2YVEA

Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
175
structure length
175
Chain Sequence
MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords Transcriptional regulator
total genus 70
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yveA00
2QIBA 3HIMA 5D19A 5HSZA 4V2FA 4CGRA 3CRJA 4DW6A 3QKXA 2HXIA 3V78A 2OPTA 4NN1A 1Z77A 5J1RA 4D5CA 4M3BA 2V57A 3DPJA 2XGEA 3ON4A 3PM1A 5F0HA 4M3FA 5J1UA 3MNLA 3KZ9A 3SFIA 3LSRA 3WHCA 3VW0A 5FGLA 2QTQA 3VOXA 4M3GA 2I10A 3RH2A 2G3BA 2JJ7A 3BRUA 2QWTA 5D18A 3TP3A 4GCTA 3ZQLA 3NNRA 5K7ZA 4B3AA 3BTJA 4MK6A 3AQSA 3E7QA 5IOYA 4ME9A 3QPLA 3LJLA 5F04A 5GPAA 3CCYA 2W53A 3JSJA 2HKUA 3BQYA 3Q0VA 4AC6A 3QQAA 4MXMA 3O8GA 3ANPA 2NS8A 3F1BA 2GBYA 2HQ5A 2ZCMA 3HTHA 1QVUA 2GFNA 2O7OA 2XRLA 3BQZA 3G7RA 3LSJA 4G12A 3FIWA 4YZEA 2RAEA 4M3DA 5FKNA 3HTJA 3MVPA 1JTYA 5J3LA 2XGCA 3GEUA 2GUHA 4ABZA 3ON2A 2ZCNA 2XPUA 3P9TA 5AQCA 3RD3A 2UXPA 4NELA 2ID6A 5FKKA 2VKEA 3BR6A 2XPVA 5K58A 3ZQHA 3NXCA 2WGBA 3C07A 3AQTA 5HAWA 1RKTA 5FKLA 2F07A 3BT9A 3ZQFA 2OF7A 3BHQA 3PASA 4AF5A 5D1RA 3TP0A 4M3EA 5FKOA 3VVYA 3V6GA 1ZK8A 3Q3SA 5IP6A 5GP9A 2DTZA 2QCOA 3NRGA 3G56A 2ZOYA 3G1LA 4L62A 2NX4A 1RKWA 3BR1A 3DCFA 5H9TA 4ACIA 1JUSA 4ICHA 3SDGA 4JNNA 3HGGA 5F0FA 3B6AA 5HBUA 2G7LA 4I6ZA 3O8HA 5IOZA 4I76A 5FMPA 5EFYA 1JUPA 4MO7A 5FHPA 2IAIA 3LSPA 2IU5A 2ID3A 2NP3A 5DAJA 5EZGA 3VW1A 3IH2A 2FJ1A 3DEWA 4JKZA 2X6OA 3CWRA 3G1MA 2NS7A 1U9OA 1UI6A 3BR2A 4GCLA 3B81A 3HTAA 3VPRA 3CDLA 3VW2A 4JL3A 2UXHA 2FQ4A 4XK4A 4W1UA 1U9NA 5K7FA 5CXGA 5C4YA 3IUVA 3BR5A 2DG7A 1VI0A 3VP5A 3BJBA 2Q24A 3NPIA 2HYTA 3QPSA 3KNWA 4AC0A 2G7SA 1BJZA 2Y30A 3BNIA 3Q0UA 5F0CA 2D6YA 2UXUA 1RPWA 2HXOA 2FD5A 5CXIA 3LOCA 5GPCA 2REKA 2XDNA 2HYJA 4JYKA 3FK7A 2OERA 2UXOA 4UDSA 2FX0A 3WHBA 3KKCA 4HKUA 3LHQA 4GFLA 3VVZA 1A6IA 2ZCXA 1JT6A 2ZOZA 4GCKA 4D7NA 2XPWA 3NI7A 3S5RA 3T6NA 1QVTA 2ZB9A 2Y2ZA 3B6CA 3VOKA 2QKOA 3F0CA 2EH3A 2OI8A 3ZQGA 3HE0A 2QOPA 4X1EA 4AUXA 3EGQA 2VKVA 3QBMA 2IEKA 4GFKA 5F27A 2YVHA 4W97A 2G7GA 3FK6A 2PBXA 5K7HA 1JT0A 5CW8A 3KKDA 3BTIA 3LWJA 3HGYA 3G1OA 3BCGA 3BR3A 2G0EA 3IH3A 1JUMA 3HTIA 3GZIA 1T33A 3PPBA 4D7MA 2GENA 1Z0XA 2TCTA 2VPRA 4D5FA 3CJDA 5EZHA 1SGMA 1QPIA 1JTXA 2XGDA 3BTCA 1ORKA 2PZ9A 3Q0WA 5FKMA 4KWAA 2WV1A 3C2BA 2IBDA 3FRQA 2XB5A 2RHAA 5F1JA 1ZKGA 2O7TA 3VVXA 3VIBA 1T56A 5F08A 4PXIA 5IPAA 2FBQA 2X9DA 3IH4A 3VUQA 2DG8A 2RASA 2Y31A 2UXIA 2JK3A 3ZQIA 2WUIA 3ANGA 2TRTA 5J1YA 3COLA 3EUPA 4V2GA 4B1RA 1UI5A 3BTLA 3BR0A 3O60A 2YVEA 2NP5A 5EYRA
