2YVEA

Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor cgmr
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
175
structure length
175
Chain Sequence
MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQWIPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator
publication title Crystal Structures of the Multidrug Binding Repressor Corynebacteriumglutamicum CgmR in Complex with Inducers and with an Operator
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 70
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17937 TetR_C_28 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2yveA00
5FKOA 3BTCA 4JL3A 3SDGA 3NI7A 2FJ1A 4AC6A 3CCYA 2HKUA 5EZGA 4NELA 3VOKA 5J1UA 2D6YA 5EZHA 2TCTA 3QPLA 2UXOA 3GZIA 3VOXA 2UXUA 2XPVA 2V57A 3HGYA 3PASA 3WHBA 5CXGA 3B81A 4JYKA 3BR6A 3QBMA 1QPIA 3BQYA 3CRJA 5FHPA 2REKA 3V78A 5D1RA 2Y2ZA 3BTIA 4MK6A 2X6OA 2PBXA 4ACIA 1RPWA 2JK3A 2W53A 3QKXA 5F08A 2OPTA 4GCLA 2ZOZA 3BTLA 4G12A 4W1UA 5K7ZA 2GUHA 4W97A 3Q0VA 4V2GA 4GCTA 1QVTA 5F0HA 5EYRA 4V2FA 3LSJA 2ZOYA 4AUXA 1JT0A 5GPCA 3MVPA 4ICHA 3VP5A 2FX0A 2Q24A 3RD3A 3NPIA 2DTZA 3BJBA 2XGCA 2IBDA 5K58A 3CWRA 3BCGA 3HTIA 3BRUA 3LOCA 2FBQA 3F1BA 2RHAA 2ID3A 3KKDA 5HAWA 5J1YA 3IUVA 4MXMA 1RKTA 5CW8A 3KNWA 2G7LA 4M3BA 5HSZA 3VW0A 4JKZA 3G1LA 2OF7A 1ZKGA 2XGEA 3DPJA 3NNRA 3C2BA 5C4YA 3TP3A 5F27A 3WHCA 3NRGA 3LJLA 3B6CA 3AQSA 3PM1A 2VKEA 2TRTA 5D19A 3P9TA 3DEWA 4NN1A 3BR0A 4D7NA 3G56A 2FQ4A 2EH3A 2HXOA 2PZ9A 2XB5A 5J3LA 3IH4A 3C07A 5EFYA 4XK4A 3EUPA 3HTAA 4M3DA 4L62A 3LHQA 3NXCA 1JT6A 5GPAA 1RKWA 3SFIA 2IAIA 5DAJA 2G0EA 4MO7A 3F0CA 3LWJA 2GBYA 3BTJA 3FK7A 1JTYA 1U9NA 3Q3SA 2NS7A 5AQCA 3VPRA 1JUMA 5F0FA 3FIWA 3ON4A 2RAEA 3LSRA 1Z0XA 3ANPA 5HBUA 5J1RA 3AQTA 5F1JA 2UXHA 5FGLA 1QVUA 4PXIA 3VIBA 4AF5A 2QKOA 3HTHA 2XPUA 1JUSA 2ZB9A 4HKUA 4GFKA 2XPWA 3HTJA 2HXIA 3DCFA 3Q0WA 4M3EA 5FMPA 2QTQA 4ME9A 3VVXA 4M3FA 4DW6A 3QQAA 5FKKA 2QIBA 3HGGA 5FKLA 3COLA 4KWAA 2QOPA 3CDLA 2I10A 4D7MA 1SGMA 1UI6A 1VI0A 4AC0A 5FKNA 4GFLA 2VKVA 1U9OA 2FD5A 3BT9A 3TP0A 3Q0UA 3VVYA 1ZK8A 4JNNA 3FRQA 3HIMA 3ZQHA 4D5CA 2UXPA 3BHQA 3B6AA 2O7TA 3VW1A 4M3GA 5IOYA 5IPAA 3QPSA 3IH2A 2YVHA 3G7RA 2YVEA 3HE0A 2NX4A 3E7QA 4D5FA 2G7SA 4YZEA 3BR5A 2VPRA 2IEKA 3S5RA 4B1RA 4CGRA 