2YVEA

Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
175
structure length
175
Chain Sequence
MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 70
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yveA00
3VVYA 2FX0A 5D19A 2OI8A 2NS7A 2IBDA 3CDLA 3MVPA 5F04A 2QCOA 3HTAA 3PM1A 5EFYA 3B6AA 1Z0XA 2IU5A 2G7SA 3EUPA 2QTQA 2W53A 3ANPA 3JSJA 1T56A 2QWTA 3BHQA 2F07A 3ZQLA 4D5CA 2YVEA 2XRLA 5D1RA 3RD3A 1ORKA 2VKEA 4KWAA 2O7TA 3NPIA 3LSRA 5HSZA 2XPUA 2RAEA 3LJLA 2ZOYA 2GUHA 1U9NA 2HQ5A 5FHPA 3VPRA 5CXIA 2OF7A 3BTCA 3CRJA 2DG7A 3BR2A 3VW0A 4X1EA 4M3BA 1JT6A 3BJBA 4JL3A 2V57A 4JNNA 5GP9A 3QQAA 4MXMA 3PASA 2NP5A 3CCYA 5F27A 2PBXA 3COLA 3HTHA 3NXCA 3KKCA 5J3LA 1ZK8A 3G7RA 3BRUA 3NNRA 3MNLA 3WHBA 3BQZA 4MO7A 2UXUA 3VIBA 3ANGA 3Q0UA 2FJ1A 2G7LA 3BTLA 3RH2A 2HXIA 3PPBA 4NN1A 4YZEA 5DAJA 5FMPA 4XK4A 2DG8A 2XGDA 4B1RA 3IH4A 3BR6A 3LSPA 4AUXA 3Q0WA 5J1UA 5F1JA 2JJ7A 3FRQA 1ZKGA 5IOYA 4D5FA 2HYTA 5HBUA 3S5RA 3ON4A 3VOXA 2TRTA 3VVZA 5FKKA 2NS8A 4I6ZA 1QVTA 2XPVA 3BR1A 3EGQA 3FK7A 2G7GA 3BR5A 3B6CA 2D6YA 5J1YA 3LOCA 2RHAA 3HIMA 2QKOA 4GCKA 3AQTA 3O60A 4W1UA 4ME9A 5IPAA 5D18A 3SFIA 3ZQIA 3VW1A 3QPLA 3HGYA 1RPWA 3O8HA 2XB5A 1UI6A 3G1MA 3DPJA 2QIBA 2XGEA 3KZ9A 2Y30A 3C07A 3P9TA 3IH3A 3NI7A 3V78A 2EH3A 4JKZA 5F0FA 2GFNA 3GZIA 2YVHA 2GENA 2NX4A 3VUQA 1JT0A 2QOPA 4JYKA 5K7ZA 4V2GA 1BJZA 2GBYA 3G1LA 4G12A 2OPTA 4CGRA 2IEKA 1UI5A 1JUMA 1U9OA 4AC6A 4ICHA 3VVXA 3DCFA 3IH2A 4ACIA 2XDNA 5FGLA 5H9TA 2G0EA 2FBQA 2XPWA 2WGBA 3DEWA 3QKXA 4M3GA 3TP3A 1QVUA 3VW2A 3VP5A 2UXHA 3F1BA 3KNWA 4D7MA 2ID3A 4W97A 3FIWA 3B81A 4AF5A 3HE0A 5AQCA 3IUVA 5K7FA 2IAIA 3NRGA 4D7NA 2OERA 3KKDA 5FKOA 3C2BA 2WV1A 2Q24A 5GPCA 3Q3SA 3ZQHA 3BCGA 4HKUA 3VOKA 5EYRA 4I76A 4B3AA 2ZB9A 3G1OA 3CJDA 1A6IA 4GFKA 2Y31A 5F08A 3BR3A 2X6OA 3V6GA 5C4YA 4GCTA 2ZCMA 4AC0A 3BQYA 3BTIA 2ID6A 2JK3A 2ZOZA 2RASA 3BTJA 1Z77A 2I10A 3CWRA 5FKNA 5GPAA 3ON2A 3HGGA 3GEUA 3LWJA 2ZCNA 2NP3A 2FQ4A 2HXOA 2X9DA 2FD5A 3SDGA 3ZQFA 3TP0A 4V2FA 5CW8A 3QBMA 2WUIA 1T33A 4DW6A 3LHQA 2UXOA 3BR0A 1RKWA 5FKLA 3BNIA 4ABZA 5EZHA 5F0CA 2TCTA 1VI0A 3E7QA 4PXIA 3F0CA 2HYJA 3LSJA 1JUSA 4M3FA 5CXGA 4UDSA 3G56A 5IOZA 3QPSA 2UXIA 5HAWA 2DTZA 3O8GA 1JTYA 4L62A 3ZQGA 2PZ9A 4GFLA 4M3DA 3FK6A 3Q0VA 2VKVA 2O7OA 5F0HA 5EZGA 5J1RA 5FKMA 1JUPA 1JTXA 2HKUA 2REKA 4MK6A 3HTIA 3BT9A 3HTJA 2VPRA 1RKTA 2Y2ZA 4M3EA 4NELA 1QPIA 5IP6A 2G3BA 3AQSA 4GCLA 1SGMA 2XGCA 3T6NA 2ZCXA 2UXPA 3WHCA 5K7HA 5K58A