chains in the Genus database with same CATH superfamily
2QIBA 3HIMA 5D19A 5HSZA 3VTIA 4V2FA 4CGRA 3CRJA 4DW6A 3QKXA 2HXIA 3V78A 2OPTA 4NN1A 1Z77A 4OD5A 5J1RA 4D5CA 4M3BA 2V57A 3DPJA 2XGEA 3ON4A 3PM1A 5F0HA 4M3FA 5J1UA 3MNLA 3KZ9A 3SFIA 4DVYP 3LSRA 3WHCA 4WIBA 3VW0A 5FGLA 2QTQA 3VOXA 4M3GA 2I10A 3RH2A 2G3BA 2JJ7A 2B3WA 3BRUA 2QWTA 5D18A 3TP3A 4GCTA 3ZQLA 3NNRA 5K7ZA 4B3AA 3BTJA 4MK6A 3AQSA 3E7QA 5IOYA 4ME9A 3QPLA 3LJLA 5F04A 5GPAA 3CCYA 2W53A 4C2MA 3JSJA 2HKUA 3BQYA 3Q0VA 4AC6A 3QQAA 4MXMA 3O8GA 3ANPA 2NS8A 3F1BA 2GBYA 4OD4A 2HQ5A 2ZCMA 3HTHA 2R7RA 1QVUA 2GFNA 2O7OA 2XRLA 3BQZA 3G7RA 3LSJA 4G12A 3FIWA 3NS4A 4YZEA 2RAEA 4M3DA 5FKNA 3HTJA 3MVPA 1JTYA 5J3LA 2XGCA 3GEUA 2GUHA 2R7UA 4ABZA 3ON2A 2ZCNA 2XPUA 3P9TA 5AQCA 3RD3A 2UXPA 4NELA 2ID6A 5FKKA 2VKEA 3BR6A 2XPVA 5K58A 3ZQHA 3NXCA 2WGBA 3C07A 3AQTA 5HAWA 1RKTA 5FKLA 2F07A 3BT9A 3ZQFA 2OF7A 3BHQA 3PASA 4AF5A 5D1RA 4U9LA 3TP0A 4M3EA 5FKOA 3VVYA 3V6GA 1ZK8A 2R7WA 3Q3SA 5IP6A 5GP9A 2DTZA 2QCOA 3NRGA 3G56A 2ZOYA 3G1LA 4L62A 2NX4A 1RKWA 3BR1A 3DCFA 4IRVA 5H9TA 4ACIA 1JUSA 4ICHA 3SDGA 4JNNA 3HGGA 5F0FA 2R7SA 3B6AA 5HBUA 2G7LA 4I6ZA 2R7VA 3O8HA 2R7QA 5IOZA 4I76A 5FMPA 2PFVA 5EFYA 1JUPA 4MO7A 5FHPA 2IAIA 3LSPA 2IU5A 2ID3A 2NP3A 5DAJA 5EZGA 3VW1A 3IH2A 2FJ1A 3DEWA 3KYLA 4JKZA 2X6OA 3CWRA 3G1MA 2NS7A 1U9OA 1UI6A 3BR2A 4GCLA 3B81A 3HTAA 3VPRA 3CDLA 3VW2A 4JL3A 2UXHA 3DU6A 2FQ4A 3FHNA 4XK4A 4W1UA 1U9NA 5K7FA 5CXGA 5C4YA 3IUVA 3BR5A 2DG7A 1VI0A 3VP5A 3BJBA 2Q24A 3NPIA 2HYTA 3QPSA 3KNWA 4AC0A 2G7SA 2R7TA 1BJZA 2R7OA 2Y30A 3BNIA 3Q0UA 5F0CA 2D6YA 3DU5A 2UXUA 1RPWA 2HXOA 2FD5A 5CXIA 3LOCA 5GPCA 2REKA 2XDNA 2HYJA 4JYKA 3FK7A 2OERA 2UXOA 4UDSA 2FX0A 3WHBA 3KKCA 4HKUA 3LHQA 4GFLA 3VVZA 1A6IA 2ZCXA 1JT6A 2ZOZA 4GCKA 4D7NA 2XPWA 3NI7A 3S5RA 3T6NA 1QVTA 2A2FX 2ZB9A 2Y2ZA 3B6CA 3VOKA 2QKOA 3F0CA 2EH3A 2OI8A 3ZQGA 2R7XA 3HE0A 2QOPA 4X1EA 4AUXA 3EGQA 2VKVA 3QBMA 2IEKA 4GFKA 5CQGA 5F27A 2FJI1 2YVHA 