3CJDA 1Z77A 2XGDA 3MNLA 3O8GA 2HYJA 5FKMA 4B3AA 3ZQGA 4UDSA 3T6NA 2NS8A 2IU5A 2DG8A 2X9DA 2O7OA 3G1MA 2NP5A 5H9TA 2Y31A 3KKCA 2WUIA 2ID6A 2OI8A 1JUPA 2XDNA 3ZQLA 3KZ9A 1BJZA 3V6GA 2JJ7A 2G3BA 3ANGA 2HYTA 3BR1A 3BR3A 3ZQFA 1T33A 5F0CA 3IH3A 2HQ5A 3VW2A 2XRLA 3BQZA 4I6ZA 3VVZA 4I76A 5K7HA 3VUQA 2OERA 1ORKA 2ZCNA 4GCKA 2Y30A 5GP9A 2WV1A 4ABZA 1A6IA 2GFNA 2DG7A 5IOZA 2ZCMA 4X1EA 3G1OA 3ZQIA 3O8HA 2QWTA 5K7FA 3RH2A 2ZCXA 1UI5A 5D18A 5F04A 2NP3A 2WGBA 3EGQA 2RASA 3GEUA 3LSPA 1T56A 3ON2A 1JTXA 3BNIA 5CXIA 2GENA 2QCOA 3JSJA 3BR2A 2F07A 3FK6A 2UXIA 3PPBA 3O60A 5IP6A 2G7GA
chains in the Genus database with same CATH superfamily
5FKOA 3BTCA 4JL3A 3SDGA 3NI7A 2FJ1A 4AC6A 3CCYA 2HKUA 5EZGA 4NELA 3VOKA 5J1UA 2D6YA 5EZHA 2TCTA 3QPLA 2UXOA 3GZIA 3VOXA 2UXUA 2XPVA 2V57A 3HGYA 3PASA 3SWHA 3WHBA 5CXGA 3B81A 4JYKA 3BR6A 4C2MA 3KYLA 3QBMA 4WIBA 1QPIA 3BQYA 3CRJA 5FHPA 2REKA 3V78A 5D1RA 2Y2ZA 3BTIA 4MK6A 2X6OA 2PBXA 4ACIA 1RPWA 2JK3A 2W53A 3QKXA 5F08A 2OPTA 4GCLA 2ZOZA 3BTLA 4G12A 4W1UA 5K7ZA 3NS4A 2GUHA 3K8PC 4W97A 3Q0VA 4V2GA 4GCTA 1QVTA 5F0HA 5EYRA 4V2FA 3LSJA 2ZOYA 4AUXA 1JT0A 5GPCA 3MVPA 4ICHA 2B3WA 3VP5A 2FX0A 2Q24A 3RD3A 3NPIA 2DTZA 3BJBA 2XGCA 2IBDA 5K58A 3CWRA 3BCGA 3HTIA 4U9NA 3BRUA 3LOCA 2FBQA 3F1BA 2RHAA 2ID3A 3KKDA 5HAWA 5J1YA 3IUVA 4DVYP 4MXMA 1RKTA 5CW8A 3KNWA 2G7LA 5CQGA 4M3BA 4U9LA 5HSZA 4OD4A 3VW0A 4JKZA 3G1LA 2OF7A 1ZKGA 2XGEA 3DPJA 3NNRA 3C2BA 5C4YA 3TP3A 5F27A 3WHCA 3NRGA 3LJLA 3B6CA 3AQSA 3PM1A 2VKEA 2TRTA 5D19A 3P9TA 3DEWA 4NN1A 3BR0A 4OD5A 4D7NA 3G56A 2FQ4A 2EH3A 2HXOA 2PZ9A 2XB5A 5J3LA 3IH4A 3C07A 5EFYA 4XK4A 3EUPA 3HTAA 4M3DA 4L62A 3LHQA 3NXCA 1JT6A 5GPAA 1RKWA 3SFIA 2IAIA 5DAJA 2G0EA 4MO7A 3F0CA 3LWJA 2GBYA 3BTJA 3FK7A 1JTYA 1U9NA 3Q3SA 2NS7A 5AQCA 2ZY9A 3VPRA 1JUMA 2R7QA 5F0FA 3FIWA 3ON4A 2RAEA 3LSRA 1Z0XA 3ANPA 2R7SA 5HBUA 5J1RA 3AQTA 5F1JA 2R7WA 2UXHA 5FGLA 1QVUA 4PXIA 3VIBA 4AF5A 2R7VA 2QKOA 3HTHA 2XPUA 1JUSA 2ZB9A 4HKUA 2B1EA 2XPWA 4GFKA 3HTJA 2HXIA 3DCFA 3Q0WA 4M3EA 5FMPA 2R7RA 2R7TA 2QTQA 4ME9A 3VVXA 4M3FA 4DW6A 3QQAA 5FKKA 2QIBA 3HGGA 5FKLA 3COLA 4KWAA 2QOPA 3CDLA 2I10A 4D7MA 1SGMA 2FJI1 2R7OA 3FHNA 1UI6A 1VI0A 4AC0A 4IRVA 5FKNA 4GFLA 2VKVA 1U9OA 2FD5A 3BT9A 3TP0A 3Q0UA 1ZK8A 3VVYA 4JNNA 3FRQA 3HIMA 3ZQHA 