chains in the Genus database with same CATH superfamily
3VVYA 2FX0A 5D19A 2OI8A 2NS7A 2IBDA 3CDLA 3MVPA 5F04A 2QCOA 3HTAA 3PM1A 5EFYA 3NS4A 3B6AA 1Z0XA 2IU5A 2G7SA 3EUPA 2QTQA 2W53A 3ANPA 3JSJA 3DU6A 1T56A 2QWTA 3BHQA 2F07A 3ZQLA 4D5CA 2YVEA 2XRLA 5D1RA 3RD3A 1ORKA 2VKEA 4KWAA 2O7TA 3NPIA 3LSRA 5HSZA 2XPUA 2RAEA 3LJLA 2ZOYA 2GUHA 1U9NA 2PFVA 2HQ5A 5FHPA 3VPRA 5CXIA 2OF7A 3BTCA 3CRJA 2DG7A 3BR2A 3VW0A 4X1EA 4M3BA 1JT6A 3BJBA 4JL3A 2V57A 4JNNA 5GP9A 3QQAA 4MXMA 3PASA 2NP5A 4OD4A 3CCYA 5F27A 2PBXA 3COLA 3HTHA 3NXCA 3KKCA 5J3LA 1ZK8A 3G7RA 3BRUA 3NNRA 3MNLA 3WHBA 3BQZA 4MO7A 4C2MA 2UXUA 3VIBA 3ANGA 3Q0UA 2FJ1A 2G7LA 3BTLA 3RH2A 2HXIA 2R7UA 3PPBA 4NN1A 4YZEA 5DAJA 5FMPA 4XK4A 2DG8A 2XGDA 4B1RA 3IH4A 3BR6A 3LSPA 4AUXA 3Q0WA 5J1UA 5F1JA 2JJ7A 3FRQA 1ZKGA 5IOYA 4D5FA 2HYTA 5HBUA 3S5RA 3ON4A 3VOXA 2TRTA 3VVZA 5FKKA 2R7VA 2NS8A 4I6ZA 1QVTA 2XPVA 3BR1A 3EGQA 3FK7A 2G7GA 3BR5A 3B6CA 2D6YA 5J1YA 3LOCA 3DU5A 2RHAA 3HIMA 2QKOA 4GCKA 3AQTA 3O60A 4W1UA 4ME9A 5IPAA 5D18A 3SFIA 2R7TA 3ZQIA 3QPLA 3VW1A 3HGYA 1RPWA 4U9NA 3O8HA 2XB5A 1UI6A 3G1MA 2R7XA 3DPJA 2QIBA 2XGEA 3KZ9A 2Y30A 3C07A 3P9TA 3IH3A 3NI7A 3V78A 2EH3A 4JKZA 5F0FA 2GFNA 5CQGA 2R7QA 3GZIA 3SWHA 2YVHA 2ZY9A 2GENA 2NX4A 3VUQA 1JT0A 2QOPA 4JYKA 5K7ZA 4V2GA 1BJZA 2GBYA 3G1LA 4G12A 2OPTA 4CGRA 2IEKA 2B1EA 1UI5A 1JUMA 1U9OA 4AC6A 4ICHA 3VVXA 3DCFA 3IH2A 4ACIA 2XDNA 5FGLA 5H9TA 2R7RA 2G0EA 2FBQA 2XPWA 2WGBA 2R7OA 3DEWA 3QKXA 4M3GA 3TP3A 2R7WA 1QVUA 3VW2A 3VP5A 2UXHA 3F1BA 3KNWA 4D7MA 2ID3A 4W97A 3FIWA 3B81A 4AF5A 3HE0A 5AQCA 3IUVA 5K7FA 2IAIA 3NRGA 4D7NA 2OERA 3KKDA 5FKOA 3C2BA 2WV1A 3KYLA 2Q24A 5GPCA 3Q3SA 3ZQHA 3BCGA 4HKUA 3VOKA 5EYRA 4I76A 4B3AA 2ZB9A 3G1OA 3CJDA 1A6IA 4GFKA 2Y31A 2B3WA 5F08A 3BR3A 2X6OA 3V6GA 5C4YA 4GCTA 2ZCMA 4AC0A 3BQYA 3BTIA 2ID6A 2JK3A 2ZOZA 2RASA 3BTJA 1Z77A 2I10A 3CWRA 5FKNA 5GPAA 3ON2A 3HGGA 3GEUA 3LWJA 2ZCNA 2NP3A 4U9LA 2FQ4A 2HXOA 2X9DA 2FD5A 3SDGA 3ZQFA 3TP0A 4DVYP 4V2FA 5CW8A 3QBMA 