4W97A 2G7GA 3FK6A 2PBXA 5K7HA 1JT0A 5CW8A 3KKDA 3BTIA 3LWJA 3HGYA 3G1OA 3BCGA 3BR3A 2G0EA 3IH3A 1JUMA 3HTIA 3GZIA 1T33A 3PPBA 4D7MA 2GENA 1Z0XA 2TCTA 2VPRA 4D5FA 3CJDA 5EZHA 1SGMA 1QPIA 2ZY9A 1JTXA 2XGDA 3BTCA 3SWHA 1ORKA 2PZ9A 2B1EA 3Q0WA 5FKMA 4KWAA 2WV1A 3C2BA 2IBDA 3FRQA 4U9NA 2XB5A 3K8PC 2RHAA 2YVXA 5F1JA 1ZKGA 2O7TA 3VVXA 3VIBA 1T56A 5F08A 4PXIA 5IPAA 2FBQA 2X9DA 3IH4A 3VUQA 2DG8A 2RASA 2Y31A 2UXIA 2JK3A 3ZQIA 2WUIA 3ANGA 2TRTA 5J1YA 3COLA 3EUPA 4V2GA 4B1RA 1UI5A 3BTLA 3BR0A 3O60A 2YVEA 2NP5A 5EYRA
chains in the Genus database with same CATH topology
2QIBA 3HIMA 5D19A 5HSZA 4V2FA 4CGRA 3CRJA 4DW6A 3QKXA 2HXIA 3V78A 2OPTA 4NN1A 1Z77A 5J1RA 4D5CA 4M3BA 2V57A 3DPJA 2XGEA 3ON4A 3PM1A 5F0HA 4M3FA 5J1UA 3MNLA 3KZ9A 3SFIA 3LSRA 3WHCA 3VW0A 5FGLA 2QTQA 3VOXA 4M3GA 2I10A 3RH2A 2G3BA 2JJ7A 3BRUA 2QWTA 5D18A 3TP3A 4GCTA 3ZQLA 3NNRA 5K7ZA 4B3AA 3BTJA 4MK6A 3AQSA 3E7QA 5IOYA 4ME9A 3QPLA 3LJLA 5F04A 5GPAA 3CCYA 2W53A 3JSJA 2HKUA 3BQYA 3Q0VA 4AC6A 3QQAA 4MXMA 3O8GA 3ANPA 2NS8A 3F1BA 2GBYA 2HQ5A 2ZCMA 3HTHA 1QVUA 2GFNA 2O7OA 2XRLA 3BQZA 3G7RA 3LSJA 4G12A 3FIWA 4YZEA 2RAEA 4M3DA 5FKNA 3HTJA 3MVPA 1JTYA 5J3LA 2XGCA 3GEUA 2GUHA 4ABZA 3ON2A 2ZCNA 2XPUA 3P9TA 5AQCA 3RD3A 2UXPA 4NELA 2ID6A 5FKKA 2VKEA 3BR6A 2XPVA 5K58A 3ZQHA 3NXCA 2WGBA 3C07A 3AQTA 5HAWA 1RKTA 5FKLA 2F07A 3BT9A 3ZQFA 2OF7A 3BHQA 3PASA 4AF5A 5D1RA 3TP0A 4M3EA 5FKOA 3VVYA 3V6GA 1ZK8A 3Q3SA 5IP6A 5GP9A 2DTZA 2QCOA 3NRGA 3G56A 2ZOYA 3G1LA 4L62A 2NX4A 1RKWA 3BR1A 3DCFA 5H9TA 4ACIA 1JUSA 4ICHA 3SDGA 4JNNA 3HGGA 5F0FA 3B6AA 5HBUA 2G7LA 4I6ZA 3O8HA 5IOZA 4I76A 5FMPA 5EFYA 1JUPA 4MO7A 5FHPA 2IAIA 3LSPA 2IU5A 2ID3A 2NP3A 5DAJA 5EZGA 3VW1A 3IH2A 2FJ1A 3DEWA 4JKZA 2X6OA 3CWRA 3G1MA 2NS7A 1U9OA 1UI6A 3BR2A 4GCLA 3B81A 3HTAA 3VPRA 3CDLA 3VW2A 4JL3A 2UXHA 2FQ4A 4XK4A 4W1UA 1U9NA 5K7FA 5CXGA 5C4YA 3IUVA 3BR5A 2DG7A 1VI0A 3VP5A 3BJBA 2Q24A 3NPIA 2HYTA 3QPSA 3KNWA 4AC0A 2G7SA 1BJZA 2Y30A 3BNIA 3Q0UA 5F0CA 2D6YA 2UXUA 1RPWA 2HXOA 2FD5A 5CXIA 3LOCA 5GPCA 2REKA 2XDNA 2HYJA 4JYKA 3FK7A 2OERA 2UXOA 4UDSA 2FX0A 3WHBA 3KKCA 4HKUA 3LHQA 4GFLA 3VVZA 1A6IA 2ZCXA 1JT6A 2ZOZA 4GCKA 4D7NA 2XPWA 3NI7A 3S5RA 3T6NA 1QVTA 2ZB9A 2Y2ZA 3B6CA 3VOKA 2QKOA 3F0CA 