4D5CA 2UXPA 2YVXA 3BHQA 3B6AA 2O7TA 3VW1A 4M3GA 5IOYA 5IPAA 3QPSA 3IH2A 2YVHA 3G7RA 2YVEA 3HE0A 2NX4A 3E7QA 4D5FA 3DU6A 2G7SA 4YZEA 3BR5A 2VPRA 2IEKA 3S5RA 4B1RA 4CGRA 3CJDA 3VTIA 1Z77A 2XGDA 3MNLA 3O8GA 2HYJA 5FKMA 4B3AA 3ZQGA 4UDSA 3T6NA 2NS8A 2IU5A 2DG8A 2X9DA 2O7OA 3G1MA 2NP5A 5H9TA 2Y31A 3KKCA 2WUIA 2ID6A 2OI8A 1JUPA 2XDNA 3ZQLA 3KZ9A 2R7XA 1BJZA 3V6GA 2JJ7A 2G3BA 3ANGA 2HYTA 3BR1A 3BR3A 3ZQFA 2A2FX 1T33A 5F0CA 3IH3A 2HQ5A 3VW2A 2XRLA 3BQZA 3DU5A 4I6ZA 3VVZA 4I76A 5K7HA 3VUQA 2OERA 1ORKA 2ZCNA 2PFVA 2Y30A 4GCKA 5GP9A 2R7UA 2WV1A 4ABZA 1A6IA 2GFNA 2DG7A 5IOZA 2ZCMA 4X1EA 3G1OA 3ZQIA 3O8HA 2QWTA 5K7FA 3RH2A 2ZCXA 1UI5A 5D18A 5F04A 2NP3A 2WGBA 3EGQA 2RASA 3GEUA 3LSPA 1T56A 3ON2A 1JTXA 3BNIA 5CXIA 2GENA 2QCOA 3JSJA 3BR2A 2F07A 3FK6A 2UXIA 3PPBA 3O60A 5IP6A 2G7GA
chains in the Genus database with same CATH topology
5FKOA 3BTCA 4JL3A 3SDGA 3NI7A 2FJ1A 4AC6A 3CCYA 2HKUA 5EZGA 4NELA 3VOKA 5J1UA 2D6YA 5EZHA 2TCTA 3QPLA 2UXOA 3GZIA 3VOXA 2UXUA 2XPVA 2V57A 3HGYA 3PASA 3WHBA 5CXGA 3B81A 4JYKA 3BR6A 3QBMA 1QPIA 3BQYA 3CRJA 5FHPA 2REKA 3V78A 5D1RA 2Y2ZA 3BTIA 4MK6A 2X6OA 2PBXA 4ACIA 1RPWA 2JK3A 2W53A 3QKXA 5F08A 2OPTA 4GCLA 2ZOZA 3BTLA 4G12A 4W1UA 5K7ZA 2GUHA 4W97A 3Q0VA 4V2GA 4GCTA 1QVTA 5F0HA 5EYRA 4V2FA 3LSJA 2ZOYA 4AUXA 1JT0A 5GPCA 3MVPA 4ICHA 3VP5A 2FX0A 2Q24A 3RD3A 3NPIA 2DTZA 3BJBA 2XGCA 2IBDA 5K58A 3CWRA 3BCGA 3HTIA 3BRUA 3LOCA 2FBQA 3F1BA 2RHAA 2ID3A 3KKDA 5HAWA 5J1YA 3IUVA 4MXMA 1RKTA 5CW8A 3KNWA 2G7LA 4M3BA 5HSZA 3VW0A 4JKZA 3G1LA 2OF7A 1ZKGA 2XGEA 3DPJA 3NNRA 3C2BA 5C4YA 3TP3A 5F27A 3WHCA 3NRGA 3LJLA 3B6CA 3AQSA 3PM1A 2VKEA 2TRTA 5D19A 3P9TA 3DEWA 4NN1A 3BR0A 4D7NA 3G56A 2FQ4A 2EH3A 2HXOA 2PZ9A 2XB5A 5J3LA 3IH4A 3C07A 5EFYA 4XK4A 3EUPA 3HTAA 4M3DA 4L62A 3LHQA 3NXCA 1JT6A 5GPAA 1RKWA 3SFIA 2IAIA 5DAJA 2G0EA 4MO7A 3F0CA 3LWJA 2GBYA 3BTJA 3FK7A 1JTYA 1U9NA 3Q3SA 2NS7A 5AQCA 3VPRA 1JUMA 5F0FA 3FIWA 3ON4A 2RAEA 3LSRA 1Z0XA 3ANPA 5HBUA 5J1RA 3AQTA 5F1JA 2UXHA 5FGLA 1QVUA 4PXIA 3VIBA 4AF5A 2QKOA 3HTHA 2XPUA 1JUSA 2ZB9A 4HKUA 4GFKA 2XPWA 3HTJA 2HXIA 3DCFA 3Q0WA 4M3EA 5FMPA 2QTQA 4ME9A 3VVXA 4M3FA 4DW6A 3QQAA 5FKKA 2QIBA 3HGGA 5FKLA 3COLA 4KWAA 2QOPA 3CDLA 2I10A 4D7MA 1SGMA 1UI6A 1VI0A 4AC0A 5FKNA 4GFLA 2VKVA 1U9OA 2FD5A 