z77A 3KKDA 3ANPA 5FKNA 3BR6A 2UXOA 2UXIA 3VVYA 4NN1A 4ABZA 5IP6A 3BQYA 1JTYA 4MXMA 3SFIA 2ZCNA 3VVXA 3BNIA 1RKTA 2XPVA 2XPWA 3IUVA 2V57A 3HE0A 5CXIA 3Q0UA 5J3LA 5F27A 2WUIA 1UI6A 1ZKGA 4X1EA 4AUXA 2YVEA 3ON4A 3PM1A 3CDLA 2ZCMA 2QTQA 2ZOYA 3FIWA 3G1LA 5DAJA 2OI8A 5GP9A 1T33A 1QVUA 3LSJA 1RKWA 3BJBA 4W1UA 3SDGA 2FD5A 5K58A 4D5CA 1U9OA 4G12A 1QVTA 2XDNA 4W97A 2QWTA 4MO7A 2OERA 4JL3A 2DG8A 2HQ5A 1A6IA 3LSRA 3NI7A 3F0CA 2OPTA 1JT6A 3NRGA 2W53A 2WGBA 3QBMA 3BT9A 3FK7A 3VW1A 3GEUA 5HSZA 4MK6A 2Q24A 3HTJA 1QPIA 2PBXA 4M3GA 1RPWA 5EFYA 5FKKA 5K7HA 3IH3A 3P9TA 3NPIA 2FBQA 2XB5A 2DG7A 3VW0A 2GUHA 2VKVA 3FK6A 5FMPA 2EH3A 4PXIA 3BHQA 2G7GA 4D5FA 4YZEA 3WHBA 3O8HA 2TRTA 2JK3A 3G56A 4GCTA 2G0EA 3GZIA 4M3BA 5F0HA 3G1OA 4V2FA 2REKA 2RASA 2UXPA 3O60A 2IAIA 2O7OA 2ID3A 3B6AA 2VKEA 3NXCA 4NELA 3KZ9A 2XGCA 5F1JA 3ANGA 2G3BA 3E7QA 2Y2ZA 4JYKA 1JUMA 3AQSA 2NS7A 5H9TA 3T6NA 3VP5A 3BR1A 2RHAA 3PASA 3VVZA 3C2BA 4ACIA 3G1MA 3DPJA 3ZQIA 3VW2A 5C4YA 2G7SA 3QKXA 1ZK8A 3TP3A 2XGEA 2NP3A 4B3AA
chains in the Genus database with same CATH superfamily
2FJI1 5EZGA 3HTAA 4ICHA 4I76A 2IBDA 4GFKA 3COLA 3KNWA 2FQ4A 5K7ZA 3HTIA 3BQZA 3RH2A 4U9LA 2FX0A 4UDSA 2ZOZA 4M3DA 3HGGA 2IU5A 5HAWA 3VTIA 3BR5A 2F07A 3MVPA 4KWAA 5HBUA 1U9NA 3B81A 2HXIA 2TCTA 1JT0A 2VPRA 4AF5A 3VOKA 3QQAA 3F1BA 2G7LA 2X9DA 3EUPA 2GBYA 4D7NA 2PFVA 5EZHA 3BTJA 2R7VA 5D19A 2UXUA 2UXHA 4GCLA 3S5RA 3SWHA 4L62A 2HYTA 3Q3SA 2O7TA 3Q0WA 1SGMA 3NS4A 3BTIA 3DU6A 3LOCA 3ON2A 3TP0A 4JKZA 5FHPA 3QPSA 3V6GA 1T56A 3WHCA 3EGQA 4GFLA 5CW8A 3QPLA 3CRJA 5F04A 3B6CA 3CCYA 4B1RA 2HKUA 1JTXA 2RAEA 5J1RA 3V78A 3MNLA 5J1UA 1Z0XA 3LWJA 4OD4A 2ID6A 2QKOA 3K8PC 5IPAA 3PPBA 4I6ZA 3DU5A 1JUSA 1JUPA 5FKOA 3ZQGA 2ZCXA 2XGDA 4V2GA 1BJZA 4HKUA 2GFNA 5FGLA 2WV1A 5IOZA 3HIMA 3LJLA 3BR3A 3FRQA 3BCGA 2D6YA 4AC0A 3VUQA 3O8GA 1VI0A 2XPUA 3AQTA 3IH4A 5IOYA 3FHNA 4XK4A 2QCOA 5J1YA 4JNNA 3LHQA 5D18A 2YVHA 5F0CA 1UI5A 2NX4A 2Y31A 5GPAA 5FKLA 4DW6A 5F0FA 3VIBA 2QOPA 5AQCA 3C07A 3BRUA 3DEWA 3BR0A 3BTLA 2HYJA 4GCKA 