2EH3A 2OI8A 3ZQGA 3HE0A 2QOPA 4X1EA 4AUXA 3EGQA 2VKVA 3QBMA 2IEKA 4GFKA 5F27A 2YVHA 4W97A 2G7GA 3FK6A 2PBXA 5K7HA 1JT0A 5CW8A 3KKDA 3BTIA 3LWJA 3HGYA 3G1OA 3BCGA 3BR3A 2G0EA 3IH3A 1JUMA 3HTIA 3GZIA 1T33A 3PPBA 4D7MA 2GENA 1Z0XA 2TCTA 2VPRA 4D5FA 3CJDA 5EZHA 1SGMA 1QPIA 1JTXA 2XGDA 3BTCA 1ORKA 2PZ9A 3Q0WA 5FKMA 4KWAA 2WV1A 3C2BA 2IBDA 3FRQA 2XB5A 2RHAA 5F1JA 1ZKGA 2O7TA 3VVXA 3VIBA 1T56A 5F08A 4PXIA 5IPAA 2FBQA 2X9DA 3IH4A 3VUQA 2DG8A 2RASA 2Y31A 2UXIA 2JK3A 3ZQIA 2WUIA 3ANGA 2TRTA 5J1YA 3COLA 3EUPA 4V2GA 4B1RA 1UI5A 3BTLA 3BR0A 3O60A 2YVEA 2NP5A 5EYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIB A;  3HIM A;  5D19 A;  5HSZ A;  4V2F A;  4CGR A;  3CRJ A;  4DW6 A;  3QKX A;  2HXI A;  3V78 A;  2OPT A;  4NN1 A;  1Z77 A;  5J1R A;  4D5C A;  4M3B A;  2V57 A;  3DPJ A;  2XGE A;  3ON4 A;  3PM1 A;  5F0H A;  4M3F A;  5J1U A;  3MNL A;  3KZ9 A;  3SFI A;  3LSR A;  3WHC A;  3VW0 A;  5FGL A;  2QTQ A;  3VOX A;  4M3G A;  2I10 A;  3RH2 A;  2G3B A;  2JJ7 A;  3BRU A;  2QWT A;  5D18 A;  3TP3 A;  4GCT A;  3ZQL A;  3NNR A;  5K7Z A;  4B3A A;  3BTJ A;  4MK6 A;  3AQS A;  3E7Q A;  5IOY A;  4ME9 A;  3QPL A;  3LJL A;  5F04 A;  5GPA A;  3CCY A;  2W53 A;  3JSJ A;  2HKU A;  3BQY A;  3Q0V A;  4AC6 A;  3QQA A;  4MXM A;  3O8G A;  3ANP A;  2NS8 A;  3F1B A;  2GBY A;  2HQ5 A;  2ZCM A;  3HTH A;  1QVU A;  2GFN A;  2O7O A;  2XRL A;  3BQZ A;  3G7R A;  3LSJ A;  4G12 A;  3FIW A;  4YZE A;  2RAE A;  4M3D A;  5FKN A;  3HTJ A;  3MVP A;  1JTY A;  5J3L A;  2XGC A;  3GEU A;  2GUH A;  4ABZ A;  3ON2 A;  2ZCN A;  2XPU A;  3P9T A;  5AQC A;  3RD3 A;  2UXP A;  4NEL A;  2ID6 A;  5FKK A;  2VKE A;  3BR6 A;  2XPV A;  5K58 A;  3ZQH A;  3NXC A;  2WGB A;  3C07 A;  3AQT A;  5HAW A;  1RKT A;  5FKL A;  2F07 A;  3BT9 A;  3ZQF A;  2OF7 A;  3BHQ A;  3PAS A;  4AF5 A;  5D1R A;  3TP0 A;  4M3E A;  5FKO A;  3VVY A;  3V6G A;  1ZK8 A;  3Q3S A;  5IP6 A;  5GP9 A;  2DTZ A;  2QCO A;  3NRG A;  3G56 A;  2ZOY A;  3G1L A;  4L62 A;  2NX4 A;  1RKW A;  3BR1 A;  3DCF A;  5H9T A;  4ACI A;  1JUS A;  4ICH A;  3SDG A;  4JNN A;  3HGG A;  5F0F A;  3B6A A;  5HBU A;  2G7L A;  4I6Z A;  3O8H A;  5IOZ A;  4I76 A;  5FMP A;  5EFY A;  1JUP A;  4MO7 A;  5FHP A;  2IAI