3BT9A 3TP0A 3Q0UA 3VVYA 1ZK8A 4JNNA 3FRQA 3HIMA 3ZQHA 4D5CA 2UXPA 3BHQA 3B6AA 2O7TA 3VW1A 4M3GA 5IOYA 5IPAA 3QPSA 3IH2A 2YVHA 3G7RA 2YVEA 3HE0A 2NX4A 3E7QA 4D5FA 2G7SA 4YZEA 3BR5A 2VPRA 2IEKA 3S5RA 4B1RA 4CGRA 3CJDA 1Z77A 2XGDA 3MNLA 3O8GA 2HYJA 5FKMA 4B3AA 3ZQGA 4UDSA 3T6NA 2NS8A 2IU5A 2DG8A 2X9DA 2O7OA 3G1MA 2NP5A 5H9TA 2Y31A 3KKCA 2WUIA 2ID6A 2OI8A 1JUPA 2XDNA 3ZQLA 3KZ9A 1BJZA 3V6GA 2JJ7A 2G3BA 3ANGA 2HYTA 3BR1A 3BR3A 3ZQFA 1T33A 5F0CA 3IH3A 2HQ5A 3VW2A 2XRLA 3BQZA 4I6ZA 3VVZA 4I76A 5K7HA 3VUQA 2OERA 1ORKA 2ZCNA 4GCKA 2Y30A 5GP9A 2WV1A 4ABZA 1A6IA 2GFNA 2DG7A 5IOZA 2ZCMA 4X1EA 3G1OA 3ZQIA 3O8HA 2QWTA 5K7FA 3RH2A 2ZCXA 1UI5A 5D18A 5F04A 2NP3A 2WGBA 3EGQA 2RASA 3GEUA 3LSPA 1T56A 3ON2A 1JTXA 3BNIA 5CXIA 2GENA 2QCOA 3JSJA 3BR2A 2F07A 3FK6A 2UXIA 3PPBA 3O60A 5IP6A 2G7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKO A;  3BTC A;  4JL3 A;  3SDG A;  3NI7 A;  2FJ1 A;  4AC6 A;  3CCY A;  2HKU A;  5EZG A;  4NEL A;  3VOK A;  5J1U A;  2D6Y A;  5EZH A;  2TCT A;  3QPL A;  2UXO A;  3GZI A;  3VOX A;  2UXU A;  2XPV A;  2V57 A;  3HGY A;  3PAS A;  3WHB A;  5CXG A;  3B81 A;  4JYK A;  3BR6 A;  3QBM A;  1QPI A;  3BQY A;  3CRJ A;  5FHP A;  2REK A;  3V78 A;  5D1R A;  2Y2Z A;  3BTI A;  4MK6 A;  2X6O A;  2PBX A;  4ACI A;  1RPW A;  2JK3 A;  2W53 A;  3QKX A;  5F08 A;  2OPT A;  4GCL A;  2ZOZ A;  3BTL A;  4G12 A;  4W1U A;  5K7Z A;  2GUH A;  4W97 A;  3Q0V A;  4V2G A;  4GCT A;  1QVT A;  5F0H A;  5EYR A;  4V2F A;  3LSJ A;  2ZOY A;  4AUX A;  1JT0 A;  5GPC A;  3MVP A;  4ICH A;  3VP5 A;  2FX0 A;  2Q24 A;  3RD3 A;  3NPI A;  2DTZ A;  3BJB A;  2XGC A;  2IBD A;  5K58 A;  3CWR A;  3BCG A;  3HTI A;  3BRU A;  3LOC A;  2FBQ A;  3F1B A;  2RHA A;  2ID3 A;  3KKD A;  5HAW A;  5J1Y A;  3IUV A;  4MXM A;  1RKT A;  5CW8 A;  3KNW A;  2G7L A;  4M3B A;  5HSZ A;  3VW0 A;  4JKZ A;  3G1L A;  2OF7 A;  1ZKG A;  2XGE A;  3DPJ A;  3NNR A;  3C2B A;  5C4Y A;  3TP3 A;  5F27 A;  3WHC A;  3NRG A;  3LJL A;  3B6C A;  3AQS A;  3PM1 A;  2VKE A;  2TRT A;  5D19 A;  3P9T A;  3DEW A;  4NN1 A;  3BR0 A;  4D7N A;  3G56 A;  2FQ4 A;  2EH3 A;  2HXO A;  2PZ9 A;  2XB5 A;  5J3L A;  3IH4 A;  3C07 A;  5EFY A;  4XK4 A;  3EUP A;  3HTA A;  4M3D A;  4L62 A;  3LHQ A;  3NXC A;  1JT6 A;  5GPA A;  