3VPRA 3VOXA 3DCFA 5FKMA 3KYLA 3JSJA 3G7RA 4CGRA 2DTZA 2NS8A 3ZQHA 2JJ7A 3HGYA 3NNRA 5F08A 3HTHA 5GPCA 5D1RA 2I10A 2FJ1A 2OF7A 3ZQLA 3Q0VA 3IH2A 2NP5A 2X6OA 3LSPA 2XRLA 3BR2A 3ZQFA 4OD5A 2R7RA 1ORKA 4M3FA 5CXGA 2R7XA 2B3WA 4D7MA 2ZB9A 3BTCA 2QIBA 2GENA 3RD3A 2PZ9A 2IEKA 5K7FA 4ME9A 2HXOA 2Y30A 3CJDA 3KKCA 3CWRA 4AC6A 4M3EA 5EYRA 1Z77A 3KKDA 3ANPA 5FKNA 3BR6A 2UXOA 2R7QA 2UXIA 3VVYA 4NN1A 4ABZA 5IP6A 3BQYA 1JTYA 4MXMA 3SFIA 2ZCNA 3VVXA 3BNIA 1RKTA 2XPVA 2XPWA 3IUVA 2V57A 3HE0A 5CXIA 3Q0UA 5J3LA 5F27A 2WUIA 1UI6A 1ZKGA 4X1EA 4AUXA 2YVXA 2YVEA 2R7OA 3ON4A 5CQGA 3PM1A 3CDLA 2ZCMA 2QTQA 2ZOYA 3FIWA 3G1LA 5DAJA 2OI8A 5GP9A 2B1EA 1T33A 1QVUA 3LSJA 4C2MA 2ZY9A 1RKWA 3BJBA 4W1UA 3SDGA 2FD5A 5K58A 4D5CA 1U9OA 2R7TA 4G12A 1QVTA 4U9NA 2XDNA 4W97A 2QWTA 4MO7A 2OERA 4JL3A 2DG8A 2HQ5A 1A6IA 3LSRA 3NI7A 3F0CA 2OPTA 1JT6A 3NRGA 2W53A 2WGBA 2R7SA 2R7UA 3QBMA 3BT9A 3FK7A 4DVYP 3VW1A 3GEUA 5HSZA 4MK6A 2Q24A 3HTJA 1QPIA 2PBXA 4M3GA 1RPWA 5EFYA 5FKKA 5K7HA 3IH3A 3P9TA 3NPIA 2FBQA 2XB5A 2DG7A 3VW0A 2GUHA 2VKVA 3FK6A 5FMPA 2EH3A 4PXIA 3BHQA 2G7GA 4D5FA 4YZEA 3WHBA 3O8HA 2A2FX 2TRTA 2JK3A 3G56A 4GCTA 2G0EA 3GZIA 4M3BA 5F0HA 3G1OA 4V2FA 2REKA 2RASA 4IRVA 2UXPA 3O60A 2IAIA 2O7OA 2R7WA 2ID3A 3B6AA 2VKEA 3NXCA 4NELA 3KZ9A 2XGCA 5F1JA 3ANGA 2G3BA 3E7QA 2Y2ZA 4JYKA 1JUMA 3AQSA 2NS7A 4WIBA 5H9TA 3T6NA 3VP5A 3BR1A 2RHAA 3PASA 3VVZA 3C2BA 4ACIA 3G1MA 3DPJA 3ZQIA 3VW2A 5C4YA 2G7SA 3QKXA 1ZK8A 3TP3A 2XGEA 2NP3A 4B3AA
chains in the Genus database with same CATH topology
5EZGA 3HTAA 4ICHA 4I76A 2IBDA 4GFKA 3COLA 3KNWA 2FQ4A 5K7ZA 3HTIA 3BQZA 3RH2A 2FX0A 4UDSA 2ZOZA 4M3DA 3HGGA 2IU5A 5HAWA 3BR5A 2F07A 3MVPA 4KWAA 5HBUA 1U9NA 3B81A 2HXIA 2TCTA 1JT0A 2VPRA 4AF5A 3VOKA 3QQAA 3F1BA 2G7LA 2X9DA 3EUPA 2GBYA 4D7NA 5EZHA 3BTJA 5D19A 2UXUA 2UXHA 4GCLA 3S5RA 4L62A 2HYTA 3Q3SA 2O7TA 3Q0WA 1SGMA 3BTIA 3LOCA 3ON2A 3TP0A 4JKZA 5FHPA 3QPSA 3V6GA 1T56A 3WHCA 3EGQA 4GFLA 5CW8A 3QPLA 3CRJA 5F04A 3B6CA 3CCYA 4B1RA 2HKUA 1JTXA 2RAEA 5J1RA 3V78A 3MNLA 5J1UA 1Z0XA 