A;  3LSP A;  2IU5 A;  2ID3 A;  2NP3 A;  5DAJ A;  5EZG A;  3VW1 A;  3IH2 A;  2FJ1 A;  3DEW A;  4JKZ A;  2X6O A;  3CWR A;  3G1M A;  2NS7 A;  1U9O A;  1UI6 A;  3BR2 A;  4GCL A;  3B81 A;  3HTA A;  3VPR A;  3CDL A;  3VW2 A;  4JL3 A;  2UXH A;  2FQ4 A;  4XK4 A;  4W1U A;  1U9N A;  5K7F A;  5CXG A;  5C4Y A;  3IUV A;  3BR5 A;  2DG7 A;  1VI0 A;  3VP5 A;  3BJB A;  2Q24 A;  3NPI A;  2HYT A;  3QPS A;  3KNW A;  4AC0 A;  2G7S A;  1BJZ A;  2Y30 A;  3BNI A;  3Q0U A;  5F0C A;  2D6Y A;  2UXU A;  1RPW A;  2HXO A;  2FD5 A;  5CXI A;  3LOC A;  5GPC A;  2REK A;  2XDN A;  2HYJ A;  4JYK A;  3FK7 A;  2OER A;  2UXO A;  4UDS A;  2FX0 A;  3WHB A;  3KKC A;  4HKU A;  3LHQ A;  4GFL A;  3VVZ A;  1A6I A;  2ZCX A;  1JT6 A;  2ZOZ A;  4GCK A;  4D7N A;  2XPW A;  3NI7 A;  3S5R A;  3T6N A;  1QVT A;  2ZB9 A;  2Y2Z A;  3B6C A;  3VOK A;  2QKO A;  3F0C A;  2EH3 A;  2OI8 A;  3ZQG A;  3HE0 A;  2QOP A;  4X1E A;  4AUX A;  3EGQ A;  2VKV A;  3QBM A;  2IEK A;  4GFK A;  5F27 A;  2YVH A;  4W97 A;  2G7G A;  3FK6 A;  2PBX A;  5K7H A;  1JT0 A;  5CW8 A;  3KKD A;  3BTI A;  3LWJ A;  3HGY A;  3G1O A;  3BCG A;  3BR3 A;  2G0E A;  3IH3 A;  1JUM A;  3HTI A;  3GZI A;  1T33 A;  3PPB A;  4D7M A;  2GEN A;  1Z0X A;  2TCT A;  2VPR A;  4D5F A;  3CJD A;  5EZH A;  1SGM A;  1QPI A;  1JTX A;  2XGD A;  3BTC A;  1ORK A;  2PZ9 A;  3Q0W A;  5FKM A;  4KWA A;  2WV1 A;  3C2B A;  2IBD A;  3FRQ A;  2XB5 A;  2RHA A;  5F1J A;  1ZKG A;  2O7T A;  3VVX A;  3VIB A;  1T56 A;  5F08 A;  4PXI A;  5IPA A;  2FBQ A;  2X9D A;  3IH4 A;  3VUQ A;  2DG8 A;  2RAS A;  2Y31 A;  2UXI A;  2JK3 A;  3ZQI A;  2WUI A;  3ANG A;  2TRT A;  5J1Y A;  3COL A;  3EUP A;  4V2G A;  4B1R A;  1UI5 A;  3BTL A;  3BR0 A;  3O60 A;  2YVE A;  2NP5 A;  5EYR A; 
#chains in the Genus database with same CATH topology
 2QIB A;  3HIM A;  5D19 A;  5HSZ A;  3VTI A;  4V2F A;  4CGR A;  3CRJ A;  4DW6 A;  3QKX A;  2HXI A;  3V78 A;  2OPT A;  4NN1 A;  1Z77 A;  4OD5 A;  5J1R A;  4D5C A;  4M3B A;  2V57 A;  3DPJ A;  2XGE A;  3ON4 A;  3PM1 A;  5F0H A;  4M3F A;  5J1U A;  3MNL A;  3KZ9 A;  3SFI A;  4DVY P;  3LSR A;  3WHC A;  4WIB A;  3VW0 A;  5FGL A;  2QTQ A;  3VOX A;  4M3G A;  2I10 A;  3RH2 A;  2G3B A;  2JJ7 A;  2B3W A;  