2WUIA 1T33A 4DW6A 3LHQA 2UXOA 3BR0A 1RKWA 5FKLA 3BNIA 4ABZA 5EZHA 5F0CA 2TCTA 3K8PC 1VI0A 3E7QA 2FJI1 4PXIA 3F0CA 2HYJA 3LSJA 1JUSA 4M3FA 5CXGA 4IRVA 4UDSA 3G56A 5IOZA 3QPSA 2UXIA 5HAWA 2DTZA 3O8GA 4WIBA 1JTYA 4L62A 3ZQGA 2PZ9A 4GFLA 2R7SA 4M3DA 3FK6A 3Q0VA 2VKVA 2O7OA 5F0HA 5EZGA 2YVXA 5J1RA 5FKMA 1JUPA 1JTXA 2HKUA 2REKA 4MK6A 3HTIA 3BT9A 3HTJA 2A2FX 2VPRA 1RKTA 2Y2ZA 4M3EA 4NELA 1QPIA 5IP6A 2G3BA 3AQSA 4OD5A 4GCLA 1SGMA 2XGCA 3T6NA 2ZCXA 2UXPA 3WHCA 5K7HA 3FHNA 5K58A 3VTIA
chains in the Genus database with same CATH topology
3VVYA 2FX0A 5D19A 2OI8A 2NS7A 2IBDA 3CDLA 3MVPA 5F04A 2QCOA 3HTAA 3PM1A 5EFYA 3B6AA 1Z0XA 2IU5A 2G7SA 3EUPA 2QTQA 2W53A 3ANPA 3JSJA 1T56A 2QWTA 3BHQA 2F07A 3ZQLA 4D5CA 2YVEA 2XRLA 5D1RA 3RD3A 1ORKA 2VKEA 4KWAA 2O7TA 3NPIA 3LSRA 5HSZA 2XPUA 2RAEA 3LJLA 2ZOYA 2GUHA 1U9NA 2HQ5A 5FHPA 3VPRA 5CXIA 2OF7A 3BTCA 3CRJA 2DG7A 3BR2A 3VW0A 4X1EA 4M3BA 1JT6A 3BJBA 4JL3A 2V57A 4JNNA 5GP9A 3QQAA 4MXMA 3PASA 2NP5A 3CCYA 5F27A 2PBXA 3COLA 3HTHA 3NXCA 3KKCA 5J3LA 1ZK8A 3G7RA 3BRUA 3NNRA 3MNLA 3WHBA 3BQZA 4MO7A 2UXUA 3VIBA 3ANGA 3Q0UA 2FJ1A 2G7LA 3BTLA 3RH2A 2HXIA 3PPBA 4NN1A 4YZEA 5DAJA 5FMPA 4XK4A 2DG8A 2XGDA 4B1RA 3IH4A 3BR6A 3LSPA 4AUXA 3Q0WA 5J1UA 5F1JA 2JJ7A 3FRQA 1ZKGA 5IOYA 4D5FA 2HYTA 5HBUA 3S5RA 3ON4A 3VOXA 2TRTA 3VVZA 5FKKA 2NS8A 4I6ZA 1QVTA 2XPVA 3BR1A 3EGQA 3FK7A 2G7GA 3BR5A 3B6CA 2D6YA 5J1YA 3LOCA 2RHAA 3HIMA 2QKOA 4GCKA 3AQTA 3O60A 4W1UA 4ME9A 5IPAA 5D18A 3SFIA 3ZQIA 3VW1A 3QPLA 3HGYA 1RPWA 3O8HA 2XB5A 1UI6A 3G1MA 3DPJA 2QIBA 2XGEA 3KZ9A 2Y30A 3C07A 3P9TA 3IH3A 3NI7A 3V78A 2EH3A 4JKZA 5F0FA 2GFNA 3GZIA 2YVHA 2GENA 2NX4A 3VUQA 1JT0A 2QOPA 4JYKA 5K7ZA 4V2GA 1BJZA 2GBYA 3G1LA 4G12A 2OPTA 4CGRA 2IEKA 1UI5A 1JUMA 1U9OA 4AC6A 4ICHA 3VVXA 3DCFA 3IH2A 4ACIA 2XDNA 5FGLA 5H9TA 2G0EA 2FBQA 2XPWA 2WGBA 3DEWA 3QKXA 4M3GA 3TP3A 1QVUA 3VW2A 3VP5A 2UXHA 3F1BA 3KNWA 4D7MA 2ID3A 4W97A 3FIWA 3B81A 4AF5A 3HE0A 5AQCA 3IUVA 5K7FA 2IAIA 3NRGA 4D7NA 2OERA 3KKDA 5FKOA 3C2BA 2WV1A 2Q24A 5GPCA 3Q3SA 3ZQHA 3BCGA 4HKUA 3VOKA 5EYRA 4I76A 4B3AA 2ZB9A 3G1OA 3CJDA 1A6IA 4GFKA 2Y31A 5F08A 3BR3A 2X6OA 3V6GA 5C4YA 4GCTA 2ZCMA 4AC0A 3BQYA 3BTIA 2ID6A 2JK3A 2ZOZA 2RASA 3BTJA 1Z77A 2I10A 