3LWJA 2ID6A 2QKOA 5IPAA 3PPBA 4I6ZA 1JUSA 1JUPA 5FKOA 3ZQGA 2ZCXA 2XGDA 4V2GA 1BJZA 4HKUA 2GFNA 5FGLA 2WV1A 5IOZA 3HIMA 3LJLA 3BR3A 3FRQA 3BCGA 2D6YA 4AC0A 3VUQA 3O8GA 1VI0A 2XPUA 3AQTA 3IH4A 5IOYA 4XK4A 2QCOA 5J1YA 4JNNA 3LHQA 5D18A 2YVHA 5F0CA 1UI5A 2NX4A 2Y31A 5GPAA 5FKLA 4DW6A 5F0FA 3VIBA 2QOPA 5AQCA 3C07A 3BRUA 3DEWA 3BR0A 3BTLA 2HYJA 4GCKA 3VPRA 3VOXA 3DCFA 5FKMA 3JSJA 3G7RA 4CGRA 2DTZA 2NS8A 3ZQHA 2JJ7A 3HGYA 3NNRA 5F08A 3HTHA 5GPCA 5D1RA 2I10A 2FJ1A 2OF7A 3ZQLA 3Q0VA 3IH2A 2NP5A 2X6OA 3LSPA 2XRLA 3BR2A 3ZQFA 1ORKA 4M3FA 5CXGA 4D7MA 2ZB9A 3BTCA 2QIBA 2GENA 3RD3A 2PZ9A 2IEKA 5K7FA 4ME9A 2HXOA 2Y30A 3CJDA 3KKCA 3CWRA 4AC6A 4M3EA 5EYRA 1Z77A 3KKDA 3ANPA 5FKNA 3BR6A 2UXOA 2UXIA 3VVYA 4NN1A 4ABZA 5IP6A 3BQYA 1JTYA 4MXMA 3SFIA 2ZCNA 3VVXA 3BNIA 1RKTA 2XPVA 2XPWA 3IUVA 2V57A 3HE0A 5CXIA 3Q0UA 5J3LA 5F27A 2WUIA 1UI6A 1ZKGA 4X1EA 4AUXA 2YVEA 3ON4A 3PM1A 3CDLA 2ZCMA 2QTQA 2ZOYA 3FIWA 3G1LA 5DAJA 2OI8A 5GP9A 1T33A 1QVUA 3LSJA 1RKWA 3BJBA 4W1UA 3SDGA 2FD5A 5K58A 4D5CA 1U9OA 4G12A 1QVTA 2XDNA 4W97A 2QWTA 4MO7A 2OERA 4JL3A 2DG8A 2HQ5A 1A6IA 3LSRA 3NI7A 3F0CA 2OPTA 1JT6A 3NRGA 2W53A 2WGBA 3QBMA 3BT9A 3FK7A 3VW1A 3GEUA 5HSZA 4MK6A 2Q24A 3HTJA 1QPIA 2PBXA 4M3GA 1RPWA 5EFYA 5FKKA 5K7HA 3IH3A 3P9TA 3NPIA 2FBQA 2XB5A 2DG7A 3VW0A 2GUHA 2VKVA 3FK6A 5FMPA 2EH3A 4PXIA 3BHQA 2G7GA 4D5FA 4YZEA 3WHBA 3O8HA 2TRTA 2JK3A 3G56A 4GCTA 2G0EA 3GZIA 4M3BA 5F0HA 3G1OA 4V2FA 2REKA 2RASA 2UXPA 3O60A 2IAIA 2O7OA 2ID3A 3B6AA 2VKEA 3NXCA 4NELA 3KZ9A 2XGCA 5F1JA 3ANGA 2G3BA 3E7QA 2Y2ZA 4JYKA 1JUMA 3AQSA 2NS7A 5H9TA 3T6NA 3VP5A 3BR1A 2RHAA 3PASA 3VVZA 3C2BA 4ACIA 3G1MA 3DPJA 3ZQIA 3VW2A 5C4YA 2G7SA 3QKXA 1ZK8A 3TP3A 2XGEA 2NP3A 4B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EZG A;  3HTA A;  4ICH A;  4I76 A;  2IBD A;  4GFK A;  3COL A;  3KNW A;  2FQ4 A;  5K7Z A;  3HTI A;  3BQZ A;  3RH2 A;  2FX0 A;  4UDS A;  2ZOZ A;  4M3D A;  3HGG A;  2IU5 A;  5HAW A;  3BR5 A;  2F07 A;  3MVP A;  4KWA A;  5HBU A;  1U9N A;  3B81 A;  2HXI A;  2TCT A;  