3BRU A;  2QWT A;  5D18 A;  3TP3 A;  4GCT A;  3ZQL A;  3NNR A;  5K7Z A;  4B3A A;  3BTJ A;  4MK6 A;  3AQS A;  3E7Q A;  5IOY A;  4ME9 A;  3QPL A;  3LJL A;  5F04 A;  5GPA A;  3CCY A;  2W53 A;  4C2M A;  3JSJ A;  2HKU A;  3BQY A;  3Q0V A;  4AC6 A;  3QQA A;  4MXM A;  3O8G A;  3ANP A;  2NS8 A;  3F1B A;  2GBY A;  4OD4 A;  2HQ5 A;  2ZCM A;  3HTH A;  2R7R A;  1QVU A;  2GFN A;  2O7O A;  2XRL A;  3BQZ A;  3G7R A;  3LSJ A;  4G12 A;  3FIW A;  3NS4 A;  4YZE A;  2RAE A;  4M3D A;  5FKN A;  3HTJ A;  3MVP A;  1JTY A;  5J3L A;  2XGC A;  3GEU A;  2GUH A;  2R7U A;  4ABZ A;  3ON2 A;  2ZCN A;  2XPU A;  3P9T A;  5AQC A;  3RD3 A;  2UXP A;  4NEL A;  2ID6 A;  5FKK A;  2VKE A;  3BR6 A;  2XPV A;  5K58 A;  3ZQH A;  3NXC A;  2WGB A;  3C07 A;  3AQT A;  5HAW A;  1RKT A;  5FKL A;  2F07 A;  3BT9 A;  3ZQF A;  2OF7 A;  3BHQ A;  3PAS A;  4AF5 A;  5D1R A;  4U9L A;  3TP0 A;  4M3E A;  5FKO A;  3VVY A;  3V6G A;  1ZK8 A;  2R7W A;  3Q3S A;  5IP6 A;  5GP9 A;  2DTZ A;  2QCO A;  3NRG A;  3G56 A;  2ZOY A;  3G1L A;  4L62 A;  2NX4 A;  1RKW A;  3BR1 A;  3DCF A;  4IRV A;  5H9T A;  4ACI A;  1JUS A;  4ICH A;  3SDG A;  4JNN A;  3HGG A;  5F0F A;  2R7S A;  3B6A A;  5HBU A;  2G7L A;  4I6Z A;  2R7V A;  3O8H A;  2R7Q A;  5IOZ A;  4I76 A;  5FMP A;  2PFV A;  5EFY A;  1JUP A;  4MO7 A;  5FHP A;  2IAI A;  3LSP A;  2IU5 A;  2ID3 A;  2NP3 A;  5DAJ A;  5EZG A;  3VW1 A;  3IH2 A;  2FJ1 A;  3DEW A;  3KYL A;  4JKZ A;  2X6O A;  3CWR A;  3G1M A;  2NS7 A;  1U9O A;  1UI6 A;  3BR2 A;  4GCL A;  3B81 A;  3HTA A;  3VPR A;  3CDL A;  3VW2 A;  4JL3 A;  2UXH A;  3DU6 A;  2FQ4 A;  3FHN A;  4XK4 A;  4W1U A;  1U9N A;  5K7F A;  5CXG A;  5C4Y A;  3IUV A;  3BR5 A;  2DG7 A;  1VI0 A;  3VP5 A;  3BJB A;  2Q24 A;  3NPI A;  2HYT A;  3QPS A;  3KNW A;  4AC0 A;  2G7S A;  2R7T A;  1BJZ A;  2R7O A;  2Y30 A;  3BNI A;  3Q0U A;  5F0C A;  2D6Y A;  3DU5 A;  2UXU A;  1RPW A;  2HXO A;  2FD5 A;  5CXI A;  3LOC A;  5GPC A;  2REK A;  2XDN A;  2HYJ A;  4JYK A;  3FK7 A;  2OER A;  2UXO A;  4UDS A;  2FX0 A;  3WHB A;  3KKC A;  4HKU A;  3LHQ A;  4GFL A;  3VVZ A;  1A6I A;  2ZCX A;  1JT6 A;  2ZOZ A;  4GCK A;  4D7N A;  2XPW A;  3NI7 A;  3S5R A;  3T6N A;  1QVT A;  2A2F X;  2ZB9 A;  2Y2Z A;  