3CWRA 5FKNA 5GPAA 3ON2A 3HGGA 3GEUA 3LWJA 2ZCNA 2NP3A 2FQ4A 2HXOA 2X9DA 2FD5A 3SDGA 3ZQFA 3TP0A 4V2FA 5CW8A 3QBMA 2WUIA 1T33A 4DW6A 3LHQA 2UXOA 3BR0A 1RKWA 5FKLA 3BNIA 4ABZA 5EZHA 5F0CA 2TCTA 1VI0A 3E7QA 4PXIA 3F0CA 2HYJA 3LSJA 1JUSA 4M3FA 5CXGA 4UDSA 3G56A 5IOZA 3QPSA 2UXIA 5HAWA 2DTZA 3O8GA 1JTYA 4L62A 3ZQGA 2PZ9A 4GFLA 4M3DA 3FK6A 3Q0VA 2VKVA 2O7OA 5F0HA 5EZGA 5J1RA 5FKMA 1JUPA 1JTXA 2HKUA 2REKA 4MK6A 3HTIA 3BT9A 3HTJA 2VPRA 1RKTA 2Y2ZA 4M3EA 4NELA 1QPIA 5IP6A 2G3BA 3AQSA 4GCLA 1SGMA 2XGCA 3T6NA 2ZCXA 2UXPA 3WHCA 5K7HA 5K58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVY A;  2FX0 A;  5D19 A;  2OI8 A;  2NS7 A;  2IBD A;  3CDL A;  3MVP A;  5F04 A;  2QCO A;  3HTA A;  3PM1 A;  5EFY A;  3B6A A;  1Z0X A;  2IU5 A;  2G7S A;  3EUP A;  2QTQ A;  2W53 A;  3ANP A;  3JSJ A;  1T56 A;  2QWT A;  3BHQ A;  2F07 A;  3ZQL A;  4D5C A;  2YVE A;  2XRL A;  5D1R A;  3RD3 A;  1ORK A;  2VKE A;  4KWA A;  2O7T A;  3NPI A;  3LSR A;  5HSZ A;  2XPU A;  2RAE A;  3LJL A;  2ZOY A;  2GUH A;  1U9N A;  2HQ5 A;  5FHP A;  3VPR A;  5CXI A;  2OF7 A;  3BTC A;  3CRJ A;  2DG7 A;  3BR2 A;  3VW0 A;  4X1E A;  4M3B A;  1JT6 A;  3BJB A;  4JL3 A;  2V57 A;  4JNN A;  5GP9 A;  3QQA A;  4MXM A;  3PAS A;  2NP5 A;  3CCY A;  5F27 A;  2PBX A;  3COL A;  3HTH A;  3NXC A;  3KKC A;  5J3L A;  1ZK8 A;  3G7R A;  3BRU A;  3NNR A;  3MNL A;  3WHB A;  3BQZ A;  4MO7 A;  2UXU A;  3VIB A;  3ANG A;  3Q0U A;  2FJ1 A;  2G7L A;  3BTL A;  3RH2 A;  2HXI A;  3PPB A;  4NN1 A;  4YZE A;  5DAJ A;  5FMP A;  4XK4 A;  2DG8 A;  2XGD A;  4B1R A;  3IH4 A;  3BR6 A;  3LSP A;  4AUX A;  3Q0W A;  5J1U A;  5F1J A;  2JJ7 A;  3FRQ A;  1ZKG A;  5IOY A;  4D5F A;  2HYT A;  5HBU A;  3S5R A;  3ON4 A;  3VOX A;  2TRT A;  3VVZ A;  5FKK A;  2NS8 A;  4I6Z A;  1QVT A;  2XPV A;  3BR1 A;  3EGQ A;  3FK7 A;  2G7G A;  3BR5 A;  3B6C A;  2D6Y A;  5J1Y A;  3LOC A;  2RHA A;  3HIM A;  2QKO A;  4GCK A;  3AQT A;  3O60 A;  4W1U A;  4ME9 A;  5IPA A;  5D18 A;  3SFI A;  3ZQI A;  3VW1 A;  3QPL A;  3HGY A;  1RPW A;  3O8H A;  2XB5 A;  1UI6 A;  3G1M A;  3DPJ A;  2QIB A;  2XGE A;  3KZ9 A;  2Y30 A;  3C07 A;  3P9T A;  3IH3 A;  3NI7 A;  3V78 A;  2EH3 A;  4JKZ A;  5F0F A;  2GFN A;  3GZI A;  