1JT0 A;  2VPR A;  4AF5 A;  3VOK A;  3QQA A;  3F1B A;  2G7L A;  2X9D A;  3EUP A;  2GBY A;  4D7N A;  5EZH A;  3BTJ A;  5D19 A;  2UXU A;  2UXH A;  4GCL A;  3S5R A;  4L62 A;  2HYT A;  3Q3S A;  2O7T A;  3Q0W A;  1SGM A;  3BTI A;  3LOC A;  3ON2 A;  3TP0 A;  4JKZ A;  5FHP A;  3QPS A;  3V6G A;  1T56 A;  3WHC A;  3EGQ A;  4GFL A;  5CW8 A;  3QPL A;  3CRJ A;  5F04 A;  3B6C A;  3CCY A;  4B1R A;  2HKU A;  1JTX A;  2RAE A;  5J1R A;  3V78 A;  3MNL A;  5J1U A;  1Z0X A;  3LWJ A;  2ID6 A;  2QKO A;  5IPA A;  3PPB A;  4I6Z A;  1JUS A;  1JUP A;  5FKO A;  3ZQG A;  2ZCX A;  2XGD A;  4V2G A;  1BJZ A;  4HKU A;  2GFN A;  5FGL A;  2WV1 A;  5IOZ A;  3HIM A;  3LJL A;  3BR3 A;  3FRQ A;  3BCG A;  2D6Y A;  4AC0 A;  3VUQ A;  3O8G A;  1VI0 A;  2XPU A;  3AQT A;  3IH4 A;  5IOY A;  4XK4 A;  2QCO A;  5J1Y A;  4JNN A;  3LHQ A;  5D18 A;  2YVH A;  5F0C A;  1UI5 A;  2NX4 A;  2Y31 A;  5GPA A;  5FKL A;  4DW6 A;  5F0F A;  3VIB A;  2QOP A;  5AQC A;  3C07 A;  3BRU A;  3DEW A;  3BR0 A;  3BTL A;  2HYJ A;  4GCK A;  3VPR A;  3VOX A;  3DCF A;  5FKM A;  3JSJ A;  3G7R A;  4CGR A;  2DTZ A;  2NS8 A;  3ZQH A;  2JJ7 A;  3HGY A;  3NNR A;  5F08 A;  3HTH A;  5GPC A;  5D1R A;  2I10 A;  2FJ1 A;  2OF7 A;  3ZQL A;  3Q0V A;  3IH2 A;  2NP5 A;  2X6O A;  3LSP A;  2XRL A;  3BR2 A;  3ZQF A;  1ORK A;  4M3F A;  5CXG A;  4D7M A;  2ZB9 A;  3BTC A;  2QIB A;  2GEN A;  3RD3 A;  2PZ9 A;  2IEK A;  5K7F A;  4ME9 A;  2HXO A;  2Y30 A;  3CJD A;  3KKC A;  3CWR A;  4AC6 A;  4M3E A;  5EYR A;  1Z77 A;  3KKD A;  3ANP A;  5FKN A;  3BR6 A;  2UXO A;  2UXI A;  3VVY A;  4NN1 A;  4ABZ A;  5IP6 A;  3BQY A;  1JTY A;  4MXM A;  3SFI A;  2ZCN A;  3VVX A;  3BNI A;  1RKT A;  2XPV A;  2XPW A;  3IUV A;  2V57 A;  3HE0 A;  5CXI A;  3Q0U A;  5J3L A;  5F27 A;  2WUI A;  1UI6 A;  1ZKG A;  4X1E A;  4AUX A;  2YVE A;  3ON4 A;  3PM1 A;  3CDL A;  2ZCM A;  2QTQ A;  2ZOY A;  3FIW A;  3G1L A;  5DAJ A;  2OI8 A;  5GP9 A;  1T33 A;  1QVU A;  3LSJ A;  1RKW A;  3BJB A;  4W1U A;  3SDG A;  2FD5 A;  5K58 A;  4D5C A;  1U9O A;  