3B6C A;  3VOK A;  2QKO A;  3F0C A;  2EH3 A;  2OI8 A;  3ZQG A;  2R7X A;  3HE0 A;  2QOP A;  4X1E A;  4AUX A;  3EGQ A;  2VKV A;  3QBM A;  2IEK A;  4GFK A;  5CQG A;  5F27 A;  2FJI 1;  2YVH A;  4W97 A;  2G7G A;  3FK6 A;  2PBX A;  5K7H A;  1JT0 A;  5CW8 A;  3KKD A;  3BTI A;  3LWJ A;  3HGY A;  3G1O A;  3BCG A;  3BR3 A;  2G0E A;  3IH3 A;  1JUM A;  3HTI A;  3GZI A;  1T33 A;  3PPB A;  4D7M A;  2GEN A;  1Z0X A;  2TCT A;  2VPR A;  4D5F A;  3CJD A;  5EZH A;  1SGM A;  1QPI A;  2ZY9 A;  1JTX A;  2XGD A;  3BTC A;  3SWH A;  1ORK A;  2PZ9 A;  2B1E A;  3Q0W A;  5FKM A;  4KWA A;  2WV1 A;  3C2B A;  2IBD A;  3FRQ A;  4U9N A;  2XB5 A;  3K8P C;  2RHA A;  2YVX A;  5F1J A;  1ZKG A;  2O7T A;  3VVX A;  3VIB A;  1T56 A;  5F08 A;  4PXI A;  5IPA A;  2FBQ A;  2X9D A;  3IH4 A;  3VUQ A;  2DG8 A;  2RAS A;  2Y31 A;  2UXI A;  2JK3 A;  3ZQI A;  2WUI A;  3ANG A;  2TRT A;  5J1Y A;  3COL A;  3EUP A;  4V2G A;  4B1R A;  1UI5 A;  3BTL A;  3BR0 A;  3O60 A;  2YVE A;  2NP5 A;  5EYR A; 
#chains in the Genus database with same CATH homology
 2QIB A;  3HIM A;  5D19 A;  5HSZ A;  4V2F A;  4CGR A;  3CRJ A;  4DW6 A;  3QKX A;  2HXI A;  3V78 A;  2OPT A;  4NN1 A;  1Z77 A;  5J1R A;  4D5C A;  4M3B A;  2V57 A;  3DPJ A;  2XGE A;  3ON4 A;  3PM1 A;  5F0H A;  4M3F A;  5J1U A;  3MNL A;  3KZ9 A;  3SFI A;  3LSR A;  3WHC A;  3VW0 A;  5FGL A;  2QTQ A;  3VOX A;  4M3G A;  2I10 A;  3RH2 A;  2G3B A;  2JJ7 A;  3BRU A;  2QWT A;  5D18 A;  3TP3 A;  4GCT A;  3ZQL A;  3NNR A;  5K7Z A;  4B3A A;  3BTJ A;  4MK6 A;  3AQS A;  3E7Q A;  5IOY A;  4ME9 A;  3QPL A;  3LJL A;  5F04 A;  5GPA A;  3CCY A;  2W53 A;  3JSJ A;  2HKU A;  3BQY A;  3Q0V A;  4AC6 A;  3QQA A;  4MXM A;  3O8G A;  3ANP A;  2NS8 A;  3F1B A;  2GBY A;  2HQ5 A;  2ZCM A;  3HTH A;  1QVU A;  2GFN A;  2O7O A;  2XRL A;  3BQZ A;  3G7R A;  3LSJ A;  4G12 A;  3FIW A;  4YZE A;  2RAE A;  4M3D A;  5FKN A;  3HTJ A;  3MVP A;  1JTY A;  5J3L A;  2XGC A;  3GEU A;  2GUH A;  4ABZ A;  3ON2 A;  2ZCN A;  2XPU A;  3P9T A;  5AQC A;  3RD3 A;  2UXP A;  4NEL A;  2ID6 A;  5FKK A;  2VKE A;  3BR6 A;  2XPV A;  5K58 A;  3ZQH A;  3NXC A;  2WGB A;  3C07 A;  3AQT A;  5HAW A;  1RKT A;  5FKL A;  2F07 A;  3BT9 A;  3ZQF A;  2OF7 A;  