1RKW A;  3SFI A;  2IAI A;  5DAJ A;  2G0E A;  4MO7 A;  3F0C A;  3LWJ A;  2GBY A;  3BTJ A;  3FK7 A;  1JTY A;  1U9N A;  3Q3S A;  2NS7 A;  5AQC A;  3VPR A;  1JUM A;  5F0F A;  3FIW A;  3ON4 A;  2RAE A;  3LSR A;  1Z0X A;  3ANP A;  5HBU A;  5J1R A;  3AQT A;  5F1J A;  2UXH A;  5FGL A;  1QVU A;  4PXI A;  3VIB A;  4AF5 A;  2QKO A;  3HTH A;  2XPU A;  1JUS A;  2ZB9 A;  4HKU A;  4GFK A;  2XPW A;  3HTJ A;  2HXI A;  3DCF A;  3Q0W A;  4M3E A;  5FMP A;  2QTQ A;  4ME9 A;  3VVX A;  4M3F A;  4DW6 A;  3QQA A;  5FKK A;  2QIB A;  3HGG A;  5FKL A;  3COL A;  4KWA A;  2QOP A;  3CDL A;  2I10 A;  4D7M A;  1SGM A;  1UI6 A;  1VI0 A;  4AC0 A;  5FKN A;  4GFL A;  2VKV A;  1U9O A;  2FD5 A;  3BT9 A;  3TP0 A;  3Q0U A;  3VVY A;  1ZK8 A;  4JNN A;  3FRQ A;  3HIM A;  3ZQH A;  4D5C A;  2UXP A;  3BHQ A;  3B6A A;  2O7T A;  3VW1 A;  4M3G A;  5IOY A;  5IPA A;  3QPS A;  3IH2 A;  2YVH A;  3G7R A;  2YVE A;  3HE0 A;  2NX4 A;  3E7Q A;  4D5F A;  2G7S A;  4YZE A;  3BR5 A;  2VPR A;  2IEK A;  3S5R A;  4B1R A;  4CGR A;  3CJD A;  1Z77 A;  2XGD A;  3MNL A;  3O8G A;  2HYJ A;  5FKM A;  4B3A A;  3ZQG A;  4UDS A;  3T6N A;  2NS8 A;  2IU5 A;  2DG8 A;  2X9D A;  2O7O A;  3G1M A;  2NP5 A;  5H9T A;  2Y31 A;  3KKC A;  2WUI A;  2ID6 A;  2OI8 A;  1JUP A;  2XDN A;  3ZQL A;  3KZ9 A;  1BJZ A;  3V6G A;  2JJ7 A;  2G3B A;  3ANG A;  2HYT A;  3BR1 A;  3BR3 A;  3ZQF A;  1T33 A;  5F0C A;  3IH3 A;  2HQ5 A;  3VW2 A;  2XRL A;  3BQZ A;  4I6Z A;  3VVZ A;  4I76 A;  5K7H A;  3VUQ A;  2OER A;  1ORK A;  2ZCN A;  4GCK A;  2Y30 A;  5GP9 A;  2WV1 A;  4ABZ A;  1A6I A;  2GFN A;  2DG7 A;  5IOZ A;  2ZCM A;  4X1E A;  3G1O A;  3ZQI A;  3O8H A;  2QWT A;  5K7F A;  3RH2 A;  2ZCX A;  1UI5 A;  5D18 A;  5F04 A;  2NP3 A;  2WGB A;  3EGQ A;  2RAS A;  3GEU A;  3LSP A;  1T56 A;  3ON2 A;  1JTX A;  3BNI A;  5CXI A;  2GEN A;  2QCO A;  3JSJ A;  3BR2 A;  2F07 A;  3FK6 A;  2UXI A;  3PPB A;  3O60 A;  5IP6 A;  2G7G A; 
#chains in the Genus database with same CATH topology