2YVH A;  2GEN A;  2NX4 A;  3VUQ A;  1JT0 A;  2QOP A;  4JYK A;  5K7Z A;  4V2G A;  1BJZ A;  2GBY A;  3G1L A;  4G12 A;  2OPT A;  4CGR A;  2IEK A;  1UI5 A;  1JUM A;  1U9O A;  4AC6 A;  4ICH A;  3VVX A;  3DCF A;  3IH2 A;  4ACI A;  2XDN A;  5FGL A;  5H9T A;  2G0E A;  2FBQ A;  2XPW A;  2WGB A;  3DEW A;  3QKX A;  4M3G A;  3TP3 A;  1QVU A;  3VW2 A;  3VP5 A;  2UXH A;  3F1B A;  3KNW A;  4D7M A;  2ID3 A;  4W97 A;  3FIW A;  3B81 A;  4AF5 A;  3HE0 A;  5AQC A;  3IUV A;  5K7F A;  2IAI A;  3NRG A;  4D7N A;  2OER A;  3KKD A;  5FKO A;  3C2B A;  2WV1 A;  2Q24 A;  5GPC A;  3Q3S A;  3ZQH A;  3BCG A;  4HKU A;  3VOK A;  5EYR A;  4I76 A;  4B3A A;  2ZB9 A;  3G1O A;  3CJD A;  1A6I A;  4GFK A;  2Y31 A;  5F08 A;  3BR3 A;  2X6O A;  3V6G A;  5C4Y A;  4GCT A;  2ZCM A;  4AC0 A;  3BQY A;  3BTI A;  2ID6 A;  2JK3 A;  2ZOZ A;  2RAS A;  3BTJ A;  1Z77 A;  2I10 A;  3CWR A;  5FKN A;  5GPA A;  3ON2 A;  3HGG A;  3GEU A;  3LWJ A;  2ZCN A;  2NP3 A;  2FQ4 A;  2HXO A;  2X9D A;  2FD5 A;  3SDG A;  3ZQF A;  3TP0 A;  4V2F A;  5CW8 A;  3QBM A;  2WUI A;  1T33 A;  4DW6 A;  3LHQ A;  2UXO A;  3BR0 A;  1RKW A;  5FKL A;  3BNI A;  4ABZ A;  5EZH A;  5F0C A;  2TCT A;  1VI0 A;  3E7Q A;  4PXI A;  3F0C A;  2HYJ A;  3LSJ A;  1JUS A;  4M3F A;  5CXG A;  4UDS A;  3G56 A;  5IOZ A;  3QPS A;  2UXI A;  5HAW A;  2DTZ A;  3O8G A;  1JTY A;  4L62 A;  3ZQG A;  2PZ9 A;  4GFL A;  4M3D A;  3FK6 A;  3Q0V A;  2VKV A;  2O7O A;  5F0H A;  5EZG A;  5J1R A;  5FKM A;  1JUP A;  1JTX A;  2HKU A;  2REK A;  4MK6 A;  3HTI A;  3BT9 A;  3HTJ A;  2VPR A;  1RKT A;  2Y2Z A;  4M3E A;  4NEL A;  1QPI A;  5IP6 A;  2G3B A;  3AQS A;  4GCL A;  1SGM A;  2XGC A;  3T6N A;  2ZCX A;  2UXP A;  3WHC A;  5K7H A;  5K58 A; 
#chains in the Genus database with same CATH topology
 3VVY A;  2FX0 A;  5D19 A;  2OI8 A;  2NS7 A;  2IBD A;  3CDL A;  3MVP A;  5F04 A;  2QCO A;  3HTA A;  3PM1 A;  5EFY A;  3NS4 A;  3B6A A;  1Z0X A;  2IU5 A;  2G7S A;  3EUP A;  2QTQ A;  2W53 A;  3ANP A;  3JSJ A;  3DU6 A;  1T56 A;  2QWT A;  3BHQ A;  2F07 A;  3ZQL A;  4D5C A;  2YVE A;  2XRL A;  5D1R A;  3RD3 A;  1ORK A;  2VKE A;  4KWA A;  2O7T A;  3NPI A;  3LSR A;  5HSZ A;  2XPU A;  2RAE A;  3LJL A;  2ZOY A;  2GUH