4G12 A;  1QVT A;  2XDN A;  4W97 A;  2QWT A;  4MO7 A;  2OER A;  4JL3 A;  2DG8 A;  2HQ5 A;  1A6I A;  3LSR A;  3NI7 A;  3F0C A;  2OPT A;  1JT6 A;  3NRG A;  2W53 A;  2WGB A;  3QBM A;  3BT9 A;  3FK7 A;  3VW1 A;  3GEU A;  5HSZ A;  4MK6 A;  2Q24 A;  3HTJ A;  1QPI A;  2PBX A;  4M3G A;  1RPW A;  5EFY A;  5FKK A;  5K7H A;  3IH3 A;  3P9T A;  3NPI A;  2FBQ A;  2XB5 A;  2DG7 A;  3VW0 A;  2GUH A;  2VKV A;  3FK6 A;  5FMP A;  2EH3 A;  4PXI A;  3BHQ A;  2G7G A;  4D5F A;  4YZE A;  3WHB A;  3O8H A;  2TRT A;  2JK3 A;  3G56 A;  4GCT A;  2G0E A;  3GZI A;  4M3B A;  5F0H A;  3G1O A;  4V2F A;  2REK A;  2RAS A;  2UXP A;  3O60 A;  2IAI A;  2O7O A;  2ID3 A;  3B6A A;  2VKE A;  3NXC A;  4NEL A;  3KZ9 A;  2XGC A;  5F1J A;  3ANG A;  2G3B A;  3E7Q A;  2Y2Z A;  4JYK A;  1JUM A;  3AQS A;  2NS7 A;  5H9T A;  3T6N A;  3VP5 A;  3BR1 A;  2RHA A;  3PAS A;  3VVZ A;  3C2B A;  4ACI A;  3G1M A;  3DPJ A;  3ZQI A;  3VW2 A;  5C4Y A;  2G7S A;  3QKX A;  1ZK8 A;  3TP3 A;  2XGE A;  2NP3 A;  4B3A A; 
#chains in the Genus database with same CATH topology
 2FJI 1;  5EZG A;  3HTA A;  4ICH A;  4I76 A;  2IBD A;  4GFK A;  3COL A;  3KNW A;  2FQ4 A;  5K7Z A;  3HTI A;  3BQZ A;  3RH2 A;  4U9L A;  2FX0 A;  4UDS A;  2ZOZ A;  4M3D A;  3HGG A;  2IU5 A;  5HAW A;  3VTI A;  3BR5 A;  2F07 A;  3MVP A;  4KWA A;  5HBU A;  1U9N A;  3B81 A;  2HXI A;  2TCT A;  1JT0 A;  2VPR A;  4AF5 A;  3VOK A;  3QQA A;  3F1B A;  2G7L A;  2X9D A;  3EUP A;  2GBY A;  4D7N A;  2PFV A;  5EZH A;  3BTJ A;  2R7V A;  5D19 A;  2UXU A;  2UXH A;  4GCL A;  3S5R A;  3SWH A;  4L62 A;  2HYT A;  3Q3S A;  2O7T A;  3Q0W A;  1SGM A;  3NS4 A;  3BTI A;  3DU6 A;  3LOC A;  3ON2 A;  3TP0 A;  4JKZ A;  5FHP A;  3QPS A;  3V6G A;  1T56 A;  3WHC A;  3EGQ A;  4GFL A;  5CW8 A;  3QPL A;  3CRJ A;  5F04 A;  3B6C A;  3CCY A;  4B1R A;  2HKU A;  1JTX A;  2RAE A;  5J1R A;  3V78 A;  3MNL A;  5J1U A;  1Z0X A;  3LWJ A;  4OD4 A;  2ID6 A;  2QKO A;  3K8P C;  5IPA A;  3PPB A;  4I6Z A;  3DU5 A;  1JUS A;  1JUP A;  5FKO A;  3ZQG A;  2ZCX