 5FKO A;  3BTC A;  4JL3 A;  3SDG A;  3NI7 A;  2FJ1 A;  4AC6 A;  3CCY A;  2HKU A;  5EZG A;  4NEL A;  3VOK A;  5J1U A;  2D6Y A;  5EZH A;  2TCT A;  3QPL A;  2UXO A;  3GZI A;  3VOX A;  2UXU A;  2XPV A;  2V57 A;  3HGY A;  3PAS A;  3SWH A;  3WHB A;  5CXG A;  3B81 A;  4JYK A;  3BR6 A;  4C2M A;  3KYL A;  3QBM A;  4WIB A;  1QPI A;  3BQY A;  3CRJ A;  5FHP A;  2REK A;  3V78 A;  5D1R A;  2Y2Z A;  3BTI A;  4MK6 A;  2X6O A;  2PBX A;  4ACI A;  1RPW A;  2JK3 A;  2W53 A;  3QKX A;  5F08 A;  2OPT A;  4GCL A;  2ZOZ A;  3BTL A;  4G12 A;  4W1U A;  5K7Z A;  3NS4 A;  2GUH A;  3K8P C;  4W97 A;  3Q0V A;  4V2G A;  4GCT A;  1QVT A;  5F0H A;  5EYR A;  4V2F A;  3LSJ A;  2ZOY A;  4AUX A;  1JT0 A;  5GPC A;  3MVP A;  4ICH A;  2B3W A;  3VP5 A;  2FX0 A;  2Q24 A;  3RD3 A;  3NPI A;  2DTZ A;  3BJB A;  2XGC A;  2IBD A;  5K58 A;  3CWR A;  3BCG A;  3HTI A;  4U9N A;  3BRU A;  3LOC A;  2FBQ A;  3F1B A;  2RHA A;  2ID3 A;  3KKD A;  5HAW A;  5J1Y A;  3IUV A;  4DVY P;  4MXM A;  1RKT A;  5CW8 A;  3KNW A;  2G7L A;  5CQG A;  4M3B A;  4U9L A;  5HSZ A;  4OD4 A;  3VW0 A;  4JKZ A;  3G1L A;  2OF7 A;  1ZKG A;  2XGE A;  3DPJ A;  3NNR A;  3C2B A;  5C4Y A;  3TP3 A;  5F27 A;  3WHC A;  3NRG A;  3LJL A;  3B6C A;  3AQS A;  3PM1 A;  2VKE A;  2TRT A;  5D19 A;  3P9T A;  3DEW A;  4NN1 A;  3BR0 A;  4OD5 A;  4D7N A;  3G56 A;  2FQ4 A;  2EH3 A;  2HXO A;  2PZ9 A;  2XB5 A;  5J3L A;  3IH4 A;  3C07 A;  5EFY A;  4XK4 A;  3EUP A;  3HTA A;  4M3D A;  4L62 A;  3LHQ A;  3NXC A;  1JT6 A;  5GPA A;  1RKW A;  3SFI A;  2IAI A;  5DAJ A;  2G0E A;  4MO7 A;  3F0C A;  3LWJ A;  2GBY A;  3BTJ A;  3FK7 A;  1JTY A;  1U9N A;  3Q3S A;  2NS7 A;  5AQC A;  2ZY9 A;  3VPR A;  1JUM A;  2R7Q A;  5F0F A;  3FIW A;  3ON4 A;  2RAE A;  3LSR A;  1Z0X A;  3ANP A;  2R7S A;  5HBU A;  5J1R A;  3AQT A;  5F1J A;  2R7W A;  2UXH A;  5FGL A;  1QVU A;  4PXI A;  3VIB A;  4AF5 A;  2R7V A;  2QKO A;  3HTH A;  2XPU A;  1JUS A;  2ZB9 A;  4HKU A;  2B1E A;  2XPW A;  4GFK A;  3HTJ A;  2HXI A;  3DCF A;  3Q0W A;  4M3E A;  5FMP A;  2R7R A;  2R7T A;  2QTQ A;  4ME9 A;  3VVX A;  4M3F A;  4DW6 A;  3QQA A;  5FKK A;  2QIB A;  3HGG A;  5FKL A;  3COL A;  4KWA A;  2QOP A;  3CDL A;  2I10 A;  4D7M A;  1SGM A;  2FJI 1;  2R7O A;  3FHN A;  1UI6 A;  1VI0 A;  4AC0 A;  4IRV A;  5FKN A;  4GFL A;  2VKV A;  1U9O A;  2FD5 A;  3BT9 A;  3TP0 A;  3Q0U A;  1ZK8 A;  3VVY A;  4JNN A;  3FRQ A;  3HIM A;  3ZQH A;  4D5C A;  2UXP A;  2YVX A;  3BHQ A;  3B6A A;  2O7T A;  3VW1 A;  4M3G A;  5IOY A;  5IPA A;  3QPS A;  3IH2 A;  2YVH A;  3G7R