A;  1U9N A;  2PFV A;  2HQ5 A;  5FHP A;  3VPR A;  5CXI A;  2OF7 A;  3BTC A;  3CRJ A;  2DG7 A;  3BR2 A;  3VW0 A;  4X1E A;  4M3B A;  1JT6 A;  3BJB A;  4JL3 A;  2V57 A;  4JNN A;  5GP9 A;  3QQA A;  4MXM A;  3PAS A;  2NP5 A;  4OD4 A;  3CCY A;  5F27 A;  2PBX A;  3COL A;  3HTH A;  3NXC A;  3KKC A;  5J3L A;  1ZK8 A;  3G7R A;  3BRU A;  3NNR A;  3MNL A;  3WHB A;  3BQZ A;  4MO7 A;  4C2M A;  2UXU A;  3VIB A;  3ANG A;  3Q0U A;  2FJ1 A;  2G7L A;  3BTL A;  3RH2 A;  2HXI A;  2R7U A;  3PPB A;  4NN1 A;  4YZE A;  5DAJ A;  5FMP A;  4XK4 A;  2DG8 A;  2XGD A;  4B1R A;  3IH4 A;  3BR6 A;  3LSP A;  4AUX A;  3Q0W A;  5J1U A;  5F1J A;  2JJ7 A;  3FRQ A;  1ZKG A;  5IOY A;  4D5F A;  2HYT A;  5HBU A;  3S5R A;  3ON4 A;  3VOX A;  2TRT A;  3VVZ A;  5FKK A;  2R7V A;  2NS8 A;  4I6Z A;  1QVT A;  2XPV A;  3BR1 A;  3EGQ A;  3FK7 A;  2G7G A;  3BR5 A;  3B6C A;  2D6Y A;  5J1Y A;  3LOC A;  3DU5 A;  2RHA A;  3HIM A;  2QKO A;  4GCK A;  3AQT A;  3O60 A;  4W1U A;  4ME9 A;  5IPA A;  5D18 A;  3SFI A;  2R7T A;  3ZQI A;  3QPL A;  3VW1 A;  3HGY A;  1RPW A;  4U9N A;  3O8H A;  2XB5 A;  1UI6 A;  3G1M A;  2R7X A;  3DPJ A;  2QIB A;  2XGE A;  3KZ9 A;  2Y30 A;  3C07 A;  3P9T A;  3IH3 A;  3NI7 A;  3V78 A;  2EH3 A;  4JKZ A;  5F0F A;  2GFN A;  5CQG A;  2R7Q A;  3GZI A;  3SWH A;  2YVH A;  2ZY9 A;  2GEN A;  2NX4 A;  3VUQ A;  1JT0 A;  2QOP A;  4JYK A;  5K7Z A;  4V2G A;  1BJZ A;  2GBY A;  3G1L A;  4G12 A;  2OPT A;  4CGR A;  2IEK A;  2B1E A;  1UI5 A;  1JUM A;  1U9O A;  4AC6 A;  4ICH A;  3VVX A;  3DCF A;  3IH2 A;  4ACI A;  2XDN A;  5FGL A;  5H9T A;  2R7R A;  2G0E A;  2FBQ A;  2XPW A;  2WGB A;  2R7O A;  3DEW A;  3QKX A;  4M3G A;  3TP3 A;  2R7W A;  1QVU A;  3VW2 A;  3VP5 A;  2UXH A;  3F1B A;  3KNW A;  4D7M A;  2ID3 A;  4W97 A;  3FIW A;  3B81 A;  4AF5 A;  3HE0 A;  5AQC A;  3IUV A;  5K7F A;  2IAI A;  3NRG A;  4D7N A;  2OER A;  3KKD A;  5FKO A;  3C2B A;  2WV1 A;  3KYL A;  2Q24 A;  5GPC A;  3Q3S A;  3ZQH A;  3BCG A;  4HKU A;  3VOK A;  5EYR A;  4I76 A;  4B3A A;  2ZB9 A;  3G1O A;  3CJD A;  1A6I A;  4GFK A;  2Y31 A;  2B3W A;  5F08 A;  3BR3 A;  2X6O A;  3V6G A;  5C4Y A;  4GCT A;  2ZCM A;  4AC0 A;  3BQY A;  3BTI A;  2ID6 A;  2JK3 A;  2ZOZ A;  2RAS