A;  2XGD A;  4V2G A;  1BJZ A;  4HKU A;  2GFN A;  5FGL A;  2WV1 A;  5IOZ A;  3HIM A;  3LJL A;  3BR3 A;  3FRQ A;  3BCG A;  2D6Y A;  4AC0 A;  3VUQ A;  3O8G A;  1VI0 A;  2XPU A;  3AQT A;  3IH4 A;  5IOY A;  3FHN A;  4XK4 A;  2QCO A;  5J1Y A;  4JNN A;  3LHQ A;  5D18 A;  2YVH A;  5F0C A;  1UI5 A;  2NX4 A;  2Y31 A;  5GPA A;  5FKL A;  4DW6 A;  5F0F A;  3VIB A;  2QOP A;  5AQC A;  3C07 A;  3BRU A;  3DEW A;  3BR0 A;  3BTL A;  2HYJ A;  4GCK A;  3VPR A;  3VOX A;  3DCF A;  5FKM A;  3KYL A;  3JSJ A;  3G7R A;  4CGR A;  2DTZ A;  2NS8 A;  3ZQH A;  2JJ7 A;  3HGY A;  3NNR A;  5F08 A;  3HTH A;  5GPC A;  5D1R A;  2I10 A;  2FJ1 A;  2OF7 A;  3ZQL A;  3Q0V A;  3IH2 A;  2NP5 A;  2X6O A;  3LSP A;  2XRL A;  3BR2 A;  3ZQF A;  4OD5 A;  2R7R A;  1ORK A;  4M3F A;  5CXG A;  2R7X A;  2B3W A;  4D7M A;  2ZB9 A;  3BTC A;  2QIB A;  2GEN A;  3RD3 A;  2PZ9 A;  2IEK A;  5K7F A;  4ME9 A;  2HXO A;  2Y30 A;  3CJD A;  3KKC A;  3CWR A;  4AC6 A;  4M3E A;  5EYR A;  1Z77 A;  3KKD A;  3ANP A;  5FKN A;  3BR6 A;  2UXO A;  2R7Q A;  2UXI A;  3VVY A;  4NN1 A;  4ABZ A;  5IP6 A;  3BQY A;  1JTY A;  4MXM A;  3SFI A;  2ZCN A;  3VVX A;  3BNI A;  1RKT A;  2XPV A;  2XPW A;  3IUV A;  2V57 A;  3HE0 A;  5CXI A;  3Q0U A;  5J3L A;  5F27 A;  2WUI A;  1UI6 A;  1ZKG A;  4X1E A;  4AUX A;  2YVX A;  2YVE A;  2R7O A;  3ON4 A;  5CQG A;  3PM1 A;  3CDL A;  2ZCM A;  2QTQ A;  2ZOY A;  3FIW A;  3G1L A;  5DAJ A;  2OI8 A;  5GP9 A;  2B1E A;  1T33 A;  1QVU A;  3LSJ A;  4C2M A;  2ZY9 A;  1RKW A;  3BJB A;  4W1U A;  3SDG A;  2FD5 A;  5K58 A;  4D5C A;  1U9O A;  2R7T A;  4G12 A;  1QVT A;  4U9N A;  2XDN A;  4W97 A;  2QWT A;  4MO7 A;  2OER A;  4JL3 A;  2DG8 A;  2HQ5 A;  1A6I A;  3LSR A;  3NI7 A;  3F0C A;  2OPT A;  1JT6 A;  3NRG A;  2W53 A;  2WGB A;  2R7S A;  2R7U A;  3QBM A;  3BT9 A;  3FK7 A;  4DVY P;  3VW1 A;  3GEU A;  5HSZ A;  4MK6 A;  2Q24 A;  3HTJ A;  1QPI A;  2PBX A;  4M3G A;  1RPW A;  5EFY A;  5FKK A;  5K7H A;  3IH3 A;  3P9T A;  3NPI A;  2FBQ A;  2XB5 A;  2DG7 A;  3VW0 A;  2GUH A;  2VKV