A;  2YVE A;  3HE0 A;  2NX4 A;  3E7Q A;  4D5F A;  3DU6 A;  2G7S A;  4YZE A;  3BR5 A;  2VPR A;  2IEK A;  3S5R A;  4B1R A;  4CGR A;  3CJD A;  3VTI A;  1Z77 A;  2XGD A;  3MNL A;  3O8G A;  2HYJ A;  5FKM A;  4B3A A;  3ZQG A;  4UDS A;  3T6N A;  2NS8 A;  2IU5 A;  2DG8 A;  2X9D A;  2O7O A;  3G1M A;  2NP5 A;  5H9T A;  2Y31 A;  3KKC A;  2WUI A;  2ID6 A;  2OI8 A;  1JUP A;  2XDN A;  3ZQL A;  3KZ9 A;  2R7X A;  1BJZ A;  3V6G A;  2JJ7 A;  2G3B A;  3ANG A;  2HYT A;  3BR1 A;  3BR3 A;  3ZQF A;  2A2F X;  1T33 A;  5F0C A;  3IH3 A;  2HQ5 A;  3VW2 A;  2XRL A;  3BQZ A;  3DU5 A;  4I6Z A;  3VVZ A;  4I76 A;  5K7H A;  3VUQ A;  2OER A;  1ORK A;  2ZCN A;  2PFV A;  2Y30 A;  4GCK A;  5GP9 A;  2R7U A;  2WV1 A;  4ABZ A;  1A6I A;  2GFN A;  2DG7 A;  5IOZ A;  2ZCM A;  4X1E A;  3G1O A;  3ZQI A;  3O8H A;  2QWT A;  5K7F A;  3RH2 A;  2ZCX A;  1UI5 A;  5D18 A;  5F04 A;  2NP3 A;  2WGB A;  3EGQ A;  2RAS A;  3GEU A;  3LSP A;  1T56 A;  3ON2 A;  1JTX A;  3BNI A;  5CXI A;  2GEN A;  2QCO A;  3JSJ A;  3BR2 A;  2F07 A;  3FK6 A;  2UXI A;  3PPB A;  3O60 A;  5IP6 A;  2G7G A; 
#chains in the Genus database with same CATH homology
 5FKO A;  3BTC A;  4JL3 A;  3SDG A;  3NI7 A;  2FJ1 A;  4AC6 A;  3CCY A;  2HKU A;  5EZG A;  4NEL A;  3VOK A;  5J1U A;  2D6Y A;  5EZH A;  2TCT A;  3QPL A;  2UXO A;  3GZI A;  3VOX A;  2UXU A;  2XPV A;  2V57 A;  3HGY A;  3PAS A;  3WHB A;  5CXG A;  3B81 A;  4JYK A;  3BR6 A;  3QBM A;  1QPI A;  3BQY A;  3CRJ A;  5FHP A;  2REK A;  3V78 A;  5D1R A;  2Y2Z A;  3BTI A;  4MK6 A;  2X6O A;  2PBX A;  4ACI A;  1RPW A;  2JK3 A;  2W53 A;  3QKX A;  5F08 A;  2OPT A;  4GCL A;  2ZOZ A;  3BTL A;  4G12 A;  4W1U A;  5K7Z A;  2GUH A;  4W97 A;  3Q0V A;  4V2G A;  4GCT A;  1QVT A;  5F0H A;  5EYR A;  4V2F A;  3LSJ A;  2ZOY A;  4AUX A;  1JT0 A;  5GPC A;  3MVP A;  4ICH A;  3VP5 A;  2FX0 A;  2Q24 A;  3RD3 A;  3NPI A;  2DTZ A;  3BJB A;  2XGC A;  2IBD A;  5K58 A;  3CWR A;  3BCG A;  3HTI A;  3BRU A;  3LOC A;  2FBQ A;  3F1B A;  2RHA A;  2ID3 A;  3KKD A;  5HAW A;  5J1Y A;  3IUV A;  4MXM A;  1RKT A;  5CW8 A;  3KNW A;  2G7L A;  4M3B A;  5HSZ A;  3VW0 A;  4JKZ A;  3G1L A;  2OF7 A;  1ZKG A;  2XGE A;  3DPJ A;  3NNR A;  3C2B A;  5C4Y A;  3TP3 A;  5F27 A;  3WHC A;  3NRG A;  3LJL A;  3B6C