A;  3BTJ A;  1Z77 A;  2I10 A;  3CWR A;  5FKN A;  5GPA A;  3ON2 A;  3HGG A;  3GEU A;  3LWJ A;  2ZCN A;  2NP3 A;  4U9L A;  2FQ4 A;  2HXO A;  2X9D A;  2FD5 A;  3SDG A;  3ZQF A;  3TP0 A;  4DVY P;  4V2F A;  5CW8 A;  3QBM A;  2WUI A;  1T33 A;  4DW6 A;  3LHQ A;  2UXO A;  3BR0 A;  1RKW A;  5FKL A;  3BNI A;  4ABZ A;  5EZH A;  5F0C A;  2TCT A;  3K8P C;  1VI0 A;  3E7Q A;  2FJI 1;  4PXI A;  3F0C A;  2HYJ A;  3LSJ A;  1JUS A;  4M3F A;  5CXG A;  4IRV A;  4UDS A;  3G56 A;  5IOZ A;  3QPS A;  2UXI A;  5HAW A;  2DTZ A;  3O8G A;  4WIB A;  1JTY A;  4L62 A;  3ZQG A;  2PZ9 A;  4GFL A;  2R7S A;  4M3D A;  3FK6 A;  3Q0V A;  2VKV A;  2O7O A;  5F0H A;  5EZG A;  2YVX A;  5J1R A;  5FKM A;  1JUP A;  1JTX A;  2HKU A;  2REK A;  4MK6 A;  3HTI A;  3BT9 A;  3HTJ A;  2A2F X;  2VPR A;  1RKT A;  2Y2Z A;  4M3E A;  4NEL A;  1QPI A;  5IP6 A;  2G3B A;  3AQS A;  4OD5 A;  4GCL A;  1SGM A;  2XGC A;  3T6N A;  2ZCX A;  2UXP A;  3WHC A;  5K7H A;  3FHN A;  5K58 A;  3VTI A; 
#chains in the Genus database with same CATH homology
 3VVY A;  2FX0 A;  5D19 A;  2OI8 A;  2NS7 A;  2IBD A;  3CDL A;  3MVP A;  5F04 A;  2QCO A;  3HTA A;  3PM1 A;  5EFY A;  3B6A A;  1Z0X A;  2IU5 A;  2G7S A;  3EUP A;  2QTQ A;  2W53 A;  3ANP A;  3JSJ A;  1T56 A;  2QWT A;  3BHQ A;  2F07 A;  3ZQL A;  4D5C A;  2YVE A;  2XRL A;  5D1R A;  3RD3 A;  1ORK A;  2VKE A;  4KWA A;  2O7T A;  3NPI A;  3LSR A;  5HSZ A;  2XPU A;  2RAE A;  3LJL A;  2ZOY A;  2GUH A;  1U9N A;  2HQ5 A;  5FHP A;  3VPR A;  5CXI A;  2OF7 A;  3BTC A;  3CRJ A;  2DG7 A;  3BR2 A;  3VW0 A;  4X1E A;  4M3B A;  1JT6 A;  3BJB A;  4JL3 A;  2V57 A;  4JNN A;  5GP9 A;  3QQA A;  4MXM A;  3PAS A;  2NP5 A;  3CCY A;  5F27 A;  2PBX A;  3COL A;  3HTH A;  3NXC A;  3KKC A;  5J3L A;  1ZK8 A;  3G7R A;  3BRU A;  3NNR A;  3MNL A;  3WHB A;  3BQZ A;  4MO7 A;  2UXU A;  3VIB A;  3ANG A;  3Q0U A;  2FJ1 A;  2G7L A;  3BTL A;  3RH2 A;  2HXI A;  3PPB A;  4NN1 A;  4YZE A;  5DAJ A;  5FMP A;  4XK4 A;  2DG8 A;  2XGD A;  4B1R A;  3IH4 A;  3BR6 A;  3LSP A;  4AUX A;  3Q0W A;  5J1U A;  5F1J A;  2JJ7 A;  3FRQ A;  1ZKG A;  5IOY A;  4D5F A;  2HYT A;  5HBU A;  3S5R A;  3ON4 A;  3VOX A;  2TRT A;  3VVZ A;  5FKK A;  2NS8 A;  4I6Z A;  