A;  3FK6 A;  5FMP A;  2EH3 A;  4PXI A;  3BHQ A;  2G7G A;  4D5F A;  4YZE A;  3WHB A;  3O8H A;  2A2F X;  2TRT A;  2JK3 A;  3G56 A;  4GCT A;  2G0E A;  3GZI A;  4M3B A;  5F0H A;  3G1O A;  4V2F A;  2REK A;  2RAS A;  4IRV A;  2UXP A;  3O60 A;  2IAI A;  2O7O A;  2R7W A;  2ID3 A;  3B6A A;  2VKE A;  3NXC A;  4NEL A;  3KZ9 A;  2XGC A;  5F1J A;  3ANG A;  2G3B A;  3E7Q A;  2Y2Z A;  4JYK A;  1JUM A;  3AQS A;  2NS7 A;  4WIB A;  5H9T A;  3T6N A;  3VP5 A;  3BR1 A;  2RHA A;  3PAS A;  3VVZ A;  3C2B A;  4ACI A;  3G1M A;  3DPJ A;  3ZQI A;  3VW2 A;  5C4Y A;  2G7S A;  3QKX A;  1ZK8 A;  3TP3 A;  2XGE A;  2NP3 A;  4B3A A; 
#chains in the Genus database with same CATH homology
 5EZG A;  3HTA A;  4ICH A;  4I76 A;  2IBD A;  4GFK A;  3COL A;  3KNW A;  2FQ4 A;  5K7Z A;  3HTI A;  3BQZ A;  3RH2 A;  2FX0 A;  4UDS A;  2ZOZ A;  4M3D A;  3HGG A;  2IU5 A;  5HAW A;  3BR5 A;  2F07 A;  3MVP A;  4KWA A;  5HBU A;  1U9N A;  3B81 A;  2HXI A;  2TCT A;  1JT0 A;  2VPR A;  4AF5 A;  3VOK A;  3QQA A;  3F1B A;  2G7L A;  2X9D A;  3EUP A;  2GBY A;  4D7N A;  5EZH A;  3BTJ A;  5D19 A;  2UXU A;  2UXH A;  4GCL A;  3S5R A;  4L62 A;  2HYT A;  3Q3S A;  2O7T A;  3Q0W A;  1SGM A;  3BTI A;  3LOC A;  3ON2 A;  3TP0 A;  4JKZ A;  5FHP A;  3QPS A;  3V6G A;  1T56 A;  3WHC A;  3EGQ A;  4GFL A;  5CW8 A;  3QPL A;  3CRJ A;  5F04 A;  3B6C A;  3CCY A;  4B1R A;  2HKU A;  1JTX A;  2RAE A;  5J1R A;  3V78 A;  3MNL A;  5J1U A;  1Z0X A;  3LWJ A;  2ID6 A;  2QKO A;  5IPA A;  3PPB A;  4I6Z A;  1JUS A;  1JUP A;  5FKO A;  3ZQG A;  2ZCX A;  2XGD A;  4V2G A;  1BJZ A;  4HKU A;  2GFN A;  5FGL A;  2WV1 A;  5IOZ A;  3HIM A;  3LJL A;  3BR3 A;  3FRQ A;  3BCG A;  2D6Y A;  4AC0 A;  3VUQ A;  3O8G A;  1VI0 A;  2XPU A;  3AQT A;  3IH4 A;  5IOY A;  4XK4 A;  2QCO A;  5J1Y A;  4JNN A;  3LHQ A;  5D18 A;  2YVH A;  5F0C A;  1UI5 A;  2NX4 A;  2Y31 A;  5GPA A;  5FKL A;  4DW6 A;  5F0F A;  3VIB A;  2QOP A;  5AQC A;  3C07 A;  3BRU A;  3DEW A;  3BR0 A;  3BTL A;  2HYJ A;  4GCK A;  3VPR A;  3VOX A;  3DCF A;  5FKM