3BHQ A;  3PAS A;  4AF5 A;  5D1R A;  3TP0 A;  4M3E A;  5FKO A;  3VVY A;  3V6G A;  1ZK8 A;  3Q3S A;  5IP6 A;  5GP9 A;  2DTZ A;  2QCO A;  3NRG A;  3G56 A;  2ZOY A;  3G1L A;  4L62 A;  2NX4 A;  1RKW A;  3BR1 A;  3DCF A;  5H9T A;  4ACI A;  1JUS A;  4ICH A;  3SDG A;  4JNN A;  3HGG A;  5F0F A;  3B6A A;  5HBU A;  2G7L A;  4I6Z A;  3O8H A;  5IOZ A;  4I76 A;  5FMP A;  5EFY A;  1JUP A;  4MO7 A;  5FHP A;  2IAI A;  3LSP A;  2IU5 A;  2ID3 A;  2NP3 A;  5DAJ A;  5EZG A;  3VW1 A;  3IH2 A;  2FJ1 A;  3DEW A;  4JKZ A;  2X6O A;  3CWR A;  3G1M A;  2NS7 A;  1U9O A;  1UI6 A;  3BR2 A;  4GCL A;  3B81 A;  3HTA A;  3VPR A;  3CDL A;  3VW2 A;  4JL3 A;  2UXH A;  2FQ4 A;  4XK4 A;  4W1U A;  1U9N A;  5K7F A;  5CXG A;  5C4Y A;  3IUV A;  3BR5 A;  2DG7 A;  1VI0 A;  3VP5 A;  3BJB A;  2Q24 A;  3NPI A;  2HYT A;  3QPS A;  3KNW A;  4AC0 A;  2G7S A;  1BJZ A;  2Y30 A;  3BNI A;  3Q0U A;  5F0C A;  2D6Y A;  2UXU A;  1RPW A;  2HXO A;  2FD5 A;  5CXI A;  3LOC A;  5GPC A;  2REK A;  2XDN A;  2HYJ A;  4JYK A;  3FK7 A;  2OER A;  2UXO A;  4UDS A;  2FX0 A;  3WHB A;  3KKC A;  4HKU A;  3LHQ A;  4GFL A;  3VVZ A;  1A6I A;  2ZCX A;  1JT6 A;  2ZOZ A;  4GCK A;  4D7N A;  2XPW A;  3NI7 A;  3S5R A;  3T6N A;  1QVT A;  2ZB9 A;  2Y2Z A;  3B6C A;  3VOK A;  2QKO A;  3F0C A;  2EH3 A;  2OI8 A;  3ZQG A;  3HE0 A;  2QOP A;  4X1E A;  4AUX A;  3EGQ A;  2VKV A;  3QBM A;  2IEK A;  4GFK A;  5F27 A;  2YVH A;  4W97 A;  2G7G A;  3FK6 A;  2PBX A;  5K7H A;  1JT0 A;  5CW8 A;  3KKD A;  3BTI A;  3LWJ A;  3HGY A;  3G1O A;  3BCG A;  3BR3 A;  2G0E A;  3IH3 A;  1JUM A;  3HTI A;  3GZI A;  1T33 A;  3PPB A;  4D7M A;  2GEN A;  1Z0X A;  2TCT A;  2VPR A;  4D5F A;  3CJD A;  5EZH A;  1SGM A;  1QPI A;  1JTX A;  2XGD A;  3BTC A;  1ORK A;  2PZ9 A;  3Q0W A;  5FKM A;  4KWA A;  2WV1 A;  3C2B A;  2IBD A;  3FRQ A;  2XB5 A;  2RHA A;  5F1J A;  1ZKG A;  2O7T A;  3VVX A;  3VIB A;  1T56 A;  5F08 A;  4PXI A;  5IPA A;  2FBQ A;  2X9D A;  3IH4 A;  3VUQ A;  2DG8 A;  2RAS A;  2Y31 A;  2UXI A;  2JK3 A;  3ZQI A;  2WUI A;  3ANG A;  2TRT A;  5J1Y A;  3COL A;  3EUP A;  4V2G A;  4B1R A;  1UI5 A;  3BTL A;  3BR0 A;  3O60 A;  2YVE A;  2NP5 A;  5EYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...