1QVT A;  2XPV A;  3BR1 A;  3EGQ A;  3FK7 A;  2G7G A;  3BR5 A;  3B6C A;  2D6Y A;  5J1Y A;  3LOC A;  2RHA A;  3HIM A;  2QKO A;  4GCK A;  3AQT A;  3O60 A;  4W1U A;  4ME9 A;  5IPA A;  5D18 A;  3SFI A;  3ZQI A;  3VW1 A;  3QPL A;  3HGY A;  1RPW A;  3O8H A;  2XB5 A;  1UI6 A;  3G1M A;  3DPJ A;  2QIB A;  2XGE A;  3KZ9 A;  2Y30 A;  3C07 A;  3P9T A;  3IH3 A;  3NI7 A;  3V78 A;  2EH3 A;  4JKZ A;  5F0F A;  2GFN A;  3GZI A;  2YVH A;  2GEN A;  2NX4 A;  3VUQ A;  1JT0 A;  2QOP A;  4JYK A;  5K7Z A;  4V2G A;  1BJZ A;  2GBY A;  3G1L A;  4G12 A;  2OPT A;  4CGR A;  2IEK A;  1UI5 A;  1JUM A;  1U9O A;  4AC6 A;  4ICH A;  3VVX A;  3DCF A;  3IH2 A;  4ACI A;  2XDN A;  5FGL A;  5H9T A;  2G0E A;  2FBQ A;  2XPW A;  2WGB A;  3DEW A;  3QKX A;  4M3G A;  3TP3 A;  1QVU A;  3VW2 A;  3VP5 A;  2UXH A;  3F1B A;  3KNW A;  4D7M A;  2ID3 A;  4W97 A;  3FIW A;  3B81 A;  4AF5 A;  3HE0 A;  5AQC A;  3IUV A;  5K7F A;  2IAI A;  3NRG A;  4D7N A;  2OER A;  3KKD A;  5FKO A;  3C2B A;  2WV1 A;  2Q24 A;  5GPC A;  3Q3S A;  3ZQH A;  3BCG A;  4HKU A;  3VOK A;  5EYR A;  4I76 A;  4B3A A;  2ZB9 A;  3G1O A;  3CJD A;  1A6I A;  4GFK A;  2Y31 A;  5F08 A;  3BR3 A;  2X6O A;  3V6G A;  5C4Y A;  4GCT A;  2ZCM A;  4AC0 A;  3BQY A;  3BTI A;  2ID6 A;  2JK3 A;  2ZOZ A;  2RAS A;  3BTJ A;  1Z77 A;  2I10 A;  3CWR A;  5FKN A;  5GPA A;  3ON2 A;  3HGG A;  3GEU A;  3LWJ A;  2ZCN A;  2NP3 A;  2FQ4 A;  2HXO A;  2X9D A;  2FD5 A;  3SDG A;  3ZQF A;  3TP0 A;  4V2F A;  5CW8 A;  3QBM A;  2WUI A;  1T33 A;  4DW6 A;  3LHQ A;  2UXO A;  3BR0 A;  1RKW A;  5FKL A;  3BNI A;  4ABZ A;  5EZH A;  5F0C A;  2TCT A;  1VI0 A;  3E7Q A;  4PXI A;  3F0C A;  2HYJ A;  3LSJ A;  1JUS A;  4M3F A;  5CXG A;  4UDS A;  3G56 A;  5IOZ A;  3QPS A;  2UXI A;  5HAW A;  2DTZ A;  3O8G A;  1JTY A;  4L62 A;  3ZQG A;  2PZ9 A;  4GFL A;  4M3D A;  3FK6 A;  3Q0V A;  2VKV A;  2O7O A;  5F0H A;  5EZG A;  5J1R A;  5FKM A;  1JUP A;  1JTX A;  2HKU A;  2REK A;  4MK6 A;  3HTI A;  3BT9 A;  3HTJ A;  2VPR A;  1RKT A;  2Y2Z A;  4M3E A;  4NEL A;  1QPI A;  5IP6 A;  2G3B A;  3AQS A;  4GCL A;  1SGM A;  2XGC A;  3T6N A;  2ZCX A;  2UXP A;  3WHC A;  5K7H A;  5K58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...