A;  3AQS A;  3PM1 A;  2VKE A;  2TRT A;  5D19 A;  3P9T A;  3DEW A;  4NN1 A;  3BR0 A;  4D7N A;  3G56 A;  2FQ4 A;  2EH3 A;  2HXO A;  2PZ9 A;  2XB5 A;  5J3L A;  3IH4 A;  3C07 A;  5EFY A;  4XK4 A;  3EUP A;  3HTA A;  4M3D A;  4L62 A;  3LHQ A;  3NXC A;  1JT6 A;  5GPA A;  1RKW A;  3SFI A;  2IAI A;  5DAJ A;  2G0E A;  4MO7 A;  3F0C A;  3LWJ A;  2GBY A;  3BTJ A;  3FK7 A;  1JTY A;  1U9N A;  3Q3S A;  2NS7 A;  5AQC A;  3VPR A;  1JUM A;  5F0F A;  3FIW A;  3ON4 A;  2RAE A;  3LSR A;  1Z0X A;  3ANP A;  5HBU A;  5J1R A;  3AQT A;  5F1J A;  2UXH A;  5FGL A;  1QVU A;  4PXI A;  3VIB A;  4AF5 A;  2QKO A;  3HTH A;  2XPU A;  1JUS A;  2ZB9 A;  4HKU A;  4GFK A;  2XPW A;  3HTJ A;  2HXI A;  3DCF A;  3Q0W A;  4M3E A;  5FMP A;  2QTQ A;  4ME9 A;  3VVX A;  4M3F A;  4DW6 A;  3QQA A;  5FKK A;  2QIB A;  3HGG A;  5FKL A;  3COL A;  4KWA A;  2QOP A;  3CDL A;  2I10 A;  4D7M A;  1SGM A;  1UI6 A;  1VI0 A;  4AC0 A;  5FKN A;  4GFL A;  2VKV A;  1U9O A;  2FD5 A;  3BT9 A;  3TP0 A;  3Q0U A;  3VVY A;  1ZK8 A;  4JNN A;  3FRQ A;  3HIM A;  3ZQH A;  4D5C A;  2UXP A;  3BHQ A;  3B6A A;  2O7T A;  3VW1 A;  4M3G A;  5IOY A;  5IPA A;  3QPS A;  3IH2 A;  2YVH A;  3G7R A;  2YVE A;  3HE0 A;  2NX4 A;  3E7Q A;  4D5F A;  2G7S A;  4YZE A;  3BR5 A;  2VPR A;  2IEK A;  3S5R A;  4B1R A;  4CGR A;  3CJD A;  1Z77 A;  2XGD A;  3MNL A;  3O8G A;  2HYJ A;  5FKM A;  4B3A A;  3ZQG A;  4UDS A;  3T6N A;  2NS8 A;  2IU5 A;  2DG8 A;  2X9D A;  2O7O A;  3G1M A;  2NP5 A;  5H9T A;  2Y31 A;  3KKC A;  2WUI A;  2ID6 A;  2OI8 A;  1JUP A;  2XDN A;  3ZQL A;  3KZ9 A;  1BJZ A;  3V6G A;  2JJ7 A;  2G3B A;  3ANG A;  2HYT A;  3BR1 A;  3BR3 A;  3ZQF A;  1T33 A;  5F0C A;  3IH3 A;  2HQ5 A;  3VW2 A;  2XRL A;  3BQZ A;  4I6Z A;  3VVZ A;  4I76 A;  5K7H A;  3VUQ A;  2OER A;  1ORK A;  2ZCN A;  4GCK A;  2Y30 A;  5GP9 A;  2WV1 A;  4ABZ A;  1A6I A;  2GFN A;  2DG7 A;  5IOZ A;  2ZCM A;  4X1E A;  3G1O A;  3ZQI A;  3O8H A;  2QWT A;  5K7F A;  3RH2 A;  2ZCX A;  1UI5 A;  5D18 A;  5F04 A;  2NP3 A;  2WGB A;  3EGQ A;  2RAS A;  3GEU A;  3LSP A;  1T56 A;  3ON2 A;  1JTX A;  3BNI A;  5CXI A;  2GEN A;  2QCO A;  3JSJ A;  3BR2 A;  2F07 A;  3FK6 A;  2UXI A;  3PPB A;  3O60 A;  5IP6 A;  2G7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...