A;  3JSJ A;  3G7R A;  4CGR A;  2DTZ A;  2NS8 A;  3ZQH A;  2JJ7 A;  3HGY A;  3NNR A;  5F08 A;  3HTH A;  5GPC A;  5D1R A;  2I10 A;  2FJ1 A;  2OF7 A;  3ZQL A;  3Q0V A;  3IH2 A;  2NP5 A;  2X6O A;  3LSP A;  2XRL A;  3BR2 A;  3ZQF A;  1ORK A;  4M3F A;  5CXG A;  4D7M A;  2ZB9 A;  3BTC A;  2QIB A;  2GEN A;  3RD3 A;  2PZ9 A;  2IEK A;  5K7F A;  4ME9 A;  2HXO A;  2Y30 A;  3CJD A;  3KKC A;  3CWR A;  4AC6 A;  4M3E A;  5EYR A;  1Z77 A;  3KKD A;  3ANP A;  5FKN A;  3BR6 A;  2UXO A;  2UXI A;  3VVY A;  4NN1 A;  4ABZ A;  5IP6 A;  3BQY A;  1JTY A;  4MXM A;  3SFI A;  2ZCN A;  3VVX A;  3BNI A;  1RKT A;  2XPV A;  2XPW A;  3IUV A;  2V57 A;  3HE0 A;  5CXI A;  3Q0U A;  5J3L A;  5F27 A;  2WUI A;  1UI6 A;  1ZKG A;  4X1E A;  4AUX A;  2YVE A;  3ON4 A;  3PM1 A;  3CDL A;  2ZCM A;  2QTQ A;  2ZOY A;  3FIW A;  3G1L A;  5DAJ A;  2OI8 A;  5GP9 A;  1T33 A;  1QVU A;  3LSJ A;  1RKW A;  3BJB A;  4W1U A;  3SDG A;  2FD5 A;  5K58 A;  4D5C A;  1U9O A;  4G12 A;  1QVT A;  2XDN A;  4W97 A;  2QWT A;  4MO7 A;  2OER A;  4JL3 A;  2DG8 A;  2HQ5 A;  1A6I A;  3LSR A;  3NI7 A;  3F0C A;  2OPT A;  1JT6 A;  3NRG A;  2W53 A;  2WGB A;  3QBM A;  3BT9 A;  3FK7 A;  3VW1 A;  3GEU A;  5HSZ A;  4MK6 A;  2Q24 A;  3HTJ A;  1QPI A;  2PBX A;  4M3G A;  1RPW A;  5EFY A;  5FKK A;  5K7H A;  3IH3 A;  3P9T A;  3NPI A;  2FBQ A;  2XB5 A;  2DG7 A;  3VW0 A;  2GUH A;  2VKV A;  3FK6 A;  5FMP A;  2EH3 A;  4PXI A;  3BHQ A;  2G7G A;  4D5F A;  4YZE A;  3WHB A;  3O8H A;  2TRT A;  2JK3 A;  3G56 A;  4GCT A;  2G0E A;  3GZI A;  4M3B A;  5F0H A;  3G1O A;  4V2F A;  2REK A;  2RAS A;  2UXP A;  3O60 A;  2IAI A;  2O7O A;  2ID3 A;  3B6A A;  2VKE A;  3NXC A;  4NEL A;  3KZ9 A;  2XGC A;  5F1J A;  3ANG A;  2G3B A;  3E7Q A;  2Y2Z A;  4JYK A;  1JUM A;  3AQS A;  2NS7 A;  5H9T A;  3T6N A;  3VP5 A;  3BR1 A;  2RHA A;  3PAS A;  3VVZ A;  3C2B A;  4ACI A;  3G1M A;  3DPJ A;  3ZQI A;  3VW2 A;  5C4Y A;  2G7S A;  3QKX A;  1ZK8 A;  3TP3 A;  2XGE A;  2NP3 A;  4B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...